1ZBFA

Crystal structure of b. halodurans rnase h catalytic domain mutant d132n
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
132
structure length
132
Chain Sequence
b'EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribonuclease H-related protein
publication title Crystal Structures of RNase H Bound to an RNA/DNA Hybrid: Substrate Specificity and Metal-Dependent Catalysis.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase
total genus 41
structure length 132
sequence length 132
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1zbfA00
2HHWA 3AVNA 5KRTA 4JS4A 2B6AA 2VG6A 1IO2A 3LDSA 1SL0A 3AVAA 3QETA 3ULDA 1WAJA 5KTQA 4CJVA 1N5YA 5EU7A 1ZBUA 3VA0A 1N6QA 1EXQA 2LSNA 3SZ2A 3QEWA 2PY5A 4NCBA 4FK2A 3M8QA 4JRPA 4E7HA 4ICLA 4DMNA 4J2AA 2IOCA 4RG8A 4KV8A 1BCMA 1TKZA 3M8RA 1FKOA 3VA3A 1S5JA 3K5NA 4DU3A 1R0AA 3ZSYA 2F8TA 1C6VA 2HNDA 4N47A 4DTRA 4OJRA 2Y1IA 3RMCA 4BACA 1X9SA 2HHVA 3QO9A 3JYTA 4OKEA 4DSFA 3MEDA 2FC0A 4FXDA 3V6DA 4DS4A 2Z1GA 4M3WA 2HVHA 1ZBIA 3L3VA 4YFUA 1FXXA 1YVUA 2DFEA 3HSTB 4H4OA 5FDLA 4UQGA 1UA1A 1U47A 1Q9YA 4FJHA 4EZ6A 2OZMA 2P51A 2P5GA 1WSJA 1CZBA 3C95A 1HYZA 4B8CA 1L5UA 2F8SA 1YTAA 1IKWA 1BHLA 4CEEA 4FZYA 3HYFA 2FBYA 3HPGA 4CGGA 1S1TA 1BL3A 1B9DA 3D0PA 1KLNA 3BDPA 2KFNA 3VN5A 1VSKA 2OPPA 4XIUA 3KLEA 1EP4A 5KI6A 4KHWA 3IAYA 4CF8A 4Z4CA 1Z26A 3DRPA 3PX0A 4B3OA 5FROA 1U49A 3OYAA 2ATQA 2YKNA 1WAFA 3LWMA 3B6PA 4JS5A 3F9KA 4CF0A 3TAEA 3L2QA 2HMIA 4DQIA 2KTQA 3O3FA 4Q5VA 1HYVA 1RTHA 3ZT0A 4CEQA 4E7KA 2A1RA 4KHUA 3NGZA 2NUBA 3KLFA 1RBVA 4F2RA 3ZSQA 1IKXA 1T03A 4FJGA 4CEDA 4PWDA 2Z1HA 3CM5A 4CHPA 1RTIA 3QNOA 1DTTA 2YNIA 3O4NA 5JS2A 3HM9A 1BI4B 4DLEA 1HRHA 1NK9A 4M42A 3VQQA 1NJXA 3SUQA 3S3MA 1T8EA 1BIUA 3D45A 4FJJA 4LD0A 1U48A 3CM6A 4DU4A 3SCXA 3ASMA 1ASWA 3LANA 3QINA 4KKOA 4NYNA 3HP6A 3S3OA 4ZTJA 3T1AA 1QSYA 4I2QA 1HYSA 2KFZA 2GV9A 4YNQA 1JLAA 4OPJA 1WSFA 4N56A 1KVCA 2OPRA 3HVTA 3EYZA 4F3TA 1TVRA 4W5OA 1L3VA 3NH1A 4CHOA 2AJQA 1CXUA 1VSMA 3EZ5A 1KRPA 4H8KA 4I2PA 3L2VA 2G8UA 3QIPA 4HUFA 2W42A 4OVLA 1RILA 4FJXA 4CF9A 1S1UA 3AVCA 4ELUA 2BE2A 3NGYA 5J2PA 4CCHA 4CK3A 3PV8A 4DG1A 4CIEA 1RBSA 5J2MA 1KSPA 4B9LA 4M45A 1UWBA 1TKTA 3OYCA 1RBTA 3K2PA 3S3NA 1SV5A 4HTUA 5J2QA 2D5RA 4NYFA 4M41A 3OYLA 4C8LA 3HK2A 2X74A 3CFRA 4IG0A 1C1AA 4E1NA 3AA4A 1VSDA 2OPSA 3SI6A 4DF8A 4CJSA 4ZHRA 1CXQA 1HNIA 3CYMA 1RT3A 3VQCA 4CEFA 2XO7A 1X9WA 4KHSA 5JS1A 4B8AB 1NOYA 1C0UA 1JLFA 1TL1A 3SQ0A 2IC3A 4FCYA 4O0JA 1JKHA 3RMAA 4CF1A 3C94A 1J54A 3NF8A 3NF6A 1RDCA 4B08A 1QSLA 1LW0A 2KZMA 4ID1A 4FJ5A 1F21A 3JSMA 1YTUA 1EETA 3AVHA 3QEXA 1IKYA 4DTOA 1UA0A 1JL1A 3SNNA 3MEGA 1BISA 5HRPA 3AO2A 2XY7A 4O55A 1LAWA 3KK1A 3V9SA 4FLVA 4DQPA 4KB1A 2BDPA 3RRHA 1BGXT 4B9NA 4CJ4A 3THVA 4IFYA 4MFBA 1VSIA 3VQ8A 4J2DA 2E4LA 3OYEA 3KD5E 4KHQA 4E7LA 2HHTA 5HRNA 3AA2A 1BQMA 3I0SA 4KPYA 4QCLA 4DSIA 3WNEA 3HPHA 3O4QA 4JRQA 2DFHA 3NGIA 4DTMA 1UOCA 3ZT3A 4QAGA 5CZ1A 3WNFA 4OLBA 3PO5A 3DLGA 4IBNA 4AH9A 4N76A 1TKXA 5KGWA 1U45A 1RBRA 4BE1A 1ZBLA 3ZCMA 2G8WA 4AHTA 3VQ7A 1LWFA 4BE0A 3TANA 2HHXA 4AHUA 1NJZA 4E7JA 1IG9A 3OYNA 4ZTFA 1C0MA 1S6PA 4DTNA 5E41A 1SKWA 3KLIA 3F73A 2RKIA 3KK3A 4CE9A 4E1MA 3LZJA 1X9MA 2EX3A 3I0RA 2HNZA 5K14A 2F96A 4FW2A 1D9DA 3TR8A 3NH0A 1A5WA 3V9XA 1HMVA 3TWHA 1JLBA 4CIFA 4FM0A 2E6MA 1SKSA 1CLQA 3P83D 4CJTA 2BANA 3DLBA 1I3AA 4E7IA 4M3YA 1G15A 3ZT1A 3AV9A 2OPQA 3AO1A 2Y1JA 4IKFA 4CJWA 1WSGA 3QEPA 1WNSA 1JLCA 4CFBA 4GMJB 4FLZA 2XY6A 4DSJA 3SUPA 5CYMA 4CJQA 2OA8A 3VQAA 4FLUA 1T05A 2OYQA 4KREA 3DI6A 4Z4HA 3V9UA 4I9QA 3VQ4A 1Q8IA 4KO0A 1REVA 4DFPA 4M3ZA 2ZQBA 2G8FA 3TAQA 3V81A 1O1WA 4FJ7A 1TL3A 3H08A 1ITGA 1VSLA 1HQEA 5DMRA 3U3GA 3OYGA 1KFDA 3KK2A 1EX4A 4J2EA 2O4IA 4RW8A 4CJEA 3O3HA 2YHAA 4F8RA 3RR7A 2BGGA 2G8IA 3SPYA 2YKMA 4CF2A 1BI4A 3AVFA 3QLHA 3CFPA 3CQ8A 4FJIA 3KJVA 1TAUA 1NK7A 4DTXA 3L8BA 3V4IA 5CYQA 5C24A 3ZT4A 4CJUA 3RMBA 1RT4A 2X6NA 4OKJA 4DQSA 3HT3A 2G8HA 3NF7A 3VQEA 1Q9XA 3AO4A 2OZSA 4ELVA 2XY8A 3LWLA 4BDZA 2PZSA 5FRNA 2KZZA 1HPZA 3IRXA 4CHQA 1JLGA 3ZSZA 4CJLA 5C42A 2B5JA 4DQRA 5D3GA 1NJYA 4K8XA 1ASVA 4HUEA 2YNHA 3OJSA 4RW6A 3VQ9A 1RT5A 4O0IA 1TK5A 4KTWA 3K58A 4B9SA 2X78A 5HRSA 2ZE2A 4FZXC 3DM2A 2YNFA 3DMJA 4DF4A 3TABA 4FM1A 1RTDA 3SQ1A 1A5XA 4QOZB 4EP5A 1GOCA 4W5QA 3QERA 1JLEA 1MU2A 1RCHA 5KRSA 4BDYA 3VQ6A 1TV6A 4I7FA 3TARA 1L3TA 1XHXA 3K5OA 1RBUA 4CEZA 4OLAA 3TAPA 4FJ8A 3VQPA 4PUOA 4IG3A 3ZSWA 3RTVA 3U6FA 3RRGA 2RN2A 1NOZA 1FK9A 2FBTA 4CK2A 3SV4A 2JGUA 3DYAA 1QTMA 2DTUA 3ZSVA 4M3TA 4CEAA 4HUGA 1S1WA 1ZYQA 1RDAA 1L3UA 1VSHA 4CGDA 1KLMA 4OGCA 4DSLA 1BCOA 1RTJA 2D0CA 1JXBA 1QSSA 2VWKA 3V1QA 1VRUA 4CHNA 1ZBHA 3IS9A 3ZSRA 3HVRA 1KVBA 4M3XA 3UIQA 3SYZA 2Q3SA 2A1SA 4FLWA 4AHVA 5T7BA 4EZ9A 1JXEA 3NF9A 1L3SA 1B9FA 3A2FA 4RW9A 3QEVA 5HP1A 2HW3A 4GVMA 1A5VA 1VK0A 3DRRA 3G10A 1WSIA 3RWUA 4DS5A 3MXMA 1SKRA 3DOLA 5HBMA 1TKDA 1WSEA 4FM2A 1FKPA 3T3FA 3L3UA 3AO3A 1SL2A 4Z4GA 4CFCA 1QS4A 2ZD1A 1D8YA 2VG7A 3OYKA 3MAQA 1WSHA 3SV3A 3PX6A 4F3OA 4HVJA 4B9UA 1GOAA 1RT7A 2YHBA 1S1XA 3OJUA 3I8DA 3AO5A 1RDBA 4KFBA 3L2WA 3SUOA 3ZSOA 3ISNC 3SQ2A 3LPTA 2G8KA 1ZBFA 4N41A 4BWMA 1S6QA 2FBVA 1LWCA 4ID5A 3OYBA 4CEOA 5CY4A 4CK1A 3SUNA 2E6LA 1Y97A 3KLHA 3HXMA 3TAFA 1NK0A 2HHUA 3VQBA 4FYDA 3PUFA 2KQ2A 1HJRA 3S9HA 3RR8A 3L2UA 2X6SA 3PO4A 1RT2A 3KD1E 3KKRA 3LAMA 4BWJA 4HCBA 3OYJA 1NK5A 4FK4A 1TK8A 3VQDA 3NHGA 3ZSXA 3AA5X 1TK0A 4PY5A 1X1PA 4RW7A 4DSKA 4AHRA 1D5AA 3WNGA 2EHGA 3NFAA 3V9WA 2P1JA 2QXFA 3C6UA 4NCGA 3G0ZA 2VG5A 3K5LA 1LW2A 3V9ZA 4B9VA 1RDDA 3HL8A 4MQ3A 3IG1A 4CERA 1JLQA 3PX4A 4DFMA 4FJLA 2VWJA 2G8VA 1IH7A 5I42A 3LP0A 4F2SA 1J53A 4KI6A 1S1VA 4ELTA 4CGHA 3SPZA 4Z4IA 1WN7A 4CEBA 1HQUA 2FBXA 1XC9A 4CFDA 1KTQA 3OVNA 2I5JA 3CG7A 4DTPA 4B9TA 1TGOA 1S9GA 4AILC 4HHTA 1T7PA 1HNVA 4LSLA 2GBZA 2WONA 4LY7A 2IAJA 5SWMA 3OS1A 3KLGA 4W5NA 1NK8A 4CJRA 3FFIA 3KKSA 4CJ3A 1KCFA 3HP9A 4K8ZA 2IGIA 4Z4FA 4OKKA 4I9LA 1C0TA 1YT3A 3AVMA 1KFSA 1EKEA 1VSJA 4M3RA 3V1RA 4G1QA 4KAZA 4KTZA 3B6OA 4CFAA 4FJ9A 4R5PA 1QQCA 1WLJA 4H4MA 5CZ2A 2IDOA 3AVKA 1B92A 1C1CA 4RW4A 2QKKA 4CJFA 4DFJA 4LH4A 3QEIA 3V1OA 1LAVA 4DTSA 2YV0X 2XHBA 3DLRA 4DQQA 2QKBA 4CESA 3MXIA 3OYMA 4BDPA 1TAQA 2D0AA 4Q0BA 3O3GA 3NE6A 1GOBA 4DFKA 4B9MA 4CGJA 2HHQA 3MXJA 4E3SA 3DLKA 4FJKA 1J5OA 1NK4A 1BQNA 3AVJA 3QIOA 4Y1CA 3K57A 3BGRA 1I39A 3NCIA 3SQ4A 4KHYA 4KRFA 1LWEA 4L8RB 2DY4A 3AVLA 4LSNA 4N5SA 4C8OA 2ETJA 4M3UA 4LH5A 5J2NA 3ALYA 1RNHA 3AVGA 3DLEA 2HB5A 4Y1DA 1VSEA 5FRMA 2QK9A 1C1BA 4CHYA 4FJNA 2DFFA 4TSXA 4CJ5A 1UAXA 4E89A 5J1EA 3QNNA 4E0DA 4CHZA 3WNHA 2IS3A 2B4JA 2PYJA 5I3UA 3AVIA 4CGIA 4AHCA 3M8SA 5HRRA 2Z1JA 4FLYA 1XI1A 4PA1A 4OPKA 3OS2A 1XWLA 2KW4A 3OYIA 4Z4EA 4NCAA 3OS0A 3DLHA 2JLEA 3PY8A 1U04A 3LALA 2HNYA 3HPOA 4FLTA 4DWIA 4PQUA 3LP2A 4O4GA 3AA3A 3C6TA 3OY9A 4HCCA 1U4BA 3NAEA 2XY5A 1ASUA 3RMDA 3P1GA 1JL2A 3OYDA 5HLFA 3E01A 1KVAA 1QE1A 2YNGA 4CJPA 3VQ5A 3EY1A 2XRIA 1NK6A 3DRSA 4FW1A 4O5BA 1NJWA 3QESA 4C8NA 3ZT2A 1IKVA 2GUIA 4W5RA 4FK0A 3HJFA 1DTQA 4FVMA 3P5JA 1XHZA 4DSEA 4CJKA 1SL1A 1D9FA 2PYLA 3LP1A 4FJMA 4CIGA 4DTUA 3L2RA 1QHTA 3TAMA 4FZZA 1W9HA 2WOMA 3LPUA 4FLXA 3KTQA 2D0BA 2P5OA 1K6YA 3HO1A 4W5TA 5C25A 2HHSA 4CGFA 1NKBA 2Z1IA 4WE1A 3NH2A 3OYHA 5HROA 1J9AA 1DLOA 3KIOA 3LZIA 1Z25A 3LP3A 4KHNA 5DK5A 4E19A 1RT1A 1BIZA 2O4GA 3MEEA 3LAKA 4EP4A 4O44A 1VSFA 1SUQA 3CFOA 4KB0A 2RF2A 4Z0UA 3TI0A 1S9EA 3T19A 3SJJA 1LV5A 2HVIA 2ITGA 4GW6A 5SZTA 4DLGA 4OGEA 2R7YA 4DTJA 4IFVA 3ITHA 5KGXA 4IDKA 4C8MA 3K59A 4DU1A 1NKEA 4C8KA 3DOKA 3TAGA 4KI4A 3AVBA 3NDKA 1NKCA 4AHSA 3OYFA 4KTQA 3M8PA 3NBPA 4F4KA 4JLHA 4CECA 3K5MA 1RT6A 4J2BA 1CZ9A 1VRTA 2RPIA 4BE2A 3MECA 3U3YA 1W0HA
chains in the Genus database with same CATH superfamily
3DWLA 2B6AA 2VG6A 1IO2A 5KQDA 1T3VA 1BWFO 3CI5A 4CJVA 4A57A 2A6AA 3QEWA 4H03B 4H0YB 4QS9A 2P9NA 3M8QA 4GNIA 4JRPA 4DMNA 1BCMA 3MN6A 4CW7B 4JI4K 4N47A 2Y1IA 3RMCA 3H46O 3QO9A 4OKEA 4DSFA 5AZIA 4FXDA 3O9UA 2Z1GA 5AQGA 1T44A 1EWRA 3L3VA 4YFUA 1FXXA 4AF1A 1U47A 2OZMA 2QWPA 1CZBA 3C95A 1L5UA 3GL1A 4YOTA 4FZYA 1BHLA 2BTFA 3H3NO 2FBYA 1B9DA 3D0PA 1KLNA 2KFNA 3VN5A 4A2BA 5KI6A 4K41A 2GTDA 4Z4CA 4JKBA 3HM8A 4B3OA 3CQXA 3ZYYX 1X3NA 1KAYA 5AQTA 3CJ7A 2O8CA 4JS5A 2V51B 4CF0A 3TAEA 4CD1A 1JCFA 3IDHA 3CMAN 4F2RA 2O8DB 1IKXA 4FJGA 3CM5A 4CHPA 5FRMA 5JS2A 3HM9A 4M42A 3G25A 3S3MA 3ZETB 4PHTX 1HPMA 4K42A 1ASWA 4EIAA 3HP6A 2QEXN 4ZTJA 4YNQA 1VQ6N 3EYZA 4F3TA 2W6LA 2J4RA 4DR4K 2ASOA 1VSMA 2NRVA 4H8KA 1KRPA 4NLBA 3L2VA 5M1PA 4YOYA 5AQZA 2W42A 2P9LB 5LJWA 2BE2A 4JKHA 4CK3A 1DT9A 4MLEA 4IWVA 4B9LA 3NMUA 1UWBA 1TKTA 1RBTA 3NVKA 4BVPA 3K2PA 4WYBA 3S3NA 1TYQB 2UYTA 3WQUA 5LMNK 3BY5A 5DM6L 3AA4A 1GLAG 4ZHRA 3VQCA 2XO7A 4LFCK 5TKWA 3TSPA 2JWKA 2FXUA 4O0JA 5AQIA 4BRIA 3Q7BA 4CF1A 3C94A 4XEIA 1NGHA 3NF6A 4ID1A 3JSMA 4J8FA 3QEXA 2P9PB 2QM1A 4CZLA 5DM7L 1C0FA 4JKDA 3A5LC 5M1QA 2BDPA 3ULEA 3RRHA 4CJ4A 4MFBA 1VSIA 2E4LA 3AA2A 3HTVA 4KPYA 5AR0A 4C23A 3O4QA 2DFHA 4IBNA 1RBRA 4IO8A 3CCLN 3TANA 4ILHA 4IXCA 2QTDA 1NJZA 4E7JA 1IG9A 5GIOA 4ZTFA 1C0MA 4DTNA 4BRPA 1HJOA 3LDQA 4CE9A 5BPMA 3LZJA 5IT9O 1QVGM 2F96A 3TR8A 3NH0A 3V9XA 1VQLN 4CIFA 3CIPA 1XNRK 1S3XA 1SKSA 3P83D 1CLQA 3H45C 3T1HK 3VGKA 4FOEA 3ATUA 3ZT1A 3CJ9A 1WSGA 1OH5A 5C0YA 1WNSA 1X9JA 4CFBA 2XY6A 1YI2N 3WXKA 2HBJA 2E88A 2FSNA 3VQAA 4FLUA 4QS7A 2ZJQL 1P90A 4KO0A 4DFPA 2Q1NA 3GBTA 1O1WA 3D2FB 3TTFA 3CPWM 3VENA 1VSLA 1BOTO 2O4IA 1BO5O 2YHAA 4JI8K 2BGGA 2G8IA 3OA9A 1VQPN 3QLHA 1DGKN 4BG8A 1TAUA 4JK8A 3EO3A 5C24A 4WQ5A 2X6NA 4OKJA 4JI7K 1Q9XA 2QWRA 5FRNA 2KZZA 1NGGA 2YCHA 3ZSZA 4CJLA 4A59A 2B5JA 4DQRA 5D3GA 1NJYA 2A42A 5GAHP 4RW6A 4O0IA 1TK5A 1XUPO 3O5BA 3AGKA 4FWKA 1RTDA 2O8BA 4BRHA 4DF4A 3MN9A 4EP5A 1GOCA 2IVPA 5KRSA 4I7FA 4OO1J 3C6HA 3K5OA 5LMUK 3K0SA 4OLAA 3TAPA 3ZSWA 3RTVA 3JAMO 3C7NB 2E2OA 3JXUA 1EQYA 1S1WA 1L3UA 4CZHA 4CJ7A 1QSSA 4YY3K 2VWKA 4CHNA 1ZBHA 1HLUA 2YX6A 3C6AA 2ZF5O 4BC2A 1BDGA 1KVBA 4M3XA 4IDHA 4EZ9A 3QEVA 3CC2N 3DXKB 4DB3A 3DRRA 4DS5A 2WC9A 3MXMA 5GIPA 1TKDA 2F7TA 1ATRA 4Z4GA 1M90O 4CFCA 2P9UB 1D8YA 4H5TA 3OYKA 3SV3A 3PX6A 4B9UA 1GOAA 1LCUA 3U9DA 1RT7A 2YHBA 3BEXA 3OJUA 1VQ5N 4WQ5C 4JI0K 4BQLA 4N41A 2FBVA 4PL8A 2O8EB 4CEOA 5CY4A 4CK1A 2E6LA 1Y97A 3ZLJA 3DLLL 1NK0A 2HHUA 3VQBA 3PUFA 1Z05A 3S9HA 3L2UA 3KD1E 1NK5A 3M6GA 1TK8A 3NHGA 4I6MA 3ZSXA 4FWRA 3FLCO 5FLXO 2EHGA 3THYA 3V9WA 2P1JA 2QXFA 2IVOA 3C65A 3O4WA 4GV9A 1NLVA 1LW2A 2D0PA 3V9ZA 4A61A 4BRCA 3CJCA 2AA4A 3TSUA 1JLQA 2G8VA 3LP0A 4F2SA 4ELTA 4Z4IA 5AZIB 4CFDA 4B9TA 1S9GA 1HNVA 1RDUA 2GBZA 5ADXA 5JLHA 5SWMA 3KLGA 1W2BM 4W5NA 3LDNA 4CJ3A 5AQFA 2GX9A 4Z4FA 3EL2A 2A5XA 3AAQA 3V1RA 4O8UA 4KAZA 2O8DA 3B6OA 1QZ5A 4CFAA 4WFAL 2IDOA 3LDOA 1QVFM 1B92A 3O9RA 2QKKA 4CJFA 4LH4A 1HKGA 3LDLA 2XHBA 4DQQA 3ZETA 2W41A 4BDPA 2O8CB 1V4TA 3DLKA 4WF9L 4FJKA 2D1KA 1J5OA 1NK4A 4MO5A 3BGRA 4KHYA 4C8OA 2WFBA 5LJVA 4LH5A 2NZTA 3EZWA 3ALYA 1K9MO 2ZWHA 4Y1DA 5J1EA 4CHZA 1HNXK 1CZAN 2B4JA 2Q0UA 4YDUA 4CGIA 1ESVA 4AHCA 1WB9A 2Z1JA 4HTLA 3J80O 4FLYA 1XWLA 3OS0A 3DLHA 2JLEA 1VQ7N 1U04A 2WUSA 3PY8A 1EO1A 4FLTA 5BR9A 4PQUA 3A0IX 3I56N 4HCCA 3WT0A 2HOEA 4FWNA 3SK3A 3OYDA 3O9TA 3VQ5A 4M7XA 4FW1A 4EAHD 1JCEA 3QESA 2UU9K 4FK0A 4O8KA 1N33K 2GUIA 5I9EB 2PYLA 3LP1A 4B3TK 4CIGA 4DTUA 1KC8O 1NGEA 1W9HA 4PKIA 3VEOA 1K6YA 2HHSA 3L0QA 3LZIA 1Z25A 3LP3A 4KHNA 1S22A 1BUPA 1RT1A 2P9KA 1BIZA 3LAKA 4EP4A 2CGLA 2D4WA 5FPNA 3TI0A 3SLCA 3SJJA 2FLOA 2CGJA 5SZTA 2GEMA 4IDKA 3K59A 4C8KA 3DOKA 1N8RO 3NDKA 4AHSA 4YOVA 2Q2RA 4F4KA 4JLHA 3ULEB 4CD3A 2HHWA 3AVAA 4KBOA 3VESA 3ULDA 1N32K 1WAJA 4DQ8A 5KTQA 1N5YA 1HKBA 5EU7A 1ZBUA 4NCBA 5AQSA 4ICLA 2IOCA 4KV8A 2O8FA 5KQ8A 3PIOL 2HNDA 4DTRA 3P4IA 4JI3K 2F9TA 2A41A 4BACA 1X9SA 3O6WA 3BZCA 3ID6A 4DS4A 4M3WA 2HVHA 1SQKA 4H4OA 3CCRN 3ENBA 4EZ6A 1WSJA 4FWOA 1HYZA 4B8CA 2F8SA 5LL6Z 4CEEA 3F5TA 3HPGA 4CGGA 5BRHA 2FSKA 3EN9A 1EP4A 1NGFA 3IAYA 3D7EO 1OVYA 4KH4A 1MA9B 1OKJA 4CVNE 3L2QA 4FWQA 4DQIA 2A1RA 4KHUA 3NGZA 4YOXA 4H0OA 1RBVA 2KHOA 3BUZB 4PWDA 2E5LK 5ELZA 4NO7A 4M63C 1NK9A 3O4NA 4DLEA 1HRHA 4H5WA 1NJXA 3CD6N 1T8EA 1BIUA 4BRMA 2E8AA 4LD0A 1U48A 3CM6A 2QXLA 3QINA 3HSCA 4NYNA 3S3OA 2KFZA 2HHHK 4N56A 4V19S 3GOIA 4W5OA 3NH1A 4CHOA 3IUCA 3CETA 4I2PA 2G8UA 3HZ6A 4JK7A 2F4VK 2O8BB 1S1UA 3E1YA 3AVCA 3AARA 4CZIA 4CCHA 3ZX2A 3PV8A 4DG1A 4CIEA 3CCSN 1RBSA 3CF5L 4CZEA 3WUHA 4FVUA 4FWSA 5M1KA 3MDQA 4M41A 3OYLA 2UUBK 3HK2A 3VEXA 3DXKA 4E1NA 3E9PA 4DF8A 3VF2A 4CJSA 1GLEG 1HNIA 1W97L 5JVGL 1X9WA 4KHSA 4B8AB 1NOYA 1JLFA 1TL1A 2QWLA 3SQ0A 5AFUA 2QWOA 1DEJA 1RDCA 4DV5K 4B08A 1QSLA 1LW0A 2KZMA 4FJ5A 1YTUA 2O8EA 4XH5A 3AY9A 3SNNA 3AO2A 5GADP 3KK1A 4JKFA 4B9NA 5BPNA 4K43A 3VQ8A 4J2DA 3KD5E 4XH4A 2HHTA 3ZX3A 4QCLA 2OTJN 3WNEA 3EE8A 3NGIA 4DTMA 3ZT3A 4QAGA 3PO5A 1NGCA 1ILYA 4LFBK 3R3LA 2BUPA 1TUUA 2OCEA 4I6MB 5KGWA 1NMNA 3H3OB 2G8WA 4BGAA 3A5NC 3THYB 2V52B 4DR1K 4EHUA 3OYNA 1YJWN 5E41A 2A40A 2GELA 3H1VX 2RKIA 4CZJA 3KK3A 4KH6A 3I0RA 4FW2A 1RDWX 1D9DA 4FM0A 1JLBA 2E1ZA 2VGMA 4CJTA 2BANA 2WTUA 4K25A 1G15A 2BH1A 4IKFA 1JLCA 3SJHA 2UXBK 3THXB 2OA8A 4KREA 4Z4HA 3V9UA 3CCEN 4M7YA 2ZQBA 3B8AX 1HNZK 3OYGA 1KFDA 1EX4A 4RW8A 4XH1A 3SPYA 2PBDA 4FJIA 4Z94A 3KJVA 5EOYA 2UUAK 3O9QA 5CYQA 3ZT4A 1RT4A 4DQSA 1ZC6A 3TTDA 1NGJA 2P9SA 4ELVA 3LWLA 4BR2A 4DV3K 4PKHA 3VPZA 4K8XA 1ASVA 4HUEA 1QQNA 2NRTA 3K58A 4B9SA 3O80A 3O1BA 4FM1A 3SQ1A 1MU2A 3H6EA 1RCHA 3FE1A 3OBWA 3VQ6A 1L3TA 1XHXA 3U4LA 2ZJRL 1XC3A 3U6FA 3TPQA 2D0OA 1QTMA 3CERA 4M3TA 4RTFD 4C1NI 1KLMA 3J7YP 4OPHA 4DSLA 1RTJA 2D0CA 4CZMA 4B3MK 4DKWA 4ILGB 3ZSRA 3HVRA 3UIQA 2VQFK 1JXEA 5MLCQ 2RE2A 3CJBA 4BRAA 2YHXA 1VK0A 4LFAK 1WSIA 4DR3K 3FR0A 3DOLA 2ZD1A 3AAPA 1I94K 2VG7A 2P9KB 3VEZA 1S1XA 1NGBA 3MWPA 3AO5A 4KFBA 2KKZA 3GDQA 3F2KA 4DV4K 1KD1O 2FF3B 3ISNC 1YAGA 2G8KA 1ZBFA 4E1JA 1LWCA 4GV6A 2ZGZA 2KQ2A 5GAGP 1TUYA 4BWJA 4HCBA 4FOIA 1S72N 1TK0A 1NG9A 4RW7A 4AHRA 5JICA 1YHQN 2YI1A 3NFAA 3CMEN 3C6UA 3K5LA 3G6EN 3WXMB 2QW9A 2YHWA 1GLJO 1W7AA 3PX4A 2O8FB 4FJLA 3VTHA 1IH7A 3WXJA 1J53A 4CGHA 4NB4A 3SPZA 3O9SA 1NM1A 2E2PA 3WXLA 4BRQA 1KTQA 2I5JA 3ID8A 1TGOA 1T7PA 4B1ZA 2WONA 1SS6A 1NK8A 4LF5K 3KKSA 4JHDB 3OHRA 5BRFA 1KCFA 3HP9A 4K8ZA 4UY8O 4OKKA 4YHHK 4I9LA 3AVMA 1KFSA 1VSJA 4G1QA 3O8MA 5AQMA 1WLJA 4BC4A 3HOTA 1K8KA 5C2DA 4DFJA 1WOQA 4BRNA 4DR2K 4JV5K 3OYMA 3QB0A 1XNQK 1GOBA 4B9MA 2ASMA 4CGJA 1OH7A 4BREA 1BQNA 1DKGD 4BR5A 3QIOA 4Y1CA 3NCIA 1LWEA 3AVLA 4M3UA 5AQYA 1RNHA 3AVGA 1E4FT 3DLEA 2QK9A 1D4XA 4CHYA 4TSXA 4CJ5A 3QNNA 2PYJA 4L3QA 3OS2A 5AZJB 1QQMA 5M1NA 4NCAA 3LALA 1NBWA 5E26A 3A8YA 3LP2A 4O4GA 3AA3A 3D2EA 5GINA 1V4SA 2Q31A 3P1GA 4GV3A 1BU6O 4U7BA 1KVAA 1QZ6A 2YNGA 4CJPA 3BZKA 1NK6A 3DRSA 3M3ZA 1NJWA 2VGNA 4C8NA 1DTQA 3P5JA 1XHZA 3O1WA 4FZZA 4JAXA 4LF9K 2H3GX 3TU5A 2P5OA 4W5TA 4CGFA 2V7YA 1XMQK 4WE1A 5HROA 5DK5A 2W6KA 4E19A 4CZKA 4JKAA 3VGLA 1VSFA 1SUQA 2RF2A 5EXWA 4Z0UA 1S9EA 2HVIA 4H0VB 4GW6A 2HF3A 4OGEA 3KK7A 2R7YA 3QBWA 5KGXA 4C8MA 4DU1A 4KI4A 1NKCA 4BRGA 2QI2A 4KTQA 3M8PA 3NBPA 3G4SN 1O13A 3K5MA 1RT6A 3EKSA 4BE2A 3U3YA 4DSJA 5HOOA 5KRTA 3LDSA 2NRZA 3D6RA 4NLCA 3Q7CA 4FK2A 1VQ9N 4E7HA 4RG8A 2E1YA 5KPZA 1TKZA 3M8RA 1MDUB 1FKOA 3VA3A 1S5JA 3ZSYA 1C6VA 3J8AA 4BRLA 2HHVA 3WEEA 5AQHA 3V6DA 2P9IB 1YVUA 2DFEA 1Q9YA 3THXA 4UQGA 4FJHA 3PSFA 2P51A 2P5GA 3QDKA 1Q7YO 1YTAA 3HYFA 1BL3A 1OVQA 3ZX0A 1VSKA 2ZJPL 3KLEA 5AQRA 1Z26A 1HUXA 3DRPA 5EVZA 3L4IA 2ATQA 2YKNA 2CH6A 4X64K 1WAFA 3LWMA 3CXCM 3B6PA 3F9KA 2HMIA 2KTQA 4Q5VA 1HYVA 1RTHA 3ATVA 3ZT0A 3KLFA 3MMVA 4CEDA 2Z1HA 5ADXH 3SAFA 3THWA 5AJ3K 1RTIA 2YNIA 3SUQA 3UE5A 3D45A 3U8XA 4DU4A 3SCXA 3LANA 4KKOA 1QSYA 1R59O 3ENOA 2P9SB 3T1AA 3LM2A 1WSFA 1KVCA 3TSQA 1YVNA 2AJQA 4CZGA 4BR0A 1J5EK 4HUFA 1RILA 4CF9A 4DV7K 3N4PA 2A3ZA 3ENHA 5J2MA 1KSPA 3OYCA 4A62A 1RFQA 4JI2K 1SV5A 5J2QA 2D5RA 1J6ZA 4IG0A 3SI6A 2OPSA 4LF4K 3SBGA 2VWBA 3CYMA 1RT3A 1X3MA 4CEFA 3J7ZO 5JS1A 5AQKA 1C0UA 4JN4A 3FFKB 3RMAA 4U67L 3CCVN 3HOSA 1F21A 4CZFA 1EETA 3AVHA 3QFUA 4DHYA 1UA0A 1JL1A 2UXDK 2KLAA 3I8BA 5HRPA 4O55A 1LAWA 3V9SA 4DQPA 4KB1A 4MDBA 1BGXT 3THVA 3OYEA 4E7LA 3GG4A 4IJAA 4YDUC 2OANA 4DSIA 3RVCA 4JRQA 3GE1A 4OLBA 1VHXA 3DLGA 1KAZA 1T6CA 1U45A 3WXIA 1ZBLA 1LWFA 2I7NA 3K9KA 4AHUA 3CCQN 4O5FA 3KLIA 3F73A 1U6ZA 1N34K 2HMPA 1NU0A 4JHDA 5K14A 2HNZA 4IOCL 4CI6A 1HMVA 3TWHA 1VQKN 2ZGYA 5B8HA 1I3AA 1C0GA 2FF6A 2OPQA 3AO1A 2VYPA 2Y1JA 4GMJB 4H0XB 3SUPA 5CYMA 3DI6A 4I9QA 3MK6A 3VQ4A 2W40A 1REVA 3TAQA 5H1SQ 5HL7L 1ITGA 3KK2A 2E20A 4BR7A 4J2EA 3O3HA 3MN7A 1K8KB 4F8RA 5C12A 4PL7A 4C1NK 1GLLO 1BI4A 1WUAA 3AVFA 3CFPA 3CQ8A 4MLHA 4LF7K 1NK7A 2NRXA 3V4IA 1Q82O 1IBLK 3RMBA 3NF7A 3AO4A 1SAZA 2PZSA 1HPZA 3IRXA 4CHQA 1JLGA 4AM6A 5C42A 5AZJA 3A5OC 3PIPL 3I55N 4G9ZA 2YNHA 4RCHA 1RT5A 1YXQA 4CBWA 2E2QA 2ASPA 4EHTA 1QQOA 5HRSA 2ZE2A 1WBBA 4FZXC 3DMJA 3TABA 4QOZB 4W5QA 3QERA 3QMLA 4QS8A 3TARA 5AQVA 1RBUA 1WBDA 4FJ8A 3VQPA 3DJCA 4IG3A 3RRGA 2RN2A 1NOZA 1FK9A 2Q36A 3SV4A 2DTUA 3D2EB 5C2FA 1YITN 3SMPA 4IEEA 1IG8A 1RDAA 3G71N 4CGDA 1JCGA 1BCOA 1JXBA 3V1QA 3CPEA 3R8EA 4JI1K 3R6MA 4A5BA 1OH8A 4DV6K 3CCUN 2I7PA 1Y64A 3E9LA 3SYZA 2Q3SA 4FLWA 4AHVA 3UKUA 5T7BA 1L3SA 2EWSA 2HBKA 3A2FA 5HP1A 4ISFA 4GVMA 2HW3A 1Q81O 3RWUA 1SKRA 5HBMA 1WSEA 1U2VA 4KH5A 1FKPA 4FO0A 2HSTA 4IJNA 3W3DA 3L3UA 4JD2A 3KWGA 4JYAK 4X62K 3MWTA 3W0LA 4ILJA 4B3SK 2ZM6K 4F3OA 3SBTA 4JKEA 3SUOA 5E84A 5IWAK 1S6QA 4PKGA 4X66K 3OYBA 3SUNA 5F1XA 3KLHA 3HXMA 3KHYA 4NXMK 4FYDA 1K73O 5AFUH 2X6SA 2FSJA 3KKRA 2CGKA 3LAMA 3VQDA 3AA5X 1X1PA 1ATNA 4DSKA 3WNGA 5FPEA 5M1OA 2P9IA 3G0ZA 1E3MA 1RDDA 5KPTA 3HL8A 5AQUA 4H0PA 4MQ3A 3IG1A 4JKGA 2VWJA 3LDPA 1S1VA 2YJEA 5EY4A 4FSVA 2YHYA 3P39A 3WEEB 2GUPA 1XC9A 4AILC 4DR6K 4LSLA 5F0XA 3J7AP 3VEWA 4H5VA 3K9JA 4CJRA 3FFIA 3VOVA 1P8ZA 2IGIA 1XQSC 3FZMA 4DV2K 1QQCA 2HBMA 4H4MA 1C1CA 4RW4A 3UKRB 1XMOK 3V1OA 1LAVA 4B1VA 2YV0X 4FPBA 4DV1K 1OH6A 3J81O 4BY9C 3BP8A 3MXIA 1H1VA 4BR4A 4BVOA 3O3GA 3NE6A 3MCPA 3MXJA 3CCJN 2AP1A 3SQ4A 3K57A 1I39A 4KRFA 4A2AA 1YJ9N 3THWB 2DY4A 4LSNA 5A2QO 2QWNA 4R79A 1FW6A 5BPLA 3M1FA 4BGBA 1C1BA 1NJIO 4FJNA 4CBXA 3FZKA 4E89A 3BF1A 4E0DA 2IS3A 4IZ9A 3AVIA 4HWIA 4K0KK 1NGDA 3M5RA 1XI1A 4PA1A 4IOAL 3HPOA 5JMVA 1MWKA 3KZBA 2VCPA 4BRDA 3NAEA 3QBXA 2XY5A 4IOXA 5HLFA 4ISGA 1QE1A 3T7ZA 1IJJA 3CC4N 4O5BA 4FWPA 1IKVA 4DSEA 4CJKA 1D9FA 3R9PA 3L2RA 4OPAA 3TAMA 1VQ8N 4FLXA 3EEQA 2D0BA 1VQMN 3OYHA 1J9AA 1DLOA 5GAEP 4JI6K 5AQOA 3L6QA 4O44A 4DLGA 4DTJA 3VF6A 3AVBA 3OYFA 4AM7A 4CECA 4J2BA 1VRTA 2RPIA 3MECA 3ZEUA 3AVNA 4A5AA 4JS4A 1SL0A 3QETA 5JLFA 4X65K 2F9WA 5FPMA 3VA0A 1N6QA 1EXQA 2LSNA 3SZ2A 2PY5A 1M1KO 4J2AA 4KHPK 4BC5A 3K5NA 4DU3A 1R0AA 2F8TA 4AQYK 4OJRA 4WFBL 1LOTB 3DXMA 3JYTA 3MEDA 2FC0A 3F9MA 4BG9A 1T6DA 1ZBIA 3HSTB 5FDLA 1UA1A 4WCEL 5EX5A 1IKWA 5AQQA 4B1XB 3T1YK 1S1TA 2NRWA 3BDPA 2OPPA 4XIUA 1RGIA 4KHWA 2IIRA 4CF8A 1VQON 3PX0A 4GVEA 5FROA 1U49A 3OYAA 1YJNN 1Z6RA 3MX5A 3N4QA 3O3FA 4GKJK 4CEQA 4E7KA 2NUBA 3ZSQA 1T03A 3VTIA 3OBYA 3QNOA 1DTTA 1BI4B 1ZBSA 3VQQA 2NLXA 4FJJA 4BRFA 3RSEA 3BF3A 3VETA 3ASMA 4GY2B 1HYSA 1VQ4N 4I2QA 4FWMA 2GV9A 3CCMN 5LY3A 1JLAA 4OPJA 2YJFA 2OPRA 3HVTA 3KVGA 1TVRA 1L3VA 1CXUA 3EZ5A 3AGRA 3QIPA 4OVLA 4FJXA 5M1FA 4ELUA 3NGYA 5J2PA 3MX2A 4M45A 2CH5A 1E4GT 4B1YB 4HTUA 4NYFA 4C8LA 3VEVA 2X74A 3CFRA 4BR9A 1C1AA 1VSDA 4EFHA 1CXQA 3KWIA 3MCAB 2IC3A 4DR5K 4FCYA 1JKHA 1J54A 3NF8A 3UKUB 3NVMA 4DUYK 1U2VB 2Q97A 1IKYA 4JD2B 4DTOA 3MEGA 1BISA 2XY7A 4MDAA 4LF8K 3VEYA 4FLVA 4IFYA 5F2RA 5AQJA 1YUWA 3SMSA 4KHQA 4IFEA 4JK9A 4B1UB 5BREA 5HRNA 1BQMA 2HBLA 3I0SA 5C10A 1K8AO 3HPHA 2GWKA 2QA4N 1BG3A 5AQXA 1UOCA 5CZ1A 3WNFA 3CJ1A 4AH9A 3H1QA 3PSIA 4N76A 3FGUA 1TKXA 2HF4A 4JI5K 4BE1A 3ZCMA 4AHTA 3VQ7A 4FPAA 4WFNL 4BE0A 2HHXA 2WBNA 1S6PA 1SKWA 1HNWK 1HKCA 4E1MA 2P9NB 1Q18A 2EX3A 3CJAA 1X9MA 3MN5A 3R1XA 4JKGB 1A5WA 1JJ2M 2E6MA 1GLDG 2UXCK 3DLBA 4BC3A 4YORA 2DPNA 4E7IA 4M3YA 3VERA 1FJGK 3AV9A 4DUZK 1N36K 4CJWA 3QEPA 3UKRA 5CR4A 4FLZA 3OW2M 4CJQA 3HBTA 1T05A 2OYQA 4LF6K 1Q8IA 4M3ZA 2G8FA 4WQ4A 3V81A 4FJ7A 4DCHA 1TL3A 3H08A 5DMRA 4JNEA 1HQEA 3U3GA 1ZXOA 4CJEA 3E9OA 3RR7A 2YKMA 4CF2A 4DTXA 3L8BA 4CJUA 1QHAA 3HT3A 4B1WB 2G8HA 3FZHA 3VQEA 2OZSA 2XY8A 4BDZA 1YIJN 1IBMK 1VQNN 2NNWA 3OJSA 3VQ9A 4FL9A 4KTWA 2X78A 3QFPA 3DM2A 2YNFA 5KPRA 1A5XA 1BA0A 2P9LA 5AQWA 2V7ZA 1JLEA 4YOUA 4BDYA 3VGMA 1GLFO 2Q0RA 1TV6A 1HR0K 3IKMA 3JS6A 4H0TB 1Q86O 4CEZA 2GWJA 3P31A 4PUOA 1TYQA 2FBTA 3VF4A 4CK2A 2JGUA 3DYAA 3ZSVA 4CEAA 4HUGA 1ZYQA 1VSHA 4OGCA 4LC9B 1VRUA 1NMDA 5BRDA 3IS9A 1GLBG 2A1SA 3NF9A 1B9FA 3VMFB 4RW9A 3SAHA 4WQ4C 1A5VA 3G10A 1IBKK 2JWLA 4Y0WA 4FM2A 2P9PA 3C0BA 3T3FA 1SL2A 3AO3A 1NNEA 3L4QA 1QS4A 2NRRA 3MAQA 1WSHA 1IV0A 4HVJA 4BROA 3I8DA 1RDBA 3L2WA 3ZSOA 3SQ2A 3LPTA 1G99A 5C15A 3HRGA 4BWMA 4ID5A 3TAFA 2E2NA 1HJRA 4NXNK 4H5NA 3RR8A 3FZLA 3PO4A 1RT2A 5CE3A 5BN8A 3OYJA 4FK4A 3ZEUB 3CQYA 4PY5A 3IMXA 2QWMA 1D5AA 5FPDA 4NCGA 1KAXA 2VG5A 4B9VA 4DR7K 2UUCK 3A5MC 4CERA 1GLCG 4DFMA 5I42A 4KI6A 3LL3A 3DXMB 1WN7A 4CEBA 1HQUA 2FBXA 3OVNA 3CG7A 4DTPA 2IVNA 3EKUA 4HHTA 4GKKK 2PFUA 4LY7A 3P38A 2IAJA 3OS1A 2OTLN 1SZ2A 4ISEA 4F9OA 4H5RA 1C0TA 1YT3A 1EKEA 4M3RA 1KXPA 3D2FA 5BN9A 4KTZA 4FJ9A 4RWTA 1HX1A 4R5PA 3IFRA 5CZ2A 4OX9K 3AVKA 3QEIA 4DTSA 3CC7N 3DLRA 2QKBA 4CESA 1TAQA 2D0AA 4Q0BA 4DFKA 4MO4A 2HHQA 3S41A 4E3SA 3T69A 3AVJA 3E66A 3HI0A 4L8RB 4N5SA 5BR8K 2ETJA 2NRHA 5J2NA 3RSEB 2HB5A 1VSEA 5AQLA 3LM9A 3EE9A 2VQEK 2DFFA 1UAXA 1NGAA 4JKCA 5JVHL 3WNHA 2ITMA 1EWQA 3SAGA 5I3UA 3M8SA 5HRRA 5AQNA 3I33A 4OPKA 2KW4A 3O08A 3OYIA 4Z4EA 1YF5L 2HNYA 4DWIA 4IEIA 3C7NA 3TTCA 3C6TA 5AQPA 3OY9A 1U4BA 3CHWA 4YOWA 1ASUA 4JEPA 3RMDA 1JL2A 3E01A 4FWLA 3EY1A 1NWKA 2XRIA 4CBUA 4DV0K 3ZT2A 4W5RA 3HJFA 3PLAA 4FVMA 1SL1A 4FJMA 3WQTA 1QHTA 4B9QA 5TKYA 2WOMA 1BA1A 3LPUA 3KTQA 2PAVA 2QWQA 4BQZA 3HO1A 5C25A 2RHKA 1NKBA 2Z1IA 3NH2A 2P9UA 3KIOA 4IO9L 1KQSM 2O4GA 3MEEA 4BRKA 1NGIA 3CFOA 4KB0A 1ATSA 5CHIA 3T19A 1LV5A 4B3RK 3U9ZA 2ITGA 3DAWA 4IFVA 3QICA 3ITHA 1NKEA 3OTOK 3TAGA 3FZFA 1VAZA 1CZ9A 1MWMA 1W0HA 3UB5A
chains in the Genus database with same CATH topology
2HHWA 3AVNA 5KRTA 4JS4A 2B6AA 2VG6A 1IO2A 3LDSA 1SL0A 3AVAA 3QETA 3ULDA 1WAJA 5KTQA 4CJVA 1N5YA 5EU7A 1ZBUA 3VA0A 1N6QA 1EXQA 2LSNA 3SZ2A 3QEWA 2PY5A 4NCBA 4FK2A 3M8QA 4JRPA 4E7HA 4ICLA 4DMNA 4J2AA 2IOCA 4RG8A 4KV8A 1BCMA 1TKZA 3M8RA 1FKOA 3VA3A 1S5JA 3K5NA 4DU3A 1R0AA 3ZSYA 2F8TA 1C6VA 2HNDA 4N47A 4DTRA 4OJRA 2Y1IA 3RMCA 4BACA 1X9SA 2HHVA 3QO9A 3JYTA 4OKEA 4DSFA 3MEDA 2FC0A 4FXDA 3V6DA 4DS4A 2Z1GA 4M3WA 2HVHA 1ZBIA 3L3VA 4YFUA 1FXXA 1YVUA 2DFEA 3HSTB 4H4OA 5FDLA 4UQGA 1UA1A 1U47A 1Q9YA 4FJHA 4EZ6A 2OZMA 2P51A 2P5GA 1WSJA 1CZBA 3C95A 1HYZA 4B8CA 1L5UA 2F8SA 1YTAA 1IKWA 1BHLA 4CEEA 4FZYA 3HYFA 2FBYA 3HPGA 4CGGA 1S1TA 1BL3A 1B9DA 3D0PA 1KLNA 3BDPA 2KFNA 3VN5A 1VSKA 2OPPA 4XIUA 3KLEA 1EP4A 5KI6A 4KHWA 3IAYA 4CF8A 4Z4CA 1Z26A 3DRPA 3PX0A 4B3OA 5FROA 1U49A 3OYAA 2ATQA 2YKNA 1WAFA 3LWMA 3B6PA 4JS5A 3F9KA 4CF0A 3TAEA 3L2QA 2HMIA 4DQIA 2KTQA 3O3FA 4Q5VA 1HYVA 1RTHA 3ZT0A 4CEQA 4E7KA 2A1RA 4KHUA 3NGZA 2NUBA 3KLFA 1RBVA 4F2RA 3ZSQA 1IKXA 1T03A 4FJGA 4CEDA 4PWDA 2Z1HA 3CM5A 4CHPA 1RTIA 3QNOA 1DTTA 2YNIA 3O4NA 5JS2A 3HM9A 1BI4B 4DLEA 1HRHA 1NK9A 4M42A 3VQQA 1NJXA 3SUQA 3S3MA 1T8EA 1BIUA 3D45A 4FJJA 4LD0A 1U48A 3CM6A 4DU4A 3SCXA 3ASMA 1ASWA 3LANA 3QINA 4KKOA 4NYNA 3HP6A 3S3OA 4ZTJA 3T1AA 1QSYA 4I2QA 1HYSA 2KFZA 2GV9A 4YNQA 1JLAA 4OPJA 1WSFA 4N56A 1KVCA 2OPRA 3HVTA 3EYZA 4F3TA 1TVRA 4W5OA 1L3VA 3NH1A 4CHOA 2AJQA 1CXUA 1VSMA 3EZ5A 1KRPA 4H8KA 4I2PA 3L2VA 2G8UA 3QIPA 4HUFA 2W42A 4OVLA 1RILA 4FJXA 4CF9A 1S1UA 3AVCA 4ELUA 2BE2A 3NGYA 5J2PA 4CCHA 4CK3A 3PV8A 4DG1A 4CIEA 1RBSA 5J2MA 1KSPA 4B9LA 4M45A 1UWBA 1TKTA 3OYCA 1RBTA 3K2PA 3S3NA 1SV5A 4HTUA 5J2QA 2D5RA 4NYFA 4M41A 3OYLA 4C8LA 3HK2A 2X74A 3CFRA 4IG0A 1C1AA 4E1NA 3AA4A 1VSDA 2OPSA 3SI6A 4DF8A 4CJSA 4ZHRA 1CXQA 1HNIA 3CYMA 1RT3A 3VQCA 4CEFA 2XO7A 1X9WA 4KHSA 5JS1A 4B8AB 1NOYA 1C0UA 1JLFA 1TL1A 3SQ0A 2IC3A 4FCYA 4O0JA 1JKHA 3RMAA 4CF1A 3C94A 1J54A 3NF8A 3NF6A 1RDCA 4B08A 1QSLA 1LW0A 2KZMA 4ID1A 4FJ5A 1F21A 3JSMA 1YTUA 1EETA 3AVHA 3QEXA 1IKYA 4DTOA 1UA0A 1JL1A 3SNNA 3MEGA 1BISA 5HRPA 3AO2A 2XY7A 4O55A 1LAWA 3KK1A 3V9SA 4FLVA 4DQPA 4KB1A 2BDPA 3RRHA 1BGXT 4B9NA 4CJ4A 3THVA 4IFYA 4MFBA 1VSIA 3VQ8A 4J2DA 2E4LA 3OYEA 3KD5E 4KHQA 4E7LA 2HHTA 5HRNA 3AA2A 1BQMA 3I0SA 4KPYA 4QCLA 4DSIA 3WNEA 3HPHA 3O4QA 4JRQA 2DFHA 3NGIA 4DTMA 1UOCA 3ZT3A 4QAGA 5CZ1A 3WNFA 4OLBA 3PO5A 3DLGA 4IBNA 4AH9A 4N76A 1TKXA 5KGWA 1U45A 1RBRA 4BE1A 1ZBLA 3ZCMA 2G8WA 4AHTA 3VQ7A 1LWFA 4BE0A 3TANA 2HHXA 4AHUA 1NJZA 4E7JA 1IG9A 3OYNA 4ZTFA 1C0MA 1S6PA 4DTNA 5E41A 1SKWA 3KLIA 3F73A 2RKIA 3KK3A 4CE9A 4E1MA 3LZJA 1X9MA 2EX3A 3I0RA 2HNZA 5K14A 2F96A 4FW2A 1D9DA 3TR8A 3NH0A 1A5WA 3V9XA 1HMVA 3TWHA 1JLBA 4CIFA 4FM0A 2E6MA 1SKSA 1CLQA 3P83D 4CJTA 2BANA 3DLBA 1I3AA 4E7IA 4M3YA 1G15A 3ZT1A 3AV9A 2OPQA 3AO1A 2Y1JA 4IKFA 4CJWA 1WSGA 3QEPA 1WNSA 1JLCA 4CFBA 4GMJB 4FLZA 2XY6A 4DSJA 3SUPA 5CYMA 4CJQA 2OA8A 3VQAA 4FLUA 1T05A 2OYQA 4KREA 3DI6A 4Z4HA 3V9UA 4I9QA 3VQ4A 1Q8IA 4KO0A 1REVA 4DFPA 4M3ZA 2ZQBA 2G8FA 3TAQA 3V81A 1O1WA 4FJ7A 1TL3A 3H08A 1ITGA 1VSLA 1HQEA 5DMRA 3U3GA 3OYGA 1KFDA 3KK2A 1EX4A 4J2EA 2O4IA 4RW8A 4CJEA 3O3HA 2YHAA 4F8RA 3RR7A 2BGGA 2G8IA 3SPYA 2YKMA 4CF2A 1BI4A 3AVFA 3QLHA 3CFPA 3CQ8A 4FJIA 3KJVA 1TAUA 1NK7A 4DTXA 3L8BA 3V4IA 5CYQA 5C24A 3ZT4A 4CJUA 3RMBA 1RT4A 2X6NA 4OKJA 4DQSA 3HT3A 2G8HA 3NF7A 3VQEA 1Q9XA 3AO4A 2OZSA 4ELVA 2XY8A 3LWLA 4BDZA 2PZSA 5FRNA 2KZZA 1HPZA 3IRXA 4CHQA 1JLGA 3ZSZA 4CJLA 5C42A 2B5JA 4DQRA 5D3GA 1NJYA 4K8XA 1ASVA 4HUEA 2YNHA 3OJSA 4RW6A 3VQ9A 1RT5A 4O0IA 1TK5A 4KTWA 3K58A 4B9SA 2X78A 5HRSA 2ZE2A 4FZXC 3DM2A 2YNFA 3DMJA 4DF4A 3TABA 4FM1A 1RTDA 3SQ1A 1A5XA 4QOZB 4EP5A 1GOCA 4W5QA 3QERA 1JLEA 1MU2A 1RCHA 5KRSA 4BDYA 3VQ6A 1TV6A 4I7FA 3TARA 1L3TA 1XHXA 3K5OA 1RBUA 4CEZA 4OLAA 3TAPA 4FJ8A 3VQPA 4PUOA 4IG3A 3ZSWA 3RTVA 3U6FA 3RRGA 2RN2A 1NOZA 1FK9A 2FBTA 4CK2A 3SV4A 2JGUA 3DYAA 1QTMA 2DTUA 3ZSVA 4M3TA 4CEAA 4HUGA 1S1WA 1ZYQA 1RDAA 1L3UA 1VSHA 4CGDA 1KLMA 4OGCA 4DSLA 1BCOA 1RTJA 2D0CA 1JXBA 1QSSA 2VWKA 3V1QA 1VRUA 4CHNA 1ZBHA 3IS9A 3ZSRA 3HVRA 1KVBA 4M3XA 3UIQA 3SYZA 2Q3SA 2A1SA 4FLWA 4AHVA 5T7BA 4EZ9A 1JXEA 3NF9A 1L3SA 1B9FA 3A2FA 4RW9A 3QEVA 5HP1A 2HW3A 4GVMA 1A5VA 1VK0A 3DRRA 3G10A 1WSIA 3RWUA 4DS5A 3MXMA 1SKRA 3DOLA 5HBMA 1TKDA 1WSEA 4FM2A 1FKPA 3T3FA 3L3UA 3AO3A 1SL2A 4Z4GA 4CFCA 1QS4A 2ZD1A 1D8YA 2VG7A 3OYKA 3MAQA 1WSHA 3SV3A 3PX6A 4F3OA 4HVJA 4B9UA 1GOAA 1RT7A 2YHBA 1S1XA 3OJUA 3I8DA 3AO5A 1RDBA 4KFBA 3L2WA 3SUOA 3ZSOA 3ISNC 3SQ2A 3LPTA 2G8KA 1ZBFA 4N41A 4BWMA 1S6QA 2FBVA 1LWCA 4ID5A 3OYBA 4CEOA 5CY4A 4CK1A 3SUNA 2E6LA 1Y97A 3KLHA 3HXMA 3TAFA 1NK0A 2HHUA 3VQBA 4FYDA 3PUFA 2KQ2A 1HJRA 3S9HA 3RR8A 3L2UA 2X6SA 3PO4A 1RT2A 3KD1E 3KKRA 3LAMA 4BWJA 4HCBA 3OYJA 1NK5A 4FK4A 1TK8A 3VQDA 3NHGA 3ZSXA 3AA5X 1TK0A 4PY5A 1X1PA 4RW7A 4DSKA 4AHRA 1D5AA 3WNGA 2EHGA 3NFAA 3V9WA 2P1JA 2QXFA 3C6UA 4NCGA 3G0ZA 2VG5A 3K5LA 1LW2A 3V9ZA 4B9VA 1RDDA 3HL8A 4MQ3A 3IG1A 4CERA 1JLQA 3PX4A 4DFMA 4FJLA 2VWJA 2G8VA 1IH7A 5I42A 3LP0A 4F2SA 1J53A 4KI6A 1S1VA 4ELTA 4CGHA 3SPZA 4Z4IA 1WN7A 4CEBA 1HQUA 2FBXA 1XC9A 4CFDA 1KTQA 3OVNA 2I5JA 3CG7A 4DTPA 4B9TA 1TGOA 1S9GA 4AILC 4HHTA 1T7PA 1HNVA 4LSLA 2GBZA 2WONA 4LY7A 2IAJA 5SWMA 3OS1A 3KLGA 4W5NA 1NK8A 4CJRA 3FFIA 3KKSA 4CJ3A 1KCFA 3HP9A 4K8ZA 2IGIA 4Z4FA 4OKKA 4I9LA 1C0TA 1YT3A 3AVMA 1KFSA 1EKEA 1VSJA 4M3RA 3V1RA 4G1QA 4KAZA 4KTZA 3B6OA 4CFAA 4FJ9A 4R5PA 1QQCA 1WLJA 4H4MA 5CZ2A 2IDOA 3AVKA 1B92A 1C1CA 4RW4A 2QKKA 4CJFA 4DFJA 4LH4A 3QEIA 3V1OA 1LAVA 4DTSA 2YV0X 2XHBA 3DLRA 4DQQA 2QKBA 4CESA 3MXIA 3OYMA 4BDPA 1TAQA 2D0AA 4Q0BA 3O3GA 3NE6A 1GOBA 4DFKA 4B9MA 4CGJA 2HHQA 3MXJA 4E3SA 3DLKA 4FJKA 1J5OA 1NK4A 1BQNA 3AVJA 3QIOA 4Y1CA 3K57A 3BGRA 1I39A 3NCIA 3SQ4A 4KHYA 4KRFA 1LWEA 4L8RB 2DY4A 3AVLA 4LSNA 4N5SA 4C8OA 2ETJA 4M3UA 4LH5A 5J2NA 3ALYA 1RNHA 3AVGA 3DLEA 2HB5A 4Y1DA 1VSEA 5FRMA 2QK9A 1C1BA 4CHYA 4FJNA 2DFFA 4TSXA 4CJ5A 1UAXA 4E89A 5J1EA 3QNNA 4E0DA 4CHZA 3WNHA 2IS3A 2B4JA 2PYJA 5I3UA 3AVIA 4CGIA 4AHCA 3M8SA 5HRRA 2Z1JA 4FLYA 1XI1A 4PA1A 4OPKA 3OS2A 1XWLA 2KW4A 3OYIA 4Z4EA 4NCAA 3OS0A 3DLHA 2JLEA 3PY8A 1U04A 3LALA 2HNYA 3HPOA 4FLTA 4DWIA 4PQUA 3LP2A 4O4GA 3AA3A 3C6TA 3OY9A 4HCCA 1U4BA 3NAEA 2XY5A 1ASUA 3RMDA 3P1GA 1JL2A 3OYDA 5HLFA 3E01A 1KVAA 1QE1A 2YNGA 4CJPA 3VQ5A 3EY1A 2XRIA 1NK6A 3DRSA 4FW1A 4O5BA 1NJWA 3QESA 4C8NA 3ZT2A 1IKVA 2GUIA 4W5RA 4FK0A 3HJFA 1DTQA 4FVMA 3P5JA 1XHZA 4DSEA 4CJKA 1SL1A 1D9FA 2PYLA 3LP1A 4FJMA 4CIGA 4DTUA 3L2RA 1QHTA 3TAMA 4FZZA 1W9HA 2WOMA 3LPUA 4FLXA 3KTQA 2D0BA 2P5OA 1K6YA 3HO1A 4W5TA 5C25A 2HHSA 4CGFA 1NKBA 2Z1IA 4WE1A 3NH2A 3OYHA 5HROA 1J9AA 1DLOA 3KIOA 3LZIA 1Z25A 3LP3A 4KHNA 5DK5A 4E19A 1RT1A 1BIZA 2O4GA 3MEEA 3LAKA 4EP4A 4O44A 1VSFA 1SUQA 3CFOA 4KB0A 2RF2A 4Z0UA 3TI0A 1S9EA 3T19A 3SJJA 1LV5A 2HVIA 2ITGA 4GW6A 5SZTA 4DLGA 4OGEA 2R7YA 4DTJA 4IFVA 3ITHA 5KGXA 4IDKA 4C8MA 3K59A 4DU1A 1NKEA 4C8KA 3DOKA 3TAGA 4KI4A 3AVBA 3NDKA 1NKCA 4AHSA 3OYFA 4KTQA 3M8PA 3NBPA 4F4KA 4JLHA 4CECA 3K5MA 1RT6A 4J2BA 1CZ9A 1VRTA 2RPIA 4BE2A 3MECA 3U3YA 1W0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHW A;  3AVN A;  5KRT A;  4JS4 A;  2B6A A;  2VG6 A;  1IO2 A;  3LDS A;  1SL0 A;  3AVA A;  3QET A;  3ULD A;  1WAJ A;  5KTQ A;  4CJV A;  1N5Y A;  5EU7 A;  1ZBU A;  3VA0 A;  1N6Q A;  1EXQ A;  2LSN A;  3SZ2 A;  3QEW A;  2PY5 A;  4NCB A;  4FK2 A;  3M8Q A;  4JRP A;  4E7H A;  4ICL A;  4DMN A;  4J2A A;  2IOC A;  4RG8 A;  4KV8 A;  1BCM A;  1TKZ A;  3M8R A;  1FKO A;  3VA3 A;  1S5J A;  3K5N A;  4DU3 A;  1R0A A;  3ZSY A;  2F8T A;  1C6V A;  2HND A;  4N47 A;  4DTR A;  4OJR A;  2Y1I A;  3RMC A;  4BAC A;  1X9S A;  2HHV A;  3QO9 A;  3JYT A;  4OKE A;  4DSF A;  3MED A;  2FC0 A;  4FXD A;  3V6D A;  4DS4 A;  2Z1G A;  4M3W A;  2HVH A;  1ZBI A;  3L3V A;  4YFU A;  1FXX A;  1YVU A;  2DFE A;  3HST B;  4H4O A;  5FDL A;  4UQG A;  1UA1 A;  1U47 A;  1Q9Y A;  4FJH A;  4EZ6 A;  2OZM A;  2P51 A;  2P5G A;  1WSJ A;  1CZB A;  3C95 A;  1HYZ A;  4B8C A;  1L5U A;  2F8S A;  1YTA A;  1IKW A;  1BHL A;  4CEE A;  4FZY A;  3HYF A;  2FBY A;  3HPG A;  4CGG A;  1S1T A;  1BL3 A;  1B9D A;  3D0P A;  1KLN A;  3BDP A;  2KFN A;  3VN5 A;  1VSK A;  2OPP A;  4XIU A;  3KLE A;  1EP4 A;  5KI6 A;  4KHW A;  3IAY A;  4CF8 A;  4Z4C A;  1Z26 A;  3DRP A;  3PX0 A;  4B3O A;  5FRO A;  1U49 A;  3OYA A;  2ATQ A;  2YKN A;  1WAF A;  3LWM A;  3B6P A;  4JS5 A;  3F9K A;  4CF0 A;  3TAE A;  3L2Q A;  2HMI A;  4DQI A;  2KTQ A;  3O3F A;  4Q5V A;  1HYV A;  1RTH A;  3ZT0 A;  4CEQ A;  4E7K A;  2A1R A;  4KHU A;  3NGZ A;  2NUB A;  3KLF A;  1RBV A;  4F2R A;  3ZSQ A;  1IKX A;  1T03 A;  4FJG A;  4CED A;  4PWD A;  2Z1H A;  3CM5 A;  4CHP A;  1RTI A;  3QNO A;  1DTT A;  2YNI A;  3O4N A;  5JS2 A;  3HM9 A;  1BI4 B;  4DLE A;  1HRH A;  1NK9 A;  4M42 A;  3VQQ A;  1NJX A;  3SUQ A;  3S3M A;  1T8E A;  1BIU A;  3D45 A;  4FJJ A;  4LD0 A;  1U48 A;  3CM6 A;  4DU4 A;  3SCX A;  3ASM A;  1ASW A;  3LAN A;  3QIN A;  4KKO A;  4NYN A;  3HP6 A;  3S3O A;  4ZTJ A;  3T1A A;  1QSY A;  4I2Q A;  1HYS A;  2KFZ A;  2GV9 A;  4YNQ A;  1JLA A;  4OPJ A;  1WSF A;  4N56 A;  1KVC A;  2OPR A;  3HVT A;  3EYZ A;  4F3T A;  1TVR A;  4W5O A;  1L3V A;  3NH1 A;  4CHO A;  2AJQ A;  1CXU A;  1VSM A;  3EZ5 A;  1KRP A;  4H8K A;  4I2P A;  3L2V A;  2G8U A;  3QIP A;  4HUF A;  2W42 A;  4OVL A;  1RIL A;  4FJX A;  4CF9 A;  1S1U A;  3AVC A;  4ELU A;  2BE2 A;  3NGY A;  5J2P A;  4CCH A;  4CK3 A;  3PV8 A;  4DG1 A;  4CIE A;  1RBS A;  5J2M A;  1KSP A;  4B9L A;  4M45 A;  1UWB A;  1TKT A;  3OYC A;  1RBT A;  3K2P A;  3S3N A;  1SV5 A;  4HTU A;  5J2Q A;  2D5R A;  4NYF A;  4M41 A;  3OYL A;  4C8L A;  3HK2 A;  2X74 A;  3CFR A;  4IG0 A;  1C1A A;  4E1N A;  3AA4 A;  1VSD A;  2OPS A;  3SI6 A;  4DF8 A;  4CJS A;  4ZHR A;  1CXQ A;  1HNI A;  3CYM A;  1RT3 A;  3VQC A;  4CEF A;  2XO7 A;  1X9W A;  4KHS A;  5JS1 A;  4B8A B;  1NOY A;  1C0U A;  1JLF A;  1TL1 A;  3SQ0 A;  2IC3 A;  4FCY A;  4O0J A;  1JKH A;  3RMA A;  4CF1 A;  3C94 A;  1J54 A;  3NF8 A;  3NF6 A;  1RDC A;  4B08 A;  1QSL A;  1LW0 A;  2KZM A;  4ID1 A;  4FJ5 A;  1F21 A;  3JSM A;  1YTU A;  1EET A;  3AVH A;  3QEX A;  1IKY A;  4DTO A;  1UA0 A;  1JL1 A;  3SNN A;  3MEG A;  1BIS A;  5HRP A;  3AO2 A;  2XY7 A;  4O55 A;  1LAW A;  3KK1 A;  3V9S A;  4FLV A;  4DQP A;  4KB1 A;  2BDP A;  3RRH A;  1BGX T;  4B9N A;  4CJ4 A;  3THV A;  4IFY A;  4MFB A;  1VSI A;  3VQ8 A;  4J2D A;  2E4L A;  3OYE A;  3KD5 E;  4KHQ A;  4E7L A;  2HHT A;  5HRN A;  3AA2 A;  1BQM A;  3I0S A;  4KPY A;  4QCL A;  4DSI A;  3WNE A;  3HPH A;  3O4Q A;  4JRQ A;  2DFH A;  3NGI A;  4DTM A;  1UOC A;  3ZT3 A;  4QAG A;  5CZ1 A;  3WNF A;  4OLB A;  3PO5 A;  3DLG A;  4IBN A;  4AH9 A;  4N76 A;  1TKX A;  5KGW A;  1U45 A;  1RBR A;  4BE1 A;  1ZBL A;  3ZCM A;  2G8W A;  4AHT A;  3VQ7 A;  1LWF A;  4BE0 A;  3TAN A;  2HHX A;  4AHU A;  1NJZ A;  4E7J A;  1IG9 A;  3OYN A;  4ZTF A;  1C0M A;  1S6P A;  4DTN A;  5E41 A;  1SKW A;  3KLI A;  3F73 A;  2RKI A;  3KK3 A;  4CE9 A;  4E1M A;  3LZJ A;  1X9M A;  2EX3 A;  3I0R A;  2HNZ A;  5K14 A;  2F96 A;  4FW2 A;  1D9D A;  3TR8 A;  3NH0 A;  1A5W A;  3V9X A;  1HMV A;  3TWH A;  1JLB A;  4CIF A;  4FM0 A;  2E6M A;  1SKS A;  1CLQ A;  3P83 D;  4CJT A;  2BAN A;  3DLB A;  1I3A A;  4E7I A;  4M3Y A;  1G15 A;  3ZT1 A;  3AV9 A;  2OPQ A;  3AO1 A;  2Y1J A;  4IKF A;  4CJW A;  1WSG A;  3QEP A;  1WNS A;  1JLC A;  4CFB A;  4GMJ B;  4FLZ A;  2XY6 A;  4DSJ A;  3SUP A;  5CYM A;  4CJQ A;  2OA8 A;  3VQA A;  4FLU A;  1T05 A;  2OYQ A;  4KRE A;  3DI6 A;  4Z4H A;  3V9U A;  4I9Q A;  3VQ4 A;  1Q8I A;  4KO0 A;  1REV A;  4DFP A;  4M3Z A;  2ZQB A;  2G8F A;  3TAQ A;  3V81 A;  1O1W A;  4FJ7 A;  1TL3 A;  3H08 A;  1ITG A;  1VSL A;  1HQE A;  5DMR A;  3U3G A;  3OYG A;  1KFD A;  3KK2 A;  1EX4 A;  4J2E A;  2O4I A;  4RW8 A;  4CJE A;  3O3H A;  2YHA A;  4F8R A;  3RR7 A;  2BGG A;  2G8I A;  3SPY A;  2YKM A;  4CF2 A;  1BI4 A;  3AVF A;  3QLH A;  3CFP A;  3CQ8 A;  4FJI A;  3KJV A;  1TAU A;  1NK7 A;  4DTX A;  3L8B A;  3V4I A;  5CYQ A;  5C24 A;  3ZT4 A;  4CJU A;  3RMB A;  1RT4 A;  2X6N A;  4OKJ A;  4DQS A;  3HT3 A;  2G8H A;  3NF7 A;  3VQE A;  1Q9X A;  3AO4 A;  2OZS A;  4ELV A;  2XY8 A;  3LWL A;  4BDZ A;  2PZS A;  5FRN A;  2KZZ A;  1HPZ A;  3IRX A;  4CHQ A;  1JLG A;  3ZSZ A;  4CJL A;  5C42 A;  2B5J A;  4DQR A;  5D3G A;  1NJY A;  4K8X A;  1ASV A;  4HUE A;  2YNH A;  3OJS A;  4RW6 A;  3VQ9 A;  1RT5 A;  4O0I A;  1TK5 A;  4KTW A;  3K58 A;  4B9S A;  2X78 A;  5HRS A;  2ZE2 A;  4FZX C;  3DM2 A;  2YNF A;  3DMJ A;  4DF4 A;  3TAB A;  4FM1 A;  1RTD A;  3SQ1 A;  1A5X A;  4QOZ B;  4EP5 A;  1GOC A;  4W5Q A;  3QER A;  1JLE A;  1MU2 A;  1RCH A;  5KRS A;  4BDY A;  3VQ6 A;  1TV6 A;  4I7F A;  3TAR A;  1L3T A;  1XHX A;  3K5O A;  1RBU A;  4CEZ A;  4OLA A;  3TAP A;  4FJ8 A;  3VQP A;  4PUO A;  4IG3 A;  3ZSW A;  3RTV A;  3U6F A;  3RRG A;  2RN2 A;  1NOZ A;  1FK9 A;  2FBT A;  4CK2 A;  3SV4 A;  2JGU A;  3DYA A;  1QTM A;  2DTU A;  3ZSV A;  4M3T A;  4CEA A;  4HUG A;  1S1W A;  1ZYQ A;  1RDA A;  1L3U A;  1VSH A;  4CGD A;  1KLM A;  4OGC A;  4DSL A;  1BCO A;  1RTJ A;  2D0C A;  1JXB A;  1QSS A;  2VWK A;  3V1Q A;  1VRU A;  4CHN A;  1ZBH A;  3IS9 A;  3ZSR A;  3HVR A;  1KVB A;  4M3X A;  3UIQ A;  3SYZ A;  2Q3S A;  2A1S A;  4FLW A;  4AHV A;  5T7B A;  4EZ9 A;  1JXE A;  3NF9 A;  1L3S A;  1B9F A;  3A2F A;  4RW9 A;  3QEV A;  5HP1 A;  2HW3 A;  4GVM A;  1A5V A;  1VK0 A;  3DRR A;  3G10 A;  1WSI A;  3RWU A;  4DS5 A;  3MXM A;  1SKR A;  3DOL A;  5HBM A;  1TKD A;  1WSE A;  4FM2 A;  1FKP A;  3T3F A;  3L3U A;  3AO3 A;  1SL2 A;  4Z4G A;  4CFC A;  1QS4 A;  2ZD1 A;  1D8Y A;  2VG7 A;  3OYK A;  3MAQ A;  1WSH A;  3SV3 A;  3PX6 A;  4F3O A;  4HVJ A;  4B9U A;  1GOA A;  1RT7 A;  2YHB A;  1S1X A;  3OJU A;  3I8D A;  3AO5 A;  1RDB A;  4KFB A;  3L2W A;  3SUO A;  3ZSO A;  3ISN C;  3SQ2 A;  3LPT A;  2G8K A;  1ZBF A;  4N41 A;  4BWM A;  1S6Q A;  2FBV A;  1LWC A;  4ID5 A;  3OYB A;  4CEO A;  5CY4 A;  4CK1 A;  3SUN A;  2E6L A;  1Y97 A;  3KLH A;  3HXM A;  3TAF A;  1NK0 A;  2HHU A;  3VQB A;  4FYD A;  3PUF A;  2KQ2 A;  1HJR A;  3S9H A;  3RR8 A;  3L2U A;  2X6S A;  3PO4 A;  1RT2 A;  3KD1 E;  3KKR A;  3LAM A;  4BWJ A;  4HCB A;  3OYJ A;  1NK5 A;  4FK4 A;  1TK8 A;  3VQD A;  3NHG A;  3ZSX A;  3AA5 X;  1TK0 A;  4PY5 A;  1X1P A;  4RW7 A;  4DSK A;  4AHR A;  1D5A A;  3WNG A;  2EHG A;  3NFA A;  3V9W A;  2P1J A;  2QXF A;  3C6U A;  4NCG A;  3G0Z A;  2VG5 A;  3K5L A;  1LW2 A;  3V9Z A;  4B9V A;  1RDD A;  3HL8 A;  4MQ3 A;  3IG1 A;  4CER A;  1JLQ A;  3PX4 A;  4DFM A;  4FJL A;  2VWJ A;  2G8V A;  1IH7 A;  5I42 A;  3LP0 A;  4F2S A;  1J53 A;  4KI6 A;  1S1V A;  4ELT A;  4CGH A;  3SPZ A;  4Z4I A;  1WN7 A;  4CEB A;  1HQU A;  2FBX A;  1XC9 A;  4CFD A;  1KTQ A;  3OVN A;  2I5J A;  3CG7 A;  4DTP A;  4B9T A;  1TGO A;  1S9G A;  4AIL C;  4HHT A;  1T7P A;  1HNV A;  4LSL A;  2GBZ A;  2WON A;  4LY7 A;  2IAJ A;  5SWM A;  3OS1 A;  3KLG A;  4W5N A;  1NK8 A;  4CJR A;  3FFI A;  3KKS A;  4CJ3 A;  1KCF A;  3HP9 A;  4K8Z A;  2IGI A;  4Z4F A;  4OKK A;  4I9L A;  1C0T A;  1YT3 A;  3AVM A;  1KFS A;  1EKE A;  1VSJ A;  4M3R A;  3V1R A;  4G1Q A;  4KAZ A;  4KTZ A;  3B6O A;  4CFA A;  4FJ9 A;  4R5P A;  1QQC A;  1WLJ A;  4H4M A;  5CZ2 A;  2IDO A;  3AVK A;  1B92 A;  1C1C A;  4RW4 A;  2QKK A;  4CJF A;  4DFJ A;  4LH4 A;  3QEI A;  3V1O A;  1LAV A;  4DTS A;  2YV0 X;  2XHB A;  3DLR A;  4DQQ A;  2QKB A;  4CES A;  3MXI A;  3OYM A;  4BDP A;  1TAQ A;  2D0A A;  4Q0B A;  3O3G A;  3NE6 A;  1GOB A;  4DFK A;  4B9M A;  4CGJ A;  2HHQ A;  3MXJ A;  4E3S A;  3DLK A;  4FJK A;  1J5O A;  1NK4 A;  1BQN A;  3AVJ A;  3QIO A;  4Y1C A;  3K57 A;  3BGR A;  1I39 A;  3NCI A;  3SQ4 A;  4KHY A;  4KRF A;  1LWE A;  4L8R B;  2DY4 A;  3AVL A;  4LSN A;  4N5S A;  4C8O A;  2ETJ A;  4M3U A;  4LH5 A;  5J2N A;  3ALY A;  1RNH A;  3AVG A;  3DLE A;  2HB5 A;  4Y1D A;  1VSE A;  5FRM A;  2QK9 A;  1C1B A;  4CHY A;  4FJN A;  2DFF A;  4TSX A;  4CJ5 A;  1UAX A;  4E89 A;  5J1E A;  3QNN A;  4E0D A;  4CHZ A;  3WNH A;  2IS3 A;  2B4J A;  2PYJ A;  5I3U A;  3AVI A;  4CGI A;  4AHC A;  3M8S A;  5HRR A;  2Z1J A;  4FLY A;  1XI1 A;  4PA1 A;  4OPK A;  3OS2 A;  1XWL A;  2KW4 A;  3OYI A;  4Z4E A;  4NCA A;  3OS0 A;  3DLH A;  2JLE A;  3PY8 A;  1U04 A;  3LAL A;  2HNY A;  3HPO A;  4FLT A;  4DWI A;  4PQU A;  3LP2 A;  4O4G A;  3AA3 A;  3C6T A;  3OY9 A;  4HCC A;  1U4B A;  3NAE A;  2XY5 A;  1ASU A;  3RMD A;  3P1G A;  1JL2 A;  3OYD A;  5HLF A;  3E01 A;  1KVA A;  1QE1 A;  2YNG A;  4CJP A;  3VQ5 A;  3EY1 A;  2XRI A;  1NK6 A;  3DRS A;  4FW1 A;  4O5B A;  1NJW A;  3QES A;  4C8N A;  3ZT2 A;  1IKV A;  2GUI A;  4W5R A;  4FK0 A;  3HJF A;  1DTQ A;  4FVM A;  3P5J A;  1XHZ A;  4DSE A;  4CJK A;  1SL1 A;  1D9F A;  2PYL A;  3LP1 A;  4FJM A;  4CIG A;  4DTU A;  3L2R A;  1QHT A;  3TAM A;  4FZZ A;  1W9H A;  2WOM A;  3LPU A;  4FLX A;  3KTQ A;  2D0B A;  2P5O A;  1K6Y A;  3HO1 A;  4W5T A;  5C25 A;  2HHS A;  4CGF A;  1NKB A;  2Z1I A;  4WE1 A;  3NH2 A;  3OYH A;  5HRO A;  1J9A A;  1DLO A;  3KIO A;  3LZI A;  1Z25 A;  3LP3 A;  4KHN A;  5DK5 A;  4E19 A;  1RT1 A;  1BIZ A;  2O4G A;  3MEE A;  3LAK A;  4EP4 A;  4O44 A;  1VSF A;  1SUQ A;  3CFO A;  4KB0 A;  2RF2 A;  4Z0U A;  3TI0 A;  1S9E A;  3T19 A;  3SJJ A;  1LV5 A;  2HVI A;  2ITG A;  4GW6 A;  5SZT A;  4DLG A;  4OGE A;  2R7Y A;  4DTJ A;  4IFV A;  3ITH A;  5KGX A;  4IDK A;  4C8M A;  3K59 A;  4DU1 A;  1NKE A;  4C8K A;  3DOK A;  3TAG A;  4KI4 A;  3AVB A;  3NDK A;  1NKC A;  4AHS A;  3OYF A;  4KTQ A;  3M8P A;  3NBP A;  4F4K A;  4JLH A;  4CEC A;  3K5M A;  1RT6 A;  4J2B A;  1CZ9 A;  1VRT A;  2RPI A;  4BE2 A;  3MEC A;  3U3Y A;  1W0H A; 
#chains in the Genus database with same CATH topology
 3DWL A;  2B6A A;  2VG6 A;  1IO2 A;  5KQD A;  1T3V A;  1BWF O;  3CI5 A;  4CJV A;  4A57 A;  2A6A A;  3QEW A;  4H03 B;  4H0Y B;  4QS9 A;  2P9N A;  3M8Q A;  4GNI A;  4JRP A;  4DMN A;  1BCM A;  3MN6 A;  4CW7 B;  4JI4 K;  4N47 A;  2Y1I A;  3RMC A;  3H46 O;  3QO9 A;  4OKE A;  4DSF A;  5AZI A;  4FXD A;  3O9U A;  2Z1G A;  5AQG A;  1T44 A;  1EWR A;  3L3V A;  4YFU A;  1FXX A;  4AF1 A;  1U47 A;  2OZM A;  2QWP A;  1CZB A;  3C95 A;  1L5U A;  3GL1 A;  4YOT A;  4FZY A;  1BHL A;  2BTF A;  3H3N O;  2FBY A;  1B9D A;  3D0P A;  1KLN A;  2KFN A;  3VN5 A;  4A2B A;  5KI6 A;  4K41 A;  2GTD A;  4Z4C A;  4JKB A;  3HM8 A;  4B3O A;  3CQX A;  3ZYY X;  1X3N A;  1KAY A;  5AQT A;  3CJ7 A;  2O8C A;  4JS5 A;  2V51 B;  4CF0 A;  3TAE A;  4CD1 A;  1JCF A;  3IDH A;  3CMA N;  4F2R A;  2O8D B;  1IKX A;  4FJG A;  3CM5 A;  4CHP A;  5FRM A;  5JS2 A;  3HM9 A;  4M42 A;  3G25 A;  3S3M A;  3ZET B;  4PHT X;  1HPM A;  4K42 A;  1ASW A;  4EIA A;  3HP6 A;  2QEX N;  4ZTJ A;  4YNQ A;  1VQ6 N;  3EYZ A;  4F3T A;  2W6L A;  2J4R A;  4DR4 K;  2ASO A;  1VSM A;  2NRV A;  4H8K A;  1KRP A;  4NLB A;  3L2V A;  5M1P A;  4YOY A;  5AQZ A;  2W42 A;  2P9L B;  5LJW A;  2BE2 A;  4JKH A;  4CK3 A;  1DT9 A;  4MLE A;  4IWV A;  4B9L A;  3NMU A;  1UWB A;  1TKT A;  1RBT A;  3NVK A;  4BVP A;  3K2P A;  4WYB A;  3S3N A;  1TYQ B;  2UYT A;  3WQU A;  5LMN K;  3BY5 A;  5DM6 L;  3AA4 A;  1GLA G;  4ZHR A;  3VQC A;  2XO7 A;  4LFC K;  5TKW A;  3TSP A;  2JWK A;  2FXU A;  4O0J A;  5AQI A;  4BRI A;  3Q7B A;  4CF1 A;  3C94 A;  4XEI A;  1NGH A;  3NF6 A;  4ID1 A;  3JSM A;  4J8F A;  3QEX A;  2P9P B;  2QM1 A;  4CZL A;  5DM7 L;  1C0F A;  4JKD A;  3A5L C;  5M1Q A;  2BDP A;  3ULE A;  3RRH A;  4CJ4 A;  4MFB A;  1VSI A;  2E4L A;  3AA2 A;  3HTV A;  4KPY A;  5AR0 A;  4C23 A;  3O4Q A;  2DFH A;  4IBN A;  1RBR A;  4IO8 A;  3CCL N;  3TAN A;  4ILH A;  4IXC A;  2QTD A;  1NJZ A;  4E7J A;  1IG9 A;  5GIO A;  4ZTF A;  1C0M A;  4DTN A;  4BRP A;  1HJO A;  3LDQ A;  4CE9 A;  5BPM A;  3LZJ A;  5IT9 O;  1QVG M;  2F96 A;  3TR8 A;  3NH0 A;  3V9X A;  1VQL N;  4CIF A;  3CIP A;  1XNR K;  1S3X A;  1SKS A;  3P83 D;  1CLQ A;  3H45 C;  3T1H K;  3VGK A;  4FOE A;  3ATU A;  3ZT1 A;  3CJ9 A;  1WSG A;  1OH5 A;  5C0Y A;  1WNS A;  1X9J A;  4CFB A;  2XY6 A;  1YI2 N;  3WXK A;  2HBJ A;  2E88 A;  2FSN A;  3VQA A;  4FLU A;  4QS7 A;  2ZJQ L;  1P90 A;  4KO0 A;  4DFP A;  2Q1N A;  3GBT A;  1O1W A;  3D2F B;  3TTF A;  3CPW M;  3VEN A;  1VSL A;  1BOT O;  2O4I A;  1BO5 O;  2YHA A;  4JI8 K;  2BGG A;  2G8I A;  3OA9 A;  1VQP N;  3QLH A;  1DGK N;  4BG8 A;  1TAU A;  4JK8 A;  3EO3 A;  5C24 A;  4WQ5 A;  2X6N A;  4OKJ A;  4JI7 K;  1Q9X A;  2QWR A;  5FRN A;  2KZZ A;  1NGG A;  2YCH A;  3ZSZ A;  4CJL A;  4A59 A;  2B5J A;  4DQR A;  5D3G A;  1NJY A;  2A42 A;  5GAH P;  4RW6 A;  4O0I A;  1TK5 A;  1XUP O;  3O5B A;  3AGK A;  4FWK A;  1RTD A;  2O8B A;  4BRH A;  4DF4 A;  3MN9 A;  4EP5 A;  1GOC A;  2IVP A;  5KRS A;  4I7F A;  4OO1 J;  3C6H A;  3K5O A;  5LMU K;  3K0S A;  4OLA A;  3TAP A;  3ZSW A;  3RTV A;  3JAM O;  3C7N B;  2E2O A;  3JXU A;  1EQY A;  1S1W A;  1L3U A;  4CZH A;  4CJ7 A;  1QSS A;  4YY3 K;  2VWK A;  4CHN A;  1ZBH A;  1HLU A;  2YX6 A;  3C6A A;  2ZF5 O;  4BC2 A;  1BDG A;  1KVB A;  4M3X A;  4IDH A;  4EZ9 A;  3QEV A;  3CC2 N;  3DXK B;  4DB3 A;  3DRR A;  4DS5 A;  2WC9 A;  3MXM A;  5GIP A;  1TKD A;  2F7T A;  1ATR A;  4Z4G A;  1M90 O;  4CFC A;  2P9U B;  1D8Y A;  4H5T A;  3OYK A;  3SV3 A;  3PX6 A;  4B9U A;  1GOA A;  1LCU A;  3U9D A;  1RT7 A;  2YHB A;  3BEX A;  3OJU A;  1VQ5 N;  4WQ5 C;  4JI0 K;  4BQL A;  4N41 A;  2FBV A;  4PL8 A;  2O8E B;  4CEO A;  5CY4 A;  4CK1 A;  2E6L A;  1Y97 A;  3ZLJ A;  3DLL L;  1NK0 A;  2HHU A;  3VQB A;  3PUF A;  1Z05 A;  3S9H A;  3L2U A;  3KD1 E;  1NK5 A;  3M6G A;  1TK8 A;  3NHG A;  4I6M A;  3ZSX A;  4FWR A;  3FLC O;  5FLX O;  2EHG A;  3THY A;  3V9W A;  2P1J A;  2QXF A;  2IVO A;  3C65 A;  3O4W A;  4GV9 A;  1NLV A;  1LW2 A;  2D0P A;  3V9Z A;  4A61 A;  4BRC A;  3CJC A;  2AA4 A;  3TSU A;  1JLQ A;  2G8V A;  3LP0 A;  4F2S A;  4ELT A;  4Z4I A;  5AZI B;  4CFD A;  4B9T A;  1S9G A;  1HNV A;  1RDU A;  2GBZ A;  5ADX A;  5JLH A;  5SWM A;  3KLG A;  1W2B M;  4W5N A;  3LDN A;  4CJ3 A;  5AQF A;  2GX9 A;  4Z4F A;  3EL2 A;  2A5X A;  3AAQ A;  3V1R A;  4O8U A;  4KAZ A;  2O8D A;  3B6O A;  1QZ5 A;  4CFA A;  4WFA L;  2IDO A;  3LDO A;  1QVF M;  1B92 A;  3O9R A;  2QKK A;  4CJF A;  4LH4 A;  1HKG A;  3LDL A;  2XHB A;  4DQQ A;  3ZET A;  2W41 A;  4BDP A;  2O8C B;  1V4T A;  3DLK A;  4WF9 L;  4FJK A;  2D1K A;  1J5O A;  1NK4 A;  4MO5 A;  3BGR A;  4KHY A;  4C8O A;  2WFB A;  5LJV A;  4LH5 A;  2NZT A;  3EZW A;  3ALY A;  1K9M O;  2ZWH A;  4Y1D A;  5J1E A;  4CHZ A;  1HNX K;  1CZA N;  2B4J A;  2Q0U A;  4YDU A;  4CGI A;  1ESV A;  4AHC A;  1WB9 A;  2Z1J A;  4HTL A;  3J80 O;  4FLY A;  1XWL A;  3OS0 A;  3DLH A;  2JLE A;  1VQ7 N;  1U04 A;  2WUS A;  3PY8 A;  1EO1 A;  4FLT A;  5BR9 A;  4PQU A;  3A0I X;  3I56 N;  4HCC A;  3WT0 A;  2HOE A;  4FWN A;  3SK3 A;  3OYD A;  3O9T A;  3VQ5 A;  4M7X A;  4FW1 A;  4EAH D;  1JCE A;  3QES A;  2UU9 K;  4FK0 A;  4O8K A;  1N33 K;  2GUI A;  5I9E B;  2PYL A;  3LP1 A;  4B3T K;  4CIG A;  4DTU A;  1KC8 O;  1NGE A;  1W9H A;  4PKI A;  3VEO A;  1K6Y A;  2HHS A;  3L0Q A;  3LZI A;  1Z25 A;  3LP3 A;  4KHN A;  1S22 A;  1BUP A;  1RT1 A;  2P9K A;  1BIZ A;  3LAK A;  4EP4 A;  2CGL A;  2D4W A;  5FPN A;  3TI0 A;  3SLC A;  3SJJ A;  2FLO A;  2CGJ A;  5SZT A;  2GEM A;  4IDK A;  3K59 A;  4C8K A;  3DOK A;  1N8R O;  3NDK A;  4AHS A;  4YOV A;  2Q2R A;  4F4K A;  4JLH A;  3ULE B;  4CD3 A;  2HHW A;  3AVA A;  4KBO A;  3VES A;  3ULD A;  1N32 K;  1WAJ A;  4DQ8 A;  5KTQ A;  1N5Y A;  1HKB A;  5EU7 A;  1ZBU A;  4NCB A;  5AQS A;  4ICL A;  2IOC A;  4KV8 A;  2O8F A;  5KQ8 A;  3PIO L;  2HND A;  4DTR A;  3P4I A;  4JI3 K;  2F9T A;  2A41 A;  4BAC A;  1X9S A;  3O6W A;  3BZC A;  3ID6 A;  4DS4 A;  4M3W A;  2HVH A;  1SQK A;  4H4O A;  3CCR N;  3ENB A;  4EZ6 A;  1WSJ A;  4FWO A;  1HYZ A;  4B8C A;  2F8S A;  5LL6 Z;  4CEE A;  3F5T A;  3HPG A;  4CGG A;  5BRH A;  2FSK A;  3EN9 A;  1EP4 A;  1NGF A;  3IAY A;  3D7E O;  1OVY A;  4KH4 A;  1MA9 B;  1OKJ A;  4CVN E;  3L2Q A;  4FWQ A;  4DQI A;  2A1R A;  4KHU A;  3NGZ A;  4YOX A;  4H0O A;  1RBV A;  2KHO A;  3BUZ B;  4PWD A;  2E5L K;  5ELZ A;  4NO7 A;  4M63 C;  1NK9 A;  3O4N A;  4DLE A;  1HRH A;  4H5W A;  1NJX A;  3CD6 N;  1T8E A;  1BIU A;  4BRM A;  2E8A A;  4LD0 A;  1U48 A;  3CM6 A;  2QXL A;  3QIN A;  3HSC A;  4NYN A;  3S3O A;  2KFZ A;  2HHH K;  4N56 A;  4V19 S;  3GOI A;  4W5O A;  3NH1 A;  4CHO A;  3IUC A;  3CET A;  4I2P A;  2G8U A;  3HZ6 A;  4JK7 A;  2F4V K;  2O8B B;  1S1U A;  3E1Y A;  3AVC A;  3AAR A;  4CZI A;  4CCH A;  3ZX2 A;  3PV8 A;  4DG1 A;  4CIE A;  3CCS N;  1RBS A;  3CF5 L;  4CZE A;  3WUH A;  4FVU A;  4FWS A;  5M1K A;  3MDQ A;  4M41 A;  3OYL A;  2UUB K;  3HK2 A;  3VEX A;  3DXK A;  4E1N A;  3E9P A;  4DF8 A;  3VF2 A;  4CJS A;  1GLE G;  1HNI A;  1W97 L;  5JVG L;  1X9W A;  4KHS A;  4B8A B;  1NOY A;  1JLF A;  1TL1 A;  2QWL A;  3SQ0 A;  5AFU A;  2QWO A;  1DEJ A;  1RDC A;  4DV5 K;  4B08 A;  1QSL A;  1LW0 A;  2KZM A;  4FJ5 A;  1YTU A;  2O8E A;  4XH5 A;  3AY9 A;  3SNN A;  3AO2 A;  5GAD P;  3KK1 A;  4JKF A;  4B9N A;  5BPN A;  4K43 A;  3VQ8 A;  4J2D A;  3KD5 E;  4XH4 A;  2HHT A;  3ZX3 A;  4QCL A;  2OTJ N;  3WNE A;  3EE8 A;  3NGI A;  4DTM A;  3ZT3 A;  4QAG A;  3PO5 A;  1NGC A;  1ILY A;  4LFB K;  3R3L A;  2BUP A;  1TUU A;  2OCE A;  4I6M B;  5KGW A;  1NMN A;  3H3O B;  2G8W A;  4BGA A;  3A5N C;  3THY B;  2V52 B;  4DR1 K;  4EHU A;  3OYN A;  1YJW N;  5E41 A;  2A40 A;  2GEL A;  3H1V X;  2RKI A;  4CZJ A;  3KK3 A;  4KH6 A;  3I0R A;  4FW2 A;  1RDW X;  1D9D A;  4FM0 A;  1JLB A;  2E1Z A;  2VGM A;  4CJT A;  2BAN A;  2WTU A;  4K25 A;  1G15 A;  2BH1 A;  4IKF A;  1JLC A;  3SJH A;  2UXB K;  3THX B;  2OA8 A;  4KRE A;  4Z4H A;  3V9U A;  3CCE N;  4M7Y A;  2ZQB A;  3B8A X;  1HNZ K;  3OYG A;  1KFD A;  1EX4 A;  4RW8 A;  4XH1 A;  3SPY A;  2PBD A;  4FJI A;  4Z94 A;  3KJV A;  5EOY A;  2UUA K;  3O9Q A;  5CYQ A;  3ZT4 A;  1RT4 A;  4DQS A;  1ZC6 A;  3TTD A;  1NGJ A;  2P9S A;  4ELV A;  3LWL A;  4BR2 A;  4DV3 K;  4PKH A;  3VPZ A;  4K8X A;  1ASV A;  4HUE A;  1QQN A;  2NRT A;  3K58 A;  4B9S A;  3O80 A;  3O1B A;  4FM1 A;  3SQ1 A;  1MU2 A;  3H6E A;  1RCH A;  3FE1 A;  3OBW A;  3VQ6 A;  1L3T A;  1XHX A;  3U4L A;  2ZJR L;  1XC3 A;  3U6F A;  3TPQ A;  2D0O A;  1QTM A;  3CER A;  4M3T A;  4RTF D;  4C1N I;  1KLM A;  3J7Y P;  4OPH A;  4DSL A;  1RTJ A;  2D0C A;  4CZM A;  4B3M K;  4DKW A;  4ILG B;  3ZSR A;  3HVR A;  3UIQ A;  2VQF K;  1JXE A;  5MLC Q;  2RE2 A;  3CJB A;  4BRA A;  2YHX A;  1VK0 A;  4LFA K;  1WSI A;  4DR3 K;  3FR0 A;  3DOL A;  2ZD1 A;  3AAP A;  1I94 K;  2VG7 A;  2P9K B;  3VEZ A;  1S1X A;  1NGB A;  3MWP A;  3AO5 A;  4KFB A;  2KKZ A;  3GDQ A;  3F2K A;  4DV4 K;  1KD1 O;  2FF3 B;  3ISN C;  1YAG A;  2G8K A;  1ZBF A;  4E1J A;  1LWC A;  4GV6 A;  2ZGZ A;  2KQ2 A;  5GAG P;  1TUY A;  4BWJ A;  4HCB A;  4FOI A;  1S72 N;  1TK0 A;  1NG9 A;  4RW7 A;  4AHR A;  5JIC A;  1YHQ N;  2YI1 A;  3NFA A;  3CME N;  3C6U A;  3K5L A;  3G6E N;  3WXM B;  2QW9 A;  2YHW A;  1GLJ O;  1W7A A;  3PX4 A;  2O8F B;  4FJL A;  3VTH A;  1IH7 A;  3WXJ A;  1J53 A;  4CGH A;  4NB4 A;  3SPZ A;  3O9S A;  1NM1 A;  2E2P A;  3WXL A;  4BRQ A;  1KTQ A;  2I5J A;  3ID8 A;  1TGO A;  1T7P A;  4B1Z A;  2WON A;  1SS6 A;  1NK8 A;  4LF5 K;  3KKS A;  4JHD B;  3OHR A;  5BRF A;  1KCF A;  3HP9 A;  4K8Z A;  4UY8 O;  4OKK A;  4YHH K;  4I9L A;  3AVM A;  1KFS A;  1VSJ A;  4G1Q A;  3O8M A;  5AQM A;  1WLJ A;  4BC4 A;  3HOT A;  1K8K A;  5C2D A;  4DFJ A;  1WOQ A;  4BRN A;  4DR2 K;  4JV5 K;  3OYM A;  3QB0 A;  1XNQ K;  1GOB A;  4B9M A;  2ASM A;  4CGJ A;  1OH7 A;  4BRE A;  1BQN A;  1DKG D;  4BR5 A;  3QIO A;  4Y1C A;  3NCI A;  1LWE A;  3AVL A;  4M3U A;  5AQY A;  1RNH A;  3AVG A;  1E4F T;  3DLE A;  2QK9 A;  1D4X A;  4CHY A;  4TSX A;  4CJ5 A;  3QNN A;  2PYJ A;  4L3Q A;  3OS2 A;  5AZJ B;  1QQM A;  5M1N A;  4NCA A;  3LAL A;  1NBW A;  5E26 A;  3A8Y A;  3LP2 A;  4O4G A;  3AA3 A;  3D2E A;  5GIN A;  1V4S A;  2Q31 A;  3P1G A;  4GV3 A;  1BU6 O;  4U7B A;  1KVA A;  1QZ6 A;  2YNG A;  4CJP A;  3BZK A;  1NK6 A;  3DRS A;  3M3Z A;  1NJW A;  2VGN A;  4C8N A;  1DTQ A;  3P5J A;  1XHZ A;  3O1W A;  4FZZ A;  4JAX A;  4LF9 K;  2H3G X;  3TU5 A;  2P5O A;  4W5T A;  4CGF A;  2V7Y A;  1XMQ K;  4WE1 A;  5HRO A;  5DK5 A;  2W6K A;  4E19 A;  4CZK A;  4JKA A;  3VGL A;  1VSF A;  1SUQ A;  2RF2 A;  5EXW A;  4Z0U A;  1S9E A;  2HVI A;  4H0V B;  4GW6 A;  2HF3 A;  4OGE A;  3KK7 A;  2R7Y A;  3QBW A;  5KGX A;  4C8M A;  4DU1 A;  4KI4 A;  1NKC A;  4BRG A;  2QI2 A;  4KTQ A;  3M8P A;  3NBP A;  3G4S N;  1O13 A;  3K5M A;  1RT6 A;  3EKS A;  4BE2 A;  3U3Y A;  4DSJ A;  5HOO A;  5KRT A;  3LDS A;  2NRZ A;  3D6R A;  4NLC A;  3Q7C A;  4FK2 A;  1VQ9 N;  4E7H A;  4RG8 A;  2E1Y A;  5KPZ A;  1TKZ A;  3M8R A;  1MDU B;  1FKO A;  3VA3 A;  1S5J A;  3ZSY A;  1C6V A;  3J8A A;  4BRL A;  2HHV A;  3WEE A;  5AQH A;  3V6D A;  2P9I B;  1YVU A;  2DFE A;  1Q9Y A;  3THX A;  4UQG A;  4FJH A;  3PSF A;  2P51 A;  2P5G A;  3QDK A;  1Q7Y O;  1YTA A;  3HYF A;  1BL3 A;  1OVQ A;  3ZX0 A;  1VSK A;  2ZJP L;  3KLE A;  5AQR A;  1Z26 A;  1HUX A;  3DRP A;  5EVZ A;  3L4I A;  2ATQ A;  2YKN A;  2CH6 A;  4X64 K;  1WAF A;  3LWM A;  3CXC M;  3B6P A;  3F9K A;  2HMI A;  2KTQ A;  4Q5V A;  1HYV A;  1RTH A;  3ATV A;  3ZT0 A;  3KLF A;  3MMV A;  4CED A;  2Z1H A;  5ADX H;  3SAF A;  3THW A;  5AJ3 K;  1RTI A;  2YNI A;  3SUQ A;  3UE5 A;  3D45 A;  3U8X A;  4DU4 A;  3SCX A;  3LAN A;  4KKO A;  1QSY A;  1R59 O;  3ENO A;  2P9S B;  3T1A A;  3LM2 A;  1WSF A;  1KVC A;  3TSQ A;  1YVN A;  2AJQ A;  4CZG A;  4BR0 A;  1J5E K;  4HUF A;  1RIL A;  4CF9 A;  4DV7 K;  3N4P A;  2A3Z A;  3ENH A;  5J2M A;  1KSP A;  3OYC A;  4A62 A;  1RFQ A;  4JI2 K;  1SV5 A;  5J2Q A;  2D5R A;  1J6Z A;  4IG0 A;  3SI6 A;  2OPS A;  4LF4 K;  3SBG A;  2VWB A;  3CYM A;  1RT3 A;  1X3M A;  4CEF A;  3J7Z O;  5JS1 A;  5AQK A;  1C0U A;  4JN4 A;  3FFK B;  3RMA A;  4U67 L;  3CCV N;  3HOS A;  1F21 A;  4CZF A;  1EET A;  3AVH A;  3QFU A;  4DHY A;  1UA0 A;  1JL1 A;  2UXD K;  2KLA A;  3I8B A;  5HRP A;  4O55 A;  1LAW A;  3V9S A;  4DQP A;  4KB1 A;  4MDB A;  1BGX T;  3THV A;  3OYE A;  4E7L A;  3GG4 A;  4IJA A;  4YDU C;  2OAN A;  4DSI A;  3RVC A;  4JRQ A;  3GE1 A;  4OLB A;  1VHX A;  3DLG A;  1KAZ A;  1T6C A;  1U45 A;  3WXI A;  1ZBL A;  1LWF A;  2I7N A;  3K9K A;  4AHU A;  3CCQ N;  4O5F A;  3KLI A;  3F73 A;  1U6Z A;  1N34 K;  2HMP A;  1NU0 A;  4JHD A;  5K14 A;  2HNZ A;  4IOC L;  4CI6 A;  1HMV A;  3TWH A;  1VQK N;  2ZGY A;  5B8H A;  1I3A A;  1C0G A;  2FF6 A;  2OPQ A;  3AO1 A;  2VYP A;  2Y1J A;  4GMJ B;  4H0X B;  3SUP A;  5CYM A;  3DI6 A;  4I9Q A;  3MK6 A;  3VQ4 A;  2W40 A;  1REV A;  3TAQ A;  5H1S Q;  5HL7 L;  1ITG A;  3KK2 A;  2E20 A;  4BR7 A;  4J2E A;  3O3H A;  3MN7 A;  1K8K B;  4F8R A;  5C12 A;  4PL7 A;  4C1N K;  1GLL O;  1BI4 A;  1WUA A;  3AVF A;  3CFP A;  3CQ8 A;  4MLH A;  4LF7 K;  1NK7 A;  2NRX A;  3V4I A;  1Q82 O;  1IBL K;  3RMB A;  3NF7 A;  3AO4 A;  1SAZ A;  2PZS A;  1HPZ A;  3IRX A;  4CHQ A;  1JLG A;  4AM6 A;  5C42 A;  5AZJ A;  3A5O C;  3PIP L;  3I55 N;  4G9Z A;  2YNH A;  4RCH A;  1RT5 A;  1YXQ A;  4CBW A;  2E2Q A;  2ASP A;  4EHT A;  1QQO A;  5HRS A;  2ZE2 A;  1WBB A;  4FZX C;  3DMJ A;  3TAB A;  4QOZ B;  4W5Q A;  3QER A;  3QML A;  4QS8 A;  3TAR A;  5AQV A;  1RBU A;  1WBD A;  4FJ8 A;  3VQP A;  3DJC A;  4IG3 A;  3RRG A;  2RN2 A;  1NOZ A;  1FK9 A;  2Q36 A;  3SV4 A;  2DTU A;  3D2E B;  5C2F A;  1YIT N;  3SMP A;  4IEE A;  1IG8 A;  1RDA A;  3G71 N;  4CGD A;  1JCG A;  1BCO A;  1JXB A;  3V1Q A;  3CPE A;  3R8E A;  4JI1 K;  3R6M A;  4A5B A;  1OH8 A;  4DV6 K;  3CCU N;  2I7P A;  1Y64 A;  3E9L A;  3SYZ A;  2Q3S A;  4FLW A;  4AHV A;  3UKU A;  5T7B A;  1L3S A;  2EWS A;  2HBK A;  3A2F A;  5HP1 A;  4ISF A;  4GVM A;  2HW3 A;  1Q81 O;  3RWU A;  1SKR A;  5HBM A;  1WSE A;  1U2V A;  4KH5 A;  1FKP A;  4FO0 A;  2HST A;  4IJN A;  3W3D A;  3L3U A;  4JD2 A;  3KWG A;  4JYA K;  4X62 K;  3MWT A;  3W0L A;  4ILJ A;  4B3S K;  2ZM6 K;  4F3O A;  3SBT A;  4JKE A;  3SUO A;  5E84 A;  5IWA K;  1S6Q A;  4PKG A;  4X66 K;  3OYB A;  3SUN A;  5F1X A;  3KLH A;  3HXM A;  3KHY A;  4NXM K;  4FYD A;  1K73 O;  5AFU H;  2X6S A;  2FSJ A;  3KKR A;  2CGK A;  3LAM A;  3VQD A;  3AA5 X;  1X1P A;  1ATN A;  4DSK A;  3WNG A;  5FPE A;  5M1O A;  2P9I A;  3G0Z A;  1E3M A;  1RDD A;  5KPT A;  3HL8 A;  5AQU A;  4H0P A;  4MQ3 A;  3IG1 A;  4JKG A;  2VWJ A;  3LDP A;  1S1V A;  2YJE A;  5EY4 A;  4FSV A;  2YHY A;  3P39 A;  3WEE B;  2GUP A;  1XC9 A;  4AIL C;  4DR6 K;  4LSL A;  5F0X A;  3J7A P;  3VEW A;  4H5V A;  3K9J A;  4CJR A;  3FFI A;  3VOV A;  1P8Z A;  2IGI A;  1XQS C;  3FZM A;  4DV2 K;  1QQC A;  2HBM A;  4H4M A;  1C1C A;  4RW4 A;  3UKR B;  1XMO K;  3V1O A;  1LAV A;  4B1V A;  2YV0 X;  4FPB A;  4DV1 K;  1OH6 A;  3J81 O;  4BY9 C;  3BP8 A;  3MXI A;  1H1V A;  4BR4 A;  4BVO A;  3O3G A;  3NE6 A;  3MCP A;  3MXJ A;  3CCJ N;  2AP1 A;  3SQ4 A;  3K57 A;  1I39 A;  4KRF A;  4A2A A;  1YJ9 N;  3THW B;  2DY4 A;  4LSN A;  5A2Q O;  2QWN A;  4R79 A;  1FW6 A;  5BPL A;  3M1F A;  4BGB A;  1C1B A;  1NJI O;  4FJN A;  4CBX A;  3FZK A;  4E89 A;  3BF1 A;  4E0D A;  2IS3 A;  4IZ9 A;  3AVI A;  4HWI A;  4K0K K;  1NGD A;  3M5R A;  1XI1 A;  4PA1 A;  4IOA L;  3HPO A;  5JMV A;  1MWK A;  3KZB A;  2VCP A;  4BRD A;  3NAE A;  3QBX A;  2XY5 A;  4IOX A;  5HLF A;  4ISG A;  1QE1 A;  3T7Z A;  1IJJ A;  3CC4 N;  4O5B A;  4FWP A;  1IKV A;  4DSE A;  4CJK A;  1D9F A;  3R9P A;  3L2R A;  4OPA A;  3TAM A;  1VQ8 N;  4FLX A;  3EEQ A;  2D0B A;  1VQM N;  3OYH A;  1J9A A;  1DLO A;  5GAE P;  4JI6 K;  5AQO A;  3L6Q A;  4O44 A;  4DLG A;  4DTJ A;  3VF6 A;  3AVB A;  3OYF A;  4AM7 A;  4CEC A;  4J2B A;  1VRT A;  2RPI A;  3MEC A;  3ZEU A;  3AVN A;  4A5A A;  4JS4 A;  1SL0 A;  3QET A;  5JLF A;  4X65 K;  2F9W A;  5FPM A;  3VA0 A;  1N6Q A;  1EXQ A;  2LSN A;  3SZ2 A;  2PY5 A;  1M1K O;  4J2A A;  4KHP K;  4BC5 A;  3K5N A;  4DU3 A;  1R0A A;  2F8T A;  4AQY K;  4OJR A;  4WFB L;  1LOT B;  3DXM A;  3JYT A;  3MED A;  2FC0 A;  3F9M A;  4BG9 A;  1T6D A;  1ZBI A;  3HST B;  5FDL A;  1UA1 A;  4WCE L;  5EX5 A;  1IKW A;  5AQQ A;  4B1X B;  3T1Y K;  1S1T A;  2NRW A;  3BDP A;  2OPP A;  4XIU A;  1RGI A;  4KHW A;  2IIR A;  4CF8 A;  1VQO N;  3PX0 A;  4GVE A;  5FRO A;  1U49 A;  3OYA A;  1YJN N;  1Z6R A;  3MX5 A;  3N4Q A;  3O3F A;  4GKJ K;  4CEQ A;  4E7K A;  2NUB A;  3ZSQ A;  1T03 A;  3VTI A;  3OBY A;  3QNO A;  1DTT A;  1BI4 B;  1ZBS A;  3VQQ A;  2NLX A;  4FJJ A;  4BRF A;  3RSE A;  3BF3 A;  3VET A;  3ASM A;  4GY2 B;  1HYS A;  1VQ4 N;  4I2Q A;  4FWM A;  2GV9 A;  3CCM N;  5LY3 A;  1JLA A;  4OPJ A;  2YJF A;  2OPR A;  3HVT A;  3KVG A;  1TVR A;  1L3V A;  1CXU A;  3EZ5 A;  3AGR A;  3QIP A;  4OVL A;  4FJX A;  5M1F A;  4ELU A;  3NGY A;  5J2P A;  3MX2 A;  4M45 A;  2CH5 A;  1E4G T;  4B1Y B;  4HTU A;  4NYF A;  4C8L A;  3VEV A;  2X74 A;  3CFR A;  4BR9 A;  1C1A A;  1VSD A;  4EFH A;  1CXQ A;  3KWI A;  3MCA B;  2IC3 A;  4DR5 K;  4FCY A;  1JKH A;  1J54 A;  3NF8 A;  3UKU B;  3NVM A;  4DUY K;  1U2V B;  2Q97 A;  1IKY A;  4JD2 B;  4DTO A;  3MEG A;  1BIS A;  2XY7 A;  4MDA A;  4LF8 K;  3VEY A;  4FLV A;  4IFY A;  5F2R A;  5AQJ A;  1YUW A;  3SMS A;  4KHQ A;  4IFE A;  4JK9 A;  4B1U B;  5BRE A;  5HRN A;  1BQM A;  2HBL A;  3I0S A;  5C10 A;  1K8A O;  3HPH A;  2GWK A;  2QA4 N;  1BG3 A;  5AQX A;  1UOC A;  5CZ1 A;  3WNF A;  3CJ1 A;  4AH9 A;  3H1Q A;  3PSI A;  4N76 A;  3FGU A;  1TKX A;  2HF4 A;  4JI5 K;  4BE1 A;  3ZCM A;  4AHT A;  3VQ7 A;  4FPA A;  4WFN L;  4BE0 A;  2HHX A;  2WBN A;  1S6P A;  1SKW A;  1HNW K;  1HKC A;  4E1M A;  2P9N B;  1Q18 A;  2EX3 A;  3CJA A;  1X9M A;  3MN5 A;  3R1X A;  4JKG B;  1A5W A;  1JJ2 M;  2E6M A;  1GLD G;  2UXC K;  3DLB A;  4BC3 A;  4YOR A;  2DPN A;  4E7I A;  4M3Y A;  3VER A;  1FJG K;  3AV9 A;  4DUZ K;  1N36 K;  4CJW A;  3QEP A;  3UKR A;  5CR4 A;  4FLZ A;  3OW2 M;  4CJQ A;  3HBT A;  1T05 A;  2OYQ A;  4LF6 K;  1Q8I A;  4M3Z A;  2G8F A;  4WQ4 A;  3V81 A;  4FJ7 A;  4DCH A;  1TL3 A;  3H08 A;  5DMR A;  4JNE A;  1HQE A;  3U3G A;  1ZXO A;  4CJE A;  3E9O A;  3RR7 A;  2YKM A;  4CF2 A;  4DTX A;  3L8B A;  4CJU A;  1QHA A;  3HT3 A;  4B1W B;  2G8H A;  3FZH A;  3VQE A;  2OZS A;  2XY8 A;  4BDZ A;  1YIJ N;  1IBM K;  1VQN N;  2NNW A;  3OJS A;  3VQ9 A;  4FL9 A;  4KTW A;  2X78 A;  3QFP A;  3DM2 A;  2YNF A;  5KPR A;  1A5X A;  1BA0 A;  2P9L A;  5AQW A;  2V7Z A;  1JLE A;  4YOU A;  4BDY A;  3VGM A;  1GLF O;  2Q0R A;  1TV6 A;  1HR0 K;  3IKM A;  3JS6 A;  4H0T B;  1Q86 O;  4CEZ A;  2GWJ A;  3P31 A;  4PUO A;  1TYQ A;  2FBT A;  3VF4 A;  4CK2 A;  2JGU A;  3DYA A;  3ZSV A;  4CEA A;  4HUG A;  1ZYQ A;  1VSH A;  4OGC A;  4LC9 B;  1VRU A;  1NMD A;  5BRD A;  3IS9 A;  1GLB G;  2A1S A;  3NF9 A;  1B9F A;  3VMF B;  4RW9 A;  3SAH A;  4WQ4 C;  1A5V A;  3G10 A;  1IBK K;  2JWL A;  4Y0W A;  4FM2 A;  2P9P A;  3C0B A;  3T3F A;  1SL2 A;  3AO3 A;  1NNE A;  3L4Q A;  1QS4 A;  2NRR A;  3MAQ A;  1WSH A;  1IV0 A;  4HVJ A;  4BRO A;  3I8D A;  1RDB A;  3L2W A;  3ZSO A;  3SQ2 A;  3LPT A;  1G99 A;  5C15 A;  3HRG A;  4BWM A;  4ID5 A;  3TAF A;  2E2N A;  1HJR A;  4NXN K;  4H5N A;  3RR8 A;  3FZL A;  3PO4 A;  1RT2 A;  5CE3 A;  5BN8 A;  3OYJ A;  4FK4 A;  3ZEU B;  3CQY A;  4PY5 A;  3IMX A;  2QWM A;  1D5A A;  5FPD A;  4NCG A;  1KAX A;  2VG5 A;  4B9V A;  4DR7 K;  2UUC K;  3A5M C;  4CER A;  1GLC G;  4DFM A;  5I42 A;  4KI6 A;  3LL3 A;  3DXM B;  1WN7 A;  4CEB A;  1HQU A;  2FBX A;  3OVN A;  3CG7 A;  4DTP A;  2IVN A;  3EKU A;  4HHT A;  4GKK K;  2PFU A;  4LY7 A;  3P38 A;  2IAJ A;  3OS1 A;  2OTL N;  1SZ2 A;  4ISE A;  4F9O A;  4H5R A;  1C0T A;  1YT3 A;  1EKE A;  4M3R A;  1KXP A;  3D2F A;  5BN9 A;  4KTZ A;  4FJ9 A;  4RWT A;  1HX1 A;  4R5P A;  3IFR A;  5CZ2 A;  4OX9 K;  3AVK A;  3QEI A;  4DTS A;  3CC7 N;  3DLR A;  2QKB A;  4CES A;  1TAQ A;  2D0A A;  4Q0B A;  4DFK A;  4MO4 A;  2HHQ A;  3S41 A;  4E3S A;  3T69 A;  3AVJ A;  3E66 A;  3HI0 A;  4L8R B;  4N5S A;  5BR8 K;  2ETJ A;  2NRH A;  5J2N A;  3RSE B;  2HB5 A;  1VSE A;  5AQL A;  3LM9 A;  3EE9 A;  2VQE K;  2DFF A;  1UAX A;  1NGA A;  4JKC A;  5JVH L;  3WNH A;  2ITM A;  1EWQ A;  3SAG A;  5I3U A;  3M8S A;  5HRR A;  5AQN A;  3I33 A;  4OPK A;  2KW4 A;  3O08 A;  3OYI A;  4Z4E A;  1YF5 L;  2HNY A;  4DWI A;  4IEI A;  3C7N A;  3TTC A;  3C6T A;  5AQP A;  3OY9 A;  1U4B A;  3CHW A;  4YOW A;  1ASU A;  4JEP A;  3RMD A;  1JL2 A;  3E01 A;  4FWL A;  3EY1 A;  1NWK A;  2XRI A;  4CBU A;  4DV0 K;  3ZT2 A;  4W5R A;  3HJF A;  3PLA A;  4FVM A;  1SL1 A;  4FJM A;  3WQT A;  1QHT A;  4B9Q A;  5TKY A;  2WOM A;  1BA1 A;  3LPU A;  3KTQ A;  2PAV A;  2QWQ A;  4BQZ A;  3HO1 A;  5C25 A;  2RHK A;  1NKB A;  2Z1I A;  3NH2 A;  2P9U A;  3KIO A;  4IO9 L;  1KQS M;  2O4G A;  3MEE A;  4BRK A;  1NGI A;  3CFO A;  4KB0 A;  1ATS A;  5CHI A;  3T19 A;  1LV5 A;  4B3R K;  3U9Z A;  2ITG A;  3DAW A;  4IFV A;  3QIC A;  3ITH A;  1NKE A;  3OTO K;  3TAG A;  3FZF A;  1VAZ A;  1CZ9 A;  1MWM A;  1W0H A;  3UB5 A; 
#chains in the Genus database with same CATH homology
 2HHW A;  3AVN A;  5KRT A;  4JS4 A;  2B6A A;  2VG6 A;  1IO2 A;  3LDS A;  1SL0 A;  3AVA A;  3QET A;  3ULD A;  1WAJ A;  5KTQ A;  4CJV A;  1N5Y A;  5EU7 A;  1ZBU A;  3VA0 A;  1N6Q A;  1EXQ A;  2LSN A;  3SZ2 A;  3QEW A;  2PY5 A;  4NCB A;  4FK2 A;  3M8Q A;  4JRP A;  4E7H A;  4ICL A;  4DMN A;  4J2A A;  2IOC A;  4RG8 A;  4KV8 A;  1BCM A;  1TKZ A;  3M8R A;  1FKO A;  3VA3 A;  1S5J A;  3K5N A;  4DU3 A;  1R0A A;  3ZSY A;  2F8T A;  1C6V A;  2HND A;  4N47 A;  4DTR A;  4OJR A;  2Y1I A;  3RMC A;  4BAC A;  1X9S A;  2HHV A;  3QO9 A;  3JYT A;  4OKE A;  4DSF A;  3MED A;  2FC0 A;  4FXD A;  3V6D A;  4DS4 A;  2Z1G A;  4M3W A;  2HVH A;  1ZBI A;  3L3V A;  4YFU A;  1FXX A;  1YVU A;  2DFE A;  3HST B;  4H4O A;  5FDL A;  4UQG A;  1UA1 A;  1U47 A;  1Q9Y A;  4FJH A;  4EZ6 A;  2OZM A;  2P51 A;  2P5G A;  1WSJ A;  1CZB A;  3C95 A;  1HYZ A;  4B8C A;  1L5U A;  2F8S A;  1YTA A;  1IKW A;  1BHL A;  4CEE A;  4FZY A;  3HYF A;  2FBY A;  3HPG A;  4CGG A;  1S1T A;  1BL3 A;  1B9D A;  3D0P A;  1KLN A;  3BDP A;  2KFN A;  3VN5 A;  1VSK A;  2OPP A;  4XIU A;  3KLE A;  1EP4 A;  5KI6 A;  4KHW A;  3IAY A;  4CF8 A;  4Z4C A;  1Z26 A;  3DRP A;  3PX0 A;  4B3O A;  5FRO A;  1U49 A;  3OYA A;  2ATQ A;  2YKN A;  1WAF A;  3LWM A;  3B6P A;  4JS5 A;  3F9K A;  4CF0 A;  3TAE A;  3L2Q A;  2HMI A;  4DQI A;  2KTQ A;  3O3F A;  4Q5V A;  1HYV A;  1RTH A;  3ZT0 A;  4CEQ A;  4E7K A;  2A1R A;  4KHU A;  3NGZ A;  2NUB A;  3KLF A;  1RBV A;  4F2R A;  3ZSQ A;  1IKX A;  1T03 A;  4FJG A;  4CED A;  4PWD A;  2Z1H A;  3CM5 A;  4CHP A;  1RTI A;  3QNO A;  1DTT A;  2YNI A;  3O4N A;  5JS2 A;  3HM9 A;  1BI4 B;  4DLE A;  1HRH A;  1NK9 A;  4M42 A;  3VQQ A;  1NJX A;  3SUQ A;  3S3M A;  1T8E A;  1BIU A;  3D45 A;  4FJJ A;  4LD0 A;  1U48 A;  3CM6 A;  4DU4 A;  3SCX A;  3ASM A;  1ASW A;  3LAN A;  3QIN A;  4KKO A;  4NYN A;  3HP6 A;  3S3O A;  4ZTJ A;  3T1A A;  1QSY A;  4I2Q A;  1HYS A;  2KFZ A;  2GV9 A;  4YNQ A;  1JLA A;  4OPJ A;  1WSF A;  4N56 A;  1KVC A;  2OPR A;  3HVT A;  3EYZ A;  4F3T A;  1TVR A;  4W5O A;  1L3V A;  3NH1 A;  4CHO A;  2AJQ A;  1CXU A;  1VSM A;  3EZ5 A;  1KRP A;  4H8K A;  4I2P A;  3L2V A;  2G8U A;  3QIP A;  4HUF A;  2W42 A;  4OVL A;  1RIL A;  4FJX A;  4CF9 A;  1S1U A;  3AVC A;  4ELU A;  2BE2 A;  3NGY A;  5J2P A;  4CCH A;  4CK3 A;  3PV8 A;  4DG1 A;  4CIE A;  1RBS A;  5J2M A;  1KSP A;  4B9L A;  4M45 A;  1UWB A;  1TKT A;  3OYC A;  1RBT A;  3K2P A;  3S3N A;  1SV5 A;  4HTU A;  5J2Q A;  2D5R A;  4NYF A;  4M41 A;  3OYL A;  4C8L A;  3HK2 A;  2X74 A;  3CFR A;  4IG0 A;  1C1A A;  4E1N A;  3AA4 A;  1VSD A;  2OPS A;  3SI6 A;  4DF8 A;  4CJS A;  4ZHR A;  1CXQ A;  1HNI A;  3CYM A;  1RT3 A;  3VQC A;  4CEF A;  2XO7 A;  1X9W A;  4KHS A;  5JS1 A;  4B8A B;  1NOY A;  1C0U A;  1JLF A;  1TL1 A;  3SQ0 A;  2IC3 A;  4FCY A;  4O0J A;  1JKH A;  3RMA A;  4CF1 A;  3C94 A;  1J54 A;  3NF8 A;  3NF6 A;  1RDC A;  4B08 A;  1QSL A;  1LW0 A;  2KZM A;  4ID1 A;  4FJ5 A;  1F21 A;  3JSM A;  1YTU A;  1EET A;  3AVH A;  3QEX A;  1IKY A;  4DTO A;  1UA0 A;  1JL1 A;  3SNN A;  3MEG A;  1BIS A;  5HRP A;  3AO2 A;  2XY7 A;  4O55 A;  1LAW A;  3KK1 A;  3V9S A;  4FLV A;  4DQP A;  4KB1 A;  2BDP A;  3RRH A;  1BGX T;  4B9N A;  4CJ4 A;  3THV A;  4IFY A;  4MFB A;  1VSI A;  3VQ8 A;  4J2D A;  2E4L A;  3OYE A;  3KD5 E;  4KHQ A;  4E7L A;  2HHT A;  5HRN A;  3AA2 A;  1BQM A;  3I0S A;  4KPY A;  4QCL A;  4DSI A;  3WNE A;  3HPH A;  3O4Q A;  4JRQ A;  2DFH A;  3NGI A;  4DTM A;  1UOC A;  3ZT3 A;  4QAG A;  5CZ1 A;  3WNF A;  4OLB A;  3PO5 A;  3DLG A;  4IBN A;  4AH9 A;  4N76 A;  1TKX A;  5KGW A;  1U45 A;  1RBR A;  4BE1 A;  1ZBL A;  3ZCM A;  2G8W A;  4AHT A;  3VQ7 A;  1LWF A;  4BE0 A;  3TAN A;  2HHX A;  4AHU A;  1NJZ A;  4E7J A;  1IG9 A;  3OYN A;  4ZTF A;  1C0M A;  1S6P A;  4DTN A;  5E41 A;  1SKW A;  3KLI A;  3F73 A;  2RKI A;  3KK3 A;  4CE9 A;  4E1M A;  3LZJ A;  1X9M A;  2EX3 A;  3I0R A;  2HNZ A;  5K14 A;  2F96 A;  4FW2 A;  1D9D A;  3TR8 A;  3NH0 A;  1A5W A;  3V9X A;  1HMV A;  3TWH A;  1JLB A;  4CIF A;  4FM0 A;  2E6M A;  1SKS A;  1CLQ A;  3P83 D;  4CJT A;  2BAN A;  3DLB A;  1I3A A;  4E7I A;  4M3Y A;  1G15 A;  3ZT1 A;  3AV9 A;  2OPQ A;  3AO1 A;  2Y1J A;  4IKF A;  4CJW A;  1WSG A;  3QEP A;  1WNS A;  1JLC A;  4CFB A;  4GMJ B;  4FLZ A;  2XY6 A;  4DSJ A;  3SUP A;  5CYM A;  4CJQ A;  2OA8 A;  3VQA A;  4FLU A;  1T05 A;  2OYQ A;  4KRE A;  3DI6 A;  4Z4H A;  3V9U A;  4I9Q A;  3VQ4 A;  1Q8I A;  4KO0 A;  1REV A;  4DFP A;  4M3Z A;  2ZQB A;  2G8F A;  3TAQ A;  3V81 A;  1O1W A;  4FJ7 A;  1TL3 A;  3H08 A;  1ITG A;  1VSL A;  1HQE A;  5DMR A;  3U3G A;  3OYG A;  1KFD A;  3KK2 A;  1EX4 A;  4J2E A;  2O4I A;  4RW8 A;  4CJE A;  3O3H A;  2YHA A;  4F8R A;  3RR7 A;  2BGG A;  2G8I A;  3SPY A;  2YKM A;  4CF2 A;  1BI4 A;  3AVF A;  3QLH A;  3CFP A;  3CQ8 A;  4FJI A;  3KJV A;  1TAU A;  1NK7 A;  4DTX A;  3L8B A;  3V4I A;  5CYQ A;  5C24 A;  3ZT4 A;  4CJU A;  3RMB A;  1RT4 A;  2X6N A;  4OKJ A;  4DQS A;  3HT3 A;  2G8H A;  3NF7 A;  3VQE A;  1Q9X A;  3AO4 A;  2OZS A;  4ELV A;  2XY8 A;  3LWL A;  4BDZ A;  2PZS A;  5FRN A;  2KZZ A;  1HPZ A;  3IRX A;  4CHQ A;  1JLG A;  3ZSZ A;  4CJL A;  5C42 A;  2B5J A;  4DQR A;  5D3G A;  1NJY A;  4K8X A;  1ASV A;  4HUE A;  2YNH A;  3OJS A;  4RW6 A;  3VQ9 A;  1RT5 A;  4O0I A;  1TK5 A;  4KTW A;  3K58 A;  4B9S A;  2X78 A;  5HRS A;  2ZE2 A;  4FZX C;  3DM2 A;  2YNF A;  3DMJ A;  4DF4 A;  3TAB A;  4FM1 A;  1RTD A;  3SQ1 A;  1A5X A;  4QOZ B;  4EP5 A;  1GOC A;  4W5Q A;  3QER A;  1JLE A;  1MU2 A;  1RCH A;  5KRS A;  4BDY A;  3VQ6 A;  1TV6 A;  4I7F A;  3TAR A;  1L3T A;  1XHX A;  3K5O A;  1RBU A;  4CEZ A;  4OLA A;  3TAP A;  4FJ8 A;  3VQP A;  4PUO A;  4IG3 A;  3ZSW A;  3RTV A;  3U6F A;  3RRG A;  2RN2 A;  1NOZ A;  1FK9 A;  2FBT A;  4CK2 A;  3SV4 A;  2JGU A;  3DYA A;  1QTM A;  2DTU A;  3ZSV A;  4M3T A;  4CEA A;  4HUG A;  1S1W A;  1ZYQ A;  1RDA A;  1L3U A;  1VSH A;  4CGD A;  1KLM A;  4OGC A;  4DSL A;  1BCO A;  1RTJ A;  2D0C A;  1JXB A;  1QSS A;  2VWK A;  3V1Q A;  1VRU A;  4CHN A;  1ZBH A;  3IS9 A;  3ZSR A;  3HVR A;  1KVB A;  4M3X A;  3UIQ A;  3SYZ A;  2Q3S A;  2A1S A;  4FLW A;  4AHV A;  5T7B A;  4EZ9 A;  1JXE A;  3NF9 A;  1L3S A;  1B9F A;  3A2F A;  4RW9 A;  3QEV A;  5HP1 A;  2HW3 A;  4GVM A;  1A5V A;  1VK0 A;  3DRR A;  3G10 A;  1WSI A;  3RWU A;  4DS5 A;  3MXM A;  1SKR A;  3DOL A;  5HBM A;  1TKD A;  1WSE A;  4FM2 A;  1FKP A;  3T3F A;  3L3U A;  3AO3 A;  1SL2 A;  4Z4G A;  4CFC A;  1QS4 A;  2ZD1 A;  1D8Y A;  2VG7 A;  3OYK A;  3MAQ A;  1WSH A;  3SV3 A;  3PX6 A;  4F3O A;  4HVJ A;  4B9U A;  1GOA A;  1RT7 A;  2YHB A;  1S1X A;  3OJU A;  3I8D A;  3AO5 A;  1RDB A;  4KFB A;  3L2W A;  3SUO A;  3ZSO A;  3ISN C;  3SQ2 A;  3LPT A;  2G8K A;  1ZBF A;  4N41 A;  4BWM A;  1S6Q A;  2FBV A;  1LWC A;  4ID5 A;  3OYB A;  4CEO A;  5CY4 A;  4CK1 A;  3SUN A;  2E6L A;  1Y97 A;  3KLH A;  3HXM A;  3TAF A;  1NK0 A;  2HHU A;  3VQB A;  4FYD A;  3PUF A;  2KQ2 A;  1HJR A;  3S9H A;  3RR8 A;  3L2U A;  2X6S A;  3PO4 A;  1RT2 A;  3KD1 E;  3KKR A;  3LAM A;  4BWJ A;  4HCB A;  3OYJ A;  1NK5 A;  4FK4 A;  1TK8 A;  3VQD A;  3NHG A;  3ZSX A;  3AA5 X;  1TK0 A;  4PY5 A;  1X1P A;  4RW7 A;  4DSK A;  4AHR A;  1D5A A;  3WNG A;  2EHG A;  3NFA A;  3V9W A;  2P1J A;  2QXF A;  3C6U A;  4NCG A;  3G0Z A;  2VG5 A;  3K5L A;  1LW2 A;  3V9Z A;  4B9V A;  1RDD A;  3HL8 A;  4MQ3 A;  3IG1 A;  4CER A;  1JLQ A;  3PX4 A;  4DFM A;  4FJL A;  2VWJ A;  2G8V A;  1IH7 A;  5I42 A;  3LP0 A;  4F2S A;  1J53 A;  4KI6 A;  1S1V A;  4ELT A;  4CGH A;  3SPZ A;  4Z4I A;  1WN7 A;  4CEB A;  1HQU A;  2FBX A;  1XC9 A;  4CFD A;  1KTQ A;  3OVN A;  2I5J A;  3CG7 A;  4DTP A;  4B9T A;  1TGO A;  1S9G A;  4AIL C;  4HHT A;  1T7P A;  1HNV A;  4LSL A;  2GBZ A;  2WON A;  4LY7 A;  2IAJ A;  5SWM A;  3OS1 A;  3KLG A;  4W5N A;  1NK8 A;  4CJR A;  3FFI A;  3KKS A;  4CJ3 A;  1KCF A;  3HP9 A;  4K8Z A;  2IGI A;  4Z4F A;  4OKK A;  4I9L A;  1C0T A;  1YT3 A;  3AVM A;  1KFS A;  1EKE A;  1VSJ A;  4M3R A;  3V1R A;  4G1Q A;  4KAZ A;  4KTZ A;  3B6O A;  4CFA A;  4FJ9 A;  4R5P A;  1QQC A;  1WLJ A;  4H4M A;  5CZ2 A;  2IDO A;  3AVK A;  1B92 A;  1C1C A;  4RW4 A;  2QKK A;  4CJF A;  4DFJ A;  4LH4 A;  3QEI A;  3V1O A;  1LAV A;  4DTS A;  2YV0 X;  2XHB A;  3DLR A;  4DQQ A;  2QKB A;  4CES A;  3MXI A;  3OYM A;  4BDP A;  1TAQ A;  2D0A A;  4Q0B A;  3O3G A;  3NE6 A;  1GOB A;  4DFK A;  4B9M A;  4CGJ A;  2HHQ A;  3MXJ A;  4E3S A;  3DLK A;  4FJK A;  1J5O A;  1NK4 A;  1BQN A;  3AVJ A;  3QIO A;  4Y1C A;  3K57 A;  3BGR A;  1I39 A;  3NCI A;  3SQ4 A;  4KHY A;  4KRF A;  1LWE A;  4L8R B;  2DY4 A;  3AVL A;  4LSN A;  4N5S A;  4C8O A;  2ETJ A;  4M3U A;  4LH5 A;  5J2N A;  3ALY A;  1RNH A;  3AVG A;  3DLE A;  2HB5 A;  4Y1D A;  1VSE A;  5FRM A;  2QK9 A;  1C1B A;  4CHY A;  4FJN A;  2DFF A;  4TSX A;  4CJ5 A;  1UAX A;  4E89 A;  5J1E A;  3QNN A;  4E0D A;  4CHZ A;  3WNH A;  2IS3 A;  2B4J A;  2PYJ A;  5I3U A;  3AVI A;  4CGI A;  4AHC A;  3M8S A;  5HRR A;  2Z1J A;  4FLY A;  1XI1 A;  4PA1 A;  4OPK A;  3OS2 A;  1XWL A;  2KW4 A;  3OYI A;  4Z4E A;  4NCA A;  3OS0 A;  3DLH A;  2JLE A;  3PY8 A;  1U04 A;  3LAL A;  2HNY A;  3HPO A;  4FLT A;  4DWI A;  4PQU A;  3LP2 A;  4O4G A;  3AA3 A;  3C6T A;  3OY9 A;  4HCC A;  1U4B A;  3NAE A;  2XY5 A;  1ASU A;  3RMD A;  3P1G A;  1JL2 A;  3OYD A;  5HLF A;  3E01 A;  1KVA A;  1QE1 A;  2YNG A;  4CJP A;  3VQ5 A;  3EY1 A;  2XRI A;  1NK6 A;  3DRS A;  4FW1 A;  4O5B A;  1NJW A;  3QES A;  4C8N A;  3ZT2 A;  1IKV A;  2GUI A;  4W5R A;  4FK0 A;  3HJF A;  1DTQ A;  4FVM A;  3P5J A;  1XHZ A;  4DSE A;  4CJK A;  1SL1 A;  1D9F A;  2PYL A;  3LP1 A;  4FJM A;  4CIG A;  4DTU A;  3L2R A;  1QHT A;  3TAM A;  4FZZ A;  1W9H A;  2WOM A;  3LPU A;  4FLX A;  3KTQ A;  2D0B A;  2P5O A;  1K6Y A;  3HO1 A;  4W5T A;  5C25 A;  2HHS A;  4CGF A;  1NKB A;  2Z1I A;  4WE1 A;  3NH2 A;  3OYH A;  5HRO A;  1J9A A;  1DLO A;  3KIO A;  3LZI A;  1Z25 A;  3LP3 A;  4KHN A;  5DK5 A;  4E19 A;  1RT1 A;  1BIZ A;  2O4G A;  3MEE A;  3LAK A;  4EP4 A;  4O44 A;  1VSF A;  1SUQ A;  3CFO A;  4KB0 A;  2RF2 A;  4Z0U A;  3TI0 A;  1S9E A;  3T19 A;  3SJJ A;  1LV5 A;  2HVI A;  2ITG A;  4GW6 A;  5SZT A;  4DLG A;  4OGE A;  2R7Y A;  4DTJ A;  4IFV A;  3ITH A;  5KGX A;  4IDK A;  4C8M A;  3K59 A;  4DU1 A;  1NKE A;  4C8K A;  3DOK A;  3TAG A;  4KI4 A;  3AVB A;  3NDK A;  1NKC A;  4AHS A;  3OYF A;  4KTQ A;  3M8P A;  3NBP A;  4F4K A;  4JLH A;  4CEC A;  3K5M A;  1RT6 A;  4J2B A;  1CZ9 A;  1VRT A;  2RPI A;  4BE2 A;  3MEC A;  3U3Y A;  1W0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...