1ZBFA

Crystal structure of b. halodurans rnase h catalytic domain mutant d132n
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
132
structure length
132
Chain Sequence
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribonuclease H-related protein
publication title Crystal Structures of RNase H Bound to an RNA/DNA Hybrid: Substrate Specificity and Metal-Dependent Catalysis.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase
total genus 41
structure length 132
sequence length 132
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1zbfA00
1C1AA 1TK0A 5CY4A 4BDPA 2VWJA 4FJ7A 3NF8A 2IC3A 4KTWA 3KJVA 4JS5A 3DI6A 1UA0A 3PY8A 4F3OA 1S5JA 1U04A 3ZT4A 4FJ8A 4DFKA 2HHSA 2Z1GA 3QLHA 4CJLA 3HPGA 2ZQBA 4PA1A 3AVAA 1RDBA 3CG7A 4OKEA 3TR8A 3HPHA 2GV9A 1XI1A 2Z1JA 1JLGA 1D9DA 4BDYA 2YHBA 3HL8A 3QEWA 4KI6A 1JLBA 3RMBA 1L5UA 3VQ4A 3NGZA 2D0CA 3NF9A 4CGIA 4DQQA 1EETA 1JL1A 3VQCA 4CJQA 4BE2A 4QOZB 1VSLA 1FK9A 1ITGA 3QNNA 2FBTA 2G8IA 4PQUA 4GW6A 2Y1IA 3O4QA 4KTZA 3RRHA 2G8HA 4DSIA 4M41A 3KKSA 4HTUA 3VQAA 2E6MA 3TWHA 3DRSA 4CEEA 3G0ZA 3OYJA 2PY5A 4F2RA 1WSEA 1X1PA 4QAGA 4DTPA 4DFJA 1NK0A 4UQGA 2XY8A 1X9WA 3KLGA 1REVA 3SCXA 2HVHA 1I3AA 5KGXA 3O3GA 1C1CA 1WSHA 1NK4A 3HJFA 3VQQA 4CIGA 1UAXA 1JLEA 1RT2A 1BIZA 2F96A 3LAKA 1SV5A 4E19A 5J2NA 3AVHA 2NUBA 1VRUA 1S1WA 3I0SA 1FXXA 3VA0A 1EKEA 3QESA 2XY7A 3V81A 3DLHA 4F2SA 1WAJA 1VSFA 1ZBFA 1SL0A 3HYFA 1O1WA 3OYNA 3V9ZA 4DF4A 3AO5A 4CFBA 5HRNA 3V9XA 1VSEA 4ID1A 4I9LA 3OJSA 1N5YA 1TKTA 2G8WA 1TV6A 2GBZA 4YFUA 2G8VA 1W0HA 3MXIA 4CHOA 4FK2A 4RW7A 1J54A 4E7LA 1TGOA 5D3GA 2OZMA 2XHBA 4CJRA 1SUQA 1VRTA 3MECA 3PX6A 4KB0A 4L8RB 4Z4HA 3QO9A 3NBPA 1TK5A 3VQ9A 2B4JA 5HLFA 2VG5A 3CQ8A 4KB1A 3IG1A 2HMIA 3O3FA 1WN7A 3L8BA 4CK1A 3LWMA 3V4IA 3AVCA 1L3UA 2PYJA 5FDLA 3ZSOA 4CIEA 1D9FA 4FW1A 3RWUA 2BGGA 1RTHA 3SUNA 2YNHA 4DTXA 1ZBHA 1WSGA 5DMRA 2RPIA 3TAQA 3L2QA 4CGDA 3NCIA 3RMDA 4DTSA 3PV8A 4O55A 1NK8A 4DMNA 3AV9A 2VG6A 4LY7A 4Z4GA 3L2UA 3OY9A 2WOMA 4BE1A 4ELVA 3S3MA 4ELTA 4CFAA 5HRRA 1HMVA 1IH7A 2HHUA 3VQ7A 3VQ8A 4B9LA 1VSHA 3CFRA 4FLXA 3ZSZA 3KD5E 5KRTA 3C6UA 3NH0A 3KTQA 2DFHA 3BDPA 3NF7A 3NH2A 4CF2A 2KZMA 3KLEA 1ZBLA 4B8CA 4CFDA 4Z4FA 5KRSA 4FJGA 4CESA 3DLGA 3AA5X 1ASUA 3ALYA 4FJKA 4CJVA 1J9AA 1Z25A 1WSJA 5SZTA 1CLQA 2EHGA 4Z4CA 1CZBA 4W5NA 1TL1A 2B6AA 3VQ5A 1S1TA 2RN2A 4LH4A 4CHNA 4CHPA 3TAMA 4JS4A 4OLAA 4FJJA 2B5JA 2R7YA 3IRXA 1WLJA 4DQRA 4NYNA 4Z4EA 3NDKA 3TAPA 1RBUA 3AVKA 4CF0A 3JSMA 4M3RA 4AHUA 3O4NA 1IG9A 5KI6A 1GOAA 3HT3A 3HK2A 1BI4B 2X6SA 1WAFA 4EP4A 1L3VA 4E7JA 4DS4A 2YHAA 4PWDA 3CM5A 4ZHRA 3M8PA 3TAEA 1KTQA 3E01A 2D5RA 4DFPA 2FBVA 2JLEA 3DMJA 3QINA 1RDDA 3OVNA 4CJWA 5C25A 4AILC 5HP1A 1NJYA 4FLVA 4KPYA 3SJJA 4M3UA 3JYTA 3V1RA 1ZBUA 4ZTJA 3V6DA 2QXFA 4AHRA 4CJ5A 4E7HA 3RR8A 2HHXA 1BHLA 1A5WA 3D45A 1S9GA 3OYIA 3RR7A 4GMJB 4AHTA 4KAZA 1NK6A 4M3ZA 1TL3A 4EZ6A 2GUIA 4N5SA 4C8NA 1VSJA 4M3WA 1S6QA 1R0AA 2F8TA 3KLFA 4CEBA 4JRQA 4Q0BA 3DLRA 3VN5A 1RBVA 2XY5A 4E1NA 2E6LA 1RDCA 1KFSA 1J53A 3WNEA 4FM1A 3VA3A 4G1QA 4CECA 3DYAA 3KIOA 2F8SA 5C24A 1DTQA 3AVNA 4CEQA 3AA3A 3VQPA 5CZ2A 3K57A 5FRMA 1VSMA 4OLBA 1HNVA 4CEDA 4C8LA 4KTQA 4B9SA 2HW3A 4DG1A 2KFZA 4WE1A 1CXUA 5DK5A 1Y97A 2YKNA 1JXEA 3PO4A 3TANA 1ASVA 3SV3A 4CGFA 4JLHA 4HCCA 1TK8A 3KK1A 2LSNA 4KFBA 4CJPA 4LSNA 3RRGA 1JLCA 2OPRA 4CJKA 2XO7A 5J2PA 3TAGA 2QKKA 3DM2A 4M3XA 1LWCA 2HNDA 2D0AA 2HNYA 5JS1A 3HVRA 3DRRA 1IKVA 3QNOA 5HROA 4IDKA 4M3TA 2QK9A 3AO3A 1NJWA 2BDPA 1BQNA 2IGIA 2KFNA 3ZT0A 1JL2A 3OYLA 1VSIA 2XRIA 3AO4A 4DWIA 1IKXA 2ZD1A 1FKOA 4DTRA 1TKDA 2YNGA 4FJMA 4Z0UA 4HVJA 4CJEA 4AHCA 3KK2A 1LAVA 1QTMA 1HRHA 3ASMA 1KSPA 3IS9A 1JLAA 4CJTA 4W5OA 3HP6A 1LV5A 4K8XA 4DLEA 2O4GA 4OPKA 2Y1JA 3LDSA 4F4KA 4W5TA 1RT7A 5I3UA 4E3SA 1UOCA 3T1AA 4FK4A 3DRPA 1YTAA 4CF1A 1RBSA 1NK5A 1C0TA 3SQ2A 3MEEA 4JRPA 2P5OA 3SNNA 2FBXA 3ZT2A 4FM0A 4E0DA 1KLMA 1EX4A 4FJIA 1YVUA 4I7FA 4DS5A 4PUOA 4KHSA 1RILA 3VQBA 4B3OA 4CFCA 3SI6A 4DTOA 1HQEA 3H08A 3LPUA 4AHSA 4IG3A 4CJUA 4CHZA 3A2FA 3LZIA 5J2MA 4Q5VA 3KKRA 1S1XA 1NOYA 3TABA 3SPZA 3S3OA 3QETA 3TARA 4O44A 3KD1E 4FJ5A 3ITHA 1TKZA 3ZSQA 2PYLA 3QEIA 5HRPA 3S3NA 2HHWA 3OYEA 3CFOA 1RDAA 2D0BA 1IKWA 3SUPA 2IDOA 1RT3A 2A1SA 3P5JA 4KREA 1D5AA 1HYZA 5K14A 1FKPA 4BWJA 4DTJA 4DTUA 3ZSVA 1X9MA 4CK3A 1U4BA 4FJHA 4ELUA 5EU7A 1RT6A 5SWMA 3V9SA 4LD0A 1RCHA 4KHUA 3HSTB 4W5RA 2O4IA 3SUOA 1BCMA 2YNFA 4IBNA 1QSLA 1YTUA 3K5LA 1KCFA 1G15A 1LWFA 3I0RA 3T3FA 1BQMA 3AA4A 4FZYA 3K2PA 3NGYA 4CF8A 3PUFA 1B9FA 4C8OA 4DTNA 4OKJA 3MEGA 5C42A 1RBTA 3OYDA 1LW0A 1XHXA 4ZTFA 4CEFA 1RTIA 4O0IA 1KLNA 1RNHA 4I2PA 2HVIA 2DFEA 4FZXC 4E7IA 5KGWA 5JS2A 3L2WA 4KHQA 2QKBA 1W9HA 3HP9A 4B8AB 3LP1A 3QIOA 4EP5A 3VQEA 1HQUA 1RBRA 4RW9A 3MXMA 1JKHA 1Q9XA 3G10A 1JLFA 2HB5A 1DLOA 3QEVA 3FFIA 2I5JA 2OYQA 4DQIA 4B08A 2A1RA 5CYQA 1QQCA 4BE0A 3PX4A 3RMAA 1Q9YA 3P1GA 3CFPA 4Y1CA 1IKYA 4DSKA 3V1OA 2RKIA 1ASWA 3C6TA 3S9HA 1SKWA 3TI0A 1WSFA 1UA1A 4OPJA 1BL3A 1VSDA 2DTUA 4CJFA 4GVMA 4B9TA 1LW2A 2WONA 5I42A 4FLWA 1NK7A 3AA2A 3MAQA 4CJ3A 3F73A 3SZ2A 3M8SA 1L3TA 4YNQA 1RTDA 3DLEA 5CYMA 4O0JA 4CCHA 4FW2A 4KHNA 4DSJA 1RTJA 1J5OA 4C8MA 3LWLA 4FJ9A 1HYVA 1B92A 1CZ9A 3ZT3A 3HM9A 1DTTA 1S6PA 2BANA 2E4LA 3B6PA 5FROA 4KKOA 3OS2A 3HXMA 3C94A 1BI4A 3V9UA 1JLQA 4B9MA 1C0UA 4F8RA 4CF9A 4LH5A 3UIQA 3NHGA 3RMCA 4B9VA 3K58A 3ULDA 4E89A 3V1QA 1X9SA 4OKKA 4N41A 2HNZA 2X78A 1U49A 2OPSA 4CEAA 1L3SA 3SUQA 4DU1A 2Z1HA 4CJ4A 4B9UA 1QE1A 1KVAA 3NGIA 3QERA 4CIFA 4I9QA 4HUEA 4RW4A 1HPZA 1B9DA 1ZYQA 5E41A 1SKSA 3ZSWA 2IS3A 1NJZA 1HJRA 1S1UA 1NOZA 2EX3A 4FVMA 4FJLA 2W42A 4J2DA 4KV8A 2OZSA 4CEZA 4IFYA 2ITGA 2P51A 4OJRA 4CJSA 1TVRA 1A5XA 4N76A 3LZJA 1KRPA 3K59A 2X6NA 3SPYA 4FK0A 5FRNA 3LALA 3AO1A 3QIPA 1CXQA 3OYFA 1N6QA 4DLGA 3ZCMA 1BISA 2ATQA 1KVCA 2KQ2A 4DTMA 4CE9A 1ZBIA 4FYDA 4TSXA 3THVA 1F21A 3O3HA 3VQDA 3ZSRA 3OYKA 3P83D 4EZ9A 3L2VA 1QSSA 1QSYA 1VSKA 4DQSA 5HRSA 1QHTA 1UWBA 3K5OA 3NAEA 4KRFA 4ID5A 3SQ4A 4J2AA 4OGEA 4DSEA 3I8DA 3ZT1A 4BWMA 2VWKA 4RG8A 4E1MA 1TAQA 4RW8A 3F9KA 3ZSYA 3PO5A 3HO1A 1NK9A 1RT1A 3DLKA 3LAMA 4FCYA 4KO0A 2YKMA 2FC0A 3NH1A 3SYZA 1TAUA 3U3GA 1HNIA 1LAWA 4NCAA 4KHWA 3LP2A 1JXBA 5J2QA 1SL2A 3ZSXA 3HPOA 4E7KA 2KW4A 4DFMA 4FXDA 2Q3SA 4RW6A 4ICLA 4H4OA 1EP4A 4OGCA 1MU2A 1XC9A 2RF2A 1T05A 2IAJA 2AJQA 3MXJA 3NF6A 4CGJA 3K5MA 4AH9A 4M45A 3VQ6A 3OS0A 3WNHA 3OYAA 4PY5A 4M42A 1QS4A 4O4GA 4DU3A 1XWLA 2VG7A 4KI4A 4DSLA 1D8YA 2DFFA 3AVMA 4H4MA 3QEXA 2PZSA 3CYMA 4CGHA 3L3VA 3M8QA 4IFVA 3DOLA 5J1EA 4XIUA 3M8RA 1WSIA 3AVGA 1U45A 4R5PA 1TKXA 1YT3A 5KTQA 3OYCA 3OS1A 3KK3A 4BACA 1NKCA 3OYMA 1T7PA 4KHYA 2IOCA 4CEOA 2KZZA 2G8KA 1NKBA 2HHQA 3NE6A 3IAYA 4HCBA 1WNSA 3C95A 3DLBA 3AVIA 4DQPA 3D0PA 3KLHA 4N47A 1S1VA 2ETJA 4MFBA 2OPQA 4FLUA 4N56A 3OYGA 3OJUA 4BDZA 3NFAA 1T03A 2X74A 1S9EA 4FJXA 4Y1DA 3PX0A 4CGGA 3U6FA 3B6OA 3LP0A 1VK0A 4HHTA 1A5VA 4NCGA 3EZ5A 4FM2A 4M3YA 3EYZA 3SQ1A 4HUFA 3QEPA 1XHZA 4J2BA 2YNIA 2Z1IA 1GOCA 1LWEA 1KVBA 3U3YA 3WNFA 3KLIA 1IO2A 4NCBA 1SKRA 3EY1A 4B9NA 1K6YA 4LSLA 1EXQA 3T19A 4CERA 3K5NA 4FLZA 4DSFA 1RT4A 4DU4A 4J2EA 1BIUA 4I2QA 4K8ZA 3SQ0A 1NJXA 4CHYA 1GOBA 3AVLA 2OA8A 3OYHA 2HHVA 1RT5A 3BGRA 3DOKA 4QCLA 3LP3A 3CM6A 4CK2A 2JGUA 4FZZA 3ISNC 4HUGA 3OYBA 2HHTA 2G8UA 2XY6A 4MQ3A 1BCOA 3RTVA 1Q8IA 3MEDA 3AVFA 4NYFA 1U48A 2FBYA 4F3TA 2YV0X 2KTQA 1KFDA 2OPPA 1C6VA 3AVBA 3SV4A 1U47A 1SL1A 1T8EA 3LPTA 3AO2A 4OVLA 2ZE2A 5CZ1A 3TAFA 1BGXT 4W5QA 1NKEA 2G8FA 3HVTA 4DF8A 4AHVA 4FLTA 2DY4A 4CHQA 4IG0A 4O5BA 1HYSA 4C8KA 1Z26A 3WNGA 2P5GA 1C0MA 1C1BA 4Z4IA 3AVJA 3V9WA 4FJNA 2P1JA 4IKFA 5HBMA 2BE2A 3LANA 1I39A 3L2RA 4H8KA 4FLYA 3L3UA 5T7BA
chains in the Genus database with same CATH superfamily
1C1AA 1RDUA 4KTWA 3KJVA 1UA0A 1S5JA 1ATSA 5BPNA 1K8KB 3EL2A 3ZT4A 4FJ8A 2Z1GA 3HPGA 3TR8A 1D9DA 3QEWA 1JLBA 3RMBA 3VQ4A 3NF9A 5KPZA 4CBXA 4BE2A 4QOZB 1NMDA 4BRPA 3RRHA 4M41A 4CD3A 4CD1A 3VQAA 2E6MA 4CEEA 3L4QA 4BRDA 4ISEA 1X1PA 1OH7A 4UQGA 2XY8A 2FXUA 3O3GA 1WSHA 2NRXA 2F96A 1SV5A 3ULEA 5BPMA 4F2SA 1WAJA 3V9ZA 4DF4A 2VGMA 1NM1A 3V9XA 1XNQK 3VEXA 1TV6A 2GBZA 5CE3A 3OBYA 2E2NA 1Z05A 1Q86O 3THWB 4NB4A 2XHBA 1SUQA 3PX6A 4KB0A 3QDKA 1FJGK 3V4IA 1HPMA 1L3UA 5FDLA 5A2QO 3HOTA 3C7NB 4CGDA 4DTSA 3U9DA 4O55A 4DMNA 3D7EO 3AGRA 3OY9A 2WOMA 4ELVA 2QWRA 3VQ7A 1QVFM 4B9LA 1VSHA 3CFRA 3C6UA 3VGLA 4FJGA 4CESA 2UXBK 3BUZB 1VQNN 1J9AA 1WSJA 3ATVA 4JHDA 1S1TA 3UKRB 5FPNA 4CHNA 1TYQA 1J6ZA 4DUZK 4NYNA 4JN4A 3UKUA 3HBTA 3O5BA 3JSMA 3DXKB 1GOAA 4BG9A 4CZMA 3HK2A 2X6SA 1WAFA 1L3VA 4DS4A 4PWDA 4ZHRA 3TAEA 1KTQA 1ZBSA 1GLDG 3TPQA 1VQPN 2FBVA 2KLAA 2YHYA 4KPYA 4BQZA 3JYTA 3V1RA 4JK7A 2GELA 2A5XA 4BR4A 4E7HA 4IDHA 4CJ5A 1BHLA 1A5WA 4EHTA 5AQIA 3LDNA 2O8DB 4KAZA 3VMFB 1YHQN 2GUIA 4C8NA 5AQVA 4BRNA 4E1NA 2FLOA 1RDCA 5BN8A 4JI8K 1XNRK 3EKSA 2E88A 3WNEA 5C10A 3VA3A 4G1QA 3KIOA 2O8BA 5JLFA 3AVNA 3VQPA 3K57A 4OLBA 1HNVA 3SAGA 2ZJQL 1NGIA 5MLCQ 2NLXA 4KTQA 4DKWA 4B9SA 4DG1A 4WE1A 5FPEA 3U8XA 1N36K 1K8AO 4BROA 1ASVA 1EO1A 4JNEA 4KFBA 1JLCA 2OPRA 4CJKA 3TAGA 3DM2A 3DRRA 4IDKA 1QZ5A 1NGEA 3AO3A 5AQNA 1NJWA 2QW9A 4FWSA 1Z6RA 2ITMA 1VSIA 2D4WA 3TU5A 5JVGL 2ZD1A 4BC5A 1BA0A 4FJMA 4BVOA 1LAVA 1KSPA 3H46O 1EWQA 2O4GA 4XEIA 2ZWHA 3CJCA 4WFNL 4KBOA 4E0DA 4FJIA 4I7FA 4PUOA 2Q97A 4CFCA 3E9OA 2A6AA 3H08A 4CHZA 4JEPA 3KKRA 1NOYA 4WFAL 2GX9A 5IWAK 3ITHA 1TKZA 4JI6K 3ZSQA 2PYLA 3CFOA 4M63C 4B1XB 4MO5A 2IDOA 3M6GA 3P5JA 5DM7L 4KREA 4DTUA 4BRIA 3IMXA 1U4BA 4WYBA 4ELUA 5EU7A 3C65A 5AZJA 3EEQA 3HSTB 4W5RA 1YTUA 1KCFA 1N32K 1G15A 1LWFA 5FLXO 1BQMA 3AA4A 3K2PA 3G4SN 5C42A 1RBTA 1KLNA 1LW0A 1RTIA 1N33K 3FZLA 4FZXC 5KGWA 1W9HA 3HP9A 3CD6N 2Q2RA 1GLAG 1RBRA 4JI4K 5JLHA 4BG8A 4BGBA 1DLOA 3FFIA 2D0OA 1T6DA 2A41A 5CYQA 4BE0A 1Q9YA 3HM8A 3M3ZA 4Y1CA 1IKYA 3V1OA 3H3OB 2RKIA 1ASWA 1OH6A 3CIPA 1VSDA 3R1XA 2P9UA 4IWVA 1NK7A 3MAQA 5BREA 3F73A 3M8SA 3SZ2A 1L3TA 4KHNA 4IEEA 4FW2A 4DSJA 1J5OA 4C8MA 1ATNA 1HYVA 3KWIA 2BANA 1S6PA 5BR8K 3MN7A 3DLLL 3HXMA 1VQ5N 5AQLA 3ZX2A 1NBWA 3NHGA 3D2EA 1YI2N 3THYA 1BWFO 4E89A 3ULDA 1X9SA 2HNZA 1U49A 3SUQA 3LDLA 4DU1A 4CJ4A 5LJWA 3NGIA 3QERA 4CIFA 4I9QA 1ESVA 1SS6A 1HPZA 1ZYQA 2QWLA 1S1UA 2EX3A 3CCEN 5EXWA 2P51A 3VTIA 3SPYA 1CXQA 1N6QA 2ATQA 4DTMA 2KQ2A 3K9JA 3THVA 4O8KA 2HBLA 4Z94A 4X65K 3ZSRA 4JKEA 1QSSA 2IVOA 4DQSA 4HTLA 1QHTA 3I8BA 3ZETA 3NAEA 5AQJA 3CPWM 3I8DA 4BWMA 5JMVA 3ZSYA 5M1KA 3LAMA 5AQUA 2E1ZA 2FC0A 3NH1A 1HNIA 3AAPA 5AFUH 1U2VB 3MWTA 3CCVN 3D2FA 4KHWA 4G9ZA 1JXBA 5J2QA 1SL2A 4E7KA 2KW4A 2Q3SA 2E20A 1ATRA 4H4OA 1MU2A 1XC9A 1QQOA 2RF2A 5GAEP 2W40A 4AH9A 2YCHA 2BH1A 2H3GX 2KHOA 4B3MK 1XWLA 2O8CA 2VG7A 3A0IX 4DSLA 1VQ6N 3VPZA 3AVMA 4H4MA 4ILGB 5TKYA 4IFVA 4A62A 1IG8A 3M8RA 2CGLA 4ILJA 4R5PA 1TKXA 1BG3A 2VCPA 4I6MA 5CR4A 1NKCA 1GLFO 1WNSA 4FWRA 4R79A 4FJXA 3SK3A 4B1UB 4AQYK 3LP0A 4H0VB 1VK0A 1A5VA 4H5WA 4NCGA 4IOXA 5EVZA 5AQYA 3QEPA 3O1WA 2ZGZA 1LWEA 4YOWA 4DR7K 1SKRA 3L4IA 4JKGA 4DV5K 1K6YA 1EXQA 4CERA 1KAYA 4MLEA 4CZEA 4J2EA 1BIUA 1GOBA 2OA8A 2HHVA 3OYHA 4EIAA 4ISGA 4DCHA 1NLVA 4CK2A 4FZZA 3CC4N 3ISNC 4HUGA 1S72N 3J81O 2O8BB 3LM2A 3ENOA 3C6AA 4F3TA 3AVFA 2KTQA 1WUAA 4PKIA 3A8YA 3AVBA 1C6VA 1IJJA 1U47A 3SMPA 3SBGA 2ZE2A 4QS7A 3HVTA 4DF8A 4YOVA 5FPMA 4C8KA 3CETA 3V9WA 2P1JA 3CF5L 1I39A 4BRCA 3L3UA 5T7BA 1TK0A 5CY4A 2O8EA 2VWJA 4FJ7A 3NF8A 3RSEB 3DI6A 4F3OA 3HZ6A 1U04A 3QLHA 2ZQBA 1XI1A 3AVAA 1RDBA 3HPHA 2GV9A 2Z1JA 3AGKA 4BDYA 3NGZA 4IO8A 2D0CA 3P38A 4YY3K 4DQQA 1JL1A 1HKBA 3VQCA 4CJQA 1VSLA 4PQUA 3QNNA 2FBTA 4BQLA 2FSKA 2YHWA 3OYJA 2PY5A 4F2RA 4DR4K 1WSEA 4DFJA 4GV3A 2RE2A 1REVA 3SCXA 5AZIB 4H0TB 3VERA 1I3AA 5F1XA 5AJ3K 2V7YA 2F4VK 1NK4A 1UAXA 1JLEA 4WCEL 4E19A 4JK9A 1FXXA 3QESA 3IKMA 1SL0A 3Q7BA 3HYFA 1O1WA 1WB9A 5HRNA 1OH8A 4I9LA 2G8WA 1N5YA 4YFUA 3Q7CA 1W0HA 5AZJB 4CHOA 2O8FB 2QWMA 3QBXA 1OH5A 3EKUA 2FSJA 2OANA 3CPEA 3TSQA 2GEMA 1VQ7N 1GLEG 2WFBA 2VWBA 2WC9A 4AM7A 2VG5A 3DXMB 3O9QA 3CQ8A 3A5LC 3L8BA 4CK1A 3AVCA 3ZSOA 3T69A 4CIEA 1D9FA 3CCUN 4BC2A 1RTHA 4GKKK 4BRAA 1ZBHA 1WSGA 3TAQA 3SBTA 3AV9A 2VG6A 3L2UA 4OPAA 4BE1A 4ELTA 4CFAA 4JK8A 3H3NO 2HHUA 4FLXA 4FPAA 1HKGA 3ZSZA 4CJ7A 3MDQA 3KD5E 2Q0UA 3BDPA 1ZXOA 3NF7A 3KLEA 2YI1A 2QWPA 1ZBLA 4B8CA 5KRSA 3ALYA 4FJKA 4CJVA 5GIOA 5SZTA 1JCFA 2EHGA 3MX5A 4FPBA 2P9UB 2P9NA 3VETA 4KH4A 1E3MA 2E2OA 4A61A 2W6KA 3O1BA 4OLAA 2B5JA 5EX5A 3IRXA 3T1YK 3IUCA 2YJFA 3TAPA 1IBMK 3AVKA 1NGFA 2CH5A 1HUXA 3BF1A 4OPHA 3EE9A 3G6EN 2YHAA 4M7YA 3U9ZA 3E01A 3THYB 5HP1A 2JLEA 3DMJA 3VGKA 4AHRA 3RR8A 2HHXA 3D45A 1S9GA 4DR3K 4AHTA 1BU6O 4IEIA 3PSIA 4M3ZA 1TL3A 4FVUA 1V4TA 4Y0WA 4N5SA 1VSJA 1S6QA 1R0AA 2P9LA 4FWQA 2F8TA 3MCAB 3O9SA 4DR1K 1J53A 1HX1A 5KQ8A 3O8MA 1DTQA 4CEQA 1VSMA 4O8UA 4H5VA 1HR0K 4GV9A 4BRLA 2KFZA 3PO4A 3TANA 4K0KK 4CJPA 3RRGA 1Q18A 5J2PA 2HNDA 2D0AA 2HNYA 4FOIA 1MWMA 2P9PA 5JS1A 3L6QA 2F7TA 3CJ7A 1BQNA 2IGIA 5BN9A 3O9TA 3OYLA 1KAZA 3AO4A 4JKBA 1FKOA 4C23A 4DTRA 2YNGA 4Z0UA 3ZEUA 4CJEA 2F9WA 3HP6A 1LV5A 1CZAN 4QS9A 4F4KA 4JI3K 5I3UA 2CGKA 1UOCA 3DRPA 4KH6A 1C0TA 4CZFA 4B3SK 4BR9A 4JRPA 2P5OA 1GLJO 3ZT2A 4KHSA 1RILA 4GY2B 3WQTA 2HOEA 3SI6A 3CCJN 1HQEA 3LPUA 3FZFA 2ZGYA 3CCMN 4I6MB 4LF6K 4IOAL 2UU9K 1ILYA 4FWOA 1HNWK 3KWGA 2D0BA 1RT3A 2A1SA 5AR0A 4JKFA 4A2AA 1X9MA 4FJHA 5AQGA 3G71N 3F9MA 3ENHA 3WEEA 4JD2A 4KHUA 3KZBA 3N4QA 5JICA 1BCMA 2O4IA 2UXDK 2UUAK 3P31A 5HOOA 3VEYA 1E4GT 3PUFA 2P9SA 1B9FA 3NVKA 4OKJA 2HSTA 3MEGA 3OYDA 1GLCG 1XHXA 4CEFA 2HVIA 4I2PA 4E7IA 3DAWA 2A40A 2ASMA 1HQUA 1JKHA 2HB5A 3MCPA 2QTDA 2I5JA 3CQXA 4BRKA 5AQPA 4B08A 2A1RA 1NJIO 5AQSA 4MDBA 3O08A 3S9HA 3C6TA 1WSFA 3J7AP 1QQNA 4J8FA 2DTUA 2CGJA 4B9TA 1LW2A 5I42A 4FLWA 2QWOA 3AA2A 2V51B 4CJ3A 1RTDA 4CCHA 2UUBK 3LWLA 2Q31A 4CZHA 2BUPA 3ZT3A 1DTTA 1RGIA 5AQFA 3C94A 1BI4A 3FZKA 4O5FA 5I9EB 1C0UA 3CJ1A 1WBBA 3RMCA 2WTUA 3K58A 4B9VA 3V1QA 4OKKA 1N34K 2OPSA 4V19S 1BUPA 1L3SA 4A5BA 1VQMN 2IVNA 1BA1A 3GDQA 5AQWA 3ZSWA 4FVMA 3GL1A 1C0GA 1NOZA 3R3LA 4CEZA 4IFYA 1G99A 4CJSA 1A5XA 5LY3A 1NGAA 3J7YP 3LALA 3QIPA 4B1VA 1NGJA 1BISA 1ZBIA 1KVCA 4CE9A 4TSXA 4NLCA 1F21A 3O3HA 3VQDA 1KD1O 3P83D 3L2VA 3L0QA 1VQKN 3VF2A 3K5OA 4ID5A 1KAXA 4OGEA 4DSEA 4C1NK 3ZT1A 2VWKA 4RW8A 5ELZA 3ZYYX 3K0SA 2OTLN 3SYZA 5BPLA 1LAWA 5M1PA 3VEVA 1WOQA 4FXDA 1NGBA 2ASPA 4RW6A 3O9UA 4MDAA 3E66A 3K5MA 4DV2K 3QB0A 3OS0A 1YAGA 4O4GA 4BY9C 1D8YA 2PZSA 1YF5L 3CYMA 1KC8O 2P9NB 4CGHA 3L3VA 3M8QA 5M1QA 3SJHA 4RCHA 5M1NA 1U45A 1YT3A 3OYCA 2YX6A 4BRFA 1DT9A 4BACA 3MN5A 3OYMA 1T7PA 4CEOA 3NE6A 3C95A 1VQ4N 3DLBA 3GE1A 3VTHA 4WFBL 2OPQA 4LF4K 3TSUA 5AQZA 3OW2M 5BRFA 3WUHA 3EYZA 2IIRA 2RHKA 3LDOA 3SQ1A 4BREA 2Z1IA 1GOCA 3THXB 3R6MA 1IO2A 3HTVA 4B9NA 4FLZA 3T19A 4DSFA 1RT4A 4HWIA 1FW6A 3AVLA 2P9LB 1N8RO 1RT5A 3SAFA 1H1VA 3VEOA 1DGKN 3RVCA 3WXLA 1ZC6A 4B3TK 3RTVA 1Q8IA 3MEDA 1U48A 4LF8K 2FBYA 1T8EA 4FWKA 3LPTA 5CZ1A 4W5QA 4FLTA 2NRZA 4IG0A 4O5BA 5KQDA 1C0MA 3TSPA 4Z4IA 2P9PB 2D0PA 4IO9L 5HBMA 2BE2A 4H8KA 4FLYA 2QEXN 5LMNK 2QWQA 4DR2K 4JS5A 3PY8A 2HHSA 4DFKA 3A5OC 4LFCK 4BGAA 4HVJA 4N41A 3ULEB 1SAZA 1JLGA 3BZKA 2YHBA 3HL8A 1L5UA 1RDWX 1RFQA 4CGIA 1EETA 2I7PA 1YUWA 1ITGA 2G8IA 3I56N 2Y1IA 4KTZA 5C2FA 3KKSA 4XH1A 4IOCL 3TWHA 3G0ZA 3CI5A 4QAGA 3QFUA 2HF4A 5M1FA 2GWJA 1C1CA 1K8KA 3VQQA 4CIGA 1RT2A 3SAHA 5J2NA 1K9MO 1EKEA 3VEWA 4X64K 3WT0A 4K42A 1VSFA 2KKZA 3OYNA 4B1ZA 4IZ9A 1VSEA 4ID1A 3SMSA 3MXIA 3WEEB 1TGOA 1XMOK 1S3XA 4CJRA 1VRTA 3MECA 4L8RB 3FZHA 4FSVA 4BR0A 2FSNA 4LF7K 2B4JA 3B8AX 5HLFA 4KB1A 3IG1A 4JHDB 1WN7A 3P4IA 3LWMA 2P9SB 2VQEK 1TYQB 3RWUA 2BGGA 5DMRA 2RPIA 3NCIA 3RMDA 1NMNA 3PV8A 3CJAA 4LFAK 4LY7A 3R8EA 3UKUB 1X3MA 2F9TA 3S3MA 2QWNA 1IH7A 3KHYA 5KRTA 2DFHA 3H1VX 3MN9A 3THWA 4Z4FA 1HLUA 3DLGA 3AA5X 1ASUA 4CW7B 1Z25A 4PL8A 4W5NA 1CZBA 2B6AA 3M5RA 3J7ZO 2RN2A 3C7NA 4FJJA 2R7YA 5C12A 4DQRA 5AQTA 4Z4EA 3NDKA 4CF0A 3VOVA 4AHUA 3HT3A 1BI4B 4EP4A 4E7JA 2IVPA 3OTOK 2D5RA 4DFPA 5C25A 4K41A 3OVNA 4M3UA 3SJJA 1ZBUA 4ZTJA 1M1KO 3V6DA 2QXFA 3G25A 1VQ8N 4CZJA 1DKGD 2E5LK 4FWPA 4MO4A 5E84A 1XC3A 1R59O 2V7ZA 4EZ6A 4JI0K 1Q82O 4FWMA 4JI7K 2V52B 4H03B 2WUSA 4CEBA 4JRQA 4A5AA 4Q0BA 3VN5A 1RBVA 2XY5A 1U6ZA 2E6LA 3DXKA 3C0BA 4IJNA 4FM1A 1NWKA 2NNWA 2F8SA 4EAHD 4YORA 1T3VA 3MWPA 5CZ2A 5LMUK 4C8LA 5FPDA 4H0OA 1CXUA 5DK5A 1NGCA 2GWKA 4JLHA 4HCCA 2O8DA 4MLHA 3KK1A 1TK8A 3QBWA 4M3XA 1LWCA 3GOIA 1Q81O 3QNOA 4M3TA 2BDPA 3IDHA 1JL2A 1IV0A 3FGUA 1IKXA 1TKDA 3TTFA 2E1YA 4AHCA 3KK2A 1I94K 1HRHA 3ASMA 4K8XA 4OPKA 4PL7A 4XH5A 4W5TA 1RT7A 4FK4A 1RBSA 3HRGA 1NK5A 3WQUA 3SNNA 3EE8A 4FM0A 4WQ5A 1KLMA 4DS5A 3GG4A 2GUPA 3VQBA 4DV4K 3QICA 4AHSA 4CJUA 4DB3A 5GIPA 2DPNA 3A2FA 3LZIA 3ATUA 4Q5VA 1S1XA 3S3OA 2AP1A 3QETA 4O44A 4FJ5A 4UY8O 3MX2A 5HRPA 3LDQA 3N4PA 4BR2A 3CMEN 1W7AA 1RDAA 5F0XA 1IKWA 4H0XB 5K14A 1FKPA 3U4LA 3ZSVA 3LDPA 4CK3A 1RT6A 3V9SA 4LD0A 3LM9A 4DV1K 1SQKA 3SUOA 2YNFA 4IBNA 1QSLA 3K5LA 3I0RA 3CJ9A 4JKHA 3NGYA 5AQOA 1J5EK 3VESA 3CCRN 3O9RA 5GAGP 4O0IA 4WF9L 2DFEA 2PFUA 2NRHA 4EP5A 3VQEA 4GNIA 3VF4A 4B9QA 3G10A 1JLFA 2OYQA 4DQIA 4LFBK 3D2EB 1WBDA 3RMAA 1QQCA 3P1GA 4DQ8A 2J4RA 4DSKA 3TI0A 3W3DA 3I33A 1BL3A 1W2BM 2NRRA 4CJFA 4NLBA 2WONA 1NG9A 5EOYA 4JI2K 5CYMA 4O0JA 1B92A 1CZ9A 2P9IA 3HM9A 3B6PA 2E4LA 1X9JA 4KKOA 4DV6K 3V9UA 1JLQA 4WQ4A 4F8RA 4CF9A 3T1HK 1HNZK 4QS8A 1BDGA 4B9UA 3ZETB 1KVAA 1HKCA 1B9DA 5E41A 1SKSA 1KXPA 2IS3A 1NJZA 2QXLA 3EN9A 3H1QA 3MMVA 1DEJA 2OZSA 2ITGA 4N76A 1QQMA 5H1SQ 3K59A 3KVGA 2X6NA 5FRNA 4FK0A 3D2FB 1K73O 4FWNA 3AO1A 4U67L 2YHXA 3ZCMA 3WXKA 5AQMA 2VQFK 4JAXA 1KQSM 3OYKA 2A42A 4EZ9A 1VSKA 3MN6A 1UWBA 4KRFA 2O8CB 4JKCA 4J2AA 2VYPA 3UE5A 3HO1A 1TUYA 4IJAA 1NK9A 1RT1A 4BC3A 2YKMA 1HJOA 1S22A 2ASOA 3VEZA 4ICLA 2NZTA 1HNXK 1NNEA 1T05A 2WBNA 5BRHA 4BRHA 3EO3A 1W97L 4CGJA 5DM6L 1MDUB 3VQ6A 2D1KA 3OYAA 4PY5A 4DU3A 4BRQA 4B3RK 2P9KA 1X3NA 3H45C 3DJCA 4JKGB 5J1EA 1WSIA 3AVGA 3S41A 3CXCM 2HBMA 1JCEA 1U2VA 2VGNA 3KK3A 3PLAA 2G8KA 1NKBA 5AQHA 4HCBA 3AVIA 4DQPA 3KLHA 2NRVA 1S1VA 2ETJA 4MFBA 4N56A 1T03A 3NFAA 1S9EA 4Y1DA 3PX0A 1E4FT 4CGGA 3B6OA 5AFUA 4HHTA 3EZ5A 4M3YA 4FM2A 3BP8A 4LC9B 4AM6A 1XHZA 4J2BA 2YNIA 2HMPA 3EY1A 3WXMB 4A59A 2Q0RA 3TTDA 2HBJA 4NXNK 4DV0K 4DU4A 4K8ZA 3SQ0A 1NJXA 1LCUA 3JAMO 3HSCA 4QCLA 3LP3A 3BZCA 3PSFA 2O8EB 3CHWA 2G8UA 2XY6A 4MQ3A 1BCOA 4NYFA 1Y64A 1D4XA 2YV0X 1KFDA 2OPPA 1SL1A 3FE1A 4NO7A 4L3QA 5C0YA 3T7ZA 3AO2A 4OVLA 3TAFA 1BGXT 3HOSA 2G8FA 4AHVA 1Z26A 2P5GA 2OCEA 1OKJA 1OVQA 3AVJA 4FJNA 4YDUA 3PIOL 4IKFA 2YJEA 2ZJRL 4FWLA 5GINA 4IXCA 4WQ5C 2HHHK 4H5RA 3AAQA 3PIPL 4BDPA 3J80O 2IC3A 1P90A 3W0LA 4JI1K 4CJLA 4PA1A 1VQLN 3CG7A 4OKEA 3QMLA 3CCLN 4KI6A 3NMUA 3OA9A 4JI5K 1OVYA 1FK9A 4BR5A 4GW6A 4DSIA 3O4QA 2G8HA 4DV7K 3ZX3A 4HTUA 3DRSA 1LOTB 1NK0A 2CH6A 4DTPA 1EQYA 1X9WA 4YOTA 4EHUA 3KLGA 2JWLA 3E1YA 1EWRA 2PAVA 5KGXA 3RSEA 4PHTX 3HJFA 2E8AA 1BIZA 3LAKA 2QA4N 3QFPA 3AVHA 2NUBA 1VRUA 1S1WA 3I0SA 3VA0A 2XY7A 3V81A 3CCSN 3DLHA 4BC4A 1BOTO 1ZBFA 3AO5A 3BY5A 4CFBA 3OJSA 1TKTA 2G8VA 2JWKA 4FK2A 4RW7A 1J54A 4E7LA 1YJWN 5D3GA 2OZMA 1NGHA 4DHYA 4Z4HA 3QO9A 1O13A 3NBPA 1TK5A 3VQ9A 5ADXH 4OX9K 2HMIA 5AZIA 4X62K 3O3FA 1IBLK 2PYJA 4DR5K 4FW1A 3VENA 5AQXA 4ISFA 3SUNA 2YNHA 4DTXA 3L2QA 2FF3B 3IFRA 1NK8A 4Z4GA 1XQSC 4BRGA 5HRRA 3KK7A 1HMVA 5KPTA 3VQ8A 3NH0A 2O8FA 3KTQA 3NVMA 4WQ4C 4NXMK 4AF1A 4CF2A 3NH2A 2KZMA 4CFDA 3ID8A 2QI2A 3DXMA 1CLQA 4Z4CA 1TL1A 3VQ5A 4LH4A 4CHPA 1MA9B 3TAMA 4JS4A 1WLJA 2NRTA 1P8ZA 1RBUA 5AQKA 2P9IB 1VQON 4M3RA 1IG9A 3O4NA 4DR6K 5KI6A 3CM5A 3M8PA 5LJVA 3UB5A 4BVPA 3QINA 4CJWA 1RDDA 4AILC 1NJYA 5E26A 4FLVA 3M1FA 4B1WB 4DUYK 3ENBA 5M1OA 3OYIA 5HL7L 3CCQN 3RR7A 4GMJB 1NK6A 3FLCO 4A57A 2FF6A 4M3WA 4JKAA 3LL3A 3C6HA 3KLFA 2EWSA 3F5TA 3DLRA 1V4SA 3CERA 1KFSA 4CZIA 4F9OA 4CECA 3DYAA 1Q7YO 5JVHL 5C24A 3AARA 3AA3A 4K43A 3ZEUB 2OTJN 3H6EA 5FRMA 4CEDA 2UYTA 1T6CA 2HW3A 4H0YB 1Y97A 1YVNA 2YKNA 1JXEA 3D6RA 5GAHP 3SV3A 4CGFA 3CC2N 2LSNA 3CC7N 4LSNA 4B1YB 4CZLA 2QKKA 2XO7A 4YOYA 3VF6A 3WXJA 3HVRA 3I55N 1IKVA 5HROA 1QVGM 2QK9A 1YIJN 2ZM6K 2KFNA 3ZT0A 1VHXA 2XRIA 4DWIA 3ZX0A 1T44A 4KH5A 1TUUA 1YITN 1QTMA 5BR9A 3BEXA 1JLAA 3IS9A 4CJTA 4W5OA 3ZLJA 3JS6A 4PKHA 2Q1NA 4DLEA 2Y1JA 4K25A 3LDSA 1NGGA 4E3SA 3T1AA 5AQQA 1YTAA 4CF1A 4CI6A 3SQ2A 3MEEA 2P9KB 4U7BA 2FBXA 4JD2B 4LF9K 5BRDA 1EX4A 1YVUA 4B3OA 4DTOA 1XUPO 2PBDA 4IG3A 4IFEA 4JYAK 5J2MA 3HI0A 3TABA 3SPZA 3TARA 3AY9A 3KD1E 4BR7A 2HHWA 1BO5O 3QEIA 3S3NA 3OYEA 4FL9A 3SUPA 1D5AA 1HYZA 4DTJA 1GLLO 4RWTA 5SWMA 1RCHA 1YXQA 4XH4A 2E2PA 3T3FA 1XMQK 4FZYA 4CF8A 3A5MC 4C8OA 4EFHA 4DTNA 4YDUC 4ZTFA 3VGMA 2HVHA 4GVEA 1RNHA 3J8AA 1JCGA 5JS2A 3L2WA 2Q36A 4KHQA 2QKBA 3TTCA 4B8AB 3LP1A 3QIOA 4YOUA 4RW9A 3MXMA 1Q9XA 3FR0A 3EZWA 3E9LA 3QEVA 4JV5K 3PX4A 3OBWA 3CFPA 4LF5K 1SKWA 1UA1A 1VAZA 4OPJA 4GVMA 3E9PA 4E1JA 3UKRA 4X66K 4YNQA 3DLEA 1RTJA 4FOEA 4FJ9A 4GV6A 4FO0A 5FROA 3GBTA 3OS2A 3WXIA 3MK6A 4B9MA 4LH5A 3UIQA 2E2QA 2HBKA 2X78A 3R9PA 3F2KA 4CEAA 3FZMA 2Z1HA 3OHRA 1QE1A 2NRWA 4HUEA 4RW4A 1HJRA 4FJLA 2W42A 4J2DA 4KV8A 4H5NA 4YOXA 4OJRA 1TVRA 3K9KA 3LZJA 1KRPA 3A5NC 4M7XA 1C0FA 2UUCK 3OYFA 4DLGA 3CJBA 4FYDA 2W41A 2AA4A 1QHAA 4BRMA 1QSYA 5HRSA 3O4WA 1YJ9N 1JJ2M 2ZF5O 3SQ4A 5KPRA 3DWLA 1M90O 4RG8A 4E1MA 1TAQA 3F9KA 3PO5A 2QM1A 1VQ9N 3DLKA 4OO1J 4FCYA 4KO0A 4H5TA 1YJNN 1TAUA 3U3GA 1NGDA 1QZ6A 4NCAA 3LP2A 2ZJPL 3ZSXA 3HPOA 4DFMA 4GKJK 4CVNE 5C2DA 1EP4A 4OGCA 2IAJA 2AJQA 3MXJA 3NF6A 2BTFA 4M45A 5TKWA 4PKGA 3WNHA 4M42A 4C1NI 1QS4A 3JXUA 5B8HA 4KI4A 4DV3K 2DFFA 2HF3A 5CHIA 3QEXA 4ILHA 1MWKA 3DOLA 4XIUA 5IT9O 4JKDA 4CBUA 4RTFD 5EY4A 5KTQA 3OS1A 2W6LA 5C15A 4A2BA 3CMAN 4KHYA 2IOCA 2KZZA 2HHQA 3IAYA 5GADP 3D0PA 4N47A 4CBWA 4FLUA 3OYGA 4BDZA 3OJUA 2X74A 1NU0A 3U6FA 1SZ2A 4H0PA 1GLBG 3O6WA 4CZGA 4HUFA 3U3YA 1KVBA 3WNFA 3KLIA 4NCBA 4LSLA 3K5NA 4YHHK 4I2QA 3ID6A 4CHYA 4KHPK 2A3ZA 3BGRA 3BF3A 5ADXA 3DOKA 3CM6A 2JGUA 3OYBA 2HHTA 4CZKA 3SV4A 2I7NA 3O80A 1NKEA 3CQYA 3THXA 5AQRA 5LL6Z 2DY4A 5F2RA 4CHQA 1HYSA 3SLCA 3FFKB 3P39A 2GTDA 1IBKK 1C1BA 3LANA 2UXCK 3L2RA 3WNGA 4BWJA
chains in the Genus database with same CATH topology
1C1AA 1TK0A 5CY4A 4BDPA 2VWJA 4FJ7A 3NF8A 2IC3A 4KTWA 3KJVA 4JS5A 3DI6A 1UA0A 3PY8A 4F3OA 1S5JA 1U04A 3ZT4A 4FJ8A 4DFKA 2HHSA 2Z1GA 3QLHA 4CJLA 3HPGA 2ZQBA 4PA1A 3AVAA 1RDBA 3CG7A 4OKEA 3TR8A 3HPHA 2GV9A 1XI1A 2Z1JA 1JLGA 1D9DA 4BDYA 2YHBA 3HL8A 3QEWA 4KI6A 1JLBA 3RMBA 1L5UA 3VQ4A 3NGZA 2D0CA 3NF9A 4CGIA 4DQQA 1EETA 1JL1A 3VQCA 4CJQA 4BE2A 4QOZB 1VSLA 1FK9A 1ITGA 3QNNA 2FBTA 2G8IA 4PQUA 4GW6A 2Y1IA 3O4QA 4KTZA 3RRHA 2G8HA 4DSIA 4M41A 3KKSA 4HTUA 3VQAA 2E6MA 3TWHA 3DRSA 4CEEA 3G0ZA 3OYJA 2PY5A 4F2RA 1WSEA 1X1PA 4QAGA 4DTPA 4DFJA 1NK0A 4UQGA 2XY8A 1X9WA 3KLGA 1REVA 3SCXA 2HVHA 1I3AA 5KGXA 3O3GA 1C1CA 1WSHA 1NK4A 3HJFA 3VQQA 4CIGA 1UAXA 1JLEA 1RT2A 1BIZA 2F96A 3LAKA 1SV5A 4E19A 5J2NA 3AVHA 2NUBA 1VRUA 1S1WA 3I0SA 1FXXA 3VA0A 1EKEA 3QESA 2XY7A 3V81A 3DLHA 4F2SA 1WAJA 1VSFA 1ZBFA 1SL0A 3HYFA 1O1WA 3OYNA 3V9ZA 4DF4A 3AO5A 4CFBA 5HRNA 3V9XA 1VSEA 4ID1A 4I9LA 3OJSA 1N5YA 1TKTA 2G8WA 1TV6A 2GBZA 4YFUA 2G8VA 1W0HA 3MXIA 4CHOA 4FK2A 4RW7A 1J54A 4E7LA 1TGOA 5D3GA 2OZMA 2XHBA 4CJRA 1SUQA 1VRTA 3MECA 3PX6A 4KB0A 4L8RB 4Z4HA 3QO9A 3NBPA 1TK5A 3VQ9A 2B4JA 5HLFA 2VG5A 3CQ8A 4KB1A 3IG1A 2HMIA 3O3FA 1WN7A 3L8BA 4CK1A 3LWMA 3V4IA 3AVCA 1L3UA 2PYJA 5FDLA 3ZSOA 4CIEA 1D9FA 4FW1A 3RWUA 2BGGA 1RTHA 3SUNA 2YNHA 4DTXA 1ZBHA 1WSGA 5DMRA 2RPIA 3TAQA 3L2QA 4CGDA 3NCIA 3RMDA 4DTSA 3PV8A 4O55A 1NK8A 4DMNA 3AV9A 2VG6A 4LY7A 4Z4GA 3L2UA 3OY9A 2WOMA 4BE1A 4ELVA 3S3MA 4ELTA 4CFAA 5HRRA 1HMVA 1IH7A 2HHUA 3VQ7A 3VQ8A 4B9LA 1VSHA 3CFRA 4FLXA 3ZSZA 3KD5E 5KRTA 3C6UA 3NH0A 3KTQA 2DFHA 3BDPA 3NF7A 3NH2A 4CF2A 2KZMA 3KLEA 1ZBLA 4B8CA 4CFDA 4Z4FA 5KRSA 4FJGA 4CESA 3DLGA 3AA5X 1ASUA 3ALYA 4FJKA 4CJVA 1J9AA 1Z25A 1WSJA 5SZTA 1CLQA 2EHGA 4Z4CA 1CZBA 4W5NA 1TL1A 2B6AA 3VQ5A 1S1TA 2RN2A 4LH4A 4CHNA 4CHPA 3TAMA 4JS4A 4OLAA 4FJJA 2B5JA 2R7YA 3IRXA 1WLJA 4DQRA 4NYNA 4Z4EA 3NDKA 3TAPA 1RBUA 3AVKA 4CF0A 3JSMA 4M3RA 4AHUA 3O4NA 1IG9A 5KI6A 1GOAA 3HT3A 3HK2A 1BI4B 2X6SA 1WAFA 4EP4A 1L3VA 4E7JA 4DS4A 2YHAA 4PWDA 3CM5A 4ZHRA 3M8PA 3TAEA 1KTQA 3E01A 2D5RA 4DFPA 2FBVA 2JLEA 3DMJA 3QINA 1RDDA 3OVNA 4CJWA 5C25A 4AILC 5HP1A 1NJYA 4FLVA 4KPYA 3SJJA 4M3UA 3JYTA 3V1RA 1ZBUA 4ZTJA 3V6DA 2QXFA 4AHRA 4CJ5A 4E7HA 3RR8A 2HHXA 1BHLA 1A5WA 3D45A 1S9GA 3OYIA 3RR7A 4GMJB 4AHTA 4KAZA 1NK6A 4M3ZA 1TL3A 4EZ6A 2GUIA 4N5SA 4C8NA 1VSJA 4M3WA 1S6QA 1R0AA 2F8TA 3KLFA 4CEBA 4JRQA 4Q0BA 3DLRA 3VN5A 1RBVA 2XY5A 4E1NA 2E6LA 1RDCA 1KFSA 1J53A 3WNEA 4FM1A 3VA3A 4G1QA 4CECA 3DYAA 3KIOA 2F8SA 5C24A 1DTQA 3AVNA 4CEQA 3AA3A 3VQPA 5CZ2A 3K57A 5FRMA 1VSMA 4OLBA 1HNVA 4CEDA 4C8LA 4KTQA 4B9SA 2HW3A 4DG1A 2KFZA 4WE1A 1CXUA 5DK5A 1Y97A 2YKNA 1JXEA 3PO4A 3TANA 1ASVA 3SV3A 4CGFA 4JLHA 4HCCA 1TK8A 3KK1A 2LSNA 4KFBA 4CJPA 4LSNA 3RRGA 1JLCA 2OPRA 4CJKA 2XO7A 5J2PA 3TAGA 2QKKA 3DM2A 4M3XA 1LWCA 2HNDA 2D0AA 2HNYA 5JS1A 3HVRA 3DRRA 1IKVA 3QNOA 5HROA 4IDKA 4M3TA 2QK9A 3AO3A 1NJWA 2BDPA 1BQNA 2IGIA 2KFNA 3ZT0A 1JL2A 3OYLA 1VSIA 2XRIA 3AO4A 4DWIA 1IKXA 2ZD1A 1FKOA 4DTRA 1TKDA 2YNGA 4FJMA 4Z0UA 4HVJA 4CJEA 4AHCA 3KK2A 1LAVA 1QTMA 1HRHA 3ASMA 1KSPA 3IS9A 1JLAA 4CJTA 4W5OA 3HP6A 1LV5A 4K8XA 4DLEA 2O4GA 4OPKA 2Y1JA 3LDSA 4F4KA 4W5TA 1RT7A 5I3UA 4E3SA 1UOCA 3T1AA 4FK4A 3DRPA 1YTAA 4CF1A 1RBSA 1NK5A 1C0TA 3SQ2A 3MEEA 4JRPA 2P5OA 3SNNA 2FBXA 3ZT2A 4FM0A 4E0DA 1KLMA 1EX4A 4FJIA 1YVUA 4I7FA 4DS5A 4PUOA 4KHSA 1RILA 3VQBA 4B3OA 4CFCA 3SI6A 4DTOA 1HQEA 3H08A 3LPUA 4AHSA 4IG3A 4CJUA 4CHZA 3A2FA 3LZIA 5J2MA 4Q5VA 3KKRA 1S1XA 1NOYA 3TABA 3SPZA 3S3OA 3QETA 3TARA 4O44A 3KD1E 4FJ5A 3ITHA 1TKZA 3ZSQA 2PYLA 3QEIA 5HRPA 3S3NA 2HHWA 3OYEA 3CFOA 1RDAA 2D0BA 1IKWA 3SUPA 2IDOA 1RT3A 2A1SA 3P5JA 4KREA 1D5AA 1HYZA 5K14A 1FKPA 4BWJA 4DTJA 4DTUA 3ZSVA 1X9MA 4CK3A 1U4BA 4FJHA 4ELUA 5EU7A 1RT6A 5SWMA 3V9SA 4LD0A 1RCHA 4KHUA 3HSTB 4W5RA 2O4IA 3SUOA 1BCMA 2YNFA 4IBNA 1QSLA 1YTUA 3K5LA 1KCFA 1G15A 1LWFA 3I0RA 3T3FA 1BQMA 3AA4A 4FZYA 3K2PA 3NGYA 4CF8A 3PUFA 1B9FA 4C8OA 4DTNA 4OKJA 3MEGA 5C42A 1RBTA 3OYDA 1LW0A 1XHXA 4ZTFA 4CEFA 1RTIA 4O0IA 1KLNA 1RNHA 4I2PA 2HVIA 2DFEA 4FZXC 4E7IA 5KGWA 5JS2A 3L2WA 4KHQA 2QKBA 1W9HA 3HP9A 4B8AB 3LP1A 3QIOA 4EP5A 3VQEA 1HQUA 1RBRA 4RW9A 3MXMA 1JKHA 1Q9XA 3G10A 1JLFA 2HB5A 1DLOA 3QEVA 3FFIA 2I5JA 2OYQA 4DQIA 4B08A 2A1RA 5CYQA 1QQCA 4BE0A 3PX4A 3RMAA 1Q9YA 3P1GA 3CFPA 4Y1CA 1IKYA 4DSKA 3V1OA 2RKIA 1ASWA 3C6TA 3S9HA 1SKWA 3TI0A 1WSFA 1UA1A 4OPJA 1BL3A 1VSDA 2DTUA 4CJFA 4GVMA 4B9TA 1LW2A 2WONA 5I42A 4FLWA 1NK7A 3AA2A 3MAQA 4CJ3A 3F73A 3SZ2A 3M8SA 1L3TA 4YNQA 1RTDA 3DLEA 5CYMA 4O0JA 4CCHA 4FW2A 4KHNA 4DSJA 1RTJA 1J5OA 4C8MA 3LWLA 4FJ9A 1HYVA 1B92A 1CZ9A 3ZT3A 3HM9A 1DTTA 1S6PA 2BANA 2E4LA 3B6PA 5FROA 4KKOA 3OS2A 3HXMA 3C94A 1BI4A 3V9UA 1JLQA 4B9MA 1C0UA 4F8RA 4CF9A 4LH5A 3UIQA 3NHGA 3RMCA 4B9VA 3K58A 3ULDA 4E89A 3V1QA 1X9SA 4OKKA 4N41A 2HNZA 2X78A 1U49A 2OPSA 4CEAA 1L3SA 3SUQA 4DU1A 2Z1HA 4CJ4A 4B9UA 1QE1A 1KVAA 3NGIA 3QERA 4CIFA 4I9QA 4HUEA 4RW4A 1HPZA 1B9DA 1ZYQA 5E41A 1SKSA 3ZSWA 2IS3A 1NJZA 1HJRA 1S1UA 1NOZA 2EX3A 4FVMA 4FJLA 2W42A 4J2DA 4KV8A 2OZSA 4CEZA 4IFYA 2ITGA 2P51A 4OJRA 4CJSA 1TVRA 1A5XA 4N76A 3LZJA 1KRPA 3K59A 2X6NA 3SPYA 4FK0A 5FRNA 3LALA 3AO1A 3QIPA 1CXQA 3OYFA 1N6QA 4DLGA 3ZCMA 1BISA 2ATQA 1KVCA 2KQ2A 4DTMA 4CE9A 1ZBIA 4FYDA 4TSXA 3THVA 1F21A 3O3HA 3VQDA 3ZSRA 3OYKA 3P83D 4EZ9A 3L2VA 1QSSA 1QSYA 1VSKA 4DQSA 5HRSA 1QHTA 1UWBA 3K5OA 3NAEA 4KRFA 4ID5A 3SQ4A 4J2AA 4OGEA 4DSEA 3I8DA 3ZT1A 4BWMA 2VWKA 4RG8A 4E1MA 1TAQA 4RW8A 3F9KA 3ZSYA 3PO5A 3HO1A 1NK9A 1RT1A 3DLKA 3LAMA 4FCYA 4KO0A 2YKMA 2FC0A 3NH1A 3SYZA 1TAUA 3U3GA 1HNIA 1LAWA 4NCAA 4KHWA 3LP2A 1JXBA 5J2QA 1SL2A 3ZSXA 3HPOA 4E7KA 2KW4A 4DFMA 4FXDA 2Q3SA 4RW6A 4ICLA 4H4OA 1EP4A 4OGCA 1MU2A 1XC9A 2RF2A 1T05A 2IAJA 2AJQA 3MXJA 3NF6A 4CGJA 3K5MA 4AH9A 4M45A 3VQ6A 3OS0A 3WNHA 3OYAA 4PY5A 4M42A 1QS4A 4O4GA 4DU3A 1XWLA 2VG7A 4KI4A 4DSLA 1D8YA 2DFFA 3AVMA 4H4MA 3QEXA 2PZSA 3CYMA 4CGHA 3L3VA 3M8QA 4IFVA 3DOLA 5J1EA 4XIUA 3M8RA 1WSIA 3AVGA 1U45A 4R5PA 1TKXA 1YT3A 5KTQA 3OYCA 3OS1A 3KK3A 4BACA 1NKCA 3OYMA 1T7PA 4KHYA 2IOCA 4CEOA 2KZZA 2G8KA 1NKBA 2HHQA 3NE6A 3IAYA 4HCBA 1WNSA 3C95A 3DLBA 3AVIA 4DQPA 3D0PA 3KLHA 4N47A 1S1VA 2ETJA 4MFBA 2OPQA 4FLUA 4N56A 3OYGA 3OJUA 4BDZA 3NFAA 1T03A 2X74A 1S9EA 4FJXA 4Y1DA 3PX0A 4CGGA 3U6FA 3B6OA 3LP0A 1VK0A 4HHTA 1A5VA 4NCGA 3EZ5A 4FM2A 4M3YA 3EYZA 3SQ1A 4HUFA 3QEPA 1XHZA 4J2BA 2YNIA 2Z1IA 1GOCA 1LWEA 1KVBA 3U3YA 3WNFA 3KLIA 1IO2A 4NCBA 1SKRA 3EY1A 4B9NA 1K6YA 4LSLA 1EXQA 3T19A 4CERA 3K5NA 4FLZA 4DSFA 1RT4A 4DU4A 4J2EA 1BIUA 4I2QA 4K8ZA 3SQ0A 1NJXA 4CHYA 1GOBA 3AVLA 2OA8A 3OYHA 2HHVA 1RT5A 3BGRA 3DOKA 4QCLA 3LP3A 3CM6A 4CK2A 2JGUA 4FZZA 3ISNC 4HUGA 3OYBA 2HHTA 2G8UA 2XY6A 4MQ3A 1BCOA 3RTVA 1Q8IA 3MEDA 3AVFA 4NYFA 1U48A 2FBYA 4F3TA 2YV0X 2KTQA 1KFDA 2OPPA 1C6VA 3AVBA 3SV4A 1U47A 1SL1A 1T8EA 3LPTA 3AO2A 4OVLA 2ZE2A 5CZ1A 3TAFA 1BGXT 4W5QA 1NKEA 2G8FA 3HVTA 4DF8A 4AHVA 4FLTA 2DY4A 4CHQA 4IG0A 4O5BA 1HYSA 4C8KA 1Z26A 3WNGA 2P5GA 1C0MA 1C1BA 4Z4IA 3AVJA 3V9WA 4FJNA 2P1JA 4IKFA 5HBMA 2BE2A 3LANA 1I39A 3L2RA 4H8KA 4FLYA 3L3UA 5T7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C1A A;  1TK0 A;  5CY4 A;  4BDP A;  2VWJ A;  4FJ7 A;  3NF8 A;  2IC3 A;  4KTW A;  3KJV A;  4JS5 A;  3DI6 A;  1UA0 A;  3PY8 A;  4F3O A;  1S5J A;  1U04 A;  3ZT4 A;  4FJ8 A;  4DFK A;  2HHS A;  2Z1G A;  3QLH A;  4CJL A;  3HPG A;  2ZQB A;  4PA1 A;  3AVA A;  1RDB A;  3CG7 A;  4OKE A;  3TR8 A;  3HPH A;  2GV9 A;  1XI1 A;  2Z1J A;  1JLG A;  1D9D A;  4BDY A;  2YHB A;  3HL8 A;  3QEW A;  4KI6 A;  1JLB A;  3RMB A;  1L5U A;  3VQ4 A;  3NGZ A;  2D0C A;  3NF9 A;  4CGI A;  4DQQ A;  1EET A;  1JL1 A;  3VQC A;  4CJQ A;  4BE2 A;  4QOZ B;  1VSL A;  1FK9 A;  1ITG A;  3QNN A;  2FBT A;  2G8I A;  4PQU A;  4GW6 A;  2Y1I A;  3O4Q A;  4KTZ A;  3RRH A;  2G8H A;  4DSI A;  4M41 A;  3KKS A;  4HTU A;  3VQA A;  2E6M A;  3TWH A;  3DRS A;  4CEE A;  3G0Z A;  3OYJ A;  2PY5 A;  4F2R A;  1WSE A;  1X1P A;  4QAG A;  4DTP A;  4DFJ A;  1NK0 A;  4UQG A;  2XY8 A;  1X9W A;  3KLG A;  1REV A;  3SCX A;  2HVH A;  1I3A A;  5KGX A;  3O3G A;  1C1C A;  1WSH A;  1NK4 A;  3HJF A;  3VQQ A;  4CIG A;  1UAX A;  1JLE A;  1RT2 A;  1BIZ A;  2F96 A;  3LAK A;  1SV5 A;  4E19 A;  5J2N A;  3AVH A;  2NUB A;  1VRU A;  1S1W A;  3I0S A;  1FXX A;  3VA0 A;  1EKE A;  3QES A;  2XY7 A;  3V81 A;  3DLH A;  4F2S A;  1WAJ A;  1VSF A;  1ZBF A;  1SL0 A;  3HYF A;  1O1W A;  3OYN A;  3V9Z A;  4DF4 A;  3AO5 A;  4CFB A;  5HRN A;  3V9X A;  1VSE A;  4ID1 A;  4I9L A;  3OJS A;  1N5Y A;  1TKT A;  2G8W A;  1TV6 A;  2GBZ A;  4YFU A;  2G8V A;  1W0H A;  3MXI A;  4CHO A;  4FK2 A;  4RW7 A;  1J54 A;  4E7L A;  1TGO A;  5D3G A;  2OZM A;  2XHB A;  4CJR A;  1SUQ A;  1VRT A;  3MEC A;  3PX6 A;  4KB0 A;  4L8R B;  4Z4H A;  3QO9 A;  3NBP A;  1TK5 A;  3VQ9 A;  2B4J A;  5HLF A;  2VG5 A;  3CQ8 A;  4KB1 A;  3IG1 A;  2HMI A;  3O3F A;  1WN7 A;  3L8B A;  4CK1 A;  3LWM A;  3V4I A;  3AVC A;  1L3U A;  2PYJ A;  5FDL A;  3ZSO A;  4CIE A;  1D9F A;  4FW1 A;  3RWU A;  2BGG A;  1RTH A;  3SUN A;  2YNH A;  4DTX A;  1ZBH A;  1WSG A;  5DMR A;  2RPI A;  3TAQ A;  3L2Q A;  4CGD A;  3NCI A;  3RMD A;  4DTS A;  3PV8 A;  4O55 A;  1NK8 A;  4DMN A;  3AV9 A;  2VG6 A;  4LY7 A;  4Z4G A;  3L2U A;  3OY9 A;  2WOM A;  4BE1 A;  4ELV A;  3S3M A;  4ELT A;  4CFA A;  5HRR A;  1HMV A;  1IH7 A;  2HHU A;  3VQ7 A;  3VQ8 A;  4B9L A;  1VSH A;  3CFR A;  4FLX A;  3ZSZ A;  3KD5 E;  5KRT A;  3C6U A;  3NH0 A;  3KTQ A;  2DFH A;  3BDP A;  3NF7 A;  3NH2 A;  4CF2 A;  2KZM A;  3KLE A;  1ZBL A;  4B8C A;  4CFD A;  4Z4F A;  5KRS A;  4FJG A;  4CES A;  3DLG A;  3AA5 X;  1ASU A;  3ALY A;  4FJK A;  4CJV A;  1J9A A;  1Z25 A;  1WSJ A;  5SZT A;  1CLQ A;  2EHG A;  4Z4C A;  1CZB A;  4W5N A;  1TL1 A;  2B6A A;  3VQ5 A;  1S1T A;  2RN2 A;  4LH4 A;  4CHN A;  4CHP A;  3TAM A;  4JS4 A;  4OLA A;  4FJJ A;  2B5J A;  2R7Y A;  3IRX A;  1WLJ A;  4DQR A;  4NYN A;  4Z4E A;  3NDK A;  3TAP A;  1RBU A;  3AVK A;  4CF0 A;  3JSM A;  4M3R A;  4AHU A;  3O4N A;  1IG9 A;  5KI6 A;  1GOA A;  3HT3 A;  3HK2 A;  1BI4 B;  2X6S A;  1WAF A;  4EP4 A;  1L3V A;  4E7J A;  4DS4 A;  2YHA A;  4PWD A;  3CM5 A;  4ZHR A;  3M8P A;  3TAE A;  1KTQ A;  3E01 A;  2D5R A;  4DFP A;  2FBV A;  2JLE A;  3DMJ A;  3QIN A;  1RDD A;  3OVN A;  4CJW A;  5C25 A;  4AIL C;  5HP1 A;  1NJY A;  4FLV A;  4KPY A;  3SJJ A;  4M3U A;  3JYT A;  3V1R A;  1ZBU A;  4ZTJ A;  3V6D A;  2QXF A;  4AHR A;  4CJ5 A;  4E7H A;  3RR8 A;  2HHX A;  1BHL A;  1A5W A;  3D45 A;  1S9G A;  3OYI A;  3RR7 A;  4GMJ B;  4AHT A;  4KAZ A;  1NK6 A;  4M3Z A;  1TL3 A;  4EZ6 A;  2GUI A;  4N5S A;  4C8N A;  1VSJ A;  4M3W A;  1S6Q A;  1R0A A;  2F8T A;  3KLF A;  4CEB A;  4JRQ A;  4Q0B A;  3DLR A;  3VN5 A;  1RBV A;  2XY5 A;  4E1N A;  2E6L A;  1RDC A;  1KFS A;  1J53 A;  3WNE A;  4FM1 A;  3VA3 A;  4G1Q A;  4CEC A;  3DYA A;  3KIO A;  2F8S A;  5C24 A;  1DTQ A;  3AVN A;  4CEQ A;  3AA3 A;  3VQP A;  5CZ2 A;  3K57 A;  5FRM A;  1VSM A;  4OLB A;  1HNV A;  4CED A;  4C8L A;  4KTQ A;  4B9S A;  2HW3 A;  4DG1 A;  2KFZ A;  4WE1 A;  1CXU A;  5DK5 A;  1Y97 A;  2YKN A;  1JXE A;  3PO4 A;  3TAN A;  1ASV A;  3SV3 A;  4CGF A;  4JLH A;  4HCC A;  1TK8 A;  3KK1 A;  2LSN A;  4KFB A;  4CJP A;  4LSN A;  3RRG A;  1JLC A;  2OPR A;  4CJK A;  2XO7 A;  5J2P A;  3TAG A;  2QKK A;  3DM2 A;  4M3X A;  1LWC A;  2HND A;  2D0A A;  2HNY A;  5JS1 A;  3HVR A;  3DRR A;  1IKV A;  3QNO A;  5HRO A;  4IDK A;  4M3T A;  2QK9 A;  3AO3 A;  1NJW A;  2BDP A;  1BQN A;  2IGI A;  2KFN A;  3ZT0 A;  1JL2 A;  3OYL A;  1VSI A;  2XRI A;  3AO4 A;  4DWI A;  1IKX A;  2ZD1 A;  1FKO A;  4DTR A;  1TKD A;  2YNG A;  4FJM A;  4Z0U A;  4HVJ A;  4CJE A;  4AHC A;  3KK2 A;  1LAV A;  1QTM A;  1HRH A;  3ASM A;  1KSP A;  3IS9 A;  1JLA A;  4CJT A;  4W5O A;  3HP6 A;  1LV5 A;  4K8X A;  4DLE A;  2O4G A;  4OPK A;  2Y1J A;  3LDS A;  4F4K A;  4W5T A;  1RT7 A;  5I3U A;  4E3S A;  1UOC A;  3T1A A;  4FK4 A;  3DRP A;  1YTA A;  4CF1 A;  1RBS A;  1NK5 A;  1C0T A;  3SQ2 A;  3MEE A;  4JRP A;  2P5O A;  3SNN A;  2FBX A;  3ZT2 A;  4FM0 A;  4E0D A;  1KLM A;  1EX4 A;  4FJI A;  1YVU A;  4I7F A;  4DS5 A;  4PUO A;  4KHS A;  1RIL A;  3VQB A;  4B3O A;  4CFC A;  3SI6 A;  4DTO A;  1HQE A;  3H08 A;  3LPU A;  4AHS A;  4IG3 A;  4CJU A;  4CHZ A;  3A2F A;  3LZI A;  5J2M A;  4Q5V A;  3KKR A;  1S1X A;  1NOY A;  3TAB A;  3SPZ A;  3S3O A;  3QET A;  3TAR A;  4O44 A;  3KD1 E;  4FJ5 A;  3ITH A;  1TKZ A;  3ZSQ A;  2PYL A;  3QEI A;  5HRP A;  3S3N A;  2HHW A;  3OYE A;  3CFO A;  1RDA A;  2D0B A;  1IKW A;  3SUP A;  2IDO A;  1RT3 A;  2A1S A;  3P5J A;  4KRE A;  1D5A A;  1HYZ A;  5K14 A;  1FKP A;  4BWJ A;  4DTJ A;  4DTU A;  3ZSV A;  1X9M A;  4CK3 A;  1U4B A;  4FJH A;  4ELU A;  5EU7 A;  1RT6 A;  5SWM A;  3V9S A;  4LD0 A;  1RCH A;  4KHU A;  3HST B;  4W5R A;  2O4I A;  3SUO A;  1BCM A;  2YNF A;  4IBN A;  1QSL A;  1YTU A;  3K5L A;  1KCF A;  1G15 A;  1LWF A;  3I0R A;  3T3F A;  1BQM A;  3AA4 A;  4FZY A;  3K2P A;  3NGY A;  4CF8 A;  3PUF A;  1B9F A;  4C8O A;  4DTN A;  4OKJ A;  3MEG A;  5C42 A;  1RBT A;  3OYD A;  1LW0 A;  1XHX A;  4ZTF A;  4CEF A;  1RTI A;  4O0I A;  1KLN A;  1RNH A;  4I2P A;  2HVI A;  2DFE A;  4FZX C;  4E7I A;  5KGW A;  5JS2 A;  3L2W A;  4KHQ A;  2QKB A;  1W9H A;  3HP9 A;  4B8A B;  3LP1 A;  3QIO A;  4EP5 A;  3VQE A;  1HQU A;  1RBR A;  4RW9 A;  3MXM A;  1JKH A;  1Q9X A;  3G10 A;  1JLF A;  2HB5 A;  1DLO A;  3QEV A;  3FFI A;  2I5J A;  2OYQ A;  4DQI A;  4B08 A;  2A1R A;  5CYQ A;  1QQC A;  4BE0 A;  3PX4 A;  3RMA A;  1Q9Y A;  3P1G A;  3CFP A;  4Y1C A;  1IKY A;  4DSK A;  3V1O A;  2RKI A;  1ASW A;  3C6T A;  3S9H A;  1SKW A;  3TI0 A;  1WSF A;  1UA1 A;  4OPJ A;  1BL3 A;  1VSD A;  2DTU A;  4CJF A;  4GVM A;  4B9T A;  1LW2 A;  2WON A;  5I42 A;  4FLW A;  1NK7 A;  3AA2 A;  3MAQ A;  4CJ3 A;  3F73 A;  3SZ2 A;  3M8S A;  1L3T A;  4YNQ A;  1RTD A;  3DLE A;  5CYM A;  4O0J A;  4CCH A;  4FW2 A;  4KHN A;  4DSJ A;  1RTJ A;  1J5O A;  4C8M A;  3LWL A;  4FJ9 A;  1HYV A;  1B92 A;  1CZ9 A;  3ZT3 A;  3HM9 A;  1DTT A;  1S6P A;  2BAN A;  2E4L A;  3B6P A;  5FRO A;  4KKO A;  3OS2 A;  3HXM A;  3C94 A;  1BI4 A;  3V9U A;  1JLQ A;  4B9M A;  1C0U A;  4F8R A;  4CF9 A;  4LH5 A;  3UIQ A;  3NHG A;  3RMC A;  4B9V A;  3K58 A;  3ULD A;  4E89 A;  3V1Q A;  1X9S A;  4OKK A;  4N41 A;  2HNZ A;  2X78 A;  1U49 A;  2OPS A;  4CEA A;  1L3S A;  3SUQ A;  4DU1 A;  2Z1H A;  4CJ4 A;  4B9U A;  1QE1 A;  1KVA A;  3NGI A;  3QER A;  4CIF A;  4I9Q A;  4HUE A;  4RW4 A;  1HPZ A;  1B9D A;  1ZYQ A;  5E41 A;  1SKS A;  3ZSW A;  2IS3 A;  1NJZ A;  1HJR A;  1S1U A;  1NOZ A;  2EX3 A;  4FVM A;  4FJL A;  2W42 A;  4J2D A;  4KV8 A;  2OZS A;  4CEZ A;  4IFY A;  2ITG A;  2P51 A;  4OJR A;  4CJS A;  1TVR A;  1A5X A;  4N76 A;  3LZJ A;  1KRP A;  3K59 A;  2X6N A;  3SPY A;  4FK0 A;  5FRN A;  3LAL A;  3AO1 A;  3QIP A;  1CXQ A;  3OYF A;  1N6Q A;  4DLG A;  3ZCM A;  1BIS A;  2ATQ A;  1KVC A;  2KQ2 A;  4DTM A;  4CE9 A;  1ZBI A;  4FYD A;  4TSX A;  3THV A;  1F21 A;  3O3H A;  3VQD A;  3ZSR A;  3OYK A;  3P83 D;  4EZ9 A;  3L2V A;  1QSS A;  1QSY A;  1VSK A;  4DQS A;  5HRS A;  1QHT A;  1UWB A;  3K5O A;  3NAE A;  4KRF A;  4ID5 A;  3SQ4 A;  4J2A A;  4OGE A;  4DSE A;  3I8D A;  3ZT1 A;  4BWM A;  2VWK A;  4RG8 A;  4E1M A;  1TAQ A;  4RW8 A;  3F9K A;  3ZSY A;  3PO5 A;  3HO1 A;  1NK9 A;  1RT1 A;  3DLK A;  3LAM A;  4FCY A;  4KO0 A;  2YKM A;  2FC0 A;  3NH1 A;  3SYZ A;  1TAU A;  3U3G A;  1HNI A;  1LAW A;  4NCA A;  4KHW A;  3LP2 A;  1JXB A;  5J2Q A;  1SL2 A;  3ZSX A;  3HPO A;  4E7K A;  2KW4 A;  4DFM A;  4FXD A;  2Q3S A;  4RW6 A;  4ICL A;  4H4O A;  1EP4 A;  4OGC A;  1MU2 A;  1XC9 A;  2RF2 A;  1T05 A;  2IAJ A;  2AJQ A;  3MXJ A;  3NF6 A;  4CGJ A;  3K5M A;  4AH9 A;  4M45 A;  3VQ6 A;  3OS0 A;  3WNH A;  3OYA A;  4PY5 A;  4M42 A;  1QS4 A;  4O4G A;  4DU3 A;  1XWL A;  2VG7 A;  4KI4 A;  4DSL A;  1D8Y A;  2DFF A;  3AVM A;  4H4M A;  3QEX A;  2PZS A;  3CYM A;  4CGH A;  3L3V A;  3M8Q A;  4IFV A;  3DOL A;  5J1E A;  4XIU A;  3M8R A;  1WSI A;  3AVG A;  1U45 A;  4R5P A;  1TKX A;  1YT3 A;  5KTQ A;  3OYC A;  3OS1 A;  3KK3 A;  4BAC A;  1NKC A;  3OYM A;  1T7P A;  4KHY A;  2IOC A;  4CEO A;  2KZZ A;  2G8K A;  1NKB A;  2HHQ A;  3NE6 A;  3IAY A;  4HCB A;  1WNS A;  3C95 A;  3DLB A;  3AVI A;  4DQP A;  3D0P A;  3KLH A;  4N47 A;  1S1V A;  2ETJ A;  4MFB A;  2OPQ A;  4FLU A;  4N56 A;  3OYG A;  3OJU A;  4BDZ A;  3NFA A;  1T03 A;  2X74 A;  1S9E A;  4FJX A;  4Y1D A;  3PX0 A;  4CGG A;  3U6F A;  3B6O A;  3LP0 A;  1VK0 A;  4HHT A;  1A5V A;  4NCG A;  3EZ5 A;  4FM2 A;  4M3Y A;  3EYZ A;  3SQ1 A;  4HUF A;  3QEP A;  1XHZ A;  4J2B A;  2YNI A;  2Z1I A;  1GOC A;  1LWE A;  1KVB A;  3U3Y A;  3WNF A;  3KLI A;  1IO2 A;  4NCB A;  1SKR A;  3EY1 A;  4B9N A;  1K6Y A;  4LSL A;  1EXQ A;  3T19 A;  4CER A;  3K5N A;  4FLZ A;  4DSF A;  1RT4 A;  4DU4 A;  4J2E A;  1BIU A;  4I2Q A;  4K8Z A;  3SQ0 A;  1NJX A;  4CHY A;  1GOB A;  3AVL A;  2OA8 A;  3OYH A;  2HHV A;  1RT5 A;  3BGR A;  3DOK A;  4QCL A;  3LP3 A;  3CM6 A;  4CK2 A;  2JGU A;  4FZZ A;  3ISN C;  4HUG A;  3OYB A;  2HHT A;  2G8U A;  2XY6 A;  4MQ3 A;  1BCO A;  3RTV A;  1Q8I A;  3MED A;  3AVF A;  4NYF A;  1U48 A;  2FBY A;  4F3T A;  2YV0 X;  2KTQ A;  1KFD A;  2OPP A;  1C6V A;  3AVB A;  3SV4 A;  1U47 A;  1SL1 A;  1T8E A;  3LPT A;  3AO2 A;  4OVL A;  2ZE2 A;  5CZ1 A;  3TAF A;  1BGX T;  4W5Q A;  1NKE A;  2G8F A;  3HVT A;  4DF8 A;  4AHV A;  4FLT A;  2DY4 A;  4CHQ A;  4IG0 A;  4O5B A;  1HYS A;  4C8K A;  1Z26 A;  3WNG A;  2P5G A;  1C0M A;  1C1B A;  4Z4I A;  3AVJ A;  3V9W A;  4FJN A;  2P1J A;  4IKF A;  5HBM A;  2BE2 A;  3LAN A;  1I39 A;  3L2R A;  4H8K A;  4FLY A;  3L3U A;  5T7B A; 
#chains in the Genus database with same CATH topology
 1C1A A;  1RDU A;  4KTW A;  3KJV A;  1UA0 A;  1S5J A;  1ATS A;  5BPN A;  1K8K B;  3EL2 A;  3ZT4 A;  4FJ8 A;  2Z1G A;  3HPG A;  3TR8 A;  1D9D A;  3QEW A;  1JLB A;  3RMB A;  3VQ4 A;  3NF9 A;  5KPZ A;  4CBX A;  4BE2 A;  4QOZ B;  1NMD A;  4BRP A;  3RRH A;  4M41 A;  4CD3 A;  4CD1 A;  3VQA A;  2E6M A;  4CEE A;  3L4Q A;  4BRD A;  4ISE A;  1X1P A;  1OH7 A;  4UQG A;  2XY8 A;  2FXU A;  3O3G A;  1WSH A;  2NRX A;  2F96 A;  1SV5 A;  3ULE A;  5BPM A;  4F2S A;  1WAJ A;  3V9Z A;  4DF4 A;  2VGM A;  1NM1 A;  3V9X A;  1XNQ K;  3VEX A;  1TV6 A;  2GBZ A;  5CE3 A;  3OBY A;  2E2N A;  1Z05 A;  1Q86 O;  3THW B;  4NB4 A;  2XHB A;  1SUQ A;  3PX6 A;  4KB0 A;  3QDK A;  1FJG K;  3V4I A;  1HPM A;  1L3U A;  5FDL A;  5A2Q O;  3HOT A;  3C7N B;  4CGD A;  4DTS A;  3U9D A;  4O55 A;  4DMN A;  3D7E O;  3AGR A;  3OY9 A;  2WOM A;  4ELV A;  2QWR A;  3VQ7 A;  1QVF M;  4B9L A;  1VSH A;  3CFR A;  3C6U A;  3VGL A;  4FJG A;  4CES A;  2UXB K;  3BUZ B;  1VQN N;  1J9A A;  1WSJ A;  3ATV A;  4JHD A;  1S1T A;  3UKR B;  5FPN A;  4CHN A;  1TYQ A;  1J6Z A;  4DUZ K;  4NYN A;  4JN4 A;  3UKU A;  3HBT A;  3O5B A;  3JSM A;  3DXK B;  1GOA A;  4BG9 A;  4CZM A;  3HK2 A;  2X6S A;  1WAF A;  1L3V A;  4DS4 A;  4PWD A;  4ZHR A;  3TAE A;  1KTQ A;  1ZBS A;  1GLD G;  3TPQ A;  1VQP N;  2FBV A;  2KLA A;  2YHY A;  4KPY A;  4BQZ A;  3JYT A;  3V1R A;  4JK7 A;  2GEL A;  2A5X A;  4BR4 A;  4E7H A;  4IDH A;  4CJ5 A;  1BHL A;  1A5W A;  4EHT A;  5AQI A;  3LDN A;  2O8D B;  4KAZ A;  3VMF B;  1YHQ N;  2GUI A;  4C8N A;  5AQV A;  4BRN A;  4E1N A;  2FLO A;  1RDC A;  5BN8 A;  4JI8 K;  1XNR K;  3EKS A;  2E88 A;  3WNE A;  5C10 A;  3VA3 A;  4G1Q A;  3KIO A;  2O8B A;  5JLF A;  3AVN A;  3VQP A;  3K57 A;  4OLB A;  1HNV A;  3SAG A;  2ZJQ L;  1NGI A;  5MLC Q;  2NLX A;  4KTQ A;  4DKW A;  4B9S A;  4DG1 A;  4WE1 A;  5FPE A;  3U8X A;  1N36 K;  1K8A O;  4BRO A;  1ASV A;  1EO1 A;  4JNE A;  4KFB A;  1JLC A;  2OPR A;  4CJK A;  3TAG A;  3DM2 A;  3DRR A;  4IDK A;  1QZ5 A;  1NGE A;  3AO3 A;  5AQN A;  1NJW A;  2QW9 A;  4FWS A;  1Z6R A;  2ITM A;  1VSI A;  2D4W A;  3TU5 A;  5JVG L;  2ZD1 A;  4BC5 A;  1BA0 A;  4FJM A;  4BVO A;  1LAV A;  1KSP A;  3H46 O;  1EWQ A;  2O4G A;  4XEI A;  2ZWH A;  3CJC A;  4WFN L;  4KBO A;  4E0D A;  4FJI A;  4I7F A;  4PUO A;  2Q97 A;  4CFC A;  3E9O A;  2A6A A;  3H08 A;  4CHZ A;  4JEP A;  3KKR A;  1NOY A;  4WFA L;  2GX9 A;  5IWA K;  3ITH A;  1TKZ A;  4JI6 K;  3ZSQ A;  2PYL A;  3CFO A;  4M63 C;  4B1X B;  4MO5 A;  2IDO A;  3M6G A;  3P5J A;  5DM7 L;  4KRE A;  4DTU A;  4BRI A;  3IMX A;  1U4B A;  4WYB A;  4ELU A;  5EU7 A;  3C65 A;  5AZJ A;  3EEQ A;  3HST B;  4W5R A;  1YTU A;  1KCF A;  1N32 K;  1G15 A;  1LWF A;  5FLX O;  1BQM A;  3AA4 A;  3K2P A;  3G4S N;  5C42 A;  1RBT A;  1KLN A;  1LW0 A;  1RTI A;  1N33 K;  3FZL A;  4FZX C;  5KGW A;  1W9H A;  3HP9 A;  3CD6 N;  2Q2R A;  1GLA G;  1RBR A;  4JI4 K;  5JLH A;  4BG8 A;  4BGB A;  1DLO A;  3FFI A;  2D0O A;  1T6D A;  2A41 A;  5CYQ A;  4BE0 A;  1Q9Y A;  3HM8 A;  3M3Z A;  4Y1C A;  1IKY A;  3V1O A;  3H3O B;  2RKI A;  1ASW A;  1OH6 A;  3CIP A;  1VSD A;  3R1X A;  2P9U A;  4IWV A;  1NK7 A;  3MAQ A;  5BRE A;  3F73 A;  3M8S A;  3SZ2 A;  1L3T A;  4KHN A;  4IEE A;  4FW2 A;  4DSJ A;  1J5O A;  4C8M A;  1ATN A;  1HYV A;  3KWI A;  2BAN A;  1S6P A;  5BR8 K;  3MN7 A;  3DLL L;  3HXM A;  1VQ5 N;  5AQL A;  3ZX2 A;  1NBW A;  3NHG A;  3D2E A;  1YI2 N;  3THY A;  1BWF O;  4E89 A;  3ULD A;  1X9S A;  2HNZ A;  1U49 A;  3SUQ A;  3LDL A;  4DU1 A;  4CJ4 A;  5LJW A;  3NGI A;  3QER A;  4CIF A;  4I9Q A;  1ESV A;  1SS6 A;  1HPZ A;  1ZYQ A;  2QWL A;  1S1U A;  2EX3 A;  3CCE N;  5EXW A;  2P51 A;  3VTI A;  3SPY A;  1CXQ A;  1N6Q A;  2ATQ A;  4DTM A;  2KQ2 A;  3K9J A;  3THV A;  4O8K A;  2HBL A;  4Z94 A;  4X65 K;  3ZSR A;  4JKE A;  1QSS A;  2IVO A;  4DQS A;  4HTL A;  1QHT A;  3I8B A;  3ZET A;  3NAE A;  5AQJ A;  3CPW M;  3I8D A;  4BWM A;  5JMV A;  3ZSY A;  5M1K A;  3LAM A;  5AQU A;  2E1Z A;  2FC0 A;  3NH1 A;  1HNI A;  3AAP A;  5AFU H;  1U2V B;  3MWT A;  3CCV N;  3D2F A;  4KHW A;  4G9Z A;  1JXB A;  5J2Q A;  1SL2 A;  4E7K A;  2KW4 A;  2Q3S A;  2E20 A;  1ATR A;  4H4O A;  1MU2 A;  1XC9 A;  1QQO A;  2RF2 A;  5GAE P;  2W40 A;  4AH9 A;  2YCH A;  2BH1 A;  2H3G X;  2KHO A;  4B3M K;  1XWL A;  2O8C A;  2VG7 A;  3A0I X;  4DSL A;  1VQ6 N;  3VPZ A;  3AVM A;  4H4M A;  4ILG B;  5TKY A;  4IFV A;  4A62 A;  1IG8 A;  3M8R A;  2CGL A;  4ILJ A;  4R5P A;  1TKX A;  1BG3 A;  2VCP A;  4I6M A;  5CR4 A;  1NKC A;  1GLF O;  1WNS A;  4FWR A;  4R79 A;  4FJX A;  3SK3 A;  4B1U B;  4AQY K;  3LP0 A;  4H0V B;  1VK0 A;  1A5V A;  4H5W A;  4NCG A;  4IOX A;  5EVZ A;  5AQY A;  3QEP A;  3O1W A;  2ZGZ A;  1LWE A;  4YOW A;  4DR7 K;  1SKR A;  3L4I A;  4JKG A;  4DV5 K;  1K6Y A;  1EXQ A;  4CER A;  1KAY A;  4MLE A;  4CZE A;  4J2E A;  1BIU A;  1GOB A;  2OA8 A;  2HHV A;  3OYH A;  4EIA A;  4ISG A;  4DCH A;  1NLV A;  4CK2 A;  4FZZ A;  3CC4 N;  3ISN C;  4HUG A;  1S72 N;  3J81 O;  2O8B B;  3LM2 A;  3ENO A;  3C6A A;  4F3T A;  3AVF A;  2KTQ A;  1WUA A;  4PKI A;  3A8Y A;  3AVB A;  1C6V A;  1IJJ A;  1U47 A;  3SMP A;  3SBG A;  2ZE2 A;  4QS7 A;  3HVT A;  4DF8 A;  4YOV A;  5FPM A;  4C8K A;  3CET A;  3V9W A;  2P1J A;  3CF5 L;  1I39 A;  4BRC A;  3L3U A;  5T7B A;  1TK0 A;  5CY4 A;  2O8E A;  2VWJ A;  4FJ7 A;  3NF8 A;  3RSE B;  3DI6 A;  4F3O A;  3HZ6 A;  1U04 A;  3QLH A;  2ZQB A;  1XI1 A;  3AVA A;  1RDB A;  3HPH A;  2GV9 A;  2Z1J A;  3AGK A;  4BDY A;  3NGZ A;  4IO8 A;  2D0C A;  3P38 A;  4YY3 K;  4DQQ A;  1JL1 A;  1HKB A;  3VQC A;  4CJQ A;  1VSL A;  4PQU A;  3QNN A;  2FBT A;  4BQL A;  2FSK A;  2YHW A;  3OYJ A;  2PY5 A;  4F2R A;  4DR4 K;  1WSE A;  4DFJ A;  4GV3 A;  2RE2 A;  1REV A;  3SCX A;  5AZI B;  4H0T B;  3VER A;  1I3A A;  5F1X A;  5AJ3 K;  2V7Y A;  2F4V K;  1NK4 A;  1UAX A;  1JLE A;  4WCE L;  4E19 A;  4JK9 A;  1FXX A;  3QES A;  3IKM A;  1SL0 A;  3Q7B A;  3HYF A;  1O1W A;  1WB9 A;  5HRN A;  1OH8 A;  4I9L A;  2G8W A;  1N5Y A;  4YFU A;  3Q7C A;  1W0H A;  5AZJ B;  4CHO A;  2O8F B;  2QWM A;  3QBX A;  1OH5 A;  3EKU A;  2FSJ A;  2OAN A;  3CPE A;  3TSQ A;  2GEM A;  1VQ7 N;  1GLE G;  2WFB A;  2VWB A;  2WC9 A;  4AM7 A;  2VG5 A;  3DXM B;  3O9Q A;  3CQ8 A;  3A5L C;  3L8B A;  4CK1 A;  3AVC A;  3ZSO A;  3T69 A;  4CIE A;  1D9F A;  3CCU N;  4BC2 A;  1RTH A;  4GKK K;  4BRA A;  1ZBH A;  1WSG A;  3TAQ A;  3SBT A;  3AV9 A;  2VG6 A;  3L2U A;  4OPA A;  4BE1 A;  4ELT A;  4CFA A;  4JK8 A;  3H3N O;  2HHU A;  4FLX A;  4FPA A;  1HKG A;  3ZSZ A;  4CJ7 A;  3MDQ A;  3KD5 E;  2Q0U A;  3BDP A;  1ZXO A;  3NF7 A;  3KLE A;  2YI1 A;  2QWP A;  1ZBL A;  4B8C A;  5KRS A;  3ALY A;  4FJK A;  4CJV A;  5GIO A;  5SZT A;  1JCF A;  2EHG A;  3MX5 A;  4FPB A;  2P9U B;  2P9N A;  3VET A;  4KH4 A;  1E3M A;  2E2O A;  4A61 A;  2W6K A;  3O1B A;  4OLA A;  2B5J A;  5EX5 A;  3IRX A;  3T1Y K;  3IUC A;  2YJF A;  3TAP A;  1IBM K;  3AVK A;  1NGF A;  2CH5 A;  1HUX A;  3BF1 A;  4OPH A;  3EE9 A;  3G6E N;  2YHA A;  4M7Y A;  3U9Z A;  3E01 A;  3THY B;  5HP1 A;  2JLE A;  3DMJ A;  3VGK A;  4AHR A;  3RR8 A;  2HHX A;  3D45 A;  1S9G A;  4DR3 K;  4AHT A;  1BU6 O;  4IEI A;  3PSI A;  4M3Z A;  1TL3 A;  4FVU A;  1V4T A;  4Y0W A;  4N5S A;  1VSJ A;  1S6Q A;  1R0A A;  2P9L A;  4FWQ A;  2F8T A;  3MCA B;  3O9S A;  4DR1 K;  1J53 A;  1HX1 A;  5KQ8 A;  3O8M A;  1DTQ A;  4CEQ A;  1VSM A;  4O8U A;  4H5V A;  1HR0 K;  4GV9 A;  4BRL A;  2KFZ A;  3PO4 A;  3TAN A;  4K0K K;  4CJP A;  3RRG A;  1Q18 A;  5J2P A;  2HND A;  2D0A A;  2HNY A;  4FOI A;  1MWM A;  2P9P A;  5JS1 A;  3L6Q A;  2F7T A;  3CJ7 A;  1BQN A;  2IGI A;  5BN9 A;  3O9T A;  3OYL A;  1KAZ A;  3AO4 A;  4JKB A;  1FKO A;  4C23 A;  4DTR A;  2YNG A;  4Z0U A;  3ZEU A;  4CJE A;  2F9W A;  3HP6 A;  1LV5 A;  1CZA N;  4QS9 A;  4F4K A;  4JI3 K;  5I3U A;  2CGK A;  1UOC A;  3DRP A;  4KH6 A;  1C0T A;  4CZF A;  4B3S K;  4BR9 A;  4JRP A;  2P5O A;  1GLJ O;  3ZT2 A;  4KHS A;  1RIL A;  4GY2 B;  3WQT A;  2HOE A;  3SI6 A;  3CCJ N;  1HQE A;  3LPU A;  3FZF A;  2ZGY A;  3CCM N;  4I6M B;  4LF6 K;  4IOA L;  2UU9 K;  1ILY A;  4FWO A;  1HNW K;  3KWG A;  2D0B A;  1RT3 A;  2A1S A;  5AR0 A;  4JKF A;  4A2A A;  1X9M A;  4FJH A;  5AQG A;  3G71 N;  3F9M A;  3ENH A;  3WEE A;  4JD2 A;  4KHU A;  3KZB A;  3N4Q A;  5JIC A;  1BCM A;  2O4I A;  2UXD K;  2UUA K;  3P31 A;  5HOO A;  3VEY A;  1E4G T;  3PUF A;  2P9S A;  1B9F A;  3NVK A;  4OKJ A;  2HST A;  3MEG A;  3OYD A;  1GLC G;  1XHX A;  4CEF A;  2HVI A;  4I2P A;  4E7I A;  3DAW A;  2A40 A;  2ASM A;  1HQU A;  1JKH A;  2HB5 A;  3MCP A;  2QTD A;  2I5J A;  3CQX A;  4BRK A;  5AQP A;  4B08 A;  2A1R A;  1NJI O;  5AQS A;  4MDB A;  3O08 A;  3S9H A;  3C6T A;  1WSF A;  3J7A P;  1QQN A;  4J8F A;  2DTU A;  2CGJ A;  4B9T A;  1LW2 A;  5I42 A;  4FLW A;  2QWO A;  3AA2 A;  2V51 B;  4CJ3 A;  1RTD A;  4CCH A;  2UUB K;  3LWL A;  2Q31 A;  4CZH A;  2BUP A;  3ZT3 A;  1DTT A;  1RGI A;  5AQF A;  3C94 A;  1BI4 A;  3FZK A;  4O5F A;  5I9E B;  1C0U A;  3CJ1 A;  1WBB A;  3RMC A;  2WTU A;  3K58 A;  4B9V A;  3V1Q A;  4OKK A;  1N34 K;  2OPS A;  4V19 S;  1BUP A;  1L3S A;  4A5B A;  1VQM N;  2IVN A;  1BA1 A;  3GDQ A;  5AQW A;  3ZSW A;  4FVM A;  3GL1 A;  1C0G A;  1NOZ A;  3R3L A;  4CEZ A;  4IFY A;  1G99 A;  4CJS A;  1A5X A;  5LY3 A;  1NGA A;  3J7Y P;  3LAL A;  3QIP A;  4B1V A;  1NGJ A;  1BIS A;  1ZBI A;  1KVC A;  4CE9 A;  4TSX A;  4NLC A;  1F21 A;  3O3H A;  3VQD A;  1KD1 O;  3P83 D;  3L2V A;  3L0Q A;  1VQK N;  3VF2 A;  3K5O A;  4ID5 A;  1KAX A;  4OGE A;  4DSE A;  4C1N K;  3ZT1 A;  2VWK A;  4RW8 A;  5ELZ A;  3ZYY X;  3K0S A;  2OTL N;  3SYZ A;  5BPL A;  1LAW A;  5M1P A;  3VEV A;  1WOQ A;  4FXD A;  1NGB A;  2ASP A;  4RW6 A;  3O9U A;  4MDA A;  3E66 A;  3K5M A;  4DV2 K;  3QB0 A;  3OS0 A;  1YAG A;  4O4G A;  4BY9 C;  1D8Y A;  2PZS A;  1YF5 L;  3CYM A;  1KC8 O;  2P9N B;  4CGH A;  3L3V A;  3M8Q A;  5M1Q A;  3SJH A;  4RCH A;  5M1N A;  1U45 A;  1YT3 A;  3OYC A;  2YX6 A;  4BRF A;  1DT9 A;  4BAC A;  3MN5 A;  3OYM A;  1T7P A;  4CEO A;  3NE6 A;  3C95 A;  1VQ4 N;  3DLB A;  3GE1 A;  3VTH A;  4WFB L;  2OPQ A;  4LF4 K;  3TSU A;  5AQZ A;  3OW2 M;  5BRF A;  3WUH A;  3EYZ A;  2IIR A;  2RHK A;  3LDO A;  3SQ1 A;  4BRE A;  2Z1I A;  1GOC A;  3THX B;  3R6M A;  1IO2 A;  3HTV A;  4B9N A;  4FLZ A;  3T19 A;  4DSF A;  1RT4 A;  4HWI A;  1FW6 A;  3AVL A;  2P9L B;  1N8R O;  1RT5 A;  3SAF A;  1H1V A;  3VEO A;  1DGK N;  3RVC A;  3WXL A;  1ZC6 A;  4B3T K;  3RTV A;  1Q8I A;  3MED A;  1U48 A;  4LF8 K;  2FBY A;  1T8E A;  4FWK A;  3LPT A;  5CZ1 A;  4W5Q A;  4FLT A;  2NRZ A;  4IG0 A;  4O5B A;  5KQD A;  1C0M A;  3TSP A;  4Z4I A;  2P9P B;  2D0P A;  4IO9 L;  5HBM A;  2BE2 A;  4H8K A;  4FLY A;  2QEX N;  5LMN K;  2QWQ A;  4DR2 K;  4JS5 A;  3PY8 A;  2HHS A;  4DFK A;  3A5O C;  4LFC K;  4BGA A;  4HVJ A;  4N41 A;  3ULE B;  1SAZ A;  1JLG A;  3BZK A;  2YHB A;  3HL8 A;  1L5U A;  1RDW X;  1RFQ A;  4CGI A;  1EET A;  2I7P A;  1YUW A;  1ITG A;  2G8I A;  3I56 N;  2Y1I A;  4KTZ A;  5C2F A;  3KKS A;  4XH1 A;  4IOC L;  3TWH A;  3G0Z A;  3CI5 A;  4QAG A;  3QFU A;  2HF4 A;  5M1F A;  2GWJ A;  1C1C A;  1K8K A;  3VQQ A;  4CIG A;  1RT2 A;  3SAH A;  5J2N A;  1K9M O;  1EKE A;  3VEW A;  4X64 K;  3WT0 A;  4K42 A;  1VSF A;  2KKZ A;  3OYN A;  4B1Z A;  4IZ9 A;  1VSE A;  4ID1 A;  3SMS A;  3MXI A;  3WEE B;  1TGO A;  1XMO K;  1S3X A;  4CJR A;  1VRT A;  3MEC A;  4L8R B;  3FZH A;  4FSV A;  4BR0 A;  2FSN A;  4LF7 K;  2B4J A;  3B8A X;  5HLF A;  4KB1 A;  3IG1 A;  4JHD B;  1WN7 A;  3P4I A;  3LWM A;  2P9S B;  2VQE K;  1TYQ B;  3RWU A;  2BGG A;  5DMR A;  2RPI A;  3NCI A;  3RMD A;  1NMN A;  3PV8 A;  3CJA A;  4LFA K;  4LY7 A;  3R8E A;  3UKU B;  1X3M A;  2F9T A;  3S3M A;  2QWN A;  1IH7 A;  3KHY A;  5KRT A;  2DFH A;  3H1V X;  3MN9 A;  3THW A;  4Z4F A;  1HLU A;  3DLG A;  3AA5 X;  1ASU A;  4CW7 B;  1Z25 A;  4PL8 A;  4W5N A;  1CZB A;  2B6A A;  3M5R A;  3J7Z O;  2RN2 A;  3C7N A;  4FJJ A;  2R7Y A;  5C12 A;  4DQR A;  5AQT A;  4Z4E A;  3NDK A;  4CF0 A;  3VOV A;  4AHU A;  3HT3 A;  1BI4 B;  4EP4 A;  4E7J A;  2IVP A;  3OTO K;  2D5R A;  4DFP A;  5C25 A;  4K41 A;  3OVN A;  4M3U A;  3SJJ A;  1ZBU A;  4ZTJ A;  1M1K O;  3V6D A;  2QXF A;  3G25 A;  1VQ8 N;  4CZJ A;  1DKG D;  2E5L K;  4FWP A;  4MO4 A;  5E84 A;  1XC3 A;  1R59 O;  2V7Z A;  4EZ6 A;  4JI0 K;  1Q82 O;  4FWM A;  4JI7 K;  2V52 B;  4H03 B;  2WUS A;  4CEB A;  4JRQ A;  4A5A A;  4Q0B A;  3VN5 A;  1RBV A;  2XY5 A;  1U6Z A;  2E6L A;  3DXK A;  3C0B A;  4IJN A;  4FM1 A;  1NWK A;  2NNW A;  2F8S A;  4EAH D;  4YOR A;  1T3V A;  3MWP A;  5CZ2 A;  5LMU K;  4C8L A;  5FPD A;  4H0O A;  1CXU A;  5DK5 A;  1NGC A;  2GWK A;  4JLH A;  4HCC A;  2O8D A;  4MLH A;  3KK1 A;  1TK8 A;  3QBW A;  4M3X A;  1LWC A;  3GOI A;  1Q81 O;  3QNO A;  4M3T A;  2BDP A;  3IDH A;  1JL2 A;  1IV0 A;  3FGU A;  1IKX A;  1TKD A;  3TTF A;  2E1Y A;  4AHC A;  3KK2 A;  1I94 K;  1HRH A;  3ASM A;  4K8X A;  4OPK A;  4PL7 A;  4XH5 A;  4W5T A;  1RT7 A;  4FK4 A;  1RBS A;  3HRG A;  1NK5 A;  3WQU A;  3SNN A;  3EE8 A;  4FM0 A;  4WQ5 A;  1KLM A;  4DS5 A;  3GG4 A;  2GUP A;  3VQB A;  4DV4 K;  3QIC A;  4AHS A;  4CJU A;  4DB3 A;  5GIP A;  2DPN A;  3A2F A;  3LZI A;  3ATU A;  4Q5V A;  1S1X A;  3S3O A;  2AP1 A;  3QET A;  4O44 A;  4FJ5 A;  4UY8 O;  3MX2 A;  5HRP A;  3LDQ A;  3N4P A;  4BR2 A;  3CME N;  1W7A A;  1RDA A;  5F0X A;  1IKW A;  4H0X B;  5K14 A;  1FKP A;  3U4L A;  3ZSV A;  3LDP A;  4CK3 A;  1RT6 A;  3V9S A;  4LD0 A;  3LM9 A;  4DV1 K;  1SQK A;  3SUO A;  2YNF A;  4IBN A;  1QSL A;  3K5L A;  3I0R A;  3CJ9 A;  4JKH A;  3NGY A;  5AQO A;  1J5E K;  3VES A;  3CCR N;  3O9R A;  5GAG P;  4O0I A;  4WF9 L;  2DFE A;  2PFU A;  2NRH A;  4EP5 A;  3VQE A;  4GNI A;  3VF4 A;  4B9Q A;  3G10 A;  1JLF A;  2OYQ A;  4DQI A;  4LFB K;  3D2E B;  1WBD A;  3RMA A;  1QQC A;  3P1G A;  4DQ8 A;  2J4R A;  4DSK A;  3TI0 A;  3W3D A;  3I33 A;  1BL3 A;  1W2B M;  2NRR A;  4CJF A;  4NLB A;  2WON A;  1NG9 A;  5EOY A;  4JI2 K;  5CYM A;  4O0J A;  1B92 A;  1CZ9 A;  2P9I A;  3HM9 A;  3B6P A;  2E4L A;  1X9J A;  4KKO A;  4DV6 K;  3V9U A;  1JLQ A;  4WQ4 A;  4F8R A;  4CF9 A;  3T1H K;  1HNZ K;  4QS8 A;  1BDG A;  4B9U A;  3ZET B;  1KVA A;  1HKC A;  1B9D A;  5E41 A;  1SKS A;  1KXP A;  2IS3 A;  1NJZ A;  2QXL A;  3EN9 A;  3H1Q A;  3MMV A;  1DEJ A;  2OZS A;  2ITG A;  4N76 A;  1QQM A;  5H1S Q;  3K59 A;  3KVG A;  2X6N A;  5FRN A;  4FK0 A;  3D2F B;  1K73 O;  4FWN A;  3AO1 A;  4U67 L;  2YHX A;  3ZCM A;  3WXK A;  5AQM A;  2VQF K;  4JAX A;  1KQS M;  3OYK A;  2A42 A;  4EZ9 A;  1VSK A;  3MN6 A;  1UWB A;  4KRF A;  2O8C B;  4JKC A;  4J2A A;  2VYP A;  3UE5 A;  3HO1 A;  1TUY A;  4IJA A;  1NK9 A;  1RT1 A;  4BC3 A;  2YKM A;  1HJO A;  1S22 A;  2ASO A;  3VEZ A;  4ICL A;  2NZT A;  1HNX K;  1NNE A;  1T05 A;  2WBN A;  5BRH A;  4BRH A;  3EO3 A;  1W97 L;  4CGJ A;  5DM6 L;  1MDU B;  3VQ6 A;  2D1K A;  3OYA A;  4PY5 A;  4DU3 A;  4BRQ A;  4B3R K;  2P9K A;  1X3N A;  3H45 C;  3DJC A;  4JKG B;  5J1E A;  1WSI A;  3AVG A;  3S41 A;  3CXC M;  2HBM A;  1JCE A;  1U2V A;  2VGN A;  3KK3 A;  3PLA A;  2G8K A;  1NKB A;  5AQH A;  4HCB A;  3AVI A;  4DQP A;  3KLH A;  2NRV A;  1S1V A;  2ETJ A;  4MFB A;  4N56 A;  1T03 A;  3NFA A;  1S9E A;  4Y1D A;  3PX0 A;  1E4F T;  4CGG A;  3B6O A;  5AFU A;  4HHT A;  3EZ5 A;  4M3Y A;  4FM2 A;  3BP8 A;  4LC9 B;  4AM6 A;  1XHZ A;  4J2B A;  2YNI A;  2HMP A;  3EY1 A;  3WXM B;  4A59 A;  2Q0R A;  3TTD A;  2HBJ A;  4NXN K;  4DV0 K;  4DU4 A;  4K8Z A;  3SQ0 A;  1NJX A;  1LCU A;  3JAM O;  3HSC A;  4QCL A;  3LP3 A;  3BZC A;  3PSF A;  2O8E B;  3CHW A;  2G8U A;  2XY6 A;  4MQ3 A;  1BCO A;  4NYF A;  1Y64 A;  1D4X A;  2YV0 X;  1KFD A;  2OPP A;  1SL1 A;  3FE1 A;  4NO7 A;  4L3Q A;  5C0Y A;  3T7Z A;  3AO2 A;  4OVL A;  3TAF A;  1BGX T;  3HOS A;  2G8F A;  4AHV A;  1Z26 A;  2P5G A;  2OCE A;  1OKJ A;  1OVQ A;  3AVJ A;  4FJN A;  4YDU A;  3PIO L;  4IKF A;  2YJE A;  2ZJR L;  4FWL A;  5GIN A;  4IXC A;  4WQ5 C;  2HHH K;  4H5R A;  3AAQ A;  3PIP L;  4BDP A;  3J80 O;  2IC3 A;  1P90 A;  3W0L A;  4JI1 K;  4CJL A;  4PA1 A;  1VQL N;  3CG7 A;  4OKE A;  3QML A;  3CCL N;  4KI6 A;  3NMU A;  3OA9 A;  4JI5 K;  1OVY A;  1FK9 A;  4BR5 A;  4GW6 A;  4DSI A;  3O4Q A;  2G8H A;  4DV7 K;  3ZX3 A;  4HTU A;  3DRS A;  1LOT B;  1NK0 A;  2CH6 A;  4DTP A;  1EQY A;  1X9W A;  4YOT A;  4EHU A;  3KLG A;  2JWL A;  3E1Y A;  1EWR A;  2PAV A;  5KGX A;  3RSE A;  4PHT X;  3HJF A;  2E8A A;  1BIZ A;  3LAK A;  2QA4 N;  3QFP A;  3AVH A;  2NUB A;  1VRU A;  1S1W A;  3I0S A;  3VA0 A;  2XY7 A;  3V81 A;  3CCS N;  3DLH A;  4BC4 A;  1BOT O;  1ZBF A;  3AO5 A;  3BY5 A;  4CFB A;  3OJS A;  1TKT A;  2G8V A;  2JWK A;  4FK2 A;  4RW7 A;  1J54 A;  4E7L A;  1YJW N;  5D3G A;  2OZM A;  1NGH A;  4DHY A;  4Z4H A;  3QO9 A;  1O13 A;  3NBP A;  1TK5 A;  3VQ9 A;  5ADX H;  4OX9 K;  2HMI A;  5AZI A;  4X62 K;  3O3F A;  1IBL K;  2PYJ A;  4DR5 K;  4FW1 A;  3VEN A;  5AQX A;  4ISF A;  3SUN A;  2YNH A;  4DTX A;  3L2Q A;  2FF3 B;  3IFR A;  1NK8 A;  4Z4G A;  1XQS C;  4BRG A;  5HRR A;  3KK7 A;  1HMV A;  5KPT A;  3VQ8 A;  3NH0 A;  2O8F A;  3KTQ A;  3NVM A;  4WQ4 C;  4NXM K;  4AF1 A;  4CF2 A;  3NH2 A;  2KZM A;  4CFD A;  3ID8 A;  2QI2 A;  3DXM A;  1CLQ A;  4Z4C A;  1TL1 A;  3VQ5 A;  4LH4 A;  4CHP A;  1MA9 B;  3TAM A;  4JS4 A;  1WLJ A;  2NRT A;  1P8Z A;  1RBU A;  5AQK A;  2P9I B;  1VQO N;  4M3R A;  1IG9 A;  3O4N A;  4DR6 K;  5KI6 A;  3CM5 A;  3M8P A;  5LJV A;  3UB5 A;  4BVP A;  3QIN A;  4CJW A;  1RDD A;  4AIL C;  1NJY A;  5E26 A;  4FLV A;  3M1F A;  4B1W B;  4DUY K;  3ENB A;  5M1O A;  3OYI A;  5HL7 L;  3CCQ N;  3RR7 A;  4GMJ B;  1NK6 A;  3FLC O;  4A57 A;  2FF6 A;  4M3W A;  4JKA A;  3LL3 A;  3C6H A;  3KLF A;  2EWS A;  3F5T A;  3DLR A;  1V4S A;  3CER A;  1KFS A;  4CZI A;  4F9O A;  4CEC A;  3DYA A;  1Q7Y O;  5JVH L;  5C24 A;  3AAR A;  3AA3 A;  4K43 A;  3ZEU B;  2OTJ N;  3H6E A;  5FRM A;  4CED A;  2UYT A;  1T6C A;  2HW3 A;  4H0Y B;  1Y97 A;  1YVN A;  2YKN A;  1JXE A;  3D6R A;  5GAH P;  3SV3 A;  4CGF A;  3CC2 N;  2LSN A;  3CC7 N;  4LSN A;  4B1Y B;  4CZL A;  2QKK A;  2XO7 A;  4YOY A;  3VF6 A;  3WXJ A;  3HVR A;  3I55 N;  1IKV A;  5HRO A;  1QVG M;  2QK9 A;  1YIJ N;  2ZM6 K;  2KFN A;  3ZT0 A;  1VHX A;  2XRI A;  4DWI A;  3ZX0 A;  1T44 A;  4KH5 A;  1TUU A;  1YIT N;  1QTM A;  5BR9 A;  3BEX A;  1JLA A;  3IS9 A;  4CJT A;  4W5O A;  3ZLJ A;  3JS6 A;  4PKH A;  2Q1N A;  4DLE A;  2Y1J A;  4K25 A;  3LDS A;  1NGG A;  4E3S A;  3T1A A;  5AQQ A;  1YTA A;  4CF1 A;  4CI6 A;  3SQ2 A;  3MEE A;  2P9K B;  4U7B A;  2FBX A;  4JD2 B;  4LF9 K;  5BRD A;  1EX4 A;  1YVU A;  4B3O A;  4DTO A;  1XUP O;  2PBD A;  4IG3 A;  4IFE A;  4JYA K;  5J2M A;  3HI0 A;  3TAB A;  3SPZ A;  3TAR A;  3AY9 A;  3KD1 E;  4BR7 A;  2HHW A;  1BO5 O;  3QEI A;  3S3N A;  3OYE A;  4FL9 A;  3SUP A;  1D5A A;  1HYZ A;  4DTJ A;  1GLL O;  4RWT A;  5SWM A;  1RCH A;  1YXQ A;  4XH4 A;  2E2P A;  3T3F A;  1XMQ K;  4FZY A;  4CF8 A;  3A5M C;  4C8O A;  4EFH A;  4DTN A;  4YDU C;  4ZTF A;  3VGM A;  2HVH A;  4GVE A;  1RNH A;  3J8A A;  1JCG A;  5JS2 A;  3L2W A;  2Q36 A;  4KHQ A;  2QKB A;  3TTC A;  4B8A B;  3LP1 A;  3QIO A;  4YOU A;  4RW9 A;  3MXM A;  1Q9X A;  3FR0 A;  3EZW A;  3E9L A;  3QEV A;  4JV5 K;  3PX4 A;  3OBW A;  3CFP A;  4LF5 K;  1SKW A;  1UA1 A;  1VAZ A;  4OPJ A;  4GVM A;  3E9P A;  4E1J A;  3UKR A;  4X66 K;  4YNQ A;  3DLE A;  1RTJ A;  4FOE A;  4FJ9 A;  4GV6 A;  4FO0 A;  5FRO A;  3GBT A;  3OS2 A;  3WXI A;  3MK6 A;  4B9M A;  4LH5 A;  3UIQ A;  2E2Q A;  2HBK A;  2X78 A;  3R9P A;  3F2K A;  4CEA A;  3FZM A;  2Z1H A;  3OHR A;  1QE1 A;  2NRW A;  4HUE A;  4RW4 A;  1HJR A;  4FJL A;  2W42 A;  4J2D A;  4KV8 A;  4H5N A;  4YOX A;  4OJR A;  1TVR A;  3K9K A;  3LZJ A;  1KRP A;  3A5N C;  4M7X A;  1C0F A;  2UUC K;  3OYF A;  4DLG A;  3CJB A;  4FYD A;  2W41 A;  2AA4 A;  1QHA A;  4BRM A;  1QSY A;  5HRS A;  3O4W A;  1YJ9 N;  1JJ2 M;  2ZF5 O;  3SQ4 A;  5KPR A;  3DWL A;  1M90 O;  4RG8 A;  4E1M A;  1TAQ A;  3F9K A;  3PO5 A;  2QM1 A;  1VQ9 N;  3DLK A;  4OO1 J;  4FCY A;  4KO0 A;  4H5T A;  1YJN N;  1TAU A;  3U3G A;  1NGD A;  1QZ6 A;  4NCA A;  3LP2 A;  2ZJP L;  3ZSX A;  3HPO A;  4DFM A;  4GKJ K;  4CVN E;  5C2D A;  1EP4 A;  4OGC A;  2IAJ A;  2AJQ A;  3MXJ A;  3NF6 A;  2BTF A;  4M45 A;  5TKW A;  4PKG A;  3WNH A;  4M42 A;  4C1N I;  1QS4 A;  3JXU A;  5B8H A;  4KI4 A;  4DV3 K;  2DFF A;  2HF3 A;  5CHI A;  3QEX A;  4ILH A;  1MWK A;  3DOL A;  4XIU A;  5IT9 O;  4JKD A;  4CBU A;  4RTF D;  5EY4 A;  5KTQ A;  3OS1 A;  2W6L A;  5C15 A;  4A2B A;  3CMA N;  4KHY A;  2IOC A;  2KZZ A;  2HHQ A;  3IAY A;  5GAD P;  3D0P A;  4N47 A;  4CBW A;  4FLU A;  3OYG A;  4BDZ A;  3OJU A;  2X74 A;  1NU0 A;  3U6F A;  1SZ2 A;  4H0P A;  1GLB G;  3O6W A;  4CZG A;  4HUF A;  3U3Y A;  1KVB A;  3WNF A;  3KLI A;  4NCB A;  4LSL A;  3K5N A;  4YHH K;  4I2Q A;  3ID6 A;  4CHY A;  4KHP K;  2A3Z A;  3BGR A;  3BF3 A;  5ADX A;  3DOK A;  3CM6 A;  2JGU A;  3OYB A;  2HHT A;  4CZK A;  3SV4 A;  2I7N A;  3O80 A;  1NKE A;  3CQY A;  3THX A;  5AQR A;  5LL6 Z;  2DY4 A;  5F2R A;  4CHQ A;  1HYS A;  3SLC A;  3FFK B;  3P39 A;  2GTD A;  1IBK K;  1C1B A;  3LAN A;  2UXC K;  3L2R A;  3WNG A;  4BWJ A; 
#chains in the Genus database with same CATH homology
 1C1A A;  1TK0 A;  5CY4 A;  4BDP A;  2VWJ A;  4FJ7 A;  3NF8 A;  2IC3 A;  4KTW A;  3KJV A;  4JS5 A;  3DI6 A;  1UA0 A;  3PY8 A;  4F3O A;  1S5J A;  1U04 A;  3ZT4 A;  4FJ8 A;  4DFK A;  2HHS A;  2Z1G A;  3QLH A;  4CJL A;  3HPG A;  2ZQB A;  4PA1 A;  3AVA A;  1RDB A;  3CG7 A;  4OKE A;  3TR8 A;  3HPH A;  2GV9 A;  1XI1 A;  2Z1J A;  1JLG A;  1D9D A;  4BDY A;  2YHB A;  3HL8 A;  3QEW A;  4KI6 A;  1JLB A;  3RMB A;  1L5U A;  3VQ4 A;  3NGZ A;  2D0C A;  3NF9 A;  4CGI A;  4DQQ A;  1EET A;  1JL1 A;  3VQC A;  4CJQ A;  4BE2 A;  4QOZ B;  1VSL A;  1FK9 A;  1ITG A;  3QNN A;  2FBT A;  2G8I A;  4PQU A;  4GW6 A;  2Y1I A;  3O4Q A;  4KTZ A;  3RRH A;  2G8H A;  4DSI A;  4M41 A;  3KKS A;  4HTU A;  3VQA A;  2E6M A;  3TWH A;  3DRS A;  4CEE A;  3G0Z A;  3OYJ A;  2PY5 A;  4F2R A;  1WSE A;  1X1P A;  4QAG A;  4DTP A;  4DFJ A;  1NK0 A;  4UQG A;  2XY8 A;  1X9W A;  3KLG A;  1REV A;  3SCX A;  2HVH A;  1I3A A;  5KGX A;  3O3G A;  1C1C A;  1WSH A;  1NK4 A;  3HJF A;  3VQQ A;  4CIG A;  1UAX A;  1JLE A;  1RT2 A;  1BIZ A;  2F96 A;  3LAK A;  1SV5 A;  4E19 A;  5J2N A;  3AVH A;  2NUB A;  1VRU A;  1S1W A;  3I0S A;  1FXX A;  3VA0 A;  1EKE A;  3QES A;  2XY7 A;  3V81 A;  3DLH A;  4F2S A;  1WAJ A;  1VSF A;  1ZBF A;  1SL0 A;  3HYF A;  1O1W A;  3OYN A;  3V9Z A;  4DF4 A;  3AO5 A;  4CFB A;  5HRN A;  3V9X A;  1VSE A;  4ID1 A;  4I9L A;  3OJS A;  1N5Y A;  1TKT A;  2G8W A;  1TV6 A;  2GBZ A;  4YFU A;  2G8V A;  1W0H A;  3MXI A;  4CHO A;  4FK2 A;  4RW7 A;  1J54 A;  4E7L A;  1TGO A;  5D3G A;  2OZM A;  2XHB A;  4CJR A;  1SUQ A;  1VRT A;  3MEC A;  3PX6 A;  4KB0 A;  4L8R B;  4Z4H A;  3QO9 A;  3NBP A;  1TK5 A;  3VQ9 A;  2B4J A;  5HLF A;  2VG5 A;  3CQ8 A;  4KB1 A;  3IG1 A;  2HMI A;  3O3F A;  1WN7 A;  3L8B A;  4CK1 A;  3LWM A;  3V4I A;  3AVC A;  1L3U A;  2PYJ A;  5FDL A;  3ZSO A;  4CIE A;  1D9F A;  4FW1 A;  3RWU A;  2BGG A;  1RTH A;  3SUN A;  2YNH A;  4DTX A;  1ZBH A;  1WSG A;  5DMR A;  2RPI A;  3TAQ A;  3L2Q A;  4CGD A;  3NCI A;  3RMD A;  4DTS A;  3PV8 A;  4O55 A;  1NK8 A;  4DMN A;  3AV9 A;  2VG6 A;  4LY7 A;  4Z4G A;  3L2U A;  3OY9 A;  2WOM A;  4BE1 A;  4ELV A;  3S3M A;  4ELT A;  4CFA A;  5HRR A;  1HMV A;  1IH7 A;  2HHU A;  3VQ7 A;  3VQ8 A;  4B9L A;  1VSH A;  3CFR A;  4FLX A;  3ZSZ A;  3KD5 E;  5KRT A;  3C6U A;  3NH0 A;  3KTQ A;  2DFH A;  3BDP A;  3NF7 A;  3NH2 A;  4CF2 A;  2KZM A;  3KLE A;  1ZBL A;  4B8C A;  4CFD A;  4Z4F A;  5KRS A;  4FJG A;  4CES A;  3DLG A;  3AA5 X;  1ASU A;  3ALY A;  4FJK A;  4CJV A;  1J9A A;  1Z25 A;  1WSJ A;  5SZT A;  1CLQ A;  2EHG A;  4Z4C A;  1CZB A;  4W5N A;  1TL1 A;  2B6A A;  3VQ5 A;  1S1T A;  2RN2 A;  4LH4 A;  4CHN A;  4CHP A;  3TAM A;  4JS4 A;  4OLA A;  4FJJ A;  2B5J A;  2R7Y A;  3IRX A;  1WLJ A;  4DQR A;  4NYN A;  4Z4E A;  3NDK A;  3TAP A;  1RBU A;  3AVK A;  4CF0 A;  3JSM A;  4M3R A;  4AHU A;  3O4N A;  1IG9 A;  5KI6 A;  1GOA A;  3HT3 A;  3HK2 A;  1BI4 B;  2X6S A;  1WAF A;  4EP4 A;  1L3V A;  4E7J A;  4DS4 A;  2YHA A;  4PWD A;  3CM5 A;  4ZHR A;  3M8P A;  3TAE A;  1KTQ A;  3E01 A;  2D5R A;  4DFP A;  2FBV A;  2JLE A;  3DMJ A;  3QIN A;  1RDD A;  3OVN A;  4CJW A;  5C25 A;  4AIL C;  5HP1 A;  1NJY A;  4FLV A;  4KPY A;  3SJJ A;  4M3U A;  3JYT A;  3V1R A;  1ZBU A;  4ZTJ A;  3V6D A;  2QXF A;  4AHR A;  4CJ5 A;  4E7H A;  3RR8 A;  2HHX A;  1BHL A;  1A5W A;  3D45 A;  1S9G A;  3OYI A;  3RR7 A;  4GMJ B;  4AHT A;  4KAZ A;  1NK6 A;  4M3Z A;  1TL3 A;  4EZ6 A;  2GUI A;  4N5S A;  4C8N A;  1VSJ A;  4M3W A;  1S6Q A;  1R0A A;  2F8T A;  3KLF A;  4CEB A;  4JRQ A;  4Q0B A;  3DLR A;  3VN5 A;  1RBV A;  2XY5 A;  4E1N A;  2E6L A;  1RDC A;  1KFS A;  1J53 A;  3WNE A;  4FM1 A;  3VA3 A;  4G1Q A;  4CEC A;  3DYA A;  3KIO A;  2F8S A;  5C24 A;  1DTQ A;  3AVN A;  4CEQ A;  3AA3 A;  3VQP A;  5CZ2 A;  3K57 A;  5FRM A;  1VSM A;  4OLB A;  1HNV A;  4CED A;  4C8L A;  4KTQ A;  4B9S A;  2HW3 A;  4DG1 A;  2KFZ A;  4WE1 A;  1CXU A;  5DK5 A;  1Y97 A;  2YKN A;  1JXE A;  3PO4 A;  3TAN A;  1ASV A;  3SV3 A;  4CGF A;  4JLH A;  4HCC A;  1TK8 A;  3KK1 A;  2LSN A;  4KFB A;  4CJP A;  4LSN A;  3RRG A;  1JLC A;  2OPR A;  4CJK A;  2XO7 A;  5J2P A;  3TAG A;  2QKK A;  3DM2 A;  4M3X A;  1LWC A;  2HND A;  2D0A A;  2HNY A;  5JS1 A;  3HVR A;  3DRR A;  1IKV A;  3QNO A;  5HRO A;  4IDK A;  4M3T A;  2QK9 A;  3AO3 A;  1NJW A;  2BDP A;  1BQN A;  2IGI A;  2KFN A;  3ZT0 A;  1JL2 A;  3OYL A;  1VSI A;  2XRI A;  3AO4 A;  4DWI A;  1IKX A;  2ZD1 A;  1FKO A;  4DTR A;  1TKD A;  2YNG A;  4FJM A;  4Z0U A;  4HVJ A;  4CJE A;  4AHC A;  3KK2 A;  1LAV A;  1QTM A;  1HRH A;  3ASM A;  1KSP A;  3IS9 A;  1JLA A;  4CJT A;  4W5O A;  3HP6 A;  1LV5 A;  4K8X A;  4DLE A;  2O4G A;  4OPK A;  2Y1J A;  3LDS A;  4F4K A;  4W5T A;  1RT7 A;  5I3U A;  4E3S A;  1UOC A;  3T1A A;  4FK4 A;  3DRP A;  1YTA A;  4CF1 A;  1RBS A;  1NK5 A;  1C0T A;  3SQ2 A;  3MEE A;  4JRP A;  2P5O A;  3SNN A;  2FBX A;  3ZT2 A;  4FM0 A;  4E0D A;  1KLM A;  1EX4 A;  4FJI A;  1YVU A;  4I7F A;  4DS5 A;  4PUO A;  4KHS A;  1RIL A;  3VQB A;  4B3O A;  4CFC A;  3SI6 A;  4DTO A;  1HQE A;  3H08 A;  3LPU A;  4AHS A;  4IG3 A;  4CJU A;  4CHZ A;  3A2F A;  3LZI A;  5J2M A;  4Q5V A;  3KKR A;  1S1X A;  1NOY A;  3TAB A;  3SPZ A;  3S3O A;  3QET A;  3TAR A;  4O44 A;  3KD1 E;  4FJ5 A;  3ITH A;  1TKZ A;  3ZSQ A;  2PYL A;  3QEI A;  5HRP A;  3S3N A;  2HHW A;  3OYE A;  3CFO A;  1RDA A;  2D0B A;  1IKW A;  3SUP A;  2IDO A;  1RT3 A;  2A1S A;  3P5J A;  4KRE A;  1D5A A;  1HYZ A;  5K14 A;  1FKP A;  4BWJ A;  4DTJ A;  4DTU A;  3ZSV A;  1X9M A;  4CK3 A;  1U4B A;  4FJH A;  4ELU A;  5EU7 A;  1RT6 A;  5SWM A;  3V9S A;  4LD0 A;  1RCH A;  4KHU A;  3HST B;  4W5R A;  2O4I A;  3SUO A;  1BCM A;  2YNF A;  4IBN A;  1QSL A;  1YTU A;  3K5L A;  1KCF A;  1G15 A;  1LWF A;  3I0R A;  3T3F A;  1BQM A;  3AA4 A;  4FZY A;  3K2P A;  3NGY A;  4CF8 A;  3PUF A;  1B9F A;  4C8O A;  4DTN A;  4OKJ A;  3MEG A;  5C42 A;  1RBT A;  3OYD A;  1LW0 A;  1XHX A;  4ZTF A;  4CEF A;  1RTI A;  4O0I A;  1KLN A;  1RNH A;  4I2P A;  2HVI A;  2DFE A;  4FZX C;  4E7I A;  5KGW A;  5JS2 A;  3L2W A;  4KHQ A;  2QKB A;  1W9H A;  3HP9 A;  4B8A B;  3LP1 A;  3QIO A;  4EP5 A;  3VQE A;  1HQU A;  1RBR A;  4RW9 A;  3MXM A;  1JKH A;  1Q9X A;  3G10 A;  1JLF A;  2HB5 A;  1DLO A;  3QEV A;  3FFI A;  2I5J A;  2OYQ A;  4DQI A;  4B08 A;  2A1R A;  5CYQ A;  1QQC A;  4BE0 A;  3PX4 A;  3RMA A;  1Q9Y A;  3P1G A;  3CFP A;  4Y1C A;  1IKY A;  4DSK A;  3V1O A;  2RKI A;  1ASW A;  3C6T A;  3S9H A;  1SKW A;  3TI0 A;  1WSF A;  1UA1 A;  4OPJ A;  1BL3 A;  1VSD A;  2DTU A;  4CJF A;  4GVM A;  4B9T A;  1LW2 A;  2WON A;  5I42 A;  4FLW A;  1NK7 A;  3AA2 A;  3MAQ A;  4CJ3 A;  3F73 A;  3SZ2 A;  3M8S A;  1L3T A;  4YNQ A;  1RTD A;  3DLE A;  5CYM A;  4O0J A;  4CCH A;  4FW2 A;  4KHN A;  4DSJ A;  1RTJ A;  1J5O A;  4C8M A;  3LWL A;  4FJ9 A;  1HYV A;  1B92 A;  1CZ9 A;  3ZT3 A;  3HM9 A;  1DTT A;  1S6P A;  2BAN A;  2E4L A;  3B6P A;  5FRO A;  4KKO A;  3OS2 A;  3HXM A;  3C94 A;  1BI4 A;  3V9U A;  1JLQ A;  4B9M A;  1C0U A;  4F8R A;  4CF9 A;  4LH5 A;  3UIQ A;  3NHG A;  3RMC A;  4B9V A;  3K58 A;  3ULD A;  4E89 A;  3V1Q A;  1X9S A;  4OKK A;  4N41 A;  2HNZ A;  2X78 A;  1U49 A;  2OPS A;  4CEA A;  1L3S A;  3SUQ A;  4DU1 A;  2Z1H A;  4CJ4 A;  4B9U A;  1QE1 A;  1KVA A;  3NGI A;  3QER A;  4CIF A;  4I9Q A;  4HUE A;  4RW4 A;  1HPZ A;  1B9D A;  1ZYQ A;  5E41 A;  1SKS A;  3ZSW A;  2IS3 A;  1NJZ A;  1HJR A;  1S1U A;  1NOZ A;  2EX3 A;  4FVM A;  4FJL A;  2W42 A;  4J2D A;  4KV8 A;  2OZS A;  4CEZ A;  4IFY A;  2ITG A;  2P51 A;  4OJR A;  4CJS A;  1TVR A;  1A5X A;  4N76 A;  3LZJ A;  1KRP A;  3K59 A;  2X6N A;  3SPY A;  4FK0 A;  5FRN A;  3LAL A;  3AO1 A;  3QIP A;  1CXQ A;  3OYF A;  1N6Q A;  4DLG A;  3ZCM A;  1BIS A;  2ATQ A;  1KVC A;  2KQ2 A;  4DTM A;  4CE9 A;  1ZBI A;  4FYD A;  4TSX A;  3THV A;  1F21 A;  3O3H A;  3VQD A;  3ZSR A;  3OYK A;  3P83 D;  4EZ9 A;  3L2V A;  1QSS A;  1QSY A;  1VSK A;  4DQS A;  5HRS A;  1QHT A;  1UWB A;  3K5O A;  3NAE A;  4KRF A;  4ID5 A;  3SQ4 A;  4J2A A;  4OGE A;  4DSE A;  3I8D A;  3ZT1 A;  4BWM A;  2VWK A;  4RG8 A;  4E1M A;  1TAQ A;  4RW8 A;  3F9K A;  3ZSY A;  3PO5 A;  3HO1 A;  1NK9 A;  1RT1 A;  3DLK A;  3LAM A;  4FCY A;  4KO0 A;  2YKM A;  2FC0 A;  3NH1 A;  3SYZ A;  1TAU A;  3U3G A;  1HNI A;  1LAW A;  4NCA A;  4KHW A;  3LP2 A;  1JXB A;  5J2Q A;  1SL2 A;  3ZSX A;  3HPO A;  4E7K A;  2KW4 A;  4DFM A;  4FXD A;  2Q3S A;  4RW6 A;  4ICL A;  4H4O A;  1EP4 A;  4OGC A;  1MU2 A;  1XC9 A;  2RF2 A;  1T05 A;  2IAJ A;  2AJQ A;  3MXJ A;  3NF6 A;  4CGJ A;  3K5M A;  4AH9 A;  4M45 A;  3VQ6 A;  3OS0 A;  3WNH A;  3OYA A;  4PY5 A;  4M42 A;  1QS4 A;  4O4G A;  4DU3 A;  1XWL A;  2VG7 A;  4KI4 A;  4DSL A;  1D8Y A;  2DFF A;  3AVM A;  4H4M A;  3QEX A;  2PZS A;  3CYM A;  4CGH A;  3L3V A;  3M8Q A;  4IFV A;  3DOL A;  5J1E A;  4XIU A;  3M8R A;  1WSI A;  3AVG A;  1U45 A;  4R5P A;  1TKX A;  1YT3 A;  5KTQ A;  3OYC A;  3OS1 A;  3KK3 A;  4BAC A;  1NKC A;  3OYM A;  1T7P A;  4KHY A;  2IOC A;  4CEO A;  2KZZ A;  2G8K A;  1NKB A;  2HHQ A;  3NE6 A;  3IAY A;  4HCB A;  1WNS A;  3C95 A;  3DLB A;  3AVI A;  4DQP A;  3D0P A;  3KLH A;  4N47 A;  1S1V A;  2ETJ A;  4MFB A;  2OPQ A;  4FLU A;  4N56 A;  3OYG A;  3OJU A;  4BDZ A;  3NFA A;  1T03 A;  2X74 A;  1S9E A;  4FJX A;  4Y1D A;  3PX0 A;  4CGG A;  3U6F A;  3B6O A;  3LP0 A;  1VK0 A;  4HHT A;  1A5V A;  4NCG A;  3EZ5 A;  4FM2 A;  4M3Y A;  3EYZ A;  3SQ1 A;  4HUF A;  3QEP A;  1XHZ A;  4J2B A;  2YNI A;  2Z1I A;  1GOC A;  1LWE A;  1KVB A;  3U3Y A;  3WNF A;  3KLI A;  1IO2 A;  4NCB A;  1SKR A;  3EY1 A;  4B9N A;  1K6Y A;  4LSL A;  1EXQ A;  3T19 A;  4CER A;  3K5N A;  4FLZ A;  4DSF A;  1RT4 A;  4DU4 A;  4J2E A;  1BIU A;  4I2Q A;  4K8Z A;  3SQ0 A;  1NJX A;  4CHY A;  1GOB A;  3AVL A;  2OA8 A;  3OYH A;  2HHV A;  1RT5 A;  3BGR A;  3DOK A;  4QCL A;  3LP3 A;  3CM6 A;  4CK2 A;  2JGU A;  4FZZ A;  3ISN C;  4HUG A;  3OYB A;  2HHT A;  2G8U A;  2XY6 A;  4MQ3 A;  1BCO A;  3RTV A;  1Q8I A;  3MED A;  3AVF A;  4NYF A;  1U48 A;  2FBY A;  4F3T A;  2YV0 X;  2KTQ A;  1KFD A;  2OPP A;  1C6V A;  3AVB A;  3SV4 A;  1U47 A;  1SL1 A;  1T8E A;  3LPT A;  3AO2 A;  4OVL A;  2ZE2 A;  5CZ1 A;  3TAF A;  1BGX T;  4W5Q A;  1NKE A;  2G8F A;  3HVT A;  4DF8 A;  4AHV A;  4FLT A;  2DY4 A;  4CHQ A;  4IG0 A;  4O5B A;  1HYS A;  4C8K A;  1Z26 A;  3WNG A;  2P5G A;  1C0M A;  1C1B A;  4Z4I A;  3AVJ A;  3V9W A;  4FJN A;  2P1J A;  4IKF A;  5HBM A;  2BE2 A;  3LAN A;  1I39 A;  3L2R A;  4H8K A;  4FLY A;  3L3U A;  5T7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...