1ZBFA

Crystal structure of b. halodurans rnase h catalytic domain mutant d132n
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
132
structure length
132
Chain Sequence
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribonuclease H-related protein
publication title Crystal Structures of RNase H Bound to an RNA/DNA Hybrid: Substrate Specificity and Metal-Dependent Catalysis.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase
total genus 41
structure length 132
sequence length 132
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1zbfA00
1RT2A 4DTJA 2Z1GA 3DLBA 4KHYA 4FW2A 3LZIA 3AVJA 2EX3A 4CHPA 3MXJA 3CQ8A 3RTVA 4OPJA 3ZSWA 4FM2A 4IG3A 3LP1A 5KGXA 2B6AA 1T05A 4CJ3A 3DLGA 1VRUA 4DQPA 1WAJA 5I3UA 4YNQA 3OYNA 3DLKA 1EKEA 3AVMA 2PYJA 4DU3A 4BDYA 2IS3A 5J2PA 4CGFA 4M41A 1EP4A 1O1WA 2YHAA 3DRPA 4EP4A 3T19A 4CEBA 3QEPA 3QIOA 1BI4B 1C0UA 1CXQA 1HQUA 3SJJA 1LWEA 3PX0A 1DTTA 4F4KA 5E41A 3D45A 4OKJA 1YT3A 5K14A 3HL8A 2KW4A 2GUIA 1RDAA 1NK4A 2BE2A 3AA3A 4IDKA 1LAWA 4CK2A 4KTQA 4K8ZA 4CECA 4NCAA 1VK0A 3MECA 4FLYA 2O4GA 1NKEA 2Z1IA 5FROA 3L2QA 4NYNA 4FLUA 2PY5A 3PUFA 1KLNA 3ZT4A 3PV8A 4H4MA 4LH4A 3L2VA 1BCMA 2XHBA 2XRIA 1TVRA 3ZSQA 4JS5A 3TAGA 2KFNA 5CY4A 4L8RB 4AHUA 1NOYA 3V9XA 1SV5A 4IFYA 4LH5A 2A1SA 2XO7A 3ZSVA 3ASMA 1CZBA 4E0DA 3ISNC 3B6OA 2I5JA 3K5MA 4OLAA 4N47A 1FXXA 5C25A 3NH0A 3P1GA 4ZTFA 3HP9A 4RW7A 5SWMA 1TAQA 4YFUA 3CFPA 4FCYA 3TAQA 4BWJA 1L3SA 2PZSA 3PO5A 1EX4A 4Q0BA 5KI6A 2XY7A 3MEEA 2QXFA 1J9AA 3IG1A 4RW4A 4JRQA 4B9TA 3PX6A 3L3UA 4CJ4A 1S9EA 1GOCA 4B9LA 4N76A 4FXDA 4DS4A 3JYTA 3VN5A 1C1BA 5J1EA 4E7JA 1R0AA 4KI4A 3KLEA 3S3MA 4FJIA 3SUOA 2HHTA 1ZYQA 3OS1A 3SZ2A 4K8XA 4NYFA 1N6QA 4FZZA 3TAMA 4DTXA 4G1QA 3O3HA 2WONA 4CESA 1L3UA 2X74A 1JLBA 1CLQA 3NFAA 3TARA 1BL3A 1HPZA 4EZ6A 3BGRA 4HVJA 1D8YA 1XHZA 4O0JA 2X6NA 4CE9A 5KTQA 1RTJA 4FJJA 1EXQA 3AVCA 1RDCA 1ASWA 4B9NA 3V1RA 1ZBHA 1BISA 1RT5A 3RRGA 4HTUA 1Z25A 4GVMA 3T3FA 3V1QA 3OJUA 4C8LA 4CJ5A 3V4IA 1RTHA 3SQ1A 3VQ7A 3ZT3A 4HHTA 1JL1A 4H4OA 5DK5A 4FK0A 1JLFA 2RN2A 3WNHA 1QE1A 3MEGA 2OPQA 4W5RA 1NK7A 1KSPA 4DQRA 5CYMA 3G0ZA 3NDKA 4Z4FA 1JXEA 2ATQA 4F2SA 2HNDA 3NBPA 4UQGA 3TI0A 4BWMA 2HHWA 2AJQA 3AA2A 1A5VA 3HVTA 4KTZA 4FM0A 3SQ2A 4MQ3A 1ZBLA 2Y1JA 1VSLA 3O4NA 4B3OA 3PX4A 3DYAA 3HK2A 3FFIA 1YTAA 1TGOA 3TAPA 3KD1E 4IBNA 3HSTB 2OA8A 3OYJA 3U3GA 4M3UA 1C1AA 4E7IA 2QKBA 3C95A 4HCBA 1RCHA 3DOKA 3LPTA 5HROA 1QS4A 3ZSRA 3CFOA 3CYMA 2D0AA 3VQBA 3KLGA 2OYQA 3K59A 1S1VA 4E7LA 4C8KA 4N5SA 1S6QA 3QEIA 3OYLA 3AVKA 4HUFA 1UA1A 4CEFA 1WSFA 4FK2A 2HNYA 4Y1CA 4ELVA 2G8HA 3V9SA 1S9GA 3NF7A 3LP2A 4RW6A 2JLEA 5KGWA 3M8RA 3QNOA 4E7KA 3QESA 1L5UA 4HUGA 3NHGA 3OJSA 4AHTA 5CZ1A 4DTUA 3VQAA 3CM6A 4PA1A 3ITHA 4CFDA 3M8QA 3RMDA 3DLEA 1VSHA 1W0HA 1T03A 4LY7A 3QEVA 3AVAA 5SZTA 1X9WA 2KZZA 1LV5A 3KIOA 4O5BA 4J2EA 1J54A 1ASUA 4CIGA 1RT7A 1JL2A 1JLEA 3F9KA 3L2UA 4FLWA 4DS5A 1D9FA 3AVGA 5D3GA 3OYEA 1T8EA 1B9DA 5JS2A 5J2QA 2Y1IA 4FJKA 5T7BA 1NKCA 3OS2A 2VG7A 3S9HA 2OZSA 1F21A 4DSIA 3WNGA 1YTUA 5CYQA 1C0TA 4BACA 4GMJB 3THVA 5HRPA 1TKTA 1FKOA 2JGUA 3K5LA 3V6DA 3TAEA 3RWUA 1WSJA 1XI1A 3SV4A 4DLGA 4DTSA 1UOCA 3TWHA 3DLHA 4FZXC 4DG1A 4B8CA 3QEXA 1D9DA 3SNNA 4CJQA 3SYZA 3VQ4A 3TANA 3NAEA 4DF4A 4M3TA 4KRFA 1YVUA 1RBUA 3VQ8A 1SUQA 3L2WA 3HVRA 3SPZA 4JRPA 2A1RA 3ALYA 4DTPA 4CHOA 4CGHA 1NK5A 1NK8A 1C6VA 1LWFA 3U6FA 1J5OA 1J53A 3PY8A 5J2NA 5C24A 4Z4HA 4W5NA 4CJEA 2XY5A 4NCBA 4FW1A 4AHCA 1WAFA 4DMNA 3P5JA 3H08A 3LALA 1LW0A 1BQNA 1C1CA 3ZT1A 3HT3A 1RTDA 4J2BA 1KVCA 4ELTA 4OGCA 3LP3A 3QETA 1D5AA 4ZTJA 3LWMA 1Q9YA 4O55A 4AHRA 4PUOA 1KTQA 4AH9A 1SKSA 1HQEA 2HB5A 5HRRA 3HPOA 4W5OA 1TK0A 3SCXA 2IDOA 1HYZA 1EETA 4FJMA 4CEQA 4CFCA 4FYDA 3LDSA 2DY4A 3C94A 2OZMA 3P83D 1BIUA 3C6TA 2BANA 1CZ9A 1QSYA 1QTMA 4DQSA 4LSNA 2DFFA 1WN7A 3KLHA 3VQEA 3I0RA 3IAYA 4CK1A 3F73A 1WSGA 1RT6A 2DFEA 2ITGA 3EYZA 4DWIA 3SQ4A 4RG8A 3RR8A 1IKYA 4E3SA 4O0IA 3V1OA 3C6UA 1RT1A 2KFZA 1FKPA 3VQDA 3I0SA 1U48A 4KV8A 4CJSA 4O4GA 2OPSA 3NGZA 3HPGA 3OYGA 4M42A 1MU2A 2LSNA 4DTNA 3CG7A 2XY8A 4I9LA 1RBVA 4CFBA 1NKBA 4CEAA 3EZ5A 4KPYA 5HRNA 3S3NA 1X9MA 1BI4A 3K58A 2HHUA 2D5RA 4CEZA 2YHBA 4CHZA 1IO2A 4FLTA 1IH7A 4GW6A 3MXMA 5CZ2A 2P51A 3DM2A 4OKKA 1NK6A 1GOAA 1WNSA 3OYBA 4OVLA 3NH1A 4KREA 4OGEA 3QIPA 1XC9A 4KB0A 2O4IA 3AO1A 1UAXA 2HMIA 4M3RA 1QSSA 3V9ZA 3O3GA 4ID5A 1I3AA 4CEDA 3QERA 3AVBA 3G10A 4BE2A 1UA0A 3K2PA 4AILC 4CK3A 3LAMA 2IOCA 4E19A 3VQCA 4DU1A 5JS1A 1HYVA 2ZD1A 3KK2A 1HRHA 1HNVA 4IKFA 4CEOA 3ZSZA 4ZHRA 3NE6A 2W42A 1C0MA 4FLXA 2YNFA 1HYSA 3OS0A 4CHQA 4NCGA 1GOBA 4OKEA 2BGGA 4DTMA 4DFPA 4KB1A 2QK9A 1RBSA 3HYFA 3VA0A 3ULDA 3DRRA 3K5OA 3LZJA 1QHTA 2FBTA 3HP6A 3VA3A 1VSKA 4M3YA 4QOZB 1JLAA 3AO5A 4KO0A 1S1UA 4FJLA 4B9SA 4FJNA 3HPHA 2D0CA 2YNIA 3K5NA 1ZBIA 3OYCA 4FJXA 2HHVA 1BHLA 1L3VA 3SUPA 3AO2A 3DRSA 1REVA 2XY6A 2YNGA 2F96A 3O3FA 2YNHA 3OYIA 4B9VA 3AV9A 4E1NA 1VSIA 5FRNA 3WNFA 1BGXT 1RILA 5FDLA 3ZT0A 4Z4CA 3NCIA 4HUEA 1ZBUA 5C42A 2RPIA 1KLMA 1Q8IA 1B92A 1IKXA 4LSLA 5KRSA 4R5PA 3SI6A 1QSLA 4F2RA 2D0BA 1SL1A 4C8MA 4I9QA 3AVFA 1HNIA 4FZYA 1NK9A 4DFKA 2RKIA 1SL2A 1LAVA 3K57A 3KD5E 1NOZA 4KI6A 5HP1A 2E4LA 2DFHA 1WSHA 3AO4A 4N56A 4DSFA 3LP0A 1BQMA 3NF6A 4C8NA 5KRTA 1SKRA 3RR7A 4I2QA 1X1PA 2Z1JA 4CJFA 3QNNA 3UIQA 2QKKA 1VRTA 4BDPA 3AVNA 3SPYA 4OLBA 4E7HA 2G8IA 1U4BA 5DMRA 4KHNA 1SL0A 1JXBA 4M45A 2WOMA 3M8SA 2P5OA 3ZSYA 4B08A 4CIEA 2GBZA 3OVNA 2X78A 1UWBA 2HHQA 1NJXA 3NH2A 3MEDA 2P5GA 1ASVA 2VWJA 1S6PA 4OJRA 4F3OA 1RBRA 2YKMA 1KRPA 4DSKA 1RTIA 4DQQA 4FJGA 1VSMA 2FBYA 2IGIA 5I42A 4OPKA 2FBVA 2NUBA 3AVHA 3OYFA 4B9UA 3OYKA 1KFDA 4N41A 4DQIA 2FC0A 4DSEA 4FLZA 5HRSA 4FK4A 3LWLA 3AA4A 4DFJA 5HBMA 4CIFA 3RMAA 2BDPA 4RW9A 3QINA 3MAQA 4CJLA 2KTQA 1RNHA 1B9FA 3OYMA 3RMCA 2G8UA 1X9SA 2YV0X 1U45A 1RT4A 5FRMA 3ZSOA 4DF8A 3LANA 3OY9A 4CHNA 1Z26A 4W5QA 3VQ9A 2R7YA 1IG9A 4CGDA 3L2RA 4KFBA 1I39A 2YKNA 1G15A 1S5JA 4ICLA 4FJ8A 1HMVA 4C8OA 4I2PA 4BE1A 3OYHA 1TL3A 4RW8A 1BIZA 3KK1A 4O44A 2HVHA 3TAFA 1TK8A 4F3TA 1XHXA 2HHSA 1KVBA 1JKHA 3NF8A 3HM9A 1TL1A 2B4JA 4B8AB 4CJUA 3BDPA 4CF8A 1KVAA 2ZQBA 1A5WA 3I8DA 4F8RA 1JLGA 4DFMA 4KHQA 4Z4GA 1IKVA 4PQUA 4H8KA 3HXMA 1RDBA 1U04A 1LW2A 2ETJA 2IC3A 2B5JA 3AO3A 3IRXA 4FM1A 3V81A 2G8VA 1S1XA 3TR8A 3O4QA 2X6SA 4EP5A 1T7PA 1Y97A 4Y1DA 1VSEA 3KLFA 1DLOA 1JLQA 3DI6A 4CF1A 3EY1A 2DTUA 4FVMA 4CJWA 2HNZA 1WLJA 1U47A 3V9UA 3PO4A 4FJ5A 3QO9A 4HCCA 1TKXA 3VQQA 4I7FA 4CHYA 4Z4EA 3SV3A 4CGGA 2F8SA 4KHWA 1BCOA 4IG0A 3VQ5A 2KZMA 3LPUA 1CXUA 3L8BA 2VG5A 4FJ9A 2E6MA 2VG6A 3M8PA 1ITGA 1TV6A 1TKZA 1S1TA 3CM5A 3VQ6A 4KHSA 1TAUA 1WSEA 1FK9A 2RF2A 2F8TA 3L3VA 4WE1A 3AVLA 4E1MA 4DU4A 4CFAA 5J2MA 2OPPA 4FJHA 4QAGA 3MXIA 4FLVA 3SQ0A 3T1AA 1DTQA 3JSMA 4DSJA 3DOLA 1NJYA 5HLFA 1Q9XA 1JLCA 3AA5X 1SKWA 4DLEA 1N5YA 3KTQA 3KKSA 4KHUA 2G8KA 1IKWA 2PYLA 4AHVA 4CJPA 3RRHA 3OYDA 4AHSA 2Z1HA 4B9MA 1VSDA 1U49A 4CGIA 3OYAA 4LD0A 4CJTA 4PY5A 1RBTA 4CGJA 2Q3SA 5EU7A 1VSJA 2OPRA 4CF2A 3NGIA 1KFSA 4J2DA 2G8WA 4FJ7A 4ID1A 1W9HA 1TKDA 2FBXA 2IAJA 4Z4IA 4JLHA 1LWCA 1QQCA 3E01A 4M3XA 4CJVA 1NJZA 4PWDA 4CJRA 1S1WA 4E89A 2G8FA 2E6LA 1KCFA 2HHXA 4CEEA 1WSIA 1RDDA 3KLIA 1A5XA 3DMJA 1HJRA 3NF9A 4IFVA 3VQPA 3ZSXA 4Q5VA 4DTRA 1RT3A 4XIUA 3U3YA 3TABA 3ZT2A 3B6PA 3V9WA 3QLHA 2ZE2A 3NGYA 4MFBA 4BDZA 3WNEA 4QCLA 4CCHA 4ELUA 2HW3A 3A2FA 3SUNA 4EZ9A 3HO1A 3CFRA 4Z0UA 4J2AA 3S3OA 2HVIA 4M3WA 3HJFA 4CF9A 3D0PA 1VSFA 2EHGA 2KQ2A 4KKOA 4DTOA 3SUQA 2GV9A 3AVIA 3IS9A 3DLRA 3KKRA 3ZCMA 4JS4A 2VWKA 3KJVA 4CJKA 4KAZA 3KK3A 3LAKA 4KTWA 1NJWA 4CERA 4W5TA 1NK0A 1L3TA 1K6YA 4BE0A 4DSLA 3QEWA 3RMBA 4CF0A 1XWLA 4M3ZA 2P1JA 1TK5A 4TSXA 1ZBFA
chains in the Genus database with same CATH superfamily
1RT2A 3WXKA 3AAQA 3CQ8A 3RTVA 3BUZB 3R3LA 4PKIA 3LP1A 2B6AA 2JWLA 4DQPA 4X62K 1WAJA 2VQEK 3U9DA 1BA1A 5I3UA 1EKEA 3UE5A 4BDYA 4EP4A 1K8KA 2YHAA 4BY9C 4C1NK 1BI4B 1CXQA 5JVGL 1LWEA 3PX0A 2KW4A 1RDAA 1NK4A 3AA3A 1LAWA 2VCPA 4FLYA 3L2QA 4NYNA 2PY5A 2YJEA 4H4MA 1ESVA 2J4RA 3CCJN 1TVRA 4L3QA 4JS5A 5M1KA 2KFNA 1HUXA 4AHUA 1NOYA 3QB0A 1OKJA 3ENBA 4AF1A 3ZSVA 1CZBA 2FF3B 3UKRB 3ISNC 3B6OA 2I5JA 4YOYA 3K5MA 4E0DA 4N47A 4WQ4C 4BVPA 4RW7A 3CFPA 2PZSA 3PO5A 4YDUC 4JRQA 3ATVA 3L3UA 4CJ4A 5JVHL 4DS4A 1C1BA 5J1EA 3S3MA 4FJIA 3SUOA 4H03B 3OS1A 5TKYA 3SZ2A 4B3MK 1N6QA 1XNRK 4G1QA 1QQMA 2X74A 3N4QA 1BL3A 1EXQA 1ASWA 1ZBHA 4LF6K 1RT5A 3RRGA 1T6CA 3V1QA 3SBGA 4C8LA 4CJ5A 1RTHA 2NZTA 4H4OA 5ELZA 3WNHA 1QE1A 4MLHA 4DQRA 3G0ZA 3NDKA 3VERA 3VTIA 1VQ6N 4FWQA 3NBPA 3CPEA 3TI0A 1A5VA 5M1OA 3THYB 2V7YA 1ZBLA 3KWGA 1VSLA 2NNWA 4B3OA 3DYAA 2OA8A 1C1AA 2HBKA 1RCHA 2P9SA 4MDBA 5HROA 1HJOA 2W6LA 2P9LB 3ZSRA 3CFOA 3P4IA 4YY3K 1N32K 3UKUA 2OYQA 4JI8K 4N5SA 1S6QA 4IXCA 1I94K 1HNXK 3FZLA 3DLLL 5I9EB 3V9SA 3LP2A 1T3VA 2Q1NA 3R1XA 3QESA 1L5UA 1W7AA 4LF8K 3B8AX 4WFNL 2I7NA 3VQAA 3CM6A 4V19S 2P9KB 4CFDA 4K41A 4FO0A 4LY7A 3AVAA 4YOTA 5LJWA 4MLEA 4B1YB 1LV5A 3KIOA 4J2EA 4NXNK 4FLWA 1P90A 3F9KA 4DS5A 4RTFD 3OYEA 1DGKN 3MX2A 1N36K 5JS2A 1VQMN 4MO5A 4FJKA 5T7BA 1NKCA 2VG7A 4DSIA 1YTUA 1C0TA 2JGUA 3VMFB 5FPNA 4JKGB 5IWAK 4BC2A 3ENHA 4DLGA 3DLHA 1UOCA 3QEXA 3SNNA 3ENOA 4KRFA 3NAEA 4DF4A 2V52B 1RBUA 3VQ8A 3L2WA 4NXMK 3ALYA 1D9DA 1KXPA 4CZHA 5J2NA 1YITN 3MCPA 4CJEA 3LALA 1C1CA 4A61A 4J2BA 1WBDA 3LP3A 3QETA 5EOYA 1D5AA 4ZTJA 1Q9YA 4PUOA 1KTQA 5CE3A 1TUUA 3T7ZA 3HPOA 2NRWA 1VQ8N 2IDOA 3DWLA 4IJAA 1BIUA 5M1PA 1QSYA 1QTMA 4DQSA 4LSNA 2GX9A 3VQEA 1RT6A 2DFEA 4LF9K 3C6HA 4BC4A 1NU0A 5BREA 3SQ4A 1NGHA 3RR8A 4KH6A 1KAZA 1RT1A 2KFZA 4KV8A 4CJSA 3OA9A 3HM8A 2OPSA 4FOEA 3CCEN 3QFUA 3BP8A 4BR5A 4I9LA 1RBVA 4KPYA 3A8YA 3EZ5A 4JD2B 3S3NA 3VEOA 1X9MA 1BI4A 2HHUA 1VQNN 2D5RA 4WFAL 1M90O 4FLTA 3BEXA 1MDUB 4IDHA 4BR0A 3CXCM 5CZ2A 1NK6A 1NGAA 4BRIA 4KB0A 4GV9A 2O4IA 3V9ZA 3W3DA 4ID5A 1I3AA 3GL1A 5M1QA 4CEDA 3G10A 3J80O 4BE2A 4AILC 3VQCA 1HYVA 4HTLA 4YOUA 4ZHRA 2W42A 3VF2A 3UKRA 3CETA 3OS0A 3IKMA 2O8FB 4DTMA 3KVGA 4DFPA 3HYFA 1JCEA 2NRVA 4YORA 3NVKA 3O8MA 3HP6A 2FBTA 2EWSA 4M3YA 4FJNA 1X3MA 2YNIA 4HWIA 5HOOA 1ZBIA 4JKEA 3SUPA 3K9JA 4DR4K 5AQRA 2YNGA 3O3FA 4JNEA 2YNHA 3OYIA 4DKWA 3MN6A 1VSIA 4E1NA 3WNFA 1BGXT 1RILA 1DKGD 3G6EN 2RPIA 1KLMA 4CD3A 1BO5O 4LSLA 1QSLA 4F2RA 3LDOA 2D0BA 4C8MA 3AVFA 4DFKA 4BGBA 4BRNA 3KD5E 2OCEA 2HHHK 2FXUA 2HOEA 5HP1A 2E4LA 3AO4A 3R8EA 3RR7A 1X1PA 3UIQA 3AVNA 5FLXO 1XQSC 5DMRA 4LC9B 3QMLA 2P5OA 1ILYA 3THYA 5C0YA 4BRHA 3MEDA 3QFPA 2CGKA 4DQQA 5AQQA 1OVYA 2ASMA 4O8KA 4DQIA 2P9LA 2FC0A 1E4FT 4FK4A 3THXB 3A5NC 3AA4A 3LWLA 5HBMA 4DFJA 1YJWN 1X9SA 2YV0X 5FRMA 4WCEL 3CC4N 1Z26A 3QBXA 1VQ9N 4U7BA 4PL8A 3E9LA 4LFBK 3O9RA 4RW8A 4BRLA 3KK1A 1TK8A 4F3TA 1XHXA 1S22A 2HBJA 4OX9K 3HM9A 2P9KA 3NF8A 4CF8A 2ZQBA 1A5WA 1JLGA 2PAVA 1NWKA 1IKVA 4UY8O 3H3NO 1WB9A 1LW2A 4ISGA 2E2OA 3EO3A 1S1XA 3O4QA 2X6SA 4OO1J 4Y1DA 1VSEA 3KLFA 1DLOA 3FFKB 3EY1A 3HSCA 3EEQA 2GUPA 4FVMA 3PO4A 4ILHA 4JKGA 4CGGA 1S72N 3AAPA 3VQ6A 2W6KA 3SAHA 2F8TA 4WE1A 4QAGA 4DSJA 3DOLA 1QVGM 1Q9XA 1JLCA 3AA5X 3L0QA 4DLEA 4KBOA 1N5YA 4DV0K 1YJ9N 1IKWA 4B1ZA 3C6AA 1HR0K 1VSDA 4B9MA 3OYAA 4LD0A 3T1HK 3ID8A 1E3MA 1IBKK 4JI5K 4PL7A 4ID1A 5BR8K 4CZMA 3NMUA 4H0PA 3CJ7A 3E01A 1C0GA 2GTDA 4QS9A 4PKGA 3M5RA 1SAZA 4IOCL 3ZYYX 2ITMA 4CEEA 3J7AP 4AM6A 1A5XA 1NGIA 3GOIA 3NF9A 3G71N 3U3YA 2O8DB 3ZX0A 4GY2B 4XIUA 2YHWA 5KQDA 2PFUA 3NGYA 5AQXA 1OH6A 1J6ZA 3M1FA 1NGFA 4JD2A 4M3WA 1X9JA 4EAHD 5LJVA 2KQ2A 4DTOA 4KKOA 4JS4A 5M1NA 3CJ9A 3KJVA 3KK3A 3KZBA 5AJ3K 4M3ZA 5BPNA 3Q7BA 4TSXA 1BU6O 3DLBA 1U6ZA 3MN5A 4FW2A 4KHYA 3AVJA 4XEIA 4WFBL 3VEZA 4OPJA 3TTFA 5KGXA 3SLCA 1T05A 3DLGA 3DLKA 2PYJA 3W0LA 4DU3A 2O8FA 4M41A 3T19A 4OPHA 4DUZK 3VPZA 1HQUA 4JYAK 4IEEA 1DTTA 4F4KA 5E41A 4OKJA 3HL8A 2BE2A 4NCAA 1VK0A 1NKEA 1BWFO 5FROA 1X3NA 1HLUA 4JKCA 5AQGA 3ZT4A 4LH4A 3L2VA 3WQTA 3ZSQA 3OW2M 4MO4A 1S3XA 4IFYA 5KPRA 5C25A 3NH0A 2HHWA 1L3SA 4QS7A 4FCYA 3BZCA 4Q0BA 5KI6A 3FZKA 3MEEA 2QXFA 5GAHP 4KHPK 1GOCA 4OPAA 2QWOA 2E8AA 5DM7L 4FXDA 3JYTA 3VN5A 4BG9A 4DR1K 2UUCK 4KI4A 4JK7A 3KLEA 3MX5A 1VHXA 4DQ8A 4X64K 4NYFA 4FZZA 3TAMA 4DTXA 1KC8O 3L6QA 1OH7A 2WONA 1L3UA 1CLQA 3TARA 4A2BA 5BPMA 1HPZA 3BGRA 1XHZA 4O0JA 1IV0A 1RTJA 3HZ6A 1RDCA 3BF1A 4FPBA 4B9NA 4BG8A 2A6AA 4FWSA 4HTUA 4BR4A 5JLFA 4B1UB 3THXA 4HHTA 2ZM6K 2VGNA 1JL1A 5DK5A 2E2PA 3HI0A 3OBWA 3K0SA 4W5RA 4ILGB 4Z4FA 2HNDA 3LM2A 2Q97A 2QWNA 3WUHA 1IJJA 4GVEA 3HVTA 4FM0A 3SQ2A 3BF3A 1QQOA 2V7ZA 3PX4A 3HK2A 4H0TB 3FFIA 1YTAA 3SMSA 1TGOA 5AQVA 3E1YA 3O6WA 4HCBA 4B3SK 1VAZA 3VF6A 3CYMA 3KLGA 1KQSM 4E7LA 4C8KA 3H1QA 2BH1A 3MCAB 4HUFA 3C7NB 5FPMA 1WSFA 4ELVA 2G8HA 3M8RA 1GLAG 5KGWA 2JLEA 3QNOA 4M7YA 3A0IX 1SS6A 3CC7N 3U4LA 1N8RO 4AHTA 4O5FA 2UXBK 4DTUA 3S41A 1NMDA 3ITHA 3M8QA 3DLEA 4A57A 1W0HA 3QEVA 5SZTA 4CJ7A 2E20A 1J54A 1ASUA 5AQSA 1JLEA 3L2UA 1B9DA 3JS6A 3QICA 1XMQK 2Y1IA 2UU9K 3OS2A 3S9HA 2OZSA 3WNGA 4CZEA 3TAEA 4JK8A 3SV4A 3WEEB 4FZXC 2ZWHA 3SYZA 3VQ4A 3VTHA 1SUQA 3P38A 3HVRA 2A1RA 3HOTA 4DTPA 1C6VA 1J5OA 2O8DA 4JKFA 3J7YP 5C24A 2YHXA 3CQYA 4M63C 1VQ5N 4W5NA 1GLCG 4M7XA 3HT3A 4B3RK 4OGCA 1Q82O 3LWMA 3EKUA 3MWPA 4O55A 2HB5A 1NBWA 1QHAA 3I33A 1EETA 4CEQA 1Q81O 4WQ5C 1BUPA 4NB4A 1MA9B 2BANA 3DXMB 1CZ9A 1WN7A 3KLHA 3IAYA 3AY9A 4CK1A 3F73A 3EYZA 1RDWX 4A62A 3CCRN 3ID6A 4O0IA 2WC9A 3NGZA 3HPGA 3OYGA 4M42A 2GWKA 2LSNA 3CERA 3Q7CA 3CG7A 2XY8A 1NKBA 4CFBA 4CEAA 4KH5A 3A5LC 3K58A 2IVOA 4CHZA 1IO2A 4XH1A 2P51A 5LMUK 1K9MO 1GOAA 4OVLA 3QIPA 1IBLK 4BRPA 1QSSA 5BN8A 3TSQA 2HF4A 2IOCA 4E19A 3IDHA 2D1KA 4CEOA 3NE6A 1C0MA 4DR6K 2ZGYA 1WUAA 4NCGA 4OKEA 1BDGA 3VESA 4YOVA 3LDQA 1VSKA 5AQIA 3AO5A 1T6DA 1S1UA 3WXIA 4GKJK 2FF6A 3HPHA 1HKGA 4K43A 3K5NA 3OYCA 1BHLA 1L3VA 3AO2A 3DRSA 4QS8A 5AQHA 3EKSA 4BGAA 3NCIA 5FDLA 5BRDA 4Z4CA 4HUEA 1Q8IA 3CF5L 5KRSA 1NK9A 2RKIA 4DHYA 4BR2A 2FSJA 4N56A 1BQMA 3NF6A 4C8NA 3ZX2A 3E9PA 4BDPA 3SPYA 1OH8A 4NLBA 1U4BA 5F0XA 4DV6K 1SL0A 2WOMA 3M8SA 4B08A 1NGGA 1ZC6A 2I7PA 3OVNA 1UWBA 3NH2A 3CIPA 2E1ZA 1S6PA 3OTOK 2VWJA 4F3OA 5I42A 2NUBA 4B9UA 1KFDA 2ZJPL 4DSEA 4FLZA 4BRQA 4U67L 2A3ZA 2WTUA 3R6MA 3C7NA 1JCGA 2QWLA 4CIFA 3DXKB 3MAQA 4GKKK 4CJLA 3RMCA 3OYMA 1U45A 4H5RA 3ZSOA 4W5QA 4CGDA 2P9PB 3I8BA 1G15A 1S5JA 2CH6A 1HMVA 4NO7A 4BE1A 3OYHA 1KAYA 1BIZA 1GLEG 4O44A 2HVHA 3VENA 2UYTA 1TL1A 2B4JA 4B8AB 4CJUA 3CI5A 5AQPA 1KVAA 3N4PA 4DFMA 4KHQA 5AQLA 3HXMA 1U04A 5AQJA 2IC3A 4FM1A 4CZLA 1GLFO 4BVOA 4GV6A 1DT9A 2DTUA 4ISFA 4BR9A 4CJWA 1W97L 3V9UA 1TKXA 3VQQA 4Z4EA 2F8SA 2KZMA 4IG0A 5GAGP 3WEEA 1TAUA 3CM5A 1TKZA 1S1TA 3IMXA 4DV7K 4BRKA 2RF2A 4E1MA 3AVLA 5C2FA 1O13A 1NJYA 4BC5A 5EXWA 5C12A 4AHVA 3QBWA 3RRHA 2UXDK 4A5BA 4EHUA 1GLBG 1M1KO 3P31A 1RBTA 3IFRA 2NRZA 3NGIA 3LM9A 2Q0RA 5FPEA 2YHYA 3DXMA 5AQUA 3I55N 3H46O 3VGKA 4M3XA 4PWDA 1S1WA 4E89A 2G8FA 1KCFA 3KLIA 3GDQA 3ZSXA 4IFVA 5CHIA 1RT3A 4XH4A 3ZT2A 3B6PA 3V9WA 3QLHA 5GAEP 4C1NI 3WNEA 4QCLA 2BTFA 2HW3A 3A2FA 2UXCK 3HO1A 2AA4A 4J2AA 3FZFA 3ZX3A 5BRFA 3HJFA 3SUQA 2EHGA 3CMAN 3KKRA 3IS9A 5F1XA 1ATNA 1L3TA 4DSLA 1D4XA 3EN9A 4CF0A 4BRGA 3VGMA 1ZBFA 2QM1A 3LZIA 2ZJQL 3MXJA 3ZSWA 4FM2A 4AM7A 3AVMA 1TYQB 3OHRA 3QEPA 1O1WA 3DRPA 4CEBA 3LDLA 3QIOA 1WOQA 3KHYA 3HRGA 2HMPA 3D45A 4CW7B 2PBDA 3PSIA 5K14A 2GUIA 3BZKA 4KTQA 4CK2A 4CECA 3CPWM 2Z1IA 4FLUA 3PV8A 1BCMA 4CBWA 2KLAA 2XRIA 4CZIA 5ADXH 3FLCO 5KPTA 2E1YA 3TAGA 4L8RB 4CVNE 5F2RA 4OLAA 1FXXA 4B9VA 3FZMA 2PYLA 4BWJA 5BPLA 3SAFA 1EX4A 3IG1A 3EE8A 3PX6A 1S9EA 1JCFA 4N76A 4AQYK 3TSUA 4E7JA 1R0AA 3AGRA 3C65A 3O9UA 2RE2A 3O3HA 4BRCA 4EZ6A 3H6EA 1VQPN 4HVJA 2X6NA 3D2EB 4FJJA 4DR3K 2A42A 3O80A 3G4SN 3CCSN 1BISA 3RVCA 1Z25A 3T3FA 5C10A 3MDQA 3O08A 4FK0A 3DXKA 3MK6A 1JLFA 1NK7A 1KSPA 2OPQA 5CYMA 2FSNA 1Q18A 4IFEA 4F2SA 2ZGZA 1K8AO 4BWMA 2P9PA 2AJQA 3AA2A 4JI0K 4KTZA 2QTDA 4MQ3A 1HPMA 1LOTB 3O4NA 2NRTA 4JI1K 3TU5A 4JI7K 3HSTB 3MWTA 3C95A 3M3ZA 3CCMN 3DOKA 3LPTA 2H3GX 1QS4A 3VQBA 5AR0A 3K59A 4JI4K 3QEIA 4FSVA 4CEFA 4JKHA 2ASPA 1S9GA 3NF7A 5KQ8A 3NHGA 3OJSA 3CCVN 1KD1O 3O9SA 3RMDA 1VQKN 1VSHA 4E1JA 2O8EB 1T03A 2KZZA 3J81O 4FWMA 4CZKA 1JL2A 3CMEN 3U8XA 1D9FA 3AVGA 5D3GA 2P9IB 1T8EA 4PHTX 5AQFA 3THVA 4BACA 5HRPA 1TKTA 1FKOA 5B8HA 3K5LA 4DV2K 3V6DA 1WSJA 4DB3A 4B8CA 3MN7A 3TANA 4M3TA 1YVUA 2HBLA 4FVUA 3SPZA 3L4QA 1NK8A 4CHOA 4CGHA 3F2KA 1NK5A 2D0OA 2XY5A 4NCBA 4AHCA 1WAFA 4DMNA 1LW0A 3ZT1A 1HKBA 4ELTA 4DR5K 4AHRA 4AH9A 4DV3K 2ZJRL 4W5OA 3SCXA 3FR0A 4CFCA 2DY4A 1BOTO 2OZMA 1NMNA 3I0RA 1WSGA 4IZ9A 4DWIA 4RG8A 1IKYA 3VQDA 3I0SA 1U48A 2VGMA 4FL9A 1TYQA 5ADXA 1MU2A 5BR9A 3QDKA 5AQMA 5HRNA 1YF5L 3VEWA 2YHBA 2HF3A 3TTDA 4GW6A 2GWJA 3MXMA 5AQYA 3DM2A 4H5WA 2OTJN 1WNSA 3OYBA 3NH1A 4KREA 4OGEA 1XC9A 2Q2RA 4FWNA 3AO1A 2HMIA 3O3GA 3QERA 1UA0A 4BC3A 3FE1A 1T44A 5E84A 5JS1A 3KK2A 1HNVA 1N34K 2P9NB 3ZSZA 1N33K 2YNFA 1HYSA 3DAWA 2BGGA 3EL2A 2VWBA 3O9QA 2QK9A 1RBSA 3VA0A 4JEPA 2V51B 1NG9A 3CJ1A 1JLAA 4KO0A 4FJLA 4B9SA 1V4SA 4ILJA 3A5MC 1HNZK 2D0CA 2AP1A 4DR7K 4FJXA 2QI2A 3E9OA 4FWPA 4IJNA 2F96A 3NVMA 3RSEB 3AV9A 3ZT0A 3CJCA 2F4VK 5AQTA 2HBMA 1B92A 4A59A 3SAGA 3D2EA 1IKXA 4R5PA 3R9PA 1NGBA 4BQZA 1SL1A 4LF4K 3J7ZO 4H0VB 1SL2A 4BROA 1LAVA 3K57A 3AGKA 2FLOA 3CCQN 3LP0A 1HX1A 2Z1JA 1VRTA 2A40A 4E7HA 2G8IA 4KHNA 4M45A 5C15A 4H5TA 2OANA 2GBZA 2X78A 2HHQA 2P5GA 1ASVA 2IVPA 4JI6K 3HBTA 5LY3A 1YI2N 1RBRA 2YKMA 1KRPA 1RTIA 2IIRA 4JKDA 3H3OB 1TUYA 2FBVA 2Q0UA 4OPKA 3OYFA 3LDNA 2YX6A 1NGEA 4B1VA 3EZWA 2O8CB 2BDPA 4RW9A 3QINA 2KTQA 1RNHA 1B9FA 2QWPA 3O9TA 1RT4A 5AZIB 3VEVA 4DF8A 3D7EO 4CHNA 2R7YA 1IG9A 1ZXOA 3PIOL 1I39A 2YKNA 4FJ8A 3SK3A 3OBYA 1OH5A 1TL3A 4H0YB 3TAFA 4IO9L 3O1WA 1KVBA 2HHSA 1P8ZA 2O8EA 2BUPA 3I8DA 4Z4GA 4PQUA 3L4IA 3VF4A 3AO3A 2ETJA 3V81A 2P9IA 4EP5A 5JLHA 2KKZA 3DI6A 1JLQA 4CF1A 3TPQA 2E2NA 3QO9A 4HCCA 2ASOA 4I7FA 4CHYA 1NLVA 4KHWA 1BCOA 5BN9A 4H0OA 5H1SQ 2QWMA 3LPUA 2F9TA 1YXQA 3MMVA 1TV6A 1JJ2M 1VQ7N 4YOWA 1WSEA 1EQYA 1LCUA 4DU4A 3T69A 3MXIA 4FLVA 3SQ0A 3T1AA 1DTQA 3CHWA 5HLFA 5AQWA 3CD6N 5JMVA 4IOAL 4CJPA 2CGJA 5E26A 4H0XB 3OYDA 2Z1HA 1U49A 4CJTA 4PY5A 5GIPA 5EU7A 1VSJA 2OPRA 4CF2A 3ZEUB 1KFSA 1W9HA 1TKDA 1NM1A 4Z4IA 1LWCA 1NJZA 3CCLN 1H1VA 1DEJA 2UUBK 2E6LA 1VQ4N 2HHXA 1WSIA 4DTRA 3DMJA 4Q5VA 3TABA 4WYBA 2ZE2A 4BRFA 5KPZA 4BDZA 2WFBA 3A5OC 3CFRA 1CZAN 2HVIA 4CF9A 2GV9A 3AVIA 3ZCMA 2VWKA 1Q7YO 2VQFK 4CJKA 4KAZA 1NJWA 3LAKA 4KTWA 4BRAA 3AARA 3QEWA 2Q31A 3RMBA 1XWLA 2P1JA 4DV5K 4DTJA 2Z1GA 3ULEB 3HOSA 4DV1K 2EX3A 4CHPA 4IG3A 3GE1A 4CJ3A 1VRUA 2P9NA 1RFQA 1XNQK 4YNQA 3OYNA 1NGCA 2IS3A 5J2PA 4CGFA 1EP4A 2QEXN 1C0UA 5BRHA 3SJJA 5EY4A 3O1BA 3H1VX 1YT3A 2E2QA 4IDKA 3TTCA 4K8ZA 4K42A 3MECA 2O4GA 2NRRA 3PUFA 1KLNA 2XHBA 3WT0A 3RSEA 5CY4A 3V9XA 1SV5A 4LH5A 2A1SA 2XO7A 3ASMA 2W41A 1QQNA 1KAXA 4ZTFA 4FZYA 3P1GA 3HP9A 5SWMA 4YFUA 1TAQA 3TAQA 2XY7A 2JWKA 4DUYK 4RW4A 1J9AA 4B9TA 4LFCK 4B9LA 3G25A 5AQNA 1EO1A 3CCUN 2GEMA 5CR4A 2HHTA 1ZYQA 4K8XA 5LMNK 5GIOA 2O8BB 4CESA 1JLBA 3NFAA 3TSPA 1D8YA 2FSKA 3MN9A 5KTQA 4CE9A 3AVCA 3V1RA 4F9OA 4GVMA 3CQXA 3OJUA 3U9ZA 3V4IA 3SQ1A 5M1FA 3VQ7A 3ZT3A 4BR7A 2WBNA 2O8CA 1SZ2A 1YUWA 2RN2A 3MEGA 1YHQN 4B1WB 5AZIA 2E5LK 1JXEA 2ATQA 5MLCQ 1C0FA 1VQON 4UQGA 4JAXA 1YVNA 5TKWA 2Y1JA 2D4WA 3FGUA 3TAPA 2NLXA 4I6MB 4JKAA 3KD1E 4IBNA 3CC2N 3OYJA 5AZJB 3U3GA 4M3UA 4E7IA 3T1YK 2QKBA 4BQLA 4WF9L 5GINA 1Y64A 2D0AA 1S1VA 1XUPO 1SQKA 3OYLA 3AVKA 3F5TA 2P9UB 1UA1A 4XH5A 4FK2A 2HNYA 4Y1CA 4A5AA 4JHDB 5AFUH 1J5EK 4RW6A 3ZETB 3FZHA 1RGIA 4E7KA 4HUGA 3GG4A 5EVZA 5CZ1A 2YI1A 4PA1A 3JAMO 1X9WA 4PKHA 3CJBA 4O5BA 4CIGA 1RT7A 1IG8A 1G99A 2YCHA 2D0PA 1WBBA 1QZ5A 4CZJA 5J2QA 3IUCA 1F21A 3D2FB 1HNWK 4K25A 1VQLN 5CYQA 3WXMB 4GMJB 3ZEUA 4ISEA 3RWUA 1XI1A 5HL7L 4DTSA 1EWRA 3TWHA 4LF7K 4A2AA 4DG1A 1BA0A 1YJNN 3D6RA 5AQKA 4CJQA 2ZF5O 4JRPA 3C0BA 3PY8A 1IBMK 1LWFA 3P39A 3U6FA 1J53A 4B1XB 4Z4HA 1HKCA 4FW1A 2OTLN 5C2DA 3VOVA 3P5JA 3H08A 4JI2K 1BQNA 4BRMA 1RTDA 1KVCA 3SJHA 5LL6Z 1GLLO 1SKSA 1HQEA 3KK7A 1ATSA 5HRRA 4CZGA 1TK0A 1GLDG 1HYZA 4FJMA 4Z94A 4FYDA 1BG3A 3LDSA 3C94A 3P83D 3C6TA 2CH5A 2DFFA 3THWB 4Y0WA 3ULEA 1W2BM 2ITGA 2QWQA 3VGLA 1FJGK 4E3SA 3V1OA 2KHOA 3C6UA 1FKPA 2F9WA 2QW9A 4O4GA 2CGLA 1U2VB 4BREA 3K9KA 4DTNA 4FWOA 5A2QO 5IT9O 4CEZA 1EWQA 4EFHA 1IH7A 4B9QA 4OKKA 1UAXA 4M3RA 4CBXA 2NRXA 3AVBA 3K2PA 4CK3A 3LAMA 4DU1A 2ZD1A 3HTVA 1HRHA 4IKFA 4KH4A 1ZBSA 4FLXA 1V4TA 4CHQA 1GOBA 4KB1A 1K8KB 3WXLA 3PSFA 3ULDA 3DRRA 3K5OA 3LZJA 1QHTA 3VA3A 4QOZB 3H45C 3I56N 5AQOA 2HHVA 1REVA 4JK9A 2XY6A 2O8BA 5FRNA 4DV4K 5EX5A 3VEXA 1ZBUA 5C42A 2YJFA 5FPDA 4FOIA 5AQZA 3SI6A 3KWIA 4EIAA 2Q36A 4JI3K 4I9QA 1HNIA 3SBTA 4FWKA 3LL3A 1Z6RA 3JXUA 4IOXA 1NOZA 4KI6A 1K73O 2A5XA 2DFHA 1WSHA 2VYPA 4DSFA 4CZFA 5KRTA 1SKRA 4FJGA 3J8AA 3UB5A 4I2QA 4CJFA 3QNNA 2QKKA 4OLBA 3LDPA 4JV5K 2NRHA 1MWMA 1JXBA 4IWVA 4WQ4A 3ZSYA 4CIEA 1QVFM 5AFUA 1NJXA 4YDUA 1ATRA 4OJRA 2E88A 3GBTA 1NGJA 1NJIO 4I6MA 2QXLA 4DSKA 4WQ5A 1VSMA 2FBYA 2IGIA 3EE9A 5AZJA 3AVHA 4C23A 3OYKA 4N41A 1GLJO 1FW6A 2W40A 4JKBA 5HRSA 2RHKA 4DCHA 3RMAA 2P9UA 4IEIA 4K0KK 2G8UA 1XC3A 2QWRA 1R59O 4JHDA 3LANA 3OY9A 2IVNA 3VQ9A 3ZETA 1XMOK 4DR2K 3L2RA 4KFBA 4CD1A 4ICLA 4C8OA 4I2PA 4X66K 2A41A 4RCHA 1JKHA 4NLCA 3WXJA 3BDPA 3CJAA 4R79A 4FWLA 3E66A 4MDAA 2P9SB 4F8RA 4BRDA 3VETA 2WUSA 4H8KA 4B3TK 3WQUA 1RDBA 2G8VA 3IRXA 2B5JA 3UKUB 3ATUA 3TR8A 4G9ZA 1Q86O 1T7PA 1Y97A 2HNZA 3D2FA 3O4WA 1WLJA 4FPAA 1U47A 4FJ5A 3ZLJA 1MWKA 1NNEA 4JN4A 3SV3A 3VQ5A 1CXUA 4CBUA 3L8BA 2VG5A 4FJ9A 2E6MA 2VG6A 3M8PA 1ITGA 3F9MA 4KHSA 4FWRA 1FK9A 4CI6A 2DPNA 3L3VA 5J2MA 4CFAA 3PIPL 2OPPA 4GNIA 4FJHA 4GV3A 3M6GA 4X65K 4H5VA 3JSMA 1SKWA 1YIJN 2HSTA 3KKSA 1RDUA 2G8KA 3KTQA 4KHUA 3VEYA 4AHSA 4J8FA 4CGIA 3BY5A 4CGJA 2Q3SA 3SMPA 4J2DA 2G8WA 4FJ7A 1Z05A 2FBXA 2IAJA 4JLHA 5JICA 1QQCA 2F7TA 1OVQA 2GELA 4EHTA 3THWA 4CJVA 4CJRA 4O8UA 1NGDA 4IO8A 5DM6L 1RDDA 1HJRA 3VQPA 4LF5K 3O5BA 4MFBA 4YOXA 4CCHA 4ELUA 1U2VA 3SUNA 4EZ9A 4Z0UA 3S3OA 4LFAK 3D0PA 1VSFA 1YAGA 2QA4N 2UUAK 3DLRA 4CERA 4YHHK 4W5TA 1NK0A 1K6YA 5GADP 4BE0A 3PLAA 1QZ6A 1TK5A 4H5NA 1E4GT 3DJCA 4RWTA
chains in the Genus database with same CATH topology
1RT2A 4DTJA 2Z1GA 3DLBA 4KHYA 4FW2A 3LZIA 3AVJA 2EX3A 4CHPA 3MXJA 3CQ8A 3RTVA 4OPJA 3ZSWA 4FM2A 4IG3A 3LP1A 5KGXA 2B6AA 1T05A 4CJ3A 3DLGA 1VRUA 4DQPA 1WAJA 5I3UA 4YNQA 3OYNA 3DLKA 1EKEA 3AVMA 2PYJA 4DU3A 4BDYA 2IS3A 5J2PA 4CGFA 4M41A 1EP4A 1O1WA 2YHAA 3DRPA 4EP4A 3T19A 4CEBA 3QEPA 3QIOA 1BI4B 1C0UA 1CXQA 1HQUA 3SJJA 1LWEA 3PX0A 1DTTA 4F4KA 5E41A 3D45A 4OKJA 1YT3A 5K14A 3HL8A 2KW4A 2GUIA 1RDAA 1NK4A 2BE2A 3AA3A 4IDKA 1LAWA 4CK2A 4KTQA 4K8ZA 4CECA 4NCAA 1VK0A 3MECA 4FLYA 2O4GA 1NKEA 2Z1IA 5FROA 3L2QA 4NYNA 4FLUA 2PY5A 3PUFA 1KLNA 3ZT4A 3PV8A 4H4MA 4LH4A 3L2VA 1BCMA 2XHBA 2XRIA 1TVRA 3ZSQA 4JS5A 3TAGA 2KFNA 5CY4A 4L8RB 4AHUA 1NOYA 3V9XA 1SV5A 4IFYA 4LH5A 2A1SA 2XO7A 3ZSVA 3ASMA 1CZBA 4E0DA 3ISNC 3B6OA 2I5JA 3K5MA 4OLAA 4N47A 1FXXA 5C25A 3NH0A 3P1GA 4ZTFA 3HP9A 4RW7A 5SWMA 1TAQA 4YFUA 3CFPA 4FCYA 3TAQA 4BWJA 1L3SA 2PZSA 3PO5A 1EX4A 4Q0BA 5KI6A 2XY7A 3MEEA 2QXFA 1J9AA 3IG1A 4RW4A 4JRQA 4B9TA 3PX6A 3L3UA 4CJ4A 1S9EA 1GOCA 4B9LA 4N76A 4FXDA 4DS4A 3JYTA 3VN5A 1C1BA 5J1EA 4E7JA 1R0AA 4KI4A 3KLEA 3S3MA 4FJIA 3SUOA 2HHTA 1ZYQA 3OS1A 3SZ2A 4K8XA 4NYFA 1N6QA 4FZZA 3TAMA 4DTXA 4G1QA 3O3HA 2WONA 4CESA 1L3UA 2X74A 1JLBA 1CLQA 3NFAA 3TARA 1BL3A 1HPZA 4EZ6A 3BGRA 4HVJA 1D8YA 1XHZA 4O0JA 2X6NA 4CE9A 5KTQA 1RTJA 4FJJA 1EXQA 3AVCA 1RDCA 1ASWA 4B9NA 3V1RA 1ZBHA 1BISA 1RT5A 3RRGA 4HTUA 1Z25A 4GVMA 3T3FA 3V1QA 3OJUA 4C8LA 4CJ5A 3V4IA 1RTHA 3SQ1A 3VQ7A 3ZT3A 4HHTA 1JL1A 4H4OA 5DK5A 4FK0A 1JLFA 2RN2A 3WNHA 1QE1A 3MEGA 2OPQA 4W5RA 1NK7A 1KSPA 4DQRA 5CYMA 3G0ZA 3NDKA 4Z4FA 1JXEA 2ATQA 4F2SA 2HNDA 3NBPA 4UQGA 3TI0A 4BWMA 2HHWA 2AJQA 3AA2A 1A5VA 3HVTA 4KTZA 4FM0A 3SQ2A 4MQ3A 1ZBLA 2Y1JA 1VSLA 3O4NA 4B3OA 3PX4A 3DYAA 3HK2A 3FFIA 1YTAA 1TGOA 3TAPA 3KD1E 4IBNA 3HSTB 2OA8A 3OYJA 3U3GA 4M3UA 1C1AA 4E7IA 2QKBA 3C95A 4HCBA 1RCHA 3DOKA 3LPTA 5HROA 1QS4A 3ZSRA 3CFOA 3CYMA 2D0AA 3VQBA 3KLGA 2OYQA 3K59A 1S1VA 4E7LA 4C8KA 4N5SA 1S6QA 3QEIA 3OYLA 3AVKA 4HUFA 1UA1A 4CEFA 1WSFA 4FK2A 2HNYA 4Y1CA 4ELVA 2G8HA 3V9SA 1S9GA 3NF7A 3LP2A 4RW6A 2JLEA 5KGWA 3M8RA 3QNOA 4E7KA 3QESA 1L5UA 4HUGA 3NHGA 3OJSA 4AHTA 5CZ1A 4DTUA 3VQAA 3CM6A 4PA1A 3ITHA 4CFDA 3M8QA 3RMDA 3DLEA 1VSHA 1W0HA 1T03A 4LY7A 3QEVA 3AVAA 5SZTA 1X9WA 2KZZA 1LV5A 3KIOA 4O5BA 4J2EA 1J54A 1ASUA 4CIGA 1RT7A 1JL2A 1JLEA 3F9KA 3L2UA 4FLWA 4DS5A 1D9FA 3AVGA 5D3GA 3OYEA 1T8EA 1B9DA 5JS2A 5J2QA 2Y1IA 4FJKA 5T7BA 1NKCA 3OS2A 2VG7A 3S9HA 2OZSA 1F21A 4DSIA 3WNGA 1YTUA 5CYQA 1C0TA 4BACA 4GMJB 3THVA 5HRPA 1TKTA 1FKOA 2JGUA 3K5LA 3V6DA 3TAEA 3RWUA 1WSJA 1XI1A 3SV4A 4DLGA 4DTSA 1UOCA 3TWHA 3DLHA 4FZXC 4DG1A 4B8CA 3QEXA 1D9DA 3SNNA 4CJQA 3SYZA 3VQ4A 3TANA 3NAEA 4DF4A 4M3TA 4KRFA 1YVUA 1RBUA 3VQ8A 1SUQA 3L2WA 3HVRA 3SPZA 4JRPA 2A1RA 3ALYA 4DTPA 4CHOA 4CGHA 1NK5A 1NK8A 1C6VA 1LWFA 3U6FA 1J5OA 1J53A 3PY8A 5J2NA 5C24A 4Z4HA 4W5NA 4CJEA 2XY5A 4NCBA 4FW1A 4AHCA 1WAFA 4DMNA 3P5JA 3H08A 3LALA 1LW0A 1BQNA 1C1CA 3ZT1A 3HT3A 1RTDA 4J2BA 1KVCA 4ELTA 4OGCA 3LP3A 3QETA 1D5AA 4ZTJA 3LWMA 1Q9YA 4O55A 4AHRA 4PUOA 1KTQA 4AH9A 1SKSA 1HQEA 2HB5A 5HRRA 3HPOA 4W5OA 1TK0A 3SCXA 2IDOA 1HYZA 1EETA 4FJMA 4CEQA 4CFCA 4FYDA 3LDSA 2DY4A 3C94A 2OZMA 3P83D 1BIUA 3C6TA 2BANA 1CZ9A 1QSYA 1QTMA 4DQSA 4LSNA 2DFFA 1WN7A 3KLHA 3VQEA 3I0RA 3IAYA 4CK1A 3F73A 1WSGA 1RT6A 2DFEA 2ITGA 3EYZA 4DWIA 3SQ4A 4RG8A 3RR8A 1IKYA 4E3SA 4O0IA 3V1OA 3C6UA 1RT1A 2KFZA 1FKPA 3VQDA 3I0SA 1U48A 4KV8A 4CJSA 4O4GA 2OPSA 3NGZA 3HPGA 3OYGA 4M42A 1MU2A 2LSNA 4DTNA 3CG7A 2XY8A 4I9LA 1RBVA 4CFBA 1NKBA 4CEAA 3EZ5A 4KPYA 5HRNA 3S3NA 1X9MA 1BI4A 3K58A 2HHUA 2D5RA 4CEZA 2YHBA 4CHZA 1IO2A 4FLTA 1IH7A 4GW6A 3MXMA 5CZ2A 2P51A 3DM2A 4OKKA 1NK6A 1GOAA 1WNSA 3OYBA 4OVLA 3NH1A 4KREA 4OGEA 3QIPA 1XC9A 4KB0A 2O4IA 3AO1A 1UAXA 2HMIA 4M3RA 1QSSA 3V9ZA 3O3GA 4ID5A 1I3AA 4CEDA 3QERA 3AVBA 3G10A 4BE2A 1UA0A 3K2PA 4AILC 4CK3A 3LAMA 2IOCA 4E19A 3VQCA 4DU1A 5JS1A 1HYVA 2ZD1A 3KK2A 1HRHA 1HNVA 4IKFA 4CEOA 3ZSZA 4ZHRA 3NE6A 2W42A 1C0MA 4FLXA 2YNFA 1HYSA 3OS0A 4CHQA 4NCGA 1GOBA 4OKEA 2BGGA 4DTMA 4DFPA 4KB1A 2QK9A 1RBSA 3HYFA 3VA0A 3ULDA 3DRRA 3K5OA 3LZJA 1QHTA 2FBTA 3HP6A 3VA3A 1VSKA 4M3YA 4QOZB 1JLAA 3AO5A 4KO0A 1S1UA 4FJLA 4B9SA 4FJNA 3HPHA 2D0CA 2YNIA 3K5NA 1ZBIA 3OYCA 4FJXA 2HHVA 1BHLA 1L3VA 3SUPA 3AO2A 3DRSA 1REVA 2XY6A 2YNGA 2F96A 3O3FA 2YNHA 3OYIA 4B9VA 3AV9A 4E1NA 1VSIA 5FRNA 3WNFA 1BGXT 1RILA 5FDLA 3ZT0A 4Z4CA 3NCIA 4HUEA 1ZBUA 5C42A 2RPIA 1KLMA 1Q8IA 1B92A 1IKXA 4LSLA 5KRSA 4R5PA 3SI6A 1QSLA 4F2RA 2D0BA 1SL1A 4C8MA 4I9QA 3AVFA 1HNIA 4FZYA 1NK9A 4DFKA 2RKIA 1SL2A 1LAVA 3K57A 3KD5E 1NOZA 4KI6A 5HP1A 2E4LA 2DFHA 1WSHA 3AO4A 4N56A 4DSFA 3LP0A 1BQMA 3NF6A 4C8NA 5KRTA 1SKRA 3RR7A 4I2QA 1X1PA 2Z1JA 4CJFA 3QNNA 3UIQA 2QKKA 1VRTA 4BDPA 3AVNA 3SPYA 4OLBA 4E7HA 2G8IA 1U4BA 5DMRA 4KHNA 1SL0A 1JXBA 4M45A 2WOMA 3M8SA 2P5OA 3ZSYA 4B08A 4CIEA 2GBZA 3OVNA 2X78A 1UWBA 2HHQA 1NJXA 3NH2A 3MEDA 2P5GA 1ASVA 2VWJA 1S6PA 4OJRA 4F3OA 1RBRA 2YKMA 1KRPA 4DSKA 1RTIA 4DQQA 4FJGA 1VSMA 2FBYA 2IGIA 5I42A 4OPKA 2FBVA 2NUBA 3AVHA 3OYFA 4B9UA 3OYKA 1KFDA 4N41A 4DQIA 2FC0A 4DSEA 4FLZA 5HRSA 4FK4A 3LWLA 3AA4A 4DFJA 5HBMA 4CIFA 3RMAA 2BDPA 4RW9A 3QINA 3MAQA 4CJLA 2KTQA 1RNHA 1B9FA 3OYMA 3RMCA 2G8UA 1X9SA 2YV0X 1U45A 1RT4A 5FRMA 3ZSOA 4DF8A 3LANA 3OY9A 4CHNA 1Z26A 4W5QA 3VQ9A 2R7YA 1IG9A 4CGDA 3L2RA 4KFBA 1I39A 2YKNA 1G15A 1S5JA 4ICLA 4FJ8A 1HMVA 4C8OA 4I2PA 4BE1A 3OYHA 1TL3A 4RW8A 1BIZA 3KK1A 4O44A 2HVHA 3TAFA 1TK8A 4F3TA 1XHXA 2HHSA 1KVBA 1JKHA 3NF8A 3HM9A 1TL1A 2B4JA 4B8AB 4CJUA 3BDPA 4CF8A 1KVAA 2ZQBA 1A5WA 3I8DA 4F8RA 1JLGA 4DFMA 4KHQA 4Z4GA 1IKVA 4PQUA 4H8KA 3HXMA 1RDBA 1U04A 1LW2A 2ETJA 2IC3A 2B5JA 3AO3A 3IRXA 4FM1A 3V81A 2G8VA 1S1XA 3TR8A 3O4QA 2X6SA 4EP5A 1T7PA 1Y97A 4Y1DA 1VSEA 3KLFA 1DLOA 1JLQA 3DI6A 4CF1A 3EY1A 2DTUA 4FVMA 4CJWA 2HNZA 1WLJA 1U47A 3V9UA 3PO4A 4FJ5A 3QO9A 4HCCA 1TKXA 3VQQA 4I7FA 4CHYA 4Z4EA 3SV3A 4CGGA 2F8SA 4KHWA 1BCOA 4IG0A 3VQ5A 2KZMA 3LPUA 1CXUA 3L8BA 2VG5A 4FJ9A 2E6MA 2VG6A 3M8PA 1ITGA 1TV6A 1TKZA 1S1TA 3CM5A 3VQ6A 4KHSA 1TAUA 1WSEA 1FK9A 2RF2A 2F8TA 3L3VA 4WE1A 3AVLA 4E1MA 4DU4A 4CFAA 5J2MA 2OPPA 4FJHA 4QAGA 3MXIA 4FLVA 3SQ0A 3T1AA 1DTQA 3JSMA 4DSJA 3DOLA 1NJYA 5HLFA 1Q9XA 1JLCA 3AA5X 1SKWA 4DLEA 1N5YA 3KTQA 3KKSA 4KHUA 2G8KA 1IKWA 2PYLA 4AHVA 4CJPA 3RRHA 3OYDA 4AHSA 2Z1HA 4B9MA 1VSDA 1U49A 4CGIA 3OYAA 4LD0A 4CJTA 4PY5A 1RBTA 4CGJA 2Q3SA 5EU7A 1VSJA 2OPRA 4CF2A 3NGIA 1KFSA 4J2DA 2G8WA 4FJ7A 4ID1A 1W9HA 1TKDA 2FBXA 2IAJA 4Z4IA 4JLHA 1LWCA 1QQCA 3E01A 4M3XA 4CJVA 1NJZA 4PWDA 4CJRA 1S1WA 4E89A 2G8FA 2E6LA 1KCFA 2HHXA 4CEEA 1WSIA 1RDDA 3KLIA 1A5XA 3DMJA 1HJRA 3NF9A 4IFVA 3VQPA 3ZSXA 4Q5VA 4DTRA 1RT3A 4XIUA 3U3YA 3TABA 3ZT2A 3B6PA 3V9WA 3QLHA 2ZE2A 3NGYA 4MFBA 4BDZA 3WNEA 4QCLA 4CCHA 4ELUA 2HW3A 3A2FA 3SUNA 4EZ9A 3HO1A 3CFRA 4Z0UA 4J2AA 3S3OA 2HVIA 4M3WA 3HJFA 4CF9A 3D0PA 1VSFA 2EHGA 2KQ2A 4KKOA 4DTOA 3SUQA 2GV9A 3AVIA 3IS9A 3DLRA 3KKRA 3ZCMA 4JS4A 2VWKA 3KJVA 4CJKA 4KAZA 3KK3A 3LAKA 4KTWA 1NJWA 4CERA 4W5TA 1NK0A 1L3TA 1K6YA 4BE0A 4DSLA 3QEWA 3RMBA 4CF0A 1XWLA 4M3ZA 2P1JA 1TK5A 4TSXA 1ZBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RT2 A;  4DTJ A;  2Z1G A;  3DLB A;  4KHY A;  4FW2 A;  3LZI A;  3AVJ A;  2EX3 A;  4CHP A;  3MXJ A;  3CQ8 A;  3RTV A;  4OPJ A;  3ZSW A;  4FM2 A;  4IG3 A;  3LP1 A;  5KGX A;  2B6A A;  1T05 A;  4CJ3 A;  3DLG A;  1VRU A;  4DQP A;  1WAJ A;  5I3U A;  4YNQ A;  3OYN A;  3DLK A;  1EKE A;  3AVM A;  2PYJ A;  4DU3 A;  4BDY A;  2IS3 A;  5J2P A;  4CGF A;  4M41 A;  1EP4 A;  1O1W A;  2YHA A;  3DRP A;  4EP4 A;  3T19 A;  4CEB A;  3QEP A;  3QIO A;  1BI4 B;  1C0U A;  1CXQ A;  1HQU A;  3SJJ A;  1LWE A;  3PX0 A;  1DTT A;  4F4K A;  5E41 A;  3D45 A;  4OKJ A;  1YT3 A;  5K14 A;  3HL8 A;  2KW4 A;  2GUI A;  1RDA A;  1NK4 A;  2BE2 A;  3AA3 A;  4IDK A;  1LAW A;  4CK2 A;  4KTQ A;  4K8Z A;  4CEC A;  4NCA A;  1VK0 A;  3MEC A;  4FLY A;  2O4G A;  1NKE A;  2Z1I A;  5FRO A;  3L2Q A;  4NYN A;  4FLU A;  2PY5 A;  3PUF A;  1KLN A;  3ZT4 A;  3PV8 A;  4H4M A;  4LH4 A;  3L2V A;  1BCM A;  2XHB A;  2XRI A;  1TVR A;  3ZSQ A;  4JS5 A;  3TAG A;  2KFN A;  5CY4 A;  4L8R B;  4AHU A;  1NOY A;  3V9X A;  1SV5 A;  4IFY A;  4LH5 A;  2A1S A;  2XO7 A;  3ZSV A;  3ASM A;  1CZB A;  4E0D A;  3ISN C;  3B6O A;  2I5J A;  3K5M A;  4OLA A;  4N47 A;  1FXX A;  5C25 A;  3NH0 A;  3P1G A;  4ZTF A;  3HP9 A;  4RW7 A;  5SWM A;  1TAQ A;  4YFU A;  3CFP A;  4FCY A;  3TAQ A;  4BWJ A;  1L3S A;  2PZS A;  3PO5 A;  1EX4 A;  4Q0B A;  5KI6 A;  2XY7 A;  3MEE A;  2QXF A;  1J9A A;  3IG1 A;  4RW4 A;  4JRQ A;  4B9T A;  3PX6 A;  3L3U A;  4CJ4 A;  1S9E A;  1GOC A;  4B9L A;  4N76 A;  4FXD A;  4DS4 A;  3JYT A;  3VN5 A;  1C1B A;  5J1E A;  4E7J A;  1R0A A;  4KI4 A;  3KLE A;  3S3M A;  4FJI A;  3SUO A;  2HHT A;  1ZYQ A;  3OS1 A;  3SZ2 A;  4K8X A;  4NYF A;  1N6Q A;  4FZZ A;  3TAM A;  4DTX A;  4G1Q A;  3O3H A;  2WON A;  4CES A;  1L3U A;  2X74 A;  1JLB A;  1CLQ A;  3NFA A;  3TAR A;  1BL3 A;  1HPZ A;  4EZ6 A;  3BGR A;  4HVJ A;  1D8Y A;  1XHZ A;  4O0J A;  2X6N A;  4CE9 A;  5KTQ A;  1RTJ A;  4FJJ A;  1EXQ A;  3AVC A;  1RDC A;  1ASW A;  4B9N A;  3V1R A;  1ZBH A;  1BIS A;  1RT5 A;  3RRG A;  4HTU A;  1Z25 A;  4GVM A;  3T3F A;  3V1Q A;  3OJU A;  4C8L A;  4CJ5 A;  3V4I A;  1RTH A;  3SQ1 A;  3VQ7 A;  3ZT3 A;  4HHT A;  1JL1 A;  4H4O A;  5DK5 A;  4FK0 A;  1JLF A;  2RN2 A;  3WNH A;  1QE1 A;  3MEG A;  2OPQ A;  4W5R A;  1NK7 A;  1KSP A;  4DQR A;  5CYM A;  3G0Z A;  3NDK A;  4Z4F A;  1JXE A;  2ATQ A;  4F2S A;  2HND A;  3NBP A;  4UQG A;  3TI0 A;  4BWM A;  2HHW A;  2AJQ A;  3AA2 A;  1A5V A;  3HVT A;  4KTZ A;  4FM0 A;  3SQ2 A;  4MQ3 A;  1ZBL A;  2Y1J A;  1VSL A;  3O4N A;  4B3O A;  3PX4 A;  3DYA A;  3HK2 A;  3FFI A;  1YTA A;  1TGO A;  3TAP A;  3KD1 E;  4IBN A;  3HST B;  2OA8 A;  3OYJ A;  3U3G A;  4M3U A;  1C1A A;  4E7I A;  2QKB A;  3C95 A;  4HCB A;  1RCH A;  3DOK A;  3LPT A;  5HRO A;  1QS4 A;  3ZSR A;  3CFO A;  3CYM A;  2D0A A;  3VQB A;  3KLG A;  2OYQ A;  3K59 A;  1S1V A;  4E7L A;  4C8K A;  4N5S A;  1S6Q A;  3QEI A;  3OYL A;  3AVK A;  4HUF A;  1UA1 A;  4CEF A;  1WSF A;  4FK2 A;  2HNY A;  4Y1C A;  4ELV A;  2G8H A;  3V9S A;  1S9G A;  3NF7 A;  3LP2 A;  4RW6 A;  2JLE A;  5KGW A;  3M8R A;  3QNO A;  4E7K A;  3QES A;  1L5U A;  4HUG A;  3NHG A;  3OJS A;  4AHT A;  5CZ1 A;  4DTU A;  3VQA A;  3CM6 A;  4PA1 A;  3ITH A;  4CFD A;  3M8Q A;  3RMD A;  3DLE A;  1VSH A;  1W0H A;  1T03 A;  4LY7 A;  3QEV A;  3AVA A;  5SZT A;  1X9W A;  2KZZ A;  1LV5 A;  3KIO A;  4O5B A;  4J2E A;  1J54 A;  1ASU A;  4CIG A;  1RT7 A;  1JL2 A;  1JLE A;  3F9K A;  3L2U A;  4FLW A;  4DS5 A;  1D9F A;  3AVG A;  5D3G A;  3OYE A;  1T8E A;  1B9D A;  5JS2 A;  5J2Q A;  2Y1I A;  4FJK A;  5T7B A;  1NKC A;  3OS2 A;  2VG7 A;  3S9H A;  2OZS A;  1F21 A;  4DSI A;  3WNG A;  1YTU A;  5CYQ A;  1C0T A;  4BAC A;  4GMJ B;  3THV A;  5HRP A;  1TKT A;  1FKO A;  2JGU A;  3K5L A;  3V6D A;  3TAE A;  3RWU A;  1WSJ A;  1XI1 A;  3SV4 A;  4DLG A;  4DTS A;  1UOC A;  3TWH A;  3DLH A;  4FZX C;  4DG1 A;  4B8C A;  3QEX A;  1D9D A;  3SNN A;  4CJQ A;  3SYZ A;  3VQ4 A;  3TAN A;  3NAE A;  4DF4 A;  4M3T A;  4KRF A;  1YVU A;  1RBU A;  3VQ8 A;  1SUQ A;  3L2W A;  3HVR A;  3SPZ A;  4JRP A;  2A1R A;  3ALY A;  4DTP A;  4CHO A;  4CGH A;  1NK5 A;  1NK8 A;  1C6V A;  1LWF A;  3U6F A;  1J5O A;  1J53 A;  3PY8 A;  5J2N A;  5C24 A;  4Z4H A;  4W5N A;  4CJE A;  2XY5 A;  4NCB A;  4FW1 A;  4AHC A;  1WAF A;  4DMN A;  3P5J A;  3H08 A;  3LAL A;  1LW0 A;  1BQN A;  1C1C A;  3ZT1 A;  3HT3 A;  1RTD A;  4J2B A;  1KVC A;  4ELT A;  4OGC A;  3LP3 A;  3QET A;  1D5A A;  4ZTJ A;  3LWM A;  1Q9Y A;  4O55 A;  4AHR A;  4PUO A;  1KTQ A;  4AH9 A;  1SKS A;  1HQE A;  2HB5 A;  5HRR A;  3HPO A;  4W5O A;  1TK0 A;  3SCX A;  2IDO A;  1HYZ A;  1EET A;  4FJM A;  4CEQ A;  4CFC A;  4FYD A;  3LDS A;  2DY4 A;  3C94 A;  2OZM A;  3P83 D;  1BIU A;  3C6T A;  2BAN A;  1CZ9 A;  1QSY A;  1QTM A;  4DQS A;  4LSN A;  2DFF A;  1WN7 A;  3KLH A;  3VQE A;  3I0R A;  3IAY A;  4CK1 A;  3F73 A;  1WSG A;  1RT6 A;  2DFE A;  2ITG A;  3EYZ A;  4DWI A;  3SQ4 A;  4RG8 A;  3RR8 A;  1IKY A;  4E3S A;  4O0I A;  3V1O A;  3C6U A;  1RT1 A;  2KFZ A;  1FKP A;  3VQD A;  3I0S A;  1U48 A;  4KV8 A;  4CJS A;  4O4G A;  2OPS A;  3NGZ A;  3HPG A;  3OYG A;  4M42 A;  1MU2 A;  2LSN A;  4DTN A;  3CG7 A;  2XY8 A;  4I9L A;  1RBV A;  4CFB A;  1NKB A;  4CEA A;  3EZ5 A;  4KPY A;  5HRN A;  3S3N A;  1X9M A;  1BI4 A;  3K58 A;  2HHU A;  2D5R A;  4CEZ A;  2YHB A;  4CHZ A;  1IO2 A;  4FLT A;  1IH7 A;  4GW6 A;  3MXM A;  5CZ2 A;  2P51 A;  3DM2 A;  4OKK A;  1NK6 A;  1GOA A;  1WNS A;  3OYB A;  4OVL A;  3NH1 A;  4KRE A;  4OGE A;  3QIP A;  1XC9 A;  4KB0 A;  2O4I A;  3AO1 A;  1UAX A;  2HMI A;  4M3R A;  1QSS A;  3V9Z A;  3O3G A;  4ID5 A;  1I3A A;  4CED A;  3QER A;  3AVB A;  3G10 A;  4BE2 A;  1UA0 A;  3K2P A;  4AIL C;  4CK3 A;  3LAM A;  2IOC A;  4E19 A;  3VQC A;  4DU1 A;  5JS1 A;  1HYV A;  2ZD1 A;  3KK2 A;  1HRH A;  1HNV A;  4IKF A;  4CEO A;  3ZSZ A;  4ZHR A;  3NE6 A;  2W42 A;  1C0M A;  4FLX A;  2YNF A;  1HYS A;  3OS0 A;  4CHQ A;  4NCG A;  1GOB A;  4OKE A;  2BGG A;  4DTM A;  4DFP A;  4KB1 A;  2QK9 A;  1RBS A;  3HYF A;  3VA0 A;  3ULD A;  3DRR A;  3K5O A;  3LZJ A;  1QHT A;  2FBT A;  3HP6 A;  3VA3 A;  1VSK A;  4M3Y A;  4QOZ B;  1JLA A;  3AO5 A;  4KO0 A;  1S1U A;  4FJL A;  4B9S A;  4FJN A;  3HPH A;  2D0C A;  2YNI A;  3K5N A;  1ZBI A;  3OYC A;  4FJX A;  2HHV A;  1BHL A;  1L3V A;  3SUP A;  3AO2 A;  3DRS A;  1REV A;  2XY6 A;  2YNG A;  2F96 A;  3O3F A;  2YNH A;  3OYI A;  4B9V A;  3AV9 A;  4E1N A;  1VSI A;  5FRN A;  3WNF A;  1BGX T;  1RIL A;  5FDL A;  3ZT0 A;  4Z4C A;  3NCI A;  4HUE A;  1ZBU A;  5C42 A;  2RPI A;  1KLM A;  1Q8I A;  1B92 A;  1IKX A;  4LSL A;  5KRS A;  4R5P A;  3SI6 A;  1QSL A;  4F2R A;  2D0B A;  1SL1 A;  4C8M A;  4I9Q A;  3AVF A;  1HNI A;  4FZY A;  1NK9 A;  4DFK A;  2RKI A;  1SL2 A;  1LAV A;  3K57 A;  3KD5 E;  1NOZ A;  4KI6 A;  5HP1 A;  2E4L A;  2DFH A;  1WSH A;  3AO4 A;  4N56 A;  4DSF A;  3LP0 A;  1BQM A;  3NF6 A;  4C8N A;  5KRT A;  1SKR A;  3RR7 A;  4I2Q A;  1X1P A;  2Z1J A;  4CJF A;  3QNN A;  3UIQ A;  2QKK A;  1VRT A;  4BDP A;  3AVN A;  3SPY A;  4OLB A;  4E7H A;  2G8I A;  1U4B A;  5DMR A;  4KHN A;  1SL0 A;  1JXB A;  4M45 A;  2WOM A;  3M8S A;  2P5O A;  3ZSY A;  4B08 A;  4CIE A;  2GBZ A;  3OVN A;  2X78 A;  1UWB A;  2HHQ A;  1NJX A;  3NH2 A;  3MED A;  2P5G A;  1ASV A;  2VWJ A;  1S6P A;  4OJR A;  4F3O A;  1RBR A;  2YKM A;  1KRP A;  4DSK A;  1RTI A;  4DQQ A;  4FJG A;  1VSM A;  2FBY A;  2IGI A;  5I42 A;  4OPK A;  2FBV A;  2NUB A;  3AVH A;  3OYF A;  4B9U A;  3OYK A;  1KFD A;  4N41 A;  4DQI A;  2FC0 A;  4DSE A;  4FLZ A;  5HRS A;  4FK4 A;  3LWL A;  3AA4 A;  4DFJ A;  5HBM A;  4CIF A;  3RMA A;  2BDP A;  4RW9 A;  3QIN A;  3MAQ A;  4CJL A;  2KTQ A;  1RNH A;  1B9F A;  3OYM A;  3RMC A;  2G8U A;  1X9S A;  2YV0 X;  1U45 A;  1RT4 A;  5FRM A;  3ZSO A;  4DF8 A;  3LAN A;  3OY9 A;  4CHN A;  1Z26 A;  4W5Q A;  3VQ9 A;  2R7Y A;  1IG9 A;  4CGD A;  3L2R A;  4KFB A;  1I39 A;  2YKN A;  1G15 A;  1S5J A;  4ICL A;  4FJ8 A;  1HMV A;  4C8O A;  4I2P A;  4BE1 A;  3OYH A;  1TL3 A;  4RW8 A;  1BIZ A;  3KK1 A;  4O44 A;  2HVH A;  3TAF A;  1TK8 A;  4F3T A;  1XHX A;  2HHS A;  1KVB A;  1JKH A;  3NF8 A;  3HM9 A;  1TL1 A;  2B4J A;  4B8A B;  4CJU A;  3BDP A;  4CF8 A;  1KVA A;  2ZQB A;  1A5W A;  3I8D A;  4F8R A;  1JLG A;  4DFM A;  4KHQ A;  4Z4G A;  1IKV A;  4PQU A;  4H8K A;  3HXM A;  1RDB A;  1U04 A;  1LW2 A;  2ETJ A;  2IC3 A;  2B5J A;  3AO3 A;  3IRX A;  4FM1 A;  3V81 A;  2G8V A;  1S1X A;  3TR8 A;  3O4Q A;  2X6S A;  4EP5 A;  1T7P A;  1Y97 A;  4Y1D A;  1VSE A;  3KLF A;  1DLO A;  1JLQ A;  3DI6 A;  4CF1 A;  3EY1 A;  2DTU A;  4FVM A;  4CJW A;  2HNZ A;  1WLJ A;  1U47 A;  3V9U A;  3PO4 A;  4FJ5 A;  3QO9 A;  4HCC A;  1TKX A;  3VQQ A;  4I7F A;  4CHY A;  4Z4E A;  3SV3 A;  4CGG A;  2F8S A;  4KHW A;  1BCO A;  4IG0 A;  3VQ5 A;  2KZM A;  3LPU A;  1CXU A;  3L8B A;  2VG5 A;  4FJ9 A;  2E6M A;  2VG6 A;  3M8P A;  1ITG A;  1TV6 A;  1TKZ A;  1S1T A;  3CM5 A;  3VQ6 A;  4KHS A;  1TAU A;  1WSE A;  1FK9 A;  2RF2 A;  2F8T A;  3L3V A;  4WE1 A;  3AVL A;  4E1M A;  4DU4 A;  4CFA A;  5J2M A;  2OPP A;  4FJH A;  4QAG A;  3MXI A;  4FLV A;  3SQ0 A;  3T1A A;  1DTQ A;  3JSM A;  4DSJ A;  3DOL A;  1NJY A;  5HLF A;  1Q9X A;  1JLC A;  3AA5 X;  1SKW A;  4DLE A;  1N5Y A;  3KTQ A;  3KKS A;  4KHU A;  2G8K A;  1IKW A;  2PYL A;  4AHV A;  4CJP A;  3RRH A;  3OYD A;  4AHS A;  2Z1H A;  4B9M A;  1VSD A;  1U49 A;  4CGI A;  3OYA A;  4LD0 A;  4CJT A;  4PY5 A;  1RBT A;  4CGJ A;  2Q3S A;  5EU7 A;  1VSJ A;  2OPR A;  4CF2 A;  3NGI A;  1KFS A;  4J2D A;  2G8W A;  4FJ7 A;  4ID1 A;  1W9H A;  1TKD A;  2FBX A;  2IAJ A;  4Z4I A;  4JLH A;  1LWC A;  1QQC A;  3E01 A;  4M3X A;  4CJV A;  1NJZ A;  4PWD A;  4CJR A;  1S1W A;  4E89 A;  2G8F A;  2E6L A;  1KCF A;  2HHX A;  4CEE A;  1WSI A;  1RDD A;  3KLI A;  1A5X A;  3DMJ A;  1HJR A;  3NF9 A;  4IFV A;  3VQP A;  3ZSX A;  4Q5V A;  4DTR A;  1RT3 A;  4XIU A;  3U3Y A;  3TAB A;  3ZT2 A;  3B6P A;  3V9W A;  3QLH A;  2ZE2 A;  3NGY A;  4MFB A;  4BDZ A;  3WNE A;  4QCL A;  4CCH A;  4ELU A;  2HW3 A;  3A2F A;  3SUN A;  4EZ9 A;  3HO1 A;  3CFR A;  4Z0U A;  4J2A A;  3S3O A;  2HVI A;  4M3W A;  3HJF A;  4CF9 A;  3D0P A;  1VSF A;  2EHG A;  2KQ2 A;  4KKO A;  4DTO A;  3SUQ A;  2GV9 A;  3AVI A;  3IS9 A;  3DLR A;  3KKR A;  3ZCM A;  4JS4 A;  2VWK A;  3KJV A;  4CJK A;  4KAZ A;  3KK3 A;  3LAK A;  4KTW A;  1NJW A;  4CER A;  4W5T A;  1NK0 A;  1L3T A;  1K6Y A;  4BE0 A;  4DSL A;  3QEW A;  3RMB A;  4CF0 A;  1XWL A;  4M3Z A;  2P1J A;  1TK5 A;  4TSX A;  1ZBF A; 
#chains in the Genus database with same CATH topology
 1RT2 A;  3WXK A;  3AAQ A;  3CQ8 A;  3RTV A;  3BUZ B;  3R3L A;  4PKI A;  3LP1 A;  2B6A A;  2JWL A;  4DQP A;  4X62 K;  1WAJ A;  2VQE K;  3U9D A;  1BA1 A;  5I3U A;  1EKE A;  3UE5 A;  4BDY A;  4EP4 A;  1K8K A;  2YHA A;  4BY9 C;  4C1N K;  1BI4 B;  1CXQ A;  5JVG L;  1LWE A;  3PX0 A;  2KW4 A;  1RDA A;  1NK4 A;  3AA3 A;  1LAW A;  2VCP A;  4FLY A;  3L2Q A;  4NYN A;  2PY5 A;  2YJE A;  4H4M A;  1ESV A;  2J4R A;  3CCJ N;  1TVR A;  4L3Q A;  4JS5 A;  5M1K A;  2KFN A;  1HUX A;  4AHU A;  1NOY A;  3QB0 A;  1OKJ A;  3ENB A;  4AF1 A;  3ZSV A;  1CZB A;  2FF3 B;  3UKR B;  3ISN C;  3B6O A;  2I5J A;  4YOY A;  3K5M A;  4E0D A;  4N47 A;  4WQ4 C;  4BVP A;  4RW7 A;  3CFP A;  2PZS A;  3PO5 A;  4YDU C;  4JRQ A;  3ATV A;  3L3U A;  4CJ4 A;  5JVH L;  4DS4 A;  1C1B A;  5J1E A;  3S3M A;  4FJI A;  3SUO A;  4H03 B;  3OS1 A;  5TKY A;  3SZ2 A;  4B3M K;  1N6Q A;  1XNR K;  4G1Q A;  1QQM A;  2X74 A;  3N4Q A;  1BL3 A;  1EXQ A;  1ASW A;  1ZBH A;  4LF6 K;  1RT5 A;  3RRG A;  1T6C A;  3V1Q A;  3SBG A;  4C8L A;  4CJ5 A;  1RTH A;  2NZT A;  4H4O A;  5ELZ A;  3WNH A;  1QE1 A;  4MLH A;  4DQR A;  3G0Z A;  3NDK A;  3VER A;  3VTI A;  1VQ6 N;  4FWQ A;  3NBP A;  3CPE A;  3TI0 A;  1A5V A;  5M1O A;  3THY B;  2V7Y A;  1ZBL A;  3KWG A;  1VSL A;  2NNW A;  4B3O A;  3DYA A;  2OA8 A;  1C1A A;  2HBK A;  1RCH A;  2P9S A;  4MDB A;  5HRO A;  1HJO A;  2W6L A;  2P9L B;  3ZSR A;  3CFO A;  3P4I A;  4YY3 K;  1N32 K;  3UKU A;  2OYQ A;  4JI8 K;  4N5S A;  1S6Q A;  4IXC A;  1I94 K;  1HNX K;  3FZL A;  3DLL L;  5I9E B;  3V9S A;  3LP2 A;  1T3V A;  2Q1N A;  3R1X A;  3QES A;  1L5U A;  1W7A A;  4LF8 K;  3B8A X;  4WFN L;  2I7N A;  3VQA A;  3CM6 A;  4V19 S;  2P9K B;  4CFD A;  4K41 A;  4FO0 A;  4LY7 A;  3AVA A;  4YOT A;  5LJW A;  4MLE A;  4B1Y B;  1LV5 A;  3KIO A;  4J2E A;  4NXN K;  4FLW A;  1P90 A;  3F9K A;  4DS5 A;  4RTF D;  3OYE A;  1DGK N;  3MX2 A;  1N36 K;  5JS2 A;  1VQM N;  4MO5 A;  4FJK A;  5T7B A;  1NKC A;  2VG7 A;  4DSI A;  1YTU A;  1C0T A;  2JGU A;  3VMF B;  5FPN A;  4JKG B;  5IWA K;  4BC2 A;  3ENH A;  4DLG A;  3DLH A;  1UOC A;  3QEX A;  3SNN A;  3ENO A;  4KRF A;  3NAE A;  4DF4 A;  2V52 B;  1RBU A;  3VQ8 A;  3L2W A;  4NXM K;  3ALY A;  1D9D A;  1KXP A;  4CZH A;  5J2N A;  1YIT N;  3MCP A;  4CJE A;  3LAL A;  1C1C A;  4A61 A;  4J2B A;  1WBD A;  3LP3 A;  3QET A;  5EOY A;  1D5A A;  4ZTJ A;  1Q9Y A;  4PUO A;  1KTQ A;  5CE3 A;  1TUU A;  3T7Z A;  3HPO A;  2NRW A;  1VQ8 N;  2IDO A;  3DWL A;  4IJA A;  1BIU A;  5M1P A;  1QSY A;  1QTM A;  4DQS A;  4LSN A;  2GX9 A;  3VQE A;  1RT6 A;  2DFE A;  4LF9 K;  3C6H A;  4BC4 A;  1NU0 A;  5BRE A;  3SQ4 A;  1NGH A;  3RR8 A;  4KH6 A;  1KAZ A;  1RT1 A;  2KFZ A;  4KV8 A;  4CJS A;  3OA9 A;  3HM8 A;  2OPS A;  4FOE A;  3CCE N;  3QFU A;  3BP8 A;  4BR5 A;  4I9L A;  1RBV A;  4KPY A;  3A8Y A;  3EZ5 A;  4JD2 B;  3S3N A;  3VEO A;  1X9M A;  1BI4 A;  2HHU A;  1VQN N;  2D5R A;  4WFA L;  1M90 O;  4FLT A;  3BEX A;  1MDU B;  4IDH A;  4BR0 A;  3CXC M;  5CZ2 A;  1NK6 A;  1NGA A;  4BRI A;  4KB0 A;  4GV9 A;  2O4I A;  3V9Z A;  3W3D A;  4ID5 A;  1I3A A;  3GL1 A;  5M1Q A;  4CED A;  3G10 A;  3J80 O;  4BE2 A;  4AIL C;  3VQC A;  1HYV A;  4HTL A;  4YOU A;  4ZHR A;  2W42 A;  3VF2 A;  3UKR A;  3CET A;  3OS0 A;  3IKM A;  2O8F B;  4DTM A;  3KVG A;  4DFP A;  3HYF A;  1JCE A;  2NRV A;  4YOR A;  3NVK A;  3O8M A;  3HP6 A;  2FBT A;  2EWS A;  4M3Y A;  4FJN A;  1X3M A;  2YNI A;  4HWI A;  5HOO A;  1ZBI A;  4JKE A;  3SUP A;  3K9J A;  4DR4 K;  5AQR A;  2YNG A;  3O3F A;  4JNE A;  2YNH A;  3OYI A;  4DKW A;  3MN6 A;  1VSI A;  4E1N A;  3WNF A;  1BGX T;  1RIL A;  1DKG D;  3G6E N;  2RPI A;  1KLM A;  4CD3 A;  1BO5 O;  4LSL A;  1QSL A;  4F2R A;  3LDO A;  2D0B A;  4C8M A;  3AVF A;  4DFK A;  4BGB A;  4BRN A;  3KD5 E;  2OCE A;  2HHH K;  2FXU A;  2HOE A;  5HP1 A;  2E4L A;  3AO4 A;  3R8E A;  3RR7 A;  1X1P A;  3UIQ A;  3AVN A;  5FLX O;  1XQS C;  5DMR A;  4LC9 B;  3QML A;  2P5O A;  1ILY A;  3THY A;  5C0Y A;  4BRH A;  3MED A;  3QFP A;  2CGK A;  4DQQ A;  5AQQ A;  1OVY A;  2ASM A;  4O8K A;  4DQI A;  2P9L A;  2FC0 A;  1E4F T;  4FK4 A;  3THX B;  3A5N C;  3AA4 A;  3LWL A;  5HBM A;  4DFJ A;  1YJW N;  1X9S A;  2YV0 X;  5FRM A;  4WCE L;  3CC4 N;  1Z26 A;  3QBX A;  1VQ9 N;  4U7B A;  4PL8 A;  3E9L A;  4LFB K;  3O9R A;  4RW8 A;  4BRL A;  3KK1 A;  1TK8 A;  4F3T A;  1XHX A;  1S22 A;  2HBJ A;  4OX9 K;  3HM9 A;  2P9K A;  3NF8 A;  4CF8 A;  2ZQB A;  1A5W A;  1JLG A;  2PAV A;  1NWK A;  1IKV A;  4UY8 O;  3H3N O;  1WB9 A;  1LW2 A;  4ISG A;  2E2O A;  3EO3 A;  1S1X A;  3O4Q A;  2X6S A;  4OO1 J;  4Y1D A;  1VSE A;  3KLF A;  1DLO A;  3FFK B;  3EY1 A;  3HSC A;  3EEQ A;  2GUP A;  4FVM A;  3PO4 A;  4ILH A;  4JKG A;  4CGG A;  1S72 N;  3AAP A;  3VQ6 A;  2W6K A;  3SAH A;  2F8T A;  4WE1 A;  4QAG A;  4DSJ A;  3DOL A;  1QVG M;  1Q9X A;  1JLC A;  3AA5 X;  3L0Q A;  4DLE A;  4KBO A;  1N5Y A;  4DV0 K;  1YJ9 N;  1IKW A;  4B1Z A;  3C6A A;  1HR0 K;  1VSD A;  4B9M A;  3OYA A;  4LD0 A;  3T1H K;  3ID8 A;  1E3M A;  1IBK K;  4JI5 K;  4PL7 A;  4ID1 A;  5BR8 K;  4CZM A;  3NMU A;  4H0P A;  3CJ7 A;  3E01 A;  1C0G A;  2GTD A;  4QS9 A;  4PKG A;  3M5R A;  1SAZ A;  4IOC L;  3ZYY X;  2ITM A;  4CEE A;  3J7A P;  4AM6 A;  1A5X A;  1NGI A;  3GOI A;  3NF9 A;  3G71 N;  3U3Y A;  2O8D B;  3ZX0 A;  4GY2 B;  4XIU A;  2YHW A;  5KQD A;  2PFU A;  3NGY A;  5AQX A;  1OH6 A;  1J6Z A;  3M1F A;  1NGF A;  4JD2 A;  4M3W A;  1X9J A;  4EAH D;  5LJV A;  2KQ2 A;  4DTO A;  4KKO A;  4JS4 A;  5M1N A;  3CJ9 A;  3KJV A;  3KK3 A;  3KZB A;  5AJ3 K;  4M3Z A;  5BPN A;  3Q7B A;  4TSX A;  1BU6 O;  3DLB A;  1U6Z A;  3MN5 A;  4FW2 A;  4KHY A;  3AVJ A;  4XEI A;  4WFB L;  3VEZ A;  4OPJ A;  3TTF A;  5KGX A;  3SLC A;  1T05 A;  3DLG A;  3DLK A;  2PYJ A;  3W0L A;  4DU3 A;  2O8F A;  4M41 A;  3T19 A;  4OPH A;  4DUZ K;  3VPZ A;  1HQU A;  4JYA K;  4IEE A;  1DTT A;  4F4K A;  5E41 A;  4OKJ A;  3HL8 A;  2BE2 A;  4NCA A;  1VK0 A;  1NKE A;  1BWF O;  5FRO A;  1X3N A;  1HLU A;  4JKC A;  5AQG A;  3ZT4 A;  4LH4 A;  3L2V A;  3WQT A;  3ZSQ A;  3OW2 M;  4MO4 A;  1S3X A;  4IFY A;  5KPR A;  5C25 A;  3NH0 A;  2HHW A;  1L3S A;  4QS7 A;  4FCY A;  3BZC A;  4Q0B A;  5KI6 A;  3FZK A;  3MEE A;  2QXF A;  5GAH P;  4KHP K;  1GOC A;  4OPA A;  2QWO A;  2E8A A;  5DM7 L;  4FXD A;  3JYT A;  3VN5 A;  4BG9 A;  4DR1 K;  2UUC K;  4KI4 A;  4JK7 A;  3KLE A;  3MX5 A;  1VHX A;  4DQ8 A;  4X64 K;  4NYF A;  4FZZ A;  3TAM A;  4DTX A;  1KC8 O;  3L6Q A;  1OH7 A;  2WON A;  1L3U A;  1CLQ A;  3TAR A;  4A2B A;  5BPM A;  1HPZ A;  3BGR A;  1XHZ A;  4O0J A;  1IV0 A;  1RTJ A;  3HZ6 A;  1RDC A;  3BF1 A;  4FPB A;  4B9N A;  4BG8 A;  2A6A A;  4FWS A;  4HTU A;  4BR4 A;  5JLF A;  4B1U B;  3THX A;  4HHT A;  2ZM6 K;  2VGN A;  1JL1 A;  5DK5 A;  2E2P A;  3HI0 A;  3OBW A;  3K0S A;  4W5R A;  4ILG B;  4Z4F A;  2HND A;  3LM2 A;  2Q97 A;  2QWN A;  3WUH A;  1IJJ A;  4GVE A;  3HVT A;  4FM0 A;  3SQ2 A;  3BF3 A;  1QQO A;  2V7Z A;  3PX4 A;  3HK2 A;  4H0T B;  3FFI A;  1YTA A;  3SMS A;  1TGO A;  5AQV A;  3E1Y A;  3O6W A;  4HCB A;  4B3S K;  1VAZ A;  3VF6 A;  3CYM A;  3KLG A;  1KQS M;  4E7L A;  4C8K A;  3H1Q A;  2BH1 A;  3MCA B;  4HUF A;  3C7N B;  5FPM A;  1WSF A;  4ELV A;  2G8H A;  3M8R A;  1GLA G;  5KGW A;  2JLE A;  3QNO A;  4M7Y A;  3A0I X;  1SS6 A;  3CC7 N;  3U4L A;  1N8R O;  4AHT A;  4O5F A;  2UXB K;  4DTU A;  3S41 A;  1NMD A;  3ITH A;  3M8Q A;  3DLE A;  4A57 A;  1W0H A;  3QEV A;  5SZT A;  4CJ7 A;  2E20 A;  1J54 A;  1ASU A;  5AQS A;  1JLE A;  3L2U A;  1B9D A;  3JS6 A;  3QIC A;  1XMQ K;  2Y1I A;  2UU9 K;  3OS2 A;  3S9H A;  2OZS A;  3WNG A;  4CZE A;  3TAE A;  4JK8 A;  3SV4 A;  3WEE B;  4FZX C;  2ZWH A;  3SYZ A;  3VQ4 A;  3VTH A;  1SUQ A;  3P38 A;  3HVR A;  2A1R A;  3HOT A;  4DTP A;  1C6V A;  1J5O A;  2O8D A;  4JKF A;  3J7Y P;  5C24 A;  2YHX A;  3CQY A;  4M63 C;  1VQ5 N;  4W5N A;  1GLC G;  4M7X A;  3HT3 A;  4B3R K;  4OGC A;  1Q82 O;  3LWM A;  3EKU A;  3MWP A;  4O55 A;  2HB5 A;  1NBW A;  1QHA A;  3I33 A;  1EET A;  4CEQ A;  1Q81 O;  4WQ5 C;  1BUP A;  4NB4 A;  1MA9 B;  2BAN A;  3DXM B;  1CZ9 A;  1WN7 A;  3KLH A;  3IAY A;  3AY9 A;  4CK1 A;  3F73 A;  3EYZ A;  1RDW X;  4A62 A;  3CCR N;  3ID6 A;  4O0I A;  2WC9 A;  3NGZ A;  3HPG A;  3OYG A;  4M42 A;  2GWK A;  2LSN A;  3CER A;  3Q7C A;  3CG7 A;  2XY8 A;  1NKB A;  4CFB A;  4CEA A;  4KH5 A;  3A5L C;  3K58 A;  2IVO A;  4CHZ A;  1IO2 A;  4XH1 A;  2P51 A;  5LMU K;  1K9M O;  1GOA A;  4OVL A;  3QIP A;  1IBL K;  4BRP A;  1QSS A;  5BN8 A;  3TSQ A;  2HF4 A;  2IOC A;  4E19 A;  3IDH A;  2D1K A;  4CEO A;  3NE6 A;  1C0M A;  4DR6 K;  2ZGY A;  1WUA A;  4NCG A;  4OKE A;  1BDG A;  3VES A;  4YOV A;  3LDQ A;  1VSK A;  5AQI A;  3AO5 A;  1T6D A;  1S1U A;  3WXI A;  4GKJ K;  2FF6 A;  3HPH A;  1HKG A;  4K43 A;  3K5N A;  3OYC A;  1BHL A;  1L3V A;  3AO2 A;  3DRS A;  4QS8 A;  5AQH A;  3EKS A;  4BGA A;  3NCI A;  5FDL A;  5BRD A;  4Z4C A;  4HUE A;  1Q8I A;  3CF5 L;  5KRS A;  1NK9 A;  2RKI A;  4DHY A;  4BR2 A;  2FSJ A;  4N56 A;  1BQM A;  3NF6 A;  4C8N A;  3ZX2 A;  3E9P A;  4BDP A;  3SPY A;  1OH8 A;  4NLB A;  1U4B A;  5F0X A;  4DV6 K;  1SL0 A;  2WOM A;  3M8S A;  4B08 A;  1NGG A;  1ZC6 A;  2I7P A;  3OVN A;  1UWB A;  3NH2 A;  3CIP A;  2E1Z A;  1S6P A;  3OTO K;  2VWJ A;  4F3O A;  5I42 A;  2NUB A;  4B9U A;  1KFD A;  2ZJP L;  4DSE A;  4FLZ A;  4BRQ A;  4U67 L;  2A3Z A;  2WTU A;  3R6M A;  3C7N A;  1JCG A;  2QWL A;  4CIF A;  3DXK B;  3MAQ A;  4GKK K;  4CJL A;  3RMC A;  3OYM A;  1U45 A;  4H5R A;  3ZSO A;  4W5Q A;  4CGD A;  2P9P B;  3I8B A;  1G15 A;  1S5J A;  2CH6 A;  1HMV A;  4NO7 A;  4BE1 A;  3OYH A;  1KAY A;  1BIZ A;  1GLE G;  4O44 A;  2HVH A;  3VEN A;  2UYT A;  1TL1 A;  2B4J A;  4B8A B;  4CJU A;  3CI5 A;  5AQP A;  1KVA A;  3N4P A;  4DFM A;  4KHQ A;  5AQL A;  3HXM A;  1U04 A;  5AQJ A;  2IC3 A;  4FM1 A;  4CZL A;  1GLF O;  4BVO A;  4GV6 A;  1DT9 A;  2DTU A;  4ISF A;  4BR9 A;  4CJW A;  1W97 L;  3V9U A;  1TKX A;  3VQQ A;  4Z4E A;  2F8S A;  2KZM A;  4IG0 A;  5GAG P;  3WEE A;  1TAU A;  3CM5 A;  1TKZ A;  1S1T A;  3IMX A;  4DV7 K;  4BRK A;  2RF2 A;  4E1M A;  3AVL A;  5C2F A;  1O13 A;  1NJY A;  4BC5 A;  5EXW A;  5C12 A;  4AHV A;  3QBW A;  3RRH A;  2UXD K;  4A5B A;  4EHU A;  1GLB G;  1M1K O;  3P31 A;  1RBT A;  3IFR A;  2NRZ A;  3NGI A;  3LM9 A;  2Q0R A;  5FPE A;  2YHY A;  3DXM A;  5AQU A;  3I55 N;  3H46 O;  3VGK A;  4M3X A;  4PWD A;  1S1W A;  4E89 A;  2G8F A;  1KCF A;  3KLI A;  3GDQ A;  3ZSX A;  4IFV A;  5CHI A;  1RT3 A;  4XH4 A;  3ZT2 A;  3B6P A;  3V9W A;  3QLH A;  5GAE P;  4C1N I;  3WNE A;  4QCL A;  2BTF A;  2HW3 A;  3A2F A;  2UXC K;  3HO1 A;  2AA4 A;  4J2A A;  3FZF A;  3ZX3 A;  5BRF A;  3HJF A;  3SUQ A;  2EHG A;  3CMA N;  3KKR A;  3IS9 A;  5F1X A;  1ATN A;  1L3T A;  4DSL A;  1D4X A;  3EN9 A;  4CF0 A;  4BRG A;  3VGM A;  1ZBF A;  2QM1 A;  3LZI A;  2ZJQ L;  3MXJ A;  3ZSW A;  4FM2 A;  4AM7 A;  3AVM A;  1TYQ B;  3OHR A;  3QEP A;  1O1W A;  3DRP A;  4CEB A;  3LDL A;  3QIO A;  1WOQ A;  3KHY A;  3HRG A;  2HMP A;  3D45 A;  4CW7 B;  2PBD A;  3PSI A;  5K14 A;  2GUI A;  3BZK A;  4KTQ A;  4CK2 A;  4CEC A;  3CPW M;  2Z1I A;  4FLU A;  3PV8 A;  1BCM A;  4CBW A;  2KLA A;  2XRI A;  4CZI A;  5ADX H;  3FLC O;  5KPT A;  2E1Y A;  3TAG A;  4L8R B;  4CVN E;  5F2R A;  4OLA A;  1FXX A;  4B9V A;  3FZM A;  2PYL A;  4BWJ A;  5BPL A;  3SAF A;  1EX4 A;  3IG1 A;  3EE8 A;  3PX6 A;  1S9E A;  1JCF A;  4N76 A;  4AQY K;  3TSU A;  4E7J A;  1R0A A;  3AGR A;  3C65 A;  3O9U A;  2RE2 A;  3O3H A;  4BRC A;  4EZ6 A;  3H6E A;  1VQP N;  4HVJ A;  2X6N A;  3D2E B;  4FJJ A;  4DR3 K;  2A42 A;  3O80 A;  3G4S N;  3CCS N;  1BIS A;  3RVC A;  1Z25 A;  3T3F A;  5C10 A;  3MDQ A;  3O08 A;  4FK0 A;  3DXK A;  3MK6 A;  1JLF A;  1NK7 A;  1KSP A;  2OPQ A;  5CYM A;  2FSN A;  1Q18 A;  4IFE A;  4F2S A;  2ZGZ A;  1K8A O;  4BWM A;  2P9P A;  2AJQ A;  3AA2 A;  4JI0 K;  4KTZ A;  2QTD A;  4MQ3 A;  1HPM A;  1LOT B;  3O4N A;  2NRT A;  4JI1 K;  3TU5 A;  4JI7 K;  3HST B;  3MWT A;  3C95 A;  3M3Z A;  3CCM N;  3DOK A;  3LPT A;  2H3G X;  1QS4 A;  3VQB A;  5AR0 A;  3K59 A;  4JI4 K;  3QEI A;  4FSV A;  4CEF A;  4JKH A;  2ASP A;  1S9G A;  3NF7 A;  5KQ8 A;  3NHG A;  3OJS A;  3CCV N;  1KD1 O;  3O9S A;  3RMD A;  1VQK N;  1VSH A;  4E1J A;  2O8E B;  1T03 A;  2KZZ A;  3J81 O;  4FWM A;  4CZK A;  1JL2 A;  3CME N;  3U8X A;  1D9F A;  3AVG A;  5D3G A;  2P9I B;  1T8E A;  4PHT X;  5AQF A;  3THV A;  4BAC A;  5HRP A;  1TKT A;  1FKO A;  5B8H A;  3K5L A;  4DV2 K;  3V6D A;  1WSJ A;  4DB3 A;  4B8C A;  3MN7 A;  3TAN A;  4M3T A;  1YVU A;  2HBL A;  4FVU A;  3SPZ A;  3L4Q A;  1NK8 A;  4CHO A;  4CGH A;  3F2K A;  1NK5 A;  2D0O A;  2XY5 A;  4NCB A;  4AHC A;  1WAF A;  4DMN A;  1LW0 A;  3ZT1 A;  1HKB A;  4ELT A;  4DR5 K;  4AHR A;  4AH9 A;  4DV3 K;  2ZJR L;  4W5O A;  3SCX A;  3FR0 A;  4CFC A;  2DY4 A;  1BOT O;  2OZM A;  1NMN A;  3I0R A;  1WSG A;  4IZ9 A;  4DWI A;  4RG8 A;  1IKY A;  3VQD A;  3I0S A;  1U48 A;  2VGM A;  4FL9 A;  1TYQ A;  5ADX A;  1MU2 A;  5BR9 A;  3QDK A;  5AQM A;  5HRN A;  1YF5 L;  3VEW A;  2YHB A;  2HF3 A;  3TTD A;  4GW6 A;  2GWJ A;  3MXM A;  5AQY A;  3DM2 A;  4H5W A;  2OTJ N;  1WNS A;  3OYB A;  3NH1 A;  4KRE A;  4OGE A;  1XC9 A;  2Q2R A;  4FWN A;  3AO1 A;  2HMI A;  3O3G A;  3QER A;  1UA0 A;  4BC3 A;  3FE1 A;  1T44 A;  5E84 A;  5JS1 A;  3KK2 A;  1HNV A;  1N34 K;  2P9N B;  3ZSZ A;  1N33 K;  2YNF A;  1HYS A;  3DAW A;  2BGG A;  3EL2 A;  2VWB A;  3O9Q A;  2QK9 A;  1RBS A;  3VA0 A;  4JEP A;  2V51 B;  1NG9 A;  3CJ1 A;  1JLA A;  4KO0 A;  4FJL A;  4B9S A;  1V4S A;  4ILJ A;  3A5M C;  1HNZ K;  2D0C A;  2AP1 A;  4DR7 K;  4FJX A;  2QI2 A;  3E9O A;  4FWP A;  4IJN A;  2F96 A;  3NVM A;  3RSE B;  3AV9 A;  3ZT0 A;  3CJC A;  2F4V K;  5AQT A;  2HBM A;  1B92 A;  4A59 A;  3SAG A;  3D2E A;  1IKX A;  4R5P A;  3R9P A;  1NGB A;  4BQZ A;  1SL1 A;  4LF4 K;  3J7Z O;  4H0V B;  1SL2 A;  4BRO A;  1LAV A;  3K57 A;  3AGK A;  2FLO A;  3CCQ N;  3LP0 A;  1HX1 A;  2Z1J A;  1VRT A;  2A40 A;  4E7H A;  2G8I A;  4KHN A;  4M45 A;  5C15 A;  4H5T A;  2OAN A;  2GBZ A;  2X78 A;  2HHQ A;  2P5G A;  1ASV A;  2IVP A;  4JI6 K;  3HBT A;  5LY3 A;  1YI2 N;  1RBR A;  2YKM A;  1KRP A;  1RTI A;  2IIR A;  4JKD A;  3H3O B;  1TUY A;  2FBV A;  2Q0U A;  4OPK A;  3OYF A;  3LDN A;  2YX6 A;  1NGE A;  4B1V A;  3EZW A;  2O8C B;  2BDP A;  4RW9 A;  3QIN A;  2KTQ A;  1RNH A;  1B9F A;  2QWP A;  3O9T A;  1RT4 A;  5AZI B;  3VEV A;  4DF8 A;  3D7E O;  4CHN A;  2R7Y A;  1IG9 A;  1ZXO A;  3PIO L;  1I39 A;  2YKN A;  4FJ8 A;  3SK3 A;  3OBY A;  1OH5 A;  1TL3 A;  4H0Y B;  3TAF A;  4IO9 L;  3O1W A;  1KVB A;  2HHS A;  1P8Z A;  2O8E A;  2BUP A;  3I8D A;  4Z4G A;  4PQU A;  3L4I A;  3VF4 A;  3AO3 A;  2ETJ A;  3V81 A;  2P9I A;  4EP5 A;  5JLH A;  2KKZ A;  3DI6 A;  1JLQ A;  4CF1 A;  3TPQ A;  2E2N A;  3QO9 A;  4HCC A;  2ASO A;  4I7F A;  4CHY A;  1NLV A;  4KHW A;  1BCO A;  5BN9 A;  4H0O A;  5H1S Q;  2QWM A;  3LPU A;  2F9T A;  1YXQ A;  3MMV A;  1TV6 A;  1JJ2 M;  1VQ7 N;  4YOW A;  1WSE A;  1EQY A;  1LCU A;  4DU4 A;  3T69 A;  3MXI A;  4FLV A;  3SQ0 A;  3T1A A;  1DTQ A;  3CHW A;  5HLF A;  5AQW A;  3CD6 N;  5JMV A;  4IOA L;  4CJP A;  2CGJ A;  5E26 A;  4H0X B;  3OYD A;  2Z1H A;  1U49 A;  4CJT A;  4PY5 A;  5GIP A;  5EU7 A;  1VSJ A;  2OPR A;  4CF2 A;  3ZEU B;  1KFS A;  1W9H A;  1TKD A;  1NM1 A;  4Z4I A;  1LWC A;  1NJZ A;  3CCL N;  1H1V A;  1DEJ A;  2UUB K;  2E6L A;  1VQ4 N;  2HHX A;  1WSI A;  4DTR A;  3DMJ A;  4Q5V A;  3TAB A;  4WYB A;  2ZE2 A;  4BRF A;  5KPZ A;  4BDZ A;  2WFB A;  3A5O C;  3CFR A;  1CZA N;  2HVI A;  4CF9 A;  2GV9 A;  3AVI A;  3ZCM A;  2VWK A;  1Q7Y O;  2VQF K;  4CJK A;  4KAZ A;  1NJW A;  3LAK A;  4KTW A;  4BRA A;  3AAR A;  3QEW A;  2Q31 A;  3RMB A;  1XWL A;  2P1J A;  4DV5 K;  4DTJ A;  2Z1G A;  3ULE B;  3HOS A;  4DV1 K;  2EX3 A;  4CHP A;  4IG3 A;  3GE1 A;  4CJ3 A;  1VRU A;  2P9N A;  1RFQ A;  1XNQ K;  4YNQ A;  3OYN A;  1NGC A;  2IS3 A;  5J2P A;  4CGF A;  1EP4 A;  2QEX N;  1C0U A;  5BRH A;  3SJJ A;  5EY4 A;  3O1B A;  3H1V X;  1YT3 A;  2E2Q A;  4IDK A;  3TTC A;  4K8Z A;  4K42 A;  3MEC A;  2O4G A;  2NRR A;  3PUF A;  1KLN A;  2XHB A;  3WT0 A;  3RSE A;  5CY4 A;  3V9X A;  1SV5 A;  4LH5 A;  2A1S A;  2XO7 A;  3ASM A;  2W41 A;  1QQN A;  1KAX A;  4ZTF A;  4FZY A;  3P1G A;  3HP9 A;  5SWM A;  4YFU A;  1TAQ A;  3TAQ A;  2XY7 A;  2JWK A;  4DUY K;  4RW4 A;  1J9A A;  4B9T A;  4LFC K;  4B9L A;  3G25 A;  5AQN A;  1EO1 A;  3CCU N;  2GEM A;  5CR4 A;  2HHT A;  1ZYQ A;  4K8X A;  5LMN K;  5GIO A;  2O8B B;  4CES A;  1JLB A;  3NFA A;  3TSP A;  1D8Y A;  2FSK A;  3MN9 A;  5KTQ A;  4CE9 A;  3AVC A;  3V1R A;  4F9O A;  4GVM A;  3CQX A;  3OJU A;  3U9Z A;  3V4I A;  3SQ1 A;  5M1F A;  3VQ7 A;  3ZT3 A;  4BR7 A;  2WBN A;  2O8C A;  1SZ2 A;  1YUW A;  2RN2 A;  3MEG A;  1YHQ N;  4B1W B;  5AZI A;  2E5L K;  1JXE A;  2ATQ A;  5MLC Q;  1C0F A;  1VQO N;  4UQG A;  4JAX A;  1YVN A;  5TKW A;  2Y1J A;  2D4W A;  3FGU A;  3TAP A;  2NLX A;  4I6M B;  4JKA A;  3KD1 E;  4IBN A;  3CC2 N;  3OYJ A;  5AZJ B;  3U3G A;  4M3U A;  4E7I A;  3T1Y K;  2QKB A;  4BQL A;  4WF9 L;  5GIN A;  1Y64 A;  2D0A A;  1S1V A;  1XUP O;  1SQK A;  3OYL A;  3AVK A;  3F5T A;  2P9U B;  1UA1 A;  4XH5 A;  4FK2 A;  2HNY A;  4Y1C A;  4A5A A;  4JHD B;  5AFU H;  1J5E K;  4RW6 A;  3ZET B;  3FZH A;  1RGI A;  4E7K A;  4HUG A;  3GG4 A;  5EVZ A;  5CZ1 A;  2YI1 A;  4PA1 A;  3JAM O;  1X9W A;  4PKH A;  3CJB A;  4O5B A;  4CIG A;  1RT7 A;  1IG8 A;  1G99 A;  2YCH A;  2D0P A;  1WBB A;  1QZ5 A;  4CZJ A;  5J2Q A;  3IUC A;  1F21 A;  3D2F B;  1HNW K;  4K25 A;  1VQL N;  5CYQ A;  3WXM B;  4GMJ B;  3ZEU A;  4ISE A;  3RWU A;  1XI1 A;  5HL7 L;  4DTS A;  1EWR A;  3TWH A;  4LF7 K;  4A2A A;  4DG1 A;  1BA0 A;  1YJN N;  3D6R A;  5AQK A;  4CJQ A;  2ZF5 O;  4JRP A;  3C0B A;  3PY8 A;  1IBM K;  1LWF A;  3P39 A;  3U6F A;  1J53 A;  4B1X B;  4Z4H A;  1HKC A;  4FW1 A;  2OTL N;  5C2D A;  3VOV A;  3P5J A;  3H08 A;  4JI2 K;  1BQN A;  4BRM A;  1RTD A;  1KVC A;  3SJH A;  5LL6 Z;  1GLL O;  1SKS A;  1HQE A;  3KK7 A;  1ATS A;  5HRR A;  4CZG A;  1TK0 A;  1GLD G;  1HYZ A;  4FJM A;  4Z94 A;  4FYD A;  1BG3 A;  3LDS A;  3C94 A;  3P83 D;  3C6T A;  2CH5 A;  2DFF A;  3THW B;  4Y0W A;  3ULE A;  1W2B M;  2ITG A;  2QWQ A;  3VGL A;  1FJG K;  4E3S A;  3V1O A;  2KHO A;  3C6U A;  1FKP A;  2F9W A;  2QW9 A;  4O4G A;  2CGL A;  1U2V B;  4BRE A;  3K9K A;  4DTN A;  4FWO A;  5A2Q O;  5IT9 O;  4CEZ A;  1EWQ A;  4EFH A;  1IH7 A;  4B9Q A;  4OKK A;  1UAX A;  4M3R A;  4CBX A;  2NRX A;  3AVB A;  3K2P A;  4CK3 A;  3LAM A;  4DU1 A;  2ZD1 A;  3HTV A;  1HRH A;  4IKF A;  4KH4 A;  1ZBS A;  4FLX A;  1V4T A;  4CHQ A;  1GOB A;  4KB1 A;  1K8K B;  3WXL A;  3PSF A;  3ULD A;  3DRR A;  3K5O A;  3LZJ A;  1QHT A;  3VA3 A;  4QOZ B;  3H45 C;  3I56 N;  5AQO A;  2HHV A;  1REV A;  4JK9 A;  2XY6 A;  2O8B A;  5FRN A;  4DV4 K;  5EX5 A;  3VEX A;  1ZBU A;  5C42 A;  2YJF A;  5FPD A;  4FOI A;  5AQZ A;  3SI6 A;  3KWI A;  4EIA A;  2Q36 A;  4JI3 K;  4I9Q A;  1HNI A;  3SBT A;  4FWK A;  3LL3 A;  1Z6R A;  3JXU A;  4IOX A;  1NOZ A;  4KI6 A;  1K73 O;  2A5X A;  2DFH A;  1WSH A;  2VYP A;  4DSF A;  4CZF A;  5KRT A;  1SKR A;  4FJG A;  3J8A A;  3UB5 A;  4I2Q A;  4CJF A;  3QNN A;  2QKK A;  4OLB A;  3LDP A;  4JV5 K;  2NRH A;  1MWM A;  1JXB A;  4IWV A;  4WQ4 A;  3ZSY A;  4CIE A;  1QVF M;  5AFU A;  1NJX A;  4YDU A;  1ATR A;  4OJR A;  2E88 A;  3GBT A;  1NGJ A;  1NJI O;  4I6M A;  2QXL A;  4DSK A;  4WQ5 A;  1VSM A;  2FBY A;  2IGI A;  3EE9 A;  5AZJ A;  3AVH A;  4C23 A;  3OYK A;  4N41 A;  1GLJ O;  1FW6 A;  2W40 A;  4JKB A;  5HRS A;  2RHK A;  4DCH A;  3RMA A;  2P9U A;  4IEI A;  4K0K K;  2G8U A;  1XC3 A;  2QWR A;  1R59 O;  4JHD A;  3LAN A;  3OY9 A;  2IVN A;  3VQ9 A;  3ZET A;  1XMO K;  4DR2 K;  3L2R A;  4KFB A;  4CD1 A;  4ICL A;  4C8O A;  4I2P A;  4X66 K;  2A41 A;  4RCH A;  1JKH A;  4NLC A;  3WXJ A;  3BDP A;  3CJA A;  4R79 A;  4FWL A;  3E66 A;  4MDA A;  2P9S B;  4F8R A;  4BRD A;  3VET A;  2WUS A;  4H8K A;  4B3T K;  3WQU A;  1RDB A;  2G8V A;  3IRX A;  2B5J A;  3UKU B;  3ATU A;  3TR8 A;  4G9Z A;  1Q86 O;  1T7P A;  1Y97 A;  2HNZ A;  3D2F A;  3O4W A;  1WLJ A;  4FPA A;  1U47 A;  4FJ5 A;  3ZLJ A;  1MWK A;  1NNE A;  4JN4 A;  3SV3 A;  3VQ5 A;  1CXU A;  4CBU A;  3L8B A;  2VG5 A;  4FJ9 A;  2E6M A;  2VG6 A;  3M8P A;  1ITG A;  3F9M A;  4KHS A;  4FWR A;  1FK9 A;  4CI6 A;  2DPN A;  3L3V A;  5J2M A;  4CFA A;  3PIP L;  2OPP A;  4GNI A;  4FJH A;  4GV3 A;  3M6G A;  4X65 K;  4H5V A;  3JSM A;  1SKW A;  1YIJ N;  2HST A;  3KKS A;  1RDU A;  2G8K A;  3KTQ A;  4KHU A;  3VEY A;  4AHS A;  4J8F A;  4CGI A;  3BY5 A;  4CGJ A;  2Q3S A;  3SMP A;  4J2D A;  2G8W A;  4FJ7 A;  1Z05 A;  2FBX A;  2IAJ A;  4JLH A;  5JIC A;  1QQC A;  2F7T A;  1OVQ A;  2GEL A;  4EHT A;  3THW A;  4CJV A;  4CJR A;  4O8U A;  1NGD A;  4IO8 A;  5DM6 L;  1RDD A;  1HJR A;  3VQP A;  4LF5 K;  3O5B A;  4MFB A;  4YOX A;  4CCH A;  4ELU A;  1U2V A;  3SUN A;  4EZ9 A;  4Z0U A;  3S3O A;  4LFA K;  3D0P A;  1VSF A;  1YAG A;  2QA4 N;  2UUA K;  3DLR A;  4CER A;  4YHH K;  4W5T A;  1NK0 A;  1K6Y A;  5GAD P;  4BE0 A;  3PLA A;  1QZ6 A;  1TK5 A;  4H5N A;  1E4G T;  3DJC A;  4RWT A; 
#chains in the Genus database with same CATH homology
 1RT2 A;  4DTJ A;  2Z1G A;  3DLB A;  4KHY A;  4FW2 A;  3LZI A;  3AVJ A;  2EX3 A;  4CHP A;  3MXJ A;  3CQ8 A;  3RTV A;  4OPJ A;  3ZSW A;  4FM2 A;  4IG3 A;  3LP1 A;  5KGX A;  2B6A A;  1T05 A;  4CJ3 A;  3DLG A;  1VRU A;  4DQP A;  1WAJ A;  5I3U A;  4YNQ A;  3OYN A;  3DLK A;  1EKE A;  3AVM A;  2PYJ A;  4DU3 A;  4BDY A;  2IS3 A;  5J2P A;  4CGF A;  4M41 A;  1EP4 A;  1O1W A;  2YHA A;  3DRP A;  4EP4 A;  3T19 A;  4CEB A;  3QEP A;  3QIO A;  1BI4 B;  1C0U A;  1CXQ A;  1HQU A;  3SJJ A;  1LWE A;  3PX0 A;  1DTT A;  4F4K A;  5E41 A;  3D45 A;  4OKJ A;  1YT3 A;  5K14 A;  3HL8 A;  2KW4 A;  2GUI A;  1RDA A;  1NK4 A;  2BE2 A;  3AA3 A;  4IDK A;  1LAW A;  4CK2 A;  4KTQ A;  4K8Z A;  4CEC A;  4NCA A;  1VK0 A;  3MEC A;  4FLY A;  2O4G A;  1NKE A;  2Z1I A;  5FRO A;  3L2Q A;  4NYN A;  4FLU A;  2PY5 A;  3PUF A;  1KLN A;  3ZT4 A;  3PV8 A;  4H4M A;  4LH4 A;  3L2V A;  1BCM A;  2XHB A;  2XRI A;  1TVR A;  3ZSQ A;  4JS5 A;  3TAG A;  2KFN A;  5CY4 A;  4L8R B;  4AHU A;  1NOY A;  3V9X A;  1SV5 A;  4IFY A;  4LH5 A;  2A1S A;  2XO7 A;  3ZSV A;  3ASM A;  1CZB A;  4E0D A;  3ISN C;  3B6O A;  2I5J A;  3K5M A;  4OLA A;  4N47 A;  1FXX A;  5C25 A;  3NH0 A;  3P1G A;  4ZTF A;  3HP9 A;  4RW7 A;  5SWM A;  1TAQ A;  4YFU A;  3CFP A;  4FCY A;  3TAQ A;  4BWJ A;  1L3S A;  2PZS A;  3PO5 A;  1EX4 A;  4Q0B A;  5KI6 A;  2XY7 A;  3MEE A;  2QXF A;  1J9A A;  3IG1 A;  4RW4 A;  4JRQ A;  4B9T A;  3PX6 A;  3L3U A;  4CJ4 A;  1S9E A;  1GOC A;  4B9L A;  4N76 A;  4FXD A;  4DS4 A;  3JYT A;  3VN5 A;  1C1B A;  5J1E A;  4E7J A;  1R0A A;  4KI4 A;  3KLE A;  3S3M A;  4FJI A;  3SUO A;  2HHT A;  1ZYQ A;  3OS1 A;  3SZ2 A;  4K8X A;  4NYF A;  1N6Q A;  4FZZ A;  3TAM A;  4DTX A;  4G1Q A;  3O3H A;  2WON A;  4CES A;  1L3U A;  2X74 A;  1JLB A;  1CLQ A;  3NFA A;  3TAR A;  1BL3 A;  1HPZ A;  4EZ6 A;  3BGR A;  4HVJ A;  1D8Y A;  1XHZ A;  4O0J A;  2X6N A;  4CE9 A;  5KTQ A;  1RTJ A;  4FJJ A;  1EXQ A;  3AVC A;  1RDC A;  1ASW A;  4B9N A;  3V1R A;  1ZBH A;  1BIS A;  1RT5 A;  3RRG A;  4HTU A;  1Z25 A;  4GVM A;  3T3F A;  3V1Q A;  3OJU A;  4C8L A;  4CJ5 A;  3V4I A;  1RTH A;  3SQ1 A;  3VQ7 A;  3ZT3 A;  4HHT A;  1JL1 A;  4H4O A;  5DK5 A;  4FK0 A;  1JLF A;  2RN2 A;  3WNH A;  1QE1 A;  3MEG A;  2OPQ A;  4W5R A;  1NK7 A;  1KSP A;  4DQR A;  5CYM A;  3G0Z A;  3NDK A;  4Z4F A;  1JXE A;  2ATQ A;  4F2S A;  2HND A;  3NBP A;  4UQG A;  3TI0 A;  4BWM A;  2HHW A;  2AJQ A;  3AA2 A;  1A5V A;  3HVT A;  4KTZ A;  4FM0 A;  3SQ2 A;  4MQ3 A;  1ZBL A;  2Y1J A;  1VSL A;  3O4N A;  4B3O A;  3PX4 A;  3DYA A;  3HK2 A;  3FFI A;  1YTA A;  1TGO A;  3TAP A;  3KD1 E;  4IBN A;  3HST B;  2OA8 A;  3OYJ A;  3U3G A;  4M3U A;  1C1A A;  4E7I A;  2QKB A;  3C95 A;  4HCB A;  1RCH A;  3DOK A;  3LPT A;  5HRO A;  1QS4 A;  3ZSR A;  3CFO A;  3CYM A;  2D0A A;  3VQB A;  3KLG A;  2OYQ A;  3K59 A;  1S1V A;  4E7L A;  4C8K A;  4N5S A;  1S6Q A;  3QEI A;  3OYL A;  3AVK A;  4HUF A;  1UA1 A;  4CEF A;  1WSF A;  4FK2 A;  2HNY A;  4Y1C A;  4ELV A;  2G8H A;  3V9S A;  1S9G A;  3NF7 A;  3LP2 A;  4RW6 A;  2JLE A;  5KGW A;  3M8R A;  3QNO A;  4E7K A;  3QES A;  1L5U A;  4HUG A;  3NHG A;  3OJS A;  4AHT A;  5CZ1 A;  4DTU A;  3VQA A;  3CM6 A;  4PA1 A;  3ITH A;  4CFD A;  3M8Q A;  3RMD A;  3DLE A;  1VSH A;  1W0H A;  1T03 A;  4LY7 A;  3QEV A;  3AVA A;  5SZT A;  1X9W A;  2KZZ A;  1LV5 A;  3KIO A;  4O5B A;  4J2E A;  1J54 A;  1ASU A;  4CIG A;  1RT7 A;  1JL2 A;  1JLE A;  3F9K A;  3L2U A;  4FLW A;  4DS5 A;  1D9F A;  3AVG A;  5D3G A;  3OYE A;  1T8E A;  1B9D A;  5JS2 A;  5J2Q A;  2Y1I A;  4FJK A;  5T7B A;  1NKC A;  3OS2 A;  2VG7 A;  3S9H A;  2OZS A;  1F21 A;  4DSI A;  3WNG A;  1YTU A;  5CYQ A;  1C0T A;  4BAC A;  4GMJ B;  3THV A;  5HRP A;  1TKT A;  1FKO A;  2JGU A;  3K5L A;  3V6D A;  3TAE A;  3RWU A;  1WSJ A;  1XI1 A;  3SV4 A;  4DLG A;  4DTS A;  1UOC A;  3TWH A;  3DLH A;  4FZX C;  4DG1 A;  4B8C A;  3QEX A;  1D9D A;  3SNN A;  4CJQ A;  3SYZ A;  3VQ4 A;  3TAN A;  3NAE A;  4DF4 A;  4M3T A;  4KRF A;  1YVU A;  1RBU A;  3VQ8 A;  1SUQ A;  3L2W A;  3HVR A;  3SPZ A;  4JRP A;  2A1R A;  3ALY A;  4DTP A;  4CHO A;  4CGH A;  1NK5 A;  1NK8 A;  1C6V A;  1LWF A;  3U6F A;  1J5O A;  1J53 A;  3PY8 A;  5J2N A;  5C24 A;  4Z4H A;  4W5N A;  4CJE A;  2XY5 A;  4NCB A;  4FW1 A;  4AHC A;  1WAF A;  4DMN A;  3P5J A;  3H08 A;  3LAL A;  1LW0 A;  1BQN A;  1C1C A;  3ZT1 A;  3HT3 A;  1RTD A;  4J2B A;  1KVC A;  4ELT A;  4OGC A;  3LP3 A;  3QET A;  1D5A A;  4ZTJ A;  3LWM A;  1Q9Y A;  4O55 A;  4AHR A;  4PUO A;  1KTQ A;  4AH9 A;  1SKS A;  1HQE A;  2HB5 A;  5HRR A;  3HPO A;  4W5O A;  1TK0 A;  3SCX A;  2IDO A;  1HYZ A;  1EET A;  4FJM A;  4CEQ A;  4CFC A;  4FYD A;  3LDS A;  2DY4 A;  3C94 A;  2OZM A;  3P83 D;  1BIU A;  3C6T A;  2BAN A;  1CZ9 A;  1QSY A;  1QTM A;  4DQS A;  4LSN A;  2DFF A;  1WN7 A;  3KLH A;  3VQE A;  3I0R A;  3IAY A;  4CK1 A;  3F73 A;  1WSG A;  1RT6 A;  2DFE A;  2ITG A;  3EYZ A;  4DWI A;  3SQ4 A;  4RG8 A;  3RR8 A;  1IKY A;  4E3S A;  4O0I A;  3V1O A;  3C6U A;  1RT1 A;  2KFZ A;  1FKP A;  3VQD A;  3I0S A;  1U48 A;  4KV8 A;  4CJS A;  4O4G A;  2OPS A;  3NGZ A;  3HPG A;  3OYG A;  4M42 A;  1MU2 A;  2LSN A;  4DTN A;  3CG7 A;  2XY8 A;  4I9L A;  1RBV A;  4CFB A;  1NKB A;  4CEA A;  3EZ5 A;  4KPY A;  5HRN A;  3S3N A;  1X9M A;  1BI4 A;  3K58 A;  2HHU A;  2D5R A;  4CEZ A;  2YHB A;  4CHZ A;  1IO2 A;  4FLT A;  1IH7 A;  4GW6 A;  3MXM A;  5CZ2 A;  2P51 A;  3DM2 A;  4OKK A;  1NK6 A;  1GOA A;  1WNS A;  3OYB A;  4OVL A;  3NH1 A;  4KRE A;  4OGE A;  3QIP A;  1XC9 A;  4KB0 A;  2O4I A;  3AO1 A;  1UAX A;  2HMI A;  4M3R A;  1QSS A;  3V9Z A;  3O3G A;  4ID5 A;  1I3A A;  4CED A;  3QER A;  3AVB A;  3G10 A;  4BE2 A;  1UA0 A;  3K2P A;  4AIL C;  4CK3 A;  3LAM A;  2IOC A;  4E19 A;  3VQC A;  4DU1 A;  5JS1 A;  1HYV A;  2ZD1 A;  3KK2 A;  1HRH A;  1HNV A;  4IKF A;  4CEO A;  3ZSZ A;  4ZHR A;  3NE6 A;  2W42 A;  1C0M A;  4FLX A;  2YNF A;  1HYS A;  3OS0 A;  4CHQ A;  4NCG A;  1GOB A;  4OKE A;  2BGG A;  4DTM A;  4DFP A;  4KB1 A;  2QK9 A;  1RBS A;  3HYF A;  3VA0 A;  3ULD A;  3DRR A;  3K5O A;  3LZJ A;  1QHT A;  2FBT A;  3HP6 A;  3VA3 A;  1VSK A;  4M3Y A;  4QOZ B;  1JLA A;  3AO5 A;  4KO0 A;  1S1U A;  4FJL A;  4B9S A;  4FJN A;  3HPH A;  2D0C A;  2YNI A;  3K5N A;  1ZBI A;  3OYC A;  4FJX A;  2HHV A;  1BHL A;  1L3V A;  3SUP A;  3AO2 A;  3DRS A;  1REV A;  2XY6 A;  2YNG A;  2F96 A;  3O3F A;  2YNH A;  3OYI A;  4B9V A;  3AV9 A;  4E1N A;  1VSI A;  5FRN A;  3WNF A;  1BGX T;  1RIL A;  5FDL A;  3ZT0 A;  4Z4C A;  3NCI A;  4HUE A;  1ZBU A;  5C42 A;  2RPI A;  1KLM A;  1Q8I A;  1B92 A;  1IKX A;  4LSL A;  5KRS A;  4R5P A;  3SI6 A;  1QSL A;  4F2R A;  2D0B A;  1SL1 A;  4C8M A;  4I9Q A;  3AVF A;  1HNI A;  4FZY A;  1NK9 A;  4DFK A;  2RKI A;  1SL2 A;  1LAV A;  3K57 A;  3KD5 E;  1NOZ A;  4KI6 A;  5HP1 A;  2E4L A;  2DFH A;  1WSH A;  3AO4 A;  4N56 A;  4DSF A;  3LP0 A;  1BQM A;  3NF6 A;  4C8N A;  5KRT A;  1SKR A;  3RR7 A;  4I2Q A;  1X1P A;  2Z1J A;  4CJF A;  3QNN A;  3UIQ A;  2QKK A;  1VRT A;  4BDP A;  3AVN A;  3SPY A;  4OLB A;  4E7H A;  2G8I A;  1U4B A;  5DMR A;  4KHN A;  1SL0 A;  1JXB A;  4M45 A;  2WOM A;  3M8S A;  2P5O A;  3ZSY A;  4B08 A;  4CIE A;  2GBZ A;  3OVN A;  2X78 A;  1UWB A;  2HHQ A;  1NJX A;  3NH2 A;  3MED A;  2P5G A;  1ASV A;  2VWJ A;  1S6P A;  4OJR A;  4F3O A;  1RBR A;  2YKM A;  1KRP A;  4DSK A;  1RTI A;  4DQQ A;  4FJG A;  1VSM A;  2FBY A;  2IGI A;  5I42 A;  4OPK A;  2FBV A;  2NUB A;  3AVH A;  3OYF A;  4B9U A;  3OYK A;  1KFD A;  4N41 A;  4DQI A;  2FC0 A;  4DSE A;  4FLZ A;  5HRS A;  4FK4 A;  3LWL A;  3AA4 A;  4DFJ A;  5HBM A;  4CIF A;  3RMA A;  2BDP A;  4RW9 A;  3QIN A;  3MAQ A;  4CJL A;  2KTQ A;  1RNH A;  1B9F A;  3OYM A;  3RMC A;  2G8U A;  1X9S A;  2YV0 X;  1U45 A;  1RT4 A;  5FRM A;  3ZSO A;  4DF8 A;  3LAN A;  3OY9 A;  4CHN A;  1Z26 A;  4W5Q A;  3VQ9 A;  2R7Y A;  1IG9 A;  4CGD A;  3L2R A;  4KFB A;  1I39 A;  2YKN A;  1G15 A;  1S5J A;  4ICL A;  4FJ8 A;  1HMV A;  4C8O A;  4I2P A;  4BE1 A;  3OYH A;  1TL3 A;  4RW8 A;  1BIZ A;  3KK1 A;  4O44 A;  2HVH A;  3TAF A;  1TK8 A;  4F3T A;  1XHX A;  2HHS A;  1KVB A;  1JKH A;  3NF8 A;  3HM9 A;  1TL1 A;  2B4J A;  4B8A B;  4CJU A;  3BDP A;  4CF8 A;  1KVA A;  2ZQB A;  1A5W A;  3I8D A;  4F8R A;  1JLG A;  4DFM A;  4KHQ A;  4Z4G A;  1IKV A;  4PQU A;  4H8K A;  3HXM A;  1RDB A;  1U04 A;  1LW2 A;  2ETJ A;  2IC3 A;  2B5J A;  3AO3 A;  3IRX A;  4FM1 A;  3V81 A;  2G8V A;  1S1X A;  3TR8 A;  3O4Q A;  2X6S A;  4EP5 A;  1T7P A;  1Y97 A;  4Y1D A;  1VSE A;  3KLF A;  1DLO A;  1JLQ A;  3DI6 A;  4CF1 A;  3EY1 A;  2DTU A;  4FVM A;  4CJW A;  2HNZ A;  1WLJ A;  1U47 A;  3V9U A;  3PO4 A;  4FJ5 A;  3QO9 A;  4HCC A;  1TKX A;  3VQQ A;  4I7F A;  4CHY A;  4Z4E A;  3SV3 A;  4CGG A;  2F8S A;  4KHW A;  1BCO A;  4IG0 A;  3VQ5 A;  2KZM A;  3LPU A;  1CXU A;  3L8B A;  2VG5 A;  4FJ9 A;  2E6M A;  2VG6 A;  3M8P A;  1ITG A;  1TV6 A;  1TKZ A;  1S1T A;  3CM5 A;  3VQ6 A;  4KHS A;  1TAU A;  1WSE A;  1FK9 A;  2RF2 A;  2F8T A;  3L3V A;  4WE1 A;  3AVL A;  4E1M A;  4DU4 A;  4CFA A;  5J2M A;  2OPP A;  4FJH A;  4QAG A;  3MXI A;  4FLV A;  3SQ0 A;  3T1A A;  1DTQ A;  3JSM A;  4DSJ A;  3DOL A;  1NJY A;  5HLF A;  1Q9X A;  1JLC A;  3AA5 X;  1SKW A;  4DLE A;  1N5Y A;  3KTQ A;  3KKS A;  4KHU A;  2G8K A;  1IKW A;  2PYL A;  4AHV A;  4CJP A;  3RRH A;  3OYD A;  4AHS A;  2Z1H A;  4B9M A;  1VSD A;  1U49 A;  4CGI A;  3OYA A;  4LD0 A;  4CJT A;  4PY5 A;  1RBT A;  4CGJ A;  2Q3S A;  5EU7 A;  1VSJ A;  2OPR A;  4CF2 A;  3NGI A;  1KFS A;  4J2D A;  2G8W A;  4FJ7 A;  4ID1 A;  1W9H A;  1TKD A;  2FBX A;  2IAJ A;  4Z4I A;  4JLH A;  1LWC A;  1QQC A;  3E01 A;  4M3X A;  4CJV A;  1NJZ A;  4PWD A;  4CJR A;  1S1W A;  4E89 A;  2G8F A;  2E6L A;  1KCF A;  2HHX A;  4CEE A;  1WSI A;  1RDD A;  3KLI A;  1A5X A;  3DMJ A;  1HJR A;  3NF9 A;  4IFV A;  3VQP A;  3ZSX A;  4Q5V A;  4DTR A;  1RT3 A;  4XIU A;  3U3Y A;  3TAB A;  3ZT2 A;  3B6P A;  3V9W A;  3QLH A;  2ZE2 A;  3NGY A;  4MFB A;  4BDZ A;  3WNE A;  4QCL A;  4CCH A;  4ELU A;  2HW3 A;  3A2F A;  3SUN A;  4EZ9 A;  3HO1 A;  3CFR A;  4Z0U A;  4J2A A;  3S3O A;  2HVI A;  4M3W A;  3HJF A;  4CF9 A;  3D0P A;  1VSF A;  2EHG A;  2KQ2 A;  4KKO A;  4DTO A;  3SUQ A;  2GV9 A;  3AVI A;  3IS9 A;  3DLR A;  3KKR A;  3ZCM A;  4JS4 A;  2VWK A;  3KJV A;  4CJK A;  4KAZ A;  3KK3 A;  3LAK A;  4KTW A;  1NJW A;  4CER A;  4W5T A;  1NK0 A;  1L3T A;  1K6Y A;  4BE0 A;  4DSL A;  3QEW A;  3RMB A;  4CF0 A;  1XWL A;  4M3Z A;  2P1J A;  1TK5 A;  4TSX A;  1ZBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...