1ZBFA

Crystal structure of b. halodurans rnase h catalytic domain mutant d132n
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
132
structure length
132
Chain Sequence
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ribonuclease H-related protein
publication title Crystal Structures of RNase H Bound to an RNA/DNA Hybrid: Substrate Specificity and Metal-Dependent Catalysis.
pubmed doi rcsb
source organism Bacillus halodurans
total genus 41
structure length 132
sequence length 132
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1zbfA00
1HRHA 4FJGA 4NCBA 4B9UA 3TAEA 1S1WA 1NK4A 3WNFA 1FKOA 2YNIA 3O4NA 4CJUA 3AV9A 3ZT0A 4K8XA 1KFSA 3TAMA 1TL3A 1EXQA 2XRIA 4O0IA 3RRHA 3ALYA 1L3TA 4ICLA 4LY7A 4CK3A 3OYLA 3SI6A 3LWMA 3AO5A 2F96A 3PX0A 1WSFA 4KV8A 4RW8A 1GOBA 4ID1A 5CZ1A 3KLEA 5HROA 1IO2A 3P83D 3EYZA 4PA1A 4RW7A 5SZTA 1TK0A 4PWDA 5DK5A 3QLHA 1ASWA 2YV0X 3TI0A 4KTWA 4ELUA 1REVA 2FBYA 4Y1CA 3RMAA 3ITHA 4PY5A 2RPIA 4J2BA 2HHWA 5FDLA 4AH9A 2GUIA 5EU7A 3C6TA 4H4OA 4FZZA 1IKXA 1JXEA 4CJFA 4WE1A 4DFMA 1BI4B 3RTVA 4Z0UA 4YFUA 1KVCA 1RBRA 5J2PA 3HP6A 1NKCA 1Z25A 4FW2A 2EHGA 3KLFA 3SUNA 1VK0A 4FJLA 3HK2A 3HSTB 2Y1IA 4Z4IA 4JS5A 2ITGA 1HQEA 3S3OA 3H08A 3QNOA 1SV5A 1WSJA 2G8IA 4QAGA 5J2QA 4E1MA 2ATQA 2HMIA 2RKIA 1S9GA 4O55A 4CHPA 1HNIA 4OKJA 3LAMA 2BE2A 3IRXA 3IS9A 3WNGA 1RT7A 2Z1IA 3SZ2A 4E7HA 4Q0BA 2HNZA 2G8VA 1HYVA 1S1VA 4M45A 4M41A 4RG8A 3V9ZA 1S6PA 5J2MA 2RN2A 2D0CA 1JLCA 1IH7A 1QHTA 1MU2A 1ZYQA 1ZBUA 5KRTA 1X1PA 4AHRA 2XHBA 4GW6A 1LV5A 3NGZA 1J54A 2DFHA 3LP3A 4CJTA 3T19A 1IKWA 1UAXA 3HXMA 1L5UA 3HPGA 1RT1A 3KLHA 1XC9A 3VA3A 4ELTA 4CGDA 3HM9A 1YTUA 2KZZA 3FFIA 4Y1DA 4UQGA 2LSNA 4CEEA 4IKFA 4CJ5A 3L2WA 3OYDA 1U45A 4CHNA 3M8QA 3ZSWA 4BE0A 1D8YA 1VSIA 4JS4A 1S1TA 3CYMA 4ZTFA 3HP9A 3HVRA 4C8OA 4KRFA 2KFNA 1KVAA 4H8KA 3KLIA 4FK2A 1B92A 5C25A 3VQ6A 4JLHA 1JL2A 1WNSA 1ASUA 4CJKA 2HHQA 4AHSA 3ZT4A 1VSDA 3O4QA 1A5XA 1VRUA 2HVIA 1J9AA 4HHTA 2QXFA 3SUPA 3M8SA 3RRGA 3SPYA 1RBUA 4RW9A 4Z4HA 3SJJA 3CQ8A 4KAZA 2E6LA 3S3NA 1RNHA 4MFBA 3LWLA 3MXMA 1U48A 1NK9A 4FJHA 2HHVA 1CLQA 3EY1A 2A1RA 1HNVA 4AHCA 4CHZA 4CF9A 3QNNA 3CM6A 1HMVA 2X74A 2YNHA 1HQUA 4CJPA 2Z1GA 3JYTA 3SYZA 4CJVA 1WN7A 3ZT3A 1NJYA 2BGGA 4BDZA 3AA2A 1C0MA 2JLEA 5HRNA 1JLFA 1C0UA 1LWEA 3AO3A 4M3ZA 3TR8A 3NHGA 2IDOA 1S1XA 1FK9A 3ZSZA 3SPZA 2XY8A 1J5OA 4CEOA 2DTUA 4DWIA 4B8CA 2E4LA 3NE6A 1RDCA 4FLUA 2IC3A 3C6UA 2OZMA 1TAUA 4BWMA 4CK2A 1EETA 3MECA 3MEEA 4CGHA 3D0PA 4AHVA 4DLGA 4FJJA 1VSLA 3NH0A 3O3GA 4KO0A 3NBPA 3RMBA 1BHLA 4CJQA 2VG5A 4KHUA 3WNHA 3AO4A 1X9MA 2G8KA 2DFFA 4FJXA 4CF1A 2HW3A 4FCYA 2HHUA 3ZSRA 2G8HA 3BDPA 3QEXA 3G10A 4DFJA 4CJWA 4FJ9A 3NDKA 1HPZA 1NKEA 2HHXA 3CG7A 3MXIA 4NCAA 4KB1A 3TABA 4KB0A 2XY7A 4FLTA 4CFDA 3OYBA 3E01A 1C1AA 4O4GA 3WNEA 3OJUA 2IAJA 1QE1A 4OVLA 4DS4A 4AHUA 5KGXA 3OYAA 4BE2A 4N41A 2X6SA 3P5JA 3I8DA 3TARA 1EX4A 3G0ZA 2FBXA 3RMDA 4ZTJA 1BI4A 4FJIA 2KZMA 1LW0A 3HT3A 3OS2A 1NK0A 1RTJA 3HJFA 3V1RA 3QEIA 1UA0A 2IOCA 3ZSQA 5C42A 1JKHA 3B6OA 4IBNA 1XHZA 3UIQA 4B9TA 4DLEA 3K5NA 3CFPA 1RDAA 1LW2A 3QIOA 1VSMA 1ZBFA 3VN5A 3A2FA 3AVNA 1N5YA 1KSPA 4KHYA 3B6PA 3OYKA 1Q8IA 2ZD1A 4ZHRA 3LALA 1ASVA 3ZT1A 4CFCA 4AILC 3QEVA 1TK8A 1TKZA 1YVUA 4F2SA 3KTQA 1TV6A 1LWCA 5J2NA 1QSYA 4FW1A 2RF2A 4M3RA 4DTOA 4KHSA 1UWBA 4W5RA 4HVJA 3KD5E 4E7JA 4CE9A 4CHYA 3OYFA 3KJVA 4DU4A 3PX4A 3IAYA 3VQ5A 3V6DA 4CJEA 5FRMA 2QKBA 1QS4A 2IGIA 4C8LA 4BWJA 4B9SA 3TANA 4BE1A 4CJ3A 3PX6A 4W5NA 2O4GA 3L2RA 3QO9A 1Y97A 4CHQA 3DOKA 3TAQA 4HCCA 4AHTA 2HVHA 1CZ9A 2WOMA 3K2PA 5FROA 5HRSA 3TWHA 4EP4A 4DF4A 4FJMA 1BISA 4KI6A 1WSIA 5CYQA 4LSNA 4FM1A 3HVTA 1WAFA 1LWFA 2D0AA 4CEZA 4LH5A 3RMCA 5JS1A 2YNGA 4OJRA 3U6FA 2BDPA 4O0JA 4CGGA 4DSKA 1J53A 1BL3A 2Z1JA 3LPUA 4RW4A 4GMJB 4DSIA 4J2AA 4M3UA 4O44A 1NJZA 3THVA 2VWKA 3DI6A 5I42A 3ZSOA 1KVBA 3NF6A 4KKOA 3HPOA 3LZJA 4HTUA 4B9NA 3AVCA 3V9UA 2OPRA 1L3SA 3U3YA 3SQ4A 1KCFA 4KPYA 1RT6A 4KHWA 4F8RA 4FK0A 1GOAA 2BANA 3DLGA 1CXQA 4J2DA 3S3MA 5D3GA 1U04A 1TAQA 1VSKA 4FLXA 1NK8A 1BCMA 4FZYA 4LD0A 5KI6A 3ZSYA 4CHOA 4E3SA 4DMNA 4I2QA 3OYIA 1WSGA 1JLQA 4E7KA 1XWLA 3DLHA 4CEDA 3KKSA 2X6NA 2OPSA 1VSFA 4DU3A 3AVJA 4CIGA 5KRSA 4CGIA 3V4IA 2ZE2A 1A5WA 1T8EA 2PYJA 4KREA 1SKRA 1RTDA 3T3FA 1IKVA 1KRPA 4ELVA 1YTAA 1TL1A 1T7PA 2OPQA 4E0DA 2FBVA 2DFEA 4CF0A 4CJSA 2XY5A 3L2UA 4F4KA 1Q9YA 3SV3A 4HCBA 1EP4A 3OYGA 2OPPA 1RDDA 2GV9A 2X78A 3DRSA 4C8MA 1U49A 1BQNA 4QCLA 2KQ2A 4HUGA 4M42A 1NK6A 3T1AA 1S1UA 3VQPA 4FM0A 4IG0A 1X9SA 3AVAA 3OVNA 1O1WA 1RT3A 5HRRA 3V9XA 5CZ2A 1RBSA 2G8UA 4J2EA 2KW4A 1SL0A 3V1QA 5DMRA 4IG3A 3QERA 3TAPA 3AVKA 4DFPA 1NJWA 1JLAA 2HB5A 3L3VA 3AVHA 2F8TA 5KTQA 2YHBA 2R7YA 4JRQA 1BGXT 1R0AA 1FXXA 4OPJA 4FLZA 4CECA 3CM5A 1KLNA 2FC0A 3OYJA 4DFKA 1JXBA 5JS2A 3QETA 1RDBA 4HUEA 2PY5A 1NJXA 4M3XA 3VQDA 1IG9A 2B4JA 1TVRA 1QQCA 1D9DA 4N56A 4OLBA 3KK1A 4CK1A 1W0HA 3P1GA 4CGFA 3HL8A 1TK5A 3RR8A 3RWUA 3OYMA 4M3YA 4B9VA 3ISNC 3LANA 3NF7A 2YKNA 1DLOA 4MQ3A 3OJSA 4DTUA 4CJLA 4N47A 4PUOA 1D5AA 2JGUA 3VQ8A 1QSSA 2XY6A 1DTQA 4RW6A 3AVBA 3AVIA 2KTQA 1ZBLA 2D0BA 1C1CA 1S6QA 4IFYA 3BGRA 3SV4A 4E7LA 1UA1A 2ZQBA 3LAKA 3VQEA 3HYFA 2VG6A 3V9WA 2GBZA 1U4BA 1NK5A 4DU1A 2G8FA 5HBMA 1DTTA 3HPHA 4CF2A 3LZIA 1NK7A 4PQUA 4IFVA 1A5VA 3NF9A 1B9DA 4LSLA 3M8RA 4I9QA 3ASMA 2QKKA 4M3TA 3AVMA 3L3UA 4DS5A 3DLEA 4EZ6A 3F73A 4CFAA 4FLVA 3HO1A 3V1OA 4W5QA 1F21A 1JL1A 1T03A 3V81A 1TKDA 3SCXA 4B8AB 3SQ0A 3QESA 4BACA 1SKSA 3DM2A 4FJ5A 3AVGA 3OYCA 3JSMA 1C0TA 1CXUA 1RILA 4FZXC 3AVLA 1G15A 3K58A 1EKEA 1XHXA 4M3WA 4DTNA 3O3HA 4CGJA 1BQMA 3AA5X 3MXJA 3C94A 4EP5A 1C1BA 1SL2A 1S5JA 2HNYA 1X9WA 1VSHA 4CIFA 3OS0A 2QK9A 3ULDA 4NYNA 1B9FA 2P51A 1JLGA 4F3TA 2WONA 5I3UA 1I39A 3LPTA 4NCGA 4FM2A 3L8BA 3DYAA 4DQQA 3AO2A 3TAFA 1NOYA 3CFOA 3NCIA 4FJKA 1K6YA 4GVMA 1RTHA 4I9LA 1WSEA 1SUQA 1L3VA 4DTRA 3OY9A 4C8KA 3VQQA 1I3AA 1SKWA 1VSEA 4KHNA 4IDKA 3L2VA 4K8ZA 3DLRA 3ZSVA 4Z4GA 1JLEA 1CZBA 1Z26A 1VRTA 3NAEA 3OYEA 3PV8A 4CERA 1XI1A 5HRPA 4CEAA 2IS3A 4W5OA 3U3GA 1UOCA 4CEFA 3KIOA 4F2RA 3CFRA 3ZCMA 3L2QA 1RTIA 4B9MA 1VSJA 3VQ9A 4JRPA 2A1SA 3VA0A 2Y1JA 3NGIA 4TSXA 2FBTA 3C95A 4OPKA 4DTXA 4DSFA 4FXDA 3QEPA 1W9HA 3KKRA 1LAWA 3DRRA 3NH1A 2G8WA 2NUBA 3S9HA 1TKXA 3D45A 4I2PA 2ETJA 3KLGA 2VWJA 4DSJA 2HHTA 1LAVA 3DRPA 4CIEA 2EX3A 4DTSA 3LP1A 4B3OA 3ZT2A 3KD1E 5HLFA 3K5MA 4FK4A 4OGEA 4CESA 4N76A 3NGYA 3VQ7A 4FYDA 4HUFA 5HP1A 2OYQA 2B5JA 1KTQA 1RBTA 4KTQA 3PY8A 4FJ7A 3MEDA 3QIPA 4CCHA 3SUOA 2VG7A 4DQIA 3F9KA 1IKYA 2OZSA 2PYLA 1NKBA 1QTMA 4BDYA 2P1JA 4CF8A 1RT5A 2P5OA 2O4IA 4DQRA 4Z4CA 4CFBA 3KK3A 3DLBA 4QOZB 1FKPA 3SNNA 1N6QA 4NYFA 3K5OA 3I0RA 1HYSA 3LP2A 3I0SA 1D9FA 1ITGA 2E6MA 2PZSA 1WAJA 2F8SA 4BDPA 4DTPA 5FRNA 5K14A 4YNQA 4W5TA 4E89A 4DSEA 2YNFA 3OYHA 4CJ4A 2OA8A 3M8PA 3ZSXA 1GOCA 2XO7A 4FLYA 1TKTA 1L3UA 4E19A 3QEWA 4DSLA 4OGCA 4DQSA 4EZ9A 1HYZA 3AA4A 1RBVA 5KGWA 3K57A 4OKEA 4F3OA 1SL1A 3SUQA 4FJNA 1S9EA 4KHQA 2D5RA 4B9LA 1ZBIA 3MAQA 2Q3SA 4CEQA 3AVFA 3LDSA 3PUFA 4DTJA 4DTMA 1YT3A 5E41A 2P5GA 5SWMA 4L8RB 4R5PA 4O5BA 1U47A 4DQPA 3OS1A 3VQCA 5J1EA 4LH4A 3MEGA 4Q5VA 3DMJA 5C24A 3EZ5A 1WLJA 4KI4A 3IG1A 1Q9XA 1BIZA 3O3FA 4Z4FA 4N5SA 1QSLA 3PO5A 3RR7A 1TGOA 1HJRA 4DF8A 4C8NA 5T7BA 4H4MA 4CEBA 5CYMA 2W42A 4OKKA 2Z1HA 3KK2A 2HHSA 3DLKA 3K5LA 4E7IA 1KFDA 4FLWA 3NF8A 4FJ8A 1C6VA 3LP0A 3QINA 2I5JA 4I7FA 4XIUA 3SQ2A 2KFZA 1BCOA 1NOZA 4CJRA 3NH2A 1WSHA 1JLBA 3AO1A 3VQAA 4KFBA 1ZBHA 3V9SA 4FVMA 3OYNA 4OLAA 4G1QA 3NFAA 3TAGA 3PO4A 3K59A 3VQBA 2DY4A 1BIUA 4B08A 4KTZA 4DG1A 2HNDA 1T05A 1RT2A 2YKMA 2YHAA 3AA3A 1KLMA 3DOLA 4ID5A 4Z4EA 5CY4A 1RT4A 1RCHA 2AJQA 3SQ1A 3VQ4A 4E1NA 2B6AA
chains in the Genus database with same CATH superfamily
4NCBA 2HF3A 3HI0A 4Y0WA 1GLAG 4DV5K 1YJNN 2P9LB 3UKUB 4LY7A 2FSKA 4YY3K 3U9DA 4B1ZA 1GOBA 3KLEA 5GADP 5HROA 3P83D 3SBTA 3EYZA 5SZTA 1ASWA 4KTWA 4Y1CA 3RMAA 2O8DB 3ITHA 5AQSA 4AH9A 2GUIA 5EU7A 3DXKA 4DHYA 1JXEA 2QXLA 1RBRA 3HP6A 1GLCG 1VK0A 3HK2A 2Y1IA 3AAQA 1W7AA 2ZJPL 1T6CA 4ILGB 5JLFA 1WSJA 2G8IA 4QAGA 3H1QA 5J2QA 2RKIA 1S9GA 4CHPA 5CHIA 4OKJA 2BE2A 3IS9A 3WNGA 4ILJA 5JVGL 2G8VA 5AQLA 1VQ9N 1S6PA 3BZCA 2RN2A 3BEXA 3ZETB 4OX9K 1QHTA 2FF3B 3TSPA 2HSTA 4JI3K 1X1PA 4GW6A 3QMLA 3MDQA 3LP3A 4CJTA 3T19A 1IKWA 1RT1A 1XC9A 3VA3A 4R79A 2KZZA 3FFIA 2LSNA 4CEEA 2CH6A 4CJ5A 1U45A 4CHNA 2O8FA 3FE1A 1N34K 1KD1O 1D8YA 4JS4A 4CZIA 5AQZA 3CYMA 1ESVA 1KVAA 3N4QA 3VENA 4M7YA 2YX6A 3WXLA 3ATVA 3SLCA 1A5XA 2HVIA 1J9AA 1RBUA 4RW9A 4MFBA 1CLQA 4O8UA 3BF3A 4QS8A 1HNVA 4AHCA 4M3TA 2X74A 2BGGA 1NJYA 4CJVA 1JLFA 3PSFA 1C0UA 3MX5A 3AO3A 2UXBK 1S1XA 3SAFA 2XY8A 1RDCA 1TAUA 4BWMA 4DLGA 4FJJA 2ITMA 1VSLA 4JKBA 1BHLA 3CCQN 2G8KA 4IEIA 3BZKA 4A2BA 4BRPA 2HW3A 3ZSRA 4CJWA 1HPZA 2HHXA 4JKFA 4FLTA 4H0YB 4IEEA 3OYBA 3WQTA 2O8DA 1GLLO 1TUYA 4FPAA 3I8DA 3TTFA 2NRTA 3J8AA 3RMDA 1M1KO 3V1RA 2FLOA 2IOCA 5C42A 1JKHA 1E3MA 1YUWA 4IBNA 2P9PB 4L3QA 4DLEA 3CFPA 5AQIA 2E2QA 1IBMK 3C65A 3OYKA 3HRGA 1Q8IA 4DV4K 3ZT1A 4CFCA 1TK8A 1TKZA 2H3GX 3CJBA 4F2SA 1T6DA 1LWCA 5AQUA 4M3RA 3ZETA 4PKIA 4DTOA 4W5RA 4HVJA 3KD5E 4E7JA 1J6ZA 3OYFA 3KJVA 1T3VA 4CJEA 2ASOA 2QKBA 4BWJA 2HBKA 4W5NA 2HMPA 3L2RA 4CHQA 3K9KA 1HX1A 2WOMA 3K2PA 1XQSC 3L4IA 3HVTA 2D0AA 4CEZA 1EWRA 2YNGA 5F1XA 4DSKA 2E88A 1NJZA 1U49A 2VWKA 3DI6A 5I42A 3LZJA 4KKOA 4B9NA 3AVCA 3V9UA 2OPRA 1L3SA 4DUZK 1RT6A 2BANA 1CXQA 1Z6RA 2Q0UA 3S3MA 4FLXA 1BCMA 4FZYA 4CHOA 4DMNA 4I2QA 3OYIA 4E7KA 1XWLA 3KKSA 3A5MC 3AVJA 4CGIA 3V4IA 1SKRA 1E4GT 5AZIB 1SZ2A 2DFEA 4YOXA 5AQGA 5A2QO 4F4KA 3C6AA 4HCBA 4Z94A 1EP4A 2OTJN 2OPPA 2X78A 4LF8K 4QCLA 2OTLN 1BOTO 4M42A 1YITN 3MK6A 4B1YB 1S1UA 5JVHL 3CMEN 1X9SA 4JHDB 4J2EA 2YI1A 3T1YK 4IG3A 1NJWA 1E4FT 3CCVN 1R0AA 2UUBK 1FXXA 4OPJA 2IVNA 1HKGA 3FZKA 3HTVA 5AQPA 1NJXA 5KPZA 3VQDA 5M1OA 1QQCA 3K0SA 4N56A 3VGLA 2WFBA 1W97L 4CK1A 2P9PA 4CGFA 1I94K 3RR8A 3OYMA 4B9VA 2A3ZA 3ISNC 3OJSA 4DTUA 4JI1K 1V4SA 1X3NA 1DTQA 4RW6A 3UKRB 4JV5K 1S6QA 2QM1A 1UA1A 3VQEA 1NK5A 3TU5A 4DU1A 2G8FA 1NGFA 3EKUA 3HPHA 3ASMA 1BWFO 5JMVA 3F73A 4FLVA 2E1ZA 3MWTA 1TKDA 4V19S 4BC2A 3SCXA 3QESA 3AVGA 3JSMA 2P9SB 1RILA 3F2KA 4CBWA 1T44A 3C6HA 5FPNA 4M3WA 1Q7YO 4FOEA 2HNYA 4BRKA 3J7AP 1B9FA 2P51A 1MWMA 3LPTA 4DQQA 3DYAA 3VEOA 3DWLA 1GLFO 1K6YA 2JWKA 4GVMA 1VQPN 1QVGM 1L3VA 3OW2M 1SKWA 1VSEA 1BUPA 4K8ZA 3DLRA 4JI7K 2GUPA 1JLEA 3CJ7A 3PLAA 5AZIA 4BVOA 1XI1A 2IS3A 4W5OA 3U3GA 1S22A 3KIOA 4FVUA 3CFRA 4B9MA 1H1VA 1VSJA 3VQ9A 4JRPA 2Y1JA 2UXCK 4TSXA 2FBTA 1M90O 4DSFA 1W9HA 1LAWA 3DRRA 3Q7CA 4JKDA 3NH1A 4BR2A 3CF5L 2ETJA 3AGRA 1WBDA 5TKWA 4JHDA 3DRPA 4CIEA 4DTSA 4B3OA 3KVGA 2UXDK 4OGEA 4N76A 4FYDA 4HUFA 1KTQA 5KPRA 4FJ7A 3MEDA 3UE5A 3QIPA 3SUOA 4JAXA 3SBGA 3D2EA 1BG3A 1QTMA 2VYPA 2P1JA 2F9WA 3H3NO 4CF8A 1RT5A 2P5OA 2V52B 4QOZB 4CFBA 3DLBA 3VERA 3SNNA 1D9FA 1WAJA 2QW9A 3OYHA 3M8PA 3ZSXA 1GOCA 4E19A 4RCHA 4DQSA 3MX2A 1HYZA 3AA4A 5EOYA 4CZFA 3CCSN 2ZGYA 3QDKA 4FJNA 4KHQA 2GELA 1HJOA 3MAQA 3ENOA 3H3OB 4B1VA 4L8RB 5SWMA 5BR9A 4O5BA 3QBXA 5J1EA 1R59O 4LH4A 4IOAL 2RE2A 4XEIA 4WQ4C 4CZKA 1BU6O 4Z4FA 4N5SA 3C7NB 3PO5A 3A5NC 3VEWA 1K9MO 4DF8A 4H4MA 4OKKA 1KQSM 4MDBA 4MO5A 3K5LA 1NMNA 3D2FB 3DJCA 3NMUA 1JCGA 1BCOA 3MN9A 3A0IX 4DR7K 4EHUA 3O4WA 1XNRK 3OYNA 4DCHA 3TAGA 3O5BA 4DR1K 3O9TA 3OTOK 3K59A 4KTZA 2YHAA 3DOLA 3EKSA 2AJQA 2IIRA 2E8AA 4C1NI 1HRHA 1IV0A 3WNFA 4CJUA 3ZT0A 4K8XA 3CPWM 2D4WA 3E66A 3SI6A 3T7ZA 3L4QA 3LWMA 2F96A 1VQMN 4KV8A 1GLEG 5CZ1A 3ZYYX 3P4IA 4PWDA 4A5BA 5AQNA 2O8CB 4NXMK 2O8EA 2RPIA 4J2BA 2E2OA 4H4OA 1N33K 3O08A 4BRDA 1QZ6A 3RTVA 4YFUA 1KVCA 4H03B 5AQKA 4LF4K 1YXQA 3KLFA 4MDAA 2NZTA 4JS5A 2FXUA 4RWTA 1SV5A 2HMIA 1HNIA 3LAMA 4E7HA 3D6RA 4M41A 4RG8A 1JLCA 1IH7A 4GY2B 1SS6A 1VQ5N 3ZEUA 2XHBA 1LV5A 3NGZA 1J54A 2DFHA 2QWLA 1IJJA 1MDUB 3HPGA 1YTUA 4CGDA 3HM9A 3VEVA 4JI0K 3THWB 3L2WA 3ZSWA 5BRDA 4BE0A 4BR5A 1HR0K 1S1TA 3C7NA 4ZTFA 3HP9A 3HVRA 4KRFA 4FWPA 5AQXA 1EQYA 3KLIA 4DR4K 4WQ5C 1WNSA 4CJKA 3MWPA 3QFPA 4CJ7A 3O4QA 3FR0A 4H0VB 1DEJA 1VRUA 3D2FA 4BGBA 3GG4A 2BTFA 3S3NA 3MXMA 1U48A 4LF5K 1NGIA 1BA0A 5BPNA 2YNHA 1C0GA 4FWKA 4H5RA 3ZT3A 3CIPA 4J8FA 2O8FB 1C0MA 4M3ZA 3HSCA 1EWQA 2GWJA 1WOQA 1J5OA 1V4TA 5C2DA 5AQOA 2E4LA 3O8MA 5F2RA 3GL1A 4FLUA 3EL2A 3C6UA 1OH5A 1EETA 3MEEA 3D0PA 2YHYA 1NBWA 3ATUA 4KO0A 4CJQA 4KHUA 3WNHA 2DFFA 4LC9B 5GIPA 4XH5A 3PSIA 1HUXA 3QEXA 3G25A 1N32K 4DFJA 4AM6A 1VQLN 3M6GA 3R8EA 1NKEA 3MXIA 5FLXO 2XY7A 3E01A 4O4GA 3WNEA 2IAJA 4OVLA 5BRFA 2KZMA 3ENBA 2KHOA 3ZSQA 3B6OA 1XHZA 4B9TA 5AR0A 3PIPL 3K5NA 4JI8K 1JCEA 3QIOA 1ZBFA 3VN5A 3AVNA 1N5YA 3CQXA 3B6PA 3L0QA 4YOUA 4WFBL 2YCHA 4JK9A 2RF2A 3VTHA 4KHSA 3O6WA 2Q0RA 4CHYA 2J4RA 3PX4A 3SK3A 3TTCA 4B1WB 5ADXA 2IGIA 4C8LA 4B9SA 3PX6A 3THWA 3SAHA 3QO9A 4AHTA 2QWQA 1CZ9A 5FROA 4FPBA 4E1JA 4EP4A 4BREA 1WAFA 4CZHA 3CC2N 3U6FA 2BDPA 4O0JA 4CGGA 1J53A 1BL3A 2VQFK 4GMJB 4DSIA 4J2AA 4O44A 1WUAA 2W40A 3NF6A 2EWSA 3HPOA 1NU0A 1GOAA 2QTDA 5BPMA 4AM7A 3CD6N 1NK8A 1VQNN 1NM1A 1JLQA 2X6NA 2OPSA 1NGGA 1VSFA 4WQ4A 5AJ3K 4KREA 1A5WA 1RTDA 3T3FA 4ELVA 1HLUA 3UB5A 2OPQA 4CJSA 4CF0A 1GLDG 3G6EN 3L2UA 3B8AX 1KC8O 1RDDA 3DRSA 3GE1A 1VQ6N 1BQNA 2KQ2A 4HUGA 5EXWA 3O9SA 1NK6A 4YHHK 3VQPA 4DWIA 5CZ2A 2G8UA 3E9PA 2KW4A 1SL0A 2QWPA 5M1PA 3WXMB 3TAPA 4K43A 2HB5A 3L3VA 5KTQA 1Z05A 2R7YA 4JRQA 1BGXT 4FLZA 2JWLA 2BUPA 1NLVA 1JXBA 3MMVA 1RDBA 2PY5A 1IG9A 4LF7K 5AQYA 3KK1A 3P1GA 1TK5A 3RWUA 4JKGB 3VMFB 5AFUA 3NF7A 1DLOA 4N47A 1D5AA 4K41A 3H45C 1OH8A 3AVIA 2KTQA 3FZLA 2ZQBA 3LAKA 2GBZA 2YHWA 2UU9K 4MLHA 1NK7A 2WUSA 3I55N 4IFVA 1A5VA 3M8RA 4LSLA 1IBLK 1XMQK 1Q86O 4CFAA 5GINA 3HO1A 3JXUA 3CJAA 3SQ0A 3DM2A 1VQON 3AVLA 3JAMO 1VQ8N 4IJAA 2WBNA 3M3ZA 1EKEA 1YI2N 3O3HA 2I7PA 1BQMA 4CGJA 3MXJA 4EP5A 4NO7A 3U9ZA 3ID6A 3AGKA 1X9WA 4CIFA 5AQRA 3ULDA 3NVKA 3KWGA 5AQJA 1I39A 4HWIA 4NCGA 4BRAA 5EX5A 1OVYA 1GLJO 1WSEA 3J81O 1I3AA 4KHNA 3L2VA 1GLBG 1CZBA 1Z26A 1VRTA 3NAEA 3OYEA 3PV8A 4FWOA 4O5FA 1ZBSA 3SMPA 4F2RA 4H5NA 1ATRA 3CCEN 4BRCA 3DLLL 3NGIA 4OPKA 3C95A 4DTXA 3GDQA 4FXDA 1NG9A 2NUBA 1TKXA 3D45A 4I2PA 3KLGA 2VWJA 4DV7K 4DSJA 3H6EA 2Q31A 3LDOA 3FZHA 3LDPA 3ZT2A 3H46O 3KD1E 5HLFA 3K5MA 4FK4A 3J7YP 1P90A 2QWOA 3THYB 1RBTA 4KTQA 3PY8A 2Q36A 2GEMA 2VG7A 4DQIA 3F9KA 3CJ1A 3ZX3A 1IKYA 2OZSA 1S3XA 2VGNA 1VQ7N 3QICA 3LM9A 4BC3A 1Y64A 1FKPA 4NYFA 4JKGA 1HYSA 4XH4A 1ITGA 2E6MA 2PZSA 4BDPA 4W5TA 4E89A 4U67L 1SAZA 4FLYA 2CH5A 3QEWA 1RBVA 4F3OA 4C23A 4BGAA 3MN6A 3SUQA 1S9EA 4WFAL 3AVFA 3D2EB 3PUFA 4DTJA 5E41A 1U47A 3VF4A 2WC9A 4BR0A 3VQCA 4BRQA 3OS1A 1VAZA 3HOTA 5AQWA 1U6ZA 4Q5VA 5C24A 4BRLA 1Q9XA 4YOYA 1BIZA 3EE8A 3IMXA 1QSLA 1K8KB 1HJRA 2A42A 4C8NA 1D4XA 2I7NA 1XMOK 3CETA 3HOSA 2HHSA 3DLKA 3O80A 3QINA 2I5JA 1QQOA 4BRNA 4DR2K 4I7FA 1WSHA 2KLAA 3R9PA 4DV0K 4G1QA 2DY4A 1BIUA 4Z4EA 4ID5A 4CZMA 3TAEA 4F9OA 1FKOA 2YNIA 3O4NA 1KFSA 4M7XA 1KAZA 4CBUA 1L3TA 1ZXOA 3OYLA 2FSJA 3K9JA 1JJ2M 5BRHA 5M1FA 1OH6A 3J7ZO 4RW8A 4ID1A 1CZAN 3CPEA 5H1SQ 1IO2A 4OO1J 4PA1A 1TK0A 3QLHA 3E1YA 3GOIA 2DPNA 4ELUA 2FBYA 5KQDA 5FDLA 1TYQB 3THYA 2Q97A 4JKHA 4FZZA 1IKXA 3SAGA 1BI4B 5J2PA 3NVMA 3SUNA 4FJLA 4Z4IA 3RSEB 3H08A 3WUHA 4O55A 2W41A 3TTDA 3WEEB 3IRXA 3WXKA 2YHXA 2O8EB 4IO9L 1S1VA 2HHHK 3V9ZA 5J2MA 4AQYK 1ZYQA 5HOOA 2AP1A 4GNIA 1NGJA 3P39A 3VGMA 1L5UA 1UAXA 3KLHA 1K8AO 4M63C 2ZF5O 3IUCA 4IO8A 1W2BM 3OYDA 4LFAK 1K8KA 4JI4K 5KQ8A 2KFNA 4FK2A 1B92A 3ZX0A 3S41A 5C25A 4AHSA 1VSDA 4CZJA 3QFUA 2P9IA 4HHTA 3RRGA 3SPYA 4Z4HA 4DV3K 3G4SN 3ZEUB 3CQ8A 3CMAN 4FJHA 4X65K 3LWLA 2D0PA 1NK9A 1N8RO 5AQFA 4CHZA 4CF9A 1YHQN 4H0OA 3CM6A 3QNNA 3SJJA 5TKYA 1HQUA 4CJPA 4XH1A 4MLEA 3AA2A 5IWAK 3MCAB 4BDZA 1LWEA 2P9UA 3TR8A 2E2PA 3NHGA 2IDOA 4IDHA 3VF2A 1FK9A 3ZSZA 3SPZA 4GV3A 4CEOA 2PAVA 2ZWHA 3NE6A 5E26A 3Q7BA 2PBDA 2OZMA 4CK2A 1U2VB 3MECA 4CGHA 3NBPA 3HM8A 3AO4A 3H1VX 1J5EK 4FJXA 4B3MK 4FCYA 2HHUA 4K0KK 2G8HA 3BDPA 1NGAA 3G10A 3DAWA 3HBTA 4B9QA 4FSVA 4FJ9A 2F4VK 5C15A 1FW6A 4KB0A 5IT9O 4CFDA 1C1AA 5AQHA 4DS4A 1TYQA 3F9MA 5KGXA 4BE2A 1NWKA 1S72N 1Q82O 4N41A 3TARA 1EX4A 2FBXA 4ZTJA 1BI4A 4FJIA 4JD2A 1LW0A 3HT3A 2QWNA 4BR9A 5KPTA 3HJFA 3QEIA 1UA0A 5M1NA 5E84A 4X64K 3OHRA 3RSEA 3CQYA 1LW2A 3A2FA 4A61A 4KHYA 5AQMA 2VCPA 4FWNA 2A6AA 3VF6A 3LL3A 3WEEA 3LALA 4PKGA 1YVUA 1LCUA 3KTQA 1TV6A 5J2NA 4FW1A 3MCPA 4JK8A 2E5LK 5GIOA 2NRRA 4PL8A 2ASMA 2WTUA 4DU4A 5FRMA 5BR8K 4EIAA 4CJ3A 4BE1A 2O4GA 2OANA 4HCCA 3TAQA 1YJWN 3MN5A 2HVHA 5HL7L 3TWHA 4YDUC 1BISA 1WSIA 4CI6A 4LSNA 4FM1A 3I8BA 3RMCA 5JS1A 4JKCA 1ATSA 4OJRA 5BREA 3VOVA 3EZWA 4G9ZA 3LPUA 4RW4A 4HTUA 5LJVA 4WYBA 2NRXA 3U3YA 1KCFA 4KPYA 4KHWA 4F8RA 4FK0A 3DLGA 5EY4A 1U04A 4LD0A 4JI2K 3ZSYA 4E3SA 1NNEA 1DKGD 5LL6Z 4CEDA 2ASPA 5KRSA 1NGDA 4JYAK 1XUPO 2ZE2A 1IKVA 1KRPA 1TL1A 4A59A 4E0DA 2FBVA 3CERA 1U2VA 3WQUA 1Q9YA 3FFKB 2ZGZA 3J80O 5ELZA 4ISFA 3T1AA 4FM0A 3CJ9A 4IG0A 3AVAA 4JKAA 1O1WA 5B8HA 3V9XA 4CW7B 2YJFA 4BY9C 3QERA 1YJ9N 5BN9A 3DXMB 4A62A 4CBXA 1JLAA 5C2FA 2A5XA 5GAEP 4CZLA 4B3RK 4DFKA 2E2NA 4IJNA 4HUEA 1WB9A 3SJHA 4M3XA 2B4JA 1TVRA 5LJWA 1D9DA 2E20A 4DV1K 1W0HA 3EE9A 5BN8A 4H5VA 3LANA 4EAHD 4PUOA 4IFEA 4NB4A 4H0XB 1HKCA 1NGBA 2JGUA 3E9LA 5MLCQ 1BO5O 1QSSA 1RFQA 5AZJA 2VQEK 3M5RA 2YJEA 3VTIA 3AVBA 4CD3A 4IOCL 1ZBLA 2D0BA 1VQKN 1C1CA 4FL9A 4IFYA 3BGRA 3L6QA 3HYFA 3V9WA 1U4BA 5HBMA 3P31A 1Q81O 4CF2A 4U7BA 1LOTB 4PQUA 3NF9A 4DQ8A 4DS5A 3L3UA 1TUUA 3DLEA 4BRGA 4W5QA 1RDUA 4YOVA 1F21A 1T03A 3KWIA 3V81A 1X9JA 1VHXA 4BACA 4FJ5A 5AQVA 1CXUA 2V7ZA 4FWLA 4ISEA 1RDWX 4GKKK 2GTDA 4KHPK 4PKHA 1BA1A 2V51B 1SL2A 1C1BA 1S5JA 1VSHA 3OS0A 4K42A 2QI2A 1QQNA 4FO0A 5AQTA 2CGLA 4FM2A 3L8BA 3AO2A 3TAFA 1NOYA 3CFOA 3NCIA 4FJKA 1RTHA 4DUYK 3IDHA 3OY9A 4IDKA 5M1QA 3RVCA 4Z4GA 4BRMA 5HRPA 4O8KA 4CEFA 1UOCA 4DR6K 3L2QA 2A1SA 3R1XA 3CCMN 4A57A 2P9NA 2QA4N 3QEPA 3JS6A 2G8WA 3CJCA 3S9HA 2HHTA 1LAVA 2NNWA 3DXMA 4I6MB 4CESA 4DV6K 2OYQA 3O9RA 4OPHA 3VEYA 3ZX2A 4CCHA 4RTFD 3O9UA 3O1BA 1NKBA 4FWSA 1N6QA 3K5OA 3I0RA 3I0SA 4DTPA 4CD1A 5FRNA 5C12A 3CCRN 2YNFA 4CJ4A 1HNXK 1HKBA 5AFUH 4FOIA 4OGCA 5KGWA 1P8ZA 3VGKA 4OKEA 3K57A 1SL1A 2HBLA 2D5RA 4B9LA 1ZBIA 3LDSA 4LFBK 1YT3A 5C10A 4R5PA 4DQPA 3C0BA 2HBJA 3EZ5A 3O3FA 3D7EO 2D1KA 2GX9A 5T7BA 4H0TB 3P38A 2W42A 2Z1HA 2Q1NA 1KFDA 3NF8A 4FJ8A 3LP0A 2HBMA 2P9LA 3CCJN 3UKUA 4C1NK 4XIUA 2KFZA 3NH2A 1JLBA 2FF6A 3AO1A 5FPDA 1IBKK 4X66K 3V9SA 5AQQA 1ZBHA 3VETA 1EO1A 1NGEA 3NFAA 1MA9B 4B1XB 3VQBA 1T05A 2HNDA 1RT2A 2YKMA 3AA3A 1XNQK 1KLMA 4YDUA 1RT4A 4JI6K 1RCHA 4CJFA 4E1NA 2B6AA 4FJGA 2P9KB 1S1WA 1NK4A 2W6LA 3WXJA 3AV9A 2QEXN 4KH4A 3TPQA 3TAMA 1TL3A 1EXQA 2XRIA 4O0IA 3RRHA 3ALYA 5JLHA 4ICLA 4JK7A 4CK3A 2A40A 3AO5A 3PX0A 4NLBA 1WSFA 1OKJA 4RW7A 3IKMA 4JI5K 5DK5A 4UY8O 2YV0X 3TI0A 2NRHA 1REVA 3ENHA 4WCEL 4PY5A 2HHWA 4I6MA 5GAHP 3C6TA 1WBBA 4WQ5A 3VEXA 4WE1A 3F5TA 4DFMA 4Z0UA 2F7TA 1NKCA 1Z25A 4FW2A 2EHGA 3THXB 3HSTB 2ITGA 1HQEA 2BH1A 3S3OA 3QNOA 3CXCM 4E1MA 2ATQA 3QB0A 4AF1A 3R6MA 3SZ2A 1RT7A 2Z1IA 4Q0BA 2HNZA 4EHTA 1ATNA 1HYVA 4M45A 3TSUA 4KH6A 2D0CA 5C0YA 1MU2A 2GWKA 1YAGA 1ZBUA 5KRTA 1OH7A 4ISGA 4AHRA 4H5WA 3HXMA 4ELTA 3WXIA 2VWBA 4Y1DA 4UQGA 4IKFA 3KZBA 3N4PA 2PFUA 3U4LA 3CCLN 3M8QA 3FZMA 1VSIA 4CVNE 4C8OA 3SMSA 3OBYA 4H8KA 4FWRA 1X3MA 4JKEA 4OPAA 3VQ6A 4JLHA 1JL2A 2HHQA 1ASUA 3ZT4A 3LM2A 3SUPA 2QXFA 3M8SA 3EEQA 3U8XA 3T69A 2E6LA 4KAZA 1RNHA 3IFRA 4YOWA 2NRZA 2HHVA 3CC4N 3EY1A 2A1RA 4MO4A 1ILYA 2XY6A 1HMVA 3JYTA 3SYZA 4B3TK 2Z1GA 1WN7A 1QHAA 3CI5A 2JLEA 5HRNA 1JCFA 4JNEA 4WF9L 2NRWA 2DTUA 2P9KA 4FWMA 3I33A 4B8CA 4IXCA 2IC3A 4AHVA 4DKWA 5FPEA 2P9IB 4BR4A 3NH0A 4CZEA 3O3GA 3RMBA 2VG5A 1X9MA 1NJIO 4CF1A 3W0LA 5DM6L 3NDKA 3CG7A 4NLCA 4NCAA 4KB1A 3TABA 4FWQA 2P9UB 2KKZA 4YOTA 3OJUA 4GV9A 1QE1A 4BC5A 2Q2RA 3FLCO 3A5OC 4AHUA 3OYAA 2X6SA 3P5JA 3LDLA 3G0ZA 1VQ4N 3AY9A 3OS2A 1NK0A 1RTJA 3THXA 3UIQA 1RDAA 1VSMA 4BG8A 1KSPA 4YORA 4BVPA 4BG9A 2ZD1A 4ZHRA 4AILC 1ASVA 2QWRA 3AARA 3QEVA 3PIOL 3VESA 3W3DA 4GV6A 4JEPA 1QSYA 1UWBA 4B1UB 3LDQA 4CE9A 1YF5L 3IAYA 4WFNL 3VQ5A 3V6DA 4JD2B 3FZFA 3OA9A 3WT0A 1QS4A 3ULEB 3AAPA 3TANA 2HF4A 3EO3A 1Y97A 3DOKA 3G71N 4KI6A 5HRSA 4FJMA 5LY3A 4DF4A 5CYQA 4DR3K 1LWFA 4LH5A 2Z1JA 5GAGP 2VGMA 4M3UA 1QZ5A 4B9UA 3THVA 3ZSOA 1KVBA 2UUAK 1G99A 3SQ4A 4J2DA 5D3GA 1TAQA 1VSKA 2E1YA 1OVQA 5KI6A 3VEZA 1NGCA 3DLHA 1WSGA 4DU3A 4CIGA 2PYJA 1T8EA 1K73O 2IVPA 2F9TA 1YTAA 3KK7A 3O1WA 1T7PA 1C0FA 1NMDA 2XY5A 3SV3A 3OYGA 4C8MA 2GV9A 5JICA 2QWMA 2O8BB 3OVNA 1RT3A 5HRRA 3QBWA 1RBSA 3V1QA 5DMRA 1QVFM 4IOXA 3AVKA 4DFPA 3AVHA 3BY5A 3UKRA 4H5TA 2YHBA 2F8TA 2UUCK 1FJGK 4CECA 1BDGA 3CM5A 1KLNA 2FC0A 3OYJA 5JS2A 2ZM6K 3QETA 3LDNA 3ZLJA 4OLBA 3OBWA 1HNZK 3HL8A 4M3YA 3ID8A 4MQ3A 2YKNA 5LMNK 4PHTX 4CJLA 2P9SA 4B3SK 3VQ8A 3GBTA 1Q18A 3I56N 4E7LA 5CR4A 3SV4A 3R3LA 2VG6A 2HOEA 1DTTA 3LZIA 4LFCK 3MN7A 4DV2K 4I9QA 1B9DA 2D0OA 4EFHA 2QKKA 4BROA 3ULEA 3AVMA 4EZ6A 4LF6K 1QQMA 4H0PA 3V1OA 1JL1A 4B8AB 1YIJN 1SKSA 4KBOA 2V7YA 5M1KA 3OYCA 1C0TA 5AZJB 4FZXC 1XC3A 1G15A 3EN9A 1ZC6A 2CGJA 3K58A 1XHXA 4DTNA 3VPZA 3AA5X 3C94A 2ZJQL 4DB3A 2QK9A 4NYNA 2NRVA 1JLGA 4F3TA 2WONA 5I3UA 3CHWA 1DT9A 4IZ9A 3A8YA 4BC4A 4NXNK 4I9LA 1SUQA 4KH5A 4HTLA 4ILHA 4DTRA 4C8KA 3VQQA 3T1HK 4BQZA 3ZSVA 5I9EB 4QS9A 5DM7L 4QS7A 4CERA 4JN4A 1DGKN 4CEAA 1IG8A 2CGKA 1RGIA 1KAXA 3ZCMA 1RTIA 3BP8A 3VA0A 4BQLA 3BF1A 4GKJK 3KKRA 3O9QA 2O8BA 3E9OA 3TSQA 1KXPA 2EX3A 3CCUN 2UYTA 3LP1A 4K25A 3HZ6A 3NGYA 3DXKB 3VQ7A 5HP1A 2B5JA 2PYLA 4GVEA 4BDYA 2P9NB 2O4IA 4DQRA 4Z4CA 4LF9K 3KK3A 2A41A 1MWKA 1HPMA 2FSNA 3LP2A 2F8SA 5K14A 4YNQA 4DSEA 4CZGA 5BPLA 1O13A 2OA8A 4BRHA 2XO7A 1TKTA 1L3UA 1SQKA 3BUZB 4DSLA 2W6KA 2ZJRL 3M1FA 4EZ9A 4X62K 1YVNA 3FGUA 2Q3SA 4CEQA 3CC7N 4DTMA 2P5GA 2AA4A 1HNWK 1N36K 1KAYA 4PL7A 4BRFA 4BR7A 2RHKA 2OCEA 3MEGA 3DMJA 5FPMA 1WLJA 4KI4A 3IG1A 4A2AA 3RR7A 1TGOA 1NGHA 4CEBA 5CYMA 4DR5K 5EVZA 3KK2A 5F0XA 4E7IA 4FLWA 1C6VA 3A5LC 2IVOA 4BRIA 3SQ2A 4A5AA 1NOZA 4CJRA 3VQAA 4KFBA 3KHYA 4FVMA 5LMUK 4OLAA 3PO4A 2NLXA 4DG1A 4B08A 2O8CA 5ADXH 4IWVA 5CY4A 3SQ1A 3VQ4A 5CE3A
chains in the Genus database with same CATH topology
1HRHA 4FJGA 4NCBA 4B9UA 3TAEA 1S1WA 1NK4A 3WNFA 1FKOA 2YNIA 3O4NA 4CJUA 3AV9A 3ZT0A 4K8XA 1KFSA 3TAMA 1TL3A 1EXQA 2XRIA 4O0IA 3RRHA 3ALYA 1L3TA 4ICLA 4LY7A 4CK3A 3OYLA 3SI6A 3LWMA 3AO5A 2F96A 3PX0A 1WSFA 4KV8A 4RW8A 1GOBA 4ID1A 5CZ1A 3KLEA 5HROA 1IO2A 3P83D 3EYZA 4PA1A 4RW7A 5SZTA 1TK0A 4PWDA 5DK5A 3QLHA 1ASWA 2YV0X 3TI0A 4KTWA 4ELUA 1REVA 2FBYA 4Y1CA 3RMAA 3ITHA 4PY5A 2RPIA 4J2BA 2HHWA 5FDLA 4AH9A 2GUIA 5EU7A 3C6TA 4H4OA 4FZZA 1IKXA 1JXEA 4CJFA 4WE1A 4DFMA 1BI4B 3RTVA 4Z0UA 4YFUA 1KVCA 1RBRA 5J2PA 3HP6A 1NKCA 1Z25A 4FW2A 2EHGA 3KLFA 3SUNA 1VK0A 4FJLA 3HK2A 3HSTB 2Y1IA 4Z4IA 4JS5A 2ITGA 1HQEA 3S3OA 3H08A 3QNOA 1SV5A 1WSJA 2G8IA 4QAGA 5J2QA 4E1MA 2ATQA 2HMIA 2RKIA 1S9GA 4O55A 4CHPA 1HNIA 4OKJA 3LAMA 2BE2A 3IRXA 3IS9A 3WNGA 1RT7A 2Z1IA 3SZ2A 4E7HA 4Q0BA 2HNZA 2G8VA 1HYVA 1S1VA 4M45A 4M41A 4RG8A 3V9ZA 1S6PA 5J2MA 2RN2A 2D0CA 1JLCA 1IH7A 1QHTA 1MU2A 1ZYQA 1ZBUA 5KRTA 1X1PA 4AHRA 2XHBA 4GW6A 1LV5A 3NGZA 1J54A 2DFHA 3LP3A 4CJTA 3T19A 1IKWA 1UAXA 3HXMA 1L5UA 3HPGA 1RT1A 3KLHA 1XC9A 3VA3A 4ELTA 4CGDA 3HM9A 1YTUA 2KZZA 3FFIA 4Y1DA 4UQGA 2LSNA 4CEEA 4IKFA 4CJ5A 3L2WA 3OYDA 1U45A 4CHNA 3M8QA 3ZSWA 4BE0A 1D8YA 1VSIA 4JS4A 1S1TA 3CYMA 4ZTFA 3HP9A 3HVRA 4C8OA 4KRFA 2KFNA 1KVAA 4H8KA 3KLIA 4FK2A 1B92A 5C25A 3VQ6A 4JLHA 1JL2A 1WNSA 1ASUA 4CJKA 2HHQA 4AHSA 3ZT4A 1VSDA 3O4QA 1A5XA 1VRUA 2HVIA 1J9AA 4HHTA 2QXFA 3SUPA 3M8SA 3RRGA 3SPYA 1RBUA 4RW9A 4Z4HA 3SJJA 3CQ8A 4KAZA 2E6LA 3S3NA 1RNHA 4MFBA 3LWLA 3MXMA 1U48A 1NK9A 4FJHA 2HHVA 1CLQA 3EY1A 2A1RA 1HNVA 4AHCA 4CHZA 4CF9A 3QNNA 3CM6A 1HMVA 2X74A 2YNHA 1HQUA 4CJPA 2Z1GA 3JYTA 3SYZA 4CJVA 1WN7A 3ZT3A 1NJYA 2BGGA 4BDZA 3AA2A 1C0MA 2JLEA 5HRNA 1JLFA 1C0UA 1LWEA 3AO3A 4M3ZA 3TR8A 3NHGA 2IDOA 1S1XA 1FK9A 3ZSZA 3SPZA 2XY8A 1J5OA 4CEOA 2DTUA 4DWIA 4B8CA 2E4LA 3NE6A 1RDCA 4FLUA 2IC3A 3C6UA 2OZMA 1TAUA 4BWMA 4CK2A 1EETA 3MECA 3MEEA 4CGHA 3D0PA 4AHVA 4DLGA 4FJJA 1VSLA 3NH0A 3O3GA 4KO0A 3NBPA 3RMBA 1BHLA 4CJQA 2VG5A 4KHUA 3WNHA 3AO4A 1X9MA 2G8KA 2DFFA 4FJXA 4CF1A 2HW3A 4FCYA 2HHUA 3ZSRA 2G8HA 3BDPA 3QEXA 3G10A 4DFJA 4CJWA 4FJ9A 3NDKA 1HPZA 1NKEA 2HHXA 3CG7A 3MXIA 4NCAA 4KB1A 3TABA 4KB0A 2XY7A 4FLTA 4CFDA 3OYBA 3E01A 1C1AA 4O4GA 3WNEA 3OJUA 2IAJA 1QE1A 4OVLA 4DS4A 4AHUA 5KGXA 3OYAA 4BE2A 4N41A 2X6SA 3P5JA 3I8DA 3TARA 1EX4A 3G0ZA 2FBXA 3RMDA 4ZTJA 1BI4A 4FJIA 2KZMA 1LW0A 3HT3A 3OS2A 1NK0A 1RTJA 3HJFA 3V1RA 3QEIA 1UA0A 2IOCA 3ZSQA 5C42A 1JKHA 3B6OA 4IBNA 1XHZA 3UIQA 4B9TA 4DLEA 3K5NA 3CFPA 1RDAA 1LW2A 3QIOA 1VSMA 1ZBFA 3VN5A 3A2FA 3AVNA 1N5YA 1KSPA 4KHYA 3B6PA 3OYKA 1Q8IA 2ZD1A 4ZHRA 3LALA 1ASVA 3ZT1A 4CFCA 4AILC 3QEVA 1TK8A 1TKZA 1YVUA 4F2SA 3KTQA 1TV6A 1LWCA 5J2NA 1QSYA 4FW1A 2RF2A 4M3RA 4DTOA 4KHSA 1UWBA 4W5RA 4HVJA 3KD5E 4E7JA 4CE9A 4CHYA 3OYFA 3KJVA 4DU4A 3PX4A 3IAYA 3VQ5A 3V6DA 4CJEA 5FRMA 2QKBA 1QS4A 2IGIA 4C8LA 4BWJA 4B9SA 3TANA 4BE1A 4CJ3A 3PX6A 4W5NA 2O4GA 3L2RA 3QO9A 1Y97A 4CHQA 3DOKA 3TAQA 4HCCA 4AHTA 2HVHA 1CZ9A 2WOMA 3K2PA 5FROA 5HRSA 3TWHA 4EP4A 4DF4A 4FJMA 1BISA 4KI6A 1WSIA 5CYQA 4LSNA 4FM1A 3HVTA 1WAFA 1LWFA 2D0AA 4CEZA 4LH5A 3RMCA 5JS1A 2YNGA 4OJRA 3U6FA 2BDPA 4O0JA 4CGGA 4DSKA 1J53A 1BL3A 2Z1JA 3LPUA 4RW4A 4GMJB 4DSIA 4J2AA 4M3UA 4O44A 1NJZA 3THVA 2VWKA 3DI6A 5I42A 3ZSOA 1KVBA 3NF6A 4KKOA 3HPOA 3LZJA 4HTUA 4B9NA 3AVCA 3V9UA 2OPRA 1L3SA 3U3YA 3SQ4A 1KCFA 4KPYA 1RT6A 4KHWA 4F8RA 4FK0A 1GOAA 2BANA 3DLGA 1CXQA 4J2DA 3S3MA 5D3GA 1U04A 1TAQA 1VSKA 4FLXA 1NK8A 1BCMA 4FZYA 4LD0A 5KI6A 3ZSYA 4CHOA 4E3SA 4DMNA 4I2QA 3OYIA 1WSGA 1JLQA 4E7KA 1XWLA 3DLHA 4CEDA 3KKSA 2X6NA 2OPSA 1VSFA 4DU3A 3AVJA 4CIGA 5KRSA 4CGIA 3V4IA 2ZE2A 1A5WA 1T8EA 2PYJA 4KREA 1SKRA 1RTDA 3T3FA 1IKVA 1KRPA 4ELVA 1YTAA 1TL1A 1T7PA 2OPQA 4E0DA 2FBVA 2DFEA 4CF0A 4CJSA 2XY5A 3L2UA 4F4KA 1Q9YA 3SV3A 4HCBA 1EP4A 3OYGA 2OPPA 1RDDA 2GV9A 2X78A 3DRSA 4C8MA 1U49A 1BQNA 4QCLA 2KQ2A 4HUGA 4M42A 1NK6A 3T1AA 1S1UA 3VQPA 4FM0A 4IG0A 1X9SA 3AVAA 3OVNA 1O1WA 1RT3A 5HRRA 3V9XA 5CZ2A 1RBSA 2G8UA 4J2EA 2KW4A 1SL0A 3V1QA 5DMRA 4IG3A 3QERA 3TAPA 3AVKA 4DFPA 1NJWA 1JLAA 2HB5A 3L3VA 3AVHA 2F8TA 5KTQA 2YHBA 2R7YA 4JRQA 1BGXT 1R0AA 1FXXA 4OPJA 4FLZA 4CECA 3CM5A 1KLNA 2FC0A 3OYJA 4DFKA 1JXBA 5JS2A 3QETA 1RDBA 4HUEA 2PY5A 1NJXA 4M3XA 3VQDA 1IG9A 2B4JA 1TVRA 1QQCA 1D9DA 4N56A 4OLBA 3KK1A 4CK1A 1W0HA 3P1GA 4CGFA 3HL8A 1TK5A 3RR8A 3RWUA 3OYMA 4M3YA 4B9VA 3ISNC 3LANA 3NF7A 2YKNA 1DLOA 4MQ3A 3OJSA 4DTUA 4CJLA 4N47A 4PUOA 1D5AA 2JGUA 3VQ8A 1QSSA 2XY6A 1DTQA 4RW6A 3AVBA 3AVIA 2KTQA 1ZBLA 2D0BA 1C1CA 1S6QA 4IFYA 3BGRA 3SV4A 4E7LA 1UA1A 2ZQBA 3LAKA 3VQEA 3HYFA 2VG6A 3V9WA 2GBZA 1U4BA 1NK5A 4DU1A 2G8FA 5HBMA 1DTTA 3HPHA 4CF2A 3LZIA 1NK7A 4PQUA 4IFVA 1A5VA 3NF9A 1B9DA 4LSLA 3M8RA 4I9QA 3ASMA 2QKKA 4M3TA 3AVMA 3L3UA 4DS5A 3DLEA 4EZ6A 3F73A 4CFAA 4FLVA 3HO1A 3V1OA 4W5QA 1F21A 1JL1A 1T03A 3V81A 1TKDA 3SCXA 4B8AB 3SQ0A 3QESA 4BACA 1SKSA 3DM2A 4FJ5A 3AVGA 3OYCA 3JSMA 1C0TA 1CXUA 1RILA 4FZXC 3AVLA 1G15A 3K58A 1EKEA 1XHXA 4M3WA 4DTNA 3O3HA 4CGJA 1BQMA 3AA5X 3MXJA 3C94A 4EP5A 1C1BA 1SL2A 1S5JA 2HNYA 1X9WA 1VSHA 4CIFA 3OS0A 2QK9A 3ULDA 4NYNA 1B9FA 2P51A 1JLGA 4F3TA 2WONA 5I3UA 1I39A 3LPTA 4NCGA 4FM2A 3L8BA 3DYAA 4DQQA 3AO2A 3TAFA 1NOYA 3CFOA 3NCIA 4FJKA 1K6YA 4GVMA 1RTHA 4I9LA 1WSEA 1SUQA 1L3VA 4DTRA 3OY9A 4C8KA 3VQQA 1I3AA 1SKWA 1VSEA 4KHNA 4IDKA 3L2VA 4K8ZA 3DLRA 3ZSVA 4Z4GA 1JLEA 1CZBA 1Z26A 1VRTA 3NAEA 3OYEA 3PV8A 4CERA 1XI1A 5HRPA 4CEAA 2IS3A 4W5OA 3U3GA 1UOCA 4CEFA 3KIOA 4F2RA 3CFRA 3ZCMA 3L2QA 1RTIA 4B9MA 1VSJA 3VQ9A 4JRPA 2A1SA 3VA0A 2Y1JA 3NGIA 4TSXA 2FBTA 3C95A 4OPKA 4DTXA 4DSFA 4FXDA 3QEPA 1W9HA 3KKRA 1LAWA 3DRRA 3NH1A 2G8WA 2NUBA 3S9HA 1TKXA 3D45A 4I2PA 2ETJA 3KLGA 2VWJA 4DSJA 2HHTA 1LAVA 3DRPA 4CIEA 2EX3A 4DTSA 3LP1A 4B3OA 3ZT2A 3KD1E 5HLFA 3K5MA 4FK4A 4OGEA 4CESA 4N76A 3NGYA 3VQ7A 4FYDA 4HUFA 5HP1A 2OYQA 2B5JA 1KTQA 1RBTA 4KTQA 3PY8A 4FJ7A 3MEDA 3QIPA 4CCHA 3SUOA 2VG7A 4DQIA 3F9KA 1IKYA 2OZSA 2PYLA 1NKBA 1QTMA 4BDYA 2P1JA 4CF8A 1RT5A 2P5OA 2O4IA 4DQRA 4Z4CA 4CFBA 3KK3A 3DLBA 4QOZB 1FKPA 3SNNA 1N6QA 4NYFA 3K5OA 3I0RA 1HYSA 3LP2A 3I0SA 1D9FA 1ITGA 2E6MA 2PZSA 1WAJA 2F8SA 4BDPA 4DTPA 5FRNA 5K14A 4YNQA 4W5TA 4E89A 4DSEA 2YNFA 3OYHA 4CJ4A 2OA8A 3M8PA 3ZSXA 1GOCA 2XO7A 4FLYA 1TKTA 1L3UA 4E19A 3QEWA 4DSLA 4OGCA 4DQSA 4EZ9A 1HYZA 3AA4A 1RBVA 5KGWA 3K57A 4OKEA 4F3OA 1SL1A 3SUQA 4FJNA 1S9EA 4KHQA 2D5RA 4B9LA 1ZBIA 3MAQA 2Q3SA 4CEQA 3AVFA 3LDSA 3PUFA 4DTJA 4DTMA 1YT3A 5E41A 2P5GA 5SWMA 4L8RB 4R5PA 4O5BA 1U47A 4DQPA 3OS1A 3VQCA 5J1EA 4LH4A 3MEGA 4Q5VA 3DMJA 5C24A 3EZ5A 1WLJA 4KI4A 3IG1A 1Q9XA 1BIZA 3O3FA 4Z4FA 4N5SA 1QSLA 3PO5A 3RR7A 1TGOA 1HJRA 4DF8A 4C8NA 5T7BA 4H4MA 4CEBA 5CYMA 2W42A 4OKKA 2Z1HA 3KK2A 2HHSA 3DLKA 3K5LA 4E7IA 1KFDA 4FLWA 3NF8A 4FJ8A 1C6VA 3LP0A 3QINA 2I5JA 4I7FA 4XIUA 3SQ2A 2KFZA 1BCOA 1NOZA 4CJRA 3NH2A 1WSHA 1JLBA 3AO1A 3VQAA 4KFBA 1ZBHA 3V9SA 4FVMA 3OYNA 4OLAA 4G1QA 3NFAA 3TAGA 3PO4A 3K59A 3VQBA 2DY4A 1BIUA 4B08A 4KTZA 4DG1A 2HNDA 1T05A 1RT2A 2YKMA 2YHAA 3AA3A 1KLMA 3DOLA 4ID5A 4Z4EA 5CY4A 1RT4A 1RCHA 2AJQA 3SQ1A 3VQ4A 4E1NA 2B6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HRH A;  4FJG A;  4NCB A;  4B9U A;  3TAE A;  1S1W A;  1NK4 A;  3WNF A;  1FKO A;  2YNI A;  3O4N A;  4CJU A;  3AV9 A;  3ZT0 A;  4K8X A;  1KFS A;  3TAM A;  1TL3 A;  1EXQ A;  2XRI A;  4O0I A;  3RRH A;  3ALY A;  1L3T A;  4ICL A;  4LY7 A;  4CK3 A;  3OYL A;  3SI6 A;  3LWM A;  3AO5 A;  2F96 A;  3PX0 A;  1WSF A;  4KV8 A;  4RW8 A;  1GOB A;  4ID1 A;  5CZ1 A;  3KLE A;  5HRO A;  1IO2 A;  3P83 D;  3EYZ A;  4PA1 A;  4RW7 A;  5SZT A;  1TK0 A;  4PWD A;  5DK5 A;  3QLH A;  1ASW A;  2YV0 X;  3TI0 A;  4KTW A;  4ELU A;  1REV A;  2FBY A;  4Y1C A;  3RMA A;  3ITH A;  4PY5 A;  2RPI A;  4J2B A;  2HHW A;  5FDL A;  4AH9 A;  2GUI A;  5EU7 A;  3C6T A;  4H4O A;  4FZZ A;  1IKX A;  1JXE A;  4CJF A;  4WE1 A;  4DFM A;  1BI4 B;  3RTV A;  4Z0U A;  4YFU A;  1KVC A;  1RBR A;  5J2P A;  3HP6 A;  1NKC A;  1Z25 A;  4FW2 A;  2EHG A;  3KLF A;  3SUN A;  1VK0 A;  4FJL A;  3HK2 A;  3HST B;  2Y1I A;  4Z4I A;  4JS5 A;  2ITG A;  1HQE A;  3S3O A;  3H08 A;  3QNO A;  1SV5 A;  1WSJ A;  2G8I A;  4QAG A;  5J2Q A;  4E1M A;  2ATQ A;  2HMI A;  2RKI A;  1S9G A;  4O55 A;  4CHP A;  1HNI A;  4OKJ A;  3LAM A;  2BE2 A;  3IRX A;  3IS9 A;  3WNG A;  1RT7 A;  2Z1I A;  3SZ2 A;  4E7H A;  4Q0B A;  2HNZ A;  2G8V A;  1HYV A;  1S1V A;  4M45 A;  4M41 A;  4RG8 A;  3V9Z A;  1S6P A;  5J2M A;  2RN2 A;  2D0C A;  1JLC A;  1IH7 A;  1QHT A;  1MU2 A;  1ZYQ A;  1ZBU A;  5KRT A;  1X1P A;  4AHR A;  2XHB A;  4GW6 A;  1LV5 A;  3NGZ A;  1J54 A;  2DFH A;  3LP3 A;  4CJT A;  3T19 A;  1IKW A;  1UAX A;  3HXM A;  1L5U A;  3HPG A;  1RT1 A;  3KLH A;  1XC9 A;  3VA3 A;  4ELT A;  4CGD A;  3HM9 A;  1YTU A;  2KZZ A;  3FFI A;  4Y1D A;  4UQG A;  2LSN A;  4CEE A;  4IKF A;  4CJ5 A;  3L2W A;  3OYD A;  1U45 A;  4CHN A;  3M8Q A;  3ZSW A;  4BE0 A;  1D8Y A;  1VSI A;  4JS4 A;  1S1T A;  3CYM A;  4ZTF A;  3HP9 A;  3HVR A;  4C8O A;  4KRF A;  2KFN A;  1KVA A;  4H8K A;  3KLI A;  4FK2 A;  1B92 A;  5C25 A;  3VQ6 A;  4JLH A;  1JL2 A;  1WNS A;  1ASU A;  4CJK A;  2HHQ A;  4AHS A;  3ZT4 A;  1VSD A;  3O4Q A;  1A5X A;  1VRU A;  2HVI A;  1J9A A;  4HHT A;  2QXF A;  3SUP A;  3M8S A;  3RRG A;  3SPY A;  1RBU A;  4RW9 A;  4Z4H A;  3SJJ A;  3CQ8 A;  4KAZ A;  2E6L A;  3S3N A;  1RNH A;  4MFB A;  3LWL A;  3MXM A;  1U48 A;  1NK9 A;  4FJH A;  2HHV A;  1CLQ A;  3EY1 A;  2A1R A;  1HNV A;  4AHC A;  4CHZ A;  4CF9 A;  3QNN A;  3CM6 A;  1HMV A;  2X74 A;  2YNH A;  1HQU A;  4CJP A;  2Z1G A;  3JYT A;  3SYZ A;  4CJV A;  1WN7 A;  3ZT3 A;  1NJY A;  2BGG A;  4BDZ A;  3AA2 A;  1C0M A;  2JLE A;  5HRN A;  1JLF A;  1C0U A;  1LWE A;  3AO3 A;  4M3Z A;  3TR8 A;  3NHG A;  2IDO A;  1S1X A;  1FK9 A;  3ZSZ A;  3SPZ A;  2XY8 A;  1J5O A;  4CEO A;  2DTU A;  4DWI A;  4B8C A;  2E4L A;  3NE6 A;  1RDC A;  4FLU A;  2IC3 A;  3C6U A;  2OZM A;  1TAU A;  4BWM A;  4CK2 A;  1EET A;  3MEC A;  3MEE A;  4CGH A;  3D0P A;  4AHV A;  4DLG A;  4FJJ A;  1VSL A;  3NH0 A;  3O3G A;  4KO0 A;  3NBP A;  3RMB A;  1BHL A;  4CJQ A;  2VG5 A;  4KHU A;  3WNH A;  3AO4 A;  1X9M A;  2G8K A;  2DFF A;  4FJX A;  4CF1 A;  2HW3 A;  4FCY A;  2HHU A;  3ZSR A;  2G8H A;  3BDP A;  3QEX A;  3G10 A;  4DFJ A;  4CJW A;  4FJ9 A;  3NDK A;  1HPZ A;  1NKE A;  2HHX A;  3CG7 A;  3MXI A;  4NCA A;  4KB1 A;  3TAB A;  4KB0 A;  2XY7 A;  4FLT A;  4CFD A;  3OYB A;  3E01 A;  1C1A A;  4O4G A;  3WNE A;  3OJU A;  2IAJ A;  1QE1 A;  4OVL A;  4DS4 A;  4AHU A;  5KGX A;  3OYA A;  4BE2 A;  4N41 A;  2X6S A;  3P5J A;  3I8D A;  3TAR A;  1EX4 A;  3G0Z A;  2FBX A;  3RMD A;  4ZTJ A;  1BI4 A;  4FJI A;  2KZM A;  1LW0 A;  3HT3 A;  3OS2 A;  1NK0 A;  1RTJ A;  3HJF A;  3V1R A;  3QEI A;  1UA0 A;  2IOC A;  3ZSQ A;  5C42 A;  1JKH A;  3B6O A;  4IBN A;  1XHZ A;  3UIQ A;  4B9T A;  4DLE A;  3K5N A;  3CFP A;  1RDA A;  1LW2 A;  3QIO A;  1VSM A;  1ZBF A;  3VN5 A;  3A2F A;  3AVN A;  1N5Y A;  1KSP A;  4KHY A;  3B6P A;  3OYK A;  1Q8I A;  2ZD1 A;  4ZHR A;  3LAL A;  1ASV A;  3ZT1 A;  4CFC A;  4AIL C;  3QEV A;  1TK8 A;  1TKZ A;  1YVU A;  4F2S A;  3KTQ A;  1TV6 A;  1LWC A;  5J2N A;  1QSY A;  4FW1 A;  2RF2 A;  4M3R A;  4DTO A;  4KHS A;  1UWB A;  4W5R A;  4HVJ A;  3KD5 E;  4E7J A;  4CE9 A;  4CHY A;  3OYF A;  3KJV A;  4DU4 A;  3PX4 A;  3IAY A;  3VQ5 A;  3V6D A;  4CJE A;  5FRM A;  2QKB A;  1QS4 A;  2IGI A;  4C8L A;  4BWJ A;  4B9S A;  3TAN A;  4BE1 A;  4CJ3 A;  3PX6 A;  4W5N A;  2O4G A;  3L2R A;  3QO9 A;  1Y97 A;  4CHQ A;  3DOK A;  3TAQ A;  4HCC A;  4AHT A;  2HVH A;  1CZ9 A;  2WOM A;  3K2P A;  5FRO A;  5HRS A;  3TWH A;  4EP4 A;  4DF4 A;  4FJM A;  1BIS A;  4KI6 A;  1WSI A;  5CYQ A;  4LSN A;  4FM1 A;  3HVT A;  1WAF A;  1LWF A;  2D0A A;  4CEZ A;  4LH5 A;  3RMC A;  5JS1 A;  2YNG A;  4OJR A;  3U6F A;  2BDP A;  4O0J A;  4CGG A;  4DSK A;  1J53 A;  1BL3 A;  2Z1J A;  3LPU A;  4RW4 A;  4GMJ B;  4DSI A;  4J2A A;  4M3U A;  4O44 A;  1NJZ A;  3THV A;  2VWK A;  3DI6 A;  5I42 A;  3ZSO A;  1KVB A;  3NF6 A;  4KKO A;  3HPO A;  3LZJ A;  4HTU A;  4B9N A;  3AVC A;  3V9U A;  2OPR A;  1L3S A;  3U3Y A;  3SQ4 A;  1KCF A;  4KPY A;  1RT6 A;  4KHW A;  4F8R A;  4FK0 A;  1GOA A;  2BAN A;  3DLG A;  1CXQ A;  4J2D A;  3S3M A;  5D3G A;  1U04 A;  1TAQ A;  1VSK A;  4FLX A;  1NK8 A;  1BCM A;  4FZY A;  4LD0 A;  5KI6 A;  3ZSY A;  4CHO A;  4E3S A;  4DMN A;  4I2Q A;  3OYI A;  1WSG A;  1JLQ A;  4E7K A;  1XWL A;  3DLH A;  4CED A;  3KKS A;  2X6N A;  2OPS A;  1VSF A;  4DU3 A;  3AVJ A;  4CIG A;  5KRS A;  4CGI A;  3V4I A;  2ZE2 A;  1A5W A;  1T8E A;  2PYJ A;  4KRE A;  1SKR A;  1RTD A;  3T3F A;  1IKV A;  1KRP A;  4ELV A;  1YTA A;  1TL1 A;  1T7P A;  2OPQ A;  4E0D A;  2FBV A;  2DFE A;  4CF0 A;  4CJS A;  2XY5 A;  3L2U A;  4F4K A;  1Q9Y A;  3SV3 A;  4HCB A;  1EP4 A;  3OYG A;  2OPP A;  1RDD A;  2GV9 A;  2X78 A;  3DRS A;  4C8M A;  1U49 A;  1BQN A;  4QCL A;  2KQ2 A;  4HUG A;  4M42 A;  1NK6 A;  3T1A A;  1S1U A;  3VQP A;  4FM0 A;  4IG0 A;  1X9S A;  3AVA A;  3OVN A;  1O1W A;  1RT3 A;  5HRR A;  3V9X A;  5CZ2 A;  1RBS A;  2G8U A;  4J2E A;  2KW4 A;  1SL0 A;  3V1Q A;  5DMR A;  4IG3 A;  3QER A;  3TAP A;  3AVK A;  4DFP A;  1NJW A;  1JLA A;  2HB5 A;  3L3V A;  3AVH A;  2F8T A;  5KTQ A;  2YHB A;  2R7Y A;  4JRQ A;  1BGX T;  1R0A A;  1FXX A;  4OPJ A;  4FLZ A;  4CEC A;  3CM5 A;  1KLN A;  2FC0 A;  3OYJ A;  4DFK A;  1JXB A;  5JS2 A;  3QET A;  1RDB A;  4HUE A;  2PY5 A;  1NJX A;  4M3X A;  3VQD A;  1IG9 A;  2B4J A;  1TVR A;  1QQC A;  1D9D A;  4N56 A;  4OLB A;  3KK1 A;  4CK1 A;  1W0H A;  3P1G A;  4CGF A;  3HL8 A;  1TK5 A;  3RR8 A;  3RWU A;  3OYM A;  4M3Y A;  4B9V A;  3ISN C;  3LAN A;  3NF7 A;  2YKN A;  1DLO A;  4MQ3 A;  3OJS A;  4DTU A;  4CJL A;  4N47 A;  4PUO A;  1D5A A;  2JGU A;  3VQ8 A;  1QSS A;  2XY6 A;  1DTQ A;  4RW6 A;  3AVB A;  3AVI A;  2KTQ A;  1ZBL A;  2D0B A;  1C1C A;  1S6Q A;  4IFY A;  3BGR A;  3SV4 A;  4E7L A;  1UA1 A;  2ZQB A;  3LAK A;  3VQE A;  3HYF A;  2VG6 A;  3V9W A;  2GBZ A;  1U4B A;  1NK5 A;  4DU1 A;  2G8F A;  5HBM A;  1DTT A;  3HPH A;  4CF2 A;  3LZI A;  1NK7 A;  4PQU A;  4IFV A;  1A5V A;  3NF9 A;  1B9D A;  4LSL A;  3M8R A;  4I9Q A;  3ASM A;  2QKK A;  4M3T A;  3AVM A;  3L3U A;  4DS5 A;  3DLE A;  4EZ6 A;  3F73 A;  4CFA A;  4FLV A;  3HO1 A;  3V1O A;  4W5Q A;  1F21 A;  1JL1 A;  1T03 A;  3V81 A;  1TKD A;  3SCX A;  4B8A B;  3SQ0 A;  3QES A;  4BAC A;  1SKS A;  3DM2 A;  4FJ5 A;  3AVG A;  3OYC A;  3JSM A;  1C0T A;  1CXU A;  1RIL A;  4FZX C;  3AVL A;  1G15 A;  3K58 A;  1EKE A;  1XHX A;  4M3W A;  4DTN A;  3O3H A;  4CGJ A;  1BQM A;  3AA5 X;  3MXJ A;  3C94 A;  4EP5 A;  1C1B A;  1SL2 A;  1S5J A;  2HNY A;  1X9W A;  1VSH A;  4CIF A;  3OS0 A;  2QK9 A;  3ULD A;  4NYN A;  1B9F A;  2P51 A;  1JLG A;  4F3T A;  2WON A;  5I3U A;  1I39 A;  3LPT A;  4NCG A;  4FM2 A;  3L8B A;  3DYA A;  4DQQ A;  3AO2 A;  3TAF A;  1NOY A;  3CFO A;  3NCI A;  4FJK A;  1K6Y A;  4GVM A;  1RTH A;  4I9L A;  1WSE A;  1SUQ A;  1L3V A;  4DTR A;  3OY9 A;  4C8K A;  3VQQ A;  1I3A A;  1SKW A;  1VSE A;  4KHN A;  4IDK A;  3L2V A;  4K8Z A;  3DLR A;  3ZSV A;  4Z4G A;  1JLE A;  1CZB A;  1Z26 A;  1VRT A;  3NAE A;  3OYE A;  3PV8 A;  4CER A;  1XI1 A;  5HRP A;  4CEA A;  2IS3 A;  4W5O A;  3U3G A;  1UOC A;  4CEF A;  3KIO A;  4F2R A;  3CFR A;  3ZCM A;  3L2Q A;  1RTI A;  4B9M A;  1VSJ A;  3VQ9 A;  4JRP A;  2A1S A;  3VA0 A;  2Y1J A;  3NGI A;  4TSX A;  2FBT A;  3C95 A;  4OPK A;  4DTX A;  4DSF A;  4FXD A;  3QEP A;  1W9H A;  3KKR A;  1LAW A;  3DRR A;  3NH1 A;  2G8W A;  2NUB A;  3S9H A;  1TKX A;  3D45 A;  4I2P A;  2ETJ A;  3KLG A;  2VWJ A;  4DSJ A;  2HHT A;  1LAV A;  3DRP A;  4CIE A;  2EX3 A;  4DTS A;  3LP1 A;  4B3O A;  3ZT2 A;  3KD1 E;  5HLF A;  3K5M A;  4FK4 A;  4OGE A;  4CES A;  4N76 A;  3NGY A;  3VQ7 A;  4FYD A;  4HUF A;  5HP1 A;  2OYQ A;  2B5J A;  1KTQ A;  1RBT A;  4KTQ A;  3PY8 A;  4FJ7 A;  3MED A;  3QIP A;  4CCH A;  3SUO A;  2VG7 A;  4DQI A;  3F9K A;  1IKY A;  2OZS A;  2PYL A;  1NKB A;  1QTM A;  4BDY A;  2P1J A;  4CF8 A;  1RT5 A;  2P5O A;  2O4I A;  4DQR A;  4Z4C A;  4CFB A;  3KK3 A;  3DLB A;  4QOZ B;  1FKP A;  3SNN A;  1N6Q A;  4NYF A;  3K5O A;  3I0R A;  1HYS A;  3LP2 A;  3I0S A;  1D9F A;  1ITG A;  2E6M A;  2PZS A;  1WAJ A;  2F8S A;  4BDP A;  4DTP A;  5FRN A;  5K14 A;  4YNQ A;  4W5T A;  4E89 A;  4DSE A;  2YNF A;  3OYH A;  4CJ4 A;  2OA8 A;  3M8P A;  3ZSX A;  1GOC A;  2XO7 A;  4FLY A;  1TKT A;  1L3U A;  4E19 A;  3QEW A;  4DSL A;  4OGC A;  4DQS A;  4EZ9 A;  1HYZ A;  3AA4 A;  1RBV A;  5KGW A;  3K57 A;  4OKE A;  4F3O A;  1SL1 A;  3SUQ A;  4FJN A;  1S9E A;  4KHQ A;  2D5R A;  4B9L A;  1ZBI A;  3MAQ A;  2Q3S A;  4CEQ A;  3AVF A;  3LDS A;  3PUF A;  4DTJ A;  4DTM A;  1YT3 A;  5E41 A;  2P5G A;  5SWM A;  4L8R B;  4R5P A;  4O5B A;  1U47 A;  4DQP A;  3OS1 A;  3VQC A;  5J1E A;  4LH4 A;  3MEG A;  4Q5V A;  3DMJ A;  5C24 A;  3EZ5 A;  1WLJ A;  4KI4 A;  3IG1 A;  1Q9X A;  1BIZ A;  3O3F A;  4Z4F A;  4N5S A;  1QSL A;  3PO5 A;  3RR7 A;  1TGO A;  1HJR A;  4DF8 A;  4C8N A;  5T7B A;  4H4M A;  4CEB A;  5CYM A;  2W42 A;  4OKK A;  2Z1H A;  3KK2 A;  2HHS A;  3DLK A;  3K5L A;  4E7I A;  1KFD A;  4FLW A;  3NF8 A;  4FJ8 A;  1C6V A;  3LP0 A;  3QIN A;  2I5J A;  4I7F A;  4XIU A;  3SQ2 A;  2KFZ A;  1BCO A;  1NOZ A;  4CJR A;  3NH2 A;  1WSH A;  1JLB A;  3AO1 A;  3VQA A;  4KFB A;  1ZBH A;  3V9S A;  4FVM A;  3OYN A;  4OLA A;  4G1Q A;  3NFA A;  3TAG A;  3PO4 A;  3K59 A;  3VQB A;  2DY4 A;  1BIU A;  4B08 A;  4KTZ A;  4DG1 A;  2HND A;  1T05 A;  1RT2 A;  2YKM A;  2YHA A;  3AA3 A;  1KLM A;  3DOL A;  4ID5 A;  4Z4E A;  5CY4 A;  1RT4 A;  1RCH A;  2AJQ A;  3SQ1 A;  3VQ4 A;  4E1N A;  2B6A A; 
#chains in the Genus database with same CATH topology
 4NCB A;  2HF3 A;  3HI0 A;  4Y0W A;  1GLA G;  4DV5 K;  1YJN N;  2P9L B;  3UKU B;  4LY7 A;  2FSK A;  4YY3 K;  3U9D A;  4B1Z A;  1GOB A;  3KLE A;  5GAD P;  5HRO A;  3P83 D;  3SBT A;  3EYZ A;  5SZT A;  1ASW A;  4KTW A;  4Y1C A;  3RMA A;  2O8D B;  3ITH A;  5AQS A;  4AH9 A;  2GUI A;  5EU7 A;  3DXK A;  4DHY A;  1JXE A;  2QXL A;  1RBR A;  3HP6 A;  1GLC G;  1VK0 A;  3HK2 A;  2Y1I A;  3AAQ A;  1W7A A;  2ZJP L;  1T6C A;  4ILG B;  5JLF A;  1WSJ A;  2G8I A;  4QAG A;  3H1Q A;  5J2Q A;  2RKI A;  1S9G A;  4CHP A;  5CHI A;  4OKJ A;  2BE2 A;  3IS9 A;  3WNG A;  4ILJ A;  5JVG L;  2G8V A;  5AQL A;  1VQ9 N;  1S6P A;  3BZC A;  2RN2 A;  3BEX A;  3ZET B;  4OX9 K;  1QHT A;  2FF3 B;  3TSP A;  2HST A;  4JI3 K;  1X1P A;  4GW6 A;  3QML A;  3MDQ A;  3LP3 A;  4CJT A;  3T19 A;  1IKW A;  1RT1 A;  1XC9 A;  3VA3 A;  4R79 A;  2KZZ A;  3FFI A;  2LSN A;  4CEE A;  2CH6 A;  4CJ5 A;  1U45 A;  4CHN A;  2O8F A;  3FE1 A;  1N34 K;  1KD1 O;  1D8Y A;  4JS4 A;  4CZI A;  5AQZ A;  3CYM A;  1ESV A;  1KVA A;  3N4Q A;  3VEN A;  4M7Y A;  2YX6 A;  3WXL A;  3ATV A;  3SLC A;  1A5X A;  2HVI A;  1J9A A;  1RBU A;  4RW9 A;  4MFB A;  1CLQ A;  4O8U A;  3BF3 A;  4QS8 A;  1HNV A;  4AHC A;  4M3T A;  2X74 A;  2BGG A;  1NJY A;  4CJV A;  1JLF A;  3PSF A;  1C0U A;  3MX5 A;  3AO3 A;  2UXB K;  1S1X A;  3SAF A;  2XY8 A;  1RDC A;  1TAU A;  4BWM A;  4DLG A;  4FJJ A;  2ITM A;  1VSL A;  4JKB A;  1BHL A;  3CCQ N;  2G8K A;  4IEI A;  3BZK A;  4A2B A;  4BRP A;  2HW3 A;  3ZSR A;  4CJW A;  1HPZ A;  2HHX A;  4JKF A;  4FLT A;  4H0Y B;  4IEE A;  3OYB A;  3WQT A;  2O8D A;  1GLL O;  1TUY A;  4FPA A;  3I8D A;  3TTF A;  2NRT A;  3J8A A;  3RMD A;  1M1K O;  3V1R A;  2FLO A;  2IOC A;  5C42 A;  1JKH A;  1E3M A;  1YUW A;  4IBN A;  2P9P B;  4L3Q A;  4DLE A;  3CFP A;  5AQI A;  2E2Q A;  1IBM K;  3C65 A;  3OYK A;  3HRG A;  1Q8I A;  4DV4 K;  3ZT1 A;  4CFC A;  1TK8 A;  1TKZ A;  2H3G X;  3CJB A;  4F2S A;  1T6D A;  1LWC A;  5AQU A;  4M3R A;  3ZET A;  4PKI A;  4DTO A;  4W5R A;  4HVJ A;  3KD5 E;  4E7J A;  1J6Z A;  3OYF A;  3KJV A;  1T3V A;  4CJE A;  2ASO A;  2QKB A;  4BWJ A;  2HBK A;  4W5N A;  2HMP A;  3L2R A;  4CHQ A;  3K9K A;  1HX1 A;  2WOM A;  3K2P A;  1XQS C;  3L4I A;  3HVT A;  2D0A A;  4CEZ A;  1EWR A;  2YNG A;  5F1X A;  4DSK A;  2E88 A;  1NJZ A;  1U49 A;  2VWK A;  3DI6 A;  5I42 A;  3LZJ A;  4KKO A;  4B9N A;  3AVC A;  3V9U A;  2OPR A;  1L3S A;  4DUZ K;  1RT6 A;  2BAN A;  1CXQ A;  1Z6R A;  2Q0U A;  3S3M A;  4FLX A;  1BCM A;  4FZY A;  4CHO A;  4DMN A;  4I2Q A;  3OYI A;  4E7K A;  1XWL A;  3KKS A;  3A5M C;  3AVJ A;  4CGI A;  3V4I A;  1SKR A;  1E4G T;  5AZI B;  1SZ2 A;  2DFE A;  4YOX A;  5AQG A;  5A2Q O;  4F4K A;  3C6A A;  4HCB A;  4Z94 A;  1EP4 A;  2OTJ N;  2OPP A;  2X78 A;  4LF8 K;  4QCL A;  2OTL N;  1BOT O;  4M42 A;  1YIT N;  3MK6 A;  4B1Y B;  1S1U A;  5JVH L;  3CME N;  1X9S A;  4JHD B;  4J2E A;  2YI1 A;  3T1Y K;  4IG3 A;  1NJW A;  1E4F T;  3CCV N;  1R0A A;  2UUB K;  1FXX A;  4OPJ A;  2IVN A;  1HKG A;  3FZK A;  3HTV A;  5AQP A;  1NJX A;  5KPZ A;  3VQD A;  5M1O A;  1QQC A;  3K0S A;  4N56 A;  3VGL A;  2WFB A;  1W97 L;  4CK1 A;  2P9P A;  4CGF A;  1I94 K;  3RR8 A;  3OYM A;  4B9V A;  2A3Z A;  3ISN C;  3OJS A;  4DTU A;  4JI1 K;  1V4S A;  1X3N A;  1DTQ A;  4RW6 A;  3UKR B;  4JV5 K;  1S6Q A;  2QM1 A;  1UA1 A;  3VQE A;  1NK5 A;  3TU5 A;  4DU1 A;  2G8F A;  1NGF A;  3EKU A;  3HPH A;  3ASM A;  1BWF O;  5JMV A;  3F73 A;  4FLV A;  2E1Z A;  3MWT A;  1TKD A;  4V19 S;  4BC2 A;  3SCX A;  3QES A;  3AVG A;  3JSM A;  2P9S B;  1RIL A;  3F2K A;  4CBW A;  1T44 A;  3C6H A;  5FPN A;  4M3W A;  1Q7Y O;  4FOE A;  2HNY A;  4BRK A;  3J7A P;  1B9F A;  2P51 A;  1MWM A;  3LPT A;  4DQQ A;  3DYA A;  3VEO A;  3DWL A;  1GLF O;  1K6Y A;  2JWK A;  4GVM A;  1VQP N;  1QVG M;  1L3V A;  3OW2 M;  1SKW A;  1VSE A;  1BUP A;  4K8Z A;  3DLR A;  4JI7 K;  2GUP A;  1JLE A;  3CJ7 A;  3PLA A;  5AZI A;  4BVO A;  1XI1 A;  2IS3 A;  4W5O A;  3U3G A;  1S22 A;  3KIO A;  4FVU A;  3CFR A;  4B9M A;  1H1V A;  1VSJ A;  3VQ9 A;  4JRP A;  2Y1J A;  2UXC K;  4TSX A;  2FBT A;  1M90 O;  4DSF A;  1W9H A;  1LAW A;  3DRR A;  3Q7C A;  4JKD A;  3NH1 A;  4BR2 A;  3CF5 L;  2ETJ A;  3AGR A;  1WBD A;  5TKW A;  4JHD A;  3DRP A;  4CIE A;  4DTS A;  4B3O A;  3KVG A;  2UXD K;  4OGE A;  4N76 A;  4FYD A;  4HUF A;  1KTQ A;  5KPR A;  4FJ7 A;  3MED A;  3UE5 A;  3QIP A;  3SUO A;  4JAX A;  3SBG A;  3D2E A;  1BG3 A;  1QTM A;  2VYP A;  2P1J A;  2F9W A;  3H3N O;  4CF8 A;  1RT5 A;  2P5O A;  2V52 B;  4QOZ B;  4CFB A;  3DLB A;  3VER A;  3SNN A;  1D9F A;  1WAJ A;  2QW9 A;  3OYH A;  3M8P A;  3ZSX A;  1GOC A;  4E19 A;  4RCH A;  4DQS A;  3MX2 A;  1HYZ A;  3AA4 A;  5EOY A;  4CZF A;  3CCS N;  2ZGY A;  3QDK A;  4FJN A;  4KHQ A;  2GEL A;  1HJO A;  3MAQ A;  3ENO A;  3H3O B;  4B1V A;  4L8R B;  5SWM A;  5BR9 A;  4O5B A;  3QBX A;  5J1E A;  1R59 O;  4LH4 A;  4IOA L;  2RE2 A;  4XEI A;  4WQ4 C;  4CZK A;  1BU6 O;  4Z4F A;  4N5S A;  3C7N B;  3PO5 A;  3A5N C;  3VEW A;  1K9M O;  4DF8 A;  4H4M A;  4OKK A;  1KQS M;  4MDB A;  4MO5 A;  3K5L A;  1NMN A;  3D2F B;  3DJC A;  3NMU A;  1JCG A;  1BCO A;  3MN9 A;  3A0I X;  4DR7 K;  4EHU A;  3O4W A;  1XNR K;  3OYN A;  4DCH A;  3TAG A;  3O5B A;  4DR1 K;  3O9T A;  3OTO K;  3K59 A;  4KTZ A;  2YHA A;  3DOL A;  3EKS A;  2AJQ A;  2IIR A;  2E8A A;  4C1N I;  1HRH A;  1IV0 A;  3WNF A;  4CJU A;  3ZT0 A;  4K8X A;  3CPW M;  2D4W A;  3E66 A;  3SI6 A;  3T7Z A;  3L4Q A;  3LWM A;  2F96 A;  1VQM N;  4KV8 A;  1GLE G;  5CZ1 A;  3ZYY X;  3P4I A;  4PWD A;  4A5B A;  5AQN A;  2O8C B;  4NXM K;  2O8E A;  2RPI A;  4J2B A;  2E2O A;  4H4O A;  1N33 K;  3O08 A;  4BRD A;  1QZ6 A;  3RTV A;  4YFU A;  1KVC A;  4H03 B;  5AQK A;  4LF4 K;  1YXQ A;  3KLF A;  4MDA A;  2NZT A;  4JS5 A;  2FXU A;  4RWT A;  1SV5 A;  2HMI A;  1HNI A;  3LAM A;  4E7H A;  3D6R A;  4M41 A;  4RG8 A;  1JLC A;  1IH7 A;  4GY2 B;  1SS6 A;  1VQ5 N;  3ZEU A;  2XHB A;  1LV5 A;  3NGZ A;  1J54 A;  2DFH A;  2QWL A;  1IJJ A;  1MDU B;  3HPG A;  1YTU A;  4CGD A;  3HM9 A;  3VEV A;  4JI0 K;  3THW B;  3L2W A;  3ZSW A;  5BRD A;  4BE0 A;  4BR5 A;  1HR0 K;  1S1T A;  3C7N A;  4ZTF A;  3HP9 A;  3HVR A;  4KRF A;  4FWP A;  5AQX A;  1EQY A;  3KLI A;  4DR4 K;  4WQ5 C;  1WNS A;  4CJK A;  3MWP A;  3QFP A;  4CJ7 A;  3O4Q A;  3FR0 A;  4H0V B;  1DEJ A;  1VRU A;  3D2F A;  4BGB A;  3GG4 A;  2BTF A;  3S3N A;  3MXM A;  1U48 A;  4LF5 K;  1NGI A;  1BA0 A;  5BPN A;  2YNH A;  1C0G A;  4FWK A;  4H5R A;  3ZT3 A;  3CIP A;  4J8F A;  2O8F B;  1C0M A;  4M3Z A;  3HSC A;  1EWQ A;  2GWJ A;  1WOQ A;  1J5O A;  1V4T A;  5C2D A;  5AQO A;  2E4L A;  3O8M A;  5F2R A;  3GL1 A;  4FLU A;  3EL2 A;  3C6U A;  1OH5 A;  1EET A;  3MEE A;  3D0P A;  2YHY A;  1NBW A;  3ATU A;  4KO0 A;  4CJQ A;  4KHU A;  3WNH A;  2DFF A;  4LC9 B;  5GIP A;  4XH5 A;  3PSI A;  1HUX A;  3QEX A;  3G25 A;  1N32 K;  4DFJ A;  4AM6 A;  1VQL N;  3M6G A;  3R8E A;  1NKE A;  3MXI A;  5FLX O;  2XY7 A;  3E01 A;  4O4G A;  3WNE A;  2IAJ A;  4OVL A;  5BRF A;  2KZM A;  3ENB A;  2KHO A;  3ZSQ A;  3B6O A;  1XHZ A;  4B9T A;  5AR0 A;  3PIP L;  3K5N A;  4JI8 K;  1JCE A;  3QIO A;  1ZBF A;  3VN5 A;  3AVN A;  1N5Y A;  3CQX A;  3B6P A;  3L0Q A;  4YOU A;  4WFB L;  2YCH A;  4JK9 A;  2RF2 A;  3VTH A;  4KHS A;  3O6W A;  2Q0R A;  4CHY A;  2J4R A;  3PX4 A;  3SK3 A;  3TTC A;  4B1W B;  5ADX A;  2IGI A;  4C8L A;  4B9S A;  3PX6 A;  3THW A;  3SAH A;  3QO9 A;  4AHT A;  2QWQ A;  1CZ9 A;  5FRO A;  4FPB A;  4E1J A;  4EP4 A;  4BRE A;  1WAF A;  4CZH A;  3CC2 N;  3U6F A;  2BDP A;  4O0J A;  4CGG A;  1J53 A;  1BL3 A;  2VQF K;  4GMJ B;  4DSI A;  4J2A A;  4O44 A;  1WUA A;  2W40 A;  3NF6 A;  2EWS A;  3HPO A;  1NU0 A;  1GOA A;  2QTD A;  5BPM A;  4AM7 A;  3CD6 N;  1NK8 A;  1VQN N;  1NM1 A;  1JLQ A;  2X6N A;  2OPS A;  1NGG A;  1VSF A;  4WQ4 A;  5AJ3 K;  4KRE A;  1A5W A;  1RTD A;  3T3F A;  4ELV A;  1HLU A;  3UB5 A;  2OPQ A;  4CJS A;  4CF0 A;  1GLD G;  3G6E N;  3L2U A;  3B8A X;  1KC8 O;  1RDD A;  3DRS A;  3GE1 A;  1VQ6 N;  1BQN A;  2KQ2 A;  4HUG A;  5EXW A;  3O9S A;  1NK6 A;  4YHH K;  3VQP A;  4DWI A;  5CZ2 A;  2G8U A;  3E9P A;  2KW4 A;  1SL0 A;  2QWP A;  5M1P A;  3WXM B;  3TAP A;  4K43 A;  2HB5 A;  3L3V A;  5KTQ A;  1Z05 A;  2R7Y A;  4JRQ A;  1BGX T;  4FLZ A;  2JWL A;  2BUP A;  1NLV A;  1JXB A;  3MMV A;  1RDB A;  2PY5 A;  1IG9 A;  4LF7 K;  5AQY A;  3KK1 A;  3P1G A;  1TK5 A;  3RWU A;  4JKG B;  3VMF B;  5AFU A;  3NF7 A;  1DLO A;  4N47 A;  1D5A A;  4K41 A;  3H45 C;  1OH8 A;  3AVI A;  2KTQ A;  3FZL A;  2ZQB A;  3LAK A;  2GBZ A;  2YHW A;  2UU9 K;  4MLH A;  1NK7 A;  2WUS A;  3I55 N;  4IFV A;  1A5V A;  3M8R A;  4LSL A;  1IBL K;  1XMQ K;  1Q86 O;  4CFA A;  5GIN A;  3HO1 A;  3JXU A;  3CJA A;  3SQ0 A;  3DM2 A;  1VQO N;  3AVL A;  3JAM O;  1VQ8 N;  4IJA A;  2WBN A;  3M3Z A;  1EKE A;  1YI2 N;  3O3H A;  2I7P A;  1BQM A;  4CGJ A;  3MXJ A;  4EP5 A;  4NO7 A;  3U9Z A;  3ID6 A;  3AGK A;  1X9W A;  4CIF A;  5AQR A;  3ULD A;  3NVK A;  3KWG A;  5AQJ A;  1I39 A;  4HWI A;  4NCG A;  4BRA A;  5EX5 A;  1OVY A;  1GLJ O;  1WSE A;  3J81 O;  1I3A A;  4KHN A;  3L2V A;  1GLB G;  1CZB A;  1Z26 A;  1VRT A;  3NAE A;  3OYE A;  3PV8 A;  4FWO A;  4O5F A;  1ZBS A;  3SMP A;  4F2R A;  4H5N A;  1ATR A;  3CCE N;  4BRC A;  3DLL L;  3NGI A;  4OPK A;  3C95 A;  4DTX A;  3GDQ A;  4FXD A;  1NG9 A;  2NUB A;  1TKX A;  3D45 A;  4I2P A;  3KLG A;  2VWJ A;  4DV7 K;  4DSJ A;  3H6E A;  2Q31 A;  3LDO A;  3FZH A;  3LDP A;  3ZT2 A;  3H46 O;  3KD1 E;  5HLF A;  3K5M A;  4FK4 A;  3J7Y P;  1P90 A;  2QWO A;  3THY B;  1RBT A;  4KTQ A;  3PY8 A;  2Q36 A;  2GEM A;  2VG7 A;  4DQI A;  3F9K A;  3CJ1 A;  3ZX3 A;  1IKY A;  2OZS A;  1S3X A;  2VGN A;  1VQ7 N;  3QIC A;  3LM9 A;  4BC3 A;  1Y64 A;  1FKP A;  4NYF A;  4JKG A;  1HYS A;  4XH4 A;  1ITG A;  2E6M A;  2PZS A;  4BDP A;  4W5T A;  4E89 A;  4U67 L;  1SAZ A;  4FLY A;  2CH5 A;  3QEW A;  1RBV A;  4F3O A;  4C23 A;  4BGA A;  3MN6 A;  3SUQ A;  1S9E A;  4WFA L;  3AVF A;  3D2E B;  3PUF A;  4DTJ A;  5E41 A;  1U47 A;  3VF4 A;  2WC9 A;  4BR0 A;  3VQC A;  4BRQ A;  3OS1 A;  1VAZ A;  3HOT A;  5AQW A;  1U6Z A;  4Q5V A;  5C24 A;  4BRL A;  1Q9X A;  4YOY A;  1BIZ A;  3EE8 A;  3IMX A;  1QSL A;  1K8K B;  1HJR A;  2A42 A;  4C8N A;  1D4X A;  2I7N A;  1XMO K;  3CET A;  3HOS A;  2HHS A;  3DLK A;  3O80 A;  3QIN A;  2I5J A;  1QQO A;  4BRN A;  4DR2 K;  4I7F A;  1WSH A;  2KLA A;  3R9P A;  4DV0 K;  4G1Q A;  2DY4 A;  1BIU A;  4Z4E A;  4ID5 A;  4CZM A;  3TAE A;  4F9O A;  1FKO A;  2YNI A;  3O4N A;  1KFS A;  4M7X A;  1KAZ A;  4CBU A;  1L3T A;  1ZXO A;  3OYL A;  2FSJ A;  3K9J A;  1JJ2 M;  5BRH A;  5M1F A;  1OH6 A;  3J7Z O;  4RW8 A;  4ID1 A;  1CZA N;  3CPE A;  5H1S Q;  1IO2 A;  4OO1 J;  4PA1 A;  1TK0 A;  3QLH A;  3E1Y A;  3GOI A;  2DPN A;  4ELU A;  2FBY A;  5KQD A;  5FDL A;  1TYQ B;  3THY A;  2Q97 A;  4JKH A;  4FZZ A;  1IKX A;  3SAG A;  1BI4 B;  5J2P A;  3NVM A;  3SUN A;  4FJL A;  4Z4I A;  3RSE B;  3H08 A;  3WUH A;  4O55 A;  2W41 A;  3TTD A;  3WEE B;  3IRX A;  3WXK A;  2YHX A;  2O8E B;  4IO9 L;  1S1V A;  2HHH K;  3V9Z A;  5J2M A;  4AQY K;  1ZYQ A;  5HOO A;  2AP1 A;  4GNI A;  1NGJ A;  3P39 A;  3VGM A;  1L5U A;  1UAX A;  3KLH A;  1K8A O;  4M63 C;  2ZF5 O;  3IUC A;  4IO8 A;  1W2B M;  3OYD A;  4LFA K;  1K8K A;  4JI4 K;  5KQ8 A;  2KFN A;  4FK2 A;  1B92 A;  3ZX0 A;  3S41 A;  5C25 A;  4AHS A;  1VSD A;  4CZJ A;  3QFU A;  2P9I A;  4HHT A;  3RRG A;  3SPY A;  4Z4H A;  4DV3 K;  3G4S N;  3ZEU B;  3CQ8 A;  3CMA N;  4FJH A;  4X65 K;  3LWL A;  2D0P A;  1NK9 A;  1N8R O;  5AQF A;  4CHZ A;  4CF9 A;  1YHQ N;  4H0O A;  3CM6 A;  3QNN A;  3SJJ A;  5TKY A;  1HQU A;  4CJP A;  4XH1 A;  4MLE A;  3AA2 A;  5IWA K;  3MCA B;  4BDZ A;  1LWE A;  2P9U A;  3TR8 A;  2E2P A;  3NHG A;  2IDO A;  4IDH A;  3VF2 A;  1FK9 A;  3ZSZ A;  3SPZ A;  4GV3 A;  4CEO A;  2PAV A;  2ZWH A;  3NE6 A;  5E26 A;  3Q7B A;  2PBD A;  2OZM A;  4CK2 A;  1U2V B;  3MEC A;  4CGH A;  3NBP A;  3HM8 A;  3AO4 A;  3H1V X;  1J5E K;  4FJX A;  4B3M K;  4FCY A;  2HHU A;  4K0K K;  2G8H A;  3BDP A;  1NGA A;  3G10 A;  3DAW A;  3HBT A;  4B9Q A;  4FSV A;  4FJ9 A;  2F4V K;  5C15 A;  1FW6 A;  4KB0 A;  5IT9 O;  4CFD A;  1C1A A;  5AQH A;  4DS4 A;  1TYQ A;  3F9M A;  5KGX A;  4BE2 A;  1NWK A;  1S72 N;  1Q82 O;  4N41 A;  3TAR A;  1EX4 A;  2FBX A;  4ZTJ A;  1BI4 A;  4FJI A;  4JD2 A;  1LW0 A;  3HT3 A;  2QWN A;  4BR9 A;  5KPT A;  3HJF A;  3QEI A;  1UA0 A;  5M1N A;  5E84 A;  4X64 K;  3OHR A;  3RSE A;  3CQY A;  1LW2 A;  3A2F A;  4A61 A;  4KHY A;  5AQM A;  2VCP A;  4FWN A;  2A6A A;  3VF6 A;  3LL3 A;  3WEE A;  3LAL A;  4PKG A;  1YVU A;  1LCU A;  3KTQ A;  1TV6 A;  5J2N A;  4FW1 A;  3MCP A;  4JK8 A;  2E5L K;  5GIO A;  2NRR A;  4PL8 A;  2ASM A;  2WTU A;  4DU4 A;  5FRM A;  5BR8 K;  4EIA A;  4CJ3 A;  4BE1 A;  2O4G A;  2OAN A;  4HCC A;  3TAQ A;  1YJW N;  3MN5 A;  2HVH A;  5HL7 L;  3TWH A;  4YDU C;  1BIS A;  1WSI A;  4CI6 A;  4LSN A;  4FM1 A;  3I8B A;  3RMC A;  5JS1 A;  4JKC A;  1ATS A;  4OJR A;  5BRE A;  3VOV A;  3EZW A;  4G9Z A;  3LPU A;  4RW4 A;  4HTU A;  5LJV A;  4WYB A;  2NRX A;  3U3Y A;  1KCF A;  4KPY A;  4KHW A;  4F8R A;  4FK0 A;  3DLG A;  5EY4 A;  1U04 A;  4LD0 A;  4JI2 K;  3ZSY A;  4E3S A;  1NNE A;  1DKG D;  5LL6 Z;  4CED A;  2ASP A;  5KRS A;  1NGD A;  4JYA K;  1XUP O;  2ZE2 A;  1IKV A;  1KRP A;  1TL1 A;  4A59 A;  4E0D A;  2FBV A;  3CER A;  1U2V A;  3WQU A;  1Q9Y A;  3FFK B;  2ZGZ A;  3J80 O;  5ELZ A;  4ISF A;  3T1A A;  4FM0 A;  3CJ9 A;  4IG0 A;  3AVA A;  4JKA A;  1O1W A;  5B8H A;  3V9X A;  4CW7 B;  2YJF A;  4BY9 C;  3QER A;  1YJ9 N;  5BN9 A;  3DXM B;  4A62 A;  4CBX A;  1JLA A;  5C2F A;  2A5X A;  5GAE P;  4CZL A;  4B3R K;  4DFK A;  2E2N A;  4IJN A;  4HUE A;  1WB9 A;  3SJH A;  4M3X A;  2B4J A;  1TVR A;  5LJW A;  1D9D A;  2E20 A;  4DV1 K;  1W0H A;  3EE9 A;  5BN8 A;  4H5V A;  3LAN A;  4EAH D;  4PUO A;  4IFE A;  4NB4 A;  4H0X B;  1HKC A;  1NGB A;  2JGU A;  3E9L A;  5MLC Q;  1BO5 O;  1QSS A;  1RFQ A;  5AZJ A;  2VQE K;  3M5R A;  2YJE A;  3VTI A;  3AVB A;  4CD3 A;  4IOC L;  1ZBL A;  2D0B A;  1VQK N;  1C1C A;  4FL9 A;  4IFY A;  3BGR A;  3L6Q A;  3HYF A;  3V9W A;  1U4B A;  5HBM A;  3P31 A;  1Q81 O;  4CF2 A;  4U7B A;  1LOT B;  4PQU A;  3NF9 A;  4DQ8 A;  4DS5 A;  3L3U A;  1TUU A;  3DLE A;  4BRG A;  4W5Q A;  1RDU A;  4YOV A;  1F21 A;  1T03 A;  3KWI A;  3V81 A;  1X9J A;  1VHX A;  4BAC A;  4FJ5 A;  5AQV A;  1CXU A;  2V7Z A;  4FWL A;  4ISE A;  1RDW X;  4GKK K;  2GTD A;  4KHP K;  4PKH A;  1BA1 A;  2V51 B;  1SL2 A;  1C1B A;  1S5J A;  1VSH A;  3OS0 A;  4K42 A;  2QI2 A;  1QQN A;  4FO0 A;  5AQT A;  2CGL A;  4FM2 A;  3L8B A;  3AO2 A;  3TAF A;  1NOY A;  3CFO A;  3NCI A;  4FJK A;  1RTH A;  4DUY K;  3IDH A;  3OY9 A;  4IDK A;  5M1Q A;  3RVC A;  4Z4G A;  4BRM A;  5HRP A;  4O8K A;  4CEF A;  1UOC A;  4DR6 K;  3L2Q A;  2A1S A;  3R1X A;  3CCM N;  4A57 A;  2P9N A;  2QA4 N;  3QEP A;  3JS6 A;  2G8W A;  3CJC A;  3S9H A;  2HHT A;  1LAV A;  2NNW A;  3DXM A;  4I6M B;  4CES A;  4DV6 K;  2OYQ A;  3O9R A;  4OPH A;  3VEY A;  3ZX2 A;  4CCH A;  4RTF D;  3O9U A;  3O1B A;  1NKB A;  4FWS A;  1N6Q A;  3K5O A;  3I0R A;  3I0S A;  4DTP A;  4CD1 A;  5FRN A;  5C12 A;  3CCR N;  2YNF A;  4CJ4 A;  1HNX K;  1HKB A;  5AFU H;  4FOI A;  4OGC A;  5KGW A;  1P8Z A;  3VGK A;  4OKE A;  3K57 A;  1SL1 A;  2HBL A;  2D5R A;  4B9L A;  1ZBI A;  3LDS A;  4LFB K;  1YT3 A;  5C10 A;  4R5P A;  4DQP A;  3C0B A;  2HBJ A;  3EZ5 A;  3O3F A;  3D7E O;  2D1K A;  2GX9 A;  5T7B A;  4H0T B;  3P38 A;  2W42 A;  2Z1H A;  2Q1N A;  1KFD A;  3NF8 A;  4FJ8 A;  3LP0 A;  2HBM A;  2P9L A;  3CCJ N;  3UKU A;  4C1N K;  4XIU A;  2KFZ A;  3NH2 A;  1JLB A;  2FF6 A;  3AO1 A;  5FPD A;  1IBK K;  4X66 K;  3V9S A;  5AQQ A;  1ZBH A;  3VET A;  1EO1 A;  1NGE A;  3NFA A;  1MA9 B;  4B1X B;  3VQB A;  1T05 A;  2HND A;  1RT2 A;  2YKM A;  3AA3 A;  1XNQ K;  1KLM A;  4YDU A;  1RT4 A;  4JI6 K;  1RCH A;  4CJF A;  4E1N A;  2B6A A;  4FJG A;  2P9K B;  1S1W A;  1NK4 A;  2W6L A;  3WXJ A;  3AV9 A;  2QEX N;  4KH4 A;  3TPQ A;  3TAM A;  1TL3 A;  1EXQ A;  2XRI A;  4O0I A;  3RRH A;  3ALY A;  5JLH A;  4ICL A;  4JK7 A;  4CK3 A;  2A40 A;  3AO5 A;  3PX0 A;  4NLB A;  1WSF A;  1OKJ A;  4RW7 A;  3IKM A;  4JI5 K;  5DK5 A;  4UY8 O;  2YV0 X;  3TI0 A;  2NRH A;  1REV A;  3ENH A;  4WCE L;  4PY5 A;  2HHW A;  4I6M A;  5GAH P;  3C6T A;  1WBB A;  4WQ5 A;  3VEX A;  4WE1 A;  3F5T A;  4DFM A;  4Z0U A;  2F7T A;  1NKC A;  1Z25 A;  4FW2 A;  2EHG A;  3THX B;  3HST B;  2ITG A;  1HQE A;  2BH1 A;  3S3O A;  3QNO A;  3CXC M;  4E1M A;  2ATQ A;  3QB0 A;  4AF1 A;  3R6M A;  3SZ2 A;  1RT7 A;  2Z1I A;  4Q0B A;  2HNZ A;  4EHT A;  1ATN A;  1HYV A;  4M45 A;  3TSU A;  4KH6 A;  2D0C A;  5C0Y A;  1MU2 A;  2GWK A;  1YAG A;  1ZBU A;  5KRT A;  1OH7 A;  4ISG A;  4AHR A;  4H5W A;  3HXM A;  4ELT A;  3WXI A;  2VWB A;  4Y1D A;  4UQG A;  4IKF A;  3KZB A;  3N4P A;  2PFU A;  3U4L A;  3CCL N;  3M8Q A;  3FZM A;  1VSI A;  4CVN E;  4C8O A;  3SMS A;  3OBY A;  4H8K A;  4FWR A;  1X3M A;  4JKE A;  4OPA A;  3VQ6 A;  4JLH A;  1JL2 A;  2HHQ A;  1ASU A;  3ZT4 A;  3LM2 A;  3SUP A;  2QXF A;  3M8S A;  3EEQ A;  3U8X A;  3T69 A;  2E6L A;  4KAZ A;  1RNH A;  3IFR A;  4YOW A;  2NRZ A;  2HHV A;  3CC4 N;  3EY1 A;  2A1R A;  4MO4 A;  1ILY A;  2XY6 A;  1HMV A;  3JYT A;  3SYZ A;  4B3T K;  2Z1G A;  1WN7 A;  1QHA A;  3CI5 A;  2JLE A;  5HRN A;  1JCF A;  4JNE A;  4WF9 L;  2NRW A;  2DTU A;  2P9K A;  4FWM A;  3I33 A;  4B8C A;  4IXC A;  2IC3 A;  4AHV A;  4DKW A;  5FPE A;  2P9I B;  4BR4 A;  3NH0 A;  4CZE A;  3O3G A;  3RMB A;  2VG5 A;  1X9M A;  1NJI O;  4CF1 A;  3W0L A;  5DM6 L;  3NDK A;  3CG7 A;  4NLC A;  4NCA A;  4KB1 A;  3TAB A;  4FWQ A;  2P9U B;  2KKZ A;  4YOT A;  3OJU A;  4GV9 A;  1QE1 A;  4BC5 A;  2Q2R A;  3FLC O;  3A5O C;  4AHU A;  3OYA A;  2X6S A;  3P5J A;  3LDL A;  3G0Z A;  1VQ4 N;  3AY9 A;  3OS2 A;  1NK0 A;  1RTJ A;  3THX A;  3UIQ A;  1RDA A;  1VSM A;  4BG8 A;  1KSP A;  4YOR A;  4BVP A;  4BG9 A;  2ZD1 A;  4ZHR A;  4AIL C;  1ASV A;  2QWR A;  3AAR A;  3QEV A;  3PIO L;  3VES A;  3W3D A;  4GV6 A;  4JEP A;  1QSY A;  1UWB A;  4B1U B;  3LDQ A;  4CE9 A;  1YF5 L;  3IAY A;  4WFN L;  3VQ5 A;  3V6D A;  4JD2 B;  3FZF A;  3OA9 A;  3WT0 A;  1QS4 A;  3ULE B;  3AAP A;  3TAN A;  2HF4 A;  3EO3 A;  1Y97 A;  3DOK A;  3G71 N;  4KI6 A;  5HRS A;  4FJM A;  5LY3 A;  4DF4 A;  5CYQ A;  4DR3 K;  1LWF A;  4LH5 A;  2Z1J A;  5GAG P;  2VGM A;  4M3U A;  1QZ5 A;  4B9U A;  3THV A;  3ZSO A;  1KVB A;  2UUA K;  1G99 A;  3SQ4 A;  4J2D A;  5D3G A;  1TAQ A;  1VSK A;  2E1Y A;  1OVQ A;  5KI6 A;  3VEZ A;  1NGC A;  3DLH A;  1WSG A;  4DU3 A;  4CIG A;  2PYJ A;  1T8E A;  1K73 O;  2IVP A;  2F9T A;  1YTA A;  3KK7 A;  3O1W A;  1T7P A;  1C0F A;  1NMD A;  2XY5 A;  3SV3 A;  3OYG A;  4C8M A;  2GV9 A;  5JIC A;  2QWM A;  2O8B B;  3OVN A;  1RT3 A;  5HRR A;  3QBW A;  1RBS A;  3V1Q A;  5DMR A;  1QVF M;  4IOX A;  3AVK A;  4DFP A;  3AVH A;  3BY5 A;  3UKR A;  4H5T A;  2YHB A;  2F8T A;  2UUC K;  1FJG K;  4CEC A;  1BDG A;  3CM5 A;  1KLN A;  2FC0 A;  3OYJ A;  5JS2 A;  2ZM6 K;  3QET A;  3LDN A;  3ZLJ A;  4OLB A;  3OBW A;  1HNZ K;  3HL8 A;  4M3Y A;  3ID8 A;  4MQ3 A;  2YKN A;  5LMN K;  4PHT X;  4CJL A;  2P9S A;  4B3S K;  3VQ8 A;  3GBT A;  1Q18 A;  3I56 N;  4E7L A;  5CR4 A;  3SV4 A;  3R3L A;  2VG6 A;  2HOE A;  1DTT A;  3LZI A;  4LFC K;  3MN7 A;  4DV2 K;  4I9Q A;  1B9D A;  2D0O A;  4EFH A;  2QKK A;  4BRO A;  3ULE A;  3AVM A;  4EZ6 A;  4LF6 K;  1QQM A;  4H0P A;  3V1O A;  1JL1 A;  4B8A B;  1YIJ N;  1SKS A;  4KBO A;  2V7Y A;  5M1K A;  3OYC A;  1C0T A;  5AZJ B;  4FZX C;  1XC3 A;  1G15 A;  3EN9 A;  1ZC6 A;  2CGJ A;  3K58 A;  1XHX A;  4DTN A;  3VPZ A;  3AA5 X;  3C94 A;  2ZJQ L;  4DB3 A;  2QK9 A;  4NYN A;  2NRV A;  1JLG A;  4F3T A;  2WON A;  5I3U A;  3CHW A;  1DT9 A;  4IZ9 A;  3A8Y A;  4BC4 A;  4NXN K;  4I9L A;  1SUQ A;  4KH5 A;  4HTL A;  4ILH A;  4DTR A;  4C8K A;  3VQQ A;  3T1H K;  4BQZ A;  3ZSV A;  5I9E B;  4QS9 A;  5DM7 L;  4QS7 A;  4CER A;  4JN4 A;  1DGK N;  4CEA A;  1IG8 A;  2CGK A;  1RGI A;  1KAX A;  3ZCM A;  1RTI A;  3BP8 A;  3VA0 A;  4BQL A;  3BF1 A;  4GKJ K;  3KKR A;  3O9Q A;  2O8B A;  3E9O A;  3TSQ A;  1KXP A;  2EX3 A;  3CCU N;  2UYT A;  3LP1 A;  4K25 A;  3HZ6 A;  3NGY A;  3DXK B;  3VQ7 A;  5HP1 A;  2B5J A;  2PYL A;  4GVE A;  4BDY A;  2P9N B;  2O4I A;  4DQR A;  4Z4C A;  4LF9 K;  3KK3 A;  2A41 A;  1MWK A;  1HPM A;  2FSN A;  3LP2 A;  2F8S A;  5K14 A;  4YNQ A;  4DSE A;  4CZG A;  5BPL A;  1O13 A;  2OA8 A;  4BRH A;  2XO7 A;  1TKT A;  1L3U A;  1SQK A;  3BUZ B;  4DSL A;  2W6K A;  2ZJR L;  3M1F A;  4EZ9 A;  4X62 K;  1YVN A;  3FGU A;  2Q3S A;  4CEQ A;  3CC7 N;  4DTM A;  2P5G A;  2AA4 A;  1HNW K;  1N36 K;  1KAY A;  4PL7 A;  4BRF A;  4BR7 A;  2RHK A;  2OCE A;  3MEG A;  3DMJ A;  5FPM A;  1WLJ A;  4KI4 A;  3IG1 A;  4A2A A;  3RR7 A;  1TGO A;  1NGH A;  4CEB A;  5CYM A;  4DR5 K;  5EVZ A;  3KK2 A;  5F0X A;  4E7I A;  4FLW A;  1C6V A;  3A5L C;  2IVO A;  4BRI A;  3SQ2 A;  4A5A A;  1NOZ A;  4CJR A;  3VQA A;  4KFB A;  3KHY A;  4FVM A;  5LMU K;  4OLA A;  3PO4 A;  2NLX A;  4DG1 A;  4B08 A;  2O8C A;  5ADX H;  4IWV A;  5CY4 A;  3SQ1 A;  3VQ4 A;  5CE3 A; 
#chains in the Genus database with same CATH homology
 1HRH A;  4FJG A;  4NCB A;  4B9U A;  3TAE A;  1S1W A;  1NK4 A;  3WNF A;  1FKO A;  2YNI A;  3O4N A;  4CJU A;  3AV9 A;  3ZT0 A;  4K8X A;  1KFS A;  3TAM A;  1TL3 A;  1EXQ A;  2XRI A;  4O0I A;  3RRH A;  3ALY A;  1L3T A;  4ICL A;  4LY7 A;  4CK3 A;  3OYL A;  3SI6 A;  3LWM A;  3AO5 A;  2F96 A;  3PX0 A;  1WSF A;  4KV8 A;  4RW8 A;  1GOB A;  4ID1 A;  5CZ1 A;  3KLE A;  5HRO A;  1IO2 A;  3P83 D;  3EYZ A;  4PA1 A;  4RW7 A;  5SZT A;  1TK0 A;  4PWD A;  5DK5 A;  3QLH A;  1ASW A;  2YV0 X;  3TI0 A;  4KTW A;  4ELU A;  1REV A;  2FBY A;  4Y1C A;  3RMA A;  3ITH A;  4PY5 A;  2RPI A;  4J2B A;  2HHW A;  5FDL A;  4AH9 A;  2GUI A;  5EU7 A;  3C6T A;  4H4O A;  4FZZ A;  1IKX A;  1JXE A;  4CJF A;  4WE1 A;  4DFM A;  1BI4 B;  3RTV A;  4Z0U A;  4YFU A;  1KVC A;  1RBR A;  5J2P A;  3HP6 A;  1NKC A;  1Z25 A;  4FW2 A;  2EHG A;  3KLF A;  3SUN A;  1VK0 A;  4FJL A;  3HK2 A;  3HST B;  2Y1I A;  4Z4I A;  4JS5 A;  2ITG A;  1HQE A;  3S3O A;  3H08 A;  3QNO A;  1SV5 A;  1WSJ A;  2G8I A;  4QAG A;  5J2Q A;  4E1M A;  2ATQ A;  2HMI A;  2RKI A;  1S9G A;  4O55 A;  4CHP A;  1HNI A;  4OKJ A;  3LAM A;  2BE2 A;  3IRX A;  3IS9 A;  3WNG A;  1RT7 A;  2Z1I A;  3SZ2 A;  4E7H A;  4Q0B A;  2HNZ A;  2G8V A;  1HYV A;  1S1V A;  4M45 A;  4M41 A;  4RG8 A;  3V9Z A;  1S6P A;  5J2M A;  2RN2 A;  2D0C A;  1JLC A;  1IH7 A;  1QHT A;  1MU2 A;  1ZYQ A;  1ZBU A;  5KRT A;  1X1P A;  4AHR A;  2XHB A;  4GW6 A;  1LV5 A;  3NGZ A;  1J54 A;  2DFH A;  3LP3 A;  4CJT A;  3T19 A;  1IKW A;  1UAX A;  3HXM A;  1L5U A;  3HPG A;  1RT1 A;  3KLH A;  1XC9 A;  3VA3 A;  4ELT A;  4CGD A;  3HM9 A;  1YTU A;  2KZZ A;  3FFI A;  4Y1D A;  4UQG A;  2LSN A;  4CEE A;  4IKF A;  4CJ5 A;  3L2W A;  3OYD A;  1U45 A;  4CHN A;  3M8Q A;  3ZSW A;  4BE0 A;  1D8Y A;  1VSI A;  4JS4 A;  1S1T A;  3CYM A;  4ZTF A;  3HP9 A;  3HVR A;  4C8O A;  4KRF A;  2KFN A;  1KVA A;  4H8K A;  3KLI A;  4FK2 A;  1B92 A;  5C25 A;  3VQ6 A;  4JLH A;  1JL2 A;  1WNS A;  1ASU A;  4CJK A;  2HHQ A;  4AHS A;  3ZT4 A;  1VSD A;  3O4Q A;  1A5X A;  1VRU A;  2HVI A;  1J9A A;  4HHT A;  2QXF A;  3SUP A;  3M8S A;  3RRG A;  3SPY A;  1RBU A;  4RW9 A;  4Z4H A;  3SJJ A;  3CQ8 A;  4KAZ A;  2E6L A;  3S3N A;  1RNH A;  4MFB A;  3LWL A;  3MXM A;  1U48 A;  1NK9 A;  4FJH A;  2HHV A;  1CLQ A;  3EY1 A;  2A1R A;  1HNV A;  4AHC A;  4CHZ A;  4CF9 A;  3QNN A;  3CM6 A;  1HMV A;  2X74 A;  2YNH A;  1HQU A;  4CJP A;  2Z1G A;  3JYT A;  3SYZ A;  4CJV A;  1WN7 A;  3ZT3 A;  1NJY A;  2BGG A;  4BDZ A;  3AA2 A;  1C0M A;  2JLE A;  5HRN A;  1JLF A;  1C0U A;  1LWE A;  3AO3 A;  4M3Z A;  3TR8 A;  3NHG A;  2IDO A;  1S1X A;  1FK9 A;  3ZSZ A;  3SPZ A;  2XY8 A;  1J5O A;  4CEO A;  2DTU A;  4DWI A;  4B8C A;  2E4L A;  3NE6 A;  1RDC A;  4FLU A;  2IC3 A;  3C6U A;  2OZM A;  1TAU A;  4BWM A;  4CK2 A;  1EET A;  3MEC A;  3MEE A;  4CGH A;  3D0P A;  4AHV A;  4DLG A;  4FJJ A;  1VSL A;  3NH0 A;  3O3G A;  4KO0 A;  3NBP A;  3RMB A;  1BHL A;  4CJQ A;  2VG5 A;  4KHU A;  3WNH A;  3AO4 A;  1X9M A;  2G8K A;  2DFF A;  4FJX A;  4CF1 A;  2HW3 A;  4FCY A;  2HHU A;  3ZSR A;  2G8H A;  3BDP A;  3QEX A;  3G10 A;  4DFJ A;  4CJW A;  4FJ9 A;  3NDK A;  1HPZ A;  1NKE A;  2HHX A;  3CG7 A;  3MXI A;  4NCA A;  4KB1 A;  3TAB A;  4KB0 A;  2XY7 A;  4FLT A;  4CFD A;  3OYB A;  3E01 A;  1C1A A;  4O4G A;  3WNE A;  3OJU A;  2IAJ A;  1QE1 A;  4OVL A;  4DS4 A;  4AHU A;  5KGX A;  3OYA A;  4BE2 A;  4N41 A;  2X6S A;  3P5J A;  3I8D A;  3TAR A;  1EX4 A;  3G0Z A;  2FBX A;  3RMD A;  4ZTJ A;  1BI4 A;  4FJI A;  2KZM A;  1LW0 A;  3HT3 A;  3OS2 A;  1NK0 A;  1RTJ A;  3HJF A;  3V1R A;  3QEI A;  1UA0 A;  2IOC A;  3ZSQ A;  5C42 A;  1JKH A;  3B6O A;  4IBN A;  1XHZ A;  3UIQ A;  4B9T A;  4DLE A;  3K5N A;  3CFP A;  1RDA A;  1LW2 A;  3QIO A;  1VSM A;  1ZBF A;  3VN5 A;  3A2F A;  3AVN A;  1N5Y A;  1KSP A;  4KHY A;  3B6P A;  3OYK A;  1Q8I A;  2ZD1 A;  4ZHR A;  3LAL A;  1ASV A;  3ZT1 A;  4CFC A;  4AIL C;  3QEV A;  1TK8 A;  1TKZ A;  1YVU A;  4F2S A;  3KTQ A;  1TV6 A;  1LWC A;  5J2N A;  1QSY A;  4FW1 A;  2RF2 A;  4M3R A;  4DTO A;  4KHS A;  1UWB A;  4W5R A;  4HVJ A;  3KD5 E;  4E7J A;  4CE9 A;  4CHY A;  3OYF A;  3KJV A;  4DU4 A;  3PX4 A;  3IAY A;  3VQ5 A;  3V6D A;  4CJE A;  5FRM A;  2QKB A;  1QS4 A;  2IGI A;  4C8L A;  4BWJ A;  4B9S A;  3TAN A;  4BE1 A;  4CJ3 A;  3PX6 A;  4W5N A;  2O4G A;  3L2R A;  3QO9 A;  1Y97 A;  4CHQ A;  3DOK A;  3TAQ A;  4HCC A;  4AHT A;  2HVH A;  1CZ9 A;  2WOM A;  3K2P A;  5FRO A;  5HRS A;  3TWH A;  4EP4 A;  4DF4 A;  4FJM A;  1BIS A;  4KI6 A;  1WSI A;  5CYQ A;  4LSN A;  4FM1 A;  3HVT A;  1WAF A;  1LWF A;  2D0A A;  4CEZ A;  4LH5 A;  3RMC A;  5JS1 A;  2YNG A;  4OJR A;  3U6F A;  2BDP A;  4O0J A;  4CGG A;  4DSK A;  1J53 A;  1BL3 A;  2Z1J A;  3LPU A;  4RW4 A;  4GMJ B;  4DSI A;  4J2A A;  4M3U A;  4O44 A;  1NJZ A;  3THV A;  2VWK A;  3DI6 A;  5I42 A;  3ZSO A;  1KVB A;  3NF6 A;  4KKO A;  3HPO A;  3LZJ A;  4HTU A;  4B9N A;  3AVC A;  3V9U A;  2OPR A;  1L3S A;  3U3Y A;  3SQ4 A;  1KCF A;  4KPY A;  1RT6 A;  4KHW A;  4F8R A;  4FK0 A;  1GOA A;  2BAN A;  3DLG A;  1CXQ A;  4J2D A;  3S3M A;  5D3G A;  1U04 A;  1TAQ A;  1VSK A;  4FLX A;  1NK8 A;  1BCM A;  4FZY A;  4LD0 A;  5KI6 A;  3ZSY A;  4CHO A;  4E3S A;  4DMN A;  4I2Q A;  3OYI A;  1WSG A;  1JLQ A;  4E7K A;  1XWL A;  3DLH A;  4CED A;  3KKS A;  2X6N A;  2OPS A;  1VSF A;  4DU3 A;  3AVJ A;  4CIG A;  5KRS A;  4CGI A;  3V4I A;  2ZE2 A;  1A5W A;  1T8E A;  2PYJ A;  4KRE A;  1SKR A;  1RTD A;  3T3F A;  1IKV A;  1KRP A;  4ELV A;  1YTA A;  1TL1 A;  1T7P A;  2OPQ A;  4E0D A;  2FBV A;  2DFE A;  4CF0 A;  4CJS A;  2XY5 A;  3L2U A;  4F4K A;  1Q9Y A;  3SV3 A;  4HCB A;  1EP4 A;  3OYG A;  2OPP A;  1RDD A;  2GV9 A;  2X78 A;  3DRS A;  4C8M A;  1U49 A;  1BQN A;  4QCL A;  2KQ2 A;  4HUG A;  4M42 A;  1NK6 A;  3T1A A;  1S1U A;  3VQP A;  4FM0 A;  4IG0 A;  1X9S A;  3AVA A;  3OVN A;  1O1W A;  1RT3 A;  5HRR A;  3V9X A;  5CZ2 A;  1RBS A;  2G8U A;  4J2E A;  2KW4 A;  1SL0 A;  3V1Q A;  5DMR A;  4IG3 A;  3QER A;  3TAP A;  3AVK A;  4DFP A;  1NJW A;  1JLA A;  2HB5 A;  3L3V A;  3AVH A;  2F8T A;  5KTQ A;  2YHB A;  2R7Y A;  4JRQ A;  1BGX T;  1R0A A;  1FXX A;  4OPJ A;  4FLZ A;  4CEC A;  3CM5 A;  1KLN A;  2FC0 A;  3OYJ A;  4DFK A;  1JXB A;  5JS2 A;  3QET A;  1RDB A;  4HUE A;  2PY5 A;  1NJX A;  4M3X A;  3VQD A;  1IG9 A;  2B4J A;  1TVR A;  1QQC A;  1D9D A;  4N56 A;  4OLB A;  3KK1 A;  4CK1 A;  1W0H A;  3P1G A;  4CGF A;  3HL8 A;  1TK5 A;  3RR8 A;  3RWU A;  3OYM A;  4M3Y A;  4B9V A;  3ISN C;  3LAN A;  3NF7 A;  2YKN A;  1DLO A;  4MQ3 A;  3OJS A;  4DTU A;  4CJL A;  4N47 A;  4PUO A;  1D5A A;  2JGU A;  3VQ8 A;  1QSS A;  2XY6 A;  1DTQ A;  4RW6 A;  3AVB A;  3AVI A;  2KTQ A;  1ZBL A;  2D0B A;  1C1C A;  1S6Q A;  4IFY A;  3BGR A;  3SV4 A;  4E7L A;  1UA1 A;  2ZQB A;  3LAK A;  3VQE A;  3HYF A;  2VG6 A;  3V9W A;  2GBZ A;  1U4B A;  1NK5 A;  4DU1 A;  2G8F A;  5HBM A;  1DTT A;  3HPH A;  4CF2 A;  3LZI A;  1NK7 A;  4PQU A;  4IFV A;  1A5V A;  3NF9 A;  1B9D A;  4LSL A;  3M8R A;  4I9Q A;  3ASM A;  2QKK A;  4M3T A;  3AVM A;  3L3U A;  4DS5 A;  3DLE A;  4EZ6 A;  3F73 A;  4CFA A;  4FLV A;  3HO1 A;  3V1O A;  4W5Q A;  1F21 A;  1JL1 A;  1T03 A;  3V81 A;  1TKD A;  3SCX A;  4B8A B;  3SQ0 A;  3QES A;  4BAC A;  1SKS A;  3DM2 A;  4FJ5 A;  3AVG A;  3OYC A;  3JSM A;  1C0T A;  1CXU A;  1RIL A;  4FZX C;  3AVL A;  1G15 A;  3K58 A;  1EKE A;  1XHX A;  4M3W A;  4DTN A;  3O3H A;  4CGJ A;  1BQM A;  3AA5 X;  3MXJ A;  3C94 A;  4EP5 A;  1C1B A;  1SL2 A;  1S5J A;  2HNY A;  1X9W A;  1VSH A;  4CIF A;  3OS0 A;  2QK9 A;  3ULD A;  4NYN A;  1B9F A;  2P51 A;  1JLG A;  4F3T A;  2WON A;  5I3U A;  1I39 A;  3LPT A;  4NCG A;  4FM2 A;  3L8B A;  3DYA A;  4DQQ A;  3AO2 A;  3TAF A;  1NOY A;  3CFO A;  3NCI A;  4FJK A;  1K6Y A;  4GVM A;  1RTH A;  4I9L A;  1WSE A;  1SUQ A;  1L3V A;  4DTR A;  3OY9 A;  4C8K A;  3VQQ A;  1I3A A;  1SKW A;  1VSE A;  4KHN A;  4IDK A;  3L2V A;  4K8Z A;  3DLR A;  3ZSV A;  4Z4G A;  1JLE A;  1CZB A;  1Z26 A;  1VRT A;  3NAE A;  3OYE A;  3PV8 A;  4CER A;  1XI1 A;  5HRP A;  4CEA A;  2IS3 A;  4W5O A;  3U3G A;  1UOC A;  4CEF A;  3KIO A;  4F2R A;  3CFR A;  3ZCM A;  3L2Q A;  1RTI A;  4B9M A;  1VSJ A;  3VQ9 A;  4JRP A;  2A1S A;  3VA0 A;  2Y1J A;  3NGI A;  4TSX A;  2FBT A;  3C95 A;  4OPK A;  4DTX A;  4DSF A;  4FXD A;  3QEP A;  1W9H A;  3KKR A;  1LAW A;  3DRR A;  3NH1 A;  2G8W A;  2NUB A;  3S9H A;  1TKX A;  3D45 A;  4I2P A;  2ETJ A;  3KLG A;  2VWJ A;  4DSJ A;  2HHT A;  1LAV A;  3DRP A;  4CIE A;  2EX3 A;  4DTS A;  3LP1 A;  4B3O A;  3ZT2 A;  3KD1 E;  5HLF A;  3K5M A;  4FK4 A;  4OGE A;  4CES A;  4N76 A;  3NGY A;  3VQ7 A;  4FYD A;  4HUF A;  5HP1 A;  2OYQ A;  2B5J A;  1KTQ A;  1RBT A;  4KTQ A;  3PY8 A;  4FJ7 A;  3MED A;  3QIP A;  4CCH A;  3SUO A;  2VG7 A;  4DQI A;  3F9K A;  1IKY A;  2OZS A;  2PYL A;  1NKB A;  1QTM A;  4BDY A;  2P1J A;  4CF8 A;  1RT5 A;  2P5O A;  2O4I A;  4DQR A;  4Z4C A;  4CFB A;  3KK3 A;  3DLB A;  4QOZ B;  1FKP A;  3SNN A;  1N6Q A;  4NYF A;  3K5O A;  3I0R A;  1HYS A;  3LP2 A;  3I0S A;  1D9F A;  1ITG A;  2E6M A;  2PZS A;  1WAJ A;  2F8S A;  4BDP A;  4DTP A;  5FRN A;  5K14 A;  4YNQ A;  4W5T A;  4E89 A;  4DSE A;  2YNF A;  3OYH A;  4CJ4 A;  2OA8 A;  3M8P A;  3ZSX A;  1GOC A;  2XO7 A;  4FLY A;  1TKT A;  1L3U A;  4E19 A;  3QEW A;  4DSL A;  4OGC A;  4DQS A;  4EZ9 A;  1HYZ A;  3AA4 A;  1RBV A;  5KGW A;  3K57 A;  4OKE A;  4F3O A;  1SL1 A;  3SUQ A;  4FJN A;  1S9E A;  4KHQ A;  2D5R A;  4B9L A;  1ZBI A;  3MAQ A;  2Q3S A;  4CEQ A;  3AVF A;  3LDS A;  3PUF A;  4DTJ A;  4DTM A;  1YT3 A;  5E41 A;  2P5G A;  5SWM A;  4L8R B;  4R5P A;  4O5B A;  1U47 A;  4DQP A;  3OS1 A;  3VQC A;  5J1E A;  4LH4 A;  3MEG A;  4Q5V A;  3DMJ A;  5C24 A;  3EZ5 A;  1WLJ A;  4KI4 A;  3IG1 A;  1Q9X A;  1BIZ A;  3O3F A;  4Z4F A;  4N5S A;  1QSL A;  3PO5 A;  3RR7 A;  1TGO A;  1HJR A;  4DF8 A;  4C8N A;  5T7B A;  4H4M A;  4CEB A;  5CYM A;  2W42 A;  4OKK A;  2Z1H A;  3KK2 A;  2HHS A;  3DLK A;  3K5L A;  4E7I A;  1KFD A;  4FLW A;  3NF8 A;  4FJ8 A;  1C6V A;  3LP0 A;  3QIN A;  2I5J A;  4I7F A;  4XIU A;  3SQ2 A;  2KFZ A;  1BCO A;  1NOZ A;  4CJR A;  3NH2 A;  1WSH A;  1JLB A;  3AO1 A;  3VQA A;  4KFB A;  1ZBH A;  3V9S A;  4FVM A;  3OYN A;  4OLA A;  4G1Q A;  3NFA A;  3TAG A;  3PO4 A;  3K59 A;  3VQB A;  2DY4 A;  1BIU A;  4B08 A;  4KTZ A;  4DG1 A;  2HND A;  1T05 A;  1RT2 A;  2YKM A;  2YHA A;  3AA3 A;  1KLM A;  3DOL A;  4ID5 A;  4Z4E A;  5CY4 A;  1RT4 A;  1RCH A;  2AJQ A;  3SQ1 A;  3VQ4 A;  4E1N A;  2B6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...