1ZBFA

Crystal structure of b. halodurans rnase h catalytic domain mutant d132n
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
132
structure length
132
Chain Sequence
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of RNase H Bound to an RNA/DNA Hybrid: Substrate Specificity and Metal-Dependent Catalysis.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase
molecule keywords ribonuclease H-related protein
total genus 41
structure length 132
sequence length 132
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1zbfA00
4E1MA 2YV0X 3I0RA 1VSJA 1I3AA 3IG1A 4CEDA 5EU7A 3QEIA 4CHYA 3ZT0A 1IKWA 4KHYA 1BIUA 3MECA 1CXQA 4E0DA 3IS9A 1DTQA 4AHUA 3RWUA 4L8RB 1WSHA 3FFIA 4CF0A 1TKDA 4CERA 5KRSA 1KVAA 4KHNA 5CYQA 4F2RA 3TI0A 3SUPA 3KTQA 4FJGA 3KK1A 1U4BA 4CJSA 3D0PA 4EP4A 1N5YA 1T05A 3OJSA 4W5NA 4J2DA 1JLFA 1TK0A 3OYKA 3LANA 3K59A 3NGIA 5J2MA 3UIQA 1D8YA 5T7BA 4E1NA 1W0HA 4F8RA 4CGFA 1QTMA 3ZSWA 4ZTFA 4DTJA 2HHQA 1KVCA 1TVRA 1LAVA 4TSXA 4AHVA 4N47A 3KLEA 1C0TA 1JL2A 3NH2A 1KLMA 1RBSA 1RTIA 4CF8A 1NK4A 1BQMA 3OYJA 3JSMA 4CEBA 4E7HA 3OY9A 3LZJA 4FLWA 2XY8A 4PUOA 1S6QA 4N56A 3O4NA 4AHCA 2R7YA 3L3VA 1IKVA 4HTUA 4ID1A 2HHTA 3OYHA 3SPYA 3AVHA 4BE2A 2YHBA 3G10A 4Y1CA 3TAPA 1CZBA 1X9MA 2NUBA 4KTWA 1Q9YA 5I42A 4E19A 4LSNA 3HO1A 4Z4EA 1I39A 5KGXA 4EZ6A 4OKEA 3AO1A 4KFBA 1WSFA 3LP1A 4R5PA 2ZQBA 2Y1JA 2KFNA 5HROA 4BACA 3QEXA 3DLHA 2VG7A 1UA0A 1L3TA 1YTAA 1YVUA 3ISNC 3V9WA 4FJJA 2JLEA 4NCBA 1C1BA 3AVIA 3V9UA 4J2BA 1QHTA 1ZBHA 4CHZA 2QXFA 1RT7A 3VQ6A 3MEEA 2Z1JA 3MXJA 2G8HA 1VSHA 4OKKA 3HVTA 3KD5E 3M8PA 2X74A 3T19A 1B92A 4CFBA 2D0AA 1EETA 3PX6A 3RMDA 3VQ7A 3P83D 4KRFA 1D5AA 3ZT4A 3HXMA 4J2AA 1RT3A 4B3OA 2VWJA 1G15A 4HVJA 2G8FA 3S3NA 3NGYA 4FLXA 1QSLA 2B6AA 1C0MA 1JL1A 1X9WA 4GMJB 3TABA 2OPQA 3ZT2A 4DQQA 4RW7A 4CK1A 1RBRA 1LWFA 3L8BA 3V9ZA 2G8IA 1CXUA 1HPZA 4FJNA 1FKPA 3AVFA 4DSEA 1S5JA 4NCAA 3DRSA 1Z25A 4QAGA 4HUEA 3LAKA 4CJVA 3RMBA 4LH5A 2GUIA 4DTOA 2P51A 3AVLA 4GVMA 4K8XA 2PYJA 4NYNA 4CF9A 3VQ9A 2HHWA 4Q0BA 1JLEA 3HPGA 4CJQA 3S3OA 4KI6A 4M3UA 4FK0A 4E7KA 4PWDA 3TR8A 2DY4A 1C1CA 4CGDA 3I8DA 3QEVA 1DLOA 3V1OA 2D5RA 1HMVA 4CIGA 4ELTA 3RMCA 3NH0A 2Z1GA 3AO2A 4N5SA 3PX4A 4ID5A 3HVRA 3O4QA 2D0BA 2Z1IA 2EHGA 2ITGA 2O4GA 3AVBA 4BDYA 4M3YA 4KTZA 4AILC 4FW2A 4B8AB 3L2RA 5KTQA 3RRGA 4JRPA 3P5JA 4Z4IA 3QERA 4FJ8A 1WLJA 3M8SA 4M3ZA 1IKYA 3V6DA 4RG8A 1S1XA 3PX0A 3HSTB 4OPKA 1JLQA 4E7IA 3S3MA 1Q9XA 4CK2A 1J9AA 1HNIA 2OPPA 1TAQA 4IG3A 1WN7A 1CZ9A 4AHTA 2KTQA 1RTDA 3DLRA 1NK5A 4CJ3A 5C25A 1X1PA 5KRTA 3ZSRA 3V1RA 2YKNA 3HPHA 3ITHA 3H08A 2B5JA 2WOMA 4CHOA 3OS2A 1GOCA 1LW2A 1NKEA 4DSKA 4OJRA 1QS4A 1SV5A 4CJEA 1LW0A 5HRNA 2KQ2A 3RMAA 3V4IA 4Z0UA 4M3RA 3ULDA 3K58A 2ZE2A 4ZHRA 1RBVA 3VQDA 4QCLA 4NCGA 4DTUA 1REVA 3G0ZA 4DTNA 4Y1DA 3DOLA 3AO4A 4W5TA 2VG6A 4O0JA 3K57A 3L3UA 3HK2A 3BGRA 2HVHA 1JXEA 3QINA 3KLHA 3CQ8A 4J2EA 3OYFA 2DFEA 1NKBA 5K14A 4CEZA 3V9SA 4PQUA 1BHLA 4CGJA 4DSJA 2BDPA 1RT4A 4WE1A 4DTRA 4BDZA 1L3VA 3WNFA 3PO5A 4C8NA 3SNNA 2FBYA 4DMNA 3NDKA 3CFOA 4FJLA 1KCFA 4FLTA 3NHGA 4FLUA 2YNIA 3KLGA 5FDLA 4E7LA 4B9TA 3CM6A 3OJUA 3DI6A 4FLZA 1JLGA 4M41A 3ZSVA 2OZSA 2HHUA 3M8RA 2Y1IA 2JGUA 3VA0A 3LPUA 4FJIA 4HHTA 1ZBIA 2HW3A 3DOKA 4C8OA 4DWIA 3OYLA 3OYGA 3SQ0A 3P1GA 4FK2A 3C94A 4CJ4A 3LP2A 2B4JA 4LH4A 4B9UA 1L3UA 3SV3A 3VQBA 4B9LA 1JLBA 2D0CA 3MEDA 4RW4A 3SZ2A 4CJUA 2G8KA 1S9EA 1TAUA 3SI6A 5JS1A 3CFRA 1VRUA 3K5MA 3PV8A 3L2UA 3TWHA 1IO2A 1TKTA 3NF8A 4DSLA 4E7JA 1YTUA 1F21A 4G1QA 1HNVA 4I7FA 4IG0A 2DFFA 3EY1A 3VA3A 3F73A 4CJPA 2W42A 4DF8A 4F3TA 2HNYA 5DK5A 5HRSA 4KREA 2QKKA 2HB5A 2VWKA 3ZT1A 3SJJA 1BI4B 2RN2A 3WNEA 1O1WA 4CF2A 3T3FA 3NBPA 4LY7A 1KRPA 1TK8A 3CG7A 4O0IA 3LALA 4CK3A 5J2NA 2ETJA 4FZYA 3EYZA 3QNOA 4H4MA 1EP4A 1ZBFA 2IS3A 1BQNA 5JS2A 4H8KA 3IRXA 5HP1A 3QLHA 3DRPA 3B6OA 4DSFA 1BGXT 4HUGA 4BE0A 4KI4A 3TARA 1KFDA 1KTQA 3OYAA 4FVMA 5FROA 1ASUA 1YT3A 4BDPA 2X6NA 3SV4A 4OGCA 4QOZB 1HYSA 3VQ4A 2IOCA 3NH1A 3KK3A 1TKZA 2E4LA 5KI6A 5SWMA 1NK0A 3U6FA 2OZMA 4KPYA 4Z4CA 4CFAA 3C95A 4CECA 4O4GA 4DS5A 3SQ2A 3AO3A 3KK2A 2O4IA 4C8MA 4CF1A 3DLBA 4I2QA 3KLIA 4YFUA 1WNSA 4FXDA 4ZTJA 4KKOA 4DSIA 4CIEA 5CZ1A 4Z4FA 1XWLA 1VSKA 4CJRA 4RW9A 2BANA 5HBMA 4CEOA 1VK0A 2OPSA 4KB0A 1LAWA 1JLAA 5J2QA 1VSIA 3KKSA 3KKRA 2XRIA 4DFKA 3V81A 5CZ2A 3TAMA 2XO7A 1Z26A 2FC0A 2E6MA 3T1AA 4M3TA 2Z1HA 4HCCA 2FBTA 5J2PA 3K5LA 3DYAA 4DF4A 4FYDA 1U47A 2BGGA 3AVKA 1SKSA 2KW4A 4PA1A 1RNHA 1NJWA 4H4OA 3AV9A 4DU3A 1UOCA 1RTJA 3QESA 5HRPA 1C0UA 3DRRA 4CJWA 4AHSA 3SCXA 1TKXA 3AA2A 1X9SA 3NF9A 3ZSOA 4N41A 3NF6A 3NF7A 2F8SA 1RCHA 1QQCA 4EZ9A 5KGWA 4OPJA 4W5QA 3ZCMA 2PY5A 3AVGA 1BISA 3WNGA 3IAYA 1VSDA 3A2FA 1D9DA 3SUNA 1TK5A 1T7PA 1TV6A 1RBTA 4FZXC 2G8UA 3QEWA 3K2PA 1BCOA 3VQAA 2RF2A 4LD0A 5J1EA 1MU2A 1NOYA 2DTUA 4DG1A 3SPZA 4FJ7A 4KHQA 5DMRA 4W5RA 2F96A 3AA3A 3V9XA 2OYQA 4KHUA 1RDCA 3L2VA 4KHWA 4M3WA 4BWMA 3NGZA 3C6UA 1Q8IA 4FJ5A 3ALYA 1BIZA 3NFAA 2KFZA 1IG9A 2ZD1A 4CCHA 3OS0A 1J53A 1UWBA 3LPTA 3AVMA 3AVCA 4CGIA 1T8EA 1KVBA 1IKXA 1S1VA 3L2WA 3U3YA 1U48A 2IGIA 4JS5A 4B8CA 4AH9A 1RT6A 4CGHA 1KSPA 1BCMA 3VQPA 2YNHA 3ZSQA 1BL3A 4HCBA 4NYFA 4ELVA 3RR8A 3HT3A 2HHSA 3C6TA 1SUQA 4GW6A 1TGOA 3D45A 2GV9A 3M8QA 4IFVA 3ZT3A 3O3FA 1WSJA 4DU1A 1HYVA 3F9KA 4CHPA 1FXXA 3B6PA 4CJKA 2IDOA 2IAJA 2LSNA 4IFYA 4MQ3A 3PO4A 4CESA 3NCIA 3MXIA 1NK6A 3QIPA 4CHQA 3VN5A 3O3HA 1JKHA 1A5WA 3HP9A 2YNFA 1QSSA 2DFHA 1WAJA 3OYCA 4CE9A 3AA4A 3I0SA 3OS1A 1EX4A 4DFMA 1U49A 1NJYA 4FLVA 3PUFA 4CJFA 2XY6A 1L5UA 2OA8A 2EX3A 1SL0A 4IDKA 4I2PA 4RW8A 2X78A 1S6PA 4I9QA 1RT2A 4B9VA 4FJKA 3VQ8A 4CEAA 4UQGA 2QKBA 1CLQA 4DTXA 4CFDA 1GOBA 1RILA 1LWEA 3TAGA 3SQ4A 1LWCA 4AHRA 1NK7A 4KB1A 1S1TA 5HLFA 1VRTA 5SZTA 5C42A 5FRMA 1J5OA 3CM5A 3WNHA 2WONA 1HQEA 3LWMA 4I9LA 2G8WA 3BDPA 3QEPA 3QO9A 1UA1A 1EKEA 3LZIA 4KV8A 4W5OA 3MAQA 1C1AA 2VG5A 4DTSA 3S9HA 3PY8A 5D3GA 4DQPA 4DLEA 1SKWA 2YKMA 4JS4A 3AO5A 4FZZA 2QK9A 1UAXA 3AA5X 3AVJA 4ICLA 3SUOA 3AVAA 2KZMA 3VQ5A 3RRHA 1C6VA 4DS4A 1LV5A 1ZYQA 4C8KA 1RT5A 1KFSA 4IBNA 4O44A 2PZSA 4LSLA 3DLKA 4FM0A 1NJZA 3KJVA 1HYZA 2HMIA 4B9MA 1VSMA 1GOAA 2GBZA 3LP3A 4DQSA 1VSFA 2E6LA 3OVNA 1ZBUA 4O5BA 3ZSYA 1EXQA 1W9HA 3K5NA 1RTHA 3K5OA 3VQCA 4B08A 1RT1A 2HVIA 5CYMA 1XHXA 1B9DA 2HNDA 2Q3SA 4MFBA 3TAQA 1XI1A 3OYMA 3HM9A 4BE1A 4JRQA 4FJ9A 4F3OA 4EP5A 1ASVA 4FK4A 3LAMA 1XC9A 4OLAA 1HQUA 1NK9A 4RW6A 1K6YA 4DFPA 3SQ1A 5I3UA 1NKCA 2F8TA 2A1SA 3O3GA 3SUQA 4FLYA 4CHNA 2YNGA 4FJHA 4FJXA 4ELUA 4F2SA 3KLFA 1RBUA 4CEEA 4DLGA 4CIFA 4FCYA 3DMJA 1QSYA 3RR7A 4KAZA 3ZSZA 2HHXA 3OYBA 1FK9A 1ITGA 5HRRA 1WSGA 3ZSXA 4DQIA 1TL1A 3LDSA 4B9NA 3JYTA 1NOZA 4DTPA 4M3XA 2KZZA 3NAEA 4CFCA 3EZ5A 4KO0A 1JLCA 1FKOA 1S1WA 1VSLA 2FBXA 5CY4A 2P1JA 1WSIA 1S1UA 3DM2A 3QETA 3QNNA 1WAFA 1S9GA 1L3SA 1NJXA 4M42A 3OYIA 4IKFA 2X6SA 2BE2A 3DLGA 1B9FA 2FBVA 3NE6A 3DLEA 1T03A 1N6QA 2G8VA 3HP6A 3CFPA 4E3SA 4CEQA 3OYEA 4Z4GA 3SYZA 3CYMA 2RKIA 3KIOA 3LP0A 3OYDA 1WSEA 1DTTA 3AVNA 5E41A 2XHBA 4OGEA 1ZBLA 1SKRA 2XY5A 1U45A 1D9FA 2P5GA 4CJTA 4DU4A 1RDDA 1QE1A 4OKJA 1U04A 4XIUA 4FM2A 2A1RA 2P5OA 2AJQA 5C24A 1IH7A 4DQRA 1R0AA 2OPRA 4CGGA 3TANA 4Q5VA 2ATQA 3L2QA 4E89A 1TL3A 4JLHA 4BWJA 3LWLA 4B9SA 3MEGA 2I5JA 1SL2A 3QIOA 3HJFA 1A5XA 4KTQA 2PYLA 4DFJA 4YNQA 4HUFA 3V1QA 2XY7A 1KLNA 4OLBA 3VQQA 1HJRA 2RPIA 4N76A 1ASWA 3MXMA 1Y97A 1XHZA 1A5VA 4OVLA 4PY5A 3TAEA 4FW1A 3RTVA 4CEFA 1NK8A 4FM1A 5FRNA 4F4KA 4CJ5A 4K8ZA 3HYFA 3HL8A 2IC3A 1HRHA 4FJMA 3HPOA 3ASMA 1VSEA 4C8LA 4O55A 2HNZA 3THVA 1J54A 4Z4HA 3KD1E 3U3GA 3E01A 3TAFA 1SL1A 2YHAA 3OYNA 4DTMA 3VQEA 4M45A 2HHVA 1RDAA 4KHSA 1BI4A 1RDBA 1JXBA 4CJLA
chains in the Genus database with same CATH superfamily
4OPAA 3QEIA 4E0DA 3CCJN 3CPWM 2V51B 1DTQA 4B1WB 4CERA 3KTQA 5EX5A 3F9MA 3VTIA 4BROA 1D8YA 5T7BA 2HSTA 5AQLA 5I9EB 3QMLA 3KLEA 3NH2A 1KLMA 1RBSA 3R1XA 3OBWA 1NK4A 3ENBA 4CZGA 4FLWA 4X64K 3UKRA 1BOTO 1WB9A 2YHBA 3MWTA 4YORA 1X9MA 5M1FA 5I42A 4FOEA 5KGXA 1BU6O 1X3NA 1HNZK 4JI7K 2E20A 3ID8A 5GAHP 3CMEN 1YTAA 3BP8A 2JLEA 3VGMA 3AVIA 1QHTA 4CHZA 1RT7A 4OKKA 1MDUB 4JKFA 1B92A 1K8KA 1WOQA 1NGIA 3CERA 3VQ7A 1D5AA 2IVPA 3S3NA 2AP1A 4CZFA 3TABA 3ZT2A 4CK1A 4FSVA 2P9KB 3ULEB 3LL3A 4WFNL 2W40A 3LAKA 4CJVA 4LH5A 2GUIA 4Z94A 5C2FA 3VQ9A 4M3UA 2DY4A 4FK0A 4ILJA 3TR8A 3I8DA 3QEVA 4GNIA 1QQNA 4CIGA 5EXWA 3NH0A 4N5SA 3CF5L 4GKKK 2HBLA 2Z1IA 3AGKA 2O4GA 5AQNA 4BDYA 3N4QA 2VQFK 5KTQA 5AQSA 3RRGA 4Z4IA 5AQXA 4FJ8A 3M8SA 3V6DA 4RG8A 5HL7L 5KQDA 4OPKA 1JLQA 4E7IA 1XC3A 4IG3A 1WN7A 1RTDA 3M6GA 1NK5A 4NXMK 3IUCA 3K0SA 1ATRA 4CHOA 1LW2A 3NMUA 1HKCA 1XMQK 3HOTA 4JI5K 4B1UB 3VEXA 2KQ2A 3V4IA 4Z0UA 1JJ2M 2F4VK 4QCLA 4DTNA 2BUPA 4OO1J 1EO1A 4W5TA 1E4FT 3HK2A 5BR9A 1HX1A 1JXEA 1DT9A 3ENOA 3OYFA 3PSFA 2DFEA 1NKBA 2UXDK 2BDPA 1VQ8N 2UXCK 4BDZA 1BUPA 3WNFA 4C8NA 2FBYA 4K41A 4B1VA 3KLGA 3CM6A 1YIJN 1NGBA 1N8RO 4M41A 2OZSA 2Q36A 3M8RA 4FJIA 3LPUA 1ZBIA 3DOKA 4DWIA 4CJ4A 4B9UA 4EAHD 1LCUA 3R3LA 3SV3A 2QWRA 1XUPO 1JLBA 4CJUA 5LJWA 5BRDA 3CFRA 3K5MA 3PV8A 3L2UA 2QWLA 1IO2A 5C15A 4E7JA 4BRIA 4L3QA 2W42A 4DF8A 5HRSA 3QBXA 2VWKA 2H3GX 3EO3A 4WCEL 1O1WA 3T3FA 3NBPA 4LY7A 1KRPA 3CG7A 3CQYA 5J2NA 2ETJA 5AQUA 1BQNA 3QLHA 3MMVA 4BY9C 1BGXT 2NRRA 3H46O 4KI4A 1RDUA 3VENA 1KTQA 2AA4A 3CCMN 2E2PA 3SV4A 1HYSA 2IOCA 3KK3A 2OZMA 5KI6A 4NB4A 5MLCQ 4BGBA 3U6FA 4CFAA 3CCSN 2ITMA 3DLBA 3SAHA 3UKUA 1VSKA 3O9QA 1JLAA 5J2QA 1VSIA 5KPZA 1FW6A 4GVEA 3D7EO 1J6ZA 1Z26A 3T1AA 2FBTA 4Y0WA 1IV0A 4DF4A 1VQON 1VQMN 5AQHA 5FPEA 3AVKA 4YOXA 1SKSA 3GE1A 3SBGA 2KKZA 4WQ4A 5HRPA 4AHSA 3AA2A 4WYBA 4BR2A 1X9SA 1KC8O 4YOYA 2ZJPL 4EZ9A 5KGWA 3DXMA 3U9DA 1YI2N 1T7PA 1TV6A 4A57A 3G4SN 4LD0A 4YOWA 3SPZA 3TTFA 3VTHA 3NVMA 2F96A 3AA3A 4W5RA 2OYQA 4KHUA 4KHWA 4I6MA 2KFZA 3OS0A 1J53A 1UWBA 2O8CB 3LPTA 1T8EA 1KVBA 3I56N 1MWMA 4B3RK 2HF3A 1U48A 2IGIA 3EL2A 2HBKA 4CGHA 2E1YA 2YNHA 4IEEA 1BL3A 3MN5A 2YJFA 3KHYA 4BRDA 3HT3A 3C6TA 1SUQA 3ZEUB 2GV9A 3O3FA 4IFVA 4FVUA 4H0PA 3M3ZA 2GWJA 4IJAA 4CHPA 1FXXA 4QS7A 4A59A 3G6EN 1BWFO 3F2KA 4MQ3A 4GV9A 3PO4A 4H0YB 3MXIA 1NK6A 3QIPA 3O3HA 1W2BM 5A2QO 1EX4A 4M63C 4FLVA 4CJFA 4IDKA 4I2PA 2X78A 1S6PA 3MN9A 4I9QA 1RT2A 4KH6A 3VQ8A 4X66K 4UQGA 2QKBA 1CLQA 4CFDA 3CCRN 3TAGA 4IZ9A 4FWRA 1VRTA 5IWAK 1YITN 3J80O 2WONA 5DM6L 2G8WA 4XH1A 1QQOA 1UA1A 3TSPA 3VERA 4BRCA 3OBYA 3PY8A 3CJAA 4DLEA 2YKMA 2W6KA 4FZZA 4PKHA 2RE2A 3QICA 1Z05A 2YHWA 4DS4A 1KFSA 4O44A 4FM0A 3DLKA 1NJZA 4RCHA 4B9MA 1VSMA 1NGAA 1GOAA 2OCEA 3O80A 5ADXH 2P9SA 3K5NA 1RT1A 3MWPA 1XHXA 5BR8K 1B9DA 2HNDA 2Q3SA 1XI1A 3MX2A 3UKRB 4F3OA 4OLAA 3TTDA 1HQUA 4DV3K 2F8TA 2A40A 3O3GA 1P8ZA 3SUQA 4DLGA 1QSYA 3RR7A 2HHXA 3ZSZA 2CH6A 3LDLA 3WT0A 3OYBA 1WSGA 4BRGA 1R59O 4JD2A 4JI2K 3U9ZA 3A0IX 2FF3B 3P4IA 3D2EA 3EZ5A 1GLDG 5AQFA 1EQYA 1S1WA 1VSLA 1WSIA 5AZIA 3DM2A 3QNNA 2HHHK 1S9GA 4X62K 1NJXA 4BQZA 3DLGA 3HBTA 1B9FA 3O9TA 4PWDA 2G8VA 2WTUA 3HP6A 3CFPA 5AQQA 3KIOA 4PKIA 5E41A 2P5GA 1ZBLA 5AQVA 2XY5A 4CJTA 4YY3K 1RDDA 1QE1A 1U04A 4XIUA 5C24A 1IH7A 1HLUA 4CZIA 2OPRA 4F9OA 3MEGA 3HJFA 2UUBK 5AZJB 4DFJA 3HZ6A 3V1QA 1HJRA 1NU0A 2CH5A 2HBMA 3MXMA 2IVNA 3KK7A 1NK8A 1ZC6A 4FM1A 3SAGA 5FRNA 4F4KA 3QFUA 1HRHA 3HPOA 3ASMA 4O55A 2UU9K 3IKMA 4JNEA 5BRHA 1SL1A 5C12A 4GKJK 2W6LA 2QWMA 1RDAA 4IXCA 4JKGA 4BG8A 3S41A 4CJLA 3TTCA 1YVNA 4YOUA 2YV0X 3I0RA 4DR7K 1I3AA 4CEDA 4CHYA 3ZT0A 1IKWA 1KXPA 1NG9A 3VF4A 3FFIA 3T7ZA 4CF0A 1OH6A 3SUPA 4FJGA 3KK1A 1N5YA 4EP4A 4W5NA 3OJSA 4H0TB 1K8AO 2FXUA 4LC9B 4E1NA 1W0HA 4F8RA 5AQZA 2HHQA 4TSXA 1YHQN 4N47A 3TU5A 5GIPA 1C0TA 1JL2A 2UUCK 4HWIA 3L4QA 4E7HA 3CCVN 3A5NC 3AY9A 3LZJA 2XY8A 4PUOA 4N56A 1VQNN 4DV7K 4WQ4C 2R7YA 2NRTA 3SPYA 3AVHA 1VQ9N 3P39A 1Q9YA 3FR0A 2P9SB 1XNQK 4Z4EA 1I39A 4WFAL 4BG9A 2E2OA 4KFBA 3ATUA 3PIPL 3LP1A 4R5PA 2ZQBA 4C23A 3FFKB 5HROA 4BVPA 3QEXA 4NCBA 3V9WA 1T44A 4BGAA 3O9UA 3MXJA 3SMSA 3KD5E 3M8PA 1I94K 3T19A 4V19S 5M1NA 3OW2M 4CFBA 1VQ6N 4JI4K 4ISGA 3ZETA 1OH8A 3LDQA 2JWLA 4JD2B 5H1SQ 3HXMA 1G15A 3WUHA 1NBWA 1QSLA 2B6AA 1C0MA 2HBJA 1X9WA 3CJ9A 5B8HA 2OPQA 4DQQA 5AQPA 4C1NK 2RHKA 4BVOA 1MWKA 1EWQA 1WBBA 1HPZA 5F0XA 1FKPA 3DRSA 1GLCG 1Z25A 4QAGA 1OH5A 3RMBA 2OTJN 2Q97A 3AVLA 2PYJA 4NYNA 5GINA 4DV6K 3FE1A 5KPRA 1C1CA 2DPNA 3V1OA 1HMVA 3RMCA 1V4TA 5CHIA 2Z1GA 4ID5A 1BDGA 2EHGA 4YDUA 2PFUA 4H5RA 4KTZA 4AILC 3ZLJA 4BREA 5C10A 2GEMA 3QERA 1Q81O 4FPAA 3PX0A 3S3MA 1Q9XA 2OPPA 4DCHA 3ZEUA 1CZ9A 4CJ3A 1KAYA 5KRTA 4IJNA 2QXLA 4JI0K 2YKNA 3H08A 3OS2A 3L6QA 4BR7A 1NKEA 5M1QA 3THWB 1K73O 1SV5A 3HM8A 4CJEA 3AAPA 4JKHA 5HRNA 4B1YB 2O8BB 4EHTA 2ZE2A 5M1PA 2VCPA 1RBVA 3VQDA 5TKYA 4NCGA 4Y1DA 4B3MK 2A5XA 3AO4A 2VG6A 4O0JA 2ZGZA 3QINA 3KLHA 3IDHA 4XEIA 3UE5A 1BHLA 4CGJA 1X9JA 2OANA 1L3VA 5JVHL 3B8AX 2VQEK 1KCFA 4FLUA 3I8BA 3M5RA 4B9TA 3MCPA 4BRQA 3VA0A 2HW3A 2CGLA 3OYLA 3OYGA 3SQ0A 1C0FA 3LP2A 3EKUA 4RW4A 3P38A 2ZGYA 4BRHA 4O8UA 3IMXA 4OPHA 1HKGA 1YTUA 1F21A 2QTDA 4IG0A 4NLCA 4I7FA 2HVHA 3EY1A 1XNRK 4BC5A 2A41A 2HB5A 3SJJA 1BI4B 2RN2A 4WQ5A 1NNEA 1NGDA 4A61A 3LALA 5AQGA 3QNOA 4H4MA 4LF9K 1ZBFA 2IS3A 4H8KA 3IRXA 3DRPA 3B6OA 4DSFA 4BE0A 2QWPA 4MO4A 1KFDA 4QS9A 5F2RA 4CJ7A 3OYAA 2PBDA 1XMOK 1ASUA 4BDPA 1KAZA 2X6NA 4OGCA 1QZ6A 2YHXA 1XQSC 3NH1A 1ZBSA 1YJWN 1DGKN 4KPYA 4Z4CA 1ZXOA 3CI5A 3SMPA 4O4GA 3SQ2A 2O4IA 2HMPA 4C8MA 1E4GT 4FXDA 1NM1A 4KKOA 4DSIA 5CZ1A 4B9QA 4Z4FA 3TSUA 4KB0A 4HTLA 3KKSA 3KKRA 4YOVA 3V81A 4DFKA 3K9JA 2ZM6K 2XO7A 4PHTX 2E6MA 4HCCA 3AARA 2QM1A 3K5LA 4FYDA 1U2VA 2BGGA 3LDOA 5LL6Z 4PA1A 1RNHA 2P9UB 1NJWA 4H4OA 4BR9A 1UOCA 1GLJO 4CJWA 2NZTA 2Q0UA 4BRLA 1TKXA 3NF9A 4BRMA 3NF7A 4CZLA 1T6CA 1RCHA 2PY5A 4OPJA 4W5QA 1HR0K 1YUWA 3MN7A 3IAYA 3SUNA 1TK5A 5AQTA 4CVNE 2G8UA 5E26A 3BY5A 1MU2A 1NOYA 3RVCA 2UXBK 4H03B 3J7YP 2GWKA 1IBKK 3NGZA 3C6UA 1VQ5N 3ALYA 1BIZA 2ZD1A 3AVMA 4CGIA 2FSKA 3BF3A 3FZKA 2FSNA 4NLBA 4AH9A 1NGEA 1KSPA 3VQPA 1U6ZA 4CI6A 3KZBA 4A62A 3CD6N 3RR8A 4GW6A 1WSJA 1N36K 3DJCA 4CJKA 4IFYA 4CESA 3NCIA 1GLBG 3C0BA 1QSSA 2P9NA 3OYCA 3AA4A 3I0SA 1NJYA 1L5UA 3D6RA 4RW8A 3HSCA 1QQMA 4FJKA 4CEAA 3CJCA 3DXKB 1LWEA 4JK9A 3THXB 3SQ4A 3O08A 1LWCA 4AHRA 4KB1A 1S1TA 5HLFA 5SZTA 1GLAG 4JKAA 3QEPA 1GLFO 4W5OA 4U67L 5KQ8A 3S9HA 5D3GA 1VQKN 5F1XA 2QK9A 2D1KA 4K43A 3SUOA 2NRZA 1ATSA 3RRHA 4EIAA 5BPNA 1Z6RA 3KJVA 4DR5K 4AF1A 3LP3A 3OVNA 2P9IA 4O5BA 1HNWK 3K5OA 4B08A 1EWRA 4GY2B 2HVIA 5CYMA 3ZX0A 3L4IA 3VF6A 2PAVA 1OVQA 5EVZA 3TAQA 3HRGA 3U8XA 4FJ9A 3VEYA 4JI3K 1QVFM 3MN6A 5I3UA 5AQOA 4FLYA 4CHNA 4FJXA 4U7BA 3KLFA 2E2QA 2Q31A 1YJ9N 1ITGA 5HRRA 3LDSA 5BN9A 1NOZA 4XH5A 4CFCA 1JLCA 5BREA 2FBXA 5CY4A 2O8CA 5EOYA 2BE2A 4A2AA 4E1JA 3NE6A 4FO0A 1N6QA 3OYEA 3EE9A 1DTTA 4CBXA 2P5OA 4LF8K 4DQRA 2HOEA 3SBTA 2A6AA 2ATQA 3GG4A 4E89A 4JLHA 3LWLA 3WEEA 4KTQA 2PYLA 4K25A 2XY7A 1KLNA 2ZJQL 1ATNA 1VQ4N 1XHZA 1A5VA 4OVLA 4NXNK 2P9IB 2ASPA 3D2EB 3RSEB 3CHWA 4IOAL 1BA1A 1VQPN 1VSEA 4IFEA 5BPMA 2O8DB 3THVA 3QBWA 3KD1E 4K0KK 1P90A 3DWLA 3VQEA 4YDUC 1BO5O 3A8YA 2HHVA 3SLCA 4JAXA 3EEQA 1JXBA 3LM2A 1VSJA 5EU7A 1YAGA 5BN8A 4X65K 4KHYA 4BC3A 3VOVA 4AHUA 4R79A 1WSHA 4KHNA 1TKDA 5KRSA 2P9KA 1OKJA 4JKBA 4CJSA 3D0PA 4J2DA 1TK0A 3OYKA 3K59A 3NGIA 5J2MA 3UIQA 3VGLA 1QTMA 3ZSWA 3DLLL 1LAVA 1BA0A 3ENHA 2GUPA 2FF6A 3OYJA 3JSMA 4CEBA 2WBNA 1S6QA 4AHCA 4HTUA 3L3VA 4ID1A 1NJIO 2HHTA 4FL9A 4BE2A 1Y64A 3TAPA 1CZBA 2NUBA 4LSNA 4EZ6A 3R6MA 3D2FA 3AO1A 1WSFA 2KFNA 3Q7CA 3CCEN 1SZ2A 3VETA 3DLHA 2VG7A 1UA0A 1L3TA 4FJJA 3I55N 5JVGL 1C1BA 3V9UA 1ZBHA 3OHRA 2QXFA 3VQ6A 3MEEA 4JV5K 5JICA 1VSHA 5BPLA 2G8HA 4CBWA 2D0AA 1EETA 3IFRA 3P83D 4KRFA 2P9PA 3W3DA 3ZT4A 4J2AA 1IG8A 2G8FA 2Q1NA 3CJ7A 3NGYA 5LY3A 4GMJB 2P9UA 1X3MA 4CZKA 3V9ZA 2IVOA 1CXUA 3QFPA 4FJNA 4DSEA 4NCAA 4HUEA 4DTOA 4H5WA 2Q2RA 2HHWA 1JLEA 3VESA 4CJQA 1YJNN 3L0QA 4DV4K 2D5RA 5AQMA 4ELTA 3T1YK 4B3SK 3AO2A 3J7ZO 4H5NA 3O1WA 2ITGA 3AVBA 1JCEA 4M3YA 3PSIA 4FW2A 3L2RA 3P5JA 3VMFB 2QW9A 1IKYA 1S1XA 5GIOA 3HSTB 4CK2A 1J9AA 1HJOA 2A3ZA 2F7TA 4AHTA 1VHXA 3DLRA 1TYQB 5C25A 1X1PA 1Q18A 4M7XA 3VEVA 3ZSRA 3V1RA 3E9OA 4GV6A 2WOMA 4LFCK 3O5BA 3O9RA 4ISFA 1U2VB 4KH5A 1QS4A 1LW0A 5M1OA 3RMAA 1Q7YO 3ULDA 3K58A 4ZHRA 4DR6K 4PL8A 4FWOA 3H45C 3P31A 3K57A 3SAFA 3JS6A 4J2EA 3MCAB 4CEZA 3CJ1A 2D0OA 2NNWA 1RT4A 4WE1A 4DTRA 2UYTA 3FZFA 3NDKA 3CFOA 3ZX2A 4FJLA 4FLTA 4E7LA 3O8MA 4H0OA 1VAZA 3DI6A 1JLGA 2NRHA 2Y1IA 4HHTA 1FJGK 4C8OA 4BRFA 4FK2A 2HF4A 3C94A 4LH4A 2B4JA 2D0CA 3LDNA 3GBTA 3ATVA 3VEWA 5JMVA 1S9EA 1TAUA 3SI6A 4LF6K 1VRUA 4H0XB 2O8DA 3WXKA 3NF8A 1HNVA 3F73A 2HNYA 5EY4A 3ZT1A 4JI6K 2QWOA 1NMNA 3F5TA 4H5TA 5AFUA 1N33K 2BH1A 2P9LB 3KWIA 4O0IA 4J8FA 5HP1A 4HUGA 3ULEA 3TARA 4FVMA 5FROA 1CZAN 1TKZA 2E4LA 1M1KO 3CMAN 3FLCO 3C95A 4BRAA 3JXUA 3AO3A 3C7NB 4BRPA 1DKGD 4CF1A 3J81O 4CIEA 4DKWA 3GOIA 1XWLA 4LF4K 4CJRA 2BANA 3DAWA 4RWTA 1VK0A 2OPSA 1LAWA 4ILHA 4K42A 3TAMA 3CQXA 2FC0A 4B1XB 1JCGA 4KH4A 2Z1HA 4BR0A 5J2PA 3VGKA 5FLXO 1VQ7N 2KW4A 3KWGA 3VEZA 4DR1K 4BRNA 2NRVA 3VF2A 4DU3A 3QESA 1C0UA 4JK7A 3SCXA 1W97L 4H5VA 3ZSOA 4LF5K 1YXQA 2F8SA 1TYQA 3CC4N 1QQCA 3DXMB 3CC2N 3ZCMA 3AVGA 3WNGA 4DR2K 1VSDA 4KHPK 4BC2A 1K8KB 4FZXC 3WXLA 1BCOA 2RF2A 2DTUA 3ZX3A 4FWQA 5DMRA 5GAEP 1RDCA 2KHOA 3L2VA 4BWMA 1Q8IA 3SJHA 4FJ5A 1IG9A 1SAZA 1NWKA 3DXKA 3ZYYX 1S1VA 3CCUN 5LJVA 4LFAK 5FPNA 1BCMA 3ZSQA 3A5OC 5AFUH 4HCBA 3C6HA 3C7NA 3H1VX 3M8QA 4DV1K 4FWMA 4DU1A 3R9PA 2QWQA 3B6PA 2IDOA 2IAJA 2LSNA 4CZHA 1RGIA 1JKHA 4IOCL 2YNFA 2DFHA 1WAJA 2O8BA 4DFMA 3OS1A 3PUFA 2EX3A 3RSEA 3EN9A 3BZKA 4B9VA 2E1ZA 3H3OB 3OTOK 1GOBA 4DV0K 1QVGM 1NK7A 3WXJA 5FRMA 1J5OA 3WNHA 3LWMA 4I9LA 3BDPA 2P9LA 4YHHK 3LZIA 2KLAA 3PIOL 4AQYK 3LM9A 4DQPA 4JS4A 1WBDA 3AO5A 3ID6A 2V52B 3CCQN 3AA5X 4DR3K 3PLAA 4ICLA 1IJJA 2I7NA 2KZMA 1ZYQA 4C8KA 1RT5A 4IBNA 2PZSA 1HPMA 4LSLA 1S72N 1HYZA 2HMIA 2GBZA 2GTDA 5AR0A 1VSFA 2E6LA 1ZBUA 4PL7A 3G71N 2O8FA 3BZCA 1RTHA 1T6DA 3MK6A 2VGMA 3AGRA 4BE1A 2NLXA 4CD1A 4JRQA 1ASVA 3LAMA 4C1NI 1XC9A 4UY8O 4FPBA 4RW6A 4DFPA 3SQ1A 2A1SA 1TUYA 4FJHA 4ELUA 1RBUA 3E1YA 4CD3A 4CIFA 4FCYA 4AM7A 3LDPA 1FK9A 5E84A 4B9NA 4M3XA 3NAEA 4FWKA 5AZIB 5AQIA 1WAFA 1L3SA 1K9MO 4A2BA 3OYIA 2X6SA 3DLEA 4CEQA 4CW7B 3SYZA 3CYMA 3LP0A 2F9TA 3OYDA 2XHBA 5TKWA 4JKDA 2AJQA 1R0AA 1HKBA 3TANA 4I6MB 4BWJA 4B9SA 3QIOA 1QZ5A 1A5XA 4YNQA 2D0PA 4HUFA 5JLHA 3VQQA 4MDBA 2OTLN 2FLOA 1NGFA 1ASWA 1Y97A 4PY5A 3FZLA 3WQUA 1GLLO 4FW1A 3RTVA 2NRWA 4O5FA 4CEFA 3HL8A 1KD1O 4FJMA 1J54A 4Z4HA 3U3GA 3E01A 3TAFA 1N34K 1OH7A 2YHAA 3OYNA 4DTMA 3BUZB 4M45A 1BI4A 2VYPA 3AAQA 1RDBA 4FK4A 4XH4A 4E1MA 3IG1A 1BIUA 3MECA 1CXQA 1HUXA 1LOTB 3IS9A 5FPMA 3RWUA 4L8RB 1IBMK 1KVAA 5CYQA 4F2RA 3HI0A 3TI0A 1U4BA 1T05A 4MLHA 1JLFA 3LANA 3A5LC 5KPTA 4JKCA 2W41A 3QB0A 4CGFA 3O9SA 5LMNK 4DTJA 1KVCA 4ZTFA 1TVRA 4AHVA 2O8EA 4MLEA 2CGKA 1RTIA 3MX5A 4CF8A 3FGUA 1BQMA 3OY9A 3UB5A 4A5BA 3O4NA 4CZEA 1IKVA 3OYHA 3A5MC 2NRXA 3G10A 4Y1CA 1Q82O 4KTWA 4WFBL 4E19A 2O8FB 3HO1A 4OKEA 4CZMA 2Y1JA 4BACA 1D4XA 4LF7K 4DUZK 2ASOA 1YVUA 3ISNC 4M7YA 1YF5L 4J2BA 2Z1JA 2VWBA 3HVTA 3HTVA 2J4RA 2X74A 2E8AA 2A42A 3CCLN 5C0YA 3RMDA 3PX6A 2ASMA 1RT3A 4B3OA 2VWJA 4HVJA 4FWLA 4FLXA 1JL1A 3E9LA 4WF9L 4RW7A 3L8BA 1RBRA 1LWFA 2G8IA 5IT9O 3AVFA 1S5JA 2GELA 3KVGA 4JYAK 4CBUA 2P51A 4GVMA 2E2NA 4BR5A 4K8XA 4CF9A 3K9KA 4B3TK 4Q0BA 3HPGA 2YHYA 3S3OA 3THYA 4KI6A 4E7KA 3C6AA 4CGDA 5CE3A 1DLOA 3EE8A 3PX4A 4BC4A 3M1FA 3O4QA 3HVRA 2D0BA 5ADXA 1S3XA 4JHDB 4B8AB 4JHDA 1T3VA 2QWNA 4JRPA 2YI1A 4KBOA 1WLJA 4M3ZA 3SK3A 3UKUB 5GADP 1HNIA 2KTQA 1TAQA 2FSJA 3HPHA 3ITHA 2B5JA 1GOCA 3I33A 4OJRA 4DSKA 5AQJA 4DUYK 3TPQA 1J5EK 4AM6A 3WEEB 2ZJRL 4M3RA 4DQ8A 1NGCA 5C2DA 4DTUA 1REVA 3G0ZA 5CR4A 3N4PA 3DOLA 2E88A 3J7AP 1DEJA 1OVYA 3L3UA 3BGRA 4DR4K 3CQ8A 5K14A 4PQUA 3V9SA 4DSJA 3GL1A 4YOTA 3PO5A 3SNNA 4DMNA 3NHGA 3THYB 2YNIA 5FDLA 5AJ3K 3OJUA 3E66A 3CIPA 4FLZA 5AZJA 2HHUA 3ZSVA 1M90O 3BEXA 2JGUA 1RDWX 2WC9A 2UUAK 5FPDA 4ILGB 2P9NB 3P1GA 4A5AA 1L3UA 3HOSA 3VQBA 4LFBK 4B9LA 5AQKA 3SZ2A 3MEDA 3J8AA 2G8KA 4FWNA 5JS1A 3TWHA 1TKTA 4DSLA 3THXA 4G1QA 2DFFA 3VA3A 1NGHA 4CJPA 4F3TA 5DK5A 4FWSA 3EZWA 2QKKA 4KREA 3WNEA 4B1ZA 4CF2A 5DM7L 1QHAA 1TK8A 2QA4N 2YCHA 4CK3A 4FZYA 3EYZA 1EP4A 5JS2A 4OX9K 3CC7N 1ESVA 2QEXN 1RFQA 1YT3A 4QOZB 3VQ4A 1NK0A 5SWMA 2O8EB 1BG3A 3VPZA 4CECA 4DS5A 2GX9A 3KK2A 2BTFA 3WQTA 4I2QA 3KLIA 4YFUA 1WNSA 4ZTJA 3C65A 3H6EA 4RW9A 4CEOA 2YJEA 5HBMA 1WUAA 3R8EA 4O8KA 2YX6A 2XRIA 5CZ2A 1NLVA 3NVKA 4FOIA 2VGNA 4M3TA 3WXMB 3DYAA 1G99A 4IO8A 1U47A 1E3MA 1KQSM 3AV9A 5AQRA 1HNXK 1RTJA 1SS6A 3DRRA 4N41A 3NF6A 4IEIA 1NGJA 4DV2K 1BISA 4IOXA 1SQKA 3A2FA 1D9DA 2IIRA 3THWA 1RBTA 2D4WA 3JAMO 3QEWA 4JN4A 3K2PA 3VQAA 5J1EA 5LMUK 4DG1A 4FJ7A 4MO5A 4KHQA 3V9XA 5ELZA 3T69A 3NFAA 4JKEA 2E5LK 4CCHA 3AVCA 1IKXA 3L2WA 3U3YA 4BRKA 4JS5A 1NMDA 3O1BA 4B8CA 1RT6A 4JI1K 3O6WA 3CXCM 4NYFA 2CGJA 5HOOA 3U4LA 4ELVA 2HHSA 1MA9B 1TGOA 2WFBA 3D45A 4QS8A 4IDHA 3ZT3A 1HYVA 3F9KA 2V7YA 3MDQA 4CZJA 3VN5A 4CHQA 1A5WA 3HP9A 1ILYA 1U49A 2JWKA 4BR4A 4CE9A 4M3WA 2XY6A 2OA8A 1KAXA 5AQWA 1SL0A 1Q86O 4GV3A 4JK8A 2WUSA 2F9WA 4DTXA 1RILA 2I7PA 1TUUA 5C42A 3CM5A 1HQEA 4NO7A 4IO9L 3QO9A 2QI2A 4FWPA 1EKEA 1N32K 4KV8A 3MAQA 4PKGA 1C1AA 2VG5A 4DTSA 1SKWA 1UAXA 3QDKA 3AVJA 3AVAA 3CJBA 3VQ5A 1C6VA 1LV5A 3BF1A 4DV5K 3ZETB 4H0VB 1H1VA 4DQSA 3VEOA 3ZSYA 1EXQA 1W9HA 3H1QA 4MDAA 5GAGP 3Q7BA 3H3NO 3VQCA 4MFBA 2EWSA 3OYMA 3HM9A 1JCFA 4EP5A 3O4WA 1IBLK 1NK9A 3E9PA 1K6YA 1NKCA 4EHUA 2YNGA 4F2SA 4CEEA 4EFHA 3DMJA 4KAZA 3WXIA 4DQIA 3ZSXA 1TL1A 4JI8K 3JYTA 2P9PB 4DTPA 2KZZA 2ZF5O 3CPEA 4KO0A 5JLFA 5M1KA 1FKOA 4DHYA 2P1JA 1S1UA 3QETA 4M42A 4IKFA 1C0GA 1V4SA 3GDQA 4BQLA 2FBVA 1T03A 1NGGA 4E3SA 4Z4GA 4JEPA 2V7ZA 2RKIA 5BRFA 1WSEA 3AVNA 2Q0RA 4JKGB 4OGEA 1U45A 1SKRA 1D9FA 3EKSA 4DU4A 4OKJA 4FM2A 2A1RA 3G25A 2ZWHA 4CGGA 3CETA 4Q5VA 3L2QA 1TL3A 1VQLN 3FZMA 4DB3A 2I5JA 1SL2A 4WQ5C 4OLBA 3TSQA 3T1HK 3D2FB 2RPIA 4N76A 3OA9A 4G9ZA 5AQYA 3TAEA 4K8ZA 4CJ5A 3HYFA 3FZHA 1S22A 2IC3A 4RTFD 3W0LA 4C8LA 2HNZA 1W7AA 4IWVA 4ISEA 1O13A 1GLEG 4KHSA
chains in the Genus database with same CATH topology
4E1MA 2YV0X 3I0RA 1VSJA 1I3AA 3IG1A 4CEDA 5EU7A 3QEIA 4CHYA 3ZT0A 1IKWA 4KHYA 1BIUA 3MECA 1CXQA 4E0DA 3IS9A 1DTQA 4AHUA 3RWUA 4L8RB 1WSHA 3FFIA 4CF0A 1TKDA 4CERA 5KRSA 1KVAA 4KHNA 5CYQA 4F2RA 3TI0A 3SUPA 3KTQA 4FJGA 3KK1A 1U4BA 4CJSA 3D0PA 4EP4A 1N5YA 1T05A 3OJSA 4W5NA 4J2DA 1JLFA 1TK0A 3OYKA 3LANA 3K59A 3NGIA 5J2MA 3UIQA 1D8YA 5T7BA 4E1NA 1W0HA 4F8RA 4CGFA 1QTMA 3ZSWA 4ZTFA 4DTJA 2HHQA 1KVCA 1TVRA 1LAVA 4TSXA 4AHVA 4N47A 3KLEA 1C0TA 1JL2A 3NH2A 1KLMA 1RBSA 1RTIA 4CF8A 1NK4A 1BQMA 3OYJA 3JSMA 4CEBA 4E7HA 3OY9A 3LZJA 4FLWA 2XY8A 4PUOA 1S6QA 4N56A 3O4NA 4AHCA 2R7YA 3L3VA 1IKVA 4HTUA 4ID1A 2HHTA 3OYHA 3SPYA 3AVHA 4BE2A 2YHBA 3G10A 4Y1CA 3TAPA 1CZBA 1X9MA 2NUBA 4KTWA 1Q9YA 5I42A 4E19A 4LSNA 3HO1A 4Z4EA 1I39A 5KGXA 4EZ6A 4OKEA 3AO1A 4KFBA 1WSFA 3LP1A 4R5PA 2ZQBA 2Y1JA 2KFNA 5HROA 4BACA 3QEXA 3DLHA 2VG7A 1UA0A 1L3TA 1YTAA 1YVUA 3ISNC 3V9WA 4FJJA 2JLEA 4NCBA 1C1BA 3AVIA 3V9UA 4J2BA 1QHTA 1ZBHA 4CHZA 2QXFA 1RT7A 3VQ6A 3MEEA 2Z1JA 3MXJA 2G8HA 1VSHA 4OKKA 3HVTA 3KD5E 3M8PA 2X74A 3T19A 1B92A 4CFBA 2D0AA 1EETA 3PX6A 3RMDA 3VQ7A 3P83D 4KRFA 1D5AA 3ZT4A 3HXMA 4J2AA 1RT3A 4B3OA 2VWJA 1G15A 4HVJA 2G8FA 3S3NA 3NGYA 4FLXA 1QSLA 2B6AA 1C0MA 1JL1A 1X9WA 4GMJB 3TABA 2OPQA 3ZT2A 4DQQA 4RW7A 4CK1A 1RBRA 1LWFA 3L8BA 3V9ZA 2G8IA 1CXUA 1HPZA 4FJNA 1FKPA 3AVFA 4DSEA 1S5JA 4NCAA 3DRSA 1Z25A 4QAGA 4HUEA 3LAKA 4CJVA 3RMBA 4LH5A 2GUIA 4DTOA 2P51A 3AVLA 4GVMA 4K8XA 2PYJA 4NYNA 4CF9A 3VQ9A 2HHWA 4Q0BA 1JLEA 3HPGA 4CJQA 3S3OA 4KI6A 4M3UA 4FK0A 4E7KA 4PWDA 3TR8A 2DY4A 1C1CA 4CGDA 3I8DA 3QEVA 1DLOA 3V1OA 2D5RA 1HMVA 4CIGA 4ELTA 3RMCA 3NH0A 2Z1GA 3AO2A 4N5SA 3PX4A 4ID5A 3HVRA 3O4QA 2D0BA 2Z1IA 2EHGA 2ITGA 2O4GA 3AVBA 4BDYA 4M3YA 4KTZA 4AILC 4FW2A 4B8AB 3L2RA 5KTQA 3RRGA 4JRPA 3P5JA 4Z4IA 3QERA 4FJ8A 1WLJA 3M8SA 4M3ZA 1IKYA 3V6DA 4RG8A 1S1XA 3PX0A 3HSTB 4OPKA 1JLQA 4E7IA 3S3MA 1Q9XA 4CK2A 1J9AA 1HNIA 2OPPA 1TAQA 4IG3A 1WN7A 1CZ9A 4AHTA 2KTQA 1RTDA 3DLRA 1NK5A 4CJ3A 5C25A 1X1PA 5KRTA 3ZSRA 3V1RA 2YKNA 3HPHA 3ITHA 3H08A 2B5JA 2WOMA 4CHOA 3OS2A 1GOCA 1LW2A 1NKEA 4DSKA 4OJRA 1QS4A 1SV5A 4CJEA 1LW0A 5HRNA 2KQ2A 3RMAA 3V4IA 4Z0UA 4M3RA 3ULDA 3K58A 2ZE2A 4ZHRA 1RBVA 3VQDA 4QCLA 4NCGA 4DTUA 1REVA 3G0ZA 4DTNA 4Y1DA 3DOLA 3AO4A 4W5TA 2VG6A 4O0JA 3K57A 3L3UA 3HK2A 3BGRA 2HVHA 1JXEA 3QINA 3KLHA 3CQ8A 4J2EA 3OYFA 2DFEA 1NKBA 5K14A 4CEZA 3V9SA 4PQUA 1BHLA 4CGJA 4DSJA 2BDPA 1RT4A 4WE1A 4DTRA 4BDZA 1L3VA 3WNFA 3PO5A 4C8NA 3SNNA 2FBYA 4DMNA 3NDKA 3CFOA 4FJLA 1KCFA 4FLTA 3NHGA 4FLUA 2YNIA 3KLGA 5FDLA 4E7LA 4B9TA 3CM6A 3OJUA 3DI6A 4FLZA 1JLGA 4M41A 3ZSVA 2OZSA 2HHUA 3M8RA 2Y1IA 2JGUA 3VA0A 3LPUA 4FJIA 4HHTA 1ZBIA 2HW3A 3DOKA 4C8OA 4DWIA 3OYLA 3OYGA 3SQ0A 3P1GA 4FK2A 3C94A 4CJ4A 3LP2A 2B4JA 4LH4A 4B9UA 1L3UA 3SV3A 3VQBA 4B9LA 1JLBA 2D0CA 3MEDA 4RW4A 3SZ2A 4CJUA 2G8KA 1S9EA 1TAUA 3SI6A 5JS1A 3CFRA 1VRUA 3K5MA 3PV8A 3L2UA 3TWHA 1IO2A 1TKTA 3NF8A 4DSLA 4E7JA 1YTUA 1F21A 4G1QA 1HNVA 4I7FA 4IG0A 2DFFA 3EY1A 3VA3A 3F73A 4CJPA 2W42A 4DF8A 4F3TA 2HNYA 5DK5A 5HRSA 4KREA 2QKKA 2HB5A 2VWKA 3ZT1A 3SJJA 1BI4B 2RN2A 3WNEA 1O1WA 4CF2A 3T3FA 3NBPA 4LY7A 1KRPA 1TK8A 3CG7A 4O0IA 3LALA 4CK3A 5J2NA 2ETJA 4FZYA 3EYZA 3QNOA 4H4MA 1EP4A 1ZBFA 2IS3A 1BQNA 5JS2A 4H8KA 3IRXA 5HP1A 3QLHA 3DRPA 3B6OA 4DSFA 1BGXT 4HUGA 4BE0A 4KI4A 3TARA 1KFDA 1KTQA 3OYAA 4FVMA 5FROA 1ASUA 1YT3A 4BDPA 2X6NA 3SV4A 4OGCA 4QOZB 1HYSA 3VQ4A 2IOCA 3NH1A 3KK3A 1TKZA 2E4LA 5KI6A 5SWMA 1NK0A 3U6FA 2OZMA 4KPYA 4Z4CA 4CFAA 3C95A 4CECA 4O4GA 4DS5A 3SQ2A 3AO3A 3KK2A 2O4IA 4C8MA 4CF1A 3DLBA 4I2QA 3KLIA 4YFUA 1WNSA 4FXDA 4ZTJA 4KKOA 4DSIA 4CIEA 5CZ1A 4Z4FA 1XWLA 1VSKA 4CJRA 4RW9A 2BANA 5HBMA 4CEOA 1VK0A 2OPSA 4KB0A 1LAWA 1JLAA 5J2QA 1VSIA 3KKSA 3KKRA 2XRIA 4DFKA 3V81A 5CZ2A 3TAMA 2XO7A 1Z26A 2FC0A 2E6MA 3T1AA 4M3TA 2Z1HA 4HCCA 2FBTA 5J2PA 3K5LA 3DYAA 4DF4A 4FYDA 1U47A 2BGGA 3AVKA 1SKSA 2KW4A 4PA1A 1RNHA 1NJWA 4H4OA 3AV9A 4DU3A 1UOCA 1RTJA 3QESA 5HRPA 1C0UA 3DRRA 4CJWA 4AHSA 3SCXA 1TKXA 3AA2A 1X9SA 3NF9A 3ZSOA 4N41A 3NF6A 3NF7A 2F8SA 1RCHA 1QQCA 4EZ9A 5KGWA 4OPJA 4W5QA 3ZCMA 2PY5A 3AVGA 1BISA 3WNGA 3IAYA 1VSDA 3A2FA 1D9DA 3SUNA 1TK5A 1T7PA 1TV6A 1RBTA 4FZXC 2G8UA 3QEWA 3K2PA 1BCOA 3VQAA 2RF2A 4LD0A 5J1EA 1MU2A 1NOYA 2DTUA 4DG1A 3SPZA 4FJ7A 4KHQA 5DMRA 4W5RA 2F96A 3AA3A 3V9XA 2OYQA 4KHUA 1RDCA 3L2VA 4KHWA 4M3WA 4BWMA 3NGZA 3C6UA 1Q8IA 4FJ5A 3ALYA 1BIZA 3NFAA 2KFZA 1IG9A 2ZD1A 4CCHA 3OS0A 1J53A 1UWBA 3LPTA 3AVMA 3AVCA 4CGIA 1T8EA 1KVBA 1IKXA 1S1VA 3L2WA 3U3YA 1U48A 2IGIA 4JS5A 4B8CA 4AH9A 1RT6A 4CGHA 1KSPA 1BCMA 3VQPA 2YNHA 3ZSQA 1BL3A 4HCBA 4NYFA 4ELVA 3RR8A 3HT3A 2HHSA 3C6TA 1SUQA 4GW6A 1TGOA 3D45A 2GV9A 3M8QA 4IFVA 3ZT3A 3O3FA 1WSJA 4DU1A 1HYVA 3F9KA 4CHPA 1FXXA 3B6PA 4CJKA 2IDOA 2IAJA 2LSNA 4IFYA 4MQ3A 3PO4A 4CESA 3NCIA 3MXIA 1NK6A 3QIPA 4CHQA 3VN5A 3O3HA 1JKHA 1A5WA 3HP9A 2YNFA 1QSSA 2DFHA 1WAJA 3OYCA 4CE9A 3AA4A 3I0SA 3OS1A 1EX4A 4DFMA 1U49A 1NJYA 4FLVA 3PUFA 4CJFA 2XY6A 1L5UA 2OA8A 2EX3A 1SL0A 4IDKA 4I2PA 4RW8A 2X78A 1S6PA 4I9QA 1RT2A 4B9VA 4FJKA 3VQ8A 4CEAA 4UQGA 2QKBA 1CLQA 4DTXA 4CFDA 1GOBA 1RILA 1LWEA 3TAGA 3SQ4A 1LWCA 4AHRA 1NK7A 4KB1A 1S1TA 5HLFA 1VRTA 5SZTA 5C42A 5FRMA 1J5OA 3CM5A 3WNHA 2WONA 1HQEA 3LWMA 4I9LA 2G8WA 3BDPA 3QEPA 3QO9A 1UA1A 1EKEA 3LZIA 4KV8A 4W5OA 3MAQA 1C1AA 2VG5A 4DTSA 3S9HA 3PY8A 5D3GA 4DQPA 4DLEA 1SKWA 2YKMA 4JS4A 3AO5A 4FZZA 2QK9A 1UAXA 3AA5X 3AVJA 4ICLA 3SUOA 3AVAA 2KZMA 3VQ5A 3RRHA 1C6VA 4DS4A 1LV5A 1ZYQA 4C8KA 1RT5A 1KFSA 4IBNA 4O44A 2PZSA 4LSLA 3DLKA 4FM0A 1NJZA 3KJVA 1HYZA 2HMIA 4B9MA 1VSMA 1GOAA 2GBZA 3LP3A 4DQSA 1VSFA 2E6LA 3OVNA 1ZBUA 4O5BA 3ZSYA 1EXQA 1W9HA 3K5NA 1RTHA 3K5OA 3VQCA 4B08A 1RT1A 2HVIA 5CYMA 1XHXA 1B9DA 2HNDA 2Q3SA 4MFBA 3TAQA 1XI1A 3OYMA 3HM9A 4BE1A 4JRQA 4FJ9A 4F3OA 4EP5A 1ASVA 4FK4A 3LAMA 1XC9A 4OLAA 1HQUA 1NK9A 4RW6A 1K6YA 4DFPA 3SQ1A 5I3UA 1NKCA 2F8TA 2A1SA 3O3GA 3SUQA 4FLYA 4CHNA 2YNGA 4FJHA 4FJXA 4ELUA 4F2SA 3KLFA 1RBUA 4CEEA 4DLGA 4CIFA 4FCYA 3DMJA 1QSYA 3RR7A 4KAZA 3ZSZA 2HHXA 3OYBA 1FK9A 1ITGA 5HRRA 1WSGA 3ZSXA 4DQIA 1TL1A 3LDSA 4B9NA 3JYTA 1NOZA 4DTPA 4M3XA 2KZZA 3NAEA 4CFCA 3EZ5A 4KO0A 1JLCA 1FKOA 1S1WA 1VSLA 2FBXA 5CY4A 2P1JA 1WSIA 1S1UA 3DM2A 3QETA 3QNNA 1WAFA 1S9GA 1L3SA 1NJXA 4M42A 3OYIA 4IKFA 2X6SA 2BE2A 3DLGA 1B9FA 2FBVA 3NE6A 3DLEA 1T03A 1N6QA 2G8VA 3HP6A 3CFPA 4E3SA 4CEQA 3OYEA 4Z4GA 3SYZA 3CYMA 2RKIA 3KIOA 3LP0A 3OYDA 1WSEA 1DTTA 3AVNA 5E41A 2XHBA 4OGEA 1ZBLA 1SKRA 2XY5A 1U45A 1D9FA 2P5GA 4CJTA 4DU4A 1RDDA 1QE1A 4OKJA 1U04A 4XIUA 4FM2A 2A1RA 2P5OA 2AJQA 5C24A 1IH7A 4DQRA 1R0AA 2OPRA 4CGGA 3TANA 4Q5VA 2ATQA 3L2QA 4E89A 1TL3A 4JLHA 4BWJA 3LWLA 4B9SA 3MEGA 2I5JA 1SL2A 3QIOA 3HJFA 1A5XA 4KTQA 2PYLA 4DFJA 4YNQA 4HUFA 3V1QA 2XY7A 1KLNA 4OLBA 3VQQA 1HJRA 2RPIA 4N76A 1ASWA 3MXMA 1Y97A 1XHZA 1A5VA 4OVLA 4PY5A 3TAEA 4FW1A 3RTVA 4CEFA 1NK8A 4FM1A 5FRNA 4F4KA 4CJ5A 4K8ZA 3HYFA 3HL8A 2IC3A 1HRHA 4FJMA 3HPOA 3ASMA 1VSEA 4C8LA 4O55A 2HNZA 3THVA 1J54A 4Z4HA 3KD1E 3U3GA 3E01A 3TAFA 1SL1A 2YHAA 3OYNA 4DTMA 3VQEA 4M45A 2HHVA 1RDAA 4KHSA 1BI4A 1RDBA 1JXBA 4CJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E1M A;  2YV0 X;  3I0R A;  1VSJ A;  1I3A A;  3IG1 A;  4CED A;  5EU7 A;  3QEI A;  4CHY A;  3ZT0 A;  1IKW A;  4KHY A;  1BIU A;  3MEC A;  1CXQ A;  4E0D A;  3IS9 A;  1DTQ A;  4AHU A;  3RWU A;  4L8R B;  1WSH A;  3FFI A;  4CF0 A;  1TKD A;  4CER A;  5KRS A;  1KVA A;  4KHN A;  5CYQ A;  4F2R A;  3TI0 A;  3SUP A;  3KTQ A;  4FJG A;  3KK1 A;  1U4B A;  4CJS A;  3D0P A;  4EP4 A;  1N5Y A;  1T05 A;  3OJS A;  4W5N A;  4J2D A;  1JLF A;  1TK0 A;  3OYK A;  3LAN A;  3K59 A;  3NGI A;  5J2M A;  3UIQ A;  1D8Y A;  5T7B A;  4E1N A;  1W0H A;  4F8R A;  4CGF A;  1QTM A;  3ZSW A;  4ZTF A;  4DTJ A;  2HHQ A;  1KVC A;  1TVR A;  1LAV A;  4TSX A;  4AHV A;  4N47 A;  3KLE A;  1C0T A;  1JL2 A;  3NH2 A;  1KLM A;  1RBS A;  1RTI A;  4CF8 A;  1NK4 A;  1BQM A;  3OYJ A;  3JSM A;  4CEB A;  4E7H A;  3OY9 A;  3LZJ A;  4FLW A;  2XY8 A;  4PUO A;  1S6Q A;  4N56 A;  3O4N A;  4AHC A;  2R7Y A;  3L3V A;  1IKV A;  4HTU A;  4ID1 A;  2HHT A;  3OYH A;  3SPY A;  3AVH A;  4BE2 A;  2YHB A;  3G10 A;  4Y1C A;  3TAP A;  1CZB A;  1X9M A;  2NUB A;  4KTW A;  1Q9Y A;  5I42 A;  4E19 A;  4LSN A;  3HO1 A;  4Z4E A;  1I39 A;  5KGX A;  4EZ6 A;  4OKE A;  3AO1 A;  4KFB A;  1WSF A;  3LP1 A;  4R5P A;  2ZQB A;  2Y1J A;  2KFN A;  5HRO A;  4BAC A;  3QEX A;  3DLH A;  2VG7 A;  1UA0 A;  1L3T A;  1YTA A;  1YVU A;  3ISN C;  3V9W A;  4FJJ A;  2JLE A;  4NCB A;  1C1B A;  3AVI A;  3V9U A;  4J2B A;  1QHT A;  1ZBH A;  4CHZ A;  2QXF A;  1RT7 A;  3VQ6 A;  3MEE A;  2Z1J A;  3MXJ A;  2G8H A;  1VSH A;  4OKK A;  3HVT A;  3KD5 E;  3M8P A;  2X74 A;  3T19 A;  1B92 A;  4CFB A;  2D0A A;  1EET A;  3PX6 A;  3RMD A;  3VQ7 A;  3P83 D;  4KRF A;  1D5A A;  3ZT4 A;  3HXM A;  4J2A A;  1RT3 A;  4B3O A;  2VWJ A;  1G15 A;  4HVJ A;  2G8F A;  3S3N A;  3NGY A;  4FLX A;  1QSL A;  2B6A A;  1C0M A;  1JL1 A;  1X9W A;  4GMJ B;  3TAB A;  2OPQ A;  3ZT2 A;  4DQQ A;  4RW7 A;  4CK1 A;  1RBR A;  1LWF A;  3L8B A;  3V9Z A;  2G8I A;  1CXU A;  1HPZ A;  4FJN A;  1FKP A;  3AVF A;  4DSE A;  1S5J A;  4NCA A;  3DRS A;  1Z25 A;  4QAG A;  4HUE A;  3LAK A;  4CJV A;  3RMB A;  4LH5 A;  2GUI A;  4DTO A;  2P51 A;  3AVL A;  4GVM A;  4K8X A;  2PYJ A;  4NYN A;  4CF9 A;  3VQ9 A;  2HHW A;  4Q0B A;  1JLE A;  3HPG A;  4CJQ A;  3S3O A;  4KI6 A;  4M3U A;  4FK0 A;  4E7K A;  4PWD A;  3TR8 A;  2DY4 A;  1C1C A;  4CGD A;  3I8D A;  3QEV A;  1DLO A;  3V1O A;  2D5R A;  1HMV A;  4CIG A;  4ELT A;  3RMC A;  3NH0 A;  2Z1G A;  3AO2 A;  4N5S A;  3PX4 A;  4ID5 A;  3HVR A;  3O4Q A;  2D0B A;  2Z1I A;  2EHG A;  2ITG A;  2O4G A;  3AVB A;  4BDY A;  4M3Y A;  4KTZ A;  4AIL C;  4FW2 A;  4B8A B;  3L2R A;  5KTQ A;  3RRG A;  4JRP A;  3P5J A;  4Z4I A;  3QER A;  4FJ8 A;  1WLJ A;  3M8S A;  4M3Z A;  1IKY A;  3V6D A;  4RG8 A;  1S1X A;  3PX0 A;  3HST B;  4OPK A;  1JLQ A;  4E7I A;  3S3M A;  1Q9X A;  4CK2 A;  1J9A A;  1HNI A;  2OPP A;  1TAQ A;  4IG3 A;  1WN7 A;  1CZ9 A;  4AHT A;  2KTQ A;  1RTD A;  3DLR A;  1NK5 A;  4CJ3 A;  5C25 A;  1X1P A;  5KRT A;  3ZSR A;  3V1R A;  2YKN A;  3HPH A;  3ITH A;  3H08 A;  2B5J A;  2WOM A;  4CHO A;  3OS2 A;  1GOC A;  1LW2 A;  1NKE A;  4DSK A;  4OJR A;  1QS4 A;  1SV5 A;  4CJE A;  1LW0 A;  5HRN A;  2KQ2 A;  3RMA A;  3V4I A;  4Z0U A;  4M3R A;  3ULD A;  3K58 A;  2ZE2 A;  4ZHR A;  1RBV A;  3VQD A;  4QCL A;  4NCG A;  4DTU A;  1REV A;  3G0Z A;  4DTN A;  4Y1D A;  3DOL A;  3AO4 A;  4W5T A;  2VG6 A;  4O0J A;  3K57 A;  3L3U A;  3HK2 A;  3BGR A;  2HVH A;  1JXE A;  3QIN A;  3KLH A;  3CQ8 A;  4J2E A;  3OYF A;  2DFE A;  1NKB A;  5K14 A;  4CEZ A;  3V9S A;  4PQU A;  1BHL A;  4CGJ A;  4DSJ A;  2BDP A;  1RT4 A;  4WE1 A;  4DTR A;  4BDZ A;  1L3V A;  3WNF A;  3PO5 A;  4C8N A;  3SNN A;  2FBY A;  4DMN A;  3NDK A;  3CFO A;  4FJL A;  1KCF A;  4FLT A;  3NHG A;  4FLU A;  2YNI A;  3KLG A;  5FDL A;  4E7L A;  4B9T A;  3CM6 A;  3OJU A;  3DI6 A;  4FLZ A;  1JLG A;  4M41 A;  3ZSV A;  2OZS A;  2HHU A;  3M8R A;  2Y1I A;  2JGU A;  3VA0 A;  3LPU A;  4FJI A;  4HHT A;  1ZBI A;  2HW3 A;  3DOK A;  4C8O A;  4DWI A;  3OYL A;  3OYG A;  3SQ0 A;  3P1G A;  4FK2 A;  3C94 A;  4CJ4 A;  3LP2 A;  2B4J A;  4LH4 A;  4B9U A;  1L3U A;  3SV3 A;  3VQB A;  4B9L A;  1JLB A;  2D0C A;  3MED A;  4RW4 A;  3SZ2 A;  4CJU A;  2G8K A;  1S9E A;  1TAU A;  3SI6 A;  5JS1 A;  3CFR A;  1VRU A;  3K5M A;  3PV8 A;  3L2U A;  3TWH A;  1IO2 A;  1TKT A;  3NF8 A;  4DSL A;  4E7J A;  1YTU A;  1F21 A;  4G1Q A;  1HNV A;  4I7F A;  4IG0 A;  2DFF A;  3EY1 A;  3VA3 A;  3F73 A;  4CJP A;  2W42 A;  4DF8 A;  4F3T A;  2HNY A;  5DK5 A;  5HRS A;  4KRE A;  2QKK A;  2HB5 A;  2VWK A;  3ZT1 A;  3SJJ A;  1BI4 B;  2RN2 A;  3WNE A;  1O1W A;  4CF2 A;  3T3F A;  3NBP A;  4LY7 A;  1KRP A;  1TK8 A;  3CG7 A;  4O0I A;  3LAL A;  4CK3 A;  5J2N A;  2ETJ A;  4FZY A;  3EYZ A;  3QNO A;  4H4M A;  1EP4 A;  1ZBF A;  2IS3 A;  1BQN A;  5JS2 A;  4H8K A;  3IRX A;  5HP1 A;  3QLH A;  3DRP A;  3B6O A;  4DSF A;  1BGX T;  4HUG A;  4BE0 A;  4KI4 A;  3TAR A;  1KFD A;  1KTQ A;  3OYA A;  4FVM A;  5FRO A;  1ASU A;  1YT3 A;  4BDP A;  2X6N A;  3SV4 A;  4OGC A;  4QOZ B;  1HYS A;  3VQ4 A;  2IOC A;  3NH1 A;  3KK3 A;  1TKZ A;  2E4L A;  5KI6 A;  5SWM A;  1NK0 A;  3U6F A;  2OZM A;  4KPY A;  4Z4C A;  4CFA A;  3C95 A;  4CEC A;  4O4G A;  4DS5 A;  3SQ2 A;  3AO3 A;  3KK2 A;  2O4I A;  4C8M A;  4CF1 A;  3DLB A;  4I2Q A;  3KLI A;  4YFU A;  1WNS A;  4FXD A;  4ZTJ A;  4KKO A;  4DSI A;  4CIE A;  5CZ1 A;  4Z4F A;  1XWL A;  1VSK A;  4CJR A;  4RW9 A;  2BAN A;  5HBM A;  4CEO A;  1VK0 A;  2OPS A;  4KB0 A;  1LAW A;  1JLA A;  5J2Q A;  1VSI A;  3KKS A;  3KKR A;  2XRI A;  4DFK A;  3V81 A;  5CZ2 A;  3TAM A;  2XO7 A;  1Z26 A;  2FC0 A;  2E6M A;  3T1A A;  4M3T A;  2Z1H A;  4HCC A;  2FBT A;  5J2P A;  3K5L A;  3DYA A;  4DF4 A;  4FYD A;  1U47 A;  2BGG A;  3AVK A;  1SKS A;  2KW4 A;  4PA1 A;  1RNH A;  1NJW A;  4H4O A;  3AV9 A;  4DU3 A;  1UOC A;  1RTJ A;  3QES A;  5HRP A;  1C0U A;  3DRR A;  4CJW A;  4AHS A;  3SCX A;  1TKX A;  3AA2 A;  1X9S A;  3NF9 A;  3ZSO A;  4N41 A;  3NF6 A;  3NF7 A;  2F8S A;  1RCH A;  1QQC A;  4EZ9 A;  5KGW A;  4OPJ A;  4W5Q A;  3ZCM A;  2PY5 A;  3AVG A;  1BIS A;  3WNG A;  3IAY A;  1VSD A;  3A2F A;  1D9D A;  3SUN A;  1TK5 A;  1T7P A;  1TV6 A;  1RBT A;  4FZX C;  2G8U A;  3QEW A;  3K2P A;  1BCO A;  3VQA A;  2RF2 A;  4LD0 A;  5J1E A;  1MU2 A;  1NOY A;  2DTU A;  4DG1 A;  3SPZ A;  4FJ7 A;  4KHQ A;  5DMR A;  4W5R A;  2F96 A;  3AA3 A;  3V9X A;  2OYQ A;  4KHU A;  1RDC A;  3L2V A;  4KHW A;  4M3W A;  4BWM A;  3NGZ A;  3C6U A;  1Q8I A;  4FJ5 A;  3ALY A;  1BIZ A;  3NFA A;  2KFZ A;  1IG9 A;  2ZD1 A;  4CCH A;  3OS0 A;  1J53 A;  1UWB A;  3LPT A;  3AVM A;  3AVC A;  4CGI A;  1T8E A;  1KVB A;  1IKX A;  1S1V A;  3L2W A;  3U3Y A;  1U48 A;  2IGI A;  4JS5 A;  4B8C A;  4AH9 A;  1RT6 A;  4CGH A;  1KSP A;  1BCM A;  3VQP A;  2YNH A;  3ZSQ A;  1BL3 A;  4HCB A;  4NYF A;  4ELV A;  3RR8 A;  3HT3 A;  2HHS A;  3C6T A;  1SUQ A;  4GW6 A;  1TGO A;  3D45 A;  2GV9 A;  3M8Q A;  4IFV A;  3ZT3 A;  3O3F A;  1WSJ A;  4DU1 A;  1HYV A;  3F9K A;  4CHP A;  1FXX A;  3B6P A;  4CJK A;  2IDO A;  2IAJ A;  2LSN A;  4IFY A;  4MQ3 A;  3PO4 A;  4CES A;  3NCI A;  3MXI A;  1NK6 A;  3QIP A;  4CHQ A;  3VN5 A;  3O3H A;  1JKH A;  1A5W A;  3HP9 A;  2YNF A;  1QSS A;  2DFH A;  1WAJ A;  3OYC A;  4CE9 A;  3AA4 A;  3I0S A;  3OS1 A;  1EX4 A;  4DFM A;  1U49 A;  1NJY A;  4FLV A;  3PUF A;  4CJF A;  2XY6 A;  1L5U A;  2OA8 A;  2EX3 A;  1SL0 A;  4IDK A;  4I2P A;  4RW8 A;  2X78 A;  1S6P A;  4I9Q A;  1RT2 A;  4B9V A;  4FJK A;  3VQ8 A;  4CEA A;  4UQG A;  2QKB A;  1CLQ A;  4DTX A;  4CFD A;  1GOB A;  1RIL A;  1LWE A;  3TAG A;  3SQ4 A;  1LWC A;  4AHR A;  1NK7 A;  4KB1 A;  1S1T A;  5HLF A;  1VRT A;  5SZT A;  5C42 A;  5FRM A;  1J5O A;  3CM5 A;  3WNH A;  2WON A;  1HQE A;  3LWM A;  4I9L A;  2G8W A;  3BDP A;  3QEP A;  3QO9 A;  1UA1 A;  1EKE A;  3LZI A;  4KV8 A;  4W5O A;  3MAQ A;  1C1A A;  2VG5 A;  4DTS A;  3S9H A;  3PY8 A;  5D3G A;  4DQP A;  4DLE A;  1SKW A;  2YKM A;  4JS4 A;  3AO5 A;  4FZZ A;  2QK9 A;  1UAX A;  3AA5 X;  3AVJ A;  4ICL A;  3SUO A;  3AVA A;  2KZM A;  3VQ5 A;  3RRH A;  1C6V A;  4DS4 A;  1LV5 A;  1ZYQ A;  4C8K A;  1RT5 A;  1KFS A;  4IBN A;  4O44 A;  2PZS A;  4LSL A;  3DLK A;  4FM0 A;  1NJZ A;  3KJV A;  1HYZ A;  2HMI A;  4B9M A;  1VSM A;  1GOA A;  2GBZ A;  3LP3 A;  4DQS A;  1VSF A;  2E6L A;  3OVN A;  1ZBU A;  4O5B A;  3ZSY A;  1EXQ A;  1W9H A;  3K5N A;  1RTH A;  3K5O A;  3VQC A;  4B08 A;  1RT1 A;  2HVI A;  5CYM A;  1XHX A;  1B9D A;  2HND A;  2Q3S A;  4MFB A;  3TAQ A;  1XI1 A;  3OYM A;  3HM9 A;  4BE1 A;  4JRQ A;  4FJ9 A;  4F3O A;  4EP5 A;  1ASV A;  4FK4 A;  3LAM A;  1XC9 A;  4OLA A;  1HQU A;  1NK9 A;  4RW6 A;  1K6Y A;  4DFP A;  3SQ1 A;  5I3U A;  1NKC A;  2F8T A;  2A1S A;  3O3G A;  3SUQ A;  4FLY A;  4CHN A;  2YNG A;  4FJH A;  4FJX A;  4ELU A;  4F2S A;  3KLF A;  1RBU A;  4CEE A;  4DLG A;  4CIF A;  4FCY A;  3DMJ A;  1QSY A;  3RR7 A;  4KAZ A;  3ZSZ A;  2HHX A;  3OYB A;  1FK9 A;  1ITG A;  5HRR A;  1WSG A;  3ZSX A;  4DQI A;  1TL1 A;  3LDS A;  4B9N A;  3JYT A;  1NOZ A;  4DTP A;  4M3X A;  2KZZ A;  3NAE A;  4CFC A;  3EZ5 A;  4KO0 A;  1JLC A;  1FKO A;  1S1W A;  1VSL A;  2FBX A;  5CY4 A;  2P1J A;  1WSI A;  1S1U A;  3DM2 A;  3QET A;  3QNN A;  1WAF A;  1S9G A;  1L3S A;  1NJX A;  4M42 A;  3OYI A;  4IKF A;  2X6S A;  2BE2 A;  3DLG A;  1B9F A;  2FBV A;  3NE6 A;  3DLE A;  1T03 A;  1N6Q A;  2G8V A;  3HP6 A;  3CFP A;  4E3S A;  4CEQ A;  3OYE A;  4Z4G A;  3SYZ A;  3CYM A;  2RKI A;  3KIO A;  3LP0 A;  3OYD A;  1WSE A;  1DTT A;  3AVN A;  5E41 A;  2XHB A;  4OGE A;  1ZBL A;  1SKR A;  2XY5 A;  1U45 A;  1D9F A;  2P5G A;  4CJT A;  4DU4 A;  1RDD A;  1QE1 A;  4OKJ A;  1U04 A;  4XIU A;  4FM2 A;  2A1R A;  2P5O A;  2AJQ A;  5C24 A;  1IH7 A;  4DQR A;  1R0A A;  2OPR A;  4CGG A;  3TAN A;  4Q5V A;  2ATQ A;  3L2Q A;  4E89 A;  1TL3 A;  4JLH A;  4BWJ A;  3LWL A;  4B9S A;  3MEG A;  2I5J A;  1SL2 A;  3QIO A;  3HJF A;  1A5X A;  4KTQ A;  2PYL A;  4DFJ A;  4YNQ A;  4HUF A;  3V1Q A;  2XY7 A;  1KLN A;  4OLB A;  3VQQ A;  1HJR A;  2RPI A;  4N76 A;  1ASW A;  3MXM A;  1Y97 A;  1XHZ A;  1A5V A;  4OVL A;  4PY5 A;  3TAE A;  4FW1 A;  3RTV A;  4CEF A;  1NK8 A;  4FM1 A;  5FRN A;  4F4K A;  4CJ5 A;  4K8Z A;  3HYF A;  3HL8 A;  2IC3 A;  1HRH A;  4FJM A;  3HPO A;  3ASM A;  1VSE A;  4C8L A;  4O55 A;  2HNZ A;  3THV A;  1J54 A;  4Z4H A;  3KD1 E;  3U3G A;  3E01 A;  3TAF A;  1SL1 A;  2YHA A;  3OYN A;  4DTM A;  3VQE A;  4M45 A;  2HHV A;  1RDA A;  4KHS A;  1BI4 A;  1RDB A;  1JXB A;  4CJL A; 
#chains in the Genus database with same CATH topology
 4OPA A;  3QEI A;  4E0D A;  3CCJ N;  3CPW M;  2V51 B;  1DTQ A;  4B1W B;  4CER A;  3KTQ A;  5EX5 A;  3F9M A;  3VTI A;  4BRO A;  1D8Y A;  5T7B A;  2HST A;  5AQL A;  5I9E B;  3QML A;  3KLE A;  3NH2 A;  1KLM A;  1RBS A;  3R1X A;  3OBW A;  1NK4 A;  3ENB A;  4CZG A;  4FLW A;  4X64 K;  3UKR A;  1BOT O;  1WB9 A;  2YHB A;  3MWT A;  4YOR A;  1X9M A;  5M1F A;  5I42 A;  4FOE A;  5KGX A;  1BU6 O;  1X3N A;  1HNZ K;  4JI7 K;  2E20 A;  3ID8 A;  5GAH P;  3CME N;  1YTA A;  3BP8 A;  2JLE A;  3VGM A;  3AVI A;  1QHT A;  4CHZ A;  1RT7 A;  4OKK A;  1MDU B;  4JKF A;  1B92 A;  1K8K A;  1WOQ A;  1NGI A;  3CER A;  3VQ7 A;  1D5A A;  2IVP A;  3S3N A;  2AP1 A;  4CZF A;  3TAB A;  3ZT2 A;  4CK1 A;  4FSV A;  2P9K B;  3ULE B;  3LL3 A;  4WFN L;  2W40 A;  3LAK A;  4CJV A;  4LH5 A;  2GUI A;  4Z94 A;  5C2F A;  3VQ9 A;  4M3U A;  2DY4 A;  4FK0 A;  4ILJ A;  3TR8 A;  3I8D A;  3QEV A;  4GNI A;  1QQN A;  4CIG A;  5EXW A;  3NH0 A;  4N5S A;  3CF5 L;  4GKK K;  2HBL A;  2Z1I A;  3AGK A;  2O4G A;  5AQN A;  4BDY A;  3N4Q A;  2VQF K;  5KTQ A;  5AQS A;  3RRG A;  4Z4I A;  5AQX A;  4FJ8 A;  3M8S A;  3V6D A;  4RG8 A;  5HL7 L;  5KQD A;  4OPK A;  1JLQ A;  4E7I A;  1XC3 A;  4IG3 A;  1WN7 A;  1RTD A;  3M6G A;  1NK5 A;  4NXM K;  3IUC A;  3K0S A;  1ATR A;  4CHO A;  1LW2 A;  3NMU A;  1HKC A;  1XMQ K;  3HOT A;  4JI5 K;  4B1U B;  3VEX A;  2KQ2 A;  3V4I A;  4Z0U A;  1JJ2 M;  2F4V K;  4QCL A;  4DTN A;  2BUP A;  4OO1 J;  1EO1 A;  4W5T A;  1E4F T;  3HK2 A;  5BR9 A;  1HX1 A;  1JXE A;  1DT9 A;  3ENO A;  3OYF A;  3PSF A;  2DFE A;  1NKB A;  2UXD K;  2BDP A;  1VQ8 N;  2UXC K;  4BDZ A;  1BUP A;  3WNF A;  4C8N A;  2FBY A;  4K41 A;  4B1V A;  3KLG A;  3CM6 A;  1YIJ N;  1NGB A;  1N8R O;  4M41 A;  2OZS A;  2Q36 A;  3M8R A;  4FJI A;  3LPU A;  1ZBI A;  3DOK A;  4DWI A;  4CJ4 A;  4B9U A;  4EAH D;  1LCU A;  3R3L A;  3SV3 A;  2QWR A;  1XUP O;  1JLB A;  4CJU A;  5LJW A;  5BRD A;  3CFR A;  3K5M A;  3PV8 A;  3L2U A;  2QWL A;  1IO2 A;  5C15 A;  4E7J A;  4BRI A;  4L3Q A;  2W42 A;  4DF8 A;  5HRS A;  3QBX A;  2VWK A;  2H3G X;  3EO3 A;  4WCE L;  1O1W A;  3T3F A;  3NBP A;  4LY7 A;  1KRP A;  3CG7 A;  3CQY A;  5J2N A;  2ETJ A;  5AQU A;  1BQN A;  3QLH A;  3MMV A;  4BY9 C;  1BGX T;  2NRR A;  3H46 O;  4KI4 A;  1RDU A;  3VEN A;  1KTQ A;  2AA4 A;  3CCM N;  2E2P A;  3SV4 A;  1HYS A;  2IOC A;  3KK3 A;  2OZM A;  5KI6 A;  4NB4 A;  5MLC Q;  4BGB A;  3U6F A;  4CFA A;  3CCS N;  2ITM A;  3DLB A;  3SAH A;  3UKU A;  1VSK A;  3O9Q A;  1JLA A;  5J2Q A;  1VSI A;  5KPZ A;  1FW6 A;  4GVE A;  3D7E O;  1J6Z A;  1Z26 A;  3T1A A;  2FBT A;  4Y0W A;  1IV0 A;  4DF4 A;  1VQO N;  1VQM N;  5AQH A;  5FPE A;  3AVK A;  4YOX A;  1SKS A;  3GE1 A;  3SBG A;  2KKZ A;  4WQ4 A;  5HRP A;  4AHS A;  3AA2 A;  4WYB A;  4BR2 A;  1X9S A;  1KC8 O;  4YOY A;  2ZJP L;  4EZ9 A;  5KGW A;  3DXM A;  3U9D A;  1YI2 N;  1T7P A;  1TV6 A;  4A57 A;  3G4S N;  4LD0 A;  4YOW A;  3SPZ A;  3TTF A;  3VTH A;  3NVM A;  2F96 A;  3AA3 A;  4W5R A;  2OYQ A;  4KHU A;  4KHW A;  4I6M A;  2KFZ A;  3OS0 A;  1J53 A;  1UWB A;  2O8C B;  3LPT A;  1T8E A;  1KVB A;  3I56 N;  1MWM A;  4B3R K;  2HF3 A;  1U48 A;  2IGI A;  3EL2 A;  2HBK A;  4CGH A;  2E1Y A;  2YNH A;  4IEE A;  1BL3 A;  3MN5 A;  2YJF A;  3KHY A;  4BRD A;  3HT3 A;  3C6T A;  1SUQ A;  3ZEU B;  2GV9 A;  3O3F A;  4IFV A;  4FVU A;  4H0P A;  3M3Z A;  2GWJ A;  4IJA A;  4CHP A;  1FXX A;  4QS7 A;  4A59 A;  3G6E N;  1BWF O;  3F2K A;  4MQ3 A;  4GV9 A;  3PO4 A;  4H0Y B;  3MXI A;  1NK6 A;  3QIP A;  3O3H A;  1W2B M;  5A2Q O;  1EX4 A;  4M63 C;  4FLV A;  4CJF A;  4IDK A;  4I2P A;  2X78 A;  1S6P A;  3MN9 A;  4I9Q A;  1RT2 A;  4KH6 A;  3VQ8 A;  4X66 K;  4UQG A;  2QKB A;  1CLQ A;  4CFD A;  3CCR N;  3TAG A;  4IZ9 A;  4FWR A;  1VRT A;  5IWA K;  1YIT N;  3J80 O;  2WON A;  5DM6 L;  2G8W A;  4XH1 A;  1QQO A;  1UA1 A;  3TSP A;  3VER A;  4BRC A;  3OBY A;  3PY8 A;  3CJA A;  4DLE A;  2YKM A;  2W6K A;  4FZZ A;  4PKH A;  2RE2 A;  3QIC A;  1Z05 A;  2YHW A;  4DS4 A;  1KFS A;  4O44 A;  4FM0 A;  3DLK A;  1NJZ A;  4RCH A;  4B9M A;  1VSM A;  1NGA A;  1GOA A;  2OCE A;  3O80 A;  5ADX H;  2P9S A;  3K5N A;  1RT1 A;  3MWP A;  1XHX A;  5BR8 K;  1B9D A;  2HND A;  2Q3S A;  1XI1 A;  3MX2 A;  3UKR B;  4F3O A;  4OLA A;  3TTD A;  1HQU A;  4DV3 K;  2F8T A;  2A40 A;  3O3G A;  1P8Z A;  3SUQ A;  4DLG A;  1QSY A;  3RR7 A;  2HHX A;  3ZSZ A;  2CH6 A;  3LDL A;  3WT0 A;  3OYB A;  1WSG A;  4BRG A;  1R59 O;  4JD2 A;  4JI2 K;  3U9Z A;  3A0I X;  2FF3 B;  3P4I A;  3D2E A;  3EZ5 A;  1GLD G;  5AQF A;  1EQY A;  1S1W A;  1VSL A;  1WSI A;  5AZI A;  3DM2 A;  3QNN A;  2HHH K;  1S9G A;  4X62 K;  1NJX A;  4BQZ A;  3DLG A;  3HBT A;  1B9F A;  3O9T A;  4PWD A;  2G8V A;  2WTU A;  3HP6 A;  3CFP A;  5AQQ A;  3KIO A;  4PKI A;  5E41 A;  2P5G A;  1ZBL A;  5AQV A;  2XY5 A;  4CJT A;  4YY3 K;  1RDD A;  1QE1 A;  1U04 A;  4XIU A;  5C24 A;  1IH7 A;  1HLU A;  4CZI A;  2OPR A;  4F9O A;  3MEG A;  3HJF A;  2UUB K;  5AZJ B;  4DFJ A;  3HZ6 A;  3V1Q A;  1HJR A;  1NU0 A;  2CH5 A;  2HBM A;  3MXM A;  2IVN A;  3KK7 A;  1NK8 A;  1ZC6 A;  4FM1 A;  3SAG A;  5FRN A;  4F4K A;  3QFU A;  1HRH A;  3HPO A;  3ASM A;  4O55 A;  2UU9 K;  3IKM A;  4JNE A;  5BRH A;  1SL1 A;  5C12 A;  4GKJ K;  2W6L A;  2QWM A;  1RDA A;  4IXC A;  4JKG A;  4BG8 A;  3S41 A;  4CJL A;  3TTC A;  1YVN A;  4YOU A;  2YV0 X;  3I0R A;  4DR7 K;  1I3A A;  4CED A;  4CHY A;  3ZT0 A;  1IKW A;  1KXP A;  1NG9 A;  3VF4 A;  3FFI A;  3T7Z A;  4CF0 A;  1OH6 A;  3SUP A;  4FJG A;  3KK1 A;  1N5Y A;  4EP4 A;  4W5N A;  3OJS A;  4H0T B;  1K8A O;  2FXU A;  4LC9 B;  4E1N A;  1W0H A;  4F8R A;  5AQZ A;  2HHQ A;  4TSX A;  1YHQ N;  4N47 A;  3TU5 A;  5GIP A;  1C0T A;  1JL2 A;  2UUC K;  4HWI A;  3L4Q A;  4E7H A;  3CCV N;  3A5N C;  3AY9 A;  3LZJ A;  2XY8 A;  4PUO A;  4N56 A;  1VQN N;  4DV7 K;  4WQ4 C;  2R7Y A;  2NRT A;  3SPY A;  3AVH A;  1VQ9 N;  3P39 A;  1Q9Y A;  3FR0 A;  2P9S B;  1XNQ K;  4Z4E A;  1I39 A;  4WFA L;  4BG9 A;  2E2O A;  4KFB A;  3ATU A;  3PIP L;  3LP1 A;  4R5P A;  2ZQB A;  4C23 A;  3FFK B;  5HRO A;  4BVP A;  3QEX A;  4NCB A;  3V9W A;  1T44 A;  4BGA A;  3O9U A;  3MXJ A;  3SMS A;  3KD5 E;  3M8P A;  1I94 K;  3T19 A;  4V19 S;  5M1N A;  3OW2 M;  4CFB A;  1VQ6 N;  4JI4 K;  4ISG A;  3ZET A;  1OH8 A;  3LDQ A;  2JWL A;  4JD2 B;  5H1S Q;  3HXM A;  1G15 A;  3WUH A;  1NBW A;  1QSL A;  2B6A A;  1C0M A;  2HBJ A;  1X9W A;  3CJ9 A;  5B8H A;  2OPQ A;  4DQQ A;  5AQP A;  4C1N K;  2RHK A;  4BVO A;  1MWK A;  1EWQ A;  1WBB A;  1HPZ A;  5F0X A;  1FKP A;  3DRS A;  1GLC G;  1Z25 A;  4QAG A;  1OH5 A;  3RMB A;  2OTJ N;  2Q97 A;  3AVL A;  2PYJ A;  4NYN A;  5GIN A;  4DV6 K;  3FE1 A;  5KPR A;  1C1C A;  2DPN A;  3V1O A;  1HMV A;  3RMC A;  1V4T A;  5CHI A;  2Z1G A;  4ID5 A;  1BDG A;  2EHG A;  4YDU A;  2PFU A;  4H5R A;  4KTZ A;  4AIL C;  3ZLJ A;  4BRE A;  5C10 A;  2GEM A;  3QER A;  1Q81 O;  4FPA A;  3PX0 A;  3S3M A;  1Q9X A;  2OPP A;  4DCH A;  3ZEU A;  1CZ9 A;  4CJ3 A;  1KAY A;  5KRT A;  4IJN A;  2QXL A;  4JI0 K;  2YKN A;  3H08 A;  3OS2 A;  3L6Q A;  4BR7 A;  1NKE A;  5M1Q A;  3THW B;  1K73 O;  1SV5 A;  3HM8 A;  4CJE A;  3AAP A;  4JKH A;  5HRN A;  4B1Y B;  2O8B B;  4EHT A;  2ZE2 A;  5M1P A;  2VCP A;  1RBV A;  3VQD A;  5TKY A;  4NCG A;  4Y1D A;  4B3M K;  2A5X A;  3AO4 A;  2VG6 A;  4O0J A;  2ZGZ A;  3QIN A;  3KLH A;  3IDH A;  4XEI A;  3UE5 A;  1BHL A;  4CGJ A;  1X9J A;  2OAN A;  1L3V A;  5JVH L;  3B8A X;  2VQE K;  1KCF A;  4FLU A;  3I8B A;  3M5R A;  4B9T A;  3MCP A;  4BRQ A;  3VA0 A;  2HW3 A;  2CGL A;  3OYL A;  3OYG A;  3SQ0 A;  1C0F A;  3LP2 A;  3EKU A;  4RW4 A;  3P38 A;  2ZGY A;  4BRH A;  4O8U A;  3IMX A;  4OPH A;  1HKG A;  1YTU A;  1F21 A;  2QTD A;  4IG0 A;  4NLC A;  4I7F A;  2HVH A;  3EY1 A;  1XNR K;  4BC5 A;  2A41 A;  2HB5 A;  3SJJ A;  1BI4 B;  2RN2 A;  4WQ5 A;  1NNE A;  1NGD A;  4A61 A;  3LAL A;  5AQG A;  3QNO A;  4H4M A;  4LF9 K;  1ZBF A;  2IS3 A;  4H8K A;  3IRX A;  3DRP A;  3B6O A;  4DSF A;  4BE0 A;  2QWP A;  4MO4 A;  1KFD A;  4QS9 A;  5F2R A;  4CJ7 A;  3OYA A;  2PBD A;  1XMO K;  1ASU A;  4BDP A;  1KAZ A;  2X6N A;  4OGC A;  1QZ6 A;  2YHX A;  1XQS C;  3NH1 A;  1ZBS A;  1YJW N;  1DGK N;  4KPY A;  4Z4C A;  1ZXO A;  3CI5 A;  3SMP A;  4O4G A;  3SQ2 A;  2O4I A;  2HMP A;  4C8M A;  1E4G T;  4FXD A;  1NM1 A;  4KKO A;  4DSI A;  5CZ1 A;  4B9Q A;  4Z4F A;  3TSU A;  4KB0 A;  4HTL A;  3KKS A;  3KKR A;  4YOV A;  3V81 A;  4DFK A;  3K9J A;  2ZM6 K;  2XO7 A;  4PHT X;  2E6M A;  4HCC A;  3AAR A;  2QM1 A;  3K5L A;  4FYD A;  1U2V A;  2BGG A;  3LDO A;  5LL6 Z;  4PA1 A;  1RNH A;  2P9U B;  1NJW A;  4H4O A;  4BR9 A;  1UOC A;  1GLJ O;  4CJW A;  2NZT A;  2Q0U A;  4BRL A;  1TKX A;  3NF9 A;  4BRM A;  3NF7 A;  4CZL A;  1T6C A;  1RCH A;  2PY5 A;  4OPJ A;  4W5Q A;  1HR0 K;  1YUW A;  3MN7 A;  3IAY A;  3SUN A;  1TK5 A;  5AQT A;  4CVN E;  2G8U A;  5E26 A;  3BY5 A;  1MU2 A;  1NOY A;  3RVC A;  2UXB K;  4H03 B;  3J7Y P;  2GWK A;  1IBK K;  3NGZ A;  3C6U A;  1VQ5 N;  3ALY A;  1BIZ A;  2ZD1 A;  3AVM A;  4CGI A;  2FSK A;  3BF3 A;  3FZK A;  2FSN A;  4NLB A;  4AH9 A;  1NGE A;  1KSP A;  3VQP A;  1U6Z A;  4CI6 A;  3KZB A;  4A62 A;  3CD6 N;  3RR8 A;  4GW6 A;  1WSJ A;  1N36 K;  3DJC A;  4CJK A;  4IFY A;  4CES A;  3NCI A;  1GLB G;  3C0B A;  1QSS A;  2P9N A;  3OYC A;  3AA4 A;  3I0S A;  1NJY A;  1L5U A;  3D6R A;  4RW8 A;  3HSC A;  1QQM A;  4FJK A;  4CEA A;  3CJC A;  3DXK B;  1LWE A;  4JK9 A;  3THX B;  3SQ4 A;  3O08 A;  1LWC A;  4AHR A;  4KB1 A;  1S1T A;  5HLF A;  5SZT A;  1GLA G;  4JKA A;  3QEP A;  1GLF O;  4W5O A;  4U67 L;  5KQ8 A;  3S9H A;  5D3G A;  1VQK N;  5F1X A;  2QK9 A;  2D1K A;  4K43 A;  3SUO A;  2NRZ A;  1ATS A;  3RRH A;  4EIA A;  5BPN A;  1Z6R A;  3KJV A;  4DR5 K;  4AF1 A;  3LP3 A;  3OVN A;  2P9I A;  4O5B A;  1HNW K;  3K5O A;  4B08 A;  1EWR A;  4GY2 B;  2HVI A;  5CYM A;  3ZX0 A;  3L4I A;  3VF6 A;  2PAV A;  1OVQ A;  5EVZ A;  3TAQ A;  3HRG A;  3U8X A;  4FJ9 A;  3VEY A;  4JI3 K;  1QVF M;  3MN6 A;  5I3U A;  5AQO A;  4FLY A;  4CHN A;  4FJX A;  4U7B A;  3KLF A;  2E2Q A;  2Q31 A;  1YJ9 N;  1ITG A;  5HRR A;  3LDS A;  5BN9 A;  1NOZ A;  4XH5 A;  4CFC A;  1JLC A;  5BRE A;  2FBX A;  5CY4 A;  2O8C A;  5EOY A;  2BE2 A;  4A2A A;  4E1J A;  3NE6 A;  4FO0 A;  1N6Q A;  3OYE A;  3EE9 A;  1DTT A;  4CBX A;  2P5O A;  4LF8 K;  4DQR A;  2HOE A;  3SBT A;  2A6A A;  2ATQ A;  3GG4 A;  4E89 A;  4JLH A;  3LWL A;  3WEE A;  4KTQ A;  2PYL A;  4K25 A;  2XY7 A;  1KLN A;  2ZJQ L;  1ATN A;  1VQ4 N;  1XHZ A;  1A5V A;  4OVL A;  4NXN K;  2P9I B;  2ASP A;  3D2E B;  3RSE B;  3CHW A;  4IOA L;  1BA1 A;  1VQP N;  1VSE A;  4IFE A;  5BPM A;  2O8D B;  3THV A;  3QBW A;  3KD1 E;  4K0K K;  1P90 A;  3DWL A;  3VQE A;  4YDU C;  1BO5 O;  3A8Y A;  2HHV A;  3SLC A;  4JAX A;  3EEQ A;  1JXB A;  3LM2 A;  1VSJ A;  5EU7 A;  1YAG A;  5BN8 A;  4X65 K;  4KHY A;  4BC3 A;  3VOV A;  4AHU A;  4R79 A;  1WSH A;  4KHN A;  1TKD A;  5KRS A;  2P9K A;  1OKJ A;  4JKB A;  4CJS A;  3D0P A;  4J2D A;  1TK0 A;  3OYK A;  3K59 A;  3NGI A;  5J2M A;  3UIQ A;  3VGL A;  1QTM A;  3ZSW A;  3DLL L;  1LAV A;  1BA0 A;  3ENH A;  2GUP A;  2FF6 A;  3OYJ A;  3JSM A;  4CEB A;  2WBN A;  1S6Q A;  4AHC A;  4HTU A;  3L3V A;  4ID1 A;  1NJI O;  2HHT A;  4FL9 A;  4BE2 A;  1Y64 A;  3TAP A;  1CZB A;  2NUB A;  4LSN A;  4EZ6 A;  3R6M A;  3D2F A;  3AO1 A;  1WSF A;  2KFN A;  3Q7C A;  3CCE N;  1SZ2 A;  3VET A;  3DLH A;  2VG7 A;  1UA0 A;  1L3T A;  4FJJ A;  3I55 N;  5JVG L;  1C1B A;  3V9U A;  1ZBH A;  3OHR A;  2QXF A;  3VQ6 A;  3MEE A;  4JV5 K;  5JIC A;  1VSH A;  5BPL A;  2G8H A;  4CBW A;  2D0A A;  1EET A;  3IFR A;  3P83 D;  4KRF A;  2P9P A;  3W3D A;  3ZT4 A;  4J2A A;  1IG8 A;  2G8F A;  2Q1N A;  3CJ7 A;  3NGY A;  5LY3 A;  4GMJ B;  2P9U A;  1X3M A;  4CZK A;  3V9Z A;  2IVO A;  1CXU A;  3QFP A;  4FJN A;  4DSE A;  4NCA A;  4HUE A;  4DTO A;  4H5W A;  2Q2R A;  2HHW A;  1JLE A;  3VES A;  4CJQ A;  1YJN N;  3L0Q A;  4DV4 K;  2D5R A;  5AQM A;  4ELT A;  3T1Y K;  4B3S K;  3AO2 A;  3J7Z O;  4H5N A;  3O1W A;  2ITG A;  3AVB A;  1JCE A;  4M3Y A;  3PSI A;  4FW2 A;  3L2R A;  3P5J A;  3VMF B;  2QW9 A;  1IKY A;  1S1X A;  5GIO A;  3HST B;  4CK2 A;  1J9A A;  1HJO A;  2A3Z A;  2F7T A;  4AHT A;  1VHX A;  3DLR A;  1TYQ B;  5C25 A;  1X1P A;  1Q18 A;  4M7X A;  3VEV A;  3ZSR A;  3V1R A;  3E9O A;  4GV6 A;  2WOM A;  4LFC K;  3O5B A;  3O9R A;  4ISF A;  1U2V B;  4KH5 A;  1QS4 A;  1LW0 A;  5M1O A;  3RMA A;  1Q7Y O;  3ULD A;  3K58 A;  4ZHR A;  4DR6 K;  4PL8 A;  4FWO A;  3H45 C;  3P31 A;  3K57 A;  3SAF A;  3JS6 A;  4J2E A;  3MCA B;  4CEZ A;  3CJ1 A;  2D0O A;  2NNW A;  1RT4 A;  4WE1 A;  4DTR A;  2UYT A;  3FZF A;  3NDK A;  3CFO A;  3ZX2 A;  4FJL A;  4FLT A;  4E7L A;  3O8M A;  4H0O A;  1VAZ A;  3DI6 A;  1JLG A;  2NRH A;  2Y1I A;  4HHT A;  1FJG K;  4C8O A;  4BRF A;  4FK2 A;  2HF4 A;  3C94 A;  4LH4 A;  2B4J A;  2D0C A;  3LDN A;  3GBT A;  3ATV A;  3VEW A;  5JMV A;  1S9E A;  1TAU A;  3SI6 A;  4LF6 K;  1VRU A;  4H0X B;  2O8D A;  3WXK A;  3NF8 A;  1HNV A;  3F73 A;  2HNY A;  5EY4 A;  3ZT1 A;  4JI6 K;  2QWO A;  1NMN A;  3F5T A;  4H5T A;  5AFU A;  1N33 K;  2BH1 A;  2P9L B;  3KWI A;  4O0I A;  4J8F A;  5HP1 A;  4HUG A;  3ULE A;  3TAR A;  4FVM A;  5FRO A;  1CZA N;  1TKZ A;  2E4L A;  1M1K O;  3CMA N;  3FLC O;  3C95 A;  4BRA A;  3JXU A;  3AO3 A;  3C7N B;  4BRP A;  1DKG D;  4CF1 A;  3J81 O;  4CIE A;  4DKW A;  3GOI A;  1XWL A;  4LF4 K;  4CJR A;  2BAN A;  3DAW A;  4RWT A;  1VK0 A;  2OPS A;  1LAW A;  4ILH A;  4K42 A;  3TAM A;  3CQX A;  2FC0 A;  4B1X B;  1JCG A;  4KH4 A;  2Z1H A;  4BR0 A;  5J2P A;  3VGK A;  5FLX O;  1VQ7 N;  2KW4 A;  3KWG A;  3VEZ A;  4DR1 K;  4BRN A;  2NRV A;  3VF2 A;  4DU3 A;  3QES A;  1C0U A;  4JK7 A;  3SCX A;  1W97 L;  4H5V A;  3ZSO A;  4LF5 K;  1YXQ A;  2F8S A;  1TYQ A;  3CC4 N;  1QQC A;  3DXM B;  3CC2 N;  3ZCM A;  3AVG A;  3WNG A;  4DR2 K;  1VSD A;  4KHP K;  4BC2 A;  1K8K B;  4FZX C;  3WXL A;  1BCO A;  2RF2 A;  2DTU A;  3ZX3 A;  4FWQ A;  5DMR A;  5GAE P;  1RDC A;  2KHO A;  3L2V A;  4BWM A;  1Q8I A;  3SJH A;  4FJ5 A;  1IG9 A;  1SAZ A;  1NWK A;  3DXK A;  3ZYY X;  1S1V A;  3CCU N;  5LJV A;  4LFA K;  5FPN A;  1BCM A;  3ZSQ A;  3A5O C;  5AFU H;  4HCB A;  3C6H A;  3C7N A;  3H1V X;  3M8Q A;  4DV1 K;  4FWM A;  4DU1 A;  3R9P A;  2QWQ A;  3B6P A;  2IDO A;  2IAJ A;  2LSN A;  4CZH A;  1RGI A;  1JKH A;  4IOC L;  2YNF A;  2DFH A;  1WAJ A;  2O8B A;  4DFM A;  3OS1 A;  3PUF A;  2EX3 A;  3RSE A;  3EN9 A;  3BZK A;  4B9V A;  2E1Z A;  3H3O B;  3OTO K;  1GOB A;  4DV0 K;  1QVG M;  1NK7 A;  3WXJ A;  5FRM A;  1J5O A;  3WNH A;  3LWM A;  4I9L A;  3BDP A;  2P9L A;  4YHH K;  3LZI A;  2KLA A;  3PIO L;  4AQY K;  3LM9 A;  4DQP A;  4JS4 A;  1WBD A;  3AO5 A;  3ID6 A;  2V52 B;  3CCQ N;  3AA5 X;  4DR3 K;  3PLA A;  4ICL A;  1IJJ A;  2I7N A;  2KZM A;  1ZYQ A;  4C8K A;  1RT5 A;  4IBN A;  2PZS A;  1HPM A;  4LSL A;  1S72 N;  1HYZ A;  2HMI A;  2GBZ A;  2GTD A;  5AR0 A;  1VSF A;  2E6L A;  1ZBU A;  4PL7 A;  3G71 N;  2O8F A;  3BZC A;  1RTH A;  1T6D A;  3MK6 A;  2VGM A;  3AGR A;  4BE1 A;  2NLX A;  4CD1 A;  4JRQ A;  1ASV A;  3LAM A;  4C1N I;  1XC9 A;  4UY8 O;  4FPB A;  4RW6 A;  4DFP A;  3SQ1 A;  2A1S A;  1TUY A;  4FJH A;  4ELU A;  1RBU A;  3E1Y A;  4CD3 A;  4CIF A;  4FCY A;  4AM7 A;  3LDP A;  1FK9 A;  5E84 A;  4B9N A;  4M3X A;  3NAE A;  4FWK A;  5AZI B;  5AQI A;  1WAF A;  1L3S A;  1K9M O;  4A2B A;  3OYI A;  2X6S A;  3DLE A;  4CEQ A;  4CW7 B;  3SYZ A;  3CYM A;  3LP0 A;  2F9T A;  3OYD A;  2XHB A;  5TKW A;  4JKD A;  2AJQ A;  1R0A A;  1HKB A;  3TAN A;  4I6M B;  4BWJ A;  4B9S A;  3QIO A;  1QZ5 A;  1A5X A;  4YNQ A;  2D0P A;  4HUF A;  5JLH A;  3VQQ A;  4MDB A;  2OTL N;  2FLO A;  1NGF A;  1ASW A;  1Y97 A;  4PY5 A;  3FZL A;  3WQU A;  1GLL O;  4FW1 A;  3RTV A;  2NRW A;  4O5F A;  4CEF A;  3HL8 A;  1KD1 O;  4FJM A;  1J54 A;  4Z4H A;  3U3G A;  3E01 A;  3TAF A;  1N34 K;  1OH7 A;  2YHA A;  3OYN A;  4DTM A;  3BUZ B;  4M45 A;  1BI4 A;  2VYP A;  3AAQ A;  1RDB A;  4FK4 A;  4XH4 A;  4E1M A;  3IG1 A;  1BIU A;  3MEC A;  1CXQ A;  1HUX A;  1LOT B;  3IS9 A;  5FPM A;  3RWU A;  4L8R B;  1IBM K;  1KVA A;  5CYQ A;  4F2R A;  3HI0 A;  3TI0 A;  1U4B A;  1T05 A;  4MLH A;  1JLF A;  3LAN A;  3A5L C;  5KPT A;  4JKC A;  2W41 A;  3QB0 A;  4CGF A;  3O9S A;  5LMN K;  4DTJ A;  1KVC A;  4ZTF A;  1TVR A;  4AHV A;  2O8E A;  4MLE A;  2CGK A;  1RTI A;  3MX5 A;  4CF8 A;  3FGU A;  1BQM A;  3OY9 A;  3UB5 A;  4A5B A;  3O4N A;  4CZE A;  1IKV A;  3OYH A;  3A5M C;  2NRX A;  3G10 A;  4Y1C A;  1Q82 O;  4KTW A;  4WFB L;  4E19 A;  2O8F B;  3HO1 A;  4OKE A;  4CZM A;  2Y1J A;  4BAC A;  1D4X A;  4LF7 K;  4DUZ K;  2ASO A;  1YVU A;  3ISN C;  4M7Y A;  1YF5 L;  4J2B A;  2Z1J A;  2VWB A;  3HVT A;  3HTV A;  2J4R A;  2X74 A;  2E8A A;  2A42 A;  3CCL N;  5C0Y A;  3RMD A;  3PX6 A;  2ASM A;  1RT3 A;  4B3O A;  2VWJ A;  4HVJ A;  4FWL A;  4FLX A;  1JL1 A;  3E9L A;  4WF9 L;  4RW7 A;  3L8B A;  1RBR A;  1LWF A;  2G8I A;  5IT9 O;  3AVF A;  1S5J A;  2GEL A;  3KVG A;  4JYA K;  4CBU A;  2P51 A;  4GVM A;  2E2N A;  4BR5 A;  4K8X A;  4CF9 A;  3K9K A;  4B3T K;  4Q0B A;  3HPG A;  2YHY A;  3S3O A;  3THY A;  4KI6 A;  4E7K A;  3C6A A;  4CGD A;  5CE3 A;  1DLO A;  3EE8 A;  3PX4 A;  4BC4 A;  3M1F A;  3O4Q A;  3HVR A;  2D0B A;  5ADX A;  1S3X A;  4JHD B;  4B8A B;  4JHD A;  1T3V A;  2QWN A;  4JRP A;  2YI1 A;  4KBO A;  1WLJ A;  4M3Z A;  3SK3 A;  3UKU B;  5GAD P;  1HNI A;  2KTQ A;  1TAQ A;  2FSJ A;  3HPH A;  3ITH A;  2B5J A;  1GOC A;  3I33 A;  4OJR A;  4DSK A;  5AQJ A;  4DUY K;  3TPQ A;  1J5E K;  4AM6 A;  3WEE B;  2ZJR L;  4M3R A;  4DQ8 A;  1NGC A;  5C2D A;  4DTU A;  1REV A;  3G0Z A;  5CR4 A;  3N4P A;  3DOL A;  2E88 A;  3J7A P;  1DEJ A;  1OVY A;  3L3U A;  3BGR A;  4DR4 K;  3CQ8 A;  5K14 A;  4PQU A;  3V9S A;  4DSJ A;  3GL1 A;  4YOT A;  3PO5 A;  3SNN A;  4DMN A;  3NHG A;  3THY B;  2YNI A;  5FDL A;  5AJ3 K;  3OJU A;  3E66 A;  3CIP A;  4FLZ A;  5AZJ A;  2HHU A;  3ZSV A;  1M90 O;  3BEX A;  2JGU A;  1RDW X;  2WC9 A;  2UUA K;  5FPD A;  4ILG B;  2P9N B;  3P1G A;  4A5A A;  1L3U A;  3HOS A;  3VQB A;  4LFB K;  4B9L A;  5AQK A;  3SZ2 A;  3MED A;  3J8A A;  2G8K A;  4FWN A;  5JS1 A;  3TWH A;  1TKT A;  4DSL A;  3THX A;  4G1Q A;  2DFF A;  3VA3 A;  1NGH A;  4CJP A;  4F3T A;  5DK5 A;  4FWS A;  3EZW A;  2QKK A;  4KRE A;  3WNE A;  4B1Z A;  4CF2 A;  5DM7 L;  1QHA A;  1TK8 A;  2QA4 N;  2YCH A;  4CK3 A;  4FZY A;  3EYZ A;  1EP4 A;  5JS2 A;  4OX9 K;  3CC7 N;  1ESV A;  2QEX N;  1RFQ A;  1YT3 A;  4QOZ B;  3VQ4 A;  1NK0 A;  5SWM A;  2O8E B;  1BG3 A;  3VPZ A;  4CEC A;  4DS5 A;  2GX9 A;  3KK2 A;  2BTF A;  3WQT A;  4I2Q A;  3KLI A;  4YFU A;  1WNS A;  4ZTJ A;  3C65 A;  3H6E A;  4RW9 A;  4CEO A;  2YJE A;  5HBM A;  1WUA A;  3R8E A;  4O8K A;  2YX6 A;  2XRI A;  5CZ2 A;  1NLV A;  3NVK A;  4FOI A;  2VGN A;  4M3T A;  3WXM B;  3DYA A;  1G99 A;  4IO8 A;  1U47 A;  1E3M A;  1KQS M;  3AV9 A;  5AQR A;  1HNX K;  1RTJ A;  1SS6 A;  3DRR A;  4N41 A;  3NF6 A;  4IEI A;  1NGJ A;  4DV2 K;  1BIS A;  4IOX A;  1SQK A;  3A2F A;  1D9D A;  2IIR A;  3THW A;  1RBT A;  2D4W A;  3JAM O;  3QEW A;  4JN4 A;  3K2P A;  3VQA A;  5J1E A;  5LMU K;  4DG1 A;  4FJ7 A;  4MO5 A;  4KHQ A;  3V9X A;  5ELZ A;  3T69 A;  3NFA A;  4JKE A;  2E5L K;  4CCH A;  3AVC A;  1IKX A;  3L2W A;  3U3Y A;  4BRK A;  4JS5 A;  1NMD A;  3O1B A;  4B8C A;  1RT6 A;  4JI1 K;  3O6W A;  3CXC M;  4NYF A;  2CGJ A;  5HOO A;  3U4L A;  4ELV A;  2HHS A;  1MA9 B;  1TGO A;  2WFB A;  3D45 A;  4QS8 A;  4IDH A;  3ZT3 A;  1HYV A;  3F9K A;  2V7Y A;  3MDQ A;  4CZJ A;  3VN5 A;  4CHQ A;  1A5W A;  3HP9 A;  1ILY A;  1U49 A;  2JWK A;  4BR4 A;  4CE9 A;  4M3W A;  2XY6 A;  2OA8 A;  1KAX A;  5AQW A;  1SL0 A;  1Q86 O;  4GV3 A;  4JK8 A;  2WUS A;  2F9W A;  4DTX A;  1RIL A;  2I7P A;  1TUU A;  5C42 A;  3CM5 A;  1HQE A;  4NO7 A;  4IO9 L;  3QO9 A;  2QI2 A;  4FWP A;  1EKE A;  1N32 K;  4KV8 A;  3MAQ A;  4PKG A;  1C1A A;  2VG5 A;  4DTS A;  1SKW A;  1UAX A;  3QDK A;  3AVJ A;  3AVA A;  3CJB A;  3VQ5 A;  1C6V A;  1LV5 A;  3BF1 A;  4DV5 K;  3ZET B;  4H0V B;  1H1V A;  4DQS A;  3VEO A;  3ZSY A;  1EXQ A;  1W9H A;  3H1Q A;  4MDA A;  5GAG P;  3Q7B A;  3H3N O;  3VQC A;  4MFB A;  2EWS A;  3OYM A;  3HM9 A;  1JCF A;  4EP5 A;  3O4W A;  1IBL K;  1NK9 A;  3E9P A;  1K6Y A;  1NKC A;  4EHU A;  2YNG A;  4F2S A;  4CEE A;  4EFH A;  3DMJ A;  4KAZ A;  3WXI A;  4DQI A;  3ZSX A;  1TL1 A;  4JI8 K;  3JYT A;  2P9P B;  4DTP A;  2KZZ A;  2ZF5 O;  3CPE A;  4KO0 A;  5JLF A;  5M1K A;  1FKO A;  4DHY A;  2P1J A;  1S1U A;  3QET A;  4M42 A;  4IKF A;  1C0G A;  1V4S A;  3GDQ A;  4BQL A;  2FBV A;  1T03 A;  1NGG A;  4E3S A;  4Z4G A;  4JEP A;  2V7Z A;  2RKI A;  5BRF A;  1WSE A;  3AVN A;  2Q0R A;  4JKG B;  4OGE A;  1U45 A;  1SKR A;  1D9F A;  3EKS A;  4DU4 A;  4OKJ A;  4FM2 A;  2A1R A;  3G25 A;  2ZWH A;  4CGG A;  3CET A;  4Q5V A;  3L2Q A;  1TL3 A;  1VQL N;  3FZM A;  4DB3 A;  2I5J A;  1SL2 A;  4WQ5 C;  4OLB A;  3TSQ A;  3T1H K;  3D2F B;  2RPI A;  4N76 A;  3OA9 A;  4G9Z A;  5AQY A;  3TAE A;  4K8Z A;  4CJ5 A;  3HYF A;  3FZH A;  1S22 A;  2IC3 A;  4RTF D;  3W0L A;  4C8L A;  2HNZ A;  1W7A A;  4IWV A;  4ISE A;  1O13 A;  1GLE G;  4KHS A; 
#chains in the Genus database with same CATH homology
 4E1M A;  2YV0 X;  3I0R A;  1VSJ A;  1I3A A;  3IG1 A;  4CED A;  5EU7 A;  3QEI A;  4CHY A;  3ZT0 A;  1IKW A;  4KHY A;  1BIU A;  3MEC A;  1CXQ A;  4E0D A;  3IS9 A;  1DTQ A;  4AHU A;  3RWU A;  4L8R B;  1WSH A;  3FFI A;  4CF0 A;  1TKD A;  4CER A;  5KRS A;  1KVA A;  4KHN A;  5CYQ A;  4F2R A;  3TI0 A;  3SUP A;  3KTQ A;  4FJG A;  3KK1 A;  1U4B A;  4CJS A;  3D0P A;  4EP4 A;  1N5Y A;  1T05 A;  3OJS A;  4W5N A;  4J2D A;  1JLF A;  1TK0 A;  3OYK A;  3LAN A;  3K59 A;  3NGI A;  5J2M A;  3UIQ A;  1D8Y A;  5T7B A;  4E1N A;  1W0H A;  4F8R A;  4CGF A;  1QTM A;  3ZSW A;  4ZTF A;  4DTJ A;  2HHQ A;  1KVC A;  1TVR A;  1LAV A;  4TSX A;  4AHV A;  4N47 A;  3KLE A;  1C0T A;  1JL2 A;  3NH2 A;  1KLM A;  1RBS A;  1RTI A;  4CF8 A;  1NK4 A;  1BQM A;  3OYJ A;  3JSM A;  4CEB A;  4E7H A;  3OY9 A;  3LZJ A;  4FLW A;  2XY8 A;  4PUO A;  1S6Q A;  4N56 A;  3O4N A;  4AHC A;  2R7Y A;  3L3V A;  1IKV A;  4HTU A;  4ID1 A;  2HHT A;  3OYH A;  3SPY A;  3AVH A;  4BE2 A;  2YHB A;  3G10 A;  4Y1C A;  3TAP A;  1CZB A;  1X9M A;  2NUB A;  4KTW A;  1Q9Y A;  5I42 A;  4E19 A;  4LSN A;  3HO1 A;  4Z4E A;  1I39 A;  5KGX A;  4EZ6 A;  4OKE A;  3AO1 A;  4KFB A;  1WSF A;  3LP1 A;  4R5P A;  2ZQB A;  2Y1J A;  2KFN A;  5HRO A;  4BAC A;  3QEX A;  3DLH A;  2VG7 A;  1UA0 A;  1L3T A;  1YTA A;  1YVU A;  3ISN C;  3V9W A;  4FJJ A;  2JLE A;  4NCB A;  1C1B A;  3AVI A;  3V9U A;  4J2B A;  1QHT A;  1ZBH A;  4CHZ A;  2QXF A;  1RT7 A;  3VQ6 A;  3MEE A;  2Z1J A;  3MXJ A;  2G8H A;  1VSH A;  4OKK A;  3HVT A;  3KD5 E;  3M8P A;  2X74 A;  3T19 A;  1B92 A;  4CFB A;  2D0A A;  1EET A;  3PX6 A;  3RMD A;  3VQ7 A;  3P83 D;  4KRF A;  1D5A A;  3ZT4 A;  3HXM A;  4J2A A;  1RT3 A;  4B3O A;  2VWJ A;  1G15 A;  4HVJ A;  2G8F A;  3S3N A;  3NGY A;  4FLX A;  1QSL A;  2B6A A;  1C0M A;  1JL1 A;  1X9W A;  4GMJ B;  3TAB A;  2OPQ A;  3ZT2 A;  4DQQ A;  4RW7 A;  4CK1 A;  1RBR A;  1LWF A;  3L8B A;  3V9Z A;  2G8I A;  1CXU A;  1HPZ A;  4FJN A;  1FKP A;  3AVF A;  4DSE A;  1S5J A;  4NCA A;  3DRS A;  1Z25 A;  4QAG A;  4HUE A;  3LAK A;  4CJV A;  3RMB A;  4LH5 A;  2GUI A;  4DTO A;  2P51 A;  3AVL A;  4GVM A;  4K8X A;  2PYJ A;  4NYN A;  4CF9 A;  3VQ9 A;  2HHW A;  4Q0B A;  1JLE A;  3HPG A;  4CJQ A;  3S3O A;  4KI6 A;  4M3U A;  4FK0 A;  4E7K A;  4PWD A;  3TR8 A;  2DY4 A;  1C1C A;  4CGD A;  3I8D A;  3QEV A;  1DLO A;  3V1O A;  2D5R A;  1HMV A;  4CIG A;  4ELT A;  3RMC A;  3NH0 A;  2Z1G A;  3AO2 A;  4N5S A;  3PX4 A;  4ID5 A;  3HVR A;  3O4Q A;  2D0B A;  2Z1I A;  2EHG A;  2ITG A;  2O4G A;  3AVB A;  4BDY A;  4M3Y A;  4KTZ A;  4AIL C;  4FW2 A;  4B8A B;  3L2R A;  5KTQ A;  3RRG A;  4JRP A;  3P5J A;  4Z4I A;  3QER A;  4FJ8 A;  1WLJ A;  3M8S A;  4M3Z A;  1IKY A;  3V6D A;  4RG8 A;  1S1X A;  3PX0 A;  3HST B;  4OPK A;  1JLQ A;  4E7I A;  3S3M A;  1Q9X A;  4CK2 A;  1J9A A;  1HNI A;  2OPP A;  1TAQ A;  4IG3 A;  1WN7 A;  1CZ9 A;  4AHT A;  2KTQ A;  1RTD A;  3DLR A;  1NK5 A;  4CJ3 A;  5C25 A;  1X1P A;  5KRT A;  3ZSR A;  3V1R A;  2YKN A;  3HPH A;  3ITH A;  3H08 A;  2B5J A;  2WOM A;  4CHO A;  3OS2 A;  1GOC A;  1LW2 A;  1NKE A;  4DSK A;  4OJR A;  1QS4 A;  1SV5 A;  4CJE A;  1LW0 A;  5HRN A;  2KQ2 A;  3RMA A;  3V4I A;  4Z0U A;  4M3R A;  3ULD A;  3K58 A;  2ZE2 A;  4ZHR A;  1RBV A;  3VQD A;  4QCL A;  4NCG A;  4DTU A;  1REV A;  3G0Z A;  4DTN A;  4Y1D A;  3DOL A;  3AO4 A;  4W5T A;  2VG6 A;  4O0J A;  3K57 A;  3L3U A;  3HK2 A;  3BGR A;  2HVH A;  1JXE A;  3QIN A;  3KLH A;  3CQ8 A;  4J2E A;  3OYF A;  2DFE A;  1NKB A;  5K14 A;  4CEZ A;  3V9S A;  4PQU A;  1BHL A;  4CGJ A;  4DSJ A;  2BDP A;  1RT4 A;  4WE1 A;  4DTR A;  4BDZ A;  1L3V A;  3WNF A;  3PO5 A;  4C8N A;  3SNN A;  2FBY A;  4DMN A;  3NDK A;  3CFO A;  4FJL A;  1KCF A;  4FLT A;  3NHG A;  4FLU A;  2YNI A;  3KLG A;  5FDL A;  4E7L A;  4B9T A;  3CM6 A;  3OJU A;  3DI6 A;  4FLZ A;  1JLG A;  4M41 A;  3ZSV A;  2OZS A;  2HHU A;  3M8R A;  2Y1I A;  2JGU A;  3VA0 A;  3LPU A;  4FJI A;  4HHT A;  1ZBI A;  2HW3 A;  3DOK A;  4C8O A;  4DWI A;  3OYL A;  3OYG A;  3SQ0 A;  3P1G A;  4FK2 A;  3C94 A;  4CJ4 A;  3LP2 A;  2B4J A;  4LH4 A;  4B9U A;  1L3U A;  3SV3 A;  3VQB A;  4B9L A;  1JLB A;  2D0C A;  3MED A;  4RW4 A;  3SZ2 A;  4CJU A;  2G8K A;  1S9E A;  1TAU A;  3SI6 A;  5JS1 A;  3CFR A;  1VRU A;  3K5M A;  3PV8 A;  3L2U A;  3TWH A;  1IO2 A;  1TKT A;  3NF8 A;  4DSL A;  4E7J A;  1YTU A;  1F21 A;  4G1Q A;  1HNV A;  4I7F A;  4IG0 A;  2DFF A;  3EY1 A;  3VA3 A;  3F73 A;  4CJP A;  2W42 A;  4DF8 A;  4F3T A;  2HNY A;  5DK5 A;  5HRS A;  4KRE A;  2QKK A;  2HB5 A;  2VWK A;  3ZT1 A;  3SJJ A;  1BI4 B;  2RN2 A;  3WNE A;  1O1W A;  4CF2 A;  3T3F A;  3NBP A;  4LY7 A;  1KRP A;  1TK8 A;  3CG7 A;  4O0I A;  3LAL A;  4CK3 A;  5J2N A;  2ETJ A;  4FZY A;  3EYZ A;  3QNO A;  4H4M A;  1EP4 A;  1ZBF A;  2IS3 A;  1BQN A;  5JS2 A;  4H8K A;  3IRX A;  5HP1 A;  3QLH A;  3DRP A;  3B6O A;  4DSF A;  1BGX T;  4HUG A;  4BE0 A;  4KI4 A;  3TAR A;  1KFD A;  1KTQ A;  3OYA A;  4FVM A;  5FRO A;  1ASU A;  1YT3 A;  4BDP A;  2X6N A;  3SV4 A;  4OGC A;  4QOZ B;  1HYS A;  3VQ4 A;  2IOC A;  3NH1 A;  3KK3 A;  1TKZ A;  2E4L A;  5KI6 A;  5SWM A;  1NK0 A;  3U6F A;  2OZM A;  4KPY A;  4Z4C A;  4CFA A;  3C95 A;  4CEC A;  4O4G A;  4DS5 A;  3SQ2 A;  3AO3 A;  3KK2 A;  2O4I A;  4C8M A;  4CF1 A;  3DLB A;  4I2Q A;  3KLI A;  4YFU A;  1WNS A;  4FXD A;  4ZTJ A;  4KKO A;  4DSI A;  4CIE A;  5CZ1 A;  4Z4F A;  1XWL A;  1VSK A;  4CJR A;  4RW9 A;  2BAN A;  5HBM A;  4CEO A;  1VK0 A;  2OPS A;  4KB0 A;  1LAW A;  1JLA A;  5J2Q A;  1VSI A;  3KKS A;  3KKR A;  2XRI A;  4DFK A;  3V81 A;  5CZ2 A;  3TAM A;  2XO7 A;  1Z26 A;  2FC0 A;  2E6M A;  3T1A A;  4M3T A;  2Z1H A;  4HCC A;  2FBT A;  5J2P A;  3K5L A;  3DYA A;  4DF4 A;  4FYD A;  1U47 A;  2BGG A;  3AVK A;  1SKS A;  2KW4 A;  4PA1 A;  1RNH A;  1NJW A;  4H4O A;  3AV9 A;  4DU3 A;  1UOC A;  1RTJ A;  3QES A;  5HRP A;  1C0U A;  3DRR A;  4CJW A;  4AHS A;  3SCX A;  1TKX A;  3AA2 A;  1X9S A;  3NF9 A;  3ZSO A;  4N41 A;  3NF6 A;  3NF7 A;  2F8S A;  1RCH A;  1QQC A;  4EZ9 A;  5KGW A;  4OPJ A;  4W5Q A;  3ZCM A;  2PY5 A;  3AVG A;  1BIS A;  3WNG A;  3IAY A;  1VSD A;  3A2F A;  1D9D A;  3SUN A;  1TK5 A;  1T7P A;  1TV6 A;  1RBT A;  4FZX C;  2G8U A;  3QEW A;  3K2P A;  1BCO A;  3VQA A;  2RF2 A;  4LD0 A;  5J1E A;  1MU2 A;  1NOY A;  2DTU A;  4DG1 A;  3SPZ A;  4FJ7 A;  4KHQ A;  5DMR A;  4W5R A;  2F96 A;  3AA3 A;  3V9X A;  2OYQ A;  4KHU A;  1RDC A;  3L2V A;  4KHW A;  4M3W A;  4BWM A;  3NGZ A;  3C6U A;  1Q8I A;  4FJ5 A;  3ALY A;  1BIZ A;  3NFA A;  2KFZ A;  1IG9 A;  2ZD1 A;  4CCH A;  3OS0 A;  1J53 A;  1UWB A;  3LPT A;  3AVM A;  3AVC A;  4CGI A;  1T8E A;  1KVB A;  1IKX A;  1S1V A;  3L2W A;  3U3Y A;  1U48 A;  2IGI A;  4JS5 A;  4B8C A;  4AH9 A;  1RT6 A;  4CGH A;  1KSP A;  1BCM A;  3VQP A;  2YNH A;  3ZSQ A;  1BL3 A;  4HCB A;  4NYF A;  4ELV A;  3RR8 A;  3HT3 A;  2HHS A;  3C6T A;  1SUQ A;  4GW6 A;  1TGO A;  3D45 A;  2GV9 A;  3M8Q A;  4IFV A;  3ZT3 A;  3O3F A;  1WSJ A;  4DU1 A;  1HYV A;  3F9K A;  4CHP A;  1FXX A;  3B6P A;  4CJK A;  2IDO A;  2IAJ A;  2LSN A;  4IFY A;  4MQ3 A;  3PO4 A;  4CES A;  3NCI A;  3MXI A;  1NK6 A;  3QIP A;  4CHQ A;  3VN5 A;  3O3H A;  1JKH A;  1A5W A;  3HP9 A;  2YNF A;  1QSS A;  2DFH A;  1WAJ A;  3OYC A;  4CE9 A;  3AA4 A;  3I0S A;  3OS1 A;  1EX4 A;  4DFM A;  1U49 A;  1NJY A;  4FLV A;  3PUF A;  4CJF A;  2XY6 A;  1L5U A;  2OA8 A;  2EX3 A;  1SL0 A;  4IDK A;  4I2P A;  4RW8 A;  2X78 A;  1S6P A;  4I9Q A;  1RT2 A;  4B9V A;  4FJK A;  3VQ8 A;  4CEA A;  4UQG A;  2QKB A;  1CLQ A;  4DTX A;  4CFD A;  1GOB A;  1RIL A;  1LWE A;  3TAG A;  3SQ4 A;  1LWC A;  4AHR A;  1NK7 A;  4KB1 A;  1S1T A;  5HLF A;  1VRT A;  5SZT A;  5C42 A;  5FRM A;  1J5O A;  3CM5 A;  3WNH A;  2WON A;  1HQE A;  3LWM A;  4I9L A;  2G8W A;  3BDP A;  3QEP A;  3QO9 A;  1UA1 A;  1EKE A;  3LZI A;  4KV8 A;  4W5O A;  3MAQ A;  1C1A A;  2VG5 A;  4DTS A;  3S9H A;  3PY8 A;  5D3G A;  4DQP A;  4DLE A;  1SKW A;  2YKM A;  4JS4 A;  3AO5 A;  4FZZ A;  2QK9 A;  1UAX A;  3AA5 X;  3AVJ A;  4ICL A;  3SUO A;  3AVA A;  2KZM A;  3VQ5 A;  3RRH A;  1C6V A;  4DS4 A;  1LV5 A;  1ZYQ A;  4C8K A;  1RT5 A;  1KFS A;  4IBN A;  4O44 A;  2PZS A;  4LSL A;  3DLK A;  4FM0 A;  1NJZ A;  3KJV A;  1HYZ A;  2HMI A;  4B9M A;  1VSM A;  1GOA A;  2GBZ A;  3LP3 A;  4DQS A;  1VSF A;  2E6L A;  3OVN A;  1ZBU A;  4O5B A;  3ZSY A;  1EXQ A;  1W9H A;  3K5N A;  1RTH A;  3K5O A;  3VQC A;  4B08 A;  1RT1 A;  2HVI A;  5CYM A;  1XHX A;  1B9D A;  2HND A;  2Q3S A;  4MFB A;  3TAQ A;  1XI1 A;  3OYM A;  3HM9 A;  4BE1 A;  4JRQ A;  4FJ9 A;  4F3O A;  4EP5 A;  1ASV A;  4FK4 A;  3LAM A;  1XC9 A;  4OLA A;  1HQU A;  1NK9 A;  4RW6 A;  1K6Y A;  4DFP A;  3SQ1 A;  5I3U A;  1NKC A;  2F8T A;  2A1S A;  3O3G A;  3SUQ A;  4FLY A;  4CHN A;  2YNG A;  4FJH A;  4FJX A;  4ELU A;  4F2S A;  3KLF A;  1RBU A;  4CEE A;  4DLG A;  4CIF A;  4FCY A;  3DMJ A;  1QSY A;  3RR7 A;  4KAZ A;  3ZSZ A;  2HHX A;  3OYB A;  1FK9 A;  1ITG A;  5HRR A;  1WSG A;  3ZSX A;  4DQI A;  1TL1 A;  3LDS A;  4B9N A;  3JYT A;  1NOZ A;  4DTP A;  4M3X A;  2KZZ A;  3NAE A;  4CFC A;  3EZ5 A;  4KO0 A;  1JLC A;  1FKO A;  1S1W A;  1VSL A;  2FBX A;  5CY4 A;  2P1J A;  1WSI A;  1S1U A;  3DM2 A;  3QET A;  3QNN A;  1WAF A;  1S9G A;  1L3S A;  1NJX A;  4M42 A;  3OYI A;  4IKF A;  2X6S A;  2BE2 A;  3DLG A;  1B9F A;  2FBV A;  3NE6 A;  3DLE A;  1T03 A;  1N6Q A;  2G8V A;  3HP6 A;  3CFP A;  4E3S A;  4CEQ A;  3OYE A;  4Z4G A;  3SYZ A;  3CYM A;  2RKI A;  3KIO A;  3LP0 A;  3OYD A;  1WSE A;  1DTT A;  3AVN A;  5E41 A;  2XHB A;  4OGE A;  1ZBL A;  1SKR A;  2XY5 A;  1U45 A;  1D9F A;  2P5G A;  4CJT A;  4DU4 A;  1RDD A;  1QE1 A;  4OKJ A;  1U04 A;  4XIU A;  4FM2 A;  2A1R A;  2P5O A;  2AJQ A;  5C24 A;  1IH7 A;  4DQR A;  1R0A A;  2OPR A;  4CGG A;  3TAN A;  4Q5V A;  2ATQ A;  3L2Q A;  4E89 A;  1TL3 A;  4JLH A;  4BWJ A;  3LWL A;  4B9S A;  3MEG A;  2I5J A;  1SL2 A;  3QIO A;  3HJF A;  1A5X A;  4KTQ A;  2PYL A;  4DFJ A;  4YNQ A;  4HUF A;  3V1Q A;  2XY7 A;  1KLN A;  4OLB A;  3VQQ A;  1HJR A;  2RPI A;  4N76 A;  1ASW A;  3MXM A;  1Y97 A;  1XHZ A;  1A5V A;  4OVL A;  4PY5 A;  3TAE A;  4FW1 A;  3RTV A;  4CEF A;  1NK8 A;  4FM1 A;  5FRN A;  4F4K A;  4CJ5 A;  4K8Z A;  3HYF A;  3HL8 A;  2IC3 A;  1HRH A;  4FJM A;  3HPO A;  3ASM A;  1VSE A;  4C8L A;  4O55 A;  2HNZ A;  3THV A;  1J54 A;  4Z4H A;  3KD1 E;  3U3G A;  3E01 A;  3TAF A;  1SL1 A;  2YHA A;  3OYN A;  4DTM A;  3VQE A;  4M45 A;  2HHV A;  1RDA A;  4KHS A;  1BI4 A;  1RDB A;  1JXB A;  4CJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...