4LH4A

Dual inhibition of hiv-1 replication by integrase-ledgf allosteric inhibitors is predominant at post-integration stage during virus production rather than at integration
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
152
structure length
129
Chain Sequence
SPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Integrase
publication title Dual inhibition of HIV-1 replication by integrase-LEDGF allosteric inhibitors is predominant at the post-integration stage.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 43
structure length 129
sequence length 152
ec nomenclature
pdb deposition date 2013-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4lh4A00
2HHXA 2EHGA 2ZQBA 5HRPA 4M3RA 3AVJA 3OYFA 4Z0UA 3ZSYA 2G8VA 5FRNA 3DLKA 1MU2A 4ELUA 4DSJA 3M8PA 3OJSA 1A5XA 4BDZA 3QIOA 3ZSZA 3LP3A 4B9MA 1LAVA 3D45A 3NH0A 4OGEA 4E1NA 2OYQA 1SKWA 3KLEA 1XC9A 4KHSA 3T3FA 1R0AA 1KLMA 2XRIA 5SWMA 1JL2A 4E7JA 3ZCMA 4Q5VA 1KTQA 5C25A 1JLQA 4DTUA 3KLHA 3AO2A 4FJ8A 3HVTA 2VWKA 4W5RA 3O3FA 1N6QA 5HRRA 2YV0X 4Z4FA 4CHZA 2HVHA 1Z26A 4CJTA 2ZD1A 3OYCA 4FJHA 1O1WA 3AO5A 2R7YA 5KRTA 1WSJA 3O4NA 4W5TA 3TANA 4EP5A 1KVCA 1BQNA 4CJKA 4DWIA 2F8SA 1BI4A 3PX4A 4CJ3A 4M3ZA 1U48A 1VSDA 2GV9A 3HPHA 3VQ8A 4KI6A 1CLQA 1RDBA 4AHCA 4N47A 4W5OA 5I3UA 4FJNA 3QESA 1FKOA 1XHXA 4OVLA 4N41A 4GVMA 1NK7A 4FLXA 2I5JA 4CJEA 3K57A 1GOAA 4DTOA 2QKBA 4CF9A 1VSKA 4XIUA 4F3TA 4Z4GA 3DLGA 2HHQA 4PY5A 1IH7A 3DLBA 1HYVA 3SYZA 1VSJA 2RF2A 2VG6A 3SUPA 2IC3A 2YNIA 4KO0A 3OYMA 1RT5A 3HP9A 4CJWA 1J54A 2X74A 2HMIA 3C6UA 3VQCA 1ZBFA 3LP1A 4CFBA 1SV5A 1X9SA 1HRHA 1JL1A 1FXXA 1S5JA 3QEPA 3AA4A 5HBMA 3KKSA 4CIGA 4UQGA 1W9HA 4DG1A 1I39A 3B6PA 1NK5A 3THVA 2IDOA 3NF7A 4CJUA 1NK6A 5J1EA 1TVRA 2FBXA 3K2PA 1D9DA 1HNIA 4DFJA 4Z4CA 4CIEA 4RW6A 4CJFA 3LAMA 1JLBA 3TAPA 1VRTA 2FBTA 1NOYA 1GOBA 3L2VA 2PZSA 4DQPA 4CFDA 2RKIA 4O0JA 4G1QA 4I9QA 1Y97A 3HPOA 3ALYA 3MXJA 4CGGA 1NJXA 3NAEA 3TI0A 2P1JA 3DRSA 4CEFA 1QE1A 4WE1A 1NKBA 3PO5A 4H4OA 5KGXA 3AO1A 4LH5A 4CEAA 2Q3SA 3OYDA 1WSGA 4I2QA 3OVNA 3ISNC 3CFRA 4BE1A 3ZT2A 1ZYQA 1TAUA 4CJRA 5CZ2A 4DF4A 4M45A 2XY6A 2JGUA 3V9XA 1XI1A 4DQRA 1NKCA 4DTSA 1CZBA 1BHLA 1RTHA 4KB0A 4CJLA 4Y1CA 3LPUA 1N5YA 4DSLA 2DFEA 3LDSA 3NE6A 3AVBA 3ZSXA 1LW0A 3LPTA 2RPIA 3AO3A 3TAFA 3K59A 1TKZA 3AVFA 2G8UA 2B4JA 2AJQA 2DY4A 1WSFA 5CZ1A 2XY7A 3QEXA 1UA0A 4Z4EA 3C94A 1IKXA 2B6AA 3L3UA 4IG3A 3VQ7A 5HP1A 4BWJA 4AH9A 4LY7A 2HNYA 2P5GA 1U4BA 3L3VA 4OKKA 3OYJA 1NK9A 3OS0A 4Q0BA 4DTPA 3O4QA 4CF1A 3V81A 1C0UA 2DTUA 4CK3A 3JYTA 3TAEA 3DM2A 2E6MA 4CK1A 3LANA 4RW9A 4BDYA 3MXIA 1D9FA 2Z1HA 4M3YA 3P83D 4FZZA 5HRNA 1ZBIA 1JXBA 1RBUA 4HTUA 2PYLA 4E19A 3ZT3A 3S3NA 2HB5A 2QK9A 3OYGA 4OLBA 3RMCA 4FJMA 1LWFA 1LWCA 2F96A 4KHWA 3A2FA 4DSFA 2HNZA 1TL1A 5CY4A 1TGOA 1L3UA 4KAZA 3QETA 4DSIA 1LWEA 5C24A 1KVBA 1C1BA 2G8IA 4QOZB 1LW2A 1A5WA 2YHAA 5CYMA 1RT1A 4FJJA 1WSIA 3RMBA 1ITGA 1VSLA 4OLAA 3SV4A 1IO2A 3ZSQA 3RWUA 1BISA 2ITGA 2Z1JA 4KTWA 3MEGA 3FFIA 3ZT1A 1RT4A 4PA1A 3DMJA 3F73A 3AVGA 4CEZA 3U6FA 1NJWA 4CGFA 4M41A 3MECA 3S9HA 4NYNA 5JS2A 3RMAA 3CG7A 3KKRA 4JRQA 4TSXA 2X78A 4KKOA 4YFUA 4AHUA 4B08A 4FJIA 3PUFA 4IKFA 3WNEA 4E3SA 3ZT0A 1HQUA 2EX3A 3S3MA 1BI4B 3KIOA 1RBRA 3TAMA 3ZSVA 4FVMA 1Q8IA 3NF9A 3VQEA 5FRMA 4NCAA 2YNFA 3SQ0A 1QQCA 2YHBA 1TL3A 4KRFA 4HUEA 4E7KA 1U49A 5JS1A 1NJZA 3K58A 4DTNA 3CM5A 3QLHA 2YKMA 3L2UA 2HHSA 2X6NA 3DRPA 4H8KA 3SQ4A 3KK3A 1IKYA 4HHTA 4E89A 4I7FA 3VQ5A 3V9UA 1ASVA 2XY8A 3TR8A 3P1GA 3VQAA 4KPYA 1BIUA 3SQ1A 3NH1A 1WSEA 4IG0A 4OKJA 1RTJA 1ZBUA 4FM2A 4E1MA 4B9UA 3RR8A 4JS4A 3PV8A 1EP4A 4OGCA 3WNGA 2PYJA 4F2RA 1HNVA 3AA5X 4CJ4A 4B9TA 4AHVA 4O44A 4YNQA 1TKTA 4J2BA 3H08A 4FJLA 2D0CA 3T1AA 4MFBA 4ELTA 3V1OA 1YVUA 4ICLA 5K14A 4DS4A 1S9EA 4KTZA 3NCIA 1K6YA 4E7IA 3RMDA 4AHRA 4FLVA 3SZ2A 3L2QA 4C8KA 5J2PA 5HRSA 3SPZA 1NK8A 4E0DA 4DSKA 1HMVA 3QINA 2FC0A 3KLGA 3LP0A 1VK0A 3LALA 3DLEA 4M3UA 4DTMA 4FK0A 3KLIA 1S6QA 4MQ3A 4CF8A 1WN7A 4BWMA 4BDPA 4HUGA 1RTIA 3QO9A 4DTRA 4KHYA 2A1SA 4KFBA 4CEBA 2HNDA 1J9AA 3E01A 4I2PA 4LH4A 4DLGA 2QKKA 2QXFA 4JS5A 1C6VA 3RRHA 1U04A 3HXMA 2A1RA 4IDKA 3NGIA 4AHTA 4DF8A 4B8AB 2OPQA 2OPPA 4O4GA 4PUOA 5FDLA 2PY5A 3K5OA 4M3WA 2HVIA 4HVJA 1KVAA 4OPJA 3AA3A 3OYBA 1RT3A 4CFAA 1ZBLA 1KRPA 4FM1A 3ZSWA 1TAQA 3LWLA 5EU7A 1NKEA 3ULDA 3PX6A 1TK5A 2FBYA 3SPYA 1U47A 1XHZA 1KSPA 2O4IA 3KLFA 4ID1A 3HM9A 1Q9YA 3C6TA 3MAQA 3SUNA 3NDKA 4JLHA 1LAWA 3V4IA 4N56A 4DTXA 1B9FA 1RNHA 4FW1A 2KZMA 1C0MA 3HYFA 4HCBA 2KFNA 4J2EA 1NOZA 4HUFA 2VG7A 5E41A 1F21A 1QS4A 4NYFA 4OJRA 4J2AA 2F8TA 1NJYA 3EZ5A 3L8BA 2NUBA 1JLAA 1FK9A 1WAFA 3V9ZA 1IG9A 4LSLA 4CGDA 4FLYA 3VQ9A 2E6LA 1WLJA 4FLUA 3VQDA 2HHUA 3V6DA 2BANA 2IOCA 1S1XA 3ASMA 4CFCA 3VQ4A 1C1CA 3RR7A 4FM0A 3QEIA 1KFSA 4C8NA 4DQIA 1X9WA 3AV9A 3OYNA 4CGIA 4DS5A 1B9DA 4CJQA 1SL1A 4FW2A 1TK0A 1KFDA 4FZYA 1VSHA 3KD5E 4F2SA 2D5RA 3SNNA 1RT7A 1RILA 3TAQA 3MEDA 5SZTA 1UWBA 4E7LA 3IAYA 4CF2A 2D0BA 3OS2A 3M8SA 1X9MA 3OY9A 3SV3A 1WSHA 1WNSA 1T8EA 2OPSA 5CYQA 2VWJA 2XY5A 2XHBA 4ZTJA 3TARA 1UA1A 1RDAA 2B5JA 4CGHA 4CHPA 3KK2A 1UAXA 3AVNA 1IKVA 5DK5A 4W5NA 1SL2A 3V9WA 3NGYA 3KK1A 2P5OA 3AVCA 1QSLA 4PWDA 4CJ5A 1BCOA 4IFVA 1TK8A 2WOMA 4FJ9A 3CM6A 1S1UA 3NF6A 1XWLA 2YNGA 3QNNA 1HYZA 4QAGA 1LV5A 1G15A 4CEEA 1QSSA 1S9GA 2XO7A 2Z1GA 4FK4A 4CEQA 1C0TA 4FJXA 2G8WA 1ASUA 1ZBHA 1J5OA 2LSNA 2G8FA 4KHNA 1RT6A 4DU4A 2BGGA 4KREA 1Z25A 3M8RA 2BE2A 4CECA 1JLFA 1BCMA 5HROA 5D3GA 2FBVA 3KJVA 3SUOA 2DFHA 1S1WA 2WONA 3SQ2A 3HJFA 2BDPA 3KD1E 3OYLA 1YTUA 2KTQA 2HHTA 4FJGA 4KV8A 3CQ8A 3QEWA 4LSNA 3OYIA 2Z1IA 3ITHA 4DFPA 4B9LA 2DFFA 4O5BA 4CHOA 3CFPA 4I9LA 1T03A 3M8QA 3EY1A 5J2QA 3C95A 5C42A 2ETJA 4FJ7A 3QERA 3QNOA 1S6PA 2Y1JA 4PQUA 3CFOA 1YTAA 1L3SA 4KTQA 3LWMA 3SUQA 3K5NA 2HW3A 1REVA 3DRRA 4CCHA 1YT3A 3L2RA 4O0IA 3P5JA 4C8LA 4E7HA 1TKDA 2W42A 3V9SA 1L5UA 4FYDA 3SJJA 3MEEA 1RBVA 1GOCA 3SCXA 1RBTA 3T19A 3ZSRA 2YKNA 3HO1A 1EKEA 2YNHA 4CJPA 4K8XA 2JLEA 3U3YA 4Y1DA 3VA0A 3DYAA 4CK2A 1RDDA 4CGJA 3LZIA 4CHNA 4GMJB 3HVRA 1SL0A 4C8OA 5J2NA 4CJSA 4RW4A 1WAJA 3HT3A 4C8MA 3JSMA 5I42A 4N5SA 4F3OA 3AVHA 1IKWA 4CEOA 3AVLA 4CERA 3OYEA 4FZXC 1JLCA 3AVKA 3O3HA 3V1RA 1T7PA 1S1VA 1TV6A 4K8ZA 1EX4A 3IRXA 1BGXT 1CXQA 1J53A 4BE0A 3MXMA 1QTMA 4B9VA 4EZ6A 3L2WA 2KFZA 4DSEA 3VQQA 2IAJA 4ZTFA 3OYAA 1SKRA 1D8YA 4OPKA 4LD0A 4R5PA 2KQ2A 4ZHRA 1BQMA 4O55A 1NK4A 2KZZA 1EETA 3CYMA 3LZJA 3VA3A 1SKSA 3AO4A 3QEVA 3ZSOA 1ASWA 1UOCA 4B3OA 1JLEA 3AVMA 2HHVA 4FJKA 3HK2A 4DFMA 5J2MA 1JKHA 4AILC 3WNHA 4FJ5A 2GBZA 2ZE2A 5KI6A 4F8RA 5KTQA 3IG1A 4DFKA 5DMRA 1B92A 1VSMA 3F9KA 4IBNA 2P51A 4Z4IA 1VSEA 3V1QA 4CE9A 3K5LA 3NH2A 3NBPA 4ELVA 3HP6A 1L3VA 1Q9XA 3DOLA 3LAKA 3BGRA 2X6SA 3VN5A 2Y1IA 2D0AA 1HJRA 4CF0A 4DTJA 1VSIA 2VG5A 3NHGA 4DU1A 4L8RB 3RTVA 1DTQA 1X1PA 4CJVA 4DQQA 4HCCA 2GUIA 4W5QA 4M42A 4DU3A 3G10A 1BL3A 5T7BA 3D0PA 3B6OA 1L3TA 3OYHA 3KTQA 4QCLA 3NF8A 4RW8A 3AVAA 1RT2A 4M3TA 2OZMA 1RBSA 3LP2A 3ZT4A 1VRUA 4M3XA 1W0HA 3OS1A 4CHYA 4KHQA 3K5MA 4CHQA 3PY8A 3NFAA 1D5AA 1CXUA 1BIZA 2G8HA 5KGWA 1FKPA 3HSTB 2E4LA 5FROA 1TKXA 4EP4A 2IS3A 1U45A 3AVIA 3VQ6A 4FXDA 4KI4A 1JLGA 3QIPA 3TAGA 4GW6A 4BE2A 3BDPA 1RDCA 4CEDA 1SUQA 3SI6A 1NK0A 1RCHA 4FLZA 2OPRA 4B9NA 3UIQA 4DLEA 3PX0A 1A5VA 4F4KA 1VSFA 4EZ9A 3DLRA 4RW7A 1RTDA 3OJUA 3DLHA 4NCBA 3DI6A 3HPGA 3VQBA 4N76A 3I0RA 3S3OA 4AHSA 3WNFA 1T05A 4KB1A 2O4GA 4BACA 1HPZA 4CESA 4FK2A 1DLOA 1QHTA 4CIFA 4FLWA 3AA2A 2OA8A 5KRSA 2OZSA 3VQPA 3O3GA 3IS9A 4NCGA 4OKEA 3PO4A 1CZ9A 4B8CA 1HQEA 1DTTA 1KCFA 3TWHA 1EXQA 3EYZA 1HYSA 3TABA 4DQSA 4JRPA 3DOKA 3HL8A 2HHWA 3U3GA 4FLTA 3I0SA 1C1AA 3G0ZA 3NGZA 3OYKA 1S1TA 4IFYA 2G8KA 4B9SA 4RG8A 4KHUA 2ATQA 4ID5A 4H4MA 3I8DA 4J2DA 2IGIA 1QSYA 4FCYA 1JXEA 4Z4HA 4DMNA 5HLFA 3RRGA 2RN2A 1I3AA 2KW4A 1KLNA
chains in the Genus database with same CATH superfamily
3T1YK 2G8VA 4WFBL 3OYFA 4Z0UA 3MCPA 4B9MA 2OYQA 2O8DA 3SBGA 1XC9A 2VQEK 4KHSA 4JN4A 2XRIA 4E7JA 1RFQA 3ZCMA 2I7NA 1KTQA 3KLHA 3HVTA 2VWKA 5HRRA 3HM8A 2NRWA 1O1WA 3O1WA 4BRKA 2ZF5O 2OTLN 3CHWA 3C6HA 4CJKA 4FWOA 3CPEA 3CJCA 1ILYA 1KC8O 1CLQA 1RDBA 2ASOA 1YI2N 3A5OC 3BP8A 1Z6RA 2I5JA 1ZBSA 4CJEA 4CD3A 2QKBA 1VQON 1GLCG 1Q86O 1VSKA 2Q0UA 4XIUA 4B3RK 4F3TA 1BWFO 1IH7A 3LL3A 3O80A 3OA9A 3OYMA 1WUAA 1YJNN 4QS8A 4BGAA 2D4WA 1ZBFA 4CFBA 1FXXA 3MX2A 5HBMA 4DG1A 2V7YA 2NRZA 2FBXA 3K2PA 4H03B 3HTVA 3ATUA 4CIEA 5F0XA 2V52B 3LAMA 1JLBA 1QQOA 1GOBA 3OTOK 3L2VA 3M3ZA 1P8ZA 1QZ6A 4CGGA 1NJXA 3NAEA 3BUZB 3EO3A 2Q3SA 4XH4A 3ISNC 4CZLA 4BE1A 2GELA 1ATNA 2E2QA 2JGUA 2QM1A 4JI5K 1BHLA 4KB0A 4Y1CA 3LPUA 3MN7A 3M6GA 4H0YB 3NE6A 1KAXA 1DT9A 3AVBA 3U4LA 2RPIA 3AO3A 3AVFA 2AJQA 2DY4A 2XY7A 1BO5O 2WUSA 4IG3A 3JS6A 4BWJA 4JKBA 2P5GA 4NLCA 1U4BA 3L3VA 4UY8O 1GLAG 2P9IB 4IOCL 2IIRA 1VQ6N 3OS0A 2VGMA 4CK3A 3H3NO 5GINA 1D9FA 2Z1HA 3PIOL 4FZZA 4BRMA 3AAQA 4JHDA 3J80O 5EX5A 4A62A 2QK9A 3OYGA 4JI2K 3H46O 2F96A 1KAYA 4LFAK 1VQ8N 2O8DB 5C24A 1C1BA 1LW2A 1RT1A 1WSIA 1OVQA 4WFAL 4FWQA 1HJOA 4BRFA 5HOOA 3AVGA 3CQYA 5BRFA 3U6FA 4CGFA 1RDUA 4BR9A 1FW6A 3RMAA 3CG7A 3KKRA 2X78A 3WNEA 3S3MA 2ZJPL 2E1ZA 3KIOA 1HLUA 1Q8IA 4BRPA 1QQCA 2YHBA 2CGKA 4KRFA 1U49A 2YKMA 3Q7BA 2O8EA 5AQUA 4YHHK 4OKJA 1MA9B 4B9UA 4E1MA 4JS4A 4OGCA 4F2RA 5CE3A 1HNVA 5H1SQ 4BR0A 4YNQA 4BRHA 4J2BA 1BA0A 5AQHA 2Q36A 3CCRN 4MFBA 4ELTA 3V1OA 3U8XA 4QS9A 1S9EA 3RMDA 3SZ2A 4FLVA 3CCSN 2HBMA 2FC0A 2YHXA 3LP0A 1VK0A 5ELZA 1WN7A 4DTRA 2FSKA 4CEBA 2HNDA 4PL8A 1J9AA 3AAPA 5GADP 4JS5A 2FSNA 2W40A 3RRHA 3HXMA 3HI0A 2E2NA 3NGIA 1J5EK 4B8AB 1XMOK 2OPPA 4O4GA 5AQIA 5M1NA 4A2AA 4OPAA 1RT3A 2NNWA 4FM1A 1NJIO 1TAQA 5EU7A 3ULDA 2IVNA 1JJ2M 1U47A 5CHIA 3KLFA 1Q9YA 3SUNA 3MAQA 4B1WB 3NDKA 2P9NA 4N56A 4RCHA 5LMNK 4MO5A 1RNHA 2W41A 4J2EA 5E41A 1GLDG 4OJRA 3C65A 1IG9A 3L8BA 4IOAL 3VEOA 1JCEA 2W6LA 2HHUA 3V6DA 1M1KO 3ASMA 5AQYA 4R79A 4XH5A 4JI4K 4DR1K 5MLCQ 3QEIA 1KFSA 4DQIA 1HR0K 1SL1A 1S72N 4M63C 3KD5E 2O8BA 1RILA 3TAQA 3MEDA 4ILGB 4JHDB 1Q18A 3SV3A 4CZKA 1YIJN 3TARA 2B5JA 3KK2A 3AVNA 1IKVA 5DK5A 4W5NA 3NGYA 3AVCA 4CJ5A 4C1NI 4JK7A 5JLHA 1DGKN 3QNNA 1IBKK 1HYZA 5AQTA 2YI1A 4CEEA 4DUZK 2HSTA 3WQUA 4IZ9A 4H0OA 4CD1A 3M8RA 2BE2A 4CECA 5HROA 2FBVA 1HNXK 3KJVA 4QS7A 3HJFA 2KTQA 2V7ZA 4DV1K 1YTUA 3A5NC 2O8EB 3CERA 1T6DA 3FZHA 4DFPA 4JI7K 4I9LA 2ZGYA 1BA1A 3QNOA 3QBXA 1YUWA 1ATSA 3HRGA 3UKRA 4F9OA 1XNRK 1NM1A 1T44A 2CH5A 4EHUA 3CPWM 1YT3A 4CBXA 4C8LA 2UXDK 1L5UA 3SJJA 1RBVA 3SCXA 5M1QA 3T19A 3ZSRA 1BUPA 4LF5K 4GNIA 3LM2A 4K8XA 3VOVA 3U3YA 4GKKK 4Y1DA 4BY9C 4CHNA 4C8OA 3D7EO 3C6AA 3H1QA 4CEOA 5LY3A 4FZXC 1JLCA 1K9MO 3O3HA 5LMUK 1J53A 2KFZA 4DSEA 4BQZA 1SKRA 4FVUA 4R5PA 5AJ3K 3ZETA 4O55A 3U9ZA 3CYMA 4CW7B 3AO4A 4LC9B 3QEVA 1K8AO 1UOCA 5M1OA 4AILC 3WNHA 4EAHD 4DFKA 1VSMA 4Z4IA 2P9NB 3VTHA 5DM7L 4ELVA 1Q9XA 3O6WA 1O13A 3VN5A 2D0AA 4MDAA 4CF0A 4L8RB 4DU1A 2VQFK 1OH8A 4DQQA 2F4VK 4W5QA 3CC4N 4LF8K 3J8AA 1BL3A 3DXKA 3H6EA 3D0PA 4QCLA 4RW8A 3AVAA 1NGAA 3TU5A 1GLJO 3WQTA 5GAHP 1BIZA 2UUAK 3VESA 3HSTB 3BF3A 4EP4A 1TKXA 2O8BB 3AVIA 4KI4A 1XUPO 1SUQA 3SI6A 2OPRA 3UIQA 1RTDA 3CMEN 3AARA 3OJUA 3DI6A 4WQ5C 3WNFA 1HPZA 4CIFA 3VEWA 2OZSA 3P39A 3O3GA 3IS9A 4OKEA 1DTTA 3BZCA 3EYZA 3TABA 5ADXH 2CGLA 5KPTA 2QWRA 1C1AA 1S1TA 3J81O 4EHTA 2NRTA 1QSYA 3RRGA 4FCYA 4H0PA 4BRNA 4DMNA 1HKCA 5JVGL 4YOUA 4X64K 2HHXA 2EHGA 4HWIA 3AVJA 5FRNA 4I6MA 1BU6O 4ELUA 4AF1A 4BDZA 1VQMN 1SKWA 3CCLN 2GWKA 3LDQA 2QWQA 3MCAB 3T3FA 5FPNA 5SWMA 1JL2A 2GEMA 3VEXA 5F2RA 4Q5VA 3UKRB 3KWGA 4DTUA 4W5RA 3O3FA 1N6QA 4Z4FA 3SMPA 2ZD1A 3OYCA 3PSFA 1WSJA 3O5BA 3O4NA 1YHQN 2QA4N 4EP5A 1KVCA 3QFPA 2KKZA 3A0IX 4CJ3A 1U48A 2GV9A 1R59O 2P9PA 4LF7K 4N47A 4DR3K 4KBOA 1NGBA 1FKOA 5GAEP 1KXPA 1SQKA 5FPEA 3O1BA 3K57A 3CCEN 4K25A 3MK6A 4DQ8A 2HHQA 3IFRA 3L4IA 3ZETB 2BUPA 1YITN 1Q7YO 3DLBA 1HYVA 3MN6A 1VSJA 2VG6A 2YNIA 4KO0A 2F7TA 4JI3K 4CJWA 4PL7A 4IO9L 4DR5K 3VQCA 4BQLA 4B1VA 1JL1A 3AA4A 4JKDA 4CIGA 4IDHA 1I39A 3NF7A 4CJUA 5J1EA 4BRGA 3ENOA 3VF2A 4CJFA 1VRTA 3DXKB 3QDKA 2PZSA 3BEXA 2DPNA 3VENA 4G1QA 4I9QA 3MXJA 3O9RA 3NMUA 1QE1A 4H4OA 3AO1A 1WSGA 3CFRA 1MWMA 4CJRA 4JKAA 4DF4A 4DTSA 1RTHA 3CCVN 5BR8K 3WXMB 3ZSXA 3ATVA 3LPTA 4OPHA 4C23A 2G8UA 3G4SN 4CZMA 5CZ1A 3M5RA 3QEXA 1W7AA 3C94A 5AZJA 2B6AA 3L3UA 3VQ7A 3KK7A 4OKKA 3EE8A 1MWKA 5LL6Z 1NK9A 4Q0BA 3O4QA 4JK8A 1C0UA 1HX1A 3THYA 3JYTA 3TAEA 3DM2A 5A2QO 4WFNL 4B3SK 3S41A 5HRNA 1ZBIA 3LDOA 1JXBA 1BOTO 4I6MB 4HTUA 4E19A 3S3NA 1ZC6A 2HF4A 1LWFA 1TL1A 2NRVA 3CI5A 1TGOA 5AZIA 4Y0WA 5FPDA 3QETA 1LWEA 3DJCA 4DSIA 4KAZA 3ZSQA 3O9QA 3R1XA 4CVNE 1BISA 3MEGA 3FFIA 3EKUA 3ZT1A 3DMJA 4M41A 3S9HA 4JRQA 4B08A 2QXLA 3PUFA 4FJIA 4IKFA 3ZT0A 4BG9A 1RBRA 3ZSVA 3RSEA 4NCAA 5JICA 2P9PB 4L3QA 3DLLL 1XC3A 3CM5A 3L2UA 2HHSA 2X6NA 4HHTA 1IKYA 1E3MA 4I7FA 3P1GA 4JEPA 3N4QA 1RTJA 4G9ZA 3UE5A 3T7ZA 1EP4A 2PYJA 1NGHA 4BR4A 4CJ4A 3H08A 2D0CA 4IO8A 1YVUA 5K14A 1IBMK 4JKCA 4E7IA 4AHRA 3C7NA 5J2PA 4E0DA 3HBTA 3QINA 3WXJA 2RE2A 5FLXO 3KLGA 1SZ2A 3LALA 3DLEA 2HHHK 4HUGA 2WBNA 4KHYA 4KFBA 4NXNK 2QI2A 3THXA 3E01A 2QKKA 2OCEA 1C6VA 4DB3A 4IDKA 2ZGZA 2A41A 2QWOA 4U67L 2PY5A 3K5OA 4HVJA 3SMSA 3AA3A 3OYBA 1VQKN 1ZBLA 3FLCO 4HTLA 3LWLA 1NKEA 1TK5A 2FBYA 1NGIA 3UKUA 2QWMA 4PKGA 5AQPA 4CZFA 5KQDA 3HM9A 3C6TA 3G71N 4M7YA 1N36K 3GBTA 4FW1A 1C0MA 3HYFA 2KFNA 1TUYA 1X3MA 3I56N 4J2AA 2F8TA 2VG7A 1QS4A 5M1PA 1NJYA 4YOTA 1KAZA 2F9TA 3MX5A 1FK9A 1OKJA 1C0GA 4FPAA 3VQ9A 2E6LA 2YX6A 2UXCK 3VQDA 4FWRA 5AZJB 3CF5L 3W0LA 5IWAK 2P9KA 2BANA 1S1XA 4CFCA 3CMAN 3E1YA 3VQ4A 4FM0A 2UUBK 3AGRA 4IEIA 4C8NA 1X9WA 4CGIA 2E88A 1B9DA 4CJQA 1TK0A 4FW2A 1KFDA 3THYB 1VSHA 3SNNA 1RT7A 2J4RA 4JKHA 5SZTA 2P9UA 2D0BA 3OS2A 1WSHA 2OPSA 1HNZK 5AZIB 1GLFO 4WF9L 4PWDA 1TK8A 2WOMA 1YXQA 1XWLA 4AM7A 2E2PA 4IFEA 1VQPN 4CEQA 3SAFA 1NLVA 4FJXA 1ASUA 3A5LC 2BGGA 3RSEB 1Z25A 3SAHA 1BCMA 4WQ4C 2IVOA 3CJ9A 2DFHA 4YOXA 3H3OB 2QEXN 2UYTA 3SQ2A 4GVEA 4NXMK 1NU0A 4FJGA 3CQ8A 4JI1K 4JKEA 4LSNA 3OYIA 1EWQA 2WFBA 4CI6A 4O5BA 3CFPA 3PSIA 1T03A 3M8QA 5BR9A 2ETJA 1NMDA 3QERA 3CFOA 1L3SA 1VQ9N 2HW3A 1IV0A 2NZTA 3L2RA 4O0IA 3P5JA 1T3VA 1GOCA 1RBTA 1EKEA 4CJPA 3DYAA 3C7NB 3LZIA 3VGMA 1E4FT 1VAZA 5J2NA 4CJSA 4RW4A 4N5SA 1IKWA 5ADXA 3AVLA 4CERA 3AVKA 3V1RA 4FWMA 3THXB 4K8ZA 1EX4A 3MXMA 1QTMA 2PBDA 3E9LA 3QBWA 1BQMA 3HOTA 3LZJA 4ISEA 4A61A 1JLEA 3HK2A 4DFMA 3FR0A 3DWLA 3CCQN 4FJ5A 5KTQA 3IG1A 3UKUB 2UUCK 3F9KA 4IBNA 3WUHA 3V1QA 3HP6A 1L3VA 3LAKA 3BGRA 2X6SA 2Y1IA 1HJRA 3NHGA 3RTVA 1X1PA 5AQRA 4CJVA 2GUIA 4DU3A 3G10A 3B6OA 1RT2A 2P9KB 4M3TA 1RBSA 3LP2A 3ZT4A 1BDGA 1VRUA 3A5MC 4M3XA 1W0HA 5AQWA 4KHQA 4CHQA 2NRXA 4FL9A 5KGWA 4PKHA 2E4LA 1U45A 4KHPK 4GW6A 2P9UB 1RDCA 4CEDA 3CCJN 5C0YA 4FLZA 2FLOA 2O8FA 4GV9A 3CD6N 4RW7A 3DLHA 2ZJQL 4N76A 3I0RA 4KB1A 3IKMA 4CESA 5GIPA 1DLOA 4FWLA 3AA2A 1VQLN 2UXBK 5KPZA 4X62K 3O9UA 4DQSA 3CC2N 4FWSA 3K9KA 4DUYK 3DOKA 3HL8A 2HHWA 3U3GA 1NG9A 5IT9O 1V4SA 4CZJA 3NGZA 2G8KA 3KVGA 2IGIA 4K42A 3M1FA 3K0SA 4M3RA 4JK9A 3ZSYA 3M8PA 3T69A 3OJSA 1LAVA 1NGDA 3NH0A 4OGEA 4JI8K 4E1NA 4O8KA 3KLEA 4H0VB 2ZM6K 2ASPA 1KLMA 5AR0A 5C25A 1KQSM 3AO2A 2YV0X 4CHZA 4FJHA 3FFKB 4K0KK 2R7YA 5KRTA 4B3TK 3D2FA 4W5TA 1HKGA 3TANA 3G25A 1BQNA 4DWIA 2F8SA 3PX4A 4M3ZA 1VSDA 2Q2RA 4FSVA 4KI6A 4GKJK 5I3UA 3B8AX 5BRDA 2NLXA 1XHXA 4N41A 4GVMA 3QFUA 4FLXA 3VGKA 3MMVA 2VCPA 4NLBA 3SK3A 2GWJA 3E9PA 3VETA 1OH6A 2VGNA 3FZKA 2FXUA 2HBJA 1RT5A 3Q7CA 3HP9A 2Q0RA 1J54A 3C6UA 1JCFA 3LP1A 4BVOA 4BRQA 1SV5A 1X9SA 1S5JA 3TSPA 3QEPA 2OANA 2QWNA 4FOEA 1W9HA 4AQYK 3F9MA 4BGBA 1NK6A 4GV6A 3ULEA 1D9DA 4DFJA 3GL1A 4RW6A 2Q97A 3I33A 3RVCA 3TAPA 3ID8A 4DQPA 4CFDA 4MLEA 4BREA 1BG3A 3GG4A 4O0JA 3HPOA 3ALYA 3TI0A 2GTDA 2V51B 1NKBA 4WE1A 2QWPA 3PO5A 1NMNA 5BPNA 4LH5A 4DV0K 3OVNA 3OHRA 4K41A 5KPRA 5CZ2A 4M45A 3V9XA 1S3XA 3LDNA 4DQRA 1CZBA 2O8FB 4CJLA 1N5YA 4V19S 3CXCM 3LDSA 3TSQA 1LW0A 3TAFA 3K59A 1TKZA 1OH5A 5E26A 1WSFA 3H1VX 1U6ZA 4CZEA 1VQ4N 1QQMA 4Z4EA 2HMPA 1IKXA 3OW2M 3H45C 3EE9A 4AH9A 2HNYA 4LFCK 3OYJA 4BRIA 4DTPA 4CF1A 1YJ9N 2DTUA 2HBLA 4FO0A 4CK1A 3LANA 3U9DA 4BDYA 3MXIA 1YF5L 4H0XB 1NWKA 1J6ZA 4NO7A 2PYLA 4DV3K 2HB5A 5LJVA 1HKBA 4OLBA 3RMCA 3L4QA 4H5RA 2VYPA 4YDUC 1L3UA 1WB9A 1WBDA 2G8IA 4QOZB 2YHAA 1A5WA 2D0PA 5CYMA 5AFUA 5GIOA 4FJJA 3RMBA 3SV4A 1IO2A 2E5LK 3RWUA 2ITGA 4KTWA 3ZX2A 4CEZA 3MDQA 4X66K 3LDPA 3D2FB 4TSXA 5TKYA 4KKOA 3ZX0A 4E3SA 1HQUA 3NF9A 2GUPA 4E7KA 3P4IA 5JS1A 3QLHA 1NGJA 3KK3A 1ZXOA 4KPYA 1ASVA 3VQAA 1BIUA 4EFHA 4O8UA 3SQ1A 1WSEA 4FM2A 1ZBUA 3RR8A 3WNGA 3UB5A 2NRRA 1TKTA 2BH1A 4H5NA 2VWBA 4C1NK 3O8MA 4DS4A 4YOYA 4C8KA 4DR4K 1VQ7N 2E1YA 3SPZA 1G99A 3ZX3A 1Q81O 4CZIA 4M3UA 3KLIA 1S6QA 4YY3K 4JV5K 3F5TA 4BDPA 3VEYA 1RTIA 3ULEB 2A1SA 4LH4A 4DLGA 1N33K 3I8BA 4BRDA 2QXFA 4CJ7A 1U04A 2ZWHA 4AHTA 5AQZA 4DF8A 5AQXA 1OH7A 5FDLA 5F1XA 4WQ5A 4M3WA 2HVIA 3LM9A 2AA4A 5C10A 4OPJA 3CCMN 1QHAA 1KRPA 4BC4A 4BC3A 5CR4A 1XHZA 2O4IA 3VF6A 4O5FA 4JLHA 2E20A 1B9FA 4DV5K 4JYAK 3QB0A 3QMLA 1NOZA 4HUFA 5AQFA 2W6KA 1F21A 4ILJA 1T6CA 4DV6K 2NUBA 1JLAA 4FLYA 4FLUA 2IOCA 1C1CA 1H1VA 2A40A 2P9SA 3RR7A 5EOYA 5DM6L 3AV9A 3OYNA 4BG8A 1NGCA 4FZYA 3IMXA 4MLHA 4F2SA 1UWBA 4E7LA 4CF2A 3SBTA 5AQMA 1T8EA 5CYQA 2VWJA 3THWA 2XY5A 2XHBA 1UA1A 3T1HK 1WBBA 1UAXA 4PHTX 1IJJA 5EXWA 4LF9K 4WYBA 1K8KA 4LF6K 3V9WA 3KK1A 2P5OA 1BCOA 4IFVA 1V4TA 1C0FA 1S1UA 3CJBA 3NF6A 4A2BA 2YNGA 1NNEA 3D6RA 4OO1J 1QSSA 1S9GA 2KLAA 4DHYA 3HOSA 1ZBHA 2LSNA 2G8FA 3OBWA 4DU4A 1JLFA 4BRAA 5D3GA 4BROA 2CH6A 3OYLA 2HHTA 3VF4A 4KV8A 2NRHA 1QVFM 4B1XB 4B3MK 2QW9A 2Z1IA 4B9LA 2DFFA 5LJWA 3EN9A 1DEJA 3FGUA 3F2KA 3JAMO 5C42A 4JAXA 4FJ7A 5TKWA 4KTQA 5E84A 3LWMA 3K5NA 2D1KA 3DRRA 4E7HA 3VERA 3HO1A 2YNHA 3GE1A 2JLEA 1D4XA 3VA0A 4CK2A 1XMQK 4A5AA 3D2EA 4GMJB 3HVRA 1SL0A 5I42A 3HT3A 5AQGA 4C8MA 4F3OA 2FF6A 3NVMA 3OBYA 1U2VA 2FF3B 1N8RO 1S1VA 1TV6A 4FWKA 5AQKA 4RWTA 4BE0A 4GV3A 2IAJA 4ZTFA 3OYAA 2KHOA 4JNEA 1D8YA 4LD0A 4B1UB 2KQ2A 1NK4A 1EETA 4GY2B 4DR7K 1Q82O 3ZLJA 1ASWA 2HHVA 3AVMA 2YHWA 4FJKA 2IVPA 4DV2K 5AQNA 3QICA 2GBZA 5KI6A 3NVKA 5AFUH 3K5LA 4CE9A 2CGJA 3NBPA 3ENBA 5AQSA 1YAGA 4DTJA 1X3NA 2I7PA 3CIPA 4HCCA 1SS6A 5T7BA 1L3TA 2E8AA 3R8EA 1N32K 2P9SB 4CHYA 3OS1A 2A42A 3K5MA 3NFAA 5GAGP 1CXUA 2G8HA 1FKPA 2IS3A 3VQ6A 4FXDA 1JLGA 5JMVA 3QIPA 3TAGA 4XEIA 3BDPA 1NK0A 1RCHA 1X9JA 4B9NA 4DLEA 3PX0A 2ZJRL 3THWB 4F4KA 3MN9A 4JD2A 4NCBA 1TYQA 3HPGA 3VEVA 4AHSA 1K8KB 2O4GA 4BACA 4FK2A 1QHTA 5KRSA 3PO4A 1CZ9A 4BVPA 1EXQA 2BTFA 5C15A 5C12A 3I0SA 3FZMA 1HPMA 4B9SA 4KH5A 4RG8A 4H4MA 4J2DA 1JXEA 1IG8A 1KLNA 2ZQBA 5HRPA 3DLKA 1MU2A 1ESVA 3R6MA 4DSJA 1A5XA 3QIOA 3ZSZA 3LP3A 3D45A 4YORA 4JI6K 4X65K 3I55N 1R0AA 3ZEUA 2OTJN 3CETA 3CQXA 1JLQA 4FJ8A 2HVHA 1ATRA 4ISFA 1Z26A 4CJTA 3AO5A 3FZFA 4BR2A 3EKSA 4AM6A 4BR5A 1BI4A 3D2EB 3VQ8A 3HPHA 4LF4K 5AQOA 1HNWK 4AHCA 3MWPA 4W5OA 4FJNA 4CZHA 3QESA 4EIAA 4OVLA 1U2VB 1NK7A 2ITMA 2Q31A 3G6EN 1GOAA 4DTOA 4DCHA 2QWLA 4CF9A 4BRLA 2PAVA 4LFBK 4Z4GA 3DAWA 3DLGA 3J7ZO 1RDWX 4PY5A 1JCGA 3SYZA 2RF2A 3SUPA 5KQ8A 1EO1A 2IC3A 3EZWA 5FPMA 4DV4K 2X74A 2HMIA 4IXCA 3VMFB 1HRHA 3KKSA 1MDUB 4UQGA 1LOTB 4PKIA 3B6PA 1NK5A 1HUXA 2IDOA 3THVA 1TVRA 1HNIA 4Z4CA 4DR2K 1KD1O 3PLAA 3WEEA 1NOYA 2FBTA 1YJWN 4B1ZA 4BR7A 2EWSA 2RKIA 4JKGA 1Y97A 2P1JA 3DRSA 4CEFA 4E1JA 1GLBG 4U7BA 5KGXA 1XQSC 1RGIA 3CJ7A 4CEAA 3OYDA 3MN5A 2YCHA 4I2QA 3ZT2A 1ZYQA 1TAUA 2XY6A 4IEEA 2P9LA 1XI1A 1NKCA 3GDQA 4JD2B 4DSLA 1TYQB 2DFEA 2JWKA 2ASMA 5I9EB 3VPZA 4WQ4A 2B4JA 3EEQA 1UA0A 1Y64A 3R3LA 5HP1A 4LY7A 3L6QA 3KHYA 4MDBA 3SAGA 3WXKA 1N34K 3SJHA 3V81A 2E6MA 5M1FA 4RW9A 2O8CA 4M3YA 3P83D 1RBUA 3ZT3A 3O08A 1NGFA 4FWPA 4FJMA 1LWCA 4RTFD 4KHWA 3A2FA 4DSFA 2HNZA 4WCEL 5CY4A 1KVBA 3ZEUB 4CBUA 3E9OA 1ITGA 1VSLA 4OLAA 2Z1JA 1RT4A 4PA1A 3F73A 1NJWA 3MECA 4ILHA 4NYNA 5JS2A 4YFUA 4KH6A 4AHUA 3R9PA 2EX3A 5BN9A 1BI4B 3TAMA 4FVMA 5FRMA 3VQEA 2YNFA 3SQ0A 1TL3A 4HUEA 1NJZA 3K58A 4DTNA 3DRPA 3SQ4A 4H8KA 3KWIA 4E89A 3VQ5A 3V9UA 2XY8A 3TR8A 3NH1A 3CJ1A 4IG0A 3C0BA 1FJGK 5BN8A 3PV8A 1QVGM 3O9SA 3AA5X 2E2OA 4B9TA 4AHVA 4O44A 3CCUN 5C2FA 4H5TA 3WXLA 4FJLA 3BY5A 3VGLA 4J8FA 3T1AA 5B8HA 4ICLA 3NCIA 4KTZA 1K6YA 3P31A 3J7YP 3L2QA 5HRSA 3O4WA 1NK8A 4DSKA 1HMVA 1QQNA 4BRCA 4DTMA 4FK0A 4CF8A 4MQ3A 2YJFA 4BWMA 3QO9A 3AY9A 4I2PA 4H5VA 3WEEB 5EY4A 2A1RA 3P38A 5BPLA 1YVNA 2OPQA 3DXMA 2HF3A 4JKGB 4PUOA 1VHXA 1KVAA 2YHYA 4K43A 3O9TA 4A57A 4CFAA 1NGEA 3TTCA 4JI0K 4CZGA 3WT0A 3ZSWA 3PX6A 3SPYA 2AP1A 1KSPA 4ID1A 1CZAN 2H3GX 2P9LB 2GX9A 1LAWA 3V4IA 1GLEG 2F9WA 4DTXA 2KZMA 4A59A 4HCBA 4FPBA 4NYFA 3EZ5A 1WAFA 3V9ZA 4LSLA 4CGDA 2HOEA 3HZ6A 1WLJA 3LDLA 2Q1NA 3SLCA 3BZKA 4DS5A 1OVYA 4B9QA 2D5RA 3J7AP 2O8CB 2JWLA 3MWTA 3IAYA 3M8SA 1X9MA 4Z94A 3OY9A 1WNSA 4ZTJA 1RDAA 4CHPA 4CGHA 3CJAA 5AQLA 3GOIA 1SL2A 1XNQK 2D0OA 4DR6K 4BC2A 1DKGD 1QSLA 5BRHA 4NB4A 4FJ9A 3CM6A 3FE1A 4QAGA 1S22A 1LV5A 1G15A 4H0TB 2XO7A 2Z1GA 4FK4A 1C0TA 1QZ5A 4OX9K 2G8WA 1J5OA 4KHNA 1Z05A 1RT6A 4KREA 3WXIA 3EL2A 4KH4A 3SUOA 1S1WA 2WONA 2BDPA 3KD1E 3QEWA 3K9JA 5JLFA 3ITHA 4ISGA 3ENHA 3PIPL 4CHOA 4IJAA 1LCUA 3EY1A 5J2QA 3C95A 3IDHA 5BPMA 1S6PA 3ZYYX 2Y1JA 4PQUA 1SAZA 1YTAA 2PFUA 3SUQA 1REVA 4CCHA 4CBWA 1TKDA 4IJNA 2W42A 3V9SA 4FYDA 3MEEA 2YKNA 4YOWA 3ID6A 1RDDA 4CGJA 1I94K 1GLLO 5HL7L 3L0QA 1WAJA 3JSMA 1E4GT 3TTDA 2A3ZA 3AVHA 3TPQA 3OYEA 4JKFA 1T7PA 2QTDA 4A5BA 4EZ6A 3IRXA 1BGXT 1CXQA 4B1YB 5C2DA 2UU9K 4H5WA 3L2WA 3VQQA 2A5XA 4MO4A 3DXMB 4OPKA 4ZHRA 2KZZA 3VA3A 1SKSA 3ZSOA 4B3OA 2RHKA 5J2MA 1JKHA 3JXUA 2ZE2A 3HSCA 4F8RA 5DMRA 3TTFA 1B92A 2P51A 3AGKA 1VSEA 5BREA 3NH2A 1EWRA 1K73O 3DOLA 5AQQA 4B9VA 1VSIA 2VG5A 1DTQA 4XH1A 4DKWA 4M42A 2A6AA 3OYHA 3KTQA 3NF8A 1W97L 3KZBA 2OZMA 2FSJA 1WOQA 3N4PA 3PY8A 4YDUA 1D5AA 5JVHL 1NBWA 3TSUA 4DV7K 5FROA 3W3DA 1P90A 5AQJA 2YJEA 4BE2A 4YOVA 3BF1A 1TUUA 1A5VA 1VSFA 1W2BM 3DLRA 4FOIA 4EZ9A 3VQBA 3S3OA 1T05A 1IBLK 1VQ5N 2WTUA 4FLWA 3FZLA 2OA8A 3VQPA 4IWVA 4NCGA 3E66A 4B8CA 1HQEA 1KCFA 4FWNA 3VEZA 2HBKA 3TWHA 5EVZA 1HYSA 4M7XA 4BC5A 4JRPA 5AQVA 1NGGA 1M90O 4FLTA 2P9IA 3VTIA 3G0ZA 3OYKA 3CC7N 4IFYA 2WC9A 1EQYA 4KHUA 2ATQA 4ID5A 3I8DA 4Z4HA 5HLFA 3A8YA 3IUCA 2RN2A 4IOXA 1VQNN 1I3AA 5M1KA 2KW4A
chains in the Genus database with same CATH topology
2HHXA 2EHGA 2ZQBA 5HRPA 4M3RA 3AVJA 3OYFA 4Z0UA 3ZSYA 2G8VA 5FRNA 3DLKA 1MU2A 4ELUA 4DSJA 3M8PA 3OJSA 1A5XA 4BDZA 3QIOA 3ZSZA 3LP3A 4B9MA 1LAVA 3D45A 3NH0A 4OGEA 4E1NA 2OYQA 1SKWA 3KLEA 1XC9A 4KHSA 3T3FA 1R0AA 1KLMA 2XRIA 5SWMA 1JL2A 4E7JA 3ZCMA 4Q5VA 1KTQA 5C25A 1JLQA 4DTUA 3KLHA 3AO2A 4FJ8A 3HVTA 2VWKA 4W5RA 3O3FA 1N6QA 5HRRA 2YV0X 4Z4FA 4CHZA 2HVHA 1Z26A 4CJTA 2ZD1A 3OYCA 4FJHA 1O1WA 3AO5A 2R7YA 5KRTA 1WSJA 3O4NA 4W5TA 3TANA 4EP5A 1KVCA 1BQNA 4CJKA 4DWIA 2F8SA 1BI4A 3PX4A 4CJ3A 4M3ZA 1U48A 1VSDA 2GV9A 3HPHA 3VQ8A 4KI6A 1CLQA 1RDBA 4AHCA 4N47A 4W5OA 5I3UA 4FJNA 3QESA 1FKOA 1XHXA 4OVLA 4N41A 4GVMA 1NK7A 4FLXA 2I5JA 4CJEA 3K57A 1GOAA 4DTOA 2QKBA 4CF9A 1VSKA 4XIUA 4F3TA 4Z4GA 3DLGA 2HHQA 4PY5A 1IH7A 3DLBA 1HYVA 3SYZA 1VSJA 2RF2A 2VG6A 3SUPA 2IC3A 2YNIA 4KO0A 3OYMA 1RT5A 3HP9A 4CJWA 1J54A 2X74A 2HMIA 3C6UA 3VQCA 1ZBFA 3LP1A 4CFBA 1SV5A 1X9SA 1HRHA 1JL1A 1FXXA 1S5JA 3QEPA 3AA4A 5HBMA 3KKSA 4CIGA 4UQGA 1W9HA 4DG1A 1I39A 3B6PA 1NK5A 3THVA 2IDOA 3NF7A 4CJUA 1NK6A 5J1EA 1TVRA 2FBXA 3K2PA 1D9DA 1HNIA 4DFJA 4Z4CA 4CIEA 4RW6A 4CJFA 3LAMA 1JLBA 3TAPA 1VRTA 2FBTA 1NOYA 1GOBA 3L2VA 2PZSA 4DQPA 4CFDA 2RKIA 4O0JA 4G1QA 4I9QA 1Y97A 3HPOA 3ALYA 3MXJA 4CGGA 1NJXA 3NAEA 3TI0A 2P1JA 3DRSA 4CEFA 1QE1A 4WE1A 1NKBA 3PO5A 4H4OA 5KGXA 3AO1A 4LH5A 4CEAA 2Q3SA 3OYDA 1WSGA 4I2QA 3OVNA 3ISNC 3CFRA 4BE1A 3ZT2A 1ZYQA 1TAUA 4CJRA 5CZ2A 4DF4A 4M45A 2XY6A 2JGUA 3V9XA 1XI1A 4DQRA 1NKCA 4DTSA 1CZBA 1BHLA 1RTHA 4KB0A 4CJLA 4Y1CA 3LPUA 1N5YA 4DSLA 2DFEA 3LDSA 3NE6A 3AVBA 3ZSXA 1LW0A 3LPTA 2RPIA 3AO3A 3TAFA 3K59A 1TKZA 3AVFA 2G8UA 2B4JA 2AJQA 2DY4A 1WSFA 5CZ1A 2XY7A 3QEXA 1UA0A 4Z4EA 3C94A 1IKXA 2B6AA 3L3UA 4IG3A 3VQ7A 5HP1A 4BWJA 4AH9A 4LY7A 2HNYA 2P5GA 1U4BA 3L3VA 4OKKA 3OYJA 1NK9A 3OS0A 4Q0BA 4DTPA 3O4QA 4CF1A 3V81A 1C0UA 2DTUA 4CK3A 3JYTA 3TAEA 3DM2A 2E6MA 4CK1A 3LANA 4RW9A 4BDYA 3MXIA 1D9FA 2Z1HA 4M3YA 3P83D 4FZZA 5HRNA 1ZBIA 1JXBA 1RBUA 4HTUA 2PYLA 4E19A 3ZT3A 3S3NA 2HB5A 2QK9A 3OYGA 4OLBA 3RMCA 4FJMA 1LWFA 1LWCA 2F96A 4KHWA 3A2FA 4DSFA 2HNZA 1TL1A 5CY4A 1TGOA 1L3UA 4KAZA 3QETA 4DSIA 1LWEA 5C24A 1KVBA 1C1BA 2G8IA 4QOZB 1LW2A 1A5WA 2YHAA 5CYMA 1RT1A 4FJJA 1WSIA 3RMBA 1ITGA 1VSLA 4OLAA 3SV4A 1IO2A 3ZSQA 3RWUA 1BISA 2ITGA 2Z1JA 4KTWA 3MEGA 3FFIA 3ZT1A 1RT4A 4PA1A 3DMJA 3F73A 3AVGA 4CEZA 3U6FA 1NJWA 4CGFA 4M41A 3MECA 3S9HA 4NYNA 5JS2A 3RMAA 3CG7A 3KKRA 4JRQA 4TSXA 2X78A 4KKOA 4YFUA 4AHUA 4B08A 4FJIA 3PUFA 4IKFA 3WNEA 4E3SA 3ZT0A 1HQUA 2EX3A 3S3MA 1BI4B 3KIOA 1RBRA 3TAMA 3ZSVA 4FVMA 1Q8IA 3NF9A 3VQEA 5FRMA 4NCAA 2YNFA 3SQ0A 1QQCA 2YHBA 1TL3A 4KRFA 4HUEA 4E7KA 1U49A 5JS1A 1NJZA 3K58A 4DTNA 3CM5A 3QLHA 2YKMA 3L2UA 2HHSA 2X6NA 3DRPA 4H8KA 3SQ4A 3KK3A 1IKYA 4HHTA 4E89A 4I7FA 3VQ5A 3V9UA 1ASVA 2XY8A 3TR8A 3P1GA 3VQAA 4KPYA 1BIUA 3SQ1A 3NH1A 1WSEA 4IG0A 4OKJA 1RTJA 1ZBUA 4FM2A 4E1MA 4B9UA 3RR8A 4JS4A 3PV8A 1EP4A 4OGCA 3WNGA 2PYJA 4F2RA 1HNVA 3AA5X 4CJ4A 4B9TA 4AHVA 4O44A 4YNQA 1TKTA 4J2BA 3H08A 4FJLA 2D0CA 3T1AA 4MFBA 4ELTA 3V1OA 1YVUA 4ICLA 5K14A 4DS4A 1S9EA 4KTZA 3NCIA 1K6YA 4E7IA 3RMDA 4AHRA 4FLVA 3SZ2A 3L2QA 4C8KA 5J2PA 5HRSA 3SPZA 1NK8A 4E0DA 4DSKA 1HMVA 3QINA 2FC0A 3KLGA 3LP0A 1VK0A 3LALA 3DLEA 4M3UA 4DTMA 4FK0A 3KLIA 1S6QA 4MQ3A 4CF8A 1WN7A 4BWMA 4BDPA 4HUGA 1RTIA 3QO9A 4DTRA 4KHYA 2A1SA 4KFBA 4CEBA 2HNDA 1J9AA 3E01A 4I2PA 4LH4A 4DLGA 2QKKA 2QXFA 4JS5A 1C6VA 3RRHA 1U04A 3HXMA 2A1RA 4IDKA 3NGIA 4AHTA 4DF8A 4B8AB 2OPQA 2OPPA 4O4GA 4PUOA 5FDLA 2PY5A 3K5OA 4M3WA 2HVIA 4HVJA 1KVAA 4OPJA 3AA3A 3OYBA 1RT3A 4CFAA 1ZBLA 1KRPA 4FM1A 3ZSWA 1TAQA 3LWLA 5EU7A 1NKEA 3ULDA 3PX6A 1TK5A 2FBYA 3SPYA 1U47A 1XHZA 1KSPA 2O4IA 3KLFA 4ID1A 3HM9A 1Q9YA 3C6TA 3MAQA 3SUNA 3NDKA 4JLHA 1LAWA 3V4IA 4N56A 4DTXA 1B9FA 1RNHA 4FW1A 2KZMA 1C0MA 3HYFA 4HCBA 2KFNA 4J2EA 1NOZA 4HUFA 2VG7A 5E41A 1F21A 1QS4A 4NYFA 4OJRA 4J2AA 2F8TA 1NJYA 3EZ5A 3L8BA 2NUBA 1JLAA 1FK9A 1WAFA 3V9ZA 1IG9A 4LSLA 4CGDA 4FLYA 3VQ9A 2E6LA 1WLJA 4FLUA 3VQDA 2HHUA 3V6DA 2BANA 2IOCA 1S1XA 3ASMA 4CFCA 3VQ4A 1C1CA 3RR7A 4FM0A 3QEIA 1KFSA 4C8NA 4DQIA 1X9WA 3AV9A 3OYNA 4CGIA 4DS5A 1B9DA 4CJQA 1SL1A 4FW2A 1TK0A 1KFDA 4FZYA 1VSHA 3KD5E 4F2SA 2D5RA 3SNNA 1RT7A 1RILA 3TAQA 3MEDA 5SZTA 1UWBA 4E7LA 3IAYA 4CF2A 2D0BA 3OS2A 3M8SA 1X9MA 3OY9A 3SV3A 1WSHA 1WNSA 1T8EA 2OPSA 5CYQA 2VWJA 2XY5A 2XHBA 4ZTJA 3TARA 1UA1A 1RDAA 2B5JA 4CGHA 4CHPA 3KK2A 1UAXA 3AVNA 1IKVA 5DK5A 4W5NA 1SL2A 3V9WA 3NGYA 3KK1A 2P5OA 3AVCA 1QSLA 4PWDA 4CJ5A 1BCOA 4IFVA 1TK8A 2WOMA 4FJ9A 3CM6A 1S1UA 3NF6A 1XWLA 2YNGA 3QNNA 1HYZA 4QAGA 1LV5A 1G15A 4CEEA 1QSSA 1S9GA 2XO7A 2Z1GA 4FK4A 4CEQA 1C0TA 4FJXA 2G8WA 1ASUA 1ZBHA 1J5OA 2LSNA 2G8FA 4KHNA 1RT6A 4DU4A 2BGGA 4KREA 1Z25A 3M8RA 2BE2A 4CECA 1JLFA 1BCMA 5HROA 5D3GA 2FBVA 3KJVA 3SUOA 2DFHA 1S1WA 2WONA 3SQ2A 3HJFA 2BDPA 3KD1E 3OYLA 1YTUA 2KTQA 2HHTA 4FJGA 4KV8A 3CQ8A 3QEWA 4LSNA 3OYIA 2Z1IA 3ITHA 4DFPA 4B9LA 2DFFA 4O5BA 4CHOA 3CFPA 4I9LA 1T03A 3M8QA 3EY1A 5J2QA 3C95A 5C42A 2ETJA 4FJ7A 3QERA 3QNOA 1S6PA 2Y1JA 4PQUA 3CFOA 1YTAA 1L3SA 4KTQA 3LWMA 3SUQA 3K5NA 2HW3A 1REVA 3DRRA 4CCHA 1YT3A 3L2RA 4O0IA 3P5JA 4C8LA 4E7HA 1TKDA 2W42A 3V9SA 1L5UA 4FYDA 3SJJA 3MEEA 1RBVA 1GOCA 3SCXA 1RBTA 3T19A 3ZSRA 2YKNA 3HO1A 1EKEA 2YNHA 4CJPA 4K8XA 2JLEA 3U3YA 4Y1DA 3VA0A 3DYAA 4CK2A 1RDDA 4CGJA 3LZIA 4CHNA 4GMJB 3HVRA 1SL0A 4C8OA 5J2NA 4CJSA 4RW4A 1WAJA 3HT3A 4C8MA 3JSMA 5I42A 4N5SA 4F3OA 3AVHA 1IKWA 4CEOA 3AVLA 4CERA 3OYEA 4FZXC 1JLCA 3AVKA 3O3HA 3V1RA 1T7PA 1S1VA 1TV6A 4K8ZA 1EX4A 3IRXA 1BGXT 1CXQA 1J53A 4BE0A 3MXMA 1QTMA 4B9VA 4EZ6A 3L2WA 2KFZA 4DSEA 3VQQA 2IAJA 4ZTFA 3OYAA 1SKRA 1D8YA 4OPKA 4LD0A 4R5PA 2KQ2A 4ZHRA 1BQMA 4O55A 1NK4A 2KZZA 1EETA 3CYMA 3LZJA 3VA3A 1SKSA 3AO4A 3QEVA 3ZSOA 1ASWA 1UOCA 4B3OA 1JLEA 3AVMA 2HHVA 4FJKA 3HK2A 4DFMA 5J2MA 1JKHA 4AILC 3WNHA 4FJ5A 2GBZA 2ZE2A 5KI6A 4F8RA 5KTQA 3IG1A 4DFKA 5DMRA 1B92A 1VSMA 3F9KA 4IBNA 2P51A 4Z4IA 1VSEA 3V1QA 4CE9A 3K5LA 3NH2A 3NBPA 4ELVA 3HP6A 1L3VA 1Q9XA 3DOLA 3LAKA 3BGRA 2X6SA 3VN5A 2Y1IA 2D0AA 1HJRA 4CF0A 4DTJA 1VSIA 2VG5A 3NHGA 4DU1A 4L8RB 3RTVA 1DTQA 1X1PA 4CJVA 4DQQA 4HCCA 2GUIA 4W5QA 4M42A 4DU3A 3G10A 1BL3A 5T7BA 3D0PA 3B6OA 1L3TA 3OYHA 3KTQA 4QCLA 3NF8A 4RW8A 3AVAA 1RT2A 4M3TA 2OZMA 1RBSA 3LP2A 3ZT4A 1VRUA 4M3XA 1W0HA 3OS1A 4CHYA 4KHQA 3K5MA 4CHQA 3PY8A 3NFAA 1D5AA 1CXUA 1BIZA 2G8HA 5KGWA 1FKPA 3HSTB 2E4LA 5FROA 1TKXA 4EP4A 2IS3A 1U45A 3AVIA 3VQ6A 4FXDA 4KI4A 1JLGA 3QIPA 3TAGA 4GW6A 4BE2A 3BDPA 1RDCA 4CEDA 1SUQA 3SI6A 1NK0A 1RCHA 4FLZA 2OPRA 4B9NA 3UIQA 4DLEA 3PX0A 1A5VA 4F4KA 1VSFA 4EZ9A 3DLRA 4RW7A 1RTDA 3OJUA 3DLHA 4NCBA 3DI6A 3HPGA 3VQBA 4N76A 3I0RA 3S3OA 4AHSA 3WNFA 1T05A 4KB1A 2O4GA 4BACA 1HPZA 4CESA 4FK2A 1DLOA 1QHTA 4CIFA 4FLWA 3AA2A 2OA8A 5KRSA 2OZSA 3VQPA 3O3GA 3IS9A 4NCGA 4OKEA 3PO4A 1CZ9A 4B8CA 1HQEA 1DTTA 1KCFA 3TWHA 1EXQA 3EYZA 1HYSA 3TABA 4DQSA 4JRPA 3DOKA 3HL8A 2HHWA 3U3GA 4FLTA 3I0SA 1C1AA 3G0ZA 3NGZA 3OYKA 1S1TA 4IFYA 2G8KA 4B9SA 4RG8A 4KHUA 2ATQA 4ID5A 4H4MA 3I8DA 4J2DA 2IGIA 1QSYA 4FCYA 1JXEA 4Z4HA 4DMNA 5HLFA 3RRGA 2RN2A 1I3AA 2KW4A 1KLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHX A;  2EHG A;  2ZQB A;  5HRP A;  4M3R A;  3AVJ A;  3OYF A;  4Z0U A;  3ZSY A;  2G8V A;  5FRN A;  3DLK A;  1MU2 A;  4ELU A;  4DSJ A;  3M8P A;  3OJS A;  1A5X A;  4BDZ A;  3QIO A;  3ZSZ A;  3LP3 A;  4B9M A;  1LAV A;  3D45 A;  3NH0 A;  4OGE A;  4E1N A;  2OYQ A;  1SKW A;  3KLE A;  1XC9 A;  4KHS A;  3T3F A;  1R0A A;  1KLM A;  2XRI A;  5SWM A;  1JL2 A;  4E7J A;  3ZCM A;  4Q5V A;  1KTQ A;  5C25 A;  1JLQ A;  4DTU A;  3KLH A;  3AO2 A;  4FJ8 A;  3HVT A;  2VWK A;  4W5R A;  3O3F A;  1N6Q A;  5HRR A;  2YV0 X;  4Z4F A;  4CHZ A;  2HVH A;  1Z26 A;  4CJT A;  2ZD1 A;  3OYC A;  4FJH A;  1O1W A;  3AO5 A;  2R7Y A;  5KRT A;  1WSJ A;  3O4N A;  4W5T A;  3TAN A;  4EP5 A;  1KVC A;  1BQN A;  4CJK A;  4DWI A;  2F8S A;  1BI4 A;  3PX4 A;  4CJ3 A;  4M3Z A;  1U48 A;  1VSD A;  2GV9 A;  3HPH A;  3VQ8 A;  4KI6 A;  1CLQ A;  1RDB A;  4AHC A;  4N47 A;  4W5O A;  5I3U A;  4FJN A;  3QES A;  1FKO A;  1XHX A;  4OVL A;  4N41 A;  4GVM A;  1NK7 A;  4FLX A;  2I5J A;  4CJE A;  3K57 A;  1GOA A;  4DTO A;  2QKB A;  4CF9 A;  1VSK A;  4XIU A;  4F3T A;  4Z4G A;  3DLG A;  2HHQ A;  4PY5 A;  1IH7 A;  3DLB A;  1HYV A;  3SYZ A;  1VSJ A;  2RF2 A;  2VG6 A;  3SUP A;  2IC3 A;  2YNI A;  4KO0 A;  3OYM A;  1RT5 A;  3HP9 A;  4CJW A;  1J54 A;  2X74 A;  2HMI A;  3C6U A;  3VQC A;  1ZBF A;  3LP1 A;  4CFB A;  1SV5 A;  1X9S A;  1HRH A;  1JL1 A;  1FXX A;  1S5J A;  3QEP A;  3AA4 A;  5HBM A;  3KKS A;  4CIG A;  4UQG A;  1W9H A;  4DG1 A;  1I39 A;  3B6P A;  1NK5 A;  3THV A;  2IDO A;  3NF7 A;  4CJU A;  1NK6 A;  5J1E A;  1TVR A;  2FBX A;  3K2P A;  1D9D A;  1HNI A;  4DFJ A;  4Z4C A;  4CIE A;  4RW6 A;  4CJF A;  3LAM A;  1JLB A;  3TAP A;  1VRT A;  2FBT A;  1NOY A;  1GOB A;  3L2V A;  2PZS A;  4DQP A;  4CFD A;  2RKI A;  4O0J A;  4G1Q A;  4I9Q A;  1Y97 A;  3HPO A;  3ALY A;  3MXJ A;  4CGG A;  1NJX A;  3NAE A;  3TI0 A;  2P1J A;  3DRS A;  4CEF A;  1QE1 A;  4WE1 A;  1NKB A;  3PO5 A;  4H4O A;  5KGX A;  3AO1 A;  4LH5 A;  4CEA A;  2Q3S A;  3OYD A;  1WSG A;  4I2Q A;  3OVN A;  3ISN C;  3CFR A;  4BE1 A;  3ZT2 A;  1ZYQ A;  1TAU A;  4CJR A;  5CZ2 A;  4DF4 A;  4M45 A;  2XY6 A;  2JGU A;  3V9X A;  1XI1 A;  4DQR A;  1NKC A;  4DTS A;  1CZB A;  1BHL A;  1RTH A;  4KB0 A;  4CJL A;  4Y1C A;  3LPU A;  1N5Y A;  4DSL A;  2DFE A;  3LDS A;  3NE6 A;  3AVB A;  3ZSX A;  1LW0 A;  3LPT A;  2RPI A;  3AO3 A;  3TAF A;  3K59 A;  1TKZ A;  3AVF A;  2G8U A;  2B4J A;  2AJQ A;  2DY4 A;  1WSF A;  5CZ1 A;  2XY7 A;  3QEX A;  1UA0 A;  4Z4E A;  3C94 A;  1IKX A;  2B6A A;  3L3U A;  4IG3 A;  3VQ7 A;  5HP1 A;  4BWJ A;  4AH9 A;  4LY7 A;  2HNY A;  2P5G A;  1U4B A;  3L3V A;  4OKK A;  3OYJ A;  1NK9 A;  3OS0 A;  4Q0B A;  4DTP A;  3O4Q A;  4CF1 A;  3V81 A;  1C0U A;  2DTU A;  4CK3 A;  3JYT A;  3TAE A;  3DM2 A;  2E6M A;  4CK1 A;  3LAN A;  4RW9 A;  4BDY A;  3MXI A;  1D9F A;  2Z1H A;  4M3Y A;  3P83 D;  4FZZ A;  5HRN A;  1ZBI A;  1JXB A;  1RBU A;  4HTU A;  2PYL A;  4E19 A;  3ZT3 A;  3S3N A;  2HB5 A;  2QK9 A;  3OYG A;  4OLB A;  3RMC A;  4FJM A;  1LWF A;  1LWC A;  2F96 A;  4KHW A;  3A2F A;  4DSF A;  2HNZ A;  1TL1 A;  5CY4 A;  1TGO A;  1L3U A;  4KAZ A;  3QET A;  4DSI A;  1LWE A;  5C24 A;  1KVB A;  1C1B A;  2G8I A;  4QOZ B;  1LW2 A;  1A5W A;  2YHA A;  5CYM A;  1RT1 A;  4FJJ A;  1WSI A;  3RMB A;  1ITG A;  1VSL A;  4OLA A;  3SV4 A;  1IO2 A;  3ZSQ A;  3RWU A;  1BIS A;  2ITG A;  2Z1J A;  4KTW A;  3MEG A;  3FFI A;  3ZT1 A;  1RT4 A;  4PA1 A;  3DMJ A;  3F73 A;  3AVG A;  4CEZ A;  3U6F A;  1NJW A;  4CGF A;  4M41 A;  3MEC A;  3S9H A;  4NYN A;  5JS2 A;  3RMA A;  3CG7 A;  3KKR A;  4JRQ A;  4TSX A;  2X78 A;  4KKO A;  4YFU A;  4AHU A;  4B08 A;  4FJI A;  3PUF A;  4IKF A;  3WNE A;  4E3S A;  3ZT0 A;  1HQU A;  2EX3 A;  3S3M A;  1BI4 B;  3KIO A;  1RBR A;  3TAM A;  3ZSV A;  4FVM A;  1Q8I A;  3NF9 A;  3VQE A;  5FRM A;  4NCA A;  2YNF A;  3SQ0 A;  1QQC A;  2YHB A;  1TL3 A;  4KRF A;  4HUE A;  4E7K A;  1U49 A;  5JS1 A;  1NJZ A;  3K58 A;  4DTN A;  3CM5 A;  3QLH A;  2YKM A;  3L2U A;  2HHS A;  2X6N A;  3DRP A;  4H8K A;  3SQ4 A;  3KK3 A;  1IKY A;  4HHT A;  4E89 A;  4I7F A;  3VQ5 A;  3V9U A;  1ASV A;  2XY8 A;  3TR8 A;  3P1G A;  3VQA A;  4KPY A;  1BIU A;  3SQ1 A;  3NH1 A;  1WSE A;  4IG0 A;  4OKJ A;  1RTJ A;  1ZBU A;  4FM2 A;  4E1M A;  4B9U A;  3RR8 A;  4JS4 A;  3PV8 A;  1EP4 A;  4OGC A;  3WNG A;  2PYJ A;  4F2R A;  1HNV A;  3AA5 X;  4CJ4 A;  4B9T A;  4AHV A;  4O44 A;  4YNQ A;  1TKT A;  4J2B A;  3H08 A;  4FJL A;  2D0C A;  3T1A A;  4MFB A;  4ELT A;  3V1O A;  1YVU A;  4ICL A;  5K14 A;  4DS4 A;  1S9E A;  4KTZ A;  3NCI A;  1K6Y A;  4E7I A;  3RMD A;  4AHR A;  4FLV A;  3SZ2 A;  3L2Q A;  4C8K A;  5J2P A;  5HRS A;  3SPZ A;  1NK8 A;  4E0D A;  4DSK A;  1HMV A;  3QIN A;  2FC0 A;  3KLG A;  3LP0 A;  1VK0 A;  3LAL A;  3DLE A;  4M3U A;  4DTM A;  4FK0 A;  3KLI A;  1S6Q A;  4MQ3 A;  4CF8 A;  1WN7 A;  4BWM A;  4BDP A;  4HUG A;  1RTI A;  3QO9 A;  4DTR A;  4KHY A;  2A1S A;  4KFB A;  4CEB A;  2HND A;  1J9A A;  3E01 A;  4I2P A;  4LH4 A;  4DLG A;  2QKK A;  2QXF A;  4JS5 A;  1C6V A;  3RRH A;  1U04 A;  3HXM A;  2A1R A;  4IDK A;  3NGI A;  4AHT A;  4DF8 A;  4B8A B;  2OPQ A;  2OPP A;  4O4G A;  4PUO A;  5FDL A;  2PY5 A;  3K5O A;  4M3W A;  2HVI A;  4HVJ A;  1KVA A;  4OPJ A;  3AA3 A;  3OYB A;  1RT3 A;  4CFA A;  1ZBL A;  1KRP A;  4FM1 A;  3ZSW A;  1TAQ A;  3LWL A;  5EU7 A;  1NKE A;  3ULD A;  3PX6 A;  1TK5 A;  2FBY A;  3SPY A;  1U47 A;  1XHZ A;  1KSP A;  2O4I A;  3KLF A;  4ID1 A;  3HM9 A;  1Q9Y A;  3C6T A;  3MAQ A;  3SUN A;  3NDK A;  4JLH A;  1LAW A;  3V4I A;  4N56 A;  4DTX A;  1B9F A;  1RNH A;  4FW1 A;  2KZM A;  1C0M A;  3HYF A;  4HCB A;  2KFN A;  4J2E A;  1NOZ A;  4HUF A;  2VG7 A;  5E41 A;  1F21 A;  1QS4 A;  4NYF A;  4OJR A;  4J2A A;  2F8T A;  1NJY A;  3EZ5 A;  3L8B A;  2NUB A;  1JLA A;  1FK9 A;  1WAF A;  3V9Z A;  1IG9 A;  4LSL A;  4CGD A;  4FLY A;  3VQ9 A;  2E6L A;  1WLJ A;  4FLU A;  3VQD A;  2HHU A;  3V6D A;  2BAN A;  2IOC A;  1S1X A;  3ASM A;  4CFC A;  3VQ4 A;  1C1C A;  3RR7 A;  4FM0 A;  3QEI A;  1KFS A;  4C8N A;  4DQI A;  1X9W A;  3AV9 A;  3OYN A;  4CGI A;  4DS5 A;  1B9D A;  4CJQ A;  1SL1 A;  4FW2 A;  1TK0 A;  1KFD A;  4FZY A;  1VSH A;  3KD5 E;  4F2S A;  2D5R A;  3SNN A;  1RT7 A;  1RIL A;  3TAQ A;  3MED A;  5SZT A;  1UWB A;  4E7L A;  3IAY A;  4CF2 A;  2D0B A;  3OS2 A;  3M8S A;  1X9M A;  3OY9 A;  3SV3 A;  1WSH A;  1WNS A;  1T8E A;  2OPS A;  5CYQ A;  2VWJ A;  2XY5 A;  2XHB A;  4ZTJ A;  3TAR A;  1UA1 A;  1RDA A;  2B5J A;  4CGH A;  4CHP A;  3KK2 A;  1UAX A;  3AVN A;  1IKV A;  5DK5 A;  4W5N A;  1SL2 A;  3V9W A;  3NGY A;  3KK1 A;  2P5O A;  3AVC A;  1QSL A;  4PWD A;  4CJ5 A;  1BCO A;  4IFV A;  1TK8 A;  2WOM A;  4FJ9 A;  3CM6 A;  1S1U A;  3NF6 A;  1XWL A;  2YNG A;  3QNN A;  1HYZ A;  4QAG A;  1LV5 A;  1G15 A;  4CEE A;  1QSS A;  1S9G A;  2XO7 A;  2Z1G A;  4FK4 A;  4CEQ A;  1C0T A;  4FJX A;  2G8W A;  1ASU A;  1ZBH A;  1J5O A;  2LSN A;  2G8F A;  4KHN A;  1RT6 A;  4DU4 A;  2BGG A;  4KRE A;  1Z25 A;  3M8R A;  2BE2 A;  4CEC A;  1JLF A;  1BCM A;  5HRO A;  5D3G A;  2FBV A;  3KJV A;  3SUO A;  2DFH A;  1S1W A;  2WON A;  3SQ2 A;  3HJF A;  2BDP A;  3KD1 E;  3OYL A;  1YTU A;  2KTQ A;  2HHT A;  4FJG A;  4KV8 A;  3CQ8 A;  3QEW A;  4LSN A;  3OYI A;  2Z1I A;  3ITH A;  4DFP A;  4B9L A;  2DFF A;  4O5B A;  4CHO A;  3CFP A;  4I9L A;  1T03 A;  3M8Q A;  3EY1 A;  5J2Q A;  3C95 A;  5C42 A;  2ETJ A;  4FJ7 A;  3QER A;  3QNO A;  1S6P A;  2Y1J A;  4PQU A;  3CFO A;  1YTA A;  1L3S A;  4KTQ A;  3LWM A;  3SUQ A;  3K5N A;  2HW3 A;  1REV A;  3DRR A;  4CCH A;  1YT3 A;  3L2R A;  4O0I A;  3P5J A;  4C8L A;  4E7H A;  1TKD A;  2W42 A;  3V9S A;  1L5U A;  4FYD A;  3SJJ A;  3MEE A;  1RBV A;  1GOC A;  3SCX A;  1RBT A;  3T19 A;  3ZSR A;  2YKN A;  3HO1 A;  1EKE A;  2YNH A;  4CJP A;  4K8X A;  2JLE A;  3U3Y A;  4Y1D A;  3VA0 A;  3DYA A;  4CK2 A;  1RDD A;  4CGJ A;  3LZI A;  4CHN A;  4GMJ B;  3HVR A;  1SL0 A;  4C8O A;  5J2N A;  4CJS A;  4RW4 A;  1WAJ A;  3HT3 A;  4C8M A;  3JSM A;  5I42 A;  4N5S A;  4F3O A;  3AVH A;  1IKW A;  4CEO A;  3AVL A;  4CER A;  3OYE A;  4FZX C;  1JLC A;  3AVK A;  3O3H A;  3V1R A;  1T7P A;  1S1V A;  1TV6 A;  4K8Z A;  1EX4 A;  3IRX A;  1BGX T;  1CXQ A;  1J53 A;  4BE0 A;  3MXM A;  1QTM A;  4B9V A;  4EZ6 A;  3L2W A;  2KFZ A;  4DSE A;  3VQQ A;  2IAJ A;  4ZTF A;  3OYA A;  1SKR A;  1D8Y A;  4OPK A;  4LD0 A;  4R5P A;  2KQ2 A;  4ZHR A;  1BQM A;  4O55 A;  1NK4 A;  2KZZ A;  1EET A;  3CYM A;  3LZJ A;  3VA3 A;  1SKS A;  3AO4 A;  3QEV A;  3ZSO A;  1ASW A;  1UOC A;  4B3O A;  1JLE A;  3AVM A;  2HHV A;  4FJK A;  3HK2 A;  4DFM A;  5J2M A;  1JKH A;  4AIL C;  3WNH A;  4FJ5 A;  2GBZ A;  2ZE2 A;  5KI6 A;  4F8R A;  5KTQ A;  3IG1 A;  4DFK A;  5DMR A;  1B92 A;  1VSM A;  3F9K A;  4IBN A;  2P51 A;  4Z4I A;  1VSE A;  3V1Q A;  4CE9 A;  3K5L A;  3NH2 A;  3NBP A;  4ELV A;  3HP6 A;  1L3V A;  1Q9X A;  3DOL A;  3LAK A;  3BGR A;  2X6S A;  3VN5 A;  2Y1I A;  2D0A A;  1HJR A;  4CF0 A;  4DTJ A;  1VSI A;  2VG5 A;  3NHG A;  4DU1 A;  4L8R B;  3RTV A;  1DTQ A;  1X1P A;  4CJV A;  4DQQ A;  4HCC A;  2GUI A;  4W5Q A;  4M42 A;  4DU3 A;  3G10 A;  1BL3 A;  5T7B A;  3D0P A;  3B6O A;  1L3T A;  3OYH A;  3KTQ A;  4QCL A;  3NF8 A;  4RW8 A;  3AVA A;  1RT2 A;  4M3T A;  2OZM A;  1RBS A;  3LP2 A;  3ZT4 A;  1VRU A;  4M3X A;  1W0H A;  3OS1 A;  4CHY A;  4KHQ A;  3K5M A;  4CHQ A;  3PY8 A;  3NFA A;  1D5A A;  1CXU A;  1BIZ A;  2G8H A;  5KGW A;  1FKP A;  3HST B;  2E4L A;  5FRO A;  1TKX A;  4EP4 A;  2IS3 A;  1U45 A;  3AVI A;  3VQ6 A;  4FXD A;  4KI4 A;  1JLG A;  3QIP A;  3TAG A;  4GW6 A;  4BE2 A;  3BDP A;  1RDC A;  4CED A;  1SUQ A;  3SI6 A;  1NK0 A;  1RCH A;  4FLZ A;  2OPR A;  4B9N A;  3UIQ A;  4DLE A;  3PX0 A;  1A5V A;  4F4K A;  1VSF A;  4EZ9 A;  3DLR A;  4RW7 A;  1RTD A;  3OJU A;  3DLH A;  4NCB A;  3DI6 A;  3HPG A;  3VQB A;  4N76 A;  3I0R A;  3S3O A;  4AHS A;  3WNF A;  1T05 A;  4KB1 A;  2O4G A;  4BAC A;  1HPZ A;  4CES A;  4FK2 A;  1DLO A;  1QHT A;  4CIF A;  4FLW A;  3AA2 A;  2OA8 A;  5KRS A;  2OZS A;  3VQP A;  3O3G A;  3IS9 A;  4NCG A;  4OKE A;  3PO4 A;  1CZ9 A;  4B8C A;  1HQE A;  1DTT A;  1KCF A;  3TWH A;  1EXQ A;  3EYZ A;  1HYS A;  3TAB A;  4DQS A;  4JRP A;  3DOK A;  3HL8 A;  2HHW A;  3U3G A;  4FLT A;  3I0S A;  1C1A A;  3G0Z A;  3NGZ A;  3OYK A;  1S1T A;  4IFY A;  2G8K A;  4B9S A;  4RG8 A;  4KHU A;  2ATQ A;  4ID5 A;  4H4M A;  3I8D A;  4J2D A;  2IGI A;  1QSY A;  4FCY A;  1JXE A;  4Z4H A;  4DMN A;  5HLF A;  3RRG A;  2RN2 A;  1I3A A;  2KW4 A;  1KLN A; 
#chains in the Genus database with same CATH topology
 3T1Y K;  2G8V A;  4WFB L;  3OYF A;  4Z0U A;  3MCP A;  4B9M A;  2OYQ A;  2O8D A;  3SBG A;  1XC9 A;  2VQE K;  4KHS A;  4JN4 A;  2XRI A;  4E7J A;  1RFQ A;  3ZCM A;  2I7N A;  1KTQ A;  3KLH A;  3HVT A;  2VWK A;  5HRR A;  3HM8 A;  2NRW A;  1O1W A;  3O1W A;  4BRK A;  2ZF5 O;  2OTL N;  3CHW A;  3C6H A;  4CJK A;  4FWO A;  3CPE A;  3CJC A;  1ILY A;  1KC8 O;  1CLQ A;  1RDB A;  2ASO A;  1YI2 N;  3A5O C;  3BP8 A;  1Z6R A;  2I5J A;  1ZBS A;  4CJE A;  4CD3 A;  2QKB A;  1VQO N;  1GLC G;  1Q86 O;  1VSK A;  2Q0U A;  4XIU A;  4B3R K;  4F3T A;  1BWF O;  1IH7 A;  3LL3 A;  3O80 A;  3OA9 A;  3OYM A;  1WUA A;  1YJN N;  4QS8 A;  4BGA A;  2D4W A;  1ZBF A;  4CFB A;  1FXX A;  3MX2 A;  5HBM A;  4DG1 A;  2V7Y A;  2NRZ A;  2FBX A;  3K2P A;  4H03 B;  3HTV A;  3ATU A;  4CIE A;  5F0X A;  2V52 B;  3LAM A;  1JLB A;  1QQO A;  1GOB A;  3OTO K;  3L2V A;  3M3Z A;  1P8Z A;  1QZ6 A;  4CGG A;  1NJX A;  3NAE A;  3BUZ B;  3EO3 A;  2Q3S A;  4XH4 A;  3ISN C;  4CZL A;  4BE1 A;  2GEL A;  1ATN A;  2E2Q A;  2JGU A;  2QM1 A;  4JI5 K;  1BHL A;  4KB0 A;  4Y1C A;  3LPU A;  3MN7 A;  3M6G A;  4H0Y B;  3NE6 A;  1KAX A;  1DT9 A;  3AVB A;  3U4L A;  2RPI A;  3AO3 A;  3AVF A;  2AJQ A;  2DY4 A;  2XY7 A;  1BO5 O;  2WUS A;  4IG3 A;  3JS6 A;  4BWJ A;  4JKB A;  2P5G A;  4NLC A;  1U4B A;  3L3V A;  4UY8 O;  1GLA G;  2P9I B;  4IOC L;  2IIR A;  1VQ6 N;  3OS0 A;  2VGM A;  4CK3 A;  3H3N O;  5GIN A;  1D9F A;  2Z1H A;  3PIO L;  4FZZ A;  4BRM A;  3AAQ A;  4JHD A;  3J80 O;  5EX5 A;  4A62 A;  2QK9 A;  3OYG A;  4JI2 K;  3H46 O;  2F96 A;  1KAY A;  4LFA K;  1VQ8 N;  2O8D B;  5C24 A;  1C1B A;  1LW2 A;  1RT1 A;  1WSI A;  1OVQ A;  4WFA L;  4FWQ A;  1HJO A;  4BRF A;  5HOO A;  3AVG A;  3CQY A;  5BRF A;  3U6F A;  4CGF A;  1RDU A;  4BR9 A;  1FW6 A;  3RMA A;  3CG7 A;  3KKR A;  2X78 A;  3WNE A;  3S3M A;  2ZJP L;  2E1Z A;  3KIO A;  1HLU A;  1Q8I A;  4BRP A;  1QQC A;  2YHB A;  2CGK A;  4KRF A;  1U49 A;  2YKM A;  3Q7B A;  2O8E A;  5AQU A;  4YHH K;  4OKJ A;  1MA9 B;  4B9U A;  4E1M A;  4JS4 A;  4OGC A;  4F2R A;  5CE3 A;  1HNV A;  5H1S Q;  4BR0 A;  4YNQ A;  4BRH A;  4J2B A;  1BA0 A;  5AQH A;  2Q36 A;  3CCR N;  4MFB A;  4ELT A;  3V1O A;  3U8X A;  4QS9 A;  1S9E A;  3RMD A;  3SZ2 A;  4FLV A;  3CCS N;  2HBM A;  2FC0 A;  2YHX A;  3LP0 A;  1VK0 A;  5ELZ A;  1WN7 A;  4DTR A;  2FSK A;  4CEB A;  2HND A;  4PL8 A;  1J9A A;  3AAP A;  5GAD P;  4JS5 A;  2FSN A;  2W40 A;  3RRH A;  3HXM A;  3HI0 A;  2E2N A;  3NGI A;  1J5E K;  4B8A B;  1XMO K;  2OPP A;  4O4G A;  5AQI A;  5M1N A;  4A2A A;  4OPA A;  1RT3 A;  2NNW A;  4FM1 A;  1NJI O;  1TAQ A;  5EU7 A;  3ULD A;  2IVN A;  1JJ2 M;  1U47 A;  5CHI A;  3KLF A;  1Q9Y A;  3SUN A;  3MAQ A;  4B1W B;  3NDK A;  2P9N A;  4N56 A;  4RCH A;  5LMN K;  4MO5 A;  1RNH A;  2W41 A;  4J2E A;  5E41 A;  1GLD G;  4OJR A;  3C65 A;  1IG9 A;  3L8B A;  4IOA L;  3VEO A;  1JCE A;  2W6L A;  2HHU A;  3V6D A;  1M1K O;  3ASM A;  5AQY A;  4R79 A;  4XH5 A;  4JI4 K;  4DR1 K;  5MLC Q;  3QEI A;  1KFS A;  4DQI A;  1HR0 K;  1SL1 A;  1S72 N;  4M63 C;  3KD5 E;  2O8B A;  1RIL A;  3TAQ A;  3MED A;  4ILG B;  4JHD B;  1Q18 A;  3SV3 A;  4CZK A;  1YIJ N;  3TAR A;  2B5J A;  3KK2 A;  3AVN A;  1IKV A;  5DK5 A;  4W5N A;  3NGY A;  3AVC A;  4CJ5 A;  4C1N I;  4JK7 A;  5JLH A;  1DGK N;  3QNN A;  1IBK K;  1HYZ A;  5AQT A;  2YI1 A;  4CEE A;  4DUZ K;  2HST A;  3WQU A;  4IZ9 A;  4H0O A;  4CD1 A;  3M8R A;  2BE2 A;  4CEC A;  5HRO A;  2FBV A;  1HNX K;  3KJV A;  4QS7 A;  3HJF A;  2KTQ A;  2V7Z A;  4DV1 K;  1YTU A;  3A5N C;  2O8E B;  3CER A;  1T6D A;  3FZH A;  4DFP A;  4JI7 K;  4I9L A;  2ZGY A;  1BA1 A;  3QNO A;  3QBX A;  1YUW A;  1ATS A;  3HRG A;  3UKR A;  4F9O A;  1XNR K;  1NM1 A;  1T44 A;  2CH5 A;  4EHU A;  3CPW M;  1YT3 A;  4CBX A;  4C8L A;  2UXD K;  1L5U A;  3SJJ A;  1RBV A;  3SCX A;  5M1Q A;  3T19 A;  3ZSR A;  1BUP A;  4LF5 K;  4GNI A;  3LM2 A;  4K8X A;  3VOV A;  3U3Y A;  4GKK K;  4Y1D A;  4BY9 C;  4CHN A;  4C8O A;  3D7E O;  3C6A A;  3H1Q A;  4CEO A;  5LY3 A;  4FZX C;  1JLC A;  1K9M O;  3O3H A;  5LMU K;  1J53 A;  2KFZ A;  4DSE A;  4BQZ A;  1SKR A;  4FVU A;  4R5P A;  5AJ3 K;  3ZET A;  4O55 A;  3U9Z A;  3CYM A;  4CW7 B;  3AO4 A;  4LC9 B;  3QEV A;  1K8A O;  1UOC A;  5M1O A;  4AIL C;  3WNH A;  4EAH D;  4DFK A;  1VSM A;  4Z4I A;  2P9N B;  3VTH A;  5DM7 L;  4ELV A;  1Q9X A;  3O6W A;  1O13 A;  3VN5 A;  2D0A A;  4MDA A;  4CF0 A;  4L8R B;  4DU1 A;  2VQF K;  1OH8 A;  4DQQ A;  2F4V K;  4W5Q A;  3CC4 N;  4LF8 K;  3J8A A;  1BL3 A;  3DXK A;  3H6E A;  3D0P A;  4QCL A;  4RW8 A;  3AVA A;  1NGA A;  3TU5 A;  1GLJ O;  3WQT A;  5GAH P;  1BIZ A;  2UUA K;  3VES A;  3HST B;  3BF3 A;  4EP4 A;  1TKX A;  2O8B B;  3AVI A;  4KI4 A;  1XUP O;  1SUQ A;  3SI6 A;  2OPR A;  3UIQ A;  1RTD A;  3CME N;  3AAR A;  3OJU A;  3DI6 A;  4WQ5 C;  3WNF A;  1HPZ A;  4CIF A;  3VEW A;  2OZS A;  3P39 A;  3O3G A;  3IS9 A;  4OKE A;  1DTT A;  3BZC A;  3EYZ A;  3TAB A;  5ADX H;  2CGL A;  5KPT A;  2QWR A;  1C1A A;  1S1T A;  3J81 O;  4EHT A;  2NRT A;  1QSY A;  3RRG A;  4FCY A;  4H0P A;  4BRN A;  4DMN A;  1HKC A;  5JVG L;  4YOU A;  4X64 K;  2HHX A;  2EHG A;  4HWI A;  3AVJ A;  5FRN A;  4I6M A;  1BU6 O;  4ELU A;  4AF1 A;  4BDZ A;  1VQM N;  1SKW A;  3CCL N;  2GWK A;  3LDQ A;  2QWQ A;  3MCA B;  3T3F A;  5FPN A;  5SWM A;  1JL2 A;  2GEM A;  3VEX A;  5F2R A;  4Q5V A;  3UKR B;  3KWG A;  4DTU A;  4W5R A;  3O3F A;  1N6Q A;  4Z4F A;  3SMP A;  2ZD1 A;  3OYC A;  3PSF A;  1WSJ A;  3O5B A;  3O4N A;  1YHQ N;  2QA4 N;  4EP5 A;  1KVC A;  3QFP A;  2KKZ A;  3A0I X;  4CJ3 A;  1U48 A;  2GV9 A;  1R59 O;  2P9P A;  4LF7 K;  4N47 A;  4DR3 K;  4KBO A;  1NGB A;  1FKO A;  5GAE P;  1KXP A;  1SQK A;  5FPE A;  3O1B A;  3K57 A;  3CCE N;  4K25 A;  3MK6 A;  4DQ8 A;  2HHQ A;  3IFR A;  3L4I A;  3ZET B;  2BUP A;  1YIT N;  1Q7Y O;  3DLB A;  1HYV A;  3MN6 A;  1VSJ A;  2VG6 A;  2YNI A;  4KO0 A;  2F7T A;  4JI3 K;  4CJW A;  4PL7 A;  4IO9 L;  4DR5 K;  3VQC A;  4BQL A;  4B1V A;  1JL1 A;  3AA4 A;  4JKD A;  4CIG A;  4IDH A;  1I39 A;  3NF7 A;  4CJU A;  5J1E A;  4BRG A;  3ENO A;  3VF2 A;  4CJF A;  1VRT A;  3DXK B;  3QDK A;  2PZS A;  3BEX A;  2DPN A;  3VEN A;  4G1Q A;  4I9Q A;  3MXJ A;  3O9R A;  3NMU A;  1QE1 A;  4H4O A;  3AO1 A;  1WSG A;  3CFR A;  1MWM A;  4CJR A;  4JKA A;  4DF4 A;  4DTS A;  1RTH A;  3CCV N;  5BR8 K;  3WXM B;  3ZSX A;  3ATV A;  3LPT A;  4OPH A;  4C23 A;  2G8U A;  3G4S N;  4CZM A;  5CZ1 A;  3M5R A;  3QEX A;  1W7A A;  3C94 A;  5AZJ A;  2B6A A;  3L3U A;  3VQ7 A;  3KK7 A;  4OKK A;  3EE8 A;  1MWK A;  5LL6 Z;  1NK9 A;  4Q0B A;  3O4Q A;  4JK8 A;  1C0U A;  1HX1 A;  3THY A;  3JYT A;  3TAE A;  3DM2 A;  5A2Q O;  4WFN L;  4B3S K;  3S41 A;  5HRN A;  1ZBI A;  3LDO A;  1JXB A;  1BOT O;  4I6M B;  4HTU A;  4E19 A;  3S3N A;  1ZC6 A;  2HF4 A;  1LWF A;  1TL1 A;  2NRV A;  3CI5 A;  1TGO A;  5AZI A;  4Y0W A;  5FPD A;  3QET A;  1LWE A;  3DJC A;  4DSI A;  4KAZ A;  3ZSQ A;  3O9Q A;  3R1X A;  4CVN E;  1BIS A;  3MEG A;  3FFI A;  3EKU A;  3ZT1 A;  3DMJ A;  4M41 A;  3S9H A;  4JRQ A;  4B08 A;  2QXL A;  3PUF A;  4FJI A;  4IKF A;  3ZT0 A;  4BG9 A;  1RBR A;  3ZSV A;  3RSE A;  4NCA A;  5JIC A;  2P9P B;  4L3Q A;  3DLL L;  1XC3 A;  3CM5 A;  3L2U A;  2HHS A;  2X6N A;  4HHT A;  1IKY A;  1E3M A;  4I7F A;  3P1G A;  4JEP A;  3N4Q A;  1RTJ A;  4G9Z A;  3UE5 A;  3T7Z A;  1EP4 A;  2PYJ A;  1NGH A;  4BR4 A;  4CJ4 A;  3H08 A;  2D0C A;  4IO8 A;  1YVU A;  5K14 A;  1IBM K;  4JKC A;  4E7I A;  4AHR A;  3C7N A;  5J2P A;  4E0D A;  3HBT A;  3QIN A;  3WXJ A;  2RE2 A;  5FLX O;  3KLG A;  1SZ2 A;  3LAL A;  3DLE A;  2HHH K;  4HUG A;  2WBN A;  4KHY A;  4KFB A;  4NXN K;  2QI2 A;  3THX A;  3E01 A;  2QKK A;  2OCE A;  1C6V A;  4DB3 A;  4IDK A;  2ZGZ A;  2A41 A;  2QWO A;  4U67 L;  2PY5 A;  3K5O A;  4HVJ A;  3SMS A;  3AA3 A;  3OYB A;  1VQK N;  1ZBL A;  3FLC O;  4HTL A;  3LWL A;  1NKE A;  1TK5 A;  2FBY A;  1NGI A;  3UKU A;  2QWM A;  4PKG A;  5AQP A;  4CZF A;  5KQD A;  3HM9 A;  3C6T A;  3G71 N;  4M7Y A;  1N36 K;  3GBT A;  4FW1 A;  1C0M A;  3HYF A;  2KFN A;  1TUY A;  1X3M A;  3I56 N;  4J2A A;  2F8T A;  2VG7 A;  1QS4 A;  5M1P A;  1NJY A;  4YOT A;  1KAZ A;  2F9T A;  3MX5 A;  1FK9 A;  1OKJ A;  1C0G A;  4FPA A;  3VQ9 A;  2E6L A;  2YX6 A;  2UXC K;  3VQD A;  4FWR A;  5AZJ B;  3CF5 L;  3W0L A;  5IWA K;  2P9K A;  2BAN A;  1S1X A;  4CFC A;  3CMA N;  3E1Y A;  3VQ4 A;  4FM0 A;  2UUB K;  3AGR A;  4IEI A;  4C8N A;  1X9W A;  4CGI A;  2E88 A;  1B9D A;  4CJQ A;  1TK0 A;  4FW2 A;  1KFD A;  3THY B;  1VSH A;  3SNN A;  1RT7 A;  2J4R A;  4JKH A;  5SZT A;  2P9U A;  2D0B A;  3OS2 A;  1WSH A;  2OPS A;  1HNZ K;  5AZI B;  1GLF O;  4WF9 L;  4PWD A;  1TK8 A;  2WOM A;  1YXQ A;  1XWL A;  4AM7 A;  2E2P A;  4IFE A;  1VQP N;  4CEQ A;  3SAF A;  1NLV A;  4FJX A;  1ASU A;  3A5L C;  2BGG A;  3RSE B;  1Z25 A;  3SAH A;  1BCM A;  4WQ4 C;  2IVO A;  3CJ9 A;  2DFH A;  4YOX A;  3H3O B;  2QEX N;  2UYT A;  3SQ2 A;  4GVE A;  4NXM K;  1NU0 A;  4FJG A;  3CQ8 A;  4JI1 K;  4JKE A;  4LSN A;  3OYI A;  1EWQ A;  2WFB A;  4CI6 A;  4O5B A;  3CFP A;  3PSI A;  1T03 A;  3M8Q A;  5BR9 A;  2ETJ A;  1NMD A;  3QER A;  3CFO A;  1L3S A;  1VQ9 N;  2HW3 A;  1IV0 A;  2NZT A;  3L2R A;  4O0I A;  3P5J A;  1T3V A;  1GOC A;  1RBT A;  1EKE A;  4CJP A;  3DYA A;  3C7N B;  3LZI A;  3VGM A;  1E4F T;  1VAZ A;  5J2N A;  4CJS A;  4RW4 A;  4N5S A;  1IKW A;  5ADX A;  3AVL A;  4CER A;  3AVK A;  3V1R A;  4FWM A;  3THX B;  4K8Z A;  1EX4 A;  3MXM A;  1QTM A;  2PBD A;  3E9L A;  3QBW A;  1BQM A;  3HOT A;  3LZJ A;  4ISE A;  4A61 A;  1JLE A;  3HK2 A;  4DFM A;  3FR0 A;  3DWL A;  3CCQ N;  4FJ5 A;  5KTQ A;  3IG1 A;  3UKU B;  2UUC K;  3F9K A;  4IBN A;  3WUH A;  3V1Q A;  3HP6 A;  1L3V A;  3LAK A;  3BGR A;  2X6S A;  2Y1I A;  1HJR A;  3NHG A;  3RTV A;  1X1P A;  5AQR A;  4CJV A;  2GUI A;  4DU3 A;  3G10 A;  3B6O A;  1RT2 A;  2P9K B;  4M3T A;  1RBS A;  3LP2 A;  3ZT4 A;  1BDG A;  1VRU A;  3A5M C;  4M3X A;  1W0H A;  5AQW A;  4KHQ A;  4CHQ A;  2NRX A;  4FL9 A;  5KGW A;  4PKH A;  2E4L A;  1U45 A;  4KHP K;  4GW6 A;  2P9U B;  1RDC A;  4CED A;  3CCJ N;  5C0Y A;  4FLZ A;  2FLO A;  2O8F A;  4GV9 A;  3CD6 N;  4RW7 A;  3DLH A;  2ZJQ L;  4N76 A;  3I0R A;  4KB1 A;  3IKM A;  4CES A;  5GIP A;  1DLO A;  4FWL A;  3AA2 A;  1VQL N;  2UXB K;  5KPZ A;  4X62 K;  3O9U A;  4DQS A;  3CC2 N;  4FWS A;  3K9K A;  4DUY K;  3DOK A;  3HL8 A;  2HHW A;  3U3G A;  1NG9 A;  5IT9 O;  1V4S A;  4CZJ A;  3NGZ A;  2G8K A;  3KVG A;  2IGI A;  4K42 A;  3M1F A;  3K0S A;  4M3R A;  4JK9 A;  3ZSY A;  3M8P A;  3T69 A;  3OJS A;  1LAV A;  1NGD A;  3NH0 A;  4OGE A;  4JI8 K;  4E1N A;  4O8K A;  3KLE A;  4H0V B;  2ZM6 K;  2ASP A;  1KLM A;  5AR0 A;  5C25 A;  1KQS M;  3AO2 A;  2YV0 X;  4CHZ A;  4FJH A;  3FFK B;  4K0K K;  2R7Y A;  5KRT A;  4B3T K;  3D2F A;  4W5T A;  1HKG A;  3TAN A;  3G25 A;  1BQN A;  4DWI A;  2F8S A;  3PX4 A;  4M3Z A;  1VSD A;  2Q2R A;  4FSV A;  4KI6 A;  4GKJ K;  5I3U A;  3B8A X;  5BRD A;  2NLX A;  1XHX A;  4N41 A;  4GVM A;  3QFU A;  4FLX A;  3VGK A;  3MMV A;  2VCP A;  4NLB A;  3SK3 A;  2GWJ A;  3E9P A;  3VET A;  1OH6 A;  2VGN A;  3FZK A;  2FXU A;  2HBJ A;  1RT5 A;  3Q7C A;  3HP9 A;  2Q0R A;  1J54 A;  3C6U A;  1JCF A;  3LP1 A;  4BVO A;  4BRQ A;  1SV5 A;  1X9S A;  1S5J A;  3TSP A;  3QEP A;  2OAN A;  2QWN A;  4FOE A;  1W9H A;  4AQY K;  3F9M A;  4BGB A;  1NK6 A;  4GV6 A;  3ULE A;  1D9D A;  4DFJ A;  3GL1 A;  4RW6 A;  2Q97 A;  3I33 A;  3RVC A;  3TAP A;  3ID8 A;  4DQP A;  4CFD A;  4MLE A;  4BRE A;  1BG3 A;  3GG4 A;  4O0J A;  3HPO A;  3ALY A;  3TI0 A;  2GTD A;  2V51 B;  1NKB A;  4WE1 A;  2QWP A;  3PO5 A;  1NMN A;  5BPN A;  4LH5 A;  4DV0 K;  3OVN A;  3OHR A;  4K41 A;  5KPR A;  5CZ2 A;  4M45 A;  3V9X A;  1S3X A;  3LDN A;  4DQR A;  1CZB A;  2O8F B;  4CJL A;  1N5Y A;  4V19 S;  3CXC M;  3LDS A;  3TSQ A;  1LW0 A;  3TAF A;  3K59 A;  1TKZ A;  1OH5 A;  5E26 A;  1WSF A;  3H1V X;  1U6Z A;  4CZE A;  1VQ4 N;  1QQM A;  4Z4E A;  2HMP A;  1IKX A;  3OW2 M;  3H45 C;  3EE9 A;  4AH9 A;  2HNY A;  4LFC K;  3OYJ A;  4BRI A;  4DTP A;  4CF1 A;  1YJ9 N;  2DTU A;  2HBL A;  4FO0 A;  4CK1 A;  3LAN A;  3U9D A;  4BDY A;  3MXI A;  1YF5 L;  4H0X B;  1NWK A;  1J6Z A;  4NO7 A;  2PYL A;  4DV3 K;  2HB5 A;  5LJV A;  1HKB A;  4OLB A;  3RMC A;  3L4Q A;  4H5R A;  2VYP A;  4YDU C;  1L3U A;  1WB9 A;  1WBD A;  2G8I A;  4QOZ B;  2YHA A;  1A5W A;  2D0P A;  5CYM A;  5AFU A;  5GIO A;  4FJJ A;  3RMB A;  3SV4 A;  1IO2 A;  2E5L K;  3RWU A;  2ITG A;  4KTW A;  3ZX2 A;  4CEZ A;  3MDQ A;  4X66 K;  3LDP A;  3D2F B;  4TSX A;  5TKY A;  4KKO A;  3ZX0 A;  4E3S A;  1HQU A;  3NF9 A;  2GUP A;  4E7K A;  3P4I A;  5JS1 A;  3QLH A;  1NGJ A;  3KK3 A;  1ZXO A;  4KPY A;  1ASV A;  3VQA A;  1BIU A;  4EFH A;  4O8U A;  3SQ1 A;  1WSE A;  4FM2 A;  1ZBU A;  3RR8 A;  3WNG A;  3UB5 A;  2NRR A;  1TKT A;  2BH1 A;  4H5N A;  2VWB A;  4C1N K;  3O8M A;  4DS4 A;  4YOY A;  4C8K A;  4DR4 K;  1VQ7 N;  2E1Y A;  3SPZ A;  1G99 A;  3ZX3 A;  1Q81 O;  4CZI A;  4M3U A;  3KLI A;  1S6Q A;  4YY3 K;  4JV5 K;  3F5T A;  4BDP A;  3VEY A;  1RTI A;  3ULE B;  2A1S A;  4LH4 A;  4DLG A;  1N33 K;  3I8B A;  4BRD A;  2QXF A;  4CJ7 A;  1U04 A;  2ZWH A;  4AHT A;  5AQZ A;  4DF8 A;  5AQX A;  1OH7 A;  5FDL A;  5F1X A;  4WQ5 A;  4M3W A;  2HVI A;  3LM9 A;  2AA4 A;  5C10 A;  4OPJ A;  3CCM N;  1QHA A;  1KRP A;  4BC4 A;  4BC3 A;  5CR4 A;  1XHZ A;  2O4I A;  3VF6 A;  4O5F A;  4JLH A;  2E20 A;  1B9F A;  4DV5 K;  4JYA K;  3QB0 A;  3QML A;  1NOZ A;  4HUF A;  5AQF A;  2W6K A;  1F21 A;  4ILJ A;  1T6C A;  4DV6 K;  2NUB A;  1JLA A;  4FLY A;  4FLU A;  2IOC A;  1C1C A;  1H1V A;  2A40 A;  2P9S A;  3RR7 A;  5EOY A;  5DM6 L;  3AV9 A;  3OYN A;  4BG8 A;  1NGC A;  4FZY A;  3IMX A;  4MLH A;  4F2S A;  1UWB A;  4E7L A;  4CF2 A;  3SBT A;  5AQM A;  1T8E A;  5CYQ A;  2VWJ A;  3THW A;  2XY5 A;  2XHB A;  1UA1 A;  3T1H K;  1WBB A;  1UAX A;  4PHT X;  1IJJ A;  5EXW A;  4LF9 K;  4WYB A;  1K8K A;  4LF6 K;  3V9W A;  3KK1 A;  2P5O A;  1BCO A;  4IFV A;  1V4T A;  1C0F A;  1S1U A;  3CJB A;  3NF6 A;  4A2B A;  2YNG A;  1NNE A;  3D6R A;  4OO1 J;  1QSS A;  1S9G A;  2KLA A;  4DHY A;  3HOS A;  1ZBH A;  2LSN A;  2G8F A;  3OBW A;  4DU4 A;  1JLF A;  4BRA A;  5D3G A;  4BRO A;  2CH6 A;  3OYL A;  2HHT A;  3VF4 A;  4KV8 A;  2NRH A;  1QVF M;  4B1X B;  4B3M K;  2QW9 A;  2Z1I A;  4B9L A;  2DFF A;  5LJW A;  3EN9 A;  1DEJ A;  3FGU A;  3F2K A;  3JAM O;  5C42 A;  4JAX A;  4FJ7 A;  5TKW A;  4KTQ A;  5E84 A;  3LWM A;  3K5N A;  2D1K A;  3DRR A;  4E7H A;  3VER A;  3HO1 A;  2YNH A;  3GE1 A;  2JLE A;  1D4X A;  3VA0 A;  4CK2 A;  1XMQ K;  4A5A A;  3D2E A;  4GMJ B;  3HVR A;  1SL0 A;  5I42 A;  3HT3 A;  5AQG A;  4C8M A;  4F3O A;  2FF6 A;  3NVM A;  3OBY A;  1U2V A;  2FF3 B;  1N8R O;  1S1V A;  1TV6 A;  4FWK A;  5AQK A;  4RWT A;  4BE0 A;  4GV3 A;  2IAJ A;  4ZTF A;  3OYA A;  2KHO A;  4JNE A;  1D8Y A;  4LD0 A;  4B1U B;  2KQ2 A;  1NK4 A;  1EET A;  4GY2 B;  4DR7 K;  1Q82 O;  3ZLJ A;  1ASW A;  2HHV A;  3AVM A;  2YHW A;  4FJK A;  2IVP A;  4DV2 K;  5AQN A;  3QIC A;  2GBZ A;  5KI6 A;  3NVK A;  5AFU H;  3K5L A;  4CE9 A;  2CGJ A;  3NBP A;  3ENB A;  5AQS A;  1YAG A;  4DTJ A;  1X3N A;  2I7P A;  3CIP A;  4HCC A;  1SS6 A;  5T7B A;  1L3T A;  2E8A A;  3R8E A;  1N32 K;  2P9S B;  4CHY A;  3OS1 A;  2A42 A;  3K5M A;  3NFA A;  5GAG P;  1CXU A;  2G8H A;  1FKP A;  2IS3 A;  3VQ6 A;  4FXD A;  1JLG A;  5JMV A;  3QIP A;  3TAG A;  4XEI A;  3BDP A;  1NK0 A;  1RCH A;  1X9J A;  4B9N A;  4DLE A;  3PX0 A;  2ZJR L;  3THW B;  4F4K A;  3MN9 A;  4JD2 A;  4NCB A;  1TYQ A;  3HPG A;  3VEV A;  4AHS A;  1K8K B;  2O4G A;  4BAC A;  4FK2 A;  1QHT A;  5KRS A;  3PO4 A;  1CZ9 A;  4BVP A;  1EXQ A;  2BTF A;  5C15 A;  5C12 A;  3I0S A;  3FZM A;  1HPM A;  4B9S A;  4KH5 A;  4RG8 A;  4H4M A;  4J2D A;  1JXE A;  1IG8 A;  1KLN A;  2ZQB A;  5HRP A;  3DLK A;  1MU2 A;  1ESV A;  3R6M A;  4DSJ A;  1A5X A;  3QIO A;  3ZSZ A;  3LP3 A;  3D45 A;  4YOR A;  4JI6 K;  4X65 K;  3I55 N;  1R0A A;  3ZEU A;  2OTJ N;  3CET A;  3CQX A;  1JLQ A;  4FJ8 A;  2HVH A;  1ATR A;  4ISF A;  1Z26 A;  4CJT A;  3AO5 A;  3FZF A;  4BR2 A;  3EKS A;  4AM6 A;  4BR5 A;  1BI4 A;  3D2E B;  3VQ8 A;  3HPH A;  4LF4 K;  5AQO A;  1HNW K;  4AHC A;  3MWP A;  4W5O A;  4FJN A;  4CZH A;  3QES A;  4EIA A;  4OVL A;  1U2V B;  1NK7 A;  2ITM A;  2Q31 A;  3G6E N;  1GOA A;  4DTO A;  4DCH A;  2QWL A;  4CF9 A;  4BRL A;  2PAV A;  4LFB K;  4Z4G A;  3DAW A;  3DLG A;  3J7Z O;  1RDW X;  4PY5 A;  1JCG A;  3SYZ A;  2RF2 A;  3SUP A;  5KQ8 A;  1EO1 A;  2IC3 A;  3EZW A;  5FPM A;  4DV4 K;  2X74 A;  2HMI A;  4IXC A;  3VMF B;  1HRH A;  3KKS A;  1MDU B;  4UQG A;  1LOT B;  4PKI A;  3B6P A;  1NK5 A;  1HUX A;  2IDO A;  3THV A;  1TVR A;  1HNI A;  4Z4C A;  4DR2 K;  1KD1 O;  3PLA A;  3WEE A;  1NOY A;  2FBT A;  1YJW N;  4B1Z A;  4BR7 A;  2EWS A;  2RKI A;  4JKG A;  1Y97 A;  2P1J A;  3DRS A;  4CEF A;  4E1J A;  1GLB G;  4U7B A;  5KGX A;  1XQS C;  1RGI A;  3CJ7 A;  4CEA A;  3OYD A;  3MN5 A;  2YCH A;  4I2Q A;  3ZT2 A;  1ZYQ A;  1TAU A;  2XY6 A;  4IEE A;  2P9L A;  1XI1 A;  1NKC A;  3GDQ A;  4JD2 B;  4DSL A;  1TYQ B;  2DFE A;  2JWK A;  2ASM A;  5I9E B;  3VPZ A;  4WQ4 A;  2B4J A;  3EEQ A;  1UA0 A;  1Y64 A;  3R3L A;  5HP1 A;  4LY7 A;  3L6Q A;  3KHY A;  4MDB A;  3SAG A;  3WXK A;  1N34 K;  3SJH A;  3V81 A;  2E6M A;  5M1F A;  4RW9 A;  2O8C A;  4M3Y A;  3P83 D;  1RBU A;  3ZT3 A;  3O08 A;  1NGF A;  4FWP A;  4FJM A;  1LWC A;  4RTF D;  4KHW A;  3A2F A;  4DSF A;  2HNZ A;  4WCE L;  5CY4 A;  1KVB A;  3ZEU B;  4CBU A;  3E9O A;  1ITG A;  1VSL A;  4OLA A;  2Z1J A;  1RT4 A;  4PA1 A;  3F73 A;  1NJW A;  3MEC A;  4ILH A;  4NYN A;  5JS2 A;  4YFU A;  4KH6 A;  4AHU A;  3R9P A;  2EX3 A;  5BN9 A;  1BI4 B;  3TAM A;  4FVM A;  5FRM A;  3VQE A;  2YNF A;  3SQ0 A;  1TL3 A;  4HUE A;  1NJZ A;  3K58 A;  4DTN A;  3DRP A;  3SQ4 A;  4H8K A;  3KWI A;  4E89 A;  3VQ5 A;  3V9U A;  2XY8 A;  3TR8 A;  3NH1 A;  3CJ1 A;  4IG0 A;  3C0B A;  1FJG K;  5BN8 A;  3PV8 A;  1QVG M;  3O9S A;  3AA5 X;  2E2O A;  4B9T A;  4AHV A;  4O44 A;  3CCU N;  5C2F A;  4H5T A;  3WXL A;  4FJL A;  3BY5 A;  3VGL A;  4J8F A;  3T1A A;  5B8H A;  4ICL A;  3NCI A;  4KTZ A;  1K6Y A;  3P31 A;  3J7Y P;  3L2Q A;  5HRS A;  3O4W A;  1NK8 A;  4DSK A;  1HMV A;  1QQN A;  4BRC A;  4DTM A;  4FK0 A;  4CF8 A;  4MQ3 A;  2YJF A;  4BWM A;  3QO9 A;  3AY9 A;  4I2P A;  4H5V A;  3WEE B;  5EY4 A;  2A1R A;  3P38 A;  5BPL A;  1YVN A;  2OPQ A;  3DXM A;  2HF3 A;  4JKG B;  4PUO A;  1VHX A;  1KVA A;  2YHY A;  4K43 A;  3O9T A;  4A57 A;  4CFA A;  1NGE A;  3TTC A;  4JI0 K;  4CZG A;  3WT0 A;  3ZSW A;  3PX6 A;  3SPY A;  2AP1 A;  1KSP A;  4ID1 A;  1CZA N;  2H3G X;  2P9L B;  2GX9 A;  1LAW A;  3V4I A;  1GLE G;  2F9W A;  4DTX A;  2KZM A;  4A59 A;  4HCB A;  4FPB A;  4NYF A;  3EZ5 A;  1WAF A;  3V9Z A;  4LSL A;  4CGD A;  2HOE A;  3HZ6 A;  1WLJ A;  3LDL A;  2Q1N A;  3SLC A;  3BZK A;  4DS5 A;  1OVY A;  4B9Q A;  2D5R A;  3J7A P;  2O8C B;  2JWL A;  3MWT A;  3IAY A;  3M8S A;  1X9M A;  4Z94 A;  3OY9 A;  1WNS A;  4ZTJ A;  1RDA A;  4CHP A;  4CGH A;  3CJA A;  5AQL A;  3GOI A;  1SL2 A;  1XNQ K;  2D0O A;  4DR6 K;  4BC2 A;  1DKG D;  1QSL A;  5BRH A;  4NB4 A;  4FJ9 A;  3CM6 A;  3FE1 A;  4QAG A;  1S22 A;  1LV5 A;  1G15 A;  4H0T B;  2XO7 A;  2Z1G A;  4FK4 A;  1C0T A;  1QZ5 A;  4OX9 K;  2G8W A;  1J5O A;  4KHN A;  1Z05 A;  1RT6 A;  4KRE A;  3WXI A;  3EL2 A;  4KH4 A;  3SUO A;  1S1W A;  2WON A;  2BDP A;  3KD1 E;  3QEW A;  3K9J A;  5JLF A;  3ITH A;  4ISG A;  3ENH A;  3PIP L;  4CHO A;  4IJA A;  1LCU A;  3EY1 A;  5J2Q A;  3C95 A;  3IDH A;  5BPM A;  1S6P A;  3ZYY X;  2Y1J A;  4PQU A;  1SAZ A;  1YTA A;  2PFU A;  3SUQ A;  1REV A;  4CCH A;  4CBW A;  1TKD A;  4IJN A;  2W42 A;  3V9S A;  4FYD A;  3MEE A;  2YKN A;  4YOW A;  3ID6 A;  1RDD A;  4CGJ A;  1I94 K;  1GLL O;  5HL7 L;  3L0Q A;  1WAJ A;  3JSM A;  1E4G T;  3TTD A;  2A3Z A;  3AVH A;  3TPQ A;  3OYE A;  4JKF A;  1T7P A;  2QTD A;  4A5B A;  4EZ6 A;  3IRX A;  1BGX T;  1CXQ A;  4B1Y B;  5C2D A;  2UU9 K;  4H5W A;  3L2W A;  3VQQ A;  2A5X A;  4MO4 A;  3DXM B;  4OPK A;  4ZHR A;  2KZZ A;  3VA3 A;  1SKS A;  3ZSO A;  4B3O A;  2RHK A;  5J2M A;  1JKH A;  3JXU A;  2ZE2 A;  3HSC A;  4F8R A;  5DMR A;  3TTF A;  1B92 A;  2P51 A;  3AGK A;  1VSE A;  5BRE A;  3NH2 A;  1EWR A;  1K73 O;  3DOL A;  5AQQ A;  4B9V A;  1VSI A;  2VG5 A;  1DTQ A;  4XH1 A;  4DKW A;  4M42 A;  2A6A A;  3OYH A;  3KTQ A;  3NF8 A;  1W97 L;  3KZB A;  2OZM A;  2FSJ A;  1WOQ A;  3N4P A;  3PY8 A;  4YDU A;  1D5A A;  5JVH L;  1NBW A;  3TSU A;  4DV7 K;  5FRO A;  3W3D A;  1P90 A;  5AQJ A;  2YJE A;  4BE2 A;  4YOV A;  3BF1 A;  1TUU A;  1A5V A;  1VSF A;  1W2B M;  3DLR A;  4FOI A;  4EZ9 A;  3VQB A;  3S3O A;  1T05 A;  1IBL K;  1VQ5 N;  2WTU A;  4FLW A;  3FZL A;  2OA8 A;  3VQP A;  4IWV A;  4NCG A;  3E66 A;  4B8C A;  1HQE A;  1KCF A;  4FWN A;  3VEZ A;  2HBK A;  3TWH A;  5EVZ A;  1HYS A;  4M7X A;  4BC5 A;  4JRP A;  5AQV A;  1NGG A;  1M90 O;  4FLT A;  2P9I A;  3VTI A;  3G0Z A;  3OYK A;  3CC7 N;  4IFY A;  2WC9 A;  1EQY A;  4KHU A;  2ATQ A;  4ID5 A;  3I8D A;  4Z4H A;  5HLF A;  3A8Y A;  3IUC A;  2RN2 A;  4IOX A;  1VQN N;  1I3A A;  5M1K A;  2KW4 A; 
#chains in the Genus database with same CATH homology
 2HHX A;  2EHG A;  2ZQB A;  5HRP A;  4M3R A;  3AVJ A;  3OYF A;  4Z0U A;  3ZSY A;  2G8V A;  5FRN A;  3DLK A;  1MU2 A;  4ELU A;  4DSJ A;  3M8P A;  3OJS A;  1A5X A;  4BDZ A;  3QIO A;  3ZSZ A;  3LP3 A;  4B9M A;  1LAV A;  3D45 A;  3NH0 A;  4OGE A;  4E1N A;  2OYQ A;  1SKW A;  3KLE A;  1XC9 A;  4KHS A;  3T3F A;  1R0A A;  1KLM A;  2XRI A;  5SWM A;  1JL2 A;  4E7J A;  3ZCM A;  4Q5V A;  1KTQ A;  5C25 A;  1JLQ A;  4DTU A;  3KLH A;  3AO2 A;  4FJ8 A;  3HVT A;  2VWK A;  4W5R A;  3O3F A;  1N6Q A;  5HRR A;  2YV0 X;  4Z4F A;  4CHZ A;  2HVH A;  1Z26 A;  4CJT A;  2ZD1 A;  3OYC A;  4FJH A;  1O1W A;  3AO5 A;  2R7Y A;  5KRT A;  1WSJ A;  3O4N A;  4W5T A;  3TAN A;  4EP5 A;  1KVC A;  1BQN A;  4CJK A;  4DWI A;  2F8S A;  1BI4 A;  3PX4 A;  4CJ3 A;  4M3Z A;  1U48 A;  1VSD A;  2GV9 A;  3HPH A;  3VQ8 A;  4KI6 A;  1CLQ A;  1RDB A;  4AHC A;  4N47 A;  4W5O A;  5I3U A;  4FJN A;  3QES A;  1FKO A;  1XHX A;  4OVL A;  4N41 A;  4GVM A;  1NK7 A;  4FLX A;  2I5J A;  4CJE A;  3K57 A;  1GOA A;  4DTO A;  2QKB A;  4CF9 A;  1VSK A;  4XIU A;  4F3T A;  4Z4G A;  3DLG A;  2HHQ A;  4PY5 A;  1IH7 A;  3DLB A;  1HYV A;  3SYZ A;  1VSJ A;  2RF2 A;  2VG6 A;  3SUP A;  2IC3 A;  2YNI A;  4KO0 A;  3OYM A;  1RT5 A;  3HP9 A;  4CJW A;  1J54 A;  2X74 A;  2HMI A;  3C6U A;  3VQC A;  1ZBF A;  3LP1 A;  4CFB A;  1SV5 A;  1X9S A;  1HRH A;  1JL1 A;  1FXX A;  1S5J A;  3QEP A;  3AA4 A;  5HBM A;  3KKS A;  4CIG A;  4UQG A;  1W9H A;  4DG1 A;  1I39 A;  3B6P A;  1NK5 A;  3THV A;  2IDO A;  3NF7 A;  4CJU A;  1NK6 A;  5J1E A;  1TVR A;  2FBX A;  3K2P A;  1D9D A;  1HNI A;  4DFJ A;  4Z4C A;  4CIE A;  4RW6 A;  4CJF A;  3LAM A;  1JLB A;  3TAP A;  1VRT A;  2FBT A;  1NOY A;  1GOB A;  3L2V A;  2PZS A;  4DQP A;  4CFD A;  2RKI A;  4O0J A;  4G1Q A;  4I9Q A;  1Y97 A;  3HPO A;  3ALY A;  3MXJ A;  4CGG A;  1NJX A;  3NAE A;  3TI0 A;  2P1J A;  3DRS A;  4CEF A;  1QE1 A;  4WE1 A;  1NKB A;  3PO5 A;  4H4O A;  5KGX A;  3AO1 A;  4LH5 A;  4CEA A;  2Q3S A;  3OYD A;  1WSG A;  4I2Q A;  3OVN A;  3ISN C;  3CFR A;  4BE1 A;  3ZT2 A;  1ZYQ A;  1TAU A;  4CJR A;  5CZ2 A;  4DF4 A;  4M45 A;  2XY6 A;  2JGU A;  3V9X A;  1XI1 A;  4DQR A;  1NKC A;  4DTS A;  1CZB A;  1BHL A;  1RTH A;  4KB0 A;  4CJL A;  4Y1C A;  3LPU A;  1N5Y A;  4DSL A;  2DFE A;  3LDS A;  3NE6 A;  3AVB A;  3ZSX A;  1LW0 A;  3LPT A;  2RPI A;  3AO3 A;  3TAF A;  3K59 A;  1TKZ A;  3AVF A;  2G8U A;  2B4J A;  2AJQ A;  2DY4 A;  1WSF A;  5CZ1 A;  2XY7 A;  3QEX A;  1UA0 A;  4Z4E A;  3C94 A;  1IKX A;  2B6A A;  3L3U A;  4IG3 A;  3VQ7 A;  5HP1 A;  4BWJ A;  4AH9 A;  4LY7 A;  2HNY A;  2P5G A;  1U4B A;  3L3V A;  4OKK A;  3OYJ A;  1NK9 A;  3OS0 A;  4Q0B A;  4DTP A;  3O4Q A;  4CF1 A;  3V81 A;  1C0U A;  2DTU A;  4CK3 A;  3JYT A;  3TAE A;  3DM2 A;  2E6M A;  4CK1 A;  3LAN A;  4RW9 A;  4BDY A;  3MXI A;  1D9F A;  2Z1H A;  4M3Y A;  3P83 D;  4FZZ A;  5HRN A;  1ZBI A;  1JXB A;  1RBU A;  4HTU A;  2PYL A;  4E19 A;  3ZT3 A;  3S3N A;  2HB5 A;  2QK9 A;  3OYG A;  4OLB A;  3RMC A;  4FJM A;  1LWF A;  1LWC A;  2F96 A;  4KHW A;  3A2F A;  4DSF A;  2HNZ A;  1TL1 A;  5CY4 A;  1TGO A;  1L3U A;  4KAZ A;  3QET A;  4DSI A;  1LWE A;  5C24 A;  1KVB A;  1C1B A;  2G8I A;  4QOZ B;  1LW2 A;  1A5W A;  2YHA A;  5CYM A;  1RT1 A;  4FJJ A;  1WSI A;  3RMB A;  1ITG A;  1VSL A;  4OLA A;  3SV4 A;  1IO2 A;  3ZSQ A;  3RWU A;  1BIS A;  2ITG A;  2Z1J A;  4KTW A;  3MEG A;  3FFI A;  3ZT1 A;  1RT4 A;  4PA1 A;  3DMJ A;  3F73 A;  3AVG A;  4CEZ A;  3U6F A;  1NJW A;  4CGF A;  4M41 A;  3MEC A;  3S9H A;  4NYN A;  5JS2 A;  3RMA A;  3CG7 A;  3KKR A;  4JRQ A;  4TSX A;  2X78 A;  4KKO A;  4YFU A;  4AHU A;  4B08 A;  4FJI A;  3PUF A;  4IKF A;  3WNE A;  4E3S A;  3ZT0 A;  1HQU A;  2EX3 A;  3S3M A;  1BI4 B;  3KIO A;  1RBR A;  3TAM A;  3ZSV A;  4FVM A;  1Q8I A;  3NF9 A;  3VQE A;  5FRM A;  4NCA A;  2YNF A;  3SQ0 A;  1QQC A;  2YHB A;  1TL3 A;  4KRF A;  4HUE A;  4E7K A;  1U49 A;  5JS1 A;  1NJZ A;  3K58 A;  4DTN A;  3CM5 A;  3QLH A;  2YKM A;  3L2U A;  2HHS A;  2X6N A;  3DRP A;  4H8K A;  3SQ4 A;  3KK3 A;  1IKY A;  4HHT A;  4E89 A;  4I7F A;  3VQ5 A;  3V9U A;  1ASV A;  2XY8 A;  3TR8 A;  3P1G A;  3VQA A;  4KPY A;  1BIU A;  3SQ1 A;  3NH1 A;  1WSE A;  4IG0 A;  4OKJ A;  1RTJ A;  1ZBU A;  4FM2 A;  4E1M A;  4B9U A;  3RR8 A;  4JS4 A;  3PV8 A;  1EP4 A;  4OGC A;  3WNG A;  2PYJ A;  4F2R A;  1HNV A;  3AA5 X;  4CJ4 A;  4B9T A;  4AHV A;  4O44 A;  4YNQ A;  1TKT A;  4J2B A;  3H08 A;  4FJL A;  2D0C A;  3T1A A;  4MFB A;  4ELT A;  3V1O A;  1YVU A;  4ICL A;  5K14 A;  4DS4 A;  1S9E A;  4KTZ A;  3NCI A;  1K6Y A;  4E7I A;  3RMD A;  4AHR A;  4FLV A;  3SZ2 A;  3L2Q A;  4C8K A;  5J2P A;  5HRS A;  3SPZ A;  1NK8 A;  4E0D A;  4DSK A;  1HMV A;  3QIN A;  2FC0 A;  3KLG A;  3LP0 A;  1VK0 A;  3LAL A;  3DLE A;  4M3U A;  4DTM A;  4FK0 A;  3KLI A;  1S6Q A;  4MQ3 A;  4CF8 A;  1WN7 A;  4BWM A;  4BDP A;  4HUG A;  1RTI A;  3QO9 A;  4DTR A;  4KHY A;  2A1S A;  4KFB A;  4CEB A;  2HND A;  1J9A A;  3E01 A;  4I2P A;  4LH4 A;  4DLG A;  2QKK A;  2QXF A;  4JS5 A;  1C6V A;  3RRH A;  1U04 A;  3HXM A;  2A1R A;  4IDK A;  3NGI A;  4AHT A;  4DF8 A;  4B8A B;  2OPQ A;  2OPP A;  4O4G A;  4PUO A;  5FDL A;  2PY5 A;  3K5O A;  4M3W A;  2HVI A;  4HVJ A;  1KVA A;  4OPJ A;  3AA3 A;  3OYB A;  1RT3 A;  4CFA A;  1ZBL A;  1KRP A;  4FM1 A;  3ZSW A;  1TAQ A;  3LWL A;  5EU7 A;  1NKE A;  3ULD A;  3PX6 A;  1TK5 A;  2FBY A;  3SPY A;  1U47 A;  1XHZ A;  1KSP A;  2O4I A;  3KLF A;  4ID1 A;  3HM9 A;  1Q9Y A;  3C6T A;  3MAQ A;  3SUN A;  3NDK A;  4JLH A;  1LAW A;  3V4I A;  4N56 A;  4DTX A;  1B9F A;  1RNH A;  4FW1 A;  2KZM A;  1C0M A;  3HYF A;  4HCB A;  2KFN A;  4J2E A;  1NOZ A;  4HUF A;  2VG7 A;  5E41 A;  1F21 A;  1QS4 A;  4NYF A;  4OJR A;  4J2A A;  2F8T A;  1NJY A;  3EZ5 A;  3L8B A;  2NUB A;  1JLA A;  1FK9 A;  1WAF A;  3V9Z A;  1IG9 A;  4LSL A;  4CGD A;  4FLY A;  3VQ9 A;  2E6L A;  1WLJ A;  4FLU A;  3VQD A;  2HHU A;  3V6D A;  2BAN A;  2IOC A;  1S1X A;  3ASM A;  4CFC A;  3VQ4 A;  1C1C A;  3RR7 A;  4FM0 A;  3QEI A;  1KFS A;  4C8N A;  4DQI A;  1X9W A;  3AV9 A;  3OYN A;  4CGI A;  4DS5 A;  1B9D A;  4CJQ A;  1SL1 A;  4FW2 A;  1TK0 A;  1KFD A;  4FZY A;  1VSH A;  3KD5 E;  4F2S A;  2D5R A;  3SNN A;  1RT7 A;  1RIL A;  3TAQ A;  3MED A;  5SZT A;  1UWB A;  4E7L A;  3IAY A;  4CF2 A;  2D0B A;  3OS2 A;  3M8S A;  1X9M A;  3OY9 A;  3SV3 A;  1WSH A;  1WNS A;  1T8E A;  2OPS A;  5CYQ A;  2VWJ A;  2XY5 A;  2XHB A;  4ZTJ A;  3TAR A;  1UA1 A;  1RDA A;  2B5J A;  4CGH A;  4CHP A;  3KK2 A;  1UAX A;  3AVN A;  1IKV A;  5DK5 A;  4W5N A;  1SL2 A;  3V9W A;  3NGY A;  3KK1 A;  2P5O A;  3AVC A;  1QSL A;  4PWD A;  4CJ5 A;  1BCO A;  4IFV A;  1TK8 A;  2WOM A;  4FJ9 A;  3CM6 A;  1S1U A;  3NF6 A;  1XWL A;  2YNG A;  3QNN A;  1HYZ A;  4QAG A;  1LV5 A;  1G15 A;  4CEE A;  1QSS A;  1S9G A;  2XO7 A;  2Z1G A;  4FK4 A;  4CEQ A;  1C0T A;  4FJX A;  2G8W A;  1ASU A;  1ZBH A;  1J5O A;  2LSN A;  2G8F A;  4KHN A;  1RT6 A;  4DU4 A;  2BGG A;  4KRE A;  1Z25 A;  3M8R A;  2BE2 A;  4CEC A;  1JLF A;  1BCM A;  5HRO A;  5D3G A;  2FBV A;  3KJV A;  3SUO A;  2DFH A;  1S1W A;  2WON A;  3SQ2 A;  3HJF A;  2BDP A;  3KD1 E;  3OYL A;  1YTU A;  2KTQ A;  2HHT A;  4FJG A;  4KV8 A;  3CQ8 A;  3QEW A;  4LSN A;  3OYI A;  2Z1I A;  3ITH A;  4DFP A;  4B9L A;  2DFF A;  4O5B A;  4CHO A;  3CFP A;  4I9L A;  1T03 A;  3M8Q A;  3EY1 A;  5J2Q A;  3C95 A;  5C42 A;  2ETJ A;  4FJ7 A;  3QER A;  3QNO A;  1S6P A;  2Y1J A;  4PQU A;  3CFO A;  1YTA A;  1L3S A;  4KTQ A;  3LWM A;  3SUQ A;  3K5N A;  2HW3 A;  1REV A;  3DRR A;  4CCH A;  1YT3 A;  3L2R A;  4O0I A;  3P5J A;  4C8L A;  4E7H A;  1TKD A;  2W42 A;  3V9S A;  1L5U A;  4FYD A;  3SJJ A;  3MEE A;  1RBV A;  1GOC A;  3SCX A;  1RBT A;  3T19 A;  3ZSR A;  2YKN A;  3HO1 A;  1EKE A;  2YNH A;  4CJP A;  4K8X A;  2JLE A;  3U3Y A;  4Y1D A;  3VA0 A;  3DYA A;  4CK2 A;  1RDD A;  4CGJ A;  3LZI A;  4CHN A;  4GMJ B;  3HVR A;  1SL0 A;  4C8O A;  5J2N A;  4CJS A;  4RW4 A;  1WAJ A;  3HT3 A;  4C8M A;  3JSM A;  5I42 A;  4N5S A;  4F3O A;  3AVH A;  1IKW A;  4CEO A;  3AVL A;  4CER A;  3OYE A;  4FZX C;  1JLC A;  3AVK A;  3O3H A;  3V1R A;  1T7P A;  1S1V A;  1TV6 A;  4K8Z A;  1EX4 A;  3IRX A;  1BGX T;  1CXQ A;  1J53 A;  4BE0 A;  3MXM A;  1QTM A;  4B9V A;  4EZ6 A;  3L2W A;  2KFZ A;  4DSE A;  3VQQ A;  2IAJ A;  4ZTF A;  3OYA A;  1SKR A;  1D8Y A;  4OPK A;  4LD0 A;  4R5P A;  2KQ2 A;  4ZHR A;  1BQM A;  4O55 A;  1NK4 A;  2KZZ A;  1EET A;  3CYM A;  3LZJ A;  3VA3 A;  1SKS A;  3AO4 A;  3QEV A;  3ZSO A;  1ASW A;  1UOC A;  4B3O A;  1JLE A;  3AVM A;  2HHV A;  4FJK A;  3HK2 A;  4DFM A;  5J2M A;  1JKH A;  4AIL C;  3WNH A;  4FJ5 A;  2GBZ A;  2ZE2 A;  5KI6 A;  4F8R A;  5KTQ A;  3IG1 A;  4DFK A;  5DMR A;  1B92 A;  1VSM A;  3F9K A;  4IBN A;  2P51 A;  4Z4I A;  1VSE A;  3V1Q A;  4CE9 A;  3K5L A;  3NH2 A;  3NBP A;  4ELV A;  3HP6 A;  1L3V A;  1Q9X A;  3DOL A;  3LAK A;  3BGR A;  2X6S A;  3VN5 A;  2Y1I A;  2D0A A;  1HJR A;  4CF0 A;  4DTJ A;  1VSI A;  2VG5 A;  3NHG A;  4DU1 A;  4L8R B;  3RTV A;  1DTQ A;  1X1P A;  4CJV A;  4DQQ A;  4HCC A;  2GUI A;  4W5Q A;  4M42 A;  4DU3 A;  3G10 A;  1BL3 A;  5T7B A;  3D0P A;  3B6O A;  1L3T A;  3OYH A;  3KTQ A;  4QCL A;  3NF8 A;  4RW8 A;  3AVA A;  1RT2 A;  4M3T A;  2OZM A;  1RBS A;  3LP2 A;  3ZT4 A;  1VRU A;  4M3X A;  1W0H A;  3OS1 A;  4CHY A;  4KHQ A;  3K5M A;  4CHQ A;  3PY8 A;  3NFA A;  1D5A A;  1CXU A;  1BIZ A;  2G8H A;  5KGW A;  1FKP A;  3HST B;  2E4L A;  5FRO A;  1TKX A;  4EP4 A;  2IS3 A;  1U45 A;  3AVI A;  3VQ6 A;  4FXD A;  4KI4 A;  1JLG A;  3QIP A;  3TAG A;  4GW6 A;  4BE2 A;  3BDP A;  1RDC A;  4CED A;  1SUQ A;  3SI6 A;  1NK0 A;  1RCH A;  4FLZ A;  2OPR A;  4B9N A;  3UIQ A;  4DLE A;  3PX0 A;  1A5V A;  4F4K A;  1VSF A;  4EZ9 A;  3DLR A;  4RW7 A;  1RTD A;  3OJU A;  3DLH A;  4NCB A;  3DI6 A;  3HPG A;  3VQB A;  4N76 A;  3I0R A;  3S3O A;  4AHS A;  3WNF A;  1T05 A;  4KB1 A;  2O4G A;  4BAC A;  1HPZ A;  4CES A;  4FK2 A;  1DLO A;  1QHT A;  4CIF A;  4FLW A;  3AA2 A;  2OA8 A;  5KRS A;  2OZS A;  3VQP A;  3O3G A;  3IS9 A;  4NCG A;  4OKE A;  3PO4 A;  1CZ9 A;  4B8C A;  1HQE A;  1DTT A;  1KCF A;  3TWH A;  1EXQ A;  3EYZ A;  1HYS A;  3TAB A;  4DQS A;  4JRP A;  3DOK A;  3HL8 A;  2HHW A;  3U3G A;  4FLT A;  3I0S A;  1C1A A;  3G0Z A;  3NGZ A;  3OYK A;  1S1T A;  4IFY A;  2G8K A;  4B9S A;  4RG8 A;  4KHU A;  2ATQ A;  4ID5 A;  4H4M A;  3I8D A;  4J2D A;  2IGI A;  1QSY A;  4FCY A;  1JXE A;  4Z4H A;  4DMN A;  5HLF A;  3RRG A;  2RN2 A;  1I3A A;  2KW4 A;  1KLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...