4LH4A

Dual inhibition of hiv-1 replication by integrase-ledgf allosteric inhibitors is predominant at post-integration stage during virus production rather than at integration
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
152
structure length
129
Chain Sequence
b'SPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKYSAGERIVDIIATDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Dual inhibition of HIV-1 replication by integrase-LEDGF allosteric inhibitors is predominant at the post-integration stage.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 43
structure length 129
sequence length 152
ec nomenclature
pdb deposition date 2013-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4lh4A00
1IH7A 4FJ7A 1L3TA 4O44A 4AHCA 5J2MA 1LAWA 1N6QA 1S6PA 4BDPA 1JLBA 3K5OA 4AHUA 5KGXA 4E3SA 3KD5E 3MEDA 1FKPA 3ZT4A 4E1NA 4ID1A 3TAEA 4B9LA 1X9WA 2KTQA 3LZJA 4KPYA 3ISNC 2IC3A 2G8WA 2G8VA 1U04A 2GV9A 2HHWA 4B9UA 4ELTA 1QQCA 3L2WA 4KI4A 2FBVA 4DF8A 3DLKA 1KFSA 4FJJA 1S1TA 2BANA 4Q0BA 2HB5A 4E7IA 2HHXA 1BQMA 1RBSA 1RBRA 2X78A 4H4OA 3TR8A 2YNFA 3PX6A 4EZ6A 1YTUA 1K6YA 2KFZA 1RTIA 2OA8A 3KKRA 1SL2A 3OYHA 1U48A 5SZTA 3QIPA 3V6DA 3NDKA 1RTDA 2I5JA 2KFNA 1CLQA 3M8RA 4LH4A 1ITGA 3SQ1A 3KLHA 4DFPA 3SNNA 3VQEA 1S1UA 1WSJA 4HTUA 4EZ9A 4K8ZA 1NKBA 1KTQA 4DLEA 2HNDA 3C94A 2DTUA 3RRHA 3V1RA 4CEFA 2B6AA 4FLYA 1DLOA 3VQ9A 4ZHRA 2F8SA 4FVMA 3LAKA 4KRFA 2GUIA 4KKOA 2HHQA 4DS4A 4B08A 1S5JA 3ZSOA 2EHGA 2ETJA 1FK9A 1JLFA 4CIFA 3OYAA 2XY8A 3QETA 4OPJA 1D9FA 4M3TA 1Z25A 1N5YA 4KHQA 4DSEA 2BE2A 1U47A 3MEGA 3OYKA 3OYJA 4KI6A 1J54A 1RT5A 1I3AA 3I0RA 4FLTA 4DTSA 4FYDA 3AVCA 4N47A 4CJ4A 4LD0A 1EKEA 4CJWA 3O3FA 5C24A 1XI1A 4AHRA 2FBTA 4JLHA 2NUBA 4BDZA 3U3GA 4F4KA 4F2SA 3O3GA 1NJWA 2F8TA 4C8KA 3D45A 1CXQA 4Y1DA 3EZ5A 1RNHA 1UA1A 3OS1A 3OVNA 3UIQA 1RDBA 4CGDA 4HUEA 2Y1JA 1X9MA 2DFEA 4DSFA 4OJRA 2P1JA 5KTQA 3ZSXA 3U6FA 4Q5VA 1RT7A 3V9ZA 5J2NA 2O4IA 3DLBA 3SZ2A 3S3MA 4EP4A 3VN5A 3SUQA 3VA3A 1NK4A 2HHSA 1KSPA 2YHBA 1VSJA 4CFDA 4E7LA 1SL0A 4W5RA 3TWHA 4M3YA 4GW6A 5HRRA 4DTUA 1WSFA 4CEZA 1WAJA 1RTJA 4O5BA 5HROA 2KZMA 5KRTA 1RT4A 2ITGA 4OKKA 4CEEA 3QEIA 3NFAA 1D9DA 2PYLA 4LH5A 2XHBA 1HQEA 2X74A 2Z1HA 3HYFA 1L3VA 1QSLA 4CJRA 1UA0A 3I0SA 1ASUA 1S1XA 4FK4A 1JL1A 4DG1A 1LWFA 4W5TA 4OPKA 4DTMA 4M3ZA 4FJ8A 1Y97A 3WNHA 1JXEA 3NF7A 3LZIA 3OYMA 4MQ3A 4I9LA 3V81A 3SV3A 3AA2A 3S3OA 4E19A 2OYQA 2XY7A 1QHTA 4FM2A 1HNVA 3HVRA 3TANA 2QKBA 4B9MA 1TKZA 2OPRA 4IFVA 3ZT2A 4C8LA 2IOCA 1UWBA 4RW7A 3THVA 1T8EA 4IG3A 1TGOA 1DTQA 4OGEA 1L5UA 4EP5A 3QLHA 1S9EA 4FLWA 4M41A 3NGZA 1BCOA 3RR7A 1KCFA 4OGCA 1BIZA 3CFOA 4M45A 4AHVA 3KK3A 1BI4B 3CQ8A 3QIOA 1XHZA 5HRSA 1NK0A 4DQIA 4CGIA 3SUPA 5D3GA 3HPOA 5CZ2A 4NCGA 1VRUA 3AVBA 3T19A 1RCHA 1TK5A 4W5QA 1NOZA 3IG1A 3K5MA 4B9TA 4M3WA 1EXQA 5KRSA 3QEXA 1WNSA 3V9SA 1VSFA 2HVIA 3CM5A 1I39A 1EP4A 1WSHA 1A5VA 3AO3A 3PO5A 3DYAA 1RT3A 1GOCA 3OS0A 2XRIA 5CYQA 1RT2A 3HM9A 4DU3A 1BL3A 1JLAA 1ZBUA 4W5NA 1EX4A 4DTJA 4DMNA 4FJNA 1GOBA 4DQPA 5KI6A 3HT3A 1S6QA 3LP1A 4RG8A 4CEAA 3LPUA 4I2PA 4NYNA 3WNFA 2XO7A 3VQPA 2ZE2A 3KLEA 1Q8IA 1IO2A 3C6TA 3ZSVA 1NJXA 2RPIA 3RRGA 4KHWA 4CFCA 4J2DA 3LAMA 4CJQA 1Q9XA 4CGHA 1S1WA 1CXUA 1LWEA 3DLHA 3M8PA 2AJQA 3OYFA 4DQSA 3KLFA 3ZSZA 1JLEA 3PUFA 3H08A 3KKSA 4L8RB 4FXDA 4HCBA 1NK7A 2A1SA 4FZXC 3TAQA 5CY4A 4RW6A 4HVJA 4BDYA 4O0IA 4CK2A 1VRTA 3HK2A 2X6SA 1HPZA 4DLGA 1J5OA 2HW3A 1F21A 1B9FA 2Z1IA 2P51A 4BACA 2DFHA 4JS4A 4QOZB 4KHSA 3QNNA 4YFUA 2QKKA 3TARA 3QO9A 4QAGA 3CYMA 5HRPA 4N41A 1QSSA 3SCXA 1YVUA 3AVMA 1SKRA 1KLNA 3L2UA 4CK1A 3CG7A 2OPQA 3NAEA 4ELVA 4AHTA 1NKCA 1L3SA 1T7PA 3RMCA 1BCMA 2FC0A 1R0AA 4CJUA 1T03A 3K2PA 1ZBLA 3DRRA 2HNYA 4I7FA 4KO0A 4FK0A 2HMIA 4E1MA 4DS5A 3V4IA 4DFKA 1RT6A 3DLGA 2HVHA 1WSGA 1HYZA 3DLRA 3HVTA 4IBNA 3SJJA 4ZTJA 1MU2A 1C1AA 4DTRA 3DM2A 4N56A 4FM1A 3OYBA 4CF8A 5C42A 4LSNA 4PY5A 3ZT3A 1J9AA 4NYFA 1U45A 4FJXA 1SV5A 4OLBA 3KJVA 3ZSQA 4DSLA 4DSJA 3OJUA 3NBPA 4DFJA 3OYNA 2YKMA 1D8YA 1TAQA 1YT3A 1HQUA 4JRQA 4Z0UA 1U49A 1QTMA 4KTWA 4N76A 2KZZA 3NH2A 4R5PA 4TSXA 4DSIA 3ZT1A 3VQBA 3TAFA 3L3VA 4CEDA 4CGFA 1IKXA 3NF6A 4AHSA 1NOYA 4FLZA 1GOAA 3AVKA 1VSHA 4M3XA 2WONA 3OYGA 4PUOA 2OPPA 4PA1A 3P1GA 3PX0A 4KTQA 2BDPA 1WSEA 4O0JA 4FW2A 3HP9A 3M8QA 5KGWA 4JS5A 1NJYA 1ZBHA 2ZQBA 2KQ2A 4KV8A 3VA0A 4CJ5A 3AVFA 4CJ3A 4CHQA 1TL3A 3AO5A 3F9KA 1LW0A 3NF9A 4LY7A 2QK9A 4BE2A 1CZ9A 3P83D 3B6OA 5DK5A 3M8SA 3L8BA 4DU4A 5FRNA 2HNZA 4BWJA 4KB1A 1C1BA 3AA5X 3NE6A 4DQRA 2RKIA 3NHGA 4CHPA 5EU7A 2IS3A 1VSEA 4CEBA 1B9DA 3JSMA 2G8KA 1IKWA 1TAUA 3L2RA 3RMBA 4PWDA 3NGYA 4MFBA 1FXXA 4IKFA 1RTHA 1LV5A 3QEPA 3VQ5A 4CECA 1RDDA 5T7BA 3OS2A 2IAJA 5HBMA 1ZBIA 2P5OA 2PY5A 1U4BA 1B92A 3HO1A 2YKNA 1TK0A 4J2AA 4Z4CA 4CHYA 4XIUA 1ZYQA 4K8XA 5E41A 3RWUA 1Z26A 3DRSA 1C0TA 1DTTA 4FJHA 1BIUA 1VK0A 3AV9A 4HUGA 1NJZA 4KHNA 1SUQA 3AA4A 3JYTA 2VG6A 3V1QA 4FLVA 3S9HA 1LWCA 4FZYA 1HRHA 1S9GA 1LW2A 3MECA 4IFYA 1UOCA 4C8OA 4Z4FA 1XC9A 5SWMA 2PYJA 4B9SA 4Z4EA 5FROA 3AVIA 1D5AA 3RR8A 3BDPA 2YHAA 4F3TA 2Z1JA 4CIEA 2G8HA 4FLUA 2E4LA 2QXFA 2RF2A 3IS9A 3RTVA 3DRPA 3ZT0A 2BGGA 1TVRA 4Y1CA 5HP1A 2YV0X 4KAZA 4DSKA 2G8UA 2LSNA 3TABA 2W42A 3WNGA 2VWKA 4CE9A 1CZBA 1C0UA 4E7JA 3V9WA 5J2QA 3VQ7A 4KHYA 1HJRA 5JS2A 3LALA 4ICLA 4H8KA 1QS4A 3TAMA 3OYEA 3OJSA 1S1VA 2XY5A 2OPSA 3EY1A 2B5JA 3TAPA 4FK2A 3AVHA 3ZSWA 1HYSA 3V1OA 2VG5A 4CHOA 4QCLA 3F73A 4HUFA 4FLXA 1KFDA 4OKJA 1IKVA 4BWMA 1ASWA 3OYLA 4CEOA 3KLGA 4DF4A 3NCIA 5JS1A 2PZSA 4F3OA 1C1CA 3OYCA 3CM6A 1ASVA 3ITHA 1NK8A 2O4GA 3SI6A 4DWIA 3QESA 1SL1A 3PY8A 1JXBA 4FJLA 1G15A 4DQQA 3ASMA 3PO4A 3ZCMA 4CGGA 4DTXA 3AVGA 1FKOA 3FFIA 3LP0A 4G1QA 4M42A 3OYIA 5I42A 3HL8A 3T3FA 1IG9A 1NKEA 3LANA 3QEVA 1SKSA 5FRMA 4DFMA 3AO2A 3L2QA 5J1EA 4CCHA 4FJ9A 1SKWA 5HLFA 4AH9A 4KHUA 4FZZA 3HPGA 3EYZA 1KVAA 1JL2A 4CJTA 4RW9A 1IKYA 3HP6A 3SQ0A 4E7HA 2A1RA 1RBTA 1TK8A 4DU1A 3KK2A 4OKEA 4FW1A 5I3UA 2X6NA 4N5SA 5C25A 2B4JA 4O4GA 3OY9A 4FJMA 1WN7A 4CJVA 1HNIA 4JRPA 4E0DA 3AVJA 4RW4A 4CHZA 4CF2A 4CIGA 3DOKA 1REVA 4IDKA 5HRNA 3K5NA 4DTPA 3S3NA 3E01A 4KB0A 3B6PA 3RMDA 3SQ2A 3K58A 1BISA 3OYDA 3SYZA 3KD1E 4CESA 1BI4A 1TKXA 3VQAA 3ZSRA 5CYMA 4CJEA 3KIOA 3AO1A 3WNEA 2XY6A 1RDCA 1RT1A 1LAVA 3T1AA 4BE1A 1KVCA 1TKDA 1X1PA 5FDLA 4B8AB 3IAYA 2YNGA 4PQUA 3DLEA 2E6LA 3LWMA 4Z4GA 4FJ5A 4C8NA 3D0PA 3L3UA 4LSLA 3O4NA 1JLQA 3NH1A 2RN2A 3SPYA 1W0HA 4CJFA 3K59A 1QE1A 5K14A 2YNIA 1KVBA 5CZ1A 3LDSA 1WAFA 5DMRA 4CJPA 3LP2A 2F96A 3QNOA 3ZSYA 3AA3A 3QEWA 2G8FA 1Q9YA 3TI0A 3SV4A 4CK3A 4CHNA 1BQNA 3AO4A 1TKTA 1ZBFA 4OVLA 3NGIA 1XWLA 1VSLA 3HJFA 1J53A 3A2FA 3HPHA 2OZMA 1JKHA 1HYVA 4CERA 3I8DA 3DI6A 4B9VA 1RILA 2G8IA 2GBZA 2D0CA 1RBUA 3O4QA 1JLGA 4B9NA 4CGJA 3IRXA 4J2BA 4CEQA 3O3HA 3SUNA 4J2EA 3MXIA 3AVNA 4F2RA 3SQ4A 3V9XA 1HMVA 4I2QA 2JGUA 4OLAA 2OZSA 4M3RA 4HHTA 2YNHA 4B3OA 4FM0A 1NK5A 4M3UA 1RDAA 4NCBA 1KLMA 3ULDA 5J2PA 3MXMA 2HHTA 3KTQA 1UAXA 2IGIA 2FBXA 4C8MA 4YNQA 1A5WA 4Z4HA 3HXMA 4ZTFA 1T05A 2P5GA 4CJSA 2R7YA 3MXJA 2EX3A 3C95A 4GVMA 2DY4A 2KW4A 1TV6A 4CJKA 3VQ8A 2E6MA 3PX4A 3PV8A 1VSMA 1VSKA 4AILC 1NK9A 2VWJA 4DTOA 1A5XA 3SUOA 3HSTB 4W5OA 4FJKA 4CF9A 1QSYA 2VG7A 4UQGA 2Y1IA 1L3UA 4KTZA 3CFRA 2D5RA 2D0AA 1RBVA 3U3YA 4CFAA 4KREA 1O1WA 4H4MA 4CFBA 2WOMA 4O55A 4CF1A 2Z1GA 2D0BA 3VQDA 2HHUA 2JLEA 3V9UA 3L2VA 3K57A 4KFBA 4ID5A 4CF0A 1NK6A 3VQCA 2Q3SA 4GMJB 4F8RA 3QINA 4E89A 3AVLA 4ELUA 4DTNA 1EETA 4E7KA 3KK1A 3DOLA 3VQ6A 4CJLA 3LWLA 3QERA 1BHLA 3TAGA 3ALYA 3VQ4A 4FJIA 1TL1A 2HHVA 1BGXT 4BE0A 1C0MA 3BGRA 3MEEA 1W9HA 3C6UA 3AVAA 3VQQA 1WLJA 3NF8A 1WSIA 1C6VA 1YTAA 3K5LA 4I9QA 4WE1A 4Z4IA 1JLCA 3DMJA 3G10A 3P5JA 4B8CA 2IDOA 4HCCA 1VSDA 1XHXA 1KRPA 3KLIA 3SPZA 3RMAA 4RW8A 3MAQA 3LPTA 1VSIA 2DFFA 4FJGA 4NCAA 1X9SA 2ATQA 3NH0A 3CFPA 3G0ZA 2FBYA 4FCYA 2ZD1A 3LP3A 4IG0A
chains in the Genus database with same CATH superfamily
2E2QA 1YF5L 5M1FA 1BUPA 4O44A 4YY3K 5AQNA 1LCUA 2P9LB 4CVNE 3KD5E 4E1NA 3TAEA 3TTFA 4B9LA 3R3LA 3LZJA 4KPYA 3ISNC 1WOQA 4B9UA 3BZCA 3MWTA 2FBVA 4FJJA 3AAPA 1S1TA 3ENOA 4Q0BA 2HHXA 4JI8K 1XC3A 4X65K 1YTUA 1YI2N 4JKAA 4DCHA 1SL2A 4RTFD 2ZJPL 1U48A 3GE1A 4WQ4C 3TTCA 1ITGA 4EZ9A 4DFPA 3A5OC 1S1UA 1WSJA 4JD2B 3ZETA 3VGMA 4CZIA 2DTUA 4DKWA 2B6AA 2I7NA 4B9QA 4FLYA 3ZX0A 3VQ9A 4ZHRA 2F8SA 4KRFA 4KKOA 2HBJA 4DS4A 2ZJQL 4B08A 1S5JA 3OYAA 3QETA 1JLFA 4CIFA 1D9FA 2OYQA 1KD1O 1Z25A 1VQ7N 2VGNA 1N5YA 1VQ9N 3Q7CA 2QWPA 4BC3A 2F7TA 5M1NA 2QWRA 1J54A 1QVFM 5BPMA 3I0RA 1EKEA 3W0LA 3FZFA 4QS7A 2QA4N 4IJNA 5C24A 1XI1A 3NMUA 3ZX2A 2NRTA 5CHIA 3O3GA 1NJWA 1NGEA 2QWNA 2O8FA 1N34K 4C8KA 3O5BA 1UA1A 3OS1A 3OVNA 1X9MA 2Y1JA 4OJRA 2ITMA 3EKSA 5GINA 3ZSXA 3U6FA 4Q5VA 5J2NA 5KPZA 4K0KK 3DLBA 3S3MA 4EP4A 1NK4A 2HHSA 4BRLA 4JK8A 2O8CA 4JKCA 4M3YA 1YXQA 4DTUA 1VQPN 1WAJA 1DKGD 4CD3A 4IFEA 1RT4A 4CEEA 1D9DA 2PYLA 2XHBA 2Z1HA 2X74A 4O8KA 1S1XA 3VOVA 1LWFA 4CI6A 1Y97A 3RSEB 3NF7A 4E19A 2GTDA 1QHTA 2QKBA 3HVRA 5AQTA 3UKRB 3ZT2A 1I94K 3THVA 3A5MC 4IG3A 3BZKA 1DTQA 3IFRA 4EP5A 4MO4A 1KCFA 3I8BA 3MDQA 4FO0A 1NK0A 1GLAG 1BI4B 3QIOA 2NNWA 5TKWA 4DQIA 3HPOA 5CZ2A 4NCGA 1VRUA 3VF4A 3T19A 1RCHA 3IG1A 4JI2K 1WNSA 3CM5A 1I39A 1EP4A 5AQXA 3VENA 1GOCA 1JLAA 1ZBUA 1EX4A 4IWVA 4YOTA 5KI6A 3HT3A 1S6QA 4B3MK 4CEAA 1X3MA 4I2PA 3KLEA 1NGFA 3C6TA 1NJXA 2RPIA 3RRGA 4PKGA 4AF1A 4J2DA 3CETA 4CGHA 1BOTO 1S1WA 3DLHA 3L0QA 4JI3K 3OYFA 4DV4K 4DQSA 3ZSZA 3PUFA 4L8RB 4HCBA 2A1SA 3TAQA 3HK2A 1HPZA 1J5OA 1F21A 1B9FA 4QOZB 3FZLA 3QICA 2QKKA 3AVMA 4CK1A 3CG7A 4A2AA 2OPQA 3MX2A 1HJOA 3RMCA 2FC0A 1KAXA 3ZX3A 4KO0A 1XNRK 2HVHA 1RT6A 1FJGK 3HSCA 4WQ5C 3O6WA 1J9AA 2DPNA 4NYFA 3U4LA 3O9UA 4FJXA 4OLBA 3ZSQA 4LF8K 3OJUA 5AQOA 2HHHK 1D8YA 4JRQA 1U49A 5F1XA 4TSXA 4GKJK 1J5EK 1G99A 3D7EO 3L3VA 5GADP 3NF6A 3PIPL 2BTFA 3OHRA 3BF3A 3VETA 3OYGA 3B8AX 4PA1A 3P1GA 1WSEA 4FW2A 3HP9A 1ZBHA 2ZQBA 4KV8A 3AVFA 4HTLA 4CHQA 3CCUN 1IBKK 3NF9A 4LY7A 2Q31A 3M8SA 3B6OA 4FOEA 1W7AA 3NE6A 3NHGA 3L4QA 5EU7A 5LJWA 3RMBA 4PWDA 3NGYA 4MFBA 4IKFA 1YJNN 3S41A 1N8RO 3VQ5A 4CECA 2IAJA 2P5OA 3O9SA 1BU6O 3HO1A 3NVKA 3WXKA 1Z26A 4FJHA 1DTTA 2V52B 1K73O 4NB4A 3JYTA 4FZYA 1HRHA 1LW2A 3MECA 1XC9A 2PYJA 1KXPA 1D5AA 4DB3A 2Z1JA 4CIEA 2RF2A 3IS9A 1OH6A 3M5RA 3DRPA 2BGGA 2YV0X 1OH7A 4DSKA 3VPZA 2LSNA 3TABA 2HMPA 2VWKA 3CJ7A 1CZBA 1C0UA 4CBXA 4CE9A 2NRXA 5J2QA 3CCLN 3VEYA 3TAMA 3OYEA 3E66A 3VERA 1EWRA 2B5JA 3TAPA 4QCLA 4BWMA 1IKVA 3OYLA 1ASWA 3KLGA 4PL8A 3NCIA 3CM6A 1ASVA 1SL1A 2O8CB 3PO4A 4CGGA 3H3NO 4DTXA 2QTDA 3FFIA 1S72N 4M42A 5M1QA 3OYIA 1IG9A 3LANA 5FRMA 3AO2A 1Q7YO 1SKWA 3CMEN 4DR7K 3EYZA 3MX5A 3CJBA 1KVAA 4GKKK 3MN9A 3TSQA 4DU1A 3KK2A 2HF3A 4OKEA 3WT0A 1TUUA 4QS8A 2NLXA 4CHZA 3DOKA 1RDUA 4BGAA 4GY2B 3EZWA 3QMLA 2YJFA 5JMVA 3FZKA 1TKXA 3WNEA 4BE1A 4B8AB 3IAYA 2YNGA 3E9OA 2E6LA 4C8NA 3SPYA 3WEEA 5K14A 4YOXA 1WAFA 1SAZA 4CJPA 3LP2A 1NM1A 4M7XA 3J8AA 4BRPA 1TKTA 3SAHA 3A2FA 3HPHA 3J80O 2OZMA 1HYVA 4CERA 4B9VA 5BPNA 4B9NA 1JLGA 2JWKA 3QFPA 3O3HA 3SUNA 4F2RA 3A0IX 4A5AA 3V9XA 1YAGA 3SQ4A 2QEXN 2OZSA 4HHTA 2YNHA 4FM0A 1NK5A 1TUYA 1UAXA 4C8MA 4CZJA 2D0OA 4H5NA 5KQDA 1K8KA 3PX4A 4WFBL 1VQON 1QSYA 4H5TA 2F9TA 4H5VA 4I6MA 3R8EA 4KTZA 4BRMA 4X66K 2D0AA 1RBVA 2E1ZA 3U3YA 4CFAA 3VGLA 4H4MA 4J8FA 2D0BA 3L2VA 3ZYYX 4DQ8A 1S3XA 2QWMA 4E89A 3CJ9A 5BRDA 3LWLA 3VQ6A 3CCMN 4UY8O 1BHLA 5CR4A 3VQ4A 5IT9O 4BRCA 3AVAA 3VQQA 1SZ2A 4QS9A 4Z4IA 5LL6Z 4BQLA 1NGJA 3IDHA 3ZEUA 3RMAA 2YX6A 3LPTA 4MDAA 1NGDA 2ATQA 3G0ZA 2FBYA 2ZD1A 2KQ2A 1H1VA 1IH7A 1WB9A 4AHCA 5J2MA 2NRHA 4BDPA 5GIOA 4AHUA 1ZC6A 3MEDA 1FKPA 1X9WA 2P9KA 3LDLA 4DR3K 2G8VA 2GV9A 2HHWA 3L2WA 2BANA 4E7IA 4FWMA 3TR8A 1RBRA 2X78A 4H4OA 4EZ6A 3PX6A 4JKDA 1GLCG 4FWRA 2KFZA 1C0GA 1K9MO 1NGAA 1KC8O 3V6DA 4JI5K 3O9TA 1CLQA 1QQMA 2OTJN 3SNNA 4KBOA 3KLHA 3SQ1A 1IBMK 2UXDK 1KTQA 3CMAN 4DLEA 2HNDA 4K42A 3V1RA 2YHWA 1DLOA 3FLCO 3LAKA 4JNEA 1Y64A 3SBTA 2EHGA 2ETJA 4KHYA 2OTLN 2XY8A 4M3TA 5AQQA 1GLJO 3EN9A 3O8MA 3OYKA 3C65A 4LF6K 1RT5A 4FLTA 3IUCA 3CC4N 4LD0A 4CJWA 4JLHA 4JN4A 2NUBA 2YHYA 1YHQN 4F2SA 4CZLA 1N32K 3VTIA 4Y1DA 4NXNK 1VQ6N 1RDBA 3QFUA 5ADXA 4DSFA 3BF1A 3T69A 4BC2A 3W3DA 5KTQA 1RT7A 2O4IA 4C1NI 1HKGA 4LF7K 3VA3A 1LOTB 4BR4A 3R9PA 3J7ZO 3WXLA 4B1WB 1YIJN 1VSJA 4KH6A 4CZMA 3TWHA 3H45C 1NMNA 4JKHA 2KZMA 2KLAA 3QEIA 2HF4A 3EEQA 3U8XA 4CJRA 2P9IA 3LDOA 3G6EN 1QSLA 4FK4A 1JL1A 5DM6L 3TTDA 4M3ZA 4B3RK 5GAGP 3WNHA 3VGKA 3BEXA 3V81A 4AM7A 4CBUA 3S3OA 1XMOK 5AQYA 1EO1A 1HNVA 3O9RA 2O8EB 2BH1A 4XEIA 2IOCA 4OGEA 1L5UA 3QLHA 1S9EA 4FLWA 1VQ4N 3NGZA 1ESVA 3MN7A 1BCOA 3UB5A 2F9WA 4AHVA 4OGCA 1BIZA 3CFOA 4M45A 4NLBA 3KK3A 3CQ8A 5H1SQ 5D3GA 3SUPA 4IOAL 3K9JA 1NGCA 2P9UB 1NOZA 4RCHA 4BROA 3QEXA 3V9SA 1VSFA 2HVIA 3ATVA 3JS6A 3JAMO 3CPEA 1BL3A 4PKIA 4H5WA 5HL7L 5BRHA 5AQPA 5CE3A 4JI0K 4DQPA 3VEOA 3LPUA 4B1XB 4LC9B 4BG8A 4KHWA 4DV7K 1XNQK 4X62K 1JLEA 1HNWK 5AQRA 2V51B 1BDGA 4JI4K 4BDYA 3LDQA 1R59O 4DLGA 3AY9A 1OH5A 4JS4A 3QNNA 4YFUA 3D2EA 3H1VX 4N41A 5BR8K 3L2UA 3NAEA 3VESA 3G71N 1NKCA 1L3SA 1BCMA 1HUXA 2FSKA 3E9LA 3U9DA 2HMIA 4DS5A 4DFKA 1HYZA 3SJJA 4YDUC 5BR9A 4A59A 2F4VK 2A42A 3OYBA 2GWKA 4LSNA 3ZT3A 1U2VA 4DSJA 4IZ9A 3O80A 3OYNA 4WQ4A 2YKMA 1YT3A 3OA9A 1QTMA 2A5XA 1HLUA 4KTWA 4N76A 2KZZA 4R5PA 3ZEUB 4DSIA 1MA9B 3ZT1A 4CEDA 4CGFA 2VYPA 4O8UA 1NOYA 1GOAA 3AVKA 2CH6A 4DV1K 3A8YA 3SJHA 2OPPA 3PX0A 2W41A 4KTQA 5KGWA 1NGHA 5AZIB 2P9NB 4CJ3A 5BN8A 1TL3A 3AO5A 1W2BM 1LW0A 4EHUA 1CZ9A 4DU4A 3CCJN 3KHYA 4KB1A 4DQRA 3AA5X 3GOIA 2G8KA 1TAUA 1IKWA 2BUPA 3PSIA 1FXXA 4FWSA 1RTHA 1KAYA 5AFUA 4BG9A 5KPTA 5HBMA 3OS2A 3L4IA 1RGIA 2VWBA 1U4BA 1TK0A 4Z4CA 4K8XA 3RWUA 1SQKA 1MDUB 4HUGA 4C8OA 4IFYA 4B9SA 4Z4EA 5FROA 2EWSA 2YHAA 3Q7BA 2G8HA 1Z05A 2E4LA 2CGJA 2QXFA 5AQFA 3RTVA 2GELA 1VAZA 4FWKA 1TVRA 4Y1CA 3WNGA 3H46O 1QS4A 3HOSA 3OJSA 1BO5O 2OPSA 3EY1A 4FK2A 3VEZA 5JS1A 5C0YA 3OYCA 1NK8A 2ZM6K 3SI6A 4DWIA 3QESA 1VQLN 4FJLA 1JXBA 3QBXA 4DQQA 3ASMA 3C6AA 2HBLA 3AVGA 2P9SA 4IOXA 4DV2K 1NKEA 4FWOA 3L2QA 3EE9A 5JICA 4FWNA 5J1EA 4FJ9A 4FWQA 4KHUA 2P9IB 1ATRA 4GNIA 1JL2A 3HP6A 4F9OA 3SQ0A 4E7HA 1TK8A 1E3MA 2X6NA 4N5SA 4O4GA 4FJMA 4CJVA 4MLHA 3CC7N 2Q0RA 1REVA 4IDKA 3K5NA 4DTPA 3C0BA 4XH1A 3B6PA 3OYDA 3KD1E 4CESA 4CJEA 1SL0A 1T6DA 3KIOA 2A6AA 4BVOA 4PQUA 2FSNA 3LWMA 3F2KA 3NH1A 1TYQA 1W0HA 2AP1A 4KH5A 3ULEA 2FSJA 3QNOA 4H0PA 4YOWA 3QEWA 4A61A 3M1FA 1BQNA 3SAFA 1ZBFA 1XWLA 3HJFA 3R1XA 3DI6A 2G8IA 4BRIA 2D0CA 1RBUA 4BRKA 1M90O 3IRXA 1IV0A 4J2EA 4JK9A 2JGUA 3HM8A 4H03B 4M3RA 5J2PA 3GG4A 3WUHA 4ZTFA 2P5GA 4YNQA 1A5WA 3SMSA 3HXMA 1HX1A 4CJSA 2EX3A 3ENBA 2DY4A 2KW4A 4CJKA 3ZETB 4JKBA 1VHXA 3D2EB 5AQVA 3MN5A 4CF9A 1HNXK 2D5RA 1O13A 3H3OB 5FPEA 1XUPO 3QBWA 1O1WA 4O55A 3FFKB 5JVGL 2UUCK 3DLLL 2P9PA 1NK6A 3VQCA 2Q3SA 4F8RA 3HOTA 3E9PA 3EE8A 1EETA 3KWGA 3TU5A 4CJLA 3TAGA 4Y0WA 5HOOA 2O8FB 4WFAL 2HHVA 1BGXT 4B1ZA 3C6UA 1VQ5N 1WLJA 2Q97A 1C6VA 1YTAA 4I9QA 2ASMA 1JLCA 3G10A 3WXJA 1VSDA 1HPMA 3M3ZA 1WBDA 3KLIA 2ASPA 4FJGA 4RW8A 2GX9A 4NCAA 2DFFA 5AZJA 4JKGA 5SZTA 4IG0A 3I33A 2VCPA 1LAWA 5FPDA 1JLBA 3K5OA 1OKJA 4YHHK 2KTQA 3HI0A 3ZT4A 4ID1A 4K25A 4LF5K 4M7YA 4ELTA 3OTOK 4DF8A 3DLKA 2HB5A 3AARA 1BQMA 1NG9A 1RTIA 3KKRA 2UU9K 3OYHA 2FXUA 1RTDA 2KFNA 3SLCA 3CXCM 4LH4A 1E4FT 4HTUA 4FPBA 1NKBA 1N36K 4FWLA 1ATNA 3DXMA 3C94A 3CCQN 4CEFA 2HBMA 1VQMN 4L3QA 2VQEK 5AR0A 3SK3A 4DSEA 2BE2A 1U47A 3MEGA 3NVMA 2Q1NA 2ZGZA 2FF6A 4JYAK 4U7BA 3LP3A 3AVCA 4CJ4A 3L6QA 5AQKA 3A5NC 5FPMA 1CZAN 4BDZA 3U3GA 2Q0UA 4NO7A 3P4IA 3D45A 3EZ5A 3UIQA 2P1JA 1NU0A 2Q36A 3E1YA 3GBTA 3KK7A 3SMPA 3MK6A 5C10A 5JLHA 3V9ZA 4DUYK 3SZ2A 3P31A 1J6ZA 4EHTA 5BREA 5JLFA 1ATSA 1KSPA 2YHBA 3DJCA 4CFDA 4A62A 4GW6A 5HRRA 1MWKA 1RTJA 4O5BA 3U9ZA 5KRTA 2ITGA 4OKKA 1X9JA 4LH5A 1UA0A 1QQNA 3I0SA 1FW6A 3C7NA 4LFCK 4DG1A 2WUSA 4FJ8A 2KKZA 1JXEA 3OYMA 3VF2A 3SV3A 3CCSN 3DWLA 5AQZA 2IVOA 4B9MA 4NXMK 1TKZA 2OPRA 4IFVA 4DR6K 2QWLA 1VQ8N 3D2FA 4DR5K 3RR7A 4LFBK 3FGUA 4PY5A 1IBLK 1NBWA 4DV3K 4K43A 1TK5A 4W5QA 1OVQA 1VQKN 3BY5A 3OBYA 5DM7L 2YJEA 1NGGA 1WSHA 3DYAA 4EAHD 3HM9A 3OS0A 2XRIA 1RT2A 2NRWA 1XQSC 1NGBA 1KQSM 5LMUK 4DTJA 4DMNA 4OX9K 3LP1A 4RG8A 4BRQA 3CC2N 4B3TK 4NYNA 2NRRA 3VQPA 2ZE2A 1Q8IA 1IO2A 4CFCA 3LAMA 3HTVA 3FZHA 1HKCA 1CXUA 3O1WA 2E2NA 2AJQA 3BUZB 4FXDA 4FWPA 4PHTX 4FZXC 5CY4A 4RW6A 4O0IA 5BN9A 3PLAA 5TKYA 5IWAK 2JWLA 2X6SA 2HW3A 2DFHA 4IXCA 2E1YA 4QAGA 3CYMA 4BC4A 5FLXO 4KH4A 3FZMA 4E1JA 3GDQA 1KLNA 3RSEA 1GLFO 2E88A 3F9MA 4AHTA 1T7PA 2IVNA 4CJUA 1T03A 3I55N 3UKRA 3DRRA 4I7FA 2W6KA 4E1MA 2P9PB 3ATUA 4ZTJA 1QZ5A 1C1AA 4DTRA 3H1QA 2WC9A 1SV5A 3KJVA 4DSLA 2QI2A 4JHDA 5EVZA 3O08A 3THYA 4DUZK 5AQUA 3NH2A 5EXWA 5BPLA 5E26A 5AQLA 3VQBA 3TAFA 1IKXA 3CD6N 4JKGB 4FLZA 4M3XA 3DAWA 2WONA 5MLCQ 2PAVA 4PUOA 2CGLA 4JKEA 2BDPA 1Q86O 3KZBA 1NJYA 4JS5A 3UE5A 3H6EA 4CJ5A 1DT9A 3WQUA 4GV9A 2QK9A 3P83D 5DK5A 5FRNA 3G25A 3TSUA 4CHPA 2IS3A 4DV0K 4JKFA 3VTHA 4CEBA 1YJWN 3L2RA 3PIOL 4LF9K 1V4TA 4FPAA 1RDDA 5T7BA 4XH5A 2PY5A 2YKNA 5I9EB 4PKHA 4CHYA 5E41A 3DRSA 1BIUA 1VK0A 3AV9A 1SUQA 3AA4A 4FLVA 2VG6A 3V1QA 3VF6A 1NNEA 1LWCA 3KVGA 2NRVA 1MWMA 5SWMA 4HWIA 2AA4A 3CI5A 3AVIA 4CZEA 4F3TA 4BY9C 3WEEB 3WXMB 2O8DA 4FLUA 4LF4K 3ZT0A 1HNZK 5HP1A 3HZ6A 2G8UA 5EOYA 4E7JA 5JS2A 4ICLA 4H8KA 5LMNK 1S1VA 2XY5A 4BR7A 1HYSA 2VG5A 4CHOA 3THWA 4HUFA 4CEOA 3O9QA 3CERA 5C15A 3CCEN 4F3OA 1GLLO 3CHWA 3PY8A 3DXKA 4G9ZA 3LM9A 4CZHA 3LP0A 5I42A 3HL8A 3T3FA 4EFHA 3QEVA 1SKSA 4LFAK 4DR4K 3MMVA 1K8KB 4BRHA 4CCHA 5HLFA 5M1KA 4AH9A 3OW2M 3HPGA 2D0PA 3C7NB 1NGIA 4I6MB 4RW9A 4CJTA 2A1RA 1ILYA 2GUPA 4B1VA 4IJAA 3EL2A 4FW1A 5I3UA 5KQ8A 3P38A 1Q82O 3OY9A 1WN7A 1OVYA 2WFBA 4JRPA 2A41A 4CF2A 1ZBSA 4CIGA 1VQNN 4KB0A 4IEEA 5HRNA 3S3NA 3E01A 3D2FB 2Q2RA 3SQ2A 3K58A 1BISA 4H0VB 3VQAA 3MN6A 5CYMA 3AO1A 1LAVA 3T1AA 3F5TA 4A57A 1X1PA 4IO9L 5FDLA 5C2DA 3DLEA 4FJ5A 3L3UA 4LSLA 2FLOA 3O4NA 2W6LA 4CJFA 4CZFA 1QE1A 1Z6RA 1YJ9N 4V19S 2UUBK 4IO8A 2YNIA 5CZ1A 5DMRA 5AQJA 1GLBG 2F96A 3CIPA 1IJJA 4CK3A 4CHNA 5AQGA 3AO4A 4OVLA 1J53A 2P9KB 4H0XB 4ISGA 1JKHA 4JI6K 1RILA 2GBZA 3O4QA 4CGJA 3R6MA 4YDUA 3GL1A 4CEQA 2IIRA 4C1NK 3MXIA 3AVNA 1YVNA 3HRGA 4OLAA 4B3OA 4M3UA 5F0XA 1RDAA 1KLMA 3ULDA 3MXMA 2HHTA 2IGIA 4Z4HA 1EQYA 2R7YA 3K0SA 3C95A 4FSVA 4BRGA 4XH4A 4YORA 2YHXA 1TV6A 3G4SN 1VSKA 1NK9A 2VWJA 4DTOA 1A5XA 3SUOA 3HSTB 4W5OA 5GAHP 5EY4A 2Y1IA 5AQHA 3CFRA 4JAXA 2WOMA 3VQDA 2JLEA 3V9UA 1BWFO 3K57A 3T7ZA 4MDBA 4DTNA 3AGKA 4E7KA 2GWJA 3DOLA 3LDPA 4C23A 4DHYA 4BGBA 4BE0A 4B1YB 1W9HA 1P90A 4JHDB 1WSIA 3LDNA 4WE1A 3P5JA 1JCGA 3DMJA 4B8CA 3THYB 1XHXA 1T6CA 3SPZA 3MAQA 3CFPA 1GLEG 4FCYA 4BR9A 3NFAA 4XIUA 4FJ7A 1L3TA 1WBBA 1N6QA 1S6PA 3P39A 4GV3A 3JXUA 5KGXA 4E3SA 4BR2A 1NJIO 2IC3A 2G8WA 1U04A 1QQCA 3I56N 1NMDA 4KI4A 1KFSA 1RBSA 2YNFA 1K6YA 2OA8A 3QIPA 3NDKA 4BRAA 2I5JA 3M8RA 4R79A 4K8ZA 3VQEA 4DV5K 3RRHA 5AQSA 4FVMA 2GUIA 2HHQA 4DV6K 4OPHA 4GV6A 3ZSOA 1NWKA 1FK9A 3N4PA 4OPJA 2ASOA 4JI1K 2D4WA 3C6HA 2E8AA 3WXIA 3OYJA 4KI6A 1I3AA 4DTSA 4FYDA 4N47A 2E5LK 4O5FA 3O3FA 4AHRA 2FBTA 2O8DB 4F4KA 4MO5A 2F8TA 3N4QA 1CXQA 1V4SA 1RNHA 5E84A 4CGDA 4HUEA 2DFEA 2H3GX 1C0FA 3RVCA 3CF5L 1KAZA 4WQ5A 3A5LC 1IG8A 3VN5A 4YOYA 3THWB 4B1UB 3SUQA 3VEVA 3CCRN 2J4RA 3DXKB 4E7LA 4JK7A 4W5RA 5ADXH 1WSFA 3LL3A 4CEZA 5HROA 3QB0A 1T3VA 5A2QO 1HQEA 2HBKA 1WUAA 3HYFA 4A5BA 1L3VA 2WTUA 1ASUA 1E4GT 4W5TA 5M1PA 4OPKA 4DTMA 3ZLJA 4BR0A 3LZIA 4OPAA 4MQ3A 4PL7A 4I9LA 1GLDG 3AA2A 2XY7A 4FM2A 3TANA 3TPQA 2O8BA 2V7ZA 4IEIA 4C8LA 1UWBA 4RW7A 1T8EA 1BG3A 1TGOA 5GIPA 4AM6A 1NLVA 5AQWA 4M41A 2QWQA 4CJ7A 2E20A 1XHZA 1U2VB 5HRSA 4CGIA 3AVBA 3EKUA 4B9TA 4M3WA 3K5MA 1EXQA 5KRSA 5BRFA 1A5VA 3AO3A 5C2FA 3PO5A 1RT3A 2UUAK 4OO1J 5CYQA 4DU3A 1ZXOA 3THXA 4W5NA 2I7PA 2KHOA 4BRFA 4Z94A 4YOUA 4FJNA 1GOBA 2E2OA 4M63C 4H5RA 3WNFA 2XO7A 3ZSVA 1XMQK 4WCEL 3D6RA 3AAQA 4CJQA 1T44A 1Q9XA 1EWQA 1LWEA 3M8PA 4DR2K 3KLFA 3H08A 3KKSA 5AQIA 1BA0A 1NK7A 3UKUA 4HVJA 4CK2A 1VRTA 2HSTA 3CJ1A 1YITN 1JCEA 1N33K 2Z1IA 4BACA 2P51A 3VEWA 4KHSA 3TARA 3QO9A 5HRPA 1QSSA 3SCXA 1YVUA 1SKRA 4ELVA 1DEJA 2OANA 3ENHA 1R0AA 2VGMA 3K2PA 2O8EA 3VEXA 1ZBLA 2HNYA 4FK0A 3V4IA 3DLGA 1WSGA 1OH8A 3DLRA 3HVTA 4IBNA 1JJ2M 1HR0K 1MU2A 1M1KO 3DM2A 4N56A 1DGKN 4FM1A 3J7AP 4CF8A 5C42A 1U45A 1QZ6A 3LM2A 3OBWA 3NBPA 4DFJA 4WYBA 2P9UA 1TAQA 2ZGYA 1HQUA 3K9KA 4Z0UA 1X3NA 1Q18A 1Q81O 1K8AO 4BRDA 4AHSA 2RE2A 1QHAA 4GVEA 1VSHA 2P9LA 4CD1A 4MLEA 4O0JA 1S22A 3M8QA 4A2BA 2P9SB 3VA0A 5AJ3K 3F9KA 4KHPK 4IDHA 1HKBA 2WBNA 4BE2A 3L8BA 2YCHA 2HNZA 2RHKA 4BWJA 5F2RA 1C1BA 3CCVN 2ZJRL 2RKIA 3ID6A 4WF9L 1VSEA 1B9DA 3JSMA 1LV5A 4JD2A 3QEPA 3O1BA 3J7YP 4K41A 1ZBIA 4DR1K 4X64K 1B92A 4J2AA 1ZYQA 2UXCK 2QW9A 1C0TA 4KHNA 5B8HA 1NJZA 3S9HA 2CGKA 3CJCA 1S9GA 3ID8A 3FR0A 1UOCA 3O4WA 4Z4FA 5AFUH 1TYQB 3RR8A 3BDPA 5ELZA 3ULEB 4H0TB 4B3SK 1W97L 4IOCL 4KAZA 2A3ZA 4BRNA 2W42A 4NLCA 3V9WA 3VQ7A 1HJRA 3LALA 2GEMA 1QVGM 4JI7K 3QDKA 4YOVA 5EX5A 3AVHA 3ZSWA 3V1OA 3EO3A 3F73A 4KHQA 4FLXA 1KFDA 4OKJA 4DF4A 2PZSA 1C1CA 4BQZA 3ITHA 2O4GA 1G15A 2ZWHA 4H0YB 3SBGA 5M1OA 3ZCMA 1P8ZA 4BVPA 1FKOA 4ISEA 4G1QA 5AZIA 2P9NA 2QXLA 4DFMA 4U67L 2UYTA 3PSFA 4CW7B 4ILGB 4FZZA 2NZTA 3M6GA 1IKYA 1RBTA 2W40A 5KPRA 5AQMA 2A40A 5C25A 2B4JA 4BREA 2O8BB 1HNIA 3BP8A 4E0DA 4WFNL 3AVJA 4RW4A 3CQXA 3RMDA 3CQYA 3SYZA 2VQFK 2HOEA 1BI4A 2QM1A 3CJAA 3ZSRA 4CBWA 2XY6A 3SAGA 1RDCA 1RT1A 3AGRA 1KVCA 3IMXA 4BC5A 1TKDA 3MWPA 4Z4GA 2CH5A 3D0PA 1JLQA 4FOIA 2RN2A 3VMFB 3K59A 5AZJB 3TSPA 4AQYK 1KVBA 3LDSA 2NRZA 3THXB 2D1KA 3AA3A 3ZSYA 2G8FA 1Q9YA 3TI0A 1YUWA 3SV4A 1D4XA 3NGIA 3HBTA 1VSLA 4JEPA 4BR5A 3I8DA 1SS6A 3MCPA 3T1YK 4J2BA 4CZGA 1HMVA 4I2QA 4JV5K 3CPWM 1RDWX 3KWIA 5LJVA 3FE1A 4NCBA 3KTQA 5GAEP 4ILHA 2FBXA 1T05A 5FPNA 1QQOA 3MXJA 3UKUB 4GVMA 5LY3A 4FVUA 3VQ8A 3DXMB 3T1HK 2E6MA 3PV8A 1VSMA 4AILC 4FJKA 3IKMA 2VG7A 4UQGA 1L3UA 4H0OA 2YI1A 2ZF5O 4KREA 4CFBA 4CF1A 1RFQA 2Z1GA 2HHUA 4ISFA 4KFBA 2UXBK 4ID5A 4CF0A 4GMJB 3QINA 5JVHL 3AVLA 4ELUA 3KK1A 2PBDA 3QERA 4RWTA 3ALYA 1JCFA 4FJIA 1TL1A 2IVPA 3WQTA 3MCAB 1C0MA 3BGRA 3MEEA 3J81O 4ILJA 2FF3B 2OCEA 1U6ZA 1BA1A 3NF8A 3K5LA 2IDOA 4EIAA 4HCCA 2PFUA 1KRPA 1VSIA 2E2PA 1X9SA 4CZKA 3NH0A 2V7YA 5C12A 2QWOA 4FL9A
chains in the Genus database with same CATH topology
1IH7A 4FJ7A 1L3TA 4O44A 4AHCA 5J2MA 1LAWA 1N6QA 1S6PA 4BDPA 1JLBA 3K5OA 4AHUA 5KGXA 4E3SA 3KD5E 3MEDA 1FKPA 3ZT4A 4E1NA 4ID1A 3TAEA 4B9LA 1X9WA 2KTQA 3LZJA 4KPYA 3ISNC 2IC3A 2G8WA 2G8VA 1U04A 2GV9A 2HHWA 4B9UA 4ELTA 1QQCA 3L2WA 4KI4A 2FBVA 4DF8A 3DLKA 1KFSA 4FJJA 1S1TA 2BANA 4Q0BA 2HB5A 4E7IA 2HHXA 1BQMA 1RBSA 1RBRA 2X78A 4H4OA 3TR8A 2YNFA 3PX6A 4EZ6A 1YTUA 1K6YA 2KFZA 1RTIA 2OA8A 3KKRA 1SL2A 3OYHA 1U48A 5SZTA 3QIPA 3V6DA 3NDKA 1RTDA 2I5JA 2KFNA 1CLQA 3M8RA 4LH4A 1ITGA 3SQ1A 3KLHA 4DFPA 3SNNA 3VQEA 1S1UA 1WSJA 4HTUA 4EZ9A 4K8ZA 1NKBA 1KTQA 4DLEA 2HNDA 3C94A 2DTUA 3RRHA 3V1RA 4CEFA 2B6AA 4FLYA 1DLOA 3VQ9A 4ZHRA 2F8SA 4FVMA 3LAKA 4KRFA 2GUIA 4KKOA 2HHQA 4DS4A 4B08A 1S5JA 3ZSOA 2EHGA 2ETJA 1FK9A 1JLFA 4CIFA 3OYAA 2XY8A 3QETA 4OPJA 1D9FA 4M3TA 1Z25A 1N5YA 4KHQA 4DSEA 2BE2A 1U47A 3MEGA 3OYKA 3OYJA 4KI6A 1J54A 1RT5A 1I3AA 3I0RA 4FLTA 4DTSA 4FYDA 3AVCA 4N47A 4CJ4A 4LD0A 1EKEA 4CJWA 3O3FA 5C24A 1XI1A 4AHRA 2FBTA 4JLHA 2NUBA 4BDZA 3U3GA 4F4KA 4F2SA 3O3GA 1NJWA 2F8TA 4C8KA 3D45A 1CXQA 4Y1DA 3EZ5A 1RNHA 1UA1A 3OS1A 3OVNA 3UIQA 1RDBA 4CGDA 4HUEA 2Y1JA 1X9MA 2DFEA 4DSFA 4OJRA 2P1JA 5KTQA 3ZSXA 3U6FA 4Q5VA 1RT7A 3V9ZA 5J2NA 2O4IA 3DLBA 3SZ2A 3S3MA 4EP4A 3VN5A 3SUQA 3VA3A 1NK4A 2HHSA 1KSPA 2YHBA 1VSJA 4CFDA 4E7LA 1SL0A 4W5RA 3TWHA 4M3YA 4GW6A 5HRRA 4DTUA 1WSFA 4CEZA 1WAJA 1RTJA 4O5BA 5HROA 2KZMA 5KRTA 1RT4A 2ITGA 4OKKA 4CEEA 3QEIA 3NFAA 1D9DA 2PYLA 4LH5A 2XHBA 1HQEA 2X74A 2Z1HA 3HYFA 1L3VA 1QSLA 4CJRA 1UA0A 3I0SA 1ASUA 1S1XA 4FK4A 1JL1A 4DG1A 1LWFA 4W5TA 4OPKA 4DTMA 4M3ZA 4FJ8A 1Y97A 3WNHA 1JXEA 3NF7A 3LZIA 3OYMA 4MQ3A 4I9LA 3V81A 3SV3A 3AA2A 3S3OA 4E19A 2OYQA 2XY7A 1QHTA 4FM2A 1HNVA 3HVRA 3TANA 2QKBA 4B9MA 1TKZA 2OPRA 4IFVA 3ZT2A 4C8LA 2IOCA 1UWBA 4RW7A 3THVA 1T8EA 4IG3A 1TGOA 1DTQA 4OGEA 1L5UA 4EP5A 3QLHA 1S9EA 4FLWA 4M41A 3NGZA 1BCOA 3RR7A 1KCFA 4OGCA 1BIZA 3CFOA 4M45A 4AHVA 3KK3A 1BI4B 3CQ8A 3QIOA 1XHZA 5HRSA 1NK0A 4DQIA 4CGIA 3SUPA 5D3GA 3HPOA 5CZ2A 4NCGA 1VRUA 3AVBA 3T19A 1RCHA 1TK5A 4W5QA 1NOZA 3IG1A 3K5MA 4B9TA 4M3WA 1EXQA 5KRSA 3QEXA 1WNSA 3V9SA 1VSFA 2HVIA 3CM5A 1I39A 1EP4A 1WSHA 1A5VA 3AO3A 3PO5A 3DYAA 1RT3A 1GOCA 3OS0A 2XRIA 5CYQA 1RT2A 3HM9A 4DU3A 1BL3A 1JLAA 1ZBUA 4W5NA 1EX4A 4DTJA 4DMNA 4FJNA 1GOBA 4DQPA 5KI6A 3HT3A 1S6QA 3LP1A 4RG8A 4CEAA 3LPUA 4I2PA 4NYNA 3WNFA 2XO7A 3VQPA 2ZE2A 3KLEA 1Q8IA 1IO2A 3C6TA 3ZSVA 1NJXA 2RPIA 3RRGA 4KHWA 4CFCA 4J2DA 3LAMA 4CJQA 1Q9XA 4CGHA 1S1WA 1CXUA 1LWEA 3DLHA 3M8PA 2AJQA 3OYFA 4DQSA 3KLFA 3ZSZA 1JLEA 3PUFA 3H08A 3KKSA 4L8RB 4FXDA 4HCBA 1NK7A 2A1SA 4FZXC 3TAQA 5CY4A 4RW6A 4HVJA 4BDYA 4O0IA 4CK2A 1VRTA 3HK2A 2X6SA 1HPZA 4DLGA 1J5OA 2HW3A 1F21A 1B9FA 2Z1IA 2P51A 4BACA 2DFHA 4JS4A 4QOZB 4KHSA 3QNNA 4YFUA 2QKKA 3TARA 3QO9A 4QAGA 3CYMA 5HRPA 4N41A 1QSSA 3SCXA 1YVUA 3AVMA 1SKRA 1KLNA 3L2UA 4CK1A 3CG7A 2OPQA 3NAEA 4ELVA 4AHTA 1NKCA 1L3SA 1T7PA 3RMCA 1BCMA 2FC0A 1R0AA 4CJUA 1T03A 3K2PA 1ZBLA 3DRRA 2HNYA 4I7FA 4KO0A 4FK0A 2HMIA 4E1MA 4DS5A 3V4IA 4DFKA 1RT6A 3DLGA 2HVHA 1WSGA 1HYZA 3DLRA 3HVTA 4IBNA 3SJJA 4ZTJA 1MU2A 1C1AA 4DTRA 3DM2A 4N56A 4FM1A 3OYBA 4CF8A 5C42A 4LSNA 4PY5A 3ZT3A 1J9AA 4NYFA 1U45A 4FJXA 1SV5A 4OLBA 3KJVA 3ZSQA 4DSLA 4DSJA 3OJUA 3NBPA 4DFJA 3OYNA 2YKMA 1D8YA 1TAQA 1YT3A 1HQUA 4JRQA 4Z0UA 1U49A 1QTMA 4KTWA 4N76A 2KZZA 3NH2A 4R5PA 4TSXA 4DSIA 3ZT1A 3VQBA 3TAFA 3L3VA 4CEDA 4CGFA 1IKXA 3NF6A 4AHSA 1NOYA 4FLZA 1GOAA 3AVKA 1VSHA 4M3XA 2WONA 3OYGA 4PUOA 2OPPA 4PA1A 3P1GA 3PX0A 4KTQA 2BDPA 1WSEA 4O0JA 4FW2A 3HP9A 3M8QA 5KGWA 4JS5A 1NJYA 1ZBHA 2ZQBA 2KQ2A 4KV8A 3VA0A 4CJ5A 3AVFA 4CJ3A 4CHQA 1TL3A 3AO5A 3F9KA 1LW0A 3NF9A 4LY7A 2QK9A 4BE2A 1CZ9A 3P83D 3B6OA 5DK5A 3M8SA 3L8BA 4DU4A 5FRNA 2HNZA 4BWJA 4KB1A 1C1BA 3AA5X 3NE6A 4DQRA 2RKIA 3NHGA 4CHPA 5EU7A 2IS3A 1VSEA 4CEBA 1B9DA 3JSMA 2G8KA 1IKWA 1TAUA 3L2RA 3RMBA 4PWDA 3NGYA 4MFBA 1FXXA 4IKFA 1RTHA 1LV5A 3QEPA 3VQ5A 4CECA 1RDDA 5T7BA 3OS2A 2IAJA 5HBMA 1ZBIA 2P5OA 2PY5A 1U4BA 1B92A 3HO1A 2YKNA 1TK0A 4J2AA 4Z4CA 4CHYA 4XIUA 1ZYQA 4K8XA 5E41A 3RWUA 1Z26A 3DRSA 1C0TA 1DTTA 4FJHA 1BIUA 1VK0A 3AV9A 4HUGA 1NJZA 4KHNA 1SUQA 3AA4A 3JYTA 2VG6A 3V1QA 4FLVA 3S9HA 1LWCA 4FZYA 1HRHA 1S9GA 1LW2A 3MECA 4IFYA 1UOCA 4C8OA 4Z4FA 1XC9A 5SWMA 2PYJA 4B9SA 4Z4EA 5FROA 3AVIA 1D5AA 3RR8A 3BDPA 2YHAA 4F3TA 2Z1JA 4CIEA 2G8HA 4FLUA 2E4LA 2QXFA 2RF2A 3IS9A 3RTVA 3DRPA 3ZT0A 2BGGA 1TVRA 4Y1CA 5HP1A 2YV0X 4KAZA 4DSKA 2G8UA 2LSNA 3TABA 2W42A 3WNGA 2VWKA 4CE9A 1CZBA 1C0UA 4E7JA 3V9WA 5J2QA 3VQ7A 4KHYA 1HJRA 5JS2A 3LALA 4ICLA 4H8KA 1QS4A 3TAMA 3OYEA 3OJSA 1S1VA 2XY5A 2OPSA 3EY1A 2B5JA 3TAPA 4FK2A 3AVHA 3ZSWA 1HYSA 3V1OA 2VG5A 4CHOA 4QCLA 3F73A 4HUFA 4FLXA 1KFDA 4OKJA 1IKVA 4BWMA 1ASWA 3OYLA 4CEOA 3KLGA 4DF4A 3NCIA 5JS1A 2PZSA 4F3OA 1C1CA 3OYCA 3CM6A 1ASVA 3ITHA 1NK8A 2O4GA 3SI6A 4DWIA 3QESA 1SL1A 3PY8A 1JXBA 4FJLA 1G15A 4DQQA 3ASMA 3PO4A 3ZCMA 4CGGA 4DTXA 3AVGA 1FKOA 3FFIA 3LP0A 4G1QA 4M42A 3OYIA 5I42A 3HL8A 3T3FA 1IG9A 1NKEA 3LANA 3QEVA 1SKSA 5FRMA 4DFMA 3AO2A 3L2QA 5J1EA 4CCHA 4FJ9A 1SKWA 5HLFA 4AH9A 4KHUA 4FZZA 3HPGA 3EYZA 1KVAA 1JL2A 4CJTA 4RW9A 1IKYA 3HP6A 3SQ0A 4E7HA 2A1RA 1RBTA 1TK8A 4DU1A 3KK2A 4OKEA 4FW1A 5I3UA 2X6NA 4N5SA 5C25A 2B4JA 4O4GA 3OY9A 4FJMA 1WN7A 4CJVA 1HNIA 4JRPA 4E0DA 3AVJA 4RW4A 4CHZA 4CF2A 4CIGA 3DOKA 1REVA 4IDKA 5HRNA 3K5NA 4DTPA 3S3NA 3E01A 4KB0A 3B6PA 3RMDA 3SQ2A 3K58A 1BISA 3OYDA 3SYZA 3KD1E 4CESA 1BI4A 1TKXA 3VQAA 3ZSRA 5CYMA 4CJEA 3KIOA 3AO1A 3WNEA 2XY6A 1RDCA 1RT1A 1LAVA 3T1AA 4BE1A 1KVCA 1TKDA 1X1PA 5FDLA 4B8AB 3IAYA 2YNGA 4PQUA 3DLEA 2E6LA 3LWMA 4Z4GA 4FJ5A 4C8NA 3D0PA 3L3UA 4LSLA 3O4NA 1JLQA 3NH1A 2RN2A 3SPYA 1W0HA 4CJFA 3K59A 1QE1A 5K14A 2YNIA 1KVBA 5CZ1A 3LDSA 1WAFA 5DMRA 4CJPA 3LP2A 2F96A 3QNOA 3ZSYA 3AA3A 3QEWA 2G8FA 1Q9YA 3TI0A 3SV4A 4CK3A 4CHNA 1BQNA 3AO4A 1TKTA 1ZBFA 4OVLA 3NGIA 1XWLA 1VSLA 3HJFA 1J53A 3A2FA 3HPHA 2OZMA 1JKHA 1HYVA 4CERA 3I8DA 3DI6A 4B9VA 1RILA 2G8IA 2GBZA 2D0CA 1RBUA 3O4QA 1JLGA 4B9NA 4CGJA 3IRXA 4J2BA 4CEQA 3O3HA 3SUNA 4J2EA 3MXIA 3AVNA 4F2RA 3SQ4A 3V9XA 1HMVA 4I2QA 2JGUA 4OLAA 2OZSA 4M3RA 4HHTA 2YNHA 4B3OA 4FM0A 1NK5A 4M3UA 1RDAA 4NCBA 1KLMA 3ULDA 5J2PA 3MXMA 2HHTA 3KTQA 1UAXA 2IGIA 2FBXA 4C8MA 4YNQA 1A5WA 4Z4HA 3HXMA 4ZTFA 1T05A 2P5GA 4CJSA 2R7YA 3MXJA 2EX3A 3C95A 4GVMA 2DY4A 2KW4A 1TV6A 4CJKA 3VQ8A 2E6MA 3PX4A 3PV8A 1VSMA 1VSKA 4AILC 1NK9A 2VWJA 4DTOA 1A5XA 3SUOA 3HSTB 4W5OA 4FJKA 4CF9A 1QSYA 2VG7A 4UQGA 2Y1IA 1L3UA 4KTZA 3CFRA 2D5RA 2D0AA 1RBVA 3U3YA 4CFAA 4KREA 1O1WA 4H4MA 4CFBA 2WOMA 4O55A 4CF1A 2Z1GA 2D0BA 3VQDA 2HHUA 2JLEA 3V9UA 3L2VA 3K57A 4KFBA 4ID5A 4CF0A 1NK6A 3VQCA 2Q3SA 4GMJB 4F8RA 3QINA 4E89A 3AVLA 4ELUA 4DTNA 1EETA 4E7KA 3KK1A 3DOLA 3VQ6A 4CJLA 3LWLA 3QERA 1BHLA 3TAGA 3ALYA 3VQ4A 4FJIA 1TL1A 2HHVA 1BGXT 4BE0A 1C0MA 3BGRA 3MEEA 1W9HA 3C6UA 3AVAA 3VQQA 1WLJA 3NF8A 1WSIA 1C6VA 1YTAA 3K5LA 4I9QA 4WE1A 4Z4IA 1JLCA 3DMJA 3G10A 3P5JA 4B8CA 2IDOA 4HCCA 1VSDA 1XHXA 1KRPA 3KLIA 3SPZA 3RMAA 4RW8A 3MAQA 3LPTA 1VSIA 2DFFA 4FJGA 4NCAA 1X9SA 2ATQA 3NH0A 3CFPA 3G0ZA 2FBYA 4FCYA 2ZD1A 3LP3A 4IG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IH7 A;  4FJ7 A;  1L3T A;  4O44 A;  4AHC A;  5J2M A;  1LAW A;  1N6Q A;  1S6P A;  4BDP A;  1JLB A;  3K5O A;  4AHU A;  5KGX A;  4E3S A;  3KD5 E;  3MED A;  1FKP A;  3ZT4 A;  4E1N A;  4ID1 A;  3TAE A;  4B9L A;  1X9W A;  2KTQ A;  3LZJ A;  4KPY A;  3ISN C;  2IC3 A;  2G8W A;  2G8V A;  1U04 A;  2GV9 A;  2HHW A;  4B9U A;  4ELT A;  1QQC A;  3L2W A;  4KI4 A;  2FBV A;  4DF8 A;  3DLK A;  1KFS A;  4FJJ A;  1S1T A;  2BAN A;  4Q0B A;  2HB5 A;  4E7I A;  2HHX A;  1BQM A;  1RBS A;  1RBR A;  2X78 A;  4H4O A;  3TR8 A;  2YNF A;  3PX6 A;  4EZ6 A;  1YTU A;  1K6Y A;  2KFZ A;  1RTI A;  2OA8 A;  3KKR A;  1SL2 A;  3OYH A;  1U48 A;  5SZT A;  3QIP A;  3V6D A;  3NDK A;  1RTD A;  2I5J A;  2KFN A;  1CLQ A;  3M8R A;  4LH4 A;  1ITG A;  3SQ1 A;  3KLH A;  4DFP A;  3SNN A;  3VQE A;  1S1U A;  1WSJ A;  4HTU A;  4EZ9 A;  4K8Z A;  1NKB A;  1KTQ A;  4DLE A;  2HND A;  3C94 A;  2DTU A;  3RRH A;  3V1R A;  4CEF A;  2B6A A;  4FLY A;  1DLO A;  3VQ9 A;  4ZHR A;  2F8S A;  4FVM A;  3LAK A;  4KRF A;  2GUI A;  4KKO A;  2HHQ A;  4DS4 A;  4B08 A;  1S5J A;  3ZSO A;  2EHG A;  2ETJ A;  1FK9 A;  1JLF A;  4CIF A;  3OYA A;  2XY8 A;  3QET A;  4OPJ A;  1D9F A;  4M3T A;  1Z25 A;  1N5Y A;  4KHQ A;  4DSE A;  2BE2 A;  1U47 A;  3MEG A;  3OYK A;  3OYJ A;  4KI6 A;  1J54 A;  1RT5 A;  1I3A A;  3I0R A;  4FLT A;  4DTS A;  4FYD A;  3AVC A;  4N47 A;  4CJ4 A;  4LD0 A;  1EKE A;  4CJW A;  3O3F A;  5C24 A;  1XI1 A;  4AHR A;  2FBT A;  4JLH A;  2NUB A;  4BDZ A;  3U3G A;  4F4K A;  4F2S A;  3O3G A;  1NJW A;  2F8T A;  4C8K A;  3D45 A;  1CXQ A;  4Y1D A;  3EZ5 A;  1RNH A;  1UA1 A;  3OS1 A;  3OVN A;  3UIQ A;  1RDB A;  4CGD A;  4HUE A;  2Y1J A;  1X9M A;  2DFE A;  4DSF A;  4OJR A;  2P1J A;  5KTQ A;  3ZSX A;  3U6F A;  4Q5V A;  1RT7 A;  3V9Z A;  5J2N A;  2O4I A;  3DLB A;  3SZ2 A;  3S3M A;  4EP4 A;  3VN5 A;  3SUQ A;  3VA3 A;  1NK4 A;  2HHS A;  1KSP A;  2YHB A;  1VSJ A;  4CFD A;  4E7L A;  1SL0 A;  4W5R A;  3TWH A;  4M3Y A;  4GW6 A;  5HRR A;  4DTU A;  1WSF A;  4CEZ A;  1WAJ A;  1RTJ A;  4O5B A;  5HRO A;  2KZM A;  5KRT A;  1RT4 A;  2ITG A;  4OKK A;  4CEE A;  3QEI A;  3NFA A;  1D9D A;  2PYL A;  4LH5 A;  2XHB A;  1HQE A;  2X74 A;  2Z1H A;  3HYF A;  1L3V A;  1QSL A;  4CJR A;  1UA0 A;  3I0S A;  1ASU A;  1S1X A;  4FK4 A;  1JL1 A;  4DG1 A;  1LWF A;  4W5T A;  4OPK A;  4DTM A;  4M3Z A;  4FJ8 A;  1Y97 A;  3WNH A;  1JXE A;  3NF7 A;  3LZI A;  3OYM A;  4MQ3 A;  4I9L A;  3V81 A;  3SV3 A;  3AA2 A;  3S3O A;  4E19 A;  2OYQ A;  2XY7 A;  1QHT A;  4FM2 A;  1HNV A;  3HVR A;  3TAN A;  2QKB A;  4B9M A;  1TKZ A;  2OPR A;  4IFV A;  3ZT2 A;  4C8L A;  2IOC A;  1UWB A;  4RW7 A;  3THV A;  1T8E A;  4IG3 A;  1TGO A;  1DTQ A;  4OGE A;  1L5U A;  4EP5 A;  3QLH A;  1S9E A;  4FLW A;  4M41 A;  3NGZ A;  1BCO A;  3RR7 A;  1KCF A;  4OGC A;  1BIZ A;  3CFO A;  4M45 A;  4AHV A;  3KK3 A;  1BI4 B;  3CQ8 A;  3QIO A;  1XHZ A;  5HRS A;  1NK0 A;  4DQI A;  4CGI A;  3SUP A;  5D3G A;  3HPO A;  5CZ2 A;  4NCG A;  1VRU A;  3AVB A;  3T19 A;  1RCH A;  1TK5 A;  4W5Q A;  1NOZ A;  3IG1 A;  3K5M A;  4B9T A;  4M3W A;  1EXQ A;  5KRS A;  3QEX A;  1WNS A;  3V9S A;  1VSF A;  2HVI A;  3CM5 A;  1I39 A;  1EP4 A;  1WSH A;  1A5V A;  3AO3 A;  3PO5 A;  3DYA A;  1RT3 A;  1GOC A;  3OS0 A;  2XRI A;  5CYQ A;  1RT2 A;  3HM9 A;  4DU3 A;  1BL3 A;  1JLA A;  1ZBU A;  4W5N A;  1EX4 A;  4DTJ A;  4DMN A;  4FJN A;  1GOB A;  4DQP A;  5KI6 A;  3HT3 A;  1S6Q A;  3LP1 A;  4RG8 A;  4CEA A;  3LPU A;  4I2P A;  4NYN A;  3WNF A;  2XO7 A;  3VQP A;  2ZE2 A;  3KLE A;  1Q8I A;  1IO2 A;  3C6T A;  3ZSV A;  1NJX A;  2RPI A;  3RRG A;  4KHW A;  4CFC A;  4J2D A;  3LAM A;  4CJQ A;  1Q9X A;  4CGH A;  1S1W A;  1CXU A;  1LWE A;  3DLH A;  3M8P A;  2AJQ A;  3OYF A;  4DQS A;  3KLF A;  3ZSZ A;  1JLE A;  3PUF A;  3H08 A;  3KKS A;  4L8R B;  4FXD A;  4HCB A;  1NK7 A;  2A1S A;  4FZX C;  3TAQ A;  5CY4 A;  4RW6 A;  4HVJ A;  4BDY A;  4O0I A;  4CK2 A;  1VRT A;  3HK2 A;  2X6S A;  1HPZ A;  4DLG A;  1J5O A;  2HW3 A;  1F21 A;  1B9F A;  2Z1I A;  2P51 A;  4BAC A;  2DFH A;  4JS4 A;  4QOZ B;  4KHS A;  3QNN A;  4YFU A;  2QKK A;  3TAR A;  3QO9 A;  4QAG A;  3CYM A;  5HRP A;  4N41 A;  1QSS A;  3SCX A;  1YVU A;  3AVM A;  1SKR A;  1KLN A;  3L2U A;  4CK1 A;  3CG7 A;  2OPQ A;  3NAE A;  4ELV A;  4AHT A;  1NKC A;  1L3S A;  1T7P A;  3RMC A;  1BCM A;  2FC0 A;  1R0A A;  4CJU A;  1T03 A;  3K2P A;  1ZBL A;  3DRR A;  2HNY A;  4I7F A;  4KO0 A;  4FK0 A;  2HMI A;  4E1M A;  4DS5 A;  3V4I A;  4DFK A;  1RT6 A;  3DLG A;  2HVH A;  1WSG A;  1HYZ A;  3DLR A;  3HVT A;  4IBN A;  3SJJ A;  4ZTJ A;  1MU2 A;  1C1A A;  4DTR A;  3DM2 A;  4N56 A;  4FM1 A;  3OYB A;  4CF8 A;  5C42 A;  4LSN A;  4PY5 A;  3ZT3 A;  1J9A A;  4NYF A;  1U45 A;  4FJX A;  1SV5 A;  4OLB A;  3KJV A;  3ZSQ A;  4DSL A;  4DSJ A;  3OJU A;  3NBP A;  4DFJ A;  3OYN A;  2YKM A;  1D8Y A;  1TAQ A;  1YT3 A;  1HQU A;  4JRQ A;  4Z0U A;  1U49 A;  1QTM A;  4KTW A;  4N76 A;  2KZZ A;  3NH2 A;  4R5P A;  4TSX A;  4DSI A;  3ZT1 A;  3VQB A;  3TAF A;  3L3V A;  4CED A;  4CGF A;  1IKX A;  3NF6 A;  4AHS A;  1NOY A;  4FLZ A;  1GOA A;  3AVK A;  1VSH A;  4M3X A;  2WON A;  3OYG A;  4PUO A;  2OPP A;  4PA1 A;  3P1G A;  3PX0 A;  4KTQ A;  2BDP A;  1WSE A;  4O0J A;  4FW2 A;  3HP9 A;  3M8Q A;  5KGW A;  4JS5 A;  1NJY A;  1ZBH A;  2ZQB A;  2KQ2 A;  4KV8 A;  3VA0 A;  4CJ5 A;  3AVF A;  4CJ3 A;  4CHQ A;  1TL3 A;  3AO5 A;  3F9K A;  1LW0 A;  3NF9 A;  4LY7 A;  2QK9 A;  4BE2 A;  1CZ9 A;  3P83 D;  3B6O A;  5DK5 A;  3M8S A;  3L8B A;  4DU4 A;  5FRN A;  2HNZ A;  4BWJ A;  4KB1 A;  1C1B A;  3AA5 X;  3NE6 A;  4DQR A;  2RKI A;  3NHG A;  4CHP A;  5EU7 A;  2IS3 A;  1VSE A;  4CEB A;  1B9D A;  3JSM A;  2G8K A;  1IKW A;  1TAU A;  3L2R A;  3RMB A;  4PWD A;  3NGY A;  4MFB A;  1FXX A;  4IKF A;  1RTH A;  1LV5 A;  3QEP A;  3VQ5 A;  4CEC A;  1RDD A;  5T7B A;  3OS2 A;  2IAJ A;  5HBM A;  1ZBI A;  2P5O A;  2PY5 A;  1U4B A;  1B92 A;  3HO1 A;  2YKN A;  1TK0 A;  4J2A A;  4Z4C A;  4CHY A;  4XIU A;  1ZYQ A;  4K8X A;  5E41 A;  3RWU A;  1Z26 A;  3DRS A;  1C0T A;  1DTT A;  4FJH A;  1BIU A;  1VK0 A;  3AV9 A;  4HUG A;  1NJZ A;  4KHN A;  1SUQ A;  3AA4 A;  3JYT A;  2VG6 A;  3V1Q A;  4FLV A;  3S9H A;  1LWC A;  4FZY A;  1HRH A;  1S9G A;  1LW2 A;  3MEC A;  4IFY A;  1UOC A;  4C8O A;  4Z4F A;  1XC9 A;  5SWM A;  2PYJ A;  4B9S A;  4Z4E A;  5FRO A;  3AVI A;  1D5A A;  3RR8 A;  3BDP A;  2YHA A;  4F3T A;  2Z1J A;  4CIE A;  2G8H A;  4FLU A;  2E4L A;  2QXF A;  2RF2 A;  3IS9 A;  3RTV A;  3DRP A;  3ZT0 A;  2BGG A;  1TVR A;  4Y1C A;  5HP1 A;  2YV0 X;  4KAZ A;  4DSK A;  2G8U A;  2LSN A;  3TAB A;  2W42 A;  3WNG A;  2VWK A;  4CE9 A;  1CZB A;  1C0U A;  4E7J A;  3V9W A;  5J2Q A;  3VQ7 A;  4KHY A;  1HJR A;  5JS2 A;  3LAL A;  4ICL A;  4H8K A;  1QS4 A;  3TAM A;  3OYE A;  3OJS A;  1S1V A;  2XY5 A;  2OPS A;  3EY1 A;  2B5J A;  3TAP A;  4FK2 A;  3AVH A;  3ZSW A;  1HYS A;  3V1O A;  2VG5 A;  4CHO A;  4QCL A;  3F73 A;  4HUF A;  4FLX A;  1KFD A;  4OKJ A;  1IKV A;  4BWM A;  1ASW A;  3OYL A;  4CEO A;  3KLG A;  4DF4 A;  3NCI A;  5JS1 A;  2PZS A;  4F3O A;  1C1C A;  3OYC A;  3CM6 A;  1ASV A;  3ITH A;  1NK8 A;  2O4G A;  3SI6 A;  4DWI A;  3QES A;  1SL1 A;  3PY8 A;  1JXB A;  4FJL A;  1G15 A;  4DQQ A;  3ASM A;  3PO4 A;  3ZCM A;  4CGG A;  4DTX A;  3AVG A;  1FKO A;  3FFI A;  3LP0 A;  4G1Q A;  4M42 A;  3OYI A;  5I42 A;  3HL8 A;  3T3F A;  1IG9 A;  1NKE A;  3LAN A;  3QEV A;  1SKS A;  5FRM A;  4DFM A;  3AO2 A;  3L2Q A;  5J1E A;  4CCH A;  4FJ9 A;  1SKW A;  5HLF A;  4AH9 A;  4KHU A;  4FZZ A;  3HPG A;  3EYZ A;  1KVA A;  1JL2 A;  4CJT A;  4RW9 A;  1IKY A;  3HP6 A;  3SQ0 A;  4E7H A;  2A1R A;  1RBT A;  1TK8 A;  4DU1 A;  3KK2 A;  4OKE A;  4FW1 A;  5I3U A;  2X6N A;  4N5S A;  5C25 A;  2B4J A;  4O4G A;  3OY9 A;  4FJM A;  1WN7 A;  4CJV A;  1HNI A;  4JRP A;  4E0D A;  3AVJ A;  4RW4 A;  4CHZ A;  4CF2 A;  4CIG A;  3DOK A;  1REV A;  4IDK A;  5HRN A;  3K5N A;  4DTP A;  3S3N A;  3E01 A;  4KB0 A;  3B6P A;  3RMD A;  3SQ2 A;  3K58 A;  1BIS A;  3OYD A;  3SYZ A;  3KD1 E;  4CES A;  1BI4 A;  1TKX A;  3VQA A;  3ZSR A;  5CYM A;  4CJE A;  3KIO A;  3AO1 A;  3WNE A;  2XY6 A;  1RDC A;  1RT1 A;  1LAV A;  3T1A A;  4BE1 A;  1KVC A;  1TKD A;  1X1P A;  5FDL A;  4B8A B;  3IAY A;  2YNG A;  4PQU A;  3DLE A;  2E6L A;  3LWM A;  4Z4G A;  4FJ5 A;  4C8N A;  3D0P A;  3L3U A;  4LSL A;  3O4N A;  1JLQ A;  3NH1 A;  2RN2 A;  3SPY A;  1W0H A;  4CJF A;  3K59 A;  1QE1 A;  5K14 A;  2YNI A;  1KVB A;  5CZ1 A;  3LDS A;  1WAF A;  5DMR A;  4CJP A;  3LP2 A;  2F96 A;  3QNO A;  3ZSY A;  3AA3 A;  3QEW A;  2G8F A;  1Q9Y A;  3TI0 A;  3SV4 A;  4CK3 A;  4CHN A;  1BQN A;  3AO4 A;  1TKT A;  1ZBF A;  4OVL A;  3NGI A;  1XWL A;  1VSL A;  3HJF A;  1J53 A;  3A2F A;  3HPH A;  2OZM A;  1JKH A;  1HYV A;  4CER A;  3I8D A;  3DI6 A;  4B9V A;  1RIL A;  2G8I A;  2GBZ A;  2D0C A;  1RBU A;  3O4Q A;  1JLG A;  4B9N A;  4CGJ A;  3IRX A;  4J2B A;  4CEQ A;  3O3H A;  3SUN A;  4J2E A;  3MXI A;  3AVN A;  4F2R A;  3SQ4 A;  3V9X A;  1HMV A;  4I2Q A;  2JGU A;  4OLA A;  2OZS A;  4M3R A;  4HHT A;  2YNH A;  4B3O A;  4FM0 A;  1NK5 A;  4M3U A;  1RDA A;  4NCB A;  1KLM A;  3ULD A;  5J2P A;  3MXM A;  2HHT A;  3KTQ A;  1UAX A;  2IGI A;  2FBX A;  4C8M A;  4YNQ A;  1A5W A;  4Z4H A;  3HXM A;  4ZTF A;  1T05 A;  2P5G A;  4CJS A;  2R7Y A;  3MXJ A;  2EX3 A;  3C95 A;  4GVM A;  2DY4 A;  2KW4 A;  1TV6 A;  4CJK A;  3VQ8 A;  2E6M A;  3PX4 A;  3PV8 A;  1VSM A;  1VSK A;  4AIL C;  1NK9 A;  2VWJ A;  4DTO A;  1A5X A;  3SUO A;  3HST B;  4W5O A;  4FJK A;  4CF9 A;  1QSY A;  2VG7 A;  4UQG A;  2Y1I A;  1L3U A;  4KTZ A;  3CFR A;  2D5R A;  2D0A A;  1RBV A;  3U3Y A;  4CFA A;  4KRE A;  1O1W A;  4H4M A;  4CFB A;  2WOM A;  4O55 A;  4CF1 A;  2Z1G A;  2D0B A;  3VQD A;  2HHU A;  2JLE A;  3V9U A;  3L2V A;  3K57 A;  4KFB A;  4ID5 A;  4CF0 A;  1NK6 A;  3VQC A;  2Q3S A;  4GMJ B;  4F8R A;  3QIN A;  4E89 A;  3AVL A;  4ELU A;  4DTN A;  1EET A;  4E7K A;  3KK1 A;  3DOL A;  3VQ6 A;  4CJL A;  3LWL A;  3QER A;  1BHL A;  3TAG A;  3ALY A;  3VQ4 A;  4FJI A;  1TL1 A;  2HHV A;  1BGX T;  4BE0 A;  1C0M A;  3BGR A;  3MEE A;  1W9H A;  3C6U A;  3AVA A;  3VQQ A;  1WLJ A;  3NF8 A;  1WSI A;  1C6V A;  1YTA A;  3K5L A;  4I9Q A;  4WE1 A;  4Z4I A;  1JLC A;  3DMJ A;  3G10 A;  3P5J A;  4B8C A;  2IDO A;  4HCC A;  1VSD A;  1XHX A;  1KRP A;  3KLI A;  3SPZ A;  3RMA A;  4RW8 A;  3MAQ A;  3LPT A;  1VSI A;  2DFF A;  4FJG A;  4NCA A;  1X9S A;  2ATQ A;  3NH0 A;  3CFP A;  3G0Z A;  2FBY A;  4FCY A;  2ZD1 A;  3LP3 A;  4IG0 A; 
#chains in the Genus database with same CATH topology
 2E2Q A;  1YF5 L;  5M1F A;  1BUP A;  4O44 A;  4YY3 K;  5AQN A;  1LCU A;  2P9L B;  4CVN E;  3KD5 E;  4E1N A;  3TAE A;  3TTF A;  4B9L A;  3R3L A;  3LZJ A;  4KPY A;  3ISN C;  1WOQ A;  4B9U A;  3BZC A;  3MWT A;  2FBV A;  4FJJ A;  3AAP A;  1S1T A;  3ENO A;  4Q0B A;  2HHX A;  4JI8 K;  1XC3 A;  4X65 K;  1YTU A;  1YI2 N;  4JKA A;  4DCH A;  1SL2 A;  4RTF D;  2ZJP L;  1U48 A;  3GE1 A;  4WQ4 C;  3TTC A;  1ITG A;  4EZ9 A;  4DFP A;  3A5O C;  1S1U A;  1WSJ A;  4JD2 B;  3ZET A;  3VGM A;  4CZI A;  2DTU A;  4DKW A;  2B6A A;  2I7N A;  4B9Q A;  4FLY A;  3ZX0 A;  3VQ9 A;  4ZHR A;  2F8S A;  4KRF A;  4KKO A;  2HBJ A;  4DS4 A;  2ZJQ L;  4B08 A;  1S5J A;  3OYA A;  3QET A;  1JLF A;  4CIF A;  1D9F A;  2OYQ A;  1KD1 O;  1Z25 A;  1VQ7 N;  2VGN A;  1N5Y A;  1VQ9 N;  3Q7C A;  2QWP A;  4BC3 A;  2F7T A;  5M1N A;  2QWR A;  1J54 A;  1QVF M;  5BPM A;  3I0R A;  1EKE A;  3W0L A;  3FZF A;  4QS7 A;  2QA4 N;  4IJN A;  5C24 A;  1XI1 A;  3NMU A;  3ZX2 A;  2NRT A;  5CHI A;  3O3G A;  1NJW A;  1NGE A;  2QWN A;  2O8F A;  1N34 K;  4C8K A;  3O5B A;  1UA1 A;  3OS1 A;  3OVN A;  1X9M A;  2Y1J A;  4OJR A;  2ITM A;  3EKS A;  5GIN A;  3ZSX A;  3U6F A;  4Q5V A;  5J2N A;  5KPZ A;  4K0K K;  3DLB A;  3S3M A;  4EP4 A;  1NK4 A;  2HHS A;  4BRL A;  4JK8 A;  2O8C A;  4JKC A;  4M3Y A;  1YXQ A;  4DTU A;  1VQP N;  1WAJ A;  1DKG D;  4CD3 A;  4IFE A;  1RT4 A;  4CEE A;  1D9D A;  2PYL A;  2XHB A;  2Z1H A;  2X74 A;  4O8K A;  1S1X A;  3VOV A;  1LWF A;  4CI6 A;  1Y97 A;  3RSE B;  3NF7 A;  4E19 A;  2GTD A;  1QHT A;  2QKB A;  3HVR A;  5AQT A;  3UKR B;  3ZT2 A;  1I94 K;  3THV A;  3A5M C;  4IG3 A;  3BZK A;  1DTQ A;  3IFR A;  4EP5 A;  4MO4 A;  1KCF A;  3I8B A;  3MDQ A;  4FO0 A;  1NK0 A;  1GLA G;  1BI4 B;  3QIO A;  2NNW A;  5TKW A;  4DQI A;  3HPO A;  5CZ2 A;  4NCG A;  1VRU A;  3VF4 A;  3T19 A;  1RCH A;  3IG1 A;  4JI2 K;  1WNS A;  3CM5 A;  1I39 A;  1EP4 A;  5AQX A;  3VEN A;  1GOC A;  1JLA A;  1ZBU A;  1EX4 A;  4IWV A;  4YOT A;  5KI6 A;  3HT3 A;  1S6Q A;  4B3M K;  4CEA A;  1X3M A;  4I2P A;  3KLE A;  1NGF A;  3C6T A;  1NJX A;  2RPI A;  3RRG A;  4PKG A;  4AF1 A;  4J2D A;  3CET A;  4CGH A;  1BOT O;  1S1W A;  3DLH A;  3L0Q A;  4JI3 K;  3OYF A;  4DV4 K;  4DQS A;  3ZSZ A;  3PUF A;  4L8R B;  4HCB A;  2A1S A;  3TAQ A;  3HK2 A;  1HPZ A;  1J5O A;  1F21 A;  1B9F A;  4QOZ B;  3FZL A;  3QIC A;  2QKK A;  3AVM A;  4CK1 A;  3CG7 A;  4A2A A;  2OPQ A;  3MX2 A;  1HJO A;  3RMC A;  2FC0 A;  1KAX A;  3ZX3 A;  4KO0 A;  1XNR K;  2HVH A;  1RT6 A;  1FJG K;  3HSC A;  4WQ5 C;  3O6W A;  1J9A A;  2DPN A;  4NYF A;  3U4L A;  3O9U A;  4FJX A;  4OLB A;  3ZSQ A;  4LF8 K;  3OJU A;  5AQO A;  2HHH K;  1D8Y A;  4JRQ A;  1U49 A;  5F1X A;  4TSX A;  4GKJ K;  1J5E K;  1G99 A;  3D7E O;  3L3V A;  5GAD P;  3NF6 A;  3PIP L;  2BTF A;  3OHR A;  3BF3 A;  3VET A;  3OYG A;  3B8A X;  4PA1 A;  3P1G A;  1WSE A;  4FW2 A;  3HP9 A;  1ZBH A;  2ZQB A;  4KV8 A;  3AVF A;  4HTL A;  4CHQ A;  3CCU N;  1IBK K;  3NF9 A;  4LY7 A;  2Q31 A;  3M8S A;  3B6O A;  4FOE A;  1W7A A;  3NE6 A;  3NHG A;  3L4Q A;  5EU7 A;  5LJW A;  3RMB A;  4PWD A;  3NGY A;  4MFB A;  4IKF A;  1YJN N;  3S41 A;  1N8R O;  3VQ5 A;  4CEC A;  2IAJ A;  2P5O A;  3O9S A;  1BU6 O;  3HO1 A;  3NVK A;  3WXK A;  1Z26 A;  4FJH A;  1DTT A;  2V52 B;  1K73 O;  4NB4 A;  3JYT A;  4FZY A;  1HRH A;  1LW2 A;  3MEC A;  1XC9 A;  2PYJ A;  1KXP A;  1D5A A;  4DB3 A;  2Z1J A;  4CIE A;  2RF2 A;  3IS9 A;  1OH6 A;  3M5R A;  3DRP A;  2BGG A;  2YV0 X;  1OH7 A;  4DSK A;  3VPZ A;  2LSN A;  3TAB A;  2HMP A;  2VWK A;  3CJ7 A;  1CZB A;  1C0U A;  4CBX A;  4CE9 A;  2NRX A;  5J2Q A;  3CCL N;  3VEY A;  3TAM A;  3OYE A;  3E66 A;  3VER A;  1EWR A;  2B5J A;  3TAP A;  4QCL A;  4BWM A;  1IKV A;  3OYL A;  1ASW A;  3KLG A;  4PL8 A;  3NCI A;  3CM6 A;  1ASV A;  1SL1 A;  2O8C B;  3PO4 A;  4CGG A;  3H3N O;  4DTX A;  2QTD A;  3FFI A;  1S72 N;  4M42 A;  5M1Q A;  3OYI A;  1IG9 A;  3LAN A;  5FRM A;  3AO2 A;  1Q7Y O;  1SKW A;  3CME N;  4DR7 K;  3EYZ A;  3MX5 A;  3CJB A;  1KVA A;  4GKK K;  3MN9 A;  3TSQ A;  4DU1 A;  3KK2 A;  2HF3 A;  4OKE A;  3WT0 A;  1TUU A;  4QS8 A;  2NLX A;  4CHZ A;  3DOK A;  1RDU A;  4BGA A;  4GY2 B;  3EZW A;  3QML A;  2YJF A;  5JMV A;  3FZK A;  1TKX A;  3WNE A;  4BE1 A;  4B8A B;  3IAY A;  2YNG A;  3E9O A;  2E6L A;  4C8N A;  3SPY A;  3WEE A;  5K14 A;  4YOX A;  1WAF A;  1SAZ A;  4CJP A;  3LP2 A;  1NM1 A;  4M7X A;  3J8A A;  4BRP A;  1TKT A;  3SAH A;  3A2F A;  3HPH A;  3J80 O;  2OZM A;  1HYV A;  4CER A;  4B9V A;  5BPN A;  4B9N A;  1JLG A;  2JWK A;  3QFP A;  3O3H A;  3SUN A;  4F2R A;  3A0I X;  4A5A A;  3V9X A;  1YAG A;  3SQ4 A;  2QEX N;  2OZS A;  4HHT A;  2YNH A;  4FM0 A;  1NK5 A;  1TUY A;  1UAX A;  4C8M A;  4CZJ A;  2D0O A;  4H5N A;  5KQD A;  1K8K A;  3PX4 A;  4WFB L;  1VQO N;  1QSY A;  4H5T A;  2F9T A;  4H5V A;  4I6M A;  3R8E A;  4KTZ A;  4BRM A;  4X66 K;  2D0A A;  1RBV A;  2E1Z A;  3U3Y A;  4CFA A;  3VGL A;  4H4M A;  4J8F A;  2D0B A;  3L2V A;  3ZYY X;  4DQ8 A;  1S3X A;  2QWM A;  4E89 A;  3CJ9 A;  5BRD A;  3LWL A;  3VQ6 A;  3CCM N;  4UY8 O;  1BHL A;  5CR4 A;  3VQ4 A;  5IT9 O;  4BRC A;  3AVA A;  3VQQ A;  1SZ2 A;  4QS9 A;  4Z4I A;  5LL6 Z;  4BQL A;  1NGJ A;  3IDH A;  3ZEU A;  3RMA A;  2YX6 A;  3LPT A;  4MDA A;  1NGD A;  2ATQ A;  3G0Z A;  2FBY A;  2ZD1 A;  2KQ2 A;  1H1V A;  1IH7 A;  1WB9 A;  4AHC A;  5J2M A;  2NRH A;  4BDP A;  5GIO A;  4AHU A;  1ZC6 A;  3MED A;  1FKP A;  1X9W A;  2P9K A;  3LDL A;  4DR3 K;  2G8V A;  2GV9 A;  2HHW A;  3L2W A;  2BAN A;  4E7I A;  4FWM A;  3TR8 A;  1RBR A;  2X78 A;  4H4O A;  4EZ6 A;  3PX6 A;  4JKD A;  1GLC G;  4FWR A;  2KFZ A;  1C0G A;  1K9M O;  1NGA A;  1KC8 O;  3V6D A;  4JI5 K;  3O9T A;  1CLQ A;  1QQM A;  2OTJ N;  3SNN A;  4KBO A;  3KLH A;  3SQ1 A;  1IBM K;  2UXD K;  1KTQ A;  3CMA N;  4DLE A;  2HND A;  4K42 A;  3V1R A;  2YHW A;  1DLO A;  3FLC O;  3LAK A;  4JNE A;  1Y64 A;  3SBT A;  2EHG A;  2ETJ A;  4KHY A;  2OTL N;  2XY8 A;  4M3T A;  5AQQ A;  1GLJ O;  3EN9 A;  3O8M A;  3OYK A;  3C65 A;  4LF6 K;  1RT5 A;  4FLT A;  3IUC A;  3CC4 N;  4LD0 A;  4CJW A;  4JLH A;  4JN4 A;  2NUB A;  2YHY A;  1YHQ N;  4F2S A;  4CZL A;  1N32 K;  3VTI A;  4Y1D A;  4NXN K;  1VQ6 N;  1RDB A;  3QFU A;  5ADX A;  4DSF A;  3BF1 A;  3T69 A;  4BC2 A;  3W3D A;  5KTQ A;  1RT7 A;  2O4I A;  4C1N I;  1HKG A;  4LF7 K;  3VA3 A;  1LOT B;  4BR4 A;  3R9P A;  3J7Z O;  3WXL A;  4B1W B;  1YIJ N;  1VSJ A;  4KH6 A;  4CZM A;  3TWH A;  3H45 C;  1NMN A;  4JKH A;  2KZM A;  2KLA A;  3QEI A;  2HF4 A;  3EEQ A;  3U8X A;  4CJR A;  2P9I A;  3LDO A;  3G6E N;  1QSL A;  4FK4 A;  1JL1 A;  5DM6 L;  3TTD A;  4M3Z A;  4B3R K;  5GAG P;  3WNH A;  3VGK A;  3BEX A;  3V81 A;  4AM7 A;  4CBU A;  3S3O A;  1XMO K;  5AQY A;  1EO1 A;  1HNV A;  3O9R A;  2O8E B;  2BH1 A;  4XEI A;  2IOC A;  4OGE A;  1L5U A;  3QLH A;  1S9E A;  4FLW A;  1VQ4 N;  3NGZ A;  1ESV A;  3MN7 A;  1BCO A;  3UB5 A;  2F9W A;  4AHV A;  4OGC A;  1BIZ A;  3CFO A;  4M45 A;  4NLB A;  3KK3 A;  3CQ8 A;  5H1S Q;  5D3G A;  3SUP A;  4IOA L;  3K9J A;  1NGC A;  2P9U B;  1NOZ A;  4RCH A;  4BRO A;  3QEX A;  3V9S A;  1VSF A;  2HVI A;  3ATV A;  3JS6 A;  3JAM O;  3CPE A;  1BL3 A;  4PKI A;  4H5W A;  5HL7 L;  5BRH A;  5AQP A;  5CE3 A;  4JI0 K;  4DQP A;  3VEO A;  3LPU A;  4B1X B;  4LC9 B;  4BG8 A;  4KHW A;  4DV7 K;  1XNQ K;  4X62 K;  1JLE A;  1HNW K;  5AQR A;  2V51 B;  1BDG A;  4JI4 K;  4BDY A;  3LDQ A;  1R59 O;  4DLG A;  3AY9 A;  1OH5 A;  4JS4 A;  3QNN A;  4YFU A;  3D2E A;  3H1V X;  4N41 A;  5BR8 K;  3L2U A;  3NAE A;  3VES A;  3G71 N;  1NKC A;  1L3S A;  1BCM A;  1HUX A;  2FSK A;  3E9L A;  3U9D A;  2HMI A;  4DS5 A;  4DFK A;  1HYZ A;  3SJJ A;  4YDU C;  5BR9 A;  4A59 A;  2F4V K;  2A42 A;  3OYB A;  2GWK A;  4LSN A;  3ZT3 A;  1U2V A;  4DSJ A;  4IZ9 A;  3O80 A;  3OYN A;  4WQ4 A;  2YKM A;  1YT3 A;  3OA9 A;  1QTM A;  2A5X A;  1HLU A;  4KTW A;  4N76 A;  2KZZ A;  4R5P A;  3ZEU B;  4DSI A;  1MA9 B;  3ZT1 A;  4CED A;  4CGF A;  2VYP A;  4O8U A;  1NOY A;  1GOA A;  3AVK A;  2CH6 A;  4DV1 K;  3A8Y A;  3SJH A;  2OPP A;  3PX0 A;  2W41 A;  4KTQ A;  5KGW A;  1NGH A;  5AZI B;  2P9N B;  4CJ3 A;  5BN8 A;  1TL3 A;  3AO5 A;  1W2B M;  1LW0 A;  4EHU A;  1CZ9 A;  4DU4 A;  3CCJ N;  3KHY A;  4KB1 A;  4DQR A;  3AA5 X;  3GOI A;  2G8K A;  1TAU A;  1IKW A;  2BUP A;  3PSI A;  1FXX A;  4FWS A;  1RTH A;  1KAY A;  5AFU A;  4BG9 A;  5KPT A;  5HBM A;  3OS2 A;  3L4I A;  1RGI A;  2VWB A;  1U4B A;  1TK0 A;  4Z4C A;  4K8X A;  3RWU A;  1SQK A;  1MDU B;  4HUG A;  4C8O A;  4IFY A;  4B9S A;  4Z4E A;  5FRO A;  2EWS A;  2YHA A;  3Q7B A;  2G8H A;  1Z05 A;  2E4L A;  2CGJ A;  2QXF A;  5AQF A;  3RTV A;  2GEL A;  1VAZ A;  4FWK A;  1TVR A;  4Y1C A;  3WNG A;  3H46 O;  1QS4 A;  3HOS A;  3OJS A;  1BO5 O;  2OPS A;  3EY1 A;  4FK2 A;  3VEZ A;  5JS1 A;  5C0Y A;  3OYC A;  1NK8 A;  2ZM6 K;  3SI6 A;  4DWI A;  3QES A;  1VQL N;  4FJL A;  1JXB A;  3QBX A;  4DQQ A;  3ASM A;  3C6A A;  2HBL A;  3AVG A;  2P9S A;  4IOX A;  4DV2 K;  1NKE A;  4FWO A;  3L2Q A;  3EE9 A;  5JIC A;  4FWN A;  5J1E A;  4FJ9 A;  4FWQ A;  4KHU A;  2P9I B;  1ATR A;  4GNI A;  1JL2 A;  3HP6 A;  4F9O A;  3SQ0 A;  4E7H A;  1TK8 A;  1E3M A;  2X6N A;  4N5S A;  4O4G A;  4FJM A;  4CJV A;  4MLH A;  3CC7 N;  2Q0R A;  1REV A;  4IDK A;  3K5N A;  4DTP A;  3C0B A;  4XH1 A;  3B6P A;  3OYD A;  3KD1 E;  4CES A;  4CJE A;  1SL0 A;  1T6D A;  3KIO A;  2A6A A;  4BVO A;  4PQU A;  2FSN A;  3LWM A;  3F2K A;  3NH1 A;  1TYQ A;  1W0H A;  2AP1 A;  4KH5 A;  3ULE A;  2FSJ A;  3QNO A;  4H0P A;  4YOW A;  3QEW A;  4A61 A;  3M1F A;  1BQN A;  3SAF A;  1ZBF A;  1XWL A;  3HJF A;  3R1X A;  3DI6 A;  2G8I A;  4BRI A;  2D0C A;  1RBU A;  4BRK A;  1M90 O;  3IRX A;  1IV0 A;  4J2E A;  4JK9 A;  2JGU A;  3HM8 A;  4H03 B;  4M3R A;  5J2P A;  3GG4 A;  3WUH A;  4ZTF A;  2P5G A;  4YNQ A;  1A5W A;  3SMS A;  3HXM A;  1HX1 A;  4CJS A;  2EX3 A;  3ENB A;  2DY4 A;  2KW4 A;  4CJK A;  3ZET B;  4JKB A;  1VHX A;  3D2E B;  5AQV A;  3MN5 A;  4CF9 A;  1HNX K;  2D5R A;  1O13 A;  3H3O B;  5FPE A;  1XUP O;  3QBW A;  1O1W A;  4O55 A;  3FFK B;  5JVG L;  2UUC K;  3DLL L;  2P9P A;  1NK6 A;  3VQC A;  2Q3S A;  4F8R A;  3HOT A;  3E9P A;  3EE8 A;  1EET A;  3KWG A;  3TU5 A;  4CJL A;  3TAG A;  4Y0W A;  5HOO A;  2O8F B;  4WFA L;  2HHV A;  1BGX T;  4B1Z A;  3C6U A;  1VQ5 N;  1WLJ A;  2Q97 A;  1C6V A;  1YTA A;  4I9Q A;  2ASM A;  1JLC A;  3G10 A;  3WXJ A;  1VSD A;  1HPM A;  3M3Z A;  1WBD A;  3KLI A;  2ASP A;  4FJG A;  4RW8 A;  2GX9 A;  4NCA A;  2DFF A;  5AZJ A;  4JKG A;  5SZT A;  4IG0 A;  3I33 A;  2VCP A;  1LAW A;  5FPD A;  1JLB A;  3K5O A;  1OKJ A;  4YHH K;  2KTQ A;  3HI0 A;  3ZT4 A;  4ID1 A;  4K25 A;  4LF5 K;  4M7Y A;  4ELT A;  3OTO K;  4DF8 A;  3DLK A;  2HB5 A;  3AAR A;  1BQM A;  1NG9 A;  1RTI A;  3KKR A;  2UU9 K;  3OYH A;  2FXU A;  1RTD A;  2KFN A;  3SLC A;  3CXC M;  4LH4 A;  1E4F T;  4HTU A;  4FPB A;  1NKB A;  1N36 K;  4FWL A;  1ATN A;  3DXM A;  3C94 A;  3CCQ N;  4CEF A;  2HBM A;  1VQM N;  4L3Q A;  2VQE K;  5AR0 A;  3SK3 A;  4DSE A;  2BE2 A;  1U47 A;  3MEG A;  3NVM A;  2Q1N A;  2ZGZ A;  2FF6 A;  4JYA K;  4U7B A;  3LP3 A;  3AVC A;  4CJ4 A;  3L6Q A;  5AQK A;  3A5N C;  5FPM A;  1CZA N;  4BDZ A;  3U3G A;  2Q0U A;  4NO7 A;  3P4I A;  3D45 A;  3EZ5 A;  3UIQ A;  2P1J A;  1NU0 A;  2Q36 A;  3E1Y A;  3GBT A;  3KK7 A;  3SMP A;  3MK6 A;  5C10 A;  5JLH A;  3V9Z A;  4DUY K;  3SZ2 A;  3P31 A;  1J6Z A;  4EHT A;  5BRE A;  5JLF A;  1ATS A;  1KSP A;  2YHB A;  3DJC A;  4CFD A;  4A62 A;  4GW6 A;  5HRR A;  1MWK A;  1RTJ A;  4O5B A;  3U9Z A;  5KRT A;  2ITG A;  4OKK A;  1X9J A;  4LH5 A;  1UA0 A;  1QQN A;  3I0S A;  1FW6 A;  3C7N A;  4LFC K;  4DG1 A;  2WUS A;  4FJ8 A;  2KKZ A;  1JXE A;  3OYM A;  3VF2 A;  3SV3 A;  3CCS N;  3DWL A;  5AQZ A;  2IVO A;  4B9M A;  4NXM K;  1TKZ A;  2OPR A;  4IFV A;  4DR6 K;  2QWL A;  1VQ8 N;  3D2F A;  4DR5 K;  3RR7 A;  4LFB K;  3FGU A;  4PY5 A;  1IBL K;  1NBW A;  4DV3 K;  4K43 A;  1TK5 A;  4W5Q A;  1OVQ A;  1VQK N;  3BY5 A;  3OBY A;  5DM7 L;  2YJE A;  1NGG A;  1WSH A;  3DYA A;  4EAH D;  3HM9 A;  3OS0 A;  2XRI A;  1RT2 A;  2NRW A;  1XQS C;  1NGB A;  1KQS M;  5LMU K;  4DTJ A;  4DMN A;  4OX9 K;  3LP1 A;  4RG8 A;  4BRQ A;  3CC2 N;  4B3T K;  4NYN A;  2NRR A;  3VQP A;  2ZE2 A;  1Q8I A;  1IO2 A;  4CFC A;  3LAM A;  3HTV A;  3FZH A;  1HKC A;  1CXU A;  3O1W A;  2E2N A;  2AJQ A;  3BUZ B;  4FXD A;  4FWP A;  4PHT X;  4FZX C;  5CY4 A;  4RW6 A;  4O0I A;  5BN9 A;  3PLA A;  5TKY A;  5IWA K;  2JWL A;  2X6S A;  2HW3 A;  2DFH A;  4IXC A;  2E1Y A;  4QAG A;  3CYM A;  4BC4 A;  5FLX O;  4KH4 A;  3FZM A;  4E1J A;  3GDQ A;  1KLN A;  3RSE A;  1GLF O;  2E88 A;  3F9M A;  4AHT A;  1T7P A;  2IVN A;  4CJU A;  1T03 A;  3I55 N;  3UKR A;  3DRR A;  4I7F A;  2W6K A;  4E1M A;  2P9P B;  3ATU A;  4ZTJ A;  1QZ5 A;  1C1A A;  4DTR A;  3H1Q A;  2WC9 A;  1SV5 A;  3KJV A;  4DSL A;  2QI2 A;  4JHD A;  5EVZ A;  3O08 A;  3THY A;  4DUZ K;  5AQU A;  3NH2 A;  5EXW A;  5BPL A;  5E26 A;  5AQL A;  3VQB A;  3TAF A;  1IKX A;  3CD6 N;  4JKG B;  4FLZ A;  4M3X A;  3DAW A;  2WON A;  5MLC Q;  2PAV A;  4PUO A;  2CGL A;  4JKE A;  2BDP A;  1Q86 O;  3KZB A;  1NJY A;  4JS5 A;  3UE5 A;  3H6E A;  4CJ5 A;  1DT9 A;  3WQU A;  4GV9 A;  2QK9 A;  3P83 D;  5DK5 A;  5FRN A;  3G25 A;  3TSU A;  4CHP A;  2IS3 A;  4DV0 K;  4JKF A;  3VTH A;  4CEB A;  1YJW N;  3L2R A;  3PIO L;  4LF9 K;  1V4T A;  4FPA A;  1RDD A;  5T7B A;  4XH5 A;  2PY5 A;  2YKN A;  5I9E B;  4PKH A;  4CHY A;  5E41 A;  3DRS A;  1BIU A;  1VK0 A;  3AV9 A;  1SUQ A;  3AA4 A;  4FLV A;  2VG6 A;  3V1Q A;  3VF6 A;  1NNE A;  1LWC A;  3KVG A;  2NRV A;  1MWM A;  5SWM A;  4HWI A;  2AA4 A;  3CI5 A;  3AVI A;  4CZE A;  4F3T A;  4BY9 C;  3WEE B;  3WXM B;  2O8D A;  4FLU A;  4LF4 K;  3ZT0 A;  1HNZ K;  5HP1 A;  3HZ6 A;  2G8U A;  5EOY A;  4E7J A;  5JS2 A;  4ICL A;  4H8K A;  5LMN K;  1S1V A;  2XY5 A;  4BR7 A;  1HYS A;  2VG5 A;  4CHO A;  3THW A;  4HUF A;  4CEO A;  3O9Q A;  3CER A;  5C15 A;  3CCE N;  4F3O A;  1GLL O;  3CHW A;  3PY8 A;  3DXK A;  4G9Z A;  3LM9 A;  4CZH A;  3LP0 A;  5I42 A;  3HL8 A;  3T3F A;  4EFH A;  3QEV A;  1SKS A;  4LFA K;  4DR4 K;  3MMV A;  1K8K B;  4BRH A;  4CCH A;  5HLF A;  5M1K A;  4AH9 A;  3OW2 M;  3HPG A;  2D0P A;  3C7N B;  1NGI A;  4I6M B;  4RW9 A;  4CJT A;  2A1R A;  1ILY A;  2GUP A;  4B1V A;  4IJA A;  3EL2 A;  4FW1 A;  5I3U A;  5KQ8 A;  3P38 A;  1Q82 O;  3OY9 A;  1WN7 A;  1OVY A;  2WFB A;  4JRP A;  2A41 A;  4CF2 A;  1ZBS A;  4CIG A;  1VQN N;  4KB0 A;  4IEE A;  5HRN A;  3S3N A;  3E01 A;  3D2F B;  2Q2R A;  3SQ2 A;  3K58 A;  1BIS A;  4H0V B;  3VQA A;  3MN6 A;  5CYM A;  3AO1 A;  1LAV A;  3T1A A;  3F5T A;  4A57 A;  1X1P A;  4IO9 L;  5FDL A;  5C2D A;  3DLE A;  4FJ5 A;  3L3U A;  4LSL A;  2FLO A;  3O4N A;  2W6L A;  4CJF A;  4CZF A;  1QE1 A;  1Z6R A;  1YJ9 N;  4V19 S;  2UUB K;  4IO8 A;  2YNI A;  5CZ1 A;  5DMR A;  5AQJ A;  1GLB G;  2F96 A;  3CIP A;  1IJJ A;  4CK3 A;  4CHN A;  5AQG A;  3AO4 A;  4OVL A;  1J53 A;  2P9K B;  4H0X B;  4ISG A;  1JKH A;  4JI6 K;  1RIL A;  2GBZ A;  3O4Q A;  4CGJ A;  3R6M A;  4YDU A;  3GL1 A;  4CEQ A;  2IIR A;  4C1N K;  3MXI A;  3AVN A;  1YVN A;  3HRG A;  4OLA A;  4B3O A;  4M3U A;  5F0X A;  1RDA A;  1KLM A;  3ULD A;  3MXM A;  2HHT A;  2IGI A;  4Z4H A;  1EQY A;  2R7Y A;  3K0S A;  3C95 A;  4FSV A;  4BRG A;  4XH4 A;  4YOR A;  2YHX A;  1TV6 A;  3G4S N;  1VSK A;  1NK9 A;  2VWJ A;  4DTO A;  1A5X A;  3SUO A;  3HST B;  4W5O A;  5GAH P;  5EY4 A;  2Y1I A;  5AQH A;  3CFR A;  4JAX A;  2WOM A;  3VQD A;  2JLE A;  3V9U A;  1BWF O;  3K57 A;  3T7Z A;  4MDB A;  4DTN A;  3AGK A;  4E7K A;  2GWJ A;  3DOL A;  3LDP A;  4C23 A;  4DHY A;  4BGB A;  4BE0 A;  4B1Y B;  1W9H A;  1P90 A;  4JHD B;  1WSI A;  3LDN A;  4WE1 A;  3P5J A;  1JCG A;  3DMJ A;  4B8C A;  3THY B;  1XHX A;  1T6C A;  3SPZ A;  3MAQ A;  3CFP A;  1GLE G;  4FCY A;  4BR9 A;  3NFA A;  4XIU A;  4FJ7 A;  1L3T A;  1WBB A;  1N6Q A;  1S6P A;  3P39 A;  4GV3 A;  3JXU A;  5KGX A;  4E3S A;  4BR2 A;  1NJI O;  2IC3 A;  2G8W A;  1U04 A;  1QQC A;  3I56 N;  1NMD A;  4KI4 A;  1KFS A;  1RBS A;  2YNF A;  1K6Y A;  2OA8 A;  3QIP A;  3NDK A;  4BRA A;  2I5J A;  3M8R A;  4R79 A;  4K8Z A;  3VQE A;  4DV5 K;  3RRH A;  5AQS A;  4FVM A;  2GUI A;  2HHQ A;  4DV6 K;  4OPH A;  4GV6 A;  3ZSO A;  1NWK A;  1FK9 A;  3N4P A;  4OPJ A;  2ASO A;  4JI1 K;  2D4W A;  3C6H A;  2E8A A;  3WXI A;  3OYJ A;  4KI6 A;  1I3A A;  4DTS A;  4FYD A;  4N47 A;  2E5L K;  4O5F A;  3O3F A;  4AHR A;  2FBT A;  2O8D B;  4F4K A;  4MO5 A;  2F8T A;  3N4Q A;  1CXQ A;  1V4S A;  1RNH A;  5E84 A;  4CGD A;  4HUE A;  2DFE A;  2H3G X;  1C0F A;  3RVC A;  3CF5 L;  1KAZ A;  4WQ5 A;  3A5L C;  1IG8 A;  3VN5 A;  4YOY A;  3THW B;  4B1U B;  3SUQ A;  3VEV A;  3CCR N;  2J4R A;  3DXK B;  4E7L A;  4JK7 A;  4W5R A;  5ADX H;  1WSF A;  3LL3 A;  4CEZ A;  5HRO A;  3QB0 A;  1T3V A;  5A2Q O;  1HQE A;  2HBK A;  1WUA A;  3HYF A;  4A5B A;  1L3V A;  2WTU A;  1ASU A;  1E4G T;  4W5T A;  5M1P A;  4OPK A;  4DTM A;  3ZLJ A;  4BR0 A;  3LZI A;  4OPA A;  4MQ3 A;  4PL7 A;  4I9L A;  1GLD G;  3AA2 A;  2XY7 A;  4FM2 A;  3TAN A;  3TPQ A;  2O8B A;  2V7Z A;  4IEI A;  4C8L A;  1UWB A;  4RW7 A;  1T8E A;  1BG3 A;  1TGO A;  5GIP A;  4AM6 A;  1NLV A;  5AQW A;  4M41 A;  2QWQ A;  4CJ7 A;  2E20 A;  1XHZ A;  1U2V B;  5HRS A;  4CGI A;  3AVB A;  3EKU A;  4B9T A;  4M3W A;  3K5M A;  1EXQ A;  5KRS A;  5BRF A;  1A5V A;  3AO3 A;  5C2F A;  3PO5 A;  1RT3 A;  2UUA K;  4OO1 J;  5CYQ A;  4DU3 A;  1ZXO A;  3THX A;  4W5N A;  2I7P A;  2KHO A;  4BRF A;  4Z94 A;  4YOU A;  4FJN A;  1GOB A;  2E2O A;  4M63 C;  4H5R A;  3WNF A;  2XO7 A;  3ZSV A;  1XMQ K;  4WCE L;  3D6R A;  3AAQ A;  4CJQ A;  1T44 A;  1Q9X A;  1EWQ A;  1LWE A;  3M8P A;  4DR2 K;  3KLF A;  3H08 A;  3KKS A;  5AQI A;  1BA0 A;  1NK7 A;  3UKU A;  4HVJ A;  4CK2 A;  1VRT A;  2HST A;  3CJ1 A;  1YIT N;  1JCE A;  1N33 K;  2Z1I A;  4BAC A;  2P51 A;  3VEW A;  4KHS A;  3TAR A;  3QO9 A;  5HRP A;  1QSS A;  3SCX A;  1YVU A;  1SKR A;  4ELV A;  1DEJ A;  2OAN A;  3ENH A;  1R0A A;  2VGM A;  3K2P A;  2O8E A;  3VEX A;  1ZBL A;  2HNY A;  4FK0 A;  3V4I A;  3DLG A;  1WSG A;  1OH8 A;  3DLR A;  3HVT A;  4IBN A;  1JJ2 M;  1HR0 K;  1MU2 A;  1M1K O;  3DM2 A;  4N56 A;  1DGK N;  4FM1 A;  3J7A P;  4CF8 A;  5C42 A;  1U45 A;  1QZ6 A;  3LM2 A;  3OBW A;  3NBP A;  4DFJ A;  4WYB A;  2P9U A;  1TAQ A;  2ZGY A;  1HQU A;  3K9K A;  4Z0U A;  1X3N A;  1Q18 A;  1Q81 O;  1K8A O;  4BRD A;  4AHS A;  2RE2 A;  1QHA A;  4GVE A;  1VSH A;  2P9L A;  4CD1 A;  4MLE A;  4O0J A;  1S22 A;  3M8Q A;  4A2B A;  2P9S B;  3VA0 A;  5AJ3 K;  3F9K A;  4KHP K;  4IDH A;  1HKB A;  2WBN A;  4BE2 A;  3L8B A;  2YCH A;  2HNZ A;  2RHK A;  4BWJ A;  5F2R A;  1C1B A;  3CCV N;  2ZJR L;  2RKI A;  3ID6 A;  4WF9 L;  1VSE A;  1B9D A;  3JSM A;  1LV5 A;  4JD2 A;  3QEP A;  3O1B A;  3J7Y P;  4K41 A;  1ZBI A;  4DR1 K;  4X64 K;  1B92 A;  4J2A A;  1ZYQ A;  2UXC K;  2QW9 A;  1C0T A;  4KHN A;  5B8H A;  1NJZ A;  3S9H A;  2CGK A;  3CJC A;  1S9G A;  3ID8 A;  3FR0 A;  1UOC A;  3O4W A;  4Z4F A;  5AFU H;  1TYQ B;  3RR8 A;  3BDP A;  5ELZ A;  3ULE B;  4H0T B;  4B3S K;  1W97 L;  4IOC L;  4KAZ A;  2A3Z A;  4BRN A;  2W42 A;  4NLC A;  3V9W A;  3VQ7 A;  1HJR A;  3LAL A;  2GEM A;  1QVG M;  4JI7 K;  3QDK A;  4YOV A;  5EX5 A;  3AVH A;  3ZSW A;  3V1O A;  3EO3 A;  3F73 A;  4KHQ A;  4FLX A;  1KFD A;  4OKJ A;  4DF4 A;  2PZS A;  1C1C A;  4BQZ A;  3ITH A;  2O4G A;  1G15 A;  2ZWH A;  4H0Y B;  3SBG A;  5M1O A;  3ZCM A;  1P8Z A;  4BVP A;  1FKO A;  4ISE A;  4G1Q A;  5AZI A;  2P9N A;  2QXL A;  4DFM A;  4U67 L;  2UYT A;  3PSF A;  4CW7 B;  4ILG B;  4FZZ A;  2NZT A;  3M6G A;  1IKY A;  1RBT A;  2W40 A;  5KPR A;  5AQM A;  2A40 A;  5C25 A;  2B4J A;  4BRE A;  2O8B B;  1HNI A;  3BP8 A;  4E0D A;  4WFN L;  3AVJ A;  4RW4 A;  3CQX A;  3RMD A;  3CQY A;  3SYZ A;  2VQF K;  2HOE A;  1BI4 A;  2QM1 A;  3CJA A;  3ZSR A;  4CBW A;  2XY6 A;  3SAG A;  1RDC A;  1RT1 A;  3AGR A;  1KVC A;  3IMX A;  4BC5 A;  1TKD A;  3MWP A;  4Z4G A;  2CH5 A;  3D0P A;  1JLQ A;  4FOI A;  2RN2 A;  3VMF B;  3K59 A;  5AZJ B;  3TSP A;  4AQY K;  1KVB A;  3LDS A;  2NRZ A;  3THX B;  2D1K A;  3AA3 A;  3ZSY A;  2G8F A;  1Q9Y A;  3TI0 A;  1YUW A;  3SV4 A;  1D4X A;  3NGI A;  3HBT A;  1VSL A;  4JEP A;  4BR5 A;  3I8D A;  1SS6 A;  3MCP A;  3T1Y K;  4J2B A;  4CZG A;  1HMV A;  4I2Q A;  4JV5 K;  3CPW M;  1RDW X;  3KWI A;  5LJV A;  3FE1 A;  4NCB A;  3KTQ A;  5GAE P;  4ILH A;  2FBX A;  1T05 A;  5FPN A;  1QQO A;  3MXJ A;  3UKU B;  4GVM A;  5LY3 A;  4FVU A;  3VQ8 A;  3DXM B;  3T1H K;  2E6M A;  3PV8 A;  1VSM A;  4AIL C;  4FJK A;  3IKM A;  2VG7 A;  4UQG A;  1L3U A;  4H0O A;  2YI1 A;  2ZF5 O;  4KRE A;  4CFB A;  4CF1 A;  1RFQ A;  2Z1G A;  2HHU A;  4ISF A;  4KFB A;  2UXB K;  4ID5 A;  4CF0 A;  4GMJ B;  3QIN A;  5JVH L;  3AVL A;  4ELU A;  3KK1 A;  2PBD A;  3QER A;  4RWT A;  3ALY A;  1JCF A;  4FJI A;  1TL1 A;  2IVP A;  3WQT A;  3MCA B;  1C0M A;  3BGR A;  3MEE A;  3J81 O;  4ILJ A;  2FF3 B;  2OCE A;  1U6Z A;  1BA1 A;  3NF8 A;  3K5L A;  2IDO A;  4EIA A;  4HCC A;  2PFU A;  1KRP A;  1VSI A;  2E2P A;  1X9S A;  4CZK A;  3NH0 A;  2V7Y A;  5C12 A;  2QWO A;  4FL9 A; 
#chains in the Genus database with same CATH homology
 1IH7 A;  4FJ7 A;  1L3T A;  4O44 A;  4AHC A;  5J2M A;  1LAW A;  1N6Q A;  1S6P A;  4BDP A;  1JLB A;  3K5O A;  4AHU A;  5KGX A;  4E3S A;  3KD5 E;  3MED A;  1FKP A;  3ZT4 A;  4E1N A;  4ID1 A;  3TAE A;  4B9L A;  1X9W A;  2KTQ A;  3LZJ A;  4KPY A;  3ISN C;  2IC3 A;  2G8W A;  2G8V A;  1U04 A;  2GV9 A;  2HHW A;  4B9U A;  4ELT A;  1QQC A;  3L2W A;  4KI4 A;  2FBV A;  4DF8 A;  3DLK A;  1KFS A;  4FJJ A;  1S1T A;  2BAN A;  4Q0B A;  2HB5 A;  4E7I A;  2HHX A;  1BQM A;  1RBS A;  1RBR A;  2X78 A;  4H4O A;  3TR8 A;  2YNF A;  3PX6 A;  4EZ6 A;  1YTU A;  1K6Y A;  2KFZ A;  1RTI A;  2OA8 A;  3KKR A;  1SL2 A;  3OYH A;  1U48 A;  5SZT A;  3QIP A;  3V6D A;  3NDK A;  1RTD A;  2I5J A;  2KFN A;  1CLQ A;  3M8R A;  4LH4 A;  1ITG A;  3SQ1 A;  3KLH A;  4DFP A;  3SNN A;  3VQE A;  1S1U A;  1WSJ A;  4HTU A;  4EZ9 A;  4K8Z A;  1NKB A;  1KTQ A;  4DLE A;  2HND A;  3C94 A;  2DTU A;  3RRH A;  3V1R A;  4CEF A;  2B6A A;  4FLY A;  1DLO A;  3VQ9 A;  4ZHR A;  2F8S A;  4FVM A;  3LAK A;  4KRF A;  2GUI A;  4KKO A;  2HHQ A;  4DS4 A;  4B08 A;  1S5J A;  3ZSO A;  2EHG A;  2ETJ A;  1FK9 A;  1JLF A;  4CIF A;  3OYA A;  2XY8 A;  3QET A;  4OPJ A;  1D9F A;  4M3T A;  1Z25 A;  1N5Y A;  4KHQ A;  4DSE A;  2BE2 A;  1U47 A;  3MEG A;  3OYK A;  3OYJ A;  4KI6 A;  1J54 A;  1RT5 A;  1I3A A;  3I0R A;  4FLT A;  4DTS A;  4FYD A;  3AVC A;  4N47 A;  4CJ4 A;  4LD0 A;  1EKE A;  4CJW A;  3O3F A;  5C24 A;  1XI1 A;  4AHR A;  2FBT A;  4JLH A;  2NUB A;  4BDZ A;  3U3G A;  4F4K A;  4F2S A;  3O3G A;  1NJW A;  2F8T A;  4C8K A;  3D45 A;  1CXQ A;  4Y1D A;  3EZ5 A;  1RNH A;  1UA1 A;  3OS1 A;  3OVN A;  3UIQ A;  1RDB A;  4CGD A;  4HUE A;  2Y1J A;  1X9M A;  2DFE A;  4DSF A;  4OJR A;  2P1J A;  5KTQ A;  3ZSX A;  3U6F A;  4Q5V A;  1RT7 A;  3V9Z A;  5J2N A;  2O4I A;  3DLB A;  3SZ2 A;  3S3M A;  4EP4 A;  3VN5 A;  3SUQ A;  3VA3 A;  1NK4 A;  2HHS A;  1KSP A;  2YHB A;  1VSJ A;  4CFD A;  4E7L A;  1SL0 A;  4W5R A;  3TWH A;  4M3Y A;  4GW6 A;  5HRR A;  4DTU A;  1WSF A;  4CEZ A;  1WAJ A;  1RTJ A;  4O5B A;  5HRO A;  2KZM A;  5KRT A;  1RT4 A;  2ITG A;  4OKK A;  4CEE A;  3QEI A;  3NFA A;  1D9D A;  2PYL A;  4LH5 A;  2XHB A;  1HQE A;  2X74 A;  2Z1H A;  3HYF A;  1L3V A;  1QSL A;  4CJR A;  1UA0 A;  3I0S A;  1ASU A;  1S1X A;  4FK4 A;  1JL1 A;  4DG1 A;  1LWF A;  4W5T A;  4OPK A;  4DTM A;  4M3Z A;  4FJ8 A;  1Y97 A;  3WNH A;  1JXE A;  3NF7 A;  3LZI A;  3OYM A;  4MQ3 A;  4I9L A;  3V81 A;  3SV3 A;  3AA2 A;  3S3O A;  4E19 A;  2OYQ A;  2XY7 A;  1QHT A;  4FM2 A;  1HNV A;  3HVR A;  3TAN A;  2QKB A;  4B9M A;  1TKZ A;  2OPR A;  4IFV A;  3ZT2 A;  4C8L A;  2IOC A;  1UWB A;  4RW7 A;  3THV A;  1T8E A;  4IG3 A;  1TGO A;  1DTQ A;  4OGE A;  1L5U A;  4EP5 A;  3QLH A;  1S9E A;  4FLW A;  4M41 A;  3NGZ A;  1BCO A;  3RR7 A;  1KCF A;  4OGC A;  1BIZ A;  3CFO A;  4M45 A;  4AHV A;  3KK3 A;  1BI4 B;  3CQ8 A;  3QIO A;  1XHZ A;  5HRS A;  1NK0 A;  4DQI A;  4CGI A;  3SUP A;  5D3G A;  3HPO A;  5CZ2 A;  4NCG A;  1VRU A;  3AVB A;  3T19 A;  1RCH A;  1TK5 A;  4W5Q A;  1NOZ A;  3IG1 A;  3K5M A;  4B9T A;  4M3W A;  1EXQ A;  5KRS A;  3QEX A;  1WNS A;  3V9S A;  1VSF A;  2HVI A;  3CM5 A;  1I39 A;  1EP4 A;  1WSH A;  1A5V A;  3AO3 A;  3PO5 A;  3DYA A;  1RT3 A;  1GOC A;  3OS0 A;  2XRI A;  5CYQ A;  1RT2 A;  3HM9 A;  4DU3 A;  1BL3 A;  1JLA A;  1ZBU A;  4W5N A;  1EX4 A;  4DTJ A;  4DMN A;  4FJN A;  1GOB A;  4DQP A;  5KI6 A;  3HT3 A;  1S6Q A;  3LP1 A;  4RG8 A;  4CEA A;  3LPU A;  4I2P A;  4NYN A;  3WNF A;  2XO7 A;  3VQP A;  2ZE2 A;  3KLE A;  1Q8I A;  1IO2 A;  3C6T A;  3ZSV A;  1NJX A;  2RPI A;  3RRG A;  4KHW A;  4CFC A;  4J2D A;  3LAM A;  4CJQ A;  1Q9X A;  4CGH A;  1S1W A;  1CXU A;  1LWE A;  3DLH A;  3M8P A;  2AJQ A;  3OYF A;  4DQS A;  3KLF A;  3ZSZ A;  1JLE A;  3PUF A;  3H08 A;  3KKS A;  4L8R B;  4FXD A;  4HCB A;  1NK7 A;  2A1S A;  4FZX C;  3TAQ A;  5CY4 A;  4RW6 A;  4HVJ A;  4BDY A;  4O0I A;  4CK2 A;  1VRT A;  3HK2 A;  2X6S A;  1HPZ A;  4DLG A;  1J5O A;  2HW3 A;  1F21 A;  1B9F A;  2Z1I A;  2P51 A;  4BAC A;  2DFH A;  4JS4 A;  4QOZ B;  4KHS A;  3QNN A;  4YFU A;  2QKK A;  3TAR A;  3QO9 A;  4QAG A;  3CYM A;  5HRP A;  4N41 A;  1QSS A;  3SCX A;  1YVU A;  3AVM A;  1SKR A;  1KLN A;  3L2U A;  4CK1 A;  3CG7 A;  2OPQ A;  3NAE A;  4ELV A;  4AHT A;  1NKC A;  1L3S A;  1T7P A;  3RMC A;  1BCM A;  2FC0 A;  1R0A A;  4CJU A;  1T03 A;  3K2P A;  1ZBL A;  3DRR A;  2HNY A;  4I7F A;  4KO0 A;  4FK0 A;  2HMI A;  4E1M A;  4DS5 A;  3V4I A;  4DFK A;  1RT6 A;  3DLG A;  2HVH A;  1WSG A;  1HYZ A;  3DLR A;  3HVT A;  4IBN A;  3SJJ A;  4ZTJ A;  1MU2 A;  1C1A A;  4DTR A;  3DM2 A;  4N56 A;  4FM1 A;  3OYB A;  4CF8 A;  5C42 A;  4LSN A;  4PY5 A;  3ZT3 A;  1J9A A;  4NYF A;  1U45 A;  4FJX A;  1SV5 A;  4OLB A;  3KJV A;  3ZSQ A;  4DSL A;  4DSJ A;  3OJU A;  3NBP A;  4DFJ A;  3OYN A;  2YKM A;  1D8Y A;  1TAQ A;  1YT3 A;  1HQU A;  4JRQ A;  4Z0U A;  1U49 A;  1QTM A;  4KTW A;  4N76 A;  2KZZ A;  3NH2 A;  4R5P A;  4TSX A;  4DSI A;  3ZT1 A;  3VQB A;  3TAF A;  3L3V A;  4CED A;  4CGF A;  1IKX A;  3NF6 A;  4AHS A;  1NOY A;  4FLZ A;  1GOA A;  3AVK A;  1VSH A;  4M3X A;  2WON A;  3OYG A;  4PUO A;  2OPP A;  4PA1 A;  3P1G A;  3PX0 A;  4KTQ A;  2BDP A;  1WSE A;  4O0J A;  4FW2 A;  3HP9 A;  3M8Q A;  5KGW A;  4JS5 A;  1NJY A;  1ZBH A;  2ZQB A;  2KQ2 A;  4KV8 A;  3VA0 A;  4CJ5 A;  3AVF A;  4CJ3 A;  4CHQ A;  1TL3 A;  3AO5 A;  3F9K A;  1LW0 A;  3NF9 A;  4LY7 A;  2QK9 A;  4BE2 A;  1CZ9 A;  3P83 D;  3B6O A;  5DK5 A;  3M8S A;  3L8B A;  4DU4 A;  5FRN A;  2HNZ A;  4BWJ A;  4KB1 A;  1C1B A;  3AA5 X;  3NE6 A;  4DQR A;  2RKI A;  3NHG A;  4CHP A;  5EU7 A;  2IS3 A;  1VSE A;  4CEB A;  1B9D A;  3JSM A;  2G8K A;  1IKW A;  1TAU A;  3L2R A;  3RMB A;  4PWD A;  3NGY A;  4MFB A;  1FXX A;  4IKF A;  1RTH A;  1LV5 A;  3QEP A;  3VQ5 A;  4CEC A;  1RDD A;  5T7B A;  3OS2 A;  2IAJ A;  5HBM A;  1ZBI A;  2P5O A;  2PY5 A;  1U4B A;  1B92 A;  3HO1 A;  2YKN A;  1TK0 A;  4J2A A;  4Z4C A;  4CHY A;  4XIU A;  1ZYQ A;  4K8X A;  5E41 A;  3RWU A;  1Z26 A;  3DRS A;  1C0T A;  1DTT A;  4FJH A;  1BIU A;  1VK0 A;  3AV9 A;  4HUG A;  1NJZ A;  4KHN A;  1SUQ A;  3AA4 A;  3JYT A;  2VG6 A;  3V1Q A;  4FLV A;  3S9H A;  1LWC A;  4FZY A;  1HRH A;  1S9G A;  1LW2 A;  3MEC A;  4IFY A;  1UOC A;  4C8O A;  4Z4F A;  1XC9 A;  5SWM A;  2PYJ A;  4B9S A;  4Z4E A;  5FRO A;  3AVI A;  1D5A A;  3RR8 A;  3BDP A;  2YHA A;  4F3T A;  2Z1J A;  4CIE A;  2G8H A;  4FLU A;  2E4L A;  2QXF A;  2RF2 A;  3IS9 A;  3RTV A;  3DRP A;  3ZT0 A;  2BGG A;  1TVR A;  4Y1C A;  5HP1 A;  2YV0 X;  4KAZ A;  4DSK A;  2G8U A;  2LSN A;  3TAB A;  2W42 A;  3WNG A;  2VWK A;  4CE9 A;  1CZB A;  1C0U A;  4E7J A;  3V9W A;  5J2Q A;  3VQ7 A;  4KHY A;  1HJR A;  5JS2 A;  3LAL A;  4ICL A;  4H8K A;  1QS4 A;  3TAM A;  3OYE A;  3OJS A;  1S1V A;  2XY5 A;  2OPS A;  3EY1 A;  2B5J A;  3TAP A;  4FK2 A;  3AVH A;  3ZSW A;  1HYS A;  3V1O A;  2VG5 A;  4CHO A;  4QCL A;  3F73 A;  4HUF A;  4FLX A;  1KFD A;  4OKJ A;  1IKV A;  4BWM A;  1ASW A;  3OYL A;  4CEO A;  3KLG A;  4DF4 A;  3NCI A;  5JS1 A;  2PZS A;  4F3O A;  1C1C A;  3OYC A;  3CM6 A;  1ASV A;  3ITH A;  1NK8 A;  2O4G A;  3SI6 A;  4DWI A;  3QES A;  1SL1 A;  3PY8 A;  1JXB A;  4FJL A;  1G15 A;  4DQQ A;  3ASM A;  3PO4 A;  3ZCM A;  4CGG A;  4DTX A;  3AVG A;  1FKO A;  3FFI A;  3LP0 A;  4G1Q A;  4M42 A;  3OYI A;  5I42 A;  3HL8 A;  3T3F A;  1IG9 A;  1NKE A;  3LAN A;  3QEV A;  1SKS A;  5FRM A;  4DFM A;  3AO2 A;  3L2Q A;  5J1E A;  4CCH A;  4FJ9 A;  1SKW A;  5HLF A;  4AH9 A;  4KHU A;  4FZZ A;  3HPG A;  3EYZ A;  1KVA A;  1JL2 A;  4CJT A;  4RW9 A;  1IKY A;  3HP6 A;  3SQ0 A;  4E7H A;  2A1R A;  1RBT A;  1TK8 A;  4DU1 A;  3KK2 A;  4OKE A;  4FW1 A;  5I3U A;  2X6N A;  4N5S A;  5C25 A;  2B4J A;  4O4G A;  3OY9 A;  4FJM A;  1WN7 A;  4CJV A;  1HNI A;  4JRP A;  4E0D A;  3AVJ A;  4RW4 A;  4CHZ A;  4CF2 A;  4CIG A;  3DOK A;  1REV A;  4IDK A;  5HRN A;  3K5N A;  4DTP A;  3S3N A;  3E01 A;  4KB0 A;  3B6P A;  3RMD A;  3SQ2 A;  3K58 A;  1BIS A;  3OYD A;  3SYZ A;  3KD1 E;  4CES A;  1BI4 A;  1TKX A;  3VQA A;  3ZSR A;  5CYM A;  4CJE A;  3KIO A;  3AO1 A;  3WNE A;  2XY6 A;  1RDC A;  1RT1 A;  1LAV A;  3T1A A;  4BE1 A;  1KVC A;  1TKD A;  1X1P A;  5FDL A;  4B8A B;  3IAY A;  2YNG A;  4PQU A;  3DLE A;  2E6L A;  3LWM A;  4Z4G A;  4FJ5 A;  4C8N A;  3D0P A;  3L3U A;  4LSL A;  3O4N A;  1JLQ A;  3NH1 A;  2RN2 A;  3SPY A;  1W0H A;  4CJF A;  3K59 A;  1QE1 A;  5K14 A;  2YNI A;  1KVB A;  5CZ1 A;  3LDS A;  1WAF A;  5DMR A;  4CJP A;  3LP2 A;  2F96 A;  3QNO A;  3ZSY A;  3AA3 A;  3QEW A;  2G8F A;  1Q9Y A;  3TI0 A;  3SV4 A;  4CK3 A;  4CHN A;  1BQN A;  3AO4 A;  1TKT A;  1ZBF A;  4OVL A;  3NGI A;  1XWL A;  1VSL A;  3HJF A;  1J53 A;  3A2F A;  3HPH A;  2OZM A;  1JKH A;  1HYV A;  4CER A;  3I8D A;  3DI6 A;  4B9V A;  1RIL A;  2G8I A;  2GBZ A;  2D0C A;  1RBU A;  3O4Q A;  1JLG A;  4B9N A;  4CGJ A;  3IRX A;  4J2B A;  4CEQ A;  3O3H A;  3SUN A;  4J2E A;  3MXI A;  3AVN A;  4F2R A;  3SQ4 A;  3V9X A;  1HMV A;  4I2Q A;  2JGU A;  4OLA A;  2OZS A;  4M3R A;  4HHT A;  2YNH A;  4B3O A;  4FM0 A;  1NK5 A;  4M3U A;  1RDA A;  4NCB A;  1KLM A;  3ULD A;  5J2P A;  3MXM A;  2HHT A;  3KTQ A;  1UAX A;  2IGI A;  2FBX A;  4C8M A;  4YNQ A;  1A5W A;  4Z4H A;  3HXM A;  4ZTF A;  1T05 A;  2P5G A;  4CJS A;  2R7Y A;  3MXJ A;  2EX3 A;  3C95 A;  4GVM A;  2DY4 A;  2KW4 A;  1TV6 A;  4CJK A;  3VQ8 A;  2E6M A;  3PX4 A;  3PV8 A;  1VSM A;  1VSK A;  4AIL C;  1NK9 A;  2VWJ A;  4DTO A;  1A5X A;  3SUO A;  3HST B;  4W5O A;  4FJK A;  4CF9 A;  1QSY A;  2VG7 A;  4UQG A;  2Y1I A;  1L3U A;  4KTZ A;  3CFR A;  2D5R A;  2D0A A;  1RBV A;  3U3Y A;  4CFA A;  4KRE A;  1O1W A;  4H4M A;  4CFB A;  2WOM A;  4O55 A;  4CF1 A;  2Z1G A;  2D0B A;  3VQD A;  2HHU A;  2JLE A;  3V9U A;  3L2V A;  3K57 A;  4KFB A;  4ID5 A;  4CF0 A;  1NK6 A;  3VQC A;  2Q3S A;  4GMJ B;  4F8R A;  3QIN A;  4E89 A;  3AVL A;  4ELU A;  4DTN A;  1EET A;  4E7K A;  3KK1 A;  3DOL A;  3VQ6 A;  4CJL A;  3LWL A;  3QER A;  1BHL A;  3TAG A;  3ALY A;  3VQ4 A;  4FJI A;  1TL1 A;  2HHV A;  1BGX T;  4BE0 A;  1C0M A;  3BGR A;  3MEE A;  1W9H A;  3C6U A;  3AVA A;  3VQQ A;  1WLJ A;  3NF8 A;  1WSI A;  1C6V A;  1YTA A;  3K5L A;  4I9Q A;  4WE1 A;  4Z4I A;  1JLC A;  3DMJ A;  3G10 A;  3P5J A;  4B8C A;  2IDO A;  4HCC A;  1VSD A;  1XHX A;  1KRP A;  3KLI A;  3SPZ A;  3RMA A;  4RW8 A;  3MAQ A;  3LPT A;  1VSI A;  2DFF A;  4FJG A;  4NCA A;  1X9S A;  2ATQ A;  3NH0 A;  3CFP A;  3G0Z A;  2FBY A;  4FCY A;  2ZD1 A;  3LP3 A;  4IG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...