4LH4A

Dual inhibition of hiv-1 replication by integrase-ledgf allosteric inhibitors is predominant at post-integration stage during virus production rather than at integration
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
152
structure length
129
Chain Sequence
SPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dual inhibition of HIV-1 replication by integrase-LEDGF allosteric inhibitors is predominant at the post-integration stage.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Integrase
total genus 43
structure length 129
sequence length 152
ec nomenclature
pdb deposition date 2013-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4lh4A00
1RBUA 1IKYA 1RT1A 1GOCA 3HP9A 3VQ6A 3SPZA 3VQDA 5CZ2A 4CJWA 4BE0A 1JL1A 1WN7A 3MAQA 2YNGA 5T7BA 4MQ3A 4M3XA 4FJ5A 4FK0A 3TANA 1O1WA 3ISNC 3AVAA 1HPZA 4F4KA 3RMDA 3OJSA 4E0DA 5KRSA 3KK2A 4HCCA 1J5OA 4ELUA 4ELVA 3LWLA 3PUFA 4O0IA 3V9WA 4B9NA 3EY1A 2WONA 4Z4HA 3AVIA 1EKEA 3NF6A 3V9UA 5J2MA 1JKHA 1U49A 1NKEA 1KVCA 4CERA 3S3OA 3CFRA 4FJHA 2Z1IA 1IKWA 3QESA 2A1RA 2HMIA 1U47A 5KGWA 4J2AA 3CM5A 1HYZA 2FBXA 1VRTA 1NKBA 2BANA 4IFYA 1IH7A 1RBSA 4FW2A 4GVMA 2W42A 3QEXA 4KHSA 2HHSA 3U3GA 1QTMA 5HROA 2IAJA 3O4QA 3F9KA 4DTOA 4DF4A 1QSLA 3MECA 4I2PA 1FK9A 4DU4A 1HQEA 3PV8A 2YNFA 4TSXA 4HUGA 1SL1A 3G0ZA 2ZD1A 3NBPA 1RT2A 2KTQA 3THVA 4M3ZA 2HHVA 1U45A 1HRHA 3ZT0A 4KKOA 3TI0A 3UIQA 3U3YA 1C0UA 2ZE2A 3OYFA 2HHWA 1S1UA 5JS1A 2OZSA 3AA4A 2RPIA 3KLGA 3FFIA 3OYNA 3SV4A 4DTPA 3PO4A 4HVJA 4JLHA 4E7KA 3L3UA 1RDCA 2BGGA 4CF9A 4FJNA 1BQMA 4E1NA 4AHTA 4DS4A 3TAGA 2IOCA 3KKRA 4KO0A 1JLQA 4GMJB 5CZ1A 5KTQA 4EP5A 2Y1JA 1U48A 5SZTA 3T3FA 4MFBA 1ZBIA 3K5OA 3NGYA 3OS0A 3P5JA 1WSIA 4FZXC 2D0AA 3OS2A 4FM2A 1T8EA 1LV5A 4FXDA 3B6PA 4EZ6A 4K8XA 3SYZA 1Q9YA 3NH2A 1F21A 2B6AA 2OPRA 3AA2A 3ZT3A 3KKSA 4N47A 3HL8A 1XI1A 2PZSA 1NK7A 3VQ8A 2DTUA 3AA5X 4DS5A 4CIEA 4BDZA 4FJIA 2X74A 2VG5A 4O0JA 4B9LA 1RTJA 3OYEA 1NJWA 4Z4IA 4CK1A 1KRPA 1ZBLA 4HHTA 4F3TA 4JRQA 3WNGA 1BGXT 3I0SA 4KTZA 3V9XA 3DI6A 1X9WA 3IS9A 3OJUA 3QETA 3AVHA 1NK8A 4PY5A 1HNIA 2OPPA 2FC0A 4FJXA 4M3TA 3VQCA 4DQQA 4KHQA 3HVTA 4CF8A 4XIUA 3SCXA 1NK6A 4CEEA 2PY5A 1L3UA 2VWJA 3RRHA 1U4BA 1VSIA 1Z25A 3IAYA 3OYLA 3V1RA 2OZMA 3LZJA 3V6DA 2HVHA 3RMCA 1HMVA 4F2SA 3DRSA 1SV5A 1KCFA 3K5LA 1W9HA 3AO3A 2KFZA 4FLVA 4O55A 2YKMA 2AJQA 2QXFA 1N5YA 5E41A 2HHUA 2GV9A 3OYJA 3C94A 2HNZA 3AO5A 5CYMA 1IKXA 3SNNA 3CFPA 4L8RB 3TAPA 2E6MA 4CF2A 3ZSWA 1Q8IA 3L2RA 4NYNA 2XY6A 1LAVA 4ID5A 3OYGA 3SI6A 4B9TA 4CJRA 4CHPA 4I7FA 3AVMA 1VSKA 2Z1GA 3VQ7A 1CXUA 3KK3A 1JLGA 1WSHA 4NCAA 4CJPA 3VA3A 2B4JA 4BWJA 3VN5A 4FM0A 4KHNA 1EX4A 3MEEA 3VQPA 2G8KA 1BIZA 5K14A 1Y97A 4AHCA 3KD1E 4R5PA 3HO1A 2X6NA 3QO9A 3V4IA 1SKWA 2JLEA 2G8WA 1BI4B 1EP4A 1RBVA 1S9GA 3AVBA 1UWBA 4C8NA 3QNNA 4FW1A 4M3RA 2D5RA 3VA0A 1VSEA 1RT7A 4OKEA 1D9DA 3VQEA 2GBZA 3AV9A 4E19A 1VSDA 1TKDA 1RT4A 3ZCMA 5HP1A 5HLFA 4CJ5A 4CJFA 4C8KA 5J2QA 2OA8A 3KD5E 1RDDA 4AHRA 3SQ4A 3KLIA 3MEDA 2XY7A 1NK5A 4FJMA 2HHTA 3CQ8A 3DMJA 3V1QA 4CGGA 1CXQA 4CK2A 3S9HA 3MEGA 4DMNA 2XY5A 1TL1A 1CZBA 1C1CA 1TL3A 2YV0X 2HB5A 3KIOA 4IFVA 3ZT4A 4CJ3A 2BDPA 4KRFA 3KJVA 3ZSXA 3ZSRA 4FJ9A 1RBTA 1JLEA 2E6LA 4J2BA 2F8TA 4E89A 2KZZA 2VG7A 3VQ5A 3G10A 1J9AA 1KFDA 4CEBA 2G8IA 3NF8A 1T05A 1S5JA 5I3UA 1J53A 2ATQA 2FBTA 1ASUA 1NK4A 4HCBA 2KQ2A 2O4GA 1S1TA 3LPTA 3LP1A 4IG0A 4CJ4A 3LDSA 4BE2A 3LWMA 4DU3A 4WE1A 4CESA 3ITHA 3TARA 3KK1A 1VSHA 3L3VA 4CFDA 4CIFA 4EZ9A 1BL3A 2RN2A 5D3GA 2HNDA 4OLAA 3TR8A 3I0RA 1QE1A 3P1GA 3TAEA 4GW6A 4DQPA 4FZYA 1B92A 1S1WA 4AILC 2PYJA 3NE6A 1N6QA 3F73A 4K8ZA 2YHBA 1NJYA 4CHYA 2Z1HA 3M8RA 3O3FA 2YHAA 4W5NA 1YVUA 3ALYA 1C0TA 4KTQA 5FROA 1QHTA 2HW3A 2HHQA 3OS1A 4DG1A 3ZSOA 5HRPA 1T7PA 1TKXA 4DTSA 1TVRA 4RW4A 3HK2A 4JS4A 4ICLA 3OYIA 4CEAA 3NH0A 1BHLA 2RF2A 3QEIA 3KLHA 1XHZA 3SQ1A 2YKNA 2IC3A 4W5OA 4FVMA 3RMAA 4B9MA 3QEVA 1A5VA 3MXMA 4F3OA 1RDBA 3VQ4A 2G8HA 4UQGA 1DTQA 1WAFA 3VQ9A 4JRPA 1G15A 1WLJA 1KFSA 1QS4A 3EYZA 1X9MA 3AA3A 1R0AA 1WSFA 2I5JA 3T19A 2OPSA 5HRNA 3K5MA 1BQNA 4ELTA 3O3GA 4CEDA 4DFMA 1LWFA 1UAXA 1HNVA 4Z0UA 4FLYA 4OPKA 3SJJA 4E1MA 4RW8A 1UA0A 4B3OA 5FRMA 2Q3SA 3LANA 1T03A 1IKVA 1HJRA 1Z26A 3DLKA 4OJRA 4NYFA 3OYHA 3ZSVA 4M3UA 1YTUA 3DM2A 4J2DA 1NKCA 3D45A 1BCMA 2XHBA 3V9SA 1RBRA 3SQ0A 2P5GA 1YT3A 1VSFA 3BGRA 3NCIA 4M3YA 4FJ8A 5HRRA 4W5RA 1RNHA 4FJLA 3SZ2A 2F96A 1XHXA 2A1SA 3HSTB 2GUIA 1WSEA 1UOCA 4C8OA 1KVBA 3VQBA 3L2QA 4YFUA 4OKJA 2FBYA 1JLFA 5DMRA 4FK4A 2YNIA 4HUFA 1LWEA 1L3SA 1L3TA 4CJEA 4HTUA 3ULDA 4CHZA 1TK8A 3I8DA 2XRIA 4CHNA 1ZBFA 2PYLA 3ZSQA 1IO2A 1SKRA 4FYDA 4AH9A 1RTDA 4B8CA 1KLMA 1X1PA 4OPJA 4FJGA 3OYBA 1KVAA 5CYQA 5J2NA 3NHGA 1RT5A 4BWMA 2HHXA 3OVNA 4PQUA 1LWCA 4E3SA 3HPGA 4ZHRA 3L2UA 1QSSA 5J2PA 3LAKA 5HRSA 4LH5A 4KFBA 5CY4A 4B08A 3D0PA 1DLOA 2XY8A 2YNHA 4Y1CA 2FBVA 2ZQBA 4CGFA 4NCGA 1TGOA 4CGJA 3HJFA 1ASWA 3CM6A 5KGXA 1RILA 1WSJA 3OYDA 4CF1A 2D0BA 4DU1A 1S1VA 1REVA 3QLHA 1WAJA 4OKKA 3V1OA 4B8AB 4BDYA 4H4MA 1W0HA 4M41A 2ITGA 4QOZB 3DYAA 3NH1A 2G8FA 4KREA 1RDAA 3LP2A 3NDKA 3ZSZA 3NF7A 4IG3A 2XO7A 1SKSA 1C6VA 3VQQA 3EZ5A 4BACA 1VK0A 2QKKA 4W5QA 1B9DA 4LY7A 1A5WA 3CFOA 3DLEA 1TKZA 3AVLA 4OVLA 5EU7A 4C8MA 3DLBA 1TV6A 3HVRA 3RR7A 1ITGA 4LSLA 4KTWA 1B9FA 1JXBA 4JS5A 1XWLA 3KLEA 4DSEA 3AO2A 2P51A 5KI6A 3LPUA 4IDKA 3DRPA 1SL0A 3RMBA 1S6PA 1JL2A 3SUQA 3NGIA 5C42A 4DTNA 3VQAA 1VRUA 2HVIA 3AO4A 1Q9XA 4CJLA 4M45A 4DTMA 2DFFA 4CEFA 4CGHA 3ZSYA 1LAWA 4CE9A 1TK5A 1HYSA 4YNQA 4DLGA 3M8PA 1UA1A 3O3HA 1L5UA 4Z4GA 3OYKA 4FM1A 1FKPA 3HPHA 3IRXA 4ID1A 3WNFA 1C1BA 4DF8A 3SPYA 4B9UA 4DSJA 2O4IA 3L2VA 4PWDA 1VSMA 4CJSA 4OGCA 1CZ9A 3K58A 1FKOA 4FCYA 3BDPA 5FRNA 2QK9A 1U04A 3C6TA 4N76A 3AVJA 3DRRA 4N56A 4NCBA 2KW4A 3PX4A 2NUBA 4O4GA 4B9VA 4FJKA 4I9QA 1ZBHA 2EX3A 4KAZA 1NJZA 1KLNA 4M3WA 4KI4A 4H8KA 3SQ2A 4CCHA 4CFCA 1D8YA 4QAGA 4CECA 1HYVA 5I42A 3AO1A 4DSFA 2QKBA 4Q0BA 2G8UA 2IS3A 1K6YA 3NF9A 3T1AA 3RWUA 4KHYA 3RTVA 4AHUA 3JYTA 3TWHA 1FXXA 3QNOA 4E7JA 3B6OA 4I9LA 3DLGA 5KRTA 3LZIA 4F8RA 2VG6A 3S3NA 3AVKA 5C24A 3SV3A 1NJXA 3TAMA 5JS2A 4I2QA 5HBMA 3MXIA 4DSLA 2Z1JA 4Z4EA 4IBNA 4FLWA 4DSKA 4PUOA 2EHGA 3DOLA 3LALA 3QIOA 4O5BA 3M8SA 4LH4A 1S6QA 1C0MA 5DK5A 4B9SA 4CJQA 4OLBA 3S3MA 4RG8A 1IG9A 1KSPA 3AVCA 1BI4A 2IDOA 2LSNA 1YTAA 1JLBA 3HM9A 2VWKA 3A2FA 1CLQA 4CEQA 1HQUA 4O44A 3NAEA 1GOBA 3QERA 1RT6A 3M8QA 4LD0A 4FLUA 1XC9A 1NOYA 3C6UA 4J2EA 3ASMA 4M42A 4CK3A 4OGEA 4CJTA 3HPOA 4KPYA 1S9EA 3CG7A 1NOZA 1BIUA 3MXJA 1I3AA 4KB0A 1VSJA 1I39A 1ZBUA 2B5JA 3K2PA 4KV8A 1LW2A 4CFBA 1JLAA 3IG1A 2Y1IA 2X78A 4FLZA 4W5TA 2IGIA 5SWMA 4LSNA 3HXMA 3PY8A 4EP4A 1J54A 1DTTA 3HP6A 4HUEA 2OYQA 1QQCA 3SUNA 4E7IA 2BE2A 3QINA 3TABA 3RR8A 4CEOA 2DFEA 3AVGA 3L2WA 3V9ZA 1D9FA 2DY4A 1A5XA 1VSLA 1D5AA 3C95A 1ZYQA 4KHUA 1TAQA 4DFPA 4FK2A 4ZTFA 4CF0A 1KTQA 2JGUA 3V81A 1SUQA 1X9SA 1NK9A 4FZZA 3HYFA 4CJKA 4DTJA 4CFAA 4DWIA 4C8LA 1JXEA 4CGDA 4FJ7A 1RTHA 4N5SA 2DFHA 3LP0A 1RT3A 5J1EA 4CHQA 3U6FA 2F8SA 3QEPA 4CJVA 3OYAA 1BCOA 4F2RA 4KI6A 3WNHA 3TAQA 3AVFA 2KFNA 4RW7A 4FLTA 1EXQA 4KB1A 3KLFA 4BE1A 4DTUA 1LW0A 1TKTA 4QCLA 3PO5A 3PX0A 3CYMA 4AHVA 4DFJA 2P1JA 2D0CA 3QIPA 4DQRA 3SUOA 1TAUA 3DLRA 1SL2A 2P5OA 4Z4FA 1QSYA 4FJJA 4IKFA 3DLHA 2HNYA 4DTXA 3SUPA 2E4LA 4DQSA 4PA1A 1MU2A 3WNEA 1L3VA 3KTQA 1S1XA 1ASVA 1WSGA 3ZT1A 2X6SA 3JSMA 3K59A 4G1QA 2RKIA 1RCHA 3NFAA 4DFKA 4AHSA 3K57A 4Z4CA 4BDPA 1TK0A 4Q5VA 3L8BA 4E7HA 4E7LA 3QEWA 3TAFA 3NGZA 4DSIA 1NK0A 4RW9A 4FLXA 4KHWA 4CIGA 3HT3A 2G8VA 4N41A 3K5NA 1BISA 1C1AA 2WOMA 4RW6A 4CHOA 5FDLA 3AVNA 3OYMA 3OYCA 4DLEA 4CGIA 3O4NA 3DOKA 1RTIA 4H4OA 4Y1DA 1JLCA 1WNSA 5C25A 3PX6A 1GOAA 3LP3A 4DTRA 2R7YA 2KZMA 3LAMA 4CJUA 4CEZA 2OPQA 1EETA 3RRGA 3H08A 3OY9A 4ZTJA 3E01A 4DQIA 3ZT2A 3P83D 2ETJA
chains in the Genus database with same CATH superfamily
3VQ6A 4CZIA 5AZJA 4BC4A 3U9DA 2RE2A 3VTHA 4CZJA 5T7BA 4MQ3A 4M3XA 3Q7BA 1JCFA 4PKGA 4E0DA 4ELVA 3LWLA 4O0IA 2UYTA 3EY1A 2WONA 3P38A 5J2MA 3V9UA 1JKHA 4M7XA 4B1ZA 3CFRA 1NGBA 2A1RA 1U47A 2FBXA 4BRAA 2Q2RA 2BANA 1QTMA 3NVKA 2YHWA 4DTOA 4DF4A 3Q7CA 1BOTO 4I2PA 3G25A 1RT2A 3UKRA 4IZ9A 2KTQA 4M3ZA 2HHVA 4AF1A 1U45A 4KKOA 3TI0A 3FE1A 5JS1A 3AA4A 3KLGA 4HVJA 2Q31A 5KQ8A 4MDAA 3L3UA 3HSCA 3HBTA 3TAGA 2QTDA 2IOCA 1JLQA 4GMJB 3EKSA 2Y1JA 1ZBIA 5SZTA 1GLCG 4MFBA 3K5OA 4A57A 4DUZK 3OS2A 3JXUA 2V7YA 1F21A 4N47A 1XI1A 2PZSA 3O9SA 3VQ8A 2DTUA 4XH5A 1GLEG 4GV3A 4O0JA 2JWLA 3OYEA 1NJWA 3HTVA 3JS6A 4X64K 4JRQA 1KQSM 1BGXT 2HBMA 1X3MA 3I0SA 1HJOA 3IS9A 3CCMN 3AVHA 5BPLA 4GVEA 2HOEA 2OPPA 4YOXA 4FJXA 4M3TA 1NWKA 4DQQA 4CF8A 4CEEA 2PY5A 1L3UA 1U4BA 1VQ4N 3VEVA 3MCAB 3EO3A 4G9ZA 5BR8K 3K5LA 2VGMA 4JK7A 4O55A 5FPEA 4R79A 2QXFA 3AO5A 4DV6K 3TAPA 3RVCA 3ZSWA 3KK7A 4NYNA 4XH1A 1LAVA 3GOIA 4ID5A 2Z1GA 3KK3A 4CJPA 1NG9A 1EX4A 3MEEA 3VESA 2EWSA 4WYBA 5AQFA 3WXLA 1Q81O 4AHCA 4CI6A 1SKWA 3V4IA 3WUHA 2G8WA 1RBVA 1S9GA 3AVBA 4NXNK 1VQNN 4FW1A 3VA0A 1VSEA 3AV9A 1ESVA 4JV5K 3ZCMA 3O9TA 3KD5E 4C8KA 3VEWA 4DR3K 1NK5A 2WTUA 4DV4K 1KAYA 2QWNA 3TSPA 3S9HA 3MEGA 4DMNA 2XY5A 1TL3A 1C1CA 2YV0X 3ZT4A 3U4LA 2F9WA 4CBXA 5BPMA 5F1XA 2KZZA 2VG7A 1EWRA 1NGIA 1J9AA 4MLHA 4Z94A 1HR0K 2ZJQL 2FBTA 4A2BA 4JKCA 1NK4A 4CJ4A 3LDSA 4KH4A 1Q86O 4WE1A 4BRKA 1N34K 1VQ7N 5CE3A 3I0RA 3N4QA 1N6QA 3J80O 4JKFA 4BRFA 1NJYA 2Z1HA 4W5NA 3D7EO 3B8AX 3E9LA 2GELA 4X66K 2HW3A 3ULEB 4WF9L 3OS1A 4DG1A 3HK2A 1TVRA 4ICLA 4CEAA 1IBKK 5M1NA 3D2FB 3O9UA 3QEVA 1RDBA 1ILYA 4BR5A 1YJNN 1WAFA 1WLJA 2I5JA 3T19A 1IV0A 5AFUA 2D4WA 4BRHA 1UAXA 4OPKA 2I7NA 4RW8A 1UA0A 4XH4A 4A2AA 3LANA 1HJRA 4IJAA 3KVGA 4O8KA 3OYHA 4M3UA 1DT9A 5M1FA 2P5GA 2P9SB 4JKAA 2O8BB 4M3YA 1JCEA 4FJLA 2F96A 3BY5A 3CCLN 3HSTB 2PBDA 1UOCA 5AQSA 4C8OA 3G6EN 3L2QA 3T69A 5DM7L 1QVFM 4EFHA 4H5WA 4HUFA 1L3SA 4CJEA 4BG8A 1EQYA 2XRIA 4CHNA 2PYLA 1RDWX 1X1PA 4PQUA 3HPGA 4ZHRA 1N8RO 1QSSA 3LAKA 3QDKA 4KFBA 4B08A 4J8FA 2ZQBA 1BO5O 4NCGA 5FPMA 1KD1O 4IEEA 4FOIA 2D0BA 2E2OA 1QQMA 4FWNA 3HOSA 4LF6K 3CJAA 3MX2A 4H4MA 3OA9A 4M41A 2ITGA 3DYAA 5AQGA 2D1KA 2XO7A 2JWKA 3D2EA 3U8XA 3VQQA 1JCGA 1VK0A 2QKKA 3NVMA 1TKZA 3AVLA 3FFKB 4BROA 1ITGA 4QS7A 3QMLA 3KLEA 1SL0A 3LDQA 3RMBA 1S6PA 1RGIA 1JL2A 3THYA 5C42A 2FF3B 1U6ZA 2P9PA 2DFFA 1K8KB 1XNQK 1LAWA 3M8PA 1L5UA 4Z4GA 3HPHA 1VQKN 2HBLA 4ID1A 4JEPA 4FVUA 3M6GA 3J7AP 3BDPA 2QK9A 4JHDA 3C6TA 3SAFA 4N76A 2QWLA 3BF1A 1U2VA 3ZEUA 3A5MC 3P39A 4JKDA 3U9ZA 4B9VA 4O4GA 4FJKA 1MDUB 3QBXA 3O1BA 4GV9A 3CD6N 5A2QO 1KLNA 4KI4A 4H8KA 4C1NI 4QAGA 3AO1A 3WQUA 2HF4A 2QKBA 4B9QA 4Q0BA 3T1AA 1K6YA 3NF9A 5AQJA 3QNOA 5KRTA 2FSKA 3AVKA 1NJXA 5C10A 4K42A 4H0OA 4FLWA 2YX6A 3DOLA 3QIOA 3M8SA 4O5BA 4B9SA 1KSPA 1YTAA 1JLBA 4L3QA 2VWKA 3HM9A 1GOBA 3FGUA 3ASMA 3DXKA 4LFCK 4FO0A 4JKHA 4CJTA 4U7BA 3HPOA 4KPYA 2P9SA 3CG7A 3OBYA 1I39A 3K2PA 2Y1IA 4FWSA 2X78A 3EL2A 3PY8A 1HUXA 1J54A 1DTTA 4O8UA 3HP6A 2ZGZA 1YAGA 3SUNA 4BQZA 2BE2A 4X65K 3OHRA 3AVGA 1BU6O 3IUCA 3S41A 1A5XA 2YHYA 4CZFA 3KWGA 4FK2A 3MN5A 4CFAA 4DWIA 3ENOA 1JXEA 4FJ7A 1DKGD 4X62K 1BA0A 4CJVA 3OYAA 3WNHA 4YOUA 4MDBA 1TKTA 5BN9A 1YI2N 3CYMA 3H1QA 3P4IA 2F7TA 3SUOA 1SL2A 2P5OA 4I6MA 4IKFA 4JKGB 4DR6K 2F9TA 1L3VA 1NGCA 1YIJN 2O8BA 1N36K 3NFAA 3K57A 2P9IA 1TK0A 4E7LA 1NK0A 3HM8A 4KHWA 4N41A 1C1AA 5FDLA 3AVNA 4JN4A 4H4OA 5F2RA 3SAHA 4JKEA 3LP3A 3LAMA 3RRGA 4ZTJA 2NRVA 3E01A 3ZT2A 3P83D 1NBWA 1RBUA 1GOCA 3HP9A 2YCHA 4CJWA 4BE0A 1WN7A 4GY2B 3MAQA 1NU0A 2YNGA 1OVYA 1WUAA 2P9KB 4F4KA 4ELUA 3VF6A 4I6MB 1NGJA 2D0PA 3NF6A 4DQ8A 4BR7A 5CHIA 1KVCA 4B3TK 4FJHA 3J8AA 5KGWA 1HYZA 3EE9A 4BQLA 3O08A 1RBSA 4FW2A 3QB0A 4CVNE 2IAJA 3F9KA 2E8AA 2VCPA 1FK9A 1ZXOA 5C15A 4HUGA 4LF8K 4ISFA 3G0ZA 3NBPA 3THVA 1HNZK 3ZT0A 3IDHA 3UIQA 1C0UA 3P31A 3FZFA 4PL8A 1XMOK 2HHWA 1QZ6A 3SMPA 5KPZA 1FW6A 5AQIA 5AQNA 4E7KA 1RDCA 2BGGA 3C7NA 4DS4A 2ZF5O 2V51B 4KO0A 5E84A 5AR0A 2W40A 3P5JA 1WSIA 3IFRA 3VF4A 3KKSA 4DV7K 4YDUC 2X74A 4Z4IA 1ZBLA 1O13A 4B1VA 4CJ7A 4KTZA 4PY5A 3H46O 3QETA 1NK8A 3CCEN 3LM2A 2FC0A 4IOAL 4BRCA 5JMVA 1NK6A 1X3NA 3O8MA 2VWJA 3N4PA 3RRHA 1VSIA 3IAYA 5EX5A 2OZMA 4M63C 1NJIO 1HMVA 4F2SA 1W9HA 2KFZA 2YKMA 2AJQA 5HOOA 1VQPN 4YOWA 2HHUA 3C6HA 1XUPO 3PLAA 2NZTA 3SK3A 2XY6A 3OTOK 4B9TA 3SI6A 4CJRA 4CHPA 3F9MA 4NCAA 1JLGA 1WSHA 3VA3A 4BWJA 3VN5A 1BUPA 3ZETA 5H1SQ 2FLOA 3T7ZA 4H03B 3KD1E 5GIPA 3HO1A 3QO9A 2JLEA 4JI4K 4C8NA 2E5LK 4WFBL 1RT7A 3IMXA 4E19A 2GBZA 1RT4A 5HLFA 4CJ5A 5AQXA 5AZIA 2FSNA 4CJFA 3C7NB 3FLCO 5AQWA 3SQ4A 3MEDA 4CZKA 3THYB 2GEMA 4CGGA 1H1VA 1TL1A 2BDPA 4KRFA 4FPAA 3KJVA 3ZSXA 3ZSRA 1RBTA 1JLEA 4YOTA 1P90A 3R8EA 4CZMA 1T05A 1S5JA 1ASUA 1Z6RA 2QA4N 1VSHA 4CFDA 4EZ9A 4CIFA 1BL3A 3EKUA 3TR8A 1QE1A 4KBOA 3P1GA 1GLDG 4OO1J 4GW6A 2E2NA 4DQPA 4JI8K 4FZYA 1B92A 1S1WA 4FWRA 2P9NB 4K8ZA 3NE6A 3UB5A 2YHBA 1YJ9N 4CHYA 1YVUA 1VQ5N 4FWLA 2V7ZA 3PSIA 1QHTA 1TKXA 4DTSA 3OYIA 2PFUA 2YKNA 5C0YA 3MK6A 3MXMA 2IIRA 3WQTA 4UQGA 1N33K 1G15A 3EYZA 5JLFA 3AA3A 1R0AA 5AQYA 5HRNA 1BQNA 5LJWA 3ZETB 4QS9A 3ZX0A 1LWFA 1RDUA 2QWRA 3UKRB 2QW9A 4BRQA 4B3OA 3SJJA 4JHDB 3MX5A 1IKVA 3DLKA 4OJRA 1EWQA 4A5AA 4NYFA 2BH1A 1BCMA 5CR4A 1GLJO 3V9SA 2BUPA 3BGRA 4FJ8A 3M5RA 3ID6A 3A5OC 1XHXA 4WQ4C 2O8CA 1KXPA 4PKIA 1M90O 3WXJA 3F2KA 4BR9A 4B3MK 3CCVN 2P9UA 2YNIA 3ULDA 3DWLA 3JAMO 3I8DA 3FZMA 2KKZA 1IO2A 1SKRA 3CPWM 1N32K 4FJGA 5CYQA 2E2PA 5J2NA 4JI0K 1HNWK 4GKKK 3VPZA 1SQKA 1LWCA 3L6QA 4NLBA 3VENA 3F5TA 4DCHA 2CGJA 5CY4A 1DLOA 2XY8A 2FBVA 4CGFA 1NNEA 1ASWA 1S3XA 3CM6A 5KGXA 1RILA 1WSJA 2UXBK 4CF1A 1YUWA 1REVA 4BVPA 1WAJA 3V1OA 4BVOA 4QOZB 4BR2A 4RCHA 3NF7A 4K0KK 2W41A 3HZ6A 1D4XA 4BACA 5ADXA 1B9DA 4FWKA 2O8DA 1WOQA 3CFOA 1TV6A 4BGBA 4YORA 1JXBA 3AO2A 3NGIA 4CBUA 4DTNA 3VQAA 1VRUA 2HVIA 2WC9A 4M45A 1K9MO 4CEFA 2P9IB 4LFAK 3CCUN 1TK5A 3E9PA 4IO8A 3CQXA 4YNQA 1UA1A 3SBTA 1FKPA 3IRXA 2CGLA 2RHKA 3WNFA 3R6MA 2VYPA 3ULEA 4B3RK 5FRNA 3K58A 4K25A 4H0VB 2E20A 4H5RA 2NUBA 4I9QA 2EX3A 4KAZA 3BP8A 4OPAA 2A41A 3SQ2A 1D8YA 4LF4K 4DSFA 3MWTA 3RSEA 4DKWA 2IS3A 3D2EB 3RWUA 3R1XA 3SJHA 3TWHA 4I9LA 3LZIA 1OH5A 2O8FA 2VG6A 3S3NA 4MO5A 3TAMA 5JS2A 4I2QA 5HBMA 4DSKA 4PUOA 3BZKA 2EHGA 3LALA 4LH4A 5DK5A 4CJQA 4GNIA 4OLBA 3KHYA 3AVCA 3IKMA 2IDOA 4CEQA 1HQUA 4JAXA 1RT6A 1NOYA 4M42A 2P9KA 4OGEA 1NOZA 1BIUA 3MXJA 4KB0A 4KH6A 4KV8A 3ZYYX 4CFBA 1JLAA 2IGIA 2E1ZA 3C65A 5EXWA 4HUEA 1XC3A 1BA1A 1YF5L 4CEOA 4FOEA 3L2WA 3V9ZA 5KPTA 1SZ2A 3C95A 1TAQA 5GAEP 4CF0A 3V81A 1SUQA 3I55N 1NK9A 1IBLK 3HYFA 4DTJA 1HX1A 4IOXA 4C8LA 4NLCA 3LP0A 1W97L 4CHQA 2FSJA 2F8SA 3QEPA 2KFNA 2A40A 3CCJN 3GL1A 2NRRA 4BE1A 4QCLA 3PO5A 4NO7A 2YHXA 4DV2K 3DLHA 4BRDA 4DTXA 5LL6Z 3O4WA 3J7YP 4AM7A 5DM6L 1MU2A 1S1XA 1ASVA 3M3ZA 3MWPA 3BUZB 3ZT1A 3JSMA 3VGKA 4AHSA 1E3MA 4DB3A 4Z4CA 4E7HA 5JVGL 3TAFA 4M7YA 5AQLA 2G8VA 3K5NA 2QWOA 4A5BA 4CHOA 2NRZA 1YJWN 3OYMA 3OYCA 3DOKA 4Y1DA 4PHTX 3PX6A 3A0IX 4CEZA 4LF9K 1GLLO 1BDGA 3H08A 1C0FA 1QHAA 3OY9A 2O8FB 4BG9A 1IKYA 1RT1A 5LMNK 3K9JA 4EIAA 5CZ2A 2NRWA 4FJ5A 4FK0A 3WEEA 5C12A 3TANA 3ISNC 3KK2A 1J5OA 3PUFA 2NRXA 4CD1A 2Q36A 4B1XB 1NKEA 1EKEA 1U49A 4JNEA 2CH6A 3VEXA 1K73O 2AA4A 3CJBA 3UKUA 5KPRA 2Z1IA 5LMUK 3S3OA 3GE1A 1IKWA 2O8DB 3CJ9A 1NKBA 4JI3K 2HHSA 4IFYA 4GVMA 4KHSA 3CJ7A 3U3GA 5HROA 1HKCA 1T6DA 1WBBA 3O4QA 1DGKN 4KHPK 3TSUA 3MECA 1NGEA 1SL1A 4TSXA 3WT0A 4YDUA 3WXKA 5AQPA 4B1YB 1HRHA 5AQMA 3OYFA 2UUCK 1QZ5A 2OZSA 2NRTA 3ZEUB 5JICA 4DTPA 3CC2N 4A62A 2A42A 4FJNA 1W2BM 4E1NA 3LDNA 5CZ1A 5KTQA 3T3FA 3VEYA 4H0YB 4FZXC 2D0AA 4FM2A 2OTLN 3B6PA 4EZ6A 3SYZA 1Q9YA 3NH2A 2OANA 1X9JA 3T1YK 3ZT3A 3ZX2A 3HL8A 4WQ5C 3AA5X 4FJIA 3CCQN 1VQMN 1VHXA 2VG5A 5JVHL 4IJNA 2HMPA 5AQOA 3QFUA 4B1UB 5EY4A 4CK1A 4HHTA 1HNXK 4BRPA 1R59O 1X9WA 3DI6A 4LF5K 2QWMA 1HNIA 3H6EA 3DXKB 1OH8A 4ILHA 4KHQA 3HVTA 4XIUA 3SCXA 4BRIA 5C2FA 1ZC6A 3EZWA 1Z25A 2E2QA 2W6KA 1XQSC 1CZAN 1NGDA 2HVHA 2ZJPL 1SV5A 5HL7L 3C0BA 3VGMA 1HLUA 1Y64A 4FLVA 5E41A 5TKYA 4EHTA 3QBWA 2GV9A 3VGLA 3OYJA 2HNZA 3SNNA 5CYMA 1IKXA 3VEZA 3CFPA 4A61A 4CF2A 4EHUA 4FL9A 3L2RA 2A5XA 3AAQA 4I7FA 3VQ7A 1CXUA 1RFQA 3AARA 4AQYK 2B4JA 3VQPA 1U2VB 5ADXH 1LCUA 4BC3A 3O5BA 5IT9O 1BI4B 1EP4A 4DR2K 1UWBA 3WXIA 3ATUA 4OKEA 3DLBA 3VQEA 2Q1NA 4QS8A 4FXDA 1VSDA 2QM1A 1TKDA 3QICA 2P9PB 5J2QA 1RDDA 3OBWA 4AHRA 3HRGA 3KLIA 5GINA 2XY7A 1JJ2M 2HHTA 3CQ8A 3DMJA 3V1QA 1TUUA 1CZBA 2HB5A 3KIOA 3D6RA 4CJ3A 4FJ9A 2E6LA 4J2BA 5AQKA 4LFBK 3VQ5A 5AZJB 3G10A 1T3VA 3NF8A 4CZHA 5I3UA 5EVZA 1J53A 2KQ2A 2Q0RA 1S1TA 4IG0A 2CH5A 3LP1A 4JI6K 4DR5K 3OW2M 4DU3A 3TARA 3L3VA 5D3GA 2RN2A 1NMNA 3M1FA 3TAEA 3BF3A 4WFAL 2PYJA 3F73A 3O3FA 2YHAA 2P9LA 5MLCQ 4U67L 3ZSOA 1T7PA 4RW4A 1SAZA 4JS4A 3D2FA 4YHHK 3QEIA 3L4IA 1K8AO 2UUAK 4W5OA 4FVMA 3RMAA 3VQ4A 1DTQA 4XEIA 3J7ZO 2P9LB 4BRNA 3CMEN 1X9MA 1WSFA 4ELTA 2OPSA 3CPEA 2Q0UA 3LDLA 3UE5A 4Z0UA 2UXDK 4DR7K 4FLYA 4FSVA 5FRMA 2Q3SA 1T03A 1YTUA 1NKCA 3SQ0A 1VSFA 4W5RA 2A1SA 2GUIA 1WSEA 5AQHA 3MDQA 5M1PA 4OKJA 1JLFA 4FK4A 1L3TA 4CHZA 3LL3A 2QXLA 3ZSQA 4JI5K 3PIPL 4H5TA 4FYDA 4AH9A 4BR4A 1RTDA 4OPJA 2FF6A 1KVAA 3NHGA 1RT5A 3OVNA 4HTLA 5J2PA 5HRSA 4JYAK 5BRFA 1QQOA 2YNHA 4CGJA 1Q7YO 2ASOA 3OYDA 3TTDA 5FPNA 4B8AB 1W0HA 2QWPA 3CCRN 5M1KA 4YOYA 5LY3A 3NH1A 5GADP 3LP2A 4NB4A 1C6VA 3EZ5A 1A5WA 5AQVA 3DLEA 5EU7A 4C8MA 3I33A 4BR0A 3HVRA 3RR7A 4LSLA 4KTWA 3NMUA 1B9FA 2Q97A 4JS5A 1XWLA 4DSEA 2P51A 3C6AA 2HBJA 4IDKA 3AAPA 1GLAG 5BRDA 3SUQA 3AO4A 1Q9XA 1E4FT 4CJLA 3CXCM 1HYSA 3ZSYA 3CQYA 3R9PA 4DLGA 4DV1K 3O3HA 4FM1A 3CC7N 3I56N 3SMSA 1C1BA 1QQNA 4DF8A 2O4IA 4CJSA 4DR4K 4FCYA 5BN8A 3AVJA 3DRRA 5E26A 4N56A 4NCBA 2KW4A 1ZBHA 2GTDA 1NJZA 3ENHA 1OH7A 4M3WA 4FWMA 4CECA 1HYVA 3DXMB 5I42A 2G8UA 1Q18A 3O80A 4O5FA 4GV6A 4E1JA 1FXXA 4E7JA 2DPNA 4F8RA 4LC9B 3G71N 3VF2A 3SV3A 2OCEA 3MXIA 3BEXA 4DSLA 2Z1JA 4Z4EA 4IBNA 2ASPA 3O6WA 1S6QA 1Z05A 3S3MA 4RG8A 1BI4A 2LSNA 3PSFA 3VEOA 3DAWA 3A2FA 1GLBG 3NAEA 3DLLL 1XC9A 3M8QA 3C6UA 4WCEL 4CK3A 1S9EA 2I7PA 1I3AA 3LM9A 4JD2B 1LW2A 4WFNL 5FPDA 3BZCA 5SWMA 4LSNA 2QEXN 4EP4A 4CZEA 4IOCL 1M1KO 3L0QA 3TABA 2DFEA 2DY4A 2A3ZA 3ZX3A 5M1QA 1D5AA 4KHUA 3AY9A 4DFPA 3THWB 4JK9A 4ZTFA 3O9RA 3E66A 4CZLA 2JGUA 4ILGB 4CJKA 5GIOA 4CGDA 2DFHA 4EAHD 1IJJA 5J1EA 1VAZA 4MLEA 4F2RA 4K43A 4FLTA 1EXQA 2BTFA 1NGAA 3QFPA 3KLFA 1LW0A 4OX9K 2ZM6K 2IVPA 4AHVA 3UKUB 2WUSA 3ZLJA 1OKJA 3ENBA 4MO4A 2P1JA 2D0CA 4DFJA 3QIPA 1TAUA 3DLRA 4Z4FA 1YHQN 1QSYA 1VQ6N 2HNYA 2E4LA 2VQFK 4DQSA 4PA1A 3WNEA 3KTQA 2E1YA 1WSGA 4DFKA 2X6SA 4G1QA 1RCHA 5EOYA 4WQ5A 3EEQA 3L8BA 1J6ZA 3NGZA 1NGGA 4FLXA 4CIGA 2WOMA 2HBKA 2P9NA 4CGIA 3O4NA 1RTIA 1JLCA 3I8BA 5C25A 2KZMA 4DTRA 2R7YA 4CJUA 4K41A 1EETA 4A59A 4BRLA 2ETJA 5BPNA 5BREA 2ASMA 1BG3A 2IVOA 3SPZA 3VQDA 2VQEK 1JL1A 3RSEB 1OH6A 3CJ1A 4BC5A 2GX9A 1O1WA 3AVAA 2H3GX 1HPZA 3CERA 3CHWA 3OJSA 3RMDA 5KRSA 4B3SK 4HCCA 3E1YA 3V9WA 2GWJA 4B9NA 3H1VX 4Z4HA 3AVIA 4LF7K 4CERA 1MWKA 3QESA 2WFBA 4F9OA 2HMIA 4J2AA 3CM5A 4CBWA 1VRTA 3WXMB 1IH7A 3QEXA 2W42A 1KC8O 2YI1A 1QSLA 1XMQK 4DU4A 1HQEA 3K0SA 2YNFA 3PV8A 2ZD1A 3FZLA 1YITN 3U3YA 2ZE2A 1ATNA 2NLXA 1S1UA 1MA9B 2RPIA 3FFIA 3OYNA 3SV4A 2ITMA 3PO4A 2GUPA 4JLHA 4NXMK 4CF9A 2HSTA 1BQMA 5I9EB 4AHTA 3KKRA 4EP5A 2FXUA 1U48A 1XNRK 3NGYA 3OS0A 3GDQA 4KH5A 1T8EA 1LV5A 4PL7A 4K8XA 2A6AA 2B6AA 2OPRA 3AA2A 3O9QA 3CIPA 1NK7A 5LJVA 4DS5A 4CIEA 1TYQB 2IVNA 4BDZA 4B9LA 1RTJA 4CD3A 1KRPA 3GG4A 3VOVA 2CGKA 4F3TA 3WNGA 2QI2A 3V9XA 2YJEA 3OJUA 4FWOA 1YVNA 4H5VA 3VQCA 1S22A 4HWIA 3TSQA 1IBMK 5C2DA 3OYLA 3V1RA 3VTIA 4UY8O 3LZJA 3V6DA 2HF3A 3RMCA 3WEEB 3DRSA 1KCFA 3AO3A 3SLCA 3TTCA 1N5YA 1VQ8N 3C94A 4L8RB 2NNWA 2E6MA 3CCSN 4BRMA 5KQDA 1Q8IA 5TKWA 3OYGA 3VETA 3HOTA 3AVMA 1VSKA 4CZGA 1IG8A 2E88A 2AP1A 4FM0A 4KHNA 1OVQA 3FZKA 3MN9A 2G8KA 1BIZA 5K14A 1Y97A 4R5PA 2X6NA 1Q82O 3QNNA 4M3RA 4IFEA 2D5RA 1VQ9N 3CF5L 1D9DA 5HP1A 4PKHA 2OA8A 3MN7A 4FJMA 3SAGA 1CXQA 4CK2A 2J4RA 4IFVA 3THWA 2UXCK 4GKJK 3H45C 4JI7K 1GLFO 1T44A 2F8TA 4E89A 1KFDA 4CEBA 2G8IA 4RTFD 2ATQA 4HCBA 2O4GA 3LPTA 4ISGA 4BE2A 3LWMA 1HKBA 3ITHA 4CESA 3KK1A 2ZJRL 4OLAA 2HNDA 4B1WB 4AILC 4BY9C 4ILJA 1J5EK 3M8RA 3ALYA 1C0TA 4KTQA 5FROA 3CI5A 1KAXA 2HHQA 1G99A 4DUYK 5HRPA 3FR0A 3TPQA 4JKBA 3K9KA 3MCPA 1BHLA 2RF2A 3NH0A 3KLHA 1T6CA 3SQ1A 1XHZA 2IC3A 4B9MA 4IXCA 5AQRA 1A5VA 1HKGA 4F3OA 4DV5K 5AFUH 2G8HA 1V4TA 1TUYA 2V52B 3VQ9A 1NMDA 3TU5A 4JRPA 1SS6A 1NGHA 3VERA 3CETA 1QS4A 3E9OA 1KFSA 4H0XB 3VMFB 3K5MA 3DXMA 3O3GA 4CEDA 4DFMA 4BRGA 1WBDA 1NM1A 1HNVA 3H3OB 1VQON 4DV0K 3W3DA 4H0TB 4E1MA 3EE8A 3O1WA 1Z26A 3ZSVA 3DM2A 4J2DA 2VWBA 3D45A 2XHBA 1RBRA 2QWQA 1YT3A 4IWVA 3NCIA 1DEJA 5HRRA 1RNHA 3SZ2A 3J81O 4BGAA 1FJGK 1KVBA 4JI2K 3VQBA 4YFUA 2O8CB 2FBYA 3EN9A 5DMRA 4AM6A 1LWEA 2YJFA 3TTFA 4HTUA 1ATSA 1TK8A 1ZBFA 4DV3K 3CMAN 1WB9A 4B8CA 1KLMA 3OYBA 3H3NO 2HHXA 4BWMA 3GBTA 4E3SA 3L2UA 4LH5A 3D0PA 4Y1CA 1HPMA 5IWAK 1TGOA 3HJFA 2O8EA 2OTJN 4DU1A 1S1VA 3QLHA 4OKKA 4BDYA 4IEIA 2G8FA 4KREA 1RDAA 3NDKA 3ZSZA 4IG3A 1I94K 1SKSA 4W5QA 4FWQA 4IDHA 4H0PA 4LY7A 4OVLA 1QVGM 2P9UB 5KI6A 3LPUA 3DRPA 3PIOL 1LOTB 5AZIB 4DTMA 4CGHA 4CE9A 3A8YA 3CJCA 3OYKA 4CW7B 2VGNA 3A5LC 3SPYA 4B9UA 4DSJA 4FWPA 3L2VA 4PWDA 1VSMA 4OGCA 1CZ9A 2W6LA 1FKOA 3ID8A 5B8HA 2NRHA 3AGRA 1U04A 3R3LA 2ZGYA 3PX4A 1P8ZA 1ZBSA 4V19S 4CCHA 4CFCA 5AQQA 1VQLN 1KAZA 4KHYA 4H5NA 5AQUA 3RTVA 4AHUA 2ZWHA 3JYTA 3MN6A 3B6OA 4C1NK 3DLGA 5C24A 1V4SA 3THXB 5F0XA 4BREA 4YY3K 3HI0A 1C0MA 3W0LA 1IG9A 1CLQA 1NGFA 3KZBA 2HHHK 4O44A 3QERA 1C0GA 4LD0A 4FLUA 4RWTA 4BC2A 4J2EA 5GAHP 4JD2A 2WBNA 1E4GT 4JK8A 3L4QA 4JI1K 1VSJA 1ZBUA 2B5JA 2F4VK 4FPBA 3IG1A 2KLAA 4JKGA 4FLZA 1NLVA 4W5TA 3HXMA 1BWFO 1TYQA 2OYQA 1QQCA 3FZHA 3QINA 4E7IA 3RR8A 1S72N 3SBGA 2GWKA 1D9FA 3LDOA 1ZYQA 1VSLA 2UU9K 3A5NC 4WQ4A 5FLXO 1ATRA 4Y0WA 3T1HK 1KTQA 3G4SN 1X9SA 1YXQA 4FZZA 1RTHA 4N5SA 2UUBK 1W7AA 1RT3A 4IO9L 3U6FA 5GAGP 4YOVA 4KI6A 1BCOA 3TAQA 3AVFA 4RW7A 3LDPA 5JLHA 4KB1A 4DTUA 1K8KA 2PAVA 2O8EB 5AJ3K 3PX0A 3DJCA 3CC4N 1MWMA 4DQRA 5ELZA 4FJJA 3SUPA 2KHOA 4ISEA 5AQZA 5BR9A 3K59A 3THXA 2RKIA 4C23A 4DHYA 4BDPA 4Q5VA 5BRHA 3QEWA 4DSIA 4RW9A 1EO1A 3HT3A 1BISA 4RW6A 3KWIA 4DLEA 3AGKA 1WNSA 3ATVA 1GOAA 2OPQA 3MMVA 4DR1K 2D0OA 4OPHA 5AQTA 4DQIA 5M1OA
chains in the Genus database with same CATH topology
1RBUA 1IKYA 1RT1A 1GOCA 3HP9A 3VQ6A 3SPZA 3VQDA 5CZ2A 4CJWA 4BE0A 1JL1A 1WN7A 3MAQA 2YNGA 5T7BA 4MQ3A 4M3XA 4FJ5A 4FK0A 3TANA 1O1WA 3ISNC 3AVAA 1HPZA 4F4KA 3RMDA 3OJSA 4E0DA 5KRSA 3KK2A 4HCCA 1J5OA 4ELUA 4ELVA 3LWLA 3PUFA 4O0IA 3V9WA 4B9NA 3EY1A 2WONA 4Z4HA 3AVIA 1EKEA 3NF6A 3V9UA 5J2MA 1JKHA 1U49A 1NKEA 1KVCA 4CERA 3S3OA 3CFRA 4FJHA 2Z1IA 1IKWA 3QESA 2A1RA 2HMIA 1U47A 5KGWA 4J2AA 3CM5A 1HYZA 2FBXA 1VRTA 1NKBA 2BANA 4IFYA 1IH7A 1RBSA 4FW2A 4GVMA 2W42A 3QEXA 4KHSA 2HHSA 3U3GA 1QTMA 5HROA 2IAJA 3O4QA 3F9KA 4DTOA 4DF4A 1QSLA 3MECA 4I2PA 1FK9A 4DU4A 1HQEA 3PV8A 2YNFA 4TSXA 4HUGA 1SL1A 3G0ZA 2ZD1A 3NBPA 1RT2A 2KTQA 3THVA 4M3ZA 2HHVA 1U45A 1HRHA 3ZT0A 4KKOA 3TI0A 3UIQA 3U3YA 1C0UA 2ZE2A 3OYFA 2HHWA 1S1UA 5JS1A 2OZSA 3AA4A 2RPIA 3KLGA 3FFIA 3OYNA 3SV4A 4DTPA 3PO4A 4HVJA 4JLHA 4E7KA 3L3UA 1RDCA 2BGGA 4CF9A 4FJNA 1BQMA 4E1NA 4AHTA 4DS4A 3TAGA 2IOCA 3KKRA 4KO0A 1JLQA 4GMJB 5CZ1A 5KTQA 4EP5A 2Y1JA 1U48A 5SZTA 3T3FA 4MFBA 1ZBIA 3K5OA 3NGYA 3OS0A 3P5JA 1WSIA 4FZXC 2D0AA 3OS2A 4FM2A 1T8EA 1LV5A 4FXDA 3B6PA 4EZ6A 4K8XA 3SYZA 1Q9YA 3NH2A 1F21A 2B6AA 2OPRA 3AA2A 3ZT3A 3KKSA 4N47A 3HL8A 1XI1A 2PZSA 1NK7A 3VQ8A 2DTUA 3AA5X 4DS5A 4CIEA 4BDZA 4FJIA 2X74A 2VG5A 4O0JA 4B9LA 1RTJA 3OYEA 1NJWA 4Z4IA 4CK1A 1KRPA 1ZBLA 4HHTA 4F3TA 4JRQA 3WNGA 1BGXT 3I0SA 4KTZA 3V9XA 3DI6A 1X9WA 3IS9A 3OJUA 3QETA 3AVHA 1NK8A 4PY5A 1HNIA 2OPPA 2FC0A 4FJXA 4M3TA 3VQCA 4DQQA 4KHQA 3HVTA 4CF8A 4XIUA 3SCXA 1NK6A 4CEEA 2PY5A 1L3UA 2VWJA 3RRHA 1U4BA 1VSIA 1Z25A 3IAYA 3OYLA 3V1RA 2OZMA 3LZJA 3V6DA 2HVHA 3RMCA 1HMVA 4F2SA 3DRSA 1SV5A 1KCFA 3K5LA 1W9HA 3AO3A 2KFZA 4FLVA 4O55A 2YKMA 2AJQA 2QXFA 1N5YA 5E41A 2HHUA 2GV9A 3OYJA 3C94A 2HNZA 3AO5A 5CYMA 1IKXA 3SNNA 3CFPA 4L8RB 3TAPA 2E6MA 4CF2A 3ZSWA 1Q8IA 3L2RA 4NYNA 2XY6A 1LAVA 4ID5A 3OYGA 3SI6A 4B9TA 4CJRA 4CHPA 4I7FA 3AVMA 1VSKA 2Z1GA 3VQ7A 1CXUA 3KK3A 1JLGA 1WSHA 4NCAA 4CJPA 3VA3A 2B4JA 4BWJA 3VN5A 4FM0A 4KHNA 1EX4A 3MEEA 3VQPA 2G8KA 1BIZA 5K14A 1Y97A 4AHCA 3KD1E 4R5PA 3HO1A 2X6NA 3QO9A 3V4IA 1SKWA 2JLEA 2G8WA 1BI4B 1EP4A 1RBVA 1S9GA 3AVBA 1UWBA 4C8NA 3QNNA 4FW1A 4M3RA 2D5RA 3VA0A 1VSEA 1RT7A 4OKEA 1D9DA 3VQEA 2GBZA 3AV9A 4E19A 1VSDA 1TKDA 1RT4A 3ZCMA 5HP1A 5HLFA 4CJ5A 4CJFA 4C8KA 5J2QA 2OA8A 3KD5E 1RDDA 4AHRA 3SQ4A 3KLIA 3MEDA 2XY7A 1NK5A 4FJMA 2HHTA 3CQ8A 3DMJA 3V1QA 4CGGA 1CXQA 4CK2A 3S9HA 3MEGA 4DMNA 2XY5A 1TL1A 1CZBA 1C1CA 1TL3A 2YV0X 2HB5A 3KIOA 4IFVA 3ZT4A 4CJ3A 2BDPA 4KRFA 3KJVA 3ZSXA 3ZSRA 4FJ9A 1RBTA 1JLEA 2E6LA 4J2BA 2F8TA 4E89A 2KZZA 2VG7A 3VQ5A 3G10A 1J9AA 1KFDA 4CEBA 2G8IA 3NF8A 1T05A 1S5JA 5I3UA 1J53A 2ATQA 2FBTA 1ASUA 1NK4A 4HCBA 2KQ2A 2O4GA 1S1TA 3LPTA 3LP1A 4IG0A 4CJ4A 3LDSA 4BE2A 3LWMA 4DU3A 4WE1A 4CESA 3ITHA 3TARA 3KK1A 1VSHA 3L3VA 4CFDA 4CIFA 4EZ9A 1BL3A 2RN2A 5D3GA 2HNDA 4OLAA 3TR8A 3I0RA 1QE1A 3P1GA 3TAEA 4GW6A 4DQPA 4FZYA 1B92A 1S1WA 4AILC 2PYJA 3NE6A 1N6QA 3F73A 4K8ZA 2YHBA 1NJYA 4CHYA 2Z1HA 3M8RA 3O3FA 2YHAA 4W5NA 1YVUA 3ALYA 1C0TA 4KTQA 5FROA 1QHTA 2HW3A 2HHQA 3OS1A 4DG1A 3ZSOA 5HRPA 1T7PA 1TKXA 4DTSA 1TVRA 4RW4A 3HK2A 4JS4A 4ICLA 3OYIA 4CEAA 3NH0A 1BHLA 2RF2A 3QEIA 3KLHA 1XHZA 3SQ1A 2YKNA 2IC3A 4W5OA 4FVMA 3RMAA 4B9MA 3QEVA 1A5VA 3MXMA 4F3OA 1RDBA 3VQ4A 2G8HA 4UQGA 1DTQA 1WAFA 3VQ9A 4JRPA 1G15A 1WLJA 1KFSA 1QS4A 3EYZA 1X9MA 3AA3A 1R0AA 1WSFA 2I5JA 3T19A 2OPSA 5HRNA 3K5MA 1BQNA 4ELTA 3O3GA 4CEDA 4DFMA 1LWFA 1UAXA 1HNVA 4Z0UA 4FLYA 4OPKA 3SJJA 4E1MA 4RW8A 1UA0A 4B3OA 5FRMA 2Q3SA 3LANA 1T03A 1IKVA 1HJRA 1Z26A 3DLKA 4OJRA 4NYFA 3OYHA 3ZSVA 4M3UA 1YTUA 3DM2A 4J2DA 1NKCA 3D45A 1BCMA 2XHBA 3V9SA 1RBRA 3SQ0A 2P5GA 1YT3A 1VSFA 3BGRA 3NCIA 4M3YA 4FJ8A 5HRRA 4W5RA 1RNHA 4FJLA 3SZ2A 2F96A 1XHXA 2A1SA 3HSTB 2GUIA 1WSEA 1UOCA 4C8OA 1KVBA 3VQBA 3L2QA 4YFUA 4OKJA 2FBYA 1JLFA 5DMRA 4FK4A 2YNIA 4HUFA 1LWEA 1L3SA 1L3TA 4CJEA 4HTUA 3ULDA 4CHZA 1TK8A 3I8DA 2XRIA 4CHNA 1ZBFA 2PYLA 3ZSQA 1IO2A 1SKRA 4FYDA 4AH9A 1RTDA 4B8CA 1KLMA 1X1PA 4OPJA 4FJGA 3OYBA 1KVAA 5CYQA 5J2NA 3NHGA 1RT5A 4BWMA 2HHXA 3OVNA 4PQUA 1LWCA 4E3SA 3HPGA 4ZHRA 3L2UA 1QSSA 5J2PA 3LAKA 5HRSA 4LH5A 4KFBA 5CY4A 4B08A 3D0PA 1DLOA 2XY8A 2YNHA 4Y1CA 2FBVA 2ZQBA 4CGFA 4NCGA 1TGOA 4CGJA 3HJFA 1ASWA 3CM6A 5KGXA 1RILA 1WSJA 3OYDA 4CF1A 2D0BA 4DU1A 1S1VA 1REVA 3QLHA 1WAJA 4OKKA 3V1OA 4B8AB 4BDYA 4H4MA 1W0HA 4M41A 2ITGA 4QOZB 3DYAA 3NH1A 2G8FA 4KREA 1RDAA 3LP2A 3NDKA 3ZSZA 3NF7A 4IG3A 2XO7A 1SKSA 1C6VA 3VQQA 3EZ5A 4BACA 1VK0A 2QKKA 4W5QA 1B9DA 4LY7A 1A5WA 3CFOA 3DLEA 1TKZA 3AVLA 4OVLA 5EU7A 4C8MA 3DLBA 1TV6A 3HVRA 3RR7A 1ITGA 4LSLA 4KTWA 1B9FA 1JXBA 4JS5A 1XWLA 3KLEA 4DSEA 3AO2A 2P51A 5KI6A 3LPUA 4IDKA 3DRPA 1SL0A 3RMBA 1S6PA 1JL2A 3SUQA 3NGIA 5C42A 4DTNA 3VQAA 1VRUA 2HVIA 3AO4A 1Q9XA 4CJLA 4M45A 4DTMA 2DFFA 4CEFA 4CGHA 3ZSYA 1LAWA 4CE9A 1TK5A 1HYSA 4YNQA 4DLGA 3M8PA 1UA1A 3O3HA 1L5UA 4Z4GA 3OYKA 4FM1A 1FKPA 3HPHA 3IRXA 4ID1A 3WNFA 1C1BA 4DF8A 3SPYA 4B9UA 4DSJA 2O4IA 3L2VA 4PWDA 1VSMA 4CJSA 4OGCA 1CZ9A 3K58A 1FKOA 4FCYA 3BDPA 5FRNA 2QK9A 1U04A 3C6TA 4N76A 3AVJA 3DRRA 4N56A 4NCBA 2KW4A 3PX4A 2NUBA 4O4GA 4B9VA 4FJKA 4I9QA 1ZBHA 2EX3A 4KAZA 1NJZA 1KLNA 4M3WA 4KI4A 4H8KA 3SQ2A 4CCHA 4CFCA 1D8YA 4QAGA 4CECA 1HYVA 5I42A 3AO1A 4DSFA 2QKBA 4Q0BA 2G8UA 2IS3A 1K6YA 3NF9A 3T1AA 3RWUA 4KHYA 3RTVA 4AHUA 3JYTA 3TWHA 1FXXA 3QNOA 4E7JA 3B6OA 4I9LA 3DLGA 5KRTA 3LZIA 4F8RA 2VG6A 3S3NA 3AVKA 5C24A 3SV3A 1NJXA 3TAMA 5JS2A 4I2QA 5HBMA 3MXIA 4DSLA 2Z1JA 4Z4EA 4IBNA 4FLWA 4DSKA 4PUOA 2EHGA 3DOLA 3LALA 3QIOA 4O5BA 3M8SA 4LH4A 1S6QA 1C0MA 5DK5A 4B9SA 4CJQA 4OLBA 3S3MA 4RG8A 1IG9A 1KSPA 3AVCA 1BI4A 2IDOA 2LSNA 1YTAA 1JLBA 3HM9A 2VWKA 3A2FA 1CLQA 4CEQA 1HQUA 4O44A 3NAEA 1GOBA 3QERA 1RT6A 3M8QA 4LD0A 4FLUA 1XC9A 1NOYA 3C6UA 4J2EA 3ASMA 4M42A 4CK3A 4OGEA 4CJTA 3HPOA 4KPYA 1S9EA 3CG7A 1NOZA 1BIUA 3MXJA 1I3AA 4KB0A 1VSJA 1I39A 1ZBUA 2B5JA 3K2PA 4KV8A 1LW2A 4CFBA 1JLAA 3IG1A 2Y1IA 2X78A 4FLZA 4W5TA 2IGIA 5SWMA 4LSNA 3HXMA 3PY8A 4EP4A 1J54A 1DTTA 3HP6A 4HUEA 2OYQA 1QQCA 3SUNA 4E7IA 2BE2A 3QINA 3TABA 3RR8A 4CEOA 2DFEA 3AVGA 3L2WA 3V9ZA 1D9FA 2DY4A 1A5XA 1VSLA 1D5AA 3C95A 1ZYQA 4KHUA 1TAQA 4DFPA 4FK2A 4ZTFA 4CF0A 1KTQA 2JGUA 3V81A 1SUQA 1X9SA 1NK9A 4FZZA 3HYFA 4CJKA 4DTJA 4CFAA 4DWIA 4C8LA 1JXEA 4CGDA 4FJ7A 1RTHA 4N5SA 2DFHA 3LP0A 1RT3A 5J1EA 4CHQA 3U6FA 2F8SA 3QEPA 4CJVA 3OYAA 1BCOA 4F2RA 4KI6A 3WNHA 3TAQA 3AVFA 2KFNA 4RW7A 4FLTA 1EXQA 4KB1A 3KLFA 4BE1A 4DTUA 1LW0A 1TKTA 4QCLA 3PO5A 3PX0A 3CYMA 4AHVA 4DFJA 2P1JA 2D0CA 3QIPA 4DQRA 3SUOA 1TAUA 3DLRA 1SL2A 2P5OA 4Z4FA 1QSYA 4FJJA 4IKFA 3DLHA 2HNYA 4DTXA 3SUPA 2E4LA 4DQSA 4PA1A 1MU2A 3WNEA 1L3VA 3KTQA 1S1XA 1ASVA 1WSGA 3ZT1A 2X6SA 3JSMA 3K59A 4G1QA 2RKIA 1RCHA 3NFAA 4DFKA 4AHSA 3K57A 4Z4CA 4BDPA 1TK0A 4Q5VA 3L8BA 4E7HA 4E7LA 3QEWA 3TAFA 3NGZA 4DSIA 1NK0A 4RW9A 4FLXA 4KHWA 4CIGA 3HT3A 2G8VA 4N41A 3K5NA 1BISA 1C1AA 2WOMA 4RW6A 4CHOA 5FDLA 3AVNA 3OYMA 3OYCA 4DLEA 4CGIA 3O4NA 3DOKA 1RTIA 4H4OA 4Y1DA 1JLCA 1WNSA 5C25A 3PX6A 1GOAA 3LP3A 4DTRA 2R7YA 2KZMA 3LAMA 4CJUA 4CEZA 2OPQA 1EETA 3RRGA 3H08A 3OY9A 4ZTJA 3E01A 4DQIA 3ZT2A 3P83D 2ETJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RBU A;  1IKY A;  1RT1 A;  1GOC A;  3HP9 A;  3VQ6 A;  3SPZ A;  3VQD A;  5CZ2 A;  4CJW A;  4BE0 A;  1JL1 A;  1WN7 A;  3MAQ A;  2YNG A;  5T7B A;  4MQ3 A;  4M3X A;  4FJ5 A;  4FK0 A;  3TAN A;  1O1W A;  3ISN C;  3AVA A;  1HPZ A;  4F4K A;  3RMD A;  3OJS A;  4E0D A;  5KRS A;  3KK2 A;  4HCC A;  1J5O A;  4ELU A;  4ELV A;  3LWL A;  3PUF A;  4O0I A;  3V9W A;  4B9N A;  3EY1 A;  2WON A;  4Z4H A;  3AVI A;  1EKE A;  3NF6 A;  3V9U A;  5J2M A;  1JKH A;  1U49 A;  1NKE A;  1KVC A;  4CER A;  3S3O A;  3CFR A;  4FJH A;  2Z1I A;  1IKW A;  3QES A;  2A1R A;  2HMI A;  1U47 A;  5KGW A;  4J2A A;  3CM5 A;  1HYZ A;  2FBX A;  1VRT A;  1NKB A;  2BAN A;  4IFY A;  1IH7 A;  1RBS A;  4FW2 A;  4GVM A;  2W42 A;  3QEX A;  4KHS A;  2HHS A;  3U3G A;  1QTM A;  5HRO A;  2IAJ A;  3O4Q A;  3F9K A;  4DTO A;  4DF4 A;  1QSL A;  3MEC A;  4I2P A;  1FK9 A;  4DU4 A;  1HQE A;  3PV8 A;  2YNF A;  4TSX A;  4HUG A;  1SL1 A;  3G0Z A;  2ZD1 A;  3NBP A;  1RT2 A;  2KTQ A;  3THV A;  4M3Z A;  2HHV A;  1U45 A;  1HRH A;  3ZT0 A;  4KKO A;  3TI0 A;  3UIQ A;  3U3Y A;  1C0U A;  2ZE2 A;  3OYF A;  2HHW A;  1S1U A;  5JS1 A;  2OZS A;  3AA4 A;  2RPI A;  3KLG A;  3FFI A;  3OYN A;  3SV4 A;  4DTP A;  3PO4 A;  4HVJ A;  4JLH A;  4E7K A;  3L3U A;  1RDC A;  2BGG A;  4CF9 A;  4FJN A;  1BQM A;  4E1N A;  4AHT A;  4DS4 A;  3TAG A;  2IOC A;  3KKR A;  4KO0 A;  1JLQ A;  4GMJ B;  5CZ1 A;  5KTQ A;  4EP5 A;  2Y1J A;  1U48 A;  5SZT A;  3T3F A;  4MFB A;  1ZBI A;  3K5O A;  3NGY A;  3OS0 A;  3P5J A;  1WSI A;  4FZX C;  2D0A A;  3OS2 A;  4FM2 A;  1T8E A;  1LV5 A;  4FXD A;  3B6P A;  4EZ6 A;  4K8X A;  3SYZ A;  1Q9Y A;  3NH2 A;  1F21 A;  2B6A A;  2OPR A;  3AA2 A;  3ZT3 A;  3KKS A;  4N47 A;  3HL8 A;  1XI1 A;  2PZS A;  1NK7 A;  3VQ8 A;  2DTU A;  3AA5 X;  4DS5 A;  4CIE A;  4BDZ A;  4FJI A;  2X74 A;  2VG5 A;  4O0J A;  4B9L A;  1RTJ A;  3OYE A;  1NJW A;  4Z4I A;  4CK1 A;  1KRP A;  1ZBL A;  4HHT A;  4F3T A;  4JRQ A;  3WNG A;  1BGX T;  3I0S A;  4KTZ A;  3V9X A;  3DI6 A;  1X9W A;  3IS9 A;  3OJU A;  3QET A;  3AVH A;  1NK8 A;  4PY5 A;  1HNI A;  2OPP A;  2FC0 A;  4FJX A;  4M3T A;  3VQC A;  4DQQ A;  4KHQ A;  3HVT A;  4CF8 A;  4XIU A;  3SCX A;  1NK6 A;  4CEE A;  2PY5 A;  1L3U A;  2VWJ A;  3RRH A;  1U4B A;  1VSI A;  1Z25 A;  3IAY A;  3OYL A;  3V1R A;  2OZM A;  3LZJ A;  3V6D A;  2HVH A;  3RMC A;  1HMV A;  4F2S A;  3DRS A;  1SV5 A;  1KCF A;  3K5L A;  1W9H A;  3AO3 A;  2KFZ A;  4FLV A;  4O55 A;  2YKM A;  2AJQ A;  2QXF A;  1N5Y A;  5E41 A;  2HHU A;  2GV9 A;  3OYJ A;  3C94 A;  2HNZ A;  3AO5 A;  5CYM A;  1IKX A;  3SNN A;  3CFP A;  4L8R B;  3TAP A;  2E6M A;  4CF2 A;  3ZSW A;  1Q8I A;  3L2R A;  4NYN A;  2XY6 A;  1LAV A;  4ID5 A;  3OYG A;  3SI6 A;  4B9T A;  4CJR A;  4CHP A;  4I7F A;  3AVM A;  1VSK A;  2Z1G A;  3VQ7 A;  1CXU A;  3KK3 A;  1JLG A;  1WSH A;  4NCA A;  4CJP A;  3VA3 A;  2B4J A;  4BWJ A;  3VN5 A;  4FM0 A;  4KHN A;  1EX4 A;  3MEE A;  3VQP A;  2G8K A;  1BIZ A;  5K14 A;  1Y97 A;  4AHC A;  3KD1 E;  4R5P A;  3HO1 A;  2X6N A;  3QO9 A;  3V4I A;  1SKW A;  2JLE A;  2G8W A;  1BI4 B;  1EP4 A;  1RBV A;  1S9G A;  3AVB A;  1UWB A;  4C8N A;  3QNN A;  4FW1 A;  4M3R A;  2D5R A;  3VA0 A;  1VSE A;  1RT7 A;  4OKE A;  1D9D A;  3VQE A;  2GBZ A;  3AV9 A;  4E19 A;  1VSD A;  1TKD A;  1RT4 A;  3ZCM A;  5HP1 A;  5HLF A;  4CJ5 A;  4CJF A;  4C8K A;  5J2Q A;  2OA8 A;  3KD5 E;  1RDD A;  4AHR A;  3SQ4 A;  3KLI A;  3MED A;  2XY7 A;  1NK5 A;  4FJM A;  2HHT A;  3CQ8 A;  3DMJ A;  3V1Q A;  4CGG A;  1CXQ A;  4CK2 A;  3S9H A;  3MEG A;  4DMN A;  2XY5 A;  1TL1 A;  1CZB A;  1C1C A;  1TL3 A;  2YV0 X;  2HB5 A;  3KIO A;  4IFV A;  3ZT4 A;  4CJ3 A;  2BDP A;  4KRF A;  3KJV A;  3ZSX A;  3ZSR A;  4FJ9 A;  1RBT A;  1JLE A;  2E6L A;  4J2B A;  2F8T A;  4E89 A;  2KZZ A;  2VG7 A;  3VQ5 A;  3G10 A;  1J9A A;  1KFD A;  4CEB A;  2G8I A;  3NF8 A;  1T05 A;  1S5J A;  5I3U A;  1J53 A;  2ATQ A;  2FBT A;  1ASU A;  1NK4 A;  4HCB A;  2KQ2 A;  2O4G A;  1S1T A;  3LPT A;  3LP1 A;  4IG0 A;  4CJ4 A;  3LDS A;  4BE2 A;  3LWM A;  4DU3 A;  4WE1 A;  4CES A;  3ITH A;  3TAR A;  3KK1 A;  1VSH A;  3L3V A;  4CFD A;  4CIF A;  4EZ9 A;  1BL3 A;  2RN2 A;  5D3G A;  2HND A;  4OLA A;  3TR8 A;  3I0R A;  1QE1 A;  3P1G A;  3TAE A;  4GW6 A;  4DQP A;  4FZY A;  1B92 A;  1S1W A;  4AIL C;  2PYJ A;  3NE6 A;  1N6Q A;  3F73 A;  4K8Z A;  2YHB A;  1NJY A;  4CHY A;  2Z1H A;  3M8R A;  3O3F A;  2YHA A;  4W5N A;  1YVU A;  3ALY A;  1C0T A;  4KTQ A;  5FRO A;  1QHT A;  2HW3 A;  2HHQ A;  3OS1 A;  4DG1 A;  3ZSO A;  5HRP A;  1T7P A;  1TKX A;  4DTS A;  1TVR A;  4RW4 A;  3HK2 A;  4JS4 A;  4ICL A;  3OYI A;  4CEA A;  3NH0 A;  1BHL A;  2RF2 A;  3QEI A;  3KLH A;  1XHZ A;  3SQ1 A;  2YKN A;  2IC3 A;  4W5O A;  4FVM A;  3RMA A;  4B9M A;  3QEV A;  1A5V A;  3MXM A;  4F3O A;  1RDB A;  3VQ4 A;  2G8H A;  4UQG A;  1DTQ A;  1WAF A;  3VQ9 A;  4JRP A;  1G15 A;  1WLJ A;  1KFS A;  1QS4 A;  3EYZ A;  1X9M A;  3AA3 A;  1R0A A;  1WSF A;  2I5J A;  3T19 A;  2OPS A;  5HRN A;  3K5M A;  1BQN A;  4ELT A;  3O3G A;  4CED A;  4DFM A;  1LWF A;  1UAX A;  1HNV A;  4Z0U A;  4FLY A;  4OPK A;  3SJJ A;  4E1M A;  4RW8 A;  1UA0 A;  4B3O A;  5FRM A;  2Q3S A;  3LAN A;  1T03 A;  1IKV A;  1HJR A;  1Z26 A;  3DLK A;  4OJR A;  4NYF A;  3OYH A;  3ZSV A;  4M3U A;  1YTU A;  3DM2 A;  4J2D A;  1NKC A;  3D45 A;  1BCM A;  2XHB A;  3V9S A;  1RBR A;  3SQ0 A;  2P5G A;  1YT3 A;  1VSF A;  3BGR A;  3NCI A;  4M3Y A;  4FJ8 A;  5HRR A;  4W5R A;  1RNH A;  4FJL A;  3SZ2 A;  2F96 A;  1XHX A;  2A1S A;  3HST B;  2GUI A;  1WSE A;  1UOC A;  4C8O A;  1KVB A;  3VQB A;  3L2Q A;  4YFU A;  4OKJ A;  2FBY A;  1JLF A;  5DMR A;  4FK4 A;  2YNI A;  4HUF A;  1LWE A;  1L3S A;  1L3T A;  4CJE A;  4HTU A;  3ULD A;  4CHZ A;  1TK8 A;  3I8D A;  2XRI A;  4CHN A;  1ZBF A;  2PYL A;  3ZSQ A;  1IO2 A;  1SKR A;  4FYD A;  4AH9 A;  1RTD A;  4B8C A;  1KLM A;  1X1P A;  4OPJ A;  4FJG A;  3OYB A;  1KVA A;  5CYQ A;  5J2N A;  3NHG A;  1RT5 A;  4BWM A;  2HHX A;  3OVN A;  4PQU A;  1LWC A;  4E3S A;  3HPG A;  4ZHR A;  3L2U A;  1QSS A;  5J2P A;  3LAK A;  5HRS A;  4LH5 A;  4KFB A;  5CY4 A;  4B08 A;  3D0P A;  1DLO A;  2XY8 A;  2YNH A;  4Y1C A;  2FBV A;  2ZQB A;  4CGF A;  4NCG A;  1TGO A;  4CGJ A;  3HJF A;  1ASW A;  3CM6 A;  5KGX A;  1RIL A;  1WSJ A;  3OYD A;  4CF1 A;  2D0B A;  4DU1 A;  1S1V A;  1REV A;  3QLH A;  1WAJ A;  4OKK A;  3V1O A;  4B8A B;  4BDY A;  4H4M A;  1W0H A;  4M41 A;  2ITG A;  4QOZ B;  3DYA A;  3NH1 A;  2G8F A;  4KRE A;  1RDA A;  3LP2 A;  3NDK A;  3ZSZ A;  3NF7 A;  4IG3 A;  2XO7 A;  1SKS A;  1C6V A;  3VQQ A;  3EZ5 A;  4BAC A;  1VK0 A;  2QKK A;  4W5Q A;  1B9D A;  4LY7 A;  1A5W A;  3CFO A;  3DLE A;  1TKZ A;  3AVL A;  4OVL A;  5EU7 A;  4C8M A;  3DLB A;  1TV6 A;  3HVR A;  3RR7 A;  1ITG A;  4LSL A;  4KTW A;  1B9F A;  1JXB A;  4JS5 A;  1XWL A;  3KLE A;  4DSE A;  3AO2 A;  2P51 A;  5KI6 A;  3LPU A;  4IDK A;  3DRP A;  1SL0 A;  3RMB A;  1S6P A;  1JL2 A;  3SUQ A;  3NGI A;  5C42 A;  4DTN A;  3VQA A;  1VRU A;  2HVI A;  3AO4 A;  1Q9X A;  4CJL A;  4M45 A;  4DTM A;  2DFF A;  4CEF A;  4CGH A;  3ZSY A;  1LAW A;  4CE9 A;  1TK5 A;  1HYS A;  4YNQ A;  4DLG A;  3M8P A;  1UA1 A;  3O3H A;  1L5U A;  4Z4G A;  3OYK A;  4FM1 A;  1FKP A;  3HPH A;  3IRX A;  4ID1 A;  3WNF A;  1C1B A;  4DF8 A;  3SPY A;  4B9U A;  4DSJ A;  2O4I A;  3L2V A;  4PWD A;  1VSM A;  4CJS A;  4OGC A;  1CZ9 A;  3K58 A;  1FKO A;  4FCY A;  3BDP A;  5FRN A;  2QK9 A;  1U04 A;  3C6T A;  4N76 A;  3AVJ A;  3DRR A;  4N56 A;  4NCB A;  2KW4 A;  3PX4 A;  2NUB A;  4O4G A;  4B9V A;  4FJK A;  4I9Q A;  1ZBH A;  2EX3 A;  4KAZ A;  1NJZ A;  1KLN A;  4M3W A;  4KI4 A;  4H8K A;  3SQ2 A;  4CCH A;  4CFC A;  1D8Y A;  4QAG A;  4CEC A;  1HYV A;  5I42 A;  3AO1 A;  4DSF A;  2QKB A;  4Q0B A;  2G8U A;  2IS3 A;  1K6Y A;  3NF9 A;  3T1A A;  3RWU A;  4KHY A;  3RTV A;  4AHU A;  3JYT A;  3TWH A;  1FXX A;  3QNO A;  4E7J A;  3B6O A;  4I9L A;  3DLG A;  5KRT A;  3LZI A;  4F8R A;  2VG6 A;  3S3N A;  3AVK A;  5C24 A;  3SV3 A;  1NJX A;  3TAM A;  5JS2 A;  4I2Q A;  5HBM A;  3MXI A;  4DSL A;  2Z1J A;  4Z4E A;  4IBN A;  4FLW A;  4DSK A;  4PUO A;  2EHG A;  3DOL A;  3LAL A;  3QIO A;  4O5B A;  3M8S A;  4LH4 A;  1S6Q A;  1C0M A;  5DK5 A;  4B9S A;  4CJQ A;  4OLB A;  3S3M A;  4RG8 A;  1IG9 A;  1KSP A;  3AVC A;  1BI4 A;  2IDO A;  2LSN A;  1YTA A;  1JLB A;  3HM9 A;  2VWK A;  3A2F A;  1CLQ A;  4CEQ A;  1HQU A;  4O44 A;  3NAE A;  1GOB A;  3QER A;  1RT6 A;  3M8Q A;  4LD0 A;  4FLU A;  1XC9 A;  1NOY A;  3C6U A;  4J2E A;  3ASM A;  4M42 A;  4CK3 A;  4OGE A;  4CJT A;  3HPO A;  4KPY A;  1S9E A;  3CG7 A;  1NOZ A;  1BIU A;  3MXJ A;  1I3A A;  4KB0 A;  1VSJ A;  1I39 A;  1ZBU A;  2B5J A;  3K2P A;  4KV8 A;  1LW2 A;  4CFB A;  1JLA A;  3IG1 A;  2Y1I A;  2X78 A;  4FLZ A;  4W5T A;  2IGI A;  5SWM A;  4LSN A;  3HXM A;  3PY8 A;  4EP4 A;  1J54 A;  1DTT A;  3HP6 A;  4HUE A;  2OYQ A;  1QQC A;  3SUN A;  4E7I A;  2BE2 A;  3QIN A;  3TAB A;  3RR8 A;  4CEO A;  2DFE A;  3AVG A;  3L2W A;  3V9Z A;  1D9F A;  2DY4 A;  1A5X A;  1VSL A;  1D5A A;  3C95 A;  1ZYQ A;  4KHU A;  1TAQ A;  4DFP A;  4FK2 A;  4ZTF A;  4CF0 A;  1KTQ A;  2JGU A;  3V81 A;  1SUQ A;  1X9S A;  1NK9 A;  4FZZ A;  3HYF A;  4CJK A;  4DTJ A;  4CFA A;  4DWI A;  4C8L A;  1JXE A;  4CGD A;  4FJ7 A;  1RTH A;  4N5S A;  2DFH A;  3LP0 A;  1RT3 A;  5J1E A;  4CHQ A;  3U6F A;  2F8S A;  3QEP A;  4CJV A;  3OYA A;  1BCO A;  4F2R A;  4KI6 A;  3WNH A;  3TAQ A;  3AVF A;  2KFN A;  4RW7 A;  4FLT A;  1EXQ A;  4KB1 A;  3KLF A;  4BE1 A;  4DTU A;  1LW0 A;  1TKT A;  4QCL A;  3PO5 A;  3PX0 A;  3CYM A;  4AHV A;  4DFJ A;  2P1J A;  2D0C A;  3QIP A;  4DQR A;  3SUO A;  1TAU A;  3DLR A;  1SL2 A;  2P5O A;  4Z4F A;  1QSY A;  4FJJ A;  4IKF A;  3DLH A;  2HNY A;  4DTX A;  3SUP A;  2E4L A;  4DQS A;  4PA1 A;  1MU2 A;  3WNE A;  1L3V A;  3KTQ A;  1S1X A;  1ASV A;  1WSG A;  3ZT1 A;  2X6S A;  3JSM A;  3K59 A;  4G1Q A;  2RKI A;  1RCH A;  3NFA A;  4DFK A;  4AHS A;  3K57 A;  4Z4C A;  4BDP A;  1TK0 A;  4Q5V A;  3L8B A;  4E7H A;  4E7L A;  3QEW A;  3TAF A;  3NGZ A;  4DSI A;  1NK0 A;  4RW9 A;  4FLX A;  4KHW A;  4CIG A;  3HT3 A;  2G8V A;  4N41 A;  3K5N A;  1BIS A;  1C1A A;  2WOM A;  4RW6 A;  4CHO A;  5FDL A;  3AVN A;  3OYM A;  3OYC A;  4DLE A;  4CGI A;  3O4N A;  3DOK A;  1RTI A;  4H4O A;  4Y1D A;  1JLC A;  1WNS A;  5C25 A;  3PX6 A;  1GOA A;  3LP3 A;  4DTR A;  2R7Y A;  2KZM A;  3LAM A;  4CJU A;  4CEZ A;  2OPQ A;  1EET A;  3RRG A;  3H08 A;  3OY9 A;  4ZTJ A;  3E01 A;  4DQI A;  3ZT2 A;  3P83 D;  2ETJ A; 
#chains in the Genus database with same CATH topology
 3VQ6 A;  4CZI A;  5AZJ A;  4BC4 A;  3U9D A;  2RE2 A;  3VTH A;  4CZJ A;  5T7B A;  4MQ3 A;  4M3X A;  3Q7B A;  1JCF A;  4PKG A;  4E0D A;  4ELV A;  3LWL A;  4O0I A;  2UYT A;  3EY1 A;  2WON A;  3P38 A;  5J2M A;  3V9U A;  1JKH A;  4M7X A;  4B1Z A;  3CFR A;  1NGB A;  2A1R A;  1U47 A;  2FBX A;  4BRA A;  2Q2R A;  2BAN A;  1QTM A;  3NVK A;  2YHW A;  4DTO A;  4DF4 A;  3Q7C A;  1BOT O;  4I2P A;  3G25 A;  1RT2 A;  3UKR A;  4IZ9 A;  2KTQ A;  4M3Z A;  2HHV A;  4AF1 A;  1U45 A;  4KKO A;  3TI0 A;  3FE1 A;  5JS1 A;  3AA4 A;  3KLG A;  4HVJ A;  2Q31 A;  5KQ8 A;  4MDA A;  3L3U A;  3HSC A;  3HBT A;  3TAG A;  2QTD A;  2IOC A;  1JLQ A;  4GMJ B;  3EKS A;  2Y1J A;  1ZBI A;  5SZT A;  1GLC G;  4MFB A;  3K5O A;  4A57 A;  4DUZ K;  3OS2 A;  3JXU A;  2V7Y A;  1F21 A;  4N47 A;  1XI1 A;  2PZS A;  3O9S A;  3VQ8 A;  2DTU A;  4XH5 A;  1GLE G;  4GV3 A;  4O0J A;  2JWL A;  3OYE A;  1NJW A;  3HTV A;  3JS6 A;  4X64 K;  4JRQ A;  1KQS M;  1BGX T;  2HBM A;  1X3M A;  3I0S A;  1HJO A;  3IS9 A;  3CCM N;  3AVH A;  5BPL A;  4GVE A;  2HOE A;  2OPP A;  4YOX A;  4FJX A;  4M3T A;  1NWK A;  4DQQ A;  4CF8 A;  4CEE A;  2PY5 A;  1L3U A;  1U4B A;  1VQ4 N;  3VEV A;  3MCA B;  3EO3 A;  4G9Z A;  5BR8 K;  3K5L A;  2VGM A;  4JK7 A;  4O55 A;  5FPE A;  4R79 A;  2QXF A;  3AO5 A;  4DV6 K;  3TAP A;  3RVC A;  3ZSW A;  3KK7 A;  4NYN A;  4XH1 A;  1LAV A;  3GOI A;  4ID5 A;  2Z1G A;  3KK3 A;  4CJP A;  1NG9 A;  1EX4 A;  3MEE A;  3VES A;  2EWS A;  4WYB A;  5AQF A;  3WXL A;  1Q81 O;  4AHC A;  4CI6 A;  1SKW A;  3V4I A;  3WUH A;  2G8W A;  1RBV A;  1S9G A;  3AVB A;  4NXN K;  1VQN N;  4FW1 A;  3VA0 A;  1VSE A;  3AV9 A;  1ESV A;  4JV5 K;  3ZCM A;  3O9T A;  3KD5 E;  4C8K A;  3VEW A;  4DR3 K;  1NK5 A;  2WTU A;  4DV4 K;  1KAY A;  2QWN A;  3TSP A;  3S9H A;  3MEG A;  4DMN A;  2XY5 A;  1TL3 A;  1C1C A;  2YV0 X;  3ZT4 A;  3U4L A;  2F9W A;  4CBX A;  5BPM A;  5F1X A;  2KZZ A;  2VG7 A;  1EWR A;  1NGI A;  1J9A A;  4MLH A;  4Z94 A;  1HR0 K;  2ZJQ L;  2FBT A;  4A2B A;  4JKC A;  1NK4 A;  4CJ4 A;  3LDS A;  4KH4 A;  1Q86 O;  4WE1 A;  4BRK A;  1N34 K;  1VQ7 N;  5CE3 A;  3I0R A;  3N4Q A;  1N6Q A;  3J80 O;  4JKF A;  4BRF A;  1NJY A;  2Z1H A;  4W5N A;  3D7E O;  3B8A X;  3E9L A;  2GEL A;  4X66 K;  2HW3 A;  3ULE B;  4WF9 L;  3OS1 A;  4DG1 A;  3HK2 A;  1TVR A;  4ICL A;  4CEA A;  1IBK K;  5M1N A;  3D2F B;  3O9U A;  3QEV A;  1RDB A;  1ILY A;  4BR5 A;  1YJN N;  1WAF A;  1WLJ A;  2I5J A;  3T19 A;  1IV0 A;  5AFU A;  2D4W A;  4BRH A;  1UAX A;  4OPK A;  2I7N A;  4RW8 A;  1UA0 A;  4XH4 A;  4A2A A;  3LAN A;  1HJR A;  4IJA A;  3KVG A;  4O8K A;  3OYH A;  4M3U A;  1DT9 A;  5M1F A;  2P5G A;  2P9S B;  4JKA A;  2O8B B;  4M3Y A;  1JCE A;  4FJL A;  2F96 A;  3BY5 A;  3CCL N;  3HST B;  2PBD A;  1UOC A;  5AQS A;  4C8O A;  3G6E N;  3L2Q A;  3T69 A;  5DM7 L;  1QVF M;  4EFH A;  4H5W A;  4HUF A;  1L3S A;  4CJE A;  4BG8 A;  1EQY A;  2XRI A;  4CHN A;  2PYL A;  1RDW X;  1X1P A;  4PQU A;  3HPG A;  4ZHR A;  1N8R O;  1QSS A;  3LAK A;  3QDK A;  4KFB A;  4B08 A;  4J8F A;  2ZQB A;  1BO5 O;  4NCG A;  5FPM A;  1KD1 O;  4IEE A;  4FOI A;  2D0B A;  2E2O A;  1QQM A;  4FWN A;  3HOS A;  4LF6 K;  3CJA A;  3MX2 A;  4H4M A;  3OA9 A;  4M41 A;  2ITG A;  3DYA A;  5AQG A;  2D1K A;  2XO7 A;  2JWK A;  3D2E A;  3U8X A;  3VQQ A;  1JCG A;  1VK0 A;  2QKK A;  3NVM A;  1TKZ A;  3AVL A;  3FFK B;  4BRO A;  1ITG A;  4QS7 A;  3QML A;  3KLE A;  1SL0 A;  3LDQ A;  3RMB A;  1S6P A;  1RGI A;  1JL2 A;  3THY A;  5C42 A;  2FF3 B;  1U6Z A;  2P9P A;  2DFF A;  1K8K B;  1XNQ K;  1LAW A;  3M8P A;  1L5U A;  4Z4G A;  3HPH A;  1VQK N;  2HBL A;  4ID1 A;  4JEP A;  4FVU A;  3M6G A;  3J7A P;  3BDP A;  2QK9 A;  4JHD A;  3C6T A;  3SAF A;  4N76 A;  2QWL A;  3BF1 A;  1U2V A;  3ZEU A;  3A5M C;  3P39 A;  4JKD A;  3U9Z A;  4B9V A;  4O4G A;  4FJK A;  1MDU B;  3QBX A;  3O1B A;  4GV9 A;  3CD6 N;  5A2Q O;  1KLN A;  4KI4 A;  4H8K A;  4C1N I;  4QAG A;  3AO1 A;  3WQU A;  2HF4 A;  2QKB A;  4B9Q A;  4Q0B A;  3T1A A;  1K6Y A;  3NF9 A;  5AQJ A;  3QNO A;  5KRT A;  2FSK A;  3AVK A;  1NJX A;  5C10 A;  4K42 A;  4H0O A;  4FLW A;  2YX6 A;  3DOL A;  3QIO A;  3M8S A;  4O5B A;  4B9S A;  1KSP A;  1YTA A;  1JLB A;  4L3Q A;  2VWK A;  3HM9 A;  1GOB A;  3FGU A;  3ASM A;  3DXK A;  4LFC K;  4FO0 A;  4JKH A;  4CJT A;  4U7B A;  3HPO A;  4KPY A;  2P9S A;  3CG7 A;  3OBY A;  1I39 A;  3K2P A;  2Y1I A;  4FWS A;  2X78 A;  3EL2 A;  3PY8 A;  1HUX A;  1J54 A;  1DTT A;  4O8U A;  3HP6 A;  2ZGZ A;  1YAG A;  3SUN A;  4BQZ A;  2BE2 A;  4X65 K;  3OHR A;  3AVG A;  1BU6 O;  3IUC A;  3S41 A;  1A5X A;  2YHY A;  4CZF A;  3KWG A;  4FK2 A;  3MN5 A;  4CFA A;  4DWI A;  3ENO A;  1JXE A;  4FJ7 A;  1DKG D;  4X62 K;  1BA0 A;  4CJV A;  3OYA A;  3WNH A;  4YOU A;  4MDB A;  1TKT A;  5BN9 A;  1YI2 N;  3CYM A;  3H1Q A;  3P4I A;  2F7T A;  3SUO A;  1SL2 A;  2P5O A;  4I6M A;  4IKF A;  4JKG B;  4DR6 K;  2F9T A;  1L3V A;  1NGC A;  1YIJ N;  2O8B A;  1N36 K;  3NFA A;  3K57 A;  2P9I A;  1TK0 A;  4E7L A;  1NK0 A;  3HM8 A;  4KHW A;  4N41 A;  1C1A A;  5FDL A;  3AVN A;  4JN4 A;  4H4O A;  5F2R A;  3SAH A;  4JKE A;  3LP3 A;  3LAM A;  3RRG A;  4ZTJ A;  2NRV A;  3E01 A;  3ZT2 A;  3P83 D;  1NBW A;  1RBU A;  1GOC A;  3HP9 A;  2YCH A;  4CJW A;  4BE0 A;  1WN7 A;  4GY2 B;  3MAQ A;  1NU0 A;  2YNG A;  1OVY A;  1WUA A;  2P9K B;  4F4K A;  4ELU A;  3VF6 A;  4I6M B;  1NGJ A;  2D0P A;  3NF6 A;  4DQ8 A;  4BR7 A;  5CHI A;  1KVC A;  4B3T K;  4FJH A;  3J8A A;  5KGW A;  1HYZ A;  3EE9 A;  4BQL A;  3O08 A;  1RBS A;  4FW2 A;  3QB0 A;  4CVN E;  2IAJ A;  3F9K A;  2E8A A;  2VCP A;  1FK9 A;  1ZXO A;  5C15 A;  4HUG A;  4LF8 K;  4ISF A;  3G0Z A;  3NBP A;  3THV A;  1HNZ K;  3ZT0 A;  3IDH A;  3UIQ A;  1C0U A;  3P31 A;  3FZF A;  4PL8 A;  1XMO K;  2HHW A;  1QZ6 A;  3SMP A;  5KPZ A;  1FW6 A;  5AQI A;  5AQN A;  4E7K A;  1RDC A;  2BGG A;  3C7N A;  4DS4 A;  2ZF5 O;  2V51 B;  4KO0 A;  5E84 A;  5AR0 A;  2W40 A;  3P5J A;  1WSI A;  3IFR A;  3VF4 A;  3KKS A;  4DV7 K;  4YDU C;  2X74 A;  4Z4I A;  1ZBL A;  1O13 A;  4B1V A;  4CJ7 A;  4KTZ A;  4PY5 A;  3H46 O;  3QET A;  1NK8 A;  3CCE N;  3LM2 A;  2FC0 A;  4IOA L;  4BRC A;  5JMV A;  1NK6 A;  1X3N A;  3O8M A;  2VWJ A;  3N4P A;  3RRH A;  1VSI A;  3IAY A;  5EX5 A;  2OZM A;  4M63 C;  1NJI O;  1HMV A;  4F2S A;  1W9H A;  2KFZ A;  2YKM A;  2AJQ A;  5HOO A;  1VQP N;  4YOW A;  2HHU A;  3C6H A;  1XUP O;  3PLA A;  2NZT A;  3SK3 A;  2XY6 A;  3OTO K;  4B9T A;  3SI6 A;  4CJR A;  4CHP A;  3F9M A;  4NCA A;  1JLG A;  1WSH A;  3VA3 A;  4BWJ A;  3VN5 A;  1BUP A;  3ZET A;  5H1S Q;  2FLO A;  3T7Z A;  4H03 B;  3KD1 E;  5GIP A;  3HO1 A;  3QO9 A;  2JLE A;  4JI4 K;  4C8N A;  2E5L K;  4WFB L;  1RT7 A;  3IMX A;  4E19 A;  2GBZ A;  1RT4 A;  5HLF A;  4CJ5 A;  5AQX A;  5AZI A;  2FSN A;  4CJF A;  3C7N B;  3FLC O;  5AQW A;  3SQ4 A;  3MED A;  4CZK A;  3THY B;  2GEM A;  4CGG A;  1H1V A;  1TL1 A;  2BDP A;  4KRF A;  4FPA A;  3KJV A;  3ZSX A;  3ZSR A;  1RBT A;  1JLE A;  4YOT A;  1P90 A;  3R8E A;  4CZM A;  1T05 A;  1S5J A;  1ASU A;  1Z6R A;  2QA4 N;  1VSH A;  4CFD A;  4EZ9 A;  4CIF A;  1BL3 A;  3EKU A;  3TR8 A;  1QE1 A;  4KBO A;  3P1G A;  1GLD G;  4OO1 J;  4GW6 A;  2E2N A;  4DQP A;  4JI8 K;  4FZY A;  1B92 A;  1S1W A;  4FWR A;  2P9N B;  4K8Z A;  3NE6 A;  3UB5 A;  2YHB A;  1YJ9 N;  4CHY A;  1YVU A;  1VQ5 N;  4FWL A;  2V7Z A;  3PSI A;  1QHT A;  1TKX A;  4DTS A;  3OYI A;  2PFU A;  2YKN A;  5C0Y A;  3MK6 A;  3MXM A;  2IIR A;  3WQT A;  4UQG A;  1N33 K;  1G15 A;  3EYZ A;  5JLF A;  3AA3 A;  1R0A A;  5AQY A;  5HRN A;  1BQN A;  5LJW A;  3ZET B;  4QS9 A;  3ZX0 A;  1LWF A;  1RDU A;  2QWR A;  3UKR B;  2QW9 A;  4BRQ A;  4B3O A;  3SJJ A;  4JHD B;  3MX5 A;  1IKV A;  3DLK A;  4OJR A;  1EWQ A;  4A5A A;  4NYF A;  2BH1 A;  1BCM A;  5CR4 A;  1GLJ O;  3V9S A;  2BUP A;  3BGR A;  4FJ8 A;  3M5R A;  3ID6 A;  3A5O C;  1XHX A;  4WQ4 C;  2O8C A;  1KXP A;  4PKI A;  1M90 O;  3WXJ A;  3F2K A;  4BR9 A;  4B3M K;  3CCV N;  2P9U A;  2YNI A;  3ULD A;  3DWL A;  3JAM O;  3I8D A;  3FZM A;  2KKZ A;  1IO2 A;  1SKR A;  3CPW M;  1N32 K;  4FJG A;  5CYQ A;  2E2P A;  5J2N A;  4JI0 K;  1HNW K;  4GKK K;  3VPZ A;  1SQK A;  1LWC A;  3L6Q A;  4NLB A;  3VEN A;  3F5T A;  4DCH A;  2CGJ A;  5CY4 A;  1DLO A;  2XY8 A;  2FBV A;  4CGF A;  1NNE A;  1ASW A;  1S3X A;  3CM6 A;  5KGX A;  1RIL A;  1WSJ A;  2UXB K;  4CF1 A;  1YUW A;  1REV A;  4BVP A;  1WAJ A;  3V1O A;  4BVO A;  4QOZ B;  4BR2 A;  4RCH A;  3NF7 A;  4K0K K;  2W41 A;  3HZ6 A;  1D4X A;  4BAC A;  5ADX A;  1B9D A;  4FWK A;  2O8D A;  1WOQ A;  3CFO A;  1TV6 A;  4BGB A;  4YOR A;  1JXB A;  3AO2 A;  3NGI A;  4CBU A;  4DTN A;  3VQA A;  1VRU A;  2HVI A;  2WC9 A;  4M45 A;  1K9M O;  4CEF A;  2P9I B;  4LFA K;  3CCU N;  1TK5 A;  3E9P A;  4IO8 A;  3CQX A;  4YNQ A;  1UA1 A;  3SBT A;  1FKP A;  3IRX A;  2CGL A;  2RHK A;  3WNF A;  3R6M A;  2VYP A;  3ULE A;  4B3R K;  5FRN A;  3K58 A;  4K25 A;  4H0V B;  2E20 A;  4H5R A;  2NUB A;  4I9Q A;  2EX3 A;  4KAZ A;  3BP8 A;  4OPA A;  2A41 A;  3SQ2 A;  1D8Y A;  4LF4 K;  4DSF A;  3MWT A;  3RSE A;  4DKW A;  2IS3 A;  3D2E B;  3RWU A;  3R1X A;  3SJH A;  3TWH A;  4I9L A;  3LZI A;  1OH5 A;  2O8F A;  2VG6 A;  3S3N A;  4MO5 A;  3TAM A;  5JS2 A;  4I2Q A;  5HBM A;  4DSK A;  4PUO A;  3BZK A;  2EHG A;  3LAL A;  4LH4 A;  5DK5 A;  4CJQ A;  4GNI A;  4OLB A;  3KHY A;  3AVC A;  3IKM A;  2IDO A;  4CEQ A;  1HQU A;  4JAX A;  1RT6 A;  1NOY A;  4M42 A;  2P9K A;  4OGE A;  1NOZ A;  1BIU A;  3MXJ A;  4KB0 A;  4KH6 A;  4KV8 A;  3ZYY X;  4CFB A;  1JLA A;  2IGI A;  2E1Z A;  3C65 A;  5EXW A;  4HUE A;  1XC3 A;  1BA1 A;  1YF5 L;  4CEO A;  4FOE A;  3L2W A;  3V9Z A;  5KPT A;  1SZ2 A;  3C95 A;  1TAQ A;  5GAE P;  4CF0 A;  3V81 A;  1SUQ A;  3I55 N;  1NK9 A;  1IBL K;  3HYF A;  4DTJ A;  1HX1 A;  4IOX A;  4C8L A;  4NLC A;  3LP0 A;  1W97 L;  4CHQ A;  2FSJ A;  2F8S A;  3QEP A;  2KFN A;  2A40 A;  3CCJ N;  3GL1 A;  2NRR A;  4BE1 A;  4QCL A;  3PO5 A;  4NO7 A;  2YHX A;  4DV2 K;  3DLH A;  4BRD A;  4DTX A;  5LL6 Z;  3O4W A;  3J7Y P;  4AM7 A;  5DM6 L;  1MU2 A;  1S1X A;  1ASV A;  3M3Z A;  3MWP A;  3BUZ B;  3ZT1 A;  3JSM A;  3VGK A;  4AHS A;  1E3M A;  4DB3 A;  4Z4C A;  4E7H A;  5JVG L;  3TAF A;  4M7Y A;  5AQL A;  2G8V A;  3K5N A;  2QWO A;  4A5B A;  4CHO A;  2NRZ A;  1YJW N;  3OYM A;  3OYC A;  3DOK A;  4Y1D A;  4PHT X;  3PX6 A;  3A0I X;  4CEZ A;  4LF9 K;  1GLL O;  1BDG A;  3H08 A;  1C0F A;  1QHA A;  3OY9 A;  2O8F B;  4BG9 A;  1IKY A;  1RT1 A;  5LMN K;  3K9J A;  4EIA A;  5CZ2 A;  2NRW A;  4FJ5 A;  4FK0 A;  3WEE A;  5C12 A;  3TAN A;  3ISN C;  3KK2 A;  1J5O A;  3PUF A;  2NRX A;  4CD1 A;  2Q36 A;  4B1X B;  1NKE A;  1EKE A;  1U49 A;  4JNE A;  2CH6 A;  3VEX A;  1K73 O;  2AA4 A;  3CJB A;  3UKU A;  5KPR A;  2Z1I A;  5LMU K;  3S3O A;  3GE1 A;  1IKW A;  2O8D B;  3CJ9 A;  1NKB A;  4JI3 K;  2HHS A;  4IFY A;  4GVM A;  4KHS A;  3CJ7 A;  3U3G A;  5HRO A;  1HKC A;  1T6D A;  1WBB A;  3O4Q A;  1DGK N;  4KHP K;  3TSU A;  3MEC A;  1NGE A;  1SL1 A;  4TSX A;  3WT0 A;  4YDU A;  3WXK A;  5AQP A;  4B1Y B;  1HRH A;  5AQM A;  3OYF A;  2UUC K;  1QZ5 A;  2OZS A;  2NRT A;  3ZEU B;  5JIC A;  4DTP A;  3CC2 N;  4A62 A;  2A42 A;  4FJN A;  1W2B M;  4E1N A;  3LDN A;  5CZ1 A;  5KTQ A;  3T3F A;  3VEY A;  4H0Y B;  4FZX C;  2D0A A;  4FM2 A;  2OTL N;  3B6P A;  4EZ6 A;  3SYZ A;  1Q9Y A;  3NH2 A;  2OAN A;  1X9J A;  3T1Y K;  3ZT3 A;  3ZX2 A;  3HL8 A;  4WQ5 C;  3AA5 X;  4FJI A;  3CCQ N;  1VQM N;  1VHX A;  2VG5 A;  5JVH L;  4IJN A;  2HMP A;  5AQO A;  3QFU A;  4B1U B;  5EY4 A;  4CK1 A;  4HHT A;  1HNX K;  4BRP A;  1R59 O;  1X9W A;  3DI6 A;  4LF5 K;  2QWM A;  1HNI A;  3H6E A;  3DXK B;  1OH8 A;  4ILH A;  4KHQ A;  3HVT A;  4XIU A;  3SCX A;  4BRI A;  5C2F A;  1ZC6 A;  3EZW A;  1Z25 A;  2E2Q A;  2W6K A;  1XQS C;  1CZA N;  1NGD A;  2HVH A;  2ZJP L;  1SV5 A;  5HL7 L;  3C0B A;  3VGM A;  1HLU A;  1Y64 A;  4FLV A;  5E41 A;  5TKY A;  4EHT A;  3QBW A;  2GV9 A;  3VGL A;  3OYJ A;  2HNZ A;  3SNN A;  5CYM A;  1IKX A;  3VEZ A;  3CFP A;  4A61 A;  4CF2 A;  4EHU A;  4FL9 A;  3L2R A;  2A5X A;  3AAQ A;  4I7F A;  3VQ7 A;  1CXU A;  1RFQ A;  3AAR A;  4AQY K;  2B4J A;  3VQP A;  1U2V B;  5ADX H;  1LCU A;  4BC3 A;  3O5B A;  5IT9 O;  1BI4 B;  1EP4 A;  4DR2 K;  1UWB A;  3WXI A;  3ATU A;  4OKE A;  3DLB A;  3VQE A;  2Q1N A;  4QS8 A;  4FXD A;  1VSD A;  2QM1 A;  1TKD A;  3QIC A;  2P9P B;  5J2Q A;  1RDD A;  3OBW A;  4AHR A;  3HRG A;  3KLI A;  5GIN A;  2XY7 A;  1JJ2 M;  2HHT A;  3CQ8 A;  3DMJ A;  3V1Q A;  1TUU A;  1CZB A;  2HB5 A;  3KIO A;  3D6R A;  4CJ3 A;  4FJ9 A;  2E6L A;  4J2B A;  5AQK A;  4LFB K;  3VQ5 A;  5AZJ B;  3G10 A;  1T3V A;  3NF8 A;  4CZH A;  5I3U A;  5EVZ A;  1J53 A;  2KQ2 A;  2Q0R A;  1S1T A;  4IG0 A;  2CH5 A;  3LP1 A;  4JI6 K;  4DR5 K;  3OW2 M;  4DU3 A;  3TAR A;  3L3V A;  5D3G A;  2RN2 A;  1NMN A;  3M1F A;  3TAE A;  3BF3 A;  4WFA L;  2PYJ A;  3F73 A;  3O3F A;  2YHA A;  2P9L A;  5MLC Q;  4U67 L;  3ZSO A;  1T7P A;  4RW4 A;  1SAZ A;  4JS4 A;  3D2F A;  4YHH K;  3QEI A;  3L4I A;  1K8A O;  2UUA K;  4W5O A;  4FVM A;  3RMA A;  3VQ4 A;  1DTQ A;  4XEI A;  3J7Z O;  2P9L B;  4BRN A;  3CME N;  1X9M A;  1WSF A;  4ELT A;  2OPS A;  3CPE A;  2Q0U A;  3LDL A;  3UE5 A;  4Z0U A;  2UXD K;  4DR7 K;  4FLY A;  4FSV A;  5FRM A;  2Q3S A;  1T03 A;  1YTU A;  1NKC A;  3SQ0 A;  1VSF A;  4W5R A;  2A1S A;  2GUI A;  1WSE A;  5AQH A;  3MDQ A;  5M1P A;  4OKJ A;  1JLF A;  4FK4 A;  1L3T A;  4CHZ A;  3LL3 A;  2QXL A;  3ZSQ A;  4JI5 K;  3PIP L;  4H5T A;  4FYD A;  4AH9 A;  4BR4 A;  1RTD A;  4OPJ A;  2FF6 A;  1KVA A;  3NHG A;  1RT5 A;  3OVN A;  4HTL A;  5J2P A;  5HRS A;  4JYA K;  5BRF A;  1QQO A;  2YNH A;  4CGJ A;  1Q7Y O;  2ASO A;  3OYD A;  3TTD A;  5FPN A;  4B8A B;  1W0H A;  2QWP A;  3CCR N;  5M1K A;  4YOY A;  5LY3 A;  3NH1 A;  5GAD P;  3LP2 A;  4NB4 A;  1C6V A;  3EZ5 A;  1A5W A;  5AQV A;  3DLE A;  5EU7 A;  4C8M A;  3I33 A;  4BR0 A;  3HVR A;  3RR7 A;  4LSL A;  4KTW A;  3NMU A;  1B9F A;  2Q97 A;  4JS5 A;  1XWL A;  4DSE A;  2P51 A;  3C6A A;  2HBJ A;  4IDK A;  3AAP A;  1GLA G;  5BRD A;  3SUQ A;  3AO4 A;  1Q9X A;  1E4F T;  4CJL A;  3CXC M;  1HYS A;  3ZSY A;  3CQY A;  3R9P A;  4DLG A;  4DV1 K;  3O3H A;  4FM1 A;  3CC7 N;  3I56 N;  3SMS A;  1C1B A;  1QQN A;  4DF8 A;  2O4I A;  4CJS A;  4DR4 K;  4FCY A;  5BN8 A;  3AVJ A;  3DRR A;  5E26 A;  4N56 A;  4NCB A;  2KW4 A;  1ZBH A;  2GTD A;  1NJZ A;  3ENH A;  1OH7 A;  4M3W A;  4FWM A;  4CEC A;  1HYV A;  3DXM B;  5I42 A;  2G8U A;  1Q18 A;  3O80 A;  4O5F A;  4GV6 A;  4E1J A;  1FXX A;  4E7J A;  2DPN A;  4F8R A;  4LC9 B;  3G71 N;  3VF2 A;  3SV3 A;  2OCE A;  3MXI A;  3BEX A;  4DSL A;  2Z1J A;  4Z4E A;  4IBN A;  2ASP A;  3O6W A;  1S6Q A;  1Z05 A;  3S3M A;  4RG8 A;  1BI4 A;  2LSN A;  3PSF A;  3VEO A;  3DAW A;  3A2F A;  1GLB G;  3NAE A;  3DLL L;  1XC9 A;  3M8Q A;  3C6U A;  4WCE L;  4CK3 A;  1S9E A;  2I7P A;  1I3A A;  3LM9 A;  4JD2 B;  1LW2 A;  4WFN L;  5FPD A;  3BZC A;  5SWM A;  4LSN A;  2QEX N;  4EP4 A;  4CZE A;  4IOC L;  1M1K O;  3L0Q A;  3TAB A;  2DFE A;  2DY4 A;  2A3Z A;  3ZX3 A;  5M1Q A;  1D5A A;  4KHU A;  3AY9 A;  4DFP A;  3THW B;  4JK9 A;  4ZTF A;  3O9R A;  3E66 A;  4CZL A;  2JGU A;  4ILG B;  4CJK A;  5GIO A;  4CGD A;  2DFH A;  4EAH D;  1IJJ A;  5J1E A;  1VAZ A;  4MLE A;  4F2R A;  4K43 A;  4FLT A;  1EXQ A;  2BTF A;  1NGA A;  3QFP A;  3KLF A;  1LW0 A;  4OX9 K;  2ZM6 K;  2IVP A;  4AHV A;  3UKU B;  2WUS A;  3ZLJ A;  1OKJ A;  3ENB A;  4MO4 A;  2P1J A;  2D0C A;  4DFJ A;  3QIP A;  1TAU A;  3DLR A;  4Z4F A;  1YHQ N;  1QSY A;  1VQ6 N;  2HNY A;  2E4L A;  2VQF K;  4DQS A;  4PA1 A;  3WNE A;  3KTQ A;  2E1Y A;  1WSG A;  4DFK A;  2X6S A;  4G1Q A;  1RCH A;  5EOY A;  4WQ5 A;  3EEQ A;  3L8B A;  1J6Z A;  3NGZ A;  1NGG A;  4FLX A;  4CIG A;  2WOM A;  2HBK A;  2P9N A;  4CGI A;  3O4N A;  1RTI A;  1JLC A;  3I8B A;  5C25 A;  2KZM A;  4DTR A;  2R7Y A;  4CJU A;  4K41 A;  1EET A;  4A59 A;  4BRL A;  2ETJ A;  5BPN A;  5BRE A;  2ASM A;  1BG3 A;  2IVO A;  3SPZ A;  3VQD A;  2VQE K;  1JL1 A;  3RSE B;  1OH6 A;  3CJ1 A;  4BC5 A;  2GX9 A;  1O1W A;  3AVA A;  2H3G X;  1HPZ A;  3CER A;  3CHW A;  3OJS A;  3RMD A;  5KRS A;  4B3S K;  4HCC A;  3E1Y A;  3V9W A;  2GWJ A;  4B9N A;  3H1V X;  4Z4H A;  3AVI A;  4LF7 K;  4CER A;  1MWK A;  3QES A;  2WFB A;  4F9O A;  2HMI A;  4J2A A;  3CM5 A;  4CBW A;  1VRT A;  3WXM B;  1IH7 A;  3QEX A;  2W42 A;  1KC8 O;  2YI1 A;  1QSL A;  1XMQ K;  4DU4 A;  1HQE A;  3K0S A;  2YNF A;  3PV8 A;  2ZD1 A;  3FZL A;  1YIT N;  3U3Y A;  2ZE2 A;  1ATN A;  2NLX A;  1S1U A;  1MA9 B;  2RPI A;  3FFI A;  3OYN A;  3SV4 A;  2ITM A;  3PO4 A;  2GUP A;  4JLH A;  4NXM K;  4CF9 A;  2HST A;  1BQM A;  5I9E B;  4AHT A;  3KKR A;  4EP5 A;  2FXU A;  1U48 A;  1XNR K;  3NGY A;  3OS0 A;  3GDQ A;  4KH5 A;  1T8E A;  1LV5 A;  4PL7 A;  4K8X A;  2A6A A;  2B6A A;  2OPR A;  3AA2 A;  3O9Q A;  3CIP A;  1NK7 A;  5LJV A;  4DS5 A;  4CIE A;  1TYQ B;  2IVN A;  4BDZ A;  4B9L A;  1RTJ A;  4CD3 A;  1KRP A;  3GG4 A;  3VOV A;  2CGK A;  4F3T A;  3WNG A;  2QI2 A;  3V9X A;  2YJE A;  3OJU A;  4FWO A;  1YVN A;  4H5V A;  3VQC A;  1S22 A;  4HWI A;  3TSQ A;  1IBM K;  5C2D A;  3OYL A;  3V1R A;  3VTI A;  4UY8 O;  3LZJ A;  3V6D A;  2HF3 A;  3RMC A;  3WEE B;  3DRS A;  1KCF A;  3AO3 A;  3SLC A;  3TTC A;  1N5Y A;  1VQ8 N;  3C94 A;  4L8R B;  2NNW A;  2E6M A;  3CCS N;  4BRM A;  5KQD A;  1Q8I A;  5TKW A;  3OYG A;  3VET A;  3HOT A;  3AVM A;  1VSK A;  4CZG A;  1IG8 A;  2E88 A;  2AP1 A;  4FM0 A;  4KHN A;  1OVQ A;  3FZK A;  3MN9 A;  2G8K A;  1BIZ A;  5K14 A;  1Y97 A;  4R5P A;  2X6N A;  1Q82 O;  3QNN A;  4M3R A;  4IFE A;  2D5R A;  1VQ9 N;  3CF5 L;  1D9D A;  5HP1 A;  4PKH A;  2OA8 A;  3MN7 A;  4FJM A;  3SAG A;  1CXQ A;  4CK2 A;  2J4R A;  4IFV A;  3THW A;  2UXC K;  4GKJ K;  3H45 C;  4JI7 K;  1GLF O;  1T44 A;  2F8T A;  4E89 A;  1KFD A;  4CEB A;  2G8I A;  4RTF D;  2ATQ A;  4HCB A;  2O4G A;  3LPT A;  4ISG A;  4BE2 A;  3LWM A;  1HKB A;  3ITH A;  4CES A;  3KK1 A;  2ZJR L;  4OLA A;  2HND A;  4B1W B;  4AIL C;  4BY9 C;  4ILJ A;  1J5E K;  3M8R A;  3ALY A;  1C0T A;  4KTQ A;  5FRO A;  3CI5 A;  1KAX A;  2HHQ A;  1G99 A;  4DUY K;  5HRP A;  3FR0 A;  3TPQ A;  4JKB A;  3K9K A;  3MCP A;  1BHL A;  2RF2 A;  3NH0 A;  3KLH A;  1T6C A;  3SQ1 A;  1XHZ A;  2IC3 A;  4B9M A;  4IXC A;  5AQR A;  1A5V A;  1HKG A;  4F3O A;  4DV5 K;  5AFU H;  2G8H A;  1V4T A;  1TUY A;  2V52 B;  3VQ9 A;  1NMD A;  3TU5 A;  4JRP A;  1SS6 A;  1NGH A;  3VER A;  3CET A;  1QS4 A;  3E9O A;  1KFS A;  4H0X B;  3VMF B;  3K5M A;  3DXM A;  3O3G A;  4CED A;  4DFM A;  4BRG A;  1WBD A;  1NM1 A;  1HNV A;  3H3O B;  1VQO N;  4DV0 K;  3W3D A;  4H0T B;  4E1M A;  3EE8 A;  3O1W A;  1Z26 A;  3ZSV A;  3DM2 A;  4J2D A;  2VWB A;  3D45 A;  2XHB A;  1RBR A;  2QWQ A;  1YT3 A;  4IWV A;  3NCI A;  1DEJ A;  5HRR A;  1RNH A;  3SZ2 A;  3J81 O;  4BGA A;  1FJG K;  1KVB A;  4JI2 K;  3VQB A;  4YFU A;  2O8C B;  2FBY A;  3EN9 A;  5DMR A;  4AM6 A;  1LWE A;  2YJF A;  3TTF A;  4HTU A;  1ATS A;  1TK8 A;  1ZBF A;  4DV3 K;  3CMA N;  1WB9 A;  4B8C A;  1KLM A;  3OYB A;  3H3N O;  2HHX A;  4BWM A;  3GBT A;  4E3S A;  3L2U A;  4LH5 A;  3D0P A;  4Y1C A;  1HPM A;  5IWA K;  1TGO A;  3HJF A;  2O8E A;  2OTJ N;  4DU1 A;  1S1V A;  3QLH A;  4OKK A;  4BDY A;  4IEI A;  2G8F A;  4KRE A;  1RDA A;  3NDK A;  3ZSZ A;  4IG3 A;  1I94 K;  1SKS A;  4W5Q A;  4FWQ A;  4IDH A;  4H0P A;  4LY7 A;  4OVL A;  1QVG M;  2P9U B;  5KI6 A;  3LPU A;  3DRP A;  3PIO L;  1LOT B;  5AZI B;  4DTM A;  4CGH A;  4CE9 A;  3A8Y A;  3CJC A;  3OYK A;  4CW7 B;  2VGN A;  3A5L C;  3SPY A;  4B9U A;  4DSJ A;  4FWP A;  3L2V A;  4PWD A;  1VSM A;  4OGC A;  1CZ9 A;  2W6L A;  1FKO A;  3ID8 A;  5B8H A;  2NRH A;  3AGR A;  1U04 A;  3R3L A;  2ZGY A;  3PX4 A;  1P8Z A;  1ZBS A;  4V19 S;  4CCH A;  4CFC A;  5AQQ A;  1VQL N;  1KAZ A;  4KHY A;  4H5N A;  5AQU A;  3RTV A;  4AHU A;  2ZWH A;  3JYT A;  3MN6 A;  3B6O A;  4C1N K;  3DLG A;  5C24 A;  1V4S A;  3THX B;  5F0X A;  4BRE A;  4YY3 K;  3HI0 A;  1C0M A;  3W0L A;  1IG9 A;  1CLQ A;  1NGF A;  3KZB A;  2HHH K;  4O44 A;  3QER A;  1C0G A;  4LD0 A;  4FLU A;  4RWT A;  4BC2 A;  4J2E A;  5GAH P;  4JD2 A;  2WBN A;  1E4G T;  4JK8 A;  3L4Q A;  4JI1 K;  1VSJ A;  1ZBU A;  2B5J A;  2F4V K;  4FPB A;  3IG1 A;  2KLA A;  4JKG A;  4FLZ A;  1NLV A;  4W5T A;  3HXM A;  1BWF O;  1TYQ A;  2OYQ A;  1QQC A;  3FZH A;  3QIN A;  4E7I A;  3RR8 A;  1S72 N;  3SBG A;  2GWK A;  1D9F A;  3LDO A;  1ZYQ A;  1VSL A;  2UU9 K;  3A5N C;  4WQ4 A;  5FLX O;  1ATR A;  4Y0W A;  3T1H K;  1KTQ A;  3G4S N;  1X9S A;  1YXQ A;  4FZZ A;  1RTH A;  4N5S A;  2UUB K;  1W7A A;  1RT3 A;  4IO9 L;  3U6F A;  5GAG P;  4YOV A;  4KI6 A;  1BCO A;  3TAQ A;  3AVF A;  4RW7 A;  3LDP A;  5JLH A;  4KB1 A;  4DTU A;  1K8K A;  2PAV A;  2O8E B;  5AJ3 K;  3PX0 A;  3DJC A;  3CC4 N;  1MWM A;  4DQR A;  5ELZ A;  4FJJ A;  3SUP A;  2KHO A;  4ISE A;  5AQZ A;  5BR9 A;  3K59 A;  3THX A;  2RKI A;  4C23 A;  4DHY A;  4BDP A;  4Q5V A;  5BRH A;  3QEW A;  4DSI A;  4RW9 A;  1EO1 A;  3HT3 A;  1BIS A;  4RW6 A;  3KWI A;  4DLE A;  3AGK A;  1WNS A;  3ATV A;  1GOA A;  2OPQ A;  3MMV A;  4DR1 K;  2D0O A;  4OPH A;  5AQT A;  4DQI A;  5M1O A; 
#chains in the Genus database with same CATH homology
 1RBU A;  1IKY A;  1RT1 A;  1GOC A;  3HP9 A;  3VQ6 A;  3SPZ A;  3VQD A;  5CZ2 A;  4CJW A;  4BE0 A;  1JL1 A;  1WN7 A;  3MAQ A;  2YNG A;  5T7B A;  4MQ3 A;  4M3X A;  4FJ5 A;  4FK0 A;  3TAN A;  1O1W A;  3ISN C;  3AVA A;  1HPZ A;  4F4K A;  3RMD A;  3OJS A;  4E0D A;  5KRS A;  3KK2 A;  4HCC A;  1J5O A;  4ELU A;  4ELV A;  3LWL A;  3PUF A;  4O0I A;  3V9W A;  4B9N A;  3EY1 A;  2WON A;  4Z4H A;  3AVI A;  1EKE A;  3NF6 A;  3V9U A;  5J2M A;  1JKH A;  1U49 A;  1NKE A;  1KVC A;  4CER A;  3S3O A;  3CFR A;  4FJH A;  2Z1I A;  1IKW A;  3QES A;  2A1R A;  2HMI A;  1U47 A;  5KGW A;  4J2A A;  3CM5 A;  1HYZ A;  2FBX A;  1VRT A;  1NKB A;  2BAN A;  4IFY A;  1IH7 A;  1RBS A;  4FW2 A;  4GVM A;  2W42 A;  3QEX A;  4KHS A;  2HHS A;  3U3G A;  1QTM A;  5HRO A;  2IAJ A;  3O4Q A;  3F9K A;  4DTO A;  4DF4 A;  1QSL A;  3MEC A;  4I2P A;  1FK9 A;  4DU4 A;  1HQE A;  3PV8 A;  2YNF A;  4TSX A;  4HUG A;  1SL1 A;  3G0Z A;  2ZD1 A;  3NBP A;  1RT2 A;  2KTQ A;  3THV A;  4M3Z A;  2HHV A;  1U45 A;  1HRH A;  3ZT0 A;  4KKO A;  3TI0 A;  3UIQ A;  3U3Y A;  1C0U A;  2ZE2 A;  3OYF A;  2HHW A;  1S1U A;  5JS1 A;  2OZS A;  3AA4 A;  2RPI A;  3KLG A;  3FFI A;  3OYN A;  3SV4 A;  4DTP A;  3PO4 A;  4HVJ A;  4JLH A;  4E7K A;  3L3U A;  1RDC A;  2BGG A;  4CF9 A;  4FJN A;  1BQM A;  4E1N A;  4AHT A;  4DS4 A;  3TAG A;  2IOC A;  3KKR A;  4KO0 A;  1JLQ A;  4GMJ B;  5CZ1 A;  5KTQ A;  4EP5 A;  2Y1J A;  1U48 A;  5SZT A;  3T3F A;  4MFB A;  1ZBI A;  3K5O A;  3NGY A;  3OS0 A;  3P5J A;  1WSI A;  4FZX C;  2D0A A;  3OS2 A;  4FM2 A;  1T8E A;  1LV5 A;  4FXD A;  3B6P A;  4EZ6 A;  4K8X A;  3SYZ A;  1Q9Y A;  3NH2 A;  1F21 A;  2B6A A;  2OPR A;  3AA2 A;  3ZT3 A;  3KKS A;  4N47 A;  3HL8 A;  1XI1 A;  2PZS A;  1NK7 A;  3VQ8 A;  2DTU A;  3AA5 X;  4DS5 A;  4CIE A;  4BDZ A;  4FJI A;  2X74 A;  2VG5 A;  4O0J A;  4B9L A;  1RTJ A;  3OYE A;  1NJW A;  4Z4I A;  4CK1 A;  1KRP A;  1ZBL A;  4HHT A;  4F3T A;  4JRQ A;  3WNG A;  1BGX T;  3I0S A;  4KTZ A;  3V9X A;  3DI6 A;  1X9W A;  3IS9 A;  3OJU A;  3QET A;  3AVH A;  1NK8 A;  4PY5 A;  1HNI A;  2OPP A;  2FC0 A;  4FJX A;  4M3T A;  3VQC A;  4DQQ A;  4KHQ A;  3HVT A;  4CF8 A;  4XIU A;  3SCX A;  1NK6 A;  4CEE A;  2PY5 A;  1L3U A;  2VWJ A;  3RRH A;  1U4B A;  1VSI A;  1Z25 A;  3IAY A;  3OYL A;  3V1R A;  2OZM A;  3LZJ A;  3V6D A;  2HVH A;  3RMC A;  1HMV A;  4F2S A;  3DRS A;  1SV5 A;  1KCF A;  3K5L A;  1W9H A;  3AO3 A;  2KFZ A;  4FLV A;  4O55 A;  2YKM A;  2AJQ A;  2QXF A;  1N5Y A;  5E41 A;  2HHU A;  2GV9 A;  3OYJ A;  3C94 A;  2HNZ A;  3AO5 A;  5CYM A;  1IKX A;  3SNN A;  3CFP A;  4L8R B;  3TAP A;  2E6M A;  4CF2 A;  3ZSW A;  1Q8I A;  3L2R A;  4NYN A;  2XY6 A;  1LAV A;  4ID5 A;  3OYG A;  3SI6 A;  4B9T A;  4CJR A;  4CHP A;  4I7F A;  3AVM A;  1VSK A;  2Z1G A;  3VQ7 A;  1CXU A;  3KK3 A;  1JLG A;  1WSH A;  4NCA A;  4CJP A;  3VA3 A;  2B4J A;  4BWJ A;  3VN5 A;  4FM0 A;  4KHN A;  1EX4 A;  3MEE A;  3VQP A;  2G8K A;  1BIZ A;  5K14 A;  1Y97 A;  4AHC A;  3KD1 E;  4R5P A;  3HO1 A;  2X6N A;  3QO9 A;  3V4I A;  1SKW A;  2JLE A;  2G8W A;  1BI4 B;  1EP4 A;  1RBV A;  1S9G A;  3AVB A;  1UWB A;  4C8N A;  3QNN A;  4FW1 A;  4M3R A;  2D5R A;  3VA0 A;  1VSE A;  1RT7 A;  4OKE A;  1D9D A;  3VQE A;  2GBZ A;  3AV9 A;  4E19 A;  1VSD A;  1TKD A;  1RT4 A;  3ZCM A;  5HP1 A;  5HLF A;  4CJ5 A;  4CJF A;  4C8K A;  5J2Q A;  2OA8 A;  3KD5 E;  1RDD A;  4AHR A;  3SQ4 A;  3KLI A;  3MED A;  2XY7 A;  1NK5 A;  4FJM A;  2HHT A;  3CQ8 A;  3DMJ A;  3V1Q A;  4CGG A;  1CXQ A;  4CK2 A;  3S9H A;  3MEG A;  4DMN A;  2XY5 A;  1TL1 A;  1CZB A;  1C1C A;  1TL3 A;  2YV0 X;  2HB5 A;  3KIO A;  4IFV A;  3ZT4 A;  4CJ3 A;  2BDP A;  4KRF A;  3KJV A;  3ZSX A;  3ZSR A;  4FJ9 A;  1RBT A;  1JLE A;  2E6L A;  4J2B A;  2F8T A;  4E89 A;  2KZZ A;  2VG7 A;  3VQ5 A;  3G10 A;  1J9A A;  1KFD A;  4CEB A;  2G8I A;  3NF8 A;  1T05 A;  1S5J A;  5I3U A;  1J53 A;  2ATQ A;  2FBT A;  1ASU A;  1NK4 A;  4HCB A;  2KQ2 A;  2O4G A;  1S1T A;  3LPT A;  3LP1 A;  4IG0 A;  4CJ4 A;  3LDS A;  4BE2 A;  3LWM A;  4DU3 A;  4WE1 A;  4CES A;  3ITH A;  3TAR A;  3KK1 A;  1VSH A;  3L3V A;  4CFD A;  4CIF A;  4EZ9 A;  1BL3 A;  2RN2 A;  5D3G A;  2HND A;  4OLA A;  3TR8 A;  3I0R A;  1QE1 A;  3P1G A;  3TAE A;  4GW6 A;  4DQP A;  4FZY A;  1B92 A;  1S1W A;  4AIL C;  2PYJ A;  3NE6 A;  1N6Q A;  3F73 A;  4K8Z A;  2YHB A;  1NJY A;  4CHY A;  2Z1H A;  3M8R A;  3O3F A;  2YHA A;  4W5N A;  1YVU A;  3ALY A;  1C0T A;  4KTQ A;  5FRO A;  1QHT A;  2HW3 A;  2HHQ A;  3OS1 A;  4DG1 A;  3ZSO A;  5HRP A;  1T7P A;  1TKX A;  4DTS A;  1TVR A;  4RW4 A;  3HK2 A;  4JS4 A;  4ICL A;  3OYI A;  4CEA A;  3NH0 A;  1BHL A;  2RF2 A;  3QEI A;  3KLH A;  1XHZ A;  3SQ1 A;  2YKN A;  2IC3 A;  4W5O A;  4FVM A;  3RMA A;  4B9M A;  3QEV A;  1A5V A;  3MXM A;  4F3O A;  1RDB A;  3VQ4 A;  2G8H A;  4UQG A;  1DTQ A;  1WAF A;  3VQ9 A;  4JRP A;  1G15 A;  1WLJ A;  1KFS A;  1QS4 A;  3EYZ A;  1X9M A;  3AA3 A;  1R0A A;  1WSF A;  2I5J A;  3T19 A;  2OPS A;  5HRN A;  3K5M A;  1BQN A;  4ELT A;  3O3G A;  4CED A;  4DFM A;  1LWF A;  1UAX A;  1HNV A;  4Z0U A;  4FLY A;  4OPK A;  3SJJ A;  4E1M A;  4RW8 A;  1UA0 A;  4B3O A;  5FRM A;  2Q3S A;  3LAN A;  1T03 A;  1IKV A;  1HJR A;  1Z26 A;  3DLK A;  4OJR A;  4NYF A;  3OYH A;  3ZSV A;  4M3U A;  1YTU A;  3DM2 A;  4J2D A;  1NKC A;  3D45 A;  1BCM A;  2XHB A;  3V9S A;  1RBR A;  3SQ0 A;  2P5G A;  1YT3 A;  1VSF A;  3BGR A;  3NCI A;  4M3Y A;  4FJ8 A;  5HRR A;  4W5R A;  1RNH A;  4FJL A;  3SZ2 A;  2F96 A;  1XHX A;  2A1S A;  3HST B;  2GUI A;  1WSE A;  1UOC A;  4C8O A;  1KVB A;  3VQB A;  3L2Q A;  4YFU A;  4OKJ A;  2FBY A;  1JLF A;  5DMR A;  4FK4 A;  2YNI A;  4HUF A;  1LWE A;  1L3S A;  1L3T A;  4CJE A;  4HTU A;  3ULD A;  4CHZ A;  1TK8 A;  3I8D A;  2XRI A;  4CHN A;  1ZBF A;  2PYL A;  3ZSQ A;  1IO2 A;  1SKR A;  4FYD A;  4AH9 A;  1RTD A;  4B8C A;  1KLM A;  1X1P A;  4OPJ A;  4FJG A;  3OYB A;  1KVA A;  5CYQ A;  5J2N A;  3NHG A;  1RT5 A;  4BWM A;  2HHX A;  3OVN A;  4PQU A;  1LWC A;  4E3S A;  3HPG A;  4ZHR A;  3L2U A;  1QSS A;  5J2P A;  3LAK A;  5HRS A;  4LH5 A;  4KFB A;  5CY4 A;  4B08 A;  3D0P A;  1DLO A;  2XY8 A;  2YNH A;  4Y1C A;  2FBV A;  2ZQB A;  4CGF A;  4NCG A;  1TGO A;  4CGJ A;  3HJF A;  1ASW A;  3CM6 A;  5KGX A;  1RIL A;  1WSJ A;  3OYD A;  4CF1 A;  2D0B A;  4DU1 A;  1S1V A;  1REV A;  3QLH A;  1WAJ A;  4OKK A;  3V1O A;  4B8A B;  4BDY A;  4H4M A;  1W0H A;  4M41 A;  2ITG A;  4QOZ B;  3DYA A;  3NH1 A;  2G8F A;  4KRE A;  1RDA A;  3LP2 A;  3NDK A;  3ZSZ A;  3NF7 A;  4IG3 A;  2XO7 A;  1SKS A;  1C6V A;  3VQQ A;  3EZ5 A;  4BAC A;  1VK0 A;  2QKK A;  4W5Q A;  1B9D A;  4LY7 A;  1A5W A;  3CFO A;  3DLE A;  1TKZ A;  3AVL A;  4OVL A;  5EU7 A;  4C8M A;  3DLB A;  1TV6 A;  3HVR A;  3RR7 A;  1ITG A;  4LSL A;  4KTW A;  1B9F A;  1JXB A;  4JS5 A;  1XWL A;  3KLE A;  4DSE A;  3AO2 A;  2P51 A;  5KI6 A;  3LPU A;  4IDK A;  3DRP A;  1SL0 A;  3RMB A;  1S6P A;  1JL2 A;  3SUQ A;  3NGI A;  5C42 A;  4DTN A;  3VQA A;  1VRU A;  2HVI A;  3AO4 A;  1Q9X A;  4CJL A;  4M45 A;  4DTM A;  2DFF A;  4CEF A;  4CGH A;  3ZSY A;  1LAW A;  4CE9 A;  1TK5 A;  1HYS A;  4YNQ A;  4DLG A;  3M8P A;  1UA1 A;  3O3H A;  1L5U A;  4Z4G A;  3OYK A;  4FM1 A;  1FKP A;  3HPH A;  3IRX A;  4ID1 A;  3WNF A;  1C1B A;  4DF8 A;  3SPY A;  4B9U A;  4DSJ A;  2O4I A;  3L2V A;  4PWD A;  1VSM A;  4CJS A;  4OGC A;  1CZ9 A;  3K58 A;  1FKO A;  4FCY A;  3BDP A;  5FRN A;  2QK9 A;  1U04 A;  3C6T A;  4N76 A;  3AVJ A;  3DRR A;  4N56 A;  4NCB A;  2KW4 A;  3PX4 A;  2NUB A;  4O4G A;  4B9V A;  4FJK A;  4I9Q A;  1ZBH A;  2EX3 A;  4KAZ A;  1NJZ A;  1KLN A;  4M3W A;  4KI4 A;  4H8K A;  3SQ2 A;  4CCH A;  4CFC A;  1D8Y A;  4QAG A;  4CEC A;  1HYV A;  5I42 A;  3AO1 A;  4DSF A;  2QKB A;  4Q0B A;  2G8U A;  2IS3 A;  1K6Y A;  3NF9 A;  3T1A A;  3RWU A;  4KHY A;  3RTV A;  4AHU A;  3JYT A;  3TWH A;  1FXX A;  3QNO A;  4E7J A;  3B6O A;  4I9L A;  3DLG A;  5KRT A;  3LZI A;  4F8R A;  2VG6 A;  3S3N A;  3AVK A;  5C24 A;  3SV3 A;  1NJX A;  3TAM A;  5JS2 A;  4I2Q A;  5HBM A;  3MXI A;  4DSL A;  2Z1J A;  4Z4E A;  4IBN A;  4FLW A;  4DSK A;  4PUO A;  2EHG A;  3DOL A;  3LAL A;  3QIO A;  4O5B A;  3M8S A;  4LH4 A;  1S6Q A;  1C0M A;  5DK5 A;  4B9S A;  4CJQ A;  4OLB A;  3S3M A;  4RG8 A;  1IG9 A;  1KSP A;  3AVC A;  1BI4 A;  2IDO A;  2LSN A;  1YTA A;  1JLB A;  3HM9 A;  2VWK A;  3A2F A;  1CLQ A;  4CEQ A;  1HQU A;  4O44 A;  3NAE A;  1GOB A;  3QER A;  1RT6 A;  3M8Q A;  4LD0 A;  4FLU A;  1XC9 A;  1NOY A;  3C6U A;  4J2E A;  3ASM A;  4M42 A;  4CK3 A;  4OGE A;  4CJT A;  3HPO A;  4KPY A;  1S9E A;  3CG7 A;  1NOZ A;  1BIU A;  3MXJ A;  1I3A A;  4KB0 A;  1VSJ A;  1I39 A;  1ZBU A;  2B5J A;  3K2P A;  4KV8 A;  1LW2 A;  4CFB A;  1JLA A;  3IG1 A;  2Y1I A;  2X78 A;  4FLZ A;  4W5T A;  2IGI A;  5SWM A;  4LSN A;  3HXM A;  3PY8 A;  4EP4 A;  1J54 A;  1DTT A;  3HP6 A;  4HUE A;  2OYQ A;  1QQC A;  3SUN A;  4E7I A;  2BE2 A;  3QIN A;  3TAB A;  3RR8 A;  4CEO A;  2DFE A;  3AVG A;  3L2W A;  3V9Z A;  1D9F A;  2DY4 A;  1A5X A;  1VSL A;  1D5A A;  3C95 A;  1ZYQ A;  4KHU A;  1TAQ A;  4DFP A;  4FK2 A;  4ZTF A;  4CF0 A;  1KTQ A;  2JGU A;  3V81 A;  1SUQ A;  1X9S A;  1NK9 A;  4FZZ A;  3HYF A;  4CJK A;  4DTJ A;  4CFA A;  4DWI A;  4C8L A;  1JXE A;  4CGD A;  4FJ7 A;  1RTH A;  4N5S A;  2DFH A;  3LP0 A;  1RT3 A;  5J1E A;  4CHQ A;  3U6F A;  2F8S A;  3QEP A;  4CJV A;  3OYA A;  1BCO A;  4F2R A;  4KI6 A;  3WNH A;  3TAQ A;  3AVF A;  2KFN A;  4RW7 A;  4FLT A;  1EXQ A;  4KB1 A;  3KLF A;  4BE1 A;  4DTU A;  1LW0 A;  1TKT A;  4QCL A;  3PO5 A;  3PX0 A;  3CYM A;  4AHV A;  4DFJ A;  2P1J A;  2D0C A;  3QIP A;  4DQR A;  3SUO A;  1TAU A;  3DLR A;  1SL2 A;  2P5O A;  4Z4F A;  1QSY A;  4FJJ A;  4IKF A;  3DLH A;  2HNY A;  4DTX A;  3SUP A;  2E4L A;  4DQS A;  4PA1 A;  1MU2 A;  3WNE A;  1L3V A;  3KTQ A;  1S1X A;  1ASV A;  1WSG A;  3ZT1 A;  2X6S A;  3JSM A;  3K59 A;  4G1Q A;  2RKI A;  1RCH A;  3NFA A;  4DFK A;  4AHS A;  3K57 A;  4Z4C A;  4BDP A;  1TK0 A;  4Q5V A;  3L8B A;  4E7H A;  4E7L A;  3QEW A;  3TAF A;  3NGZ A;  4DSI A;  1NK0 A;  4RW9 A;  4FLX A;  4KHW A;  4CIG A;  3HT3 A;  2G8V A;  4N41 A;  3K5N A;  1BIS A;  1C1A A;  2WOM A;  4RW6 A;  4CHO A;  5FDL A;  3AVN A;  3OYM A;  3OYC A;  4DLE A;  4CGI A;  3O4N A;  3DOK A;  1RTI A;  4H4O A;  4Y1D A;  1JLC A;  1WNS A;  5C25 A;  3PX6 A;  1GOA A;  3LP3 A;  4DTR A;  2R7Y A;  2KZM A;  3LAM A;  4CJU A;  4CEZ A;  2OPQ A;  1EET A;  3RRG A;  3H08 A;  3OY9 A;  4ZTJ A;  3E01 A;  4DQI A;  3ZT2 A;  3P83 D;  2ETJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...