4LH4A

Dual inhibition of hiv-1 replication by integrase-ledgf allosteric inhibitors is predominant at post-integration stage during virus production rather than at integration
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
152
structure length
129
Chain Sequence
SPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Dual inhibition of HIV-1 replication by integrase-LEDGF allosteric inhibitors is predominant at the post-integration stage.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 43
structure length 129
sequence length 152
ec nomenclature
pdb deposition date 2013-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4lh4A00
3OYBA 1J54A 1W0HA 2Z1HA 3DLGA 4DTUA 3K58A 1WSFA 2BDPA 4BWJA 1NJZA 1JXBA 3LAMA 1NKCA 4W5OA 1DTQA 3KJVA 1TL1A 3RMDA 1CZ9A 1NJYA 3KLHA 3TARA 4FLZA 1BI4B 3MXMA 3HL8A 4EZ6A 4E3SA 2OPRA 5J2PA 5HRPA 3V9WA 1JLAA 1HJRA 4KV8A 3U6FA 1HNVA 3ZCMA 2B6AA 3P5JA 4CHOA 3T3FA 4JRQA 3HK2A 3OJSA 3AO1A 1JLEA 3S9HA 3RWUA 1CXUA 4CEFA 3G10A 2HHSA 2XO7A 3RTVA 1TAUA 3EZ5A 4CJRA 4EP4A 4XIUA 3RR8A 3VQAA 1JL1A 1WSIA 1VSEA 3K2PA 3AO5A 3VQBA 1VSHA 1B9FA 2XY5A 2O4GA 3DYAA 3OYEA 3PX0A 3VQ7A 1A5VA 1RT7A 1YT3A 3HP6A 4DLGA 4M3RA 2P1JA 2G8UA 1SUQA 3DMJA 3AVKA 1BHLA 2OA8A 1RBRA 3RR7A 3ULDA 4M3XA 4C8NA 4LSLA 3AVJA 3EY1A 3SQ4A 4KRFA 4KTWA 1U04A 1LV5A 3MECA 4CEDA 3RRHA 3P1GA 4DG1A 3C95A 3M8RA 4NYNA 4HHTA 4FM2A 3V9UA 4DSKA 4DSIA 4RG8A 3SUOA 3HVRA 4QAGA 4K8XA 4H4MA 1VSDA 3KD1E 2KTQA 3HO1A 1HNIA 3HP9A 4CFBA 3KK2A 3QEXA 4FZYA 3DLKA 3LPTA 1RTDA 1BGXT 3RMBA 3ALYA 1WN7A 3ZSZA 3SPYA 3QEIA 1NOYA 3KD5E 1U4BA 3ZT0A 4JRPA 3PX4A 4MFBA 3NF7A 3L8BA 4WE1A 3OYFA 2HHWA 3O3GA 4EZ9A 1W9HA 3LDSA 3CM6A 1T8EA 1J5OA 3NGZA 2HVHA 4CJ5A 1NJWA 5T7BA 4FM0A 1NK4A 4HCCA 3K5MA 4CEOA 3V1RA 4CK3A 4O4GA 4CEAA 1ZBHA 3QERA 1TKDA 1FKOA 3LANA 1S1UA 1ZBUA 4N47A 3RMCA 1YTUA 1RTJA 2IAJA 4MQ3A 3PUFA 3ZT3A 4DF8A 2KW4A 2X78A 4CJUA 1HYVA 4AHUA 2VWKA 3VQCA 3TABA 4KHQA 1KVCA 2Z1IA 5FROA 4C8MA 1WSEA 2G8HA 4CJWA 3SUNA 1RBVA 4FK0A 2XY7A 4IFVA 2P5OA 3AA4A 4UQGA 1X9WA 1RDAA 3NBPA 4DSLA 3MEEA 4DQQA 3ZSVA 4B08A 5I3UA 1HQEA 2FC0A 1TKXA 1QHTA 2GV9A 4DTXA 4ELUA 3D45A 3LZIA 3RMAA 1WNSA 3AVGA 2HNDA 1NK9A 3NAEA 3PO4A 2HHUA 2BE2A 4M3YA 4DQSA 1B92A 4FJHA 3UIQA 1HYZA 3C6TA 4OLAA 4E0DA 1IO2A 4RW8A 2G8IA 4BDZA 4RW4A 4CIGA 2E6LA 3OJUA 4OPKA 1U49A 5E41A 2KZZA 4M3TA 3KLFA 4KAZA 1NK0A 4B9UA 3AVBA 2RF2A 3CQ8A 4CJQA 1TV6A 4Z4FA 4FXDA 3LPUA 4FZZA 4Y1DA 3LP1A 4F2SA 4BDPA 4FJLA 2KFNA 3AO3A 4CGGA 4KHWA 1Z25A 3IG1A 1X1PA 1ZBFA 3DLEA 1LW2A 4C8OA 4CF2A 1HYSA 4FW2A 1JLGA 3QINA 4W5TA 3K5NA 1RBSA 3P83D 3PX6A 3SPZA 3L2QA 4FJ5A 2O4IA 1VSMA 4FJNA 3AVHA 3OYNA 1TVRA 1U48A 3NF6A 1JL2A 1J53A 2YV0X 4CEQA 4DTRA 2P5GA 4I9QA 4KPYA 2VG7A 4KHUA 1JKHA 2FBXA 1JLBA 4F3TA 3FFIA 4KHNA 2HNYA 5KRSA 1UOCA 4E7JA 4CERA 2HNZA 4DU4A 4NCBA 3V6DA 4CGFA 1QE1A 2DY4A 1FKPA 4IG0A 4DF4A 4H4OA 1YVUA 2X6SA 1RT2A 4BACA 5DK5A 3TI0A 1RNHA 4FJGA 3BGRA 1Z26A 3ZT1A 3TANA 1GOAA 2Q3SA 1RTIA 4O0JA 2DFFA 4I2PA 3IAYA 2F8SA 1X9MA 2IC3A 3SNNA 5CZ1A 5EU7A 1IKWA 1G15A 3G0ZA 3WNEA 4W5NA 4DTJA 4DFKA 3DOLA 4DQPA 1KCFA 1TK5A 4DFPA 1C6VA 3VQ8A 3OY9A 4KTQA 4CEZA 3NF8A 1EP4A 3K5LA 1ITGA 2IDOA 2XY8A 1ASUA 2F96A 1RT6A 3T1AA 4CJLA 5C25A 3OYGA 2ZQBA 3HXMA 4DQRA 3S3MA 4L8RB 1RILA 1VSJA 3QEVA 3TR8A 4B9VA 4CJEA 3KLGA 1DLOA 4KB0A 1N5YA 5DMRA 1XWLA 5CYQA 4I9LA 3SCXA 2DTUA 3QNOA 1D8YA 3DRRA 3TAMA 4M3WA 2YNHA 4NYFA 4OJRA 3OYIA 4LSNA 1WSGA 4Z4HA 4GVMA 2RN2A 4E89A 1RT5A 3L2UA 1KTQA 4CJSA 5J2MA 2HB5A 4GMJB 2VG5A 4IBNA 4CCHA 3KK1A 4CHZA 3LP0A 1SKWA 1L5UA 1MU2A 2DFEA 3CM5A 1JLCA 4ELTA 3IS9A 4FJIA 3OS2A 3OYCA 4FJ7A 3L2RA 1B9DA 1S5JA 4CJFA 1Q9XA 4W5QA 4FJKA 5SZTA 4BE1A 1K6YA 1LW0A 1UWBA 3HPHA 3AVIA 4ID1A 2D5RA 4B9TA 2ETJA 3AO4A 4DTSA 4IKFA 1C1AA 2HHXA 4FK2A 3E01A 3BDPA 4B3OA 3LP2A 1WAFA 1DTTA 3NDKA 1VSIA 3O4QA 4J2AA 3VN5A 1BCMA 1LWCA 4E7LA 2ATQA 1WAJA 4DU1A 2A1RA 4FLWA 2XRIA 4DS5A 4B9MA 4FK4A 4H8KA 1BL3A 3ISNC 4OPJA 4DMNA 1EXQA 2E4LA 5C42A 1VSKA 2P51A 4J2EA 2HHTA 4B8AB 3F73A 1BIZA 3TAQA 3H08A 2ZE2A 2QKKA 2OPQA 4B8CA 3A2FA 3RRGA 2HVIA 4J2BA 3T19A 4FJJA 4ID5A 4JLHA 3TWHA 1KFSA 3KTQA 4DSEA 1S9GA 3DLRA 3NH2A 5HBMA 5HLFA 2JGUA 3SQ2A 1KLMA 3OS1A 1KVBA 1REVA 2RKIA 1VRUA 1T05A 4LH5A 3TAFA 2IOCA 3M8QA 4CJ4A 1S6QA 2IS3A 1NJXA 3ZSQA 1TKTA 3TAEA 3SJJA 1T7PA 4CHNA 1A5WA 3DOKA 3VQQA 4W5RA 1RBUA 1JLQA 5HRSA 2BANA 4TSXA 3V1OA 1RBTA 4KREA 4E7IA 3NCIA 1L3SA 1U45A 1UAXA 3HJFA 1I39A 1L3VA 1ASVA 4F3OA 3DLBA 1LWFA 3AA5X 1ZBIA 1JXEA 2HHQA 1UA0A 4DFJA 2DFHA 3LZJA 1S1TA 4FZXC 1TKZA 2E6MA 4EP5A 4CFDA 2OZMA 4FJXA 4AHTA 1BCOA 3PY8A 1Y97A 4O5BA 1RDCA 1QQCA 4CGJA 3OS0A 3VQ9A 2QKBA 2EX3A 3CYMA 3AVNA 1RT4A 4N5SA 4FJMA 1CLQA 3TAPA 1C1BA 3DRSA 4G1QA 4HCBA 1FXXA 4CECA 4HUFA 2Z1GA 3ITHA 4M42A 1EKEA 1S1XA 1JLFA 1TGOA 3LWLA 1UA1A 1TL3A 3S3OA 3C94A 5CZ2A 3ZSWA 4E1NA 1D9FA 4OKKA 2Y1IA 2GUIA 3V9ZA 1LAWA 3AV9A 3V1QA 4B9LA 1S9EA 2D0BA 3QETA 3I0RA 1NK7A 3CFRA 3CFPA 1CZBA 4FLTA 3SYZA 4KHYA 4CJTA 1TAQA 1XHZA 4FLXA 2VG6A 2X6NA 4O44A 4ZTFA 4DSJA 5J2QA 4FW1A 4HVJA 4CIEA 5D3GA 1A5XA 4LH4A 4N41A 1GOBA 4KHSA 4OLBA 1L3TA 1LWEA 4FCYA 1SV5A 3K5OA 4FVMA 1QSLA 4OGEA 4PA1A 3DRPA 1VSLA 2YHBA 1BISA 3QLHA 4DS4A 4JS4A 4CJVA 2XY6A 3SI6A 1KRPA 4OVLA 1VRTA 3IRXA 4IG3A 3ZSRA 1QSSA 4KI4A 2Z1JA 1RCHA 4RW7A 4CHPA 2YNIA 3ASMA 3B6OA 4HUEA 1BQMA 2VWJA 4DU3A 3U3YA 4Q0BA 1S1VA 4NCAA 1CXQA 4PQUA 3AVCA 4OGCA 1O1WA 3AVMA 4KFBA 3VQPA 4ZTJA 3JYTA 1TK8A 3LP3A 2YNFA 1QS4A 4F8RA 1FK9A 1EETA 3ZSXA 3ZT2A 5CYMA 3SV3A 3THVA 2D0AA 1T03A 2G8VA 1ZYQA 1XC9A 4FLVA 5JS2A 3QIPA 1SL1A 4N56A 2OYQA 3NFAA 3NH0A 4F2RA 1HRHA 2YKNA 3AA2A 3OYLA 3V81A 1Q8IA 4BE0A 1NK8A 4CK1A 4Z4CA 3B6PA 3U3GA 2ZD1A 1ASWA 1BI4A 1IKVA 4AHSA 1KFDA 2NUBA 4Y1CA 3VQEA 4E1MA 2Y1JA 4M3ZA 4E19A 1TK0A 2QXFA 4IDKA 3WNGA 1QTMA 2W42A 3K59A 4DFMA 5I42A 5JS1A 5HROA 3OYJA 3PO5A 1C0MA 1QSYA 4F4KA 2R7YA 4QCLA 4FJ8A 5KRTA 2B5JA 3M8SA 4JS5A 4E7KA 3QO9A 1WSJA 4RW6A 4ICLA 3HPOA 1KLNA 5KTQA 3V4IA 4DTMA 1EX4A 3ZT4A 1LAVA 3QEWA 2GBZA 2HHVA 3DM2A 3HPGA 3KIOA 4ZHRA 5HP1A 1D5AA 1NKEA 3DLHA 4OKEA 1NK6A 1WSHA 3V9SA 4DLEA 1Q9YA 2WONA 3HYFA 3DI6A 1NKBA 2G8WA 3NGIA 1RDDA 4CHYA 3LALA 4BDYA 4CGDA 1IH7A 2ITGA 3HSTB 4CGIA 4J2DA 1GOCA 4PY5A 2LSNA 1WLJA 1U47A 5FRNA 4CJPA 4B9SA 3NE6A 3SV4A 1XI1A 3L3UA 3OYHA 4M3UA 4Z4EA 1BQNA 4Z0UA 4BWMA 3ZSOA 3VA3A 4DTNA 4CEBA 4PWDA 4KI6A 4KKOA 5FDLA 3AA3A 4Z4GA 4DSFA 1IKYA 4AHRA 5SWMA 4YFUA 4AILC 1RDBA 1S1WA 3PV8A 2FBYA 2IGIA 2YKMA 5CY4A 3OYKA 3D0PA 1C0TA 2PYLA 4CEEA 3AVLA 4DQIA 2JLEA 3AO2A 2HMIA 3OYDA 4QOZB 3I8DA 4DTOA 1N6QA 3KLIA 3MXIA 2KZMA 5KGXA 4RW9A 3NH1A 4I7FA 4FJ9A 3F9KA 2G8KA 4M45A 4CESA 3L2WA 2XHBA 1SL0A 5FRMA 3VQ6A 2A1SA 4FLYA 3S3NA 3KKRA 3WNFA 2PYJA 4C8KA 3NHGA 3QNNA 3AVAA 3KK3A 3HVTA 4OKJA 4FLUA 4YNQA 4CF8A 3QIOA 3NGYA 1SKSA 2B4JA 3MEDA 1YTAA 4I2QA 4CFAA 2OZSA 3SQ1A 4CF1A 1XHXA 2X74A 3VQDA 1VSFA 4CF0A 1D9DA 4CIFA 3L3VA 3AVFA 3I0SA 4K8ZA 2OPPA 1SKRA 4HUGA 3TAGA 3LWMA 4LY7A 1BIUA 3CG7A 3EYZA 1SL2A 1NK5A 4CF9A 3SZ2A 1NOZA 1RT1A 2KQ2A 3C6UA 1J9AA 2PY5A 2D0CA 3WNHA 3O3FA 2YNGA 4IFYA 3O3HA 1KVAA 2QK9A 2KFZA 1S6PA 1HQUA 4FM1A 4PUOA 4AHVA 1R0AA 1ZBLA 4FYDA 3MXJA 3V9XA 3MEGA 3SQ0A 1KSPA 4KB1A 4AH9A 2EHGA 4Q5VA 1F21A 1X9SA 3VQ4A 4CE9A 4DWIA 2HW3A 3VA0A 1C0UA 4GW6A 3JSMA 4C8LA 3OVNA 2FBVA 3VQ5A 3M8PA 4CJ3A 4CK2A 5J1EA 1HPZA 4KTZA 4O0IA 5J2NA 3NF9A 3MAQA 2F8TA 2YHAA 1RTHA 4CGHA 5HRNA 3SUQA 5KGWA 2WOMA 3O4NA 3KLEA 1I3AA 4KO0A 4R5PA 4O55A 4NCGA 3SUPA 3K57A 2PZSA 5K14A 3LAKA 4CFCA 4AHCA 3L2VA 4B9NA 4LD0A 4CHQA 2RPIA 4ELVA 3CFOA 4BE2A 3ZSYA 5KI6A 1IG9A 4HTUA 3OYAA 1IKXA 2I5JA 1C1CA 4N76A 1VK0A 5HRRA 4CJKA 2BGGA 3QEPA 2G8FA 3QESA 2AJQA 3HT3A 1RT3A 2FBTA 5C24A 2OPSA 4E7HA 3HM9A 4DTPA 4Z4IA 4M41A 1HMVA 1L3UA 3OYMA 3KKSA
chains in the Genus database with same CATH superfamily
1J54A 4NLBA 2Z1HA 1IBMK 3LAMA 3OBWA 4DR6K 5KQDA 3RR7A 4GV9A 4WQ5A 3TARA 4LC9B 4EZ6A 2OPRA 5J2PA 5HRPA 3V9WA 4BRMA 4DR1K 4PL8A 1C0GA 3W3DA 5EXWA 3G10A 2XO7A 4WQ4A 2H3GX 4XIUA 1KAYA 1TUUA 5M1OA 3PLAA 1P8ZA 3OYEA 3VQ7A 5C2DA 5H1SQ 4M3RA 3AVKA 5M1QA 1GLEG 3ULDA 3EY1A 4LSLA 3SAFA 1I94K 4KRFA 1U04A 2QW9A 3M8RA 3C95A 4DSKA 4NYNA 4FM2A 4K8XA 1YXQA 3HP9A 4CFBA 3QEXA 1N36K 4JEPA 3ALYA 1NOYA 1Q82O 3CIPA 4JRPA 2QTDA 4JV5K 2YHYA 2ITMA 4EZ9A 1W9HA 4JNEA 1T8EA 1J5OA 4CJ5A 1NJWA 4GV6A 1NK4A 3K5MA 4CEOA 2QM1A 3V1RA 4O4GA 4C1NI 3UE5A 5AFUH 2GWKA 5HOOA 5CE3A 3QERA 1JCFA 4BRDA 4ISGA 1S1UA 4N47A 2IAJA 3PUFA 3ZT3A 3BF1A 3MCAB 1RBVA 4PKGA 4MO5A 1YIJN 5BR8K 3NBPA 4BRLA 4DQQA 1NMDA 3VMFB 5F1XA 4EHUA 4ELUA 4B3OA 4JI7K 2HNDA 2HHUA 1TUYA 2RE2A 2W6KA 2FLOA 4NXMK 3JS6A 4CIGA 1U49A 2KZZA 3KLFA 3AVBA 1JCGA 3FZLA 4Y1DA 3LP1A 4JKCA 4BDPA 4F2SA 4GKKK 5AQGA 1Z25A 1ZBFA 2PBDA 2V51B 1ZXOA 4CF2A 3CQXA 3K5NA 4DV6K 2QWRA 3SPZA 2O4IA 1VSMA 3AVHA 3NF6A 4CEQA 4DTRA 4CZKA 3FFIA 4M63C 3VETA 2HNYA 5KRSA 4CBUA 2HNZA 4DU4A 4NCBA 2DY4A 4XEIA 3THXA 3K0SA 1GOAA 3THYA 1RTIA 4O0JA 3NVKA 1Z05A 1IKWA 3G0ZA 4W5NA 1BA1A 1P90A 4YOVA 3VQ8A 4KTQA 4CEZA 5A2QO 5M1KA 3NF8A 1ITGA 4FWPA 2F96A 1BUPA 3HXMA 2ZQBA 3MN7A 1VSJA 2V52B 4CJEA 3KLGA 3IMXA 4JI6K 4KB0A 3TTDA 5CYQA 5EX5A 1D8YA 3TAMA 2YNHA 3LDLA 1VQMN 1WSGA 4B1ZA 1VQNN 4KBOA 4GMJB 3MK6A 2I7PA 4JI1K 4FJIA 3OS2A 3OYCA 4FJKA 4B3SK 1K6YA 3LDPA 5AQFA 3CD6N 2O8FA 2HHXA 5LJVA 3LP2A 1DTTA 2WTUA 5BPNA 2WC9A 3VN5A 1V4TA 3E9LA 1LWCA 4E7LA 4FK4A 1MWKA 3ISNC 4OPJA 4DMNA 5C42A 2P51A 4BC2A 4YOXA 2UUCK 1TYQA 3TSQA 4DKWA 3SBGA 3J7ZO 4JK8A 4BGBA 3DXKA 3O9UA 3TWHA 2YX6A 4H0PA 1N33K 4IEIA 4LH5A 3TAFA 2IOCA 3M8QA 3FLCO 2IS3A 3TAEA 3SJJA 1T7PA 4CHNA 5HRSA 4U67L 1YF5L 3HJFA 1I39A 3AA5X 4A61A 4UY8O 2DFHA 1S1TA 4FWKA 2NLXA 1HNXK 1BCOA 1OH5A 2YCHA 3JAMO 4CGJA 3OS0A 1GLDG 3UKRA 2NRRA 1IG8A 3ULEB 1FXXA 4CVNE 1EKEA 4IXCA 3LWLA 1UA1A 3FGUA 3EN9A 1D9FA 3DAWA 1LAWA 1S9EA 2D0BA 3I0RA 1VHXA 3WQTA 2FF6A 3WEEA 3CFRA 3BEXA 4FLTA 2D1KA 4BC3A 4AF1A 1XHZA 4O44A 3IUCA 5TKYA 4CIEA 1DT9A 4KHSA 3WT0A 3H1QA 3N4PA 4FVMA 1QSLA 2W6LA 2YHBA 1KRPA 1YJNN 1VRTA 1VQ9N 2Z1JA 1HJOA 3SAGA 2VCPA 4DQ8A 3B6OA 4HUEA 4Q0BA 2D0PA 4NCAA 1CXQA 3VQPA 1S3XA 1O1WA 3AVMA 1T3VA 4A5BA 3MDQA 2YNFA 2OTLN 4F8RA 3ZT2A 2Q0RA 3SBTA 1J5EK 5CYMA 1ZYQA 5FLXO 2KHOA 3NFAA 1HRHA 5AZIA 1NGIA 3CJ7A 4BE0A 3UKUA 1NK8A 4H0YB 4WYBA 1NM1A 2NUBA 3VQEA 4BRFA 4BR0A 2Y1JA 4M3ZA 1YAGA 2YJFA 1BG3A 3WNGA 2W42A 5JS1A 5I42A 3OYJA 1BA0A 4F4KA 4DCHA 3DXMA 1MDUB 4X64K 5KRTA 2F9TA 3QO9A 3HPOA 1N34K 3WXIA 4DV7K 5KTQA 3ZT4A 4A5AA 3T7ZA 4OKEA 1WSHA 4CBXA 4BQLA 4BDYA 1YI2N 5AR0A 3A0IX 2EWSA 1IH7A 3HSTB 1JJ2M 1OH8A 1WLJA 4O8UA 4CJPA 4V19S 4ILHA 1NWKA 3GDQA 3WQUA 1IJJA 3C0BA 3R1XA 1ILYA 4BWMA 4DTNA 2Q31A 4CEBA 4PWDA 1NGHA 2P9NB 4KKOA 5FDLA 4KI6A 4DSFA 3CC2N 4YFUA 5GAGP 5SWMA 3VESA 4JI3K 4Z4GA 1S1WA 5E84A 1OVQA 2YKMA 1NNEA 4CEEA 4DQIA 3C7NA 3EEQA 4QOZB 4WQ5C 2WUSA 4DTOA 2P9IA 3KLIA 5KGXA 2F4VK 3NH1A 1K8KA 2XHBA 2P9SB 2HHHK 4FLYA 3KKRA 3NHGA 1Q7YO 2P9KA 4FLUA 3TSPA 4YOTA 1SKSA 1YTAA 4WQ4C 3VENA 4CFAA 1XHXA 1VSFA 4BROA 3L3VA 4MDBA 4BC4A 5FPEA 3I0SA 2GUPA 2UU9K 3VF4A 1JCEA 4LY7A 4NLCA 1YVNA 3G71N 4DUZK 4LF7K 1NK5A 1DEJA 3QBWA 1NOZA 2PY5A 1J9AA 3G25A 5C12A 4PUOA 4FM1A 2KKZA 1R0AA 3HRGA 3MXJA 4IJAA 4JI0K 4NB4A 3VA0A 2HBLA 4DV3K 1GLLO 3OVNA 3ZX2A 4CK2A 1HPZA 4KTZA 3CJBA 4CGHA 3DJCA 2YI1A 3O4NA 3KLEA 1I3AA 3CQYA 4LF4K 3LDNA 4NCGA 3SUPA 3CETA 5AQRA 3LAKA 1OH6A 4AHCA 5AQJA 1LOTB 1GLJO 2RPIA 1NGAA 3OYAA 2Q36A 1IKXA 1VK0A 1CZAN 5CHIA 1VQKN 2AJQA 3HT3A 4DTPA 4M41A 2V7YA 1HMVA 3KKSA 3DLGA 3O5BA 3K58A 1WSFA 4BWJA 1NJZA 3O1WA 3AARA 3GG4A 5AQQA 3VOVA 4W5OA 1DTQA 1TL1A 3VGLA 3KLHA 3MXMA 1BI4B 2A3ZA 4KV8A 4J8FA 1HNVA 1C0FA 3ZCMA 1FW6A 1NG9A 2O8CA 3OJSA 3AO1A 3RWUA 2AA4A 1QQMA 3EZ5A 3VQAA 1JL1A 1WSIA 1VSEA 3K2PA 3AO5A 1VSHA 1B9FA 2O4GA 3G6EN 3PX0A 3HP6A 4B1UB 1YT3A 1IBLK 2G8UA 3DMJA 4LF6K 2E5LK 1RBRA 1DGKN 4KTWA 4JI5K 3R3LA 1LV5A 1VQ7N 3P1GA 5B8HA 4HHTA 2BH1A 4RG8A 3HVRA 1HNZK 4H4MA 4FZYA 3B8AX 4CW7B 1RTDA 3AGKA 3C6HA 3PX4A 3L8BA 1BDGA 4WE1A 5BN9A 3FZHA 4BRQA 4B1WB 5KPRA 1M90O 3NGZA 5HL7L 1ZBHA 1FKOA 2DPNA 1ZBUA 3L4QA 1YTUA 4MQ3A 4DF8A 3VEZA 2KW4A 2X78A 4BRGA 2HMPA 3VQCA 3VEWA 5FROA 4PL7A 2ZF5O 2V7ZA 4IFVA 4LF5K 5M1PA 3THWA 1RDAA 1X9WA 4DSLA 3CCJN 3BP8A 2F9WA 5EY4A 1H1VA 2GV9A 1WNSA 3AVGA 3NAEA 3PO4A 4JHDB 2PAVA 4DQSA 1U6ZA 4E0DA 3M3ZA 4BDZA 5AFUA 4OPKA 5E41A 4B9UA 4FOEA 3I56N 2KFNA 2QXLA 4BRKA 3DLEA 1LW2A 4C8OA 3EO3A 3QINA 4PHTX 5C15A 4XH5A 4OPAA 5GIOA 1TVRA 1JL2A 4KHUA 1EQYA 4I9QA 4KPYA 2FBXA 4F3TA 3LM9A 4H5RA 3CHWA 3TU5A 4H4OA 2QWOA 1RT2A 2X6SA 1RNHA 4FJGA 3BGRA 1EO1A 3TANA 2Q3SA 5BREA 2O8BB 2CH6A 2OCEA 4DTJA 4LFCK 3DOLA 4DFPA 1C6VA 4JKFA 1EP4A 2HBKA 2IDOA 2XY8A 1ASUA 2IVPA 1RT6A 4K42A 1HUXA 3T1AA 4DQRA 1RILA 4AQYK 4B9VA 3ZETB 1DLOA 1N5YA 4IJNA 4RTFD 3H1VX 3P39A 3SCXA 1K9MO 3DRRA 3OHRA 4NYFA 4LSNA 4Z4HA 4GVMA 4E89A 1RT5A 4BG9A 4DV5K 3KWGA 5EVZA 1SKWA 1JLCA 3CCSN 1Q9XA 1B9DA 4W5QA 5SZTA 1UWBA 3HPHA 4B3MK 3VF2A 2D5RA 2ETJA 4IKFA 1C1AA 3BDPA 3MN5A 4CI6A 3UB5A 1WAFA 3WXKA 3O4QA 1BCMA 2GEMA 2XRIA 3D2FA 5JLFA 3R9PA 2E4LA 3IFRA 5BPMA 2NRWA 1XNRK 2HHTA 1BIZA 5MLCQ 4L3QA 3T19A 3KTQA 4JLHA 1KFSA 3QFPA 2Q0UA 1S9GA 3DLRA 3NH2A 2JGUA 3OS1A 2RKIA 3ZSQA 3CCMN 3U9ZA 2ZJPL 3QICA 1HR0K 4TSXA 4ILGB 2ZJQL 1UAXA 1ASVA 1VQ6N 1LWFA 1JXEA 2HHQA 3PIPL 4LF9K 1UA0A 3MMVA 2HBJA 1TKZA 4FZXC 4RCHA 1Y97A 4O5BA 4F9OA 1QQCA 1KC8O 1J6ZA 3CYMA 3AVNA 1RT4A 1CLQA 4BRAA 1C1BA 5ADXH 3AGRA 1S72N 3DRSA 4G1QA 5EOYA 4X62K 4HCBA 1VQ5N 1VQLN 3ITHA 1K73O 4YOUA 4CZLA 1TGOA 3C94A 4OKKA 2Y1IA 1S22A 2GUIA 3S41A 3V1QA 2NZTA 4ISEA 4B3TK 3CFPA 2QI2A 3THXB 2VG6A 2X6NA 2UUBK 5AQSA 2NRVA 4N41A 1GOBA 5JVHL 3TPQA 4JS4A 2VQEK 4OVLA 1QSSA 3VEYA 4KI4A 3SK3A 2OTJN 5GADP 5C2FA 1S1VA 4FWRA 3O08A 2E2PA 3AVCA 4OGCA 4KFBA 1TK8A 1Z6RA 1T03A 3SLCA 1XC9A 4FLVA 5JS2A 3QIPA 3V81A 2YKNA 2O8DB 2BUPA 3H45C 4NXNK 4CK1A 4Z4CA 2ZD1A 1ASWA 4AHSA 4WFBL 4E19A 1TK0A 3K59A 5DM7L 3PO5A 1C0MA 4BY9C 4LF8K 2O8FB 4C1NK 4DV0K 4QCLA 2J4RA 4FJ8A 2B5JA 4JS5A 1GLFO 4OX9K 4ICLA 2AP1A 3V4IA 3QEWA 3KIOA 1NKEA 3U9DA 2E2QA 1NK6A 3O8MA 4JK9A 3A8YA 3DI6A 1NKBA 2F7TA 4CHYA 2QWNA 1TYQB 2FF3B 4CD1A 1GOCA 5ELZA 4PY5A 5FRNA 4H5NA 4QS9A 4B9SA 3H6EA 3DXKB 3NE6A 3SV4A 2NRZA 3L3UA 3OYHA 4DR2K 2YHWA 3BY5A 4CJ7A 3TSUA 4CZHA 1XMQK 1IKYA 1NGJA 4FL9A 1RDBA 4WFNL 3EE8A 3NVMA 2FBYA 3OYKA 5CY4A 3CCUN 5AQLA 1MWMA 1OVYA 3MN9A 4E1JA 3MXIA 1RDWX 3D6RA 3LDQA 4CESA 5BRDA 5FRMA 2PYJA 3QNNA 3CMEN 2BTFA 1T6CA 3NGYA 1KXPA 2JWKA 5LL6Z 3KZBA 3VQDA 4CF0A 1YJWN 3AVFA 4NO7A 1SZ2A 1U2VA 2OPPA 4HUGA 1XUPO 3LWMA 3UKRB 3WUHA 3CG7A 3EYZA 2PFUA 3HBTA 4WFAL 4A59A 4FWOA 2D0CA 4FWNA 3OW2M 3O3HA 5F2RA 1S6PA 1ZBLA 3FZFA 4IDHA 4Q5VA 5IT9O 3VQ4A 2ZGYA 1C0UA 4GW6A 3JSMA 2QWPA 4H0OA 5J2NA 1RTHA 5HRNA 3WXLA 1QZ5A 3QFUA 4R5PA 4DR7K 2CGLA 4O55A 3K57A 3ULEA 4CFCA 4B9NA 4JYAK 3VERA 4CHQA 3CCEN 4ELVA 3ZSYA 1IG9A 2NRHA 4EFHA 2I5JA 3U4LA 3BF3A 5HRRA 2HBMA 5GINA 2BGGA 3QESA 2FBTA 3F9MA 5C24A 2E1ZA 2OPSA 5F0XA 4EIAA 1N32K 1L3UA 2D4WA 3J81O 3OYBA 2BDPA 3PSIA 4DUYK 1NKCA 5AZIB 5BPLA 3ZEUB 3UKUB 1NJYA 1CZ9A 3O6WA 1BOTO 3HL8A 4E3SA 1FJGK 2E20A 4YOWA 3U6FA 3P5JA 3HZ6A 4JRQA 3HK2A 2YJEA 3DXMB 3S9HA 3VF6A 4JN4A 1CXUA 4CEFA 3RTVA 1Q86O 3RR8A 3ENBA 3VQBA 2XY5A 4GV3A 1HNWK 1RT7A 4DLGA 2OA8A 3H3OB 4ILJA 4KH6A 4WF9L 2P9UA 1M1KO 1NGCA 3HOSA 4CEDA 4DSIA 3SUOA 3QBXA 3KD1E 5C0YA 3HO1A 1HNIA 3KK2A 3LPTA 2UUAK 1BGXT 3RMBA 4CD3A 3KD5E 5E26A 3QEIA 3FZKA 1U4BA 3ZT0A 3TTCA 5AQVA 3NF7A 1X9JA 3OYFA 1K8KB 4CBWA 1WOQA 3SJHA 5JMVA 4FM0A 2P9KB 4CK3A 3I8BA 4O5FA 4CEAA 5JICA 4PKIA 3LANA 4IEEA 3H46O 4CJUA 1HYVA 4AHUA 2P9NA 2Z1IA 4C8MA 1W7AA 2G8HA 4BGAA 4JI2K 1R59O 4UQGA 3RSEA 2ASOA 3MEEA 3ZSVA 4B08A 4BRIA 5I3UA 1HQEA 1TKXA 2QWQA 1NJIO 2UYTA 3D45A 3LZIA 2O8EA 3CCVN 1KD1O 3O1BA 4A2AA 2BE2A 1B92A 4JKEA 3I55N 1VAZA 3C6TA 3K9KA 4OLAA 1IO2A 4RW8A 4DV2K 2G8IA 2E6LA 3OJUA 4DB3A 4M3TA 1NK0A 2RF2A 1TV6A 4Z4FA 3LPUA 4BRPA 4FZZA 1DKGD 4FJLA 5LY3A 3AO3A 4CGGA 4KHWA 3IG1A 1X1PA 4FW2A 1JLGA 1HPMA 4W5TA 2HF4A 1RBSA 3PX6A 2OANA 3L2QA 4FJ5A 2ASMA 4FJNA 4BR7A 1T44A 1U48A 2P5GA 1J53A 2VQFK 3F2KA 4JKGB 1WBBA 4KHNA 3D7EO 5AQYA 3V6DA 4CGFA 1QE1A 4IG0A 4DF4A 5AJ3K 3HI0A 4JKDA 2E88A 5DK5A 3TI0A 4B1XB 3ZT1A 2NRTA 4I2PA 2F8SA 2IC3A 3SNNA 5EU7A 1G15A 3WNEA 3CC4N 4DQPA 1KCFA 1HLUA 1D4XA 4B1YB 2O8CB 4CJLA 3HM8A 3S3MA 3ZLJA 4L8RB 2P9LA 4XH1A 3TR8A 4B1VA 1XWLA 4A62A 2Q1NA 4QS8A 1K8AO 3ZX3A 4YDUA 2DTUA 4DHYA 4M3WA 4K25A 2QEXN 4IOCL 4JK7A 2RN2A 3WXMB 4BRNA 5J2MA 2HB5A 2VG5A 3Q7BA 4CHZA 1MU2A 3IS9A 4FJ7A 3E66A 1S5JA 1LW0A 4ID1A 1Q81O 3RVCA 3E01A 1X3NA 1ESVA 1VSIA 4IOXA 3M1FA 3A5MC 4J2AA 3HSCA 1WAJA 4DU1A 4FLWA 4DS5A 3J80O 4H8KA 1BL3A 2JWLA 1VSKA 4B8AB 3F73A 2GELA 3TAQA 2ZWHA 3VTHA 1NGBA 3H08A 3L0QA 3ZYYX 2ZE2A 3J7AP 2QKKA 2OPQA 3GOIA 3A2FA 3RRGA 2HVIA 3R8EA 4J2BA 4ID5A 4FWSA 5HLFA 5HBMA 1KLMA 4FSVA 5M1NA 1T05A 4CJ4A 1LCUA 4U7BA 3AAPA 1NJXA 1TKTA 5AZJB 2UXBK 3D2EA 1JLQA 2BANA 4H0VB 5LMNK 3V1OA 1RBTA 4E7IA 3BZKA 1L3SA 2A40A 1U45A 1ZBIA 3FR0A 4DFJA 4I6MA 3QMLA 5DM6L 1T6DA 2E6MA 4CFDA 2OZMA 2VGNA 1RDCA 3VQ9A 2QKBA 4BVOA 4FJMA 3C6AA 3TAPA 4HUFA 2Z1GA 4Z94A 1S1XA 3ATVA 4FVUA 5JVGL 3S3OA 3ZSWA 5CZ2A 4H0XB 4JD2A 3V9ZA 2P9PB 4CZMA 4B9LA 4CZIA 1VQ4N 1NK7A 2ASPA 4IZ9A 1CZBA 4KHYA 4CJTA 1TAQA 1IBKK 1ATRA 5J2QA 1A5XA 4LH4A 4OLBA 1L3TA 3BZCA 4FCYA 3K5OA 3CMAN 3QB0A 1VSLA 3QLHA 1X3MA 5ADXA 3SI6A 4H5WA 1RGIA 4IG3A 1RFQA 1RCHA 4RW7A 3EZWA 4CHPA 2YNIA 1IV0A 3ASMA 4DU3A 1BQMA 2HOEA 4ZTJA 3LP3A 4DV4K 3IDHA 1FK9A 3A5OC 3GL1A 3SV3A 4H5VA 2G8VA 1NLVA 5AQKA 4YORA 2OYQA 4N56A 4KH5A 5JLHA 3OYLA 3KWIA 2O8BA 3B6PA 3U3GA 2WFBA 3LDOA 3EKSA 4IDKA 4H03B 3GBTA 3E9OA 1QTMA 1QSYA 4IOAL 2R7YA 3ZETA 3M8SA 4E7KA 1WSJA 4RW6A 1KLNA 3MWTA 4XH4A 1W97L 2HHVA 1LAVA 3DM2A 3HPGA 4ZHRA 5HP1A 1D5AA 3D2FB 3V9SA 4DR3K 2WONA 3HYFA 1RDDA 3LALA 4CGDA 2ITGA 4CGIA 4J2DA 1XNQK 4LFAK 1YHQN 4BRCA 2Q97A 5GIPA 1BQNA 5IWAK 3VA3A 5FPDA 4AHRA 4MO4A 4AILC 3PV8A 3EE9A 3T1HK 2PYLA 2JLEA 2D0OA 3AO2A 3VEXA 3OYDA 1QVGM 1N6QA 4C23A 2E2OA 4RW9A 2G8KA 2VWBA 4Y0WA 4BQZA 3S3NA 3WNFA 3O4WA 4C8KA 3AVAA 1XC3A 3HVTA 4CF8A 1HKGA 3QIOA 1VQ8N 2B4JA 3MEDA 3WXJA 2OZSA 4K0KK 4CIFA 5BN8A 3C65A 4CF9A 3SZ2A 1MA9B 1RT1A 3C6UA 3O9RA 2YNGA 4LFBK 3HTVA 4FYDA 3VGMA 3M5RA 4AHVA 3SQ0A 4X65K 4KB1A 1X9SA 4DWIA 4BR2A 1QZ6A 3VQ5A 2FBVA 3QEVA 1YUWA 5LMUK 2E1YA 2UXCK 4RWTA 4AM7A 3DLLL 5KGWA 2WOMA 3AAQA 3THYB 2IVOA 2PZSA 5K14A 3L2VA 4LD0A 3CFOA 4FO0A 1SAZA 3DWLA 1C1CA 3OA9A 4CJKA 1GLBG 4IO9L 3QEPA 2G8FA 1BWFO 2VGMA 5AQOA 4BC5A 3P38A 4E7HA 4MDAA 4JI8K 5I9EB 2A42A 2QWLA 1W0HA 4DTUA 2WBNA 4KHPK 1JXBA 2W41A 1EWQA 3KJVA 3RMDA 3ENHA 4FLZA 1VQPN 1JLAA 1HJRA 2B6AA 4CHOA 2FSNA 1WUAA 2FXUA 3T3FA 1JLEA 3JXUA 4MLHA 5FPMA 1QHAA 2A5XA 2W40A 2HHSA 2ZGZA 1TAUA 3OBYA 4CJRA 4EP4A 4FWQA 5AQTA 3L6QA 1E4FT 3VEOA 3DYAA 1A5VA 2P1JA 2O8DA 1SUQA 1BHLA 4M3XA 1G99A 4C8NA 3AVJA 4BR4A 3CJ1A 3SQ4A 3MECA 3RRHA 4DG1A 3FFKB 3V9UA 1VQON 4QAGA 1VSDA 5GAEP 2KTQA 5AQUA 3CI5A 3DLKA 3SPYA 3ZSZA 1WN7A 4HTLA 2YHXA 3MWPA 4MFBA 3VEVA 2HHWA 3O3GA 3LDSA 3CM6A 2HVHA 5CR4A 5T7BA 4HCCA 3CXCM 1BO5O 1TKDA 2HF3A 3RMCA 1RTJA 1U2VB 2VWKA 3TABA 4YDUC 4KHQA 1KVCA 1WSEA 4CJWA 3SUNA 4FK0A 2XY7A 2P5OA 1ATNA 3AA4A 4B9QA 2NRXA 1EWRA 3EL2A 2FC0A 1QHTA 4DTXA 3J7YP 3RMAA 1NK9A 2KLAA 4M3YA 5BR9A 4FJHA 1BU6O 1HYZA 3UIQA 3GE1A 5AQWA 3J8AA 3WEEB 5TKWA 4RW4A 4BRHA 1Q18A 4GY2B 4KAZA 1NGGA 2A41A 3CQ8A 4CJQA 4FXDA 3E9PA 3R6MA 1NGEA 2GWJA 3H3NO 1HYSA 5BRHA 1V4SA 4M7XA 3CCQN 4JAXA 3P83D 3A5NC 2IVNA 3OYNA 1NGFA 2YV0X 3O80A 2VG7A 1JKHA 3VTIA 1JLBA 4FOIA 4FPBA 3IKMA 4BG8A 5FPNA 1UOCA 4E7JA 4CERA 3BUZB 1FKPA 3CF5L 1YVUA 4BACA 1KQSM 1Z26A 3MCPA 3IAYA 2DFFA 4ISFA 1X9MA 4K43A 5CZ1A 4A57A 4DFKA 1TK5A 1HKBA 3OY9A 3K5LA 5C25A 3OYGA 3CC7N 4QS7A 3A5LC 5DMRA 5AQNA 3CJCA 4I9LA 4M7YA 1E3MA 3I33A 3QNOA 2CGKA 4JKBA 4OJRA 3OYIA 3ENOA 3L2UA 1KTQA 4BVPA 3ZEUA 4CJSA 4PKHA 1RDUA 4IBNA 4CCHA 3KK1A 2P9UB 3LP0A 1L5UA 2DFEA 3CM5A 4ELTA 2CH5A 5AQHA 2Q2RA 3L2RA 1Y64A 4CJFA 5C10A 5AQXA 5AQZA 4EAHD 4BE1A 4G9ZA 4KH4A 4X66K 3AVIA 4B9TA 1GLAG 3AO4A 2NNWA 4DTSA 4FK2A 3W0LA 4AM6A 3NDKA 4K41A 4DR4K 3C7NB 3PIOL 3MX2A 2ATQA 2A1RA 4B9MA 2P9IB 3KVGA 1EXQA 3CJ9A 4J2EA 1WB9A 1NMNA 2E2NA 3SAHA 3O9TA 4B8CA 2QWMA 4BR5A 4FJJA 4DSEA 3ATUA 3QDKA 4YY3K 3SQ2A 4YHHK 1KVBA 1REVA 1VRUA 3T69A 1S6QA 2UXDK 3RSEB 1A5WA 3DOKA 3VQQA 4W5RA 1RBUA 4CZFA 4FWMA 4IO8A 5AQMA 1N8RO 2O8EB 4KREA 3NCIA 4WCEL 5KPZA 1ZC6A 1L3VA 4F3OA 3DLBA 3ZX0A 2P9SA 4OO1J 3LM2A 3PSFA 3LZJA 4EP5A 1HX1A 4FJXA 4B3RK 4AHTA 3PY8A 2FSKA 3CCLN 2CGJA 2EX3A 4N5SA 4CZGA 2IIRA 3G4SN 4CZJA 4CECA 4M42A 1JLFA 3M6GA 3T1YK 3P31A 1TL3A 4E1NA 4DR5K 3AV9A 1YITN 3QETA 4JKHA 3MN6A 1W2BM 4OPHA 5AQIA 3SYZA 3CJAA 4FLXA 1GLCG 3FE1A 4ZTFA 4DSJA 3MX5A 4FW1A 4HVJA 5D3GA 1OKJA 2RHKA 1LWEA 1SV5A 4OGEA 4PA1A 4JI4K 3DRPA 1BISA 5KPTA 4DS4A 4CJVA 3LL3A 2ZJRL 2XY6A 1NGDA 1KAXA 3ID8A 3IRXA 3ZSRA 4EHTA 4MLEA 2P9LB 2VWJA 3U3YA 5KQ8A 4JKGA 4PQUA 2ZM6K 3CPEA 1SS6A 3JYTA 3ID6A 1QS4A 3CCRN 1EETA 3ZSXA 3N4QA 3U8XA 2D0AA 3THVA 2GTDA 1ZBSA 4H5TA 1SL1A 3NH0A 4F2RA 3AA2A 2HSTA 1Q8IA 4H0TB 1BI4A 1IKVA 3E1YA 1KFDA 4Y1CA 3K9JA 4E1MA 2QXFA 3KHYA 4R79A 4DFMA 5HROA 4HWIA 1KAZA 3TTFA 1QVFM 2I7NA 1XMOK 4DTMA 1EX4A 1NBWA 2GBZA 3DLHA 3L4IA 3EKUA 5GAHP 4DLEA 1Q9YA 4YOYA 4IFEA 2G8WA 3NGIA 2E8AA 3SMSA 4GNIA 2LSNA 1U47A 1YJ9N 1XI1A 4M3UA 4Z4EA 4Z0UA 5BRFA 3ZSOA 4FWLA 3NMUA 3AA3A 3KK7A 4CZEA 3D0PA 2IGIA 3D2EB 1ATSA 1C0TA 3THWB 3AVLA 2HMIA 3O9SA 4FPAA 3VPZA 3I8DA 3P4IA 5AQPA 2KZMA 1SQKA 4I7FA 1WBDA 4FJ9A 3F9KA 4M45A 1SL0A 3L2WA 3VQ6A 2A1SA 4I6MB 3HOTA 3KK3A 4OKJA 4YNQA 3O9QA 4I2QA 3FZMA 4CF1A 3SQ1A 2X74A 4DV1K 1D9DA 4BR9A 4K8ZA 1SKRA 3TAGA 1OH7A 5M1FA 1NU0A 5AZJA 1BIUA 3CPWM 1SL2A 3SMPA 2FSJA 5LJWA 4IWVA 2KQ2A 4GKJK 3WNHA 4JKAA 3O3FA 4IFYA 1KVAA 2QK9A 2KFZA 1HQUA 4JD2B 3V9XA 3MEGA 4GVEA 1KSPA 4AH9A 2EHGA 4JHDA 1F21A 4BREA 4CE9A 2HW3A 3AY9A 1QQNA 4C8LA 4CJ3A 3M8PA 5J1EA 4O0IA 2QA4N 2GX9A 3NF9A 4O8KA 3MAQA 2F8TA 2YHAA 2A6AA 3OTOK 3SUQA 2VYPA 3F5TA 4KO0A 1HKCA 4BE2A 4A2BA 5KI6A 4HTUA 1O13A 4N76A 3CERA 2P9PA 1XQSC 1RT3A 3Q7CA 3VGKA 3HM9A 4Z4IA 1QQOA 1E4GT 3OYMA
chains in the Genus database with same CATH topology
3OYBA 1J54A 1W0HA 2Z1HA 3DLGA 4DTUA 3K58A 1WSFA 2BDPA 4BWJA 1NJZA 1JXBA 3LAMA 1NKCA 4W5OA 1DTQA 3KJVA 1TL1A 3RMDA 1CZ9A 1NJYA 3KLHA 3TARA 4FLZA 1BI4B 3MXMA 3HL8A 4EZ6A 4E3SA 2OPRA 5J2PA 5HRPA 3V9WA 1JLAA 1HJRA 4KV8A 3U6FA 1HNVA 3ZCMA 2B6AA 3P5JA 4CHOA 3T3FA 4JRQA 3HK2A 3OJSA 3AO1A 1JLEA 3S9HA 3RWUA 1CXUA 4CEFA 3G10A 2HHSA 2XO7A 3RTVA 1TAUA 3EZ5A 4CJRA 4EP4A 4XIUA 3RR8A 3VQAA 1JL1A 1WSIA 1VSEA 3K2PA 3AO5A 3VQBA 1VSHA 1B9FA 2XY5A 2O4GA 3DYAA 3OYEA 3PX0A 3VQ7A 1A5VA 1RT7A 1YT3A 3HP6A 4DLGA 4M3RA 2P1JA 2G8UA 1SUQA 3DMJA 3AVKA 1BHLA 2OA8A 1RBRA 3RR7A 3ULDA 4M3XA 4C8NA 4LSLA 3AVJA 3EY1A 3SQ4A 4KRFA 4KTWA 1U04A 1LV5A 3MECA 4CEDA 3RRHA 3P1GA 4DG1A 3C95A 3M8RA 4NYNA 4HHTA 4FM2A 3V9UA 4DSKA 4DSIA 4RG8A 3SUOA 3HVRA 4QAGA 4K8XA 4H4MA 1VSDA 3KD1E 2KTQA 3HO1A 1HNIA 3HP9A 4CFBA 3KK2A 3QEXA 4FZYA 3DLKA 3LPTA 1RTDA 1BGXT 3RMBA 3ALYA 1WN7A 3ZSZA 3SPYA 3QEIA 1NOYA 3KD5E 1U4BA 3ZT0A 4JRPA 3PX4A 4MFBA 3NF7A 3L8BA 4WE1A 3OYFA 2HHWA 3O3GA 4EZ9A 1W9HA 3LDSA 3CM6A 1T8EA 1J5OA 3NGZA 2HVHA 4CJ5A 1NJWA 5T7BA 4FM0A 1NK4A 4HCCA 3K5MA 4CEOA 3V1RA 4CK3A 4O4GA 4CEAA 1ZBHA 3QERA 1TKDA 1FKOA 3LANA 1S1UA 1ZBUA 4N47A 3RMCA 1YTUA 1RTJA 2IAJA 4MQ3A 3PUFA 3ZT3A 4DF8A 2KW4A 2X78A 4CJUA 1HYVA 4AHUA 2VWKA 3VQCA 3TABA 4KHQA 1KVCA 2Z1IA 5FROA 4C8MA 1WSEA 2G8HA 4CJWA 3SUNA 1RBVA 4FK0A 2XY7A 4IFVA 2P5OA 3AA4A 4UQGA 1X9WA 1RDAA 3NBPA 4DSLA 3MEEA 4DQQA 3ZSVA 4B08A 5I3UA 1HQEA 2FC0A 1TKXA 1QHTA 2GV9A 4DTXA 4ELUA 3D45A 3LZIA 3RMAA 1WNSA 3AVGA 2HNDA 1NK9A 3NAEA 3PO4A 2HHUA 2BE2A 4M3YA 4DQSA 1B92A 4FJHA 3UIQA 1HYZA 3C6TA 4OLAA 4E0DA 1IO2A 4RW8A 2G8IA 4BDZA 4RW4A 4CIGA 2E6LA 3OJUA 4OPKA 1U49A 5E41A 2KZZA 4M3TA 3KLFA 4KAZA 1NK0A 4B9UA 3AVBA 2RF2A 3CQ8A 4CJQA 1TV6A 4Z4FA 4FXDA 3LPUA 4FZZA 4Y1DA 3LP1A 4F2SA 4BDPA 4FJLA 2KFNA 3AO3A 4CGGA 4KHWA 1Z25A 3IG1A 1X1PA 1ZBFA 3DLEA 1LW2A 4C8OA 4CF2A 1HYSA 4FW2A 1JLGA 3QINA 4W5TA 3K5NA 1RBSA 3P83D 3PX6A 3SPZA 3L2QA 4FJ5A 2O4IA 1VSMA 4FJNA 3AVHA 3OYNA 1TVRA 1U48A 3NF6A 1JL2A 1J53A 2YV0X 4CEQA 4DTRA 2P5GA 4I9QA 4KPYA 2VG7A 4KHUA 1JKHA 2FBXA 1JLBA 4F3TA 3FFIA 4KHNA 2HNYA 5KRSA 1UOCA 4E7JA 4CERA 2HNZA 4DU4A 4NCBA 3V6DA 4CGFA 1QE1A 2DY4A 1FKPA 4IG0A 4DF4A 4H4OA 1YVUA 2X6SA 1RT2A 4BACA 5DK5A 3TI0A 1RNHA 4FJGA 3BGRA 1Z26A 3ZT1A 3TANA 1GOAA 2Q3SA 1RTIA 4O0JA 2DFFA 4I2PA 3IAYA 2F8SA 1X9MA 2IC3A 3SNNA 5CZ1A 5EU7A 1IKWA 1G15A 3G0ZA 3WNEA 4W5NA 4DTJA 4DFKA 3DOLA 4DQPA 1KCFA 1TK5A 4DFPA 1C6VA 3VQ8A 3OY9A 4KTQA 4CEZA 3NF8A 1EP4A 3K5LA 1ITGA 2IDOA 2XY8A 1ASUA 2F96A 1RT6A 3T1AA 4CJLA 5C25A 3OYGA 2ZQBA 3HXMA 4DQRA 3S3MA 4L8RB 1RILA 1VSJA 3QEVA 3TR8A 4B9VA 4CJEA 3KLGA 1DLOA 4KB0A 1N5YA 5DMRA 1XWLA 5CYQA 4I9LA 3SCXA 2DTUA 3QNOA 1D8YA 3DRRA 3TAMA 4M3WA 2YNHA 4NYFA 4OJRA 3OYIA 4LSNA 1WSGA 4Z4HA 4GVMA 2RN2A 4E89A 1RT5A 3L2UA 1KTQA 4CJSA 5J2MA 2HB5A 4GMJB 2VG5A 4IBNA 4CCHA 3KK1A 4CHZA 3LP0A 1SKWA 1L5UA 1MU2A 2DFEA 3CM5A 1JLCA 4ELTA 3IS9A 4FJIA 3OS2A 3OYCA 4FJ7A 3L2RA 1B9DA 1S5JA 4CJFA 1Q9XA 4W5QA 4FJKA 5SZTA 4BE1A 1K6YA 1LW0A 1UWBA 3HPHA 3AVIA 4ID1A 2D5RA 4B9TA 2ETJA 3AO4A 4DTSA 4IKFA 1C1AA 2HHXA 4FK2A 3E01A 3BDPA 4B3OA 3LP2A 1WAFA 1DTTA 3NDKA 1VSIA 3O4QA 4J2AA 3VN5A 1BCMA 1LWCA 4E7LA 2ATQA 1WAJA 4DU1A 2A1RA 4FLWA 2XRIA 4DS5A 4B9MA 4FK4A 4H8KA 1BL3A 3ISNC 4OPJA 4DMNA 1EXQA 2E4LA 5C42A 1VSKA 2P51A 4J2EA 2HHTA 4B8AB 3F73A 1BIZA 3TAQA 3H08A 2ZE2A 2QKKA 2OPQA 4B8CA 3A2FA 3RRGA 2HVIA 4J2BA 3T19A 4FJJA 4ID5A 4JLHA 3TWHA 1KFSA 3KTQA 4DSEA 1S9GA 3DLRA 3NH2A 5HBMA 5HLFA 2JGUA 3SQ2A 1KLMA 3OS1A 1KVBA 1REVA 2RKIA 1VRUA 1T05A 4LH5A 3TAFA 2IOCA 3M8QA 4CJ4A 1S6QA 2IS3A 1NJXA 3ZSQA 1TKTA 3TAEA 3SJJA 1T7PA 4CHNA 1A5WA 3DOKA 3VQQA 4W5RA 1RBUA 1JLQA 5HRSA 2BANA 4TSXA 3V1OA 1RBTA 4KREA 4E7IA 3NCIA 1L3SA 1U45A 1UAXA 3HJFA 1I39A 1L3VA 1ASVA 4F3OA 3DLBA 1LWFA 3AA5X 1ZBIA 1JXEA 2HHQA 1UA0A 4DFJA 2DFHA 3LZJA 1S1TA 4FZXC 1TKZA 2E6MA 4EP5A 4CFDA 2OZMA 4FJXA 4AHTA 1BCOA 3PY8A 1Y97A 4O5BA 1RDCA 1QQCA 4CGJA 3OS0A 3VQ9A 2QKBA 2EX3A 3CYMA 3AVNA 1RT4A 4N5SA 4FJMA 1CLQA 3TAPA 1C1BA 3DRSA 4G1QA 4HCBA 1FXXA 4CECA 4HUFA 2Z1GA 3ITHA 4M42A 1EKEA 1S1XA 1JLFA 1TGOA 3LWLA 1UA1A 1TL3A 3S3OA 3C94A 5CZ2A 3ZSWA 4E1NA 1D9FA 4OKKA 2Y1IA 2GUIA 3V9ZA 1LAWA 3AV9A 3V1QA 4B9LA 1S9EA 2D0BA 3QETA 3I0RA 1NK7A 3CFRA 3CFPA 1CZBA 4FLTA 3SYZA 4KHYA 4CJTA 1TAQA 1XHZA 4FLXA 2VG6A 2X6NA 4O44A 4ZTFA 4DSJA 5J2QA 4FW1A 4HVJA 4CIEA 5D3GA 1A5XA 4LH4A 4N41A 1GOBA 4KHSA 4OLBA 1L3TA 1LWEA 4FCYA 1SV5A 3K5OA 4FVMA 1QSLA 4OGEA 4PA1A 3DRPA 1VSLA 2YHBA 1BISA 3QLHA 4DS4A 4JS4A 4CJVA 2XY6A 3SI6A 1KRPA 4OVLA 1VRTA 3IRXA 4IG3A 3ZSRA 1QSSA 4KI4A 2Z1JA 1RCHA 4RW7A 4CHPA 2YNIA 3ASMA 3B6OA 4HUEA 1BQMA 2VWJA 4DU3A 3U3YA 4Q0BA 1S1VA 4NCAA 1CXQA 4PQUA 3AVCA 4OGCA 1O1WA 3AVMA 4KFBA 3VQPA 4ZTJA 3JYTA 1TK8A 3LP3A 2YNFA 1QS4A 4F8RA 1FK9A 1EETA 3ZSXA 3ZT2A 5CYMA 3SV3A 3THVA 2D0AA 1T03A 2G8VA 1ZYQA 1XC9A 4FLVA 5JS2A 3QIPA 1SL1A 4N56A 2OYQA 3NFAA 3NH0A 4F2RA 1HRHA 2YKNA 3AA2A 3OYLA 3V81A 1Q8IA 4BE0A 1NK8A 4CK1A 4Z4CA 3B6PA 3U3GA 2ZD1A 1ASWA 1BI4A 1IKVA 4AHSA 1KFDA 2NUBA 4Y1CA 3VQEA 4E1MA 2Y1JA 4M3ZA 4E19A 1TK0A 2QXFA 4IDKA 3WNGA 1QTMA 2W42A 3K59A 4DFMA 5I42A 5JS1A 5HROA 3OYJA 3PO5A 1C0MA 1QSYA 4F4KA 2R7YA 4QCLA 4FJ8A 5KRTA 2B5JA 3M8SA 4JS5A 4E7KA 3QO9A 1WSJA 4RW6A 4ICLA 3HPOA 1KLNA 5KTQA 3V4IA 4DTMA 1EX4A 3ZT4A 1LAVA 3QEWA 2GBZA 2HHVA 3DM2A 3HPGA 3KIOA 4ZHRA 5HP1A 1D5AA 1NKEA 3DLHA 4OKEA 1NK6A 1WSHA 3V9SA 4DLEA 1Q9YA 2WONA 3HYFA 3DI6A 1NKBA 2G8WA 3NGIA 1RDDA 4CHYA 3LALA 4BDYA 4CGDA 1IH7A 2ITGA 3HSTB 4CGIA 4J2DA 1GOCA 4PY5A 2LSNA 1WLJA 1U47A 5FRNA 4CJPA 4B9SA 3NE6A 3SV4A 1XI1A 3L3UA 3OYHA 4M3UA 4Z4EA 1BQNA 4Z0UA 4BWMA 3ZSOA 3VA3A 4DTNA 4CEBA 4PWDA 4KI6A 4KKOA 5FDLA 3AA3A 4Z4GA 4DSFA 1IKYA 4AHRA 5SWMA 4YFUA 4AILC 1RDBA 1S1WA 3PV8A 2FBYA 2IGIA 2YKMA 5CY4A 3OYKA 3D0PA 1C0TA 2PYLA 4CEEA 3AVLA 4DQIA 2JLEA 3AO2A 2HMIA 3OYDA 4QOZB 3I8DA 4DTOA 1N6QA 3KLIA 3MXIA 2KZMA 5KGXA 4RW9A 3NH1A 4I7FA 4FJ9A 3F9KA 2G8KA 4M45A 4CESA 3L2WA 2XHBA 1SL0A 5FRMA 3VQ6A 2A1SA 4FLYA 3S3NA 3KKRA 3WNFA 2PYJA 4C8KA 3NHGA 3QNNA 3AVAA 3KK3A 3HVTA 4OKJA 4FLUA 4YNQA 4CF8A 3QIOA 3NGYA 1SKSA 2B4JA 3MEDA 1YTAA 4I2QA 4CFAA 2OZSA 3SQ1A 4CF1A 1XHXA 2X74A 3VQDA 1VSFA 4CF0A 1D9DA 4CIFA 3L3VA 3AVFA 3I0SA 4K8ZA 2OPPA 1SKRA 4HUGA 3TAGA 3LWMA 4LY7A 1BIUA 3CG7A 3EYZA 1SL2A 1NK5A 4CF9A 3SZ2A 1NOZA 1RT1A 2KQ2A 3C6UA 1J9AA 2PY5A 2D0CA 3WNHA 3O3FA 2YNGA 4IFYA 3O3HA 1KVAA 2QK9A 2KFZA 1S6PA 1HQUA 4FM1A 4PUOA 4AHVA 1R0AA 1ZBLA 4FYDA 3MXJA 3V9XA 3MEGA 3SQ0A 1KSPA 4KB1A 4AH9A 2EHGA 4Q5VA 1F21A 1X9SA 3VQ4A 4CE9A 4DWIA 2HW3A 3VA0A 1C0UA 4GW6A 3JSMA 4C8LA 3OVNA 2FBVA 3VQ5A 3M8PA 4CJ3A 4CK2A 5J1EA 1HPZA 4KTZA 4O0IA 5J2NA 3NF9A 3MAQA 2F8TA 2YHAA 1RTHA 4CGHA 5HRNA 3SUQA 5KGWA 2WOMA 3O4NA 3KLEA 1I3AA 4KO0A 4R5PA 4O55A 4NCGA 3SUPA 3K57A 2PZSA 5K14A 3LAKA 4CFCA 4AHCA 3L2VA 4B9NA 4LD0A 4CHQA 2RPIA 4ELVA 3CFOA 4BE2A 3ZSYA 5KI6A 1IG9A 4HTUA 3OYAA 1IKXA 2I5JA 1C1CA 4N76A 1VK0A 5HRRA 4CJKA 2BGGA 3QEPA 2G8FA 3QESA 2AJQA 3HT3A 1RT3A 2FBTA 5C24A 2OPSA 4E7HA 3HM9A 4DTPA 4Z4IA 4M41A 1HMVA 1L3UA 3OYMA 3KKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYB A;  1J54 A;  1W0H A;  2Z1H A;  3DLG A;  4DTU A;  3K58 A;  1WSF A;  2BDP A;  4BWJ A;  1NJZ A;  1JXB A;  3LAM A;  1NKC A;  4W5O A;  1DTQ A;  3KJV A;  1TL1 A;  3RMD A;  1CZ9 A;  1NJY A;  3KLH A;  3TAR A;  4FLZ A;  1BI4 B;  3MXM A;  3HL8 A;  4EZ6 A;  4E3S A;  2OPR A;  5J2P A;  5HRP A;  3V9W A;  1JLA A;  1HJR A;  4KV8 A;  3U6F A;  1HNV A;  3ZCM A;  2B6A A;  3P5J A;  4CHO A;  3T3F A;  4JRQ A;  3HK2 A;  3OJS A;  3AO1 A;  1JLE A;  3S9H A;  3RWU A;  1CXU A;  4CEF A;  3G10 A;  2HHS A;  2XO7 A;  3RTV A;  1TAU A;  3EZ5 A;  4CJR A;  4EP4 A;  4XIU A;  3RR8 A;  3VQA A;  1JL1 A;  1WSI A;  1VSE A;  3K2P A;  3AO5 A;  3VQB A;  1VSH A;  1B9F A;  2XY5 A;  2O4G A;  3DYA A;  3OYE A;  3PX0 A;  3VQ7 A;  1A5V A;  1RT7 A;  1YT3 A;  3HP6 A;  4DLG A;  4M3R A;  2P1J A;  2G8U A;  1SUQ A;  3DMJ A;  3AVK A;  1BHL A;  2OA8 A;  1RBR A;  3RR7 A;  3ULD A;  4M3X A;  4C8N A;  4LSL A;  3AVJ A;  3EY1 A;  3SQ4 A;  4KRF A;  4KTW A;  1U04 A;  1LV5 A;  3MEC A;  4CED A;  3RRH A;  3P1G A;  4DG1 A;  3C95 A;  3M8R A;  4NYN A;  4HHT A;  4FM2 A;  3V9U A;  4DSK A;  4DSI A;  4RG8 A;  3SUO A;  3HVR A;  4QAG A;  4K8X A;  4H4M A;  1VSD A;  3KD1 E;  2KTQ A;  3HO1 A;  1HNI A;  3HP9 A;  4CFB A;  3KK2 A;  3QEX A;  4FZY A;  3DLK A;  3LPT A;  1RTD A;  1BGX T;  3RMB A;  3ALY A;  1WN7 A;  3ZSZ A;  3SPY A;  3QEI A;  1NOY A;  3KD5 E;  1U4B A;  3ZT0 A;  4JRP A;  3PX4 A;  4MFB A;  3NF7 A;  3L8B A;  4WE1 A;  3OYF A;  2HHW A;  3O3G A;  4EZ9 A;  1W9H A;  3LDS A;  3CM6 A;  1T8E A;  1J5O A;  3NGZ A;  2HVH A;  4CJ5 A;  1NJW A;  5T7B A;  4FM0 A;  1NK4 A;  4HCC A;  3K5M A;  4CEO A;  3V1R A;  4CK3 A;  4O4G A;  4CEA A;  1ZBH A;  3QER A;  1TKD A;  1FKO A;  3LAN A;  1S1U A;  1ZBU A;  4N47 A;  3RMC A;  1YTU A;  1RTJ A;  2IAJ A;  4MQ3 A;  3PUF A;  3ZT3 A;  4DF8 A;  2KW4 A;  2X78 A;  4CJU A;  1HYV A;  4AHU A;  2VWK A;  3VQC A;  3TAB A;  4KHQ A;  1KVC A;  2Z1I A;  5FRO A;  4C8M A;  1WSE A;  2G8H A;  4CJW A;  3SUN A;  1RBV A;  4FK0 A;  2XY7 A;  4IFV A;  2P5O A;  3AA4 A;  4UQG A;  1X9W A;  1RDA A;  3NBP A;  4DSL A;  3MEE A;  4DQQ A;  3ZSV A;  4B08 A;  5I3U A;  1HQE A;  2FC0 A;  1TKX A;  1QHT A;  2GV9 A;  4DTX A;  4ELU A;  3D45 A;  3LZI A;  3RMA A;  1WNS A;  3AVG A;  2HND A;  1NK9 A;  3NAE A;  3PO4 A;  2HHU A;  2BE2 A;  4M3Y A;  4DQS A;  1B92 A;  4FJH A;  3UIQ A;  1HYZ A;  3C6T A;  4OLA A;  4E0D A;  1IO2 A;  4RW8 A;  2G8I A;  4BDZ A;  4RW4 A;  4CIG A;  2E6L A;  3OJU A;  4OPK A;  1U49 A;  5E41 A;  2KZZ A;  4M3T A;  3KLF A;  4KAZ A;  1NK0 A;  4B9U A;  3AVB A;  2RF2 A;  3CQ8 A;  4CJQ A;  1TV6 A;  4Z4F A;  4FXD A;  3LPU A;  4FZZ A;  4Y1D A;  3LP1 A;  4F2S A;  4BDP A;  4FJL A;  2KFN A;  3AO3 A;  4CGG A;  4KHW A;  1Z25 A;  3IG1 A;  1X1P A;  1ZBF A;  3DLE A;  1LW2 A;  4C8O A;  4CF2 A;  1HYS A;  4FW2 A;  1JLG A;  3QIN A;  4W5T A;  3K5N A;  1RBS A;  3P83 D;  3PX6 A;  3SPZ A;  3L2Q A;  4FJ5 A;  2O4I A;  1VSM A;  4FJN A;  3AVH A;  3OYN A;  1TVR A;  1U48 A;  3NF6 A;  1JL2 A;  1J53 A;  2YV0 X;  4CEQ A;  4DTR A;  2P5G A;  4I9Q A;  4KPY A;  2VG7 A;  4KHU A;  1JKH A;  2FBX A;  1JLB A;  4F3T A;  3FFI A;  4KHN A;  2HNY A;  5KRS A;  1UOC A;  4E7J A;  4CER A;  2HNZ A;  4DU4 A;  4NCB A;  3V6D A;  4CGF A;  1QE1 A;  2DY4 A;  1FKP A;  4IG0 A;  4DF4 A;  4H4O A;  1YVU A;  2X6S A;  1RT2 A;  4BAC A;  5DK5 A;  3TI0 A;  1RNH A;  4FJG A;  3BGR A;  1Z26 A;  3ZT1 A;  3TAN A;  1GOA A;  2Q3S A;  1RTI A;  4O0J A;  2DFF A;  4I2P A;  3IAY A;  2F8S A;  1X9M A;  2IC3 A;  3SNN A;  5CZ1 A;  5EU7 A;  1IKW A;  1G15 A;  3G0Z A;  3WNE A;  4W5N A;  4DTJ A;  4DFK A;  3DOL A;  4DQP A;  1KCF A;  1TK5 A;  4DFP A;  1C6V A;  3VQ8 A;  3OY9 A;  4KTQ A;  4CEZ A;  3NF8 A;  1EP4 A;  3K5L A;  1ITG A;  2IDO A;  2XY8 A;  1ASU A;  2F96 A;  1RT6 A;  3T1A A;  4CJL A;  5C25 A;  3OYG A;  2ZQB A;  3HXM A;  4DQR A;  3S3M A;  4L8R B;  1RIL A;  1VSJ A;  3QEV A;  3TR8 A;  4B9V A;  4CJE A;  3KLG A;  1DLO A;  4KB0 A;  1N5Y A;  5DMR A;  1XWL A;  5CYQ A;  4I9L A;  3SCX A;  2DTU A;  3QNO A;  1D8Y A;  3DRR A;  3TAM A;  4M3W A;  2YNH A;  4NYF A;  4OJR A;  3OYI A;  4LSN A;  1WSG A;  4Z4H A;  4GVM A;  2RN2 A;  4E89 A;  1RT5 A;  3L2U A;  1KTQ A;  4CJS A;  5J2M A;  2HB5 A;  4GMJ B;  2VG5 A;  4IBN A;  4CCH A;  3KK1 A;  4CHZ A;  3LP0 A;  1SKW A;  1L5U A;  1MU2 A;  2DFE A;  3CM5 A;  1JLC A;  4ELT A;  3IS9 A;  4FJI A;  3OS2 A;  3OYC A;  4FJ7 A;  3L2R A;  1B9D A;  1S5J A;  4CJF A;  1Q9X A;  4W5Q A;  4FJK A;  5SZT A;  4BE1 A;  1K6Y A;  1LW0 A;  1UWB A;  3HPH A;  3AVI A;  4ID1 A;  2D5R A;  4B9T A;  2ETJ A;  3AO4 A;  4DTS A;  4IKF A;  1C1A A;  2HHX A;  4FK2 A;  3E01 A;  3BDP A;  4B3O A;  3LP2 A;  1WAF A;  1DTT A;  3NDK A;  1VSI A;  3O4Q A;  4J2A A;  3VN5 A;  1BCM A;  1LWC A;  4E7L A;  2ATQ A;  1WAJ A;  4DU1 A;  2A1R A;  4FLW A;  2XRI A;  4DS5 A;  4B9M A;  4FK4 A;  4H8K A;  1BL3 A;  3ISN C;  4OPJ A;  4DMN A;  1EXQ A;  2E4L A;  5C42 A;  1VSK A;  2P51 A;  4J2E A;  2HHT A;  4B8A B;  3F73 A;  1BIZ A;  3TAQ A;  3H08 A;  2ZE2 A;  2QKK A;  2OPQ A;  4B8C A;  3A2F A;  3RRG A;  2HVI A;  4J2B A;  3T19 A;  4FJJ A;  4ID5 A;  4JLH A;  3TWH A;  1KFS A;  3KTQ A;  4DSE A;  1S9G A;  3DLR A;  3NH2 A;  5HBM A;  5HLF A;  2JGU A;  3SQ2 A;  1KLM A;  3OS1 A;  1KVB A;  1REV A;  2RKI A;  1VRU A;  1T05 A;  4LH5 A;  3TAF A;  2IOC A;  3M8Q A;  4CJ4 A;  1S6Q A;  2IS3 A;  1NJX A;  3ZSQ A;  1TKT A;  3TAE A;  3SJJ A;  1T7P A;  4CHN A;  1A5W A;  3DOK A;  3VQQ A;  4W5R A;  1RBU A;  1JLQ A;  5HRS A;  2BAN A;  4TSX A;  3V1O A;  1RBT A;  4KRE A;  4E7I A;  3NCI A;  1L3S A;  1U45 A;  1UAX A;  3HJF A;  1I39 A;  1L3V A;  1ASV A;  4F3O A;  3DLB A;  1LWF A;  3AA5 X;  1ZBI A;  1JXE A;  2HHQ A;  1UA0 A;  4DFJ A;  2DFH A;  3LZJ A;  1S1T A;  4FZX C;  1TKZ A;  2E6M A;  4EP5 A;  4CFD A;  2OZM A;  4FJX A;  4AHT A;  1BCO A;  3PY8 A;  1Y97 A;  4O5B A;  1RDC A;  1QQC A;  4CGJ A;  3OS0 A;  3VQ9 A;  2QKB A;  2EX3 A;  3CYM A;  3AVN A;  1RT4 A;  4N5S A;  4FJM A;  1CLQ A;  3TAP A;  1C1B A;  3DRS A;  4G1Q A;  4HCB A;  1FXX A;  4CEC A;  4HUF A;  2Z1G A;  3ITH A;  4M42 A;  1EKE A;  1S1X A;  1JLF A;  1TGO A;  3LWL A;  1UA1 A;  1TL3 A;  3S3O A;  3C94 A;  5CZ2 A;  3ZSW A;  4E1N A;  1D9F A;  4OKK A;  2Y1I A;  2GUI A;  3V9Z A;  1LAW A;  3AV9 A;  3V1Q A;  4B9L A;  1S9E A;  2D0B A;  3QET A;  3I0R A;  1NK7 A;  3CFR A;  3CFP A;  1CZB A;  4FLT A;  3SYZ A;  4KHY A;  4CJT A;  1TAQ A;  1XHZ A;  4FLX A;  2VG6 A;  2X6N A;  4O44 A;  4ZTF A;  4DSJ A;  5J2Q A;  4FW1 A;  4HVJ A;  4CIE A;  5D3G A;  1A5X A;  4LH4 A;  4N41 A;  1GOB A;  4KHS A;  4OLB A;  1L3T A;  1LWE A;  4FCY A;  1SV5 A;  3K5O A;  4FVM A;  1QSL A;  4OGE A;  4PA1 A;  3DRP A;  1VSL A;  2YHB A;  1BIS A;  3QLH A;  4DS4 A;  4JS4 A;  4CJV A;  2XY6 A;  3SI6 A;  1KRP A;  4OVL A;  1VRT A;  3IRX A;  4IG3 A;  3ZSR A;  1QSS A;  4KI4 A;  2Z1J A;  1RCH A;  4RW7 A;  4CHP A;  2YNI A;  3ASM A;  3B6O A;  4HUE A;  1BQM A;  2VWJ A;  4DU3 A;  3U3Y A;  4Q0B A;  1S1V A;  4NCA A;  1CXQ A;  4PQU A;  3AVC A;  4OGC A;  1O1W A;  3AVM A;  4KFB A;  3VQP A;  4ZTJ A;  3JYT A;  1TK8 A;  3LP3 A;  2YNF A;  1QS4 A;  4F8R A;  1FK9 A;  1EET A;  3ZSX A;  3ZT2 A;  5CYM A;  3SV3 A;  3THV A;  2D0A A;  1T03 A;  2G8V A;  1ZYQ A;  1XC9 A;  4FLV A;  5JS2 A;  3QIP A;  1SL1 A;  4N56 A;  2OYQ A;  3NFA A;  3NH0 A;  4F2R A;  1HRH A;  2YKN A;  3AA2 A;  3OYL A;  3V81 A;  1Q8I A;  4BE0 A;  1NK8 A;  4CK1 A;  4Z4C A;  3B6P A;  3U3G A;  2ZD1 A;  1ASW A;  1BI4 A;  1IKV A;  4AHS A;  1KFD A;  2NUB A;  4Y1C A;  3VQE A;  4E1M A;  2Y1J A;  4M3Z A;  4E19 A;  1TK0 A;  2QXF A;  4IDK A;  3WNG A;  1QTM A;  2W42 A;  3K59 A;  4DFM A;  5I42 A;  5JS1 A;  5HRO A;  3OYJ A;  3PO5 A;  1C0M A;  1QSY A;  4F4K A;  2R7Y A;  4QCL A;  4FJ8 A;  5KRT A;  2B5J A;  3M8S A;  4JS5 A;  4E7K A;  3QO9 A;  1WSJ A;  4RW6 A;  4ICL A;  3HPO A;  1KLN A;  5KTQ A;  3V4I A;  4DTM A;  1EX4 A;  3ZT4 A;  1LAV A;  3QEW A;  2GBZ A;  2HHV A;  3DM2 A;  3HPG A;  3KIO A;  4ZHR A;  5HP1 A;  1D5A A;  1NKE A;  3DLH A;  4OKE A;  1NK6 A;  1WSH A;  3V9S A;  4DLE A;  1Q9Y A;  2WON A;  3HYF A;  3DI6 A;  1NKB A;  2G8W A;  3NGI A;  1RDD A;  4CHY A;  3LAL A;  4BDY A;  4CGD A;  1IH7 A;  2ITG A;  3HST B;  4CGI A;  4J2D A;  1GOC A;  4PY5 A;  2LSN A;  1WLJ A;  1U47 A;  5FRN A;  4CJP A;  4B9S A;  3NE6 A;  3SV4 A;  1XI1 A;  3L3U A;  3OYH A;  4M3U A;  4Z4E A;  1BQN A;  4Z0U A;  4BWM A;  3ZSO A;  3VA3 A;  4DTN A;  4CEB A;  4PWD A;  4KI6 A;  4KKO A;  5FDL A;  3AA3 A;  4Z4G A;  4DSF A;  1IKY A;  4AHR A;  5SWM A;  4YFU A;  4AIL C;  1RDB A;  1S1W A;  3PV8 A;  2FBY A;  2IGI A;  2YKM A;  5CY4 A;  3OYK A;  3D0P A;  1C0T A;  2PYL A;  4CEE A;  3AVL A;  4DQI A;  2JLE A;  3AO2 A;  2HMI A;  3OYD A;  4QOZ B;  3I8D A;  4DTO A;  1N6Q A;  3KLI A;  3MXI A;  2KZM A;  5KGX A;  4RW9 A;  3NH1 A;  4I7F A;  4FJ9 A;  3F9K A;  2G8K A;  4M45 A;  4CES A;  3L2W A;  2XHB A;  1SL0 A;  5FRM A;  3VQ6 A;  2A1S A;  4FLY A;  3S3N A;  3KKR A;  3WNF A;  2PYJ A;  4C8K A;  3NHG A;  3QNN A;  3AVA A;  3KK3 A;  3HVT A;  4OKJ A;  4FLU A;  4YNQ A;  4CF8 A;  3QIO A;  3NGY A;  1SKS A;  2B4J A;  3MED A;  1YTA A;  4I2Q A;  4CFA A;  2OZS A;  3SQ1 A;  4CF1 A;  1XHX A;  2X74 A;  3VQD A;  1VSF A;  4CF0 A;  1D9D A;  4CIF A;  3L3V A;  3AVF A;  3I0S A;  4K8Z A;  2OPP A;  1SKR A;  4HUG A;  3TAG A;  3LWM A;  4LY7 A;  1BIU A;  3CG7 A;  3EYZ A;  1SL2 A;  1NK5 A;  4CF9 A;  3SZ2 A;  1NOZ A;  1RT1 A;  2KQ2 A;  3C6U A;  1J9A A;  2PY5 A;  2D0C A;  3WNH A;  3O3F A;  2YNG A;  4IFY A;  3O3H A;  1KVA A;  2QK9 A;  2KFZ A;  1S6P A;  1HQU A;  4FM1 A;  4PUO A;  4AHV A;  1R0A A;  1ZBL A;  4FYD A;  3MXJ A;  3V9X A;  3MEG A;  3SQ0 A;  1KSP A;  4KB1 A;  4AH9 A;  2EHG A;  4Q5V A;  1F21 A;  1X9S A;  3VQ4 A;  4CE9 A;  4DWI A;  2HW3 A;  3VA0 A;  1C0U A;  4GW6 A;  3JSM A;  4C8L A;  3OVN A;  2FBV A;  3VQ5 A;  3M8P A;  4CJ3 A;  4CK2 A;  5J1E A;  1HPZ A;  4KTZ A;  4O0I A;  5J2N A;  3NF9 A;  3MAQ A;  2F8T A;  2YHA A;  1RTH A;  4CGH A;  5HRN A;  3SUQ A;  5KGW A;  2WOM A;  3O4N A;  3KLE A;  1I3A A;  4KO0 A;  4R5P A;  4O55 A;  4NCG A;  3SUP A;  3K57 A;  2PZS A;  5K14 A;  3LAK A;  4CFC A;  4AHC A;  3L2V A;  4B9N A;  4LD0 A;  4CHQ A;  2RPI A;  4ELV A;  3CFO A;  4BE2 A;  3ZSY A;  5KI6 A;  1IG9 A;  4HTU A;  3OYA A;  1IKX A;  2I5J A;  1C1C A;  4N76 A;  1VK0 A;  5HRR A;  4CJK A;  2BGG A;  3QEP A;  2G8F A;  3QES A;  2AJQ A;  3HT3 A;  1RT3 A;  2FBT A;  5C24 A;  2OPS A;  4E7H A;  3HM9 A;  4DTP A;  4Z4I A;  4M41 A;  1HMV A;  1L3U A;  3OYM A;  3KKS A; 
#chains in the Genus database with same CATH topology
 1J54 A;  4NLB A;  2Z1H A;  1IBM K;  3LAM A;  3OBW A;  4DR6 K;  5KQD A;  3RR7 A;  4GV9 A;  4WQ5 A;  3TAR A;  4LC9 B;  4EZ6 A;  2OPR A;  5J2P A;  5HRP A;  3V9W A;  4BRM A;  4DR1 K;  4PL8 A;  1C0G A;  3W3D A;  5EXW A;  3G10 A;  2XO7 A;  4WQ4 A;  2H3G X;  4XIU A;  1KAY A;  1TUU A;  5M1O A;  3PLA A;  1P8Z A;  3OYE A;  3VQ7 A;  5C2D A;  5H1S Q;  4M3R A;  3AVK A;  5M1Q A;  1GLE G;  3ULD A;  3EY1 A;  4LSL A;  3SAF A;  1I94 K;  4KRF A;  1U04 A;  2QW9 A;  3M8R A;  3C95 A;  4DSK A;  4NYN A;  4FM2 A;  4K8X A;  1YXQ A;  3HP9 A;  4CFB A;  3QEX A;  1N36 K;  4JEP A;  3ALY A;  1NOY A;  1Q82 O;  3CIP A;  4JRP A;  2QTD A;  4JV5 K;  2YHY A;  2ITM A;  4EZ9 A;  1W9H A;  4JNE A;  1T8E A;  1J5O A;  4CJ5 A;  1NJW A;  4GV6 A;  1NK4 A;  3K5M A;  4CEO A;  2QM1 A;  3V1R A;  4O4G A;  4C1N I;  3UE5 A;  5AFU H;  2GWK A;  5HOO A;  5CE3 A;  3QER A;  1JCF A;  4BRD A;  4ISG A;  1S1U A;  4N47 A;  2IAJ A;  3PUF A;  3ZT3 A;  3BF1 A;  3MCA B;  1RBV A;  4PKG A;  4MO5 A;  1YIJ N;  5BR8 K;  3NBP A;  4BRL A;  4DQQ A;  1NMD A;  3VMF B;  5F1X A;  4EHU A;  4ELU A;  4B3O A;  4JI7 K;  2HND A;  2HHU A;  1TUY A;  2RE2 A;  2W6K A;  2FLO A;  4NXM K;  3JS6 A;  4CIG A;  1U49 A;  2KZZ A;  3KLF A;  3AVB A;  1JCG A;  3FZL A;  4Y1D A;  3LP1 A;  4JKC A;  4BDP A;  4F2S A;  4GKK K;  5AQG A;  1Z25 A;  1ZBF A;  2PBD A;  2V51 B;  1ZXO A;  4CF2 A;  3CQX A;  3K5N A;  4DV6 K;  2QWR A;  3SPZ A;  2O4I A;  1VSM A;  3AVH A;  3NF6 A;  4CEQ A;  4DTR A;  4CZK A;  3FFI A;  4M63 C;  3VET A;  2HNY A;  5KRS A;  4CBU A;  2HNZ A;  4DU4 A;  4NCB A;  2DY4 A;  4XEI A;  3THX A;  3K0S A;  1GOA A;  3THY A;  1RTI A;  4O0J A;  3NVK A;  1Z05 A;  1IKW A;  3G0Z A;  4W5N A;  1BA1 A;  1P90 A;  4YOV A;  3VQ8 A;  4KTQ A;  4CEZ A;  5A2Q O;  5M1K A;  3NF8 A;  1ITG A;  4FWP A;  2F96 A;  1BUP A;  3HXM A;  2ZQB A;  3MN7 A;  1VSJ A;  2V52 B;  4CJE A;  3KLG A;  3IMX A;  4JI6 K;  4KB0 A;  3TTD A;  5CYQ A;  5EX5 A;  1D8Y A;  3TAM A;  2YNH A;  3LDL A;  1VQM N;  1WSG A;  4B1Z A;  1VQN N;  4KBO A;  4GMJ B;  3MK6 A;  2I7P A;  4JI1 K;  4FJI A;  3OS2 A;  3OYC A;  4FJK A;  4B3S K;  1K6Y A;  3LDP A;  5AQF A;  3CD6 N;  2O8F A;  2HHX A;  5LJV A;  3LP2 A;  1DTT A;  2WTU A;  5BPN A;  2WC9 A;  3VN5 A;  1V4T A;  3E9L A;  1LWC A;  4E7L A;  4FK4 A;  1MWK A;  3ISN C;  4OPJ A;  4DMN A;  5C42 A;  2P51 A;  4BC2 A;  4YOX A;  2UUC K;  1TYQ A;  3TSQ A;  4DKW A;  3SBG A;  3J7Z O;  4JK8 A;  4BGB A;  3DXK A;  3O9U A;  3TWH A;  2YX6 A;  4H0P A;  1N33 K;  4IEI A;  4LH5 A;  3TAF A;  2IOC A;  3M8Q A;  3FLC O;  2IS3 A;  3TAE A;  3SJJ A;  1T7P A;  4CHN A;  5HRS A;  4U67 L;  1YF5 L;  3HJF A;  1I39 A;  3AA5 X;  4A61 A;  4UY8 O;  2DFH A;  1S1T A;  4FWK A;  2NLX A;  1HNX K;  1BCO A;  1OH5 A;  2YCH A;  3JAM O;  4CGJ A;  3OS0 A;  1GLD G;  3UKR A;  2NRR A;  1IG8 A;  3ULE B;  1FXX A;  4CVN E;  1EKE A;  4IXC A;  3LWL A;  1UA1 A;  3FGU A;  3EN9 A;  1D9F A;  3DAW A;  1LAW A;  1S9E A;  2D0B A;  3I0R A;  1VHX A;  3WQT A;  2FF6 A;  3WEE A;  3CFR A;  3BEX A;  4FLT A;  2D1K A;  4BC3 A;  4AF1 A;  1XHZ A;  4O44 A;  3IUC A;  5TKY A;  4CIE A;  1DT9 A;  4KHS A;  3WT0 A;  3H1Q A;  3N4P A;  4FVM A;  1QSL A;  2W6L A;  2YHB A;  1KRP A;  1YJN N;  1VRT A;  1VQ9 N;  2Z1J A;  1HJO A;  3SAG A;  2VCP A;  4DQ8 A;  3B6O A;  4HUE A;  4Q0B A;  2D0P A;  4NCA A;  1CXQ A;  3VQP A;  1S3X A;  1O1W A;  3AVM A;  1T3V A;  4A5B A;  3MDQ A;  2YNF A;  2OTL N;  4F8R A;  3ZT2 A;  2Q0R A;  3SBT A;  1J5E K;  5CYM A;  1ZYQ A;  5FLX O;  2KHO A;  3NFA A;  1HRH A;  5AZI A;  1NGI A;  3CJ7 A;  4BE0 A;  3UKU A;  1NK8 A;  4H0Y B;  4WYB A;  1NM1 A;  2NUB A;  3VQE A;  4BRF A;  4BR0 A;  2Y1J A;  4M3Z A;  1YAG A;  2YJF A;  1BG3 A;  3WNG A;  2W42 A;  5JS1 A;  5I42 A;  3OYJ A;  1BA0 A;  4F4K A;  4DCH A;  3DXM A;  1MDU B;  4X64 K;  5KRT A;  2F9T A;  3QO9 A;  3HPO A;  1N34 K;  3WXI A;  4DV7 K;  5KTQ A;  3ZT4 A;  4A5A A;  3T7Z A;  4OKE A;  1WSH A;  4CBX A;  4BQL A;  4BDY A;  1YI2 N;  5AR0 A;  3A0I X;  2EWS A;  1IH7 A;  3HST B;  1JJ2 M;  1OH8 A;  1WLJ A;  4O8U A;  4CJP A;  4V19 S;  4ILH A;  1NWK A;  3GDQ A;  3WQU A;  1IJJ A;  3C0B A;  3R1X A;  1ILY A;  4BWM A;  4DTN A;  2Q31 A;  4CEB A;  4PWD A;  1NGH A;  2P9N B;  4KKO A;  5FDL A;  4KI6 A;  4DSF A;  3CC2 N;  4YFU A;  5GAG P;  5SWM A;  3VES A;  4JI3 K;  4Z4G A;  1S1W A;  5E84 A;  1OVQ A;  2YKM A;  1NNE A;  4CEE A;  4DQI A;  3C7N A;  3EEQ A;  4QOZ B;  4WQ5 C;  2WUS A;  4DTO A;  2P9I A;  3KLI A;  5KGX A;  2F4V K;  3NH1 A;  1K8K A;  2XHB A;  2P9S B;  2HHH K;  4FLY A;  3KKR A;  3NHG A;  1Q7Y O;  2P9K A;  4FLU A;  3TSP A;  4YOT A;  1SKS A;  1YTA A;  4WQ4 C;  3VEN A;  4CFA A;  1XHX A;  1VSF A;  4BRO A;  3L3V A;  4MDB A;  4BC4 A;  5FPE A;  3I0S A;  2GUP A;  2UU9 K;  3VF4 A;  1JCE A;  4LY7 A;  4NLC A;  1YVN A;  3G71 N;  4DUZ K;  4LF7 K;  1NK5 A;  1DEJ A;  3QBW A;  1NOZ A;  2PY5 A;  1J9A A;  3G25 A;  5C12 A;  4PUO A;  4FM1 A;  2KKZ A;  1R0A A;  3HRG A;  3MXJ A;  4IJA A;  4JI0 K;  4NB4 A;  3VA0 A;  2HBL A;  4DV3 K;  1GLL O;  3OVN A;  3ZX2 A;  4CK2 A;  1HPZ A;  4KTZ A;  3CJB A;  4CGH A;  3DJC A;  2YI1 A;  3O4N A;  3KLE A;  1I3A A;  3CQY A;  4LF4 K;  3LDN A;  4NCG A;  3SUP A;  3CET A;  5AQR A;  3LAK A;  1OH6 A;  4AHC A;  5AQJ A;  1LOT B;  1GLJ O;  2RPI A;  1NGA A;  3OYA A;  2Q36 A;  1IKX A;  1VK0 A;  1CZA N;  5CHI A;  1VQK N;  2AJQ A;  3HT3 A;  4DTP A;  4M41 A;  2V7Y A;  1HMV A;  3KKS A;  3DLG A;  3O5B A;  3K58 A;  1WSF A;  4BWJ A;  1NJZ A;  3O1W A;  3AAR A;  3GG4 A;  5AQQ A;  3VOV A;  4W5O A;  1DTQ A;  1TL1 A;  3VGL A;  3KLH A;  3MXM A;  1BI4 B;  2A3Z A;  4KV8 A;  4J8F A;  1HNV A;  1C0F A;  3ZCM A;  1FW6 A;  1NG9 A;  2O8C A;  3OJS A;  3AO1 A;  3RWU A;  2AA4 A;  1QQM A;  3EZ5 A;  3VQA A;  1JL1 A;  1WSI A;  1VSE A;  3K2P A;  3AO5 A;  1VSH A;  1B9F A;  2O4G A;  3G6E N;  3PX0 A;  3HP6 A;  4B1U B;  1YT3 A;  1IBL K;  2G8U A;  3DMJ A;  4LF6 K;  2E5L K;  1RBR A;  1DGK N;  4KTW A;  4JI5 K;  3R3L A;  1LV5 A;  1VQ7 N;  3P1G A;  5B8H A;  4HHT A;  2BH1 A;  4RG8 A;  3HVR A;  1HNZ K;  4H4M A;  4FZY A;  3B8A X;  4CW7 B;  1RTD A;  3AGK A;  3C6H A;  3PX4 A;  3L8B A;  1BDG A;  4WE1 A;  5BN9 A;  3FZH A;  4BRQ A;  4B1W B;  5KPR A;  1M90 O;  3NGZ A;  5HL7 L;  1ZBH A;  1FKO A;  2DPN A;  1ZBU A;  3L4Q A;  1YTU A;  4MQ3 A;  4DF8 A;  3VEZ A;  2KW4 A;  2X78 A;  4BRG A;  2HMP A;  3VQC A;  3VEW A;  5FRO A;  4PL7 A;  2ZF5 O;  2V7Z A;  4IFV A;  4LF5 K;  5M1P A;  3THW A;  1RDA A;  1X9W A;  4DSL A;  3CCJ N;  3BP8 A;  2F9W A;  5EY4 A;  1H1V A;  2GV9 A;  1WNS A;  3AVG A;  3NAE A;  3PO4 A;  4JHD B;  2PAV A;  4DQS A;  1U6Z A;  4E0D A;  3M3Z A;  4BDZ A;  5AFU A;  4OPK A;  5E41 A;  4B9U A;  4FOE A;  3I56 N;  2KFN A;  2QXL A;  4BRK A;  3DLE A;  1LW2 A;  4C8O A;  3EO3 A;  3QIN A;  4PHT X;  5C15 A;  4XH5 A;  4OPA A;  5GIO A;  1TVR A;  1JL2 A;  4KHU A;  1EQY A;  4I9Q A;  4KPY A;  2FBX A;  4F3T A;  3LM9 A;  4H5R A;  3CHW A;  3TU5 A;  4H4O A;  2QWO A;  1RT2 A;  2X6S A;  1RNH A;  4FJG A;  3BGR A;  1EO1 A;  3TAN A;  2Q3S A;  5BRE A;  2O8B B;  2CH6 A;  2OCE A;  4DTJ A;  4LFC K;  3DOL A;  4DFP A;  1C6V A;  4JKF A;  1EP4 A;  2HBK A;  2IDO A;  2XY8 A;  1ASU A;  2IVP A;  1RT6 A;  4K42 A;  1HUX A;  3T1A A;  4DQR A;  1RIL A;  4AQY K;  4B9V A;  3ZET B;  1DLO A;  1N5Y A;  4IJN A;  4RTF D;  3H1V X;  3P39 A;  3SCX A;  1K9M O;  3DRR A;  3OHR A;  4NYF A;  4LSN A;  4Z4H A;  4GVM A;  4E89 A;  1RT5 A;  4BG9 A;  4DV5 K;  3KWG A;  5EVZ A;  1SKW A;  1JLC A;  3CCS N;  1Q9X A;  1B9D A;  4W5Q A;  5SZT A;  1UWB A;  3HPH A;  4B3M K;  3VF2 A;  2D5R A;  2ETJ A;  4IKF A;  1C1A A;  3BDP A;  3MN5 A;  4CI6 A;  3UB5 A;  1WAF A;  3WXK A;  3O4Q A;  1BCM A;  2GEM A;  2XRI A;  3D2F A;  5JLF A;  3R9P A;  2E4L A;  3IFR A;  5BPM A;  2NRW A;  1XNR K;  2HHT A;  1BIZ A;  5MLC Q;  4L3Q A;  3T19 A;  3KTQ A;  4JLH A;  1KFS A;  3QFP A;  2Q0U A;  1S9G A;  3DLR A;  3NH2 A;  2JGU A;  3OS1 A;  2RKI A;  3ZSQ A;  3CCM N;  3U9Z A;  2ZJP L;  3QIC A;  1HR0 K;  4TSX A;  4ILG B;  2ZJQ L;  1UAX A;  1ASV A;  1VQ6 N;  1LWF A;  1JXE A;  2HHQ A;  3PIP L;  4LF9 K;  1UA0 A;  3MMV A;  2HBJ A;  1TKZ A;  4FZX C;  4RCH A;  1Y97 A;  4O5B A;  4F9O A;  1QQC A;  1KC8 O;  1J6Z A;  3CYM A;  3AVN A;  1RT4 A;  1CLQ A;  4BRA A;  1C1B A;  5ADX H;  3AGR A;  1S72 N;  3DRS A;  4G1Q A;  5EOY A;  4X62 K;  4HCB A;  1VQ5 N;  1VQL N;  3ITH A;  1K73 O;  4YOU A;  4CZL A;  1TGO A;  3C94 A;  4OKK A;  2Y1I A;  1S22 A;  2GUI A;  3S41 A;  3V1Q A;  2NZT A;  4ISE A;  4B3T K;  3CFP A;  2QI2 A;  3THX B;  2VG6 A;  2X6N A;  2UUB K;  5AQS A;  2NRV A;  4N41 A;  1GOB A;  5JVH L;  3TPQ A;  4JS4 A;  2VQE K;  4OVL A;  1QSS A;  3VEY A;  4KI4 A;  3SK3 A;  2OTJ N;  5GAD P;  5C2F A;  1S1V A;  4FWR A;  3O08 A;  2E2P A;  3AVC A;  4OGC A;  4KFB A;  1TK8 A;  1Z6R A;  1T03 A;  3SLC A;  1XC9 A;  4FLV A;  5JS2 A;  3QIP A;  3V81 A;  2YKN A;  2O8D B;  2BUP A;  3H45 C;  4NXN K;  4CK1 A;  4Z4C A;  2ZD1 A;  1ASW A;  4AHS A;  4WFB L;  4E19 A;  1TK0 A;  3K59 A;  5DM7 L;  3PO5 A;  1C0M A;  4BY9 C;  4LF8 K;  2O8F B;  4C1N K;  4DV0 K;  4QCL A;  2J4R A;  4FJ8 A;  2B5J A;  4JS5 A;  1GLF O;  4OX9 K;  4ICL A;  2AP1 A;  3V4I A;  3QEW A;  3KIO A;  1NKE A;  3U9D A;  2E2Q A;  1NK6 A;  3O8M A;  4JK9 A;  3A8Y A;  3DI6 A;  1NKB A;  2F7T A;  4CHY A;  2QWN A;  1TYQ B;  2FF3 B;  4CD1 A;  1GOC A;  5ELZ A;  4PY5 A;  5FRN A;  4H5N A;  4QS9 A;  4B9S A;  3H6E A;  3DXK B;  3NE6 A;  3SV4 A;  2NRZ A;  3L3U A;  3OYH A;  4DR2 K;  2YHW A;  3BY5 A;  4CJ7 A;  3TSU A;  4CZH A;  1XMQ K;  1IKY A;  1NGJ A;  4FL9 A;  1RDB A;  4WFN L;  3EE8 A;  3NVM A;  2FBY A;  3OYK A;  5CY4 A;  3CCU N;  5AQL A;  1MWM A;  1OVY A;  3MN9 A;  4E1J A;  3MXI A;  1RDW X;  3D6R A;  3LDQ A;  4CES A;  5BRD A;  5FRM A;  2PYJ A;  3QNN A;  3CME N;  2BTF A;  1T6C A;  3NGY A;  1KXP A;  2JWK A;  5LL6 Z;  3KZB A;  3VQD A;  4CF0 A;  1YJW N;  3AVF A;  4NO7 A;  1SZ2 A;  1U2V A;  2OPP A;  4HUG A;  1XUP O;  3LWM A;  3UKR B;  3WUH A;  3CG7 A;  3EYZ A;  2PFU A;  3HBT A;  4WFA L;  4A59 A;  4FWO A;  2D0C A;  4FWN A;  3OW2 M;  3O3H A;  5F2R A;  1S6P A;  1ZBL A;  3FZF A;  4IDH A;  4Q5V A;  5IT9 O;  3VQ4 A;  2ZGY A;  1C0U A;  4GW6 A;  3JSM A;  2QWP A;  4H0O A;  5J2N A;  1RTH A;  5HRN A;  3WXL A;  1QZ5 A;  3QFU A;  4R5P A;  4DR7 K;  2CGL A;  4O55 A;  3K57 A;  3ULE A;  4CFC A;  4B9N A;  4JYA K;  3VER A;  4CHQ A;  3CCE N;  4ELV A;  3ZSY A;  1IG9 A;  2NRH A;  4EFH A;  2I5J A;  3U4L A;  3BF3 A;  5HRR A;  2HBM A;  5GIN A;  2BGG A;  3QES A;  2FBT A;  3F9M A;  5C24 A;  2E1Z A;  2OPS A;  5F0X A;  4EIA A;  1N32 K;  1L3U A;  2D4W A;  3J81 O;  3OYB A;  2BDP A;  3PSI A;  4DUY K;  1NKC A;  5AZI B;  5BPL A;  3ZEU B;  3UKU B;  1NJY A;  1CZ9 A;  3O6W A;  1BOT O;  3HL8 A;  4E3S A;  1FJG K;  2E20 A;  4YOW A;  3U6F A;  3P5J A;  3HZ6 A;  4JRQ A;  3HK2 A;  2YJE A;  3DXM B;  3S9H A;  3VF6 A;  4JN4 A;  1CXU A;  4CEF A;  3RTV A;  1Q86 O;  3RR8 A;  3ENB A;  3VQB A;  2XY5 A;  4GV3 A;  1HNW K;  1RT7 A;  4DLG A;  2OA8 A;  3H3O B;  4ILJ A;  4KH6 A;  4WF9 L;  2P9U A;  1M1K O;  1NGC A;  3HOS A;  4CED A;  4DSI A;  3SUO A;  3QBX A;  3KD1 E;  5C0Y A;  3HO1 A;  1HNI A;  3KK2 A;  3LPT A;  2UUA K;  1BGX T;  3RMB A;  4CD3 A;  3KD5 E;  5E26 A;  3QEI A;  3FZK A;  1U4B A;  3ZT0 A;  3TTC A;  5AQV A;  3NF7 A;  1X9J A;  3OYF A;  1K8K B;  4CBW A;  1WOQ A;  3SJH A;  5JMV A;  4FM0 A;  2P9K B;  4CK3 A;  3I8B A;  4O5F A;  4CEA A;  5JIC A;  4PKI A;  3LAN A;  4IEE A;  3H46 O;  4CJU A;  1HYV A;  4AHU A;  2P9N A;  2Z1I A;  4C8M A;  1W7A A;  2G8H A;  4BGA A;  4JI2 K;  1R59 O;  4UQG A;  3RSE A;  2ASO A;  3MEE A;  3ZSV A;  4B08 A;  4BRI A;  5I3U A;  1HQE A;  1TKX A;  2QWQ A;  1NJI O;  2UYT A;  3D45 A;  3LZI A;  2O8E A;  3CCV N;  1KD1 O;  3O1B A;  4A2A A;  2BE2 A;  1B92 A;  4JKE A;  3I55 N;  1VAZ A;  3C6T A;  3K9K A;  4OLA A;  1IO2 A;  4RW8 A;  4DV2 K;  2G8I A;  2E6L A;  3OJU A;  4DB3 A;  4M3T A;  1NK0 A;  2RF2 A;  1TV6 A;  4Z4F A;  3LPU A;  4BRP A;  4FZZ A;  1DKG D;  4FJL A;  5LY3 A;  3AO3 A;  4CGG A;  4KHW A;  3IG1 A;  1X1P A;  4FW2 A;  1JLG A;  1HPM A;  4W5T A;  2HF4 A;  1RBS A;  3PX6 A;  2OAN A;  3L2Q A;  4FJ5 A;  2ASM A;  4FJN A;  4BR7 A;  1T44 A;  1U48 A;  2P5G A;  1J53 A;  2VQF K;  3F2K A;  4JKG B;  1WBB A;  4KHN A;  3D7E O;  5AQY A;  3V6D A;  4CGF A;  1QE1 A;  4IG0 A;  4DF4 A;  5AJ3 K;  3HI0 A;  4JKD A;  2E88 A;  5DK5 A;  3TI0 A;  4B1X B;  3ZT1 A;  2NRT A;  4I2P A;  2F8S A;  2IC3 A;  3SNN A;  5EU7 A;  1G15 A;  3WNE A;  3CC4 N;  4DQP A;  1KCF A;  1HLU A;  1D4X A;  4B1Y B;  2O8C B;  4CJL A;  3HM8 A;  3S3M A;  3ZLJ A;  4L8R B;  2P9L A;  4XH1 A;  3TR8 A;  4B1V A;  1XWL A;  4A62 A;  2Q1N A;  4QS8 A;  1K8A O;  3ZX3 A;  4YDU A;  2DTU A;  4DHY A;  4M3W A;  4K25 A;  2QEX N;  4IOC L;  4JK7 A;  2RN2 A;  3WXM B;  4BRN A;  5J2M A;  2HB5 A;  2VG5 A;  3Q7B A;  4CHZ A;  1MU2 A;  3IS9 A;  4FJ7 A;  3E66 A;  1S5J A;  1LW0 A;  4ID1 A;  1Q81 O;  3RVC A;  3E01 A;  1X3N A;  1ESV A;  1VSI A;  4IOX A;  3M1F A;  3A5M C;  4J2A A;  3HSC A;  1WAJ A;  4DU1 A;  4FLW A;  4DS5 A;  3J80 O;  4H8K A;  1BL3 A;  2JWL A;  1VSK A;  4B8A B;  3F73 A;  2GEL A;  3TAQ A;  2ZWH A;  3VTH A;  1NGB A;  3H08 A;  3L0Q A;  3ZYY X;  2ZE2 A;  3J7A P;  2QKK A;  2OPQ A;  3GOI A;  3A2F A;  3RRG A;  2HVI A;  3R8E A;  4J2B A;  4ID5 A;  4FWS A;  5HLF A;  5HBM A;  1KLM A;  4FSV A;  5M1N A;  1T05 A;  4CJ4 A;  1LCU A;  4U7B A;  3AAP A;  1NJX A;  1TKT A;  5AZJ B;  2UXB K;  3D2E A;  1JLQ A;  2BAN A;  4H0V B;  5LMN K;  3V1O A;  1RBT A;  4E7I A;  3BZK A;  1L3S A;  2A40 A;  1U45 A;  1ZBI A;  3FR0 A;  4DFJ A;  4I6M A;  3QML A;  5DM6 L;  1T6D A;  2E6M A;  4CFD A;  2OZM A;  2VGN A;  1RDC A;  3VQ9 A;  2QKB A;  4BVO A;  4FJM A;  3C6A A;  3TAP A;  4HUF A;  2Z1G A;  4Z94 A;  1S1X A;  3ATV A;  4FVU A;  5JVG L;  3S3O A;  3ZSW A;  5CZ2 A;  4H0X B;  4JD2 A;  3V9Z A;  2P9P B;  4CZM A;  4B9L A;  4CZI A;  1VQ4 N;  1NK7 A;  2ASP A;  4IZ9 A;  1CZB A;  4KHY A;  4CJT A;  1TAQ A;  1IBK K;  1ATR A;  5J2Q A;  1A5X A;  4LH4 A;  4OLB A;  1L3T A;  3BZC A;  4FCY A;  3K5O A;  3CMA N;  3QB0 A;  1VSL A;  3QLH A;  1X3M A;  5ADX A;  3SI6 A;  4H5W A;  1RGI A;  4IG3 A;  1RFQ A;  1RCH A;  4RW7 A;  3EZW A;  4CHP A;  2YNI A;  1IV0 A;  3ASM A;  4DU3 A;  1BQM A;  2HOE A;  4ZTJ A;  3LP3 A;  4DV4 K;  3IDH A;  1FK9 A;  3A5O C;  3GL1 A;  3SV3 A;  4H5V A;  2G8V A;  1NLV A;  5AQK A;  4YOR A;  2OYQ A;  4N56 A;  4KH5 A;  5JLH A;  3OYL A;  3KWI A;  2O8B A;  3B6P A;  3U3G A;  2WFB A;  3LDO A;  3EKS A;  4IDK A;  4H03 B;  3GBT A;  3E9O A;  1QTM A;  1QSY A;  4IOA L;  2R7Y A;  3ZET A;  3M8S A;  4E7K A;  1WSJ A;  4RW6 A;  1KLN A;  3MWT A;  4XH4 A;  1W97 L;  2HHV A;  1LAV A;  3DM2 A;  3HPG A;  4ZHR A;  5HP1 A;  1D5A A;  3D2F B;  3V9S A;  4DR3 K;  2WON A;  3HYF A;  1RDD A;  3LAL A;  4CGD A;  2ITG A;  4CGI A;  4J2D A;  1XNQ K;  4LFA K;  1YHQ N;  4BRC A;  2Q97 A;  5GIP A;  1BQN A;  5IWA K;  3VA3 A;  5FPD A;  4AHR A;  4MO4 A;  4AIL C;  3PV8 A;  3EE9 A;  3T1H K;  2PYL A;  2JLE A;  2D0O A;  3AO2 A;  3VEX A;  3OYD A;  1QVG M;  1N6Q A;  4C23 A;  2E2O A;  4RW9 A;  2G8K A;  2VWB A;  4Y0W A;  4BQZ A;  3S3N A;  3WNF A;  3O4W A;  4C8K A;  3AVA A;  1XC3 A;  3HVT A;  4CF8 A;  1HKG A;  3QIO A;  1VQ8 N;  2B4J A;  3MED A;  3WXJ A;  2OZS A;  4K0K K;  4CIF A;  5BN8 A;  3C65 A;  4CF9 A;  3SZ2 A;  1MA9 B;  1RT1 A;  3C6U A;  3O9R A;  2YNG A;  4LFB K;  3HTV A;  4FYD A;  3VGM A;  3M5R A;  4AHV A;  3SQ0 A;  4X65 K;  4KB1 A;  1X9S A;  4DWI A;  4BR2 A;  1QZ6 A;  3VQ5 A;  2FBV A;  3QEV A;  1YUW A;  5LMU K;  2E1Y A;  2UXC K;  4RWT A;  4AM7 A;  3DLL L;  5KGW A;  2WOM A;  3AAQ A;  3THY B;  2IVO A;  2PZS A;  5K14 A;  3L2V A;  4LD0 A;  3CFO A;  4FO0 A;  1SAZ A;  3DWL A;  1C1C A;  3OA9 A;  4CJK A;  1GLB G;  4IO9 L;  3QEP A;  2G8F A;  1BWF O;  2VGM A;  5AQO A;  4BC5 A;  3P38 A;  4E7H A;  4MDA A;  4JI8 K;  5I9E B;  2A42 A;  2QWL A;  1W0H A;  4DTU A;  2WBN A;  4KHP K;  1JXB A;  2W41 A;  1EWQ A;  3KJV A;  3RMD A;  3ENH A;  4FLZ A;  1VQP N;  1JLA A;  1HJR A;  2B6A A;  4CHO A;  2FSN A;  1WUA A;  2FXU A;  3T3F A;  1JLE A;  3JXU A;  4MLH A;  5FPM A;  1QHA A;  2A5X A;  2W40 A;  2HHS A;  2ZGZ A;  1TAU A;  3OBY A;  4CJR A;  4EP4 A;  4FWQ A;  5AQT A;  3L6Q A;  1E4F T;  3VEO A;  3DYA A;  1A5V A;  2P1J A;  2O8D A;  1SUQ A;  1BHL A;  4M3X A;  1G99 A;  4C8N A;  3AVJ A;  4BR4 A;  3CJ1 A;  3SQ4 A;  3MEC A;  3RRH A;  4DG1 A;  3FFK B;  3V9U A;  1VQO N;  4QAG A;  1VSD A;  5GAE P;  2KTQ A;  5AQU A;  3CI5 A;  3DLK A;  3SPY A;  3ZSZ A;  1WN7 A;  4HTL A;  2YHX A;  3MWP A;  4MFB A;  3VEV A;  2HHW A;  3O3G A;  3LDS A;  3CM6 A;  2HVH A;  5CR4 A;  5T7B A;  4HCC A;  3CXC M;  1BO5 O;  1TKD A;  2HF3 A;  3RMC A;  1RTJ A;  1U2V B;  2VWK A;  3TAB A;  4YDU C;  4KHQ A;  1KVC A;  1WSE A;  4CJW A;  3SUN A;  4FK0 A;  2XY7 A;  2P5O A;  1ATN A;  3AA4 A;  4B9Q A;  2NRX A;  1EWR A;  3EL2 A;  2FC0 A;  1QHT A;  4DTX A;  3J7Y P;  3RMA A;  1NK9 A;  2KLA A;  4M3Y A;  5BR9 A;  4FJH A;  1BU6 O;  1HYZ A;  3UIQ A;  3GE1 A;  5AQW A;  3J8A A;  3WEE B;  5TKW A;  4RW4 A;  4BRH A;  1Q18 A;  4GY2 B;  4KAZ A;  1NGG A;  2A41 A;  3CQ8 A;  4CJQ A;  4FXD A;  3E9P A;  3R6M A;  1NGE A;  2GWJ A;  3H3N O;  1HYS A;  5BRH A;  1V4S A;  4M7X A;  3CCQ N;  4JAX A;  3P83 D;  3A5N C;  2IVN A;  3OYN A;  1NGF A;  2YV0 X;  3O80 A;  2VG7 A;  1JKH A;  3VTI A;  1JLB A;  4FOI A;  4FPB A;  3IKM A;  4BG8 A;  5FPN A;  1UOC A;  4E7J A;  4CER A;  3BUZ B;  1FKP A;  3CF5 L;  1YVU A;  4BAC A;  1KQS M;  1Z26 A;  3MCP A;  3IAY A;  2DFF A;  4ISF A;  1X9M A;  4K43 A;  5CZ1 A;  4A57 A;  4DFK A;  1TK5 A;  1HKB A;  3OY9 A;  3K5L A;  5C25 A;  3OYG A;  3CC7 N;  4QS7 A;  3A5L C;  5DMR A;  5AQN A;  3CJC A;  4I9L A;  4M7Y A;  1E3M A;  3I33 A;  3QNO A;  2CGK A;  4JKB A;  4OJR A;  3OYI A;  3ENO A;  3L2U A;  1KTQ A;  4BVP A;  3ZEU A;  4CJS A;  4PKH A;  1RDU A;  4IBN A;  4CCH A;  3KK1 A;  2P9U B;  3LP0 A;  1L5U A;  2DFE A;  3CM5 A;  4ELT A;  2CH5 A;  5AQH A;  2Q2R A;  3L2R A;  1Y64 A;  4CJF A;  5C10 A;  5AQX A;  5AQZ A;  4EAH D;  4BE1 A;  4G9Z A;  4KH4 A;  4X66 K;  3AVI A;  4B9T A;  1GLA G;  3AO4 A;  2NNW A;  4DTS A;  4FK2 A;  3W0L A;  4AM6 A;  3NDK A;  4K41 A;  4DR4 K;  3C7N B;  3PIO L;  3MX2 A;  2ATQ A;  2A1R A;  4B9M A;  2P9I B;  3KVG A;  1EXQ A;  3CJ9 A;  4J2E A;  1WB9 A;  1NMN A;  2E2N A;  3SAH A;  3O9T A;  4B8C A;  2QWM A;  4BR5 A;  4FJJ A;  4DSE A;  3ATU A;  3QDK A;  4YY3 K;  3SQ2 A;  4YHH K;  1KVB A;  1REV A;  1VRU A;  3T69 A;  1S6Q A;  2UXD K;  3RSE B;  1A5W A;  3DOK A;  3VQQ A;  4W5R A;  1RBU A;  4CZF A;  4FWM A;  4IO8 A;  5AQM A;  1N8R O;  2O8E B;  4KRE A;  3NCI A;  4WCE L;  5KPZ A;  1ZC6 A;  1L3V A;  4F3O A;  3DLB A;  3ZX0 A;  2P9S A;  4OO1 J;  3LM2 A;  3PSF A;  3LZJ A;  4EP5 A;  1HX1 A;  4FJX A;  4B3R K;  4AHT A;  3PY8 A;  2FSK A;  3CCL N;  2CGJ A;  2EX3 A;  4N5S A;  4CZG A;  2IIR A;  3G4S N;  4CZJ A;  4CEC A;  4M42 A;  1JLF A;  3M6G A;  3T1Y K;  3P31 A;  1TL3 A;  4E1N A;  4DR5 K;  3AV9 A;  1YIT N;  3QET A;  4JKH A;  3MN6 A;  1W2B M;  4OPH A;  5AQI A;  3SYZ A;  3CJA A;  4FLX A;  1GLC G;  3FE1 A;  4ZTF A;  4DSJ A;  3MX5 A;  4FW1 A;  4HVJ A;  5D3G A;  1OKJ A;  2RHK A;  1LWE A;  1SV5 A;  4OGE A;  4PA1 A;  4JI4 K;  3DRP A;  1BIS A;  5KPT A;  4DS4 A;  4CJV A;  3LL3 A;  2ZJR L;  2XY6 A;  1NGD A;  1KAX A;  3ID8 A;  3IRX A;  3ZSR A;  4EHT A;  4MLE A;  2P9L B;  2VWJ A;  3U3Y A;  5KQ8 A;  4JKG A;  4PQU A;  2ZM6 K;  3CPE A;  1SS6 A;  3JYT A;  3ID6 A;  1QS4 A;  3CCR N;  1EET A;  3ZSX A;  3N4Q A;  3U8X A;  2D0A A;  3THV A;  2GTD A;  1ZBS A;  4H5T A;  1SL1 A;  3NH0 A;  4F2R A;  3AA2 A;  2HST A;  1Q8I A;  4H0T B;  1BI4 A;  1IKV A;  3E1Y A;  1KFD A;  4Y1C A;  3K9J A;  4E1M A;  2QXF A;  3KHY A;  4R79 A;  4DFM A;  5HRO A;  4HWI A;  1KAZ A;  3TTF A;  1QVF M;  2I7N A;  1XMO K;  4DTM A;  1EX4 A;  1NBW A;  2GBZ A;  3DLH A;  3L4I A;  3EKU A;  5GAH P;  4DLE A;  1Q9Y A;  4YOY A;  4IFE A;  2G8W A;  3NGI A;  2E8A A;  3SMS A;  4GNI A;  2LSN A;  1U47 A;  1YJ9 N;  1XI1 A;  4M3U A;  4Z4E A;  4Z0U A;  5BRF A;  3ZSO A;  4FWL A;  3NMU A;  3AA3 A;  3KK7 A;  4CZE A;  3D0P A;  2IGI A;  3D2E B;  1ATS A;  1C0T A;  3THW B;  3AVL A;  2HMI A;  3O9S A;  4FPA A;  3VPZ A;  3I8D A;  3P4I A;  5AQP A;  2KZM A;  1SQK A;  4I7F A;  1WBD A;  4FJ9 A;  3F9K A;  4M45 A;  1SL0 A;  3L2W A;  3VQ6 A;  2A1S A;  4I6M B;  3HOT A;  3KK3 A;  4OKJ A;  4YNQ A;  3O9Q A;  4I2Q A;  3FZM A;  4CF1 A;  3SQ1 A;  2X74 A;  4DV1 K;  1D9D A;  4BR9 A;  4K8Z A;  1SKR A;  3TAG A;  1OH7 A;  5M1F A;  1NU0 A;  5AZJ A;  1BIU A;  3CPW M;  1SL2 A;  3SMP A;  2FSJ A;  5LJW A;  4IWV A;  2KQ2 A;  4GKJ K;  3WNH A;  4JKA A;  3O3F A;  4IFY A;  1KVA A;  2QK9 A;  2KFZ A;  1HQU A;  4JD2 B;  3V9X A;  3MEG A;  4GVE A;  1KSP A;  4AH9 A;  2EHG A;  4JHD A;  1F21 A;  4BRE A;  4CE9 A;  2HW3 A;  3AY9 A;  1QQN A;  4C8L A;  4CJ3 A;  3M8P A;  5J1E A;  4O0I A;  2QA4 N;  2GX9 A;  3NF9 A;  4O8K A;  3MAQ A;  2F8T A;  2YHA A;  2A6A A;  3OTO K;  3SUQ A;  2VYP A;  3F5T A;  4KO0 A;  1HKC A;  4BE2 A;  4A2B A;  5KI6 A;  4HTU A;  1O13 A;  4N76 A;  3CER A;  2P9P A;  1XQS C;  1RT3 A;  3Q7C A;  3VGK A;  3HM9 A;  4Z4I A;  1QQO A;  1E4G T;  3OYM A; 
#chains in the Genus database with same CATH homology
 3OYB A;  1J54 A;  1W0H A;  2Z1H A;  3DLG A;  4DTU A;  3K58 A;  1WSF A;  2BDP A;  4BWJ A;  1NJZ A;  1JXB A;  3LAM A;  1NKC A;  4W5O A;  1DTQ A;  3KJV A;  1TL1 A;  3RMD A;  1CZ9 A;  1NJY A;  3KLH A;  3TAR A;  4FLZ A;  1BI4 B;  3MXM A;  3HL8 A;  4EZ6 A;  4E3S A;  2OPR A;  5J2P A;  5HRP A;  3V9W A;  1JLA A;  1HJR A;  4KV8 A;  3U6F A;  1HNV A;  3ZCM A;  2B6A A;  3P5J A;  4CHO A;  3T3F A;  4JRQ A;  3HK2 A;  3OJS A;  3AO1 A;  1JLE A;  3S9H A;  3RWU A;  1CXU A;  4CEF A;  3G10 A;  2HHS A;  2XO7 A;  3RTV A;  1TAU A;  3EZ5 A;  4CJR A;  4EP4 A;  4XIU A;  3RR8 A;  3VQA A;  1JL1 A;  1WSI A;  1VSE A;  3K2P A;  3AO5 A;  3VQB A;  1VSH A;  1B9F A;  2XY5 A;  2O4G A;  3DYA A;  3OYE A;  3PX0 A;  3VQ7 A;  1A5V A;  1RT7 A;  1YT3 A;  3HP6 A;  4DLG A;  4M3R A;  2P1J A;  2G8U A;  1SUQ A;  3DMJ A;  3AVK A;  1BHL A;  2OA8 A;  1RBR A;  3RR7 A;  3ULD A;  4M3X A;  4C8N A;  4LSL A;  3AVJ A;  3EY1 A;  3SQ4 A;  4KRF A;  4KTW A;  1U04 A;  1LV5 A;  3MEC A;  4CED A;  3RRH A;  3P1G A;  4DG1 A;  3C95 A;  3M8R A;  4NYN A;  4HHT A;  4FM2 A;  3V9U A;  4DSK A;  4DSI A;  4RG8 A;  3SUO A;  3HVR A;  4QAG A;  4K8X A;  4H4M A;  1VSD A;  3KD1 E;  2KTQ A;  3HO1 A;  1HNI A;  3HP9 A;  4CFB A;  3KK2 A;  3QEX A;  4FZY A;  3DLK A;  3LPT A;  1RTD A;  1BGX T;  3RMB A;  3ALY A;  1WN7 A;  3ZSZ A;  3SPY A;  3QEI A;  1NOY A;  3KD5 E;  1U4B A;  3ZT0 A;  4JRP A;  3PX4 A;  4MFB A;  3NF7 A;  3L8B A;  4WE1 A;  3OYF A;  2HHW A;  3O3G A;  4EZ9 A;  1W9H A;  3LDS A;  3CM6 A;  1T8E A;  1J5O A;  3NGZ A;  2HVH A;  4CJ5 A;  1NJW A;  5T7B A;  4FM0 A;  1NK4 A;  4HCC A;  3K5M A;  4CEO A;  3V1R A;  4CK3 A;  4O4G A;  4CEA A;  1ZBH A;  3QER A;  1TKD A;  1FKO A;  3LAN A;  1S1U A;  1ZBU A;  4N47 A;  3RMC A;  1YTU A;  1RTJ A;  2IAJ A;  4MQ3 A;  3PUF A;  3ZT3 A;  4DF8 A;  2KW4 A;  2X78 A;  4CJU A;  1HYV A;  4AHU A;  2VWK A;  3VQC A;  3TAB A;  4KHQ A;  1KVC A;  2Z1I A;  5FRO A;  4C8M A;  1WSE A;  2G8H A;  4CJW A;  3SUN A;  1RBV A;  4FK0 A;  2XY7 A;  4IFV A;  2P5O A;  3AA4 A;  4UQG A;  1X9W A;  1RDA A;  3NBP A;  4DSL A;  3MEE A;  4DQQ A;  3ZSV A;  4B08 A;  5I3U A;  1HQE A;  2FC0 A;  1TKX A;  1QHT A;  2GV9 A;  4DTX A;  4ELU A;  3D45 A;  3LZI A;  3RMA A;  1WNS A;  3AVG A;  2HND A;  1NK9 A;  3NAE A;  3PO4 A;  2HHU A;  2BE2 A;  4M3Y A;  4DQS A;  1B92 A;  4FJH A;  3UIQ A;  1HYZ A;  3C6T A;  4OLA A;  4E0D A;  1IO2 A;  4RW8 A;  2G8I A;  4BDZ A;  4RW4 A;  4CIG A;  2E6L A;  3OJU A;  4OPK A;  1U49 A;  5E41 A;  2KZZ A;  4M3T A;  3KLF A;  4KAZ A;  1NK0 A;  4B9U A;  3AVB A;  2RF2 A;  3CQ8 A;  4CJQ A;  1TV6 A;  4Z4F A;  4FXD A;  3LPU A;  4FZZ A;  4Y1D A;  3LP1 A;  4F2S A;  4BDP A;  4FJL A;  2KFN A;  3AO3 A;  4CGG A;  4KHW A;  1Z25 A;  3IG1 A;  1X1P A;  1ZBF A;  3DLE A;  1LW2 A;  4C8O A;  4CF2 A;  1HYS A;  4FW2 A;  1JLG A;  3QIN A;  4W5T A;  3K5N A;  1RBS A;  3P83 D;  3PX6 A;  3SPZ A;  3L2Q A;  4FJ5 A;  2O4I A;  1VSM A;  4FJN A;  3AVH A;  3OYN A;  1TVR A;  1U48 A;  3NF6 A;  1JL2 A;  1J53 A;  2YV0 X;  4CEQ A;  4DTR A;  2P5G A;  4I9Q A;  4KPY A;  2VG7 A;  4KHU A;  1JKH A;  2FBX A;  1JLB A;  4F3T A;  3FFI A;  4KHN A;  2HNY A;  5KRS A;  1UOC A;  4E7J A;  4CER A;  2HNZ A;  4DU4 A;  4NCB A;  3V6D A;  4CGF A;  1QE1 A;  2DY4 A;  1FKP A;  4IG0 A;  4DF4 A;  4H4O A;  1YVU A;  2X6S A;  1RT2 A;  4BAC A;  5DK5 A;  3TI0 A;  1RNH A;  4FJG A;  3BGR A;  1Z26 A;  3ZT1 A;  3TAN A;  1GOA A;  2Q3S A;  1RTI A;  4O0J A;  2DFF A;  4I2P A;  3IAY A;  2F8S A;  1X9M A;  2IC3 A;  3SNN A;  5CZ1 A;  5EU7 A;  1IKW A;  1G15 A;  3G0Z A;  3WNE A;  4W5N A;  4DTJ A;  4DFK A;  3DOL A;  4DQP A;  1KCF A;  1TK5 A;  4DFP A;  1C6V A;  3VQ8 A;  3OY9 A;  4KTQ A;  4CEZ A;  3NF8 A;  1EP4 A;  3K5L A;  1ITG A;  2IDO A;  2XY8 A;  1ASU A;  2F96 A;  1RT6 A;  3T1A A;  4CJL A;  5C25 A;  3OYG A;  2ZQB A;  3HXM A;  4DQR A;  3S3M A;  4L8R B;  1RIL A;  1VSJ A;  3QEV A;  3TR8 A;  4B9V A;  4CJE A;  3KLG A;  1DLO A;  4KB0 A;  1N5Y A;  5DMR A;  1XWL A;  5CYQ A;  4I9L A;  3SCX A;  2DTU A;  3QNO A;  1D8Y A;  3DRR A;  3TAM A;  4M3W A;  2YNH A;  4NYF A;  4OJR A;  3OYI A;  4LSN A;  1WSG A;  4Z4H A;  4GVM A;  2RN2 A;  4E89 A;  1RT5 A;  3L2U A;  1KTQ A;  4CJS A;  5J2M A;  2HB5 A;  4GMJ B;  2VG5 A;  4IBN A;  4CCH A;  3KK1 A;  4CHZ A;  3LP0 A;  1SKW A;  1L5U A;  1MU2 A;  2DFE A;  3CM5 A;  1JLC A;  4ELT A;  3IS9 A;  4FJI A;  3OS2 A;  3OYC A;  4FJ7 A;  3L2R A;  1B9D A;  1S5J A;  4CJF A;  1Q9X A;  4W5Q A;  4FJK A;  5SZT A;  4BE1 A;  1K6Y A;  1LW0 A;  1UWB A;  3HPH A;  3AVI A;  4ID1 A;  2D5R A;  4B9T A;  2ETJ A;  3AO4 A;  4DTS A;  4IKF A;  1C1A A;  2HHX A;  4FK2 A;  3E01 A;  3BDP A;  4B3O A;  3LP2 A;  1WAF A;  1DTT A;  3NDK A;  1VSI A;  3O4Q A;  4J2A A;  3VN5 A;  1BCM A;  1LWC A;  4E7L A;  2ATQ A;  1WAJ A;  4DU1 A;  2A1R A;  4FLW A;  2XRI A;  4DS5 A;  4B9M A;  4FK4 A;  4H8K A;  1BL3 A;  3ISN C;  4OPJ A;  4DMN A;  1EXQ A;  2E4L A;  5C42 A;  1VSK A;  2P51 A;  4J2E A;  2HHT A;  4B8A B;  3F73 A;  1BIZ A;  3TAQ A;  3H08 A;  2ZE2 A;  2QKK A;  2OPQ A;  4B8C A;  3A2F A;  3RRG A;  2HVI A;  4J2B A;  3T19 A;  4FJJ A;  4ID5 A;  4JLH A;  3TWH A;  1KFS A;  3KTQ A;  4DSE A;  1S9G A;  3DLR A;  3NH2 A;  5HBM A;  5HLF A;  2JGU A;  3SQ2 A;  1KLM A;  3OS1 A;  1KVB A;  1REV A;  2RKI A;  1VRU A;  1T05 A;  4LH5 A;  3TAF A;  2IOC A;  3M8Q A;  4CJ4 A;  1S6Q A;  2IS3 A;  1NJX A;  3ZSQ A;  1TKT A;  3TAE A;  3SJJ A;  1T7P A;  4CHN A;  1A5W A;  3DOK A;  3VQQ A;  4W5R A;  1RBU A;  1JLQ A;  5HRS A;  2BAN A;  4TSX A;  3V1O A;  1RBT A;  4KRE A;  4E7I A;  3NCI A;  1L3S A;  1U45 A;  1UAX A;  3HJF A;  1I39 A;  1L3V A;  1ASV A;  4F3O A;  3DLB A;  1LWF A;  3AA5 X;  1ZBI A;  1JXE A;  2HHQ A;  1UA0 A;  4DFJ A;  2DFH A;  3LZJ A;  1S1T A;  4FZX C;  1TKZ A;  2E6M A;  4EP5 A;  4CFD A;  2OZM A;  4FJX A;  4AHT A;  1BCO A;  3PY8 A;  1Y97 A;  4O5B A;  1RDC A;  1QQC A;  4CGJ A;  3OS0 A;  3VQ9 A;  2QKB A;  2EX3 A;  3CYM A;  3AVN A;  1RT4 A;  4N5S A;  4FJM A;  1CLQ A;  3TAP A;  1C1B A;  3DRS A;  4G1Q A;  4HCB A;  1FXX A;  4CEC A;  4HUF A;  2Z1G A;  3ITH A;  4M42 A;  1EKE A;  1S1X A;  1JLF A;  1TGO A;  3LWL A;  1UA1 A;  1TL3 A;  3S3O A;  3C94 A;  5CZ2 A;  3ZSW A;  4E1N A;  1D9F A;  4OKK A;  2Y1I A;  2GUI A;  3V9Z A;  1LAW A;  3AV9 A;  3V1Q A;  4B9L A;  1S9E A;  2D0B A;  3QET A;  3I0R A;  1NK7 A;  3CFR A;  3CFP A;  1CZB A;  4FLT A;  3SYZ A;  4KHY A;  4CJT A;  1TAQ A;  1XHZ A;  4FLX A;  2VG6 A;  2X6N A;  4O44 A;  4ZTF A;  4DSJ A;  5J2Q A;  4FW1 A;  4HVJ A;  4CIE A;  5D3G A;  1A5X A;  4LH4 A;  4N41 A;  1GOB A;  4KHS A;  4OLB A;  1L3T A;  1LWE A;  4FCY A;  1SV5 A;  3K5O A;  4FVM A;  1QSL A;  4OGE A;  4PA1 A;  3DRP A;  1VSL A;  2YHB A;  1BIS A;  3QLH A;  4DS4 A;  4JS4 A;  4CJV A;  2XY6 A;  3SI6 A;  1KRP A;  4OVL A;  1VRT A;  3IRX A;  4IG3 A;  3ZSR A;  1QSS A;  4KI4 A;  2Z1J A;  1RCH A;  4RW7 A;  4CHP A;  2YNI A;  3ASM A;  3B6O A;  4HUE A;  1BQM A;  2VWJ A;  4DU3 A;  3U3Y A;  4Q0B A;  1S1V A;  4NCA A;  1CXQ A;  4PQU A;  3AVC A;  4OGC A;  1O1W A;  3AVM A;  4KFB A;  3VQP A;  4ZTJ A;  3JYT A;  1TK8 A;  3LP3 A;  2YNF A;  1QS4 A;  4F8R A;  1FK9 A;  1EET A;  3ZSX A;  3ZT2 A;  5CYM A;  3SV3 A;  3THV A;  2D0A A;  1T03 A;  2G8V A;  1ZYQ A;  1XC9 A;  4FLV A;  5JS2 A;  3QIP A;  1SL1 A;  4N56 A;  2OYQ A;  3NFA A;  3NH0 A;  4F2R A;  1HRH A;  2YKN A;  3AA2 A;  3OYL A;  3V81 A;  1Q8I A;  4BE0 A;  1NK8 A;  4CK1 A;  4Z4C A;  3B6P A;  3U3G A;  2ZD1 A;  1ASW A;  1BI4 A;  1IKV A;  4AHS A;  1KFD A;  2NUB A;  4Y1C A;  3VQE A;  4E1M A;  2Y1J A;  4M3Z A;  4E19 A;  1TK0 A;  2QXF A;  4IDK A;  3WNG A;  1QTM A;  2W42 A;  3K59 A;  4DFM A;  5I42 A;  5JS1 A;  5HRO A;  3OYJ A;  3PO5 A;  1C0M A;  1QSY A;  4F4K A;  2R7Y A;  4QCL A;  4FJ8 A;  5KRT A;  2B5J A;  3M8S A;  4JS5 A;  4E7K A;  3QO9 A;  1WSJ A;  4RW6 A;  4ICL A;  3HPO A;  1KLN A;  5KTQ A;  3V4I A;  4DTM A;  1EX4 A;  3ZT4 A;  1LAV A;  3QEW A;  2GBZ A;  2HHV A;  3DM2 A;  3HPG A;  3KIO A;  4ZHR A;  5HP1 A;  1D5A A;  1NKE A;  3DLH A;  4OKE A;  1NK6 A;  1WSH A;  3V9S A;  4DLE A;  1Q9Y A;  2WON A;  3HYF A;  3DI6 A;  1NKB A;  2G8W A;  3NGI A;  1RDD A;  4CHY A;  3LAL A;  4BDY A;  4CGD A;  1IH7 A;  2ITG A;  3HST B;  4CGI A;  4J2D A;  1GOC A;  4PY5 A;  2LSN A;  1WLJ A;  1U47 A;  5FRN A;  4CJP A;  4B9S A;  3NE6 A;  3SV4 A;  1XI1 A;  3L3U A;  3OYH A;  4M3U A;  4Z4E A;  1BQN A;  4Z0U A;  4BWM A;  3ZSO A;  3VA3 A;  4DTN A;  4CEB A;  4PWD A;  4KI6 A;  4KKO A;  5FDL A;  3AA3 A;  4Z4G A;  4DSF A;  1IKY A;  4AHR A;  5SWM A;  4YFU A;  4AIL C;  1RDB A;  1S1W A;  3PV8 A;  2FBY A;  2IGI A;  2YKM A;  5CY4 A;  3OYK A;  3D0P A;  1C0T A;  2PYL A;  4CEE A;  3AVL A;  4DQI A;  2JLE A;  3AO2 A;  2HMI A;  3OYD A;  4QOZ B;  3I8D A;  4DTO A;  1N6Q A;  3KLI A;  3MXI A;  2KZM A;  5KGX A;  4RW9 A;  3NH1 A;  4I7F A;  4FJ9 A;  3F9K A;  2G8K A;  4M45 A;  4CES A;  3L2W A;  2XHB A;  1SL0 A;  5FRM A;  3VQ6 A;  2A1S A;  4FLY A;  3S3N A;  3KKR A;  3WNF A;  2PYJ A;  4C8K A;  3NHG A;  3QNN A;  3AVA A;  3KK3 A;  3HVT A;  4OKJ A;  4FLU A;  4YNQ A;  4CF8 A;  3QIO A;  3NGY A;  1SKS A;  2B4J A;  3MED A;  1YTA A;  4I2Q A;  4CFA A;  2OZS A;  3SQ1 A;  4CF1 A;  1XHX A;  2X74 A;  3VQD A;  1VSF A;  4CF0 A;  1D9D A;  4CIF A;  3L3V A;  3AVF A;  3I0S A;  4K8Z A;  2OPP A;  1SKR A;  4HUG A;  3TAG A;  3LWM A;  4LY7 A;  1BIU A;  3CG7 A;  3EYZ A;  1SL2 A;  1NK5 A;  4CF9 A;  3SZ2 A;  1NOZ A;  1RT1 A;  2KQ2 A;  3C6U A;  1J9A A;  2PY5 A;  2D0C A;  3WNH A;  3O3F A;  2YNG A;  4IFY A;  3O3H A;  1KVA A;  2QK9 A;  2KFZ A;  1S6P A;  1HQU A;  4FM1 A;  4PUO A;  4AHV A;  1R0A A;  1ZBL A;  4FYD A;  3MXJ A;  3V9X A;  3MEG A;  3SQ0 A;  1KSP A;  4KB1 A;  4AH9 A;  2EHG A;  4Q5V A;  1F21 A;  1X9S A;  3VQ4 A;  4CE9 A;  4DWI A;  2HW3 A;  3VA0 A;  1C0U A;  4GW6 A;  3JSM A;  4C8L A;  3OVN A;  2FBV A;  3VQ5 A;  3M8P A;  4CJ3 A;  4CK2 A;  5J1E A;  1HPZ A;  4KTZ A;  4O0I A;  5J2N A;  3NF9 A;  3MAQ A;  2F8T A;  2YHA A;  1RTH A;  4CGH A;  5HRN A;  3SUQ A;  5KGW A;  2WOM A;  3O4N A;  3KLE A;  1I3A A;  4KO0 A;  4R5P A;  4O55 A;  4NCG A;  3SUP A;  3K57 A;  2PZS A;  5K14 A;  3LAK A;  4CFC A;  4AHC A;  3L2V A;  4B9N A;  4LD0 A;  4CHQ A;  2RPI A;  4ELV A;  3CFO A;  4BE2 A;  3ZSY A;  5KI6 A;  1IG9 A;  4HTU A;  3OYA A;  1IKX A;  2I5J A;  1C1C A;  4N76 A;  1VK0 A;  5HRR A;  4CJK A;  2BGG A;  3QEP A;  2G8F A;  3QES A;  2AJQ A;  3HT3 A;  1RT3 A;  2FBT A;  5C24 A;  2OPS A;  4E7H A;  3HM9 A;  4DTP A;  4Z4I A;  4M41 A;  1HMV A;  1L3U A;  3OYM A;  3KKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...