3ITHA

Crystal structure of the hiv-1 reverse transcriptase bound to a 6-vinylpyrimidine inhibitor
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
556
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, hydrolase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Crystal Structure of HIV-1 Reverse Transcriptase Bound to a Non-Nucleoside Inhibitor with a Novel Mechanism of Action
pubmed doi rcsb
source organism Human immunodeficiency virus
total genus 136
structure length 556
sequence length 556
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3ithA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ithA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ithA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ithA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ithA05
3AVCA 3HPOA 2AGOA 1JKHA 2B5JB 1TL1B 1ZBLA 5EWFA 1FKPB 3BQ1A 5L9XA 3G10A 1C0TA 1T7PA 1BL3A 3V6JA 3L2QA 5KFYA 3K5MA 2ZD1A 3QGIA 3SV4A 1DTTB 2VG6B 4RW9B 4G3IA 4W5QA 1SL2A 4ZPDA 2C28A 5F8JA 2F96A 4CHQA 1J53A 3CJ5A 4E3SA 4ID1A 4O0JA 4F50A 3KIOA 4BE1A 1MU2A 2BGGA 4IFYA 5L1JA 1CSJA 2PYLA 4H54A 4ED7A 1IKWB 1JLBA 1Q9XA 5J1EB 5DMRA 5KGWA 3JSMA 4Y3CA 1KCFA 4CEBA 2DFEA 4KHRA 5KI6A 2EC0A 2HWHA 1BCMA 1RT6B 3VQ5A 2HMIA 1TAQA 2V9WA 1KRPA 4KFBA 4RU9A 3O4NA 4CK3A 1KVBA 3CM6A 1WNSA 1A5XA 3SQ4A 4MFBB 3I0SB 3OYLA 4J2EA 1RYSA 4ED0A 3QEWA 1LWFA 3Q8PB 3RMAA 1LWCB 2ZKUA 4QW8A 5DQIA 3ISND 4B9LA 4R8UA 4FJ5A 5KG7A 3PR4A 1F21A 4I7FB 3LPTA 3PJXA 3HXMA 3AVLA 2QXFA 4C8NA 4IQXA 3KNAA 4DTJA 1RT2A 5KFRA 3M9NB 1T3NA 4EBDA 1J54A 3N6NA 4E7JA 4CJRA 1S5JA 1N48A 3AVMA 1D5AA 3OSPA 2B6AA 4Q0BA 3OYDA 1NKCA 4F4WA 2HNYB 4IR9A 2YNIA 1SV5B 1LW0A 3LP2A 4RUCA 5F9LA 1IKXA 5KFQA 5HBMB 4NRTA 1HYZA 3DLGA 3IS9A 2E9TA 4X2BA 3OVNA 3DRSB 1JXBA 3PUFA 2Z1JA 3NH1A 4DTOA 2HNZA 4NLYA 3M8QB 1JLGA 2JGUA 3MR2A 3DOKA 4DSLA 1VRUA 3MXJA 3BR9A 2XGQA 2IAJA 3BJYA 2FLLA 2LSNA 1W0HA 5DG9A 3D28A 4ECTA 1RNHA 2A1SA 5KRSA 1RT7B 1XHZA 2UUTA 4J9PA 3KJVA 2G8IA 1T03B 3SJJA 2E4LA 1C0UB 5EUHA 1GX5A 4JRPA 4QAGA 1ZBIA 4PWDB 4JS5A 4CIFA 1CXUA 3SV3A 1VSJA 1GX6A 3B6OA 4E7HA 4ELTA 3V1RA 3AVFA 2Y1IA 3AA2A 1U48A 3U3YA 4NLUA 4E1NA 1CLQA 5DQGA 4M3YA 4H4MB 3V6KA 1QE1B 4K4TA 1RAJA 2BRLA 1FK9A 2YHBA 4XO0A 4AH9A 4B9UA 1TKZB 4I2PA 1NK5A 2D3UA 4J2AA 3DRRA 4ECSA 4HCBA 4ZPCA 1HNVB 3QLHB 2R2TA 3N6LA 4IG0B 3G86A 4Y34A 3LDSA 3BSAA 4CJSA 4DU3A 1JX4A 3OYCA 3L2VA 2OZMA 4DF4A 3OYFA 3RR7A 3T5LA 1EX4A 1Q8IA 4FYDA 3MECB 3IGNA 3D45A 1L3VA 3CJ0A 3QIOA 5C25B 2R8JA 4K4SA 3VN5A 2WHOA 4B3OA 4ZVEA 5D3GA 1C1CB 4QPXA 4M3TA 3OYIA 2BDPA 1NK0A 3PR5B 3VQEA 4O0IA 3SUPA 3QETA 4DFKA 1SH3A 4MK8A 2D0CA 1LW2A 4WXWA 1XR5A 4DEZA 3ZT4A 1JLFA 4DTSA 2VG7A 5F9NA 3ZSVA 3DDKA 3EY1A 5DGBA 2G8KA 3AA5X 1ASVA 1S6QB 4DU1A 1I39A 5C24A 1QHTA 1C1BB 1QQCA 1HPZA 1S10A 1QSSA 1D8YA 1RT3B 1TVRA 1NKBA 2JEFA 3GIIA 3LALA 4DTRA 3LZJA 2AX1A 4OL8A 4DL6A 4MK9A 4ZP8A 4E1MA 1EETA 4CHYA 1VSIA 4EYHB 1RT4B 2RF2A 5HRRA 1TKXA 3H08A 4N41A 3A2FA 4PY5A 3CJ2A 4N5SA 2QKBA 3QZ8A 3UIQA 2Z1HA 3PW7A 3OL9A 2W9CA 2X6NA 4O4RA 3DLKB 5KFSA 2VG5B 4NCBA 1RTDB 5KFWA 4DTPA 1D0EA 4N47A 2XGPA 2Z1IA 2OYQA 1C0MA 2WB4A 2IM1A 3DLBA 4BDYA 4CJLA 1YVUA 3T5JA 3FFIB 3BQ2A 5F8HA 4Y1CA 2HNDB 3DI6A 4ECQA 1RT1A 4ED6A 2FVPA 3VQCA 1S9EB 1HYSB 3L3VA 3MEGA 3F9KA 3KKRA 3ZT0A 3V1QA 2D41A 3T5KA 2YNHA 5KG5A 1S1WA 1WAFA 4ZTJA 4ICLB 1N5YA 2E6LA 2VA2A 2GIRA 2WTFA 1WSHA 3CDEA 5C5JA 2ITGA 3MEEB 2ASDA 3PJWA 2YNGA 5I42A 4OGEA 1I6JA 5KRTA 4O3OA 4K50A 3NKYA 4F3OA 3V9XA 4DWIA 4CFCA 4J9OA 3SYZA 4NLXA 2A1RA 3KK1B 2FVSA 1K1QA 1WSGA 2ETJA 4FM2A 3QO9B 2XI3A 1S4FA 2ASJA 1YVFA 4M94A 3MF5A 1DTTA 3L2RA 2OA8A 3WNHA 3S3MA 1RTIA 4CF9A 1JXEA 4O3QA 4CJVA 1IKWA 1RBRA 5SWMA 3HPGA 3LP1B 1RBVA 2DFFA 2QE5A 2ZE2B 4J9RA 2OPSA 1JXLA 2FLPA 1JLAB 1Z25A 4U7CA 2ATQA 1HRHA 5KFJA 1BIZA 2GIQA 3DMJA 3MTKA 4CGHA 5HROB 3P83D 1TKTB 4CJ3A 3KLGB 1TV6B 3V6DB 3RRHA 2BANB 3TAMB 3I0SA 2RKIB 1FKOA 4WYLA 3NCIA 2XCPA 4DL7A 2YV0X 4RG8A 1IM4A 3ZSXA 4ECRA 3K57A 2UVVA 2GBZA 4NYFA 1LWCA 3MAQA 4L8RB 3KLHA 2P5OA 4ID5B 4HCCA 3CO9A 3LWLA 4RW8B 3C95A 1WNEA 4I7FA 4DSEA 1SKSA 4LH4A 4FJMA 4IDKA 5F8NA 5FROA 3DOLB 1RT5B 5C42B 3NGYA 2R2SA 1SH2A 4CJFA 4RUAA 3ZT2A 2IA6A 4FZXC 4G1QB 3PY8A 4FJLA 1N56A 3G6XA 1WN7A 2HNYA 1RDRA 2BE2B 1SV5A 1SUQB 4CFBA 4IG3A 2E6MA 5KFZA 3KK3A 3AO2A 4DG1B 4ECVA 4DQPA 2X78A 2R8HA 3AO1A 3OYHA 4DLEA 3M8QA 4WFYA 1T05B 4EZ9A 3G0ZA 3K2PA 4AILC 2XWYA 5I3UB 4NCGB 2DPJA 4DQIA 3I0RB 3PZPA 3ZT1A 4NLPA 3QIDA 4U6PA 4AHVA 1HNIB 3CIZA 1L5UA 4KHSA 1IO2A 2XY5A 1UWBB 1RT7A 1RTHB 4YR2A 1JIHA 2XY8A 1SKRA 2D0BA 3ZSYA 2IBKA 3QEXA 1D9DA 1C0UA 1VSMA 2FVCA 4KSEB 4PWDA 4BACA 4JRQA 3SQ1A 2IGIA 4ZMMA 5SZTA 1S6PB 4F8RA 4H4OB 2W7PA 3NFAA 1HJRA 2W9BB 2IC3B 4H4MA 1CZBA 4IRCA 3RTVA 3V4IB 4K4WA 3HVRA 4B8CA 1REVB 3SUNA 4J9KA 4B9VA 4JUZA 1HNVA 3U6FA 4OPJA 3QLHA 3HP9A 4K4UA 4URSA 4FK0A 2OPQB 2F8EX 2XHBA 3CFRA 4E0DA 3K58A 3WNFA 3NGZA 4IG0A 4KTQA 1W9HA 2DFHA 1NKEA 2ZQBA 5KTQA 2WCXA 3HVTB 1QUVA 3SUQA 3MECA 1U45A 4URQU 3DRPA 3NGDA 4N56A 1L3SA 5C25A 4KO0B 4NRUA 3KK2B 1QSLA 1DTQB 3L2WA 3NHGA 4FJHA 3M8SA 1C1CA 2GV9A 2YHAA 5J2MB 3NDKA 2AGPA 4KHWA 2IM0A 3NH2A 2EX3A 1ASWA 1ZBFA 2JC1A 4Q5VA 4FJ8A 1S1UB 1UOCA 3MFHA 3LANA 3V9UA 2W8LA 4KI6A 2WONB 3Q8SB 3PO5A 4YP3A 5KFOA 4ECWA 4Q8EA 1YTAA 4DL2A 3EZUA 1C1BA 2X6SA 1RA6A 3UPFA 3IN5A 5KG3A 1BI4A 4FLTA 2HVHA 1YTUA 1KFDA 4O44B 3ITHA 5KT6A 4DL3A 4KHNA 2P1JA 3AO4A 3PX6A 2HHUA 3QIPB 1RT4A 3T1AA 5CYMB 1J5OB 1T94A 3OJUA 4DS4A 3I5AA 2FBTA 2JLEA 3AVJA 2AQ4A 1Z26A 3CVKA 4BE2A 4RW4B 3VQ8A 1NK6A 4GW6A 3DLKA 4CF2A 1JLQB 4MH8A 5F8LA 4WE1B 3V81B 4FZZA 1RTDA 4R5PB 5KFVA 4B9TA 1IKYB 3QNOA 4EYIB 1HMVB 3OHAA 3T3FA 1RDDA 1L3TA 5CYQB 5KFBA 1ZBHA 4DSJA 5J2PB 1UA0A 3LPUA 1X9WA 1N6QB 4FJNA 4I2QA 3JYTA 4WYWA 3GIMA 4QCLA 5FDLB 3RR8A 1HYVA 2KW4A 4CJPA 5CZ1A 4XPEA 4Y2CA 5L1KA 1HYSA 2D7SA 2P5GA 4JV1A 4ZHRB 2IJNA 3RAQA 4CECA 1VSHA 3TAGA 4CGFA 1KLNA 2Q3SA 3NBPA 2R8IA 4ICLA 4CJKA 4TY8B 2FJVA 3OS0A 3MEDB 3RB4A 2I5JB 4O4GA 2C2RA 3KMQA 4J9LA 4DTNA 4M42A 1N4LA 3QINA 3E01A 3LAKA 1A5VA 2OPRB 2BQUA 1ASUA 4EP5A 3M9MB 3RWUA 3S9HA 4AHTA 3QO9A 3EPGA 5KFUA 2J6SA 1RYRA 5KFCA 3LAMA 4NLDA 4O3PA 3L3UA 4IR1A 3IAYA 1R0AB 4CGGA 4Y1DA 1RBTA 4NLRA 3KTQA 4J9SA 1KLMB 1GOBA 1U04A 2D5RA 2R2UA 5KT7A 2ZE2A 4IBNA 4M45A 4TQRA 5T14A 4ED1A 5JS2A 4CGJA 1JLAA 2O5DA 2O4IA 4Q43A 3QYYA 4CJTA 2Y1JA 3HKWA 3SCXA 4Q8FA 3TR8A 2CJQA 3SPZA 3AVNA 4ECXA 3WNGA 3AVKA 1TKTA 2JEGA 2OH2A 4LSLB 1TV6A 4ZP9A 3VA3A 2BANA 3TAMA 3C6TA 4WZMA 4M41A 5KFPA 3AVAA 4W5RA 5L1LA 1DLOA 3SUOA 4J9MA 4IRKA 4FLZA 1S48A 3PVXA 3AVGA 4QWEA 2R2RA 5JS1A 3HHKA 2YNFB 4CFAA 4CHZA 3CFPA 1S49A 4M3RA 4Y2AA 4ID5A 3K5NA 3VQSA 1BQMB 4FW2A 5EU7A 4RW8A 3VQ4A 4LY7A 4FCYA 2W8KA 1Q9YA 1NJYA 4IRDA 3HYFA 4DTMA 4ED3A 5C42A 5CZ2A 1WAJA 3PX0A 3SQ2A 2XY7A 4CEAA 3KOAA 1RTJB 3GV5B 4RW7B 3I5CA 4W5TA 3ZSRA 2X74A 2AGQA 4Z4HA 2OZSA 1I3AA 1BGXT 2PYJA 2V4QA 2RDIA 4CJ4A 3CDWA 3NAIA 3BGRA 4KV8B 1LWEB 3BSOA 4DG1A 4KTWA 1TK8A 4OKJA 4MKAA 3NAEA 1B9DA 3KD5E 4DMNA 1T05A 4QWDA 1S0NA 3H5XA 3LP3A 5I3UA 4NCGA 4CEEA 4CERA 3I0RA 1S1TB 1RCHA 3S3OA 4E7LA 3CG7A 4FS2A 3RMDA 1LWFB 4TXSA 1RBSA 3M8RA 1J9AA 3CJ4A 1HNIA 1SKWA 4KRFA 1UWBA 3GIJA 2HVIA 5KG2A 3N6MA 3G6YA 4TQSA 4K8XA 3TANA 3TWHA 3LP0A 3QEVA 4MQ3A 1RA7A 4RNMA 2GC8A 1S6PA 4H4OA 3VQ7A 5L1IA 1A5WA 1FXXA 4K8ZA 4B08A 2AJQA 3DLEA 3KLFB 2W9BA 3TAEA 2IC3A 3ZCMA 4CF8A 2PY5A 3V4IA 4J9NA 2HHQA 1REVA 4Q0BB 2UVRA 4O55A 3OYBA 5DG8A 4IH5A 3S3NA 3TARA 1LW0B 3LP2B 3UR0A 1IKXB 5KT2A 1WSFA 3THVA 2AU0A 2OPQA 5DGAA 4JV2A 1U09A 2KTQA 2B5JA 4NLGA 4FJ7A 1TL1A 3K59A 4CE9A 3C94A 1FKPA 4K4YA 3ASMA 1EP4B 4AHRA 3AA4A 3KKSA 4B9MA 4ZP7A 2BR0A 5F8GA 2IJFA 3HVTA 3RBDA 3RMBA 4DSKA 3L2UA 2VG6A 4RW9A 2UVWA 3PV8A 1U47A 4GC7A 4HVJA 1JLEB 2W9AA 4O3NA 4QWAA 2OPPB 1XI1A 4LSNB 2XO7A 3EPIA 2W42A 2HHTA 1NK7A 3TVKA 5J1EA 4QWBA 1TGOA 5HLFB 5J2QB 4IKFA 4CF0A 4E89A 5DK5A 2RPIA 3AVHA 1S1UA 5HP1B 2R8KA 1RT6A 4PUOB 1NJWA 4Q45A 4NCAA 3NMAA 4E7IA 2YKNB 4QW9A 1BQNB 2B4JA 4I2PB 4HUGA 3HJFA 3DRRB 3KHHA 4IFVB 3ZSQA 5DQHA 1YT3A 2R7YA 4CJWA 4MFBA 2C2EA 3CQ8A 3ICLA 4K4VA 4ZPBA 5KFKA 4J2BA 4HYKA 1TP7A 4CCHA 1KHWA 4PQUB 4AHUA 1KVCA 3OYGA 3C6UB 4EZ6A 4N76A 4F4ZA 5KT3A 1X1PA 3QIPA 3V6HA 2Z1GA 2HW3A 2JEIA 1D9FA 4F2SA 1ZTWA 3OYAA 2XRIA 3PO4A 3H4BA 1NJZA 5DLGA 1D1UA 3SZ2A 3H2LA 4IOBA 4CESA 4EP4A 1NJXA 4RW4A 3M8PB 4LD0A 1U4BA 2YKMB 3V81A 3VQQA 4KB1A 4R5PA 1IKYA 1HMVA 4FK4A 4FS1A 4TY9A 3DLHA 3VQDA 5CYQA 5K14B 3SI8A 4TYBA 4JS4A 5J2PA 4FLYA 1L3UA 1JLFB 3SI6A 2VG7B 1N6QA 2IOCA 4NYNA 3OHBA 1SH0A 5HBMA 5KFIA 2HHSA 3OLBA 4GC6A 3DRSA 3QEIA 4CJQA 2O4GA 1B9FA 4ZHRA 4H8KA 1XR7A 2UVUA 3KHRA 3H4DA 3PW2A 4TY8A 1NOZA 3VQ6A 3IG1B 1LV5A 3ZSZA 4B9SA 1S9GB 5HRPA 2I5JA 4EBCA 3MR5A 3PW5A 1RDCA 1B92A 1GOCA 2OPRA 2RF2B 3ISNC 4ZVGA 3CWJA 2JC0A 1T03A 3DLRA 3BSNA 3BDPA 2FVRA 1EXQA 1KVAA 1X9SA 5JUMA 1QS4A 3EYZA 5KFLA 4ZVFA 4HUEA 4E19A 4EO8A 2ILZA 4F4KA 2IMWP 1R0AA 4FK2A 4DSIA 5F8MA 1CXQA 1QE1A 4KHYA 4C8MA 1TKZA 5KFDA 3KMSA 4DQRA 3CFOA 2D0AA 1Y97A 4OKKA 4LH5A 5J2NB 2KQ2A 4DQSA 3DI6B 3H59A 3P1GA 1RT1B 3QGGA 3OYMA 3P5JA 4XPCA 3M9OB 4K4XA 4LSLA 3V9SA 1X9MA 3PW0A 1C6VA 2ASLA 3DYAB 3NAHA 5DLFA 2JEJA 4KB7A 1NK4A 5I42B 2WOMB 4CGDA 3FDSA 3CM5A 4MKBA 3AO5A 3G6VA 2WRMA 3NL0A 3VQ9A 1XC9A 4CK1A 2DTUA 2KZMA 2YNFA 4PA1A 4FJXA 1WLJA 3I5BA 4OJRA 1BCOA 4IKAA 1BQMA 4B8AB 4RW6B 3GQCA 2PZSA 3OLAA 4BWMA 3RRGA 4OPKA 3OYNA 3O3HA 4KB0A 3MXMA 4F3TA 1KFSA 4WFZA 1S1XB 4M3XA 4FM0A 1RTIB 1KHVA 3KLEB 1QSYA 3WNEA 1TL3B 1RTJA 4NLWA 1S6QA 4O3RA 2V0NA 2FLNA 1QAIA 3GV8B 4RW7A 1JLCB 2AX0A 4GMJB 1HQEB 3TI0A 2OPSB 4FJGA 1VSEA 1U49A 4KTZA 4DU4A 2FVQA 4ED2A 4F4YA 1RT3A 3HM9A 3H40A 4K4ZA 4FZYA 1NNDA 4CEQA 4FJKA 4KV8A 1LWEA 3DMJB 4Z4EA 4FLWA 4DL5A 2QV6A 4FBUA 2RDJA 5F8IA 4ZP6A 3MFIA 3DM2B 4NLOA 4NZ0A 2DPIA 3I8DA 3D0PA 4TLRA 5KG6A 2HB5A 4TYAA 1FKOB 3OYEA 2W7OA 2HHXA 4LQ3A 2ATLA 1S1TA 1CZ9A 4J2DA 1XWLA 4URGA 1ZETA 4R0EA 3KLHB 2VG5A 2NUBA 4ELVA 1VK0A 2I1RA 3Q8RB 3RB3A 1WSIA 5KFTA 2FBXA 4RNNA 3OL8A 2F8TA 4AHSA 4KE5A 1JL1A 3ZT3A 2ALZA 3HSTB 3H5SA 2CKWA 3AVBA 1VRTB 3FFIA 3KHLA 4MIBA 4IDKB 4DL4A 4HHTA 3O3FA 2E9ZA 4ECUA 2BQRA 4YFUA 3V9ZA 3BSCA 4FJJA 1TKDA 4NYZA 5KT4A 4KAZA 5KT5A 1IH7A 4KREA 5KGXA 2HNDA 4CFDA 3KLFA 4YR3A 1S1VB 4O3SA 1BHLA 4KHQA 4KBIA 3AA3A 4CK2A 1S9EA 5KFMA 4Z4CA 3GILA 4M3WA 1WSEA 3OY9A 1HQUB 5KFFA 4CIEA 1NOYA 3MEEA 1S0OA 4IG3B 1VSDA 3NF7A 4Z0UA 4C8LA 3KK3B 4FW1A 4JLHA 3RMCA 4Z4GA 2KZZA 3KK1A 4NLVA 4Z4IA 5E41A 1EP4A 3ULDA 2VA3A 1SL1A 1IKVB 2ILYA 5FRMA 3IRXB 3UQSA 5KFGA 3HP6A 2GUIA 4KKOB 1UAXA 1VSKA 4OLAA 3HPHA 2J6UA 4DFMA 1JLEA 3FSIA 3GV7B 2XCAA 4YR0A 2OPPA 2VWJA 4DFPA 4LSNA 1UA1A 3LP1A 2KFZA 5HLFA 5J2QA 3Q8QB 1KTQA 2FC0A 3SNNA 5HP1A 3O3GA 2IM3A 3KLIB 3D5MA 4PUOA 4BDPA 3NF8A 4B9NA 4ZTFA 3SFGA 1S97A 5HROA 2YKNA 2AWZA 3GYNA 1BQNA 1NK9A 3KLGA 4IFVA 3SFUA 3V6DA 5HRSA 3RB6A 3AV9A 1VSFA 2RKIA 1VSLA 4M95A 4RZRA 3OS2A 4CGIA 3NE6A 4PQUA 3T19A 1ZYQA 4I9LA 4DQQA 3QNNA 1JKHB 1ZTTA 3C6UA 1S0MA 3VQBA 4ECYA 3RAXA 4FLUA 4W5OA 3SQ0A 1C0TB 3CDUA 1TK0A 4FLVA 2G8HA 2C22A 2B43A 1C2PA 1TQLA 3DRPB 2ZD1B 4ECZA 5KFHA 4ELUA 4YMEA 2UUWA 3DOLA 3QGHA 3KLVA 1RT5A 3M8PA 1MU2B 5KFEA 4IFYB 4CHPA 4RNFA 2YKMA 3PW4A 3O4QA 1JLBB 3H5UA 2KFNA 5CY4A 4G1QA 1ITGA 1IG9A 3JSMB 1NK8A 4CEDA 4FXDA 5K14A 4DFJA 4CJUA 5KFNA 2J6TA 4GVMA 2BE2A 2HWIA 3QESA 1SUQA 1S9FA 5EWGA 3MXIA 4CJ5A 4F2RA 5EWEA 2HMIB 4WXOA 4KFBB 4BDZA 1EKEA 1K6YA 3TAFA 2E9RX 1TAUA 4E7KA 3AO3A 1C1AA 4OLBA 3MR3A 1BI4B 4BWJA 2G8VA 5T7BA 3IG1A 1LAVA 3ITHB 3PHEA 3FQLA 2XY6A 1S9GA 3K5OA 4FBTA 4CF1A 4QWCA 4DLGA 4KPYA 3OJSA 1RILA 4R8UB 4HKQA 1RTHA 4ED8A 3TQ1A 4KHUA 1LAWA 4DSFA 3HO1A 4TN2A 4WZQA 5EDWA 5DG7A 4QOZB 2R8GA 3VA0A 3K5LA 1RT2B 4EBEA 2FJWA 3FRZA 3OS1A 2IS3A 2V4RA 1BIUA 3LZIA 1NHUA 1RBUA 4IH6A 2B6AB 4I2QB 3JYTB 2YNIB 1JL2A 3DLGB 3IS9B 5J2NA 1RDAA 3PX4A 1QTMA 1G15A 2HNZB 3KD1E 4YQWA 3CYMA 1JLGB 2HHWA 4W5NA 3DOKB 4CJEA 1VRUB 3B6PA 5KFXA 3NBPB 3V9WA 4KHMA 3HK2A 2IAJB 3DYAA 4Q44A 2WOMA 4M3UA 3NF6A 1O1WA 4O4GB 4TSXA 4KO0A 2BRKA 3RBEA 3KK2A 4XIUA 3E01B 1DTQA 4I9QA 4HTUA 3KJVB 3HVAA 3QERA 5J2MA 2FBYA 2IM2A 1GOAA 3OL7A 4RW6A 3U3GA 3TAPA 4WFXA 4KI4A 2XI2A 4LQ9A 3V1OA 1S1XA 4DS5A 4ZVHA 3IGVA 2WONA 3KLEA 5FRNA 1HARA 2WK4A 1TL3A 2FJXA 1FK9B 4ZPAA 4UQGA 3BREA 3GIKA 1JLCA 4F4XA 1HQEA 3SPYA 1BISA 2VWKA 4O44A 4OVLA 1RDBA 4IH7A 3DM2A 4NLSA 1WSJA 3FQKA 3HT3A 1QAJA 1MMLA 3OYKA 4O5BA 5CYMA 1J5OA 1SL0A 3C6TB 4KAIA 3RB0A 3LWMA 4C8KA 5JXSA 1DLOB 4CEZA 3F73A 4CEOA 1ZBUA 4Z4FA 4B3OB 3E51A 4CHNA 3NH0A 5D3GB 3QZ7A 3TABA 1JLQA 2DY4A 3MR6A 4WE1A 4EEYA 3HVWA 4HUFA 3HL8A 2RN2A 1LW2B 3KHGA 3ZSWA 1VRTA 3T5HA 5KFAA 1OS5A 3NF9A 4OKEA 5FDLA 4RNHA 3TAQA 2EHGA 4BE0A 1S1VA 3BQ0A 3CJ3A 5C24B 2G8UA 4DTUA 1HPZB 4FJ9A 2G8FA 5KG1A 3VQPA 1TK5A 4CHOA 1HQUA 3OL6A 1TVRB 4EO6A 1KSPA 1T8EA 3BGRB 4NLTA 3MEDA 4DF8A 4MIAA 2D3ZA 2XC9A 4AHCA 5HRNA 1EETB 4RNOA 4YNQA 4MK7A 1NHVA 4FM1A 1TKXB 2G8WA 1IKVA 3IRXA 1K1SA 2F8SA 3L8BA 4KKOA 3VQAA 2W9CB 5KG0A 4FJIA 2QK9A 3AVIA 2HAIA 3UDLA 4J9QA 3H5YA 2IDOA 2HHVA 1KLMA 3LP0B 3H98A 4CIGA 3ZSOA 2QKKA 4M3ZA 4C8OA 2C2DA 3ALYA 3OYJA 3DLEB 4OGCA 3KLIA 3OSNA 3MEGB 1W25A 2P51A 4FLXA 3QEPA 2BQ3A 2YNHB 1XR6A 4FVMA 4DTXA 1XHXA 4NLQA 5KG4A 1S1WB 3NGIA 1N5YB 4JV0A 2FBVA 4CEFA 2YNGB 3EZ5A 1Z4UA
chains in the Genus database with same CATH superfamily
3HPOA 2DHSA 5AZIB 1TL1B 3CHWA 3ULEA 3FFKB 1GTHA 4JYAF 4RU2A 4O8UA 1C0TA 1T7PA 2I7NA 2YWWA 4A8KA 3SCKE 4R25A 1HA1A 4WTYA 1TUUA 3S8SA 4ZPDA 2F96A 2HRUA 1NCLA 1REGX 3KIOA 2CVIA 5L1JA 3R5GA 2DR7A 1Q9XA 5AJ3F 2RHKA 4NOHA 1YHQN 5J1EB 1PO6A 1ZAXA 3JSMA 1HLUA 5KGWA 4CEBA 2D0OA 4KJIA 5M1QA 5KI6A 1WF0A 1WDTA 2FUG9 2NXNA 4QZVB 2HMIA 2V9WA 1XNQF 4KFBA 5AQTA 3O4NA 3ENVA 2C42A 3I55N 3PXGa 3I0SB 2OANA 3OYLA 9RUBA 4FWRA 2UXDJ 2DT9A 2E8AA 2J9DE 4IO9Q 4KR0B 7AT1B 2JJ4D 3G82B 1RI7A 3C66A 3RMAA 4BR5A 4A2AA 4B9LA 4R8UA 4FJ5A 2ASYA 3OTCA 1XEZA 4L3KA 2AA4A 1RACB 1HWKA 3A13A 2QXFA 3T6BA 5A8KB 4IQXA 3CJKA 4EU0A 3J81O 5KFRA 2BE9B 1NXIA 2V34A 4O0NA 3RG6A 1J54A 2J4RA 5IT9U 1H72C 1FXRA 1LK5A 3OSPA 2B6AA 1FX4A 1NKCA 5HAOA 3D0GE 4V19X 5HBMB 3T9ZA 1HYZA 3E1YA 4YOYA 3IS9A 4O5FA 4ETZA 4X2BA 1PC5A 3PUFA 1OY9A 2Z1JA 3NH1A 2CQBA 2AYBA 1MROB 4PXEA 4BRHA 4ILJA 3IA0A 1JLGA 3O08A 4DSLA 3B54A 4NA3A 3G87A 2IHR1 2XGQA 3RW6A 3THXB 5FPMA 4DR2F 1M5KC 3GJRB 3RGIA 3A3NB 4DPTA 1RNHA 1XHZA 1OQ3A 4YEAA 4FF2A 2X3DA 4J9PA 5IXUA 2QWRA 5EUHA 1GX5A 4PWDB 3NRBA 1HIYA 3MDQA 4JI2F 4CZFA 2I2YA 1HHQA 1VSJA 3D1QA 2KXNB 1GX6A 3V1RA 1U48A 1CLQA 2D1KA 5BRHA 1RAJA 4JI7J 3TSPA 2YHBA 4XO0A 4HVZA 2P9LA 4ZPCA 1BXNA 1KQSM 3W5ZA 4DV4K 1X60A 1Q86T 3D54A 1KEKA 1AXQA 4V19J 1E3MA 3TVZA 3BSAA 2YWGA 5E84A 3OXGA 2DITA 2PAVA 5B0CA 3R1HA 3TZXA 1HKCA 3RR7A 3T5LA 1Q8BA 1Q8IA 3JXOA 3D45A 2OTLN 4ISGA 1YWXA 1F9EB 4RWTA 4K4SA 1I94J 3VN5A 2WHOA 3V4MA 4B3OA 4ZVEA 2NCKL 2RE1A 2NREA 3GR1A 1HNXK 4QPXA 4M3TA 3ENBA 1NK0A 1DAXA 3QETA 1SJRA 3GJSB 3MD1A 1LW2A 4WXWA 1XR5A 1JLFA 3EJMA 5EVZA 3UW1A 5F9NA 1UEKA 5LM7E 4BRGA 4DQ8A 3DDKA 2G8KA 3NMRA 1CS4B 1AT1B 4OMFG 1K73O 2OCEA 4DU1A 1S6QB 3SAHA 1MMNA 3CCUS 5IWAK 2DR9A 1VQ6S 3BH6B 1HPZA 3VVUA 3J81U 2B4VA 1U6FA 5JVGQ 2ZHAA 1UVMA 1NKBA 5AQYA 1RHRB 2BV3A 4DTRA 1Q7LB 1B0PA 4MK9A 4HHHA 3W2VB 3OUYB 3CCMS 1UTAA 3CTRA 2OHDA 3N4PA 2RF2A 4RL1A 2ITMA 4N41A 2PIIA 3C7NB 1KQFB 1UW4A 3NGKA 1VQNS 2D9OA 3QZ8A 2PFFB 3UI3A 1FI4A 2XZDB 3QBCA 5ADXH 3DLKB 2Z2YB 2VZ9A 1F3VA 2YVSA 2VG5B 4NCBA 4H0VB 2C2NA 5KFWA 2NUUG 1D0EA 1DURA 1D8ZA 2CH6A 4JD2A 3N0VA 1YVUA 3T5JA 3BQ2A 4QS9A 4Q2MA 3HHLD 5AE2A 2DK2A 2IRYA 1IG8A 2HNDB 2OELA 4ECQA 2J0SD 1WORA 3TZZA 4ED6A 2FVPA 1HYSB 3W8PA 5ETQA 3ZT0A 3V1QA 2QI2A 2D41A 3T5KA 3EE3A 1IR1A 5D15A 1WAFA 1N5YA 2ZWHA 4ZTJA 3CDEA 4DV1F 5C5JA 2ITGA 3MEEB 2ASDA 1VQYA 2YNGA 2WBNA 4F3OA 2BA9A 2UXCF 2GQQA 4WCEL 1H38A 2G2ZA 4NLXA 2A1RA 3P4UB 2LEPA 3MM8A 3KWIA 3J7AN 1S4FA 1X5OA 2JWKA 2A42A 2QG9B 1NGEA 3ZZ0A 3CCEN 4M94A 3MF5A 2CJYB 3EGVA 2OA8A 2F5GA 4LJMA 3WNHA 1GTEA 1JXEA 1P8GA 4O3QA 4CJVA 4WIQA 5F1XA 3ZETA 1RBRA 4LVNP 5SWMA 4NMXA 2IIHA 1RBVA 2ZE2B 5KOXA 4J9RA 4KGMA 3VALA 2PFDA 5M1NA 4HHUA 3D3CJ 2GJFA 2ATQA 4C0HA 5HN0A 2GA7A 2KLAA 5KFJA 3OFGA 2L9WA 4X64K 3Q7CA 5D0EA 4U96A 3MAAB 2MPUA 2XLKA 1S12A 3EGZA 5A76A 4NI2A 2RKIB 1FKOA 4IXCA 1VBKA 1QVFM 2IDEA 2ZGYA 2YV0X 1IM4A 2RH3A 4ECRA 3R8YA 2VBYA 1LWCA 1KNZA 3CO9A 1OYDA 5T7LA 3DDNA 1HKGA 4KGZB 3O80A 4OYIA 4DSEA 1SKSA 2QLWA 1VR6A 5ETLA 2GFFA 5FROA 3VF4A 4E2FB 3EXCX 4Y65A 2R2SA 1SH2A 4IYQA 3ZT2A 2IA6A 4BR0A 2QM1A 2Q6BA 5CHCB 2P6TA 2HIQA 4DR6K 4ZN3A 1N56A 3HULA 1SAZA 4CYUA 1T6DA 1RDRA 4K0KJ 4F3MA 1SV5A 1SUQB 4MLHA 4IG3A 4TKTA 2E6MA 1U1KA 5DM7Q 2HZCA 3AHPA 3OYHA 1N33K 3M8QA 3Q83A 1FFGB 2L08A 4OYMA 3K2PA 5I3UB 1XMOK 4DQIA 4LREA 3FBCA 4NLPA 2BW7A 5BRDA 4U6PA 1HNIB 1L5UA 1UWBB 2P9KB 1JIHA 3AAPA 3Q2SC 1T6CA 2D0BA 2IBKA 3QEXA 1C0UA 2MZJA 1XTZA 1RAOA 4AFFA 4BACA 4UOCA 1RB0A 2IGIA 4ZK7M 4H5RA 2VB6A 1HJRA 2W9BB 2BABA 4ZVPB 2AEJA 3T1YK 3HVRA 2UUAJ 1R6VA 4JUZA 3U6FA 4GV9A 4K4UA 4FK0A 2R9LA 3R5CA 4LF6F 3LW5C 3ZZZA 2XHBA 2X51A 2OIHA 3CFRA 2RUGA 5G4DA 3A5MC 2NRVA 2E1ZA 4WPAA 4CH1A 4MKVA 2UXDF 5FPEA 3AD7C 2UYTA 1VAZA 2WCXA 1QUVA 4F9OA 3SUQA 1L3SA 3MM6B 4NRUA 3ZEUB 2GS8A 2NSCA 3NDKA 3F5TA 2IM0A 2BYCA 1NBEB 2ZDPA 4ERDA 1ASWA 1ZM2A 3TWZA 2A2DA 4O23A 3EX7B 1LCUA 4KI6A 3MWTA 5KOWA 4YP3A 2EC2A 5HQMA 3J7ZO 3DRXA 4B3TJ 3LM9A 1H98A 1HL6A 3KG1A 4O8KA 2X6SA 4QS7A 3OVAA 4GKJJ 1EJ7L 1YTUA 4O44B 5DDPC 1EIYB 4DJBA 5KT6A 2ABYA 4UOGA 4DL3A 3MM9A 2W4CA 4TVAB 1WHYA 4KHNA 3G71S 4JI3J 1AZSA 1T02A 4CI6A 2V8DA 3WQUA 1SXLA 4D3GA 2DO4A 2HHUA 4BCAA 1RT4A 3MK6A 3PIOL 1T94A 4DV7F 3I5AA 4JI1F 2FBTA 4NO7A 2C3PA 1VQ8N 2DHXA 2JLEA 2ZOGA 1O6XA 3ID6A 3CVKA 4HTIA 3UN2A 1NK6A 4BE2A 3H46O 4CF2A 5A2QO 3J7A1 1S72S 1RTDA 4R5PB 2XEXA 2NQPA 1HMVB 5CYJA 3SXLA 4ES2A 4NA2A 2LU2A 4PG6A 4A8SA 2RQMA 2WVBA 2D0PA 2NRRA 2YQ3A 4IEEA 1TU0B 2HHPA 4FXVA 2CUYA 3RR8A 1AROP 2ZOFA 1HYVA 1FFWB 2D7SA 4LFCJ 4CBWA 4X66K 4ZHRB 2UUBJ 3RAQA 3CJ9A 4X4UA 1Y5IB 3ZX3A 2QLJB 1VSHA 1KLNA 5AQZA 1NGHA 1X9JA 4TY8B 2FJVA 3I9V9 1SB6A 4P74A 4YN3B 3CPWM 3UDCA 4QYZJ 4O4GA 4QR0A 1J27A 2VOOA 3QATA 3QINA 6AT1B 3GONA 4DZDA 3HZ6A 1A5VA 5F3TA 2IDLA 1ASUA 3AB2B 2FF6A 3S9HA 3EPGA 2RD5C 3CJSA 4AE5A 3L3UA 2W6KA 1BA1A 2GVZB 1TZ0A 2YHWA 4Y1DA 1RBTA 1V4SA 2JX2A 4TU8A 2CZ4A 2B0GA 4NLRA 1ILYA 2MYFA 1FRMA 1N36J 5KT7A 3HM8A 4IBNA 5CD4H 5T14A 4ED1A 2QL9B 5JS2A 4CO5A 4LBHA 3MN7A 4L6V3 3QYYA 3HKWA 4USUA 2CJQA 3FRYA 2JEGA 1FD2A 1FWKA 4LSLB 3HT0A 3TA1A 3TR5A 2FDNA 4H0TB 3TAMA 1MWQA 5KFPA 4GV6A 4K2XA 3WC2A 3L95X 2YKOA 5L1LA 5CZXA 1DLOA 4J9MA 1S48A 3PVXA 2R2RA 2YNFB 2NPIA 3WQPA 1KVKA 4CHZA 3CFPA 3CCQN 3CC7N 5B8HA 2UXBF 3O6QA 1PJ7A 1U2VA 4OYOA 1NJYA 1DRZA 3VGSA 4CW7B 4DTMA 4ED3A 2EFGA 2W40A 1NSAA 2ZWOA 2NYHA 5C42A 2N7CA 3M30A 5HSPA 4ZJQA 1VQKS 3KOAA 1VRQC 1NRKA 2CA9A 3PKMA 2CPYA 2D1CA 3I5CA 1EQ0A 2AGQA 5FLXY 2OZSA 3I82A 2EFOA 5A2QU 4DV3J 1BGXT 3BO2A 1Z2ZA 3NAIA 4KV8B 3LQVA 2DH8A 2YTCA 4KTWA 4ZJLA 3TA0A 3KD5E 3UVJA 3O9UA 1R3NA 4USHA 2GQCA 3H5XA 2VD3A 2IA0A 2CQCA 4E7LA 3RMDA 5HJYA 5C0YA 3CJ4A 1M5OC 2VHGA 3TO8A 2HQGA 4KRFA 3H6EA 2D3O1 3MZIA 1U8SA 4WTOB 5KG2A 4K8XA 1FRHA 3GLJA 1VK3A 2KDOA 3ENOA 3LP0A 4JI6J 2VKZG 3PNIA 4ILRA 1S6PA 1FE0A 1RHMB 3OHRA 1A5WA 2E88A 2VBXA 2DHHA 1HX1A 2CPZA 3RU0A 4J9NA 4L76A 1REVA 4MO4A 1DQ8A 4O55A 1XIQA 2HBJA 3CSKA 3VEWA 3UR0A 5KT2A 2ASMA 1F0XA 4JI7K 4C4WA 4P2FA 4JV2A 1U09A 3PDNA 3IKMA 2KTQA 4NYOA 3O9QA 3H0PA 3C94A 1FKPA 4EIAA 2LKZA 4U8VA 1M5VC 1F5AA 2LXUA 3GYGA 2HS3A 4N7TA 3ZNUA 3HVTA 3RMBA 4DSKA 5HMXA 5FPDA 4DUTA 2UVWA 1U47A 4GC7A 2W9AA 1F60B 1UFKA 2XM3A 2I0XA 4LSNB 1Y00A 2N3OA 2XO7A 2HHTA 1I94K 3TVKA 3IP0A 3UO0A 2VPZB 5HLFB 3T9NA 5H1SQ 4BG8A 5DK5A 1S6OA 2Y1RI 1SBRA 2R8KA 1FCAA 2CWKA 2AEFA 4EMDA 3VV2B 2IVMA 2UP1A 4PUOB 4X4SA 5C10A 3GU0A 1E4GT 5IS2A 4YB5A 5BPMA 1WI6A 3CCLN 4OHWA 1C0GA 1BQNB 3K9KA 5LSOA 2PI4A 2R7YA 2C2EA 4YOXA 3BGUA 4OYZA 4ZCMA 4CCHA 4PQUB 1ZPVA 4FYYB 3MCAB 4CLWA 3U9DA 4AHUA 4A4JA 3UN5A 4N76A 1GMWD 1AB8A 4FWPA 1KWMA 3QIPA 2RMLA 2DISA 3AOCA 3SAFA 2Z1GA 2HGMA 4ZCLA 2JEIA 3O44A 3H4BA 5DLGA 1APSA 3SZ2A 4DR3F 4RW4A 1YRUA 1HNWF 2QEXN 1U4BA 3RBXA 2AYGA 3VQQA 4FS1A 4DV0J 4PYAA 2M4MA 3VEZA 1J6ZA 5J2PA 7FD1A 1JLFB 1N6QA 2IOCA 4NYNA 3OHBA 1VQ4S 1SH0A 2MQQA 2W4DA 4ER8A 3W1YC 1U6ZA 2ZVIA 1IJEB 4CJQA 2MKJA 1TL5A 4C1NK 2A2CA 1XR7A 1F1BB 1H6KX 4J91A 4X62J 4JI5F 3PW2A 3U7JA 3VZHA 2LQ5A 2ZBIA 1IR2A 1ULRA 3MR5A 2HQFA 3G9CA 2OPRA 2CJ9A 2RF2B 1KTVA 3ISNC 2DGXA 4ZVGA 5IFMA 5JICA 3QJLA 3DLRA 2FVRA 1EXQA 3KJNB 3X3UA 2C2ZB 2MZRA 2XMTA 3DHWC 5KFLA 2JHEA 2VU5A 4EO8A 4F4KA 5IQ6A 1R0AA 4FWQA 2Y1LB 5GADP 3EL2A 5F8MA 3C14A 4KHPJ 3H25A 1QE1A 3R6LB 3OBYA 2NZ4A 5KPRA 2A3JA 4K5SA 3ZZYA 3BKFA 1F2GA 1R59O 4IO9L 1NZAA 4J9UE 3CFOA 4CLUA 4LF5F 5DETA 1VBZA 1V6HA 3A5LC 5GINA 4LH5A 3H59A 3P1GA 4EHTA 3T6JA 3MOJB 1NM2A 4G9ZA 2O8DB 4ZS6A 4XPCA 4K4XA 3VGTA 3EWGA 1RAEB 3BY5A 1X9MA 3LDPA 1NBWA 1NK4A 5JLHA 2J76E 3CM5A 4MKBA 5HQLA 1WG4A 2W1BA 1O8BA 2QYGA 2KZMA 1RCOB 4PA1A 2EBEA 4FJXA 1K73T 3QRQA 3MM8B 1J5EJ 4RW6B 2NRTA 4F3TA 1KFSA 3KLEB 2EKNA 3Q7BA 3K0SA 1X3NA 1TL3B 3D2EA 1QD1A 1RTJA 4NLWA 2XSJB 2FLNA 4RW7A 1JLCB 4GMJB 3HD1A 3I8BA 5M1FA 4UZBA 3NMUA 3TI0A 4FJGA 2LECA 3CQXA 2XWXA 4DU4A 4ED2A 1Y5NB 3K89A 3MWPA 4FJKA 1LWEA 4B3SF 4DL5A 2QV6A 3MFIA 2RDJA 3NGTA 4NLOA 4NZ0A 1C4AA 2WTUA 4K0KK 2ZWPA 2LLZA 3RVCA 4NI2B 1FKOB 2CJAA 3GP9A 1FKAF 2LDIA 1CZ9A 5CE3A 1YJNN 3FZ2A 4CO4A 1XWLA 2KYXA 5AZJB 3S7RA 1ZETA 4R0EA 2VQEF 2NUBA 1VK0A 2I1RA 4KH6A 3DXMB 2CXEA 2FBXA 2KXFA 5IT0A 4USJC 3FFIA 3WZ0A 1T11A 4ECUA 4YFUA 2VPXB 2R4FA 2A0FB 1TKDA 1RDWX 1PJ5A 3ZZPA 5KGXA 2Q36A 2Z30B 4O3SA 1U1OA 1KQGB 1BHLA 4KBIA 4CK2A 3M1VB 4Z4CA 3ISZA 3U8XA 4BC5A 4CYUB 4FOEA 1HQUB 4OHZA 5KFFA 4IG3B 2UUAK 2F4VJ 3M2RA 4Z4GA 3KK1A 2YJEA 4BRPA 4Z4IA 5E41A 1EP4A 3ULDA 4B1XB 4NZ6A 1IKVB 2J5AA 4YY3F 3R2CJ 5GAEI 3LDQA 4KKOB 1UAXA 3RRKA 2R7UA 5K8OA 1NDLA 4CRJA 3HPHA 1S5ZA 5ADZA 3OR1A 5GIOA 1TL4A 1VS3A 3A1YG 2XCAA 2DNHA 5LT5A 2GO8A 3E66A 2OPPA 1N32F 5EGYA 1FRIA 1UA1A 3LP1A 3BBFA 4ILGB 5FPNA 5B08A 1RE1B 2IIRA 5J2QA 2B9XA 2FC0A 1ZXOA 5HP1A 3O3GA 3A8YA 4BDPA 3KLIB 1ZH5A 2XQCA 3M05A 4GVEA 1S97A 3KJQB 2YKNA 4N8NA 1QLNA 2GGPA 4IFVA 1K8KA 5DM6Q 4DHVA 3SFUA 2CNKB 5HRSA 2QSFA 4EGLA 1VSFA 2MKSA 4B3TK 2FJBB 4CGIA 1ZM3A 4DCHA 2QFIA 1ZYQA 2GCFA 2OTLS 4CLSA 4H03B 3O6WA 4GKJK 2FHMA 2P9CA 4QYRA 1AFJA 3W5XA 5ETTA 4DUZJ 4BY9C 3A8JA 2UUCJ 4H5NA 2XLIA 4CT8A 3FUYA 1TK0A 2IYGA 3FLCO 4DUYJ 4JI3K 1GXTA 2ZD1B 4ECZA 4PKGA 1OSDA 4ELUA 1WC3A 2Q6CA 1CBKA 3M8PA 4CHPA 2V52B 3PW4A 2XULA 3GG1A 2GZOA 1HI8A 4IEIA 1UWAA 1IG9A 1YXQA 2H65B 3FZKA 4FXDA 2XYHB 1H73A 5K14A 3VTIA 5KFNA 1HR0F 2BE2A 3U9ZA 1E6VA 4JV5J 3MXIA 4ZVUB 3D7SB 3R7NB 4BDZA 1EKEA 1VQMS 2E9RX 1TAUA 2FHJA 4E7KA 1C1AA 4OLBA 4X84A 2M8HA 2L41A 3E9LA 4LFCK 5ITHA 1LAVA 1LFWA 2UUBK 4BC7A 3O5BA 2VFVA 3R1XA 2XY6A 4C7QA 4G1IA 3WDOA 4QWCA 1AZSB 3OJSA 1RILA 4LF2A 4HKQA 1RTHA 1CG2A 4QYZK 1JCEA 2ZZMA 3VQTA 1T9XA 5GAGI 4GVBB 3HO1A 4HR2A 4QOZB 1WKLA 3Q8UA 2ZC3A 1RT2B 2CDRB 3P5BP 2OEKA 1V3ZA 1NHUA 1RBUA 3UFCX 4IH6A 3W62A 3NOCA 5A0YB 2YNIB 2D3OR 5HVHA 3CCTA 3NGSA 2QA4N 1N36K 2O8EB 2XMJA 2ZH8A 1QTMA 3W7BA 2C1EB 2GELA 2HNZB 3KD1E 4YQWA 2HHWA 3ENAA 3CYMA 5LXRA 2BH1A 1VGYA 3CCRN 3CPEA 3B6PA 1SIWB 3KG0A 1UJ5A 3QJPA 2IAJB 4WKRA 4BC3A 4PG5A 1FT8A 4Q44A 4NA1A 3H45C 3R3LA 3A3PB 4M3UA 1U8WA 1U1LA 1QVFR 4O4GB 1RAFB 2EVZA 1HD1A 4KO0A 1DTQA 1CJTA 2YWEA 2QXLA 3J7ZT 2JOQA 3ONQA 1OQ6A 3EXYA 1HWLA 1ZS6A 4WFXA 4A62A 2Q2RA 5DM7L 4RO0A 4LQ9A 4ZVHA 2WK4A 3WXLA 1P9QC 4ZPAA 1K8AO 3GIKA 5IT9Y 1HQEA 4N8OA 3SPYA 4KC5A 1BISA 2F7TA 3DLLL 2VWKA 4WU2A 4OJGA 4YOUA 1D3WA 5D8HB 3AJ1A 3FCHA 3QB0A 4NLSA 3T7ZA 4DV3K 4X4PA 1QAJA 4K5RA 1SL0A 2ZNZA 3LWMA 1FX2A 1M90O 3PYEA 1DLOB 3LPYA 3ID8A 2GAGC 4Z4FA 2ZBPA 3E51A 2ZH2A 3O9SA 1JNZB 2E1RA 2KT5A 1JNRB 3P38A 3G96A 1RABB 3HL8A 1U2VB 2QTWA 3EVMA 3J7YI 3QPIA 1HWIA 3H1QA 2F7VA 3BO4A 2F4FA 5FDLA 4RNHA 4YB6A 1XNRJ 1MSWD 4OI6A 2EHGA 4JI6K 4BE0A 1X7VA 3PSIA 4E98A 5H9EK 2HVZA 4FJ9A 2DY1A 2QT7A 2LEBA 2QLFB 4DKWA 3Q23A 2D3ZA 4CTAB 4AHCA 1SJ4P 3N4WA 3R27A 4FZVA 2BBEA 4YNQA 4IOCL 1SQGA 4WK3A 4A8XA 3D9BA 1Y3KA 2FSKA 5C2DA 2K3IA 3HKZD 2Z58B 2D74B 4Z37A 1K1SA 3L8BA 5FIIA 1M5HA 2YH1A 2ZH9A 3AVIA 3PFOA 1F2HA 5GAHP 4A8OA 4FWLA 1VQ9S 1T9VA 2HPUA 2R7TA 1PIEA 2IDOA 1KLMA 3CT9A 3LP0B 4NX9A 2E5LF 3MCSA 4B1YB 5GVQA 2FIUA 2C2DA 1DKGD 2YWKA 1RWMB 1X0FA 5ETSA 3ILOA 3UCUP 2H48B 2EW9A 1OSCA 4FLXA 2DR8A 3NWGA 2RHQB 1C4CA 5KG4A 2HG4A 2PA3A 5C7PA 2BM1A 2Z56B 2Y3YA 3FKBA 5E3AA 3K8WA 1NU0A 2LA6A 3EZ5A 3WC0A 3R5JB 3AVCA 3FMWA 5IM0A 3POTA 3VAJA 4AL5A 1W7AA 3EN9A 3UE2A 2OAUA 3MOZA 1FKPB 3BDEA 5L9XA 2Z4PA 2E5IA 5BR8J 4ZVQB 2LP4A 3L2QA 5KFYA 2ZVSA 4A5AA 3EZWA 3QGIA 3SV4A 1DTTB 3QWPA 3TJ8A 4G3IA 1RFQA 4JKDA 4W5QA 1LXNA 5F8JA 3AGRA 1J53A 3CJ5A 3M6VA 4YOVA 1MU2A 4IFYA 2Q31A 2JSXA 1UETA 2EFQA 1JLBA 3NGUA 1UZHA 2HBZB 5BPNA 1OPIA 3NS5A 4DR7J 4GKKF 2QWOA 4BRCA 1N0VC 2EC0A 2HWHA 2J9DA 5LL6d 3VQ5A 4DV0K 1G3OA 3ZZOA 4C0OC 2RILA 4RU9A 4CK3A 2HBKA 1KVBA 3CM6A 1X4HA 2PDAA 1IVZA 1A5XA 1Q82O 3N5BA 2CPDA 3SMPA 1VQ8S 1RYSA 2RAQA 1GXLA 1M5SA 4MIWA 3QRRA 5AQLA 4ED0A 3CPWR 3FCVA 4X62K 3N5FA 4M5DA 2ZKUA 2CQ0A 3PR4A 2J0WA 4NEYA 4DCOB 3H90A 5M1OA 4C8NA 1MG7A 5A8RB 3KNAA 4DTJA 4U8YA 4E1JA 3ZZUA 4P6QA 2E66A 4EBDA 4E7JA 4CJRA 4ANDA 1N48A 1S5JA 3AVMA 5I3QA 1IQZA 1D5AA 4DV2F 5A6WA 5L46A 1IBKJ 4IR9A 4KHPK 5KFQA 1SIZA 1JXBA 2RVJA 2ZJRQ 3CJ1A 4NLYA 2FGCA 1YIJS 2JGUA 3DOKA 2WAQD 1URRA 2LSNA 3FJ2A 4BRIA 2ZUAA 1I5OB 3T1HF 3K8VA 2A1SA 1RT7B 2UUTA 2E5HA 2Q3PA 3ZFVA 2E4LA 4AYBD 4JRPA 4RX6A 1ZOTA 1X3MA 4JS5A 3SV3A 1N5SA 1VMBA 3K7RA 1EZZB 4E7HA 1J5EK 2CADA 4CJ7A 3AA2A 2FXUA 5HATA 4E1NA 3C14B 5DQGA 3TSUA 3V6KA 1KD1O 1QE1B 1RHUB 1FK9A 2B9YA 3VCDA 4X65J 1NK5A 2DGOA 2D3UA 3DRRA 3PIPQ 5MAOA 1TFWA 3BO3A 4F67A 2R2TA 3QT8A 1SCJB 3F56A 2MJNA 4N77A 4LF8J 3N6LA 5D0RA 1SZ2A 1DGKN 3P31A 3AOAA 4OX9J 1Q1KA 3BGFA 3CCQS 3FMBA 3UN3A 1XBWA 1X4CA 3OYCA 1EX4A 4FYDA 4ZCIA 5LMNJ 1N88A 2AJ4A 1WKJA 2XMAA 5C25B 2R8JA 1DHMA 5GADU 4QJVA 1B7FA 2POKA 2CQPA 4U9RA 4HT5A 4O0IA 2RQCA 4NE9C 4ENOA 1IBMJ 2CGLA 3AARA 4CZKA 2R3VA 3VGKA 1TR0A 5D78A 1NDPA 1A0OB 2B4OA 1X8DA 3P96A 3D2EB 3TJAA 5C24A 1ZBSA 1YTYA 5CH7B 5EY4A 2ZM6J 4JI4J 5BYRA 4AQYF 3C46A 4Y00A 3B4MA 1TVRA 2JEFA 3GIIA 4C11A 5J1NA 2K7KA 4OL8A 2R7OA 4DL6A 5JMNA 2EG1A 1VSIA 1DQAA 1TKXA 1UEVA 3A2FA 2F4VK 4N5SA 1EWQA 2P2CB 4PHTX 3OTBA 3UIQA 3NVKA 2AJ0A 2ACMA 3IAS9 3PW7A 1BD6A 2W9CA 3BGLA 4O4RA 2V8PA 2HBQB 2NYIA 4N47A 5E3CA 2XGPA 2Z1IA 3TW0A 1S59A 1TUVA 2WB4A 2FB0A 2B8QA 5EX3A 1N54B 1CJUB 3FFIB 1FNMA 2G0IA 2Y9HA 1T9UA 4Y1CA 1HBNA 2QO3A 1RUSA 5E2QA 1RLCL 3IC1A 2DRBA 5KQ8A 2ERRA 2M3DA 2JL9A 3L7OA 2N4DA 3L3VA 2BOPA 3KKRA 1U1PA 3GL1A 3QAUA 5EX0A 4YDXA 2EBGA 2BE7D 4PL7A 3PJWA 2CZVC 3R1LA 4K50A 2LMIA 4OX7A 2KO1A 2LU1A 4FF3A 3SYZA 3P3DA 5AZIA 4JI0J 2HFOA 3KK1B 1XQSC 1T9YA 4OI2A 3F44A 1F3FA 3D6RA 4DR1J 4FM2A 1HNZF 3QO9B 3B4DA 3CCWA 3SCIE 3MURP 3FGVA 1E6YB 5FLXO 5AFUH 2ASJA 1IBLK 4DUZK 2HFNA 3W63A 2UUCK 2RQKA 3OR1B 3SAGA 3S3MA 4XDCA 2QRRA 4DUYK 2DXDA 4DR4J 3AQOA 3A4TA 4DV5J 3IM9A 4OYBA 3LP1B 3CCLS 4AUKA 2BTFA 2OPSA 3GYXB 1JXLA 3LM2A 2GNKA 1JLAB 4P72A 3ILIA 3UDVA 4UY8O 1HRHA 2GIQA 3DMJA 3K5PA 2QWPA 4M63A 3DJCA 3VPZA 4FWNA 1TV6B 1CQMA 4JV5K 4OPAA 2VODA 3NCRA 1QUPA 3I0SA 3U1LA 3UNYA 4JI8J 2XCPA 5AXNA 4NXMK 1W2BR 4HHJA 5FD1A 3ZSXA 1DFDA 2GHWA 4B3MF 2UVVA 1LNQA 4P2XA 4NYFA 1NSPA 3N4QA 1UVKA 4ZLLA 2P5OA 4ID5B 4UUWA 4RW8B 3D6FB 1WNEA 3M6GA 4LH4A 3HFVA 2W2MP 4OI0A 3C19A 1QZ5A 3CUNA 3OTOF 5BN9A 3M7VA 2IFXA 5L9NA 2CJXB 3UE5A 1B0TA 1PYSB 3PY8A 4FJLA 5HMYA 2BE2B 2QMWA 1E6VB 3VAKA 5KFZA 1NJIT 3TTDA 4DG1B 1NGAA 2X78A 1TL7B 1NB2A 2O8BA 4DLEA 2VQFJ 2VONA 3GDQA 2OTJN 1VK8A 3CMES 1O5JA 2GHVC 5D6GA 5EOYA 4AILC 5AQKA 2K7JA 3I0RB 3FZFA 3SCJE 2VWBA 3PRDA 2C3OA 4GY2B 2HZAA 1QAYA 2XY5A 1IO2A 1RTHB 1SJ1A 2LQ9A 1SKRA 4PCQA 4WQ4A 2V51B 1D9DA 1ATRA 1VSMA 2BVZA 4KSEB 4PWDA 1T9TA 4ZMMA 4H4OB 2C2KB 2NLWA 3TEHB 3ZTQA 2ADBA 1HFEL 4DZ6A 2YX4A 4GO5X 3ATUA 4OI4A 2IRXA 2IC3B 4P7VA 3V4IB 1I51B 2QWLA 4B8CA 5FLXU 4FYVB 1FHTA 4OPJA 1GLEG 3ZTPA 4URSA 2OPQB 5A2QY 2F8EX 4CO3A 1PYTA 3G8TA 4E0DA 4LFAF 1X5PA 5K5MA 3WNFA 2D69A 2CNNB 5HANA 4KTQA 1NWKA 3CCSN 3ET6A 2ZQBA 4FO0A 3GJTB 1YBTA 1FERA 2P8IA 3FEYB 3BM7A 1TMJA 3SIPB 3THWB 1ICEB 4KO0B 1QSLA 1DTQB 2KM8C 2RB7A 3L2WA 1U26A 4FJHA 3TP2A 3M8SA 2GV9A 1X4FA 1A9NB 2AGPA 4C0BA 1V5IB 4OZLA 2KHCA 4C98A 1KR4A 1H2VZ 1ZBFA 2JC1A 4Q5VA 3MFHA 3V9UA 2W8LA 3BEXA 5F0UA 1CS4A 1T9WA 5KFOA 4ECWA 4BC9A 1NGDA 5F0XA 4H0OA 1M5PC 5B7WA 1QM9A 1XUPO 1Y0HA 2SXLA 8AT1B 5HL7Q 4LF4F 3UPFA 4GMKA 1RDUA 1XNRK 1U0HB 2V2ZA 2HVHA 4FLTA 1RZMA 4ZVSB 3HSZA 3ITHA 3C16B 5F3ZA 1YUWA 2ZH1A 2P1JA 3OD2A 3PX6A 2BACA 2F40A 1NGIA 3VESA 2JNJA 2FLOA 2HHHF 2IVPA 3WHIA 1D09B 4RKUC 3RBZA 4JYAJ 3C7NA 5GMEA 2AQ4A 2CJBA 1DBDA 2GIFA 1Q7YO 2XLJA 3DLKA 2K3KA 3MPUB 3V81B 3UDEA 5KFVA 4B9TA 1IKYB 5DM6L 3QNOA 2FHKA 3VGLA 3DXSX 1L3TA 5AJ3J 5CYQB 3ENWA 1ZBHA 3MPVA 1UA0A 1X9WA 3O8MA 5AXKA 3JYTA 3CD5A 4WYWA 3GIMA 4QCLA 3EE9A 3C8YA 5DJBA 5FDLB 1KP6A 5CZ1A 4Y2CA 5L1KA 1HYSA 3MMCB 1XNQJ 4LT6A 3TAGA 2NRXA 3WX8A 3HCXA 3I56S 3VGVA 1WELA 2G4BA 2VPWB 3BH7B 1IM6A 4J9LA 1BU6O 4DTNA 4M42A 1N4LA 2W2QP 3WIVA 2MZ1A 1NLVA 2AIRB 1HHSA 3M9MB 3LUYA 4OQJA 4AHTA 1K8AT 2OMOA 3PYGA 1RBOB 3ZLJA 2PN6A 5C2GA 5KFCA 4NLDA 3HRGA 4MTPA 5BR8K 3U1NA 3CF5Q 1OMSA 1NAQA 1KLMB 4DU7A 2KL8A 2ZE2A 1KONA 4TQRA 2QGFB 1M90T 4CGJA 2E7VA 2O5DA 2O4IA 1MMDA 1CZAN 4Q43A 3IRWP 1N5TA 4DR7K 4ECXA 3WNGA 2MLXA 3MCPA 2HQIA 3MAAA 3E9PA 2V7ZA 4ZP9A 2H5JB 4NB4A 1C0FA 1PAUB 1TYQA 4DR2J 1OIAA 1ROFA 2AHOB 2O8CB 3HHKA 4G6VB 2F63A 1RLDA 4LF9F 4LMZA 3GSDA 3G4SN 3FVYA 5EU7A 2FSJA 2CWXA 3U02A 4DV6F 4IRDA 5IV3A 4JI2J 2VBWA 3EO3A 4M5JA 1FJGF 4BVOA 4NXNF 2Q79A 2B4UA 3SQ2A 1ZBTA 2X3GA 3GV5B 2O01C 4CJ4A 1J2VA 2KJWA 2I9SA 2HRYA 5RUBA 4MKAA 5DRKA 1IBKK 3GOIA 4LF1A 4PZVA 4OZ3A 3LP3A 5I3UA 4CERA 2V9KA 1Y64A 1S1TB 1YGYA 1WOSA 4OLPA 5D4OA 3TX8A 2ZZNA 5G0RA 4XDDA 1WWHA 3M8RA 1IBCB 1HNIA 5BYSA 1QQNA 3FBEA 1UWBA 3G8SA 2P9KA 3GIJA 2HVIA 5C15A 4TQSA 1HKBA 1VQPN 5EHHA 1SC3B 1RU2A 3QEVA 3OTDA 1GT8A 5MLCV 4YHHF 1KOOA 2Y8WA 2A6OA 4WP3A 3H8YA 1CJVB 1FXXA 4K8ZA 4QR2A 2QA2A 2W9BA 1GMWA 3TAEA 4J9VA 3ZCMA 4ES1A 4X4NA 2HHQA 3C6HA 4L3NA 2UVRA 4DR5K 3S3NA 1F6TA 3TARA 1VLYA 4JHDB 1HUXA 4X65K 1YZ7A 3CD6N 3TTFA 4BQZA 2ZF5O 4Y0WA 2MQOA 3R8EA 4X4OA 4CE9A 3ASMA 4LF8K 3KKSA 4B9MA 3A8EA 1IJFB 1N5VA 4FYWB 1RWPB 1MN9A 4OX9K 2VG6A 3MM6A 4OO1J 4P71A 3ZEUA 5HOOA 4QWAA 2FHJD 3W9HA 5LMNK 1JB0C 1WOPA 4FOIA 3EPIA 2W42A 1N0UA 2H5EA 1FESA 3QFPA 1EAYC 4CF0A 1ZAWA 3GFXA 1WSRA 2QLXA 4KH0B 4ANEA 1GLLO 1NJWA 4K8RA 4LRAA 1IBMK 3NMAA 2N7YA 4QW9A 3D0IE 3HJFA 3LGMA 3J80O 3DRRB 3NS6A 5DQHA 3CC4S 2O66A 4MFBA 5M1PA 3VVTA 1XQIA 1TP7A 4B02A 2PE8A 4DV1J 2E29A 2ZM6K 4ZPTR 5E26A 4JI4K 4EZ6A 3C6UB 2UXCJ 4F4ZA 2A1BA 4DI6A 5KT3A 1X1PA 1Q0NA 2J0QD 3HBTA 3LOUA 1S3XA 1WTFA 3H2LA 4CESA 4EP4A 5JLFA 4NEZA 4ZPVR 3SSSA 2NPFA 5TKYA 2WVEA 4KB1A 4R5PA 1HMVA 4FK4A 3KKFA 4OHXA 1YAGA 4P9SA 2YWFA 1RCXB 4LFBF 2W41A 4TYBA 4FLYA 3R5BA 3SQGB 2CDQA 4HI2A 5KFIA 4LVOP 1SJ3P 3DRSA 3QEIA 1Z1ZA 1B9FA 4YDUC 4ZHRA 2RNEA 1S0VA 3TUPA 2NR0A 4H8KA 3W0LA 2UVUA 4X4QA 3KHRA 2HGLA 3D6MB 4TY8A 3TA2A 1DY3A 3VQ6A 4IJAA 4C11B 4AXIA 3ZSZA 3W2WB 4WQ5C 2DY9A 4EBCA 1KD1T 3ZX0A 4BGAA 2GHPA 2MB0B 2K1RB 2HFUA 1OWXA 3BDPA 1VBYA 1X9SA 5JUMA 3BPDA 4JI0K 3PEHA 2HBRB 4DR1K 4BR7A 4WQ5A 2GVZA 3WIUA 2IMWP 3WXKA 2MQMA 5AQHA 2ZJQL 2HF4A 4BBYA 1OPZA 4KHYA 4C8MA 2MLZA 1WEYA 3KMSA 4DQRA 3RYLA 2UV8G 3ULHA 5B0BA 1O13A 1Y97A 3O2IA 1OH8A 4DR4K 2XMUA 3DU5A 4DV5K 5J2NB 1CPZA 3ETMA 1HWUA 1ZZNA 3K17A 3OYMA 3BKTA 3M9OB 1EHWA 4LSLA 3PHTA 5LXYA 3SMSA 4JEPA 3EM1A 3QMQA 1NLKL 3I32A 2ASLA 2GWJA 3NAHA 4CGDA 5IOLA 1XC9A 2H3EB 3J80U 2NSBA 2YNFA 3KUGA 5BYQA 2P6SA 4JI8K 5HI7A 1OH6A 2V2VA 1WLJA 3IUCA 2XZTB 3BZQA 4PXDA 3OLAA 4ZLJA 1RWKB 3VF6A 4ZVOB 2HFZA 3O3HA 4WFZA 4M3XA 4FM0A 4OFZA 5CCMA 2ZH5A 3FBFA 5DDRC 2MLYA 2KXHA 1FNXH 3GV8B 5E3PA 2OPSB 4F4YA 1RT3A 3BZCA 4PAAA 4ED4A 4KV8A 4LF6J 3DMJB 4DN0A 4Z4EA 1YDLA 2DB1A 4FLWA 5F8IA 3L4BC 4WFBQ 3WEEB 5KG6A 3HHEA 4OX8A 1G2EA 1BO5O 2HHXA 3IR5B 5DO2A 2ATLA 2VQFK 2XZWA 4J2DA 4URGA 4ELVA 2P9NB 3Q8RB 2HIYA 3PIPL 5KFTA 3VERA 2W4PA 3OL8A 2F8TA 3J7Z5 1JL1A 2ALZA 3LDOA 4W4MA 1VRTB 4MIBA 5EN1A 4HHTA 2BQRA 3V9ZA 1HBOA 3BN4A 4FJJA 4KAZA 3CB4A 2MKHA 5KT5A 5D4PA 4OZ2A 2ADCA 1AA1B 1S9EA 1RHKB 5GAEP 2E7WA 5KFMA 2J8SA 3MPDA 1WSEA 1H7XA 1NOYA 4IOXA 1YJ7A 3NF7A 1GH8A 1Q18A 5K8NA 3RMCA 2O8BB 1UAWA 2XTJP 5CABA 4NLVA 1WF2A 3GWCA 4F26A 5IQQA 2VA3A 3VMFB 4DV7J 3ZTOA 2H54B 4JI1J 3IRXB 1R8CA 2GUIA 3NNAA 3GE9A 2HFSA 2J6UA 1W2IA 4DFMA 2NXJA 2N4CA 4A48A 4A8MP 3W5YA 4OZ0A 4DFPA 4LSNA 2UU9F 3H3OB 3HX9A 2PSZA 1IXKA 5ETVA 3TYTA 1UVLA 2B7BB 5HLFA 1KTQA 3PFEA 3Q8QB 4JKGA 4KGKA 4KH4A 4LRFA 5HMWA 3TPQA 2IM3A 4PUOA 3AB4B 3NF8A 5AE1A 4ZTFA 3K9JA 1BQNA 1NK9A 1WC6A 1CEZA 1I3OB 3V6DA 3RB6A 1H1VA 1VSLA 4M95A 2NUHA 4WK1A 1QQMA 3NE6A 3AXKA 4PQUA 3T19A 1WG5A 2VPYB 1JKHB 3EUNA 2JVOA 4KY3A 4ECYA 2XS5A 3ET6B 4WP9A 5K8PA 4HTJA 4HWIA 1YK9A 3M5RA 4OZ1A 1C2PA 2H3GX 5KFHA 1KAYA 3NWRA 2UUWA 3DOLA 2KG0A 4LF7F 1RT5A 4JYAK 3TU5A 4RNFA 1WC5A 3O4QA 2FJDB 4G1QA 1WSVA 4CEDA 4CZLA 1NNEA 2J6TA 4F0KA 2HWIA 4CWBA 3QESA 1S9FA 1L3KA 5AQQA 5GAGP 2KM8B 2E2OA 5AJ3K 2R7WA 4CZCA 1OH5A 1VDHA 3TAFA 3CCUN 1VQ6N 3MMBB 1B70B 2CAJA 3HTVA 1NZ8A 1OYEA 3HLUA 2G8VA 1Y7PA 1GLAG 5T7BA 2J9EA 1XNQK 2LEAA 3ITHB 1K0VA 1G4CA 4FBTA 4DLGA 1N34F 4KPYA 1U1MA 4FXWA 4HI1A 5F2RA 3HD2A 3EVOA 5KQDA 4KHUA 1LAWA 4WZQA 4Y28C 2UXBJ 4FDFA 5EDWA 5DG7A 4JB8B 3K5LA 3JSYA 1YRTA 3TOQA 4EBEA 2Z8QA 2DNOA 4JAXA 3FRZA 9ATCB 2V4RA 4WFAQ 3LZIA 5DDOC 4UF4A 1URNA 3JYTB 3CCVN 1OY6A 1JL2A 3CJAA 3DLGB 2JFKA 4I6MB 2B3TB 2VBZA 3OBWA 4BR9A 2EFPA 3PX4A 4QS8A 3M1FA 4LIWA 2O8DA 4W5NA 4CJEA 1VRUB 1BWVA 5KFXA 1NH8A 4RCHA 4AXJA 5IV4A 2KKHA 4H0YB 3VOVA 2BRKA 1V4TA 4XIUA 4I9QA 3KJVB 4FSVA 4RTFD 3HVAA 3QERA 2MKIA 4NLCA 4DR2K 5JMVA 3OL7A 4RW6A 2P9GA 2IYIA 4OI1A 4KI4A 2XI2A 3CMAS 4DS5A 3J7AP 5CR4A 2WONA 3KLEA 3MX5A 1KKHA 3LH2S 1HARA 1TL3A 3DRYA 4JI2K 2IPOB 4NPOA 2XSJA 4IZ9A 1JLCA 1FEHA 4J5OA 1DT9A 4HL9A 3VAMA 1RDBA 4HH1A 1NGGA 4DPXA 4CZGA 4MYUA 3J7YP 2NXCA 4RWWA 2IY5B 3OYKA 3R6MA 4FWOA 5LJ5Y 5ETRA 1V5VA 3RB0A 2K8GA 3CXCM 1TYQB 3BS9A 2NZTA 4CEZA 4RUBA 3F73A 1RK8A 3BF3A 5AZJA 2CQHA 3NH0A 5D3GB 3QZ7A 1JLQA 4DL0C 1R8PA 1KVIA 3HVWA 4LRCA 4WCEQ 2BJDA 3DXMA 2QL7B 1RAGB 4K43A 1RAAB 2R42A 4OJ3A 3N01A 1OS5A 4OKEA 5GMDA 4RR5A 3DFEA 2BJ7A 3CC2S 3L3CA 3M1VA 4DTUA 2ZZTA 2IBOA 5KG1A 4P52A 4B3RF 2CJKA 1HQUA 1YJVA 3MM7A 1XJWB 3MEDA 4MIAA 3OW2M 3KZBA 1FJCA 3ZX2A 1EETB 3AXMA 3R6GB 4RBVA 3K0JA 1S77D 4ETXA 4I4BA 2WSEC 2PGCA 4TU9A 4FM1A 2RDDA 5EX5A 1BLUA 1FRJA 4UQTA 1IKVA 4I68A 1YKWA 3RJMB 5CAAA 3B6BA 5G0RB 4KKOA 4FJIA 1RQ0A 2F8MA 4DR3J 4FWSA 2HAIA 3UDLA 5BR9A 3THYB 1HNWJ 5HL7L 3H5YA 3OR2A 4P2MA 3SDEB 1VBXA 8ATCB 3H98A 4CIGA 1P27B 1YJWS 4OIXA 2AF6A 2XS7A 1WHVA 2GJIA 3JSRA 2AD9A 3KYLA 2CQGA 2I8EA 4CLTA 3ALYA 3OYJA 2FC8A 2HLUA 3KLIA 3CJ8A 1YVNA 2PI5A 3MEGB 2P51A 4Z7CA 2W7AA 2YNHB 4FVMA 1HBMA 1S1WB 3NGIA 3CCSS 2FBVA 4CEFA 4JI5J 3S6EA 2AGOA 3MR7A 5HVFA 3D3BJ 4H5WA 2V68A 1ZBLA 2DIUA 4WFNL 2OO4A 1VQ5S 3TQEA 4ZPWR 4DV1K 2WB1D 1M1GA 3BBCA 1H74A 2H9ZA 1BL3A 2CPHA 3V6JA 2UXCK 3K5MA 2ZD1A 2DGSA 3C65A 2VG6B 4CHQA 4E3SA 2EEYA 1R0CB 4F50A 4ID1A 4BE1A 4FVUA 1EARA 1CSJA 1RKIA 2PYLA 2CQ3A 1IKWB 1N8RO 2ZH4A 5AT1B 2GVDB 4Y3CA 2EPIA 3DLJA 4KQZA 1BCMA 4LF5J 3OFEA 1PC4A 4OI3A 3PRBA 1NMEB 2KKZA 1KRPA 2RS2A 2VASA 1FDAA 5A8WB 4MFBB 5AQFA 3Q86A 2BW2A 1Y11A 3IMQJ 2M70A 3QEWA 1X4BA 3G71N 4F36A 3CF5L 4WBFA 1TUYA 2BZ2A 3ILLA 3ADAC 5DQIA 4CLPA 1U1RA 2R7RA 4NL5A 4GVBA 4I7FB 1R7IA 2QA4G 4Z7YA 4J7CA 4QBUA 3UR3C 2ZKTA 2M2BA 1WTBA 3Q2TC 3L09A 1RT2A 2MKCA 3M9NB 1S72N 2XO6A 2MZTA 4PWUA 3CCZA 2KN4A 1F9HA 2HVDA 5I3PA 3DN9A 4Y2MA 2Q1NA 4H0XB 5A0YA 4Q0BA 3O8WA 3OYDA 1VIXA 3KWMA 2HNYB 1WHXA 4C3MA 2YNIA 1DQ9A 1NM1A 1IKXA 5BREA 5LJVA 3F41A 1G99A 5L8RC 1S99A 2RJZA 2YPZA 1GLCG 3OVNA 3DRSB 4QOTA 2O8EA 4JNEA 2VC0A 4DTOA 4B3SJ 2HNZA 3HOSA 3MR2A 4DXLA 3BR9A 3D6TB 2IAJA 3BJYA 1UW9A 4DPWA 1W0HA 1BWEA 3D4JA 1YI2S 4MLEA 3W66A 5AQXA 3CJTA 3D28A 4ECTA 4HTLA 2VQEJ 3SJJA 1KC8O 4I6YA 4EWTA 2PMWA 4TLQA 4YS2A 4CIFA 2LXFA 3I4PA 1VJWA 3L7UA 1CXUA 3J8AA 2V4JB 4MT1A 1QDUB 3B6OA 3OQ2A 4ELTA 3AVFA 2Y1IA 2QLBB 4BR4A 3CJ7A 3H7HB 4NLUA 2B9WA 4M3YA 4H4MB 3EZOA 4K59A 4AH9A 3P49B 4I2PA 2GUPA 2W25A 4J2AA 3FZBA 4ECSA 1RBLA 3PEJA 3R5DA 1HNVB 3QLHB 3NNHA 3KNGA 2M8DB 3Q8YA 2A41A 1HQ2A 1S7IA 3H20A 3VF2A 3M2UB 1GK8A 2OI2A 2CFXA 2DVIA 2JRSA 4IUFA 4FPAA 3P6YC 4IG0B 2WSCC 3PSFA 1CULB 3L2VA 4DF4A 4LF6K 3OYFA 2FZCB 2ASOA 3MECB 2JDJA 3CJ0A 1EKSA 1CLFA 4YY3J 3QSYB 3FZLA 1UFWA 3VWSA 3NP5A 2UXDK 4X4VA 1C1CB 3OYIA 2BDPA 3PR5B 3SUPA 4DHYA 1N32J 1SH3A 4MK8A 4LR8A 2D0CA 2W2OP 5ELZA 3EGNA 3ZT4A 4U7UD 4ALZA 4J8FA 1FFSB 2JLFA 3ZSVA 2L9NA 1FW6A 3EY1A 3G6ES 3S1TA 4L72B 2O8FB 1XMQF 1U2RA 3C6AA 2NRHA 2QSWA 1C1BB 4ZVTB 3QAEA 4PEOA 1S10A 1QSSA 1S22A 1SQKA 1LFPA 3B8AX 1D8YA 1RT3B 1U2CA 3GBTA 3ZZRA 2AX1A 4ZP8A 4CTAA 3SBGA 4E1MA 5THWA 1M0SA 3QJJA 1NDKA 3R2DJ 4EYHB 1B99A 5HRRA 2KVIA 2CNLB 4PY5A 4NLBA 2MKKA 3MPYA 2XNRA 4LIRA 4DV7K 5LMUF 4JI1K 4DTPA 3G2XA 1B3TA 2XYGB 5J1PA 3NS7B 4C9DA 2DR5A 4BDYA 1UMJA 4ID8A 1NH7A 1U25A 5ETPA 2V50A 4P75A 2FPHX 5F8HA 1HBOB 2BKPA 5JVHQ 1HR0J 2YX7A 3QFHA 3AQPA 3FE1A 5E3RA 1RT1A 2BJ8A 1ZZFA 1S9EB 3JAMY 3M32B 4EUVA 5KG5A 2OD4A 2ZDOA 4ICLB 2WTFA 2RSQA 1WSHA 2BJ3A 5I42A 3GZ7A 4A8QA 3V9XA 1FTCA 3DGPB 4J9OA 2I7PA 2HFVA 1K1QA 3N9UC 1WSGA 4OHYA 2RRBA 3GCXP 1G1XA 4MYTA 2LQ8A 2HURA 1FRLA 1VISA 1YVFA 1SC1B 4D3HA 1DTTA 2EKYA 3PJ9A 3AJDA 5GAEU 3W64A 5I9EB 3NNCA 4F02A 2DEJA 4F3QA 2ROEA 1SI9A 3TUIC 3FEZA 3D68A 4OZNA 4CZIA 4JKGB 1Z25A 3VHQA 2PC6A 3AAQA 3RSEB 1BIZA 4DB3A 2ZITA 4Y2KA 4CBUA 4CGHA 4UUXA 1TKTB 1VQLS 4CJ3A 3V6DB 3RRHA 2V6AA 2BANB 5TKWA 4WYLA 2E1PA 2FGOA 3VENA 4DL7A 2H1YA 3K57A 1RWOB 1SJFA 3E2EA 4JKAA 2AJ1A 4R0JA 4A8WA 2VC1A 3JSBA 4NYPA 4JOUA 1Y10A 3C95A 3NG8A 3MMAB 3MEKA 3QT7A 1F5BA 4OZJA 5A8RA 4IDKA 1N52B 3DOLB 1KAZA 1VQOS 1RT5B 3NGYA 3V5RA 1UPPA 2UXBK 4NZ7A 2FY8A 3ATVA 4M5IA 3IAM9 5HQ8A 2YI1A 4FZXC 1HWJA 4M5GA 4G1QB 3WX4A 4Z94A 5E7OB 1ITPA 2CQIA 5M2UA 1VC5A 1VQ4N 2PA8D 4CFBA 2O3DA 1FE4A 3GSIA 1T95A 1RWNB 4ECVA 4YOEA 4BLGA 3QT6A 3AO1A 4WFYA 1T05B 4EZ9A 2BKNA 2ZBCA 4NCGB 3NXZA 1DEJA 3PZPA 4JKHA 4CI0B 1UCNA 3ZT1A 2CYYA 4AHVA 3CIZA 4KHSA 4C8YA 5CCLA 1RT7A 3L7PA 2XY8A 3UKRA 3ZSYA 2C3UA 3VGMA 4JRQA 5SZTA 4F8RA 5D0GA 1FDBA 2W7PA 5GAGU 3IWXA 3NFAA 2JWNA 4MAKA 2ZJPQ 4WFBL 4DV4F 3JS6A 2DGWA 3OT9A 2VDIA 2F65A 4K42A 1CZBA 4IRCA 3RTVA 1HLWA 2F9JA 4J9KA 4B9VA 4CH7A 4X4TA 1RJJA 3AODA 2YHXA 2HZVA 4W92B 3UKUB 2DPNA 1Q5YA 4QPTA 1T0TV 3VR1A 3TVYA 3D2FB 4DX7A 3M6UA 3NGZA 1U2FA 1VQ7N 2KT3A 1YJRA 3IWLA 2DFHA 1NKEA 4USWA 2ZH3A 1HNXF 3SSRA 4ED5A 1GNKA 1FWLA 1MN7A 1U45A 5AFUA 2KRRA 2DGUA 5C25A 3ZTSA 4CQ1A 4ZIVA 3NHGA 1U1QA 5E3QA 2YHAA 4KHWA 4ISFA 3TTCA 4IJNA 1YHQS 2EX3A 2BMBA 5IWAF 2VDHA 2VH7A 1S1UB 1OH7A 3LANA 2DKOB 2RT3A 3FBBA 2E5LJ 2WONB 2XYPB 3HFKA 1S7HA 1BOTO 2J7KA 1YTAA 2J8AA 1R8AA 1RA6A 2E2NA 3H2UB 5KG3A 3I55S 1BI4A 3Q22A 1KFDA 3MCMA 1FXDA 1RKJA 3I6PA 4FF1A 2RQ4A 1UVJA 3AO4A 3C15A 3OXFA 3TUZC 4L74A 4L3QA 5B09A 2HF3A 4DS4A 4CZJA 2V2QA 4FPIA 2AP6A 3LDLA 2V63A 4DX5A 3AVJA 4IO8A 5BJRA 5BXIA 2B56A 3VQ8A 1HD0A 1JXVA 4GW6A 1JLQB 4M7XA 4MH8A 1RAHB 4FZZA 4EYIB 3O5TB 2RS8A 3T3FA 1VC0A 3LF0A 2MJUA 5KFBA 4DR3K 1CJUA 4FNIA 2N82B 4FJNA 1HNWK 4WKYA 4GKKJ 2QA1A 4A59A 4UOHA 3J7YU 2KW4A 3QICA 3LL3A 2XSFA 2YX6A 4YB7A 3KDNA 1RWUA 3DNCA 2W24A 4CGFA 2Q3SA 3NBPA 2IJRA 4CJKA 1FJ7A 1MDUB 2VUGA 3OS0A 2QIFA 3MM7B 1KQSR 3MEDB 3FNNA 4A57A 2I5JB 2C2RA 3KMQA 2EFNA 1QY7A 2MHNA 3BYRA 3JS9A 4ZIWA 4JI5K 2BQUA 4A46A 4EP5A 2XBPA 4BG9A 3GIRA 3RWUA 1V3SA 3QO9A 3M2VA 5I4MA 2J6SA 5JJBA 1RYRA 2IRUA 4DBQA 1E6YA 1Q79A 4CP5A 3LAMA 4O3PA 2Q97A 2IVOA 4IR1A 4P2SA 3CERA 2KH9A 4CGGA 2D4WA 2FQQB 5B0EA 2MGZA 2MSTA 3OR2B 4ZLPA 2UV8A 3KTQA 4J9SA 1GOBA 1U04A 3AJ2A 4X64F 5JVGL 2P9UB 4BRNA 4DV2J 4M45A 4L75A 1JLAA 5E5NA 3TR8A 3SPZA 1ESVA 2WW4A 5HMZA 4FF4A 2DNLA 2OH2A 2DR6A 1GAOA 1TV6A 4LF5K 2M5YA 1HBMB 3TRGA 1AW0A 3VA3A 3C6TA 4M41A 5L38A 3MI7X 5E33A 4W5RA 3RZAA 3SUOA 4IRKA 1HBUB 4FLZA 3AVGA 3L0QA 4WFAL 2DNRA 2MTLA 1LXJA 3T1HJ 3D67A 1S49A 3R9LA 4ID5A 2Y8YA 4PABA 2W01A 1BQMB 4FW2A 4RW8A 4JK7A 2W8KA 1SC4B 1Q9YA 2E5JA 1HI1A 4DR6F 3AAWB 4CO1A 3HYFA 5D77A 1BHNA 4ILMA 3CJQA 3ZO7A 4CEAA 3MTJA 3W9IA 4QIEA 2HWTA 3BGOP 1LOTB 3ZSRA 4U95A 1GXUA 2MZSA 1N33F 3BEGB 1TMMA 2CH5A 2PYJA 3BYPA 1XMOF 4BROA 3BGRA 2HBLA 3BSOA 1ZC6A 2QWQA 1VQMN 4DG1A 1QJHA 4OJ1A 1TK8A 3NAEA 1Z6RA 1TL7A 4EK2A 1B9DA 3ENHA 1ELOA 4DMNA 4JP8A 4QWDA 2F9TA 1S0NA 4ZCKA 3I0RA 3JXUA 1RCHA 3S3OA 4B3SK 2DNMA 3CG7A 4FS2A 2DXEA 1RBSA 5U47A 4BR2A 3IR7B 3L6QA 2Q66A 3J80Y 3N6MA 1UZDA 3TWHA 1U1NA 3T1YF 3MX2A 4LBPA 3LDNA 4H4OA 2VQEK 3CCVS 5AXMA 1DARA 2A18A 4CLFA 2AJQA 3KLFB 2IC3A 2Z2MA 1EWRA 2PY5A 3V4IA 2EWHA 4KH5A 4Q0BB 1K9MO 2DNZA 5DG8A 4FN5A 4IH5A 4AT1B 2X1AA 2DNQA 4AQYJ 1IKXB 1ZM9A 3THVA 2EK1A 2AU0A 2OPQA 5D4NA 3P8BB 1BC6A 3NVMA 4KPCA 1O0PA 2B5JA 2RRAA 4NLGA 4FJ7A 4BRKA 2M0GB 3K59A 4AHRA 4K4YA 1N8RT 3T41A 2PBDA 4ZP7A 3UB5A 2BR0A 5F8GA 5AQPA 3CXCR 3L2UA 3CCES 1WEZA 3THWA 4RW9A 2RRNA 3PV8A 3H42A