3ITHA

Crystal structure of the hiv-1 reverse transcriptase bound to a 6-vinylpyrimidine inhibitor
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
556
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Crystal Structure of HIV-1 Reverse Transcriptase Bound to a Non-Nucleoside Inhibitor with a Novel Mechanism of Action
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase, hydrolase
total genus 136
structure length 556
sequence length 556
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3ithA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ithA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ithA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ithA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ithA05
4RNOA 2G8UA 1S1VB 1JL1A 3KLIB 2E4LA 3UQSA 4I9LA 1SUQA 5KFNA 3KLEB 3KIOA 4MIBA 2WONA 5DG7A 3ITHA 2J6SA 1QTMA 4FM1A 4BE2A 4B3OB 1O1WA 4DSLA 1S6QA 3BQ2A 1Y97A 4NYFA 3OYMA 5KT3A 2RKIB 4MK8A 1NOYA 3NE6A 4EZ6A 2RF2B 1RT4B 1D0EA 1QUVA 3E01A 4CE9A 1SL0A 3OSNA 4KSEB 5KFDA 2OPPB 3L3UA 4MQ3A 4K4XA 3PJWA 1HJRA 4JV0A 4H4MB 3PR4A 1BQNA 4RW7A 4QCLA 4QWDA 3Q8PB 5KT5A 4CFAA 3DRRB 1VSJA 4K4WA 1KLMB 1XWLA 3P83D 3V6KA 2D0BA 3DLKA 2LSNA 4FYDA 2HHWA 4CJFA 2FJVA 1NK4A 5FDLB 4CJSA 4E1NA 2Y1IA 1CLQA 1VSLA 3DMJB 3GV7B 4ED3A 5SZTA 1VSMA 2X74A 3QEXA 3PX4A 4ZVEA 4KE5A 1LWFA 1CSJA 5HROA 3DLEA 3HL8A 3K59A 2WTFA 4CF9A 4I2PA 3MR3A 4ECVA 2W9AA 3SFUA 1LV5A 4CCHA 1TKZB 4CK2A 3BGRB 3OS0A 1IKWA 2FVPA 1U45A 3MR2A 3M8PA 3HT3A 4DQSA 2IBKA 3M8QB 3HPGA 1R0AA 3CVKA 4WXWA 1FKOB 3PX0A 3O4QA 5F8NA 4LSLB 4IKAA 4OKEA 2HHSA 2BR0A 1XR5A 1U09A 4I2QA 2E6LA 3QIPA 3M9OB 2YKMB 3ZT2A 3F73A 4M94A 2GC8A 1TVRA 2R2SA 2B5JA 4DS4A 4NLTA 5DMRA 4QW9A 3NHGA 3CJ4A 1TL3B 3LPUA 4WFXA 4DFKA 3QYYA 4M3WA 1KCFA 3MR5A 3NH1A 4XPEA 3B6PA 4DL5A 2C22A 2D7SA 5KT4A 3SPZA 3DMJA 4Z4HA 4FLZA 1BL3A 1RTIB 4B9SA 4DL6A 1IKXA 2CKWA 3IG1A 3QO9B 2W42A 4KRFA 3IS9A 3H4DA 4DFMA 1C0TA 5J2QA 3QNNA 2XHBA 4J9PA 3RB0A 1NK6A 4HHTA 2QXFA 4CEDA 3OS1A 2ATQA 4Y1CA 4C8LA 4CEZA 1N6QB 2YHAA 4CF8A 1JLAB 1C0UB 4AHSA 3NAIA 2JEGA 3GV8B 3OHAA 1QQCA 3C94A 4PY5A 1EP4A 1JLGB 1NJZA 2O5DA 4RW9A 1S0NA 4KFBB 3AVHA 4ID5B 2WB4A 3DRPB 1XI1A 1TKTA 4LSLA 4ID1A 2VG5A 3IGVA 4ECYA 3T3FA 4K4SA 1U4BA 4NLGA 2OPSB 4MK7A 2BRKA 2EX3A 3V9UA 5KT2A 1IKVB 4N41A 1S1WB 2ZE2B 4CFDA 1WSEA 4Z4EA 3MXIA 3UDLA 3DOLA 3LANA 2IJFA 4ZPCA 2PYLA 4PWDA 1JLFB 1LW2B 2KFZA 5DG8A 4E7HA 4CJRA 2W9CA 3NF9A 2X6SA 3N6LA 4F50A 4KKOB 4G1QB 3KK2A 3QO9A 2KFNA 1IH7A 3AVCA 3RAXA 1VRUB 5KFLA 1UWBB 4KO0A 3TQ1A 1D8YA 4N5SA 5KFZA 2VWKA 4FLTA 5JUMA 5DGAA 4WFZA 4YNQA 4RG8A 3HVWA 2F8SA 4E7IA 3OJSA 1TKXA 2BGGA 4M42A 3RB3A 4DG1A 5CYQA 3T5KA 1RTHA 5CZ1A 5J2PB 3VQ8A 1KHVA 2UVRA 5DG9A 3DM2A 1HPZB 1WSHA 3I8DA 3CM6A 4CJUA 4ICLA 2GUIA 1RTJB 1DTTA 1KVBA 3AVFA 4FLUA 5J1EA 2ZD1A 2E9ZA 1S1WA 3DI6B 4FZXC 3VQ5A 1IKYA 4W5NA 1LWEA 4DFPA 3BJYA 4FW1A 4O55A 3HK2A 2V9WA 1BQMA 4NYZA 3PW7A 4EZ9A 4KB0A 1DLOA 4N76A 1LWCA 2W8KA 4DF8A 3NF7A 3TAGA 3KHGA 3BSAA 4C8OA 4I7FA 2XCPA 3K5MA 1KSPA 2WCXA 2F96A 4IDKA 4MFBA 2GBZA 5L1JA 4DEZA 1ASWA 5JS1A 5KFXA 3OY9A 3WNHA 5FROA 3MEEB 3F9KA 3CIZA 4TQRA 3HSTB 4M3RA 4J9RA 3LP2B 4RNFA 4B9VA 4C8MA 1VRTB 4U6PA 5KFHA 4BACA 4I9QA 3OL7A 1QSYA 1ZBLA 4LSNA 2HAIA 1RTJA 2B6AB 3CFRA 1RDCA 4EO6A 4CEFA 4KHSA 1U49A 5HP1B 4AH9A 4WXOA 4O44A 4KV8B 4C8NA 2IM3A 3L3VA 4IFVA 1DTQB 1RDDA 2P51A 4J2BA 3KJVA 1RDAA 3RR7A 4RU9A 1SH0A 3MEGA 4QWBA 1B9FA 4QOZB 3P5JA 3CJ3A 4BDZA 1T7PA 2YNHA 4DLEA 2OPRA 3AVJA 3SPYA 4CJLA 5L1LA 3H2LA 4MH8A 3HXMA 3CJ2A 3TAMA 3RRGA 1GOCA 3D28A 4ECXA 1J54A 2HNYB 5EWFA 1XC9A 1G15A 2FJWA 2B4JA 4IG0B 4DL3A 3LP1B 1SH2A 4NLDA 1Z26A 2ETJA 4G3IA 4IFYB 4DMNA 3QINA 1JLQA 5KG4A 3IRXA 3ZCMA 1RAJA 1HRHA 3SUOA 4JUZA 1JLCB 1REVA 5K14B 3AVLA 2FBTA 4FJNA 3CQ8A 1RT2B 4RW4B 3DRSB 1BIZA 1KTQA 3S3NA 3I0RB 4DTSA 2OZSA 1F21A 5C42B 4KHMA 4OPKA 4CECA 4Y3CA 4PQUA 1N56A 3PJXA 5KFUA 2QKBA 2XWYA 1S9EA 1QSSA 1TV6A 4R0EA 3RB4A 4ELUA 2YKNB 3LWLA 4F2SA 4FZZA 2FLNA 1S1UB 1ZTTA 1EETB 2PYJA 4IR1A 1RBTA 2A1RA 5KT7A 4KB7A 4ECSA 3C6UB 2EHGA 2YNGB 5KFJA 3OS2A 2O4IA 3KLVA 1HYZA 4W5QA 4KAZA 1NKBA 1T05A 3V9WA 5KFTA 4IFYA 1KHWA 3HHKA 4IOBA 4AHUA 4DU3A 3JYTA 5DLGA 3QGIA 3UPFA 4NLUA 4J2EA 1BI4A 2XI2A 1D9FA 4OKKA 5J2MB 5K14A 1YT3A 2C2DA 1YVUA 2R2UA 4ECZA 4FJ7A 4RNNA 4J9OA 3M9NB 2JC0A 3GV5B 5E41A 1TL1A 1HQEB 1TQLA 1JXEA 2OPQA 4IG3A 3TVKA 1HARA 1WSGA 3KHRA 1Z25A 3L2WA 3ZSOA 4FXDA 2G8WA 4JRQA 4E3SA 2XY5A 3NGYA 1SUQB 1CZ9A 1ITGA 2WONB 3ITHB 1JLEA 1B92A 4DSKA 4LQ3A 3PO4A 3ZSZA 1S1UA 4K4UA 4Q8FA 3VQAA 1EETA 1S6QB 3MTKA 1ZETA 2R7YA 4RNMA 1WSFA 1HNIA 3ULDA 2QKKA 1RTDA 1RBSA 4CJTA 3FSIA 3JSMA 3KLFA 4YQWA 3E01B 1N4LA 1HYSA 3DLRA 2ILZA 1L3UA 1TGOA 4UQGA 5KGXA 3V81A 5CY4A 4XO0A 4M95A 4FK4A 1BQNB 3GQCA 3RBEA 4FVMA 2YHBA 4RW7B 4M3YA 5HRSA 3LALA 1HNVA 5KFEA 3AO4A 5KGWA 5I42A 3FDSA 4Z4CA 4ECRA 1T03A 4IRKA 2XI3A 3DLKB 4WYWA 3ZT1A 4H54A 3VA3A 3DLGA 5C24A 2VA3A 1S9FA 4ED7A 1KVCA 2HHVA 3S3OA 2ASLA 3K57A 2BQRA 2BRLA 3M8RA 4HTUA 3DDKA 5T14A 4Q45A 5SWMA 4J9SA 1S49A 4URGA 4ED8A 3N6MA 1LWFB 3AO1A 4NCAA 5HROB 3DLEB 3AVNA 4ZPDA 1YTUA 3T5HA 4EBCA 1S0MA 4I2PB 1SH3A 2FLLA 3MF5A 3CJ0A 2EC0A 4Y1DA 4MKBA 4EYHB 3S3MA 5C5JA 4DL7A 4C8KA 1WLJA 3CWJA 1RT7B 1IKWB 2FJXA 4DQRA 3M8PB 2ALZA 4O3QA 2G8IA 4ECTA 4LQ9A 4EEYA 1ZBIA 4DQPA 3LZIA 1R0AB 4ZP7A 2YNIA 2HNZA 4M3TA 4NLRA 4JV2A 4FBTA 5KFOA 4IBNA 4FM2A 4I2QB 4E7KA 4Z0UA 3QIPB 3M9MB 1RCHA 1TVRB 2C28A 2JLEA 2B5JB 2AX0A 4ELVA 3QESA 5DQIA 3SQ4A 3D45A 4QWCA 4F3OA 4YR0A 3ZSYA 4H4OA 4K50A 4CGIA 2G8FA 4QPXA 4O5BA 5KFFA 3D0PA 4E7JA 4JS4A 4GW6A 3V9XA 4YR2A 4ZPBA 1IKXB 5HBMA 3V6HA 2OA8A 2E9RX 4QWAA 4DSIA 3IG1B 4FJGA 1KLNA 3IS9B 1C0TB 4ZP6A 4ECWA 5J2QB 1W0HA 1K1SA 5C25A 4FCYA 1S1TA 4EYIB 1RT7A 3PX6A 4CJWA 1UOCA 3KKSA 4YMEA 2Z1HA 1EP4B 4CGGA 4R5PA 2D0AA 4RW9B 4IRCA 1S6PA 3QEPA 3E51A 1NKCA 3H5SA 3GIJA 3SV4A 1TKTB 4CEEA 2VG5B 1BCMA 3IAYA 1NJYA 5KFCA 3CDUA 2KQ2A 2ASJA 2VWJA 3CFPA 4KBIA 2HHQA 3QNOA 1YVFA 2HMIA 1LW0A 4B9TA 4F8RA 4KHYA 5HRNA 3DOLB 4ED2A 4CERA 4PWDB 3TAQA 1J53A 3WNEA 1GX6A 1BISA 4Q5VA 5F8IA 3DLHA 3G6YA 4CGFA 2W9CB 3PW4A 1N48A 4URSA 4F2RA 3TR8A 3KK2B 3V6DA 3VQEA 2JC1A 4B9MA 2HVHA 3DOKA 3PO5A 4KO0B 2ITGA 1A5WA 3CFOA 3OYLA 4CGDA 1TKXB 1XR7A 4FS1A 3TANA 4ZMMA 4DG1B 5CYQB 1RTHB 4J9NA 3DM2B 4PUOA 3U3YA 4KPYA 4LD0A 1VSKA 4CFBA 4EP5A 3MFIA 4ICLB 4KI6A 1TAUA 3VQ4A 4KAIA 1DTTB 4TQSA 4BE1A 3V1OA 3KD5E 5J1EB 2ZD1B 2FLPA 3NGDA 1UAXA 1IKYB 3LPTA 1LWEB 4FS2A 3Q8RB 1QAIA 1BQMB 4DQIA 4RW8B 3G6XA 1S10A 4OJRA 4F3TA 5F8MA 1DLOB 1RT3A 1LWCB 5DGBA 3LP3A 4GMJB 2Z1GA 2XY7A 2WOMA 4Y2AA 5EWEA 3FQLA 2P1JA 3AV9A 4I7FB 2IM0A 1RBVA 3ALYA 4IDKB 4MFBB 4W5RA 3DYAA 1RNHA 3QZ7A 3H08A 4K4YA 1L3VA 5EUHA 4ELTA 3B6OA 3OYFA 2RPIA 4CHYA 3L2RA 3BREA 1RILA 3QEVA 4K8XA 3K5NA 3AVGA 1RT6B 1VSIA 4O0JA 1X1PA 1RBUA 4B9LA 3L8BA 3HM9A 2PZSA 4OLAA 2HWIA 1FKPA 3O3HA 4LSNB 4M3UA 3H5XA 1T94A 3MXJA 4FK0A 4Y2CA 4O44B 3OYGA 2IAJA 3V4IB 4TLRA 1IO2A 4IR9A 4E1MA 5CYMB 2HB5A 4IFVB 4TYAA 3SQ1A 4RW6A 1X9WA 3KJVB 3V1RA 3MEGB 4RW8A 5DLFA 3KNAA 4EBEA 1L3TA 2YNHB 2VA2A 2OPRB 4RNHA 5F8JA 3QLHA 2E6MA 3ZSRA 4NYNA 4KTZA 3MR6A 2YNFB 4URQU 5F8HA 2P5GA 4FJ8A 4J9LA 4KHNA 3TAMB 3CYMA 3EPIA 3ZSXA 3OYAA 4B8CA 5KFSA 4FZYA 1D9DA 1D1UA 5KFPA 3EPGA 1C2PA 4CJVA 4RUCA 4FW2A 4U7CA 1RT6A 1JLQB 4NLPA 1C1BA 3IRXB 1JXLA 4DTRA 2G8KA 4O3SA 4DSEA 3OYBA 3ISND 1REVB 1U04A 4IKFA 2FBXA 2KZZA 5KG2A 4KHRA 1J5OA 4CIGA 1Z4UA 2C2EA 4CIEA 1HQUA 4F4YA 1L5UA 4O4RA 3SNNA 4Q0BA 3V4IA 4CEQA 2W9BB 2AJQA 5CYMA 3I5BA 4MIAA 2FVCA 4O4GB 4CHOA 3LP0A 1KVAA 1S0OA 4PQUB 3MXMA 3M8SA 3RWUA 1S9EB 4M41A 2VG6A 1TV6B 2P5OA 1ZBFA 1WSIA 2YNFA 4NLQA 4MK9A 3VQDA 4E19A 4Z4IA 3OJUA 3BQ1A 3I5AA 2R8IA 2DTUA 3I0SA 2V4RA 4BDPA 2AU0A 2IS3A 1T05B 2QE5A 2KTQA 5KG5A 4CHPA 1NJXA 3JYTB 3NH0A 3L2UA 4O3NA 4ZVHA 2XGPA 3VQCA 3CDWA 1BI4B 2HW3A 3KMSA 3MECA 4ED6A 1RYRA 2G8VA 4FJ5A 2IM2A 3MEDA 1N5YA 3AO5A 2FVSA 4NLOA 3EZ5A 4JRPA 4LH5A 4CF0A 4WFYA 2FVQA 3NAEA 2IA6A 4OL8A 1J9AA 3ZSWA 4YR3A 3Q8SB 1TL1B 3TARA 2OPQB 4IG3B 3AO3A 3KTQA 2HHTA 5KFQA 4FBUA 2GV9A 2W9BA 2ATLA 1HMVA 2I5JA 4O4GA 3PUFA 4FLWA 4AHRA 2O4GA 4DU1A 3SYZA 3ZT3A 1ZYQA 3I5CA 2KZMA 2B43A 1ZBHA 1BIUA 4M3XA 2V4QA 4CK1A 3LZJA 1JLEB 4FJHA 1RBRA 3QEWA 2YV0X 4DTUA 3Q8QB 4KI4A 3FFIA 3KLGA 4FM0A 5KFRA 2HVIA 4J9MA 1T8EA 4QWEA 1TAQA 4CJ4A 4JS5A 4Z4GA 3TI0A 1HNIB 2XY8A 5D3GA 4FLVA 1RTDB 3SUNA 1JIHA 4TY9A 1S5JA 4HKQA 3JSMB 3KLFB 3N6NA 3AA4A 4KHWA 2D0CA 1HYSB 3QGHA 4AHCA 4FJIA 3KK3B 1K1QA 4J9QA 3O3GA 3V81B 3KK1A 4LH4A 5KFBA 4FLXA 3WNGA 1HNVB 3NH2A 5I42B 2BANA 4CHNA 1T03B 4Q43A 3TAPA 3KLHA 4R8UA 4WE1A 2OZMA 3DLGB 5C24B 4FLYA 2R8HA 4DSJA 1BHLA 5EU7A 2R2TA 4ZVGA 3FRZA 1RA7A 4DTPA 2IJNA 3GIIA 3G0ZA 1JLBA 1RT1A 1FK9A 3BSNA 2XC9A 2XY6A 3PW0A 1BCOA 3RRHA 4FK2A 4FJKA 4HCCA 4NZ0A 4O3RA 1MU2A 4OVLA 4HVJA 3BSCA 3HVTA 4CESA 2J6UA 4N56A 2R8JA 3SQ0A 4B9NA 4W5TA 2IC3A 3KD1E 3KK3A 4ZTJA 3UR0A 2YNIB 4ZVFA 4KHQA 2HNZB 5F9LA 3VQPA 2HNDA 2FVRA 1Q8IA 3MFHA 4KTWA 2QV6A 2AQ4A 4F4XA 3AVBA 1TP7A 3TABA 4DSFA 3C6TA 1S1XA 3NGZA 4CK3A 5KRTA 3OYIA 5J2NA 1NK9A 1X9MA 2R8GA 2D41A 2NUBA 3NKYA 1EKEA 4H4OB 3QIOA 3VQ7A 4B08A 3NBPB 1TK8A 3SFGA 2FBYA 2D5RA 5HBMB 5I3UA 3NF6A 3K2PA 3OVNA 1SV5A 1NK7A 3SUQA 3WNFA 1SL1A 4BE0A 1WAJA 4ZHRA 5C25B 2AGPA 1S1TB 3H59A 1QSLA 2F8TA 4DTOA 1MMLA 4EP4A 5KFYA 5L9XA 2PY5A 4R5PB 1Q9XA 1S6PB 1SKRA 4YP3A 1JKHA 4HYKA 5KFMA 2Z1IA 4GC6A 4DL4A 3NGIA 4OGCA 3BDPA 4K4ZA 4NCGB 2AWZA 2JEIA 3MAQA 2HMIB 1LW0B 4OGEA 3A2FA 2IOCA 2Q3SA 4F4KA 4EBDA 3ZSQA 3OSPA 3HVAA 3THVA 3G10A 1S4FA 4MKAA 4ED1A 2R8KA 3NBPA 3SV3A 5DQGA 3NDKA 3H5YA 1RYSA 4WZQA 3KHLA 4KHUA 2D3UA 3K5LA 3V6DB 1RA6A 2Z1JA 3PW2A 3DOKB 1ASUA 3CM5A 1NK5A 2BDPA 1IG9A 1L3SA 2XO7A 1S1VA 5HRPA 3KLIA 2V0NA 2QK9A 5KT6A 4E89A 5HRRA 3SI6A 3AVMA 4CJEA 3KLEA 5EDWA 4PUOB 1HYVA 4B3OA 4NLXA 5KTQA 4Q44A 1BGXT 3GYNA 1U48A 4IH5A 3PY8A 3UIQA 2KW4A 4ZP9A 2RKIA 2DPJA 2IGIA 3O3FA 3FQKA 4CEAA 2RF2A 4NCGA 1RT4A 4ED0A 5FRMA 4DTNA 4IQXA 3RMBA 3EZUA 1I6JA 2OPPA 3T5LA 3GIKA 4H4MA 3T1AA 3OYHA 1YTAA 4AHVA 5KI6A 5L1IA 1RT3B 3DRRA 4CEOA 2WOMB 2Y1JA 1KLMA 3HO1A 3H5UA 1VSHA 2X78A 1LAWA 3DYAB 2R2RA 4B8AB 1NKEA 4NLSA 5FDLA 4CJ3A 4CHQA 2DFFA 3RR8A 4DU4A 2DFEA 1GOAA 4QAGA 3VQ6A 3TAEA 3QZ8A 4KREA 2ZKUA 3OHBA 3K58A 2DY4A 3HPHA 3BSOA 2OH2A 3V9SA 2DPIA 1XR6A 3QEIA 2OYQA 3BR9A 1FKPB 2CJQA 3LWMA 1CZBA 4FJ9A 4JV1A 4BWMA 3VQ9A 1VSFA 2IMWP 4RUAA 3LDSA 1TKZA 3BGRA 3VN5A 2HHUA 4CJ5A 3ASMA 2BQ3A 3AA2A 4ECUA 2UVUA 2IAJB 3M8QA 3HVRA 4N47A 5KG3A 3KHHA 4GC7A 4RW6B 1NOZA 2VG7B 4CJPA 2FBVA 1FKOA 5T7BA 1WN7A 5JXSA 1KFDA 2HHXA 3U6FA 3QLHB 3AVKA 3RMCA 2JGUA 2YKMA 5F8LA 1SL2A 1S9GB 3PW5A 2XRIA 4JLHA 1EXQA 4IH6A 1RDBA 2E9TA 4CF1A 1TL3A 4NLYA 3QGGA 2RDJA 3OYKA 3EYZA 4F4WA 5DQHA 1SKSA 3GILA 1NK0A 1C1BB 4IRDA 3HP9A 1RTIA 2ASDA 4DTMA 3LAKA 4KB1A 3ZT0A 3O4NA 5F8GA 3KKRA 4CIFA 3DLBA 1J5OB 4E7LA 2UUTA 5FRNA 3HPOA 4CF2A 3L2VA 1HQUB 4CGJA 3ZT4A 3AVAA 1N6QA 1JLAA 1C0UA 4Q0BB 3G6VA 2IM1A 4J2DA 2G8HA 3AA3A 3ISNC 3S9HA 1JLGA 2VG7A 3LP0B 4KFBA 4QW8A 4ID5A 4BWJA 3DRPA 2J6TA 3K5OA 5HLFB 4K4TA 2BQUA 2WHOA 1S48A 2VG6B 1UA1A 4OPJA 3SQ2A 1C1AA 2OPSA 4K8ZA 3VA0A 1S9GA 1IKVA 2ZE2A 5KG0A 3HJFA 4Y34A 4TXSA 4TYBA 3SJJA 1C1CB 1ZBUA 3I0SB 1JLFA 1XHZA 1LW2A 3SUPA 1EX4A 1NHUA 4Q8EA 5KG7A 3OL8A 2D3ZA 2C2RA 5EWGA 1C6VA 3D5MA 1NHVA 4KKOA 4G1QA 4HUGA 4DF4A 3VQBA 2W8LA 3MECB 3IGNA 1VK0A 3MEDB 1N5YB 1NK8A 2XGQA 1VRUA 4F4ZA 1UWBA 1U47A 4CFCA 4W5OA 2GIRA 4BDYA 3SZ2A 1CXQA 3KOAA 2JEJA 1TK5A 1KFSA 3RBDA 3RAQA 4DTJA 3V6JA 5F9NA 4O3PA 4PA1A 3OYNA 1QAJA 4WYLA 3PZPA 1TK0A 5KFVA 4NRTA 5J2PA 4K4VA 4J2AA 1HMVB 2I5JB 2AGOA 1HPZA 2RN2A 4TN2A 3OYCA 4XIUA 3HKWA 3T19A 3ZSVA 5HLFA 3RMDA 3CO9A 3V9ZA 2WRMA 3DI6A 2ILYA 4B9UA 4NCBA 3FFIB 3KLGB 3C95A 1WSJA 4YFUA 1C1CA 3RMAA 4CJQA 5D3GB 1JL2A 1RDRA 1WNSA 5KFIA 4TSXA 3NFAA 1OS5A 1K6YA 4FJJA 4WZMA 1Q9YA 3KK1B 4M45A 5JS2A 2X6NA 4RZRA 1QHTA 1I39A 1NNDA 2BANB 3GIMA 3OL6A 4HCBA 5DK5A 2AGQA 3KLHB 3RB6A 4O0IA 3MEEA 4R8UB 3NL0A 3PR5B 4WE1B 4FJLA 4AHTA 4AILC 2DFHA 1ASVA 1VSDA 3LP2A 3V1QA 1VRTA 1UA0A 3PVXA 1ZTWA 2I1RA 1JLBB 1RT1B 1FK9B 2B6AA 2GIQA 4ZTFA 1B9DA 3OLAA 5L1KA 5HP1A 5KG6A 1QS4A 2JEFA 4KV8A 1MU2B 4ECQA 3SCXA 4M3ZA 3OL9A 2FC0A 4CEBA 3QETA 1DTQA 3HVTB 5KFWA 3H40A 4FJXA 2UVWA 5KFGA 3AVIA 1IM4A 4EO8A 3NMAA 2F8EX 3RTVA 2IC3B 1TKDA 1GX5A 1FXXA 3OYEA 3U3GA 1RT5B 2HNDB 4KTQA 3VQSA 2HNYA 2UVVA 4H8KA 1QE1B 5KRSA 3OYJA 4HUEA 4FJMA 2ZQBA 2BE2B 4IG0A 3LP1A 2XCAA 3LAMA 3VQQA 3OYDA 3TAFA 1LAVA 3C6TB 3ICLA 1S1XB 4NLWA 4TY8B 1C0MA 5J2NB 3PHEA 4OKJA 1CXUA 1SKWA 3CDEA 4DFJA 1JLCA 2W7PA 5KG1A 1JXBA 3CG7A 4IH7A 1GOBA 1RT2A 4RW4A 4X2BA 3DRSA 5I3UB 3I0RA 1S97A 3AO2A 3G86A 1D5AA 3KMQA 1SV5B 3HP6A 1T3NA 5C42A 3L2QA 3T5JA 3HYFA 4ZHRB 2HWHA 1WAFA 1NJWA 3TWHA 3P1GA 4XPCA 2UUWA 1WNEA 4CHZA 1X9SA 2RDIA 4GVMA 4LY7A 4L8RB 4J9KA 2YKNA 4DQQA 3NAHA 1RT5A 2WK4A 1JKHB 3CJ5A 4ZP8A 1QE1A 2W7OA 1A5VA 3NF8A 3C6UA 2YNGA 1W25A 2BE2A 4HUFA 4DLGA 4Z4FA 3QIDA 2IDOA 4DL2A 4TY8A 1A5XA 2AX1A 4DWIA 4ZPAA 4DTXA 1KRPA 4CJKA 5J2MA 1JX4A 3PV8A 4O3OA 4DS5A 3NCIA 5CZ2A 2A1SA 1VSEA 1XHXA 4CGHA 3OLBA 4NRUA 5KFKA 3EY1A 1HQEA 3H4BA 3IN5A 5KFAA 3SI8A 3QERA 3H98A 4NLVA 4E0DA 4OLBA 3BQ0A 1I3AA 3AA5X 1W9HA
chains in the Genus database with same CATH superfamily
3GCXP 2VDIA 4FYYB 4XTTA 3CQYA 4LF5J 3BYPA 5KFNA 1CJTB 4MIBA 5HK4A 3ITHA 4FM1A 1FFSB 4B3OB 2ZF5O 2E44A 5IZHA 3UN2A 1Y97A 4CLSA 4FYWB 4GO5X 5B0GA 3THYA 4MK8A 3THWB 1NOYA 4LFAK 3NE6A 1RT4B 4WFBQ 4JKGA 4LF8F 2EK1A 1O13A 1DEJA 4KSEB 5KFDA 2EKYA 2DR6A 2XLIA 1VQPS 4MQ3A 4K4XA 2CQ1A 4JP8A 4H4MB 5M1FA 5ETLA 4QCLA 5HL7L 2LDYA 4UY85 4BVOA 1KLMB 2DXDA 3V6KA 3CC7S 2QSFA 3JAMU 2P9PB 2H4WB 2PFDA 4DV0K 1YGYA 2Y8WA 5H9EJ 1C4AA 5SZTA 1N32K 2CA9A 2P9KB 2X74A 3QEXA 5HROA 4CO4A 2IRYA 3R3TA 3W5YA 4I2PA 3MR3A 4IQMA 2W9AA 5HANA 2HG4A 4K25A 1LFWA 1AUDA 5GAHI 3HT3A 3P4UB 5JLFA 1R0AA 4NXMK 3CVKA 3V4MA 4USVA 3Q8YA 2CQ3A 2BR0A 1XR5A 1U09A 2OTLN 3W2WB 4I2QA 1U2CA 2E6LA 3M9OB 2YKMB 2ZJPQ 2R2SA 2B5JA 4OI2A 4NLTA 4P71A 5DMRA 2C3MA 1RKJA 2BA9A 4F67A 2IYIA 4WFXA 4DFKA 3QYYA 4M3WA 4UUXA 4UZBA 1KCFA 1UVNA 4ES1A 5HJYA 4XPEA 4AD6A 2EKNA 3B6PA 2D7SA 5KT4A 2UU9K 3DMJA 4P10A 1JJ4A 3BDEA 1VHFA 3HHNB 3ZX3A 1RTIB 4IOAQ 4DL6A 2NZTA 1W2BM 3QO9B 4KRFA 1C0TA 1Y3KA 1K0VA 3LPYA 2XZDB 1E6YA 3RB0A 3ZZ0A 1NK6A 4PXCA 2DK2A 1R6YA 2QXFA 4CEDA 1SJFA 4H0YB 2MDAA 1JLAB 3JAMY 3TR5A 2OO4A 1BA1A 2O5DA 1S0NA 4OV6A 4KFBB 4ID5B 2WB4A 4LSLA 2DEIA 3VTHA 4U67Q 1CZAN 4C6AA 4BR9A 3T3FA 5D4NA 4K4SA 2CWKA 3CCVS 1E6VA 4MK7A 3VF4A 3V9UA 5KT2A 1S1WB 3M8YA 3OBYA 3PIOL 1C0GA 3CXCR 4I4BA 3D2WA 1EZZB 1U7LA 3M2VB 3R8YA 2VPXB 5DG8A 3JSYA 4ITSA 4E7HA 4X66F 2B8QA 1RJJA 1LCUA 3IFEA 5A6WA 5LM7E 4H0XB 2Q79A 4B3RK 1WB9A 3RAXA 1RLCL 2AEFA 5KFLA 5J1NA 2Q3PA 4I1TA 4N5SA 2VWKA 1OY6A 3J80U 3VTIA 4B3MK 3H3NO 2BJ8A 4YNQA 5IT9Y 5AXNA 3OJSA 1TKXA 4P73A 2QA4N 1VDHA 2KM8C 3RB3A 3T5KA 2MZRA 3M6VA 3DM2A 2OD4A 3O4WA 2MTLA 4KBOA 3I8DA 5JVGL 4H4KA 1QY7A 2GUIA 3BUZB 1DTTA 4WJBA 3VENA 1QDUB 4BRAA 3T6BA 2ZD1A 2ZEJA 1Y64A 4GV9A 3DI6B 5M1QA 2QWOA 4O55A 5B0DA 3HK2A 3K0SA 4B1VA 3PW7A 4OPAA 4KB0A 4ISFA 3NF7A 3KHGA 1HNZK 4FKYA 2XCPA 1UPMB 2NPFA 3TA1A 1O5JA 1R8BA 3SBMA 3WBZA 5HMWA 3OY9A 2K7JA 5K20B 5MLCV 5EY4A 3WNHA 5FROA 2CUYA 3CIZA 2UUBF 3LP2B 1FF2A 3FBBA 3GMGA 4U6PA 2MQLA 2UZAA 3L95X 2E1MC 5MLCQ 1QSYA 3DCAA 4LSNA 2HAIA 2B6AB 1RDCA 4EO6A 4CEFA 1X31C 2MQOA 4KHSA 1V3SA 4AH9A 2KKHA 2W41A 2BE9B 2VL1A 2IM3A 1JWWA 4IFVA 1RDDA 1RDAA 3UE5A 3J80Y 3MX2A 3R5JB 3P5JA 5AQHA 4P9SA 3FZ2A 3DN9A 4BDZA 1NDCA 1VQ9N 3AVJA 5L1LA 1S3XA 2GJ2A 3H2LA 4MH8A 3CJ2A 1EO1A 1GOCA 5C10A 2A6MA 3NVMA 1KQFB 4ECXA 4AQYJ 5BR8F 1UKUA 4X65F 2H51B 4LF7J 2B9EA 1G15A 2FJWA 2B4JA 1Z26A 4NLDA 1VYAA 3QFHA 3VZHA 1CQNA 4DMNA 3UD5A 3QINA 3SUOA 1SBRA 1JLCB 4HDGA 5K14B 3G6ES 2PD1A 5BN8A 3CQ8A 5D78A 2MQNA 5KQ8A 3UKUA 4IEIA 1RT2B 2JH3A 3DRSB 4CLLA 2DNMA 5M1NA 3VAFA 4DR3F 1GTHA 2JVOA 4WFBL 4OPKA 1QQOA 5F0WA 4CECA 3D0GE 3U4LA 2B3TB 1JQGA 3A8JA 2MKIA 1TV6A 4DI6A 2KHCA 1G1XA 4R0EA 4ELUA 2OIHA 3LWLA 4FZZA 3Q89A 2W6LA 3F44A 2GQ2A 2Z0GA 1RBTA 2VASA 2LQ9A 1W2IA 3O3LA 3R1XA 2L9DA 2NPIA 2AYGA 5GAEP 4W5QA 3V9WA 3TUIC 4IFYA 1KHWA 1X0PA 4IOBA 4AHUA 5D15A 2EFVA 1VBYA 3JYTA 3QGIA 1RZMA 2PI4A 4FWNA 2CQ4A 2FSJA 4DV2K 2GTDA 4QJVA 3WHIA 2GJFA 1YT3A 1VQON 2R2UA 5GAGU 1X4BA 4JD2A 2VKRA 2MPUA 1KVKA 2DGTA 4HACA 1IBMF 4W4MA 4EMDA 2CQCA 1NGBA 4TU9A 3AOAA 2PEBA 3OFGA 1WSGA 1IBLK 2IJRA 1NSPA 2Q43A 3ZSOA 1OPZA 4DUZF 4DR1K 2XY5A 1YIJN 2KM8B 3G8TA 4WK3A 3O9RA 2A42A 3ITHB 4C23A 1JLEA 4P52A 2ZBQA 1XNRF 3PO4A 4F26A 1NJIO 4K4UA 4LF9K 4Q8FA 3AQPA 1EETA 3AY9A 1OH8A 1GLJO 1XERA 4RNMA 3THYB 2QKKA 2AJ4A 3CD7A 3ZZYA 4JKGB 3JSMA 2I6WA 1VHXA 2DR9A 4BRNA 3DLRA 1VBKA 1TGOA 4UQGA 3PIPQ 5KGXA 2BJDA 5AQMA 4KIAA 4FK4A 1YRXA 3B8HA 3RBEA 1DHMA 1V4SA 3EKSA 3MUTP 3HJVA 3AO4A 3FDSA 4Z4CA 3HKZD 4DPWA 4IOAL 2CDRB 3RJMB 4TU8A 2XMAA 3VA3A 3T1YF 4V1Ak 1S9FA 2A3ZA 1YLXA 1VQKS 4RBVA 4M5DA 3K57A 2BRLA 3M8RA 4HTUA 4Z37A 5L46A 4A8MP 4J90A 1VC0A 2FDNA 2VQFJ 4ZIWA 5HROB 1OSDA 1OWXA 4U67L 4OZLA 4A5BA 4EBCA 3CO0P 1ZA2B 3JS9A 4CLKA 1S0MA 4CLZA 4I2PB 2QXLA 2HLTA 2UXCK 2HIYA 3HHLA 2EC0A 4Y1DA 1P90A 3HRGA 3WXKA 4LR8A 5C5JA 2D4WA 1YJUA 4YOXA 1RT7B 4KGVB 4O3QA 4EEYA 3SAHA 1R0AB 2NR0A 2HQCA 4M3TA 2XSJA 1LQ9A 4GVLA 5KFOA 3BO4A 4IBNA 4I2QB 2QL9B 1PC5A 3M9MB 5CXTA 1QQNA 2RJZA 4DKWA 1RCHA 3HULA 2C28A 2GVZB 1HBMA 2B5JB 2PBDA 2J9CA 3QESA 1XC3A 1YZ6A 3D45A 4U7UK 4LFCF 3ZSYA 3QWPA 1PKUA 3VWSA 3OV7A 3ZEUA 1JNRB 4CGIA 2CJXB 3GTYX 2G8FA 1MMNA 2H5JB 2YCHA 4M5HA 3M5RA 2OA8A 2E9RX 2MHNA 4CZIA 5G0RB 1C0TB 1X0FA 5GVQA 1AUSL 3MXHP 2UUAF 4OHZA 4A8QA 1E6YB 2OI2A 1BWEA 1S1TA 4WYBA 4YY3K 4JEPA 4CJWA 5EX3A 4CGGA 3MMCA 3G8SA 4IRCA 2JX2A 3QB0A 3GIJA 3B8AX 1WHXA 3A5NC 1BCMA 3IAYA 5D8HB 1HR0J 3D6HB 1E6VB 1WTFA 4PG7A 3RUBL 2ASJA 3NCRA 3VEXA 4KBIA 1YVFA 1LW0A 4B9TA 1HI1A 5HRNA 3GE1A 3CJ9A 2OHDA 5HO4A 1J53A 1BISA 4YDXA 4OIXA 4Y0WA 4JI4F 3D6RA 4DV3K 4LF4J 3AA9A 2DBBA 2ADCA 2QLFB 2DVIA 3R9LA 4IEEA 4YB7A 3MUMP 3G9CA 2JC1A 2PFFB 1Q81T 2X7IA 3PO5A 1FVQA 2ITGA 2ZH6A 5AT1B 1KTVA 2ACMA 3CFOA 1REGX 2V6AA 1TKXB 1N52B 3CULA 1XR7A 2VQFK 3OXFA 2VGMA 2QTDA 3DM2B 4PUOA 3MCAB 2QI2A 2XYGB 2C3PA 1WDTA 3KKFA 3QMQA 4KQZA 6FD1A 1TAUA 3BBCA 3D66A 1DTTB 2ZBCA 4CNYA 5HI7A 2OELA 5HVFA 2ZD1B 2FLPA 2V2VA 3P49B 1UAXA 3VOVA 4M1KA 5F3ZA 1NRKA 4FZVA 2DNHA 5LMNK 4FS2A 4LF8J 1LWXA 3CD6S 1G99A 4KHPF 4DQIA 4RW8B 1NB7A 5M1KA 3KHYA 5F8MA 1QJHA 1S6UA 1RT3A 3BF1A 2WOMA 2QZ8A 2BJ1A 2C2NA 3ENWA 2DNPA 2EPIA 4NZ7A 1KQSR 2KXFA 3EMTA 1RNHA 1N36K 1FTRA 1L3VA 3LH2S 2J8AA 4LUBA 2P9LA 3M8WA 2R4FA 4F7VA 2CXEA 2HF3A 4O0JA 3PNIA 4A57A 2VBXA 3MN6A 4NPOA 4DZ6A 3EL2A 3U1NA 4LSNB 3H5XA 1T94A 3O08A 2NYHA 2KB2A 5F41A 4RTFD 5E84A 2FHKA 2YY3A 3OYGA 1BUPA 1XNQK 1MROA 1S5ZA 3AAPA 2QX0A 4IFVB 5D0EA 3S1TA 1F9FA 1DQ9A 3JSRA 2R3VA 1YI2S 4EBEA 3DHXA 2GW8A 2ZH7A 3ZZZA 3KUHA 2XULA 2E6MA 1TTHB 3NS6A 3VGTA 2YNFB 4URQU 4J9LA 1HNWF 5AQNA 2CPDA 4EK2A 1ATNA 4B8CA 5KFPA 1VQ5N 2GHWA 2RUGA 4MYTA 3THPA 3OHRA 3GG4A 4FWPA 4U7CA 4BS2A 3HD2A 4C98A 4CM0A 1GLAG 3VVTA 3I8BA 4DTRA 4O3SA 3IXQA 2KT3A 2FHJA 2H3GX 4C0BA 2NRZA 1U25A 5I9EB 2FBXA 1Q7YT 3KVGA 1ULRA 2K3KA 3UKUB 4CIGA 1FDBA 2AEJA 2DH8A 3AGRA 3R3LA 3D7EO 1L5UA 3GFHA 5EX0A 1RCOB 3CC2S 5CYMA 2I7PA 2FVCA 4O4GB 1EKSA 4PPZA 1RHMB 4FP9A 3MXMA 2BW2A 1F9EB 3RWUA 3PIPL 2VG6A 1TV6B 3TEHB 4OZ5A 2FIUA 5KOXA 4RBUA 3CPEA 2PI5A 5IV3A 2VPYB 3VAIA 2LP4A 4JI0K 2CPIA 4QIWD 4BDPA 2IS3A 2QE5A 3UCUP 5KG5A 2HVZA 3JYTB 3UNGC 4X66J 4JI2K 3MR7A 4O3NA 2XGPA 4PAAA 2HW3A 3MECA 4ED6A 4CZCA 1QLNA 4N8OA 4LH5A 4JD2B 4WFYA 4CF0A 3NAEA 1Q7YO 1HNXK 4OL8A 4HACB 4IWVA 3KNGA 4JHDA 1P27B 3MI7X 2ZH2A 2W2MP 2RS2A 4FBUA 2YQ0A 3SQOP 2FXUA 3ZT3A 2YJEA 4JI5F 3ZTRA 4DUYF 3FGUA 3MTJA 3EUNA 4CK1A 3J81O 4CZKA 1JLEB 3QRQA 3ET6A 5KPZA 4DTUA 3Q8QB 2IVMA 2IDLA 2HVIA 5LXYA 4FL9A 2AHOB 5D3GA 1RISA 2CJ9A 3JSMB 3AA4A 4FWKA 2D0CA 3CI5A 3I31A 3QGHA 3W5ZA 3KK3B 4J9QA 2ZDPA 4BRFA 3CMEN 1TELA 1R8AA 1UJ5A 5KAKA 1WKJA 5KFBA 4XDCA 4FLXA 2DRAA 1NPKA 5AQJA 1RUSA 3NH2A 3OBWA 3WQPA 2HS4A 3WDOA 4Q43A 2E2NA 2R7WA 3HMJG 1AT1B 2DO4A 4JAXA 2OZMA 1BHLA 4YB1P 2R2TA 4M5DB 2UUBJ 1LK7A 2AEMA 5T7LB 1T95A 2ZVIA 2MLXA 4DTPA 3E3XA 1APSA 5BPLA 1N34K 1FK9A 1NGGA 2XC9A 5CABA 1RBAA 1E4FT 4IFEA 1H72C 4WCEQ 1NPPA 1MU2A 1EKRA 1HIYA 3HHLB 3HVTA 5BRHA 3JB9k 2YHYA 4CESA 2HAFA 1FDNA 1RWMB 4N56A 1GMWD 2FHOB 3BP8A 2MQ8A 4B9NA 1NSQA 2HEKA 3FZHA 4FOEA 3G4SN 3KD1E 3UDCA 2CJBA 4J9UE 5CQGA 4KHQA 4X4RA 3VQPA 2HNDA 2XSJB 2AQ4A 1HKCA 3TABA 1PYTA 5BR8J 1Q8BA 1HBMB 4X65J 1G3OA 4CK3A 5M2PA 1SC4B 1X9MA 2VF3A 4BRKA 2G4BA 3E9LA 1VR6A 2F9DA 2IVNA 3ZEUB 1FFWB 5E0OA 1ELOA 5BRFA 2G2OA 1TK8A 1NLVA 2I7NA 3SFGA 2FBYA 4OX9K 3M05A 2D5RA 4ZPWR 1DURA 1Z05A 2P5VA 1NK7A 1SL1A 1WI8A 2GEMA 1FDDA 4OYMA 4BE0A 4DXLA 2O8EA 3C0BA 1S1TB 3H59A 4DR3J 2F8TA 4GKJK 1NM2A 1GXUA 2U1AA 3MUVP 1S4EA 3MMCB 5LSOA 4O5FA 3WQUA 2BUPA 4YP3A 1JKHA 1K73T 2PEHA 2GAHC 1S77D 2J0SD 3MAQA 3AD7C 5DZ6A 1LW0B 4OGEA 3D1OA 2IOCA 4CO3A 2CQ0A 1CJVA 3OSPA 2LQ8A 3THVA 3G10A 4B3SF 2CNKB 4MKAA 3NMRA 3NBPA 4ZCKA 3ZX0A 3NDKA 1NB2A 4EU0A 1RYSA 4WZQA 3K5LA 1IV0A 3SXLA 4F0KA 4CI0B 4LRFA 3D6TB 1IBMJ 1RBOB 3PW2A 5KQDA 2M70A 2UXBK 1ASUA 4H5WA 4NA2A 2BDPA 1PILA 2DHXA 4FF3A 4P2XA 3VEVA 4XH5A 4E89A 4DUZJ 3SI6A 4DR5F 4CJEA 3KLEA 2O8DA 2KYXA 1NGJA 4PUOB 1S72N 1MN9A 4NLXA 4PXDA 3GYNA 4K5SA 4P7TA 4IH5A 1XNRJ 4ZP9A 2KU7A 1RWOB 2DPJA 2WC9A 4CEAA 1K73O 4NCGA 1XEZA 1JXVA 2GCFA 2YWFA 3RMBA 1U26A 4ZIVA 1I6JA 2OD6A 3M1VA 1PG5B 3DKDA 2V63A 3HOSA 1YTAA 4NA1A 1RT3B 1I51B 1RABB 1ZM9A 5K5MA 4ES3A 2WOMB 3H5UA 2X3DA 3B6BA 2CQBA 1LAWA 2ITMA 2VODA 5GAEU 4NLSA 4CJ3A 2DNRA 4DU4A 3T1YJ 2P9LB 3QBXA 3TAEA 3PYEA 2WZ1A 4KREA 4RUHA 4BG9A 2FZCB 5LMUF 3K58A 3BSOA 1OVQA 3D2FA 2OH2A 2DPIA 4BR0A 4NYOA 4CH1A 1MWZA 1T11A 2ZWOA 4FVCA 2HSEB 4BWMA 4ILJA 3AB2B 1YF5L 3TZWA 2IMWP 4RUAA 4OYPA 3LDSA 3BGRA 2HHUA 3CW2C 2BQ3A 3AA2A 2A3JA 4HR2A 1MROB 5KG3A 2GUPA 1NOZA 4CJPA 2PSZA 1FKOA 2BKNA 2QMUB 2RIJA 4ENOA 3C6HA 5KPTA 1XBWA 2WFBA 5L8RC 4OZ2A 1ICEB 1SL2A 4OV1A 2DHGA 3A12A 1KNZA 2XRIA 3T1HK 4JLHA 1CS4A 3EE9A 3J81U 2YH0A 5EOYA 1VK3A 4IH6A 1Q82T 3WEEA 5FD1A 1GMWA 4CD1A 2R42A 1FNMA 1AYEA 4LFCJ 3ENBA 1BDGA 1NK0A 4RU2A 3BO2A 4FF4A 1HX1A 4KB1A 3P38A 1Q53A 4L75A 3ZT0A 5F8GA 3PSFA 1WJ9A 2Y9HA 4X64K 4K0KK 4LFBF 2JRSA 1B70B 4E7LA 4G9ZA 3H0PA 3JXUA 2JOQA 2M8HA 3U9DA 2UUAJ 3AVAA 3IBFB 1NWKA 3MHYA 1FRJA 4J2DA 3E9OA 1VQ7N 1RAOA 3K0JA 1JLGA 2P9NA 1M5OC 5GMKa 1U24A 4EI2A 3GG1A 3DRPA 2J6TA 4K4TA 2WHOA 2VG6B 1UA1A 2C2ZB 4LF1A 3SQ2A 2OPSA 4I56A 4USJC 1IKVA 4UY8T 5HQMA 4DR7F 2O1PA 5D77A 1HWLA 3FSYA 2YPZA 2HGLA 2L9WA 1Q82O 1XHZA 1XQSC 4QIGA 1PJ5A 1OIAA 3MD1A 1WORA 2XQCA 2IVYA 1TUWA 2QFIA 1C6VA 3D5MA 4C4WA 1Q95G 4JI4J 3IWLA 4KKOA 3HT0A 1U02A 4DF4A 3MECB 1FEEA 1VRUA 1SS6A 3ZZRA 4W5OA 4D3HA 3J7YP 2N4DA 4WCEL 2RS8A 2QLJB 3AD9C 3RBDA 2YHXA 4DTJA 4JHDB 4CH0S 3J81Y 5F9NA 3W62A 2M8DB 1QAJA 4DR4F 1TK0A 2FF6A 4Z7YA 1AZSA 2RN2A 1GNKA 1Q1KA 3HKWA 4HHHA 3FZKA 4DHYA 3R1LA 1RBLA 1SJRA 3GONA 1V5IB 5K8PA 2IDEA 1WKKA 4OO1J 3W9JA 4TU7A 3ET6B 4NCBA 2A10A 1VQLN 2WW8A 4UY8O 2O8CA 3UNYA 2WVCA 1N54B 1C1CA 3CCLS 5D3GB 4CJQA 1ESVA 1RDRA 1WNSA 1JJ2R 2D0OA 5KFIA 4KHPJ 4OX6A 3BZQA 1OS5A 1UFKA 2QWMA 2XMUA 1CPZA 1IR0A 3NEKA 4ETZA 4FPAA 4RZRA 2AYEA 1V5VA 1I39A 1NNDA 1AW0A 3O80A 4B1YB 3OL6A 2IMOA 4FJLA 4AHTA 4AILC 1TFWA 2CQPA 2GS8A 1H2UX 3PVXA 4ILGB 3TSPA 3CCJN 2R7OA 2GIQA 1FK9B 4ZTFA 2YBVA 1XTZA 1MU2B 2YPYA 2K8GA 1GLCG 2JL9A 1WACA 4OJ3A 1DTQA 1BQXA 3HVTB 3FK4A 1R31A 2ZM6F 3ZTQA 3AVIA 3R6LB 3VGMA 2QA4G 2F8EX 4JI6K 1FXXA 4WU2A 3OYEA 3C2PA 2HNDB 2AP6A 4OJGA 4QIVA 4N7TA 1HBUA 4WTOB 1R8PA 1HNWJ 2ZQBA 2BE2B 2BUNA 3LP1A 1XN9A 1LAVA 1CBKA 1C0MA 2EVZA 4B1ZA 5AQUA 3OW2R 1YJ7A 3C19A 5KOWA 3CDEA 4DFJA 1PGZA 4DBQA 2Q0RA 5KG1A 2E1RA 1GOBA 1K0TA 3UE2A 4RW4A 4X2BA 4DCOB 5BYSA 2MXYA 3GJSB 3G86A 1D5AA 3HP6A 1BO5O 5C42A 3U27A 2PMWA 4U96A 2EG1A 3IFRA 3CIPA 2Q36A 1WAFA 3SCKE 1Y4ZB 5F3TA 5H9FK 3MCOA 3L4QA 1GAOA 4GVMA 1UMJA 1URNA 4DQQA 3ETOA 1YBUA 2QL5B 3DLLQ 1JKHB 3GG0A 2W7OA 4ED4A 1A5VA 1KDNA 3CSKA 2YNGA 1W25A 1NH7A 4HUFA 4DLGA 2JJ4D 1IXKA 2CADA 2MYFA 4TY8A 1A5XA 4DWIA 3W3SA 1CJVB 4DTXA 3VF6A 2B4PA 1UCNA 1AB8A 3CMAN 4H5TA 3I87A 1V3RA 1JX4A 2MZQA 4U7UD 4O3OA 3NCIA 1LK5A 1T6DA 2QA4S 3CC4N 4QYZK 4CGHA 2UUCK 4NLBA 5KFKA 3EY1A 2C2KB 3SI8A 4NLVA 4E0DA 4OLBA 2RUSA 1YJWN 4RL1A 5LT5A 4RNOA 2G8UA 1K9MT 4I9LA 2B8PA 1SUQA 1EQYA 3TUZC 3OR2A 3KLEB 4O0NA 3KIOA 4JI5J 2HBJA 4DUYJ 1MN7A 1OO0B 1OY9A 4BE2A 2HZAA 3OFEA 3OT9A 4NYFA 1VBZA 3OYMA 3W64A 3I55N 3T9ZA 2MKHA 1QUVA 5E3QA 3EDRB 3O5TB 1HJRA 3KJQB 1S79A 1S7HA 2D1CA 3Q8PB 2BZ2A 1GXTA 2C2OB 5A2QU 4YDDB 4K4WA 1BWVA 3LA0A 3P83D 1T9WA 3DLKA 2LSNA 4FYDA 2HHWA 3JQJA 2ZFHA 1K8KA 3O5BA 2FJVA 4BR7A 4RCHA 2MY8A 4CJ7A 1VSLA 2RQKA 3GV7B 1RE1B 4ED3A 2D1KA 3BKTA 1K9MO 3PX4A 4CZHA 3D2FB 1LWFA 2CYYA 3DLEA 4ILHA 1M0SA 3NS5A 3IDHA 3K59A 4CF9A 2DRDA 1TMMA 4X62K 3R6MA 2P9UA 1LV5A 4CCHA 1C4CA 3BGRB 1ZBTA 3THTA 3ZZOA 2FVPA 1U45A 3MR2A 3M8PA 2IBKA 2J0WA 1VBXA 4LVOP 4WP8A 2XS5A 1FKOB 3RG6A 4LJMA 3SMPA 4OKEA 2EFQA 3EVMA 1C0FA 2QYCA 3QIPA 4A8KA 4M94A 2GC8A 1CS4B 3ZO7A 3IMXA 4DS4A 2HWTA 4J5OA 3NHGA 2BJ7A 3CJCA 3CJ4A 1OQ3A 4CT8A 3WEEB 3HF5A 3NH1A 4BLGA 1UEKA 1WWHA 2QTWA 1IKXA 4DX8H 1UVLA 4D3GA 1VC6A 5GAEI 2DY9A 3PYDA 3CD5A 5AQFA 3VGSA 1IBKF 5J2QA 2ZH1A 4WP9A 5LJWA 3QNNA 2J9DA 1FWLA 2XO6A 4HHTA 2ATQA 4LR9A 1TYQB 2YHAA 4AHSA 4M7YA 3GV8B 2SXLA 3IWNC 1U1MA 1K47A 1JLGB 2P9NB 1NJZA 4L73A 4TLQA 3DRPB 4ID1A 3OVBA 4ZA1A 3SMZA 4X4SA 3R2CJ 2OPSB 2GHPA 1I5OB 2EX3A 1IKVB 3Q2SC 3MXIA 3DOLA 3LANA 4OMFG 2DNKA 3UKRA 2IJFA 2PYLA 1O8BA 1VQOS 4CBUA 3ENQA 1ZPWX 4NOHA 4MDAA 1D9AA 4ZK7M 2W9CA 3QJJA 1TU0B 3VERA 5AJ3K 3OTBA 4B3SJ 1UEUA 4KKOB 3LW5C 3GYGA 3KK2A 3X1LB 3WT0A 3GZ7A 1VRUB 1ACMB 2F4VK 3TQ1A 2PDAA 1YIJS 5JUMA 3PM9A 1K8AT 2ZBIA 2V2QA 2FGCA 1GLFO 2F8SA 1HHTP 2UV8A 4DPYA 1RTHA 1JCGA 4QIFA 5CZ1A 3VQ8A 4J9VA 5DG9A 3A3NB 4DR5J 3CM6A 1FT8A 4CJUA 1H2VZ 4ICLA 4OYOA 3UD4P 2QSWA 1Y5LB 4HTLA 1KVBA 1YTYA 3CT9A 2A0FB 1BXNA 4PKGA 1VQ4N 4W5NA 2O8CB 1LWEA 1MSWD 3E8OA 5HOOA 5IM0B 3DOMA 1FNXH 2V9WA 1BQMA 1FHTA 4XH1A 1HPMA 1DLOA 4N76A 5ETMA 1LWCA 2W8KA 2A2DA 3V2UC 2KJVA 4I7FA 1KSPA 2F96A 4MFBA 5ETKA 1M1GA 2YX1A 2EWHA 1TZ0A 4KGZB 1KKHA 1ASWA 5JS1A 3P4IA 3IBCB 1B99A 2Z2ZA 1BY9A 3US5A 1Y10A 2HHHK 3FBCA 2P9GA 4TQRA 3HSTB 3ADAC 3HSZA 4BR2A 4C8MA 4YB6A 5KFHA 1T02A 5LMUJ 2QN6B 4I9QA 4ERDA 5TKYA 1IN0A 2WUSA 1RTJA 3CFRA 1SIZA 3BR8A 2ZH5A 1EJ7L 5CA5A 3DLLL 4DHVA 3DDIA 4WXOA 2BTFA 5FPMA 1Z1ZA 1ZAVA 1DTQB 2P51A 3K89A 2EW9A 3VALA 5FJ4A 3MEGA 4WQ5A 1OH6A 1QVFR 1FJ7A 1WD6A 2HBRB 4DLEA 3GSIA 3SPYA 5CR4A 4IO8A 1RI7A 1NSAA 3HXMA 1NSKL 5BN9A 2HQDA 4DV6F 1HBUB 3D0HE 2FC8A 5EWFA 2JLGA 1XC9A 5DM6Q 2V4JB 3FZLA 1S59A 4DL3A 3LP1B 2Q1LA 3ZLJA 2FYXA 2BX6A 3BV8A 1JLQA 3GSDA 3VCDA 5AXKA 1HRHA 3UVJA 2HFZA 4JUZA 2CPHA 3JSBA 1REVA 4OQJA 2DHAA 2K06A 2MMYA 2VFSA 4U95A 2ZWHA 4RW4B 2J4RA 1BIZA 1KTQA 3ILIA 3S3NA 3TUPA 4LFBJ 2OZSA 4A8WA 1F21A 2E7WA 5C42B 2FHMA 2I38A 2H54B 3A8KA 2XS7A 1S12A 1HD1A 2VGNA 4Y3CA 1N56A 5KFUA 3MM8A 4NXNK 4NEZA 4DMZA 2XWYA 3CETA 3NS7B 1IJEB 3K8VA 3AGKA 4WFAQ 1VCTA 2G0IA 1ZTTA 3CHWA 3PDNA 1FXRA 5E7OB 4YB5A 2PYJA 1RHKB 3O6QA 4RJVA 4DR7J 3WXJA 2YNGB 3KLVA 2PC6A 1G7CB 1RAEB 1F0XA 2PA3A 2M88A 2LVWA 3HHKA 4NLUA 2XI2A 1D9FA 1NBWA 4PZVA 1M1KT 1EHWA 1FJGK 3Q22A 1X4AA 1WOOA 1XIQA 4ECZA 4FJ7A 4RNNA 4LIRA 3G87A 2HFNA 2KI2A 5ETVA 4DV1F 2JC0A 3GV5B 1RHQB 1TL1A 8RUCA 3EWGA 2OPQA 4IG3A 4IOXA 3TVKA 3QSIA 1QUPA 4DR4J 3A1YG 1NM1A 2G8WA 3SLCA 3G2XA 1SUQB 1CZ9A 3OR2B 1ITGA 2IYGA 3BEXA 5LJVA 1B92A 4DSKA 3PFOA 2HIQA 3ZSZA 1S1UA 4ID8A 3VQAA 2CDQA 4KYZA 3EGVA 1WSFA 1HNIA 1RTDA 1RBSA 4ZLJA 3MM7A 3FSIA 5AQVA 3K7RA 1N4LA 1HYSA 1YDLA 1L3UA 3AODA 3DXBA 4M95A 5AE1A 4FVMA 4M3YA 4U8VA 4XEIA 1CC7A 4FWQA 5KGWA 2BXJA 3MPDA 4YDUC 4NMLA 1T03A 3CUNA 4HI1A 3DLKB 1P1TA 4WYWA 2WVFA 2E2QA 4H54A 3DLGA 4JI1K 5C24A 4L6V3 3W2VA 2HBKA 1K8KB 4ED7A 2HHVA 4GRSA 1IR2A 3H3OB 3ILLA 1J5EK 3MWTA 1HHSA 4J7CA 1VJWA 4URGA 4CP5A 2DISA 2M9KA 1LWFB 3AO1A 1OJ4A 3DLEB 2GFFA 1YTUA 2BMBA 3J7YU 3MF5A 2P9UB 3DNCA 3IRWP 4C8KA 4WQ5C 3A5MC 2ZM6J 2FJXA 3CJSA 4JYAF 3M8PB 3V5RA 2G8IA 4LQ9A 3LDOA 2YNIA 2D74B 4FBTA 1X4GA 1VQ5S 2E1ZA 2G0CA 4FM2A 2HFOA 4Z0UA 2FZGB 3QIPB 5GMDA 4XK8C 2AX0A 4LF6K 2IPOB 3L7UA 3CERA 3VVUA 2NREA 3RSEA 3VV2B 4QWCA 1BC6A 2QGFB 5D0HA 4PKIA 4H4OA 2EG2A 4K50A 3I32A 1MWYA 1YITN 2HVDA 1FRKA 3MM6A 3SCIE 2CIMA 1IKXB 2YWHA 1HL6A 3M1FA 3RAMA 2L41A 2VC1A 4DSIA 2BEFA 4UOHA 2G2YA 1YJ9N 2HURA 4QBUA 5B7WA 5J2QB 2CNLB 1K1SA 2YVSA 3M8ZA 4LT6A 4LVNP 2CQDA 5GAHU 3QAEA 2K1RA 3C16A 4FF2A 1UOCA 3WX4A 2ROGA 2D0AA 1S6PA 3QEPA 2CAJA 3MURP 3H5SA 3SV4A 2G2ZA 4XAKA 1NJYA 5KFCA 3CDUA 4LRCA 2KQ2A 4L74A 2NXCA 4OYWA 3CFPA 4CRJA 2A41A 3DOLB 2MKSA 4CH7A 5CE3A 3HI9A 4NE9C 4GMKA 3VGLA 1GX6A 4Q5VA 5F8IA 4CGFA 2W9CB 3PW4A 1N48A 5AZIB 4URSA 3FLCO 2ALYB 3KK2B 3Q8UA 4X4VA 1A5WA 3BH7B 2MQMA 1B64A 2CPXA 3OYLA 2EBGA 3JTPA 3TJ8A 4FS1A 3TANA 2UXDK 4F4AA 1U1OA 1RTHB 4IJNA 2HBZB 3U3YA 2C3YA 4C1NI 1OY8A 3D6FB 1VSKA 2CGJA 4EP5A 3N5FA 1AFIA 2RHQB 4EFHA 4ICLB 3GCWP 4TQSA 1PJ6A 1I1GA 3ZTSA 3AJ1A 3FUYA 3NGDA 5DM6L 2BM0A 3P5TL 3LPTA 1LWEB 2O8BA 5E2QA 1BQMB 2AJ2A 1RSCA 1Y00A 3FCVA 3MMVA 1FXDA 1DLOB 5C2GA 3GL1A 1LWCB 3LO3A 5AQSA 4GMJB 2XSFA 4RWWA 2P1JA 1G6BA 3AV9A 4I7FB 1RBVA 1FESA 3ALYA 1SVDA 4MFBB 4W5RA 2ERRA 2Q31A 1R89A 3GJTB 1EB0A 2GGPA 1EIYB 9RUBA 4QU6A 2VFTA 2CH6A 1DQAA 4K4YA 2LA6A 3TZYA 5EUHA 4ELTA 1VFJA 3W8PA 2LEBA 2RPIA 4HHUA 4DV5F 3L2RA 3AY0A 3QEVA 4JI8K 4GVBA 2VBWA 1RBUA 3CPWR 1ZXOA 2PZSA 5THWA 4OLAA 5A8KA 2FTRA 5B0EA 4C11A 3O3HA 4M3UA 2WSFC 3KJNB 4WFAL 4DU8A 2V2ZA 3EDQB 1FD2A 2GMHA 2NNWA 1SC1B 4Y2CA 4TKTA 3V4IB 4TYAA 3V1RA 2KHOA 1I94F 1QQMA 1HBNA 3MEGB 3D4JA 3CDAA 2ABYA 3W66A 5JMVA 4CZEA 4KTZA 1KR4A 2P5GA 4FJ8A 1SQFA 4JI7F 3ZSXA 3OYAA 2E5IA 2PO4A 1JJ2M 2CG4A 4Q7AA 5KFSA 1D9DA 1D1UA 1UVJA 3EPGA 2XMVA 4CJVA 1WC0A 2NZCA 4U8YA 4NA3A 4FW2A 1UETA 1NCLA 1EX8A 1RT6A 1JLQB 3F9MA 3UVJB 3QRRA 4DSEA 1REVB 1D8ZA 3CGIA 5K9FA 2XLJA 5AXMA 1Z4UA 1RWKB 1U0HA 1IBKJ 3OTOK 2L3MA 4Q0BA 5LOQA 1F3VA 2Z58B 3ZTOA 2AJQA 3I5BA 4MIAA 4IXCA 3J7AP 4CHOA 3LP0A 1KVAA 3MM8B 5C0YA 3HBTA 2YKOA 3GR1A 2W2QP 3R8EA 2WBNA 2XMWA 3AJ2A 4ISGA 4NLQA 4E19A 5A76A 5D0RA 4ZLLA 2V68A 3OVAA 3I0SA 4HHJA 1X9JA 3M2RA 2KTQA 5CAAA 4MTPA 2HRYA 3K2YA 4GKKF 3E9PA 4CHPA 1NJXA 4G65A 4ZVHA 1TFYA 3VQCA 3SMSA 1RYRA 2IM2A 2FVSA 4NLOA 3EZ5A 3MAHA 4NMXA 4DCJB 3OW2M 3G82A 2IBOA 4JI3K 3ZYYX 3EEQA 1S72S 1TL1B 4PRFA 2OPQB 4IG3B 2XMJA 3AO3A 3KTQA 4DQ8A 5KFQA 1TUUA 2CGKA 2W9BA 2GV9A 2ATLA 1HMVA 2Q6BA 1HQ2A 4FLWA 1LOUA 4AHRA 2KRRA 4DU1A 2KZMA 2MKCA 3MMBA 3CD0A 1ZBHA 1BIUA 1RADB 2W6KA 2V4QA 3LZJA 3QEWA 4M63A 3B4DA 1YHQN 4FM0A 4IJAA 4CJ4A 2FY1A 3CCEN 1FO1A 4Z4GA 3TI0A 1HNIB 1RTDB 1WUAA 1SQEA 3MM7B 4TY9A 1S5JA 2M52A 1HYSB 4NB4A 2CJYB 3C3LA 2EC2A 5IS2A 1MA9B 3HZ6A 4YEAA 3WNGA 3R6GB 4JV5F 2HF4A 3L9ZA 1Q5VA 4H0VB 1T03B 4W92B 5LSRA 3ZFVA 1WG4A 5ITHA 4B3TF 3KLHA 5G4DA 3MN5A 1N5QA 3DLGB 5C24B 4FLYA 3W2VB 3UCZP 5L39A 2LMIA 3UN3A 4I0WA 4ZVGA 2IFXA 2IJNA 2OP5A 3L6QA 2YI1A 1JLBA 1RT1A 1VQYA 4JKAA 2YHWA 1Q79A 1BCOA 2Z2LA 4HCCA 1S6OA 1QZ5A 2RRAA 3ONQA 4OVLA 4HVJA 1N33F 3BSCA 3U02A 4CLFA 2H1YA 3QMLA 3SQ0A 1PO6A 2CPZA 2HQ3A 1QM9A 2IC3A 2CJKA 4ZTJA 4BC9A 1RAIB 1XMQF 2YNIB 5F9LA 4C8YA 2NQPA 2QV6A 4KGKA 5DZ7A 3JTNA 4DV6J 4F4XA 4FWMA 1TP7A 2Q66A 1FX2A 5D0GA 3C6TA 2V8GA 3NGZA 3N9UC 3RSEB 3LM9A 5C7PA 2D41A 2YWGA 4H4OB 1FRIA 2NLXA 3VQ7A 3MCSA 4FKXA 2RQ4A 2V52B 3MM6B 2N4CA 4OYZA 2OCEA 1NXIA 3A5OC 3K2PA 1VQ7S 2XMKA 1V4TA 2LU2A 1SIWB 3SK3A 3SUQA 3WNFA 2MLYA 3W8GA 4Y2MA 4DR2K 4ZHRA 2KXNB 1TUVA 3MWPA 2K1RB 3C16B 1WG5A 3K8WA 3S8SA 2PY5A 5IWAF 5GIPA 1S6PB 2ZOFA 3J7YI 2W4CA 2VQEF 4CZGA 3Q7CA 1MLAA 2F65A 3CCQN 4GC6A 1SCJB 2VDHA 3C14A 3J7Z5 4DL4A 3BDPA 4K4ZA 3N5BA 4HTIA 2D0PA 2QJ3A 1U6BA 2J0XA 5H1SQ 3A2FA 3TX0A 2A2CA 5AXLA 4DR6F 1M5KC 4PXBA 2BKOA 5J1PA 4BRMA 3SAGA 4FPIA 4PKDB 2A5XA 5DQGA 1DY3A 3KHLA 2D3UA 3CJKB 5ADZA 2Z1JA 2DKOB 4DV1J 3W0LA 2PFUA 1IG9A 4YOYA 1L3SA 3J81j 2XO7A 1S1VA 2VFUA 5DS7A 2PN6A 3KLIA 2EFPA 2W4PA 2QK9A 4NLCA 1U0SA 5KT6A 1KEKA 3K9KA 1VQLS 5EDWA 3HLUA 4E8UA 5KTQA 1JMTA 2MLZA 4M5JA 2IRXA 4KH5A 3A4TA 2IGIA 2EFGA 3FQKA 3KWGA 4DTNA 1PBAA 4C1NK 4GVEA 2XYPB 2OPPA 4FF1A 2O8BB 3GIKA 1XMOK 3T1AA 3M2UA 2W24A 4AHVA 4DV7F 4DV6K 2HQGA 2J8SA 1NMNA 1ZC6A 4IO9Q 4ZCIA 4YHHF 2J7KA 4CEOA 2VU5A 3O9SA 3FBFA 4A8YA 1Q8KA 3MM9A 4ZS6A 4ANEA 4PL8A 1F60B 2P9SA 2H65B 5AZJA 5FDLA 4CHQA 3F2KA 3RR8A 4EHUA 3CCJS 2YX7A 4QAGA 4C3KA 2DB1A 4GVBB 2YKQA 3P8BB 4AM6A 2HS3A 2DY4A 3EZOA 1XR6A 2Y0BB 5A8KB 2OYQA 1U6FA 2J5AA 1VQSA 4OYXA 2FSKA 4C11B 1H3DA 3CCWA 4DV4F 2VCPA 4JV1A 1BLUA 3AT1B 1NH8A 4O8KA 4L3QA 1RP5A 3KXDA 1IWAA 4LF5K 3VN5A 4QS9A 2IIHA 2ADBA 3NNCA 1X4CA 3M8QA 3MOZA 5CYJA 3HVRA 3KHHA 4JYAJ 2NXJA 1HBNB 4C8ZA 3IO1A 2GMJA 4ZITA 2DR7A 3EKUA 1DGKN 2HGNA 5F8LA 3HM8A 4OLPA 1HKBA 3PW5A 4OI0A 5LJ3Y 4G1PA 1RDBA 2WTUA 1TL3A 2AP1A 1FNOA 1N88A 2XYHB 1SKSA 4CLTA 1ZPVA 3JQMA 1Y5NB 2VH7A 4OJ1A 4IRDA 5HSPA 2XB2D 4ZJOA 1H38A 2DIVA 2BJ3A 3EE8A 2RILA 2LQJA 4WF9Q 3WC2A 5H9EK 4A62A 4CIFA 5IC6B 2UUTA 1U0HB 4MO5A 4CGJA 4L72B 2P9EA 4Q0BB 3AA3A 2XTJP 1UVMA 2VG7A 3LP0B 2VUGA 2RRBA 4LFAF 4QW8A 2ZHOA 4OFZA 3K5OA 5HQLA 5HLFB 1S48A 2CG8A 1C1AA 1F2HA 4KT0C 1S9GA 1X60A 2ZE2A 2Q6CA 5B0CA 4KR0B 3NGUA 5EN1A 4TXSA 3CMAS 1QVFM 1F9HA 5IQQA 3CCRN 3I0SB 1LW2A 3BF4A 3M2RB 3SUPA 3R7BB 2JNJA 2EEYA 5CD4A 2RSQA 1VQ8N 1N0VC 4ILLA 5EWGA 3AAQA 1DT9A 4DV0F 4HUGA 3VQBA 2W8LA 1AFJA 1YJWS 1VK0A 3DRYA 4F4ZA 3J8AA 3D2EA 1UWBA 1N32F 2M2BA 3TZZA 1R8HA 3HHLD 2N7YA 3G82B 1CXQA 2VHGA 1E3MA 3RAQA 4ETXA 5D4LA 4O3PA 3OYNA 4WYLA 3PZPA 2H3EB 5E3AA 5J2PA 8ATCB 4X4NA 1HMVB 1HPZA 5M2RA 4QYRA 4CM2A 3MMBB 3TU5A 3TTFA 3MN7A 3RMDA 1BD6A 4NXMF 3V9ZA 4B9UA 3KG4A 1WC1A 1MG7A 3NGSA 3C95A 3B54A 2WVEA 2R7UA 3RMAA 5DM7Q 1D09B 3PTWA 5HMYA 1OMSA 3QDKA 4WZMA 3RW7A 4M45A 1ILYA 3DHWC 3M6WA 2X6NA 3ZXWA 1Z6RA 4DPOA 1QVGM 4CZLA 1UPPA 1QHTA 2UU9F 3ENHA 5HN0A 2WVBA 2OUGA 4HCBA 2HYIB 2PIIA 3KLHB 5IOLA 4O0IA 3RB6A 3MEEA 3PR5B 1I3OB 2WAQD 2DFHA 1HWKA 1ASVA 3R1HA 4BRHA 1NPRA 2E20A 4RLEA 2AV5A 3BGOP 2Y1LB 2NRHA 1R0BG 1FA0A 1JLBB 1RT1B 1B9DA 1JK9B 2F9JA 5L1KA 5HP1A 3CJQA 3I4HX 4A8XA 3RBZA 1QS4A 4KV8A 5B0FA 3VF2A 4U9RA 3N4WA 3H40A 2NXNA 2P6SA 5KFWA 3HD1A 2F9WA 1F3FA 1G4CA 2HOEA 1IM4A 3NMAA 2YJFA 1I94J 2PE8A 2RU9A 3RTVA 3LOUA 4PG5A 2IC3B 1IM6A 1LKZA 1NJIT 3MD3A 3M4XA 4KTQA 4FPRA 1FERA 2HFSA 2QWQA 4JI7J 3CD6N 3OYJA 4IG0A 3OYDA 3C6TB 4B3RF 1NDLA 2OEMA 2HBQB 3S7RA 1CXUA 3DU5A 2AJFE 3PRDA 2LYVA 4QR2A 2VBZA 4LRBA 4B3MF 4DB3A 3BZCA 1F5AA 3K17A 2V7ZA 4PQAA 3NCPA 1JXBA 4WKYA 3IA0A 5HMZA 3DXMA 3IBWA 2NCKL 3D3CJ 3A13A 1GLLO 3I0RA 5SUHA 1BG3A 3HFKA 3L2QA 4ZHRB 2KT5A 4H4KC 4XPCA 2D3OR 4H5VA 2VIHA 4CHZA 2OLWA 3AD8C 1WBDA 2FGOA 4BRGA 1KN6A 2HVEA 4CZMA 2YKNA 1FWPA 4IZ9A 4IO9L 1RT5A 4F3MA 2ZJPL 4ZP8A 3C14B 1QE1A 3NGTA 1HNZF 3C6UA 1XUPO 3POTA 2IDOA 2ATCB 2BW7A 4GKKJ 4AQYK 1KRPA 3MAAA 3DFEA 4LF7K 1FDAA 2HK2A 3PV8A 1NUEA 3QWUA 4MKVA 1NDKA 2XZTB 4A5AA 3C65A 5K8MA 5CZ2A 1VSEA 1XHXA 2MB0B 4RWTA 1YRTA 3WIUA 3H4BA 2B7CB 2MKJA 3H98A 1I3AA 5EGYA 3AA5X 2MSSA 1W9HA 3ATUA 2WB1D 1HKGA 4WQ4A 1S1VB 2XBPA 1ITPA 4X4QA 3KLIB 4ZCMA 2E4LA 2E5JA 3UQSA 4CLWA 2HHPA 2NRRA 3ULHA 3A8IA 1VQ4S 2WONA 5DG7A 1QTMA 3A5LC 4JKDA 4DCHA 3WC0A 5EX5A 1U8SA 1O1WA 3CC2N 5I3PA 1S6QA 1OSCA 5GIOA 4CYUA 3U9ZA 1SL0A 3OSNA 4I6AA 4CI6A 2OPPB 3PJWA 4JV0A 1BQNA 2FHJD 3M2UB 1U1RA 5KT5A 5CZVA 4KC5A 1XWLA 4JV5J 1HI0P 4WF9L 3MM9B 2R9LA 3H90A 3CTRA 4B3TJ 2P9SB 3SSSA 5AZJB 1NK4A 5FDLB 1Y7PA 4B02A 3TW0A 4PKHA 1UW4A 2VYPA 1VS3A 3QNWB 3AOBA 1A0OB 4OHYA 3DMJB 4BQLA 1S7IA 2OMOA 4MYUA 3GFZA 2VBYA 3ELHA 1CSJA 2LQ5A 5C2DA 3O9UA 2WTFA 2HZVA 5E3RA 2DT9A 4U7BA 3TUJC 2X1BA 1N33J 3OS0A 4PCQA 2FY8A 1GMVA 4AM7A 3M8QB 3HPGA 5IT0A 4WXWA 5AQOA 3PX0A 5F8NA 4LSLB 3O9QA 1XMQJ 1RHUB 1F5CA 1DBDA 4BGBA 1TVRA 1FWKA 2NRVA 2LECA 2DNGA 3JQKA 4DV2F 1YZ7A 3EO3A 4R79A 1WKLA 3H46O 4QW9A 2ASYA 1TL3B 2XHCA 3LPUA 2WBMA 3OA9A 2DH7A 2I8EA 2C22A 3R97A 4Z4HA 2HQFA 4C0OC 1BL3A 2AYMA 1JCEA 1IBLF 2L08A 4B9SA 2CKWA 2HZCA 4MO4A 4DR1F 2DPNA 3H4DA 3NG8A 2B9WA 1NAQA 2ZHBA 3HI0A 3GYXB 3CPWM 4PEOA 5AQQA 1X4EA 3W61A 3OS1A 3CCUS 3HZGA 4CEZA 4CF8A 2LXIA 2V8PA 5ETNA 3NAIA 4LF9F 3C94A 1QQCA 4PY5A 3DJCA 5DM7L 1EP4A 3N79A 4RW9A 3AVHA 1XI1A 1TKTA 5IWAJ 3IGVA 1VOMA 4ECYA 3RBXA 2OAUA 2VQEJ 1U4BA 2BRKA 4ZPVR 2ZE2B 1Q7LB 1WSEA 4Z4EA 1XQIA 3UDLA 3KJFB 2ZZTA 1HHQA 2R7VA 3ZC4A 1AROP 4ZPCA 4PWDA 1LW2B 1OH5A 2FJDB 3J7A1 2ZJQQ 1NBEB 3EVWA 4DR6J 3NF9A 3IP0A 4JV5K 3W9IA 3N6LA 2XLKA 3N01A 3QO9A 7FD1A 2KFNA 1IH7A 3TPQA 1TUYA 2DITA 4AL5A 3OTCA 1UWBB 1D8YA 5KFZA 3SCLE 4FLTA 2QMXA 4RG8A 4EIAA 4E7IA 2BGGA 4DG1A 4WK1A 2UXCF 5J2PB 6AT1B 1KHVA 2UVRA 1HPZB 1WSHA 4CO1A 3I82A 1HW8A 2Z30B 3HHLC 4PPDA 3OFFA 1F1BB 2E9ZA 1S1WA 4M8LA 3VQ5A 1IKYA 4DFPA 3BJYA 4FW1A 7FDRA 1HR0K 4RPFA 3T9NA 1ATRA 4DF8A 3TAGA 4DV7J 4DX6A 3BSAA 4YHHJ 3K5MA 2GBZA 5L1JA 3R5AA 4JBCA 5BR9A 4MLEA 1W26A 4DEZA 1RGVA 4JKEA 2W4DA 2OKQA 1JCFA 2OTJN 3O1LA 5KFXA 5AQIA 4J37A 4BHQA 1U1KA 3EGWB 3MEEB 4LF4K 4LRAA 4M3RA 2B9XA 4J9RA 1Q16B 3FEZA 3O1BA 3ZNJ1 3ZETA 5IFMA 2AD9A 2MZ1A 4YY3F 1ZBLA 3KUGA 3NXZA 3BN7A 4DV4J 5ADXA 5GADI 2DGSA 1U49A 5HP1B 3N4QA 4DUTA 4O44A 4KV8B 4BY9C 3ENAA 5CD4H 4C8NA 3L3VA 4J2BA 3RR7A 4RU9A 3C15A 1Y0HA 3BB5A 4QWBA 1B9FA 4DPTA 3S6EA 3GB0A 2L9NA 3CJ3A 4ED5A 2YNHA 2B4UA 5E5NA 2B4OA 5U47A 3TAMA 4GY2B 4LF8K 1J54A 1HKAA 4DV3F 3PSIA 1VLOA 4IG0B 1SH2A 3PIOQ 2GO9A 4YOEA 3HZEA 4BRQA 3TSUA 4G3IA 4IFYB 1QHAA 4QU7A 2QM1A 2VWBA 5KG4A 3ZCMA 1H73A 1VQNN 3VAGA 1X3NA 3P39A 3AVLA 4UQTA 2FBTA 4HDHA 2H5EA 2VQFF 2GNKA 5I4MA 4OI1A 3DXMB 1KC8T 3I0RB 2Y1RI 2OEJA 2GVDA 2KG1A 4HH0A 3BPSP 3EX7B 4CIOA 1ZBSA 1YQHA 2QKBA 2ZWPA 4LFAJ 1S9EA 1QSSA 3GU0A 4CZFA 5LMNF 4PR6A 2YKNB 4F2SA 2FLNA 1W97L 1EETB 2IIRA 4IR1A 3ENOA 2A1RA 5KT7A 1Q78A 3NMUA 3G71S 3C6UB 1HYZA 1DAXA 1E4GT 1T05A 5KFTA 3POTB 1JB0C 3I9ZA 1FVSA 4DU3A 3H2VE 1N36F 3UPFA 2HLUA 3MAAB 2KJWA 4OKKA 5K14A 3I56N 4DV0J 4WIQA 3D9BA 3MZIA 2NZ4A 1FI4A 4F3QA 4W90B 5C12A 3VEWA 1N32J 3M9NB 2G0JA 5E41A 1KC8O 1GLDG 1TQLA 3FC9A 3KHRA 1Z25A 3L2WA 4F04B 2FB0A 4I6MA 3PRVA 4FXDA 3NGYA 3VAKA 1R27B 3QGPA 1XNQF 1Q5YA 4FXWA 2ZBRA 3FZMA 2WONB 4NXMJ 1S6QB 3RU0A 1Q4RA 4ZVPB 2IY5B 3MTKA 1WI6A 2R7YA 4Y65A 1KD1O 1A9NB 3LM2A 2GA7A 4CJTA 4CYUB 3L09A 2OJ3A 3CCMN 2ILZA 2GV1A 2QW9A 5CY4A 1RKIA 1RXOB 1NHKL 5L9NA 4L3KA 1BQNB 2YHBA 5HRSA 5KFEA 2O8FA 2C42A 4IRKA 2UU9J 4X66K 5CHIA 3Q24A 2VA3A 1UZDA 1KVCA 2ASLA 2XS2A 1EQ0A 1BWFO 4K2XA 1P1LA 4BBYA 2H48B 3DDKA 1Y11A 1CJKA 5SWMA 1CULA 4ZKAA 1GLEG 2QEXN 1OVYA 3OVSA 4ED8A 4NCAA 4RX6A 4OZ1A 2CH5A 4K59A 3T5HA 1KVIA 2YWKA 1SJQA 2GELA 4EYHB 3MWBA 1WLJA 3CWJA 3JS6A 2ZOMA 2CJAA 4DQRA 3NNAA 4ECTA 1ZBIA 3LZIA 1PCAA 2ZJQL 4JI0F 1M5HA 3KWMA 2HBYB 2V5HG 4JKCA 4JV2A 4ZVRB 2MKKA 2VPZB 3MDFA 2CVEA 1YX2A 2GQCA 3CCLN 4JI2F 2WW4A 1TVRB 3QFPA 2MJUA 2JLEA 4G6VB 1GFWB 4LMZA 4B1WB 5AFUA 2HFUA 1UL3A 5DQIA 4JN4A 4QS7A 3M6GA 4F3OA 4B3RJ 1SQKA 2E7VA 2W25A 4YR0A 1HNXF 1RDUA 1RAFB 1O0PA 1B0PA 4B3MJ 4O5BA 1YJNN 3CJ7A 3NVKA 3AAWB 5KFFA 1WEYA 4WTYA 4E7JA 4GW6A 1YJVA 4YR2A 4ZPBA 1SI9A 1IUJA 1VJQA 2UUBK 4FJGA 4BG8A 4XH4A 1KLNA 3TJAA 1T0TV 1KQGB 4ECWA 2LXUA 2W01A 4FCYA 2WSCC 1RT7A 1DQ8A 3TQEA 1VQMS 2UP1A 2DNQA 3KKSA 5ETQA 4LIWA 4YMEA 2Z1HA 1IJJA 1EP4B 4RW9B 3E51A 1NKCA 1X7VA 1WBBA 1TKTB 2OEKA 4OI6A 2V9KA 2AZ1A 2X1FA 2GVZA 3NOCA 2HHQA 3QNOA 5IT9U 1HNZJ 3SSRA 4MT1A 2Z2MA 1BUXA 4CERA 4PWDB 3UO0A 4B9QA 3WNEA 2DCUB 3DLHA 3VGUA 3G6YA 5BR8K 3LL3A 2E5LF 3ID8A 3AXMA 1UJ4A 4X65K 5F1XA 3MCPA 3TR8A 3KUEA 2BACA 3V6DA 3VQEA 4USIA 4B9MA 3WXMB 5G0RA 2HVHA 3DOKA 4LREA 1N34F 2KYZA 1OQ6A 2E2PA 1FTCA 8AT1B 4MKYA 2ZZNA 4CGDA 4YORA 4ZMMA 4DG1B 2JWNA 4J9NA 1YHQS 2CNNB 2D69A 4KPYA 1SAZA 3CCES 3RGIA 5FPDA 2C3OA 3MFIA 3OTDA 3J7AN 4KAIA 2DJWA 3OD2A 1KAXA 4DR3K 4Y2KA 2O67A 1DJ0A 3V1OA 3KD5E 3IM9A 2Z56B 5D4PA 1IKYB 2KFYA 5JMNA 2JFDA 3Q8RB 1OYDA 1QAIA 1S10A 4F3TA 3U1LA 5DGBA 5AE2A 3LP3A 3UB5A 2Z1GA 4Y2AA 5EWEA 1OYEA 1NGHA 2IM0A 3DYAA 3F0NA 4PXEA 3QZ7A 2DHSA 3I9V9 4UOCA 2GX9A 3H08A 2CGLA 4OX9F 1M90T 3BKUA 3FVYA 4DOZA 4CHYA 3BREA 4K8XA 1A7GE 4CO5A 1HI8A 4NYPA 3AVGA 3PCOB 2JWLA 4FWSA 1X1PA 1YWXA 4B9LA 3L8BA 3CIMA 1IBMK 2HFVA 2HWIA 4BREA 4PG6A 3CCZA 3SBTA 3ZETB 1FKPA 4GKJF 4A4JA 5JVHQ 4USHA 3MXJA 1UJ6A 1UFWA 1VAZA 3SDEA 4DUZK 3J7ZT 3OQ2A 3CJ1A 4O44B 2NYIA 1MW7A 2IAJA 3D54A 1IO2A 3IM8A 5CYMB 3SQ1A 2QC3A 1R59O 1X9WA 4GV6A 3C15B 3IWXA 1XNRK 4WIIA 3CQXA 4RW8A 5DLFA 3KNAA 2BV3A 1L3TA 5A2QO 2CPFA 2YNHB 1Y5IB 4RNHA 4NYNA 1WC4A 1H1VA 2ZH4A 3TAMB 1FCAA 3VQTA 1RWUA 2LCWA 2QYGA 1YJRA 2YWWA 4DV2J 4FZYA 1AA1B 2JLFA 4KGMA 3CF5Q 4RUCA 3JXOA 1M90O 3E1YA 4NLPA 4X4OA 1C1BA 2UXBF 4KH4A 3CCTA 1JXLA 2G8KA 4USUA 3OYBA 3O44A 2DRBA 3T1YK 1IBLJ 2MQPA 2KZZA 3S01A 4BCAA 2AZ3A 4DR1J 3VESA 1HD0A 2C2EA 4CIEA 1HQUA 4F4YA 5A8RA 2GVDB 2DH9A 1PC4A 3J7ZO 5HVHA 1YAGA 4CEQA 5BYQA 2HMPA 4IOCQ 2V2KA 4ATNA 4LF9J 2AW0A 1T9UA 3CCQS 2VJUA 5KPRA 3M8SA 4MDBA 2JSXA 2DXFA 1S9EB 1BOTO 2F8HA 2P5OA 1ZBFA 1WSIA 2YNFA 3M3ZA 4P2MA 2DGQA 2Y0SD 4AUKA 2N3OA 3BQ1A 4OHVA 3X3UA 2R8IA 2DTUA 3NY0A 1RLDA 1X4FA 5JLHA 1KXPA 1LNQA 1T05B 4RBTA 2DNLA 1S22A