3ITHA

Crystal structure of the hiv-1 reverse transcriptase bound to a 6-vinylpyrimidine inhibitor
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
556
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Crystal Structure of HIV-1 Reverse Transcriptase Bound to a Non-Nucleoside Inhibitor with a Novel Mechanism of Action
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase, hydrolase
total genus 136
structure length 556
sequence length 556
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3ithA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ithA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ithA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ithA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ithA05
1SL0A 1B92A 3WNFA 3SYZA 1FKPA 4RW6A 4FXDA 5D3GB 2YV0X 3DLHA 4CESA 3DI6A 1WLJA 3AVLA 1BQMA 4YR0A 2ILZA 3SI8A 3KMQA 1NK9A 1TK8A 3KD1E 4DSKA 1B9FA 2ASDA 3NMAA 1S1UB 4Y34A 1RA6A 4B8AB 4W5RA 3Q8QB 1S97A 1ASVA 1RTHA 4IFYA 2HMIA 2IDOA 4KTZA 4I7FA 3RAXA 1J5OA 1ZBUA 1HQUB 2C2RA 4XIUA 5KG4A 1VRTA 4RNHA 4IH5A 5CYMA 4FZZA 1A5XA 5CZ2A 3CFRA 1JLAA 2VG5A 4AHVA 1N56A 3CDEA 3PW4A 2IJFA 1JLCB 3D0PA 3VA0A 1S9EA 3MXJA 3FQLA 5J2QB 3G0ZA 2B6AB 5L1JA 1Q8IA 3OL7A 1S1WB 3KMSA 3SV4A 2R8KA 4I9LA 4KV8B 4ED1A 1TV6B 4KAIA 1ZETA 1X9MA 2FVCA 1ZBFA 3QGIA 2Z1GA 1SV5B 3UQSA 1WNSA 4O3NA 3GQCA 3VQ6A 4ZTJA 4KRFA 4IR1A 3OSNA 4URQU 5I3UB 5J2MA 1IKXA 4W5QA 1SH2A 1MU2A 4N41A 1SUQA 4KFBA 4H4MB 1N6QA 1DLOA 2QKKA 4J9NA 5HRPA 4ECUA 3KLGA 4CHOA 1XR5A 3KHRA 1F21A 4CIEA 4O4GB 3KD5E 1RA7A 1RDRA 3V6KA 1JKHA 3KK2B 1RBRA 2FVRA 3NBPB 3V9UA 4K4WA 4BE2A 4ZP9A 4CK2A 1NOYA 2UUWA 2DTUA 3DDKA 1VRUA 4KKOB 4TY8A 1T94A 3O4NA 1D9FA 1HNVA 5T14A 4R5PA 4K4SA 5F8GA 2E6MA 2QK9A 1WSEA 2D3UA 1KFDA 4FM0A 3NE6A 2YNFB 4PQUA 1UAXA 5KI6A 4O44B 4K4TA 4O3OA 1U45A 4EBDA 5FDLB 4R8UB 5T7BA 2IM2A 1XR7A 4NLVA 3NL0A 3TVKA 4JV2A 3HVTB 3RRGA 4AHRA 2ETJA 3QETA 2W9BA 3VQEA 3QINA 5HRNA 4N56A 1S6PB 1XI1A 3VQBA 1LW0A 4ECTA 4J9PA 1GOAA 3ZSVA 3OYNA 1NHVA 4PUOB 4CEAA 3DLBA 1RTDB 3RMBA 1R0AA 1JLQA 1D1UA 4JS5A 4DF4A 2XC9A 3V6HA 1N48A 2HNZB 2GBZA 2FBVA 3PZPA 4MK7A 4RNNA 2OPRB 3PR5B 4UQGA 4MQ3A 3ZT3A 4DQQA 3MEGB 3IG1B 4ZHRA 1XR6A 2J6UA 2EHGA 4KREA 3DLEA 1DTQB 2X6NA 4Z4IA 4TXSA 3BQ1A 2RPIA 3DOLB 2BR0A 2G8IA 1OS5A 2D41A 3KKRA 1O1WA 1FK9B 3KLHA 2AGQA 2IAJA 2R8HA 2CKWA 4FLYA 3P83D 3RMDA 3VQ8A 4NLSA 4GVMA 3JYTB 3ITHB 4ELTA 3V81A 2ZD1B 4URSA 3MEDB 4DQSA 2XWYA 1FXXA 4WZQA 4K4ZA 4B9UA 2P5OA 1RT6B 3VQCA 3RR7A 3BSNA 2GIRA 4IRKA 1LAVA 1JLGA 5KFYA 4IFVB 3ALYA 3ZT1A 3LANA 3ZT2A 2YNGB 4IG0B 4JUZA 3PVXA 1RDCA 4FJ8A 3V9XA 4HCCA 4TN2A 5SZTA 4E89A 2B5JA 1VK0A 4CFDA 2XGPA 3D28A 4B3OA 1FKOB 1HMVB 4Z4GA 4NCGA 2HHUA 4DL5A 4WFZA 3U3YA 4J2BA 4FK0A 3H2LA 3ZSRA 4FLTA 3E01B 4M3YA 4GMJB 1NK6A 5KG5A 3T5LA 2AQ4A 1BQNB 1YVFA 4AHCA 2HW3A 1JLEA 4MIAA 2IM1A 5HROA 1JL2A 1SKSA 4CJKA 3IN5A 1K1QA 1S1VA 2F96A 1S6QB 3C6UB 2JC1A 4DSFA 3PO4A 4IRDA 4H4OB 1DTTA 3AVCA 1TL1A 1NJYA 2DPJA 1RT7A 3M9OB 3ISNC 3AO3A 3EPIA 4F4XA 5EUHA 2WRMA 3NF6A 4OPJA 4J2DA 3AVNA 2F8SA 3BR9A 2WONA 1C0UA 1NK7A 4NLQA 1Z4UA 4QWEA 3QEWA 1FKPB 4RW6B 4K8ZA 1RCHA 2Z1JA 3DI6B 3HK2A 1L3VA 5DK5A 4FJMA 1BQMB 2IGIA 4E0DA 3KHGA 4GC7A 3V9ZA 1TKDA 3V1QA 3I5CA 4CEOA 3QIOA 3NHGA 2WB4A 1D8YA 3LZJA 4ZP6A 3OHBA 4DG1A 2BQ3A 4HHTA 3L2WA 1RTHB 4I2QA 4IFYB 2E9TA 4KHMA 2HMIB 5KFGA 1J5OB 2V4QA 2HHXA 1ZYQA 3TAMA 1VRTB 4MK8A 1HPZA 3QLHA 3OYHA 5F8HA 5J2PA 3KTQA 1CSJA 4OPKA 2VG5B 1KSPA 3GV8B 2W9CA 4J2AA 4J9QA 4EYIB 4B9VA 2YKMA 2JLEA 3QEXA 1S0OA 2IS3A 4FLVA 1BCMA 4N5SA 3CFPA 2FBYA 1N5YB 2F8TA 3N6NA 3V6DB 4KBIA 1I6JA 2FVSA 1WN7A 4OL8A 4WXWA 3AVGA 4CJSA 3H98A 2FC0A 5J2MB 3GV7B 3HL8A 1MU2B 4OGEA 3QEVA 4B9TA 4IKAA 4DU1A 3M8PA 3UPFA 1JXEA 1SUQB 4KFBB 4YNQA 4I9QA 4FLWA 1N4LA 1RT1A 4PWDA 1N6QB 1DLOB 4M3TA 2WOMA 2WCXA 3KHLA 3SCXA 1ZBLA 3QO9A 1QAJA 3L2VA 1X9WA 5KRSA 1RT3A 3NKYA 2AX0A 4QWBA 4G3IA 1VSIA 4ED6A 4KO0A 2HNDA 2A1SA 1JL1A 4DTXA 4FK2A 4FCYA 1W9HA 3SPZA 4QWAA 5EWEA 3PW2A 3ZSYA 1L5UA 4R5PB 3SQ0A 5KT4A 1IG9A 3UIQA 2ZE2A 3IS9A 3KJVB 3AO1A 4HYKA 4PQUB 5J2NA 3K5LA 4TYAA 3L8BA 4CJ4A 3HVAA 4ECZA 4IH7A 1VSEA 1W0HA 4O55A 4FLXA 5KGXA 3NGZA 4IBNA 2A1RA 3NGDA 3MEEB 2W9BB 2FVPA 3BQ2A 3DLKB 5C24A 1LW0B 4C8MA 4IQXA 4CJLA 3S9HA 2R2RA 1RTIA 2HB5A 3BDPA 5F9NA 1BIZA 2BQRA 1X9SA 3H08A 1R0AB 1RILA 1QAIA 3MR6A 4O3RA 3GYNA 3TWHA 3M9NB 2C28A 4DTRA 3PX4A 4CCHA 5JUMA 5KT3A 2D0CA 3P1GA 4XO0A 3WNEA 4Z4FA 3BSOA 3H5YA 1D0EA 4ZHRB 3GIKA 1CXQA 4YMEA 1S0NA 3DLEB 2W42A 1QSSA 4QOZB 4ID5A 4KTWA 4W5TA 3G6VA 2JGUA 3KLHB 2IAJB 3I5BA 1RT4A 5HBMA 1VSJA 2YHAA 1A5WA 5KG7A 3AVMA 1RDBA 3KOAA 1NK4A 5E41A 1I3AA 4ECXA 3KNAA 4DTPA 1VSLA 2XGQA 3SUOA 3OJSA 1JLGB 1BGXT 1C6VA 4WFYA 3K5OA 4C8OA 2Z1IA 4CIFA 4K4VA 1SH3A 2B5JB 4NZ0A 4RW8A 5KFLA 1HYSA 3IGVA 4B3OB 4RW9A 4EBCA 5F8LA 4LQ3A 4M3XA 4JRQA 1TL3B 3OYEA 4ECSA 4IDKA 3L2RA 4NYZA 1NNDA 3AO2A 1S49A 3Q8PB 4RUCA 4CEQA 3TI0A 1HARA 5HROB 4FJIA 3OSPA 4KHQA 1S1VB 4CJ3A 1DTTB 4R0EA 4KTQA 5KGWA 4CGFA 3MF5A 5L9XA 4EZ9A 3WNHA 1EKEA 4KHRA 5KFCA 1C1BA 3RTVA 4CGHA 1U4BA 2WONB 1C0UB 3LZIA 4Q45A 1Q9YA 2HVHA 1BL3A 1EETA 5KFSA 3ZCMA 2G8FA 4O0IA 4AH9A 5KT7A 1QSLA 1LWEA 1KCFA 4RNOA 1T03A 3SJJA 4I2PA 1JIHA 3CYMA 4XPCA 5KFNA 3MECA 4DG1B 4FBUA 3KLFA 3FQKA 2RDIA 4I2QB 4BDYA 3SUNA 3DOKA 4NLUA 4ZPCA 3TAMB 3CDWA 1WSIA 3QLHB 2LSNA 5CY4A 4CEEA 2YNHA 3C95A 3OS0A 3RRHA 2ATQA 4CHQA 2W9CB 2YKMB 4FW1A 3ISND 1T3NA 1WSGA 3RB0A 3EYZA 2P5GA 4GC6A 2QXFA 4RW4A 2YNIA 4QW9A 1NKBA 4CF2A 3THVA 1KHVA 3OYBA 2UVRA 1CZ9A 1BI4A 3PHEA 2XHBA 4CGJA 5HP1B 3G6YA 2AGOA 2BQUA 1YTUA 5KFMA 2IOCA 4FLZA 1KLNA 4Y1CA 2QKBA 1TKZA 3C6TA 1EXQA 2RF2A 3M8PB 4RU9A 5KFBA 4CHYA 1XWLA 2WTFA 3GV5B 1RT1B 2HWHA 1Z25A 1ITGA 4PWDB 3RMCA 2UVVA 1J53A 5L1KA 1SKWA 3IAYA 4ED2A 4YQWA 1BISA 4GW6A 4M3ZA 2O5DA 2DPIA 3QO9B 1LAWA 4LSLA 4QWCA 3ICLA 3AVFA 5DLFA 3LALA 1Z26A 2E9ZA 2XY6A 4KO0B 2HNDB 3LAMA 4BDPA 1TKXB 1WNEA 4B9NA 1S48A 3LP0B 4F4ZA 3MFHA 3VN5A 2R2SA 3ZSZA 4CFAA 5K14A 1VSMA 2ZE2B 3IS9B 3HPHA 1IKYA 5KFVA 5J2NB 1REVA 2KW4A 3SZ2A 3SFUA 3KK3B 3BQ0A 3AA4A 4FVMA 5KFDA 5J1EA 3BREA 4DMNA 5C24B 3HP6A 4Q5VA 2IC3A 1NHUA 1T05A 3FRZA 1LW2B 4ZPBA 2EX3A 1RTIB 1HQEA 4BE0A 2BRKA 2DFFA 3MFIA 1WAJA 3S3NA 2R7YA 3I5AA 1XC9A 3VQSA 3OL8A 3AVJA 2WK4A 4CF1A 4CE9A 5L1IA 3DYAA 1KVAA 4M95A 3V9WA 3H5UA 4ID5B 2W8KA 4DFKA 4CEZA 4IOBA 3VQ5A 2PY5A 2J6SA 2HHWA 1ZTTA 1RT4B 1UWBA 4WYWA 4ZMMA 3TABA 5C5JA 5EU7A 4LD0A 4FM2A 2KZZA 3RB6A 2G8VA 4DTMA 1HYVA 1S10A 3T3FA 4FBTA 1LWFA 3HXMA 1RT5A 4MKBA 1S4FA 1GX6A 3FFIA 4FS1A 2YHBA 2E9RX 5DMRA 3OLBA 1VSFA 4DTOA 1T7PA 3DMJA 3OYKA 4CEFA 5C42A 4L8RB 1WSJA 1QE1A 1TP7A 1S0MA 4HUFA 4RW8B 3H4BA 1GOCA 1HYSB 4RW9B 4MFBA 4LQ9A 3LP1A 4O3PA 4RUAA 1KLMA 2C22A 4NLRA 4IDKB 4XPEA 3KLEA 3TR8A 4ZVFA 4MH8A 3DRSB 4KB1A 3LAKA 3MR3A 4WXOA 1IKWB 4CEDA 4F8RA 4ZP8A 3FSIA 2OA8A 5KFQA 4CJFA 1RBVA 3NF9A 3KHHA 1TGOA 4CIGA 1IM4A 3K5MA 4FJNA 4H54A 2CJQA 2B43A 4DQRA 1C1AA 4ID1A 3RMAA 3NAHA 1EX4A 5DG8A 4NYFA 2AJQA 2ASLA 1C1BB 2F8EX 3TAFA 4DS5A 1IKVA 2BANA 3CVKA 4E7IA 3K57A 3BSCA 4WYLA 4I7FB 3G6XA 1CXUA 1NOZA 5F8NA 2R8GA 4O3SA 3DLRA 4DSJA 3AA2A 3QIDA 3NH1A 1L3UA 2D5RA 5CYMB 3MAQA 3T5HA 1LWEB 3CWJA 4FYDA 4BACA 1T03B 4I2PB 4CERA 1JLAB 5DGAA 4LSNA 1S9EB 4DTUA 3MECB 3M8QA 3SPYA 4C8KA 4CJPA 4CJQA 3OYIA 3KLFB 3JSMA 5KFIA 4CHZA 2GUIA 3DOKB 2VG6A 3S3MA 4FJXA 4FLUA 4HKQA 4O4RA 3PO5A 5DQIA 1QHTA 4FJLA 3K5NA 5HRSA 2YNHB 2FVQA 2P51A 1C0MA 2EC0A 4IRCA 1IKXB 3U6FA 4YP3A 1KFSA 4Q44A 2R8IA 4AHUA 2HNYA 5SWMA 4RW4B 2YNIB 4KSEB 2VWJA 3QEIA 4EZ6A 4CJTA 3AVHA 3ZT4A 5DG7A 4Z4EA 4DU3A 2XI2A 3LP2A 1BI4B 4F2SA 3AVIA 1VSDA 3AVAA 3CIZA 4F3TA 4JV0A 3KLGB 4ECYA 3KK2A 3OYLA 4QW8A 4E7HA 3QEPA 1JKHB 3ZSQA 5KFAA 3K2PA 1L3TA 1TKZB 1NJXA 2KQ2A 2X78A 1Q9XA 2JEFA 2FBXA 4MK9A 4RG8A 3VQDA 4FJJA 2HHVA 3V4IA 2BDPA 4MIBA 3TAEA 1VRUB 4TY8B 4LH5A 1RNHA 1HNVB 3OL6A 2KFZA 2IA6A 4J9SA 5JS2A 1KVBA 2XO7A 1KHWA 4HTUA 4ECQA 4NLOA 1JLFA 2RKIA 1LWCA 5HLFA 4EYHB 3KK1A 5JXSA 4R8UA 3LPTA 3NH2A 5KFZA 2YKNA 4CJEA 4O3QA 4RZRA 3V9SA 2OPSA 2C2DA 1S6PA 3LP3A 3VQ7A 4J9OA 2ILYA 5K14B 4Y1DA 1IKYB 5HRRA 1WSHA 1REVB 3MTKA 4M45A 4FJ7A 4OLBA 5F8JA 1JLQB 3QYYA 5KFEA 4O0JA 3HSTB 5J1EB 2V4RA 3N6LA 2D0BA 4ZVHA 2V9WA 4OLAA 3DM2A 4CJVA 4E7LA 3QZ8A 3MEGA 3H59A 4DTSA 5KFTA 2IC3B 3IGNA 3IG1A 1L3SA 4DEZA 4DQPA 4CGIA 3CM5A 5DQHA 5DQGA 2X6SA 4DL6A 3RBDA 3L2QA 3PV8A 3TARA 3CJ0A 1U49A 1TK5A 2O4GA 2ASJA 3B6OA 3VQQA 4CJRA 2R2TA 3JYTA 4ED8A 3V81B 4NLWA 3K59A 4X2BA 4F2RA 2QE5A 3DYAB 2ITGA 2ALZA 2D3ZA 2YNGA 4IG0A 3CDUA 4J2EA 3NDKA 3SV3A 4B9LA 3I0SA 3RBEA 3VA3A 3QIPA 2FJVA 1UWBB 3TQ1A 4KHYA 4QPXA 3MXMA 3S3OA 1BIUA 1RDAA 4NCAA 2D7SA 2OZMA 5KFWA 4W5NA 2DFHA 4U7CA 3SNNA 2JEIA 5KFPA 3NF8A 4AHSA 4E1MA 4MKAA 4ZVEA 4NCGB 1LWFB 1RT5B 2IJNA 5FRNA 3HM9A 3FFIB 3SQ2A 3CQ8A 3DMJB 4DSIA 4Q0BA 5DG9A 1JLEB 5C42B 3RR8A 1QE1B 3EZ5A 4J9LA 4Q8FA 2W7OA 3N6MA 4M3RA 4H4OA 3KIOA 4Z4CA 4MFBB 4ZP7A 4KHNA 3TANA 3VQAA 1TL1B 1RT7B 4PY5A 1KLMB 2GC8A 3H4DA 3KLEB 3GIJA 1X1PA 1C2PA 1KTQA 3PJWA 4KB7A 3OVNA 4DL3A 4RNMA 2FBTA 4FM1A 1UOCA 3DRRA 1NK8A 4Y2AA 4KHWA 1WAFA 3CJ5A 2PYLA 4G1QA 4HCBA 3G10A 2AX1A 4DWIA 4Z4HA 1CLQA 1TVRA 2W9AA 5CYQA 4E3SA 4IG3A 4F4WA 2XI3A 1A5VA 3HPGA 5KG3A 3AV9A 3V1RA 4YR3A 2Z1HA 3O3HA 1U48A 2Y1IA 3EY1A 5KFHA 1RTJA 1IKVB 5KFOA 2BANB 1RBUA 2NUBA 4JLHA 4CFCA 1D9DA 4N47A 4CJWA 4M94A 1U09A 4TQSA 2KTQA 2V0NA 5F8IA 4NLGA 1HPZB 4E7JA 3QERA 4DTNA 5J2PB 3PW7A 4LSNB 5KT5A 4F3OA 3G86A 3M8QB 1N5YA 1NKEA 3V6DA 2OPPA 3JSMB 4FJKA 3LDSA 2FLPA 3LWMA 1EP4A 2IBKA 3AA3A 2VG6B 3OYAA 1RT2A 3QZ7A 2W8LA 3M8SA 1SH0A 3IRXA 5L1LA 1QSYA 4KHSA 4CGGA 1SKRA 3OLAA 5F9LA 3OS2A 3HVRA 2HNYB 2OPQA 2J6TA 3OY9A 2DFEA 1JXLA 2I5JA 3NCIA 2I1RA 3OHAA 4CGDA 1HJRA 3HYFA 3KKSA 2R8JA 3LP2B 2G8UA 4IKFA 2C2EA 3M8RA 2VG7A 2WOMB 1KVCA 1TK0A 3Q8RB 1S1XA 4OJRA 4KAZA 1IO2A 4TY9A 3NGYA 3WNGA 2OH2A 4HUGA 4M42A 1RT3B 4ZPDA 2BE2A 3O3GA 3NAEA 4NCBA 2OYQA 4M3UA 3PX0A 4KHUA 3V4IB 1TAQA 3UDLA 3C94A 4CHPA 4F4YA 1MMLA 3H5SA 4B08A 4K4UA 4ZTFA 4ZPAA 3T5JA 4ED3A 3I0RA 1SL1A 4RW7A 4EO8A 4NRTA 3DRPA 3KJVA 3QESA 2W7PA 4J9MA 1JLFB 2RKIB 1LWCB 5HLFB 3KK1B 2G8KA 3I8DA 2D0AA 3CFOA 4FJ5A 2KFNA 2YKNB 1NKCA 1VSKA 1TQLA 3F73A 4EO6A 1HRHA 2HHQA 4TQRA 4YR2A 3MEEA 2G8WA 2OPSB 4DL4A 2GIQA 3DLKA 1B9DA 1NJZA 1C1CA 4NLTA 4C8NA 5I42A 3ULDA 3M9MB 3D45A 4DL2A 5KG0A 1K1SA 2XRIA 5EWFA 1ZTWA 1YT3A 3KLIA 4DTJA 1JLBA 2UUTA 2FJWA 3QNNA 4FS2A 3B6PA 4K4XA 5KTQA 3QGGA 4M41A 3PY8A 4CK3A 1ASWA 4U6PA 3NH0A 3T19A 3PX6A 3TAGA 3DM2B 1S1TA 4F50A 3PJXA 1I39A 3AA5X 3AVKA 4KPYA 3LWLA 4WE1A 4HUEA 2XY5A 3AO5A 1JXBA 3SUQA 3TAQA 2HHTA 4DU4A 5KFUA 1ZBIA 3D5MA 2FLLA 4DSEA 5CZ1A 3P5JA 4C8LA 1TKTA 4TLRA 3AVBA 5HBMB 2PYJA 3BGRA 4NLXA 2PZSA 4ICLA 1G15A 1S9GA 3BSAA 3UR0A 5F8MA 3CM6A 3RAQA 4FZXC 4QWDA 1HNIA 3H40A 5EWGA 1Y97A 2JEJA 3DLGA 3I0SB 3KLVA 3QIPB 1RYRA 3V1OA 1VSHA 4OKKA 4Q8EA 4ECRA 2HVIA 4DS4A 4F4KA 2WHOA 5KT2A 2VA2A 3ZSWA 1TL3A 4BE1A 4NLPA 3QNOA 3EZUA 3OYGA 5FRMA 5C25A 5KG6A 3CG7A 4IR9A 5KRTA 4ECVA 1J9AA 1C0TA 4Q0BB 3OS1A 4QAGA 3VQ9A 1K6YA 1NJWA 5D3GA 4IH6A 1QUVA 1HYZA 3O3FA 2RDJA 2BRLA 1QS4A 4Q43A 1QQCA 1S1UA 2VWKA 3PUFA 4Y3CA 3HT3A 3ZSOA 3OYCA 3DRRB 3OYDA 2G8HA 3CJ3A 3CJ4A 4G1QB 3F9KA 4EP4A 3L3UA 1HQUA 2ZKUA 1EETB 4DFMA 4WZMA 1TVRB 4ED7A 5CYQB 3HJFA 1TAUA 4IG3B 1LV5A 2XY8A 4RNFA 4DL7A 2XY7A 3SI6A 4ELVA 1WSFA 1JLCA 4TYBA 3CJ2A 4AILC 5J2QA 5FROA 4TSXA 1GX5A 1RTJB 2B6AA 1S9FA 3VQPA 4LY7A 3SUPA 1QTMA 1S1WA 3TAPA 3RB3A 2HAIA 4KV8A 1TV6A 1IH7A 2GV9A 4ELUA 2FLNA 3RB4A 1SV5A 4CHNA 2AGPA 3L2UA 2DY4A 4JRPA 4N76A 4NLYA 4FJHA 5I3UA 2B4JA 5KFJA 4BWMA 4KI4A 3K58A 1D5AA 4Y2CA 3MR2A 2OPPB 4DLGA 1EP4B 2ATLA 4NLDA 1RT2B 2JC0A 4H4MA 5HP1A 3IRXB 3SQ4A 3SQ1A 3MXIA 5KG2A 4OKEA 4O4GA 4H8KA 3ZT0A 1RAJA 2P1JA 5DGBA 3GIIA 3OL9A 4CF9A 3C6TB 3NBPA 2HHSA 2OPQB 3RWUA 4FJGA 4LH4A 2I5JB 2RF2B 2ZQBA 1XHXA 4EBEA 1BHLA 3HPOA 4CK1A 4KKOA 4KB0A 2KZMA 4AHTA 3NGIA 4CJUA 2VG7B 4DFJA 1ASUA 5EDWA 2AU0A 2UVWA 1S1XB 3LPUA 4LSLB 3HVWA 1XHZA 4EP5A 2YNFA 1RDDA 4QCLA 4W5OA 4O44A 3QGHA 2Q3SA 2BE2B 5KG1A 1UA1A 5FDLA 4CF0A 1TKXA 3A2FA 1S5JA 3PW5A 3NF7A 2RN2A 3HVTA 2X74A 3OYMA 3LP0A 4J9KA 2O4IA 1U47A 3NAIA 3GILA 2QV6A 3I0RB 3HP9A 4RW7B 4O5BA 3DRPB 5DLGA 3O4QA 4E19A 4K8XA 1ZBHA 4PUOA 3E51A 1RTDA 4JS4A 4JV1A 3KK3A 1W25A 4YFUA 4E7KA 3HKWA 1GOBA 4WFXA 1T8EA 3U3GA 2HNZA 4EEYA 4Z0UA 4B9MA 2FJXA 5KFFA 1C1CB 3PR4A 2OPRA 1KRPA 4DFPA 2IM0A 2VA3A 4E1NA 5I42B 1JX4A 3T1AA 1LW2A 2E6LA 4OKJA 1T05B 2XCAA 4OGCA 2IMWP 1DTQA 1HQEB 3KLIB 3DOLA 1JLBB 3Q8SB 4FZYA 1FK9A 3V6JA 4FW2A 4BDZA 3ITHA 2HWIA 1S1TB 4NYNA 2OZSA 2ZD1A 2IM3A 3MEDA 3OJUA 5KFKA 1RT6A 4WE1B 4CF8A 2AWZA 3SFGA 4DLEA 1SL2A 4BWJA 3HHKA 3OYJA 4IFVA 2R2UA 2UVUA 5JS1A 4CEBA 3CO9A 4FJ9A 3HO1A 1U04A 1TKTB 4DF8A 4HVJA 3BJYA 3BGRB 4ICLB 4M3WA 1S9GB 2XCPA 4ECWA 1UA0A 1FKOA 1HMVA 3ZSXA 2JEGA 5KFXA 5KFRA 4DSLA 1YVUA 3ASMA 3H5XA 1NK0A 1RBTA 1HNIB 3E01A 4CJ5A 4KE5A 4NRUA 5KT6A 3DLGB 1RBSA 4DQIA 1BQNA 3VQ4A 3EPGA 3GIMA 4ED0A 4ZVGA 4B9SA 2E4LA 4CFBA 1RYSA 4KI6A 3C6UA 1S6QA 4J9RA 3L3VA 3FDSA 3LP1B 3T5KA 4OVLA 1BCOA 3AO4A 4PA1A 4FK4A 4CECA 5C25B 4K50A 3DRSA 4K4YA 2Y1JA 2BGGA 1IKWA 4URGA 3PW0A 3MR5A 1YTAA 1NK5A 1J54A 1C0TB 4B8CA 1CZBA 3NFAA 3OYFA
chains in the Genus database with same CATH superfamily
1SL0A 2DK2A 1NSAA 5DETA 3WNFA 4B3RJ 3SYZA 3CC4N 3IFEA 3BGOP 3OA9A 4CESA 4FKXA 1QQMA 1SJRA 3KMQA 5HQMA 4FWLA 2DR6A 3FUYA 1H1VA 2KH9A 1MROB 1N32F 4AUKA 1RA6A 2ZWPA 3Q8QB 1ASVA 1RTHA 4KTZA 5JLFA 3W64A 4DXLA 5HOOA 1GLFO 2C2RA 5KG4A 4IH5A 4FZZA 1OSCA 4FOEA 3CFRA 3CDEA 3VA0A 3FQLA 2ZZMA 2CQ2A 3OL7A 1HHTP 3CCZA 3W5XA 4Z94A 4KV8B 2UU9K 1TV6B 4AFFA 2NLWA 3HD2A 4DR1J 1KXPA 1X9MA 1B64A 4PQAA 4JOUA 4OYOA 1SV5B 3H3OB 3J7ZT 3M1VB 4ED5A 3VQ6A 3O9SA 4C11B 4LT6A 1KWMA 2YKOA 5J2MA 1W26A 3ILIA 2R7OA 1SH2A 1GTHA 4M5MA 5JVGQ 4N8NA 1T9TA 4IOCL 2EEYA 4KFBA 2M70A 4LFAF 1N6QA 2RE2A 2ZC4A 3AT1B 5LMNK 1BLUA 4ID8A 4W98A 5HRPA 3ULEB 2DHAA 3KHRA 4CIEA 4O4GB 1RDRA 1GAOA 1YG0A 3Q7BA 3NBPB 1S59A 4DB3A 4BRCA 4CK2A 2HBMA 1Q53A 4DV1F 2ZH8A 3CCQN 1T94A 3O4NA 3ZX0A 1HNVA 1RAOA 5IT9U 3TPQA 4BRMA 1ZBTA 2B51A 2QG9B 2KXHA 3EUNA 2D3UA 1WSEA 3C19A 5KQDA 1N36F 1UAXA 2ASYA 3M2UA 1GXUA 4K4TA 1HBMB 3EN9A 5LOQA 4B3MF 5FDLB 1YRTA 2YTCA 3GG0A 2M0GB 4E2FB 3MOZA 3ZLJA 4CH7A 5AQTA 3M05A 3RRGA 5I9EB 2ETJA 3I56N 2UUAK 3TJ8A 2HFSA 2DY9A 2DIUA 4N56A 1RU2A 1NJIT 3VQBA 1LW0A 4NA1A 4J9PA 1M5HA 5F0UA 2GQCA 1TUGB 1QZ6A 3THTA 4DR1K 3SJHA 5ADZA 4JS5A 2CZVC 4W4MA 5F2RA 4Y0WA 2HNZB 2IYGA 4LF5K 3ZZYA 3PZPA 2UUBJ 5LJWA 1Q78A 2KB2A 4DKWA 4RNNA 4LF2A 3PR5B 3HFZB 3ZT3A 4DQQA 2XYHB 3Q2TC 1HBOA 4ZHRA 1XR6A 2EHGA 1WHXA 4KH6A 4HACB 4TXSA 2RQMA 2RPIA 3DOLB 4F04B 2G8IA 3NWRA 3FC9A 3ZC4A 3Q2SC 4ELTA 2QI2A 2ZD1B 4WKRA 2AW0A 3C14B 4K4ZA 1I1GA 1RT6B 3R97A 4IRKA 4GVBA 3LANA 2MJNA 3ZT1A 2YNGB 3ZT2A 4JUZA 4DHYA 3V9XA 2XQCA 3P4UB 1SJ3P 3M32B 5M2PA 4WU3A 4ZS6A 1W7AA 1HFEL 1JJCB 5CAAA 4B3OA 4Z4GA 2CWXA 3M8ZA 4FK0A 3H2LA 4FLTA 3D1OA 3RRKA 1R59O 3I55N 1NK6A 4GMJB 4YOUA 5KG5A 1C0FA 4MIAA 4R25A 2IM1A 1JL2A 4LRFA 1S6QB 1YJRA 3M5RA 1DTTA 4C48A 1A6LA 1HWUA 3G82A 2VPZB 4DR6F 2RH3A 1HNWJ 3H0PA 3NF6A 5HMYA 3NGUA 3DU6A 2HFVA 3BR9A 5IM0A 4BC7A 3MX2A 1Z4UA 2CUYA 3MCSA 4PCQA 1C4CA 3DXSX 3H8YA 3DRXA 2IGIA 3MMBA 3SCIE 1NH8A 2P9KA 4F02A 3NVMA 4K2XA 2E5LK 2LDIA 1S72N 2HS3A 3V9ZA 3V1QA 1K44A 4CEOA 3NHGA 1GLCG 3OTDA 1D8YA 3LZJA 4ZP6A 2K8GA 3CI5A 2CNKB 4BC9A 4HHTA 2H9ZA 4IFYB 4KHMA 4NEZA 1J5OB 2KFYA 1VISA 1ZYQA 4GY2B 2FHKA 3AHPA 4H4KC 3TAMA 2F3JA 4MK8A 2ACYA 1HPZA 3SMPA 4C2MA 2CNNB 2LEPA 5J2PA 2LU1A 3KUHA 4DUZJ 7FDRA 4EYIB 3Q0AA 1HPMA 1YQHA 2JLEA 2IS3A 1BCMA 2AJFE 1N5YB 3AJ2A 2BOPA 3M30B 1I6JA 2FVSA 3ZZTA 4DR3J 1WN7A 3M2RA 4CH1A 3AVGA 4PAAA 2XULA 3ENOA 2FZGB 4L3KA 3R1LA 3ENHA 4B9TA 4IKAA 3FZKA 1JXEA 1SUQB 1DKGD 3D6HB 1Q8KA 1AFIA 1BY9A 2RQKA 4M3TA 4FSVA 2P9EA 5M1QA 3D54A 4ILGB 1YXQA 1X9WA 1RT3A 2J0XA 1KTVA 1VSIA 4C1NI 2VGMA 2HNDA 3R5BA 2CJ9A 1KR4A 3GYGA 1ZPVA 4AQYJ 3PW2A 3ZSYA 2MZSA 5C2FA 4DPOA 3SQ0A 3GTYX 2YVSA 2FPHX 1U0HB 3IS9A 2B8PA 2CQCA 4QS7A 2CJKA 2CPDA 1VSEA 1W0HA 3NGZA 3Q86A 3SMSA 2Y9HA 3MWTA 2CRLA 3I8BA 1RWMB 4EK2A 4H0TB 2Z8QA 1YITN 1FKAF 3G9CA 1BIZA 1O13A 3D4JA 1IBKK 4K0KF 3MR6A 1V4SA 4DTRA 2C28A 3PX4A 5HSPA 1AXQA 2D0CA 4BHQA 2QMXA 4JI7J 4BR7A 4OPHA 1PKUA 3WNEA 4BRDA 4Z4FA 1BU6O 1D0EA 1EB0A 1OQ3A 3DOMB 3ZO7A 4YMEA 3EE8A 3CJ7A 4LMZA 1QSSA 2COLA 4ID5A 3LGHA 4KTWA 1S22A 1TMMA 2MZTA 1GMWD 1Q8BA 5C7PA 4JI6F 3GR1A 4ZCLA 5AQLA 4LFBK 1DJ0A 5E41A 4LF8J 1VQ5S 4ECXA 3ENVA 1VSLA 1JLGB 3DKDA 1WG5A 4B3TJ 3K5OA 3CCVS 4IUFA 2UP1A 4BRFA 5HI7A 1RBLA 4K4VA 1RAFB 3HTVA 4X62J 1WF0A 3T1YF 4NZ0A 1ZXOA 2QT7A 3J7A1 3HBTA 4EBCA 4JRQA 5AQOA 1ZC6A 5E33A 3OYEA 5DM7Q 4ECSA 1FJGK 1NNDA 2O3DA 4YOEA 2P9NA 4CEQA 3WC2A 1YF5L 3TI0A 3D1QA 5HROB 2NRHA 4DZDA 3IMQJ 1S1VB 4CJ3A 1MDUB 4EHTA 3WNHA 2Y8YA 5GINA 4ZVUB 3MN5A 3RTVA 4CGHA 5J1NA 1C0UB 3EZWA 1FJEB 2JWKA 4HT5A 1EETA 3W3DA 3X1LB 5KT7A 2D0PA 2VZ9A 2GWJA 2R42A 3OVSA 3SJJA 1E3MA 4A2AA 5FPMA 1AUDA 4DG1B 2J8AA 3B8AX 4ETXA 3R5DA 4I2QB 1SZ2A 4ILJA 1WC5A 4NLUA 1P27B 1Q5YA 4ZPCA 2HF3A 4K8RA 1ILYA 2FYXA 3B8HA 3CDWA 4Y6IA 4K59A 1FERA 2YWWA 2ATQA 4JKBA 2W4DA 1WSGA 5HO4A 2ZH9A 2VQEF 2YNIA 2DNPA 2OEKA 3R6GB 1M90T 3GLJA 1BI4A 1JCGA 3D2EB 2CVEA 2XHBA 1TL4A 2LXIA 2DXDA 1YTUA 5AQFA 3K0SA 2IOCA 1J5EF 4KJIA 4FLZA 2YX7A 4GNIA 2XLJA 2QKBA 3C6TA 1PJ5A 2FJBB 3O44A 3ZZPA 2RF2A 1QDUB 4F0KA 2IRXA 4P2SA 2WTFA 5AQIA 2HWHA 1ITGA 3RMCA 4CVNE 1Y5NB 1J53A 1SKWA 1KQKA 4YQWA 1BISA 3QBWA 3T9ZA 1OO0B 4J91A 1NGAA 2O5DA 1ZBSA 4M3ZA 1X4FA 4JAXA 4LSLA 3VEZA 2CQ4A 3BB5A 3G8QA 4KGZB 2QYGA 4M5IA 3FMBA 2XM3A 2E1MC 4IO9L 4F9OA 2PI4A 1CULB 2HHHK 4ZPWR 3LP0B 5C2GA 4F4ZA 3HHDA 4NXNF 1V3SA 2V4JB 1JK9B 4CFAA 2E8AA 2P9PA 2ZE2B 2NZ4A 2IA0A 2ZGYA 5J2NB 2L9DA 2LQ9A 3EXCX 3A8YA 2KW4A 2ZH1A 4AXIA 4IDHA 1VMBA 1U2RA 4NI2B 3BQ0A 2N4DA 5J1EA 3BREA 3OFFA 4WJBA 1O0PA 2WTUA 4O8KA 1R6YA 4CO1A 1RSCA 2X51A 3PJ9A 4A4JA 1HQEA 4BE0A 2BRKA 1VC5A 2RU3A 3MFIA 1O5JA 2DHHA 3C15B 1ZH5A 3MN6A 4DR7J 4ILHA 3R7NB 2WK4A 4GKKF 4NL5A 3U27A 4L73A 4FWOA 3DYAA 4U7UD 1KVAA 2MPUA 4QYZJ 4DFKA 2AYMA 4CEZA 4IOBA 2MY7A 2PY5A 3G8TA 3I96A 1UWBA 4LF6F 1UPMB 3EE3A 4LD0A 1SXLA 2BW7A 4FM2A 3PRBA 4I6WA 1WSRA 3T3FA 4L75A 4FBTA 2Z2YB 3MCPA 1LWFA 3HXMA 2E5IA 3NNAA 2V2ZA 1VRQC 2MMYA 1S4FA 4Z37A 2AZ3A 4LF7J 2Y1RI 5DMRA 1MSWD 4MAKA 4DR5K 3GONA 3R27A 4CEFA 1JCFA 4A8SA 1S0MA 5BR8F 3H4BA 1HYSB 4RW9B 4LQ9A 4USIA 4C0OC 2QFIA 1KLMA 4FWNA 1R31A 4NLRA 4ZVFA 3CPEA 1FTRA 1VQ5N 3DRSB 3LAKA 4KRWA 3MR3A 3E3XA 4WXOA 3TU5A 1YJ9N 1WELA 4LC9B 2Q1LA 3VGLA 3GFHA 4ZA1A 2HBJA 4CIGA 1YJUA 2YHWA 3VF0B 4DQRA 1Q86T 1I94F 3NAHA 4B1VA 4AL6A 1WG1A 2RQ4A 2I7PA 4NYFA 3PFEA 7FD1A 4U7BA 2ASLA 1C1BB 2GQ2A 1B7YB 4E7IA 3G6XA 2HZVA 3I82A 4O3SA 2PT0A 1L3UA 2D5RA 3MAQA 4BREA 2M7SA 4BACA 3RSEB 3ZETA 4LSZB 4MYTA 3IP0A 4DJBA 5FPNA 3SPYA 4CJPA 4CJQA 4UQTA 5KFIA 2A3ZA 2A6AA 3DOKB 3VEXA 4RWWA 4CLZA 2KO1A 2XSFA 4ZJQA 4DDFA 4FJLA 4JI4J 1C0MA 3MR7A 2C3YA 2JRSA 2AJ2A 4Q44A 2D74B 3CIPA 3CCMS 3G25A 3T6JA 4KSEB 3LM9A 2VWJA 1NB7A 3AVAA 3CIZA 3UO0A 4K2JA 3KK2A 2DCLA 4E7HA 4DCHA 3H42A 1L3TA 1VLYA 2UXCF 3K2PA 1TKZB 1NJXA 1MWYA 3BF3A 3D66A 4B1UB 5HL7L 1FRMA 4X84A 3AXKA 2BE7D 5EXWA 4EU0A 4RG8A 3VQDA 1B3TA 2HK2A 1HNVB 2OSQA 4H5VA 5K8MA 2MHEA 3VAMA 2QEXS 4KH0B 4C3KA 1GMVA 1H2VZ 2XO7A 1TYQB 1WOPA 4X4UA 1KHWA 4HTUA 1GLDG 1IBLF 3AJDA 5FPEA 2KHOA 3EGVA 3KG1A 3B6BA 5EX5A 4FNHA 2YKNA 2OD4A 4CJEA 4O3QA 3V9SA 2Q36A 1LXJA 4WIQA 3LP3A 1HNZF 1S0VA 3VQ7A 4J9OA 5H9EK 5K14B 1FE0A 1K8AT 4MO5A 3BZCA 3A8KA 4OYWA 3ET6A 3Q7CA 4USMA 1REVB 3TVZA 2WW4A 5L39A 3QYYA 5KFEA 4WU2A 4F25A 2HRUA 5LXYA 2IVMA 1Q4RA 2V9WA 4E7LA 3MEGA 3EJMA 3H59A 5KFTA 4DV7K 3VETA 2WBNA 4DEZA 1SS6A 4EUVA 4DQPA 4CGIA 1HBOB 1GNKA 3KDOA 1F3FA 1CG2A 1MW7A 3NGTA 2E2NA 1V4TA 1FE4A 1R0BG 1FNOA 2D3OR 2QA2A 4ED8A 4JV5J 1RBOB 2F8HA 3CD5A 4X2BA 4XH5A 4A59A 4F2RA 2QE5A 3L3CA 2DGSA 2D3ZA 4GO5X 3R6MA 4IG0A 3CDUA 4J2EA 2J0WA 4BGBA 5E3AA 3VAIA 4FWSA 1E6YB 2DR9A 2XYPB 3MXMA 1VC6A 4NCAA 3MN7A 4BR2A 1NB2A 4W5NA 2DFHA 4U7CA 3FR0A 2R7QA 2UXBK 2GO8A 3HDSA 1EQYA 2ASOA 2K3IA 2DGOA 2V2QA 4OIXA 1K9MO 4NA3A 4P6QA 3SQ2A 3CULA 4CZIA 3DMJB 4DSIA 1WEXA 4Q0BA 2JLGA 4YY3J 2J76E 5JICA 4RJVA 3R7SB 4G1IA 2W7OA 5E84A 3N6MA 4TLQA 1T3VA 4Z4CA 4ZP7A 2GVZB 4KHNA 4USTA 3VQAA 4KT0C 2JX2A 1F9FA 4PY5A 5IFMA 2GC8A 4KGKA 4FNIA 3VEYA 4J37A 3GIJA 2MEWA 2KRRA 1KTQA 1OVQA 5AQNA 4O5FA 1ZM9A 2ZWOA 3U4LA 3OTOF 3DRRA 2IDEA 4KHWA 1YRXA 1WAFA 3CJ5A 5A2QU 5AJ3K 2WSFC 1R8PA 2QIFA 2DHXA 4BLGA 2J7UA 2VIHA 3IUCA 4IG3A 2P9KB 1GLEG 3KUGA 2ZJPQ 4P2XA 2FQQB 3V1RA 3O3HA 3BH6B 1X0FA 2YX4A 5KFHA 1RTJA 1RK8A 3WXLA 4BRIA 5IT9Y 4N47A 1VQ4S 2KTQA 1HPZB 3QERA 3KFWX 5J2PB 4H0OA 4CZJA 2QWPA 5E3CA 4F3OA 1HR0K 1RWKB 2W41A 1Q7LB 1FTCA 4WPAA 2F4FA 3V6DA 1EP4A 2CQ1A 2F7TA 4NA2A 3AA3A 1RT2A 3QZ7A 2W8LA 4IO1A 2ZHOA 2PFDA 3HSZA 3J80U 1OY8A 1NGCA 3EWGA 3OLAA 5F9LA 3OS2A 4PYDA 2GVDA 2Z30B 3KKSA 5ETQA 1G99A 4AM6A 1FRHA 4IKFA 2VKRA 4OJHA 5JJBA 3T1HF 1TK0A 3Q8RB 5GMEA 1XIQA 1WSVA 4X66J 1WHWA 3FZMA 1FI4A 4TY9A 3NGYA 1NUEA 3N4QA 3US5A 3WNGA 2XWXA 2OH2A 1RT3B 1UJ5A 1FFGB 4N8OA 1CC7A 2OYQA 3PX0A 4KHUA 3UDLA 3M4XA 1S5ZA 1GEHA 4CHPA 3LGNA 2E5GA 4EGLA 5LXRA 2FSNA 4OZJA 1OMSA 3M6GA 5C10A 4EO8A 4NRTA 3DRPA 1U6BA 4JI8F 1FDNA 1K73O 1X9JA 3QESA 2B0GA 2G13A 2IDLA 3IXQA 4J9MA 1SQEA 2RKIB 4B1XB 4K25A 3CFOA 1SPBP 2F5GA 2VFVA 1VSKA 3F73A 2NUHA 4EO6A 3O9QA 3AOBA 4YR2A 2DGXA 2P9UA 2HQFA 1T0TV 3VENA 3MM6A 4C8NA 3OUYA 2Q97A 5I42A 5H9FK 3BR8A 1SC4B 1T9UA 5RUBA 3VF4A 4M8LA 2HVEA 3M2VA 4UW2A 3EE9A 4JK7A 4CIOA 2J0QD 3MM9A 4F3MA 3GIRA 1WC4A 3QGGA 4XDDA 1N32J 3T19A 2WVBA 4F50A 4BRQA 4GKJF 1WC3A 4HUEA 3OPKA 1XMBA 3AO5A 3TAQA 4Q2MA 2F1FA 1EQ0A 2AYGA 1ZBIA 1TL5A 2POKA 3D5MA 4QIGA 3R5CA 3DJCA 2M2BA 1RQ0A 4C8LA 1TKTA 3QT7A 4QOTA 1MLAA 2GW8A 1G15A 2OEMA 3UR0A 5F8MA 4U8VA 2FHOB 2WVEA 2WVCA 2PA3A 1QVFM 2ADBA 4LRCA 2P9IB 4LBPA 2Z2MA 1FT8A 2CPZA 1BWFO 4C7QA 3V1OA 2HBZB 1VSHA 1XEZA 4DV5F 5BR9A 2QYCA 4DS4A 4F4KA 1FXDA 3I32A 1HHSA 2CQBA 2D9PA 1IQZA 4NLPA 4LFAJ 3CMES 1VQOS 1PBUA 5KG6A 3U02A 4AL7A 2LU2A 4ECVA 1PCAA 1KVJA 3U9ZA 3AQPA 4F4AA 4DV1J 1Q7YO 1XJWB 3VEOA 4Q43A 2VOPA 3PUFA 4FPAA 4Y3CA 1N36J 5KPTA 4G1QB 2DTJA 4X4SA 3TYTA 3U7JA 3L3UA 4B3MJ 5IOLA 1WBBA 3G96A 3VAFA 1EETB 2FY1A 4DFMA 3PNIA 1TVRB 3LGMA 1X3NA 3WQPA 4IOCQ 1QVFR 3OTBA 1WDDA 2XY8A 4DL7A 3BEGB 1RHRB 3QMLA 2XY7A 2B9EA 3SI6A 1WSFA 1JLCA 5J2QA 3CNQP 4TSXA 1S9FA 3VQPA 3SUPA 2PA8D 3TAPA 3RB3A 2NRZA 2UZAA 3GG4A 5U47A 3A5LC 2XEXA 3FCHA 1M5VC 2FLNA 3RB4A 3R2CJ 4CHNA 3L2UA 4JRPA 2Z2LA 1VBKA 4FJHA 3B54A 5I3UA 2KYZA 2VDHA 2VOOA 2ROEA 2UU9F 1NU0A 4USHA 1QVGM 4RCHA 4Y2CA 1M1HA 3O9RA 3MN9A 2OPPB 4DLGA 3GJSB 3BY5A 4ITSA 1H2UX 4H4MA 5HP1A 4YS2A 2RJZA 3MXIA 2JHEA 2OGUA 5KG2A 1VQ4N 2E5HA 3HHNB 4WFNQ 8RUCA 5E2QA 1RAJA 3SCJE 5DGBA 4YUDA 3AGKA 3C6TB 2FZKB 2VICA 4J8FA 2RUGA 3WT0A 2I5JB 2RF2B 4EBEA 3HPOA 4CK1A 1WEYA 3VMFB 4JI5K 5LMNF 1VAZA 2OJ3A 1ASUA 3BS9A 3E9OA 3LPUA 4LSLB 3ZZOA 3W5YA 3ENQA 3DDNA 1J2VA 4O44A 2FB0A 2BUPA 2BE2B 4OYZA 1YAGA 1CS4A 1TKXA 3A2FA 3CCSS 1F9EB 2LEBA 1BA1A 3OYMA 3NAIA 3VVTA 3UKRA 2MKJA 1ATNA 1Q79A 1NGDA 5M1OA 4OZ0A 4K8XA 2RIJA 2PBDA 2QTDA 1QVGR 3HMJG 2GEMA 4JS4A 4JV1A 5C2DA 3ELHA 3KK3A 3HKWA 4DR6J 1T8EA 4CM0A 2UUAF 1QLNA 2QXLA 2DRBA 3KWGA 4JK8A 2MQPA 1AZSB 5KFFA 2C1EB 3F5TA 4DFPA 1N8RO 3UD5A 3T1AA 3QJLA 5IS2A 2HURA 4OGCA 1DTQA 1HQEB 1RP5A 2AIRB 5GAEP 5D4LA 1VQMN 4CO0A 2ZBQA 4LF5F 2XS2A 4JNEA 3V6JA 3JS9A 2YH1A 3IWNC 2GHWA 2VODA 4ER8A 3VCDA 1Q81T 2ZWHA 2OZSA 3UDVA 4V19S 2V6AA 2JDJA 1MN7A 2DH8A 2QA1A 1GMUA 4CF8A 1Q8LA 4BWJA 2VPWB 3VGMA 4IFVA 2HG4A 4AL5A 4L74A 1AROP 2I8EA 2W2MP 2NRXA 3BGRB 4M5HA 4ICLB 4EFHA 2XCPA 3ZZUA 1FKOA 1HMVA 3CC7N 1JQGA 2NXNA 2DBBA 3H5XA 5A8WA 4OX6A 5GMKa 1HNIB 3FBEA 4CJ5A 4NRUA 3DLGB 3NGKA 4JI1K 3VQ4A 3EPGA 4ED0A 2CZ9A 5BRDA 5DDRC 3T7ZA 3C6UA 3MTJA 3CCLS 1U1OA 4OVLA 3RJMB 5C25B 4K50A 2M4MA 4CBUA 2BGGA 5D0GA 1NK5A 3MR5A 2D69A 4B8CA 2J5AA 3NFAA 3OYFA 2JWNA 1YZ7A 2MYFA 1CJKB 3N0VA 2CPXA 4XH1A 1FKPA 4RW6A 2V52B 1R8HA 5D3GB 3AVLA 3E8OA 1BQMA 4YR0A 3AJ1A 4A8MP 1UZDA 4LJMA 3KD1E 2ZH2A 4DSKA 4IWVA 1SJQA 1VQON 4BQZA 1SIWB 1S1UB 2AMCB 4B8AB 1S97A 4CO4A 3RAXA 1ZBUA 1NDCA 1VGYA 1HQUB 1VRTA 2EBGA 2L3MA 2E5LF 4M7XA 4B17A 1JLAA 4AHVA 3W61A 3PW4A 2IJFA 3KUEA 3D7SB 3M8WA 1BUPA 3G0ZA 2B6AB 5L1JA 3L9ZA 1T6DA 3THYA 2R8KA 3ETMA 4I9LA 3J7ZO 2IVYA 4ED1A 4F67A 2HEKA 4UOGA 1RWPB 4ZKAA 4K0KJ 1HKGA 3UQSA 2V7ZA 1OYEA 4ZTJA 3MK6A 4URQU 4OI6A 5EGYA 4H5RA 1IKXA 1YJ7A 4PG7A 5IV3A 4WBFA 4CNYA 2M5YA 1Z1ZA 2MQQA 3RYLA 1FX2A 2O8CB 4QR0A 2ADCA 5LMUK 2CDQA 1YHQS 2Q6BA 2QKKA 3KLGA 3DGPB 1XR5A 3SQGA 2DR5A 2EK1A 1FHTA 4DR2K 4JI6J 3T69A 4P2FA 3KK2B 2DR7A 5AQZA 3RZAA 1BC6A 1MMNA 3V9UA 2A2CA 4ZDNA 2UUWA 5HQ8A 4YDUA 3DDKA 3P4IA 4KKOB 4DR4K 1PO6A 4Y28C 4FPRA 2YWEA 2HBQB 5T14A 4YDUC 1ZA2B 2MQ8A 4QU6A 1WKLA 2H5IB 1KFDA 2XYGB 3T1YJ 1XQIA 4O3OA 4EBDA 2GJIA 1NJIO 2W9BA 3DAWA 5HRNA 2CJBA 4OJ3A 4H0XB 3AY9A 3MPWA 1NHVA 3S1TA 4I67A 3ET6B 1RWOB 2O8EB 1R0AA 1JLQA 1D1UA 4DF4A 1Q5VA 3R7BB 1SCJB 2XC9A 1N48A 3G71N 4C97A 3JS6A 4HEA9 1VQKS 2JFKA 1EWRA 4UQGA 4MQ3A 4UZBA 3MEGB 1IBKF 2J6UA 3DLEA 3JSBA 2B4PA 3BQ1A 2BR0A 1OS5A 3GJQB 4KGXB 1O1WA 1FJCA 3MCNA 2VKZG 1XMOK 2DITA 2P6SA 3KLHA 2AGQA 2IAJA 3NNHA 2CKWA 2NUUG 3A8JA 1M1KT 3P96A 3VQ8A 4NLSA 2BM0A 3ITHB 3V81A 3D0GE 5ADXA 2Q79A 3MEDB 3L6QA 3IAM9 3W62A 2J9DA 3H2UB 4Z7CA 1FXXA 3VQCA 4JYAK 3AAPA 5HMWA 1LAVA 3FVYA 5KFYA 4DV3K 4IG0B 2M8HA 2HBRB 2FLOA 1J6ZA 3JSYA 1WWHA 5AZJA 4HCCA 4CBWA 5SZTA 4E89A 2LA6A 4LFBF 3L95X 2VQEJ 2LQBA 5A6PA 2RS8A 3DLLQ 3PKMA 2QJ3A 1KD1T 4WFZA 4J2BA 4M3YA 2XZWA 4DX8H 2AQ4A 3LTOA 2V68A 1J5EJ 4AHCA 2HW3A 1JLEA 1DGKN 1B4SA 1SKSA 1WJ9A 2W4PA 2FSKA 2F96A 2JC1A 3PO4A 2P9LA 2IY5B 4A8OA 1V9OA 3LM2A 1TL1A 2DPJA 1RT7A 1FJGF 2BOAA 2HQIA 2MZJA 2NZTA 2NLXA 1U1RA 3PFOA 3Q8UA 4ETZA 3NMRA 4Y0FA 2AA4A 1NK7A 3CCJS 3QEWA 4ZCKA 1RCHA 1T95A 2A6MA 1TZ0A 5BN8A 1URNA 3DI6B 5DK5A 4FJMA 2W01A 3CCLN 3VOVA 4GC7A 3D1HA 1TKDA 2R9LA 4NXNJ 1R27B 1FD2A 2MQOA 1VIXA 5FIIA 3QIOA 5ETOA 4HR2A 3SDEB 3W60A 3AB2B 2BQ3A 5D15A 3L2WA 2HMIB 2ZUAA 2HFNA 3OFGA 2AKWB 3QLHA 3OYHA 5F8HA 1UW4A 2CPHA 1CSJA 2VG5B 1PAEX 1KSPA 4WYBA 3HX9A 2YKMA 4X65K 2FBYA 4B02A 2F8TA 2EKNA 1WD6A 3V6DB 2ZITA 4KY3A 3GCXP 4WXWA 5DDPC 2NRTA 2G0CA 3NRBA 1E4GT 2NXEA 4MKYA 4JHDA 2N4CA 3D6FB 4MYUA 1MU2B 4OGEA 4GKKJ 2QM1A 3IM9A 3UPFA 4I9QA 4FLWA 1RT1A 4PWDA 3ZXWA 4PRFA 1F0XA 1DLOB 2WCXA 4TVAB 2XS7A 3SCXA 4DUYK 2HLTA 3WUHA 5EVZA 4UZCA 4LF6J 1Z05A 3PHTA 2MQLA 1JJ2M 1YI2N 1W2BM 5KRSA 3NKYA 3C3LA 3B4MA 3Q23A 1JL1A 4FCYA 1W9HA 2YQ3A 4QWAA 2L08A 3UE5A 1B0TA 2OIHA 4R5PB 3MX5A 3CJ9A 1PSDA 1Y5LB 1YHQN 2RRNA 3MMVA 5KT4A 2QLFB 1Y10A 5GAHP 4NXMK 4LFCK 1UZHA 4PQUB 5BR8J 1TL7B 3BDEA 1IJJA 3VAGA 4CJ4A 4WK3A 1EKSA 2HHHF 5G0RB 2OMOA 4MO4A 4FLXA 3HZ6A 2GV1A 2XBPA 3IM8A 3MPVA 2HYIB 2F9WA 2I7NA 5LM7E 3F44A 5C24A 2K1RB 4C8MA 3MM6B 3UCUP 1RI7A 4CJLA 3BP8A 1RTIA 1X9SA 3D0IE 3R1XA 1ZAWA 1QAIA 4QIEA 2VU5A 4F0MA 1Z6RA 4O3RA 4AM7A 3CIMA 4M5KA 3CETA 3HHLD 2HF4A 3MM9B 3RW7A 1I94J 3A8IA 4WF9L 3P1GA 4TKTA 3QBXA 3O8MA 1N5TA 3J81U 2UUCK 1A0OB 1JJ2R 3H5YA 2E2OA 3B4DA 1W2BR 1CXQA 3N4WA 2KYXA 2O8DA 3Q8YA 2W42A 3JXUA 3THXA 3CQXA 2JGUA 1D09B 5A2QY 2PMZD 1RT4A 1SBRA 4CYUB 3AVMA 1RDBA 1NK4A 1YJNN 1JWWA 3L7UA 1I3AA 1Q95G 3KNAA 3BN4A 4DTPA 3C46A 4M5JA 3SUOA 2BXJA 4GO7X 3VVUA 3THWB 2F9DA 4QR1A 4X4TA 2VD3A 4BQLA 1CZAN 1SH3A 1RGVA 1JCEA 4KR0B 2B5JB 2O67A 4RW8A 1D3WA 1F5CA 4FYYB 4LQ3A 4PWUA 2HAFA 4IDKA 3EL2A 3L2RA 4DR5F 1X4HA 4Y65A 1S49A 1GLAG 3MUMP 4MDAA 2DD8S 4AXJA 3QBCA 3OSPA 3VAJA 2UXCJ 1UMJA 1RDUA 4CTAA 2DR8A 4R0EA 4KTQA 4DPUA 3TZXA 5E0OA 3L4BC 2AYEA 2DNHA 4EZ9A 3TO8A 3BBBA 1NDLA 4KHRA 2ZNYA 2E2QA 2GELA 4B1ZA 3J8AA 3MCOA 1IBLJ 2WONB 2V8GA 5AQXA 3J7YP 4Q45A 1Q9YA 2E7VA 4JBCA 3VGVA 2G8FA 2MTLA 4GMKA 3GJRB 4AH9A 1LWEA 5AT1B 4RNOA 1T03A 1JIHA 4LR9A 4LIWA 1AT1B 3CYMA 4XPCA 1HNZJ 3DLJA 2AYBA 4E98A 3MECA 4Y00A 3R3LA 1H2TZ 2VF3A 4BDYA 4YEAA 2QMWA 3WEEA 5HL7Q 1EAYC 4I68A 3CCJN 1XNQK 1WSIA 3P39A 2P9SA 2LSNA 4QJVA 3GCWP 2YNHA 3SXLA 4CHQA 2W9CB 3E9PA 3RB0A 3EYZA 2P5GA 4GC6A 4RW4A 4QW9A 1NKBA 2GNKA 2EC2A 3TEGA 2PEBA 1KHVA 3TUZC 5CZVA 3TZWA 1CZ9A 2NSBA 3CD0A 5EOYA 2XZTB 4CGJA 5HP1B 3G6YA 4LR7A 5KFMA 2XG8A 4O0NA 3CTRA 4Y1CA 1DHMA 3N9UC 4ZVQB 1L3KA 1WEZA 4CZLA 2CADA 2RRAA 1UEUA 1RABB 4I6MA 2A18A 1UVNA 3M8PB 2APOA 2ZUGA 5KFBA 2CH5A 3UKUA 4ZIWA 1Z25A 2UVVA 5AZIA 5L1KA 3IAYA 4ED2A 3O6WA 1N0VC 3FRYA 2LP4A 3OR2A 3QO9B 4CZKA 3CDBA 5A0YA 1R8BA 2GZOA 3ICLA 3N28A 3W0LA 5IZHA 5DLFA 1ZAXA 1Z26A 2E9ZA 3D9BA 4KO0B 4HDGA 1CS4B 2I38A 1TKXB 4B9NA 1MMDA 4YDDB 1WUAA 5THWA 2YKAA 2XLIA 3E9LA 2XHCA 2R2SA 3ZSZA 4OHZA 3T9NA 3UB5A 5DO2A 3RGIA 2M9KA 3EGWB 1RGIA 4N77A 1YKWA 1Y00A 3KK3B 3QFHA 1KC8O 3C2PA 1YTYA 4FVMA 1NH7A 3HP6A 1NBEB 1JMTA 2IC3A 3OTOJ 1KVIA 2ZH7A 4UUXA 3FRZA 3KG0A 3MM5B 5CABA 3RAMA 3OFHA 1NBWA 1WAJA 3E2EA 1FRLA 5CCLA 4P9SA 2AEMA 3AQOA 4USVA 3NWGA 4ZLLA 3GSDA 4DV7F 3VZIA 3SBMA 3VQSA 5A8KA 3OL8A 3AVJA 2EFOA 1HHQA 4CE9A 4NX9A 4U95A 2WBMA 4CDIA 3VQ5A 1AA1B 3TABA 2D1CA 5C5JA 2RILA 2YCHA 3QQCD 2CZ4A 2G8VA 3IWXA 1QQNA 4DTMA 3W3SA 2RQCA 1S10A 1I3OB 4DV4F 3X3UA 4ZN1A 1MG7A 1Y3JA 2ALYB 2E9RX 2BACA 3IR5B 3IMXA 5C42A 2H54B 1WSJA 1QE1A 1U26A 2EI5A 2NREA 1GOCA 4DCOB 5EN1A 4J90A 2UXBF 3LP1A 2W7AA 4YHHK 3WDOA 5D4OA 1AFJA 4RUAA 3OVAA 1P1LA 2KJWA 3QSYB 3KLEA 3TR8A 3RBXA 2FJAB 4MH8A 3T1HJ 1EJ7L 2Y8WA 1Q0NA 2OTLN 3GFZA 1NEEA 4OYXA 1RKIA 1HNXK 4F8RA 3TX8A 1DT9A 4NASA 3LL3A 3PYFA 3NF9A 3KHHA 4U9RA 2QRRA 3BO4A 1TGOA 1Q86O 1IM4A 1XNRK 3K8VA 3K5MA 2CJQA 1C1AA 2ZBCA 4ID1A 4L3QA 3PYGA 4ANCA 3EDRB 3ZEUB 2F8EX 1IKVA 2CPJA 3RVCA 5AJ3F 3K57A 2ZHAA 4PXBA 5F8NA 2R8GA 4DSJA 2ZVSA 4BRKA 4C8YA 3AFGA 3VR1A 2G2YA 1UVMA 3T5HA 3CWJA 4YOTA 4I2PB 1JLAB 4LSNA 1RFQA 1QUPA 1FNMA 4DTUA 3M8QA 1T02A 3KLFB 3JSMA 2VG6A 1HQ2A 4CI0B 2R7TA 1Q82O 4FJXA 1JXVA 5CD4A 4FLUA 2RMLA 5TKWA 1G4CA 1XTZA 3K5NA 1HR0F 2EC0A 3AD9C 3V5RA 1IKXB 5JVHL 4YP3A 2AZ1A 1KFSA 5FLXO 3CJTA 5SWMA 2UYTA 3LQVA 4JI2K 3QEIA 3AVHA 4CI6A 4GKJJ 1WB9A 4Z4EA 2O8FA 3LF0A 3MMCB 3H1VX 4ECYA 3KLGB 3G6ES 3ZZ0A 4QW8A 3QEPA 5KFAA 4F7VA 2I0XA 2X78A 2VYPA 3BV8A 5AQHA 1RTZA 4MK9A 2HMPA 4H5NA 2NNWA 3HI0A 2CFXA 2C3OA 2J9CA 2IA6A 4J9SA 5JS2A 1SVDA 3NEKA 1IG8A 4DV5J 4E1JA 3PLAA 2VUGA 3GR0A 4EYHB 3OV7A 4R8UA 5FD1A 4GVLA 2FJEB 2IHR1 1VHIA 1EWQA 3OXGA 2NRWA 3O6QA 5A6WA 4MTPA 4A61A 4RZRA 1K8AO 2OPSA 5ETTA 1S6PA 2JJ4D 3OBWA 1TFWA 1VQLS 5EX3A 1IKYB 3CJKB 4H5TA 4FJ7A 3TUIC 5IV4A 4M45A 2Y3YA 1F6TA 3P5BP 1GFWB 1R8CA 1JLQB 2I9SA 2B4VA 5BRHA 1T9XA 3N6LA 4BR0A 3JXOA 2CPYA 1CLFA 4FPIA 3DM2A 4CJVA 2ZNZA 4DTSA 4PWWA 3IGNA 3IG1A 5GAEI 4HI1A 5F3ZA 1K8KA 3CUNA 3CM5A 5DQGA 3VGKA 2D1KA 3PV8A 4CLUA 2O4GA 2OD6A 1WF1A 3VQQA 4DV2K 1SAZA 4CJRA 1YIJS 4USKA 3JYTA 3MWPA 1YZ6A 3FSXA 3V81B 4NOHA 3GFXA 4NLWA 4DV0J 2ITGA 2ALZA 2NYHA 4YOWA 1UVLA 1RWUA 2K7KA 4ZJOA 3QIPA 3MM7A 2KJVA 3S3OA 1RDAA 2D7SA 2OZMA 2UU9J 2MKHA 2QWMA 3HRGA 1AUSL 5IC6B 1XQSC 3C6HA 3H90A 1EO1A 3SAFA 3CCES 5KFPA 4AHSA 3A5MC 4CW7B 1RT5B 4I0WA 2RS2A 5FRNA 2IYIA 2DNKA 3FFIB 4HVZA 3FKBA 1JLEB 4NYOA 2CA9A 3UDCA 3IDHA 4M3RA 4H4OA 3KIOA 4FOIA 4LIRA 4MFBB 2RT3A 1TL1B 1NPPA 1RT7B 5LMNJ 1Y5IB 1HL6A 3C16B 5B8HA 4ILMA 1X1PA 3PJWA 2VL1A 4KB7A 1RWWB 3OTCA 4CT9A 4DL3A 4RNMA 3PIPQ 4FM1A 2B8QA 2LYVA 2AX1A 4OJGA 3S41A 3O9TA 1N54B 1CLQA 4LVNP 2F65A 3ID6A 3O3LA 1HBUB 4FXVA 3GMGA 5CYQA 4E3SA 1NNEA 2W2OP 1A5VA 3BZKA 4YR3A 2Z1HA 2HVZA 5KFOA 4PPDA 2BANB 4DV0K 1SKUB 4CJWA 4M94A 3MHYA 3CD6S 4NLGA 2UUAJ 2G4BA 3CE8A 1YLXA 4FF1A 2VJVA 3QT5A 1PYSB 1YVNA 4FJKA 4QIWD 2FLPA 3LWMA 1LK5A 5AQMA 2IBKA 3D7EO 3OYAA 3EVWA 4QIVA 4LF5J 3DXKB 5L1LA 4IQMA 4JEPA 1HD1A 2B4OA 2ZH5A 4JHDB 2R4FA 3C66A 2HNYB 4WKYA 2J6TA 2DFEA 5B0EA 3NCIA 4AF1A 1HJRA 1BOTO 3GE9A 4BG8A 3LP2B 5M1KA 4F0HA 4X4OA 1OH7A 4OI4A 1J27A 1S1XA 5AXKA 4KAZA 4OPAA 1IO2A 2QWLA 2BM1A 4M42A 1SJ1A 4ZPDA 1UVKA 4JI5F 4NCBA 2YX6A 3V4IB 3TRGA 2O66A 3QWPA 1S6OA 4B08A 2RDDA 2EK6A 2F4VK 4UOCA 2N7YA 1SL1A 4RW7A 4K41A 1T9YA 3CQYA 3KJVA 2F63A 5M2RA 3G6EN 1JLFB 1LWCB 5HLFB 3KK1B 3CCUN 4UOFA 2D0AA 3UVJA 4MKVA 4FJ5A 2QZ8A 2KFNA 4WFNL 2HHQA 4TQRA 1NGJA 5IT9O 4OX7A 1S79A 3U9DA 3O1BA 1U1NA 3DLKA 1OPZA 1NJZA 2GMHA 5DRKA 3ULDA 3D45A 4DL2A 2HGMA 4PEOA 2MZ1A 2KL8A 2GO9A 2O8BA 1YT3A 3LPYA 3AXMA 2MXYA 1JLBA 2UUTA 1YJWS 2AD9A 1U2VA 3GFYA 5KTQA 3PY8A 2Q1NA 2QW9A 1XN9A 4U6PA 3TSQA 5B09A 3NH0A 5F3TA 4DN0A 3UN2A 3PJXA 1P9YA 3AVKA 4EI2A 3LWLA 3W8GA 2FHMA 3A3NB 4ANDA 4WE1A 2BABA 2O8DB 3SUQA 3KYLA 4DU4A 2E5LJ 4WK1A 4X64K 5T7LB 2ZBPA 5GAHU 5AFUH 2FLLA 5BRFA 3P5JA 1VQ6S 2FD2A 3FEZA 2PYJA 2AEJA 2PZSA 3BSAA 1MN9A 1BXNA 2CWKA 2PN6A 3PSFA 4FZXC 3CC2N 1U7LA 3JQJA 3H40A 2ZBRA 1BHNA 1IWGA 4MLHA 3W9IA 4L72B 3I0SB 2FJDB 2OO4A 1RYRA 1IR1A 3UFCX 4OKKA 3PIOQ 2L9WA 4ECRA 2WHOA 1YIJN 1ROFA 3ZSWA 3EICA 1TL3A 4BE1A 1CJUA 3J7AN 1SC3B 4I4BA 3OYGA 1RKJA 4U67L 2LEAA 4JI1F 1HLWA 3PYDA 4X4PA 4MT1A 3CG7A 2CGLA 1ZM2A 1HUXA 1C0TA 3OS1A 1XMQK 4QAGA 3VQ9A 1HIYA 5HVFA 3IC1A 1K6YA 4YOYA 4ES2A 3QAEA 3FGVA 3O3FA 1S99A 4CO2A 4LF4K 3FZLA 3A0IX 5AXMA 3FZFA 4RWTA 4FYXB 3BPSP 1QQCA 3J7Z5 4QU7A 2YI1A 2Z56B 4OV6A 3ZSOA 1HBNB 3OYDA 3F9KA 4EP4A 1YK9A 4G9ZA 2OANA 1S6UA 1U2FA 3CJ1A 1LV5A 3IWLA 4X4QA 2K2PA 3M8YA 4PG8A 4AILC 1GX5A 4ZITA 1QTMA 4LY7A 1NM2A 1S76D 4KV8A 1TV6A 3VGTA 3ATUA 5HVGA 3A3OB 1HWJA 1SV5A 3M1VA 3NG8A 2AGPA 4N76A 3RBZA 4C11A 4TU7A 4NWBA 4A8XA 1RAEB 3OR1A 1AYEA 3OFEA 4OYMA 1YJTA 3K58A 1D5AA 1MWMA 3OW2M 1IBKJ 2NRRA 2LFVA 5L38A 2QA4S 5B7WA 3UN3A 3HSCA 1RJJA 3IRXB 1W7WA 4OKEA 4O4GA 3CD6N 3J7YU 1U24A 4BC4A 3OL9A 1SQFA 2MKIA 3NBPA 1VQPS 4BRHA 2OPQB 1UFWA 3RWUA 4FJGA 2M8DB 5LMUF 1PGZA 1XHXA 1BHLA 3J81Y 1LXNA 4KB0A 2LA4A 2KZMA 4AHTA 3OHRA 2VG7B 4DR2F 4UY8T 2KLAA 1E6VA 2XMUA 2OEJA 1UPPA 2KN4A 5FPDA 1NSKL 4LFBJ 1M5KC 2FHJA 3P38A 1HBMA 1C0GA 4DR4F 4KH4A 5FDLA 4CF0A 1U1QA 2XS5A 3NF7A 4YOVA 5GAHI 1EX8A 2OFGX 1U47A 5CH7B 3GILA 3HP9A 3I0RB 4O5BA 4G1PA 4RBUA 3O4QA 3IBFB 3DXBA 3TUPA 2J9DE 3K5PA 3OW2R 1ZM3A 1FJGJ 3R9LA 2RHKA 1GOBA 4KGVB 5DZ6A 3U3GA 4IZ9A 2HNZA 2PDAA 4EEYA 2W6LA 1UWAA 3QRPA 4B9MA 1C1CB 4EMDA 2D4WA 2VA3A 1LW2A 1CJVB 2C2OB 1YX2A 4BG9A 3K9JA 2G0JA 3P6YC 1ATRA 4HACA 3KLIB 3DOLA 1I5OB 5AR0A 4FZYA 1RAIB 3VF2A 1CEZA 1Q81O 1RADB 4BDZA 5A8KB 1S1TB 2ZD1A 5M2UA 3C14A 3SBGA 5KFKA 2DXEA 3P31A 1RT6A 3EVMA 1XMOF 2DO0A 2QGFB 5IC4B 1F5AA 2UVUA 5JS1A 3CO9A 5CCMA 3HO1A 1U04A 4HVJA 1S9GB 5HATA 4YB7A 4ECWA 4JYAF 9RUBA 2JEGA 5KFXA 4JD2B 5KFRA 4DSLA 1YVUA 3ASMA 4Q7AA 4GV6A 5L46A 2VH7A 1NK0A 2NYIA 3GWCA 4DV3F 2HQCA 3P45B 2GWKA 1RBSA 3JTOA 2OKQA 3GP9A 2WSEC 4B9SA 4LBHA 5D6GA 2E4LA 2IVFB 1S6QA 4A62A 4J9RA 1NDPA 2M52A 3L3VA 3LP1B 3ZTSA 4K4YA 1ATSA 1XERA 4BVPA 1YTAA 1J54A 1KAYA 4M5DB 3BF1A 2MB0B 1WOQA 4A5BA 4LRDA 3NLCA 2CXEA 4FXDA 3SI8A 4FWPA 1NK9A 1TK8A 4BR5A 3W63A 3EKSA 4H0PA 2ASDA 3AOAA 1TUUA 3DLLL 3J7YI 1FW6A 4Y34A 3I9V9 1W2IA 2NQPA 4W5RA 4IFYA 1NM1A 2IDOA 4Z7YA 2A6OA 2MKCA 1J5OA 1OH5A 4P74A 3Q8VA 4RNHA 2HHHJ 3K0JA 1A5XA 4B1WB 2DYAA 4A5AA 2XMTA 1ZA1B 1Z2ZA 1ACMB 1R89A 4C0HA 3R2DJ 1S1WB 3QSIA 3KMSA 3SV4A 1N33K 4YB5A 1PC5A 1UFKA 3AB4B 3OQ2A 3M30A 2FVCA 1ZBFA 2MSTA 3QGIA 4IJAA 3NS5A 2Z1GA 1U2CA 1LWXA 4TU9A 4WCEL 1WNSA 4O3NA 3GQCA 3SCKE 4KRFA 4IR1A 3OSNA 3W2VB 4LF1A 2NPFA 3L09A 4X65F 3LA0A 1U1MA 3LDOA 2JOQA 2HRYA 3PG9A 1IJFB 1SUQA 2LCWA 1ZZNA 1N52B 4C0BA 3O9UA 2YJFA 3K7RA 2CJYB 2YKPA 4ECUA 3FEYB 2OAUA 1F1BB 2QL5B 3NGRA 2BJ3A 3V6KA 1JKHA 3HHLA 1UJ6A 1RBRA 4JI0K 2FVRA 5I3PA 3HHLC 1UETA 1UEKA 1URRA 4BE2A 1NOYA 2DTUA 4KC5A 3I31A 4DUYF 2QA4N 5F8GA 2QK9A 4WF9Q 2BKOA 2QLXA 2MQMA 1D9AA 3TQEA 2YNFB 3NE6A 2KRBA 3TWZA 1U45A 3EEQA 1KBRA 4R8UB 5AQJA 1RAAB 5T7BA 1XR7A 4ISGA 1O8BA 5LJVA 3NL0A 4DR5J 4B3SK 3HVTB 4AHRA 3VV2B 5E26A 1VIOA 2C2ZB 3VQEA 1S6PB 4NXMF 1XI1A 1FJ7A 4LFCF 2DGUA 5GVQA 3OYNA 1NMNA 2KT5A 5B0BA 1G2EA 1OY9A 4X4VA 4PUOB 4CEAA 1RTDB 2HPUA 1GLLO 1FDAA 3HFVA 1KQFB 2PMWA 2DY1A 4CZMA 3ZFVA 5ELZA 2Q2RA 4EIAA 4MK7A 1Y11A 2OPRB 1VBZA 3O2IA 2CGKA 2NSCA 3IG1B 1NZAA 3DOMA 1BWEA 1PILA 3TR5A 3UCGA 1UVIA 4Z4IA 1U8SA 1PAUB 4OYBA 2XSJB 3QFPA 1FK9B 1VQSA 4I69A 4JN4A 3PSIA 3MCMA 2R8HA 2YXLA 1IXKA 2Z57B 2RUSA 3KNGA 2UUCF 3P83D 1KP6A 3RMDA 4USUA 3JYTB 2XMVA 2G1HA 4B9QA 5IWAK 4URSA 4DQSA 2XWYA 4B9UA 4NMLA 2P5OA 3RR7A 2XMKA 4IOAQ 3HSJA 1NLVA 1JLGA 3CMAS 2WZ1A 2R7XA 2Q0RA 3ALYA 2VC0A 4JK9A 3PVXA 4FJ8A 2E1ZA 4DMZA 5CE3A 5KOWA 4C8ZA 4HI2A 3CC4S 4TN2A 1LOTB 3G4SS 5M1PA 2XHWA 4I6YA 1VK0A 4CFDA 4NCGA 3MMJA 1M5OC 3MMAA 3E01B 2BYCA 3KVGA 3D2FB 3A5NC 2CG8A 2QL9B 2N3LA 1BQNB 1YVFA 3AY0A 1GQEA 5HROA 4CLWA 4WQ5A 3IN5A 1K1QA 4DPYA 3EZOA 1RB0A 1S1VA 4DSFA 4WQ5C 4A8KA 3GG1A 4IRDA 4H4OB 1RHQB 2VPYB 2VQFK 1DFDA 1YBTA 3AO3A 4KHPK 3KDNA 4A48A 3EPIA 4F4XA 4Y2IA 4DV6K 4J2DA 3AVNA 3CCVN 2F8SA 3VTIA 1BG3A 1C0UA 4NLQA 4QWEA 4JKAA 1YRUA 2J0SD 2Z1JA 1VOMA 3HK2A 1L3VA 2JVOA 4E0DA 1X4EA 3I5CA 4ZVOB 4HTIA 3OHBA 4DG1A 4PXEA 2VFSA 1RTHB 4I2QA 5CQGA 2MZRA 2SXLA 1FD8A 3CGIA 2X1FA 4JI3K 4I6AA 3CO0P 3UN5A 4LF9K 2RB7A 1JJHA 4K42A 3GV8B 4FZVA 1OH6A 4J2AA 1FWLA 5H9EJ 4B9VA 3TTDA 3DFEA 4FLVA 4OX9K 4N5SA 4OZNA 3CJAA 3CCQS 3KG4A 2NZCA 3K8WA 4KBIA 1XNQF 1X0PA 4ZVRB 3D2EA 2HFZA 3H2VE 4LUBA 2VBWA 5LSLA 4JKGA 2FC0A 1YSJA 5J2MB 2PO4A 4DV7J 4K5SA 2KVQE 3GV7B 5BPNA 3HL8A 3QEVA 3SIPB 1VJWA 2DEIA 4DU1A 2CQPA 3FSYA 4KFBB 4YNQA 2EKYA 1N4LA 3TSUA 2K06A 1N6QB 2N7CA 3HD1A 3KHLA 2C3MA 3BYPA 3LDNA 1ZS6A 5CR4A 2ATCB 5L8RC 1U25A 5K8NA 1QAJA 5AQSA 3L2VA 5F41A 4QWBA 3UCZP 4ED6A 5T41A 3GL1A 2A1SA 2A0FB 4OFZA 4DV4J 4DTXA 3ZTRA 2FGCA 2VHGA 5EWEA 1CULA 1NMEB 4LBIA 1NGFA 2V4JA 5GIPA 3MXHP 2ZE2A 3KJVB 5J2NA 3W7BA 1M5PC 3M2UB 3L8BA 1SIZA 2UXBJ 2V5HG 2RU9A 4ECZA 1KS2A 4O55A 2WVFA 4IBNA 2EFPA 3L7PA 5B0DA 2ROGA 4P52A 2HSEB 3M6UA 4HHUA 4I1TA 3BQ2A 2VDIA 2ZKTA 3DLKB 3POTA 4ANEA 2V8DA 3DDIA 2QA4G 1LW0B 5D77A 3I4PA 3S9HA 4CLKA 2R2RA 1V5IB 1KAZA 3BDPA 2B9WA 2UXDK 5F9NA 4PKHA 2BQRA 1N8RT 3H08A 2VBYA 1RILA 2D0OA 1LQ9A 5HMZA 2O8BB 3TWHA 3GYNA 3M9NB 2DEJA 4CCHA 1WC1A 5JUMA 3DU5A 3C15A 3EM1A 5KT3A 1DZ5A 3EO3A 3JAMU 3CW2C 3AOCA 4XO0A 1VQNS 3PEHA 3D68A 3SQOP 5AJ3J 3QAUA 4ZHRB 3GIKA 3BKUA 2AF6A 2RRBA 1S0NA 3N4PA 5C2CA 2V7YA 4QOZB 4C98A 4ES3A 4W5TA 1H6KX 5AQGA 2ZJQL 3I5BA 1P90A 2GJ2A 4WP3A 2YHAA 4NB4A 1VQ8S 2L41A 3UW1A 2DO4A 4IEEA 3KOAA 3GJTB 4CLTA 1KQGB 4DV4K 3OJSA 1BGXT 1C6VA 1U6FA 3F0NA 2ZM6K 4GVBB 5GIOA 2QC3A 2KT3A 3ADAC 2A41A 1HR0J 3TVYA 2QLWA 1HYSA 3IGVA 4B3OB 4RW9A 4C4WA 1PYTA 2KXNB 4M3XA 1NSPA 1TL3B 1WOSA 3H25A 4NYZA 5F0XA 3AO2A 1HI0P 3Q8PB 4ZIVA 4RO0A 4RUCA 3CMAN 1M5SA 4FJIA 2RHQB 1OKJA 2G2ZA 4XDCA 3HKZD 4YHHF 3SMZA 1DTTB 5KGWA 3G4SN 4CGFA 2CAJA 2P8IA 2JZ5A 3KJQB 3G82B 3MF5A 5L9XA 2R7VA 4PKDB 2R7UA 5HJYA 1HNXF 1V5VA 4OI1A 1N34K 2HS0A 1C1BA 5IM0B 1U4BA 2VV5A 1WBDA 3ATVA 3LZIA 3H3NO 1XNRF 2F7VA 1VK3A 2VGNA 5JVHQ 1R6VA 3ZCMA 3AA8A 2IMOA 2PC6A 2Q66A 4O0IA 2CQGA 4DPXA 2P9CA 3MMBB 4WTYA 1QAXA 3RSEA 3MAAA 1M0SA 2BZ2A 1EKRA 5KFNA 1VFJA 4FBUA 2E7WA 3FQKA 3RW6A 5A2QO 1B70B 3DOKA 3TZZA 3QT6A 3TAMB 3WZ0A 1FWKA 3A12A 4DX7A 3RRHA 2R7SA 2QTWA 3A1YG 4FW1A 3ISND 3FZ2A 3OR1B 4OZ5A 5H9FJ 1SC1B 1NGBA 3VTHA 4LRAA 1UVJA 1R3NA 4UTGA 3HCXA 1X60A 1X5PA 5LL6Z 3M2RB 2AGOA 2BQUA 3ZTQA 1WDTA 4P7VA 4EWTA 1H74A 1KLNA 2JWLA 1TKZA 4DN9A 4JI2F 3AARA 1ZM4A 3Q22A 5B08A 4RU9A 4KIAA 4B3RK 4CHYA 2A5XA 3QATA 3AA9A 1FRXA 3UE2A 1Y4ZB 3J80O 1U1PA 1FX4A 1YITS 1E6VB 2DPIA 1IBMF 1LAWA 1TYQA 4QWCA 3HULA 2IBOA 1DQ9A 1Y3KA 3AVFA 5L9NA 4PG6A 3LALA 1VS3A 2XY6A 4OI3A 3L4QA 2HNDB 9ATCB 3CCMN 2Z58B 2YWFA 1WNEA 1S48A 4ILRA 4KPCA 1ELOA 2LVWA 4QR2A 3MFHA 1GTEA 4M63A 5K14A 1NU4A 3WXIA 3IS9B 4WP8A 4K7QA 1Q18A 5KFVA 4M63C 3I6PA 1EHWA 1REVA 1FFWB 2DKOB 3SZ2A 3TP2A 3RG6A 1HX1A 1YDLA 3AA4A 2ZJRL 2ZC3A 5CYJA 3U1NA 3I9ZA 4ZPVR 4DMNA 1X5OA 2VCPA 4HLBA 4Q5VA 5LJ3Y 4CLFA 2QEXN 4M5LA 4JKDA 1LW2B 2EX3A 2EFQA 1F2GA 3CMQA 2DNRA 2DFFA 5IT4A 3S3NA 2R7YA 5K8OA 3I5AA 1P1TA 2AEFA 3K17A 3C7NA 3UI3A 3MI7X 2O01C 1VBYA 3HI9A 1PJ6A 4H0VB 3G8SA 4C6AA 4M95A 4AD6A 3V9WA 3HJVA 3H5UA 4ID5B 1U02A 2RHSB 3H6EA 4DV2F 4NZ7A 5LY3A 2J6SA 2EG2A 4XTTA 3MPYA 1E6YA 5EU7A 3RB6A 3AGRA 3A13A 2F9TA 1HYVA 1VQNN 2C2NA 1VDHA 1VBXA 4A46A 2G2OA 4X4RA 2UV8G 4X4NA 2W2NP 1GX6A 4FS1A 1W97L 3OLBA 1VSFA 4DTOA 3DMJA 2OFHX 3OYKA 4IFEA 2CPIA 2CJXB 1TP7A 4HUFA 4JKCA 1IV0A 2QO3A 1VQ8N 2GVZA 3NOGA 1NGGA 2IRUA 2P9NB 1H3DA 4RX6A 5AE1A 4CEDA 4ZP8A 2UUBK 2P2CB 5KFQA 2K3KA 1WUUA 3QJPA 1RAHB 4IEIA 4JKHA 4JI5J 4CD3A 4H54A 1BA0A 3D3BJ 5BYSA 3PEJA 5DG8A 1BE4A 2AJQA 2OTJS 4HT7A 4OHYA 4RTFD 4BC5A 2X1BA 4DS5A 3QICA 4FVUA 4H4KA 3LPEA 2W2QP 1NOZA 3DXMA 2MGZA 3DLRA 3AA2A 2CVIA 3U1LA 4G65A 3NH1A 2HS4A 2DVIA 4FYDA 2PFUA 4CERA 5DGAA 2CNOB 1TR0A 2EWSA 4C8KA 3OYIA 4DV0F 4CHZA 1XBWA 2YWGA 1O6XA 1IUJA 2BBEA 4HKQA 1QHTA 5HQLA 2HLUA 3PIPL 1NGIA 2FVQA 1H98A 2P51A 2BEFA 4CM2A 1DQ8A 4CBXA 5LSRA 4IRCA 3U6FA 1T3OA 4AHUA 2R8IA 2VC1A 2HK3A 2YNIB 4OX8A 4CJTA 4ZN3A 2AHOB 2XI2A 1BI4B 4F2SA 3AVIA 4WFBQ 1VSDA 3DHXA 4B1YB 2BUNA 4FP9A 1ZZFA 4PPZA 4JV0A 1HNWK 4DHVA 3H45C 3T6BA 3V2UC 1JKHB 3HHLB 3ZSQA 2KQ2A 3DRYA 4TU8A 2JEFA 4D3HA 3PCOB 2FBXA 3N01A 3S6EA 2PEHA 4FJJA 2HHVA 2BDPA 2ZH6A 1UEVA 3L4IA 4LH5A 4GV3A 1LOUA 3W9HA 3CCTA 1KVBA 4ECQA 4NLOA 4PHTX 3BH7B 2RKIA 4FF3A 4IJNA 2V34A 3LPTA 5AQYA 1RU1A 3NH2A 5KFZA 1CVJA 2CNLB