4WFBL

The crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with bc-3205
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
110
structure length
110
Chain Sequence
MISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKGVTLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYLYHGRVKALAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S rRNA
publication title Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2014-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4wfbL01
4IO9L 2QEXN 3OW2M 2OTJN 4WF9L 5GADP 2ZJPL 1W2BM 1QVFM 1OVYA 5GAHP 4WFBL 3I56N 1VQPN 3CC2N 5JVHL 1YHQN 5GAGP 3G71N 1YJ9N 1M90O 1VQKN 1K9MO 1YI2N 1VQ5N 1Q86O 3CCUN 5MLCQ 3CCJN 1VQ9N 3CMEN 2ZJQL 1KC8O 2QA4N 1YIJN 1ILYA 3CPWM 3G6EN 5HL7L 5H1SQ 2ZJRL 1JJ2M 1VQMN 3CCEN 3CC4N 3CCMN 1K8AO 1VQ6N 5JVGL 3CCSN 1VQLN 5DM6L 1KQSM 1N8RO 1QVGM 3CCRN 3I55N 4WCEL 4UY8O 5DM7L 1VQ7N 3DLLL 3CCVN 3PIPL 4IOCL 1S72N 3PIOL 3CMAN 3G4SN 4IOAL 4WFAL 4U67L 1YJNN 1NJIO 1VQNN 3CF5L 1VQON 3CXCM 1Q7YO 2OTLN 1VQ4N 3CC7N 3CCLN 3CD6N 1Q82O 1VQ8N 3CCQN 1M1KO 1YITN 1K73O 4WFNL 3J7ZO 1YJWN 1Q81O 1KD1O 5GAEP
chains in the Genus database with same CATH superfamily
5KI6A 4AQYK 4BRLA 3QNOA 4BE1A 3KK1A 4JKDA 2GBZA 4FOEA 3TTCA 1W2BM 1HNZK 3V1RA 5M1PA 3ZETA 4DFKA 1S1XA 2E2NA 5BR8K 4FJMA 4EP4A 5CE3A 3U6FA 1U49A 4JKGB 3WXKA 2RE2A 5GAGP 3NHGA 1YXQA 3M1FA 4DQRA 4B8CA 2FBXA 1ATNA 1B92A 1RT3A 3H46O 5C24A 2QKBA 3AVKA 5AQIA 1FW6A 4CI6A 1Q9XA 3SQ2A 4BRPA 3LP2A 1KC8O 1YIJN 3HPOA 2ZWHA 1W7AA 1X3NA 2UXCK 3O3FA 1HYSA 5T7BA 1NK8A 2D0BA 4FYDA 3L4IA 3AAQA 2P51A 4YOVA 1TYQA 1S5JA 3KWGA 4AILC 3AA5X 5AZIB 1U47A 1VRTA 2IVNA 3F9KA 3VGLA 3WNEA 3TTDA 4AM7A 3AO4A 4Z4EA 1ASWA 5FLXO 1RBSA 1EXQA 4B3MK 3L2RA 4CEOA 3K9JA 3ZT4A 3O3GA 3MX5A 3FLCO 3OBYA 5EY4A 1GLEG 4CW7B 1QS4A 4ELUA 3QDKA 4I6MA 3UIQA 1WBDA 3CCVN 2Z1HA 4O0IA 3NH2A 3CETA 1S72N 3QEXA 1HNXK 4NYNA 5J2PA 2V7YA 1NGCA 1IBLK 1TKDA 1NMDA 1NGDA 3O1BA 3BGRA 2ASOA 2HNDA 4BRFA 4DUZK 3ZEUB 2HSTA 1KXPA 3K5LA 4CZMA 5AQFA 5EVZA 3SI6A 5LY3A 1SKSA 1Q8IA 3HZ6A 3ULEA 3I8DA 3THXA 4IDKA 1D5AA 2O4GA 5M1NA 3K0SA 5IT9O 2W6LA 4E7HA 4M3YA 3U8XA 1IG9A 1JLFA 1WOQA 4FLXA 4BR9A 3L4QA 3ZX0A 1I39A 3NVKA 2KQ2A 2A1RA 3CQ8A 3ZSVA 2BTFA 5CYMA 4BRAA 4B1UB 4IFEA 1TYQB 3PX4A 1T7PA 4Z4FA 3LDLA 3OS1A 3TAPA 4M42A 1F21A 3SAGA 3AVAA 2ZGYA 5E41A 4DLEA 4DTSA 1Q86O 3SUQA 3ATVA 1C1BA 2GEMA 1ZBHA 4BWJA 3A0IX 2XY5A 5KGWA 3VQ7A 4DV2K 2OA8A 3NF9A 2PBDA 4FJ8A 3HYFA 3CPWM 3GBTA 4CJFA 4DV6K 3EEQA 5HL7L 5H1SQ 3U9DA 3RSEB 4M3TA 4HUFA 1LW2A 2UU9K 1E4GT 2E20A 5TKYA 3THVA 1YUWA 3NF6A 4I6MB 1HNWK 1QSLA 2WOMA 5LJVA 1BIZA 1LWEA 4O8KA 3RRHA 3U3GA 1HQEA 2EHGA 3OBWA 1N8RO 3MMVA 3EZWA 3HVTA 3LP0A 4EIAA 1SKRA 3P39A 4FK2A 4X65K 4CFCA 4FJLA 1WN7A 4FJIA 1NJYA 1J5OA 4YORA 4CEQA 2KFNA 4B08A 3DLHA 4CJWA 1QZ6A 4CZKA 4GKKK 3AA4A 3DLLL 4ID5A 1KAYA 3ULEB 3THXB 5AR0A 3K5OA 4EHTA 3OYFA 4F2SA 1Y64A 3MECA 3H3NO 3T1YK 1XWLA 1Z25A 5F1XA 2ZGZA 1VQON 1SZ2A 3I0SA 3QEWA 1NLVA 2CGLA 3CHWA 4BR7A 2GUIA 3TABA 1VQ4N 3NAEA 1NGEA 1ZYQA 3CD6N 4PKGA 3CM6A 2Q31A 2G8UA 1SV5A 3L3VA 3SQ1A 5ADXH 3FZFA 2QKKA 3O4QA 3R9PA 1RT1A 3HP9A 4IZ9A 5F0XA 5KGXA 4JLHA 1GOBA 1L3TA 2P9UB 4MQ3A 4CJPA 1X9JA 3DJCA 3SNNA 4HVJA 1ZXOA 5AQPA 3HXMA 2Q36A 2AA4A 4A2BA 3QNNA 5FPNA 1U2VA 1SUQA 3QLHA 4OPKA 1BISA 3KKSA 2KKZA 3NFAA 4E7LA 1KLNA 3LZIA 1IKYA 2FXUA 1R59O 3SUNA 1N6QA 3V9UA 3LP1A 3LM9A 4M7XA 2I5JA 3O1WA 4XH5A 5BR9A 2P9LA 1UA1A 1NK7A 4FJ7A 2KTQA 4JI1K 3QO9A 1NKBA 4H8KA 2A1SA 5AQJA 4FLYA 4NXMK 1RTIA 3CC4N 1RBRA 1D9FA 1JLAA 5JMVA 1TVRA 2YX6A 4FVMA 4FLZA 5JVGL 1VSJA 1HNVA 1RBVA 1BUPA 3M8SA 1MDUB 2IDOA 4FM0A 1QZ5A 1B9FA 5AQMA 1VK0A 1S1UA 4AHTA 2J4RA 3N4PA 3PO4A 2Q1NA 3DLBA 4J2EA 1GLDG 4H0PA 1DT9A 4CVNE 3VN5A 1OVQA 1JKHA 1LCUA 3WEEB 3P31A 4DU4A 4PL8A 4O8UA 4FLTA 3V81A 3PIPL 2YHXA 4KHYA 4DS5A 1GLFO 3LL3A 3MN6A 2VQFK 4OVLA 1BI4A 4CJ7A 4ZTJA 5FPEA 3S3MA 3AA2A 3G10A 3SPZA 1G15A 1KLMA 4ICLA 1XNRK 4CJ4A 4K25A 2WONA 1WSJA 4BY9C 4FCYA 3BEXA 3SJHA 1WSHA 3CCLN 3MK6A 1Q82O 2O8CB 1M1KO 3PLAA 1U2VB 3E1YA 5HRNA 4B1YB 3L0QA 3MEGA 4GNIA 3VERA 5CYQA 4CBUA 4N5SA 1OH6A 4FJXA 4DF8A 1Q81O 4CERA 3WXMB 1DTQA 4BR4A 4DKWA 1C0UA 5EOYA 4BC3A 1X1PA 1SKWA 3AO1A 4MLEA 5AZJB 4LFCK 2IGIA 2P5GA 5AQNA 2E1ZA 3DI6A 1IH7A 3GE1A 3J81O 2HOEA 2HHUA 1HLUA 2YKMA 4FZXC 4KHQA 3RMDA 1B9DA 2F8SA 1ITGA 4A2AA 1ASVA 2E5LK 3NGYA 1YJ9N 4JI7K 1ZBUA 3SAHA 1L3UA 3KLGA 4YDUC 1Q9YA 2PYLA 2E6LA 4QOZB 4BRDA 3ISNC 3TAGA 4CIFA 3LAKA 4CK3A 4CK2A 4E7JA 3ALYA 3E01A 3VQ8A 3NVMA 4KFBA 4LF6K 1K8AO 4CBWA 4ISEA 4QS8A 3TARA 2PFUA 2O8EA 4YOXA 4BWMA 2P9IA 3VTIA 4E19A 4DV3K 4DTOA 4JRQA 2HB5A 1BI4B 1CZBA 2PY5A 2QK9A 3H08A 3O08A 2UUCK 4HHTA 5JICA 4CJUA 2ATQA 2OPQA 1W97L 1HUXA 3QESA 2XY7A 4TSXA 3I33A 3VPZA 3Q7CA 4NLBA 5LJWA 1A5XA 4FM2A 3J8AA 2OPPA 4MDBA 3V9SA 3ZSRA 1T6CA 3QERA 4BGAA 5KPRA 5EU7A 1NJIO 4BRNA 3A5MC 2A42A 5CY4A 4CEEA 3HI0A 3OVNA 3AA3A 4W5RA 3P38A 1T6DA 3L2UA 2IVOA 1EX4A 2WUSA 4JI3K 3L3UA 1J53A 1X9SA 1YJWN 3NCIA 3PX0A 4CD3A 3A5OC 3ZYYX 1RILA 2EWSA 1BQNA 4QCLA 2D4WA 2GX9A 3AO3A 2OPRA 2QWLA 2Q0UA 4JI5K 3L2VA 3VQAA 3WUHA 3MAQA 1NGAA 1S9GA 3G71N 4ISFA 5AQQA 4BRHA 1RFQA 1A5VA 1NK9A 1FXXA 3SUOA 5BREA 3CCJN 4RW7A 3QIPA 1OH8A 4B8AB 1QHAA 4CZIA 3HPGA 4MDAA 1ZBLA 4YFUA 1RTJA 3LDPA 4HCCA 4DQQA 4QS7A 3D2EA 3RR7A 1HJOA 3ZX2A 2NRHA 4ILJA 5BPNA 3IRXA 3OTOK 1IBMK 3S3OA 2HNZA 3I8BA 4F8RA 2QW9A 5JLHA 4WQ4A 2YNFA 2G8IA 4DUYK 1U48A 1SAZA 3MEDA 4CFBA 4Z4IA 3SCXA 1QQNA 3RMAA 3IAYA 4JKCA 1A5WA 4DQPA 3G0ZA 4KPYA 4CFDA 4X62K 1CZAN 3VEVA 1E3MA 2AP1A 2QWRA 4N76A 4UY8O 1S1VA 4JK9A 5KQ8A 1N34K 3KLFA 1RNHA 4H0VB 4FWRA 4IO8A 2V51B 4IEEA 2GELA 4CGHA 5AQKA 4I2PA 1JLCA 4H0YB 1WSEA 3CJ9A 4CIGA 1TUYA 3QB0A 1Q18A 3PUFA 2QXLA 4CECA 1VQ8N 3HM8A 4OPAA 1IKWA 1IKXA 3LAMA 5C2DA 4JD2B 2P9KB 3HTVA 4I9LA 4WFNL 4FJJA 3CJAA 4LF8K 4JRPA 3L8BA 3Q7BA 4FWNA 4DQ8A 3SAFA 4E1JA 2FSNA 2YJFA 4EAHD 3HL8A 1N36K 2A5XA 2IOCA 4IO9L 1QTMA 5E84A 2FF3B 4BR2A 1C6VA 1QVFM 4JKEA 2IC3A 4ELTA 2XRIA 1IG8A 3VEYA 4LD0A 1SL2A 4B9SA 3AVCA 3I56N 5C0YA 3A2FA 3ASMA 5ADXA 3UE5A 1J6ZA 3O9RA 3JAMO 3D2EB 3NDKA 1CZ9A 1NGGA 1YAGA 4N47A 2DY4A 4CK1A 2HBMA 4KTZA 1BCOA 1RDUA 2VG5A 3KTQA 4YNQA 4O44A 5C12A 4XIUA 4CFAA 2HNYA 1VSIA 5M1KA 3ZEUA 2NRXA 3SMSA 3DOKA 4KH4A 4OKKA 3OS2A 3OY9A 3A5LC 4Y1CA 1GOCA 2WBNA 1KVBA 1RBUA 1VSEA 3V4IA 3IKMA 3PY8A 4BRCA 1ATRA 2A3ZA 2YHYA 3RVCA 4FWMA 3HOTA 2NZTA 4HUEA 1H1VA 3VQDA 3J7YP 1KQSM 1FJGK 4HUGA 2YJEA 2YKNA 4KH6A 4KI6A 4LH5A 1X9WA 1L5UA 4RCHA 2HBJA 2IIRA 4JI2K 4FJ9A 3M8RA 1NKCA 5DM7L 2LSNA 4X64K 4YHHK 2ZM6K 3VQQA 1WSGA 3HO1A 1KVAA 5AFUH 4IOXA 4B1XB 5AQGA 1LWFA 1LWCA 3SZ2A 3QMLA 3H45C 4FSVA 3HOSA 2YHWA 4CD1A 1ZC6A 4UQGA 3S41A 5C10A 3WQTA 4BR0A 1TK0A 1EP4A 5KQDA 3AO2A 3FFIA 3RSEA 2HHQA 4E1MA 4OGEA 2RKIA 1C1AA 1W9HA 1WAJA 3TAMA 5AQXA 3AVLA 4AHVA 1UWBA 4ELVA 3K9KA 1BDGA 2QTDA 4JKAA 2QWQA 4GV6A 3QICA 4DV0K 3BZCA 3KZBA 2YNHA 5SZTA 4MFBA 4AM6A 5FDLA 4DV4K 2B4JA 1C1CA 1GOAA 4PKIA 2HMPA 1IJJA 5B8HA 1M90O 4E7KA 4B9NA 5D3GA 4NCAA 5FRMA 2P9NB 3A8YA 1EO1A 4W5TA 1VQ5N 2G8KA 5F2RA 4CF2A 3WNGA 1WBBA 2OYQA 3ZSOA 3D6RA 3BZKA 3JXUA 3EY1A 4CZLA 4EHUA 4CZFA 3OJUA 1KAZA 4LF7K 3CG7A 1HQUA 4FO0A 5CZ2A 3GL1A 1UAXA 1YVNA 1TUUA 4LSLA 1VAZA 3CM5A 1GLBG 3L2WA 2UXDK 1Z6RA 3E66A 3VQBA 3CCSN 5C42A 1J5EK 2O4IA 1TGOA 2P9UA 4WE1A 4M3RA 4CGGA 3M3ZA 3ENHA 1XI1A 3VF2A 4HWIA 3RRGA 4NLCA 2YNGA 3VGMA 2CGJA 4C8OA 3QETA 1T3VA 4RW6A 5BN9A 3DRSA 4DTXA 4IOCL 4DTNA 4BRGA 3F9MA 1WLJA 4B1WB 3HBTA 3GOIA 1TL1A 4NO7A 4E0DA 4IKFA 2Y1IA 3B6OA 2DFHA 2HVHA 4KTWA 4OLAA 2VQEK 3RMCA 3EE8A 1VSKA 2YNIA 4BC5A 1V4SA 3LDQA 1NJWA 2YHAA 4KAZA 4Z4HA 4DQIA 1HR0K 1JL1A 4NXNK 3K57A 4PA1A 5LMUK 1BHLA 5J2MA 3AVHA 2QEXN 4CJTA 3ID6A 3BDPA 2DTUA 1IV0A 4FWQA 4K8XA 3D2FB 1P8ZA 4JK8A 3T7ZA 3WEEA 3KWIA 1WSIA 3AGKA 1IKVA 4LC9B 3OYHA 3LP3A 2BGGA 1XNQK 1QE1A 3MDQA 3O9TA 2JWKA 4FJGA 5KPZA 3HP6A 1KAXA 5BPMA 4KHWA 1ASUA 4K41A 4BC2A 2G8HA 2DFEA 3HSCA 3DRPA 1BA1A 4JI0K 1NM1A 3ATUA 4NYFA 3CMEN 3FZLA 1JLBA 3PSFA 4CHYA 3MN9A 4CF8A 1ILYA 5BRHA 4FJHA 3K2PA 1JJ2M 3H6EA 2O8CA 5J1EA 1BU6O 1UA0A 3NMUA 1BGXT 2XY8A 3ZT0A 1GLAG 1JCGA 3H1QA 3WQUA 4K42A 1FKOA 4FXDA 4XEIA 3MEEA 1NJXA 4FZZA 3AARA 1C0TA 2HBKA 2Z1JA 5J2NA 3TU5A 5AZJA 2HF4A 1QVGM 4OLBA 4CIEA 1G99A 5HBMA 3I55N 4RTFD 2NRTA 1TKTA 4G9ZA 3SQ4A 2G8VA 2UUBK 1Z26A 3KIOA 3VQ6A 2ASMA 3O4WA 3QBXA 1NK4A 3ZT2A 4KRFA 3D7EO 4U67L 3C6UA 2P9SA 2UUAK 1NK6A 4JV5K 4M41A 4IWVA 2JWLA 3DLEA 3KKRA 3NH1A 2FC0A 1RT6A 3JSMA 5AQYA 4M63C 4FK0A 4O5BA 1K73O 3SV3A 3C65A 1T44A 1WSFA 3SV4A 1VSDA 1JL2A 4CJKA 4J2DA 1KD1O 3HRGA 3O80A 2FSJA 3THWA 1RT7A 4CZGA 3TI0A 4JN4A 2ZJPL 2AJQA 1XHZA 4DFMA 2ETJA 4FJ5A 3EKUA 3EYZA 4C1NK 1NU0A 2RPIA 1JLQA 3E9LA 4PHTX 1MWMA 4NB4A 1VQPN 4WQ5C 1HKCA 3MCPA 4WQ5A 2Q0RA 4KHUA 1J9AA 2HHHK 4C8KA 3GDQA 1QSSA 1LOTB 3MN7A 4Y1DA 4FOIA 5GIPA 1NGJA 3WNHA 2QA4N 1S1WA 3RMBA 1FK9A 3CCEN 4CGFA 4ISGA 3LPTA 1WB9A 3TAEA 1HJRA 1XMQK 2O8FA 2O8BB 5C2FA 5ELZA 3C6HA 4ILGB 3TANA 3QEVA 2P9SB 1N32K 1OH7A 2QXFA 3T69A 4IJNA 1CXQA 1IO2A 3D45A 3MCAB 2PAVA 4KV8A 4FJKA 1D9DA 1EWQA 3RWUA 2GUPA 4CHPA 4C8MA 3S9HA 2V7ZA 4PY5A 3NF8A 1KCFA 4H0OA 4F2RA 3O6WA 3VGKA 4CEFA 2F9WA 1BIUA 1KTQA 3EO3A 4KHSA 4CJ3A 2W42A 1K6YA 4IXCA 1R0AA 3LDOA 2E8AA 4HTLA 3THWB 3T1AA 4O5FA 4R79A 4IFVA 2OTLN 3CPEA 3UKRB 4CGIA 2G8FA 2Z1IA 3OHRA 4B1ZA 2GWKA 4EZ9A 1HYVA 4QAGA 5AFUA 4DV5K 2H3GX 3CQYA 3AGRA 3IUCA 4OPHA 2ITMA 3KD5E 2GWJA 3F5TA 3KK3A 1RDBA 3S3NA 1TK8A 2HBLA 5C25A 1DTTA 3VEXA 3OW2M 4FPAA 4DR5K 5GADP 4H5TA 3OYNA 3GG4A 2WFBA 4J2AA 1NWKA 3PSIA 2Q2RA 1RTDA 4B3SK 3NBPA 3EL2A 1VQKN 5LL6Z 2O8FB 5KRSA 4I2QA 3CFOA 3ZSQA 4A61A 3VEWA 4YY3K 5SWMA 3HVRA 2XO7A 2P9PA 4AH9A 5M1FA 4YOYA 3VTHA 1VQ9N 3LWLA 3DRRA 4M3UA 2ZJQL 3ZX3A 3RTVA 4BR5A 3VENA 2ZJRL 2HHTA 3V1OA 2B5JA 4Z4CA 2BUPA 5KRTA 4H5VA 4JD2A 2P9KA 4CJRA 3U9ZA 4DR3K 3DLKA 1S3XA 4CGDA 1BL3A 4CJ5A 4FLWA 4GW6A 4CZJA 4DU3A 3C6TA 1U45A 4LF4K 1O1WA 1SL1A 2HMIA 1RDAA 4DWIA 4JKBA 2JLEA 2VYPA 1NK5A 4CZEA 5HOOA 1QQOA 4DSIA 3E9OA 3MXJA 4IEIA 4F4KA 1X3MA 3AVJA 1N5YA 4NCGA 3AV9A 4ZHRA 5KTQA 5A2QO 3VF4A 4DSKA 2CGKA 4WQ4C 4IOAL 3J80O 1I3AA 1RBTA 3T1HK 2E1YA 1XHXA 2ZF5O 3OYAA 3HT3A 3AVBA 4KHNA 1NK0A 2F4VK 4I7FA 1Q7YO 4C8LA 4W5OA 3CERA 3QIOA 3O8MA 3CC7N 4FVUA 1RT4A 5JLFA 4O55A 4DR4K 3AVMA 2HHWA 1YITN 3HM9A 3FZKA 3CI5A 4AHCA 3VETA 1K8KA 2P9PB 4FW1A 4DQSA 2OTJN 3KLEA 4YOWA 1OVYA 1OKJA 1GLCG 3O9QA 2A6AA 1NGBA 4DR1K 1YT3A 4C1NI 3KLIA 3T19A 4B3OA 4C23A 5JVHL 3O9UA 4J8FA 4GVMA 3U4LA 4DTPA 1WUAA 4B3TK 1WNSA 5AQOA 2NNWA 4RWTA 4N41A 4CHQA 2VWKA 3LWMA 4GVEA 4B9LA 4GY2B 1DEJA 2EX3A 3O4NA 5HRRA 4A59A 1TKZA 3P83D 3VQ9A 4KTQA 3AVNA 3QFUA 4FM1A 2KW4A 1RDDA 3OYLA 2WC9A 1KFSA 4AHUA 3MXIA 3HK2A 2FF6A 2D0CA 4E1NA 1VQLN 3DM2A 1HX1A 2X6SA 3WXLA 4H5RA 4JI4K 4Z0UA 4FK4A 4LFAK 2Z1GA 2GTDA 4HCBA 2E88A 4M3WA 3CCRN 1U4BA 1BWFO 2X6NA 4BDZA 3OYIA 5CZ1A 4WCEL 3PX6A 3VQCA 4CE9A 3QEPA 2ZQBA 2P9NA 4DMNA 1TL3A 3ULDA 1L3SA 4DTRA 3K5NA 2OCEA 2KFZA 2QM1A 2FBVA 1X9MA 1VQNN 2HHXA 4IDHA 5I42A 1MA9B 3CF5L 1K8KB 4BDYA 1N33K 3DXMB 4LH4A 4L8RB 3DOLA 1T03A 4E89A 3F73A 3FE1A 4DCHA 1E4FT 4XH1A 2KLAA 2Q97A 3OYBA 3VQPA 1NGFA 4BDPA 1DGKN 3DWLA 3PO5A 4PUOA 5GAEP 4CHZA 2E2QA 2PZSA 3THYB 4DU1A 4B9UA 3B6PA 3WT0A 4WF9L 1P90A 1VSMA 4KH5A 1FKPA 3OS0A 4OPJA 3QEIA 2KZZA 4LY7A 1XQSC 5HP1A 5HLFA 3M5RA 4H5WA 4FPBA 3SJJA 4CEBA 2D0OA 4H03B 3BP8A 2OZMA 1NMNA 5EX5A 2CH5A 2D5RA 3ITHA 3HPHA 3V1QA 3ZSWA 3SPYA 3SK3A 1S22A 3E9PA 3AVGA 3KJVA 2VWJA 4X66K 3V9XA 3OYDA 1UOCA 4DF4A 3UB5A 1SS6A 2FBTA 2QWNA 1MWKA 4JI6K 1QSYA 4F3OA 3LM2A 3FFKB 3U3YA 3L2QA 1MU2A 3AVIA 4DFJA 4OX9K 4F3TA 4DHYA 5DM6L 2KZMA 4DSJA 1W0HA 3CJBA 3OYCA 1OH5A 5GINA 1D8YA 3D2FA 3ENOA 5AQRA 4JYAK 3ZETB 4K43A 4DLGA 3KHYA 4R5PA 3IDHA 2NRRA 2QWMA 1HKGA 3VEZA 2A41A 4CCHA 1HYZA 3LANA 2DFFA 3JYTA 4I9QA 1NG9A 1JLEA 2B6AA 3BY5A 1LAVA 2I7NA 4DR6K 3VMFB 4JS4A 4CF0A 4YOTA 3NH0A 5HRPA 1SL0A 1BO5O 4U7BA 4DSLA 3FZHA 4JKFA 3OYMA 4AHSA 4CHOA 5M1OA 4BQZA 2UYTA 5FPMA 4MO5A 2ITGA 2RF2A 1HNIA 1BG3A 1GLLO 3ZSYA 4M45A 4DTMA 4M7YA 2YI1A 4F9OA 3SUPA 1RDCA 1Z05A 2HHSA 4BREA 4Y0WA 3O3HA 4BACA 2QWPA 4KB1A 3CJCA 1QQMA 5BRDA 1JCFA 1YHQN 3FGUA 3AVFA 3MWTA 3IS9A 3TTFA 5AQVA 4BRIA 1HPZA 4B9MA 3OYKA 2HVIA 3CJ7A 3I0RA 3SMPA 2D0AA 3BUZB 3EKSA 3H1VX 3CCMN 3G25A 1GLJO 2HF3A 4CESA 1TV6A 2P5OA 4EZ6A 3H3OB 2E4LA 1HPMA 3MN5A 1JCEA 3MWPA 1NGIA 2ZD1A 3AY9A 4BC4A 2VCPA 2P1JA 3KD1E 4H4MA 2Q3SA 3W0LA 4CEDA 3WNFA 1VRUA 4CF1A 1RTHA 4FW2A 1ZBIA 3EN9A 1VQ7N 2G8WA 3BF3A 3M8QA 5DMRA 4A5BA 4WFAL 3NF7A 4IJAA 2Y1JA 1YJNN 3MX2A 1LAWA 4IG3A 4XH4A 1RGIA 1HRHA 1TK5A 2WTUA 2IVPA 4B9QA 3P1GA 4JHDA 4BE2A 1VHXA 3M6GA 5JS1A 5IWAK 4G1QA 5DK5A 4DTUA 4Q5VA 4OJRA 1L3VA 2O8BA 4H5NA 4DFPA 4BGBA 1EKEA 2XHBA 3ID8A 4CJQA 2W41A 4FWOA 4W5QA 4CJSA 1O13A 1D4XA 3LPUA 4B9VA 2VGNA 1EQYA 1VSHA 2BANA 4RG8A 3TAFA 1NOZA 1YTAA 3TSQA 4K0KK 3SQ0A 3CYMA 4FWKA 4H0XB 2FLOA 5I9EB 1C0FA 4KHPK 3C0BA 3V9WA 2F8TA 4OGCA 5AQUA 4B9TA 1K9MO 1YI2N 4DV1K 4GV9A 3ZSXA 5TKWA 5EXWA 4GV3A 2YHBA 4CJLA 4FLUA 4Q0BA 1YVUA 2CH6A 1NOYA 3P4IA 1DLOA 2RHKA 3UKRA 1BCMA 4DSEA 3G6EN 5AQTA 1VQMN 1ATSA 4NCBA 2NRWA 1J54A 2NRZA 2OPSA 3A5NC 4BQLA 4FWPA 2R7YA 1LW0A 2X78A 4H0TB 4JK7A 4JEPA 3ENBA 3O9SA 4A57A 3KVGA 3DYAA 4LF5K 4E7IA 3BF1A 1IBKK 3WXJA 4JHDB 3VF6A 5C15A 3MXMA 5K14A 2GV9A 3L6QA 1NGHA 1TAQA 5FRNA 4MO4A 1EWRA 4KKOA 3OA9A 3C6AA 5AQLA 4LF9K 1EETA 1RT2A 4KO0A 3R3LA 2OZSA 4H4OA 5JS2A 2P9LB 3CQXA 2UXBK 2F7TA 3CXCM 2VG6A 3R6MA 1XUPO 2FBYA 1VSLA 3DMJA 1QHTA 3PV8A 2D0PA 4MLHA 2F96A 5HRSA 1BQMA 5E26A 2W6KA 4BRMA 3JS6A 1S9EA 3J7ZO 2NRVA 5AQSA 1LV5A 4PKHA 1WAFA 4CEZA 1JXEA 4DTJA 4YDUA 1ZBSA 4BVPA 2QI2A 4PL7A 1I94K 2XY6A 3K5MA 2W40A 3AAPA 3TPQA 4FJNA 3P5JA 2V52B 3CFPA 3CFRA 4N56A 3ZLJA 4JS5A 4DS4A 4PWDA 1Y97A 4KI4A 3TSPA 5MLCQ 3DLRA 2VWBA 3TR8A 1BOTO 3OYGA 3T3FA 4FLVA 4GKJK 1QQCA 2HW3A 1RT5A 5FROA 3F2KA 5KPTA 1CLQA 3CJ1A 4CZHA 3HJFA 1C0GA 2BDPA 3KK7A 3QBWA 3VOVA 3NGZA 4BRQA 3IMXA 1VQ6N 4K8ZA 1XC9A 3ZT3A 4IG0A 4RW9A 3M8PA 2ASPA 2NLXA 3VEOA 2QWOA 3QFPA 3OYJA 4KREA 4JAXA 1RCHA 4C8NA 5GIOA 4ZTFA 4J2BA 4BRKA 4CGJA 4OO1J 2E2OA 3LDNA 1REVA 1SQKA 1C0MA 3IFRA 2JGUA 2YCHA 3C7NA 4CEAA 4FWSA 3VQEA 3V6DA 5CR4A 2O8DA 3NE6A 3FZMA 3RR8A 1ZBFA 3LZJA 3LALA 1BA0A 2BE2A 2I7PA 2RN2A 5FPDA 1TKXA 3ZT1A 3G4SN 4IFYA 4BROA 5AQWA 2KHOA 2YV0X 4M3ZA 3ZCMA 3K59A 3DXKA 1JLGA 2E6MA 3ZSZA 3SYZA 2NUBA 3VESA 3W3DA 4M3XA 3FR0A 4YOUA 1RDWX 5BPLA 1S6PA 3IG1A 3CCQN 1ESVA 1XC3A 4JNEA 3R8EA 1YTUA 3KLHA 1VSFA 4V19S 2IS3A 2O8EB 1KVCA 1NNEA 2DPNA 3OYEA 1U6ZA 1V4TA 2P9IB 4RW4A 4WYBA 3VA3A 4ILHA 5AQHA 4HTUA 1T8EA 1NBWA 3HSTB 5CHIA 2BH1A 4A62A 4BVOA 4W5NA 1S6QA 5GAHP 4O4GA 5J2QA 3UKUA 4WFBL 3TSUA 5I3UA 4DG1A 5BRFA 3CC2N 1CXUA 3NGIA 1NKEA 3SLCA 3TWHA 4B1VA 3WXIA 4KB0A 3DAWA 3D0PA 3DLGA 5BN8A 2E2PA 4DB3A 5M1QA 3CCUN 1TAUA 3SBGA 4DSFA 4LSNA 3TAQA 4EP5A 1S1TA 3DXMA 2D1KA 4AHRA 3SBTA 2IAJA 3C7NB 4OKJA 3OJSA 1KSPA 1KRPA 4FZYA 4LFBK 4QS9A 4ID1A 2O8DB 3VQ5A 4JKGA 3B8AX 4Z94A 3C94A 4JKHA 4BG8A 4DR7K 2ZE2A 2OANA 4IBNA 4RW8A 4CJEA 4CJVA 1DKGD 4BE0A 3THYA 3DXKB 5AJ3K 4CHNA 2FSKA 1KFDA 4FWLA 4A5AA 3EE9A 4E3SA 3K58A 4L3QA 4PQUA 3C95A 5AZIA 3J7AP 4CBXA 3CIPA 2PYJA 3AO5A 5AQZA 3PIOL 3CMAN 1YF5L 3VQ4A 5HROA 1T05A 4DR2K 4OKEA 4B3RK 4AF1A 1U04A 4BG9A 3EZ5A 3O5BA 2A40A 4FL9A 1NJZA 3V9ZA 2F9TA 3KK2A 4DV7K 2VGMA 3QINA 4GMJB 1XMOK 3VA0A 5LMNK 3LDSA 4Z4GA 3UKUB 2X74A 4EFHA 3R1XA 1JXBA 1HKBA 4KBOA 3N4QA 4O0JA 2VG7A 2HHVA 1HMVA 4JI8K 4CF9A
chains in the Genus database with same CATH topology
3ZYYX 4CZGA 4BRLA 2EWSA 4M7YA 2YI1A 4F9OA 4JKDA 4JN4A 4FOEA 1Z05A 3TTCA 2ZJPL 1W2BM 2D4WA 2GX9A 4BREA 3EKUA 4Y0WA 2QWLA 5M1PA 2Q0UA 3ZETA 2QWPA 2E2NA 4C1NK 3E9LA 3WUHA 3CJCA 1NGAA 1QQMA 4PHTX 1MWMA 4NB4A 5BRDA 1VQPN 4WQ5C 5CE3A 1JCFA 1HKCA 4JKGB 1YHQN 3FGUA 2RE2A 3MCPA 3WXKA 5GAGP 4ISFA 3G71N 4WQ5A 2Q0RA 5AQQA 4BRHA 1YXQA 3M1FA 1RFQA 3MWTA 3TTFA 1ATNA 3GDQA 1LOTB 3H46O 3MN7A 4FOIA 5AQIA 5AQVA 4CI6A 5BREA 5GIPA 1NGJA 3CCJN 4BRIA 4BRPA 1QHAA 4CZIA 1KC8O 2QA4N 3CJ7A 1YIJN 2ZWHA 4MDAA 3SMPA 1X3NA 3BUZB 3CCEN 3L4IA 3AAQA 3EKSA 3H1VX 3LDPA 3CCMN 3G25A 4ISGA 1TYQA 4QS7A 3D2EA 4YOVA 3KWGA 1HJOA 1GLJO 3ZX2A 2NRHA 4ILJA 5BPNA 2HF3A 5AZIB 5C2FA 3H3OB 2IVNA 3I8BA 3VGLA 1HPMA 3MN5A 1JCEA 2QW9A 5JLHA 3MWPA 4WQ4A 5ELZA 3C6HA 4ILGB 1NGIA 2P9SB 3AY9A 3TTDA 4AM7A 4BC4A 2VCPA 1SAZA 1QQNA 4JKCA 3W0LA 3K9JA 3MX5A 3T69A 4IJNA 3FLCO 3OBYA 1CZAN 3MCAB 5EY4A 3VEVA 1GLEG 2AP1A 2PAVA 2QWRA 4UY8O 4JK9A 3EN9A 1VQ7N 2GUPA 5KQ8A 3QDKA 3BF3A 4I6MA 2V7ZA 4H0VB 3CCVN 4H0OA 1S72N 3CETA 3O6WA 4A5BA 3VGKA 4FWRA 4WFAL 2V7YA 2F9WA 1NGCA 4IO8A 1NMDA 2V51B 4IJAA 1NGDA 3O1BA 1YJNN 3EO3A 3MX2A 4IEEA 2GELA 2ASOA 5AQKA 4IXCA 4BRFA 3LDOA 2E8AA 4HTLA 4XH4A 1RGIA 4H0YB 4O5FA 4R79A 3ZEUB 2HSTA 2OTLN 3CJ9A 2IVPA 1TUYA 1KXPA 3CPEA 3UKRB 4B9QA 3QB0A 3OHRA 1Q18A 4JHDA 4B1ZA 4CZMA 5AQFA 5EVZA 3M6GA 2QXLA 2GWKA 1VQ8N 3HM8A 4OPAA 5C2DA 5LY3A 5AFUA 4JD2B 2P9KB 3HZ6A 3HTVA 4WFNL 3ULEA 2H3GX 3CQYA 3AGRA 3IUCA 4OPHA 2ITMA 3CJAA 2GWJA 4H5NA 3F5TA 3Q7BA 5M1NA 4FWNA 4DQ8A 3SAFA 4BGBA 2HBLA 3ID8A 4E1JA 3U8XA 2FSNA 2YJFA 4EAHD 1WOQA 2A5XA 4IO9L 3VEXA 2W41A 4FWOA 5E84A 3OW2M 2FF3B 4FPAA 4BR2A 4BR9A 5GADP 4H5TA 3L4QA 1O13A 1QVFM 1D4XA 4JKEA 3ZX0A 3GG4A 2WFBA 3NVKA 1NWKA 2VGNA 1IG8A 1EQYA 3VEYA 2Q2RA 3TSQA 3I56N 5C0YA 2BTFA 5ADXA 3UE5A 3EL2A 1J6ZA 3O9RA 4FWKA 4IFEA 4B1UB 1TYQB 4BRAA 3D2EB 4H0XB 1NGGA 2FLOA 1C0FA 3LDLA 1YAGA 5I9EB 1VQKN 3C0BA 3SAGA 5AQUA 2HBMA 1K9MO 4A61A 1YI2N 3VEWA 2ZGYA 1Q86O 1RDUA 4GV9A 2P9PA 5EXWA 5TKWA 3ATVA 5M1FA 4YOYA 4GV3A 2GEMA 3VTHA 1VQ9N 5C12A 3A0IX 2ZJQL 2CH6A 3ZX3A 3P4IA 3ZEUA 5M1KA 2NRXA 2RHKA 3UKRA 2PBDA 3SMSA 4BR5A 3GBTA 3CPWM 4KH4A 3VENA 5AQTA 5HL7L 5H1SQ 3A5LC 3U9DA 3G6EN 2ZJRL 2WBNA 3RSEB 1VQMN 2BUPA 1E4GT 4H5VA 1ATSA 2P9KA 4JD2A 2NRWA 3IKMA 2E20A 4BRCA 3U9ZA 1ATRA 2A3ZA 5TKYA 1S3XA 2YHYA 1YUWA 4I6MB 2NRZA 3RVCA 3A5NC 4FWMA 3HOTA 5LJVA 4CZJA 2NZTA 4FWPA 4BQLA 1H1VA 4O8KA 4H0TB 1KQSM 4JK7A 4JEPA 4JKBA 3OBWA 1N8RO 3ENBA 3MMVA 3EZWA 2YJEA 3O9SA 4KH6A 4EIAA 2VYPA 3P39A 4CZEA 5HOOA 4A57A 1QQOA 3E9OA 3KVGA 4RCHA 2HBJA 4IEIA 2IIRA 4YORA 3BF1A 1X3MA 3WXJA 4JHDB 3VF6A 5C15A 5DM7L 3L6QA 1QZ6A 4CZKA 1NGHA 3VF4A 3DLLL 1KAYA 4MO4A 3ULEB 2CGKA 5AFUH 5AR0A 4WQ4C 4EHTA 3OA9A 4IOXA 3C6AA 4IOAL 4B1XB 5AQGA 1Y64A 3H3NO 3QMLA 3H45C 4FSVA 5AQLA 5F1XA 2ZGZA 3HOSA 2YHWA 3R3LA 2E1YA 1ZC6A 4CD1A 2ZF5O 3S41A 1SZ2A 5C10A 2P9LB 3CQXA 3WQTA 4BR0A 1VQON 1NLVA 2F7TA 5KQDA 3CXCM 1Q7YO 2CGLA 3CERA 3CHWA 3RSEA 3O8MA 4BR7A 1VQ4N 3CC7N 4FVUA 1NGEA 3R6MA 1XUPO 3CD6N 4PKGA 5JLFA 2Q31A 1YITN 2D0PA 4MLHA 3FZKA 5E26A 4BRMA 3JS6A 5AQXA 5ADXH 3J7ZO 3FZFA 2NRVA 5AQSA 4PKHA 3K9KA 1BDGA 3R9PA 2QTDA 4JKAA 2QWQA 4IZ9A 5F0XA 3CI5A 4YDUA 2P9UB 4GV6A 1ZBSA 1K8KA 3VETA 2P9PB 3QICA 4BVPA 2QI2A 4PL7A 1X9JA 2OTJN 3DJCA 3KZBA 4YOWA 1OVYA 1ZXOA 1OKJA 5AQPA 2W40A 1GLCG 2Q36A 4AM6A 3O9QA 2A6AA 1NGBA 2AA4A 3AAPA 3TPQA 4A2BA 4C1NI 5FPNA 1U2VA 4C23A 2V52B 5JVHL 3O9UA 4J8FA 4PKIA 2HMPA 1IJJA 5B8HA 3U4LA 1M90O 2KKZA 1WUAA 2P9NB 3A8YA 1EO1A 5AQOA 1VQ5N 2FXUA 1R59O 5F2RA 2NNWA 4RWTA 3TSPA 5MLCQ 2VWBA 3LM9A 4M7XA 3O1WA 1BOTO 3D6RA 4XH5A 5BR9A 2P9LA 3JXUA 4GVEA 4CZLA 4EHUA 4CZFA 4GY2B 1KAZA 4FO0A 3GL1A 1DEJA 3F2KA 4A59A 5KPTA 5AQJA 3CJ1A 4CZHA 1C0GA 1YVNA 3QFUA 3CC4N 3KK7A 1TUUA 3QBWA 3VOVA 1VAZA 5JMVA 2WC9A 4BRQA 2YX6A 1GLBG 3IMXA 1VQ6N 1Z6RA 5JVGL 3E66A 3CCSN 1BUPA 2ASPA 2FF6A 1MDUB 2NLXA 1QZ5A 3VEOA 1VQLN 5AQMA 2QWOA 1HX1A 3QFPA 4JAXA 2J4RA 3WXLA 3N4PA 2P9UA 4H5RA 5GIOA 4BRKA 2Q1NA 3M3ZA 3ENHA 4OO1J 2E2OA 2GTDA 3VF2A 3LDNA 2E88A 1GLDG 1SQKA 3IFRA 4H0PA 4HWIA 4NLCA 2YCHA 3CCRN 3C7NA 1DT9A 4FWSA 3VGMA 2CGJA 5CR4A 1LCUA 1BWFO 3FZMA 3WEEB 3P31A 4WCEL 1T3VA 4PL8A 5BN9A 1BA0A 4O8UA 2I7PA 3PIPL 4IOCL 2YHXA 4BRGA 3F9MA 5FPDA 2P9NA 3G4SN 1GLFO 3LL3A 3MN6A 4BROA 5AQWA 2KHOA 4B1WB 3HBTA 3DXKA 4CJ7A 5FPEA 2QM1A 3GOIA 1VQNN 4IDHA 4NO7A 1MA9B 3VESA 1K8KB 3CF5L 3DXMB 3W3DA 4K25A 4BY9C 3FR0A 4YOUA 3BEXA 3SJHA 1RDWX 5BPLA 3CCLN 3MK6A 1Q82O 3CCQN 1ESVA 3EE8A 1XC3A 1M1KO 4JNEA 3PLAA 3R8EA 1U2VB 3E1YA 3FE1A 4DCHA 4B1YB 4BC5A 3L0QA 1V4SA 1E4FT 3LDQA 4GNIA 2KLAA 2Q97A 4XH1A 3VERA 4CBUA 1Q81O 1NGFA 2DPNA 1U6ZA 1V4TA 1DGKN 2P9IB 3DWLA 4WYBA 3WXMB 5GAEP 4ILHA 4BR4A 4DKWA 5EOYA 2E2QA 2QEXN 4BC3A 5AQHA 3ID6A 3WT0A 4FWQA 4WF9L 1P90A 4MLEA 5AZJB 1NBWA 5CHIA 3D2FB 4KH5A 1P8ZA 2BH1A 4JK8A 5AQNA 3T7ZA 2E1ZA 4A62A 3WEEA 4BVOA 3GE1A 3KWIA 2HOEA 5GAHP 1HLUA 1XQSC 3AGKA 4LC9B 3TSUA 3UKUA 4WFBL 5BRFA 3CC2N 3MDQA 3M5RA 4H5WA 3O9TA 4A2AA 2JWKA 4FPBA 3SLCA 5KPZA 1YJ9N 1KAXA 2D0OA 4H03B 3BP8A 3WXIA 4B1VA 5BPMA 3DAWA 4K41A 3SAHA 4BC2A 3HSCA 4YDUC 5EX5A 2CH5A 2E2PA 4DB3A 1BA1A 5BN8A 5M1QA 3CCUN 1NM1A 3SBGA 3ATUA 4BRDA 3CMEN 3SK3A 3FZLA 1S22A 3DXMA 3E9PA 2D1KA 3MN9A 1ILYA 3SBTA 5BRHA 3C7NB 3UB5A 1JJ2M 3H6EA 4QS9A 3NVMA 1BU6O 1SS6A 3B8AX 4JKGA 3NMUA 2QWNA 4Z94A 1K8AO 4JKHA 1MWKA 4BG8A 4CBWA 4ISEA 4QS8A 3LM2A 1GLAG 3FFKB 2PFUA 2OANA 1JCGA 4YOXA 3H1QA 2P9IA 3WQUA 4K42A 4XEIA 4DHYA 3VTIA 5DM6L 1DKGD 3AARA 2HBKA 3DXKB 3CJBA 3TU5A 5GINA 5AZJA 2FSKA 3D2FA 3ENOA 2HF4A 5AQRA 1QVGM 1G99A 4FWLA 3O08A 3ZETB 3I55N 4RTFD 4A5AA 4K43A 3EE9A 2NRTA 5JICA 4G9ZA 3KHYA 4L3QA 3IDHA 5AZIA 2NRRA 1W97L 1HUXA 2ASMA 2QWMA 3O4WA 1HKGA 3CIPA 4CBXA 3I33A 3QBXA 3VPZA 3Q7CA 2A41A 4NLBA 5AQZA 3VEZA 3PIOL 5LJWA 3CMAN 3J8AA 1YF5L 4MDBA 3D7EO 4U67L 1T6CA 2P9SA 4BGAA 5KPRA 4AF1A 1NJIO 4IWVA 4BRNA 4BG9A 3O5BA 3A5MC 2A40A 2JWLA 4FL9A 2A42A 2I7NA 1GLLO 3HI0A 3VMFB 2F9TA 4YOTA 2VGMA 3P38A 5AQYA 4M63C 1T6DA 1BO5O 4U7BA 3FZHA 2IVOA 4JKFA 3UKUB 1K73O 4EFHA 2WUSA 3R1XA 3C65A 1T44A 1HKBA 4KBOA 3N4QA 5M1OA 1YJWN 4BQZA 2UYTA 5FPMA 1KD1O 4CD3A 4MO5A 3HRGA 1BG3A 3O80A 3A5OC 2FSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IO9 L;  2QEX N;  3OW2 M;  2OTJ N;  4WF9 L;  5GAD P;  2ZJP L;  1W2B M;  1QVF M;  1OVY A;  5GAH P;  4WFB L;  3I56 N;  1VQP N;  3CC2 N;  5JVH L;  1YHQ N;  5GAG P;  3G71 N;  1YJ9 N;  1M90 O;  1VQK N;  1K9M O;  1YI2 N;  1VQ5 N;  1Q86 O;  3CCU N;  5MLC Q;  3CCJ N;  1VQ9 N;  3CME N;  2ZJQ L;  1KC8 O;  2QA4 N;  1YIJ N;  1ILY A;  3CPW M;  3G6E N;  5HL7 L;  5H1S Q;  2ZJR L;  1JJ2 M;  1VQM N;  3CCE N;  3CC4 N;  3CCM N;  1K8A O;  1VQ6 N;  5JVG L;  3CCS N;  1VQL N;  5DM6 L;  1KQS M;  1N8R O;  1QVG M;  3CCR N;  3I55 N;  4WCE L;  4UY8 O;  5DM7 L;  1VQ7 N;  3DLL L;  3CCV N;  3PIP L;  4IOC L;  1S72 N;  3PIO L;  3CMA N;  3G4S N;  4IOA L;  4WFA L;  4U67 L;  1YJN N;  1NJI O;  1VQN N;  3CF5 L;  1VQO N;  3CXC M;  1Q7Y O;  2OTL N;  1VQ4 N;  3CC7 N;  3CCL N;  3CD6 N;  1Q82 O;  1VQ8 N;  3CCQ N;  1M1K O;  1YIT N;  1K73 O;  4WFN L;  3J7Z O;  1YJW N;  1Q81 O;  1KD1 O;  5GAE P; 
#chains in the Genus database with same CATH topology
 5KI6 A;  4AQY K;  4BRL A;  3QNO A;  4BE1 A;  3KK1 A;  4JKD A;  2GBZ A;  4FOE A;  3TTC A;  1W2B M;  1HNZ K;  3V1R A;  5M1P A;  3ZET A;  4DFK A;  1S1X A;  2E2N A;  5BR8 K;  4FJM A;  4EP4 A;  5CE3 A;  3U6F A;  1U49 A;  4JKG B;  3WXK A;  2RE2 A;  5GAG P;  3NHG A;  1YXQ A;  3M1F A;  4DQR A;  4B8C A;  2FBX A;  1ATN A;  1B92 A;  1RT3 A;  3H46 O;  5C24 A;  2QKB A;  3AVK A;  5AQI A;  1FW6 A;  4CI6 A;  1Q9X A;  3SQ2 A;  4BRP A;  3LP2 A;  1KC8 O;  1YIJ N;  3HPO A;  2ZWH A;  1W7A A;  1X3N A;  2UXC K;  3O3F A;  1HYS A;  5T7B A;  1NK8 A;  2D0B A;  4FYD A;  3L4I A;  3AAQ A;  2P51 A;  4YOV A;  1TYQ A;  1S5J A;  3KWG A;  4AIL C;  3AA5 X;  5AZI B;  1U47 A;  1VRT A;  2IVN A;  3F9K A;  3VGL A;  3WNE A;  3TTD A;  4AM7 A;  3AO4 A;  4Z4E A;  1ASW A;  5FLX O;  1RBS A;  1EXQ A;  4B3M K;  3L2R A;  4CEO A;  3K9J A;  3ZT4 A;  3O3G A;  3MX5 A;  3FLC O;  3OBY A;  5EY4 A;  1GLE G;  4CW7 B;  1QS4 A;  4ELU A;  3QDK A;  4I6M A;  3UIQ A;  1WBD A;  3CCV N;  2Z1H A;  4O0I A;  3NH2 A;  3CET A;  1S72 N;  3QEX A;  1HNX K;  4NYN A;  5J2P A;  2V7Y A;  1NGC A;  1IBL K;  1TKD A;  1NMD A;  1NGD A;  3O1B A;  3BGR A;  2ASO A;  2HND A;  4BRF A;  4DUZ K;  3ZEU B;  2HST A;  1KXP A;  3K5L A;  4CZM A;  5AQF A;  5EVZ A;  3SI6 A;  5LY3 A;  1SKS A;  1Q8I A;  3HZ6 A;  3ULE A;  3I8D A;  3THX A;  4IDK A;  1D5A A;  2O4G A;  5M1N A;  3K0S A;  5IT9 O;  2W6L A;  4E7H A;  4M3Y A;  3U8X A;  1IG9 A;  1JLF A;  1WOQ A;  4FLX A;  4BR9 A;  3L4Q A;  3ZX0 A;  1I39 A;  3NVK A;  2KQ2 A;  2A1R A;  3CQ8 A;  3ZSV A;  2BTF A;  5CYM A;  4BRA A;  4B1U B;  4IFE A;  1TYQ B;  3PX4 A;  1T7P A;  4Z4F A;  3LDL A;  3OS1 A;  3TAP A;  4M42 A;  1F21 A;  3SAG A;  3AVA A;  2ZGY A;  5E41 A;  4DLE A;  4DTS A;  1Q86 O;  3SUQ A;  3ATV A;  1C1B A;  2GEM A;  1ZBH A;  4BWJ A;  3A0I X;  2XY5 A;  5KGW A;  3VQ7 A;  4DV2 K;  2OA8 A;  3NF9 A;  2PBD A;  4FJ8 A;  3HYF A;  3CPW M;  3GBT A;  4CJF A;  4DV6 K;  3EEQ A;  5HL7 L;  5H1S Q;  3U9D A;  3RSE B;  4M3T A;  4HUF A;  1LW2 A;  2UU9 K;  1E4G T;  2E20 A;  5TKY A;  3THV A;  1YUW A;  3NF6 A;  4I6M B;  1HNW K;  1QSL A;  2WOM A;  5LJV A;  1BIZ A;  1LWE A;  4O8K A;  3RRH A;  3U3G A;  1HQE A;  2EHG A;  3OBW A;  1N8R O;  3MMV A;  3EZW A;  3HVT A;  3LP0 A;  4EIA A;  1SKR A;  3P39 A;  4FK2 A;  4X65 K;  4CFC A;  4FJL A;  1WN7 A;  4FJI A;  1NJY A;  1J5O A;  4YOR A;  4CEQ A;  2KFN A;  4B08 A;  3DLH A;  4CJW A;  1QZ6 A;  4CZK A;  4GKK K;  3AA4 A;  3DLL L;  4ID5 A;  1KAY A;  3ULE B;  3THX B;  5AR0 A;  3K5O A;  4EHT A;  3OYF A;  4F2S A;  1Y64 A;  3MEC A;  3H3N O;  3T1Y K;  1XWL A;  1Z25 A;  5F1X A;  2ZGZ A;  1VQO N;  1SZ2 A;  3I0S A;  3QEW A;  1NLV A;  2CGL A;  3CHW A;  4BR7 A;  2GUI A;  3TAB A;  1VQ4 N;  3NAE A;  1NGE A;  1ZYQ A;  3CD6 N;  4PKG A;  3CM6 A;  2Q31 A;  2G8U A;  1SV5 A;  3L3V A;  3SQ1 A;  5ADX H;  3FZF A;  2QKK A;  3O4Q A;  3R9P A;  1RT1 A;  3HP9 A;  4IZ9 A;  5F0X A;  5KGX A;  4JLH A;  1GOB A;  1L3T A;  2P9U B;  4MQ3 A;  4CJP A;  1X9J A;  3DJC A;  3SNN A;  4HVJ A;  1ZXO A;  5AQP A;  3HXM A;  2Q36 A;  2AA4 A;  4A2B A;  3QNN A;  5FPN A;  1U2V A;  1SUQ A;  3QLH A;  4OPK A;  1BIS A;  3KKS A;  2KKZ A;  3NFA A;  4E7L A;  1KLN A;  3LZI A;  1IKY A;  2FXU A;  1R59 O;  3SUN A;  1N6Q A;  3V9U A;  3LP1 A;  3LM9 A;  4M7X A;  2I5J A;  3O1W A;  4XH5 A;  5BR9 A;  2P9L A;  1UA1 A;  1NK7 A;  4FJ7 A;  2KTQ A;  4JI1 K;  3QO9 A;  1NKB A;  4H8K A;  2A1S A;  5AQJ A;  4FLY A;  4NXM K;  1RTI A;  3CC4 N;  1RBR A;  1D9F A;  1JLA A;  5JMV A;  1TVR A;  2YX6 A;  4FVM A;  4FLZ A;  5JVG L;  1VSJ A;  1HNV A;  1RBV A;  1BUP A;  3M8S A;  1MDU B;  2IDO A;  4FM0 A;  1QZ5 A;  1B9F A;  5AQM A;  1VK0 A;  1S1U A;  4AHT A;  2J4R A;  3N4P A;  3PO4 A;  2Q1N A;  3DLB A;  4J2E A;  1GLD G;  4H0P A;  1DT9 A;  4CVN E;  3VN5 A;  1OVQ A;  1JKH A;  1LCU A;  3WEE B;  3P31 A;  4DU4 A;  4PL8 A;  4O8U A;  4FLT A;  3V81 A;  3PIP L;  2YHX A;  4KHY A;  4DS5 A;  1GLF O;  3LL3 A;  3MN6 A;  2VQF K;  4OVL A;  1BI4 A;  4CJ7 A;  4ZTJ A;  5FPE A;  3S3M A;  3AA2 A;  3G10 A;  3SPZ A;  1G15 A;  1KLM A;  4ICL A;  1XNR K;  4CJ4 A;  4K25 A;  2WON A;  1WSJ A;  4BY9 C;  4FCY A;  3BEX A;  3SJH A;  1WSH A;  3CCL N;  3MK6 A;  1Q82 O;  2O8C B;  1M1K O;  3PLA A;  1U2V B;  3E1Y A;  5HRN A;  4B1Y B;  3L0Q A;  3MEG A;  4GNI A;  3VER A;  5CYQ A;  4CBU A;  4N5S A;  1OH6 A;  4FJX A;  4DF8 A;  1Q81 O;  4CER A;  3WXM B;  1DTQ A;  4BR4 A;  4DKW A;  1C0U A;  5EOY A;  4BC3 A;  1X1P A;  1SKW A;  3AO1 A;  4MLE A;  5AZJ B;  4LFC K;  2IGI A;  2P5G A;  5AQN A;  2E1Z A;  3DI6 A;  1IH7 A;  3GE1 A;  3J81 O;  2HOE A;  2HHU A;  1HLU A;  2YKM A;  4FZX C;  4KHQ A;  3RMD A;  1B9D A;  2F8S A;  1ITG A;  4A2A A;  1ASV A;  2E5L K;  3NGY A;  1YJ9 N;  4JI7 K;  1ZBU A;  3SAH A;  1L3U A;  3KLG A;  4YDU C;  1Q9Y A;  2PYL A;  2E6L A;  4QOZ B;  4BRD A;  3ISN C;  3TAG A;  4CIF A;  3LAK A;  4CK3 A;  4CK2 A;  4E7J A;  3ALY A;  3E01 A;  3VQ8 A;  3NVM A;  4KFB A;  4LF6 K;  1K8A O;  4CBW A;  4ISE A;  4QS8 A;  3TAR A;  2PFU A;  2O8E A;  4YOX A;  4BWM A;  2P9I A;  3VTI A;  4E19 A;  4DV3 K;  4DTO A;  4JRQ A;  2HB5 A;  1BI4 B;  1CZB A;  2PY5 A;  2QK9 A;  3H08 A;  3O08 A;  2UUC K;  4HHT A;  5JIC A;  4CJU A;  2ATQ A;  2OPQ A;  1W97 L;  1HUX A;  3QES A;  2XY7 A;  4TSX A;  3I33 A;  3VPZ A;  3Q7C A;  4NLB A;  5LJW A;  1A5X A;  4FM2 A;  3J8A A;  2OPP A;  4MDB A;  3V9S A;  3ZSR A;  1T6C A;  3QER A;  4BGA A;  5KPR A;  5EU7 A;  1NJI O;  4BRN A;  3A5M C;  2A42 A;  5CY4 A;  4CEE A;  3HI0 A;  3OVN A;  3AA3 A;  4W5R A;  3P38 A;  1T6D A;  3L2U A;  2IVO A;  1EX4 A;  2WUS A;  4JI3 K;  3L3U A;  1J53 A;  1X9S A;  1YJW N;  3NCI A;  3PX0 A;  4CD3 A;  3A5O C;  3ZYY X;  1RIL A;  2EWS A;  1BQN A;  4QCL A;  2D4W A;  2GX9 A;  3AO3 A;  2OPR A;  2QWL A;  2Q0U A;  4JI5 K;  3L2V A;  3VQA A;  3WUH A;  3MAQ A;  1NGA A;  1S9G A;  3G71 N;  4ISF A;  5AQQ A;  4BRH A;  1RFQ A;  1A5V A;  1NK9 A;  1FXX A;  3SUO A;  5BRE A;  3CCJ N;  4RW7 A;  3QIP A;  1OH8 A;  4B8A B;  1QHA A;  4CZI A;  3HPG A;  4MDA A;  1ZBL A;  4YFU A;  1RTJ A;  3LDP A;  4HCC A;  4DQQ A;  4QS7 A;  3D2E A;  3RR7 A;  1HJO A;  3ZX2 A;  2NRH A;  4ILJ A;  5BPN A;  3IRX A;  3OTO K;  1IBM K;  3S3O A;  2HNZ A;  3I8B A;  4F8R A;  2QW9 A;  5JLH A;  4WQ4 A;  2YNF A;  2G8I A;  4DUY K;  1U48 A;  1SAZ A;  3MED A;  4CFB A;  4Z4I A;  3SCX A;  1QQN A;  3RMA A;  3IAY A;  4JKC A;  1A5W A;  4DQP A;  3G0Z A;  4KPY A;  4CFD A;  4X62 K;  1CZA N;  3VEV A;  1E3M A;  2AP1 A;  2QWR A;  4N76 A;  4UY8 O;  1S1V A;  4JK9 A;  5KQ8 A;  1N34 K;  3KLF A;  1RNH A;  4H0V B;  4FWR A;  4IO8 A;  2V51 B;  4IEE A;  2GEL A;  4CGH A;  5AQK A;  4I2P A;  1JLC A;  4H0Y B;  1WSE A;  3CJ9 A;  4CIG A;  1TUY A;  3QB0 A;  1Q18 A;  3PUF A;  2QXL A;  4CEC A;  1VQ8 N;  3HM8 A;  4OPA A;  1IKW A;  1IKX A;  3LAM A;  5C2D A;  4JD2 B;  2P9K B;  3HTV A;  4I9L A;  4WFN L;  4FJJ A;  3CJA A;  4LF8 K;  4JRP A;  3L8B A;  3Q7B A;  4FWN A;  4DQ8 A;  3SAF A;  4E1J A;  2FSN A;  2YJF A;  4EAH D;  3HL8 A;  1N36 K;  2A5X A;  2IOC A;  4IO9 L;  1QTM A;  5E84 A;  2FF3 B;  4BR2 A;  1C6V A;  1QVF M;  4JKE A;  2IC3 A;  4ELT A;  2XRI A;  1IG8 A;  3VEY A;  4LD0 A;  1SL2 A;  4B9S A;  3AVC A;  3I56 N;  5C0Y A;  3A2F A;  3ASM A;  5ADX A;  3UE5 A;  1J6Z A;  3O9R A;  3JAM O;  3D2E B;  3NDK A;  1CZ9 A;  1NGG A;  1YAG A;  4N47 A;  2DY4 A;  4CK1 A;  2HBM A;  4KTZ A;  1BCO A;  1RDU A;  2VG5 A;  3KTQ A;  4YNQ A;  4O44 A;  5C12 A;  4XIU A;  4CFA A;  2HNY A;  1VSI A;  5M1K A;  3ZEU A;  2NRX A;  3SMS A;  3DOK A;  4KH4 A;  4OKK A;  3OS2 A;  3OY9 A;  3A5L C;  4Y1C A;  1GOC A;  2WBN A;  1KVB A;  1RBU A;  1VSE A;  3V4I A;  3IKM A;  3PY8 A;  4BRC A;  1ATR A;  2A3Z A;  2YHY A;  3RVC A;  4FWM A;  3HOT A;  2NZT A;  4HUE A;  1H1V A;  3VQD A;  3J7Y P;  1KQS M;  1FJG K;  4HUG A;  2YJE A;  2YKN A;  4KH6 A;  4KI6 A;  4LH5 A;  1X9W A;  1L5U A;  4RCH A;  2HBJ A;  2IIR A;  4JI2 K;  4FJ9 A;  3M8R A;  1NKC A;  5DM7 L;  2LSN A;  4X64 K;  4YHH K;  2ZM6 K;  3VQQ A;  1WSG A;  3HO1 A;  1KVA A;  5AFU H;  4IOX A;  4B1X B;  5AQG A;  1LWF A;  1LWC A;  3SZ2 A;  3QML A;  3H45 C;  4FSV A;  3HOS A;  2YHW A;  4CD1 A;  1ZC6 A;  4UQG A;  3S41 A;  5C10 A;  3WQT A;  4BR0 A;  1TK0 A;  1EP4 A;  5KQD A;  3AO2 A;  3FFI A;  3RSE A;  2HHQ A;  4E1M A;  4OGE A;  2RKI A;  1C1A A;  1W9H A;  1WAJ A;  3TAM A;  5AQX A;  3AVL A;  4AHV A;  1UWB A;  4ELV A;  3K9K A;  1BDG A;  2QTD A;  4JKA A;  2QWQ A;  4GV6 A;  3QIC A;  4DV0 K;  3BZC A;  3KZB A;  2YNH A;  5SZT A;  4MFB A;  4AM6 A;  5FDL A;  4DV4 K;  2B4J A;  1C1C A;  1GOA A;  4PKI A;  2HMP A;  1IJJ A;  5B8H A;  1M90 O;  4E7K A;  4B9N A;  5D3G A;  4NCA A;  5FRM A;  2P9N B;  3A8Y A;  1EO1 A;  4W5T A;  1VQ5 N;  2G8K A;  5F2R A;  4CF2 A;  3WNG A;  1WBB A;  2OYQ A;  3ZSO A;  3D6R A;  3BZK A;  3JXU A;  3EY1 A;  4CZL A;  4EHU A;  4CZF A;  3OJU A;  1KAZ A;  4LF7 K;  3CG7 A;  1HQU A;  4FO0 A;  5CZ2 A;  3GL1 A;  1UAX A;  1YVN A;  1TUU A;  4LSL A;  1VAZ A;  3CM5 A;  1GLB G;  3L2W A;  2UXD K;  1Z6R A;  3E66 A;  3VQB A;  3CCS N;  5C42 A;  1J5E K;  2O4I A;  1TGO A;  2P9U A;  4WE1 A;  4M3R A;  4CGG A;  3M3Z A;  3ENH A;  1XI1 A;  3VF2 A;  4HWI A;  3RRG A;  4NLC A;  2YNG A;  3VGM A;  2CGJ A;  4C8O A;  3QET A;  1T3V A;  4RW6 A;  5BN9 A;  3DRS A;  4DTX A;  4IOC L;  4DTN A;  4BRG A;  3F9M A;  1WLJ A;  4B1W B;  3HBT A;  3GOI A;  1TL1 A;  4NO7 A;  4E0D A;  4IKF A;  2Y1I A;  3B6O A;  2DFH A;  2HVH A;  4KTW A;  4OLA A;  2VQE K;  3RMC A;  3EE8 A;  1VSK A;  2YNI A;  4BC5 A;  1V4S A;  3LDQ A;  1NJW A;  2YHA A;  4KAZ A;  4Z4H A;  4DQI A;  1HR0 K;  1JL1 A;  4NXN K;  3K57 A;  4PA1 A;  5LMU K;  1BHL A;  5J2M A;  3AVH A;  2QEX N;  4CJT A;  3ID6 A;  3BDP A;  2DTU A;  1IV0 A;  4FWQ A;  4K8X A;  3D2F B;  1P8Z A;  4JK8 A;  3T7Z A;  3WEE A;  3KWI A;  1WSI A;  3AGK A;  1IKV A;  4LC9 B;  3OYH A;  3LP3 A;  2BGG A;  1XNQ K;  1QE1 A;  3MDQ A;  3O9T A;  2JWK A;  4FJG A;  5KPZ A;  3HP6 A;  1KAX A;  5BPM A;  4KHW A;  1ASU A;  4K41 A;  4BC2 A;  2G8H A;  2DFE A;  3HSC A;  3DRP A;  1BA1 A;  4JI0 K;  1NM1 A;  3ATU A;  4NYF A;  3CME N;  3FZL A;  1JLB A;  3PSF A;  4CHY A;  3MN9 A;  4CF8 A;  1ILY A;  5BRH A;  4FJH A;  3K2P A;  1JJ2 M;  3H6E A;  2O8C A;  5J1E A;  1BU6 O;  1UA0 A;  3NMU A;  1BGX T;  2XY8 A;  3ZT0 A;  1GLA G;  1JCG A;  3H1Q A;  3WQU A;  4K42 A;  1FKO A;  4FXD A;  4XEI A;  3MEE A;  1NJX A;  4FZZ A;  3AAR A;  1C0T A;  2HBK A;  2Z1J A;  5J2N A;  3TU5 A;  5AZJ A;  2HF4 A;  1QVG M;  4OLB A;  4CIE A;  1G99 A;  5HBM A;  3I55 N;  4RTF D;  2NRT A;  1TKT A;  4G9Z A;  3SQ4 A;  2G8V A;  2UUB K;  1Z26 A;  3KIO A;  3VQ6 A;  2ASM A;  3O4W A;  3QBX A;  1NK4 A;  3ZT2 A;  4KRF A;  3D7E O;  4U67 L;  3C6U A;  2P9S A;  2UUA K;  1NK6 A;  4JV5 K;  4M41 A;  4IWV A;  2JWL A;  3DLE A;  3KKR A;  3NH1 A;  2FC0 A;  1RT6 A;  3JSM A;  5AQY A;  4M63 C;  4FK0 A;  4O5B A;  1K73 O;  3SV3 A;  3C65 A;  1T44 A;  1WSF A;  3SV4 A;  1VSD A;  1JL2 A;  4CJK A;  4J2D A;  1KD1 O;  3HRG A;  3O80 A;  2FSJ A;  3THW A;  1RT7 A;  4CZG A;  3TI0 A;  4JN4 A;  2ZJP L;  2AJQ A;  1XHZ A;  4DFM A;  2ETJ A;  4FJ5 A;  3EKU A;  3EYZ A;  4C1N K;  1NU0 A;  2RPI A;  1JLQ A;  3E9L A;  4PHT X;  1MWM A;  4NB4 A;  1VQP N;  4WQ5 C;  1HKC A;  3MCP A;  4WQ5 A;  2Q0R A;  4KHU A;  1J9A A;  2HHH K;  4C8K A;  3GDQ A;  1QSS A;  1LOT B;  3MN7 A;  4Y1D A;  4FOI A;  5GIP A;  1NGJ A;  3WNH A;  2QA4 N;  1S1W A;  3RMB A;  1FK9 A;  3CCE N;  4CGF A;  4ISG A;  3LPT A;  1WB9 A;  3TAE A;  1HJR A;  1XMQ K;  2O8F A;  2O8B B;  5C2F A;  5ELZ A;  3C6H A;  4ILG B;  3TAN A;  3QEV A;  2P9S B;  1N32 K;  1OH7 A;  2QXF A;  3T69 A;  4IJN A;  1CXQ A;  1IO2 A;  3D45 A;  3MCA B;  2PAV A;  4KV8 A;  4FJK A;  1D9D A;  1EWQ A;  3RWU A;  2GUP A;  4CHP A;  4C8M A;  3S9H A;  2V7Z A;  4PY5 A;  3NF8 A;  1KCF A;  4H0O A;  4F2R A;  3O6W A;  3VGK A;  4CEF A;  2F9W A;  1BIU A;  1KTQ A;  3EO3 A;  4KHS A;  4CJ3 A;  2W42 A;  1K6Y A;  4IXC A;  1R0A A;  3LDO A;  2E8A A;  4HTL A;  3THW B;  3T1A A;  4O5F A;  4R79 A;  4IFV A;  2OTL N;  3CPE A;  3UKR B;  4CGI A;  2G8F A;  2Z1I A;  3OHR A;  4B1Z A;  2GWK A;  4EZ9 A;  1HYV A;  4QAG A;  5AFU A;  4DV5 K;  2H3G X;  3CQY A;  3AGR A;  3IUC A;  4OPH A;  2ITM A;  3KD5 E;  2GWJ A;  3F5T A;  3KK3 A;  1RDB A;  3S3N A;  1TK8 A;  2HBL A;  5C25 A;  1DTT A;  3VEX A;  3OW2 M;  4FPA A;  4DR5 K;  5GAD P;  4H5T A;  3OYN A;  3GG4 A;  2WFB A;  4J2A A;  1NWK A;  3PSI A;  2Q2R A;  1RTD A;  4B3S K;  3NBP A;  3EL2 A;  1VQK N;  5LL6 Z;  2O8F B;  5KRS A;  4I2Q A;  3CFO A;  3ZSQ A;  4A61 A;  3VEW A;  4YY3 K;  5SWM A;  3HVR A;  2XO7 A;  2P9P A;  4AH9 A;  5M1F A;  4YOY A;  3VTH A;  1VQ9 N;  3LWL A;  3DRR A;  4M3U A;  2ZJQ L;  3ZX3 A;  3RTV A;  4BR5 A;  3VEN A;  2ZJR L;  2HHT A;  3V1O A;  2B5J A;  4Z4C A;  2BUP A;  5KRT A;  4H5V A;  4JD2 A;  2P9K A;  4CJR A;  3U9Z A;  4DR3 K;  3DLK A;  1S3X A;  4CGD A;  1BL3 A;  4CJ5 A;  4FLW A;  4GW6 A;  4CZJ A;  4DU3 A;  3C6T A;  1U45 A;  4LF4 K;  1O1W A;  1SL1 A;  2HMI A;  1RDA A;  4DWI A;  4JKB A;  2JLE A;  2VYP A;  1NK5 A;  4CZE A;  5HOO A;  1QQO A;  4DSI A;  3E9O A;  3MXJ A;  4IEI A;  4F4K A;  1X3M A;  3AVJ A;  1N5Y A;  4NCG A;  3AV9 A;  4ZHR A;  5KTQ A;  5A2Q O;  3VF4 A;  4DSK A;  2CGK A;  4WQ4 C;  4IOA L;  3J80 O;  1I3A A;  1RBT A;  3T1H K;  2E1Y A;  1XHX A;  2ZF5 O;  3OYA A;  3HT3 A;  3AVB A;  4KHN A;  1NK0 A;  2F4V K;  4I7F A;  1Q7Y O;  4C8L A;  4W5O A;  3CER A;  3QIO A;  3O8M A;  3CC7 N;  4FVU A;  1RT4 A;  5JLF A;  4O55 A;  4DR4 K;  3AVM A;  2HHW A;  1YIT N;  3HM9 A;  3FZK A;  3CI5 A;  4AHC A;  3VET A;  1K8K A;  2P9P B;  4FW1 A;  4DQS A;  2OTJ N;  3KLE A;  4YOW A;  1OVY A;  1OKJ A;  1GLC G;  3O9Q A;  2A6A A;  1NGB A;  4DR1 K;  1YT3 A;  4C1N I;  3KLI A;  3T19 A;  4B3O A;  4C23 A;  5JVH L;  3O9U A;  4J8F A;  4GVM A;  3U4L A;  4DTP A;  1WUA A;  4B3T K;  1WNS A;  5AQO A;  2NNW A;  4RWT A;  4N41 A;  4CHQ A;  2VWK A;  3LWM A;  4GVE A;  4B9L A;  4GY2 B;  1DEJ A;  2EX3 A;  3O4N A;  5HRR A;  4A59 A;  1TKZ A;  3P83 D;  3VQ9 A;  4KTQ A;  3AVN A;  3QFU A;  4FM1 A;  2KW4 A;  1RDD A;  3OYL A;  2WC9 A;  1KFS A;  4AHU A;  3MXI A;  3HK2 A;  2FF6 A;  2D0C A;  4E1N A;  1VQL N;  3DM2 A;  1HX1 A;  2X6S A;  3WXL A;  4H5R A;  4JI4 K;  4Z0U A;  4FK4 A;  4LFA K;  2Z1G A;  2GTD A;  4HCB A;  2E88 A;  4M3W A;  3CCR N;  1U4B A;  1BWF O;  2X6N A;  4BDZ A;  3OYI A;  5CZ1 A;  4WCE L;  3PX6 A;  3VQC A;  4CE9 A;  3QEP A;  2ZQB A;  2P9N A;  4DMN A;  1TL3 A;  3ULD A;  1L3S A;  4DTR A;  3K5N A;  2OCE A;  2KFZ A;  2QM1 A;  2FBV A;  1X9M A;  1VQN N;  2HHX A;  4IDH A;  5I42 A;  1MA9 B;  3CF5 L;  1K8K B;  4BDY A;  1N33 K;  3DXM B;  4LH4 A;  4L8R B;  3DOL A;  1T03 A;  4E89 A;  3F73 A;  3FE1 A;  4DCH A;  1E4F T;  4XH1 A;  2KLA A;  2Q97 A;  3OYB A;  3VQP A;  1NGF A;  4BDP A;  1DGK N;  3DWL A;  3PO5 A;  4PUO A;  5GAE P;  4CHZ A;  2E2Q A;  2PZS A;  3THY B;  4DU1 A;  4B9U A;  3B6P A;  3WT0 A;  4WF9 L;  1P90 A;  1VSM A;  4KH5 A;  1FKP A;  3OS0 A;  4OPJ A;  3QEI A;  2KZZ A;  4LY7 A;  1XQS C;  5HP1 A;  5HLF A;  3M5R A;  4H5W A;  4FPB A;  3SJJ A;  4CEB A;  2D0O A;  4H03 B;  3BP8 A;  2OZM A;  1NMN A;  5EX5 A;  2CH5 A;  2D5R A;  3ITH A;  3HPH A;  3V1Q A;  3ZSW A;  3SPY A;  3SK3 A;  1S22 A;  3E9P A;  3AVG A;  3KJV A;  2VWJ A;  4X66 K;  3V9X A;  3OYD A;  1UOC A;  4DF4 A;  3UB5 A;  1SS6 A;  2FBT A;  2QWN A;  1MWK A;  4JI6 K;  1QSY A;  4F3O A;  3LM2 A;  3FFK B;  3U3Y A;  3L2Q A;  1MU2 A;  3AVI A;  4DFJ A;  4OX9 K;  4F3T A;  4DHY A;  5DM6 L;  2KZM A;  4DSJ A;  1W0H A;  3CJB A;  3OYC A;  1OH5 A;  5GIN A;  1D8Y A;  3D2F A;  3ENO A;  5AQR A;  4JYA K;  3ZET B;  4K43 A;  4DLG A;  3KHY A;  4R5P A;  3IDH A;  2NRR A;  2QWM A;  1HKG A;  3VEZ A;  2A41 A;  4CCH A;  1HYZ A;  3LAN A;  2DFF A;  3JYT A;  4I9Q A;  1NG9 A;  1JLE A;  2B6A A;  3BY5 A;  1LAV A;  2I7N A;  4DR6 K;  3VMF B;  4JS4 A;  4CF0 A;  4YOT A;  3NH0 A;  5HRP A;  1SL0 A;  1BO5 O;  4U7B A;  4DSL A;  3FZH A;  4JKF A;  3OYM A;  4AHS A;  4CHO A;  5M1O A;  4BQZ A;  2UYT A;  5FPM A;  4MO5 A;  2ITG A;  2RF2 A;  1HNI A;  1BG3 A;  1GLL O;  3ZSY A;  4M45 A;  4DTM A;  4M7Y A;  2YI1 A;  4F9O A;  3SUP A;  1RDC A;  1Z05 A;  2HHS A;  4BRE A;  4Y0W A;  3O3H A;  4BAC A;  2QWP A;  4KB1 A;  3CJC A;  1QQM A;  5BRD A;  1JCF A;  1YHQ N;  3FGU A;  3AVF A;  3MWT A;  3IS9 A;  3TTF A;  5AQV A;  4BRI A;  1HPZ A;  4B9M A;  3OYK A;  2HVI A;  3CJ7 A;  3I0R A;  3SMP A;  2D0A A;  3BUZ B;  3EKS A;  3H1V X;  3CCM N;  3G25 A;  1GLJ O;  2HF3 A;  4CES A;  1TV6 A;  2P5O A;  4EZ6 A;  3H3O B;  2E4L A;  1HPM A;  3MN5 A;  1JCE A;  3MWP A;  1NGI A;  2ZD1 A;  3AY9 A;  4BC4 A;  2VCP A;  2P1J A;  3KD1 E;  4H4M A;  2Q3S A;  3W0L A;  4CED A;  3WNF A;  1VRU A;  4CF1 A;  1RTH A;  4FW2 A;  1ZBI A;  3EN9 A;  1VQ7 N;  2G8W A;  3BF3 A;  3M8Q A;  5DMR A;  4A5B A;  4WFA L;  3NF7 A;  4IJA A;  2Y1J A;  1YJN N;  3MX2 A;  1LAW A;  4IG3 A;  4XH4 A;  1RGI A;  1HRH A;  1TK5 A;  2WTU A;  2IVP A;  4B9Q A;  3P1G A;  4JHD A;  4BE2 A;  1VHX A;  3M6G A;  5JS1 A;  5IWA K;  4G1Q A;  5DK5 A;  4DTU A;  4Q5V A;  4OJR A;  1L3V A;  2O8B A;  4H5N A;  4DFP A;  4BGB A;  1EKE A;  2XHB A;  3ID8 A;  4CJQ A;  2W41 A;  4FWO A;  4W5Q A;  4CJS A;  1O13 A;  1D4X A;  3LPU A;  4B9V A;  2VGN A;  1EQY A;  1VSH A;  2BAN A;  4RG8 A;  3TAF A;  1NOZ A;  1YTA A;  3TSQ A;  4K0K K;  3SQ0 A;  3CYM A;  4FWK A;  4H0X B;  2FLO A;  5I9E B;  1C0F A;  4KHP K;  3C0B A;  3V9W A;  2F8T A;  4OGC A;  5AQU A;  4B9T A;  1K9M O;  1YI2 N;  4DV1 K;  4GV9 A;  3ZSX A;  5TKW A;  5EXW A;  4GV3 A;  2YHB A;  4CJL A;  4FLU A;  4Q0B A;  1YVU A;  2CH6 A;  1NOY A;  3P4I A;  1DLO A;  2RHK A;  3UKR A;  1BCM A;  4DSE A;  3G6E N;  5AQT A;  1VQM N;  1ATS A;  4NCB A;  2NRW A;  1J54 A;  2NRZ A;  2OPS A;  3A5N C;  4BQL A;  4FWP A;  2R7Y A;  1LW0 A;  2X78 A;  4H0T B;  4JK7 A;  4JEP A;  3ENB A;  3O9S A;  4A57 A;  3KVG A;  3DYA A;  4LF5 K;  4E7I A;  3BF1 A;  1IBK K;  3WXJ A;  4JHD B;  3VF6 A;  5C15 A;  3MXM A;  5K14 A;  2GV9 A;  3L6Q A;  1NGH A;  1TAQ A;  5FRN A;  4MO4 A;  1EWR A;  4KKO A;  3OA9 A;  3C6A A;  5AQL A;  4LF9 K;  1EET A;  1RT2 A;  4KO0 A;  3R3L A;  2OZS A;  4H4O A;  5JS2 A;  2P9L B;  3CQX A;  2UXB K;  2F7T A;  3CXC M;  2VG6 A;  3R6M A;  1XUP O;  2FBY A;  1VSL A;  3DMJ A;  1QHT A;  3PV8 A;  2D0P A;  4MLH A;  2F96 A;  5HRS A;  1BQM A;  5E26 A;  2W6K A;  4BRM A;  3JS6 A;  1S9E A;  3J7Z O;  2NRV A;  5AQS A;  1LV5 A;  4PKH A;  1WAF A;  4CEZ A;  1JXE A;  4DTJ A;  4YDU A;  1ZBS A;  4BVP A;  2QI2 A;  4PL7 A;  1I94 K;  2XY6 A;  3K5M A;  2W40 A;  3AAP A;  3TPQ A;  4FJN A;  3P5J A;  2V52 B;  3CFP A;  3CFR A;  4N56 A;  3ZLJ A;  4JS5 A;  4DS4 A;  4PWD A;  1Y97 A;  4KI4 A;  3TSP A;  5MLC Q;  3DLR A;  2VWB A;  3TR8 A;  1BOT O;  3OYG A;  3T3F A;  4FLV A;  4GKJ K;  1QQC A;  2HW3 A;  1RT5 A;  5FRO A;  3F2K A;  5KPT A;  1CLQ A;  3CJ1 A;  4CZH A;  3HJF A;  1C0G A;  2BDP A;  3KK7 A;  3QBW A;  3VOV A;  3NGZ A;  4BRQ A;  3IMX A;  1VQ6 N;  4K8Z A;  1XC9 A;  3ZT3 A;  4IG0 A;  4RW9 A;  3M8P A;  2ASP A;  2NLX A;  3VEO A;  2QWO A;  3QFP A;  3OYJ A;  4KRE A;  4JAX A;  1RCH A;  4C8N A;  5GIO A;  4ZTF A;  4J2B A;  4BRK A;  4CGJ A;  4OO1 J;  2E2O A;  3LDN A;  1REV A;  1SQK A;  1C0M A;  3IFR A;  2JGU A;  2YCH A;  3C7N A;  4CEA A;  4FWS A;  3VQE A;  3V6D A;  5CR4 A;  2O8D A;  3NE6 A;  3FZM A;  3RR8 A;  1ZBF A;  3LZJ A;  3LAL A;  1BA0 A;  2BE2 A;  2I7P A;  2RN2 A;  5FPD A;  1TKX A;  3ZT1 A;  3G4S N;  4IFY A;  4BRO A;  5AQW A;  2KHO A;  2YV0 X;  4M3Z A;  3ZCM A;  3K59 A;  3DXK A;  1JLG A;  2E6M A;  3ZSZ A;  3SYZ A;  2NUB A;  3VES A;  3W3D A;  4M3X A;  3FR0 A;  4YOU A;  1RDW X;  5BPL A;  1S6P A;  3IG1 A;  3CCQ N;  1ESV A;  1XC3 A;  4JNE A;  3R8E A;  1YTU A;  3KLH A;  1VSF A;  4V19 S;  2IS3 A;  2O8E B;  1KVC A;  1NNE A;  2DPN A;  3OYE A;  1U6Z A;  1V4T A;  2P9I B;  4RW4 A;  4WYB A;  3VA3 A;  4ILH A;  5AQH A;  4HTU A;  1T8E A;  1NBW A;  3HST B;  5CHI A;  2BH1 A;  4A62 A;  4BVO A;  4W5N A;  1S6Q A;  5GAH P;  4O4G A;  5J2Q A;  3UKU A;  4WFB L;  3TSU A;  5I3U A;  4DG1 A;  5BRF A;  3CC2 N;  1CXU A;  3NGI A;  1NKE A;  3SLC A;  3TWH A;  4B1V A;  3WXI A;  4KB0 A;  3DAW A;  3D0P A;  3DLG A;  5BN8 A;  2E2P A;  4DB3 A;  5M1Q A;  3CCU N;  1TAU A;  3SBG A;  4DSF A;  4LSN A;  3TAQ A;  4EP5 A;  1S1T A;  3DXM A;  2D1K A;  4AHR A;  3SBT A;  2IAJ A;  3C7N B;  4OKJ A;  3OJS A;  1KSP A;  1KRP A;  4FZY A;  4LFB K;  4QS9 A;  4ID1 A;  2O8D B;  3VQ5 A;  4JKG A;  3B8A X;  4Z94 A;  3C94 A;  4JKH A;  4BG8 A;  4DR7 K;  2ZE2 A;  2OAN A;  4IBN A;  4RW8 A;  4CJE A;  4CJV A;  1DKG D;  4BE0 A;  3THY A;  3DXK B;  5AJ3 K;  4CHN A;  2FSK A;  1KFD A;  4FWL A;  4A5A A;  3EE9 A;  4E3S A;  3K58 A;  4L3Q A;  4PQU A;  3C95 A;  5AZI A;  3J7A P;  4CBX A;  3CIP A;  2PYJ A;  3AO5 A;  5AQZ A;  3PIO L;  3CMA N;  1YF5 L;  3VQ4 A;  5HRO A;  1T05 A;  4DR2 K;  4OKE A;  4B3R K;  4AF1 A;  1U04 A;  4BG9 A;  3EZ5 A;  3O5B A;  2A40 A;  4FL9 A;  1NJZ A;  3V9Z A;  2F9T A;  3KK2 A;  4DV7 K;  2VGM A;  3QIN A;  4GMJ B;  1XMO K;  3VA0 A;  5LMN K;  3LDS A;  4Z4G A;  3UKU B;  2X74 A;  4EFH A;  3R1X A;  1JXB A;  1HKB A;  4KBO A;  3N4Q A;  4O0J A;  2VG7 A;  2HHV A;  1HMV A;  4JI8 K;  4CF9 A; 
#chains in the Genus database with same CATH homology
 3ZYY X;  4CZG A;  4BRL A;  2EWS A;  4M7Y A;  2YI1 A;  4F9O A;  4JKD A;  4JN4 A;  4FOE A;  1Z05 A;  3TTC A;  2ZJP L;  1W2B M;  2D4W A;  2GX9 A;  4BRE A;  3EKU A;  4Y0W A;  2QWL A;  5M1P A;  2Q0U A;  3ZET A;  2QWP A;  2E2N A;  4C1N K;  3E9L A;  3WUH A;  3CJC A;  1NGA A;  1QQM A;  4PHT X;  1MWM A;  4NB4 A;  5BRD A;  1VQP N;  4WQ5 C;  5CE3 A;  1JCF A;  1HKC A;  4JKG B;  1YHQ N;  3FGU A;  2RE2 A;  3MCP A;  3WXK A;  5GAG P;  4ISF A;  3G71 N;  4WQ5 A;  2Q0R A;  5AQQ A;  4BRH A;  1YXQ A;  3M1F A;  1RFQ A;  3MWT A;  3TTF A;  1ATN A;  3GDQ A;  1LOT B;  3H46 O;  3MN7 A;  4FOI A;  5AQI A;  5AQV A;  4CI6 A;  5BRE A;  5GIP A;  1NGJ A;  3CCJ N;  4BRI A;  4BRP A;  1QHA A;  4CZI A;  1KC8 O;  2QA4 N;  3CJ7 A;  1YIJ N;  2ZWH A;  4MDA A;  3SMP A;  1X3N A;  3BUZ B;  3CCE N;  3L4I A;  3AAQ A;  3EKS A;  3H1V X;  3LDP A;  3CCM N;  3G25 A;  4ISG A;  1TYQ A;  4QS7 A;  3D2E A;  4YOV A;  3KWG A;  1HJO A;  1GLJ O;  3ZX2 A;  2NRH A;  4ILJ A;  5BPN A;  2HF3 A;  5AZI B;  5C2F A;  3H3O B;  2IVN A;  3I8B A;  3VGL A;  1HPM A;  3MN5 A;  1JCE A;  2QW9 A;  5JLH A;  3MWP A;  4WQ4 A;  5ELZ A;  3C6H A;  4ILG B;  1NGI A;  2P9S B;  3AY9 A;  3TTD A;  4AM7 A;  4BC4 A;  2VCP A;  1SAZ A;  1QQN A;  4JKC A;  3W0L A;  3K9J A;  3MX5 A;  3T69 A;  4IJN A;  3FLC O;  3OBY A;  1CZA N;  3MCA B;  5EY4 A;  3VEV A;  1GLE G;  2AP1 A;  2PAV A;  2QWR A;  4UY8 O;  4JK9 A;  3EN9 A;  1VQ7 N;  2GUP A;  5KQ8 A;  3QDK A;  3BF3 A;  4I6M A;  2V7Z A;  4H0V B;  3CCV N;  4H0O A;  1S72 N;  3CET A;  3O6W A;  4A5B A;  3VGK A;  4FWR A;  4WFA L;  2V7Y A;  2F9W A;  1NGC A;  4IO8 A;  1NMD A;  2V51 B;  4IJA A;  1NGD A;  3O1B A;  1YJN N;  3EO3 A;  3MX2 A;  4IEE A;  2GEL A;  2ASO A;  5AQK A;  4IXC A;  4BRF A;  3LDO A;  2E8A A;  4HTL A;  4XH4 A;  1RGI A;  4H0Y B;  4O5F A;  4R79 A;  3ZEU B;  2HST A;  2OTL N;  3CJ9 A;  2IVP A;  1TUY A;  1KXP A;  3CPE A;  3UKR B;  4B9Q A;  3QB0 A;  3OHR A;  1Q18 A;  4JHD A;  4B1Z A;  4CZM A;  5AQF A;  5EVZ A;  3M6G A;  2QXL A;  2GWK A;  1VQ8 N;  3HM8 A;  4OPA A;  5C2D A;  5LY3 A;  5AFU A;  4JD2 B;  2P9K B;  3HZ6 A;  3HTV A;  4WFN L;  3ULE A;  2H3G X;  3CQY A;  3AGR A;  3IUC A;  4OPH A;  2ITM A;  3CJA A;  2GWJ A;  4H5N A;  3F5T A;  3Q7B A;  5M1N A;  4FWN A;  4DQ8 A;  3SAF A;  4BGB A;  2HBL A;  3ID8 A;  4E1J A;  3U8X A;  2FSN A;  2YJF A;  4EAH D;  1WOQ A;  2A5X A;  4IO9 L;  3VEX A;  2W41 A;  4FWO A;  5E84 A;  3OW2 M;  2FF3 B;  4FPA A;  4BR2 A;  4BR9 A;  5GAD P;  4H5T A;  3L4Q A;  1O13 A;  1QVF M;  1D4X A;  4JKE A;  3ZX0 A;  3GG4 A;  2WFB A;  3NVK A;  1NWK A;  2VGN A;  1IG8 A;  1EQY A;  3VEY A;  2Q2R A;  3TSQ A;  3I56 N;  5C0Y A;  2BTF A;  5ADX A;  3UE5 A;  3EL2 A;  1J6Z A;  3O9R A;  4FWK A;  4IFE A;  4B1U B;  1TYQ B;  4BRA A;  3D2E B;  4H0X B;  1NGG A;  2FLO A;  1C0F A;  3LDL A;  1YAG A;  5I9E B;  1VQK N;  3C0B A;  3SAG A;  5AQU A;  2HBM A;  1K9M O;  4A61 A;  1YI2 N;  3VEW A;  2ZGY A;  1Q86 O;  1RDU A;  4GV9 A;  2P9P A;  5EXW A;  5TKW A;  3ATV A;  5M1F A;  4YOY A;  4GV3 A;  2GEM A;  3VTH A;  1VQ9 N;  5C12 A;  3A0I X;  2ZJQ L;  2CH6 A;  3ZX3 A;  3P4I A;  3ZEU A;  5M1K A;  2NRX A;  2RHK A;  3UKR A;  2PBD A;  3SMS A;  4BR5 A;  3GBT A;  3CPW M;  4KH4 A;  3VEN A;  5AQT A;  5HL7 L;  5H1S Q;  3A5L C;  3U9D A;  3G6E N;  2ZJR L;  2WBN A;  3RSE B;  1VQM N;  2BUP A;  1E4G T;  4H5V A;  1ATS A;  2P9K A;  4JD2 A;  2NRW A;  3IKM A;  2E20 A;  4BRC A;  3U9Z A;  1ATR A;  2A3Z A;  5TKY A;  1S3X A;  2YHY A;  1YUW A;  4I6M B;  2NRZ A;  3RVC A;  3A5N C;  4FWM A;  3HOT A;  5LJV A;  4CZJ A;  2NZT A;  4FWP A;  4BQL A;  1H1V A;  4O8K A;  4H0T B;  1KQS M;  4JK7 A;  4JEP A;  4JKB A;  3OBW A;  1N8R O;  3ENB A;  3MMV A;  3EZW A;  2YJE A;  3O9S A;  4KH6 A;  4EIA A;  2VYP A;  3P39 A;  4CZE A;  5HOO A;  4A57 A;  1QQO A;  3E9O A;  3KVG A;  4RCH A;  2HBJ A;  4IEI A;  2IIR A;  4YOR A;  3BF1 A;  1X3M A;  3WXJ A;  4JHD B;  3VF6 A;  5C15 A;  5DM7 L;  3L6Q A;  1QZ6 A;  4CZK A;  1NGH A;  3VF4 A;  3DLL L;  1KAY A;  4MO4 A;  3ULE B;  2CGK A;  5AFU H;  5AR0 A;  4WQ4 C;  4EHT A;  3OA9 A;  4IOX A;  3C6A A;  4IOA L;  4B1X B;  5AQG A;  1Y64 A;  3H3N O;  3QML A;  3H45 C;  4FSV A;  5AQL A;  5F1X A;  2ZGZ A;  3HOS A;  2YHW A;  3R3L A;  2E1Y A;  1ZC6 A;  4CD1 A;  2ZF5 O;  3S41 A;  1SZ2 A;  5C10 A;  2P9L B;  3CQX A;  3WQT A;  4BR0 A;  1VQO N;  1NLV A;  2F7T A;  5KQD A;  3CXC M;  1Q7Y O;  2CGL A;  3CER A;  3CHW A;  3RSE A;  3O8M A;  4BR7 A;  1VQ4 N;  3CC7 N;  4FVU A;  1NGE A;  3R6M A;  1XUP O;  3CD6 N;  4PKG A;  5JLF A;  2Q31 A;  1YIT N;  2D0P A;  4MLH A;  3FZK A;  5E26 A;  4BRM A;  3JS6 A;  5AQX A;  5ADX H;  3J7Z O;  3FZF A;  2NRV A;  5AQS A;  4PKH A;  3K9K A;  1BDG A;  3R9P A;  2QTD A;  4JKA A;  2QWQ A;  4IZ9 A;  5F0X A;  3CI5 A;  4YDU A;  2P9U B;  4GV6 A;  1ZBS A;  1K8K A;  3VET A;  2P9P B;  3QIC A;  4BVP A;  2QI2 A;  4PL7 A;  1X9J A;  2OTJ N;  3DJC A;  3KZB A;  4YOW A;  1OVY A;  1ZXO A;  1OKJ A;  5AQP A;  2W40 A;  1GLC G;  2Q36 A;  4AM6 A;  3O9Q A;  2A6A A;  1NGB A;  2AA4 A;  3AAP A;  3TPQ A;  4A2B A;  4C1N I;  5FPN A;  1U2V A;  4C23 A;  2V52 B;  5JVH L;  3O9U A;  4J8F A;  4PKI A;  2HMP A;  1IJJ A;  5B8H A;  3U4L A;  1M90 O;  2KKZ A;  1WUA A;  2P9N B;  3A8Y A;  1EO1 A;  5AQO A;  1VQ5 N;  2FXU A;  1R59 O;  5F2R A;  2NNW A;  4RWT A;  3TSP A;  5MLC Q;  2VWB A;  3LM9 A;  4M7X A;  3O1W A;  1BOT O;  3D6R A;  4XH5 A;  5BR9 A;  2P9L A;  3JXU A;  4GVE A;  4CZL A;  4EHU A;  4CZF A;  4GY2 B;  1KAZ A;  4FO0 A;  3GL1 A;  1DEJ A;  3F2K A;  4A59 A;  5KPT A;  5AQJ A;  3CJ1 A;  4CZH A;  1C0G A;  1YVN A;  3QFU A;  3CC4 N;  3KK7 A;  1TUU A;  3QBW A;  3VOV A;  1VAZ A;  5JMV A;  2WC9 A;  4BRQ A;  2YX6 A;  1GLB G;  3IMX A;  1VQ6 N;  1Z6R A;  5JVG L;  3E66 A;  3CCS N;  1BUP A;  2ASP A;  2FF6 A;  1MDU B;  2NLX A;  1QZ5 A;  3VEO A;  1VQL N;  5AQM A;  2QWO A;  1HX1 A;  3QFP A;  4JAX A;  2J4R A;  3WXL A;  3N4P A;  2P9U A;  4H5R A;  5GIO A;  4BRK A;  2Q1N A;  3M3Z A;  3ENH A;  4OO1 J;  2E2O A;  2GTD A;  3VF2 A;  3LDN A;  2E88 A;  1GLD G;  1SQK A;  3IFR A;  4H0P A;  4HWI A;  4NLC A;  2YCH A;  3CCR N;  3C7N A;  1DT9 A;  4FWS A;  3VGM A;  2CGJ A;  5CR4 A;  1LCU A;  1BWF O;  3FZM A;  3WEE B;  3P31 A;  4WCE L;  1T3V A;  4PL8 A;  5BN9 A;  1BA0 A;  4O8U A;  2I7P A;  3PIP L;  4IOC L;  2YHX A;  4BRG A;  3F9M A;  5FPD A;  2P9N A;  3G4S N;  1GLF O;  3LL3 A;  3MN6 A;  4BRO A;  5AQW A;  2KHO A;  4B1W B;  3HBT A;  3DXK A;  4CJ7 A;  5FPE A;  2QM1 A;  3GOI A;  1VQN N;  4IDH A;  4NO7 A;  1MA9 B;  3VES A;  1K8K B;  3CF5 L;  3DXM B;  3W3D A;  4K25 A;  4BY9 C;  3FR0 A;  4YOU A;  3BEX A;  3SJH A;  1RDW X;  5BPL A;  3CCL N;  3MK6 A;  1Q82 O;  3CCQ N;  1ESV A;  3EE8 A;  1XC3 A;  1M1K O;  4JNE A;  3PLA A;  3R8E A;  1U2V B;  3E1Y A;  3FE1 A;  4DCH A;  4B1Y B;  4BC5 A;  3L0Q A;  1V4S A;  1E4F T;  3LDQ A;  4GNI A;  2KLA A;  2Q97 A;  4XH1 A;  3VER A;  4CBU A;  1Q81 O;  1NGF A;  2DPN A;  1U6Z A;  1V4T A;  1DGK N;  2P9I B;  3DWL A;  4WYB A;  3WXM B;  5GAE P;  4ILH A;  4BR4 A;  4DKW A;  5EOY A;  2E2Q A;  2QEX N;  4BC3 A;  5AQH A;  3ID6 A;  3WT0 A;  4FWQ A;  4WF9 L;  1P90 A;  4MLE A;  5AZJ B;  1NBW A;  5CHI A;  3D2F B;  4KH5 A;  1P8Z A;  2BH1 A;  4JK8 A;  5AQN A;  3T7Z A;  2E1Z A;  4A62 A;  3WEE A;  4BVO A;  3GE1 A;  3KWI A;  2HOE A;  5GAH P;  1HLU A;  1XQS C;  3AGK A;  4LC9 B;  3TSU A;  3UKU A;  4WFB L;  5BRF A;  3CC2 N;  3MDQ A;  3M5R A;  4H5W A;  3O9T A;  4A2A A;  2JWK A;  4FPB A;  3SLC A;  5KPZ A;  1YJ9 N;  1KAX A;  2D0O A;  4H03 B;  3BP8 A;  3WXI A;  4B1V A;  5BPM A;  3DAW A;  4K41 A;  3SAH A;  4BC2 A;  3HSC A;  4YDU C;  5EX5 A;  2CH5 A;  2E2P A;  4DB3 A;  1BA1 A;  5BN8 A;  5M1Q A;  3CCU N;  1NM1 A;  3SBG A;  3ATU A;  4BRD A;  3CME N;  3SK3 A;  3FZL A;  1S22 A;  3DXM A;  3E9P A;  2D1K A;  3MN9 A;  1ILY A;  3SBT A;  5BRH A;  3C7N B;  3UB5 A;  1JJ2 M;  3H6E A;  4QS9 A;  3NVM A;  1BU6 O;  1SS6 A;  3B8A X;  4JKG A;  3NMU A;  2QWN A;  4Z94 A;  1K8A O;  4JKH A;  1MWK A;  4BG8 A;  4CBW A;  4ISE A;  4QS8 A;  3LM2 A;  1GLA G;  3FFK B;  2PFU A;  2OAN A;  1JCG A;  4YOX A;  3H1Q A;  2P9I A;  3WQU A;  4K42 A;  4XEI A;  4DHY A;  3VTI A;  5DM6 L;  1DKG D;  3AAR A;  2HBK A;  3DXK B;  3CJB A;  3TU5 A;  5GIN A;  5AZJ A;  2FSK A;  3D2F A;  3ENO A;  2HF4 A;  5AQR A;  1QVG M;  1G99 A;  4FWL A;  3O08 A;  3ZET B;  3I55 N;  4RTF D;  4A5A A;  4K43 A;  3EE9 A;  2NRT A;  5JIC A;  4G9Z A;  3KHY A;  4L3Q A;  3IDH A;  5AZI A;  2NRR A;  1W97 L;  1HUX A;  2ASM A;  2QWM A;  3O4W A;  1HKG A;  3CIP A;  4CBX A;  3I33 A;  3QBX A;  3VPZ A;  3Q7C A;  2A41 A;  4NLB A;  5AQZ A;  3VEZ A;  3PIO L;  5LJW A;  3CMA N;  3J8A A;  1YF5 L;  4MDB A;  3D7E O;  4U67 L;  1T6C A;  2P9S A;  4BGA A;  5KPR A;  4AF1 A;  1NJI O;  4IWV A;  4BRN A;  4BG9 A;  3O5B A;  3A5M C;  2A40 A;  2JWL A;  4FL9 A;  2A42 A;  2I7N A;  1GLL O;  3HI0 A;  3VMF B;  2F9T A;  4YOT A;  2VGM A;  3P38 A;  5AQY A;  4M63 C;  1T6D A;  1BO5 O;  4U7B A;  3FZH A;  2IVO A;  4JKF A;  3UKU B;  1K73 O;  4EFH A;  2WUS A;  3R1X A;  3C65 A;  1T44 A;  1HKB A;  4KBO A;  3N4Q A;  5M1O A;  1YJW N;  4BQZ A;  2UYT A;  5FPM A;  1KD1 O;  4CD3 A;  4MO5 A;  3HRG A;  1BG3 A;  3O80 A;  3A5O C;  2FSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...