4WFBL

The crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with bc-3205
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
110
structure length
110
Chain Sequence
MISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKGVTLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYLYHGRVKALAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S rRNA
publication title Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
pubmed doi rcsb
total genus 16
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2014-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4wfbL01
1YITN 2ZJQL 1NJIO 3CCVN 3DLLL 1VQ6N 1W2BM 1QVFM 2OTJN 3CMEN 1K73O 1VQ5N 3CCMN 5GAGP 3CCRN 3CCUN 1N8RO 1YI2N 5DM6L 5DM7L 4WF9L 1VQ9N 3CC4N 3G71N 3CCJN 3OW2M 1YIJN 1VQKN 1Q86O 1YJNN 1VQ8N 1YHQN 4WFAL 1ILYA 1OVYA 1K9MO 1VQLN 3CXCM 5GADP 4WCEL 3I56N 1VQNN 3I55N 3CCLN 5JVGL 3G4SN 4IO9L 1VQPN 1M1KO 5GAEP 1YJWN 1Q7YO 3CCEN 3CCSN 1VQON 5JVHL 2ZJRL 2OTLN 3J7ZO 4WFBL 5HL7L 1KQSM 1Q82O 3CPWM 3G6EN 3CF5L 3CCQN 5H1SQ 1VQMN 4U67L 4IOCL 1JJ2M 2ZJPL 3PIPL 4WFNL 3CMAN 4IOAL 1K8AO 3CC2N 1YJ9N 3CD6N 1KC8O 1Q81O 1M90O 2QEXN 3PIOL 2QA4N 1VQ7N 5MLCQ 1S72N 4UY8O 5GAHP 1VQ4N 1KD1O 1QVGM 3CC7N
chains in the Genus database with same CATH superfamily
1XWLA 2V7ZA 4LH4A 3ULEA 3WXMB 1IKYA 3VEOA 3O4NA 3S9HA 3FZMA 4EHUA 1KAYA 1OH7A 2O8DB 3VENA 4BRDA 1HR0K 3DM2A 4R79A 3C0BA 2OCEA 3RMAA 3OJUA 5J2QA 2X74A 3HJFA 4JN4A 4CF0A 3CFPA 3ZSOA 1YTUA 1RILA 4LF8K 3AA4A 3TTDA 1KSPA 3DRRA 3SBTA 3VERA 4H03B 4E7LA 2E6LA 2QWNA 1RT7A 1U49A 1LWCA 1JCFA 2QWPA 3TSUA 4CHOA 5AQQA 4PKHA 3J80O 4JHDA 1K8KB 1N33K 5GIOA 1J5EK 4BRNA 3SI6A 1T6DA 1U2VB 2X6NA 1VQPN 5KRSA 4M3RA 4FW2A 2GWJA 3RSEA 4CESA 5CYMA 3IG1A 3L2WA 3CCEN 2AP1A 2QI2A 4ILHA 3VGMA 3KLIA 4IEIA 3CQ8A 4EP5A 3NGZA 2WFBA 5KQDA 4Z4CA 4K0KK 4M3YA 3E9PA 3SUOA 5BR9A 3CQXA 3L3VA 3D2EA 3WXJA 4FJGA 4FZXC 5AZIB 5JS2A 4O8UA 3MXIA 4FJNA 3HSCA 1BU6O 5AQJA 1J6ZA 3QIPA 1WSIA 2P9UB 4JLHA 1JLBA 3DLGA 3WXKA 1GOCA 3FE1A 5HOOA 3AA3A 1UOCA 5HP1A 1NK0A 3OJSA 4DSLA 3UB5A 1KXPA 4PA1A 4M42A 2A41A 1QSLA 1VQ4N 3A5NC 4B8CA 4W5RA 2D4WA 2I7NA 3EKSA 3L2VA 3CC7N 1HPZA 3ZCMA 4FVMA 1WLJA 1J5OA 5AJ3K 1KFDA 3HM8A 2YNHA 4GVEA 3V9ZA 3VEZA 2G8UA 3DAWA 2Q0UA 3CJ7A 2VWKA 1TVRA 3CETA 3ZSXA 4DFMA 1VSIA 1IKVA 4QS7A 1YI2N 3U9DA 1TKZA 4O4GA 4EP4A 1RTDA 3BF1A 2YV0X 2XY6A 2HVIA 1BISA 3UKRB 3VQEA 3MCAB 1GOAA 4F2RA 1QQMA 3KIOA 3HM9A 3WT0A 4RW9A 2ZGZA 3P39A 3O9SA 4W5NA 4IJNA 4CF1A 3DLHA 3AO3A 4CIGA 2ZQBA 2ETJA 4ZTFA 3ZYYX 2CGJA 3DXMB 1CZAN 3PO5A 4FXDA 4BDZA 1QTMA 3S3NA 3M5RA 4DR2K 4M3ZA 1TKDA 3ZSRA 2HHTA 4IG0A 5GAEP 4DTMA 1Y64A 3P38A 2P9PB 3P5JA 1NGGA 1RDCA 2BGGA 3CCSN 2OPSA 1DT9A 1ASWA 3K9KA 2OTLN 2QKKA 4H5TA 2EX3A 5HL7L 3NF9A 2ZWHA 3W0LA 3E01A 3TAGA 4LF5K 4AHRA 1BIZA 2F4VK 4B3RK 4GKKK 5ADXA 3THYB 3TU5A 1JJ2M 3L4QA 4B9MA 3HOSA 4H0VB 1RT3A 2F7TA 1WSHA 4IOAL 3CJCA 2R7YA 4DS4A 1BO5O 3OTOK 4HUGA 5T7BA 2HHWA 2ZGYA 1BUPA 3ZETA 1T8EA 3RMCA 1REVA 1HNXK 3I0SA 3NF7A 4DF4A 1NJZA 1QHAA 2G8FA 1VQ7N 1EP4A 5KQ8A 4IKFA 1B9DA 4JI4K 3PSIA 3WQUA 4DTPA 3AA5X 4E19A 1GLAG 4O0JA 1RBTA 2O8FB 3BGRA 4I7FA 3VQ5A 1NK7A 1NJIO 4OPAA 1UWBA 4IDKA 3SJHA 4NB4A 1RBRA 2A40A 2KQ2A 3A5MC 2OTJN 4RW4A 4DR5K 3TAFA 4CF9A 5F2RA 3CCRN 5BPNA 3DMJA 1XMQK 4CJKA 4DU3A 1VSFA 4B3MK 4YDUC 4CEAA 1DKGD 2IOCA 4DTNA 4HWIA 4KTZA 1XNQK 2O8CA 4CD1A 1QZ6A 5F1XA 4JI0K 2W6KA 5TKWA 5C25A 4W5QA 3RMBA 2P9KA 4Z4EA 3LDLA 3D2FA 4O44A 4FM0A 3KLEA 1RTIA 5AZJB 4CGGA 3MN7A 2A1SA 2KLAA 5JVGL 1NKCA 2ZF5O 2BTFA 4ILGB 1G15A 4XH4A 1CLQA 1QQCA 3O1WA 4Z94A 3G0ZA 2IC3A 3A5LC 3OYFA 3TTFA 5KTQA 4OPKA 3ZX0A 4DQIA 1I39A 3L2UA 1RT2A 5I42A 4JS5A 1YTAA 4CCHA 2JWKA 3SQ1A 1HNWK 1VHXA 4JI2K 3VQ7A 1LCUA 4BR9A 4H8KA 1LW0A 3O9UA 2Z1HA 2KHOA 4F2SA 4YNQA 2ZJPL 1QHTA 3FFKB 2YCHA 1OVQA 3PIPL 3EN9A 1T44A 4KHWA 3QFPA 4BRMA 1BA0A 3CQYA 4JI3K 2ATQA 3JS6A 1EO1A 1M90O 3DLEA 3HI0A 2GUPA 5A2QO 4JKAA 2QA4N 2D0PA 3T7ZA 1WOQA 5MLCQ 4A62A 4E3SA 2QWMA 1Q8IA 3WNFA 3J8AA 4OPJA 3I33A 3OHRA 2A1RA 3AVNA 3T69A 3AVMA 5AQNA 4H0TB 2IVPA 3FFIA 1C1CA 1N8RO 2ITMA 2YNFA 4WF9L 4DSEA 3Q7BA 4YORA 4CFAA 3MK6A 3HOTA 3QBXA 5GIPA 2HMPA 3D0PA 2OZSA 3CFRA 2NRVA 3JSMA 3J7YP 1YIJN 4LFBK 4KAZA 4FWPA 4CW7B 1VQ8N 1SL1A 4WFAL 4B9QA 4DFKA 4O0IA 4ISGA 3WEEA 3CYMA 2DPNA 5LMNK 3I56N 4KTWA 2P9NB 5AFUH 3S3OA 1BCMA 4LC9B 1M1KO 1J9AA 2UYTA 3QEXA 1BA1A 3QESA 4C1NI 1HKCA 3BUZB 4CJSA 4YY3K 4B1YB 3T1HK 2HBKA 4OGCA 2UXBK 4B1ZA 1W7AA 2P5GA 2F9TA 1S1UA 4DR4K 5HROA 4BDPA 3J7ZO 4WFBL 1NWKA 4V19S 1WN7A 4AF1A 1GLJO 4LSNA 4FLUA 2PZSA 1IKWA 3NGIA 3KD5E 3KKRA 1IO2A 2FF3B 3GG4A 1O1WA 1KVBA 3MEDA 1X3NA 4DQQA 3DWLA 3KLGA 4NXNK 5SWMA 2E5LK 1FK9A 1HX1A 4F4KA 3DXKA 3ZSZA 4CZKA 3HPHA 2BANA 4YOYA 4BQLA 3UE5A 5AQHA 2ASMA 3MDQA 4I6MA 5AQIA 4KREA 4IJAA 4DWIA 3OS0A 4EAHD 4BDYA 4JKDA 2VG7A 3L2RA 3SV4A 5JLFA 3AO5A 3QLHA 3KWGA 4K25A 4PY5A 4WQ4C 1Q18A 2I5JA 1KRPA 2IVOA 3ISNC 1CZBA 3KKSA 4CJ4A 2P5OA 4B9NA 4CE9A 4DSFA 3GL1A 3QDKA 3SK3A 1N36K 1NGDA 4IFVA 4FJ5A 3QETA 2XY8A 1VRUA 4CFCA 4YOXA 3CCUN 4FJKA 2YHYA 2HNYA 4ELUA 1DTTA 4YOVA 1ATNA 3HP9A 3EEQA 4GV6A 2D5RA 4KHQA 3E9OA 1B92A 2G8WA 3VQ6A 2W6LA 3HP6A 1ILYA 1BCOA 3CXCM 1JLGA 3UKUA 2OZMA 4CJ7A 4M41A 1KVAA 1XC3A 1NMNA 1D9FA 2DTUA 4DV0K 3RVCA 3ZSYA 2ZM6K 4NCAA 3L6QA 3SPZA 4CJVA 1IG9A 1C0TA 4GV3A 2G8HA 3IAYA 3WNGA 2D1KA 4HTLA 2O4GA 4FLXA 1KCFA 5C15A 4CHPA 4E7IA 1RDWX 2QWRA 3RRGA 3KK2A 3H3NO 3OYIA 4CZEA 4YOUA 2G8KA 3RTVA 4BY9C 1VAZA 4C8KA 2RE2A 3BZCA 4R5PA 4A5BA 4JK9A 4JKBA 4JHDB 3ZEUB 4BREA 4CK3A 4A57A 5CZ1A 1T7PA 3R6MA 4KH4A 1KFSA 4LFCK 3LZJA 1S72N 4ZTJA 5AQSA 3BZKA 4MDBA 1OH6A 4KI6A 3O4WA 4BR7A 4OVLA 3PSFA 4FLWA 1NK4A 3HSTB 4DKWA 2ZJQL 3NH2A 4LF9K 1Z6RA 3W3DA 4K8XA 1JLQA 1FJGK 4CK2A 3V81A 5C12A 2O4IA 2QK9A 4JKEA 2B5JA 4PKGA 4CZLA 3VQ9A 1GLLO 4CGJA 1RT1A 4HUFA 1N34K 3C6HA 3V1QA 4B9UA 3LALA 1WBBA 1YVUA 4YFUA 4X62K 2O8BB 2V51B 5BN9A 2P9SA 3OBYA 4IOXA 1RDBA 4DLEA 1D5AA 4LD0A 3K5NA 4QCLA 1WSJA 1HJRA 3THWA 3TWHA 2OPPA 2FBYA 1I3AA 1EKEA 4WCEL 4DB3A 2UUCK 2QTDA 1RT4A 4RW7A 4BE2A 1VSMA 1QSSA 1JLFA 4JKGB 1EWRA 3G4SN 1SKWA 5HRSA 5JMVA 2VQEK 3V9XA 4FWQA 1BIUA 2GBZA 3ID8A 4U7BA 3D45A 4DV6K 1QS4A 1LWEA 3SAHA 5FPDA 5EXWA 5I3UA 2EWSA 4BC2A 4FZYA 4GKJK 1S22A 4WYBA 5JVHL 1JLEA 3VF6A 3M8QA 3VF2A 1DLOA 3B6OA 4F9OA 3OYBA 1Z26A 2Q36A 3VPZA 5B8HA 3H08A 2WTUA 2FBXA 3SQ2A 1RTJA 4FWNA 2OA8A 1YAGA 4IOCL 4H5RA 4L8RB 4RW6A 1TKTA 4MLHA 3ZT1A 1DEJA 4NYFA 3HYFA 3JYTA 3ZX3A 4LY7A 4DTJA 2VWBA 3H6EA 2QEXN 3AVFA 3ENBA 1H1VA 2JLEA 3O1BA 4K8ZA 1XNRK 4GVMA 3E9LA 1L3UA 2Y1JA 2E20A 3BP8A 3C7NA 1HNIA 3K9JA 4MO4A 4CF8A 4Q0BA 4DR1K 1QVGM 3K5OA 4A5AA 3KLHA 2WC9A 5LMUK 2D0BA 3MWPA 4CI6A 1NJWA 4Y1DA 2BUPA 3V9UA 3KTQA 3SAFA 3VQ8A 3ULDA 4OJRA 2NRWA 2F9WA 1ZBLA 1TAUA 1K73O 5AQTA 4X65K 1L3VA 3O8MA 1WAFA 2D0CA 3K59A 4EZ9A 3M8SA 4KFBA 2F96A 3PX6A 4FW1A 3PX0A 4AHTA 4GY2B 4CJQA 4CHNA 3KK3A 4EZ6A 4J2DA 4N5SA 3OYNA 2HF4A 3CPEA 2IVNA 5AQUA 3AO4A 3H45C 4FJ8A 4IEEA 1IKXA 2VYPA 1YUWA 4DS5A 3BEXA 4DTUA 1IH7A 4KPYA 4NLCA 4BRAA 4CGIA 2O8DA 1P90A 2QWOA 3IDHA 4CJWA 4N47A 3U3YA 4Y1CA 5AR0A 2HW3A 1BQNA 3AVKA 5LJVA 1HQUA 1QZ5A 3SUPA 3O9TA 2BE2A 2YJEA 2YKNA 3CCQN 2KZMA 1EWQA 1ITGA 1LOTB 1XHZA 2E2OA 3O3GA 1XI1A 1GOBA 3MN9A 1K8KA 3N4PA 4J8FA 1YXQA 4BRGA 1K8AO 3OS1A 1U2VA 5CHIA 2A42A 4CJ5A 4B3TK 2V7YA 5M1KA 4DTSA 3T1YK 3VQQA 2HHXA 2RN2A 4CEEA 2E2NA 2ZD1A 3D6RA 5C0YA 5M1NA 3H3OB 4J2EA 1YITN 4CD3A 1TUUA 4Q5VA 2WBNA 2GX9A 1BI4B 3LP0A 2D0OA 4B3OA 3NBPA 1W2BM 5AZIA 4CJ3A 1HNZK 4F8RA 1KVCA 1TYQA 4BRFA 4EFHA 1NGJA 4B1XB 4CIFA 4KV8A 3C6TA 4IXCA 1HRHA 3F73A 3IUCA 4BQZA 2NRXA 4JV5K 3LWMA 3G71N 3NFAA 1U45A 2P9IB 3NH0A 2O8EB 1A5WA 4H5WA 3T19A 1NOYA 3G25A 3SBGA 3VQDA 3G10A 1EX4A 2Q31A 3LANA 2QXFA 1YVNA 3MECA 5GINA 4N56A 1HPMA 3VEXA 3QNNA 3ZSQA 1GLBG 3H46O 3HL8A 3LDPA 4YDUA 1NK8A 3CI5A 1WSFA 3P1GA 3QEVA 3QB0A 4G9ZA 1SZ2A 1HNVA 5CZ2A 3OYJA 2KW4A 4A2AA 1NGBA 3P83D 5BREA 4EHTA 4CHQA 1IG8A 1ZBIA 3ZX2A 4X64K 1W97L 2FC0A 4WQ5C 1U6ZA 4B8AB 2OPRA 4FPAA 3UKRA 1LV5A 4DMNA 5KGXA 1ZBHA 3KWIA 1UA1A 4Z4GA 3ATVA 4E7JA 4DV2K 2ITGA 3CIPA 4BR5A 1E4GT 3G6EN 3CF5L 3C94A 3NHGA 4NCBA 3HPOA 2NNWA 5CYQA 1GLDG 3VQCA 4JYAK 2IDOA 1C0FA 1JKHA 3THXB 3WNEA 3FZLA 2XRIA 1NGCA 4B1WB 3CJ1A 3SMPA 1U48A 3GE1A 4RG8A 3AO1A 5DMRA 4PL8A 3AV9A 4E1JA 4JD2B 3JXUA 2P9PA 5C24A 2YI1A 3OVNA 4C8NA 5M1PA 3TAEA 3U6FA 5HRRA 3ZT2A 2E1YA 1JCEA 3K5LA 1S9GA 1X3MA 3V6DA 1NLVA 2HVHA 3AVLA 2DFFA 3CJBA 2KFZA 2OANA 3HT3A 4F3TA 1HKBA 4BWMA 3DYAA 4IFYA 4DQRA 1T05A 1VSJA 2RF2A 4B9VA 5KGWA 2W40A 3LAMA 3S3MA 1NU0A 2V52B 4N41A 3H1QA 1S9EA 4PKIA 3K2PA 5AQWA 3SPYA 2UU9K 4FM2A 2YX6A 3U3GA 4B1VA 4DV7K 3TR8A 3OW2M 3RMDA 1A5XA 1WBDA 1NKBA 1NK6A 2BDPA 1VQKN 2UUBK 4G1QA 4OLBA 1HUXA 1G99A 5AQPA 5JICA 4LF6K 2GUIA 1VQLN 2X6SA 4NO7A 2O8FA 1IJJA 3R3LA 2VWJA 1BG3A 1V4SA 1SUQA 1CXUA 4M63C 2XHBA 4IO9L 3B6PA 5HRPA 1BL3A 2E8AA 3LAKA 4GW6A 4CFDA 4CEQA 3CG7A 3OYGA 2E6MA 4FOIA 4CEDA 2AJQA 2HF3A 3V9WA 3WUHA 3U4LA 4ELVA 2WOMA 4BVOA 1LWFA 2FBTA 5AQKA 3SMSA 5C2FA 4H0OA 1FW6A 5C2DA 1NGHA 5BR8K 4U67L 3ENOA 2Q97A 3Q7CA 4ICLA 4FJHA 1W0HA 4DV3K 3GBTA 1L3SA 2HSTA 3DLRA 4NCGA 3OYDA 4PUOA 3WXIA 4DR7K 3O80A 4H0XB 4Z4FA 1NKEA 3CERA 5EU7A 1YJ9N 2IS3A 4DU1A 1RBVA 4X66K 5CE3A 1N5YA 3U9ZA 1JXBA 3AA2A 2ASPA 3RWUA 3VA3A 2B6AA 4CJPA 5ADXH 3THVA 3O9RA 4DQSA 4KH5A 5KI6A 3A0IX 3TI0A 4FJ7A 5BRFA 3DLLL 1HYSA 2RPIA 4ISFA 4DQ8A 1QVFM 4IZ9A 4JRQA 1VQ5N 4NXMK 3VQBA 1N32K 4AM6A 3A8YA 4C8OA 2KTQA 4DV4K 4DR3K 4WQ4A 2DY4A 3RR7A 4CHZA 1VQ9N 3OYHA 2VGNA 3TABA 1S1VA 2E88A 3CM5A 2VG5A 4FLYA 1K6YA 4QS9A 4HVJA 2HHHK 3DLBA 3HVTA 1TK5A 1QQOA 4DSIA 2NZTA 5EY4A 4DUYK 4LFAK 3VTHA 1VQNN 4CJRA 4YOTA 5AQLA 4W5TA 1WB9A 3CJAA 3E1YA 1T3VA 5FPEA 2P9LB 5HLFA 3FZHA 3SCXA 3OS2A 4CGDA 1B9FA 1UAXA 3FR0A 4E0DA 2A3ZA 2HHQA 2E4LA 3SUNA 4M7YA 1BWFO 1NNEA 3EE8A 4PQUA 2HOEA 1TKXA 3LWLA 4KI4A 3ULEB 4FL9A 5C42A 1VQMN 2FF6A 1KLMA 4CEBA 1RT6A 3CM6A 4O8KA 2WONA 3CMAN 1I94K 4ELTA 2P9NA 2UXDK 4YOWA 4XH1A 4OPHA 4JI8K 5JS1A 2Z1GA 1U04A 3P31A 2NRHA 5C10A 3SAGA 4DLGA 5FPMA 2PAVA 3SQ0A 4KTQA 5E41A 3B8AX 3PO4A 3SJJA 2RHKA 1F21A 5EOYA 4B9SA 3OA9A 4O5FA 2VGMA 4A59A 1NGFA 4AILC 4FJJA 2YJFA 4KB1A 3OYCA 2PY5A 4FJLA 3QEWA 1JXEA 5JLHA 4BRQA 3ASMA 3BDPA 4H0YB 5AQOA 4CEOA 1KTQA 4KHYA 1NBWA 4UQGA 4GMJB 1LAWA 3RSEB 4OKKA 3HBTA 3C95A 3LDSA 3AO2A 2XO7A 1HQEA 4JK7A 4DQPA 3CCJN 3NVKA 4IG3A 4IWVA 2B4JA 4O55A 4BR4A 4H4OA 4FLVA 2WUSA 3D2EB 3C7NB 3VESA 4PWDA 1YJNN 3FLCO 3QERA 4AHSA 3NH1A 4CERA 4CJEA 4RWTA 4AQYK 2FSJA 1RGIA 4C23A 4BC3A 3WQTA 2E1ZA 1BDGA 4DG1A 1HYZA 3A2FA 3LDQA 3VEWA 3NGYA 4N76A 1Q7YO 1IBMK 5KPRA 3AAQA 3SLCA 3QNOA 1TV6A 2CGLA 1EQYA 4RTFD 5D3GA 2FXUA 1S6PA 3O08A 3OY9A 1KQSM 1VSEA 1RTHA 4H5NA 4FYDA 3OYAA 2BH1A 1TUYA 4RCHA 4J2BA 3DRSA 4JKCA 5EVZA 4BROA 4FO0A 4FK0A 1NG9A 4BE0A 4NLBA 5I9EB 4QOZB 1W9HA 4BRKA 1RBSA 3AAPA 1SKRA 1HJOA 2QM1A 1SKSA 5LY3A 1ZBUA 3EZWA 4JKFA 1Q81O 1KC8O 3CD6N 3KK1A 2Q3SA 2HNDA 3TSQA 3HVRA 3O9QA 4AH9A 3VQPA 1SAZA 1S6QA 1TL1A 4CEFA 1TK0A 4BACA 3KJVA 2AA4A 2J4RA 1HMVA 4CZFA 1NK9A 1NJYA 2QXLA 4M3WA 1VQ6N 4J2AA 4BRCA 1TK8A 2GTDA 5AQGA 4DHYA 3DRPA 3LPUA 4H0PA 3ZEUA 1E3MA 5CR4A 3TANA 2IAJA 3CC4N 4CK1A 3MX5A 1DTQA 4CEZA 3DOKA 4AHUA 1QE1A 2YKMA 4PL7A 3TAPA 4BE1A 3R9PA 2HBLA 1VSLA 4H4MA 1QQNA 4M3TA 3ZSVA 2Z1IA 2UXCK 3AARA 2Z1JA 2D0AA 1FKPA 3SUQA 1OVYA 3SQ4A 4KKOA 3PLAA 3F9MA 4GNIA 2GV9A 3ZSWA 3IS9A 4CIEA 3I55N 3CCLN 4ID5A 5J1EA 3J7AP 3ZETB 3SNNA 4CFBA 4KHPK 1TYQB 3KLFA 3LPTA 4KH6A 2PBDA 1BQMA 2W42A 3ZT0A 1E4FT 1RFQA 1L5UA 1ZC6A 4MO5A 1VRTA 3L3UA 4FK4A 1ZBFA 1VSKA 3EY1A 4OLAA 1IBKK 2O8BA 1NGAA 3PV8A 5IT9O 4TSXA 4FLZA 1Q82O 2XY5A 3CPWM 4L3QA 1WSGA 3CJ9A 5H1SQ 2P51A 3EE9A 4H5VA 4FK2A 2YHXA 4I2PA 3EZ5A 2A5XA 4JKGA 3H1VX 4LF7K 5HBMA 3VF4A 3AVJA 4KO0A 1ZBSA 2Q2RA 4IDHA 4CHYA 4M3XA 1TGOA 1NM1A 4DFJA 4BGBA 4K43A 1C0UA 5M1FA 2HHVA 2W41A 4FOEA 1S1TA 2O8CB 3TTCA 5GAHP 2FSKA 3SYZA 2P9KB 3I0RA 3D2FB 3F2KA 3QEIA 4XIUA 1U47A 3QBWA 1CZ9A 5M1OA 4F3OA 3R8EA 3LP1A 3QEPA 1RDAA 1YT3A 5AQYA 2PYLA 3MX2A 3CCMN 1HYVA 2PYJA 4DSKA 3MMVA 3NCIA 3CHWA 4OO1J 3FZFA 5DM7L 2QKBA 5AFUA 4DUZK 3ATUA 5HRNA 1RNHA 3K0SA 3VQAA 4AM7A 1LW2A 3ID6A 3CFOA 4BR0A 1IV0A 1XQSC 4ZHRA 3AVHA 1HKGA 3AVCA 1Q86O 4JNEA 1X9JA 1S3XA 1J53A 3V4IA 2CGKA 1YHQN 1SL0A 3ITHA 2DFHA 1NOZA 5CY4A 1K9MO 3MXMA 3AVIA 4I2QA 3NDKA 3K57A 2GELA 3M6GA 1BGXT 1NMDA 3VN5A 2P9UA 5FRNA 1S1WA 1Z25A 3KZBA 3JAMO 5DK5A 4CECA 4CJLA 1WNSA 3E66A 1JCGA 1NGIA 4CZHA 2VCPA 4CF2A 3TAMA 3NF8A 4DV1K 1RDDA 4JKHA 2F8SA 4E7HA 3IMXA 3O3HA 2ZE2A 3WNHA 2JGUA 2VG6A 3ZT4A 3NMUA 4C8MA 3VA0A 3C6AA 5ELZA 4E89A 3TARA 3MXJA 3V1OA 1J54A 4JRPA 4WQ5A 3VEYA 4CZGA 4CBUA 4B9TA 4ISEA 1Z05A 4DTRA 4FCYA 3EYZA 4DSJA 2NRZA 1EETA 1KAZA 4RW8A 1S5JA 3O6WA 3VGKA 2XY7A 5AQFA 1ATSA 5BPMA 3D7EO 3HRGA 4FWRA 3NVMA 4M7XA 3MN5A 5BRDA 1D8YA 2QWLA 2Q1NA 4Z4IA 1VK0A 1X9WA 3HO1A 4UY8O 4FPBA 3IKMA 5IWAK 4E1NA 4FJXA 2NUBA 4B08A 4HUEA 1TAQA 3MN6A 5KRTA 4LF4K 3WEEB 3AY9A 1C6VA 2YHAA 3DI6A 1U4BA 3DXMA 4IFEA 5FPNA 1CXQA 5M1QA 1D9DA 3C65A 3R1XA 2Y1IA 1GLCG 3AGKA 5EX5A 1BHLA 5KPTA 3CMEN 2E2QA 5GAGP 2QWQA 3EKUA 1RCHA 4XH5A 2JWLA 4PHTX 3AGRA 3WXLA 1NK5A 4DR6K 4BR2A 4DTOA 3VEVA 2KZZA 3LM2A 1MDUB 4CBXA 4CJFA 4BC4A 3HZ6A 4DU4A 1X1PA 1KAXA 3KHYA 4FLTA 1RDUA 3THYA 4IO8A 3ZLJA 1MWKA 3L2QA 1R0AA 1FXXA 2P1JA 1Q9YA 3VOVA 1MU2A 5GADP 3HK2A 2UUAK 3T3FA 1BI4A 1C0GA 3VGLA 3DXKB 3QFUA 3OYLA 2HBMA 4BRHA 2F8TA 3C6UA 4LH5A 2I7PA 1SL2A 1LAVA 4I6MB 3K58A 4YHHK 1VQON 1WUAA 4BWJA 3M8RA 2ZJRL 3GOIA 2P9IA 4FWMA 4E1MA 4BG8A 2O8EA 4FJMA 3S41A 4A61A 3MCPA 1OH8A 1ESVA 2A6AA 2KKZA 3V1RA 4W5OA 3LP3A 3FZKA 1SV5A 3TPQA 4FJIA 4A2BA 5J2NA 4B1UB 2G8VA 3L0QA 1GLFO 4MQ3A 4DTXA 4C8LA 4AHCA 4E7KA 3A5OC 1HLUA 4KHUA 4DF8A 2OYQA 4ILJA 4K41A 3U8XA 4KRFA 3OYMA 1QSYA 3PX4A 1SQKA 2YHBA 1Q9XA 1WAJA 5AQMA 2RKIA 4Y0WA 4BRPA 4HCCA 2LSNA 2IIRA 4M45A 5FRMA 4BG9A 1A5VA 5AZJA 3UKUB 3MEGA 3P4IA 3CCVN 5J2PA 4FZZA 4FWLA 2YNGA 5J2MA 4KHNA 4Z0UA 4C1NK 3LP2A 3THXA 3KVGA 2PFUA 5DM6L 4BRLA 2X78A 5F0XA 3PUFA 3DJCA 1BOTO 3EL2A 4JD2A 1XHXA 3ALYA 4JEPA 1P8ZA 1OKJA 4JI1K 2YHWA 5TKYA 1ATRA 4Z4HA 4OX9K 4JI5K 4ID1A 1JL1A 1X9SA 4CZMA 4JAXA 2FLOA 4HTUA 3PY8A 4B9LA 2NRTA 3M8PA 4K42A 2VQFK 4BC5A 3MAQA 3M3ZA 3QICA 4OKJA 3ZT3A 1L3TA 3RR8A 3AVGA 4FWKA 3LL3A 3OYEA 1R59O 1EXQA 4JS4A 5E26A 5BPLA 1KLNA 3MWTA 4B3SK 4MLEA 3HXMA 4LSLA 1S1XA 1ASUA 1UA0A 4IBNA 4CGHA 4WE1A 1V4TA 2FBVA 3SZ2A 3T1AA 3TAQA 1TL3A 1OH5A 2KFNA 4WFNL 3IRXA 3NF6A 3QIOA 4JI7K 3AVBA 1X9MA 4MDAA 1O13A 3CC2N 1GLEG 3O5BA 1XMOK 1T6CA 2CH5A 1JLCA 4DFPA 3TSPA 4FWOA 2HHSA 2HB5A 4QS8A 4I9QA 2P9SB 3LDNA 2GWKA 5AQXA 1KD1O 5FDLA 2FSNA 4OGEA 3V9SA 5AQZA 3BY5A 3THWB 3O4QA 4CVNE 4DCHA 3RRHA 4CJTA 2ASOA 3L4IA 1IBLK 4CZIA 1VSHA 2QW9A 3N4QA 3EO3A 4XEIA 4CJUA 4FSVA 3QMLA 1SS6A 3OBWA 3HTVA 4O5BA 1Y97A 3I8DA 1NGEA 1N6QA 4KBOA 1C1AA 3LDOA 4BGAA 3LZIA 3GDQA 4KB0A 3KK7A 3QINA 3KD1E 1ASVA 4M3UA 3VETA 2H3GX 2EHGA 3DLKA 3ENHA 4DV5K 4FJ9A 2YNIA 5KPZA 5FLXO 4HCBA 3K5MA 5BRHA 3VQ4A 2NLXA 3UIQA 1YF5L 4AHVA 5AQVA 1JLAA 4BRIA 4CZJA 1YJWN 3M1FA 4CGFA 4MFBA 3MEEA 3IFRA 4EIAA 1RBUA 2HHUA 1C0MA 3J81O 3AVAA 3NE6A 3L8BA 3LM9A 4HHTA 3SV3A 5AQRA 1ZXOA 3F5TA 2G8IA 4CBWA 1NJXA 4GV9A 2CH6A 4JK8A 1XC9A 3VTIA 4BVPA 3OYKA 5E84A 4JI6K 5FROA 4KHSA 5LL6Z 1JL2A 3BF3A 3NAEA 1XUPO 2HBJA 3I8BA 1FKOA 1MA9B 2HNZA 2NRRA 1C1BA 3O3FA 4FWSA 2DFEA 4FM1A 2OPQA 2P9LA 5LJWA 3DOLA 2HMIA 3QO9A 1WSEA 1VSDA 3PIOL 2Q0RA 4I9LA 1DGKN 4NYNA 4FVUA 5K14A 1MWMA 1RT5A 4OKEA 2E2PA 1T03A 2IGIA 3HPGA 5BN8A 5SZTA 3F9KA 3FGUA 4QAGA 3VMFB 2GEMA 1ZYQA 1D4XA
chains in the Genus database with same CATH topology
2V7ZA 4K25A 2P9KB 4WQ4C 1Q18A 3D2FB 3F2KA 2IVOA 3QBWA 3ULEA 5M1OA 1HKBA 3R8EA 3WXMB 3GL1A 3QDKA 3VEOA 3SK3A 1NGDA 3FZMA 4EHUA 5AQYA 1KAYA 2W40A 3VENA 4BRDA 3MX2A 4YOXA 3CCMN 3CCUN 2V52B 2YHYA 3MMVA 4R79A 3C0BA 3CHWA 3H1QA 4OO1J 3FZFA 5DM7L 5AFUA 4PKIA 5AQWA 3ATUA 4JN4A 2YX6A 4AM7A 4YOVA 3ID6A 1ATNA 4B1VA 4BR0A 3OW2M 1XQSC 4GV6A 3TTDA 1HKGA 3E9OA 1VQKN 3SBTA 3VERA 1Q86O 4H03B 1HUXA 4JNEA 1X9JA 1S3XA 1G99A 2QWNA 5AQPA 2CGKA 5JICA 1YHQN 1JCFA 2QWPA 3TSUA 1ILYA 1K9MO 1VQLN 4NO7A 5AQQA 3CXCM 3UKUA 1IJJA 3R3LA 4CJ7A 1XC3A 4PKHA 1BG3A 4JHDA 1K8KB 1V4SA 2GELA 3M6GA 1NMDA 4M63C 5GIOA 4BRNA 1D4XA 2P9UA 4IO9L 3KZBA 1T6DA 1U2VB 3RVCA 1VQPN 3L6QA 2E8AA 2GWJA 3RSEA 4GV3A 3E66A 1JCGA 1NGIA 4CZHA 3CCEN 2VCPA 2AP1A 4FOIA 2QI2A 4ILHA 2HF3A 3VGMA 2D1KA 4HTLA 3WUHA 3U4LA 4IEIA 4JKHA 3IMXA 4BVOA 5AQKA 5C15A 3NMUA 2WFBA 3SMSA 5KQDA 3C6AA 5C2FA 5ELZA 3E9PA 1RDWX 4H0OA 5BR9A 3CQXA 5C2DA 3D2EA 1NGHA 2QWRA 4WQ5A 3VEYA 4CZGA 4CBUA 3WXJA 4ISEA 3ENOA 4U67L 1Z05A 2Q97A 3H3NO 3Q7CA 5AZIB 4CZEA 4YOUA 3GBTA 4BY9C 1VAZA 4O8UA 2RE2A 2HSTA 2NRZA 4A5BA 3HSCA 1BU6O 4JK9A 4JKBA 4JHDB 5AQJA 1KAZA 1J6ZA 3ZEUB 3O6WA 3VGKA 3O80A 4H0XB 3WXIA 5AQFA 2P9UB 1ATSA 3CERA 4BREA 1YJ9N 4A57A 3WXKA 5BPMA 3R6MA 3D7EO 3HRGA 4FWRA 3NVMA 3FE1A 3MN5A 4KH4A 4M7XA 5BRDA 5CE3A 5HOOA 3U9ZA 1S72N 2QWLA 2Q1NA 2ASPA 3UB5A 5AQSA 1KXPA 4MDBA 4UY8O 4FPBA 2A41A 3IKMA 1VQ4N 3A5NC 5ADXH 2D4WA 2I7NA 3EKSA 3O9RA 3O4WA 3CC7N 4KH5A 4BR7A 3MN6A 3WEEB 3AY9A 4DKWA 2ZJQL 3A0IX 1Z6RA 3DXMA 4IFEA 5FPNA 3W3DA 5BRFA 3DLLL 3HM8A 5M1QA 3C65A 4ISFA 3R1XA 4DQ8A 4GVEA 4IZ9A 1GLCG 3AGKA 5EX5A 5C12A 5KPTA 1QVFM 3VEZA 3CMEN 2E2QA 1VQ5N 4JKEA 5GAGP 4AM6A 3A8YA 3DAWA 2Q0UA 1GLLO 3CJ7A 2QWQA 4PKGA 3CETA 4CZLA 1YI2N 3EKUA 4QS7A 4XH5A 2JWLA 4WQ4A 3U9DA 4PHTX 3AGRA 3C6HA 3BF1A 3WXLA 3UKRB 4BR2A 1VQ9N 3VEVA 3LM2A 1MDUB 3MCAB 4CBXA 2VGNA 1QQMA 4BC4A 3HZ6A 1KAXA 2V51B 5BN9A 2P9SA 3WT0A 2E88A 3OBYA 3KHYA 2ZGZA 4IOXA 3P39A 4QS9A 3O9SA 1RDUA 4IO8A 1QQOA 1MWKA 4IJNA 2NZTA 5EY4A 3VOVA 5GADP 4WCEL 4DB3A 2QTDA 3VTHA 1VQNN 3ZYYX 2CGJA 4YOTA 3DXMB 1CZAN 4JKGB 1C0GA 5AQLA 3DXKB 3CJAA 3E1YA 1T3VA 3VGLA 3QFUA 5FPEA 3G4SN 2HBMA 2P9LB 3FZHA 4BRHA 3M5RA 5JMVA 4FWQA 3ID8A 5GAEP 1Y64A 4U7BA 3P38A 2P9PB 2I7PA 1NGGA 3FR0A 3SAHA 4I6MB 2A3ZA 3CCSN 5FPDA 1VQON 1WUAA 1DT9A 5EXWA 2EWSA 4BC2A 1S22A 4WYBA 5JVHL 2ZJRL 3GOIA 3VF6A 2P9IA 4FWMA 3K9KA 3VF2A 4BG8A 4M7YA 1BWFO 2OTLN 3S41A 4F9OA 4H5TA 4A61A 3EE8A 2Q36A 3VPZA 5B8HA 5HL7L 3MCPA 2HOEA 2ZWHA 3W0LA 1ESVA 2A6AA 2KKZA 3ULEB 5ADXA 4FL9A 3FZKA 4FWNA 3TU5A 2FF6A 3TPQA 1YAGA 1VQMN 4A2BA 4IOCL 1JJ2M 4H5RA 3L4QA 3HOSA 4B1UB 4O8KA 3L0QA 4H0VB 1GLFO 2F7TA 4MLHA 3CMAN 4IOAL 3CJCA 1BO5O 1DEJA 3A5OC 2P9NA 1HLUA 2ZGYA 4YOWA 4XH1A 4ILJA 4OPHA 1BUPA 3ZETA 3ZX3A 2VWBA 3H6EA 1QHAA 3P31A 2QEXN 4K41A 3U8XA 2NRHA 5C10A 3SAGA 1VQ7N 3ENBA 1H1VA 3O1BA 5FPMA 5KQ8A 2PAVA 3E9LA 1SQKA 2E20A 3BP8A 3WQUA 3C7NA 3B8AX 3K9JA 5AQMA 2RHKA 4MO4A 4Y0WA 5EOYA 4BRPA 1GLAG 1QVGM 3OA9A 4O5FA 2IIRA 2VGMA 4A59A 1NGFA 4A5AA 2YJFA 2WC9A 4BG9A 3MWPA 4CI6A 3UKUB 5AZJA 2BUPA 5JLHA 4BRQA 1NJIO 3P4IA 4OPAA 3SAFA 3CCVN 4H0YB 5AQOA 3SJHA 4FWLA 4NB4A 2A40A 2NRWA 3A5MC 2OTJN 4C1NK 2F9WA 1NBWA 1K73O 3KVGA 5AQTA 5F2RA 3CCRN 5BPNA 3RSEB 2PFUA 3HBTA 3O8MA 5DM6L 4BRLA 5F0XA 4YDUC 3DJCA 1BOTO 1DKGD 3EL2A 4JD2A 4JEPA 4HWIA 1P8ZA 1OKJA 4JK7A 4GY2B 3CCJN 2YHWA 5TKYA 3NVKA 1ATRA 4CD1A 4IWVA 4BR4A 1QZ6A 2WUSA 5F1XA 3D2EB 2HF4A 3C7NB 3CPEA 3VESA 5TKWA 1YJNN 2IVNA 3FLCO 5AQUA 3H45C 4CZMA 2P9KA 4JAXA 3LDLA 3D2FA 2VYPA 4IEEA 1YUWA 2FLOA 5AZJB 3MN7A 3BEXA 2KLAA 2NRTA 4RWTA 5JVGL 4NLCA 2FSJA 4K42A 4BRAA 1RGIA 2ZF5O 2BTFA 4ILGB 4BC5A 3WQTA 2E1ZA 1BDGA 4BC3A 1P90A 2QWOA 3M3ZA 3QICA 4XH4A 3IDHA 3O1WA 4Z94A 3LDQA 3VEWA 3A5LC 1Q7YO 5AR0A 4FWKA 3TTFA 5KPRA 3AAQA 3ZX0A 3LL3A 3SLCA 1R59O 5LJVA 2JWKA 2CGLA 1EQYA 4RTFD 5E26A 5BPLA 2FXUA 1QZ5A 3MWTA 3O9TA 3O08A 4MLEA 1KQSM 2YJEA 1LCUA 4BR9A 4H5NA 3CCQN 2BH1A 1TUYA 3O9UA 4RCHA 4JKCA 5EVZA 2KHOA 4BROA 4FO0A 1LOTB 2ZJPL 4NLBA 1V4TA 3FFKB 2YCHA 2E2OA 5I9EB 3PIPL 4WFNL 3EN9A 1T44A 3MN9A 1K8KA 3N4PA 4J8FA 4BRKA 3QFPA 3AAPA 4MDAA 1YXQA 1O13A 4BRGA 1K8AO 3CC2N 1GLEG 1HJOA 2QM1A 1BA0A 3CQYA 3O5BA 4BRMA 1U2VA 1T6CA 2CH5A 5CHIA 3JS6A 5LY3A 3CD6N 3EZWA 4JKFA 1Q81O 1KC8O 1M90O 2A42A 1EO1A 3HI0A 2GUPA 3TSPA 4FWOA 4JKAA 2QA4N 2D0PA 3T7ZA 2V7YA 4QS8A 5M1KA 1WOQA 5MLCQ 4A62A 3TSQA 2P9SB 3LDNA 3O9QA 2GWKA 2E2NA 1SAZA 2QWMA 5AQXA 1KD1O 3J8AA 2FSNA 3D6RA 5C0YA 3I33A 5AQZA 2AA4A 3OHRA 5M1NA 3H3OB 4DCHA 2J4RA 4CZFA 4CD3A 1TUUA 1YITN 2QXLA 2WBNA 2ASOA 3T69A 2GX9A 2D0OA 3L4IA 1VQ6N 3KWGA 4CZIA 2QW9A 5AQNA 4H0TB 2IVPA 5AZIA 1W2BM 3N4QA 4BRCA 3EO3A 2GTDA 5AQGA 4DHYA 4XEIA 1TYQA 4BRFA 4EFHA 1N8RO 4H0PA 4FSVA 1NGJA 4B1XB 3QMLA 1SS6A 3ZEUA 2ITMA 3OBWA 4IXCA 5CR4A 4WF9L 3IUCA 4BQZA 3Q7BA 4YORA 2NRXA 3MK6A 3HOTA 3HTVA 3CC4N 3G71N 1NGEA 2P9IB 3MX5A 3QBXA 5GIPA 2HMPA 4KBOA 4H5WA 3LDOA 4BGAA 3G25A 3SBGA 2NRVA 3GDQA 3KK7A 2Q31A 4PL7A 5GINA 1YVNA 1YIJN 3R9PA 1HPMA 2HBLA 1QQNA 3VEXA 4FWPA 3VETA 2H3GX 3AARA 1VQ8N 1GLBG 3H46O 3LDPA 4WFAL 4YDUA 4B9QA 1OVYA 3ENHA 3CI5A 4G9ZA 3PLAA 3QB0A 4ISGA 3WEEA 1SZ2A 3F9MA 4GNIA 2DPNA 3I56N 5KPZA 2P9NB 4A2AA 3I55N 3CCLN 1NGBA 5BRHA 5AFUH 2NLXA 1YF5L 5BREA 4LC9B 3ZETB 4EHTA 1M1KO 1IG8A 2UYTA 5AQVA 1BA1A 1TYQB 4BRIA 4C1NI 1HKCA 3BUZB 3ZX2A 4CZJA 1YJWN 1W97L 4KH6A 3M1FA 4WQ5C 2PBDA 1U6ZA 4B1YB 2HBKA 1E4FT 4FPAA 3UKRA 1RFQA 4B1ZA 1ZC6A 3IFRA 4MO5A 4EIAA 3KWIA 2F9TA 4C23A 3LM9A 3J7ZO 4WFBL 1NGAA 1NWKA 3ATVA 4AF1A 5AQRA 1ZXOA 1GLJO 3F5TA 1Q82O 4CBWA 3CIPA 4BR5A 3CPWM 1E4GT 3G6EN 4GV9A 2CH6A 4JK8A 4L3QA 3CF5L 3VTIA 4BVPA 3CJ9A 2NNWA 2FF3B 3GG4A 5E84A 5H1SQ 1GLDG 3EE9A 4H5VA 1X3NA 3BF3A 1XUPO 3DWLA 1C0FA 2HBJA 2YHXA 3I8BA 1MA9B 2NRRA 3FZLA 2A5XA 1NGCA 1HX1A 4FWSA 4JKGA 3H1VX 3CJ1A 3DXKA 4B1WB 3SMPA 3VF4A 4CZKA 3GE1A 2P9LA 1ZBSA 2Q2RA 4IDHA 4PL8A 4E1JA 5LJWA 1NM1A 4YOYA 4JD2B 4K43A 4BGBA 3JXUA 2P9PA 4BQLA 3UE5A 5M1FA 3PIOL 2W41A 2YI1A 5AQHA 2ASMA 3MDQA 4FOEA 4I6MA 5AQIA 2Q0RA 4IJAA 5M1PA 1DGKN 4EAHD 2E1YA 1JCEA 4FVUA 1X3MA 3TTCA 1MWMA 1NLVA 4JKDA 2E2PA 5GAHP 5BN8A 3CJBA 3FGUA 5JLFA 3VMFB 2GEMA 2FSKA 2OANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT N;  2ZJQ L;  1NJI O;  3CCV N;  3DLL L;  1VQ6 N;  1W2B M;  1QVF M;  2OTJ N;  3CME N;  1K73 O;  1VQ5 N;  3CCM N;  5GAG P;  3CCR N;  3CCU N;  1N8R O;  1YI2 N;  5DM6 L;  5DM7 L;  4WF9 L;  1VQ9 N;  3CC4 N;  3G71 N;  3CCJ N;  3OW2 M;  1YIJ N;  1VQK N;  1Q86 O;  1YJN N;  1VQ8 N;  1YHQ N;  4WFA L;  1ILY A;  1OVY A;  1K9M O;  1VQL N;  3CXC M;  5GAD P;  4WCE L;  3I56 N;  1VQN N;  3I55 N;  3CCL N;  5JVG L;  3G4S N;  4IO9 L;  1VQP N;  1M1K O;  5GAE P;  1YJW N;  1Q7Y O;  3CCE N;  3CCS N;  1VQO N;  5JVH L;  2ZJR L;  2OTL N;  3J7Z O;  4WFB L;  5HL7 L;  1KQS M;  1Q82 O;  3CPW M;  3G6E N;  3CF5 L;  3CCQ N;  5H1S Q;  1VQM N;  4U67 L;  4IOC L;  1JJ2 M;  2ZJP L;  3PIP L;  4WFN L;  3CMA N;  4IOA L;  1K8A O;  3CC2 N;  1YJ9 N;  3CD6 N;  1KC8 O;  1Q81 O;  1M90 O;  2QEX N;  3PIO L;  2QA4 N;  1VQ7 N;  5MLC Q;  1S72 N;  4UY8 O;  5GAH P;  1VQ4 N;  1KD1 O;  1QVG M;  3CC7 N; 
#chains in the Genus database with same CATH topology
 1XWL A;  2V7Z A;  4LH4 A;  3ULE A;  3WXM B;  1IKY A;  3VEO A;  3O4N A;  3S9H A;  3FZM A;  4EHU A;  1KAY A;  1OH7 A;  2O8D B;  3VEN A;  4BRD A;  1HR0 K;  3DM2 A;  4R79 A;  3C0B A;  2OCE A;  3RMA A;  3OJU A;  5J2Q A;  2X74 A;  3HJF A;  4JN4 A;  4CF0 A;  3CFP A;  3ZSO A;  1YTU A;  1RIL A;  4LF8 K;  3AA4 A;  3TTD A;  1KSP A;  3DRR A;  3SBT A;  3VER A;  4H03 B;  4E7L A;  2E6L A;  2QWN A;  1RT7 A;  1U49 A;  1LWC A;  1JCF A;  2QWP A;  3TSU A;  4CHO A;  5AQQ A;  4PKH A;  3J80 O;  4JHD A;  1K8K B;  1N33 K;  5GIO A;  1J5E K;  4BRN A;  3SI6 A;  1T6D A;  1U2V B;  2X6N A;  1VQP N;  5KRS A;  4M3R A;  4FW2 A;  2GWJ A;  3RSE A;  4CES A;  5CYM A;  3IG1 A;  3L2W A;  3CCE N;  2AP1 A;  2QI2 A;  4ILH A;  3VGM A;  3KLI A;  4IEI A;  3CQ8 A;  4EP5 A;  3NGZ A;  2WFB A;  5KQD A;  4Z4C A;  4K0K K;  4M3Y A;  3E9P A;  3SUO A;  5BR9 A;  3CQX A;  3L3V A;  3D2E A;  3WXJ A;  4FJG A;  4FZX C;  5AZI B;  5JS2 A;  4O8U A;  3MXI A;  4FJN A;  3HSC A;  1BU6 O;  5AQJ A;  1J6Z A;  3QIP A;  1WSI A;  2P9U B;  4JLH A;  1JLB A;  3DLG A;  3WXK A;  1GOC A;  3FE1 A;  5HOO A;  3AA3 A;  1UOC A;  5HP1 A;  1NK0 A;  3OJS A;  4DSL A;  3UB5 A;  1KXP A;  4PA1 A;  4M42 A;  2A41 A;  1QSL A;  1VQ4 N;  3A5N C;  4B8C A;  4W5R A;  2D4W A;  2I7N A;  3EKS A;  3L2V A;  3CC7 N;  1HPZ A;  3ZCM A;  4FVM A;  1WLJ A;  1J5O A;  5AJ3 K;  1KFD A;  3HM8 A;  2YNH A;  4GVE A;  3V9Z A;  3VEZ A;  2G8U A;  3DAW A;  2Q0U A;  3CJ7 A;  2VWK A;  1TVR A;  3CET A;  3ZSX A;  4DFM A;  1VSI A;  1IKV A;  4QS7 A;  1YI2 N;  3U9D A;  1TKZ A;  4O4G A;  4EP4 A;  1RTD A;  3BF1 A;  2YV0 X;  2XY6 A;  2HVI A;  1BIS A;  3UKR B;  3VQE A;  3MCA B;  1GOA A;  4F2R A;  1QQM A;  3KIO A;  3HM9 A;  3WT0 A;  4RW9 A;  2ZGZ A;  3P39 A;  3O9S A;  4W5N A;  4IJN A;  4CF1 A;  3DLH A;  3AO3 A;  4CIG A;  2ZQB A;  2ETJ A;  4ZTF A;  3ZYY X;  2CGJ A;  3DXM B;  1CZA N;  3PO5 A;  4FXD A;  4BDZ A;  1QTM A;  3S3N A;  3M5R A;  4DR2 K;  4M3Z A;  1TKD A;  3ZSR A;  2HHT A;  4IG0 A;  5GAE P;  4DTM A;  1Y64 A;  3P38 A;  2P9P B;  3P5J A;  1NGG A;  1RDC A;  2BGG A;  3CCS N;  2OPS A;  1DT9 A;  1ASW A;  3K9K A;  2OTL N;  2QKK A;  4H5T A;  2EX3 A;  5HL7 L;  3NF9 A;  2ZWH A;  3W0L A;  3E01 A;  3TAG A;  4LF5 K;  4AHR A;  1BIZ A;  2F4V K;  4B3R K;  4GKK K;  5ADX A;  3THY B;  3TU5 A;  1JJ2 M;  3L4Q A;  4B9M A;  3HOS A;  4H0V B;  1RT3 A;  2F7T A;  1WSH A;  4IOA L;  3CJC A;  2R7Y A;  4DS4 A;  1BO5 O;  3OTO K;  4HUG A;  5T7B A;  2HHW A;  2ZGY A;  1BUP A;  3ZET A;  1T8E A;  3RMC A;  1REV A;  1HNX K;  3I0S A;  3NF7 A;  4DF4 A;  1NJZ A;  1QHA A;  2G8F A;  1VQ7 N;  1EP4 A;  5KQ8 A;  4IKF A;  1B9D A;  4JI4 K;  3PSI A;  3WQU A;  4DTP A;  3AA5 X;  4E19 A;  1GLA G;  4O0J A;  1RBT A;  2O8F B;  3BGR A;  4I7F A;  3VQ5 A;  1NK7 A;  1NJI O;  4OPA A;  1UWB A;  4IDK A;  3SJH A;  4NB4 A;  1RBR A;  2A40 A;  2KQ2 A;  3A5M C;  2OTJ N;  4RW4 A;  4DR5 K;  3TAF A;  4CF9 A;  5F2R A;  3CCR N;  5BPN A;  3DMJ A;  1XMQ K;  4CJK A;  4DU3 A;  1VSF A;  4B3M K;  4YDU C;  4CEA A;  1DKG D;  2IOC A;  4DTN A;  4HWI A;  4KTZ A;  1XNQ K;  2O8C A;  4CD1 A;  1QZ6 A;  5F1X A;  4JI0 K;  2W6K A;  5TKW A;  5C25 A;  4W5Q A;  3RMB A;  2P9K A;  4Z4E A;  3LDL A;  3D2F A;  4O44 A;  4FM0 A;  3KLE A;  1RTI A;  5AZJ B;  4CGG A;  3MN7 A;  2A1S A;  2KLA A;  5JVG L;  1NKC A;  2ZF5 O;  2BTF A;  4ILG B;  1G15 A;  4XH4 A;  1CLQ A;  1QQC A;  3O1W A;  4Z94 A;  3G0Z A;  2IC3 A;  3A5L C;  3OYF A;  3TTF A;  5KTQ A;  4OPK A;  3ZX0 A;  4DQI A;  1I39 A;  3L2U A;  1RT2 A;  5I42 A;  4JS5 A;  1YTA A;  4CCH A;  2JWK A;  3SQ1 A;  1HNW K;  1VHX A;  4JI2 K;  3VQ7 A;  1LCU A;  4BR9 A;  4H8K A;  1LW0 A;  3O9U A;  2Z1H A;  2KHO A;  4F2S A;  4YNQ A;  2ZJP L;  1QHT A;  3FFK B;  2YCH A;  1OVQ A;  3PIP L;  3EN9 A;  1T44 A;  4KHW A;  3QFP A;  4BRM A;  1BA0 A;  3CQY A;  4JI3 K;  2ATQ A;  3JS6 A;  1EO1 A;  1M90 O;  3DLE A;  3HI0 A;  2GUP A;  5A2Q O;  4JKA A;  2QA4 N;  2D0P A;  3T7Z A;  1WOQ A;  5MLC Q;  4A62 A;  4E3S A;  2QWM A;  1Q8I A;  3WNF A;  3J8A A;  4OPJ A;  3I33 A;  3OHR A;  2A1R A;  3AVN A;  3T69 A;  3AVM A;  5AQN A;  4H0T B;  2IVP A;  3FFI A;  1C1C A;  1N8R O;  2ITM A;  2YNF A;  4WF9 L;  4DSE A;  3Q7B A;  4YOR A;  4CFA A;  3MK6 A;  3HOT A;  3QBX A;  5GIP A;  2HMP A;  3D0P A;  2OZS A;  3CFR A;  2NRV A;  3JSM A;  3J7Y P;  1YIJ N;  4LFB K;  4KAZ A;  4FWP A;  4CW7 B;  1VQ8 N;  1SL1 A;  4WFA L;  4B9Q A;  4DFK A;  4O0I A;  4ISG A;  3WEE A;  3CYM A;  2DPN A;  5LMN K;  3I56 N;  4KTW A;  2P9N B;  5AFU H;  3S3O A;  1BCM A;  4LC9 B;  1M1K O;  1J9A A;  2UYT A;  3QEX A;  1BA1 A;  3QES A;  4C1N I;  1HKC A;  3BUZ B;  4CJS A;  4YY3 K;  4B1Y B;  3T1H K;  2HBK A;  4OGC A;  2UXB K;  4B1Z A;  1W7A A;  2P5G A;  2F9T A;  1S1U A;  4DR4 K;  5HRO A;  4BDP A;  3J7Z O;  4WFB L;  1NWK A;  4V19 S;  1WN7 A;  4AF1 A;  1GLJ O;  4LSN A;  4FLU A;  2PZS A;  1IKW A;  3NGI A;  3KD5 E;  3KKR A;  1IO2 A;  2FF3 B;  3GG4 A;  1O1W A;  1KVB A;  3MED A;  1X3N A;  4DQQ A;  3DWL A;  3KLG A;  4NXN K;  5SWM A;  2E5L K;  1FK9 A;  1HX1 A;  4F4K A;  3DXK A;  3ZSZ A;  4CZK A;  3HPH A;  2BAN A;  4YOY A;  4BQL A;  3UE5 A;  5AQH A;  2ASM A;  3MDQ A;  4I6M A;  5AQI A;  4KRE A;  4IJA A;  4DWI A;  3OS0 A;  4EAH D;  4BDY A;  4JKD A;  2VG7 A;  3L2R A;  3SV4 A;  5JLF A;  3AO5 A;  3QLH A;  3KWG A;  4K25 A;  4PY5 A;  4WQ4 C;  1Q18 A;  2I5J A;  1KRP A;  2IVO A;  3ISN C;  1CZB A;  3KKS A;  4CJ4 A;  2P5O A;  4B9N A;  4CE9 A;  4DSF A;  3GL1 A;  3QDK A;  3SK3 A;  1N36 K;  1NGD A;  4IFV A;  4FJ5 A;  3QET A;  2XY8 A;  1VRU A;  4CFC A;  4YOX A;  3CCU N;  4FJK A;  2YHY A;  2HNY A;  4ELU A;  1DTT A;  4YOV A;  1ATN A;  3HP9 A;  3EEQ A;  4GV6 A;  2D5R A;  4KHQ A;  3E9O A;  1B92 A;  2G8W A;  3VQ6 A;  2W6L A;  3HP6 A;  1ILY A;  1BCO A;  3CXC M;  1JLG A;  3UKU A;  2OZM A;  4CJ7 A;  4M41 A;  1KVA A;  1XC3 A;  1NMN A;  1D9F A;  2DTU A;  4DV0 K;  3RVC A;  3ZSY A;  2ZM6 K;  4NCA A;  3L6Q A;  3SPZ A;  4CJV A;  1IG9 A;  1C0T A;  4GV3 A;  2G8H A;  3IAY A;  3WNG A;  2D1K A;  4HTL A;  2O4G A;  4FLX A;  1KCF A;  5C15 A;  4CHP A;  4E7I A;  1RDW X;  2QWR A;  3RRG A;  3KK2 A;  3H3N O;  3OYI A;  4CZE A;  4YOU A;  2G8K A;  3RTV A;  4BY9 C;  1VAZ A;  4C8K A;  2RE2 A;  3BZC A;  4R5P A;  4A5B A;  4JK9 A;  4JKB A;  4JHD B;  3ZEU B;  4BRE A;  4CK3 A;  4A57 A;  5CZ1 A;  1T7P A;  3R6M A;  4KH4 A;  1KFS A;  4LFC K;  3LZJ A;  1S72 N;  4ZTJ A;  5AQS A;  3BZK A;  4MDB A;  1OH6 A;  4KI6 A;  3O4W A;  4BR7 A;  4OVL A;  3PSF A;  4FLW A;  1NK4 A;  3HST B;  4DKW A;  2ZJQ L;  3NH2 A;  4LF9 K;  1Z6R A;  3W3D A;  4K8X A;  1JLQ A;  1FJG K;  4CK2 A;  3V81 A;  5C12 A;  2O4I A;  2QK9 A;  4JKE A;  2B5J A;  4PKG A;  4CZL A;  3VQ9 A;  1GLL O;  4CGJ A;  1RT1 A;  4HUF A;  1N34 K;  3C6H A;  3V1Q A;  4B9U A;  3LAL A;  1WBB A;  1YVU A;  4YFU A;  4X62 K;  2O8B B;  2V51 B;  5BN9 A;  2P9S A;  3OBY A;  4IOX A;  1RDB A;  4DLE A;  1D5A A;  4LD0 A;  3K5N A;  4QCL A;  1WSJ A;  1HJR A;  3THW A;  3TWH A;  2OPP A;  2FBY A;  1I3A A;  1EKE A;  4WCE L;  4DB3 A;  2UUC K;  2QTD A;  1RT4 A;  4RW7 A;  4BE2 A;  1VSM A;  1QSS A;  1JLF A;  4JKG B;  1EWR A;  3G4S N;  1SKW A;  5HRS A;  5JMV A;  2VQE K;  3V9X A;  4FWQ A;  1BIU A;  2GBZ A;  3ID8 A;  4U7B A;  3D45 A;  4DV6 K;  1QS4 A;  1LWE A;  3SAH A;  5FPD A;  5EXW A;  5I3U A;  2EWS A;  4BC2 A;  4FZY A;  4GKJ K;  1S22 A;  4WYB A;  5JVH L;  1JLE A;  3VF6 A;  3M8Q A;  3VF2 A;  1DLO A;  3B6O A;  4F9O A;  3OYB A;  1Z26 A;  2Q36 A;  3VPZ A;  5B8H A;  3H08 A;  2WTU A;  2FBX A;  3SQ2 A;  1RTJ A;  4FWN A;  2OA8 A;  1YAG A;  4IOC L;  4H5R A;  4L8R B;  4RW6 A;  1TKT A;  4MLH A;  3ZT1 A;  1DEJ A;  4NYF A;  3HYF A;  3JYT A;  3ZX3 A;  4LY7 A;  4DTJ A;  2VWB A;  3H6E A;  2QEX N;  3AVF A;  3ENB A;  1H1V A;  2JLE A;  3O1B A;  4K8Z A;  1XNR K;  4GVM A;  3E9L A;  1L3U A;  2Y1J A;  2E20 A;  3BP8 A;  3C7N A;  1HNI A;  3K9J A;  4MO4 A;  4CF8 A;  4Q0B A;  4DR1 K;  1QVG M;  3K5O A;  4A5A A;  3KLH A;  2WC9 A;  5LMU K;  2D0B A;  3MWP A;  4CI6 A;  1NJW A;  4Y1D A;  2BUP A;  3V9U A;  3KTQ A;  3SAF A;  3VQ8 A;  3ULD A;  4OJR A;  2NRW A;  2F9W A;  1ZBL A;  1TAU A;  1K73 O;  5AQT A;  4X65 K;  1L3V A;  3O8M A;  1WAF A;  2D0C A;  3K59 A;  4EZ9 A;  3M8S A;  4KFB A;  2F96 A;  3PX6 A;  4FW1 A;  3PX0 A;  4AHT A;  4GY2 B;  4CJQ A;  4CHN A;  3KK3 A;  4EZ6 A;  4J2D A;  4N5S A;  3OYN A;  2HF4 A;  3CPE A;  2IVN A;  5AQU A;  3AO4 A;  3H45 C;  4FJ8 A;  4IEE A;  1IKX A;  2VYP A;  1YUW A;  4DS5 A;  3BEX A;  4DTU A;  1IH7 A;  4KPY A;  4NLC A;  4BRA A;  4CGI A;  2O8D A;  1P90 A;  2QWO A;  3IDH A;  4CJW A;  4N47 A;  3U3Y A;  4Y1C A;  5AR0 A;  2HW3 A;  1BQN A;  3AVK A;  5LJV A;  1HQU A;  1QZ5 A;  3SUP A;  3O9T A;  2BE2 A;  2YJE A;  2YKN A;  3CCQ N;  2KZM A;  1EWQ A;  1ITG A;  1LOT B;  1XHZ A;  2E2O A;  3O3G A;  1XI1 A;  1GOB A;  3MN9 A;  1K8K A;  3N4P A;  4J8F A;  1YXQ A;  4BRG A;  1K8A O;  3OS1 A;  1U2V A;  5CHI A;  2A42 A;  4CJ5 A;  4B3T K;  2V7Y A;  5M1K A;  4DTS A;  3T1Y K;  3VQQ A;  2HHX A;  2RN2 A;  4CEE A;  2E2N A;  2ZD1 A;  3D6R A;  5C0Y A;  5M1N A;  3H3O B;  4J2E A;  1YIT N;  4CD3 A;  1TUU A;  4Q5V A;  2WBN A;  2GX9 A;  1BI4 B;  3LP0 A;  2D0O A;  4B3O A;  3NBP A;  1W2B M;  5AZI A;  4CJ3 A;  1HNZ K;  4F8R A;  1KVC A;  1TYQ A;  4BRF A;  4EFH A;  1NGJ A;  4B1X B;  4CIF A;  4KV8 A;  3C6T A;  4IXC A;  1HRH A;  3F73 A;  3IUC A;  4BQZ A;  2NRX A;  4JV5 K;  3LWM A;  3G71 N;  3NFA A;  1U45 A;  2P9I B;  3NH0 A;  2O8E B;  1A5W A;  4H5W A;  3T19 A;  1NOY A;  3G25 A;  3SBG A;  3VQD A;  3G10 A;  1EX4 A;  2Q31 A;  3LAN A;  2QXF A;  1YVN A;  3MEC A;  5GIN A;  4N56 A;  1HPM A;  3VEX A;  3QNN A;  3ZSQ A;  1GLB G;  3H46 O;  3HL8 A;  3LDP A;  4YDU A;  1NK8 A;  3CI5 A;  1WSF A;  3P1G A;  3QEV A;  3QB0 A;  4G9Z A;  1SZ2 A;  1HNV A;  5CZ2 A;  3OYJ A;  2KW4 A;  4A2A A;  1NGB A;  3P83 D;  5BRE A;  4EHT A;  4CHQ A;  1IG8 A;  1ZBI A;  3ZX2 A;  4X64 K;  1W97 L;  2FC0 A;  4WQ5 C;  1U6Z A;  4B8A B;  2OPR A;  4FPA A;  3UKR A;  1LV5 A;  4DMN A;  5KGX A;  1ZBH A;  3KWI A;  1UA1 A;  4Z4G A;  3ATV A;  4E7J A;  4DV2 K;  2ITG A;  3CIP A;  4BR5 A;  1E4G T;  3G6E N;  3CF5 L;  3C94 A;  3NHG A;  4NCB A;  3HPO A;  2NNW A;  5CYQ A;  1GLD G;  3VQC A;  4JYA K;  2IDO A;  1C0F A;  1JKH A;  3THX B;  3WNE A;  3FZL A;  2XRI A;  1NGC A;  4B1W B;  3CJ1 A;  3SMP A;  1U48 A;  3GE1 A;  4RG8 A;  3AO1 A;  5DMR A;  4PL8 A;  3AV9 A;  4E1J A;  4JD2 B;  3JXU A;  2P9P A;  5C24 A;  2YI1 A;  3OVN A;  4C8N A;  5M1P A;  3TAE A;  3U6F A;  5HRR A;  3ZT2 A;  2E1Y A;  1JCE A;  3K5L A;  1S9G A;  1X3M A;  3V6D A;  1NLV A;  2HVH A;  3AVL A;  2DFF A;  3CJB A;  2KFZ A;  2OAN A;  3HT3 A;  4F3T A;  1HKB A;  4BWM A;  3DYA A;  4IFY A;  4DQR A;  1T05 A;  1VSJ A;  2RF2 A;  4B9V A;  5KGW A;  2W40 A;  3LAM A;  3S3M A;  1NU0 A;  2V52 B;  4N41 A;  3H1Q A;  1S9E A;  4PKI A;  3K2P A;  5AQW A;  3SPY A;  2UU9 K;  4FM2 A;  2YX6 A;  3U3G A;  4B1V A;  4DV7 K;  3TR8 A;  3OW2 M;  3RMD A;  1A5X A;  1WBD A;  1NKB A;  1NK6 A;  2BDP A;  1VQK N;  2UUB K;  4G1Q A;  4OLB A;  1HUX A;  1G99 A;  5AQP A;  5JIC A;  4LF6 K;  2GUI A;  1VQL N;  2X6S A;  4NO7 A;  2O8F A;  1IJJ A;  3R3L A;  2VWJ A;  1BG3 A;  1V4S A;  1SUQ A;  1CXU A;  4M63 C;  2XHB A;  4IO9 L;  3B6P A;  5HRP A;  1BL3 A;  2E8A A;  3LAK A;  4GW6 A;  4CFD A;  4CEQ A;  3CG7 A;  3OYG A;  2E6M A;  4FOI A;  4CED A;  2AJQ A;  2HF3 A;  3V9W A;  3WUH A;  3U4L A;  4ELV A;  2WOM A;  4BVO A;  1LWF A;  2FBT A;  5AQK A;  3SMS A;  5C2F A;  4H0O A;  1FW6 A;  5C2D A;  1NGH A;  5BR8 K;  4U67 L;  3ENO A;  2Q97 A;  3Q7C A;  4ICL A;  4FJH A;  1W0H A;  4DV3 K;  3GBT A;  1L3S A;  2HST A;  3DLR A;  4NCG A;  3OYD A;  4PUO A;  3WXI A;  4DR7 K;  3O80 A;  4H0X B;  4Z4F A;  1NKE A;  3CER A;  5EU7 A;  1YJ9 N;  2IS3 A;  4DU1 A;  1RBV A;  4X66 K;  5CE3 A;  1N5Y A;  3U9Z A;  1JXB A;  3AA2 A;  2ASP A;  3RWU A;  3VA3 A;  2B6A A;  4CJP A;  5ADX H;  3THV A;  3O9R A;  4DQS A;  4KH5 A;  5KI6 A;  3A0I X;  3TI0 A;  4FJ7 A;  5BRF A;  3DLL L;  1HYS A;  2RPI A;  4ISF A;  4DQ8 A;  1QVF M;  4IZ9 A;  4JRQ A;  1VQ5 N;  4NXM K;  3VQB A;  1N32 K;  4AM6 A;  3A8Y A;  4C8O A;  2KTQ A;  4DV4 K;  4DR3 K;  4WQ4 A;  2DY4 A;  3RR7 A;  4CHZ A;  1VQ9 N;  3OYH A;  2VGN A;  3TAB A;  1S1V A;  2E88 A;  3CM5 A;  2VG5 A;  4FLY A;  1K6Y A;  4QS9 A;  4HVJ A;  2HHH K;  3DLB A;  3HVT A;  1TK5 A;  1QQO A;  4DSI A;  2NZT A;  5EY4 A;  4DUY K;  4LFA K;  3VTH A;  1VQN N;  4CJR A;  4YOT A;  5AQL A;  4W5T A;  1WB9 A;  3CJA A;  3E1Y A;  1T3V A;  5FPE A;  2P9L B;  5HLF A;  3FZH A;  3SCX A;  3OS2 A;  4CGD A;  1B9F A;  1UAX A;  3FR0 A;  4E0D A;  2A3Z A;  2HHQ A;  2E4L A;  3SUN A;  4M7Y A;  1BWF O;  1NNE A;  3EE8 A;  4PQU A;  2HOE A;  1TKX A;  3LWL A;  4KI4 A;  3ULE B;  4FL9 A;  5C42 A;  1VQM N;  2FF6 A;  1KLM A;  4CEB A;  1RT6 A;  3CM6 A;  4O8K A;  2WON A;  3CMA N;  1I94 K;  4ELT A;  2P9N A;  2UXD K;  4YOW A;  4XH1 A;  4OPH A;  4JI8 K;  5JS1 A;  2Z1G A;  1U04 A;  3P31 A;  2NRH A;  5C10 A;  3SAG A;  4DLG A;  5FPM A;  2PAV A;  3SQ0 A;  4KTQ A;  5E41 A;  3B8A X;  3PO4 A;  3SJJ A;  2RHK A;  1F21 A;  5EOY A;  4B9S A;  3OA9 A;  4O5F A;  2VGM A;  4A59 A;  1NGF A;  4AIL C;  4FJJ A;  2YJF A;  4KB1 A;  3OYC A;  2PY5 A;  4FJL A;  3QEW A;  1JXE A;  5JLH A;  4BRQ A;  3ASM A;  3BDP A;  4H0Y B;  5AQO A;  4CEO A;  1KTQ A;  4KHY A;  1NBW A;  4UQG A;  4GMJ B;  1LAW A;  3RSE B;  4OKK A;  3HBT A;  3C95 A;  3LDS A;  3AO2 A;  2XO7 A;  1HQE A;  4JK7 A;  4DQP A;  3CCJ N;  3NVK A;  4IG3 A;  4IWV A;  2B4J A;  4O55 A;  4BR4 A;  4H4O A;  4FLV A;  2WUS A;  3D2E B;  3C7N B;  3VES A;  4PWD A;  1YJN N;  3FLC O;  3QER A;  4AHS A;  3NH1 A;  4CER A;  4CJE A;  4RWT A;  4AQY K;  2FSJ A;  1RGI A;  4C23 A;  4BC3 A;  3WQT A;  2E1Z A;  1BDG A;  4DG1 A;  1HYZ A;  3A2F A;  3LDQ A;  3VEW A;  3NGY A;  4N76 A;  1Q7Y O;  1IBM K;  5KPR A;  3AAQ A;  3SLC A;  3QNO A;  1TV6 A;  2CGL A;  1EQY A;  4RTF D;  5D3G A;  2FXU A;  1S6P A;  3O08 A;  3OY9 A;  1KQS M;  1VSE A;  1RTH A;  4H5N A;  4FYD A;  3OYA A;  2BH1 A;  1TUY A;  4RCH A;  4J2B A;  3DRS A;  4JKC A;  5EVZ A;  4BRO A;  4FO0 A;  4FK0 A;  1NG9 A;  4BE0 A;  4NLB A;  5I9E B;  4QOZ B;  1W9H A;  4BRK A;  1RBS A;  3AAP A;  1SKR A;  1HJO A;  2QM1 A;  1SKS A;  5LY3 A;  1ZBU A;  3EZW A;  4JKF A;  1Q81 O;  1KC8 O;  3CD6 N;  3KK1 A;  2Q3S A;  2HND A;  3TSQ A;  3HVR A;  3O9Q A;  4AH9 A;  3VQP A;  1SAZ A;  1S6Q A;  1TL1 A;  4CEF A;  1TK0 A;  4BAC A;  3KJV A;  2AA4 A;  2J4R A;  1HMV A;  4CZF A;  1NK9 A;  1NJY A;  2QXL A;  4M3W A;  1VQ6 N;  4J2A A;  4BRC A;  1TK8 A;  2GTD A;  5AQG A;  4DHY A;  3DRP A;  3LPU A;  4H0P A;  3ZEU A;  1E3M A;  5CR4 A;  3TAN A;  2IAJ A;  3CC4 N;  4CK1 A;  3MX5 A;  1DTQ A;  4CEZ A;  3DOK A;  4AHU A;  1QE1 A;  2YKM A;  4PL7 A;  3TAP A;  4BE1 A;  3R9P A;  2HBL A;  1VSL A;  4H4M A;  1QQN A;  4M3T A;  3ZSV A;  2Z1I A;  2UXC K;  3AAR A;  2Z1J A;  2D0A A;  1FKP A;  3SUQ A;  1OVY A;  3SQ4 A;  4KKO A;  3PLA A;  3F9M A;  4GNI A;  2GV9 A;  3ZSW A;  3IS9 A;  4CIE A;  3I55 N;  3CCL N;  4ID5 A;  5J1E A;  3J7A P;  3ZET B;  3SNN A;  4CFB A;  4KHP K;  1TYQ B;  3KLF A;  3LPT A;  4KH6 A;  2PBD A;  1BQM A;  2W42 A;  3ZT0 A;  1E4F T;  1RFQ A;  1L5U A;  1ZC6 A;  4MO5 A;  1VRT A;  3L3U A;  4FK4 A;  1ZBF A;  1VSK A;  3EY1 A;  4OLA A;  1IBK K;  2O8B A;  1NGA A;  3PV8 A;  5IT9 O;  4TSX A;  4FLZ A;  1Q82 O;  2XY5 A;  3CPW M;  4L3Q A;  1WSG A;  3CJ9 A;  5H1S Q;  2P51 A;  3EE9 A;  4H5V A;  4FK2 A;  2YHX A;  4I2P A;  3EZ5 A;  2A5X A;  4JKG A;  3H1V X;  4LF7 K;  5HBM A;  3VF4 A;  3AVJ A;  4KO0 A;  1ZBS A;  2Q2R A;  4IDH A;  4CHY A;  4M3X A;  1TGO A;  1NM1 A;  4DFJ A;  4BGB A;  4K43 A;  1C0U A;  5M1F A;  2HHV A;  2W41 A;  4FOE A;  1S1T A;  2O8C B;  3TTC A;  5GAH P;  2FSK A;  3SYZ A;  2P9K B;  3I0R A;  3D2F B;  3F2K A;  3QEI A;  4XIU A;  1U47 A;  3QBW A;  1CZ9 A;  5M1O A;  4F3O A;  3R8E A;  3LP1 A;  3QEP A;  1RDA A;  1YT3 A;  5AQY A;  2PYL A;  3MX2 A;  3CCM N;  1HYV A;  2PYJ A;  4DSK A;  3MMV A;  3NCI A;  3CHW A;  4OO1 J;  3FZF A;  5DM7 L;  2QKB A;  5AFU A;  4DUZ K;  3ATU A;  5HRN A;  1RNH A;  3K0S A;  3VQA A;  4AM7 A;  1LW2 A;  3ID6 A;  3CFO A;  4BR0 A;  1IV0 A;  1XQS C;  4ZHR A;  3AVH A;  1HKG A;  3AVC A;  1Q86 O;  4JNE A;  1X9J A;  1S3X A;  1J53 A;  3V4I A;  2CGK A;  1YHQ N;  1SL0 A;  3ITH A;  2DFH A;  1NOZ A;  5CY4 A;  1K9M O;  3MXM A;  3AVI A;  4I2Q A;  3NDK A;  3K57 A;  2GEL A;  3M6G A;  1BGX T;  1NMD A;  3VN5 A;  2P9U A;  5FRN A;  1S1W A;  1Z25 A;  3KZB A;  3JAM O;  5DK5 A;  4CEC A;  4CJL A;  1WNS A;  3E66 A;  1JCG A;  1NGI A;  4CZH A;  2VCP A;  4CF2 A;  3TAM A;  3NF8 A;  4DV1 K;  1RDD A;  4JKH A;  2F8S A;  4E7H A;  3IMX A;  3O3H A;  2ZE2 A;  3WNH A;  2JGU A;  2VG6 A;  3ZT4 A;  3NMU A;  4C8M A;  3VA0 A;  3C6A A;  5ELZ A;  4E89 A;  3TAR A;  3MXJ A;  3V1O A;  1J54 A;  4JRP A;  4WQ5 A;  3VEY A;  4CZG A;  4CBU A;  4B9T A;  4ISE A;  1Z05 A;  4DTR A;  4FCY A;  3EYZ A;  4DSJ A;  2NRZ A;  1EET A;  1KAZ A;  4RW8 A;  1S5J A;  3O6W A;  3VGK A;  2XY7 A;  5AQF A;  1ATS A;  5BPM A;  3D7E O;  3HRG A;  4FWR A;  3NVM A;  4M7X A;  3MN5 A;  5BRD A;  1D8Y A;  2QWL A;  2Q1N A;  4Z4I A;  1VK0 A;  1X9W A;  3HO1 A;  4UY8 O;  4FPB A;  3IKM A;  5IWA K;  4E1N A;  4FJX A;  2NUB A;  4B08 A;  4HUE A;  1TAQ A;  3MN6 A;  5KRT A;  4LF4 K;  3WEE B;  3AY9 A;  1C6V A;  2YHA A;  3DI6 A;  1U4B A;  3DXM A;  4IFE A;  5FPN A;  1CXQ A;  5M1Q A;  1D9D A;  3C65 A;  3R1X A;  2Y1I A;  1GLC G;  3AGK A;  5EX5 A;  1BHL A;  5KPT A;  3CME N;  2E2Q A;  5GAG P;  2QWQ A;  3EKU A;  1RCH A;  4XH5 A;  2JWL A;  4PHT X;  3AGR A;  3WXL A;  1NK5 A;  4DR6 K;  4BR2 A;  4DTO A;  3VEV A;  2KZZ A;  3LM2 A;  1MDU B;  4CBX A;  4CJF A;  4BC4 A;  3HZ6 A;  4DU4 A;  1X1P A;  1KAX A;  3KHY A;  4FLT A;  1RDU A;  3THY A;  4IO8 A;  3ZLJ A;  1MWK A;  3L2Q A;  1R0A A;  1FXX A;  2P1J A;  1Q9Y A;  3VOV A;  1MU2 A;  5GAD P;  3HK2 A;  2UUA K;  3T3F A;  1BI4 A;  1C0G A;  3VGL A;  3DXK B;  3QFU A;  3OYL A;  2HBM A;  4BRH A;  2F8T A;  3C6U A;  4LH5 A;  2I7P A;  1SL2 A;  1LAV A;  4I6M B;  3K58 A;  4YHH K;  1VQO N;  1WUA A;  4BWJ A;  3M8R A;  2ZJR L;  3GOI A;  2P9I A;  4FWM A;  4E1M A;  4BG8 A;  2O8E A;  4FJM A;  3S41 A;  4A61 A;  3MCP A;  1OH8 A;  1ESV A;  2A6A A;  2KKZ A;  3V1R A;  4W5O A;  3LP3 A;  3FZK A;  1SV5 A;  3TPQ A;  4FJI A;  4A2B A;  5J2N A;  4B1U B;  2G8V A;  3L0Q A;  1GLF O;  4MQ3 A;  4DTX A;  4C8L A;  4AHC A;  4E7K A;  3A5O C;  1HLU A;  4KHU A;  4DF8 A;  2OYQ A;  4ILJ A;  4K41 A;  3U8X A;  4KRF A;  3OYM A;  1QSY A;  3PX4 A;  1SQK A;  2YHB A;  1Q9X A;  1WAJ A;  5AQM A;  2RKI A;  4Y0W A;  4BRP A;  4HCC A;  2LSN A;  2IIR A;  4M45 A;  5FRM A;  4BG9 A;  1A5V A;  5AZJ A;  3UKU B;  3MEG A;  3P4I A;  3CCV N;  5J2P A;  4FZZ A;  4FWL A;  2YNG A;  5J2M A;  4KHN A;  4Z0U A;  4C1N K;  3LP2 A;  3THX A;  3KVG A;  2PFU A;  5DM6 L;  4BRL A;  2X78 A;  5F0X A;  3PUF A;  3DJC A;  1BOT O;  3EL2 A;  4JD2 A;  1XHX A;  3ALY A;  4JEP A;  1P8Z A;  1OKJ A;  4JI1 K;  2YHW A;  5TKY A;  1ATR A;  4Z4H A;  4OX9 K;  4JI5 K;  4ID1 A;  1JL1 A;  1X9S A;  4CZM A;  4JAX A;  2FLO A;  4HTU A;  3PY8 A;  4B9L A;  2NRT A;  3M8P A;  4K42 A;  2VQF K;  4BC5 A;  3MAQ A;  3M3Z A;  3QIC A;  4OKJ A;  3ZT3 A;  1L3T A;  3RR8 A;  3AVG A;  4FWK A;  3LL3 A;  3OYE A;  1R59 O;  1EXQ A;  4JS4 A;  5E26 A;  5BPL A;  1KLN A;  3MWT A;  4B3S K;  4MLE A;  3HXM A;  4LSL A;  1S1X A;  1ASU A;  1UA0 A;  4IBN A;  4CGH A;  4WE1 A;  1V4T A;  2FBV A;  3SZ2 A;  3T1A A;  3TAQ A;  1TL3 A;  1OH5 A;  2KFN A;  4WFN L;  3IRX A;  3NF6 A;  3QIO A;  4JI7 K;  3AVB A;  1X9M A;  4MDA A;  1O13 A;  3CC2 N;  1GLE G;  3O5B A;  1XMO K;  1T6C A;  2CH5 A;  1JLC A;  4DFP A;  3TSP A;  4FWO A;  2HHS A;  2HB5 A;  4QS8 A;  4I9Q A;  2P9S B;  3LDN A;  2GWK A;  5AQX A;  1KD1 O;  5FDL A;  2FSN A;  4OGE A;  3V9S A;  5AQZ A;  3BY5 A;  3THW B;  3O4Q A;  4CVN E;  4DCH A;  3RRH A;  4CJT A;  2ASO A;  3L4I A;  1IBL K;  4CZI A;  1VSH A;  2QW9 A;  3N4Q A;  3EO3 A;  4XEI A;  4CJU A;  4FSV A;  3QML A;  1SS6 A;  3OBW A;  3HTV A;  4O5B A;  1Y97 A;  3I8D A;  1NGE A;  1N6Q A;  4KBO A;  1C1A A;  3LDO A;  4BGA A;  3LZI A;  3GDQ A;  4KB0 A;  3KK7 A;  3QIN A;  3KD1 E;  1ASV A;  4M3U A;  3VET A;  2H3G X;  2EHG A;  3DLK A;  3ENH A;  4DV5 K;  4FJ9 A;  2YNI A;  5KPZ A;  5FLX O;  4HCB A;  3K5M A;  5BRH A;  3VQ4 A;  2NLX A;  3UIQ A;  1YF5 L;  4AHV A;  5AQV A;  1JLA A;  4BRI A;  4CZJ A;  1YJW N;  3M1F A;  4CGF A;  4MFB A;  3MEE A;  3IFR A;  4EIA A;  1RBU A;  2HHU A;  1C0M A;  3J81 O;  3AVA A;  3NE6 A;  3L8B A;  3LM9 A;  4HHT A;  3SV3 A;  5AQR A;  1ZXO A;  3F5T A;  2G8I A;  4CBW A;  1NJX A;  4GV9 A;  2CH6 A;  4JK8 A;  1XC9 A;  3VTI A;  4BVP A;  3OYK A;  5E84 A;  4JI6 K;  5FRO A;  4KHS A;  5LL6 Z;  1JL2 A;  3BF3 A;  3NAE A;  1XUP O;  2HBJ A;  3I8B A;  1FKO A;  1MA9 B;  2HNZ A;  2NRR A;  1C1B A;  3O3F A;  4FWS A;  2DFE A;  4FM1 A;  2OPQ A;  2P9L A;  5LJW A;  3DOL A;  2HMI A;  3QO9 A;  1WSE A;  1VSD A;  3PIO L;  2Q0R A;  4I9L A;  1DGK N;  4NYN A;  4FVU A;  5K14 A;  1MWM A;  1RT5 A;  4OKE A;  2E2P A;  1T03 A;  2IGI A;  3HPG A;  5BN8 A;  5SZT A;  3F9K A;  3FGU A;  4QAG A;  3VMF B;  2GEM A;  1ZYQ A;  1D4X A; 
#chains in the Genus database with same CATH homology
 2V7Z A;  4K25 A;  2P9K B;  4WQ4 C;  1Q18 A;  3D2F B;  3F2K A;  2IVO A;  3QBW A;  3ULE A;  5M1O A;  1HKB A;  3R8E A;  3WXM B;  3GL1 A;  3QDK A;  3VEO A;  3SK3 A;  1NGD A;  3FZM A;  4EHU A;  5AQY A;  1KAY A;  2W40 A;  3VEN A;  4BRD A;  3MX2 A;  4YOX A;  3CCM N;  3CCU N;  2V52 B;  2YHY A;  3MMV A;  4R79 A;  3C0B A;  3CHW A;  3H1Q A;  4OO1 J;  3FZF A;  5DM7 L;  5AFU A;  4PKI A;  5AQW A;  3ATU A;  4JN4 A;  2YX6 A;  4AM7 A;  4YOV A;  3ID6 A;  1ATN A;  4B1V A;  4BR0 A;  3OW2 M;  1XQS C;  4GV6 A;  3TTD A;  1HKG A;  3E9O A;  1VQK N;  3SBT A;  3VER A;  1Q86 O;  4H03 B;  1HUX A;  4JNE A;  1X9J A;  1S3X A;  1G99 A;  2QWN A;  5AQP A;  2CGK A;  5JIC A;  1YHQ N;  1JCF A;  2QWP A;  3TSU A;  1ILY A;  1K9M O;  1VQL N;  4NO7 A;  5AQQ A;  3CXC M;  3UKU A;  1IJJ A;  3R3L A;  4CJ7 A;  1XC3 A;  4PKH A;  1BG3 A;  4JHD A;  1K8K B;  1V4S A;  2GEL A;  3M6G A;  1NMD A;  4M63 C;  5GIO A;  4BRN A;  1D4X A;  2P9U A;  4IO9 L;  3KZB A;  1T6D A;  1U2V B;  3RVC A;  1VQP N;  3L6Q A;  2E8A A;  2GWJ A;  3RSE A;  4GV3 A;  3E66 A;  1JCG A;  1NGI A;  4CZH A;  3CCE N;  2VCP A;  2AP1 A;  4FOI A;  2QI2 A;  4ILH A;  2HF3 A;  3VGM A;  2D1K A;  4HTL A;  3WUH A;  3U4L A;  4IEI A;  4JKH A;  3IMX A;  4BVO A;  5AQK A;  5C15 A;  3NMU A;  2WFB A;  3SMS A;  5KQD A;  3C6A A;  5C2F A;  5ELZ A;  3E9P A;  1RDW X;  4H0O A;  5BR9 A;  3CQX A;  5C2D A;  3D2E A;  1NGH A;  2QWR A;  4WQ5 A;  3VEY A;  4CZG A;  4CBU A;  3WXJ A;  4ISE A;  3ENO A;  4U67 L;  1Z05 A;  2Q97 A;  3H3N O;  3Q7C A;  5AZI B;  4CZE A;  4YOU A;  3GBT A;  4BY9 C;  1VAZ A;  4O8U A;  2RE2 A;  2HST A;  2NRZ A;  4A5B A;  3HSC A;  1BU6 O;  4JK9 A;  4JKB A;  4JHD B;  5AQJ A;  1KAZ A;  1J6Z A;  3ZEU B;  3O6W A;  3VGK A;  3O80 A;  4H0X B;  3WXI A;  5AQF A;  2P9U B;  1ATS A;  3CER A;  4BRE A;  1YJ9 N;  4A57 A;  3WXK A;  5BPM A;  3R6M A;  3D7E O;  3HRG A;  4FWR A;  3NVM A;  3FE1 A;  3MN5 A;  4KH4 A;  4M7X A;  5BRD A;  5CE3 A;  5HOO A;  3U9Z A;  1S72 N;  2QWL A;  2Q1N A;  2ASP A;  3UB5 A;  5AQS A;  1KXP A;  4MDB A;  4UY8 O;  4FPB A;  2A41 A;  3IKM A;  1VQ4 N;  3A5N C;  5ADX H;  2D4W A;  2I7N A;  3EKS A;  3O9R A;  3O4W A;  3CC7 N;  4KH5 A;  4BR7 A;  3MN6 A;  3WEE B;  3AY9 A;  4DKW A;  2ZJQ L;  3A0I X;  1Z6R A;  3DXM A;  4IFE A;  5FPN A;  3W3D A;  5BRF A;  3DLL L;  3HM8 A;  5M1Q A;  3C65 A;  4ISF A;  3R1X A;  4DQ8 A;  4GVE A;  4IZ9 A;  1GLC G;  3AGK A;  5EX5 A;  5C12 A;  5KPT A;  1QVF M;  3VEZ A;  3CME N;  2E2Q A;  1VQ5 N;  4JKE A;  5GAG P;  4AM6 A;  3A8Y A;  3DAW A;  2Q0U A;  1GLL O;  3CJ7 A;  2QWQ A;  4PKG A;  3CET A;  4CZL A;  1YI2 N;  3EKU A;  4QS7 A;  4XH5 A;  2JWL A;  4WQ4 A;  3U9D A;  4PHT X;  3AGR A;  3C6H A;  3BF1 A;  3WXL A;  3UKR B;  4BR2 A;  1VQ9 N;  3VEV A;  3LM2 A;  1MDU B;  3MCA B;  4CBX A;  2VGN A;  1QQM A;  4BC4 A;  3HZ6 A;  1KAX A;  2V51 B;  5BN9 A;  2P9S A;  3WT0 A;  2E88 A;  3OBY A;  3KHY A;  2ZGZ A;  4IOX A;  3P39 A;  4QS9 A;  3O9S A;  1RDU A;  4IO8 A;  1QQO A;  1MWK A;  4IJN A;  2NZT A;  5EY4 A;  3VOV A;  5GAD P;  4WCE L;  4DB3 A;  2QTD A;  3VTH A;  1VQN N;  3ZYY X;  2CGJ A;  4YOT A;  3DXM B;  1CZA N;  4JKG B;  1C0G A;  5AQL A;  3DXK B;  3CJA A;  3E1Y A;  1T3V A;  3VGL A;  3QFU A;  5FPE A;  3G4S N;  2HBM A;  2P9L B;  3FZH A;  4BRH A;  3M5R A;  5JMV A;  4FWQ A;  3ID8 A;  5GAE P;  1Y64 A;  4U7B A;  3P38 A;  2P9P B;  2I7P A;  1NGG A;  3FR0 A;  3SAH A;  4I6M B;  2A3Z A;  3CCS N;  5FPD A;  1VQO N;  1WUA A;  1DT9 A;  5EXW A;  2EWS A;  4BC2 A;  1S22 A;  4WYB A;  5JVH L;  2ZJR L;  3GOI A;  3VF6 A;  2P9I A;  4FWM A;  3K9K A;  3VF2 A;  4BG8 A;  4M7Y A;  1BWF O;  2OTL N;  3S41 A;  4F9O A;  4H5T A;  4A61 A;  3EE8 A;  2Q36 A;  3VPZ A;  5B8H A;  5HL7 L;  3MCP A;  2HOE A;  2ZWH A;  3W0L A;  1ESV A;  2A6A A;  2KKZ A;  3ULE B;  5ADX A;  4FL9 A;  3FZK A;  4FWN A;  3TU5 A;  2FF6 A;  3TPQ A;  1YAG A;  1VQM N;  4A2B A;  4IOC L;  1JJ2 M;  4H5R A;  3L4Q A;  3HOS A;  4B1U B;  4O8K A;  3L0Q A;  4H0V B;  1GLF O;  2F7T A;  4MLH A;  3CMA N;  4IOA L;  3CJC A;  1BO5 O;  1DEJ A;  3A5O C;  2P9N A;  1HLU A;  2ZGY A;  4YOW A;  4XH1 A;  4ILJ A;  4OPH A;  1BUP A;  3ZET A;  3ZX3 A;  2VWB A;  3H6E A;  1QHA A;  3P31 A;  2QEX N;  4K41 A;  3U8X A;  2NRH A;  5C10 A;  3SAG A;  1VQ7 N;  3ENB A;  1H1V A;  3O1B A;  5FPM A;  5KQ8 A;  2PAV A;  3E9L A;  1SQK A;  2E20 A;  3BP8 A;  3WQU A;  3C7N A;  3B8A X;  3K9J A;  5AQM A;  2RHK A;  4MO4 A;  4Y0W A;  5EOY A;  4BRP A;  1GLA G;  1QVG M;  3OA9 A;  4O5F A;  2IIR A;  2VGM A;  4A59 A;  1NGF A;  4A5A A;  2YJF A;  2WC9 A;  4BG9 A;  3MWP A;  4CI6 A;  3UKU B;  5AZJ A;  2BUP A;  5JLH A;  4BRQ A;  1NJI O;  3P4I A;  4OPA A;  3SAF A;  3CCV N;  4H0Y B;  5AQO A;  3SJH A;  4FWL A;  4NB4 A;  2A40 A;  2NRW A;  3A5M C;  2OTJ N;  4C1N K;  2F9W A;  1NBW A;  1K73 O;  3KVG A;  5AQT A;  5F2R A;  3CCR N;  5BPN A;  3RSE B;  2PFU A;  3HBT A;  3O8M A;  5DM6 L;  4BRL A;  5F0X A;  4YDU C;  3DJC A;  1BOT O;  1DKG D;  3EL2 A;  4JD2 A;  4JEP A;  4HWI A;  1P8Z A;  1OKJ A;  4JK7 A;  4GY2 B;  3CCJ N;  2YHW A;  5TKY A;  3NVK A;  1ATR A;  4CD1 A;  4IWV A;  4BR4 A;  1QZ6 A;  2WUS A;  5F1X A;  3D2E B;  2HF4 A;  3C7N B;  3CPE A;  3VES A;  5TKW A;  1YJN N;  2IVN A;  3FLC O;  5AQU A;  3H45 C;  4CZM A;  2P9K A;  4JAX A;  3LDL A;  3D2F A;  2VYP A;  4IEE A;  1YUW A;  2FLO A;  5AZJ B;  3MN7 A;  3BEX A;  2KLA A;  2NRT A;  4RWT A;  5JVG L;  4NLC A;  2FSJ A;  4K42 A;  4BRA A;  1RGI A;  2ZF5 O;  2BTF A;  4ILG B;  4BC5 A;  3WQT A;  2E1Z A;  1BDG A;  4BC3 A;  1P90 A;  2QWO A;  3M3Z A;  3QIC A;  4XH4 A;  3IDH A;  3O1W A;  4Z94 A;  3LDQ A;  3VEW A;  3A5L C;  1Q7Y O;  5AR0 A;  4FWK A;  3TTF A;  5KPR A;  3AAQ A;  3ZX0 A;  3LL3 A;  3SLC A;  1R59 O;  5LJV A;  2JWK A;  2CGL A;  1EQY A;  4RTF D;  5E26 A;  5BPL A;  2FXU A;  1QZ5 A;  3MWT A;  3O9T A;  3O08 A;  4MLE A;  1KQS M;  2YJE A;  1LCU A;  4BR9 A;  4H5N A;  3CCQ N;  2BH1 A;  1TUY A;  3O9U A;  4RCH A;  4JKC A;  5EVZ A;  2KHO A;  4BRO A;  4FO0 A;  1LOT B;  2ZJP L;  4NLB A;  1V4T A;  3FFK B;  2YCH A;  2E2O A;  5I9E B;  3PIP L;  4WFN L;  3EN9 A;  1T44 A;  3MN9 A;  1K8K A;  3N4P A;  4J8F A;  4BRK A;  3QFP A;  3AAP A;  4MDA A;  1YXQ A;  1O13 A;  4BRG A;  1K8A O;  3CC2 N;  1GLE G;  1HJO A;  2QM1 A;  1BA0 A;  3CQY A;  3O5B A;  4BRM A;  1U2V A;  1T6C A;  2CH5 A;  5CHI A;  3JS6 A;  5LY3 A;  3CD6 N;  3EZW A;  4JKF A;  1Q81 O;  1KC8 O;  1M90 O;  2A42 A;  1EO1 A;  3HI0 A;  2GUP A;  3TSP A;  4FWO A;  4JKA A;  2QA4 N;  2D0P A;  3T7Z A;  2V7Y A;  4QS8 A;  5M1K A;  1WOQ A;  5MLC Q;  4A62 A;  3TSQ A;  2P9S B;  3LDN A;  3O9Q A;  2GWK A;  2E2N A;  1SAZ A;  2QWM A;  5AQX A;  1KD1 O;  3J8A A;  2FSN A;  3D6R A;  5C0Y A;  3I33 A;  5AQZ A;  2AA4 A;  3OHR A;  5M1N A;  3H3O B;  4DCH A;  2J4R A;  4CZF A;  4CD3 A;  1TUU A;  1YIT N;  2QXL A;  2WBN A;  2ASO A;  3T69 A;  2GX9 A;  2D0O A;  3L4I A;  1VQ6 N;  3KWG A;  4CZI A;  2QW9 A;  5AQN A;  4H0T B;  2IVP A;  5AZI A;  1W2B M;  3N4Q A;  4BRC A;  3EO3 A;  2GTD A;  5AQG A;  4DHY A;  4XEI A;  1TYQ A;  4BRF A;  4EFH A;  1N8R O;  4H0P A;  4FSV A;  1NGJ A;  4B1X B;  3QML A;  1SS6 A;  3ZEU A;  2ITM A;  3OBW A;  4IXC A;  5CR4 A;  4WF9 L;  3IUC A;  4BQZ A;  3Q7B A;  4YOR A;  2NRX A;  3MK6 A;  3HOT A;  3HTV A;  3CC4 N;  3G71 N;  1NGE A;  2P9I B;  3MX5 A;  3QBX A;  5GIP A;  2HMP A;  4KBO A;  4H5W A;  3LDO A;  4BGA A;  3G25 A;  3SBG A;  2NRV A;  3GDQ A;  3KK7 A;  2Q31 A;  4PL7 A;  5GIN A;  1YVN A;  1YIJ N;  3R9P A;  1HPM A;  2HBL A;  1QQN A;  3VEX A;  4FWP A;  3VET A;  2H3G X;  3AAR A;  1VQ8 N;  1GLB G;  3H46 O;  3LDP A;  4WFA L;  4YDU A;  4B9Q A;  1OVY A;  3ENH A;  3CI5 A;  4G9Z A;  3PLA A;  3QB0 A;  4ISG A;  3WEE A;  1SZ2 A;  3F9M A;  4GNI A;  2DPN A;  3I56 N;  5KPZ A;  2P9N B;  4A2A A;  3I55 N;  3CCL N;  1NGB A;  5BRH A;  5AFU H;  2NLX A;  1YF5 L;  5BRE A;  4LC9 B;  3ZET B;  4EHT A;  1M1K O;  1IG8 A;  2UYT A;  5AQV A;  1BA1 A;  1TYQ B;  4BRI A;  4C1N I;  1HKC A;  3BUZ B;  3ZX2 A;  4CZJ A;  1YJW N;  1W97 L;  4KH6 A;  3M1F A;  4WQ5 C;  2PBD A;  1U6Z A;  4B1Y B;  2HBK A;  1E4F T;  4FPA A;  3UKR A;  1RFQ A;  4B1Z A;  1ZC6 A;  3IFR A;  4MO5 A;  4EIA A;  3KWI A;  2F9T A;  4C23 A;  3LM9 A;  3J7Z O;  4WFB L;  1NGA A;  1NWK A;  3ATV A;  4AF1 A;  5AQR A;  1ZXO A;  1GLJ O;  3F5T A;  1Q82 O;  4CBW A;  3CIP A;  4BR5 A;  3CPW M;  1E4G T;  3G6E N;  4GV9 A;  2CH6 A;  4JK8 A;  4L3Q A;  3CF5 L;  3VTI A;  4BVP A;  3CJ9 A;  2NNW A;  2FF3 B;  3GG4 A;  5E84 A;  5H1S Q;  1GLD G;  3EE9 A;  4H5V A;  1X3N A;  3BF3 A;  1XUP O;  3DWL A;  1C0F A;  2HBJ A;  2YHX A;  3I8B A;  1MA9 B;  2NRR A;  3FZL A;  2A5X A;  1NGC A;  1HX1 A;  4FWS A;  4JKG A;  3H1V X;  3CJ1 A;  3DXK A;  4B1W B;  3SMP A;  3VF4 A;  4CZK A;  3GE1 A;  2P9L A;  1ZBS A;  2Q2R A;  4IDH A;  4PL8 A;  4E1J A;  5LJW A;  1NM1 A;  4YOY A;  4JD2 B;  4K43 A;  4BGB A;  3JXU A;  2P9P A;  4BQL A;  3UE5 A;  5M1F A;  3PIO L;  2W41 A;  2YI1 A;  5AQH A;  2ASM A;  3MDQ A;  4FOE A;  4I6M A;  5AQI A;  2Q0R A;  4IJA A;  5M1P A;  1DGK N;  4EAH D;  2E1Y A;  1JCE A;  4FVU A;  1X3M A;  3TTC A;  1MWM A;  1NLV A;  4JKD A;  2E2P A;  5GAH P;  5BN8 A;  3CJB A;  3FGU A;  5JLF A;  3VMF B;  2GEM A;  2FSK A;  2OAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...