4WFBL

The crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with bc-3205
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
110
structure length
110
Chain Sequence
b'MISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKGVTLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYLYHGRVKALAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S rRNA
publication title Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2014-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4wfbL01
2ZJRL 5GAEP 3CMEN 1YJNN 3CCRN 2OTJN 3OW2M 1VQ5N 1Q81O 3CCVN 1YIJN 1W2BM 3G4SN 1QVGM 1VQLN 3CCMN 1KC8O 1S72N 3G71N 3CC7N 2ZJQL 3CCEN 3DLLL 3CMAN 1K73O 3CD6N 1K8AO 1YHQN 3J7ZO 1VQ6N 3CC2N 3CCJN 3CXCM 2OTLN 4IO9L 1VQ4N 5HL7L 4WF9L 1VQ9N 1ILYA 1VQ8N 1VQKN 3PIOL 5GAHP 3CF5L 5GAGP 3CC4N 1M1KO 4U67L 1YJWN 5H1SQ 3CCSN 3G6EN 1YJ9N 1QVFM 5DM7L 2ZJPL 3CPWM 1JJ2M 1VQNN 3I55N 1YITN 3CCLN 1N8RO 1OVYA 2QEXN 1Q82O 1VQ7N 4UY8O 3CCUN 1K9MO 4WFNL 5MLCQ 4WFAL 1KD1O 1Q7YO 4IOCL 1VQPN 5DM6L 3CCQN 5GADP 4IOAL 1YI2N 4WFBL 1VQMN 5JVHL 1KQSM 4WCEL 3PIPL 2QA4N 1M90O 1NJIO 5JVGL 1VQON 3I56N 1Q86O
chains in the Genus database with same CATH superfamily
3ZYYX 3K5MA 4A5AA 2V51B 4BC5A 4BDZA 2UUCK 4DSIA 1BQMA 4DLEA 4DQRA 4RCHA 4N47A 5EY4A 3ENBA 5F0XA 3F5TA 4DU3A 4AHTA 4DV4K 3VQ9A 4WQ5A 1JKHA 1S3XA 2G8WA 3UKRA 2FBTA 4HTLA 4CCHA 4NYFA 1UOCA 2GEMA 4LY7A 3VQ7A 4BWJA 3ZETA 3RSEB 2DTUA 3P4IA 2NNWA 3LP2A 3HSCA 1WSIA 1WN7A 4IO9L 1VQ4N 3OYFA 1S6QA 4CFBA 1BGXT 2I7NA 3DXKA 1E3MA 3VTIA 4FWQA 2F96A 3V1QA 3NFAA 4O0IA 3MN5A 3QLHA 2WUSA 2KFZA 5FPEA 4OGCA 2BDPA 1EO1A 2Z1IA 3CPWM 4KHSA 2KTQA 4EZ9A 1QE1A 1QSYA 3V9WA 3AA5X 3VTHA 2QEXN 1BU6O 4DFPA 4IBNA 3BDPA 4B08A 1K9MO 1Q9XA 5MLCQ 2GBZA 4CJ7A 3NH2A 3VGKA 2PYLA 2HHUA 5AQZA 3EN9A 3T1YK 3MEEA 3OS1A 4BC3A 5JVHL 3O1WA 4BR5A 2P1JA 5JLHA 4BRFA 3WUHA 4J2AA 5C24A 1C1AA 3SV4A 2PAVA 4KH5A 4FW2A 1EQYA 2OYQA 3AO5A 4FM0A 2OPQA 4EFHA 3AVHA 5BR8K 3DLEA 4DR4K 5AQHA 3VQQA 2YNHA 1YF5L 2OANA 3THYB 2E2PA 3OY9A 5BRFA 4B9SA 4DR6K 4KHYA 3MEDA 3P38A 2D4WA 3NF9A 2XO7A 2YI1A 5LL6Z 3BF3A 1ZC6A 5AQLA 4KBOA 3FFKB 3AY9A 3FGUA 1HYVA 3KKRA 5M1PA 1BIUA 3E01A 1T7PA 3M5RA 4B1ZA 3A0IX 4UQGA 1R0AA 1VAZA 4FWNA 1TKZA 2CH6A 3GE1A 3RMAA 3V9UA 1NJYA 3MN7A 1RTHA 4C1NI 1SKWA 2VCPA 2OTLN 4FW1A 1BA0A 2BE2A 2KW4A 4H0PA 3UIQA 3U8XA 4Z0UA 3ZX0A 2HVHA 5LMNK 2RHKA 4YOWA 4BRAA 1HJRA 2QWMA 4CFDA 2WBNA 2P9IA 4DR1K 2F8TA 3E1YA 1TUUA 3R8EA 2XHBA 2EHGA 4FJ5A 3TTDA 4HUEA 3GG4A 2A3ZA 4Z94A 2GV9A 1U2VA 1YUWA 3LZIA 3CCUN 1LW0A 4IJNA 3MXMA 5KPZA 1UA1A 2CGKA 1VSLA 4AF1A 4FLWA 4CIFA 3O3FA 4RTFD 3HVRA 3QICA 2BH1A 4JS4A 1WSEA 4CBXA 3J7AP 3VQCA 3KK7A 1J53A 3Q7CA 3U9DA 2QWOA 3G10A 1N34K 2IVNA 4FJJA 1IG8A 3HVTA 2YKNA 4A2BA 4DV2K 4KI4A 3S9HA 2NRVA 3CFPA 4JLHA 1P90A 4FOIA 2NRRA 4H0VB 1GLCG 3U3YA 2YJEA 5CE3A 2PY5A 2E20A 2O8FB 1NGJA 2Q36A 5KGXA 5GINA 1HR0K 4FO0A 3S3MA 4DFKA 5AJ3K 3TAFA 3DM2A 1VQLN 3CM5A 4ILJA 4JRQA 3E66A 1UWBA 2YNFA 1G15A 1IBLK 3ZLJA 1RT7A 2ZJQL 1WLJA 1X9MA 3CJCA 2YHYA 2VQEK 4DR5K 4PKGA 4FM1A 5C42A 4HWIA 3OJUA 1WAFA 1XHXA 3IUCA 4J2EA 3J7ZO 4KPYA 4QAGA 4BVOA 2Y1IA 1HNXK 4B3TK 1JLCA 3VGMA 3SV3A 1CXUA 3A5NC 4CBUA 5JMVA 1BI4A 1S9EA 4PA1A 4CZGA 1D4XA 5AQUA 2A42A 1G99A 1NK7A 4W5QA 4KO0A 3AVMA 2OCEA 1IBKK 4ELVA 3NMUA 3C0BA 3DYAA 3EZWA 1MWKA 3A5OC 1NK5A 2BUPA 4A62A 3MWPA 1S1XA 2AJQA 3DLRA 1DTTA 1NM1A 4IG3A 4BRDA 5H1SQ 4DS4A 3G6EN 2KZMA 1MWMA 5E26A 3S3NA 4FJGA 1ASWA 4YOTA 1NGAA 4LH5A 3AVIA 1OH7A 1VK0A 3T19A 4RW4A 1K8KB 5TKYA 4GV3A 1P8ZA 4HTUA 1X1PA 1WSGA 4CJPA 5C15A 4C8KA 2GUPA 1C1CA 4I9QA 1YI2N 1A5VA 1HPZA 3O9TA 1FW6A 1T8EA 4CHYA 4WQ5C 4FJNA 1NWKA 3C7NA 4N41A 5AQVA 1KVBA 3ZSXA 1U6ZA 4JD2A 2HHHK 1ZBFA 4H5RA 4DTUA 4FXDA 1WAJA 4NLCA 1N36K 3HRGA 4YOVA 4CK2A 4CJUA 1VSMA 4DF4A 3LP1A 1E4GT 1SZ2A 3L6QA 4KTZA 3QB0A 2QXLA 2W42A 4CZHA 1W2BM 4Y1CA 1DKGD 1C0UA 1JCFA 5FRNA 3SYZA 3HI0A 2X6NA 1KFDA 1VSKA 3I8DA 1H1VA 2QW9A 1LW2A 5T7BA 5IWAK 3UB5A 2ZD1A 1IG9A 1HYSA 1GLLO 2OPRA 3VQ6A 3R6MA 1IKVA 4RW9A 2I7PA 4CZFA 4JEPA 2I5JA 3THXA 3NGIA 1TV6A 4O55A 4YOXA 4DLGA 3GL1A 1I94K 2QM1A 4WF9L 5EOYA 3MCAB 1VQ8N 5GAHP 1Z26A 3CJBA 4Z4IA 1S1VA 1VHXA 5KQ8A 1BOTO 3CCSN 2ZQBA 3CIPA 3QMLA 3CPEA 2FF3B 1TYQA 2HW3A 3OS0A 3L2UA 4BY9C 3AA4A 3P5JA 1KSPA 2F9TA 4FWOA 3OS2A 4IO8A 3RRGA 4H0OA 4GV9A 3I0RA 3ZT4A 1NGHA 3SQ0A 3J8AA 1LV5A 1Q7YO 2G8HA 3JS6A 2BGGA 3EKUA 1I39A 3LPUA 3C94A 3EE8A 2QA4N 4FLUA 4R79A 3PX0A 3F73A 1X9SA 4MDBA 2PBDA 3MK6A 3FE1A 4JYAK 4L3QA 4H5TA 3ZSZA 2B4JA 4LFAK 5CYQA 3VEOA 3K5OA 1NLVA 2ZJRL 2NRZA 1ITGA 4I2QA 1HLUA 4DB3A 5I3UA 2HNDA 1TL1A 3ISNC 3EYZA 5E41A 4N76A 4FPBA 5EVZA 4WE1A 4BWMA 3OW2M 1TK8A 3ZSYA 4A5BA 5BPMA 1Q81O 3MECA 4J2DA 2P9NB 5KGWA 2OZMA 5J2QA 1N33K 3DMJA 3EY1A 1N6QA 4BRPA 4G1QA 1VSFA 1VSJA 1L3TA 1XI1A 4DR2K 1XQSC 5HRRA 5LJWA 4GV6A 4JK7A 1TKTA 1BA1A 3O5BA 4FJHA 3OYBA 2E6LA 2OPPA 4NYNA 1EWQA 1U45A 3CC2N 5BN8A 3SMSA 1TUYA 1ASVA 4BC4A 1BCMA 4E7IA 2QTDA 4I6MB 4Z4EA 3VMFB 3NCIA 4KHWA 2VQFK 1JCGA 3S41A 4HVJA 1VQKN 2GELA 2Q2RA 3LAKA 1Q9YA 4FJKA 4DTPA 3AO4A 1X3MA 1BDGA 2E2OA 3CJ7A 3VQEA 1NOZA 3CC4N 3P39A 4I6MA 4H03B 4BG8A 4DQ8A 3QIPA 1RT4A 1VQNN 4AILC 3CCLN 1JLQA 3AVLA 3QO9A 4KB0A 4BRNA 4ILHA 5HRNA 3NDKA 5AZJB 3HPHA 1RDCA 3UKUB 3OYKA 5A2QO 1HNIA 3HTVA 4KV8A 4CJ5A 3VA3A 2HHWA 1KD1O 3TWHA 3NH1A 5AQNA 3BEXA 5LJVA 4CHNA 5AQYA 1KVCA 3SAGA 3OYAA 4FYDA 3D45A 1U04A 3ID6A 1XHZA 2O8CB 2JLEA 2VYPA 3WQUA 1VQON 4BR9A 3ZSRA 1DEJA 1LCUA 3RVCA 4OPHA 1NBWA 2ASPA 3NGYA 2HHTA 5D3GA 4JKFA 1JLGA 2QI2A 3QNNA 4V19S 1BHLA 4DR7K 2XY8A 3TU5A 4PHTX 3QERA 4M3RA 4FWKA 3K57A 3PSIA 4K8XA 1YVNA 3SJJA 1ATRA 4FM2A 4FCYA 2WC9A 3SQ1A 2YNGA 4AHCA 2FSNA 3R3LA 5AQXA 4DUZK 1KXPA 4KHNA 4CEDA 4FVMA 2O8BA 2P9PA 3F9MA 3W0LA 5CHIA 1CZAN 3QEXA 3U3GA 1LWCA 2O8EB 1S1TA 1IV0A 2NRXA 4PQUA 1RDUA 1GLFO 5HL7L 4MO5A 4BE0A 4A2AA 4X62K 2HOEA 4M3XA 2E4LA 4JK9A 2D0AA 2A1RA 3T1HK 1VSHA 1HX1A 4FL9A 4DU4A 1D5AA 3AVGA 4JHDB 5DK5A 4EHUA 4CGDA 1RT1A 1RBSA 1GLJO 3PUFA 4OPJA 3DLHA 3VESA 3K5LA 3EEQA 3O3GA 4E1MA 1BO5O 3KJVA 3T69A 1V4SA 2QWQA 4O5BA 4KHPK 3ENOA 5HRSA 3V9SA 1X3NA 4E1JA 1EX4A 5J2MA 1TAQA 4DV7K 3V81A 1HQUA 3RSEA 3HL8A 4IFYA 1KCFA 4B9QA 3MMVA 2UUAK 4H0TB 1GOAA 3ITHA 1Y64A 1K6YA 2JGUA 1RDBA 1XNQK 1HUXA 2DPNA 2UXDK 3FZHA 1U48A 1EP4A 3MN9A 4BRLA 1LWEA 4IWVA 1NNEA 4CJLA 3SAHA 1DTQA 4E19A 5GAEP 4EHTA 4CZMA 2O8DB 1BIZA 4WYBA 4HCCA 4CK3A 2ZWHA 3KLFA 3M3ZA 4FPAA 1GOCA 3HBTA 4B9TA 1NK6A 1SL0A 4DSFA 4H5WA 1NGFA 3C65A 3QEIA 4ELTA 3K9JA 2ZE2A 2A41A 4DV5K 1QZ5A 3QEVA 4EP5A 3RMCA 3BY5A 1KC8O 2Q0RA 3KWGA 2O8DA 3C95A 3LWLA 3F9KA 4BRKA 4IKFA 3KZBA 3QIOA 1X9WA 2Z1GA 2GX9A 1S5JA 3KLEA 3CMAN 3TANA 4CESA 1QSSA 2IVPA 4CF8A 4FOEA 3TAMA 1Z25A 1L5UA 3H6EA 2XY7A 1OKJA 3DOKA 4H0XB 3SK3A 3VQ5A 2XRIA 3D7EO 5JLFA 3EZ5A 2HHSA 3VQBA 2X78A 1Q8IA 5EU7A 3FLCO 3SNNA 3THYA 3KTQA 4M7YA 3JXUA 4ISEA 2P9UB 1D9FA 4J2BA 3TSQA 3VENA 4CW7B 3C6HA 3AVAA 4IFEA 4FJMA 1YJWN 1YJ9N 3AVNA 4OO1J 1B92A 5DMRA 2Q97A 4NO7A 1JXBA 2KQ2A 5BN9A 2ITMA 3VQAA 2F7TA 4LSLA 1C0TA 2KKZA 5ELZA 3VQ8A 4CEQA 4EP4A 1HJOA 4EZ6A 3LAMA 4BRHA 5C12A 3SZ2A 3O4QA 3LDNA 3ZSWA 2KZZA 3JAMO 4DCHA 3SJHA 3K9KA 3NH0A 1WBDA 5HBMA 1ASUA 5C2FA 1M90O 1VRUA 5JVGL 3WNFA 2A6AA 1WB9A 2FC0A 3FZLA 1RCHA 2P9SB 2HBLA 1GLAG 1SQKA 4JKGB 3VEVA 1S9GA 1GLEG 5AQQA 2Q0UA 2RPIA 1RT2A 3EE9A 4BQLA 3OYGA 4EAHD 3L2VA 3VEWA 1JLEA 4IDHA 2IDOA 1O1WA 3E9OA 1SUQA 1LAVA 3DXMB 4IDKA 1BG3A 4OVLA 1ZYQA 5F1XA 4CHZA 1UA0A 4CBWA 1XNRK 1YXQA 4QS9A 1EKEA 3H3OB 2B5JA 4YFUA 2KFNA 3TSPA 2YCHA 3PO4A 1TK5A 4E7HA 2W6LA 3C6TA 3RMDA 2AP1A 5AQFA 1B9FA 4JNEA 5HLFA 4FLTA 1Z05A 4DFMA 3DOLA 5BPNA 4FJ9A 3EKSA 3DJCA 5B8HA 4DG1A 5J2PA 4A61A 4E89A 2O8FA 1XUPO 4DV6K 1NGCA 3VPZA 3VF4A 4QOZB 3OYDA 4J8FA 1X9JA 4CGIA 2D5RA 3WEEB 3ZCMA 1HNVA 3TSUA 3ZX3A 1HYZA 3AAQA 3ATVA 3EL2A 3B6PA 4M3TA 4JKDA 1ZBIA 5C0YA 4CF2A 3M8SA 4JS5A 1KFSA 2DFFA 3R9PA 1FJGK 1L3SA 4OX9K 3WXJA 1NU0A 2JWLA 2UUBK 2QXFA 1TL3A 2E1ZA 1OH8A 5C2DA 1EXQA 4BR2A 4YY3K 4IOCL 2QKBA 3LDLA 2NLXA 4B3RK 1NK8A 1JL2A 1JLFA 3ULDA 2HBJA 4JKAA 3C6UA 4B9VA 2D0CA 4JI7K 2ASOA 4BDYA 3KVGA 1CZ9A 3I56N 4BE2A 2HMPA 4E7JA 3BZCA 4MFBA 4DQPA 4FWPA 1QQOA 2VWKA 4CGJA 3TARA 3M8PA 3RR8A 3AVKA 1T44A 5HRPA 3VEXA 4LD0A 2G8UA 3L2RA 1KAYA 4JI4K 3K58A 3AVFA 1K8KA 2A1SA 3HXMA 2WTUA 4C8OA 4NXNK 3L2QA 4B9NA 3ID8A 1NK0A 3CJ9A 3V1OA 3HZ6A 3OA9A 3CCMN 1SL2A 4HCBA 3ZT3A 4K42A 1NOYA 4LF8K 1LAWA 4HUGA 1NKBA 4W5NA 1NJWA 3I33A 4GVMA 5JS2A 3AA2A 3D2FB 1QQMA 3NF7A 3T3FA 2QK9A 4IZ9A 1MU2A 3S3OA 2O4GA 1K8AO 4MDAA 1VRTA 4B8CA 2UU9K 1BL3A 2YNIA 2P9KB 4BC2A 4DU1A 3MWTA 1A5XA 4FZZA 4KKOA 2HSTA 3P83D 1WSJA 4CJQA 3RRHA 4O44A 4FJ8A 4F4KA 5HROA 4BRQA 5LMUK 3QNOA 4TSXA 5KQDA 3HM8A 3DRSA 1VSEA 3VEYA 3PX4A 5ADXH 1U49A 2HF4A 2H3GX 3NE6A 3V1RA 1U4BA 3NF8A 3OHRA 3OBWA 3OYLA 1OVYA 2YHWA 1IBMK 1NJZA 3OYJA 3PV8A 3O08A 3KKSA 5KPRA 1JLBA 3SPZA 4WFNL 4CJ4A 1HKBA 2P51A 3LDQA 4LFCK 4XH5A 3O80A 2RE2A 2WOMA 3MAQA 4WFBL 4CD3A 4CZLA 2NZTA 5M1QA 2P5OA 4WCEL 1NJIO 1S1WA 3ULEB 4CHOA 4MLEA 4DMNA 1YAGA 2FBYA 4B3SK 3SQ2A 4M3YA 1BISA 2EWSA 2IC3A 4JKBA 4CZIA 2HF3A 3JSMA 4B9LA 2IS3A 3IAYA 1KAXA 2A40A 2G8IA 1GLBG 1WSFA 3Q7BA 4BDPA 4AH9A 2OTJN 4F9OA 4BRGA 5AQOA 4XEIA 4AHRA 1CXQA 3ATUA 2KLAA 1J9AA 1Q18A 1QVGM 1W97L 3BUZB 2YX6A 3FFIA 3V9XA 4DUYK 4CEAA 2YV0X 2FSJA 4LF9K 3HK2A 4CHQA 1XC3A 3G71N 4M41A 3ENHA 3FR0A 2YHAA 2HMIA 3MXIA 3KIOA 2A5XA 5AQRA 2IVOA 5AQSA 3TAGA 2UXCK 4O4GA 4CJWA 3RWUA 2PYJA 4DHYA 2FSKA 1OH6A 3CCJN 4OJRA 2CGLA 1ILYA 3J7YP 1L3UA 3AV9A 3H46O 1NGEA 3VA0A 3A8YA 4IEIA 1YTAA 1WOQA 2D0OA 3O9UA 2P9NA 3MN6A 2E5LK 2F9WA 3TABA 3DLBA 3L3VA 4Q0BA 4DSJA 4Z4CA 4M42A 3SLCA 3LPTA 5C10A 4CZKA 1QHAA 4I7FA 3VN5A 1QTMA 1B9DA 1FKOA 3MCPA 3ZSOA 2IOCA 4OLAA 1ZBSA 3MEGA 3A5MC 3ZT2A 4LF4K 3O9RA 3N4QA 5DM6L 3EO3A 1ZBLA 5GADP 5I42A 3K5NA 3NF6A 1KLMA 1SV5A 5KPTA 2F8SA 1T3VA 1KQSM 4G9ZA 4ZHRA 4ID1A 4CJ3A 4DTOA 1DGKN 1RT5A 4DQQA 4K8ZA 5M1NA 3NBPA 3AVBA 4C23A 3HO1A 3FZKA 4BROA 3T1AA 3DRPA 2EX3A 3VQPA 2YJFA 1DLOA 1V4TA 2F4VK 1I3AA 5AZIB 4CEOA 3CMEN 4XIUA 3KK3A 3VEZA 3BGRA 4PWDA 2JWKA 4F3OA 4FJIA 1VQ5N 5AZJA 3G4SN 3UKUA 3HT3A 1WUAA 5JICA 5AZIA 3WXKA 5SZTA 2HHXA 3K59A 4KHUA 1IO2A 1W7AA 4F2SA 3ZT0A 1QHTA 4BQZA 1K73O 3SPYA 5K14A 5HP1A 4KTQA 2HBMA 2OA8A 3NGZA 1J5EK 2O8CA 2O4IA 4B1XB 3WT0A 3O4WA 3ZSVA 3LANA 4BRMA 4BACA 1NMDA 4Z4GA 3J81O 3TTFA 4BR0A 2IAJA 4F3TA 5FPDA 5FLXO 3NVMA 3THWB 5I9EB 5SWMA 1NKEA 4FWMA 3ALYA 1NJXA 4AM7A 3PSFA 4BGAA 4B1YB 4YDUA 3M8QA 2QWLA 4OGEA 2LSNA 1W9HA 3TPQA 3J80O 1RT6A 4CJVA 4CF9A 4PKIA 4DSKA 3U9ZA 4K41A 3VQ4A 4CERA 3HYFA 3LP3A 3AVJA 1NK4A 4L8RB 3LDPA 3ZX2A 5AQWA 1NK9A 2O8EA 3H1QA 1S1UA 3KLHA 1LWFA 3CCQN 4FWRA 1IKXA 2W6KA 3UKRB 4U7BA 1RNHA 4GW6A 5KTQA 3RTVA 4X65K 1TGOA 1C0GA 3AO2A 3WXMB 2E2QA 4CGFA 4N5SA 3ZETB 1BQNA 4JHDA 4CFAA 4GKJK 4M3WA 3HPOA 1UAXA 5J1EA 4Y0WA 4FK4A 4H5NA 4CK1A 4HUFA 2YKMA 3KK2A 4RWTA 3DXKB 4OKKA 4K25A 1TK0A 2XY6A 1D9DA 1FK9A 4B3MK 1C0FA 5FPNA 4YOYA 4CHPA 4LF5K 1S72N 4ISFA 3HOSA 3NHGA 1RBVA 4IXCA 4OLBA 3MX5A 3M6GA 5AQTA 4JK8A 4Y1DA 1SL1A 2HNZA 3CD6N 1KVAA 1VQ6N 1YTUA 3N4PA 4CF0A 1ZXOA 4XH1A 3QESA 3I8BA 4GKKK 3DI6A 3QDKA 1T6CA 3SBTA 3THVA 3TAEA 5AQMA 3MXJA 4FK0A 4C8MA 4WQ4A 3QEPA 3CERA 3JYTA 5CZ2A 4DQSA 3IDHA 2CGJA 3FZMA 3CF5L 3OYIA 4LSNA 1HKGA 1HRHA 4QS8A 3CI5A 1QVFM 3ZEUB 4DS5A 3RMBA 3AARA 2ZJPL 1Z6RA 1JJ2M 4DTJA 3WNGA 4YOUA 3I55N 1YITN 4DV3K 2CH5A 3HP9A 3MX2A 5CY4A 4KRFA 3ZEUA 4B3OA 3ZT1A 4Z4HA 4KHQA 3A2FA 3IRXA 4YORA 3OYHA 2GTDA 1VQPN 3TI0A 1XMOK 1NGGA 2Q1NA 1NGIA 2UYTA 2BTFA 2RKIA 3VETA 3O9QA 4RG8A 4H0YB 3CJAA 1J6ZA 2E88A 2P9UA 4ICLA 4GNIA 3GDQA 4BRIA 3AO3A 3PY8A 1NMNA 4E0DA 4CJRA 4K43A 3T7ZA 1Q86O 1T6DA 4PY5A 4M63C 4CJEA 4DKWA 2ITGA 1S22A 4FLZA 2HVIA 3K2PA 3LDSA 4W5TA 2E8AA 4FZYA 4FWLA 2E6MA 3WNEA 4LF6K 2QWNA 5AQGA 2DFHA 2NUBA 3SAFA 4E7KA 3CHWA 3CCVN 2KHOA 3TTCA 2Z1JA 4PKHA 4E3SA 2P9IB 4LH4A 1JLAA 4BE1A 4CZEA 3HM9A 3VF6A 2NRWA 4H4OA 3LM2A 3KD1E 4CJTA 4H4MA 3AA3A 1HKCA 4IOXA 3OYNA 1RTIA 3OYCA 5BR9A 3CC7N 5BREA 5EX5A 3QFUA 3V4IA 2B6AA 5EXWA 1U2VB 3AGRA 1DT9A 2D0BA 3IG1A 2VGNA 3CM6A 4FLYA 2HNYA 3SCXA 2P9SA 3LP0A 4B1VA 3QETA 4JKGA 5LY3A 4AHUA 3CQ8A 4RW8A 3O1BA 3H08A 2X6SA 3PIOL 1CLQA 2Y1JA 3IS9A 4ZTFA 4JRPA 5M1KA 3CG7A 3L8BA 2WFBA 5KRTA 3DXMA 5AQJA 2PZSA 2NRTA 3H1VX 4DV1K 1C6VA 4IG0A 4LF7K 4CJKA 2Q3SA 3CQXA 5FROA 3LL3A 4NCBA 4IFVA 2D1KA 1RTDA 4DTNA 3PX6A 4CEEA 1N8RO 4NCGA 3B6OA 4X66K 1BWFO 5AQKA 3KD5E 1RBUA 1RTJA 1RDAA 1NGBA 4CGHA 3O3HA 4CF1A 5GIOA 3IMXA 4CI6A 2AA4A 2QWRA 3FZFA 4KFBA 4KH6A 4IEEA 4BRCA 1VQMN 1VSIA 4RW6A 5M1FA 2W40A 4C8NA 4MQ3A 1QS4A 3TAPA 1FXXA 1L3VA 4E1NA 3AAPA 5BRDA 4JAXA 1U47A 2FBVA 3WEEA 3DLKA 1BI4B 2V7ZA 3R1XA 1R59O 3BP8A 3CJ1A 4BVPA 3WNHA 4DQIA 1C1BA 4JI0K 3CCRN 1E4FT 1MA9B 3E9PA 4XH4A 1OH5A 3WXIA 4LC9B 4KTWA 4YDUC 1QZ6A 4O8KA 3L2WA 4AHVA 5AFUA 4CD1A 3D2EB 1HMVA 4F8RA 1ZBUA 2HHVA 1RDWX 1W0HA 1C0MA 2VG5A 5AFUH 3PO5A 4CFCA 2IGIA 2GWJA 3SUQA 3VERA 3SUOA 1TKDA 2ASMA 3D2EA 1SAZA 4KAZA 4E7LA 4GY2B 4CECA 2E2NA 1D8YA 3E9LA 3AVCA 1VQ9N 1RFQA 3LWMA 3C7NB 3H3NO 4NB4A 4JD2B 2X74A 4M3ZA 5AR0A 4KH4A 2DFEA 2P5GA 1RBTA 4FJXA 3VOVA 5CZ1A 5HOOA 3P1GA 1ATSA 3UE5A 3TR8A 3GBTA 1F21A 3GOIA 4ILGB 4FZXC 4M3UA 3D2FA 4FVUA 4CIEA 5AQPA 3OJSA 4M7XA 1Q82O 1BUPA 1SKRA 1VQ7N 1SS6A 1XC9A 4B1WB 3QINA 4O0JA 1TAUA 4WFAL 2GWKA 5ADXA 2P9KA 3OVNA 3ZSQA 2PFUA 4IOAL 3D0PA 1XMQK 1RT3A 4KI6A 1O13A 5FDLA 5KI6A 2RF2A 1NG9A 4CJSA 1T05A 1SKSA 3PIPL 4FJ7A 3NAEA 3HJFA 3OTOK 4ID5A 3H45C 1GLDG 3THXB 3O6WA 2VG7A 3LDOA 5M1OA 5BPLA 2ZGYA 4CJFA 2OPSA 3L0QA 1T03A 4FLXA 4DTRA 1QSLA 2G8VA 5KRSA 4O8UA 4QS7A 3CYMA 2OZSA 3U4LA 4QCLA 4JKCA 1HQEA 3RR7A 4NCAA 4WQ4C 3DRRA 3DWLA 4OKJA 3SMPA 1YIJN 1Y97A 5BRHA 4MLHA 3LALA 1FKPA 1RDDA 5TKWA 3IFRA 2YHXA 3A5LC 3HSTB 4BREA 3ASMA 4DV0K 4FJLA 1TYQB 4I2PA 3C6AA 2GUIA 4X64K 4JKEA 2WONA 3KK1A 2IIRA 3VGLA 3QEWA 1IH7A 4C1NK 3DLLL 1JCEA 1RILA 1HPMA 3L3UA 2UXBK 3BZKA 4W5OA 3DLGA 3ULEA 2HHQA 1IKWA 3LM9A 2V7YA 4GMJB 3D6RA 1S6PA 4DTMA 4NLBA 3MDQA 3M8RA 1CZBA 2D0PA 4ZTJA 4A57A 1YT3A 1REVA 3CFOA 3SBGA 4OKEA 3WXLA 1EWRA 4CEFA 5GAGP 4DR3K 3SI6A 5CYMA 4A59A 3OYMA 2G8KA 4HHTA 2P9LB 1M1KO 1BCOA 4U67L 3QFPA 4JI8K 4AQYK 3NVKA 4BR4A 4PL8A 4MO4A 5DM7L 4R5PA 2VG6A 4DFJA 4B9MA 4H5VA 2HB5A 1VSDA 3BF1A 2P9LA 3F2KA 3KLGA 3TAQA 3CETA 1QQCA 4UY8O 1KAZA 4OPAA 3QBXA 5E84A 3VQDA 4DSEA 5AQIA 4RW7A 4AM6A 4O5FA 4I9LA 4JI6K 4IJAA 4OPKA 2ZGZA 3O9SA 4F2RA 3CFRA 4CGGA 1ESVA 5FRMA 3L4IA 3SQ4A 3VF2A 3OBYA 4FWSA 1A5WA 2FLOA 1KLNA 2E1YA 1YVUA 2VWJA 2ATQA 4CIGA 5J2NA 1WSHA 4M45A 3SUNA 4FK2A 3OYEA 2ZM6K 1NKCA 4Z4FA 1JXEA 4LFBK 1LOTB 1YJNN 4JKHA 2BANA 3KLIA 3B8AX 4H8KA 3CQYA 4CZJA 4KB1A 3LZJA 4BG9A 2R7YA 1J5OA 4EIAA 4BGBA 2ETJA 3WQTA 4DTSA 4B9UA 4B1UB 3PLAA 3SUPA 1QQNA 2Z1HA 2ZF5O 1GOBA 3AGKA 4JI5K 1JL1A 1RBRA 2RN2A 1XWLA 2VGMA 3U6FA 3CCEN 4ISGA 4CVNE 1YHQN 1ZBHA 1HNZK 4ELUA 1OVQA 1MDUB 2XY5A 2QKKA 4BR7A 3G0ZA 4DWIA 5C25A 1N32K 3AO1A 1TVRA 3W3DA 3CXCM 4AHSA 4DSLA 3DAWA 4JI3K 2G8FA 2V52B 1KRPA 2FBXA 3KHYA 1KTQA 5F2RA 2FF6A 3G25A 2VWBA 4JI2K 4PUOA 4W5RA 5JS1A 1WNSA 1EETA 1ATNA 4CEBA 3O4NA 1N5YA 5CR4A 2J4RA 3P31A 1IJJA 3O8MA 3HP6A 4JN4A 4NXMK 2QWPA 4B8AB 2HBKA 1WBBA 3HOTA 4FSVA 4FLVA 2YHBA 4CE9A 5FPMA 1HNWK 1NGDA 4KREA 4JI1K 4YNQA 3HPGA 4GVEA 2NRHA 4YHHK 3V6DA 4DTXA 3IKMA 3M1FA 4Q5VA 4JV5K 4DF8A 2W41A 2FXUA 1IKYA 3K0SA 3I0SA 2O8BB 5IT9O 3KWIA 4C8LA 2DY4A 2P9PB 3V9ZA 1RGIA 5GIPA 3THWA 3L4QA 3QBWA 1TKXA 4K0KK 1J54A 4PL7A 2Q31A 4N56A 4CEZA
chains in the Genus database with same CATH topology
1NLVA 3ZYYX 1T6DA 2ZJRL 4M63C 4A5AA 2NRZA 4DKWA 2V51B 4BC5A 1HLUA 1S22A 4DB3A 1T44A 3VEXA 2E8AA 4FWLA 4FPBA 5EVZA 2QWNA 5AQGA 3OW2M 1KAYA 3SAFA 1K8KA 3CHWA 4A5BA 4RCHA 5BPMA 1Q81O 3CCVN 2KHOA 3ID8A 3TTCA 3CJ9A 2P9NB 4PKHA 5EY4A 3HZ6A 2P9IB 3ENBA 3OA9A 3CCMN 5F0XA 4CZEA 4K42A 3VF6A 3F5TA 2NRWA 3LM2A 4BRPA 1HKCA 4IOXA 3CC7N 3I33A 5BR9A 4WQ5A 1S3XA 1XQSC 5EX5A 5BREA 3UKRA 3D2FB 1QQMA 3QFUA 4HTLA 4JK7A 5LJWA 4GV6A 1BA1A 4IZ9A 3O5BA 5EXWA 2GEMA 1U2VB 3AGRA 1DT9A 1K8AO 3CC2N 2VGNA 4MDAA 5BN8A 3SMSA 2P9KB 4BC2A 3MWTA 3RSEB 3ZETA 3P4IA 1TUYA 2NNWA 4BC4A 2P9SA 4B1VA 3HSCA 2QTDA 4I6MB 4JKGA 4IO9L 2HSTA 1VQ4N 5LY3A 3VMFB 3O1BA 1JCGA 2I7NA 3S41A 3DXKA 1VQKN 2GELA 3PIOL 2Q2RA 3VTIA 4BRQA 4FWQA 5M1KA 2WFBA 1X3MA 1BDGA 2E2OA 3CJ7A 3DXMA 2NRTA 5AQJA 5KQDA 3CC4N 3HM8A 3P39A 3H1VX 3MN5A 4I6MA 2WUSA 3VEYA 5FPEA 4H03B 3CQXA 1EO1A 3LL3A 5ADXH 4BG8A 4DQ8A 3CPWM 2HF4A 2H3GX 1VQNN 2D1KA 3CCLN 1N8RO 3OHRA 3OBWA 1OVYA 2YHWA 4ILHA 4BRNA 1BWFO 3VTHA 5AZJB 2QEXN 3O08A 1BU6O 5KPRA 1K9MO 5AQKA 3UKUB 4WFNL 5MLCQ 1HKBA 3HTVA 3LDQA 1NGBA 4CJ7A 1KD1O 3VGKA 5GIOA 5AQNA 3BEXA 3IMXA 4XH5A 5LJVA 4CI6A 2AA4A 2QWRA 3O80A 2RE2A 3EN9A 5AQZA 3FZFA 4WFBL 4CD3A 4KH6A 5AQYA 4CZLA 2NZTA 4IEEA 4BRCA 3SAGA 4BC3A 1VQMN 5M1QA 5JVHL 3O1WA 4BR5A 5M1FA 3ID6A 4WCEL 5JLHA 2W40A 4BRFA 3WUHA 1NJIO 2VYPA 3WQUA 1VQON 2PAVA 4KH5A 3AAPA 4BR9A 3ULEB 1EQYA 5BRDA 4JAXA 1DEJA 1LCUA 4MLEA 4OPHA 3RVCA 3WEEA 4EFHA 1NBWA 1YAGA 2V7ZA 3R1XA 2ASPA 5AQHA 1R59O 3BP8A 4JKFA 3CJ1A 2EWSA 4JKBA 1YF5L 2QI2A 4BVPA 4CZIA 2HF3A 2OANA 1KAXA 2A40A 1GLBG 3Q7BA 2E2PA 5BRFA 4PHTX 3TU5A 3CCRN 2OTJN 4F9OA 4BRGA 5AQOA 4XEIA 3P38A 3ATUA 2D4WA 4FWKA 2KLAA 1E4FT 1Q18A 2YI1A 1YVNA 1QVGM 3BF3A 1MA9B 1W97L 3BUZB 1ZC6A 1ATRA 3E9PA 2YX6A 4XH4A 5AQLA 4KBOA 4LC9B 3WXIA 2WC9A 4YDUC 3FFKB 2FSJA 1QZ6A 3AY9A 3FGUA 4O8KA 1XC3A 3G71N 5M1PA 5AFUA 2FSNA 3ENHA 3D2EB 3R3LA 3FR0A 1KXPA 5AQXA 4CD1A 1RDWX 2A5XA 5AQRA 2IVOA 2P9PA 3F9MA 3M5RA 4B1ZA 3W0LA 3A0IX 1CZAN 5AQSA 5CHIA 1VAZA 4FWNA 5AFUH 2CH6A 4DHYA 3GE1A 2GWJA 2FSKA 2NRXA 3VERA 3MN7A 2ASMA 3D2EA 1SAZA 4C1NI 3CCJN 2VCPA 4GY2B 1RDUA 2E2NA 2OTLN 1GLFO 3E9LA 5HL7L 1BA0A 2CGLA 1VQ9N 1ILYA 4MO5A 4H0PA 1RFQA 4A2AA 3H46O 1NGEA 2HOEA 3A8YA 3C7NB 3H3NO 4IEIA 3U8XA 4JK9A 3ZX0A 4NB4A 4JD2B 2RHKA 4YOWA 4BRAA 1HX1A 4FL9A 5AR0A 1WOQA 4KH4A 2D0OA 3O9UA 2P9NA 2QWMA 3MN6A 4JHDB 2WBNA 2F9WA 2P9IA 3VOVA 3E1YA 1TUUA 5HOOA 4EHUA 1ATSA 3UE5A 1GLJO 3R8EA 3SLCA 3GBTA 3GOIA 4ILGB 3VESA 5C10A 3TTDA 4CZKA 3D2FA 4FVUA 3GG4A 1QHAA 5AQPA 4M7XA 2A3ZA 4Z94A 1Q82O 1BO5O 1U2VA 1BUPA 1YUWA 3MCPA 1VQ7N 1SS6A 1V4SA 2QWQA 3T69A 4IJNA 4B1WB 3ENOA 3CCUN 5KPZA 1X3NA 4E1JA 4WFAL 1ZBSA 2CGKA 2GWKA 3A5MC 5ADXA 4AF1A 3O9RA 2P9KA 3N4QA 3RSEA 4RTFD 5DM6L 3EO3A 2PFUA 3QICA 5GADP 2BH1A 4IOAL 4CBXA 3KK7A 4B9QA 5KPTA 1O13A 3MMVA 3Q7CA 2QWOA 3U9DA 1T3VA 4H0TB 1KQSM 4G9ZA 2IVNA 1IG8A 3PIPL 1Y64A 1HUXA 1DGKN 4A2BA 5M1NA 3H45C 1GLDG 2NRVA 2DPNA 4C23A 3FZHA 3FZKA 3O6WA 4BROA 1P90A 4FOIA 2NRRA 3LDOA 4H0VB 5M1OA 1GLCG 5BPLA 2ZGYA 3MN9A 4BRLA 2YJEA 4IWVA 2YJFA 1V4TA 5CE3A 3L0QA 3SAHA 2E20A 5AZIB 5GAEP 1NGJA 4EHTA 4CZMA 2Q36A 4O8UA 3CMEN 4QS7A 4WYBA 3U4LA 5GINA 4JKCA 3VEZA 2JWKA 4FO0A 2ZWHA 3M3ZA 4FPAA 1VQ5N 4WQ4C 5AZJA 3HBTA 3DWLA 3SMPA 1YIJN 5BRHA 3G4SN 3UKUA 1WUAA 4H5WA 1NGFA 3C65A 5JICA 4ILJA 4MLHA 1VQLN 3K9JA 2A41A 5TKWA 3IFRA 5AZIA 2YHXA 1QZ5A 3WXKA 3A5LC 4FWPA 4BREA 3E66A 1KC8O 2Q0RA 3KWGA 1TYQB 3C6AA 4BRKA 2ZJQL 4JKEA 3KZBA 3CJCA 2IIRA 2YHYA 3VGLA 4PKGA 4BQZA 2GX9A 4C1NK 3DLLL 1JCEA 3CMAN 1K73O 4HWIA 1HPMA 2HBMA 3IUCA 2IVPA 3J7ZO 4FOEA 4B1XB 4BVOA 3H6EA 3ULEA 1OKJA 3WT0A 3VGMA 3O4WA 4H0XB 3SK3A 3A5NC 4CBUA 3LM9A 4BRMA 5JMVA 2V7YA 1NMDA 3D6RA 3D7EO 4NLBA 4CZGA 5JLFA 1D4XA 5AQUA 2A42A 3MDQA 2D0PA 3TTFA 1G99A 4A57A 4BR0A 3SBGA 3FLCO 3NMUA 3C0BA 5FPDA 3WXLA 4M7YA 3EZWA 1MWKA 3A5OC 3JXUA 4ISEA 2P9UB 2BUPA 3NVMA 4A62A 5I9EB 3MWPA 5GAGP 3TSQA 3VENA 4A59A 4FWMA 3C6HA 1NM1A 4AM7A 4IFEA 2P9LB 1M1KO 4U67L 4BGAA 4B1YB 3QFPA 4YDUA 1YJWN 4BRDA 3NVKA 4BR4A 2QWLA 5H1SQ 3G6EN 4PL8A 1YJ9N 1MWMA 4MO4A 5E26A 5DM7L 4OO1J 2Q97A 4NO7A 5BN9A 2ITMA 3TPQA 4H5VA 4YOTA 1NGAA 4PKIA 2F7TA 2KKZA 5ELZA 3U9ZA 4K41A 1HJOA 3BF1A 5TKYA 1K8KB 2P9LA 3F2KA 4BRHA 5C12A 3CETA 4GV3A 1KAZA 3LDPA 4UY8O 1P8ZA 3ZX2A 5AQWA 4OPAA 3QBXA 5E84A 3LDNA 5C15A 5AQIA 4AM6A 2GUPA 3H1QA 4O5FA 3CCQN 4DCHA 4IJAA 4FWRA 1YI2N 2ZGZA 3O9SA 3SJHA 3K9KA 3UKRB 3O9TA 4U7BA 1C0GA 1ESVA 3L4IA 4WQ5C 1NWKA 3C7NA 3VF2A 5C2FA 1M90O 3OBYA 5AQVA 5JVGL 1U6ZA 4FWSA 2A6AA 4JD2A 3WXMB 2E2QA 2FLOA 4H5RA 3ZETB 2E1YA 4JHDA 3FZLA 2P9SB 4NLCA 2HBLA 1GLAG 3HRGA 4YOVA 1SQKA 4JKGB 3VEVA 1GLEG 4Y0WA 5AQQA 4H5NA 2Q0UA 3EE9A 4BQLA 4EAHD 1E4GT 1LOTB 1SZ2A 3L6QA 3DXKB 4JKHA 4RWTA 1YJNN 3VEWA 3B8AX 3QB0A 4IDHA 4K25A 2QXLA 3CQYA 4CZJA 3E9OA 4CZHA 3DXMB 1W2BM 1DKGD 1JCFA 4BG9A 1BG3A 1C0FA 5FPNA 3HI0A 4EIAA 4BGBA 5F1XA 4YOYA 3WQTA 1H1VA 2QW9A 4CBWA 1S72N 4B1UB 4ISFA 3HOSA 3PLAA 3UB5A 1QQNA 2ZF5O 1YXQA 3AGKA 4IXCA 1GLLO 4QS9A 2VGMA 3MX5A 3M6GA 5AQTA 3R6MA 3CCEN 4JK8A 4ISGA 3H3OB 3TSPA 2YCHA 3CD6N 1YHQN 2I7PA 1VQ6N 4CZFA 4JEPA 3N4PA 1MDUB 1ZXOA 2AP1A 5AQFA 4XH1A 4JNEA 4BR7A 3I8BA 4YOXA 3QDKA 1Z05A 1T6CA 3W3DA 5BPNA 3SBTA 3CXCM 3GL1A 3EKSA 3DJCA 2QM1A 4WF9L 3DAWA 5B8HA 5AQMA 2V52B 4A61A 4WQ4A 5EOYA 1XUPO 3CERA 3KHYA 3MCAB 1NGCA 1VQ8N 5F2RA 3VPZA 3VF4A 2FF6A 3IDHA 2CGJA 3G25A 3FZMA 2VWBA 5GAHP 3CF5L 3CJBA 4J8FA 1HKGA 1X9JA 1ATNA 4QS8A 3WEEB 5KQ8A 3CI5A 1BOTO 3TSUA 3ZX3A 5CR4A 3CCSN 3AAQA 1QVFM 3ZEUB 3CIPA 3QMLA 3AARA 3ATVA 3CPEA 2FF3B 2J4RA 2ZJPL 3EL2A 1Z6RA 3P31A 1TYQA 4JKDA 1JJ2M 5C0YA 1IJJA 3O8MA 4BY9C 4YOUA 3I55N 4JN4A 1YITN 2QWPA 2CH5A 2HBKA 3R9PA 3HOTA 2F9TA 4FWOA 3MX2A 4FSVA 4IO8A 3WXJA 4H0OA 5FPMA 2JWLA 1NGDA 4GV9A 3ZEUA 2E1ZA 4GVEA 1NGHA 2NRHA 3J8AA 5C2DA 1Q7YO 4YORA 4BR2A 2GTDA 3JS6A 4IOCL 3LDLA 1VQPN 3EKUA 1NGGA 2Q1NA 3IKMA 3M1FA 1NGIA 2NLXA 2UYTA 2BTFA 3VETA 3O9QA 2W41A 4H0YB 2HBJA 2FXUA 4JKAA 3CJAA 1J6ZA 3KWIA 3EE8A 2P9PB 2QA4N 1RGIA 4R79A 5GIPA 2E88A 2P9UA 4MDBA 2PBDA 2ASOA 3L4QA 3FE1A 3MK6A 3QBWA 3GDQA 3KVGA 4GNIA 4H5TA 4L3QA 4BRIA 3I56N 2HMPA 4K43A 3T7ZA 1Q86O 4PL7A 2Q31A 1QQOA 3VEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJR L;  5GAE P;  3CME N;  1YJN N;  3CCR N;  2OTJ N;  3OW2 M;  1VQ5 N;  1Q81 O;  3CCV N;  1YIJ N;  1W2B M;  3G4S N;  1QVG M;  1VQL N;  3CCM N;  1KC8 O;  1S72 N;  3G71 N;  3CC7 N;  2ZJQ L;  3CCE N;  3DLL L;  3CMA N;  1K73 O;  3CD6 N;  1K8A O;  1YHQ N;  3J7Z O;  1VQ6 N;  3CC2 N;  3CCJ N;  3CXC M;  2OTL N;  4IO9 L;  1VQ4 N;  5HL7 L;  4WF9 L;  1VQ9 N;  1ILY A;  1VQ8 N;  1VQK N;  3PIO L;  5GAH P;  3CF5 L;  5GAG P;  3CC4 N;  1M1K O;  4U67 L;  1YJW N;  5H1S Q;  3CCS N;  3G6E N;  1YJ9 N;  1QVF M;  5DM7 L;  2ZJP L;  3CPW M;  1JJ2 M;  1VQN N;  3I55 N;  1YIT N;  3CCL N;  1N8R O;  1OVY A;  2QEX N;  1Q82 O;  1VQ7 N;  4UY8 O;  3CCU N;  1K9M O;  4WFN L;  5MLC Q;  4WFA L;  1KD1 O;  1Q7Y O;  4IOC L;  1VQP N;  5DM6 L;  3CCQ N;  5GAD P;  4IOA L;  1YI2 N;  4WFB L;  1VQM N;  5JVH L;  1KQS M;  4WCE L;  3PIP L;  2QA4 N;  1M90 O;  1NJI O;  5JVG L;  1VQO N;  3I56 N;  1Q86 O; 
#chains in the Genus database with same CATH topology
 3ZYY X;  3K5M A;  4A5A A;  2V51 B;  4BC5 A;  4BDZ A;  2UUC K;  4DSI A;  1BQM A;  4DLE A;  4DQR A;  4RCH A;  4N47 A;  5EY4 A;  3ENB A;  5F0X A;  3F5T A;  4DU3 A;  4AHT A;  4DV4 K;  3VQ9 A;  4WQ5 A;  1JKH A;  1S3X A;  2G8W A;  3UKR A;  2FBT A;  4HTL A;  4CCH A;  4NYF A;  1UOC A;  2GEM A;  4LY7 A;  3VQ7 A;  4BWJ A;  3ZET A;  3RSE B;  2DTU A;  3P4I A;  2NNW A;  3LP2 A;  3HSC A;  1WSI A;  1WN7 A;  4IO9 L;  1VQ4 N;  3OYF A;  1S6Q A;  4CFB A;  1BGX T;  2I7N A;  3DXK A;  1E3M A;  3VTI A;  4FWQ A;  2F96 A;  3V1Q A;  3NFA A;  4O0I A;  3MN5 A;  3QLH A;  2WUS A;  2KFZ A;  5FPE A;  4OGC A;  2BDP A;  1EO1 A;  2Z1I A;  3CPW M;  4KHS A;  2KTQ A;  4EZ9 A;  1QE1 A;  1QSY A;  3V9W A;  3AA5 X;  3VTH A;  2QEX N;  1BU6 O;  4DFP A;  4IBN A;  3BDP A;  4B08 A;  1K9M O;  1Q9X A;  5MLC Q;  2GBZ A;  4CJ7 A;  3NH2 A;  3VGK A;  2PYL A;  2HHU A;  5AQZ A;  3EN9 A;  3T1Y K;  3MEE A;  3OS1 A;  4BC3 A;  5JVH L;  3O1W A;  4BR5 A;  2P1J A;  5JLH A;  4BRF A;  3WUH A;  4J2A A;  5C24 A;  1C1A A;  3SV4 A;  2PAV A;  4KH5 A;  4FW2 A;  1EQY A;  2OYQ A;  3AO5 A;  4FM0 A;  2OPQ A;  4EFH A;  3AVH A;  5BR8 K;  3DLE A;  4DR4 K;  5AQH A;  3VQQ A;  2YNH A;  1YF5 L;  2OAN A;  3THY B;  2E2P A;  3OY9 A;  5BRF A;  4B9S A;  4DR6 K;  4KHY A;  3MED A;  3P38 A;  2D4W A;  3NF9 A;  2XO7 A;  2YI1 A;  5LL6 Z;  3BF3 A;  1ZC6 A;  5AQL A;  4KBO A;  3FFK B;  3AY9 A;  3FGU A;  1HYV A;  3KKR A;  5M1P A;  1BIU A;  3E01 A;  1T7P A;  3M5R A;  4B1Z A;  3A0I X;  4UQG A;  1R0A A;  1VAZ A;  4FWN A;  1TKZ A;  2CH6 A;  3GE1 A;  3RMA A;  3V9U A;  1NJY A;  3MN7 A;  1RTH A;  4C1N I;  1SKW A;  2VCP A;  2OTL N;  4FW1 A;  1BA0 A;  2BE2 A;  2KW4 A;  4H0P A;  3UIQ A;  3U8X A;  4Z0U A;  3ZX0 A;  2HVH A;  5LMN K;  2RHK A;  4YOW A;  4BRA A;  1HJR A;  2QWM A;  4CFD A;  2WBN A;  2P9I A;  4DR1 K;  2F8T A;  3E1Y A;  1TUU A;  3R8E A;  2XHB A;  2EHG A;  4FJ5 A;  3TTD A;  4HUE A;  3GG4 A;  2A3Z A;  4Z94 A;  2GV9 A;  1U2V A;  1YUW A;  3LZI A;  3CCU N;  1LW0 A;  4IJN A;  3MXM A;  5KPZ A;  1UA1 A;  2CGK A;  1VSL A;  4AF1 A;  4FLW A;  4CIF A;  3O3F A;  4RTF D;  3HVR A;  3QIC A;  2BH1 A;  4JS4 A;  1WSE A;  4CBX A;  3J7A P;  3VQC A;  3KK7 A;  1J53 A;  3Q7C A;  3U9D A;  2QWO A;  3G10 A;  1N34 K;  2IVN A;  4FJJ A;  1IG8 A;  3HVT A;  2YKN A;  4A2B A;  4DV2 K;  4KI4 A;  3S9H A;  2NRV A;  3CFP A;  4JLH A;  1P90 A;  4FOI A;  2NRR A;  4H0V B;  1GLC G;  3U3Y A;  2YJE A;  5CE3 A;  2PY5 A;  2E20 A;  2O8F B;  1NGJ A;  2Q36 A;  5KGX A;  5GIN A;  1HR0 K;  4FO0 A;  3S3M A;  4DFK A;  5AJ3 K;  3TAF A;  3DM2 A;  1VQL N;  3CM5 A;  4ILJ A;  4JRQ A;  3E66 A;  1UWB A;  2YNF A;  1G15 A;  1IBL K;  3ZLJ A;  1RT7 A;  2ZJQ L;  1WLJ A;  1X9M A;  3CJC A;  2YHY A;  2VQE K;  4DR5 K;  4PKG A;  4FM1 A;  5C42 A;  4HWI A;  3OJU A;  1WAF A;  1XHX A;  3IUC A;  4J2E A;  3J7Z O;  4KPY A;  4QAG A;  4BVO A;  2Y1I A;  1HNX K;  4B3T K;  1JLC A;  3VGM A;  3SV3 A;  1CXU A;  3A5N C;  4CBU A;  5JMV A;  1BI4 A;  1S9E A;  4PA1 A;  4CZG A;  1D4X A;  5AQU A;  2A42 A;  1G99 A;  1NK7 A;  4W5Q A;  4KO0 A;  3AVM A;  2OCE A;  1IBK K;  4ELV A;  3NMU A;  3C0B A;  3DYA A;  3EZW A;  1MWK A;  3A5O C;  1NK5 A;  2BUP A;  4A62 A;  3MWP A;  1S1X A;  2AJQ A;  3DLR A;  1DTT A;  1NM1 A;  4IG3 A;  4BRD A;  5H1S Q;  4DS4 A;  3G6E N;  2KZM A;  1MWM A;  5E26 A;  3S3N A;  4FJG A;  1ASW A;  4YOT A;  1NGA A;  4LH5 A;  3AVI A;  1OH7 A;  1VK0 A;  3T19 A;  4RW4 A;  1K8K B;  5TKY A;  4GV3 A;  1P8Z A;  4HTU A;  1X1P A;  1WSG A;  4CJP A;  5C15 A;  4C8K A;  2GUP A;  1C1C A;  4I9Q A;  1YI2 N;  1A5V A;  1HPZ A;  3O9T A;  1FW6 A;  1T8E A;  4CHY A;  4WQ5 C;  4FJN A;  1NWK A;  3C7N A;  4N41 A;  5AQV A;  1KVB A;  3ZSX A;  1U6Z A;  4JD2 A;  2HHH K;  1ZBF A;  4H5R A;  4DTU A;  4FXD A;  1WAJ A;  4NLC A;  1N36 K;  3HRG A;  4YOV A;  4CK2 A;  4CJU A;  1VSM A;  4DF4 A;  3LP1 A;  1E4G T;  1SZ2 A;  3L6Q A;  4KTZ A;  3QB0 A;  2QXL A;  2W42 A;  4CZH A;  1W2B M;  4Y1C A;  1DKG D;  1C0U A;  1JCF A;  5FRN A;  3SYZ A;  3HI0 A;  2X6N A;  1KFD A;  1VSK A;  3I8D A;  1H1V A;  2QW9 A;  1LW2 A;  5T7B A;  5IWA K;  3UB5 A;  2ZD1 A;  1IG9 A;  1HYS A;  1GLL O;  2OPR A;  3VQ6 A;  3R6M A;  1IKV A;  4RW9 A;  2I7P A;  4CZF A;  4JEP A;  2I5J A;  3THX A;  3NGI A;  1TV6 A;  4O55 A;  4YOX A;  4DLG A;  3GL1 A;  1I94 K;  2QM1 A;  4WF9 L;  5EOY A;  3MCA B;  1VQ8 N;  5GAH P;  1Z26 A;  3CJB A;  4Z4I A;  1S1V A;  1VHX A;  5KQ8 A;  1BOT O;  3CCS N;  2ZQB A;  3CIP A;  3QML A;  3CPE A;  2FF3 B;  1TYQ A;  2HW3 A;  3OS0 A;  3L2U A;  4BY9 C;  3AA4 A;  3P5J A;  1KSP A;  2F9T A;  4FWO A;  3OS2 A;  4IO8 A;  3RRG A;  4H0O A;  4GV9 A;  3I0R A;  3ZT4 A;  1NGH A;  3SQ0 A;  3J8A A;  1LV5 A;  1Q7Y O;  2G8H A;  3JS6 A;  2BGG A;  3EKU A;  1I39 A;  3LPU A;  3C94 A;  3EE8 A;  2QA4 N;  4FLU A;  4R79 A;  3PX0 A;  3F73 A;  1X9S A;  4MDB A;  2PBD A;  3MK6 A;  3FE1 A;  4JYA K;  4L3Q A;  4H5T A;  3ZSZ A;  2B4J A;  4LFA K;  5CYQ A;  3VEO A;  3K5O A;  1NLV A;  2ZJR L;  2NRZ A;  1ITG A;  4I2Q A;  1HLU A;  4DB3 A;  5I3U A;  2HND A;  1TL1 A;  3ISN C;  3EYZ A;  5E41 A;  4N76 A;  4FPB A;  5EVZ A;  4WE1 A;  4BWM A;  3OW2 M;  1TK8 A;  3ZSY A;  4A5B A;  5BPM A;  1Q81 O;  3MEC A;  4J2D A;  2P9N B;  5KGW A;  2OZM A;  5J2Q A;  1N33 K;  3DMJ A;  3EY1 A;  1N6Q A;  4BRP A;  4G1Q A;  1VSF A;  1VSJ A;  1L3T A;  1XI1 A;  4DR2 K;  1XQS C;  5HRR A;  5LJW A;  4GV6 A;  4JK7 A;  1TKT A;  1BA1 A;  3O5B A;  4FJH A;  3OYB A;  2E6L A;  2OPP A;  4NYN A;  1EWQ A;  1U45 A;  3CC2 N;  5BN8 A;  3SMS A;  1TUY A;  1ASV A;  4BC4 A;  1BCM A;  4E7I A;  2QTD A;  4I6M B;  4Z4E A;  3VMF B;  3NCI A;  4KHW A;  2VQF K;  1JCG A;  3S41 A;  4HVJ A;  1VQK N;  2GEL A;  2Q2R A;  3LAK A;  1Q9Y A;  4FJK A;  4DTP A;  3AO4 A;  1X3M A;  1BDG A;  2E2O A;  3CJ7 A;  3VQE A;  1NOZ A;  3CC4 N;  3P39 A;  4I6M A;  4H03 B;  4BG8 A;  4DQ8 A;  3QIP A;  1RT4 A;  1VQN N;  4AIL C;  3CCL N;  1JLQ A;  3AVL A;  3QO9 A;  4KB0 A;  4BRN A;  4ILH A;  5HRN A;  3NDK A;  5AZJ B;  3HPH A;  1RDC A;  3UKU B;  3OYK A;  5A2Q O;  1HNI A;  3HTV A;  4KV8 A;  4CJ5 A;  3VA3 A;  2HHW A;  1KD1 O;  3TWH A;  3NH1 A;  5AQN A;  3BEX A;  5LJV A;  4CHN A;  5AQY A;  1KVC A;  3SAG A;  3OYA A;  4FYD A;  3D45 A;  1U04 A;  3ID6 A;  1XHZ A;  2O8C B;  2JLE A;  2VYP A;  3WQU A;  1VQO N;  4BR9 A;  3ZSR A;  1DEJ A;  1LCU A;  3RVC A;  4OPH A;  1NBW A;  2ASP A;  3NGY A;  2HHT A;  5D3G A;  4JKF A;  1JLG A;  2QI2 A;  3QNN A;  4V19 S;  1BHL A;  4DR7 K;  2XY8 A;  3TU5 A;  4PHT X;  3QER A;  4M3R A;  4FWK A;  3K57 A;  3PSI A;  4K8X A;  1YVN A;  3SJJ A;  1ATR A;  4FM2 A;  4FCY A;  2WC9 A;  3SQ1 A;  2YNG A;  4AHC A;  2FSN A;  3R3L A;  5AQX A;  4DUZ K;  1KXP A;  4KHN A;  4CED A;  4FVM A;  2O8B A;  2P9P A;  3F9M A;  3W0L A;  5CHI A;  1CZA N;  3QEX A;  3U3G A;  1LWC A;  2O8E B;  1S1T A;  1IV0 A;  2NRX A;  4PQU A;  1RDU A;  1GLF O;  5HL7 L;  4MO5 A;  4BE0 A;  4A2A A;  4X62 K;  2HOE A;  4M3X A;  2E4L A;  4JK9 A;  2D0A A;  2A1R A;  3T1H K;  1VSH A;  1HX1 A;  4FL9 A;  4DU4 A;  1D5A A;  3AVG A;  4JHD B;  5DK5 A;  4EHU A;  4CGD A;  1RT1 A;  1RBS A;  1GLJ O;  3PUF A;  4OPJ A;  3DLH A;  3VES A;  3K5L A;  3EEQ A;  3O3G A;  4E1M A;  1BO5 O;  3KJV A;  3T69 A;  1V4S A;  2QWQ A;  4O5B A;  4KHP K;  3ENO A;  5HRS A;  3V9S A;  1X3N A;  4E1J A;  1EX4 A;  5J2M A;  1TAQ A;  4DV7 K;  3V81 A;  1HQU A;  3RSE A;  3HL8 A;  4IFY A;  1KCF A;  4B9Q A;  3MMV A;  2UUA K;  4H0T B;  1GOA A;  3ITH A;  1Y64 A;  1K6Y A;  2JGU A;  1RDB A;  1XNQ K;  1HUX A;  2DPN A;  2UXD K;  3FZH A;  1U48 A;  1EP4 A;  3MN9 A;  4BRL A;  1LWE A;  4IWV A;  1NNE A;  4CJL A;  3SAH A;  1DTQ A;  4E19 A;  5GAE P;  4EHT A;  4CZM A;  2O8D B;  1BIZ A;  4WYB A;  4HCC A;  4CK3 A;  2ZWH A;  3KLF A;  3M3Z A;  4FPA A;  1GOC A;  3HBT A;  4B9T A;  1NK6 A;  1SL0 A;  4DSF A;  4H5W A;  1NGF A;  3C65 A;  3QEI A;  4ELT A;  3K9J A;  2ZE2 A;  2A41 A;  4DV5 K;  1QZ5 A;  3QEV A;  4EP5 A;  3RMC A;  3BY5 A;  1KC8 O;  2Q0R A;  3KWG A;  2O8D A;  3C95 A;  3LWL A;  3F9K A;  4BRK A;  4IKF A;  3KZB A;  3QIO A;  1X9W A;  2Z1G A;  2GX9 A;  1S5J A;  3KLE A;  3CMA N;  3TAN A;  4CES A;  1QSS A;  2IVP A;  4CF8 A;  4FOE A;  3TAM A;  1Z25 A;  1L5U A;  3H6E A;  2XY7 A;  1OKJ A;  3DOK A;  4H0X B;  3SK3 A;  3VQ5 A;  2XRI A;  3D7E O;  5JLF A;  3EZ5 A;  2HHS A;  3VQB A;  2X78 A;  1Q8I A;  5EU7 A;  3FLC O;  3SNN A;  3THY A;  3KTQ A;  4M7Y A;  3JXU A;  4ISE A;  2P9U B;  1D9F A;  4J2B A;  3TSQ A;  3VEN A;  4CW7 B;  3C6H A;  3AVA A;  4IFE A;  4FJM A;  1YJW N;  1YJ9 N;  3AVN A;  4OO1 J;  1B92 A;  5DMR A;  2Q97 A;  4NO7 A;  1JXB A;  2KQ2 A;  5BN9 A;  2ITM A;  3VQA A;  2F7T A;  4LSL A;  1C0T A;  2KKZ A;  5ELZ A;  3VQ8 A;  4CEQ A;  4EP4 A;  1HJO A;  4EZ6 A;  3LAM A;  4BRH A;  5C12 A;  3SZ2 A;  3O4Q A;  3LDN A;  3ZSW A;  2KZZ A;  3JAM O;  4DCH A;  3SJH A;  3K9K A;  3NH0 A;  1WBD A;  5HBM A;  1ASU A;  5C2F A;  1M90 O;  1VRU A;  5JVG L;  3WNF A;  2A6A A;  1WB9 A;  2FC0 A;  3FZL A;  1RCH A;  2P9S B;  2HBL A;  1GLA G;  1SQK A;  4JKG B;  3VEV A;  1S9G A;  1GLE G;  5AQQ A;  2Q0U A;  2RPI A;  1RT2 A;  3EE9 A;  4BQL A;  3OYG A;  4EAH D;  3L2V A;  3VEW A;  1JLE A;  4IDH A;  2IDO A;  1O1W A;  3E9O A;  1SUQ A;  1LAV A;  3DXM B;  4IDK A;  1BG3 A;  4OVL A;  1ZYQ A;  5F1X A;  4CHZ A;  1UA0 A;  4CBW A;  1XNR K;  1YXQ A;  4QS9 A;  1EKE A;  3H3O B;  2B5J A;  4YFU A;  2KFN A;  3TSP A;  2YCH A;  3PO4 A;  1TK5 A;  4E7H A;  2W6L A;  3C6T A;  3RMD A;  2AP1 A;  5AQF A;  1B9F A;  4JNE A;  5HLF A;  4FLT A;  1Z05 A;  4DFM A;  3DOL A;  5BPN A;  4FJ9 A;  3EKS A;  3DJC A;  5B8H A;  4DG1 A;  5J2P A;  4A61 A;  4E89 A;  2O8F A;  1XUP O;  4DV6 K;  1NGC A;  3VPZ A;  3VF4 A;  4QOZ B;  3OYD A;  4J8F A;  1X9J A;  4CGI A;  2D5R A;  3WEE B;  3ZCM A;  1HNV A;  3TSU A;  3ZX3 A;  1HYZ A;  3AAQ A;  3ATV A;  3EL2 A;  3B6P A;  4M3T A;  4JKD A;  1ZBI A;  5C0Y A;  4CF2 A;  3M8S A;  4JS5 A;  1KFS A;  2DFF A;  3R9P A;  1FJG K;  1L3S A;  4OX9 K;  3WXJ A;  1NU0 A;  2JWL A;  2UUB K;  2QXF A;  1TL3 A;  2E1Z A;  1OH8 A;  5C2D A;  1EXQ A;  4BR2 A;  4YY3 K;  4IOC L;  2QKB A;  3LDL A;  2NLX A;  4B3R K;  1NK8 A;  1JL2 A;  1JLF A;  3ULD A;  2HBJ A;  4JKA A;  3C6U A;  4B9V A;  2D0C A;  4JI7 K;  2ASO A;  4BDY A;  3KVG A;  1CZ9 A;  3I56 N;  4BE2 A;  2HMP A;  4E7J A;  3BZC A;  4MFB A;  4DQP A;  4FWP A;  1QQO A;  2VWK A;  4CGJ A;  3TAR A;  3M8P A;  3RR8 A;  3AVK A;  1T44 A;  5HRP A;  3VEX A;  4LD0 A;  2G8U A;  3L2R A;  1KAY A;  4JI4 K;  3K58 A;  3AVF A;  1K8K A;  2A1S A;  3HXM A;  2WTU A;  4C8O A;  4NXN K;  3L2Q A;  4B9N A;  3ID8 A;  1NK0 A;  3CJ9 A;  3V1O A;  3HZ6 A;  3OA9 A;  3CCM N;  1SL2 A;  4HCB A;  3ZT3 A;  4K42 A;  1NOY A;  4LF8 K;  1LAW A;  4HUG A;  1NKB A;  4W5N A;  1NJW A;  3I33 A;  4GVM A;  5JS2 A;  3AA2 A;  3D2F B;  1QQM A;  3NF7 A;  3T3F A;  2QK9 A;  4IZ9 A;  1MU2 A;  3S3O A;  2O4G A;  1K8A O;  4MDA A;  1VRT A;  4B8C A;  2UU9 K;  1BL3 A;  2YNI A;  2P9K B;  4BC2 A;  4DU1 A;  3MWT A;  1A5X A;  4FZZ A;  4KKO A;  2HST A;  3P83 D;  1WSJ A;  4CJQ A;  3RRH A;  4O44 A;  4FJ8 A;  4F4K A;  5HRO A;  4BRQ A;  5LMU K;  3QNO A;  4TSX A;  5KQD A;  3HM8 A;  3DRS A;  1VSE A;  3VEY A;  3PX4 A;  5ADX H;  1U49 A;  2HF4 A;  2H3G X;  3NE6 A;  3V1R A;  1U4B A;  3NF8 A;  3OHR A;  3OBW A;  3OYL A;  1OVY A;  2YHW A;  1IBM K;  1NJZ A;  3OYJ A;  3PV8 A;  3O08 A;  3KKS A;  5KPR A;  1JLB A;  3SPZ A;  4WFN L;  4CJ4 A;  1HKB A;  2P51 A;  3LDQ A;  4LFC K;  4XH5 A;  3O80 A;  2RE2 A;  2WOM A;  3MAQ A;  4WFB L;  4CD3 A;  4CZL A;  2NZT A;  5M1Q A;  2P5O A;  4WCE L;  1NJI O;  1S1W A;  3ULE B;  4CHO A;  4MLE A;  4DMN A;  1YAG A;  2FBY A;  4B3S K;  3SQ2 A;  4M3Y A;  1BIS A;  2EWS A;  2IC3 A;  4JKB A;  4CZI A;  2HF3 A;  3JSM A;  4B9L A;  2IS3 A;  3IAY A;  1KAX A;  2A40 A;  2G8I A;  1GLB G;  1WSF A;  3Q7B A;  4BDP A;  4AH9 A;  2OTJ N;  4F9O A;  4BRG A;  5AQO A;  4XEI A;  4AHR A;  1CXQ A;  3ATU A;  2KLA A;  1J9A A;  1Q18 A;  1QVG M;  1W97 L;  3BUZ B;  2YX6 A;  3FFI A;  3V9X A;  4DUY K;  4CEA A;  2YV0 X;  2FSJ A;  4LF9 K;  3HK2 A;  4CHQ A;  1XC3 A;  3G71 N;  4M41 A;  3ENH A;  3FR0 A;  2YHA A;  2HMI A;  3MXI A;  3KIO A;  2A5X A;  5AQR A;  2IVO A;  5AQS A;  3TAG A;  2UXC K;  4O4G A;  4CJW A;  3RWU A;  2PYJ A;  4DHY A;  2FSK A;  1OH6 A;  3CCJ N;  4OJR A;  2CGL A;  1ILY A;  3J7Y P;  1L3U A;  3AV9 A;  3H46 O;  1NGE A;  3VA0 A;  3A8Y A;  4IEI A;  1YTA A;  1WOQ A;  2D0O A;  3O9U A;  2P9N A;  3MN6 A;  2E5L K;  2F9W A;  3TAB A;  3DLB A;  3L3V A;  4Q0B A;  4DSJ A;  4Z4C A;  4M42 A;  3SLC A;  3LPT A;  5C10 A;  4CZK A;  1QHA A;  4I7F A;  3VN5 A;  1QTM A;  1B9D A;  1FKO A;  3MCP A;  3ZSO A;  2IOC A;  4OLA A;  1ZBS A;  3MEG A;  3A5M C;  3ZT2 A;  4LF4 K;  3O9R A;  3N4Q A;  5DM6 L;  3EO3 A;  1ZBL A;  5GAD P;  5I42 A;  3K5N A;  3NF6 A;  1KLM A;  1SV5 A;  5KPT A;  2F8S A;  1T3V A;  1KQS M;  4G9Z A;  4ZHR A;  4ID1 A;  4CJ3 A;  4DTO A;  1DGK N;  1RT5 A;  4DQQ A;  4K8Z A;  5M1N A;  3NBP A;  3AVB A;  4C23 A;  3HO1 A;  3FZK A;  4BRO A;  3T1A A;  3DRP A;  2EX3 A;  3VQP A;  2YJF A;  1DLO A;  1V4T A;  2F4V K;  1I3A A;  5AZI B;  4CEO A;  3CME N;  4XIU A;  3KK3 A;  3VEZ A;  3BGR A;  4PWD A;  2JWK A;  4F3O A;  4FJI A;  1VQ5 N;  5AZJ A;  3G4S N;  3UKU A;  3HT3 A;  1WUA A;  5JIC A;  5AZI A;  3WXK A;  5SZT A;  2HHX A;  3K59 A;  4KHU A;  1IO2 A;  1W7A A;  4F2S A;  3ZT0 A;  1QHT A;  4BQZ A;  1K73 O;  3SPY A;  5K14 A;  5HP1 A;  4KTQ A;  2HBM A;  2OA8 A;  3NGZ A;  1J5E K;  2O8C A;  2O4I A;  4B1X B;  3WT0 A;  3O4W A;  3ZSV A;  3LAN A;  4BRM A;  4BAC A;  1NMD A;  4Z4G A;  3J81 O;  3TTF A;  4BR0 A;  2IAJ A;  4F3T A;  5FPD A;  5FLX O;  3NVM A;  3THW B;  5I9E B;  5SWM A;  1NKE A;  4FWM A;  3ALY A;  1NJX A;  4AM7 A;  3PSF A;  4BGA A;  4B1Y B;  4YDU A;  3M8Q A;  2QWL A;  4OGE A;  2LSN A;  1W9H A;  3TPQ A;  3J80 O;  1RT6 A;  4CJV A;  4CF9 A;  4PKI A;  4DSK A;  3U9Z A;  4K41 A;  3VQ4 A;  4CER A;  3HYF A;  3LP3 A;  3AVJ A;  1NK4 A;  4L8R B;  3LDP A;  3ZX2 A;  5AQW A;  1NK9 A;  2O8E A;  3H1Q A;  1S1U A;  3KLH A;  1LWF A;  3CCQ N;  4FWR A;  1IKX A;  2W6K A;  3UKR B;  4U7B A;  1RNH A;  4GW6 A;  5KTQ A;  3RTV A;  4X65 K;  1TGO A;  1C0G A;  3AO2 A;  3WXM B;  2E2Q A;  4CGF A;  4N5S A;  3ZET B;  1BQN A;  4JHD A;  4CFA A;  4GKJ K;  4M3W A;  3HPO A;  1UAX A;  5J1E A;  4Y0W A;  4FK4 A;  4H5N A;  4CK1 A;  4HUF A;  2YKM A;  3KK2 A;  4RWT A;  3DXK B;  4OKK A;  4K25 A;  1TK0 A;  2XY6 A;  1D9D A;  1FK9 A;  4B3M K;  1C0F A;  5FPN A;  4YOY A;  4CHP A;  4LF5 K;  1S72 N;  4ISF A;  3HOS A;  3NHG A;  1RBV A;  4IXC A;  4OLB A;  3MX5 A;  3M6G A;  5AQT A;  4JK8 A;  4Y1D A;  1SL1 A;  2HNZ A;  3CD6 N;  1KVA A;  1VQ6 N;  1YTU A;  3N4P A;  4CF0 A;  1ZXO A;  4XH1 A;  3QES A;  3I8B A;  4GKK K;  3DI6 A;  3QDK A;  1T6C A;  3SBT A;  3THV A;  3TAE A;  5AQM A;  3MXJ A;  4FK0 A;  4C8M A;  4WQ4 A;  3QEP A;  3CER A;  3JYT A;  5CZ2 A;  4DQS A;  3IDH A;  2CGJ A;  3FZM A;  3CF5 L;  3OYI A;  4LSN A;  1HKG A;  1HRH A;  4QS8 A;  3CI5 A;  1QVF M;  3ZEU B;  4DS5 A;  3RMB A;  3AAR A;  2ZJP L;  1Z6R A;  1JJ2 M;  4DTJ A;  3WNG A;  4YOU A;  3I55 N;  1YIT N;  4DV3 K;  2CH5 A;  3HP9 A;  3MX2 A;  5CY4 A;  4KRF A;  3ZEU A;  4B3O A;  3ZT1 A;  4Z4H A;  4KHQ A;  3A2F A;  3IRX A;  4YOR A;  3OYH A;  2GTD A;  1VQP N;  3TI0 A;  1XMO K;  1NGG A;  2Q1N A;  1NGI A;  2UYT A;  2BTF A;  2RKI A;  3VET A;  3O9Q A;  4RG8 A;  4H0Y B;  3CJA A;  1J6Z A;  2E88 A;  2P9U A;  4ICL A;  4GNI A;  3GDQ A;  4BRI A;  3AO3 A;  3PY8 A;  1NMN A;  4E0D A;  4CJR A;  4K43 A;  3T7Z A;  1Q86 O;  1T6D A;  4PY5 A;  4M63 C;  4CJE A;  4DKW A;  2ITG A;  1S22 A;  4FLZ A;  2HVI A;  3K2P A;  3LDS A;  4W5T A;  2E8A A;  4FZY A;  4FWL A;  2E6M A;  3WNE A;  4LF6 K;  2QWN A;  5AQG A;  2DFH A;  2NUB A;  3SAF A;  4E7K A;  3CHW A;  3CCV N;  2KHO A;  3TTC A;  2Z1J A;  4PKH A;  4E3S A;  2P9I B;  4LH4 A;  1JLA A;  4BE1 A;  4CZE A;  3HM9 A;  3VF6 A;  2NRW A;  4H4O A;  3LM2 A;  3KD1 E;  4CJT A;  4H4M A;  3AA3 A;  1HKC A;  4IOX A;  3OYN A;  1RTI A;  3OYC A;  5BR9 A;  3CC7 N;  5BRE A;  5EX5 A;  3QFU A;  3V4I A;  2B6A A;  5EXW A;  1U2V B;  3AGR A;  1DT9 A;  2D0B A;  3IG1 A;  2VGN A;  3CM6 A;  4FLY A;  2HNY A;  3SCX A;  2P9S A;  3LP0 A;  4B1V A;  3QET A;  4JKG A;  5LY3 A;  4AHU A;  3CQ8 A;  4RW8 A;  3O1B A;  3H08 A;  2X6S A;  3PIO L;  1CLQ A;  2Y1J A;  3IS9 A;  4ZTF A;  4JRP A;  5M1K A;  3CG7 A;  3L8B A;  2WFB A;  5KRT A;  3DXM A;  5AQJ A;  2PZS A;  2NRT A;  3H1V X;  4DV1 K;  1C6V A;  4IG0 A;  4LF7 K;  4CJK A;  2Q3S A;  3CQX A;  5FRO A;  3LL3 A;  4NCB A;  4IFV A;  2D1K A;  1RTD A;  4DTN A;  3PX6 A;  4CEE A;  1N8R O;  4NCG A;  3B6O A;  4X66 K;  1BWF O;  5AQK A;  3KD5 E;  1RBU A;  1RTJ A;  1RDA A;  1NGB A;  4CGH A;  3O3H A;  4CF1 A;  5GIO A;  3IMX A;  4CI6 A;  2AA4 A;  2QWR A;  3FZF A;  4KFB A;  4KH6 A;  4IEE A;  4BRC A;  1VQM N;  1VSI A;  4RW6 A;  5M1F A;  2W40 A;  4C8N A;  4MQ3 A;  1QS4 A;  3TAP A;  1FXX A;  1L3V A;  4E1N A;  3AAP A;  5BRD A;  4JAX A;  1U47 A;  2FBV A;  3WEE A;  3DLK A;  1BI4 B;  2V7Z A;  3R1X A;  1R59 O;  3BP8 A;  3CJ1 A;  4BVP A;  3WNH A;  4DQI A;  1C1B A;  4JI0 K;  3CCR N;  1E4F T;  1MA9 B;  3E9P A;  4XH4 A;  1OH5 A;  3WXI A;  4LC9 B;  4KTW A;  4YDU C;  1QZ6 A;  4O8K A;  3L2W A;  4AHV A;  5AFU A;  4CD1 A;  3D2E B;  1HMV A;  4F8R A;  1ZBU A;  2HHV A;  1RDW X;  1W0H A;  1C0M A;  2VG5 A;  5AFU H;  3PO5 A;  4CFC A;  2IGI A;  2GWJ A;  3SUQ A;  3VER A;  3SUO A;  1TKD A;  2ASM A;  3D2E A;  1SAZ A;  4KAZ A;  4E7L A;  4GY2 B;  4CEC A;  2E2N A;  1D8Y A;  3E9L A;  3AVC A;  1VQ9 N;  1RFQ A;  3LWM A;  3C7N B;  3H3N O;  4NB4 A;  4JD2 B;  2X74 A;  4M3Z A;  5AR0 A;  4KH4 A;  2DFE A;  2P5G A;  1RBT A;  4FJX A;  3VOV A;  5CZ1 A;  5HOO A;  3P1G A;  1ATS A;  3UE5 A;  3TR8 A;  3GBT A;  1F21 A;  3GOI A;  4ILG B;  4FZX C;  4M3U A;  3D2F A;  4FVU A;  4CIE A;  5AQP A;  3OJS A;  4M7X A;  1Q82 O;  1BUP A;  1SKR A;  1VQ7 N;  1SS6 A;  1XC9 A;  4B1W B;  3QIN A;  4O0J A;  1TAU A;  4WFA L;  2GWK A;  5ADX A;  2P9K A;  3OVN A;  3ZSQ A;  2PFU A;  4IOA L;  3D0P A;  1XMQ K;  1RT3 A;  4KI6 A;  1O13 A;  5FDL A;  5KI6 A;  2RF2 A;  1NG9 A;  4CJS A;  1T05 A;  1SKS A;  3PIP L;  4FJ7 A;  3NAE A;  3HJF A;  3OTO K;  4ID5 A;  3H45 C;  1GLD G;  3THX B;  3O6W A;  2VG7 A;  3LDO A;  5M1O A;  5BPL A;  2ZGY A;  4CJF A;  2OPS A;  3L0Q A;  1T03 A;  4FLX A;  4DTR A;  1QSL A;  2G8V A;  5KRS A;  4O8U A;  4QS7 A;  3CYM A;  2OZS A;  3U4L A;  4QCL A;  4JKC A;  1HQE A;  3RR7 A;  4NCA A;  4WQ4 C;  3DRR A;  3DWL A;  4OKJ A;  3SMP A;  1YIJ N;  1Y97 A;  5BRH A;  4MLH A;  3LAL A;  1FKP A;  1RDD A;  5TKW A;  3IFR A;  2YHX A;  3A5L C;  3HST B;  4BRE A;  3ASM A;  4DV0 K;  4FJL A;  1TYQ B;  4I2P A;  3C6A A;  2GUI A;  4X64 K;  4JKE A;  2WON A;  3KK1 A;  2IIR A;  3VGL A;  3QEW A;  1IH7 A;  4C1N K;  3DLL L;  1JCE A;  1RIL A;  1HPM A;  3L3U A;  2UXB K;  3BZK A;  4W5O A;  3DLG A;  3ULE A;  2HHQ A;  1IKW A;  3LM9 A;  2V7Y A;  4GMJ B;  3D6R A;  1S6P A;  4DTM A;  4NLB A;  3MDQ A;  3M8R A;  1CZB A;  2D0P A;  4ZTJ A;  4A57 A;  1YT3 A;  1REV A;  3CFO A;  3SBG A;  4OKE A;  3WXL A;  1EWR A;  4CEF A;  5GAG P;  4DR3 K;  3SI6 A;  5CYM A;  4A59 A;  3OYM A;  2G8K A;  4HHT A;  2P9L B;  1M1K O;  1BCO A;  4U67 L;  3QFP A;  4JI8 K;  4AQY K;  3NVK A;  4BR4 A;  4PL8 A;  4MO4 A;  5DM7 L;  4R5P A;  2VG6 A;  4DFJ A;  4B9M A;  4H5V A;  2HB5 A;  1VSD A;  3BF1 A;  2P9L A;  3F2K A;  3KLG A;  3TAQ A;  3CET A;  1QQC A;  4UY8 O;  1KAZ A;  4OPA A;  3QBX A;  5E84 A;  3VQD A;  4DSE A;  5AQI A;  4RW7 A;  4AM6 A;  4O5F A;  4I9L A;  4JI6 K;  4IJA A;  4OPK A;  2ZGZ A;  3O9S A;  4F2R A;  3CFR A;  4CGG A;  1ESV A;  5FRM A;  3L4I A;  3SQ4 A;  3VF2 A;  3OBY A;  4FWS A;  1A5W A;  2FLO A;  1KLN A;  2E1Y A;  1YVU A;  2VWJ A;  2ATQ A;  4CIG A;  5J2N A;  1WSH A;  4M45 A;  3SUN A;  4FK2 A;  3OYE A;  2ZM6 K;  1NKC A;  4Z4F A;  1JXE A;  4LFB K;  1LOT B;  1YJN N;  4JKH A;  2BAN A;  3KLI A;  3B8A X;  4H8K A;  3CQY A;  4CZJ A;  4KB1 A;  3LZJ A;  4BG9 A;  2R7Y A;  1J5O A;  4EIA A;  4BGB A;  2ETJ A;  3WQT A;  4DTS A;  4B9U A;  4B1U B;  3PLA A;  3SUP A;  1QQN A;  2Z1H A;  2ZF5 O;  1GOB A;  3AGK A;  4JI5 K;  1JL1 A;  1RBR A;  2RN2 A;  1XWL A;  2VGM A;  3U6F A;  3CCE N;  4ISG A;  4CVN E;  1YHQ N;  1ZBH A;  1HNZ K;  4ELU A;  1OVQ A;  1MDU B;  2XY5 A;  2QKK A;  4BR7 A;  3G0Z A;  4DWI A;  5C25 A;  1N32 K;  3AO1 A;  1TVR A;  3W3D A;  3CXC M;  4AHS A;  4DSL A;  3DAW A;  4JI3 K;  2G8F A;  2V52 B;  1KRP A;  2FBX A;  3KHY A;  1KTQ A;  5F2R A;  2FF6 A;  3G25 A;  2VWB A;  4JI2 K;  4PUO A;  4W5R A;  5JS1 A;  1WNS A;  1EET A;  1ATN A;  4CEB A;  3O4N A;  1N5Y A;  5CR4 A;  2J4R A;  3P31 A;  1IJJ A;  3O8M A;  3HP6 A;  4JN4 A;  4NXM K;  2QWP A;  4B8A B;  2HBK A;  1WBB A;  3HOT A;  4FSV A;  4FLV A;  2YHB A;  4CE9 A;  5FPM A;  1HNW K;  1NGD A;  4KRE A;  4JI1 K;  4YNQ A;  3HPG A;  4GVE A;  2NRH A;  4YHH K;  3V6D A;  4DTX A;  3IKM A;  3M1F A;  4Q5V A;  4JV5 K;  4DF8 A;  2W41 A;  2FXU A;  1IKY A;  3K0S A;  3I0S A;  2O8B B;  5IT9 O;  3KWI A;  4C8L A;  2DY4 A;  2P9P B;  3V9Z A;  1RGI A;  5GIP A;  3THW A;  3L4Q A;  3QBW A;  1TKX A;  4K0K K;  1J54 A;  4PL7 A;  2Q31 A;  4N56 A;  4CEZ A; 
#chains in the Genus database with same CATH homology
 1NLV A;  3ZYY X;  1T6D A;  2ZJR L;  4M63 C;  4A5A A;  2NRZ A;  4DKW A;  2V51 B;  4BC5 A;  1HLU A;  1S22 A;  4DB3 A;  1T44 A;  3VEX A;  2E8A A;  4FWL A;  4FPB A;  5EVZ A;  2QWN A;  5AQG A;  3OW2 M;  1KAY A;  3SAF A;  1K8K A;  3CHW A;  4A5B A;  4RCH A;  5BPM A;  1Q81 O;  3CCV N;  2KHO A;  3ID8 A;  3TTC A;  3CJ9 A;  2P9N B;  4PKH A;  5EY4 A;  3HZ6 A;  2P9I B;  3ENB A;  3OA9 A;  3CCM N;  5F0X A;  4CZE A;  4K42 A;  3VF6 A;  3F5T A;  2NRW A;  3LM2 A;  4BRP A;  1HKC A;  4IOX A;  3CC7 N;  3I33 A;  5BR9 A;  4WQ5 A;  1S3X A;  1XQS C;  5EX5 A;  5BRE A;  3UKR A;  3D2F B;  1QQM A;  3QFU A;  4HTL A;  4JK7 A;  5LJW A;  4GV6 A;  1BA1 A;  4IZ9 A;  3O5B A;  5EXW A;  2GEM A;  1U2V B;  3AGR A;  1DT9 A;  1K8A O;  3CC2 N;  2VGN A;  4MDA A;  5BN8 A;  3SMS A;  2P9K B;  4BC2 A;  3MWT A;  3RSE B;  3ZET A;  3P4I A;  1TUY A;  2NNW A;  4BC4 A;  2P9S A;  4B1V A;  3HSC A;  2QTD A;  4I6M B;  4JKG A;  4IO9 L;  2HST A;  1VQ4 N;  5LY3 A;  3VMF B;  3O1B A;  1JCG A;  2I7N A;  3S41 A;  3DXK A;  1VQK N;  2GEL A;  3PIO L;  2Q2R A;  3VTI A;  4BRQ A;  4FWQ A;  5M1K A;  2WFB A;  1X3M A;  1BDG A;  2E2O A;  3CJ7 A;  3DXM A;  2NRT A;  5AQJ A;  5KQD A;  3CC4 N;  3HM8 A;  3P39 A;  3H1V X;  3MN5 A;  4I6M A;  2WUS A;  3VEY A;  5FPE A;  4H03 B;  3CQX A;  1EO1 A;  3LL3 A;  5ADX H;  4BG8 A;  4DQ8 A;  3CPW M;  2HF4 A;  2H3G X;  1VQN N;  2D1K A;  3CCL N;  1N8R O;  3OHR A;  3OBW A;  1OVY A;  2YHW A;  4ILH A;  4BRN A;  1BWF O;  3VTH A;  5AZJ B;  2QEX N;  3O08 A;  1BU6 O;  5KPR A;  1K9M O;  5AQK A;  3UKU B;  4WFN L;  5MLC Q;  1HKB A;  3HTV A;  3LDQ A;  1NGB A;  4CJ7 A;  1KD1 O;  3VGK A;  5GIO A;  5AQN A;  3BEX A;  3IMX A;  4XH5 A;  5LJV A;  4CI6 A;  2AA4 A;  2QWR A;  3O80 A;  2RE2 A;  3EN9 A;  5AQZ A;  3FZF A;  4WFB L;  4CD3 A;  4KH6 A;  5AQY A;  4CZL A;  2NZT A;  4IEE A;  4BRC A;  3SAG A;  4BC3 A;  1VQM N;  5M1Q A;  5JVH L;  3O1W A;  4BR5 A;  5M1F A;  3ID6 A;  4WCE L;  5JLH A;  2W40 A;  4BRF A;  3WUH A;  1NJI O;  2VYP A;  3WQU A;  1VQO N;  2PAV A;  4KH5 A;  3AAP A;  4BR9 A;  3ULE B;  1EQY A;  5BRD A;  4JAX A;  1DEJ A;  1LCU A;  4MLE A;  4OPH A;  3RVC A;  3WEE A;  4EFH A;  1NBW A;  1YAG A;  2V7Z A;  3R1X A;  2ASP A;  5AQH A;  1R59 O;  3BP8 A;  4JKF A;  3CJ1 A;  2EWS A;  4JKB A;  1YF5 L;  2QI2 A;  4BVP A;  4CZI A;  2HF3 A;  2OAN A;  1KAX A;  2A40 A;  1GLB G;  3Q7B A;  2E2P A;  5BRF A;  4PHT X;  3TU5 A;  3CCR N;  2OTJ N;  4F9O A;  4BRG A;  5AQO A;  4XEI A;  3P38 A;  3ATU A;  2D4W A;  4FWK A;  2KLA A;  1E4F T;  1Q18 A;  2YI1 A;  1YVN A;  1QVG M;  3BF3 A;  1MA9 B;  1W97 L;  3BUZ B;  1ZC6 A;  1ATR A;  3E9P A;  2YX6 A;  4XH4 A;  5AQL A;  4KBO A;  4LC9 B;  3WXI A;  2WC9 A;  4YDU C;  3FFK B;  2FSJ A;  1QZ6 A;  3AY9 A;  3FGU A;  4O8K A;  1XC3 A;  3G71 N;  5M1P A;  5AFU A;  2FSN A;  3ENH A;  3D2E B;  3R3L A;  3FR0 A;  1KXP A;  5AQX A;  4CD1 A;  1RDW X;  2A5X A;  5AQR A;  2IVO A;  2P9P A;  3F9M A;  3M5R A;  4B1Z A;  3W0L A;  3A0I X;  1CZA N;  5AQS A;  5CHI A;  1VAZ A;  4FWN A;  5AFU H;  2CH6 A;  4DHY A;  3GE1 A;  2GWJ A;  2FSK A;  2NRX A;  3VER A;  3MN7 A;  2ASM A;  3D2E A;  1SAZ A;  4C1N I;  3CCJ N;  2VCP A;  4GY2 B;  1RDU A;  2E2N A;  2OTL N;  1GLF O;  3E9L A;  5HL7 L;  1BA0 A;  2CGL A;  1VQ9 N;  1ILY A;  4MO5 A;  4H0P A;  1RFQ A;  4A2A A;  3H46 O;  1NGE A;  2HOE A;  3A8Y A;  3C7N B;  3H3N O;  4IEI A;  3U8X A;  4JK9 A;  3ZX0 A;  4NB4 A;  4JD2 B;  2RHK A;  4YOW A;  4BRA A;  1HX1 A;  4FL9 A;  5AR0 A;  1WOQ A;  4KH4 A;  2D0O A;  3O9U A;  2P9N A;  2QWM A;  3MN6 A;  4JHD B;  2WBN A;  2F9W A;  2P9I A;  3VOV A;  3E1Y A;  1TUU A;  5HOO A;  4EHU A;  1ATS A;  3UE5 A;  1GLJ O;  3R8E A;  3SLC A;  3GBT A;  3GOI A;  4ILG B;  3VES A;  5C10 A;  3TTD A;  4CZK A;  3D2F A;  4FVU A;  3GG4 A;  1QHA A;  5AQP A;  4M7X A;  2A3Z A;  4Z94 A;  1Q82 O;  1BO5 O;  1U2V A;  1BUP A;  1YUW A;  3MCP A;  1VQ7 N;  1SS6 A;  1V4S A;  2QWQ A;  3T69 A;  4IJN A;  4B1W B;  3ENO A;  3CCU N;  5KPZ A;  1X3N A;  4E1J A;  4WFA L;  1ZBS A;  2CGK A;  2GWK A;  3A5M C;  5ADX A;  4AF1 A;  3O9R A;  2P9K A;  3N4Q A;  3RSE A;  4RTF D;  5DM6 L;  3EO3 A;  2PFU A;  3QIC A;  5GAD P;  2BH1 A;  4IOA L;  4CBX A;  3KK7 A;  4B9Q A;  5KPT A;  1O13 A;  3MMV A;  3Q7C A;  2QWO A;  3U9D A;  1T3V A;  4H0T B;  1KQS M;  4G9Z A;  2IVN A;  1IG8 A;  3PIP L;  1Y64 A;  1HUX A;  1DGK N;  4A2B A;  5M1N A;  3H45 C;  1GLD G;  2NRV A;  2DPN A;  4C23 A;  3FZH A;  3FZK A;  3O6W A;  4BRO A;  1P90 A;  4FOI A;  2NRR A;  3LDO A;  4H0V B;  5M1O A;  1GLC G;  5BPL A;  2ZGY A;  3MN9 A;  4BRL A;  2YJE A;  4IWV A;  2YJF A;  1V4T A;  5CE3 A;  3L0Q A;  3SAH A;  2E20 A;  5AZI B;  5GAE P;  1NGJ A;  4EHT A;  4CZM A;  2Q36 A;  4O8U A;  3CME N;  4QS7 A;  4WYB A;  3U4L A;  5GIN A;  4JKC A;  3VEZ A;  2JWK A;  4FO0 A;  2ZWH A;  3M3Z A;  4FPA A;  1VQ5 N;  4WQ4 C;  5AZJ A;  3HBT A;  3DWL A;  3SMP A;  1YIJ N;  5BRH A;  3G4S N;  3UKU A;  1WUA A;  4H5W A;  1NGF A;  3C65 A;  5JIC A;  4ILJ A;  4MLH A;  1VQL N;  3K9J A;  2A41 A;  5TKW A;  3IFR A;  5AZI A;  2YHX A;  1QZ5 A;  3WXK A;  3A5L C;  4FWP A;  4BRE A;  3E66 A;  1KC8 O;  2Q0R A;  3KWG A;  1TYQ B;  3C6A A;  4BRK A;  2ZJQ L;  4JKE A;  3KZB A;  3CJC A;  2IIR A;  2YHY A;  3VGL A;  4PKG A;  4BQZ A;  2GX9 A;  4C1N K;  3DLL L;  1JCE A;  3CMA N;  1K73 O;  4HWI A;  1HPM A;  2HBM A;  3IUC A;  2IVP A;  3J7Z O;  4FOE A;  4B1X B;  4BVO A;  3H6E A;  3ULE A;  1OKJ A;  3WT0 A;  3VGM A;  3O4W A;  4H0X B;  3SK3 A;  3A5N C;  4CBU A;  3LM9 A;  4BRM A;  5JMV A;  2V7Y A;  1NMD A;  3D6R A;  3D7E O;  4NLB A;  4CZG A;  5JLF A;  1D4X A;  5AQU A;  2A42 A;  3MDQ A;  2D0P A;  3TTF A;  1G99 A;  4A57 A;  4BR0 A;  3SBG A;  3FLC O;  3NMU A;  3C0B A;  5FPD A;  3WXL A;  4M7Y A;  3EZW A;  1MWK A;  3A5O C;  3JXU A;  4ISE A;  2P9U B;  2BUP A;  3NVM A;  4A62 A;  5I9E B;  3MWP A;  5GAG P;  3TSQ A;  3VEN A;  4A59 A;  4FWM A;  3C6H A;  1NM1 A;  4AM7 A;  4IFE A;  2P9L B;  1M1K O;  4U67 L;  4BGA A;  4B1Y B;  3QFP A;  4YDU A;  1YJW N;  4BRD A;  3NVK A;  4BR4 A;  2QWL A;  5H1S Q;  3G6E N;  4PL8 A;  1YJ9 N;  1MWM A;  4MO4 A;  5E26 A;  5DM7 L;  4OO1 J;  2Q97 A;  4NO7 A;  5BN9 A;  2ITM A;  3TPQ A;  4H5V A;  4YOT A;  1NGA A;  4PKI A;  2F7T A;  2KKZ A;  5ELZ A;  3U9Z A;  4K41 A;  1HJO A;  3BF1 A;  5TKY A;  1K8K B;  2P9L A;  3F2K A;  4BRH A;  5C12 A;  3CET A;  4GV3 A;  1KAZ A;  3LDP A;  4UY8 O;  1P8Z A;  3ZX2 A;  5AQW A;  4OPA A;  3QBX A;  5E84 A;  3LDN A;  5C15 A;  5AQI A;  4AM6 A;  2GUP A;  3H1Q A;  4O5F A;  3CCQ N;  4DCH A;  4IJA A;  4FWR A;  1YI2 N;  2ZGZ A;  3O9S A;  3SJH A;  3K9K A;  3UKR B;  3O9T A;  4U7B A;  1C0G A;  1ESV A;  3L4I A;  4WQ5 C;  1NWK A;  3C7N A;  3VF2 A;  5C2F A;  1M90 O;  3OBY A;  5AQV A;  5JVG L;  1U6Z A;  4FWS A;  2A6A A;  4JD2 A;  3WXM B;  2E2Q A;  2FLO A;  4H5R A;  3ZET B;  2E1Y A;  4JHD A;  3FZL A;  2P9S B;  4NLC A;  2HBL A;  1GLA G;  3HRG A;  4YOV A;  1SQK A;  4JKG B;  3VEV A;  1GLE G;  4Y0W A;  5AQQ A;  4H5N A;  2Q0U A;  3EE9 A;  4BQL A;  4EAH D;  1E4G T;  1LOT B;  1SZ2 A;  3L6Q A;  3DXK B;  4JKH A;  4RWT A;  1YJN N;  3VEW A;  3B8A X;  3QB0 A;  4IDH A;  4K25 A;  2QXL A;  3CQY A;  4CZJ A;  3E9O A;  4CZH A;  3DXM B;  1W2B M;  1DKG D;  1JCF A;  4BG9 A;  1BG3 A;  1C0F A;  5FPN A;  3HI0 A;  4EIA A;  4BGB A;  5F1X A;  4YOY A;  3WQT A;  1H1V A;  2QW9 A;  4CBW A;  1S72 N;  4B1U B;  4ISF A;  3HOS A;  3PLA A;  3UB5 A;  1QQN A;  2ZF5 O;  1YXQ A;  3AGK A;  4IXC A;  1GLL O;  4QS9 A;  2VGM A;  3MX5 A;  3M6G A;  5AQT A;  3R6M A;  3CCE N;  4JK8 A;  4ISG A;  3H3O B;  3TSP A;  2YCH A;  3CD6 N;  1YHQ N;  2I7P A;  1VQ6 N;  4CZF A;  4JEP A;  3N4P A;  1MDU B;  1ZXO A;  2AP1 A;  5AQF A;  4XH1 A;  4JNE A;  4BR7 A;  3I8B A;  4YOX A;  3QDK A;  1Z05 A;  1T6C A;  3W3D A;  5BPN A;  3SBT A;  3CXC M;  3GL1 A;  3EKS A;  3DJC A;  2QM1 A;  4WF9 L;  3DAW A;  5B8H A;  5AQM A;  2V52 B;  4A61 A;  4WQ4 A;  5EOY A;  1XUP O;  3CER A;  3KHY A;  3MCA B;  1NGC A;  1VQ8 N;  5F2R A;  3VPZ A;  3VF4 A;  2FF6 A;  3IDH A;  2CGJ A;  3G25 A;  3FZM A;  2VWB A;  5GAH P;  3CF5 L;  3CJB A;  4J8F A;  1HKG A;  1X9J A;  1ATN A;  4QS8 A;  3WEE B;  5KQ8 A;  3CI5 A;  1BOT O;  3TSU A;  3ZX3 A;  5CR4 A;  3CCS N;  3AAQ A;  1QVF M;  3ZEU B;  3CIP A;  3QML A;  3AAR A;  3ATV A;  3CPE A;  2FF3 B;  2J4R A;  2ZJP L;  3EL2 A;  1Z6R A;  3P31 A;  1TYQ A;  4JKD A;  1JJ2 M;  5C0Y A;  1IJJ A;  3O8M A;  4BY9 C;  4YOU A;  3I55 N;  4JN4 A;  1YIT N;  2QWP A;  2CH5 A;  2HBK A;  3R9P A;  3HOT A;  2F9T A;  4FWO A;  3MX2 A;  4FSV A;  4IO8 A;  3WXJ A;  4H0O A;  5FPM A;  2JWL A;  1NGD A;  4GV9 A;  3ZEU A;  2E1Z A;  4GVE A;  1NGH A;  2NRH A;  3J8A A;  5C2D A;  1Q7Y O;  4YOR A;  4BR2 A;  2GTD A;  3JS6 A;  4IOC L;  3LDL A;  1VQP N;  3EKU A;  1NGG A;  2Q1N A;  3IKM A;  3M1F A;  1NGI A;  2NLX A;  2UYT A;  2BTF A;  3VET A;  3O9Q A;  2W41 A;  4H0Y B;  2HBJ A;  2FXU A;  4JKA A;  3CJA A;  1J6Z A;  3KWI A;  3EE8 A;  2P9P B;  2QA4 N;  1RGI A;  4R79 A;  5GIP A;  2E88 A;  2P9U A;  4MDB A;  2PBD A;  2ASO A;  3L4Q A;  3FE1 A;  3MK6 A;  3QBW A;  3GDQ A;  3KVG A;  4GNI A;  4H5T A;  4L3Q A;  4BRI A;  3I56 N;  2HMP A;  4K43 A;  3T7Z A;  1Q86 O;  4PL7 A;  2Q31 A;  1QQO A;  3VEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...