4WFBL

The crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with bc-3205
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
110
structure length
110
Chain Sequence
MISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKGVTLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYLYHGRVKALAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S rRNA
total genus 16
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2014-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4wfbL01
5GAHP 4U67L 1Q82O 1NJIO 3CCJN 1K73O 5MLCQ 5JVHL 3CPWM 5JVGL 1VQ8N 1KC8O 3OW2M 1OVYA 1N8RO 4IOAL 1VQ7N 3J7ZO 4IOCL 1VQMN 2ZJPL 1QVGM 1M90O 3CCEN 3CCLN 1KD1O 4WFNL 2OTJN 1Q86O 3CF5L 1Q7YO 5GAEP 1YI2N 5DM7L 5GAGP 4IO9L 3CC2N 3DLLL 1YITN 1VQPN 3CMEN 1K9MO 5HL7L 1K8AO 1QVFM 1VQ9N 1S72N 3CCRN 1KQSM 1M1KO 1JJ2M 4WF9L 1Q81O 3CD6N 3I55N 3CC7N 1VQKN 1VQON 4WFAL 3CCMN 5H1SQ 3CCUN 3CC4N 1VQNN 3CXCM 1VQLN 4UY8O 3G6EN 3PIOL 1YIJN 4WFBL 5DM6L 3G71N 3CCQN 2ZJQL 4WCEL 1YJ9N 2QA4N 1YJWN 3CCSN 3CMAN 3CCVN 1VQ5N 1YHQN 2QEXN 1YJNN 1W2BM 1VQ4N 3G4SN 5GADP 2OTLN 1VQ6N 3I56N 3PIPL 2ZJRL 1ILYA
chains in the Genus database with same CATH superfamily
4N5SA 2FBXA 3H1QA 4FLVA 3THVA 4ILHA 4YOWA 3PSFA 1NJZA 1TK8A 3D2FA 3ZSOA 3N4PA 3WXMB 4I9LA 2BANA 3O9TA 4JS4A 4CEFA 1L5UA 3L8BA 1LW0A 1CLQA 2A6AA 1TL1A 4M63C 4IZ9A 3VA3A 3AARA 3R9PA 4ID1A 4FZZA 1RDUA 4DQSA 1S5JA 1X9SA 3VTHA 4CK1A 2DFHA 4BR5A 4C8LA 2VWKA 1BQNA 5CHIA 4XH1A 1SL2A 2QI2A 3GL1A 4XEIA 3VGKA 5EXWA 2GELA 3G10A 3FZKA 4Z0UA 4PA1A 3VQ9A 3KJVA 2BUPA 4DQIA 4HVJA 2I5JA 1VRTA 1VSMA 4W5NA 1RTJA 3CIPA 1HYSA 1RT6A 3TTDA 3KK3A 3T69A 3HP9A 5BREA 3WNGA 1WN7A 1BIUA 4FZXC 3VA0A 2FF6A 3CI5A 1ASVA 4XH5A 5J2NA 4A61A 3FFIA 3FZHA 2ASOA 3GDQA 1KAXA 4WQ5A 2EWSA 4BRFA 4YDUA 3LWMA 3JSMA 4ISFA 2F96A 4GY2B 1A5VA 5EU7A 2GWJA 4KH6A 3GG4A 1J9AA 2WFBA 1CZAN 2O4GA 5KTQA 1X3NA 4JEPA 5BN9A 4R5PA 3AGKA 1T7PA 4X66K 1NKBA 1NMNA 3QNNA 4HCBA 4J2EA 3U8XA 4OLAA 3P38A 2Q2RA 2P9IA 4PHTX 4LF7K 3JYTA 4CJ7A 5M1PA 1NK4A 1BUPA 1T3VA 4IXCA 4KI6A 4IWVA 2GTDA 5I9EB 3B6OA 1FK9A 4YY3K 4B9QA 3SBTA 1MWMA 4CHZA 4DS5A 4FJ7A 3W0LA 3VQCA 1TVRA 3QDKA 4A59A 2P9UA 3PSIA 3WXJA 4CJPA 4CK2A 1VSFA 4KO0A 1KFSA 3T3FA 5TKWA 3QBXA 3CQYA 1RT1A 4CJRA 3ISNC 4XH4A 3AO3A 2X78A 3T19A 1NGGA 3C95A 3WNEA 3J7ZO 2E88A 1SUQA 4E1JA 1N33K 4H5TA 4CIFA 3P83D 4RW6A 3V6DA 3OYHA 2PBDA 3L2WA 4OX9K 1WUAA 1NGDA 3EZWA 4QS7A 1ASWA 5M1OA 4J8FA 1RDCA 2KKZA 4YOXA 1C0TA 4MQ3A 2E8AA 2FBTA 3LALA 4AM6A 3RRGA 3DLLL 4CJWA 3DOKA 1OH8A 5EY4A 3A5LC 4BQLA 4C8KA 4DWIA 4FJNA 2NRWA 4FK4A 3CC7N 2IOCA 5FROA 3K58A 1A5WA 3NF7A 1TYQA 4M7XA 1U2VB 3DXKA 3HI0A 4KB1A 3CM6A 3LL3A 5J1EA 2Y1IA 1UAXA 1I3AA 4EFHA 1UOCA 1W0HA 1SL0A 1NKEA 3KWIA 1ATSA 3TAGA 1NK9A 3RSEB 4DQRA 5BR9A 3L2RA 3L4IA 4CHPA 1TKTA 5CE3A 1BO5O 3OY9A 1RBRA 1RDBA 4KTWA 4JI4K 2NRTA 2A1RA 3THWB 2OYQA 2NZTA 4RCHA 1N32K 4FJMA 4CHQA 3CM5A 1SKRA 2I7PA 4IFVA 3TTCA 3G4SN 3K9KA 2KFNA 4FJKA 4JI8K 3CQXA 3WXIA 1L3TA 1RCHA 2X6NA 3M6GA 1XC9A 2AP1A 5A2QO 2HMIA 1H1VA 3QESA 3H46O 3IKMA 4H5WA 4FJJA 3NVMA 4FLWA 1WSFA 3NGYA 4FCYA 4LD0A 1TKZA 1EX4A 3VERA 1BISA 3QBWA 3SV4A 2O4IA 2IDOA 3P5JA 1EWQA 3HSTB 4YFUA 3MCPA 3THXB 5F2RA 2D4WA 4MO4A 3C94A 4CJEA 1HNVA 2HBKA 4DR1K 4H5VA 3RTVA 1S1VA 2VG5A 2CH5A 3D7EO 3LAKA 3VQEA 3EZ5A 4YDUC 1C0MA 5FPDA 3L2VA 4DTXA 4IOXA 3K5OA 4BQZA 3NCIA 2P9NB 1Z25A 4FWPA 4K8ZA 4KB0A 3QINA 3CCRN 4KH5A 3CJCA 2G8WA 4CBWA 5E26A 1Q81O 1E3MA 5BN8A 4Z4HA 3ENOA 1HJRA 3DLGA 1RTDA 2CGKA 4JKCA 5AQZA 2XY7A 1SV5A 4PKGA 3L4QA 3AA4A 1VHXA 5E84A 1U48A 4E7LA 2P9IB 4OKEA 1HNWK 2FXUA 4IJAA 3VEZA 4BG8A 5AQGA 3CJ9A 3CYMA 3EKUA 5CZ1A 4HTLA 3PO5A 3ENHA 4AHUA 2QEXN 4E1NA 2PZSA 3LDPA 3QNOA 3A5NC 4KH4A 4CGGA 2VQEK 4NCBA 4DSEA 3BZCA 2OTLN 4OJRA 3GE1A 4DTJA 4KFBA 1S6QA 4FJHA 3HRGA 4B9SA 4U67L 1DGKN 2HB5A 4B9TA 2QXLA 4X62K 4BRDA 3V9XA 4ELTA 3V1QA 1RT5A 3MK6A 3AVAA 1K6YA 3DRRA 4JKBA 1XC3A 4CEEA 4CZGA 2XHBA 5AQYA 4M3XA 1Q9YA 4CEQA 1J53A 3VEXA 4DF8A 2OCEA 1BDGA 3D6RA 4EP5A 3T1HK 4B3SK 1M90O 3DLKA 3OS0A 3MXJA 4H5NA 4BRGA 4KV8A 1T6DA 1NOZA 4YNQA 2A41A 1Q7YO 1ZBIA 4BRKA 3JXUA 1V4TA 1C6VA 1GLEG 2WUSA 3CMEN 1JKHA 3E9OA 2P9SB 4K42A 2CH6A 3VEVA 2KQ2A 3LPTA 3MEEA 5KPZA 1S6PA 2D0CA 2FSJA 3AVLA 4BACA 2A40A 3H45C 3BUZB 1BCMA 3AA3A 4DF4A 2QK9A 3A2FA 4HUFA 4FZYA 1Z6RA 4UY8O 1X9WA 1JL2A 4O0IA 5C0YA 4UQGA 3VQ8A 4OPAA 3LDQA 4RW8A 1SS6A 2NLXA 3KD5E 3SZ2A 3P4IA 4Y0WA 4A5BA 4WE1A 4H0TB 2FC0A 3BDPA 3TU5A 5I3UA 2AA4A 3G0ZA 3LAMA 3QIPA 4KTQA 4CFDA 4B1WB 5D3GA 4H5RA 4AHRA 3ZX0A 3CMAN 4K8XA 4EAHD 4JI7K 3HPOA 4H8KA 4QS9A 2NRZA 3ZSQA 5HRPA 3HK2A 4LF4K 5HRSA 2ZE2A 1VQ4N 3QEVA 3KLHA 3M8RA 2IVNA 4FVMA 3HSCA 1NJYA 2ZGYA 2WTUA 3LWLA 4JI0K 5GIPA 5EX5A 3SUPA 4CF2A 1P8ZA 4B8AB 1S1TA 4I7FA 3PLAA 4MFBA 1NGIA 1F21A 3O9RA 5LMNK 1KC8O 4H03B 4F4KA 1OH5A 3O9UA 1HR0K 2BDPA 2O8EB 4NCGA 5JLHA 4IOAL 2HNYA 1HNXK 4O0JA 1RBVA 1Q8IA 2WBNA 4Q0BA 3VEYA 1VQMN 1RFQA 4Y1DA 3OYIA 5GINA 4DTOA 3FZMA 3VGLA 2UUBK 4W5OA 4FWQA 3PV8A 1IG8A 3KKSA 4W5RA 2P9NA 1WSGA 3G25A 1Q86O 1TKXA 1Z26A 3C7NB 3CF5L 3O4NA 4GMJB 2P9UB 4IG3A 4L3QA 4BR7A 3OS2A 3J81O 1YITN 2QKKA 1VQPN 1TKDA 2O8BA 2QWOA 3R8EA 4YHHK 1QZ5A 5GIOA 4OPKA 2EHGA 4DU3A 1LWEA 1MU2A 1RT2A 1KXPA 4FWRA 3ZX3A 3M8PA 4CHNA 3HP6A 3HBTA 5CY4A 3PX6A 2KZMA 4E89A 2Q3SA 1K8KA 1FJGK 3RRHA 1NGCA 1ZC6A 2JWLA 1CZBA 1MDUB 1KVAA 1VQLN 5AQIA 4WQ4A 1GLJO 4BC5A 1JLAA 3HVTA 2ATQA 3CFPA 3NGZA 2UUCK 4EP4A 4DR3K 3ZT2A 3G71N 1GLCG 1X9JA 1SAZA 5CR4A 3V81A 4I6MA 2HHHK 1N5YA 2J4RA 4FVUA 3O8MA 4BE2A 3CCSN 1XUPO 4ILJA 5LJWA 5AQRA 2O8CA 4JK9A 4PKHA 5BPMA 1N36K 3M3ZA 4JI2K 5GADP 3IS9A 4GV9A 3ZSWA 5I42A 2HBJA 4ELUA 1GOAA 4KKOA 4CCHA 2W6LA 3T1YK 1DEJA 3SPZA 4CZKA 2BE2A 2A42A 4BGBA 3UKRB 5LMUK 4CW7B 3LP1A 1WBBA 1QSSA 3VN5A 1LOTB 3LPUA 4DS4A 3H3OB 1RDAA 4IJNA 2NNWA 5AQKA 4F3TA 2UXCK 3TSUA 4IOCL 4NXNK 1HUXA 3O3GA 1W7AA 1T03A 4LH4A 3THWA 3L2QA 3RMAA 2QWMA 1QVGM 4I2PA 5C25A 4DUYK 4FK2A 1RT3A 1W9HA 4CZLA 1KD1O 4CEDA 3LP2A 3CETA 3HYFA 4BRMA 3CG7A 4C8OA 4DMNA 2P9SA 5KRTA 4DSFA 3AVGA 3HOSA 3ID8A 3V1OA 3QLHA 4CJVA 3AO5A 3KD1E 5DM7L 3FGUA 4WYBA 3KWGA 3S3NA 1BQMA 2P9LA 3CC2N 3BZKA 3ZCMA 3R3LA 4RW4A 5HLFA 4DQPA 3EE8A 1EO1A 2OPQA 4LF8K 2YHBA 3D2EB 2HHXA 4BRIA 4OGCA 4BRQA 3K5MA 3SCXA 3E66A 1L3SA 3CCMN 1KLNA 3OYLA 3CC4N 2QWPA 4ICLA 1E4GT 2UXDK 2E6MA 3I8BA 3NAEA 5JLFA 4CZIA 4Z4CA 1OH6A 2IAJA 3VEWA 1VAZA 3AVFA 3OYDA 2Z1JA 1YJ9N 2VGNA 4FPAA 3ATVA 4BROA 3U9ZA 4CGHA 4NLCA 4YOYA 1N6QA 2P9KB 5F1XA 3AO2A 2A1SA 5HOOA 1HJOA 4DB3A 3AA2A 1QQNA 1YVNA 4G9ZA 3NBPA 4CJTA 2ETJA 1J5EK 4KHPK 2UXBK 1JCGA 4F3OA 1NK7A 3BP8A 5GAHP 4FLUA 3I0SA 1ASUA 2H3GX 1QHTA 4OGEA 1X1PA 4OVLA 2QTDA 4GW6A 2IVOA 1K73O 4PWDA 3QEPA 3KK7A 4FWSA 4GNIA 2P5GA 4V19S 2QM1A 3VF6A 3C6TA 5AZIB 3J7YP 3ZETB 3JS6A 3SV3A 4BRPA 3SI6A 4IFYA 1GOBA 2E1YA 2HBMA 3NF8A 3AVKA 1LCUA 3BF3A 3H1VX 3MAQA 4LFBK 2HVHA 3SUOA 3DM2A 5C10A 4CF9A 4RG8A 4B3RK 5KGWA 5AQHA 1JLFA 4AF1A 1ZBSA 2HHVA 3WT0A 4BY9C 3ULEA 1O13A 3THYA 4HUEA 3SJJA 3IFRA 4B3MK 4DSKA 1NNEA 1NWKA 1HX1A 4AH9A 1ATNA 2QWRA 1K8KB 1TK5A 4HHTA 3OYGA 2D0PA 4BR2A 1NGBA 3TAEA 1FKOA 1VSDA 4M3YA 2HF3A 3DYAA 3V9UA 3V9WA 4DSJA 4DV0K 1TAUA 1BG3A 1VQKN 4WFAL 2EX3A 3VETA 3HO1A 1ATRA 3ZSZA 1HYZA 3MX2A 1BI4A 3I0RA 2FBVA 3UKUB 4AHCA 3CXCM 2BH1A 2F4VK 3KLIA 1FXXA 5DM6L 1NMDA 3WQUA 3CFOA 3ALYA 2OPSA 2ZGZA 1IKVA 3RMCA 4JLHA 4BG9A 1NK8A 4KI4A 1LWFA 3HXMA 4ID5A 4O44A 1WSJA 1WLJA 1RBTA 1KLMA 1A5XA 4FK0A 3UKRA 5AQWA 4FW2A 4PUOA 1X3MA 3J7AP 1XWLA 4N47A 4M3TA 3U9DA 3L3UA 3VQDA 3T7ZA 4FXDA 3OYKA 4GVEA 3TR8A 1S22A 4CK3A 5CZ2A 4E0DA 4FLXA 3MWTA 3AVBA 4M7YA 2PAVA 4OKKA 3SMPA 4RW9A 5JVGL 3MEDA 3E1YA 3UIQA 1OVYA 3BGRA 4A2AA 4DFJA 4CIEA 1FKPA 2OZMA 4FLYA 4IEIA 2YX6A 3L6QA 2IGIA 3LANA 4O5FA 2RHKA 5FDLA 3SQ4A 3HM8A 2HHUA 1C1CA 1VSEA 4DCHA 4WFNL 2G8IA 2HHSA 4CGIA 3GOIA 4X65K 5HROA 3VQQA 2FSKA 1S9GA 1LAWA 5GAEP 1WAFA 3MCAB 4H4MA 3TSPA 3MN5A 1T6CA 2JGUA 3KKRA 3TI0A 1R59O 4MDAA 4BC2A 1DLOA 5KI6A 2G8VA 3F5TA 3SUQA 4FJ8A 2G8FA 2YNGA 3OA9A 3AAQA 1IKXA 1DKGD 3K9JA 1JLEA 3BEXA 4F2RA 2F8SA 1VQON 4CFCA 4BR0A 3DXMB 5FLXO 3NMUA 5C24A 5H1SQ 1QQOA 3VTIA 3C6HA 3IMXA 4RTFD 4HUGA 1VQNN 1QZ6A 4KHSA 4DSLA 1YVUA 1UWBA 4LSNA 4E7HA 3PIOL 5AFUH 4FM1A 5KQ8A 4B9LA 1JCFA 4BRAA 3CCQN 4C8NA 5C2DA 3ZLJA 2BGGA 2NUBA 1OKJA 4CVNE 3O4QA 3VMFB 1GLAG 3MMVA 3LM2A 3CJ7A 1NK6A 3H3NO 3HM9A 4DSIA 2FSNA 1RTIA 1HKGA 4PL7A 2Z1IA 3ZEUA 4CZHA 1VQ5N 3WNHA 4G1QA 5J2MA 2A5XA 3DMJA 4CJ3A 3R6MA 2F9WA 3K57A 3VQ7A 2WOMA 3OS1A 4JD2B 3PIPL 2CGLA 3ZETA 2LSNA 2P51A 2HF4A 2W42A 3P31A 1JLQA 1NGAA 5TKYA 1ZBHA 5JS2A 4GKKK 4CIGA 4N41A 2YHXA 4PY5A 3E01A 1SKWA 4JAXA 4CGDA 4CEZA 3EY1A 1CZ9A 3D2FB 3DLEA 1B9FA 1DTQA 3KLFA 3TARA 4IG0A 5LJVA 4ILGB 3VOVA 3RMDA 5DK5A 4CJSA 3ZT4A 1MWKA 1T44A 3IG1A 3HVRA 2YHAA 2ZF5O 1HKCA 4A57A 5GAGP 1IG9A 1IO2A 4CHOA 4KHUA 4CJKA 3VQ5A 3PY8A 1BWFO 3E9PA 3SBGA 1BA0A 3IDHA 4BRCA 3VQ6A 5DMRA 3J8AA 2IC3A 4ZTFA 5KRSA 1EP4A 1TV6A 4FSVA 1NGFA 4M3WA 4NLBA 4I9QA 1ZBFA 4E7KA 1B9DA 4CJUA 2R7YA 2GV9A 4FWMA 1NM1A 2XO7A 4FM2A 3KK1A 1RDWX 1XNRK 3LP3A 3TTFA 3O9SA 4FM0A 1NJXA 4WCEL 4OKJA 4M42A 4K0KK 2JLEA 3OYMA 3M1FA 4CBUA 3V1RA 5AQPA 3NVKA 4DR5K 4LF6K 3M8QA 1IH7A 4JKEA 4J2DA 2YNHA 3D2EA 2HBLA 2HSTA 3L3VA 2E2PA 4LSLA 3AO4A 3KHYA 1S3XA 5AQSA 1J54A 4H4OA 5BPLA 3GBTA 4DTPA 3DAWA 4KTZA 3NFAA 4DTSA 2GX9A 2KZZA 3P39A 3NGIA 1BCOA 4ZHRA 4EZ9A 1VSIA 3U4LA 1DT9A 1QSLA 3VQBA 3CJBA 1CXQA 1WSHA 5AFUA 3MXIA 3DI6A 4FJIA 2W40A 3EL2A 4F9OA 4NCAA 4FLTA 3AAPA 1YTUA 2KW4A 2OTJN 5AQFA 3MECA 3VESA 1BOTO 3OYAA 4FOIA 4CFBA 3MN7A 4CI6A 5KPRA 4AM7A 2KLAA 5M1QA 3TABA 2DPNA 3AVCA 3DXMA 1VQ9N 4JKGA 4F2SA 3TWHA 1S72N 4CZJA 3MWPA 1XMOK 1M1KO 1KQSM 1JJ2M 1BGXT 2YJFA 4DV7K 3S3OA 3QFUA 1HLUA 3KLGA 3PO4A 4GV3A 1YF5L 1WSIA 3QFPA 4O8KA 5SZTA 2WONA 2AJQA 1ZXOA 4DU1A 1U2VA 2W6KA 4FOEA 4KAZA 3QEXA 4B1UB 3G6EN 4W5TA 4JN4A 5AQJA 4X64K 3LZIA 3KZBA 5AQLA 5JMVA 1YUWA 3ZSYA 2HHTA 4ISGA 4IFEA 3MEGA 1JLGA 3HPHA 1Q18A 1CXUA 4JD2A 1U04A 4B9UA 5HBMA 1U4BA 4FWNA 1WSEA 5FRMA 4KHQA 2VWJA 2NRHA 1N34K 4H0OA 3VQAA 2I7NA 3SQ0A 2E2QA 3OVNA 3A5MC 4J2AA 3SPYA 1V4SA 2UYTA 4JS5A 4DQQA 3K59A 3ID6A 3SJHA 1VQ6N 5BR8K 3I56N 3WEEA 1LW2A 4CFAA 4H0PA 4CGJA 3AVMA 4DR6K 3TSQA 2WC9A 5EOYA 1Q82O 3CCJN 3K5NA 1TL3A 4KPYA 4CERA 5AZJA 2NRVA 4JKDA 3CPWM 4M3ZA 1UA0A 5BRFA 4DV3K 4EZ6A 3DLHA 1KAZA 3O9QA 2O8DA 4M41A 2ZJPL 1NJWA 1GLBG 3LZJA 3CCEN 3SQ2A 3SAHA 4DFPA 4JK7A 2QW9A 3KTQA 2OZSA 1TUUA 3F9MA 5AQNA 2OPRA 3HTVA 1NK0A 1VSHA 4O4GA 4IO9L 3J80O 4CF8A 4JI1K 1K9MO 4DHYA 1J6ZA 5CYQA 1JXEA 3SAFA 2F7TA 1RNHA 4YOUA 3A0IX 3CD6N 4CZEA 4DQ8A 4A5AA 1SZ2A 4KHNA 2GUPA 4DR4K 1TAQA 4JKFA 5CYMA 4B1YB 3VPZA 4W5QA 3TANA 1IKYA 2PFUA 4A2BA 1ZBLA 3V9ZA 2G8HA 5BRHA 4DKWA 2DY4A 3VENA 3RVCA 2D1KA 1B92A 4LC9B 4FJXA 4WQ4C 4HCCA 1EQYA 4JYAK 1QE1A 3SMSA 1S1XA 4E7JA 1VRUA 5ADXH 3B8AX 3A8YA 3NDKA 4LF9K 3ZSRA 3O08A 3C65A 1Z05A 4BR9A 4LFCK 2YKMA 2IVPA 4NYFA 3ITHA 3FFKB 1RTHA 5J2PA 3I8DA 2ZQBA 3WNFA 5M1NA 1S1WA 3DRPA 3K2PA 3SUNA 1QS4A 2YHYA 4OPHA 4DTRA 4DTMA 4Q5VA 1N8RO 1JL1A 3KLEA 3DXKB 3OBYA 1NK5A 3OYNA 3VQPA 4AHTA 4DFKA 4BVPA 5FPNA 3TAQA 4Z4IA 1DTTA 5KGXA 4AHVA 1IV0A 4AILC 3RSEA 3VQ4A 2Z1GA 3MDQA 1G15A 4CD3A 4CJFA 4FWOA 4JKGB 1XHZA 1RBUA 1XQSC 1WAJA 4JKAA 4YOTA 1T05A 3O3HA 1SL1A 1WB9A 2DTUA 3RMBA 3QIOA 2KFZA 2B5JA 3AVJA 3W3DA 4FO0A 4K25A 4FJ5A 4FL9A 1S1UA 4HWIA 4DTNA 1XNQK 2PYLA 4B9VA 5FRNA 3RWUA 1YTAA 3WUHA 1GOCA 4H0XB 1IKWA 1RT7A 2B4JA 1W97L 4LY7A 3WQTA 2ZJQL 1BIZA 4BREA 4O8UA 2E5LK 3PX0A 2FLOA 5SWMA 2HHWA 3S3MA 1BHLA 3LDOA 5AQQA 4PQUA 1YJWN 5JS1A 2VQFK 4IEEA 1R0AA 3QMLA 3THXA 1WBDA 4BR4A 2P9LB 3SQ1A 3M5RA 1YHQN 4TSXA 1YJNN 3JAMO 5AZJB 4CGFA 3T1AA 1P90A 3OHRA 4CJ5A 4QAGA 2ZJRL 2DFEA 5AQUA 1ZYQA 3IUCA 4DLEA 1MA9B 1IBLK 4XIUA 4DFMA 2GUIA 3NH0A 4PL8A 2IIRA 3SK3A 3U3GA 4CZFA 4M45A 2HMPA 1RGIA 4B08A 4YOVA 3F73A 2O8EA 4BE1A 1VQ8N 5M1FA 2ZM6K 2HNDA 3ULDA 3O6WA 4CD1A 3S9HA 3ATUA 4NYNA 2O8FA 3AY9A 2Q31A 1D5AA 4RWTA 2P9PA 4GKJK 5HRNA 3NH1A 2QWQA 3LP0A 4BWMA 2V7ZA 1HPZA 4B3OA 3FR0A 4YORA 1BA1A 4CECA 4WQ5C 1NLVA 4I2QA 1D9FA 4FLZA 1EWRA 3K0SA 2NRRA 5JICA 1LWCA 2YJEA 1U49A 3QO9A 4EIAA 3RR7A 3LDLA 4C8MA 4GVMA 2YCHA 4H0VB 4B1XB 3VEOA 1G99A 2Q97A 2HVIA 3PUFA 3HZ6A 5K14A 4QS8A 3AO1A 3OJUA 2Z1HA 4BGAA 5KQDA 3V9SA 3SYZA 5B8HA 2PY5A 5ELZA 3S41A 4B9MA 3I55N 4QOZB 4GV6A 4CBXA 2ASMA 3H6EA 4CE9A 5C2FA 4ISEA 2IS3A 1GLDG 3OYFA 4KHWA 3A5OC 1QSYA 4Z4FA 3KVGA 2QWNA 3TAPA 2YNFA 3LDSA 2VCPA 3UB5A 3KIOA 1ESVA 5FPMA 1VK0A 4I6MB 4KHYA 2QA4N 1L3VA 4IDKA 1SQKA 2KHOA 3AVIA 3F9KA 1RBSA 1JLCA 2G8UA 3THYB 4CJQA 1IBMK 1D9DA 2O8CB 4CEAA 2RF2A 3U6FA 4DV1K 4CF1A 4LH5A 2P1JA 1JXBA 1BU6O 1U45A 4DG1A 2GBZA 4E3SA 4B1VA 2KTQA 2QXFA 4M3UA 4OPJA 4JI6K 3EO3A 3UE5A 4IO8A 4A62A 4BC3A 3R1XA 1GLFO 1NU0A 1QQCA 3BF1A 4RW7A 4CESA 4FJ9A 4CJLA 4O5BA 1BL3A 1BI4B 3BY5A 3UKUA 2YI1A 5J2QA 4DV6K 3OYEA 4BWJA 1VQ7N 4NXMK 3AVNA 1NKCA 4DR7K 1QHAA 4C1NK 3FE1A 3KK2A 3Q7BA 3ASMA 2XY6A 1EETA 4BRLA 1D8YA 1HQUA 3E9LA 4AHSA 3WEEB 2Q36A 1O1WA 2YNIA 1XHXA 4DU4A 2E2NA 3CJ1A 3VF4A 4ZTJA 4Z4GA 2OA8A 3O80A 2FF3B 4FJGA 3TAFA 3C6AA 5HL7L 2QWLA 2D0AA 5HP1A 4BRNA 2ITMA 2ASPA 5C42A 2D0BA 5E41A 4HTUA 1ITGA 4DV2K 2O8DB 2E6LA 3NH2A 4BRHA 1T8EA 3P1GA 3HPGA 2YKNA 3O4WA 1C1BA 1LAVA 5ADXA 4OO1J 3NF6A 3QEIA 2HOEA 1YIJN 3LDNA 4WFBL 4FWKA 4FWLA 3DRSA 2RE2A 2VWBA 2VYPA 3CERA 2G8KA 3TAMA 2V52B 5AQTA 3QB0A 4JI5K 4KREA 1HRHA 1KTQA 3CHWA 1L3UA 3C7NA 1C0GA 2GWKA 3CPEA 3EN9A 4JKHA 1HNIA 1YAGA 2GEMA 3EYZA 2E20A 3QETA 2O8BB 2XRIA 3CQ8A 2UU9K 4R79A 2X6SA 5KPTA 2O8FB 2YHWA 3ZSXA 1NJIO 2P5OA 1KAYA 2P9PB 2CGJA 1ZBUA 1YT3A 1E4FT 4JHDA 4C23A 1U6ZA 5MLCQ 5JVHL 4DV5K 4H0YB 4O55A 3O1WA 5C12A 3OW2M 1UA1A 2HHQA 5AZIA 4CEBA 3DWLA 3FLCO 4B3TK 3WXKA 3D45A 5LY3A 1J5OA 4E1MA 3CJAA 2RPIA 3AGRA 3OYCA 4DLGA 1Q9XA 3DJCA 5IT9O 3AV9A 2NRXA 3O5BA 3TPQA 2UUAK 1RT4A 3MN9A 2XY5A 2OANA 1I39A 4JRPA 3OTOK 4DV4K 4Y1CA 3MN6A 1IBKK 3IAYA 1QQMA 5AQMA 3O1BA 4IBNA 3U3YA 1YXQA 4JV5K 2JWKA 1C0UA 1QVFM 1OVQA 1RILA 3L2UA 4FYDA 1VSKA 2YV0X 3C6UA 4K43A 4WF9L 1NGHA 2BTFA 3F2KA 5M1KA 3OBWA 3ZYYX 1EKEA 2D5RA 5BRDA 3NHGA 1HQEA 1REVA 4LFAK 3AVHA 4N56A 1SKSA 2ITGA 3EE9A 5LL6Z 4FW1A 1NBWA 4CJ4A 4J2BA 2Q0UA 3V4IA 3MX5A 4BDYA 1IJJA 2HNZA 4DR2K 4BE0A 4Z4EA 2X74A 1HNZK 4JNEA 3IRXA 4BDPA 1JLBA 3RR8A 4L8RB 2F8TA 4CEOA 3D0PA 2E4LA 4NB4A 1EXQA 2Q0RA 3B6PA 5F0XA 4M3RA 4OLBA 1D4XA 3M8SA 1KFDA 2Q1NA 3LM9A 4E7IA 1WNSA 3EKSA 1XMQK 3ZX2A 1ILYA 1HMVA 4EHTA 5IWAK 2VG6A 2E2OA 5T7BA 2RKIA 4EHUA 3FZFA 3NE6A 2ZWHA 1NOYA 3OYBA 4AQYK 1KVCA 3SAGA 4IDHA 4MLHA 2FBYA 4DUZK 4LF5K 4MDBA 2Y1JA 1NG9A 1X9MA 3H08A 4CHYA 4E19A 2HW3A 1C0FA 1Y97A 2VGMA 4N76A 3O3FA 2DFFA 1LV5A 5HRRA 5FPEA 4JI3K 4JRQA 5AQXA 4JK8A 2PYJA 3NF9A 1I94K 3CCLN 1OH7A 1VSJA 2A3ZA 3HOTA 2F9TA 2OPPA 1KSPA 3N4QA 1RDDA 1YI2N 5AJ3K 3OYJA 1U47A 4B8CA 2P9KA 5AQVA 4IKFA 2B6AA 1NGEA 3K5LA 3MXMA 3L0QA 1KVBA 3VF2A 4BVOA 4CZMA 1K8AO 4B9NA 2E1ZA 1TGOA 4QCLA 1S9EA 4FJLA 2XY8A 3HL8A 4KRFA 2W41A 3ZSVA 4MO5A 3CFRA 3QEWA 4Z94A 4U7BA 4CF0A 5C15A 1C1AA 4FPBA 3CCUN 1JCEA 3FZLA 4NO7A 1TUYA 3I33A 3AA5X 1NGJA 3Q7CA 3PX4A 1KRPA 4F8RA 1QTMA 1WOQA 4MLEA 5AR0A 3QERA 2RN2A 4DTUA 3SNNA 3ENBA 3HT3A 4KBOA 3QICA 3DOLA 4BC4A 3DLRA 3WXLA 4BDZA 3DLBA 1XI1A 1KCFA 1TYQB 4K41A 2V51B 2D0OA 1GLLO 1HYVA 5BPNA 1TK0A 4PKIA 1VSLA 1HKBA 3CCVN 2QKBA 2VG7A 2ZD1A 3C0BA 4C1NI 1FW6A 3ZT0A 3ULEB 5EVZA 3SLCA 3VGMA 3ZEUB 4B1ZA 3OJSA 3HJFA 1W2BM 3EEQA 4JHDB 2V7YA 3ZT3A 1HPMA 5AQOA 3ZT1A 1Y64A 4ELVA
chains in the Genus database with same CATH topology
3P31A 1NGAA 2ZGYA 5TKYA 3H1QA 3IUCA 5GIPA 1MA9B 5EX5A 1P8ZA 4ILHA 4YOWA 4PL8A 2IIRA 2YHXA 3SK3A 3PLAA 4CZFA 2HMPA 1RGIA 4YOVA 3D2FA 1NGIA 3N4PA 3WXMB 4JAXA 5M1FA 3O9TA 3O9RA 1KC8O 1VQ8N 4H03B 3O9UA 3D2FB 3O6WA 4CD1A 5JLHA 4IOAL 3ATUA 2A6AA 3ZETA 2WBNA 3AY9A 3VEYA 2Q31A 1VQMN 4M63C 4IZ9A 5LJVA 4RWTA 1RFQA 2P9PA 3AARA 5GINA 3R9PA 2QWQA 3FZMA 3VGLA 1RDUA 2V7ZA 3FR0A 4ILGB 3VOVA 4YORA 1BA1A 4FWQA 4WQ5C 1NLVA 3VTHA 1IG8A 1MWKA 4BR5A 1T44A 2NRRA 2P9NA 5JICA 2YJEA 3G25A 4EIAA 5CHIA 1Q86O 3C7NB 3CF5L 2ZF5O 4XH1A 2QI2A 3LDLA 4H0VB 2YCHA 1HKCA 3GL1A 2P9UB 4XEIA 4A57A 4L3QA 3VEOA 3VGKA 4B1XB 5GAGP 4BR7A 1G99A 2Q97A 5EXWA 3HZ6A 1YITN 1VQPN 2GELA 4QS8A 2QWOA 3FZKA 3R8EA 4BGAA 5KQDA 1QZ5A 1BWFO 3E9PA 5B8HA 3SBGA 1BA0A 2BUPA 5GIOA 3IDHA 4BRCA 5ELZA 3J8AA 1KXPA 3CIPA 4FWRA 3S41A 3TTDA 3ZX3A 3T69A 3I55N 5BREA 4FSVA 1NGFA 4GV6A 3HBTA 4NLBA 4CBXA 2ASMA 3H6EA 1K8KA 1NGCA 2FF6A 1ZC6A 5C2FA 2JWLA 3CI5A 4ISEA 1MDUB 4FWMA 1GLDG 1NM1A 4XH5A 1VQLN 5AQIA 4A61A 3FZHA 2ASOA 1GLJO 4WQ4A 3A5OC 3GDQA 1KAXA 4BC5A 1RDWX 3KVGA 4WQ5A 2EWSA 2QWNA 2VCPA 3TTFA 4YDUA 3O9SA 3UB5A 4ISFA 4BRFA 4GY2B 3G71N 4WCEL 1GLCG 1X9JA 2GWJA 1ESVA 4KH6A 3GG4A 5FPMA 1SAZA 4I6MB 2WFBA 1CZAN 2QA4N 5CR4A 1X3NA 3M1FA 4JEPA 5BN9A 3AGKA 1SQKA 2KHOA 4I6MA 4CBUA 5AQPA 3NVKA 2J4RA 4FVUA 3O8MA 3CCSN 1XUPO 4JKEA 3U8XA 4ILJA 3D2EA 5LJWA 2HBLA 3P38A 5AQRA 2Q2RA 2P9IA 4PHTX 2HSTA 4JK9A 4PKHA 5BPMA 1BU6O 2E2PA 4CJ7A 5M1PA 3M3ZA 1BUPA 1S3XA 1T3VA 3KHYA 4IXCA 4IWVA 5AQSA 5GADP 2GTDA 5I9EB 4GV9A 4B1VA 5BPLA 2HBJA 4B9QA 3SBTA 3GBTA 1MWMA 3DAWA 3EO3A 3UE5A 4IO8A 3W0LA 4A62A 3QDKA 4A59A 2P9UA 3WXJA 1DEJA 2GX9A 4BC3A 4CZKA 2A42A 3R1XA 3UKRB 1GLFO 3BF1A 5TKWA 3QBXA 3CQYA 4BGBA 3P39A 3UKUA 2YI1A 4XH4A 3U4LA 1DT9A 1LOTB 3H3OB 4IJNA 1NGGA 2NNWA 3CJBA 5AQKA 1VQ7N 3J7ZO 2E88A 3TSUA 4IOCL 1HUXA 4E1JA 4H5TA 1QHAA 4C1NK 5AFUA 2QWMA 1QVGM 3FE1A 3Q7BA 2W40A 2PBDA 3EL2A 4BRLA 4CZLA 1KD1O 1WUAA 4F9OA 3E9LA 1NGDA 3CETA 3AAPA 4BRMA 3EZWA 3WEEB 2P9SA 2Q36A 4QS7A 5M1OA 4J8FA 3HOSA 2KKZA 3ID8A 4YOXA 2OTJN 2E2NA 5AQFA 3VESA 1BOTO 2E8AA 3CJ1A 5DM7L 4AM6A 4FOIA 3VF4A 3FGUA 3MN7A 4CI6A 5KPRA 4WYBA 3KWGA 3O80A 4AM7A 2KLAA 2P9LA 5M1QA 3CC2N 3DLLL 2DPNA 2FF3B 3C6AA 3DXMA 5EY4A 3A5LC 5HL7L 3R3LA 4G9ZA 2QWLA 4BQLA 1VQ9N 4JKGA 3EE8A 4BRNA 1EO1A 1S72N 4CZJA 3MWPA 2ITMA 1M1KO 1KQSM 2ASPA 1JJ2M 2YJFA 3D2EB 2NRWA 4BRIA 3QFUA 1HLUA 4BRQA 3CC7N 4BRHA 4GV3A 1YF5L 3E66A 3CCMN 3O4WA 1TYQA 3QFPA 4M7XA 1U2VB 4O8KA 3CC4N 3DXKA 3HI0A 2QWPA 1E4GT 1ZXOA 1U2VA 3I8BA 4FOEA 5JLFA 3LL3A 5ADXA 4OO1J 4CZIA 4B1UB 3G6EN 4EFHA 2HOEA 1YIJN 1NJIO 3LDNA 4WFBL 4FWKA 4JN4A 4FWLA 3VEWA 3KWIA 1ATSA 5AQJA 1VAZA 3KZBA 5AQLA 5JMVA 2RE2A 3RSEB 2VWBA 2VYPA 1YUWA 3CERA 1YJ9N 5BR9A 3L4IA 2VGNA 4FPAA 4ISGA 4IFEA 2ZJRL 2V52B 5AQTA 3QB0A 3ATVA 5CE3A 1Q18A 1BO5O 4JD2A 3U9ZA 4BROA 4NLCA 2NRTA 4YOYA 4FWNA 2NZTA 2P9KB 2NRHA 5F1XA 4RCHA 3CHWA 4H0OA 2I7NA 5HOOA 1HJOA 3C7NA 2E2QA 3A5MC 4DB3A 1V4SA 2UYTA 1C0GA 1QQNA 2I7PA 2GWKA 3ID6A 1YVNA 3SJHA 3CPEA 3EN9A 3K9KA 4JKHA 3TTCA 1YAGA 3I56N 3G4SN 3WEEA 1VQ6N 2GEMA 4H0PA 2E20A 1JCGA 3BP8A 5GAHP 4R79A 5KPTA 2H3GX 3CQXA 3WXIA 2YHWA 3TSQA 2QTDA 2WC9A 5EOYA 3CCJN 3M6GA 1KAYA 2AP1A 2IVOA 2P9PB 1Q82O 2CGJA 1H1VA 1K73O 3KK7A 3H46O 3IKMA 4FWSA 4GNIA 1E4FT 2NRVA 4H5WA 4JHDA 1U6ZA 2QM1A 4JKDA 3VF6A 4C23A 5AZJA 5MLCQ 3CPWM 5JVHL 3NVMA 4H0YB 5AZIB 3O1WA 3JS6A 3ZETB 4BRPA 5C12A 2E1YA 2HBMA 3OW2M 5BRFA 5AZIA 1LCUA 3BF3A 3DWLA 3FLCO 3H1VX 3QBWA 3VERA 1KAZA 3O9QA 3WXKA 2ZJPL 1GLBG 5LY3A 3CJAA 5C10A 3CCEN 3AGRA 3DJCA 5AQHA 4AF1A 3SAHA 4JK7A 2QW9A 1ZBSA 2NRXA 3MCPA 1TUUA 2D4WA 3F9MA 3O5BA 5AQNA 4MO4A 5F2RA 3TPQA 3WT0A 3MN9A 4BY9C 3ULEA 1O13A 3HTVA 2HBKA 4H5VA 3IFRA 2OANA 4IO9L 2CH5A 3D7EO 3MN6A 1NWKA 1HX1A 4YDUC 1QQMA 1ATNA 5AQMA 2QWRA 1K8KB 3O1BA 5FPDA 1K9MO 1YXQA 2JWKA 4IOXA 4BQZA 4DHYA 1QVFM 2P9NB 1J6ZA 2D0PA 4FWPA 3SAFA 2F7TA 3CCRN 4KH5A 4BR2A 3CJCA 1NGBA 4YOUA 3A0IX 4CBWA 5E26A 4K43A 4WF9L 1NGHA 2BTFA 2HF3A 1Q81O 3CD6N 4CZEA 4DQ8A 5BN8A 3F2KA 5M1KA 3OBWA 1BG3A 3ZYYX 1VQKN 4A5AA 1SZ2A 3ENOA 4WFAL 2GUPA 3VETA 4JKFA 4B1YB 1ATRA 3MX2A 3VPZA 3UKUB 2CGKA 5BRDA 3CXCM 4JKCA 2BH1A 2PFUA 5AQZA 4A2BA 3EE9A 1NBWA 5BRHA 4DKWA 4PKGA 2Q0UA 3L4QA 3VENA 3MX5A 5DM6L 3RVCA 1NMDA 2D1KA 1IJJA 5E84A 3WQUA 4LC9B 2P9IB 4WQ4C 4JNEA 2ZGZA 1EQYA 3SMSA 4BG9A 5ADXH 2FXUA 3B8AX 4IJAA 3VEZA 4NB4A 4BG8A 3A8YA 5AQGA 3CJ9A 2Q0RA 5F0XA 3EKUA 4HTLA 3ENHA 1D4XA 2QEXN 3UKRA 5AQWA 3LDPA 3A5NC 2Q1NA 4KH4A 3O08A 3LM9A 3C65A 3EKSA 2OTLN 1Z05A 3GE1A 4BR9A 2IVPA 3FFKB 3ZX2A 1ILYA 4EHTA 1X3MA 3HRGA 4U67L 3U9DA 2E2OA 1DGKN 3T7ZA 4EHUA 4GVEA 3FZFA 2ZWHA 1S22A 5M1NA 3SAGA 4IDHA 2QXLA 4MLHA 3MWTA 4M7YA 2PAVA 4BRDA 4MDBA 3SMPA 5JVGL 2YHYA 4OPHA 3E1YA 3MK6A 1OVYA 1N8RO 4A2AA 3DXKB 3OBYA 1XC3A 4JKBA 1C0FA 4CZGA 5AQYA 4IEIA 2YX6A 2VGMA 3L6QA 4O5FA 2RHKA 3VEXA 4BVPA 5FPNA 3HM8A 5FPEA 1BDGA 3D6RA 5AQXA 1M90O 4JK8A 3CCLN 4H5NA 3RSEA 4DCHA 4WFNL 2A3ZA 3HOTA 3MDQA 4CD3A 4BRGA 4FWOA 3GOIA 2F9TA 4JKGB 1T6DA 2FSKA 2A41A 3N4QA 1Q7YO 5GAEP 1XQSC 1YI2N 4BRKA 3JXUA 3MCAB 2P9KA 3TSPA 5AQVA 1V4TA 1NGEA 1GLEG 3MN5A 4JKAA 1T6CA 3L0QA 4YOTA 2WUSA 3CMEN 1R59O 3VF2A 4MDAA 4BVOA 3E9OA 4BC2A 4CZMA 1K8AO 2P9SB 2E1ZA 4K42A 3F5TA 2CH6A 3VEVA 3OA9A 3AAQA 1DKGD 5KPZA 3K9JA 3BEXA 2W41A 3W3DA 4FO0A 2FSJA 4K25A 4MO5A 4Z94A 4FL9A 4U7BA 2A40A 1VQON 3H45C 4BR0A 3DXMB 3BUZB 3NMUA 5C15A 4HWIA 5H1SQ 1QQOA 3VTIA 3C6HA 3IMXA 4FPBA 4RTFD 3CCUN 1JCEA 1QZ6A 1VQNN 3FZLA 4NO7A 1Z6RA 1TUYA 3I33A 3WUHA 4UY8O 1NGJA 3Q7CA 4H0XB 1WOQA 5C0YA 4MLEA 3PIOL 5AFUH 5AR0A 5KQ8A 4OPAA 3LDQA 1JCFA 1W97L 4BRAA 3ENBA 3WQTA 3CCQN 4KBOA 3QICA 4BC4A 5C2DA 1SS6A 2NLXA 1OKJA 3WXLA 4BREA 2ZJQL 3P4IA 4O8UA 4Y0WA 1TYQB 2FLOA 4A5BA 3VMFB 4H0TB 1GLAG 3LDOA 3MMVA 4K41A 2V51B 2AA4A 5AQQA 3TU5A 3LM2A 1YJWN 2D0OA 1GLLO 3CJ7A 3H3NO 4B1WB 4IEEA 5BPNA 4H5RA 4PKIA 3ZX0A 2FSNA 3CMAN 1HKBA 1HKGA 4EAHD 3QMLA 3CCVN 4PL7A 3C0BA 4BR4A 2P9LB 4C1NI 3ZEUA 4CZHA 3M5RA 1YHQN 1VQ5N 4QS9A 2NRZA 3ULEB 5EVZA 2A5XA 3SLCA 3R6MA 3VGMA 3ZEUB 2F9WA 4B1ZA 1YJNN 1W2BM 1VQ4N 4JHDB 2V7YA 5AZJB 1P90A 2IVNA 3OHRA 1HPMA 4JD2B 5AQOA 3PIPL 2CGLA 1Y64A 3HSCA 2HF4A 5AQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAH P;  4U67 L;  1Q82 O;  1NJI O;  3CCJ N;  1K73 O;  5MLC Q;  5JVH L;  3CPW M;  5JVG L;  1VQ8 N;  1KC8 O;  3OW2 M;  1OVY A;  1N8R O;  4IOA L;  1VQ7 N;  3J7Z O;  4IOC L;  1VQM N;  2ZJP L;  1QVG M;  1M90 O;  3CCE N;  3CCL N;  1KD1 O;  4WFN L;  2OTJ N;  1Q86 O;  3CF5 L;  1Q7Y O;  5GAE P;  1YI2 N;  5DM7 L;  5GAG P;  4IO9 L;  3CC2 N;  3DLL L;  1YIT N;  1VQP N;  3CME N;  1K9M O;  5HL7 L;  1K8A O;  1QVF M;  1VQ9 N;  1S72 N;  3CCR N;  1KQS M;  1M1K O;  1JJ2 M;  4WF9 L;  1Q81 O;  3CD6 N;  3I55 N;  3CC7 N;  1VQK N;  1VQO N;  4WFA L;  3CCM N;  5H1S Q;  3CCU N;  3CC4 N;  1VQN N;  3CXC M;  1VQL N;  4UY8 O;  3G6E N;  3PIO L;  1YIJ N;  4WFB L;  5DM6 L;  3G71 N;  3CCQ N;  2ZJQ L;  4WCE L;  1YJ9 N;  2QA4 N;  1YJW N;  3CCS N;  3CMA N;  3CCV N;  1VQ5 N;  1YHQ N;  2QEX N;  1YJN N;  1W2B M;  1VQ4 N;  3G4S N;  5GAD P;  2OTL N;  1VQ6 N;  3I56 N;  3PIP L;  2ZJR L;  1ILY A; 
#chains in the Genus database with same CATH topology
 4N5S A;  2FBX A;  3H1Q A;  4FLV A;  3THV A;  4ILH A;  4YOW A;  3PSF A;  1NJZ A;  1TK8 A;  3D2F A;  3ZSO A;  3N4P A;  3WXM B;  4I9L A;  2BAN A;  3O9T A;  4JS4 A;  4CEF A;  1L5U A;  3L8B A;  1LW0 A;  1CLQ A;  2A6A A;  1TL1 A;  4M63 C;  4IZ9 A;  3VA3 A;  3AAR A;  3R9P A;  4ID1 A;  4FZZ A;  1RDU A;  4DQS A;  1S5J A;  1X9S A;  3VTH A;  4CK1 A;  2DFH A;  4BR5 A;  4C8L A;  2VWK A;  1BQN A;  5CHI A;  4XH1 A;  1SL2 A;  2QI2 A;  3GL1 A;  4XEI A;  3VGK A;  5EXW A;  2GEL A;  3G10 A;  3FZK A;  4Z0U A;  4PA1 A;  3VQ9 A;  3KJV A;  2BUP A;  4DQI A;  4HVJ A;  2I5J A;  1VRT A;  1VSM A;  4W5N A;  1RTJ A;  3CIP A;  1HYS A;  1RT6 A;  3TTD A;  3KK3 A;  3T69 A;  3HP9 A;  5BRE A;  3WNG A;  1WN7 A;  1BIU A;  4FZX C;  3VA0 A;  2FF6 A;  3CI5 A;  1ASV A;  4XH5 A;  5J2N A;  4A61 A;  3FFI A;  3FZH A;  2ASO A;  3GDQ A;  1KAX A;  4WQ5 A;  2EWS A;  4BRF A;  4YDU A;  3LWM A;  3JSM A;  4ISF A;  2F96 A;  4GY2 B;  1A5V A;  5EU7 A;  2GWJ A;  4KH6 A;  3GG4 A;  1J9A A;  2WFB A;  1CZA N;  2O4G A;  5KTQ A;  1X3N A;  4JEP A;  5BN9 A;  4R5P A;  3AGK A;  1T7P A;  4X66 K;  1NKB A;  1NMN A;  3QNN A;  4HCB A;  4J2E A;  3U8X A;  4OLA A;  3P38 A;  2Q2R A;  2P9I A;  4PHT X;  4LF7 K;  3JYT A;  4CJ7 A;  5M1P A;  1NK4 A;  1BUP A;  1T3V A;  4IXC A;  4KI6 A;  4IWV A;  2GTD A;  5I9E B;  3B6O A;  1FK9 A;  4YY3 K;  4B9Q A;  3SBT A;  1MWM A;  4CHZ A;  4DS5 A;  4FJ7 A;  3W0L A;  3VQC A;  1TVR A;  3QDK A;  4A59 A;  2P9U A;  3PSI A;  3WXJ A;  4CJP A;  4CK2 A;  1VSF A;  4KO0 A;  1KFS A;  3T3F A;  5TKW A;  3QBX A;  3CQY A;  1RT1 A;  4CJR A;  3ISN C;  4XH4 A;  3AO3 A;  2X78 A;  3T19 A;  1NGG A;  3C95 A;  3WNE A;  3J7Z O;  2E88 A;  1SUQ A;  4E1J A;  1N33 K;  4H5T A;  4CIF A;  3P83 D;  4RW6 A;  3V6D A;  3OYH A;  2PBD A;  3L2W A;  4OX9 K;  1WUA A;  1NGD A;  3EZW A;  4QS7 A;  1ASW A;  5M1O A;  4J8F A;  1RDC A;  2KKZ A;  4YOX A;  1C0T A;  4MQ3 A;  2E8A A;  2FBT A;  3LAL A;  4AM6 A;  3RRG A;  3DLL L;  4CJW A;  3DOK A;  1OH8 A;  5EY4 A;  3A5L C;  4BQL A;  4C8K A;  4DWI A;  4FJN A;  2NRW A;  4FK4 A;  3CC7 N;  2IOC A;  5FRO A;  3K58 A;  1A5W A;  3NF7 A;  1TYQ A;  4M7X A;  1U2V B;  3DXK A;  3HI0 A;  4KB1 A;  3CM6 A;  3LL3 A;  5J1E A;  2Y1I A;  1UAX A;  1I3A A;  4EFH A;  1UOC A;  1W0H A;  1SL0 A;  1NKE A;  3KWI A;  1ATS A;  3TAG A;  1NK9 A;  3RSE B;  4DQR A;  5BR9 A;  3L2R A;  3L4I A;  4CHP A;  1TKT A;  5CE3 A;  1BO5 O;  3OY9 A;  1RBR A;  1RDB A;  4KTW A;  4JI4 K;  2NRT A;  2A1R A;  3THW B;  2OYQ A;  2NZT A;  4RCH A;  1N32 K;  4FJM A;  4CHQ A;  3CM5 A;  1SKR A;  2I7P A;  4IFV A;  3TTC A;  3G4S N;  3K9K A;  2KFN A;  4FJK A;  4JI8 K;  3CQX A;  3WXI A;  1L3T A;  1RCH A;  2X6N A;  3M6G A;  1XC9 A;  2AP1 A;  5A2Q O;  2HMI A;  1H1V A;  3QES A;  3H46 O;  3IKM A;  4H5W A;  4FJJ A;  3NVM A;  4FLW A;  1WSF A;  3NGY A;  4FCY A;  4LD0 A;  1TKZ A;  1EX4 A;  3VER A;  1BIS A;  3QBW A;  3SV4 A;  2O4I A;  2IDO A;  3P5J A;  1EWQ A;  3HST B;  4YFU A;  3MCP A;  3THX B;  5F2R A;  2D4W A;  4MO4 A;  3C94 A;  4CJE A;  1HNV A;  2HBK A;  4DR1 K;  4H5V A;  3RTV A;  1S1V A;  2VG5 A;  2CH5 A;  3D7E O;  3LAK A;  3VQE A;  3EZ5 A;  4YDU C;  1C0M A;  5FPD A;  3L2V A;  4DTX A;  4IOX A;  3K5O A;  4BQZ A;  3NCI A;  2P9N B;  1Z25 A;  4FWP A;  4K8Z A;  4KB0 A;  3QIN A;  3CCR N;  4KH5 A;  3CJC A;  2G8W A;  4CBW A;  5E26 A;  1Q81 O;  1E3M A;  5BN8 A;  4Z4H A;  3ENO A;  1HJR A;  3DLG A;  1RTD A;  2CGK A;  4JKC A;  5AQZ A;  2XY7 A;  1SV5 A;  4PKG A;  3L4Q A;  3AA4 A;  1VHX A;  5E84 A;  1U48 A;  4E7L A;  2P9I B;  4OKE A;  1HNW K;  2FXU A;  4IJA A;  3VEZ A;  4BG8 A;  5AQG A;  3CJ9 A;  3CYM A;  3EKU A;  5CZ1 A;  4HTL A;  3PO5 A;  3ENH A;  4AHU A;  2QEX N;  4E1N A;  2PZS A;  3LDP A;  3QNO A;  3A5N C;  4KH4 A;  4CGG A;  2VQE K;  4NCB A;  4DSE A;  3BZC A;  2OTL N;  4OJR A;  3GE1 A;  4DTJ A;  4KFB A;  1S6Q A;  4FJH A;  3HRG A;  4B9S A;  4U67 L;  1DGK N;  2HB5 A;  4B9T A;  2QXL A;  4X62 K;  4BRD A;  3V9X A;  4ELT A;  3V1Q A;  1RT5 A;  3MK6 A;  3AVA A;  1K6Y A;  3DRR A;  4JKB A;  1XC3 A;  4CEE A;  4CZG A;  2XHB A;  5AQY A;  4M3X A;  1Q9Y A;  4CEQ A;  1J53 A;  3VEX A;  4DF8 A;  2OCE A;  1BDG A;  3D6R A;  4EP5 A;  3T1H K;  4B3S K;  1M90 O;  3DLK A;  3OS0 A;  3MXJ A;  4H5N A;  4BRG A;  4KV8 A;  1T6D A;  1NOZ A;  4YNQ A;  2A41 A;  1Q7Y O;  1ZBI A;  4BRK A;  3JXU A;  1V4T A;  1C6V A;  1GLE G;  2WUS A;  3CME N;  1JKH A;  3E9O A;  2P9S B;  4K42 A;  2CH6 A;  3VEV A;  2KQ2 A;  3LPT A;  3MEE A;  5KPZ A;  1S6P A;  2D0C A;  2FSJ A;  3AVL A;  4BAC A;  2A40 A;  3H45 C;  3BUZ B;  1BCM A;  3AA3 A;  4DF4 A;  2QK9 A;  3A2F A;  4HUF A;  4FZY A;  1Z6R A;  4UY8 O;  1X9W A;  1JL2 A;  4O0I A;  5C0Y A;  4UQG A;  3VQ8 A;  4OPA A;  3LDQ A;  4RW8 A;  1SS6 A;  2NLX A;  3KD5 E;  3SZ2 A;  3P4I A;  4Y0W A;  4A5B A;  4WE1 A;  4H0T B;  2FC0 A;  3BDP A;  3TU5 A;  5I3U A;  2AA4 A;  3G0Z A;  3LAM A;  3QIP A;  4KTQ A;  4CFD A;  4B1W B;  5D3G A;  4H5R A;  4AHR A;  3ZX0 A;  3CMA N;  4K8X A;  4EAH D;  4JI7 K;  3HPO A;  4H8K A;  4QS9 A;  2NRZ A;  3ZSQ A;  5HRP A;  3HK2 A;  4LF4 K;  5HRS A;  2ZE2 A;  1VQ4 N;  3QEV A;  3KLH A;  3M8R A;  2IVN A;  4FVM A;  3HSC A;  1NJY A;  2ZGY A;  2WTU A;  3LWL A;  4JI0 K;  5GIP A;  5EX5 A;  3SUP A;  4CF2 A;  1P8Z A;  4B8A B;  1S1T A;  4I7F A;  3PLA A;  4MFB A;  1NGI A;  1F21 A;  3O9R A;  5LMN K;  1KC8 O;  4H03 B;  4F4K A;  1OH5 A;  3O9U A;  1HR0 K;  2BDP A;  2O8E B;  4NCG A;  5JLH A;  4IOA L;  2HNY A;  1HNX K;  4O0J A;  1RBV A;  1Q8I A;  2WBN A;  4Q0B A;  3VEY A;  1VQM N;  1RFQ A;  4Y1D A;  3OYI A;  5GIN A;  4DTO A;  3FZM A;  3VGL A;  2UUB K;  4W5O A;  4FWQ A;  3PV8 A;  1IG8 A;  3KKS A;  4W5R A;  2P9N A;  1WSG A;  3G25 A;  1Q86 O;  1TKX A;  1Z26 A;  3C7N B;  3CF5 L;  3O4N A;  4GMJ B;  2P9U B;  4IG3 A;  4L3Q A;  4BR7 A;  3OS2 A;  3J81 O;  1YIT N;  2QKK A;  1VQP N;  1TKD A;  2O8B A;  2QWO A;  3R8E A;  4YHH K;  1QZ5 A;  5GIO A;  4OPK A;  2EHG A;  4DU3 A;  1LWE A;  1MU2 A;  1RT2 A;  1KXP A;  4FWR A;  3ZX3 A;  3M8P A;  4CHN A;  3HP6 A;  3HBT A;  5CY4 A;  3PX6 A;  2KZM A;  4E89 A;  2Q3S A;  1K8K A;  1FJG K;  3RRH A;  1NGC A;  1ZC6 A;  2JWL A;  1CZB A;  1MDU B;  1KVA A;  1VQL N;  5AQI A;  4WQ4 A;  1GLJ O;  4BC5 A;  1JLA A;  3HVT A;  2ATQ A;  3CFP A;  3NGZ A;  2UUC K;  4EP4 A;  4DR3 K;  3ZT2 A;  3G71 N;  1GLC G;  1X9J A;  1SAZ A;  5CR4 A;  3V81 A;  4I6M A;  2HHH K;  1N5Y A;  2J4R A;  4FVU A;  3O8M A;  4BE2 A;  3CCS N;  1XUP O;  4ILJ A;  5LJW A;  5AQR A;  2O8C A;  4JK9 A;  4PKH A;  5BPM A;  1N36 K;  3M3Z A;  4JI2 K;  5GAD P;  3IS9 A;  4GV9 A;  3ZSW A;  5I42 A;  2HBJ A;  4ELU A;  1GOA A;  4KKO A;  4CCH A;  2W6L A;  3T1Y K;  1DEJ A;  3SPZ A;  4CZK A;  2BE2 A;  2A42 A;  4BGB A;  3UKR B;  5LMU K;  4CW7 B;  3LP1 A;  1WBB A;  1QSS A;  3VN5 A;  1LOT B;  3LPU A;  4DS4 A;  3H3O B;  1RDA A;  4IJN A;  2NNW A;  5AQK A;  4F3T A;  2UXC K;  3TSU A;  4IOC L;  4NXN K;  1HUX A;  3O3G A;  1W7A A;  1T03 A;  4LH4 A;  3THW A;  3L2Q A;  3RMA A;  2QWM A;  1QVG M;  4I2P A;  5C25 A;  4DUY K;  4FK2 A;  1RT3 A;  1W9H A;  4CZL A;  1KD1 O;  4CED A;  3LP2 A;  3CET A;  3HYF A;  4BRM A;  3CG7 A;  4C8O A;  4DMN A;  2P9S A;  5KRT A;  4DSF A;  3AVG A;  3HOS A;  3ID8 A;  3V1O A;  3QLH A;  4CJV A;  3AO5 A;  3KD1 E;  5DM7 L;  3FGU A;  4WYB A;  3KWG A;  3S3N A;  1BQM A;  2P9L A;  3CC2 N;  3BZK A;  3ZCM A;  3R3L A;  4RW4 A;  5HLF A;  4DQP A;  3EE8 A;  1EO1 A;  2OPQ A;  4LF8 K;  2YHB A;  3D2E B;  2HHX A;  4BRI A;  4OGC A;  4BRQ A;  3K5M A;  3SCX A;  3E66 A;  1L3S A;  3CCM N;  1KLN A;  3OYL A;  3CC4 N;  2QWP A;  4ICL A;  1E4G T;  2UXD K;  2E6M A;  3I8B A;  3NAE A;  5JLF A;  4CZI A;  4Z4C A;  1OH6 A;  2IAJ A;  3VEW A;  1VAZ A;  3AVF A;  3OYD A;  2Z1J A;  1YJ9 N;  2VGN A;  4FPA A;  3ATV A;  4BRO A;  3U9Z A;  4CGH A;  4NLC A;  4YOY A;  1N6Q A;  2P9K B;  5F1X A;  3AO2 A;  2A1S A;  5HOO A;  1HJO A;  4DB3 A;  3AA2 A;  1QQN A;  1YVN A;  4G9Z A;  3NBP A;  4CJT A;  2ETJ A;  1J5E K;  4KHP K;  2UXB K;  1JCG A;  4F3O A;  1NK7 A;  3BP8 A;  5GAH P;  4FLU A;  3I0S A;  1ASU A;  2H3G X;  1QHT A;  4OGE A;  1X1P A;  4OVL A;  2QTD A;  4GW6 A;  2IVO A;  1K73 O;  4PWD A;  3QEP A;  3KK7 A;  4FWS A;  4GNI A;  2P5G A;  4V19 S;  2QM1 A;  3VF6 A;  3C6T A;  5AZI B;  3J7Y P;  3ZET B;  3JS6 A;  3SV3 A;  4BRP A;  3SI6 A;  4IFY A;  1GOB A;  2E1Y A;  2HBM A;  3NF8 A;  3AVK A;  1LCU A;  3BF3 A;  3H1V X;  3MAQ A;  4LFB K;  2HVH A;  3SUO A;  3DM2 A;  5C10 A;  4CF9 A;  4RG8 A;  4B3R K;  5KGW A;  5AQH A;  1JLF A;  4AF1 A;  1ZBS A;  2HHV A;  3WT0 A;  4BY9 C;  3ULE A;  1O13 A;  3THY A;  4HUE A;  3SJJ A;  3IFR A;  4B3M K;  4DSK A;  1NNE A;  1NWK A;  1HX1 A;  4AH9 A;  1ATN A;  2QWR A;  1K8K B;  1TK5 A;  4HHT A;  3OYG A;  2D0P A;  4BR2 A;  1NGB A;  3TAE A;  1FKO A;  1VSD A;  4M3Y A;  2HF3 A;  3DYA A;  3V9U A;  3V9W A;  4DSJ A;  4DV0 K;  1TAU A;  1BG3 A;  1VQK N;  4WFA L;  2EX3 A;  3VET A;  3HO1 A;  1ATR A;  3ZSZ A;  1HYZ A;  3MX2 A;  1BI4 A;  3I0R A;  2FBV A;  3UKU B;  4AHC A;  3CXC M;  2BH1 A;  2F4V K;  3KLI A;  1FXX A;  5DM6 L;  1NMD A;  3WQU A;  3CFO A;  3ALY A;  2OPS A;  2ZGZ A;  1IKV A;  3RMC A;  4JLH A;  4BG9 A;  1NK8 A;  4KI4 A;  1LWF A;  3HXM A;  4ID5 A;  4O44 A;  1WSJ A;  1WLJ A;  1RBT A;  1KLM A;  1A5X A;  4FK0 A;  3UKR A;  5AQW A;  4FW2 A;  4PUO A;  1X3M A;  3J7A P;  1XWL A;  4N47 A;  4M3T A;  3U9D A;  3L3U A;  3VQD A;  3T7Z A;  4FXD A;  3OYK A;  4GVE A;  3TR8 A;  1S22 A;  4CK3 A;  5CZ2 A;  4E0D A;  4FLX A;  3MWT A;  3AVB A;  4M7Y A;  2PAV A;  4OKK A;  3SMP A;  4RW9 A;  5JVG L;  3MED A;  3E1Y A;  3UIQ A;  1OVY A;  3BGR A;  4A2A A;  4DFJ A;  4CIE A;  1FKP A;  2OZM A;  4FLY A;  4IEI A;  2YX6 A;  3L6Q A;  2IGI A;  3LAN A;  4O5F A;  2RHK A;  5FDL A;  3SQ4 A;  3HM8 A;  2HHU A;  1C1C A;  1VSE A;  4DCH A;  4WFN L;  2G8I A;  2HHS A;  4CGI A;  3GOI A;  4X65 K;  5HRO A;  3VQQ A;  2FSK A;  1S9G A;  1LAW A;  5GAE P;  1WAF A;  3MCA B;  4H4M A;  3TSP A;  3MN5 A;  1T6C A;  2JGU A;  3KKR A;  3TI0 A;  1R59 O;  4MDA A;  4BC2 A;  1DLO A;  5KI6 A;  2G8V A;  3F5T A;  3SUQ A;  4FJ8 A;  2G8F A;  2YNG A;  3OA9 A;  3AAQ A;  1IKX A;  1DKG D;  3K9J A;  1JLE A;  3BEX A;  4F2R A;  2F8S A;  1VQO N;  4CFC A;  4BR0 A;  3DXM B;  5FLX O;  3NMU A;  5C24 A;  5H1S Q;  1QQO A;  3VTI A;  3C6H A;  3IMX A;  4RTF D;  4HUG A;  1VQN N;  1QZ6 A;  4KHS A;  4DSL A;  1YVU A;  1UWB A;  4LSN A;  4E7H A;  3PIO L;  5AFU H;  4FM1 A;  5KQ8 A;  4B9L A;  1JCF A;  4BRA A;  3CCQ N;  4C8N A;  5C2D A;  3ZLJ A;  2BGG A;  2NUB A;  1OKJ A;  4CVN E;  3O4Q A;  3VMF B;  1GLA G;  3MMV A;  3LM2 A;  3CJ7 A;  1NK6 A;  3H3N O;  3HM9 A;  4DSI A;  2FSN A;  1RTI A;  1HKG A;  4PL7 A;  2Z1I A;  3ZEU A;  4CZH A;  1VQ5 N;  3WNH A;  4G1Q A;  5J2M A;  2A5X A;  3DMJ A;  4CJ3 A;  3R6M A;  2F9W A;  3K57 A;  3VQ7 A;  2WOM A;  3OS1 A;  4JD2 B;  3PIP L;  2CGL A;  3ZET A;  2LSN A;  2P51 A;  2HF4 A;  2W42 A;  3P31 A;  1JLQ A;  1NGA A;  5TKY A;  1ZBH A;  5JS2 A;  4GKK K;  4CIG A;  4N41 A;  2YHX A;  4PY5 A;  3E01 A;  1SKW A;  4JAX A;  4CGD A;  4CEZ A;  3EY1 A;  1CZ9 A;  3D2F B;  3DLE A;  1B9F A;  1DTQ A;  3KLF A;  3TAR A;  4IG0 A;  5LJV A;  4ILG B;  3VOV A;  3RMD A;  5DK5 A;  4CJS A;  3ZT4 A;  1MWK A;  1T44 A;  3IG1 A;  3HVR A;  2YHA A;  2ZF5 O;  1HKC A;  4A57 A;  5GAG P;  1IG9 A;  1IO2 A;  4CHO A;  4KHU A;  4CJK A;  3VQ5 A;  3PY8 A;  1BWF O;  3E9P A;  3SBG A;  1BA0 A;  3IDH A;  4BRC A;  3VQ6 A;  5DMR A;  3J8A A;  2IC3 A;  4ZTF A;  5KRS A;  1EP4 A;  1TV6 A;  4FSV A;  1NGF A;  4M3W A;  4NLB A;  4I9Q A;  1ZBF A;  4E7K A;  1B9D A;  4CJU A;  2R7Y A;  2GV9 A;  4FWM A;  1NM1 A;  2XO7 A;  4FM2 A;  3KK1 A;  1RDW X;  1XNR K;  3LP3 A;  3TTF A;  3O9S A;  4FM0 A;  1NJX A;  4WCE L;  4OKJ A;  4M42 A;  4K0K K;  2JLE A;  3OYM A;  3M1F A;  4CBU A;  3V1R A;  5AQP A;  3NVK A;  4DR5 K;  4LF6 K;  3M8Q A;  1IH7 A;  4JKE A;  4J2D A;  2YNH A;  3D2E A;  2HBL A;  2HST A;  3L3V A;  2E2P A;  4LSL A;  3AO4 A;  3KHY A;  1S3X A;  5AQS A;  1J54 A;  4H4O A;  5BPL A;  3GBT A;  4DTP A;  3DAW A;  4KTZ A;  3NFA A;  4DTS A;  2GX9 A;  2KZZ A;  3P39 A;  3NGI A;  1BCO A;  4ZHR A;  4EZ9 A;  1VSI A;  3U4L A;  1DT9 A;  1QSL A;  3VQB A;  3CJB A;  1CXQ A;  1WSH A;  5AFU A;  3MXI A;  3DI6 A;  4FJI A;  2W40 A;  3EL2 A;  4F9O A;  4NCA A;  4FLT A;  3AAP A;  1YTU A;  2KW4 A;  2OTJ N;  5AQF A;  3MEC A;  3VES A;  1BOT O;  3OYA A;  4FOI A;  4CFB A;  3MN7 A;  4CI6 A;  5KPR A;  4AM7 A;  2KLA A;  5M1Q A;  3TAB A;  2DPN A;  3AVC A;  3DXM A;  1VQ9 N;  4JKG A;  4F2S A;  3TWH A;  1S72 N;  4CZJ A;  3MWP A;  1XMO K;  1M1K O;  1KQS M;  1JJ2 M;  1BGX T;  2YJF A;  4DV7 K;  3S3O A;  3QFU A;  1HLU A;  3KLG A;  3PO4 A;  4GV3 A;  1YF5 L;  1WSI A;  3QFP A;  4O8K A;  5SZT A;  2WON A;  2AJQ A;  1ZXO A;  4DU1 A;  1U2V A;  2W6K A;  4FOE A;  4KAZ A;  3QEX A;  4B1U B;  3G6E N;  4W5T A;  4JN4 A;  5AQJ A;  4X64 K;  3LZI A;  3KZB A;  5AQL A;  5JMV A;  1YUW A;  3ZSY A;  2HHT A;  4ISG A;  4IFE A;  3MEG A;  1JLG A;  3HPH A;  1Q18 A;  1CXU A;  4JD2 A;  1U04 A;  4B9U A;  5HBM A;  1U4B A;  4FWN A;  1WSE A;  5FRM A;  4KHQ A;  2VWJ A;  2NRH A;  1N34 K;  4H0O A;  3VQA A;  2I7N A;  3SQ0 A;  2E2Q A;  3OVN A;  3A5M C;  4J2A A;  3SPY A;  1V4S A;  2UYT A;  4JS5 A;  4DQQ A;  3K59 A;  3ID6 A;  3SJH A;  1VQ6 N;  5BR8 K;  3I56 N;  3WEE A;  1LW2 A;  4CFA A;  4H0P A;  4CGJ A;  3AVM A;  4DR6 K;  3TSQ A;  2WC9 A;  5EOY A;  1Q82 O;  3CCJ N;  3K5N A;  1TL3 A;  4KPY A;  4CER A;  5AZJ A;  2NRV A;  4JKD A;  3CPW M;  4M3Z A;  1UA0 A;  5BRF A;  4DV3 K;  4EZ6 A;  3DLH A;  1KAZ A;  3O9Q A;  2O8D A;  4M41 A;  2ZJP L;  1NJW A;  1GLB G;  3LZJ A;  3CCE N;  3SQ2 A;  3SAH A;  4DFP A;  4JK7 A;  2QW9 A;  3KTQ A;  2OZS A;  1TUU A;  3F9M A;  5AQN A;  2OPR A;  3HTV A;  1NK0 A;  1VSH A;  4O4G A;  4IO9 L;  3J80 O;  4CF8 A;  4JI1 K;  1K9M O;  4DHY A;  1J6Z A;  5CYQ A;  1JXE A;  3SAF A;  2F7T A;  1RNH A;  4YOU A;  3A0I X;  3CD6 N;  4CZE A;  4DQ8 A;  4A5A A;  1SZ2 A;  4KHN A;  2GUP A;  4DR4 K;  1TAQ A;  4JKF A;  5CYM A;  4B1Y B;  3VPZ A;  4W5Q A;  3TAN A;  1IKY A;  2PFU A;  4A2B A;  1ZBL A;  3V9Z A;  2G8H A;  5BRH A;  4DKW A;  2DY4 A;  3VEN A;  3RVC A;  2D1K A;  1B92 A;  4LC9 B;  4FJX A;  4WQ4 C;  4HCC A;  1EQY A;  4JYA K;  1QE1 A;  3SMS A;  1S1X A;  4E7J A;  1VRU A;  5ADX H;  3B8A X;  3A8Y A;  3NDK A;  4LF9 K;  3ZSR A;  3O08 A;  3C65 A;  1Z05 A;  4BR9 A;  4LFC K;  2YKM A;  2IVP A;  4NYF A;  3ITH A;  3FFK B;  1RTH A;  5J2P A;  3I8D A;  2ZQB A;  3WNF A;  5M1N A;  1S1W A;  3DRP A;  3K2P A;  3SUN A;  1QS4 A;  2YHY A;  4OPH A;  4DTR A;  4DTM A;  4Q5V A;  1N8R O;  1JL1 A;  3KLE A;  3DXK B;  3OBY A;  1NK5 A;  3OYN A;  3VQP A;  4AHT A;  4DFK A;  4BVP A;  5FPN A;  3TAQ A;  4Z4I A;  1DTT A;  5KGX A;  4AHV A;  1IV0 A;  4AIL C;  3RSE A;  3VQ4 A;  2Z1G A;  3MDQ A;  1G15 A;  4CD3 A;  4CJF A;  4FWO A;  4JKG B;  1XHZ A;  1RBU A;  1XQS C;  1WAJ A;  4JKA A;  4YOT A;  1T05 A;  3O3H A;  1SL1 A;  1WB9 A;  2DTU A;  3RMB A;  3QIO A;  2KFZ A;  2B5J A;  3AVJ A;  3W3D A;  4FO0 A;  4K25 A;  4FJ5 A;  4FL9 A;  1S1U A;  4HWI A;  4DTN A;  1XNQ K;  2PYL A;  4B9V A;  5FRN A;  3RWU A;  1YTA A;  3WUH A;  1GOC A;  4H0X B;  1IKW A;  1RT7 A;  2B4J A;  1W97 L;  4LY7 A;  3WQT A;  2ZJQ L;  1BIZ A;  4BRE A;  4O8U A;  2E5L K;  3PX0 A;  2FLO A;  5SWM A;  2HHW A;  3S3M A;  1BHL A;  3LDO A;  5AQQ A;  4PQU A;  1YJW N;  5JS1 A;  2VQF K;  4IEE A;  1R0A A;  3QML A;  3THX A;  1WBD A;  4BR4 A;  2P9L B;  3SQ1 A;  3M5R A;  1YHQ N;  4TSX A;  1YJN N;  3JAM O;  5AZJ B;  4CGF A;  3T1A A;  1P90 A;  3OHR A;  4CJ5 A;  4QAG A;  2ZJR L;  2DFE A;  5AQU A;  1ZYQ A;  3IUC A;  4DLE A;  1MA9 B;  1IBL K;  4XIU A;  4DFM A;  2GUI A;  3NH0 A;  4PL8 A;  2IIR A;  3SK3 A;  3U3G A;  4CZF A;  4M45 A;  2HMP A;  1RGI A;  4B08 A;  4YOV A;  3F73 A;  2O8E A;  4BE1 A;  1VQ8 N;  5M1F A;  2ZM6 K;  2HND A;  3ULD A;  3O6W A;  4CD1 A;  3S9H A;  3ATU A;  4NYN A;  2O8F A;  3AY9 A;  2Q31 A;  1D5A A;  4RWT A;  2P9P A;  4GKJ K;  5HRN A;  3NH1 A;  2QWQ A;  3LP0 A;  4BWM A;  2V7Z A;  1HPZ A;  4B3O A;  3FR0 A;  4YOR A;  1BA1 A;  4CEC A;  4WQ5 C;  1NLV A;  4I2Q A;  1D9F A;  4FLZ A;  1EWR A;  3K0S A;  2NRR A;  5JIC A;  1LWC A;  2YJE A;  1U49 A;  3QO9 A;  4EIA A;  3RR7 A;  3LDL A;  4C8M A;  4GVM A;  2YCH A;  4H0V B;  4B1X B;  3VEO A;  1G99 A;  2Q97 A;  2HVI A;  3PUF A;  3HZ6 A;  5K14 A;  4QS8 A;  3AO1 A;  3OJU A;  2Z1H A;  4BGA A;  5KQD A;  3V9S A;  3SYZ A;  5B8H A;  2PY5 A;  5ELZ A;  3S41 A;  4B9M A;  3I55 N;  4QOZ B;  4GV6 A;  4CBX A;  2ASM A;  3H6E A;  4CE9 A;  5C2F A;  4ISE A;  2IS3 A;  1GLD G;  3OYF A;  4KHW A;  3A5O C;  1QSY A;  4Z4F A;  3KVG A;  2QWN A;  3TAP A;  2YNF A;  3LDS A;  2VCP A;  3UB5 A;  3KIO A;  1ESV A;  5FPM A;  1VK0 A;  4I6M B;  4KHY A;  2QA4 N;  1L3V A;  4IDK A;  1SQK A;  2KHO A;  3AVI A;  3F9K A;  1RBS A;  1JLC A;  2G8U A;  3THY B;  4CJQ A;  1IBM K;  1D9D A;  2O8C B;  4CEA A;  2RF2 A;  3U6F A;  4DV1 K;  4CF1 A;  4LH5 A;  2P1J A;  1JXB A;  1BU6 O;  1U45 A;  4DG1 A;  2GBZ A;  4E3S A;  4B1V A;  2KTQ A;  2QXF A;  4M3U A;  4OPJ A;  4JI6 K;  3EO3 A;  3UE5 A;  4IO8 A;  4A62 A;  4BC3 A;  3R1X A;  1GLF O;  1NU0 A;  1QQC A;  3BF1 A;  4RW7 A;  4CES A;  4FJ9 A;  4CJL A;  4O5B A;  1BL3 A;  1BI4 B;  3BY5 A;  3UKU A;  2YI1 A;  5J2Q A;  4DV6 K;  3OYE A;  4BWJ A;  1VQ7 N;  4NXM K;  3AVN A;  1NKC A;  4DR7 K;  1QHA A;  4C1N K;  3FE1 A;  3KK2 A;  3Q7B A;  3ASM A;  2XY6 A;  1EET A;  4BRL A;  1D8Y A;  1HQU A;  3E9L A;  4AHS A;  3WEE B;  2Q36 A;  1O1W A;  2YNI A;  1XHX A;  4DU4 A;  2E2N A;  3CJ1 A;  3VF4 A;  4ZTJ A;  4Z4G A;  2OA8 A;  3O80 A;  2FF3 B;  4FJG A;  3TAF A;  3C6A A;  5HL7 L;  2QWL A;  2D0A A;  5HP1 A;  4BRN A;  2ITM A;  2ASP A;  5C42 A;  2D0B A;  5E41 A;  4HTU A;  1ITG A;  4DV2 K;  2O8D B;  2E6L A;  3NH2 A;  4BRH A;  1T8E A;  3P1G A;  3HPG A;  2YKN A;  3O4W A;  1C1B A;  1LAV A;  5ADX A;  4OO1 J;  3NF6 A;  3QEI A;  2HOE A;  1YIJ N;  3LDN A;  4WFB L;  4FWK A;  4FWL A;  3DRS A;  2RE2 A;  2VWB A;  2VYP A;  3CER A;  2G8K A;  3TAM A;  2V52 B;  5AQT A;  3QB0 A;  4JI5 K;  4KRE A;  1HRH A;  1KTQ A;  3CHW A;  1L3U A;  3C7N A;  1C0G A;  2GWK A;  3CPE A;  3EN9 A;  4JKH A;  1HNI A;  1YAG A;  2GEM A;  3EYZ A;  2E20 A;  3QET A;  2O8B B;  2XRI A;  3CQ8 A;  2UU9 K;  4R79 A;  2X6S A;  5KPT A;  2O8F B;  2YHW A;  3ZSX A;  1NJI O;  2P5O A;  1KAY A;  2P9P B;  2CGJ A;  1ZBU A;  1YT3 A;  1E4F T;  4JHD A;  4C23 A;  1U6Z A;  5MLC Q;  5JVH L;  4DV5 K;  4H0Y B;  4O55 A;  3O1W A;  5C12 A;  3OW2 M;  1UA1 A;  2HHQ A;  5AZI A;  4CEB A;  3DWL A;  3FLC O;  4B3T K;  3WXK A;  3D45 A;  5LY3 A;  1J5O A;  4E1M A;  3CJA A;  2RPI A;  3AGR A;  3OYC A;  4DLG A;  1Q9X A;  3DJC A;  5IT9 O;  3AV9 A;  2NRX A;  3O5B A;  3TPQ A;  2UUA K;  1RT4 A;  3MN9 A;  2XY5 A;  2OAN A;  1I39 A;  4JRP A;  3OTO K;  4DV4 K;  4Y1C A;  3MN6 A;  1IBK K;  3IAY A;  1QQM A;  5AQM A;  3O1B A;  4IBN A;  3U3Y A;  1YXQ A;  4JV5 K;  2JWK A;  1C0U A;  1QVF M;  1OVQ A;  1RIL A;  3L2U A;  4FYD A;  1VSK A;  2YV0 X;  3C6U A;  4K43 A;  4WF9 L;  1NGH A;  2BTF A;  3F2K A;  5M1K A;  3OBW A;  3ZYY X;  1EKE A;  2D5R A;  5BRD A;  3NHG A;  1HQE A;  1REV A;  4LFA K;  3AVH A;  4N56 A;  1SKS A;  2ITG A;  3EE9 A;  5LL6 Z;  4FW1 A;  1NBW A;  4CJ4 A;  4J2B A;  2Q0U A;  3V4I A;  3MX5 A;  4BDY A;  1IJJ A;  2HNZ A;  4DR2 K;  4BE0 A;  4Z4E A;  2X74 A;  1HNZ K;  4JNE A;  3IRX A;  4BDP A;  1JLB A;  3RR8 A;  4L8R B;  2F8T A;  4CEO A;  3D0P A;  2E4L A;  4NB4 A;  1EXQ A;  2Q0R A;  3B6P A;  5F0X A;  4M3R A;  4OLB A;  1D4X A;  3M8S A;  1KFD A;  2Q1N A;  3LM9 A;  4E7I A;  1WNS A;  3EKS A;  1XMQ K;  3ZX2 A;  1ILY A;  1HMV A;  4EHT A;  5IWA K;  2VG6 A;  2E2O A;  5T7B A;  2RKI A;  4EHU A;  3FZF A;  3NE6 A;  2ZWH A;  1NOY A;  3OYB A;  4AQY K;  1KVC A;  3SAG A;  4IDH A;  4MLH A;  2FBY A;  4DUZ K;  4LF5 K;  4MDB A;  2Y1J A;  1NG9 A;  1X9M A;  3H08 A;  4CHY A;  4E19 A;  2HW3 A;  1C0F A;  1Y97 A;  2VGM A;  4N76 A;  3O3F A;  2DFF A;  1LV5 A;  5HRR A;  5FPE A;  4JI3 K;  4JRQ A;  5AQX A;  4JK8 A;  2PYJ A;  3NF9 A;  1I94 K;  3CCL N;  1OH7 A;  1VSJ A;  2A3Z A;  3HOT A;  2F9T A;  2OPP A;  1KSP A;  3N4Q A;  1RDD A;  1YI2 N;  5AJ3 K;  3OYJ A;  1U47 A;  4B8C A;  2P9K A;  5AQV A;  4IKF A;  2B6A A;  1NGE A;  3K5L A;  3MXM A;  3L0Q A;  1KVB A;  3VF2 A;  4BVO A;  4CZM A;  1K8A O;  4B9N A;  2E1Z A;  1TGO A;  4QCL A;  1S9E A;  4FJL A;  2XY8 A;  3HL8 A;  4KRF A;  2W41 A;  3ZSV A;  4MO5 A;  3CFR A;  3QEW A;  4Z94 A;  4U7B A;  4CF0 A;  5C15 A;  1C1A A;  4FPB A;  3CCU N;  1JCE A;  3FZL A;  4NO7 A;  1TUY A;  3I33 A;  3AA5 X;  1NGJ A;  3Q7C A;  3PX4 A;  1KRP A;  4F8R A;  1QTM A;  1WOQ A;  4MLE A;  5AR0 A;  3QER A;  2RN2 A;  4DTU A;  3SNN A;  3ENB A;  3HT3 A;  4KBO A;  3QIC A;  3DOL A;  4BC4 A;  3DLR A;  3WXL A;  4BDZ A;  3DLB A;  1XI1 A;  1KCF A;  1TYQ B;  4K41 A;  2V51 B;  2D0O A;  1GLL O;  1HYV A;  5BPN A;  1TK0 A;  4PKI A;  1VSL A;  1HKB A;  3CCV N;  2QKB A;  2VG7 A;  2ZD1 A;  3C0B A;  4C1N I;  1FW6 A;  3ZT0 A;  3ULE B;  5EVZ A;  3SLC A;  3VGM A;  3ZEU B;  4B1Z A;  3OJS A;  3HJF A;  1W2B M;  3EEQ A;  4JHD B;  2V7Y A;  3ZT3 A;  1HPM A;  5AQO A;  3ZT1 A;  1Y64 A;  4ELV A; 
#chains in the Genus database with same CATH homology
 3P31 A;  1NGA A;  2ZGY A;  5TKY A;  3H1Q A;  3IUC A;  5GIP A;  1MA9 B;  5EX5 A;  1P8Z A;  4ILH A;  4YOW A;  4PL8 A;  2IIR A;  2YHX A;  3SK3 A;  3PLA A;  4CZF A;  2HMP A;  1RGI A;  4YOV A;  3D2F A;  1NGI A;  3N4P A;  3WXM B;  4JAX A;  5M1F A;  3O9T A;  3O9R A;  1KC8 O;  1VQ8 N;  4H03 B;  3O9U A;  3D2F B;  3O6W A;  4CD1 A;  5JLH A;  4IOA L;  3ATU A;  2A6A A;  3ZET A;  2WBN A;  3AY9 A;  3VEY A;  2Q31 A;  1VQM N;  4M63 C;  4IZ9 A;  5LJV A;  4RWT A;  1RFQ A;  2P9P A;  3AAR A;  5GIN A;  3R9P A;  2QWQ A;  3FZM A;  3VGL A;  1RDU A;  2V7Z A;  3FR0 A;  4ILG B;  3VOV A;  4YOR A;  1BA1 A;  4FWQ A;  4WQ5 C;  1NLV A;  3VTH A;  1IG8 A;  1MWK A;  4BR5 A;  1T44 A;  2NRR A;  2P9N A;  5JIC A;  2YJE A;  3G25 A;  4EIA A;  5CHI A;  1Q86 O;  3C7N B;  3CF5 L;  2ZF5 O;  4XH1 A;  2QI2 A;  3LDL A;  4H0V B;  2YCH A;  1HKC A;  3GL1 A;  2P9U B;  4XEI A;  4A57 A;  4L3Q A;  3VEO A;  3VGK A;  4B1X B;  5GAG P;  4BR7 A;  1G99 A;  2Q97 A;  5EXW A;  3HZ6 A;  1YIT N;  1VQP N;  2GEL A;  4QS8 A;  2QWO A;  3FZK A;  3R8E A;  4BGA A;  5KQD A;  1QZ5 A;  1BWF O;  3E9P A;  5B8H A;  3SBG A;  1BA0 A;  2BUP A;  5GIO A;  3IDH A;  4BRC A;  5ELZ A;  3J8A A;  1KXP A;  3CIP A;  4FWR A;  3S41 A;  3TTD A;  3ZX3 A;  3T69 A;  3I55 N;  5BRE A;  4FSV A;  1NGF A;  4GV6 A;  3HBT A;  4NLB A;  4CBX A;  2ASM A;  3H6E A;  1K8K A;  1NGC A;  2FF6 A;  1ZC6 A;  5C2F A;  2JWL A;  3CI5 A;  4ISE A;  1MDU B;  4FWM A;  1GLD G;  1NM1 A;  4XH5 A;  1VQL N;  5AQI A;  4A61 A;  3FZH A;  2ASO A;  1GLJ O;  4WQ4 A;  3A5O C;  3GDQ A;  1KAX A;  4BC5 A;  1RDW X;  3KVG A;  4WQ5 A;  2EWS A;  2QWN A;  2VCP A;  3TTF A;  4YDU A;  3O9S A;  3UB5 A;  4ISF A;  4BRF A;  4GY2 B;  3G71 N;  4WCE L;  1GLC G;  1X9J A;  2GWJ A;  1ESV A;  4KH6 A;  3GG4 A;  5FPM A;  1SAZ A;  4I6M B;  2WFB A;  1CZA N;  2QA4 N;  5CR4 A;  1X3N A;  3M1F A;  4JEP A;  5BN9 A;  3AGK A;  1SQK A;  2KHO A;  4I6M A;  4CBU A;  5AQP A;  3NVK A;  2J4R A;  4FVU A;  3O8M A;  3CCS N;  1XUP O;  4JKE A;  3U8X A;  4ILJ A;  3D2E A;  5LJW A;  2HBL A;  3P38 A;  5AQR A;  2Q2R A;  2P9I A;  4PHT X;  2HST A;  4JK9 A;  4PKH A;  5BPM A;  1BU6 O;  2E2P A;  4CJ7 A;  5M1P A;  3M3Z A;  1BUP A;  1S3X A;  1T3V A;  3KHY A;  4IXC A;  4IWV A;  5AQS A;  5GAD P;  2GTD A;  5I9E B;  4GV9 A;  4B1V A;  5BPL A;  2HBJ A;  4B9Q A;  3SBT A;  3GBT A;  1MWM A;  3DAW A;  3EO3 A;  3UE5 A;  4IO8 A;  3W0L A;  4A62 A;  3QDK A;  4A59 A;  2P9U A;  3WXJ A;  1DEJ A;  2GX9 A;  4BC3 A;  4CZK A;  2A42 A;  3R1X A;  3UKR B;  1GLF O;  3BF1 A;  5TKW A;  3QBX A;  3CQY A;  4BGB A;  3P39 A;  3UKU A;  2YI1 A;  4XH4 A;  3U4L A;  1DT9 A;  1LOT B;  3H3O B;  4IJN A;  1NGG A;  2NNW A;  3CJB A;  5AQK A;  1VQ7 N;  3J7Z O;  2E88 A;  3TSU A;  4IOC L;  1HUX A;  4E1J A;  4H5T A;  1QHA A;  4C1N K;  5AFU A;  2QWM A;  1QVG M;  3FE1 A;  3Q7B A;  2W40 A;  2PBD A;  3EL2 A;  4BRL A;  4CZL A;  1KD1 O;  1WUA A;  4F9O A;  3E9L A;  1NGD A;  3CET A;  3AAP A;  4BRM A;  3EZW A;  3WEE B;  2P9S A;  2Q36 A;  4QS7 A;  5M1O A;  4J8F A;  3HOS A;  2KKZ A;  3ID8 A;  4YOX A;  2OTJ N;  2E2N A;  5AQF A;  3VES A;  1BOT O;  2E8A A;  3CJ1 A;  5DM7 L;  4AM6 A;  4FOI A;  3VF4 A;  3FGU A;  3MN7 A;  4CI6 A;  5KPR A;  4WYB A;  3KWG A;  3O80 A;  4AM7 A;  2KLA A;  2P9L A;  5M1Q A;  3CC2 N;  3DLL L;  2DPN A;  2FF3 B;  3C6A A;  3DXM A;  5EY4 A;  3A5L C;  5HL7 L;  3R3L A;  4G9Z A;  2QWL A;  4BQL A;  1VQ9 N;  4JKG A;  3EE8 A;  4BRN A;  1EO1 A;  1S72 N;  4CZJ A;  3MWP A;  2ITM A;  1M1K O;  1KQS M;  2ASP A;  1JJ2 M;  2YJF A;  3D2E B;  2NRW A;  4BRI A;  3QFU A;  1HLU A;  4BRQ A;  3CC7 N;  4BRH A;  4GV3 A;  1YF5 L;  3E66 A;  3CCM N;  3O4W A;  1TYQ A;  3QFP A;  4M7X A;  1U2V B;  4O8K A;  3CC4 N;  3DXK A;  3HI0 A;  2QWP A;  1E4G T;  1ZXO A;  1U2V A;  3I8B A;  4FOE A;  5JLF A;  3LL3 A;  5ADX A;  4OO1 J;  4CZI A;  4B1U B;  3G6E N;  4EFH A;  2HOE A;  1YIJ N;  1NJI O;  3LDN A;  4WFB L;  4FWK A;  4JN4 A;  4FWL A;  3VEW A;  3KWI A;  1ATS A;  5AQJ A;  1VAZ A;  3KZB A;  5AQL A;  5JMV A;  2RE2 A;  3RSE B;  2VWB A;  2VYP A;  1YUW A;  3CER A;  1YJ9 N;  5BR9 A;  3L4I A;  2VGN A;  4FPA A;  4ISG A;  4IFE A;  2ZJR L;  2V52 B;  5AQT A;  3QB0 A;  3ATV A;  5CE3 A;  1Q18 A;  1BO5 O;  4JD2 A;  3U9Z A;  4BRO A;  4NLC A;  2NRT A;  4YOY A;  4FWN A;  2NZT A;  2P9K B;  2NRH A;  5F1X A;  4RCH A;  3CHW A;  4H0O A;  2I7N A;  5HOO A;  1HJO A;  3C7N A;  2E2Q A;  3A5M C;  4DB3 A;  1V4S A;  2UYT A;  1C0G A;  1QQN A;  2I7P A;  2GWK A;  3ID6 A;  1YVN A;  3SJH A;  3CPE A;  3EN9 A;  3K9K A;  4JKH A;  3TTC A;  1YAG A;  3I56 N;  3G4S N;  3WEE A;  1VQ6 N;  2GEM A;  4H0P A;  2E20 A;  1JCG A;  3BP8 A;  5GAH P;  4R79 A;  5KPT A;  2H3G X;  3CQX A;  3WXI A;  2YHW A;  3TSQ A;  2QTD A;  2WC9 A;  5EOY A;  3CCJ N;  3M6G A;  1KAY A;  2AP1 A;  2IVO A;  2P9P B;  1Q82 O;  2CGJ A;  1H1V A;  1K73 O;  3KK7 A;  3H46 O;  3IKM A;  4FWS A;  4GNI A;  1E4F T;  2NRV A;  4H5W A;  4JHD A;  1U6Z A;  2QM1 A;  4JKD A;  3VF6 A;  4C23 A;  5AZJ A;  5MLC Q;  3CPW M;  5JVH L;  3NVM A;  4H0Y B;  5AZI B;  3O1W A;  3JS6 A;  3ZET B;  4BRP A;  5C12 A;  2E1Y A;  2HBM A;  3OW2 M;  5BRF A;  5AZI A;  1LCU A;  3BF3 A;  3DWL A;  3FLC O;  3H1V X;  3QBW A;  3VER A;  1KAZ A;  3O9Q A;  3WXK A;  2ZJP L;  1GLB G;  5LY3 A;  3CJA A;  5C10 A;  3CCE N;  3AGR A;  3DJC A;  5AQH A;  4AF1 A;  3SAH A;  4JK7 A;  2QW9 A;  1ZBS A;  2NRX A;  3MCP A;  1TUU A;  2D4W A;  3F9M A;  3O5B A;  5AQN A;  4MO4 A;  5F2R A;  3TPQ A;  3WT0 A;  3MN9 A;  4BY9 C;  3ULE A;  1O13 A;  3HTV A;  2HBK A;  4H5V A;  3IFR A;  2OAN A;  4IO9 L;  2CH5 A;  3D7E O;  3MN6 A;  1NWK A;  1HX1 A;  4YDU C;  1QQM A;  1ATN A;  5AQM A;  2QWR A;  1K8K B;  3O1B A;  5FPD A;  1K9M O;  1YXQ A;  2JWK A;  4IOX A;  4BQZ A;  4DHY A;  1QVF M;  2P9N B;  1J6Z A;  2D0P A;  4FWP A;  3SAF A;  2F7T A;  3CCR N;  4KH5 A;  4BR2 A;  3CJC A;  1NGB A;  4YOU A;  3A0I X;  4CBW A;  5E26 A;  4K43 A;  4WF9 L;  1NGH A;  2BTF A;  2HF3 A;  1Q81 O;  3CD6 N;  4CZE A;  4DQ8 A;  5BN8 A;  3F2K A;  5M1K A;  3OBW A;  1BG3 A;  3ZYY X;  1VQK N;  4A5A A;  1SZ2 A;  3ENO A;  4WFA L;  2GUP A;  3VET A;  4JKF A;  4B1Y B;  1ATR A;  3MX2 A;  3VPZ A;  3UKU B;  2CGK A;  5BRD A;  3CXC M;  4JKC A;  2BH1 A;  2PFU A;  5AQZ A;  4A2B A;  3EE9 A;  1NBW A;  5BRH A;  4DKW A;  4PKG A;  2Q0U A;  3L4Q A;  3VEN A;  3MX5 A;  5DM6 L;  3RVC A;  1NMD A;  2D1K A;  1IJJ A;  5E84 A;  3WQU A;  4LC9 B;  2P9I B;  4WQ4 C;  4JNE A;  2ZGZ A;  1EQY A;  3SMS A;  4BG9 A;  5ADX H;  2FXU A;  3B8A X;  4IJA A;  3VEZ A;  4NB4 A;  4BG8 A;  3A8Y A;  5AQG A;  3CJ9 A;  2Q0R A;  5F0X A;  3EKU A;  4HTL A;  3ENH A;  1D4X A;  2QEX N;  3UKR A;  5AQW A;  3LDP A;  3A5N C;  2Q1N A;  4KH4 A;  3O08 A;  3LM9 A;  3C65 A;  3EKS A;  2OTL N;  1Z05 A;  3GE1 A;  4BR9 A;  2IVP A;  3FFK B;  3ZX2 A;  1ILY A;  4EHT A;  1X3M A;  3HRG A;  4U67 L;  3U9D A;  2E2O A;  1DGK N;  3T7Z A;  4EHU A;  4GVE A;  3FZF A;  2ZWH A;  1S22 A;  5M1N A;  3SAG A;  4IDH A;  2QXL A;  4MLH A;  3MWT A;  4M7Y A;  2PAV A;  4BRD A;  4MDB A;  3SMP A;  5JVG L;  2YHY A;  4OPH A;  3E1Y A;  3MK6 A;  1OVY A;  1N8R O;  4A2A A;  3DXK B;  3OBY A;  1XC3 A;  4JKB A;  1C0F A;  4CZG A;  5AQY A;  4IEI A;  2YX6 A;  2VGM A;  3L6Q A;  4O5F A;  2RHK A;  3VEX A;  4BVP A;  5FPN A;  3HM8 A;  5FPE A;  1BDG A;  3D6R A;  5AQX A;  1M90 O;  4JK8 A;  3CCL N;  4H5N A;  3RSE A;  4DCH A;  4WFN L;  2A3Z A;  3HOT A;  3MDQ A;  4CD3 A;  4BRG A;  4FWO A;  3GOI A;  2F9T A;  4JKG B;  1T6D A;  2FSK A;  2A41 A;  3N4Q A;  1Q7Y O;  5GAE P;  1XQS C;  1YI2 N;  4BRK A;  3JXU A;  3MCA B;  2P9K A;  3TSP A;  5AQV A;  1V4T A;  1NGE A;  1GLE G;  3MN5 A;  4JKA A;  1T6C A;  3L0Q A;  4YOT A;  2WUS A;  3CME N;  1R59 O;  3VF2 A;  4MDA A;  4BVO A;  3E9O A;  4BC2 A;  4CZM A;  1K8A O;  2P9S B;  2E1Z A;  4K42 A;  3F5T A;  2CH6 A;  3VEV A;  3OA9 A;  3AAQ A;  1DKG D;  5KPZ A;  3K9J A;  3BEX A;  2W41 A;  3W3D A;  4FO0 A;  2FSJ A;  4K25 A;  4MO5 A;  4Z94 A;  4FL9 A;  4U7B A;  2A40 A;  1VQO N;  3H45 C;  4BR0 A;  3DXM B;  3BUZ B;  3NMU A;  5C15 A;  4HWI A;  5H1S Q;  1QQO A;  3VTI A;  3C6H A;  3IMX A;  4FPB A;  4RTF D;  3CCU N;  1JCE A;  1QZ6 A;  1VQN N;  3FZL A;  4NO7 A;  1Z6R A;  1TUY A;  3I33 A;  3WUH A;  4UY8 O;  1NGJ A;  3Q7C A;  4H0X B;  1WOQ A;  5C0Y A;  4MLE A;  3PIO L;  5AFU H;  5AR0 A;  5KQ8 A;  4OPA A;  3LDQ A;  1JCF A;  1W97 L;  4BRA A;  3ENB A;  3WQT A;  3CCQ N;  4KBO A;  3QIC A;  4BC4 A;  5C2D A;  1SS6 A;  2NLX A;  1OKJ A;  3WXL A;  4BRE A;  2ZJQ L;  3P4I A;  4O8U A;  4Y0W A;  1TYQ B;  2FLO A;  4A5B A;  3VMF B;  4H0T B;  1GLA G;  3LDO A;  3MMV A;  4K41 A;  2V51 B;  2AA4 A;  5AQQ A;  3TU5 A;  3LM2 A;  1YJW N;  2D0O A;  1GLL O;  3CJ7 A;  3H3N O;  4B1W B;  4IEE A;  5BPN A;  4H5R A;  4PKI A;  3ZX0 A;  2FSN A;  3CMA N;  1HKB A;  1HKG A;  4EAH D;  3QML A;  3CCV N;  4PL7 A;  3C0B A;  4BR4 A;  2P9L B;  4C1N I;  3ZEU A;  4CZH A;  3M5R A;  1YHQ N;  1VQ5 N;  4QS9 A;  2NRZ A;  3ULE B;  5EVZ A;  2A5X A;  3SLC A;  3R6M A;  3VGM A;  3ZEU B;  2F9W A;  4B1Z A;  1YJN N;  1W2B M;  1VQ4 N;  4JHD B;  2V7Y A;  5AZJ B;  1P90 A;  2IVN A;  3OHR A;  1HPM A;  4JD2 B;  5AQO A;  3PIP L;  2CGL A;  1Y64 A;  3HSC A;  2HF4 A;  5AQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...