2RE2A

Crystal structure of a putative iron-molybdenum cofactor (femo-co) dinitrogenase (ta1041m) from thermoplasma acidophilum dsm 1728 at 1.30 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
YFQGMKFAVAVSGDRVNGPGESEEVQIYETDGGNVRLIEKYSNPALNATAARGVFMLKSALDHGANALVLSEIGSPGFNFIKNKMDVYIVPEMPVADALKLILEGKVSPATAPTHDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Uncharacterized protein Ta1041
publication title Crystal structure of protein of unknown function (NP_394501.1) from Thermoplasma acidophilum at 1.30 A resolution
rcsb
source organism Thermoplasma acidophilum dsm 1728
total genus 29
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02579 Nitro_FeMo-Co Dinitrogenase iron-molybdenum cofactor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.130 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2re2A00
2KLAA 2WFBA 1EO1A 1T3VA 2RE2A 1O13A 1P90A 2YX6A 2QTDA 1RDUA
chains in the Genus database with same CATH superfamily
3NCIA 1RTJA 3U9DA 3RWUA 1TKDA 1NGHA 3L4QA 4WFBL 1BA1A 4DQRA 1XUPO 3ZEUB 3ENBA 4XH1A 5AQRA 1OH6A 1DKGD 2E2OA 4BQLA 3AVMA 3D2EA 1TK8A 4AHUA 1KFDA 3WUHA 4HTUA 1S72N 4KV8A 1IBKK 4KB1A 3A5NC 3VGKA 1Q7YO 4B1VA 4M3ZA 3A5OC 1VQLN 2O8BB 4B1UB 3VESA 1UAXA 1CZBA 4O5BA 3DYAA 2ZGZA 3PSIA 4CHYA 3T1YK 2HHVA 1FXXA 4BR4A 1HRHA 3QEXA 4M3YA 3KKRA 4BR9A 3RR7A 2HSTA 4MLHA 4B1WB 2E1ZA 4NB4A 3VOVA 2Q31A 4BRQA 3CERA 4E1JA 3C7NA 1RBTA 4DFJA 3OYNA 4CZKA 4O5FA 3SPZA 5HRRA 1DLOA 4FWNA 1UWBA 3VEWA 1VHXA 1HNXK 3J80O 3DXKA 3QFUA 2PFUA 2G8UA 1WSHA 3ULEB 3CCSN 3GDQA 4EFHA 3THXB 3JXUA 2I5JA 3OBWA 3AVGA 3FFKB 2P9UB 5TKWA 4CJRA 4BRFA 4EIAA 5AQSA 3NFAA 3TAPA 1X9WA 4BQZA 4CJUA 1VAZA 5EVZA 5BN9A 5T7BA 5HP1A 1T6DA 5HLFA 3VQAA 1NGBA 2OPSA 2P9LA 2CGLA 3OS0A 1G99A 4FLVA 3WXLA 1DGKN 2ZJPL 4W5NA 2E2PA 1HLUA 3K5LA 3TWHA 1JLBA 3SJHA 3LANA 4V19S 1KC8O 4DLGA 4JI4K 3LAMA 4K0KK 4A59A 1X9SA 4CJ4A 1D4XA 1C0TA 1NGDA 1IJJA 3M8RA 1YJ9N 4YOUA 3F9MA 2AP1A 3CCJN 1OVYA 4IOCL 2YJFA 4BRCA 4M42A 4EP5A 5C15A 5K14A 1SZ2A 3IG1A 3OYIA 1BIZA 2FF3B 4CZMA 3IFRA 2P9SB 4LC9B 4CF1A 1D8YA 4MLEA 4DWIA 3HL8A 3K59A 1NK5A 3O4WA 2QK9A 2O8FB 4FWQA 3K9JA 1EWQA 4E7LA 4J2BA 1LV5A 4NO7A 1K6YA 1KAYA 1QHAA 3P38A 4DTUA 1LCUA 1Q86O 4BC4A 4JI8K 3T1HK 3TSUA 1VQ6N 1MWMA 3U9ZA 3MN5A 3E9OA 4RW6A 4HUGA 4MDBA 3SLCA 4B1YB 3LM2A 1JCGA 3RR8A 5BRHA 1NKBA 4DHYA 1C1AA 4ELUA 4LSLA 4KTQA 3VN5A 2GX9A 3HM9A 2FC0A 3TPQA 3T19A 4OGCA 3HPOA 2NRRA 4FK2A 3NMUA 3UKUA 1JLQA 5BPMA 3I0RA 1VSMA 2P5OA 4OGEA 4LSNA 3O08A 3G71N 1S1XA 1WAFA 3U8XA 3R3LA 4CEOA 3KLIA 3FGUA 4IOAL 4H4MA 4RG8A 3CC7N 2HHSA 3DLKA 3OYDA 2RN2A 3LDQA 4BR7A 5AQXA 4LF5K 4C1NI 2D0CA 4M7YA 3HVTA 3Q7CA 2F9WA 4NCGA 3DRRA 4OVLA 1JLEA 3PLAA 3DOLA 1TKXA 5HRPA 4F3OA 3NVKA 4CEBA 3H1VX 5IT9O 4H5TA 1T44A 3RSEA 3O5BA 5GAHP 3KD5E 5ELZA 3QNOA 2NNWA 3VQDA 2ETJA 2KTQA 4BC5A 5CE3A 4PL7A 2AJQA 1RT6A 3HVRA 2ZWHA 4DR7K 4K8XA 5C2DA 2RPIA 4E3SA 3CYMA 3C6AA 1IV0A 4IZ9A 4CHNA 3I0SA 3WXMB 4CFCA 4JI3K 3DRSA 3VQPA 5BREA 2GUIA 4H5NA 2XY5A 3UB5A 2R7YA 4NCBA 3BZKA 1TL1A 4CZGA 4B3SK 4JKBA 3G6EN 1Z05A 1TVRA 2QXFA 4RW4A 3SNNA 3L0QA 3O3HA 4GKJK 2Q0RA 3SJJA 2A41A 4GV6A 4F2RA 4B1ZA 5AQNA 3PX0A 3Q7BA 3ZSWA 4DS4A 2A42A 3GL1A 3ZSZA 3TARA 4IFEA 3SUOA 2Q0UA 2ZQBA 4FPBA 4B3RK 3QNNA 1CXQA 2DFEA 4BVOA 3SQ4A 1JJ2M 5CYQA 1JXEA 4TSXA 2BE2A 5GADP 4JN4A 1U49A 3RMDA 3RRHA 2I7PA 4CFBA 2HVHA 1K8AO 4CW7B 2IIRA 2E1YA 3AVHA 4BROA 4FO0A 1WB9A 4W5TA 1YITN 4JKGA 3AARA 4DF8A 3HK2A 2YNIA 5AQPA 1RTDA 3V1OA 3G25A 4C8OA 4MDAA 4DTPA 1LWCA 1S6QA 4O55A 4CECA 4KHYA 2PZSA 3WXJA 4CEQA 2Z1IA 4CIEA 1NGFA 3D7EO 1SKSA 1QSYA 3PUFA 4KI4A 3AGKA 3RMBA 2YNGA 3T1AA 2JWKA 4I2PA 4JYAK 1T7PA 3EN9A 4A61A 2WTUA 4DQSA 3KD1E 1X9JA 3EE8A 1Q81O 4CF0A 3C65A 4Q0BA 1MWKA 3LWLA 1JCFA 5HOOA 4CJSA 3T69A 3TTDA 3OY9A 3K2PA 3UKRA 3LDSA 4H0YB 4DTXA 1RDBA 1NWKA 4O44A 3CFOA 1YVUA 4AHTA 3IS9A 1HR0K 1IG8A 1VQKN 1S6PA 1HUXA 1N33K 4ISEA 1T3VA 3U4LA 5F2RA 4B8CA 3ZETA 5KGWA 5LL6Z 1Z6RA 3MXIA 2XRIA 2OYQA 1VRTA 3SUPA 4H5RA 3R9PA 2HHWA 3C6UA 2FBVA 3NH0A 4DR1K 5HROA 3MMVA 3F73A 2A40A 5C42A 3KLFA 3THWB 4ZTFA 2UXDK 3THYB 1YTUA 1VSJA 1YIJN 1WSFA 3LDOA 2QM1A 4BR2A 4FJKA 2BTFA 5KRSA 3PIOL 3H6EA 3FZMA 4DCHA 1NJZA 3TI0A 1OH5A 4O8UA 4KRFA 1U2VA 4B9SA 1WSEA 3G4SN 3CMEN 3CIPA 4BVPA 4Q5VA 4LF6K 1QQOA 4I9LA 1J5OA 1OH8A 2W40A 4KHPK 3V1RA 5AQZA 5FRNA 1IKYA 1OH7A 4FWOA 3HP6A 4HWIA 3QIOA 1N8RO 3HP9A 3MXJA 4B3MK 1J6ZA 1ATNA 2HMIA 3K0SA 4JI5K 4DU3A 1WNSA 3FLCO 1K8KB 1E4GT 3SV3A 3RMAA 2HNYA 4A2AA 4FJMA 2O4IA 4JS5A 3M8PA 4OKKA 3KVGA 5AZIA 4IJAA 4IEIA 3BF3A 4ISGA 3W3DA 1TGOA 4CGHA 5AJ3K 1WAJA 3FZFA 4LF7K 4L3QA 1L5UA 2ZD1A 1BI4B 5BR9A 3CCMN 3WEEB 1UA0A 5FPMA 3SQ2A 1HKCA 4OPKA 2XY8A 4LFAK 5HL7L 3ISNC 3A0IX 4WQ5A 1KLNA 3DLGA 3S3NA 3A5LC 3R1XA 4CJ5A 4RTFD 1S5JA 4FL9A 5AQMA 4BGAA 3OBYA 3U6FA 1KQSM 3NGZA 1RTHA 4I6MB 4G1QA 3JAMO 1YI2N 5FPNA 1R0AA 4CHPA 3AAPA 4J2DA 1NK7A 2W42A 5AQYA 4WFAL 1JLFA 5JVHL 4KHQA 2HNZA 1NU0A 2QWRA 4LF4K 4BR5A 4E19A 3V9ZA 4WCEL 1GLBG 1KRPA 1NGCA 2Y1JA 2WONA 3D2EB 1LAWA 1V4TA 5GAEP 2DTUA 3NGYA 4ICLA 3VA3A 5F0XA 3HO1A 3EE9A 3OYMA 4CCHA 3BZCA 4FJIA 4M3UA 4DV3K 4DQ8A 1Y97A 4FOIA 3CFPA 1EO1A 4CHZA 3WNGA 5GAGP 2LSNA 3PO4A 4AH9A 2GTDA 4CJQA 1HQUA 2WFBA 5C12A 4KTZA 4CJ3A 3H08A 4FWSA 3OYHA 1X9MA 4CESA 1J9AA 3AVAA 4DS5A 3C7NB 4CGIA 1IBMK 4PQUA 3CI5A 3R8EA 3PO5A 1QVGM 4IG0A 2I7NA 4H0VB 4I9QA 4QOZB 3DXKB 2QW9A 3FE1A 3OS2A 3PX4A 3L8BA 3IUCA 3PV8A 2V7YA 2PYLA 3MN6A 4CIGA 4C8KA 2HHXA 4NXNK 3QB0A 2IAJA 4CEAA 4OO1J 4JKHA 1LWEA 3J8AA 1N36K 2HB5A 3L2UA 4DQPA 4C8LA 1EX4A 1HMVA 4CE9A 1O13A 1TKTA 1Z26A 2KKZA 4JI2K 4DFMA 3EKSA 3HT3A 4PL8A 2W41A 3SQ1A 2P9LB 3P83D 4MFBA 1BISA 4X64K 4FJ9A 1P8ZA 1NK8A 1RDCA 3EZ5A 4Z4FA 1WN7A 2YHAA 2V52B 4DTMA 4R5PA 3TAFA 3CD6N 1G15A 3NF6A 2Q97A 3VF2A 1EETA 3QBXA 4IXCA 4N47A 1YTAA 4BDYA 1RDAA 4LF9K 1J53A 4FJNA 3SCXA 4IOXA 3LP0A 5JICA 3CXCM 3ID6A 3F2KA 4IKFA 1NGIA 5E84A 3KLEA 5HRNA 2VWBA 3KWIA 1BWFO 4PHTX 3D2FA 1VSHA 3MEDA 4O4GA 4KI6A 5FPEA 1MU2A 3AO1A 4NYFA 1BCOA 3L3UA 4BY9C 4F4KA 3R6MA 1LWFA 3P1GA 3AA4A 5ADXA 3LZJA 1JL2A 4H0XB 1RDWX 2X6NA 2PBDA 5AFUH 5H1SQ 1KFSA 1Q82O 4W5QA 3GG4A 3V9WA 1KXPA 1SL2A 3HI0A 1HNZK 4FWKA 1RBUA 3UKUB 1QZ6A 3SMPA 1E3MA 1L3VA 3AO5A 3KHYA 5AQTA 1ITGA 3ZSVA 1SL1A 3N4PA 3LP2A 1NK9A 5J2QA 2X74A 1S1TA 3A5MC 2FSKA 4KBOA 4ILGB 4BE0A 4LY7A 3HM8A 4M3TA 3DLLL 4BRMA 4BR0A 2RHKA 4MO4A 3KK3A 5J1EA 1I94K 3NVMA 4QAGA 2NRZA 5BN8A 1K73O 3VQ4A 4PKGA 3MCAB 4B08A 1TL3A 3I33A 3RSEB 1NBWA 1BA0A 2NLXA 5AQIA 3VQ9A 2OCEA 2BANA 4EHTA 1WSGA 2Q3SA 3KK1A 4FJHA 5J2NA 4GY2B 3N4QA 3EYZA 1E4FT 1IG9A 4Y1CA 5D3GA 1LOTB 1SL0A 3OYGA 1YAGA 3O1WA 3O3FA 4F9OA 1BG3A 2NZTA 1NLVA 4BE1A 4CD1A 2XHBA 5AQHA 4B9QA 3NDKA 1J5EK 1XHZA 5AQKA 3DRPA 2E88A 2CGJA 2O8EA 5LMUK 3SK3A 3MWPA 1RILA 4HUEA 1L3UA 4X66K 4FK0A 4XIUA 3NGIA 2XO7A 1BUPA 1SV5A 3JS6A 1GOAA 1ILYA 4HCCA 4EZ9A 3QEVA 5AZJA 2Z1GA 3L2VA 3TSPA 3ZT3A 2QKKA 2IDOA 2KLAA 1TUYA 3AAQA 4PKHA 4DV1K 4KPYA 3E66A 1W9HA 2HBJA 4PY5A 3CJ9A 1U48A 3CFRA 4IEEA 4DR4K 3QEWA 5C0YA 5M1FA 4CFDA 3DLHA 1HNWK 3SZ2A 4FM0A 2E6MA 4C23A 2QTDA 3L6QA 3VQ6A 4CGDA 3QO9A 4CJEA 3CCLN 4CK2A 2Q2RA 3KLGA 2ZJRL 3A8YA 1JXBA 1BU6O 1EWRA 1VQ5N 5JS1A 4JKGB 4FXDA 4UQGA 3HZ6A 4HUFA 2OTJN 2VYPA 1T03A 1RT1A 5EXWA 4N76A 4YHHK 4GV3A 1R59O 3LAKA 4DV5K 2F7TA 3QINA 2GWJA 4BRKA 4DTJA 1KCFA 1CLQA 1QQNA 3HRGA 3VEZA 1P90A 4FSVA 1CZ9A 1ESVA 4IO9L 1ZYQA 4GKKK 2JLEA 4WYBA 2VG6A 3ZCMA 2E5LK 1XC9A 3S41A 3AVNA 1B92A 4DSJA 3UKRB 4KFBA 3ASMA 4LD0A 4DUYK 2O8DA 3M3ZA 4QS9A 2J4RA 2QWLA 1ZBHA 3HSCA 3WXKA 3ZYYX 1GOCA 4EAHD 3VQ7A 3CQXA 4JI1K 3ZETB 4FLUA 3BP8A 3W0LA 4FW2A 1ASUA 3NAEA 1L3SA 4DQIA 3EL2A 4M63C 2O4GA 2OZMA 3C0BA 3CC2N 5AQQA 2DFFA 4K43A 1D5AA 1QSLA 1O1WA 1W97L 1YXQA 4B8AB 3TAQA 4E7KA 4YY3K 1S1UA 3VERA 1TK5A 3O4QA 1SQKA 2YKNA 2XY7A 4NLBA 3DI6A 3LDPA 5A2QO 1U2VB 4CZEA 4GVEA 4Z4IA 1NGEA 2X6SA 3HSTB 2YHWA 4E89A 1QS4A 4M3XA 4E7JA 4B9TA 3CJAA 4BG9A 2QWPA 1IKWA 3WNFA 2P9PA 2VWJA 3V9SA 4GVMA 3P39A 3O1BA 3CMAN 4FLZA 3M8QA 1HYVA 5CZ1A 3L2QA 4M7XA 2A5XA 1D9FA 4FWMA 3D6RA 4QS7A 2PAVA 1KVCA 4N41A 3IMXA 1VSDA 4YDUA 4JHDA 4LH4A 4CZJA 2DFHA 3S9HA 3CCEN 2P9KA 1BHLA 4WFNL 3QEIA 4ELTA 1Q8IA 2HMPA 4XEIA 2G8VA 1WLJA 4E7IA 5JLHA 1HQEA 5AZIB 3U3YA 4FJGA 2KQ2A 2ITMA 2UXCK 3CJCA 1H1VA 1NJXA 4G9ZA 4K42A 4JLHA 2D4WA 1GLEG 3ID8A 4Z94A 4CF8A 5DK5A 3THVA 3QFPA 3E9PA 4FLXA 4WQ4C 2VQFK 4BREA 5C24A 4JK9A 3U3GA 1S1VA 2F9TA 3P5JA 2V7ZA 3AA3A 3WQTA 2B6AA 3KK7A 4RW9A 1NK0A 5FLXO 1SUQA 4HHTA 4W5OA 4NXMK 4FZYA 3MX2A 2YNHA 1RT5A 1ZBUA 3TR8A 3C6TA 2FLOA 5FROA 1RFQA 1CXUA 1VK0A 3E9LA 2HW3A 4IFYA 3LP1A 3O6WA 1NJIO 4B9VA 4DTRA 4AHVA 5BPLA 4IO8A 2WC9A 3O9RA 2YKMA 3P4IA 3V4IA 3CHWA 3DWLA 1U6ZA 1NK4A 5EU7A 1XNQK 3O9TA 2QWNA 1OKJA 2RF2A 5BRDA 1NKCA 2JWLA 3KLHA 4YOTA 1GLAG 4H5WA 1IKXA 2EHGA 4FOEA 3K57A 1GLDG 3V9UA 1QHTA 2CH5A 3B6OA 3WT0A 1V4SA 4YORA 3DLBA 1WBDA 2HNDA 3HOSA 1VSEA 1ATRA 4BE2A 2D0BA 2HOEA 1NK6A 1TUUA 3QETA 1W7AA 3MXMA 3FZLA 3VEVA 2ASPA 4FWRA 3ZT2A 1ZBIA 3L3VA 5JLFA 4B1XB 4IJNA 3VF6A 3P31A 3V81A 3OYAA 1RT7A 3OYEA 2CGKA 2UUAK 4H5VA 1ATSA 2IGIA 5SWMA 2OTLN 3VQCA 4HCBA 1QSSA 1NGGA 2WUSA 1VRUA 4A5AA 2YNFA 2YHXA 3KIOA 2VGNA 2FXUA 2OA8A 4CBXA 2BUPA 4YOVA 2O8CA 5M1QA 2B4JA 3IKMA 4BDPA 2P9NA 4N5SA 5AQUA 4U67L 4CF9A 4B9LA 5M1OA 4IDKA 3SUQA 1N5YA 1REVA 4PKIA 3CPWM 2F96A 3OW2M 1NMNA 4L8RB 1VQ7N 3ZX2A 3ENHA 1RT2A 4LH5A 1VSIA 2QXLA 3FR0A 5DM7L 1ZBLA 1ZBFA 2YV0X 4AHSA 4HVJA 4YFUA 4U7BA 4B9UA 1N32K 3CCRN 2NRXA 3J7YP 1XHXA 4DSKA 3AV9A 4KH6A 3MAQA 4WQ5C 3ZX3A 2H3GX 3O9QA 4BWJA 3ZT1A 1NOZA 2GUPA 1VSKA 1HKGA 4ISFA 4JAXA 4IFVA 3TANA 2F8TA 4CHQA 3OS1A 1VQON 3SBGA 1S9EA 1M1KO 4AQYK 1GLLO 4FM2A 2NRTA 3EEQA 3NBPA 2QWQA 3RVCA 2ASOA 4Z0UA 2NUBA 3D2FB 3VEYA 3ALYA 4KREA 4BRHA 2WOMA 3NF7A 1RT4A 2UUCK 3IDHA 1C0UA 2E20A 4A5BA 3O4NA 5LMNK 1HJOA 1QQMA 4OPHA 2ITGA 3SBTA 3KK2A 5I42A 1HYSA 5J2PA 4RCHA 4KO0A 5JVGL 5AQGA 4WF9L 4QS8A 4AM6A 3WXIA 4AHRA 2AA4A 3TAEA 3CPEA 4F8RA 1QTMA 3MK6A 4BRDA 2G8FA 4FLTA 3OHRA 4NLCA 5BPNA 4JRQA 3VEXA 1U47A 5C2FA 1VSFA 2VQEK 2A1RA 3VQ5A 1QE1A 1N6QA 3DJCA 1KAZA 3AVIA 4M3WA 2IVOA 3LZIA 1RBSA 1WSIA 3CC4N 3M1FA 3CJ1A 3QLHA 4JK8A 5I3UA 3SMSA 4JK7A 3ZSQA 3J81O 2ZF5O 4CBUA 3CJ7A 3GOIA 3K5OA 1RBVA 1HYZA 3H46O 4NYNA 3WNHA 3AGRA 2FSNA 1RDDA 2HBKA 3HPGA 5AQOA 1FKPA 3HBTA 3BUZB 5KRTA 1TYQA 3VETA 2QA4N 3OVNA 3O8MA 2QEXN 2D0OA 2FBYA 3ZLJA 1NKEA 1HNIA 2X78A 4RWTA 3H45C 2O8EB 2HHUA 1VQ9N 3KTQA 3VGMA 4DV6K 1FKOA 1QVFM 2HF4A 3VENA 2PYJA 3NHGA 3VTHA 3T7ZA 3RRGA 2V51B 4DU1A 2A6AA 3VQEA 1C0MA 4GW6A 3QDKA 5AZJB 2QI2A 2YCHA 4FVUA 3E01A 3CG7A 2KW4A 1X1PA 3F5TA 4MQ3A 4FJXA 4JNEA 1SS6A 4O8KA 5LY3A 5B8HA 1TAQA 3G10A 4J8FA 4CZLA 5KPRA 2NRWA 3C6HA 1U4BA 4NCAA 2UXBK 4K8ZA 3FZKA 3JSMA 4I2QA 3DXMA 2YHBA 4OKJA 1XQSC 3LM9A 4JKDA 3VGLA 4JKCA 2P9IA 2GBZA 3JYTA 1A5VA 4PUOA 1KD1O 2VG7A 4ID5A 4YOXA 3E1YA 4FJLA 3CQYA 2ZM6K 4C1NK 2W6KA 4DG1A 4CF2A 4CIFA 3ATVA 3AVFA 2D0PA 3OTOK 3SAFA 4DU4A 4B3OA 4LFBK 5TKYA 3H1QA 2HHTA 2Y1IA 1NJYA 3AVCA 4FWLA 1LAVA 4E1NA 1BL3A 4CZHA 3VA0A 1BO5O 4F3TA 4K25A 4DR6K 3ITHA 1QQCA 4JD2A 3VEOA 4ID1A 2HVIA 1U04A 5DM6L 1YVNA 3SPYA 3TU5A 5M1KA 3VF4A 3K9KA 1Q9XA 2Z1HA 4CVNE 1XMQK 1DTTA 3K5NA 2HHQA 5GINA 2O8DB 4GV9A 1HNVA 2Q36A 2HBLA 2P5GA 2KZMA 3ZEUA 2BH1A 5EY4A 5HBMA 1KVBA 3DAWA 3MN9A 4A57A 3CCQN 4H0PA 4CFAA 2NRHA 4BRLA 3ZT0A 2GV9A 4CGGA 5EX5A 3L2RA 3TABA 3CJBA 1JKHA 1T6CA 2O8BA 1C1CA 4JI6K 5AR0A 1TK0A 1RCHA 4JKEA 1JLCA 3CM5A 4DR3K 2BGGA 4DSFA 4O0JA 3OYJA 3C94A 4K41A 1NM1A 2Z1JA 5JS2A 2YI1A 5AQJA 1HPZA 4BRAA 2WBNA 3OYKA 5KGXA 1X3NA 5E26A 2VG5A 3PX6A 3QBWA 5IWAK 1KTQA 4IDHA 4A62A 4AM7A 4DTSA 3NH2A 4FJ5A 3EKUA 4HTLA 2G8WA 4DR2K 1JL1A 4DB3A 5FPDA 4X65K 3D45A 1DEJA 4CK3A 3S3MA 2P9PB 3ZSOA 5KI6A 3HYFA 1MDUB 1IH7A 3G0ZA 3J7ZO 2G8KA 4GMJB 3L4IA 3WNEA 4EHUA 1BDGA 5GIOA 4ZTJA 1LW2A 5CY4A 1MA9B 2VGMA 5KPTA 4ELVA 4JS4A 3ULEA 3THXA 5I9EB 1IKVA 2P9UA 5AFUA 4BACA 1EXQA 4J2AA 3PY8A 1YJWN 3PSFA 4CJ7A 4JHDB 4KHNA 4W5RA 3AVJA 4OLAA 2DY4A 2YHYA 5KTQA 4H8KA 2IVPA 4KAZA 4FPAA 2P9KB 4LFCK 2EWSA 4CHOA 2KZZA 3K58A 3F9KA 4B3TK 4FJJA 4R79A 1WUAA 5CYMA 3T3FA 4JRPA 1S9GA 2UU9K 2RKIA 1RNHA 1NMDA 2P51A 4Z4HA 1T05A 5F1XA 1Y64A 4H03B 3AA5X 4ILJA 5MLCQ 5AQWA 2FSJA 2KHOA 2HF3A 1XWLA 1VQ4N 3K5MA 3MWTA 3MEEA 2E2NA 5C10A 4YOYA 1F21A 4H0TB 3OA9A 1X3MA 3KKSA 3FZHA 1GLCG 1OVQA 2P9SA 2JGUA 1D9DA 4EZ6A 2O8FA 4E1MA 1ZXOA 3VQBA 1L3TA 4DSEA 2OPRA 3PIPL 1RTIA 4CJLA 4ILHA 4KTWA 3CCVN 5LJWA 2UYTA 3VQ8A 1K9MO 2ASMA 3KZBA 1S22A 4CEDA 4O0IA 3GE1A 3IRXA 2A1SA 1YT3A 3CCUN 4J2EA 2D5RA 2Q1NA 3AO4A 1NOYA 3HJFA 3AVKA 2E2QA 1SKRA 4I7FA 4WE1A 1XI1A 4B9NA 2QWOA 1BQNA 4JI7K 4KB0A 4QCLA 4BRGA 3SI6A 3AVLA 2HBMA 3LPTA 1RBRA 1SKWA 2E8AA 4CEZA 4CEEA 4BDZA 4FZXC 2F8SA 4DKWA 3OJUA 4M41A 4CEFA 4ZHRA 4CZIA 1WOQA 3AO2A 2HHHK 4FLWA 3EO3A 4Y0WA 3LL3A 4FLYA 2OPPA 2OPQA 2EX3A 3O9SA 2W6LA 5E41A 5AQVA 2GELA 1RGIA 2FBXA 3DMJA 4DV7K 2ZE2A 1NNEA 4DQQA 1C0FA 3MCPA 3TAGA 3FFIA 3TAMA 2KFNA 4AHCA 4DSIA 4X62K 3CQ8A 3CM6A 3WQUA 4JV5K 1Q9YA 3ZSXA 3AO3A 4WQ4A 1YF5L 4BG8A 3DM2A 1N34K 2RE2A 5DMRA 2VWKA 4YDUC 2G8HA 1ASWA 4AILC 4FWPA 3LPUA 3BGRA 2GEMA 3TSQA 2O8CB 4FYDA 4C8MA 4PA1A 3I8BA 4E0DA 2P9NB 3V9XA 4E7HA 2A3ZA 1B9DA 3NF9A 3GBTA 1YJNN 5M1PA 4CK1A 3UE5A 1TV6A 3J7AP 1TAUA 1T8EA 3BY5A 4CJKA 4B9MA 2IVNA 3ZSYA 4DFKA 3QEPA 4BC2A 1XC3A 5J2MA 1JLAA 1LW0A 2CH6A 1QZ5A 4C8NA 1YHQN 1W2BM 4IBNA 4CZFA 2D1KA 3KJVA 4FM1A 4JI0K 3LDNA 1XMOK 4UY8O 4OX9K 1HKBA 1RDUA 5FDLA 4RW8A 1M90O 3LALA 3QESA 1EP4A 3VMFB 2E6LA 4YNQA 3ZT4A 1BOTO 3EZWA 3I8DA 4OKEA 4DR5K 4Z4CA 3QMLA 2FBTA 1U45A 5C25A 1I3AA 1I39A 4OPAA 4KHSA 2XY6A 1NGJA 3M5RA 5M1NA 5LJVA 3LP3A 4DSLA 4A2BA 3D0PA 2UUBK 4CBWA 3OYCA 4H0OA 1Z25A 4H4OA 3RTVA 5FRMA 3ZX0A 2E4LA 3HPHA 3LWMA 4FJ8A 1W0HA 3OYLA 4OLBA 4KKOA 3H3NO 3MN7A 3TTCA 1B9FA 2B5JA 4DV0K 4KH5A 1VQNN 3I55N 3A2FA 1EQYA 4CJVA 4FW1A 5JMVA 4FK4A 1ZBSA 2OANA 1BIUA 1RT3A 3DLRA 3SV4A 4CJPA 3MEGA 1BCMA 4DTNA 4YOWA 3NE6A 5KQ8A 2BDPA 5KPZA 5AQFA 1GLJO 4F2SA 3BEXA 3HOTA 1UOCA 3O3GA 4Z4EA 1WBBA 5HRSA 1FK9A 4AF1A 4CI6A 5SZTA 2FF6A 2G8IA 1EKEA 1HX1A 1KLMA 4Y1DA 1J54A 1TKZA 3C95A 1DT9A 4BC3A 4DFPA 4BWMA 3L2WA 4CERA 1VQ8N 4RW7A 2ATQA 3NH1A 3HXMA 4DUZK 3MDQA 4JEPA 3V6DA 3ZSRA 2GWKA 1C0GA 4FVMA 1IO2A 3MX5A 3HTVA 1VQPN 1NG9A 4FZZA 3OYFA 3CF5L 3NF8A 2DPNA 3H3OB 3SAHA 3BDPA 4CJTA 4M45A 4FCYA 4CD3A 3SQ0A 3QERA 3SYZA 4KHWA 3THWA 4KHUA 3THYA 2NRVA 1TYQB 3TTFA 2OZSA 5GIPA 1VQMN 2KFZA 3MECA 4DTOA 1S3XA 1KVAA 3B8AX 3DOKA 3UIQA 4FJ7A 5BR8K 2ZGYA 3AY9A 2F4VK 1BGXT 1IBLK 1HJRA 1Q18A 3LDLA 4JKFA 2VCPA 3ENOA 1C1BA 5ADXH 4PWDA 4GNIA 4CJFA 1A5WA 4XH5A 2YX6A 3ULDA 4LF8K 1XNRK 3VPZA 4DF4A 4XH4A 3SAGA 1ZC6A 3O80A 4OPJA 2ZJQL 3BF1A 5EOYA 1JCEA 4BRIA 4DV2K 4MO5A 1S1WA 1K8KA 4IG3A 4BRNA 3B6PA 3M8SA 3V1QA 5CZ2A 4BRPA 3VQQA 1WSJA 2QKBA 1BQMA 3DXMB 1JLGA 1GOBA 3M6GA 1FJGK 1DTQA 3QIPA 4CGJA 5AQLA 2P9IB 1C6VA 3CETA 1BI4A 3RMCA 2IS3A 1HPMA 1SAZA 3WEEA 5CR4A 4BGBA 3AVBA 2QWMA 1GLFO 4IWVA 4CJWA 4KH4A 4N56A 1UA1A 3ATUA 2PY5A 5CHIA 2D0AA 3AA2A 4CGFA 4M3RA 4EP4A 4JKAA 3O9UA 3S3OA 1NGAA 2P1JA 3IAYA 1FW6A 4DLEA 3VTIA 1YUWA 4JD2B 3SUNA 3EY1A 1NJWA 3OJSA 3DLEA 1VSLA 1ASVA 2IC3A 1KAXA 4I6MA 1A5XA 5BRFA 1KSPA 4DV4K 3QICA 3I56N 4DMNA 2IOCA 3KWGA 4Z4GA 3OYBA 2YJEA 5KQDA 4OJRA 1CZAN
chains in the Genus database with same CATH topology
4FWMA 3D6RA 4K41A 4QS7A 2PAVA 1NM1A 3U9DA 5AQJA 2YI1A 1NGHA 3L4QA 5HL7L 3IMXA 1BA1A 3A0IX 4YDUA 4JHDA 4WFBL 1XUPO 3ZEUB 4BRAA 2WBNA 3ENBA 4XH1A 5AQRA 4WQ5A 1DKGD 2E2OA 4CZJA 3CCEN 1X3NA 5E26A 2P9KA 3A5LC 3QBWA 3R1XA 4IDHA 4BQLA 4A62A 4AM7A 2HMPA 3D2EA 4RTFD 4XEIA 4WFNL 3EKUA 4HTLA 4FL9A 5AQMA 4BGAA 3OBYA 3WUHA 4DB3A 5JLHA 5AZIB 1S72N 5FPDA 2ITMA 1DEJA 1KQSM 3A5NC 3VGKA 2P9PB 4B1VA 1Q7YO 4I6MB 3CJCA 1H1VA 3A5OC 1MDUB 1VQLN 4K42A 4B1UB 3VESA 2D4WA 4G9ZA 1GLEG 3J7ZO 1YI2N 3L4IA 3ID8A 4EHUA 1BDGA 4Z94A 5GIOA 5FPNA 3QFPA 1MA9B 2VGMA 3E9PA 5KPTA 2ZGZA 3ULEA 3AAPA 4WQ4C 4BREA 5I9EB 4JK9A 2P9UA 5AFUA 5AQYA 4BR4A 4WFAL 5JVHL 1YJWN 2F9TA 4CJ7A 4JHDB 2QWRA 2V7ZA 2YHYA 3WQTA 4BR5A 4BR9A 3KK7A 4WCEL 2HSTA 2IVPA 1GLBG 4MLHA 4FPAA 4B1WB 1NGCA 2P9KB 2EWSA 3MX2A 2E1ZA 4NB4A 3VOVA 2Q31A 4BRQA 3CERA 4E1JA 3D2EB 4R79A 1V4TA 5GAEP 2FLOA 1WUAA 3C7NA 1RFQA 3E9LA 4O5FA 4CZKA 1NMDA 4FWNA 3O6WA 5F0XA 3EE9A 3VEWA 1NJIO 5F1XA 1Y64A 3DXKA 3QFUA 2PFUA 4H03B 4DQ8A 5BPLA 4ILJA 3ULEB 3CCSN 3GDQA 5MLCQ 5AQWA 4IO8A 2WC9A 3O9RA 4EFHA 2FSJA 2KHOA 3JXUA 4FOIA 2HF3A 3OBWA 3P4IA 1EO1A 3FFKB 2P9UB 3MWTA 5TKWA 4BRFA 4EIAA 5AQSA 1VQ4N 2E2NA 4BQZA 5GAGP 5C10A 4YOYA 1VAZA 3CHWA 3DWLA 4H0TB 5EVZA 2GTDA 1U6ZA 5BN9A 2WFBA 3OA9A 5C12A 1X3MA 3FZHA 3O9TA 2QWNA 1GLCG 1OKJA 1T6DA 4FWSA 2P9SA 5BRDA 2JWLA 1NGBA 4YOTA 1GLAG 2P9LA 4H5WA 2CGLA 4FOEA 1GLDG 1G99A 3WXLA 1DGKN 2CH5A 1ZXOA 3WT0A 2ZJPL 3C7NB 2E2PA 1HLUA 3CI5A 3R8EA 3SJHA 3PIPL 1KC8O 1V4SA 4YORA 4ILHA 1QVGM 3HOSA 3CCVN 5LJWA 2UYTA 2I7NA 2ASMA 1ATRA 3KZBA 1S22A 1K9MO 4A59A 4H0VB 1D4XA 2HOEA 1TUUA 3DXKB 2QW9A 3FE1A 1NGDA 3IUCA 3GE1A 1IJJA 2V7YA 1YJ9N 3FZLA 4YOUA 3MN6A 3F9MA 3VEVA 3CCUN 2ASPA 2AP1A 4FWRA 3CCJN 1OVYA 2Q1NA 3QB0A 4IOCL 2YJFA 4BRCA 4OO1J 4JKHA 3J8AA 5C15A 1O13A 1SZ2A 5JLFA 2FF3B 2KKZA 4CZMA 3IFRA 2E2QA 4B1XB 2P9SB 4LC9B 3EKSA 4PL8A 4IJNA 2W41A 3VF6A 2QWOA 2P9LB 3P31A 4MLEA 3O4WA 4BRGA 4FWQA 3K9JA 2CGKA 2HBMA 4H5VA 1ATSA 2E8AA 4NO7A 1P8ZA 1KAYA 2OTLN 1QHAA 4DKWA 3P38A 1NGGA 1LCUA 2WUSA 4CZIA 1WOQA 1Q86O 4BC4A 3EO3A 2V52B 4A5AA 4Y0WA 2YHXA 3TSUA 2VGNA 3LL3A 1VQ6N 2FXUA 3CD6N 1MWMA 2Q97A 4CBXA 3QBXA 3U9ZA 2BUPA 4IXCA 3MN5A 3E9OA 3O9SA 3VF2A 4YOVA 5M1QA 3IKMA 4MDBA 5AQVA 3LM2A 2GELA 1RGIA 1JCGA 3SLCA 4B1YB 2P9NA 5BRHA 5AQUA 4DHYA 4U67L 4IOXA 1C0FA 5M1OA 3MCPA 5JICA 4PKIA 3CXCM 3ID6A 3CPWM 2GX9A 3F2KA 3OW2M 1NGIA 5E84A 3TPQA 1VQ7N 3ZX2A 3ENHA 2VWBA 3KWIA 1BWFO 3WQUA 2QXLA 3FR0A 5DM7L 2NRRA 4WQ4A 1YF5L 3UKUA 4BG8A 4U7BA 3NMUA 5BPMA 3CCRN 2NRXA 2RE2A 4PHTX 4YDUC 3D2FA 3O08A 3G71N 4KH6A 3U8XA 3R3LA 3FGUA 4IOAL 4FWPA 4WQ5C 3CC7N 3ZX3A 2GEMA 5FPEA 2H3GX 3TSQA 3O9QA 3LDQA 4BR7A 3I8BA 5AQXA 4C1NI 2P9NB 4M7YA 4BY9C 2GUPA 3Q7CA 3R6MA 1HKGA 2F9WA 4ISFA 2A3ZA 4JAXA 3PLAA 3GBTA 5ADXA 4H0XB 1RDWX 1YJNN 1VQON 2PBDA 3SBGA 5M1PA 1M1KO 5AFUH 3UE5A 3NVKA 5H1SQ 3H1VX 1GLLO 2IVNA 1Q82O 3GG4A 1KXPA 4H5TA 3HI0A 2NRTA 4FWKA 4BC2A 1XC3A 2QWQA 1QZ6A 1T44A 3RSEA 3O5BA 3RVCA 3UKUB 5ELZA 5GAHP 2CH6A 1QZ5A 2ASOA 3SMPA 1YHQN 3KHYA 1W2BM 2NNWA 3D2FB 3VEYA 4CZFA 5AQTA 2D1KA 4BRHA 3LDNA 4UY8O 3N4PA 4BC5A 3IDHA 5CE3A 4PL7A 2E20A 3A5MC 2FSKA 2ZWHA 1RDUA 1HKBA 4ILGB 4KBOA 3HM8A 4A5BA 5C2DA 1M90O 3DLLL 3C6AA 4BRMA 4BR0A 1HJOA 3VMFB 2RHKA 4IZ9A 4MO4A 1QQMA 4OPHA 1BOTO 3EZWA 3WXMB 3NVMA 3SBTA 2NRZA 5BREA 4H5NA 5BN8A 3UB5A 3QMLA 1K73O 4PKGA 3MCAB 4RCHA 3I33A 3RSEB 5JVGL 1NBWA 4OPAA 4CZGA 5AQGA 1NGJA 3M5RA 4JKBA 4QS8A 4AM6A 4WF9L 5M1NA 1BA0A 1Z05A 2NLXA 5AQIA 3WXIA 4A2BA 2AA4A 5LJVA 3CPEA 4EHTA 3L0QA 4GY2B 4CBWA 3N4QA 2Q0RA 2A41A 4H0OA 4GV6A 3MK6A 4BRDA 1E4FT 4B1ZA 5AQNA 3OHRA 1LOTB 3ZX0A 3Q7BA 1YAGA 3O1WA 4NLCA 3VEXA 5BPNA 2A42A 3GL1A 5C2FA 4IFEA 4F9OA 1BG3A 2NZTA 1NLVA 3TTCA 3H3NO 3MN7A 4CD1A 2Q0UA 5AQHA 4KH5A 4B9QA 4FPBA 1VQNN 3I55N 5AQKA 4BVOA 1EQYA 3DJCA 2E88A 2CGJA 1JJ2M 1KAZA 5JMVA 2IVOA 1ZBSA 5GADP 4JN4A 3SK3A 3MWPA 2OANA 3CC4N 2I7PA 3M1FA 3CJ1A 4JK8A 1K8AO 1BUPA 3SMSA 4JK7A 3JS6A 2ZF5O 4CBUA 3CJ7A 2IIRA 2E1YA 4YOWA 3GOIA 1ILYA 5KQ8A 3H46O 5KPZA 5AQFA 1GLJO 3BEXA 3HOTA 3AGRA 2FSNA 4BROA 4FO0A 5AZJA 2HBKA 5AQOA 3TSPA 4AF1A 1YITN 3HBTA 3BUZB 4JKGA 4CI6A 1TYQA 2FF6A 3AARA 1HX1A 2KLAA 1TUYA 3AAQA 4PKHA 3VETA 2QA4N 3E66A 2HBJA 5AQPA 3O8MA 2QEXN 1DT9A 4BC3A 3CJ9A 2D0OA 1VQ8N 4IEEA 3G25A 4MDAA 3MDQA 4JEPA 4RWTA 3H45C 5C0YA 2GWKA 3WXJA 5M1FA 1VQ9N 1C0GA 1NGFA 3D7EO 3VGMA 3MX5A 3HTVA 1QVFM 2HF4A 3AGKA 3VENA 4C23A 1VQPN 2JWKA 2QTDA 3VTHA 3L6QA 3T7ZA 3CF5L 3EN9A 4A61A 2V51B 1X9JA 3EE8A 2DPNA 1Q81O 3H3OB 3SAHA 2A6AA 3C65A 3CCLN 4CD3A 1MWKA 2Q2RA 2ZJRL 3A8YA 5AZJB 1CZAN 3QDKA 1BU6O 1JCFA 2QI2A 2YCHA 1VQ5N 5HOOA 4FVUA 3T69A 3TTDA 3UKRA 4H0YB 1NWKA 4JKGB 3G6EN 2NRVA 1TYQB 3TTFA 3HZ6A 2OTJN 5GIPA 1VQMN 3F5TA 1IG8A 1VQKN 4JNEA 1HUXA 1S3XA 2VYPA 5EXWA 3B8AX 1SS6A 4O8KA 5LY3A 5B8HA 4GV3A 1R59O 4ISEA 4J8FA 4CZLA 5KPRA 1T3VA 2F7TA 2NRWA 3C6HA 2GWJA 5F2RA 3U4LA 4BRKA 3ZETA 2ZGYA 3AY9A 1Z6RA 1Q18A 1QQNA 3LDLA 3HRGA 4JKFA 2VCPA 3FZKA 1P90A 4FSVA 4H5RA 3R9PA 3VEZA 3ENOA 1ESVA 4IO9L 3DXMA 5ADXH 4GNIA 1XQSC 3LM9A 3MMVA 4JKDA 3VGLA 4JKCA 4XH5A 2YX6A 4WYBA 2P9IA 2A40A 3VPZA 3S41A 1KD1O 4YOXA 3E1YA 3UKRB 3CQYA 4C1NK 4XH4A 3SAGA 1ZC6A 3ATVA 3M3ZA 1YIJN 3O80A 4QS9A 3LDOA 2QM1A 2D0PA 2J4RA 3BF1A 2ZJQL 4BR2A 3SAFA 2BTFA 5EOYA 1JCEA 2QWLA 4BRIA 3H6EA 3FZMA 3PIOL 3HSCA 5TKYA 3WXKA 4MO5A 3ZYYX 3H1QA 4EAHD 4DCHA 3CQXA 4FWLA 3ZETB 1K8KA 4O8UA 4CZHA 4BRNA 1BO5O 1U2VA 3BP8A 4K25A 3W0LA 3G4SN 3CMEN 4BRPA 3CIPA 4JD2A 4BVPA 3VEOA 3DXMB 5DM6L 1YVNA 1QQOA 3M6GA 3TU5A 5M1KA 2W40A 3EL2A 4M63C 3VF4A 5AQZA 5AQLA 2P9IB 3CETA 3C0BA 3CC2N 3K9KA 4FWOA 5AQQA 1HPMA 4K43A 4HWIA 1SAZA 3WEEA 5CR4A 4BGBA 1W97L 1YXQA 1N8RO 2QWMA 1GLFO 5GINA 4IWVA 4GV9A 1J6ZA 4KH4A 2Q36A 1ATNA 2HBLA 3ATUA 5CHIA 3ZEUA 3VERA 2BH1A 5EY4A 1SQKA 3O9UA 4JKAA 3DAWA 3FLCO 1NGAA 3MN9A 1K8KB 1E4GT 4NLBA 4A57A 3LDPA 3CCQN 1U2VB 4A2AA 4CZEA 4GVEA 1NGEA 4H0PA 2YHWA 2NRHA 3VTIA 4BRLA 1YUWA 4JD2B 3KVGA 3CJAA 5AZIA 5EX5A 4BG9A 2QWPA 4IJAA 4IEIA 3BF3A 4ISGA 3W3DA 2P9PA 3CJBA 3FZFA 1KAXA 4I6MA 1T6CA 4L3QA 5BRFA 5BR9A 3P39A 3QICA 3I56N 3O1BA 3CCMN 5AR0A 3CMAN 4JKEA 3KWGA 3WEEB 5FPMA 2YJEA 5KQDA 4M7XA 2A5XA 1HKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KLA A;  2WFB A;  1EO1 A;  1T3V A;  2RE2 A;  1O13 A;  1P90 A;  2YX6 A;  2QTD A;  1RDU A; 
#chains in the Genus database with same CATH topology
 3NCI A;  1RTJ A;  3U9D A;  3RWU A;  1TKD A;  1NGH A;  3L4Q A;  4WFB L;  1BA1 A;  4DQR A;  1XUP O;  3ZEU B;  3ENB A;  4XH1 A;  5AQR A;  1OH6 A;  1DKG D;  2E2O A;  4BQL A;  3AVM A;  3D2E A;  1TK8 A;  4AHU A;  1KFD A;  3WUH A;  4HTU A;  1S72 N;  4KV8 A;  1IBK K;  4KB1 A;  3A5N C;  3VGK A;  1Q7Y O;  4B1V A;  4M3Z A;  3A5O C;  1VQL N;  2O8B B;  4B1U B;  3VES A;  1UAX A;  1CZB A;  4O5B A;  3DYA A;  2ZGZ A;  3PSI A;  4CHY A;  3T1Y K;  2HHV A;  1FXX A;  4BR4 A;  1HRH A;  3QEX A;  4M3Y A;  3KKR A;  4BR9 A;  3RR7 A;  2HST A;  4MLH A;  4B1W B;  2E1Z A;  4NB4 A;  3VOV A;  2Q31 A;  4BRQ A;  3CER A;  4E1J A;  3C7N A;  1RBT A;  4DFJ A;  3OYN A;  4CZK A;  4O5F A;  3SPZ A;  5HRR A;  1DLO A;  4FWN A;  1UWB A;  3VEW A;  1VHX A;  1HNX K;  3J80 O;  3DXK A;  3QFU A;  2PFU A;  2G8U A;  1WSH A;  3ULE B;  3CCS N;  3GDQ A;  4EFH A;  3THX B;  3JXU A;  2I5J A;  3OBW A;  3AVG A;  3FFK B;  2P9U B;  5TKW A;  4CJR A;  4BRF A;  4EIA A;  5AQS A;  3NFA A;  3TAP A;  1X9W A;  4BQZ A;  4CJU A;  1VAZ A;  5EVZ A;  5BN9 A;  5T7B A;  5HP1 A;  1T6D A;  5HLF A;  3VQA A;  1NGB A;  2OPS A;  2P9L A;  2CGL A;  3OS0 A;  1G99 A;  4FLV A;  3WXL A;  1DGK N;  2ZJP L;  4W5N A;  2E2P A;  1HLU A;  3K5L A;  3TWH A;  1JLB A;  3SJH A;  3LAN A;  4V19 S;  1KC8 O;  4DLG A;  4JI4 K;  3LAM A;  4K0K K;  4A59 A;  1X9S A;  4CJ4 A;  1D4X A;  1C0T A;  1NGD A;  1IJJ A;  3M8R A;  1YJ9 N;  4YOU A;  3F9M A;  2AP1 A;  3CCJ N;  1OVY A;  4IOC L;  2YJF A;  4BRC A;  4M42 A;  4EP5 A;  5C15 A;  5K14 A;  1SZ2 A;  3IG1 A;  3OYI A;  1BIZ A;  2FF3 B;  4CZM A;  3IFR A;  2P9S B;  4LC9 B;  4CF1 A;  1D8Y A;  4MLE A;  4DWI A;  3HL8 A;  3K59 A;  1NK5 A;  3O4W A;  2QK9 A;  2O8F B;  4FWQ A;  3K9J A;  1EWQ A;  4E7L A;  4J2B A;  1LV5 A;  4NO7 A;  1K6Y A;  1KAY A;  1QHA A;  3P38 A;  4DTU A;  1LCU A;  1Q86 O;  4BC4 A;  4JI8 K;  3T1H K;  3TSU A;  1VQ6 N;  1MWM A;  3U9Z A;  3MN5 A;  3E9O A;  4RW6 A;  4HUG A;  4MDB A;  3SLC A;  4B1Y B;  3LM2 A;  1JCG A;  3RR8 A;  5BRH A;  1NKB A;  4DHY A;  1C1A A;  4ELU A;  4LSL A;  4KTQ A;  3VN5 A;  2GX9 A;  3HM9 A;  2FC0 A;  3TPQ A;  3T19 A;  4OGC A;  3HPO A;  2NRR A;  4FK2 A;  3NMU A;  3UKU A;  1JLQ A;  5BPM A;  3I0R A;  1VSM A;  2P5O A;  4OGE A;  4LSN A;  3O08 A;  3G71 N;  1S1X A;  1WAF A;  3U8X A;  3R3L A;  4CEO A;  3KLI A;  3FGU A;  4IOA L;  4H4M A;  4RG8 A;  3CC7 N;  2HHS A;  3DLK A;  3OYD A;  2RN2 A;  3LDQ A;  4BR7 A;  5AQX A;  4LF5 K;  4C1N I;  2D0C A;  4M7Y A;  3HVT A;  3Q7C A;  2F9W A;  4NCG A;  3DRR A;  4OVL A;  1JLE A;  3PLA A;  3DOL A;  1TKX A;  5HRP A;  4F3O A;  3NVK A;  4CEB A;  3H1V X;  5IT9 O;  4H5T A;  1T44 A;  3RSE A;  3O5B A;  5GAH P;  3KD5 E;  5ELZ A;  3QNO A;  2NNW A;  3VQD A;  2ETJ A;  2KTQ A;  4BC5 A;  5CE3 A;  4PL7 A;  2AJQ A;  1RT6 A;  3HVR A;  2ZWH A;  4DR7 K;  4K8X A;  5C2D A;  2RPI A;  4E3S A;  3CYM A;  3C6A A;  1IV0 A;  4IZ9 A;  4CHN A;  3I0S A;  3WXM B;  4CFC A;  4JI3 K;  3DRS A;  3VQP A;  5BRE A;  2GUI A;  4H5N A;  2XY5 A;  3UB5 A;  2R7Y A;  4NCB A;  3BZK A;  1TL1 A;  4CZG A;  4B3S K;  4JKB A;  3G6E N;  1Z05 A;  1TVR A;  2QXF A;  4RW4 A;  3SNN A;  3L0Q A;  3O3H A;  4GKJ K;  2Q0R A;  3SJJ A;  2A41 A;  4GV6 A;  4F2R A;  4B1Z A;  5AQN A;  3PX0 A;  3Q7B A;  3ZSW A;  4DS4 A;  2A42 A;  3GL1 A;  3ZSZ A;  3TAR A;  4IFE A;  3SUO A;  2Q0U A;  2ZQB A;  4FPB A;  4B3R K;  3QNN A;  1CXQ A;  2DFE A;  4BVO A;  3SQ4 A;  1JJ2 M;  5CYQ A;  1JXE A;  4TSX A;  2BE2 A;  5GAD P;  4JN4 A;  1U49 A;  3RMD A;  3RRH A;  2I7P A;  4CFB A;  2HVH A;  1K8A O;  4CW7 B;  2IIR A;  2E1Y A;  3AVH A;  4BRO A;  4FO0 A;  1WB9 A;  4W5T A;  1YIT N;  4JKG A;  3AAR A;  4DF8 A;  3HK2 A;  2YNI A;  5AQP A;  1RTD A;  3V1O A;  3G25 A;  4C8O A;  4MDA A;  4DTP A;  1LWC A;  1S6Q A;  4O55 A;  4CEC A;  4KHY A;  2PZS A;  3WXJ A;  4CEQ A;  2Z1I A;  4CIE A;  1NGF A;  3D7E O;  1SKS A;  1QSY A;  3PUF A;  4KI4 A;  3AGK A;  3RMB A;  2YNG A;  3T1A A;  2JWK A;  4I2P A;  4JYA K;  1T7P A;  3EN9 A;  4A61 A;  2WTU A;  4DQS A;  3KD1 E;  1X9J A;  3EE8 A;  1Q81 O;  4CF0 A;  3C65 A;  4Q0B A;  1MWK A;  3LWL A;  1JCF A;  5HOO A;  4CJS A;  3T69 A;  3TTD A;  3OY9 A;  3K2P A;  3UKR A;  3LDS A;  4H0Y B;  4DTX A;  1RDB A;  1NWK A;  4O44 A;  3CFO A;  1YVU A;  4AHT A;  3IS9 A;  1HR0 K;  1IG8 A;  1VQK N;  1S6P A;  1HUX A;  1N33 K;  4ISE A;  1T3V A;  3U4L A;  5F2R A;  4B8C A;  3ZET A;  5KGW A;  5LL6 Z;  1Z6R A;  3MXI A;  2XRI A;  2OYQ A;  1VRT A;  3SUP A;  4H5R A;  3R9P A;  2HHW A;  3C6U A;  2FBV A;  3NH0 A;  4DR1 K;  5HRO A;  3MMV A;  3F73 A;  2A40 A;  5C42 A;  3KLF A;  3THW B;  4ZTF A;  2UXD K;  3THY B;  1YTU A;  1VSJ A;  1YIJ N;  1WSF A;  3LDO A;  2QM1 A;  4BR2 A;  4FJK A;  2BTF A;  5KRS A;  3PIO L;  3H6E A;  3FZM A;  4DCH A;  1NJZ A;  3TI0 A;  1OH5 A;  4O8U A;  4KRF A;  1U2V A;  4B9S A;  1WSE A;  3G4S N;  3CME N;  3CIP A;  4BVP A;  4Q5V A;  4LF6 K;  1QQO A;  4I9L A;  1J5O A;  1OH8 A;  2W40 A;  4KHP K;  3V1R A;  5AQZ A;  5FRN A;  1IKY A;  1OH7 A;  4FWO A;  3HP6 A;  4HWI A;  3QIO A;  1N8R O;  3HP9 A;  3MXJ A;  4B3M K;  1J6Z A;  1ATN A;  2HMI A;  3K0S A;  4JI5 K;  4DU3 A;  1WNS A;  3FLC O;  1K8K B;  1E4G T;  3SV3 A;  3RMA A;  2HNY A;  4A2A A;  4FJM A;  2O4I A;  4JS5 A;  3M8P A;  4OKK A;  3KVG A;  5AZI A;  4IJA A;  4IEI A;  3BF3 A;  4ISG A;  3W3D A;  1TGO A;  4CGH A;  5AJ3 K;  1WAJ A;  3FZF A;  4LF7 K;  4L3Q A;  1L5U A;  2ZD1 A;  1BI4 B;  5BR9 A;  3CCM N;  3WEE B;  1UA0 A;  5FPM A;  3SQ2 A;  1HKC A;  4OPK A;  2XY8 A;  4LFA K;  5HL7 L;  3ISN C;  3A0I X;  4WQ5 A;  1KLN A;  3DLG A;  3S3N A;  3A5L C;  3R1X A;  4CJ5 A;  4RTF D;  1S5J A;  4FL9 A;  5AQM A;  4BGA A;  3OBY A;  3U6F A;  1KQS M;  3NGZ A;  1RTH A;  4I6M B;  4G1Q A;  3JAM O;  1YI2 N;  5FPN A;  1R0A A;  4CHP A;  3AAP A;  4J2D A;  1NK7 A;  2W42 A;  5AQY A;  4WFA L;  1JLF A;  5JVH L;  4KHQ A;  2HNZ A;  1NU0 A;  2QWR A;  4LF4 K;  4BR5 A;  4E19 A;  3V9Z A;  4WCE L;  1GLB G;  1KRP A;  1NGC A;  2Y1J A;  2WON A;  3D2E B;  1LAW A;  1V4T A;  5GAE P;  2DTU A;  3NGY A;  4ICL A;  3VA3 A;  5F0X A;  3HO1 A;  3EE9 A;  3OYM A;  4CCH A;  3BZC A;  4FJI A;  4M3U A;  4DV3 K;  4DQ8 A;  1Y97 A;  4FOI A;  3CFP A;  1EO1 A;  4CHZ A;  3WNG A;  5GAG P;  2LSN A;  3PO4 A;  4AH9 A;  2GTD A;  4CJQ A;  1HQU A;  2WFB A;  5C12 A;  4KTZ A;  4CJ3 A;  3H08 A;  4FWS A;  3OYH A;  1X9M A;  4CES A;  1J9A A;  3AVA A;  4DS5 A;  3C7N B;  4CGI A;  1IBM K;  4PQU A;  3CI5 A;  3R8E A;  3PO5 A;  1QVG M;  4IG0 A;  2I7N A;  4H0V B;  4I9Q A;  4QOZ B;  3DXK B;  2QW9 A;  3FE1 A;  3OS2 A;  3PX4 A;  3L8B A;  3IUC A;  3PV8 A;  2V7Y A;  2PYL A;  3MN6 A;  4CIG A;  4C8K A;  2HHX A;  4NXN K;  3QB0 A;  2IAJ A;  4CEA A;  4OO1 J;  4JKH A;  1LWE A;  3J8A A;  1N36 K;  2HB5 A;  3L2U A;  4DQP A;  4C8L A;  1EX4 A;  1HMV A;  4CE9 A;  1O13 A;  1TKT A;  1Z26 A;  2KKZ A;  4JI2 K;  4DFM A;  3EKS A;  3HT3 A;  4PL8 A;  2W41 A;  3SQ1 A;  2P9L B;  3P83 D;  4MFB A;  1BIS A;  4X64 K;  4FJ9 A;  1P8Z A;  1NK8 A;  1RDC A;  3EZ5 A;  4Z4F A;  1WN7 A;  2YHA A;  2V52 B;  4DTM A;  4R5P A;  3TAF A;  3CD6 N;  1G15 A;  3NF6 A;  2Q97 A;  3VF2 A;  1EET A;  3QBX A;  4IXC A;  4N47 A;  1YTA A;  4BDY A;  1RDA A;  4LF9 K;  1J53 A;  4FJN A;  3SCX A;  4IOX A;  3LP0 A;  5JIC A;  3CXC M;  3ID6 A;  3F2K A;  4IKF A;  1NGI A;  5E84 A;  3KLE A;  5HRN A;  2VWB A;  3KWI A;  1BWF O;  4PHT X;  3D2F A;  1VSH A;  3MED A;  4O4G A;  4KI6 A;  5FPE A;  1MU2 A;  3AO1 A;  4NYF A;  1BCO A;  3L3U A;  4BY9 C;  4F4K A;  3R6M A;  1LWF A;  3P1G A;  3AA4 A;  5ADX A;  3LZJ A;  1JL2 A;  4H0X B;  1RDW X;  2X6N A;  2PBD A;  5AFU H;  5H1S Q;  1KFS A;  1Q82 O;  4W5Q A;  3GG4 A;  3V9W A;  1KXP A;  1SL2 A;  3HI0 A;  1HNZ K;  4FWK A;  1RBU A;  3UKU B;  1QZ6 A;  3SMP A;  1E3M A;  1L3V A;  3AO5 A;  3KHY A;  5AQT A;  1ITG A;  3ZSV A;  1SL1 A;  3N4P A;  3LP2 A;  1NK9 A;  5J2Q A;  2X74 A;  1S1T A;  3A5M C;  2FSK A;  4KBO A;  4ILG B;  4BE0 A;  4LY7 A;  3HM8 A;  4M3T A;  3DLL L;  4BRM A;  4BR0 A;  2RHK A;  4MO4 A;  3KK3 A;  5J1E A;  1I94 K;  3NVM A;  4QAG A;  2NRZ A;  5BN8 A;  1K73 O;  3VQ4 A;  4PKG A;  3MCA B;  4B08 A;  1TL3 A;  3I33 A;  3RSE B;  1NBW A;  1BA0 A;  2NLX A;  5AQI A;  3VQ9 A;  2OCE A;  2BAN A;  4EHT A;  1WSG A;  2Q3S A;  3KK1 A;  4FJH A;  5J2N A;  4GY2 B;  3N4Q A;  3EYZ A;  1E4F T;  1IG9 A;  4Y1C A;  5D3G A;  1LOT B;  1SL0 A;  3OYG A;  1YAG A;  3O1W A;  3O3F A;  4F9O A;  1BG3 A;  2NZT A;  1NLV A;  4BE1 A;  4CD1 A;  2XHB A;  5AQH A;  4B9Q A;  3NDK A;  1J5E K;  1XHZ A;  5AQK A;  3DRP A;  2E88 A;  2CGJ A;  2O8E A;  5LMU K;  3SK3 A;  3MWP A;  1RIL A;  4HUE A;  1L3U A;  4X66 K;  4FK0 A;  4XIU A;  3NGI A;  2XO7 A;  1BUP A;  1SV5 A;  3JS6 A;  1GOA A;  1ILY A;  4HCC A;  4EZ9 A;  3QEV A;  5AZJ A;  2Z1G A;  3L2V A;  3TSP A;  3ZT3 A;  2QKK A;  2IDO A;  2KLA A;  1TUY A;  3AAQ A;  4PKH A;  4DV1 K;  4KPY A;  3E66 A;  1W9H A;  2HBJ A;  4PY5 A;  3CJ9 A;  1U48 A;  3CFR A;  4IEE A;  4DR4 K;  3QEW A;  5C0Y A;  5M1F A;  4CFD A;  3DLH A;  1HNW K;  3SZ2 A;  4FM0 A;  2E6M A;  4C23 A;  2QTD A;  3L6Q A;  3VQ6 A;  4CGD A;  3QO9 A;  4CJE A;  3CCL N;  4CK2 A;  2Q2R A;  3KLG A;  2ZJR L;  3A8Y A;  1JXB A;  1BU6 O;  1EWR A;  1VQ5 N;  5JS1 A;  4JKG B;  4FXD A;  4UQG A;  3HZ6 A;  4HUF A;  2OTJ N;  2VYP A;  1T03 A;  1RT1 A;  5EXW A;  4N76 A;  4YHH K;  4GV3 A;  1R59 O;  3LAK A;  4DV5 K;  2F7T A;  3QIN A;  2GWJ A;  4BRK A;  4DTJ A;  1KCF A;  1CLQ A;  1QQN A;  3HRG A;  3VEZ A;  1P90 A;  4FSV A;  1CZ9 A;  1ESV A;  4IO9 L;  1ZYQ A;  4GKK K;  2JLE A;  4WYB A;  2VG6 A;  3ZCM A;  2E5L K;  1XC9 A;  3S41 A;  3AVN A;  1B92 A;  4DSJ A;  3UKR B;  4KFB A;  3ASM A;  4LD0 A;  4DUY K;  2O8D A;  3M3Z A;  4QS9 A;  2J4R A;  2QWL A;  1ZBH A;  3HSC A;  3WXK A;  3ZYY X;  1GOC A;  4EAH D;  3VQ7 A;  3CQX A;  4JI1 K;  3ZET B;  4FLU A;  3BP8 A;  3W0L A;  4FW2 A;  1ASU A;  3NAE A;  1L3S A;  4DQI A;  3EL2 A;  4M63 C;  2O4G A;  2OZM A;  3C0B A;  3CC2 N;  5AQQ A;  2DFF A;  4K43 A;  1D5A A;  1QSL A;  1O1W A;  1W97 L;  1YXQ A;  4B8A B;  3TAQ A;  4E7K A;  4YY3 K;  1S1U A;  3VER A;  1TK5 A;  3O4Q A;  1SQK A;  2YKN A;  2XY7 A;  4NLB A;  3DI6 A;  3LDP A;  5A2Q O;  1U2V B;  4CZE A;  4GVE A;  4Z4I A;  1NGE A;  2X6S A;  3HST B;  2YHW A;  4E89 A;  1QS4 A;  4M3X A;  4E7J A;  4B9T A;  3CJA A;  4BG9 A;  2QWP A;  1IKW A;  3WNF A;  2P9P A;  2VWJ A;  3V9S A;  4GVM A;  3P39 A;  3O1B A;  3CMA N;  4FLZ A;  3M8Q A;  1HYV A;  5CZ1 A;  3L2Q A;  4M7X A;  2A5X A;  1D9F A;  4FWM A;  3D6R A;  4QS7 A;  2PAV A;  1KVC A;  4N41 A;  3IMX A;  1VSD A;  4YDU A;  4JHD A;  4LH4 A;  4CZJ A;  2DFH A;  3S9H A;  3CCE N;  2P9K A;  1BHL A;  4WFN L;  3QEI A;  4ELT A;  1Q8I A;  2HMP A;  4XEI A;  2G8V A;  1WLJ A;  4E7I A;  5JLH A;  1HQE A;  5AZI B;  3U3Y A;  4FJG A;  2KQ2 A;  2ITM A;  2UXC K;  3CJC A;  1H1V A;  1NJX A;  4G9Z A;  4K42 A;  4JLH A;  2D4W A;  1GLE G;  3ID8 A;  4Z94 A;  4CF8 A;  5DK5 A;  3THV A;  3QFP A;  3E9P A;  4FLX A;  4WQ4 C;  2VQF K;  4BRE A;  5C24 A;  4JK9 A;  3U3G A;  1S1V A;  2F9T A;  3P5J A;  2V7Z A;  3AA3 A;  3WQT A;  2B6A A;  3KK7 A;  4RW9 A;  1NK0 A;  5FLX O;  1SUQ A;  4HHT A;  4W5O A;  4NXM K;  4FZY A;  3MX2 A;  2YNH A;  1RT5 A;  1ZBU A;  3TR8 A;  3C6T A;  2FLO A;  5FRO A;  1RFQ A;  1CXU A;  1VK0 A;  3E9L A;  2HW3 A;  4IFY A;  3LP1 A;  3O6W A;  1NJI O;  4B9V A;  4DTR A;  4AHV A;  5BPL A;  4IO8 A;  2WC9 A;  3O9R A;  2YKM A;  3P4I A;  3V4I A;  3CHW A;  3DWL A;  1U6Z A;  1NK4 A;  5EU7 A;  1XNQ K;  3O9T A;  2QWN A;  1OKJ A;  2RF2 A;  5BRD A;  1NKC A;  2JWL A;  3KLH A;  4YOT A;  1GLA G;  4H5W A;  1IKX A;  2EHG A;  4FOE A;  3K57 A;  1GLD G;  3V9U A;  1QHT A;  2CH5 A;  3B6O A;  3WT0 A;  1V4S A;  4YOR A;  3DLB A;  1WBD A;  2HND A;  3HOS A;  1VSE A;  1ATR A;  4BE2 A;  2D0B A;  2HOE A;  1NK6 A;  1TUU A;  3QET A;  1W7A A;  3MXM A;  3FZL A;  3VEV A;  2ASP A;  4FWR A;  3ZT2 A;  1ZBI A;  3L3V A;  5JLF A;  4B1X B;  4IJN A;  3VF6 A;  3P31 A;  3V81 A;  3OYA A;  1RT7 A;  3OYE A;  2CGK A;  2UUA K;  4H5V A;  1ATS A;  2IGI A;  5SWM A;  2OTL N;  3VQC A;  4HCB A;  1QSS A;  1NGG A;  2WUS A;  1VRU A;  4A5A A;  2YNF A;  2YHX A;  3KIO A;  2VGN A;  2FXU A;  2OA8 A;  4CBX A;  2BUP A;  4YOV A;  2O8C A;  5M1Q A;  2B4J A;  3IKM A;  4BDP A;  2P9N A;  4N5S A;  5AQU A;  4U67 L;  4CF9 A;  4B9L A;  5M1O A;  4IDK A;  3SUQ A;  1N5Y A;  1REV A;  4PKI A;  3CPW M;  2F96 A;  3OW2 M;  1NMN A;  4L8R B;  1VQ7 N;  3ZX2 A;  3ENH A;  1RT2 A;  4LH5 A;  1VSI A;  2QXL A;  3FR0 A;  5DM7 L;  1ZBL A;  1ZBF A;  2YV0 X;  4AHS A;  4HVJ A;  4YFU A;  4U7B A;  4B9U A;  1N32 K;  3CCR N;  2NRX A;  3J7Y P;  1XHX A;  4DSK A;  3AV9 A;  4KH6 A;  3MAQ A;  4WQ5 C;  3ZX3 A;  2H3G X;  3O9Q A;  4BWJ A;  3ZT1 A;  1NOZ A;  2GUP A;  1VSK A;  1HKG A;  4ISF A;  4JAX A;  4IFV A;  3TAN A;  2F8T A;  4CHQ A;  3OS1 A;  1VQO N;  3SBG A;  1S9E A;  1M1K O;  4AQY K;  1GLL O;  4FM2 A;  2NRT A;  3EEQ A;  3NBP A;  2QWQ A;  3RVC A;  2ASO A;  4Z0U A;  2NUB A;  3D2F B;  3VEY A;  3ALY A;  4KRE A;  4BRH A;  2WOM A;  3NF7 A;  1RT4 A;  2UUC K;  3IDH A;  1C0U A;  2E20 A;  4A5B A;  3O4N A;  5LMN K;  1HJO A;  1QQM A;  4OPH A;  2ITG A;  3SBT A;  3KK2 A;  5I42 A;  1HYS A;  5J2P A;  4RCH A;  4KO0 A;  5JVG L;  5AQG A;  4WF9 L;  4QS8 A;  4AM6 A;  3WXI A;  4AHR A;  2AA4 A;  3TAE A;  3CPE A;  4F8R A;  1QTM A;  3MK6 A;  4BRD A;  2G8F A;  4FLT A;  3OHR A;  4NLC A;  5BPN A;  4JRQ A;  3VEX A;  1U47 A;  5C2F A;  1VSF A;  2VQE K;  2A1R A;  3VQ5 A;  1QE1 A;  1N6Q A;  3DJC A;  1KAZ A;  3AVI A;  4M3W A;  2IVO A;  3LZI A;  1RBS A;  1WSI A;  3CC4 N;  3M1F A;  3CJ1 A;  3QLH A;  4JK8 A;  5I3U A;  3SMS A;  4JK7 A;  3ZSQ A;  3J81 O;  2ZF5 O;  4CBU A;  3CJ7 A;  3GOI A;  3K5O A;  1RBV A;  1HYZ A;  3H46 O;  4NYN A;  3WNH A;  3AGR A;  2FSN A;  1RDD A;  2HBK A;  3HPG A;  5AQO A;  1FKP A;  3HBT A;  3BUZ B;  5KRT A;  1TYQ A;  3VET A;  2QA4 N;  3OVN A;  3O8M A;  2QEX N;  2D0O A;  2FBY A;  3ZLJ A;  1NKE A;  1HNI A;  2X78 A;  4RWT A;  3H45 C;  2O8E B;  2HHU A;  1VQ9 N;  3KTQ A;  3VGM A;  4DV6 K;  1FKO A;  1QVF M;  2HF4 A;  3VEN A;  2PYJ A;  3NHG A;  3VTH A;  3T7Z A;  3RRG A;  2V51 B;  4DU1 A;  2A6A A;  3VQE A;  1C0M A;  4GW6 A;  3QDK A;  5AZJ B;  2QI2 A;  2YCH A;  4FVU A;  3E01 A;  3CG7 A;  2KW4 A;  1X1P A;  3F5T A;  4MQ3 A;  4FJX A;  4JNE A;  1SS6 A;  4O8K A;  5LY3 A;  5B8H A;  1TAQ A;  3G10 A;  4J8F A;  4CZL A;  5KPR A;  2NRW A;  3C6H A;  1U4B A;  4NCA A;  2UXB K;  4K8Z A;  3FZK A;  3JSM A;  4I2Q A;  3DXM A;  2YHB A;  4OKJ A;  1XQS C;  3LM9 A;  4JKD A;  3VGL A;  4JKC A;  2P9I A;  2GBZ A;  3JYT A;  1A5V A;  4PUO A;  1KD1 O;  2VG7 A;  4ID5 A;  4YOX A;  3E1Y A;  4FJL A;  3CQY A;  2ZM6 K;  4C1N K;  2W6K A;  4DG1 A;  4CF2 A;  4CIF A;  3ATV A;  3AVF A;  2D0P A;  3OTO K;  3SAF A;  4DU4 A;  4B3O A;  4LFB K;  5TKY A;  3H1Q A;  2HHT A;  2Y1I A;  1NJY A;  3AVC A;  4FWL A;  1LAV A;  4E1N A;  1BL3 A;  4CZH A;  3VA0 A;  1BO5 O;  4F3T A;  4K25 A;  4DR6 K;  3ITH A;  1QQC A;  4JD2 A;  3VEO A;  4ID1 A;  2HVI A;  1U04 A;  5DM6 L;  1YVN A;  3SPY A;  3TU5 A;  5M1K A;  3VF4 A;  3K9K A;  1Q9X A;  2Z1H A;  4CVN E;  1XMQ K;  1DTT A;  3K5N A;  2HHQ A;  5GIN A;  2O8D B;  4GV9 A;  1HNV A;  2Q36 A;  2HBL A;  2P5G A;  2KZM A;  3ZEU A;  2BH1 A;  5EY4 A;  5HBM A;  1KVB A;  3DAW A;  3MN9 A;  4A57 A;  3CCQ N;  4H0P A;  4CFA A;  2NRH A;  4BRL A;  3ZT0 A;  2GV9 A;  4CGG A;  5EX5 A;  3L2R A;  3TAB A;  3CJB A;  1JKH A;  1T6C A;  2O8B A;  1C1C A;  4JI6 K;  5AR0 A;  1TK0 A;  1RCH A;  4JKE A;  1JLC A;  3CM5 A;  4DR3 K;  2BGG A;  4DSF A;  4O0J A;  3OYJ A;  3C94 A;  4K41 A;  1NM1 A;  2Z1J A;  5JS2 A;  2YI1 A;  5AQJ A;  1HPZ A;  4BRA A;  2WBN A;  3OYK A;  5KGX A;  1X3N A;  5E26 A;  2VG5 A;  3PX6 A;  3QBW A;  5IWA K;  1KTQ A;  4IDH A;  4A62 A;  4AM7 A;  4DTS A;  3NH2 A;  4FJ5 A;  3EKU A;  4HTL A;  2G8W A;  4DR2 K;  1JL1 A;  4DB3 A;  5FPD A;  4X65 K;  3D45 A;  1DEJ A;  4CK3 A;  3S3M A;  2P9P B;  3ZSO A;  5KI6 A;  3HYF A;  1MDU B;  1IH7 A;  3G0Z A;  3J7Z O;  2G8K A;  4GMJ B;  3L4I A;  3WNE A;  4EHU A;  1BDG A;  5GIO A;  4ZTJ A;  1LW2 A;  5CY4 A;  1MA9 B;  2VGM A;  5KPT A;  4ELV A;  4JS4 A;  3ULE A;  3THX A;  5I9E B;  1IKV A;  2P9U A;  5AFU A;  4BAC A;  1EXQ A;  4J2A A;  3PY8 A;  1YJW N;  3PSF A;  4CJ7 A;  4JHD B;  4KHN A;  4W5R A;  3AVJ A;  4OLA A;  2DY4 A;  2YHY A;  5KTQ A;  4H8K A;  2IVP A;  4KAZ A;  4FPA A;  2P9K B;  4LFC K;  2EWS A;  4CHO A;  2KZZ A;  3K58 A;  3F9K A;  4B3T K;  4FJJ A;  4R79 A;  1WUA A;  5CYM A;  3T3F A;  4JRP A;  1S9G A;  2UU9 K;  2RKI A;  1RNH A;  1NMD A;  2P51 A;  4Z4H A;  1T05 A;  5F1X A;  1Y64 A;  4H03 B;  3AA5 X;  4ILJ A;  5MLC Q;  5AQW A;  2FSJ A;  2KHO A;  2HF3 A;  1XWL A;  1VQ4 N;  3K5M A;  3MWT A;  3MEE A;  2E2N A;  5C10 A;  4YOY A;  1F21 A;  4H0T B;  3OA9 A;  1X3M A;  3KKS A;  3FZH A;  1GLC G;  1OVQ A;  2P9S A;  2JGU A;  1D9D A;  4EZ6 A;  2O8F A;  4E1M A;  1ZXO A;  3VQB A;  1L3T A;  4DSE A;  2OPR A;  3PIP L;  1RTI A;  4CJL A;  4ILH A;  4KTW A;  3CCV N;  5LJW A;  2UYT A;  3VQ8 A;  1K9M O;  2ASM A;  3KZB A;  1S22 A;  4CED A;  4O0I A;  3GE1 A;  3IRX A;  2A1S A;  1YT3 A;  3CCU N;  4J2E A;  2D5R A;  2Q1N A;  3AO4 A;  1NOY A;  3HJF A;  3AVK A;  2E2Q A;  1SKR A;  4I7F A;  4WE1 A;  1XI1 A;  4B9N A;  2QWO A;  1BQN A;  4JI7 K;  4KB0 A;  4QCL A;  4BRG A;  3SI6 A;  3AVL A;  2HBM A;  3LPT A;  1RBR A;  1SKW A;  2E8A A;  4CEZ A;  4CEE A;  4BDZ A;  4FZX C;  2F8S A;  4DKW A;  3OJU A;  4M41 A;  4CEF A;  4ZHR A;  4CZI A;  1WOQ A;  3AO2 A;  2HHH K;  4FLW A;  3EO3 A;  4Y0W A;  3LL3 A;  4FLY A;  2OPP A;  2OPQ A;  2EX3 A;  3O9S A;  2W6L A;  5E41 A;  5AQV A;  2GEL A;  1RGI A;  2FBX A;  3DMJ A;  4DV7 K;  2ZE2 A;  1NNE A;  4DQQ A;  1C0F A;  3MCP A;  3TAG A;  3FFI A;  3TAM A;  2KFN A;  4AHC A;  4DSI A;  4X62 K;  3CQ8 A;  3CM6 A;  3WQU A;  4JV5 K;  1Q9Y A;  3ZSX A;  3AO3 A;  4WQ4 A;  1YF5 L;  4BG8 A;  3DM2 A;  1N34 K;  2RE2 A;  5DMR A;  2VWK A;  4YDU C;  2G8H A;  1ASW A;  4AIL C;  4FWP A;  3LPU A;  3BGR A;  2GEM A;  3TSQ A;  2O8C B;  4FYD A;  4C8M A;  4PA1 A;  3I8B A;  4E0D A;  2P9N B;  3V9X A;  4E7H A;  2A3Z A;  1B9D A;  3NF9 A;  3GBT A;  1YJN N;  5M1P A;  4CK1 A;  3UE5 A;  1TV6 A;  3J7A P;  1TAU A;  1T8E A;  3BY5 A;  4CJK A;  4B9M A;  2IVN A;  3ZSY A;  4DFK A;  3QEP A;  4BC2 A;  1XC3 A;  5J2M A;  1JLA A;  1LW0 A;  2CH6 A;  1QZ5 A;  4C8N A;  1YHQ N;  1W2B M;  4IBN A;  4CZF A;  2D1K A;  3KJV A;  4FM1 A;  4JI0 K;  3LDN A;  1XMO K;  4UY8 O;  4OX9 K;  1HKB A;  1RDU A;  5FDL A;  4RW8 A;  1M90 O;  3LAL A;  3QES A;  1EP4 A;  3VMF B;  2E6L A;  4YNQ A;  3ZT4 A;  1BOT O;  3EZW A;  3I8D A;  4OKE A;  4DR5 K;  4Z4C A;  3QML A;  2FBT A;  1U45 A;  5C25 A;  1I3A A;  1I39 A;  4OPA A;  4KHS A;  2XY6 A;  1NGJ A;  3M5R A;  5M1N A;  5LJV A;  3LP3 A;  4DSL A;  4A2B A;  3D0P A;  2UUB K;  4CBW A;  3OYC A;  4H0O A;  1Z25 A;  4H4O A;  3RTV A;  5FRM A;  3ZX0 A;  2E4L A;  3HPH A;  3LWM A;  4FJ8 A;  1W0H A;  3OYL A;  4OLB A;  4KKO A;  3H3N O;  3MN7 A;  3TTC A;  1B9F A;  2B5J A;  4DV0 K;  4KH5 A;  1VQN N;  3I55 N;  3A2F A;  1EQY A;  4CJV A;  4FW1 A;  5JMV A;  4FK4 A;  1ZBS A;  2OAN A;  1BIU A;  1RT3 A;  3DLR A;  3SV4 A;  4CJP A;  3MEG A;  1BCM A;  4DTN A;  4YOW A;  3NE6 A;  5KQ8 A;  2BDP A;  5KPZ A;  5AQF A;  1GLJ O;  4F2S A;  3BEX A;  3HOT A;  1UOC A;  3O3G A;  4Z4E A;  1WBB A;  5HRS A;  1FK9 A;  4AF1 A;  4CI6 A;  5SZT A;  2FF6 A;  2G8I A;  1EKE A;  1HX1 A;  1KLM A;  4Y1D A;  1J54 A;  1TKZ A;  3C95 A;  1DT9 A;  4BC3 A;  4DFP A;  4BWM A;  3L2W A;  4CER A;  1VQ8 N;  4RW7 A;  2ATQ A;  3NH1 A;  3HXM A;  4DUZ K;  3MDQ A;  4JEP A;  3V6D A;  3ZSR A;  2GWK A;  1C0G A;  4FVM A;  1IO2 A;  3MX5 A;  3HTV A;  1VQP N;  1NG9 A;  4FZZ A;  3OYF A;  3CF5 L;  3NF8 A;  2DPN A;  3H3O B;  3SAH A;  3BDP A;  4CJT A;  4M45 A;  4FCY A;  4CD3 A;  3SQ0 A;  3QER A;  3SYZ A;  4KHW A;  3THW A;  4KHU A;  3THY A;  2NRV A;  1TYQ B;  3TTF A;  2OZS A;  5GIP A;  1VQM N;  2KFZ A;  3MEC A;  4DTO A;  1S3X A;  1KVA A;  3B8A X;  3DOK A;  3UIQ A;  4FJ7 A;  5BR8 K;  2ZGY A;  3AY9 A;  2F4V K;  1BGX T;  1IBL K;  1HJR A;  1Q18 A;  3LDL A;  4JKF A;  2VCP A;  3ENO A;  1C1B A;  5ADX H;  4PWD A;  4GNI A;  4CJF A;  1A5W A;  4XH5 A;  2YX6 A;  3ULD A;  4LF8 K;  1XNR K;  3VPZ A;  4DF4 A;  4XH4 A;  3SAG A;  1ZC6 A;  3O80 A;  4OPJ A;  2ZJQ L;  3BF1 A;  5EOY A;  1JCE A;  4BRI A;  4DV2 K;  4MO5 A;  1S1W A;  1K8K A;  4IG3 A;  4BRN A;  3B6P A;  3M8S A;  3V1Q A;  5CZ2 A;  4BRP A;  3VQQ A;  1WSJ A;  2QKB A;  1BQM A;  3DXM B;  1JLG A;  1GOB A;  3M6G A;  1FJG K;  1DTQ A;  3QIP A;  4CGJ A;  5AQL A;  2P9I B;  1C6V A;  3CET A;  1BI4 A;  3RMC A;  2IS3 A;  1HPM A;  1SAZ A;  3WEE A;  5CR4 A;  4BGB A;  3AVB A;  2QWM A;  1GLF O;  4IWV A;  4CJW A;  4KH4 A;  4N56 A;  1UA1 A;  3ATU A;  2PY5 A;  5CHI A;  2D0A A;  3AA2 A;  4CGF A;  4M3R A;  4EP4 A;  4JKA A;  3O9U A;  3S3O A;  1NGA A;  2P1J A;  3IAY A;  1FW6 A;  4DLE A;  3VTI A;  1YUW A;  4JD2 B;  3SUN A;  3EY1 A;  1NJW A;  3OJS A;  3DLE A;  1VSL A;  1ASV A;  2IC3 A;  1KAX A;  4I6M A;  1A5X A;  5BRF A;  1KSP A;  4DV4 K;  3QIC A;  3I56 N;  4DMN A;  2IOC A;  3KWG A;  4Z4G A;  3OYB A;  2YJE A;  5KQD A;  4OJR A;  1CZA N; 
#chains in the Genus database with same CATH homology
 4FWM A;  3D6R A;  4K41 A;  4QS7 A;  2PAV A;  1NM1 A;  3U9D A;  5AQJ A;  2YI1 A;  1NGH A;  3L4Q A;  5HL7 L;  3IMX A;  1BA1 A;  3A0I X;  4YDU A;  4JHD A;  4WFB L;  1XUP O;  3ZEU B;  4BRA A;  2WBN A;  3ENB A;  4XH1 A;  5AQR A;  4WQ5 A;  1DKG D;  2E2O A;  4CZJ A;  3CCE N;  1X3N A;  5E26 A;  2P9K A;  3A5L C;  3QBW A;  3R1X A;  4IDH A;  4BQL A;  4A62 A;  4AM7 A;  2HMP A;  3D2E A;  4RTF D;  4XEI A;  4WFN L;  3EKU A;  4HTL A;  4FL9 A;  5AQM A;  4BGA A;  3OBY A;  3WUH A;  4DB3 A;  5JLH A;  5AZI B;  1S72 N;  5FPD A;  2ITM A;  1DEJ A;  1KQS M;  3A5N C;  3VGK A;  2P9P B;  4B1V A;  1Q7Y O;  4I6M B;  3CJC A;  1H1V A;  3A5O C;  1MDU B;  1VQL N;  4K42 A;  4B1U B;  3VES A;  2D4W A;  4G9Z A;  1GLE G;  3J7Z O;  1YI2 N;  3L4I A;  3ID8 A;  4EHU A;  1BDG A;  4Z94 A;  5GIO A;  5FPN A;  3QFP A;  1MA9 B;  2VGM A;  3E9P A;  5KPT A;  2ZGZ A;  3ULE A;  3AAP A;  4WQ4 C;  4BRE A;  5I9E B;  4JK9 A;  2P9U A;  5AFU A;  5AQY A;  4BR4 A;  4WFA L;  5JVH L;  1YJW N;  2F9T A;  4CJ7 A;  4JHD B;  2QWR A;  2V7Z A;  2YHY A;  3WQT A;  4BR5 A;  4BR9 A;  3KK7 A;  4WCE L;  2HST A;  2IVP A;  1GLB G;  4MLH A;  4FPA A;  4B1W B;  1NGC A;  2P9K B;  2EWS A;  3MX2 A;  2E1Z A;  4NB4 A;  3VOV A;  2Q31 A;  4BRQ A;  3CER A;  4E1J A;  3D2E B;  4R79 A;  1V4T A;  5GAE P;  2FLO A;  1WUA A;  3C7N A;  1RFQ A;  3E9L A;  4O5F A;  4CZK A;  1NMD A;  4FWN A;  3O6W A;  5F0X A;  3EE9 A;  3VEW A;  1NJI O;  5F1X A;  1Y64 A;  3DXK A;  3QFU A;  2PFU A;  4H03 B;  4DQ8 A;  5BPL A;  4ILJ A;  3ULE B;  3CCS N;  3GDQ A;  5MLC Q;  5AQW A;  4IO8 A;  2WC9 A;  3O9R A;  4EFH A;  2FSJ A;  2KHO A;  3JXU A;  4FOI A;  2HF3 A;  3OBW A;  3P4I A;  1EO1 A;  3FFK B;  2P9U B;  3MWT A;  5TKW A;  4BRF A;  4EIA A;  5AQS A;  1VQ4 N;  2E2N A;  4BQZ A;  5GAG P;  5C10 A;  4YOY A;  1VAZ A;  3CHW A;  3DWL A;  4H0T B;  5EVZ A;  2GTD A;  1U6Z A;  5BN9 A;  2WFB A;  3OA9 A;  5C12 A;  1X3M A;  3FZH A;  3O9T A;  2QWN A;  1GLC G;  1OKJ A;  1T6D A;  4FWS A;  2P9S A;  5BRD A;  2JWL A;  1NGB A;  4YOT A;  1GLA G;  2P9L A;  4H5W A;  2CGL A;  4FOE A;  1GLD G;  1G99 A;  3WXL A;  1DGK N;  2CH5 A;  1ZXO A;  3WT0 A;  2ZJP L;  3C7N B;  2E2P A;  1HLU A;  3CI5 A;  3R8E A;  3SJH A;  3PIP L;  1KC8 O;  1V4S A;  4YOR A;  4ILH A;  1QVG M;  3HOS A;  3CCV N;  5LJW A;  2UYT A;  2I7N A;  2ASM A;  1ATR A;  3KZB A;  1S22 A;  1K9M O;  4A59 A;  4H0V B;  1D4X A;  2HOE A;  1TUU A;  3DXK B;  2QW9 A;  3FE1 A;  1NGD A;  3IUC A;  3GE1 A;  1IJJ A;  2V7Y A;  1YJ9 N;  3FZL A;  4YOU A;  3MN6 A;  3F9M A;  3VEV A;  3CCU N;  2ASP A;  2AP1 A;  4FWR A;  3CCJ N;  1OVY A;  2Q1N A;  3QB0 A;  4IOC L;  2YJF A;  4BRC A;  4OO1 J;  4JKH A;  3J8A A;  5C15 A;  1O13 A;  1SZ2 A;  5JLF A;  2FF3 B;  2KKZ A;  4CZM A;  3IFR A;  2E2Q A;  4B1X B;  2P9S B;  4LC9 B;  3EKS A;  4PL8 A;  4IJN A;  2W41 A;  3VF6 A;  2QWO A;  2P9L B;  3P31 A;  4MLE A;  3O4W A;  4BRG A;  4FWQ A;  3K9J A;  2CGK A;  2HBM A;  4H5V A;  1ATS A;  2E8A A;  4NO7 A;  1P8Z A;  1KAY A;  2OTL N;  1QHA A;  4DKW A;  3P38 A;  1NGG A;  1LCU A;  2WUS A;  4CZI A;  1WOQ A;  1Q86 O;  4BC4 A;  3EO3 A;  2V52 B;  4A5A A;  4Y0W A;  2YHX A;  3TSU A;  2VGN A;  3LL3 A;  1VQ6 N;  2FXU A;  3CD6 N;  1MWM A;  2Q97 A;  4CBX A;  3QBX A;  3U9Z A;  2BUP A;  4IXC A;  3MN5 A;  3E9O A;  3O9S A;  3VF2 A;  4YOV A;  5M1Q A;  3IKM A;  4MDB A;  5AQV A;  3LM2 A;  2GEL A;  1RGI A;  1JCG A;  3SLC A;  4B1Y B;  2P9N A;  5BRH A;  5AQU A;  4DHY A;  4U67 L;  4IOX A;  1C0F A;  5M1O A;  3MCP A;  5JIC A;  4PKI A;  3CXC M;  3ID6 A;  3CPW M;  2GX9 A;  3F2K A;  3OW2 M;  1NGI A;  5E84 A;  3TPQ A;  1VQ7 N;  3ZX2 A;  3ENH A;  2VWB A;  3KWI A;  1BWF O;  3WQU A;  2QXL A;  3FR0 A;  5DM7 L;  2NRR A;  4WQ4 A;  1YF5 L;  3UKU A;  4BG8 A;  4U7B A;  3NMU A;  5BPM A;  3CCR N;  2NRX A;  2RE2 A;  4PHT X;  4YDU C;  3D2F A;  3O08 A;  3G71 N;  4KH6 A;  3U8X A;  3R3L A;  3FGU A;  4IOA L;  4FWP A;  4WQ5 C;  3CC7 N;  3ZX3 A;  2GEM A;  5FPE A;  2H3G X;  3TSQ A;  3O9Q A;  3LDQ A;  4BR7 A;  3I8B A;  5AQX A;  4C1N I;  2P9N B;  4M7Y A;  4BY9 C;  2GUP A;  3Q7C A;  3R6M A;  1HKG A;  2F9W A;  4ISF A;  2A3Z A;  4JAX A;  3PLA A;  3GBT A;  5ADX A;  4H0X B;  1RDW X;  1YJN N;  1VQO N;  2PBD A;  3SBG A;  5M1P A;  1M1K O;  5AFU H;  3UE5 A;  3NVK A;  5H1S Q;  3H1V X;  1GLL O;  2IVN A;  1Q82 O;  3GG4 A;  1KXP A;  4H5T A;  3HI0 A;  2NRT A;  4FWK A;  4BC2 A;  1XC3 A;  2QWQ A;  1QZ6 A;  1T44 A;  3RSE A;  3O5B A;  3RVC A;  3UKU B;  5ELZ A;  5GAH P;  2CH6 A;  1QZ5 A;  2ASO A;  3SMP A;  1YHQ N;  3KHY A;  1W2B M;  2NNW A;  3D2F B;  3VEY A;  4CZF A;  5AQT A;  2D1K A;  4BRH A;  3LDN A;  4UY8 O;  3N4P A;  4BC5 A;  3IDH A;  5CE3 A;  4PL7 A;  2E20 A;  3A5M C;  2FSK A;  2ZWH A;  1RDU A;  1HKB A;  4ILG B;  4KBO A;  3HM8 A;  4A5B A;  5C2D A;  1M90 O;  3DLL L;  3C6A A;  4BRM A;  4BR0 A;  1HJO A;  3VMF B;  2RHK A;  4IZ9 A;  4MO4 A;  1QQM A;  4OPH A;  1BOT O;  3EZW A;  3WXM B;  3NVM A;  3SBT A;  2NRZ A;  5BRE A;  4H5N A;  5BN8 A;  3UB5 A;  3QML A;  1K73 O;  4PKG A;  3MCA B;  4RCH A;  3I33 A;  3RSE B;  5JVG L;  1NBW A;  4OPA A;  4CZG A;  5AQG A;  1NGJ A;  3M5R A;  4JKB A;  4QS8 A;  4AM6 A;  4WF9 L;  5M1N A;  1BA0 A;  1Z05 A;  2NLX A;  5AQI A;  3WXI A;  4A2B A;  2AA4 A;  5LJV A;  3CPE A;  4EHT A;  3L0Q A;  4GY2 B;  4CBW A;  3N4Q A;  2Q0R A;  2A41 A;  4H0O A;  4GV6 A;  3MK6 A;  4BRD A;  1E4F T;  4B1Z A;  5AQN A;  3OHR A;  1LOT B;  3ZX0 A;  3Q7B A;  1YAG A;  3O1W A;  4NLC A;  3VEX A;  5BPN A;  2A42 A;  3GL1 A;  5C2F A;  4IFE A;  4F9O A;  1BG3 A;  2NZT A;  1NLV A;  3TTC A;  3H3N O;  3MN7 A;  4CD1 A;  2Q0U A;  5AQH A;  4KH5 A;  4B9Q A;  4FPB A;  1VQN N;  3I55 N;  5AQK A;  4BVO A;  1EQY A;  3DJC A;  2E88 A;  2CGJ A;  1JJ2 M;  1KAZ A;  5JMV A;  2IVO A;  1ZBS A;  5GAD P;  4JN4 A;  3SK3 A;  3MWP A;  2OAN A;  3CC4 N;  2I7P A;  3M1F A;  3CJ1 A;  4JK8 A;  1K8A O;  1BUP A;  3SMS A;  4JK7 A;  3JS6 A;  2ZF5 O;  4CBU A;  3CJ7 A;  2IIR A;  2E1Y A;  4YOW A;  3GOI A;  1ILY A;  5KQ8 A;  3H46 O;  5KPZ A;  5AQF A;  1GLJ O;  3BEX A;  3HOT A;  3AGR A;  2FSN A;  4BRO A;  4FO0 A;  5AZJ A;  2HBK A;  5AQO A;  3TSP A;  4AF1 A;  1YIT N;  3HBT A;  3BUZ B;  4JKG A;  4CI6 A;  1TYQ A;  2FF6 A;  3AAR A;  1HX1 A;  2KLA A;  1TUY A;  3AAQ A;  4PKH A;  3VET A;  2QA4 N;  3E66 A;  2HBJ A;  5AQP A;  3O8M A;  2QEX N;  1DT9 A;  4BC3 A;  3CJ9 A;  2D0O A;  1VQ8 N;  4IEE A;  3G25 A;  4MDA A;  3MDQ A;  4JEP A;  4RWT A;  3H45 C;  5C0Y A;  2GWK A;  3WXJ A;  5M1F A;  1VQ9 N;  1C0G A;  1NGF A;  3D7E O;  3VGM A;  3MX5 A;  3HTV A;  1QVF M;  2HF4 A;  3AGK A;  3VEN A;  4C23 A;  1VQP N;  2JWK A;  2QTD A;  3VTH A;  3L6Q A;  3T7Z A;  3CF5 L;  3EN9 A;  4A61 A;  2V51 B;  1X9J A;  3EE8 A;  2DPN A;  1Q81 O;  3H3O B;  3SAH A;  2A6A A;  3C65 A;  3CCL N;  4CD3 A;  1MWK A;  2Q2R A;  2ZJR L;  3A8Y A;  5AZJ B;  1CZA N;  3QDK A;  1BU6 O;  1JCF A;  2QI2 A;  2YCH A;  1VQ5 N;  5HOO A;  4FVU A;  3T69 A;  3TTD A;  3UKR A;  4H0Y B;  1NWK A;  4JKG B;  3G6E N;  2NRV A;  1TYQ B;  3TTF A;  3HZ6 A;  2OTJ N;  5GIP A;  1VQM N;  3F5T A;  1IG8 A;  1VQK N;  4JNE A;  1HUX A;  1S3X A;  2VYP A;  5EXW A;  3B8A X;  1SS6 A;  4O8K A;  5LY3 A;  5B8H A;  4GV3 A;  1R59 O;  4ISE A;  4J8F A;  4CZL A;  5KPR A;  1T3V A;  2F7T A;  2NRW A;  3C6H A;  2GWJ A;  5F2R A;  3U4L A;  4BRK A;  3ZET A;  2ZGY A;  3AY9 A;  1Z6R A;  1Q18 A;  1QQN A;  3LDL A;  3HRG A;  4JKF A;  2VCP A;  3FZK A;  1P90 A;  4FSV A;  4H5R A;  3R9P A;  3VEZ A;  3ENO A;  1ESV A;  4IO9 L;  3DXM A;  5ADX H;  4GNI A;  1XQS C;  3LM9 A;  3MMV A;  4JKD A;  3VGL A;  4JKC A;  4XH5 A;  2YX6 A;  4WYB A;  2P9I A;  2A40 A;  3VPZ A;  3S41 A;  1KD1 O;  4YOX A;  3E1Y A;  3UKR B;  3CQY A;  4C1N K;  4XH4 A;  3SAG A;  1ZC6 A;  3ATV A;  3M3Z A;  1YIJ N;  3O80 A;  4QS9 A;  3LDO A;  2QM1 A;  2D0P A;  2J4R A;  3BF1 A;  2ZJQ L;  4BR2 A;  3SAF A;  2BTF A;  5EOY A;  1JCE A;  2QWL A;  4BRI A;  3H6E A;  3FZM A;  3PIO L;  3HSC A;  5TKY A;  3WXK A;  4MO5 A;  3ZYY X;  3H1Q A;  4EAH D;  4DCH A;  3CQX A;  4FWL A;  3ZET B;  1K8K A;  4O8U A;  4CZH A;  4BRN A;  1BO5 O;  1U2V A;  3BP8 A;  4K25 A;  3W0L A;  3G4S N;  3CME N;  4BRP A;  3CIP A;  4JD2 A;  4BVP A;  3VEO A;  3DXM B;  5DM6 L;  1YVN A;  1QQO A;  3M6G A;  3TU5 A;  5M1K A;  2W40 A;  3EL2 A;  4M63 C;  3VF4 A;  5AQZ A;  5AQL A;  2P9I B;  3CET A;  3C0B A;  3CC2 N;  3K9K A;  4FWO A;  5AQQ A;  1HPM A;  4K43 A;  4HWI A;  1SAZ A;  3WEE A;  5CR4 A;  4BGB A;  1W97 L;  1YXQ A;  1N8R O;  2QWM A;  1GLF O;  5GIN A;  4IWV A;  4GV9 A;  1J6Z A;  4KH4 A;  2Q36 A;  1ATN A;  2HBL A;  3ATU A;  5CHI A;  3ZEU A;  3VER A;  2BH1 A;  5EY4 A;  1SQK A;  3O9U A;  4JKA A;  3DAW A;  3FLC O;  1NGA A;  3MN9 A;  1K8K B;  1E4G T;  4NLB A;  4A57 A;  3LDP A;  3CCQ N;  1U2V B;  4A2A A;  4CZE A;  4GVE A;  1NGE A;  4H0P A;  2YHW A;  2NRH A;  3VTI A;  4BRL A;  1YUW A;  4JD2 B;  3KVG A;  3CJA A;  5AZI A;  5EX5 A;  4BG9 A;  2QWP A;  4IJA A;  4IEI A;  3BF3 A;  4ISG A;  3W3D A;  2P9P A;  3CJB A;  3FZF A;  1KAX A;  4I6M A;  1T6C A;  4L3Q A;  5BRF A;  5BR9 A;  3P39 A;  3QIC A;  3I56 N;  3O1B A;  3CCM N;  5AR0 A;  3CMA N;  4JKE A;  3KWG A;  3WEE B;  5FPM A;  2YJE A;  5KQD A;  4M7X A;  2A5X A;  1HKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...