4OVLA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Integrase
publication title Interrogating HIV integrase for compounds that bind--a SAMPL challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2013-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ovlA00
3HL8A 3HM9A 4FJ7A 2HNYA 1JL1A 1LW2A 4DWIA 2YKMA 1BISA 3KD1E 3OYKA 4CF9A 2PZSA 4KHSA 1L3SA 2XY6A 1T7PA 4R5PA 3S3NA 3UIQA 3OYIA 3ITHA 1CZBA 1BIZA 1C6VA 1ASWA 1JXBA 1RTHA 5C42A 5J2MA 1ZBLA 1T03A 1L5UA 4FJXA 1QSSA 3NHGA 1HQUA 3PO4A 3AA3A 1D9FA 4FXDA 4GVMA 4W5TA 4DG1A 4DFMA 1XI1A 2Z1GA 2A1RA 1SKSA 1B92A 1KTQA 2ETJA 3KKSA 2EX3A 3AVCA 3O4NA 4EP5A 4FLWA 4B9MA 4DF4A 2OZMA 2GUIA 1FXXA 5J1EA 4RW6A 4DMNA 4CGIA 3K2PA 2Z1HA 4CEOA 3SQ2A 1SL0A 4FLZA 4CHPA 3CFPA 3HO1A 4CHOA 2X78A 4E1NA 5HLFA 4Z4CA 4PY5A 3TARA 1VRUA 1BIUA 1VRTA 1Y97A 1NK6A 1C0UA 1DTQA 1KVAA 3MAQA 2VWJA 4KTWA 2JLEA 2F96A 4E7IA 4M41A 1VSDA 5FRMA 3LPTA 4FLYA 1QSYA 3QEXA 3OYNA 3OYBA 4M3XA 4KHQA 4DQSA 4M3TA 3LDSA 3VA0A 1S9EA 1JLCA 2HNDA 4RW8A 3SQ1A 3IAYA 4CESA 3QEWA 2HHWA 4CEBA 3EYZA 4JRQA 3TAFA 4ZHRA 4HUGA 1KLNA 4I9QA 1RBSA 3OYCA 3EY1A 3OYAA 1ZBUA 1S1WA 3LAMA 3QETA 1U4BA 1HQEA 2RF2A 4MQ3A 3M8PA 1S6PA 1NJZA 4F2SA 3OYDA 1NKCA 4FJGA 3LZJA 4DLEA 3KJVA 4CHYA 2G8KA 4B9SA 3WNGA 3WNEA 4DQQA 5DK5A 2KZMA 1TAUA 1TVRA 2YNHA 1IH7A 4QAGA 1RBTA 4RW7A 4MFBA 4B9TA 3AVMA 4O55A 4CEEA 1EETA 4KI4A 3L2UA 2YHBA 1BCOA 1VSFA 4DFPA 2Y1IA 3SUPA 3SQ0A 1NKBA 2X6SA 4H8KA 2KW4A 1J9AA 3HPGA 1C0MA 2HHVA 3ASMA 3MEEA 4E7LA 1VK0A 1DTTA 2G8WA 3AVHA 3OVNA 2G8UA 3V1RA 1NJXA 1RDDA 3RR7A 4CF0A 2RPIA 3LWLA 4OKEA 4KI6A 4BE1A 4CE9A 3G0ZA 4DTJA 3V9UA 4B8AB 3U6FA 2ATQA 3V1QA 4HHTA 3KTQA 4PWDA 3A2FA 3K59A 2XY5A 1S9GA 3T3FA 3RMAA 2Z1IA 1LWFA 3TAQA 3L3UA 2OZSA 4J2AA 3VQ5A 3QESA 3M8RA 3IS9A 3TAMA 3KLFA 3AVJA 1MU2A 4CFDA 1HYVA 1RT4A 3MECA 3M8SA 3C6UA 3PUFA 2DFEA 3QEVA 4OKJA 4FJHA 4W5OA 2QK9A 3RRHA 2O4GA 3I0RA 1JLFA 3VQCA 3TABA 5HROA 4C8OA 3AVAA 5HRNA 4BDPA 1LW0A 3NH2A 1NKEA 4EP4A 1RBUA 3AVKA 3C94A 4Z4HA 1NK4A 1WLJA 1XHZA 3LP3A 1WSEA 1Z25A 1RT3A 3NFAA 4CF8A 3THVA 4AILC 1ASVA 1FK9A 3CYMA 1JLGA 4CECA 3NH0A 4DTNA 5FRNA 4E7JA 1L3TA 4RG8A 3L2WA 4DSFA 3BGRA 3HPHA 4CFBA 4XIUA 2D0CA 3C6TA 4J2BA 3ZSQA 3OS0A 4BE0A 4FM1A 1G15A 1K6YA 1FKOA 4W5QA 3KK2A 4KAZA 4C8MA 4CJPA 1YVUA 5HRPA 1ITGA 4Y1CA 2VWKA 4IG0A 3KD5E 5CY4A 3SI6A 3OJSA 4BWMA 4I7FA 3KLHA 2E6LA 2ZE2A 1S6QA 2VG5A 1O1WA 3HYFA 3LP1A 4CJLA 3K5OA 2YKNA 4FYDA 1S1TA 1BQNA 2IAJA 1U47A 2HVIA 4AHRA 3V9XA 4C8NA 4KB1A 3ZT4A 3TWHA 4B9LA 4DTMA 4AHUA 1IKWA 4JLHA 5JS1A 4O44A 3K57A 3SNNA 1TGOA 1U49A 3HP6A 4FJMA 3HJFA 3L8BA 3S3MA 2KTQA 2YV0X 4G1QA 3LALA 3DMJA 2HMIA 1RILA 4FLUA 3HK2A 2O4IA 4AHVA 1JLQA 3ZSZA 4ELTA 5J2NA 4FK4A 4AHSA 2DY4A 3O3HA 4F8RA 3PX6A 1A5WA 4FJ8A 5JS2A 1HPZA 3E01A 3PO5A 1I39A 2WONA 4FK2A 3VQ8A 1RT5A 4OVLA 3K58A 5CYMA 4ZTJA 3V9SA 4CF1A 1EX4A 2A1SA 1JKHA 3JYTA 3S9HA 1IG9A 3D0PA 3QIOA 1VSEA 4PQUA 5HRSA 4O4GA 3SUQA 1SV5A 2YNGA 4M45A 2FBVA 4LH5A 4CIFA 4K8XA 4F4KA 3M8QA 4CEFA 2HW3A 2P1JA 3AVIA 4DF8A 1C0TA 1HRHA 2HB5A 2ZD1A 4OJRA 4CGFA 3MEGA 4CJQA 5KGXA 1RTJA 2IDOA 4CHNA 1IKYA 4BWJA 1VSIA 5J2PA 3P1GA 4EZ6A 2B6AA 1EKEA 3DRRA 4ID5A 4L8RB 4HUFA 3QEPA 1NK7A 4CJFA 3AVFA 4NCAA 4M42A 4LD0A 4N56A 3O3GA 4KHNA 4FCYA 2VG7A 4O0JA 5DMRA 4YFUA 4F2RA 4OPKA 3IG1A 3MXMA 3RWUA 2F8TA 3L3VA 4NCBA 2YHAA 1A5XA 2FC0A 4M3WA 1T8EA 4CK2A 4DU1A 4HVJA 3SQ4A 3KLIA 1W0HA 1XWLA 5KGWA 2QKBA 1SUQA 2B5JA 4DU3A 3TAPA 3AO4A 3ZSRA 3V4IA 3AVBA 1QSLA 4B9UA 4E1MA 4KV8A 1T05A 4HCBA 3ALYA 1JL2A 4CJWA 3DLBA 4CEZA 4Z4EA 1HJRA 1KCFA 2NUBA 3OJUA 1BGXT 3QNOA 2XHBA 1QTMA 2AJQA 4IFVA 1LAWA 2F8SA 4FZYA 3NH1A 4JS4A 3SV4A 4CJVA 1L3VA 2KQ2A 1GOAA 1RCHA 1TL3A 3NF6A 2BE2A 2IGIA 4FW2A 2W42A 1WAFA 3VQEA 1NK9A 1KLMA 2YNIA 4RW4A 4DTXA 4FM2A 3DI6A 1BQMA 2D5RA 1VSMA 3VQDA 4CGJA 3NAEA 4CGGA 1D8YA 3V6DA 2XRIA 4N41A 3ZT1A 2EHGA 3RTVA 3SPYA 3B6OA 4FJKA 3AVGA 3AO1A 4O0IA 3AA4A 1DLOA 5J2QA 3OYFA 3TAEA 1TK8A 1J5OA 5C25A 4OGEA 2OPPA 3PY8A 3AV9A 4DSIA 4ZTFA 4BDYA 4HTUA 1W9HA 4CK1A 4J2DA 3S3OA 1ZBIA 4ID1A 4WE1A 2DTUA 3ZSWA 4DQIA 4FJJA 1HNIA 4F3TA 3WNHA 3LP2A 4DTUA 4CCHA 4AH9A 1RBVA 1R0AA 4FJ9A 3V1OA 2X6NA 1RTIA 4DS5A 3DLRA 3DLGA 2E4LA 1GOCA 2PYJA 4PA1A 4FM0A 3I8DA 4AHTA 4DFKA 1B9FA 1XHXA 1JXEA 2G8HA 1S1UA 4CEQA 2QKKA 1Z26A 3KIOA 4CJKA 1U04A 1RTDA 4JRPA 4CJEA 2ZQBA 4E7KA 2P5OA 1UAXA 2BGGA 3DLEA 4IFYA 4DU4A 5HP1A 4Y1DA 4Q5VA 2D0BA 3P5JA 4FLVA 1HNVA 3D45A 3ISNC 1VSHA 4M3RA 5FDLA 2D0AA 4FLXA 1NOZA 4ICLA 3NGIA 1SL2A 2HNZA 3VQPA 3SJJA 2OA8A 2PYLA 3LP0A 5SZTA 4LSNA 1BI4A 4CGDA 3SCXA 1KSPA 4DTRA 1IKVA 1EP4A 4ELVA 4E0DA 3SPZA 3CM5A 2OPQA 4NYNA 3OS2A 2ITGA 2VG6A 1ASUA 3LANA 3RMDA 3U3YA 4M3ZA 2KFZA 1A5VA 4HUEA 2R7YA 1YTUA 2HHUA 4FVMA 2HHXA 3QNNA 3TI0A 4N47A 1X9WA 1NK0A 2G8IA 2P5GA 5FROA 4FW1A 3QO9A 1EXQA 2LSNA 3NBPA 3H08A 3OY9A 3AA5X 4CIEA 4E89A 1NOYA 3NCIA 3NF7A 1KRPA 3SYZA 1WSHA 4DFJA 4I9LA 3AVLA 5KTQA 3QEIA 2HVHA 4CJUA 3AO3A 4K8ZA 1NJYA 4CF2A 3DRSA 3VQ7A 5HRRA 4KFBA 1CXUA 1C1CA 3O4QA 1TKTA 1ZYQA 1N5YA 3ZT2A 3FFIA 2BDPA 1TAQA 3V9ZA 5C24A 1JLAA 1JLBA 1TKZA 4NYFA 3ZSOA 4OLBA 1TK0A 4B3OA 3WNFA 4OGCA 3RMBA 1N6QA 4KTZA 3VQ6A 2QXFA 3LAKA 3DM2A 3G10A 3VQBA 4CEDA 1C1AA 1WN7A 2KZZA 4NCGA 3LWMA 1TV6A 3LZIA 2FBYA 3DLKA 4BE2A 4FZZA 3OYJA 3HP9A 3HSTB 1B9DA 4JS5A 3NF9A 2GBZA 1WNSA 3NGYA 3QLHA 1RT7A 3QERA 2X74A 2HHQA 2G8VA 4CJ4A 4FJLA 3O3FA 1GOBA 4YNQA 1QHTA 3OYHA 1NJWA 1QS4A 3I0SA 4LH4A 4KHUA 2XO7A 4CK3A 3CQ8A 1Q9YA 4M3UA 5E41A 4LSLA 2DFFA 5KRTA 4KPYA 4C8LA 4DS4A 3MXIA 1QE1A 3TR8A 3TAGA 3SV3A 3K5LA 1WSFA 2OPRA 4FZXC 3C95A 1RNHA 1HYZA 3EZ5A 3BDPA 1WAJA 1SKRA 4H4OA 3RRGA 4KB0A 4QCLA 4DSLA 2IS3A 4CFCA 1LWEA 4BDZA 1VSKA 4F3OA 2GV9A 1LWCA 3MEDA 3VN5A 2P51A 1D9DA 4UQGA 4B9VA 3ZSVA 4TSXA 1BL3A 1FKPA 1UOCA 1VSLA 2JGUA 4DTOA 2I5JA 2Z1JA 1IO2A 3RR8A 1WSGA 3T1AA 4KHYA 3VQQA 1NK5A 1SL1A 4Q0BA 5KRSA 1ZBFA 3L2QA 2XY7A 3ULDA 3HXMA 3AO2A 3HVTA 4DQPA 3SZ2A 3NGZA 3OS1A 4CJSA 3JSMA 1HMVA 1U45A 3DYAA 2PY5A 3AVNA 3RMCA 4KO0A 3OYEA 3L2RA 2RN2A 1LV5A 3HVRA 4KTQA 4B8CA 3ZT0A 1U48A 4DTPA 4W5NA 4DQRA 1J54A 1KVCA 4IBNA 5CZ2A 4Z4IA 2HHTA 1BCMA 3OYMA 5T7BA 4M3YA 5CZ1A 3NF8A 3KLEA 4HCCA 2KFNA 1BI4B 2G8FA 3V81A 3VQAA 3ZSYA 4OPJA 2OYQA 4H4MA 5I42A 1JLEA 1TL1A 1X9SA 4Z4GA 4E7HA 2XY8A 4RW9A 3SUOA 1Q9XA 4LY7A 4E19A 2E6MA 1WSJA 3CFRA 1S1VA 2B4JA 4O5BA 5EU7A 1UA0A 4W5RA 4CHZA 4CJ3A 3KLGA 3F73A 1TKDA 4I2QA 3P83D 3MXJA 1WSIA 1RT1A 4IG3A 2IOCA 4FK0A 5HBMA 1YT3A 3V9WA 1KFSA 3K5MA 4KHWA 1VSJA 3B6PA 3DOLA 4CEAA 4FJNA 1REVA 3ZT3A 1TK5A 4C8KA 1ZBHA 2OPSA 3LPUA 5KI6A 1D5AA 3HT3A 3KK3A 4N5SA 3NE6A 4QOZB 3IRXA 1UA1A 1XC9A 1HYSA 1J53A 4IDKA 3SUNA 1RT2A 4BACA 2FBXA 4CHQA 4CJRA 3PX4A 4DSKA 3CFOA 4AHCA 4J2EA 1LAVA 1C1BA 3OYLA 3L2VA 3HPOA 1CXQA 3T19A 3QIPA 1RDCA 5K14A 1X1PA 1I3AA 4Z4FA 1RBRA 4CGHA 3U3GA 3QINA 1YTAA 1TKXA 2WOMA 1Q8IA 3PX0A 3K5NA 4OLAA 1X9MA 3ZCMA 3AA2A 1RDBA 4CFAA 5I3UA 4DSJA 3DLHA 1RDAA 1KVBA 1CZ9A 3ZSXA 4CJ5A 3NDKA 3VA3A 1SKWA 3AO5A 2BANA 4IKFA 4KRFA 2DFHA 4FJ5A 4PUOA 4GMJB 4DSEA 3CG7A 1S1XA 1IKXA 4KKOA 4GW6A 3OYGA 5CYQA 2RKIA 4DLGA 4CERA 1RT6A 4E3SA 4KREA 1KFDA 4DTSA 1NK8A 4I2PA 3KK1A 3DRPA 4ELUA 5D3GA 2HHSA 3VQ9A 4B08A 2YNFA 1CLQA 3PV8A 4N76A 5SWMA 3TANA 3VQ4A 3KKRA 4CIGA 1L3UA 1F21A 4FJIA 3CM6A 4OKKA 2Q3SA 3DOKA 4FLTA 3F9KA 4B9NA 2IC3A 4Z0UA 2FBTA 2Y1JA 1UWBA 1S5JA 4EZ9A 1BHLA 1QQCA 4CJTA
chains in the Genus database with same CATH superfamily
4A59A 3HM9A 3WQUA 4B3SK 4FJ7A 2Q97A 4XH4A 1BISA 4NXNK 3SAGA 1O13A 1L3SA 3OYIA 4CZHA 1BIZA 1VQNN 1ZBLA 1L5UA 4IOXA 3NHGA 3AA3A 2QA4N 4BRHA 2Q2RA 3ATUA 4DG1A 1KD1O 2IVPA 1WOQA 1KTQA 2ETJA 3O4NA 3C7NB 5BRHA 2A6AA 1E4GT 4DMNA 4JYAK 2HF4A 3K2PA 3IUCA 2Z1HA 3O9RA 3SLCA 3SQ2A 3BUZB 3CFPA 4CHOA 4Z4CA 3MN6A 4BC3A 5BN8A 2JLEA 1VSDA 5FRMA 4PKHA 3LPTA 4BRQA 3ID8A 4KHQA 3FZFA 4M3TA 3LDSA 3CPWM 3T1YK 4RW8A 3QEWA 1VQ4N 2P9NA 5H1SQ 3EY1A 3CCVN 3LAMA 2VQEK 3QETA 1U4BA 1YJWN 1NJZA 1NKCA 4RTFD 4CHYA 2G8KA 3WNGA 1TAUA 5DK5A 4JI6K 1IH7A 4MFBA 4O55A 2UYTA 4CEEA 3L2UA 3SMSA 2QWNA 1C0MA 2HSTA 1VK0A 3AVHA 4FWRA 4WQ4A 1MA9B 2RPIA 4CE9A 3IFRA 4DTJA 3U6FA 3KTQA 3V1QA 4BVOA 1S9GA 5BREA 3T3FA 2BH1A 3L3UA 3QESA 4Y0WA 1HYVA 5FPDA 3MECA 4MDAA 3QEVA 2O4GA 2A42A 3TABA 5HROA 4C8OA 3AVAA 1GLBG 5HRNA 3TTFA 3C94A 1NK4A 4BRPA 5FRNA 1FK9A 4DTNA 1JLGA 5M1PA 4LC9B 2D0CA 3ZSQA 2GELA 4FM1A 1VQKN 4KHPK 1FKOA 3KK2A 4C8MA 1KAYA 1XMOK 3PIOL 3SI6A 3P4IA 3CMAN 1NM1A 4LF7K 1O1WA 4FYDA 1BQNA 2WUSA 4AHRA 5GADP 4KB1A 4CZFA 4BR0A 3TWHA 4DTMA 1IKWA 3G6EN 4RCHA 1NGHA 3S3MA 4CBWA 4G1QA 4FLUA 3HK2A 2O8DA 4A57A 1JLQA 3ZSZA 3CJ7A 1HNWK 3R1XA 3ULEA 2CGKA 4CZEA 3VQ8A 3HTVA 2V7ZA 2UXDK 1EX4A 3S9HA 3JYTA 4DV1K 1IG9A 5HRSA 4FWMA 2ZJPL 4YDUC 2P1JA 1K73O 3WEEA 3T7ZA 1GLJO 1C0TA 4BG8A 1OVYA 4BR7A 2Q0RA 1RTJA 2YHWA 1VSIA 2A40A 2B6AA 1EKEA 4ID5A 3QEPA 3UKRB 4BC4A 3BF1A 4XH5A 5AQNA 4M42A 4JKAA 1SAZA 2VG7A 5DMRA 4JD2A 5AQLA 3ENBA 3M6GA 5AQOA 3MXMA 4NCBA 1T6CA 3KWGA 3SQ4A 3KLIA 2QKBA 2B5JA 4DU3A 4IOAL 3AO4A 3ZSRA 2P9SB 4CZIA 2XHBA 2OANA 4IFVA 3MMVA 2F8SA 4O8KA 3LDOA 5BPMA 4JS4A 3SV4A 5AFUH 2QM1A 2V51B 4DV7K 1RCHA 2D5RA 3THYB 5C0YA 4EHTA 4FJKA 3VERA 3AVGA 1DLOA 1YITN 4DV5K 2D0PA 4DR7K 2OPPA 3AV9A 4DSIA 4QS8A 5GAEP 3B8AX 3SK3A 5AQXA 3LP2A 4V19S 1RBVA 2X6NA 1RTIA 3LL3A 5GAHP 2YCHA 3JS6A 4BREA 4AHTA 1B9FA 2G8HA 1JXEA 5KPRA 4K43A 2QKKA 3KIOA 4E7KA 4IFYA 3U9ZA 2D0BA 4A61A 3P5JA 1HNVA 3D45A 2O8CA 3ISNC 3O8MA 1NOZA 3NGIA 3VQPA 3SJJA 2OA8A 5SZTA 4JV5K 3I56N 4ISEA 4CGDA 3SCXA 1HKGA 2ITGA 3MWTA 2VG6A 3BZKA 3K9JA 4A62A 4HUEA 4FVMA 3QNNA 3D2EB 4U67L 2P5GA 5FROA 1EXQA 1XNRK 3AA5X 4CIEA 1NOYA 3NF7A 1S22A 4AM6A 4DFJA 5KTQA 2Q31A 4CJUA 4K8ZA 3DWLA 4FWOA 1C1CA 3O4QA 1TKTA 4JI0K 3ZT2A 3DXMA 2BDPA 1TAQA 1JLAA 1JLBA 3DLLL 4EHUA 4KTZA 2QXFA 1G99A 3CF5L 1C1AA 1IBLK 4QS7A 4FZZA 3C6HA 4GKJK 3OYJA 2VGNA 4JS5A 1MDUB 5M1NA 2O8FB 4B1VA 3SAFA 2HF3A 3OYHA 5CR4A 1TUYA 3WXLA 3I0SA 5AQUA 2XO7A 3MDQA 1Q9YA 5E41A 2DFFA 2V52B 3CI5A 4C8LA 4EAHD 2OPRA 1QZ6A 1HYZA 2E1ZA 3C65A 1WAJA 4WQ5A 3ZEUA 1LWEA 5EXWA 4BQZA 4EFHA 3VN5A 2ASPA 2ZWHA 3ZSVA 3EO3A 4R79A 1W97L 5BPNA 4DTOA 2Z1JA 1IO2A 1TYQB 4WFNL 1Y64A 3L2QA 3ULDA 3HXMA 1T44A 3AO2A 2ZF5O 3JSMA 1U45A 5AQTA 2PY5A 2WC9A 3RMCA 3VTHA 3OYEA 2O8BA 4BY9C 1U48A 1NGCA 4BGBA 4DTPA 1BCMA 3OYMA 3NF8A 5HOOA 3V81A 3VQAA 4DR2K 3C7NA 1FW6A 3KZBA 5AQZA 5I42A 2XY8A 4RW9A 1P90A 4GV6A 3LDPA 3MCPA 1YI2N 1WSJA 3CFRA 1NGFA 4CJ3A 1TKDA 3CJBA 4MDBA 2IOCA 3W3DA 5BR9A 4YHHK 3V9WA 4KHWA 3K5MA 1VSJA 5DM7L 3DOLA 4CEAA 4MLEA 1D5AA 1HYSA 3NE6A 3M5RA 2O8EB 3J7YP 4J2EA 3OYLA 2VQFK 3N4PA 4FVUA 1I3AA 4IWVA 3U3GA 5AZJB 3QINA 1TKXA 1RFQA 2F7TA 2WOMA 4WCEL 3G4SN 4FOIA 1RDBA 4CFAA 5I3UA 3TSUA 3ZSXA 1CZ9A 1SKWA 3H6EA 3L0QA 4FJ5A 4DSEA 3ZX0A 2VGMA 4KKOA 4GW6A 5LL6Z 1U2VB 5CYQA 2RKIA 2UUCK 4CERA 1N33K 4ELUA 5AQJA 3I33A 1CLQA 3OBYA 5BN9A 3KKRA 3T1HK 1F21A 4FJIA 2ZGZA 3CM6A 3DOKA 4FLTA 3F9KA 1VQMN 4EZ9A 5M1OA 1HQEA 4CECA 4DQ8A 1VQ6N 1P8ZA 3HL8A 2YKMA 3KD1E 2PZSA 2QWRA 3MN7A 4ISGA 2XY6A 1T7PA 3UIQA 3ITHA 1CZBA 1RTHA 2P9IB 1T03A 1HQUA 4FXDA 4GVMA 4W5TA 5AQRA 5AJ3K 1SKSA 1B92A 2KLAA 4M7XA 2FSJA 3AVCA 4EP5A 4FLWA 4JHDA 4H5WA 1FXXA 4KH6A 3VEXA 4CEOA 1SL0A 4FLZA 1JJ2M 4CHPA 2X78A 3TTCA 1BIUA 1Y97A 1C0UA 1KVAA 2VWJA 4K25A 2F96A 2NRVA 2QXLA 3E1YA 3OYBA 3QEXA 4I6MB 3WT0A 1S9EA 2FXUA 2A5XA 3J8AA 4HUGA 4XH1A 1KLNA 4JKGB 4I9QA 3THXB 4CZGA 3M8PA 1GLLO 1S6PA 3WXKA 4F2SA 1ATRA 1SQKA 4QAGA 4DUZK 1RBTA 4B9TA 5LMNK 4AQYK 2Y1IA 1VSFA 4EIAA 2VCPA 4H8KA 2KW4A 1J9AA 2F9TA 2HHVA 3ASMA 3MEEA 4CW7B 4E7LA 1DTTA 2G8WA 2E8AA 4C1NI 3OVNA 4GY2B 1RDDA 1NG9A 1ZBSA 1RGIA 3G0ZA 5JVHL 3V9UA 3CXCM 2ATQA 4GV9A 4WQ5C 3K59A 2XY5A 1LWFA 3TAQA 4JKCA 3VQ5A 3M8RA 3L4IA 4PKGA 2YJFA 3TAMA 3ATVA 3AVJA 4CFDA 1WBDA 5IWAK 1RT4A 4JI3K 3PUFA 1XNQK 1RDUA 4FJHA 1NGBA 4W5OA 1JLFA 1KAXA 2WTUA 1LW0A 1NKEA 2NZTA 4EP4A 4Z4HA 3AVKA 2P9UA 3SAHA 4A5BA 1RT3A 3NFAA 4CF8A 3H45C 3D2FB 4AILC 3CYMA 1NGIA 3NH0A 1L3TA 3L2WA 2E5LK 4XIUA 1K6YA 4KBOA 3SJHA 5HRPA 1LOTB 5CY4A 3VEOA 4BWMA 5GINA 2ZE2A 1K8AO 2VG5A 3K5OA 2YKNA 4AF1A 2IAJA 1U47A 2ASOA 3ZT4A 1NMNA 5JS1A 3IKMA 3SNNA 3HJFA 4FL9A 2RE2A 2CGJA 3LALA 5KQ8A 1RILA 4AHVA 1YUWA 4H5NA 4AHSA 4J8FA 4JNEA 3E01A 4GNIA 2WONA 4ILJA 4OVLA 5CYMA 2YX6A 3NVMA 2A1SA 1JKHA 1QVFM 5C12A 4Z94A 3QIOA 1IV0A 1ILYA 2P9KB 3SUQA 3CQXA 4F4KA 4CEFA 3AVIA 5GAGP 2E2QA 4BRGA 2V7YA 5J2PA 3EE8A 4HUFA 1NK7A 3HRGA 4CJFA 3AVFA 3BF3A 4NCAA 4B3TK 4O0JA 4YFUA 3A5NC 3O6WA 4F2RA 3IG1A 4DUYK 3PSFA 2F8TA 3OBWA 1A5XA 2FC0A 1T8EA 4CK2A 1XWLA 5KGWA 4IO8A 1N32K 3A8YA 4HCBA 1XC3A 4CEZA 3E66A 4NLBA 5AQMA 1HJRA 3OW2M 3OA9A 2NRRA 2NUBA 1BGXT 1NGJA 5M1QA 1QTMA 4JI5K 4FZYA 3LM2A 1GOAA 5EVZA 2HBJA 4PL7A 4DV6K 4IJNA 1NK9A 4RW4A 2UXBK 2OTJN 3DI6A 1BQMA 3A0IX 4O5FA 2CGLA 2YHXA 2AA4A 1ZXOA 3NAEA 1D8YA 2XRIA 3ZT1A 4IO9L 3RTVA 3SPYA 4X64K 1NJIO 3OYFA 2ITMA 4OGEA 4B3MK 4ZTFA 2IVOA 4ID1A 2ZGYA 4H0PA 2NRTA 3WNHA 3OTOK 4CCHA 4AM7A 1R0AA 5AQIA 4DS5A 4OX9K 3DLRA 1TYQA 2E4LA 4B3RK 3MX5A 4IFEA 4PA1A 4CZLA 2J4RA 4FM0A 5LJVA 4DFKA 3FZMA 1XUPO 2I7NA 1S1UA 3CC4N 2P5OA 4CJEA 2YJEA 3AGKA 5KPZA 1UAXA 2GEMA 3DLEA 3KHYA 4LF8K 1E3MA 3CJAA 2D0AA 3QICA 4FLXA 2PYLA 3LP0A 4LSNA 1NGDA 4DTRA 1IKVA 1EP4A 1VAZA 1YVNA 3CM5A 5MLCQ 3AAQA 2KFZA 1GLFO 1K8KB 5AZIB 1VQLN 2HHXA 3AY9A 1KQSM 1V4TA 4K42A 3FZKA 4BRDA 4LF6K 4BC2A 3NBPA 3O5BA 3H08A 4OO1J 3NCIA 3TTDA 3AVLA 5FPEA 1NJYA 3DRSA 4KFBA 3UKUB 1N5YA 2QWMA 1VQ8N 3J80O 3V9ZA 4NYFA 4OLBA 1HUXA 4FWKA 4NO7A 5M1FA 1TK0A 3VQ6A 3LAKA 3NMUA 1NWKA 4NCGA 1TV6A 4BE2A 4LF9K 1RT7A 2NLXA 5TKWA 5LJWA 3QERA 2G8VA 2OTLN 4FJLA 3O3FA 3CPEA 3FZLA 4LH4A 3CQ8A 2PFUA 4DHYA 4KPYA 4LSLA 2WFBA 3CJ1A 4DS4A 3TR8A 3TAGA 3K5LA 1WSFA 4FZXC 1RNHA 3EZ5A 5AFUA 4JK7A 2UXCK 4DSLA 2IS3A 2GV9A 3CCRN 1LWCA 3QDKA 3ZETB 1VSLA 2HMPA 3O4WA 1SL1A 3MN9A 1KC8O 5KRSA 3HVTA 3HBTA 3OS1A 3CJ9A 4ISFA 4CZJA 4B1UB 1RDWX 2P9IA 4KTQA 1HLUA 4B8CA 4IDHA 1I94K 1GLCG 1J54A 5T7BA 1IBMK 3KLEA 1BI4B 4HTLA 3R6MA 4FOEA 3ZSYA 1BDGA 2VWBA 1TL1A 4Z4GA 1Q9XA 5AQFA 4LY7A 3A5LC 1HKCA 1R59O 2E6MA 4JAXA 4C1NK 4NB4A 4LF4K 1UA0A 4A2BA 3DXKB 1GLAG 3KLGA 3F73A 1WB9A 3MXJA 4BRMA 4FK0A 2HBKA 3B6PA 1REVA 1TK5A 4C8KA 4I6MA 2OPSA 3LPUA 5KI6A 3KK3A 4QOZB 1XC9A 4G9ZA 1J53A 3SUNA 2FBXA 5BPLA 4CHQA 5C2FA 4JKGA 1LAVA 2HBLA 3HPOA 3EE9A 3T19A 4IZ9A 4CGHA 4H0XB 1Q8IA 4OLAA 3K5NA 1X9MA 3ZCMA 4H5VA 4IKFA 1ZC6A 2DFHA 4OPAA 4PUOA 3CG7A 4JI8K 3JAMO 3VGMA 2FF6A 3OYGA 4WQ4C 3DRPA 2HOEA 4A2AA 5BR8K 2YNFA 3E9PA 1L3UA 3CHWA 4OKKA 2Q3SA 4X62K 4B9NA 1NGGA 1QQCA 4CJTA 4B1ZA 2KHOA 4DWIA 4CF9A 2KKZA 1QHAA 1J6ZA 4FJXA 1ASWA 1JXBA 2JWKA 3UE5A 5C42A 5J2MA 1QSSA 3P39A 3PO4A 3KK7A 1M90O 3D2FA 2NRXA 3N4QA 3CCJN 1XI1A 3L6QA 2A1RA 5LY3A 2ZM6K 1Q86O 4B9MA 4IEIA 2OZMA 2GUIA 3GBTA 4RW6A 4BRIA 4LFAK 3HO1A 3CCSN 4FPBA 4PY5A 1DTQA 3MAQA 3CD6N 4FSVA 4M41A 1MWKA 3LDNA 3HI0A 4HWIA 2CH6A 3OYNA 2NRHA 3QFUA 2BTFA 4M3XA 4DR3K 4FWNA 4H0YB 3VA0A 2HHWA 2NRWA 2HBMA 4WF9L 2QEXN 4CEBA 4JRQA 1Z05A 3TAFA 1BO5O 5FPNA 3OYCA 2P9KA 3OYDA 3LZJA 3S41A 2E2PA 4DQQA 2KZMA 2FLOA 1TVRA 1QQMA 2YNHA 3W0LA 5F1XA 4K41A 3AVMA 1EETA 4NXMK 3T69A 4KI4A 2YHBA 3VEWA 3SUPA 3SQ0A 2QWPA 3HPGA 3D7EO 2G8UA 1N36K 3V1RA 1NJXA 3RR7A 4CF0A 4JN4A 5AQQA 4H0VB 4OKEA 4KI6A 4BE1A 1BUPA 4HHTA 3H1VX 4PWDA 5AQSA 3RMAA 3EL2A 3KVGA 2Z1IA 2OZSA 3IS9A 3AGRA 3RVCA 3KLFA 1FJGK 1MU2A 5EX5A 1W7AA 3PIPL 4BRLA 1NMDA 5KQDA 2QK9A 3I0RA 3VQCA 4BDPA 3ID6A 3NH2A 1XHZA 1WSEA 4FWSA 1Z25A 3ULEB 3CJCA 1ASVA 1J5EK 4JKFA 1TUUA 4M7YA 4J2BA 1G15A 4CD1A 4W5QA 4DV3K 4KAZA 4CZMA 1ITGA 4Y1CA 2VWKA 1OH8A 3OJSA 1VQ9N 3KLHA 4I7FA 2E6LA 1S6QA 1HPMA 3E9LA 4CJLA 1S1TA 3IDHA 3V9XA 4U7BA 4BROA 1JCEA 4JLHA 5I9EB 4DR4K 1TGOA 1U49A 3HP6A 4FJMA 2KTQA 3O9QA 3SBTA 3HOSA 2YV0X 3GG4A 2O4IA 4ELTA 5J2NA 4FK4A 4BRAA 2DY4A 3O3HA 4H5TA 5JS2A 2Q0UA 3PO5A 4FK2A 1Q7YO 3VETA 3V9SA 3GDQA 3D0PA 1VSEA 4ILHA 1SV5A 4CIFA 1T6DA 3O9TA 5AZIA 4DF8A 2ZD1A 2D4WA 2HB5A 3SYZA 3F9MA 3MEGA 5KGXA 2IDOA 1EWRA 4H03B 3I8BA 4CHNA 1IKYA 3P1GA 3HSCA 4GKKK 1WUAA 3DRRA 4L8RB 1Q18A 4KHNA 1GLEG 4LF5K 1N34K 3H1QA 3UKUA 4DR5K 2YHAA 1HX1A 4M3WA 4DU1A 4HVJA 3BY5A 1W0HA 1OVQA 1SUQA 1QSLA 3V4IA 3AVBA 2YHYA 3U8XA 4B9UA 4KV8A 1T05A 3ALYA 3DLBA 1KCFA 3OJUA 3QNOA 1S72N 2RHKA 5HL7L 2NNWA 2BE2A 1YXQA 1WAFA 3VQEA 1KLMA 4FM2A 4B1XB 2JWLA 2O8CB 3VQDA 4CGGA 4N41A 3UKRA 4WYBA 2AP1A 5AQWA 3AARA 3AO1A 4O0IA 3TAEA 3VEZA 1TK8A 1J5OA 5C25A 2E88A 4HTUA 4CK1A 4J2DA 3S3OA 2DTUA 2F4VK 1HNIA 3ZETA 4F3TA 1BWFO 2GWJA 4AH9A 3M1FA 4FJ9A 2P9SA 3FGUA 4M63C 2VYPA 3R8EA 5F2RA 4H0OA 5AQPA 5BRFA 1U04A 2E20A 4JRPA 2ZQBA 2BGGA 3VOVA 3EZWA 4DU4A 3DXMB 4Y1DA 4FLVA 5GIPA 3THYA 4GV3A 4M3RA 5FDLA 1VQPN 4BC5A 1SL2A 2W40A 2WBNA 2HNZA 3CMEN 4O8UA 3ZYYX 1BI4A 1KSPA 4X66K 3OS2A 2OPQA 4MO4A 4YDUA 4E1JA 1ASUA 3RMDA 2UU9K 3U3YA 3MK6A 1A5VA 3ZX2A 1NK0A 1X9WA 3U4LA 4YOUA 3DXKA 4BG9A 3OY9A 2GX9A 4E89A 2PAVA 1KRPA 3AO3A 4CF2A 3H3NO 1HJOA 3GOIA 3ZEUB 4JKDA 5C24A 1TKZA 3CIPA 4DB3A 4B3OA 4OGCA 2QW9A 1X9JA 3DM2A 3VQBA 4CEDA 2P9LB 3LWMA 3LZIA 3DLKA 3O80A 3CCMN 1YIJN 1B9DA 3VPZA 5AQGA 3QLHA 2GBZA 1WNSA 3NGYA 2X74A 2UUBK 2HHQA 3D2EA 1QHTA 2O8BB 3RSEB 1NJWA 4JI4K 3A5OC 4KHUA 4CK3A 3CCEN 5KRTA 5JLFA 4JI2K 3SV3A 3C95A 2D1KA 3NVKA 1D4XA 3BDPA 1SKRA 4KB0A 1HNZK 2W6LA 4QCLA 4CFCA 4F3OA 3J7ZO 2QWOA 2A41A 4JK8A 5AQHA 4BRFA 4TSXA 1BL3A 2JGUA 2I5JA 4KHYA 5ELZA 3WXIA 1BA0A 1ZBFA 4DQPA 4B9QA 2O8FA 4WFAL 4DCHA 3NGZA 4CJSA 1HMVA 3QMLA 3AVNA 4JEPA 1BG3A 4KO0A 3LDLA 1DGKN 2RN2A 3ZT0A 4BVPA 2GTDA 3MCAB 4Z4IA 1DKGD 1KVCA 4IBNA 2HHTA 4GVEA 5CZ1A 4HCCA 4BRNA 2KFNA 4CVNE 2G8FA 3EKSA 5ADXA 1OH6A 4OPJA 3D6RA 2OYQA 1LCUA 1JLEA 2HHHK 4E7HA 3SUOA 4E19A 1KAZA 1N8RO 3LM9A 1S1VA 2B4JA 5EU7A 4W5RA 3CCLN 4CHZA 3VGKA 1RT1A 4IG3A 5ADXH 4YOWA 5HBMA 1YT3A 1KFSA 3THWB 3ZT3A 1ZBHA 3Q7BA 3HT3A 4N5SA 2P9PB 3IRXA 1RT2A 4IXCA 2Q36A 3PX4A 4MLHA 1C1BA 1CXQA 3ENHA 3QIPA 1OH7A 1RDCA 1CZAN 2BUPA 1RBRA 2EWSA 3HZ6A 1YTAA 3PX0A 4DSJA 3TSPA 3DLHA 1RDAA 4PL8A 1KVBA 4CJ5A 3J81O 3VA3A 4KRFA 3TU5A 3ENOA 1BA1A 1RT6A 1E4FT 4FWLA 4E3SA 4DTSA 4KREA 4JHDB 1BOTO 1SZ2A 4I2PA 1NK8A 3VQ9A 4B08A 2E2OA 3PV8A 1EQYA 4ILGB 3VQ4A 3J7AP 1IBKK 2O8EA 2IC3A 4Z0UA 2FBTA 4LFBK 1JL2A 1NLVA 1VHXA 2UUAK 2HNYA 2QI2A 1JL1A 1LW2A 1NU0A 3OYKA 5AZJA 3CC2N 4KHSA 5LMUK 3PSIA 4R5PA 3S3NA 1C6VA 2FSNA 1D9FA 5C10A 3KWIA 4DFMA 2Z1GA 1U2VA 2EX3A 3KKSA 1KXPA 1MWMA 4DF4A 4A5AA 1S3XA 3K9KA 5J1EA 4CGIA 4X65K 3I55N 5AQYA 1YAGA 4E1NA 5HLFA 3TARA 1VRUA 2Q1NA 1K9MO 1VRTA 1NK6A 4KTWA 3BEXA 4E7IA 5C15A 4FLYA 1QSYA 4DQSA 3ZLJA 1HNXK 1JLCA 2HNDA 3CCUN 3SQ1A 5KPTA 4CESA 3IAYA 1HKBA 3CC7N 3EYZA 3DJCA 4OPHA 4ZHRA 4B1YB 1RBSA 3OYAA 1ZBUA 1S1WA 1NBWA 2RF2A 4MQ3A 3BP8A 4FJGA 5C2DA 4DLEA 3KJVA 4B9SA 3PLAA 3WNEA 1VQ7N 4RW7A 1QQOA 3VGLA 2P9UB 3P38A 4DFPA 1BCOA 1NKBA 2X6SA 5FPMA 1C0FA 2ZJRL 3E9OA 5DM6L 3M3ZA 5CE3A 3MWPA 3LWLA 4CBXA 4B8AB 3QBXA 3A2FA 3QB0A 1NNEA 4NLCA 4J2AA 1U6ZA 3EKUA 5AR0A 3M8SA 3C6UA 3K0SA 3THXA 1YF5L 2DFEA 1X3MA 4KH4A 4OKJA 3RRHA 1XMQK 1VQ5N 4CI6A 1SS6A 1M1KO 3WQTA 1RBUA 2W6KA 1Q82O 1WLJA 4K0KK 2FSKA 3LP3A 3THVA 4DR6K 4FWPA 1HR0K 4E7JA 4RG8A 4DSFA 3BGRA 3HPHA 4CFBA 3C6TA 3MX2A 3DAWA 1QVGM 3OS0A 4BE0A 4CJPA 1YVUA 3L4QA 4IG0A 3KD5E 3HYFA 3LP1A 2HVIA 4DV2K 4C8NA 3WXMB 4B9LA 4RWTA 4AHUA 4YOTA 3OHRA 4L3QA 4O44A 3K57A 2F9WA 4WFBL 3L8BA 2HMIA 3DMJA 2GWKA 4F8RA 2NRZA 4CBUA 3PX6A 1A5WA 4FJ8A 2P9NB 1HPZA 1I39A 1RT5A 1XQSC 3K58A 4ZTJA 4CF1A 5M1KA 3AAPA 4IOCL 4PQUA 4O4GA 3F5TA 2YNGA 4M45A 3TSQA 2FBVA 4LH5A 4K8XA 3M8QA 2HW3A 1HRHA 4OJRA 4CGFA 4CJQA 5JLHA 2E2NA 3CQYA 4BWJA 5A2QO 3BZCA 3QFPA 4EZ6A 3H46O 4LD0A 4N56A 3O3GA 3VMFB 1IJJA 4FCYA 2IIRA 4OPKA 3QBWA 3C6AA 3RWUA 3L3VA 2QWLA 5E26A 2I7PA 3TAPA 4E1MA 4CJWA 4Z4EA 2P9LA 1WBBA 2AJQA 2QWQA 1LAWA 3NH1A 4CJVA 2A3ZA 1L3VA 2KQ2A 3NF6A 1TL3A 1YHQN 2IGIA 4FW2A 2W42A 2YNIA 4DTXA 3RSEA 1DEJA 1VSMA 4F9OA 4C23A 4CGJA 3Q7CA 5EOYA 3V6DA 2EHGA 3GL1A 3B6OA 4PKIA 3AA4A 1QZ5A 5J2QA 4CD3A 3G71N 3CETA 3PY8A 4BDYA 1W9HA 4YORA 4JKBA 1ZBIA 4WE1A 4BR5A 3ZSWA 4DQIA 4FJJA 3A5MC 4DV0K 5JICA 4DTUA 3JXUA 3V1OA 3DLGA 1Z6RA 2YI1A 1GOCA 4JKEA 2PYJA 3I8DA 3EN9A 3O08A 1XHXA 2GUPA 4CEQA 1Z26A 1RTDA 4CJKA 2O8DB 5IT9O 5HP1A 4Q5VA 2ZJQL 3R3LA 4DR1K 3R9PA 4BGAA 5E84A 1VSHA 4JI1K 4ICLA 1VQON 4ELVA 4E0DA 3SPZA 4JK9A 4NYNA 5TKYA 3LANA 3UB5A 2E1YA 5AQKA 4LFCK 4M3ZA 3WEEB 2HHUA 2R7YA 1YTUA 3TI0A 4N47A 2G8IA 4FW1A 3QO9A 3ZX3A 2LSNA 1WSHA 4I9LA 3QEIA 2HVHA 3GE1A 5EY4A 4JD2B 3VQ7A 5HRRA 3WUHA 1CXUA 4IJAA 3THWA 1ZYQA 3FFIA 1X3NA 2P9PA 3ZSOA 5JMVA 4YOXA 3VTIA 3WNFA 4XEIA 4IEEA 3RMBA 2QTDA 1N6QA 4PHTX 3G10A 4FWQA 3HOTA 1WN7A 3FFKB 2KZZA 2W41A 2FBYA 3HP9A 3HSTB 3VF4A 1C0GA 3NF9A 1K8KA 2D0OA 2FF3B 1JCGA 4CJ4A 5AQVA 4DKWA 1YJNN 1GOBA 4YNQA 4KH5A 1H1VA 1QS4A 1EO1A 5CHIA 1DT9A 3F2KA 4M3UA 4FPAA 4BR9A 3MXIA 1QE1A 3VESA 1OKJA 3RRGA 4H4OA 3U9DA 1NGEA 1BU6O 4YOYA 3O9SA 4BDZA 1VSKA 3WXJA 3MEDA 2PBDA 2P51A 3C0BA 4UQGA 1D9DA 4B9VA 4JKHA 1FKPA 1UOCA 3CERA 3RR8A 1WSGA 3T1AA 3VEYA 3VQQA 1NK5A 4Q0BA 3FE1A 2XY7A 5JVGL 3SZ2A 2OCEA 3DYAA 3G25A 1EWQA 4CZKA 3L2RA 1LV5A 4CJ7A 3HVRA 4YY3K 3VF6A 1T3VA 4W5NA 4DQRA 2CH5A 5CZ2A 4M3YA 3EEQA 3O1BA 5GIOA 4BRCA 3O9UA 1ATNA 4H4MA 1X9SA 5BRDA 5FLXO 4O5BA 3P31A 3FR0A 3VEVA 4I2QA 4H5RA 5F0XA 3P83D 1WSIA 3CCQN 2DPNA 4MO5A 5B8HA 2ASMA 4FO0A 4FJNA 1JCFA 4YOVA 4QS9A 1UA1A 4IDKA 4BACA 1OH5A 4CJRA 4DSKA 3CFOA 4AHCA 3L2VA 4BR4A 1NGAA 1V4SA 3H3OB 5K14A 3MN5A 3HM8A 1GLDG 1X1PA 2IVNA 1Q81O 1YJ9N 4Z4FA 1ESVA 4BQLA 3AA2A 1QQNA 4H0TB 2H3GX 3NDKA 3AO5A 2BANA 4B1WB 4GMJB 4BRKA 1S1XA 1IKXA 3TPQA 3FLCO 3O1WA 3SBGA 4DLGA 1W2BM 1KFDA 2HHSA 3KK1A 4DV4K 5D3GA 4N76A 3LDQA 3SMPA 5SWMA 3TANA 3VF2A 4BR2A 4CIGA 3FZHA 1IG8A 4JI7K 3VENA 4UY8O 2Y1JA 1UWBA 1S5JA 1ATSA 1BHLA 3IMXA
chains in the Genus database with same CATH topology
3HL8A 3HM9A 4FJ7A 2HNYA 1JL1A 1LW2A 4DWIA 2YKMA 1BISA 3KD1E 3OYKA 4CF9A 2PZSA 4KHSA 1L3SA 2XY6A 1T7PA 4R5PA 3S3NA 3UIQA 3OYIA 3ITHA 1CZBA 1BIZA 1C6VA 1ASWA 1JXBA 1RTHA 5C42A 5J2MA 1ZBLA 1T03A 1L5UA 4FJXA 1QSSA 3NHGA 1HQUA 3PO4A 3AA3A 1D9FA 4FXDA 4GVMA 4W5TA 4DG1A 4DFMA 1XI1A 2Z1GA 2A1RA 1SKSA 1B92A 1KTQA 2ETJA 3KKSA 2EX3A 3AVCA 3O4NA 4EP5A 4FLWA 4B9MA 4DF4A 2OZMA 2GUIA 1FXXA 5J1EA 4RW6A 4DMNA 4CGIA 3K2PA 2Z1HA 4CEOA 3SQ2A 1SL0A 4FLZA 4CHPA 3CFPA 3HO1A 4CHOA 2X78A 4E1NA 5HLFA 4Z4CA 4PY5A 3TARA 1VRUA 1BIUA 1VRTA 1Y97A 1NK6A 1C0UA 1DTQA 1KVAA 3MAQA 2VWJA 4KTWA 2JLEA 2F96A 4E7IA 4M41A 1VSDA 5FRMA 3LPTA 4FLYA 1QSYA 3QEXA 3OYNA 3OYBA 4M3XA 4KHQA 4DQSA 4M3TA 3LDSA 3VA0A 1S9EA 1JLCA 2HNDA 4RW8A 3SQ1A 3IAYA 4CESA 3QEWA 2HHWA 4CEBA 3EYZA 4JRQA 3TAFA 4ZHRA 4HUGA 1KLNA 4I9QA 1RBSA 3OYCA 3EY1A 3OYAA 1ZBUA 1S1WA 3LAMA 3QETA 1U4BA 1HQEA 2RF2A 4MQ3A 3M8PA 1S6PA 1NJZA 4F2SA 3OYDA 1NKCA 4FJGA 3LZJA 4DLEA 3KJVA 4CHYA 2G8KA 4B9SA 3WNGA 3WNEA 4DQQA 5DK5A 2KZMA 1TAUA 1TVRA 2YNHA 1IH7A 4QAGA 1RBTA 4RW7A 4MFBA 4B9TA 3AVMA 4O55A 4CEEA 1EETA 4KI4A 3L2UA 2YHBA 1BCOA 1VSFA 4DFPA 2Y1IA 3SUPA 3SQ0A 1NKBA 2X6SA 4H8KA 2KW4A 1J9AA 3HPGA 1C0MA 2HHVA 3ASMA 3MEEA 4E7LA 1VK0A 1DTTA 2G8WA 3AVHA 3OVNA 2G8UA 3V1RA 1NJXA 1RDDA 3RR7A 4CF0A 2RPIA 3LWLA 4OKEA 4KI6A 4BE1A 4CE9A 3G0ZA 4DTJA 3V9UA 4B8AB 3U6FA 2ATQA 3V1QA 4HHTA 3KTQA 4PWDA 3A2FA 3K59A 2XY5A 1S9GA 3T3FA 3RMAA 2Z1IA 1LWFA 3TAQA 3L3UA 2OZSA 4J2AA 3VQ5A 3QESA 3M8RA 3IS9A 3TAMA 3KLFA 3AVJA 1MU2A 4CFDA 1HYVA 1RT4A 3MECA 3M8SA 3C6UA 3PUFA 2DFEA 3QEVA 4OKJA 4FJHA 4W5OA 2QK9A 3RRHA 2O4GA 3I0RA 1JLFA 3VQCA 3TABA 5HROA 4C8OA 3AVAA 5HRNA 4BDPA 1LW0A 3NH2A 1NKEA 4EP4A 1RBUA 3AVKA 3C94A 4Z4HA 1NK4A 1WLJA 1XHZA 3LP3A 1WSEA 1Z25A 1RT3A 3NFAA 4CF8A 3THVA 4AILC 1ASVA 1FK9A 3CYMA 1JLGA 4CECA 3NH0A 4DTNA 5FRNA 4E7JA 1L3TA 4RG8A 3L2WA 4DSFA 3BGRA 3HPHA 4CFBA 4XIUA 2D0CA 3C6TA 4J2BA 3ZSQA 3OS0A 4BE0A 4FM1A 1G15A 1K6YA 1FKOA 4W5QA 3KK2A 4KAZA 4C8MA 4CJPA 1YVUA 5HRPA 1ITGA 4Y1CA 2VWKA 4IG0A 3KD5E 5CY4A 3SI6A 3OJSA 4BWMA 4I7FA 3KLHA 2E6LA 2ZE2A 1S6QA 2VG5A 1O1WA 3HYFA 3LP1A 4CJLA 3K5OA 2YKNA 4FYDA 1S1TA 1BQNA 2IAJA 1U47A 2HVIA 4AHRA 3V9XA 4C8NA 4KB1A 3ZT4A 3TWHA 4B9LA 4DTMA 4AHUA 1IKWA 4JLHA 5JS1A 4O44A 3K57A 3SNNA 1TGOA 1U49A 3HP6A 4FJMA 3HJFA 3L8BA 3S3MA 2KTQA 2YV0X 4G1QA 3LALA 3DMJA 2HMIA 1RILA 4FLUA 3HK2A 2O4IA 4AHVA 1JLQA 3ZSZA 4ELTA 5J2NA 4FK4A 4AHSA 2DY4A 3O3HA 4F8RA 3PX6A 1A5WA 4FJ8A 5JS2A 1HPZA 3E01A 3PO5A 1I39A 2WONA 4FK2A 3VQ8A 1RT5A 4OVLA 3K58A 5CYMA 4ZTJA 3V9SA 4CF1A 1EX4A 2A1SA 1JKHA 3JYTA 3S9HA 1IG9A 3D0PA 3QIOA 1VSEA 4PQUA 5HRSA 4O4GA 3SUQA 1SV5A 2YNGA 4M45A 2FBVA 4LH5A 4CIFA 4K8XA 4F4KA 3M8QA 4CEFA 2HW3A 2P1JA 3AVIA 4DF8A 1C0TA 1HRHA 2HB5A 2ZD1A 4OJRA 4CGFA 3MEGA 4CJQA 5KGXA 1RTJA 2IDOA 4CHNA 1IKYA 4BWJA 1VSIA 5J2PA 3P1GA 4EZ6A 2B6AA 1EKEA 3DRRA 4ID5A 4L8RB 4HUFA 3QEPA 1NK7A 4CJFA 3AVFA 4NCAA 4M42A 4LD0A 4N56A 3O3GA 4KHNA 4FCYA 2VG7A 4O0JA 5DMRA 4YFUA 4F2RA 4OPKA 3IG1A 3MXMA 3RWUA 2F8TA 3L3VA 4NCBA 2YHAA 1A5XA 2FC0A 4M3WA 1T8EA 4CK2A 4DU1A 4HVJA 3SQ4A 3KLIA 1W0HA 1XWLA 5KGWA 2QKBA 1SUQA 2B5JA 4DU3A 3TAPA 3AO4A 3ZSRA 3V4IA 3AVBA 1QSLA 4B9UA 4E1MA 4KV8A 1T05A 4HCBA 3ALYA 1JL2A 4CJWA 3DLBA 4CEZA 4Z4EA 1HJRA 1KCFA 2NUBA 3OJUA 1BGXT 3QNOA 2XHBA 1QTMA 2AJQA 4IFVA 1LAWA 2F8SA 4FZYA 3NH1A 4JS4A 3SV4A 4CJVA 1L3VA 2KQ2A 1GOAA 1RCHA 1TL3A 3NF6A 2BE2A 2IGIA 4FW2A 2W42A 1WAFA 3VQEA 1NK9A 1KLMA 2YNIA 4RW4A 4DTXA 4FM2A 3DI6A 1BQMA 2D5RA 1VSMA 3VQDA 4CGJA 3NAEA 4CGGA 1D8YA 3V6DA 2XRIA 4N41A 3ZT1A 2EHGA 3RTVA 3SPYA 3B6OA 4FJKA 3AVGA 3AO1A 4O0IA 3AA4A 1DLOA 5J2QA 3OYFA 3TAEA 1TK8A 1J5OA 5C25A 4OGEA 2OPPA 3PY8A 3AV9A 4DSIA 4ZTFA 4BDYA 4HTUA 1W9HA 4CK1A 4J2DA 3S3OA 1ZBIA 4ID1A 4WE1A 2DTUA 3ZSWA 4DQIA 4FJJA 1HNIA 4F3TA 3WNHA 3LP2A 4DTUA 4CCHA 4AH9A 1RBVA 1R0AA 4FJ9A 3V1OA 2X6NA 1RTIA 4DS5A 3DLRA 3DLGA 2E4LA 1GOCA 2PYJA 4PA1A 4FM0A 3I8DA 4AHTA 4DFKA 1B9FA 1XHXA 1JXEA 2G8HA 1S1UA 4CEQA 2QKKA 1Z26A 3KIOA 4CJKA 1U04A 1RTDA 4JRPA 4CJEA 2ZQBA 4E7KA 2P5OA 1UAXA 2BGGA 3DLEA 4IFYA 4DU4A 5HP1A 4Y1DA 4Q5VA 2D0BA 3P5JA 4FLVA 1HNVA 3D45A 3ISNC 1VSHA 4M3RA 5FDLA 2D0AA 4FLXA 1NOZA 4ICLA 3NGIA 1SL2A 2HNZA 3VQPA 3SJJA 2OA8A 2PYLA 3LP0A 5SZTA 4LSNA 1BI4A 4CGDA 3SCXA 1KSPA 4DTRA 1IKVA 1EP4A 4ELVA 4E0DA 3SPZA 3CM5A 2OPQA 4NYNA 3OS2A 2ITGA 2VG6A 1ASUA 3LANA 3RMDA 3U3YA 4M3ZA 2KFZA 1A5VA 4HUEA 2R7YA 1YTUA 2HHUA 4FVMA 2HHXA 3QNNA 3TI0A 4N47A 1X9WA 1NK0A 2G8IA 2P5GA 5FROA 4FW1A 3QO9A 1EXQA 2LSNA 3NBPA 3H08A 3OY9A 3AA5X 4CIEA 4E89A 1NOYA 3NCIA 3NF7A 1KRPA 3SYZA 1WSHA 4DFJA 4I9LA 3AVLA 5KTQA 3QEIA 2HVHA 4CJUA 3AO3A 4K8ZA 1NJYA 4CF2A 3DRSA 3VQ7A 5HRRA 4KFBA 1CXUA 1C1CA 3O4QA 1TKTA 1ZYQA 1N5YA 3ZT2A 3FFIA 2BDPA 1TAQA 3V9ZA 5C24A 1JLAA 1JLBA 1TKZA 4NYFA 3ZSOA 4OLBA 1TK0A 4B3OA 3WNFA 4OGCA 3RMBA 1N6QA 4KTZA 3VQ6A 2QXFA 3LAKA 3DM2A 3G10A 3VQBA 4CEDA 1C1AA 1WN7A 2KZZA 4NCGA 3LWMA 1TV6A 3LZIA 2FBYA 3DLKA 4BE2A 4FZZA 3OYJA 3HP9A 3HSTB 1B9DA 4JS5A 3NF9A 2GBZA 1WNSA 3NGYA 3QLHA 1RT7A 3QERA 2X74A 2HHQA 2G8VA 4CJ4A 4FJLA 3O3FA 1GOBA 4YNQA 1QHTA 3OYHA 1NJWA 1QS4A 3I0SA 4LH4A 4KHUA 2XO7A 4CK3A 3CQ8A 1Q9YA 4M3UA 5E41A 4LSLA 2DFFA 5KRTA 4KPYA 4C8LA 4DS4A 3MXIA 1QE1A 3TR8A 3TAGA 3SV3A 3K5LA 1WSFA 2OPRA 4FZXC 3C95A 1RNHA 1HYZA 3EZ5A 3BDPA 1WAJA 1SKRA 4H4OA 3RRGA 4KB0A 4QCLA 4DSLA 2IS3A 4CFCA 1LWEA 4BDZA 1VSKA 4F3OA 2GV9A 1LWCA 3MEDA 3VN5A 2P51A 1D9DA 4UQGA 4B9VA 3ZSVA 4TSXA 1BL3A 1FKPA 1UOCA 1VSLA 2JGUA 4DTOA 2I5JA 2Z1JA 1IO2A 3RR8A 1WSGA 3T1AA 4KHYA 3VQQA 1NK5A 1SL1A 4Q0BA 5KRSA 1ZBFA 3L2QA 2XY7A 3ULDA 3HXMA 3AO2A 3HVTA 4DQPA 3SZ2A 3NGZA 3OS1A 4CJSA 3JSMA 1HMVA 1U45A 3DYAA 2PY5A 3AVNA 3RMCA 4KO0A 3OYEA 3L2RA 2RN2A 1LV5A 3HVRA 4KTQA 4B8CA 3ZT0A 1U48A 4DTPA 4W5NA 4DQRA 1J54A 1KVCA 4IBNA 5CZ2A 4Z4IA 2HHTA 1BCMA 3OYMA 5T7BA 4M3YA 5CZ1A 3NF8A 3KLEA 4HCCA 2KFNA 1BI4B 2G8FA 3V81A 3VQAA 3ZSYA 4OPJA 2OYQA 4H4MA 5I42A 1JLEA 1TL1A 1X9SA 4Z4GA 4E7HA 2XY8A 4RW9A 3SUOA 1Q9XA 4LY7A 4E19A 2E6MA 1WSJA 3CFRA 1S1VA 2B4JA 4O5BA 5EU7A 1UA0A 4W5RA 4CHZA 4CJ3A 3KLGA 3F73A 1TKDA 4I2QA 3P83D 3MXJA 1WSIA 1RT1A 4IG3A 2IOCA 4FK0A 5HBMA 1YT3A 3V9WA 1KFSA 3K5MA 4KHWA 1VSJA 3B6PA 3DOLA 4CEAA 4FJNA 1REVA 3ZT3A 1TK5A 4C8KA 1ZBHA 2OPSA 3LPUA 5KI6A 1D5AA 3HT3A 3KK3A 4N5SA 3NE6A 4QOZB 3IRXA 1UA1A 1XC9A 1HYSA 1J53A 4IDKA 3SUNA 1RT2A 4BACA 2FBXA 4CHQA 4CJRA 3PX4A 4DSKA 3CFOA 4AHCA 4J2EA 1LAVA 1C1BA 3OYLA 3L2VA 3HPOA 1CXQA 3T19A 3QIPA 1RDCA 5K14A 1X1PA 1I3AA 4Z4FA 1RBRA 4CGHA 3U3GA 3QINA 1YTAA 1TKXA 2WOMA 1Q8IA 3PX0A 3K5NA 4OLAA 1X9MA 3ZCMA 3AA2A 1RDBA 4CFAA 5I3UA 4DSJA 3DLHA 1RDAA 1KVBA 1CZ9A 3ZSXA 4CJ5A 3NDKA 3VA3A 1SKWA 3AO5A 2BANA 4IKFA 4KRFA 2DFHA 4FJ5A 4PUOA 4GMJB 4DSEA 3CG7A 1S1XA 1IKXA 4KKOA 4GW6A 3OYGA 5CYQA 2RKIA 4DLGA 4CERA 1RT6A 4E3SA 4KREA 1KFDA 4DTSA 1NK8A 4I2PA 3KK1A 3DRPA 4ELUA 5D3GA 2HHSA 3VQ9A 4B08A 2YNFA 1CLQA 3PV8A 4N76A 5SWMA 3TANA 3VQ4A 3KKRA 4CIGA 1L3UA 1F21A 4FJIA 3CM6A 4OKKA 2Q3SA 3DOKA 4FLTA 3F9KA 4B9NA 2IC3A 4Z0UA 2FBTA 2Y1JA 1UWBA 1S5JA 4EZ9A 1BHLA 1QQCA 4CJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HL8 A;  3HM9 A;  4FJ7 A;  2HNY A;  1JL1 A;  1LW2 A;  4DWI A;  2YKM A;  1BIS A;  3KD1 E;  3OYK A;  4CF9 A;  2PZS A;  4KHS A;  1L3S A;  2XY6 A;  1T7P A;  4R5P A;  3S3N A;  3UIQ A;  3OYI A;  3ITH A;  1CZB A;  1BIZ A;  1C6V A;  1ASW A;  1JXB A;  1RTH A;  5C42 A;  5J2M A;  1ZBL A;  1T03 A;  1L5U A;  4FJX A;  1QSS A;  3NHG A;  1HQU A;  3PO4 A;  3AA3 A;  1D9F A;  4FXD A;  4GVM A;  4W5T A;  4DG1 A;  4DFM A;  1XI1 A;  2Z1G A;  2A1R A;  1SKS A;  1B92 A;  1KTQ A;  2ETJ A;  3KKS A;  2EX3 A;  3AVC A;  3O4N A;  4EP5 A;  4FLW A;  4B9M A;  4DF4 A;  2OZM A;  2GUI A;  1FXX A;  5J1E A;  4RW6 A;  4DMN A;  4CGI A;  3K2P A;  2Z1H A;  4CEO A;  3SQ2 A;  1SL0 A;  4FLZ A;  4CHP A;  3CFP A;  3HO1 A;  4CHO A;  2X78 A;  4E1N A;  5HLF A;  4Z4C A;  4PY5 A;  3TAR A;  1VRU A;  1BIU A;  1VRT A;  1Y97 A;  1NK6 A;  1C0U A;  1DTQ A;  1KVA A;  3MAQ A;  2VWJ A;  4KTW A;  2JLE A;  2F96 A;  4E7I A;  4M41 A;  1VSD A;  5FRM A;  3LPT A;  4FLY A;  1QSY A;  3QEX A;  3OYN A;  3OYB A;  4M3X A;  4KHQ A;  4DQS A;  4M3T A;  3LDS A;  3VA0 A;  1S9E A;  1JLC A;  2HND A;  4RW8 A;  3SQ1 A;  3IAY A;  4CES A;  3QEW A;  2HHW A;  4CEB A;  3EYZ A;  4JRQ A;  3TAF A;  4ZHR A;  4HUG A;  1KLN A;  4I9Q A;  1RBS A;  3OYC A;  3EY1 A;  3OYA A;  1ZBU A;  1S1W A;  3LAM A;  3QET A;  1U4B A;  1HQE A;  2RF2 A;  4MQ3 A;  3M8P A;  1S6P A;  1NJZ A;  4F2S A;  3OYD A;  1NKC A;  4FJG A;  3LZJ A;  4DLE A;  3KJV A;  4CHY A;  2G8K A;  4B9S A;  3WNG A;  3WNE A;  4DQQ A;  5DK5 A;  2KZM A;  1TAU A;  1TVR A;  2YNH A;  1IH7 A;  4QAG A;  1RBT A;  4RW7 A;  4MFB A;  4B9T A;  3AVM A;  4O55 A;  4CEE A;  1EET A;  4KI4 A;  3L2U A;  2YHB A;  1BCO A;  1VSF A;  4DFP A;  2Y1I A;  3SUP A;  3SQ0 A;  1NKB A;  2X6S A;  4H8K A;  2KW4 A;  1J9A A;  3HPG A;  1C0M A;  2HHV A;  3ASM A;  3MEE A;  4E7L A;  1VK0 A;  1DTT A;  2G8W A;  3AVH A;  3OVN A;  2G8U A;  3V1R A;  1NJX A;  1RDD A;  3RR7 A;  4CF0 A;  2RPI A;  3LWL A;  4OKE A;  4KI6 A;  4BE1 A;  4CE9 A;  3G0Z A;  4DTJ A;  3V9U A;  4B8A B;  3U6F A;  2ATQ A;  3V1Q A;  4HHT A;  3KTQ A;  4PWD A;  3A2F A;  3K59 A;  2XY5 A;  1S9G A;  3T3F A;  3RMA A;  2Z1I A;  1LWF A;  3TAQ A;  3L3U A;  2OZS A;  4J2A A;  3VQ5 A;  3QES A;  3M8R A;  3IS9 A;  3TAM A;  3KLF A;  3AVJ A;  1MU2 A;  4CFD A;  1HYV A;  1RT4 A;  3MEC A;  3M8S A;  3C6U A;  3PUF A;  2DFE A;  3QEV A;  4OKJ A;  4FJH A;  4W5O A;  2QK9 A;  3RRH A;  2O4G A;  3I0R A;  1JLF A;  3VQC A;  3TAB A;  5HRO A;  4C8O A;  3AVA A;  5HRN A;  4BDP A;  1LW0 A;  3NH2 A;  1NKE A;  4EP4 A;  1RBU A;  3AVK A;  3C94 A;  4Z4H A;  1NK4 A;  1WLJ A;  1XHZ A;  3LP3 A;  1WSE A;  1Z25 A;  1RT3 A;  3NFA A;  4CF8 A;  3THV A;  4AIL C;  1ASV A;  1FK9 A;  3CYM A;  1JLG A;  4CEC A;  3NH0 A;  4DTN A;  5FRN A;  4E7J A;  1L3T A;  4RG8 A;  3L2W A;  4DSF A;  3BGR A;  3HPH A;  4CFB A;  4XIU A;  2D0C A;  3C6T A;  4J2B A;  3ZSQ A;  3OS0 A;  4BE0 A;  4FM1 A;  1G15 A;  1K6Y A;  1FKO A;  4W5Q A;  3KK2 A;  4KAZ A;  4C8M A;  4CJP A;  1YVU A;  5HRP A;  1ITG A;  4Y1C A;  2VWK A;  4IG0 A;  3KD5 E;  5CY4 A;  3SI6 A;  3OJS A;  4BWM A;  4I7F A;  3KLH A;  2E6L A;  2ZE2 A;  1S6Q A;  2VG5 A;  1O1W A;  3HYF A;  3LP1 A;  4CJL A;  3K5O A;  2YKN A;  4FYD A;  1S1T A;  1BQN A;  2IAJ A;  1U47 A;  2HVI A;  4AHR A;  3V9X A;  4C8N A;  4KB1 A;  3ZT4 A;  3TWH A;  4B9L A;  4DTM A;  4AHU A;  1IKW A;  4JLH A;  5JS1 A;  4O44 A;  3K57 A;  3SNN A;  1TGO A;  1U49 A;  3HP6 A;  4FJM A;  3HJF A;  3L8B A;  3S3M A;  2KTQ A;  2YV0 X;  4G1Q A;  3LAL A;  3DMJ A;  2HMI A;  1RIL A;  4FLU A;  3HK2 A;  2O4I A;  4AHV A;  1JLQ A;  3ZSZ A;  4ELT A;  5J2N A;  4FK4 A;  4AHS A;  2DY4 A;  3O3H A;  4F8R A;  3PX6 A;  1A5W A;  4FJ8 A;  5JS2 A;  1HPZ A;  3E01 A;  3PO5 A;  1I39 A;  2WON A;  4FK2 A;  3VQ8 A;  1RT5 A;  4OVL A;  3K58 A;  5CYM A;  4ZTJ A;  3V9S A;  4CF1 A;  1EX4 A;  2A1S A;  1JKH A;  3JYT A;  3S9H A;  1IG9 A;  3D0P A;  3QIO A;  1VSE A;  4PQU A;  5HRS A;  4O4G A;  3SUQ A;  1SV5 A;  2YNG A;  4M45 A;  2FBV A;  4LH5 A;  4CIF A;  4K8X A;  4F4K A;  3M8Q A;  4CEF A;  2HW3 A;  2P1J A;  3AVI A;  4DF8 A;  1C0T A;  1HRH A;  2HB5 A;  2ZD1 A;  4OJR A;  4CGF A;  3MEG A;  4CJQ A;  5KGX A;  1RTJ A;  2IDO A;  4CHN A;  1IKY A;  4BWJ A;  1VSI A;  5J2P A;  3P1G A;  4EZ6 A;  2B6A A;  1EKE A;  3DRR A;  4ID5 A;  4L8R B;  4HUF A;  3QEP A;  1NK7 A;  4CJF A;  3AVF A;  4NCA A;  4M42 A;  4LD0 A;  4N56 A;  3O3G A;  4KHN A;  4FCY A;  2VG7 A;  4O0J A;  5DMR A;  4YFU A;  4F2R A;  4OPK A;  3IG1 A;  3MXM A;  3RWU A;  2F8T A;  3L3V A;  4NCB A;  2YHA A;  1A5X A;  2FC0 A;  4M3W A;  1T8E A;  4CK2 A;  4DU1 A;  4HVJ A;  3SQ4 A;  3KLI A;  1W0H A;  1XWL A;  5KGW A;  2QKB A;  1SUQ A;  2B5J A;  4DU3 A;  3TAP A;  3AO4 A;  3ZSR A;  3V4I A;  3AVB A;  1QSL A;  4B9U A;  4E1M A;  4KV8 A;  1T05 A;  4HCB A;  3ALY A;  1JL2 A;  4CJW A;  3DLB A;  4CEZ A;  4Z4E A;  1HJR A;  1KCF A;  2NUB A;  3OJU A;  1BGX T;  3QNO A;  2XHB A;  1QTM A;  2AJQ A;  4IFV A;  1LAW A;  2F8S A;  4FZY A;  3NH1 A;  4JS4 A;  3SV4 A;  4CJV A;  1L3V A;  2KQ2 A;  1GOA A;  1RCH A;  1TL3 A;  3NF6 A;  2BE2 A;  2IGI A;  4FW2 A;  2W42 A;  1WAF A;  3VQE A;  1NK9 A;  1KLM A;  2YNI A;  4RW4 A;  4DTX A;  4FM2 A;  3DI6 A;  1BQM A;  2D5R A;  1VSM A;  3VQD A;  4CGJ A;  3NAE A;  4CGG A;  1D8Y A;  3V6D A;  2XRI A;  4N41 A;  3ZT1 A;  2EHG A;  3RTV A;  3SPY A;  3B6O A;  4FJK A;  3AVG A;  3AO1 A;  4O0I A;  3AA4 A;  1DLO A;  5J2Q A;  3OYF A;  3TAE A;  1TK8 A;  1J5O A;  5C25 A;  4OGE A;  2OPP A;  3PY8 A;  3AV9 A;  4DSI A;  4ZTF A;  4BDY A;  4HTU A;  1W9H A;  4CK1 A;  4J2D A;  3S3O A;  1ZBI A;  4ID1 A;  4WE1 A;  2DTU A;  3ZSW A;  4DQI A;  4FJJ A;  1HNI A;  4F3T A;  3WNH A;  3LP2 A;  4DTU A;  4CCH A;  4AH9 A;  1RBV A;  1R0A A;  4FJ9 A;  3V1O A;  2X6N A;  1RTI A;  4DS5 A;  3DLR A;  3DLG A;  2E4L A;  1GOC A;  2PYJ A;  4PA1 A;  4FM0 A;  3I8D A;  4AHT A;  4DFK A;  1B9F A;  1XHX A;  1JXE A;  2G8H A;  1S1U A;  4CEQ A;  2QKK A;  1Z26 A;  3KIO A;  4CJK A;  1U04 A;  1RTD A;  4JRP A;  4CJE A;  2ZQB A;  4E7K A;  2P5O A;  1UAX A;  2BGG A;  3DLE A;  4IFY A;  4DU4 A;  5HP1 A;  4Y1D A;  4Q5V A;  2D0B A;  3P5J A;  4FLV A;  1HNV A;  3D45 A;  3ISN C;  1VSH A;  4M3R A;  5FDL A;  2D0A A;  4FLX A;  1NOZ A;  4ICL A;  3NGI A;  1SL2 A;  2HNZ A;  3VQP A;  3SJJ A;  2OA8 A;  2PYL A;  3LP0 A;  5SZT A;  4LSN A;  1BI4 A;  4CGD A;  3SCX A;  1KSP A;  4DTR A;  1IKV A;  1EP4 A;  4ELV A;  4E0D A;  3SPZ A;  3CM5 A;  2OPQ A;  4NYN A;  3OS2 A;  2ITG A;  2VG6 A;  1ASU A;  3LAN A;  3RMD A;  3U3Y A;  4M3Z A;  2KFZ A;  1A5V A;  4HUE A;  2R7Y A;  1YTU A;  2HHU A;  4FVM A;  2HHX A;  3QNN A;  3TI0 A;  4N47 A;  1X9W A;  1NK0 A;  2G8I A;  2P5G A;  5FRO A;  4FW1 A;  3QO9 A;  1EXQ A;  2LSN A;  3NBP A;  3H08 A;  3OY9 A;  3AA5 X;  4CIE A;  4E89 A;  1NOY A;  3NCI A;  3NF7 A;  1KRP A;  3SYZ A;  1WSH A;  4DFJ A;  4I9L A;  3AVL A;  5KTQ A;  3QEI A;  2HVH A;  4CJU A;  3AO3 A;  4K8Z A;  1NJY A;  4CF2 A;  3DRS A;  3VQ7 A;  5HRR A;  4KFB A;  1CXU A;  1C1C A;  3O4Q A;  1TKT A;  1ZYQ A;  1N5Y A;  3ZT2 A;  3FFI A;  2BDP A;  1TAQ A;  3V9Z A;  5C24 A;  1JLA A;  1JLB A;  1TKZ A;  4NYF A;  3ZSO A;  4OLB A;  1TK0 A;  4B3O A;  3WNF A;  4OGC A;  3RMB A;  1N6Q A;  4KTZ A;  3VQ6 A;  2QXF A;  3LAK A;  3DM2 A;  3G10 A;  3VQB A;  4CED A;  1C1A A;  1WN7 A;  2KZZ A;  4NCG A;  3LWM A;  1TV6 A;  3LZI A;  2FBY A;  3DLK A;  4BE2 A;  4FZZ A;  3OYJ A;  3HP9 A;  3HST B;  1B9D A;  4JS5 A;  3NF9 A;  2GBZ A;  1WNS A;  3NGY A;  3QLH A;  1RT7 A;  3QER A;  2X74 A;  2HHQ A;  2G8V A;  4CJ4 A;  4FJL A;  3O3F A;  1GOB A;  4YNQ A;  1QHT A;  3OYH A;  1NJW A;  1QS4 A;  3I0S A;  4LH4 A;  4KHU A;  2XO7 A;  4CK3 A;  3CQ8 A;  1Q9Y A;  4M3U A;  5E41 A;  4LSL A;  2DFF A;  5KRT A;  4KPY A;  4C8L A;  4DS4 A;  3MXI A;  1QE1 A;  3TR8 A;  3TAG A;  3SV3 A;  3K5L A;  1WSF A;  2OPR A;  4FZX C;  3C95 A;  1RNH A;  1HYZ A;  3EZ5 A;  3BDP A;  1WAJ A;  1SKR A;  4H4O A;  3RRG A;  4KB0 A;  4QCL A;  4DSL A;  2IS3 A;  4CFC A;  1LWE A;  4BDZ A;  1VSK A;  4F3O A;  2GV9 A;  1LWC A;  3MED A;  3VN5 A;  2P51 A;  1D9D A;  4UQG A;  4B9V A;  3ZSV A;  4TSX A;  1BL3 A;  1FKP A;  1UOC A;  1VSL A;  2JGU A;  4DTO A;  2I5J A;  2Z1J A;  1IO2 A;  3RR8 A;  1WSG A;  3T1A A;  4KHY A;  3VQQ A;  1NK5 A;  1SL1 A;  4Q0B A;  5KRS A;  1ZBF A;  3L2Q A;  2XY7 A;  3ULD A;  3HXM A;  3AO2 A;  3HVT A;  4DQP A;  3SZ2 A;  3NGZ A;  3OS1 A;  4CJS A;  3JSM A;  1HMV A;  1U45 A;  3DYA A;  2PY5 A;  3AVN A;  3RMC A;  4KO0 A;  3OYE A;  3L2R A;  2RN2 A;  1LV5 A;  3HVR A;  4KTQ A;  4B8C A;  3ZT0 A;  1U48 A;  4DTP A;  4W5N A;  4DQR A;  1J54 A;  1KVC A;  4IBN A;  5CZ2 A;  4Z4I A;  2HHT A;  1BCM A;  3OYM A;  5T7B A;  4M3Y A;  5CZ1 A;  3NF8 A;  3KLE A;  4HCC A;  2KFN A;  1BI4 B;  2G8F A;  3V81 A;  3VQA A;  3ZSY A;  4OPJ A;  2OYQ A;  4H4M A;  5I42 A;  1JLE A;  1TL1 A;  1X9S A;  4Z4G A;  4E7H A;  2XY8 A;  4RW9 A;  3SUO A;  1Q9X A;  4LY7 A;  4E19 A;  2E6M A;  1WSJ A;  3CFR A;  1S1V A;  2B4J A;  4O5B A;  5EU7 A;  1UA0 A;  4W5R A;  4CHZ A;  4CJ3 A;  3KLG A;  3F73 A;  1TKD A;  4I2Q A;  3P83 D;  3MXJ A;  1WSI A;  1RT1 A;  4IG3 A;  2IOC A;  4FK0 A;  5HBM A;  1YT3 A;  3V9W A;  1KFS A;  3K5M A;  4KHW A;  1VSJ A;  3B6P A;  3DOL A;  4CEA A;  4FJN A;  1REV A;  3ZT3 A;  1TK5 A;  4C8K A;  1ZBH A;  2OPS A;  3LPU A;  5KI6 A;  1D5A A;  3HT3 A;  3KK3 A;  4N5S A;  3NE6 A;  4QOZ B;  3IRX A;  1UA1 A;  1XC9 A;  1HYS A;  1J53 A;  4IDK A;  3SUN A;  1RT2 A;  4BAC A;  2FBX A;  4CHQ A;  4CJR A;  3PX4 A;  4DSK A;  3CFO A;  4AHC A;  4J2E A;  1LAV A;  1C1B A;  3OYL A;  3L2V A;  3HPO A;  1CXQ A;  3T19 A;  3QIP A;  1RDC A;  5K14 A;  1X1P A;  1I3A A;  4Z4F A;  1RBR A;  4CGH A;  3U3G A;  3QIN A;  1YTA A;  1TKX A;  2WOM A;  1Q8I A;  3PX0 A;  3K5N A;  4OLA A;  1X9M A;  3ZCM A;  3AA2 A;  1RDB A;  4CFA A;  5I3U A;  4DSJ A;  3DLH A;  1RDA A;  1KVB A;  1CZ9 A;  3ZSX A;  4CJ5 A;  3NDK A;  3VA3 A;  1SKW A;  3AO5 A;  2BAN A;  4IKF A;  4KRF A;  2DFH A;  4FJ5 A;  4PUO A;  4GMJ B;  4DSE A;  3CG7 A;  1S1X A;  1IKX A;  4KKO A;  4GW6 A;  3OYG A;  5CYQ A;  2RKI A;  4DLG A;  4CER A;  1RT6 A;  4E3S A;  4KRE A;  1KFD A;  4DTS A;  1NK8 A;  4I2P A;  3KK1 A;  3DRP A;  4ELU A;  5D3G A;  2HHS A;  3VQ9 A;  4B08 A;  2YNF A;  1CLQ A;  3PV8 A;  4N76 A;  5SWM A;  3TAN A;  3VQ4 A;  3KKR A;  4CIG A;  1L3U A;  1F21 A;  4FJI A;  3CM6 A;  4OKK A;  2Q3S A;  3DOK A;  4FLT A;  3F9K A;  4B9N A;  2IC3 A;  4Z0U A;  2FBT A;  2Y1J A;  1UWB A;  1S5J A;  4EZ9 A;  1BHL A;  1QQC A;  4CJT A; 
#chains in the Genus database with same CATH topology
 4A59 A;  3HM9 A;  3WQU A;  4B3S K;  4FJ7 A;  2Q97 A;  4XH4 A;  1BIS A;  4NXN K;  3SAG A;  1O13 A;  1L3S A;  3OYI A;  4CZH A;  1BIZ A;  1VQN N;  1ZBL A;  1L5U A;  4IOX A;  3NHG A;  3AA3 A;  2QA4 N;  4BRH A;  2Q2R A;  3ATU A;  4DG1 A;  1KD1 O;  2IVP A;  1WOQ A;  1KTQ A;  2ETJ A;  3O4N A;  3C7N B;  5BRH A;  2A6A A;  1E4G T;  4DMN A;  4JYA K;  2HF4 A;  3K2P A;  3IUC A;  2Z1H A;  3O9R A;  3SLC A;  3SQ2 A;  3BUZ B;  3CFP A;  4CHO A;  4Z4C A;  3MN6 A;  4BC3 A;  5BN8 A;  2JLE A;  1VSD A;  5FRM A;  4PKH A;  3LPT A;  4BRQ A;  3ID8 A;  4KHQ A;  3FZF A;  4M3T A;  3LDS A;  3CPW M;  3T1Y K;  4RW8 A;  3QEW A;  1VQ4 N;  2P9N A;  5H1S Q;  3EY1 A;  3CCV N;  3LAM A;  2VQE K;  3QET A;  1U4B A;  1YJW N;  1NJZ A;  1NKC A;  4RTF D;  4CHY A;  2G8K A;  3WNG A;  1TAU A;  5DK5 A;  4JI6 K;  1IH7 A;  4MFB A;  4O55 A;  2UYT A;  4CEE A;  3L2U A;  3SMS A;  2QWN A;  1C0M A;  2HST A;  1VK0 A;  3AVH A;  4FWR A;  4WQ4 A;  1MA9 B;  2RPI A;  4CE9 A;  3IFR A;  4DTJ A;  3U6F A;  3KTQ A;  3V1Q A;  4BVO A;  1S9G A;  5BRE A;  3T3F A;  2BH1 A;  3L3U A;  3QES A;  4Y0W A;  1HYV A;  5FPD A;  3MEC A;  4MDA A;  3QEV A;  2O4G A;  2A42 A;  3TAB A;  5HRO A;  4C8O A;  3AVA A;  1GLB G;  5HRN A;  3TTF A;  3C94 A;  1NK4 A;  4BRP A;  5FRN A;  1FK9 A;  4DTN A;  1JLG A;  5M1P A;  4LC9 B;  2D0C A;  3ZSQ A;  2GEL A;  4FM1 A;  1VQK N;  4KHP K;  1FKO A;  3KK2 A;  4C8M A;  1KAY A;  1XMO K;  3PIO L;  3SI6 A;  3P4I A;  3CMA N;  1NM1 A;  4LF7 K;  1O1W A;  4FYD A;  1BQN A;  2WUS A;  4AHR A;  5GAD P;  4KB1 A;  4CZF A;  4BR0 A;  3TWH A;  4DTM A;  1IKW A;  3G6E N;  4RCH A;  1NGH A;  3S3M A;  4CBW A;  4G1Q A;  4FLU A;  3HK2 A;  2O8D A;  4A57 A;  1JLQ A;  3ZSZ A;  3CJ7 A;  1HNW K;  3R1X A;  3ULE A;  2CGK A;  4CZE A;  3VQ8 A;  3HTV A;  2V7Z A;  2UXD K;  1EX4 A;  3S9H A;  3JYT A;  4DV1 K;  1IG9 A;  5HRS A;  4FWM A;  2ZJP L;  4YDU C;  2P1J A;  1K73 O;  3WEE A;  3T7Z A;  1GLJ O;  1C0T A;  4BG8 A;  1OVY A;  4BR7 A;  2Q0R A;  1RTJ A;  2YHW A;  1VSI A;  2A40 A;  2B6A A;  1EKE A;  4ID5 A;  3QEP A;  3UKR B;  4BC4 A;  3BF1 A;  4XH5 A;  5AQN A;  4M42 A;  4JKA A;  1SAZ A;  2VG7 A;  5DMR A;  4JD2 A;  5AQL A;  3ENB A;  3M6G A;  5AQO A;  3MXM A;  4NCB A;  1T6C A;  3KWG A;  3SQ4 A;  3KLI A;  2QKB A;  2B5J A;  4DU3 A;  4IOA L;  3AO4 A;  3ZSR A;  2P9S B;  4CZI A;  2XHB A;  2OAN A;  4IFV A;  3MMV A;  2F8S A;  4O8K A;  3LDO A;  5BPM A;  4JS4 A;  3SV4 A;  5AFU H;  2QM1 A;  2V51 B;  4DV7 K;  1RCH A;  2D5R A;  3THY B;  5C0Y A;  4EHT A;  4FJK A;  3VER A;  3AVG A;  1DLO A;  1YIT N;  4DV5 K;  2D0P A;  4DR7 K;  2OPP A;  3AV9 A;  4DSI A;  4QS8 A;  5GAE P;  3B8A X;  3SK3 A;  5AQX A;  3LP2 A;  4V19 S;  1RBV A;  2X6N A;  1RTI A;  3LL3 A;  5GAH P;  2YCH A;  3JS6 A;  4BRE A;  4AHT A;  1B9F A;  2G8H A;  1JXE A;  5KPR A;  4K43 A;  2QKK A;  3KIO A;  4E7K A;  4IFY A;  3U9Z A;  2D0B A;  4A61 A;  3P5J A;  1HNV A;  3D45 A;  2O8C A;  3ISN C;  3O8M A;  1NOZ A;  3NGI A;  3VQP A;  3SJJ A;  2OA8 A;  5SZT A;  4JV5 K;  3I56 N;  4ISE A;  4CGD A;  3SCX A;  1HKG A;  2ITG A;  3MWT A;  2VG6 A;  3BZK A;  3K9J A;  4A62 A;  4HUE A;  4FVM A;  3QNN A;  3D2E B;  4U67 L;  2P5G A;  5FRO A;  1EXQ A;  1XNR K;  3AA5 X;  4CIE A;  1NOY A;  3NF7 A;  1S22 A;  4AM6 A;  4DFJ A;  5KTQ A;  2Q31 A;  4CJU A;  4K8Z A;  3DWL A;  4FWO A;  1C1C A;  3O4Q A;  1TKT A;  4JI0 K;  3ZT2 A;  3DXM A;  2BDP A;  1TAQ A;  1JLA A;  1JLB A;  3DLL L;  4EHU A;  4KTZ A;  2QXF A;  1G99 A;  3CF5 L;  1C1A A;  1IBL K;  4QS7 A;  4FZZ A;  3C6H A;  4GKJ K;  3OYJ A;  2VGN A;  4JS5 A;  1MDU B;  5M1N A;  2O8F B;  4B1V A;  3SAF A;  2HF3 A;  3OYH A;  5CR4 A;  1TUY A;  3WXL A;  3I0S A;  5AQU A;  2XO7 A;  3MDQ A;  1Q9Y A;  5E41 A;  2DFF A;  2V52 B;  3CI5 A;  4C8L A;  4EAH D;  2OPR A;  1QZ6 A;  1HYZ A;  2E1Z A;  3C65 A;  1WAJ A;  4WQ5 A;  3ZEU A;  1LWE A;  5EXW A;  4BQZ A;  4EFH A;  3VN5 A;  2ASP A;  2ZWH A;  3ZSV A;  3EO3 A;  4R79 A;  1W97 L;  5BPN A;  4DTO A;  2Z1J A;  1IO2 A;  1TYQ B;  4WFN L;  1Y64 A;  3L2Q A;  3ULD A;  3HXM A;  1T44 A;  3AO2 A;  2ZF5 O;  3JSM A;  1U45 A;  5AQT A;  2PY5 A;  2WC9 A;  3RMC A;  3VTH A;  3OYE A;  2O8B A;  4BY9 C;  1U48 A;  1NGC A;  4BGB A;  4DTP A;  1BCM A;  3OYM A;  3NF8 A;  5HOO A;  3V81 A;  3VQA A;  4DR2 K;  3C7N A;  1FW6 A;  3KZB A;  5AQZ A;  5I42 A;  2XY8 A;  4RW9 A;  1P90 A;  4GV6 A;  3LDP A;  3MCP A;  1YI2 N;  1WSJ A;  3CFR A;  1NGF A;  4CJ3 A;  1TKD A;  3CJB A;  4MDB A;  2IOC A;  3W3D A;  5BR9 A;  4YHH K;  3V9W A;  4KHW A;  3K5M A;  1VSJ A;  5DM7 L;  3DOL A;  4CEA A;  4MLE A;  1D5A A;  1HYS A;  3NE6 A;  3M5R A;  2O8E B;  3J7Y P;  4J2E A;  3OYL A;  2VQF K;  3N4P A;  4FVU A;  1I3A A;  4IWV A;  3U3G A;  5AZJ B;  3QIN A;  1TKX A;  1RFQ A;  2F7T A;  2WOM A;  4WCE L;  3G4S N;  4FOI A;  1RDB A;  4CFA A;  5I3U A;  3TSU A;  3ZSX A;  1CZ9 A;  1SKW A;  3H6E A;  3L0Q A;  4FJ5 A;  4DSE A;  3ZX0 A;  2VGM A;  4KKO A;  4GW6 A;  5LL6 Z;  1U2V B;  5CYQ A;  2RKI A;  2UUC K;  4CER A;  1N33 K;  4ELU A;  5AQJ A;  3I33 A;  1CLQ A;  3OBY A;  5BN9 A;  3KKR A;  3T1H K;  1F21 A;  4FJI A;  2ZGZ A;  3CM6 A;  3DOK A;  4FLT A;  3F9K A;  1VQM N;  4EZ9 A;  5M1O A;  1HQE A;  4CEC A;  4DQ8 A;  1VQ6 N;  1P8Z A;  3HL8 A;  2YKM A;  3KD1 E;  2PZS A;  2QWR A;  3MN7 A;  4ISG A;  2XY6 A;  1T7P A;  3UIQ A;  3ITH A;  1CZB A;  1RTH A;  2P9I B;  1T03 A;  1HQU A;  4FXD A;  4GVM A;  4W5T A;  5AQR A;  5AJ3 K;  1SKS A;  1B92 A;  2KLA A;  4M7X A;  2FSJ A;  3AVC A;  4EP5 A;  4FLW A;  4JHD A;  4H5W A;  1FXX A;  4KH6 A;  3VEX A;  4CEO A;  1SL0 A;  4FLZ A;  1JJ2 M;  4CHP A;  2X78 A;  3TTC A;  1BIU A;  1Y97 A;  1C0U A;  1KVA A;  2VWJ A;  4K25 A;  2F96 A;  2NRV A;  2QXL A;  3E1Y A;  3OYB A;  3QEX A;  4I6M B;  3WT0 A;  1S9E A;  2FXU A;  2A5X A;  3J8A A;  4HUG A;  4XH1 A;  1KLN A;  4JKG B;  4I9Q A;  3THX B;  4CZG A;  3M8P A;  1GLL O;  1S6P A;  3WXK A;  4F2S A;  1ATR A;  1SQK A;  4QAG A;  4DUZ K;  1RBT A;  4B9T A;  5LMN K;  4AQY K;  2Y1I A;  1VSF A;  4EIA A;  2VCP A;  4H8K A;  2KW4 A;  1J9A A;  2F9T A;  2HHV A;  3ASM A;  3MEE A;  4CW7 B;  4E7L A;  1DTT A;  2G8W A;  2E8A A;  4C1N I;  3OVN A;  4GY2 B;  1RDD A;  1NG9 A;  1ZBS A;  1RGI A;  3G0Z A;  5JVH L;  3V9U A;  3CXC M;  2ATQ A;  4GV9 A;  4WQ5 C;  3K59 A;  2XY5 A;  1LWF A;  3TAQ A;  4JKC A;  3VQ5 A;  3M8R A;  3L4I A;  4PKG A;  2YJF A;  3TAM A;  3ATV A;  3AVJ A;  4CFD A;  1WBD A;  5IWA K;  1RT4 A;  4JI3 K;  3PUF A;  1XNQ K;  1RDU A;  4FJH A;  1NGB A;  4W5O A;  1JLF A;  1KAX A;  2WTU A;  1LW0 A;  1NKE A;  2NZT A;  4EP4 A;  4Z4H A;  3AVK A;  2P9U A;  3SAH A;  4A5B A;  1RT3 A;  3NFA A;  4CF8 A;  3H45 C;  3D2F B;  4AIL C;  3CYM A;  1NGI A;  3NH0 A;  1L3T A;  3L2W A;  2E5L K;  4XIU A;  1K6Y A;  4KBO A;  3SJH A;  5HRP A;  1LOT B;  5CY4 A;  3VEO A;  4BWM A;  5GIN A;  2ZE2 A;  1K8A O;  2VG5 A;  3K5O A;  2YKN A;  4AF1 A;  2IAJ A;  1U47 A;  2ASO A;  3ZT4 A;  1NMN A;  5JS1 A;  3IKM A;  3SNN A;  3HJF A;  4FL9 A;  2RE2 A;  2CGJ A;  3LAL A;  5KQ8 A;  1RIL A;  4AHV A;  1YUW A;  4H5N A;  4AHS A;  4J8F A;  4JNE A;  3E01 A;  4GNI A;  2WON A;  4ILJ A;  4OVL A;  5CYM A;  2YX6 A;  3NVM A;  2A1S A;  1JKH A;  1QVF M;  5C12 A;  4Z94 A;  3QIO A;  1IV0 A;  1ILY A;  2P9K B;  3SUQ A;  3CQX A;  4F4K A;  4CEF A;  3AVI A;  5GAG P;  2E2Q A;  4BRG A;  2V7Y A;  5J2P A;  3EE8 A;  4HUF A;  1NK7 A;  3HRG A;  4CJF A;  3AVF A;  3BF3 A;  4NCA A;  4B3T K;  4O0J A;  4YFU A;  3A5N C;  3O6W A;  4F2R A;  3IG1 A;  4DUY K;  3PSF A;  2F8T A;  3OBW A;  1A5X A;  2FC0 A;  1T8E A;  4CK2 A;  1XWL A;  5KGW A;  4IO8 A;  1N32 K;  3A8Y A;  4HCB A;  1XC3 A;  4CEZ A;  3E66 A;  4NLB A;  5AQM A;  1HJR A;  3OW2 M;  3OA9 A;  2NRR A;  2NUB A;  1BGX T;  1NGJ A;  5M1Q A;  1QTM A;  4JI5 K;  4FZY A;  3LM2 A;  1GOA A;  5EVZ A;  2HBJ A;  4PL7 A;  4DV6 K;  4IJN A;  1NK9 A;  4RW4 A;  2UXB K;  2OTJ N;  3DI6 A;  1BQM A;  3A0I X;  4O5F A;  2CGL A;  2YHX A;  2AA4 A;  1ZXO A;  3NAE A;  1D8Y A;  2XRI A;  3ZT1 A;  4IO9 L;  3RTV A;  3SPY A;  4X64 K;  1NJI O;  3OYF A;  2ITM A;  4OGE A;  4B3M K;  4ZTF A;  2IVO A;  4ID1 A;  2ZGY A;  4H0P A;  2NRT A;  3WNH A;  3OTO K;  4CCH A;  4AM7 A;  1R0A A;  5AQI A;  4DS5 A;  4OX9 K;  3DLR A;  1TYQ A;  2E4L A;  4B3R K;  3MX5 A;  4IFE A;  4PA1 A;  4CZL A;  2J4R A;  4FM0 A;  5LJV A;  4DFK A;  3FZM A;  1XUP O;  2I7N A;  1S1U A;  3CC4 N;  2P5O A;  4CJE A;  2YJE A;  3AGK A;  5KPZ A;  1UAX A;  2GEM A;  3DLE A;  3KHY A;  4LF8 K;  1E3M A;  3CJA A;  2D0A A;  3QIC A;  4FLX A;  2PYL A;  3LP0 A;  4LSN A;  1NGD A;  4DTR A;  1IKV A;  1EP4 A;  1VAZ A;  1YVN A;  3CM5 A;  5MLC Q;  3AAQ A;  2KFZ A;  1GLF O;  1K8K B;  5AZI B;  1VQL N;  2HHX A;  3AY9 A;  1KQS M;  1V4T A;  4K42 A;  3FZK A;  4BRD A;  4LF6 K;  4BC2 A;  3NBP A;  3O5B A;  3H08 A;  4OO1 J;  3NCI A;  3TTD A;  3AVL A;  5FPE A;  1NJY A;  3DRS A;  4KFB A;  3UKU B;  1N5Y A;  2QWM A;  1VQ8 N;  3J80 O;  3V9Z A;  4NYF A;  4OLB A;  1HUX A;  4FWK A;  4NO7 A;  5M1F A;  1TK0 A;  3VQ6 A;  3LAK A;  3NMU A;  1NWK A;  4NCG A;  1TV6 A;  4BE2 A;  4LF9 K;  1RT7 A;  2NLX A;  5TKW A;  5LJW A;  3QER A;  2G8V A;  2OTL N;  4FJL A;  3O3F A;  3CPE A;  3FZL A;  4LH4 A;  3CQ8 A;  2PFU A;  4DHY A;  4KPY A;  4LSL A;  2WFB A;  3CJ1 A;  4DS4 A;  3TR8 A;  3TAG A;  3K5L A;  1WSF A;  4FZX C;  1RNH A;  3EZ5 A;  5AFU A;  4JK7 A;  2UXC K;  4DSL A;  2IS3 A;  2GV9 A;  3CCR N;  1LWC A;  3QDK A;  3ZET B;  1VSL A;  2HMP A;  3O4W A;  1SL1 A;  3MN9 A;  1KC8 O;  5KRS A;  3HVT A;  3HBT A;  3OS1 A;  3CJ9 A;  4ISF A;  4CZJ A;  4B1U B;  1RDW X;  2P9I A;  4KTQ A;  1HLU A;  4B8C A;  4IDH A;  1I94 K;  1GLC G;  1J54 A;  5T7B A;  1IBM K;  3KLE A;  1BI4 B;  4HTL A;  3R6M A;  4FOE A;  3ZSY A;  1BDG A;  2VWB A;  1TL1 A;  4Z4G A;  1Q9X A;  5AQF A;  4LY7 A;  3A5L C;  1HKC A;  1R59 O;  2E6M A;  4JAX A;  4C1N K;  4NB4 A;  4LF4 K;  1UA0 A;  4A2B A;  3DXK B;  1GLA G;  3KLG A;  3F73 A;  1WB9 A;  3MXJ A;  4BRM A;  4FK0 A;  2HBK A;  3B6P A;  1REV A;  1TK5 A;  4C8K A;  4I6M A;  2OPS A;  3LPU A;  5KI6 A;  3KK3 A;  4QOZ B;  1XC9 A;  4G9Z A;  1J53 A;  3SUN A;  2FBX A;  5BPL A;  4CHQ A;  5C2F A;  4JKG A;  1LAV A;  2HBL A;  3HPO A;  3EE9 A;  3T19 A;  4IZ9 A;  4CGH A;  4H0X B;  1Q8I A;  4OLA A;  3K5N A;  1X9M A;  3ZCM A;  4H5V A;  4IKF A;  1ZC6 A;  2DFH A;  4OPA A;  4PUO A;  3CG7 A;  4JI8 K;  3JAM O;  3VGM A;  2FF6 A;  3OYG A;  4WQ4 C;  3DRP A;  2HOE A;  4A2A A;  5BR8 K;  2YNF A;  3E9P A;  1L3U A;  3CHW A;  4OKK A;  2Q3S A;  4X62 K;  4B9N A;  1NGG A;  1QQC A;  4CJT A;  4B1Z A;  2KHO A;  4DWI A;  4CF9 A;  2KKZ A;  1QHA A;  1J6Z A;  4FJX A;  1ASW A;  1JXB A;  2JWK A;  3UE5 A;  5C42 A;  5J2M A;  1QSS A;  3P39 A;  3PO4 A;  3KK7 A;  1M90 O;  3D2F A;  2NRX A;  3N4Q A;  3CCJ N;  1XI1 A;  3L6Q A;  2A1R A;  5LY3 A;  2ZM6 K;  1Q86 O;  4B9M A;  4IEI A;  2OZM A;  2GUI A;  3GBT A;  4RW6 A;  4BRI A;  4LFA K;  3HO1 A;  3CCS N;  4FPB A;  4PY5 A;  1DTQ A;  3MAQ A;  3CD6 N;  4FSV A;  4M41 A;  1MWK A;  3LDN A;  3HI0 A;  4HWI A;  2CH6 A;  3OYN A;  2NRH A;  3QFU A;  2BTF A;  4M3X A;  4DR3 K;  4FWN A;  4H0Y B;  3VA0 A;  2HHW A;  2NRW A;  2HBM A;  4WF9 L;  2QEX N;  4CEB A;  4JRQ A;  1Z05 A;  3TAF A;  1BO5 O;  5FPN A;  3OYC A;  2P9K A;  3OYD A;  3LZJ A;  3S41 A;  2E2P A;  4DQQ A;  2KZM A;  2FLO A;  1TVR A;  1QQM A;  2YNH A;  3W0L A;  5F1X A;  4K41 A;  3AVM A;  1EET A;  4NXM K;  3T69 A;  4KI4 A;  2YHB A;  3VEW A;  3SUP A;  3SQ0 A;  2QWP A;  3HPG A;  3D7E O;  2G8U A;  1N36 K;  3V1R A;  1NJX A;  3RR7 A;  4CF0 A;  4JN4 A;  5AQQ A;  4H0V B;  4OKE A;  4KI6 A;  4BE1 A;  1BUP A;  4HHT A;  3H1V X;  4PWD A;  5AQS A;  3RMA A;  3EL2 A;  3KVG A;  2Z1I A;  2OZS A;  3IS9 A;  3AGR A;  3RVC A;  3KLF A;  1FJG K;  1MU2 A;  5EX5 A;  1W7A A;  3PIP L;  4BRL A;  1NMD A;  5KQD A;  2QK9 A;  3I0R A;  3VQC A;  4BDP A;  3ID6 A;  3NH2 A;  1XHZ A;  1WSE A;  4FWS A;  1Z25 A;  3ULE B;  3CJC A;  1ASV A;  1J5E K;  4JKF A;  1TUU A;  4M7Y A;  4J2B A;  1G15 A;  4CD1 A;  4W5Q A;  4DV3 K;  4KAZ A;  4CZM A;  1ITG A;  4Y1C A;  2VWK A;  1OH8 A;  3OJS A;  1VQ9 N;  3KLH A;  4I7F A;  2E6L A;  1S6Q A;  1HPM A;  3E9L A;  4CJL A;  1S1T A;  3IDH A;  3V9X A;  4U7B A;  4BRO A;  1JCE A;  4JLH A;  5I9E B;  4DR4 K;  1TGO A;  1U49 A;  3HP6 A;  4FJM A;  2KTQ A;  3O9Q A;  3SBT A;  3HOS A;  2YV0 X;  3GG4 A;  2O4I A;  4ELT A;  5J2N A;  4FK4 A;  4BRA A;  2DY4 A;  3O3H A;  4H5T A;  5JS2 A;  2Q0U A;  3PO5 A;  4FK2 A;  1Q7Y O;  3VET A;  3V9S A;  3GDQ A;  3D0P A;  1VSE A;  4ILH A;  1SV5 A;  4CIF A;  1T6D A;  3O9T A;  5AZI A;  4DF8 A;  2ZD1 A;  2D4W A;  2HB5 A;  3SYZ A;  3F9M A;  3MEG A;  5KGX A;  2IDO A;  1EWR A;  4H03 B;  3I8B A;  4CHN A;  1IKY A;  3P1G A;  3HSC A;  4GKK K;  1WUA A;  3DRR A;  4L8R B;  1Q18 A;  4KHN A;  1GLE G;  4LF5 K;  1N34 K;  3H1Q A;  3UKU A;  4DR5 K;  2YHA A;  1HX1 A;  4M3W A;  4DU1 A;  4HVJ A;  3BY5 A;  1W0H A;  1OVQ A;  1SUQ A;  1QSL A;  3V4I A;  3AVB A;  2YHY A;  3U8X A;  4B9U A;  4KV8 A;  1T05 A;  3ALY A;  3DLB A;  1KCF A;  3OJU A;  3QNO A;  1S72 N;  2RHK A;  5HL7 L;  2NNW A;  2BE2 A;  1YXQ A;  1WAF A;  3VQE A;  1KLM A;  4FM2 A;  4B1X B;  2JWL A;  2O8C B;  3VQD A;  4CGG A;  4N41 A;  3UKR A;  4WYB A;  2AP1 A;  5AQW A;  3AAR A;  3AO1 A;  4O0I A;  3TAE A;  3VEZ A;  1TK8 A;  1J5O A;  5C25 A;  2E88 A;  4HTU A;  4CK1 A;  4J2D A;  3S3O A;  2DTU A;  2F4V K;  1HNI A;  3ZET A;  4F3T A;  1BWF O;  2GWJ A;  4AH9 A;  3M1F A;  4FJ9 A;  2P9S A;  3FGU A;  4M63 C;  2VYP A;  3R8E A;  5F2R A;  4H0O A;  5AQP A;  5BRF A;  1U04 A;  2E20 A;  4JRP A;  2ZQB A;  2BGG A;  3VOV A;  3EZW A;  4DU4 A;  3DXM B;  4Y1D A;  4FLV A;  5GIP A;  3THY A;  4GV3 A;  4M3R A;  5FDL A;  1VQP N;  4BC5 A;  1SL2 A;  2W40 A;  2WBN A;  2HNZ A;  3CME N;  4O8U A;  3ZYY X;  1BI4 A;  1KSP A;  4X66 K;  3OS2 A;  2OPQ A;  4MO4 A;  4YDU A;  4E1J A;  1ASU A;  3RMD A;  2UU9 K;  3U3Y A;  3MK6 A;  1A5V A;  3ZX2 A;  1NK0 A;  1X9W A;  3U4L A;  4YOU A;  3DXK A;  4BG9 A;  3OY9 A;  2GX9 A;  4E89 A;  2PAV A;  1KRP A;  3AO3 A;  4CF2 A;  3H3N O;  1HJO A;  3GOI A;  3ZEU B;  4JKD A;  5C24 A;  1TKZ A;  3CIP A;  4DB3 A;  4B3O A;  4OGC A;  2QW9 A;  1X9J A;  3DM2 A;  3VQB A;  4CED A;  2P9L B;  3LWM A;  3LZI A;  3DLK A;  3O80 A;  3CCM N;  1YIJ N;  1B9D A;  3VPZ A;  5AQG A;  3QLH A;  2GBZ A;  1WNS A;  3NGY A;  2X74 A;  2UUB K;  2HHQ A;  3D2E A;  1QHT A;  2O8B B;  3RSE B;  1NJW A;  4JI4 K;  3A5O C;  4KHU A;  4CK3 A;  3CCE N;  5KRT A;  5JLF A;  4JI2 K;  3SV3 A;  3C95 A;  2D1K A;  3NVK A;  1D4X A;  3BDP A;  1SKR A;  4KB0 A;  1HNZ K;  2W6L A;  4QCL A;  4CFC A;  4F3O A;  3J7Z O;  2QWO A;  2A41 A;  4JK8 A;  5AQH A;  4BRF A;  4TSX A;  1BL3 A;  2JGU A;  2I5J A;  4KHY A;  5ELZ A;  3WXI A;  1BA0 A;  1ZBF A;  4DQP A;  4B9Q A;  2O8F A;  4WFA L;  4DCH A;  3NGZ A;  4CJS A;  1HMV A;  3QML A;  3AVN A;  4JEP A;  1BG3 A;  4KO0 A;  3LDL A;  1DGK N;  2RN2 A;  3ZT0 A;  4BVP A;  2GTD A;  3MCA B;  4Z4I A;  1DKG D;  1KVC A;  4IBN A;  2HHT A;  4GVE A;  5CZ1 A;  4HCC A;  4BRN A;  2KFN A;  4CVN E;  2G8F A;  3EKS A;  5ADX A;  1OH6 A;  4OPJ A;  3D6R A;  2OYQ A;  1LCU A;  1JLE A;  2HHH K;  4E7H A;  3SUO A;  4E19 A;  1KAZ A;  1N8R O;  3LM9 A;  1S1V A;  2B4J A;  5EU7 A;  4W5R A;  3CCL N;  4CHZ A;  3VGK A;  1RT1 A;  4IG3 A;  5ADX H;  4YOW A;  5HBM A;  1YT3 A;  1KFS A;  3THW B;  3ZT3 A;  1ZBH A;  3Q7B A;  3HT3 A;  4N5S A;  2P9P B;  3IRX A;  1RT2 A;  4IXC A;  2Q36 A;  3PX4 A;  4MLH A;  1C1B A;  1CXQ A;  3ENH A;  3QIP A;  1OH7 A;  1RDC A;  1CZA N;  2BUP A;  1RBR A;  2EWS A;  3HZ6 A;  1YTA A;  3PX0 A;  4DSJ A;  3TSP A;  3DLH A;  1RDA A;  4PL8 A;  1KVB A;  4CJ5 A;  3J81 O;  3VA3 A;  4KRF A;  3TU5 A;  3ENO A;  1BA1 A;  1RT6 A;  1E4F T;  4FWL A;  4E3S A;  4DTS A;  4KRE A;  4JHD B;  1BOT O;  1SZ2 A;  4I2P A;  1NK8 A;  3VQ9 A;  4B08 A;  2E2O A;  3PV8 A;  1EQY A;  4ILG B;  3VQ4 A;  3J7A P;  1IBK K;  2O8E A;  2IC3 A;  4Z0U A;  2FBT A;  4LFB K;  1JL2 A;  1NLV A;  1VHX A;  2UUA K;  2HNY A;  2QI2 A;  1JL1 A;  1LW2 A;  1NU0 A;  3OYK A;  5AZJ A;  3CC2 N;  4KHS A;  5LMU K;  3PSI A;  4R5P A;  3S3N A;  1C6V A;  2FSN A;  1D9F A;  5C10 A;  3KWI A;  4DFM A;  2Z1G A;  1U2V A;  2EX3 A;  3KKS A;  1KXP A;  1MWM A;  4DF4 A;  4A5A A;  1S3X A;  3K9K A;  5J1E A;  4CGI A;  4X65 K;  3I55 N;  5AQY A;  1YAG A;  4E1N A;  5HLF A;  3TAR A;  1VRU A;  2Q1N A;  1K9M O;  1VRT A;  1NK6 A;  4KTW A;  3BEX A;  4E7I A;  5C15 A;  4FLY A;  1QSY A;  4DQS A;  3ZLJ A;  1HNX K;  1JLC A;  2HND A;  3CCU N;  3SQ1 A;  5KPT A;  4CES A;  3IAY A;  1HKB A;  3CC7 N;  3EYZ A;  3DJC A;  4OPH A;  4ZHR A;  4B1Y B;  1RBS A;  3OYA A;  1ZBU A;  1S1W A;  1NBW A;  2RF2 A;  4MQ3 A;  3BP8 A;  4FJG A;  5C2D A;  4DLE A;  3KJV A;  4B9S A;  3PLA A;  3WNE A;  1VQ7 N;  4RW7 A;  1QQO A;  3VGL A;  2P9U B;  3P38 A;  4DFP A;  1BCO A;  1NKB A;  2X6S A;  5FPM A;  1C0F A;  2ZJR L;  3E9O A;  5DM6 L;  3M3Z A;  5CE3 A;  3MWP A;  3LWL A;  4CBX A;  4B8A B;  3QBX A;  3A2F A;  3QB0 A;  1NNE A;  4NLC A;  4J2A A;  1U6Z A;  3EKU A;  5AR0 A;  3M8S A;  3C6U A;  3K0S A;  3THX A;  1YF5 L;  2DFE A;  1X3M A;  4KH4 A;  4OKJ A;  3RRH A;  1XMQ K;  1VQ5 N;  4CI6 A;  1SS6 A;  1M1K O;  3WQT A;  1RBU A;  2W6K A;  1Q82 O;  1WLJ A;  4K0K K;  2FSK A;  3LP3 A;  3THV A;  4DR6 K;  4FWP A;  1HR0 K;  4E7J A;  4RG8 A;  4DSF A;  3BGR A;  3HPH A;  4CFB A;  3C6T A;  3MX2 A;  3DAW A;  1QVG M;  3OS0 A;  4BE0 A;  4CJP A;  1YVU A;  3L4Q A;  4IG0 A;  3KD5 E;  3HYF A;  3LP1 A;  2HVI A;  4DV2 K;  4C8N A;  3WXM B;  4B9L A;  4RWT A;  4AHU A;  4YOT A;  3OHR A;  4L3Q A;  4O44 A;  3K57 A;  2F9W A;  4WFB L;  3L8B A;  2HMI A;  3DMJ A;  2GWK A;  4F8R A;  2NRZ A;  4CBU A;  3PX6 A;  1A5W A;  4FJ8 A;  2P9N B;  1HPZ A;  1I39 A;  1RT5 A;  1XQS C;  3K58 A;  4ZTJ A;  4CF1 A;  5M1K A;  3AAP A;  4IOC L;  4PQU A;  4O4G A;  3F5T A;  2YNG A;  4M45 A;  3TSQ A;  2FBV A;  4LH5 A;  4K8X A;  3M8Q A;  2HW3 A;  1HRH A;  4OJR A;  4CGF A;  4CJQ A;  5JLH A;  2E2N A;  3CQY A;  4BWJ A;  5A2Q O;  3BZC A;  3QFP A;  4EZ6 A;  3H46 O;  4LD0 A;  4N56 A;  3O3G A;  3VMF B;  1IJJ A;  4FCY A;  2IIR A;  4OPK A;  3QBW A;  3C6A A;  3RWU A;  3L3V A;  2QWL A;  5E26 A;  2I7P A;  3TAP A;  4E1M A;  4CJW A;  4Z4E A;  2P9L A;  1WBB A;  2AJQ A;  2QWQ A;  1LAW A;  3NH1 A;  4CJV A;  2A3Z A;  1L3V A;  2KQ2 A;  3NF6 A;  1TL3 A;  1YHQ N;  2IGI A;  4FW2 A;  2W42 A;  2YNI A;  4DTX A;  3RSE A;  1DEJ A;  1VSM A;  4F9O A;  4C23 A;  4CGJ A;  3Q7C A;  5EOY A;  3V6D A;  2EHG A;  3GL1 A;  3B6O A;  4PKI A;  3AA4 A;  1QZ5 A;  5J2Q A;  4CD3 A;  3G71 N;  3CET A;  3PY8 A;  4BDY A;  1W9H A;  4YOR A;  4JKB A;  1ZBI A;  4WE1 A;  4BR5 A;  3ZSW A;  4DQI A;  4FJJ A;  3A5M C;  4DV0 K;  5JIC A;  4DTU A;  3JXU A;  3V1O A;  3DLG A;  1Z6R A;  2YI1 A;  1GOC A;  4JKE A;  2PYJ A;  3I8D A;  3EN9 A;  3O08 A;  1XHX A;  2GUP A;  4CEQ A;  1Z26 A;  1RTD A;  4CJK A;  2O8D B;  5IT9 O;  5HP1 A;  4Q5V A;  2ZJQ L;  3R3L A;  4DR1 K;  3R9P A;  4BGA A;  5E84 A;  1VSH A;  4JI1 K;  4ICL A;  1VQO N;  4ELV A;  4E0D A;  3SPZ A;  4JK9 A;  4NYN A;  5TKY A;  3LAN A;  3UB5 A;  2E1Y A;  5AQK A;  4LFC K;  4M3Z A;  3WEE B;  2HHU A;  2R7Y A;  1YTU A;  3TI0 A;  4N47 A;  2G8I A;  4FW1 A;  3QO9 A;  3ZX3 A;  2LSN A;  1WSH A;  4I9L A;  3QEI A;  2HVH A;  3GE1 A;  5EY4 A;  4JD2 B;  3VQ7 A;  5HRR A;  3WUH A;  1CXU A;  4IJA A;  3THW A;  1ZYQ A;  3FFI A;  1X3N A;  2P9P A;  3ZSO A;  5JMV A;  4YOX A;  3VTI A;  3WNF A;  4XEI A;  4IEE A;  3RMB A;  2QTD A;  1N6Q A;  4PHT X;  3G10 A;  4FWQ A;  3HOT A;  1WN7 A;  3FFK B;  2KZZ A;  2W41 A;  2FBY A;  3HP9 A;  3HST B;  3VF4 A;  1C0G A;  3NF9 A;  1K8K A;  2D0O A;  2FF3 B;  1JCG A;  4CJ4 A;  5AQV A;  4DKW A;  1YJN N;  1GOB A;  4YNQ A;  4KH5 A;  1H1V A;  1QS4 A;  1EO1 A;  5CHI A;  1DT9 A;  3F2K A;  4M3U A;  4FPA A;  4BR9 A;  3MXI A;  1QE1 A;  3VES A;  1OKJ A;  3RRG A;  4H4O A;  3U9D A;  1NGE A;  1BU6 O;  4YOY A;  3O9S A;  4BDZ A;  1VSK A;  3WXJ A;  3MED A;  2PBD A;  2P51 A;  3C0B A;  4UQG A;  1D9D A;  4B9V A;  4JKH A;  1FKP A;  1UOC A;  3CER A;  3RR8 A;  1WSG A;  3T1A A;  3VEY A;  3VQQ A;  1NK5 A;  4Q0B A;  3FE1 A;  2XY7 A;  5JVG L;  3SZ2 A;  2OCE A;  3DYA A;  3G25 A;  1EWQ A;  4CZK A;  3L2R A;  1LV5 A;  4CJ7 A;  3HVR A;  4YY3 K;  3VF6 A;  1T3V A;  4W5N A;  4DQR A;  2CH5 A;  5CZ2 A;  4M3Y A;  3EEQ A;  3O1B A;  5GIO A;  4BRC A;  3O9U A;  1ATN A;  4H4M A;  1X9S A;  5BRD A;  5FLX O;  4O5B A;  3P31 A;  3FR0 A;  3VEV A;  4I2Q A;  4H5R A;  5F0X A;  3P83 D;  1WSI A;  3CCQ N;  2DPN A;  4MO5 A;  5B8H A;  2ASM A;  4FO0 A;  4FJN A;  1JCF A;  4YOV A;  4QS9 A;  1UA1 A;  4IDK A;  4BAC A;  1OH5 A;  4CJR A;  4DSK A;  3CFO A;  4AHC A;  3L2V A;  4BR4 A;  1NGA A;  1V4S A;  3H3O B;  5K14 A;  3MN5 A;  3HM8 A;  1GLD G;  1X1P A;  2IVN A;  1Q81 O;  1YJ9 N;  4Z4F A;  1ESV A;  4BQL A;  3AA2 A;  1QQN A;  4H0T B;  2H3G X;  3NDK A;  3AO5 A;  2BAN A;  4B1W B;  4GMJ B;  4BRK A;  1S1X A;  1IKX A;  3TPQ A;  3FLC O;  3O1W A;  3SBG A;  4DLG A;  1W2B M;  1KFD A;  2HHS A;  3KK1 A;  4DV4 K;  5D3G A;  4N76 A;  3LDQ A;  3SMP A;  5SWM A;  3TAN A;  3VF2 A;  4BR2 A;  4CIG A;  3FZH A;  1IG8 A;  4JI7 K;  3VEN A;  4UY8 O;  2Y1J A;  1UWB A;  1S5J A;  1ATS A;  1BHL A;  3IMX A; 
#chains in the Genus database with same CATH homology
 3HL8 A;  3HM9 A;  4FJ7 A;  2HNY A;  1JL1 A;  1LW2 A;  4DWI A;  2YKM A;  1BIS A;  3KD1 E;  3OYK A;  4CF9 A;  2PZS A;  4KHS A;  1L3S A;  2XY6 A;  1T7P A;  4R5P A;  3S3N A;  3UIQ A;  3OYI A;  3ITH A;  1CZB A;  1BIZ A;  1C6V A;  1ASW A;  1JXB A;  1RTH A;  5C42 A;  5J2M A;  1ZBL A;  1T03 A;  1L5U A;  4FJX A;  1QSS A;  3NHG A;  1HQU A;  3PO4 A;  3AA3 A;  1D9F A;  4FXD A;  4GVM A;  4W5T A;  4DG1 A;  4DFM A;  1XI1 A;  2Z1G A;  2A1R A;  1SKS A;  1B92 A;  1KTQ A;  2ETJ A;  3KKS A;  2EX3 A;  3AVC A;  3O4N A;  4EP5 A;  4FLW A;  4B9M A;  4DF4 A;  2OZM A;  2GUI A;  1FXX A;  5J1E A;  4RW6 A;  4DMN A;  4CGI A;  3K2P A;  2Z1H A;  4CEO A;  3SQ2 A;  1SL0 A;  4FLZ A;  4CHP A;  3CFP A;  3HO1 A;  4CHO A;  2X78 A;  4E1N A;  5HLF A;  4Z4C A;  4PY5 A;  3TAR A;  1VRU A;  1BIU A;  1VRT A;  1Y97 A;  1NK6 A;  1C0U A;  1DTQ A;  1KVA A;  3MAQ A;  2VWJ A;  4KTW A;  2JLE A;  2F96 A;  4E7I A;  4M41 A;  1VSD A;  5FRM A;  3LPT A;  4FLY A;  1QSY A;  3QEX A;  3OYN A;  3OYB A;  4M3X A;  4KHQ A;  4DQS A;  4M3T A;  3LDS A;  3VA0 A;  1S9E A;  1JLC A;  2HND A;  4RW8 A;  3SQ1 A;  3IAY A;  4CES A;  3QEW A;  2HHW A;  4CEB A;  3EYZ A;  4JRQ A;  3TAF A;  4ZHR A;  4HUG A;  1KLN A;  4I9Q A;  1RBS A;  3OYC A;  3EY1 A;  3OYA A;  1ZBU A;  1S1W A;  3LAM A;  3QET A;  1U4B A;  1HQE A;  2RF2 A;  4MQ3 A;  3M8P A;  1S6P A;  1NJZ A;  4F2S A;  3OYD A;  1NKC A;  4FJG A;  3LZJ A;  4DLE A;  3KJV A;  4CHY A;  2G8K A;  4B9S A;  3WNG A;  3WNE A;  4DQQ A;  5DK5 A;  2KZM A;  1TAU A;  1TVR A;  2YNH A;  1IH7 A;  4QAG A;  1RBT A;  4RW7 A;  4MFB A;  4B9T A;  3AVM A;  4O55 A;  4CEE A;  1EET A;  4KI4 A;  3L2U A;  2YHB A;  1BCO A;  1VSF A;  4DFP A;  2Y1I A;  3SUP A;  3SQ0 A;  1NKB A;  2X6S A;  4H8K A;  2KW4 A;  1J9A A;  3HPG A;  1C0M A;  2HHV A;  3ASM A;  3MEE A;  4E7L A;  1VK0 A;  1DTT A;  2G8W A;  3AVH A;  3OVN A;  2G8U A;  3V1R A;  1NJX A;  1RDD A;  3RR7 A;  4CF0 A;  2RPI A;  3LWL A;  4OKE A;  4KI6 A;  4BE1 A;  4CE9 A;  3G0Z A;  4DTJ A;  3V9U A;  4B8A B;  3U6F A;  2ATQ A;  3V1Q A;  4HHT A;  3KTQ A;  4PWD A;  3A2F A;  3K59 A;  2XY5 A;  1S9G A;  3T3F A;  3RMA A;  2Z1I A;  1LWF A;  3TAQ A;  3L3U A;  2OZS A;  4J2A A;  3VQ5 A;  3QES A;  3M8R A;  3IS9 A;  3TAM A;  3KLF A;  3AVJ A;  1MU2 A;  4CFD A;  1HYV A;  1RT4 A;  3MEC A;  3M8S A;  3C6U A;  3PUF A;  2DFE A;  3QEV A;  4OKJ A;  4FJH A;  4W5O A;  2QK9 A;  3RRH A;  2O4G A;  3I0R A;  1JLF A;  3VQC A;  3TAB A;  5HRO A;  4C8O A;  3AVA A;  5HRN A;  4BDP A;  1LW0 A;  3NH2 A;  1NKE A;  4EP4 A;  1RBU A;  3AVK A;  3C94 A;  4Z4H A;  1NK4 A;  1WLJ A;  1XHZ A;  3LP3 A;  1WSE A;  1Z25 A;  1RT3 A;  3NFA A;  4CF8 A;  3THV A;  4AIL C;  1ASV A;  1FK9 A;  3CYM A;  1JLG A;  4CEC A;  3NH0 A;  4DTN A;  5FRN A;  4E7J A;  1L3T A;  4RG8 A;  3L2W A;  4DSF A;  3BGR A;  3HPH A;  4CFB A;  4XIU A;  2D0C A;  3C6T A;  4J2B A;  3ZSQ A;  3OS0 A;  4BE0 A;  4FM1 A;  1G15 A;  1K6Y A;  1FKO A;  4W5Q A;  3KK2 A;  4KAZ A;  4C8M A;  4CJP A;  1YVU A;  5HRP A;  1ITG A;  4Y1C A;  2VWK A;  4IG0 A;  3KD5 E;  5CY4 A;  3SI6 A;  3OJS A;  4BWM A;  4I7F A;  3KLH A;  2E6L A;  2ZE2 A;  1S6Q A;  2VG5 A;  1O1W A;  3HYF A;  3LP1 A;  4CJL A;  3K5O A;  2YKN A;  4FYD A;  1S1T A;  1BQN A;  2IAJ A;  1U47 A;  2HVI A;  4AHR A;  3V9X A;  4C8N A;  4KB1 A;  3ZT4 A;  3TWH A;  4B9L A;  4DTM A;  4AHU A;  1IKW A;  4JLH A;  5JS1 A;  4O44 A;  3K57 A;  3SNN A;  1TGO A;  1U49 A;  3HP6 A;  4FJM A;  3HJF A;  3L8B A;  3S3M A;  2KTQ A;  2YV0 X;  4G1Q A;  3LAL A;  3DMJ A;  2HMI A;  1RIL A;  4FLU A;  3HK2 A;  2O4I A;  4AHV A;  1JLQ A;  3ZSZ A;  4ELT A;  5J2N A;  4FK4 A;  4AHS A;  2DY4 A;  3O3H A;  4F8R A;  3PX6 A;  1A5W A;  4FJ8 A;  5JS2 A;  1HPZ A;  3E01 A;  3PO5 A;  1I39 A;  2WON A;  4FK2 A;  3VQ8 A;  1RT5 A;  4OVL A;  3K58 A;  5CYM A;  4ZTJ A;  3V9S A;  4CF1 A;  1EX4 A;  2A1S A;  1JKH A;  3JYT A;  3S9H A;  1IG9 A;  3D0P A;  3QIO A;  1VSE A;  4PQU A;  5HRS A;  4O4G A;  3SUQ A;  1SV5 A;  2YNG A;  4M45 A;  2FBV A;  4LH5 A;  4CIF A;  4K8X A;  4F4K A;  3M8Q A;  4CEF A;  2HW3 A;  2P1J A;  3AVI A;  4DF8 A;  1C0T A;  1HRH A;  2HB5 A;  2ZD1 A;  4OJR A;  4CGF A;  3MEG A;  4CJQ A;  5KGX A;  1RTJ A;  2IDO A;  4CHN A;  1IKY A;  4BWJ A;  1VSI A;  5J2P A;  3P1G A;  4EZ6 A;  2B6A A;  1EKE A;  3DRR A;  4ID5 A;  4L8R B;  4HUF A;  3QEP A;  1NK7 A;  4CJF A;  3AVF A;  4NCA A;  4M42 A;  4LD0 A;  4N56 A;  3O3G A;  4KHN A;  4FCY A;  2VG7 A;  4O0J A;  5DMR A;  4YFU A;  4F2R A;  4OPK A;  3IG1 A;  3MXM A;  3RWU A;  2F8T A;  3L3V A;  4NCB A;  2YHA A;  1A5X A;  2FC0 A;  4M3W A;  1T8E A;  4CK2 A;  4DU1 A;  4HVJ A;  3SQ4 A;  3KLI A;  1W0H A;  1XWL A;  5KGW A;  2QKB A;  1SUQ A;  2B5J A;  4DU3 A;  3TAP A;  3AO4 A;  3ZSR A;  3V4I A;  3AVB A;  1QSL A;  4B9U A;  4E1M A;  4KV8 A;  1T05 A;  4HCB A;  3ALY A;  1JL2 A;  4CJW A;  3DLB A;  4CEZ A;  4Z4E A;  1HJR A;  1KCF A;  2NUB A;  3OJU A;  1BGX T;  3QNO A;  2XHB A;  1QTM A;  2AJQ A;  4IFV A;  1LAW A;  2F8S A;  4FZY A;  3NH1 A;  4JS4 A;  3SV4 A;  4CJV A;  1L3V A;  2KQ2 A;  1GOA A;  1RCH A;  1TL3 A;  3NF6 A;  2BE2 A;  2IGI A;  4FW2 A;  2W42 A;  1WAF A;  3VQE A;  1NK9 A;  1KLM A;  2YNI A;  4RW4 A;  4DTX A;  4FM2 A;  3DI6 A;  1BQM A;  2D5R A;  1VSM A;  3VQD A;  4CGJ A;  3NAE A;  4CGG A;  1D8Y A;  3V6D A;  2XRI A;  4N41 A;  3ZT1 A;  2EHG A;  3RTV A;  3SPY A;  3B6O A;  4FJK A;  3AVG A;  3AO1 A;  4O0I A;  3AA4 A;  1DLO A;  5J2Q A;  3OYF A;  3TAE A;  1TK8 A;  1J5O A;  5C25 A;  4OGE A;  2OPP A;  3PY8 A;  3AV9 A;  4DSI A;  4ZTF A;  4BDY A;  4HTU A;  1W9H A;  4CK1 A;  4J2D A;  3S3O A;  1ZBI A;  4ID1 A;  4WE1 A;  2DTU A;  3ZSW A;  4DQI A;  4FJJ A;  1HNI A;  4F3T A;  3WNH A;  3LP2 A;  4DTU A;  4CCH A;  4AH9 A;  1RBV A;  1R0A A;  4FJ9 A;  3V1O A;  2X6N A;  1RTI A;  4DS5 A;  3DLR A;  3DLG A;  2E4L A;  1GOC A;  2PYJ A;  4PA1 A;  4FM0 A;  3I8D A;  4AHT A;  4DFK A;  1B9F A;  1XHX A;  1JXE A;  2G8H A;  1S1U A;  4CEQ A;  2QKK A;  1Z26 A;  3KIO A;  4CJK A;  1U04 A;  1RTD A;  4JRP A;  4CJE A;  2ZQB A;  4E7K A;  2P5O A;  1UAX A;  2BGG A;  3DLE A;  4IFY A;  4DU4 A;  5HP1 A;  4Y1D A;  4Q5V A;  2D0B A;  3P5J A;  4FLV A;  1HNV A;  3D45 A;  3ISN C;  1VSH A;  4M3R A;  5FDL A;  2D0A A;  4FLX A;  1NOZ A;  4ICL A;  3NGI A;  1SL2 A;  2HNZ A;  3VQP A;  3SJJ A;  2OA8 A;  2PYL A;  3LP0 A;  5SZT A;  4LSN A;  1BI4 A;  4CGD A;  3SCX A;  1KSP A;  4DTR A;  1IKV A;  1EP4 A;  4ELV A;  4E0D A;  3SPZ A;  3CM5 A;  2OPQ A;  4NYN A;  3OS2 A;  2ITG A;  2VG6 A;  1ASU A;  3LAN A;  3RMD A;  3U3Y A;  4M3Z A;  2KFZ A;  1A5V A;  4HUE A;  2R7Y A;  1YTU A;  2HHU A;  4FVM A;  2HHX A;  3QNN A;  3TI0 A;  4N47 A;  1X9W A;  1NK0 A;  2G8I A;  2P5G A;  5FRO A;  4FW1 A;  3QO9 A;  1EXQ A;  2LSN A;  3NBP A;  3H08 A;  3OY9 A;  3AA5 X;  4CIE A;  4E89 A;  1NOY A;  3NCI A;  3NF7 A;  1KRP A;  3SYZ A;  1WSH A;  4DFJ A;  4I9L A;  3AVL A;  5KTQ A;  3QEI A;  2HVH A;  4CJU A;  3AO3 A;  4K8Z A;  1NJY A;  4CF2 A;  3DRS A;  3VQ7 A;  5HRR A;  4KFB A;  1CXU A;  1C1C A;  3O4Q A;  1TKT A;  1ZYQ A;  1N5Y A;  3ZT2 A;  3FFI A;  2BDP A;  1TAQ A;  3V9Z A;  5C24 A;  1JLA A;  1JLB A;  1TKZ A;  4NYF A;  3ZSO A;  4OLB A;  1TK0 A;  4B3O A;  3WNF A;  4OGC A;  3RMB A;  1N6Q A;  4KTZ A;  3VQ6 A;  2QXF A;  3LAK A;  3DM2 A;  3G10 A;  3VQB A;  4CED A;  1C1A A;  1WN7 A;  2KZZ A;  4NCG A;  3LWM A;  1TV6 A;  3LZI A;  2FBY A;  3DLK A;  4BE2 A;  4FZZ A;  3OYJ A;  3HP9 A;  3HST B;  1B9D A;  4JS5 A;  3NF9 A;  2GBZ A;  1WNS A;  3NGY A;  3QLH A;  1RT7 A;  3QER A;  2X74 A;  2HHQ A;  2G8V A;  4CJ4 A;  4FJL A;  3O3F A;  1GOB A;  4YNQ A;  1QHT A;  3OYH A;  1NJW A;  1QS4 A;  3I0S A;  4LH4 A;  4KHU A;  2XO7 A;  4CK3 A;  3CQ8 A;  1Q9Y A;  4M3U A;  5E41 A;  4LSL A;  2DFF A;  5KRT A;  4KPY A;  4C8L A;  4DS4 A;  3MXI A;  1QE1 A;  3TR8 A;  3TAG A;  3SV3 A;  3K5L A;  1WSF A;  2OPR A;  4FZX C;  3C95 A;  1RNH A;  1HYZ A;  3EZ5 A;  3BDP A;  1WAJ A;  1SKR A;  4H4O A;  3RRG A;  4KB0 A;  4QCL A;  4DSL A;  2IS3 A;  4CFC A;  1LWE A;  4BDZ A;  1VSK A;  4F3O A;  2GV9 A;  1LWC A;  3MED A;  3VN5 A;  2P51 A;  1D9D A;  4UQG A;  4B9V A;  3ZSV A;  4TSX A;  1BL3 A;  1FKP A;  1UOC A;  1VSL A;  2JGU A;  4DTO A;  2I5J A;  2Z1J A;  1IO2 A;  3RR8 A;  1WSG A;  3T1A A;  4KHY A;  3VQQ A;  1NK5 A;  1SL1 A;  4Q0B A;  5KRS A;  1ZBF A;  3L2Q A;  2XY7 A;  3ULD A;  3HXM A;  3AO2 A;  3HVT A;  4DQP A;  3SZ2 A;  3NGZ A;  3OS1 A;  4CJS A;  3JSM A;  1HMV A;  1U45 A;  3DYA A;  2PY5 A;  3AVN A;  3RMC A;  4KO0 A;  3OYE A;  3L2R A;  2RN2 A;  1LV5 A;  3HVR A;  4KTQ A;  4B8C A;  3ZT0 A;  1U48 A;  4DTP A;  4W5N A;  4DQR A;  1J54 A;  1KVC A;  4IBN A;  5CZ2 A;  4Z4I A;  2HHT A;  1BCM A;  3OYM A;  5T7B A;  4M3Y A;  5CZ1 A;  3NF8 A;  3KLE A;  4HCC A;  2KFN A;  1BI4 B;  2G8F A;  3V81 A;  3VQA A;  3ZSY A;  4OPJ A;  2OYQ A;  4H4M A;  5I42 A;  1JLE A;  1TL1 A;  1X9S A;  4Z4G A;  4E7H A;  2XY8 A;  4RW9 A;  3SUO A;  1Q9X A;  4LY7 A;  4E19 A;  2E6M A;  1WSJ A;  3CFR A;  1S1V A;  2B4J A;  4O5B A;  5EU7 A;  1UA0 A;  4W5R A;  4CHZ A;  4CJ3 A;  3KLG A;  3F73 A;  1TKD A;  4I2Q A;  3P83 D;  3MXJ A;  1WSI A;  1RT1 A;  4IG3 A;  2IOC A;  4FK0 A;  5HBM A;  1YT3 A;  3V9W A;  1KFS A;  3K5M A;  4KHW A;  1VSJ A;  3B6P A;  3DOL A;  4CEA A;  4FJN A;  1REV A;  3ZT3 A;  1TK5 A;  4C8K A;  1ZBH A;  2OPS A;  3LPU A;  5KI6 A;  1D5A A;  3HT3 A;  3KK3 A;  4N5S A;  3NE6 A;  4QOZ B;  3IRX A;  1UA1 A;  1XC9 A;  1HYS A;  1J53 A;  4IDK A;  3SUN A;  1RT2 A;  4BAC A;  2FBX A;  4CHQ A;  4CJR A;  3PX4 A;  4DSK A;  3CFO A;  4AHC A;  4J2E A;  1LAV A;  1C1B A;  3OYL A;  3L2V A;  3HPO A;  1CXQ A;  3T19 A;  3QIP A;  1RDC A;  5K14 A;  1X1P A;  1I3A A;  4Z4F A;  1RBR A;  4CGH A;  3U3G A;  3QIN A;  1YTA A;  1TKX A;  2WOM A;  1Q8I A;  3PX0 A;  3K5N A;  4OLA A;  1X9M A;  3ZCM A;  3AA2 A;  1RDB A;  4CFA A;  5I3U A;  4DSJ A;  3DLH A;  1RDA A;  1KVB A;  1CZ9 A;  3ZSX A;  4CJ5 A;  3NDK A;  3VA3 A;  1SKW A;  3AO5 A;  2BAN A;  4IKF A;  4KRF A;  2DFH A;  4FJ5 A;  4PUO A;  4GMJ B;  4DSE A;  3CG7 A;  1S1X A;  1IKX A;  4KKO A;  4GW6 A;  3OYG A;  5CYQ A;  2RKI A;  4DLG A;  4CER A;  1RT6 A;  4E3S A;  4KRE A;  1KFD A;  4DTS A;  1NK8 A;  4I2P A;  3KK1 A;  3DRP A;  4ELU A;  5D3G A;  2HHS A;  3VQ9 A;  4B08 A;  2YNF A;  1CLQ A;  3PV8 A;  4N76 A;  5SWM A;  3TAN A;  3VQ4 A;  3KKR A;  4CIG A;  1L3U A;  1F21 A;  4FJI A;  3CM6 A;  4OKK A;  2Q3S A;  3DOK A;  4FLT A;  3F9K A;  4B9N A;  2IC3 A;  4Z0U A;  2FBT A;  2Y1J A;  1UWB A;  1S5J A;  4EZ9 A;  1BHL A;  1QQC A;  4CJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...