4OVLA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Interrogating HIV integrase for compounds that bind--a SAMPL challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2013-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ovlA00
3HPGA 4E19A 1XHXA 4MQ3A 4CJ3A 3SV3A 1DTQA 1XWLA 2A1RA 1Q8IA 1A5WA 4LD0A 1QSYA 4N76A 3AA5X 2HNDA 2LSNA 4RG8A 1EKEA 4FM2A 4FM1A 3VQPA 3NGZA 4OVLA 3AVBA 4KHSA 1JLCA 1U45A 4W5QA 1ZBIA 4B9TA 3OYBA 3NAEA 3KK3A 3LWLA 4DTOA 3LDSA 1CXQA 1QQCA 3LWMA 3VQ5A 4FLWA 3P83D 4CJKA 4J2BA 2ZE2A 3G0ZA 5HRNA 1EX4A 1Q9YA 3TR8A 1TL1A 4CGFA 4CJLA 3K5NA 5E41A 3OJSA 1RDCA 1RT1A 3HL8A 3JYTA 2XY7A 2WONA 3DLHA 3ZSQA 2F8SA 4DSLA 1T03A 4N56A 3VQ4A 4BWMA 3AA3A 1TK0A 3SQ2A 1WNSA 1WSEA 4CHPA 1RDBA 1VRTA 4E7JA 2Z1JA 2VG6A 5SWMA 3HYFA 3VQEA 1YTAA 4DS5A 3RMCA 2XO7A 5K14A 3KTQA 3PO4A 4M3UA 1A5XA 1SV5A 1NK7A 2HHWA 3ZSWA 4DFMA 4M3RA 5C25A 1K6YA 2OYQA 1BHLA 4M41A 1HNIA 2Y1IA 4OJRA 1LW2A 4CE9A 4PY5A 3PX6A 3MXJA 2WOMA 3RMDA 4ZTJA 4CJVA 2YV0X 3A2FA 4BACA 3TWHA 3IRXA 1BI4B 4JRQA 4RW6A 1D8YA 4QCLA 3ZSZA 1RNHA 2Z1GA 5I3UA 3WNEA 4FJNA 4CIGA 3U3YA 4JLHA 3SQ1A 3L2QA 4Z4GA 1BQNA 4CESA 2D0CA 2XY6A 2OZSA 1B92A 1B9DA 1C0MA 3DYAA 4CFBA 4DF8A 1TK5A 1RDAA 1TAQA 3K2PA 3L2RA 3O4QA 5JS2A 4N5SA 1WAJA 1U04A 4RW9A 4ELTA 4HCCA 4FJHA 4CGHA 4E1NA 4NYFA 4F3TA 4DSFA 3SUPA 4R5PA 2OPQA 1DLOA 3RMAA 4O5BA 1EETA 2NUBA 2F96A 4BE2A 1VSJA 3L3UA 1RT2A 1N6QA 3TAPA 4C8KA 1BGXT 4CHZA 3C95A 3OS0A 3S3NA 4DU1A 3NH2A 1KRPA 3AVGA 4I9LA 5CYMA 4CHQA 5J2NA 1VSLA 2HVHA 3VQAA 4AH9A 3V1RA 5T7BA 1J53A 2BANA 4JS5A 4DFPA 3KIOA 1TL3A 1X1PA 2P5OA 4KHUA 3OY9A 1RT3A 3SQ4A 2YNIA 4KREA 3QEVA 2RN2A 3DMJA 3VQCA 3FFIA 4C8LA 4W5OA 4AHTA 4CEQA 2XRIA 1SUQA 5KRTA 1J9AA 2DFFA 3NBPA 3NHGA 4YNQA 4CEEA 3WNGA 2JLEA 3LPUA 1RTDA 4KI6A 2F8TA 2HHUA 1HQUA 3IAYA 3ISNC 3TARA 3MEDA 2A1SA 2GBZA 2VG5A 4EP5A 4HHTA 5KGXA 2ATQA 3OYAA 2FBTA 4CEZA 5HLFA 4FZYA 5CYQA 3HJFA 4N47A 3DM2A 4RW4A 3M8RA 1VSDA 1N5YA 3OYGA 3RRGA 4Q0BA 3QO9A 4CGDA 4QOZB 1RDDA 1IG9A 3VQ8A 3ZT0A 4G1QA 4OLBA 1RT6A 3ZCMA 3C94A 1JXEA 1QHTA 4CEOA 4FJKA 4W5NA 1RBSA 3HT3A 1RTJA 1VSEA 2PY5A 4K8XA 4Z4EA 3HVRA 1QS4A 4FZXC 4M3YA 1RTIA 4KHWA 1UA1A 2HVIA 3CG7A 3B6PA 1WSHA 4DSEA 3HO1A 1I3AA 2D5RA 3KLGA 1ZYQA 1WLJA 5KTQA 1S1TA 4CJQA 3AVJA 1LAVA 1RTHA 3AO2A 4LSNA 1RBUA 1JLEA 2KZZA 3SZ2A 2IDOA 4KB0A 3OYFA 3QIPA 4DU3A 5FRMA 2DFHA 5D3GA 2RF2A 3VQ9A 4AHRA 4CJSA 1Z26A 4OPJA 3L2UA 3SYZA 4ZTFA 4KTQA 4J2AA 3VQ6A 3TAMA 2P5GA 1FKPA 2KQ2A 1C1AA 2YKMA 3ZSVA 4ICLA 3D45A 3S9HA 1NJWA 3V9WA 3OYHA 5J2QA 4KHYA 3M8PA 4N41A 1VSMA 3DRRA 2X78A 2FBYA 4E3SA 3QEPA 2Q3SA 1C0UA 4HVJA 4FLYA 4M45A 4KPYA 3KLIA 3V1OA 4DG1A 3AVIA 5CY4A 2YNGA 3RTVA 1KFDA 4O0IA 3DI6A 3QETA 4CFCA 3ZT3A 1RT5A 3ITHA 4FVMA 1U47A 4B3OA 5CZ1A 3DLGA 1CXUA 4CIEA 1EP4A 4DQRA 3PV8A 3TAQA 1RBRA 3U6FA 1KFSA 3KK1A 3QNNA 4EZ9A 1C1BA 4H4OA 3AO5A 3OYIA 1A5VA 4CIFA 3OJUA 3HM9A 4E0DA 4M3XA 3RMBA 1W9HA 3LANA 1NOYA 2KFZA 2DY4A 4KAZA 3PO5A 4DTSA 1HQEA 1XC9A 1HMVA 1LW0A 2Z1HA 4DFJA 2G8KA 3CYMA 4NCGA 5J1EA 3MEGA 2FBVA 3OYNA 5HRPA 2YNHA 1Z25A 1HYZA 1LV5A 3NF6A 3UIQA 4BDZA 1S1UA 1KVBA 3EZ5A 2I5JA 1MU2A 1FXXA 3KK2A 4DTMA 4LH5A 3PY8A 4ID1A 1DTTA 2BGGA 1RBVA 1VRUA 3I0RA 2GV9A 4DWIA 3VQBA 1UOCA 4CF9A 3NDKA 3VA0A 1VSFA 1NK0A 2O4GA 4FJ7A 1RT7A 4F2SA 1S1WA 4OKJA 4CECA 4FJXA 1RBTA 1CZ9A 4O4GA 3WNFA 2YNFA 3AO4A 4H8KA 2W42A 3SQ0A 5DK5A 2E4LA 5I42A 1XHZA 1ZBHA 2IS3A 3DRPA 1HYSA 5C24A 3HP6A 3MXMA 1TVRA 3NGIA 4CJWA 4BE1A 2E6LA 1VSHA 3LAMA 2XY5A 1NK9A 3VA3A 4GMJB 1UWBA 4DQIA 4DFKA 1NK8A 1Q9XA 1BIZA 2QXFA 1R0AA 4FLUA 1TKXA 1J54A 4OPKA 1IKXA 1VSKA 4DMNA 4B8CA 3K5MA 3HPHA 2ZD1A 4FK2A 5J2PA 2VWKA 4XIUA 1U4BA 4DTRA 4AHCA 4ELVA 3EY1A 3NCIA 1BIUA 1JXBA 3ASMA 4KTZA 2KTQA 3AVMA 1IO2A 4OGEA 3S3MA 3NGYA 3IG1A 1KVAA 1UAXA 4CFAA 1NKCA 2QKBA 3MAQA 4B9LA 3KKSA 1X9MA 4JRPA 5HRRA 4Z4IA 4M3WA 1RCHA 1T8EA 1NK6A 1JLQA 4KTWA 1D5AA 3TABA 1LWFA 5HROA 4B9MA 4KKOA 3K5LA 4I2QA 3V9ZA 4DSIA 2PZSA 4FM0A 2AJQA 1NJYA 4DTPA 3SUOA 3IS9A 4CEBA 3HXMA 1X9WA 4FZZA 2G8IA 3HPOA 5HBMA 4CF8A 1D9DA 3O3GA 4E7HA 4L8RB 1TV6A 1WAFA 2YHAA 2Y1JA 2RKIA 1C6VA 2GUIA 3T19A 3OYLA 4CF0A 1JL2A 4LY7A 3RWUA 1QSSA 3TI0A 2HHSA 4DU4A 4OKEA 3WNHA 5KRSA 4DTUA 3RR8A 2X74A 4E7LA 2E6MA 1QTMA 4FLZA 3AV9A 2BE2A 3L2WA 2VG7A 4CF2A 4M42A 5JS1A 2X6NA 2G8UA 3DLKA 1ZBUA 3CFPA 3SNNA 4FJJA 4FLTA 2HHVA 1KLMA 1VK0A 3AVNA 4CK2A 3QERA 4AILC 3HK2A 2JGUA 3QLHA 2B5JA 4W5RA 4WE1A 4CJ5A 3I8DA 4PA1A 1U48A 3JSMA 1KTQA 4MFBA 1UA0A 3KD1E 3LP0A 3L3VA 3DRSA 3HVTA 4ZHRA 4DTNA 3NF9A 1QSLA 4CJTA 1KVCA 3OYCA 4FYDA 1TGOA 4E7KA 3TANA 1Y97A 4EZ6A 2IC3A 1WN7A 4Z0UA 1ASWA 4CFDA 3K58A 3AVAA 3V9XA 4BE0A 2G8FA 1BCMA 2YKNA 4LSLA 3LP1A 3VQQA 3NF7A 4E7IA 4DQQA 1HNVA 2P51A 4TSXA 3KKRA 4CJPA 4Y1CA 3DLBA 4FLVA 4IKFA 5KGWA 2RPIA 1KSPA 4E89A 3S3OA 4B9NA 4FJGA 2OPPA 1HPZA 3KJVA 1WSFA 3SUNA 3DLEA 1SKRA 2D0BA 3V1QA 2PYLA 4KHNA 1IKYA 1HJRA 1C1CA 2DTUA 2EHGA 2B4JA 4NCAA 3I0SA 4GW6A 2D0AA 3QINA 5CZ2A 1C0TA 4CGIA 4E1MA 3EYZA 3TAEA 3K59A 1NJZA 1U49A 4FK0A 4PUOA 4DQPA 3T1AA 4HCBA 3VQDA 1L3TA 1WSJA 3AA2A 3AO3A 4Q5VA 1TAUA 4CHYA 2Z1IA 3NE6A 3QEXA 4OKKA 2QKKA 2HHXA 2G8VA 4YFUA 1ZBLA 4CJEA 4PQUA 3LAKA 4JS4A 4CCHA 4Y1DA 1GOBA 1IKWA 3HSTB 3K5OA 2FC0A 4H4MA 3T3FA 4RW8A 2G8HA 3VQ7A 3LZIA 1BI4A 1JKHA 3E01A 5C42A 4KV8A 1JLBA 2O4IA 1RILA 3BGRA 2VWJA 4B9UA 4LH4A 2KW4A 2OPSA 3F73A 4FJMA 4KHQA 4J2EA 1JL1A 1LWEA 3AVCA 3ULDA 4BWJA 3ZT1A 5HP1A 4KB1A 5FDLA 4CEDA 1SKWA 3TAFA 1G15A 1XI1A 1T05A 3O3HA 1NKBA 4IBNA 1BCOA 3QEWA 1CLQA 4HUEA 2QK9A 1NK4A 1I39A 2BDPA 2HNYA 3NF8A 2P1JA 3V81A 3LZJA 1CZBA 1RT4A 2ITGA 3AVKA 3C6UA 5HRSA 4Z4FA 1VSIA 4W5TA 1SL0A 1NOZA 2IAJA 4AHVA 4M3ZA 4EP4A 1S6PA 3KLFA 3MECA 3LALA 1X9SA 2HW3A 2KFNA 3AVHA 1NK5A 1W0HA 4IG0A 4HUGA 3G10A 4CHNA 1L3VA 4CGGA 4BDYA 4IFVA 4RW7A 4HUFA 4FJ8A 2IGIA 3L8BA 4CJFA 3ZT4A 3DLRA 5EU7A 3AVFA 4UQGA 4C8OA 3AO1A 1O1WA 4B8AB 1LAWA 4CK1A 1JLGA 2EX3A 3NH0A 3OYEA 3PUFA 5KI6A 3ZSOA 2FBXA 1JLAA 2HNZA 4CJRA 3V9SA 3V6DA 1L5UA 4F8RA 1IKVA 4FLXA 1FKOA 3SPYA 1NJXA 1NKEA 2KZMA 4QAGA 1BL3A 4I7FA 4KFBA 4CEFA 3SPZA 4DSJA 1YTUA 4KRFA 3SCXA 4GVMA 4IG3A 4ELUA 3D0PA 4I2PA 3OS2A 3M8SA 4DQSA 3SJJA 1D9FA 4DTXA 3MXIA 1WSIA 4F3OA 2X6SA 4ID5A 4CEAA 4FJ9A 4FJLA 3VN5A 2DFEA 4O0JA 1HYVA 2ZQBA 1EXQA 2R7YA 4M3TA 4Z4CA 1GOCA 4DSKA 4F4KA 3SI6A 1BQMA 1S5JA 5FROA 4CK3A 3THVA 4F2RA 2B6AA 4FK4A 4DTJA 1JLFA 4B08A 3V9UA 1TK8A 3OYKA 3SUQA 4FXDA 3KLEA 3NH1A 2HB5A 3TAGA 4C8NA 3OS1A 1T7PA 1SL1A 3C6TA 4B9VA 1TKTA 1TKDA 4IDKA 1SKSA 1J5OA 3ZT2A 1REVA 2YHBA 1B9FA 3RR7A 1S6QA 4FCYA 3PX0A 5FRNA 1TKZA 2OA8A 1S1VA 2OPRA 1ZBFA 4PWDA 4NCBA 1L3SA 1KLNA 3KD5E 4CJUA 3DOKA 3U3GA 4Z4HA 4CJ4A 3OVNA 4IFYA 3O3FA 3B6OA 5SZTA 1QE1A 4K8ZA 4CF1A 1FK9A 3CM5A 2HMIA 4FJIA 1KCFA 3V4IA 4BDPA 2OZMA 4OLAA 3LPTA 2XHBA 4CGJA 3CM6A 3P1GA 4O44A 3M8QA 4J2DA 3F9KA 1ITGA 3SV4A 1S9EA 3ZSYA 4KI4A 3HP9A 4DLGA 3H08A 3MEEA 3QNOA 3ZSRA 1ASUA 1GOAA 1HRHA 2XY8A 3QIOA 4CERA 2IOCA 3OYMA 3OYJA 4AHSA 4CHOA 3CQ8A 4DLEA 4B9SA 4OGCA 3KLHA 1YVUA 5DMRA 4FW1A 3ALYA 1S9GA 3AVLA 4C8MA 3OYDA 1IH7A 3O4NA 5J2MA 3L2VA 3QEIA 3QESA 1BISA 4NYNA 1SL2A 1S1XA 4AHUA 3PX4A 1L3UA 3LP2A 3BDPA 1ASVA 3NFAA 4I9QA 2HHTA 1F21A 1LWCA 2G8WA 3DOLA 2HHQA 4HTUA 4KO0A 1YT3A 3ZSXA 1WSGA 3CFRA 4O55A 3AA4A 3K57A 3P5JA 4FW2A 4DS4A 3RRHA 4DF4A 3CFOA 2PYJA 4FJ5A 3LP3A 2ETJA
chains in the Genus database with same CATH superfamily
1I94K 3HPGA 4C23A 4U7BA 2I7PA 3BUZB 3SV3A 4LD0A 4N76A 1LCUA 4RG8A 3QBWA 4CBXA 1WOQA 3THXB 3EEQA 1GLAG 3AVBA 4MLEA 4KHSA 4YDUA 5AQPA 3NAEA 3I56N 3LDSA 1QQCA 4FLWA 5AQVA 3M3ZA 5HRNA 1KAZA 3TR8A 1TL1A 5TKWA 1FW6A 1S72N 3OJSA 2F8SA 1RT1A 2XY7A 5BRHA 3JXUA 4LF4K 3SQ2A 4L3QA 1NU0A 3QBXA 2VG6A 4JKDA 5SWMA 3BZKA 3CCSN 2XO7A 3PO4A 1NK7A 4B1UB 1HNIA 3CMAN 2WOMA 4CJVA 5BRDA 2WTUA 4BACA 1QVGM 1RNHA 5GAGP 1GLCG 4CESA 2OZSA 1TK5A 1B9DA 4CFBA 4DF8A 1TAQA 3K2PA 3L2RA 5JS2A 4BR7A 1U04A 4BRPA 4CGHA 2ASPA 5LMNK 2HBLA 3IUCA 4V19S 4YOTA 1RT2A 4LFAK 3S3NA 1HNWK 3ENOA 4DR5K 5CYMA 5J2NA 1J53A 3HOSA 1X1PA 2P5OA 1HKGA 4KHUA 2O8DA 4I6MA 2RN2A 3SBGA 1HX1A 2XRIA 1SUQA 4JKGB 1YVNA 2ZJRL 4CJ7A 5AQOA 2HHUA 1HQUA 4JKEA 4HHTA 2VG5A 2ATQA 3OYAA 4CEZA 1U2VB 4N47A 4ISEA 1VSDA 3O5BA 4FWKA 4Q0BA 1IG9A 1CZAN 4G1QA 4ILGB 1RT6A 3ZCMA 4CEOA 2IVOA 4FO0A 4CZJA 4Z4EA 3HVRA 4FZXC 1RTIA 4X66K 3F2KA 3CG7A 3B6PA 4DSEA 3CERA 1TUUA 1SS6A 5F1XA 3CJ9A 4WQ5A 5AQMA 4CJQA 3AO2A 4LSNA 1QZ6A 3SZ2A 1VQLN 4DUYK 3VQ9A 3PSFA 3SYZA 1Z26A 4ZTFA 3L2UA 4KTQA 2VYPA 3O6WA 3TAMA 2P5GA 4X65K 3S9HA 3D45A 3V9WA 3ZYYX 5KQ8A 2GUPA 4N41A 1T44A 3C6HA 3P39A 4HVJA 2KKZA 4BGAA 3PIPL 2QM1A 1QZ5A 3IFRA 3AVIA 2YNGA 1KFDA 3DI6A 3F5TA 4CIEA 4DQRA 3C7NA 1XMQK 4FPBA 3U6FA 4FWMA 4EZ9A 2E88A 1A5VA 2DY4A 1DT9A 4BR4A 4HWIA 1HMVA 4DFJA 4NCGA 3MEGA 2A5XA 3OYNA 4YOVA 1LV5A 2VGMA 4FSVA 2ZJPL 4H0TB 4F9OA 1VRUA 3NDKA 1VSFA 4CECA 4OKJA 4EFHA 4O4GA 3AO4A 3LDOA 5CE3A 1ZBHA 3HTVA 2E4LA 1XHZA 2IS3A 1D4XA 3VF2A 1TVRA 5AQUA 4DV7K 4BVOA 3A5MC 3VA3A 4GMJB 3LDQA 1Q9XA 1NGEA 3R3LA 1IKXA 2W41A 5AQIA 4B8CA 4K0KK 3WXLA 1U4BA 2P9SA 1GLJO 5JVHL 5JLHA 3NCIA 2V52B 4JI2K 2QKBA 2RE2A 3A5NC 1T8EA 3E66A 1NK6A 1D5AA 5EVZA 3DLLL 1NGAA 3V9ZA 3IKMA 2G8IA 3HPOA 2CGLA 3O9TA 3QDKA 4L8RB 1TV6A 2F9WA 2Y1JA 1C6VA 2W40A 3T19A 4LY7A 3RWUA 3TI0A 4DU4A 3WNHA 2E6MA 4IFEA 4CF2A 2Q1NA 4M42A 3DLKA 2QWMA 3A5LC 4FJJA 2HHVA 1VK0A 3AY9A 1K8KA 4MDAA 5LY3A 2B5JA 4W5RA 4CJ5A 4PA1A 1UA0A 4MFBA 5DM6L 3LP0A 5ADXH 3L3VA 2NLXA 1NG9A 4DTNA 1Q7YO 3NF9A 1VAZA 3A5OC 4WFNL 1KVCA 4AM7A 4EZ6A 3CCEN 4WFBL 1WN7A 3EN9A 1VQNN 3DXKA 3V9XA 4ISFA 1EWQA 2G8FA 2YKNA 4LSLA 3VQQA 4DQQA 5AFUA 4WYBA 5KGWA 3PIOL 4RWTA 3QICA 2FF3B 2E2PA 3KJVA 1SKRA 3TPQA 1ATRA 3TTFA 5C12A 2DTUA 2EHGA 2HHXA 4GW6A 3EYZA 1C0TA 3KZBA 2O8BB 4M63C 4HCBA 3VQDA 3AO3A 3GG4A 3NE6A 3QEXA 4DKWA 3H3NO 1IKWA 3BY5A 1NGDA 1NGGA 2P9PB 2QTDA 3K5OA 2F4VK 4H5RA 4OX9K 1BI4A 1JKHA 4DV0K 1JLBA 2O4IA 1RILA 2ZWHA 5BN8A 4KHQA 1JL1A 4BWJA 2A6AA 3ZT1A 4GV9A 5FDLA 1YXQA 1NKBA 3O3HA 4IBNA 2ZGYA 3FZLA 1CLQA 2QK9A 3B8AX 2UXBK 4JI4K 3NF8A 2CH5A 2ITGA 5HRSA 1SL0A 4W5TA 4AHVA 4EP4A 1S6PA 3KLFA 3ZX0A 4BR9A 1W0HA 4IG0A 4HUGA 4FJ8A 2IGIA 4CJFA 2YHXA 3AVFA 4UQGA 2QEXN 4CK1A 3O9SA 1ZXOA 3PUFA 5KI6A 1JLAA 2Q97A 1FKOA 3SPYA 1NJXA 1ATNA 4I7FA 4KFBA 5AJ3K 5CHIA 4GVMA 3SCXA 1OH7A 4ELUA 4I2PA 1D9FA 1WSIA 2X6SA 4RCHA 3UB5A 4CEAA 1WB9A 5KQDA 3AAPA 4FJLA 4WCEL 3L0QA 1EXQA 2O8CB 4DR1K 5AZJA 4DSKA 5FROA 4H0YB 2B6AA 1ATSA 4DTJA 2OCEA 4B3MK 1TK8A 4FXDA 3KLEA 3LL3A 3O9UA 4WFAL 3OHRA 4BC5A 4DV4K 5FRNA 3RR7A 2CH6A 3VEZA 4PWDA 1IBLK 3CJAA 2P9KA 4CJUA 3CC7N 3OVNA 3B6OA 4K8ZA 5AQYA 1IJJA 4CF1A 3CC2N 1KCFA 4BDPA 4OLAA 4KH4A 1K9MO 4IDHA 4J2DA 4B1XB 3F9KA 1ITGA 1HNZK 4BQLA 1S9EA 3ZSYA 4KI4A 4B3RK 3CCMN 3CQ8A 1U6ZA 4BRDA 3VEYA 4FW1A 1N33K 3OYDA 1IH7A 3QESA 3VGLA 3THYB 3BDPA 1ASVA 4I9QA 5AZIA 2J4RA 4JKCA 2HHQA 1WSGA 3CFRA 4UY8O 3D2EA 3P5JA 3CFOA 4FJ5A 4JV5K 2ETJA 2QWOA 3SAHA 4E19A 2O8EB 2HSTA 4CJ3A 1DTQA 4K25A 1A5WA 1QSYA 3AA5X 2HNDA 2P9PA 3AGRA 5C10A 1EKEA 1K8AO 3VQPA 4BC2A 4OVLA 4CZEA 4QS8A 1QQMA 1JLCA 1ZBIA 4B9TA 3SK3A 4DTOA 3VQ5A 1J5EK 2KLAA 4J2BA 4JAXA 4R79A 3GE1A 3JYTA 2V7YA 3DLHA 2WONA 5AQTA 1NGHA 2IVNA 3VF6A 3AA3A 1WNSA 1RDBA 5LJWA 4LF7K 3HYFA 1YTAA 4DS5A 3KWGA 1RDUA 5K14A 1A5XA 5AQJA 3ZSWA 4QS7A 4M3RA 2Y1IA 2NRHA 1LW2A 4CE9A 1QVFM 1YJWN 3RMDA 3A2FA 1NLVA 4JN4A 4QCLA 3CIPA 3HM8A 3CI5A 3ENBA 3L2QA 1BQNA 2D0CA 5BREA 1B92A 4IOCL 3DYAA 4IJNA 3O4QA 1WAJA 4HCCA 2O8CA 3LDLA 4F3TA 1DLOA 3RMAA 3C65A 3DXMB 4X62K 1HR0K 2BTFA 2NUBA 1NM1A 2HOEA 2F96A 1IG8A 4BE2A 1VSJA 1N6QA 3BF1A 1BGXT 5AFUH 1N32K 1G99A 3C95A 3OS0A 2WUSA 4FL9A 4DU1A 3HZ6A 3CCLN 1VSLA 3QMLA 3C6AA 3KIOA 4KHPK 3SQ4A 2YNIA 2NRZA 3O9QA 5H1SQ 4AHTA 2OTJN 5KRTA 4HTLA 3D2FB 1J9AA 3NBPA 3NHGA 2F8TA 2CGJA 2A1SA 4EP5A 5HLFA 2FBTA 3DWLA 5CYQA 3HJFA 3ZEUA 1N5YA 4QOZB 2JWKA 4LF8K 4AM6A 5GIOA 3THYA 4BRGA 4FJKA 3HT3A 4K8XA 4LF9K 4KHWA 2HVIA 1WSHA 3NVMA 2D5RA 3KLGA 5GADP 5KTQA 4O8KA 2IDOA 1ZC6A 3OYFA 3QIPA 2P9LB 4WF9L 2DFHA 2RF2A 4BR2A 4AHRA 4BG8A 4OPJA 1C1AA 2YKMA 5M1PA 3DJCA 4ICLA 5C0YA 3QEPA 2FBYA 4E3SA 4FLYA 4J8FA 4CI6A 5CY4A 3RTVA 4O0IA 1W2BM 4CFCA 1RT5A 3ITHA 3WUHA 5CZ1A 3DLGA 4DB3A 3MN9A 1VQKN 1RBRA 2FF6A 1C1BA 3MN7A 4H4OA 3AO5A 4M3XA 4DR6K 2W6LA 4A62A 4DTSA 1HQEA 5IWAK 2G8KA 3CYMA 5J1EA 5AQZA 5HRPA 2YNHA 3M5RA 1HYZA 3NF6A 3UIQA 1KVBA 3EZ5A 2I5JA 1MU2A 3U4LA 4DTMA 4ID1A 2HBMA 3LDPA 1YHQN 2GV9A 1N34K 4EHUA 4FJ7A 3VA0A 1NK0A 4FJXA 1RBTA 3R6MA 3WNFA 2YNFA 5DK5A 3AAQA 1YJNN 4JI6K 4ISGA 3HP6A 4LFBK 1XC3A 3TSPA 3UKRB 2E6LA 4GY2B 4BE1A 1W97L 5DM7L 2XY5A 1NK9A 1TYQA 1UWBA 1NK8A 3RVCA 1TKXA 1VSKA 4OPHA 4FK2A 5J2PA 2GX9A 3E1YA 2P9UB 3FE1A 3MCAB 4ELVA 5FPMA 2KTQA 2O8FB 2E2QA 3S3MA 5BR8K 3KKSA 1X9MA 4Z4IA 5FPNA 3TTDA 3CETA 4KTWA 5HROA 1NGCA 4DSIA 2PZSA 2AJQA 4B1VA 3FZFA 4FZZA 1X9WA 4K43A 1S3XA 2H3GX 3O3GA 3SAGA 3BEXA 2YHAA 2RKIA 3ZETB 4CZIA 4CF0A 2QWRA 4DTUA 3RR8A 3H3OB 1NMDA 4FLZA 1QTMA 1XNRK 2VG7A 5JS1A 4BVPA 4IEIA 2JGUA 5F0XA 3SLCA 1VQ4N 4ZHRA 3VTHA 3CMEN 3J8AA 4DHYA 4GKKK 4CW7B 4CJTA 3OYCA 3THXA 4NXMK 4CFDA 3K58A 4JKBA 1BCMA 1E4FT 3MMVA 4CJPA 4A61A 4FWOA 4E89A 3S3OA 1QHAA 2F7TA 3C0BA 1HPZA 4KBOA 1WSFA 3DLEA 2PYLA 5C15A 4KHNA 1HJRA 2NNWA 2B4JA 4NCAA 3I0SA 3QINA 4E0DA 1NJZA 2P9IB 4E1MA 3H1QA 4YOYA 3TAEA 3K59A 1NGJA 3H6EA 4DQPA 5HOOA 4DCHA 1TAUA 4Q5VA 2BH1A 3O4WA 3O9RA 4YFUA 3MK6A 4Y1DA 1GOBA 3SBTA 2FC0A 2G8HA 4RW8A 4JI8K 2E20A 3E01A 5B8HA 4KV8A 5M1FA 2VWJA 4H5WA 2KW4A 4CD3A 3F73A 5HP1A 3ULDA 3AVCA 3UKRA 4KB1A 3R9PA 2EWSA 3VEVA 4OPAA 3TAFA 4HUEA 1I39A 3R8EA 1CZBA 4BRHA 4Z4FA 2VCPA 1NOZA 2OANA 3MECA 3AVHA 3JS6A 3N4PA 2O8FA 4CHNA 4BDYA 4BRNA 2Q2RA 3DLRA 5EU7A 1VQ9N 1T6CA 3AO1A 5AQLA 2I7NA 1KXPA 1L5UA 4F8RA 2HNZA 5BR9A 3V6DA 1KAXA 4FLXA 2Q0RA 4XEIA 5F2RA 4JKGA 4QAGA 1BL3A 4DSJA 4IG3A 2NRWA 1BA1A 3D0PA 3M8SA 4DQSA 4ID5A 4M7XA 3ZETA 1VQON 4K41A 1U2VA 1HYVA 4M3TA 4JYAK 5JMVA 2ZM6K 2E1ZA 3SI6A 5C2DA 1BQMA 4F2RA 1DKGD 1JLFA 4B1YB 3V9UA 3OYKA 3HSCA 3H1VX 4C8NA 3O1BA 3OS1A 1X3MA 3C6TA 4B9VA 3TTCA 4IDKA 1C0FA 1SKSA 1B9FA 3THWB 3PLAA 3PX0A 4H0OA 1S1VA 4PL7A 4NCBA 4YHHK 1L3SA 3SMSA 4CJ4A 1ESVA 1J6ZA 5SZTA 1FK9A 3CM5A 2OZMA 4BC4A 3LPTA 1HJOA 4CGJA 4JK8A 3CM6A 4YOWA 4O44A 4IOXA 3MX5A 1YI2N 3SV4A 3HBTA 3HP9A 4A5AA 3OYMA 3QIOA 4CERA 2IOCA 3G6EN 3O08A 4DLEA 4B9SA 2ZGZA 4OGCA 3KLHA 1YVUA 5EX5A 3M6GA 5DMRA 4CVNE 3ALYA 3AVLA 3VERA 2F9TA 2ITMA 3L2VA 4NYNA 1S1XA 1X3NA 1RFQA 4AHUA 1L3UA 3LP2A 4BRCA 3NFAA 1F21A 4KO0A 4FOIA 3K57A 3GOIA 4DS4A 5E84A 3OW2M 5IT9O 2A41A 1XHXA 4MQ3A 1BWFO 2E2NA 2E5LK 1XWLA 1Q8IA 4FWPA 5CR4A 4FM1A 3EKSA 2QA4N 1DEJA 3CJ7A 1DGKN 3OYBA 3QFPA 1Z05A 1CXQA 4BRLA 3LWMA 4CJKA 4GV6A 4CGFA 3I55N 3K5NA 5E41A 4KH6A 4H0XB 3H45C 4N56A 2YI1A 4YY3K 2FSKA 1OH6A 1FJGK 1WSEA 3CJBA 1RDWX 4FWRA 2GTDA 4DQ8A 2FSJA 2NRVA 5E26A 3RMCA 3EO3A 4M3UA 4A57A 5C25A 2OYQA 4M41A 4GVEA 4OJRA 2ZF5O 3PX6A 4ZTJA 2YV0X 3LM9A 3TWHA 4JRQA 3LM2A 5BPLA 5I3UA 3WNEA 4FWLA 3SQ1A 2VQFK 2XY6A 1C0MA 4JK7A 5BPMA 4MDBA 4RW9A 3Q7BA 2IVPA 4DSFA 1GLDG 4R5PA 3SUPA 2OPQA 4X64K 1EETA 3ZLJA 3SAFA 3NH2A 3FLCO 4K42A 1KRPA 3AVGA 3CHWA 4JI0K 3VQAA 3V1RA 3EL2A 2CGKA 4JS5A 3MX2A 2HF3A 4IJAA 4GV3A 3OY9A 1RT3A 1YF5L 4KREA 2UU9K 3DMJA 3FFIA 2YCHA 3BP8A 3K0SA 2DFFA 4YNQA 4CEEA 3CCJN 3WNGA 2JLEA 3LPUA 4KI6A 4LFCK 2GBZA 5KGXA 3CJ1A 3CCVN 4RW4A 3W3DA 3RRGA 3KVGA 1RDDA 3VQ8A 1JJ2M 2NZTA 4OLBA 4ILHA 1JXEA 1YITN 1QHTA 4PL8A 4DV5K 4W5NA 1RBSA 4MLHA 1VSEA 2PY5A 1QS4A 4M3YA 3O1WA 1UA1A 5AQSA 1ZYQA 1WLJA 1YIJN 1HLUA 1S1TA 1LAVA 1RTHA 1RBUA 4M7YA 4DV1K 1WBBA 1JLEA 1OH8A 2O8BA 4B1WB 3WXKA 4KH5A 3GDQA 4DU3A 5FRMA 3ZX2A 3DAWA 4B9QA 4J2AA 4B3TK 1C0GA 3O80A 3VQ6A 1FKPA 3ZSVA 4PKHA 1NJWA 3OYHA 5J2QA 4KHYA 3M8PA 2X78A 4AF1A 3T1YK 2Q3SA 4KPYA 1BG3A 3I8BA 1EO1A 5BRFA 3CJCA 4FVMA 4B3OA 3AGKA 3UKUB 1EP4A 4CD1A 3F9MA 5C2FA 1KFSA 3SJHA 3OYIA 4CIFA 3HM9A 3RMBA 3LANA 3EE9A 1VQPN 4B3SK 1MDUB 1BUPA 2FBVA 4CZHA 1Z25A 2WFBA 3IMXA 2GWJA 4XH5A 3PY8A 1FXXA 2BGGA 4LH5A 3PSIA 1DTTA 2E1YA 2AA4A 3J81O 4BG9A 3FZMA 4DWIA 1NJIO 1UOCA 2YJEA 2O4GA 4PHTX 1RT7A 4DR3K 3U9DA 3SQ0A 4H8KA 3CPEA 3DRPA 3L6QA 1HYSA 3MXMA 3T7ZA 3NGIA 1VSHA 3CD6N 3P38A 4DQIA 4DFKA 2PAVA 4FLUA 1R0AA 4OPKA 3K5MA 4IOAL 2ZD1A 4XIUA 3EY1A 1BIUA 1JXBA 4KTZA 3AVMA 3VGKA 4OGEA 3NGYA 4CFAA 4EHTA 1UAXA 5LL6Z 4Z94A 3MAQA 4B9LA 5EY4A 5HRRA 1NBWA 1RCHA 2UYTA 3MN6A 4IO8A 4BRQA 2RHKA 4DR4K 1LWFA 4BRFA 4B9MA 4DR2K 4I2QA 4FM0A 3FZKA 4BGBA 3SUOA 3MWTA 3IS9A 4CEBA 3HXMA 5HBMA 4CF8A 5GINA 2GELA 1GLLO 2NRTA 3OYLA 1XMOK 1QSSA 1XUPO 2HHSA 2WC9A 1BU6O 2X74A 3VMFB 3CCQN 4E7LA 3NVKA 3OA9A 2BE2A 3L2WA 2G8UA 2FLOA 1H1VA 4FLTA 1KLMA 3AVNA 4PKIA 1XQSC 3QERA 3HK2A 3T69A 2O8DB 4WE1A 5JLFA 1OVQA 4EIAA 4FWQA 1MA9B 1Q86O 1IBMK 2O8EA 3DRSA 3ZX3A 4IXCA 1HNXK 3U9ZA 4FYDA 5M1OA 4E7KA 4BREA 3TANA 2QW9A 3D6RA 4Z0UA 1ASWA 2QXLA 3KHYA 4FWNA 2VWBA 3AVAA 4H5VA 3L4IA 4CBWA 2HHHK 5FPEA 4E7IA 3NF7A 2P51A 4TSXA 4CBUA 3KKRA 4O8UA 4FLVA 4IKFA 2RPIA 3G4SN 3VETA 2OPPA 4A59A 5GAHP 3SUNA 2D0BA 3V1QA 4DV6K 1C1CA 5AQXA 1NWKA 2D0AA 4NO7A 5CZ2A 1U49A 4H03B 1RGIA 4FK0A 2A42A 5JVGL 1L3TA 3FFKB 4CHYA 2Z1IA 1VQ6N 3WQUA 1ZBLA 1S22A 3LAKA 4JS4A 4CCHA 3T3FA 3LZIA 5C42A 3ATUA 4LH4A 3WEEB 2OPSA 5M1QA 1V4SA 1SKWA 1XI1A 1G15A 4CZGA 4DV2K 3C7NB 4JKAA 1NK4A 1T3VA 2HNYA 3LZJA 3VF4A 5ADXA 4BRAA 1WUAA 3DXMA 2IAJA 5KPZA 3SMPA 4NXNK 3LALA 4BR0A 1X9SA 2HW3A 2KFNA 5AQFA 1KAYA 3CCUN 3UE5A 1M90O 4JK9A 4IFVA 4RW7A 4HUFA 4E1JA 2UUCK 3L8BA 3HI0A 4FWSA 3GL1A 4C8OA 5FPDA 1O1WA 1E4GT 1LAWA 1JLGA 2EX3A 3OYEA 4CJRA 3V9SA 2FBXA 1EQYA 3ULEB 5AQKA 1NKEA 4YOUA 3D2FA 2KZMA 1YTUA 4KRFA 4XH1A 1XNQK 3OS2A 4DTXA 5EXWA 2YX6A 3VN5A 2DFEA 4O0JA 4DV3K 2R7YA 4BR5A 2Q0UA 4Z4CA 1GOCA 2A3ZA 4CK3A 3THVA 4JI1K 3J7ZO 4FK4A 4B08A 2P9SB 4IWVA 1R59O 2JWLA 4QS9A 3SUQA 1N8RO 3NH1A 2HB5A 3MN5A 3TAGA 1T7PA 1SL1A 3WQTA 1TKDA 1J5OA 5GIPA 1REVA 2YHBA 1S6QA 3RSEB 1TKZA 1ZBFA 5I9EB 1KLNA 3KD5E 5MLCQ 3U3GA 3O3FA 4JEPA 3P4IA 2P9LA 4FJIA 3V4IA 2XHBA 4IEEA 3M8QA 1OKJA 4G9ZA 5AQNA 3H08A 3MEEA 3QNOA 3QB0A 1ASUA 4WQ4C 3OYJA 1LOTB 3FZHA 4AHSA 1VHXA 3J7AP 4EAHD 4C8MA 2GWKA 5J2MA 4KB0A 1SL2A 3PX4A 4Y0WA 3G25A 1LWCA 1NGFA 1IV0A 1K8KB 1GLFO 4O55A 4FW2A 5BPNA 2PYJA 3E9OA 1X9JA 3LP3A 1BO5O 4FPAA 4GKJK 1VQ7N 2A1RA 2LSNA 1VQ5N 4FM2A 3NGZA 5AR0A 5AQWA 1Q82O 1U45A 4W5QA 3WEEA 3DXKB 3BZCA 3KK3A 1YAGA 3LWLA 3WXJA 3P83D 4LC9B 4CZKA 4U67L 2ZE2A 3G0ZA 1Q9YA 1EX4A 3VEXA 2Q31A 4CJLA 1HUXA 1RDCA 4AQYK 3HL8A 3ZSQA 3HOTA 4DSLA 1T03A 3VQ4A 4BWMA 1TK0A 4H5NA 1V4TA 4C1NI 4CHPA 3K9JA 1VRTA 4E7JA 2Z1JA 4FOEA 1IBKK 1T6DA 2YJFA 1KC8O 3VQEA 3CCRN 2P9UA 3KTQA 2HHWA 1SV5A 4DFMA 2YHYA 1K6YA 1BHLA 4PY5A 4A5BA 3MXJA 3ULEA 4XH4A 3IRXA 1BI4B 2D0OA 4RW6A 1D8YA 3ZSZA 2Z1GA 5AQHA 4FJNA 4H5TA 4CIGA 3CF5L 3U3YA 4JLHA 4Z4GA 4LF6K 3TSUA 1RDAA 1NGBA 1QQOA 4N5SA 4ELTA 3BF3A 4FJHA 2PBDA 4E1NA 4B1ZA 4NYFA 3WXMB 4O5BA 3E9LA 3J7YP 3KWIA 3L3UA 1M1KO 2UXDK 3TAPA 5LMUK 4C8KA 2HMPA 4CHZA 4JD2B 3KK7A 3RSEA 2P9NB 4I9LA 4CHQA 5FLXO 4AH9A 5T7BA 3R1XA 2BANA 4DFPA 5HL7L 1TL3A 1SZ2A 4A2AA 1Q18A 1YUWA 3QEVA 3VQCA 4C8LA 4W5OA 1JCGA 4CEQA 4GNIA 5AQGA 2NRRA 3CXCM 1RTDA 5KPRA 5M1NA 3IAYA 3ISNC 3TARA 2ASMA 3MEDA 4IZ9A 4FZYA 1OVYA 2QWLA 3DM2A 3M8RA 3OYGA 3QO9A 4CGDA 5AZJB 3ZT0A 3C94A 4JI3K 2VGNA 1RTJA 3WXIA 2QWQA 3D7EO 3HO1A 1I3AA 5ELZA 4BRIA 3P31A 3Q7CA 3AVJA 1O13A 2P9KB 2P9IA 1Z6RA 2KZZA 1NNEA 4CZFA 2IIRA 5D3GA 4NLBA 4CJSA 2AP1A 2KQ2A 4JHDB 4NLCA 3EZWA 1VSMA 3DRRA 3CC4N 1C0UA 4M45A 3KLIA 3V1OA 4DG1A 3QETA 3ZT3A 3T1HK 4H0VB 1U47A 1KD1O 1CXUA 3PV8A 3TAQA 5AZIB 3KK1A 3QNNA 4JI7K 3OJUA 4CZLA 3D2EB 2KFZA 1W9HA 1NOYA 2ZJQL 4KAZA 3PO5A 2V7ZA 1XC9A 1LW0A 2Z1HA 3L4QA 5LJVA 1EWRA 3CPWM 1VQ8N 1KQSM 4BDZA 1S1UA 3KK2A 4YORA 1RBVA 2QWPA 3I0RA 3VQBA 4CF9A 3VTIA 4F2SA 1S1WA 1CZ9A 3G71N 2W42A 5I42A 4WQ4A 3ENHA 5C24A 1JCFA 4DUZK 3FGUA 3I33A 4CJWA 4BQZA 2D4WA 3LAMA 1BIZA 2QXFA 2A40A 3VOVA 1J54A 5EOYA 4DMNA 3HPHA 3M1FA 3A8YA 4JD2A 2PFUA 2VWKA 4DTRA 2P9NA 4AHCA 3ASMA 4JI5K 1OH5A 1W7AA 2D0PA 1IO2A 1Q81O 2HF4A 3IG1A 1KVAA 1NKCA 3THWA 2KHOA 3TSQA 4JRPA 4M3WA 3IDHA 3VESA 1JLQA 3TABA 4KKOA 3K5LA 1NJYA 1BA0A 4IO9L 4BRMA 4DTPA 4YDUC 1D9DA 4E7HA 4NB4A 3ID6A 1WAFA 2FXUA 2GUIA 3QFUA 3MCPA 1JL2A 4JKFA 4BY9C 4OKEA 4RTFD 5KRSA 3VEWA 3J80O 3AV9A 4MO4A 3MWPA 2X6NA 1ZBUA 2FSNA 3CFPA 3SNNA 1E3MA 4CK2A 4JNEA 3AARA 4AILC 2BUPA 3QLHA 3TU5A 1U48A 3I8DA 1NGIA 3JSMA 1KTQA 1SQKA 3KD1E 2V51B 3HVTA 3N4QA 4C1NK 1QSLA 2VQEK 3ATVA 4JHDA 1TGOA 1Y97A 2IC3A 3VPZA 3ZEUB 3W0LA 4BE0A 3VGMA 3LP1A 1GLBG 1HNVA 3O8MA 4Y1CA 3DLBA 1BDGA 1JCEA 1KSPA 3E9PA 4B9NA 4FJGA 1Y64A 1IKYA 2W6KA 1BOTO 1GLEG 3EE8A 5A2QO 4CGIA 4PUOA 2ASOA 3T1AA 1TUYA 1WSJA 3AA2A 2UXCK 3K9KA 5AQQA 4OKKA 2Q36A 4JKHA 1HPMA 2QKKA 2G8VA 4CJEA 4MO5A 4PQUA 4DR7K 2DPNA 3HSTB 4H4MA 5BN9A 3VQ7A 3CQXA 3BGRA 4B9UA 1ZBSA 4FJMA 4J2EA 3EKUA 1LWEA 3JAMO 3NMUA 4CEDA 1T05A 3QEWA 1BCOA 4OO1J 2BDPA 2OTLN 2P1JA 3V81A 1RT4A 3AVKA 3C6UA 1NMNA 1VSIA 4M3ZA 1MWKA 1NK5A 1P8ZA 3MDQA 3G10A 5TKYA 4BROA 1L3VA 4CGGA 2UUBK 5KPTA 4WQ5C 3ZT4A 3GBTA 2YHWA 2E2OA 4B8AB 3NH0A 3ZSOA 1IKVA 4A2BA 4PKGA 4YOXA 3FR0A 3ID8A 3VENA 3SPZA 4CEFA 2QWNA 2HVHA 1SAZA 3SJJA 1WBDA 4F3OA 1HKCA 3MXIA 3A0IX 4FJ9A 1TYQB 3WT0A 5GAEP 5M1KA 2ZQBA 2HBJA 1YJ9N 2QI2A 1ILYA 2D1KA 4F4KA 2HBKA 1S5JA 4ILJA 4FVUA 1P90A 4O5FA 1K73O 4BC3A 1TKTA 4H0PA 3ZT2A 4FCYA 2OA8A 3OBYA 2OPRA 1MWMA 3DOKA 2E8AA 2WBNA 4Z4HA 3OTOK 4IFYA 1HKBA 1QE1A 3S41A 4I6MB 3LDNA 3CQYA 2HMIA 2NRXA 3U8XA 5JICA 3P1GA 1VQMN 3HRGA 4DLGA 3ZSRA 1GOAA 4HTUA 1HRHA 2XY8A 3H46O 4CZMA 4CHOA 2GEMA 3VEOA 1S9GA 3O4NA 3QEIA 1BISA 3OBWA 3UKUA 2HHTA 2G8WA 3DOLA 1QQNA 1YT3A 3ZSXA 4LF5K 3AA4A 4BRKA 3RRHA 2UUAK 4DF4A 1N36K 5AQRA
chains in the Genus database with same CATH topology
3HPGA 4E19A 1XHXA 4MQ3A 4CJ3A 3SV3A 1DTQA 1XWLA 2A1RA 1Q8IA 1A5WA 4LD0A 1QSYA 4N76A 3AA5X 2HNDA 2LSNA 4RG8A 1EKEA 4FM2A 4FM1A 3VQPA 3NGZA 4OVLA 3AVBA 4KHSA 1JLCA 1U45A 4W5QA 1ZBIA 4B9TA 3OYBA 3NAEA 3KK3A 3LWLA 4DTOA 3LDSA 1CXQA 1QQCA 3LWMA 3VQ5A 4FLWA 3P83D 4CJKA 4J2BA 2ZE2A 3G0ZA 5HRNA 1EX4A 1Q9YA 3TR8A 1TL1A 4CGFA 4CJLA 3K5NA 5E41A 3OJSA 1RDCA 1RT1A 3HL8A 3JYTA 2XY7A 2WONA 3DLHA 3ZSQA 2F8SA 4DSLA 1T03A 4N56A 3VQ4A 4BWMA 3AA3A 1TK0A 3SQ2A 1WNSA 1WSEA 4CHPA 1RDBA 1VRTA 4E7JA 2Z1JA 2VG6A 5SWMA 3HYFA 3VQEA 1YTAA 4DS5A 3RMCA 2XO7A 5K14A 3KTQA 3PO4A 4M3UA 1A5XA 1SV5A 1NK7A 2HHWA 3ZSWA 4DFMA 4M3RA 5C25A 1K6YA 2OYQA 1BHLA 4M41A 1HNIA 2Y1IA 4OJRA 1LW2A 4CE9A 4PY5A 3PX6A 3MXJA 2WOMA 3RMDA 4ZTJA 4CJVA 2YV0X 3A2FA 4BACA 3TWHA 3IRXA 1BI4B 4JRQA 4RW6A 1D8YA 4QCLA 3ZSZA 1RNHA 2Z1GA 5I3UA 3WNEA 4FJNA 4CIGA 3U3YA 4JLHA 3SQ1A 3L2QA 4Z4GA 1BQNA 4CESA 2D0CA 2XY6A 2OZSA 1B92A 1B9DA 1C0MA 3DYAA 4CFBA 4DF8A 1TK5A 1RDAA 1TAQA 3K2PA 3L2RA 3O4QA 5JS2A 4N5SA 1WAJA 1U04A 4RW9A 4ELTA 4HCCA 4FJHA 4CGHA 4E1NA 4NYFA 4F3TA 4DSFA 3SUPA 4R5PA 2OPQA 1DLOA 3RMAA 4O5BA 1EETA 2NUBA 2F96A 4BE2A 1VSJA 3L3UA 1RT2A 1N6QA 3TAPA 4C8KA 1BGXT 4CHZA 3C95A 3OS0A 3S3NA 4DU1A 3NH2A 1KRPA 3AVGA 4I9LA 5CYMA 4CHQA 5J2NA 1VSLA 2HVHA 3VQAA 4AH9A 3V1RA 5T7BA 1J53A 2BANA 4JS5A 4DFPA 3KIOA 1TL3A 1X1PA 2P5OA 4KHUA 3OY9A 1RT3A 3SQ4A 2YNIA 4KREA 3QEVA 2RN2A 3DMJA 3VQCA 3FFIA 4C8LA 4W5OA 4AHTA 4CEQA 2XRIA 1SUQA 5KRTA 1J9AA 2DFFA 3NBPA 3NHGA 4YNQA 4CEEA 3WNGA 2JLEA 3LPUA 1RTDA 4KI6A 2F8TA 2HHUA 1HQUA 3IAYA 3ISNC 3TARA 3MEDA 2A1SA 2GBZA 2VG5A 4EP5A 4HHTA 5KGXA 2ATQA 3OYAA 2FBTA 4CEZA 5HLFA 4FZYA 5CYQA 3HJFA 4N47A 3DM2A 4RW4A 3M8RA 1VSDA 1N5YA 3OYGA 3RRGA 4Q0BA 3QO9A 4CGDA 4QOZB 1RDDA 1IG9A 3VQ8A 3ZT0A 4G1QA 4OLBA 1RT6A 3ZCMA 3C94A 1JXEA 1QHTA 4CEOA 4FJKA 4W5NA 1RBSA 3HT3A 1RTJA 1VSEA 2PY5A 4K8XA 4Z4EA 3HVRA 1QS4A 4FZXC 4M3YA 1RTIA 4KHWA 1UA1A 2HVIA 3CG7A 3B6PA 1WSHA 4DSEA 3HO1A 1I3AA 2D5RA 3KLGA 1ZYQA 1WLJA 5KTQA 1S1TA 4CJQA 3AVJA 1LAVA 1RTHA 3AO2A 4LSNA 1RBUA 1JLEA 2KZZA 3SZ2A 2IDOA 4KB0A 3OYFA 3QIPA 4DU3A 5FRMA 2DFHA 5D3GA 2RF2A 3VQ9A 4AHRA 4CJSA 1Z26A 4OPJA 3L2UA 3SYZA 4ZTFA 4KTQA 4J2AA 3VQ6A 3TAMA 2P5GA 1FKPA 2KQ2A 1C1AA 2YKMA 3ZSVA 4ICLA 3D45A 3S9HA 1NJWA 3V9WA 3OYHA 5J2QA 4KHYA 3M8PA 4N41A 1VSMA 3DRRA 2X78A 2FBYA 4E3SA 3QEPA 2Q3SA 1C0UA 4HVJA 4FLYA 4M45A 4KPYA 3KLIA 3V1OA 4DG1A 3AVIA 5CY4A 2YNGA 3RTVA 1KFDA 4O0IA 3DI6A 3QETA 4CFCA 3ZT3A 1RT5A 3ITHA 4FVMA 1U47A 4B3OA 5CZ1A 3DLGA 1CXUA 4CIEA 1EP4A 4DQRA 3PV8A 3TAQA 1RBRA 3U6FA 1KFSA 3KK1A 3QNNA 4EZ9A 1C1BA 4H4OA 3AO5A 3OYIA 1A5VA 4CIFA 3OJUA 3HM9A 4E0DA 4M3XA 3RMBA 1W9HA 3LANA 1NOYA 2KFZA 2DY4A 4KAZA 3PO5A 4DTSA 1HQEA 1XC9A 1HMVA 1LW0A 2Z1HA 4DFJA 2G8KA 3CYMA 4NCGA 5J1EA 3MEGA 2FBVA 3OYNA 5HRPA 2YNHA 1Z25A 1HYZA 1LV5A 3NF6A 3UIQA 4BDZA 1S1UA 1KVBA 3EZ5A 2I5JA 1MU2A 1FXXA 3KK2A 4DTMA 4LH5A 3PY8A 4ID1A 1DTTA 2BGGA 1RBVA 1VRUA 3I0RA 2GV9A 4DWIA 3VQBA 1UOCA 4CF9A 3NDKA 3VA0A 1VSFA 1NK0A 2O4GA 4FJ7A 1RT7A 4F2SA 1S1WA 4OKJA 4CECA 4FJXA 1RBTA 1CZ9A 4O4GA 3WNFA 2YNFA 3AO4A 4H8KA 2W42A 3SQ0A 5DK5A 2E4LA 5I42A 1XHZA 1ZBHA 2IS3A 3DRPA 1HYSA 5C24A 3HP6A 3MXMA 1TVRA 3NGIA 4CJWA 4BE1A 2E6LA 1VSHA 3LAMA 2XY5A 1NK9A 3VA3A 4GMJB 1UWBA 4DQIA 4DFKA 1NK8A 1Q9XA 1BIZA 2QXFA 1R0AA 4FLUA 1TKXA 1J54A 4OPKA 1IKXA 1VSKA 4DMNA 4B8CA 3K5MA 3HPHA 2ZD1A 4FK2A 5J2PA 2VWKA 4XIUA 1U4BA 4DTRA 4AHCA 4ELVA 3EY1A 3NCIA 1BIUA 1JXBA 3ASMA 4KTZA 2KTQA 3AVMA 1IO2A 4OGEA 3S3MA 3NGYA 3IG1A 1KVAA 1UAXA 4CFAA 1NKCA 2QKBA 3MAQA 4B9LA 3KKSA 1X9MA 4JRPA 5HRRA 4Z4IA 4M3WA 1RCHA 1T8EA 1NK6A 1JLQA 4KTWA 1D5AA 3TABA 1LWFA 5HROA 4B9MA 4KKOA 3K5LA 4I2QA 3V9ZA 4DSIA 2PZSA 4FM0A 2AJQA 1NJYA 4DTPA 3SUOA 3IS9A 4CEBA 3HXMA 1X9WA 4FZZA 2G8IA 3HPOA 5HBMA 4CF8A 1D9DA 3O3GA 4E7HA 4L8RB 1TV6A 1WAFA 2YHAA 2Y1JA 2RKIA 1C6VA 2GUIA 3T19A 3OYLA 4CF0A 1JL2A 4LY7A 3RWUA 1QSSA 3TI0A 2HHSA 4DU4A 4OKEA 3WNHA 5KRSA 4DTUA 3RR8A 2X74A 4E7LA 2E6MA 1QTMA 4FLZA 3AV9A 2BE2A 3L2WA 2VG7A 4CF2A 4M42A 5JS1A 2X6NA 2G8UA 3DLKA 1ZBUA 3CFPA 3SNNA 4FJJA 4FLTA 2HHVA 1KLMA 1VK0A 3AVNA 4CK2A 3QERA 4AILC 3HK2A 2JGUA 3QLHA 2B5JA 4W5RA 4WE1A 4CJ5A 3I8DA 4PA1A 1U48A 3JSMA 1KTQA 4MFBA 1UA0A 3KD1E 3LP0A 3L3VA 3DRSA 3HVTA 4ZHRA 4DTNA 3NF9A 1QSLA 4CJTA 1KVCA 3OYCA 4FYDA 1TGOA 4E7KA 3TANA 1Y97A 4EZ6A 2IC3A 1WN7A 4Z0UA 1ASWA 4CFDA 3K58A 3AVAA 3V9XA 4BE0A 2G8FA 1BCMA 2YKNA 4LSLA 3LP1A 3VQQA 3NF7A 4E7IA 4DQQA 1HNVA 2P51A 4TSXA 3KKRA 4CJPA 4Y1CA 3DLBA 4FLVA 4IKFA 5KGWA 2RPIA 1KSPA 4E89A 3S3OA 4B9NA 4FJGA 2OPPA 1HPZA 3KJVA 1WSFA 3SUNA 3DLEA 1SKRA 2D0BA 3V1QA 2PYLA 4KHNA 1IKYA 1HJRA 1C1CA 2DTUA 2EHGA 2B4JA 4NCAA 3I0SA 4GW6A 2D0AA 3QINA 5CZ2A 1C0TA 4CGIA 4E1MA 3EYZA 3TAEA 3K59A 1NJZA 1U49A 4FK0A 4PUOA 4DQPA 3T1AA 4HCBA 3VQDA 1L3TA 1WSJA 3AA2A 3AO3A 4Q5VA 1TAUA 4CHYA 2Z1IA 3NE6A 3QEXA 4OKKA 2QKKA 2HHXA 2G8VA 4YFUA 1ZBLA 4CJEA 4PQUA 3LAKA 4JS4A 4CCHA 4Y1DA 1GOBA 1IKWA 3HSTB 3K5OA 2FC0A 4H4MA 3T3FA 4RW8A 2G8HA 3VQ7A 3LZIA 1BI4A 1JKHA 3E01A 5C42A 4KV8A 1JLBA 2O4IA 1RILA 3BGRA 2VWJA 4B9UA 4LH4A 2KW4A 2OPSA 3F73A 4FJMA 4KHQA 4J2EA 1JL1A 1LWEA 3AVCA 3ULDA 4BWJA 3ZT1A 5HP1A 4KB1A 5FDLA 4CEDA 1SKWA 3TAFA 1G15A 1XI1A 1T05A 3O3HA 1NKBA 4IBNA 1BCOA 3QEWA 1CLQA 4HUEA 2QK9A 1NK4A 1I39A 2BDPA 2HNYA 3NF8A 2P1JA 3V81A 3LZJA 1CZBA 1RT4A 2ITGA 3AVKA 3C6UA 5HRSA 4Z4FA 1VSIA 4W5TA 1SL0A 1NOZA 2IAJA 4AHVA 4M3ZA 4EP4A 1S6PA 3KLFA 3MECA 3LALA 1X9SA 2HW3A 2KFNA 3AVHA 1NK5A 1W0HA 4IG0A 4HUGA 3G10A 4CHNA 1L3VA 4CGGA 4BDYA 4IFVA 4RW7A 4HUFA 4FJ8A 2IGIA 3L8BA 4CJFA 3ZT4A 3DLRA 5EU7A 3AVFA 4UQGA 4C8OA 3AO1A 1O1WA 4B8AB 1LAWA 4CK1A 1JLGA 2EX3A 3NH0A 3OYEA 3PUFA 5KI6A 3ZSOA 2FBXA 1JLAA 2HNZA 4CJRA 3V9SA 3V6DA 1L5UA 4F8RA 1IKVA 4FLXA 1FKOA 3SPYA 1NJXA 1NKEA 2KZMA 4QAGA 1BL3A 4I7FA 4KFBA 4CEFA 3SPZA 4DSJA 1YTUA 4KRFA 3SCXA 4GVMA 4IG3A 4ELUA 3D0PA 4I2PA 3OS2A 3M8SA 4DQSA 3SJJA 1D9FA 4DTXA 3MXIA 1WSIA 4F3OA 2X6SA 4ID5A 4CEAA 4FJ9A 4FJLA 3VN5A 2DFEA 4O0JA 1HYVA 2ZQBA 1EXQA 2R7YA 4M3TA 4Z4CA 1GOCA 4DSKA 4F4KA 3SI6A 1BQMA 1S5JA 5FROA 4CK3A 3THVA 4F2RA 2B6AA 4FK4A 4DTJA 1JLFA 4B08A 3V9UA 1TK8A 3OYKA 3SUQA 4FXDA 3KLEA 3NH1A 2HB5A 3TAGA 4C8NA 3OS1A 1T7PA 1SL1A 3C6TA 4B9VA 1TKTA 1TKDA 4IDKA 1SKSA 1J5OA 3ZT2A 1REVA 2YHBA 1B9FA 3RR7A 1S6QA 4FCYA 3PX0A 5FRNA 1TKZA 2OA8A 1S1VA 2OPRA 1ZBFA 4PWDA 4NCBA 1L3SA 1KLNA 3KD5E 4CJUA 3DOKA 3U3GA 4Z4HA 4CJ4A 3OVNA 4IFYA 3O3FA 3B6OA 5SZTA 1QE1A 4K8ZA 4CF1A 1FK9A 3CM5A 2HMIA 4FJIA 1KCFA 3V4IA 4BDPA 2OZMA 4OLAA 3LPTA 2XHBA 4CGJA 3CM6A 3P1GA 4O44A 3M8QA 4J2DA 3F9KA 1ITGA 3SV4A 1S9EA 3ZSYA 4KI4A 3HP9A 4DLGA 3H08A 3MEEA 3QNOA 3ZSRA 1ASUA 1GOAA 1HRHA 2XY8A 3QIOA 4CERA 2IOCA 3OYMA 3OYJA 4AHSA 4CHOA 3CQ8A 4DLEA 4B9SA 4OGCA 3KLHA 1YVUA 5DMRA 4FW1A 3ALYA 1S9GA 3AVLA 4C8MA 3OYDA 1IH7A 3O4NA 5J2MA 3L2VA 3QEIA 3QESA 1BISA 4NYNA 1SL2A 1S1XA 4AHUA 3PX4A 1L3UA 3LP2A 3BDPA 1ASVA 3NFAA 4I9QA 2HHTA 1F21A 1LWCA 2G8WA 3DOLA 2HHQA 4HTUA 4KO0A 1YT3A 3ZSXA 1WSGA 3CFRA 4O55A 3AA4A 3K57A 3P5JA 4FW2A 4DS4A 3RRHA 4DF4A 3CFOA 2PYJA 4FJ5A 3LP3A 2ETJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HPG A;  4E19 A;  1XHX A;  4MQ3 A;  4CJ3 A;  3SV3 A;  1DTQ A;  1XWL A;  2A1R A;  1Q8I A;  1A5W A;  4LD0 A;  1QSY A;  4N76 A;  3AA5 X;  2HND A;  2LSN A;  4RG8 A;  1EKE A;  4FM2 A;  4FM1 A;  3VQP A;  3NGZ A;  4OVL A;  3AVB A;  4KHS A;  1JLC A;  1U45 A;  4W5Q A;  1ZBI A;  4B9T A;  3OYB A;  3NAE A;  3KK3 A;  3LWL A;  4DTO A;  3LDS A;  1CXQ A;  1QQC A;  3LWM A;  3VQ5 A;  4FLW A;  3P83 D;  4CJK A;  4J2B A;  2ZE2 A;  3G0Z A;  5HRN A;  1EX4 A;  1Q9Y A;  3TR8 A;  1TL1 A;  4CGF A;  4CJL A;  3K5N A;  5E41 A;  3OJS A;  1RDC A;  1RT1 A;  3HL8 A;  3JYT A;  2XY7 A;  2WON A;  3DLH A;  3ZSQ A;  2F8S A;  4DSL A;  1T03 A;  4N56 A;  3VQ4 A;  4BWM A;  3AA3 A;  1TK0 A;  3SQ2 A;  1WNS A;  1WSE A;  4CHP A;  1RDB A;  1VRT A;  4E7J A;  2Z1J A;  2VG6 A;  5SWM A;  3HYF A;  3VQE A;  1YTA A;  4DS5 A;  3RMC A;  2XO7 A;  5K14 A;  3KTQ A;  3PO4 A;  4M3U A;  1A5X A;  1SV5 A;  1NK7 A;  2HHW A;  3ZSW A;  4DFM A;  4M3R A;  5C25 A;  1K6Y A;  2OYQ A;  1BHL A;  4M41 A;  1HNI A;  2Y1I A;  4OJR A;  1LW2 A;  4CE9 A;  4PY5 A;  3PX6 A;  3MXJ A;  2WOM A;  3RMD A;  4ZTJ A;  4CJV A;  2YV0 X;  3A2F A;  4BAC A;  3TWH A;  3IRX A;  1BI4 B;  4JRQ A;  4RW6 A;  1D8Y A;  4QCL A;  3ZSZ A;  1RNH A;  2Z1G A;  5I3U A;  3WNE A;  4FJN A;  4CIG A;  3U3Y A;  4JLH A;  3SQ1 A;  3L2Q A;  4Z4G A;  1BQN A;  4CES A;  2D0C A;  2XY6 A;  2OZS A;  1B92 A;  1B9D A;  1C0M A;  3DYA A;  4CFB A;  4DF8 A;  1TK5 A;  1RDA A;  1TAQ A;  3K2P A;  3L2R A;  3O4Q A;  5JS2 A;  4N5S A;  1WAJ A;  1U04 A;  4RW9 A;  4ELT A;  4HCC A;  4FJH A;  4CGH A;  4E1N A;  4NYF A;  4F3T A;  4DSF A;  3SUP A;  4R5P A;  2OPQ A;  1DLO A;  3RMA A;  4O5B A;  1EET A;  2NUB A;  2F96 A;  4BE2 A;  1VSJ A;  3L3U A;  1RT2 A;  1N6Q A;  3TAP A;  4C8K A;  1BGX T;  4CHZ A;  3C95 A;  3OS0 A;  3S3N A;  4DU1 A;  3NH2 A;  1KRP A;  3AVG A;  4I9L A;  5CYM A;  4CHQ A;  5J2N A;  1VSL A;  2HVH A;  3VQA A;  4AH9 A;  3V1R A;  5T7B A;  1J53 A;  2BAN A;  4JS5 A;  4DFP A;  3KIO A;  1TL3 A;  1X1P A;  2P5O A;  4KHU A;  3OY9 A;  1RT3 A;  3SQ4 A;  2YNI A;  4KRE A;  3QEV A;  2RN2 A;  3DMJ A;  3VQC A;  3FFI A;  4C8L A;  4W5O A;  4AHT A;  4CEQ A;  2XRI A;  1SUQ A;  5KRT A;  1J9A A;  2DFF A;  3NBP A;  3NHG A;  4YNQ A;  4CEE A;  3WNG A;  2JLE A;  3LPU A;  1RTD A;  4KI6 A;  2F8T A;  2HHU A;  1HQU A;  3IAY A;  3ISN C;  3TAR A;  3MED A;  2A1S A;  2GBZ A;  2VG5 A;  4EP5 A;  4HHT A;  5KGX A;  2ATQ A;  3OYA A;  2FBT A;  4CEZ A;  5HLF A;  4FZY A;  5CYQ A;  3HJF A;  4N47 A;  3DM2 A;  4RW4 A;  3M8R A;  1VSD A;  1N5Y A;  3OYG A;  3RRG A;  4Q0B A;  3QO9 A;  4CGD A;  4QOZ B;  1RDD A;  1IG9 A;  3VQ8 A;  3ZT0 A;  4G1Q A;  4OLB A;  1RT6 A;  3ZCM A;  3C94 A;  1JXE A;  1QHT A;  4CEO A;  4FJK A;  4W5N A;  1RBS A;  3HT3 A;  1RTJ A;  1VSE A;  2PY5 A;  4K8X A;  4Z4E A;  3HVR A;  1QS4 A;  4FZX C;  4M3Y A;  1RTI A;  4KHW A;  1UA1 A;  2HVI A;  3CG7 A;  3B6P A;  1WSH A;  4DSE A;  3HO1 A;  1I3A A;  2D5R A;  3KLG A;  1ZYQ A;  1WLJ A;  5KTQ A;  1S1T A;  4CJQ A;  3AVJ A;  1LAV A;  1RTH A;  3AO2 A;  4LSN A;  1RBU A;  1JLE A;  2KZZ A;  3SZ2 A;  2IDO A;  4KB0 A;  3OYF A;  3QIP A;  4DU3 A;  5FRM A;  2DFH A;  5D3G A;  2RF2 A;  3VQ9 A;  4AHR A;  4CJS A;  1Z26 A;  4OPJ A;  3L2U A;  3SYZ A;  4ZTF A;  4KTQ A;  4J2A A;  3VQ6 A;  3TAM A;  2P5G A;  1FKP A;  2KQ2 A;  1C1A A;  2YKM A;  3ZSV A;  4ICL A;  3D45 A;  3S9H A;  1NJW A;  3V9W A;  3OYH A;  5J2Q A;  4KHY A;  3M8P A;  4N41 A;  1VSM A;  3DRR A;  2X78 A;  2FBY A;  4E3S A;  3QEP A;  2Q3S A;  1C0U A;  4HVJ A;  4FLY A;  4M45 A;  4KPY A;  3KLI A;  3V1O A;  4DG1 A;  3AVI A;  5CY4 A;  2YNG A;  3RTV A;  1KFD A;  4O0I A;  3DI6 A;  3QET A;  4CFC A;  3ZT3 A;  1RT5 A;  3ITH A;  4FVM A;  1U47 A;  4B3O A;  5CZ1 A;  3DLG A;  1CXU A;  4CIE A;  1EP4 A;  4DQR A;  3PV8 A;  3TAQ A;  1RBR A;  3U6F A;  1KFS A;  3KK1 A;  3QNN A;  4EZ9 A;  1C1B A;  4H4O A;  3AO5 A;  3OYI A;  1A5V A;  4CIF A;  3OJU A;  3HM9 A;  4E0D A;  4M3X A;  3RMB A;  1W9H A;  3LAN A;  1NOY A;  2KFZ A;  2DY4 A;  4KAZ A;  3PO5 A;  4DTS A;  1HQE A;  1XC9 A;  1HMV A;  1LW0 A;  2Z1H A;  4DFJ A;  2G8K A;  3CYM A;  4NCG A;  5J1E A;  3MEG A;  2FBV A;  3OYN A;  5HRP A;  2YNH A;  1Z25 A;  1HYZ A;  1LV5 A;  3NF6 A;  3UIQ A;  4BDZ A;  1S1U A;  1KVB A;  3EZ5 A;  2I5J A;  1MU2 A;  1FXX A;  3KK2 A;  4DTM A;  4LH5 A;  3PY8 A;  4ID1 A;  1DTT A;  2BGG A;  1RBV A;  1VRU A;  3I0R A;  2GV9 A;  4DWI A;  3VQB A;  1UOC A;  4CF9 A;  3NDK A;  3VA0 A;  1VSF A;  1NK0 A;  2O4G A;  4FJ7 A;  1RT7 A;  4F2S A;  1S1W A;  4OKJ A;  4CEC A;  4FJX A;  1RBT A;  1CZ9 A;  4O4G A;  3WNF A;  2YNF A;  3AO4 A;  4H8K A;  2W42 A;  3SQ0 A;  5DK5 A;  2E4L A;  5I42 A;  1XHZ A;  1ZBH A;  2IS3 A;  3DRP A;  1HYS A;  5C24 A;  3HP6 A;  3MXM A;  1TVR A;  3NGI A;  4CJW A;  4BE1 A;  2E6L A;  1VSH A;  3LAM A;  2XY5 A;  1NK9 A;  3VA3 A;  4GMJ B;  1UWB A;  4DQI A;  4DFK A;  1NK8 A;  1Q9X A;  1BIZ A;  2QXF A;  1R0A A;  4FLU A;  1TKX A;  1J54 A;  4OPK A;  1IKX A;  1VSK A;  4DMN A;  4B8C A;  3K5M A;  3HPH A;  2ZD1 A;  4FK2 A;  5J2P A;  2VWK A;  4XIU A;  1U4B A;  4DTR A;  4AHC A;  4ELV A;  3EY1 A;  3NCI A;  1BIU A;  1JXB A;  3ASM A;  4KTZ A;  2KTQ A;  3AVM A;  1IO2 A;  4OGE A;  3S3M A;  3NGY A;  3IG1 A;  1KVA A;  1UAX A;  4CFA A;  1NKC A;  2QKB A;  3MAQ A;  4B9L A;  3KKS A;  1X9M A;  4JRP A;  5HRR A;  4Z4I A;  4M3W A;  1RCH A;  1T8E A;  1NK6 A;  1JLQ A;  4KTW A;  1D5A A;  3TAB A;  1LWF A;  5HRO A;  4B9M A;  4KKO A;  3K5L A;  4I2Q A;  3V9Z A;  4DSI A;  2PZS A;  4FM0 A;  2AJQ A;  1NJY A;  4DTP A;  3SUO A;  3IS9 A;  4CEB A;  3HXM A;  1X9W A;  4FZZ A;  2G8I A;  3HPO A;  5HBM A;  4CF8 A;  1D9D A;  3O3G A;  4E7H A;  4L8R B;  1TV6 A;  1WAF A;  2YHA A;  2Y1J A;  2RKI A;  1C6V A;  2GUI A;  3T19 A;  3OYL A;  4CF0 A;  1JL2 A;  4LY7 A;  3RWU A;  1QSS A;  3TI0 A;  2HHS A;  4DU4 A;  4OKE A;  3WNH A;  5KRS A;  4DTU A;  3RR8 A;  2X74 A;  4E7L A;  2E6M A;  1QTM A;  4FLZ A;  3AV9 A;  2BE2 A;  3L2W A;  2VG7 A;  4CF2 A;  4M42 A;  5JS1 A;  2X6N A;  2G8U A;  3DLK A;  1ZBU A;  3CFP A;  3SNN A;  4FJJ A;  4FLT A;  2HHV A;  1KLM A;  1VK0 A;  3AVN A;  4CK2 A;  3QER A;  4AIL C;  3HK2 A;  2JGU A;  3QLH A;  2B5J A;  4W5R A;  4WE1 A;  4CJ5 A;  3I8D A;  4PA1 A;  1U48 A;  3JSM A;  1KTQ A;  4MFB A;  1UA0 A;  3KD1 E;  3LP0 A;  3L3V A;  3DRS A;  3HVT A;  4ZHR A;  4DTN A;  3NF9 A;  1QSL A;  4CJT A;  1KVC A;  3OYC A;  4FYD A;  1TGO A;  4E7K A;  3TAN A;  1Y97 A;  4EZ6 A;  2IC3 A;  1WN7 A;  4Z0U A;  1ASW A;  4CFD A;  3K58 A;  3AVA A;  3V9X A;  4BE0 A;  2G8F A;  1BCM A;  2YKN A;  4LSL A;  3LP1 A;  3VQQ A;  3NF7 A;  4E7I A;  4DQQ A;  1HNV A;  2P51 A;  4TSX A;  3KKR A;  4CJP A;  4Y1C A;  3DLB A;  4FLV A;  4IKF A;  5KGW A;  2RPI A;  1KSP A;  4E89 A;  3S3O A;  4B9N A;  4FJG A;  2OPP A;  1HPZ A;  3KJV A;  1WSF A;  3SUN A;  3DLE A;  1SKR A;  2D0B A;  3V1Q A;  2PYL A;  4KHN A;  1IKY A;  1HJR A;  1C1C A;  2DTU A;  2EHG A;  2B4J A;  4NCA A;  3I0S A;  4GW6 A;  2D0A A;  3QIN A;  5CZ2 A;  1C0T A;  4CGI A;  4E1M A;  3EYZ A;  3TAE A;  3K59 A;  1NJZ A;  1U49 A;  4FK0 A;  4PUO A;  4DQP A;  3T1A A;  4HCB A;  3VQD A;  1L3T A;  1WSJ A;  3AA2 A;  3AO3 A;  4Q5V A;  1TAU A;  4CHY A;  2Z1I A;  3NE6 A;  3QEX A;  4OKK A;  2QKK A;  2HHX A;  2G8V A;  4YFU A;  1ZBL A;  4CJE A;  4PQU A;  3LAK A;  4JS4 A;  4CCH A;  4Y1D A;  1GOB A;  1IKW A;  3HST B;  3K5O A;  2FC0 A;  4H4M A;  3T3F A;  4RW8 A;  2G8H A;  3VQ7 A;  3LZI A;  1BI4 A;  1JKH A;  3E01 A;  5C42 A;  4KV8 A;  1JLB A;  2O4I A;  1RIL A;  3BGR A;  2VWJ A;  4B9U A;  4LH4 A;  2KW4 A;  2OPS A;  3F73 A;  4FJM A;  4KHQ A;  4J2E A;  1JL1 A;  1LWE A;  3AVC A;  3ULD A;  4BWJ A;  3ZT1 A;  5HP1 A;  4KB1 A;  5FDL A;  4CED A;  1SKW A;  3TAF A;  1G15 A;  1XI1 A;  1T05 A;  3O3H A;  1NKB A;  4IBN A;  1BCO A;  3QEW A;  1CLQ A;  4HUE A;  2QK9 A;  1NK4 A;  1I39 A;  2BDP A;  2HNY A;  3NF8 A;  2P1J A;  3V81 A;  3LZJ A;  1CZB A;  1RT4 A;  2ITG A;  3AVK A;  3C6U A;  5HRS A;  4Z4F A;  1VSI A;  4W5T A;  1SL0 A;  1NOZ A;  2IAJ A;  4AHV A;  4M3Z A;  4EP4 A;  1S6P A;  3KLF A;  3MEC A;  3LAL A;  1X9S A;  2HW3 A;  2KFN A;  3AVH A;  1NK5 A;  1W0H A;  4IG0 A;  4HUG A;  3G10 A;  4CHN A;  1L3V A;  4CGG A;  4BDY A;  4IFV A;  4RW7 A;  4HUF A;  4FJ8 A;  2IGI A;  3L8B A;  4CJF A;  3ZT4 A;  3DLR A;  5EU7 A;  3AVF A;  4UQG A;  4C8O A;  3AO1 A;  1O1W A;  4B8A B;  1LAW A;  4CK1 A;  1JLG A;  2EX3 A;  3NH0 A;  3OYE A;  3PUF A;  5KI6 A;  3ZSO A;  2FBX A;  1JLA A;  2HNZ A;  4CJR A;  3V9S A;  3V6D A;  1L5U A;  4F8R A;  1IKV A;  4FLX A;  1FKO A;  3SPY A;  1NJX A;  1NKE A;  2KZM A;  4QAG A;  1BL3 A;  4I7F A;  4KFB A;  4CEF A;  3SPZ A;  4DSJ A;  1YTU A;  4KRF A;  3SCX A;  4GVM A;  4IG3 A;  4ELU A;  3D0P A;  4I2P A;  3OS2 A;  3M8S A;  4DQS A;  3SJJ A;  1D9F A;  4DTX A;  3MXI A;  1WSI A;  4F3O A;  2X6S A;  4ID5 A;  4CEA A;  4FJ9 A;  4FJL A;  3VN5 A;  2DFE A;  4O0J A;  1HYV A;  2ZQB A;  1EXQ A;  2R7Y A;  4M3T A;  4Z4C A;  1GOC A;  4DSK A;  4F4K A;  3SI6 A;  1BQM A;  1S5J A;  5FRO A;  4CK3 A;  3THV A;  4F2R A;  2B6A A;  4FK4 A;  4DTJ A;  1JLF A;  4B08 A;  3V9U A;  1TK8 A;  3OYK A;  3SUQ A;  4FXD A;  3KLE A;  3NH1 A;  2HB5 A;  3TAG A;  4C8N A;  3OS1 A;  1T7P A;  1SL1 A;  3C6T A;  4B9V A;  1TKT A;  1TKD A;  4IDK A;  1SKS A;  1J5O A;  3ZT2 A;  1REV A;  2YHB A;  1B9F A;  3RR7 A;  1S6Q A;  4FCY A;  3PX0 A;  5FRN A;  1TKZ A;  2OA8 A;  1S1V A;  2OPR A;  1ZBF A;  4PWD A;  4NCB A;  1L3S A;  1KLN A;  3KD5 E;  4CJU A;  3DOK A;  3U3G A;  4Z4H A;  4CJ4 A;  3OVN A;  4IFY A;  3O3F A;  3B6O A;  5SZT A;  1QE1 A;  4K8Z A;  4CF1 A;  1FK9 A;  3CM5 A;  2HMI A;  4FJI A;  1KCF A;  3V4I A;  4BDP A;  2OZM A;  4OLA A;  3LPT A;  2XHB A;  4CGJ A;  3CM6 A;  3P1G A;  4O44 A;  3M8Q A;  4J2D A;  3F9K A;  1ITG A;  3SV4 A;  1S9E A;  3ZSY A;  4KI4 A;  3HP9 A;  4DLG A;  3H08 A;  3MEE A;  3QNO A;  3ZSR A;  1ASU A;  1GOA A;  1HRH A;  2XY8 A;  3QIO A;  4CER A;  2IOC A;  3OYM A;  3OYJ A;  4AHS A;  4CHO A;  3CQ8 A;  4DLE A;  4B9S A;  4OGC A;  3KLH A;  1YVU A;  5DMR A;  4FW1 A;  3ALY A;  1S9G A;  3AVL A;  4C8M A;  3OYD A;  1IH7 A;  3O4N A;  5J2M A;  3L2V A;  3QEI A;  3QES A;  1BIS A;  4NYN A;  1SL2 A;  1S1X A;  4AHU A;  3PX4 A;  1L3U A;  3LP2 A;  3BDP A;  1ASV A;  3NFA A;  4I9Q A;  2HHT A;  1F21 A;  1LWC A;  2G8W A;  3DOL A;  2HHQ A;  4HTU A;  4KO0 A;  1YT3 A;  3ZSX A;  1WSG A;  3CFR A;  4O55 A;  3AA4 A;  3K57 A;  3P5J A;  4FW2 A;  4DS4 A;  3RRH A;  4DF4 A;  3CFO A;  2PYJ A;  4FJ5 A;  3LP3 A;  2ETJ A; 
#chains in the Genus database with same CATH topology
 1I94 K;  3HPG A;  4C23 A;  4U7B A;  2I7P A;  3BUZ B;  3SV3 A;  4LD0 A;  4N76 A;  1LCU A;  4RG8 A;  3QBW A;  4CBX A;  1WOQ A;  3THX B;  3EEQ A;  1GLA G;  3AVB A;  4MLE A;  4KHS A;  4YDU A;  5AQP A;  3NAE A;  3I56 N;  3LDS A;  1QQC A;  4FLW A;  5AQV A;  3M3Z A;  5HRN A;  1KAZ A;  3TR8 A;  1TL1 A;  5TKW A;  1FW6 A;  1S72 N;  3OJS A;  2F8S A;  1RT1 A;  2XY7 A;  5BRH A;  3JXU A;  4LF4 K;  3SQ2 A;  4L3Q A;  1NU0 A;  3QBX A;  2VG6 A;  4JKD A;  5SWM A;  3BZK A;  3CCS N;  2XO7 A;  3PO4 A;  1NK7 A;  4B1U B;  1HNI A;  3CMA N;  2WOM A;  4CJV A;  5BRD A;  2WTU A;  4BAC A;  1QVG M;  1RNH A;  5GAG P;  1GLC G;  4CES A;  2OZS A;  1TK5 A;  1B9D A;  4CFB A;  4DF8 A;  1TAQ A;  3K2P A;  3L2R A;  5JS2 A;  4BR7 A;  1U04 A;  4BRP A;  4CGH A;  2ASP A;  5LMN K;  2HBL A;  3IUC A;  4V19 S;  4YOT A;  1RT2 A;  4LFA K;  3S3N A;  1HNW K;  3ENO A;  4DR5 K;  5CYM A;  5J2N A;  1J53 A;  3HOS A;  1X1P A;  2P5O A;  1HKG A;  4KHU A;  2O8D A;  4I6M A;  2RN2 A;  3SBG A;  1HX1 A;  2XRI A;  1SUQ A;  4JKG B;  1YVN A;  2ZJR L;  4CJ7 A;  5AQO A;  2HHU A;  1HQU A;  4JKE A;  4HHT A;  2VG5 A;  2ATQ A;  3OYA A;  4CEZ A;  1U2V B;  4N47 A;  4ISE A;  1VSD A;  3O5B A;  4FWK A;  4Q0B A;  1IG9 A;  1CZA N;  4G1Q A;  4ILG B;  1RT6 A;  3ZCM A;  4CEO A;  2IVO A;  4FO0 A;  4CZJ A;  4Z4E A;  3HVR A;  4FZX C;  1RTI A;  4X66 K;  3F2K A;  3CG7 A;  3B6P A;  4DSE A;  3CER A;  1TUU A;  1SS6 A;  5F1X A;  3CJ9 A;  4WQ5 A;  5AQM A;  4CJQ A;  3AO2 A;  4LSN A;  1QZ6 A;  3SZ2 A;  1VQL N;  4DUY K;  3VQ9 A;  3PSF A;  3SYZ A;  1Z26 A;  4ZTF A;  3L2U A;  4KTQ A;  2VYP A;  3O6W A;  3TAM A;  2P5G A;  4X65 K;  3S9H A;  3D45 A;  3V9W A;  3ZYY X;  5KQ8 A;  2GUP A;  4N41 A;  1T44 A;  3C6H A;  3P39 A;  4HVJ A;  2KKZ A;  4BGA A;  3PIP L;  2QM1 A;  1QZ5 A;  3IFR A;  3AVI A;  2YNG A;  1KFD A;  3DI6 A;  3F5T A;  4CIE A;  4DQR A;  3C7N A;  1XMQ K;  4FPB A;  3U6F A;  4FWM A;  4EZ9 A;  2E88 A;  1A5V A;  2DY4 A;  1DT9 A;  4BR4 A;  4HWI A;  1HMV A;  4DFJ A;  4NCG A;  3MEG A;  2A5X A;  3OYN A;  4YOV A;  1LV5 A;  2VGM A;  4FSV A;  2ZJP L;  4H0T B;  4F9O A;  1VRU A;  3NDK A;  1VSF A;  4CEC A;  4OKJ A;  4EFH A;  4O4G A;  3AO4 A;  3LDO A;  5CE3 A;  1ZBH A;  3HTV A;  2E4L A;  1XHZ A;  2IS3 A;  1D4X A;  3VF2 A;  1TVR A;  5AQU A;  4DV7 K;  4BVO A;  3A5M C;  3VA3 A;  4GMJ B;  3LDQ A;  1Q9X A;  1NGE A;  3R3L A;  1IKX A;  2W41 A;  5AQI A;  4B8C A;  4K0K K;  3WXL A;  1U4B A;  2P9S A;  1GLJ O;  5JVH L;  5JLH A;  3NCI A;  2V52 B;  4JI2 K;  2QKB A;  2RE2 A;  3A5N C;  1T8E A;  3E66 A;  1NK6 A;  1D5A A;  5EVZ A;  3DLL L;  1NGA A;  3V9Z A;  3IKM A;  2G8I A;  3HPO A;  2CGL A;  3O9T A;  3QDK A;  4L8R B;  1TV6 A;  2F9W A;  2Y1J A;  1C6V A;  2W40 A;  3T19 A;  4LY7 A;  3RWU A;  3TI0 A;  4DU4 A;  3WNH A;  2E6M A;  4IFE A;  4CF2 A;  2Q1N A;  4M42 A;  3DLK A;  2QWM A;  3A5L C;  4FJJ A;  2HHV A;  1VK0 A;  3AY9 A;  1K8K A;  4MDA A;  5LY3 A;  2B5J A;  4W5R A;  4CJ5 A;  4PA1 A;  1UA0 A;  4MFB A;  5DM6 L;  3LP0 A;  5ADX H;  3L3V A;  2NLX A;  1NG9 A;  4DTN A;  1Q7Y O;  3NF9 A;  1VAZ A;  3A5O C;  4WFN L;  1KVC A;  4AM7 A;  4EZ6 A;  3CCE N;  4WFB L;  1WN7 A;  3EN9 A;  1VQN N;  3DXK A;  3V9X A;  4ISF A;  1EWQ A;  2G8F A;  2YKN A;  4LSL A;  3VQQ A;  4DQQ A;  5AFU A;  4WYB A;  5KGW A;  3PIO L;  4RWT A;  3QIC A;  2FF3 B;  2E2P A;  3KJV A;  1SKR A;  3TPQ A;  1ATR A;  3TTF A;  5C12 A;  2DTU A;  2EHG A;  2HHX A;  4GW6 A;  3EYZ A;  1C0T A;  3KZB A;  2O8B B;  4M63 C;  4HCB A;  3VQD A;  3AO3 A;  3GG4 A;  3NE6 A;  3QEX A;  4DKW A;  3H3N O;  1IKW A;  3BY5 A;  1NGD A;  1NGG A;  2P9P B;  2QTD A;  3K5O A;  2F4V K;  4H5R A;  4OX9 K;  1BI4 A;  1JKH A;  4DV0 K;  1JLB A;  2O4I A;  1RIL A;  2ZWH A;  5BN8 A;  4KHQ A;  1JL1 A;  4BWJ A;  2A6A A;  3ZT1 A;  4GV9 A;  5FDL A;  1YXQ A;  1NKB A;  3O3H A;  4IBN A;  2ZGY A;  3FZL A;  1CLQ A;  2QK9 A;  3B8A X;  2UXB K;  4JI4 K;  3NF8 A;  2CH5 A;  2ITG A;  5HRS A;  1SL0 A;  4W5T A;  4AHV A;  4EP4 A;  1S6P A;  3KLF A;  3ZX0 A;  4BR9 A;  1W0H A;  4IG0 A;  4HUG A;  4FJ8 A;  2IGI A;  4CJF A;  2YHX A;  3AVF A;  4UQG A;  2QEX N;  4CK1 A;  3O9S A;  1ZXO A;  3PUF A;  5KI6 A;  1JLA A;  2Q97 A;  1FKO A;  3SPY A;  1NJX A;  1ATN A;  4I7F A;  4KFB A;  5AJ3 K;  5CHI A;  4GVM A;  3SCX A;  1OH7 A;  4ELU A;  4I2P A;  1D9F A;  1WSI A;  2X6S A;  4RCH A;  3UB5 A;  4CEA A;  1WB9 A;  5KQD A;  3AAP A;  4FJL A;  4WCE L;  3L0Q A;  1EXQ A;  2O8C B;  4DR1 K;  5AZJ A;  4DSK A;  5FRO A;  4H0Y B;  2B6A A;  1ATS A;  4DTJ A;  2OCE A;  4B3M K;  1TK8 A;  4FXD A;  3KLE A;  3LL3 A;  3O9U A;  4WFA L;  3OHR A;  4BC5 A;  4DV4 K;  5FRN A;  3RR7 A;  2CH6 A;  3VEZ A;  4PWD A;  1IBL K;  3CJA A;  2P9K A;  4CJU A;  3CC7 N;  3OVN A;  3B6O A;  4K8Z A;  5AQY A;  1IJJ A;  4CF1 A;  3CC2 N;  1KCF A;  4BDP A;  4OLA A;  4KH4 A;  1K9M O;  4IDH A;  4J2D A;  4B1X B;  3F9K A;  1ITG A;  1HNZ K;  4BQL A;  1S9E A;  3ZSY A;  4KI4 A;  4B3R K;  3CCM N;  3CQ8 A;  1U6Z A;  4BRD A;  3VEY A;  4FW1 A;  1N33 K;  3OYD A;  1IH7 A;  3QES A;  3VGL A;  3THY B;  3BDP A;  1ASV A;  4I9Q A;  5AZI A;  2J4R A;  4JKC A;  2HHQ A;  1WSG A;  3CFR A;  4UY8 O;  3D2E A;  3P5J A;  3CFO A;  4FJ5 A;  4JV5 K;  2ETJ A;  2QWO A;  3SAH A;  4E19 A;  2O8E B;  2HST A;  4CJ3 A;  1DTQ A;  4K25 A;  1A5W A;  1QSY A;  3AA5 X;  2HND A;  2P9P A;  3AGR A;  5C10 A;  1EKE A;  1K8A O;  3VQP A;  4BC2 A;  4OVL A;  4CZE A;  4QS8 A;  1QQM A;  1JLC A;  1ZBI A;  4B9T A;  3SK3 A;  4DTO A;  3VQ5 A;  1J5E K;  2KLA A;  4J2B A;  4JAX A;  4R79 A;  3GE1 A;  3JYT A;  2V7Y A;  3DLH A;  2WON A;  5AQT A;  1NGH A;  2IVN A;  3VF6 A;  3AA3 A;  1WNS A;  1RDB A;  5LJW A;  4LF7 K;  3HYF A;  1YTA A;  4DS5 A;  3KWG A;  1RDU A;  5K14 A;  1A5X A;  5AQJ A;  3ZSW A;  4QS7 A;  4M3R A;  2Y1I A;  2NRH A;  1LW2 A;  4CE9 A;  1QVF M;  1YJW N;  3RMD A;  3A2F A;  1NLV A;  4JN4 A;  4QCL A;  3CIP A;  3HM8 A;  3CI5 A;  3ENB A;  3L2Q A;  1BQN A;  2D0C A;  5BRE A;  1B92 A;  4IOC L;  3DYA A;  4IJN A;  3O4Q A;  1WAJ A;  4HCC A;  2O8C A;  3LDL A;  4F3T A;  1DLO A;  3RMA A;  3C65 A;  3DXM B;  4X62 K;  1HR0 K;  2BTF A;  2NUB A;  1NM1 A;  2HOE A;  2F96 A;  1IG8 A;  4BE2 A;  1VSJ A;  1N6Q A;  3BF1 A;  1BGX T;  5AFU H;  1N32 K;  1G99 A;  3C95 A;  3OS0 A;  2WUS A;  4FL9 A;  4DU1 A;  3HZ6 A;  3CCL N;  1VSL A;  3QML A;  3C6A A;  3KIO A;  4KHP K;  3SQ4 A;  2YNI A;  2NRZ A;  3O9Q A;  5H1S Q;  4AHT A;  2OTJ N;  5KRT A;  4HTL A;  3D2F B;  1J9A A;  3NBP A;  3NHG A;  2F8T A;  2CGJ A;  2A1S A;  4EP5 A;  5HLF A;  2FBT A;  3DWL A;  5CYQ A;  3HJF A;  3ZEU A;  1N5Y A;  4QOZ B;  2JWK A;  4LF8 K;  4AM6 A;  5GIO A;  3THY A;  4BRG A;  4FJK A;  3HT3 A;  4K8X A;  4LF9 K;  4KHW A;  2HVI A;  1WSH A;  3NVM A;  2D5R A;  3KLG A;  5GAD P;  5KTQ A;  4O8K A;  2IDO A;  1ZC6 A;  3OYF A;  3QIP A;  2P9L B;  4WF9 L;  2DFH A;  2RF2 A;  4BR2 A;  4AHR A;  4BG8 A;  4OPJ A;  1C1A A;  2YKM A;  5M1P A;  3DJC A;  4ICL A;  5C0Y A;  3QEP A;  2FBY A;  4E3S A;  4FLY A;  4J8F A;  4CI6 A;  5CY4 A;  3RTV A;  4O0I A;  1W2B M;  4CFC A;  1RT5 A;  3ITH A;  3WUH A;  5CZ1 A;  3DLG A;  4DB3 A;  3MN9 A;  1VQK N;  1RBR A;  2FF6 A;  1C1B A;  3MN7 A;  4H4O A;  3AO5 A;  4M3X A;  4DR6 K;  2W6L A;  4A62 A;  4DTS A;  1HQE A;  5IWA K;  2G8K A;  3CYM A;  5J1E A;  5AQZ A;  5HRP A;  2YNH A;  3M5R A;  1HYZ A;  3NF6 A;  3UIQ A;  1KVB A;  3EZ5 A;  2I5J A;  1MU2 A;  3U4L A;  4DTM A;  4ID1 A;  2HBM A;  3LDP A;  1YHQ N;  2GV9 A;  1N34 K;  4EHU A;  4FJ7 A;  3VA0 A;  1NK0 A;  4FJX A;  1RBT A;  3R6M A;  3WNF A;  2YNF A;  5DK5 A;  3AAQ A;  1YJN N;  4JI6 K;  4ISG A;  3HP6 A;  4LFB K;  1XC3 A;  3TSP A;  3UKR B;  2E6L A;  4GY2 B;  4BE1 A;  1W97 L;  5DM7 L;  2XY5 A;  1NK9 A;  1TYQ A;  1UWB A;  1NK8 A;  3RVC A;  1TKX A;  1VSK A;  4OPH A;  4FK2 A;  5J2P A;  2GX9 A;  3E1Y A;  2P9U B;  3FE1 A;  3MCA B;  4ELV A;  5FPM A;  2KTQ A;  2O8F B;  2E2Q A;  3S3M A;  5BR8 K;  3KKS A;  1X9M A;  4Z4I A;  5FPN A;  3TTD A;  3CET A;  4KTW A;  5HRO A;  1NGC A;  4DSI A;  2PZS A;  2AJQ A;  4B1V A;  3FZF A;  4FZZ A;  1X9W A;  4K43 A;  1S3X A;  2H3G X;  3O3G A;  3SAG A;  3BEX A;  2YHA A;  2RKI A;  3ZET B;  4CZI A;  4CF0 A;  2QWR A;  4DTU A;  3RR8 A;  3H3O B;  1NMD A;  4FLZ A;  1QTM A;  1XNR K;  2VG7 A;  5JS1 A;  4BVP A;  4IEI A;  2JGU A;  5F0X A;  3SLC A;  1VQ4 N;  4ZHR A;  3VTH A;  3CME N;  3J8A A;  4DHY A;  4GKK K;  4CW7 B;  4CJT A;  3OYC A;  3THX A;  4NXM K;  4CFD A;  3K58 A;  4JKB A;  1BCM A;  1E4F T;  3MMV A;  4CJP A;  4A61 A;  4FWO A;  4E89 A;  3S3O A;  1QHA A;  2F7T A;  3C0B A;  1HPZ A;  4KBO A;  1WSF A;  3DLE A;  2PYL A;  5C15 A;  4KHN A;  1HJR A;  2NNW A;  2B4J A;  4NCA A;  3I0S A;  3QIN A;  4E0D A;  1NJZ A;  2P9I B;  4E1M A;  3H1Q A;  4YOY A;  3TAE A;  3K59 A;  1NGJ A;  3H6E A;  4DQP A;  5HOO A;  4DCH A;  1TAU A;  4Q5V A;  2BH1 A;  3O4W A;  3O9R A;  4YFU A;  3MK6 A;  4Y1D A;  1GOB A;  3SBT A;  2FC0 A;  2G8H A;  4RW8 A;  4JI8 K;  2E20 A;  3E01 A;  5B8H A;  4KV8 A;  5M1F A;  2VWJ A;  4H5W A;  2KW4 A;  4CD3 A;  3F73 A;  5HP1 A;  3ULD A;  3AVC A;  3UKR A;  4KB1 A;  3R9P A;  2EWS A;  3VEV A;  4OPA A;  3TAF A;  4HUE A;  1I39 A;  3R8E A;  1CZB A;  4BRH A;  4Z4F A;  2VCP A;  1NOZ A;  2OAN A;  3MEC A;  3AVH A;  3JS6 A;  3N4P A;  2O8F A;  4CHN A;  4BDY A;  4BRN A;  2Q2R A;  3DLR A;  5EU7 A;  1VQ9 N;  1T6C A;  3AO1 A;  5AQL A;  2I7N A;  1KXP A;  1L5U A;  4F8R A;  2HNZ A;  5BR9 A;  3V6D A;  1KAX A;  4FLX A;  2Q0R A;  4XEI A;  5F2R A;  4JKG A;  4QAG A;  1BL3 A;  4DSJ A;  4IG3 A;  2NRW A;  1BA1 A;  3D0P A;  3M8S A;  4DQS A;  4ID5 A;  4M7X A;  3ZET A;  1VQO N;  4K41 A;  1U2V A;  1HYV A;  4M3T A;  4JYA K;  5JMV A;  2ZM6 K;  2E1Z A;  3SI6 A;  5C2D A;  1BQM A;  4F2R A;  1DKG D;  1JLF A;  4B1Y B;  3V9U A;  3OYK A;  3HSC A;  3H1V X;  4C8N A;  3O1B A;  3OS1 A;  1X3M A;  3C6T A;  4B9V A;  3TTC A;  4IDK A;  1C0F A;  1SKS A;  1B9F A;  3THW B;  3PLA A;  3PX0 A;  4H0O A;  1S1V A;  4PL7 A;  4NCB A;  4YHH K;  1L3S A;  3SMS A;  4CJ4 A;  1ESV A;  1J6Z A;  5SZT A;  1FK9 A;  3CM5 A;  2OZM A;  4BC4 A;  3LPT A;  1HJO A;  4CGJ A;  4JK8 A;  3CM6 A;  4YOW A;  4O44 A;  4IOX A;  3MX5 A;  1YI2 N;  3SV4 A;  3HBT A;  3HP9 A;  4A5A A;  3OYM A;  3QIO A;  4CER A;  2IOC A;  3G6E N;  3O08 A;  4DLE A;  4B9S A;  2ZGZ A;  4OGC A;  3KLH A;  1YVU A;  5EX5 A;  3M6G A;  5DMR A;  4CVN E;  3ALY A;  3AVL A;  3VER A;  2F9T A;  2ITM A;  3L2V A;  4NYN A;  1S1X A;  1X3N A;  1RFQ A;  4AHU A;  1L3U A;  3LP2 A;  4BRC A;  3NFA A;  1F21 A;  4KO0 A;  4FOI A;  3K57 A;  3GOI A;  4DS4 A;  5E84 A;  3OW2 M;  5IT9 O;  2A41 A;  1XHX A;  4MQ3 A;  1BWF O;  2E2N A;  2E5L K;  1XWL A;  1Q8I A;  4FWP A;  5CR4 A;  4FM1 A;  3EKS A;  2QA4 N;  1DEJ A;  3CJ7 A;  1DGK N;  3OYB A;  3QFP A;  1Z05 A;  1CXQ A;  4BRL A;  3LWM A;  4CJK A;  4GV6 A;  4CGF A;  3I55 N;  3K5N A;  5E41 A;  4KH6 A;  4H0X B;  3H45 C;  4N56 A;  2YI1 A;  4YY3 K;  2FSK A;  1OH6 A;  1FJG K;  1WSE A;  3CJB A;  1RDW X;  4FWR A;  2GTD A;  4DQ8 A;  2FSJ A;  2NRV A;  5E26 A;  3RMC A;  3EO3 A;  4M3U A;  4A57 A;  5C25 A;  2OYQ A;  4M41 A;  4GVE A;  4OJR A;  2ZF5 O;  3PX6 A;  4ZTJ A;  2YV0 X;  3LM9 A;  3TWH A;  4JRQ A;  3LM2 A;  5BPL A;  5I3U A;  3WNE A;  4FWL A;  3SQ1 A;  2VQF K;  2XY6 A;  1C0M A;  4JK7 A;  5BPM A;  4MDB A;  4RW9 A;  3Q7B A;  2IVP A;  4DSF A;  1GLD G;  4R5P A;  3SUP A;  2OPQ A;  4X64 K;  1EET A;  3ZLJ A;  3SAF A;  3NH2 A;  3FLC O;  4K42 A;  1KRP A;  3AVG A;  3CHW A;  4JI0 K;  3VQA A;  3V1R A;  3EL2 A;  2CGK A;  4JS5 A;  3MX2 A;  2HF3 A;  4IJA A;  4GV3 A;  3OY9 A;  1RT3 A;  1YF5 L;  4KRE A;  2UU9 K;  3DMJ A;  3FFI A;  2YCH A;  3BP8 A;  3K0S A;  2DFF A;  4YNQ A;  4CEE A;  3CCJ N;  3WNG A;  2JLE A;  3LPU A;  4KI6 A;  4LFC K;  2GBZ A;  5KGX A;  3CJ1 A;  3CCV N;  4RW4 A;  3W3D A;  3RRG A;  3KVG A;  1RDD A;  3VQ8 A;  1JJ2 M;  2NZT A;  4OLB A;  4ILH A;  1JXE A;  1YIT N;  1QHT A;  4PL8 A;  4DV5 K;  4W5N A;  1RBS A;  4MLH A;  1VSE A;  2PY5 A;  1QS4 A;  4M3Y A;  3O1W A;  1UA1 A;  5AQS A;  1ZYQ A;  1WLJ A;  1YIJ N;  1HLU A;  1S1T A;  1LAV A;  1RTH A;  1RBU A;  4M7Y A;  4DV1 K;  1WBB A;  1JLE A;  1OH8 A;  2O8B A;  4B1W B;  3WXK A;  4KH5 A;  3GDQ A;  4DU3 A;  5FRM A;  3ZX2 A;  3DAW A;  4B9Q A;  4J2A A;  4B3T K;  1C0G A;  3O80 A;  3VQ6 A;  1FKP A;  3ZSV A;  4PKH A;  1NJW A;  3OYH A;  5J2Q A;  4KHY A;  3M8P A;  2X78 A;  4AF1 A;  3T1Y K;  2Q3S A;  4KPY A;  1BG3 A;  3I8B A;  1EO1 A;  5BRF A;  3CJC A;  4FVM A;  4B3O A;  3AGK A;  3UKU B;  1EP4 A;  4CD1 A;  3F9M A;  5C2F A;  1KFS A;  3SJH A;  3OYI A;  4CIF A;  3HM9 A;  3RMB A;  3LAN A;  3EE9 A;  1VQP N;  4B3S K;  1MDU B;  1BUP A;  2FBV A;  4CZH A;  1Z25 A;  2WFB A;  3IMX A;  2GWJ A;  4XH5 A;  3PY8 A;  1FXX A;  2BGG A;  4LH5 A;  3PSI A;  1DTT A;  2E1Y A;  2AA4 A;  3J81 O;  4BG9 A;  3FZM A;  4DWI A;  1NJI O;  1UOC A;  2YJE A;  2O4G A;  4PHT X;  1RT7 A;  4DR3 K;  3U9D A;  3SQ0 A;  4H8K A;  3CPE A;  3DRP A;  3L6Q A;  1HYS A;  3MXM A;  3T7Z A;  3NGI A;  1VSH A;  3CD6 N;  3P38 A;  4DQI A;  4DFK A;  2PAV A;  4FLU A;  1R0A A;  4OPK A;  3K5M A;  4IOA L;  2ZD1 A;  4XIU A;  3EY1 A;  1BIU A;  1JXB A;  4KTZ A;  3AVM A;  3VGK A;  4OGE A;  3NGY A;  4CFA A;  4EHT A;  1UAX A;  5LL6 Z;  4Z94 A;  3MAQ A;  4B9L A;  5EY4 A;  5HRR A;  1NBW A;  1RCH A;  2UYT A;  3MN6 A;  4IO8 A;  4BRQ A;  2RHK A;  4DR4 K;  1LWF A;  4BRF A;  4B9M A;  4DR2 K;  4I2Q A;  4FM0 A;  3FZK A;  4BGB A;  3SUO A;  3MWT A;  3IS9 A;  4CEB A;  3HXM A;  5HBM A;  4CF8 A;  5GIN A;  2GEL A;  1GLL O;  2NRT A;  3OYL A;  1XMO K;  1QSS A;  1XUP O;  2HHS A;  2WC9 A;  1BU6 O;  2X74 A;  3VMF B;  3CCQ N;  4E7L A;  3NVK A;  3OA9 A;  2BE2 A;  3L2W A;  2G8U A;  2FLO A;  1H1V A;  4FLT A;  1KLM A;  3AVN A;  4PKI A;  1XQS C;  3QER A;  3HK2 A;  3T69 A;  2O8D B;  4WE1 A;  5JLF A;  1OVQ A;  4EIA A;  4FWQ A;  1MA9 B;  1Q86 O;  1IBM K;  2O8E A;  3DRS A;  3ZX3 A;  4IXC A;  1HNX K;  3U9Z A;  4FYD A;  5M1O A;  4E7K A;  4BRE A;  3TAN A;  2QW9 A;  3D6R A;  4Z0U A;  1ASW A;  2QXL A;  3KHY A;  4FWN A;  2VWB A;  3AVA A;  4H5V A;  3L4I A;  4CBW A;  2HHH K;  5FPE A;  4E7I A;  3NF7 A;  2P51 A;  4TSX A;  4CBU A;  3KKR A;  4O8U A;  4FLV A;  4IKF A;  2RPI A;  3G4S N;  3VET A;  2OPP A;  4A59 A;  5GAH P;  3SUN A;  2D0B A;  3V1Q A;  4DV6 K;  1C1C A;  5AQX A;  1NWK A;  2D0A A;  4NO7 A;  5CZ2 A;  1U49 A;  4H03 B;  1RGI A;  4FK0 A;  2A42 A;  5JVG L;  1L3T A;  3FFK B;  4CHY A;  2Z1I A;  1VQ6 N;  3WQU A;  1ZBL A;  1S22 A;  3LAK A;  4JS4 A;  4CCH A;  3T3F A;  3LZI A;  5C42 A;  3ATU A;  4LH4 A;  3WEE B;  2OPS A;  5M1Q A;  1V4S A;  1SKW A;  1XI1 A;  1G15 A;  4CZG A;  4DV2 K;  3C7N B;  4JKA A;  1NK4 A;  1T3V A;  2HNY A;  3LZJ A;  3VF4 A;  5ADX A;  4BRA A;  1WUA A;  3DXM A;  2IAJ A;  5KPZ A;  3SMP A;  4NXN K;  3LAL A;  4BR0 A;  1X9S A;  2HW3 A;  2KFN A;  5AQF A;  1KAY A;  3CCU N;  3UE5 A;  1M90 O;  4JK9 A;  4IFV A;  4RW7 A;  4HUF A;  4E1J A;  2UUC K;  3L8B A;  3HI0 A;  4FWS A;  3GL1 A;  4C8O A;  5FPD A;  1O1W A;  1E4G T;  1LAW A;  1JLG A;  2EX3 A;  3OYE A;  4CJR A;  3V9S A;  2FBX A;  1EQY A;  3ULE B;  5AQK A;  1NKE A;  4YOU A;  3D2F A;  2KZM A;  1YTU A;  4KRF A;  4XH1 A;  1XNQ K;  3OS2 A;  4DTX A;  5EXW A;  2YX6 A;  3VN5 A;  2DFE A;  4O0J A;  4DV3 K;  2R7Y A;  4BR5 A;  2Q0U A;  4Z4C A;  1GOC A;  2A3Z A;  4CK3 A;  3THV A;  4JI1 K;  3J7Z O;  4FK4 A;  4B08 A;  2P9S B;  4IWV A;  1R59 O;  2JWL A;  4QS9 A;  3SUQ A;  1N8R O;  3NH1 A;  2HB5 A;  3MN5 A;  3TAG A;  1T7P A;  1SL1 A;  3WQT A;  1TKD A;  1J5O A;  5GIP A;  1REV A;  2YHB A;  1S6Q A;  3RSE B;  1TKZ A;  1ZBF A;  5I9E B;  1KLN A;  3KD5 E;  5MLC Q;  3U3G A;  3O3F A;  4JEP A;  3P4I A;  2P9L A;  4FJI A;  3V4I A;  2XHB A;  4IEE A;  3M8Q A;  1OKJ A;  4G9Z A;  5AQN A;  3H08 A;  3MEE A;  3QNO A;  3QB0 A;  1ASU A;  4WQ4 C;  3OYJ A;  1LOT B;  3FZH A;  4AHS A;  1VHX A;  3J7A P;  4EAH D;  4C8M A;  2GWK A;  5J2M A;  4KB0 A;  1SL2 A;  3PX4 A;  4Y0W A;  3G25 A;  1LWC A;  1NGF A;  1IV0 A;  1K8K B;  1GLF O;  4O55 A;  4FW2 A;  5BPN A;  2PYJ A;  3E9O A;  1X9J A;  3LP3 A;  1BO5 O;  4FPA A;  4GKJ K;  1VQ7 N;  2A1R A;  2LSN A;  1VQ5 N;  4FM2 A;  3NGZ A;  5AR0 A;  5AQW A;  1Q82 O;  1U45 A;  4W5Q A;  3WEE A;  3DXK B;  3BZC A;  3KK3 A;  1YAG A;  3LWL A;  3WXJ A;  3P83 D;  4LC9 B;  4CZK A;  4U67 L;  2ZE2 A;  3G0Z A;  1Q9Y A;  1EX4 A;  3VEX A;  2Q31 A;  4CJL A;  1HUX A;  1RDC A;  4AQY K;  3HL8 A;  3ZSQ A;  3HOT A;  4DSL A;  1T03 A;  3VQ4 A;  4BWM A;  1TK0 A;  4H5N A;  1V4T A;  4C1N I;  4CHP A;  3K9J A;  1VRT A;  4E7J A;  2Z1J A;  4FOE A;  1IBK K;  1T6D A;  2YJF A;  1KC8 O;  3VQE A;  3CCR N;  2P9U A;  3KTQ A;  2HHW A;  1SV5 A;  4DFM A;  2YHY A;  1K6Y A;  1BHL A;  4PY5 A;  4A5B A;  3MXJ A;  3ULE A;  4XH4 A;  3IRX A;  1BI4 B;  2D0O A;  4RW6 A;  1D8Y A;  3ZSZ A;  2Z1G A;  5AQH A;  4FJN A;  4H5T A;  4CIG A;  3CF5 L;  3U3Y A;  4JLH A;  4Z4G A;  4LF6 K;  3TSU A;  1RDA A;  1NGB A;  1QQO A;  4N5S A;  4ELT A;  3BF3 A;  4FJH A;  2PBD A;  4E1N A;  4B1Z A;  4NYF A;  3WXM B;  4O5B A;  3E9L A;  3J7Y P;  3KWI A;  3L3U A;  1M1K O;  2UXD K;  3TAP A;  5LMU K;  4C8K A;  2HMP A;  4CHZ A;  4JD2 B;  3KK7 A;  3RSE A;  2P9N B;  4I9L A;  4CHQ A;  5FLX O;  4AH9 A;  5T7B A;  3R1X A;  2BAN A;  4DFP A;  5HL7 L;  1TL3 A;  1SZ2 A;  4A2A A;  1Q18 A;  1YUW A;  3QEV A;  3VQC A;  4C8L A;  4W5O A;  1JCG A;  4CEQ A;  4GNI A;  5AQG A;  2NRR A;  3CXC M;  1RTD A;  5KPR A;  5M1N A;  3IAY A;  3ISN C;  3TAR A;  2ASM A;  3MED A;  4IZ9 A;  4FZY A;  1OVY A;  2QWL A;  3DM2 A;  3M8R A;  3OYG A;  3QO9 A;  4CGD A;  5AZJ B;  3ZT0 A;  3C94 A;  4JI3 K;  2VGN A;  1RTJ A;  3WXI A;  2QWQ A;  3D7E O;  3HO1 A;  1I3A A;  5ELZ A;  4BRI A;  3P31 A;  3Q7C A;  3AVJ A;  1O13 A;  2P9K B;  2P9I A;  1Z6R A;  2KZZ A;  1NNE A;  4CZF A;  2IIR A;  5D3G A;  4NLB A;  4CJS A;  2AP1 A;  2KQ2 A;  4JHD B;  4NLC A;  3EZW A;  1VSM A;  3DRR A;  3CC4 N;  1C0U A;  4M45 A;  3KLI A;  3V1O A;  4DG1 A;  3QET A;  3ZT3 A;  3T1H K;  4H0V B;  1U47 A;  1KD1 O;  1CXU A;  3PV8 A;  3TAQ A;  5AZI B;  3KK1 A;  3QNN A;  4JI7 K;  3OJU A;  4CZL A;  3D2E B;  2KFZ A;  1W9H A;  1NOY A;  2ZJQ L;  4KAZ A;  3PO5 A;  2V7Z A;  1XC9 A;  1LW0 A;  2Z1H A;  3L4Q A;  5LJV A;  1EWR A;  3CPW M;  1VQ8 N;  1KQS M;  4BDZ A;  1S1U A;  3KK2 A;  4YOR A;  1RBV A;  2QWP A;  3I0R A;  3VQB A;  4CF9 A;  3VTI A;  4F2S A;  1S1W A;  1CZ9 A;  3G71 N;  2W42 A;  5I42 A;  4WQ4 A;  3ENH A;  5C24 A;  1JCF A;  4DUZ K;  3FGU A;  3I33 A;  4CJW A;  4BQZ A;  2D4W A;  3LAM A;  1BIZ A;  2QXF A;  2A40 A;  3VOV A;  1J54 A;  5EOY A;  4DMN A;  3HPH A;  3M1F A;  3A8Y A;  4JD2 A;  2PFU A;  2VWK A;  4DTR A;  2P9N A;  4AHC A;  3ASM A;  4JI5 K;  1OH5 A;  1W7A A;  2D0P A;  1IO2 A;  1Q81 O;  2HF4 A;  3IG1 A;  1KVA A;  1NKC A;  3THW A;  2KHO A;  3TSQ A;  4JRP A;  4M3W A;  3IDH A;  3VES A;  1JLQ A;  3TAB A;  4KKO A;  3K5L A;  1NJY A;  1BA0 A;  4IO9 L;  4BRM A;  4DTP A;  4YDU C;  1D9D A;  4E7H A;  4NB4 A;  3ID6 A;  1WAF A;  2FXU A;  2GUI A;  3QFU A;  3MCP A;  1JL2 A;  4JKF A;  4BY9 C;  4OKE A;  4RTF D;  5KRS A;  3VEW A;  3J80 O;  3AV9 A;  4MO4 A;  3MWP A;  2X6N A;  1ZBU A;  2FSN A;  3CFP A;  3SNN A;  1E3M A;  4CK2 A;  4JNE A;  3AAR A;  4AIL C;  2BUP A;  3QLH A;  3TU5 A;  1U48 A;  3I8D A;  1NGI A;  3JSM A;  1KTQ A;  1SQK A;  3KD1 E;  2V51 B;  3HVT A;  3N4Q A;  4C1N K;  1QSL A;  2VQE K;  3ATV A;  4JHD A;  1TGO A;  1Y97 A;  2IC3 A;  3VPZ A;  3ZEU B;  3W0L A;  4BE0 A;  3VGM A;  3LP1 A;  1GLB G;  1HNV A;  3O8M A;  4Y1C A;  3DLB A;  1BDG A;  1JCE A;  1KSP A;  3E9P A;  4B9N A;  4FJG A;  1Y64 A;  1IKY A;  2W6K A;  1BOT O;  1GLE G;  3EE8 A;  5A2Q O;  4CGI A;  4PUO A;  2ASO A;  3T1A A;  1TUY A;  1WSJ A;  3AA2 A;  2UXC K;  3K9K A;  5AQQ A;  4OKK A;  2Q36 A;  4JKH A;  1HPM A;  2QKK A;  2G8V A;  4CJE A;  4MO5 A;  4PQU A;  4DR7 K;  2DPN A;  3HST B;  4H4M A;  5BN9 A;  3VQ7 A;  3CQX A;  3BGR A;  4B9U A;  1ZBS A;  4FJM A;  4J2E A;  3EKU A;  1LWE A;  3JAM O;  3NMU A;  4CED A;  1T05 A;  3QEW A;  1BCO A;  4OO1 J;  2BDP A;  2OTL N;  2P1J A;  3V81 A;  1RT4 A;  3AVK A;  3C6U A;  1NMN A;  1VSI A;  4M3Z A;  1MWK A;  1NK5 A;  1P8Z A;  3MDQ A;  3G10 A;  5TKY A;  4BRO A;  1L3V A;  4CGG A;  2UUB K;  5KPT A;  4WQ5 C;  3ZT4 A;  3GBT A;  2YHW A;  2E2O A;  4B8A B;  3NH0 A;  3ZSO A;  1IKV A;  4A2B A;  4PKG A;  4YOX A;  3FR0 A;  3ID8 A;  3VEN A;  3SPZ A;  4CEF A;  2QWN A;  2HVH A;  1SAZ A;  3SJJ A;  1WBD A;  4F3O A;  1HKC A;  3MXI A;  3A0I X;  4FJ9 A;  1TYQ B;  3WT0 A;  5GAE P;  5M1K A;  2ZQB A;  2HBJ A;  1YJ9 N;  2QI2 A;  1ILY A;  2D1K A;  4F4K A;  2HBK A;  1S5J A;  4ILJ A;  4FVU A;  1P90 A;  4O5F A;  1K73 O;  4BC3 A;  1TKT A;  4H0P A;  3ZT2 A;  4FCY A;  2OA8 A;  3OBY A;  2OPR A;  1MWM A;  3DOK A;  2E8A A;  2WBN A;  4Z4H A;  3OTO K;  4IFY A;  1HKB A;  1QE1 A;  3S41 A;  4I6M B;  3LDN A;  3CQY A;  2HMI A;  2NRX A;  3U8X A;  5JIC A;  3P1G A;  1VQM N;  3HRG A;  4DLG A;  3ZSR A;  1GOA A;  4HTU A;  1HRH A;  2XY8 A;  3H46 O;  4CZM A;  4CHO A;  2GEM A;  3VEO A;  1S9G A;  3O4N A;  3QEI A;  1BIS A;  3OBW A;  3UKU A;  2HHT A;  2G8W A;  3DOL A;  1QQN A;  1YT3 A;  3ZSX A;  4LF5 K;  3AA4 A;  4BRK A;  3RRH A;  2UUA K;  4DF4 A;  1N36 K;  5AQR A; 
#chains in the Genus database with same CATH homology
 3HPG A;  4E19 A;  1XHX A;  4MQ3 A;  4CJ3 A;  3SV3 A;  1DTQ A;  1XWL A;  2A1R A;  1Q8I A;  1A5W A;  4LD0 A;  1QSY A;  4N76 A;  3AA5 X;  2HND A;  2LSN A;  4RG8 A;  1EKE A;  4FM2 A;  4FM1 A;  3VQP A;  3NGZ A;  4OVL A;  3AVB A;  4KHS A;  1JLC A;  1U45 A;  4W5Q A;  1ZBI A;  4B9T A;  3OYB A;  3NAE A;  3KK3 A;  3LWL A;  4DTO A;  3LDS A;  1CXQ A;  1QQC A;  3LWM A;  3VQ5 A;  4FLW A;  3P83 D;  4CJK A;  4J2B A;  2ZE2 A;  3G0Z A;  5HRN A;  1EX4 A;  1Q9Y A;  3TR8 A;  1TL1 A;  4CGF A;  4CJL A;  3K5N A;  5E41 A;  3OJS A;  1RDC A;  1RT1 A;  3HL8 A;  3JYT A;  2XY7 A;  2WON A;  3DLH A;  3ZSQ A;  2F8S A;  4DSL A;  1T03 A;  4N56 A;  3VQ4 A;  4BWM A;  3AA3 A;  1TK0 A;  3SQ2 A;  1WNS A;  1WSE A;  4CHP A;  1RDB A;  1VRT A;  4E7J A;  2Z1J A;  2VG6 A;  5SWM A;  3HYF A;  3VQE A;  1YTA A;  4DS5 A;  3RMC A;  2XO7 A;  5K14 A;  3KTQ A;  3PO4 A;  4M3U A;  1A5X A;  1SV5 A;  1NK7 A;  2HHW A;  3ZSW A;  4DFM A;  4M3R A;  5C25 A;  1K6Y A;  2OYQ A;  1BHL A;  4M41 A;  1HNI A;  2Y1I A;  4OJR A;  1LW2 A;  4CE9 A;  4PY5 A;  3PX6 A;  3MXJ A;  2WOM A;  3RMD A;  4ZTJ A;  4CJV A;  2YV0 X;  3A2F A;  4BAC A;  3TWH A;  3IRX A;  1BI4 B;  4JRQ A;  4RW6 A;  1D8Y A;  4QCL A;  3ZSZ A;  1RNH A;  2Z1G A;  5I3U A;  3WNE A;  4FJN A;  4CIG A;  3U3Y A;  4JLH A;  3SQ1 A;  3L2Q A;  4Z4G A;  1BQN A;  4CES A;  2D0C A;  2XY6 A;  2OZS A;  1B92 A;  1B9D A;  1C0M A;  3DYA A;  4CFB A;  4DF8 A;  1TK5 A;  1RDA A;  1TAQ A;  3K2P A;  3L2R A;  3O4Q A;  5JS2 A;  4N5S A;  1WAJ A;  1U04 A;  4RW9 A;  4ELT A;  4HCC A;  4FJH A;  4CGH A;  4E1N A;  4NYF A;  4F3T A;  4DSF A;  3SUP A;  4R5P A;  2OPQ A;  1DLO A;  3RMA A;  4O5B A;  1EET A;  2NUB A;  2F96 A;  4BE2 A;  1VSJ A;  3L3U A;  1RT2 A;  1N6Q A;  3TAP A;  4C8K A;  1BGX T;  4CHZ A;  3C95 A;  3OS0 A;  3S3N A;  4DU1 A;  3NH2 A;  1KRP A;  3AVG A;  4I9L A;  5CYM A;  4CHQ A;  5J2N A;  1VSL A;  2HVH A;  3VQA A;  4AH9 A;  3V1R A;  5T7B A;  1J53 A;  2BAN A;  4JS5 A;  4DFP A;  3KIO A;  1TL3 A;  1X1P A;  2P5O A;  4KHU A;  3OY9 A;  1RT3 A;  3SQ4 A;  2YNI A;  4KRE A;  3QEV A;  2RN2 A;  3DMJ A;  3VQC A;  3FFI A;  4C8L A;  4W5O A;  4AHT A;  4CEQ A;  2XRI A;  1SUQ A;  5KRT A;  1J9A A;  2DFF A;  3NBP A;  3NHG A;  4YNQ A;  4CEE A;  3WNG A;  2JLE A;  3LPU A;  1RTD A;  4KI6 A;  2F8T A;  2HHU A;  1HQU A;  3IAY A;  3ISN C;  3TAR A;  3MED A;  2A1S A;  2GBZ A;  2VG5 A;  4EP5 A;  4HHT A;  5KGX A;  2ATQ A;  3OYA A;  2FBT A;  4CEZ A;  5HLF A;  4FZY A;  5CYQ A;  3HJF A;  4N47 A;  3DM2 A;  4RW4 A;  3M8R A;  1VSD A;  1N5Y A;  3OYG A;  3RRG A;  4Q0B A;  3QO9 A;  4CGD A;  4QOZ B;  1RDD A;  1IG9 A;  3VQ8 A;  3ZT0 A;  4G1Q A;  4OLB A;  1RT6 A;  3ZCM A;  3C94 A;  1JXE A;  1QHT A;  4CEO A;  4FJK A;  4W5N A;  1RBS A;  3HT3 A;  1RTJ A;  1VSE A;  2PY5 A;  4K8X A;  4Z4E A;  3HVR A;  1QS4 A;  4FZX C;  4M3Y A;  1RTI A;  4KHW A;  1UA1 A;  2HVI A;  3CG7 A;  3B6P A;  1WSH A;  4DSE A;  3HO1 A;  1I3A A;  2D5R A;  3KLG A;  1ZYQ A;  1WLJ A;  5KTQ A;  1S1T A;  4CJQ A;  3AVJ A;  1LAV A;  1RTH A;  3AO2 A;  4LSN A;  1RBU A;  1JLE A;  2KZZ A;  3SZ2 A;  2IDO A;  4KB0 A;  3OYF A;  3QIP A;  4DU3 A;  5FRM A;  2DFH A;  5D3G A;  2RF2 A;  3VQ9 A;  4AHR A;  4CJS A;  1Z26 A;  4OPJ A;  3L2U A;  3SYZ A;  4ZTF A;  4KTQ A;  4J2A A;  3VQ6 A;  3TAM A;  2P5G A;  1FKP A;  2KQ2 A;  1C1A A;  2YKM A;  3ZSV A;  4ICL A;  3D45 A;  3S9H A;  1NJW A;  3V9W A;  3OYH A;  5J2Q A;  4KHY A;  3M8P A;  4N41 A;  1VSM A;  3DRR A;  2X78 A;  2FBY A;  4E3S A;  3QEP A;  2Q3S A;  1C0U A;  4HVJ A;  4FLY A;  4M45 A;  4KPY A;  3KLI A;  3V1O A;  4DG1 A;  3AVI A;  5CY4 A;  2YNG A;  3RTV A;  1KFD A;  4O0I A;  3DI6 A;  3QET A;  4CFC A;  3ZT3 A;  1RT5 A;  3ITH A;  4FVM A;  1U47 A;  4B3O A;  5CZ1 A;  3DLG A;  1CXU A;  4CIE A;  1EP4 A;  4DQR A;  3PV8 A;  3TAQ A;  1RBR A;  3U6F A;  1KFS A;  3KK1 A;  3QNN A;  4EZ9 A;  1C1B A;  4H4O A;  3AO5 A;  3OYI A;  1A5V A;  4CIF A;  3OJU A;  3HM9 A;  4E0D A;  4M3X A;  3RMB A;  1W9H A;  3LAN A;  1NOY A;  2KFZ A;  2DY4 A;  4KAZ A;  3PO5 A;  4DTS A;  1HQE A;  1XC9 A;  1HMV A;  1LW0 A;  2Z1H A;  4DFJ A;  2G8K A;  3CYM A;  4NCG A;  5J1E A;  3MEG A;  2FBV A;  3OYN A;  5HRP A;  2YNH A;  1Z25 A;  1HYZ A;  1LV5 A;  3NF6 A;  3UIQ A;  4BDZ A;  1S1U A;  1KVB A;  3EZ5 A;  2I5J A;  1MU2 A;  1FXX A;  3KK2 A;  4DTM A;  4LH5 A;  3PY8 A;  4ID1 A;  1DTT A;  2BGG A;  1RBV A;  1VRU A;  3I0R A;  2GV9 A;  4DWI A;  3VQB A;  1UOC A;  4CF9 A;  3NDK A;  3VA0 A;  1VSF A;  1NK0 A;  2O4G A;  4FJ7 A;  1RT7 A;  4F2S A;  1S1W A;  4OKJ A;  4CEC A;  4FJX A;  1RBT A;  1CZ9 A;  4O4G A;  3WNF A;  2YNF A;  3AO4 A;  4H8K A;  2W42 A;  3SQ0 A;  5DK5 A;  2E4L A;  5I42 A;  1XHZ A;  1ZBH A;  2IS3 A;  3DRP A;  1HYS A;  5C24 A;  3HP6 A;  3MXM A;  1TVR A;  3NGI A;  4CJW A;  4BE1 A;  2E6L A;  1VSH A;  3LAM A;  2XY5 A;  1NK9 A;  3VA3 A;  4GMJ B;  1UWB A;  4DQI A;  4DFK A;  1NK8 A;  1Q9X A;  1BIZ A;  2QXF A;  1R0A A;  4FLU A;  1TKX A;  1J54 A;  4OPK A;  1IKX A;  1VSK A;  4DMN A;  4B8C A;  3K5M A;  3HPH A;  2ZD1 A;  4FK2 A;  5J2P A;  2VWK A;  4XIU A;  1U4B A;  4DTR A;  4AHC A;  4ELV A;  3EY1 A;  3NCI A;  1BIU A;  1JXB A;  3ASM A;  4KTZ A;  2KTQ A;  3AVM A;  1IO2 A;  4OGE A;  3S3M A;  3NGY A;  3IG1 A;  1KVA A;  1UAX A;  4CFA A;  1NKC A;  2QKB A;  3MAQ A;  4B9L A;  3KKS A;  1X9M A;  4JRP A;  5HRR A;  4Z4I A;  4M3W A;  1RCH A;  1T8E A;  1NK6 A;  1JLQ A;  4KTW A;  1D5A A;  3TAB A;  1LWF A;  5HRO A;  4B9M A;  4KKO A;  3K5L A;  4I2Q A;  3V9Z A;  4DSI A;  2PZS A;  4FM0 A;  2AJQ A;  1NJY A;  4DTP A;  3SUO A;  3IS9 A;  4CEB A;  3HXM A;  1X9W A;  4FZZ A;  2G8I A;  3HPO A;  5HBM A;  4CF8 A;  1D9D A;  3O3G A;  4E7H A;  4L8R B;  1TV6 A;  1WAF A;  2YHA A;  2Y1J A;  2RKI A;  1C6V A;  2GUI A;  3T19 A;  3OYL A;  4CF0 A;  1JL2 A;  4LY7 A;  3RWU A;  1QSS A;  3TI0 A;  2HHS A;  4DU4 A;  4OKE A;  3WNH A;  5KRS A;  4DTU A;  3RR8 A;  2X74 A;  4E7L A;  2E6M A;  1QTM A;  4FLZ A;  3AV9 A;  2BE2 A;  3L2W A;  2VG7 A;  4CF2 A;  4M42 A;  5JS1 A;  2X6N A;  2G8U A;  3DLK A;  1ZBU A;  3CFP A;  3SNN A;  4FJJ A;  4FLT A;  2HHV A;  1KLM A;  1VK0 A;  3AVN A;  4CK2 A;  3QER A;  4AIL C;  3HK2 A;  2JGU A;  3QLH A;  2B5J A;  4W5R A;  4WE1 A;  4CJ5 A;  3I8D A;  4PA1 A;  1U48 A;  3JSM A;  1KTQ A;  4MFB A;  1UA0 A;  3KD1 E;  3LP0 A;  3L3V A;  3DRS A;  3HVT A;  4ZHR A;  4DTN A;  3NF9 A;  1QSL A;  4CJT A;  1KVC A;  3OYC A;  4FYD A;  1TGO A;  4E7K A;  3TAN A;  1Y97 A;  4EZ6 A;  2IC3 A;  1WN7 A;  4Z0U A;  1ASW A;  4CFD A;  3K58 A;  3AVA A;  3V9X A;  4BE0 A;  2G8F A;  1BCM A;  2YKN A;  4LSL A;  3LP1 A;  3VQQ A;  3NF7 A;  4E7I A;  4DQQ A;  1HNV A;  2P51 A;  4TSX A;  3KKR A;  4CJP A;  4Y1C A;  3DLB A;  4FLV A;  4IKF A;  5KGW A;  2RPI A;  1KSP A;  4E89 A;  3S3O A;  4B9N A;  4FJG A;  2OPP A;  1HPZ A;  3KJV A;  1WSF A;  3SUN A;  3DLE A;  1SKR A;  2D0B A;  3V1Q A;  2PYL A;  4KHN A;  1IKY A;  1HJR A;  1C1C A;  2DTU A;  2EHG A;  2B4J A;  4NCA A;  3I0S A;  4GW6 A;  2D0A A;  3QIN A;  5CZ2 A;  1C0T A;  4CGI A;  4E1M A;  3EYZ A;  3TAE A;  3K59 A;  1NJZ A;  1U49 A;  4FK0 A;  4PUO A;  4DQP A;  3T1A A;  4HCB A;  3VQD A;  1L3T A;  1WSJ A;  3AA2 A;  3AO3 A;  4Q5V A;  1TAU A;  4CHY A;  2Z1I A;  3NE6 A;  3QEX A;  4OKK A;  2QKK A;  2HHX A;  2G8V A;  4YFU A;  1ZBL A;  4CJE A;  4PQU A;  3LAK A;  4JS4 A;  4CCH A;  4Y1D A;  1GOB A;  1IKW A;  3HST B;  3K5O A;  2FC0 A;  4H4M A;  3T3F A;  4RW8 A;  2G8H A;  3VQ7 A;  3LZI A;  1BI4 A;  1JKH A;  3E01 A;  5C42 A;  4KV8 A;  1JLB A;  2O4I A;  1RIL A;  3BGR A;  2VWJ A;  4B9U A;  4LH4 A;  2KW4 A;  2OPS A;  3F73 A;  4FJM A;  4KHQ A;  4J2E A;  1JL1 A;  1LWE A;  3AVC A;  3ULD A;  4BWJ A;  3ZT1 A;  5HP1 A;  4KB1 A;  5FDL A;  4CED A;  1SKW A;  3TAF A;  1G15 A;  1XI1 A;  1T05 A;  3O3H A;  1NKB A;  4IBN A;  1BCO A;  3QEW A;  1CLQ A;  4HUE A;  2QK9 A;  1NK4 A;  1I39 A;  2BDP A;  2HNY A;  3NF8 A;  2P1J A;  3V81 A;  3LZJ A;  1CZB A;  1RT4 A;  2ITG A;  3AVK A;  3C6U A;  5HRS A;  4Z4F A;  1VSI A;  4W5T A;  1SL0 A;  1NOZ A;  2IAJ A;  4AHV A;  4M3Z A;  4EP4 A;  1S6P A;  3KLF A;  3MEC A;  3LAL A;  1X9S A;  2HW3 A;  2KFN A;  3AVH A;  1NK5 A;  1W0H A;  4IG0 A;  4HUG A;  3G10 A;  4CHN A;  1L3V A;  4CGG A;  4BDY A;  4IFV A;  4RW7 A;  4HUF A;  4FJ8 A;  2IGI A;  3L8B A;  4CJF A;  3ZT4 A;  3DLR A;  5EU7 A;  3AVF A;  4UQG A;  4C8O A;  3AO1 A;  1O1W A;  4B8A B;  1LAW A;  4CK1 A;  1JLG A;  2EX3 A;  3NH0 A;  3OYE A;  3PUF A;  5KI6 A;  3ZSO A;  2FBX A;  1JLA A;  2HNZ A;  4CJR A;  3V9S A;  3V6D A;  1L5U A;  4F8R A;  1IKV A;  4FLX A;  1FKO A;  3SPY A;  1NJX A;  1NKE A;  2KZM A;  4QAG A;  1BL3 A;  4I7F A;  4KFB A;  4CEF A;  3SPZ A;  4DSJ A;  1YTU A;  4KRF A;  3SCX A;  4GVM A;  4IG3 A;  4ELU A;  3D0P A;  4I2P A;  3OS2 A;  3M8S A;  4DQS A;  3SJJ A;  1D9F A;  4DTX A;  3MXI A;  1WSI A;  4F3O A;  2X6S A;  4ID5 A;  4CEA A;  4FJ9 A;  4FJL A;  3VN5 A;  2DFE A;  4O0J A;  1HYV A;  2ZQB A;  1EXQ A;  2R7Y A;  4M3T A;  4Z4C A;  1GOC A;  4DSK A;  4F4K A;  3SI6 A;  1BQM A;  1S5J A;  5FRO A;  4CK3 A;  3THV A;  4F2R A;  2B6A A;  4FK4 A;  4DTJ A;  1JLF A;  4B08 A;  3V9U A;  1TK8 A;  3OYK A;  3SUQ A;  4FXD A;  3KLE A;  3NH1 A;  2HB5 A;  3TAG A;  4C8N A;  3OS1 A;  1T7P A;  1SL1 A;  3C6T A;  4B9V A;  1TKT A;  1TKD A;  4IDK A;  1SKS A;  1J5O A;  3ZT2 A;  1REV A;  2YHB A;  1B9F A;  3RR7 A;  1S6Q A;  4FCY A;  3PX0 A;  5FRN A;  1TKZ A;  2OA8 A;  1S1V A;  2OPR A;  1ZBF A;  4PWD A;  4NCB A;  1L3S A;  1KLN A;  3KD5 E;  4CJU A;  3DOK A;  3U3G A;  4Z4H A;  4CJ4 A;  3OVN A;  4IFY A;  3O3F A;  3B6O A;  5SZT A;  1QE1 A;  4K8Z A;  4CF1 A;  1FK9 A;  3CM5 A;  2HMI A;  4FJI A;  1KCF A;  3V4I A;  4BDP A;  2OZM A;  4OLA A;  3LPT A;  2XHB A;  4CGJ A;  3CM6 A;  3P1G A;  4O44 A;  3M8Q A;  4J2D A;  3F9K A;  1ITG A;  3SV4 A;  1S9E A;  3ZSY A;  4KI4 A;  3HP9 A;  4DLG A;  3H08 A;  3MEE A;  3QNO A;  3ZSR A;  1ASU A;  1GOA A;  1HRH A;  2XY8 A;  3QIO A;  4CER A;  2IOC A;  3OYM A;  3OYJ A;  4AHS A;  4CHO A;  3CQ8 A;  4DLE A;  4B9S A;  4OGC A;  3KLH A;  1YVU A;  5DMR A;  4FW1 A;  3ALY A;  1S9G A;  3AVL A;  4C8M A;  3OYD A;  1IH7 A;  3O4N A;  5J2M A;  3L2V A;  3QEI A;  3QES A;  1BIS A;  4NYN A;  1SL2 A;  1S1X A;  4AHU A;  3PX4 A;  1L3U A;  3LP2 A;  3BDP A;  1ASV A;  3NFA A;  4I9Q A;  2HHT A;  1F21 A;  1LWC A;  2G8W A;  3DOL A;  2HHQ A;  4HTU A;  4KO0 A;  1YT3 A;  3ZSX A;  1WSG A;  3CFR A;  4O55 A;  3AA4 A;  3K57 A;  3P5J A;  4FW2 A;  4DS4 A;  3RRH A;  4DF4 A;  3CFO A;  2PYJ A;  4FJ5 A;  3LP3 A;  2ETJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...