4OVLA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV integrase for compounds that bind--a SAMPL challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Integrase
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2013-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ovlA00
5KGXA 3V9SA 1KVBA 1BIUA 5HRSA 4ZHRA 3NGIA 3RR8A 3KD1E 5FDLA 2XY6A 4CJWA 4M3TA 3SV3A 4C8NA 3VQ4A 3NF6A 1KFDA 2OPPA 4NYNA 5HROA 4I9LA 4CESA 1TKTA 3VQAA 1YT3A 2OPRA 3I0RA 4Y1DA 2Q3SA 1NJZA 4KI6A 4CJ3A 4CJLA 3KJVA 3CM5A 1ASVA 3NE6A 3L3VA 4BWJA 3M8RA 1ZBUA 2ATQA 1CZBA 3P5JA 4RW8A 4BWMA 1RTDA 2ZQBA 4E7JA 1ASUA 1BI4B 3CYMA 1BISA 5CZ2A 4DMNA 3V1QA 1S1UA 4Z4EA 1S9GA 1RT7A 3NF8A 2PZSA 4FJXA 1LWEA 1QS4A 1DLOA 3V9ZA 3KTQA 4KHYA 3KKSA 2E6MA 2RF2A 2X74A 4BE1A 4LD0A 5J2MA 1F21A 4CF1A 2FBYA 3TARA 4OJRA 4FM0A 4Q0BA 3MEEA 2XO7A 1C6VA 2FBTA 2YNGA 3OYKA 1REVA 4NCBA 4H4OA 3LP3A 5CYMA 3KLFA 5T7BA 1Q8IA 4W5TA 3HYFA 4E7LA 2HHTA 4Q5VA 3VQ8A 4CF9A 1HRHA 1JL2A 1L3TA 4FVMA 4KKOA 4YNQA 4BACA 1JLEA 3VA0A 3OYLA 4KB0A 3ZT3A 2R7YA 4FJJA 2F96A 4HCCA 1TGOA 1ZBHA 3QIPA 3AVBA 1IKWA 2W42A 3AVHA 4Z4CA 1RILA 1C1CA 5HP1A 1KCFA 1NOYA 2ETJA 3AO5A 4FJGA 1VSEA 2OA8A 2QXFA 1RTHA 1O1WA 1RT2A 1RT1A 1TKZA 1Z25A 4O4GA 4YFUA 3L2UA 3AVKA 5KTQA 3QEXA 4DTNA 4FLTA 1XHXA 1RBRA 4DQIA 5HRRA 4CGGA 3QIOA 3D0PA 3OYFA 3CG7A 4FYDA 3HP6A 3SQ1A 1IKYA 2IOCA 4GW6A 4DFJA 4B8AB 4W5OA 1D5AA 4B8CA 3SUPA 1VSMA 3HT3A 2I5JA 4AHCA 4DF8A 1Z26A 1T8EA 3VQCA 3QLHA 3AA3A 2XY5A 4OPKA 4B08A 3AVFA 2PYJA 4B9TA 4E89A 4CEQA 2Y1JA 1VSFA 4I2QA 4N47A 4J2AA 4FZZA 3HK2A 1IKVA 1D9FA 4CF2A 1L3SA 3DYAA 3KK3A 2X6NA 3LAKA 4CJ5A 2HB5A 4CGFA 2HVHA 5DMRA 4CJRA 2PY5A 4CF0A 4ELTA 2OPSA 5DK5A 4DSLA 4FW1A 1NK9A 1JLCA 5J2QA 3LPUA 3EZ5A 3MXIA 4PY5A 3HSTB 3L2VA 3K58A 2RN2A 1UWBA 1DTTA 2XRIA 3HM9A 3KD5E 4OGEA 5HRNA 3OS0A 4B9SA 2EHGA 1VSJA 4F8RA 3K5LA 4CCHA 5EU7A 2DFFA 3VQPA 2HNZA 3DRPA 1IKXA 4CJQA 4N56A 2EX3A 2ITGA 4CEBA 1WLJA 2D0CA 2P5OA 3AVCA 1X9MA 4CK2A 5J2PA 3TI0A 4DTMA 4B9NA 4C8KA 4J2EA 4IG0A 4CJEA 5HRPA 1RDCA 1KVAA 3QEWA 4CIFA 1VSIA 5JS2A 2G8HA 2HVIA 3ZSVA 1D9DA 3HJFA 3F73A 4FM2A 4E7IA 2BDPA 1BIZA 4NCAA 2BGGA 3SPZA 4JLHA 1T05A 1TAUA 2OPQA 2HNYA 1RDAA 1QSYA 1BHLA 3S3MA 1HPZA 4LH5A 3O4NA 4LH4A 4ELVA 2XY7A 2B5JA 1BQMA 3DMJA 5SWMA 3V1OA 3NFAA 4RW6A 3HO1A 1RT5A 3C94A 1IH7A 2P5GA 1QHTA 2VG6A 5I42A 3NF7A 3VQDA 4CJFA 2PYLA 1NK8A 4HUEA 3MECA 3VQEA 3ITHA 1N5YA 1A5WA 4C8OA 4CEZA 4OKKA 3VN5A 3P1GA 4DG1A 3I8DA 1B92A 2XHBA 3SQ2A 3B6OA 3DLBA 3LANA 1S1WA 4LSLA 4LSNA 4W5RA 3OYGA 3M8SA 4PQUA 3IRXA 4LY7A 4CERA 1NK0A 4O0JA 3U6FA 1U4BA 3TR8A 1JLQA 4AHVA 1HJRA 1YVUA 4M3YA 1VSHA 3KK1A 5KGWA 3ULDA 3L2RA 1NK7A 1WSIA 3DLKA 4Z4GA 4FK4A 4FJMA 4IKFA 1HMVA 3OY9A 4K8XA 3LALA 1QTMA 4HCBA 1EX4A 4DS5A 3RRGA 1WSGA 3V9UA 2G8UA 2KW4A 2KZZA 1KSPA 4M3UA 4GMJB 3OYNA 4AILC 1JXBA 1WSHA 2QK9A 4OLAA 4DLGA 4DTSA 4FJNA 3O3FA 4FXDA 1U04A 2O4GA 4FLVA 5C25A 4KHQA 1YTUA 3SUOA 4I9QA 1NJXA 4CHQA 3OYIA 4FCYA 3QNOA 3E01A 3ZT4A 3NCIA 1C1BA 2ZE2A 3UIQA 4RW9A 4DSKA 3BGRA 3PX0A 1RT3A 1S6PA 3DOKA 4OGCA 1NJYA 2KZMA 2YHBA 1U45A 2IAJA 1HYZA 3KLGA 5FRMA 2RKIA 3NH2A 4AHRA 4RW7A 1EXQA 2YKNA 4CFDA 2VWKA 4G1QA 3NF9A 2GUIA 1B9DA 1UA1A 1VSKA 3L2WA 3THVA 3U3YA 4M3ZA 3DLGA 4BE2A 2IC3A 1CZ9A 2YNFA 1S9EA 3HPHA 3HP9A 3LWMA 1SKRA 1RBVA 3DRRA 4C8LA 2BANA 3OS2A 4O44A 1UA0A 1TK5A 3SPYA 2VG5A 3LP1A 2Z1GA 1TV6A 5FRNA 1XWLA 4FJHA 2KFNA 4DLEA 1RCHA 2JLEA 4XIUA 2DTUA 5KI6A 2AJQA 3A2FA 1TKDA 2WOMA 1T03A 2FBXA 1Q9YA 1T7PA 1DTQA 1WN7A 4CK1A 3TAQA 1XI1A 4PA1A 4FZYA 5C42A 3EYZA 3F9KA 4QOZB 1RNHA 3S9HA 3RMCA 4KHNA 3AA4A 3KK2A 4B9MA 1WAFA 1S5JA 4CJPA 3OYMA 4FK2A 3L3UA 5HLFA 1YTAA 3AO1A 1VRUA 1J9AA 2OZSA 1LW0A 2IDOA 3AVAA 2X78A 3TWHA 2FBVA 4W5QA 1LV5A 4DSFA 4DU1A 1IG9A 1RT6A 2A1RA 4CGHA 3SI6A 2Y1IA 4K8ZA 3T1AA 4RW4A 1SL1A 4DU3A 4HTUA 4Y1CA 3AO2A 5KRSA 4FLXA 2YNHA 4CJTA 1FKOA 4FLWA 3NHGA 1TK8A 4ID1A 1TVRA 1G15A 3V4IA 3ZSXA 3ASMA 3G10A 4CJKA 2FC0A 1JLFA 4KRFA 4CEAA 1I3AA 4CFCA 4CIGA 4I2PA 3QESA 1U49A 1SKSA 2ZD1A 4MQ3A 3JSMA 1S1TA 1GOCA 5I3UA 1C0TA 3DLHA 1RTJA 2HNDA 3AV9A 2Z1HA 3HL8A 3SQ4A 4FJ7A 2HHQA 4KHUA 1U47A 4CJUA 1JLGA 4JS4A 4DQSA 3PY8A 4DQPA 4ELUA 1K6YA 3ZT0A 4OPJA 1SKWA 1TKXA 3KKRA 1QE1A 4AHTA 1JKHA 3ZT2A 1ZBIA 3LP0A 3D45A 1CXUA 4CECA 4M3RA 3TAMA 3AO3A 3K5OA 3MEDA 3NH0A 3CFPA 4FJKA 1L3UA 4DSJA 1RBSA 4DTOA 3PX6A 2E4LA 4CF8A 1QQCA 3VQ7A 4F3OA 3SUQA 3AVIA 3DRSA 2HHVA 3LAMA 4MFBA 3FFIA 2D5RA 3EY1A 3CFRA 4PWDA 2HHXA 3NH1A 3MAQA 3OS1A 3VQQA 3TAGA 2F8SA 4DFMA 3NBPA 5C24A 3NGZA 1NOZA 4KTWA 4OKEA 3AVNA 3AA5X 1WNSA 2F8TA 3ZSYA 3RRHA 1JXEA 4JRQA 2XY8A 5JS1A 1VSLA 3TAFA 4B9UA 4NCGA 2A1SA 3LDSA 1W0HA 1SUQA 4AHUA 3QEVA 1HYSA 4B3OA 4KHWA 2Z1IA 4DTRA 3QETA 2BE2A 3QERA 4DQQA 2IS3A 3KLIA 3V6DA 4EZ6A 3L2QA 1KVCA 2LSNA 4CEOA 3OYJA 3IAYA 3OYCA 1L3VA 1J53A 4N76A 1UAXA 3I0SA 3QO9A 3WNHA 3KLEA 2NUBA 2B4JA 4IBNA 3S3OA 1X9WA 1S1XA 3RMDA 4H8KA 4DWIA 3PUFA 3CQ8A 1NK5A 4M42A 4BDPA 1XHZA 1TK0A 1JLAA 2HHSA 4DTPA 2HW3A 4CFAA 3P83D 1L5UA 4AH9A 4R5PA 1LWCA 2YHAA 4IFYA 1VSDA 1X1PA 4OLBA 4FZXC 3JYTA 1A5VA 2GV9A 3T19A 3OYBA 4KHSA 4QCLA 1BI4A 4JS5A 4N41A 3M8PA 4CEEA 5E41A 3ZSOA 4E1MA 3K57A 3QINA 1LAVA 4E7KA 3RR7A 1LAWA 4KB1A 5CZ1A 3SUNA 2YNIA 4F4KA 4EP5A 1X9SA 3NDKA 1ZBLA 4W5NA 4FJ9A 2DFHA 4C8MA 1R0AA 4M41A 1KFSA 4FJ5A 1WSJA 3TANA 3OYAA 3LWLA 4KPYA 3ALYA 2HHUA 1C0MA 4EP4A 3HPGA 3AVGA 2G8KA 2YV0X 4KI4A 2DY4A 1HNVA 1U48A 4HUFA 4L8RB 3IS9A 4M3XA 1ASWA 1EKEA 1WSFA 4FW2A 3ZSZA 3K5MA 1HNIA 4CEDA 4CGDA 1KRPA 3C95A 3V81A 3SJJA 1FXXA 1SV5A 2O4IA 1HQUA 3WNEA 4M45A 3SV4A 2QKBA 3HXMA 4BDYA 1GOAA 1KTQA 2DFEA 3WNGA 4CE9A 4FLZA 1RT4A 2VG7A 1W9HA 3S3NA 3C6UA 1BCOA 3IG1A 5K14A 4CJSA 4CIEA 3SZ2A 3QEPA 3LPTA 1SL2A 1CLQA 3ZCMA 4FLUA 1NJWA 1JL1A 3K2PA 3AVMA 4WE1A 4DF4A 4CGJA 3KLHA 3TABA 3SCXA 3K5NA 3CM6A 3QNNA 3K59A 2QKKA 2X6SA 3VQ5A 4CHOA 1TL1A 2GBZA 3VQBA 1LWFA 1XC9A 3H08A 1NKCA 1RBTA 3OYHA 1FK9A 4DTUA 3AVLA 3V9XA 1RDBA 1WSEA 2RPIA 5J1EA 1MU2A 3OJUA 1QSSA 4KAZA 4M3WA 3NAEA 4CFBA 4F2SA 3SNNA 4O5BA 1ZYQA 4B9VA 1D8YA 3DLEA 2G8VA 4E0DA 2E6LA 4IFVA 4HHTA 3ZSQA 2D0AA 1KLNA 5KRTA 1Y97A 4FLYA 1UOCA 3O3HA 4FM1A 1GOBA 3KIOA 4J2BA 3HPOA 3ZT1A 5J2NA 3V9WA 1I39A 2VWJA 4BDZA 3M8QA 3RTVA 2JGUA 2WONA 4F3TA 4IG3A 4BE0A 4J2DA 2G8IA 2D0BA 5HBMA 4CEFA 3DI6A 4DTXA 2KFZA 1RDDA 1HQEA 1S1VA 3NGYA 3PX4A 4PUOA 1LW2A 4Z4HA 4H4MA 4ZTFA 4GVMA 4CK3A 3QEIA 3PV8A 2HHWA 2B6AA 1IO2A 3V1RA 1NK4A 4CGIA 4ZTJA 5SZTA 2KQ2A 1B9FA 3ISNC 1EETA 3MEGA 3DLRA 4RG8A 3U3GA 2YKMA 4CJVA 3OJSA 3RMBA 1KLMA 3OYEA 1Q9XA 1VRTA 2OYQA 3LP2A 4KTZA 4EZ9A 1BQNA 4E3SA 3MXMA 4ICLA 3RMAA 3B6PA 4E7HA 4E1NA 4UQGA 3HVTA 3VQ9A 3VA3A 1C1AA 3DOLA 4KFBA 4Z0UA 3SYZA 4I7FA 4CHNA 4DU4A 3SQ0A 4DSIA 3G0ZA 4B9LA 1BCMA 4O0IA 1TAQA 1ZBFA 1EP4A 3RWUA 3PO5A 4N5SA 2G8FA 1S6QA 3ZSWA 4CHPA 4DFPA 4FK0A 3L8BA 1BL3A 4F2RA 4CHYA 3T3FA 1VK0A 4DS4A 1JLBA 1WAJA 1J54A 1RTIA 4HVJA 3PO4A 4HUGA 1C0UA 1RBUA 5D3GA 4AHSA 4Z4FA 5CYQA 4Z4IA 1BGXT 1FKPA 2OZMA 1QSLA 1TL3A 4KREA 4TSXA 3AO4A 3C6TA 1CXQA 4OKJA 1J5OA 3LZJA 4FJLA 3MXJA 1N6QA 4OVLA 2G8WA 4JRPA 3O4QA 1NKBA 1A5XA 4QAGA 4O55A 4DQRA 4DTJA 3O3GA 4ID5A 3ZSRA 3AVJA 4CHZA 1HYVA 4DSEA 4IDKA 3TAEA 4E19A 3OVNA 4DFKA 3LZIA 3TAPA 2P1JA 4FJIA 3HVRA 4KV8A 3VQ6A 1NKEA 3AA2A 1ITGA 3BDPA 4CJ4A 4KTQA 4FJ8A 2IGIA 2P51A 3WNFA 2KTQA 3DM2A 4KO0A 5CY4A 3OYDA 5FROA 4NYFA 1SL0A 1NK6A 2HMIA 3CFOA 2Z1JA
chains in the Genus database with same CATH superfamily
5C2DA 5HRSA 3A8YA 3NGIA 1W7AA 2HBJA 4C8NA 1KFDA 1T6CA 2OPPA 3T7ZA 4I9LA 1HR0K 1YT3A 3I0RA 3IFRA 4GY2B 1NJZA 4BRGA 4CJ3A 3CM5A 1CZAN 3R9PA 4B3RK 1ZBUA 2ATQA 1EWQA 3AGKA 3BEXA 3NF8A 1LWEA 1Q86O 3V9ZA 4KHYA 4B3SK 4JI4K 4YOYA 2E8AA 5J2MA 2Q0UA 3TARA 3VENA 3H46O 2YNGA 5ADXA 4H0XB 4H4OA 3LP3A 5CYMA 3P31A 4W5TA 3HYFA 2HHTA 4CZHA 5BR9A 1HRHA 3GE1A 4KKOA 4YNQA 5BPLA 1JLEA 3EO3A 3VA0A 5M1OA 5JLHA 4FJJA 4HCCA 4DV3K 4DR4K 3QIPA 1QQMA 3WXKA 5JMVA 3AO5A 4FJGA 5AQFA 2QXFA 1RTHA 1O1WA 4O4GA 4C8OA 3CMAN 4FLTA 1Z05A 4AM7A 1XHXA 4B1WB 4JAXA 3OYFA 4DUZK 3HP6A 4GW6A 3M6GA 3SUPA 1VSMA 4AHCA 4BGBA 4B9TA 4LFAK 2Y1JA 1Q81O 1VSFA 4I2QA 4CD3A 3HK2A 1J5EK 1IKVA 1D4XA 2RHKA 3VTHA 5A2QO 1IV0A 4CJ5A 2HB5A 4EAHD 2HVHA 2PY5A 3L0QA 2OPSA 4FW1A 3HSTB 2NRXA 2RN2A 2XRIA 3LDLA 3BUZB 4OGEA 3HRGA 1VSJA 3K5LA 2DFFA 4N56A 2HBLA 2ITGA 3QFPA 2WC9A 5J2PA 4C8KA 3DJCA 1KC8O 4RWTA 4CIFA 3R1XA 1YVNA 5AQNA 1D9DA 3HJFA 4FM2A 2BGGA 3MCPA 4FOIA 2YJFA 2OPQA 4FWQA 1QSYA 5FPNA 3R8EA 4BC3A 3UE5A 4RW6A 4U67L 1RT5A 3C94A 3H3NO 4C1NI 5I42A 2W6LA 3IKMA 1BUPA 1NK8A 1IJJA 4XH4A 5EX5A 3VN5A 3SQ2A 2XHBA 2ASMA 1NM1A 4DB3A 3WXLA 4W5RA 5LJVA 4LY7A 1NK0A 4JYAK 1HJRA 4M3YA 3KK1A 4BRCA 4BR0A 1YHQN 3OY9A 3JS6A 5LY3A 1YXQA 1JCFA 1WSGA 2KW4A 4CZJA 4M3UA 5AQIA 2QK9A 3P39A 4OLAA 2W40A 1U04A 3GG4A 4KHQA 4FLVA 5C25A 3PSIA 5E26A 5BPNA 1NWKA 3E01A 2AA4A 2ZE2A 3BGRA 3PX0A 1RT3A 4GVEA 2QXLA 4GNIA 3MX5A 1U45A 3TSPA 4AHRA 2YKNA 5AR0A 4CFDA 1VQKN 1UA1A 1MWMA 1WUAA 1T3VA 3QMLA 4BG9A 4BE2A 2IC3A 3HPHA 2FLOA 2GX9A 3FGUA 2NNWA 3DRRA 2BANA 2CGKA 3SPYA 3BF1A 1GLEG 3G71N 5FRNA 3FR0A 4DLEA 3BY5A 2OANA 2P9UB 4FO0A 3A2FA 2WOMA 3M3ZA 1XI1A 3FZFA 4QOZB 2V7YA 2QWNA 4H0VB 5DM7L 2FF6A 4B9MA 4CJPA 3L3UA 4JKFA 3AO1A 3MN5A 1VRUA 1IG8A 2YCHA 3AVAA 2F9TA 4W5QA 1IG9A 1X3MA 4HTUA 5IT9O 3AO2A 4B1XB 4FLWA 3NHGA 2FC0A 3PIPL 4KRFA 4CEAA 1I3AA 4YOVA 4CIGA 3JSMA 3DLHA 5I3UA 4NLBA 2HNDA 3AV9A 2Z1HA 1VQLN 5AQSA 3PY8A 4BVPA 1K6YA 3TTDA 3ZLJA 3D45A 2FSNA 4A5AA 3VOVA 3NMUA 1NLVA 2E1ZA 3DRSA 3LAMA 2DPNA 3UKRA 2GWJA 3SLCA 3MAQA 5C24A 1HNZK 1NOZA 1WNSA 1VQ6N 3MWTA 3ZSYA 4JRQA 1N32K 4ISFA 3LDSA 4LF7K 1HKBA 2VWBA 4KHWA 4IEEA 3QETA 3QERA 2IS3A 3CJAA 4MO5A 3OYCA 1L3VA 3I0SA 4IOXA 1VQPN 1S1XA 4M42A 3CQ8A 2HHSA 4DTPA 3P83D 4EIAA 4AH9A 4IFYA 1X1PA 2I7PA 4IXCA 2GEMA 3ZEUA 4OLBA 2GV9A 2Q0RA 4CEEA 4KB1A 1LAWA 4H5TA 3GL1A 3SUNA 3VGLA 1X9SA 1ZBLA 3ULEA 2NRRA 2DFHA 4DV0K 1R0AA 4KPYA 1C0MA 3CHWA 3ATVA 3G6EN 4JI0K 4QS8A 2F7TA 1ASWA 1WSFA 1HNIA 1KRPA 3SJJA 5M1PA 4LFCK 1FXXA 3WQTA 1HQUA 4DV4K 3SV4A 2QKBA 4BDYA 1KAXA 3OW2M 1DKGD 5F1XA 4IWVA 3VTIA 3VF2A 1W9HA 3S3NA 2A41A 2ZJPL 5M1NA 4FLUA 3VPZA 3K2PA 3SCXA 4CGJA 1W2BM 2X6SA 3VQ5A 4CHOA 1TL1A 2GBZA 1LWFA 1K8KA 3OYHA 1OVYA 4DTUA 3V9XA 5J1EA 1MU2A 4JI6K 4E0DA 2E6LA 3SBTA 2O8BB 3ZT1A 3V9WA 5CHIA 3M8QA 3RTVA 4JHDB 5I9EB 3DI6A 2UXCK 2KFZA 1RDDA 3DXKB 4JKGA 4ZTFA 4GVMA 5F0XA 4CJ7A 2HHWA 1IO2A 3V1RA 4CGIA 4ZTJA 4IOCL 3NVKA 2QTDA 3H1QA 3U3GA 4FJ8A 1KQSM 4RG8A 3OJSA 2YKMA 1Q9XA 1KLMA 1ATNA 3L6QA 3FZLA 3LP2A 4ICLA 4E7HA 3VQ9A 3VA3A 4KFBA 4BR5A 4M63C 4CHNA 4DSIA 3DXKA 3G0ZA 4O0IA 1ZBFA 1EP4A 1K73O 4CHPA 4CHYA 3T3FA 1JLBA 2OCEA 4LFBK 1RTIA 3PO4A 3SAFA 1RBUA 4AHSA 3M5RA 4Z4FA 5BN8A 3SAHA 1FKPA 5AQPA 4TSXA 3CCSN 3MXJA 3O4QA 3LM2A 2YJEA 1NKBA 4DTJA 4O55A 5KPZA 4UY8O 4CZKA 4CHZA 3VEOA 1HYVA 3TAEA 4E19A 3LZIA 2WFBA 3E1YA 2ASPA 3VQ6A 3VEWA 3BDPA 2P51A 3OYDA 4KO0A 5CY4A 1ESVA 4NYFA 2UXBK 1RDWX 3ID6A 2J4RA 4JKBA 1C0FA 3FZHA 3THWA 3T1HK 4DR7K 1H1VA 2FSKA 4NB4A 3VQ4A 3R3LA 3LDPA 4WFAL 5C15A 1N34K 4KI6A 1ASVA 3NE6A 1CZBA 4RW8A 1BI4B 3CYMA 1BISA 4QCLA 1RT7A 2PZSA 1QS4A 5TKWA 4YDUA 3KTQA 2E6MA 4IZ9A 3A5MC 3I8BA 3THYA 1IBLK 2FBTA 4PHTX 3NVMA 2P9KB 1HPMA 1GLDG 3KLFA 1HLUA 4E7LA 4BQLA 1ZC6A 4CF9A 4ISGA 4FVMA 2GELA 2E2QA 4BACA 3A5LC 4KB0A 3OYLA 2R7YA 1ZBHA 4YDUC 1FW6A 3AVBA 1NOYA 1VSEA 4YFUA 3QEIA 1RT2A 4ILHA 4DTNA 1SAZA 1MDUB 1RBRA 5HRRA 3QIOA 4CZMA 1NBWA 4FYDA 4IO8A 3SQ1A 2IOCA 3FZMA 4B8AB 4W5OA 4B8CA 4DF8A 1Z26A 3QLHA 4DV2K 1U2VA 3MK6A 4LF9K 4B08A 2PYJA 4LF6K 2A40A 4FZZA 4J2AA 4M7XA 5F2RA 4MDBA 1L3SA 1GLFO 3DYAA 3H6EA 3LDQA 3KK3A 4CGFA 4CZGA 1GLJO 1RFQA 4DSLA 3ZYYX 2Q36A 3L2VA 1RGIA 3EKSA 4JNEA 4B9SA 3SMSA 2VCPA 1HNWK 4CJQA 3VQPA 4FVUA 2EX3A 4DR5K 4CEBA 3THXA 1OVQA 3AVCA 3CCEN 3WT0A 4B9NA 4J2EA 4IG0A 1Q82O 2UUBK 3QEWA 2CH5A 3EEQA 2G8HA 3ZSVA 4BRNA 4DV6K 3SPZA 2HNYA 4C1NK 4BR2A 1ATRA 3I55N 3S3MA 2IIRA 4ELVA 2XY7A 3DMJA 3THXB 2P5GA 1ZXOA 3NF7A 4CJFA 2PYLA 3MECA 4KH6A 4OKKA 3P1GA 3B6OA 5AQVA 4CZIA 2P9UA 3LANA 4LSNA 5JVGL 1YF5L 5M1QA 3I56N 3IRXA 5TKYA 4CERA 1U4BA 4FL9A 5JICA 2HSTA 5KGWA 5GADP 1WSIA 3CJ1A 5AQMA 4IKFA 4M7YA 2OTLN 1OH5A 4DS5A 3RRGA 3V9UA 1JXBA 1IBKK 2CH6A 4DLGA 1BA1A 3CC4N 3CCJN 2O4GA 5AQWA 2FF3B 4X66K 4I9QA 4H0OA 4H5NA 4KH4A 2O8DA 4CHQA 5IWAK 3N4PA 3ZETA 1C1BA 4RW9A 4DSKA 5AQYA 2O8EB 3E9LA 1NJYA 3DOKA 4BRAA 3O9SA 2IAJA 1HYZA 3KLGA 5FRMA 4RW7A 3OTOK 1VAZA 4G1QA 2A6AA 2GUIA 4I6MB 5BRDA 4LC9B 3THVA 3KWGA 1X9JA 2P9NB 3HP9A 3LWMA 3ZX2A 1DEJA 1RBVA 4C8LA 5BRFA 1YUWA 3OS2A 1UA0A 1TK5A 2VG5A 1HKCA 1NGBA 1TV6A 2Z1GA 4BRPA 4DCHA 5GAEP 2JLEA 4XIUA 2DTUA 3CJ9A 5KI6A 2AJQA 4CZFA 4YOXA 1WN7A 1NGAA 5AQLA 1EWRA 5C42A 3EYZA 3F9KA 3ID8A 1RNHA 3AA4A 2QI2A 5HLFA 4IDHA 1J9AA 2OZSA 1LW0A 2X78A 2FXUA 2HBMA 2FBVA 4M3WA 4Z4EA 4K8ZA 3SI6A 3T1AA 4RW4A 1SL1A 4DU3A 5CE3A 4Y1CA 4ID1A 3WXMB 5AZJA 5LMNK 3V4IA 2YHYA 3ASMA 2W6KA 1JLFA 4I2PA 1U49A 1SKSA 1C0TA 3JXUA 4FSVA 1JJ2M 3SQ4A 2HHQA 2HF3A 4KHUA 4CJUA 4JS4A 4DQSA 4BRDA 1VQ7N 3ZX0A 3O1BA 1GLLO 5BR8K 3KKRA 4AHTA 1JKHA 3U8XA 1CXUA 3LM9A 3AO3A 3K5OA 3MEDA 1VQ5N 4DSJA 4RTFD 1RBSA 4DTOA 4H0PA 3PX6A 3W3DA 2E4LA 4BRLA 3CXCM 1NG9A 2D5RA 3HM8A 4JK8A 3QDKA 3OS1A 4IEIA 4DFMA 3NBPA 3NGZA 4A2BA 3VEVA 3MX2A 4KTWA 1OH8A 2E88A 3RRHA 3D2FA 2ZM6K 2XY8A 1VSLA 1FJGK 1W0HA 1SUQA 5AQKA 2Z1IA 3C0BA 4DTRA 2BE2A 4DQQA 3KLIA 4BRFA 1KVCA 3OYJA 1GLBG 4DR3K 4N76A 4JKAA 3WNHA 3RSEB 3RMDA 4DWIA 1NK5A 1VQNN 1XHZA 1TK0A 1JLAA 2HW3A 1L5UA 4R5PA 1LWCA 2YHAA 3D2FB 3OYBA 4N41A 4IFEA 3K57A 4E1MA 3J80O 1LAVA 2V51B 3MDQA 5CZ1A 4OO1J 1Q7YO 4EP5A 3O9RA 4WYBA 4M41A 3MWPA 4NXMK 4FJ5A 3RSEA 3ALYA 4EP4A 3HPGA 4IOAL 1SQKA 1U48A 4HUFA 4FWPA 4L8RB 2F4VK 3MN7A 3V81A 4ILGB 3C65A 3O1WA 3WNEA 5GAGP 5B8HA 4WQ5C 4MO4A 1RDUA 2DFEA 2F9WA 2VG7A 3CERA 5KPTA 1BCOA 3LPTA 3QBXA 3ZCMA 3ENHA 1NJWA 3ENOA 3TU5A 3AVMA 4WE1A 3TABA 3KLHA 3CM6A 3K59A 3GBTA 3VQBA 4CBUA 3OJUA 2RPIA 5FPMA 2D1KA 4F2SA 3WQUA 3SNNA 5AQZA 3OBYA 4BRKA 3ZSQA 2D0AA 1KLNA 5KRTA 4FLYA 3O3HA 2NRWA 1GOBA 5J2NA 2JGUA 3UB5A 3AAPA 1QVGM 4Z4HA 3EL2A 3PV8A 2VQEK 1NK4A 1NU0A 1B9FA 3ISNC 1EETA 4CJVA 3HBTA 2HMPA 1VRTA 4EZ9A 3CD6N 3EN9A 3RMAA 3B6PA 1HJOA 1BG3A 2WBNA 3OA9A 4WCEL 4Z0UA 4I7FA 4BGAA 2QWQA 3HSCA 5C12A 3VEZA 1TAQA 2D0PA 3H3OB 4JKDA 3PO5A 4FK0A 4F2RA 1VK0A 3DAWA 4DS4A 1WAJA 3HZ6A 2AP1A 4HUGA 1C0UA 5CYQA 4Z94A 5C0YA 4FPBA 2OZMA 1NGCA 1QSLA 4KREA 5ADXH 3BP8A 3FZKA 3C7NB 1N6QA 4JD2B 4JRPA 4DQRA 3O3GA 3WEEB 3OBWA 3K9KA 1U6ZA 3EKUA 4BREA 4JKHA 4CJ4A 2I7NA 2UXDK 1NK6A 3BF3A 2HMIA 2E2OA 3CFOA 4E1JA 1JCGA 4JV5K 3CETA 2KLAA 5KGXA 3V9SA 1KVBA 4BRIA 4HWIA 3WEEA 3KD1E 2XY6A 4WQ4C 2E1YA 4CJWA 4M3TA 3SV3A 4LF4K 1HUXA 4NYNA 5HROA 3VQAA 1E4FT 4Y1DA 4X62K 5EOYA 5AJ3K 3L3VA 4BWJA 4BC5A 3P5JA 2ZQBA 4E7JA 1ASUA 3CJ7A 5CZ2A 1S1UA 4FJXA 2NRVA 4LD0A 3CCVN 1F21A 2E2PA 2FBYA 1T44A 4DUYK 3MEEA 2XO7A 1C6VA 2YHWA 4DR2K 4NCBA 1W97L 5T7BA 1Q8IA 5BPMA 5FPDA 4O5FA 3LDNA 1LOTB 3VQ8A 5H1SQ 3K9JA 2A3ZA 3DLLL 3T69A 2QWLA 4WFNL 4H5WA 2IVPA 5LL6Z 1BWFO 1TGOA 2VGNA 3DXMB 3O4WA 2W42A 2PAVA 2VYPA 1BU6O 5HP1A 1OH6A 1KCFA 2ETJA 2NRHA 1YIJN 2P9IB 1RT1A 1TKZA 1Z25A 3ZEUB 3L2UA 1NJIO 2H3GX 4JI7K 1TYQB 4DQIA 1M90O 4CGGA 4IO9L 3D0PA 4XH5A 1QQOA 3QBWA 4O8UA 4DFJA 1D5AA 3HT3A 5LMUK 3VQCA 3AA3A 2XY5A 4OPKA 3ATUA 3KVGA 4N47A 1D9FA 4CF2A 1TYQA 3BZCA 4DR1K 4ELTA 2NLXA 1R59O 3E9OA 5J2QA 3EZ5A 3K58A 1UWBA 1DTTA 3KD5E 3OS0A 1GLAG 4F8RA 4CCHA 5EU7A 1HKGA 3DRPA 2P9SB 4CI6A 3I33A 3O8MA 4BRHA 1WLJA 4DKWA 2D0CA 3O9QA 5AFUH 2ZF5O 1X9MA 3QICA 4CK2A 4YHHK 4WQ5A 5GINA 1HX1A 3UKUA 5HRPA 1RDCA 2ZJQL 4KHPK 3HOTA 3KHYA 3D7EO 3L4IA 5JS2A 2HVIA 3F73A 4E7IA 4JLHA 2A5XA 1TAUA 1SZ2A 3WXIA 4AF1A 4JK9A 1YAGA 1HPZA 4LH5A 4K25A 4I6MA 3HO1A 2B5JA 1BQMA 5SWMA 4NO7A 3V1OA 3PIOL 1IH7A 1QHTA 4OPHA 3VQDA 3SMPA 4HUEA 3QB0A 1N5YA 1TUUA 4CEZA 3I8DA 4DG1A 4CZLA 4JI2K 4LSLA 3OYGA 5AQOA 3O5BA 3U6FA 4AHVA 1VSHA 3ULDA 3L2RA 2QEXN 4FWMA 1Q18A 4HCBA 4K0KK 1EX4A 3SK3A 3CCQN 1WSHA 4DHYA 3MN9A 1P8ZA 1K8AO 4L3QA 3SUOA 1NJXA 5KQDA 4BQZA 3OYIA 3NCIA 2QWPA 2ITMA 1S6PA 4OGCA 2HHHK 4A57A 2KZMA 2YHBA 1EQYA 1M1KO 4FWLA 2RKIA 3NH2A 1VQ4N 5AQGA 4MLEA 3NF9A 4MDAA 2Q31A 2UU9K 1XNQK 1BO5O 4FPAA 3L2WA 3U3YA 4M3ZA 3DLGA 2YNFA 1S9EA 4A2AA 4A62A 3MN6A 2QA4N 3O80A 5C10A 1XWLA 4FJHA 1RCHA 1TUYA 2GUPA 3Q7BA 1DTQA 4JKGB 3TAQA 3W0LA 4FZYA 4PA1A 3EZWA 4BRMA 3J7YP 3F9MA 3S9HA 3RMCA 1VQON 4KHNA 4EFHA 1S5JA 4FK2A 3OYMA 1YTAA 3RVCA 2IDOA 4BRQA 2IVOA 2QW9A 3J7ZO 1LV5A 2A1RA 4CGHA 2Y1IA 1Y64A 2P9KA 3N4QA 4GKKK 5KRSA 4KH5A 4CJTA 1DGKN 5AFUA 4FLXA 1FKOA 2ZWHA 1G15A 3F5TA 4CBXA 4GV6A 1GOCA 4BG8A 4BC4A 1U47A 1JLGA 4DQPA 3H45C 3ZT0A 4OPJA 1SKWA 1TKXA 2UYTA 1QE1A 1ZBIA 1QHAA 3LP0A 4K42A 4BR4A 3TAMA 4JI5K 1L3UA 3G25A 4CF8A 1S22A 3VQ7A 3C6HA 2HHVA 4MFBA 1YJNN 4YOWA 4GV3A 3TAGA 3VQQA 4A5BA 1J6ZA 3CI5A 3CJCA 4OKEA 3AA5X 3J8AA 1U2VB 2F8TA 3SBGA 1JXEA 3A0IX 3TAFA 2A1SA 3QEVA 1HYSA 4B3OA 3E66A 4EZ6A 4CEOA 4X65K 3IAYA 4AM6A 5ELZA 1J53A 1UAXA 3QO9A 2W41A 1KAZA 3PUFA 4BDPA 4OPAA 4LF5K 4CFAA 5LJWA 1VSDA 4CW7B 2QWOA 1K9MO 4FZXC 3JYTA 3T19A 4DV7K 1BI4A 4JS5A 5E41A 3TPQA 4E7KA 2YNIA 4F4KA 1SS6A 4FJ9A 4C8MA 1KFSA 3VEYA 2IVNA 3OYAA 2G8KA 1XQSC 3AVGA 2YV0X 3ZSZA 3K5MA 4CEDA 3F2KA 3C95A 1ZBSA 1KXPA 1XC3A 4M45A 3HXMA 3CQXA 1BA0A 1VHXA 1KD1O 1G99A 3CC7N 1GOAA 1KTQA 3CC2N 4CE9A 4FLZA 3C6UA 4CIEA 4B1YB 4CJSA 1SL2A 2O8CA 3U9DA 4V19S 3Q7CA 1JL1A 4DF4A 2QKKA 3K5NA 4NLCA 2A42A 1C0GA 3K0SA 1RBTA 4H0TB 4KBOA 4FWSA 4PKGA 4EHTA 2HHUA 3GOIA 3SJHA 3C7NA 1QSSA 4JD2A 4H5VA 4CFBA 3NAEA 4O5BA 1ATSA 1ZYQA 4B9VA 1D8YA 4NXNK 1P90A 3DLEA 2G8VA 4IFVA 2HBKA 1UOCA 2QWMA 4RCHA 4FM1A 2NZTA 3H1VX 3HPOA 2VWJA 4BDZA 2YI1A 4B1VA 3B8AX 2WONA 4F3TA 2G8IA 5HBMA 3MCAB 1S1VA 3NGYA 1XMOK 1LW2A 1V4TA 4H4MA 2O8DB 4FWRA 2Q2RA 4CK3A 4C23A 2B6AA 3AARA 5SZTA 2JWKA 4QS9A 1VQMN 3MEGA 3RMBA 3DLRA 2VGMA 3G4SN 3OYEA 4KTZA 5JVHL 4JKCA 4YOUA 4E1NA 3HVTA 3S41A 4WQ4A 4B9LA 2P9NA 3RWUA 3KWIA 2QM1A 4XEIA 2OTJN 1S6QA 4DFPA 3QFUA 4BC2A 2E2NA 3J7AP 3VEXA 5AQTA 1YITN 4HVJA 3KZBA 3ENBA 1OH7A 5D3GA 4U7BA 5AQUA 3AAQA 1BGXT 1OKJA 3C6TA 4OKJA 1CXQA 4A59A 1J5OA 3LZJA 2Q97A 2G8WA 1A5XA 4QAGA 4DV1K 3P38A 3IDHA 4IDKA 1N33K 1E4GT 2P1JA 4FJIA 3HVRA 3GDQA 1NGJA 3P4IA 1NKEA 4FWOA 3AA2A 1ITGA 4GKJK 2IGIA 3WNFA 2ZGYA 4DV5K 5EVZA 5FROA 1GLCG 4R79A 5AZJB 4WFBL 2Z1JA 1XMQK 2ZJRL 1BIUA 4ZHRA 3VF4A 4Y0WA 3RR8A 5FLXO 5FDLA 2PBDA 3NF6A 4CESA 1TKTA 2D4WA 2OPRA 2Q3SA 3VGKA 3VMFB 4CJLA 3KJVA 2UUAK 4CVNE 3AY9A 3M8RA 4CBWA 4BWMA 1RTDA 3ZETB 5CR4A 4DMNA 3V1QA 5FPEA 4B3TK 1S9GA 1DLOA 2O8EA 3KKSA 2X74A 2RF2A 4BE1A 1BDGA 4CF1A 1NNEA 5AQXA 4OJRA 4FM0A 4Q0BA 1Z6RA 3OYKA 1REVA 4JN4A 4MLHA 4B1UB 1IBMK 2GWKA 4Q5VA 1L3TA 1JL2A 3A5NC 1WOQA 3OHRA 4JEPA 2O8FA 3ZT3A 2F96A 3U4LA 1IKWA 3VESA 3AVHA 4Z4CA 3CCUN 1RILA 1C1CA 2OA8A 2V52B 3QEXA 3PSFA 3AVKA 5KTQA 1K8KB 4ILJA 2D0OA 5BREA 3CG7A 3UKRB 4JI8K 5DM6L 1IKYA 1DT9A 1WBDA 3M1FA 2I5JA 1T8EA 2WUSA 4GV9A 3CJBA 2O8BA 4HTLA 3AVFA 1HNXK 4E89A 3SAGA 1I94K 4CEQA 1NGEA 5GIOA 1XUPO 3IMXA 3TTCA 3FE1A 3O08A 2RE2A 2X6NA 3LAKA 3O6WA 5DMRA 4CJRA 4CF0A 4X64K 4K43A 5DK5A 2HF4A 1NMDA 1NK9A 3IUCA 3CF5L 1JLCA 3MXIA 3LPUA 4PY5A 4PL8A 3HM9A 5HRNA 2EHGA 2NRZA 4O8KA 1YI2N 2HNZA 1IKXA 5AQRA 2P5OA 3L4QA 3ULEB 3TI0A 4DTMA 3CQYA 4CJEA 3WUHA 1KVAA 4CD1A 1QZ6A 1VSIA 3BZKA 3KK7A 2FSJA 2BDPA 1BIZA 4NCAA 1S72N 1T05A 1RDAA 1BHLA 2CGLA 3T1YK 3O4NA 4LH4A 3NFAA 5AQHA 3C6AA 1LCUA 2VG6A 2UUCK 3VGMA 2NRTA 3VQEA 3ITHA 1A5WA 4EHUA 1O13A 5GIPA 2E5LK 1B92A 3DLBA 1X3NA 1S1WA 4A61A 3M8SA 4PQUA 4WF9L 4O0JA 1NMNA 3TR8A 1JLQA 1E3MA 5KPRA 2HOEA 4BR7A 1YVUA 1NK7A 3DLKA 3CCLN 4Z4GA 3DWLA 4FJMA 4FK4A 1NGGA 1HMVA 2ASOA 4H5RA 4K8XA 3LALA 3TSQA 1QTMA 1MA9B 2G8UA 2KZZA 3AGRA 4FOEA 1KSPA 4GMJB 3OYNA 4AILC 4JHDA 4DTSA 4FJNA 3O3FA 4FXDA 1YTUA 4FWKA 3HTVA 1QZ5A 1NGFA 4FCYA 3QNOA 3ZT4A 3UIQA 2PFUA 5E84A 5KQ8A 3J81O 3PLAA 1EXQA 2VWKA 4H03B 1B9DA 1VSKA 4YOTA 1CZ9A 1SKRA 4JK7A 3R6MA 4O44A 3LP1A 3CMEN 1S3XA 2P9LA 2KFNA 4PKHA 1TKDA 1T03A 4B3MK 2FBXA 1Q9YA 3EE8A 5M1FA 3VF6A 1T7PA 4CK1A 5C2FA 2YX6A 4K41A 4JKEA 4BROA 4CZEA 4PKIA 3KK2A 3LDOA 1WAFA 3VETA 2BUPA 2P9LB 3ZX3A 2YHXA 3TWHA 1QQNA 4DSFA 4DU1A 1RT6A 2KKZA 4B9QA 3CCMN 2YNHA 1WBBA 1TK8A 5HL7L 1TVRA 3THWB 3ZSXA 3G10A 4CJKA 4JI3K 4CFCA 3QESA 2P9PA 2ZD1A 4MQ3A 1S1TA 3EE9A 4J8FA 1RTJA 3HL8A 4FJ7A 2WTUA 3DXMA 5EXWA 4ELUA 1N36K 3ZT2A 4LF8K 1YJ9N 4CECA 4M3RA 4BR9A 4G9ZA 3NH0A 4FJKA 3CFPA 1YJWN 3MMVA 1QQCA 2P9PB 4F3OA 3SUQA 3AVIA 3FFIA 3EY1A 3CFRA 4PWDA 2HHXA 3THYB 3U9ZA 3NH1A 2F8SA 4YORA 3AVNA 2O8CB 4YY3K 4DR6K 1KAYA 5JS1A 1XNRK 4B9UA 4NCGA 4AHUA 3V6DA 4OX9K 3L2QA 2LSNA 3TSUA 3KLEA 2NUBA 2B4JA 4IBNA 4XH1A 3S3OA 1X9WA 4H8KA 5EY4A 2KHOA 2GTDA 1NGHA 1A5VA 4KHSA 3M8PA 3TTFA 3ZSOA 3QINA 4FWNA 3RR7A 2V7ZA 2ZGZA 3NDKA 4W5NA 3HI0A 1WSJA 3JAMO 3TANA 3LWLA 3CPEA 5AQJA 2DY4A 4KI4A 1HNVA 3IS9A 4M3XA 1EO1A 1EKEA 4FW2A 4CGDA 1WB9A 5GAHP 1SV5A 2O4IA 5JLFA 5AQQA 3CPWM 1VQ8N 3WNGA 1JCEA 1RT4A 3O9UA 3SZ2A 3IG1A 3O9TA 5K14A 2BTFA 3QEPA 3D2EA 5MLCQ 1CLQA 4BVOA 2P9IA 3CCRN 1V4SA 4PL7A 3QNNA 4ISEA 4BY9C 1XC9A 3H08A 1NKCA 1FK9A 3D6RA 3AVLA 1RDBA 1WSEA 4KAZA 4AQYK 3WXJA 3LL3A 4HHTA 1N8RO 1Y97A 3D2EB 3KIOA 4J2BA 1I39A 1MWKA 4IG3A 4BE0A 4J2DA 2D0BA 4CEFA 4IJAA 4DTXA 2CGJA 2JWLA 1HQEA 3VERA 3PX4A 4PUOA 1T6DA 3A5OC 1VQ9N 2KQ2A 5HOOA 1ILYA 2OYQA 2QWRA 1BQNA 4E3SA 1BOTO 3MXMA 4UQGA 1C1AA 3DOLA 4QS7A 3SYZA 3FFKB 2P9SA 4DU4A 3SQ0A 2EWSA 4B1ZA 4JI1K 1BCMA 5M1KA 4N5SA 2G8FA 3FLCO 3ZSWA 2Q1NA 2E20A 3L8BA 1BL3A 3UKUB 1J54A 4DQ8A 4Z4IA 4H0YB 5AZIB 1TL3A 3AO4A 5BRHA 4FJLA 4OVLA 1NGIA 3HOSA 3E9PA 1QVFM 4ID5A 3ZSRA 3AVJA 5BN9A 4F9OA 4DSEA 2O8FB 3OVNA 4DFKA 4IJNA 3TAPA 4KV8A 4KTQA 5AZIA 3CIPA 2VQFK 2KTQA 3DM2A 1NGDA 1SL0A 2BH1A
chains in the Genus database with same CATH topology
5KGXA 3V9SA 1KVBA 1BIUA 5HRSA 4ZHRA 3NGIA 3RR8A 3KD1E 5FDLA 2XY6A 4CJWA 4M3TA 3SV3A 4C8NA 3VQ4A 3NF6A 1KFDA 2OPPA 4NYNA 5HROA 4I9LA 4CESA 1TKTA 3VQAA 1YT3A 2OPRA 3I0RA 4Y1DA 2Q3SA 1NJZA 4KI6A 4CJ3A 4CJLA 3KJVA 3CM5A 1ASVA 3NE6A 3L3VA 4BWJA 3M8RA 1ZBUA 2ATQA 1CZBA 3P5JA 4RW8A 4BWMA 1RTDA 2ZQBA 4E7JA 1ASUA 1BI4B 3CYMA 1BISA 5CZ2A 4DMNA 3V1QA 1S1UA 4Z4EA 1S9GA 1RT7A 3NF8A 2PZSA 4FJXA 1LWEA 1QS4A 1DLOA 3V9ZA 3KTQA 4KHYA 3KKSA 2E6MA 2RF2A 2X74A 4BE1A 4LD0A 5J2MA 1F21A 4CF1A 2FBYA 3TARA 4OJRA 4FM0A 4Q0BA 3MEEA 2XO7A 1C6VA 2FBTA 2YNGA 3OYKA 1REVA 4NCBA 4H4OA 3LP3A 5CYMA 3KLFA 5T7BA 1Q8IA 4W5TA 3HYFA 4E7LA 2HHTA 4Q5VA 3VQ8A 4CF9A 1HRHA 1JL2A 1L3TA 4FVMA 4KKOA 4YNQA 4BACA 1JLEA 3VA0A 3OYLA 4KB0A 3ZT3A 2R7YA 4FJJA 2F96A 4HCCA 1TGOA 1ZBHA 3QIPA 3AVBA 1IKWA 2W42A 3AVHA 4Z4CA 1RILA 1C1CA 5HP1A 1KCFA 1NOYA 2ETJA 3AO5A 4FJGA 1VSEA 2OA8A 2QXFA 1RTHA 1O1WA 1RT2A 1RT1A 1TKZA 1Z25A 4O4GA 4YFUA 3L2UA 3AVKA 5KTQA 3QEXA 4DTNA 4FLTA 1XHXA 1RBRA 4DQIA 5HRRA 4CGGA 3QIOA 3D0PA 3OYFA 3CG7A 4FYDA 3HP6A 3SQ1A 1IKYA 2IOCA 4GW6A 4DFJA 4B8AB 4W5OA 1D5AA 4B8CA 3SUPA 1VSMA 3HT3A 2I5JA 4AHCA 4DF8A 1Z26A 1T8EA 3VQCA 3QLHA 3AA3A 2XY5A 4OPKA 4B08A 3AVFA 2PYJA 4B9TA 4E89A 4CEQA 2Y1JA 1VSFA 4I2QA 4N47A 4J2AA 4FZZA 3HK2A 1IKVA 1D9FA 4CF2A 1L3SA 3DYAA 3KK3A 2X6NA 3LAKA 4CJ5A 2HB5A 4CGFA 2HVHA 5DMRA 4CJRA 2PY5A 4CF0A 4ELTA 2OPSA 5DK5A 4DSLA 4FW1A 1NK9A 1JLCA 5J2QA 3LPUA 3EZ5A 3MXIA 4PY5A 3HSTB 3L2VA 3K58A 2RN2A 1UWBA 1DTTA 2XRIA 3HM9A 3KD5E 4OGEA 5HRNA 3OS0A 4B9SA 2EHGA 1VSJA 4F8RA 3K5LA 4CCHA 5EU7A 2DFFA 3VQPA 2HNZA 3DRPA 1IKXA 4CJQA 4N56A 2EX3A 2ITGA 4CEBA 1WLJA 2D0CA 2P5OA 3AVCA 1X9MA 4CK2A 5J2PA 3TI0A 4DTMA 4B9NA 4C8KA 4J2EA 4IG0A 4CJEA 5HRPA 1RDCA 1KVAA 3QEWA 4CIFA 1VSIA 5JS2A 2G8HA 2HVIA 3ZSVA 1D9DA 3HJFA 3F73A 4FM2A 4E7IA 2BDPA 1BIZA 4NCAA 2BGGA 3SPZA 4JLHA 1T05A 1TAUA 2OPQA 2HNYA 1RDAA 1QSYA 1BHLA 3S3MA 1HPZA 4LH5A 3O4NA 4LH4A 4ELVA 2XY7A 2B5JA 1BQMA 3DMJA 5SWMA 3V1OA 3NFAA 4RW6A 3HO1A 1RT5A 3C94A 1IH7A 2P5GA 1QHTA 2VG6A 5I42A 3NF7A 3VQDA 4CJFA 2PYLA 1NK8A 4HUEA 3MECA 3VQEA 3ITHA 1N5YA 1A5WA 4C8OA 4CEZA 4OKKA 3VN5A 3P1GA 4DG1A 3I8DA 1B92A 2XHBA 3SQ2A 3B6OA 3DLBA 3LANA 1S1WA 4LSLA 4LSNA 4W5RA 3OYGA 3M8SA 4PQUA 3IRXA 4LY7A 4CERA 1NK0A 4O0JA 3U6FA 1U4BA 3TR8A 1JLQA 4AHVA 1HJRA 1YVUA 4M3YA 1VSHA 3KK1A 5KGWA 3ULDA 3L2RA 1NK7A 1WSIA 3DLKA 4Z4GA 4FK4A 4FJMA 4IKFA 1HMVA 3OY9A 4K8XA 3LALA 1QTMA 4HCBA 1EX4A 4DS5A 3RRGA 1WSGA 3V9UA 2G8UA 2KW4A 2KZZA 1KSPA 4M3UA 4GMJB 3OYNA 4AILC 1JXBA 1WSHA 2QK9A 4OLAA 4DLGA 4DTSA 4FJNA 3O3FA 4FXDA 1U04A 2O4GA 4FLVA 5C25A 4KHQA 1YTUA 3SUOA 4I9QA 1NJXA 4CHQA 3OYIA 4FCYA 3QNOA 3E01A 3ZT4A 3NCIA 1C1BA 2ZE2A 3UIQA 4RW9A 4DSKA 3BGRA 3PX0A 1RT3A 1S6PA 3DOKA 4OGCA 1NJYA 2KZMA 2YHBA 1U45A 2IAJA 1HYZA 3KLGA 5FRMA 2RKIA 3NH2A 4AHRA 4RW7A 1EXQA 2YKNA 4CFDA 2VWKA 4G1QA 3NF9A 2GUIA 1B9DA 1UA1A 1VSKA 3L2WA 3THVA 3U3YA 4M3ZA 3DLGA 4BE2A 2IC3A 1CZ9A 2YNFA 1S9EA 3HPHA 3HP9A 3LWMA 1SKRA 1RBVA 3DRRA 4C8LA 2BANA 3OS2A 4O44A 1UA0A 1TK5A 3SPYA 2VG5A 3LP1A 2Z1GA 1TV6A 5FRNA 1XWLA 4FJHA 2KFNA 4DLEA 1RCHA 2JLEA 4XIUA 2DTUA 5KI6A 2AJQA 3A2FA 1TKDA 2WOMA 1T03A 2FBXA 1Q9YA 1T7PA 1DTQA 1WN7A 4CK1A 3TAQA 1XI1A 4PA1A 4FZYA 5C42A 3EYZA 3F9KA 4QOZB 1RNHA 3S9HA 3RMCA 4KHNA 3AA4A 3KK2A 4B9MA 1WAFA 1S5JA 4CJPA 3OYMA 4FK2A 3L3UA 5HLFA 1YTAA 3AO1A 1VRUA 1J9AA 2OZSA 1LW0A 2IDOA 3AVAA 2X78A 3TWHA 2FBVA 4W5QA 1LV5A 4DSFA 4DU1A 1IG9A 1RT6A 2A1RA 4CGHA 3SI6A 2Y1IA 4K8ZA 3T1AA 4RW4A 1SL1A 4DU3A 4HTUA 4Y1CA 3AO2A 5KRSA 4FLXA 2YNHA 4CJTA 1FKOA 4FLWA 3NHGA 1TK8A 4ID1A 1TVRA 1G15A 3V4IA 3ZSXA 3ASMA 3G10A 4CJKA 2FC0A 1JLFA 4KRFA 4CEAA 1I3AA 4CFCA 4CIGA 4I2PA 3QESA 1U49A 1SKSA 2ZD1A 4MQ3A 3JSMA 1S1TA 1GOCA 5I3UA 1C0TA 3DLHA 1RTJA 2HNDA 3AV9A 2Z1HA 3HL8A 3SQ4A 4FJ7A 2HHQA 4KHUA 1U47A 4CJUA 1JLGA 4JS4A 4DQSA 3PY8A 4DQPA 4ELUA 1K6YA 3ZT0A 4OPJA 1SKWA 1TKXA 3KKRA 1QE1A 4AHTA 1JKHA 3ZT2A 1ZBIA 3LP0A 3D45A 1CXUA 4CECA 4M3RA 3TAMA 3AO3A 3K5OA 3MEDA 3NH0A 3CFPA 4FJKA 1L3UA 4DSJA 1RBSA 4DTOA 3PX6A 2E4LA 4CF8A 1QQCA 3VQ7A 4F3OA 3SUQA 3AVIA 3DRSA 2HHVA 3LAMA 4MFBA 3FFIA 2D5RA 3EY1A 3CFRA 4PWDA 2HHXA 3NH1A 3MAQA 3OS1A 3VQQA 3TAGA 2F8SA 4DFMA 3NBPA 5C24A 3NGZA 1NOZA 4KTWA 4OKEA 3AVNA 3AA5X 1WNSA 2F8TA 3ZSYA 3RRHA 1JXEA 4JRQA 2XY8A 5JS1A 1VSLA 3TAFA 4B9UA 4NCGA 2A1SA 3LDSA 1W0HA 1SUQA 4AHUA 3QEVA 1HYSA 4B3OA 4KHWA 2Z1IA 4DTRA 3QETA 2BE2A 3QERA 4DQQA 2IS3A 3KLIA 3V6DA 4EZ6A 3L2QA 1KVCA 2LSNA 4CEOA 3OYJA 3IAYA 3OYCA 1L3VA 1J53A 4N76A 1UAXA 3I0SA 3QO9A 3WNHA 3KLEA 2NUBA 2B4JA 4IBNA 3S3OA 1X9WA 1S1XA 3RMDA 4H8KA 4DWIA 3PUFA 3CQ8A 1NK5A 4M42A 4BDPA 1XHZA 1TK0A 1JLAA 2HHSA 4DTPA 2HW3A 4CFAA 3P83D 1L5UA 4AH9A 4R5PA 1LWCA 2YHAA 4IFYA 1VSDA 1X1PA 4OLBA 4FZXC 3JYTA 1A5VA 2GV9A 3T19A 3OYBA 4KHSA 4QCLA 1BI4A 4JS5A 4N41A 3M8PA 4CEEA 5E41A 3ZSOA 4E1MA 3K57A 3QINA 1LAVA 4E7KA 3RR7A 1LAWA 4KB1A 5CZ1A 3SUNA 2YNIA 4F4KA 4EP5A 1X9SA 3NDKA 1ZBLA 4W5NA 4FJ9A 2DFHA 4C8MA 1R0AA 4M41A 1KFSA 4FJ5A 1WSJA 3TANA 3OYAA 3LWLA 4KPYA 3ALYA 2HHUA 1C0MA 4EP4A 3HPGA 3AVGA 2G8KA 2YV0X 4KI4A 2DY4A 1HNVA 1U48A 4HUFA 4L8RB 3IS9A 4M3XA 1ASWA 1EKEA 1WSFA 4FW2A 3ZSZA 3K5MA 1HNIA 4CEDA 4CGDA 1KRPA 3C95A 3V81A 3SJJA 1FXXA 1SV5A 2O4IA 1HQUA 3WNEA 4M45A 3SV4A 2QKBA 3HXMA 4BDYA 1GOAA 1KTQA 2DFEA 3WNGA 4CE9A 4FLZA 1RT4A 2VG7A 1W9HA 3S3NA 3C6UA 1BCOA 3IG1A 5K14A 4CJSA 4CIEA 3SZ2A 3QEPA 3LPTA 1SL2A 1CLQA 3ZCMA 4FLUA 1NJWA 1JL1A 3K2PA 3AVMA 4WE1A 4DF4A 4CGJA 3KLHA 3TABA 3SCXA 3K5NA 3CM6A 3QNNA 3K59A 2QKKA 2X6SA 3VQ5A 4CHOA 1TL1A 2GBZA 3VQBA 1LWFA 1XC9A 3H08A 1NKCA 1RBTA 3OYHA 1FK9A 4DTUA 3AVLA 3V9XA 1RDBA 1WSEA 2RPIA 5J1EA 1MU2A 3OJUA 1QSSA 4KAZA 4M3WA 3NAEA 4CFBA 4F2SA 3SNNA 4O5BA 1ZYQA 4B9VA 1D8YA 3DLEA 2G8VA 4E0DA 2E6LA 4IFVA 4HHTA 3ZSQA 2D0AA 1KLNA 5KRTA 1Y97A 4FLYA 1UOCA 3O3HA 4FM1A 1GOBA 3KIOA 4J2BA 3HPOA 3ZT1A 5J2NA 3V9WA 1I39A 2VWJA 4BDZA 3M8QA 3RTVA 2JGUA 2WONA 4F3TA 4IG3A 4BE0A 4J2DA 2G8IA 2D0BA 5HBMA 4CEFA 3DI6A 4DTXA 2KFZA 1RDDA 1HQEA 1S1VA 3NGYA 3PX4A 4PUOA 1LW2A 4Z4HA 4H4MA 4ZTFA 4GVMA 4CK3A 3QEIA 3PV8A 2HHWA 2B6AA 1IO2A 3V1RA 1NK4A 4CGIA 4ZTJA 5SZTA 2KQ2A 1B9FA 3ISNC 1EETA 3MEGA 3DLRA 4RG8A 3U3GA 2YKMA 4CJVA 3OJSA 3RMBA 1KLMA 3OYEA 1Q9XA 1VRTA 2OYQA 3LP2A 4KTZA 4EZ9A 1BQNA 4E3SA 3MXMA 4ICLA 3RMAA 3B6PA 4E7HA 4E1NA 4UQGA 3HVTA 3VQ9A 3VA3A 1C1AA 3DOLA 4KFBA 4Z0UA 3SYZA 4I7FA 4CHNA 4DU4A 3SQ0A 4DSIA 3G0ZA 4B9LA 1BCMA 4O0IA 1TAQA 1ZBFA 1EP4A 3RWUA 3PO5A 4N5SA 2G8FA 1S6QA 3ZSWA 4CHPA 4DFPA 4FK0A 3L8BA 1BL3A 4F2RA 4CHYA 3T3FA 1VK0A 4DS4A 1JLBA 1WAJA 1J54A 1RTIA 4HVJA 3PO4A 4HUGA 1C0UA 1RBUA 5D3GA 4AHSA 4Z4FA 5CYQA 4Z4IA 1BGXT 1FKPA 2OZMA 1QSLA 1TL3A 4KREA 4TSXA 3AO4A 3C6TA 1CXQA 4OKJA 1J5OA 3LZJA 4FJLA 3MXJA 1N6QA 4OVLA 2G8WA 4JRPA 3O4QA 1NKBA 1A5XA 4QAGA 4O55A 4DQRA 4DTJA 3O3GA 4ID5A 3ZSRA 3AVJA 4CHZA 1HYVA 4DSEA 4IDKA 3TAEA 4E19A 3OVNA 4DFKA 3LZIA 3TAPA 2P1JA 4FJIA 3HVRA 4KV8A 3VQ6A 1NKEA 3AA2A 1ITGA 3BDPA 4CJ4A 4KTQA 4FJ8A 2IGIA 2P51A 3WNFA 2KTQA 3DM2A 4KO0A 5CY4A 3OYDA 5FROA 4NYFA 1SL0A 1NK6A 2HMIA 3CFOA 2Z1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KGX A;  3V9S A;  1KVB A;  1BIU A;  5HRS A;  4ZHR A;  3NGI A;  3RR8 A;  3KD1 E;  5FDL A;  2XY6 A;  4CJW A;  4M3T A;  3SV3 A;  4C8N A;  3VQ4 A;  3NF6 A;  1KFD A;  2OPP A;  4NYN A;  5HRO A;  4I9L A;  4CES A;  1TKT A;  3VQA A;  1YT3 A;  2OPR A;  3I0R A;  4Y1D A;  2Q3S A;  1NJZ A;  4KI6 A;  4CJ3 A;  4CJL A;  3KJV A;  3CM5 A;  1ASV A;  3NE6 A;  3L3V A;  4BWJ A;  3M8R A;  1ZBU A;  2ATQ A;  1CZB A;  3P5J A;  4RW8 A;  4BWM A;  1RTD A;  2ZQB A;  4E7J A;  1ASU A;  1BI4 B;  3CYM A;  1BIS A;  5CZ2 A;  4DMN A;  3V1Q A;  1S1U A;  4Z4E A;  1S9G A;  1RT7 A;  3NF8 A;  2PZS A;  4FJX A;  1LWE A;  1QS4 A;  1DLO A;  3V9Z A;  3KTQ A;  4KHY A;  3KKS A;  2E6M A;  2RF2 A;  2X74 A;  4BE1 A;  4LD0 A;  5J2M A;  1F21 A;  4CF1 A;  2FBY A;  3TAR A;  4OJR A;  4FM0 A;  4Q0B A;  3MEE A;  2XO7 A;  1C6V A;  2FBT A;  2YNG A;  3OYK A;  1REV A;  4NCB A;  4H4O A;  3LP3 A;  5CYM A;  3KLF A;  5T7B A;  1Q8I A;  4W5T A;  3HYF A;  4E7L A;  2HHT A;  4Q5V A;  3VQ8 A;  4CF9 A;  1HRH A;  1JL2 A;  1L3T A;  4FVM A;  4KKO A;  4YNQ A;  4BAC A;  1JLE A;  3VA0 A;  3OYL A;  4KB0 A;  3ZT3 A;  2R7Y A;  4FJJ A;  2F96 A;  4HCC A;  1TGO A;  1ZBH A;  3QIP A;  3AVB A;  1IKW A;  2W42 A;  3AVH A;  4Z4C A;  1RIL A;  1C1C A;  5HP1 A;  1KCF A;  1NOY A;  2ETJ A;  3AO5 A;  4FJG A;  1VSE A;  2OA8 A;  2QXF A;  1RTH A;  1O1W A;  1RT2 A;  1RT1 A;  1TKZ A;  1Z25 A;  4O4G A;  4YFU A;  3L2U A;  3AVK A;  5KTQ A;  3QEX A;  4DTN A;  4FLT A;  1XHX A;  1RBR A;  4DQI A;  5HRR A;  4CGG A;  3QIO A;  3D0P A;  3OYF A;  3CG7 A;  4FYD A;  3HP6 A;  3SQ1 A;  1IKY A;  2IOC A;  4GW6 A;  4DFJ A;  4B8A B;  4W5O A;  1D5A A;  4B8C A;  3SUP A;  1VSM A;  3HT3 A;  2I5J A;  4AHC A;  4DF8 A;  1Z26 A;  1T8E A;  3VQC A;  3QLH A;  3AA3 A;  2XY5 A;  4OPK A;  4B08 A;  3AVF A;  2PYJ A;  4B9T A;  4E89 A;  4CEQ A;  2Y1J A;  1VSF A;  4I2Q A;  4N47 A;  4J2A A;  4FZZ A;  3HK2 A;  1IKV A;  1D9F A;  4CF2 A;  1L3S A;  3DYA A;  3KK3 A;  2X6N A;  3LAK A;  4CJ5 A;  2HB5 A;  4CGF A;  2HVH A;  5DMR A;  4CJR A;  2PY5 A;  4CF0 A;  4ELT A;  2OPS A;  5DK5 A;  4DSL A;  4FW1 A;  1NK9 A;  1JLC A;  5J2Q A;  3LPU A;  3EZ5 A;  3MXI A;  4PY5 A;  3HST B;  3L2V A;  3K58 A;  2RN2 A;  1UWB A;  1DTT A;  2XRI A;  3HM9 A;  3KD5 E;  4OGE A;  5HRN A;  3OS0 A;  4B9S A;  2EHG A;  1VSJ A;  4F8R A;  3K5L A;  4CCH A;  5EU7 A;  2DFF A;  3VQP A;  2HNZ A;  3DRP A;  1IKX A;  4CJQ A;  4N56 A;  2EX3 A;  2ITG A;  4CEB A;  1WLJ A;  2D0C A;  2P5O A;  3AVC A;  1X9M A;  4CK2 A;  5J2P A;  3TI0 A;  4DTM A;  4B9N A;  4C8K A;  4J2E A;  4IG0 A;  4CJE A;  5HRP A;  1RDC A;  1KVA A;  3QEW A;  4CIF A;  1VSI A;  5JS2 A;  2G8H A;  2HVI A;  3ZSV A;  1D9D A;  3HJF A;  3F73 A;  4FM2 A;  4E7I A;  2BDP A;  1BIZ A;  4NCA A;  2BGG A;  3SPZ A;  4JLH A;  1T05 A;  1TAU A;  2OPQ A;  2HNY A;  1RDA A;  1QSY A;  1BHL A;  3S3M A;  1HPZ A;  4LH5 A;  3O4N A;  4LH4 A;  4ELV A;  2XY7 A;  2B5J A;  1BQM A;  3DMJ A;  5SWM A;  3V1O A;  3NFA A;  4RW6 A;  3HO1 A;  1RT5 A;  3C94 A;  1IH7 A;  2P5G A;  1QHT A;  2VG6 A;  5I42 A;  3NF7 A;  3VQD A;  4CJF A;  2PYL A;  1NK8 A;  4HUE A;  3MEC A;  3VQE A;  3ITH A;  1N5Y A;  1A5W A;  4C8O A;  4CEZ A;  4OKK A;  3VN5 A;  3P1G A;  4DG1 A;  3I8D A;  1B92 A;  2XHB A;  3SQ2 A;  3B6O A;  3DLB A;  3LAN A;  1S1W A;  4LSL A;  4LSN A;  4W5R A;  3OYG A;  3M8S A;  4PQU A;  3IRX A;  4LY7 A;  4CER A;  1NK0 A;  4O0J A;  3U6F A;  1U4B A;  3TR8 A;  1JLQ A;  4AHV A;  1HJR A;  1YVU A;  4M3Y A;  1VSH A;  3KK1 A;  5KGW A;  3ULD A;  3L2R A;  1NK7 A;  1WSI A;  3DLK A;  4Z4G A;  4FK4 A;  4FJM A;  4IKF A;  1HMV A;  3OY9 A;  4K8X A;  3LAL A;  1QTM A;  4HCB A;  1EX4 A;  4DS5 A;  3RRG A;  1WSG A;  3V9U A;  2G8U A;  2KW4 A;  2KZZ A;  1KSP A;  4M3U A;  4GMJ B;  3OYN A;  4AIL C;  1JXB A;  1WSH A;  2QK9 A;  4OLA A;  4DLG A;  4DTS A;  4FJN A;  3O3F A;  4FXD A;  1U04 A;  2O4G A;  4FLV A;  5C25 A;  4KHQ A;  1YTU A;  3SUO A;  4I9Q A;  1NJX A;  4CHQ A;  3OYI A;  4FCY A;  3QNO A;  3E01 A;  3ZT4 A;  3NCI A;  1C1B A;  2ZE2 A;  3UIQ A;  4RW9 A;  4DSK A;  3BGR A;  3PX0 A;  1RT3 A;  1S6P A;  3DOK A;  4OGC A;  1NJY A;  2KZM A;  2YHB A;  1U45 A;  2IAJ A;  1HYZ A;  3KLG A;  5FRM A;  2RKI A;  3NH2 A;  4AHR A;  4RW7 A;  1EXQ A;  2YKN A;  4CFD A;  2VWK A;  4G1Q A;  3NF9 A;  2GUI A;  1B9D A;  1UA1 A;  1VSK A;  3L2W A;  3THV A;  3U3Y A;  4M3Z A;  3DLG A;  4BE2 A;  2IC3 A;  1CZ9 A;  2YNF A;  1S9E A;  3HPH A;  3HP9 A;  3LWM A;  1SKR A;  1RBV A;  3DRR A;  4C8L A;  2BAN A;  3OS2 A;  4O44 A;  1UA0 A;  1TK5 A;  3SPY A;  2VG5 A;  3LP1 A;  2Z1G A;  1TV6 A;  5FRN A;  1XWL A;  4FJH A;  2KFN A;  4DLE A;  1RCH A;  2JLE A;  4XIU A;  2DTU A;  5KI6 A;  2AJQ A;  3A2F A;  1TKD A;  2WOM A;  1T03 A;  2FBX A;  1Q9Y A;  1T7P A;  1DTQ A;  1WN7 A;  4CK1 A;  3TAQ A;  1XI1 A;  4PA1 A;  4FZY A;  5C42 A;  3EYZ A;  3F9K A;  4QOZ B;  1RNH A;  3S9H A;  3RMC A;  4KHN A;  3AA4 A;  3KK2 A;  4B9M A;  1WAF A;  1S5J A;  4CJP A;  3OYM A;  4FK2 A;  3L3U A;  5HLF A;  1YTA A;  3AO1 A;  1VRU A;  1J9A A;  2OZS A;  1LW0 A;  2IDO A;  3AVA A;  2X78 A;  3TWH A;  2FBV A;  4W5Q A;  1LV5 A;  4DSF A;  4DU1 A;  1IG9 A;  1RT6 A;  2A1R A;  4CGH A;  3SI6 A;  2Y1I A;  4K8Z A;  3T1A A;  4RW4 A;  1SL1 A;  4DU3 A;  4HTU A;  4Y1C A;  3AO2 A;  5KRS A;  4FLX A;  2YNH A;  4CJT A;  1FKO A;  4FLW A;  3NHG A;  1TK8 A;  4ID1 A;  1TVR A;  1G15 A;  3V4I A;  3ZSX A;  3ASM A;  3G10 A;  4CJK A;  2FC0 A;  1JLF A;  4KRF A;  4CEA A;  1I3A A;  4CFC A;  4CIG A;  4I2P A;  3QES A;  1U49 A;  1SKS A;  2ZD1 A;  4MQ3 A;  3JSM A;  1S1T A;  1GOC A;  5I3U A;  1C0T A;  3DLH A;  1RTJ A;  2HND A;  3AV9 A;  2Z1H A;  3HL8 A;  3SQ4 A;  4FJ7 A;  2HHQ A;  4KHU A;  1U47 A;  4CJU A;  1JLG A;  4JS4 A;  4DQS A;  3PY8 A;  4DQP A;  4ELU A;  1K6Y A;  3ZT0 A;  4OPJ A;  1SKW A;  1TKX A;  3KKR A;  1QE1 A;  4AHT A;  1JKH A;  3ZT2 A;  1ZBI A;  3LP0 A;  3D45 A;  1CXU A;  4CEC A;  4M3R A;  3TAM A;  3AO3 A;  3K5O A;  3MED A;  3NH0 A;  3CFP A;  4FJK A;  1L3U A;  4DSJ A;  1RBS A;  4DTO A;  3PX6 A;  2E4L A;  4CF8 A;  1QQC A;  3VQ7 A;  4F3O A;  3SUQ A;  3AVI A;  3DRS A;  2HHV A;  3LAM A;  4MFB A;  3FFI A;  2D5R A;  3EY1 A;  3CFR A;  4PWD A;  2HHX A;  3NH1 A;  3MAQ A;  3OS1 A;  3VQQ A;  3TAG A;  2F8S A;  4DFM A;  3NBP A;  5C24 A;  3NGZ A;  1NOZ A;  4KTW A;  4OKE A;  3AVN A;  3AA5 X;  1WNS A;  2F8T A;  3ZSY A;  3RRH A;  1JXE A;  4JRQ A;  2XY8 A;  5JS1 A;  1VSL A;  3TAF A;  4B9U A;  4NCG A;  2A1S A;  3LDS A;  1W0H A;  1SUQ A;  4AHU A;  3QEV A;  1HYS A;  4B3O A;  4KHW A;  2Z1I A;  4DTR A;  3QET A;  2BE2 A;  3QER A;  4DQQ A;  2IS3 A;  3KLI A;  3V6D A;  4EZ6 A;  3L2Q A;  1KVC A;  2LSN A;  4CEO A;  3OYJ A;  3IAY A;  3OYC A;  1L3V A;  1J53 A;  4N76 A;  1UAX A;  3I0S A;  3QO9 A;  3WNH A;  3KLE A;  2NUB A;  2B4J A;  4IBN A;  3S3O A;  1X9W A;  1S1X A;  3RMD A;  4H8K A;  4DWI A;  3PUF A;  3CQ8 A;  1NK5 A;  4M42 A;  4BDP A;  1XHZ A;  1TK0 A;  1JLA A;  2HHS A;  4DTP A;  2HW3 A;  4CFA A;  3P83 D;  1L5U A;  4AH9 A;  4R5P A;  1LWC A;  2YHA A;  4IFY A;  1VSD A;  1X1P A;  4OLB A;  4FZX C;  3JYT A;  1A5V A;  2GV9 A;  3T19 A;  3OYB A;  4KHS A;  4QCL A;  1BI4 A;  4JS5 A;  4N41 A;  3M8P A;  4CEE A;  5E41 A;  3ZSO A;  4E1M A;  3K57 A;  3QIN A;  1LAV A;  4E7K A;  3RR7 A;  1LAW A;  4KB1 A;  5CZ1 A;  3SUN A;  2YNI A;  4F4K A;  4EP5 A;  1X9S A;  3NDK A;  1ZBL A;  4W5N A;  4FJ9 A;  2DFH A;  4C8M A;  1R0A A;  4M41 A;  1KFS A;  4FJ5 A;  1WSJ A;  3TAN A;  3OYA A;  3LWL A;  4KPY A;  3ALY A;  2HHU A;  1C0M A;  4EP4 A;  3HPG A;  3AVG A;  2G8K A;  2YV0 X;  4KI4 A;  2DY4 A;  1HNV A;  1U48 A;  4HUF A;  4L8R B;  3IS9 A;  4M3X A;  1ASW A;  1EKE A;  1WSF A;  4FW2 A;  3ZSZ A;  3K5M A;  1HNI A;  4CED A;  4CGD A;  1KRP A;  3C95 A;  3V81 A;  3SJJ A;  1FXX A;  1SV5 A;  2O4I A;  1HQU A;  3WNE A;  4M45 A;  3SV4 A;  2QKB A;  3HXM A;  4BDY A;  1GOA A;  1KTQ A;  2DFE A;  3WNG A;  4CE9 A;  4FLZ A;  1RT4 A;  2VG7 A;  1W9H A;  3S3N A;  3C6U A;  1BCO A;  3IG1 A;  5K14 A;  4CJS A;  4CIE A;  3SZ2 A;  3QEP A;  3LPT A;  1SL2 A;  1CLQ A;  3ZCM A;  4FLU A;  1NJW A;  1JL1 A;  3K2P A;  3AVM A;  4WE1 A;  4DF4 A;  4CGJ A;  3KLH A;  3TAB A;  3SCX A;  3K5N A;  3CM6 A;  3QNN A;  3K59 A;  2QKK A;  2X6S A;  3VQ5 A;  4CHO A;  1TL1 A;  2GBZ A;  3VQB A;  1LWF A;  1XC9 A;  3H08 A;  1NKC A;  1RBT A;  3OYH A;  1FK9 A;  4DTU A;  3AVL A;  3V9X A;  1RDB A;  1WSE A;  2RPI A;  5J1E A;  1MU2 A;  3OJU A;  1QSS A;  4KAZ A;  4M3W A;  3NAE A;  4CFB A;  4F2S A;  3SNN A;  4O5B A;  1ZYQ A;  4B9V A;  1D8Y A;  3DLE A;  2G8V A;  4E0D A;  2E6L A;  4IFV A;  4HHT A;  3ZSQ A;  2D0A A;  1KLN A;  5KRT A;  1Y97 A;  4FLY A;  1UOC A;  3O3H A;  4FM1 A;  1GOB A;  3KIO A;  4J2B A;  3HPO A;  3ZT1 A;  5J2N A;  3V9W A;  1I39 A;  2VWJ A;  4BDZ A;  3M8Q A;  3RTV A;  2JGU A;  2WON A;  4F3T A;  4IG3 A;  4BE0 A;  4J2D A;  2G8I A;  2D0B A;  5HBM A;  4CEF A;  3DI6 A;  4DTX A;  2KFZ A;  1RDD A;  1HQE A;  1S1V A;  3NGY A;  3PX4 A;  4PUO A;  1LW2 A;  4Z4H A;  4H4M A;  4ZTF A;  4GVM A;  4CK3 A;  3QEI A;  3PV8 A;  2HHW A;  2B6A A;  1IO2 A;  3V1R A;  1NK4 A;  4CGI A;  4ZTJ A;  5SZT A;  2KQ2 A;  1B9F A;  3ISN C;  1EET A;  3MEG A;  3DLR A;  4RG8 A;  3U3G A;  2YKM A;  4CJV A;  3OJS A;  3RMB A;  1KLM A;  3OYE A;  1Q9X A;  1VRT A;  2OYQ A;  3LP2 A;  4KTZ A;  4EZ9 A;  1BQN A;  4E3S A;  3MXM A;  4ICL A;  3RMA A;  3B6P A;  4E7H A;  4E1N A;  4UQG A;  3HVT A;  3VQ9 A;  3VA3 A;  1C1A A;  3DOL A;  4KFB A;  4Z0U A;  3SYZ A;  4I7F A;  4CHN A;  4DU4 A;  3SQ0 A;  4DSI A;  3G0Z A;  4B9L A;  1BCM A;  4O0I A;  1TAQ A;  1ZBF A;  1EP4 A;  3RWU A;  3PO5 A;  4N5S A;  2G8F A;  1S6Q A;  3ZSW A;  4CHP A;  4DFP A;  4FK0 A;  3L8B A;  1BL3 A;  4F2R A;  4CHY A;  3T3F A;  1VK0 A;  4DS4 A;  1JLB A;  1WAJ A;  1J54 A;  1RTI A;  4HVJ A;  3PO4 A;  4HUG A;  1C0U A;  1RBU A;  5D3G A;  4AHS A;  4Z4F A;  5CYQ A;  4Z4I A;  1BGX T;  1FKP A;  2OZM A;  1QSL A;  1TL3 A;  4KRE A;  4TSX A;  3AO4 A;  3C6T A;  1CXQ A;  4OKJ A;  1J5O A;  3LZJ A;  4FJL A;  3MXJ A;  1N6Q A;  4OVL A;  2G8W A;  4JRP A;  3O4Q A;  1NKB A;  1A5X A;  4QAG A;  4O55 A;  4DQR A;  4DTJ A;  3O3G A;  4ID5 A;  3ZSR A;  3AVJ A;  4CHZ A;  1HYV A;  4DSE A;  4IDK A;  3TAE A;  4E19 A;  3OVN A;  4DFK A;  3LZI A;  3TAP A;  2P1J A;  4FJI A;  3HVR A;  4KV8 A;  3VQ6 A;  1NKE A;  3AA2 A;  1ITG A;  3BDP A;  4CJ4 A;  4KTQ A;  4FJ8 A;  2IGI A;  2P51 A;  3WNF A;  2KTQ A;  3DM2 A;  4KO0 A;  5CY4 A;  3OYD A;  5FRO A;  4NYF A;  1SL0 A;  1NK6 A;  2HMI A;  3CFO A;  2Z1J A; 
#chains in the Genus database with same CATH topology
 5C2D A;  5HRS A;  3A8Y A;  3NGI A;  1W7A A;  2HBJ A;  4C8N A;  1KFD A;  1T6C A;  2OPP A;  3T7Z A;  4I9L A;  1HR0 K;  1YT3 A;  3I0R A;  3IFR A;  4GY2 B;  1NJZ A;  4BRG A;  4CJ3 A;  3CM5 A;  1CZA N;  3R9P A;  4B3R K;  1ZBU A;  2ATQ A;  1EWQ A;  3AGK A;  3BEX A;  3NF8 A;  1LWE A;  1Q86 O;  3V9Z A;  4KHY A;  4B3S K;  4JI4 K;  4YOY A;  2E8A A;  5J2M A;  2Q0U A;  3TAR A;  3VEN A;  3H46 O;  2YNG A;  5ADX A;  4H0X B;  4H4O A;  3LP3 A;  5CYM A;  3P31 A;  4W5T A;  3HYF A;  2HHT A;  4CZH A;  5BR9 A;  1HRH A;  3GE1 A;  4KKO A;  4YNQ A;  5BPL A;  1JLE A;  3EO3 A;  3VA0 A;  5M1O A;  5JLH A;  4FJJ A;  4HCC A;  4DV3 K;  4DR4 K;  3QIP A;  1QQM A;  3WXK A;  5JMV A;  3AO5 A;  4FJG A;  5AQF A;  2QXF A;  1RTH A;  1O1W A;  4O4G A;  4C8O A;  3CMA N;  4FLT A;  1Z05 A;  4AM7 A;  1XHX A;  4B1W B;  4JAX A;  3OYF A;  4DUZ K;  3HP6 A;  4GW6 A;  3M6G A;  3SUP A;  1VSM A;  4AHC A;  4BGB A;  4B9T A;  4LFA K;  2Y1J A;  1Q81 O;  1VSF A;  4I2Q A;  4CD3 A;  3HK2 A;  1J5E K;  1IKV A;  1D4X A;  2RHK A;  3VTH A;  5A2Q O;  1IV0 A;  4CJ5 A;  2HB5 A;  4EAH D;  2HVH A;  2PY5 A;  3L0Q A;  2OPS A;  4FW1 A;  3HST B;  2NRX A;  2RN2 A;  2XRI A;  3LDL A;  3BUZ B;  4OGE A;  3HRG A;  1VSJ A;  3K5L A;  2DFF A;  4N56 A;  2HBL A;  2ITG A;  3QFP A;  2WC9 A;  5J2P A;  4C8K A;  3DJC A;  1KC8 O;  4RWT A;  4CIF A;  3R1X A;  1YVN A;  5AQN A;  1D9D A;  3HJF A;  4FM2 A;  2BGG A;  3MCP A;  4FOI A;  2YJF A;  2OPQ A;  4FWQ A;  1QSY A;  5FPN A;  3R8E A;  4BC3 A;  3UE5 A;  4RW6 A;  4U67 L;  1RT5 A;  3C94 A;  3H3N O;  4C1N I;  5I42 A;  2W6L A;  3IKM A;  1BUP A;  1NK8 A;  1IJJ A;  4XH4 A;  5EX5 A;  3VN5 A;  3SQ2 A;  2XHB A;  2ASM A;  1NM1 A;  4DB3 A;  3WXL A;  4W5R A;  5LJV A;  4LY7 A;  1NK0 A;  4JYA K;  1HJR A;  4M3Y A;  3KK1 A;  4BRC A;  4BR0 A;  1YHQ N;  3OY9 A;  3JS6 A;  5LY3 A;  1YXQ A;  1JCF A;  1WSG A;  2KW4 A;  4CZJ A;  4M3U A;  5AQI A;  2QK9 A;  3P39 A;  4OLA A;  2W40 A;  1U04 A;  3GG4 A;  4KHQ A;  4FLV A;  5C25 A;  3PSI A;  5E26 A;  5BPN A;  1NWK A;  3E01 A;  2AA4 A;  2ZE2 A;  3BGR A;  3PX0 A;  1RT3 A;  4GVE A;  2QXL A;  4GNI A;  3MX5 A;  1U45 A;  3TSP A;  4AHR A;  2YKN A;  5AR0 A;  4CFD A;  1VQK N;  1UA1 A;  1MWM A;  1WUA A;  1T3V A;  3QML A;  4BG9 A;  4BE2 A;  2IC3 A;  3HPH A;  2FLO A;  2GX9 A;  3FGU A;  2NNW A;  3DRR A;  2BAN A;  2CGK A;  3SPY A;  3BF1 A;  1GLE G;  3G71 N;  5FRN A;  3FR0 A;  4DLE A;  3BY5 A;  2OAN A;  2P9U B;  4FO0 A;  3A2F A;  2WOM A;  3M3Z A;  1XI1 A;  3FZF A;  4QOZ B;  2V7Y A;  2QWN A;  4H0V B;  5DM7 L;  2FF6 A;  4B9M A;  4CJP A;  3L3U A;  4JKF A;  3AO1 A;  3MN5 A;  1VRU A;  1IG8 A;  2YCH A;  3AVA A;  2F9T A;  4W5Q A;  1IG9 A;  1X3M A;  4HTU A;  5IT9 O;  3AO2 A;  4B1X B;  4FLW A;  3NHG A;  2FC0 A;  3PIP L;  4KRF A;  4CEA A;  1I3A A;  4YOV A;  4CIG A;  3JSM A;  3DLH A;  5I3U A;  4NLB A;  2HND A;  3AV9 A;  2Z1H A;  1VQL N;  5AQS A;  3PY8 A;  4BVP A;  1K6Y A;  3TTD A;  3ZLJ A;  3D45 A;  2FSN A;  4A5A A;  3VOV A;  3NMU A;  1NLV A;  2E1Z A;  3DRS A;  3LAM A;  2DPN A;  3UKR A;  2GWJ A;  3SLC A;  3MAQ A;  5C24 A;  1HNZ K;  1NOZ A;  1WNS A;  1VQ6 N;  3MWT A;  3ZSY A;  4JRQ A;  1N32 K;  4ISF A;  3LDS A;  4LF7 K;  1HKB A;  2VWB A;  4KHW A;  4IEE A;  3QET A;  3QER A;  2IS3 A;  3CJA A;  4MO5 A;  3OYC A;  1L3V A;  3I0S A;  4IOX A;  1VQP N;  1S1X A;  4M42 A;  3CQ8 A;  2HHS A;  4DTP A;  3P83 D;  4EIA A;  4AH9 A;  4IFY A;  1X1P A;  2I7P A;  4IXC A;  2GEM A;  3ZEU A;  4OLB A;  2GV9 A;  2Q0R A;  4CEE A;  4KB1 A;  1LAW A;  4H5T A;  3GL1 A;  3SUN A;  3VGL A;  1X9S A;  1ZBL A;  3ULE A;  2NRR A;  2DFH A;  4DV0 K;  1R0A A;  4KPY A;  1C0M A;  3CHW A;  3ATV A;  3G6E N;  4JI0 K;  4QS8 A;  2F7T A;  1ASW A;  1WSF A;  1HNI A;  1KRP A;  3SJJ A;  5M1P A;  4LFC K;  1FXX A;  3WQT A;  1HQU A;  4DV4 K;  3SV4 A;  2QKB A;  4BDY A;  1KAX A;  3OW2 M;  1DKG D;  5F1X A;  4IWV A;  3VTI A;  3VF2 A;  1W9H A;  3S3N A;  2A41 A;  2ZJP L;  5M1N A;  4FLU A;  3VPZ A;  3K2P A;  3SCX A;  4CGJ A;  1W2B M;  2X6S A;  3VQ5 A;  4CHO A;  1TL1 A;  2GBZ A;  1LWF A;  1K8K A;  3OYH A;  1OVY A;  4DTU A;  3V9X A;  5J1E A;  1MU2 A;  4JI6 K;  4E0D A;  2E6L A;  3SBT A;  2O8B B;  3ZT1 A;  3V9W A;  5CHI A;  3M8Q A;  3RTV A;  4JHD B;  5I9E B;  3DI6 A;  2UXC K;  2KFZ A;  1RDD A;  3DXK B;  4JKG A;  4ZTF A;  4GVM A;  5F0X A;  4CJ7 A;  2HHW A;  1IO2 A;  3V1R A;  4CGI A;  4ZTJ A;  4IOC L;  3NVK A;  2QTD A;  3H1Q A;  3U3G A;  4FJ8 A;  1KQS M;  4RG8 A;  3OJS A;  2YKM A;  1Q9X A;  1KLM A;  1ATN A;  3L6Q A;  3FZL A;  3LP2 A;  4ICL A;  4E7H A;  3VQ9 A;  3VA3 A;  4KFB A;  4BR5 A;  4M63 C;  4CHN A;  4DSI A;  3DXK A;  3G0Z A;  4O0I A;  1ZBF A;  1EP4 A;  1K73 O;  4CHP A;  4CHY A;  3T3F A;  1JLB A;  2OCE A;  4LFB K;  1RTI A;  3PO4 A;  3SAF A;  1RBU A;  4AHS A;  3M5R A;  4Z4F A;  5BN8 A;  3SAH A;  1FKP A;  5AQP A;  4TSX A;  3CCS N;  3MXJ A;  3O4Q A;  3LM2 A;  2YJE A;  1NKB A;  4DTJ A;  4O55 A;  5KPZ A;  4UY8 O;  4CZK A;  4CHZ A;  3VEO A;  1HYV A;  3TAE A;  4E19 A;  3LZI A;  2WFB A;  3E1Y A;  2ASP A;  3VQ6 A;  3VEW A;  3BDP A;  2P51 A;  3OYD A;  4KO0 A;  5CY4 A;  1ESV A;  4NYF A;  2UXB K;  1RDW X;  3ID6 A;  2J4R A;  4JKB A;  1C0F A;  3FZH A;  3THW A;  3T1H K;  4DR7 K;  1H1V A;  2FSK A;  4NB4 A;  3VQ4 A;  3R3L A;  3LDP A;  4WFA L;  5C15 A;  1N34 K;  4KI6 A;  1ASV A;  3NE6 A;  1CZB A;  4RW8 A;  1BI4 B;  3CYM A;  1BIS A;  4QCL A;  1RT7 A;  2PZS A;  1QS4 A;  5TKW A;  4YDU A;  3KTQ A;  2E6M A;  4IZ9 A;  3A5M C;  3I8B A;  3THY A;  1IBL K;  2FBT A;  4PHT X;  3NVM A;  2P9K B;  1HPM A;  1GLD G;  3KLF A;  1HLU A;  4E7L A;  4BQL A;  1ZC6 A;  4CF9 A;  4ISG A;  4FVM A;  2GEL A;  2E2Q A;  4BAC A;  3A5L C;  4KB0 A;  3OYL A;  2R7Y A;  1ZBH A;  4YDU C;  1FW6 A;  3AVB A;  1NOY A;  1VSE A;  4YFU A;  3QEI A;  1RT2 A;  4ILH A;  4DTN A;  1SAZ A;  1MDU B;  1RBR A;  5HRR A;  3QIO A;  4CZM A;  1NBW A;  4FYD A;  4IO8 A;  3SQ1 A;  2IOC A;  3FZM A;  4B8A B;  4W5O A;  4B8C A;  4DF8 A;  1Z26 A;  3QLH A;  4DV2 K;  1U2V A;  3MK6 A;  4LF9 K;  4B08 A;  2PYJ A;  4LF6 K;  2A40 A;  4FZZ A;  4J2A A;  4M7X A;  5F2R A;  4MDB A;  1L3S A;  1GLF O;  3DYA A;  3H6E A;  3LDQ A;  3KK3 A;  4CGF A;  4CZG A;  1GLJ O;  1RFQ A;  4DSL A;  3ZYY X;  2Q36 A;  3L2V A;  1RGI A;  3EKS A;  4JNE A;  4B9S A;  3SMS A;  2VCP A;  1HNW K;  4CJQ A;  3VQP A;  4FVU A;  2EX3 A;  4DR5 K;  4CEB A;  3THX A;  1OVQ A;  3AVC A;  3CCE N;  3WT0 A;  4B9N A;  4J2E A;  4IG0 A;  1Q82 O;  2UUB K;  3QEW A;  2CH5 A;  3EEQ A;  2G8H A;  3ZSV A;  4BRN A;  4DV6 K;  3SPZ A;  2HNY A;  4C1N K;  4BR2 A;  1ATR A;  3I55 N;  3S3M A;  2IIR A;  4ELV A;  2XY7 A;  3DMJ A;  3THX B;  2P5G A;  1ZXO A;  3NF7 A;  4CJF A;  2PYL A;  3MEC A;  4KH6 A;  4OKK A;  3P1G A;  3B6O A;  5AQV A;  4CZI A;  2P9U A;  3LAN A;  4LSN A;  5JVG L;  1YF5 L;  5M1Q A;  3I56 N;  3IRX A;  5TKY A;  4CER A;  1U4B A;  4FL9 A;  5JIC A;  2HST A;  5KGW A;  5GAD P;  1WSI A;  3CJ1 A;  5AQM A;  4IKF A;  4M7Y A;  2OTL N;  1OH5 A;  4DS5 A;  3RRG A;  3V9U A;  1JXB A;  1IBK K;  2CH6 A;  4DLG A;  1BA1 A;  3CC4 N;  3CCJ N;  2O4G A;  5AQW A;  2FF3 B;  4X66 K;  4I9Q A;  4H0O A;  4H5N A;  4KH4 A;  2O8D A;  4CHQ A;  5IWA K;  3N4P A;  3ZET A;  1C1B A;  4RW9 A;  4DSK A;  5AQY A;  2O8E B;  3E9L A;  1NJY A;  3DOK A;  4BRA A;  3O9S A;  2IAJ A;  1HYZ A;  3KLG A;  5FRM A;  4RW7 A;  3OTO K;  1VAZ A;  4G1Q A;  2A6A A;  2GUI A;  4I6M B;  5BRD A;  4LC9 B;  3THV A;  3KWG A;  1X9J A;  2P9N B;  3HP9 A;  3LWM A;  3ZX2 A;  1DEJ A;  1RBV A;  4C8L A;  5BRF A;  1YUW A;  3OS2 A;  1UA0 A;  1TK5 A;  2VG5 A;  1HKC A;  1NGB A;  1TV6 A;  2Z1G A;  4BRP A;  4DCH A;  5GAE P;  2JLE A;  4XIU A;  2DTU A;  3CJ9 A;  5KI6 A;  2AJQ A;  4CZF A;  4YOX A;  1WN7 A;  1NGA A;  5AQL A;  1EWR A;  5C42 A;  3EYZ A;  3F9K A;  3ID8 A;  1RNH A;  3AA4 A;  2QI2 A;  5HLF A;  4IDH A;  1J9A A;  2OZS A;  1LW0 A;  2X78 A;  2FXU A;  2HBM A;  2FBV A;  4M3W A;  4Z4E A;  4K8Z A;  3SI6 A;  3T1A A;  4RW4 A;  1SL1 A;  4DU3 A;  5CE3 A;  4Y1C A;  4ID1 A;  3WXM B;  5AZJ A;  5LMN K;  3V4I A;  2YHY A;  3ASM A;  2W6K A;  1JLF A;  4I2P A;  1U49 A;  1SKS A;  1C0T A;  3JXU A;  4FSV A;  1JJ2 M;  3SQ4 A;  2HHQ A;  2HF3 A;  4KHU A;  4CJU A;  4JS4 A;  4DQS A;  4BRD A;  1VQ7 N;  3ZX0 A;  3O1B A;  1GLL O;  5BR8 K;  3KKR A;  4AHT A;  1JKH A;  3U8X A;  1CXU A;  3LM9 A;  3AO3 A;  3K5O A;  3MED A;  1VQ5 N;  4DSJ A;  4RTF D;  1RBS A;  4DTO A;  4H0P A;  3PX6 A;  3W3D A;  2E4L A;  4BRL A;  3CXC M;  1NG9 A;  2D5R A;  3HM8 A;  4JK8 A;  3QDK A;  3OS1 A;  4IEI A;  4DFM A;  3NBP A;  3NGZ A;  4A2B A;  3VEV A;  3MX2 A;  4KTW A;  1OH8 A;  2E88 A;  3RRH A;  3D2F A;  2ZM6 K;  2XY8 A;  1VSL A;  1FJG K;  1W0H A;  1SUQ A;  5AQK A;  2Z1I A;  3C0B A;  4DTR A;  2BE2 A;  4DQQ A;  3KLI A;  4BRF A;  1KVC A;  3OYJ A;  1GLB G;  4DR3 K;  4N76 A;  4JKA A;  3WNH A;  3RSE B;  3RMD A;  4DWI A;  1NK5 A;  1VQN N;  1XHZ A;  1TK0 A;  1JLA A;  2HW3 A;  1L5U A;  4R5P A;  1LWC A;  2YHA A;  3D2F B;  3OYB A;  4N41 A;  4IFE A;  3K57 A;  4E1M A;  3J80 O;  1LAV A;  2V51 B;  3MDQ A;  5CZ1 A;  4OO1 J;  1Q7Y O;  4EP5 A;  3O9R A;  4WYB A;  4M41 A;  3MWP A;  4NXM K;  4FJ5 A;  3RSE A;  3ALY A;  4EP4 A;  3HPG A;  4IOA L;  1SQK A;  1U48 A;  4HUF A;  4FWP A;  4L8R B;  2F4V K;  3MN7 A;  3V81 A;  4ILG B;  3C65 A;  3O1W A;  3WNE A;  5GAG P;  5B8H A;  4WQ5 C;  4MO4 A;  1RDU A;  2DFE A;  2F9W A;  2VG7 A;  3CER A;  5KPT A;  1BCO A;  3LPT A;  3QBX A;  3ZCM A;  3ENH A;  1NJW A;  3ENO A;  3TU5 A;  3AVM A;  4WE1 A;  3TAB A;  3KLH A;  3CM6 A;  3K59 A;  3GBT A;  3VQB A;  4CBU A;  3OJU A;  2RPI A;  5FPM A;  2D1K A;  4F2S A;  3WQU A;  3SNN A;  5AQZ A;  3OBY A;  4BRK A;  3ZSQ A;  2D0A A;  1KLN A;  5KRT A;  4FLY A;  3O3H A;  2NRW A;  1GOB A;  5J2N A;  2JGU A;  3UB5 A;  3AAP A;  1QVG M;  4Z4H A;  3EL2 A;  3PV8 A;  2VQE K;  1NK4 A;  1NU0 A;  1B9F A;  3ISN C;  1EET A;  4CJV A;  3HBT A;  2HMP A;  1VRT A;  4EZ9 A;  3CD6 N;  3EN9 A;  3RMA A;  3B6P A;  1HJO A;  1BG3 A;  2WBN A;  3OA9 A;  4WCE L;  4Z0U A;  4I7F A;  4BGA A;  2QWQ A;  3HSC A;  5C12 A;  3VEZ A;  1TAQ A;  2D0P A;  3H3O B;  4JKD A;  3PO5 A;  4FK0 A;  4F2R A;  1VK0 A;  3DAW A;  4DS4 A;  1WAJ A;  3HZ6 A;  2AP1 A;  4HUG A;  1C0U A;  5CYQ A;  4Z94 A;  5C0Y A;  4FPB A;  2OZM A;  1NGC A;  1QSL A;  4KRE A;  5ADX H;  3BP8 A;  3FZK A;  3C7N B;  1N6Q A;  4JD2 B;  4JRP A;  4DQR A;  3O3G A;  3WEE B;  3OBW A;  3K9K A;  1U6Z A;  3EKU A;  4BRE A;  4JKH A;  4CJ4 A;  2I7N A;  2UXD K;  1NK6 A;  3BF3 A;  2HMI A;  2E2O A;  3CFO A;  4E1J A;  1JCG A;  4JV5 K;  3CET A;  2KLA A;  5KGX A;  3V9S A;  1KVB A;  4BRI A;  4HWI A;  3WEE A;  3KD1 E;  2XY6 A;  4WQ4 C;  2E1Y A;  4CJW A;  4M3T A;  3SV3 A;  4LF4 K;  1HUX A;  4NYN A;  5HRO A;  3VQA A;  1E4F T;  4Y1D A;  4X62 K;  5EOY A;  5AJ3 K;  3L3V A;  4BWJ A;  4BC5 A;  3P5J A;  2ZQB A;  4E7J A;  1ASU A;  3CJ7 A;  5CZ2 A;  1S1U A;  4FJX A;  2NRV A;  4LD0 A;  3CCV N;  1F21 A;  2E2P A;  2FBY A;  1T44 A;  4DUY K;  3MEE A;  2XO7 A;  1C6V A;  2YHW A;  4DR2 K;  4NCB A;  1W97 L;  5T7B A;  1Q8I A;  5BPM A;  5FPD A;  4O5F A;  3LDN A;  1LOT B;  3VQ8 A;  5H1S Q;  3K9J A;  2A3Z A;  3DLL L;  3T69 A;  2QWL A;  4WFN L;  4H5W A;  2IVP A;  5LL6 Z;  1BWF O;  1TGO A;  2VGN A;  3DXM B;  3O4W A;  2W42 A;  2PAV A;  2VYP A;  1BU6 O;  5HP1 A;  1OH6 A;  1KCF A;  2ETJ A;  2NRH A;  1YIJ N;  2P9I B;  1RT1 A;  1TKZ A;  1Z25 A;  3ZEU B;  3L2U A;  1NJI O;  2H3G X;  4JI7 K;  1TYQ B;  4DQI A;  1M90 O;  4CGG A;  4IO9 L;  3D0P A;  4XH5 A;  1QQO A;  3QBW A;  4O8U A;  4DFJ A;  1D5A A;  3HT3 A;  5LMU K;  3VQC A;  3AA3 A;  2XY5 A;  4OPK A;  3ATU A;  3KVG A;  4N47 A;  1D9F A;  4CF2 A;  1TYQ A;  3BZC A;  4DR1 K;  4ELT A;  2NLX A;  1R59 O;  3E9O A;  5J2Q A;  3EZ5 A;  3K58 A;  1UWB A;  1DTT A;  3KD5 E;  3OS0 A;  1GLA G;  4F8R A;  4CCH A;  5EU7 A;  1HKG A;  3DRP A;  2P9S B;  4CI6 A;  3I33 A;  3O8M A;  4BRH A;  1WLJ A;  4DKW A;  2D0C A;  3O9Q A;  5AFU H;  2ZF5 O;  1X9M A;  3QIC A;  4CK2 A;  4YHH K;  4WQ5 A;  5GIN A;  1HX1 A;  3UKU A;  5HRP A;  1RDC A;  2ZJQ L;  4KHP K;  3HOT A;  3KHY A;  3D7E O;  3L4I A;  5JS2 A;  2HVI A;  3F73 A;  4E7I A;  4JLH A;  2A5X A;  1TAU A;  1SZ2 A;  3WXI A;  4AF1 A;  4JK9 A;  1YAG A;  1HPZ A;  4LH5 A;  4K25 A;  4I6M A;  3HO1 A;  2B5J A;  1BQM A;  5SWM A;  4NO7 A;  3V1O A;  3PIO L;  1IH7 A;  1QHT A;  4OPH A;  3VQD A;  3SMP A;  4HUE A;  3QB0 A;  1N5Y A;  1TUU A;  4CEZ A;  3I8D A;  4DG1 A;  4CZL A;  4JI2 K;  4LSL A;  3OYG A;  5AQO A;  3O5B A;  3U6F A;  4AHV A;  1VSH A;  3ULD A;  3L2R A;  2QEX N;  4FWM A;  1Q18 A;  4HCB A;  4K0K K;  1EX4 A;  3SK3 A;  3CCQ N;  1WSH A;  4DHY A;  3MN9 A;  1P8Z A;  1K8A O;  4L3Q A;  3SUO A;  1NJX A;  5KQD A;  4BQZ A;  3OYI A;  3NCI A;  2QWP A;  2ITM A;  1S6P A;  4OGC A;  2HHH K;  4A57 A;  2KZM A;  2YHB A;  1EQY A;  1M1K O;  4FWL A;  2RKI A;  3NH2 A;  1VQ4 N;  5AQG A;  4MLE A;  3NF9 A;  4MDA A;  2Q31 A;  2UU9 K;  1XNQ K;  1BO5 O;  4FPA A;  3L2W A;  3U3Y A;  4M3Z A;  3DLG A;  2YNF A;  1S9E A;  4A2A A;  4A62 A;  3MN6 A;  2QA4 N;  3O80 A;  5C10 A;  1XWL A;  4FJH A;  1RCH A;  1TUY A;  2GUP A;  3Q7B A;  1DTQ A;  4JKG B;  3TAQ A;  3W0L A;  4FZY A;  4PA1 A;  3EZW A;  4BRM A;  3J7Y P;  3F9M A;  3S9H A;  3RMC A;  1VQO N;  4KHN A;  4EFH A;  1S5J A;  4FK2 A;  3OYM A;  1YTA A;  3RVC A;  2IDO A;  4BRQ A;  2IVO A;  2QW9 A;  3J7Z O;  1LV5 A;  2A1R A;  4CGH A;  2Y1I A;  1Y64 A;  2P9K A;  3N4Q A;  4GKK K;  5KRS A;  4KH5 A;  4CJT A;  1DGK N;  5AFU A;  4FLX A;  1FKO A;  2ZWH A;  1G15 A;  3F5T A;  4CBX A;  4GV6 A;  1GOC A;  4BG8 A;  4BC4 A;  1U47 A;  1JLG A;  4DQP A;  3H45 C;  3ZT0 A;  4OPJ A;  1SKW A;  1TKX A;  2UYT A;  1QE1 A;  1ZBI A;  1QHA A;  3LP0 A;  4K42 A;  4BR4 A;  3TAM A;  4JI5 K;  1L3U A;  3G25 A;  4CF8 A;  1S22 A;  3VQ7 A;  3C6H A;  2HHV A;  4MFB A;  1YJN N;  4YOW A;  4GV3 A;  3TAG A;  3VQQ A;  4A5B A;  1J6Z A;  3CI5 A;  3CJC A;  4OKE A;  3AA5 X;  3J8A A;  1U2V B;  2F8T A;  3SBG A;  1JXE A;  3A0I X;  3TAF A;  2A1S A;  3QEV A;  1HYS A;  4B3O A;  3E66 A;  4EZ6 A;  4CEO A;  4X65 K;  3IAY A;  4AM6 A;  5ELZ A;  1J53 A;  1UAX A;  3QO9 A;  2W41 A;  1KAZ A;  3PUF A;  4BDP A;  4OPA A;  4LF5 K;  4CFA A;  5LJW A;  1VSD A;  4CW7 B;  2QWO A;  1K9M O;  4FZX C;  3JYT A;  3T19 A;  4DV7 K;  1BI4 A;  4JS5 A;  5E41 A;  3TPQ A;  4E7K A;  2YNI A;  4F4K A;  1SS6 A;  4FJ9 A;  4C8M A;  1KFS A;  3VEY A;  2IVN A;  3OYA A;  2G8K A;  1XQS C;  3AVG A;  2YV0 X;  3ZSZ A;  3K5M A;  4CED A;  3F2K A;  3C95 A;  1ZBS A;  1KXP A;  1XC3 A;  4M45 A;  3HXM A;  3CQX A;  1BA0 A;  1VHX A;  1KD1 O;  1G99 A;  3CC7 N;  1GOA A;  1KTQ A;  3CC2 N;  4CE9 A;  4FLZ A;  3C6U A;  4CIE A;  4B1Y B;  4CJS A;  1SL2 A;  2O8C A;  3U9D A;  4V19 S;  3Q7C A;  1JL1 A;  4DF4 A;  2QKK A;  3K5N A;  4NLC A;  2A42 A;  1C0G A;  3K0S A;  1RBT A;  4H0T B;  4KBO A;  4FWS A;  4PKG A;  4EHT A;  2HHU A;  3GOI A;  3SJH A;  3C7N A;  1QSS A;  4JD2 A;  4H5V A;  4CFB A;  3NAE A;  4O5B A;  1ATS A;  1ZYQ A;  4B9V A;  1D8Y A;  4NXN K;  1P90 A;  3DLE A;  2G8V A;  4IFV A;  2HBK A;  1UOC A;  2QWM A;  4RCH A;  4FM1 A;  2NZT A;  3H1V X;  3HPO A;  2VWJ A;  4BDZ A;  2YI1 A;  4B1V A;  3B8A X;  2WON A;  4F3T A;  2G8I A;  5HBM A;  3MCA B;  1S1V A;  3NGY A;  1XMO K;  1LW2 A;  1V4T A;  4H4M A;  2O8D B;  4FWR A;  2Q2R A;  4CK3 A;  4C23 A;  2B6A A;  3AAR A;  5SZT A;  2JWK A;  4QS9 A;  1VQM N;  3MEG A;  3RMB A;  3DLR A;  2VGM A;  3G4S N;  3OYE A;  4KTZ A;  5JVH L;  4JKC A;  4YOU A;  4E1N A;  3HVT A;  3S41 A;  4WQ4 A;  4B9L A;  2P9N A;  3RWU A;  3KWI A;  2QM1 A;  4XEI A;  2OTJ N;  1S6Q A;  4DFP A;  3QFU A;  4BC2 A;  2E2N A;  3J7A P;  3VEX A;  5AQT A;  1YIT N;  4HVJ A;  3KZB A;  3ENB A;  1OH7 A;  5D3G A;  4U7B A;  5AQU A;  3AAQ A;  1BGX T;  1OKJ A;  3C6T A;  4OKJ A;  1CXQ A;  4A59 A;  1J5O A;  3LZJ A;  2Q97 A;  2G8W A;  1A5X A;  4QAG A;  4DV1 K;  3P38 A;  3IDH A;  4IDK A;  1N33 K;  1E4G T;  2P1J A;  4FJI A;  3HVR A;  3GDQ A;  1NGJ A;  3P4I A;  1NKE A;  4FWO A;  3AA2 A;  1ITG A;  4GKJ K;  2IGI A;  3WNF A;  2ZGY A;  4DV5 K;  5EVZ A;  5FRO A;  1GLC G;  4R79 A;  5AZJ B;  4WFB L;  2Z1J A;  1XMQ K;  2ZJR L;  1BIU A;  4ZHR A;  3VF4 A;  4Y0W A;  3RR8 A;  5FLX O;  5FDL A;  2PBD A;  3NF6 A;  4CES A;  1TKT A;  2D4W A;  2OPR A;  2Q3S A;  3VGK A;  3VMF B;  4CJL A;  3KJV A;  2UUA K;  4CVN E;  3AY9 A;  3M8R A;  4CBW A;  4BWM A;  1RTD A;  3ZET B;  5CR4 A;  4DMN A;  3V1Q A;  5FPE A;  4B3T K;  1S9G A;  1DLO A;  2O8E A;  3KKS A;  2X74 A;  2RF2 A;  4BE1 A;  1BDG A;  4CF1 A;  1NNE A;  5AQX A;  4OJR A;  4FM0 A;  4Q0B A;  1Z6R A;  3OYK A;  1REV A;  4JN4 A;  4MLH A;  4B1U B;  1IBM K;  2GWK A;  4Q5V A;  1L3T A;  1JL2 A;  3A5N C;  1WOQ A;  3OHR A;  4JEP A;  2O8F A;  3ZT3 A;  2F96 A;  3U4L A;  1IKW A;  3VES A;  3AVH A;  4Z4C A;  3CCU N;  1RIL A;  1C1C A;  2OA8 A;  2V52 B;  3QEX A;  3PSF A;  3AVK A;  5KTQ A;  1K8K B;  4ILJ A;  2D0O A;  5BRE A;  3CG7 A;  3UKR B;  4JI8 K;  5DM6 L;  1IKY A;  1DT9 A;  1WBD A;  3M1F A;  2I5J A;  1T8E A;  2WUS A;  4GV9 A;  3CJB A;  2O8B A;  4HTL A;  3AVF A;  1HNX K;  4E89 A;  3SAG A;  1I94 K;  4CEQ A;  1NGE A;  5GIO A;  1XUP O;  3IMX A;  3TTC A;  3FE1 A;  3O08 A;  2RE2 A;  2X6N A;  3LAK A;  3O6W A;  5DMR A;  4CJR A;  4CF0 A;  4X64 K;  4K43 A;  5DK5 A;  2HF4 A;  1NMD A;  1NK9 A;  3IUC A;  3CF5 L;  1JLC A;  3MXI A;  3LPU A;  4PY5 A;  4PL8 A;  3HM9 A;  5HRN A;  2EHG A;  2NRZ A;  4O8K A;  1YI2 N;  2HNZ A;  1IKX A;  5AQR A;  2P5O A;  3L4Q A;  3ULE B;  3TI0 A;  4DTM A;  3CQY A;  4CJE A;  3WUH A;  1KVA A;  4CD1 A;  1QZ6 A;  1VSI A;  3BZK A;  3KK7 A;  2FSJ A;  2BDP A;  1BIZ A;  4NCA A;  1S72 N;  1T05 A;  1RDA A;  1BHL A;  2CGL A;  3T1Y K;  3O4N A;  4LH4 A;  3NFA A;  5AQH A;  3C6A A;  1LCU A;  2VG6 A;  2UUC K;  3VGM A;  2NRT A;  3VQE A;  3ITH A;  1A5W A;  4EHU A;  1O13 A;  5GIP A;  2E5L K;  1B92 A;  3DLB A;  1X3N A;  1S1W A;  4A61 A;  3M8S A;  4PQU A;  4WF9 L;  4O0J A;  1NMN A;  3TR8 A;  1JLQ A;  1E3M A;  5KPR A;  2HOE A;  4BR7 A;  1YVU A;  1NK7 A;  3DLK A;  3CCL N;  4Z4G A;  3DWL A;  4FJM A;  4FK4 A;  1NGG A;  1HMV A;  2ASO A;  4H5R A;  4K8X A;  3LAL A;  3TSQ A;  1QTM A;  1MA9 B;  2G8U A;  2KZZ A;  3AGR A;  4FOE A;  1KSP A;  4GMJ B;  3OYN A;  4AIL C;  4JHD A;  4DTS A;  4FJN A;  3O3F A;  4FXD A;  1YTU A;  4FWK A;  3HTV A;  1QZ5 A;  1NGF A;  4FCY A;  3QNO A;  3ZT4 A;  3UIQ A;  2PFU A;  5E84 A;  5KQ8 A;  3J81 O;  3PLA A;  1EXQ A;  2VWK A;  4H03 B;  1B9D A;  1VSK A;  4YOT A;  1CZ9 A;  1SKR A;  4JK7 A;  3R6M A;  4O44 A;  3LP1 A;  3CME N;  1S3X A;  2P9L A;  2KFN A;  4PKH A;  1TKD A;  1T03 A;  4B3M K;  2FBX A;  1Q9Y A;  3EE8 A;  5M1F A;  3VF6 A;  1T7P A;  4CK1 A;  5C2F A;  2YX6 A;  4K41 A;  4JKE A;  4BRO A;  4CZE A;  4PKI A;  3KK2 A;  3LDO A;  1WAF A;  3VET A;  2BUP A;  2P9L B;  3ZX3 A;  2YHX A;  3TWH A;  1QQN A;  4DSF A;  4DU1 A;  1RT6 A;  2KKZ A;  4B9Q A;  3CCM N;  2YNH A;  1WBB A;  1TK8 A;  5HL7 L;  1TVR A;  3THW B;  3ZSX A;  3G10 A;  4CJK A;  4JI3 K;  4CFC A;  3QES A;  2P9P A;  2ZD1 A;  4MQ3 A;  1S1T A;  3EE9 A;  4J8F A;  1RTJ A;  3HL8 A;  4FJ7 A;  2WTU A;  3DXM A;  5EXW A;  4ELU A;  1N36 K;  3ZT2 A;  4LF8 K;  1YJ9 N;  4CEC A;  4M3R A;  4BR9 A;  4G9Z A;  3NH0 A;  4FJK A;  3CFP A;  1YJW N;  3MMV A;  1QQC A;  2P9P B;  4F3O A;  3SUQ A;  3AVI A;  3FFI A;  3EY1 A;  3CFR A;  4PWD A;  2HHX A;  3THY B;  3U9Z A;  3NH1 A;  2F8S A;  4YOR A;  3AVN A;  2O8C B;  4YY3 K;  4DR6 K;  1KAY A;  5JS1 A;  1XNR K;  4B9U A;  4NCG A;  4AHU A;  3V6D A;  4OX9 K;  3L2Q A;  2LSN A;  3TSU A;  3KLE A;  2NUB A;  2B4J A;  4IBN A;  4XH1 A;  3S3O A;  1X9W A;  4H8K A;  5EY4 A;  2KHO A;  2GTD A;  1NGH A;  1A5V A;  4KHS A;  3M8P A;  3TTF A;  3ZSO A;  3QIN A;  4FWN A;  3RR7 A;  2V7Z A;  2ZGZ A;  3NDK A;  4W5N A;  3HI0 A;  1WSJ A;  3JAM O;  3TAN A;  3LWL A;  3CPE A;  5AQJ A;  2DY4 A;  4KI4 A;  1HNV A;  3IS9 A;  4M3X A;  1EO1 A;  1EKE A;  4FW2 A;  4CGD A;  1WB9 A;  5GAH P;  1SV5 A;  2O4I A;  5JLF A;  5AQQ A;  3CPW M;  1VQ8 N;  3WNG A;  1JCE A;  1RT4 A;  3O9U A;  3SZ2 A;  3IG1 A;  3O9T A;  5K14 A;  2BTF A;  3QEP A;  3D2E A;  5MLC Q;  1CLQ A;  4BVO A;  2P9I A;  3CCR N;  1V4S A;  4PL7 A;  3QNN A;  4ISE A;  4BY9 C;  1XC9 A;  3H08 A;  1NKC A;  1FK9 A;  3D6R A;  3AVL A;  1RDB A;  1WSE A;  4KAZ A;  4AQY K;  3WXJ A;  3LL3 A;  4HHT A;  1N8R O;  1Y97 A;  3D2E B;  3KIO A;  4J2B A;  1I39 A;  1MWK A;  4IG3 A;  4BE0 A;  4J2D A;  2D0B A;  4CEF A;  4IJA A;  4DTX A;  2CGJ A;  2JWL A;  1HQE A;  3VER A;  3PX4 A;  4PUO A;  1T6D A;  3A5O C;  1VQ9 N;  2KQ2 A;  5HOO A;  1ILY A;  2OYQ A;  2QWR A;  1BQN A;  4E3S A;  1BOT O;  3MXM A;  4UQG A;  1C1A A;  3DOL A;  4QS7 A;  3SYZ A;  3FFK B;  2P9S A;  4DU4 A;  3SQ0 A;  2EWS A;  4B1Z A;  4JI1 K;  1BCM A;  5M1K A;  4N5S A;  2G8F A;  3FLC O;  3ZSW A;  2Q1N A;  2E20 A;  3L8B A;  1BL3 A;  3UKU B;  1J54 A;  4DQ8 A;  4Z4I A;  4H0Y B;  5AZI B;  1TL3 A;  3AO4 A;  5BRH A;  4FJL A;  4OVL A;  1NGI A;  3HOS A;  3E9P A;  1QVF M;  4ID5 A;  3ZSR A;  3AVJ A;  5BN9 A;  4F9O A;  4DSE A;  2O8F B;  3OVN A;  4DFK A;  4IJN A;  3TAP A;  4KV8 A;  4KTQ A;  5AZI A;  3CIP A;  2VQF K;  2KTQ A;  3DM2 A;  1NGD A;  1SL0 A;  2BH1 A; 
#chains in the Genus database with same CATH homology
 5KGX A;  3V9S A;  1KVB A;  1BIU A;  5HRS A;  4ZHR A;  3NGI A;  3RR8 A;  3KD1 E;  5FDL A;  2XY6 A;  4CJW A;  4M3T A;  3SV3 A;  4C8N A;  3VQ4 A;  3NF6 A;  1KFD A;  2OPP A;  4NYN A;  5HRO A;  4I9L A;  4CES A;  1TKT A;  3VQA A;  1YT3 A;  2OPR A;  3I0R A;  4Y1D A;  2Q3S A;  1NJZ A;  4KI6 A;  4CJ3 A;  4CJL A;  3KJV A;  3CM5 A;  1ASV A;  3NE6 A;  3L3V A;  4BWJ A;  3M8R A;  1ZBU A;  2ATQ A;  1CZB A;  3P5J A;  4RW8 A;  4BWM A;  1RTD A;  2ZQB A;  4E7J A;  1ASU A;  1BI4 B;  3CYM A;  1BIS A;  5CZ2 A;  4DMN A;  3V1Q A;  1S1U A;  4Z4E A;  1S9G A;  1RT7 A;  3NF8 A;  2PZS A;  4FJX A;  1LWE A;  1QS4 A;  1DLO A;  3V9Z A;  3KTQ A;  4KHY A;  3KKS A;  2E6M A;  2RF2 A;  2X74 A;  4BE1 A;  4LD0 A;  5J2M A;  1F21 A;  4CF1 A;  2FBY A;  3TAR A;  4OJR A;  4FM0 A;  4Q0B A;  3MEE A;  2XO7 A;  1C6V A;  2FBT A;  2YNG A;  3OYK A;  1REV A;  4NCB A;  4H4O A;  3LP3 A;  5CYM A;  3KLF A;  5T7B A;  1Q8I A;  4W5T A;  3HYF A;  4E7L A;  2HHT A;  4Q5V A;  3VQ8 A;  4CF9 A;  1HRH A;  1JL2 A;  1L3T A;  4FVM A;  4KKO A;  4YNQ A;  4BAC A;  1JLE A;  3VA0 A;  3OYL A;  4KB0 A;  3ZT3 A;  2R7Y A;  4FJJ A;  2F96 A;  4HCC A;  1TGO A;  1ZBH A;  3QIP A;  3AVB A;  1IKW A;  2W42 A;  3AVH A;  4Z4C A;  1RIL A;  1C1C A;  5HP1 A;  1KCF A;  1NOY A;  2ETJ A;  3AO5 A;  4FJG A;  1VSE A;  2OA8 A;  2QXF A;  1RTH A;  1O1W A;  1RT2 A;  1RT1 A;  1TKZ A;  1Z25 A;  4O4G A;  4YFU A;  3L2U A;  3AVK A;  5KTQ A;  3QEX A;  4DTN A;  4FLT A;  1XHX A;  1RBR A;  4DQI A;  5HRR A;  4CGG A;  3QIO A;  3D0P A;  3OYF A;  3CG7 A;  4FYD A;  3HP6 A;  3SQ1 A;  1IKY A;  2IOC A;  4GW6 A;  4DFJ A;  4B8A B;  4W5O A;  1D5A A;  4B8C A;  3SUP A;  1VSM A;  3HT3 A;  2I5J A;  4AHC A;  4DF8 A;  1Z26 A;  1T8E A;  3VQC A;  3QLH A;  3AA3 A;  2XY5 A;  4OPK A;  4B08 A;  3AVF A;  2PYJ A;  4B9T A;  4E89 A;  4CEQ A;  2Y1J A;  1VSF A;  4I2Q A;  4N47 A;  4J2A A;  4FZZ A;  3HK2 A;  1IKV A;  1D9F A;  4CF2 A;  1L3S A;  3DYA A;  3KK3 A;  2X6N A;  3LAK A;  4CJ5 A;  2HB5 A;  4CGF A;  2HVH A;  5DMR A;  4CJR A;  2PY5 A;  4CF0 A;  4ELT A;  2OPS A;  5DK5 A;  4DSL A;  4FW1 A;  1NK9 A;  1JLC A;  5J2Q A;  3LPU A;  3EZ5 A;  3MXI A;  4PY5 A;  3HST B;  3L2V A;  3K58 A;  2RN2 A;  1UWB A;  1DTT A;  2XRI A;  3HM9 A;  3KD5 E;  4OGE A;  5HRN A;  3OS0 A;  4B9S A;  2EHG A;  1VSJ A;  4F8R A;  3K5L A;  4CCH A;  5EU7 A;  2DFF A;  3VQP A;  2HNZ A;  3DRP A;  1IKX A;  4CJQ A;  4N56 A;  2EX3 A;  2ITG A;  4CEB A;  1WLJ A;  2D0C A;  2P5O A;  3AVC A;  1X9M A;  4CK2 A;  5J2P A;  3TI0 A;  4DTM A;  4B9N A;  4C8K A;  4J2E A;  4IG0 A;  4CJE A;  5HRP A;  1RDC A;  1KVA A;  3QEW A;  4CIF A;  1VSI A;  5JS2 A;  2G8H A;  2HVI A;  3ZSV A;  1D9D A;  3HJF A;  3F73 A;  4FM2 A;  4E7I A;  2BDP A;  1BIZ A;  4NCA A;  2BGG A;  3SPZ A;  4JLH A;  1T05 A;  1TAU A;  2OPQ A;  2HNY A;  1RDA A;  1QSY A;  1BHL A;  3S3M A;  1HPZ A;  4LH5 A;  3O4N A;  4LH4 A;  4ELV A;  2XY7 A;  2B5J A;  1BQM A;  3DMJ A;  5SWM A;  3V1O A;  3NFA A;  4RW6 A;  3HO1 A;  1RT5 A;  3C94 A;  1IH7 A;  2P5G A;  1QHT A;  2VG6 A;  5I42 A;  3NF7 A;  3VQD A;  4CJF A;  2PYL A;  1NK8 A;  4HUE A;  3MEC A;  3VQE A;  3ITH A;  1N5Y A;  1A5W A;  4C8O A;  4CEZ A;  4OKK A;  3VN5 A;  3P1G A;  4DG1 A;  3I8D A;  1B92 A;  2XHB A;  3SQ2 A;  3B6O A;  3DLB A;  3LAN A;  1S1W A;  4LSL A;  4LSN A;  4W5R A;  3OYG A;  3M8S A;  4PQU A;  3IRX A;  4LY7 A;  4CER A;  1NK0 A;  4O0J A;  3U6F A;  1U4B A;  3TR8 A;  1JLQ A;  4AHV A;  1HJR A;  1YVU A;  4M3Y A;  1VSH A;  3KK1 A;  5KGW A;  3ULD A;  3L2R A;  1NK7 A;  1WSI A;  3DLK A;  4Z4G A;  4FK4 A;  4FJM A;  4IKF A;  1HMV A;  3OY9 A;  4K8X A;  3LAL A;  1QTM A;  4HCB A;  1EX4 A;  4DS5 A;  3RRG A;  1WSG A;  3V9U A;  2G8U A;  2KW4 A;  2KZZ A;  1KSP A;  4M3U A;  4GMJ B;  3OYN A;  4AIL C;  1JXB A;  1WSH A;  2QK9 A;  4OLA A;  4DLG A;  4DTS A;  4FJN A;  3O3F A;  4FXD A;  1U04 A;  2O4G A;  4FLV A;  5C25 A;  4KHQ A;  1YTU A;  3SUO A;  4I9Q A;  1NJX A;  4CHQ A;  3OYI A;  4FCY A;  3QNO A;  3E01 A;  3ZT4 A;  3NCI A;  1C1B A;  2ZE2 A;  3UIQ A;  4RW9 A;  4DSK A;  3BGR A;  3PX0 A;  1RT3 A;  1S6P A;  3DOK A;  4OGC A;  1NJY A;  2KZM A;  2YHB A;  1U45 A;  2IAJ A;  1HYZ A;  3KLG A;  5FRM A;  2RKI A;  3NH2 A;  4AHR A;  4RW7 A;  1EXQ A;  2YKN A;  4CFD A;  2VWK A;  4G1Q A;  3NF9 A;  2GUI A;  1B9D A;  1UA1 A;  1VSK A;  3L2W A;  3THV A;  3U3Y A;  4M3Z A;  3DLG A;  4BE2 A;  2IC3 A;  1CZ9 A;  2YNF A;  1S9E A;  3HPH A;  3HP9 A;  3LWM A;  1SKR A;  1RBV A;  3DRR A;  4C8L A;  2BAN A;  3OS2 A;  4O44 A;  1UA0 A;  1TK5 A;  3SPY A;  2VG5 A;  3LP1 A;  2Z1G A;  1TV6 A;  5FRN A;  1XWL A;  4FJH A;  2KFN A;  4DLE A;  1RCH A;  2JLE A;  4XIU A;  2DTU A;  5KI6 A;  2AJQ A;  3A2F A;  1TKD A;  2WOM A;  1T03 A;  2FBX A;  1Q9Y A;  1T7P A;  1DTQ A;  1WN7 A;  4CK1 A;  3TAQ A;  1XI1 A;  4PA1 A;  4FZY A;  5C42 A;  3EYZ A;  3F9K A;  4QOZ B;  1RNH A;  3S9H A;  3RMC A;  4KHN A;  3AA4 A;  3KK2 A;  4B9M A;  1WAF A;  1S5J A;  4CJP A;  3OYM A;  4FK2 A;  3L3U A;  5HLF A;  1YTA A;  3AO1 A;  1VRU A;  1J9A A;  2OZS A;  1LW0 A;  2IDO A;  3AVA A;  2X78 A;  3TWH A;  2FBV A;  4W5Q A;  1LV5 A;  4DSF A;  4DU1 A;  1IG9 A;  1RT6 A;  2A1R A;  4CGH A;  3SI6 A;  2Y1I A;  4K8Z A;  3T1A A;  4RW4 A;  1SL1 A;  4DU3 A;  4HTU A;  4Y1C A;  3AO2 A;  5KRS A;  4FLX A;  2YNH A;  4CJT A;  1FKO A;  4FLW A;  3NHG A;  1TK8 A;  4ID1 A;  1TVR A;  1G15 A;  3V4I A;  3ZSX A;  3ASM A;  3G10 A;  4CJK A;  2FC0 A;  1JLF A;  4KRF A;  4CEA A;  1I3A A;  4CFC A;  4CIG A;  4I2P A;  3QES A;  1U49 A;  1SKS A;  2ZD1 A;  4MQ3 A;  3JSM A;  1S1T A;  1GOC A;  5I3U A;  1C0T A;  3DLH A;  1RTJ A;  2HND A;  3AV9 A;  2Z1H A;  3HL8 A;  3SQ4 A;  4FJ7 A;  2HHQ A;  4KHU A;  1U47 A;  4CJU A;  1JLG A;  4JS4 A;  4DQS A;  3PY8 A;  4DQP A;  4ELU A;  1K6Y A;  3ZT0 A;  4OPJ A;  1SKW A;  1TKX A;  3KKR A;  1QE1 A;  4AHT A;  1JKH A;  3ZT2 A;  1ZBI A;  3LP0 A;  3D45 A;  1CXU A;  4CEC A;  4M3R A;  3TAM A;  3AO3 A;  3K5O A;  3MED A;  3NH0 A;  3CFP A;  4FJK A;  1L3U A;  4DSJ A;  1RBS A;  4DTO A;  3PX6 A;  2E4L A;  4CF8 A;  1QQC A;  3VQ7 A;  4F3O A;  3SUQ A;  3AVI A;  3DRS A;  2HHV A;  3LAM A;  4MFB A;  3FFI A;  2D5R A;  3EY1 A;  3CFR A;  4PWD A;  2HHX A;  3NH1 A;  3MAQ A;  3OS1 A;  3VQQ A;  3TAG A;  2F8S A;  4DFM A;  3NBP A;  5C24 A;  3NGZ A;  1NOZ A;  4KTW A;  4OKE A;  3AVN A;  3AA5 X;  1WNS A;  2F8T A;  3ZSY A;  3RRH A;  1JXE A;  4JRQ A;  2XY8 A;  5JS1 A;  1VSL A;  3TAF A;  4B9U A;  4NCG A;  2A1S A;  3LDS A;  1W0H A;  1SUQ A;  4AHU A;  3QEV A;  1HYS A;  4B3O A;  4KHW A;  2Z1I A;  4DTR A;  3QET A;  2BE2 A;  3QER A;  4DQQ A;  2IS3 A;  3KLI A;  3V6D A;  4EZ6 A;  3L2Q A;  1KVC A;  2LSN A;  4CEO A;  3OYJ A;  3IAY A;  3OYC A;  1L3V A;  1J53 A;  4N76 A;  1UAX A;  3I0S A;  3QO9 A;  3WNH A;  3KLE A;  2NUB A;  2B4J A;  4IBN A;  3S3O A;  1X9W A;  1S1X A;  3RMD A;  4H8K A;  4DWI A;  3PUF A;  3CQ8 A;  1NK5 A;  4M42 A;  4BDP A;  1XHZ A;  1TK0 A;  1JLA A;  2HHS A;  4DTP A;  2HW3 A;  4CFA A;  3P83 D;  1L5U A;  4AH9 A;  4R5P A;  1LWC A;  2YHA A;  4IFY A;  1VSD A;  1X1P A;  4OLB A;  4FZX C;  3JYT A;  1A5V A;  2GV9 A;  3T19 A;  3OYB A;  4KHS A;  4QCL A;  1BI4 A;  4JS5 A;  4N41 A;  3M8P A;  4CEE A;  5E41 A;  3ZSO A;  4E1M A;  3K57 A;  3QIN A;  1LAV A;  4E7K A;  3RR7 A;  1LAW A;  4KB1 A;  5CZ1 A;  3SUN A;  2YNI A;  4F4K A;  4EP5 A;  1X9S A;  3NDK A;  1ZBL A;  4W5N A;  4FJ9 A;  2DFH A;  4C8M A;  1R0A A;  4M41 A;  1KFS A;  4FJ5 A;  1WSJ A;  3TAN A;  3OYA A;  3LWL A;  4KPY A;  3ALY A;  2HHU A;  1C0M A;  4EP4 A;  3HPG A;  3AVG A;  2G8K A;  2YV0 X;  4KI4 A;  2DY4 A;  1HNV A;  1U48 A;  4HUF A;  4L8R B;  3IS9 A;  4M3X A;  1ASW A;  1EKE A;  1WSF A;  4FW2 A;  3ZSZ A;  3K5M A;  1HNI A;  4CED A;  4CGD A;  1KRP A;  3C95 A;  3V81 A;  3SJJ A;  1FXX A;  1SV5 A;  2O4I A;  1HQU A;  3WNE A;  4M45 A;  3SV4 A;  2QKB A;  3HXM A;  4BDY A;  1GOA A;  1KTQ A;  2DFE A;  3WNG A;  4CE9 A;  4FLZ A;  1RT4 A;  2VG7 A;  1W9H A;  3S3N A;  3C6U A;  1BCO A;  3IG1 A;  5K14 A;  4CJS A;  4CIE A;  3SZ2 A;  3QEP A;  3LPT A;  1SL2 A;  1CLQ A;  3ZCM A;  4FLU A;  1NJW A;  1JL1 A;  3K2P A;  3AVM A;  4WE1 A;  4DF4 A;  4CGJ A;  3KLH A;  3TAB A;  3SCX A;  3K5N A;  3CM6 A;  3QNN A;  3K59 A;  2QKK A;  2X6S A;  3VQ5 A;  4CHO A;  1TL1 A;  2GBZ A;  3VQB A;  1LWF A;  1XC9 A;  3H08 A;  1NKC A;  1RBT A;  3OYH A;  1FK9 A;  4DTU A;  3AVL A;  3V9X A;  1RDB A;  1WSE A;  2RPI A;  5J1E A;  1MU2 A;  3OJU A;  1QSS A;  4KAZ A;  4M3W A;  3NAE A;  4CFB A;  4F2S A;  3SNN A;  4O5B A;  1ZYQ A;  4B9V A;  1D8Y A;  3DLE A;  2G8V A;  4E0D A;  2E6L A;  4IFV A;  4HHT A;  3ZSQ A;  2D0A A;  1KLN A;  5KRT A;  1Y97 A;  4FLY A;  1UOC A;  3O3H A;  4FM1 A;  1GOB A;  3KIO A;  4J2B A;  3HPO A;  3ZT1 A;  5J2N A;  3V9W A;  1I39 A;  2VWJ A;  4BDZ A;  3M8Q A;  3RTV A;  2JGU A;  2WON A;  4F3T A;  4IG3 A;  4BE0 A;  4J2D A;  2G8I A;  2D0B A;  5HBM A;  4CEF A;  3DI6 A;  4DTX A;  2KFZ A;  1RDD A;  1HQE A;  1S1V A;  3NGY A;  3PX4 A;  4PUO A;  1LW2 A;  4Z4H A;  4H4M A;  4ZTF A;  4GVM A;  4CK3 A;  3QEI A;  3PV8 A;  2HHW A;  2B6A A;  1IO2 A;  3V1R A;  1NK4 A;  4CGI A;  4ZTJ A;  5SZT A;  2KQ2 A;  1B9F A;  3ISN C;  1EET A;  3MEG A;  3DLR A;  4RG8 A;  3U3G A;  2YKM A;  4CJV A;  3OJS A;  3RMB A;  1KLM A;  3OYE A;  1Q9X A;  1VRT A;  2OYQ A;  3LP2 A;  4KTZ A;  4EZ9 A;  1BQN A;  4E3S A;  3MXM A;  4ICL A;  3RMA A;  3B6P A;  4E7H A;  4E1N A;  4UQG A;  3HVT A;  3VQ9 A;  3VA3 A;  1C1A A;  3DOL A;  4KFB A;  4Z0U A;  3SYZ A;  4I7F A;  4CHN A;  4DU4 A;  3SQ0 A;  4DSI A;  3G0Z A;  4B9L A;  1BCM A;  4O0I A;  1TAQ A;  1ZBF A;  1EP4 A;  3RWU A;  3PO5 A;  4N5S A;  2G8F A;  1S6Q A;  3ZSW A;  4CHP A;  4DFP A;  4FK0 A;  3L8B A;  1BL3 A;  4F2R A;  4CHY A;  3T3F A;  1VK0 A;  4DS4 A;  1JLB A;  1WAJ A;  1J54 A;  1RTI A;  4HVJ A;  3PO4 A;  4HUG A;  1C0U A;  1RBU A;  5D3G A;  4AHS A;  4Z4F A;  5CYQ A;  4Z4I A;  1BGX T;  1FKP A;  2OZM A;  1QSL A;  1TL3 A;  4KRE A;  4TSX A;  3AO4 A;  3C6T A;  1CXQ A;  4OKJ A;  1J5O A;  3LZJ A;  4FJL A;  3MXJ A;  1N6Q A;  4OVL A;  2G8W A;  4JRP A;  3O4Q A;  1NKB A;  1A5X A;  4QAG A;  4O55 A;  4DQR A;  4DTJ A;  3O3G A;  4ID5 A;  3ZSR A;  3AVJ A;  4CHZ A;  1HYV A;  4DSE A;  4IDK A;  3TAE A;  4E19 A;  3OVN A;  4DFK A;  3LZI A;  3TAP A;  2P1J A;  4FJI A;  3HVR A;  4KV8 A;  3VQ6 A;  1NKE A;  3AA2 A;  1ITG A;  3BDP A;  4CJ4 A;  4KTQ A;  4FJ8 A;  2IGI A;  2P51 A;  3WNF A;  2KTQ A;  3DM2 A;  4KO0 A;  5CY4 A;  3OYD A;  5FRO A;  4NYF A;  1SL0 A;  1NK6 A;  2HMI A;  3CFO A;  2Z1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...