4OVLA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Interrogating HIV integrase for compounds that bind--a SAMPL challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2013-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ovlA00
1JKHA 2WOMA 1WSJA 2IGIA 1J5OA 3VN5A 2RN2A 3SUQA 3QIPA 1W0HA 4KPYA 3A2FA 3M8QA 4FJ7A 1BIZA 1HYVA 2ZE2A 4F2RA 1NOYA 1D5AA 2XRIA 4CFDA 4DU4A 3RMAA 1TK5A 1A5XA 1IG9A 2YNHA 1KVAA 4AHVA 1KVCA 4E89A 1XWLA 3ZT0A 3OYFA 3VQ7A 3AVAA 4M3RA 1UA1A 4KAZA 1FXXA 1NKCA 1ASWA 2ETJA 3NE6A 1SUQA 4E7LA 1S9GA 3MEDA 3AVKA 3OS0A 1WAJA 1LW2A 3LZJA 4FK0A 3LP0A 4KHNA 1IKXA 4M3WA 4KTQA 4CEEA 2XY6A 4IFYA 3OYIA 1K6YA 1VSLA 3C6TA 3CFOA 4FVMA 4CF8A 3KLGA 4L8RB 3MXIA 2IDOA 3DOLA 4CGJA 3V9UA 1ZBHA 4CGHA 1HQUA 4DU3A 4CE9A 3AO3A 4W5NA 4OLAA 3V9SA 2XO7A 1KFDA 2X6SA 3AO5A 2OA8A 4HHTA 1YT3A 1ASUA 2DFEA 2GUIA 1S6PA 5JS1A 3QESA 1ITGA 1Q9XA 2G8UA 3AVFA 4EP4A 4N56A 2IC3A 3K58A 3HK2A 4B9MA 1RBVA 4DQPA 3AVBA 3AO2A 3K5MA 3HT3A 4F3OA 4ID5A 1QTMA 4FJJA 5KTQA 4FLVA 1RT2A 5SWMA 3M8RA 3LANA 3D0PA 3OYJA 1RDCA 1IKYA 1NK4A 3VA3A 1BISA 4IFVA 4FJKA 5HRRA 2HHWA 4E7IA 3NHGA 3SV4A 4NCAA 4B9NA 4CIGA 3L2VA 3CFPA 5HP1A 3SNNA 4BDPA 4KB0A 4FJIA 4KHUA 1RTIA 4CEFA 4N47A 3TANA 2KFZA 4DTPA 4J2AA 5I3UA 3PO4A 1L3UA 4LD0A 3AA2A 4AHSA 3U3GA 2Z1JA 4I9LA 1RT1A 3OYDA 4QAGA 1Q9YA 2F8SA 2DFHA 1HNVA 2HNZA 4BE0A 3NGIA 1NK7A 5EU7A 2KZMA 3HPOA 4M3YA 4CF9A 3RMDA 1ASVA 1NJYA 1C0UA 4BWMA 5JS2A 2OZSA 1RT4A 3KD5E 3G0ZA 4CEZA 4F2SA 1D8YA 3VQ9A 4BDZA 3ZSVA 3K59A 4JRQA 2OPQA 1TKXA 4FJMA 4CK2A 4FW2A 3ZSYA 2BANA 4PA1A 4ZHRA 4FYDA 4YFUA 2D5RA 2RF2A 3FFIA 4H8KA 1T7PA 4CEAA 3IG1A 3F9KA 4HTUA 4R5PA 4CJSA 4Z4IA 2BE2A 3OYLA 3WNHA 4LSLA 4E0DA 4HUFA 3VQAA 3I8DA 2W42A 1KCFA 3SYZA 3KD1E 3KK2A 5DMRA 4B9UA 3AV9A 1XHXA 3MEGA 4M42A 2YNGA 3D45A 1C1AA 4HVJA 4ZTJA 1Y97A 3HPGA 2G8VA 4ELTA 1SKRA 4E7KA 3QEIA 3RTVA 3QEWA 3CFRA 1S1TA 2HB5A 2BDPA 3AO4A 1RCHA 2HMIA 4CJTA 4B9LA 4DWIA 1QQCA 3OJSA 2FBXA 3MAQA 4QCLA 3OYKA 2HHVA 1WSEA 2OPRA 4CEQA 2OPPA 2FC0A 1KSPA 3NCIA 3DLHA 3SZ2A 3HYFA 3EY1A 3OYNA 3SQ2A 2P5OA 4FLYA 4FJ9A 3RMCA 4YNQA 1VSFA 3NGYA 2ATQA 2XY5A 1LAWA 2P5GA 3AA5X 4FM0A 1D9DA 4IKFA 4CJVA 5KGWA 3KLEA 1HPZA 3L2QA 5HROA 1KLMA 4FJLA 4M3TA 1VSKA 3LP2A 2XY8A 4Z4FA 3V9XA 3QETA 2QK9A 4DQQA 3ZSZA 5HRPA 1S1VA 1UWBA 3V81A 4RW7A 2O4GA 4O5BA 3AA4A 4CGGA 4NCBA 3LAKA 1VRUA 2G8WA 4FCYA 3TAQA 1TGOA 3TAGA 1W9HA 3I0SA 4OKKA 1WSGA 1XHZA 1JL2A 4LH4A 4DMNA 1R0AA 1VK0A 1JXEA 2XHBA 3OJUA 4I2PA 3KLIA 4FZYA 4I9QA 4I2QA 4AHTA 4CJLA 3P5JA 1SL1A 2Y1IA 1BQMA 3RR8A 4O55A 2PY5A 1WN7A 1BIUA 3CM5A 4CJKA 3LZIA 2B4JA 5K14A 4DSEA 1KRPA 1QSYA 4KV8A 4OVLA 1ZBLA 3PO5A 4CJQA 4CHOA 3G10A 4FM2A 4O44A 4OKJA 4CK1A 3HVRA 2Z1GA 1U49A 1SKWA 1WNSA 1CZBA 3AO1A 4AHRA 3VQ8A 3MXJA 4KKOA 4FZXC 4CEBA 2LSNA 5CYMA 1LWEA 3SQ4A 4Z4GA 1EX4A 4KHYA 1X9SA 3LAMA 2G8IA 4OKEA 4AILC 4KO0A 4HCBA 4CFCA 4DFMA 3PX4A 1RBRA 3NF6A 2YHAA 3KLFA 1QSLA 1Q8IA 4DF8A 1O1WA 3QEPA 4EZ9A 1VSHA 3TARA 1X9WA 4BE2A 1LW0A 1CZ9A 4F8RA 1RDBA 1TKDA 3VQ6A 1L3TA 1U4BA 3PV8A 1CXQA 3NF7A 1LWCA 3OY9A 3T3FA 3DLGA 3VQEA 3VQBA 4Q5VA 1G15A 4O0IA 3NH1A 4JS5A 1NK0A 1U47A 4DSJA 4CHYA 1RBSA 1RILA 2HNYA 4OJRA 1S1UA 4DFPA 3IAYA 2PYLA 3K5NA 3TAMA 4PWDA 3ASMA 2IS3A 3IRXA 1Z25A 1C1CA 1J54A 3WNGA 4MFBA 3L8BA 1C1BA 3HL8A 3LWLA 2QKKA 4FJ5A 4B08A 3O4QA 2X6NA 3ZCMA 2HVHA 3OYMA 3PX6A 3TAFA 1S6QA 1WSHA 4M3ZA 4FXDA 1I3AA 3O3HA 3HP6A 1EP4A 3PX0A 2AJQA 3V1OA 3ZT3A 1B92A 3C95A 5T7BA 2YNIA 5KRTA 4FLWA 4B9VA 5HLFA 3JYTA 1KVBA 1WSFA 3U3YA 2VG5A 3V1RA 2RPIA 4DU1A 4DQSA 1JLQA 1RNHA 3L2RA 4FJNA 2VWJA 4M41A 3RR7A 1HQEA 4M3XA 3SV3A 4KB1A 2P1JA 1RTJA 3HO1A 3S9HA 4W5RA 2PYJA 1WLJA 2FBTA 4ELVA 1NJXA 3RRHA 2KQ2A 1NK6A 1C0TA 3HP9A 4KI6A 1JL1A 4IDKA 3DLEA 3K5OA 3P1GA 4IBNA 3ZT4A 3O3FA 1ZYQA 2KZZA 1RT6A 4E7JA 2ITGA 1UOCA 3MXMA 2BGGA 3NF9A 5FROA 3T1AA 2E6LA 1JLCA 1NK5A 1S9EA 3QNNA 3LDSA 4KHQA 5FRNA 3DYAA 4CFAA 1HNIA 1JLBA 4UQGA 1F21A 3DRRA 4BDYA 1N5YA 1N6QA 3K57A 3AVMA 3DMJA 3EZ5A 1EKEA 3TI0A 4GVMA 1HRHA 4NYFA 3VQ5A 3HPHA 4DTRA 4DFKA 3SUPA 1B9FA 4CJ5A 1X9MA 2DY4A 4GW6A 4KI4A 3VQCA 3KK3A 4FJGA 4RW8A 3LP3A 3NH0A 3RMBA 4F3TA 3V1QA 4CHZA 3CQ8A 4FM1A 4W5QA 4BACA 4LSNA 2DTUA 4QOZB 1RTDA 3V4IA 3KKSA 3VQQA 4KTWA 1YVUA 3E01A 1UAXA 1EETA 4B9SA 3AVNA 5J1EA 3NF8A 1WAFA 3CG7A 4J2EA 2YV0X 4TSXA 3QLHA 2EX3A 1NKEA 1RT7A 4N5SA 4FZZA 5J2MA 3ZT2A 4E3SA 4DFJA 3L2UA 1KFSA 3DI6A 2JGUA 4DTSA 5CZ2A 4FK2A 1VSDA 1REVA 3CYMA 1TKZA 3I0RA 1IKVA 4XIUA 4OGEA 4CECA 1XI1A 2G8KA 1HYSA 1QE1A 4Z4HA 2YNFA 1C0MA 5J2NA 2KTQA 3BGRA 4I7FA 1BL3A 4Z0UA 3LWMA 1NK9A 3ZSRA 2PZSA 3LP1A 4EZ6A 1DTQA 1FKPA 5CYQA 2D0CA 4CF1A 1VRTA 3HJFA 4AH9A 3SQ0A 3KLHA 1D9FA 4C8KA 1DTTA 3DRPA 1A5VA 2JLEA 5KI6A 2GBZA 4PQUA 1NJWA 4CF0A 2B6AA 1S1XA 3ULDA 3HVTA 2WONA 4CFBA 3AVGA 4ICLA 1TV6A 2RKIA 3QEXA 1RTHA 3OS1A 4DSKA 2HHUA 1TKTA 3HXMA 4HUGA 4N76A 4KHWA 1SL2A 3TAPA 3AA3A 2NUBA 1JLFA 3ZSXA 3QO9A 5HBMA 1ZBIA 2XY7A 1Z26A 3OVNA 3CM6A 4DQIA 3S3NA 4AHCA 3SJJA 4JRPA 3IS9A 1X1PA 2B5JA 4K8XA 4CJEA 1BGXT 1UA0A 4LH5A 3JSMA 1VSJA 4CJPA 1SV5A 2QKBA 4OPKA 4DLEA 2DFFA 3QEVA 1YTAA 4K8ZA 1BQNA 4Y1DA 3AVCA 3MEEA 5KRSA 2Y1JA 4CEDA 4IG0A 4KREA 4W5TA 4B8CA 4CF2A 4FLUA 2D0BA 4RW4A 4E7HA 1XC9A 3NAEA 4M3UA 2FBVA 3LPTA 5DK5A 3VQ4A 2VWKA 4DSFA 2Z1HA 2A1SA 1RBUA 1ZBUA 3SUNA 1T8EA 3HSTB 4RW6A 4W5OA 1QS4A 3SQ1A 2A1RA 4CCHA 1RT3A 2HHXA 4GMJB 3QINA 4NYNA 1LAVA 4Z4CA 3H08A 1RDDA 4EP5A 3S3OA 4KHSA 3DM2A 3NFAA 3KJVA 4DS5A 3B6PA 2FBYA 3ZSOA 4CJ3A 4CHPA 4CJWA 1T05A 3RRGA 3AVIA 3NH2A 4Z4EA 4H4OA 1TAQA 3TABA 1JLAA 1GOBA 1TK0A 1BCOA 1IH7A 1RDAA 1U45A 4F4KA 1FK9A 1TK8A 4ZTFA 1S1WA 3M8PA 3ITHA 3OYCA 1ZBFA 1HYZA 3ISNC 4CESA 1NOZA 4HCCA 1C6VA 4OGCA 2ZD1A 4KRFA 1KLNA 3DLBA 4DG1A 4ELUA 3ALYA 3VQDA 2EHGA 4B9TA 1NK8A 2F8TA 5I42A 4OLBA 4CHNA 1U48A 5HRSA 3V6DA 2OZMA 2R7YA 4DSLA 3OYGA 4CHQA 4RW9A 2YKNA 3AVHA 4OPJA 4E19A 1QHTA 4DLGA 4B3OA 2Z1IA 2KW4A 3AVJA 1J53A 4O0JA 3NDKA 4DTNA 4FK4A 3SPYA 1CXUA 1EXQA 4JS4A 2G8FA 1LV5A 2E4LA 3KK1A 2VG6A 3QNOA 2E6MA 4Y1CA 3VA0A 3MECA 1NKBA 3KTQA 5KGXA 3PY8A 4JLHA 3OYBA 1HJRA 1BI4A 2QXFA 2VG7A 1JLGA 1TVRA 4DTMA 2YKMA 2OPSA 4FLTA 4C8NA 5SZTA 5J2QA 4DTJA 4C8MA 2HW3A 4CJ4A 3WNEA 4FW1A 1FKOA 1U04A 4CJUA 3SUOA 2ZQBA 2P51A 4CK3A 1B9DA 1MU2A 3LPUA 1BI4B 1I39A 1KTQA 1JLEA 1GOCA 1RBTA 2GV9A 3O4NA 1CLQA 3NGZA 4PUOA 4FJ8A 4DSIA 3QERA 2HHQA 4BWJA 3OYEA 1IKWA 2D0AA 4C8OA 3C94A 1VSEA 3P83D 4BE1A 3DLKA 2KFNA 4PY5A 2I5JA 1DLOA 5E41A 4LY7A 3LALA 1L3SA 4KFBA 5CZ1A 3DRSA 3SPZA 4DTOA 2G8HA 3OS2A 4CIEA 3F73A 3TAEA 1QSSA 5FRMA 4AHUA 4CEOA 3ZSWA 3L2WA 4FJHA 4CGFA 1BCMA 4O4GA 3KKRA 3OYHA 3L3VA 1S5JA 4CJFA 3M8SA 2HVIA 1TL1A 2HHSA 4E1MA 1J9AA 4DTUA 1WSIA 3SCXA 4DQRA 4DTXA 5FDLA 4G1QA 5HRNA 3VQPA 4N41A 3HM9A 4M45A 5C25A 5D3GA 1A5WA 1T03A 1RT5A 3PUFA 4FLZA 3ZT1A 3T19A 2F96A 3V9ZA 1L3VA 1IO2A 1VSIA 4CIFA 1BHLA 4WE1A 3C6UA 3TR8A 3NBPA 3V9WA 3BDPA 4CERA 5J2PA 1SL0A 2IAJA 3SI6A 4J2DA 4DS4A 1HMVA 4DF4A 3O3GA 4Q0BA 2O4IA 2IOCA 3K5LA 4MQ3A 1GOAA 4E1NA 1JXBA 1SKSA 1L5UA 4J2BA 3L3UA 3OYAA 3EYZA 3QIOA 3DOKA 1TAUA 3B6OA 2OYQA 3AVLA 3KIOA 3DLRA 4C8LA 3U6FA 3S3MA 2X78A 4KTZA 5CY4A 5C42A 3RWUA 2YHBA 4ID1A 4RG8A 2HNDA 4FLXA 4H4MA 2HHTA 2Q3SA 4IG3A 1YTUA 4CJRA 4CGIA 4HUEA 2X74A 4NCGA 5C24A 3ZSQA 3UIQA 3K2PA 1NJZA 3TWHA 3THVA 4CGDA 1VSMA 1LWFA 4B8AB 1TL3A 4FJXA 3WNFA
chains in the Genus database with same CATH superfamily
2QWQA 4LF8K 1I94K 3QIPA 3NVMA 4KPYA 3KVGA 4FJ7A 1HYVA 4F2RA 1NOYA 3SAHA 3VOVA 4A61A 1GLAG 2XRIA 4DU4A 3RMAA 2QTDA 4YOTA 2YNHA 1KVAA 3EE9A 3OTOK 3ZT0A 4KAZA 3AVAA 3H1VX 4M3RA 2QWMA 1YI2N 1ASWA 2ETJA 4KHNA 3BEXA 2Q97A 1IBMK 4FK0A 4M3WA 4IFYA 1C0FA 4JKAA 1T44A 3MXIA 2IDOA 3H3NO 3V9UA 4CGHA 2YCHA 1HQUA 2V7YA 1NGIA 1YAGA 4OLAA 3V9SA 4HHTA 1ASUA 1DKGD 2DFEA 3LDNA 3HK2A 2E1YA 3RSEA 4B9MA 1RBVA 4DQPA 3AVBA 3AO2A 2CGKA 5AQNA 3K5MA 3OYJA 4FWOA 3VA3A 4IFVA 3EO3A 4E7IA 4H0PA 4B9NA 4CIGA 3L2VA 3CFPA 4KHUA 4FJIA 4BR9A 3DLLL 4M7YA 5I3UA 3FLCO 4AHSA 2Z1JA 3OYDA 5GIOA 1HNVA 4A5AA 5AQZA 5KQDA 3OBWA 3W0LA 5BPLA 5CR4A 5EY4A 4CF9A 1NJYA 3WUHA 2OZSA 4FOEA 4F2SA 1D8YA 3VQ9A 1NJIO 4BDZA 2OPQA 4CK2A 1JCFA 4FW2A 1BDGA 2BANA 4PA1A 1GLCG 1OH5A 3ATUA 3FFIA 4H8KA 4JI3K 1XNQK 3R3LA 3D2EB 4Z4IA 5AQTA 3WNHA 3CF5L 4X65K 1KAZA 5DMRA 4FWLA 4M42A 5M1QA 2YNGA 1ATRA 1Y97A 2G8VA 5AQYA 3QEIA 2FSKA 3I33A 1S1TA 2HB5A 1RCHA 3P31A 4DWIA 3QFPA 3FZMA 2FBXA 3MAQA 4EAHD 3OYKA 2HHVA 1XUPO 4CEQA 1HPMA 1KSPA 1ILYA 3DLHA 2P5OA 3SZ2A 3HYFA 3OYNA 3SQ2A 1VQLN 4YNQA 1VSFA 2E88A 3NGYA 4C1NI 2ATQA 2P5GA 3AA5X 1FW6A 4CJVA 3U4LA 5IT9O 1QZ5A 5CHIA 3WXMB 1SAZA 2ZGYA 3HSCA 2W6KA 3MCAB 2ITMA 2O4GA 4BGAA 4BRFA 1C0GA 3LAKA 1VRUA 4JI6K 1TGOA 1MWKA 3VPZA 1W9HA 4DR4K 1WSGA 1XHZA 4DMNA 1VK0A 2XHBA 1TUUA 2CH6A 2YJFA 3IUCA 3KLIA 4FZYA 1GLDG 4I2QA 4CJLA 4BR4A 1YJWN 4BGBA 4BQLA 4O55A 1WN7A 2NRRA 5LJVA 3LZIA 1KRPA 4KV8A 4RWTA 4CHOA 5GINA 3G10A 3TTDA 2VGMA 2A6AA 3MXJA 4KKOA 4CZGA 3SQ4A 4Z4GA 1QVGM 1IJJA 3LAMA 3M6GA 2G8IA 3H6EA 3PX4A 4DF8A 4FWSA 1LW0A 1CZ9A 3M1FA 1BG3A 3C7NA 1TKDA 5MLCQ 3VQBA 4FO0A 1U47A 4IOAL 1LCUA 1QZ6A 3DXMA 3THYA 2PYLA 2NRZA 1KLNA 4FJ5A 3HL8A 3AARA 2X6NA 4BRQA 3OYMA 3TAFA 1WUAA 4ISFA 2AJQA 2RHKA 3LDPA 3UB5A 5T7BA 3WQUA 2YNIA 4B9VA 3TPQA 4BC5A 4CBUA 1QVFM 1WSFA 3U3YA 3CJ9A 4YDUA 4GY2B 4DU1A 1RNHA 3MWPA 4W5RA 1KD1O 1TYQB 1NJXA 1NK6A 1JL1A 4IDKA 3ZT4A 3J81O 1ZYQA 4PL7A 2ITGA 3NF9A 5FROA 3SMSA 3THXB 4BG8A 2E6LA 2VCPA 1ZXOA 3DXKA 5I9EB 4CFAA 1HNIA 4DV7K 1NGAA 3AVMA 3EZ5A 3TI0A 2F9TA 1E4FT 4LF9K 4DTRA 3CIPA 3OHRA 1X9MA 4LF6K 3SJHA 3VQCA 3KK3A 3SK3A 1HKCA 4BRLA 4BRPA 4F3TA 1XC3A 2W6LA 4FM1A 3O8MA 4X62K 4LSNA 4QOZB 3E01A 3AVNA 3WEEA 3NF8A 1WAFA 4EIAA 2YV0X 2VGNA 2EX3A 1RT7A 1XNRK 3DI6A 2JGUA 3GE1A 1T3VA 3HTVA 1VQ9N 4Z4HA 1C0MA 2V51B 5J2NA 4I7FA 1BL3A 3ZSRA 3I55N 5CYQA 1VRTA 3SQ0A 4C8KA 1DTTA 4CZHA 2D0OA 5KI6A 2GBZA 4PQUA 4LFBK 1GLBG 2RE2A 4JKGB 2B6AA 4DHYA 4CVNE 4H5TA 2HHUA 1TKTA 4AM7A 3CXCM 3A0IX 1SL2A 2GUPA 2P9SA 5C0YA 3VTHA 3U8XA 4AQYK 1GLJO 1R59O 4AHCA 3UKUA 3IS9A 2VWBA 1X1PA 3K0SA 4LH5A 4CJPA 5KPRA 1SV5A 4BVPA 4LFAK 2DFFA 3O9SA 3QEVA 2ASMA 1IV0A 3MDQA 2P9NA 4DV1K 3PIPL 4FLUA 4E7HA 1NGDA 1H1VA 3NAEA 3LPTA 3VF2A 4LC9B 3L4IA 4W5OA 3SQ1A 2A1RA 2P9KA 3QINA 5HL7L 3HOSA 4Z4CA 3H08A 1RDDA 3KJVA 5LMNK 3H3OB 4CJ3A 3CCVN 3RRGA 3NH2A 4JKCA 1JLAA 1GOBA 5ADXH 3M8PA 4AF1A 4HCCA 1LOTB 3ISNC 1C6VA 2UXBK 4DV0K 4DCHA 1S72N 4WQ5A 4B1ZA 4CHNA 2OZMA 4DSLA 4CHQA 4RW9A 3AVHA 3BF3A 4DLGA 1QHTA 2E8AA 4O0JA 4DTNA 1SS6A 5LJWA 4CZEA 1LV5A 2JWLA 2E4LA 4B1XB 2VG6A 3PY8A 4FWNA 1HJRA 2QXFA 2OPSA 4FLTA 1VAZA 2HW3A 1FKOA 5KPZA 2ZQBA 5LY3A 3CI5A 1BI4B 3QERA 2HHHK 3C94A 4LFCK 1DLOA 5C12A 3SPZA 4DTOA 4CIEA 1VQPN 4CGFA 5AZIA 4O4GA 3LM2A 3OYHA 4CJFA 2HVIA 1DEJA 4A2BA 4DTUA 1WSIA 1W97L 4G1QA 3J7AP 3BF1A 2UXDK 3V9ZA 2F96A 2IIRA 1U6ZA 2QA4N 1VSIA 3CPWM 3VTIA 3TR8A 3BDPA 5J2PA 1SL0A 3SI6A 4J2DA 2WFBA 3HZ6A 3NMUA 2IOCA 1YITN 1GOAA 1SKSA 1L5UA 2NZTA 3ULEA 1W2BM 3U9DA 3P4IA 2Q3SA 4IG3A 2O8EB 4CJRA 1Q18A 4NCGA 3UIQA 1JCGA 3K2PA 4YDUC 1LWFA 2Q31A 1GLFO 4H03B 1WSJA 2IGIA 1W0HA 4GKJK 3WXLA 3E1YA 2CGJA 4BREA 2YHWA 4AHVA 4A2AA 4E89A 2DPNA 1UA1A 2HBMA 4MDBA 1FXXA 1NKCA 1NMDA 3AGKA 1SUQA 4JI2K 1S9GA 3LL3A 4IOXA 1WAJA 1IKXA 1X3NA 4KTQA 2XY6A 1K6YA 3C6TA 4JI7K 1P90A 3AGRA 1N8RO 1QQNA 4CE9A 3FE1A 2XO7A 2X6SA 2OA8A 1YT3A 1T6CA 1S6PA 5JS1A 1Q9XA 4N56A 1NMNA 4AM6A 2FF3B 4F3OA 3LANA 3D0PA 2IVOA 4FJKA 5HRRA 1WBBA 1KXPA 3RSEB 1YJ9N 3OW2M 5HP1A 1RTIA 2KFZA 4DTPA 1V4TA 3FFKB 3PO4A 1L3UA 4LD0A 3L6QA 2F8SA 4BE0A 4FL9A 2VQFK 1NK7A 3L4QA 3CJCA 4YOUA 3TTFA 3VMFB 2OTLN 1ASVA 1O13A 1KAXA 4A59A 4KH6A 5KPTA 3TSUA 4A62A 1T7PA 4CEAA 2CGLA 4R5PA 4DR2K 3HOTA 1OH7A 3QB0A 4HUFA 3I8DA 4E0DA 4B9UA 3AV9A 4BRMA 1XHXA 4K42A 3D45A 4ZTJA 3HPGA 1SKRA 4E7KA 3CFRA 5AQKA 3VESA 1K8AO 2HMIA 4CJTA 3OJSA 2FC0A 3EY1A 5AQQA 1K8KB 3T7ZA 2HBKA 1LAWA 1D9DA 4IKFA 1HR0K 5HROA 4IDHA 2A5XA 4M3TA 4FJLA 5JLFA 3V9XA 3QETA 2QK9A 3VF4A 3ZSZA 3KWGA 4WQ5C 1BUPA 2ZWHA 1BA1A 3ID6A 1JXEA 4AHTA 1SQKA 1ZC6A 4LF5K 5AQWA 1BIUA 2GWKA 4CJKA 2B4JA 5K14A 3CJ7A 4OVLA 4CJQA 4CK1A 3HVRA 2Z1GA 1U49A 3QMLA 1WNSA 1SKWA 3FR0A 5EVZA 4CEBA 4GKKK 5CYMA 1LWEA 4B1YB 4KHYA 4OKEA 2A41A 4HCBA 5H1SQ 1N34K 1RBRA 2YHAA 1QSLA 5AQGA 3D6RA 3BUZB 4F8RA 1RDBA 1K73O 2D4WA 3VQ6A 1L3TA 1U4BA 4JKFA 3NF7A 1LWCA 4DB3A 2D0PA 3DLGA 3NH1A 4JS5A 4MDAA 4CHYA 4OJRA 4Y0WA 4DFPA 1NGGA 3TAMA 3ASMA 4NLCA 3C7NB 1C1CA 3L8BA 2E2PA 3ZCMA 3PX6A 1S6QA 1WSHA 3J7ZO 3F5TA 3HP6A 1EP4A 2QXLA 3V1OA 3DXMB 3THYB 4FLWA 5KRTA 3MCPA 3GDQA 4FWKA 3Q7CA 4JHDA 2RPIA 4DQSA 3CC7N 2AP1A 3GG4A 4M3XA 1RTJA 3GBTA 4KHPK 2FBTA 4ELVA 3EN9A 2J4RA 4KI6A 5EX5A 3DLEA 1BU6O 3O3FA 4IJAA 2BGGA 5M1NA 3T1AA 1JLCA 3QNNA 4KHQA 4EHTA 4XH5A 1N6QA 3B8AX 3DMJA 1IBKK 4NYFA 4BG9A 4GV9A 4XH1A 2A40A 3DXKB 4B1VA 4FJGA 1CZAN 5F1XA 3CQ8A 3ATVA 3R6MA 1K8KA 4GVEA 3V4IA 3KKSA 4IEIA 3CC2N 3HRGA 5C10A 1HLUA 5HOOA 2QWPA 4N5SA 3CETA 3VEVA 3ZX2A 1HNZK 5J2MA 4E3SA 3L2UA 1KFSA 2QM1A 4JK8A 5CZ2A 5FPNA 4FK2A 1TKZA 3I0RA 1IKVA 4XIUA 1Q7YO 2I7PA 3C6AA 3WEEB 4EHUA 2YNFA 1NK9A 2P9LA 4I6MA 2UUAK 4U67L 2PZSA 3IDHA 1DTQA 1NWKA 2FXUA 4BR2A 3KLHA 2YX6A 1A5VA 4C1NK 4CF0A 1S1XA 3ULDA 2WONA 4ICLA 4ILHA 3OS1A 1HKGA 1Q86O 3TAPA 2ZJRL 3AA3A 1BO5O 1JLFA 1P8ZA 3OVNA 3CM6A 2GEMA 2YHXA 3DAWA 1EWQA 4RTFD 4U7BA 4CJEA 1UA0A 1HUXA 3DWLA 2QKBA 2P9SB 1NGEA 1YTAA 4K8ZA 4Y1DA 3AVCA 5KRSA 2Y1JA 5GAHP 3UKUB 1M90O 4FSVA 3VGLA 4CF2A 3BZKA 1XC9A 4LF7K 4JK9A 4M3UA 2GELA 3M3ZA 2Z1HA 2A1SA 1RBUA 5JMVA 3SUNA 3HSTB 4M7XA 3QBXA 3CJAA 1YIJN 2P9NB 2UYTA 2HHXA 5CE3A 3NFAA 1T05A 3AVIA 4Z4EA 3MWTA 4H4OA 3TABA 1RDAA 2P9KB 1U45A 5AZJB 3O9TA 5F0XA 4ZTFA 1S1WA 3M5RA 4OGCA 2E2OA 2V52B 2ZD1A 5ELZA 5ADXA 4B9TA 1NK8A 4PL8A 4MLEA 2F8TA 2IVNA 4CD3A 2R7YA 4E19A 2Q0RA 4CZIA 3VEZA 2KW4A 1J53A 3NDKA 4FK4A 4JS4A 2WC9A 2HSTA 2HF4A 3R8EA 4JV5K 4DV2K 3FZLA 3KTQA 3VEXA 5AFUH 1TVRA 4WFAL 4C8MA 3WNEA 3SUOA 4QS7A 2P51A 5AQSA 3I8BA 1MWMA 2FSJA 2GV9A 1RBTA 2FLOA 4FJ8A 3OYEA 1IKWA 2D0AA 3P39A 4C8OA 1VSEA 3P83D 4BE1A 3DLKA 2Q0UA 4YOYA 4PY5A 2I5JA 4LY7A 2G8HA 4KFBA 5FPEA 4H5WA 3F73A 4A5BA 3TAEA 5FRMA 3L2WA 1Q82O 1BCMA 1NGJA 4YOVA 4H5RA 5HRNA 4N41A 3HM9A 4M45A 2QEXN 5D3GA 2P9IA 1A5WA 5AZIB 4H0TB 3T19A 2O8FA 4C23A 5BN8A 3V9WA 4H0VB 4CERA 1X3MA 1Y64A 4BR7A 4DS4A 1HMVA 2O4IA 2FSNA 1JXBA 3ENHA 5M1FA 3B6OA 4ISGA 4BRNA 2OYQA 3VENA 2X78A 4KTZA 5CY4A 5C42A 2Q1NA 2YHBA 3SAFA 2HNDA 4FLXA 4IFEA 1E4GT 2IVPA 3EKUA 3ULEB 2X74A 5AJ3K 3A8YA 3VEYA 2ZF5O 4JD2A 3TWHA 4YOXA 4B8AB 4FJXA 2YI1A 2WOMA 3TTCA 3VN5A 3SUQA 2AA4A 2JWKA 3M8QA 1BIZA 4DUYK 4FWQA 1D5AA 3CCQN 2GX9A 4B1WB 4BRCA 4CFDA 3A5MC 4DR7K 1A5XA 1IG9A 5AZJA 2VYPA 4XH4A 1HNXK 1NGCA 3OYFA 3VQ7A 3NE6A 4E7LA 3CCRN 3LZJA 3HBTA 3OS0A 1BOTO 1N33K 4JKEA 3ZX0A 1VSLA 4CF8A 3KLGA 3T1YK 4B3MK 3DOLA 1ZBHA 3OBYA 4JN4A 4PHTX 4W5NA 3AO3A 2HBLA 1KFDA 2GUIA 3QESA 4EP4A 3K58A 3G4SN 3PLAA 2W41A 1NU0A 4ID5A 1QTMA 4DR6K 1MDUB 5KTQA 4FLVA 2ZM6K 1RT2A 3M8RA 3ZLJA 1IKYA 1QHAA 1BISA 2HHWA 3WQTA 3SV4A 4NCAA 4HTLA 4KB0A 3SNNA 3TSPA 4FZZA 4B1UB 1ZBSA 4N47A 3TANA 4J2AA 3IFRA 3U3GA 4I9LA 1RT1A 3LDLA 2DFHA 2HMPA 2HNZA 5EU7A 4KH4A 3HPOA 4M3YA 3RMDA 5JS2A 3CJ1A 1RT4A 3QICA 3G0ZA 4JAXA 3G25A 5LL6Z 4CEZA 1M1KO 3ZETA 1RGIA 3K59A 1TKXA 3ZEUA 4H0OA 2OCEA 2F4VK 3J8AA 3ZSYA 4ZHRA 2BTFA 4FYDA 5BPMA 2D5RA 3N4QA 3QBWA 5AQVA 2NNWA 2E1ZA 4IWVA 3F9KA 3LDQA 4HTUA 1VQ4N 4CJSA 2BE2A 3OYLA 5IWAK 3H46O 2W42A 1KCFA 2P9PB 2QWLA 3KK2A 4UY8O 5AQFA 2O8DA 3P38A 5BR8K 2NLXA 2ZJPL 4DR3K 5M1OA 4ELTA 3AO4A 4B9LA 4QCLA 2OPRA 1JJ2M 3CCSN 2NRWA 4FLYA 1YUWA 3RMCA 4IO8A 4L3QA 4CJ7A 1GLEG 4JI5K 3CHWA 5KGWA 3KLEA 3L2QA 1VSKA 4Z4FA 2XY8A 4HWIA 5GAEP 3V81A 1S1VA 1NM1A 4RW7A 3BZCA 3AA4A 3O9RA 2G8WA 4FCYA 3TAQA 3I0SA 3QFUA 4FPBA 4OKKA 4DV3K 1JL2A 4LH4A 5C2FA 4I9QA 2Q2RA 5GAGP 1BQMA 3RR8A 4FOIA 3CM5A 1BA0A 1ZBLA 2ASOA 3PO5A 4O8UA 4FM2A 4BY9C 4O44A 1CZBA 3AO1A 3O9UA 3PSFA 4FZXC 2LSNA 1EX4A 1RDUA 4AILC 4KO0A 3CJBA 3NF6A 1WBDA 1Q8IA 1U2VA 4BE2A 3J7YP 3SMPA 2BUPA 1J6ZA 3D2FA 4YORA 4ILGB 2E20A 3T3FA 3VQEA 3G6EN 1G15A 1Z6RA 4O0IA 1W7AA 4B3SK 4DSJA 1RBSA 4NXNK 4PWDA 2IS3A 3IRXA 3K9JA 4MFBA 1C1BA 4B08A 3O4QA 2FF6A 1I3AA 3O3HA 3PX0A 3ZT3A 4PKGA 2W40A 5HLFA 3JYTA 1KVBA 2ZJQL 2VG5A 4WF9L 1YVNA 2UUBK 3L2RA 3CC4N 4M41A 3RR7A 3SV3A 4KB1A 3HO1A 3MN5A 1FJGK 4NLBA 2PYJA 4NXMK 4JHDB 1C0TA 3HP9A 3K5OA 4IBNA 4FPAA 2KZZA 1RT6A 3AAQA 3MXMA 1TUYA 4FWMA 1S9EA 5FRNA 2PAVA 4O8KA 2V7ZA 2P9PA 3DYAA 3MN9A 1N5YA 3DRRA 1EKEA 4GVMA 3VQ5A 5AR0A 3HPHA 4DFKA 3SUPA 4KI4A 2GTDA 5AQMA 5AQLA 3LP3A 3NH0A 3RMBA 3V1QA 4CHZA 2P9UA 4W5QA 3J80O 3GL1A 1RTDA 3ENOA 3VQQA 4KTWA 1UAXA 4MO5A 3MN7A 4J2EA 4TSXA 1XMQK 1EWRA 3K9KA 4BVOA 4DFJA 1ATSA 1VSDA 5C2DA 4MLHA 4CECA 1XI1A 5FLXO 4JKDA 1QE1A 5AQUA 3BGRA 3C65A 3F9MA 3CPEA 4Z0UA 4EZ6A 3LP1A 1FKPA 4CF1A 3UKRA 1D9FA 4RCHA 1NGFA 4IEEA 4H0YB 3U9ZA 1NJWA 3HVTA 4CFBA 1JCEA 2P9LB 4I6MB 2RKIA 1RTHA 4DSKA 4N76A 4KHWA 3FZFA 3QO9A 5HBMA 2XY7A 5GADP 3S3NA 3SBTA 3SJJA 4JRPA 5BRFA 1BGXT 5M1PA 3VERA 1VSJA 3JXUA 4OPKA 4DLEA 3KZBA 3PSIA 4FWPA 1BQNA 3WT0A 3MEEA 3WXIA 5AQJA 2O8BA 4B8CA 2D0BA 1YF5L 4H5NA 4M63C 3FZHA 2FBVA 3VQ4A 4DSFA 2VWKA 1T8EA 4BRHA 4WCEL 1QS4A 4GMJB 4A57A 1LAVA 4KHSA 4EP5A 3DM2A 4DS5A 4G9ZA 2FBYA 3ZSOA 3NVKA 4CHPA 1X9JA 4CJWA 5BR9A 4DV6K 1TK0A 1BCOA 2QWRA 1FK9A 1TK8A 3ITHA 3OYCA 1HYZA 3VGKA 4CESA 1N32K 4PKIA 2A3ZA 3DLBA 3VQDA 2EHGA 5I42A 1K9MO 2YJEA 1VQ8N 1U48A 5HRSA 3V6DA 1OH6A 2WBNA 2PBDA 3OYGA 4OPJA 3FGUA 2WTUA 1YXQA 2Z1IA 3AVJA 1EXQA 2E2QA 3L0QA 2G8FA 4X66K 1KC8O 2ASPA 3THWA 2E6MA 3E9OA 3VA0A 3MECA 5KGXA 4JLHA 3SLCA 1JLGA 1OVYA 2YKMA 3CMEN 4YOWA 4DTJA 2D1KA 4FW1A 2A42A 1S22A 1KQSM 3LPUA 5AFUA 3CCMN 3O5BA 1I39A 1GOCA 3O4NA 1VQNN 1CLQA 4PUOA 3MK6A 5BRHA 4BWJA 1Z05A 3CCLN 5E41A 2NRTA 5CZ1A 3DRSA 3OS2A 4AHUA 4CEOA 3KK7A 3ZSWA 5AQIA 3E66A 2VQEK 4JNEA 3KKRA 3L3VA 1S5JA 4WFNL 3ENBA 2HHSA 3O08A 4E1MA 1J9AA 3IKMA 4DQRA 4DTXA 3VQPA 1HKBA 3PUFA 3VETA 4FLZA 1IO2A 2OTJN 4CIFA 1BHLA 3C6UA 3NBPA 2GWJA 4DF4A 3O3GA 4BR5A 3K5LA 2P9IB 3CCEN 4J2BA 3L3UA 2KHOA 4ISEA 2O8FB 1TAUA 3S41A 3AVLA 3DLRA 3U6FA 3RWUA 4ID1A 4H4MA 3BP8A 1YTUA 5E26A 4HUEA 5C24A 3ZSQA 4PKHA 4JI1K 4YY3K 1NJZA 1ESVA 3THVA 1VSMA 2NRHA 1JKHA 1J5OA 2NRVA 2RN2A 4NO7A 4CI6A 3A2FA 4JD2B 2ZE2A 4O5FA 3VEWA 4IJNA 1TK5A 1KVCA 1XWLA 4H5VA 4WQ4A 4LF4K 3MEDA 3AVKA 5A2QO 1LW2A 4BC4A 3LP0A 4DV5K 3IMXA 4CEEA 1VQON 1T6DA 3OYIA 3CFOA 4FVMA 4L8RB 4CGJA 4DU3A 3AO5A 3BY5A 1ITGA 2G8UA 3LDOA 1NLVA 2BH1A 3AVFA 2IC3A 3WXKA 5E84A 1SZ2A 3HT3A 3W3DA 4OPAA 5SWMA 4FWRA 1WB9A 1MA9B 1RDCA 4BC3A 1NK4A 4DQ8A 3NHGA 3ZX3A 5FPMA 5TKYA 1E3MA 4BDPA 5M1KA 4CEFA 2O8CB 3AA2A 4GV6A 4QAGA 1Q9YA 1HJOA 3NGIA 4OO1J 2KZMA 4BR0A 4JKHA 5BRDA 3H1QA 4B9QA 5B8HA 1C0UA 4BWMA 5JVGL 3KD5E 3C0BA 3D2EA 4IO9L 4OPHA 3ZSVA 3QDKA 3UE5A 4JRQA 4FJMA 2E5LK 4GV3A 3CMAN 4YFUA 2RF2A 4F9OA 3IG1A 1DGKN 3ZETB 1V4SA 3VEOA 3ZEUB 4LSLA 3VQAA 3SYZA 1D4XA 3KD1E 4K0KK 3MEGA 5FPDA 1C1AA 4HVJA 3MX5A 3LM9A 3T1HK 3CERA 3A5LC 3OA9A 3QEWA 5BREA 3RTVA 2E2NA 2BDPA 3O6WA 4B3TK 5AQRA 2O8DB 1QQCA 1WSEA 3DJCA 2OPPA 3HM8A 3NCIA 1VQMN 3TSQA 4FJ9A 2XY5A 5TKWA 4FM0A 2F7TA 4IOCL 1HPZA 1KLMA 3LP2A 2Q36A 4DQQA 5HRPA 1UWBA 2KLAA 1GLLO 4O5BA 3MN6A 4CGGA 4NCBA 3RVCA 3TAGA 5LMUK 4CW7B 1J5EK 1R0AA 3OJUA 4I2PA 3O4WA 3P5JA 1SL1A 2Y1IA 1IBLK 2PY5A 4CZLA 1G99A 4DSEA 1YJNN 1QSYA 4JKBA 1WOQA 4OKJA 4K25A 3CCJN 4BC2A 4AHRA 3VQ8A 4OX9K 5BPNA 1X9SA 4CFCA 4DFMA 1S3XA 3KLFA 4EZ9A 3MX2A 1O1WA 3QEPA 2I7NA 2UU9K 1VSHA 3TARA 2UUCK 4KBOA 3JS6A 5JVHL 4J8FA 3PV8A 1CXQA 3OY9A 1OVQA 1OKJA 4Q5VA 1NK0A 1U2VB 2NRXA 2HBJA 1RILA 2HNYA 3AAPA 2O8CA 1S1UA 3IAYA 3K5NA 3D2FB 1OH8A 4BRDA 1VQ5N 1Z25A 1J54A 4FJJA 3WNGA 3N4PA 2QKKA 4B3RK 3Q7BA 3LWLA 5EXWA 2HVHA 4Z94A 4M3ZA 4FXDA 1XQSC 4KH5A 1NGHA 1B92A 3A5OC 3C95A 1TYQA 3V1RA 1N36K 2YHYA 1NNEA 1JLQA 3THXA 4FJNA 2VWJA 1QQMA 1HQEA 2P1JA 3S9HA 1IG8A 3O80A 1WLJA 3RRHA 2KQ2A 2ZGZA 4CZJA 1KAYA 3P1GA 2WUSA 4ILJA 4E7JA 1UOCA 2QWNA 3EL2A 1NK5A 3LDSA 2QI2A 5AQHA 4UQGA 1JLBA 4H0XB 1F21A 4BDYA 5JICA 4BRAA 3K57A 4K43A 1HRHA 4BRIA 1RFQA 3TU5A 5AQXA 4CD1A 3E9LA 4R79A 4JI8K 1B9FA 4CJ5A 5F2RA 4GW6A 2DY4A 2HF3A 4RW8A 3PIOL 4BQZA 1VHXA 4BRGA 4E1JA 3T69A 2F9WA 4BACA 2DTUA 5C15A 1YVUA 1EETA 4B9SA 4NB4A 5J1EA 2OANA 3CG7A 1DT9A 3QLHA 1NKEA 1RDWX 3EZWA 4WQ4C 2P9UB 3ZT2A 3H45C 4DTSA 1REVA 3CYMA 1BWFO 3O1BA 4OGEA 5DM7L 2G8KA 1HYSA 4JKGA 2KTQA 3LWMA 2D0CA 3HJFA 4AH9A 3MMVA 3EEQA 3DRPA 3KWIA 2JLEA 4CZFA 1NG9A 1YHQN 3AVGA 1TV6A 3QEXA 3UKRB 3HXMA 4HUGA 4JK7A 2NUBA 3CQYA 4QS9A 3ZSXA 1ZBIA 1Z26A 4DQIA 3C6HA 4JYAK 2B5JA 4K8XA 3JSMA 4BROA 3EKSA 4DR5K 5DM6L 1NGBA 4IG0A 4CEDA 4KREA 4CZKA 5GIPA 4W5TA 4RW4A 1VQ7N 5DK5A 4GNIA 1X9WA 3GOIA 1ZBUA 4RW6A 4CCHA 1RT3A 2PFUA 4NYNA 3S3OA 2EWSA 2O8BB 2CH5A 3B6PA 4QS8A 3SAGA 1TAQA 1IH7A 4F4KA 3KHYA 4EFHA 1ZBFA 1NOZA 4JEPA 3CD6N 4XEIA 4KRFA 2H3GX 4DG1A 4ELUA 3E9PA 3ALYA 4OLBA 4DR1K 4WFBL 1HX1A 4WYBA 2YKNA 3CQXA 4DKWA 4B3OA 3SPYA 3WXJA 1CXUA 4FVUA 1VQ6N 3KK1A 3QNOA 4Y1CA 1NKBA 3HI0A 3OYBA 1BI4A 2VG7A 5JLHA 4DTMA 4C8NA 5SZTA 4YHHK 5J2QA 1Q81O 4X64K 4JI4K 4CJ4A 3A5NC 4CJUA 1U04A 5KQ8A 3THWB 2QWOA 4CK3A 1B9DA 1MU2A 1HNWK 4IZ9A 2QW9A 1KTQA 1JLEA 4CBXA 3NGZA 4DSIA 3I56N 2HHQA 1VQKN 1EQYA 4V19S 3ID8A 4JI0K 4CBWA 2KFNA 3CCUN 3FZKA 2KKZA 3LALA 1L3SA 3JAMO 3ZYYX 1QSSA 4BRKA 4FJHA 3VGMA 2UXCK 3F2KA 4CZMA 3M8SA 4DV4K 1TL1A 1QQOA 3EE8A 5BN9A 5AQPA 1XMOK 3SCXA 5FDLA 5C25A 1NBWA 4DUZK 1T03A 1RT5A 1ATNA 3ZT1A 1L3VA 3O9QA 4WE1A 2HOEA 4IXCA 3R1XA 3O1WA 2IAJA 4Q0BA 4K41A 3G71N 4MQ3A 4E1NA 2O8EA 3OYAA 3EYZA 3QIOA 3DOKA 3KIOA 4C8LA 3S3MA 4RG8A 3AY9A 2HHTA 3R9PA 4CGIA 3SBGA 5EOYA 4MO4A 3D7EO 3VF6A 1EO1A 4CGDA 1TL3A 3WNFA 5AQOA
chains in the Genus database with same CATH topology
1JKHA 2WOMA 1WSJA 2IGIA 1J5OA 3VN5A 2RN2A 3SUQA 3QIPA 1W0HA 4KPYA 3A2FA 3M8QA 4FJ7A 1BIZA 1HYVA 2ZE2A 4F2RA 1NOYA 1D5AA 2XRIA 4CFDA 4DU4A 3RMAA 1TK5A 1A5XA 1IG9A 2YNHA 1KVAA 4AHVA 1KVCA 4E89A 1XWLA 3ZT0A 3OYFA 3VQ7A 3AVAA 4M3RA 1UA1A 4KAZA 1FXXA 1NKCA 1ASWA 2ETJA 3NE6A 1SUQA 4E7LA 1S9GA 3MEDA 3AVKA 3OS0A 1WAJA 1LW2A 3LZJA 4FK0A 3LP0A 4KHNA 1IKXA 4M3WA 4KTQA 4CEEA 2XY6A 4IFYA 3OYIA 1K6YA 1VSLA 3C6TA 3CFOA 4FVMA 4CF8A 3KLGA 4L8RB 3MXIA 2IDOA 3DOLA 4CGJA 3V9UA 1ZBHA 4CGHA 1HQUA 4DU3A 4CE9A 3AO3A 4W5NA 4OLAA 3V9SA 2XO7A 1KFDA 2X6SA 3AO5A 2OA8A 4HHTA 1YT3A 1ASUA 2DFEA 2GUIA 1S6PA 5JS1A 3QESA 1ITGA 1Q9XA 2G8UA 3AVFA 4EP4A 4N56A 2IC3A 3K58A 3HK2A 4B9MA 1RBVA 4DQPA 3AVBA 3AO2A 3K5MA 3HT3A 4F3OA 4ID5A 1QTMA 4FJJA 5KTQA 4FLVA 1RT2A 5SWMA 3M8RA 3LANA 3D0PA 3OYJA 1RDCA 1IKYA 1NK4A 3VA3A 1BISA 4IFVA 4FJKA 5HRRA 2HHWA 4E7IA 3NHGA 3SV4A 4NCAA 4B9NA 4CIGA 3L2VA 3CFPA 5HP1A 3SNNA 4BDPA 4KB0A 4FJIA 4KHUA 1RTIA 4CEFA 4N47A 3TANA 2KFZA 4DTPA 4J2AA 5I3UA 3PO4A 1L3UA 4LD0A 3AA2A 4AHSA 3U3GA 2Z1JA 4I9LA 1RT1A 3OYDA 4QAGA 1Q9YA 2F8SA 2DFHA 1HNVA 2HNZA 4BE0A 3NGIA 1NK7A 5EU7A 2KZMA 3HPOA 4M3YA 4CF9A 3RMDA 1ASVA 1NJYA 1C0UA 4BWMA 5JS2A 2OZSA 1RT4A 3KD5E 3G0ZA 4CEZA 4F2SA 1D8YA 3VQ9A 4BDZA 3ZSVA 3K59A 4JRQA 2OPQA 1TKXA 4FJMA 4CK2A 4FW2A 3ZSYA 2BANA 4PA1A 4ZHRA 4FYDA 4YFUA 2D5RA 2RF2A 3FFIA 4H8KA 1T7PA 4CEAA 3IG1A 3F9KA 4HTUA 4R5PA 4CJSA 4Z4IA 2BE2A 3OYLA 3WNHA 4LSLA 4E0DA 4HUFA 3VQAA 3I8DA 2W42A 1KCFA 3SYZA 3KD1E 3KK2A 5DMRA 4B9UA 3AV9A 1XHXA 3MEGA 4M42A 2YNGA 3D45A 1C1AA 4HVJA 4ZTJA 1Y97A 3HPGA 2G8VA 4ELTA 1SKRA 4E7KA 3QEIA 3RTVA 3QEWA 3CFRA 1S1TA 2HB5A 2BDPA 3AO4A 1RCHA 2HMIA 4CJTA 4B9LA 4DWIA 1QQCA 3OJSA 2FBXA 3MAQA 4QCLA 3OYKA 2HHVA 1WSEA 2OPRA 4CEQA 2OPPA 2FC0A 1KSPA 3NCIA 3DLHA 3SZ2A 3HYFA 3EY1A 3OYNA 3SQ2A 2P5OA 4FLYA 4FJ9A 3RMCA 4YNQA 1VSFA 3NGYA 2ATQA 2XY5A 1LAWA 2P5GA 3AA5X 4FM0A 1D9DA 4IKFA 4CJVA 5KGWA 3KLEA 1HPZA 3L2QA 5HROA 1KLMA 4FJLA 4M3TA 1VSKA 3LP2A 2XY8A 4Z4FA 3V9XA 3QETA 2QK9A 4DQQA 3ZSZA 5HRPA 1S1VA 1UWBA 3V81A 4RW7A 2O4GA 4O5BA 3AA4A 4CGGA 4NCBA 3LAKA 1VRUA 2G8WA 4FCYA 3TAQA 1TGOA 3TAGA 1W9HA 3I0SA 4OKKA 1WSGA 1XHZA 1JL2A 4LH4A 4DMNA 1R0AA 1VK0A 1JXEA 2XHBA 3OJUA 4I2PA 3KLIA 4FZYA 4I9QA 4I2QA 4AHTA 4CJLA 3P5JA 1SL1A 2Y1IA 1BQMA 3RR8A 4O55A 2PY5A 1WN7A 1BIUA 3CM5A 4CJKA 3LZIA 2B4JA 5K14A 4DSEA 1KRPA 1QSYA 4KV8A 4OVLA 1ZBLA 3PO5A 4CJQA 4CHOA 3G10A 4FM2A 4O44A 4OKJA 4CK1A 3HVRA 2Z1GA 1U49A 1SKWA 1WNSA 1CZBA 3AO1A 4AHRA 3VQ8A 3MXJA 4KKOA 4FZXC 4CEBA 2LSNA 5CYMA 1LWEA 3SQ4A 4Z4GA 1EX4A 4KHYA 1X9SA 3LAMA 2G8IA 4OKEA 4AILC 4KO0A 4HCBA 4CFCA 4DFMA 3PX4A 1RBRA 3NF6A 2YHAA 3KLFA 1QSLA 1Q8IA 4DF8A 1O1WA 3QEPA 4EZ9A 1VSHA 3TARA 1X9WA 4BE2A 1LW0A 1CZ9A 4F8RA 1RDBA 1TKDA 3VQ6A 1L3TA 1U4BA 3PV8A 1CXQA 3NF7A 1LWCA 3OY9A 3T3FA 3DLGA 3VQEA 3VQBA 4Q5VA 1G15A 4O0IA 3NH1A 4JS5A 1NK0A 1U47A 4DSJA 4CHYA 1RBSA 1RILA 2HNYA 4OJRA 1S1UA 4DFPA 3IAYA 2PYLA 3K5NA 3TAMA 4PWDA 3ASMA 2IS3A 3IRXA 1Z25A 1C1CA 1J54A 3WNGA 4MFBA 3L8BA 1C1BA 3HL8A 3LWLA 2QKKA 4FJ5A 4B08A 3O4QA 2X6NA 3ZCMA 2HVHA 3OYMA 3PX6A 3TAFA 1S6QA 1WSHA 4M3ZA 4FXDA 1I3AA 3O3HA 3HP6A 1EP4A 3PX0A 2AJQA 3V1OA 3ZT3A 1B92A 3C95A 5T7BA 2YNIA 5KRTA 4FLWA 4B9VA 5HLFA 3JYTA 1KVBA 1WSFA 3U3YA 2VG5A 3V1RA 2RPIA 4DU1A 4DQSA 1JLQA 1RNHA 3L2RA 4FJNA 2VWJA 4M41A 3RR7A 1HQEA 4M3XA 3SV3A 4KB1A 2P1JA 1RTJA 3HO1A 3S9HA 4W5RA 2PYJA 1WLJA 2FBTA 4ELVA 1NJXA 3RRHA 2KQ2A 1NK6A 1C0TA 3HP9A 4KI6A 1JL1A 4IDKA 3DLEA 3K5OA 3P1GA 4IBNA 3ZT4A 3O3FA 1ZYQA 2KZZA 1RT6A 4E7JA 2ITGA 1UOCA 3MXMA 2BGGA 3NF9A 5FROA 3T1AA 2E6LA 1JLCA 1NK5A 1S9EA 3QNNA 3LDSA 4KHQA 5FRNA 3DYAA 4CFAA 1HNIA 1JLBA 4UQGA 1F21A 3DRRA 4BDYA 1N5YA 1N6QA 3K57A 3AVMA 3DMJA 3EZ5A 1EKEA 3TI0A 4GVMA 1HRHA 4NYFA 3VQ5A 3HPHA 4DTRA 4DFKA 3SUPA 1B9FA 4CJ5A 1X9MA 2DY4A 4GW6A 4KI4A 3VQCA 3KK3A 4FJGA 4RW8A 3LP3A 3NH0A 3RMBA 4F3TA 3V1QA 4CHZA 3CQ8A 4FM1A 4W5QA 4BACA 4LSNA 2DTUA 4QOZB 1RTDA 3V4IA 3KKSA 3VQQA 4KTWA 1YVUA 3E01A 1UAXA 1EETA 4B9SA 3AVNA 5J1EA 3NF8A 1WAFA 3CG7A 4J2EA 2YV0X 4TSXA 3QLHA 2EX3A 1NKEA 1RT7A 4N5SA 4FZZA 5J2MA 3ZT2A 4E3SA 4DFJA 3L2UA 1KFSA 3DI6A 2JGUA 4DTSA 5CZ2A 4FK2A 1VSDA 1REVA 3CYMA 1TKZA 3I0RA 1IKVA 4XIUA 4OGEA 4CECA 1XI1A 2G8KA 1HYSA 1QE1A 4Z4HA 2YNFA 1C0MA 5J2NA 2KTQA 3BGRA 4I7FA 1BL3A 4Z0UA 3LWMA 1NK9A 3ZSRA 2PZSA 3LP1A 4EZ6A 1DTQA 1FKPA 5CYQA 2D0CA 4CF1A 1VRTA 3HJFA 4AH9A 3SQ0A 3KLHA 1D9FA 4C8KA 1DTTA 3DRPA 1A5VA 2JLEA 5KI6A 2GBZA 4PQUA 1NJWA 4CF0A 2B6AA 1S1XA 3ULDA 3HVTA 2WONA 4CFBA 3AVGA 4ICLA 1TV6A 2RKIA 3QEXA 1RTHA 3OS1A 4DSKA 2HHUA 1TKTA 3HXMA 4HUGA 4N76A 4KHWA 1SL2A 3TAPA 3AA3A 2NUBA 1JLFA 3ZSXA 3QO9A 5HBMA 1ZBIA 2XY7A 1Z26A 3OVNA 3CM6A 4DQIA 3S3NA 4AHCA 3SJJA 4JRPA 3IS9A 1X1PA 2B5JA 4K8XA 4CJEA 1BGXT 1UA0A 4LH5A 3JSMA 1VSJA 4CJPA 1SV5A 2QKBA 4OPKA 4DLEA 2DFFA 3QEVA 1YTAA 4K8ZA 1BQNA 4Y1DA 3AVCA 3MEEA 5KRSA 2Y1JA 4CEDA 4IG0A 4KREA 4W5TA 4B8CA 4CF2A 4FLUA 2D0BA 4RW4A 4E7HA 1XC9A 3NAEA 4M3UA 2FBVA 3LPTA 5DK5A 3VQ4A 2VWKA 4DSFA 2Z1HA 2A1SA 1RBUA 1ZBUA 3SUNA 1T8EA 3HSTB 4RW6A 4W5OA 1QS4A 3SQ1A 2A1RA 4CCHA 1RT3A 2HHXA 4GMJB 3QINA 4NYNA 1LAVA 4Z4CA 3H08A 1RDDA 4EP5A 3S3OA 4KHSA 3DM2A 3NFAA 3KJVA 4DS5A 3B6PA 2FBYA 3ZSOA 4CJ3A 4CHPA 4CJWA 1T05A 3RRGA 3AVIA 3NH2A 4Z4EA 4H4OA 1TAQA 3TABA 1JLAA 1GOBA 1TK0A 1BCOA 1IH7A 1RDAA 1U45A 4F4KA 1FK9A 1TK8A 4ZTFA 1S1WA 3M8PA 3ITHA 3OYCA 1ZBFA 1HYZA 3ISNC 4CESA 1NOZA 4HCCA 1C6VA 4OGCA 2ZD1A 4KRFA 1KLNA 3DLBA 4DG1A 4ELUA 3ALYA 3VQDA 2EHGA 4B9TA 1NK8A 2F8TA 5I42A 4OLBA 4CHNA 1U48A 5HRSA 3V6DA 2OZMA 2R7YA 4DSLA 3OYGA 4CHQA 4RW9A 2YKNA 3AVHA 4OPJA 4E19A 1QHTA 4DLGA 4B3OA 2Z1IA 2KW4A 3AVJA 1J53A 4O0JA 3NDKA 4DTNA 4FK4A 3SPYA 1CXUA 1EXQA 4JS4A 2G8FA 1LV5A 2E4LA 3KK1A 2VG6A 3QNOA 2E6MA 4Y1CA 3VA0A 3MECA 1NKBA 3KTQA 5KGXA 3PY8A 4JLHA 3OYBA 1HJRA 1BI4A 2QXFA 2VG7A 1JLGA 1TVRA 4DTMA 2YKMA 2OPSA 4FLTA 4C8NA 5SZTA 5J2QA 4DTJA 4C8MA 2HW3A 4CJ4A 3WNEA 4FW1A 1FKOA 1U04A 4CJUA 3SUOA 2ZQBA 2P51A 4CK3A 1B9DA 1MU2A 3LPUA 1BI4B 1I39A 1KTQA 1JLEA 1GOCA 1RBTA 2GV9A 3O4NA 1CLQA 3NGZA 4PUOA 4FJ8A 4DSIA 3QERA 2HHQA 4BWJA 3OYEA 1IKWA 2D0AA 4C8OA 3C94A 1VSEA 3P83D 4BE1A 3DLKA 2KFNA 4PY5A 2I5JA 1DLOA 5E41A 4LY7A 3LALA 1L3SA 4KFBA 5CZ1A 3DRSA 3SPZA 4DTOA 2G8HA 3OS2A 4CIEA 3F73A 3TAEA 1QSSA 5FRMA 4AHUA 4CEOA 3ZSWA 3L2WA 4FJHA 4CGFA 1BCMA 4O4GA 3KKRA 3OYHA 3L3VA 1S5JA 4CJFA 3M8SA 2HVIA 1TL1A 2HHSA 4E1MA 1J9AA 4DTUA 1WSIA 3SCXA 4DQRA 4DTXA 5FDLA 4G1QA 5HRNA 3VQPA 4N41A 3HM9A 4M45A 5C25A 5D3GA 1A5WA 1T03A 1RT5A 3PUFA 4FLZA 3ZT1A 3T19A 2F96A 3V9ZA 1L3VA 1IO2A 1VSIA 4CIFA 1BHLA 4WE1A 3C6UA 3TR8A 3NBPA 3V9WA 3BDPA 4CERA 5J2PA 1SL0A 2IAJA 3SI6A 4J2DA 4DS4A 1HMVA 4DF4A 3O3GA 4Q0BA 2O4IA 2IOCA 3K5LA 4MQ3A 1GOAA 4E1NA 1JXBA 1SKSA 1L5UA 4J2BA 3L3UA 3OYAA 3EYZA 3QIOA 3DOKA 1TAUA 3B6OA 2OYQA 3AVLA 3KIOA 3DLRA 4C8LA 3U6FA 3S3MA 2X78A 4KTZA 5CY4A 5C42A 3RWUA 2YHBA 4ID1A 4RG8A 2HNDA 4FLXA 4H4MA 2HHTA 2Q3SA 4IG3A 1YTUA 4CJRA 4CGIA 4HUEA 2X74A 4NCGA 5C24A 3ZSQA 3UIQA 3K2PA 1NJZA 3TWHA 3THVA 4CGDA 1VSMA 1LWFA 4B8AB 1TL3A 4FJXA 3WNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JKH A;  2WOM A;  1WSJ A;  2IGI A;  1J5O A;  3VN5 A;  2RN2 A;  3SUQ A;  3QIP A;  1W0H A;  4KPY A;  3A2F A;  3M8Q A;  4FJ7 A;  1BIZ A;  1HYV A;  2ZE2 A;  4F2R A;  1NOY A;  1D5A A;  2XRI A;  4CFD A;  4DU4 A;  3RMA A;  1TK5 A;  1A5X A;  1IG9 A;  2YNH A;  1KVA A;  4AHV A;  1KVC A;  4E89 A;  1XWL A;  3ZT0 A;  3OYF A;  3VQ7 A;  3AVA A;  4M3R A;  1UA1 A;  4KAZ A;  1FXX A;  1NKC A;  1ASW A;  2ETJ A;  3NE6 A;  1SUQ A;  4E7L A;  1S9G A;  3MED A;  3AVK A;  3OS0 A;  1WAJ A;  1LW2 A;  3LZJ A;  4FK0 A;  3LP0 A;  4KHN A;  1IKX A;  4M3W A;  4KTQ A;  4CEE A;  2XY6 A;  4IFY A;  3OYI A;  1K6Y A;  1VSL A;  3C6T A;  3CFO A;  4FVM A;  4CF8 A;  3KLG A;  4L8R B;  3MXI A;  2IDO A;  3DOL A;  4CGJ A;  3V9U A;  1ZBH A;  4CGH A;  1HQU A;  4DU3 A;  4CE9 A;  3AO3 A;  4W5N A;  4OLA A;  3V9S A;  2XO7 A;  1KFD A;  2X6S A;  3AO5 A;  2OA8 A;  4HHT A;  1YT3 A;  1ASU A;  2DFE A;  2GUI A;  1S6P A;  5JS1 A;  3QES A;  1ITG A;  1Q9X A;  2G8U A;  3AVF A;  4EP4 A;  4N56 A;  2IC3 A;  3K58 A;  3HK2 A;  4B9M A;  1RBV A;  4DQP A;  3AVB A;  3AO2 A;  3K5M A;  3HT3 A;  4F3O A;  4ID5 A;  1QTM A;  4FJJ A;  5KTQ A;  4FLV A;  1RT2 A;  5SWM A;  3M8R A;  3LAN A;  3D0P A;  3OYJ A;  1RDC A;  1IKY A;  1NK4 A;  3VA3 A;  1BIS A;  4IFV A;  4FJK A;  5HRR A;  2HHW A;  4E7I A;  3NHG A;  3SV4 A;  4NCA A;  4B9N A;  4CIG A;  3L2V A;  3CFP A;  5HP1 A;  3SNN A;  4BDP A;  4KB0 A;  4FJI A;  4KHU A;  1RTI A;  4CEF A;  4N47 A;  3TAN A;  2KFZ A;  4DTP A;  4J2A A;  5I3U A;  3PO4 A;  1L3U A;  4LD0 A;  3AA2 A;  4AHS A;  3U3G A;  2Z1J A;  4I9L A;  1RT1 A;  3OYD A;  4QAG A;  1Q9Y A;  2F8S A;  2DFH A;  1HNV A;  2HNZ A;  4BE0 A;  3NGI A;  1NK7 A;  5EU7 A;  2KZM A;  3HPO A;  4M3Y A;  4CF9 A;  3RMD A;  1ASV A;  1NJY A;  1C0U A;  4BWM A;  5JS2 A;  2OZS A;  1RT4 A;  3KD5 E;  3G0Z A;  4CEZ A;  4F2S A;  1D8Y A;  3VQ9 A;  4BDZ A;  3ZSV A;  3K59 A;  4JRQ A;  2OPQ A;  1TKX A;  4FJM A;  4CK2 A;  4FW2 A;  3ZSY A;  2BAN A;  4PA1 A;  4ZHR A;  4FYD A;  4YFU A;  2D5R A;  2RF2 A;  3FFI A;  4H8K A;  1T7P A;  4CEA A;  3IG1 A;  3F9K A;  4HTU A;  4R5P A;  4CJS A;  4Z4I A;  2BE2 A;  3OYL A;  3WNH A;  4LSL A;  4E0D A;  4HUF A;  3VQA A;  3I8D A;  2W42 A;  1KCF A;  3SYZ A;  3KD1 E;  3KK2 A;  5DMR A;  4B9U A;  3AV9 A;  1XHX A;  3MEG A;  4M42 A;  2YNG A;  3D45 A;  1C1A A;  4HVJ A;  4ZTJ A;  1Y97 A;  3HPG A;  2G8V A;  4ELT A;  1SKR A;  4E7K A;  3QEI A;  3RTV A;  3QEW A;  3CFR A;  1S1T A;  2HB5 A;  2BDP A;  3AO4 A;  1RCH A;  2HMI A;  4CJT A;  4B9L A;  4DWI A;  1QQC A;  3OJS A;  2FBX A;  3MAQ A;  4QCL A;  3OYK A;  2HHV A;  1WSE A;  2OPR A;  4CEQ A;  2OPP A;  2FC0 A;  1KSP A;  3NCI A;  3DLH A;  3SZ2 A;  3HYF A;  3EY1 A;  3OYN A;  3SQ2 A;  2P5O A;  4FLY A;  4FJ9 A;  3RMC A;  4YNQ A;  1VSF A;  3NGY A;  2ATQ A;  2XY5 A;  1LAW A;  2P5G A;  3AA5 X;  4FM0 A;  1D9D A;  4IKF A;  4CJV A;  5KGW A;  3KLE A;  1HPZ A;  3L2Q A;  5HRO A;  1KLM A;  4FJL A;  4M3T A;  1VSK A;  3LP2 A;  2XY8 A;  4Z4F A;  3V9X A;  3QET A;  2QK9 A;  4DQQ A;  3ZSZ A;  5HRP A;  1S1V A;  1UWB A;  3V81 A;  4RW7 A;  2O4G A;  4O5B A;  3AA4 A;  4CGG A;  4NCB A;  3LAK A;  1VRU A;  2G8W A;  4FCY A;  3TAQ A;  1TGO A;  3TAG A;  1W9H A;  3I0S A;  4OKK A;  1WSG A;  1XHZ A;  1JL2 A;  4LH4 A;  4DMN A;  1R0A A;  1VK0 A;  1JXE A;  2XHB A;  3OJU A;  4I2P A;  3KLI A;  4FZY A;  4I9Q A;  4I2Q A;  4AHT A;  4CJL A;  3P5J A;  1SL1 A;  2Y1I A;  1BQM A;  3RR8 A;  4O55 A;  2PY5 A;  1WN7 A;  1BIU A;  3CM5 A;  4CJK A;  3LZI A;  2B4J A;  5K14 A;  4DSE A;  1KRP A;  1QSY A;  4KV8 A;  4OVL A;  1ZBL A;  3PO5 A;  4CJQ A;  4CHO A;  3G10 A;  4FM2 A;  4O44 A;  4OKJ A;  4CK1 A;  3HVR A;  2Z1G A;  1U49 A;  1SKW A;  1WNS A;  1CZB A;  3AO1 A;  4AHR A;  3VQ8 A;  3MXJ A;  4KKO A;  4FZX C;  4CEB A;  2LSN A;  5CYM A;  1LWE A;  3SQ4 A;  4Z4G A;  1EX4 A;  4KHY A;  1X9S A;  3LAM A;  2G8I A;  4OKE A;  4AIL C;  4KO0 A;  4HCB A;  4CFC A;  4DFM A;  3PX4 A;  1RBR A;  3NF6 A;  2YHA A;  3KLF A;  1QSL A;  1Q8I A;  4DF8 A;  1O1W A;  3QEP A;  4EZ9 A;  1VSH A;  3TAR A;  1X9W A;  4BE2 A;  1LW0 A;  1CZ9 A;  4F8R A;  1RDB A;  1TKD A;  3VQ6 A;  1L3T A;  1U4B A;  3PV8 A;  1CXQ A;  3NF7 A;  1LWC A;  3OY9 A;  3T3F A;  3DLG A;  3VQE A;  3VQB A;  4Q5V A;  1G15 A;  4O0I A;  3NH1 A;  4JS5 A;  1NK0 A;  1U47 A;  4DSJ A;  4CHY A;  1RBS A;  1RIL A;  2HNY A;  4OJR A;  1S1U A;  4DFP A;  3IAY A;  2PYL A;  3K5N A;  3TAM A;  4PWD A;  3ASM A;  2IS3 A;  3IRX A;  1Z25 A;  1C1C A;  1J54 A;  3WNG A;  4MFB A;  3L8B A;  1C1B A;  3HL8 A;  3LWL A;  2QKK A;  4FJ5 A;  4B08 A;  3O4Q A;  2X6N A;  3ZCM A;  2HVH A;  3OYM A;  3PX6 A;  3TAF A;  1S6Q A;  1WSH A;  4M3Z A;  4FXD A;  1I3A A;  3O3H A;  3HP6 A;  1EP4 A;  3PX0 A;  2AJQ A;  3V1O A;  3ZT3 A;  1B92 A;  3C95 A;  5T7B A;  2YNI A;  5KRT A;  4FLW A;  4B9V A;  5HLF A;  3JYT A;  1KVB A;  1WSF A;  3U3Y A;  2VG5 A;  3V1R A;  2RPI A;  4DU1 A;  4DQS A;  1JLQ A;  1RNH A;  3L2R A;  4FJN A;  2VWJ A;  4M41 A;  3RR7 A;  1HQE A;  4M3X A;  3SV3 A;  4KB1 A;  2P1J A;  1RTJ A;  3HO1 A;  3S9H A;  4W5R A;  2PYJ A;  1WLJ A;  2FBT A;  4ELV A;  1NJX A;  3RRH A;  2KQ2 A;  1NK6 A;  1C0T A;  3HP9 A;  4KI6 A;  1JL1 A;  4IDK A;  3DLE A;  3K5O A;  3P1G A;  4IBN A;  3ZT4 A;  3O3F A;  1ZYQ A;  2KZZ A;  1RT6 A;  4E7J A;  2ITG A;  1UOC A;  3MXM A;  2BGG A;  3NF9 A;  5FRO A;  3T1A A;  2E6L A;  1JLC A;  1NK5 A;  1S9E A;  3QNN A;  3LDS A;  4KHQ A;  5FRN A;  3DYA A;  4CFA A;  1HNI A;  1JLB A;  4UQG A;  1F21 A;  3DRR A;  4BDY A;  1N5Y A;  1N6Q A;  3K57 A;  3AVM A;  3DMJ A;  3EZ5 A;  1EKE A;  3TI0 A;  4GVM A;  1HRH A;  4NYF A;  3VQ5 A;  3HPH A;  4DTR A;  4DFK A;  3SUP A;  1B9F A;  4CJ5 A;  1X9M A;  2DY4 A;  4GW6 A;  4KI4 A;  3VQC A;  3KK3 A;  4FJG A;  4RW8 A;  3LP3 A;  3NH0 A;  3RMB A;  4F3T A;  3V1Q A;  4CHZ A;  3CQ8 A;  4FM1 A;  4W5Q A;  4BAC A;  4LSN A;  2DTU A;  4QOZ B;  1RTD A;  3V4I A;  3KKS A;  3VQQ A;  4KTW A;  1YVU A;  3E01 A;  1UAX A;  1EET A;  4B9S A;  3AVN A;  5J1E A;  3NF8 A;  1WAF A;  3CG7 A;  4J2E A;  2YV0 X;  4TSX A;  3QLH A;  2EX3 A;  1NKE A;  1RT7 A;  4N5S A;  4FZZ A;  5J2M A;  3ZT2 A;  4E3S A;  4DFJ A;  3L2U A;  1KFS A;  3DI6 A;  2JGU A;  4DTS A;  5CZ2 A;  4FK2 A;  1VSD A;  1REV A;  3CYM A;  1TKZ A;  3I0R A;  1IKV A;  4XIU A;  4OGE A;  4CEC A;  1XI1 A;  2G8K A;  1HYS A;  1QE1 A;  4Z4H A;  2YNF A;  1C0M A;  5J2N A;  2KTQ A;  3BGR A;  4I7F A;  1BL3 A;  4Z0U A;  3LWM A;  1NK9 A;  3ZSR A;  2PZS A;  3LP1 A;  4EZ6 A;  1DTQ A;  1FKP A;  5CYQ A;  2D0C A;  4CF1 A;  1VRT A;  3HJF A;  4AH9 A;  3SQ0 A;  3KLH A;  1D9F A;  4C8K A;  1DTT A;  3DRP A;  1A5V A;  2JLE A;  5KI6 A;  2GBZ A;  4PQU A;  1NJW A;  4CF0 A;  2B6A A;  1S1X A;  3ULD A;  3HVT A;  2WON A;  4CFB A;  3AVG A;  4ICL A;  1TV6 A;  2RKI A;  3QEX A;  1RTH A;  3OS1 A;  4DSK A;  2HHU A;  1TKT A;  3HXM A;  4HUG A;  4N76 A;  4KHW A;  1SL2 A;  3TAP A;  3AA3 A;  2NUB A;  1JLF A;  3ZSX A;  3QO9 A;  5HBM A;  1ZBI A;  2XY7 A;  1Z26 A;  3OVN A;  3CM6 A;  4DQI A;  3S3N A;  4AHC A;  3SJJ A;  4JRP A;  3IS9 A;  1X1P A;  2B5J A;  4K8X A;  4CJE A;  1BGX T;  1UA0 A;  4LH5 A;  3JSM A;  1VSJ A;  4CJP A;  1SV5 A;  2QKB A;  4OPK A;  4DLE A;  2DFF A;  3QEV A;  1YTA A;  4K8Z A;  1BQN A;  4Y1D A;  3AVC A;  3MEE A;  5KRS A;  2Y1J A;  4CED A;  4IG0 A;  4KRE A;  4W5T A;  4B8C A;  4CF2 A;  4FLU A;  2D0B A;  4RW4 A;  4E7H A;  1XC9 A;  3NAE A;  4M3U A;  2FBV A;  3LPT A;  5DK5 A;  3VQ4 A;  2VWK A;  4DSF A;  2Z1H A;  2A1S A;  1RBU A;  1ZBU A;  3SUN A;  1T8E A;  3HST B;  4RW6 A;  4W5O A;  1QS4 A;  3SQ1 A;  2A1R A;  4CCH A;  1RT3 A;  2HHX A;  4GMJ B;  3QIN A;  4NYN A;  1LAV A;  4Z4C A;  3H08 A;  1RDD A;  4EP5 A;  3S3O A;  4KHS A;  3DM2 A;  3NFA A;  3KJV A;  4DS5 A;  3B6P A;  2FBY A;  3ZSO A;  4CJ3 A;  4CHP A;  4CJW A;  1T05 A;  3RRG A;  3AVI A;  3NH2 A;  4Z4E A;  4H4O A;  1TAQ A;  3TAB A;  1JLA A;  1GOB A;  1TK0 A;  1BCO A;  1IH7 A;  1RDA A;  1U45 A;  4F4K A;  1FK9 A;  1TK8 A;  4ZTF A;  1S1W A;  3M8P A;  3ITH A;  3OYC A;  1ZBF A;  1HYZ A;  3ISN C;  4CES A;  1NOZ A;  4HCC A;  1C6V A;  4OGC A;  2ZD1 A;  4KRF A;  1KLN A;  3DLB A;  4DG1 A;  4ELU A;  3ALY A;  3VQD A;  2EHG A;  4B9T A;  1NK8 A;  2F8T A;  5I42 A;  4OLB A;  4CHN A;  1U48 A;  5HRS A;  3V6D A;  2OZM A;  2R7Y A;  4DSL A;  3OYG A;  4CHQ A;  4RW9 A;  2YKN A;  3AVH A;  4OPJ A;  4E19 A;  1QHT A;  4DLG A;  4B3O A;  2Z1I A;  2KW4 A;  3AVJ A;  1J53 A;  4O0J A;  3NDK A;  4DTN A;  4FK4 A;  3SPY A;  1CXU A;  1EXQ A;  4JS4 A;  2G8F A;  1LV5 A;  2E4L A;  3KK1 A;  2VG6 A;  3QNO A;  2E6M A;  4Y1C A;  3VA0 A;  3MEC A;  1NKB A;  3KTQ A;  5KGX A;  3PY8 A;  4JLH A;  3OYB A;  1HJR A;  1BI4 A;  2QXF A;  2VG7 A;  1JLG A;  1TVR A;  4DTM A;  2YKM A;  2OPS A;  4FLT A;  4C8N A;  5SZT A;  5J2Q A;  4DTJ A;  4C8M A;  2HW3 A;  4CJ4 A;  3WNE A;  4FW1 A;  1FKO A;  1U04 A;  4CJU A;  3SUO A;  2ZQB A;  2P51 A;  4CK3 A;  1B9D A;  1MU2 A;  3LPU A;  1BI4 B;  1I39 A;  1KTQ A;  1JLE A;  1GOC A;  1RBT A;  2GV9 A;  3O4N A;  1CLQ A;  3NGZ A;  4PUO A;  4FJ8 A;  4DSI A;  3QER A;  2HHQ A;  4BWJ A;  3OYE A;  1IKW A;  2D0A A;  4C8O A;  3C94 A;  1VSE A;  3P83 D;  4BE1 A;  3DLK A;  2KFN A;  4PY5 A;  2I5J A;  1DLO A;  5E41 A;  4LY7 A;  3LAL A;  1L3S A;  4KFB A;  5CZ1 A;  3DRS A;  3SPZ A;  4DTO A;  2G8H A;  3OS2 A;  4CIE A;  3F73 A;  3TAE A;  1QSS A;  5FRM A;  4AHU A;  4CEO A;  3ZSW A;  3L2W A;  4FJH A;  4CGF A;  1BCM A;  4O4G A;  3KKR A;  3OYH A;  3L3V A;  1S5J A;  4CJF A;  3M8S A;  2HVI A;  1TL1 A;  2HHS A;  4E1M A;  1J9A A;  4DTU A;  1WSI A;  3SCX A;  4DQR A;  4DTX A;  5FDL A;  4G1Q A;  5HRN A;  3VQP A;  4N41 A;  3HM9 A;  4M45 A;  5C25 A;  5D3G A;  1A5W A;  1T03 A;  1RT5 A;  3PUF A;  4FLZ A;  3ZT1 A;  3T19 A;  2F96 A;  3V9Z A;  1L3V A;  1IO2 A;  1VSI A;  4CIF A;  1BHL A;  4WE1 A;  3C6U A;  3TR8 A;  3NBP A;  3V9W A;  3BDP A;  4CER A;  5J2P A;  1SL0 A;  2IAJ A;  3SI6 A;  4J2D A;  4DS4 A;  1HMV A;  4DF4 A;  3O3G A;  4Q0B A;  2O4I A;  2IOC A;  3K5L A;  4MQ3 A;  1GOA A;  4E1N A;  1JXB A;  1SKS A;  1L5U A;  4J2B A;  3L3U A;  3OYA A;  3EYZ A;  3QIO A;  3DOK A;  1TAU A;  3B6O A;  2OYQ A;  3AVL A;  3KIO A;  3DLR A;  4C8L A;  3U6F A;  3S3M A;  2X78 A;  4KTZ A;  5CY4 A;  5C42 A;  3RWU A;  2YHB A;  4ID1 A;  4RG8 A;  2HND A;  4FLX A;  4H4M A;  2HHT A;  2Q3S A;  4IG3 A;  1YTU A;  4CJR A;  4CGI A;  4HUE A;  2X74 A;  4NCG A;  5C24 A;  3ZSQ A;  3UIQ A;  3K2P A;  1NJZ A;  3TWH A;  3THV A;  4CGD A;  1VSM A;  1LWF A;  4B8A B;  1TL3 A;  4FJX A;  3WNF A; 
#chains in the Genus database with same CATH topology
 2QWQ A;  4LF8 K;  1I94 K;  3QIP A;  3NVM A;  4KPY A;  3KVG A;  4FJ7 A;  1HYV A;  4F2R A;  1NOY A;  3SAH A;  3VOV A;  4A61 A;  1GLA G;  2XRI A;  4DU4 A;  3RMA A;  2QTD A;  4YOT A;  2YNH A;  1KVA A;  3EE9 A;  3OTO K;  3ZT0 A;  4KAZ A;  3AVA A;  3H1V X;  4M3R A;  2QWM A;  1YI2 N;  1ASW A;  2ETJ A;  4KHN A;  3BEX A;  2Q97 A;  1IBM K;  4FK0 A;  4M3W A;  4IFY A;  1C0F A;  4JKA A;  1T44 A;  3MXI A;  2IDO A;  3H3N O;  3V9U A;  4CGH A;  2YCH A;  1HQU A;  2V7Y A;  1NGI A;  1YAG A;  4OLA A;  3V9S A;  4HHT A;  1ASU A;  1DKG D;  2DFE A;  3LDN A;  3HK2 A;  2E1Y A;  3RSE A;  4B9M A;  1RBV A;  4DQP A;  3AVB A;  3AO2 A;  2CGK A;  5AQN A;  3K5M A;  3OYJ A;  4FWO A;  3VA3 A;  4IFV A;  3EO3 A;  4E7I A;  4H0P A;  4B9N A;  4CIG A;  3L2V A;  3CFP A;  4KHU A;  4FJI A;  4BR9 A;  3DLL L;  4M7Y A;  5I3U A;  3FLC O;  4AHS A;  2Z1J A;  3OYD A;  5GIO A;  1HNV A;  4A5A A;  5AQZ A;  5KQD A;  3OBW A;  3W0L A;  5BPL A;  5CR4 A;  5EY4 A;  4CF9 A;  1NJY A;  3WUH A;  2OZS A;  4FOE A;  4F2S A;  1D8Y A;  3VQ9 A;  1NJI O;  4BDZ A;  2OPQ A;  4CK2 A;  1JCF A;  4FW2 A;  1BDG A;  2BAN A;  4PA1 A;  1GLC G;  1OH5 A;  3ATU A;  3FFI A;  4H8K A;  4JI3 K;  1XNQ K;  3R3L A;  3D2E B;  4Z4I A;  5AQT A;  3WNH A;  3CF5 L;  4X65 K;  1KAZ A;  5DMR A;  4FWL A;  4M42 A;  5M1Q A;  2YNG A;  1ATR A;  1Y97 A;  2G8V A;  5AQY A;  3QEI A;  2FSK A;  3I33 A;  1S1T A;  2HB5 A;  1RCH A;  3P31 A;  4DWI A;  3QFP A;  3FZM A;  2FBX A;  3MAQ A;  4EAH D;  3OYK A;  2HHV A;  1XUP O;  4CEQ A;  1HPM A;  1KSP A;  1ILY A;  3DLH A;  2P5O A;  3SZ2 A;  3HYF A;  3OYN A;  3SQ2 A;  1VQL N;  4YNQ A;  1VSF A;  2E88 A;  3NGY A;  4C1N I;  2ATQ A;  2P5G A;  3AA5 X;  1FW6 A;  4CJV A;  3U4L A;  5IT9 O;  1QZ5 A;  5CHI A;  3WXM B;  1SAZ A;  2ZGY A;  3HSC A;  2W6K A;  3MCA B;  2ITM A;  2O4G A;  4BGA A;  4BRF A;  1C0G A;  3LAK A;  1VRU A;  4JI6 K;  1TGO A;  1MWK A;  3VPZ A;  1W9H A;  4DR4 K;  1WSG A;  1XHZ A;  4DMN A;  1VK0 A;  2XHB A;  1TUU A;  2CH6 A;  2YJF A;  3IUC A;  3KLI A;  4FZY A;  1GLD G;  4I2Q A;  4CJL A;  4BR4 A;  1YJW N;  4BGB A;  4BQL A;  4O55 A;  1WN7 A;  2NRR A;  5LJV A;  3LZI A;  1KRP A;  4KV8 A;  4RWT A;  4CHO A;  5GIN A;  3G10 A;  3TTD A;  2VGM A;  2A6A A;  3MXJ A;  4KKO A;  4CZG A;  3SQ4 A;  4Z4G A;  1QVG M;  1IJJ A;  3LAM A;  3M6G A;  2G8I A;  3H6E A;  3PX4 A;  4DF8 A;  4FWS A;  1LW0 A;  1CZ9 A;  3M1F A;  1BG3 A;  3C7N A;  1TKD A;  5MLC Q;  3VQB A;  4FO0 A;  1U47 A;  4IOA L;  1LCU A;  1QZ6 A;  3DXM A;  3THY A;  2PYL A;  2NRZ A;  1KLN A;  4FJ5 A;  3HL8 A;  3AAR A;  2X6N A;  4BRQ A;  3OYM A;  3TAF A;  1WUA A;  4ISF A;  2AJQ A;  2RHK A;  3LDP A;  3UB5 A;  5T7B A;  3WQU A;  2YNI A;  4B9V A;  3TPQ A;  4BC5 A;  4CBU A;  1QVF M;  1WSF A;  3U3Y A;  3CJ9 A;  4YDU A;  4GY2 B;  4DU1 A;  1RNH A;  3MWP A;  4W5R A;  1KD1 O;  1TYQ B;  1NJX A;  1NK6 A;  1JL1 A;  4IDK A;  3ZT4 A;  3J81 O;  1ZYQ A;  4PL7 A;  2ITG A;  3NF9 A;  5FRO A;  3SMS A;  3THX B;  4BG8 A;  2E6L A;  2VCP A;  1ZXO A;  3DXK A;  5I9E B;  4CFA A;  1HNI A;  4DV7 K;  1NGA A;  3AVM A;  3EZ5 A;  3TI0 A;  2F9T A;  1E4F T;  4LF9 K;  4DTR A;  3CIP A;  3OHR A;  1X9M A;  4LF6 K;  3SJH A;  3VQC A;  3KK3 A;  3SK3 A;  1HKC A;  4BRL A;  4BRP A;  4F3T A;  1XC3 A;  2W6L A;  4FM1 A;  3O8M A;  4X62 K;  4LSN A;  4QOZ B;  3E01 A;  3AVN A;  3WEE A;  3NF8 A;  1WAF A;  4EIA A;  2YV0 X;  2VGN A;  2EX3 A;  1RT7 A;  1XNR K;  3DI6 A;  2JGU A;  3GE1 A;  1T3V A;  3HTV A;  1VQ9 N;  4Z4H A;  1C0M A;  2V51 B;  5J2N A;  4I7F A;  1BL3 A;  3ZSR A;  3I55 N;  5CYQ A;  1VRT A;  3SQ0 A;  4C8K A;  1DTT A;  4CZH A;  2D0O A;  5KI6 A;  2GBZ A;  4PQU A;  4LFB K;  1GLB G;  2RE2 A;  4JKG B;  2B6A A;  4DHY A;  4CVN E;  4H5T A;  2HHU A;  1TKT A;  4AM7 A;  3CXC M;  3A0I X;  1SL2 A;  2GUP A;  2P9S A;  5C0Y A;  3VTH A;  3U8X A;  4AQY K;  1GLJ O;  1R59 O;  4AHC A;  3UKU A;  3IS9 A;  2VWB A;  1X1P A;  3K0S A;  4LH5 A;  4CJP A;  5KPR A;  1SV5 A;  4BVP A;  4LFA K;  2DFF A;  3O9S A;  3QEV A;  2ASM A;  1IV0 A;  3MDQ A;  2P9N A;  4DV1 K;  3PIP L;  4FLU A;  4E7H A;  1NGD A;  1H1V A;  3NAE A;  3LPT A;  3VF2 A;  4LC9 B;  3L4I A;  4W5O A;  3SQ1 A;  2A1R A;  2P9K A;  3QIN A;  5HL7 L;  3HOS A;  4Z4C A;  3H08 A;  1RDD A;  3KJV A;  5LMN K;  3H3O B;  4CJ3 A;  3CCV N;  3RRG A;  3NH2 A;  4JKC A;  1JLA A;  1GOB A;  5ADX H;  3M8P A;  4AF1 A;  4HCC A;  1LOT B;  3ISN C;  1C6V A;  2UXB K;  4DV0 K;  4DCH A;  1S72 N;  4WQ5 A;  4B1Z A;  4CHN A;  2OZM A;  4DSL A;  4CHQ A;  4RW9 A;  3AVH A;  3BF3 A;  4DLG A;  1QHT A;  2E8A A;  4O0J A;  4DTN A;  1SS6 A;  5LJW A;  4CZE A;  1LV5 A;  2JWL A;  2E4L A;  4B1X B;  2VG6 A;  3PY8 A;  4FWN A;  1HJR A;  2QXF A;  2OPS A;  4FLT A;  1VAZ A;  2HW3 A;  1FKO A;  5KPZ A;  2ZQB A;  5LY3 A;  3CI5 A;  1BI4 B;  3QER A;  2HHH K;  3C94 A;  4LFC K;  1DLO A;  5C12 A;  3SPZ A;  4DTO A;  4CIE A;  1VQP N;  4CGF A;  5AZI A;  4O4G A;  3LM2 A;  3OYH A;  4CJF A;  2HVI A;  1DEJ A;  4A2B A;  4DTU A;  1WSI A;  1W97 L;  4G1Q A;  3J7A P;  3BF1 A;  2UXD K;  3V9Z A;  2F96 A;  2IIR A;  1U6Z A;  2QA4 N;  1VSI A;  3CPW M;  3VTI A;  3TR8 A;  3BDP A;  5J2P A;  1SL0 A;  3SI6 A;  4J2D A;  2WFB A;  3HZ6 A;  3NMU A;  2IOC A;  1YIT N;  1GOA A;  1SKS A;  1L5U A;  2NZT A;  3ULE A;  1W2B M;  3U9D A;  3P4I A;  2Q3S A;  4IG3 A;  2O8E B;  4CJR A;  1Q18 A;  4NCG A;  3UIQ A;  1JCG A;  3K2P A;  4YDU C;  1LWF A;  2Q31 A;  1GLF O;  4H03 B;  1WSJ A;  2IGI A;  1W0H A;  4GKJ K;  3WXL A;  3E1Y A;  2CGJ A;  4BRE A;  2YHW A;  4AHV A;  4A2A A;  4E89 A;  2DPN A;  1UA1 A;  2HBM A;  4MDB A;  1FXX A;  1NKC A;  1NMD A;  3AGK A;  1SUQ A;  4JI2 K;  1S9G A;  3LL3 A;  4IOX A;  1WAJ A;  1IKX A;  1X3N A;  4KTQ A;  2XY6 A;  1K6Y A;  3C6T A;  4JI7 K;  1P90 A;  3AGR A;  1N8R O;  1QQN A;  4CE9 A;  3FE1 A;  2XO7 A;  2X6S A;  2OA8 A;  1YT3 A;  1T6C A;  1S6P A;  5JS1 A;  1Q9X A;  4N56 A;  1NMN A;  4AM6 A;  2FF3 B;  4F3O A;  3LAN A;  3D0P A;  2IVO A;  4FJK A;  5HRR A;  1WBB A;  1KXP A;  3RSE B;  1YJ9 N;  3OW2 M;  5HP1 A;  1RTI A;  2KFZ A;  4DTP A;  1V4T A;  3FFK B;  3PO4 A;  1L3U A;  4LD0 A;  3L6Q A;  2F8S A;  4BE0 A;  4FL9 A;  2VQF K;  1NK7 A;  3L4Q A;  3CJC A;  4YOU A;  3TTF A;  3VMF B;  2OTL N;  1ASV A;  1O13 A;  1KAX A;  4A59 A;  4KH6 A;  5KPT A;  3TSU A;  4A62 A;  1T7P A;  4CEA A;  2CGL A;  4R5P A;  4DR2 K;  3HOT A;  1OH7 A;  3QB0 A;  4HUF A;  3I8D A;  4E0D A;  4B9U A;  3AV9 A;  4BRM A;  1XHX A;  4K42 A;  3D45 A;  4ZTJ A;  3HPG A;  1SKR A;  4E7K A;  3CFR A;  5AQK A;  3VES A;  1K8A O;  2HMI A;  4CJT A;  3OJS A;  2FC0 A;  3EY1 A;  5AQQ A;  1K8K B;  3T7Z A;  2HBK A;  1LAW A;  1D9D A;  4IKF A;  1HR0 K;  5HRO A;  4IDH A;  2A5X A;  4M3T A;  4FJL A;  5JLF A;  3V9X A;  3QET A;  2QK9 A;  3VF4 A;  3ZSZ A;  3KWG A;  4WQ5 C;  1BUP A;  2ZWH A;  1BA1 A;  3ID6 A;  1JXE A;  4AHT A;  1SQK A;  1ZC6 A;  4LF5 K;  5AQW A;  1BIU A;  2GWK A;  4CJK A;  2B4J A;  5K14 A;  3CJ7 A;  4OVL A;  4CJQ A;  4CK1 A;  3HVR A;  2Z1G A;  1U49 A;  3QML A;  1WNS A;  1SKW A;  3FR0 A;  5EVZ A;  4CEB A;  4GKK K;  5CYM A;  1LWE A;  4B1Y B;  4KHY A;  4OKE A;  2A41 A;  4HCB A;  5H1S Q;  1N34 K;  1RBR A;  2YHA A;  1QSL A;  5AQG A;  3D6R A;  3BUZ B;  4F8R A;  1RDB A;  1K73 O;  2D4W A;  3VQ6 A;  1L3T A;  1U4B A;  4JKF A;  3NF7 A;  1LWC A;  4DB3 A;  2D0P A;  3DLG A;  3NH1 A;  4JS5 A;  4MDA A;  4CHY A;  4OJR A;  4Y0W A;  4DFP A;  1NGG A;  3TAM A;  3ASM A;  4NLC A;  3C7N B;  1C1C A;  3L8B A;  2E2P A;  3ZCM A;  3PX6 A;  1S6Q A;  1WSH A;  3J7Z O;  3F5T A;  3HP6 A;  1EP4 A;  2QXL A;  3V1O A;  3DXM B;  3THY B;  4FLW A;  5KRT A;  3MCP A;  3GDQ A;  4FWK A;  3Q7C A;  4JHD A;  2RPI A;  4DQS A;  3CC7 N;  2AP1 A;  3GG4 A;  4M3X A;  1RTJ A;  3GBT A;  4KHP K;  2FBT A;  4ELV A;  3EN9 A;  2J4R A;  4KI6 A;  5EX5 A;  3DLE A;  1BU6 O;  3O3F A;  4IJA A;  2BGG A;  5M1N A;  3T1A A;  1JLC A;  3QNN A;  4KHQ A;  4EHT A;  4XH5 A;  1N6Q A;  3B8A X;  3DMJ A;  1IBK K;  4NYF A;  4BG9 A;  4GV9 A;  4XH1 A;  2A40 A;  3DXK B;  4B1V A;  4FJG A;  1CZA N;  5F1X A;  3CQ8 A;  3ATV A;  3R6M A;  1K8K A;  4GVE A;  3V4I A;  3KKS A;  4IEI A;  3CC2 N;  3HRG A;  5C10 A;  1HLU A;  5HOO A;  2QWP A;  4N5S A;  3CET A;  3VEV A;  3ZX2 A;  1HNZ K;  5J2M A;  4E3S A;  3L2U A;  1KFS A;  2QM1 A;  4JK8 A;  5CZ2 A;  5FPN A;  4FK2 A;  1TKZ A;  3I0R A;  1IKV A;  4XIU A;  1Q7Y O;  2I7P A;  3C6A A;  3WEE B;  4EHU A;  2YNF A;  1NK9 A;  2P9L A;  4I6M A;  2UUA K;  4U67 L;  2PZS A;  3IDH A;  1DTQ A;  1NWK A;  2FXU A;  4BR2 A;  3KLH A;  2YX6 A;  1A5V A;  4C1N K;  4CF0 A;  1S1X A;  3ULD A;  2WON A;  4ICL A;  4ILH A;  3OS1 A;  1HKG A;  1Q86 O;  3TAP A;  2ZJR L;  3AA3 A;  1BO5 O;  1JLF A;  1P8Z A;  3OVN A;  3CM6 A;  2GEM A;  2YHX A;  3DAW A;  1EWQ A;  4RTF D;  4U7B A;  4CJE A;  1UA0 A;  1HUX A;  3DWL A;  2QKB A;  2P9S B;  1NGE A;  1YTA A;  4K8Z A;  4Y1D A;  3AVC A;  5KRS A;  2Y1J A;  5GAH P;  3UKU B;  1M90 O;  4FSV A;  3VGL A;  4CF2 A;  3BZK A;  1XC9 A;  4LF7 K;  4JK9 A;  4M3U A;  2GEL A;  3M3Z A;  2Z1H A;  2A1S A;  1RBU A;  5JMV A;  3SUN A;  3HST B;  4M7X A;  3QBX A;  3CJA A;  1YIJ N;  2P9N B;  2UYT A;  2HHX A;  5CE3 A;  3NFA A;  1T05 A;  3AVI A;  4Z4E A;  3MWT A;  4H4O A;  3TAB A;  1RDA A;  2P9K B;  1U45 A;  5AZJ B;  3O9T A;  5F0X A;  4ZTF A;  1S1W A;  3M5R A;  4OGC A;  2E2O A;  2V52 B;  2ZD1 A;  5ELZ A;  5ADX A;  4B9T A;  1NK8 A;  4PL8 A;  4MLE A;  2F8T A;  2IVN A;  4CD3 A;  2R7Y A;  4E19 A;  2Q0R A;  4CZI A;  3VEZ A;  2KW4 A;  1J53 A;  3NDK A;  4FK4 A;  4JS4 A;  2WC9 A;  2HST A;  2HF4 A;  3R8E A;  4JV5 K;  4DV2 K;  3FZL A;  3KTQ A;  3VEX A;  5AFU H;  1TVR A;  4WFA L;  4C8M A;  3WNE A;  3SUO A;  4QS7 A;  2P51 A;  5AQS A;  3I8B A;  1MWM A;  2FSJ A;  2GV9 A;  1RBT A;  2FLO A;  4FJ8 A;  3OYE A;  1IKW A;  2D0A A;  3P39 A;  4C8O A;  1VSE A;  3P83 D;  4BE1 A;  3DLK A;  2Q0U A;  4YOY A;  4PY5 A;  2I5J A;  4LY7 A;  2G8H A;  4KFB A;  5FPE A;  4H5W A;  3F73 A;  4A5B A;  3TAE A;  5FRM A;  3L2W A;  1Q82 O;  1BCM A;  1NGJ A;  4YOV A;  4H5R A;  5HRN A;  4N41 A;  3HM9 A;  4M45 A;  2QEX N;  5D3G A;  2P9I A;  1A5W A;  5AZI B;  4H0T B;  3T19 A;  2O8F A;  4C23 A;  5BN8 A;  3V9W A;  4H0V B;  4CER A;  1X3M A;  1Y64 A;  4BR7 A;  4DS4 A;  1HMV A;  2O4I A;  2FSN A;  1JXB A;  3ENH A;  5M1F A;  3B6O A;  4ISG A;  4BRN A;  2OYQ A;  3VEN A;  2X78 A;  4KTZ A;  5CY4 A;  5C42 A;  2Q1N A;  2YHB A;  3SAF A;  2HND A;  4FLX A;  4IFE A;  1E4G T;  2IVP A;  3EKU A;  3ULE B;  2X74 A;  5AJ3 K;  3A8Y A;  3VEY A;  2ZF5 O;  4JD2 A;  3TWH A;  4YOX A;  4B8A B;  4FJX A;  2YI1 A;  2WOM A;  3TTC A;  3VN5 A;  3SUQ A;  2AA4 A;  2JWK A;  3M8Q A;  1BIZ A;  4DUY K;  4FWQ A;  1D5A A;  3CCQ N;  2GX9 A;  4B1W B;  4BRC A;  4CFD A;  3A5M C;  4DR7 K;  1A5X A;  1IG9 A;  5AZJ A;  2VYP A;  4XH4 A;  1HNX K;  1NGC A;  3OYF A;  3VQ7 A;  3NE6 A;  4E7L A;  3CCR N;  3LZJ A;  3HBT A;  3OS0 A;  1BOT O;  1N33 K;  4JKE A;  3ZX0 A;  1VSL A;  4CF8 A;  3KLG A;  3T1Y K;  4B3M K;  3DOL A;  1ZBH A;  3OBY A;  4JN4 A;  4PHT X;  4W5N A;  3AO3 A;  2HBL A;  1KFD A;  2GUI A;  3QES A;  4EP4 A;  3K58 A;  3G4S N;  3PLA A;  2W41 A;  1NU0 A;  4ID5 A;  1QTM A;  4DR6 K;  1MDU B;  5KTQ A;  4FLV A;  2ZM6 K;  1RT2 A;  3M8R A;  3ZLJ A;  1IKY A;  1QHA A;  1BIS A;  2HHW A;  3WQT A;  3SV4 A;  4NCA A;  4HTL A;  4KB0 A;  3SNN A;  3TSP A;  4FZZ A;  4B1U B;  1ZBS A;  4N47 A;  3TAN A;  4J2A A;  3IFR A;  3U3G A;  4I9L A;  1RT1 A;  3LDL A;  2DFH A;  2HMP A;  2HNZ A;  5EU7 A;  4KH4 A;  3HPO A;  4M3Y A;  3RMD A;  5JS2 A;  3CJ1 A;  1RT4 A;  3QIC A;  3G0Z A;  4JAX A;  3G25 A;  5LL6 Z;  4CEZ A;  1M1K O;  3ZET A;  1RGI A;  3K59 A;  1TKX A;  3ZEU A;  4H0O A;  2OCE A;  2F4V K;  3J8A A;  3ZSY A;  4ZHR A;  2BTF A;  4FYD A;  5BPM A;  2D5R A;  3N4Q A;  3QBW A;  5AQV A;  2NNW A;  2E1Z A;  4IWV A;  3F9K A;  3LDQ A;  4HTU A;  1VQ4 N;  4CJS A;  2BE2 A;  3OYL A;  5IWA K;  3H46 O;  2W42 A;  1KCF A;  2P9P B;  2QWL A;  3KK2 A;  4UY8 O;  5AQF A;  2O8D A;  3P38 A;  5BR8 K;  2NLX A;  2ZJP L;  4DR3 K;  5M1O A;  4ELT A;  3AO4 A;  4B9L A;  4QCL A;  2OPR A;  1JJ2 M;  3CCS N;  2NRW A;  4FLY A;  1YUW A;  3RMC A;  4IO8 A;  4L3Q A;  4CJ7 A;  1GLE G;  4JI5 K;  3CHW A;  5KGW A;  3KLE A;  3L2Q A;  1VSK A;  4Z4F A;  2XY8 A;  4HWI A;  5GAE P;  3V81 A;  1S1V A;  1NM1 A;  4RW7 A;  3BZC A;  3AA4 A;  3O9R A;  2G8W A;  4FCY A;  3TAQ A;  3I0S A;  3QFU A;  4FPB A;  4OKK A;  4DV3 K;  1JL2 A;  4LH4 A;  5C2F A;  4I9Q A;  2Q2R A;  5GAG P;  1BQM A;  3RR8 A;  4FOI A;  3CM5 A;  1BA0 A;  1ZBL A;  2ASO A;  3PO5 A;  4O8U A;  4FM2 A;  4BY9 C;  4O44 A;  1CZB A;  3AO1 A;  3O9U A;  3PSF A;  4FZX C;  2LSN A;  1EX4 A;  1RDU A;  4AIL C;  4KO0 A;  3CJB A;  3NF6 A;  1WBD A;  1Q8I A;  1U2V A;  4BE2 A;  3J7Y P;  3SMP A;  2BUP A;  1J6Z A;  3D2F A;  4YOR A;  4ILG B;  2E20 A;  3T3F A;  3VQE A;  3G6E N;  1G15 A;  1Z6R A;  4O0I A;  1W7A A;  4B3S K;  4DSJ A;  1RBS A;  4NXN K;  4PWD A;  2IS3 A;  3IRX A;  3K9J A;  4MFB A;  1C1B A;  4B08 A;  3O4Q A;  2FF6 A;  1I3A A;  3O3H A;  3PX0 A;  3ZT3 A;  4PKG A;  2W40 A;  5HLF A;  3JYT A;  1KVB A;  2ZJQ L;  2VG5 A;  4WF9 L;  1YVN A;  2UUB K;  3L2R A;  3CC4 N;  4M41 A;  3RR7 A;  3SV3 A;  4KB1 A;  3HO1 A;  3MN5 A;  1FJG K;  4NLB A;  2PYJ A;  4NXM K;  4JHD B;  1C0T A;  3HP9 A;  3K5O A;  4IBN A;  4FPA A;  2KZZ A;  1RT6 A;  3AAQ A;  3MXM A;  1TUY A;  4FWM A;  1S9E A;  5FRN A;  2PAV A;  4O8K A;  2V7Z A;  2P9P A;  3DYA A;  3MN9 A;  1N5Y A;  3DRR A;  1EKE A;  4GVM A;  3VQ5 A;  5AR0 A;  3HPH A;  4DFK A;  3SUP A;  4KI4 A;  2GTD A;  5AQM A;  5AQL A;  3LP3 A;  3NH0 A;  3RMB A;  3V1Q A;  4CHZ A;  2P9U A;  4W5Q A;  3J80 O;  3GL1 A;  1RTD A;  3ENO A;  3VQQ A;  4KTW A;  1UAX A;  4MO5 A;  3MN7 A;  4J2E A;  4TSX A;  1XMQ K;  1EWR A;  3K9K A;  4BVO A;  4DFJ A;  1ATS A;  1VSD A;  5C2D A;  4MLH A;  4CEC A;  1XI1 A;  5FLX O;  4JKD A;  1QE1 A;  5AQU A;  3BGR A;  3C65 A;  3F9M A;  3CPE A;  4Z0U A;  4EZ6 A;  3LP1 A;  1FKP A;  4CF1 A;  3UKR A;  1D9F A;  4RCH A;  1NGF A;  4IEE A;  4H0Y B;  3U9Z A;  1NJW A;  3HVT A;  4CFB A;  1JCE A;  2P9L B;  4I6M B;  2RKI A;  1RTH A;  4DSK A;  4N76 A;  4KHW A;  3FZF A;  3QO9 A;  5HBM A;  2XY7 A;  5GAD P;  3S3N A;  3SBT A;  3SJJ A;  4JRP A;  5BRF A;  1BGX T;  5M1P A;  3VER A;  1VSJ A;  3JXU A;  4OPK A;  4DLE A;  3KZB A;  3PSI A;  4FWP A;  1BQN A;  3WT0 A;  3MEE A;  3WXI A;  5AQJ A;  2O8B A;  4B8C A;  2D0B A;  1YF5 L;  4H5N A;  4M63 C;  3FZH A;  2FBV A;  3VQ4 A;  4DSF A;  2VWK A;  1T8E A;  4BRH A;  4WCE L;  1QS4 A;  4GMJ B;  4A57 A;  1LAV A;  4KHS A;  4EP5 A;  3DM2 A;  4DS5 A;  4G9Z A;  2FBY A;  3ZSO A;  3NVK A;  4CHP A;  1X9J A;  4CJW A;  5BR9 A;  4DV6 K;  1TK0 A;  1BCO A;  2QWR A;  1FK9 A;  1TK8 A;  3ITH A;  3OYC A;  1HYZ A;  3VGK A;  4CES A;  1N32 K;  4PKI A;  2A3Z A;  3DLB A;  3VQD A;  2EHG A;  5I42 A;  1K9M O;  2YJE A;  1VQ8 N;  1U48 A;  5HRS A;  3V6D A;  1OH6 A;  2WBN A;  2PBD A;  3OYG A;  4OPJ A;  3FGU A;  2WTU A;  1YXQ A;  2Z1I A;  3AVJ A;  1EXQ A;  2E2Q A;  3L0Q A;  2G8F A;  4X66 K;  1KC8 O;  2ASP A;  3THW A;  2E6M A;  3E9O A;  3VA0 A;  3MEC A;  5KGX A;  4JLH A;  3SLC A;  1JLG A;  1OVY A;  2YKM A;  3CME N;  4YOW A;  4DTJ A;  2D1K A;  4FW1 A;  2A42 A;  1S22 A;  1KQS M;  3LPU A;  5AFU A;  3CCM N;  3O5B A;  1I39 A;  1GOC A;  3O4N A;  1VQN N;  1CLQ A;  4PUO A;  3MK6 A;  5BRH A;  4BWJ A;  1Z05 A;  3CCL N;  5E41 A;  2NRT A;  5CZ1 A;  3DRS A;  3OS2 A;  4AHU A;  4CEO A;  3KK7 A;  3ZSW A;  5AQI A;  3E66 A;  2VQE K;  4JNE A;  3KKR A;  3L3V A;  1S5J A;  4WFN L;  3ENB A;  2HHS A;  3O08 A;  4E1M A;  1J9A A;  3IKM A;  4DQR A;  4DTX A;  3VQP A;  1HKB A;  3PUF A;  3VET A;  4FLZ A;  1IO2 A;  2OTJ N;  4CIF A;  1BHL A;  3C6U A;  3NBP A;  2GWJ A;  4DF4 A;  3O3G A;  4BR5 A;  3K5L A;  2P9I B;  3CCE N;  4J2B A;  3L3U A;  2KHO A;  4ISE A;  2O8F B;  1TAU A;  3S41 A;  3AVL A;  3DLR A;  3U6F A;  3RWU A;  4ID1 A;  4H4M A;  3BP8 A;  1YTU A;  5E26 A;  4HUE A;  5C24 A;  3ZSQ A;  4PKH A;  4JI1 K;  4YY3 K;  1NJZ A;  1ESV A;  3THV A;  1VSM A;  2NRH A;  1JKH A;  1J5O A;  2NRV A;  2RN2 A;  4NO7 A;  4CI6 A;  3A2F A;  4JD2 B;  2ZE2 A;  4O5F A;  3VEW A;  4IJN A;  1TK5 A;  1KVC A;  1XWL A;  4H5V A;  4WQ4 A;  4LF4 K;  3MED A;  3AVK A;  5A2Q O;  1LW2 A;  4BC4 A;  3LP0 A;  4DV5 K;  3IMX A;  4CEE A;  1VQO N;  1T6D A;  3OYI A;  3CFO A;  4FVM A;  4L8R B;  4CGJ A;  4DU3 A;  3AO5 A;  3BY5 A;  1ITG A;  2G8U A;  3LDO A;  1NLV A;  2BH1 A;  3AVF A;  2IC3 A;  3WXK A;  5E84 A;  1SZ2 A;  3HT3 A;  3W3D A;  4OPA A;  5SWM A;  4FWR A;  1WB9 A;  1MA9 B;  1RDC A;  4BC3 A;  1NK4 A;  4DQ8 A;  3NHG A;  3ZX3 A;  5FPM A;  5TKY A;  1E3M A;  4BDP A;  5M1K A;  4CEF A;  2O8C B;  3AA2 A;  4GV6 A;  4QAG A;  1Q9Y A;  1HJO A;  3NGI A;  4OO1 J;  2KZM A;  4BR0 A;  4JKH A;  5BRD A;  3H1Q A;  4B9Q A;  5B8H A;  1C0U A;  4BWM A;  5JVG L;  3KD5 E;  3C0B A;  3D2E A;  4IO9 L;  4OPH A;  3ZSV A;  3QDK A;  3UE5 A;  4JRQ A;  4FJM A;  2E5L K;  4GV3 A;  3CMA N;  4YFU A;  2RF2 A;  4F9O A;  3IG1 A;  1DGK N;  3ZET B;  1V4S A;  3VEO A;  3ZEU B;  4LSL A;  3VQA A;  3SYZ A;  1D4X A;  3KD1 E;  4K0K K;  3MEG A;  5FPD A;  1C1A A;  4HVJ A;  3MX5 A;  3LM9 A;  3T1H K;  3CER A;  3A5L C;  3OA9 A;  3QEW A;  5BRE A;  3RTV A;  2E2N A;  2BDP A;  3O6W A;  4B3T K;  5AQR A;  2O8D B;  1QQC A;  1WSE A;  3DJC A;  2OPP A;  3HM8 A;  3NCI A;  1VQM N;  3TSQ A;  4FJ9 A;  2XY5 A;  5TKW A;  4FM0 A;  2F7T A;  4IOC L;  1HPZ A;  1KLM A;  3LP2 A;  2Q36 A;  4DQQ A;  5HRP A;  1UWB A;  2KLA A;  1GLL O;  4O5B A;  3MN6 A;  4CGG A;  4NCB A;  3RVC A;  3TAG A;  5LMU K;  4CW7 B;  1J5E K;  1R0A A;  3OJU A;  4I2P A;  3O4W A;  3P5J A;  1SL1 A;  2Y1I A;  1IBL K;  2PY5 A;  4CZL A;  1G99 A;  4DSE A;  1YJN N;  1QSY A;  4JKB A;  1WOQ A;  4OKJ A;  4K25 A;  3CCJ N;  4BC2 A;  4AHR A;  3VQ8 A;  4OX9 K;  5BPN A;  1X9S A;  4CFC A;  4DFM A;  1S3X A;  3KLF A;  4EZ9 A;  3MX2 A;  1O1W A;  3QEP A;  2I7N A;  2UU9 K;  1VSH A;  3TAR A;  2UUC K;  4KBO A;  3JS6 A;  5JVH L;  4J8F A;  3PV8 A;  1CXQ A;  3OY9 A;  1OVQ A;  1OKJ A;  4Q5V A;  1NK0 A;  1U2V B;  2NRX A;  2HBJ A;  1RIL A;  2HNY A;  3AAP A;  2O8C A;  1S1U A;  3IAY A;  3K5N A;  3D2F B;  1OH8 A;  4BRD A;  1VQ5 N;  1Z25 A;  1J54 A;  4FJJ A;  3WNG A;  3N4P A;  2QKK A;  4B3R K;  3Q7B A;  3LWL A;  5EXW A;  2HVH A;  4Z94 A;  4M3Z A;  4FXD A;  1XQS C;  4KH5 A;  1NGH A;  1B92 A;  3A5O C;  3C95 A;  1TYQ A;  3V1R A;  1N36 K;  2YHY A;  1NNE A;  1JLQ A;  3THX A;  4FJN A;  2VWJ A;  1QQM A;  1HQE A;  2P1J A;  3S9H A;  1IG8 A;  3O80 A;  1WLJ A;  3RRH A;  2KQ2 A;  2ZGZ A;  4CZJ A;  1KAY A;  3P1G A;  2WUS A;  4ILJ A;  4E7J A;  1UOC A;  2QWN A;  3EL2 A;  1NK5 A;  3LDS A;  2QI2 A;  5AQH A;  4UQG A;  1JLB A;  4H0X B;  1F21 A;  4BDY A;  5JIC A;  4BRA A;  3K57 A;  4K43 A;  1HRH A;  4BRI A;  1RFQ A;  3TU5 A;  5AQX A;  4CD1 A;  3E9L A;  4R79 A;  4JI8 K;  1B9F A;  4CJ5 A;  5F2R A;  4GW6 A;  2DY4 A;  2HF3 A;  4RW8 A;  3PIO L;  4BQZ A;  1VHX A;  4BRG A;  4E1J A;  3T69 A;  2F9W A;  4BAC A;  2DTU A;  5C15 A;  1YVU A;  1EET A;  4B9S A;  4NB4 A;  5J1E A;  2OAN A;  3CG7 A;  1DT9 A;  3QLH A;  1NKE A;  1RDW X;  3EZW A;  4WQ4 C;  2P9U B;  3ZT2 A;  3H45 C;  4DTS A;  1REV A;  3CYM A;  1BWF O;  3O1B A;  4OGE A;  5DM7 L;  2G8K A;  1HYS A;  4JKG A;  2KTQ A;  3LWM A;  2D0C A;  3HJF A;  4AH9 A;  3MMV A;  3EEQ A;  3DRP A;  3KWI A;  2JLE A;  4CZF A;  1NG9 A;  1YHQ N;  3AVG A;  1TV6 A;  3QEX A;  3UKR B;  3HXM A;  4HUG A;  4JK7 A;  2NUB A;  3CQY A;  4QS9 A;  3ZSX A;  1ZBI A;  1Z26 A;  4DQI A;  3C6H A;  4JYA K;  2B5J A;  4K8X A;  3JSM A;  4BRO A;  3EKS A;  4DR5 K;  5DM6 L;  1NGB A;  4IG0 A;  4CED A;  4KRE A;  4CZK A;  5GIP A;  4W5T A;  4RW4 A;  1VQ7 N;  5DK5 A;  4GNI A;  1X9W A;  3GOI A;  1ZBU A;  4RW6 A;  4CCH A;  1RT3 A;  2PFU A;  4NYN A;  3S3O A;  2EWS A;  2O8B B;  2CH5 A;  3B6P A;  4QS8 A;  3SAG A;  1TAQ A;  1IH7 A;  4F4K A;  3KHY A;  4EFH A;  1ZBF A;  1NOZ A;  4JEP A;  3CD6 N;  4XEI A;  4KRF A;  2H3G X;  4DG1 A;  4ELU A;  3E9P A;  3ALY A;  4OLB A;  4DR1 K;  4WFB L;  1HX1 A;  4WYB A;  2YKN A;  3CQX A;  4DKW A;  4B3O A;  3SPY A;  3WXJ A;  1CXU A;  4FVU A;  1VQ6 N;  3KK1 A;  3QNO A;  4Y1C A;  1NKB A;  3HI0 A;  3OYB A;  1BI4 A;  2VG7 A;  5JLH A;  4DTM A;  4C8N A;  5SZT A;  4YHH K;  5J2Q A;  1Q81 O;  4X64 K;  4JI4 K;  4CJ4 A;  3A5N C;  4CJU A;  1U04 A;  5KQ8 A;  3THW B;  2QWO A;  4CK3 A;  1B9D A;  1MU2 A;  1HNW K;  4IZ9 A;  2QW9 A;  1KTQ A;  1JLE A;  4CBX A;  3NGZ A;  4DSI A;  3I56 N;  2HHQ A;  1VQK N;  1EQY A;  4V19 S;  3ID8 A;  4JI0 K;  4CBW A;  2KFN A;  3CCU N;  3FZK A;  2KKZ A;  3LAL A;  1L3S A;  3JAM O;  3ZYY X;  1QSS A;  4BRK A;  4FJH A;  3VGM A;  2UXC K;  3F2K A;  4CZM A;  3M8S A;  4DV4 K;  1TL1 A;  1QQO A;  3EE8 A;  5BN9 A;  5AQP A;  1XMO K;  3SCX A;  5FDL A;  5C25 A;  1NBW A;  4DUZ K;  1T03 A;  1RT5 A;  1ATN A;  3ZT1 A;  1L3V A;  3O9Q A;  4WE1 A;  2HOE A;  4IXC A;  3R1X A;  3O1W A;  2IAJ A;  4Q0B A;  4K41 A;  3G71 N;  4MQ3 A;  4E1N A;  2O8E A;  3OYA A;  3EYZ A;  3QIO A;  3DOK A;  3KIO A;  4C8L A;  3S3M A;  4RG8 A;  3AY9 A;  2HHT A;  3R9P A;  4CGI A;  3SBG A;  5EOY A;  4MO4 A;  3D7E O;  3VF6 A;  1EO1 A;  4CGD A;  1TL3 A;  3WNF A;  5AQO A; 
#chains in the Genus database with same CATH homology
 1JKH A;  2WOM A;  1WSJ A;  2IGI A;  1J5O A;  3VN5 A;  2RN2 A;  3SUQ A;  3QIP A;  1W0H A;  4KPY A;  3A2F A;  3M8Q A;  4FJ7 A;  1BIZ A;  1HYV A;  2ZE2 A;  4F2R A;  1NOY A;  1D5A A;  2XRI A;  4CFD A;  4DU4 A;  3RMA A;  1TK5 A;  1A5X A;  1IG9 A;  2YNH A;  1KVA A;  4AHV A;  1KVC A;  4E89 A;  1XWL A;  3ZT0 A;  3OYF A;  3VQ7 A;  3AVA A;  4M3R A;  1UA1 A;  4KAZ A;  1FXX A;  1NKC A;  1ASW A;  2ETJ A;  3NE6 A;  1SUQ A;  4E7L A;  1S9G A;  3MED A;  3AVK A;  3OS0 A;  1WAJ A;  1LW2 A;  3LZJ A;  4FK0 A;  3LP0 A;  4KHN A;  1IKX A;  4M3W A;  4KTQ A;  4CEE A;  2XY6 A;  4IFY A;  3OYI A;  1K6Y A;  1VSL A;  3C6T A;  3CFO A;  4FVM A;  4CF8 A;  3KLG A;  4L8R B;  3MXI A;  2IDO A;  3DOL A;  4CGJ A;  3V9U A;  1ZBH A;  4CGH A;  1HQU A;  4DU3 A;  4CE9 A;  3AO3 A;  4W5N A;  4OLA A;  3V9S A;  2XO7 A;  1KFD A;  2X6S A;  3AO5 A;  2OA8 A;  4HHT A;  1YT3 A;  1ASU A;  2DFE A;  2GUI A;  1S6P A;  5JS1 A;  3QES A;  1ITG A;  1Q9X A;  2G8U A;  3AVF A;  4EP4 A;  4N56 A;  2IC3 A;  3K58 A;  3HK2 A;  4B9M A;  1RBV A;  4DQP A;  3AVB A;  3AO2 A;  3K5M A;  3HT3 A;  4F3O A;  4ID5 A;  1QTM A;  4FJJ A;  5KTQ A;  4FLV A;  1RT2 A;  5SWM A;  3M8R A;  3LAN A;  3D0P A;  3OYJ A;  1RDC A;  1IKY A;  1NK4 A;  3VA3 A;  1BIS A;  4IFV A;  4FJK A;  5HRR A;  2HHW A;  4E7I A;  3NHG A;  3SV4 A;  4NCA A;  4B9N A;  4CIG A;  3L2V A;  3CFP A;  5HP1 A;  3SNN A;  4BDP A;  4KB0 A;  4FJI A;  4KHU A;  1RTI A;  4CEF A;  4N47 A;  3TAN A;  2KFZ A;  4DTP A;  4J2A A;  5I3U A;  3PO4 A;  1L3U A;  4LD0 A;  3AA2 A;  4AHS A;  3U3G A;  2Z1J A;  4I9L A;  1RT1 A;  3OYD A;  4QAG A;  1Q9Y A;  2F8S A;  2DFH A;  1HNV A;  2HNZ A;  4BE0 A;  3NGI A;  1NK7 A;  5EU7 A;  2KZM A;  3HPO A;  4M3Y A;  4CF9 A;  3RMD A;  1ASV A;  1NJY A;  1C0U A;  4BWM A;  5JS2 A;  2OZS A;  1RT4 A;  3KD5 E;  3G0Z A;  4CEZ A;  4F2S A;  1D8Y A;  3VQ9 A;  4BDZ A;  3ZSV A;  3K59 A;  4JRQ A;  2OPQ A;  1TKX A;  4FJM A;  4CK2 A;  4FW2 A;  3ZSY A;  2BAN A;  4PA1 A;  4ZHR A;  4FYD A;  4YFU A;  2D5R A;  2RF2 A;  3FFI A;  4H8K A;  1T7P A;  4CEA A;  3IG1 A;  3F9K A;  4HTU A;  4R5P A;  4CJS A;  4Z4I A;  2BE2 A;  3OYL A;  3WNH A;  4LSL A;  4E0D A;  4HUF A;  3VQA A;  3I8D A;  2W42 A;  1KCF A;  3SYZ A;  3KD1 E;  3KK2 A;  5DMR A;  4B9U A;  3AV9 A;  1XHX A;  3MEG A;  4M42 A;  2YNG A;  3D45 A;  1C1A A;  4HVJ A;  4ZTJ A;  1Y97 A;  3HPG A;  2G8V A;  4ELT A;  1SKR A;  4E7K A;  3QEI A;  3RTV A;  3QEW A;  3CFR A;  1S1T A;  2HB5 A;  2BDP A;  3AO4 A;  1RCH A;  2HMI A;  4CJT A;  4B9L A;  4DWI A;  1QQC A;  3OJS A;  2FBX A;  3MAQ A;  4QCL A;  3OYK A;  2HHV A;  1WSE A;  2OPR A;  4CEQ A;  2OPP A;  2FC0 A;  1KSP A;  3NCI A;  3DLH A;  3SZ2 A;  3HYF A;  3EY1 A;  3OYN A;  3SQ2 A;  2P5O A;  4FLY A;  4FJ9 A;  3RMC A;  4YNQ A;  1VSF A;  3NGY A;  2ATQ A;  2XY5 A;  1LAW A;  2P5G A;  3AA5 X;  4FM0 A;  1D9D A;  4IKF A;  4CJV A;  5KGW A;  3KLE A;  1HPZ A;  3L2Q A;  5HRO A;  1KLM A;  4FJL A;  4M3T A;  1VSK A;  3LP2 A;  2XY8 A;  4Z4F A;  3V9X A;  3QET A;  2QK9 A;  4DQQ A;  3ZSZ A;  5HRP A;  1S1V A;  1UWB A;  3V81 A;  4RW7 A;  2O4G A;  4O5B A;  3AA4 A;  4CGG A;  4NCB A;  3LAK A;  1VRU A;  2G8W A;  4FCY A;  3TAQ A;  1TGO A;  3TAG A;  1W9H A;  3I0S A;  4OKK A;  1WSG A;  1XHZ A;  1JL2 A;  4LH4 A;  4DMN A;  1R0A A;  1VK0 A;  1JXE A;  2XHB A;  3OJU A;  4I2P A;  3KLI A;  4FZY A;  4I9Q A;  4I2Q A;  4AHT A;  4CJL A;  3P5J A;  1SL1 A;  2Y1I A;  1BQM A;  3RR8 A;  4O55 A;  2PY5 A;  1WN7 A;  1BIU A;  3CM5 A;  4CJK A;  3LZI A;  2B4J A;  5K14 A;  4DSE A;  1KRP A;  1QSY A;  4KV8 A;  4OVL A;  1ZBL A;  3PO5 A;  4CJQ A;  4CHO A;  3G10 A;  4FM2 A;  4O44 A;  4OKJ A;  4CK1 A;  3HVR A;  2Z1G A;  1U49 A;  1SKW A;  1WNS A;  1CZB A;  3AO1 A;  4AHR A;  3VQ8 A;  3MXJ A;  4KKO A;  4FZX C;  4CEB A;  2LSN A;  5CYM A;  1LWE A;  3SQ4 A;  4Z4G A;  1EX4 A;  4KHY A;  1X9S A;  3LAM A;  2G8I A;  4OKE A;  4AIL C;  4KO0 A;  4HCB A;  4CFC A;  4DFM A;  3PX4 A;  1RBR A;  3NF6 A;  2YHA A;  3KLF A;  1QSL A;  1Q8I A;  4DF8 A;  1O1W A;  3QEP A;  4EZ9 A;  1VSH A;  3TAR A;  1X9W A;  4BE2 A;  1LW0 A;  1CZ9 A;  4F8R A;  1RDB A;  1TKD A;  3VQ6 A;  1L3T A;  1U4B A;  3PV8 A;  1CXQ A;  3NF7 A;  1LWC A;  3OY9 A;  3T3F A;  3DLG A;  3VQE A;  3VQB A;  4Q5V A;  1G15 A;  4O0I A;  3NH1 A;  4JS5 A;  1NK0 A;  1U47 A;  4DSJ A;  4CHY A;  1RBS A;  1RIL A;  2HNY A;  4OJR A;  1S1U A;  4DFP A;  3IAY A;  2PYL A;  3K5N A;  3TAM A;  4PWD A;  3ASM A;  2IS3 A;  3IRX A;  1Z25 A;  1C1C A;  1J54 A;  3WNG A;  4MFB A;  3L8B A;  1C1B A;  3HL8 A;  3LWL A;  2QKK A;  4FJ5 A;  4B08 A;  3O4Q A;  2X6N A;  3ZCM A;  2HVH A;  3OYM A;  3PX6 A;  3TAF A;  1S6Q A;  1WSH A;  4M3Z A;  4FXD A;  1I3A A;  3O3H A;  3HP6 A;  1EP4 A;  3PX0 A;  2AJQ A;  3V1O A;  3ZT3 A;  1B92 A;  3C95 A;  5T7B A;  2YNI A;  5KRT A;  4FLW A;  4B9V A;  5HLF A;  3JYT A;  1KVB A;  1WSF A;  3U3Y A;  2VG5 A;  3V1R A;  2RPI A;  4DU1 A;  4DQS A;  1JLQ A;  1RNH A;  3L2R A;  4FJN A;  2VWJ A;  4M41 A;  3RR7 A;  1HQE A;  4M3X A;  3SV3 A;  4KB1 A;  2P1J A;  1RTJ A;  3HO1 A;  3S9H A;  4W5R A;  2PYJ A;  1WLJ A;  2FBT A;  4ELV A;  1NJX A;  3RRH A;  2KQ2 A;  1NK6 A;  1C0T A;  3HP9 A;  4KI6 A;  1JL1 A;  4IDK A;  3DLE A;  3K5O A;  3P1G A;  4IBN A;  3ZT4 A;  3O3F A;  1ZYQ A;  2KZZ A;  1RT6 A;  4E7J A;  2ITG A;  1UOC A;  3MXM A;  2BGG A;  3NF9 A;  5FRO A;  3T1A A;  2E6L A;  1JLC A;  1NK5 A;  1S9E A;  3QNN A;  3LDS A;  4KHQ A;  5FRN A;  3DYA A;  4CFA A;  1HNI A;  1JLB A;  4UQG A;  1F21 A;  3DRR A;  4BDY A;  1N5Y A;  1N6Q A;  3K57 A;  3AVM A;  3DMJ A;  3EZ5 A;  1EKE A;  3TI0 A;  4GVM A;  1HRH A;  4NYF A;  3VQ5 A;  3HPH A;  4DTR A;  4DFK A;  3SUP A;  1B9F A;  4CJ5 A;  1X9M A;  2DY4 A;  4GW6 A;  4KI4 A;  3VQC A;  3KK3 A;  4FJG A;  4RW8 A;  3LP3 A;  3NH0 A;  3RMB A;  4F3T A;  3V1Q A;  4CHZ A;  3CQ8 A;  4FM1 A;  4W5Q A;  4BAC A;  4LSN A;  2DTU A;  4QOZ B;  1RTD A;  3V4I A;  3KKS A;  3VQQ A;  4KTW A;  1YVU A;  3E01 A;  1UAX A;  1EET A;  4B9S A;  3AVN A;  5J1E A;  3NF8 A;  1WAF A;  3CG7 A;  4J2E A;  2YV0 X;  4TSX A;  3QLH A;  2EX3 A;  1NKE A;  1RT7 A;  4N5S A;  4FZZ A;  5J2M A;  3ZT2 A;  4E3S A;  4DFJ A;  3L2U A;  1KFS A;  3DI6 A;  2JGU A;  4DTS A;  5CZ2 A;  4FK2 A;  1VSD A;  1REV A;  3CYM A;  1TKZ A;  3I0R A;  1IKV A;  4XIU A;  4OGE A;  4CEC A;  1XI1 A;  2G8K A;  1HYS A;  1QE1 A;  4Z4H A;  2YNF A;  1C0M A;  5J2N A;  2KTQ A;  3BGR A;  4I7F A;  1BL3 A;  4Z0U A;  3LWM A;  1NK9 A;  3ZSR A;  2PZS A;  3LP1 A;  4EZ6 A;  1DTQ A;  1FKP A;  5CYQ A;  2D0C A;  4CF1 A;  1VRT A;  3HJF A;  4AH9 A;  3SQ0 A;  3KLH A;  1D9F A;  4C8K A;  1DTT A;  3DRP A;  1A5V A;  2JLE A;  5KI6 A;  2GBZ A;  4PQU A;  1NJW A;  4CF0 A;  2B6A A;  1S1X A;  3ULD A;  3HVT A;  2WON A;  4CFB A;  3AVG A;  4ICL A;  1TV6 A;  2RKI A;  3QEX A;  1RTH A;  3OS1 A;  4DSK A;  2HHU A;  1TKT A;  3HXM A;  4HUG A;  4N76 A;  4KHW A;  1SL2 A;  3TAP A;  3AA3 A;  2NUB A;  1JLF A;  3ZSX A;  3QO9 A;  5HBM A;  1ZBI A;  2XY7 A;  1Z26 A;  3OVN A;  3CM6 A;  4DQI A;  3S3N A;  4AHC A;  3SJJ A;  4JRP A;  3IS9 A;  1X1P A;  2B5J A;  4K8X A;  4CJE A;  1BGX T;  1UA0 A;  4LH5 A;  3JSM A;  1VSJ A;  4CJP A;  1SV5 A;  2QKB A;  4OPK A;  4DLE A;  2DFF A;  3QEV A;  1YTA A;  4K8Z A;  1BQN A;  4Y1D A;  3AVC A;  3MEE A;  5KRS A;  2Y1J A;  4CED A;  4IG0 A;  4KRE A;  4W5T A;  4B8C A;  4CF2 A;  4FLU A;  2D0B A;  4RW4 A;  4E7H A;  1XC9 A;  3NAE A;  4M3U A;  2FBV A;  3LPT A;  5DK5 A;  3VQ4 A;  2VWK A;  4DSF A;  2Z1H A;  2A1S A;  1RBU A;  1ZBU A;  3SUN A;  1T8E A;  3HST B;  4RW6 A;  4W5O A;  1QS4 A;  3SQ1 A;  2A1R A;  4CCH A;  1RT3 A;  2HHX A;  4GMJ B;  3QIN A;  4NYN A;  1LAV A;  4Z4C A;  3H08 A;  1RDD A;  4EP5 A;  3S3O A;  4KHS A;  3DM2 A;  3NFA A;  3KJV A;  4DS5 A;  3B6P A;  2FBY A;  3ZSO A;  4CJ3 A;  4CHP A;  4CJW A;  1T05 A;  3RRG A;  3AVI A;  3NH2 A;  4Z4E A;  4H4O A;  1TAQ A;  3TAB A;  1JLA A;  1GOB A;  1TK0 A;  1BCO A;  1IH7 A;  1RDA A;  1U45 A;  4F4K A;  1FK9 A;  1TK8 A;  4ZTF A;  1S1W A;  3M8P A;  3ITH A;  3OYC A;  1ZBF A;  1HYZ A;  3ISN C;  4CES A;  1NOZ A;  4HCC A;  1C6V A;  4OGC A;  2ZD1 A;  4KRF A;  1KLN A;  3DLB A;  4DG1 A;  4ELU A;  3ALY A;  3VQD A;  2EHG A;  4B9T A;  1NK8 A;  2F8T A;  5I42 A;  4OLB A;  4CHN A;  1U48 A;  5HRS A;  3V6D A;  2OZM A;  2R7Y A;  4DSL A;  3OYG A;  4CHQ A;  4RW9 A;  2YKN A;  3AVH A;  4OPJ A;  4E19 A;  1QHT A;  4DLG A;  4B3O A;  2Z1I A;  2KW4 A;  3AVJ A;  1J53 A;  4O0J A;  3NDK A;  4DTN A;  4FK4 A;  3SPY A;  1CXU A;  1EXQ A;  4JS4 A;  2G8F A;  1LV5 A;  2E4L A;  3KK1 A;  2VG6 A;  3QNO A;  2E6M A;  4Y1C A;  3VA0 A;  3MEC A;  1NKB A;  3KTQ A;  5KGX A;  3PY8 A;  4JLH A;  3OYB A;  1HJR A;  1BI4 A;  2QXF A;  2VG7 A;  1JLG A;  1TVR A;  4DTM A;  2YKM A;  2OPS A;  4FLT A;  4C8N A;  5SZT A;  5J2Q A;  4DTJ A;  4C8M A;  2HW3 A;  4CJ4 A;  3WNE A;  4FW1 A;  1FKO A;  1U04 A;  4CJU A;  3SUO A;  2ZQB A;  2P51 A;  4CK3 A;  1B9D A;  1MU2 A;  3LPU A;  1BI4 B;  1I39 A;  1KTQ A;  1JLE A;  1GOC A;  1RBT A;  2GV9 A;  3O4N A;  1CLQ A;  3NGZ A;  4PUO A;  4FJ8 A;  4DSI A;  3QER A;  2HHQ A;  4BWJ A;  3OYE A;  1IKW A;  2D0A A;  4C8O A;  3C94 A;  1VSE A;  3P83 D;  4BE1 A;  3DLK A;  2KFN A;  4PY5 A;  2I5J A;  1DLO A;  5E41 A;  4LY7 A;  3LAL A;  1L3S A;  4KFB A;  5CZ1 A;  3DRS A;  3SPZ A;  4DTO A;  2G8H A;  3OS2 A;  4CIE A;  3F73 A;  3TAE A;  1QSS A;  5FRM A;  4AHU A;  4CEO A;  3ZSW A;  3L2W A;  4FJH A;  4CGF A;  1BCM A;  4O4G A;  3KKR A;  3OYH A;  3L3V A;  1S5J A;  4CJF A;  3M8S A;  2HVI A;  1TL1 A;  2HHS A;  4E1M A;  1J9A A;  4DTU A;  1WSI A;  3SCX A;  4DQR A;  4DTX A;  5FDL A;  4G1Q A;  5HRN A;  3VQP A;  4N41 A;  3HM9 A;  4M45 A;  5C25 A;  5D3G A;  1A5W A;  1T03 A;  1RT5 A;  3PUF A;  4FLZ A;  3ZT1 A;  3T19 A;  2F96 A;  3V9Z A;  1L3V A;  1IO2 A;  1VSI A;  4CIF A;  1BHL A;  4WE1 A;  3C6U A;  3TR8 A;  3NBP A;  3V9W A;  3BDP A;  4CER A;  5J2P A;  1SL0 A;  2IAJ A;  3SI6 A;  4J2D A;  4DS4 A;  1HMV A;  4DF4 A;  3O3G A;  4Q0B A;  2O4I A;  2IOC A;  3K5L A;  4MQ3 A;  1GOA A;  4E1N A;  1JXB A;  1SKS A;  1L5U A;  4J2B A;  3L3U A;  3OYA A;  3EYZ A;  3QIO A;  3DOK A;  1TAU A;  3B6O A;  2OYQ A;  3AVL A;  3KIO A;  3DLR A;  4C8L A;  3U6F A;  3S3M A;  2X78 A;  4KTZ A;  5CY4 A;  5C42 A;  3RWU A;  2YHB A;  4ID1 A;  4RG8 A;  2HND A;  4FLX A;  4H4M A;  2HHT A;  2Q3S A;  4IG3 A;  1YTU A;  4CJR A;  4CGI A;  4HUE A;  2X74 A;  4NCG A;  5C24 A;  3ZSQ A;  3UIQ A;  3K2P A;  1NJZ A;  3TWH A;  3THV A;  4CGD A;  1VSM A;  1LWF A;  4B8A B;  1TL3 A;  4FJX A;  3WNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...