4OVLA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Interrogating HIV integrase for compounds that bind--a SAMPL challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2013-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ovlA00
2OA8A 4CFDA 3VQ9A 4CHPA 1A5WA 2F96A 4O0JA 1ASWA 2FC0A 3I0RA 4O0IA 2KZZA 2HNZA 3AO4A 4I2PA 4CJUA 1TAUA 1VSFA 3E01A 4ID5A 3HSTB 4KHQA 1UA0A 1DLOA 3CG7A 4LH4A 4C8NA 2PYLA 1TGOA 5I42A 3TR8A 2KQ2A 3QEWA 3AVGA 3ZT1A 3TAGA 3TAPA 2PYJA 2YNHA 3B6OA 1EXQA 1JLGA 1TKXA 1HPZA 1WAFA 2B6AA 3AVLA 3DI6A 3OYBA 2Y1IA 1C0TA 3SQ1A 1LAWA 3PX4A 2E4LA 3U3GA 3HL8A 2P5OA 3M8RA 3DLHA 4M3ZA 1IO2A 2OZMA 4DQIA 2HHTA 2KW4A 1B9DA 2OPPA 1I39A 4CHNA 4JRQA 2HNYA 3HP6A 3HVRA 3VA0A 4ID1A 4KHWA 4NCAA 2KFZA 1NOZA 3VQBA 3OYHA 4CIEA 2P5GA 3TAMA 4CK1A 3O4NA 4CJVA 1UWBA 2GBZA 3C94A 4HUEA 1YTUA 4CJFA 4FJLA 1L3UA 4AH9A 3KKSA 5JS1A 1RBVA 1J9AA 2XY5A 4CJSA 2IOCA 5KI6A 2DFHA 3V1OA 1L5UA 4AHTA 4JS4A 1X9WA 4B9NA 1X9SA 4E0DA 4DU4A 2OYQA 1SKRA 3HM9A 3NF8A 3DLEA 4CECA 1CZ9A 1JLCA 4CEQA 4HHTA 3WNHA 5KGWA 3OYLA 1HNIA 2BGGA 2YHAA 3QETA 1X1PA 2OPSA 2OZSA 3ISNC 4FJMA 3PX0A 1HQEA 3OS0A 3QESA 3V9XA 3DLKA 4CJWA 3V1RA 3VN5A 1EETA 4CEBA 5SWMA 3L2UA 2A1SA 4KTWA 3RRGA 2KFNA 1RTHA 4CEAA 1BI4A 3LWLA 3DLBA 3I8DA 3DM2A 1GOBA 4DTNA 1L3VA 1N6QA 1REVA 1IKWA 3T3FA 3D0PA 5C25A 1EP4A 4OGCA 3C6UA 1KTQA 4I2QA 4RW7A 4GVMA 3SNNA 3OJUA 3DMJA 2O4IA 1A5VA 3LP1A 1NKCA 4FJ5A 3DOLA 4KHYA 3NDKA 5CYMA 4ZTJA 4OLBA 4GW6A 4K8ZA 3L2WA 3K5OA 3ZCMA 3AVAA 1C1AA 2D0AA 3PUFA 4FVMA 4CF2A 4KREA 5HBMA 4ZHRA 3LP0A 4E7IA 1JLAA 1YTAA 1NK9A 1SKWA 1U04A 4KKOA 1RBSA 4IG3A 5J1EA 3QEXA 3NF6A 1VSEA 1RDDA 1QTMA 3I0SA 4LD0A 1NJXA 1C1BA 1TKDA 3AVJA 3JSMA 4FJGA 3LAMA 1RT3A 1WSGA 3OS1A 2W42A 1SL1A 4BWMA 2BDPA 3TABA 4DLGA 3K2PA 1BCOA 4I9LA 1QE1A 1JXEA 1C0UA 3S9HA 4M3RA 4DSJA 2Z1JA 3ZSZA 4FZXC 4FLXA 4RW4A 3AO1A 1RT4A 1ZBUA 2ZE2A 4OLAA 1QHTA 3C95A 1IG9A 2G8HA 2HNDA 2YHBA 2XY8A 4H4MA 3JYTA 3HXMA 1S6PA 1TVRA 4O55A 4O44A 4B8AB 3H08A 1HJRA 4N76A 4FJ8A 5KRSA 4O5BA 4IFYA 3RWUA 1S1WA 4KFBA 3MAQA 3PY8A 4KAZA 3NGYA 1BI4B 3VQCA 2Q3SA 1XI1A 2HHQA 1WAJA 4NCGA 4CF0A 4AHVA 3SUQA 3C6TA 1BL3A 2X78A 3HPHA 2XO7A 3HPOA 4C8LA 3RRHA 4ELUA 3BGRA 3RTVA 2R7YA 2YNGA 4FK0A 4HTUA 1ZBIA 1BISA 3THVA 4B3OA 1VK0A 3QEPA 5E41A 3K57A 3V9SA 4CJ3A 3VQAA 3TAQA 2ZD1A 1FKOA 5KRTA 4FJNA 5FDLA 4IG0A 1T03A 2HB5A 4FCYA 2HHSA 3KIOA 5J2MA 1QSSA 1I3AA 1FXXA 5T7BA 3L2QA 1ZBLA 2VG5A 1DTTA 4BE1A 3TAEA 3MXIA 1XWLA 3VQPA 2QKBA 3ALYA 4FLYA 4TSXA 2A1RA 2XRIA 2OPQA 4E7JA 4DWIA 5DK5A 3QEVA 4F4KA 2E6LA 1D9DA 3SCXA 4FJ7A 1LW2A 1Y97A 2FBVA 4RW8A 4Z4IA 4DLEA 1TK5A 3P1GA 1TAQA 4CEFA 3LWMA 4YFUA 3F73A 3WNEA 4DSIA 4E19A 1ASUA 3VQ8A 4Z4CA 4AHRA 4FLZA 3AVBA 1WSHA 1Q9YA 4FXDA 4CEDA 3PX6A 1BCMA 3OYFA 3ULDA 4W5RA 3PO5A 2B5JA 1GOAA 4LY7A 2XHBA 1ZYQA 3IAYA 1JLEA 3SUPA 1XC9A 4CEEA 2HVIA 1YVUA 3DLRA 4CFBA 1S6QA 1W0HA 4DTOA 4KPYA 4F3TA 1KFSA 4CCHA 1QSYA 4FM1A 4ELTA 3VQ7A 3CM6A 2GV9A 2ETJA 2JGUA 1HYZA 4YNQA 1SUQA 3S3OA 2QK9A 2IC3A 3D45A 4DTPA 3QO9A 3VA3A 3A2FA 2BE2A 1C1CA 3OYGA 1KVCA 4B9SA 2X74A 3QINA 4OKKA 3T1AA 4FM0A 4FYDA 5HRSA 2DFFA 1WSFA 1VSMA 4CF1A 1TKTA 4M45A 4E7HA 1T7PA 4W5TA 1LWEA 3K5MA 4EP4A 1U49A 4M3XA 3AA2A 3OY9A 4DS5A 3IG1A 4K8XA 4KO0A 3OYNA 2Y1JA 1KRPA 1ASVA 2G8KA 4FLTA 2PY5A 4M42A 4ICLA 2E6MA 3MEEA 1IKYA 5C24A 1VSHA 5SZTA 3LZJA 4PA1A 3SV4A 5DMRA 4AHUA 4M3YA 1NKEA 4HUFA 1N5YA 4B9UA 4CE9A 4EP5A 4F2SA 3M8PA 4DG1A 4CJLA 4OGEA 3OVNA 3VQ5A 1A5XA 1IKXA 1HMVA 3NH2A 4JLHA 1UA1A 4FJXA 1VSDA 3RR8A 4IBNA 4RW9A 1HQUA 4CJPA 4E7LA 3L8BA 3SQ4A 2X6SA 3V9ZA 3DLGA 3KLIA 4CK3A 4EZ9A 3V81A 1SL0A 3DRSA 2QXFA 1XHZA 4CJTA 4CHYA 1YT3A 4KI6A 4O4GA 4DFJA 5HRRA 3RR7A 3KLEA 1RT2A 3EZ5A 4DU3A 1S9EA 1BQMA 3QLHA 5HP1A 4CJRA 4AILC 1VSJA 4HCCA 3QIPA 3T19A 2B4JA 3VQ4A 3U6FA 4R5PA 3AVCA 3HP9A 3HYFA 3CFOA 2F8SA 1NK0A 4LH5A 2D5RA 4QAGA 4FJIA 3V1QA 4J2EA 2IDOA 1S1VA 1UAXA 2G8IA 1IH7A 4NCBA 1LAVA 1BHLA 3OYEA 3DRRA 3F9KA 3OYJA 4Z4HA 3M8QA 3RMCA 3S3NA 2RKIA 3SPZA 1NJZA 1RBUA 1NK5A 3SI6A 2EHGA 3SPYA 3HJFA 1KLMA 3HO1A 1RT1A 2HHWA 2G8UA 2LSNA 3QNOA 4FZYA 4H4OA 2KZMA 1TL1A 3CFRA 4FLUA 5I3UA 2YNIA 4PWDA 1RT5A 4OPJA 4WE1A 4FLWA 4CFCA 2QKKA 3QERA 3LALA 3P5JA 4NYFA 3VQDA 4Z0UA 4FK4A 3OYKA 3O3HA 1HYVA 3HPGA 3KK2A 4OPKA 4M3UA 1S9GA 1JXBA 5HROA 3RMAA 2RPIA 1U47A 4Y1DA 1U45A 4XIUA 3AVMA 3V9WA 4DFKA 5J2PA 4PUOA 1EKEA 3L2VA 3NGIA 3AO3A 3LP2A 3TARA 3MEGA 3OYIA 4W5QA 2F8TA 1RILA 4B9VA 4FJ9A 4QOZB 3UIQA 1JLBA 5FROA 3VQEA 4DTRA 4DSEA 2Z1HA 2FBXA 5HRNA 1B9FA 1RBTA 1KSPA 4C8OA 4F8RA 5C42A 3AA3A 1ZBHA 2HHUA 3AVNA 1LWFA 1NKBA 1NK7A 4OKJA 3K5NA 1BIUA 3O3GA 2BANA 3CFPA 4M3TA 2WOMA 4N5SA 4UQGA 3K58A 2P1JA 4KB0A 1RT6A 4KHSA 2DTUA 4M41A 2VG6A 4CGDA 4CGHA 1FK9A 3BDPA 5J2QA 4J2AA 2O4GA 3IS9A 3AV9A 4RG8A 3G0ZA 4JS5A 1BGXT 4FM2A 5FRMA 3NGZA 4CGIA 4Z4GA 3DYAA 4DSKA 3CYMA 4DFPA 2ATQA 3OYAA 3KTQA 3G10A 4B9MA 1CZBA 1LV5A 4CIGA 1R0AA 4E7KA 4E89A 4IFVA 2FBTA 4FLVA 4J2DA 1CLQA 2PZSA 2YV0X 4CJ4A 4F2RA 1J53A 4E1NA 4PY5A 4BE0A 3SV3A 4CHOA 3RMDA 1SKSA 3PV8A 4DQRA 3TANA 3KLHA 4FJKA 4AHCA 3LDSA 1CXUA 4DF8A 2IAJA 3MEDA 1TK8A 3TAFA 3AVFA 2XY7A 3VQ6A 3L3VA 2AJQA 2YKMA 4DFMA 1NJYA 1EX4A 1JL1A 4BE2A 5CZ1A 3SZ2A 4I7FA 4FK2A 3S3MA 3ZSVA 5HRPA 2RF2A 4F3OA 4KTQA 3AVIA 2G8FA 4CK2A 4FZZA 1WSIA 1QQCA 1BIZA 3B6PA 1K6YA 1LWCA 4G1QA 4DTUA 3RMBA 2I5JA 4W5NA 4FW1A 2RN2A 4CGGA 3LPUA 4CHZA 3LPTA 4DTSA 4N47A 1RDAA 1RDBA 1TKZA 4DQPA 3WNGA 3NHGA 5KGXA 1HNVA 2D0BA 2X6NA 3LAKA 4CF8A 3LZIA 3CQ8A 1T8EA 2KTQA 2HW3A 4N41A 2FBYA 2DFEA 4CEZA 2JLEA 4JRPA 3AO5A 2Z1IA 1S1UA 3SJJA 3OYDA 3KJVA 1C6VA 4OKEA 1T05A 3K59A 4AHSA 3NH1A 5K14A 1SL2A 5D3GA 2ITGA 4L8RB 1Q8IA 3ZSRA 3QIOA 1B92A 1XHXA 1L3TA 1BQNA 4CERA 3DOKA 4Q0BA 1D5AA 3MECA 3NFAA 4FJHA 4B9TA 1VSLA 5EU7A 1VSIA 3NE6A 1WSJA 5JS2A 3L2RA 3SQ2A 3ZT3A 4BDZA 3V4IA 2HHVA 4KI4A 3M8SA 4OVLA 1S1TA 4CHQA 3NCIA 4DTXA 1C0MA 4DSFA 4E3SA 1JKHA 2VG7A 1J54A 1KVAA 2WONA 4NYNA 1X9MA 3KK3A 3LANA 1UOCA 3NH0A 1QSLA 3IRXA 3V9UA 1Z26A 3P83D 4KV8A 3ZT4A 3V6DA 2HHXA 4KTZA 3O4QA 3KKRA 5J2NA 2NUBA 4DQSA 3OJSA 4ELVA 3OYCA 4IKFA 4PQUA 3AA4A 1CXQA 3NAEA 3ZSXA 3ITHA 3ZSQA 3EY1A 1RTIA 4DS4A 4CJQA 1S1XA 2D0CA 3LP3A 4Z4EA 3OYMA 2VWKA 2XY6A 2EX3A 4ZTFA 3QEIA 4MQ3A 4BWJA 4QCLA 1RBRA 1RDCA 3AVKA 2Z1GA 4MFBA 4CF9A 4DTMA 4OJRA 3SUNA 3SQ0A 3TI0A 2VWJA 1RCHA 1U4BA 3PO4A 1ZBFA 1WN7A 4FW2A 4CFAA 2IS3A 4HVJA 4BDYA 1S5JA 4LSNA 1JLQA 1WLJA 3KD1E 3OS2A 3HT3A 1MU2A 3SYZA 1U48A 4CESA 4BACA 1F21A 4N56A 4CJKA 1WNSA 5CZ2A 4DQQA 1RNHA 4KRFA 3MXMA 3AVHA 2GUIA 3ZSOA 3ZT0A 4B08A 1ITGA 1JLFA 1SV5A 2OPRA 3CM5A 4DMNA 2HMIA 4CEOA 1O1WA 3ZSWA 4DTJA 2G8WA 4E1MA 4HUGA 1TL3A 5HLFA 4J2BA 3SUOA 1J5OA 4FJJA 3L3UA 3WNFA 1GOCA 1VRUA 1NOYA 1HYSA 4Y1CA 3AA5X 2HVHA 5KTQA 4IDKA 1G15A 1NK8A 3U3YA 5CYQA 3ASMA 4GMJB 4CJ5A 3VQQA 4DU1A 1W9HA 3NF9A 4CJEA 3ZSYA 2YKNA 4CGJA 3EYZA 1KLNA 1KCFA 4EZ6A 3TWHA 1Z25A 4Q5VA 2P51A 1NJWA 1RT7A 1NK4A 4B8CA 4CIFA 4KB1A 3KK1A 1LW0A 4KHNA 4RW6A 2ZQBA 2IGIA 1RTJA 3O3FA 1DTQA 4I9QA 3KLGA 1D9FA 3KD5E 3ZT2A 4BDPA 3HVTA 3HK2A 4C8MA 1QS4A 1VRTA 5CY4A 1JL2A 2G8VA 4DSLA 5FRNA 4H8KA 1RTDA 4C8KA 3DRPA 1TK0A 1HRHA 2DY4A 3FFIA 3K5LA 4B9LA 4HCBA 2YNFA 3NBPA 4KHUA 4W5OA 1Q9XA 1D8YA 3NF7A 3QNNA 1IKVA 1TV6A 1KVBA 3AO2A 1NK6A 3MXJA 4Z4FA 4DF4A 4LSLA 1L3SA 3KLFA 4M3WA 1FKPA 1WSEA 1KFDA 4CGFA 1VSKA
chains in the Genus database with same CATH superfamily
2OA8A 2QTDA 3I8BA 4BC5A 4WQ4A 3CCRN 1A5WA 3VEVA 3J7YP 1ASWA 2E2NA 2FC0A 4BQZA 2O8EA 4O0IA 2HNZA 2WC9A 4CJUA 3E01A 5AQQA 4C8NA 3AVGA 4FWRA 2YNHA 3DI6A 1EXQA 4H0TB 5GAGP 3OYBA 4RWTA 4O8UA 2E4LA 3CCMN 2P5OA 3DLHA 2HHTA 4DQIA 5H1SQ 1B9DA 2OPPA 2PYJA 4JRQA 2HNYA 3H3OB 3HP6A 3HVRA 1E4GT 2OTLN 4CIEA 3O4NA 3LM2A 3OW2M 3C94A 4WFAL 2XY5A 4CJSA 1HKGA 1ATRA 1L5UA 3FFKB 3CERA 4DU4A 4JK9A 1SKRA 4PKGA 3E9LA 4H5WA 4CECA 4HHTA 3J7AP 3O9SA 5FPNA 1YAGA 3AY9A 4DV5K 3ISNC 4FJMA 1DKGD 1HQEA 3OS0A 5SWMA 1EETA 4WFNL 5E84A 2RHKA 4KTWA 1H1VA 4YOUA 1BI4A 3VF6A 4FSVA 4EHTA 4WYBA 5HL7L 1REVA 2F7TA 1EP4A 1KTQA 1NGDA 2YI1A 1A5VA 3DOLA 4GW6A 3L2WA 1OVQA 3LP0A 3CC4N 1NK9A 4MDBA 1Y64A 4OPAA 5HOOA 1U04A 1TUYA 1QZ5A 4IG3A 5AFUA 3NF6A 2GTDA 4PL8A 2E2QA 3ENBA 2ZF5O 2PAVA 1NJXA 3JSMA 2BDPA 5C0YA 4BRLA 4DLGA 1BCOA 1C0UA 3J81O 4M3RA 2Z1JA 4CZKA 3THXA 1HR0K 1X3MA 1QHTA 2NLXA 3C95A 4X62K 4JHDA 3JYTA 1TVRA 5AQKA 4N76A 4FJ8A 5AQVA 1N36K 4GNIA 1S1WA 2P9NB 3MAQA 4KAZA 3VQCA 2HF3A 3ATVA 4JV5K 3HPOA 3RRHA 4NLCA 4ELUA 4A5AA 3RTVA 1E3MA 1ZBIA 1QZ6A 5E41A 3K57A 4JKGA 4FOIA 1FKOA 5AQSA 5FDLA 4IG0A 1K8KA 3KIOA 5J2MA 4I6MA 1I3AA 5FPEA 1BOTO 1DTTA 4BE1A 1NGCA 5AJ3K 3ALYA 4LF5K 3MWTA 2XRIA 4E7JA 4PL7A 2FSJA 1D9DA 1LW2A 1Y97A 4Z4IA 2F9WA 2AP1A 4KH4A 2QWRA 1T6CA 3WNEA 3DAWA 4BQLA 4E19A 1HNWK 4FLZA 3FZKA 3TSUA 1U6ZA 3PX6A 3OYFA 3ULDA 2UUAK 2VGNA 3PO5A 2B5JA 1GOAA 2XHBA 4K25A 1XC9A 1ZC6A 1YVUA 5AQIA 4CCHA 1QSYA 4IEIA 4JI2K 2QK9A 3D45A 3D2EB 2A41A 3QINA 4FYDA 1JCEA 3R1XA 5HRSA 4A62A 3C7NB 1LWEA 1S22A 3IG1A 5AZIA 4QS9A 4M42A 4BGAA 4IWVA 1VSHA 1WBBA 5DMRA 4B9UA 1HX1A 4OGEA 3NVMA 3VQ5A 4YOTA 2O8BA 2O8DB 2A40A 4IBNA 4YDUC 4E7LA 3SQ4A 2X6SA 3H1QA 3V9ZA 3DLGA 3KLIA 1SL0A 3DRSA 3VEWA 4BY9C 4OO1J 4CJTA 4C23A 1GLFO 2J4RA 3Q7CA 4GVEA 1S9EA 5AQXA 3A5NC 4HCCA 3QIPA 3WQUA 3AVCA 4DB3A 3HYFA 3ID8A 4QAGA 2G8IA 3V1QA 4BGBA 2IDOA 2KKZA 1BHLA 3OYEA 3S3NA 3RMCA 2RKIA 1RBUA 1NK5A 4DUYK 3QNOA 4BG9A 3HI0A 3LDLA 4FLWA 3VQDA 3VPZA 4MLEA 5BPLA 3CQYA 4M3UA 2YHYA 4OX9K 3EEQA 2UUCK 1NGHA 3AVMA 4PUOA 1EKEA 3L2VA 1M1KO 2P9UB 3LP2A 4K0KK 3DJCA 3OYIA 3AAQA 1JLBA 4IEEA 2HHUA 4BRMA 4C8OA 1YITN 4JKBA 1NKBA 4YDUA 1BIUA 2WOMA 4N5SA 3K58A 1JCFA 1HPMA 2YHWA 1VAZA 3AV9A 3IS9A 2P9SA 4RG8A 4E1JA 2V51B 2QWPA 4Z4GA 1MA9B 3CYMA 1TUUA 3ENHA 2ATQA 4B9QA 4B9MA 5JVHL 1CZBA 3THWA 3VEZA 4J2DA 4E89A 1Q81O 2IVPA 2PZSA 4F2RA 4HTLA 4CZHA 1NNEA 3QBWA 1SKSA 3PV8A 3TANA 1BA0A 4FJKA 1GLAG 4AHCA 4YOXA 4BC4A 3IDHA 5KQ8A 4IOXA 3TAFA 2HMPA 2AJQA 4DFMA 4CBUA 3SZ2A 5CZ1A 3RVCA 4DTUA 4G1QA 2ZGZA 4FWSA 4F9OA 4FW1A 2RN2A 4DTSA 4N47A 1RDAA 3JS6A 2X6NA 2D0BA 2KTQA 3A8YA 3G4SN 1T8EA 4N41A 4CEZA 2ITMA 2YJEA 3AO5A 1S1UA 5M1QA 4DR1K 4A5BA 3OYDA 4X66K 3KJVA 4OKEA 4H5RA 4Y0WA 4AHSA 5D3GA 1SL2A 3T7ZA 5FPDA 5AQLA 1B92A 1V4TA 1XHXA 3H3NO 1SZ2A 5E26A 3NFAA 5MLCQ 4FJHA 3F9MA 1RGIA 1VSLA 3VGLA 4DV0K 4JKCA 1WSJA 3U4LA 5CHIA 4CZEA 4ISFA 4KI4A 1C0MA 4DSFA 4NXMK 1JKHA 1J54A 3CXCM 3LANA 1YIJN 1QSLA 3ZLJA 5ELZA 3P83D 4KV8A 4DCHA 2HHXA 1P8ZA 3FZFA 4KTZA 4WCEL 1ZBSA 3OJSA 4IKFA 3MX5A 3ITHA 3CJCA 1RTIA 1VQPN 2XY6A 2EX3A 1RBRA 4CI6A 4DTMA 3SUNA 4OJRA 1U4BA 4WFBL 4JYAK 3CMAN 2IS3A 4IFEA 1JLQA 1WLJA 3OS2A 1MU2A 4N56A 3L4QA 3IFRA 3TPQA 2GUIA 3VENA 4B08A 3P31A 3UKUB 1SV5A 2OPRA 3SAFA 3L4IA 4BRKA 2P9PB 5HLFA 4J2BA 1J5OA 3L3UA 1HYSA 2W6KA 1G15A 1Z05A 2FXUA 1NK8A 4K41A 1NWKA 1W9HA 2YKNA 4CGJA 4Q5VA 1W97L 1EWQA 1RT7A 1VQKN 4B8CA 1OH7A 1LW0A 3GG4A 1RTJA 3O3FA 1DTQA 3E9PA 3KD5E 4CZFA 3GE1A 3WEEB 5LY3A 4BDPA 3PSIA 3QFUA 4ISGA 4B9LA 3ZYYX 4KHUA 4IOCL 4FPBA 1KVBA 3MN7A 3MXJA 4Z4FA 2VQEK 4DF4A 3KLFA 2NRZA 1VSKA 3VF2A 4DR2K 5FLXO 3AAPA 4O0JA 3UB5A 4EHUA 3QICA 2JWKA 5AQUA 1VQ4N 3AO4A 2EWSA 2BUPA 3M1FA 2GX9A 3HSTB 3KVGA 1UA0A 3CG7A 4LH4A 5I42A 4YORA 3TAGA 3TAPA 3B6OA 1JLGA 1TKXA 1WAFA 1HPZA 3CJ9A 1C0TA 5FPMA 4IJAA 3VESA 3M8RA 3A5OC 2P9IB 5AQYA 3VA0A 4ID1A 5BRDA 5JICA 4KHWA 3SMSA 2KFZA 3VQBA 1BUPA 4H0OA 1IJJA 3KKSA 3QFPA 1RBVA 2DFHA 3V1OA 2H3GX 4AHTA 1X9WA 4B9NA 4E0DA 4AF1A 3HM9A 3NF8A 3DLEA 4CEQA 3WNHA 5KGWA 1QHAA 2OZSA 3DLKA 4C1NI 4CJWA 3A0IX 1XUPO 4XEIA 1Q18A 1HUXA 2P9NA 4NXNK 3ULEB 2KFNA 3AGRA 1RTHA 4CEAA 3DM2A 3P39A 4BRIA 1IKWA 3T3FA 4JEPA 3C6UA 3JXUA 3OJUA 3DMJA 3BZKA 2O4IA 3ZX0A 3LP1A 4A2AA 4FJ5A 4NO7A 4ZTJA 5CYMA 5HBMA 1YTAA 4H0XB 1YXQA 1RBSA 5GINA 3HBTA 1YHQN 3AVJA 4FJGA 3LAMA 1RT3A 2W42A 1SL1A 4BWMA 1NGAA 2P9LB 3HZ6A 4I9LA 1QE1A 4DSJA 3O9QA 2A3ZA 4O55A 4O44A 2JWLA 4CBWA 4M63C 4IOAL 4B3TK 4IFYA 3RWUA 4IXCA 3SJHA 3BP8A 4NCGA 4CF0A 3C6HA 4AHVA 3SUQA 3VTHA 5LL6Z 1BL3A 1GLBG 2X78A 1BWFO 2XO7A 5BPNA 1BA1A 3D2EA 2R7YA 1OH8A 4B3OA 3QEPA 3C7NA 3TAQA 5KRTA 4MO5A 3OTOK 4B1VA 2HBMA 2QWQA 2HB5A 3NMUA 2E1ZA 2VGMA 3M5RA 3LDOA 1FXXA 4B3SK 3MXIA 2WFBA 3VQPA 2QKBA 4YOVA 2A1RA 5DK5A 4BC2A 4F4KA 4FJ7A 2O8DA 2CH6A 2PBDA 1TK5A 1TAQA 4CEFA 3CCEN 3VGKA 4CBXA 3F73A 2ZJQL 2KHOA 4AHRA 3VETA 1HLUA 3AVBA 1WSHA 5GIPA 3OA9A 3FZMA 1C0FA 2Q36A 1JLEA 4CEEA 3TSPA 3DLRA 2DPNA 2I7PA 4KPYA 4F3TA 4B1ZA 4FM1A 4ELTA 3VQ7A 3CM6A 3S3OA 1S3XA 4DR6K 4DTPA 3QO9A 3A2FA 2BE2A 3OYGA 1KVCA 4B9SA 2X74A 2Q0UA 2E1YA 3NVKA 1N34K 3K5MA 3CC7N 1VQ6N 1MDUB 1NMNA 4KO0A 1ASVA 2PY5A 3MEEA 3CMEN 1G99A 1NKEA 1NGBA 3SK3A 4FO0A 4EP5A 3M8PA 4GY2B 4CJLA 1NM1A 4CD3A 1K8AO 1VSDA 3RR8A 4WQ5C 4RW9A 4CJPA 2P9UA 3L8BA 4EZ9A 5KPRA 1XHZA 4CHYA 1YT3A 3KLEA 4DU3A 5GIOA 2QM1A 4CJRA 4AILC 1QVFM 1IG8A 4A2BA 3FR0A 4R5PA 3HP9A 3H1VX 2WTUA 3EKSA 2QWOA 4FWPA 4LH5A 1NK0A 4FJIA 4J2EA 1S1VA 1UAXA 2FF3B 3VERA 3DRRA 3F9KA 3CJBA 3VEOA 3OYJA 1OKJA 3SPZA 3SPYA 2G8UA 4H4OA 3C65A 1RT5A 3D7EO 2QKKA 4FK4A 5M1OA 3HPGA 2Q0RA 4JKHA 1S9GA 2P9KB 2VCPA 3BF3A 1U45A 4DFKA 3NGIA 1NJIO 4CZMA 4H0VB 4FJ9A 3OBYA 5FROA 3VF4A 5GAHP 4JI8K 4PQUA 4F8RA 1RBTA 2HBKA 3AA3A 4WQ5A 1NK7A 5EXWA 2BANA 1HJOA 4UQGA 2P1JA 1RT6A 4M41A 4CGDA 4IJNA 3G0ZA 2Q2RA 3CCQN 5FRMA 3CCSN 4CD1A 1J5EK 4DQ8A 2F4VK 3G10A 3MMVA 3LDQA 4CIGA 1R0AA 1J53A 4E1NA 4KH6A 3FLCO 4GV9A 4V19S 1GLJO 2BH1A 1VHXA 5EY4A 4AM7A 4DF8A 4BROA 1TK8A 3AGKA 2XY7A 3L3VA 2YKMA 5IWAK 1EX4A 1CZAN 3S3MA 4KTQA 2G8FA 4BR0A 3B6PA 1QQCA 1BIZA 3RMBA 3WUHA 5JVGL 1C0GA 2I5JA 1K9MO 1T44A 2O8FB 4CGGA 3LPUA 1TKZA 2UXBK 5BR9A 1MWKA 5KGXA 4BVOA 1HNVA 4CZGA 3F2KA 3HTVA 2HW3A 2A42A 3B8AX 2Z1IA 3SJJA 3LDNA 5K14A 2OCEA 3ZSRA 3QIOA 1L3TA 4CERA 3UKUA 5C2FA 1XMOK 1D5AA 3R6MA 2NZTA 3D2FB 2P9PA 3L2RA 3CHWA 3HOTA 4OVLA 4CHQA 1NMDA 2UXCK 4DTXA 1KVAA 3L0QA 2WONA 4B3MK 3KK3A 1UOCA 5GAEP 1DEJA 3LDPA 4XH1A 2E88A 2WBNA 3KKRA 4BR2A 4DQSA 5AFUH 1NGGA 3OYCA 3AA4A 1CXQA 3CETA 3ZSXA 3ZSQA 2CH5A 3EY1A 3CF5L 2ZWHA 4CJQA 2D0CA 4Z4EA 1GLEG 3WEEA 3QDKA 4MQ3A 1RDCA 3AVKA 2Z1GA 4MFBA 4CF9A 3TI0A 2V7YA 2O8CB 1RCHA 3DLLL 1FW6A 1WN7A 4CFAA 4BDYA 2OANA 4LSNA 3KD1E 1U48A 4BACA 2Q31A 4CJKA 1WNSA 4DQQA 3CC2N 3CJAA 3ZSOA 3O4WA 3IKMA 3U8XA 2ZM6K 3CM5A 4DMNA 3WXJA 4DTJA 1GOCA 4IDKA 3A5LC 4H5VA 1BU6O 4BRAA 3U3YA 3I33A 3ASMA 4GMJB 2E2OA 4JD2A 3VMFB 5BREA 3O1WA 5AQJA 3EYZA 3ZSYA 3W0LA 1KLNA 1Z25A 4NLBA 2P9IA 1HNXK 3KK1A 2ZJRL 4RW6A 1P90A 2ASPA 3EO3A 4I9QA 4BG8A 3HK2A 3HVTA 4LFCK 5CY4A 4FWNA 1O13A 4H8KA 2DY4A 1S72N 1KAYA 4LF8K 1Q9XA 3R8EA 1IKVA 4JI4K 2FSNA 4LSLA 3UKRB 4JI0K 4KBOA 1KRPA 2A5XA 5JLHA 5DM6L 4FWKA 2KZZA 4QS7A 3ULEA 4I2PA 1TAUA 3BEXA 3ZETA 3G71N 1XNQK 1VSFA 4KHQA 2PYLA 1TGOA 3TR8A 2KQ2A 3U9DA 3ZT1A 2HBJA 3QEWA 1OH6A 2QI2A 3SQ1A 2V7ZA 3PX4A 1XMQK 5ADXA 4CW7B 1VQLN 3TTFA 2KW4A 1SS6A 4NCAA 1NOZA 2P5GA 2D1KA 3TAMA 4CK1A 4FVUA 5AQPA 4CJFA 4FJLA 5JS1A 5BN9A 3CQXA 4JKEA 1VQ8N 2P9LA 1X9SA 4GV3A 4K42A 2Q97A 4JKDA 3OYLA 2NRWA 5AQZA 3QETA 2HHHK 2OPSA 3SBGA 3H45C 3EKUA 3PX0A 5F1XA 4BREA 4DV4K 3VEXA 3WXLA 3L2UA 4CEBA 3FZLA 2QW9A 3RRGA 1DGKN 3LWLA 2WUSA 2GELA 3ATUA 3I8DA 3TTCA 4H0YB 5KPTA 5AQWA 3UE5A 4JN4A 4GVMA 1OH5A 4JK8A 1N8RO 1NKCA 4KHYA 5AZJB 4K8ZA 4H5NA 4BRQA 3ZCMA 3AVAA 2D0AA 4FVMA 1JLAA 2Q1NA 1SKWA 5BRHA 1VSEA 3I0SA 1C1BA 3FE1A 2NRHA 1WSGA 3C6AA 3OS1A 4AQYK 4UY8O 3TABA 2UYTA 2F9TA 3K2PA 3O9TA 3S9HA 4JI5K 4FZXC 1V4SA 1RT4A 2ZE2A 4OLAA 3LL3A 2HNDA 4H4MA 2D0OA 5C2DA 2E8AA 1S6PA 4KH5A 1NGFA 4B8AB 1XC3A 5GADP 5KRSA 4O5BA 4X65K 1WAJA 4NB4A 4DV2K 4IZ9A 3BGRA 4FWQA 3THVA 1VK0A 3GBTA 3V9SA 3ZX3A 4CJ3A 3VQAA 2ZD1A 2VWBA 1T03A 4FCYA 3P38A 1QSSA 2VG5A 3TAEA 4A61A 4JI6K 4LC9B 4MO4A 2OPQA 3DWLA 1NGEA 3SCXA 4RW8A 4DLEA 3LWMA 2QWNA 3BF1A 3AARA 3CJ7A 4DSIA 1ASUA 1T6DA 3G25A 3VQ8A 4JD2B 4Z4CA 3MN6A 3PSFA 4BRCA 4U7BA 4H03B 4CEDA 4BRDA 4LY7A 3IAYA 3CD6N 2VYPA 2W40A 4DTOA 2ZGYA 5I9EB 2E2PA 4YNQA 2GV9A 2IC3A 4EIAA 3O9RA 4FM0A 2YX6A 4OKKA 2E5LK 2DFFA 5M1NA 4CF1A 4M45A 5BN8A 3EE8A 1T7PA 4EP4A 1U49A 3OY9A 1VQ5N 3FZHA 3OYNA 2Y1JA 2G8KA 3MN9A 1R59O 2E6MA 5C24A 3E9OA 3LZJA 3SV4A 2GWJA 3VGMA 1N5YA 1QQNA 2W6LA 4F2SA 4DG1A 1UA1A 5FRNA 2P9KA 1A5XA 1HMVA 2HSTA 3NH2A 3ZETB 1YJ9N 1HQUA 4LF4K 4IDHA 1ILYA 3H46O 5A2QO 3P4IA 3RR7A 5HRRA 5F0XA 1RT2A 1VSJA 3T19A 4GV6A 3VQ4A 2CGLA 2HOEA 3CFOA 2D5RA 3TTDA 3MX2A 1VQ9N 2W41A 2KLAA 3PIOL 3CPWM 3OBWA 4Z4HA 2IIRA 1NJZA 1JJ2M 2ASOA 3SI6A 2EHGA 2HHWA 1RT1A 2LSNA 4LF6K 4FZYA 3CFRA 1YJWN 2YNIA 4OPJA 4X64K 3QERA 4NYFA 4Z0UA 3K9JA 3VEYA 3OYKA 1HYVA 4B1UB 4OPKA 2ZJPL 1RDWX 1U47A 1JXBA 1T3VA 3RMAA 2RPIA 4YHHK 5HROA 4Y1DA 4DV1K 4XIUA 5AQOA 3AO3A 3TARA 4LFBK 5LJVA 3E66A 4B9VA 4QOZB 3PLAA 3UIQA 4DTRA 4B3RK 1ATNA 2Z1HA 4MLHA 2FBXA 3N4QA 2A6AA 2O8FA 5C42A 5AQRA 3AVNA 2FF6A 2NRTA 3ENOA 4OPHA 4M3TA 3CFPA 4CZLA 4KB0A 4DR4K 2VG6A 4CGHA 5J2QA 4J2AA 4JS5A 3NGZA 4CGIA 3DYAA 4DSKA 4BRFA 3OYAA 3KTQA 3K9KA 4K43A 5KQDA 4IFVA 2FBTA 3D2FA 2YV0X 4CJ4A 4PY5A 3H6EA 1GLLO 3RMDA 1D4XA 3KLHA 1NLVA 3A5MC 3KWGA 3KHYA 5CE3A 3MEDA 5BPMA 4XH5A 5JMVA 3N4PA 2HBLA 3VQ6A 2GWKA 1NJYA 4BE2A 4FK2A 4I7FA 5HRPA 2RF2A 4F3OA 3AVIA 3WQTA 1IBKK 4CK2A 4FZZA 1QQMA 2NRVA 4W5NA 3IMXA 4WF9L 4DQPA 2O8CA 2HF4A 4EAHD 3NHGA 4PKIA 3HSCA 5TKYA 3LZIA 3WT0A 2FBYA 2DFEA 4O8KA 2JLEA 1C6VA 1T05A 4L8RB 1Q8IA 5M1FA 3DOKA 2ASMA 4BRPA 4LF7K 1NGJA 5EU7A 3NE6A 4MDAA 4RCHA 3ZEUB 3ZT3A 4BDZA 2HHVA 3M8SA 1YI2N 3MCAB 1S1TA 4E3SA 4NYNA 4B1WB 3THYB 4B1XB 1TYQB 3NAEA 3HOSA 4DS4A 4ZTFA 3QEIA 4IO9L 3I55N 3J8AA 2VWJA 1NGIA 4FW2A 5TKWA 1S5JA 5BRFA 3D6RA 2AA4A 2NNWA 3UKRA 3AVHA 5AQMA 1ITGA 3O8MA 1K73O 4B1YB 4CEOA 5AQGA 2G8WA 4PKHA 1W7AA 4JI1K 4JKAA 3WNFA 3PIPL 5AQHA 1NOYA 4Y1CA 3AA5X 4ISEA 4JI3K 3ZX2A 4BRGA 5CYQA 2QEXN 4YOWA 1YVNA 3VQQA 4DU1A 1WB9A 3R9PA 4EZ6A 3TWHA 2P51A 3E1YA 4KB1A 4KHNA 3DXMB 4AM6A 4U67L 1Z6RA 4C8MA 1QS4A 1VRTA 5EOYA 2G8VA 1RTDA 5B8HA 4C8KA 3SBTA 3GOIA 1HRHA 1YJNN 3FFIA 1NBWA 4HCBA 4W5OA 3NF7A 3QNNA 4FL9A 1TV6A 3AO2A 4BR5A 3J80O 1NK6A 2UU9K 1GLDG 3DXKB 4M3WA 1X3NA 1WSEA 1KFDA 1WUAA 4CGFA 4CFDA 3VQ9A 4CHPA 3O1BA 5AR0A 2F96A 4YY3K 1KQSM 4DV7K 3I0RA 3SAHA 1IBLK 1LOTB 2YHXA 3O5BA 4ID5A 3SMPA 5AQNA 5M1PA 1DLOA 3FGUA 3IUCA 4YOYA 2Y1IA 3AVLA 2B6AA 1BDGA 1LAWA 3QBXA 5M1KA 1BG3A 3HL8A 3U3GA 4M3ZA 1IO2A 1KC8O 2OZMA 2CGKA 1KAXA 3U9ZA 5AZJA 4CHNA 1I39A 3SAGA 4ILGB 2GEMA 3OYHA 3CI5A 4CJVA 1UWBA 2GBZA 1QQOA 4HUEA 1YTUA 1L3UA 4AH9A 1J9AA 4HWIA 3CPEA 2IOCA 5KI6A 4LF9K 4JS4A 3SLCA 2OYQA 3RSEB 1CZ9A 1JLCA 1HNIA 3R3LA 2BGGA 2YHAA 3CCJN 1X1PA 3QESA 3V9XA 3V1RA 2BTFA 3VN5A 2A1SA 2O8EB 1SAZA 2YJFA 3DLBA 5DM7L 1GOBA 4DTNA 3KWIA 1L3VA 1N6QA 3D0PA 5C25A 4OGCA 3K0SA 4I2QA 4RW7A 3SNNA 4LFAK 2QWLA 4OLBA 3NDKA 1Q86O 5F2RA 3HRGA 2RE2A 2OTJN 3K5OA 1C1AA 3PUFA 4KREA 4CF2A 4J8FA 4ZHRA 4E7IA 3QEXA 4KKOA 5J1EA 5BR8K 1Q82O 1M90O 1QTMA 1RDDA 4LD0A 2D4WA 4CJ7A 1KD1O 1TKDA 3HM8A 1ZXOA 3CCLN 1JXEA 1RFQA 3ZSZA 3QB0A 3O6WA 4PHTX 4RW4A 3CCUN 1DT9A 3AO1A 4FLXA 1ZBUA 1XNRK 3T1HK 2UUBK 2G8HA 1IG9A 2YHBA 2XY8A 3HXMA 3LM9A 2FSKA 3H08A 1HJRA 2GUPA 3BUZB 4L3QA 4KFBA 3PY8A 3NGYA 3J7ZO 1BI4B 2Q3SA 1XI1A 2HHQA 5C10A 3C6TA 4IO8A 1J6ZA 1N32K 3HPHA 4C8LA 1EO1A 2YNGA 4FK0A 4HTUA 1BISA 1EWRA 4RTFD 4BRHA 4FJNA 4CZJA 1W2BM 2HHSA 5T7BA 3L2QA 1ZBLA 4O5FA 1XWLA 4ILHA 4FLYA 4TSXA 4DHYA 3WXMB 1U2VA 3QEVA 2E6LA 2FBVA 2QA4N 3S41A 3T1YK 3P1GA 4DKWA 4YFUA 3THXB 5IT9O 4Z94A 3TU5A 4JHDB 2VQFK 5JLFA 1Q9YA 4FXDA 4R79A 1LCUA 4XH4A 4A59A 1BCMA 3EZWA 4W5RA 3O80A 1ZYQA 3SUPA 4DV6K 2I7NA 2HVIA 2CGJA 4CFBA 1S6QA 1W0HA 3MCPA 1KFSA 2JGUA 2ETJA 1HYZA 1SUQA 4EFHA 3VA3A 3MDQA 1C1CA 1WOQA 3T1AA 3TSQA 1WSFA 4JKGB 1VSMA 1TKTA 2IVOA 4E7HA 4W5TA 2QWMA 4M3XA 3Q7BA 1K8KB 3AA2A 4DS5A 4K8XA 4I6MB 4FLTA 4ICLA 1HNZK 1IKYA 4KHPK 5SZTA 2E20A 4PA1A 4AHUA 4M3YA 1ESVA 4HUFA 4CE9A 3OVNA 1IKXA 4JLHA 4FJXA 5CR4A 1XQSC 3QMLA 1QVGM 3O08A 2NRRA 4CK3A 4M7YA 5AQTA 3V81A 4DR5K 2QXFA 2PFUA 4FOEA 4KI6A 1NU0A 4O4GA 4DFJA 4FWMA 3EZ5A 1BQMA 3CJ1A 3QLHA 5HP1A 2V52B 1YUWA 2B4JA 3GDQA 5LMNK 3U6FA 3CIPA 4GKKK 2F8SA 1X9JA 4C1NK 1IH7A 3EL2A 4NCBA 1LAVA 3M8QA 1KAZA 3O9UA 1I94K 5LMUK 3HJFA 1KLMA 3HO1A 4DR3K 2KZMA 5AZIB 1TL1A 4FLUA 5I3UA 4PWDA 4WE1A 4CFCA 3LALA 3P5JA 2NRXA 3BY5A 3T69A 3O3HA 1NG9A 3KK2A 2O8BB 1SQKA 3V9WA 1IBMK 5J2PA 3ID6A 3MEGA 4W5QA 2F8TA 1RILA 3GL1A 4FPAA 3VQEA 4DSEA 5HRNA 1B9FA 1KSPA 2QXLA 1ZBHA 4FWOA 1LWFA 4OKJA 3K5NA 3O3GA 2DTUA 1RDUA 3MN5A 1BO5O 4A57A 5LJWA 1FK9A 3BDPA 2O4GA 1BGXT 2FLOA 3C0BA 4FM2A 4DFPA 3EE9A 3EN9A 4DR7K 1LV5A 3BZCA 4E7KA 4FLVA 1CLQA 4H0PA 1EQYA 4BE0A 3ZEUA 3SV3A 5EX5A 4BR9A 4CHOA 1Q7YO 4DQRA 5ADXH 3LDSA 1CXUA 2IAJA 4GKJK 4H5TA 3AVFA 3THYA 1TYQA 1JL1A 3G6EN 3ZSVA 1WSIA 1K6YA 1LWCA 2D0PA 4BR4A 4JKFA 4CHZA 4BRNA 3LPTA 1RDBA 4M7XA 3WNGA 4DV3K 3LAKA 4CF8A 3CQ8A 1JCGA 4QS8A 1MWMA 2P9SB 4JRPA 3MWPA 5C12A 3K59A 3NH1A 2ITGA 2YCHA 1U2VB 4Q0BA 1E4FT 1BQNA 3THWB 3MECA 4B9TA 1VSIA 5JS2A 3SQ2A 3V4IA 3NCIA 4JNEA 2VG7A 4JAXA 5C15A 1X9MA 3NH0A 3IRXA 3V9UA 1Z26A 3ZT4A 3V6DA 3O4QA 5J2NA 2NUBA 4ELVA 3DXMA 1S1XA 3LP3A 4FWLA 3OYMA 1YF5L 1KXPA 2VWKA 3KZBA 5EVZA 4BWJA 1WBDA 4DWIA 3SQ0A 1ATSA 4QCLA 3PO4A 4DUZK 1ZBFA 3JAMO 4CZIA 4HVJA 4WQ4C 3CCVN 3F5TA 3HT3A 3WXKA 3SYZA 1VQ7N 3OHRA 3I56N 4CESA 1F21A 4ILJA 5CZ2A 4KRFA 1RNHA 3DXKA 3KK7A 3MXMA 4BC3A 3ZT0A 3VTIA 1OVYA 1JLFA 4JI7K 2HMIA 1O1WA 3ZSWA 1VQMN 1VQNN 4E1MA 4HUGA 1TL3A 3SUOA 4FJJA 2HVHA 1VRUA 1VQON 5KPZA 5KTQA 1HKBA 1N33K 3M6GA 4CJ5A 4CVNE 3NF9A 4CJEA 4JK7A 1KCFA 3L6QA 3VOVA 1NJWA 2UXDK 1NK4A 4CIFA 2ZQBA 2IGIA 3MK6A 3M3ZA 1GLCG 3KLGA 1D9FA 3ZT2A 3WXIA 1IV0A 1JL2A 4DSLA 1HKCA 2IVNA 3W3DA 4BR7A 3DRPA 1TK0A 3K5LA 1FJGK 2YNFA 3NBPA 1D8YA 4BVPA 5AQFA 3RSEA 1L3SA 4G9ZA 1FKPA 4KHSA
chains in the Genus database with same CATH topology
2OA8A 4CFDA 3VQ9A 4CHPA 1A5WA 2F96A 4O0JA 1ASWA 2FC0A 3I0RA 4O0IA 2KZZA 2HNZA 3AO4A 4I2PA 4CJUA 1TAUA 1VSFA 3E01A 4ID5A 3HSTB 4KHQA 1UA0A 1DLOA 3CG7A 4LH4A 4C8NA 2PYLA 1TGOA 5I42A 3TR8A 2KQ2A 3QEWA 3AVGA 3ZT1A 3TAGA 3TAPA 2PYJA 2YNHA 3B6OA 1EXQA 1JLGA 1TKXA 1HPZA 1WAFA 2B6AA 3AVLA 3DI6A 3OYBA 2Y1IA 1C0TA 3SQ1A 1LAWA 3PX4A 2E4LA 3U3GA 3HL8A 2P5OA 3M8RA 3DLHA 4M3ZA 1IO2A 2OZMA 4DQIA 2HHTA 2KW4A 1B9DA 2OPPA 1I39A 4CHNA 4JRQA 2HNYA 3HP6A 3HVRA 3VA0A 4ID1A 4KHWA 4NCAA 2KFZA 1NOZA 3VQBA 3OYHA 4CIEA 2P5GA 3TAMA 4CK1A 3O4NA 4CJVA 1UWBA 2GBZA 3C94A 4HUEA 1YTUA 4CJFA 4FJLA 1L3UA 4AH9A 3KKSA 5JS1A 1RBVA 1J9AA 2XY5A 4CJSA 2IOCA 5KI6A 2DFHA 3V1OA 1L5UA 4AHTA 4JS4A 1X9WA 4B9NA 1X9SA 4E0DA 4DU4A 2OYQA 1SKRA 3HM9A 3NF8A 3DLEA 4CECA 1CZ9A 1JLCA 4CEQA 4HHTA 3WNHA 5KGWA 3OYLA 1HNIA 2BGGA 2YHAA 3QETA 1X1PA 2OPSA 2OZSA 3ISNC 4FJMA 3PX0A 1HQEA 3OS0A 3QESA 3V9XA 3DLKA 4CJWA 3V1RA 3VN5A 1EETA 4CEBA 5SWMA 3L2UA 2A1SA 4KTWA 3RRGA 2KFNA 1RTHA 4CEAA 1BI4A 3LWLA 3DLBA 3I8DA 3DM2A 1GOBA 4DTNA 1L3VA 1N6QA 1REVA 1IKWA 3T3FA 3D0PA 5C25A 1EP4A 4OGCA 3C6UA 1KTQA 4I2QA 4RW7A 4GVMA 3SNNA 3OJUA 3DMJA 2O4IA 1A5VA 3LP1A 1NKCA 4FJ5A 3DOLA 4KHYA 3NDKA 5CYMA 4ZTJA 4OLBA 4GW6A 4K8ZA 3L2WA 3K5OA 3ZCMA 3AVAA 1C1AA 2D0AA 3PUFA 4FVMA 4CF2A 4KREA 5HBMA 4ZHRA 3LP0A 4E7IA 1JLAA 1YTAA 1NK9A 1SKWA 1U04A 4KKOA 1RBSA 4IG3A 5J1EA 3QEXA 3NF6A 1VSEA 1RDDA 1QTMA 3I0SA 4LD0A 1NJXA 1C1BA 1TKDA 3AVJA 3JSMA 4FJGA 3LAMA 1RT3A 1WSGA 3OS1A 2W42A 1SL1A 4BWMA 2BDPA 3TABA 4DLGA 3K2PA 1BCOA 4I9LA 1QE1A 1JXEA 1C0UA 3S9HA 4M3RA 4DSJA 2Z1JA 3ZSZA 4FZXC 4FLXA 4RW4A 3AO1A 1RT4A 1ZBUA 2ZE2A 4OLAA 1QHTA 3C95A 1IG9A 2G8HA 2HNDA 2YHBA 2XY8A 4H4MA 3JYTA 3HXMA 1S6PA 1TVRA 4O55A 4O44A 4B8AB 3H08A 1HJRA 4N76A 4FJ8A 5KRSA 4O5BA 4IFYA 3RWUA 1S1WA 4KFBA 3MAQA 3PY8A 4KAZA 3NGYA 1BI4B 3VQCA 2Q3SA 1XI1A 2HHQA 1WAJA 4NCGA 4CF0A 4AHVA 3SUQA 3C6TA 1BL3A 2X78A 3HPHA 2XO7A 3HPOA 4C8LA 3RRHA 4ELUA 3BGRA 3RTVA 2R7YA 2YNGA 4FK0A 4HTUA 1ZBIA 1BISA 3THVA 4B3OA 1VK0A 3QEPA 5E41A 3K57A 3V9SA 4CJ3A 3VQAA 3TAQA 2ZD1A 1FKOA 5KRTA 4FJNA 5FDLA 4IG0A 1T03A 2HB5A 4FCYA 2HHSA 3KIOA 5J2MA 1QSSA 1I3AA 1FXXA 5T7BA 3L2QA 1ZBLA 2VG5A 1DTTA 4BE1A 3TAEA 3MXIA 1XWLA 3VQPA 2QKBA 3ALYA 4FLYA 4TSXA 2A1RA 2XRIA 2OPQA 4E7JA 4DWIA 5DK5A 3QEVA 4F4KA 2E6LA 1D9DA 3SCXA 4FJ7A 1LW2A 1Y97A 2FBVA 4RW8A 4Z4IA 4DLEA 1TK5A 3P1GA 1TAQA 4CEFA 3LWMA 4YFUA 3F73A 3WNEA 4DSIA 4E19A 1ASUA 3VQ8A 4Z4CA 4AHRA 4FLZA 3AVBA 1WSHA 1Q9YA 4FXDA 4CEDA 3PX6A 1BCMA 3OYFA 3ULDA 4W5RA 3PO5A 2B5JA 1GOAA 4LY7A 2XHBA 1ZYQA 3IAYA 1JLEA 3SUPA 1XC9A 4CEEA 2HVIA 1YVUA 3DLRA 4CFBA 1S6QA 1W0HA 4DTOA 4KPYA 4F3TA 1KFSA 4CCHA 1QSYA 4FM1A 4ELTA 3VQ7A 3CM6A 2GV9A 2ETJA 2JGUA 1HYZA 4YNQA 1SUQA 3S3OA 2QK9A 2IC3A 3D45A 4DTPA 3QO9A 3VA3A 3A2FA 2BE2A 1C1CA 3OYGA 1KVCA 4B9SA 2X74A 3QINA 4OKKA 3T1AA 4FM0A 4FYDA 5HRSA 2DFFA 1WSFA 1VSMA 4CF1A 1TKTA 4M45A 4E7HA 1T7PA 4W5TA 1LWEA 3K5MA 4EP4A 1U49A 4M3XA 3AA2A 3OY9A 4DS5A 3IG1A 4K8XA 4KO0A 3OYNA 2Y1JA 1KRPA 1ASVA 2G8KA 4FLTA 2PY5A 4M42A 4ICLA 2E6MA 3MEEA 1IKYA 5C24A 1VSHA 5SZTA 3LZJA 4PA1A 3SV4A 5DMRA 4AHUA 4M3YA 1NKEA 4HUFA 1N5YA 4B9UA 4CE9A 4EP5A 4F2SA 3M8PA 4DG1A 4CJLA 4OGEA 3OVNA 3VQ5A 1A5XA 1IKXA 1HMVA 3NH2A 4JLHA 1UA1A 4FJXA 1VSDA 3RR8A 4IBNA 4RW9A 1HQUA 4CJPA 4E7LA 3L8BA 3SQ4A 2X6SA 3V9ZA 3DLGA 3KLIA 4CK3A 4EZ9A 3V81A 1SL0A 3DRSA 2QXFA 1XHZA 4CJTA 4CHYA 1YT3A 4KI6A 4O4GA 4DFJA 5HRRA 3RR7A 3KLEA 1RT2A 3EZ5A 4DU3A 1S9EA 1BQMA 3QLHA 5HP1A 4CJRA 4AILC 1VSJA 4HCCA 3QIPA 3T19A 2B4JA 3VQ4A 3U6FA 4R5PA 3AVCA 3HP9A 3HYFA 3CFOA 2F8SA 1NK0A 4LH5A 2D5RA 4QAGA 4FJIA 3V1QA 4J2EA 2IDOA 1S1VA 1UAXA 2G8IA 1IH7A 4NCBA 1LAVA 1BHLA 3OYEA 3DRRA 3F9KA 3OYJA 4Z4HA 3M8QA 3RMCA 3S3NA 2RKIA 3SPZA 1NJZA 1RBUA 1NK5A 3SI6A 2EHGA 3SPYA 3HJFA 1KLMA 3HO1A 1RT1A 2HHWA 2G8UA 2LSNA 3QNOA 4FZYA 4H4OA 2KZMA 1TL1A 3CFRA 4FLUA 5I3UA 2YNIA 4PWDA 1RT5A 4OPJA 4WE1A 4FLWA 4CFCA 2QKKA 3QERA 3LALA 3P5JA 4NYFA 3VQDA 4Z0UA 4FK4A 3OYKA 3O3HA 1HYVA 3HPGA 3KK2A 4OPKA 4M3UA 1S9GA 1JXBA 5HROA 3RMAA 2RPIA 1U47A 4Y1DA 1U45A 4XIUA 3AVMA 3V9WA 4DFKA 5J2PA 4PUOA 1EKEA 3L2VA 3NGIA 3AO3A 3LP2A 3TARA 3MEGA 3OYIA 4W5QA 2F8TA 1RILA 4B9VA 4FJ9A 4QOZB 3UIQA 1JLBA 5FROA 3VQEA 4DTRA 4DSEA 2Z1HA 2FBXA 5HRNA 1B9FA 1RBTA 1KSPA 4C8OA 4F8RA 5C42A 3AA3A 1ZBHA 2HHUA 3AVNA 1LWFA 1NKBA 1NK7A 4OKJA 3K5NA 1BIUA 3O3GA 2BANA 3CFPA 4M3TA 2WOMA 4N5SA 4UQGA 3K58A 2P1JA 4KB0A 1RT6A 4KHSA 2DTUA 4M41A 2VG6A 4CGDA 4CGHA 1FK9A 3BDPA 5J2QA 4J2AA 2O4GA 3IS9A 3AV9A 4RG8A 3G0ZA 4JS5A 1BGXT 4FM2A 5FRMA 3NGZA 4CGIA 4Z4GA 3DYAA 4DSKA 3CYMA 4DFPA 2ATQA 3OYAA 3KTQA 3G10A 4B9MA 1CZBA 1LV5A 4CIGA 1R0AA 4E7KA 4E89A 4IFVA 2FBTA 4FLVA 4J2DA 1CLQA 2PZSA 2YV0X 4CJ4A 4F2RA 1J53A 4E1NA 4PY5A 4BE0A 3SV3A 4CHOA 3RMDA 1SKSA 3PV8A 4DQRA 3TANA 3KLHA 4FJKA 4AHCA 3LDSA 1CXUA 4DF8A 2IAJA 3MEDA 1TK8A 3TAFA 3AVFA 2XY7A 3VQ6A 3L3VA 2AJQA 2YKMA 4DFMA 1NJYA 1EX4A 1JL1A 4BE2A 5CZ1A 3SZ2A 4I7FA 4FK2A 3S3MA 3ZSVA 5HRPA 2RF2A 4F3OA 4KTQA 3AVIA 2G8FA 4CK2A 4FZZA 1WSIA 1QQCA 1BIZA 3B6PA 1K6YA 1LWCA 4G1QA 4DTUA 3RMBA 2I5JA 4W5NA 4FW1A 2RN2A 4CGGA 3LPUA 4CHZA 3LPTA 4DTSA 4N47A 1RDAA 1RDBA 1TKZA 4DQPA 3WNGA 3NHGA 5KGXA 1HNVA 2D0BA 2X6NA 3LAKA 4CF8A 3LZIA 3CQ8A 1T8EA 2KTQA 2HW3A 4N41A 2FBYA 2DFEA 4CEZA 2JLEA 4JRPA 3AO5A 2Z1IA 1S1UA 3SJJA 3OYDA 3KJVA 1C6VA 4OKEA 1T05A 3K59A 4AHSA 3NH1A 5K14A 1SL2A 5D3GA 2ITGA 4L8RB 1Q8IA 3ZSRA 3QIOA 1B92A 1XHXA 1L3TA 1BQNA 4CERA 3DOKA 4Q0BA 1D5AA 3MECA 3NFAA 4FJHA 4B9TA 1VSLA 5EU7A 1VSIA 3NE6A 1WSJA 5JS2A 3L2RA 3SQ2A 3ZT3A 4BDZA 3V4IA 2HHVA 4KI4A 3M8SA 4OVLA 1S1TA 4CHQA 3NCIA 4DTXA 1C0MA 4DSFA 4E3SA 1JKHA 2VG7A 1J54A 1KVAA 2WONA 4NYNA 1X9MA 3KK3A 3LANA 1UOCA 3NH0A 1QSLA 3IRXA 3V9UA 1Z26A 3P83D 4KV8A 3ZT4A 3V6DA 2HHXA 4KTZA 3O4QA 3KKRA 5J2NA 2NUBA 4DQSA 3OJSA 4ELVA 3OYCA 4IKFA 4PQUA 3AA4A 1CXQA 3NAEA 3ZSXA 3ITHA 3ZSQA 3EY1A 1RTIA 4DS4A 4CJQA 1S1XA 2D0CA 3LP3A 4Z4EA 3OYMA 2VWKA 2XY6A 2EX3A 4ZTFA 3QEIA 4MQ3A 4BWJA 4QCLA 1RBRA 1RDCA 3AVKA 2Z1GA 4MFBA 4CF9A 4DTMA 4OJRA 3SUNA 3SQ0A 3TI0A 2VWJA 1RCHA 1U4BA 3PO4A 1ZBFA 1WN7A 4FW2A 4CFAA 2IS3A 4HVJA 4BDYA 1S5JA 4LSNA 1JLQA 1WLJA 3KD1E 3OS2A 3HT3A 1MU2A 3SYZA 1U48A 4CESA 4BACA 1F21A 4N56A 4CJKA 1WNSA 5CZ2A 4DQQA 1RNHA 4KRFA 3MXMA 3AVHA 2GUIA 3ZSOA 3ZT0A 4B08A 1ITGA 1JLFA 1SV5A 2OPRA 3CM5A 4DMNA 2HMIA 4CEOA 1O1WA 3ZSWA 4DTJA 2G8WA 4E1MA 4HUGA 1TL3A 5HLFA 4J2BA 3SUOA 1J5OA 4FJJA 3L3UA 3WNFA 1GOCA 1VRUA 1NOYA 1HYSA 4Y1CA 3AA5X 2HVHA 5KTQA 4IDKA 1G15A 1NK8A 3U3YA 5CYQA 3ASMA 4GMJB 4CJ5A 3VQQA 4DU1A 1W9HA 3NF9A 4CJEA 3ZSYA 2YKNA 4CGJA 3EYZA 1KLNA 1KCFA 4EZ6A 3TWHA 1Z25A 4Q5VA 2P51A 1NJWA 1RT7A 1NK4A 4B8CA 4CIFA 4KB1A 3KK1A 1LW0A 4KHNA 4RW6A 2ZQBA 2IGIA 1RTJA 3O3FA 1DTQA 4I9QA 3KLGA 1D9FA 3KD5E 3ZT2A 4BDPA 3HVTA 3HK2A 4C8MA 1QS4A 1VRTA 5CY4A 1JL2A 2G8VA 4DSLA 5FRNA 4H8KA 1RTDA 4C8KA 3DRPA 1TK0A 1HRHA 2DY4A 3FFIA 3K5LA 4B9LA 4HCBA 2YNFA 3NBPA 4KHUA 4W5OA 1Q9XA 1D8YA 3NF7A 3QNNA 1IKVA 1TV6A 1KVBA 3AO2A 1NK6A 3MXJA 4Z4FA 4DF4A 4LSLA 1L3SA 3KLFA 4M3WA 1FKPA 1WSEA 1KFDA 4CGFA 1VSKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OA8 A;  4CFD A;  3VQ9 A;  4CHP A;  1A5W A;  2F96 A;  4O0J A;  1ASW A;  2FC0 A;  3I0R A;  4O0I A;  2KZZ A;  2HNZ A;  3AO4 A;  4I2P A;  4CJU A;  1TAU A;  1VSF A;  3E01 A;  4ID5 A;  3HST B;  4KHQ A;  1UA0 A;  1DLO A;  3CG7 A;  4LH4 A;  4C8N A;  2PYL A;  1TGO A;  5I42 A;  3TR8 A;  2KQ2 A;  3QEW A;  3AVG A;  3ZT1 A;  3TAG A;  3TAP A;  2PYJ A;  2YNH A;  3B6O A;  1EXQ A;  1JLG A;  1TKX A;  1HPZ A;  1WAF A;  2B6A A;  3AVL A;  3DI6 A;  3OYB A;  2Y1I A;  1C0T A;  3SQ1 A;  1LAW A;  3PX4 A;  2E4L A;  3U3G A;  3HL8 A;  2P5O A;  3M8R A;  3DLH A;  4M3Z A;  1IO2 A;  2OZM A;  4DQI A;  2HHT A;  2KW4 A;  1B9D A;  2OPP A;  1I39 A;  4CHN A;  4JRQ A;  2HNY A;  3HP6 A;  3HVR A;  3VA0 A;  4ID1 A;  4KHW A;  4NCA A;  2KFZ A;  1NOZ A;  3VQB A;  3OYH A;  4CIE A;  2P5G A;  3TAM A;  4CK1 A;  3O4N A;  4CJV A;  1UWB A;  2GBZ A;  3C94 A;  4HUE A;  1YTU A;  4CJF A;  4FJL A;  1L3U A;  4AH9 A;  3KKS A;  5JS1 A;  1RBV A;  1J9A A;  2XY5 A;  4CJS A;  2IOC A;  5KI6 A;  2DFH A;  3V1O A;  1L5U A;  4AHT A;  4JS4 A;  1X9W A;  4B9N A;  1X9S A;  4E0D A;  4DU4 A;  2OYQ A;  1SKR A;  3HM9 A;  3NF8 A;  3DLE A;  4CEC A;  1CZ9 A;  1JLC A;  4CEQ A;  4HHT A;  3WNH A;  5KGW A;  3OYL A;  1HNI A;  2BGG A;  2YHA A;  3QET A;  1X1P A;  2OPS A;  2OZS A;  3ISN C;  4FJM A;  3PX0 A;  1HQE A;  3OS0 A;  3QES A;  3V9X A;  3DLK A;  4CJW A;  3V1R A;  3VN5 A;  1EET A;  4CEB A;  5SWM A;  3L2U A;  2A1S A;  4KTW A;  3RRG A;  2KFN A;  1RTH A;  4CEA A;  1BI4 A;  3LWL A;  3DLB A;  3I8D A;  3DM2 A;  1GOB A;  4DTN A;  1L3V A;  1N6Q A;  1REV A;  1IKW A;  3T3F A;  3D0P A;  5C25 A;  1EP4 A;  4OGC A;  3C6U A;  1KTQ A;  4I2Q A;  4RW7 A;  4GVM A;  3SNN A;  3OJU A;  3DMJ A;  2O4I A;  1A5V A;  3LP1 A;  1NKC A;  4FJ5 A;  3DOL A;  4KHY A;  3NDK A;  5CYM A;  4ZTJ A;  4OLB A;  4GW6 A;  4K8Z A;  3L2W A;  3K5O A;  3ZCM A;  3AVA A;  1C1A A;  2D0A A;  3PUF A;  4FVM A;  4CF2 A;  4KRE A;  5HBM A;  4ZHR A;  3LP0 A;  4E7I A;  1JLA A;  1YTA A;  1NK9 A;  1SKW A;  1U04 A;  4KKO A;  1RBS A;  4IG3 A;  5J1E A;  3QEX A;  3NF6 A;  1VSE A;  1RDD A;  1QTM A;  3I0S A;  4LD0 A;  1NJX A;  1C1B A;  1TKD A;  3AVJ A;  3JSM A;  4FJG A;  3LAM A;  1RT3 A;  1WSG A;  3OS1 A;  2W42 A;  1SL1 A;  4BWM A;  2BDP A;  3TAB A;  4DLG A;  3K2P A;  1BCO A;  4I9L A;  1QE1 A;  1JXE A;  1C0U A;  3S9H A;  4M3R A;  4DSJ A;  2Z1J A;  3ZSZ A;  4FZX C;  4FLX A;  4RW4 A;  3AO1 A;  1RT4 A;  1ZBU A;  2ZE2 A;  4OLA A;  1QHT A;  3C95 A;  1IG9 A;  2G8H A;  2HND A;  2YHB A;  2XY8 A;  4H4M A;  3JYT A;  3HXM A;  1S6P A;  1TVR A;  4O55 A;  4O44 A;  4B8A B;  3H08 A;  1HJR A;  4N76 A;  4FJ8 A;  5KRS A;  4O5B A;  4IFY A;  3RWU A;  1S1W A;  4KFB A;  3MAQ A;  3PY8 A;  4KAZ A;  3NGY A;  1BI4 B;  3VQC A;  2Q3S A;  1XI1 A;  2HHQ A;  1WAJ A;  4NCG A;  4CF0 A;  4AHV A;  3SUQ A;  3C6T A;  1BL3 A;  2X78 A;  3HPH A;  2XO7 A;  3HPO A;  4C8L A;  3RRH A;  4ELU A;  3BGR A;  3RTV A;  2R7Y A;  2YNG A;  4FK0 A;  4HTU A;  1ZBI A;  1BIS A;  3THV A;  4B3O A;  1VK0 A;  3QEP A;  5E41 A;  3K57 A;  3V9S A;  4CJ3 A;  3VQA A;  3TAQ A;  2ZD1 A;  1FKO A;  5KRT A;  4FJN A;  5FDL A;  4IG0 A;  1T03 A;  2HB5 A;  4FCY A;  2HHS A;  3KIO A;  5J2M A;  1QSS A;  1I3A A;  1FXX A;  5T7B A;  3L2Q A;  1ZBL A;  2VG5 A;  1DTT A;  4BE1 A;  3TAE A;  3MXI A;  1XWL A;  3VQP A;  2QKB A;  3ALY A;  4FLY A;  4TSX A;  2A1R A;  2XRI A;  2OPQ A;  4E7J A;  4DWI A;  5DK5 A;  3QEV A;  4F4K A;  2E6L A;  1D9D A;  3SCX A;  4FJ7 A;  1LW2 A;  1Y97 A;  2FBV A;  4RW8 A;  4Z4I A;  4DLE A;  1TK5 A;  3P1G A;  1TAQ A;  4CEF A;  3LWM A;  4YFU A;  3F73 A;  3WNE A;  4DSI A;  4E19 A;  1ASU A;  3VQ8 A;  4Z4C A;  4AHR A;  4FLZ A;  3AVB A;  1WSH A;  1Q9Y A;  4FXD A;  4CED A;  3PX6 A;  1BCM A;  3OYF A;  3ULD A;  4W5R A;  3PO5 A;  2B5J A;  1GOA A;  4LY7 A;  2XHB A;  1ZYQ A;  3IAY A;  1JLE A;  3SUP A;  1XC9 A;  4CEE A;  2HVI A;  1YVU A;  3DLR A;  4CFB A;  1S6Q A;  1W0H A;  4DTO A;  4KPY A;  4F3T A;  1KFS A;  4CCH A;  1QSY A;  4FM1 A;  4ELT A;  3VQ7 A;  3CM6 A;  2GV9 A;  2ETJ A;  2JGU A;  1HYZ A;  4YNQ A;  1SUQ A;  3S3O A;  2QK9 A;  2IC3 A;  3D45 A;  4DTP A;  3QO9 A;  3VA3 A;  3A2F A;  2BE2 A;  1C1C A;  3OYG A;  1KVC A;  4B9S A;  2X74 A;  3QIN A;  4OKK A;  3T1A A;  4FM0 A;  4FYD A;  5HRS A;  2DFF A;  1WSF A;  1VSM A;  4CF1 A;  1TKT A;  4M45 A;  4E7H A;  1T7P A;  4W5T A;  1LWE A;  3K5M A;  4EP4 A;  1U49 A;  4M3X A;  3AA2 A;  3OY9 A;  4DS5 A;  3IG1 A;  4K8X A;  4KO0 A;  3OYN A;  2Y1J A;  1KRP A;  1ASV A;  2G8K A;  4FLT A;  2PY5 A;  4M42 A;  4ICL A;  2E6M A;  3MEE A;  1IKY A;  5C24 A;  1VSH A;  5SZT A;  3LZJ A;  4PA1 A;  3SV4 A;  5DMR A;  4AHU A;  4M3Y A;  1NKE A;  4HUF A;  1N5Y A;  4B9U A;  4CE9 A;  4EP5 A;  4F2S A;  3M8P A;  4DG1 A;  4CJL A;  4OGE A;  3OVN A;  3VQ5 A;  1A5X A;  1IKX A;  1HMV A;  3NH2 A;  4JLH A;  1UA1 A;  4FJX A;  1VSD A;  3RR8 A;  4IBN A;  4RW9 A;  1HQU A;  4CJP A;  4E7L A;  3L8B A;  3SQ4 A;  2X6S A;  3V9Z A;  3DLG A;  3KLI A;  4CK3 A;  4EZ9 A;  3V81 A;  1SL0 A;  3DRS A;  2QXF A;  1XHZ A;  4CJT A;  4CHY A;  1YT3 A;  4KI6 A;  4O4G A;  4DFJ A;  5HRR A;  3RR7 A;  3KLE A;  1RT2 A;  3EZ5 A;  4DU3 A;  1S9E A;  1BQM A;  3QLH A;  5HP1 A;  4CJR A;  4AIL C;  1VSJ A;  4HCC A;  3QIP A;  3T19 A;  2B4J A;  3VQ4 A;  3U6F A;  4R5P A;  3AVC A;  3HP9 A;  3HYF A;  3CFO A;  2F8S A;  1NK0 A;  4LH5 A;  2D5R A;  4QAG A;  4FJI A;  3V1Q A;  4J2E A;  2IDO A;  1S1V A;  1UAX A;  2G8I A;  1IH7 A;  4NCB A;  1LAV A;  1BHL A;  3OYE A;  3DRR A;  3F9K A;  3OYJ A;  4Z4H A;  3M8Q A;  3RMC A;  3S3N A;  2RKI A;  3SPZ A;  1NJZ A;  1RBU A;  1NK5 A;  3SI6 A;  2EHG A;  3SPY A;  3HJF A;  1KLM A;  3HO1 A;  1RT1 A;  2HHW A;  2G8U A;  2LSN A;  3QNO A;  4FZY A;  4H4O A;  2KZM A;  1TL1 A;  3CFR A;  4FLU A;  5I3U A;  2YNI A;  4PWD A;  1RT5 A;  4OPJ A;  4WE1 A;  4FLW A;  4CFC A;  2QKK A;  3QER A;  3LAL A;  3P5J A;  4NYF A;  3VQD A;  4Z0U A;  4FK4 A;  3OYK A;  3O3H A;  1HYV A;  3HPG A;  3KK2 A;  4OPK A;  4M3U A;  1S9G A;  1JXB A;  5HRO A;  3RMA A;  2RPI A;  1U47 A;  4Y1D A;  1U45 A;  4XIU A;  3AVM A;  3V9W A;  4DFK A;  5J2P A;  4PUO A;  1EKE A;  3L2V A;  3NGI A;  3AO3 A;  3LP2 A;  3TAR A;  3MEG A;  3OYI A;  4W5Q A;  2F8T A;  1RIL A;  4B9V A;  4FJ9 A;  4QOZ B;  3UIQ A;  1JLB A;  5FRO A;  3VQE A;  4DTR A;  4DSE A;  2Z1H A;  2FBX A;  5HRN A;  1B9F A;  1RBT A;  1KSP A;  4C8O A;  4F8R A;  5C42 A;  3AA3 A;  1ZBH A;  2HHU A;  3AVN A;  1LWF A;  1NKB A;  1NK7 A;  4OKJ A;  3K5N A;  1BIU A;  3O3G A;  2BAN A;  3CFP A;  4M3T A;  2WOM A;  4N5S A;  4UQG A;  3K58 A;  2P1J A;  4KB0 A;  1RT6 A;  4KHS A;  2DTU A;  4M41 A;  2VG6 A;  4CGD A;  4CGH A;  1FK9 A;  3BDP A;  5J2Q A;  4J2A A;  2O4G A;  3IS9 A;  3AV9 A;  4RG8 A;  3G0Z A;  4JS5 A;  1BGX T;  4FM2 A;  5FRM A;  3NGZ A;  4CGI A;  4Z4G A;  3DYA A;  4DSK A;  3CYM A;  4DFP A;  2ATQ A;  3OYA A;  3KTQ A;  3G10 A;  4B9M A;  1CZB A;  1LV5 A;  4CIG A;  1R0A A;  4E7K A;  4E89 A;  4IFV A;  2FBT A;  4FLV A;  4J2D A;  1CLQ A;  2PZS A;  2YV0 X;  4CJ4 A;  4F2R A;  1J53 A;  4E1N A;  4PY5 A;  4BE0 A;  3SV3 A;  4CHO A;  3RMD A;  1SKS A;  3PV8 A;  4DQR A;  3TAN A;  3KLH A;  4FJK A;  4AHC A;  3LDS A;  1CXU A;  4DF8 A;  2IAJ A;  3MED A;  1TK8 A;  3TAF A;  3AVF A;  2XY7 A;  3VQ6 A;  3L3V A;  2AJQ A;  2YKM A;  4DFM A;  1NJY A;  1EX4 A;  1JL1 A;  4BE2 A;  5CZ1 A;  3SZ2 A;  4I7F A;  4FK2 A;  3S3M A;  3ZSV A;  5HRP A;  2RF2 A;  4F3O A;  4KTQ A;  3AVI A;  2G8F A;  4CK2 A;  4FZZ A;  1WSI A;  1QQC A;  1BIZ A;  3B6P A;  1K6Y A;  1LWC A;  4G1Q A;  4DTU A;  3RMB A;  2I5J A;  4W5N A;  4FW1 A;  2RN2 A;  4CGG A;  3LPU A;  4CHZ A;  3LPT A;  4DTS A;  4N47 A;  1RDA A;  1RDB A;  1TKZ A;  4DQP A;  3WNG A;  3NHG A;  5KGX A;  1HNV A;  2D0B A;  2X6N A;  3LAK A;  4CF8 A;  3LZI A;  3CQ8 A;  1T8E A;  2KTQ A;  2HW3 A;  4N41 A;  2FBY A;  2DFE A;  4CEZ A;  2JLE A;  4JRP A;  3AO5 A;  2Z1I A;  1S1U A;  3SJJ A;  3OYD A;  3KJV A;  1C6V A;  4OKE A;  1T05 A;  3K59 A;  4AHS A;  3NH1 A;  5K14 A;  1SL2 A;  5D3G A;  2ITG A;  4L8R B;  1Q8I A;  3ZSR A;  3QIO A;  1B92 A;  1XHX A;  1L3T A;  1BQN A;  4CER A;  3DOK A;  4Q0B A;  1D5A A;  3MEC A;  3NFA A;  4FJH A;  4B9T A;  1VSL A;  5EU7 A;  1VSI A;  3NE6 A;  1WSJ A;  5JS2 A;  3L2R A;  3SQ2 A;  3ZT3 A;  4BDZ A;  3V4I A;  2HHV A;  4KI4 A;  3M8S A;  4OVL A;  1S1T A;  4CHQ A;  3NCI A;  4DTX A;  1C0M A;  4DSF A;  4E3S A;  1JKH A;  2VG7 A;  1J54 A;  1KVA A;  2WON A;  4NYN A;  1X9M A;  3KK3 A;  3LAN A;  1UOC A;  3NH0 A;  1QSL A;  3IRX A;  3V9U A;  1Z26 A;  3P83 D;  4KV8 A;  3ZT4 A;  3V6D A;  2HHX A;  4KTZ A;  3O4Q A;  3KKR A;  5J2N A;  2NUB A;  4DQS A;  3OJS A;  4ELV A;  3OYC A;  4IKF A;  4PQU A;  3AA4 A;  1CXQ A;  3NAE A;  3ZSX A;  3ITH A;  3ZSQ A;  3EY1 A;  1RTI A;  4DS4 A;  4CJQ A;  1S1X A;  2D0C A;  3LP3 A;  4Z4E A;  3OYM A;  2VWK A;  2XY6 A;  2EX3 A;  4ZTF A;  3QEI A;  4MQ3 A;  4BWJ A;  4QCL A;  1RBR A;  1RDC A;  3AVK A;  2Z1G A;  4MFB A;  4CF9 A;  4DTM A;  4OJR A;  3SUN A;  3SQ0 A;  3TI0 A;  2VWJ A;  1RCH A;  1U4B A;  3PO4 A;  1ZBF A;  1WN7 A;  4FW2 A;  4CFA A;  2IS3 A;  4HVJ A;  4BDY A;  1S5J A;  4LSN A;  1JLQ A;  1WLJ A;  3KD1 E;  3OS2 A;  3HT3 A;  1MU2 A;  3SYZ A;  1U48 A;  4CES A;  4BAC A;  1F21 A;  4N56 A;  4CJK A;  1WNS A;  5CZ2 A;  4DQQ A;  1RNH A;  4KRF A;  3MXM A;  3AVH A;  2GUI A;  3ZSO A;  3ZT0 A;  4B08 A;  1ITG A;  1JLF A;  1SV5 A;  2OPR A;  3CM5 A;  4DMN A;  2HMI A;  4CEO A;  1O1W A;  3ZSW A;  4DTJ A;  2G8W A;  4E1M A;  4HUG A;  1TL3 A;  5HLF A;  4J2B A;  3SUO A;  1J5O A;  4FJJ A;  3L3U A;  3WNF A;  1GOC A;  1VRU A;  1NOY A;  1HYS A;  4Y1C A;  3AA5 X;  2HVH A;  5KTQ A;  4IDK A;  1G15 A;  1NK8 A;  3U3Y A;  5CYQ A;  3ASM A;  4GMJ B;  4CJ5 A;  3VQQ A;  4DU1 A;  1W9H A;  3NF9 A;  4CJE A;  3ZSY A;  2YKN A;  4CGJ A;  3EYZ A;  1KLN A;  1KCF A;  4EZ6 A;  3TWH A;  1Z25 A;  4Q5V A;  2P51 A;  1NJW A;  1RT7 A;  1NK4 A;  4B8C A;  4CIF A;  4KB1 A;  3KK1 A;  1LW0 A;  4KHN A;  4RW6 A;  2ZQB A;  2IGI A;  1RTJ A;  3O3F A;  1DTQ A;  4I9Q A;  3KLG A;  1D9F A;  3KD5 E;  3ZT2 A;  4BDP A;  3HVT A;  3HK2 A;  4C8M A;  1QS4 A;  1VRT A;  5CY4 A;  1JL2 A;  2G8V A;  4DSL A;  5FRN A;  4H8K A;  1RTD A;  4C8K A;  3DRP A;  1TK0 A;  1HRH A;  2DY4 A;  3FFI A;  3K5L A;  4B9L A;  4HCB A;  2YNF A;  3NBP A;  4KHU A;  4W5O A;  1Q9X A;  1D8Y A;  3NF7 A;  3QNN A;  1IKV A;  1TV6 A;  1KVB A;  3AO2 A;  1NK6 A;  3MXJ A;  4Z4F A;  4DF4 A;  4LSL A;  1L3S A;  3KLF A;  4M3W A;  1FKP A;  1WSE A;  1KFD A;  4CGF A;  1VSK A; 
#chains in the Genus database with same CATH topology
 2OA8 A;  2QTD A;  3I8B A;  4BC5 A;  4WQ4 A;  3CCR N;  1A5W A;  3VEV A;  3J7Y P;  1ASW A;  2E2N A;  2FC0 A;  4BQZ A;  2O8E A;  4O0I A;  2HNZ A;  2WC9 A;  4CJU A;  3E01 A;  5AQQ A;  4C8N A;  3AVG A;  4FWR A;  2YNH A;  3DI6 A;  1EXQ A;  4H0T B;  5GAG P;  3OYB A;  4RWT A;  4O8U A;  2E4L A;  3CCM N;  2P5O A;  3DLH A;  2HHT A;  4DQI A;  5H1S Q;  1B9D A;  2OPP A;  2PYJ A;  4JRQ A;  2HNY A;  3H3O B;  3HP6 A;  3HVR A;  1E4G T;  2OTL N;  4CIE A;  3O4N A;  3LM2 A;  3OW2 M;  3C94 A;  4WFA L;  2XY5 A;  4CJS A;  1HKG A;  1ATR A;  1L5U A;  3FFK B;  3CER A;  4DU4 A;  4JK9 A;  1SKR A;  4PKG A;  3E9L A;  4H5W A;  4CEC A;  4HHT A;  3J7A P;  3O9S A;  5FPN A;  1YAG A;  3AY9 A;  4DV5 K;  3ISN C;  4FJM A;  1DKG D;  1HQE A;  3OS0 A;  5SWM A;  1EET A;  4WFN L;  5E84 A;  2RHK A;  4KTW A;  1H1V A;  4YOU A;  1BI4 A;  3VF6 A;  4FSV A;  4EHT A;  4WYB A;  5HL7 L;  1REV A;  2F7T A;  1EP4 A;  1KTQ A;  1NGD A;  2YI1 A;  1A5V A;  3DOL A;  4GW6 A;  3L2W A;  1OVQ A;  3LP0 A;  3CC4 N;  1NK9 A;  4MDB A;  1Y64 A;  4OPA A;  5HOO A;  1U04 A;  1TUY A;  1QZ5 A;  4IG3 A;  5AFU A;  3NF6 A;  2GTD A;  4PL8 A;  2E2Q A;  3ENB A;  2ZF5 O;  2PAV A;  1NJX A;  3JSM A;  2BDP A;  5C0Y A;  4BRL A;  4DLG A;  1BCO A;  1C0U A;  3J81 O;  4M3R A;  2Z1J A;  4CZK A;  3THX A;  1HR0 K;  1X3M A;  1QHT A;  2NLX A;  3C95 A;  4X62 K;  4JHD A;  3JYT A;  1TVR A;  5AQK A;  4N76 A;  4FJ8 A;  5AQV A;  1N36 K;  4GNI A;  1S1W A;  2P9N B;  3MAQ A;  4KAZ A;  3VQC A;  2HF3 A;  3ATV A;  4JV5 K;  3HPO A;  3RRH A;  4NLC A;  4ELU A;  4A5A A;  3RTV A;  1E3M A;  1ZBI A;  1QZ6 A;  5E41 A;  3K57 A;  4JKG A;  4FOI A;  1FKO A;  5AQS A;  5FDL A;  4IG0 A;  1K8K A;  3KIO A;  5J2M A;  4I6M A;  1I3A A;  5FPE A;  1BOT O;  1DTT A;  4BE1 A;  1NGC A;  5AJ3 K;  3ALY A;  4LF5 K;  3MWT A;  2XRI A;  4E7J A;  4PL7 A;  2FSJ A;  1D9D A;  1LW2 A;  1Y97 A;  4Z4I A;  2F9W A;  2AP1 A;  4KH4 A;  2QWR A;  1T6C A;  3WNE A;  3DAW A;  4BQL A;  4E19 A;  1HNW K;  4FLZ A;  3FZK A;  3TSU A;  1U6Z A;  3PX6 A;  3OYF A;  3ULD A;  2UUA K;  2VGN A;  3PO5 A;  2B5J A;  1GOA A;  2XHB A;  4K25 A;  1XC9 A;  1ZC6 A;  1YVU A;  5AQI A;  4CCH A;  1QSY A;  4IEI A;  4JI2 K;  2QK9 A;  3D45 A;  3D2E B;  2A41 A;  3QIN A;  4FYD A;  1JCE A;  3R1X A;  5HRS A;  4A62 A;  3C7N B;  1LWE A;  1S22 A;  3IG1 A;  5AZI A;  4QS9 A;  4M42 A;  4BGA A;  4IWV A;  1VSH A;  1WBB A;  5DMR A;  4B9U A;  1HX1 A;  4OGE A;  3NVM A;  3VQ5 A;  4YOT A;  2O8B A;  2O8D B;  2A40 A;  4IBN A;  4YDU C;  4E7L A;  3SQ4 A;  2X6S A;  3H1Q A;  3V9Z A;  3DLG A;  3KLI A;  1SL0 A;  3DRS A;  3VEW A;  4BY9 C;  4OO1 J;  4CJT A;  4C23 A;  1GLF O;  2J4R A;  3Q7C A;  4GVE A;  1S9E A;  5AQX A;  3A5N C;  4HCC A;  3QIP A;  3WQU A;  3AVC A;  4DB3 A;  3HYF A;  3ID8 A;  4QAG A;  2G8I A;  3V1Q A;  4BGB A;  2IDO A;  2KKZ A;  1BHL A;  3OYE A;  3S3N A;  3RMC A;  2RKI A;  1RBU A;  1NK5 A;  4DUY K;  3QNO A;  4BG9 A;  3HI0 A;  3LDL A;  4FLW A;  3VQD A;  3VPZ A;  4MLE A;  5BPL A;  3CQY A;  4M3U A;  2YHY A;  4OX9 K;  3EEQ A;  2UUC K;  1NGH A;  3AVM A;  4PUO A;  1EKE A;  3L2V A;  1M1K O;  2P9U B;  3LP2 A;  4K0K K;  3DJC A;  3OYI A;  3AAQ A;  1JLB A;  4IEE A;  2HHU A;  4BRM A;  4C8O A;  1YIT N;  4JKB A;  1NKB A;  4YDU A;  1BIU A;  2WOM A;  4N5S A;  3K58 A;  1JCF A;  1HPM A;  2YHW A;  1VAZ A;  3AV9 A;  3IS9 A;  2P9S A;  4RG8 A;  4E1J A;  2V51 B;  2QWP A;  4Z4G A;  1MA9 B;  3CYM A;  1TUU A;  3ENH A;  2ATQ A;  4B9Q A;  4B9M A;  5JVH L;  1CZB A;  3THW A;  3VEZ A;  4J2D A;  4E89 A;  1Q81 O;  2IVP A;  2PZS A;  4F2R A;  4HTL A;  4CZH A;  1NNE A;  3QBW A;  1SKS A;  3PV8 A;  3TAN A;  1BA0 A;  4FJK A;  1GLA G;  4AHC A;  4YOX A;  4BC4 A;  3IDH A;  5KQ8 A;  4IOX A;  3TAF A;  2HMP A;  2AJQ A;  4DFM A;  4CBU A;  3SZ2 A;  5CZ1 A;  3RVC A;  4DTU A;  4G1Q A;  2ZGZ A;  4FWS A;  4F9O A;  4FW1 A;  2RN2 A;  4DTS A;  4N47 A;  1RDA A;  3JS6 A;  2X6N A;  2D0B A;  2KTQ A;  3A8Y A;  3G4S N;  1T8E A;  4N41 A;  4CEZ A;  2ITM A;  2YJE A;  3AO5 A;  1S1U A;  5M1Q A;  4DR1 K;  4A5B A;  3OYD A;  4X66 K;  3KJV A;  4OKE A;  4H5R A;  4Y0W A;  4AHS A;  5D3G A;  1SL2 A;  3T7Z A;  5FPD A;  5AQL A;  1B92 A;  1V4T A;  1XHX A;  3H3N O;  1SZ2 A;  5E26 A;  3NFA A;  5MLC Q;  4FJH A;  3F9M A;  1RGI A;  1VSL A;  3VGL A;  4DV0 K;  4JKC A;  1WSJ A;  3U4L A;  5CHI A;  4CZE A;  4ISF A;  4KI4 A;  1C0M A;  4DSF A;  4NXM K;  1JKH A;  1J54 A;  3CXC M;  3LAN A;  1YIJ N;  1QSL A;  3ZLJ A;  5ELZ A;  3P83 D;  4KV8 A;  4DCH A;  2HHX A;  1P8Z A;  3FZF A;  4KTZ A;  4WCE L;  1ZBS A;  3OJS A;  4IKF A;  3MX5 A;  3ITH A;  3CJC A;  1RTI A;  1VQP N;  2XY6 A;  2EX3 A;  1RBR A;  4CI6 A;  4DTM A;  3SUN A;  4OJR A;  1U4B A;  4WFB L;  4JYA K;  3CMA N;  2IS3 A;  4IFE A;  1JLQ A;  1WLJ A;  3OS2 A;  1MU2 A;  4N56 A;  3L4Q A;  3IFR A;  3TPQ A;  2GUI A;  3VEN A;  4B08 A;  3P31 A;  3UKU B;  1SV5 A;  2OPR A;  3SAF A;  3L4I A;  4BRK A;  2P9P B;  5HLF A;  4J2B A;  1J5O A;  3L3U A;  1HYS A;  2W6K A;  1G15 A;  1Z05 A;  2FXU A;  1NK8 A;  4K41 A;  1NWK A;  1W9H A;  2YKN A;  4CGJ A;  4Q5V A;  1W97 L;  1EWQ A;  1RT7 A;  1VQK N;  4B8C A;  1OH7 A;  1LW0 A;  3GG4 A;  1RTJ A;  3O3F A;  1DTQ A;  3E9P A;  3KD5 E;  4CZF A;  3GE1 A;  3WEE B;  5LY3 A;  4BDP A;  3PSI A;  3QFU A;  4ISG A;  4B9L A;  3ZYY X;  4KHU A;  4IOC L;  4FPB A;  1KVB A;  3MN7 A;  3MXJ A;  4Z4F A;  2VQE K;  4DF4 A;  3KLF A;  2NRZ A;  1VSK A;  3VF2 A;  4DR2 K;  5FLX O;  3AAP A;  4O0J A;  3UB5 A;  4EHU A;  3QIC A;  2JWK A;  5AQU A;  1VQ4 N;  3AO4 A;  2EWS A;  2BUP A;  3M1F A;  2GX9 A;  3HST B;  3KVG A;  1UA0 A;  3CG7 A;  4LH4 A;  5I42 A;  4YOR A;  3TAG A;  3TAP A;  3B6O A;  1JLG A;  1TKX A;  1WAF A;  1HPZ A;  3CJ9 A;  1C0T A;  5FPM A;  4IJA A;  3VES A;  3M8R A;  3A5O C;  2P9I B;  5AQY A;  3VA0 A;  4ID1 A;  5BRD A;  5JIC A;  4KHW A;  3SMS A;  2KFZ A;  3VQB A;  1BUP A;  4H0O A;  1IJJ A;  3KKS A;  3QFP A;  1RBV A;  2DFH A;  3V1O A;  2H3G X;  4AHT A;  1X9W A;  4B9N A;  4E0D A;  4AF1 A;  3HM9 A;  3NF8 A;  3DLE A;  4CEQ A;  3WNH A;  5KGW A;  1QHA A;  2OZS A;  3DLK A;  4C1N I;  4CJW A;  3A0I X;  1XUP O;  4XEI A;  1Q18 A;  1HUX A;  2P9N A;  4NXN K;  3ULE B;  2KFN A;  3AGR A;  1RTH A;  4CEA A;  3DM2 A;  3P39 A;  4BRI A;  1IKW A;  3T3F A;  4JEP A;  3C6U A;  3JXU A;  3OJU A;  3DMJ A;  3BZK A;  2O4I A;  3ZX0 A;  3LP1 A;  4A2A A;  4FJ5 A;  4NO7 A;  4ZTJ A;  5CYM A;  5HBM A;  1YTA A;  4H0X B;  1YXQ A;  1RBS A;  5GIN A;  3HBT A;  1YHQ N;  3AVJ A;  4FJG A;  3LAM A;  1RT3 A;  2W42 A;  1SL1 A;  4BWM A;  1NGA A;  2P9L B;  3HZ6 A;  4I9L A;  1QE1 A;  4DSJ A;  3O9Q A;  2A3Z A;  4O55 A;  4O44 A;  2JWL A;  4CBW A;  4M63 C;  4IOA L;  4B3T K;  4IFY A;  3RWU A;  4IXC A;  3SJH A;  3BP8 A;  4NCG A;  4CF0 A;  3C6H A;  4AHV A;  3SUQ A;  3VTH A;  5LL6 Z;  1BL3 A;  1GLB G;  2X78 A;  1BWF O;  2XO7 A;  5BPN A;  1BA1 A;  3D2E A;  2R7Y A;  1OH8 A;  4B3O A;  3QEP A;  3C7N A;  3TAQ A;  5KRT A;  4MO5 A;  3OTO K;  4B1V A;  2HBM A;  2QWQ A;  2HB5 A;  3NMU A;  2E1Z A;  2VGM A;  3M5R A;  3LDO A;  1FXX A;  4B3S K;  3MXI A;  2WFB A;  3VQP A;  2QKB A;  4YOV A;  2A1R A;  5DK5 A;  4BC2 A;  4F4K A;  4FJ7 A;  2O8D A;  2CH6 A;  2PBD A;  1TK5 A;  1TAQ A;  4CEF A;  3CCE N;  3VGK A;  4CBX A;  3F73 A;  2ZJQ L;  2KHO A;  4AHR A;  3VET A;  1HLU A;  3AVB A;  1WSH A;  5GIP A;  3OA9 A;  3FZM A;  1C0F A;  2Q36 A;  1JLE A;  4CEE A;  3TSP A;  3DLR A;  2DPN A;  2I7P A;  4KPY A;  4F3T A;  4B1Z A;  4FM1 A;  4ELT A;  3VQ7 A;  3CM6 A;  3S3O A;  1S3X A;  4DR6 K;  4DTP A;  3QO9 A;  3A2F A;  2BE2 A;  3OYG A;  1KVC A;  4B9S A;  2X74 A;  2Q0U A;  2E1Y A;  3NVK A;  1N34 K;  3K5M A;  3CC7 N;  1VQ6 N;  1MDU B;  1NMN A;  4KO0 A;  1ASV A;  2PY5 A;  3MEE A;  3CME N;  1G99 A;  1NKE A;  1NGB A;  3SK3 A;  4FO0 A;  4EP5 A;  3M8P A;  4GY2 B;  4CJL A;  1NM1 A;  4CD3 A;  1K8A O;  1VSD A;  3RR8 A;  4WQ5 C;  4RW9 A;  4CJP A;  2P9U A;  3L8B A;  4EZ9 A;  5KPR A;  1XHZ A;  4CHY A;  1YT3 A;  3KLE A;  4DU3 A;  5GIO A;  2QM1 A;  4CJR A;  4AIL C;  1QVF M;  1IG8 A;  4A2B A;  3FR0 A;  4R5P A;  3HP9 A;  3H1V X;  2WTU A;  3EKS A;  2QWO A;  4FWP A;  4LH5 A;  1NK0 A;  4FJI A;  4J2E A;  1S1V A;  1UAX A;  2FF3 B;  3VER A;  3DRR A;  3F9K A;  3CJB A;  3VEO A;  3OYJ A;  1OKJ A;  3SPZ A;  3SPY A;  2G8U A;  4H4O A;  3C65 A;  1RT5 A;  3D7E O;  2QKK A;  4FK4 A;  5M1O A;  3HPG A;  2Q0R A;  4JKH A;  1S9G A;  2P9K B;  2VCP A;  3BF3 A;  1U45 A;  4DFK A;  3NGI A;  1NJI O;  4CZM A;  4H0V B;  4FJ9 A;  3OBY A;  5FRO A;  3VF4 A;  5GAH P;  4JI8 K;  4PQU A;  4F8R A;  1RBT A;  2HBK A;  3AA3 A;  4WQ5 A;  1NK7 A;  5EXW A;  2BAN A;  1HJO A;  4UQG A;  2P1J A;  1RT6 A;  4M41 A;  4CGD A;  4IJN A;  3G0Z A;  2Q2R A;  3CCQ N;  5FRM A;  3CCS N;  4CD1 A;  1J5E K;  4DQ8 A;  2F4V K;  3G10 A;  3MMV A;  3LDQ A;  4CIG A;  1R0A A;  1J53 A;  4E1N A;  4KH6 A;  3FLC O;  4GV9 A;  4V19 S;  1GLJ O;  2BH1 A;  1VHX A;  5EY4 A;  4AM7 A;  4DF8 A;  4BRO A;  1TK8 A;  3AGK A;  2XY7 A;  3L3V A;  2YKM A;  5IWA K;  1EX4 A;  1CZA N;  3S3M A;  4KTQ A;  2G8F A;  4BR0 A;  3B6P A;  1QQC A;  1BIZ A;  3RMB A;  3WUH A;  5JVG L;  1C0G A;  2I5J A;  1K9M O;  1T44 A;  2O8F B;  4CGG A;  3LPU A;  1TKZ A;  2UXB K;  5BR9 A;  1MWK A;  5KGX A;  4BVO A;  1HNV A;  4CZG A;  3F2K A;  3HTV A;  2HW3 A;  2A42 A;  3B8A X;  2Z1I A;  3SJJ A;  3LDN A;  5K14 A;  2OCE A;  3ZSR A;  3QIO A;  1L3T A;  4CER A;  3UKU A;  5C2F A;  1XMO K;  1D5A A;  3R6M A;  2NZT A;  3D2F B;  2P9P A;  3L2R A;  3CHW A;  3HOT A;  4OVL A;  4CHQ A;  1NMD A;  2UXC K;  4DTX A;  1KVA A;  3L0Q A;  2WON A;  4B3M K;  3KK3 A;  1UOC A;  5GAE P;  1DEJ A;  3LDP A;  4XH1 A;  2E88 A;  2WBN A;  3KKR A;  4BR2 A;  4DQS A;  5AFU H;  1NGG A;  3OYC A;  3AA4 A;  1CXQ A;  3CET A;  3ZSX A;  3ZSQ A;  2CH5 A;  3EY1 A;  3CF5 L;  2ZWH A;  4CJQ A;  2D0C A;  4Z4E A;  1GLE G;  3WEE A;  3QDK A;  4MQ3 A;  1RDC A;  3AVK A;  2Z1G A;  4MFB A;  4CF9 A;  3TI0 A;  2V7Y A;  2O8C B;  1RCH A;  3DLL L;  1FW6 A;  1WN7 A;  4CFA A;  4BDY A;  2OAN A;  4LSN A;  3KD1 E;  1U48 A;  4BAC A;  2Q31 A;  4CJK A;  1WNS A;  4DQQ A;  3CC2 N;  3CJA A;  3ZSO A;  3O4W A;  3IKM A;  3U8X A;  2ZM6 K;  3CM5 A;  4DMN A;  3WXJ A;  4DTJ A;  1GOC A;  4IDK A;  3A5L C;  4H5V A;  1BU6 O;  4BRA A;  3U3Y A;  3I33 A;  3ASM A;  4GMJ B;  2E2O A;  4JD2 A;  3VMF B;  5BRE A;  3O1W A;  5AQJ A;  3EYZ A;  3ZSY A;  3W0L A;  1KLN A;  1Z25 A;  4NLB A;  2P9I A;  1HNX K;  3KK1 A;  2ZJR L;  4RW6 A;  1P90 A;  2ASP A;  3EO3 A;  4I9Q A;  4BG8 A;  3HK2 A;  3HVT A;  4LFC K;  5CY4 A;  4FWN A;  1O13 A;  4H8K A;  2DY4 A;  1S72 N;  1KAY A;  4LF8 K;  1Q9X A;  3R8E A;  1IKV A;  4JI4 K;  2FSN A;  4LSL A;  3UKR B;  4JI0 K;  4KBO A;  1KRP A;  2A5X A;  5JLH A;  5DM6 L;  4FWK A;  2KZZ A;  4QS7 A;  3ULE A;  4I2P A;  1TAU A;  3BEX A;  3ZET A;  3G71 N;  1XNQ K;  1VSF A;  4KHQ A;  2PYL A;  1TGO A;  3TR8 A;  2KQ2 A;  3U9D A;  3ZT1 A;  2HBJ A;  3QEW A;  1OH6 A;  2QI2 A;  3SQ1 A;  2V7Z A;  3PX4 A;  1XMQ K;  5ADX A;  4CW7 B;  1VQL N;  3TTF A;  2KW4 A;  1SS6 A;  4NCA A;  1NOZ A;  2P5G A;  2D1K A;  3TAM A;  4CK1 A;  4FVU A;  5AQP A;  4CJF A;  4FJL A;  5JS1 A;  5BN9 A;  3CQX A;  4JKE A;  1VQ8 N;  2P9L A;  1X9S A;  4GV3 A;  4K42 A;  2Q97 A;  4JKD A;  3OYL A;  2NRW A;  5AQZ A;  3QET A;  2HHH K;  2OPS A;  3SBG A;  3H45 C;  3EKU A;  3PX0 A;  5F1X A;  4BRE A;  4DV4 K;  3VEX A;  3WXL A;  3L2U A;  4CEB A;  3FZL A;  2QW9 A;  3RRG A;  1DGK N;  3LWL A;  2WUS A;  2GEL A;  3ATU A;  3I8D A;  3TTC A;  4H0Y B;  5KPT A;  5AQW A;  3UE5 A;  4JN4 A;  4GVM A;  1OH5 A;  4JK8 A;  1N8R O;  1NKC A;  4KHY A;  5AZJ B;  4K8Z A;  4H5N A;  4BRQ A;  3ZCM A;  3AVA A;  2D0A A;  4FVM A;  1JLA A;  2Q1N A;  1SKW A;  5BRH A;  1VSE A;  3I0S A;  1C1B A;  3FE1 A;  2NRH A;  1WSG A;  3C6A A;  3OS1 A;  4AQY K;  4UY8 O;  3TAB A;  2UYT A;  2F9T A;  3K2P A;  3O9T A;  3S9H A;  4JI5 K;  4FZX C;  1V4S A;  1RT4 A;  2ZE2 A;  4OLA A;  3LL3 A;  2HND A;  4H4M A;  2D0O A;  5C2D A;  2E8A A;  1S6P A;  4KH5 A;  1NGF A;  4B8A B;  1XC3 A;  5GAD P;  5KRS A;  4O5B A;  4X65 K;  1WAJ A;  4NB4 A;  4DV2 K;  4IZ9 A;  3BGR A;  4FWQ A;  3THV A;  1VK0 A;  3GBT A;  3V9S A;  3ZX3 A;  4CJ3 A;  3VQA A;  2ZD1 A;  2VWB A;  1T03 A;  4FCY A;  3P38 A;  1QSS A;  2VG5 A;  3TAE A;  4A61 A;  4JI6 K;  4LC9 B;  4MO4 A;  2OPQ A;  3DWL A;  1NGE A;  3SCX A;  4RW8 A;  4DLE A;  3LWM A;  2QWN A;  3BF1 A;  3AAR A;  3CJ7 A;  4DSI A;  1ASU A;  1T6D A;  3G25 A;  3VQ8 A;  4JD2 B;  4Z4C A;  3MN6 A;  3PSF A;  4BRC A;  4U7B A;  4H03 B;  4CED A;  4BRD A;  4LY7 A;  3IAY A;  3CD6 N;  2VYP A;  2W40 A;  4DTO A;  2ZGY A;  5I9E B;  2E2P A;  4YNQ A;  2GV9 A;  2IC3 A;  4EIA A;  3O9R A;  4FM0 A;  2YX6 A;  4OKK A;  2E5L K;  2DFF A;  5M1N A;  4CF1 A;  4M45 A;  5BN8 A;  3EE8 A;  1T7P A;  4EP4 A;  1U49 A;  3OY9 A;  1VQ5 N;  3FZH A;  3OYN A;  2Y1J A;  2G8K A;  3MN9 A;  1R59 O;  2E6M A;  5C24 A;  3E9O A;  3LZJ A;  3SV4 A;  2GWJ A;  3VGM A;  1N5Y A;  1QQN A;  2W6L A;  4F2S A;  4DG1 A;  1UA1 A;  5FRN A;  2P9K A;  1A5X A;  1HMV A;  2HST A;  3NH2 A;  3ZET B;  1YJ9 N;  1HQU A;  4LF4 K;  4IDH A;  1ILY A;  3H46 O;  5A2Q O;  3P4I A;  3RR7 A;  5HRR A;  5F0X A;  1RT2 A;  1VSJ A;  3T19 A;  4GV6 A;  3VQ4 A;  2CGL A;  2HOE A;  3CFO A;  2D5R A;  3TTD A;  3MX2 A;  1VQ9 N;  2W41 A;  2KLA A;  3PIO L;  3CPW M;  3OBW A;  4Z4H A;  2IIR A;  1NJZ A;  1JJ2 M;  2ASO A;  3SI6 A;  2EHG A;  2HHW A;  1RT1 A;  2LSN A;  4LF6 K;  4FZY A;  3CFR A;  1YJW N;  2YNI A;  4OPJ A;  4X64 K;  3QER A;  4NYF A;  4Z0U A;  3K9J A;  3VEY A;  3OYK A;  1HYV A;  4B1U B;  4OPK A;  2ZJP L;  1RDW X;  1U47 A;  1JXB A;  1T3V A;  3RMA A;  2RPI A;  4YHH K;  5HRO A;  4Y1D A;  4DV1 K;  4XIU A;  5AQO A;  3AO3 A;  3TAR A;  4LFB K;  5LJV A;  3E66 A;  4B9V A;  4QOZ B;  3PLA A;  3UIQ A;  4DTR A;  4B3R K;  1ATN A;  2Z1H A;  4MLH A;  2FBX A;  3N4Q A;  2A6A A;  2O8F A;  5C42 A;  5AQR A;  3AVN A;  2FF6 A;  2NRT A;  3ENO A;  4OPH A;  4M3T A;  3CFP A;  4CZL A;  4KB0 A;  4DR4 K;  2VG6 A;  4CGH A;  5J2Q A;  4J2A A;  4JS5 A;  3NGZ A;  4CGI A;  3DYA A;  4DSK A;  4BRF A;  3OYA A;  3KTQ A;  3K9K A;  4K43 A;  5KQD A;  4IFV A;  2FBT A;  3D2F A;  2YV0 X;  4CJ4 A;  4PY5 A;  3H6E A;  1GLL O;  3RMD A;  1D4X A;  3KLH A;  1NLV A;  3A5M C;  3KWG A;  3KHY A;  5CE3 A;  3MED A;  5BPM A;  4XH5 A;  5JMV A;  3N4P A;  2HBL A;  3VQ6 A;  2GWK A;  1NJY A;  4BE2 A;  4FK2 A;  4I7F A;  5HRP A;  2RF2 A;  4F3O A;  3AVI A;  3WQT A;  1IBK K;  4CK2 A;  4FZZ A;  1QQM A;  2NRV A;  4W5N A;  3IMX A;  4WF9 L;  4DQP A;  2O8C A;  2HF4 A;  4EAH D;  3NHG A;  4PKI A;  3HSC A;  5TKY A;  3LZI A;  3WT0 A;  2FBY A;  2DFE A;  4O8K A;  2JLE A;  1C6V A;  1T05 A;  4L8R B;  1Q8I A;  5M1F A;  3DOK A;  2ASM A;  4BRP A;  4LF7 K;  1NGJ A;  5EU7 A;  3NE6 A;  4MDA A;  4RCH A;  3ZEU B;  3ZT3 A;  4BDZ A;  2HHV A;  3M8S A;  1YI2 N;  3MCA B;  1S1T A;  4E3S A;  4NYN A;  4B1W B;  3THY B;  4B1X B;  1TYQ B;  3NAE A;  3HOS A;  4DS4 A;  4ZTF A;  3QEI A;  4IO9 L;  3I55 N;  3J8A A;  2VWJ A;  1NGI A;  4FW2 A;  5TKW A;  1S5J A;  5BRF A;  3D6R A;  2AA4 A;  2NNW A;  3UKR A;  3AVH A;  5AQM A;  1ITG A;  3O8M A;  1K73 O;  4B1Y B;  4CEO A;  5AQG A;  2G8W A;  4PKH A;  1W7A A;  4JI1 K;  4JKA A;  3WNF A;  3PIP L;  5AQH A;  1NOY A;  4Y1C A;  3AA5 X;  4ISE A;  4JI3 K;  3ZX2 A;  4BRG A;  5CYQ A;  2QEX N;  4YOW A;  1YVN A;  3VQQ A;  4DU1 A;  1WB9 A;  3R9P A;  4EZ6 A;  3TWH A;  2P51 A;  3E1Y A;  4KB1 A;  4KHN A;  3DXM B;  4AM6 A;  4U67 L;  1Z6R A;  4C8M A;  1QS4 A;  1VRT A;  5EOY A;  2G8V A;  1RTD A;  5B8H A;  4C8K A;  3SBT A;  3GOI A;  1HRH A;  1YJN N;  3FFI A;  1NBW A;  4HCB A;  4W5O A;  3NF7 A;  3QNN A;  4FL9 A;  1TV6 A;  3AO2 A;  4BR5 A;  3J80 O;  1NK6 A;  2UU9 K;  1GLD G;  3DXK B;  4M3W A;  1X3N A;  1WSE A;  1KFD A;  1WUA A;  4CGF A;  4CFD A;  3VQ9 A;  4CHP A;  3O1B A;  5AR0 A;  2F96 A;  4YY3 K;  1KQS M;  4DV7 K;  3I0R A;  3SAH A;  1IBL K;  1LOT B;  2YHX A;  3O5B A;  4ID5 A;  3SMP A;  5AQN A;  5M1P A;  1DLO A;  3FGU A;  3IUC A;  4YOY A;  2Y1I A;  3AVL A;  2B6A A;  1BDG A;  1LAW A;  3QBX A;  5M1K A;  1BG3 A;  3HL8 A;  3U3G A;  4M3Z A;  1IO2 A;  1KC8 O;  2OZM A;  2CGK A;  1KAX A;  3U9Z A;  5AZJ A;  4CHN A;  1I39 A;  3SAG A;  4ILG B;  2GEM A;  3OYH A;  3CI5 A;  4CJV A;  1UWB A;  2GBZ A;  1QQO A;  4HUE A;  1YTU A;  1L3U A;  4AH9 A;  1J9A A;  4HWI A;  3CPE A;  2IOC A;  5KI6 A;  4LF9 K;  4JS4 A;  3SLC A;  2OYQ A;  3RSE B;  1CZ9 A;  1JLC A;  1HNI A;  3R3L A;  2BGG A;  2YHA A;  3CCJ N;  1X1P A;  3QES A;  3V9X A;  3V1R A;  2BTF A;  3VN5 A;  2A1S A;  2O8E B;  1SAZ A;  2YJF A;  3DLB A;  5DM7 L;  1GOB A;  4DTN A;  3KWI A;  1L3V A;  1N6Q A;  3D0P A;  5C25 A;  4OGC A;  3K0S A;  4I2Q A;  4RW7 A;  3SNN A;  4LFA K;  2QWL A;  4OLB A;  3NDK A;  1Q86 O;  5F2R A;  3HRG A;  2RE2 A;  2OTJ N;  3K5O A;  1C1A A;  3PUF A;  4KRE A;  4CF2 A;  4J8F A;  4ZHR A;  4E7I A;  3QEX A;  4KKO A;  5J1E A;  5BR8 K;  1Q82 O;  1M90 O;  1QTM A;  1RDD A;  4LD0 A;  2D4W A;  4CJ7 A;  1KD1 O;  1TKD A;  3HM8 A;  1ZXO A;  3CCL N;  1JXE A;  1RFQ A;  3ZSZ A;  3QB0 A;  3O6W A;  4PHT X;  4RW4 A;  3CCU N;  1DT9 A;  3AO1 A;  4FLX A;  1ZBU A;  1XNR K;  3T1H K;  2UUB K;  2G8H A;  1IG9 A;  2YHB A;  2XY8 A;  3HXM A;  3LM9 A;  2FSK A;  3H08 A;  1HJR A;  2GUP A;  3BUZ B;  4L3Q A;  4KFB A;  3PY8 A;  3NGY A;  3J7Z O;  1BI4 B;  2Q3S A;  1XI1 A;  2HHQ A;  5C10 A;  3C6T A;  4IO8 A;  1J6Z A;  1N32 K;  3HPH A;  4C8L A;  1EO1 A;  2YNG A;  4FK0 A;  4HTU A;  1BIS A;  1EWR A;  4RTF D;  4BRH A;  4FJN A;  4CZJ A;  1W2B M;  2HHS A;  5T7B A;  3L2Q A;  1ZBL A;  4O5F A;  1XWL A;  4ILH A;  4FLY A;  4TSX A;  4DHY A;  3WXM B;  1U2V A;  3QEV A;  2E6L A;  2FBV A;  2QA4 N;  3S41 A;  3T1Y K;  3P1G A;  4DKW A;  4YFU A;  3THX B;  5IT9 O;  4Z94 A;  3TU5 A;  4JHD B;  2VQF K;  5JLF A;  1Q9Y A;  4FXD A;  4R79 A;  1LCU A;  4XH4 A;  4A59 A;  1BCM A;  3EZW A;  4W5R A;  3O80 A;  1ZYQ A;  3SUP A;  4DV6 K;  2I7N A;  2HVI A;  2CGJ A;  4CFB A;  1S6Q A;  1W0H A;  3MCP A;  1KFS A;  2JGU A;  2ETJ A;  1HYZ A;  1SUQ A;  4EFH A;  3VA3 A;  3MDQ A;  1C1C A;  1WOQ A;  3T1A A;  3TSQ A;  1WSF A;  4JKG B;  1VSM A;  1TKT A;  2IVO A;  4E7H A;  4W5T A;  2QWM A;  4M3X A;  3Q7B A;  1K8K B;  3AA2 A;  4DS5 A;  4K8X A;  4I6M B;  4FLT A;  4ICL A;  1HNZ K;  1IKY A;  4KHP K;  5SZT A;  2E20 A;  4PA1 A;  4AHU A;  4M3Y A;  1ESV A;  4HUF A;  4CE9 A;  3OVN A;  1IKX A;  4JLH A;  4FJX A;  5CR4 A;  1XQS C;  3QML A;  1QVG M;  3O08 A;  2NRR A;  4CK3 A;  4M7Y A;  5AQT A;  3V81 A;  4DR5 K;  2QXF A;  2PFU A;  4FOE A;  4KI6 A;  1NU0 A;  4O4G A;  4DFJ A;  4FWM A;  3EZ5 A;  1BQM A;  3CJ1 A;  3QLH A;  5HP1 A;  2V52 B;  1YUW A;  2B4J A;  3GDQ A;  5LMN K;  3U6F A;  3CIP A;  4GKK K;  2F8S A;  1X9J A;  4C1N K;  1IH7 A;  3EL2 A;  4NCB A;  1LAV A;  3M8Q A;  1KAZ A;  3O9U A;  1I94 K;  5LMU K;  3HJF A;  1KLM A;  3HO1 A;  4DR3 K;  2KZM A;  5AZI B;  1TL1 A;  4FLU A;  5I3U A;  4PWD A;  4WE1 A;  4CFC A;  3LAL A;  3P5J A;  2NRX A;  3BY5 A;  3T69 A;  3O3H A;  1NG9 A;  3KK2 A;  2O8B B;  1SQK A;  3V9W A;  1IBM K;  5J2P A;  3ID6 A;  3MEG A;  4W5Q A;  2F8T A;  1RIL A;  3GL1 A;  4FPA A;  3VQE A;  4DSE A;  5HRN A;  1B9F A;  1KSP A;  2QXL A;  1ZBH A;  4FWO A;  1LWF A;  4OKJ A;  3K5N A;  3O3G A;  2DTU A;  1RDU A;  3MN5 A;  1BO5 O;  4A57 A;  5LJW A;  1FK9 A;  3BDP A;  2O4G A;  1BGX T;  2FLO A;  3C0B A;  4FM2 A;  4DFP A;  3EE9 A;  3EN9 A;  4DR7 K;  1LV5 A;  3BZC A;  4E7K A;  4FLV A;  1CLQ A;  4H0P A;  1EQY A;  4BE0 A;  3ZEU A;  3SV3 A;  5EX5 A;  4BR9 A;  4CHO A;  1Q7Y O;  4DQR A;  5ADX H;  3LDS A;  1CXU A;  2IAJ A;  4GKJ K;  4H5T A;  3AVF A;  3THY A;  1TYQ A;  1JL1 A;  3G6E N;  3ZSV A;  1WSI A;  1K6Y A;  1LWC A;  2D0P A;  4BR4 A;  4JKF A;  4CHZ A;  4BRN A;  3LPT A;  1RDB A;  4M7X A;  3WNG A;  4DV3 K;  3LAK A;  4CF8 A;  3CQ8 A;  1JCG A;  4QS8 A;  1MWM A;  2P9S B;  4JRP A;  3MWP A;  5C12 A;  3K59 A;  3NH1 A;  2ITG A;  2YCH A;  1U2V B;  4Q0B A;  1E4F T;  1BQN A;  3THW B;  3MEC A;  4B9T A;  1VSI A;  5JS2 A;  3SQ2 A;  3V4I A;  3NCI A;  4JNE A;  2VG7 A;  4JAX A;  5C15 A;  1X9M A;  3NH0 A;  3IRX A;  3V9U A;  1Z26 A;  3ZT4 A;  3V6D A;  3O4Q A;  5J2N A;  2NUB A;  4ELV A;  3DXM A;  1S1X A;  3LP3 A;  4FWL A;  3OYM A;  1YF5 L;  1KXP A;  2VWK A;  3KZB A;  5EVZ A;  4BWJ A;  1WBD A;  4DWI A;  3SQ0 A;  1ATS A;  4QCL A;  3PO4 A;  4DUZ K;  1ZBF A;  3JAM O;  4CZI A;  4HVJ A;  4WQ4 C;  3CCV N;  3F5T A;  3HT3 A;  3WXK A;  3SYZ A;  1VQ7 N;  3OHR A;  3I56 N;  4CES A;  1F21 A;  4ILJ A;  5CZ2 A;  4KRF A;  1RNH A;  3DXK A;  3KK7 A;  3MXM A;  4BC3 A;  3ZT0 A;  3VTI A;  1OVY A;  1JLF A;  4JI7 K;  2HMI A;  1O1W A;  3ZSW A;  1VQM N;  1VQN N;  4E1M A;  4HUG A;  1TL3 A;  3SUO A;  4FJJ A;  2HVH A;  1VRU A;  1VQO N;  5KPZ A;  5KTQ A;  1HKB A;  1N33 K;  3M6G A;  4CJ5 A;  4CVN E;  3NF9 A;  4CJE A;  4JK7 A;  1KCF A;  3L6Q A;  3VOV A;  1NJW A;  2UXD K;  1NK4 A;  4CIF A;  2ZQB A;  2IGI A;  3MK6 A;  3M3Z A;  1GLC G;  3KLG A;  1D9F A;  3ZT2 A;  3WXI A;  1IV0 A;  1JL2 A;  4DSL A;  1HKC A;  2IVN A;  3W3D A;  4BR7 A;  3DRP A;  1TK0 A;  3K5L A;  1FJG K;  2YNF A;  3NBP A;  1D8Y A;  4BVP A;  5AQF A;  3RSE A;  1L3S A;  4G9Z A;  1FKP A;  4KHS A; 
#chains in the Genus database with same CATH homology
 2OA8 A;  4CFD A;  3VQ9 A;  4CHP A;  1A5W A;  2F96 A;  4O0J A;  1ASW A;  2FC0 A;  3I0R A;  4O0I A;  2KZZ A;  2HNZ A;  3AO4 A;  4I2P A;  4CJU A;  1TAU A;  1VSF A;  3E01 A;  4ID5 A;  3HST B;  4KHQ A;  1UA0 A;  1DLO A;  3CG7 A;  4LH4 A;  4C8N A;  2PYL A;  1TGO A;  5I42 A;  3TR8 A;  2KQ2 A;  3QEW A;  3AVG A;  3ZT1 A;  3TAG A;  3TAP A;  2PYJ A;  2YNH A;  3B6O A;  1EXQ A;  1JLG A;  1TKX A;  1HPZ A;  1WAF A;  2B6A A;  3AVL A;  3DI6 A;  3OYB A;  2Y1I A;  1C0T A;  3SQ1 A;  1LAW A;  3PX4 A;  2E4L A;  3U3G A;  3HL8 A;  2P5O A;  3M8R A;  3DLH A;  4M3Z A;  1IO2 A;  2OZM A;  4DQI A;  2HHT A;  2KW4 A;  1B9D A;  2OPP A;  1I39 A;  4CHN A;  4JRQ A;  2HNY A;  3HP6 A;  3HVR A;  3VA0 A;  4ID1 A;  4KHW A;  4NCA A;  2KFZ A;  1NOZ A;  3VQB A;  3OYH A;  4CIE A;  2P5G A;  3TAM A;  4CK1 A;  3O4N A;  4CJV A;  1UWB A;  2GBZ A;  3C94 A;  4HUE A;  1YTU A;  4CJF A;  4FJL A;  1L3U A;  4AH9 A;  3KKS A;  5JS1 A;  1RBV A;  1J9A A;  2XY5 A;  4CJS A;  2IOC A;  5KI6 A;  2DFH A;  3V1O A;  1L5U A;  4AHT A;  4JS4 A;  1X9W A;  4B9N A;  1X9S A;  4E0D A;  4DU4 A;  2OYQ A;  1SKR A;  3HM9 A;  3NF8 A;  3DLE A;  4CEC A;  1CZ9 A;  1JLC A;  4CEQ A;  4HHT A;  3WNH A;  5KGW A;  3OYL A;  1HNI A;  2BGG A;  2YHA A;  3QET A;  1X1P A;  2OPS A;  2OZS A;  3ISN C;  4FJM A;  3PX0 A;  1HQE A;  3OS0 A;  3QES A;  3V9X A;  3DLK A;  4CJW A;  3V1R A;  3VN5 A;  1EET A;  4CEB A;  5SWM A;  3L2U A;  2A1S A;  4KTW A;  3RRG A;  2KFN A;  1RTH A;  4CEA A;  1BI4 A;  3LWL A;  3DLB A;  3I8D A;  3DM2 A;  1GOB A;  4DTN A;  1L3V A;  1N6Q A;  1REV A;  1IKW A;  3T3F A;  3D0P A;  5C25 A;  1EP4 A;  4OGC A;  3C6U A;  1KTQ A;  4I2Q A;  4RW7 A;  4GVM A;  3SNN A;  3OJU A;  3DMJ A;  2O4I A;  1A5V A;  3LP1 A;  1NKC A;  4FJ5 A;  3DOL A;  4KHY A;  3NDK A;  5CYM A;  4ZTJ A;  4OLB A;  4GW6 A;  4K8Z A;  3L2W A;  3K5O A;  3ZCM A;  3AVA A;  1C1A A;  2D0A A;  3PUF A;  4FVM A;  4CF2 A;  4KRE A;  5HBM A;  4ZHR A;  3LP0 A;  4E7I A;  1JLA A;  1YTA A;  1NK9 A;  1SKW A;  1U04 A;  4KKO A;  1RBS A;  4IG3 A;  5J1E A;  3QEX A;  3NF6 A;  1VSE A;  1RDD A;  1QTM A;  3I0S A;  4LD0 A;  1NJX A;  1C1B A;  1TKD A;  3AVJ A;  3JSM A;  4FJG A;  3LAM A;  1RT3 A;  1WSG A;  3OS1 A;  2W42 A;  1SL1 A;  4BWM A;  2BDP A;  3TAB A;  4DLG A;  3K2P A;  1BCO A;  4I9L A;  1QE1 A;  1JXE A;  1C0U A;  3S9H A;  4M3R A;  4DSJ A;  2Z1J A;  3ZSZ A;  4FZX C;  4FLX A;  4RW4 A;  3AO1 A;  1RT4 A;  1ZBU A;  2ZE2 A;  4OLA A;  1QHT A;  3C95 A;  1IG9 A;  2G8H A;  2HND A;  2YHB A;  2XY8 A;  4H4M A;  3JYT A;  3HXM A;  1S6P A;  1TVR A;  4O55 A;  4O44 A;  4B8A B;  3H08 A;  1HJR A;  4N76 A;  4FJ8 A;  5KRS A;  4O5B A;  4IFY A;  3RWU A;  1S1W A;  4KFB A;  3MAQ A;  3PY8 A;  4KAZ A;  3NGY A;  1BI4 B;  3VQC A;  2Q3S A;  1XI1 A;  2HHQ A;  1WAJ A;  4NCG A;  4CF0 A;  4AHV A;  3SUQ A;  3C6T A;  1BL3 A;  2X78 A;  3HPH A;  2XO7 A;  3HPO A;  4C8L A;  3RRH A;  4ELU A;  3BGR A;  3RTV A;  2R7Y A;  2YNG A;  4FK0 A;  4HTU A;  1ZBI A;  1BIS A;  3THV A;  4B3O A;  1VK0 A;  3QEP A;  5E41 A;  3K57 A;  3V9S A;  4CJ3 A;  3VQA A;  3TAQ A;  2ZD1 A;  1FKO A;  5KRT A;  4FJN A;  5FDL A;  4IG0 A;  1T03 A;  2HB5 A;  4FCY A;  2HHS A;  3KIO A;  5J2M A;  1QSS A;  1I3A A;  1FXX A;  5T7B A;  3L2Q A;  1ZBL A;  2VG5 A;  1DTT A;  4BE1 A;  3TAE A;  3MXI A;  1XWL A;  3VQP A;  2QKB A;  3ALY A;  4FLY A;  4TSX A;  2A1R A;  2XRI A;  2OPQ A;  4E7J A;  4DWI A;  5DK5 A;  3QEV A;  4F4K A;  2E6L A;  1D9D A;  3SCX A;  4FJ7 A;  1LW2 A;  1Y97 A;  2FBV A;  4RW8 A;  4Z4I A;  4DLE A;  1TK5 A;  3P1G A;  1TAQ A;  4CEF A;  3LWM A;  4YFU A;  3F73 A;  3WNE A;  4DSI A;  4E19 A;  1ASU A;  3VQ8 A;  4Z4C A;  4AHR A;  4FLZ A;  3AVB A;  1WSH A;  1Q9Y A;  4FXD A;  4CED A;  3PX6 A;  1BCM A;  3OYF A;  3ULD A;  4W5R A;  3PO5 A;  2B5J A;  1GOA A;  4LY7 A;  2XHB A;  1ZYQ A;  3IAY A;  1JLE A;  3SUP A;  1XC9 A;  4CEE A;  2HVI A;  1YVU A;  3DLR A;  4CFB A;  1S6Q A;  1W0H A;  4DTO A;  4KPY A;  4F3T A;  1KFS A;  4CCH A;  1QSY A;  4FM1 A;  4ELT A;  3VQ7 A;  3CM6 A;  2GV9 A;  2ETJ A;  2JGU A;  1HYZ A;  4YNQ A;  1SUQ A;  3S3O A;  2QK9 A;  2IC3 A;  3D45 A;  4DTP A;  3QO9 A;  3VA3 A;  3A2F A;  2BE2 A;  1C1C A;  3OYG A;  1KVC A;  4B9S A;  2X74 A;  3QIN A;  4OKK A;  3T1A A;  4FM0 A;  4FYD A;  5HRS A;  2DFF A;  1WSF A;  1VSM A;  4CF1 A;  1TKT A;  4M45 A;  4E7H A;  1T7P A;  4W5T A;  1LWE A;  3K5M A;  4EP4 A;  1U49 A;  4M3X A;  3AA2 A;  3OY9 A;  4DS5 A;  3IG1 A;  4K8X A;  4KO0 A;  3OYN A;  2Y1J A;  1KRP A;  1ASV A;  2G8K A;  4FLT A;  2PY5 A;  4M42 A;  4ICL A;  2E6M A;  3MEE A;  1IKY A;  5C24 A;  1VSH A;  5SZT A;  3LZJ A;  4PA1 A;  3SV4 A;  5DMR A;  4AHU A;  4M3Y A;  1NKE A;  4HUF A;  1N5Y A;  4B9U A;  4CE9 A;  4EP5 A;  4F2S A;  3M8P A;  4DG1 A;  4CJL A;  4OGE A;  3OVN A;  3VQ5 A;  1A5X A;  1IKX A;  1HMV A;  3NH2 A;  4JLH A;  1UA1 A;  4FJX A;  1VSD A;  3RR8 A;  4IBN A;  4RW9 A;  1HQU A;  4CJP A;  4E7L A;  3L8B A;  3SQ4 A;  2X6S A;  3V9Z A;  3DLG A;  3KLI A;  4CK3 A;  4EZ9 A;  3V81 A;  1SL0 A;  3DRS A;  2QXF A;  1XHZ A;  4CJT A;  4CHY A;  1YT3 A;  4KI6 A;  4O4G A;  4DFJ A;  5HRR A;  3RR7 A;  3KLE A;  1RT2 A;  3EZ5 A;  4DU3 A;  1S9E A;  1BQM A;  3QLH A;  5HP1 A;  4CJR A;  4AIL C;  1VSJ A;  4HCC A;  3QIP A;  3T19 A;  2B4J A;  3VQ4 A;  3U6F A;  4R5P A;  3AVC A;  3HP9 A;  3HYF A;  3CFO A;  2F8S A;  1NK0 A;  4LH5 A;  2D5R A;  4QAG A;  4FJI A;  3V1Q A;  4J2E A;  2IDO A;  1S1V A;  1UAX A;  2G8I A;  1IH7 A;  4NCB A;  1LAV A;  1BHL A;  3OYE A;  3DRR A;  3F9K A;  3OYJ A;  4Z4H A;  3M8Q A;  3RMC A;  3S3N A;  2RKI A;  3SPZ A;  1NJZ A;  1RBU A;  1NK5 A;  3SI6 A;  2EHG A;  3SPY A;  3HJF A;  1KLM A;  3HO1 A;  1RT1 A;  2HHW A;  2G8U A;  2LSN A;  3QNO A;  4FZY A;  4H4O A;  2KZM A;  1TL1 A;  3CFR A;  4FLU A;  5I3U A;  2YNI A;  4PWD A;  1RT5 A;  4OPJ A;  4WE1 A;  4FLW A;  4CFC A;  2QKK A;  3QER A;  3LAL A;  3P5J A;  4NYF A;  3VQD A;  4Z0U A;  4FK4 A;  3OYK A;  3O3H A;  1HYV A;  3HPG A;  3KK2 A;  4OPK A;  4M3U A;  1S9G A;  1JXB A;  5HRO A;  3RMA A;  2RPI A;  1U47 A;  4Y1D A;  1U45 A;  4XIU A;  3AVM A;  3V9W A;  4DFK A;  5J2P A;  4PUO A;  1EKE A;  3L2V A;  3NGI A;  3AO3 A;  3LP2 A;  3TAR A;  3MEG A;  3OYI A;  4W5Q A;  2F8T A;  1RIL A;  4B9V A;  4FJ9 A;  4QOZ B;  3UIQ A;  1JLB A;  5FRO A;  3VQE A;  4DTR A;  4DSE A;  2Z1H A;  2FBX A;  5HRN A;  1B9F A;  1RBT A;  1KSP A;  4C8O A;  4F8R A;  5C42 A;  3AA3 A;  1ZBH A;  2HHU A;  3AVN A;  1LWF A;  1NKB A;  1NK7 A;  4OKJ A;  3K5N A;  1BIU A;  3O3G A;  2BAN A;  3CFP A;  4M3T A;  2WOM A;  4N5S A;  4UQG A;  3K58 A;  2P1J A;  4KB0 A;  1RT6 A;  4KHS A;  2DTU A;  4M41 A;  2VG6 A;  4CGD A;  4CGH A;  1FK9 A;  3BDP A;  5J2Q A;  4J2A A;  2O4G A;  3IS9 A;  3AV9 A;  4RG8 A;  3G0Z A;  4JS5 A;  1BGX T;  4FM2 A;  5FRM A;  3NGZ A;  4CGI A;  4Z4G A;  3DYA A;  4DSK A;  3CYM A;  4DFP A;  2ATQ A;  3OYA A;  3KTQ A;  3G10 A;  4B9M A;  1CZB A;  1LV5 A;  4CIG A;  1R0A A;  4E7K A;  4E89 A;  4IFV A;  2FBT A;  4FLV A;  4J2D A;  1CLQ A;  2PZS A;  2YV0 X;  4CJ4 A;  4F2R A;  1J53 A;  4E1N A;  4PY5 A;  4BE0 A;  3SV3 A;  4CHO A;  3RMD A;  1SKS A;  3PV8 A;  4DQR A;  3TAN A;  3KLH A;  4FJK A;  4AHC A;  3LDS A;  1CXU A;  4DF8 A;  2IAJ A;  3MED A;  1TK8 A;  3TAF A;  3AVF A;  2XY7 A;  3VQ6 A;  3L3V A;  2AJQ A;  2YKM A;  4DFM A;  1NJY A;  1EX4 A;  1JL1 A;  4BE2 A;  5CZ1 A;  3SZ2 A;  4I7F A;  4FK2 A;  3S3M A;  3ZSV A;  5HRP A;  2RF2 A;  4F3O A;  4KTQ A;  3AVI A;  2G8F A;  4CK2 A;  4FZZ A;  1WSI A;  1QQC A;  1BIZ A;  3B6P A;  1K6Y A;  1LWC A;  4G1Q A;  4DTU A;  3RMB A;  2I5J A;  4W5N A;  4FW1 A;  2RN2 A;  4CGG A;  3LPU A;  4CHZ A;  3LPT A;  4DTS A;  4N47 A;  1RDA A;  1RDB A;  1TKZ A;  4DQP A;  3WNG A;  3NHG A;  5KGX A;  1HNV A;  2D0B A;  2X6N A;  3LAK A;  4CF8 A;  3LZI A;  3CQ8 A;  1T8E A;  2KTQ A;  2HW3 A;  4N41 A;  2FBY A;  2DFE A;  4CEZ A;  2JLE A;  4JRP A;  3AO5 A;  2Z1I A;  1S1U A;  3SJJ A;  3OYD A;  3KJV A;  1C6V A;  4OKE A;  1T05 A;  3K59 A;  4AHS A;  3NH1 A;  5K14 A;  1SL2 A;  5D3G A;  2ITG A;  4L8R B;  1Q8I A;  3ZSR A;  3QIO A;  1B92 A;  1XHX A;  1L3T A;  1BQN A;  4CER A;  3DOK A;  4Q0B A;  1D5A A;  3MEC A;  3NFA A;  4FJH A;  4B9T A;  1VSL A;  5EU7 A;  1VSI A;  3NE6 A;  1WSJ A;  5JS2 A;  3L2R A;  3SQ2 A;  3ZT3 A;  4BDZ A;  3V4I A;  2HHV A;  4KI4 A;  3M8S A;  4OVL A;  1S1T A;  4CHQ A;  3NCI A;  4DTX A;  1C0M A;  4DSF A;  4E3S A;  1JKH A;  2VG7 A;  1J54 A;  1KVA A;  2WON A;  4NYN A;  1X9M A;  3KK3 A;  3LAN A;  1UOC A;  3NH0 A;  1QSL A;  3IRX A;  3V9U A;  1Z26 A;  3P83 D;  4KV8 A;  3ZT4 A;  3V6D A;  2HHX A;  4KTZ A;  3O4Q A;  3KKR A;  5J2N A;  2NUB A;  4DQS A;  3OJS A;  4ELV A;  3OYC A;  4IKF A;  4PQU A;  3AA4 A;  1CXQ A;  3NAE A;  3ZSX A;  3ITH A;  3ZSQ A;  3EY1 A;  1RTI A;  4DS4 A;  4CJQ A;  1S1X A;  2D0C A;  3LP3 A;  4Z4E A;  3OYM A;  2VWK A;  2XY6 A;  2EX3 A;  4ZTF A;  3QEI A;  4MQ3 A;  4BWJ A;  4QCL A;  1RBR A;  1RDC A;  3AVK A;  2Z1G A;  4MFB A;  4CF9 A;  4DTM A;  4OJR A;  3SUN A;  3SQ0 A;  3TI0 A;  2VWJ A;  1RCH A;  1U4B A;  3PO4 A;  1ZBF A;  1WN7 A;  4FW2 A;  4CFA A;  2IS3 A;  4HVJ A;  4BDY A;  1S5J A;  4LSN A;  1JLQ A;  1WLJ A;  3KD1 E;  3OS2 A;  3HT3 A;  1MU2 A;  3SYZ A;  1U48 A;  4CES A;  4BAC A;  1F21 A;  4N56 A;  4CJK A;  1WNS A;  5CZ2 A;  4DQQ A;  1RNH A;  4KRF A;  3MXM A;  3AVH A;  2GUI A;  3ZSO A;  3ZT0 A;  4B08 A;  1ITG A;  1JLF A;  1SV5 A;  2OPR A;  3CM5 A;  4DMN A;  2HMI A;  4CEO A;  1O1W A;  3ZSW A;  4DTJ A;  2G8W A;  4E1M A;  4HUG A;  1TL3 A;  5HLF A;  4J2B A;  3SUO A;  1J5O A;  4FJJ A;  3L3U A;  3WNF A;  1GOC A;  1VRU A;  1NOY A;  1HYS A;  4Y1C A;  3AA5 X;  2HVH A;  5KTQ A;  4IDK A;  1G15 A;  1NK8 A;  3U3Y A;  5CYQ A;  3ASM A;  4GMJ B;  4CJ5 A;  3VQQ A;  4DU1 A;  1W9H A;  3NF9 A;  4CJE A;  3ZSY A;  2YKN A;  4CGJ A;  3EYZ A;  1KLN A;  1KCF A;  4EZ6 A;  3TWH A;  1Z25 A;  4Q5V A;  2P51 A;  1NJW A;  1RT7 A;  1NK4 A;  4B8C A;  4CIF A;  4KB1 A;  3KK1 A;  1LW0 A;  4KHN A;  4RW6 A;  2ZQB A;  2IGI A;  1RTJ A;  3O3F A;  1DTQ A;  4I9Q A;  3KLG A;  1D9F A;  3KD5 E;  3ZT2 A;  4BDP A;  3HVT A;  3HK2 A;  4C8M A;  1QS4 A;  1VRT A;  5CY4 A;  1JL2 A;  2G8V A;  4DSL A;  5FRN A;  4H8K A;  1RTD A;  4C8K A;  3DRP A;  1TK0 A;  1HRH A;  2DY4 A;  3FFI A;  3K5L A;  4B9L A;  4HCB A;  2YNF A;  3NBP A;  4KHU A;  4W5O A;  1Q9X A;  1D8Y A;  3NF7 A;  3QNN A;  1IKV A;  1TV6 A;  1KVB A;  3AO2 A;  1NK6 A;  3MXJ A;  4Z4F A;  4DF4 A;  4LSL A;  1L3S A;  3KLF A;  4M3W A;  1FKP A;  1WSE A;  1KFD A;  4CGF A;  1VSK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...