4QOZB

Crystal structure of the histone mrna stem-loop, stem-loop binding protein (phosphorylated), and 3'hexo ternary complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
288
structure length
277
Chain Sequence
FSDPVYKEIAITNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMSYYDYICIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHTLEIEDTFQQYVRPEINTQLSDFCISLTGITQDQVDRADTFPQVLKKVIDWMKLKELGTKYKYSLLTDGSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVQTKLTIMLEKLGMDYDGRPHCGLDDSKNIARIAVRMLQDGCELRINEKMHAGQLMSVSSSLPIEGTPPPQMPHFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna/hydrolase/rna binding protein
molecule keywords histone mRNA stem-loop
publication title Molecular mechanisms for the regulation of histone mRNA stem-loop-binding protein by phosphorylation.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 277
sequence length 288
chains with identical sequence E
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00929 RNase_T Exonuclease
B PF02037 SAP SAP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4qozB02
3F9KA 3VA0A 4CEOA 3G10A 3AO1A 3NF7A 1W0HA 4LH5A 1Q8IA 4IG0A 4E1NA 4K8ZA 4CK2A 3DYAA 1LW2A 4AHRA 4M3TA 3QERA 4CEBA 5CZ2A 4FJGA 1VRTA 4B9MA 1ZYQA 4CEEA 3B6OA 2X78A 3NAEA 5HBMA 5KTQA 4FJHA 3PX4A 4L8RB 4DWIA 4B9SA 1BQNA 2OPRA 3CG7A 4FM1A 2ITGA 4YNQA 3RTVA 5EU7A 1U47A 1CZBA 3TAMA 3HYFA 3SZ2A 1JLFA 3DM2A 1GOBA 4EP4A 4QOZB 4E1MA 3QLHA 1W9HA 3OYGA 2VWKA 3TAFA 4K8XA 4DLGA 4IBNA 3QIOA 2HHVA 3SPYA 4QAGA 1ITGA 1HYSA 2VG6A 3ZSYA 1HQUA 3MXJA 4CFAA 4CJTA 3OYJA 1C1CA 4O4GA 2GBZA 3PY8A 2EHGA 3AO5A 3AA5X 1JL2A 2Y1JA 1JLAA 4CHOA 3HP9A 1WSEA 2ZE2A 4CIGA 3QNNA 1X9MA 2IC3A 2P5OA 3SUOA 3G0ZA 3OYNA 3LP1A 4CCHA 3PO5A 2IS3A 2F8TA 4ELTA 3ZSVA 4CJEA 3L3VA 1QE1A 3HSTB 3NGIA 4PWDA 1LV5A 3KKRA 2BGGA 1J54A 1BCOA 1RBRA 4ZTFA 4Z4IA 3DOKA 3V9UA 1HMVA 3DOLA 4N5SA 5J2QA 3SJJA 1IKXA 1N5YA 4CFCA 2D5RA 4G1QA 4CJVA 3LP3A 4DFJA 3SNNA 1C0TA 1NKBA 4H4MA 1LAWA 3V1QA 3AA4A 2YV0X 3THVA 2KFNA 1TL3A 5FDLA 3RMDA 1VSFA 4ID5A 3NH1A 4DSFA 2XO7A 3RR8A 2B6AA 3V9SA 4Y1CA 4DTUA 1XHZA 3AVJA 4KTZA 4KHSA 3HO1A 4CEQA 2XY5A 3KJVA 4E7JA 4W5RA 3DLBA 1HNVA 2JGUA 4FJMA 1VK0A 3DRPA 3L2WA 2VG7A 3CYMA 1LWFA 3TR8A 3V1RA 4DTXA 3AVHA 3OJUA 4DQIA 2P5GA 3OYIA 4KPYA 1Y97A 3BGRA 3AO3A 3QIPA 4CF2A 4DU4A 4HUEA 4HVJA 4KFBA 3AVGA 4I2QA 2F8SA 3QEPA 2P51A 1NJWA 4KTWA 5HROA 4NCAA 4PY5A 4I7FA 1VSHA 1RILA 3ZSWA 4FJ7A 1C0UA 2YNFA 2KZZA 3LPTA 4DFPA 3RWUA 3D0PA 5K14A 3OS2A 1HYZA 3OVNA 4F8RA 3V81A 3PV8A 3OS0A 1RTJA 3MEDA 1RT1A 4Z0UA 1A5VA 1C0MA 1KVCA 1KVAA 4AH9A 4BE1A 4B9LA 3AO2A 1ZBHA 1UOCA 2RKIA 4H4OA 4CEDA 4Z4GA 3LZIA 1U48A 4ID1A 1T03A 1XI1A 2OPSA 2ETJA 3DLGA 3QINA 3SUNA 1VSJA 3LWMA 4KREA 3OYFA 4ELUA 1NK8A 3ASMA 3OYAA 1UWBA 3NF8A 4CK1A 3HXMA 4FJ8A 3ISNC 4CF8A 4WE1A 4OVLA 4CGGA 4CHNA 1SKSA 3SV4A 4KHYA 1ASWA 2G8WA 1BI4A 1NKEA 1QS4A 3ZSQA 4OPKA 4E7HA 3ULDA 3V9ZA 1KCFA 5I3UA 2RF2A 1LWCA 3HM9A 1EETA 2OZMA 4M42A 4CK3A 5J2PA 4N76A 2WONA 4LY7A 3ALYA 5C25A 5C42A 2HHUA 3T1AA 3TAEA 4KB1A 2A1RA 4CJUA 3IG1A 4JS4A 1HRHA 3S9HA 4JS5A 3TABA 4FLWA 5FRMA 4MFBA 4E7KA 4FLUA 1TKXA 1D8YA 4ELVA 4F3OA 2E4LA 4BDPA 2XY8A 4FJJA 2A1SA 4DQSA 3IAYA 2JLEA 1RDAA 4OJRA 2FBTA 3CFPA 4EP5A 1RDCA 1IO2A 2Y1IA 4Z4FA 4KHNA 2F96A 2X74A 3VQ4A 4CIFA 1RT7A 3KK3A 1JLEA 1IKWA 3K5OA 3QO9A 1X1PA 4CGIA 3DMJA 2IOCA 4CFBA 3SUQA 1SUQA 4B3OA 4CGJA 2FBYA 4DLEA 3T19A 3WNEA 5FROA 2YKNA 3I0RA 4CEAA 4BWJA 3RRGA 4DS4A 3HPGA 3O4QA 4CHQA 1FK9A 2Z1GA 2IGIA 2WOMA 4RW7A 3VQCA 4CECA 1J5OA 4DSKA 5I42A 2KZMA 1I3AA 3TANA 4HUGA 2R7YA 3AO4A 1Z25A 5KRTA 4Z4EA 1JXBA 4C8NA 4M3UA 1UA1A 4FZYA 2XRIA 3NBPA 4OKJA 1CZ9A 4BWMA 1JLBA 3VQ8A 3NE6A 3K59A 3V9WA 3QNOA 1NK7A 1X9SA 3KK2A 2OPQA 1XC9A 4FLVA 4E0DA 1BGXT 4BACA 3SQ2A 4DTSA 1TKDA 1O1WA 3K5MA 1SV5A 2IDOA 3AVAA 3S3MA 1L3TA 3AV9A 5SZTA 3MXMA 2RPIA 3SYZA 3KIOA 2Z1JA 3NCIA 3QETA 1FKOA 1RT5A 1S9EA 2HNDA 1RT4A 2B4JA 4LSNA 3S3NA 5FRNA 2KTQA 4E3SA 3HPHA 3UIQA 3MEGA 5E41A 2KFZA 3S3OA 2PYJA 5KI6A 4LSLA 1D9DA 1C6VA 4J2DA 2G8HA 3P5JA 4Q5VA 3IRXA 2PZSA 1LW0A 3M8RA 1RT3A 3MEEA 1WNSA 1TKZA 4KV8A 3WNFA 1RTHA 1WAFA 3NDKA 2G8KA 1JL1A 2YKMA 3VQEA 4I2PA 3LWLA 1C1BA 3DLHA 2OYQA 5CYMA 4UQGA 3TWHA 4KB0A 3VQ6A 1KLMA 4OLBA 4F2RA 3DLRA 4M3RA 3ZSZA 3OYHA 3M8QA 4DS5A 5CYQA 1DTQA 2XY6A 4CE9A 4FK0A 1WSHA 2QXFA 4Y1DA 3MAQA 2VWJA 3PX6A 3HT3A 3KK1A 3TARA 4CFDA 3U6FA 3LANA 3OYBA 4W5QA 3KD1E 1VSMA 3OY9A 1RBUA 2HB5A 4FW1A 5JS2A 5KGXA 3NGZA 4CJWA 3JYTA 4KKOA 4J2AA 4E7LA 4BE2A 1YTAA 1NOZA 1ASUA 3O3HA 3LAKA 2IAJA 1KFDA 4CJQA 4F2SA 3VQQA 4RG8A 4ZHRA 4NYFA 4N56A 1ZBUA 3IS9A 3BDPA 2DY4A 3NFAA 3RMBA 4E89A 1SKRA 1VRUA 2ZQBA 2DFEA 1EXQA 1S9GA 4KRFA 1HNIA 4FW2A 4DTPA 2E6MA 4RW6A 3CQ8A 5HP1A 4CF1A 2HW3A 3SCXA 3M8PA 4M3YA 4DQQA 3LALA 2B5JA 2HMIA 1WLJA 1BL3A 4CJPA 4JLHA 5HLFA 1VSKA 4DTOA 3VQ9A 3A2FA 1U49A 1JLCA 4CJRA 2E6LA 1DLOA 4KHWA 2LSNA 3JSMA 2HVIA 1SL1A 3WNHA 1D9FA 4C8OA 1VSDA 3RR7A 3OJSA 1RDBA 1C1AA 4FYDA 2Z1IA 3O3FA 4HUFA 1Q9YA 2QKBA 3VQAA 3D45A 2O4IA 1R0AA 4KAZA 4FZZA 1ZBIA 4HHTA 2X6NA 4FLXA 1GOAA 3RMAA 3NHGA 3OYMA 3ZT0A 4DG1A 4Q0BA 1CXQA 3I8DA 5KGWA 2GV9A 4DTJA 4B9NA 4I9QA 4OGEA 4Z4CA 3L2QA 3HK2A 3AA2A 3OYLA 1VSLA 4EZ6A 2YNGA 3AVLA 1T7PA 4HCCA 3V4IA 1WSIA 4N41A 3L2RA 1VSIA 1T8EA 1JXEA 1RBTA 4EZ9A 1BCMA 3CFOA 5J1EA 1B92A 3NF6A 4FJKA 1IKYA 4RW4A 1NJXA 3NH2A 3EY1A 1L3SA 3DRSA 4Z4HA 4CHYA 4M45A 1BISA 3AVIA 2AJQA 4W5TA 4CGFA 4M41A 1TV6A 3K2PA 1HPZA 3TI0A 1TVRA 2HNZA 3VQPA 1TK5A 1RTDA 4FJIA 4LD0A 3ZSRA 4JRPA 3QESA 4O55A 3OYEA 3B6PA 2ZD1A 4IDKA 4FJXA 4FLZA 3AVCA 4OKKA 3ZT2A 3K5LA 3QEWA 4B8CA 3AVNA 3VA3A 3KLFA 1L5UA 2OZSA 1BHLA 3V6DA 1CLQA 3HP6A 4KHQA 1CXUA 2OPPA 3VQ5A 4DSIA 2KW4A 4AHCA 2YNIA 4O0JA 1G15A 4CEFA 3I0SA 2HHQA 3C6TA 3VQ7A 2D0AA 1RT2A 3DI6A 3PUFA 4CJ4A 4KTQA 3TAQA 3CM6A 4C8KA 4O0IA 3L3UA 3OYKA 4KHUA 3MECA 3K58A 1KRPA 2O4GA 4CHZA 3SQ4A 4O5BA 4FM0A 4BDYA 1TAUA 1BIZA 4MQ3A 3NGYA 4CJ3A 1ZBLA 4F4KA 3AVFA 4OLAA 1RBSA 2YHBA 2VG5A 3ZT4A 1ASVA 4DSLA 2DFFA 3LP0A 4GMJB 1GOCA 3VN5A 1Q9XA 2XY7A 1UA0A 2HHWA 1WN7A 4JRQA 1RDDA 4PA1A 3ZSOA 3ITHA 3V9XA 5HRSA 1F21A 2FC0A 3LDSA 1J9AA 2EX3A 4FJ5A 1T05A 3E01A 4DF4A 1RNHA 3VQDA 3HPOA 3SUPA 3MXIA 1QTMA 4AHUA 1U45A 1IKVA 1X9WA 4M3XA 3L2VA 3TAGA 4DFKA 1U4BA 4H8KA 4N47A 1RBVA 1LWEA 4AHVA 1TK8A 4LH4A 4FLTA 4QCLA 4ZTJA 1A5WA 2ATQA 1NKCA 2QKKA 3AVMA 3LPUA 4J2EA 5CY4A 1JLQA 3KLGA 3HVTA 4YFUA 4OGCA 4CJKA 2G8VA 2BDPA 4CJLA 1SL0A 3OYCA 4FCYA 4NCBA 4IFVA 1YT3A 3OYDA 3O4NA 4O44A 1S1WA 1I39A 1HYVA 3DLEA 4IFYA 4FJLA 1REVA 3WNGA 1U04A 1NK5A 3O3GA 1QSYA 5DMRA 3EYZA 1HJRA 2P1JA 5HRRA 4DU1A 4CJSA 1NK9A 3FFIA 3ZCMA 4FJNA 3C6UA 3K5NA 3PX0A 4W5NA 4E19A 1S1UA 1YTUA 2BANA 4OKEA 4FJ9A 1NJZA 2PY5A 1TKTA 2PYLA 3P83D 1B9FA 4E7IA 3LZJA 3F73A 3KLIA 4IG3A 1S1VA 4HTUA 1FKPA 1EKEA 4AHSA 3SV3A 2G8IA 4KI6A 5T7BA 4DF8A 3SQ0A 2W42A 1SKWA 2D0CA 3ZT3A 3NH0A 4FM2A 3HL8A 4M3WA 4C8MA 1VSEA 4CGDA 1A5XA 4IKFA 4NCGA 2HHSA 2I5JA 2X6SA 3V1OA 3LP2A 1KFSA 1UAXA 2DTUA 2Z1HA 4CF9A 2YHAA 1WSFA 1WSGA 1D5AA 3QEVA 1YVUA 5DK5A 3HVRA 4DQRA 1NOYA 4DU3A 5HRPA 3KLHA 1S1TA 5KRSA 4CJ5A 3L2UA 1KLNA 2OA8A 3SI6A 4DFMA 4KI4A 1Z26A 2YNHA 4RW8A 3P1GA 3DLKA 4BE0A 1N6QA 2D0BA 3LAMA 3NF9A 5C24A 3ZT1A 1L3UA 3SPZA 1JKHA 1S6PA 4DMNA 4J2BA 1TAQA 4CERA 1EX4A 2DFHA 1JLGA 2RN2A 3H08A 4OPJA 2BE2A 1EP4A 3KD5E 4GW6A 3KTQA 3AVBA 1TGOA 1XWLA 3T3FA 4B9UA 4FZXC 4BDZA 4CJFA 1XHXA 1RCHA 4R5PA 1S6QA 1SL2A 4CF0A 2FBVA 3OS1A 4FXDA 4ICLA 5HRNA 4DSEA 3ZSXA 2QK9A 5D3GA 1IH7A 4W5OA 1ZBFA 1KVBA 3RRHA 1K6YA 4B8AB 4FK4A 3U3YA 4DTRA 3M8SA 1RTIA 4DSJA 5SWMA 4CIEA 4FVMA 2Q3SA 1NK4A 1QSSA 2FBXA 5JS1A 1QSLA 4GVMA 2HNYA 4HCBA 4PQUA 1WSJA 1QHTA 1S5JA 4KO0A 4I9LA 4M3ZA 2HHTA 3K57A 4B9TA 1NK0A 2XHBA 4FLYA 4CEZA 4DTMA 4CGHA 1WAJA 3C94A 4RW9A 3EZ5A 3QEXA 1L3VA 3HJFA 4AHTA 3CFRA 3CM5A 1LAVA 1MU2A 1BI4B 3TAPA 3C95A 1TK0A 1RT6A 1BQMA 1IG9A 1DTTA 5CZ1A 2GUIA 4AILC 1BIUA 3PO4A 4PUOA 3L8BA 4DTNA 3RMCA 1QQCA 4CESA 5J2MA 1NK6A 2G8FA 4B9VA 2HHXA 3QEIA 4CHPA 3DRRA 1NJYA 2KQ2A 4DQPA 3U3GA 4XIUA 3AVKA 2G8UA 4C8LA 2NUBA 2HVHA 1J53A 1S1XA 3AA3A 4TSXA 4F3TA 1HQEA 3VQBA 4NYNA 1B9DA 1KSPA 4FK2A 3KKSA 1KTQA 4B08A 1TL1A 1FXXA 3KLEA 5J2NA 3SQ1A
chains in the Genus database with same CATH superfamily
4ILHA 3F9KA 4BVOA 2BTFA 1W0HA 1BG3A 4CEBA 4FJGA 1VRTA 4B9MA 3NAEA 5KTQA 4DWIA 3ENOA 4B9SA 1Q82O 2QEXN 1U47A 1CZBA 3P38A 2F7TA 5CR4A 4EIAA 1JLFA 3QLHA 4DV4K 4IBNA 4C23A 4B1VA 4QAGA 1HYSA 1NGCA 2PFUA 4CFAA 1C1CA 3PY8A 1JL2A 3VERA 4CIGA 3J7YP 4YDUA 3FZKA 3E9LA 3OYNA 4BC5A 1C0GA 5BN8A 2IS3A 5AZJA 1N34K 1OKJA 4BRPA 1QE1A 2QI2A 1BCOA 4ZTFA 3NVMA 4XH1A 3DOKA 2NRHA 3SJJA 1VQPN 4CJVA 4BC2A 1Z05A 4DFJA 1YVNA 1HUXA 1LAWA 1SAZA 3A5MC 3THVA 2KFNA 1TL3A 3PIPL 5FDLA 3RMDA 4ID5A 3NH1A 5AZIB 4Y1CA 4KTZA 3HO1A 2W41A 1NMNA 4JKAA 4W5RA 3CYMA 1S3XA 3AVHA 3OJUA 3T1HK 2P5GA 4CF2A 3QIPA 3AO3A 1IV0A 2I7NA 4I2QA 3QEPA 5HROA 4PY5A 2NRWA 3ZSWA 2YNFA 3D0PA 4ISEA 4F8RA 4GV3A 1EO1A 1RT1A 3P31A 4CBUA 1KVCA 1KVAA 4BE1A 1C0FA 1W97L 4B9LA 3RSEA 4CEDA 4K0KK 3IUCA 3CJ9A 3DLGA 3QINA 3K9KA 3SUNA 1VSJA 1NG9A 4KREA 3ASMA 2NZTA 4WE1A 4KHYA 3CC2N 4NXNK 3DLLL 4OPKA 2OCEA 3MN6A 1KCFA 3V9ZA 3EKUA 2WONA 3VMFB 4LY7A 5C25A 2A1RA 3S9HA 3MCAB 2E2NA 3TABA 2OANA 4FWLA 1D8YA 4ELVA 4F3OA 1KXPA 4JV5K 2A1SA 4DQSA 3IAYA 4OJRA 2FBTA 2P9KB 4EP5A 1RDCA 1IO2A 3DMJA 4B3OA 2FBYA 3T19A 1T3VA 1JCGA 4CEAA 3A5NC 1LCUA 3EN9A 3J7ZO 2UXDK 4YORA 5I42A 3TANA 3ZX3A 2YHXA 3MX5A 4Z4EA 4M3UA 1QQOA 4FZYA 1CZ9A 3V9WA 2P9NA 3KK2A 3Q7CA 1BGXT 5DM7L 4IOXA 1Q86O 1O1WA 3K5MA 1IBKK 1SV5A 3AVAA 3CQYA 1L3TA 3AV9A 5FPDA 4MLEA 3KIOA 5FRNA 5LJVA 4YOUA 4E3SA 3UIQA 5M1QA 2KFZA 4H03B 2RHKA 2O8FA 3S3OA 2PYJA 1HNWK 4CD1A 3M8RA 4LF5K 3MEEA 2WC9A 2G8KA 1WBDA 4KHUA 1C1BA 2OYQA 4UQGA 3VPZA 1KLMA 4F2RA 3FFKB 3DLRA 4M3RA 3ZSZA 3HOSA 1KAYA 4CE9A 1WSHA 2QXFA 3ID8A 3HT3A 4CFDA 1G99A 3OY9A 5KGXA 2HB5A 5BPNA 3JYTA 4CJWA 4JKHA 1VQ6N 1EWRA 5FLXO 3A0IX 4BRQA 2D0OA 2Q2RA 3LAKA 2IAJA 2O8BB 4N56A 3NFAA 2DFEA 3CPWM 4RW6A 2A6AA 4LF8K 3WXKA 5GADP 3LALA 1BL3A 4GY2B 1VSKA 3HI0A 3A2FA 2E6LA 1SL1A 3WNHA 4NLCA 2Z1IA 3N4QA 4LF9K 4KBOA 4DV0K 1Q81O 4HHTA 2QWRA 3OYMA 3NHGA 4DG1A 4Q0BA 3IFRA 5KGWA 1JJ2M 1YJWN 2QW9A 5KQ8A 3HK2A 3AA2A 3F5TA 5HOOA 2E8AA 2YJFA 1JXEA 4J8FA 3CFOA 1B92A 4H0OA 3NF6A 4FJKA 3GL1A 4FWOA 4RW4A 2QWOA 5AQNA 5BRFA 4Z4HA 4CHYA 3I8BA 5AQYA 1BISA 4M41A 3QBWA 3U9ZA 3VQPA 2JWLA 2Q0RA 4IDKA 2W6KA 4FPBA 3QEWA 3CCLN 4JNEA 2UU9K 3VA3A 3T69A 4B1WB 2QXLA 4DQ8A 3V6DA 1GLFO 1NU0A 1YUWA 3HP6A 4HTLA 4AHCA 2UUBK 5AQJA 1VQMN 3VQ7A 3DI6A 3FZMA 3CM6A 3WUHA 4C8KA 3OYKA 3K58A 1K8KA 1H1VA 4MQ3A 2HBLA 5M1FA 3AVFA 4OLAA 1RBSA 4DSLA 4IDHA 4JRQA 3T7ZA 4MLHA 5HRSA 1J9AA 2EX3A 3E01A 4DF4A 1RNHA 3GBTA 3QDKA 3SUPA 3IDHA 1U45A 4M3XA 1HPMA 1RBVA 4AHVA 1IG8A 3VGKA 4QCLA 1NKCA 2QKKA 3TPQA 1N32K 4CZGA 5CY4A 4YOTA 3HVTA 4YFUA 1NGBA 2KLAA 4OGCA 4LF6K 4BR9A 4NCBA 4IFVA 4WF9L 3O9TA 4O44A 1S1WA 1I39A 3DLEA 4IFYA 1FJGK 3O3GA 1QSYA 5HRRA 5AQWA 3CJCA 5H1SQ 3ID6A 4E19A 1MDUB 1NGIA 3SMPA 5AQRA 3AAQA 1TKTA 3L4IA 4G9ZA 4A2BA 3E1YA 1X3NA 3F73A 4IG3A 4MO5A 3D6RA 1FKPA 1W7AA 3SV3A 5KPZA 3SQ0A 2W42A 3BEXA 1SKWA 4FM2A 4FSVA 3TTFA 1A5XA 4NCGA 3UKUA 1KD1O 3H1QA 4AM7A 3LP2A 1KFSA 4CF9A 1WSGA 1D5AA 4QS8A 4DQRA 3F2KA 4DU3A 1S1TA 3L2UA 2OA8A 3VEOA 3SI6A 4X64K 1KAZA 4FVUA 3WQTA 2UUCK 2P9UB 3LDQA 1L3UA 1S6PA 4J2BA 5EOYA 1TAQA 3EE9A 4CERA 1EX4A 1HJOA 1E3MA 3KD5E 3QBXA 1YJ9N 4C1NK 4BDZA 4X65K 4R5PA 1S6QA 4CF0A 2FF3B 3ZSXA 3UE5A 5JICA 5HL7L 4CD3A 3U3YA 3M8SA 4BR5A 3SK3A 4DSJA 1NNEA 2VWBA 5JVGL 1QSLA 4GVMA 1WSJA 4B3SK 3BF1A 3C94A 3VETA 2E2QA 1MU2A 2ZJPL 3C95A 2CGLA 1BIUA 5AQZA 3L8BA 1RFQA 2KQ2A 3D7EO 1HQEA 3WT0A 1YHQN 2QTDA 3FZHA 2O8EB 4B08A 1Q18A 2QWPA 3U9DA 5CE3A 4DR3K 3M1FA 5C2DA 4LH5A 1Q8IA 3H46O 3LDPA 4X66K 1OH6A 1QVFM 1LW2A 4AHRA 3LM9A 2WUSA 2A3ZA 2X78A 5F1XA 3WXMB 1BQNA 2OPRA 3KVGA 5AQTA 4YNQA 2J4RA 4H5RA 5AQQA 3CCEN 3EL2A 3DM2A 4DR2K 1GOBA 1NMDA 1VQNN 3SBGA 1ILYA 3L0QA 2VWKA 5F0XA 4DLGA 2HHVA 1ITGA 3ZSYA 1HQUA 3MXJA 3OYJA 2EHGA 2Y1JA 1JLAA 3BF3A 2ZE2A 3CC4N 3QB0A 2E1ZA 3G0ZA 2F8TA 4CJEA 3O80A 4KH5A 1DEJA 3NGIA 4PWDA 3KKRA 1RGIA 1HNXK 3DOLA 2NNWA 4JK8A 3F9MA 2D5RA 4XH5A 4U67L 4KHPK 1VQKN 3V1QA 1NGDA 4K25A 1YIJN 4FWNA 5LMUK 5BR9A 3J81O 2XO7A 3D2EB 2W6LA 3BP8A 5EXWA 4RCHA 4IO9L 3L2WA 2VG7A 3V1RA 4YOVA 3TR8A 4DQIA 4L3QA 4KPYA 3BGRA 2ZJRL 4DU4A 3CMAN 4HUEA 4HVJA 4KFBA 4IEIA 4KTWA 1GLBG 2ASMA 4NCAA 4I7FA 1VSHA 1C0UA 2IVOA 3LPTA 3OS2A 3W3DA 4E1JA 3ZLJA 2Q0UA 3TSPA 1M90O 2RKIA 4Z4GA 1U48A 3O9UA 3TU5A 2OPSA 4GV6A 3RSEB 3LWMA 5GINA 4ELUA 1DKGD 3OYAA 1UWBA 3SV4A 4BREA 1ASWA 1M1KO 1NKEA 1QS4A 2A5XA 4K43A 5I3UA 1LWCA 3C0BA 4JI2K 3S41A 3HZ6A 4BRNA 4CJUA 3IG1A 4JS4A 1HRHA 2WBNA 4WCEL 4E7KA 4FLUA 5LMNK 2XY8A 3CFPA 2Y1IA 2F96A 2X74A 4CIFA 3E66A 1JLEA 3QO9A 4CFBA 4EFHA 1VQ5N 3E9PA 2IOCA 2ASPA 3J80O 3G71N 1NWKA 4NB4A 4CGJA 1N8RO 1QQNA 5ADXH 4H0TB 5GIOA 3KWGA 2A41A 1J5OA 3EEQA 4RW7A 3I33A 2KZMA 1I3AA 1VQ7N 3MK6A 3AO4A 1Z25A 5C2FA 3VESA 1UA1A 1LOTB 4OKJA 4BWMA 3VQ8A 1NK7A 1X9SA 1KAXA 2ZM6K 1TKDA 2P9NB 5SZTA 3SYZA 1HKBA 2WTUA 1S9EA 1HKCA 1RT4A 2B4JA 3HPHA 4LC9B 1NGGA 1DGKN 1V4SA 3T1YK 5KI6A 4J2DA 2ZF5O 2O8FB 3P5JA 4Q5VA 1JCFA 1RT3A 4BR4A 3SMSA 1TKZA 4K42A 3WNFA 1WAFA 4H0VB 4YY3K 4I2PA 4KB0A 3VQ6A 4JN4A 4OLBA 3OYHA 4YHHK 3DXKB 2VWJA 2NRZA 3U6FA 3LANA 3OHRA 4U7BA 1BA1A 3KD1E 3D2EA 4BGAA 4OPAA 4JKEA 4BE2A 4DV7K 4F2SA 3VQQA 4RG8A 4JYAK 3MN7A 4E89A 2ZQBA 1DT9A 1S9GA 1OVQA 2E6MA 1K9MO 5HP1A 4CZJA 3I56N 4BR2A 2HMIA 1YXQA 3VF6A 2CGKA 4FL9A 4DTOA 2VQEK 1U49A 4KHWA 3GOIA 3H3NO 1D9FA 4DV2K 4DR6K 3FZLA 1S22A 3O3FA 1Q9YA 3M3ZA 3VQAA 2YHWA 4KAZA 4WQ4C 1GOAA 3D2FB 4I6MA 4OGEA 5LY3A 2O8CB 3OYLA 2YNGA 1T7PA 4HCCA 3ZEUA 4ILGB 2OTJN 3U8XA 3EZWA 1NJXA 3QMLA 3NH2A 3EY1A 5ELZA 4M45A 3CQXA 4W5TA 4CGFA 1TV6A 1HPZA 2CH6A 1BU6O 2A40A 4FJXA 3TSUA 3TTCA 4FLZA 3AVCA 3ZT2A 3R8EA 1J5EK 1CXUA 2OPPA 2HHQA 2D0AA 3PUFA 4O0IA 3L3UA 1KRPA 4CHZA 3WQUA 5JLHA 3ZYYX 4A5AA 1K8KB 1ZBLA 2YHBA 1Q9XA 3LP0A 3CJBA 2XY7A 5LJWA 1UA0A 4Y0WA 2E2OA 3G6EN 1F21A 2FC0A 4YOYA 1XQSC 3VQDA 3MXIA 3QFPA 3JXUA 3O1BA 4AHUA 3VOVA 3WXLA 3MWTA 4DFKA 4N47A 1LWEA 4ISGA 2GELA 3BUZB 4FOEA 3AVMA 3LPUA 1JLQA 2E20A 2QWQA 2E2PA 5C15A 4CZKA 2G8VA 2BDPA 4CJLA 4JD2A 3DXKA 4DHYA 3OYDA 4JI8K 4B1YB 4H5WA 2YJEA 4FJLA 5BREA 1NK9A 4FWRA 4YOXA 1MWKA 3ZCMA 3THXB 4WFAL 3ZX0A 3CI5A 2PY5A 2QWMA 3SAGA 4BROA 4IZ9A 3LZJA 4AHSA 1EKEA 1K8AO 3A5OC 3J8AA 3KZBA 4BY9C 4B3MK 3ZT3A 2P9SB 4JKBA 4DV1K 4C8MA 4M3WA 4LFBK 4CGDA 3BZCA 5AR0A 1ZBSA 4CZIA 3UKUB 5IT9O 3PIOL 1YVUA 3KWIA 4H5TA 1NOYA 4OO1J 5HRPA 3KLHA 5KRSA 1KLNA 4DFMA 2QA4N 3L4QA 4A2AA 2D0BA 4FOIA 3NF9A 5C24A 3SPZA 1JKHA 3D2FA 2RE2A 2YCHA 2E5LK 2RN2A 3H08A 2O8CA 4OPJA 4GW6A 4C1NI 3KTQA 3AVBA 1XWLA 1RDUA 2UYTA 1XHXA 1RCHA 3GE1A 1SL2A 4FXDA 4DSEA 1IH7A 1KVBA 1GLAG 1Z6RA 1RTIA 3NVKA 1IBMK 1P90A 4RWTA 4HCBA 1QHTA 1S5JA 3EE8A 4I9LA 4FPAA 2HHTA 4DTMA 1L3VA 3EZ5A 2OTLN 4RW9A 1U2VB 4AHTA 3RVCA 2UUAK 1RT6A 4AILC 2F9WA 3PO4A 2G8FA 1QQCA 3EKSA 4CESA 3QEIA 5AQSA 3AVKA 3A8YA 2G8UA 2NUBA 2HVHA 1J53A 3AA3A 4TSXA 5AQMA 3VQBA 4CI6A 3AY9A 4NYNA 1EWQA 2EWSA 3KKSA 3SQ1A 2FSJA 1FXXA 2QWLA 4CZEA 1R0AA 5FRMA 4DCHA 3VA0A 3AO1A 4EHUA 2GTDA 1KQSM 4BGBA 5FPEA 4E1NA 4BG9A 4K8ZA 3DYAA 5CZ2A 4CEEA 3B6OA 4FWSA 3PX4A 4BRKA 3CG7A 4FM1A 2KHOA 3RTVA 3O5BA 3TAMA 2HSTA 3SZ2A 4EP4A 4A5BA 1W9HA 5M1KA 2GUPA 3TAFA 4K8XA 1HR0K 3QIOA 3SPYA 1ZC6A 5GAHP 2PAVA 2GBZA 4GKJK 1X9MA 4CHOA 3HP9A 4M7YA 3THXA 5EX5A 2H3GX 5KPRA 4CJ7A 3LP1A 4CCHA 3ZSVA 2GWJA 3HBTA 1QZ6A 3HSTB 2GX9A 2BGGA 1XUPO 1RBRA 2GWKA 4N5SA 1IKXA 3U4LA 2P9SA 4JI6K 4G1QA 3LP3A 1R59O 4WQ5C 3AGKA 1MWMA 3SNNA 1NKBA 1BUPA 3AA4A 5AQIA 3FLCO 1VSFA 4DSFA 3RR8A 2B6AA 3V9SA 1XHZA 3AVJA 4BG8A 4KHSA 3CF5L 4CEQA 4E7JA 1HNVA 1W2BM 1VK0A 3DRPA 4DTXA 1LWFA 4DUZK 3OYIA 3AVGA 2P51A 1NJWA 1GLLO 4CZHA 4FJ7A 3PSIA 4QS7A 4DFPA 3RWUA 2VGMA 3M6GA 5K14A 3OVNA 3V81A 1QZ5A 2PBDA 1NGAA 3MEDA 4Z0UA 1A5VA 3JS6A 4AH9A 2UXCK 3AO2A 1UOCA 4DR4K 2V7ZA 2ASOA 3LZIA 1T03A 1XI1A 3O9RA 1HKGA 3OYFA 2F4VK 1NBWA 4Z4FA 3HXMA 4FJ8A 3NF8A 4JI7K 1U2VA 4IOAL 4CHNA 5M1OA 3SAHA 1RDWX 4PL7A 3ULEA 5E84A 3ZSQA 4EAHD 3HM9A 1EETA 4M42A 5J2PA 4N76A 2BUPA 3T1AA 3TAEA 4JHDA 1Y64A 4CBXA 2E4LA 4FJJA 3ZETB 4KHNA 4JKGB 1GLEG 3KK3A 4CZLA 3K5OA 1X1PA 3SUQA 1SUQA 2HBKA 3WNEA 1YI2N 3I0RA 4BWJA 4JI4K 3RRGA 3HPGA 1FK9A 2V7YA 2Z1GA 2WOMA 4CECA 4DSKA 4HUGA 4BRAA 5KRTA 3L6QA 1XMQK 1T6DA 4MO4A 4C8NA 4BR7A 3QNOA 1JLBA 3K59A 2AP1A 1BOTO 3R3LA 2OPQA 3OBWA 4FLVA 4WYBA 4BACA 4DTSA 2FF6A 4BVPA 5A2QO 4BRDA 3SBTA 2RPIA 4BRMA 1NGEA 3NCIA 1D4XA 4GV9A 3S3NA 2HF4A 4JKCA 5BR8K 5E41A 3WEEA 3IMXA 4LSLA 1MA9B 5BPMA 1U6ZA 4CBWA 2G8HA 3IRXA 3LDOA 1HLUA 2IIRA 1WNSA 1JL1A 3VQEA 3LL3A 3DLHA 3LWLA 3TWHA 1OH5A 3M8QA 5CYQA 1DTQA 2V51B 3M5RA 5AFUA 5BN9A 4Y1DA 3MAQA 2VQFK 4FK0A 5C10A 3KK1A 3OYBA 4W5QA 1VSMA 1SZ2A 4J2AA 5FPNA 4KKOA 2HMPA 1KC8O 4E7LA 1XNQK 1YTAA 1YJNN 3O3HA 4ZHRA 2HOEA 3CCQN 3IS9A 3H1VX 1SKRA 1V4TA 1VRUA 4KRFA 4FW2A 4DTPA 3VEXA 1SQKA 3CQ8A 4CF1A 3SCXA 1WUAA 4JKFA 2B5JA 1HNZK 1WLJA 4JLHA 3MX2A 3VQ9A 1JLCA 1DLOA 2LSNA 4JK7A 2HVIA 4PKGA 2YX6A 1VSDA 4XH4A 4A62A 3IKMA 3OJSA 1C1AA 2YHYA 3OBYA 2O4IA 1VQ9N 4FZZA 2X6NA 1VQ8N 4FLXA 3ZX2A 4FWKA 1CXQA 3O1WA 4IXCA 4MDBA 5ADXA 4ISFA 3I8DA 4DTJA 4B9NA 3THWA 1OH7A 1VSLA 4I6MB 4PL8A 3AVLA 2HHHK 2NRTA 4QS9A 3VEZA 3C6HA 3V4IA 4BC3A 4NLBA 1ATNA 3O6WA 1VSIA 3L2RA 2FLOA 1T8EA 4EZ9A 2D4WA 3ZEUB 3J7AP 1FW6A 2FSNA 4H0PA 5AQGA 1T6CA 1VHXA 4HWIA 2QM1A 3AVIA 2AJQA 2G8WA 3K2PA 3TI0A 4DUYK 2HNZA 3ZETA 3Q7BA 1RTDA 4LD0A 3ZSRA 4JKGA 4M63C 4OX9K 3QESA 3B6PA 2ZD1A 5LL6Z 4OKKA 4WQ4A 4B8CA 4X62K 3K0SA 1VQ4N 4DSIA 2KW4A 4CEFA 5AJ3K 3I0SA 4O8UA 4NO7A 2GEMA 1WBBA 4MDAA 2O4GA 3SQ4A 4FM0A 3C7NB 3QICA 3OTOK 1EQYA 4DV6K 1BIZA 3PSFA 4F4KA 5TKWA 1TYQB 4ILJA 1VQON 3P39A 1ASVA 4BRCA 3MN9A 4KHQA 2HHWA 5JMVA 2ITMA 3LDSA 5BRHA 4DKWA 3TAGA 5BRDA 3H3OB 3PLAA 4LH4A 4ZTJA 1A5WA 2ATQA 2Q97A 3KHYA 3KK7A 2VCPA 4J2EA 3CCVN 2NRRA 3ENBA 4BRIA 1VQLN 4CJKA 4UY8O 4IOCL 1SL0A 3O4NA 4JD2B 1HYVA 4JK9A 4IJAA 3WNGA 1U04A 1HJRA 2V52B 3FFIA 4FJNA 4W5NA 1S1UA 1YTUA 4FJ9A 2IVPA 1X9JA 3THYB 3NMUA 5MLCQ 3KLIA 1S1VA 4HTUA 3DXMA 2D0CA 3HL8A 4IKFA 5GAEP 3CHWA 1E4FT 2DTUA 2Z1HA 5DK5A 5BPLA 4XEIA 4CJ5A 4KI4A 1Z26A 2YNHA 2CGJA 1N6QA 4LFCK 3LAMA 3ZT1A 3LM2A 3O8MA 1TUYA 4DMNA 5EVZA 5I9EB 2DFHA 2HF3A 1I94K 3HOTA 4FZXC 3DAWA 4CJFA 1GLJO 4W5OA 3RRHA 4AF1A 4B8AB 3TSQA 2P9LA 4JI1K 4FVMA 5SWMA 2Q3SA 1NK4A 2WFBA 2HNYA 3LDLA 5IWAK 3BZKA 3I55N 4PQUA 4KO0A 4M3ZA 4DV3K 3K57A 4BRGA 1NK0A 3CETA 3QEXA 1NJIO 3GDQA 3CFRA 3C65A 3TAPA 1BI4B 1TK0A 1DTTA 5CZ1A 2ZWHA 2P9PB 4DTNA 2HHXA 5J2MA 5AQPA 5TKYA 3C7NA 1NJYA 4DQPA 3U3GA 2O8DA 4C8LA 2Q1NA 1S1XA 3AARA 3CJ7A 1XC3A 1TYQA 1B9DA 1KSPA 3VEVA 1KTQA 5B8HA 3KLEA 5CHIA 4CEOA 3G10A 4FO0A 4YDUC 3NF7A 1N33K 4IG0A 3GG4A 4CK2A 3CIPA 4M3TA 3QERA 1ZYQA 3JAMO 5HBMA 4L8RB 4FJHA 4IO8A 2ITGA 5EU7A 3HYFA 1HX1A 4QOZB 4E1MA 3ENHA 3OYGA 5M1NA 4KH6A 5DM6L 2VG6A 2YI1A 4PKIA 4B3TK 4CJTA 4O4GA 3AAPA 3AO5A 3AA5X 3SJHA 4A59A 3QNNA 1GLDG 1WSEA 4IWVA 2IC3A 2P5OA 3SUOA 3PO5A 3HTVA 4ELTA 3L3VA 5AQFA 1LV5A 3THYA 5AQHA 1J54A 4O5FA 4F9OA 3VTIA 4Z4IA 5J2QA 3V9UA 1HMVA 1N5YA 4CFCA 1QQMA 4AM6A 1T44A 3P4IA 1C0TA 4H4MA 4H5VA 4H0XB 1XMOK 2YV0X 1GLCG 3FGUA 5AZIA 3R6MA 3N4PA 3H45C 1OH8A 4DTUA 1J6ZA 4IJNA 2XY5A 3KJVA 5AQOA 3DLBA 4FJMA 2JGUA 3CD6N 1P8ZA 1Y97A 3MCPA 3CPEA 2F8SA 4JI3K 3LDNA 1RILA 2I7PA 4WQ5A 2KZZA 2NRVA 1ESVA 1HYZA 1K73O 3PV8A 3OS0A 1RTJA 3OA9A 1C0MA 3VGMA 1IBLK 1ZBHA 4H4OA 4ID1A 4B1XB 2ZGYA 2ETJA 5E26A 2Q36A 4B1ZA 1NK8A 4CK1A 3ISNC 4CF8A 4CGGA 4OVLA 1SKSA 1TUUA 1WB9A 1BI4A 1IJJA 3O08A 4E7HA 3ULDA 3ULEB 2P9PA 2RF2A 2OZMA 4CK3A 4BC4A 3ALYA 5C42A 2HHUA 4KB1A 4A61A 4V19S 4JS5A 3MWPA 3HM8A 1BDGA 2ZJQL 4FLWA 4JHDB 4MFBA 1BWFO 2P9KA 1TKXA 4B3RK 4BDPA 2JLEA 1RDAA 3VQ4A 1RT7A 4CGIA 1IKWA 4BR0A 4GVEA 4BRLA 4DLEA 5FROA 2YKNA 2IVNA 4CVNE 4WFBL 3VTHA 2E1YA 4M7XA 4DS4A 3O4QA 4CHQA 5JLFA 2IGIA 4AQYK 3VQCA 5GIPA 2HBJA 2CH5A 2R7YA 4BQLA 4DR7K 1JXBA 2XRIA 3NBPA 3NE6A 4JI5K 1XC9A 4E0DA 2A42A 1NLVA 3AGRA 3SQ2A 2IDOA 3S3MA 4DR1K 3WXIA 3MXMA 2Z1JA 3QETA 4LSNA 1FKOA 1RT5A 2HNDA 3R9PA 2KTQA 2P9IB 3MEGA 5KQDA 1D9DA 1C6VA 3WEEB 2AA4A 2PZSA 4PHTX 1LW0A 5EY4A 4KV8A 1RTHA 5KPTA 3NDKA 2YKMA 5FPMA 3CERA 4JEPA 5CYMA 4YOWA 4DS5A 2XY6A 1E4GT 3FZFA 3PX6A 3TARA 2QWNA 3C6AA 1RBUA 4FW1A 5JS2A 3UKRB 3NGZA 1QHAA 1BA0A 3VF2A 1NOZA 1ASUA 2O8BA 1KFDA 4CJQA 4NYFA 4CZMA 1ZBUA 4BRFA 3BDPA 2DY4A 3RMBA 1N36K 1EXQA 3QFUA 1HNIA 5M1PA 4IEEA 3ATUA 2HW3A 4H0YB 3M8PA 4M3YA 4DQQA 4JI0K 3WXJA 1SS6A 1CZAN 3CJAA 2JWKA 4JKDA 4CJPA 1VAZA 5C12A 4LF4K 5HLFA 2E88A 3OW2M 4CJRA 3VGLA 3JSMA 4C8OA 3RR7A 1RDBA 4FYDA 4B9QA 4HUFA 2QKBA 3D45A 4FWQA 1ZBIA 3O4WA 3RMAA 5AQLA 3CCSN 3ZT0A 1QVGM 4I9QA 2GV9A 1NGHA 4Z4CA 3L2QA 3MMVA 4IFEA 1ZXOA 4EZ6A 4H5NA 2ZGZA 3THWB 1WSIA 4N41A 1RBTA 1BCMA 1S72N 5J1EA 3ATVA 1IKYA 4WFNL 2BH1A 1L3SA 3DRSA 3SLCA 1TK5A 3E9OA 5GAGP 1TVRA 4FJIA 4GNIA 4JRPA 4O55A 3OYEA 4BRHA 4FWMA 3K5LA 3AVNA 3KLFA 4DV5K 1L5UA 2OZSA 1BHLA 1CLQA 3VQ5A 2YNIA 4O0JA 1G15A 3C6TA 1RT2A 4KTQA 4CJ4A 3TAQA 5AQKA 2NLXA 1NGFA 4BQZA 3MECA 1WOQA 4O5BA 4BDYA 1TAUA 3UB5A 1ATRA 3NGYA 3HSCA 3CXCM 4CJ3A 1Q7YO 5AQUA 2VG5A 3ZT4A 2DFFA 3VEWA 4GMJB 1GOCA 3VN5A 2FXUA 3CCJN 5F2RA 1WN7A 1RDDA 3FE1A 4PA1A 3ITHA 3ZSOA 3V9XA 4FJ5A 2P9IA 3MDQA 1T05A 3CC7N 4JAXA 3A5LC 3HPOA 1QTMA 3TTDA 1X9WA 1IKVA 3L2VA 2Q31A 1U4BA 4H8KA 1TK8A 4FLTA 3K9JA 3EO3A 3CMEN 4NXMK 3VENA 2NRXA 2VYPA 3KLGA 1YITN 3MN5A 3OYCA 4FCYA 1YT3A 3DWLA 4O8KA 1JCEA 3HRGA 1REVA 4GKKK 3UKRA 1NK5A 5JVHL 3G25A 3W0LA 5DMRA 3EYZA 2P1JA 4DU1A 4CJSA 2F9TA 3C6UA 3K5NA 3PX0A 1YF5L 1BO5O 3DJCA 5AZJB 2BANA 4OKEA 1NJZA 2PYLA 3P83D 1B9FA 4E7IA 4FWPA 2D1KA 3CCMN 2G8IA 4EHTA 4KI6A 5T7BA 4DF8A 1NM1A 4DB3A 4LFAK 3NH0A 3CJ1A 2UXBK 1ATSA 4A57A 1VSEA 3DXMB 5C0YA 2HHSA 2I5JA 2X6SA 3H6EA 3V1OA 1UAXA 3B8AX 2YHAA 4OPHA 1WSFA 3QEVA 3HVRA 3BY5A 3R1XA 2P9UA 4RW8A 5AQVA 3P1GA 4B1UB 3DLKA 4BE0A 3O9QA 1JLGA 3FR0A 2BE2A 1EP4A 2KKZA 1TGOA 3T3FA 4B9UA 2FSKA 2FBVA 3O9SA 3OS1A 4ICLA 5HRNA 5AFUH 2QK9A 4K41A 5D3GA 1ZBFA 5AQXA 1YAGA 1X3MA 2W40A 1K6YA 4FK4A 4DTRA 3VEYA 1XNRK 2VGNA 4CIEA 1O13A 4KH4A 1QSSA 5JS1A 2FBXA 3VF4A 2P9LB 2D0PA 4B9TA 4CW7B 2XHBA 4FLYA 4CEZA 4CGHA 1WAJA 3HJFA 4R79A 3CM5A 1LAVA 1IG9A 1BQMA 2GUIA 2HBMA 4PUOA 3RMCA 4B9VA 3G4SN 1NK6A 2DPNA 4CZFA 3CCRN 4CHPA 3DRRA 4Z94A 4RTFD 1NGJA 4XIUA 1OVYA 4DR5K 2O8EA 3CCUN 3SAFA 4F3TA 2O8DB 4PKHA 4LF7K 4FK2A 1TL1A 5J2NA
chains in the Genus database with same CATH topology
3F9KA 3VA0A 4CEOA 3G10A 3AO1A 3NF7A 1W0HA 4LH5A 1Q8IA 4IG0A 4E1NA 4K8ZA 4CK2A 3DYAA 1LW2A 4AHRA 4M3TA 3QERA 4CEBA 5CZ2A 4FJGA 1VRTA 4B9MA 1ZYQA 4CEEA 3B6OA 2X78A 3NAEA 5HBMA 5KTQA 4FJHA 3PX4A 4L8RB 4DWIA 4B9SA 1BQNA 2OPRA 3CG7A 4FM1A 2ITGA 4YNQA 3RTVA 5EU7A 1U47A 1CZBA 3TAMA 3HYFA 3SZ2A 1JLFA 3DM2A 1GOBA 4EP4A 4QOZB 4E1MA 3QLHA 1W9HA 3OYGA 2VWKA 3TAFA 4K8XA 4DLGA 4IBNA 3QIOA 2HHVA 3SPYA 4QAGA 1ITGA 1HYSA 2VG6A 3ZSYA 1HQUA 3MXJA 4CFAA 4CJTA 3OYJA 1C1CA 4O4GA 2GBZA 3PY8A 2EHGA 3AO5A 3AA5X 1JL2A 2Y1JA 1JLAA 4CHOA 3HP9A 1WSEA 2ZE2A 4CIGA 3QNNA 1X9MA 2IC3A 2P5OA 3SUOA 3G0ZA 3OYNA 3LP1A 4CCHA 3PO5A 2IS3A 2F8TA 4ELTA 3ZSVA 4CJEA 3L3VA 1QE1A 3HSTB 3NGIA 4PWDA 1LV5A 3KKRA 2BGGA 1J54A 1BCOA 1RBRA 4ZTFA 4Z4IA 3DOKA 3V9UA 1HMVA 3DOLA 4N5SA 5J2QA 3SJJA 1IKXA 1N5YA 4CFCA 2D5RA 4G1QA 4CJVA 3LP3A 4DFJA 3SNNA 1C0TA 1NKBA 4H4MA 1LAWA 3V1QA 3AA4A 2YV0X 3THVA 2KFNA 1TL3A 5FDLA 3RMDA 1VSFA 4ID5A 3NH1A 4DSFA 2XO7A 3RR8A 2B6AA 3V9SA 4Y1CA 4DTUA 1XHZA 3AVJA 4KTZA 4KHSA 3HO1A 4CEQA 2XY5A 3KJVA 4E7JA 4W5RA 3DLBA 1HNVA 2JGUA 4FJMA 1VK0A 3DRPA 3L2WA 2VG7A 3CYMA 1LWFA 3TR8A 3V1RA 4DTXA 3AVHA 3OJUA 4DQIA 2P5GA 3OYIA 4KPYA 1Y97A 3BGRA 3AO3A 3QIPA 4CF2A 4DU4A 4HUEA 4HVJA 4KFBA 3AVGA 4I2QA 2F8SA 3QEPA 2P51A 1NJWA 4KTWA 5HROA 4NCAA 4PY5A 4I7FA 1VSHA 1RILA 3ZSWA 4FJ7A 1C0UA 2YNFA 2KZZA 3LPTA 4DFPA 3RWUA 3D0PA 5K14A 3OS2A 1HYZA 3OVNA 4F8RA 3V81A 3PV8A 3OS0A 1RTJA 3MEDA 1RT1A 4Z0UA 1A5VA 1C0MA 1KVCA 1KVAA 4AH9A 4BE1A 4B9LA 3AO2A 1ZBHA 1UOCA 2RKIA 4H4OA 4CEDA 4Z4GA 3LZIA 1U48A 4ID1A 1T03A 1XI1A 2OPSA 2ETJA 3DLGA 3QINA 3SUNA 1VSJA 3LWMA 4KREA 3OYFA 4ELUA 1NK8A 3ASMA 3OYAA 1UWBA 3NF8A 4CK1A 3HXMA 4FJ8A 3ISNC 4CF8A 4WE1A 4OVLA 4CGGA 4CHNA 1SKSA 3SV4A 4KHYA 1ASWA 2G8WA 1BI4A 1NKEA 1QS4A 3ZSQA 4OPKA 4E7HA 3ULDA 3V9ZA 1KCFA 5I3UA 2RF2A 1LWCA 3HM9A 1EETA 2OZMA 4M42A 4CK3A 5J2PA 4N76A 2WONA 4LY7A 3ALYA 5C25A 5C42A 2HHUA 3T1AA 3TAEA 4KB1A 2A1RA 4CJUA 3IG1A 4JS4A 1HRHA 3S9HA 4JS5A 3TABA 4FLWA 5FRMA 4MFBA 4E7KA 4FLUA 1TKXA 1D8YA 4ELVA 4F3OA 2E4LA 4BDPA 2XY8A 4FJJA 2A1SA 4DQSA 3IAYA 2JLEA 1RDAA 4OJRA 2FBTA 3CFPA 4EP5A 1RDCA 1IO2A 2Y1IA 4Z4FA 4KHNA 2F96A 2X74A 3VQ4A 4CIFA 1RT7A 3KK3A 1JLEA 1IKWA 3K5OA 3QO9A 1X1PA 4CGIA 3DMJA 2IOCA 4CFBA 3SUQA 1SUQA 4B3OA 4CGJA 2FBYA 4DLEA 3T19A 3WNEA 5FROA 2YKNA 3I0RA 4CEAA 4BWJA 3RRGA 4DS4A 3HPGA 3O4QA 4CHQA 1FK9A 2Z1GA 2IGIA 2WOMA 4RW7A 3VQCA 4CECA 1J5OA 4DSKA 5I42A 2KZMA 1I3AA 3TANA 4HUGA 2R7YA 3AO4A 1Z25A 5KRTA 4Z4EA 1JXBA 4C8NA 4M3UA 1UA1A 4FZYA 2XRIA 3NBPA 4OKJA 1CZ9A 4BWMA 1JLBA 3VQ8A 3NE6A 3K59A 3V9WA 3QNOA 1NK7A 1X9SA 3KK2A 2OPQA 1XC9A 4FLVA 4E0DA 1BGXT 4BACA 3SQ2A 4DTSA 1TKDA 1O1WA 3K5MA 1SV5A 2IDOA 3AVAA 3S3MA 1L3TA 3AV9A 5SZTA 3MXMA 2RPIA 3SYZA 3KIOA 2Z1JA 3NCIA 3QETA 1FKOA 1RT5A 1S9EA 2HNDA 1RT4A 2B4JA 4LSNA 3S3NA 5FRNA 2KTQA 4E3SA 3HPHA 3UIQA 3MEGA 5E41A 2KFZA 3S3OA 2PYJA 5KI6A 4LSLA 1D9DA 1C6VA 4J2DA 2G8HA 3P5JA 4Q5VA 3IRXA 2PZSA 1LW0A 3M8RA 1RT3A 3MEEA 1WNSA 1TKZA 4KV8A 3WNFA 1RTHA 1WAFA 3NDKA 2G8KA 1JL1A 2YKMA 3VQEA 4I2PA 3LWLA 1C1BA 3DLHA 2OYQA 5CYMA 4UQGA 3TWHA 4KB0A 3VQ6A 1KLMA 4OLBA 4F2RA 3DLRA 4M3RA 3ZSZA 3OYHA 3M8QA 4DS5A 5CYQA 1DTQA 2XY6A 4CE9A 4FK0A 1WSHA 2QXFA 4Y1DA 3MAQA 2VWJA 3PX6A 3HT3A 3KK1A 3TARA 4CFDA 3U6FA 3LANA 3OYBA 4W5QA 3KD1E 1VSMA 3OY9A 1RBUA 2HB5A 4FW1A 5JS2A 5KGXA 3NGZA 4CJWA 3JYTA 4KKOA 4J2AA 4E7LA 4BE2A 1YTAA 1NOZA 1ASUA 3O3HA 3LAKA 2IAJA 1KFDA 4CJQA 4F2SA 3VQQA 4RG8A 4ZHRA 4NYFA 4N56A 1ZBUA 3IS9A 3BDPA 2DY4A 3NFAA 3RMBA 4E89A 1SKRA 1VRUA 2ZQBA 2DFEA 1EXQA 1S9GA 4KRFA 1HNIA 4FW2A 4DTPA 2E6MA 4RW6A 3CQ8A 5HP1A 4CF1A 2HW3A 3SCXA 3M8PA 4M3YA 4DQQA 3LALA 2B5JA 2HMIA 1WLJA 1BL3A 4CJPA 4JLHA 5HLFA 1VSKA 4DTOA 3VQ9A 3A2FA 1U49A 1JLCA 4CJRA 2E6LA 1DLOA 4KHWA 2LSNA 3JSMA 2HVIA 1SL1A 3WNHA 1D9FA 4C8OA 1VSDA 3RR7A 3OJSA 1RDBA 1C1AA 4FYDA 2Z1IA 3O3FA 4HUFA 1Q9YA 2QKBA 3VQAA 3D45A 2O4IA 1R0AA 4KAZA 4FZZA 1ZBIA 4HHTA 2X6NA 4FLXA 1GOAA 3RMAA 3NHGA 3OYMA 3ZT0A 4DG1A 4Q0BA 1CXQA 3I8DA 5KGWA 2GV9A 4DTJA 4B9NA 4I9QA 4OGEA 4Z4CA 3L2QA 3HK2A 3AA2A 3OYLA 1VSLA 4EZ6A 2YNGA 3AVLA 1T7PA 4HCCA 3V4IA 1WSIA 4N41A 3L2RA 1VSIA 1T8EA 1JXEA 1RBTA 4EZ9A 1BCMA 3CFOA 5J1EA 1B92A 3NF6A 4FJKA 1IKYA 4RW4A 1NJXA 3NH2A 3EY1A 1L3SA 3DRSA 4Z4HA 4CHYA 4M45A 1BISA 3AVIA 2AJQA 4W5TA 4CGFA 4M41A 1TV6A 3K2PA 1HPZA 3TI0A 1TVRA 2HNZA 3VQPA 1TK5A 1RTDA 4FJIA 4LD0A 3ZSRA 4JRPA 3QESA 4O55A 3OYEA 3B6PA 2ZD1A 4IDKA 4FJXA 4FLZA 3AVCA 4OKKA 3ZT2A 3K5LA 3QEWA 4B8CA 3AVNA 3VA3A 3KLFA 1L5UA 2OZSA 1BHLA 3V6DA 1CLQA 3HP6A 4KHQA 1CXUA 2OPPA 3VQ5A 4DSIA 2KW4A 4AHCA 2YNIA 4O0JA 1G15A 4CEFA 3I0SA 2HHQA 3C6TA 3VQ7A 2D0AA 1RT2A 3DI6A 3PUFA 4CJ4A 4KTQA 3TAQA 3CM6A 4C8KA 4O0IA 3L3UA 3OYKA 4KHUA 3MECA 3K58A 1KRPA 2O4GA 4CHZA 3SQ4A 4O5BA 4FM0A 4BDYA 1TAUA 1BIZA 4MQ3A 3NGYA 4CJ3A 1ZBLA 4F4KA 3AVFA 4OLAA 1RBSA 2YHBA 2VG5A 3ZT4A 1ASVA 4DSLA 2DFFA 3LP0A 4GMJB 1GOCA 3VN5A 1Q9XA 2XY7A 1UA0A 2HHWA 1WN7A 4JRQA 1RDDA 4PA1A 3ZSOA 3ITHA 3V9XA 5HRSA 1F21A 2FC0A 3LDSA 1J9AA 2EX3A 4FJ5A 1T05A 3E01A 4DF4A 1RNHA 3VQDA 3HPOA 3SUPA 3MXIA 1QTMA 4AHUA 1U45A 1IKVA 1X9WA 4M3XA 3L2VA 3TAGA 4DFKA 1U4BA 4H8KA 4N47A 1RBVA 1LWEA 4AHVA 1TK8A 4LH4A 4FLTA 4QCLA 4ZTJA 1A5WA 2ATQA 1NKCA 2QKKA 3AVMA 3LPUA 4J2EA 5CY4A 1JLQA 3KLGA 3HVTA 4YFUA 4OGCA 4CJKA 2G8VA 2BDPA 4CJLA 1SL0A 3OYCA 4FCYA 4NCBA 4IFVA 1YT3A 3OYDA 3O4NA 4O44A 1S1WA 1I39A 1HYVA 3DLEA 4IFYA 4FJLA 1REVA 3WNGA 1U04A 1NK5A 3O3GA 1QSYA 5DMRA 3EYZA 1HJRA 2P1JA 5HRRA 4DU1A 4CJSA 1NK9A 3FFIA 3ZCMA 4FJNA 3C6UA 3K5NA 3PX0A 4W5NA 4E19A 1S1UA 1YTUA 2BANA 4OKEA 4FJ9A 1NJZA 2PY5A 1TKTA 2PYLA 3P83D 1B9FA 4E7IA 3LZJA 3F73A 3KLIA 4IG3A 1S1VA 4HTUA 1FKPA 1EKEA 4AHSA 3SV3A 2G8IA 4KI6A 5T7BA 4DF8A 3SQ0A 2W42A 1SKWA 2D0CA 3ZT3A 3NH0A 4FM2A 3HL8A 4M3WA 4C8MA 1VSEA 4CGDA 1A5XA 4IKFA 4NCGA 2HHSA 2I5JA 2X6SA 3V1OA 3LP2A 1KFSA 1UAXA 2DTUA 2Z1HA 4CF9A 2YHAA 1WSFA 1WSGA 1D5AA 3QEVA 1YVUA 5DK5A 3HVRA 4DQRA 1NOYA 4DU3A 5HRPA 3KLHA 1S1TA 5KRSA 4CJ5A 3L2UA 1KLNA 2OA8A 3SI6A 4DFMA 4KI4A 1Z26A 2YNHA 4RW8A 3P1GA 3DLKA 4BE0A 1N6QA 2D0BA 3LAMA 3NF9A 5C24A 3ZT1A 1L3UA 3SPZA 1JKHA 1S6PA 4DMNA 4J2BA 1TAQA 4CERA 1EX4A 2DFHA 1JLGA 2RN2A 3H08A 4OPJA 2BE2A 1EP4A 3KD5E 4GW6A 3KTQA 3AVBA 1TGOA 1XWLA 3T3FA 4B9UA 4FZXC 4BDZA 4CJFA 1XHXA 1RCHA 4R5PA 1S6QA 1SL2A 4CF0A 2FBVA 3OS1A 4FXDA 4ICLA 5HRNA 4DSEA 3ZSXA 2QK9A 5D3GA 1IH7A 4W5OA 1ZBFA 1KVBA 3RRHA 1K6YA 4B8AB 4FK4A 3U3YA 4DTRA 3M8SA 1RTIA 4DSJA 5SWMA 4CIEA 4FVMA 2Q3SA 1NK4A 1QSSA 2FBXA 5JS1A 1QSLA 4GVMA 2HNYA 4HCBA 4PQUA 1WSJA 1QHTA 1S5JA 4KO0A 4I9LA 4M3ZA 2HHTA 3K57A 4B9TA 1NK0A 2XHBA 4FLYA 4CEZA 4DTMA 4CGHA 1WAJA 3C94A 4RW9A 3EZ5A 3QEXA 1L3VA 3HJFA 4AHTA 3CFRA 3CM5A 1LAVA 1MU2A 1BI4B 3TAPA 3C95A 1TK0A 1RT6A 1BQMA 1IG9A 1DTTA 5CZ1A 2GUIA 4AILC 1BIUA 3PO4A 4PUOA 3L8BA 4DTNA 3RMCA 1QQCA 4CESA 5J2MA 1NK6A 2G8FA 4B9VA 2HHXA 3QEIA 4CHPA 3DRRA 1NJYA 2KQ2A 4DQPA 3U3GA 4XIUA 3AVKA 2G8UA 4C8LA 2NUBA 2HVHA 1J53A 1S1XA 3AA3A 4TSXA 4F3TA 1HQEA 3VQBA 4NYNA 1B9DA 1KSPA 4FK2A 3KKSA 1KTQA 4B08A 1TL1A 1FXXA 3KLEA 5J2NA 3SQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F9K A;  3VA0 A;  4CEO A;  3G10 A;  3AO1 A;  3NF7 A;  1W0H A;  4LH5 A;  1Q8I A;  4IG0 A;  4E1N A;  4K8Z A;  4CK2 A;  3DYA A;  1LW2 A;  4AHR A;  4M3T A;  3QER A;  4CEB A;  5CZ2 A;  4FJG A;  1VRT A;  4B9M A;  1ZYQ A;  4CEE A;  3B6O A;  2X78 A;  3NAE A;  5HBM A;  5KTQ A;  4FJH A;  3PX4 A;  4L8R B;  4DWI A;  4B9S A;  1BQN A;  2OPR A;  3CG7 A;  4FM1 A;  2ITG A;  4YNQ A;  3RTV A;  5EU7 A;  1U47 A;  1CZB A;  3TAM A;  3HYF A;  3SZ2 A;  1JLF A;  3DM2 A;  1GOB A;  4EP4 A;  4QOZ B;  4E1M A;  3QLH A;  1W9H A;  3OYG A;  2VWK A;  3TAF A;  4K8X A;  4DLG A;  4IBN A;  3QIO A;  2HHV A;  3SPY A;  4QAG A;  1ITG A;  1HYS A;  2VG6 A;  3ZSY A;  1HQU A;  3MXJ A;  4CFA A;  4CJT A;  3OYJ A;  1C1C A;  4O4G A;  2GBZ A;  3PY8 A;  2EHG A;  3AO5 A;  3AA5 X;  1JL2 A;  2Y1J A;  1JLA A;  4CHO A;  3HP9 A;  1WSE A;  2ZE2 A;  4CIG A;  3QNN A;  1X9M A;  2IC3 A;  2P5O A;  3SUO A;  3G0Z A;  3OYN A;  3LP1 A;  4CCH A;  3PO5 A;  2IS3 A;  2F8T A;  4ELT A;  3ZSV A;  4CJE A;  3L3V A;  1QE1 A;  3HST B;  3NGI A;  4PWD A;  1LV5 A;  3KKR A;  2BGG A;  1J54 A;  1BCO A;  1RBR A;  4ZTF A;  4Z4I A;  3DOK A;  3V9U A;  1HMV A;  3DOL A;  4N5S A;  5J2Q A;  3SJJ A;  1IKX A;  1N5Y A;  4CFC A;  2D5R A;  4G1Q A;  4CJV A;  3LP3 A;  4DFJ A;  3SNN A;  1C0T A;  1NKB A;  4H4M A;  1LAW A;  3V1Q A;  3AA4 A;  2YV0 X;  3THV A;  2KFN A;  1TL3 A;  5FDL A;  3RMD A;  1VSF A;  4ID5 A;  3NH1 A;  4DSF A;  2XO7 A;  3RR8 A;  2B6A A;  3V9S A;  4Y1C A;  4DTU A;  1XHZ A;  3AVJ A;  4KTZ A;  4KHS A;  3HO1 A;  4CEQ A;  2XY5 A;  3KJV A;  4E7J A;  4W5R A;  3DLB A;  1HNV A;  2JGU A;  4FJM A;  1VK0 A;  3DRP A;  3L2W A;  2VG7 A;  3CYM A;  1LWF A;  3TR8 A;  3V1R A;  4DTX A;  3AVH A;  3OJU A;  4DQI A;  2P5G A;  3OYI A;  4KPY A;  1Y97 A;  3BGR A;  3AO3 A;  3QIP A;  4CF2 A;  4DU4 A;  4HUE A;  4HVJ A;  4KFB A;  3AVG A;  4I2Q A;  2F8S A;  3QEP A;  2P51 A;  1NJW A;  4KTW A;  5HRO A;  4NCA A;  4PY5 A;  4I7F A;  1VSH A;  1RIL A;  3ZSW A;  4FJ7 A;  1C0U A;  2YNF A;  2KZZ A;  3LPT A;  4DFP A;  3RWU A;  3D0P A;  5K14 A;  3OS2 A;  1HYZ A;  3OVN A;  4F8R A;  3V81 A;  3PV8 A;  3OS0 A;  1RTJ A;  3MED A;  1RT1 A;  4Z0U A;  1A5V A;  1C0M A;  1KVC A;  1KVA A;  4AH9 A;  4BE1 A;  4B9L A;  3AO2 A;  1ZBH A;  1UOC A;  2RKI A;  4H4O A;  4CED A;  4Z4G A;  3LZI A;  1U48 A;  4ID1 A;  1T03 A;  1XI1 A;  2OPS A;  2ETJ A;  3DLG A;  3QIN A;  3SUN A;  1VSJ A;  3LWM A;  4KRE A;  3OYF A;  4ELU A;  1NK8 A;  3ASM A;  3OYA A;  1UWB A;  3NF8 A;  4CK1 A;  3HXM A;  4FJ8 A;  3ISN C;  4CF8 A;  4WE1 A;  4OVL A;  4CGG A;  4CHN A;  1SKS A;  3SV4 A;  4KHY A;  1ASW A;  2G8W A;  1BI4 A;  1NKE A;  1QS4 A;  3ZSQ A;  4OPK A;  4E7H A;  3ULD A;  3V9Z A;  1KCF A;  5I3U A;  2RF2 A;  1LWC A;  3HM9 A;  1EET A;  2OZM A;  4M42 A;  4CK3 A;  5J2P A;  4N76 A;  2WON A;  4LY7 A;  3ALY A;  5C25 A;  5C42 A;  2HHU A;  3T1A A;  3TAE A;  4KB1 A;  2A1R A;  4CJU A;  3IG1 A;  4JS4 A;  1HRH A;  3S9H A;  4JS5 A;  3TAB A;  4FLW A;  5FRM A;  4MFB A;  4E7K A;  4FLU A;  1TKX A;  1D8Y A;  4ELV A;  4F3O A;  2E4L A;  4BDP A;  2XY8 A;  4FJJ A;  2A1S A;  4DQS A;  3IAY A;  2JLE A;  1RDA A;  4OJR A;  2FBT A;  3CFP A;  4EP5 A;  1RDC A;  1IO2 A;  2Y1I A;  4Z4F A;  4KHN A;  2F96 A;  2X74 A;  3VQ4 A;  4CIF A;  1RT7 A;  3KK3 A;  1JLE A;  1IKW A;  3K5O A;  3QO9 A;  1X1P A;  4CGI A;  3DMJ A;  2IOC A;  4CFB A;  3SUQ A;  1SUQ A;  4B3O A;  4CGJ A;  2FBY A;  4DLE A;  3T19 A;  3WNE A;  5FRO A;  2YKN A;  3I0R A;  4CEA A;  4BWJ A;  3RRG A;  4DS4 A;  3HPG A;  3O4Q A;  4CHQ A;  1FK9 A;  2Z1G A;  2IGI A;  2WOM A;  4RW7 A;  3VQC A;  4CEC A;  1J5O A;  4DSK A;  5I42 A;  2KZM A;  1I3A A;  3TAN A;  4HUG A;  2R7Y A;  3AO4 A;  1Z25 A;  5KRT A;  4Z4E A;  1JXB A;  4C8N A;  4M3U A;  1UA1 A;  4FZY A;  2XRI A;  3NBP A;  4OKJ A;  1CZ9 A;  4BWM A;  1JLB A;  3VQ8 A;  3NE6 A;  3K59 A;  3V9W A;  3QNO A;  1NK7 A;  1X9S A;  3KK2 A;  2OPQ A;  1XC9 A;  4FLV A;  4E0D A;  1BGX T;  4BAC A;  3SQ2 A;  4DTS A;  1TKD A;  1O1W A;  3K5M A;  1SV5 A;  2IDO A;  3AVA A;  3S3M A;  1L3T A;  3AV9 A;  5SZT A;  3MXM A;  2RPI A;  3SYZ A;  3KIO A;  2Z1J A;  3NCI A;  3QET A;  1FKO A;  1RT5 A;  1S9E A;  2HND A;  1RT4 A;  2B4J A;  4LSN A;  3S3N A;  5FRN A;  2KTQ A;  4E3S A;  3HPH A;  3UIQ A;  3MEG A;  5E41 A;  2KFZ A;  3S3O A;  2PYJ A;  5KI6 A;  4LSL A;  1D9D A;  1C6V A;  4J2D A;  2G8H A;  3P5J A;  4Q5V A;  3IRX A;  2PZS A;  1LW0 A;  3M8R A;  1RT3 A;  3MEE A;  1WNS A;  1TKZ A;  4KV8 A;  3WNF A;  1RTH A;  1WAF A;  3NDK A;  2G8K A;  1JL1 A;  2YKM A;  3VQE A;  4I2P A;  3LWL A;  1C1B A;  3DLH A;  2OYQ A;  5CYM A;  4UQG A;  3TWH A;  4KB0 A;  3VQ6 A;  1KLM A;  4OLB A;  4F2R A;  3DLR A;  4M3R A;  3ZSZ A;  3OYH A;  3M8Q A;  4DS5 A;  5CYQ A;  1DTQ A;  2XY6 A;  4CE9 A;  4FK0 A;  1WSH A;  2QXF A;  4Y1D A;  3MAQ A;  2VWJ A;  3PX6 A;  3HT3 A;  3KK1 A;  3TAR A;  4CFD A;  3U6F A;  3LAN A;  3OYB A;  4W5Q A;  3KD1 E;  1VSM A;  3OY9 A;  1RBU A;  2HB5 A;  4FW1 A;  5JS2 A;  5KGX A;  3NGZ A;  4CJW A;  3JYT A;  4KKO A;  4J2A A;  4E7L A;  4BE2 A;  1YTA A;  1NOZ A;  1ASU A;  3O3H A;  3LAK A;  2IAJ A;  1KFD A;  4CJQ A;  4F2S A;  3VQQ A;  4RG8 A;  4ZHR A;  4NYF A;  4N56 A;  1ZBU A;  3IS9 A;  3BDP A;  2DY4 A;  3NFA A;  3RMB A;  4E89 A;  1SKR A;  1VRU A;  2ZQB A;  2DFE A;  1EXQ A;  1S9G A;  4KRF A;  1HNI A;  4FW2 A;  4DTP A;  2E6M A;  4RW6 A;  3CQ8 A;  5HP1 A;  4CF1 A;  2HW3 A;  3SCX A;  3M8P A;  4M3Y A;  4DQQ A;  3LAL A;  2B5J A;  2HMI A;  1WLJ A;  1BL3 A;  4CJP A;  4JLH A;  5HLF A;  1VSK A;  4DTO A;  3VQ9 A;  3A2F A;  1U49 A;  1JLC A;  4CJR A;  2E6L A;  1DLO A;  4KHW A;  2LSN A;  3JSM A;  2HVI A;  1SL1 A;  3WNH A;  1D9F A;  4C8O A;  1VSD A;  3RR7 A;  3OJS A;  1RDB A;  1C1A A;  4FYD A;  2Z1I A;  3O3F A;  4HUF A;  1Q9Y A;  2QKB A;  3VQA A;  3D45 A;  2O4I A;  1R0A A;  4KAZ A;  4FZZ A;  1ZBI A;  4HHT A;  2X6N A;  4FLX A;  1GOA A;  3RMA A;  3NHG A;  3OYM A;  3ZT0 A;  4DG1 A;  4Q0B A;  1CXQ A;  3I8D A;  5KGW A;  2GV9 A;  4DTJ A;  4B9N A;  4I9Q A;  4OGE A;  4Z4C A;  3L2Q A;  3HK2 A;  3AA2 A;  3OYL A;  1VSL A;  4EZ6 A;  2YNG A;  3AVL A;  1T7P A;  4HCC A;  3V4I A;  1WSI A;  4N41 A;  3L2R A;  1VSI A;  1T8E A;  1JXE A;  1RBT A;  4EZ9 A;  1BCM A;  3CFO A;  5J1E A;  1B92 A;  3NF6 A;  4FJK A;  1IKY A;  4RW4 A;  1NJX A;  3NH2 A;  3EY1 A;  1L3S A;  3DRS A;  4Z4H A;  4CHY A;  4M45 A;  1BIS A;  3AVI A;  2AJQ A;  4W5T A;  4CGF A;  4M41 A;  1TV6 A;  3K2P A;  1HPZ A;  3TI0 A;  1TVR A;  2HNZ A;  3VQP A;  1TK5 A;  1RTD A;  4FJI A;  4LD0 A;  3ZSR A;  4JRP A;  3QES A;  4O55 A;  3OYE A;  3B6P A;  2ZD1 A;  4IDK A;  4FJX A;  4FLZ A;  3AVC A;  4OKK A;  3ZT2 A;  3K5L A;  3QEW A;  4B8C A;  3AVN A;  3VA3 A;  3KLF A;  1L5U A;  2OZS A;  1BHL A;  3V6D A;  1CLQ A;  3HP6 A;  4KHQ A;  1CXU A;  2OPP A;  3VQ5 A;  4DSI A;  2KW4 A;  4AHC A;  2YNI A;  4O0J A;  1G15 A;  4CEF A;  3I0S A;  2HHQ A;  3C6T A;  3VQ7 A;  2D0A A;  1RT2 A;  3DI6 A;  3PUF A;  4CJ4 A;  4KTQ A;  3TAQ A;  3CM6 A;  4C8K A;  4O0I A;  3L3U A;  3OYK A;  4KHU A;  3MEC A;  3K58 A;  1KRP A;  2O4G A;  4CHZ A;  3SQ4 A;  4O5B A;  4FM0 A;  4BDY A;  1TAU A;  1BIZ A;  4MQ3 A;  3NGY A;  4CJ3 A;  1ZBL A;  4F4K A;  3AVF A;  4OLA A;  1RBS A;  2YHB A;  2VG5 A;  3ZT4 A;  1ASV A;  4DSL A;  2DFF A;  3LP0 A;  4GMJ B;  1GOC A;  3VN5 A;  1Q9X A;  2XY7 A;  1UA0 A;  2HHW A;  1WN7 A;  4JRQ A;  1RDD A;  4PA1 A;  3ZSO A;  3ITH A;  3V9X A;  5HRS A;  1F21 A;  2FC0 A;  3LDS A;  1J9A A;  2EX3 A;  4FJ5 A;  1T05 A;  3E01 A;  4DF4 A;  1RNH A;  3VQD A;  3HPO A;  3SUP A;  3MXI A;  1QTM A;  4AHU A;  1U45 A;  1IKV A;  1X9W A;  4M3X A;  3L2V A;  3TAG A;  4DFK A;  1U4B A;  4H8K A;  4N47 A;  1RBV A;  1LWE A;  4AHV A;  1TK8 A;  4LH4 A;  4FLT A;  4QCL A;  4ZTJ A;  1A5W A;  2ATQ A;  1NKC A;  2QKK A;  3AVM A;  3LPU A;  4J2E A;  5CY4 A;  1JLQ A;  3KLG A;  3HVT A;  4YFU A;  4OGC A;  4CJK A;  2G8V A;  2BDP A;  4CJL A;  1SL0 A;  3OYC A;  4FCY A;  4NCB A;  4IFV A;  1YT3 A;  3OYD A;  3O4N A;  4O44 A;  1S1W A;  1I39 A;  1HYV A;  3DLE A;  4IFY A;  4FJL A;  1REV A;  3WNG A;  1U04 A;  1NK5 A;  3O3G A;  1QSY A;  5DMR A;  3EYZ A;  1HJR A;  2P1J A;  5HRR A;  4DU1 A;  4CJS A;  1NK9 A;  3FFI A;  3ZCM A;  4FJN A;  3C6U A;  3K5N A;  3PX0 A;  4W5N A;  4E19 A;  1S1U A;  1YTU A;  2BAN A;  4OKE A;  4FJ9 A;  1NJZ A;  2PY5 A;  1TKT A;  2PYL A;  3P83 D;  1B9F A;  4E7I A;  3LZJ A;  3F73 A;  3KLI A;  4IG3 A;  1S1V A;  4HTU A;  1FKP A;  1EKE A;  4AHS A;  3SV3 A;  2G8I A;  4KI6 A;  5T7B A;  4DF8 A;  3SQ0 A;  2W42 A;  1SKW A;  2D0C A;  3ZT3 A;  3NH0 A;  4FM2 A;  3HL8 A;  4M3W A;  4C8M A;  1VSE A;  4CGD A;  1A5X A;  4IKF A;  4NCG A;  2HHS A;  2I5J A;  2X6S A;  3V1O A;  3LP2 A;  1KFS A;  1UAX A;  2DTU A;  2Z1H A;  4CF9 A;  2YHA A;  1WSF A;  1WSG A;  1D5A A;  3QEV A;  1YVU A;  5DK5 A;  3HVR A;  4DQR A;  1NOY A;  4DU3 A;  5HRP A;  3KLH A;  1S1T A;  5KRS A;  4CJ5 A;  3L2U A;  1KLN A;  2OA8 A;  3SI6 A;  4DFM A;  4KI4 A;  1Z26 A;  2YNH A;  4RW8 A;  3P1G A;  3DLK A;  4BE0 A;  1N6Q A;  2D0B A;  3LAM A;  3NF9 A;  5C24 A;  3ZT1 A;  1L3U A;  3SPZ A;  1JKH A;  1S6P A;  4DMN A;  4J2B A;  1TAQ A;  4CER A;  1EX4 A;  2DFH A;  1JLG A;  2RN2 A;  3H08 A;  4OPJ A;  2BE2 A;  1EP4 A;  3KD5 E;  4GW6 A;  3KTQ A;  3AVB A;  1TGO A;  1XWL A;  3T3F A;  4B9U A;  4FZX C;  4BDZ A;  4CJF A;  1XHX A;  1RCH A;  4R5P A;  1S6Q A;  1SL2 A;  4CF0 A;  2FBV A;  3OS1 A;  4FXD A;  4ICL A;  5HRN A;  4DSE A;  3ZSX A;  2QK9 A;  5D3G A;  1IH7 A;  4W5O A;  1ZBF A;  1KVB A;  3RRH A;  1K6Y A;  4B8A B;  4FK4 A;  3U3Y A;  4DTR A;  3M8S A;  1RTI A;  4DSJ A;  5SWM A;  4CIE A;  4FVM A;  2Q3S A;  1NK4 A;  1QSS A;  2FBX A;  5JS1 A;  1QSL A;  4GVM A;  2HNY A;  4HCB A;  4PQU A;  1WSJ A;  1QHT A;  1S5J A;  4KO0 A;  4I9L A;  4M3Z A;  2HHT A;  3K57 A;  4B9T A;  1NK0 A;  2XHB A;  4FLY A;  4CEZ A;  4DTM A;  4CGH A;  1WAJ A;  3C94 A;  4RW9 A;  3EZ5 A;  3QEX A;  1L3V A;  3HJF A;  4AHT A;  3CFR A;  3CM5 A;  1LAV A;  1MU2 A;  1BI4 B;  3TAP A;  3C95 A;  1TK0 A;  1RT6 A;  1BQM A;  1IG9 A;  1DTT A;  5CZ1 A;  2GUI A;  4AIL C;  1BIU A;  3PO4 A;  4PUO A;  3L8B A;  4DTN A;  3RMC A;  1QQC A;  4CES A;  5J2M A;  1NK6 A;  2G8F A;  4B9V A;  2HHX A;  3QEI A;  4CHP A;  3DRR A;  1NJY A;  2KQ2 A;  4DQP A;  3U3G A;  4XIU A;  3AVK A;  2G8U A;  4C8L A;  2NUB A;  2HVH A;  1J53 A;  1S1X A;  3AA3 A;  4TSX A;  4F3T A;  1HQE A;  3VQB A;  4NYN A;  1B9D A;  1KSP A;  4FK2 A;  3KKS A;  1KTQ A;  4B08 A;  1TL1 A;  1FXX A;  3KLE A;  5J2N A;  3SQ1 A; 
#chains in the Genus database with same CATH topology
 4ILH A;  3F9K A;  4BVO A;  2BTF A;  1W0H A;  1BG3 A;  4CEB A;  4FJG A;  1VRT A;  4B9M A;  3NAE A;  5KTQ A;  4DWI A;  3ENO A;  4B9S A;  1Q82 O;  2QEX N;  1U47 A;  1CZB A;  3P38 A;  2F7T A;  5CR4 A;  4EIA A;  1JLF A;  3QLH A;  4DV4 K;  4IBN A;  4C23 A;  4B1V A;  4QAG A;  1HYS A;  1NGC A;  2PFU A;  4CFA A;  1C1C A;  3PY8 A;  1JL2 A;  3VER A;  4CIG A;  3J7Y P;  4YDU A;  3FZK A;  3E9L A;  3OYN A;  4BC5 A;  1C0G A;  5BN8 A;  2IS3 A;  5AZJ A;  1N34 K;  1OKJ A;  4BRP A;  1QE1 A;  2QI2 A;  1BCO A;  4ZTF A;  3NVM A;  4XH1 A;  3DOK A;  2NRH A;  3SJJ A;  1VQP N;  4CJV A;  4BC2 A;  1Z05 A;  4DFJ A;  1YVN A;  1HUX A;  1LAW A;  1SAZ A;  3A5M C;  3THV A;  2KFN A;  1TL3 A;  3PIP L;  5FDL A;  3RMD A;  4ID5 A;  3NH1 A;  5AZI B;  4Y1C A;  4KTZ A;  3HO1 A;  2W41 A;  1NMN A;  4JKA A;  4W5R A;  3CYM A;  1S3X A;  3AVH A;  3OJU A;  3T1H K;  2P5G A;  4CF2 A;  3QIP A;  3AO3 A;  1IV0 A;  2I7N A;  4I2Q A;  3QEP A;  5HRO A;  4PY5 A;  2NRW A;  3ZSW A;  2YNF A;  3D0P A;  4ISE A;  4F8R A;  4GV3 A;  1EO1 A;  1RT1 A;  3P31 A;  4CBU A;  1KVC A;  1KVA A;  4BE1 A;  1C0F A;  1W97 L;  4B9L A;  3RSE A;  4CED A;  4K0K K;  3IUC A;  3CJ9 A;  3DLG A;  3QIN A;  3K9K A;  3SUN A;  1VSJ A;  1NG9 A;  4KRE A;  3ASM A;  2NZT A;  4WE1 A;  4KHY A;  3CC2 N;  4NXN K;  3DLL L;  4OPK A;  2OCE A;  3MN6 A;  1KCF A;  3V9Z A;  3EKU A;  2WON A;  3VMF B;  4LY7 A;  5C25 A;  2A1R A;  3S9H A;  3MCA B;  2E2N A;  3TAB A;  2OAN A;  4FWL A;  1D8Y A;  4ELV A;  4F3O A;  1KXP A;  4JV5 K;  2A1S A;  4DQS A;  3IAY A;  4OJR A;  2FBT A;  2P9K B;  4EP5 A;  1RDC A;  1IO2 A;  3DMJ A;  4B3O A;  2FBY A;  3T19 A;  1T3V A;  1JCG A;  4CEA A;  3A5N C;  1LCU A;  3EN9 A;  3J7Z O;  2UXD K;  4YOR A;  5I42 A;  3TAN A;  3ZX3 A;  2YHX A;  3MX5 A;  4Z4E A;  4M3U A;  1QQO A;  4FZY A;  1CZ9 A;  3V9W A;  2P9N A;  3KK2 A;  3Q7C A;  1BGX T;  5DM7 L;  4IOX A;  1Q86 O;  1O1W A;  3K5M A;  1IBK K;  1SV5 A;  3AVA A;  3CQY A;  1L3T A;  3AV9 A;  5FPD A;  4MLE A;  3KIO A;  5FRN A;  5LJV A;  4YOU A;  4E3S A;  3UIQ A;  5M1Q A;  2KFZ A;  4H03 B;  2RHK A;  2O8F A;  3S3O A;  2PYJ A;  1HNW K;  4CD1 A;  3M8R A;  4LF5 K;  3MEE A;  2WC9 A;  2G8K A;  1WBD A;  4KHU A;  1C1B A;  2OYQ A;  4UQG A;  3VPZ A;  1KLM A;  4F2R A;  3FFK B;  3DLR A;  4M3R A;  3ZSZ A;  3HOS A;  1KAY A;  4CE9 A;  1WSH A;  2QXF A;  3ID8 A;  3HT3 A;  4CFD A;  1G99 A;  3OY9 A;  5KGX A;  2HB5 A;  5BPN A;  3JYT A;  4CJW A;  4JKH A;  1VQ6 N;  1EWR A;  5FLX O;  3A0I X;  4BRQ A;  2D0O A;  2Q2R A;  3LAK A;  2IAJ A;  2O8B B;  4N56 A;  3NFA A;  2DFE A;  3CPW M;  4RW6 A;  2A6A A;  4LF8 K;  3WXK A;  5GAD P;  3LAL A;  1BL3 A;  4GY2 B;  1VSK A;  3HI0 A;  3A2F A;  2E6L A;  1SL1 A;  3WNH A;  4NLC A;  2Z1I A;  3N4Q A;  4LF9 K;  4KBO A;  4DV0 K;  1Q81 O;  4HHT A;  2QWR A;  3OYM A;  3NHG A;  4DG1 A;  4Q0B A;  3IFR A;  5KGW A;  1JJ2 M;  1YJW N;  2QW9 A;  5KQ8 A;  3HK2 A;  3AA2 A;  3F5T A;  5HOO A;  2E8A A;  2YJF A;  1JXE A;  4J8F A;  3CFO A;  1B92 A;  4H0O A;  3NF6 A;  4FJK A;  3GL1 A;  4FWO A;  4RW4 A;  2QWO A;  5AQN A;  5BRF A;  4Z4H A;  4CHY A;  3I8B A;  5AQY A;  1BIS A;  4M41 A;  3QBW A;  3U9Z A;  3VQP A;  2JWL A;  2Q0R A;  4IDK A;  2W6K A;  4FPB A;  3QEW A;  3CCL N;  4JNE A;  2UU9 K;  3VA3 A;  3T69 A;  4B1W B;  2QXL A;  4DQ8 A;  3V6D A;  1GLF O;  1NU0 A;  1YUW A;  3HP6 A;  4HTL A;  4AHC A;  2UUB K;  5AQJ A;  1VQM N;  3VQ7 A;  3DI6 A;  3FZM A;  3CM6 A;  3WUH A;  4C8K A;  3OYK A;  3K58 A;  1K8K A;  1H1V A;  4MQ3 A;  2HBL A;  5M1F A;  3AVF A;  4OLA A;  1RBS A;  4DSL A;  4IDH A;  4JRQ A;  3T7Z A;  4MLH A;  5HRS A;  1J9A A;  2EX3 A;  3E01 A;  4DF4 A;  1RNH A;  3GBT A;  3QDK A;  3SUP A;  3IDH A;  1U45 A;  4M3X A;  1HPM A;  1RBV A;  4AHV A;  1IG8 A;  3VGK A;  4QCL A;  1NKC A;  2QKK A;  3TPQ A;  1N32 K;  4CZG A;  5CY4 A;  4YOT A;  3HVT A;  4YFU A;  1NGB A;  2KLA A;  4OGC A;  4LF6 K;  4BR9 A;  4NCB A;  4IFV A;  4WF9 L;  3O9T A;  4O44 A;  1S1W A;  1I39 A;  3DLE A;  4IFY A;  1FJG K;  3O3G A;  1QSY A;  5HRR A;  5AQW A;  3CJC A;  5H1S Q;  3ID6 A;  4E19 A;  1MDU B;  1NGI A;  3SMP A;  5AQR A;  3AAQ A;  1TKT A;  3L4I A;  4G9Z A;  4A2B A;  3E1Y A;  1X3N A;  3F73 A;  4IG3 A;  4MO5 A;  3D6R A;  1FKP A;  1W7A A;  3SV3 A;  5KPZ A;  3SQ0 A;  2W42 A;  3BEX A;  1SKW A;  4FM2 A;  4FSV A;  3TTF A;  1A5X A;  4NCG A;  3UKU A;  1KD1 O;  3H1Q A;  4AM7 A;  3LP2 A;  1KFS A;  4CF9 A;  1WSG A;  1D5A A;  4QS8 A;  4DQR A;  3F2K A;  4DU3 A;  1S1T A;  3L2U A;  2OA8 A;  3VEO A;  3SI6 A;  4X64 K;  1KAZ A;  4FVU A;  3WQT A;  2UUC K;  2P9U B;  3LDQ A;  1L3U A;  1S6P A;  4J2B A;  5EOY A;  1TAQ A;  3EE9 A;  4CER A;  1EX4 A;  1HJO A;  1E3M A;  3KD5 E;  3QBX A;  1YJ9 N;  4C1N K;  4BDZ A;  4X65 K;  4R5P A;  1S6Q A;  4CF0 A;  2FF3 B;  3ZSX A;  3UE5 A;  5JIC A;  5HL7 L;  4CD3 A;  3U3Y A;  3M8S A;  4BR5 A;  3SK3 A;  4DSJ A;  1NNE A;  2VWB A;  5JVG L;  1QSL A;  4GVM A;  1WSJ A;  4B3S K;  3BF1 A;  3C94 A;  3VET A;  2E2Q A;  1MU2 A;  2ZJP L;  3C95 A;  2CGL A;  1BIU A;  5AQZ A;  3L8B A;  1RFQ A;  2KQ2 A;  3D7E O;  1HQE A;  3WT0 A;  1YHQ N;  2QTD A;  3FZH A;  2O8E B;  4B08 A;  1Q18 A;  2QWP A;  3U9D A;  5CE3 A;  4DR3 K;  3M1F A;  5C2D A;  4LH5 A;  1Q8I A;  3H46 O;  3LDP A;  4X66 K;  1OH6 A;  1QVF M;  1LW2 A;  4AHR A;  3LM9 A;  2WUS A;  2A3Z A;  2X78 A;  5F1X A;  3WXM B;  1BQN A;  2OPR A;  3KVG A;  5AQT A;  4YNQ A;  2J4R A;  4H5R A;  5AQQ A;  3CCE N;  3EL2 A;  3DM2 A;  4DR2 K;  1GOB A;  1NMD A;  1VQN N;  3SBG A;  1ILY A;  3L0Q A;  2VWK A;  5F0X A;  4DLG A;  2HHV A;  1ITG A;  3ZSY A;  1HQU A;  3MXJ A;  3OYJ A;  2EHG A;  2Y1J A;  1JLA A;  3BF3 A;  2ZE2 A;  3CC4 N;  3QB0 A;  2E1Z A;  3G0Z A;  2F8T A;  4CJE A;  3O80 A;  4KH5 A;  1DEJ A;  3NGI A;  4PWD A;  3KKR A;  1RGI A;  1HNX K;  3DOL A;  2NNW A;  4JK8 A;  3F9M A;  2D5R A;  4XH5 A;  4U67 L;  4KHP K;  1VQK N;  3V1Q A;  1NGD A;  4K25 A;  1YIJ N;  4FWN A;  5LMU K;  5BR9 A;  3J81 O;  2XO7 A;  3D2E B;  2W6L A;  3BP8 A;  5EXW A;  4RCH A;  4IO9 L;  3L2W A;  2VG7 A;  3V1R A;  4YOV A;  3TR8 A;  4DQI A;  4L3Q A;  4KPY A;  3BGR A;  2ZJR L;  4DU4 A;  3CMA N;  4HUE A;  4HVJ A;  4KFB A;  4IEI A;  4KTW A;  1GLB G;  2ASM A;  4NCA A;  4I7F A;  1VSH A;  1C0U A;  2IVO A;  3LPT A;  3OS2 A;  3W3D A;  4E1J A;  3ZLJ A;  2Q0U A;  3TSP A;  1M90 O;  2RKI A;  4Z4G A;  1U48 A;  3O9U A;  3TU5 A;  2OPS A;  4GV6 A;  3RSE B;  3LWM A;  5GIN A;  4ELU A;  1DKG D;  3OYA A;  1UWB A;  3SV4 A;  4BRE A;  1ASW A;  1M1K O;  1NKE A;  1QS4 A;  2A5X A;  4K43 A;  5I3U A;  1LWC A;  3C0B A;  4JI2 K;  3S41 A;  3HZ6 A;  4BRN A;  4CJU A;  3IG1 A;  4JS4 A;  1HRH A;  2WBN A;  4WCE L;  4E7K A;  4FLU A;  5LMN K;  2XY8 A;  3CFP A;  2Y1I A;  2F96 A;  2X74 A;  4CIF A;  3E66 A;  1JLE A;  3QO9 A;  4CFB A;  4EFH A;  1VQ5 N;  3E9P A;  2IOC A;  2ASP A;  3J80 O;  3G71 N;  1NWK A;  4NB4 A;  4CGJ A;  1N8R O;  1QQN A;  5ADX H;  4H0T B;  5GIO A;  3KWG A;  2A41 A;  1J5O A;  3EEQ A;  4RW7 A;  3I33 A;  2KZM A;  1I3A A;  1VQ7 N;  3MK6 A;  3AO4 A;  1Z25 A;  5C2F A;  3VES A;  1UA1 A;  1LOT B;  4OKJ A;  4BWM A;  3VQ8 A;  1NK7 A;  1X9S A;  1KAX A;  2ZM6 K;  1TKD A;  2P9N B;  5SZT A;  3SYZ A;  1HKB A;  2WTU A;  1S9E A;  1HKC A;  1RT4 A;  2B4J A;  3HPH A;  4LC9 B;  1NGG A;  1DGK N;  1V4S A;  3T1Y K;  5KI6 A;  4J2D A;  2ZF5 O;  2O8F B;  3P5J A;  4Q5V A;  1JCF A;  1RT3 A;  4BR4 A;  3SMS A;  1TKZ A;  4K42 A;  3WNF A;  1WAF A;  4H0V B;  4YY3 K;  4I2P A;  4KB0 A;  3VQ6 A;  4JN4 A;  4OLB A;  3OYH A;  4YHH K;  3DXK B;  2VWJ A;  2NRZ A;  3U6F A;  3LAN A;  3OHR A;  4U7B A;  1BA1 A;  3KD1 E;  3D2E A;  4BGA A;  4OPA A;  4JKE A;  4BE2 A;  4DV7 K;  4F2S A;  3VQQ A;  4RG8 A;  4JYA K;  3MN7 A;  4E89 A;  2ZQB A;  1DT9 A;  1S9G A;  1OVQ A;  2E6M A;  1K9M O;  5HP1 A;  4CZJ A;  3I56 N;  4BR2 A;  2HMI A;  1YXQ A;  3VF6 A;  2CGK A;  4FL9 A;  4DTO A;  2VQE K;  1U49 A;  4KHW A;  3GOI A;  3H3N O;  1D9F A;  4DV2 K;  4DR6 K;  3FZL A;  1S22 A;  3O3F A;  1Q9Y A;  3M3Z A;  3VQA A;  2YHW A;  4KAZ A;  4WQ4 C;  1GOA A;  3D2F B;  4I6M A;  4OGE A;  5LY3 A;  2O8C B;  3OYL A;  2YNG A;  1T7P A;  4HCC A;  3ZEU A;  4ILG B;  2OTJ N;  3U8X A;  3EZW A;  1NJX A;  3QML A;  3NH2 A;  3EY1 A;  5ELZ A;  4M45 A;  3CQX A;  4W5T A;  4CGF A;  1TV6 A;  1HPZ A;  2CH6 A;  1BU6 O;  2A40 A;  4FJX A;  3TSU A;  3TTC A;  4FLZ A;  3AVC A;  3ZT2 A;  3R8E A;  1J5E K;  1CXU A;  2OPP A;  2HHQ A;  2D0A A;  3PUF A;  4O0I A;  3L3U A;  1KRP A;  4CHZ A;  3WQU A;  5JLH A;  3ZYY X;  4A5A A;  1K8K B;  1ZBL A;  2YHB A;  1Q9X A;  3LP0 A;  3CJB A;  2XY7 A;  5LJW A;  1UA0 A;  4Y0W A;  2E2O A;  3G6E N;  1F21 A;  2FC0 A;  4YOY A;  1XQS C;  3VQD A;  3MXI A;  3QFP A;  3JXU A;  3O1B A;  4AHU A;  3VOV A;  3WXL A;  3MWT A;  4DFK A;  4N47 A;  1LWE A;  4ISG A;  2GEL A;  3BUZ B;  4FOE A;  3AVM A;  3LPU A;  1JLQ A;  2E20 A;  2QWQ A;  2E2P A;  5C15 A;  4CZK A;  2G8V A;  2BDP A;  4CJL A;  4JD2 A;  3DXK A;  4DHY A;  3OYD A;  4JI8 K;  4B1Y B;  4H5W A;  2YJE A;  4FJL A;  5BRE A;  1NK9 A;  4FWR A;  4YOX A;  1MWK A;  3ZCM A;  3THX B;  4WFA L;  3ZX0 A;  3CI5 A;  2PY5 A;  2QWM A;  3SAG A;  4BRO A;  4IZ9 A;  3LZJ A;  4AHS A;  1EKE A;  1K8A O;  3A5O C;  3J8A A;  3KZB A;  4BY9 C;  4B3M K;  3ZT3 A;  2P9S B;  4JKB A;  4DV1 K;  4C8M A;  4M3W A;  4LFB K;  4CGD A;  3BZC A;  5AR0 A;  1ZBS A;  4CZI A;  3UKU B;  5IT9 O;  3PIO L;  1YVU A;  3KWI A;  4H5T A;  1NOY A;  4OO1 J;  5HRP A;  3KLH A;  5KRS A;  1KLN A;  4DFM A;  2QA4 N;  3L4Q A;  4A2A A;  2D0B A;  4FOI A;  3NF9 A;  5C24 A;  3SPZ A;  1JKH A;  3D2F A;  2RE2 A;  2YCH A;  2E5L K;  2RN2 A;  3H08 A;  2O8C A;  4OPJ A;  4GW6 A;  4C1N I;  3KTQ A;  3AVB A;  1XWL A;  1RDU A;  2UYT A;  1XHX A;  1RCH A;  3GE1 A;  1SL2 A;  4FXD A;  4DSE A;  1IH7 A;  1KVB A;  1GLA G;  1Z6R A;  1RTI A;  3NVK A;  1IBM K;  1P90 A;  4RWT A;  4HCB A;  1QHT A;  1S5J A;  3EE8 A;  4I9L A;  4FPA A;  2HHT A;  4DTM A;  1L3V A;  3EZ5 A;  2OTL N;  4RW9 A;  1U2V B;  4AHT A;  3RVC A;  2UUA K;  1RT6 A;  4AIL C;  2F9W A;  3PO4 A;  2G8F A;  1QQC A;  3EKS A;  4CES A;  3QEI A;  5AQS A;  3AVK A;  3A8Y A;  2G8U A;  2NUB A;  2HVH A;  1J53 A;  3AA3 A;  4TSX A;  5AQM A;  3VQB A;  4CI6 A;  3AY9 A;  4NYN A;  1EWQ A;  2EWS A;  3KKS A;  3SQ1 A;  2FSJ A;  1FXX A;  2QWL A;  4CZE A;  1R0A A;  5FRM A;  4DCH A;  3VA0 A;  3AO1 A;  4EHU A;  2GTD A;  1KQS M;  4BGB A;  5FPE A;  4E1N A;  4BG9 A;  4K8Z A;  3DYA A;  5CZ2 A;  4CEE A;  3B6O A;  4FWS A;  3PX4 A;  4BRK A;  3CG7 A;  4FM1 A;  2KHO A;  3RTV A;  3O5B A;  3TAM A;  2HST A;  3SZ2 A;  4EP4 A;  4A5B A;  1W9H A;  5M1K A;  2GUP A;  3TAF A;  4K8X A;  1HR0 K;  3QIO A;  3SPY A;  1ZC6 A;  5GAH P;  2PAV A;  2GBZ A;  4GKJ K;  1X9M A;  4CHO A;  3HP9 A;  4M7Y A;  3THX A;  5EX5 A;  2H3G X;  5KPR A;  4CJ7 A;  3LP1 A;  4CCH A;  3ZSV A;  2GWJ A;  3HBT A;  1QZ6 A;  3HST B;  2GX9 A;  2BGG A;  1XUP O;  1RBR A;  2GWK A;  4N5S A;  1IKX A;  3U4L A;  2P9S A;  4JI6 K;  4G1Q A;  3LP3 A;  1R59 O;  4WQ5 C;  3AGK A;  1MWM A;  3SNN A;  1NKB A;  1BUP A;  3AA4 A;  5AQI A;  3FLC O;  1VSF A;  4DSF A;  3RR8 A;  2B6A A;  3V9S A;  1XHZ A;  3AVJ A;  4BG8 A;  4KHS A;  3CF5 L;  4CEQ A;  4E7J A;  1HNV A;  1W2B M;  1VK0 A;  3DRP A;  4DTX A;  1LWF A;  4DUZ K;  3OYI A;  3AVG A;  2P51 A;  1NJW A;  1GLL O;  4CZH A;  4FJ7 A;  3PSI A;  4QS7 A;  4DFP A;  3RWU A;  2VGM A;  3M6G A;  5K14 A;  3OVN A;  3V81 A;  1QZ5 A;  2PBD A;  1NGA A;  3MED A;  4Z0U A;  1A5V A;  3JS6 A;  4AH9 A;  2UXC K;  3AO2 A;  1UOC A;  4DR4 K;  2V7Z A;  2ASO A;  3LZI A;  1T03 A;  1XI1 A;  3O9R A;  1HKG A;  3OYF A;  2F4V K;  1NBW A;  4Z4F A;  3HXM A;  4FJ8 A;  3NF8 A;  4JI7 K;  1U2V A;  4IOA L;  4CHN A;  5M1O A;  3SAH A;  1RDW X;  4PL7 A;  3ULE A;  5E84 A;  3ZSQ A;  4EAH D;  3HM9 A;  1EET A;  4M42 A;  5J2P A;  4N76 A;  2BUP A;  3T1A A;  3TAE A;  4JHD A;  1Y64 A;  4CBX A;  2E4L A;  4FJJ A;  3ZET B;  4KHN A;  4JKG B;  1GLE G;  3KK3 A;  4CZL A;  3K5O A;  1X1P A;  3SUQ A;  1SUQ A;  2HBK A;  3WNE A;  1YI2 N;  3I0R A;  4BWJ A;  4JI4 K;  3RRG A;  3HPG A;  1FK9 A;  2V7Y A;  2Z1G A;  2WOM A;  4CEC A;  4DSK A;  4HUG A;  4BRA A;  5KRT A;  3L6Q A;  1XMQ K;  1T6D A;  4MO4 A;  4C8N A;  4BR7 A;  3QNO A;  1JLB A;  3K59 A;  2AP1 A;  1BOT O;  3R3L A;  2OPQ A;  3OBW A;  4FLV A;  4WYB A;  4BAC A;  4DTS A;  2FF6 A;  4BVP A;  5A2Q O;  4BRD A;  3SBT A;  2RPI A;  4BRM A;  1NGE A;  3NCI A;  1D4X A;  4GV9 A;  3S3N A;  2HF4 A;  4JKC A;  5BR8 K;  5E41 A;  3WEE A;  3IMX A;  4LSL A;  1MA9 B;  5BPM A;  1U6Z A;  4CBW A;  2G8H A;  3IRX A;  3LDO A;  1HLU A;  2IIR A;  1WNS A;  1JL1 A;  3VQE A;  3LL3 A;  3DLH A;  3LWL A;  3TWH A;  1OH5 A;  3M8Q A;  5CYQ A;  1DTQ A;  2V51 B;  3M5R A;  5AFU A;  5BN9 A;  4Y1D A;  3MAQ A;  2VQF K;  4FK0 A;  5C10 A;  3KK1 A;  3OYB A;  4W5Q A;  1VSM A;  1SZ2 A;  4J2A A;  5FPN A;  4KKO A;  2HMP A;  1KC8 O;  4E7L A;  1XNQ K;  1YTA A;  1YJN N;  3O3H A;  4ZHR A;  2HOE A;  3CCQ N;  3IS9 A;  3H1V X;  1SKR A;  1V4T A;  1VRU A;  4KRF A;  4FW2 A;  4DTP A;  3VEX A;  1SQK A;  3CQ8 A;  4CF1 A;  3SCX A;  1WUA A;  4JKF A;  2B5J A;  1HNZ K;  1WLJ A;  4JLH A;  3MX2 A;  3VQ9 A;  1JLC A;  1DLO A;  2LSN A;  4JK7 A;  2HVI A;  4PKG A;  2YX6 A;  1VSD A;  4XH4 A;  4A62 A;  3IKM A;  3OJS A;  1C1A A;  2YHY A;  3OBY A;  2O4I A;  1VQ9 N;  4FZZ A;  2X6N A;  1VQ8 N;  4FLX A;  3ZX2 A;  4FWK A;  1CXQ A;  3O1W A;  4IXC A;  4MDB A;  5ADX A;  4ISF A;  3I8D A;  4DTJ A;  4B9N A;  3THW A;  1OH7 A;  1VSL A;  4I6M B;  4PL8 A;  3AVL A;  2HHH K;  2NRT A;  4QS9 A;  3VEZ A;  3C6H A;  3V4I A;  4BC3 A;  4NLB A;  1ATN A;  3O6W A;  1VSI A;  3L2R A;  2FLO A;  1T8E A;  4EZ9 A;  2D4W A;  3ZEU B;  3J7A P;  1FW6 A;  2FSN A;  4H0P A;  5AQG A;  1T6C A;  1VHX A;  4HWI A;  2QM1 A;  3AVI A;  2AJQ A;  2G8W A;  3K2P A;  3TI0 A;  4DUY K;  2HNZ A;  3ZET A;  3Q7B A;  1RTD A;  4LD0 A;  3ZSR A;  4JKG A;  4M63 C;  4OX9 K;  3QES A;  3B6P A;  2ZD1 A;  5LL6 Z;  4OKK A;  4WQ4 A;  4B8C A;  4X62 K;  3K0S A;  1VQ4 N;  4DSI A;  2KW4 A;  4CEF A;  5AJ3 K;  3I0S A;  4O8U A;  4NO7 A;  2GEM A;  1WBB A;  4MDA A;  2O4G A;  3SQ4 A;  4FM0 A;  3C7N B;  3QIC A;  3OTO K;  1EQY A;  4DV6 K;  1BIZ A;  3PSF A;  4F4K A;  5TKW A;  1TYQ B;  4ILJ A;  1VQO N;  3P39 A;  1ASV A;  4BRC A;  3MN9 A;  4KHQ A;  2HHW A;  5JMV A;  2ITM A;  3LDS A;  5BRH A;  4DKW A;  3TAG A;  5BRD A;  3H3O B;  3PLA A;  4LH4 A;  4ZTJ A;  1A5W A;  2ATQ A;  2Q97 A;  3KHY A;  3KK7 A;  2VCP A;  4J2E A;  3CCV N;  2NRR A;  3ENB A;  4BRI A;  1VQL N;  4CJK A;  4UY8 O;  4IOC L;  1SL0 A;  3O4N A;  4JD2 B;  1HYV A;  4JK9 A;  4IJA A;  3WNG A;  1U04 A;  1HJR A;  2V52 B;  3FFI A;  4FJN A;  4W5N A;  1S1U A;  1YTU A;  4FJ9 A;  2IVP A;  1X9J A;  3THY B;  3NMU A;  5MLC Q;  3KLI A;  1S1V A;  4HTU A;  3DXM A;  2D0C A;  3HL8 A;  4IKF A;  5GAE P;  3CHW A;  1E4F T;  2DTU A;  2Z1H A;  5DK5 A;  5BPL A;  4XEI A;  4CJ5 A;  4KI4 A;  1Z26 A;  2YNH A;  2CGJ A;  1N6Q A;  4LFC K;  3LAM A;  3ZT1 A;  3LM2 A;  3O8M A;  1TUY A;  4DMN A;  5EVZ A;  5I9E B;  2DFH A;  2HF3 A;  1I94 K;  3HOT A;  4FZX C;  3DAW A;  4CJF A;  1GLJ O;  4W5O A;  3RRH A;  4AF1 A;  4B8A B;  3TSQ A;  2P9L A;  4JI1 K;  4FVM A;  5SWM A;  2Q3S A;  1NK4 A;  2WFB A;  2HNY A;  3LDL A;  5IWA K;  3BZK A;  3I55 N;  4PQU A;  4KO0 A;  4M3Z A;  4DV3 K;  3K57 A;  4BRG A;  1NK0 A;  3CET A;  3QEX A;  1NJI O;  3GDQ A;  3CFR A;  3C65 A;  3TAP A;  1BI4 B;  1TK0 A;  1DTT A;  5CZ1 A;  2ZWH A;  2P9P B;  4DTN A;  2HHX A;  5J2M A;  5AQP A;  5TKY A;  3C7N A;  1NJY A;  4DQP A;  3U3G A;  2O8D A;  4C8L A;  2Q1N A;  1S1X A;  3AAR A;  3CJ7 A;  1XC3 A;  1TYQ A;  1B9D A;  1KSP A;  3VEV A;  1KTQ A;  5B8H A;  3KLE A;  5CHI A;  4CEO A;  3G10 A;  4FO0 A;  4YDU C;  3NF7 A;  1N33 K;  4IG0 A;  3GG4 A;  4CK2 A;  3CIP A;  4M3T A;  3QER A;  1ZYQ A;  3JAM O;  5HBM A;  4L8R B;  4FJH A;  4IO8 A;  2ITG A;  5EU7 A;  3HYF A;  1HX1 A;  4QOZ B;  4E1M A;  3ENH A;  3OYG A;  5M1N A;  4KH6 A;  5DM6 L;  2VG6 A;  2YI1 A;  4PKI A;  4B3T K;  4CJT A;  4O4G A;  3AAP A;  3AO5 A;  3AA5 X;  3SJH A;  4A59 A;  3QNN A;  1GLD G;  1WSE A;  4IWV A;  2IC3 A;  2P5O A;  3SUO A;  3PO5 A;  3HTV A;  4ELT A;  3L3V A;  5AQF A;  1LV5 A;  3THY A;  5AQH A;  1J54 A;  4O5F A;  4F9O A;  3VTI A;  4Z4I A;  5J2Q A;  3V9U A;  1HMV A;  1N5Y A;  4CFC A;  1QQM A;  4AM6 A;  1T44 A;  3P4I A;  1C0T A;  4H4M A;  4H5V A;  4H0X B;  1XMO K;  2YV0 X;  1GLC G;  3FGU A;  5AZI A;  3R6M A;  3N4P A;  3H45 C;  1OH8 A;  4DTU A;  1J6Z A;  4IJN A;  2XY5 A;  3KJV A;  5AQO A;  3DLB A;  4FJM A;  2JGU A;  3CD6 N;  1P8Z A;  1Y97 A;  3MCP A;  3CPE A;  2F8S A;  4JI3 K;  3LDN A;  1RIL A;  2I7P A;  4WQ5 A;  2KZZ A;  2NRV A;  1ESV A;  1HYZ A;  1K73 O;  3PV8 A;  3OS0 A;  1RTJ A;  3OA9 A;  1C0M A;  3VGM A;  1IBL K;  1ZBH A;  4H4O A;  4ID1 A;  4B1X B;  2ZGY A;  2ETJ A;  5E26 A;  2Q36 A;  4B1Z A;  1NK8 A;  4CK1 A;  3ISN C;  4CF8 A;  4CGG A;  4OVL A;  1SKS A;  1TUU A;  1WB9 A;  1BI4 A;  1IJJ A;  3O08 A;  4E7H A;  3ULD A;  3ULE B;  2P9P A;  2RF2 A;  2OZM A;  4CK3 A;  4BC4 A;  3ALY A;  5C42 A;  2HHU A;  4KB1 A;  4A61 A;  4V19 S;  4JS5 A;  3MWP A;  3HM8 A;  1BDG A;  2ZJQ L;  4FLW A;  4JHD B;  4MFB A;  1BWF O;  2P9K A;  1TKX A;  4B3R K;  4BDP A;  2JLE A;  1RDA A;  3VQ4 A;  1RT7 A;  4CGI A;  1IKW A;  4BR0 A;  4GVE A;  4BRL A;  4DLE A;  5FRO A;  2YKN A;  2IVN A;  4CVN E;  4WFB L;  3VTH A;  2E1Y A;  4M7X A;  4DS4 A;  3O4Q A;  4CHQ A;  5JLF A;  2IGI A;  4AQY K;  3VQC A;  5GIP A;  2HBJ A;  2CH5 A;  2R7Y A;  4BQL A;  4DR7 K;  1JXB A;  2XRI A;  3NBP A;  3NE6 A;  4JI5 K;  1XC9 A;  4E0D A;  2A42 A;  1NLV A;  3AGR A;  3SQ2 A;  2IDO A;  3S3M A;  4DR1 K;  3WXI A;  3MXM A;  2Z1J A;  3QET A;  4LSN A;  1FKO A;  1RT5 A;  2HND A;  3R9P A;  2KTQ A;  2P9I B;  3MEG A;  5KQD A;  1D9D A;  1C6V A;  3WEE B;  2AA4 A;  2PZS A;  4PHT X;  1LW0 A;  5EY4 A;  4KV8 A;  1RTH A;  5KPT A;  3NDK A;  2YKM A;  5FPM A;  3CER A;  4JEP A;  5CYM A;  4YOW A;  4DS5 A;  2XY6 A;  1E4G T;  3FZF A;  3PX6 A;  3TAR A;  2QWN A;  3C6A A;  1RBU A;  4FW1 A;  5JS2 A;  3UKR B;  3NGZ A;  1QHA A;  1BA0 A;  3VF2 A;  1NOZ A;  1ASU A;  2O8B A;  1KFD A;  4CJQ A;  4NYF A;  4CZM A;  1ZBU A;  4BRF A;  3BDP A;  2DY4 A;  3RMB A;  1N36 K;  1EXQ A;  3QFU A;  1HNI A;  5M1P A;  4IEE A;  3ATU A;  2HW3 A;  4H0Y B;  3M8P A;  4M3Y A;  4DQQ A;  4JI0 K;  3WXJ A;  1SS6 A;  1CZA N;  3CJA A;  2JWK A;  4JKD A;  4CJP A;  1VAZ A;  5C12 A;  4LF4 K;  5HLF A;  2E88 A;  3OW2 M;  4CJR A;  3VGL A;  3JSM A;  4C8O A;  3RR7 A;  1RDB A;  4FYD A;  4B9Q A;  4HUF A;  2QKB A;  3D45 A;  4FWQ A;  1ZBI A;  3O4W A;  3RMA A;  5AQL A;  3CCS N;  3ZT0 A;  1QVG M;  4I9Q A;  2GV9 A;  1NGH A;  4Z4C A;  3L2Q A;  3MMV A;  4IFE A;  1ZXO A;  4EZ6 A;  4H5N A;  2ZGZ A;  3THW B;  1WSI A;  4N41 A;  1RBT A;  1BCM A;  1S72 N;  5J1E A;  3ATV A;  1IKY A;  4WFN L;  2BH1 A;  1L3S A;  3DRS A;  3SLC A;  1TK5 A;  3E9O A;  5GAG P;  1TVR A;  4FJI A;  4GNI A;  4JRP A;  4O55 A;  3OYE A;  4BRH A;  4FWM A;  3K5L A;  3AVN A;  3KLF A;  4DV5 K;  1L5U A;  2OZS A;  1BHL A;  1CLQ A;  3VQ5 A;  2YNI A;  4O0J A;  1G15 A;  3C6T A;  1RT2 A;  4KTQ A;  4CJ4 A;  3TAQ A;  5AQK A;  2NLX A;  1NGF A;  4BQZ A;  3MEC A;  1WOQ A;  4O5B A;  4BDY A;  1TAU A;  3UB5 A;  1ATR A;  3NGY A;  3HSC A;  3CXC M;  4CJ3 A;  1Q7Y O;  5AQU A;  2VG5 A;  3ZT4 A;  2DFF A;  3VEW A;  4GMJ B;  1GOC A;  3VN5 A;  2FXU A;  3CCJ N;  5F2R A;  1WN7 A;  1RDD A;  3FE1 A;  4PA1 A;  3ITH A;  3ZSO A;  3V9X A;  4FJ5 A;  2P9I A;  3MDQ A;  1T05 A;  3CC7 N;  4JAX A;  3A5L C;  3HPO A;  1QTM A;  3TTD A;  1X9W A;  1IKV A;  3L2V A;  2Q31 A;  1U4B A;  4H8K A;  1TK8 A;  4FLT A;  3K9J A;  3EO3 A;  3CME N;  4NXM K;  3VEN A;  2NRX A;  2VYP A;  3KLG A;  1YIT N;  3MN5 A;  3OYC A;  4FCY A;  1YT3 A;  3DWL A;  4O8K A;  1JCE A;  3HRG A;  1REV A;  4GKK K;  3UKR A;  1NK5 A;  5JVH L;  3G25 A;  3W0L A;  5DMR A;  3EYZ A;  2P1J A;  4DU1 A;  4CJS A;  2F9T A;  3C6U A;  3K5N A;  3PX0 A;  1YF5 L;  1BO5 O;  3DJC A;  5AZJ B;  2BAN A;  4OKE A;  1NJZ A;  2PYL A;  3P83 D;  1B9F A;  4E7I A;  4FWP A;  2D1K A;  3CCM N;  2G8I A;  4EHT A;  4KI6 A;  5T7B A;  4DF8 A;  1NM1 A;  4DB3 A;  4LFA K;  3NH0 A;  3CJ1 A;  2UXB K;  1ATS A;  4A57 A;  1VSE A;  3DXM B;  5C0Y A;  2HHS A;  2I5J A;  2X6S A;  3H6E A;  3V1O A;  1UAX A;  3B8A X;  2YHA A;  4OPH A;  1WSF A;  3QEV A;  3HVR A;  3BY5 A;  3R1X A;  2P9U A;  4RW8 A;  5AQV A;  3P1G A;  4B1U B;  3DLK A;  4BE0 A;  3O9Q A;  1JLG A;  3FR0 A;  2BE2 A;  1EP4 A;  2KKZ A;  1TGO A;  3T3F A;  4B9U A;  2FSK A;  2FBV A;  3O9S A;  3OS1 A;  4ICL A;  5HRN A;  5AFU H;  2QK9 A;  4K41 A;  5D3G A;  1ZBF A;  5AQX A;  1YAG A;  1X3M A;  2W40 A;  1K6Y A;  4FK4 A;  4DTR A;  3VEY A;  1XNR K;  2VGN A;  4CIE A;  1O13 A;  4KH4 A;  1QSS A;  5JS1 A;  2FBX A;  3VF4 A;  2P9L B;  2D0P A;  4B9T A;  4CW7 B;  2XHB A;  4FLY A;  4CEZ A;  4CGH A;  1WAJ A;  3HJF A;  4R79 A;  3CM5 A;  1LAV A;  1IG9 A;  1BQM A;  2GUI A;  2HBM A;  4PUO A;  3RMC A;  4B9V A;  3G4S N;  1NK6 A;  2DPN A;  4CZF A;  3CCR N;  4CHP A;  3DRR A;  4Z94 A;  4RTF D;  1NGJ A;  4XIU A;  1OVY A;  4DR5 K;  2O8E A;  3CCU N;  3SAF A;  4F3T A;  2O8D B;  4PKH A;  4LF7 K;  4FK2 A;  1TL1 A;  5J2N A; 
#chains in the Genus database with same CATH homology
 3F9K A;  3VA0 A;  4CEO A;  3G10 A;  3AO1 A;  3NF7 A;  1W0H A;  4LH5 A;  1Q8I A;  4IG0 A;  4E1N A;  4K8Z A;  4CK2 A;  3DYA A;  1LW2 A;  4AHR A;  4M3T A;  3QER A;  4CEB A;  5CZ2 A;  4FJG A;  1VRT A;  4B9M A;  1ZYQ A;  4CEE A;  3B6O A;  2X78 A;  3NAE A;  5HBM A;  5KTQ A;  4FJH A;  3PX4 A;  4L8R B;  4DWI A;  4B9S A;  1BQN A;  2OPR A;  3CG7 A;  4FM1 A;  2ITG A;  4YNQ A;  3RTV A;  5EU7 A;  1U47 A;  1CZB A;  3TAM A;  3HYF A;  3SZ2 A;  1JLF A;  3DM2 A;  1GOB A;  4EP4 A;  4QOZ B;  4E1M A;  3QLH A;  1W9H A;  3OYG A;  2VWK A;  3TAF A;  4K8X A;  4DLG A;  4IBN A;  3QIO A;  2HHV A;  3SPY A;  4QAG A;  1ITG A;  1HYS A;  2VG6 A;  3ZSY A;  1HQU A;  3MXJ A;  4CFA A;  4CJT A;  3OYJ A;  1C1C A;  4O4G A;  2GBZ A;  3PY8 A;  2EHG A;  3AO5 A;  3AA5 X;  1JL2 A;  2Y1J A;  1JLA A;  4CHO A;  3HP9 A;  1WSE A;  2ZE2 A;  4CIG A;  3QNN A;  1X9M A;  2IC3 A;  2P5O A;  3SUO A;  3G0Z A;  3OYN A;  3LP1 A;  4CCH A;  3PO5 A;  2IS3 A;  2F8T A;  4ELT A;  3ZSV A;  4CJE A;  3L3V A;  1QE1 A;  3HST B;  3NGI A;  4PWD A;  1LV5 A;  3KKR A;  2BGG A;  1J54 A;  1BCO A;  1RBR A;  4ZTF A;  4Z4I A;  3DOK A;  3V9U A;  1HMV A;  3DOL A;  4N5S A;  5J2Q A;  3SJJ A;  1IKX A;  1N5Y A;  4CFC A;  2D5R A;  4G1Q A;  4CJV A;  3LP3 A;  4DFJ A;  3SNN A;  1C0T A;  1NKB A;  4H4M A;  1LAW A;  3V1Q A;  3AA4 A;  2YV0 X;  3THV A;  2KFN A;  1TL3 A;  5FDL A;  3RMD A;  1VSF A;  4ID5 A;  3NH1 A;  4DSF A;  2XO7 A;  3RR8 A;  2B6A A;  3V9S A;  4Y1C A;  4DTU A;  1XHZ A;  3AVJ A;  4KTZ A;  4KHS A;  3HO1 A;  4CEQ A;  2XY5 A;  3KJV A;  4E7J A;  4W5R A;  3DLB A;  1HNV A;  2JGU A;  4FJM A;  1VK0 A;  3DRP A;  3L2W A;  2VG7 A;  3CYM A;  1LWF A;  3TR8 A;  3V1R A;  4DTX A;  3AVH A;  3OJU A;  4DQI A;  2P5G A;  3OYI A;  4KPY A;  1Y97 A;  3BGR A;  3AO3 A;  3QIP A;  4CF2 A;  4DU4 A;  4HUE A;  4HVJ A;  4KFB A;  3AVG A;  4I2Q A;  2F8S A;  3QEP A;  2P51 A;  1NJW A;  4KTW A;  5HRO A;  4NCA A;  4PY5 A;  4I7F A;  1VSH A;  1RIL A;  3ZSW A;  4FJ7 A;  1C0U A;  2YNF A;  2KZZ A;  3LPT A;  4DFP A;  3RWU A;  3D0P A;  5K14 A;  3OS2 A;  1HYZ A;  3OVN A;  4F8R A;  3V81 A;  3PV8 A;  3OS0 A;  1RTJ A;  3MED A;  1RT1 A;  4Z0U A;  1A5V A;  1C0M A;  1KVC A;  1KVA A;  4AH9 A;  4BE1 A;  4B9L A;  3AO2 A;  1ZBH A;  1UOC A;  2RKI A;  4H4O A;  4CED A;  4Z4G A;  3LZI A;  1U48 A;  4ID1 A;  1T03 A;  1XI1 A;  2OPS A;  2ETJ A;  3DLG A;  3QIN A;  3SUN A;  1VSJ A;  3LWM A;  4KRE A;  3OYF A;  4ELU A;  1NK8 A;  3ASM A;  3OYA A;  1UWB A;  3NF8 A;  4CK1 A;  3HXM A;  4FJ8 A;  3ISN C;  4CF8 A;  4WE1 A;  4OVL A;  4CGG A;  4CHN A;  1SKS A;  3SV4 A;  4KHY A;  1ASW A;  2G8W A;  1BI4 A;  1NKE A;  1QS4 A;  3ZSQ A;  4OPK A;  4E7H A;  3ULD A;  3V9Z A;  1KCF A;  5I3U A;  2RF2 A;  1LWC A;  3HM9 A;  1EET A;  2OZM A;  4M42 A;  4CK3 A;  5J2P A;  4N76 A;  2WON A;  4LY7 A;  3ALY A;  5C25 A;  5C42 A;  2HHU A;  3T1A A;  3TAE A;  4KB1 A;  2A1R A;  4CJU A;  3IG1 A;  4JS4 A;  1HRH A;  3S9H A;  4JS5 A;  3TAB A;  4FLW A;  5FRM A;  4MFB A;  4E7K A;  4FLU A;  1TKX A;  1D8Y A;  4ELV A;  4F3O A;  2E4L A;  4BDP A;  2XY8 A;  4FJJ A;  2A1S A;  4DQS A;  3IAY A;  2JLE A;  1RDA A;  4OJR A;  2FBT A;  3CFP A;  4EP5 A;  1RDC A;  1IO2 A;  2Y1I A;  4Z4F A;  4KHN A;  2F96 A;  2X74 A;  3VQ4 A;  4CIF A;  1RT7 A;  3KK3 A;  1JLE A;  1IKW A;  3K5O A;  3QO9 A;  1X1P A;  4CGI A;  3DMJ A;  2IOC A;  4CFB A;  3SUQ A;  1SUQ A;  4B3O A;  4CGJ A;  2FBY A;  4DLE A;  3T19 A;  3WNE A;  5FRO A;  2YKN A;  3I0R A;  4CEA A;  4BWJ A;  3RRG A;  4DS4 A;  3HPG A;  3O4Q A;  4CHQ A;  1FK9 A;  2Z1G A;  2IGI A;  2WOM A;  4RW7 A;  3VQC A;  4CEC A;  1J5O A;  4DSK A;  5I42 A;  2KZM A;  1I3A A;  3TAN A;  4HUG A;  2R7Y A;  3AO4 A;  1Z25 A;  5KRT A;  4Z4E A;  1JXB A;  4C8N A;  4M3U A;  1UA1 A;  4FZY A;  2XRI A;  3NBP A;  4OKJ A;  1CZ9 A;  4BWM A;  1JLB A;  3VQ8 A;  3NE6 A;  3K59 A;  3V9W A;  3QNO A;  1NK7 A;  1X9S A;  3KK2 A;  2OPQ A;  1XC9 A;  4FLV A;  4E0D A;  1BGX T;  4BAC A;  3SQ2 A;  4DTS A;  1TKD A;  1O1W A;  3K5M A;  1SV5 A;  2IDO A;  3AVA A;  3S3M A;  1L3T A;  3AV9 A;  5SZT A;  3MXM A;  2RPI A;  3SYZ A;  3KIO A;  2Z1J A;  3NCI A;  3QET A;  1FKO A;  1RT5 A;  1S9E A;  2HND A;  1RT4 A;  2B4J A;  4LSN A;  3S3N A;  5FRN A;  2KTQ A;  4E3S A;  3HPH A;  3UIQ A;  3MEG A;  5E41 A;  2KFZ A;  3S3O A;  2PYJ A;  5KI6 A;  4LSL A;  1D9D A;  1C6V A;  4J2D A;  2G8H A;  3P5J A;  4Q5V A;  3IRX A;  2PZS A;  1LW0 A;  3M8R A;  1RT3 A;  3MEE A;  1WNS A;  1TKZ A;  4KV8 A;  3WNF A;  1RTH A;  1WAF A;  3NDK A;  2G8K A;  1JL1 A;  2YKM A;  3VQE A;  4I2P A;  3LWL A;  1C1B A;  3DLH A;  2OYQ A;  5CYM A;  4UQG A;  3TWH A;  4KB0 A;  3VQ6 A;  1KLM A;  4OLB A;  4F2R A;  3DLR A;  4M3R A;  3ZSZ A;  3OYH A;  3M8Q A;  4DS5 A;  5CYQ A;  1DTQ A;  2XY6 A;  4CE9 A;  4FK0 A;  1WSH A;  2QXF A;  4Y1D A;  3MAQ A;  2VWJ A;  3PX6 A;  3HT3 A;  3KK1 A;  3TAR A;  4CFD A;  3U6F A;  3LAN A;  3OYB A;  4W5Q A;  3KD1 E;  1VSM A;  3OY9 A;  1RBU A;  2HB5 A;  4FW1 A;  5JS2 A;  5KGX A;  3NGZ A;  4CJW A;  3JYT A;  4KKO A;  4J2A A;  4E7L A;  4BE2 A;  1YTA A;  1NOZ A;  1ASU A;  3O3H A;  3LAK A;  2IAJ A;  1KFD A;  4CJQ A;  4F2S A;  3VQQ A;  4RG8 A;  4ZHR A;  4NYF A;  4N56 A;  1ZBU A;  3IS9 A;  3BDP A;  2DY4 A;  3NFA A;  3RMB A;  4E89 A;  1SKR A;  1VRU A;  2ZQB A;  2DFE A;  1EXQ A;  1S9G A;  4KRF A;  1HNI A;  4FW2 A;  4DTP A;  2E6M A;  4RW6 A;  3CQ8 A;  5HP1 A;  4CF1 A;  2HW3 A;  3SCX A;  3M8P A;  4M3Y A;  4DQQ A;  3LAL A;  2B5J A;  2HMI A;  1WLJ A;  1BL3 A;  4CJP A;  4JLH A;  5HLF A;  1VSK A;  4DTO A;  3VQ9 A;  3A2F A;  1U49 A;  1JLC A;  4CJR A;  2E6L A;  1DLO A;  4KHW A;  2LSN A;  3JSM A;  2HVI A;  1SL1 A;  3WNH A;  1D9F A;  4C8O A;  1VSD A;  3RR7 A;  3OJS A;  1RDB A;  1C1A A;  4FYD A;  2Z1I A;  3O3F A;  4HUF A;  1Q9Y A;  2QKB A;  3VQA A;  3D45 A;  2O4I A;  1R0A A;  4KAZ A;  4FZZ A;  1ZBI A;  4HHT A;  2X6N A;  4FLX A;  1GOA A;  3RMA A;  3NHG A;  3OYM A;  3ZT0 A;  4DG1 A;  4Q0B A;  1CXQ A;  3I8D A;  5KGW A;  2GV9 A;  4DTJ A;  4B9N A;  4I9Q A;  4OGE A;  4Z4C A;  3L2Q A;  3HK2 A;  3AA2 A;  3OYL A;  1VSL A;  4EZ6 A;  2YNG A;  3AVL A;  1T7P A;  4HCC A;  3V4I A;  1WSI A;  4N41 A;  3L2R A;  1VSI A;  1T8E A;  1JXE A;  1RBT A;  4EZ9 A;  1BCM A;  3CFO A;  5J1E A;  1B92 A;  3NF6 A;  4FJK A;  1IKY A;  4RW4 A;  1NJX A;  3NH2 A;  3EY1 A;  1L3S A;  3DRS A;  4Z4H A;  4CHY A;  4M45 A;  1BIS A;  3AVI A;  2AJQ A;  4W5T A;  4CGF A;  4M41 A;  1TV6 A;  3K2P A;  1HPZ A;  3TI0 A;  1TVR A;  2HNZ A;  3VQP A;  1TK5 A;  1RTD A;  4FJI A;  4LD0 A;  3ZSR A;  4JRP A;  3QES A;  4O55 A;  3OYE A;  3B6P A;  2ZD1 A;  4IDK A;  4FJX A;  4FLZ A;  3AVC A;  4OKK A;  3ZT2 A;  3K5L A;  3QEW A;  4B8C A;  3AVN A;  3VA3 A;  3KLF A;  1L5U A;  2OZS A;  1BHL A;  3V6D A;  1CLQ A;  3HP6 A;  4KHQ A;  1CXU A;  2OPP A;  3VQ5 A;  4DSI A;  2KW4 A;  4AHC A;  2YNI A;  4O0J A;  1G15 A;  4CEF A;  3I0S A;  2HHQ A;  3C6T A;  3VQ7 A;  2D0A A;  1RT2 A;  3DI6 A;  3PUF A;  4CJ4 A;  4KTQ A;  3TAQ A;  3CM6 A;  4C8K A;  4O0I A;  3L3U A;  3OYK A;  4KHU A;  3MEC A;  3K58 A;  1KRP A;  2O4G A;  4CHZ A;  3SQ4 A;  4O5B A;  4FM0 A;  4BDY A;  1TAU A;  1BIZ A;  4MQ3 A;  3NGY A;  4CJ3 A;  1ZBL A;  4F4K A;  3AVF A;  4OLA A;  1RBS A;  2YHB A;  2VG5 A;  3ZT4 A;  1ASV A;  4DSL A;  2DFF A;  3LP0 A;  4GMJ B;  1GOC A;  3VN5 A;  1Q9X A;  2XY7 A;  1UA0 A;  2HHW A;  1WN7 A;  4JRQ A;  1RDD A;  4PA1 A;  3ZSO A;  3ITH A;  3V9X A;  5HRS A;  1F21 A;  2FC0 A;  3LDS A;  1J9A A;  2EX3 A;  4FJ5 A;  1T05 A;  3E01 A;  4DF4 A;  1RNH A;  3VQD A;  3HPO A;  3SUP A;  3MXI A;  1QTM A;  4AHU A;  1U45 A;  1IKV A;  1X9W A;  4M3X A;  3L2V A;  3TAG A;  4DFK A;  1U4B A;  4H8K A;  4N47 A;  1RBV A;  1LWE A;  4AHV A;  1TK8 A;  4LH4 A;  4FLT A;  4QCL A;  4ZTJ A;  1A5W A;  2ATQ A;  1NKC A;  2QKK A;  3AVM A;  3LPU A;  4J2E A;  5CY4 A;  1JLQ A;  3KLG A;  3HVT A;  4YFU A;  4OGC A;  4CJK A;  2G8V A;  2BDP A;  4CJL A;  1SL0 A;  3OYC A;  4FCY A;  4NCB A;  4IFV A;  1YT3 A;  3OYD A;  3O4N A;  4O44 A;  1S1W A;  1I39 A;  1HYV A;  3DLE A;  4IFY A;  4FJL A;  1REV A;  3WNG A;  1U04 A;  1NK5 A;  3O3G A;  1QSY A;  5DMR A;  3EYZ A;  1HJR A;  2P1J A;  5HRR A;  4DU1 A;  4CJS A;  1NK9 A;  3FFI A;  3ZCM A;  4FJN A;  3C6U A;  3K5N A;  3PX0 A;  4W5N A;  4E19 A;  1S1U A;  1YTU A;  2BAN A;  4OKE A;  4FJ9 A;  1NJZ A;  2PY5 A;  1TKT A;  2PYL A;  3P83 D;  1B9F A;  4E7I A;  3LZJ A;  3F73 A;  3KLI A;  4IG3 A;  1S1V A;  4HTU A;  1FKP A;  1EKE A;  4AHS A;  3SV3 A;  2G8I A;  4KI6 A;  5T7B A;  4DF8 A;  3SQ0 A;  2W42 A;  1SKW A;  2D0C A;  3ZT3 A;  3NH0 A;  4FM2 A;  3HL8 A;  4M3W A;  4C8M A;  1VSE A;  4CGD A;  1A5X A;  4IKF A;  4NCG A;  2HHS A;  2I5J A;  2X6S A;  3V1O A;  3LP2 A;  1KFS A;  1UAX A;  2DTU A;  2Z1H A;  4CF9 A;  2YHA A;  1WSF A;  1WSG A;  1D5A A;  3QEV A;  1YVU A;  5DK5 A;  3HVR A;  4DQR A;  1NOY A;  4DU3 A;  5HRP A;  3KLH A;  1S1T A;  5KRS A;  4CJ5 A;  3L2U A;  1KLN A;  2OA8 A;  3SI6 A;  4DFM A;  4KI4 A;  1Z26 A;  2YNH A;  4RW8 A;  3P1G A;  3DLK A;  4BE0 A;  1N6Q A;  2D0B A;  3LAM A;  3NF9 A;  5C24 A;  3ZT1 A;  1L3U A;  3SPZ A;  1JKH A;  1S6P A;  4DMN A;  4J2B A;  1TAQ A;  4CER A;  1EX4 A;  2DFH A;  1JLG A;  2RN2 A;  3H08 A;  4OPJ A;  2BE2 A;  1EP4 A;  3KD5 E;  4GW6 A;  3KTQ A;  3AVB A;  1TGO A;  1XWL A;  3T3F A;  4B9U A;  4FZX C;  4BDZ A;  4CJF A;  1XHX A;  1RCH A;  4R5P A;  1S6Q A;  1SL2 A;  4CF0 A;  2FBV A;  3OS1 A;  4FXD A;  4ICL A;  5HRN A;  4DSE A;  3ZSX A;  2QK9 A;  5D3G A;  1IH7 A;  4W5O A;  1ZBF A;  1KVB A;  3RRH A;  1K6Y A;  4B8A B;  4FK4 A;  3U3Y A;  4DTR A;  3M8S A;  1RTI A;  4DSJ A;  5SWM A;  4CIE A;  4FVM A;  2Q3S A;  1NK4 A;  1QSS A;  2FBX A;  5JS1 A;  1QSL A;  4GVM A;  2HNY A;  4HCB A;  4PQU A;  1WSJ A;  1QHT A;  1S5J A;  4KO0 A;  4I9L A;  4M3Z A;  2HHT A;  3K57 A;  4B9T A;  1NK0 A;  2XHB A;  4FLY A;  4CEZ A;  4DTM A;  4CGH A;  1WAJ A;  3C94 A;  4RW9 A;  3EZ5 A;  3QEX A;  1L3V A;  3HJF A;  4AHT A;  3CFR A;  3CM5 A;  1LAV A;  1MU2 A;  1BI4 B;  3TAP A;  3C95 A;  1TK0 A;  1RT6 A;  1BQM A;  1IG9 A;  1DTT A;  5CZ1 A;  2GUI A;  4AIL C;  1BIU A;  3PO4 A;  4PUO A;  3L8B A;  4DTN A;  3RMC A;  1QQC A;  4CES A;  5J2M A;  1NK6 A;  2G8F A;  4B9V A;  2HHX A;  3QEI A;  4CHP A;  3DRR A;  1NJY A;  2KQ2 A;  4DQP A;  3U3G A;  4XIU A;  3AVK A;  2G8U A;  4C8L A;  2NUB A;  2HVH A;  1J53 A;  1S1X A;  3AA3 A;  4TSX A;  4F3T A;  1HQE A;  3VQB A;  4NYN A;  1B9D A;  1KSP A;  4FK2 A;  3KKS A;  1KTQ A;  4B08 A;  1TL1 A;  1FXX A;  3KLE A;  5J2N A;  3SQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...