4QOZB

Crystal structure of the histone mrna stem-loop, stem-loop binding protein (phosphorylated), and 3'hexo ternary complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
288
structure length
277
Chain Sequence
FSDPVYKEIAITNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMSYYDYICIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHTLEIEDTFQQYVRPEINTQLSDFCISLTGITQDQVDRADTFPQVLKKVIDWMKLKELGTKYKYSLLTDGSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVQTKLTIMLEKLGMDYDGRPHCGLDDSKNIARIAVRMLQDGCELRINEKMHAGQLMSVSSSLPIEGTPPPQMPHFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords histone mRNA stem-loop
publication title Molecular mechanisms for the regulation of histone mRNA stem-loop-binding protein by phosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna/hydrolase/rna binding protein
total genus 91
structure length 277
sequence length 288
chains with identical sequence E
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00929 RNase_T Exonuclease
B PF02037 SAP SAP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4qozB02
3I0SA 2ZE2A 1YTUA 2OZSA 3A2FA 3PY8A 4CJQA 4CFBA 1HYZA 3QEVA 3WNHA 4PA1A 4L8RB 4FZXC 1B9DA 4CGJA 4NCBA 4FYDA 2HHSA 2KTQA 4LY7A 1EETA 1RCHA 3T19A 1SL0A 4DTMA 4GMJB 2Y1IA 2F8TA 3IAYA 2A1SA 2HHXA 1WAJA 3AA3A 1HYVA 4CJWA 1NKBA 1LWCA 4FZYA 1F21A 1MU2A 4CK1A 1WSJA 1KTQA 1TK0A 4W5QA 3SPYA 3HPGA 3ZSVA 2D0CA 4TSXA 4BE1A 1HQUA 1XWLA 4LD0A 1B92A 3OYCA 3RMBA 1U4BA 3NF7A 1NKEA 4ELVA 3SUPA 3LP1A 5E41A 2HNZA 4CF0A 1CZBA 2FC0A 2LSNA 4JS5A 3AVHA 3O3HA 1N5YA 1WSIA 1RDCA 2Z1JA 3CYMA 1RTJA 2KZZA 3KK3A 3AVLA 3LANA 3ZSRA 4BDPA 3KKRA 3HM9A 1QSSA 2FBVA 4CJRA 1UA0A 2JLEA 1NJYA 2E4LA 1NJWA 4CHZA 2DY4A 1RDDA 2G8HA 1RT4A 3LPTA 4O5BA 4CF2A 1UOCA 4C8NA 4B9MA 4M3XA 5FRMA 3OJSA 1UA1A 3AO5A 4K8XA 4AHSA 2HMIA 3PO5A 2JGUA 2YV0X 2HHVA 3L3VA 3KD1E 2ZQBA 1VSIA 4CGDA 3LZIA 3HP6A 3TABA 3WNEA 1KVBA 3DRSA 1RT6A 4CK3A 4N5SA 3JSMA 1IG9A 4DQIA 4F3TA 4FJNA 3NF6A 1XC9A 1EXQA 1L3TA 1FK9A 4MQ3A 3ZSYA 1RBTA 3DLEA 2B6AA 3PUFA 3KLGA 4DFPA 3TAFA 3ZT2A 4E7KA 4CFCA 1R0AA 1KLNA 1EX4A 4FM2A 1VSLA 1TL1A 2X78A 4FLUA 4AHCA 4J2AA 4CGGA 4N47A 1HJRA 2EHGA 3ZT3A 1SKWA 3LP2A 3AVCA 4CJ5A 2OZMA 4B9LA 3NF8A 3VQ9A 4OVLA 4M3ZA 1C6VA 2X6SA 2D0AA 4KO0A 2I5JA 3P83D 1W9HA 3ZSOA 4OPKA 3RRHA 1CXUA 4Y1DA 4E7JA 3E01A 4W5NA 3L2QA 3HSTB 3OYDA 3D0PA 4HHTA 3O3GA 2DFFA 4ZHRA 4KHWA 4DSLA 5DK5A 1EKEA 3L2RA 3V9WA 3K5OA 4RG8A 1S9GA 3C6TA 3NGIA 3K59A 3LAKA 3SPZA 4M42A 4KTQA 1C1BA 2IAJA 2QK9A 3MEGA 1T05A 1NK9A 3TR8A 4O0JA 1Z25A 1IKWA 3VQBA 1NK4A 2IGIA 4ID1A 4LSLA 2D0BA 4E0DA 4FJ8A 4CEBA 1DTQA 4HUGA 4DQRA 1L3SA 1Z26A 1B9FA 3WNGA 1QSLA 3SQ0A 4N41A 4J2DA 4F4KA 4Y1CA 4DSIA 3DRPA 3SNNA 3SJJA 4PQUA 1A5XA 4UQGA 5C24A 1JKHA 3NHGA 1U49A 2DFHA 3TANA 3ASMA 2VG5A 4OKEA 4DTPA 3AVBA 2Y1JA 1X9MA 1JL2A 4QOZB 4CFDA 2HVHA 1RT5A 3K5MA 1X9SA 4HTUA 3NH2A 1J53A 4CFAA 3VQ6A 1CXQA 1S6PA 1WLJA 3QEPA 4DQPA 1LW0A 4H4MA 2XY7A 5CY4A 3I0RA 1RBSA 3OYFA 1NK0A 2HHTA 1NK6A 4FK2A 3VN5A 3QIOA 3BDPA 1BIUA 2P1JA 4C8MA 3VQ7A 2FBYA 3SUQA 3HPHA 1Q9XA 4H8KA 3OYNA 5I42A 3CM5A 3AO3A 4LH4A 4CJLA 3SV3A 1SKRA 2X6NA 1HMVA 3B6PA 5J1EA 3OYHA 2P51A 4F2SA 4F8RA 3DRRA 4KTWA 4YFUA 4W5TA 1S1UA 1HYSA 2QXFA 2RF2A 3MECA 3OYAA 3H08A 4Z0UA 1A5VA 1KVCA 5HRRA 3ZT0A 1TVRA 3K58A 2D5RA 4IDKA 4CJVA 4BDZA 1HQEA 3QEWA 2G8UA 2PY5A 3AA2A 3CG7A 4JLHA 3F9KA 4CIGA 4DSJA 3RMCA 4F2RA 5KGWA 3U3GA 4B9NA 4BWJA 1S1VA 4QAGA 3DLBA 4Z4IA 1KVAA 4J2EA 1C0MA 2BGGA 4EP4A 5HRPA 3VA3A 3AO2A 1BISA 3AVJA 4CEZA 3KLIA 4E1NA 3RWUA 3MEDA 3AO4A 4IG0A 3AVFA 4FLYA 3V9SA 4CEAA 4ICLA 4Q5VA 4R5PA 3NH1A 1XHXA 3U6FA 1VSDA 3VQPA 3S3OA 3PO4A 3OS2A 1KFDA 4FJJA 4CJSA 4CHQA 2FBXA 4AHRA 4DG1A 1TK8A 3SV4A 4CEFA 4OLAA 1S1WA 1I39A 4N76A 3TWHA 4FCYA 3VA0A 4LSNA 1TGOA 4I2QA 4CJKA 4HVJA 3KIOA 5CYMA 2XO7A 1VSKA 3SZ2A 1NK7A 3HJFA 4DTRA 2RPIA 3KD5E 1BGXT 3K5LA 2YNHA 5J2QA 3D45A 3P1GA 4KV8A 4CK2A 3VQEA 3OYLA 4B8AB 3AVMA 3OYIA 1QHTA 4I7FA 4FJMA 3OVNA 4CIFA 3ZSQA 3HVRA 1FKPA 5J2NA 4RW7A 3C6UA 3VQ8A 3OYJA 4CHOA 3TARA 1QQCA 2RKIA 4KPYA 3C94A 3CM6A 2KQ2A 2P5OA 3ZSZA 4CEEA 4E7LA 5FDLA 4DWIA 4RW6A 1RT1A 4CJTA 4RW4A 2HHUA 1UAXA 3OJUA 3OS0A 1QS4A 1DTTA 2IDOA 1JLBA 3MEEA 1I3AA 4BWMA 2G8WA 4G1QA 3NDKA 1JXEA 5KTQA 1D9DA 4W5OA 1Q9YA 2VG7A 4AHTA 4CF1A 3M8SA 3PX6A 4OGCA 5KRTA 1HNVA 1K6YA 1RT2A 5HBMA 1ITGA 4DSFA 1D8YA 4FZZA 4Z4FA 5JS1A 1VSMA 3TI0A 3K5NA 2HVIA 4CGHA 5DMRA 4FVMA 1BIZA 4MFBA 3QIPA 1G15A 3O4NA 1YVUA 5K14A 3S9HA 1XI1A 1X1PA 1TKXA 2HNDA 2IS3A 2W42A 4PY5A 5CZ2A 4CERA 3T3FA 4KI6A 4QCLA 1WN7A 5FROA 3JYTA 1ASVA 1SV5A 3IRXA 4DSKA 4Z4EA 3QO9A 2OPRA 2WOMA 4B9VA 4B9SA 3WNFA 4CGIA 2AJQA 1S1TA 3OYMA 1S5JA 5KRSA 1NK8A 3V4IA 1ZYQA 1HNIA 1REVA 4KHYA 3AVNA 4HCCA 1ZBFA 4E1MA 3K57A 4CF8A 4EP5A 3NF9A 4KTZA 4IFVA 4JRQA 1JL1A 1D9FA 4KAZA 3TAMA 4NYNA 2YKMA 3LALA 3KLEA 4M3TA 3IS9A 4DFKA 1JLFA 1LWEA 2KZMA 2B5JA 3V81A 5SZTA 2ITGA 4ZTFA 2KFNA 2KFZA 3RMAA 1TKTA 1BL3A 4DQSA 4FK4A 1WSEA 4KREA 4DS5A 1CLQA 1GOAA 1SKSA 3VQ4A 3DLRA 4CEOA 3OYEA 5HRNA 3I8DA 3MAQA 4M3YA 3ISNC 3VQ5A 3ZSWA 5EU7A 4FLWA 1S1XA 4E3SA 4FK0A 3C95A 1J5OA 3NE6A 3NGYA 3ITHA 3LZJA 3PX4A 1LWFA 2YKNA 3HT3A 2PYJA 3LP3A 1ZBUA 2ATQA 4DQQA 4CHPA 1ZBLA 3KK1A 3HYFA 1LAVA 1C1AA 3KK2A 1DLOA 5D3GA 1GOBA 3M8RA 2YNGA 1UWBA 2NUBA 2G8VA 1TKDA 1D5AA 4HUEA 2OA8A 3PV8A 1T7PA 2F96A 1NJZA 3NBPA 1J9AA 2HW3A 4CECA 1KLMA 3SYZA 3LWMA 4FJ7A 4NCGA 4DFJA 4CHNA 2BE2A 1QSYA 3TAQA 2EX3A 2VG6A 4GVMA 4BDYA 2ZD1A 4FJKA 1XHZA 2QKBA 1KCFA 4AILC 2P5GA 3RMDA 3QERA 1NK5A 2IOCA 1QE1A 2YHBA 4YNQA 1RT3A 4FLZA 4DU4A 1FKOA 4ID5A 1JLQA 3B6OA 3DLHA 1LAWA 4FJXA 2BANA 4Z4GA 3OYBA 3KJVA 3TAGA 3VQQA 5SWMA 3CFPA 3ZCMA 1JLEA 1IKXA 4H4OA 4FW2A 1HPZA 3LDSA 4HUFA 4BACA 3RRGA 3OS1A 4C8KA 3QEXA 2VWJA 3VQDA 4DSEA 3QNNA 4CJ3A 4DS4A 4I9QA 3T1AA 4OLBA 4FM0A 4CESA 3KLFA 4I9LA 4M3RA 4ZTJA 4I2PA 1L3VA 4OJRA 4IKFA 3HO1A 4M3WA 3SQ2A 3VQAA 2Z1HA 1IKVA 3HP9A 3AA4A 4O55A 1S9EA 4CJFA 4CJ4A 1IH7A 4OKJA 3CQ8A 1T8EA 4BE2A 5J2MA 1L3UA 1X9WA 5JS2A 4KFBA 4DMNA 4FW1A 5T7BA 2DTUA 4E89A 1TKZA 1YT3A 4AHVA 1BHLA 3V1RA 3ULDA 4DLEA 4KHSA 1EP4A 1JXBA 1LW2A 4CEQA 1Q8IA 4FJ5A 1ASWA 5J2PA 1RILA 3L2UA 4AH9A 4C8OA 1W0HA 2OYQA 4DU1A 1VRTA 1KFSA 1IO2A 2Z1IA 1RNHA 2XRIA 3DYAA 3M8PA 3MXIA 3S3NA 2YHAA 1BCMA 3QINA 1TK5A 4FJ9A 4E7IA 3DI6A 2O4IA 2FBTA 4CHYA 3AVAA 4M45A 3THVA 3NGZA 1TV6A 1C0TA 3U3YA 4DU3A 3S3MA 4FJIA 4W5RA 1KSPA 3OY9A 2RN2A 4FLXA 4EZ9A 2HHWA 2E6LA 3L2WA 3IG1A 3K2PA 4HCBA 4Z4CA 4CE9A 1BQNA 4CCHA 2E6MA 2OPQA 1JLCA 3HXMA 3SCXA 4FJHA 4ELTA 4NCAA 2OPSA 2VWKA 1QTMA 3TAPA 3AVGA 3L3UA 3NFAA 4IG3A 3SUOA 3HPOA 3MXMA 1LV5A 3HL8A 2DFEA 3DOKA 5I3UA 2ETJA 1ASUA 2WONA 1S6QA 2O4GA 3ZT4A 4E19A 3QNOA 4CJPA 2PYLA 4OKKA 1BI4A 3ALYA 4AHUA 3DM2A 1ZBHA 2F8SA 4JRPA 1GOCA 3EYZA 4CIEA 2B4JA 3HVTA 4OGEA 4O0IA 4K8ZA 1RTIA 4BE0A 2G8KA 1J54A 3ZSXA 4DFMA 3AA5X 5C25A 3QESA 4O4GA 3OYKA 4IBNA 4OPJA 3V9UA 3V6DA 3SQ4A 5CYQA 3DOLA 3G10A 4Q0BA 2GUIA 5HROA 3MXJA 4JS4A 3DMJA 3VQCA 5KGXA 3SQ1A 1U04A 1U47A 4N56A 1NOZA 4GW6A 3HK2A 3PX0A 4KB0A 4IFYA 1U45A 4B9UA 4CEDA 3LWLA 1U48A 3RR8A 4DTSA 3NH0A 4DTUA 3V1OA 2HNYA 2Q3SA 5CZ1A 4NYFA 3RR7A 2GBZA 1O1WA 4CF9A 1WSHA 2G8FA 1NJXA 3SI6A 4DF8A 2GV9A 4M41A 1WAFA 5HRSA 1T03A 2BDPA 1BQMA 5C42A 4KI4A 1RBUA 4PWDA 1CZ9A 4FXDA 3LP0A 1TAUA 4B3OA 4RW8A 1SL2A 2XY6A 1C1CA 4FJLA 3G0ZA 4FLVA 4E7HA 4F3OA 1WSGA 1A5WA 1N6QA 3TAEA 1RT7A 3FFIA 2OPPA 2YNFA 1RBRA 1JLGA 1VK0A 1KRPA 4KHUA 2XY5A 1RDAA 1HRHA 4FM1A 1TL3A 1WSFA 4CGFA 1C0UA 1ZBIA 3M8QA 3F73A 3KTQA 1BI4B 1L5UA 5HLFA 5FRNA 4B08A 4DF4A 4B9TA 3AV9A 3AVKA 4Z4HA 4XIUA 2A1RA 3CFOA 3AVIA 2R7YA 4KB1A 3EY1A 1FXXA 3KKSA 1Y97A 3BGRA 3OYGA 3EZ5A 1IKYA 3NAEA 2QKKA 2KW4A 1NOYA 2Z1GA 1RDBA 4RW9A 2YNIA 4EZ6A 3P5JA 4KRFA 5KI6A 3V9ZA 2IC3A 1VSFA 4C8LA 1VSEA 3NCIA 4DTJA 4B8CA 2XY8A 3CFRA 4FLTA 2PZSA 4J2BA 4LH5A 3ZT1A 3KLHA 4KHNA 3DLKA 3V9XA 1SL1A 4CJEA 1RTHA 4DTOA 3O3FA 3QLHA 3L2VA 4ELUA 1YTAA 4WE1A 3V1QA 1VSJA 3O4QA 2HHQA 1TAQA 4DTXA 3SUNA 4DLGA 3QEIA 1NKCA 1WNSA 3QETA 4KHQA 4O44A 3RTVA 1JLAA 1SUQA 1RTDA 3UIQA 4FJGA 2X74A 4M3UA 2HB5A 3DLGA 2XHBA 3LAMA 3LPUA 3AO1A 4KKOA 3L8BA 4DTNA 1BCOA 5HP1A 1RBVA 2G8IA 1VSHA 4CJUA 4PUOA 1VRUA
chains in the Genus database with same CATH superfamily
2ZE2A 2OZSA 3PY8A 5BRHA 4CFBA 3MWPA 1B9DA 4CGJA 4LY7A 3BZKA 5E26A 2F8TA 3IAYA 1WAJA 3AA3A 4CJWA 1DKGD 3FZKA 4JV5K 3VPZA 5LY3A 1VQKN 2ZGYA 1T44A 3SPYA 3ZSVA 2QWRA 4F9OA 4BE1A 3FR0A 3OYCA 4ELVA 1B92A 3AARA 3FLCO 5TKYA 2NZTA 4CF0A 4JS5A 1YITN 4NLCA 1I94K 2YX6A 2KZZA 1WB9A 3LANA 2UUBK 3H1VX 5JVHL 2CGJA 4CJRA 2E4LA 3HM8A 1NJWA 3O9UA 3R9PA 1DEJA 2G8HA 1BUPA 4AQYK 2HMIA 2JGUA 1QQOA 3KD1E 1GLDG 1VSIA 3HP6A 3LL3A 1KVBA 4CK3A 4F3TA 4FJNA 1L3TA 3ZSYA 3TAFA 2FLOA 4LFAK 5M1FA 5C15A 4G9ZA 4CZLA 4CGGA 3VOVA 1GLAG 4LF8K 1SKWA 4RWTA 3LP2A 4DV6K 3ZLJA 2EWSA 3VQ9A 4M3ZA 5FPMA 3P83D 1W9HA 3E01A 4FOEA 4NXNK 3O8MA 4DKWA 2DFFA 2ZGZA 4KHWA 3SBTA 1IV0A 4WFBL 3K59A 4CBXA 1C1BA 1S22A 2IAJA 2UUAK 1NK9A 3NVKA 4YOWA 1IKWA 5F2RA 4CZFA 2D0BA 2E1ZA 4E0DA 4CEBA 4NLBA 1NNEA 3BF3A 4Y1CA 3THWB 4JI0K 3SNNA 5EY4A 5C24A 1JKHA 3EL2A 3TANA 4OKEA 1KQSM 3AVBA 1JL2A 1RT5A 2UXBK 3CD6N 3THXA 3VQ6A 1WLJA 3I0RA 3OYFA 3VN5A 3BDPA 3SUQA 3C6HA 5FPNA 3CM5A 3VENA 4CJLA 4Z94A 1HMVA 4JKAA 4W5TA 2WFBA 3D2FA 5BREA 1HYSA 3H08A 4PL7A 2WC9A 5HRRA 3CCEN 3K58A 2D5RA 3UE5A 3CI5A 4DSJA 1S1VA 2V7ZA 1JCGA 3R8EA 4Z4IA 3BF1A 5GINA 1NGEA 2BGGA 2NNWA 3AO2A 5AQUA 3CCRN 3MEDA 3WXMB 2W6KA 1KFDA 3OHRA 4FJJA 4CHQA 2WUSA 3DXKA 3RSEA 4WCEL 2CGKA 3VA0A 1Q7YO 1NK7A 3SZ2A 1Q81O 3KD5E 5C2DA 4BRHA 4B8AB 1QHTA 1IG8A 4CIFA 3ZSQA 1QZ6A 3C6UA 1QQCA 2RKIA 4H5NA 4BRQA 2KQ2A 3O80A 1HKCA 5FDLA 1RT1A 4CJTA 4RW4A 1UAXA 3OJUA 3OS0A 2QW9A 4AF1A 1ZC6A 4BWMA 2G8WA 3NDKA 2VG7A 3HTVA 3PX6A 5KQ8A 1HNVA 5JS1A 2PFUA 3J7ZO 3DWLA 4CGHA 5DMRA 4FVMA 4H0PA 4BQLA 3O4NA 4I6MB 1YVUA 1XI1A 4IDHA 1EWQA 5CZ2A 4CERA 4KI6A 2I7PA 1SV5A 3W0LA 4Z4EA 3IFRA 4MO5A 4B9SA 3WNFA 4GKJK 4KH4A 4CGIA 3OYMA 4FWNA 1VQ6N 3K57A 4CF8A 3E9LA 1NWKA 3A5LC 4DV5K 2QWPA 5EXWA 3TSPA 5SZTA 2KFZA 3VF2A 4FK4A 1HPMA 3TTDA 4KREA 1OH6A 1VQ7N 5AQHA 4BRPA 5HRNA 4H5WA 3ID6A 2UXDK 1X9JA 3PX4A 2PYJA 3LP3A 1BU6O 1LAVA 5AQMA 1VQLN 5IT9O 1UWBA 2G8VA 1KAXA 2HBJA 4HUEA 2OA8A 1T7PA 1OVYA 5FPEA 3SAHA 4CECA 4LF4K 4M63C 1QSYA 2VG6A 2NRXA 1XHZA 5B8HA 2YHBA 1QE1A 4CZJA 5C0YA 1JJ2M 4BY9C 2VQEK 3CJ9A 5LL6Z 4DV0K 3KJVA 3WUHA 3KVGA 3VQQA 5SWMA 3J80O 4FW2A 2VWJA 4OLBA 4FM0A 3KLFA 4M3RA 1YUWA 4BG9A 4OJRA 3HO1A 3SQ2A 1ZXOA 4CJ4A 3QB0A 3EE8A 1GLBG 3CCUN 3RVCA 1NGHA 1HKGA 5T7BA 5DM7L 1TKZA 3V1RA 1K8KA 1LW2A 3K9KA 4CEQA 4BRIA 1RILA 4AH9A 1VRTA 2Z1IA 1RNHA 3DYAA 1FJGK 4IXCA 3S3NA 3THYB 1O13A 2IVNA 4BRDA 4FJ9A 2O4IA 1NBWA 2QWOA 2FBTA 2V51B 3CMEN 3QFPA 3NGZA 1C0TA 4B3TK 3OY9A 3MN6A 4JKFA 4HCBA 4K43A 3UKUB 4CCHA 3SCXA 4H0TB 4PL8A 3AVGA 1K9MO 2ZJPL 3LDOA 3FZFA 2ZF5O 2QWQA 4GV9A 2WONA 2O4GA 4E19A 5AQXA 4CJPA 4OKKA 3ALYA 4JI2K 1GOCA 2B4JA 1NMDA 3HVTA 1YJWN 4OGEA 4K8ZA 4BE0A 3QESA 3DOLA 3WXJA 2PAVA 1HX1A 5HROA 3MXJA 4JS4A 4WQ4A 1U47A 4N56A 3WQUA 1U48A 4XEIA 4DHYA 5AQPA 4NYFA 2GBZA 1K8AO 2HMPA 1W7AA 3R6MA 4DF8A 1WAFA 5AQOA 1VQNN 2O8FB 1CZ9A 4FXDA 3H3NO 1TAUA 4FJLA 4E7HA 1WSGA 1A5WA 1N6QA 4WF9L 2V52B 4FVUA 1YIJN 3VF4A 1KRPA 1TL3A 1WSFA 4WYBA 1C0UA 2JWLA 5FRNA 4RCHA 4WQ5A 2P9SA 3AVIA 3NAEA 3G25A 1NOYA 1MDUB 1M1KO 2ASOA 4EZ6A 1NGAA 2NRTA 3PSFA 2XY8A 4FLTA 5AZJA 1HLUA 3U4LA 3V9XA 1SL1A 1NGJA 2E2NA 1EWRA 3O3FA 2W6LA 1YTAA 4OPAA 1Z6RA 4A62A 1HNWK 3QEIA 3I55N 3QETA 4O44A 1SQKA 3E66A 1SUQA 5JMVA 4FJGA 4X65K 3HK2A 2E8AA 3DLGA 5HP1A 3LAMA 3ENBA 4DTNA 4FWQA 3ZEUB 3LM2A 4JI4K 1XQSC 4KH6A 4LFBK 2GX9A 4CJQA 3QEVA 1BG3A 3O1WA 4FYDA 1EETA 2CH5A 4DTMA 2Y1IA 1LWCA 1F21A 5KPZA 1WSJA 3J7YP 3HPGA 4LD0A 3AAQA 1NKEA 3RMBA 4B3RK 1K73O 4IWVA 4CBUA 4AM7A 2FC0A 1N5YA 3AVHA 4BVOA 1WSIA 3D7EO 3CYMA 1RTJA 1VQ4N 3TU5A 4BDPA 3IMXA 1UA0A 2JLEA 4JKBA 2P9PB 1YJ9N 1RDDA 2DY4A 3CC2N 4JKDA 4M3XA 4O5BA 1UOCA 1MWMA 4FWSA 1QQNA 3Q7BA 4AHSA 3G6EN 2YV0X 4A61A 1GLFO 2HHVA 4B1ZA 3LZIA 4L3QA 1SZ2A 3VEOA 4N5SA 1IG9A 4DQIA 3QFUA 3NF6A 1FK9A 4MQ3A 3CHWA 2B6AA 1HJOA 3MN5A 4E7KA 4CFCA 1R0AA 1OVQA 3CC4N 4FLUA 4J2AA 1V4TA 3ZT3A 1HJRA 2GELA 3MN7A 2UXCK 2OZMA 4A57A 1C6VA 2X6SA 2D0AA 1CXUA 4E7JA 4LF9K 3D0PA 4HHTA 2ASMA 4ZHRA 3FZHA 3T7ZA 5DK5A 3K5OA 4RG8A 1S9GA 3C6TA 3NGIA 2NRWA 3LAKA 3SPZA 4M42A 3I8BA 2QK9A 1U6ZA 3TR8A 1NK4A 3VQBA 1OH8A 2IGIA 1EQYA 1NG9A 4HUGA 3WQTA 4DQRA 1Z26A 1L3SA 3SQ0A 4J2DA 4QS9A 3SJJA 1A5XA 4UQGA 3VETA 3NHGA 2YJEA 1U49A 2DFHA 5AQKA 4BRKA 1XUPO 2VG5A 2O8BA 4BRFA 2Y1JA 4ISEA 1XMQK 1X9SA 3NH2A 1J53A 5CY4A 2HHTA 2I7NA 3E9OA 1YAGA 3QIOA 3ZETA 4FPAA 2YHWA 3VEVA 4BGBA 3HPHA 1Q9XA 2D0PA 4H8KA 5BRDA 5M1QA 4WQ4C 3B6PA 3OYHA 2GWJA 4A59A 3DRRA 4KTWA 4YFUA 1ATRA 1S1UA 4BC2A 2QXFA 2RF2A 3MECA 3FGUA 1KVCA 3HSCA 4DV1K 3DXMA 2VGMA 5AQSA 5KGWA 4B9NA 3EKUA 4QAGA 4X66K 4J2EA 2P9LA 5HRPA 5C12A 3AVJA 5AQYA 3VEXA 1HR0K 3RWUA 3K0SA 3AO4A 4IG0A 3AVFA 4FLYA 2BUPA 1XHXA 3THXB 1VSDA 3PO4A 2ZJQL 4WQ5C 4DG1A 3CQXA 4OLAA 4CEFA 4N76A 1I39A 3TWHA 4DQ8A 1GLLO 4A2AA 4HVJA 2RPIA 3SJHA 1BGXT 5AQIA 2YNHA 3K5LA 3VQEA 3AVMA 5ELZA 4B1YB 3D2FB 3OVNA 5J2NA 5H1SQ 1LOTB 3C94A 2P5OA 4A2BA 1BOTO 4CEEA 5AZIA 4RW6A 1U2VA 4JK9A 4C1NI 3O1BA 4IEEA 3QDKA 4AHTA 4FZZA 4Z4FA 4LF5K 4GNIA 2HBLA 2E20A 3TI0A 3U9ZA 3K5NA 2D1KA 3SLCA 3CMAN 1BIZA 1G15A 3S9HA 3L6QA 3LDQA 2HNDA 3DXKB 2W42A 3T3FA 3RSEB 1VQ5N 4QCLA 3GG4A 4CW7B 3QO9A 4DUYK 2WOMA 1S1TA 1NK8A 5ADXH 1REVA 3WXKA 5GIOA 4HCCA 1ZBFA 4E1MA 4EP5A 3NF9A 4KTZA 4KAZA 4CD1A 1E4FT 4NYNA 5I9EB 2YKMA 3LALA 4MLHA 3IS9A 2KZMA 3AGKA 3V81A 1TKTA 4CVNE 1WSEA 3ULEA 1HNZK 1GOAA 4FWPA 1SKSA 3MAQA 4M3YA 2NRZA 3UKRA 3ZSWA 3CF5L 1S1XA 4E3SA 3P31A 3C95A 3ITHA 3HT3A 2YKNA 3KK2A 2OANA 1HUXA 1GOBA 2F7TA 2ASPA 4IO8A 3PIOL 3GOIA 1KLMA 2CH6A 4NCGA 4CZEA 4M7XA 4CHNA 1NMNA 1GLEG 3VGLA 4FJKA 2QKBA 3CCLN 2IOCA 1C0FA 4YNQA 5JLFA 1FKOA 4H5RA 4ID5A 3B6OA 3DLHA 4Z4GA 3OYBA 5AQVA 3CFPA 1JLEA 4EIAA 4BACA 3OS1A 1QZ5A 3A0IX 3VQDA 2FSJA 3QNNA 4DS4A 3T1AA 3FZLA 4CESA 5KQDA 1L3VA 4IKFA 2F4VK 3VQAA 3HP9A 4C1NK 1IH7A 3CQ8A 1X9WA 5JS2A 5CHIA 5JICA 4KFBA 4LFCK 2VGNA 3GL1A 4FW1A 3H1QA 4AHVA 1LCUA 1JXBA 3L2UA 3UB5A 1IO2A 4QS7A 2XRIA 2YI1A 5M1KA 2YHAA 4GV6A 3TSQA 3QINA 1TK5A 4E7IA 3U8XA 5C10A 4CHYA 4M45A 3THVA 2P9NA 1BA0A 1IBKK 4B3MK 2KKZA 4EZ9A 2HHWA 3VTIA 4CE9A 1BQNA 2OPQA 1JLCA 4FJHA 4ELTA 1QTMA 1KAZA 4IZ9A 4EAHD 3TAPA 1GLCG 4IG3A 3SUOA 1LV5A 4BGAA 3UIQA 1ASUA 4B3OA 3TSUA 4AHUA 2F8SA 4JI7K 4O0IA 1J54A 4B3SK 3AA5X 3EKSA 4B1VA 5C25A 1K8KB 3G10A 4Q0BA 1DGKN 3DMJA 3MK6A 4GVEA 1NOZA 3PX0A 4KB0A 4DCHA 1U45A 4B9UA 3LWLA 3RR8A 1BO5O 4BC4A 3NH0A 4DTUA 1YF5L 3V1OA 3SAGA 3HI0A 3RR7A 4JI6K 2G8FA 1NJXA 3SI6A 5HRSA 1T03A 5C42A 3FFKB 4FWOA 1H1VA 3GE1A 4RW8A 4KH5A 2O8DA 1Y64A 3TAEA 2IVOA 2KLAA 1ZBIA 4CGFA 3M8QA 3SBGA 1L5UA 5HLFA 2NRVA 4B08A 4B9TA 3AV9A 2A1RA 4KB1A 5KPRA 3EY1A 1FXXA 3EZ5A 1Y97A 1N36K 2QKKA 1J6ZA 2KW4A 2YHXA 3M5RA 4JAXA 4KRFA 4J8FA 2D4WA 5MLCQ 4J2BA 1NLVA 3OW2M 1VQMN 3VESA 1MWKA 4DTOA 4ILGB 2A3ZA 2HF3A 2VQFK 3B8AX 1VSJA 1J5EK 2HHQA 1MA9B 3IUCA 4YOVA 4BR0A 1NKCA 2HHHK 2E5LK 3H6EA 2A40A 2X74A 1OH7A 2XHBA 4KKOA 3CPWM 2P9KA 3QICA 3F2KA 3KWGA 4PUOA 1KAYA 1YTUA 3WNHA 4PA1A 4L8RB 4NCBA 2KTQA 2P9SB 1SL0A 4GMJB 1JCFA 2A1SA 4JKGA 4K41A 4W5QA 4H0XB 4ILJA 4TSXA 1HQUA 1U4BA 5E84A 3SUPA 3LP1A 4BRMA 5E41A 5AZJB 2HNZA 3WXIA 3ZYYX 2LSNA 1RDCA 2Z1JA 3KK3A 3AVLA 3KKRA 3HM9A 2GTDA 2FBVA 1QSSA 4V19S 2D0OA 1ESVA 4B1UB 4YY3K 2RHKA 3IKMA 5FRMA 4B9MA 4C8NA 3OJSA 4H0YB 3TTCA 1UA1A 2E1YA 3AO5A 3PO5A 2O8EA 1YJNN 3K9JA 4CGDA 1NK0A 4FZXC 1RT6A 2HOEA 1XC9A 1EXQA 4BROA 3VTHA 3DLEA 3PUFA 3SMPA 4JHDB 1E4GT 1VSLA 4A5BA 3C0BA 3MCPA 3E9PA 2NRRA 2H3GX 3NF8A 4OVLA 4K25A 4KO0A 4OPKA 4JK8A 3ZSOA 4Y1DA 3L2QA 3HSTB 1JCEA 2Q0UA 3O3GA 3DLLL 3MN9A 1EKEA 4DR5K 4KTQA 2RE2A 3MEGA 3G4SN 2A5XA 1T05A 2IIRA 3WEEA 4BRLA 3TTFA 1YI2N 3J81O 2FXUA 4FJ8A 1DTQA 5BN9A 3WNGA 1QSLA 3N4QA 4N41A 3DRPA 4PQUA 3J7AP 2Q31A 3T69A 3ATUA 5M1PA 3ASMA 1ATSA 4E1JA 4DTPA 1QQMA 4CFDA 2HVHA 3EEQA 1YVNA 4DQPA 4CFAA 1CXQA 3LDNA 3O6WA 4YOYA 4H4MA 5AQWA 2XY7A 1RBSA 4FK2A 1BIUA 4C8MA 2FBYA 3VEWA 4K42A 3L0QA 3OYNA 5I42A 3R3LA 3SV3A 1SKRA 2BH1A 5J1EA 2P51A 4ILHA 4F2SA 3HZ6A 3GDQA 4Z0UA 1A5VA 5DM6L 3ZT0A 4DR4K 4CJVA 4IDKA 4BDZA 4YORA 1HQEA 4HWIA 3FZMA 3AA2A 3CG7A 4BR4A 3RMCA 5ADXA 4F2RA 1KC8O 4B1XB 2OTLN 4BWJA 3DLBA 1XNRK 4BRGA 4EP4A 1ATNA 4H03B 1BISA 4U67L 3KLIA 4E1NA 3NMUA 1YHQN 2O8BB 4JHDA 3MWTA 3NH1A 4ICLA 3S3OA 3VQPA 3OS2A 4CJSA 4CZIA 2FBXA 4AHRA 3OBWA 3CETA 3CPEA 3ZETB 2UYTA 4LSNA 1TGOA 4CJKA 2XO7A 3HJFA 4DR2K 5J2QA 3D45A 3P1GA 4KV8A 5EOYA 1NGGA 4NXMK 1CZAN 4FJMA 3HVRA 4GKKK 1FKPA 4RW7A 3OYJA 3VQ8A 1Q86O 3CM6A 4CZGA 3DXMB 3I56N 3CCQN 4DWIA 3BEXA 2HHUA 1DTTA 2IDOA 1I3AA 2E2PA 4DV4K 1NGFA 1JXEA 1VQPN 1RDWX 2P9LB 1D9DA 4IO9L 3SAFA 1T6DA 1Q9YA 3M8SA 5KRTA 1K6YA 1RT2A 5HBMA 1ITGA 1VSMA 3C7NA 3KZBA 4MDAA 2HVIA 3O5BA 4BC3A 4MFBA 3QIPA 1NJIO 1X1PA 3AGRA 2IS3A 3O9TA 3JYTA 2O8CB 1ASVA 2HBMA 2Q2RA 2GUPA 3ENHA 2OPRA 3H46O 3BY5A 2AJQA 1S5JA 3V4IA 1ZYQA 1HNIA 3IDHA 1QVFM 4KHYA 3O9SA 3AVNA 2A41A 4JRQA 3KWIA 1JL1A 3DJCA 4XH5A 5AQRA 3TAMA 2CGLA 4BR5A 5AZIB 4M3TA 4YDUA 1WBBA 4DFKA 1JLFA 1LWEA 2B5JA 4PKIA 1U2VB 2ITGA 3ZX3A 2Q1NA 3P4IA 4CEOA 3OYEA 3G71N 1QVGM 3ISNC 5EU7A 4FLWA 1N33K 4FSVA 4PKGA 1SS6A 5M1OA 3A5OC 3LZJA 4BQZA 2ATQA 4DQQA 1ZBLA 4CHPA 3PSIA 3KK1A 3HYFA 1C1AA 1DLOA 3M8RA 2YNGA 1TKDA 2W40A 3PV8A 1NJZA 3NBPA 1J9AA 2HW3A 5AR0A 3LWMA 4DFJA 2HBKA 2EX3A 2J4RA 5AQLA 4BDYA 2ZD1A 3ID8A 1KCFA 3EZWA 3JAMO 1QHAA 5KPTA 3QERA 4O5FA 4PKHA 2IVPA 1G99A 2BANA 3TAGA 4YOTA 3ZCMA 1IKXA 4H4OA 2FSKA 1HPZA 3LDSA 4HUFA 4DB3A 3ULEB 4DSEA 4CJ3A 4WFNL 4ZTJA 3M6GA 1NGCA 2DPNA 4I2PA 3UKRB 1TYQA 4OX9K 2Z1HA 2HF4A 2E2QA 5AQTA 4JD2A 5GAEP 5EVZA 1Q18A 4DUZK 1T8EA 1L3UA 5J2MA 4LF6K 2F9TA 3OBYA 3W3DA 4CJ7A 2O8CA 4DMNA 3QBWA 2DTUA 1RFQA 4E89A 1BHLA 3ULDA 3CJ7A 1EO1A 4FJ5A 3EN9A 1ASWA 1W0HA 4JKCA 2OYQA 5A2QO 1KFSA 2QA4N 3M8PA 4JI8K 1BCMA 1IJJA 1OH5A 3DI6A 4O8UA 3O4WA 5AQQA 3QBXA 2FF6A 5F1XA 1TV6A 4CZHA 3S3MA 4FJIA 1KSPA 2WBNA 2RN2A 4FLXA 1SAZA 2E6LA 1NGDA 1TUUA 3L2WA 3ENOA 3K2PA 4CZKA 4Z4CA 1XMOK 1FW6A 2KFNA 1ZBHA 1N34K 4NCAA 2OPSA 1IBLK 4BG8A 3NFAA 3MXMA 3HL8A 1XNQK 2ETJA 3QNOA 2YJFA 3ZT4A 5LMUK 1BI4A 3DM2A 3CC7N 5IWAK 5BN8A 3ZSXA 4XH4A 4K0KK 1TUYA 3ZX2A 3OYKA 3SQ4A 5CYQA 5KGXA 1U04A 4IFYA 5M1NA 2AA4A 3BUZB 1HKBA 1WOQA 2Q3SA 5CZ1A 4IOCL 4FL9A 4CF9A 1W97L 2P9NB 4X62K 1W2BM 1RBUA 1RDUA 3LP0A 5AFUH 1SL2A 2XY6A 1C1CA 3CQYA 3G0ZA 4F3OA 2VYPA 2OPPA 4FWKA 1RBRA 1JLGA 2ITMA 4KHUA 3FE1A 1RDAA 1HRHA 3BP8A 3F73A 4DF4A 5CE3A 4XIUA 3AVKA 3CFOA 3SMSA 4GV3A 5TKWA 3EO3A 3KKSA 3CERA 3OYGA 1WUAA 2Z1GA 4RW9A 5LJVA 2YNIA 3P5JA 3OTOK 2IC3A 4C8LA 4DTJA 4B8CA 2ZWHA 3CFRA 2PZSA 4JKHA 3CJAA 4LH5A 3ZT1A 3KLHA 4CJEA 1RTHA 4A5AA 4FWRA 3VEYA 2ZJRL 1YXQA 4ELUA 4MDBA 4WE1A 3V1QA 3M3ZA 3O4QA 5BPMA 4DTXA 3SUNA 4DLGA 1WNSA 4KHQA 3VEZA 3RTVA 1JLAA 4EHTA 4M3UA 2HHSA 2QXLA 3HBTA 2O8DB 3AO1A 4YDUC 2A42A 1RBVA 1C0GA 2G8IA 4CD3A 4CJUA 4H5TA 1D4XA 2W41A 1VRUA 3I0SA 4EHUA 3A2FA 1HYZA 2VWBA 4H5VA 1RCHA 4QS8A 3T19A 2HHXA 1NKBA 1HYVA 3U9DA 4FZYA 1MU2A 4CK1A 1KTQA 1TK0A 4DV3K 4DR6K 4ISGA 5C2FA 2BTFA 2D0CA 1XWLA 3NF7A 1KD1O 4IOXA 1CZBA 3CIPA 3O3HA 4OPHA 3WT0A 1X3MA 4JI3K 3ZSRA 4JI5K 4X64K 3AY9A 4MLEA 1NJYA 4CHZA 4JNEA 1RT4A 3LPTA 4CF2A 3F5TA 1IBMK 4LF7K 5EX5A 1VAZA 4K8XA 2P9KB 4FWLA 3L3VA 4XH1A 2ZQBA 3THWA 3TABA 3S41A 3WNEA 3DRSA 4BREA 3JSMA 4CI6A 1VQON 2F9WA 3MMVA 1VQ8N 1RBTA 3KLGA 4DFPA 4JKGB 3ZT2A 3ATVA 1KLNA 1EX4A 4FM2A 1TL1A 2X78A 4AHCA 4N47A 2EHGA 4ISFA 4O8KA 3H45C 3CCSN 3P38A 5AQZA 3AVCA 4CJ5A 4B9LA 2I5JA 3RRHA 3A8YA 4W5NA 4IOAL 2UUCK 4M7YA 3QMLA 3OYDA 2QTDA 4DSLA 3H3OB 3L2RA 3V9WA 3CJBA 3A5NC 2V7YA 3HOSA 4O0JA 1Z25A 4BR7A 4ID1A 4LSLA 2O8EB 1B9FA 4DSIA 1ZBSA 5GAGP 4JKEA 2P9IB 3D2EB 3MX5A 3VGMA 4QOZB 1NU0A 4HTLA 1X9MA 4IFEA 3K5MA 4HTUA 1S6PA 3QEPA 3C65A 1LW0A 3R1XA 1NK6A 4BR9A 3CJ1A 1S3XA 2P1JA 1KXPA 3VQ7A 3L4IA 5AQFA 2YHYA 3AO3A 4LH4A 2X6NA 4F8RA 4U7BA 1ILYA 4JYAK 4FOIA 3OYAA 1TVRA 3QEWA 2PY5A 2G8UA 2A6AA 4JLHA 3F9KA 3WEEB 4CIGA 1OKJA 3U3GA 4DV2K 2P9UB 1KVAA 1C0MA 1V4SA 2PBDA 5BPNA 4H0VB 3VA3A 4CEZA 1BDGA 5HOOA 2OCEA 4KHPK 3V9SA 2FF3B 2QWLA 4CEAA 5GADP 4R5PA 4Q5VA 3U6FA 2GEMA 4I6MA 3F9MA 5AQGA 1NM1A 4PHTX 1TK8A 3SV4A 1N32K 1S1WA 1Z05A 5FPDA 4FCYA 4BR2A 4I2QA 3KIOA 5CYMA 1VSKA 4DTRA 3CXCM 4CK2A 1P90A 3OYLA 4KBOA 3OYIA 4I7FA 3I33A 5CR4A 4KPYA 5F0XA 4CHOA 5BR8K 3TARA 3PLAA 3VF6A 3ZSZA 5AJ3K 3T1YK 4NB4A 4E7LA 3LM9A 3L4QA 1QS4A 4YHHK 1JLBA 3MEEA 4G1QA 3KHYA 2P9IA 4IJNA 3D2EA 5KTQA 4W5OA 4CF1A 3MCAB 4OGCA 3MDQA 4DSFA 4JK7A 1D8YA 2JWKA 3HRGA 3KK7A 4BRAA 1P8ZA 4F4KA 4WFAL 5K14A 3HOTA 1TKXA 4FWMA 1T6CA 1HNXK 4PY5A 2NLXA 4EFHA 1WN7A 5FROA 3MX2A 3DAWA 3IRXA 4DSKA 4B9VA 1E3MA 5KRSA 2FSNA 3D6RA 2Q97A 3AAPA 4RTFD 4IFVA 1D9FA 3PIPL 1R59O 2E2OA 3ZX0A 2P9UA 3KLEA 1T3VA 2QWNA 4FO0A 5LJWA 4ZTFA 4JN4A 3RMAA 1BL3A 4DQSA 5GAHP 4DS5A 1CLQA 3VQ4A 3DLRA 3I8DA 3VQ5A 2QM1A 3C7NB 4FK0A 1J5OA 3M1FA 3NE6A 3NGYA 4CBWA 3SK3A 1LWFA 2YCHA 1ZBUA 3WXLA 3O9RA 5D3GA 2NUBA 2GWKA 4H0OA 1D5AA 5BPLA 4DR7K 3CCMN 3LDPA 2F96A 3SYZA 3C6AA 1RGIA 4FJ7A 4FPBA 3VMFB 1XC3A 4DR3K 1NGBA 2BE2A 3TAQA 4GVMA 3THYA 4AILC 2P5GA 3RMDA 1NK5A 4Y0WA 4BVPA 1RT3A 4FLZA 4DU4A 1JLQA 1LAWA 3CJCA 2HSTA 3N4PA 3RRGA 1VHXA 4C8KA 4FJXA 3UKUA 3QEXA 4I9QA 2VCPA 4I9LA 2QI2A 4M3WA 5AQNA 5AFUA 1IKVA 4O55A 3AA4A 1S9EA 4CJFA 4OKJA 1VQ9N 4BE2A 3EE9A 1S72N 2Q0RA 1YT3A 4DLEA 4KHSA 1EP4A 1Q8IA 5J2PA 4LC9B 4C8OA 2QEXN 4DU1A 1NGIA 3LDLA 3MXIA 1M90O 3AVAA 5FLXO 3VGKA 3U3YA 3CCVN 4DU3A 4MO4A 4W5RA 4R79A 2O8FA 4DR1K 3CCJN 3IG1A 4IEIA 2E6MA 4IJAA 3HXMA 2VWKA 3A5MC 3L3UA 4BRNA 1N8RO 3VERA 1TYQB 3HPOA 3O9QA 2DFEA 3DOKA 5I3UA 1S6QA 4NO7A 4JD2B 2PYLA 3NVMA 2Q36A 2E88A 4YOUA 4JRPA 4C23A 3EYZA 4CIEA 3O08A 3JXUA 2OTJN 1RTIA 2G8KA 4BRCA 4DFMA 4O4GA 5HL7L 4IBNA 4OPJA 3V9UA 3V6DA 3Q7CA 2GUIA 5BRFA 5JLHA 3VQCA 3SQ1A 5JVGL 4GW6A 2AP1A 4CEDA 1GLJO 4DTSA 3J8AA 4DV7K 2HNYA 3GBTA 3BZCA 1O1WA 1WSHA 2GV9A 4M41A 2BDPA 1BWFO 1BQMA 4KI4A 4PWDA 2WTUA 1Q82O 4FLVA 3T1HK 1RT7A 3ZEUA 3FFIA 2YNFA 1VK0A 2XY5A 4FM1A 3KTQA 1BA1A 1BI4B 5BR9A 4Z4HA 4BC5A 4B9QA 2R7YA 5GIPA 3BGRA 1IKYA 1DT9A 2UU9K 1RDBA 4GY2B 2KHOA 2ZM6K 2QWMA 5KI6A 3V9ZA 1VSFA 5LMNK 1VSEA 3NCIA 4CZMA 4JI1K 1X3NA 3OA9A 3E1YA 4KHNA 3DLKA 3TPQA 4JEPA 3QLHA 3L2VA 3P39A 1TAQA 4AM6A 2P9PA 4OO1J 3JS6A 1RTDA 2HB5A 3LPUA 3L8BA 4UY8O 1BCOA 4B1WB 2NRHA 4YOXA 1WBDA 5AQJA 1VSHA
chains in the Genus database with same CATH topology
3I0SA 2ZE2A 1YTUA 2OZSA 3A2FA 3PY8A 4CJQA 4CFBA 1HYZA 3QEVA 3WNHA 4PA1A 4L8RB 4FZXC 1B9DA 4CGJA 4NCBA 4FYDA 2HHSA 2KTQA 4LY7A 1EETA 1RCHA 3T19A 1SL0A 4DTMA 4GMJB 2Y1IA 2F8TA 3IAYA 2A1SA 2HHXA 1WAJA 3AA3A 1HYVA 4CJWA 1NKBA 1LWCA 4FZYA 1F21A 1MU2A 4CK1A 1WSJA 1KTQA 1TK0A 4W5QA 3SPYA 3HPGA 3ZSVA 2D0CA 4TSXA 4BE1A 1HQUA 1XWLA 4LD0A 1B92A 3OYCA 3RMBA 1U4BA 3NF7A 1NKEA 4ELVA 3SUPA 3LP1A 5E41A 2HNZA 4CF0A 1CZBA 2FC0A 2LSNA 4JS5A 3AVHA 3O3HA 1N5YA 1WSIA 1RDCA 2Z1JA 3CYMA 1RTJA 2KZZA 3KK3A 3AVLA 3LANA 3ZSRA 4BDPA 3KKRA 3HM9A 1QSSA 2FBVA 4CJRA 1UA0A 2JLEA 1NJYA 2E4LA 1NJWA 4CHZA 2DY4A 1RDDA 2G8HA 1RT4A 3LPTA 4O5BA 4CF2A 1UOCA 4C8NA 4B9MA 4M3XA 5FRMA 3OJSA 1UA1A 3AO5A 4K8XA 4AHSA 2HMIA 3PO5A 2JGUA 2YV0X 2HHVA 3L3VA 3KD1E 2ZQBA 1VSIA 4CGDA 3LZIA 3HP6A 3TABA 3WNEA 1KVBA 3DRSA 1RT6A 4CK3A 4N5SA 3JSMA 1IG9A 4DQIA 4F3TA 4FJNA 3NF6A 1XC9A 1EXQA 1L3TA 1FK9A 4MQ3A 3ZSYA 1RBTA 3DLEA 2B6AA 3PUFA 3KLGA 4DFPA 3TAFA 3ZT2A 4E7KA 4CFCA 1R0AA 1KLNA 1EX4A 4FM2A 1VSLA 1TL1A 2X78A 4FLUA 4AHCA 4J2AA 4CGGA 4N47A 1HJRA 2EHGA 3ZT3A 1SKWA 3LP2A 3AVCA 4CJ5A 2OZMA 4B9LA 3NF8A 3VQ9A 4OVLA 4M3ZA 1C6VA 2X6SA 2D0AA 4KO0A 2I5JA 3P83D 1W9HA 3ZSOA 4OPKA 3RRHA 1CXUA 4Y1DA 4E7JA 3E01A 4W5NA 3L2QA 3HSTB 3OYDA 3D0PA 4HHTA 3O3GA 2DFFA 4ZHRA 4KHWA 4DSLA 5DK5A 1EKEA 3L2RA 3V9WA 3K5OA 4RG8A 1S9GA 3C6TA 3NGIA 3K59A 3LAKA 3SPZA 4M42A 4KTQA 1C1BA 2IAJA 2QK9A 3MEGA 1T05A 1NK9A 3TR8A 4O0JA 1Z25A 1IKWA 3VQBA 1NK4A 2IGIA 4ID1A 4LSLA 2D0BA 4E0DA 4FJ8A 4CEBA 1DTQA 4HUGA 4DQRA 1L3SA 1Z26A 1B9FA 3WNGA 1QSLA 3SQ0A 4N41A 4J2DA 4F4KA 4Y1CA 4DSIA 3DRPA 3SNNA 3SJJA 4PQUA 1A5XA 4UQGA 5C24A 1JKHA 3NHGA 1U49A 2DFHA 3TANA 3ASMA 2VG5A 4OKEA 4DTPA 3AVBA 2Y1JA 1X9MA 1JL2A 4QOZB 4CFDA 2HVHA 1RT5A 3K5MA 1X9SA 4HTUA 3NH2A 1J53A 4CFAA 3VQ6A 1CXQA 1S6PA 1WLJA 3QEPA 4DQPA 1LW0A 4H4MA 2XY7A 5CY4A 3I0RA 1RBSA 3OYFA 1NK0A 2HHTA 1NK6A 4FK2A 3VN5A 3QIOA 3BDPA 1BIUA 2P1JA 4C8MA 3VQ7A 2FBYA 3SUQA 3HPHA 1Q9XA 4H8KA 3OYNA 5I42A 3CM5A 3AO3A 4LH4A 4CJLA 3SV3A 1SKRA 2X6NA 1HMVA 3B6PA 5J1EA 3OYHA 2P51A 4F2SA 4F8RA 3DRRA 4KTWA 4YFUA 4W5TA 1S1UA 1HYSA 2QXFA 2RF2A 3MECA 3OYAA 3H08A 4Z0UA 1A5VA 1KVCA 5HRRA 3ZT0A 1TVRA 3K58A 2D5RA 4IDKA 4CJVA 4BDZA 1HQEA 3QEWA 2G8UA 2PY5A 3AA2A 3CG7A 4JLHA 3F9KA 4CIGA 4DSJA 3RMCA 4F2RA 5KGWA 3U3GA 4B9NA 4BWJA 1S1VA 4QAGA 3DLBA 4Z4IA 1KVAA 4J2EA 1C0MA 2BGGA 4EP4A 5HRPA 3VA3A 3AO2A 1BISA 3AVJA 4CEZA 3KLIA 4E1NA 3RWUA 3MEDA 3AO4A 4IG0A 3AVFA 4FLYA 3V9SA 4CEAA 4ICLA 4Q5VA 4R5PA 3NH1A 1XHXA 3U6FA 1VSDA 3VQPA 3S3OA 3PO4A 3OS2A 1KFDA 4FJJA 4CJSA 4CHQA 2FBXA 4AHRA 4DG1A 1TK8A 3SV4A 4CEFA 4OLAA 1S1WA 1I39A 4N76A 3TWHA 4FCYA 3VA0A 4LSNA 1TGOA 4I2QA 4CJKA 4HVJA 3KIOA 5CYMA 2XO7A 1VSKA 3SZ2A 1NK7A 3HJFA 4DTRA 2RPIA 3KD5E 1BGXT 3K5LA 2YNHA 5J2QA 3D45A 3P1GA 4KV8A 4CK2A 3VQEA 3OYLA 4B8AB 3AVMA 3OYIA 1QHTA 4I7FA 4FJMA 3OVNA 4CIFA 3ZSQA 3HVRA 1FKPA 5J2NA 4RW7A 3C6UA 3VQ8A 3OYJA 4CHOA 3TARA 1QQCA 2RKIA 4KPYA 3C94A 3CM6A 2KQ2A 2P5OA 3ZSZA 4CEEA 4E7LA 5FDLA 4DWIA 4RW6A 1RT1A 4CJTA 4RW4A 2HHUA 1UAXA 3OJUA 3OS0A 1QS4A 1DTTA 2IDOA 1JLBA 3MEEA 1I3AA 4BWMA 2G8WA 4G1QA 3NDKA 1JXEA 5KTQA 1D9DA 4W5OA 1Q9YA 2VG7A 4AHTA 4CF1A 3M8SA 3PX6A 4OGCA 5KRTA 1HNVA 1K6YA 1RT2A 5HBMA 1ITGA 4DSFA 1D8YA 4FZZA 4Z4FA 5JS1A 1VSMA 3TI0A 3K5NA 2HVIA 4CGHA 5DMRA 4FVMA 1BIZA 4MFBA 3QIPA 1G15A 3O4NA 1YVUA 5K14A 3S9HA 1XI1A 1X1PA 1TKXA 2HNDA 2IS3A 2W42A 4PY5A 5CZ2A 4CERA 3T3FA 4KI6A 4QCLA 1WN7A 5FROA 3JYTA 1ASVA 1SV5A 3IRXA 4DSKA 4Z4EA 3QO9A 2OPRA 2WOMA 4B9VA 4B9SA 3WNFA 4CGIA 2AJQA 1S1TA 3OYMA 1S5JA 5KRSA 1NK8A 3V4IA 1ZYQA 1HNIA 1REVA 4KHYA 3AVNA 4HCCA 1ZBFA 4E1MA 3K57A 4CF8A 4EP5A 3NF9A 4KTZA 4IFVA 4JRQA 1JL1A 1D9FA 4KAZA 3TAMA 4NYNA 2YKMA 3LALA 3KLEA 4M3TA 3IS9A 4DFKA 1JLFA 1LWEA 2KZMA 2B5JA 3V81A 5SZTA 2ITGA 4ZTFA 2KFNA 2KFZA 3RMAA 1TKTA 1BL3A 4DQSA 4FK4A 1WSEA 4KREA 4DS5A 1CLQA 1GOAA 1SKSA 3VQ4A 3DLRA 4CEOA 3OYEA 5HRNA 3I8DA 3MAQA 4M3YA 3ISNC 3VQ5A 3ZSWA 5EU7A 4FLWA 1S1XA 4E3SA 4FK0A 3C95A 1J5OA 3NE6A 3NGYA 3ITHA 3LZJA 3PX4A 1LWFA 2YKNA 3HT3A 2PYJA 3LP3A 1ZBUA 2ATQA 4DQQA 4CHPA 1ZBLA 3KK1A 3HYFA 1LAVA 1C1AA 3KK2A 1DLOA 5D3GA 1GOBA 3M8RA 2YNGA 1UWBA 2NUBA 2G8VA 1TKDA 1D5AA 4HUEA 2OA8A 3PV8A 1T7PA 2F96A 1NJZA 3NBPA 1J9AA 2HW3A 4CECA 1KLMA 3SYZA 3LWMA 4FJ7A 4NCGA 4DFJA 4CHNA 2BE2A 1QSYA 3TAQA 2EX3A 2VG6A 4GVMA 4BDYA 2ZD1A 4FJKA 1XHZA 2QKBA 1KCFA 4AILC 2P5GA 3RMDA 3QERA 1NK5A 2IOCA 1QE1A 2YHBA 4YNQA 1RT3A 4FLZA 4DU4A 1FKOA 4ID5A 1JLQA 3B6OA 3DLHA 1LAWA 4FJXA 2BANA 4Z4GA 3OYBA 3KJVA 3TAGA 3VQQA 5SWMA 3CFPA 3ZCMA 1JLEA 1IKXA 4H4OA 4FW2A 1HPZA 3LDSA 4HUFA 4BACA 3RRGA 3OS1A 4C8KA 3QEXA 2VWJA 3VQDA 4DSEA 3QNNA 4CJ3A 4DS4A 4I9QA 3T1AA 4OLBA 4FM0A 4CESA 3KLFA 4I9LA 4M3RA 4ZTJA 4I2PA 1L3VA 4OJRA 4IKFA 3HO1A 4M3WA 3SQ2A 3VQAA 2Z1HA 1IKVA 3HP9A 3AA4A 4O55A 1S9EA 4CJFA 4CJ4A 1IH7A 4OKJA 3CQ8A 1T8EA 4BE2A 5J2MA 1L3UA 1X9WA 5JS2A 4KFBA 4DMNA 4FW1A 5T7BA 2DTUA 4E89A 1TKZA 1YT3A 4AHVA 1BHLA 3V1RA 3ULDA 4DLEA 4KHSA 1EP4A 1JXBA 1LW2A 4CEQA 1Q8IA 4FJ5A 1ASWA 5J2PA 1RILA 3L2UA 4AH9A 4C8OA 1W0HA 2OYQA 4DU1A 1VRTA 1KFSA 1IO2A 2Z1IA 1RNHA 2XRIA 3DYAA 3M8PA 3MXIA 3S3NA 2YHAA 1BCMA 3QINA 1TK5A 4FJ9A 4E7IA 3DI6A 2O4IA 2FBTA 4CHYA 3AVAA 4M45A 3THVA 3NGZA 1TV6A 1C0TA 3U3YA 4DU3A 3S3MA 4FJIA 4W5RA 1KSPA 3OY9A 2RN2A 4FLXA 4EZ9A 2HHWA 2E6LA 3L2WA 3IG1A 3K2PA 4HCBA 4Z4CA 4CE9A 1BQNA 4CCHA 2E6MA 2OPQA 1JLCA 3HXMA 3SCXA 4FJHA 4ELTA 4NCAA 2OPSA 2VWKA 1QTMA 3TAPA 3AVGA 3L3UA 3NFAA 4IG3A 3SUOA 3HPOA 3MXMA 1LV5A 3HL8A 2DFEA 3DOKA 5I3UA 2ETJA 1ASUA 2WONA 1S6QA 2O4GA 3ZT4A 4E19A 3QNOA 4CJPA 2PYLA 4OKKA 1BI4A 3ALYA 4AHUA 3DM2A 1ZBHA 2F8SA 4JRPA 1GOCA 3EYZA 4CIEA 2B4JA 3HVTA 4OGEA 4O0IA 4K8ZA 1RTIA 4BE0A 2G8KA 1J54A 3ZSXA 4DFMA 3AA5X 5C25A 3QESA 4O4GA 3OYKA 4IBNA 4OPJA 3V9UA 3V6DA 3SQ4A 5CYQA 3DOLA 3G10A 4Q0BA 2GUIA 5HROA 3MXJA 4JS4A 3DMJA 3VQCA 5KGXA 3SQ1A 1U04A 1U47A 4N56A 1NOZA 4GW6A 3HK2A 3PX0A 4KB0A 4IFYA 1U45A 4B9UA 4CEDA 3LWLA 1U48A 3RR8A 4DTSA 3NH0A 4DTUA 3V1OA 2HNYA 2Q3SA 5CZ1A 4NYFA 3RR7A 2GBZA 1O1WA 4CF9A 1WSHA 2G8FA 1NJXA 3SI6A 4DF8A 2GV9A 4M41A 1WAFA 5HRSA 1T03A 2BDPA 1BQMA 5C42A 4KI4A 1RBUA 4PWDA 1CZ9A 4FXDA 3LP0A 1TAUA 4B3OA 4RW8A 1SL2A 2XY6A 1C1CA 4FJLA 3G0ZA 4FLVA 4E7HA 4F3OA 1WSGA 1A5WA 1N6QA 3TAEA 1RT7A 3FFIA 2OPPA 2YNFA 1RBRA 1JLGA 1VK0A 1KRPA 4KHUA 2XY5A 1RDAA 1HRHA 4FM1A 1TL3A 1WSFA 4CGFA 1C0UA 1ZBIA 3M8QA 3F73A 3KTQA 1BI4B 1L5UA 5HLFA 5FRNA 4B08A 4DF4A 4B9TA 3AV9A 3AVKA 4Z4HA 4XIUA 2A1RA 3CFOA 3AVIA 2R7YA 4KB1A 3EY1A 1FXXA 3KKSA 1Y97A 3BGRA 3OYGA 3EZ5A 1IKYA 3NAEA 2QKKA 2KW4A 1NOYA 2Z1GA 1RDBA 4RW9A 2YNIA 4EZ6A 3P5JA 4KRFA 5KI6A 3V9ZA 2IC3A 1VSFA 4C8LA 1VSEA 3NCIA 4DTJA 4B8CA 2XY8A 3CFRA 4FLTA 2PZSA 4J2BA 4LH5A 3ZT1A 3KLHA 4KHNA 3DLKA 3V9XA 1SL1A 4CJEA 1RTHA 4DTOA 3O3FA 3QLHA 3L2VA 4ELUA 1YTAA 4WE1A 3V1QA 1VSJA 3O4QA 2HHQA 1TAQA 4DTXA 3SUNA 4DLGA 3QEIA 1NKCA 1WNSA 3QETA 4KHQA 4O44A 3RTVA 1JLAA 1SUQA 1RTDA 3UIQA 4FJGA 2X74A 4M3UA 2HB5A 3DLGA 2XHBA 3LAMA 3LPUA 3AO1A 4KKOA 3L8BA 4DTNA 1BCOA 5HP1A 1RBVA 2G8IA 1VSHA 4CJUA 4PUOA 1VRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I0S A;  2ZE2 A;  1YTU A;  2OZS A;  3A2F A;  3PY8 A;  4CJQ A;  4CFB A;  1HYZ A;  3QEV A;  3WNH A;  4PA1 A;  4L8R B;  4FZX C;  1B9D A;  4CGJ A;  4NCB A;  4FYD A;  2HHS A;  2KTQ A;  4LY7 A;  1EET A;  1RCH A;  3T19 A;  1SL0 A;  4DTM A;  4GMJ B;  2Y1I A;  2F8T A;  3IAY A;  2A1S A;  2HHX A;  1WAJ A;  3AA3 A;  1HYV A;  4CJW A;  1NKB A;  1LWC A;  4FZY A;  1F21 A;  1MU2 A;  4CK1 A;  1WSJ A;  1KTQ A;  1TK0 A;  4W5Q A;  3SPY A;  3HPG A;  3ZSV A;  2D0C A;  4TSX A;  4BE1 A;  1HQU A;  1XWL A;  4LD0 A;  1B92 A;  3OYC A;  3RMB A;  1U4B A;  3NF7 A;  1NKE A;  4ELV A;  3SUP A;  3LP1 A;  5E41 A;  2HNZ A;  4CF0 A;  1CZB A;  2FC0 A;  2LSN A;  4JS5 A;  3AVH A;  3O3H A;  1N5Y A;  1WSI A;  1RDC A;  2Z1J A;  3CYM A;  1RTJ A;  2KZZ A;  3KK3 A;  3AVL A;  3LAN A;  3ZSR A;  4BDP A;  3KKR A;  3HM9 A;  1QSS A;  2FBV A;  4CJR A;  1UA0 A;  2JLE A;  1NJY A;  2E4L A;  1NJW A;  4CHZ A;  2DY4 A;  1RDD A;  2G8H A;  1RT4 A;  3LPT A;  4O5B A;  4CF2 A;  1UOC A;  4C8N A;  4B9M A;  4M3X A;  5FRM A;  3OJS A;  1UA1 A;  3AO5 A;  4K8X A;  4AHS A;  2HMI A;  3PO5 A;  2JGU A;  2YV0 X;  2HHV A;  3L3V A;  3KD1 E;  2ZQB A;  1VSI A;  4CGD A;  3LZI A;  3HP6 A;  3TAB A;  3WNE A;  1KVB A;  3DRS A;  1RT6 A;  4CK3 A;  4N5S A;  3JSM A;  1IG9 A;  4DQI A;  4F3T A;  4FJN A;  3NF6 A;  1XC9 A;  1EXQ A;  1L3T A;  1FK9 A;  4MQ3 A;  3ZSY A;  1RBT A;  3DLE A;  2B6A A;  3PUF A;  3KLG A;  4DFP A;  3TAF A;  3ZT2 A;  4E7K A;  4CFC A;  1R0A A;  1KLN A;  1EX4 A;  4FM2 A;  1VSL A;  1TL1 A;  2X78 A;  4FLU A;  4AHC A;  4J2A A;  4CGG A;  4N47 A;  1HJR A;  2EHG A;  3ZT3 A;  1SKW A;  3LP2 A;  3AVC A;  4CJ5 A;  2OZM A;  4B9L A;  3NF8 A;  3VQ9 A;  4OVL A;  4M3Z A;  1C6V A;  2X6S A;  2D0A A;  4KO0 A;  2I5J A;  3P83 D;  1W9H A;  3ZSO A;  4OPK A;  3RRH A;  1CXU A;  4Y1D A;  4E7J A;  3E01 A;  4W5N A;  3L2Q A;  3HST B;  3OYD A;  3D0P A;  4HHT A;  3O3G A;  2DFF A;  4ZHR A;  4KHW A;  4DSL A;  5DK5 A;  1EKE A;  3L2R A;  3V9W A;  3K5O A;  4RG8 A;  1S9G A;  3C6T A;  3NGI A;  3K59 A;  3LAK A;  3SPZ A;  4M42 A;  4KTQ A;  1C1B A;  2IAJ A;  2QK9 A;  3MEG A;  1T05 A;  1NK9 A;  3TR8 A;  4O0J A;  1Z25 A;  1IKW A;  3VQB A;  1NK4 A;  2IGI A;  4ID1 A;  4LSL A;  2D0B A;  4E0D A;  4FJ8 A;  4CEB A;  1DTQ A;  4HUG A;  4DQR A;  1L3S A;  1Z26 A;  1B9F A;  3WNG A;  1QSL A;  3SQ0 A;  4N41 A;  4J2D A;  4F4K A;  4Y1C A;  4DSI A;  3DRP A;  3SNN A;  3SJJ A;  4PQU A;  1A5X A;  4UQG A;  5C24 A;  1JKH A;  3NHG A;  1U49 A;  2DFH A;  3TAN A;  3ASM A;  2VG5 A;  4OKE A;  4DTP A;  3AVB A;  2Y1J A;  1X9M A;  1JL2 A;  4QOZ B;  4CFD A;  2HVH A;  1RT5 A;  3K5M A;  1X9S A;  4HTU A;  3NH2 A;  1J53 A;  4CFA A;  3VQ6 A;  1CXQ A;  1S6P A;  1WLJ A;  3QEP A;  4DQP A;  1LW0 A;  4H4M A;  2XY7 A;  5CY4 A;  3I0R A;  1RBS A;  3OYF A;  1NK0 A;  2HHT A;  1NK6 A;  4FK2 A;  3VN5 A;  3QIO A;  3BDP A;  1BIU A;  2P1J A;  4C8M A;  3VQ7 A;  2FBY A;  3SUQ A;  3HPH A;  1Q9X A;  4H8K A;  3OYN A;  5I42 A;  3CM5 A;  3AO3 A;  4LH4 A;  4CJL A;  3SV3 A;  1SKR A;  2X6N A;  1HMV A;  3B6P A;  5J1E A;  3OYH A;  2P51 A;  4F2S A;  4F8R A;  3DRR A;  4KTW A;  4YFU A;  4W5T A;  1S1U A;  1HYS A;  2QXF A;  2RF2 A;  3MEC A;  3OYA A;  3H08 A;  4Z0U A;  1A5V A;  1KVC A;  5HRR A;  3ZT0 A;  1TVR A;  3K58 A;  2D5R A;  4IDK A;  4CJV A;  4BDZ A;  1HQE A;  3QEW A;  2G8U A;  2PY5 A;  3AA2 A;  3CG7 A;  4JLH A;  3F9K A;  4CIG A;  4DSJ A;  3RMC A;  4F2R A;  5KGW A;  3U3G A;  4B9N A;  4BWJ A;  1S1V A;  4QAG A;  3DLB A;  4Z4I A;  1KVA A;  4J2E A;  1C0M A;  2BGG A;  4EP4 A;  5HRP A;  3VA3 A;  3AO2 A;  1BIS A;  3AVJ A;  4CEZ A;  3KLI A;  4E1N A;  3RWU A;  3MED A;  3AO4 A;  4IG0 A;  3AVF A;  4FLY A;  3V9S A;  4CEA A;  4ICL A;  4Q5V A;  4R5P A;  3NH1 A;  1XHX A;  3U6F A;  1VSD A;  3VQP A;  3S3O A;  3PO4 A;  3OS2 A;  1KFD A;  4FJJ A;  4CJS A;  4CHQ A;  2FBX A;  4AHR A;  4DG1 A;  1TK8 A;  3SV4 A;  4CEF A;  4OLA A;  1S1W A;  1I39 A;  4N76 A;  3TWH A;  4FCY A;  3VA0 A;  4LSN A;  1TGO A;  4I2Q A;  4CJK A;  4HVJ A;  3KIO A;  5CYM A;  2XO7 A;  1VSK A;  3SZ2 A;  1NK7 A;  3HJF A;  4DTR A;  2RPI A;  3KD5 E;  1BGX T;  3K5L A;  2YNH A;  5J2Q A;  3D45 A;  3P1G A;  4KV8 A;  4CK2 A;  3VQE A;  3OYL A;  4B8A B;  3AVM A;  3OYI A;  1QHT A;  4I7F A;  4FJM A;  3OVN A;  4CIF A;  3ZSQ A;  3HVR A;  1FKP A;  5J2N A;  4RW7 A;  3C6U A;  3VQ8 A;  3OYJ A;  4CHO A;  3TAR A;  1QQC A;  2RKI A;  4KPY A;  3C94 A;  3CM6 A;  2KQ2 A;  2P5O A;  3ZSZ A;  4CEE A;  4E7L A;  5FDL A;  4DWI A;  4RW6 A;  1RT1 A;  4CJT A;  4RW4 A;  2HHU A;  1UAX A;  3OJU A;  3OS0 A;  1QS4 A;  1DTT A;  2IDO A;  1JLB A;  3MEE A;  1I3A A;  4BWM A;  2G8W A;  4G1Q A;  3NDK A;  1JXE A;  5KTQ A;  1D9D A;  4W5O A;  1Q9Y A;  2VG7 A;  4AHT A;  4CF1 A;  3M8S A;  3PX6 A;  4OGC A;  5KRT A;  1HNV A;  1K6Y A;  1RT2 A;  5HBM A;  1ITG A;  4DSF A;  1D8Y A;  4FZZ A;  4Z4F A;  5JS1 A;  1VSM A;  3TI0 A;  3K5N A;  2HVI A;  4CGH A;  5DMR A;  4FVM A;  1BIZ A;  4MFB A;  3QIP A;  1G15 A;  3O4N A;  1YVU A;  5K14 A;  3S9H A;  1XI1 A;  1X1P A;  1TKX A;  2HND A;  2IS3 A;  2W42 A;  4PY5 A;  5CZ2 A;  4CER A;  3T3F A;  4KI6 A;  4QCL A;  1WN7 A;  5FRO A;  3JYT A;  1ASV A;  1SV5 A;  3IRX A;  4DSK A;  4Z4E A;  3QO9 A;  2OPR A;  2WOM A;  4B9V A;  4B9S A;  3WNF A;  4CGI A;  2AJQ A;  1S1T A;  3OYM A;  1S5J A;  5KRS A;  1NK8 A;  3V4I A;  1ZYQ A;  1HNI A;  1REV A;  4KHY A;  3AVN A;  4HCC A;  1ZBF A;  4E1M A;  3K57 A;  4CF8 A;  4EP5 A;  3NF9 A;  4KTZ A;  4IFV A;  4JRQ A;  1JL1 A;  1D9F A;  4KAZ A;  3TAM A;  4NYN A;  2YKM A;  3LAL A;  3KLE A;  4M3T A;  3IS9 A;  4DFK A;  1JLF A;  1LWE A;  2KZM A;  2B5J A;  3V81 A;  5SZT A;  2ITG A;  4ZTF A;  2KFN A;  2KFZ A;  3RMA A;  1TKT A;  1BL3 A;  4DQS A;  4FK4 A;  1WSE A;  4KRE A;  4DS5 A;  1CLQ A;  1GOA A;  1SKS A;  3VQ4 A;  3DLR A;  4CEO A;  3OYE A;  5HRN A;  3I8D A;  3MAQ A;  4M3Y A;  3ISN C;  3VQ5 A;  3ZSW A;  5EU7 A;  4FLW A;  1S1X A;  4E3S A;  4FK0 A;  3C95 A;  1J5O A;  3NE6 A;  3NGY A;  3ITH A;  3LZJ A;  3PX4 A;  1LWF A;  2YKN A;  3HT3 A;  2PYJ A;  3LP3 A;  1ZBU A;  2ATQ A;  4DQQ A;  4CHP A;  1ZBL A;  3KK1 A;  3HYF A;  1LAV A;  1C1A A;  3KK2 A;  1DLO A;  5D3G A;  1GOB A;  3M8R A;  2YNG A;  1UWB A;  2NUB A;  2G8V A;  1TKD A;  1D5A A;  4HUE A;  2OA8 A;  3PV8 A;  1T7P A;  2F96 A;  1NJZ A;  3NBP A;  1J9A A;  2HW3 A;  4CEC A;  1KLM A;  3SYZ A;  3LWM A;  4FJ7 A;  4NCG A;  4DFJ A;  4CHN A;  2BE2 A;  1QSY A;  3TAQ A;  2EX3 A;  2VG6 A;  4GVM A;  4BDY A;  2ZD1 A;  4FJK A;  1XHZ A;  2QKB A;  1KCF A;  4AIL C;  2P5G A;  3RMD A;  3QER A;  1NK5 A;  2IOC A;  1QE1 A;  2YHB A;  4YNQ A;  1RT3 A;  4FLZ A;  4DU4 A;  1FKO A;  4ID5 A;  1JLQ A;  3B6O A;  3DLH A;  1LAW A;  4FJX A;  2BAN A;  4Z4G A;  3OYB A;  3KJV A;  3TAG A;  3VQQ A;  5SWM A;  3CFP A;  3ZCM A;  1JLE A;  1IKX A;  4H4O A;  4FW2 A;  1HPZ A;  3LDS A;  4HUF A;  4BAC A;  3RRG A;  3OS1 A;  4C8K A;  3QEX A;  2VWJ A;  3VQD A;  4DSE A;  3QNN A;  4CJ3 A;  4DS4 A;  4I9Q A;  3T1A A;  4OLB A;  4FM0 A;  4CES A;  3KLF A;  4I9L A;  4M3R A;  4ZTJ A;  4I2P A;  1L3V A;  4OJR A;  4IKF A;  3HO1 A;  4M3W A;  3SQ2 A;  3VQA A;  2Z1H A;  1IKV A;  3HP9 A;  3AA4 A;  4O55 A;  1S9E A;  4CJF A;  4CJ4 A;  1IH7 A;  4OKJ A;  3CQ8 A;  1T8E A;  4BE2 A;  5J2M A;  1L3U A;  1X9W A;  5JS2 A;  4KFB A;  4DMN A;  4FW1 A;  5T7B A;  2DTU A;  4E89 A;  1TKZ A;  1YT3 A;  4AHV A;  1BHL A;  3V1R A;  3ULD A;  4DLE A;  4KHS A;  1EP4 A;  1JXB A;  1LW2 A;  4CEQ A;  1Q8I A;  4FJ5 A;  1ASW A;  5J2P A;  1RIL A;  3L2U A;  4AH9 A;  4C8O A;  1W0H A;  2OYQ A;  4DU1 A;  1VRT A;  1KFS A;  1IO2 A;  2Z1I A;  1RNH A;  2XRI A;  3DYA A;  3M8P A;  3MXI A;  3S3N A;  2YHA A;  1BCM A;  3QIN A;  1TK5 A;  4FJ9 A;  4E7I A;  3DI6 A;  2O4I A;  2FBT A;  4CHY A;  3AVA A;  4M45 A;  3THV A;  3NGZ A;  1TV6 A;  1C0T A;  3U3Y A;  4DU3 A;  3S3M A;  4FJI A;  4W5R A;  1KSP A;  3OY9 A;  2RN2 A;  4FLX A;  4EZ9 A;  2HHW A;  2E6L A;  3L2W A;  3IG1 A;  3K2P A;  4HCB A;  4Z4C A;  4CE9 A;  1BQN A;  4CCH A;  2E6M A;  2OPQ A;  1JLC A;  3HXM A;  3SCX A;  4FJH A;  4ELT A;  4NCA A;  2OPS A;  2VWK A;  1QTM A;  3TAP A;  3AVG A;  3L3U A;  3NFA A;  4IG3 A;  3SUO A;  3HPO A;  3MXM A;  1LV5 A;  3HL8 A;  2DFE A;  3DOK A;  5I3U A;  2ETJ A;  1ASU A;  2WON A;  1S6Q A;  2O4G A;  3ZT4 A;  4E19 A;  3QNO A;  4CJP A;  2PYL A;  4OKK A;  1BI4 A;  3ALY A;  4AHU A;  3DM2 A;  1ZBH A;  2F8S A;  4JRP A;  1GOC A;  3EYZ A;  4CIE A;  2B4J A;  3HVT A;  4OGE A;  4O0I A;  4K8Z A;  1RTI A;  4BE0 A;  2G8K A;  1J54 A;  3ZSX A;  4DFM A;  3AA5 X;  5C25 A;  3QES A;  4O4G A;  3OYK A;  4IBN A;  4OPJ A;  3V9U A;  3V6D A;  3SQ4 A;  5CYQ A;  3DOL A;  3G10 A;  4Q0B A;  2GUI A;  5HRO A;  3MXJ A;  4JS4 A;  3DMJ A;  3VQC A;  5KGX A;  3SQ1 A;  1U04 A;  1U47 A;  4N56 A;  1NOZ A;  4GW6 A;  3HK2 A;  3PX0 A;  4KB0 A;  4IFY A;  1U45 A;  4B9U A;  4CED A;  3LWL A;  1U48 A;  3RR8 A;  4DTS A;  3NH0 A;  4DTU A;  3V1O A;  2HNY A;  2Q3S A;  5CZ1 A;  4NYF A;  3RR7 A;  2GBZ A;  1O1W A;  4CF9 A;  1WSH A;  2G8F A;  1NJX A;  3SI6 A;  4DF8 A;  2GV9 A;  4M41 A;  1WAF A;  5HRS A;  1T03 A;  2BDP A;  1BQM A;  5C42 A;  4KI4 A;  1RBU A;  4PWD A;  1CZ9 A;  4FXD A;  3LP0 A;  1TAU A;  4B3O A;  4RW8 A;  1SL2 A;  2XY6 A;  1C1C A;  4FJL A;  3G0Z A;  4FLV A;  4E7H A;  4F3O A;  1WSG A;  1A5W A;  1N6Q A;  3TAE A;  1RT7 A;  3FFI A;  2OPP A;  2YNF A;  1RBR A;  1JLG A;  1VK0 A;  1KRP A;  4KHU A;  2XY5 A;  1RDA A;  1HRH A;  4FM1 A;  1TL3 A;  1WSF A;  4CGF A;  1C0U A;  1ZBI A;  3M8Q A;  3F73 A;  3KTQ A;  1BI4 B;  1L5U A;  5HLF A;  5FRN A;  4B08 A;  4DF4 A;  4B9T A;  3AV9 A;  3AVK A;  4Z4H A;  4XIU A;  2A1R A;  3CFO A;  3AVI A;  2R7Y A;  4KB1 A;  3EY1 A;  1FXX A;  3KKS A;  1Y97 A;  3BGR A;  3OYG A;  3EZ5 A;  1IKY A;  3NAE A;  2QKK A;  2KW4 A;  1NOY A;  2Z1G A;  1RDB A;  4RW9 A;  2YNI A;  4EZ6 A;  3P5J A;  4KRF A;  5KI6 A;  3V9Z A;  2IC3 A;  1VSF A;  4C8L A;  1VSE A;  3NCI A;  4DTJ A;  4B8C A;  2XY8 A;  3CFR A;  4FLT A;  2PZS A;  4J2B A;  4LH5 A;  3ZT1 A;  3KLH A;  4KHN A;  3DLK A;  3V9X A;  1SL1 A;  4CJE A;  1RTH A;  4DTO A;  3O3F A;  3QLH A;  3L2V A;  4ELU A;  1YTA A;  4WE1 A;  3V1Q A;  1VSJ A;  3O4Q A;  2HHQ A;  1TAQ A;  4DTX A;  3SUN A;  4DLG A;  3QEI A;  1NKC A;  1WNS A;  3QET A;  4KHQ A;  4O44 A;  3RTV A;  1JLA A;  1SUQ A;  1RTD A;  3UIQ A;  4FJG A;  2X74 A;  4M3U A;  2HB5 A;  3DLG A;  2XHB A;  3LAM A;  3LPU A;  3AO1 A;  4KKO A;  3L8B A;  4DTN A;  1BCO A;  5HP1 A;  1RBV A;  2G8I A;  1VSH A;  4CJU A;  4PUO A;  1VRU A; 
#chains in the Genus database with same CATH topology
 2ZE2 A;  2OZS A;  3PY8 A;  5BRH A;  4CFB A;  3MWP A;  1B9D A;  4CGJ A;  4LY7 A;  3BZK A;  5E26 A;  2F8T A;  3IAY A;  1WAJ A;  3AA3 A;  4CJW A;  1DKG D;  3FZK A;  4JV5 K;  3VPZ A;  5LY3 A;  1VQK N;  2ZGY A;  1T44 A;  3SPY A;  3ZSV A;  2QWR A;  4F9O A;  4BE1 A;  3FR0 A;  3OYC A;  4ELV A;  1B92 A;  3AAR A;  3FLC O;  5TKY A;  2NZT A;  4CF0 A;  4JS5 A;  1YIT N;  4NLC A;  1I94 K;  2YX6 A;  2KZZ A;  1WB9 A;  3LAN A;  2UUB K;  3H1V X;  5JVH L;  2CGJ A;  4CJR A;  2E4L A;  3HM8 A;  1NJW A;  3O9U A;  3R9P A;  1DEJ A;  2G8H A;  1BUP A;  4AQY K;  2HMI A;  2JGU A;  1QQO A;  3KD1 E;  1GLD G;  1VSI A;  3HP6 A;  3LL3 A;  1KVB A;  4CK3 A;  4F3T A;  4FJN A;  1L3T A;  3ZSY A;  3TAF A;  2FLO A;  4LFA K;  5M1F A;  5C15 A;  4G9Z A;  4CZL A;  4CGG A;  3VOV A;  1GLA G;  4LF8 K;  1SKW A;  4RWT A;  3LP2 A;  4DV6 K;  3ZLJ A;  2EWS A;  3VQ9 A;  4M3Z A;  5FPM A;  3P83 D;  1W9H A;  3E01 A;  4FOE A;  4NXN K;  3O8M A;  4DKW A;  2DFF A;  2ZGZ A;  4KHW A;  3SBT A;  1IV0 A;  4WFB L;  3K59 A;  4CBX A;  1C1B A;  1S22 A;  2IAJ A;  2UUA K;  1NK9 A;  3NVK A;  4YOW A;  1IKW A;  5F2R A;  4CZF A;  2D0B A;  2E1Z A;  4E0D A;  4CEB A;  4NLB A;  1NNE A;  3BF3 A;  4Y1C A;  3THW B;  4JI0 K;  3SNN A;  5EY4 A;  5C24 A;  1JKH A;  3EL2 A;  3TAN A;  4OKE A;  1KQS M;  3AVB A;  1JL2 A;  1RT5 A;  2UXB K;  3CD6 N;  3THX A;  3VQ6 A;  1WLJ A;  3I0R A;  3OYF A;  3VN5 A;  3BDP A;  3SUQ A;  3C6H A;  5FPN A;  3CM5 A;  3VEN A;  4CJL A;  4Z94 A;  1HMV A;  4JKA A;  4W5T A;  2WFB A;  3D2F A;  5BRE A;  1HYS A;  3H08 A;  4PL7 A;  2WC9 A;  5HRR A;  3CCE N;  3K58 A;  2D5R A;  3UE5 A;  3CI5 A;  4DSJ A;  1S1V A;  2V7Z A;  1JCG A;  3R8E A;  4Z4I A;  3BF1 A;  5GIN A;  1NGE A;  2BGG A;  2NNW A;  3AO2 A;  5AQU A;  3CCR N;  3MED A;  3WXM B;  2W6K A;  1KFD A;  3OHR A;  4FJJ A;  4CHQ A;  2WUS A;  3DXK A;  3RSE A;  4WCE L;  2CGK A;  3VA0 A;  1Q7Y O;  1NK7 A;  3SZ2 A;  1Q81 O;  3KD5 E;  5C2D A;  4BRH A;  4B8A B;  1QHT A;  1IG8 A;  4CIF A;  3ZSQ A;  1QZ6 A;  3C6U A;  1QQC A;  2RKI A;  4H5N A;  4BRQ A;  2KQ2 A;  3O80 A;  1HKC A;  5FDL A;  1RT1 A;  4CJT A;  4RW4 A;  1UAX A;  3OJU A;  3OS0 A;  2QW9 A;  4AF1 A;  1ZC6 A;  4BWM A;  2G8W A;  3NDK A;  2VG7 A;  3HTV A;  3PX6 A;  5KQ8 A;  1HNV A;  5JS1 A;  2PFU A;  3J7Z O;  3DWL A;  4CGH A;  5DMR A;  4FVM A;  4H0P A;  4BQL A;  3O4N A;  4I6M B;  1YVU A;  1XI1 A;  4IDH A;  1EWQ A;  5CZ2 A;  4CER A;  4KI6 A;  2I7P A;  1SV5 A;  3W0L A;  4Z4E A;  3IFR A;  4MO5 A;  4B9S A;  3WNF A;  4GKJ K;  4KH4 A;  4CGI A;  3OYM A;  4FWN A;  1VQ6 N;  3K57 A;  4CF8 A;  3E9L A;  1NWK A;  3A5L C;  4DV5 K;  2QWP A;  5EXW A;  3TSP A;  5SZT A;  2KFZ A;  3VF2 A;  4FK4 A;  1HPM A;  3TTD A;  4KRE A;  1OH6 A;  1VQ7 N;  5AQH A;  4BRP A;  5HRN A;  4H5W A;  3ID6 A;  2UXD K;  1X9J A;  3PX4 A;  2PYJ A;  3LP3 A;  1BU6 O;  1LAV A;  5AQM A;  1VQL N;  5IT9 O;  1UWB A;  2G8V A;  1KAX A;  2HBJ A;  4HUE A;  2OA8 A;  1T7P A;  1OVY A;  5FPE A;  3SAH A;  4CEC A;  4LF4 K;  4M63 C;  1QSY A;  2VG6 A;  2NRX A;  1XHZ A;  5B8H A;  2YHB A;  1QE1 A;  4CZJ A;  5C0Y A;  1JJ2 M;  4BY9 C;  2VQE K;  3CJ9 A;  5LL6 Z;  4DV0 K;  3KJV A;  3WUH A;  3KVG A;  3VQQ A;  5SWM A;  3J80 O;  4FW2 A;  2VWJ A;  4OLB A;  4FM0 A;  3KLF A;  4M3R A;  1YUW A;  4BG9 A;  4OJR A;  3HO1 A;  3SQ2 A;  1ZXO A;  4CJ4 A;  3QB0 A;  3EE8 A;  1GLB G;  3CCU N;  3RVC A;  1NGH A;  1HKG A;  5T7B A;  5DM7 L;  1TKZ A;  3V1R A;  1K8K A;  1LW2 A;  3K9K A;  4CEQ A;  4BRI A;  1RIL A;  4AH9 A;  1VRT A;  2Z1I A;  1RNH A;  3DYA A;  1FJG K;  4IXC A;  3S3N A;  3THY B;  1O13 A;  2IVN A;  4BRD A;  4FJ9 A;  2O4I A;  1NBW A;  2QWO A;  2FBT A;  2V51 B;  3CME N;  3QFP A;  3NGZ A;  1C0T A;  4B3T K;  3OY9 A;  3MN6 A;  4JKF A;  4HCB A;  4K43 A;  3UKU B;  4CCH A;  3SCX A;  4H0T B;  4PL8 A;  3AVG A;  1K9M O;  2ZJP L;  3LDO A;  3FZF A;  2ZF5 O;  2QWQ A;  4GV9 A;  2WON A;  2O4G A;  4E19 A;  5AQX A;  4CJP A;  4OKK A;  3ALY A;  4JI2 K;  1GOC A;  2B4J A;  1NMD A;  3HVT A;  1YJW N;  4OGE A;  4K8Z A;  4BE0 A;  3QES A;  3DOL A;  3WXJ A;  2PAV A;  1HX1 A;  5HRO A;  3MXJ A;  4JS4 A;  4WQ4 A;  1U47 A;  4N56 A;  3WQU A;  1U48 A;  4XEI A;  4DHY A;  5AQP A;  4NYF A;  2GBZ A;  1K8A O;  2HMP A;  1W7A A;  3R6M A;  4DF8 A;  1WAF A;  5AQO A;  1VQN N;  2O8F B;  1CZ9 A;  4FXD A;  3H3N O;  1TAU A;  4FJL A;  4E7H A;  1WSG A;  1A5W A;  1N6Q A;  4WF9 L;  2V52 B;  4FVU A;  1YIJ N;  3VF4 A;  1KRP A;  1TL3 A;  1WSF A;  4WYB A;  1C0U A;  2JWL A;  5FRN A;  4RCH A;  4WQ5 A;  2P9S A;  3AVI A;  3NAE A;  3G25 A;  1NOY A;  1MDU B;  1M1K O;  2ASO A;  4EZ6 A;  1NGA A;  2NRT A;  3PSF A;  2XY8 A;  4FLT A;  5AZJ A;  1HLU A;  3U4L A;  3V9X A;  1SL1 A;  1NGJ A;  2E2N A;  1EWR A;  3O3F A;  2W6L A;  1YTA A;  4OPA A;  1Z6R A;  4A62 A;  1HNW K;  3QEI A;  3I55 N;  3QET A;  4O44 A;  1SQK A;  3E66 A;  1SUQ A;  5JMV A;  4FJG A;  4X65 K;  3HK2 A;  2E8A A;  3DLG A;  5HP1 A;  3LAM A;  3ENB A;  4DTN A;  4FWQ A;  3ZEU B;  3LM2 A;  4JI4 K;  1XQS C;  4KH6 A;  4LFB K;  2GX9 A;  4CJQ A;  3QEV A;  1BG3 A;  3O1W A;  4FYD A;  1EET A;  2CH5 A;  4DTM A;  2Y1I A;  1LWC A;  1F21 A;  5KPZ A;  1WSJ A;  3J7Y P;  3HPG A;  4LD0 A;  3AAQ A;  1NKE A;  3RMB A;  4B3R K;  1K73 O;  4IWV A;  4CBU A;  4AM7 A;  2FC0 A;  1N5Y A;  3AVH A;  4BVO A;  1WSI A;  3D7E O;  3CYM A;  1RTJ A;  1VQ4 N;  3TU5 A;  4BDP A;  3IMX A;  1UA0 A;  2JLE A;  4JKB A;  2P9P B;  1YJ9 N;  1RDD A;  2DY4 A;  3CC2 N;  4JKD A;  4M3X A;  4O5B A;  1UOC A;  1MWM A;  4FWS A;  1QQN A;  3Q7B A;  4AHS A;  3G6E N;  2YV0 X;  4A61 A;  1GLF O;  2HHV A;  4B1Z A;  3LZI A;  4L3Q A;  1SZ2 A;  3VEO A;  4N5S A;  1IG9 A;  4DQI A;  3QFU A;  3NF6 A;  1FK9 A;  4MQ3 A;  3CHW A;  2B6A A;  1HJO A;  3MN5 A;  4E7K A;  4CFC A;  1R0A A;  1OVQ A;  3CC4 N;  4FLU A;  4J2A A;  1V4T A;  3ZT3 A;  1HJR A;  2GEL A;  3MN7 A;  2UXC K;  2OZM A;  4A57 A;  1C6V A;  2X6S A;  2D0A A;  1CXU A;  4E7J A;  4LF9 K;  3D0P A;  4HHT A;  2ASM A;  4ZHR A;  3FZH A;  3T7Z A;  5DK5 A;  3K5O A;  4RG8 A;  1S9G A;  3C6T A;  3NGI A;  2NRW A;  3LAK A;  3SPZ A;  4M42 A;  3I8B A;  2QK9 A;  1U6Z A;  3TR8 A;  1NK4 A;  3VQB A;  1OH8 A;  2IGI A;  1EQY A;  1NG9 A;  4HUG A;  3WQT A;  4DQR A;  1Z26 A;  1L3S A;  3SQ0 A;  4J2D A;  4QS9 A;  3SJJ A;  1A5X A;  4UQG A;  3VET A;  3NHG A;  2YJE A;  1U49 A;  2DFH A;  5AQK A;  4BRK A;  1XUP O;  2VG5 A;  2O8B A;  4BRF A;  2Y1J A;  4ISE A;  1XMQ K;  1X9S A;  3NH2 A;  1J53 A;  5CY4 A;  2HHT A;  2I7N A;  3E9O A;  1YAG A;  3QIO A;  3ZET A;  4FPA A;  2YHW A;  3VEV A;  4BGB A;  3HPH A;  1Q9X A;  2D0P A;  4H8K A;  5BRD A;  5M1Q A;  4WQ4 C;  3B6P A;  3OYH A;  2GWJ A;  4A59 A;  3DRR A;  4KTW A;  4YFU A;  1ATR A;  1S1U A;  4BC2 A;  2QXF A;  2RF2 A;  3MEC A;  3FGU A;  1KVC A;  3HSC A;  4DV1 K;  3DXM A;  2VGM A;  5AQS A;  5KGW A;  4B9N A;  3EKU A;  4QAG A;  4X66 K;  4J2E A;  2P9L A;  5HRP A;  5C12 A;  3AVJ A;  5AQY A;  3VEX A;  1HR0 K;  3RWU A;  3K0S A;  3AO4 A;  4IG0 A;  3AVF A;  4FLY A;  2BUP A;  1XHX A;  3THX B;  1VSD A;  3PO4 A;  2ZJQ L;  4WQ5 C;  4DG1 A;  3CQX A;  4OLA A;  4CEF A;  4N76 A;  1I39 A;  3TWH A;  4DQ8 A;  1GLL O;  4A2A A;  4HVJ A;  2RPI A;  3SJH A;  1BGX T;  5AQI A;  2YNH A;  3K5L A;  3VQE A;  3AVM A;  5ELZ A;  4B1Y B;  3D2F B;  3OVN A;  5J2N A;  5H1S Q;  1LOT B;  3C94 A;  2P5O A;  4A2B A;  1BOT O;  4CEE A;  5AZI A;  4RW6 A;  1U2V A;  4JK9 A;  4C1N I;  3O1B A;  4IEE A;  3QDK A;  4AHT A;  4FZZ A;  4Z4F A;  4LF5 K;  4GNI A;  2HBL A;  2E20 A;  3TI0 A;  3U9Z A;  3K5N A;  2D1K A;  3SLC A;  3CMA N;  1BIZ A;  1G15 A;  3S9H A;  3L6Q A;  3LDQ A;  2HND A;  3DXK B;  2W42 A;  3T3F A;  3RSE B;  1VQ5 N;  4QCL A;  3GG4 A;  4CW7 B;  3QO9 A;  4DUY K;  2WOM A;  1S1T A;  1NK8 A;  5ADX H;  1REV A;  3WXK A;  5GIO A;  4HCC A;  1ZBF A;  4E1M A;  4EP5 A;  3NF9 A;  4KTZ A;  4KAZ A;  4CD1 A;  1E4F T;  4NYN A;  5I9E B;  2YKM A;  3LAL A;  4MLH A;  3IS9 A;  2KZM A;  3AGK A;  3V81 A;  1TKT A;  4CVN E;  1WSE A;  3ULE A;  1HNZ K;  1GOA A;  4FWP A;  1SKS A;  3MAQ A;  4M3Y A;  2NRZ A;  3UKR A;  3ZSW A;  3CF5 L;  1S1X A;  4E3S A;  3P31 A;  3C95 A;  3ITH A;  3HT3 A;  2YKN A;  3KK2 A;  2OAN A;  1HUX A;  1GOB A;  2F7T A;  2ASP A;  4IO8 A;  3PIO L;  3GOI A;  1KLM A;  2CH6 A;  4NCG A;  4CZE A;  4M7X A;  4CHN A;  1NMN A;  1GLE G;  3VGL A;  4FJK A;  2QKB A;  3CCL N;  2IOC A;  1C0F A;  4YNQ A;  5JLF A;  1FKO A;  4H5R A;  4ID5 A;  3B6O A;  3DLH A;  4Z4G A;  3OYB A;  5AQV A;  3CFP A;  1JLE A;  4EIA A;  4BAC A;  3OS1 A;  1QZ5 A;  3A0I X;  3VQD A;  2FSJ A;  3QNN A;  4DS4 A;  3T1A A;  3FZL A;  4CES A;  5KQD A;  1L3V A;  4IKF A;  2F4V K;  3VQA A;  3HP9 A;  4C1N K;  1IH7 A;  3CQ8 A;  1X9W A;  5JS2 A;  5CHI A;  5JIC A;  4KFB A;  4LFC K;  2VGN A;  3GL1 A;  4FW1 A;  3H1Q A;  4AHV A;  1LCU A;  1JXB A;  3L2U A;  3UB5 A;  1IO2 A;  4QS7 A;  2XRI A;  2YI1 A;  5M1K A;  2YHA A;  4GV6 A;  3TSQ A;  3QIN A;  1TK5 A;  4E7I A;  3U8X A;  5C10 A;  4CHY A;  4M45 A;  3THV A;  2P9N A;  1BA0 A;  1IBK K;  4B3M K;  2KKZ A;  4EZ9 A;  2HHW A;  3VTI A;  4CE9 A;  1BQN A;  2OPQ A;  1JLC A;  4FJH A;  4ELT A;  1QTM A;  1KAZ A;  4IZ9 A;  4EAH D;  3TAP A;  1GLC G;  4IG3 A;  3SUO A;  1LV5 A;  4BGA A;  3UIQ A;  1ASU A;  4B3O A;  3TSU A;  4AHU A;  2F8S A;  4JI7 K;  4O0I A;  1J54 A;  4B3S K;  3AA5 X;  3EKS A;  4B1V A;  5C25 A;  1K8K B;  3G10 A;  4Q0B A;  1DGK N;  3DMJ A;  3MK6 A;  4GVE A;  1NOZ A;  3PX0 A;  4KB0 A;  4DCH A;  1U45 A;  4B9U A;  3LWL A;  3RR8 A;  1BO5 O;  4BC4 A;  3NH0 A;  4DTU A;  1YF5 L;  3V1O A;  3SAG A;  3HI0 A;  3RR7 A;  4JI6 K;  2G8F A;  1NJX A;  3SI6 A;  5HRS A;  1T03 A;  5C42 A;  3FFK B;  4FWO A;  1H1V A;  3GE1 A;  4RW8 A;  4KH5 A;  2O8D A;  1Y64 A;  3TAE A;  2IVO A;  2KLA A;  1ZBI A;  4CGF A;  3M8Q A;  3SBG A;  1L5U A;  5HLF A;  2NRV A;  4B08 A;  4B9T A;  3AV9 A;  2A1R A;  4KB1 A;  5KPR A;  3EY1 A;  1FXX A;  3EZ5 A;  1Y97 A;  1N36 K;  2QKK A;  1J6Z A;  2KW4 A;  2YHX A;  3M5R A;  4JAX A;  4KRF A;  4J8F A;  2D4W A;  5MLC Q;  4J2B A;  1NLV A;  3OW2 M;  1VQM N;  3VES A;  1MWK A;  4DTO A;  4ILG B;  2A3Z A;  2HF3 A;  2VQF K;  3B8A X;  1VSJ A;  1J5E K;  2HHQ A;  1MA9 B;  3IUC A;  4YOV A;  4BR0 A;  1NKC A;  2HHH K;  2E5L K;  3H6E A;  2A40 A;  2X74 A;  1OH7 A;  2XHB A;  4KKO A;  3CPW M;  2P9K A;  3QIC A;  3F2K A;  3KWG A;  4PUO A;  1KAY A;  1YTU A;  3WNH A;  4PA1 A;  4L8R B;  4NCB A;  2KTQ A;  2P9S B;  1SL0 A;  4GMJ B;  1JCF A;  2A1S A;  4JKG A;  4K41 A;  4W5Q A;  4H0X B;  4ILJ A;  4TSX A;  1HQU A;  1U4B A;  5E84 A;  3SUP A;  3LP1 A;  4BRM A;  5E41 A;  5AZJ B;  2HNZ A;  3WXI A;  3ZYY X;  2LSN A;  1RDC A;  2Z1J A;  3KK3 A;  3AVL A;  3KKR A;  3HM9 A;  2GTD A;  2FBV A;  1QSS A;  4V19 S;  2D0O A;  1ESV A;  4B1U B;  4YY3 K;  2RHK A;  3IKM A;  5FRM A;  4B9M A;  4C8N A;  3OJS A;  4H0Y B;  3TTC A;  1UA1 A;  2E1Y A;  3AO5 A;  3PO5 A;  2O8E A;  1YJN N;  3K9J A;  4CGD A;  1NK0 A;  4FZX C;  1RT6 A;  2HOE A;  1XC9 A;  1EXQ A;  4BRO A;  3VTH A;  3DLE A;  3PUF A;  3SMP A;  4JHD B;  1E4G T;  1VSL A;  4A5B A;  3C0B A;  3MCP A;  3E9P A;  2NRR A;  2H3G X;  3NF8 A;  4OVL A;  4K25 A;  4KO0 A;  4OPK A;  4JK8 A;  3ZSO A;  4Y1D A;  3L2Q A;  3HST B;  1JCE A;  2Q0U A;  3O3G A;  3DLL L;  3MN9 A;  1EKE A;  4DR5 K;  4KTQ A;  2RE2 A;  3MEG A;  3G4S N;  2A5X A;  1T05 A;  2IIR A;  3WEE A;  4BRL A;  3TTF A;  1YI2 N;  3J81 O;  2FXU A;  4FJ8 A;  1DTQ A;  5BN9 A;  3WNG A;  1QSL A;  3N4Q A;  4N41 A;  3DRP A;  4PQU A;  3J7A P;  2Q31 A;  3T69 A;  3ATU A;  5M1P A;  3ASM A;  1ATS A;  4E1J A;  4DTP A;  1QQM A;  4CFD A;  2HVH A;  3EEQ A;  1YVN A;  4DQP A;  4CFA A;  1CXQ A;  3LDN A;  3O6W A;  4YOY A;  4H4M A;  5AQW A;  2XY7 A;  1RBS A;  4FK2 A;  1BIU A;  4C8M A;  2FBY A;  3VEW A;  4K42 A;  3L0Q A;  3OYN A;  5I42 A;  3R3L A;  3SV3 A;  1SKR A;  2BH1 A;  5J1E A;  2P51 A;  4ILH A;  4F2S A;  3HZ6 A;  3GDQ A;  4Z0U A;  1A5V A;  5DM6 L;  3ZT0 A;  4DR4 K;  4CJV A;  4IDK A;  4BDZ A;  4YOR A;  1HQE A;  4HWI A;  3FZM A;  3AA2 A;  3CG7 A;  4BR4 A;  3RMC A;  5ADX A;  4F2R A;  1KC8 O;  4B1X B;  2OTL N;  4BWJ A;  3DLB A;  1XNR K;  4BRG A;  4EP4 A;  1ATN A;  4H03 B;  1BIS A;  4U67 L;  3KLI A;  4E1N A;  3NMU A;  1YHQ N;  2O8B B;  4JHD A;  3MWT A;  3NH1 A;  4ICL A;  3S3O A;  3VQP A;  3OS2 A;  4CJS A;  4CZI A;  2FBX A;  4AHR A;  3OBW A;  3CET A;  3CPE A;  3ZET B;  2UYT A;  4LSN A;  1TGO A;  4CJK A;  2XO7 A;  3HJF A;  4DR2 K;  5J2Q A;  3D45 A;  3P1G A;  4KV8 A;  5EOY A;  1NGG A;  4NXM K;  1CZA N;  4FJM A;  3HVR A;  4GKK K;  1FKP A;  4RW7 A;  3OYJ A;  3VQ8 A;  1Q86 O;  3CM6 A;  4CZG A;  3DXM B;  3I56 N;  3CCQ N;  4DWI A;  3BEX A;  2HHU A;  1DTT A;  2IDO A;  1I3A A;  2E2P A;  4DV4 K;  1NGF A;  1JXE A;  1VQP N;  1RDW X;  2P9L B;  1D9D A;  4IO9 L;  3SAF A;  1T6D A;  1Q9Y A;  3M8S A;  5KRT A;  1K6Y A;  1RT2 A;  5HBM A;  1ITG A;  1VSM A;  3C7N A;  3KZB A;  4MDA A;  2HVI A;  3O5B A;  4BC3 A;  4MFB A;  3QIP A;  1NJI O;  1X1P A;  3AGR A;  2IS3 A;  3O9T A;  3JYT A;  2O8C B;  1ASV A;  2HBM A;  2Q2R A;  2GUP A;  3ENH A;  2OPR A;  3H46 O;  3BY5 A;  2AJQ A;  1S5J A;  3V4I A;  1ZYQ A;  1HNI A;  3IDH A;  1QVF M;  4KHY A;  3O9S A;  3AVN A;  2A41 A;  4JRQ A;  3KWI A;  1JL1 A;  3DJC A;  4XH5 A;  5AQR A;  3TAM A;  2CGL A;  4BR5 A;  5AZI B;  4M3T A;  4YDU A;  1WBB A;  4DFK A;  1JLF A;  1LWE A;  2B5J A;  4PKI A;  1U2V B;  2ITG A;  3ZX3 A;  2Q1N A;  3P4I A;  4CEO A;  3OYE A;  3G71 N;  1QVG M;  3ISN C;  5EU7 A;  4FLW A;  1N33 K;  4FSV A;  4PKG A;  1SS6 A;  5M1O A;  3A5O C;  3LZJ A;  4BQZ A;  2ATQ A;  4DQQ A;  1ZBL A;  4CHP A;  3PSI A;  3KK1 A;  3HYF A;  1C1A A;  1DLO A;  3M8R A;  2YNG A;  1TKD A;  2W40 A;  3PV8 A;  1NJZ A;  3NBP A;  1J9A A;  2HW3 A;  5AR0 A;  3LWM A;  4DFJ A;  2HBK A;  2EX3 A;  2J4R A;  5AQL A;  4BDY A;  2ZD1 A;  3ID8 A;  1KCF A;  3EZW A;  3JAM O;  1QHA A;  5KPT A;  3QER A;  4O5F A;  4PKH A;  2IVP A;  1G99 A;  2BAN A;  3TAG A;  4YOT A;  3ZCM A;  1IKX A;  4H4O A;  2FSK A;  1HPZ A;  3LDS A;  4HUF A;  4DB3 A;  3ULE B;  4DSE A;  4CJ3 A;  4WFN L;  4ZTJ A;  3M6G A;  1NGC A;  2DPN A;  4I2P A;  3UKR B;  1TYQ A;  4OX9 K;  2Z1H A;  2HF4 A;  2E2Q A;  5AQT A;  4JD2 A;  5GAE P;  5EVZ A;  1Q18 A;  4DUZ K;  1T8E A;  1L3U A;  5J2M A;  4LF6 K;  2F9T A;  3OBY A;  3W3D A;  4CJ7 A;  2O8C A;  4DMN A;  3QBW A;  2DTU A;  1RFQ A;  4E89 A;  1BHL A;  3ULD A;  3CJ7 A;  1EO1 A;  4FJ5 A;  3EN9 A;  1ASW A;  1W0H A;  4JKC A;  2OYQ A;  5A2Q O;  1KFS A;  2QA4 N;  3M8P A;  4JI8 K;  1BCM A;  1IJJ A;  1OH5 A;  3DI6 A;  4O8U A;  3O4W A;  5AQQ A;  3QBX A;  2FF6 A;  5F1X A;  1TV6 A;  4CZH A;  3S3M A;  4FJI A;  1KSP A;  2WBN A;  2RN2 A;  4FLX A;  1SAZ A;  2E6L A;  1NGD A;  1TUU A;  3L2W A;  3ENO A;  3K2P A;  4CZK A;  4Z4C A;  1XMO K;  1FW6 A;  2KFN A;  1ZBH A;  1N34 K;  4NCA A;  2OPS A;  1IBL K;  4BG8 A;  3NFA A;  3MXM A;  3HL8 A;  1XNQ K;  2ETJ A;  3QNO A;  2YJF A;  3ZT4 A;  5LMU K;  1BI4 A;  3DM2 A;  3CC7 N;  5IWA K;  5BN8 A;  3ZSX A;  4XH4 A;  4K0K K;  1TUY A;  3ZX2 A;  3OYK A;  3SQ4 A;  5CYQ A;  5KGX A;  1U04 A;  4IFY A;  5M1N A;  2AA4 A;  3BUZ B;  1HKB A;  1WOQ A;  2Q3S A;  5CZ1 A;  4IOC L;  4FL9 A;  4CF9 A;  1W97 L;  2P9N B;  4X62 K;  1W2B M;  1RBU A;  1RDU A;  3LP0 A;  5AFU H;  1SL2 A;  2XY6 A;  1C1C A;  3CQY A;  3G0Z A;  4F3O A;  2VYP A;  2OPP A;  4FWK A;  1RBR A;  1JLG A;  2ITM A;  4KHU A;  3FE1 A;  1RDA A;  1HRH A;  3BP8 A;  3F73 A;  4DF4 A;  5CE3 A;  4XIU A;  3AVK A;  3CFO A;  3SMS A;  4GV3 A;  5TKW A;  3EO3 A;  3KKS A;  3CER A;  3OYG A;  1WUA A;  2Z1G A;  4RW9 A;  5LJV A;  2YNI A;  3P5J A;  3OTO K;  2IC3 A;  4C8L A;  4DTJ A;  4B8C A;  2ZWH A;  3CFR A;  2PZS A;  4JKH A;  3CJA A;  4LH5 A;  3ZT1 A;  3KLH A;  4CJE A;  1RTH A;  4A5A A;  4FWR A;  3VEY A;  2ZJR L;  1YXQ A;  4ELU A;  4MDB A;  4WE1 A;  3V1Q A;  3M3Z A;  3O4Q A;  5BPM A;  4DTX A;  3SUN A;  4DLG A;  1WNS A;  4KHQ A;  3VEZ A;  3RTV A;  1JLA A;  4EHT A;  4M3U A;  2HHS A;  2QXL A;  3HBT A;  2O8D B;  3AO1 A;  4YDU C;  2A42 A;  1RBV A;  1C0G A;  2G8I A;  4CD3 A;  4CJU A;  4H5T A;  1D4X A;  2W41 A;  1VRU A;  3I0S A;  4EHU A;  3A2F A;  1HYZ A;  2VWB A;  4H5V A;  1RCH A;  4QS8 A;  3T19 A;  2HHX A;  1NKB A;  1HYV A;  3U9D A;  4FZY A;  1MU2 A;  4CK1 A;  1KTQ A;  1TK0 A;  4DV3 K;  4DR6 K;  4ISG A;  5C2F A;  2BTF A;  2D0C A;  1XWL A;  3NF7 A;  1KD1 O;  4IOX A;  1CZB A;  3CIP A;  3O3H A;  4OPH A;  3WT0 A;  1X3M A;  4JI3 K;  3ZSR A;  4JI5 K;  4X64 K;  3AY9 A;  4MLE A;  1NJY A;  4CHZ A;  4JNE A;  1RT4 A;  3LPT A;  4CF2 A;  3F5T A;  1IBM K;  4LF7 K;  5EX5 A;  1VAZ A;  4K8X A;  2P9K B;  4FWL A;  3L3V A;  4XH1 A;  2ZQB A;  3THW A;  3TAB A;  3S41 A;  3WNE A;  3DRS A;  4BRE A;  3JSM A;  4CI6 A;  1VQO N;  2F9W A;  3MMV A;  1VQ8 N;  1RBT A;  3KLG A;  4DFP A;  4JKG B;  3ZT2 A;  3ATV A;  1KLN A;  1EX4 A;  4FM2 A;  1TL1 A;  2X78 A;  4AHC A;  4N47 A;  2EHG A;  4ISF A;  4O8K A;  3H45 C;  3CCS N;  3P38 A;  5AQZ A;  3AVC A;  4CJ5 A;  4B9L A;  2I5J A;  3RRH A;  3A8Y A;  4W5N A;  4IOA L;  2UUC K;  4M7Y A;  3QML A;  3OYD A;  2QTD A;  4DSL A;  3H3O B;  3L2R A;  3V9W A;  3CJB A;  3A5N C;  2V7Y A;  3HOS A;  4O0J A;  1Z25 A;  4BR7 A;  4ID1 A;  4LSL A;  2O8E B;  1B9F A;  4DSI A;  1ZBS A;  5GAG P;  4JKE A;  2P9I B;  3D2E B;  3MX5 A;  3VGM A;  4QOZ B;  1NU0 A;  4HTL A;  1X9M A;  4IFE A;  3K5M A;  4HTU A;  1S6P A;  3QEP A;  3C65 A;  1LW0 A;  3R1X A;  1NK6 A;  4BR9 A;  3CJ1 A;  1S3X A;  2P1J A;  1KXP A;  3VQ7 A;  3L4I A;  5AQF A;  2YHY A;  3AO3 A;  4LH4 A;  2X6N A;  4F8R A;  4U7B A;  1ILY A;  4JYA K;  4FOI A;  3OYA A;  1TVR A;  3QEW A;  2PY5 A;  2G8U A;  2A6A A;  4JLH A;  3F9K A;  3WEE B;  4CIG A;  1OKJ A;  3U3G A;  4DV2 K;  2P9U B;  1KVA A;  1C0M A;  1V4S A;  2PBD A;  5BPN A;  4H0V B;  3VA3 A;  4CEZ A;  1BDG A;  5HOO A;  2OCE A;  4KHP K;  3V9S A;  2FF3 B;  2QWL A;  4CEA A;  5GAD P;  4R5P A;  4Q5V A;  3U6F A;  2GEM A;  4I6M A;  3F9M A;  5AQG A;  1NM1 A;  4PHT X;  1TK8 A;  3SV4 A;  1N32 K;  1S1W A;  1Z05 A;  5FPD A;  4FCY A;  4BR2 A;  4I2Q A;  3KIO A;  5CYM A;  1VSK A;  4DTR A;  3CXC M;  4CK2 A;  1P90 A;  3OYL A;  4KBO A;  3OYI A;  4I7F A;  3I33 A;  5CR4 A;  4KPY A;  5F0X A;  4CHO A;  5BR8 K;  3TAR A;  3PLA A;  3VF6 A;  3ZSZ A;  5AJ3 K;  3T1Y K;  4NB4 A;  4E7L A;  3LM9 A;  3L4Q A;  1QS4 A;  4YHH K;  1JLB A;  3MEE A;  4G1Q A;  3KHY A;  2P9I A;  4IJN A;  3D2E A;  5KTQ A;  4W5O A;  4CF1 A;  3MCA B;  4OGC A;  3MDQ A;  4DSF A;  4JK7 A;  1D8Y A;  2JWK A;  3HRG A;  3KK7 A;  4BRA A;  1P8Z A;  4F4K A;  4WFA L;  5K14 A;  3HOT A;  1TKX A;  4FWM A;  1T6C A;  1HNX K;  4PY5 A;  2NLX A;  4EFH A;  1WN7 A;  5FRO A;  3MX2 A;  3DAW A;  3IRX A;  4DSK A;  4B9V A;  1E3M A;  5KRS A;  2FSN A;  3D6R A;  2Q97 A;  3AAP A;  4RTF D;  4IFV A;  1D9F A;  3PIP L;  1R59 O;  2E2O A;  3ZX0 A;  2P9U A;  3KLE A;  1T3V A;  2QWN A;  4FO0 A;  5LJW A;  4ZTF A;  4JN4 A;  3RMA A;  1BL3 A;  4DQS A;  5GAH P;  4DS5 A;  1CLQ A;  3VQ4 A;  3DLR A;  3I8D A;  3VQ5 A;  2QM1 A;  3C7N B;  4FK0 A;  1J5O A;  3M1F A;  3NE6 A;  3NGY A;  4CBW A;  3SK3 A;  1LWF A;  2YCH A;  1ZBU A;  3WXL A;  3O9R A;  5D3G A;  2NUB A;  2GWK A;  4H0O A;  1D5A A;  5BPL A;  4DR7 K;  3CCM N;  3LDP A;  2F96 A;  3SYZ A;  3C6A A;  1RGI A;  4FJ7 A;  4FPB A;  3VMF B;  1XC3 A;  4DR3 K;  1NGB A;  2BE2 A;  3TAQ A;  4GVM A;  3THY A;  4AIL C;  2P5G A;  3RMD A;  1NK5 A;  4Y0W A;  4BVP A;  1RT3 A;  4FLZ A;  4DU4 A;  1JLQ A;  1LAW A;  3CJC A;  2HST A;  3N4P A;  3RRG A;  1VHX A;  4C8K A;  4FJX A;  3UKU A;  3QEX A;  4I9Q A;  2VCP A;  4I9L A;  2QI2 A;  4M3W A;  5AQN A;  5AFU A;  1IKV A;  4O55 A;  3AA4 A;  1S9E A;  4CJF A;  4OKJ A;  1VQ9 N;  4BE2 A;  3EE9 A;  1S72 N;  2Q0R A;  1YT3 A;  4DLE A;  4KHS A;  1EP4 A;  1Q8I A;  5J2P A;  4LC9 B;  4C8O A;  2QEX N;  4DU1 A;  1NGI A;  3LDL A;  3MXI A;  1M90 O;  3AVA A;  5FLX O;  3VGK A;  3U3Y A;  3CCV N;  4DU3 A;  4MO4 A;  4W5R A;  4R79 A;  2O8F A;  4DR1 K;  3CCJ N;  3IG1 A;  4IEI A;  2E6M A;  4IJA A;  3HXM A;  2VWK A;  3A5M C;  3L3U A;  4BRN A;  1N8R O;  3VER A;  1TYQ B;  3HPO A;  3O9Q A;  2DFE A;  3DOK A;  5I3U A;  1S6Q A;  4NO7 A;  4JD2 B;  2PYL A;  3NVM A;  2Q36 A;  2E88 A;  4YOU A;  4JRP A;  4C23 A;  3EYZ A;  4CIE A;  3O08 A;  3JXU A;  2OTJ N;  1RTI A;  2G8K A;  4BRC A;  4DFM A;  4O4G A;  5HL7 L;  4IBN A;  4OPJ A;  3V9U A;  3V6D A;  3Q7C A;  2GUI A;  5BRF A;  5JLH A;  3VQC A;  3SQ1 A;  5JVG L;  4GW6 A;  2AP1 A;  4CED A;  1GLJ O;  4DTS A;  3J8A A;  4DV7 K;  2HNY A;  3GBT A;  3BZC A;  1O1W A;  1WSH A;  2GV9 A;  4M41 A;  2BDP A;  1BWF O;  1BQM A;  4KI4 A;  4PWD A;  2WTU A;  1Q82 O;  4FLV A;  3T1H K;  1RT7 A;  3ZEU A;  3FFI A;  2YNF A;  1VK0 A;  2XY5 A;  4FM1 A;  3KTQ A;  1BA1 A;  1BI4 B;  5BR9 A;  4Z4H A;  4BC5 A;  4B9Q A;  2R7Y A;  5GIP A;  3BGR A;  1IKY A;  1DT9 A;  2UU9 K;  1RDB A;  4GY2 B;  2KHO A;  2ZM6 K;  2QWM A;  5KI6 A;  3V9Z A;  1VSF A;  5LMN K;  1VSE A;  3NCI A;  4CZM A;  4JI1 K;  1X3N A;  3OA9 A;  3E1Y A;  4KHN A;  3DLK A;  3TPQ A;  4JEP A;  3QLH A;  3L2V A;  3P39 A;  1TAQ A;  4AM6 A;  2P9P A;  4OO1 J;  3JS6 A;  1RTD A;  2HB5 A;  3LPU A;  3L8B A;  4UY8 O;  1BCO A;  4B1W B;  2NRH A;  4YOX A;  1WBD A;  5AQJ A;  1VSH A; 
#chains in the Genus database with same CATH homology
 3I0S A;  2ZE2 A;  1YTU A;  2OZS A;  3A2F A;  3PY8 A;  4CJQ A;  4CFB A;  1HYZ A;  3QEV A;  3WNH A;  4PA1 A;  4L8R B;  4FZX C;  1B9D A;  4CGJ A;  4NCB A;  4FYD A;  2HHS A;  2KTQ A;  4LY7 A;  1EET A;  1RCH A;  3T19 A;  1SL0 A;  4DTM A;  4GMJ B;  2Y1I A;  2F8T A;  3IAY A;  2A1S A;  2HHX A;  1WAJ A;  3AA3 A;  1HYV A;  4CJW A;  1NKB A;  1LWC A;  4FZY A;  1F21 A;  1MU2 A;  4CK1 A;  1WSJ A;  1KTQ A;  1TK0 A;  4W5Q A;  3SPY A;  3HPG A;  3ZSV A;  2D0C A;  4TSX A;  4BE1 A;  1HQU A;  1XWL A;  4LD0 A;  1B92 A;  3OYC A;  3RMB A;  1U4B A;  3NF7 A;  1NKE A;  4ELV A;  3SUP A;  3LP1 A;  5E41 A;  2HNZ A;  4CF0 A;  1CZB A;  2FC0 A;  2LSN A;  4JS5 A;  3AVH A;  3O3H A;  1N5Y A;  1WSI A;  1RDC A;  2Z1J A;  3CYM A;  1RTJ A;  2KZZ A;  3KK3 A;  3AVL A;  3LAN A;  3ZSR A;  4BDP A;  3KKR A;  3HM9 A;  1QSS A;  2FBV A;  4CJR A;  1UA0 A;  2JLE A;  1NJY A;  2E4L A;  1NJW A;  4CHZ A;  2DY4 A;  1RDD A;  2G8H A;  1RT4 A;  3LPT A;  4O5B A;  4CF2 A;  1UOC A;  4C8N A;  4B9M A;  4M3X A;  5FRM A;  3OJS A;  1UA1 A;  3AO5 A;  4K8X A;  4AHS A;  2HMI A;  3PO5 A;  2JGU A;  2YV0 X;  2HHV A;  3L3V A;  3KD1 E;  2ZQB A;  1VSI A;  4CGD A;  3LZI A;  3HP6 A;  3TAB A;  3WNE A;  1KVB A;  3DRS A;  1RT6 A;  4CK3 A;  4N5S A;  3JSM A;  1IG9 A;  4DQI A;  4F3T A;  4FJN A;  3NF6 A;  1XC9 A;  1EXQ A;  1L3T A;  1FK9 A;  4MQ3 A;  3ZSY A;  1RBT A;  3DLE A;  2B6A A;  3PUF A;  3KLG A;  4DFP A;  3TAF A;  3ZT2 A;  4E7K A;  4CFC A;  1R0A A;  1KLN A;  1EX4 A;  4FM2 A;  1VSL A;  1TL1 A;  2X78 A;  4FLU A;  4AHC A;  4J2A A;  4CGG A;  4N47 A;  1HJR A;  2EHG A;  3ZT3 A;  1SKW A;  3LP2 A;  3AVC A;  4CJ5 A;  2OZM A;  4B9L A;  3NF8 A;  3VQ9 A;  4OVL A;  4M3Z A;  1C6V A;  2X6S A;  2D0A A;  4KO0 A;  2I5J A;  3P83 D;  1W9H A;  3ZSO A;  4OPK A;  3RRH A;  1CXU A;  4Y1D A;  4E7J A;  3E01 A;  4W5N A;  3L2Q A;  3HST B;  3OYD A;  3D0P A;  4HHT A;  3O3G A;  2DFF A;  4ZHR A;  4KHW A;  4DSL A;  5DK5 A;  1EKE A;  3L2R A;  3V9W A;  3K5O A;  4RG8 A;  1S9G A;  3C6T A;  3NGI A;  3K59 A;  3LAK A;  3SPZ A;  4M42 A;  4KTQ A;  1C1B A;  2IAJ A;  2QK9 A;  3MEG A;  1T05 A;  1NK9 A;  3TR8 A;  4O0J A;  1Z25 A;  1IKW A;  3VQB A;  1NK4 A;  2IGI A;  4ID1 A;  4LSL A;  2D0B A;  4E0D A;  4FJ8 A;  4CEB A;  1DTQ A;  4HUG A;  4DQR A;  1L3S A;  1Z26 A;  1B9F A;  3WNG A;  1QSL A;  3SQ0 A;  4N41 A;  4J2D A;  4F4K A;  4Y1C A;  4DSI A;  3DRP A;  3SNN A;  3SJJ A;  4PQU A;  1A5X A;  4UQG A;  5C24 A;  1JKH A;  3NHG A;  1U49 A;  2DFH A;  3TAN A;  3ASM A;  2VG5 A;  4OKE A;  4DTP A;  3AVB A;  2Y1J A;  1X9M A;  1JL2 A;  4QOZ B;  4CFD A;  2HVH A;  1RT5 A;  3K5M A;  1X9S A;  4HTU A;  3NH2 A;  1J53 A;  4CFA A;  3VQ6 A;  1CXQ A;  1S6P A;  1WLJ A;  3QEP A;  4DQP A;  1LW0 A;  4H4M A;  2XY7 A;  5CY4 A;  3I0R A;  1RBS A;  3OYF A;  1NK0 A;  2HHT A;  1NK6 A;  4FK2 A;  3VN5 A;  3QIO A;  3BDP A;  1BIU A;  2P1J A;  4C8M A;  3VQ7 A;  2FBY A;  3SUQ A;  3HPH A;  1Q9X A;  4H8K A;  3OYN A;  5I42 A;  3CM5 A;  3AO3 A;  4LH4 A;  4CJL A;  3SV3 A;  1SKR A;  2X6N A;  1HMV A;  3B6P A;  5J1E A;  3OYH A;  2P51 A;  4F2S A;  4F8R A;  3DRR A;  4KTW A;  4YFU A;  4W5T A;  1S1U A;  1HYS A;  2QXF A;  2RF2 A;  3MEC A;  3OYA A;  3H08 A;  4Z0U A;  1A5V A;  1KVC A;  5HRR A;  3ZT0 A;  1TVR A;  3K58 A;  2D5R A;  4IDK A;  4CJV A;  4BDZ A;  1HQE A;  3QEW A;  2G8U A;  2PY5 A;  3AA2 A;  3CG7 A;  4JLH A;  3F9K A;  4CIG A;  4DSJ A;  3RMC A;  4F2R A;  5KGW A;  3U3G A;  4B9N A;  4BWJ A;  1S1V A;  4QAG A;  3DLB A;  4Z4I A;  1KVA A;  4J2E A;  1C0M A;  2BGG A;  4EP4 A;  5HRP A;  3VA3 A;  3AO2 A;  1BIS A;  3AVJ A;  4CEZ A;  3KLI A;  4E1N A;  3RWU A;  3MED A;  3AO4 A;  4IG0 A;  3AVF A;  4FLY A;  3V9S A;  4CEA A;  4ICL A;  4Q5V A;  4R5P A;  3NH1 A;  1XHX A;  3U6F A;  1VSD A;  3VQP A;  3S3O A;  3PO4 A;  3OS2 A;  1KFD A;  4FJJ A;  4CJS A;  4CHQ A;  2FBX A;  4AHR A;  4DG1 A;  1TK8 A;  3SV4 A;  4CEF A;  4OLA A;  1S1W A;  1I39 A;  4N76 A;  3TWH A;  4FCY A;  3VA0 A;  4LSN A;  1TGO A;  4I2Q A;  4CJK A;  4HVJ A;  3KIO A;  5CYM A;  2XO7 A;  1VSK A;  3SZ2 A;  1NK7 A;  3HJF A;  4DTR A;  2RPI A;  3KD5 E;  1BGX T;  3K5L A;  2YNH A;  5J2Q A;  3D45 A;  3P1G A;  4KV8 A;  4CK2 A;  3VQE A;  3OYL A;  4B8A B;  3AVM A;  3OYI A;  1QHT A;  4I7F A;  4FJM A;  3OVN A;  4CIF A;  3ZSQ A;  3HVR A;  1FKP A;  5J2N A;  4RW7 A;  3C6U A;  3VQ8 A;  3OYJ A;  4CHO A;  3TAR A;  1QQC A;  2RKI A;  4KPY A;  3C94 A;  3CM6 A;  2KQ2 A;  2P5O A;  3ZSZ A;  4CEE A;  4E7L A;  5FDL A;  4DWI A;  4RW6 A;  1RT1 A;  4CJT A;  4RW4 A;  2HHU A;  1UAX A;  3OJU A;  3OS0 A;  1QS4 A;  1DTT A;  2IDO A;  1JLB A;  3MEE A;  1I3A A;  4BWM A;  2G8W A;  4G1Q A;  3NDK A;  1JXE A;  5KTQ A;  1D9D A;  4W5O A;  1Q9Y A;  2VG7 A;  4AHT A;  4CF1 A;  3M8S A;  3PX6 A;  4OGC A;  5KRT A;  1HNV A;  1K6Y A;  1RT2 A;  5HBM A;  1ITG A;  4DSF A;  1D8Y A;  4FZZ A;  4Z4F A;  5JS1 A;  1VSM A;  3TI0 A;  3K5N A;  2HVI A;  4CGH A;  5DMR A;  4FVM A;  1BIZ A;  4MFB A;  3QIP A;  1G15 A;  3O4N A;  1YVU A;  5K14 A;  3S9H A;  1XI1 A;  1X1P A;  1TKX A;  2HND A;  2IS3 A;  2W42 A;  4PY5 A;  5CZ2 A;  4CER A;  3T3F A;  4KI6 A;  4QCL A;  1WN7 A;  5FRO A;  3JYT A;  1ASV A;  1SV5 A;  3IRX A;  4DSK A;  4Z4E A;  3QO9 A;  2OPR A;  2WOM A;  4B9V A;  4B9S A;  3WNF A;  4CGI A;  2AJQ A;  1S1T A;  3OYM A;  1S5J A;  5KRS A;  1NK8 A;  3V4I A;  1ZYQ A;  1HNI A;  1REV A;  4KHY A;  3AVN A;  4HCC A;  1ZBF A;  4E1M A;  3K57 A;  4CF8 A;  4EP5 A;  3NF9 A;  4KTZ A;  4IFV A;  4JRQ A;  1JL1 A;  1D9F A;  4KAZ A;  3TAM A;  4NYN A;  2YKM A;  3LAL A;  3KLE A;  4M3T A;  3IS9 A;  4DFK A;  1JLF A;  1LWE A;  2KZM A;  2B5J A;  3V81 A;  5SZT A;  2ITG A;  4ZTF A;  2KFN A;  2KFZ A;  3RMA A;  1TKT A;  1BL3 A;  4DQS A;  4FK4 A;  1WSE A;  4KRE A;  4DS5 A;  1CLQ A;  1GOA A;  1SKS A;  3VQ4 A;  3DLR A;  4CEO A;  3OYE A;  5HRN A;  3I8D A;  3MAQ A;  4M3Y A;  3ISN C;  3VQ5 A;  3ZSW A;  5EU7 A;  4FLW A;  1S1X A;  4E3S A;  4FK0 A;  3C95 A;  1J5O A;  3NE6 A;  3NGY A;  3ITH A;  3LZJ A;  3PX4 A;  1LWF A;  2YKN A;  3HT3 A;  2PYJ A;  3LP3 A;  1ZBU A;  2ATQ A;  4DQQ A;  4CHP A;  1ZBL A;  3KK1 A;  3HYF A;  1LAV A;  1C1A A;  3KK2 A;  1DLO A;  5D3G A;  1GOB A;  3M8R A;  2YNG A;  1UWB A;  2NUB A;  2G8V A;  1TKD A;  1D5A A;  4HUE A;  2OA8 A;  3PV8 A;  1T7P A;  2F96 A;  1NJZ A;  3NBP A;  1J9A A;  2HW3 A;  4CEC A;  1KLM A;  3SYZ A;  3LWM A;  4FJ7 A;  4NCG A;  4DFJ A;  4CHN A;  2BE2 A;  1QSY A;  3TAQ A;  2EX3 A;  2VG6 A;  4GVM A;  4BDY A;  2ZD1 A;  4FJK A;  1XHZ A;  2QKB A;  1KCF A;  4AIL C;  2P5G A;  3RMD A;  3QER A;  1NK5 A;  2IOC A;  1QE1 A;  2YHB A;  4YNQ A;  1RT3 A;  4FLZ A;  4DU4 A;  1FKO A;  4ID5 A;  1JLQ A;  3B6O A;  3DLH A;  1LAW A;  4FJX A;  2BAN A;  4Z4G A;  3OYB A;  3KJV A;  3TAG A;  3VQQ A;  5SWM A;  3CFP A;  3ZCM A;  1JLE A;  1IKX A;  4H4O A;  4FW2 A;  1HPZ A;  3LDS A;  4HUF A;  4BAC A;  3RRG A;  3OS1 A;  4C8K A;  3QEX A;  2VWJ A;  3VQD A;  4DSE A;  3QNN A;  4CJ3 A;  4DS4 A;  4I9Q A;  3T1A A;  4OLB A;  4FM0 A;  4CES A;  3KLF A;  4I9L A;  4M3R A;  4ZTJ A;  4I2P A;  1L3V A;  4OJR A;  4IKF A;  3HO1 A;  4M3W A;  3SQ2 A;  3VQA A;  2Z1H A;  1IKV A;  3HP9 A;  3AA4 A;  4O55 A;  1S9E A;  4CJF A;  4CJ4 A;  1IH7 A;  4OKJ A;  3CQ8 A;  1T8E A;  4BE2 A;  5J2M A;  1L3U A;  1X9W A;  5JS2 A;  4KFB A;  4DMN A;  4FW1 A;  5T7B A;  2DTU A;  4E89 A;  1TKZ A;  1YT3 A;  4AHV A;  1BHL A;  3V1R A;  3ULD A;  4DLE A;  4KHS A;  1EP4 A;  1JXB A;  1LW2 A;  4CEQ A;  1Q8I A;  4FJ5 A;  1ASW A;  5J2P A;  1RIL A;  3L2U A;  4AH9 A;  4C8O A;  1W0H A;  2OYQ A;  4DU1 A;  1VRT A;  1KFS A;  1IO2 A;  2Z1I A;  1RNH A;  2XRI A;  3DYA A;  3M8P A;  3MXI A;  3S3N A;  2YHA A;  1BCM A;  3QIN A;  1TK5 A;  4FJ9 A;  4E7I A;  3DI6 A;  2O4I A;  2FBT A;  4CHY A;  3AVA A;  4M45 A;  3THV A;  3NGZ A;  1TV6 A;  1C0T A;  3U3Y A;  4DU3 A;  3S3M A;  4FJI A;  4W5R A;  1KSP A;  3OY9 A;  2RN2 A;  4FLX A;  4EZ9 A;  2HHW A;  2E6L A;  3L2W A;  3IG1 A;  3K2P A;  4HCB A;  4Z4C A;  4CE9 A;  1BQN A;  4CCH A;  2E6M A;  2OPQ A;  1JLC A;  3HXM A;  3SCX A;  4FJH A;  4ELT A;  4NCA A;  2OPS A;  2VWK A;  1QTM A;  3TAP A;  3AVG A;  3L3U A;  3NFA A;  4IG3 A;  3SUO A;  3HPO A;  3MXM A;  1LV5 A;  3HL8 A;  2DFE A;  3DOK A;  5I3U A;  2ETJ A;  1ASU A;  2WON A;  1S6Q A;  2O4G A;  3ZT4 A;  4E19 A;  3QNO A;  4CJP A;  2PYL A;  4OKK A;  1BI4 A;  3ALY A;  4AHU A;  3DM2 A;  1ZBH A;  2F8S A;  4JRP A;  1GOC A;  3EYZ A;  4CIE A;  2B4J A;  3HVT A;  4OGE A;  4O0I A;  4K8Z A;  1RTI A;  4BE0 A;  2G8K A;  1J54 A;  3ZSX A;  4DFM A;  3AA5 X;  5C25 A;  3QES A;  4O4G A;  3OYK A;  4IBN A;  4OPJ A;  3V9U A;  3V6D A;  3SQ4 A;  5CYQ A;  3DOL A;  3G10 A;  4Q0B A;  2GUI A;  5HRO A;  3MXJ A;  4JS4 A;  3DMJ A;  3VQC A;  5KGX A;  3SQ1 A;  1U04 A;  1U47 A;  4N56 A;  1NOZ A;  4GW6 A;  3HK2 A;  3PX0 A;  4KB0 A;  4IFY A;  1U45 A;  4B9U A;  4CED A;  3LWL A;  1U48 A;  3RR8 A;  4DTS A;  3NH0 A;  4DTU A;  3V1O A;  2HNY A;  2Q3S A;  5CZ1 A;  4NYF A;  3RR7 A;  2GBZ A;  1O1W A;  4CF9 A;  1WSH A;  2G8F A;  1NJX A;  3SI6 A;  4DF8 A;  2GV9 A;  4M41 A;  1WAF A;  5HRS A;  1T03 A;  2BDP A;  1BQM A;  5C42 A;  4KI4 A;  1RBU A;  4PWD A;  1CZ9 A;  4FXD A;  3LP0 A;  1TAU A;  4B3O A;  4RW8 A;  1SL2 A;  2XY6 A;  1C1C A;  4FJL A;  3G0Z A;  4FLV A;  4E7H A;  4F3O A;  1WSG A;  1A5W A;  1N6Q A;  3TAE A;  1RT7 A;  3FFI A;  2OPP A;  2YNF A;  1RBR A;  1JLG A;  1VK0 A;  1KRP A;  4KHU A;  2XY5 A;  1RDA A;  1HRH A;  4FM1 A;  1TL3 A;  1WSF A;  4CGF A;  1C0U A;  1ZBI A;  3M8Q A;  3F73 A;  3KTQ A;  1BI4 B;  1L5U A;  5HLF A;  5FRN A;  4B08 A;  4DF4 A;  4B9T A;  3AV9 A;  3AVK A;  4Z4H A;  4XIU A;  2A1R A;  3CFO A;  3AVI A;  2R7Y A;  4KB1 A;  3EY1 A;  1FXX A;  3KKS A;  1Y97 A;  3BGR A;  3OYG A;  3EZ5 A;  1IKY A;  3NAE A;  2QKK A;  2KW4 A;  1NOY A;  2Z1G A;  1RDB A;  4RW9 A;  2YNI A;  4EZ6 A;  3P5J A;  4KRF A;  5KI6 A;  3V9Z A;  2IC3 A;  1VSF A;  4C8L A;  1VSE A;  3NCI A;  4DTJ A;  4B8C A;  2XY8 A;  3CFR A;  4FLT A;  2PZS A;  4J2B A;  4LH5 A;  3ZT1 A;  3KLH A;  4KHN A;  3DLK A;  3V9X A;  1SL1 A;  4CJE A;  1RTH A;  4DTO A;  3O3F A;  3QLH A;  3L2V A;  4ELU A;  1YTA A;  4WE1 A;  3V1Q A;  1VSJ A;  3O4Q A;  2HHQ A;  1TAQ A;  4DTX A;  3SUN A;  4DLG A;  3QEI A;  1NKC A;  1WNS A;  3QET A;  4KHQ A;  4O44 A;  3RTV A;  1JLA A;  1SUQ A;  1RTD A;  3UIQ A;  4FJG A;  2X74 A;  4M3U A;  2HB5 A;  3DLG A;  2XHB A;  3LAM A;  3LPU A;  3AO1 A;  4KKO A;  3L8B A;  4DTN A;  1BCO A;  5HP1 A;  1RBV A;  2G8I A;  1VSH A;  4CJU A;  4PUO A;  1VRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...