5DMRA

Crystal structure of c-terminal domain of mouse erf1 in complex with rnase h domain of rt of moloney murine leukemia virus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
160
structure length
139
Chain Sequence
PDLTDQPLPDADHTWYTDGSSLLQRKAGAAVTTETEVIWAKALPAGTSAQRAELIALTQALKMAEGKKLNVYTDSRYAFATAHIHGEEIKNKDEILALLKALFLPKRLSIIHCPHSAEARGNRMADQAARKAAITETPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/translation
molecule keywords Reverse transcriptase/ribonuclease H p80
publication title Structural basis of suppression of host translation termination by Moloney Murine Leukemia Virus
pubmed doi rcsb
source organism Moloney murine leukemia virus (isolate shinnick)
total genus 37
structure length 139
sequence length 160
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5dmrA00
3RTVA 3HVTA 4JS5A 2EX3A 1U49A 3PO4A 4CFBA 4ZTJA 2Z1GA 3VN5A 4CHOA 1S1VA 5T7BA 1YVUA 3K59A 1KLMA 4DU1A 3OJUA 1QTMA 2YNHA 4FJ9A 3SYZA 4AHUA 3HVRA 1J9AA 4FK4A 1S6QA 2LSNA 3B6OA 3AVAA 4CJUA 5HP1A 3C6TA 1WSEA 3QIOA 4B8AB 4RG8A 1ZYQA 2B6AA 4AHVA 4AH9A 3QEXA 4C8KA 3AVCA 4BDYA 3ZSXA 3RWUA 3HPGA 4KRFA 3RRGA 4FLXA 3OYFA 4B08A 3AA2A 3ALYA 4IBNA 1S1WA 4LD0A 3HM9A 1X9MA 4FJNA 3VQ9A 1RT4A 2KTQA 3TAMA 2ZQBA 3AVMA 1NK0A 1IO2A 1BL3A 3BGRA 3C6UA 4FW1A 3WNEA 1SKRA 4CECA 3QETA 3SQ1A 3PO5A 4PQUA 4I2QA 2QKBA 3AVBA 1NOYA 3LZIA 3SV3A 1TK5A 4IKFA 1DTTA 2F96A 4BDZA 3KK2A 1IKYA 1LWCA 1YTAA 4DFPA 4N5SA 4CHYA 1RT2A 2OPSA 2XY5A 2PY5A 3QEWA 1NKEA 1BGXT 3M8QA 1XI1A 2YV0X 2KZZA 1I39A 5FROA 3P1GA 3ZSQA 1NJXA 3KLHA 5CYQA 2DFEA 4CEQA 1JXBA 3L3VA 5FRNA 3DM2A 4BWMA 1HNIA 4CFDA 1A5WA 2VWJA 1TKXA 1BQNA 3KD5E 5HBMA 4DSFA 4M3ZA 2F8SA 4ELTA 3SUOA 1RTDA 2VG6A 4H4OA 4CJ3A 4ELUA 1NJWA 3F73A 1REVA 2JLEA 3AVGA 4UQGA 4Z0UA 3NAEA 4E7IA 3LP3A 4DG1A 1RTIA 1I3AA 2Z1IA 4TSXA 5JS2A 1T03A 3MXJA 3WNFA 3V9UA 4Z4GA 4K8XA 4DS4A 5KRTA 3OS1A 4IDKA 2G8VA 1RDBA 3KIOA 4CGJA 1WSJA 3V1QA 1WSGA 1D9DA 4OKEA 2A1SA 4RW8A 2EHGA 4DTUA 4ELVA 1NOZA 1TVRA 4W5QA 4F2RA 3DRRA 2ZD1A 5CYMA 1JXEA 3KJVA 4CF8A 1JLCA 3AVHA 4W5NA 4MQ3A 1L3SA 1W0HA 4I9LA 3ASMA 1C1AA 1JL2A 4WE1A 3LDSA 4FM0A 4CJLA 1NK8A 1NJZA 3HP9A 4KTQA 1CXUA 2XY8A 1HQEA 1SUQA 1RDDA 3QIPA 3K58A 3RMCA 4HCBA 4KI4A 4E7LA 4KHWA 2IC3A 1BI4B 3L8BA 2P5GA 4RW4A 4O0JA 3PV8A 4CEFA 4E7KA 1BHLA 4M42A 3AV9A 1RCHA 1G15A 1HMVA 3C94A 1IKVA 3F9KA 2XO7A 1D9FA 4B9SA 3HO1A 1B92A 2OPQA 3HPOA 3VQCA 2X6SA 4LH4A 3PX0A 4F3TA 3OVNA 4B9MA 4B9NA 4OKJA 4ZTFA 4BWJA 4ID5A 3THVA 1S1XA 4BDPA 2YNIA 3LZJA 3PY8A 2HW3A 4O5BA 4Z4FA 1FK9A 3CM5A 4O44A 3A2FA 3VQAA 1RBSA 3ZT1A 1KVBA 3AVIA 3I0SA 3AO2A 3LWLA 1ZBUA 3M8SA 3L2RA 4HTUA 4KREA 4H8KA 2KFZA 4J2AA 1U47A 1K6YA 1RBRA 3TR8A 2YKMA 1RT3A 1FKPA 4DFKA 3KK1A 4FLYA 1X9SA 5HRNA 3QNOA 4KB0A 4CGGA 4OJRA 4FLUA 4K8ZA 4N76A 3HP6A 2IOCA 2X74A 4E19A 5HLFA 4KHSA 3NH1A 4M3TA 4FJKA 4DTSA 2IS3A 3M8RA 3RR7A 4FJ5A 1IG9A 1NK6A 1XC9A 1CZ9A 2E4LA 3HSTB 4ZHRA 1QS4A 2D0AA 3O3FA 2R7YA 3UIQA 1LW0A 4KPYA 2QKKA 4QAGA 4CEZA 3ISNC 3EY1A 1VSLA 3MXMA 1RT6A 1L3VA 3OY9A 4B9UA 4GW6A 4LSNA 3S3MA 3OS2A 1LV5A 3NH2A 3PUFA 1VSJA 2QXFA 3DLHA 4CJQA 4GMJB 4FLWA 4FJLA 1HYVA 4CE9A 2ITGA 3NDKA 3M8PA 4FJMA 1KFDA 1UA1A 3CQ8A 3V9WA 5E41A 4I2PA 3SUNA 2HNYA 4IFVA 3NH0A 4BE0A 3LP0A 3QEVA 4DTXA 3OYDA 1NJYA 2BDPA 3BDPA 1YTUA 2OZMA 2VG5A 2GV9A 3NE6A 1CXQA 1TL1A 5FDLA 1GOCA 4CCHA 4DQQA 4FJ8A 3SZ2A 4KAZA 1B9FA 1HRHA 4CEEA 3H08A 4DSJA 5C25A 1C0TA 2KW4A 4CIFA 3OYAA 1WSHA 4KB1A 2Y1IA 3RMBA 2RF2A 2QK9A 1GOAA 1S1UA 3RMAA 1VRTA 2OYQA 1SL0A 4FLZA 1NKCA 4FJ7A 1TL3A 4LY7A 3PX6A 2YHAA 3SQ4A 4B9TA 1QSSA 1VSDA 2VWKA 5HROA 4Z4EA 5KGWA 3MAQA 3QLHA 3OYNA 4YNQA 1HQUA 2HHUA 3WNHA 4FJXA 3AA3A 4E1NA 2KFNA 1FKOA 1HNVA 1Q8IA 1RBUA 1XWLA 3HYFA 5KGXA 1ASVA 2GUIA 3MEEA 4N56A 1KFSA 4M45A 3V1OA 4E89A 1KRPA 1WAFA 3QEPA 3ZSRA 4IG0A 5CY4A 3DLEA 3DLRA 1UOCA 4DTOA 2AJQA 1MU2A 4FW2A 4B8CA 2G8IA 3FFIA 1BISA 4KO0A 3L2UA 2Z1HA 4KI6A 4B9VA 4M41A 4GVMA 2D0BA 3L2WA 1VSHA 1QE1A 4FM1A 3LALA 2O4GA 4CGIA 3VQ6A 3I0RA 3NHGA 5FRMA 4DQRA 3O3GA 2JGUA 1VRUA 4Y1CA 1HYSA 3HPHA 4AILC 3VQPA 2B4JA 4RW9A 3NF9A 2HNZA 3TARA 1NKBA 1DLOA 1BCOA 3IRXA 3VQ5A 2HHQA 2YNGA 4CGDA 4O4GA 3VQBA 5J2NA 2HVIA 3QNNA 3TAFA 3AVKA 4M3RA 4CJFA 1QSYA 4NCGA 5DMRA 4CEDA 1SV5A 1L3TA 2G8UA 1C1CA 5I3UA 4FJJA 2RKIA 1JLGA 3OYIA 3L2VA 3NCIA 3IS9A 2P5OA 3S9HA 2B5JA 1B9DA 2PYJA 3TI0A 2G8FA 3HJFA 1RTHA 3VQEA 4CJPA 3KLFA 1JLAA 1WSFA 2YKNA 4E1MA 2G8WA 4NCAA 1NK9A 1UWBA 3ZSVA 1EX4A 3KKRA 3LPUA 1TK8A 3OYGA 3DOLA 4DU3A 3T1AA 4EP4A 5J1EA 4M3XA 4EP5A 3DRPA 2DFFA 1F21A 1SL1A 3KTQA 1U4BA 3CFOA 1T05A 3KD1E 3RMDA 2E6MA 1U48A 3K2PA 3AO3A 1R0AA 2ATQA 2IGIA 4C8OA 3CM6A 3NGZA 5HRSA 3SUPA 3I8DA 4CHQA 4W5RA 1VSMA 1S1TA 3TABA 1Z26A 2WONA 4LH5A 3OYLA 4DTRA 3U6FA 5I42A 1N6QA 4C8NA 1KCFA 2BANA 3LP2A 4DMNA 4CK1A 3TAEA 1SKWA 4FJGA 3OJSA 3AVLA 1T8EA 4FZXC 3HXMA 1RBVA 1RBTA 4NYFA 4CHPA 4DQIA 2HHXA 3ZSWA 1Y97A 1VSKA 3NGYA 3V1RA 4CFAA 3ZSOA 4CIGA 3SNNA 1TKDA 4F2SA 4M3UA 1VSIA 3VQDA 1KTQA 4F8RA 4IFYA 1ASWA 4Z4CA 3KLIA 1RT5A 3K57A 1LAWA 4EZ9A 4CIEA 2HB5A 4I7FA 4OGEA 4CJWA 3KK3A 4DF4A 4ID1A 4XIUA 1C0MA 2BGGA 1TAUA 4HVJA 3VA0A 2YNFA 1TGOA 4FCYA 4CF2A 4O0IA 3JSMA 4PWDA 4R5PA 4Z4IA 2WOMA 4CJKA 4PY5A 1ASUA 1TK0A 4OLBA 3SV4A 1JKHA 2XY6A 3OYCA 3JYTA 4KHNA 3AVNA 1XHZA 4B3OA 3SQ0A 1JLBA 5J2PA 3EYZA 2Z1JA 4ICLA 2DFHA 4DS5A 3V9XA 4CJ4A 1UAXA 3B6PA 1VSFA 5J2MA 1KVCA 3CFRA 3DRSA 4O55A 1X9WA 4KHUA 4DLEA 3KLGA 1GOBA 1TV6A 1C0UA 3DI6A 1L5UA 1W9HA 2HHWA 1U04A 1WN7A 3CG7A 4E0DA 3U3GA 1A5VA 3DOKA 1TKZA 3AO4A 1NK7A 4N41A 1S9EA 2ETJA 4J2EA 1C1BA 4FK0A 2KZMA 4J2DA 3S3OA 4OVLA 3HL8A 4I9QA 5EU7A 4J2BA 3OYMA 1LWEA 5C42A 2OPRA 3G0ZA 4CK2A 4QCLA 4DSKA 1WAJA 1WNSA 3DLKA 5C24A 2HHTA 2D0CA 4E7JA 4MFBA 3TWHA 3S3NA 4FZYA 1WLJA 4CGHA 5JS1A 4CF1A 1LW2A 3HT3A 2RPIA 1EETA 1LAVA 3SQ2A 2X6NA 3TAPA 2W42A 2IAJA 5CZ1A 1KVAA 4HUFA 4CF0A 4BE2A 4DTJA 2I5JA 2A1RA 2HMIA 3LANA 2P51A 1RT1A 4DSEA 4Q0BA 4KHYA 2FC0A 5D3GA 3L3UA 4QOZB 1BCMA 3AO1A 1T7PA 4YFUA 3AVFA 1D5AA 1DTQA 1ITGA 3O4NA 4KTZA 4CJVA 4H4MA 4HUGA 1Q9XA 4B9LA 1JLEA 4M3WA 3NFAA 3DLBA 2FBXA 3P5JA 4BACA 4C8LA 2PYLA 2HHVA 2KQ2A 2FBVA 4OLAA 1C6VA 3NGIA 4JRQA 2HVHA 2Q3SA 4FYDA 1N5YA 1Z25A 1NK5A 2G8KA 4CJ5A 3SUQA 3K5LA 4OPJA 3ZT2A 3ITHA 1S6PA 1RDCA 5KRSA 4CJRA 3CFPA 4CJTA 1HPZA 3ZSYA 3ZT4A 3RRHA 4LSLA 4E3SA 4OKKA 3OYBA 1VSEA 3V9ZA 1ZBIA 1RDAA 1A5XA 3ZSZA 2X78A 3K5NA 3SJJA 1ZBLA 1QQCA 3RR8A 4CEAA 3NF8A 4KTWA 4NCBA 2FBTA 1TKTA 4C8MA 3SI6A 3MEGA 3TANA 1L3UA 4FJIA 2Y1JA 3G10A 3ZCMA 3OYHA 4DSLA 1KLNA 4DQSA 3IAYA 4FJHA 4DFMA 1KSPA 4CJSA 2BE2A 3CYMA 3DMJA 3WNGA 4HHTA 4CGFA 1J54A 3QESA 4W5OA 2VG7A 4KHQA 1SKSA 3QINA 4DFJA 4Y1DA 1CZBA 3DYAA 1HYZA 3V6DA 4FXDA 4DWIA 1UA0A 3AA5X 3MXIA 3NF7A 3K5OA 1RNHA 1RILA 3LAKA 2XRIA 3OYEA 4N47A 4Z4HA 3L2QA 4JS4A 4DSIA 3VQ8A 3QEIA 3MEDA 1QSLA 1IH7A 3PX4A 4L8RB 3T19A 1ZBFA 2IDOA 2OPPA 2E6LA 4CESA 1BIZA 4KV8A 2F8TA 1Q9YA 2OZSA 2D5RA 1J53A 2DTUA 3O4QA 3VQQA 3ZT0A 2DY4A 1X1PA 1JL1A 4Q5VA 5SWMA 4RW6A 2GBZA 2ZE2A 4DQPA 1WSIA 3V9SA 4HUEA 1JLQA 4F4KA 3C95A 4JLHA 1VK0A 3AA4A 4CEBA 4DLGA 5HRPA 1BIUA 3ZT3A 4G1QA 5HRRA 1HJRA 1SL2A 2PZSA 4CJEA 1NK4A 4NYNA 3IG1A 4PA1A 4FVMA 1JLFA 3D0PA 2FBYA 2O4IA 3MECA 2XHBA 3VA3A 4FLVA 5J2QA 3VQ4A 1J5OA 1CLQA 3LWMA 3NF6A 1FXXA 1S5JA 3QO9A 3AVJA 3V4IA 3LAMA 4CK3A 1RTJA 2P1JA 3SPZA 2YHBA 4M3YA 3OYKA 2HNDA 4IG3A 3T3FA 1IKXA 4OGCA 1QHTA 3EZ5A 5K14A 1EKEA 3D45A 4AHCA 4FM2A 1BI4A 1EP4A 3KKSA 4BE1A 3U3YA 4DTPA 3HK2A 4CHZA 5SZTA 2OA8A 5CZ2A 4E7HA 1O1WA 3O3HA 3K5MA 3NBPA 3VQ7A 2HHSA 3DLGA 4CFCA 4CEOA 3TAGA 1XHXA 4KKOA 5KTQA 4JRPA 3QERA 5KI6A 3ULDA 3KLEA 3OS0A 4AHSA 4DU4A 3V81A 4EZ6A 4RW7A 4CERA 1EXQA 4DF8A 4PUOA 3SCXA 4CF9A 1YT3A 1LWFA 4DTMA 4FK2A 4F3OA 1TAQA 3SPYA 1IKWA 4KFBA 4FLTA 3AO5A 2XY7A 3TAQA 2G8HA 1U45A 4AHRA 4OPKA 4W5TA 4HCCA 4FZZA 4DTNA 2NUBA 3LPTA 1ZBHA 2RN2A 4AHTA 1D8YA 1RT7A 1S9GA 3E01A 1BQMA 5DK5A 4CHNA 3LP1A 3OYJA 3P83D
chains in the Genus database with same CATH superfamily
4JS5A 5KPZA 5JVHL 2PBDA 5TKWA 4ZTJA 3VN5A 4CW7B 1S1VA 1YVUA 4XH4A 1KLMA 4FJ9A 1C0FA 3SYZA 4FK4A 4H5NA 1J9AA 2JWLA 2LSNA 3U9DA 4RG8A 4BREA 4AH9A 3AVCA 3AAQA 3RWUA 4FLXA 3EKUA 4LD0A 2E5LK 2KTQA 1DGKN 1MA9B 1NK0A 1TUUA 1IO2A 1BL3A 5LMNK 4LF6K 4BVPA 4WQ4A 4I2QA 4EFHA 4BRGA 1VQPN 2QKBA 5GIOA 1NOYA 2NRXA 4IKFA 3KK2A 1IKYA 1LWCA 4CHYA 1RT2A 4IFEA 3IMXA 2P9NA 2ZM6K 5FROA 4AQYK 3KLHA 4CEQA 5FPDA 1JXBA 3L3VA 3DM2A 1A5WA 1BQNA 3OA9A 1FW6A 2F8SA 4M3ZA 4ELTA 2VGMA 3NAEA 4DG1A 4H0OA 1HUXA 4H5VA 3MXJA 5ELZA 3WNFA 3OS1A 2G8VA 1RDBA 3KIOA 4PKHA 3WXJA 1HLUA 4OKEA 1NOZA 3TTFA 3DRRA 1U6ZA 3KJVA 3NVKA 2VCPA 1CXUA 2ZF5O 4EHUA 1Q82O 4KHWA 3L8BA 1RCHA 3L4IA 1WB9A 2FSNA 3HPOA 3VQCA 4LH4A 4F3TA 1RDUA 3OVNA 3H3OB 2UYTA 4OKJA 4ZTFA 4ID5A 3D6RA 2YNIA 2Q2RA 1KQSM 3ZEUA 1KVBA 3I0SA 5GAEP 3AO2A 3P4IA 4HTUA 3CCEN 3ZETA 1RT3A 2H3GX 5BR9A 3QNOA 1T6DA 1DT9A 3MK6A 4N76A 5C2DA 3HP6A 2X74A 4E19A 5DM7L 3THYA 1V4SA 3EZWA 3NH1A 3M8RA 3RR7A 2E4LA 3HSTB 1QS4A 3F9MA 3ISNC 1K8KB 3MXMA 4BRHA 3ZX0A 1L3VA 5M1QA 1NU0A 3MN5A 3NH2A 3PUFA 1VSJA 3DLHA 2W6LA 4FJLA 2ITGA 1KFDA 5EXWA 5E41A 1SQKA 3C6HA 4I2PA 5MLCQ 3SAGA 3LP0A 4LF8K 2BDPA 1VQMN 3IUCA 1YTUA 1E4GT 4CCHA 4KAZA 1B9FA 1HRHA 1TYQB 1WSHA 5AQLA 4KB1A 3RMBA 1GOAA 1VRTA 2OYQA 5AQSA 1NKCA 3WXKA 3PX6A 4WFAL 3TU5A 2D4WA 1VSDA 2FSKA 2ZGYA 3BF3A 3OYNA 2A40A 2PFUA 4FJXA 1HNVA 5KGXA 3A5OC 1ASVA 4YY3K 3MEEA 1KFSA 4N56A 5F0XA 3V1OA 4PHTX 1KRPA 1WAFA 1JCGA 4BRCA 2GWJA 3DLEA 5I9EB 1NJIO 1UOCA 3I55N 3T1YK 3FFIA 1BISA 3R1XA 3L2WA 4JD2B 3O9QA 4CGIA 2HHHK 5FRMA 3O3GA 2YHYA 5AZJB 3TARA 4AILC 1NKBA 1BCOA 3VQ5A 4DHYA 4BRAA 2YNGA 3AARA 4JI2K 3CMEN 4B1WB 3LM9A 1RGIA 4A57A 2ASOA 4NXNK 4NCGA 4H0YB 1L3TA 4FJJA 3CQYA 2RKIA 4YOUA 1JLGA 3ATVA 4IJNA 4JEPA 4JN4A 2P5OA 5BREA 1B9DA 3MX5A 1T44A 3THWB 3HJFA 5AQXA 5ADXA 4CJPA 1JLAA 1UWBA 2P9UB 2GWKA 3O1WA 4B1ZA 3CJ7A 4OPAA 4JYAK 1F21A 3VF2A 1G99A 2ATQA 3I8DA 4W5RA 1VSMA 2D0OA 3OYLA 5I42A 4O8UA 4AM6A 2O8DA 4G9ZA 1T8EA 4MLEA 3ZSOA 4M3UA 1GLAG 3BF1A 1ESVA 2PAVA 3ENHA 3ZX3A 1LAWA 4CZFA 4EZ9A 4J8FA 3KK3A 2Q31A 4ID1A 2UXDK 1C0MA 2GTDA 3O5BA 4C23A 2YNFA 2WOMA 5F2RA 1TK0A 3H3NO 3SV4A 3KHYA 1N33K 3OYCA 3AVNA 4B3OA 5J2PA 4DS5A 3ID6A 3B6PA 4PL7A 4KHUA 1X9WA 3SMPA 3WXIA 5AQFA 1W9HA 1WN7A 3U3GA 2YHXA 3DOKA 2Q0UA 3AO4A 3OTOK 4N41A 2ETJA 1HNZK 3HL8A 5EU7A 2Q1NA 5LMUK 3NMUA 3G0ZA 4H0XB 4QCLA 4DSKA 1WNSA 3DLKA 5C24A 4X64K 3QB0A 4MFBA 4LF9K 1WLJA 3H1VX 5FPNA 5KPTA 5JS1A 3LDPA 1LW2A 2RPIA 1EETA 1LAVA 2IAJA 4HUFA 5EX5A 1T3VA 1U2VB 2D0PA 3N4PA 4RCHA 3LANA 1HPMA 4DSEA 4Q0BA 2QWPA 1D5AA 1NGCA 3DXMB 3O4NA 3P5JA 2I7PA 4BACA 2PYLA 4CZIA 2P9PA 2GELA 2FBVA 4OLAA 4JRQA 4PL8A 2FF6A 3O80A 5E84A 4OPJA 3ZT2A 5KRSA 1RDCA 3CFPA 1Q86O 3C0BA 3RRHA 2IIRA 4E3SA 1VSEA 2NNWA 2HOEA 1ZBLA 1QQCA 4KTWA 2UXBK 4E1JA 1L3UA 4FJIA 3KZBA 2Y1JA 4BGAA 1NWKA 3PIOL 1KSPA 4DR1K 3CYMA 3WNGA 3QESA 1J54A 3WEEB 4H5RA 3E9LA 4X65K 4DFJA 4Y1DA 1HYZA 4YHHK 3GDQA 4DWIA 5TKYA 5LJWA 3AA5X 3FZLA 3MXIA 3K5OA 3LDOA 2CGKA 1BWFO 3WT0A 3PX4A 1VQ4N 3J7AP 3T19A 4BG9A 2E6LA 3H45C 4CESA 3D2EB 1Q9YA 5FPMA 3VETA 1J53A 2DTUA 5E26A 1X1PA 5AFUH 5IT9O 4K42A 2HMPA 3DJCA 3AA4A 4FSVA 2CGLA 1HJRA 3VOVA 4B1YB 4PA1A 4FVMA 4JKAA 3FZHA 1E4FT 2O4IA 3MECA 3CXCM 1CLQA 3VQ4A 3U9ZA 3BY5A 3LWMA 5C0YA 1FXXA 1S5JA 2QWLA 2VQFK 4KH4A 3CJAA 3T3FA 1N36K 1IKXA 4OGCA 1QHTA 5IWAK 3EZ5A 1X3NA 1BI4A 1VQ5N 3KKSA 3HK2A 4XEIA 4E7HA 1O1WA 3K5MA 4CEOA 2A41A 4M63C 4YOTA 1NMDA 3OS0A 4DU4A 3QBWA 2YJFA 4RW7A 2KLAA 4CF9A 4DTMA 4FK2A 4WQ5C 4JI6K 3AO5A 2G8HA 2QWNA 3HBTA 4B9QA 4OPKA 1QHAA 4W5TA 4FZZA 3K9KA 5FLXO 1RT7A 1S9GA 3E01A 3I8BA 4KHPK 5DK5A 5AJ3K 2AA4A 3KWIA 1U49A 3PO4A 4JKFA 1HR0K 4CHOA 5T7BA 4K41A 3OJUA 3JXUA 3WXLA 2YJEA 3C7NA 3C6TA 1KD1O 1ZYQA 4AHVA 3A8YA 3QEXA 1NGJA 4BDYA 1ATRA 4KRFA 3RRGA 3GL1A 4CZGA 1X9MA 1S1WA 3HM9A 4FJNA 1RT4A 3TAMA 2IVNA 4QS7A 3UKUA 4NB4A 4CECA 4PQUA 3AVBA 4FVUA 5AR0A 1TK5A 2F96A 4I6MB 4BDZA 5LY3A 4N5SA 3P31A 3QEWA 1NKEA 3M8QA 1XI1A 2YV0X 1S3XA 4QS9A 1I39A 4CZLA 3P1GA 3ZSQA 2VWJA 1TKXA 1N32K 3CCQN 4LFCK 3SUOA 4H4OA 1YF5L 1NJWA 3AVGA 4E7IA 4Z0UA 1MDUB 1I3AA 3MMVA 3CERA 4CGJA 2QM1A 4BRIA 2QA4N 2ZD1A 4FPAA 3VESA 1QVFM 2UU9K 4CF8A 3AVHA 1ZBSA 3ASMA 1JL2A 4FM0A 1NJZA 5AQKA 3HP9A 3RMCA 4HCBA 1TUYA 3CI5A 1J5EK 4X66K 4DR6K 4RW4A 4O0JA 4BC2A 4CJ7A 4CEFA 4RWTA 5H1SQ 4M42A 3AV9A 2XO7A 1G15A 1HMVA 3F9KA 4A2BA 2X6SA 4B9NA 1S1XA 3LZJA 2I7NA 5LJVA 4FWOA 1FK9A 3A2FA 3VQAA 4B1VA 1OH7A 4H8KA 3WUHA 1RBRA 3VEVA 4FLYA 1XQSC 3BZKA 3UKRA 1QZ6A 4FLUA 4BRMA 4DV2K 2V7YA 4Z94A 1NK6A 1XC9A 2R7YA 1NMNA 4ZHRA 3J81O 4JKGA 2NRZA 1LW0A 4DCHA 4X62K 4QAGA 4CEZA 2QKKA 4O8KA 3DLLL 2BH1A 1HNWK 4GW6A 1VQ9N 4WQ5A 3R6MA 4FLWA 3CHWA 1HYVA 3M8PA 2ASMA 2A42A 5GINA 1GLLO 4IFVA 1VQNN 3AGKA 1NGGA 1K73O 3K9JA 4XH1A 4DV6K 3BDPA 2VG5A 2GV9A 2OZMA 4JI0K 2GX9A 2Q36A 1BUPA 3WQUA 4DSJA 4U7BA 5C25A 4FWPA 2RF2A 1S1UA 1SL0A 1TL3A 3HRGA 3DXKA 5KGWA 4MDAA 2NRRA 4A2AA 1HQUA 4BRFA 2HHUA 3M3ZA 1RBUA 4B1UB 2HF3A 5LL6Z 2GUIA 4B3TK 4M45A 4IG0A 2NRWA 5AQJA 4YOYA 4DTOA 4IO9L 3UB5A 1MU2A 4FW2A 3F2KA 4O5FA 4KO0A 3BUZB 3L2UA 2Z1HA 4B9VA 4M41A 4GVMA 4UY8O 3CCJN 2O4GA 3I0RA 3MCAB 2P9SA 3NHGA 3UE5A 2JGUA 5DM6L 4C1NI 2UUBK 2B4JA 4ISGA 3P39A 4DR2K 5J2NA 3QNNA 1K8AO 1EWQA 2QWRA 2E2PA 4A5BA 1QSYA 5KQDA 5I3UA 2G8UA 1ILYA 4K43A 3ZETB 2B5JA 4JHDB 3EE9A 4B1XB 3H46O 3VQEA 4YOVA 1BO5O 3KLFA 2YKNA 4WF9L 3T7ZA 4KBOA 1NK9A 1EX4A 3KKRA 4CZKA 3OYGA 2F4VK 3DOLA 4DU3A 3THYB 3T1AA 3HSCA 3SJHA 4EP4A 2VYPA 3MN6A 4M3XA 1SL1A 2ZJRL 2DFFA 3RSEA 4JK8A 1T05A 3RMDA 4LFBK 3MN7A 3AO3A 3VEWA 4EIAA 1KAXA 2IGIA 3CM6A 3H6EA 5HRSA 3NGZA 3MWTA 1YI2N 1S1TA 4DTRA 4DMNA 2BANA 1RBTA 4CHPA 4DQIA 2HHXA 2UUCK 3J7YP 1Y97A 4BG8A 4CFAA 1TKDA 1VSIA 3VQDA 3VF4A 4IFYA 1M90O 1RT5A 3LM2A 3J8AA 4BVOA 4XIUA 3ID8A 2BGGA 4FCYA 3OBYA 4R5PA 5AQGA 4ISFA 4CJKA 3ENBA 4OLBA 3O9TA 2GUPA 2F9TA 4IO8A 4KHNA 1XHZA 1NGDA 3SQ0A 3L4QA 3O9UA 3EYZA 3R3LA 1MWMA 2ITMA 4CJ4A 2P9KB 5J2MA 2YX6A 3DRSA 3KLGA 2O8EA 1L5UA 3CG7A 5BN8A 3MX2A 1QQNA 1C1BA 4FK0A 3S3OA 4OVLA 4J2BA 2E1ZA 4BROA 1HKGA 2Q97A 3P38A 4BY9C 4DUZK 2HHTA 2D0CA 4E7JA 4CVNE 4CGHA 5AQMA 3HT3A 5CZ1A 1KVAA 3VF6A 2A1RA 1NNEA 2HMIA 5AQIA 2P51A 1K8KA 4KHYA 4FOEA 4B3SK 1BCMA 4HUGA 3AVFA 2G8IA 4CJVA 4B9LA 4KTZA 4H4MA 1VQ6N 1JLEA 2WUSA 2KQ2A 2OCEA 1C6VA 2Q3SA 4JKEA 2G8KA 3SBTA 3SUQA 2BUPA 2V51B 3ITHA 2WC9A 4CJRA 5AQPA 2O8CB 4BRNA 3VERA 4JI4K 3VMFB 4OKKA 4JKBA 1Q7YO 2P9LB 3K5NA 2X78A 3RR8A 4ILHA 3LDNA 3Q7CA 4NCBA 4C8MA 1WUAA 2W41A 1KC8O 4BR7A 4CZHA 4DUYK 1P8ZA 3I56N 3CCVN 4FJHA 3DMJA 2YI1A 4HHTA 2O8FA 3CQXA 3V6DA 3DYAA 4LF5K 2QWQA 4MO4A 1N8RO 3OYEA 2XRIA 2FSJA 1QSLA 3R8EA 1IH7A 4CD3A 3O4QA 5CR4A 1NM1A 5SWMA 3QFPA 4JD2A 1VQ7N 4DV5K 3ZLJA 2ZE2A 1WSIA 1X9JA 4F4KA 4JLHA 1YVNA 4CEBA 4DLGA 2P9IA 2PZSA 4G1QA 4CJEA 1VQKN 1I94K 3IG1A 1NLVA 3QDKA 3VA3A 3AGRA 3AVJA 3LAMA 4CK3A 2P1JA 4JI7K 4YOXA 5K14A 4AHCA 5AQQA 4DTPA 1X3MA 5SZTA 5CZ2A 1OKJA 3NBPA 3VQ7A 4CFCA 5KTQA 4JRPA 4JKHA 4OX9K 1EXQA 1YT3A 3THXA 1TAQA 1ZXOA 4KFBA 5BRFA 3TAQA 4DV4K 4HCCA 4BRQA 2NUBA 3KWGA 3LPTA 4DV7K 4DTNA 5JLHA 3T1HK 2P9PB 4CHNA 1YUWA 3LP1A 3P83D 4AF1A 2EX3A 2Z1GA 3VEZA 3K59A 3LDQA 3O08A 4WCEL 1QTMA 4AHUA 2FXUA 3HVRA 5BRDA 4CJUA 4B8AB 3QIOA 3ZX2A 2B6AA 4ILGB 1Z6RA 3J7ZO 2O8BA 3WXMB 3ZSXA 3OYFA 4B08A 4FPBA 3L6QA 3VQ9A 4H03B 2ZQBA 1ATNA 3C6UA 4FW1A 3WNEA 4H0VB 3SQ1A 3PO5A 5JVGL 3TSPA 3C65A 4QS8A 1RFQA 3E9OA 5EOYA 2PY5A 3ULEA 3QFUA 3VEOA 4NLBA 5FPEA 4IJAA 1NJXA 2DFEA 1YHQN 3FGUA 3CJ1A 4BWMA 4KH5A 4CFDA 3KD5E 3SBGA 1RTDA 1Q81O 2VG6A 4ELUA 1REVA 4UQGA 3LP3A 4H5WA 1RTIA 4FWLA 3A5LC 2Z1IA 4TSXA 5JS2A 1BA1A 3V9UA 4Z4GA 1WSJA 3V1QA 1U2VA 4LC9B 3MCPA 4BRKA 2A1SA 4RW8A 4YOWA 4R79A 4DTUA 1Z05A 3CCLN 4W5QA 4PKIA 4F2RA 1HJOA 1JXEA 1JLCA 4W5NA 1W0HA 4I9LA 1OVYA 1C1AA 4WE1A 3D2FA 3LDSA 4KTQA 2ZJQL 2XY8A 1HQEA 3K58A 2BTFA 4F9OA 4DV0K 2IC3A 1BI4B 2E88A 4PY5A 3VTIA 3C94A 5BRHA 1D9FA 1IKVA 3GG4A 1B92A 2OPQA 3PX0A 2ZWHA 3A5NC 1WBBA 3PY8A 3CCMN 1OVQA 2FLOA 5B8HA 4Z4FA 4O44A 1RBSA 4KREA 3L2RA 2KFZA 1U47A 1XNRK 2YKMA 3KK1A 4KB0A 4CGGA 3EL2A 4OJRA 4FJKA 2IS3A 1IG9A 3C7NB 3O3FA 2D0AA 3EY1A 1VSLA 4XH5A 4A59A 3EO3A 1YAGA 3OY9A 3T69A 4DB3A 3W3DA 1VHXA 4LSNA 3OS2A 3S3MA 1LV5A 3CETA 4GMJB 3UKUB 2E2QA 4FL9A 4CE9A 4DR7K 4FJMA 3V9WA 1W97L 4H0PA 5AQTA 2HNYA 3NH0A 3JAMO 1GLJO 4DTXA 1NJYA 1CXQA 1GOCA 4FWMA 4DQQA 3N4QA 3SZ2A 5C2FA 3CC4N 3TTCA 1C0TA 2KW4A 3OYAA 2QK9A 5A2QO 3RMAA 3PIPL 1GLEG 3SQ4A 1QSSA 2VWKA 5HROA 3CD6N 3MAQA 4JK7A 4YNQA 3EKSA 3AA3A 4E1NA 2KFNA 1FKOA 1Q8IA 1XWLA 5BPNA 1SZ2A 2E8AA 4GNIA 4LF4K 2IVPA 3QEPA 5AZIB 3U8XA 3CMAN 3ZSRA 3O9SA 1M1KO 1NGBA 4B8CA 1JCFA 2Q0RA 4KI6A 1KXPA 5JLFA 5ADXH 2D0BA 5EY4A 3VQ6A 4Y1CA 3HPHA 3VQPA 3NF9A 1DLOA 2HHQA 4FWRA 4CGDA 4WFNL 4MLHA 3TAFA 3VGLA 2HVIA 3AVKA 4CJFA 2RE2A 4BC3A 1SV5A 1C1CA 2VQEK 3OYIA 1QZ5A 4IXCA 3NCIA 3S9HA 5BPLA 2QI2A 2OANA 3TI0A 2E20A 2G8FA 1IBKK 2ZGZA 3UKRB 3HI0A 4WYBA 4IWVA 4E1MA 1OH5A 4BRDA 3RVCA 3LPUA 2ASPA 4GKKK 4EP5A 3KTQA 3CFOA 5BN9A 4JKGB 2E6MA 4DV1K 1U48A 3K2PA 3K0SA 3SUPA 4B3MK 4CHQA 3CF5L 3TABA 1Z26A 3U6FA 4LH5A 1N6QA 1KCFA 3LP2A 2QEXN 4FJGA 1SKWA 2HBLA 3J80O 1QQMA 1RBVA 3MWPA 3HXMA 2HSTA 5JICA 4F2SA 1VSKA 3V1RA 4LFAK 2D1KA 4DKWA 1KTQA 5AQUA 1ASWA 3M5RA 3KLIA 4WFBL 2QWOA 2HB5A 4OGEA 4CJWA 3SAHA 1TAUA 4HVJA 3VA0A 1TGOA 4CF2A 4PWDA 4Z4IA 4YORA 2XY6A 3DXKB 2DFHA 4U67L 3G4SN 3V9XA 1UAXA 2QW9A 1SS6A 1VSFA 4FWNA 4O55A 4DLEA 1YJNN 3A5MC 4BGBA 1H1VA 2P9NB 4E0DA 1A5VA 2EWSA 1S9EA 4FWQA 4J2DA 4I9QA 3CJ9A 3QICA 3OYMA 4ILJA 1LWEA 1NGEA 3E9PA 4CK2A 3TSQA 1WAJA 2P9SB 3FZMA 3G6EN 4CF1A 1KAYA 3SQ2A 3D7EO 3TSUA 3CPEA 1RT1A 1Y64A 2YCHA 3OBWA 4BR2A 4LF7K 2FC0A 5D3GA 3L3UA 4QOZB 1T7PA 4YFUA 1DTQA 2HBMA 2A6AA 3DLBA 2FBXA 2HHVA 4K25A 2NRHA 4IOAL 2HVHA 3NGIA 1Z25A 1NK5A 3ENOA 1NGFA 3HTVA 1NGHA 4CJTA 3ZT4A 3LDLA 3OYBA 1RDAA 4BC5A 1A5XA 3ZSZA 3SAFA 1QQOA 4CEAA 3NF8A 3RSEB 3AAPA 1XMQK 1TKTA 3SI6A 1BU6O 1VAZA 3G10A 3ZEUB 1K9MO 3CC7N 3ZCMA 5AQVA 3OYHA 4DSLA 1KLNA 4DQSA 3IAYA 4CJSA 2GEMA 3CJCA 4CGFA 4NLCA 5EVZA 4KHQA 1SKSA 4M7YA 1RILA 2A5XA 4N47A 4BR0A 4Z4HA 3L2QA 4B3RK 2F9WA 3MEDA 1GLDG 4IOXA 3BP8A 4L8RB 3L0QA 1ZBFA 2IDOA 2F8TA 2OZSA 2D5RA 3CCUN 4NXMK 3VQQA 3ZT0A 2DY4A 1JJ2M 1JL1A 2VGNA 4Q5VA 4RW6A 4NO7A 1IJJA 4HUEA 1JLQA 2WFBA 3C95A 5HRPA 1BIUA 3ZT3A 4CBXA 1NK4A 3BEXA 2KHOA 3PSIA 4RTFD 2NZTA 2FBYA 2XHBA 1J5OA 1NBWA 4FLVA 5J2QA 2O8EB 3NF6A 3IFRA 3QO9A 2CH5A 3VEXA 1RTJA 3SPZA 2YHBA 1S72N 4IG3A 2UUAK 3PLAA 1MWKA 4BR9A 4ISEA 4JHDA 4FM2A 2OTJN 3U3YA 2OA8A 5AFUA 1ATSA 3O3HA 3HOSA 1R59O 3DLGA 3TAGA 3QERA 3ULDA 1IBLK 3V81A 4DF8A 1LWFA 3FR0A 2UXCK 2XY7A 1YITN 1U45A 4AHRA 4IOCL 1ZBHA 3M1FA 4PKGA 1W2BM 1D8YA 4CI6A 5GAGP 2WBNA 4DQ8A 4IZ9A 3OYJA 3RTVA 3HVTA 4EAHD 2V7ZA 4CFBA 4JK9A 4BC4A 4KH6A 4DU1A 2YNHA 2NRVA 3A0IX 1WOQA 1S6QA 1LOTB 3AVAA 3B6OA 5HP1A 1WSEA 4C8KA 3HPGA 3AA2A 3ALYA 4IBNA 1GLCG 3VTHA 3AVMA 3IKMA 1SKRA 3BGRA 3QETA 1VQLN 3C6AA 2VWBA 4YDUC 2O8FB 3LZIA 3SV3A 1RDWX 5M1PA 1DTTA 1NGAA 3HM8A 3CCSN 4DFPA 2P9KA 1YTAA 2V52B 2OPSA 2XY5A 3HOTA 1BGXT 3O9RA 2KZZA 1TYQA 3NVMA 5CYQA 4A61A 4BR5A 5FRNA 1NGIA 3FZKA 1HNIA 4GV6A 5HL7L 5HBMA 4DSFA 4CJ3A 1YJ9N 3F73A 2JLEA 4V19S 3PSFA 2O8DB 1T03A 4K8XA 2P9IB 4DS4A 5KRTA 4IDKA 2WTUA 1BDGA 1D9DA 1WSGA 5M1NA 2EHGA 4ELVA 2F7TA 1TVRA 5AQNA 1BA0A 5CYMA 3E1YA 4MQ3A 1L3SA 4BR4A 1NK8A 4IEEA 4CJLA 4AM7A 1SUQA 1RDDA 3QIPA 1BG3A 3LL3A 4KI4A 4E7LA 2P5GA 1XUPO 3PV8A 4E7KA 1DKGD 1BHLA 1HKCA 4B9SA 3GE1A 2O8CA 3HO1A 2FF3B 1DEJA 3GOIA 5AZJA 4A62A 2P9LA 4GV3A 4B9MA 3MN9A 4BWJA 1LCUA 3THVA 4BDPA 2HW3A 4O5BA 3THXB 3CM5A 3LWLA 3ZT1A 3AVIA 3O4WA 1ZBUA 3M8SA 1GLBG 2NRTA 4J2AA 1K6YA 3TR8A 4CZJA 1FKPA 4DFKA 1X9SA 5HOOA 3THWA 2CH6A 5HRNA 4BRPA 2QTDA 2ZJPL 4K8ZA 5HLFA 2IOCA 2P9UA 4KHSA 4M3TA 4DTSA 4FJ5A 1CZ9A 4IEIA 3UIQA 4KPYA 3JS6A 4CD1A 2O8BB 1RT6A 3BZCA 4B9UA 3H1QA 1T6CA 5C10A 2OTLN 3QBXA 4DR3K 2QXFA 4CJQA 4CZEA 3FFKB 3NDKA 4FWSA 1UA1A 3CQ8A 3TTDA 3SUNA 1YXQA 4BE0A 3DAWA 3QEVA 3S41A 3OYDA 5CE3A 3NE6A 1TL1A 5FDLA 3CC2N 3ULEB 4FJ8A 4CEEA 1C0GA 2E2NA 3H08A 4DV3K 4CIFA 5CHIA 3ZYYX 2Y1IA 4BQZA 4FLZA 4FJ7A 2J4RA 4LY7A 3F5TA 2YHAA 4B9TA 2E1YA 4Z4EA 5AQHA 3QLHA 2CGJA 3WNHA 4YDUA 3HYFA 3SLCA 5AQOA 4FWKA 5BPMA 1NG9A 4E89A 5CY4A 3DLRA 1S22A 3OHRA 4K0KK 3D2FB 4JI1K 2AJQA 4BRLA 1VSHA 1QE1A 2HBKA 3LALA 4FM1A 2W40A 3G25A 4DQRA 1XC3A 1VRUA 1HYSA 4RW9A 3W0LA 2HNZA 3IRXA 3M6GA 4O4GA 3VQBA 3VGMA 1N34K 4M3RA 5C12A 4M7XA 4HTLA 3DXMA 5DMRA 4CEDA 5KPRA 5GAHP 4FO0A 4L3QA 3L2VA 3IS9A 2NLXA 1XNQK 5AQWA 2PYJA 1RTHA 1WSFA 2G8WA 1YJWN 4NCAA 1EQYA 3ZSVA 1TK8A 3WQTA 1GLFO 5J1EA 3DRPA 1U4BA 3KD1E 1R0AA 2W6KA 4C8OA 4BQLA 2RHKA 3EN9A 4JAXA 4OO1J 2WONA 4Y0WA 4C8NA 3VEYA 2QWMA 2JWKA 4CK1A 5KQ8A 1IG8A 3TAEA 3OJSA 3AVLA 3WEEA 4FZXC 4NYFA 1QVGM 4EHTA 5M1OA 3ZSWA 3NGYA 4CIGA 3SNNA 2IVOA 5F1XA 2HF4A 4F8RA 4H5TA 4Z4CA 3AY9A 3K57A 5AQZA 4CIEA 4I7FA 3D2EA 4DF4A 3SMSA 4O0IA 3JSMA 4JKCA 1ASUA 3EEQA 1JKHA 3JYTA 1JLBA 2Z1JA 4ICLA 1XMOK 2YHWA 1KVCA 3G71N 3CFRA 5M1KA 1HNXK 1GOBA 1TV6A 1C0UA 2QXLA 3DI6A 2HHWA 1U04A 3HZ6A 1TKZA 1NK7A 1P90A 4JV5K 4J2EA 1JCEA 2KZMA 1V4TA 3MDQA 5C42A 2OPRA 4A5AA 1FJGK 3IDHA 3FE1A 4FZYA 3TWHA 3S3NA 4GKJK 2X6NA 1EWRA 3TAPA 2W42A 1EO1A 4CF0A 4BE2A 4DTJA 2I5JA 1WBDA 3EE8A 3AO1A 1ITGA 1Q9XA 4M3WA 3DWLA 3NFAA 1ZC6A 1KAZA 4C8LA 4WQ4C 2HBJA 4OPHA 3VPZA 4DR5K 4FYDA 1N5YA 4JKDA 3B8AX 5AQRA 4CJ5A 3K5LA 3OW2M 3R9PA 3KK7A 1S6PA 1HPZA 3ZSYA 4LSLA 1VQON 3U4LA 3V9ZA 4GY2B 1ZBIA 1YIJN 4DR4K 3SJJA 3FZFA 4MO5A 2FBTA 4JI8K 3MEGA 1O13A 3TANA 1J6ZA 5JMVA 1BOTO 3FLCO 5GIPA 4DFMA 4CBUA 2BE2A 1HKBA 4H0TB 1IBMK 3CPWM 5AQYA 4W5OA 2VG7A 3QINA 4I6MA 1CZBA 3ATUA 4GVEA 4FXDA 1UA0A 4HWIA 3NF7A 3LAKA 1RNHA 4JS4A 5AZIA 3O6WA 3VQ8A 3QEIA 1VQ8N 4DSIA 2OPPA 3I33A 1BIZA 4KV8A 1SAZA 4JNEA 3Q7BA 3SK3A 5GADP 2GBZA 4GV9A 3E66A 4DQPA 4JI3K 3V9SA 3O8MA 3VGKA 1VK0A 3QMLA 5C15A 5HRRA 1SL2A 2KKZA 4NYNA 5M1FA 1JLFA 3D0PA 3V4IA 3O1BA 1OH8A 4M3YA 3OYKA 2HNDA 1EKEA 3D45A 4MDBA 3CJBA 1EP4A 4BE1A 1CZAN 4CHZA 2HHSA 3CCRN 2DPNA 4JI5K 1D4XA 1XHXA 4KKOA 4CBWA 5KI6A 3KLEA 4AHSA 4EZ6A 1W7AA 4FOIA 2AP1A 3CIPA 4CERA 4PUOA 3SCXA 1Q18A 4F3OA 3SPYA 1IKWA 3GBTA 3KVGA 4FLTA 1E3MA 1OH6A 1IV0A 1HX1A 5BR8K 4IDHA 2E2OA 4C1NK 3VENA 2RN2A 3TPQA 4AHTA 1BQMA 2A3ZA 4CZMA
chains in the Genus database with same CATH topology
3RTVA 3HVTA 4JS5A 2EX3A 1U49A 3PO4A 4CFBA 4ZTJA 2Z1GA 3VN5A 4CHOA 1S1VA 5T7BA 1YVUA 3K59A 1KLMA 4DU1A 3OJUA 1QTMA 2YNHA 4FJ9A 3SYZA 4AHUA 3HVRA 1J9AA 4FK4A 1S6QA 2LSNA 3B6OA 3AVAA 4CJUA 5HP1A 3C6TA 1WSEA 3QIOA 4B8AB 4RG8A 1ZYQA 2B6AA 4AHVA 4AH9A 3QEXA 4C8KA 3AVCA 4BDYA 3ZSXA 3RWUA 3HPGA 4KRFA 3RRGA 4FLXA 3OYFA 4B08A 3AA2A 3ALYA 4IBNA 1S1WA 4LD0A 3HM9A 1X9MA 4FJNA 3VQ9A 1RT4A 2KTQA 3TAMA 2ZQBA 3AVMA 1NK0A 1IO2A 1BL3A 3BGRA 3C6UA 4FW1A 3WNEA 1SKRA 4CECA 3QETA 3SQ1A 3PO5A 4PQUA 4I2QA 2QKBA 3AVBA 1NOYA 3LZIA 3SV3A 1TK5A 4IKFA 1DTTA 2F96A 4BDZA 3KK2A 1IKYA 1LWCA 1YTAA 4DFPA 4N5SA 4CHYA 1RT2A 2OPSA 2XY5A 2PY5A 3QEWA 1NKEA 1BGXT 3M8QA 1XI1A 2YV0X 2KZZA 1I39A 5FROA 3P1GA 3ZSQA 1NJXA 3KLHA 5CYQA 2DFEA 4CEQA 1JXBA 3L3VA 5FRNA 3DM2A 4BWMA 1HNIA 4CFDA 1A5WA 2VWJA 1TKXA 1BQNA 3KD5E 5HBMA 4DSFA 4M3ZA 2F8SA 4ELTA 3SUOA 1RTDA 2VG6A 4H4OA 4CJ3A 4ELUA 1NJWA 3F73A 1REVA 2JLEA 3AVGA 4UQGA 4Z0UA 3NAEA 4E7IA 3LP3A 4DG1A 1RTIA 1I3AA 2Z1IA 4TSXA 5JS2A 1T03A 3MXJA 3WNFA 3V9UA 4Z4GA 4K8XA 4DS4A 5KRTA 3OS1A 4IDKA 2G8VA 1RDBA 3KIOA 4CGJA 1WSJA 3V1QA 1WSGA 1D9DA 4OKEA 2A1SA 4RW8A 2EHGA 4DTUA 4ELVA 1NOZA 1TVRA 4W5QA 4F2RA 3DRRA 2ZD1A 5CYMA 1JXEA 3KJVA 4CF8A 1JLCA 3AVHA 4W5NA 4MQ3A 1L3SA 1W0HA 4I9LA 3ASMA 1C1AA 1JL2A 4WE1A 3LDSA 4FM0A 4CJLA 1NK8A 1NJZA 3HP9A 4KTQA 1CXUA 2XY8A 1HQEA 1SUQA 1RDDA 3QIPA 3K58A 3RMCA 4HCBA 4KI4A 4E7LA 4KHWA 2IC3A 1BI4B 3L8BA 2P5GA 4RW4A 4O0JA 3PV8A 4CEFA 4E7KA 1BHLA 4M42A 3AV9A 1RCHA 1G15A 1HMVA 3C94A 1IKVA 3F9KA 2XO7A 1D9FA 4B9SA 3HO1A 1B92A 2OPQA 3HPOA 3VQCA 2X6SA 4LH4A 3PX0A 4F3TA 3OVNA 4B9MA 4B9NA 4OKJA 4ZTFA 4BWJA 4ID5A 3THVA 1S1XA 4BDPA 2YNIA 3LZJA 3PY8A 2HW3A 4O5BA 4Z4FA 1FK9A 3CM5A 4O44A 3A2FA 3VQAA 1RBSA 3ZT1A 1KVBA 3AVIA 3I0SA 3AO2A 3LWLA 1ZBUA 3M8SA 3L2RA 4HTUA 4KREA 4H8KA 2KFZA 4J2AA 1U47A 1K6YA 1RBRA 3TR8A 2YKMA 1RT3A 1FKPA 4DFKA 3KK1A 4FLYA 1X9SA 5HRNA 3QNOA 4KB0A 4CGGA 4OJRA 4FLUA 4K8ZA 4N76A 3HP6A 2IOCA 2X74A 4E19A 5HLFA 4KHSA 3NH1A 4M3TA 4FJKA 4DTSA 2IS3A 3M8RA 3RR7A 4FJ5A 1IG9A 1NK6A 1XC9A 1CZ9A 2E4LA 3HSTB 4ZHRA 1QS4A 2D0AA 3O3FA 2R7YA 3UIQA 1LW0A 4KPYA 2QKKA 4QAGA 4CEZA 3ISNC 3EY1A 1VSLA 3MXMA 1RT6A 1L3VA 3OY9A 4B9UA 4GW6A 4LSNA 3S3MA 3OS2A 1LV5A 3NH2A 3PUFA 1VSJA 2QXFA 3DLHA 4CJQA 4GMJB 4FLWA 4FJLA 1HYVA 4CE9A 2ITGA 3NDKA 3M8PA 4FJMA 1KFDA 1UA1A 3CQ8A 3V9WA 5E41A 4I2PA 3SUNA 2HNYA 4IFVA 3NH0A 4BE0A 3LP0A 3QEVA 4DTXA 3OYDA 1NJYA 2BDPA 3BDPA 1YTUA 2OZMA 2VG5A 2GV9A 3NE6A 1CXQA 1TL1A 5FDLA 1GOCA 4CCHA 4DQQA 4FJ8A 3SZ2A 4KAZA 1B9FA 1HRHA 4CEEA 3H08A 4DSJA 5C25A 1C0TA 2KW4A 4CIFA 3OYAA 1WSHA 4KB1A 2Y1IA 3RMBA 2RF2A 2QK9A 1GOAA 1S1UA 3RMAA 1VRTA 2OYQA 1SL0A 4FLZA 1NKCA 4FJ7A 1TL3A 4LY7A 3PX6A 2YHAA 3SQ4A 4B9TA 1QSSA 1VSDA 2VWKA 5HROA 4Z4EA 5KGWA 3MAQA 3QLHA 3OYNA 4YNQA 1HQUA 2HHUA 3WNHA 4FJXA 3AA3A 4E1NA 2KFNA 1FKOA 1HNVA 1Q8IA 1RBUA 1XWLA 3HYFA 5KGXA 1ASVA 2GUIA 3MEEA 4N56A 1KFSA 4M45A 3V1OA 4E89A 1KRPA 1WAFA 3QEPA 3ZSRA 4IG0A 5CY4A 3DLEA 3DLRA 1UOCA 4DTOA 2AJQA 1MU2A 4FW2A 4B8CA 2G8IA 3FFIA 1BISA 4KO0A 3L2UA 2Z1HA 4KI6A 4B9VA 4M41A 4GVMA 2D0BA 3L2WA 1VSHA 1QE1A 4FM1A 3LALA 2O4GA 4CGIA 3VQ6A 3I0RA 3NHGA 5FRMA 4DQRA 3O3GA 2JGUA 1VRUA 4Y1CA 1HYSA 3HPHA 4AILC 3VQPA 2B4JA 4RW9A 3NF9A 2HNZA 3TARA 1NKBA 1DLOA 1BCOA 3IRXA 3VQ5A 2HHQA 2YNGA 4CGDA 4O4GA 3VQBA 5J2NA 2HVIA 3QNNA 3TAFA 3AVKA 4M3RA 4CJFA 1QSYA 4NCGA 5DMRA 4CEDA 1SV5A 1L3TA 2G8UA 1C1CA 5I3UA 4FJJA 2RKIA 1JLGA 3OYIA 3L2VA 3NCIA 3IS9A 2P5OA 3S9HA 2B5JA 1B9DA 2PYJA 3TI0A 2G8FA 3HJFA 1RTHA 3VQEA 4CJPA 3KLFA 1JLAA 1WSFA 2YKNA 4E1MA 2G8WA 4NCAA 1NK9A 1UWBA 3ZSVA 1EX4A 3KKRA 3LPUA 1TK8A 3OYGA 3DOLA 4DU3A 3T1AA 4EP4A 5J1EA 4M3XA 4EP5A 3DRPA 2DFFA 1F21A 1SL1A 3KTQA 1U4BA 3CFOA 1T05A 3KD1E 3RMDA 2E6MA 1U48A 3K2PA 3AO3A 1R0AA 2ATQA 2IGIA 4C8OA 3CM6A 3NGZA 5HRSA 3SUPA 3I8DA 4CHQA 4W5RA 1VSMA 1S1TA 3TABA 1Z26A 2WONA 4LH5A 3OYLA 4DTRA 3U6FA 5I42A 1N6QA 4C8NA 1KCFA 2BANA 3LP2A 4DMNA 4CK1A 3TAEA 1SKWA 4FJGA 3OJSA 3AVLA 1T8EA 4FZXC 3HXMA 1RBVA 1RBTA 4NYFA 4CHPA 4DQIA 2HHXA 3ZSWA 1Y97A 1VSKA 3NGYA 3V1RA 4CFAA 3ZSOA 4CIGA 3SNNA 1TKDA 4F2SA 4M3UA 1VSIA 3VQDA 1KTQA 4F8RA 4IFYA 1ASWA 4Z4CA 3KLIA 1RT5A 3K57A 1LAWA 4EZ9A 4CIEA 2HB5A 4I7FA 4OGEA 4CJWA 3KK3A 4DF4A 4ID1A 4XIUA 1C0MA 2BGGA 1TAUA 4HVJA 3VA0A 2YNFA 1TGOA 4FCYA 4CF2A 4O0IA 3JSMA 4PWDA 4R5PA 4Z4IA 2WOMA 4CJKA 4PY5A 1ASUA 1TK0A 4OLBA 3SV4A 1JKHA 2XY6A 3OYCA 3JYTA 4KHNA 3AVNA 1XHZA 4B3OA 3SQ0A 1JLBA 5J2PA 3EYZA 2Z1JA 4ICLA 2DFHA 4DS5A 3V9XA 4CJ4A 1UAXA 3B6PA 1VSFA 5J2MA 1KVCA 3CFRA 3DRSA 4O55A 1X9WA 4KHUA 4DLEA 3KLGA 1GOBA 1TV6A 1C0UA 3DI6A 1L5UA 1W9HA 2HHWA 1U04A 1WN7A 3CG7A 4E0DA 3U3GA 1A5VA 3DOKA 1TKZA 3AO4A 1NK7A 4N41A 1S9EA 2ETJA 4J2EA 1C1BA 4FK0A 2KZMA 4J2DA 3S3OA 4OVLA 3HL8A 4I9QA 5EU7A 4J2BA 3OYMA 1LWEA 5C42A 2OPRA 3G0ZA 4CK2A 4QCLA 4DSKA 1WAJA 1WNSA 3DLKA 5C24A 2HHTA 2D0CA 4E7JA 4MFBA 3TWHA 3S3NA 4FZYA 1WLJA 4CGHA 5JS1A 4CF1A 1LW2A 3HT3A 2RPIA 1EETA 1LAVA 3SQ2A 2X6NA 3TAPA 2W42A 2IAJA 5CZ1A 1KVAA 4HUFA 4CF0A 4BE2A 4DTJA 2I5JA 2A1RA 2HMIA 3LANA 2P51A 1RT1A 4DSEA 4Q0BA 4KHYA 2FC0A 5D3GA 3L3UA 4QOZB 1BCMA 3AO1A 1T7PA 4YFUA 3AVFA 1D5AA 1DTQA 1ITGA 3O4NA 4KTZA 4CJVA 4H4MA 4HUGA 1Q9XA 4B9LA 1JLEA 4M3WA 3NFAA 3DLBA 2FBXA 3P5JA 4BACA 4C8LA 2PYLA 2HHVA 2KQ2A 2FBVA 4OLAA 1C6VA 3NGIA 4JRQA 2HVHA 2Q3SA 4FYDA 1N5YA 1Z25A 1NK5A 2G8KA 4CJ5A 3SUQA 3K5LA 4OPJA 3ZT2A 3ITHA 1S6PA 1RDCA 5KRSA 4CJRA 3CFPA 4CJTA 1HPZA 3ZSYA 3ZT4A 3RRHA 4LSLA 4E3SA 4OKKA 3OYBA 1VSEA 3V9ZA 1ZBIA 1RDAA 1A5XA 3ZSZA 2X78A 3K5NA 3SJJA 1ZBLA 1QQCA 3RR8A 4CEAA 3NF8A 4KTWA 4NCBA 2FBTA 1TKTA 4C8MA 3SI6A 3MEGA 3TANA 1L3UA 4FJIA 2Y1JA 3G10A 3ZCMA 3OYHA 4DSLA 1KLNA 4DQSA 3IAYA 4FJHA 4DFMA 1KSPA 4CJSA 2BE2A 3CYMA 3DMJA 3WNGA 4HHTA 4CGFA 1J54A 3QESA 4W5OA 2VG7A 4KHQA 1SKSA 3QINA 4DFJA 4Y1DA 1CZBA 3DYAA 1HYZA 3V6DA 4FXDA 4DWIA 1UA0A 3AA5X 3MXIA 3NF7A 3K5OA 1RNHA 1RILA 3LAKA 2XRIA 3OYEA 4N47A 4Z4HA 3L2QA 4JS4A 4DSIA 3VQ8A 3QEIA 3MEDA 1QSLA 1IH7A 3PX4A 4L8RB 3T19A 1ZBFA 2IDOA 2OPPA 2E6LA 4CESA 1BIZA 4KV8A 2F8TA 1Q9YA 2OZSA 2D5RA 1J53A 2DTUA 3O4QA 3VQQA 3ZT0A 2DY4A 1X1PA 1JL1A 4Q5VA 5SWMA 4RW6A 2GBZA 2ZE2A 4DQPA 1WSIA 3V9SA 4HUEA 1JLQA 4F4KA 3C95A 4JLHA 1VK0A 3AA4A 4CEBA 4DLGA 5HRPA 1BIUA 3ZT3A 4G1QA 5HRRA 1HJRA 1SL2A 2PZSA 4CJEA 1NK4A 4NYNA 3IG1A 4PA1A 4FVMA 1JLFA 3D0PA 2FBYA 2O4IA 3MECA 2XHBA 3VA3A 4FLVA 5J2QA 3VQ4A 1J5OA 1CLQA 3LWMA 3NF6A 1FXXA 1S5JA 3QO9A 3AVJA 3V4IA 3LAMA 4CK3A 1RTJA 2P1JA 3SPZA 2YHBA 4M3YA 3OYKA 2HNDA 4IG3A 3T3FA 1IKXA 4OGCA 1QHTA 3EZ5A 5K14A 1EKEA 3D45A 4AHCA 4FM2A 1BI4A 1EP4A 3KKSA 4BE1A 3U3YA 4DTPA 3HK2A 4CHZA 5SZTA 2OA8A 5CZ2A 4E7HA 1O1WA 3O3HA 3K5MA 3NBPA 3VQ7A 2HHSA 3DLGA 4CFCA 4CEOA 3TAGA 1XHXA 4KKOA 5KTQA 4JRPA 3QERA 5KI6A 3ULDA 3KLEA 3OS0A 4AHSA 4DU4A 3V81A 4EZ6A 4RW7A 4CERA 1EXQA 4DF8A 4PUOA 3SCXA 4CF9A 1YT3A 1LWFA 4DTMA 4FK2A 4F3OA 1TAQA 3SPYA 1IKWA 4KFBA 4FLTA 3AO5A 2XY7A 3TAQA 2G8HA 1U45A 4AHRA 4OPKA 4W5TA 4HCCA 4FZZA 4DTNA 2NUBA 3LPTA 1ZBHA 2RN2A 4AHTA 1D8YA 1RT7A 1S9GA 3E01A 1BQMA 5DK5A 4CHNA 3LP1A 3OYJA 3P83D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RTV A;  3HVT A;  4JS5 A;  2EX3 A;  1U49 A;  3PO4 A;  4CFB A;  4ZTJ A;  2Z1G A;  3VN5 A;  4CHO A;  1S1V A;  5T7B A;  1YVU A;  3K59 A;  1KLM A;  4DU1 A;  3OJU A;  1QTM A;  2YNH A;  4FJ9 A;  3SYZ A;  4AHU A;  3HVR A;  1J9A A;  4FK4 A;  1S6Q A;  2LSN A;  3B6O A;  3AVA A;  4CJU A;  5HP1 A;  3C6T A;  1WSE A;  3QIO A;  4B8A B;  4RG8 A;  1ZYQ A;  2B6A A;  4AHV A;  4AH9 A;  3QEX A;  4C8K A;  3AVC A;  4BDY A;  3ZSX A;  3RWU A;  3HPG A;  4KRF A;  3RRG A;  4FLX A;  3OYF A;  4B08 A;  3AA2 A;  3ALY A;  4IBN A;  1S1W A;  4LD0 A;  3HM9 A;  1X9M A;  4FJN A;  3VQ9 A;  1RT4 A;  2KTQ A;  3TAM A;  2ZQB A;  3AVM A;  1NK0 A;  1IO2 A;  1BL3 A;  3BGR A;  3C6U A;  4FW1 A;  3WNE A;  1SKR A;  4CEC A;  3QET A;  3SQ1 A;  3PO5 A;  4PQU A;  4I2Q A;  2QKB A;  3AVB A;  1NOY A;  3LZI A;  3SV3 A;  1TK5 A;  4IKF A;  1DTT A;  2F96 A;  4BDZ A;  3KK2 A;  1IKY A;  1LWC A;  1YTA A;  4DFP A;  4N5S A;  4CHY A;  1RT2 A;  2OPS A;  2XY5 A;  2PY5 A;  3QEW A;  1NKE A;  1BGX T;  3M8Q A;  1XI1 A;  2YV0 X;  2KZZ A;  1I39 A;  5FRO A;  3P1G A;  3ZSQ A;  1NJX A;  3KLH A;  5CYQ A;  2DFE A;  4CEQ A;  1JXB A;  3L3V A;  5FRN A;  3DM2 A;  4BWM A;  1HNI A;  4CFD A;  1A5W A;  2VWJ A;  1TKX A;  1BQN A;  3KD5 E;  5HBM A;  4DSF A;  4M3Z A;  2F8S A;  4ELT A;  3SUO A;  1RTD A;  2VG6 A;  4H4O A;  4CJ3 A;  4ELU A;  1NJW A;  3F73 A;  1REV A;  2JLE A;  3AVG A;  4UQG A;  4Z0U A;  3NAE A;  4E7I A;  3LP3 A;  4DG1 A;  1RTI A;  1I3A A;  2Z1I A;  4TSX A;  5JS2 A;  1T03 A;  3MXJ A;  3WNF A;  3V9U A;  4Z4G A;  4K8X A;  4DS4 A;  5KRT A;  3OS1 A;  4IDK A;  2G8V A;  1RDB A;  3KIO A;  4CGJ A;  1WSJ A;  3V1Q A;  1WSG A;  1D9D A;  4OKE A;  2A1S A;  4RW8 A;  2EHG A;  4DTU A;  4ELV A;  1NOZ A;  1TVR A;  4W5Q A;  4F2R A;  3DRR A;  2ZD1 A;  5CYM A;  1JXE A;  3KJV A;  4CF8 A;  1JLC A;  3AVH A;  4W5N A;  4MQ3 A;  1L3S A;  1W0H A;  4I9L A;  3ASM A;  1C1A A;  1JL2 A;  4WE1 A;  3LDS A;  4FM0 A;  4CJL A;  1NK8 A;  1NJZ A;  3HP9 A;  4KTQ A;  1CXU A;  2XY8 A;  1HQE A;  1SUQ A;  1RDD A;  3QIP A;  3K58 A;  3RMC A;  4HCB A;  4KI4 A;  4E7L A;  4KHW A;  2IC3 A;  1BI4 B;  3L8B A;  2P5G A;  4RW4 A;  4O0J A;  3PV8 A;  4CEF A;  4E7K A;  1BHL A;  4M42 A;  3AV9 A;  1RCH A;  1G15 A;  1HMV A;  3C94 A;  1IKV A;  3F9K A;  2XO7 A;  1D9F A;  4B9S A;  3HO1 A;  1B92 A;  2OPQ A;  3HPO A;  3VQC A;  2X6S A;  4LH4 A;  3PX0 A;  4F3T A;  3OVN A;  4B9M A;  4B9N A;  4OKJ A;  4ZTF A;  4BWJ A;  4ID5 A;  3THV A;  1S1X A;  4BDP A;  2YNI A;  3LZJ A;  3PY8 A;  2HW3 A;  4O5B A;  4Z4F A;  1FK9 A;  3CM5 A;  4O44 A;  3A2F A;  3VQA A;  1RBS A;  3ZT1 A;  1KVB A;  3AVI A;  3I0S A;  3AO2 A;  3LWL A;  1ZBU A;  3M8S A;  3L2R A;  4HTU A;  4KRE A;  4H8K A;  2KFZ A;  4J2A A;  1U47 A;  1K6Y A;  1RBR A;  3TR8 A;  2YKM A;  1RT3 A;  1FKP A;  4DFK A;  3KK1 A;  4FLY A;  1X9S A;  5HRN A;  3QNO A;  4KB0 A;  4CGG A;  4OJR A;  4FLU A;  4K8Z A;  4N76 A;  3HP6 A;  2IOC A;  2X74 A;  4E19 A;  5HLF A;  4KHS A;  3NH1 A;  4M3T A;  4FJK A;  4DTS A;  2IS3 A;  3M8R A;  3RR7 A;  4FJ5 A;  1IG9 A;  1NK6 A;  1XC9 A;  1CZ9 A;  2E4L A;  3HST B;  4ZHR A;  1QS4 A;  2D0A A;  3O3F A;  2R7Y A;  3UIQ A;  1LW0 A;  4KPY A;  2QKK A;  4QAG A;  4CEZ A;  3ISN C;  3EY1 A;  1VSL A;  3MXM A;  1RT6 A;  1L3V A;  3OY9 A;  4B9U A;  4GW6 A;  4LSN A;  3S3M A;  3OS2 A;  1LV5 A;  3NH2 A;  3PUF A;  1VSJ A;  2QXF A;  3DLH A;  4CJQ A;  4GMJ B;  4FLW A;  4FJL A;  1HYV A;  4CE9 A;  2ITG A;  3NDK A;  3M8P A;  4FJM A;  1KFD A;  1UA1 A;  3CQ8 A;  3V9W A;  5E41 A;  4I2P A;  3SUN A;  2HNY A;  4IFV A;  3NH0 A;  4BE0 A;  3LP0 A;  3QEV A;  4DTX A;  3OYD A;  1NJY A;  2BDP A;  3BDP A;  1YTU A;  2OZM A;  2VG5 A;  2GV9 A;  3NE6 A;  1CXQ A;  1TL1 A;  5FDL A;  1GOC A;  4CCH A;  4DQQ A;  4FJ8 A;  3SZ2 A;  4KAZ A;  1B9F A;  1HRH A;  4CEE A;  3H08 A;  4DSJ A;  5C25 A;  1C0T A;  2KW4 A;  4CIF A;  3OYA A;  1WSH A;  4KB1 A;  2Y1I A;  3RMB A;  2RF2 A;  2QK9 A;  1GOA A;  1S1U A;  3RMA A;  1VRT A;  2OYQ A;  1SL0 A;  4FLZ A;  1NKC A;  4FJ7 A;  1TL3 A;  4LY7 A;  3PX6 A;  2YHA A;  3SQ4 A;  4B9T A;  1QSS A;  1VSD A;  2VWK A;  5HRO A;  4Z4E A;  5KGW A;  3MAQ A;  3QLH A;  3OYN A;  4YNQ A;  1HQU A;  2HHU A;  3WNH A;  4FJX A;  3AA3 A;  4E1N A;  2KFN A;  1FKO A;  1HNV A;  1Q8I A;  1RBU A;  1XWL A;  3HYF A;  5KGX A;  1ASV A;  2GUI A;  3MEE A;  4N56 A;  1KFS A;  4M45 A;  3V1O A;  4E89 A;  1KRP A;  1WAF A;  3QEP A;  3ZSR A;  4IG0 A;  5CY4 A;  3DLE A;  3DLR A;  1UOC A;  4DTO A;  2AJQ A;  1MU2 A;  4FW2 A;  4B8C A;  2G8I A;  3FFI A;  1BIS A;  4KO0 A;  3L2U A;  2Z1H A;  4KI6 A;  4B9V A;  4M41 A;  4GVM A;  2D0B A;  3L2W A;  1VSH A;  1QE1 A;  4FM1 A;  3LAL A;  2O4G A;  4CGI A;  3VQ6 A;  3I0R A;  3NHG A;  5FRM A;  4DQR A;  3O3G A;  2JGU A;  1VRU A;  4Y1C A;  1HYS A;  3HPH A;  4AIL C;  3VQP A;  2B4J A;  4RW9 A;  3NF9 A;  2HNZ A;  3TAR A;  1NKB A;  1DLO A;  1BCO A;  3IRX A;  3VQ5 A;  2HHQ A;  2YNG A;  4CGD A;  4O4G A;  3VQB A;  5J2N A;  2HVI A;  3QNN A;  3TAF A;  3AVK A;  4M3R A;  4CJF A;  1QSY A;  4NCG A;  5DMR A;  4CED A;  1SV5 A;  1L3T A;  2G8U A;  1C1C A;  5I3U A;  4FJJ A;  2RKI A;  1JLG A;  3OYI A;  3L2V A;  3NCI A;  3IS9 A;  2P5O A;  3S9H A;  2B5J A;  1B9D A;  2PYJ A;  3TI0 A;  2G8F A;  3HJF A;  1RTH A;  3VQE A;  4CJP A;  3KLF A;  1JLA A;  1WSF A;  2YKN A;  4E1M A;  2G8W A;  4NCA A;  1NK9 A;  1UWB A;  3ZSV A;  1EX4 A;  3KKR A;  3LPU A;  1TK8 A;  3OYG A;  3DOL A;  4DU3 A;  3T1A A;  4EP4 A;  5J1E A;  4M3X A;  4EP5 A;  3DRP A;  2DFF A;  1F21 A;  1SL1 A;  3KTQ A;  1U4B A;  3CFO A;  1T05 A;  3KD1 E;  3RMD A;  2E6M A;  1U48 A;  3K2P A;  3AO3 A;  1R0A A;  2ATQ A;  2IGI A;  4C8O A;  3CM6 A;  3NGZ A;  5HRS A;  3SUP A;  3I8D A;  4CHQ A;  4W5R A;  1VSM A;  1S1T A;  3TAB A;  1Z26 A;  2WON A;  4LH5 A;  3OYL A;  4DTR A;  3U6F A;  5I42 A;  1N6Q A;  4C8N A;  1KCF A;  2BAN A;  3LP2 A;  4DMN A;  4CK1 A;  3TAE A;  1SKW A;  4FJG A;  3OJS A;  3AVL A;  1T8E A;  4FZX C;  3HXM A;  1RBV A;  1RBT A;  4NYF A;  4CHP A;  4DQI A;  2HHX A;  3ZSW A;  1Y97 A;  1VSK A;  3NGY A;  3V1R A;  4CFA A;  3ZSO A;  4CIG A;  3SNN A;  1TKD A;  4F2S A;  4M3U A;  1VSI A;  3VQD A;  1KTQ A;  4F8R A;  4IFY A;  1ASW A;  4Z4C A;  3KLI A;  1RT5 A;  3K57 A;  1LAW A;  4EZ9 A;  4CIE A;  2HB5 A;  4I7F A;  4OGE A;  4CJW A;  3KK3 A;  4DF4 A;  4ID1 A;  4XIU A;  1C0M A;  2BGG A;  1TAU A;  4HVJ A;  3VA0 A;  2YNF A;  1TGO A;  4FCY A;  4CF2 A;  4O0I A;  3JSM A;  4PWD A;  4R5P A;  4Z4I A;  2WOM A;  4CJK A;  4PY5 A;  1ASU A;  1TK0 A;  4OLB A;  3SV4 A;  1JKH A;  2XY6 A;  3OYC A;  3JYT A;  4KHN A;  3AVN A;  1XHZ A;  4B3O A;  3SQ0 A;  1JLB A;  5J2P A;  3EYZ A;  2Z1J A;  4ICL A;  2DFH A;  4DS5 A;  3V9X A;  4CJ4 A;  1UAX A;  3B6P A;  1VSF A;  5J2M A;  1KVC A;  3CFR A;  3DRS A;  4O55 A;  1X9W A;  4KHU A;  4DLE A;  3KLG A;  1GOB A;  1TV6 A;  1C0U A;  3DI6 A;  1L5U A;  1W9H A;  2HHW A;  1U04 A;  1WN7 A;  3CG7 A;  4E0D A;  3U3G A;  1A5V A;  3DOK A;  1TKZ A;  3AO4 A;  1NK7 A;  4N41 A;  1S9E A;  2ETJ A;  4J2E A;  1C1B A;  4FK0 A;  2KZM A;  4J2D A;  3S3O A;  4OVL A;  3HL8 A;  4I9Q A;  5EU7 A;  4J2B A;  3OYM A;  1LWE A;  5C42 A;  2OPR A;  3G0Z A;  4CK2 A;  4QCL A;  4DSK A;  1WAJ A;  1WNS A;  3DLK A;  5C24 A;  2HHT A;  2D0C A;  4E7J A;  4MFB A;  3TWH A;  3S3N A;  4FZY A;  1WLJ A;  4CGH A;  5JS1 A;  4CF1 A;  1LW2 A;  3HT3 A;  2RPI A;  1EET A;  1LAV A;  3SQ2 A;  2X6N A;  3TAP A;  2W42 A;  2IAJ A;  5CZ1 A;  1KVA A;  4HUF A;  4CF0 A;  4BE2 A;  4DTJ A;  2I5J A;  2A1R A;  2HMI A;  3LAN A;  2P51 A;  1RT1 A;  4DSE A;  4Q0B A;  4KHY A;  2FC0 A;  5D3G A;  3L3U A;  4QOZ B;  1BCM A;  3AO1 A;  1T7P A;  4YFU A;  3AVF A;  1D5A A;  1DTQ A;  1ITG A;  3O4N A;  4KTZ A;  4CJV A;  4H4M A;  4HUG A;  1Q9X A;  4B9L A;  1JLE A;  4M3W A;  3NFA A;  3DLB A;  2FBX A;  3P5J A;  4BAC A;  4C8L A;  2PYL A;  2HHV A;  2KQ2 A;  2FBV A;  4OLA A;  1C6V A;  3NGI A;  4JRQ A;  2HVH A;  2Q3S A;  4FYD A;  1N5Y A;  1Z25 A;  1NK5 A;  2G8K A;  4CJ5 A;  3SUQ A;  3K5L A;  4OPJ A;  3ZT2 A;  3ITH A;  1S6P A;  1RDC A;  5KRS A;  4CJR A;  3CFP A;  4CJT A;  1HPZ A;  3ZSY A;  3ZT4 A;  3RRH A;  4LSL A;  4E3S A;  4OKK A;  3OYB A;  1VSE A;  3V9Z A;  1ZBI A;  1RDA A;  1A5X A;  3ZSZ A;  2X78 A;  3K5N A;  3SJJ A;  1ZBL A;  1QQC A;  3RR8 A;  4CEA A;  3NF8 A;  4KTW A;  4NCB A;  2FBT A;  1TKT A;  4C8M A;  3SI6 A;  3MEG A;  3TAN A;  1L3U A;  4FJI A;  2Y1J A;  3G10 A;  3ZCM A;  3OYH A;  4DSL A;  1KLN A;  4DQS A;  3IAY A;  4FJH A;  4DFM A;  1KSP A;  4CJS A;  2BE2 A;  3CYM A;  3DMJ A;  3WNG A;  4HHT A;  4CGF A;  1J54 A;  3QES A;  4W5O A;  2VG7 A;  4KHQ A;  1SKS A;  3QIN A;  4DFJ A;  4Y1D A;  1CZB A;  3DYA A;  1HYZ A;  3V6D A;  4FXD A;  4DWI A;  1UA0 A;  3AA5 X;  3MXI A;  3NF7 A;  3K5O A;  1RNH A;  1RIL A;  3LAK A;  2XRI A;  3OYE A;  4N47 A;  4Z4H A;  3L2Q A;  4JS4 A;  4DSI A;  3VQ8 A;  3QEI A;  3MED A;  1QSL A;  1IH7 A;  3PX4 A;  4L8R B;  3T19 A;  1ZBF A;  2IDO A;  2OPP A;  2E6L A;  4CES A;  1BIZ A;  4KV8 A;  2F8T A;  1Q9Y A;  2OZS A;  2D5R A;  1J53 A;  2DTU A;  3O4Q A;  3VQQ A;  3ZT0 A;  2DY4 A;  1X1P A;  1JL1 A;  4Q5V A;  5SWM A;  4RW6 A;  2GBZ A;  2ZE2 A;  4DQP A;  1WSI A;  3V9S A;  4HUE A;  1JLQ A;  4F4K A;  3C95 A;  4JLH A;  1VK0 A;  3AA4 A;  4CEB A;  4DLG A;  5HRP A;  1BIU A;  3ZT3 A;  4G1Q A;  5HRR A;  1HJR A;  1SL2 A;  2PZS A;  4CJE A;  1NK4 A;  4NYN A;  3IG1 A;  4PA1 A;  4FVM A;  1JLF A;  3D0P A;  2FBY A;  2O4I A;  3MEC A;  2XHB A;  3VA3 A;  4FLV A;  5J2Q A;  3VQ4 A;  1J5O A;  1CLQ A;  3LWM A;  3NF6 A;  1FXX A;  1S5J A;  3QO9 A;  3AVJ A;  3V4I A;  3LAM A;  4CK3 A;  1RTJ A;  2P1J A;  3SPZ A;  2YHB A;  4M3Y A;  3OYK A;  2HND A;  4IG3 A;  3T3F A;  1IKX A;  4OGC A;  1QHT A;  3EZ5 A;  5K14 A;  1EKE A;  3D45 A;  4AHC A;  4FM2 A;  1BI4 A;  1EP4 A;  3KKS A;  4BE1 A;  3U3Y A;  4DTP A;  3HK2 A;  4CHZ A;  5SZT A;  2OA8 A;  5CZ2 A;  4E7H A;  1O1W A;  3O3H A;  3K5M A;  3NBP A;  3VQ7 A;  2HHS A;  3DLG A;  4CFC A;  4CEO A;  3TAG A;  1XHX A;  4KKO A;  5KTQ A;  4JRP A;  3QER A;  5KI6 A;  3ULD A;  3KLE A;  3OS0 A;  4AHS A;  4DU4 A;  3V81 A;  4EZ6 A;  4RW7 A;  4CER A;  1EXQ A;  4DF8 A;  4PUO A;  3SCX A;  4CF9 A;  1YT3 A;  1LWF A;  4DTM A;  4FK2 A;  4F3O A;  1TAQ A;  3SPY A;  1IKW A;  4KFB A;  4FLT A;  3AO5 A;  2XY7 A;  3TAQ A;  2G8H A;  1U45 A;  4AHR A;  4OPK A;  4W5T A;  4HCC A;  4FZZ A;  4DTN A;  2NUB A;  3LPT A;  1ZBH A;  2RN2 A;  4AHT A;  1D8Y A;  1RT7 A;  1S9G A;  3E01 A;  1BQM A;  5DK5 A;  4CHN A;  3LP1 A;  3OYJ A;  3P83 D; 
#chains in the Genus database with same CATH topology
 4JS5 A;  5KPZ A;  5JVH L;  2PBD A;  5TKW A;  4ZTJ A;  3VN5 A;  4CW7 B;  1S1V A;  1YVU A;  4XH4 A;  1KLM A;  4FJ9 A;  1C0F A;  3SYZ A;  4FK4 A;  4H5N A;  1J9A A;  2JWL A;  2LSN A;  3U9D A;  4RG8 A;  4BRE A;  4AH9 A;  3AVC A;  3AAQ A;  3RWU A;  4FLX A;  3EKU A;  4LD0 A;  2E5L K;  2KTQ A;  1DGK N;  1MA9 B;  1NK0 A;  1TUU A;  1IO2 A;  1BL3 A;  5LMN K;  4LF6 K;  4BVP A;  4WQ4 A;  4I2Q A;  4EFH A;  4BRG A;  1VQP N;  2QKB A;  5GIO A;  1NOY A;  2NRX A;  4IKF A;  3KK2 A;  1IKY A;  1LWC A;  4CHY A;  1RT2 A;  4IFE A;  3IMX A;  2P9N A;  2ZM6 K;  5FRO A;  4AQY K;  3KLH A;  4CEQ A;  5FPD A;  1JXB A;  3L3V A;  3DM2 A;  1A5W A;  1BQN A;  3OA9 A;  1FW6 A;  2F8S A;  4M3Z A;  4ELT A;  2VGM A;  3NAE A;  4DG1 A;  4H0O A;  1HUX A;  4H5V A;  3MXJ A;  5ELZ A;  3WNF A;  3OS1 A;  2G8V A;  1RDB A;  3KIO A;  4PKH A;  3WXJ A;  1HLU A;  4OKE A;  1NOZ A;  3TTF A;  3DRR A;  1U6Z A;  3KJV A;  3NVK A;  2VCP A;  1CXU A;  2ZF5 O;  4EHU A;  1Q82 O;  4KHW A;  3L8B A;  1RCH A;  3L4I A;  1WB9 A;  2FSN A;  3HPO A;  3VQC A;  4LH4 A;  4F3T A;  1RDU A;  3OVN A;  3H3O B;  2UYT A;  4OKJ A;  4ZTF A;  4ID5 A;  3D6R A;  2YNI A;  2Q2R A;  1KQS M;  3ZEU A;  1KVB A;  3I0S A;  5GAE P;  3AO2 A;  3P4I A;  4HTU A;  3CCE N;  3ZET A;  1RT3 A;  2H3G X;  5BR9 A;  3QNO A;  1T6D A;  1DT9 A;  3MK6 A;  4N76 A;  5C2D A;  3HP6 A;  2X74 A;  4E19 A;  5DM7 L;  3THY A;  1V4S A;  3EZW A;  3NH1 A;  3M8R A;  3RR7 A;  2E4L A;  3HST B;  1QS4 A;  3F9M A;  3ISN C;  1K8K B;  3MXM A;  4BRH A;  3ZX0 A;  1L3V A;  5M1Q A;  1NU0 A;  3MN5 A;  3NH2 A;  3PUF A;  1VSJ A;  3DLH A;  2W6L A;  4FJL A;  2ITG A;  1KFD A;  5EXW A;  5E41 A;  1SQK A;  3C6H A;  4I2P A;  5MLC Q;  3SAG A;  3LP0 A;  4LF8 K;  2BDP A;  1VQM N;  3IUC A;  1YTU A;  1E4G T;  4CCH A;  4KAZ A;  1B9F A;  1HRH A;  1TYQ B;  1WSH A;  5AQL A;  4KB1 A;  3RMB A;  1GOA A;  1VRT A;  2OYQ A;  5AQS A;  1NKC A;  3WXK A;  3PX6 A;  4WFA L;  3TU5 A;  2D4W A;  1VSD A;  2FSK A;  2ZGY A;  3BF3 A;  3OYN A;  2A40 A;  2PFU A;  4FJX A;  1HNV A;  5KGX A;  3A5O C;  1ASV A;  4YY3 K;  3MEE A;  1KFS A;  4N56 A;  5F0X A;  3V1O A;  4PHT X;  1KRP A;  1WAF A;  1JCG A;  4BRC A;  2GWJ A;  3DLE A;  5I9E B;  1NJI O;  1UOC A;  3I55 N;  3T1Y K;  3FFI A;  1BIS A;  3R1X A;  3L2W A;  4JD2 B;  3O9Q A;  4CGI A;  2HHH K;  5FRM A;  3O3G A;  2YHY A;  5AZJ B;  3TAR A;  4AIL C;  1NKB A;  1BCO A;  3VQ5 A;  4DHY A;  4BRA A;  2YNG A;  3AAR A;  4JI2 K;  3CME N;  4B1W B;  3LM9 A;  1RGI A;  4A57 A;  2ASO A;  4NXN K;  4NCG A;  4H0Y B;  1L3T A;  4FJJ A;  3CQY A;  2RKI A;  4YOU A;  1JLG A;  3ATV A;  4IJN A;  4JEP A;  4JN4 A;  2P5O A;  5BRE A;  1B9D A;  3MX5 A;  1T44 A;  3THW B;  3HJF A;  5AQX A;  5ADX A;  4CJP A;  1JLA A;  1UWB A;  2P9U B;  2GWK A;  3O1W A;  4B1Z A;  3CJ7 A;  4OPA A;  4JYA K;  1F21 A;  3VF2 A;  1G99 A;  2ATQ A;  3I8D A;  4W5R A;  1VSM A;  2D0O A;  3OYL A;  5I42 A;  4O8U A;  4AM6 A;  2O8D A;  4G9Z A;  1T8E A;  4MLE A;  3ZSO A;  4M3U A;  1GLA G;  3BF1 A;  1ESV A;  2PAV A;  3ENH A;  3ZX3 A;  1LAW A;  4CZF A;  4EZ9 A;  4J8F A;  3KK3 A;  2Q31 A;  4ID1 A;  2UXD K;  1C0M A;  2GTD A;  3O5B A;  4C23 A;  2YNF A;  2WOM A;  5F2R A;  1TK0 A;  3H3N O;  3SV4 A;  3KHY A;  1N33 K;  3OYC A;  3AVN A;  4B3O A;  5J2P A;  4DS5 A;  3ID6 A;  3B6P A;  4PL7 A;  4KHU A;  1X9W A;  3SMP A;  3WXI A;  5AQF A;  1W9H A;  1WN7 A;  3U3G A;  2YHX A;  3DOK A;  2Q0U A;  3AO4 A;  3OTO K;  4N41 A;  2ETJ A;  1HNZ K;  3HL8 A;  5EU7 A;  2Q1N A;  5LMU K;  3NMU A;  3G0Z A;  4H0X B;  4QCL A;  4DSK A;  1WNS A;  3DLK A;  5C24 A;  4X64 K;  3QB0 A;  4MFB A;  4LF9 K;  1WLJ A;  3H1V X;  5FPN A;  5KPT A;  5JS1 A;  3LDP A;  1LW2 A;  2RPI A;  1EET A;  1LAV A;  2IAJ A;  4HUF A;  5EX5 A;  1T3V A;  1U2V B;  2D0P A;  3N4P A;  4RCH A;  3LAN A;  1HPM A;  4DSE A;  4Q0B A;  2QWP A;  1D5A A;  1NGC A;  3DXM B;  3O4N A;  3P5J A;  2I7P A;  4BAC A;  2PYL A;  4CZI A;  2P9P A;  2GEL A;  2FBV A;  4OLA A;  4JRQ A;  4PL8 A;  2FF6 A;  3O80 A;  5E84 A;  4OPJ A;  3ZT2 A;  5KRS A;  1RDC A;  3CFP A;  1Q86 O;  3C0B A;  3RRH A;  2IIR A;  4E3S A;  1VSE A;  2NNW A;  2HOE A;  1ZBL A;  1QQC A;  4KTW A;  2UXB K;  4E1J A;  1L3U A;  4FJI A;  3KZB A;  2Y1J A;  4BGA A;  1NWK A;  3PIO L;  1KSP A;  4DR1 K;  3CYM A;  3WNG A;  3QES A;  1J54 A;  3WEE B;  4H5R A;  3E9L A;  4X65 K;  4DFJ A;  4Y1D A;  1HYZ A;  4YHH K;  3GDQ A;  4DWI A;  5TKY A;  5LJW A;  3AA5 X;  3FZL A;  3MXI A;  3K5O A;  3LDO A;  2CGK A;  1BWF O;  3WT0 A;  3PX4 A;  1VQ4 N;  3J7A P;  3T19 A;  4BG9 A;  2E6L A;  3H45 C;  4CES A;  3D2E B;  1Q9Y A;  5FPM A;  3VET A;  1J53 A;  2DTU A;  5E26 A;  1X1P A;  5AFU H;  5IT9 O;  4K42 A;  2HMP A;  3DJC A;  3AA4 A;  4FSV A;  2CGL A;  1HJR A;  3VOV A;  4B1Y B;  4PA1 A;  4FVM A;  4JKA A;  3FZH A;  1E4F T;  2O4I A;  3MEC A;  3CXC M;  1CLQ A;  3VQ4 A;  3U9Z A;  3BY5 A;  3LWM A;  5C0Y A;  1FXX A;  1S5J A;  2QWL A;  2VQF K;  4KH4 A;  3CJA A;  3T3F A;  1N36 K;  1IKX A;  4OGC A;  1QHT A;  5IWA K;  3EZ5 A;  1X3N A;  1BI4 A;  1VQ5 N;  3KKS A;  3HK2 A;  4XEI A;  4E7H A;  1O1W A;  3K5M A;  4CEO A;  2A41 A;  4M63 C;  4YOT A;  1NMD A;  3OS0 A;  4DU4 A;  3QBW A;  2YJF A;  4RW7 A;  2KLA A;  4CF9 A;  4DTM A;  4FK2 A;  4WQ5 C;  4JI6 K;  3AO5 A;  2G8H A;  2QWN A;  3HBT A;  4B9Q A;  4OPK A;  1QHA A;  4W5T A;  4FZZ A;  3K9K A;  5FLX O;  1RT7 A;  1S9G A;  3E01 A;  3I8B A;  4KHP K;  5DK5 A;  5AJ3 K;  2AA4 A;  3KWI A;  1U49 A;  3PO4 A;  4JKF A;  1HR0 K;  4CHO A;  5T7B A;  4K41 A;  3OJU A;  3JXU A;  3WXL A;  2YJE A;  3C7N A;  3C6T A;  1KD1 O;  1ZYQ A;  4AHV A;  3A8Y A;  3QEX A;  1NGJ A;  4BDY A;  1ATR A;  4KRF A;  3RRG A;  3GL1 A;  4CZG A;  1X9M A;  1S1W A;  3HM9 A;  4FJN A;  1RT4 A;  3TAM A;  2IVN A;  4QS7 A;  3UKU A;  4NB4 A;  4CEC A;  4PQU A;  3AVB A;  4FVU A;  5AR0 A;  1TK5 A;  2F96 A;  4I6M B;  4BDZ A;  5LY3 A;  4N5S A;  3P31 A;  3QEW A;  1NKE A;  3M8Q A;  1XI1 A;  2YV0 X;  1S3X A;  4QS9 A;  1I39 A;  4CZL A;  3P1G A;  3ZSQ A;  2VWJ A;  1TKX A;  1N32 K;  3CCQ N;  4LFC K;  3SUO A;  4H4O A;  1YF5 L;  1NJW A;  3AVG A;  4E7I A;  4Z0U A;  1MDU B;  1I3A A;  3MMV A;  3CER A;  4CGJ A;  2QM1 A;  4BRI A;  2QA4 N;  2ZD1 A;  4FPA A;  3VES A;  1QVF M;  2UU9 K;  4CF8 A;  3AVH A;  1ZBS A;  3ASM A;  1JL2 A;  4FM0 A;  1NJZ A;  5AQK A;  3HP9 A;  3RMC A;  4HCB A;  1TUY A;  3CI5 A;  1J5E K;  4X66 K;  4DR6 K;  4RW4 A;  4O0J A;  4BC2 A;  4CJ7 A;  4CEF A;  4RWT A;  5H1S Q;  4M42 A;  3AV9 A;  2XO7 A;  1G15 A;  1HMV A;  3F9K A;  4A2B A;  2X6S A;  4B9N A;  1S1X A;  3LZJ A;  2I7N A;  5LJV A;  4FWO A;  1FK9 A;  3A2F A;  3VQA A;  4B1V A;  1OH7 A;  4H8K A;  3WUH A;  1RBR A;  3VEV A;  4FLY A;  1XQS C;  3BZK A;  3UKR A;  1QZ6 A;  4FLU A;  4BRM A;  4DV2 K;  2V7Y A;  4Z94 A;  1NK6 A;  1XC9 A;  2R7Y A;  1NMN A;  4ZHR A;  3J81 O;  4JKG A;  2NRZ A;  1LW0 A;  4DCH A;  4X62 K;  4QAG A;  4CEZ A;  2QKK A;  4O8K A;  3DLL L;  2BH1 A;  1HNW K;  4GW6 A;  1VQ9 N;  4WQ5 A;  3R6M A;  4FLW A;  3CHW A;  1HYV A;  3M8P A;  2ASM A;  2A42 A;  5GIN A;  1GLL O;  4IFV A;  1VQN N;  3AGK A;  1NGG A;  1K73 O;  3K9J A;  4XH1 A;  4DV6 K;  3BDP A;  2VG5 A;  2GV9 A;  2OZM A;  4JI0 K;  2GX9 A;  2Q36 A;  1BUP A;  3WQU A;  4DSJ A;  4U7B A;  5C25 A;  4FWP A;  2RF2 A;  1S1U A;  1SL0 A;  1TL3 A;  3HRG A;  3DXK A;  5KGW A;  4MDA A;  2NRR A;  4A2A A;  1HQU A;  4BRF A;  2HHU A;  3M3Z A;  1RBU A;  4B1U B;  2HF3 A;  5LL6 Z;  2GUI A;  4B3T K;  4M45 A;  4IG0 A;  2NRW A;  5AQJ A;  4YOY A;  4DTO A;  4IO9 L;  3UB5 A;  1MU2 A;  4FW2 A;  3F2K A;  4O5F A;  4KO0 A;  3BUZ B;  3L2U A;  2Z1H A;  4B9V A;  4M41 A;  4GVM A;  4UY8 O;  3CCJ N;  2O4G A;  3I0R A;  3MCA B;  2P9S A;  3NHG A;  3UE5 A;  2JGU A;  5DM6 L;  4C1N I;  2UUB K;  2B4J A;  4ISG A;  3P39 A;  4DR2 K;  5J2N A;  3QNN A;  1K8A O;  1EWQ A;  2QWR A;  2E2P A;  4A5B A;  1QSY A;  5KQD A;  5I3U A;  2G8U A;  1ILY A;  4K43 A;  3ZET B;  2B5J A;  4JHD B;  3EE9 A;  4B1X B;  3H46 O;  3VQE A;  4YOV A;  1BO5 O;  3KLF A;  2YKN A;  4WF9 L;  3T7Z A;  4KBO A;  1NK9 A;  1EX4 A;  3KKR A;  4CZK A;  3OYG A;  2F4V K;  3DOL A;  4DU3 A;  3THY B;  3T1A A;  3HSC A;  3SJH A;  4EP4 A;  2VYP A;  3MN6 A;  4M3X A;  1SL1 A;  2ZJR L;  2DFF A;  3RSE A;  4JK8 A;  1T05 A;  3RMD A;  4LFB K;  3MN7 A;  3AO3 A;  3VEW A;  4EIA A;  1KAX A;  2IGI A;  3CM6 A;  3H6E A;  5HRS A;  3NGZ A;  3MWT A;  1YI2 N;  1S1T A;  4DTR A;  4DMN A;  2BAN A;  1RBT A;  4CHP A;  4DQI A;  2HHX A;  2UUC K;  3J7Y P;  1Y97 A;  4BG8 A;  4CFA A;  1TKD A;  1VSI A;  3VQD A;  3VF4 A;  4IFY A;  1M90 O;  1RT5 A;  3LM2 A;  3J8A A;  4BVO A;  4XIU A;  3ID8 A;  2BGG A;  4FCY A;  3OBY A;  4R5P A;  5AQG A;  4ISF A;  4CJK A;  3ENB A;  4OLB A;  3O9T A;  2GUP A;  2F9T A;  4IO8 A;  4KHN A;  1XHZ A;  1NGD A;  3SQ0 A;  3L4Q A;  3O9U A;  3EYZ A;  3R3L A;  1MWM A;  2ITM A;  4CJ4 A;  2P9K B;  5J2M A;  2YX6 A;  3DRS A;  3KLG A;  2O8E A;  1L5U A;  3CG7 A;  5BN8 A;  3MX2 A;  1QQN A;  1C1B A;  4FK0 A;  3S3O A;  4OVL A;  4J2B A;  2E1Z A;  4BRO A;  1HKG A;  2Q97 A;  3P38 A;  4BY9 C;  4DUZ K;  2HHT A;  2D0C A;  4E7J A;  4CVN E;  4CGH A;  5AQM A;  3HT3 A;  5CZ1 A;  1KVA A;  3VF6 A;  2A1R A;  1NNE A;  2HMI A;  5AQI A;  2P51 A;  1K8K A;  4KHY A;  4FOE A;  4B3S K;  1BCM A;  4HUG A;  3AVF A;  2G8I A;  4CJV A;  4B9L A;  4KTZ A;  4H4M A;  1VQ6 N;  1JLE A;  2WUS A;  2KQ2 A;  2OCE A;  1C6V A;  2Q3S A;  4JKE A;  2G8K A;  3SBT A;  3SUQ A;  2BUP A;  2V51 B;  3ITH A;  2WC9 A;  4CJR A;  5AQP A;  2O8C B;  4BRN A;  3VER A;  4JI4 K;  3VMF B;  4OKK A;  4JKB A;  1Q7Y O;  2P9L B;  3K5N A;  2X78 A;  3RR8 A;  4ILH A;  3LDN A;  3Q7C A;  4NCB A;  4C8M A;  1WUA A;  2W41 A;  1KC8 O;  4BR7 A;  4CZH A;  4DUY K;  1P8Z A;  3I56 N;  3CCV N;  4FJH A;  3DMJ A;  2YI1 A;  4HHT A;  2O8F A;  3CQX A;  3V6D A;  3DYA A;  4LF5 K;  2QWQ A;  4MO4 A;  1N8R O;  3OYE A;  2XRI A;  2FSJ A;  1QSL A;  3R8E A;  1IH7 A;  4CD3 A;  3O4Q A;  5CR4 A;  1NM1 A;  5SWM A;  3QFP A;  4JD2 A;  1VQ7 N;  4DV5 K;  3ZLJ A;  2ZE2 A;  1WSI A;  1X9J A;  4F4K A;  4JLH A;  1YVN A;  4CEB A;  4DLG A;  2P9I A;  2PZS A;  4G1Q A;  4CJE A;  1VQK N;  1I94 K;  3IG1 A;  1NLV A;  3QDK A;  3VA3 A;  3AGR A;  3AVJ A;  3LAM A;  4CK3 A;  2P1J A;  4JI7 K;  4YOX A;  5K14 A;  4AHC A;  5AQQ A;  4DTP A;  1X3M A;  5SZT A;  5CZ2 A;  1OKJ A;  3NBP A;  3VQ7 A;  4CFC A;  5KTQ A;  4JRP A;  4JKH A;  4OX9 K;  1EXQ A;  1YT3 A;  3THX A;  1TAQ A;  1ZXO A;  4KFB A;  5BRF A;  3TAQ A;  4DV4 K;  4HCC A;  4BRQ A;  2NUB A;  3KWG A;  3LPT A;  4DV7 K;  4DTN A;  5JLH A;  3T1H K;  2P9P B;  4CHN A;  1YUW A;  3LP1 A;  3P83 D;  4AF1 A;  2EX3 A;  2Z1G A;  3VEZ A;  3K59 A;  3LDQ A;  3O08 A;  4WCE L;  1QTM A;  4AHU A;  2FXU A;  3HVR A;  5BRD A;  4CJU A;  4B8A B;  3QIO A;  3ZX2 A;  2B6A A;  4ILG B;  1Z6R A;  3J7Z O;  2O8B A;  3WXM B;  3ZSX A;  3OYF A;  4B08 A;  4FPB A;  3L6Q A;  3VQ9 A;  4H03 B;  2ZQB A;  1ATN A;  3C6U A;  4FW1 A;  3WNE A;  4H0V B;  3SQ1 A;  3PO5 A;  5JVG L;  3TSP A;  3C65 A;  4QS8 A;  1RFQ A;  3E9O A;  5EOY A;  2PY5 A;  3ULE A;  3QFU A;  3VEO A;  4NLB A;  5FPE A;  4IJA A;  1NJX A;  2DFE A;  1YHQ N;  3FGU A;  3CJ1 A;  4BWM A;  4KH5 A;  4CFD A;  3KD5 E;  3SBG A;  1RTD A;  1Q81 O;  2VG6 A;  4ELU A;  1REV A;  4UQG A;  3LP3 A;  4H5W A;  1RTI A;  4FWL A;  3A5L C;  2Z1I A;  4TSX A;  5JS2 A;  1BA1 A;  3V9U A;  4Z4G A;  1WSJ A;  3V1Q A;  1U2V A;  4LC9 B;  3MCP A;  4BRK A;  2A1S A;  4RW8 A;  4YOW A;  4R79 A;  4DTU A;  1Z05 A;  3CCL N;  4W5Q A;  4PKI A;  4F2R A;  1HJO A;  1JXE A;  1JLC A;  4W5N A;  1W0H A;  4I9L A;  1OVY A;  1C1A A;  4WE1 A;  3D2F A;  3LDS A;  4KTQ A;  2ZJQ L;  2XY8 A;  1HQE A;  3K58 A;  2BTF A;  4F9O A;  4DV0 K;  2IC3 A;  1BI4 B;  2E88 A;  4PY5 A;  3VTI A;  3C94 A;  5BRH A;  1D9F A;  1IKV A;  3GG4 A;  1B92 A;  2OPQ A;  3PX0 A;  2ZWH A;  3A5N C;  1WBB A;  3PY8 A;  3CCM N;  1OVQ A;  2FLO A;  5B8H A;  4Z4F A;  4O44 A;  1RBS A;  4KRE A;  3L2R A;  2KFZ A;  1U47 A;  1XNR K;  2YKM A;  3KK1 A;  4KB0 A;  4CGG A;  3EL2 A;  4OJR A;  4FJK A;  2IS3 A;  1IG9 A;  3C7N B;  3O3F A;  2D0A A;  3EY1 A;  1VSL A;  4XH5 A;  4A59 A;  3EO3 A;  1YAG A;  3OY9 A;  3T69 A;  4DB3 A;  3W3D A;  1VHX A;  4LSN A;  3OS2 A;  3S3M A;  1LV5 A;  3CET A;  4GMJ B;  3UKU B;  2E2Q A;  4FL9 A;  4CE9 A;  4DR7 K;  4FJM A;  3V9W A;  1W97 L;  4H0P A;  5AQT A;  2HNY A;  3NH0 A;  3JAM O;  1GLJ O;  4DTX A;  1NJY A;  1CXQ A;  1GOC A;  4FWM A;  4DQQ A;  3N4Q A;  3SZ2 A;  5C2F A;  3CC4 N;  3TTC A;  1C0T A;  2KW4 A;  3OYA A;  2QK9 A;  5A2Q O;  3RMA A;  3PIP L;  1GLE G;  3SQ4 A;  1QSS A;  2VWK A;  5HRO A;  3CD6 N;  3MAQ A;  4JK7 A;  4YNQ A;  3EKS A;  3AA3 A;  4E1N A;  2KFN A;  1FKO A;  1Q8I A;  1XWL A;  5BPN A;  1SZ2 A;  2E8A A;  4GNI A;  4LF4 K;  2IVP A;  3QEP A;  5AZI B;  3U8X A;  3CMA N;  3ZSR A;  3O9S A;  1M1K O;  1NGB A;  4B8C A;  1JCF A;  2Q0R A;  4KI6 A;  1KXP A;  5JLF A;  5ADX H;  2D0B A;  5EY4 A;  3VQ6 A;  4Y1C A;  3HPH A;  3VQP A;  3NF9 A;  1DLO A;  2HHQ A;  4FWR A;  4CGD A;  4WFN L;  4MLH A;  3TAF A;  3VGL A;  2HVI A;  3AVK A;  4CJF A;  2RE2 A;  4BC3 A;  1SV5 A;  1C1C A;  2VQE K;  3OYI A;  1QZ5 A;  4IXC A;  3NCI A;  3S9H A;  5BPL A;  2QI2 A;  2OAN A;  3TI0 A;  2E20 A;  2G8F A;  1IBK K;  2ZGZ A;  3UKR B;  3HI0 A;  4WYB A;  4IWV A;  4E1M A;  1OH5 A;  4BRD A;  3RVC A;  3LPU A;  2ASP A;  4GKK K;  4EP5 A;  3KTQ A;  3CFO A;  5BN9 A;  4JKG B;  2E6M A;  4DV1 K;  1U48 A;  3K2P A;  3K0S A;  3SUP A;  4B3M K;  4CHQ A;  3CF5 L;  3TAB A;  1Z26 A;  3U6F A;  4LH5 A;  1N6Q A;  1KCF A;  3LP2 A;  2QEX N;  4FJG A;  1SKW A;  2HBL A;  3J80 O;  1QQM A;  1RBV A;  3MWP A;  3HXM A;  2HST A;  5JIC A;  4F2S A;  1VSK A;  3V1R A;  4LFA K;  2D1K A;  4DKW A;  1KTQ A;  5AQU A;  1ASW A;  3M5R A;  3KLI A;  4WFB L;  2QWO A;  2HB5 A;  4OGE A;  4CJW A;  3SAH A;  1TAU A;  4HVJ A;  3VA0 A;  1TGO A;  4CF2 A;  4PWD A;  4Z4I A;  4YOR A;  2XY6 A;  3DXK B;  2DFH A;  4U67 L;  3G4S N;  3V9X A;  1UAX A;  2QW9 A;  1SS6 A;  1VSF A;  4FWN A;  4O55 A;  4DLE A;  1YJN N;  3A5M C;  4BGB A;  1H1V A;  2P9N B;  4E0D A;  1A5V A;  2EWS A;  1S9E A;  4FWQ A;  4J2D A;  4I9Q A;  3CJ9 A;  3QIC A;  3OYM A;  4ILJ A;  1LWE A;  1NGE A;  3E9P A;  4CK2 A;  3TSQ A;  1WAJ A;  2P9S B;  3FZM A;  3G6E N;  4CF1 A;  1KAY A;  3SQ2 A;  3D7E O;  3TSU A;  3CPE A;  1RT1 A;  1Y64 A;  2YCH A;  3OBW A;  4BR2 A;  4LF7 K;  2FC0 A;  5D3G A;  3L3U A;  4QOZ B;  1T7P A;  4YFU A;  1DTQ A;  2HBM A;  2A6A A;  3DLB A;  2FBX A;  2HHV A;  4K25 A;  2NRH A;  4IOA L;  2HVH A;  3NGI A;  1Z25 A;  1NK5 A;  3ENO A;  1NGF A;  3HTV A;  1NGH A;  4CJT A;  3ZT4 A;  3LDL A;  3OYB A;  1RDA A;  4BC5 A;  1A5X A;  3ZSZ A;  3SAF A;  1QQO A;  4CEA A;  3NF8 A;  3RSE B;  3AAP A;  1XMQ K;  1TKT A;  3SI6 A;  1BU6 O;  1VAZ A;  3G10 A;  3ZEU B;  1K9M O;  3CC7 N;  3ZCM A;  5AQV A;  3OYH A;  4DSL A;  1KLN A;  4DQS A;  3IAY A;  4CJS A;  2GEM A;  3CJC A;  4CGF A;  4NLC A;  5EVZ A;  4KHQ A;  1SKS A;  4M7Y A;  1RIL A;  2A5X A;  4N47 A;  4BR0 A;  4Z4H A;  3L2Q A;  4B3R K;  2F9W A;  3MED A;  1GLD G;  4IOX A;  3BP8 A;  4L8R B;  3L0Q A;  1ZBF A;  2IDO A;  2F8T A;  2OZS A;  2D5R A;  3CCU N;  4NXM K;  3VQQ A;  3ZT0 A;  2DY4 A;  1JJ2 M;  1JL1 A;  2VGN A;  4Q5V A;  4RW6 A;  4NO7 A;  1IJJ A;  4HUE A;  1JLQ A;  2WFB A;  3C95 A;  5HRP A;  1BIU A;  3ZT3 A;  4CBX A;  1NK4 A;  3BEX A;  2KHO A;  3PSI A;  4RTF D;  2NZT A;  2FBY A;  2XHB A;  1J5O A;  1NBW A;  4FLV A;  5J2Q A;  2O8E B;  3NF6 A;  3IFR A;  3QO9 A;  2CH5 A;  3VEX A;  1RTJ A;  3SPZ A;  2YHB A;  1S72 N;  4IG3 A;  2UUA K;  3PLA A;  1MWK A;  4BR9 A;  4ISE A;  4JHD A;  4FM2 A;  2OTJ N;  3U3Y A;  2OA8 A;  5AFU A;  1ATS A;  3O3H A;  3HOS A;  1R59 O;  3DLG A;  3TAG A;  3QER A;  3ULD A;  1IBL K;  3V81 A;  4DF8 A;  1LWF A;  3FR0 A;  2UXC K;  2XY7 A;  1YIT N;  1U45 A;  4AHR A;  4IOC L;  1ZBH A;  3M1F A;  4PKG A;  1W2B M;  1D8Y A;  4CI6 A;  5GAG P;  2WBN A;  4DQ8 A;  4IZ9 A;  3OYJ A;  3RTV A;  3HVT A;  4EAH D;  2V7Z A;  4CFB A;  4JK9 A;  4BC4 A;  4KH6 A;  4DU1 A;  2YNH A;  2NRV A;  3A0I X;  1WOQ A;  1S6Q A;  1LOT B;  3AVA A;  3B6O A;  5HP1 A;  1WSE A;  4C8K A;  3HPG A;  3AA2 A;  3ALY A;  4IBN A;  1GLC G;  3VTH A;  3AVM A;  3IKM A;  1SKR A;  3BGR A;  3QET A;  1VQL N;  3C6A A;  2VWB A;  4YDU C;  2O8F B;  3LZI A;  3SV3 A;  1RDW X;  5M1P A;  1DTT A;  1NGA A;  3HM8 A;  3CCS N;  4DFP A;  2P9K A;  1YTA A;  2V52 B;  2OPS A;  2XY5 A;  3HOT A;  1BGX T;  3O9R A;  2KZZ A;  1TYQ A;  3NVM A;  5CYQ A;  4A61 A;  4BR5 A;  5FRN A;  1NGI A;  3FZK A;  1HNI A;  4GV6 A;  5HL7 L;  5HBM A;  4DSF A;  4CJ3 A;  1YJ9 N;  3F73 A;  2JLE A;  4V19 S;  3PSF A;  2O8D B;  1T03 A;  4K8X A;  2P9I B;  4DS4 A;  5KRT A;  4IDK A;  2WTU A;  1BDG A;  1D9D A;  1WSG A;  5M1N A;  2EHG A;  4ELV A;  2F7T A;  1TVR A;  5AQN A;  1BA0 A;  5CYM A;  3E1Y A;  4MQ3 A;  1L3S A;  4BR4 A;  1NK8 A;  4IEE A;  4CJL A;  4AM7 A;  1SUQ A;  1RDD A;  3QIP A;  1BG3 A;  3LL3 A;  4KI4 A;  4E7L A;  2P5G A;  1XUP O;  3PV8 A;  4E7K A;  1DKG D;  1BHL A;  1HKC A;  4B9S A;  3GE1 A;  2O8C A;  3HO1 A;  2FF3 B;  1DEJ A;  3GOI A;  5AZJ A;  4A62 A;  2P9L A;  4GV3 A;  4B9M A;  3MN9 A;  4BWJ A;  1LCU A;  3THV A;  4BDP A;  2HW3 A;  4O5B A;  3THX B;  3CM5 A;  3LWL A;  3ZT1 A;  3AVI A;  3O4W A;  1ZBU A;  3M8S A;  1GLB G;  2NRT A;  4J2A A;  1K6Y A;  3TR8 A;  4CZJ A;  1FKP A;  4DFK A;  1X9S A;  5HOO A;  3THW A;  2CH6 A;  5HRN A;  4BRP A;  2QTD A;  2ZJP L;  4K8Z A;  5HLF A;  2IOC A;  2P9U A;  4KHS A;  4M3T A;  4DTS A;  4FJ5 A;  1CZ9 A;  4IEI A;  3UIQ A;  4KPY A;  3JS6 A;  4CD1 A;  2O8B B;  1RT6 A;  3BZC A;  4B9U A;  3H1Q A;  1T6C A;  5C10 A;  2OTL N;  3QBX A;  4DR3 K;  2QXF A;  4CJQ A;  4CZE A;  3FFK B;  3NDK A;  4FWS A;  1UA1 A;  3CQ8 A;  3TTD A;  3SUN A;  1YXQ A;  4BE0 A;  3DAW A;  3QEV A;  3S41 A;  3OYD A;  5CE3 A;  3NE6 A;  1TL1 A;  5FDL A;  3CC2 N;  3ULE B;  4FJ8 A;  4CEE A;  1C0G A;  2E2N A;  3H08 A;  4DV3 K;  4CIF A;  5CHI A;  3ZYY X;  2Y1I A;  4BQZ A;  4FLZ A;  4FJ7 A;  2J4R A;  4LY7 A;  3F5T A;  2YHA A;  4B9T A;  2E1Y A;  4Z4E A;  5AQH A;  3QLH A;  2CGJ A;  3WNH A;  4YDU A;  3HYF A;  3SLC A;  5AQO A;  4FWK A;  5BPM A;  1NG9 A;  4E89 A;  5CY4 A;  3DLR A;  1S22 A;  3OHR A;  4K0K K;  3D2F B;  4JI1 K;  2AJQ A;  4BRL A;  1VSH A;  1QE1 A;  2HBK A;  3LAL A;  4FM1 A;  2W40 A;  3G25 A;  4DQR A;  1XC3 A;  1VRU A;  1HYS A;  4RW9 A;  3W0L A;  2HNZ A;  3IRX A;  3M6G A;  4O4G A;  3VQB A;  3VGM A;  1N34 K;  4M3R A;  5C12 A;  4M7X A;  4HTL A;  3DXM A;  5DMR A;  4CED A;  5KPR A;  5GAH P;  4FO0 A;  4L3Q A;  3L2V A;  3IS9 A;  2NLX A;  1XNQ K;  5AQW A;  2PYJ A;  1RTH A;  1WSF A;  2G8W A;  1YJW N;  4NCA A;  1EQY A;  3ZSV A;  1TK8 A;  3WQT A;  1GLF O;  5J1E A;  3DRP A;  1U4B A;  3KD1 E;  1R0A A;  2W6K A;  4C8O A;  4BQL A;  2RHK A;  3EN9 A;  4JAX A;  4OO1 J;  2WON A;  4Y0W A;  4C8N A;  3VEY A;  2QWM A;  2JWK A;  4CK1 A;  5KQ8 A;  1IG8 A;  3TAE A;  3OJS A;  3AVL A;  3WEE A;  4FZX C;  4NYF A;  1QVG M;  4EHT A;  5M1O A;  3ZSW A;  3NGY A;  4CIG A;  3SNN A;  2IVO A;  5F1X A;  2HF4 A;  4F8R A;  4H5T A;  4Z4C A;  3AY9 A;  3K57 A;  5AQZ A;  4CIE A;  4I7F A;  3D2E A;  4DF4 A;  3SMS A;  4O0I A;  3JSM A;  4JKC A;  1ASU A;  3EEQ A;  1JKH A;  3JYT A;  1JLB A;  2Z1J A;  4ICL A;  1XMO K;  2YHW A;  1KVC A;  3G71 N;  3CFR A;  5M1K A;  1HNX K;  1GOB A;  1TV6 A;  1C0U A;  2QXL A;  3DI6 A;  2HHW A;  1U04 A;  3HZ6 A;  1TKZ A;  1NK7 A;  1P90 A;  4JV5 K;  4J2E A;  1JCE A;  2KZM A;  1V4T A;  3MDQ A;  5C42 A;  2OPR A;  4A5A A;  1FJG K;  3IDH A;  3FE1 A;  4FZY A;  3TWH A;  3S3N A;  4GKJ K;  2X6N A;  1EWR A;  3TAP A;  2W42 A;  1EO1 A;  4CF0 A;  4BE2 A;  4DTJ A;  2I5J A;  1WBD A;  3EE8 A;  3AO1 A;  1ITG A;  1Q9X A;  4M3W A;  3DWL A;  3NFA A;  1ZC6 A;  1KAZ A;  4C8L A;  4WQ4 C;  2HBJ A;  4OPH A;  3VPZ A;  4DR5 K;  4FYD A;  1N5Y A;  4JKD A;  3B8A X;  5AQR A;  4CJ5 A;  3K5L A;  3OW2 M;  3R9P A;  3KK7 A;  1S6P A;  1HPZ A;  3ZSY A;  4LSL A;  1VQO N;  3U4L A;  3V9Z A;  4GY2 B;  1ZBI A;  1YIJ N;  4DR4 K;  3SJJ A;  3FZF A;  4MO5 A;  2FBT A;  4JI8 K;  3MEG A;  1O13 A;  3TAN A;  1J6Z A;  5JMV A;  1BOT O;  3FLC O;  5GIP A;  4DFM A;  4CBU A;  2BE2 A;  1HKB A;  4H0T B;  1IBM K;  3CPW M;  5AQY A;  4W5O A;  2VG7 A;  3QIN A;  4I6M A;  1CZB A;  3ATU A;  4GVE A;  4FXD A;  1UA0 A;  4HWI A;  3NF7 A;  3LAK A;  1RNH A;  4JS4 A;  5AZI A;  3O6W A;  3VQ8 A;  3QEI A;  1VQ8 N;  4DSI A;  2OPP A;  3I33 A;  1BIZ A;  4KV8 A;  1SAZ A;  4JNE A;  3Q7B A;  3SK3 A;  5GAD P;  2GBZ A;  4GV9 A;  3E66 A;  4DQP A;  4JI3 K;  3V9S A;  3O8M A;  3VGK A;  1VK0 A;  3QML A;  5C15 A;  5HRR A;  1SL2 A;  2KKZ A;  4NYN A;  5M1F A;  1JLF A;  3D0P A;  3V4I A;  3O1B A;  1OH8 A;  4M3Y A;  3OYK A;  2HND A;  1EKE A;  3D45 A;  4MDB A;  3CJB A;  1EP4 A;  4BE1 A;  1CZA N;  4CHZ A;  2HHS A;  3CCR N;  2DPN A;  4JI5 K;  1D4X A;  1XHX A;  4KKO A;  4CBW A;  5KI6 A;  3KLE A;  4AHS A;  4EZ6 A;  1W7A A;  4FOI A;  2AP1 A;  3CIP A;  4CER A;  4PUO A;  3SCX A;  1Q18 A;  4F3O A;  3SPY A;  1IKW A;  3GBT A;  3KVG A;  4FLT A;  1E3M A;  1OH6 A;  1IV0 A;  1HX1 A;  5BR8 K;  4IDH A;  2E2O A;  4C1N K;  3VEN A;  2RN2 A;  3TPQ A;  4AHT A;  1BQM A;  2A3Z A;  4CZM A; 
#chains in the Genus database with same CATH homology
 3RTV A;  3HVT A;  4JS5 A;  2EX3 A;  1U49 A;  3PO4 A;  4CFB A;  4ZTJ A;  2Z1G A;  3VN5 A;  4CHO A;  1S1V A;  5T7B A;  1YVU A;  3K59 A;  1KLM A;  4DU1 A;  3OJU A;  1QTM A;  2YNH A;  4FJ9 A;  3SYZ A;  4AHU A;  3HVR A;  1J9A A;  4FK4 A;  1S6Q A;  2LSN A;  3B6O A;  3AVA A;  4CJU A;  5HP1 A;  3C6T A;  1WSE A;  3QIO A;  4B8A B;  4RG8 A;  1ZYQ A;  2B6A A;  4AHV A;  4AH9 A;  3QEX A;  4C8K A;  3AVC A;  4BDY A;  3ZSX A;  3RWU A;  3HPG A;  4KRF A;  3RRG A;  4FLX A;  3OYF A;  4B08 A;  3AA2 A;  3ALY A;  4IBN A;  1S1W A;  4LD0 A;  3HM9 A;  1X9M A;  4FJN A;  3VQ9 A;  1RT4 A;  2KTQ A;  3TAM A;  2ZQB A;  3AVM A;  1NK0 A;  1IO2 A;  1BL3 A;  3BGR A;  3C6U A;  4FW1 A;  3WNE A;  1SKR A;  4CEC A;  3QET A;  3SQ1 A;  3PO5 A;  4PQU A;  4I2Q A;  2QKB A;  3AVB A;  1NOY A;  3LZI A;  3SV3 A;  1TK5 A;  4IKF A;  1DTT A;  2F96 A;  4BDZ A;  3KK2 A;  1IKY A;  1LWC A;  1YTA A;  4DFP A;  4N5S A;  4CHY A;  1RT2 A;  2OPS A;  2XY5 A;  2PY5 A;  3QEW A;  1NKE A;  1BGX T;  3M8Q A;  1XI1 A;  2YV0 X;  2KZZ A;  1I39 A;  5FRO A;  3P1G A;  3ZSQ A;  1NJX A;  3KLH A;  5CYQ A;  2DFE A;  4CEQ A;  1JXB A;  3L3V A;  5FRN A;  3DM2 A;  4BWM A;  1HNI A;  4CFD A;  1A5W A;  2VWJ A;  1TKX A;  1BQN A;  3KD5 E;  5HBM A;  4DSF A;  4M3Z A;  2F8S A;  4ELT A;  3SUO A;  1RTD A;  2VG6 A;  4H4O A;  4CJ3 A;  4ELU A;  1NJW A;  3F73 A;  1REV A;  2JLE A;  3AVG A;  4UQG A;  4Z0U A;  3NAE A;  4E7I A;  3LP3 A;  4DG1 A;  1RTI A;  1I3A A;  2Z1I A;  4TSX A;  5JS2 A;  1T03 A;  3MXJ A;  3WNF A;  3V9U A;  4Z4G A;  4K8X A;  4DS4 A;  5KRT A;  3OS1 A;  4IDK A;  2G8V A;  1RDB A;  3KIO A;  4CGJ A;  1WSJ A;  3V1Q A;  1WSG A;  1D9D A;  4OKE A;  2A1S A;  4RW8 A;  2EHG A;  4DTU A;  4ELV A;  1NOZ A;  1TVR A;  4W5Q A;  4F2R A;  3DRR A;  2ZD1 A;  5CYM A;  1JXE A;  3KJV A;  4CF8 A;  1JLC A;  3AVH A;  4W5N A;  4MQ3 A;  1L3S A;  1W0H A;  4I9L A;  3ASM A;  1C1A A;  1JL2 A;  4WE1 A;  3LDS A;  4FM0 A;  4CJL A;  1NK8 A;  1NJZ A;  3HP9 A;  4KTQ A;  1CXU A;  2XY8 A;  1HQE A;  1SUQ A;  1RDD A;  3QIP A;  3K58 A;  3RMC A;  4HCB A;  4KI4 A;  4E7L A;  4KHW A;  2IC3 A;  1BI4 B;  3L8B A;  2P5G A;  4RW4 A;  4O0J A;  3PV8 A;  4CEF A;  4E7K A;  1BHL A;  4M42 A;  3AV9 A;  1RCH A;  1G15 A;  1HMV A;  3C94 A;  1IKV A;  3F9K A;  2XO7 A;  1D9F A;  4B9S A;  3HO1 A;  1B92 A;  2OPQ A;  3HPO A;  3VQC A;  2X6S A;  4LH4 A;  3PX0 A;  4F3T A;  3OVN A;  4B9M A;  4B9N A;  4OKJ A;  4ZTF A;  4BWJ A;  4ID5 A;  3THV A;  1S1X A;  4BDP A;  2YNI A;  3LZJ A;  3PY8 A;  2HW3 A;  4O5B A;  4Z4F A;  1FK9 A;  3CM5 A;  4O44 A;  3A2F A;  3VQA A;  1RBS A;  3ZT1 A;  1KVB A;  3AVI A;  3I0S A;  3AO2 A;  3LWL A;  1ZBU A;  3M8S A;  3L2R A;  4HTU A;  4KRE A;  4H8K A;  2KFZ A;  4J2A A;  1U47 A;  1K6Y A;  1RBR A;  3TR8 A;  2YKM A;  1RT3 A;  1FKP A;  4DFK A;  3KK1 A;  4FLY A;  1X9S A;  5HRN A;  3QNO A;  4KB0 A;  4CGG A;  4OJR A;  4FLU A;  4K8Z A;  4N76 A;  3HP6 A;  2IOC A;  2X74 A;  4E19 A;  5HLF A;  4KHS A;  3NH1 A;  4M3T A;  4FJK A;  4DTS A;  2IS3 A;  3M8R A;  3RR7 A;  4FJ5 A;  1IG9 A;  1NK6 A;  1XC9 A;  1CZ9 A;  2E4L A;  3HST B;  4ZHR A;  1QS4 A;  2D0A A;  3O3F A;  2R7Y A;  3UIQ A;  1LW0 A;  4KPY A;  2QKK A;  4QAG A;  4CEZ A;  3ISN C;  3EY1 A;  1VSL A;  3MXM A;  1RT6 A;  1L3V A;  3OY9 A;  4B9U A;  4GW6 A;  4LSN A;  3S3M A;  3OS2 A;  1LV5 A;  3NH2 A;  3PUF A;  1VSJ A;  2QXF A;  3DLH A;  4CJQ A;  4GMJ B;  4FLW A;  4FJL A;  1HYV A;  4CE9 A;  2ITG A;  3NDK A;  3M8P A;  4FJM A;  1KFD A;  1UA1 A;  3CQ8 A;  3V9W A;  5E41 A;  4I2P A;  3SUN A;  2HNY A;  4IFV A;  3NH0 A;  4BE0 A;  3LP0 A;  3QEV A;  4DTX A;  3OYD A;  1NJY A;  2BDP A;  3BDP A;  1YTU A;  2OZM A;  2VG5 A;  2GV9 A;  3NE6 A;  1CXQ A;  1TL1 A;  5FDL A;  1GOC A;  4CCH A;  4DQQ A;  4FJ8 A;  3SZ2 A;  4KAZ A;  1B9F A;  1HRH A;  4CEE A;  3H08 A;  4DSJ A;  5C25 A;  1C0T A;  2KW4 A;  4CIF A;  3OYA A;  1WSH A;  4KB1 A;  2Y1I A;  3RMB A;  2RF2 A;  2QK9 A;  1GOA A;  1S1U A;  3RMA A;  1VRT A;  2OYQ A;  1SL0 A;  4FLZ A;  1NKC A;  4FJ7 A;  1TL3 A;  4LY7 A;  3PX6 A;  2YHA A;  3SQ4 A;  4B9T A;  1QSS A;  1VSD A;  2VWK A;  5HRO A;  4Z4E A;  5KGW A;  3MAQ A;  3QLH A;  3OYN A;  4YNQ A;  1HQU A;  2HHU A;  3WNH A;  4FJX A;  3AA3 A;  4E1N A;  2KFN A;  1FKO A;  1HNV A;  1Q8I A;  1RBU A;  1XWL A;  3HYF A;  5KGX A;  1ASV A;  2GUI A;  3MEE A;  4N56 A;  1KFS A;  4M45 A;  3V1O A;  4E89 A;  1KRP A;  1WAF A;  3QEP A;  3ZSR A;  4IG0 A;  5CY4 A;  3DLE A;  3DLR A;  1UOC A;  4DTO A;  2AJQ A;  1MU2 A;  4FW2 A;  4B8C A;  2G8I A;  3FFI A;  1BIS A;  4KO0 A;  3L2U A;  2Z1H A;  4KI6 A;  4B9V A;  4M41 A;  4GVM A;  2D0B A;  3L2W A;  1VSH A;  1QE1 A;  4FM1 A;  3LAL A;  2O4G A;  4CGI A;  3VQ6 A;  3I0R A;  3NHG A;  5FRM A;  4DQR A;  3O3G A;  2JGU A;  1VRU A;  4Y1C A;  1HYS A;  3HPH A;  4AIL C;  3VQP A;  2B4J A;  4RW9 A;  3NF9 A;  2HNZ A;  3TAR A;  1NKB A;  1DLO A;  1BCO A;  3IRX A;  3VQ5 A;  2HHQ A;  2YNG A;  4CGD A;  4O4G A;  3VQB A;  5J2N A;  2HVI A;  3QNN A;  3TAF A;  3AVK A;  4M3R A;  4CJF A;  1QSY A;  4NCG A;  5DMR A;  4CED A;  1SV5 A;  1L3T A;  2G8U A;  1C1C A;  5I3U A;  4FJJ A;  2RKI A;  1JLG A;  3OYI A;  3L2V A;  3NCI A;  3IS9 A;  2P5O A;  3S9H A;  2B5J A;  1B9D A;  2PYJ A;  3TI0 A;  2G8F A;  3HJF A;  1RTH A;  3VQE A;  4CJP A;  3KLF A;  1JLA A;  1WSF A;  2YKN A;  4E1M A;  2G8W A;  4NCA A;  1NK9 A;  1UWB A;  3ZSV A;  1EX4 A;  3KKR A;  3LPU A;  1TK8 A;  3OYG A;  3DOL A;  4DU3 A;  3T1A A;  4EP4 A;  5J1E A;  4M3X A;  4EP5 A;  3DRP A;  2DFF A;  1F21 A;  1SL1 A;  3KTQ A;  1U4B A;  3CFO A;  1T05 A;  3KD1 E;  3RMD A;  2E6M A;  1U48 A;  3K2P A;  3AO3 A;  1R0A A;  2ATQ A;  2IGI A;  4C8O A;  3CM6 A;  3NGZ A;  5HRS A;  3SUP A;  3I8D A;  4CHQ A;  4W5R A;  1VSM A;  1S1T A;  3TAB A;  1Z26 A;  2WON A;  4LH5 A;  3OYL A;  4DTR A;  3U6F A;  5I42 A;  1N6Q A;  4C8N A;  1KCF A;  2BAN A;  3LP2 A;  4DMN A;  4CK1 A;  3TAE A;  1SKW A;  4FJG A;  3OJS A;  3AVL A;  1T8E A;  4FZX C;  3HXM A;  1RBV A;  1RBT A;  4NYF A;  4CHP A;  4DQI A;  2HHX A;  3ZSW A;  1Y97 A;  1VSK A;  3NGY A;  3V1R A;  4CFA A;  3ZSO A;  4CIG A;  3SNN A;  1TKD A;  4F2S A;  4M3U A;  1VSI A;  3VQD A;  1KTQ A;  4F8R A;  4IFY A;  1ASW A;  4Z4C A;  3KLI A;  1RT5 A;  3K57 A;  1LAW A;  4EZ9 A;  4CIE A;  2HB5 A;  4I7F A;  4OGE A;  4CJW A;  3KK3 A;  4DF4 A;  4ID1 A;  4XIU A;  1C0M A;  2BGG A;  1TAU A;  4HVJ A;  3VA0 A;  2YNF A;  1TGO A;  4FCY A;  4CF2 A;  4O0I A;  3JSM A;  4PWD A;  4R5P A;  4Z4I A;  2WOM A;  4CJK A;  4PY5 A;  1ASU A;  1TK0 A;  4OLB A;  3SV4 A;  1JKH A;  2XY6 A;  3OYC A;  3JYT A;  4KHN A;  3AVN A;  1XHZ A;  4B3O A;  3SQ0 A;  1JLB A;  5J2P A;  3EYZ A;  2Z1J A;  4ICL A;  2DFH A;  4DS5 A;  3V9X A;  4CJ4 A;  1UAX A;  3B6P A;  1VSF A;  5J2M A;  1KVC A;  3CFR A;  3DRS A;  4O55 A;  1X9W A;  4KHU A;  4DLE A;  3KLG A;  1GOB A;  1TV6 A;  1C0U A;  3DI6 A;  1L5U A;  1W9H A;  2HHW A;  1U04 A;  1WN7 A;  3CG7 A;  4E0D A;  3U3G A;  1A5V A;  3DOK A;  1TKZ A;  3AO4 A;  1NK7 A;  4N41 A;  1S9E A;  2ETJ A;  4J2E A;  1C1B A;  4FK0 A;  2KZM A;  4J2D A;  3S3O A;  4OVL A;  3HL8 A;  4I9Q A;  5EU7 A;  4J2B A;  3OYM A;  1LWE A;  5C42 A;  2OPR A;  3G0Z A;  4CK2 A;  4QCL A;  4DSK A;  1WAJ A;  1WNS A;  3DLK A;  5C24 A;  2HHT A;  2D0C A;  4E7J A;  4MFB A;  3TWH A;  3S3N A;  4FZY A;  1WLJ A;  4CGH A;  5JS1 A;  4CF1 A;  1LW2 A;  3HT3 A;  2RPI A;  1EET A;  1LAV A;  3SQ2 A;  2X6N A;  3TAP A;  2W42 A;  2IAJ A;  5CZ1 A;  1KVA A;  4HUF A;  4CF0 A;  4BE2 A;  4DTJ A;  2I5J A;  2A1R A;  2HMI A;  3LAN A;  2P51 A;  1RT1 A;  4DSE A;  4Q0B A;  4KHY A;  2FC0 A;  5D3G A;  3L3U A;  4QOZ B;  1BCM A;  3AO1 A;  1T7P A;  4YFU A;  3AVF A;  1D5A A;  1DTQ A;  1ITG A;  3O4N A;  4KTZ A;  4CJV A;  4H4M A;  4HUG A;  1Q9X A;  4B9L A;  1JLE A;  4M3W A;  3NFA A;  3DLB A;  2FBX A;  3P5J A;  4BAC A;  4C8L A;  2PYL A;  2HHV A;  2KQ2 A;  2FBV A;  4OLA A;  1C6V A;  3NGI A;  4JRQ A;  2HVH A;  2Q3S A;  4FYD A;  1N5Y A;  1Z25 A;  1NK5 A;  2G8K A;  4CJ5 A;  3SUQ A;  3K5L A;  4OPJ A;  3ZT2 A;  3ITH A;  1S6P A;  1RDC A;  5KRS A;  4CJR A;  3CFP A;  4CJT A;  1HPZ A;  3ZSY A;  3ZT4 A;  3RRH A;  4LSL A;  4E3S A;  4OKK A;  3OYB A;  1VSE A;  3V9Z A;  1ZBI A;  1RDA A;  1A5X A;  3ZSZ A;  2X78 A;  3K5N A;  3SJJ A;  1ZBL A;  1QQC A;  3RR8 A;  4CEA A;  3NF8 A;  4KTW A;  4NCB A;  2FBT A;  1TKT A;  4C8M A;  3SI6 A;  3MEG A;  3TAN A;  1L3U A;  4FJI A;  2Y1J A;  3G10 A;  3ZCM A;  3OYH A;  4DSL A;  1KLN A;  4DQS A;  3IAY A;  4FJH A;  4DFM A;  1KSP A;  4CJS A;  2BE2 A;  3CYM A;  3DMJ A;  3WNG A;  4HHT A;  4CGF A;  1J54 A;  3QES A;  4W5O A;  2VG7 A;  4KHQ A;  1SKS A;  3QIN A;  4DFJ A;  4Y1D A;  1CZB A;  3DYA A;  1HYZ A;  3V6D A;  4FXD A;  4DWI A;  1UA0 A;  3AA5 X;  3MXI A;  3NF7 A;  3K5O A;  1RNH A;  1RIL A;  3LAK A;  2XRI A;  3OYE A;  4N47 A;  4Z4H A;  3L2Q A;  4JS4 A;  4DSI A;  3VQ8 A;  3QEI A;  3MED A;  1QSL A;  1IH7 A;  3PX4 A;  4L8R B;  3T19 A;  1ZBF A;  2IDO A;  2OPP A;  2E6L A;  4CES A;  1BIZ A;  4KV8 A;  2F8T A;  1Q9Y A;  2OZS A;  2D5R A;  1J53 A;  2DTU A;  3O4Q A;  3VQQ A;  3ZT0 A;  2DY4 A;  1X1P A;  1JL1 A;  4Q5V A;  5SWM A;  4RW6 A;  2GBZ A;  2ZE2 A;  4DQP A;  1WSI A;  3V9S A;  4HUE A;  1JLQ A;  4F4K A;  3C95 A;  4JLH A;  1VK0 A;  3AA4 A;  4CEB A;  4DLG A;  5HRP A;  1BIU A;  3ZT3 A;  4G1Q A;  5HRR A;  1HJR A;  1SL2 A;  2PZS A;  4CJE A;  1NK4 A;  4NYN A;  3IG1 A;  4PA1 A;  4FVM A;  1JLF A;  3D0P A;  2FBY A;  2O4I A;  3MEC A;  2XHB A;  3VA3 A;  4FLV A;  5J2Q A;  3VQ4 A;  1J5O A;  1CLQ A;  3LWM A;  3NF6 A;  1FXX A;  1S5J A;  3QO9 A;  3AVJ A;  3V4I A;  3LAM A;  4CK3 A;  1RTJ A;  2P1J A;  3SPZ A;  2YHB A;  4M3Y A;  3OYK A;  2HND A;  4IG3 A;  3T3F A;  1IKX A;  4OGC A;  1QHT A;  3EZ5 A;  5K14 A;  1EKE A;  3D45 A;  4AHC A;  4FM2 A;  1BI4 A;  1EP4 A;  3KKS A;  4BE1 A;  3U3Y A;  4DTP A;  3HK2 A;  4CHZ A;  5SZT A;  2OA8 A;  5CZ2 A;  4E7H A;  1O1W A;  3O3H A;  3K5M A;  3NBP A;  3VQ7 A;  2HHS A;  3DLG A;  4CFC A;  4CEO A;  3TAG A;  1XHX A;  4KKO A;  5KTQ A;  4JRP A;  3QER A;  5KI6 A;  3ULD A;  3KLE A;  3OS0 A;  4AHS A;  4DU4 A;  3V81 A;  4EZ6 A;  4RW7 A;  4CER A;  1EXQ A;  4DF8 A;  4PUO A;  3SCX A;  4CF9 A;  1YT3 A;  1LWF A;  4DTM A;  4FK2 A;  4F3O A;  1TAQ A;  3SPY A;  1IKW A;  4KFB A;  4FLT A;  3AO5 A;  2XY7 A;  3TAQ A;  2G8H A;  1U45 A;  4AHR A;  4OPK A;  4W5T A;  4HCC A;  4FZZ A;  4DTN A;  2NUB A;  3LPT A;  1ZBH A;  2RN2 A;  4AHT A;  1D8Y A;  1RT7 A;  1S9G A;  3E01 A;  1BQM A;  5DK5 A;  4CHN A;  3LP1 A;  3OYJ A;  3P83 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...