5DMRA

Crystal structure of c-terminal domain of mouse erf1 in complex with rnase h domain of rt of moloney murine leukemia virus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
160
structure length
139
Chain Sequence
PDLTDQPLPDADHTWYTDGSSLLQRKAGAAVTTETEVIWAKALPAGTSAQRAELIALTQALKMAEGKKLNVYTDSRYAFATAHIHGEEIKNKDEILALLKALFLPKRLSIIHCPHSAEARGNRMADQAARKAAITETPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Reverse transcriptase/ribonuclease H p80
publication title Structural basis of suppression of host translation termination by Moloney Murine Leukemia Virus
pubmed doi rcsb
source organism Moloney murine leukemia virus (isolate shinnick)
molecule tags Hydrolase/translation
total genus 37
structure length 139
sequence length 160
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5dmrA00
1J9AA 2VWKA 4CFAA 3CQ8A 1NKBA 1YT3A 4M3ZA 3MEEA 3LDSA 1SKWA 4E7KA 1HJRA 3V1QA 4CIGA 5CYQA 5FRNA 1WAJA 1VSDA 4YNQA 3ISNC 3BDPA 2OZSA 3DYAA 1BL3A 2X74A 1KFSA 4KI6A 4BDYA 4CJQA 4KPYA 5HBMA 4M42A 4IFYA 4M3XA 4QOZB 3NGYA 1RT2A 1KRPA 4FCYA 4CHPA 3SPZA 3VQAA 1XC9A 4FJHA 3OS0A 1TK0A 2ZE2A 3NHGA 1N5YA 4CEDA 4N76A 1O1WA 2Z1JA 3OYHA 1IKYA 3KD1E 1C6VA 3D45A 3DLHA 4W5RA 2QKBA 2E4LA 3V9WA 1BI4A 4OKEA 3RTVA 1L3SA 3AVLA 2D0BA 4DS5A 1WAFA 3JSMA 3P1GA 3F9KA 4DWIA 1TL3A 2YV0X 1S1WA 1ZYQA 3NF7A 1JLGA 1JLFA 4KTQA 2HHWA 4PWDA 4DFMA 1VRUA 1RTDA 2FBTA 3LZJA 3NF6A 3SCXA 3DRSA 3AVGA 3SV4A 2HW3A 4FJ9A 3DLGA 4CJWA 3ULDA 4PA1A 4KO0A 4E7IA 1B9FA 1SV5A 3AO1A 4HCCA 4OPJA 3LWLA 5D3GA 1B92A 4BACA 3KKRA 3LWMA 2HHVA 1TGOA 2QXFA 3CM6A 4FZXC 4M41A 4FJ8A 1EKEA 3TR8A 4K8ZA 4FVMA 2IC3A 4O4GA 4QAGA 3MXJA 1MU2A 1WLJA 4N5SA 4BE2A 1VSEA 4AHRA 3L2WA 2E6LA 1S1UA 3SPYA 2Z1IA 3AVFA 1F21A 1RT5A 1QTMA 1WSFA 2E6MA 3KTQA 1U48A 3L2VA 5HLFA 1RDBA 2OA8A 3QESA 1U04A 4CJTA 4RW8A 5SZTA 1Z25A 4J2AA 1S9EA 3MEDA 2G8HA 1CZBA 3NGZA 1D5AA 5I3UA 4CHQA 4FJ5A 2FBXA 2RKIA 3OYJA 1KFDA 1TV6A 4F4KA 2BANA 4UQGA 3AVCA 2NUBA 1YTUA 3VQPA 4CEFA 3KD5E 1JLQA 2PYJA 3LAMA 1RCHA 1TKTA 5FROA 3WNEA 3ZSRA 4KV8A 4IDKA 3ZT1A 3NCIA 4F2SA 1IKXA 1HPZA 3VQEA 3MEGA 3T1AA 1UOCA 4CGJA 3MAQA 4Q5VA 4FM1A 3ASMA 4KHQA 4AHSA 3F73A 1W9HA 1S1TA 4FK4A 1DTQA 2BGGA 4GVMA 1ITGA 1S6PA 3ZSYA 1BCOA 1EX4A 4FLWA 1NK8A 2OPRA 3K5MA 4DS4A 4CF9A 1JLEA 1RBVA 4DSKA 4DFKA 1SKRA 4DTNA 4CFBA 1A5VA 3OYNA 2F96A 4C8OA 3LP0A 4JS5A 2GUIA 2YHBA 2X6NA 4B9NA 4F3OA 4J2EA 4I2PA 3ZSWA 5J2MA 3V6DA 4Y1CA 3ZSQA 2Z1GA 3PX4A 1K6YA 2IOCA 4WE1A 2VG5A 3HT3A 1WSEA 2GBZA 3CFRA 4DF4A 2Y1IA 3L2RA 1RBTA 1DLOA 4I2QA 4E3SA 3TARA 1X9SA 1U47A 3U6FA 3CG7A 3L3VA 4O5BA 3VQ9A 4F8RA 4CHNA 4CF8A 3AO2A 1RBRA 1XWLA 3TABA 3A2FA 5HRNA 1RT7A 4AHCA 1NK6A 1HYSA 2HNDA 4Z0UA 3L2UA 1NKEA 1D9FA 4FJJA 2F8SA 2DY4A 4JLHA 4LSLA 4CGGA 3VA3A 5HROA 4DTXA 4O44A 3RRHA 1GOCA 2ZQBA 3KLHA 4FJNA 1CZ9A 2B4JA 4O0IA 3AA4A 3LAKA 3V9ZA 1WNSA 3HPGA 4E7JA 3TAQA 4PUOA 3T19A 2B5JA 3QO9A 4Z4EA 3SJJA 4IKFA 1RDCA 1NJZA 1YTAA 4FK2A 3DRPA 4DTRA 4B8AB 3K59A 2XY5A 2YNHA 3IRXA 1LWEA 1U49A 1JXEA 1I39A 1IG9A 4KHNA 2FC0A 1L3UA 3DMJA 1UWBA 3NH0A 4O55A 3RMBA 4M3RA 4CEEA 1SL2A 2GV9A 4DLGA 4B3OA 5J2QA 3MXIA 2YNFA 2ITGA 3K58A 1NOZA 4CJ4A 3VQDA 3DLRA 3HM9A 4E1NA 2HNYA 3V9XA 4NCAA 5C24A 2A1SA 1JKHA 1LW0A 1WN7A 1UAXA 4RW4A 3QNNA 4Z4IA 3C95A 4H8KA 1UA0A 4KREA 1L3TA 4CCHA 1WSGA 2RN2A 3G10A 3C6UA 2R7YA 1S6QA 2DFEA 3QIOA 4B9LA 4IBNA 4C8MA 1BQMA 4Q0BA 3CFOA 5DMRA 1RBSA 3NGIA 2BDPA 2QKKA 3OYAA 3THVA 3DLKA 1C0TA 1GOBA 2PY5A 4FJKA 3TAFA 3VQ5A 2IAJA 4ZTJA 4DU1A 4Z4FA 3KLGA 2AJQA 1JXBA 4DQPA 4HTUA 4FZYA 1TKXA 2ZD1A 2OPPA 4OGCA 4E89A 4DQRA 4ZHRA 4ELVA 1HQUA 1IKVA 1VSHA 1FKPA 1S1XA 3B6PA 2HVIA 3I8DA 2LSNA 1VK0A 4PY5A 1KLMA 4CF1A 1TL1A 4DQQA 1QS4A 1J54A 4ZTFA 2P5GA 4E0DA 4BE0A 3OYIA 2KQ2A 4CESA 3AVHA 3LP3A 1L3VA 4FW2A 1KVBA 3HVTA 2Y1JA 1JL1A 3DOKA 4CEAA 3UIQA 3RWUA 4PQUA 4CJ3A 2X78A 2EX3A 3SI6A 1GOAA 1RNHA 2KTQA 3ZT0A 1B9DA 1C1BA 4CHOA 2G8FA 4FZZA 3NDKA 1W0HA 2HHSA 1S9GA 2RPIA 3DLEA 1D8YA 5J1EA 1T05A 3K2PA 1CLQA 3DI6A 1SUQA 4CERA 5J2NA 4M3UA 1ZBHA 1VRTA 2VG7A 4KHSA 3OYCA 1HMVA 4DTJA 1TVRA 4NCBA 3ZSZA 4F3TA 1RTIA 4KHWA 3SQ2A 4RW6A 3QNOA 3L2QA 4HCBA 3RR8A 4R5PA 4B9MA 4CJFA 1REVA 2HHXA 1ZBFA 4OJRA 4CGIA 1SL1A 1RILA 1RT3A 1QE1A 4FLXA 3LZIA 1LV5A 1Z26A 3VQ8A 4LY7A 4EP5A 4Z4GA 4C8KA 3JYTA 4OLAA 4FM0A 1RDAA 3KLEA 4HUEA 1NOYA 3KLIA 3H08A 2P5OA 2KZZA 4Z4CA 1TK5A 1TKZA 3TI0A 3VQQA 3AO3A 1KSPA 3AA2A 3OYMA 4KKOA 1A5WA 3M8QA 4EP4A 1LW2A 3S3OA 4FLYA 1J5OA 3RRGA 5J2PA 3B6OA 2XHBA 4E7LA 4HUFA 3QETA 1X9WA 1Y97A 3V9SA 5KRSA 4B8CA 4CK3A 1NK5A 4JRPA 3D0PA 5JS1A 3AVKA 3AA5X 3KLFA 1NK0A 1KLNA 1ASVA 4CJUA 4M3TA 3NH1A 3I0SA 4CK2A 3OJUA 4ELUA 2QK9A 2YHAA 3V1RA 1CXQA 4FYDA 4DSEA 4M45A 4GW6A 4DTMA 2JLEA 4FK0A 3HPHA 1JL2A 2O4GA 4C8NA 1HNIA 1LWFA 3ZSOA 1FK9A 3OYGA 1KCFA 3RR7A 3HL8A 3KK1A 3OYFA 4CJVA 3LALA 5KGWA 3V1OA 2OPQA 3OJSA 2FBYA 2FBVA 3TANA 1YVUA 3O4QA 4MFBA 2D0CA 1VSIA 1QSLA 3DOLA 4IG0A 1CXUA 2ATQA 3AV9A 4CJLA 3OS2A 1T7PA 1L5UA 1BHLA 4W5QA 1IH7A 1QSSA 3QLHA 2HB5A 2HHUA 1DTTA 4DTPA 1BI4B 2D5RA 2ETJA 4F2RA 2RF2A 1NJYA 4FJMA 4KHYA 4W5NA 1T8EA 3SNNA 4AHUA 4LSNA 3AO4A 2F8TA 4CEZA 1RT4A 4HHTA 1QQCA 3DRRA 5K14A 2WOMA 3S9HA 1S1VA 4DSLA 5HRSA 3AVAA 1BISA 4H4OA 5T7BA 2OYQA 2O4IA 3QINA 3OS1A 4CEOA 3I0RA 2B6AA 5SWMA 3ZCMA 4FXDA 3OVNA 4YFUA 3P83D 3SUNA 4CJ5A 1Q8IA 4CJPA 3OYLA 2PYLA 1TAQA 4DU4A 3VA0A 4NYFA 1NK4A 4CHYA 1XHXA 4OLBA 3VQBA 1WSJA 4CF0A 4NYNA 2DTUA 4BE1A 1XI1A 1Q9YA 3ZT4A 4OPKA 3HO1A 4CJKA 2KFZA 3AVNA 4HUGA 1BIUA 3SUPA 2KFNA 5EU7A 2IGIA 4NCGA 4Y1DA 4B9TA 3ZT3A 4OKJA 3FFIA 4AHTA 3AVIA 4ID1A 4Z4HA 3O3FA 4DSFA 3U3GA 1RTJA 4KFBA 5I42A 4RG8A 2G8VA 3LANA 3NBPA 2OPSA 4AH9A 1NJXA 3SQ0A 3K5NA 1EETA 1ZBUA 3S3NA 4EZ6A 2YKMA 3PV8A 3PY8A 4OGEA 4IFVA 1X9MA 1KTQA 4FLUA 3K5LA 4CIEA 2XRIA 3NF8A 3IG1A 4K8XA 4DU3A 3PX0A 1SKSA 3NH2A 3ZT2A 3HPOA 1VSFA 3P5JA 1C0MA 3SQ4A 5CZ1A 3SQ1A 1FKOA 2XO7A 4GMJB 1HYZA 3SUOA 4KTZA 3OYEA 4LH4A 1NJWA 2IDOA 5HRRA 4N56A 1HRHA 3IAYA 4B9SA 3RMAA 3SYZA 3O4NA 1XHZA 3HP6A 1QHTA 3KK2A 3G0ZA 4BDPA 4J2BA 4DSJA 4BWJA 3BGRA 2XY7A 3QEWA 1TAUA 2BE2A 4RW9A 1ASUA 4CFCA 3QEIA 4KB1A 2HMIA 1KVAA 3SZ2A 4DFJA 4EZ9A 4N47A 3CM5A 4I7FA 5DK5A 4FJGA 3NF9A 3KKSA 2HNZA 4FLZA 2YNGA 2I5JA 5HP1A 5C25A 2JGUA 3MECA 4E19A 1LAVA 2WONA 5C42A 4DFPA 1VSJA 3TWHA 1RTHA 2G8WA 1VSKA 1SL0A 3KJVA 1TK8A 1NK9A 2YKNA 4LD0A 2P51A 3PO5A 4CEQA 4LH5A 3C94A 4G1QA 2VWJA 4FM2A 4B9VA 3LPTA 4KB0A 4I9QA 5FRMA 5HRPA 4CGHA 1U45A 2XY8A 4H4MA 4MQ3A 1UA1A 4KTWA 4FLVA 3EZ5A 4DQIA 4W5TA 3TAEA 3ZSVA 4B08A 5KGXA 2IS3A 3HJFA 3AA3A 3L3UA 5FDLA 4RW7A 3O3GA 3PX6A 2P1JA 4CECA 2HVHA 3O3HA 4CIFA 2VG6A 3KIOA 3RMDA 2Q3SA 2G8KA 4KI4A 4M3YA 1N6QA 3V81A 4FJLA 1HQEA 1RT1A 4CE9A 4FJXA 4CK1A 3DLBA 1C1AA 4QCLA 1NK7A 2OZMA 3C6TA 3CYMA 1RT6A 4DQSA 1EP4A 3QEXA 2HHTA 2XY6A 1JLCA 3HK2A 1C0UA 1ZBLA 3V9UA 1HYVA 2PZSA 1ASWA 1LAWA 4CEBA 4TSXA 1X1PA 4J2DA 4BDZA 3LP2A 3U3YA 3OY9A 3NE6A 1IO2A 1VSLA 1WSIA 1U4BA 2DFFA 4CGFA 1T03A 1S5JA 3K5OA 1BCMA 4L8RB 3WNGA 1VSMA 4N41A 3AVBA 3LP1A 3QERA 4KHUA 3HXMA 3NAEA 3CFPA 2KW4A 2X6SA 2YNIA 3VQ6A 3VQCA 4I9LA 4ICLA 2HHQA 4JS4A 3TAMA 4CHZA 4E7HA 1TKDA 1IKWA 3EYZA 4DTOA 3QEPA 4AHVA 4DSIA 4DG1A 4DMNA 3VQ7A 4CF2A 5KTQA 4OVLA 3K57A 4KAZA 3M8PA 1JLBA 4ID5A 1KVCA 3AVMA 5CY4A 4W5OA 4FLTA 1ZBIA 3RMCA 1Q9XA 4C8LA 2W42A 5CZ2A 1LWCA 3VQ4A 4DF8A 5KRTA 3OYDA 3KK3A 1RDDA 2EHGA 3AO5A 3HP9A 4XIUA 3M8RA 3EY1A 4FJ7A 2KZMA 1FXXA 2DFHA 3L8BA 1BIZA 3TAPA 3ALYA 1HNVA 4FW1A 4DLEA 3HVRA 5JS2A 4B9UA 3T3FA 1C1CA 1BGXT 3AVJA 3TAGA 3ZSXA 4CJRA 5CYMA 4DTSA 3IS9A 5E41A 4CFDA 2Z1HA 3MXMA 1RBUA 3HYFA 1EXQA 4AILC 4ELTA 4FJIA 3OYBA 1WSHA 3WNFA 3QEVA 4CJSA 3LPUA 4IG3A 1BQNA 4O0JA 3DM2A 4OKKA 3WNHA 3S3MA 2A1RA 1JLAA 2G8IA 2G8UA 3SV3A 4M3WA 1NKCA 3OYKA 1A5XA 3NFAA 3PUFA 1G15A 1I3AA 3VN5A 3V4IA 3E01A 4E1MA 4HVJA 4BWMA 3HSTB 4DTUA 1J53A 3QIPA 3PO4A 4JRQA 5KI6A 4KRFA 3M8SA 4CJEA 3SUQA 1D9DA 1R0AA 2D0AA 1QSYA 3ITHA 4CGDA
chains in the Genus database with same CATH superfamily
2VWBA 2QWLA 2VWKA 3CQ8A 3A5MC 4AQYK 4BRPA 4FWKA 2Q31A 3MEEA 2QWRA 1HJRA 4IFEA 5FRNA 3CQYA 3ISNC 2OZSA 2X74A 3PSIA 1KFSA 4M42A 4IFYA 2F4VK 3NGYA 1NGJA 4CHPA 3VQAA 4FJHA 1TK0A 2PBDA 2ZE2A 2RE2A 5BRDA 3DLHA 2E4LA 1BI4A 4NB4A 3RTVA 4B1ZA 4IEEA 3AVLA 3C6HA 3F9MA 3GG4A 1JLGA 4PWDA 4DFMA 3LZJA 3SCXA 3AVGA 4FJ9A 4DUZK 2P9NB 3DLGA 3ULDA 4KO0A 3D2FB 1FJGK 5D3GA 1B92A 2E88A 4M41A 4FJ8A 2P9PB 2QXLA 5KQ8A 4FVMA 3LDPA 1ZXOA 4BR4A 1QTMA 2A3ZA 2NRWA 5FPNA 4YHHK 3O6WA 3MN6A 1NMDA 3QESA 4CJTA 4J2AA 3LM2A 3UKRA 2ZJPL 4FJ5A 2FBXA 3OYJA 4UQGA 3AVCA 3MX2A 1YTUA 4O8UA 3BDPA 4KV8A 1IKXA 4H5NA 3MEGA 3T1AA 2Q2RA 4H5TA 4Q5VA 3ASMA 1NGFA 3F73A 4KHQA 4FK4A 3H1QA 2BGGA 4WFBL 1BCOA 3K5MA 4CF9A 1RBVA 3EE9A 3AARA 4JS5A 4J2EA 3T1YK 3ZSWA 3ZSQA 3O9RA 3PX4A 2IOCA 1ZBIA 1WSEA 4X65K 2Y1IA 3O8MA 1RBTA 4E3SA 1BA1A 4FWMA 3AO2A 1K73O 1XWLA 4WCEL 3K9KA 3A2FA 1NBWA 2VCPA 2KKZA 1HYSA 3L2UA 4Z0UA 3PSFA 1S3XA 4JLHA 5AQGA 1BDGA 3ULEA 4O44A 3KLHA 1V4TA 3UKUB 5JLHA 4O0IA 4A59A 4GNIA 3VF4A 1WNSA 3CJCA 3T19A 4IKFA 1RDCA 4FK2A 4BRMA 4R79A 2XY5A 1HNZK 1I39A 1Y64A 4BREA 3O9QA 4YOYA 3H6EA 4DV0K 5FLXO 2NRZA 4GV6A 1MWMA 2GV9A 1Q81O 4B3OA 2ITGA 2QW9A 3VQDA 5BRFA 3HM9A 2NRRA 3AGKA 1IJJA 3O1BA 3QNNA 3C95A 1UA0A 3MMVA 1L3TA 1T44A 1WSGA 3A0IX 3C6UA 2DFEA 3FZKA 3ZX2A 4IBNA 2O8CB 2VQFK 3THVA 5KPRA 2PY5A 4ZTJA 3BF1A 2VQEK 4Z4FA 5KPZA 1N32K 4JI4K 4DQPA 3P31A 1N8RO 4E89A 4OGCA 4DQ8A 1OVYA 1HQUA 1VSHA 1FKPA 1S1XA 3I8DA 1X9JA 3TSQA 1VK0A 1YUWA 4PY5A 2P9IA 1QS4A 1J54A 4ZTFA 2CGLA 1S72N 1SS6A 4H5WA 4CESA 4FW2A 2Y1JA 1JL1A 4CEAA 3VEZA 2P9SB 4PQUA 2EX3A 3SI6A 1GOAA 2KTQA 1P8ZA 2KHOA 3EN9A 3O9UA 1NU0A 3DI6A 3AAQA 1SQKA 1VRTA 2D4WA 1HMVA 4BGAA 4KHWA 3SQ2A 4JK7A 3ENOA 4NLBA 1SL1A 3SMPA 3U9ZA 3LZIA 2V51B 4C8KA 3JYTA 4JI2K 5C12A 1HPMA 3FLCO 5EX5A 1TKZA 3VQQA 3AO3A 3OYMA 4HTLA 4KKOA 3E1YA 4MLHA 1X9WA 3V9SA 1E4GT 4B8CA 4JKCA 3CCLN 3WXMB 3AA5X 3KLFA 5DM7L 2ZJRL 3TTCA 3NH1A 3I0SA 4ELUA 3V1RA 4FYDA 2FF3B 4M45A 4DTMA 4UY8O 3ID6A 4YOTA 5C10A 1JL2A 4C8NA 4K41A 1BU6O 1FK9A 3OYGA 3VGLA 3HL8A 2OPQA 3OJSA 2FBYA 3TANA 2GEMA 4MFBA 3DOLA 1XUPO 4IJAA 2ATQA 1MDUB 4CJLA 1T7PA 1L5UA 1BHLA 2RHKA 1IH7A 1BI4B 1KD1O 3BEXA 4F2RA 3EKUA 3SNNA 4AHUA 2P9KA 1QQCA 5K14A 2W6LA 4DSLA 5HRSA 4CZJA 1BISA 4O5FA 3QDKA 2W6KA 2O4IA 1G99A 3I0RA 2B6AA 5SWMA 4FXDA 4CJ5A 1Q8IA 1YHQN 2PYLA 4DU4A 3VA0A 4LF8K 2DTUA 3CI5A 1Q9YA 2E2OA 4OPKA 2GELA 2KFZA 4HUGA 2NZTA 5AQZA 4CI6A 2KFNA 3VMFB 4CZFA 4Y1DA 2A40A 3FFIA 3AVIA 4ID1A 2OTLN 4ILHA 4C1NK 4KFBA 5I42A 4RG8A 4Y0WA 4BY9C 1NJXA 4EZ6A 4RWTA 1EETA 3PV8A 4LF5K 3K5LA 2HOEA 2XRIA 2WUSA 1IBLK 4DU3A 3ZT2A 3SQ1A 1FKOA 2XO7A 4GMJB 1N36K 1NJWA 2P9LB 5BREA 1XMQK 2IVPA 3FR0A 4X64K 3CERA 4DSJA 3SLCA 3QEWA 3FZLA 3QEIA 1VHXA 2UYTA 5HL7L 2QWQA 3SMSA 4EZ9A 4FJGA 3CXCM 3KKSA 4IEIA 4FLZA 2YNGA 1VQ8N 3MECA 2WONA 5C42A 2HBMA 1RTHA 2ZGZA 3KHYA 1SL0A 2I7NA 3PO5A 4CEQA 2YHWA 4FM2A 2J4RA 4FWRA 5FRMA 2WBNA 1EO1A 2XY8A 3TAEA 4B08A 1QQOA 3AA3A 3O3GA 5E26A 2P1JA 2E20A 4CIFA 2Q3SA 3CF5L 3V81A 1RT1A 3DLBA 1C1AA 2Q0UA 2ZJQL 4BRIA 3EO3A 5C2DA 3HK2A 5AQVA 4B1YB 1OH8A 1LAWA 3LP2A 4EIAA 3OY9A 1T03A 1IO2A 2O8BB 3K5OA 4CZMA 3AVBA 3QERA 4XH1A 1XMOK 2YHXA 1ATNA 2O8FA 1EWRA 4DMNA 3NMUA 4NCAA 5CY4A 3AVMA 1V4SA 4W5OA 3Q7BA 1Q9XA 4C8LA 5EVZA 3VQ4A 4FPBA 4XEIA 1RDDA 3AO5A 5FPDA 4XIUA 3EY1A 1GLCG 3TAPA 3L8BA 1BIZA 3HI0A 4DLEA 3MCAB 3ZSXA 5CYMA 4FVUA 5E41A 4CFDA 2F7TA 1RBUA 4XH5A 1K9MO 1EXQA 4AILC 3CMAN 3JS6A 3QEVA 4CJSA 3LPUA 4AM7A 1BQNA 4O0JA 3DM2A 4OKKA 5BR9A 2ZM6K 2G8UA 1NKCA 2A41A 5TKWA 1A5XA 1WBDA 4BWMA 5KI6A 4KRFA 4BR5A 3M8SA 4CJEA 3SUQA 5AQFA 2D0AA 5M1PA 4BRGA 1J9AA 1NKBA 4M3ZA 2VGNA 3LDSA 4H0PA 4JHDA 5CYQA 1WAJA 4YNQA 4GY2B 5F0XA 4KI6A 2V7YA 3CC7N 4CJQA 5AQHA 3VGMA 4BC4A 3NHGA 3KD1E 3OYHA 1IKYA 1C6VA 3D45A 2HMPA 4W5RA 3DXKB 3KK7A 4OKEA 3R6MA 4DS5A 4JEPA 3P1GA 3F9KA 4DWIA 1TL3A 1S1WA 3KVGA 3NF7A 2HHWA 3D7EO 2FBTA 3NF6A 4JNEA 3SV4A 2HW3A 4FPAA 4CJWA 4JKAA 4PA1A 3H46O 4HCCA 3AO1A 4OPJA 2Q36A 2UXDK 1TGOA 2QXFA 3CM6A 4H03B 2BUPA 4DV3K 4BVPA 4K8ZA 3ENHA 1MU2A 1WLJA 4BE2A 3SAGA 4AHRA 3L2WA 3CCQN 1S1UA 3SPYA 2Z1IA 3CJ9A 4JKHA 1WSFA 3KTQA 3N4QA 4KBOA 1XC3A 3L2VA 4K0KK 5HLFA 3WEEA 2OA8A 1U04A 2PAVA 5LL6Z 1MWKA 3WQTA 2IVNA 3CJBA 4JI6K 1GLBG 1HNXK 4CZEA 2BANA 2OCEA 1K8KA 2Q1NA 2H3GX 4BRLA 1KQSM 1KAXA 4AHSA 3QFPA 1DTQA 1HUXA 4JI5K 3ZSYA 5JVHL 4MDAA 1YAGA 4JKDA 1SKRA 4DTNA 2F96A 4C8OA 2X6NA 4B9NA 4F3OA 4I2PA 2E1ZA 4BVOA 5J2MA 4Y1CA 3HT3A 3LM9A 2GBZA 3U6FA 3CG7A 1M1KO 4O5BA 3VQ9A 4BC5A 4CHNA 4F8RA 4A61A 1C0FA 2ITMA 3LDOA 1NGEA 4M63C 3PLAA 5EY4A 1Z6RA 1NK6A 3RSEB 1OVQA 2DY4A 5AZJB 4JD2A 1KAZA 3VEYA 3VA3A 4DTXA 3MX5A 3RRHA 1GOCA 2ZQBA 4U7BA 4FJNA 2B4JA 4IO9L 5HOOA 1VQKN 3QBXA 3W0LA 2B5JA 3RVCA 2O8EB 3DRPA 3SAHA 3K59A 3IRXA 1LWEA 3DMJA 4JN4A 4O55A 4DLGA 4DV7K 5J2QA 3J80O 3C0BA 3K58A 3AGRA 3J7ZO 4DR1K 2UXCK 1LW0A 4RW4A 2JWKA 1HR0K 1DKGD 3VEXA 4LF4K 1S6QA 3QIOA 4PKHA 1BQMA 3CFOA 3M1FA 3OYAA 2HF4A 3TAFA 3VQ5A 2IAJA 3FZMA 3DXMA 3KLGA 1JXBA 1TYQA 2Q97A 3CJ1A 2ZD1A 5FPEA 4ZHRA 2V7ZA 2HVIA 5BN8A 3B6PA 3MCPA 2LSNA 2ASOA 1Q82O 1N34K 5ADXA 2KQ2A 1L3VA 3HVTA 3DOKA 4CJ3A 4ILJA 1C1BA 3NDKA 3ENBA 4JYAK 3J81O 4CVNE 3H45C 5J1EA 2ZF5O 1CLQA 2O8FB 4DTJA 3K9JA 4RW6A 3L2QA 1VQ5N 3ZEUB 4B9MA 3SJHA 2ASPA 3SK3A 1Z26A 1BO5O 4EP5A 1QZ6A 4CBWA 4FM0A 4HUEA 3WT0A 3H08A 1VAZA 2KZZA 2O8DA 4WF9L 1LW2A 4FLYA 1N33K 4HUFA 3QETA 4CK3A 4BROA 2E2NA 1IV0A 4BRHA 3AVKA 4M3TA 2QWNA 1ASVA 2QK9A 4CK2A 3OJUA 3TPQA 3VPZA 1CXQA 4A2AA 4DSEA 4GW6A 2IVOA 3ZETA 1J6ZA 4JK8A 1LOTB 3JXUA 3KWIA 1GLAG 4DR5K 1KCFA 1SAZA 3OYFA 1TUUA 3G25A 3LALA 1YVUA 3O4QA 3O9SA 1VSIA 1QSLA 5AZIA 4IG0A 3F5TA 5ELZA 1OH6A 3ZLJA 2HHUA 1DTTA 4DTPA 2D5RA 3EKSA 3BZCA 2RF2A 4FJMA 4W5NA 1T8EA 3LL3A 3AO4A 5FPMA 2V52B 1RT4A 3DRRA 4ILGB 3QINA 3DWLA 1YF5L 1NG9A 1NJIO 4XH4A 4CEOA 5F2RA 3ZCMA 3THXA 4ISGA 3BY5A 2VGMA 1NK4A 4U67L 3W3DA 1BUPA 1WSJA 1YVNA 4CF0A 1XI1A 4CJKA 3S41A 5AQYA 3CPWM 4B9TA 4NCGA 3P4IA 3ZT3A 4X66K 3G6EN 1XQSC 3NBPA 2OPSA 4AH9A 3S3NA 3PY8A 3THYB 1X9MA 5KPTA 4FLUA 3FZHA 1ZBSA 3PX0A 3P5JA 3SQ4A 5CZ1A 2IIRA 3M3ZA 4CZIA 2IDOA 4JK9A 4JKGB 1HRHA 3IAYA 4CD1A 4OX9K 1K8KB 3M6GA 4BDPA 2CGKA 4BWJA 3BGRA 4PKGA 3CCUN 3IDHA 5AQTA 4RW9A 4WFAL 4BRCA 3AAPA 4DFJA 3ATUA 5DK5A 4I7FA 4MDBA 4BQZA 2HNZA 1XNRK 5HP1A 2JGUA 3L0QA 4LC9B 3TWHA 2G8WA 1VSKA 1TK8A 3EE8A 2P51A 4BG8A 4LH5A 5M1FA 5HRPA 4CGHA 4H4MA 4MQ3A 4KTWA 1WB9A 3EZ5A 4W5TA 3L3UA 3D2EB 3I33A 4RW7A 3PX6A 4FOIA 4KI4A 4JD2B 4M3YA 1VQ6N 3THWA 1N6QA 4FJLA 4CE9A 4QCLA 1W2BM 4CK1A 1YI2N 1NK7A 4FOEA 2OZMA 3C6TA 3KWGA 1RT6A 3I8BA 4DQSA 3C6AA 3BP8A 2GUPA 3VEVA 1C0UA 4JI1K 1ZBLA 4MLEA 1HYVA 5MLCQ 1ASWA 2WFBA 4J2DA 3VTHA 5AQUA 1DGKN 1VSLA 1NGCA 2DFFA 3PIOL 4LF6K 3U9DA 4L8RB 5C15A 4GV9A 4DR7K 2X6SA 1E4FT 2YNIA 1I94K 5AQLA 4I9LA 2HHQA 1OH7A 4JS4A 3EYZA 4DSIA 2UU9K 4DG1A 3ZYYX 4CF2A 5KTQA 3QB0A 3K57A 3M8PA 3A5LC 4BRNA 4DV1K 3CCRN 2W42A 3K0SA 1LWCA 4DF8A 5KRTA 4H0YB 2KZMA 3TTFA 1NGIA 3WXLA 4ISEA 1R59O 5GAHP 3M8RA 3VETA 5GINA 2P9UA 2E2QA 3ALYA 3SBTA 4B9UA 3T3FA 1C1CA 1TYQB 4CJRA 4DTSA 3GBTA 1GLEG 4FJIA 3OYBA 1WSHA 5LJVA 4C23A 2G8IA 3VF6A 3SV3A 4BR2A 5AR0A 3NFAA 1KC8O 1G15A 3V4IA 3HSTB 1E3MA 4JRQA 4YOUA 4YY3K 1KXPA 3LDQA 2CGJA 5B8HA 3ITHA 4CGDA 4FL9A 4K25A 4CFAA 1YT3A 5AJ3K 4KH6A 1NGBA 4KH5A 1SKWA 4CIGA 3VEOA 2D0PA 1NGGA 4K43A 1OH5A 3UKRB 5KQDA 3C7NA 3CCMN 4BDYA 4KPYA 5HBMA 3EZWA 4M3XA 5AQOA 1ATSA 4QOZB 2CH6A 4B9QA 4CZKA 4FCYA 1XC9A 4LFCK 3A8YA 3OS0A 3DAWA 4CEDA 5EOYA 2HBJA 4H5VA 2QKBA 4IDHA 1L3SA 4X62K 5C2FA 1WAFA 1QQMA 2QM1A 3L4IA 2YV0X 2HF3A 1ZYQA 1JLFA 1VRUA 1RTDA 3DRSA 2UUAK 1QQNA 4PL7A 3LWLA 3GOIA 2E8AA 4BACA 4BC3A 2FLOA 2AP1A 3MXJA 1VSEA 2E6LA 1F21A 1RT5A 4I6MA 1U48A 3M5RA 4QS8A 1IBKK 1RDBA 4OPAA 5AZIB 2QTDA 3ULEB 1OKJA 5GAGP 4RW8A 1S9EA 3NGZA 5BN9A 1D5AA 4IOAL 4CHQA 2RKIA 5AQKA 2NUBA 2YJFA 4AM6A 1JLQA 3CQXA 1GLJO 2PYJA 3LAMA 5FROA 3EEQA 4F2SA 4IDKA 1HPZA 4NXNK 1UOCA 3MAQA 3THXB 4FM1A 3HRGA 4B1WB 3VTIA 4GKKK 5TKYA 1EX4A 4DB3A 1NK8A 2OPRA 1XNQK 2A6AA 3AY9A 4FO0A 4CFBA 1A5VA 3OYNA 2GWKA 3LP0A 2GUIA 2YHBA 3GDQA 4KH4A 2P9NA 4A62A 4BRAA 2Z1GA 1K6YA 3D2FA 4WE1A 4DF4A 1YJWN 1DLOA 4I2QA 3TARA 2A5XA 3L3VA 5AQMA 3CETA 1IG8A 1DT9A 4RTFD 1RBRA 5AQSA 3P39A 4PKIA 1RT7A 3P38A 5F1XA 2HNDA 5LJWA 1NKEA 1D9FA 1CZAN 3CCEN 4FJJA 4CGGA 5HROA 1NNEA 4B3TK 2P9IB 5BR8K 4FWSA 4CD3A 2ASMA 5JVGL 4FWLA 3LAKA 3V9ZA 4E7JA 4PUOA 5AFUH 4JI7K 3QO9A 4Z4EA 3SJJA 1VQMN 1EQYA 4H0TB 4BR9A 4DTRA 4B8AB 1JXEA 5AFUA 2FC0A 4EHUA 3NH0A 2PFUA 3Q7CA 4CZLA 4M3RA 4CEEA 3MXIA 4CJ7A 3GE1A 3QBWA 1T6CA 4H0OA 5JICA 5C24A 1JKHA 2A1SA 1ZBHA 1UAXA 4OO1J 4H8KA 3CJAA 4L3QA 4CCHA 2NRTA 4BQLA 3G10A 1WUAA 4B9LA 3O80A 3MN5A 5DMRA 3THWB 3NGIA 2QKKA 1GOBA 1HJOA 2ZGYA 4DU1A 2AJQA 4HTUA 2E2PA 4FZYA 1TKXA 2OPPA 4ELVA 2NNWA 5M1OA 5GAEP 5DM6L 4CF1A 4DQQA 3J7YP 3OYIA 3H3OB 3R8EA 3AVHA 3LP3A 1KVBA 2X78A 1RNHA 3ZT0A 1B9DA 4CHOA 2G8FA 1BOTO 4FZZA 4JI0K 2RPIA 1NGHA 1D8YA 4LFAK 1ESVA 4WQ5A 1T05A 1SUQA 4CERA 1NGDA 3QICA 4DKWA 3R1XA 1WBBA 3OYCA 4KHSA 4V19S 1EWQA 1ZC6A 4F3TA 1RTIA 3OHRA 2P9KB 3L6QA 5BPNA 4HCBA 2HHXA 1ZBFA 4CGIA 2YX6A 1RILA 1RT3A 3NVMA 1LV5A 3VQ8A 5JMVA 4LF7K 3LDLA 3KLIA 3MDQA 3WXJA 4Z4CA 1TK5A 1KSPA 3AA2A 1A5WA 4IWVA 3RRGA 2XHBA 1C0GA 5CHIA 1NK5A 1VQ4N 3D0PA 1KLNA 3CPEA 5CE3A 2JLEA 4M7XA 4DUYK 3HPHA 2O4GA 2P9SA 1LWFA 3WXIA 3ZSOA 3RR7A 3KK1A 4CJVA 5KGWA 3U8XA 1JCFA 2D0CA 4A5BA 2QWOA 3AV9A 3QLHA 2HB5A 3O4WA 2ETJA 1NJYA 4LSNA 2F8TA 4CEZA 4EHTA 4HHTA 1YJ9N 2UUBK 1U2VA 4H4OA 1P90A 2GX9A 2D0OA 1SZ2A 3OVNA 4YFUA 3SUNA 1TAQA 4IO8A 4NYFA 3OBWA 4EFHA 4OLBA 3VQBA 4BE1A 1GLLO 3SUPA 2IGIA 4GKJK 3O3FA 1M90O 4Z4HA 4DSFA 1RTJA 2G8VA 4I6MB 3U4LA 5H1SQ 1BG3A 3K5NA 4OGEA 4OPHA 4CIEA 3NF8A 2UXBK 3R3LA 1SKSA 3JAMO 1VSFA 5GIPA 1Q7YO 3SAFA 4LH4A 5HRRA 5ADXH 4N56A 2CH5A 2EWSA 3VF2A 1MA9B 3RMAA 5AQXA 3IKMA 4YOXA 3O4NA 5CR4A 4DV4K 1QHTA 2WC9A 4J2BA 1QZ5A 3QFUA 1TAUA 2HHHK 4FWOA 4CFCA 4KB1A 2D1KA 1KVAA 3SZ2A 2YHYA 3CM5A 4YOWA 4CW7B 2WTUA 5M1KA 2BTFA 2QA4N 2NLXA 5C25A 5IT9O 2VYPA 5AQIA 1BA0A 1LAVA 3E66A 3A5OC 3CD6N 3KJVA 4LD0A 3CC2N 4G1QA 2VWJA 4I9QA 3LPTA 2GTDA 3TU5A 1UA1A 3A5NC 4LF9K 3TSPA 4DQIA 1O13A 5FDLA 5LMNK 4CECA 2VG6A 3KIOA 3RMDA 3QMLA 2Q0RA 5GADP 1HQEA 4FJXA 4BC2A 3CCJN 3CYMA 2HSTA 2XY6A 4H5RA 3V9UA 2P9LA 2PZSA 4CEBA 4F9OA 3HTVA 3O1WA 4CGFA 4YOVA 1KAYA 2F9WA 1HKBA 3J8AA 1NM1A 4JHDB 3WNGA 3LP1A 4KHUA 3HXMA 3NAEA 3CFPA 2KW4A 1HX1A 2KLAA 3MN7A 4JKFA 4ICLA 4CHZA 4E7HA 3H1VX 4BG9A 1Z05A 3VQ7A 4OVLA 4ID5A 4FLTA 3VESA 3WUHA 3KK3A 3HP9A 1Q86O 2FXUA 1FXXA 2DFHA 3ATVA 4FW1A 3HVRA 5JS2A 1BGXT 4QS9A 3R9PA 3IS9A 1FW6A 2YI1A 2Z1HA 5BPLA 3MXMA 1T6DA 3HYFA 1RGIA 3WNFA 4JKEA 4WYBA 3HOSA 2A1RA 1JLAA 4M3WA 4MO5A 3TSUA 3PUFA 1I3AA 3E01A 4E1MA 3T69A 4HVJA 1JCEA 2NRHA 1J53A 1Q18A 4LFBK 1QSYA 5E84A 3WEEB 2O8BA 4WQ5C 4A57A 4E7KA 3OW2M 3V1QA 4J8FA 1VSDA 3DYAA 1BL3A 2YCHA 4PHTX 3BUZB 1RT2A 1HKGA 1KRPA 2HBKA 3SPZA 1N5YA 1DEJA 4N76A 3H3NO 1O1WA 2Z1JA 1LCUA 3V9WA 2DPNA 4CBUA 2D0BA 4BR7A 3JSMA 4IXCA 4KTQA 4H0VB 3O5BA 3PIPL 1QVGM 2FF6A 2OTJN 4IOCL 1ILYA 4E7IA 1B9FA 1SV5A 4YDUA 3ID8A 2YJEA 3KKRA 3LWMA 2HHVA 4FZXC 1EKEA 3TR8A 4O8KA 3CMEN 3BZKA 2IC3A 4O4GA 4QAGA 4N5SA 3AVFA 5AQQA 2E6MA 4QS7A 1NMNA 3G4SN 5SZTA 1Z25A 2G8HA 3MEDA 1CZBA 5I3UA 4EAHD 1KFDA 1TV6A 4F4KA 1YJNN 3CIPA 3VQPA 1U2VB 4GVEA 4NO7A 4CEFA 3CCSN 3KD5E 3ZSRA 1RCHA 1TKTA 3WNEA 3NCIA 3ZT1A 3VQEA 3DXKA 4CGJA 2QWMA 5BRHA 1W9HA 1S1TA 5LMUK 4GVMA 5M1QA 1ITGA 1S6PA 4FLWA 4DS4A 1JLEA 4DSKA 4DFKA 3HM8A 3KZBA 4WQ4C 4YORA 3V6DA 5A2QO 1NGAA 2VG5A 3CFRA 3L2RA 1RFQA 4E1JA 1X9SA 1U47A 3DXMB 4CF8A 4NXMK 4MO4A 3TABA 1W97L 5HRNA 4AHCA 4B1VA 2AA4A 1W7AA 1VQNN 2F8SA 1ATRA 4LSLA 3MWPA 3CJ7A 3L4QA 5BPMA 1RDUA 1CZ9A 2W40A 3AA4A 4A2BA 1GLDG 1X3NA 3TAQA 3HPGA 1VQ7N 2FSJA 2NRXA 4Z94A 1NJZA 3OBYA 1YTAA 1HKCA 2YNHA 1U49A 1IG9A 4KHNA 1L3UA 1UWBA 3RMBA 1SL2A 3VGKA 1D4XA 2YNFA 1NOZA 3T7ZA 4CJ4A 3DLRA 1NWKA 5EXWA 3CCVN 4E1NA 2HNYA 3V9XA 3VENA 1WN7A 4Z4IA 1K8AO 3TTDA 4KREA 2RN2A 2R7YA 3NVKA 4ISFA 4C8MA 4Q0BA 2O8DB 1RBSA 2BDPA 3DLKA 1C0TA 3GL1A 4FJKA 1S22A 1YXQA 3OTOK 5C0YA 3RSEA 4DQRA 2E5LK 2A42A 5AZJA 1IKVA 1KLMA 2UUCK 1TL1A 3FGUA 3WQUA 3ZETB 2P5GA 3E9PA 4E0DA 4BE0A 3MN9A 3RWUA 3HOTA 3UIQA 3CHWA 5AQJA 4B3RK 1VQLN 2O8EA 1W0HA 2HHSA 1S9GA 3MWTA 3DLEA 2HBLA 4DV6K 4DR2K 2W41A 3K2PA 5J2NA 4M3UA 3OA9A 2VG7A 1JCGA 2ZWHA 1TVRA 4NCBA 3IUCA 3ZSZA 2GWJA 2NRVA 3QNOA 2JWLA 4K42A 3RR8A 4R5PA 4CJFA 1REVA 4OJRA 4B3MK 3J7AP 1QE1A 4FLXA 1VQ9N 4DCHA 4LY7A 3B8AX 4Z4GA 4OLAA 1RDAA 3KLEA 1NOYA 2QWPA 2P5OA 3T1HK 3G71N 3HBTA 3TI0A 3M8QA 4EP4A 3S3OA 1J5OA 3D6RA 5J2PA 3B6OA 4E7LA 1Y97A 5KRSA 3CC4N 4JRPA 5JS1A 1QHAA 1NK0A 4CJUA 4H0XB 3O08A 2E1YA 2YHAA 4DV5K 4FK0A 4CZHA 2P9PA 4C1NI 1HNIA 3VEWA 3I55N 1NLVA 4JI8K 4A5AA 3WXKA 3V1OA 2FBVA 3N4PA 1HNWK 2QI2A 1CXUA 3OS2A 4W5QA 1H1VA 1QSSA 1X3MA 4B1XB 3E9OA 4KHYA 3IFRA 3ZEUA 4B3SK 4BRFA 3S9HA 2WOMA 1S1VA 4DV2K 3AVAA 5T7BA 2OYQA 4FWQA 3OS1A 4JV5K 3SBGA 2BH1A 3P83D 4CJPA 3OYLA 4G9ZA 4YDUC 4CHYA 1XHXA 4NYNA 4PL8A 3ZT4A 3HO1A 3AVNA 4JKBA 1BIUA 3O9TA 1YITN 5EU7A 4AHTA 4OKJA 4JI3K 3U3GA 3C65A 3LANA 3UE5A 3SQ0A 1ZBUA 1YIJN 2YKMA 4IOXA 3ZX3A 4IFVA 1KTQA 4K8XA 3IG1A 3NH2A 3HPOA 5JLFA 1C0MA 1HYZA 3SUOA 4KTZA 3OYEA 3FFKB 4B9SA 1BWFO 4DHYA 3SYZA 1XHZA 3HP6A 1IBMK 3KK2A 3G0ZA 4B1UB 3UKUA 2XY7A 2BE2A 1ASUA 3HSCA 2HMIA 4N47A 4BRKA 3IMXA 2I7PA 3NF9A 4WFNL 1VQON 4KHPK 5AQNA 5LY3A 3LDNA 3BF3A 2I5JA 1HLUA 4E19A 1RDWX 1VSJA 4BRDA 4DFPA 2FSKA 3ZX0A 1NK9A 2YKNA 4IZ9A 1WOQA 1J5EK 2OANA 3C94A 4B9VA 4KB0A 4CBXA 1U45A 2P9UB 4FLVA 1QVFM 3MK6A 3HZ6A 4HWIA 3ZSVA 5KGXA 2IS3A 3HJFA 2HVHA 4BGBA 3O3HA 2G8KA 2QEXN 3THYA 2O8CA 1T3VA 4FWNA 3QEXA 1EP4A 2HHTA 1JLCA 1JJ2M 4DR6K 1VQPN 1GLFO 3UB5A 4JKGA 3VOVA 4TSXA 1X1PA 4CZGA 4BDZA 3U3YA 1U4BA 3NE6A 1WSIA 4DR3K 4ELTA 1S5JA 1BCMA 2FSNA 1VSMA 3DLLL 3DJCA 3F2KA 4N41A 3C7NB 3I56N 4FWPA 3VQ6A 3VQCA 5AQWA 3TAMA 1TKDA 1IKWA 4DTOA 3QEPA 4AHVA 3FE1A 4KAZA 5M1NA 1JLBA 1KVCA 3VERA 4RCHA 4DR4K 3RMCA 3EL2A 5CZ2A 3OYDA 2EHGA 4FJ7A 4BRQA 2F9TA 4M7YA 5GIOA 1HNVA 4JAXA 4BR0A 3AVJA 5AQPA 3TAGA 3D2EA 4GV3A 5IWAK 1TUYA 4FSVA 4IJNA 4IG3A 3WNHA 3S3MA 5AQRA 4AF1A 3OYKA 3VN5A 1U6ZA 3FZFA 5I9EB 3E9LA 4NLCA 4WQ4A 4DTUA 3QIPA 3PO4A 1D9DA 1R0AA
chains in the Genus database with same CATH topology
1J9AA 2VWKA 4CFAA 3CQ8A 1NKBA 1YT3A 4M3ZA 3MEEA 3LDSA 1SKWA 4E7KA 1HJRA 3V1QA 4CIGA 5CYQA 5FRNA 1WAJA 1VSDA 4YNQA 3ISNC 3BDPA 2OZSA 3DYAA 1BL3A 2X74A 1KFSA 4KI6A 4BDYA 4CJQA 4KPYA 5HBMA 4M42A 4IFYA 4M3XA 4QOZB 3NGYA 1RT2A 1KRPA 4FCYA 4CHPA 3SPZA 3VQAA 1XC9A 4FJHA 3OS0A 1TK0A 2ZE2A 3NHGA 1N5YA 4CEDA 4N76A 1O1WA 2Z1JA 3OYHA 1IKYA 3KD1E 1C6VA 3D45A 3DLHA 4W5RA 2QKBA 2E4LA 3V9WA 1BI4A 4OKEA 3RTVA 1L3SA 3AVLA 2D0BA 4DS5A 1WAFA 3JSMA 3P1GA 3F9KA 4DWIA 1TL3A 2YV0X 1S1WA 1ZYQA 3NF7A 1JLGA 1JLFA 4KTQA 2HHWA 4PWDA 4DFMA 1VRUA 1RTDA 2FBTA 3LZJA 3NF6A 3SCXA 3DRSA 3AVGA 3SV4A 2HW3A 4FJ9A 3DLGA 4CJWA 3ULDA 4PA1A 4KO0A 4E7IA 1B9FA 1SV5A 3AO1A 4HCCA 4OPJA 3LWLA 5D3GA 1B92A 4BACA 3KKRA 3LWMA 2HHVA 1TGOA 2QXFA 3CM6A 4FZXC 4M41A 4FJ8A 1EKEA 3TR8A 4K8ZA 4FVMA 2IC3A 4O4GA 4QAGA 3MXJA 1MU2A 1WLJA 4N5SA 4BE2A 1VSEA 4AHRA 3L2WA 2E6LA 1S1UA 3SPYA 2Z1IA 3AVFA 1F21A 1RT5A 1QTMA 1WSFA 2E6MA 3KTQA 1U48A 3L2VA 5HLFA 1RDBA 2OA8A 3QESA 1U04A 4CJTA 4RW8A 5SZTA 1Z25A 4J2AA 1S9EA 3MEDA 2G8HA 1CZBA 3NGZA 1D5AA 5I3UA 4CHQA 4FJ5A 2FBXA 2RKIA 3OYJA 1KFDA 1TV6A 4F4KA 2BANA 4UQGA 3AVCA 2NUBA 1YTUA 3VQPA 4CEFA 3KD5E 1JLQA 2PYJA 3LAMA 1RCHA 1TKTA 5FROA 3WNEA 3ZSRA 4KV8A 4IDKA 3ZT1A 3NCIA 4F2SA 1IKXA 1HPZA 3VQEA 3MEGA 3T1AA 1UOCA 4CGJA 3MAQA 4Q5VA 4FM1A 3ASMA 4KHQA 4AHSA 3F73A 1W9HA 1S1TA 4FK4A 1DTQA 2BGGA 4GVMA 1ITGA 1S6PA 3ZSYA 1BCOA 1EX4A 4FLWA 1NK8A 2OPRA 3K5MA 4DS4A 4CF9A 1JLEA 1RBVA 4DSKA 4DFKA 1SKRA 4DTNA 4CFBA 1A5VA 3OYNA 2F96A 4C8OA 3LP0A 4JS5A 2GUIA 2YHBA 2X6NA 4B9NA 4F3OA 4J2EA 4I2PA 3ZSWA 5J2MA 3V6DA 4Y1CA 3ZSQA 2Z1GA 3PX4A 1K6YA 2IOCA 4WE1A 2VG5A 3HT3A 1WSEA 2GBZA 3CFRA 4DF4A 2Y1IA 3L2RA 1RBTA 1DLOA 4I2QA 4E3SA 3TARA 1X9SA 1U47A 3U6FA 3CG7A 3L3VA 4O5BA 3VQ9A 4F8RA 4CHNA 4CF8A 3AO2A 1RBRA 1XWLA 3TABA 3A2FA 5HRNA 1RT7A 4AHCA 1NK6A 1HYSA 2HNDA 4Z0UA 3L2UA 1NKEA 1D9FA 4FJJA 2F8SA 2DY4A 4JLHA 4LSLA 4CGGA 3VA3A 5HROA 4DTXA 4O44A 3RRHA 1GOCA 2ZQBA 3KLHA 4FJNA 1CZ9A 2B4JA 4O0IA 3AA4A 3LAKA 3V9ZA 1WNSA 3HPGA 4E7JA 3TAQA 4PUOA 3T19A 2B5JA 3QO9A 4Z4EA 3SJJA 4IKFA 1RDCA 1NJZA 1YTAA 4FK2A 3DRPA 4DTRA 4B8AB 3K59A 2XY5A 2YNHA 3IRXA 1LWEA 1U49A 1JXEA 1I39A 1IG9A 4KHNA 2FC0A 1L3UA 3DMJA 1UWBA 3NH0A 4O55A 3RMBA 4M3RA 4CEEA 1SL2A 2GV9A 4DLGA 4B3OA 5J2QA 3MXIA 2YNFA 2ITGA 3K58A 1NOZA 4CJ4A 3VQDA 3DLRA 3HM9A 4E1NA 2HNYA 3V9XA 4NCAA 5C24A 2A1SA 1JKHA 1LW0A 1WN7A 1UAXA 4RW4A 3QNNA 4Z4IA 3C95A 4H8KA 1UA0A 4KREA 1L3TA 4CCHA 1WSGA 2RN2A 3G10A 3C6UA 2R7YA 1S6QA 2DFEA 3QIOA 4B9LA 4IBNA 4C8MA 1BQMA 4Q0BA 3CFOA 5DMRA 1RBSA 3NGIA 2BDPA 2QKKA 3OYAA 3THVA 3DLKA 1C0TA 1GOBA 2PY5A 4FJKA 3TAFA 3VQ5A 2IAJA 4ZTJA 4DU1A 4Z4FA 3KLGA 2AJQA 1JXBA 4DQPA 4HTUA 4FZYA 1TKXA 2ZD1A 2OPPA 4OGCA 4E89A 4DQRA 4ZHRA 4ELVA 1HQUA 1IKVA 1VSHA 1FKPA 1S1XA 3B6PA 2HVIA 3I8DA 2LSNA 1VK0A 4PY5A 1KLMA 4CF1A 1TL1A 4DQQA 1QS4A 1J54A 4ZTFA 2P5GA 4E0DA 4BE0A 3OYIA 2KQ2A 4CESA 3AVHA 3LP3A 1L3VA 4FW2A 1KVBA 3HVTA 2Y1JA 1JL1A 3DOKA 4CEAA 3UIQA 3RWUA 4PQUA 4CJ3A 2X78A 2EX3A 3SI6A 1GOAA 1RNHA 2KTQA 3ZT0A 1B9DA 1C1BA 4CHOA 2G8FA 4FZZA 3NDKA 1W0HA 2HHSA 1S9GA 2RPIA 3DLEA 1D8YA 5J1EA 1T05A 3K2PA 1CLQA 3DI6A 1SUQA 4CERA 5J2NA 4M3UA 1ZBHA 1VRTA 2VG7A 4KHSA 3OYCA 1HMVA 4DTJA 1TVRA 4NCBA 3ZSZA 4F3TA 1RTIA 4KHWA 3SQ2A 4RW6A 3QNOA 3L2QA 4HCBA 3RR8A 4R5PA 4B9MA 4CJFA 1REVA 2HHXA 1ZBFA 4OJRA 4CGIA 1SL1A 1RILA 1RT3A 1QE1A 4FLXA 3LZIA 1LV5A 1Z26A 3VQ8A 4LY7A 4EP5A 4Z4GA 4C8KA 3JYTA 4OLAA 4FM0A 1RDAA 3KLEA 4HUEA 1NOYA 3KLIA 3H08A 2P5OA 2KZZA 4Z4CA 1TK5A 1TKZA 3TI0A 3VQQA 3AO3A 1KSPA 3AA2A 3OYMA 4KKOA 1A5WA 3M8QA 4EP4A 1LW2A 3S3OA 4FLYA 1J5OA 3RRGA 5J2PA 3B6OA 2XHBA 4E7LA 4HUFA 3QETA 1X9WA 1Y97A 3V9SA 5KRSA 4B8CA 4CK3A 1NK5A 4JRPA 3D0PA 5JS1A 3AVKA 3AA5X 3KLFA 1NK0A 1KLNA 1ASVA 4CJUA 4M3TA 3NH1A 3I0SA 4CK2A 3OJUA 4ELUA 2QK9A 2YHAA 3V1RA 1CXQA 4FYDA 4DSEA 4M45A 4GW6A 4DTMA 2JLEA 4FK0A 3HPHA 1JL2A 2O4GA 4C8NA 1HNIA 1LWFA 3ZSOA 1FK9A 3OYGA 1KCFA 3RR7A 3HL8A 3KK1A 3OYFA 4CJVA 3LALA 5KGWA 3V1OA 2OPQA 3OJSA 2FBYA 2FBVA 3TANA 1YVUA 3O4QA 4MFBA 2D0CA 1VSIA 1QSLA 3DOLA 4IG0A 1CXUA 2ATQA 3AV9A 4CJLA 3OS2A 1T7PA 1L5UA 1BHLA 4W5QA 1IH7A 1QSSA 3QLHA 2HB5A 2HHUA 1DTTA 4DTPA 1BI4B 2D5RA 2ETJA 4F2RA 2RF2A 1NJYA 4FJMA 4KHYA 4W5NA 1T8EA 3SNNA 4AHUA 4LSNA 3AO4A 2F8TA 4CEZA 1RT4A 4HHTA 1QQCA 3DRRA 5K14A 2WOMA 3S9HA 1S1VA 4DSLA 5HRSA 3AVAA 1BISA 4H4OA 5T7BA 2OYQA 2O4IA 3QINA 3OS1A 4CEOA 3I0RA 2B6AA 5SWMA 3ZCMA 4FXDA 3OVNA 4YFUA 3P83D 3SUNA 4CJ5A 1Q8IA 4CJPA 3OYLA 2PYLA 1TAQA 4DU4A 3VA0A 4NYFA 1NK4A 4CHYA 1XHXA 4OLBA 3VQBA 1WSJA 4CF0A 4NYNA 2DTUA 4BE1A 1XI1A 1Q9YA 3ZT4A 4OPKA 3HO1A 4CJKA 2KFZA 3AVNA 4HUGA 1BIUA 3SUPA 2KFNA 5EU7A 2IGIA 4NCGA 4Y1DA 4B9TA 3ZT3A 4OKJA 3FFIA 4AHTA 3AVIA 4ID1A 4Z4HA 3O3FA 4DSFA 3U3GA 1RTJA 4KFBA 5I42A 4RG8A 2G8VA 3LANA 3NBPA 2OPSA 4AH9A 1NJXA 3SQ0A 3K5NA 1EETA 1ZBUA 3S3NA 4EZ6A 2YKMA 3PV8A 3PY8A 4OGEA 4IFVA 1X9MA 1KTQA 4FLUA 3K5LA 4CIEA 2XRIA 3NF8A 3IG1A 4K8XA 4DU3A 3PX0A 1SKSA 3NH2A 3ZT2A 3HPOA 1VSFA 3P5JA 1C0MA 3SQ4A 5CZ1A 3SQ1A 1FKOA 2XO7A 4GMJB 1HYZA 3SUOA 4KTZA 3OYEA 4LH4A 1NJWA 2IDOA 5HRRA 4N56A 1HRHA 3IAYA 4B9SA 3RMAA 3SYZA 3O4NA 1XHZA 3HP6A 1QHTA 3KK2A 3G0ZA 4BDPA 4J2BA 4DSJA 4BWJA 3BGRA 2XY7A 3QEWA 1TAUA 2BE2A 4RW9A 1ASUA 4CFCA 3QEIA 4KB1A 2HMIA 1KVAA 3SZ2A 4DFJA 4EZ9A 4N47A 3CM5A 4I7FA 5DK5A 4FJGA 3NF9A 3KKSA 2HNZA 4FLZA 2YNGA 2I5JA 5HP1A 5C25A 2JGUA 3MECA 4E19A 1LAVA 2WONA 5C42A 4DFPA 1VSJA 3TWHA 1RTHA 2G8WA 1VSKA 1SL0A 3KJVA 1TK8A 1NK9A 2YKNA 4LD0A 2P51A 3PO5A 4CEQA 4LH5A 3C94A 4G1QA 2VWJA 4FM2A 4B9VA 3LPTA 4KB0A 4I9QA 5FRMA 5HRPA 4CGHA 1U45A 2XY8A 4H4MA 4MQ3A 1UA1A 4KTWA 4FLVA 3EZ5A 4DQIA 4W5TA 3TAEA 3ZSVA 4B08A 5KGXA 2IS3A 3HJFA 3AA3A 3L3UA 5FDLA 4RW7A 3O3GA 3PX6A 2P1JA 4CECA 2HVHA 3O3HA 4CIFA 2VG6A 3KIOA 3RMDA 2Q3SA 2G8KA 4KI4A 4M3YA 1N6QA 3V81A 4FJLA 1HQEA 1RT1A 4CE9A 4FJXA 4CK1A 3DLBA 1C1AA 4QCLA 1NK7A 2OZMA 3C6TA 3CYMA 1RT6A 4DQSA 1EP4A 3QEXA 2HHTA 2XY6A 1JLCA 3HK2A 1C0UA 1ZBLA 3V9UA 1HYVA 2PZSA 1ASWA 1LAWA 4CEBA 4TSXA 1X1PA 4J2DA 4BDZA 3LP2A 3U3YA 3OY9A 3NE6A 1IO2A 1VSLA 1WSIA 1U4BA 2DFFA 4CGFA 1T03A 1S5JA 3K5OA 1BCMA 4L8RB 3WNGA 1VSMA 4N41A 3AVBA 3LP1A 3QERA 4KHUA 3HXMA 3NAEA 3CFPA 2KW4A 2X6SA 2YNIA 3VQ6A 3VQCA 4I9LA 4ICLA 2HHQA 4JS4A 3TAMA 4CHZA 4E7HA 1TKDA 1IKWA 3EYZA 4DTOA 3QEPA 4AHVA 4DSIA 4DG1A 4DMNA 3VQ7A 4CF2A 5KTQA 4OVLA 3K57A 4KAZA 3M8PA 1JLBA 4ID5A 1KVCA 3AVMA 5CY4A 4W5OA 4FLTA 1ZBIA 3RMCA 1Q9XA 4C8LA 2W42A 5CZ2A 1LWCA 3VQ4A 4DF8A 5KRTA 3OYDA 3KK3A 1RDDA 2EHGA 3AO5A 3HP9A 4XIUA 3M8RA 3EY1A 4FJ7A 2KZMA 1FXXA 2DFHA 3L8BA 1BIZA 3TAPA 3ALYA 1HNVA 4FW1A 4DLEA 3HVRA 5JS2A 4B9UA 3T3FA 1C1CA 1BGXT 3AVJA 3TAGA 3ZSXA 4CJRA 5CYMA 4DTSA 3IS9A 5E41A 4CFDA 2Z1HA 3MXMA 1RBUA 3HYFA 1EXQA 4AILC 4ELTA 4FJIA 3OYBA 1WSHA 3WNFA 3QEVA 4CJSA 3LPUA 4IG3A 1BQNA 4O0JA 3DM2A 4OKKA 3WNHA 3S3MA 2A1RA 1JLAA 2G8IA 2G8UA 3SV3A 4M3WA 1NKCA 3OYKA 1A5XA 3NFAA 3PUFA 1G15A 1I3AA 3VN5A 3V4IA 3E01A 4E1MA 4HVJA 4BWMA 3HSTB 4DTUA 1J53A 3QIPA 3PO4A 4JRQA 5KI6A 4KRFA 3M8SA 4CJEA 3SUQA 1D9DA 1R0AA 2D0AA 1QSYA 3ITHA 4CGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J9A A;  2VWK A;  4CFA A;  3CQ8 A;  1NKB A;  1YT3 A;  4M3Z A;  3MEE A;  3LDS A;  1SKW A;  4E7K A;  1HJR A;  3V1Q A;  4CIG A;  5CYQ A;  5FRN A;  1WAJ A;  1VSD A;  4YNQ A;  3ISN C;  3BDP A;  2OZS A;  3DYA A;  1BL3 A;  2X74 A;  1KFS A;  4KI6 A;  4BDY A;  4CJQ A;  4KPY A;  5HBM A;  4M42 A;  4IFY A;  4M3X A;  4QOZ B;  3NGY A;  1RT2 A;  1KRP A;  4FCY A;  4CHP A;  3SPZ A;  3VQA A;  1XC9 A;  4FJH A;  3OS0 A;  1TK0 A;  2ZE2 A;  3NHG A;  1N5Y A;  4CED A;  4N76 A;  1O1W A;  2Z1J A;  3OYH A;  1IKY A;  3KD1 E;  1C6V A;  3D45 A;  3DLH A;  4W5R A;  2QKB A;  2E4L A;  3V9W A;  1BI4 A;  4OKE A;  3RTV A;  1L3S A;  3AVL A;  2D0B A;  4DS5 A;  1WAF A;  3JSM A;  3P1G A;  3F9K A;  4DWI A;  1TL3 A;  2YV0 X;  1S1W A;  1ZYQ A;  3NF7 A;  1JLG A;  1JLF A;  4KTQ A;  2HHW A;  4PWD A;  4DFM A;  1VRU A;  1RTD A;  2FBT A;  3LZJ A;  3NF6 A;  3SCX A;  3DRS A;  3AVG A;  3SV4 A;  2HW3 A;  4FJ9 A;  3DLG A;  4CJW A;  3ULD A;  4PA1 A;  4KO0 A;  4E7I A;  1B9F A;  1SV5 A;  3AO1 A;  4HCC A;  4OPJ A;  3LWL A;  5D3G A;  1B92 A;  4BAC A;  3KKR A;  3LWM A;  2HHV A;  1TGO A;  2QXF A;  3CM6 A;  4FZX C;  4M41 A;  4FJ8 A;  1EKE A;  3TR8 A;  4K8Z A;  4FVM A;  2IC3 A;  4O4G A;  4QAG A;  3MXJ A;  1MU2 A;  1WLJ A;  4N5S A;  4BE2 A;  1VSE A;  4AHR A;  3L2W A;  2E6L A;  1S1U A;  3SPY A;  2Z1I A;  3AVF A;  1F21 A;  1RT5 A;  1QTM A;  1WSF A;  2E6M A;  3KTQ A;  1U48 A;  3L2V A;  5HLF A;  1RDB A;  2OA8 A;  3QES A;  1U04 A;  4CJT A;  4RW8 A;  5SZT A;  1Z25 A;  4J2A A;  1S9E A;  3MED A;  2G8H A;  1CZB A;  3NGZ A;  1D5A A;  5I3U A;  4CHQ A;  4FJ5 A;  2FBX A;  2RKI A;  3OYJ A;  1KFD A;  1TV6 A;  4F4K A;  2BAN A;  4UQG A;  3AVC A;  2NUB A;  1YTU A;  3VQP A;  4CEF A;  3KD5 E;  1JLQ A;  2PYJ A;  3LAM A;  1RCH A;  1TKT A;  5FRO A;  3WNE A;  3ZSR A;  4KV8 A;  4IDK A;  3ZT1 A;  3NCI A;  4F2S A;  1IKX A;  1HPZ A;  3VQE A;  3MEG A;  3T1A A;  1UOC A;  4CGJ A;  3MAQ A;  4Q5V A;  4FM1 A;  3ASM A;  4KHQ A;  4AHS A;  3F73 A;  1W9H A;  1S1T A;  4FK4 A;  1DTQ A;  2BGG A;  4GVM A;  1ITG A;  1S6P A;  3ZSY A;  1BCO A;  1EX4 A;  4FLW A;  1NK8 A;  2OPR A;  3K5M A;  4DS4 A;  4CF9 A;  1JLE A;  1RBV A;  4DSK A;  4DFK A;  1SKR A;  4DTN A;  4CFB A;  1A5V A;  3OYN A;  2F96 A;  4C8O A;  3LP0 A;  4JS5 A;  2GUI A;  2YHB A;  2X6N A;  4B9N A;  4F3O A;  4J2E A;  4I2P A;  3ZSW A;  5J2M A;  3V6D A;  4Y1C A;  3ZSQ A;  2Z1G A;  3PX4 A;  1K6Y A;  2IOC A;  4WE1 A;  2VG5 A;  3HT3 A;  1WSE A;  2GBZ A;  3CFR A;  4DF4 A;  2Y1I A;  3L2R A;  1RBT A;  1DLO A;  4I2Q A;  4E3S A;  3TAR A;  1X9S A;  1U47 A;  3U6F A;  3CG7 A;  3L3V A;  4O5B A;  3VQ9 A;  4F8R A;  4CHN A;  4CF8 A;  3AO2 A;  1RBR A;  1XWL A;  3TAB A;  3A2F A;  5HRN A;  1RT7 A;  4AHC A;  1NK6 A;  1HYS A;  2HND A;  4Z0U A;  3L2U A;  1NKE A;  1D9F A;  4FJJ A;  2F8S A;  2DY4 A;  4JLH A;  4LSL A;  4CGG A;  3VA3 A;  5HRO A;  4DTX A;  4O44 A;  3RRH A;  1GOC A;  2ZQB A;  3KLH A;  4FJN A;  1CZ9 A;  2B4J A;  4O0I A;  3AA4 A;  3LAK A;  3V9Z A;  1WNS A;  3HPG A;  4E7J A;  3TAQ A;  4PUO A;  3T19 A;  2B5J A;  3QO9 A;  4Z4E A;  3SJJ A;  4IKF A;  1RDC A;  1NJZ A;  1YTA A;  4FK2 A;  3DRP A;  4DTR A;  4B8A B;  3K59 A;  2XY5 A;  2YNH A;  3IRX A;  1LWE A;  1U49 A;  1JXE A;  1I39 A;  1IG9 A;  4KHN A;  2FC0 A;  1L3U A;  3DMJ A;  1UWB A;  3NH0 A;  4O55 A;  3RMB A;  4M3R A;  4CEE A;  1SL2 A;  2GV9 A;  4DLG A;  4B3O A;  5J2Q A;  3MXI A;  2YNF A;  2ITG A;  3K58 A;  1NOZ A;  4CJ4 A;  3VQD A;  3DLR A;  3HM9 A;  4E1N A;  2HNY A;  3V9X A;  4NCA A;  5C24 A;  2A1S A;  1JKH A;  1LW0 A;  1WN7 A;  1UAX A;  4RW4 A;  3QNN A;  4Z4I A;  3C95 A;  4H8K A;  1UA0 A;  4KRE A;  1L3T A;  4CCH A;  1WSG A;  2RN2 A;  3G10 A;  3C6U A;  2R7Y A;  1S6Q A;  2DFE A;  3QIO A;  4B9L A;  4IBN A;  4C8M A;  1BQM A;  4Q0B A;  3CFO A;  5DMR A;  1RBS A;  3NGI A;  2BDP A;  2QKK A;  3OYA A;  3THV A;  3DLK A;  1C0T A;  1GOB A;  2PY5 A;  4FJK A;  3TAF A;  3VQ5 A;  2IAJ A;  4ZTJ A;  4DU1 A;  4Z4F A;  3KLG A;  2AJQ A;  1JXB A;  4DQP A;  4HTU A;  4FZY A;  1TKX A;  2ZD1 A;  2OPP A;  4OGC A;  4E89 A;  4DQR A;  4ZHR A;  4ELV A;  1HQU A;  1IKV A;  1VSH A;  1FKP A;  1S1X A;  3B6P A;  2HVI A;  3I8D A;  2LSN A;  1VK0 A;  4PY5 A;  1KLM A;  4CF1 A;  1TL1 A;  4DQQ A;  1QS4 A;  1J54 A;  4ZTF A;  2P5G A;  4E0D A;  4BE0 A;  3OYI A;  2KQ2 A;  4CES A;  3AVH A;  3LP3 A;  1L3V A;  4FW2 A;  1KVB A;  3HVT A;  2Y1J A;  1JL1 A;  3DOK A;  4CEA A;  3UIQ A;  3RWU A;  4PQU A;  4CJ3 A;  2X78 A;  2EX3 A;  3SI6 A;  1GOA A;  1RNH A;  2KTQ A;  3ZT0 A;  1B9D A;  1C1B A;  4CHO A;  2G8F A;  4FZZ A;  3NDK A;  1W0H A;  2HHS A;  1S9G A;  2RPI A;  3DLE A;  1D8Y A;  5J1E A;  1T05 A;  3K2P A;  1CLQ A;  3DI6 A;  1SUQ A;  4CER A;  5J2N A;  4M3U A;  1ZBH A;  1VRT A;  2VG7 A;  4KHS A;  3OYC A;  1HMV A;  4DTJ A;  1TVR A;  4NCB A;  3ZSZ A;  4F3T A;  1RTI A;  4KHW A;  3SQ2 A;  4RW6 A;  3QNO A;  3L2Q A;  4HCB A;  3RR8 A;  4R5P A;  4B9M A;  4CJF A;  1REV A;  2HHX A;  1ZBF A;  4OJR A;  4CGI A;  1SL1 A;  1RIL A;  1RT3 A;  1QE1 A;  4FLX A;  3LZI A;  1LV5 A;  1Z26 A;  3VQ8 A;  4LY7 A;  4EP5 A;  4Z4G A;  4C8K A;  3JYT A;  4OLA A;  4FM0 A;  1RDA A;  3KLE A;  4HUE A;  1NOY A;  3KLI A;  3H08 A;  2P5O A;  2KZZ A;  4Z4C A;  1TK5 A;  1TKZ A;  3TI0 A;  3VQQ A;  3AO3 A;  1KSP A;  3AA2 A;  3OYM A;  4KKO A;  1A5W A;  3M8Q A;  4EP4 A;  1LW2 A;  3S3O A;  4FLY A;  1J5O A;  3RRG A;  5J2P A;  3B6O A;  2XHB A;  4E7L A;  4HUF A;  3QET A;  1X9W A;  1Y97 A;  3V9S A;  5KRS A;  4B8C A;  4CK3 A;  1NK5 A;  4JRP A;  3D0P A;  5JS1 A;  3AVK A;  3AA5 X;  3KLF A;  1NK0 A;  1KLN A;  1ASV A;  4CJU A;  4M3T A;  3NH1 A;  3I0S A;  4CK2 A;  3OJU A;  4ELU A;  2QK9 A;  2YHA A;  3V1R A;  1CXQ A;  4FYD A;  4DSE A;  4M45 A;  4GW6 A;  4DTM A;  2JLE A;  4FK0 A;  3HPH A;  1JL2 A;  2O4G A;  4C8N A;  1HNI A;  1LWF A;  3ZSO A;  1FK9 A;  3OYG A;  1KCF A;  3RR7 A;  3HL8 A;  3KK1 A;  3OYF A;  4CJV A;  3LAL A;  5KGW A;  3V1O A;  2OPQ A;  3OJS A;  2FBY A;  2FBV A;  3TAN A;  1YVU A;  3O4Q A;  4MFB A;  2D0C A;  1VSI A;  1QSL A;  3DOL A;  4IG0 A;  1CXU A;  2ATQ A;  3AV9 A;  4CJL A;  3OS2 A;  1T7P A;  1L5U A;  1BHL A;  4W5Q A;  1IH7 A;  1QSS A;  3QLH A;  2HB5 A;  2HHU A;  1DTT A;  4DTP A;  1BI4 B;  2D5R A;  2ETJ A;  4F2R A;  2RF2 A;  1NJY A;  4FJM A;  4KHY A;  4W5N A;  1T8E A;  3SNN A;  4AHU A;  4LSN A;  3AO4 A;  2F8T A;  4CEZ A;  1RT4 A;  4HHT A;  1QQC A;  3DRR A;  5K14 A;  2WOM A;  3S9H A;  1S1V A;  4DSL A;  5HRS A;  3AVA A;  1BIS A;  4H4O A;  5T7B A;  2OYQ A;  2O4I A;  3QIN A;  3OS1 A;  4CEO A;  3I0R A;  2B6A A;  5SWM A;  3ZCM A;  4FXD A;  3OVN A;  4YFU A;  3P83 D;  3SUN A;  4CJ5 A;  1Q8I A;  4CJP A;  3OYL A;  2PYL A;  1TAQ A;  4DU4 A;  3VA0 A;  4NYF A;  1NK4 A;  4CHY A;  1XHX A;  4OLB A;  3VQB A;  1WSJ A;  4CF0 A;  4NYN A;  2DTU A;  4BE1 A;  1XI1 A;  1Q9Y A;  3ZT4 A;  4OPK A;  3HO1 A;  4CJK A;  2KFZ A;  3AVN A;  4HUG A;  1BIU A;  3SUP A;  2KFN A;  5EU7 A;  2IGI A;  4NCG A;  4Y1D A;  4B9T A;  3ZT3 A;  4OKJ A;  3FFI A;  4AHT A;  3AVI A;  4ID1 A;  4Z4H A;  3O3F A;  4DSF A;  3U3G A;  1RTJ A;  4KFB A;  5I42 A;  4RG8 A;  2G8V A;  3LAN A;  3NBP A;  2OPS A;  4AH9 A;  1NJX A;  3SQ0 A;  3K5N A;  1EET A;  1ZBU A;  3S3N A;  4EZ6 A;  2YKM A;  3PV8 A;  3PY8 A;  4OGE A;  4IFV A;  1X9M A;  1KTQ A;  4FLU A;  3K5L A;  4CIE A;  2XRI A;  3NF8 A;  3IG1 A;  4K8X A;  4DU3 A;  3PX0 A;  1SKS A;  3NH2 A;  3ZT2 A;  3HPO A;  1VSF A;  3P5J A;  1C0M A;  3SQ4 A;  5CZ1 A;  3SQ1 A;  1FKO A;  2XO7 A;  4GMJ B;  1HYZ A;  3SUO A;  4KTZ A;  3OYE A;  4LH4 A;  1NJW A;  2IDO A;  5HRR A;  4N56 A;  1HRH A;  3IAY A;  4B9S A;  3RMA A;  3SYZ A;  3O4N A;  1XHZ A;  3HP6 A;  1QHT A;  3KK2 A;  3G0Z A;  4BDP A;  4J2B A;  4DSJ A;  4BWJ A;  3BGR A;  2XY7 A;  3QEW A;  1TAU A;  2BE2 A;  4RW9 A;  1ASU A;  4CFC A;  3QEI A;  4KB1 A;  2HMI A;  1KVA A;  3SZ2 A;  4DFJ A;  4EZ9 A;  4N47 A;  3CM5 A;  4I7F A;  5DK5 A;  4FJG A;  3NF9 A;  3KKS A;  2HNZ A;  4FLZ A;  2YNG A;  2I5J A;  5HP1 A;  5C25 A;  2JGU A;  3MEC A;  4E19 A;  1LAV A;  2WON A;  5C42 A;  4DFP A;  1VSJ A;  3TWH A;  1RTH A;  2G8W A;  1VSK A;  1SL0 A;  3KJV A;  1TK8 A;  1NK9 A;  2YKN A;  4LD0 A;  2P51 A;  3PO5 A;  4CEQ A;  4LH5 A;  3C94 A;  4G1Q A;  2VWJ A;  4FM2 A;  4B9V A;  3LPT A;  4KB0 A;  4I9Q A;  5FRM A;  5HRP A;  4CGH A;  1U45 A;  2XY8 A;  4H4M A;  4MQ3 A;  1UA1 A;  4KTW A;  4FLV A;  3EZ5 A;  4DQI A;  4W5T A;  3TAE A;  3ZSV A;  4B08 A;  5KGX A;  2IS3 A;  3HJF A;  3AA3 A;  3L3U A;  5FDL A;  4RW7 A;  3O3G A;  3PX6 A;  2P1J A;  4CEC A;  2HVH A;  3O3H A;  4CIF A;  2VG6 A;  3KIO A;  3RMD A;  2Q3S A;  2G8K A;  4KI4 A;  4M3Y A;  1N6Q A;  3V81 A;  4FJL A;  1HQE A;  1RT1 A;  4CE9 A;  4FJX A;  4CK1 A;  3DLB A;  1C1A A;  4QCL A;  1NK7 A;  2OZM A;  3C6T A;  3CYM A;  1RT6 A;  4DQS A;  1EP4 A;  3QEX A;  2HHT A;  2XY6 A;  1JLC A;  3HK2 A;  1C0U A;  1ZBL A;  3V9U A;  1HYV A;  2PZS A;  1ASW A;  1LAW A;  4CEB A;  4TSX A;  1X1P A;  4J2D A;  4BDZ A;  3LP2 A;  3U3Y A;  3OY9 A;  3NE6 A;  1IO2 A;  1VSL A;  1WSI A;  1U4B A;  2DFF A;  4CGF A;  1T03 A;  1S5J A;  3K5O A;  1BCM A;  4L8R B;  3WNG A;  1VSM A;  4N41 A;  3AVB A;  3LP1 A;  3QER A;  4KHU A;  3HXM A;  3NAE A;  3CFP A;  2KW4 A;  2X6S A;  2YNI A;  3VQ6 A;  3VQC A;  4I9L A;  4ICL A;  2HHQ A;  4JS4 A;  3TAM A;  4CHZ A;  4E7H A;  1TKD A;  1IKW A;  3EYZ A;  4DTO A;  3QEP A;  4AHV A;  4DSI A;  4DG1 A;  4DMN A;  3VQ7 A;  4CF2 A;  5KTQ A;  4OVL A;  3K57 A;  4KAZ A;  3M8P A;  1JLB A;  4ID5 A;  1KVC A;  3AVM A;  5CY4 A;  4W5O A;  4FLT A;  1ZBI A;  3RMC A;  1Q9X A;  4C8L A;  2W42 A;  5CZ2 A;  1LWC A;  3VQ4 A;  4DF8 A;  5KRT A;  3OYD A;  3KK3 A;  1RDD A;  2EHG A;  3AO5 A;  3HP9 A;  4XIU A;  3M8R A;  3EY1 A;  4FJ7 A;  2KZM A;  1FXX A;  2DFH A;  3L8B A;  1BIZ A;  3TAP A;  3ALY A;  1HNV A;  4FW1 A;  4DLE A;  3HVR A;  5JS2 A;  4B9U A;  3T3F A;  1C1C A;  1BGX T;  3AVJ A;  3TAG A;  3ZSX A;  4CJR A;  5CYM A;  4DTS A;  3IS9 A;  5E41 A;  4CFD A;  2Z1H A;  3MXM A;  1RBU A;  3HYF A;  1EXQ A;  4AIL C;  4ELT A;  4FJI A;  3OYB A;  1WSH A;  3WNF A;  3QEV A;  4CJS A;  3LPU A;  4IG3 A;  1BQN A;  4O0J A;  3DM2 A;  4OKK A;  3WNH A;  3S3M A;  2A1R A;  1JLA A;  2G8I A;  2G8U A;  3SV3 A;  4M3W A;  1NKC A;  3OYK A;  1A5X A;  3NFA A;  3PUF A;  1G15 A;  1I3A A;  3VN5 A;  3V4I A;  3E01 A;  4E1M A;  4HVJ A;  4BWM A;  3HST B;  4DTU A;  1J53 A;  3QIP A;  3PO4 A;  4JRQ A;  5KI6 A;  4KRF A;  3M8S A;  4CJE A;  3SUQ A;  1D9D A;  1R0A A;  2D0A A;  1QSY A;  3ITH A;  4CGD A; 
#chains in the Genus database with same CATH topology
 2VWB A;  2QWL A;  2VWK A;  3CQ8 A;  3A5M C;  4AQY K;  4BRP A;  4FWK A;  2Q31 A;  3MEE A;  2QWR A;  1HJR A;  4IFE A;  5FRN A;  3CQY A;  3ISN C;  2OZS A;  2X74 A;  3PSI A;  1KFS A;  4M42 A;  4IFY A;  2F4V K;  3NGY A;  1NGJ A;  4CHP A;  3VQA A;  4FJH A;  1TK0 A;  2PBD A;  2ZE2 A;  2RE2 A;  5BRD A;  3DLH A;  2E4L A;  1BI4 A;  4NB4 A;  3RTV A;  4B1Z A;  4IEE A;  3AVL A;  3C6H A;  3F9M A;  3GG4 A;  1JLG A;  4PWD A;  4DFM A;  3LZJ A;  3SCX A;  3AVG A;  4FJ9 A;  4DUZ K;  2P9N B;  3DLG A;  3ULD A;  4KO0 A;  3D2F B;  1FJG K;  5D3G A;  1B92 A;  2E88 A;  4M41 A;  4FJ8 A;  2P9P B;  2QXL A;  5KQ8 A;  4FVM A;  3LDP A;  1ZXO A;  4BR4 A;  1QTM A;  2A3Z A;  2NRW A;  5FPN A;  4YHH K;  3O6W A;  3MN6 A;  1NMD A;  3QES A;  4CJT A;  4J2A A;  3LM2 A;  3UKR A;  2ZJP L;  4FJ5 A;  2FBX A;  3OYJ A;  4UQG A;  3AVC A;  3MX2 A;  1YTU A;  4O8U A;  3BDP A;  4KV8 A;  1IKX A;  4H5N A;  3MEG A;  3T1A A;  2Q2R A;  4H5T A;  4Q5V A;  3ASM A;  1NGF A;  3F73 A;  4KHQ A;  4FK4 A;  3H1Q A;  2BGG A;  4WFB L;  1BCO A;  3K5M A;  4CF9 A;  1RBV A;  3EE9 A;  3AAR A;  4JS5 A;  4J2E A;  3T1Y K;  3ZSW A;  3ZSQ A;  3O9R A;  3PX4 A;  2IOC A;  1ZBI A;  1WSE A;  4X65 K;  2Y1I A;  3O8M A;  1RBT A;  4E3S A;  1BA1 A;  4FWM A;  3AO2 A;  1K73 O;  1XWL A;  4WCE L;  3K9K A;  3A2F A;  1NBW A;  2VCP A;  2KKZ A;  1HYS A;  3L2U A;  4Z0U A;  3PSF A;  1S3X A;  4JLH A;  5AQG A;  1BDG A;  3ULE A;  4O44 A;  3KLH A;  1V4T A;  3UKU B;  5JLH A;  4O0I A;  4A59 A;  4GNI A;  3VF4 A;  1WNS A;  3CJC A;  3T19 A;  4IKF A;  1RDC A;  4FK2 A;  4BRM A;  4R79 A;  2XY5 A;  1HNZ K;  1I39 A;  1Y64 A;  4BRE A;  3O9Q A;  4YOY A;  3H6E A;  4DV0 K;  5FLX O;  2NRZ A;  4GV6 A;  1MWM A;  2GV9 A;  1Q81 O;  4B3O A;  2ITG A;  2QW9 A;  3VQD A;  5BRF A;  3HM9 A;  2NRR A;  3AGK A;  1IJJ A;  3O1B A;  3QNN A;  3C95 A;  1UA0 A;  3MMV A;  1L3T A;  1T44 A;  1WSG A;  3A0I X;  3C6U A;  2DFE A;  3FZK A;  3ZX2 A;  4IBN A;  2O8C B;  2VQF K;  3THV A;  5KPR A;  2PY5 A;  4ZTJ A;  3BF1 A;  2VQE K;  4Z4F A;  5KPZ A;  1N32 K;  4JI4 K;  4DQP A;  3P31 A;  1N8R O;  4E89 A;  4OGC A;  4DQ8 A;  1OVY A;  1HQU A;  1VSH A;  1FKP A;  1S1X A;  3I8D A;  1X9J A;  3TSQ A;  1VK0 A;  1YUW A;  4PY5 A;  2P9I A;  1QS4 A;  1J54 A;  4ZTF A;  2CGL A;  1S72 N;  1SS6 A;  4H5W A;  4CES A;  4FW2 A;  2Y1J A;  1JL1 A;  4CEA A;  3VEZ A;  2P9S B;  4PQU A;  2EX3 A;  3SI6 A;  1GOA A;  2KTQ A;  1P8Z A;  2KHO A;  3EN9 A;  3O9U A;  1NU0 A;  3DI6 A;  3AAQ A;  1SQK A;  1VRT A;  2D4W A;  1HMV A;  4BGA A;  4KHW A;  3SQ2 A;  4JK7 A;  3ENO A;  4NLB A;  1SL1 A;  3SMP A;  3U9Z A;  3LZI A;  2V51 B;  4C8K A;  3JYT A;  4JI2 K;  5C12 A;  1HPM A;  3FLC O;  5EX5 A;  1TKZ A;  3VQQ A;  3AO3 A;  3OYM A;  4HTL A;  4KKO A;  3E1Y A;  4MLH A;  1X9W A;  3V9S A;  1E4G T;  4B8C A;  4JKC A;  3CCL N;  3WXM B;  3AA5 X;  3KLF A;  5DM7 L;  2ZJR L;  3TTC A;  3NH1 A;  3I0S A;  4ELU A;  3V1R A;  4FYD A;  2FF3 B;  4M45 A;  4DTM A;  4UY8 O;  3ID6 A;  4YOT A;  5C10 A;  1JL2 A;  4C8N A;  4K41 A;  1BU6 O;  1FK9 A;  3OYG A;  3VGL A;  3HL8 A;  2OPQ A;  3OJS A;  2FBY A;  3TAN A;  2GEM A;  4MFB A;  3DOL A;  1XUP O;  4IJA A;  2ATQ A;  1MDU B;  4CJL A;  1T7P A;  1L5U A;  1BHL A;  2RHK A;  1IH7 A;  1BI4 B;  1KD1 O;  3BEX A;  4F2R A;  3EKU A;  3SNN A;  4AHU A;  2P9K A;  1QQC A;  5K14 A;  2W6L A;  4DSL A;  5HRS A;  4CZJ A;  1BIS A;  4O5F A;  3QDK A;  2W6K A;  2O4I A;  1G99 A;  3I0R A;  2B6A A;  5SWM A;  4FXD A;  4CJ5 A;  1Q8I A;  1YHQ N;  2PYL A;  4DU4 A;  3VA0 A;  4LF8 K;  2DTU A;  3CI5 A;  1Q9Y A;  2E2O A;  4OPK A;  2GEL A;  2KFZ A;  4HUG A;  2NZT A;  5AQZ A;  4CI6 A;  2KFN A;  3VMF B;  4CZF A;  4Y1D A;  2A40 A;  3FFI A;  3AVI A;  4ID1 A;  2OTL N;  4ILH A;  4C1N K;  4KFB A;  5I42 A;  4RG8 A;  4Y0W A;  4BY9 C;  1NJX A;  4EZ6 A;  4RWT A;  1EET A;  3PV8 A;  4LF5 K;  3K5L A;  2HOE A;  2XRI A;  2WUS A;  1IBL K;  4DU3 A;  3ZT2 A;  3SQ1 A;  1FKO A;  2XO7 A;  4GMJ B;  1N36 K;  1NJW A;  2P9L B;  5BRE A;  1XMQ K;  2IVP A;  3FR0 A;  4X64 K;  3CER A;  4DSJ A;  3SLC A;  3QEW A;  3FZL A;  3QEI A;  1VHX A;  2UYT A;  5HL7 L;  2QWQ A;  3SMS A;  4EZ9 A;  4FJG A;  3CXC M;  3KKS A;  4IEI A;  4FLZ A;  2YNG A;  1VQ8 N;  3MEC A;  2WON A;  5C42 A;  2HBM A;  1RTH A;  2ZGZ A;  3KHY A;  1SL0 A;  2I7N A;  3PO5 A;  4CEQ A;  2YHW A;  4FM2 A;  2J4R A;  4FWR A;  5FRM A;  2WBN A;  1EO1 A;  2XY8 A;  3TAE A;  4B08 A;  1QQO A;  3AA3 A;  3O3G A;  5E26 A;  2P1J A;  2E20 A;  4CIF A;  2Q3S A;  3CF5 L;  3V81 A;  1RT1 A;  3DLB A;  1C1A A;  2Q0U A;  2ZJQ L;  4BRI A;  3EO3 A;  5C2D A;  3HK2 A;  5AQV A;  4B1Y B;  1OH8 A;  1LAW A;  3LP2 A;  4EIA A;  3OY9 A;  1T03 A;  1IO2 A;  2O8B B;  3K5O A;  4CZM A;  3AVB A;  3QER A;  4XH1 A;  1XMO K;  2YHX A;  1ATN A;  2O8F A;  1EWR A;  4DMN A;  3NMU A;  4NCA A;  5CY4 A;  3AVM A;  1V4S A;  4W5O A;  3Q7B A;  1Q9X A;  4C8L A;  5EVZ A;  3VQ4 A;  4FPB A;  4XEI A;  1RDD A;  3AO5 A;  5FPD A;  4XIU A;  3EY1 A;  1GLC G;  3TAP A;  3L8B A;  1BIZ A;  3HI0 A;  4DLE A;  3MCA B;  3ZSX A;  5CYM A;  4FVU A;  5E41 A;  4CFD A;  2F7T A;  1RBU A;  4XH5 A;  1K9M O;  1EXQ A;  4AIL C;  3CMA N;  3JS6 A;  3QEV A;  4CJS A;  3LPU A;  4AM7 A;  1BQN A;  4O0J A;  3DM2 A;  4OKK A;  5BR9 A;  2ZM6 K;  2G8U A;  1NKC A;  2A41 A;  5TKW A;  1A5X A;  1WBD A;  4BWM A;  5KI6 A;  4KRF A;  4BR5 A;  3M8S A;  4CJE A;  3SUQ A;  5AQF A;  2D0A A;  5M1P A;  4BRG A;  1J9A A;  1NKB A;  4M3Z A;  2VGN A;  3LDS A;  4H0P A;  4JHD A;  5CYQ A;  1WAJ A;  4YNQ A;  4GY2 B;  5F0X A;  4KI6 A;  2V7Y A;  3CC7 N;  4CJQ A;  5AQH A;  3VGM A;  4BC4 A;  3NHG A;  3KD1 E;  3OYH A;  1IKY A;  1C6V A;  3D45 A;  2HMP A;  4W5R A;  3DXK B;  3KK7 A;  4OKE A;  3R6M A;  4DS5 A;  4JEP A;  3P1G A;  3F9K A;  4DWI A;  1TL3 A;  1S1W A;  3KVG A;  3NF7 A;  2HHW A;  3D7E O;  2FBT A;  3NF6 A;  4JNE A;  3SV4 A;  2HW3 A;  4FPA A;  4CJW A;  4JKA A;  4PA1 A;  3H46 O;  4HCC A;  3AO1 A;  4OPJ A;  2Q36 A;  2UXD K;  1TGO A;  2QXF A;  3CM6 A;  4H03 B;  2BUP A;  4DV3 K;  4BVP A;  4K8Z A;  3ENH A;  1MU2 A;  1WLJ A;  4BE2 A;  3SAG A;  4AHR A;  3L2W A;  3CCQ N;  1S1U A;  3SPY A;  2Z1I A;  3CJ9 A;  4JKH A;  1WSF A;  3KTQ A;  3N4Q A;  4KBO A;  1XC3 A;  3L2V A;  4K0K K;  5HLF A;  3WEE A;  2OA8 A;  1U04 A;  2PAV A;  5LL6 Z;  1MWK A;  3WQT A;  2IVN A;  3CJB A;  4JI6 K;  1GLB G;  1HNX K;  4CZE A;  2BAN A;  2OCE A;  1K8K A;  2Q1N A;  2H3G X;  4BRL A;  1KQS M;  1KAX A;  4AHS A;  3QFP A;  1DTQ A;  1HUX A;  4JI5 K;  3ZSY A;  5JVH L;  4MDA A;  1YAG A;  4JKD A;  1SKR A;  4DTN A;  2F96 A;  4C8O A;  2X6N A;  4B9N A;  4F3O A;  4I2P A;  2E1Z A;  4BVO A;  5J2M A;  4Y1C A;  3HT3 A;  3LM9 A;  2GBZ A;  3U6F A;  3CG7 A;  1M1K O;  4O5B A;  3VQ9 A;  4BC5 A;  4CHN A;  4F8R A;  4A61 A;  1C0F A;  2ITM A;  3LDO A;  1NGE A;  4M63 C;  3PLA A;  5EY4 A;  1Z6R A;  1NK6 A;  3RSE B;  1OVQ A;  2DY4 A;  5AZJ B;  4JD2 A;  1KAZ A;  3VEY A;  3VA3 A;  4DTX A;  3MX5 A;  3RRH A;  1GOC A;  2ZQB A;  4U7B A;  4FJN A;  2B4J A;  4IO9 L;  5HOO A;  1VQK N;  3QBX A;  3W0L A;  2B5J A;  3RVC A;  2O8E B;  3DRP A;  3SAH A;  3K59 A;  3IRX A;  1LWE A;  3DMJ A;  4JN4 A;  4O55 A;  4DLG A;  4DV7 K;  5J2Q A;  3J80 O;  3C0B A;  3K58 A;  3AGR A;  3J7Z O;  4DR1 K;  2UXC K;  1LW0 A;  4RW4 A;  2JWK A;  1HR0 K;  1DKG D;  3VEX A;  4LF4 K;  1S6Q A;  3QIO A;  4PKH A;  1BQM A;  3CFO A;  3M1F A;  3OYA A;  2HF4 A;  3TAF A;  3VQ5 A;  2IAJ A;  3FZM A;  3DXM A;  3KLG A;  1JXB A;  1TYQ A;  2Q97 A;  3CJ1 A;  2ZD1 A;  5FPE A;  4ZHR A;  2V7Z A;  2HVI A;  5BN8 A;  3B6P A;  3MCP A;  2LSN A;  2ASO A;  1Q82 O;  1N34 K;  5ADX A;  2KQ2 A;  1L3V A;  3HVT A;  3DOK A;  4CJ3 A;  4ILJ A;  1C1B A;  3NDK A;  3ENB A;  4JYA K;  3J81 O;  4CVN E;  3H45 C;  5J1E A;  2ZF5 O;  1CLQ A;  2O8F B;  4DTJ A;  3K9J A;  4RW6 A;  3L2Q A;  1VQ5 N;  3ZEU B;  4B9M A;  3SJH A;  2ASP A;  3SK3 A;  1Z26 A;  1BO5 O;  4EP5 A;  1QZ6 A;  4CBW A;  4FM0 A;  4HUE A;  3WT0 A;  3H08 A;  1VAZ A;  2KZZ A;  2O8D A;  4WF9 L;  1LW2 A;  4FLY A;  1N33 K;  4HUF A;  3QET A;  4CK3 A;  4BRO A;  2E2N A;  1IV0 A;  4BRH A;  3AVK A;  4M3T A;  2QWN A;  1ASV A;  2QK9 A;  4CK2 A;  3OJU A;  3TPQ A;  3VPZ A;  1CXQ A;  4A2A A;  4DSE A;  4GW6 A;  2IVO A;  3ZET A;  1J6Z A;  4JK8 A;  1LOT B;  3JXU A;  3KWI A;  1GLA G;  4DR5 K;  1KCF A;  1SAZ A;  3OYF A;  1TUU A;  3G25 A;  3LAL A;  1YVU A;  3O4Q A;  3O9S A;  1VSI A;  1QSL A;  5AZI A;  4IG0 A;  3F5T A;  5ELZ A;  1OH6 A;  3ZLJ A;  2HHU A;  1DTT A;  4DTP A;  2D5R A;  3EKS A;  3BZC A;  2RF2 A;  4FJM A;  4W5N A;  1T8E A;  3LL3 A;  3AO4 A;  5FPM A;  2V52 B;  1RT4 A;  3DRR A;  4ILG B;  3QIN A;  3DWL A;  1YF5 L;  1NG9 A;  1NJI O;  4XH4 A;  4CEO A;  5F2R A;  3ZCM A;  3THX A;  4ISG A;  3BY5 A;  2VGM A;  1NK4 A;  4U67 L;  3W3D A;  1BUP A;  1WSJ A;  1YVN A;  4CF0 A;  1XI1 A;  4CJK A;  3S41 A;  5AQY A;  3CPW M;  4B9T A;  4NCG A;  3P4I A;  3ZT3 A;  4X66 K;  3G6E N;  1XQS C;  3NBP A;  2OPS A;  4AH9 A;  3S3N A;  3PY8 A;  3THY B;  1X9M A;  5KPT A;  4FLU A;  3FZH A;  1ZBS A;  3PX0 A;  3P5J A;  3SQ4 A;  5CZ1 A;  2IIR A;  3M3Z A;  4CZI A;  2IDO A;  4JK9 A;  4JKG B;  1HRH A;  3IAY A;  4CD1 A;  4OX9 K;  1K8K B;  3M6G A;  4BDP A;  2CGK A;  4BWJ A;  3BGR A;  4PKG A;  3CCU N;  3IDH A;  5AQT A;  4RW9 A;  4WFA L;  4BRC A;  3AAP A;  4DFJ A;  3ATU A;  5DK5 A;  4I7F A;  4MDB A;  4BQZ A;  2HNZ A;  1XNR K;  5HP1 A;  2JGU A;  3L0Q A;  4LC9 B;  3TWH A;  2G8W A;  1VSK A;  1TK8 A;  3EE8 A;  2P51 A;  4BG8 A;  4LH5 A;  5M1F A;  5HRP A;  4CGH A;  4H4M A;  4MQ3 A;  4KTW A;  1WB9 A;  3EZ5 A;  4W5T A;  3L3U A;  3D2E B;  3I33 A;  4RW7 A;  3PX6 A;  4FOI A;  4KI4 A;  4JD2 B;  4M3Y A;  1VQ6 N;  3THW A;  1N6Q A;  4FJL A;  4CE9 A;  4QCL A;  1W2B M;  4CK1 A;  1YI2 N;  1NK7 A;  4FOE A;  2OZM A;  3C6T A;  3KWG A;  1RT6 A;  3I8B A;  4DQS A;  3C6A A;  3BP8 A;  2GUP A;  3VEV A;  1C0U A;  4JI1 K;  1ZBL A;  4MLE A;  1HYV A;  5MLC Q;  1ASW A;  2WFB A;  4J2D A;  3VTH A;  5AQU A;  1DGK N;  1VSL A;  1NGC A;  2DFF A;  3PIO L;  4LF6 K;  3U9D A;  4L8R B;  5C15 A;  4GV9 A;  4DR7 K;  2X6S A;  1E4F T;  2YNI A;  1I94 K;  5AQL A;  4I9L A;  2HHQ A;  1OH7 A;  4JS4 A;  3EYZ A;  4DSI A;  2UU9 K;  4DG1 A;  3ZYY X;  4CF2 A;  5KTQ A;  3QB0 A;  3K57 A;  3M8P A;  3A5L C;  4BRN A;  4DV1 K;  3CCR N;  2W42 A;  3K0S A;  1LWC A;  4DF8 A;  5KRT A;  4H0Y B;  2KZM A;  3TTF A;  1NGI A;  3WXL A;  4ISE A;  1R59 O;  5GAH P;  3M8R A;  3VET A;  5GIN A;  2P9U A;  2E2Q A;  3ALY A;  3SBT A;  4B9U A;  3T3F A;  1C1C A;  1TYQ B;  4CJR A;  4DTS A;  3GBT A;  1GLE G;  4FJI A;  3OYB A;  1WSH A;  5LJV A;  4C23 A;  2G8I A;  3VF6 A;  3SV3 A;  4BR2 A;  5AR0 A;  3NFA A;  1KC8 O;  1G15 A;  3V4I A;  3HST B;  1E3M A;  4JRQ A;  4YOU A;  4YY3 K;  1KXP A;  3LDQ A;  2CGJ A;  5B8H A;  3ITH A;  4CGD A;  4FL9 A;  4K25 A;  4CFA A;  1YT3 A;  5AJ3 K;  4KH6 A;  1NGB A;  4KH5 A;  1SKW A;  4CIG A;  3VEO A;  2D0P A;  1NGG A;  4K43 A;  1OH5 A;  3UKR B;  5KQD A;  3C7N A;  3CCM N;  4BDY A;  4KPY A;  5HBM A;  3EZW A;  4M3X A;  5AQO A;  1ATS A;  4QOZ B;  2CH6 A;  4B9Q A;  4CZK A;  4FCY A;  1XC9 A;  4LFC K;  3A8Y A;  3OS0 A;  3DAW A;  4CED A;  5EOY A;  2HBJ A;  4H5V A;  2QKB A;  4IDH A;  1L3S A;  4X62 K;  5C2F A;  1WAF A;  1QQM A;  2QM1 A;  3L4I A;  2YV0 X;  2HF3 A;  1ZYQ A;  1JLF A;  1VRU A;  1RTD A;  3DRS A;  2UUA K;  1QQN A;  4PL7 A;  3LWL A;  3GOI A;  2E8A A;  4BAC A;  4BC3 A;  2FLO A;  2AP1 A;  3MXJ A;  1VSE A;  2E6L A;  1F21 A;  1RT5 A;  4I6M A;  1U48 A;  3M5R A;  4QS8 A;  1IBK K;  1RDB A;  4OPA A;  5AZI B;  2QTD A;  3ULE B;  1OKJ A;  5GAG P;  4RW8 A;  1S9E A;  3NGZ A;  5BN9 A;  1D5A A;  4IOA L;  4CHQ A;  2RKI A;  5AQK A;  2NUB A;  2YJF A;  4AM6 A;  1JLQ A;  3CQX A;  1GLJ O;  2PYJ A;  3LAM A;  5FRO A;  3EEQ A;  4F2S A;  4IDK A;  1HPZ A;  4NXN K;  1UOC A;  3MAQ A;  3THX B;  4FM1 A;  3HRG A;  4B1W B;  3VTI A;  4GKK K;  5TKY A;  1EX4 A;  4DB3 A;  1NK8 A;  2OPR A;  1XNQ K;  2A6A A;  3AY9 A;  4FO0 A;  4CFB A;  1A5V A;  3OYN A;  2GWK A;  3LP0 A;  2GUI A;  2YHB A;  3GDQ A;  4KH4 A;  2P9N A;  4A62 A;  4BRA A;  2Z1G A;  1K6Y A;  3D2F A;  4WE1 A;  4DF4 A;  1YJW N;  1DLO A;  4I2Q A;  3TAR A;  2A5X A;  3L3V A;  5AQM A;  3CET A;  1IG8 A;  1DT9 A;  4RTF D;  1RBR A;  5AQS A;  3P39 A;  4PKI A;  1RT7 A;  3P38 A;  5F1X A;  2HND A;  5LJW A;  1NKE A;  1D9F A;  1CZA N;  3CCE N;  4FJJ A;  4CGG A;  5HRO A;  1NNE A;  4B3T K;  2P9I B;  5BR8 K;  4FWS A;  4CD3 A;  2ASM A;  5JVG L;  4FWL A;  3LAK A;  3V9Z A;  4E7J A;  4PUO A;  5AFU H;  4JI7 K;  3QO9 A;  4Z4E A;  3SJJ A;  1VQM N;  1EQY A;  4H0T B;  4BR9 A;  4DTR A;  4B8A B;  1JXE A;  5AFU A;  2FC0 A;  4EHU A;  3NH0 A;  2PFU A;  3Q7C A;  4CZL A;  4M3R A;  4CEE A;  3MXI A;  4CJ7 A;  3GE1 A;  3QBW A;  1T6C A;  4H0O A;  5JIC A;  5C24 A;  1JKH A;  2A1S A;  1ZBH A;  1UAX A;  4OO1 J;  4H8K A;  3CJA A;  4L3Q A;  4CCH A;  2NRT A;  4BQL A;  3G10 A;  1WUA A;  4B9L A;  3O80 A;  3MN5 A;  5DMR A;  3THW B;  3NGI A;  2QKK A;  1GOB A;  1HJO A;  2ZGY A;  4DU1 A;  2AJQ A;  4HTU A;  2E2P A;  4FZY A;  1TKX A;  2OPP A;  4ELV A;  2NNW A;  5M1O A;  5GAE P;  5DM6 L;  4CF1 A;  4DQQ A;  3J7Y P;  3OYI A;  3H3O B;  3R8E A;  3AVH A;  3LP3 A;  1KVB A;  2X78 A;  1RNH A;  3ZT0 A;  1B9D A;  4CHO A;  2G8F A;  1BOT O;  4FZZ A;  4JI0 K;  2RPI A;  1NGH A;  1D8Y A;  4LFA K;  1ESV A;  4WQ5 A;  1T05 A;  1SUQ A;  4CER A;  1NGD A;  3QIC A;  4DKW A;  3R1X A;  1WBB A;  3OYC A;  4KHS A;  4V19 S;  1EWQ A;  1ZC6 A;  4F3T A;  1RTI A;  3OHR A;  2P9K B;  3L6Q A;  5BPN A;  4HCB A;  2HHX A;  1ZBF A;  4CGI A;  2YX6 A;  1RIL A;  1RT3 A;  3NVM A;  1LV5 A;  3VQ8 A;  5JMV A;  4LF7 K;  3LDL A;  3KLI A;  3MDQ A;  3WXJ A;  4Z4C A;  1TK5 A;  1KSP A;  3AA2 A;  1A5W A;  4IWV A;  3RRG A;  2XHB A;  1C0G A;  5CHI A;  1NK5 A;  1VQ4 N;  3D0P A;  1KLN A;  3CPE A;  5CE3 A;  2JLE A;  4M7X A;  4DUY K;  3HPH A;  2O4G A;  2P9S A;  1LWF A;  3WXI A;  3ZSO A;  3RR7 A;  3KK1 A;  4CJV A;  5KGW A;  3U8X A;  1JCF A;  2D0C A;  4A5B A;  2QWO A;  3AV9 A;  3QLH A;  2HB5 A;  3O4W A;  2ETJ A;  1NJY A;  4LSN A;  2F8T A;  4CEZ A;  4EHT A;  4HHT A;  1YJ9 N;  2UUB K;  1U2V A;  4H4O A;  1P90 A;  2GX9 A;  2D0O A;  1SZ2 A;  3OVN A;  4YFU A;  3SUN A;  1TAQ A;  4IO8 A;  4NYF A;  3OBW A;  4EFH A;  4OLB A;  3VQB A;  4BE1 A;  1GLL O;  3SUP A;  2IGI A;  4GKJ K;  3O3F A;  1M90 O;  4Z4H A;  4DSF A;  1RTJ A;  2G8V A;  4I6M B;  3U4L A;  5H1S Q;  1BG3 A;  3K5N A;  4OGE A;  4OPH A;  4CIE A;  3NF8 A;  2UXB K;  3R3L A;  1SKS A;  3JAM O;  1VSF A;  5GIP A;  1Q7Y O;  3SAF A;  4LH4 A;  5HRR A;  5ADX H;  4N56 A;  2CH5 A;  2EWS A;  3VF2 A;  1MA9 B;  3RMA A;  5AQX A;  3IKM A;  4YOX A;  3O4N A;  5CR4 A;  4DV4 K;  1QHT A;  2WC9 A;  4J2B A;  1QZ5 A;  3QFU A;  1TAU A;  2HHH K;  4FWO A;  4CFC A;  4KB1 A;  2D1K A;  1KVA A;  3SZ2 A;  2YHY A;  3CM5 A;  4YOW A;  4CW7 B;  2WTU A;  5M1K A;  2BTF A;  2QA4 N;  2NLX A;  5C25 A;  5IT9 O;  2VYP A;  5AQI A;  1BA0 A;  1LAV A;  3E66 A;  3A5O C;  3CD6 N;  3KJV A;  4LD0 A;  3CC2 N;  4G1Q A;  2VWJ A;  4I9Q A;  3LPT A;  2GTD A;  3TU5 A;  1UA1 A;  3A5N C;  4LF9 K;  3TSP A;  4DQI A;  1O13 A;  5FDL A;  5LMN K;  4CEC A;  2VG6 A;  3KIO A;  3RMD A;  3QML A;  2Q0R A;  5GAD P;  1HQE A;  4FJX A;  4BC2 A;  3CCJ N;  3CYM A;  2HST A;  2XY6 A;  4H5R A;  3V9U A;  2P9L A;  2PZS A;  4CEB A;  4F9O A;  3HTV A;  3O1W A;  4CGF A;  4YOV A;  1KAY A;  2F9W A;  1HKB A;  3J8A A;  1NM1 A;  4JHD B;  3WNG A;  3LP1 A;  4KHU A;  3HXM A;  3NAE A;  3CFP A;  2KW4 A;  1HX1 A;  2KLA A;  3MN7 A;  4JKF A;  4ICL A;  4CHZ A;  4E7H A;  3H1V X;  4BG9 A;  1Z05 A;  3VQ7 A;  4OVL A;  4ID5 A;  4FLT A;  3VES A;  3WUH A;  3KK3 A;  3HP9 A;  1Q86 O;  2FXU A;  1FXX A;  2DFH A;  3ATV A;  4FW1 A;  3HVR A;  5JS2 A;  1BGX T;  4QS9 A;  3R9P A;  3IS9 A;  1FW6 A;  2YI1 A;  2Z1H A;  5BPL A;  3MXM A;  1T6D A;  3HYF A;  1RGI A;  3WNF A;  4JKE A;  4WYB A;  3HOS A;  2A1R A;  1JLA A;  4M3W A;  4MO5 A;  3TSU A;  3PUF A;  1I3A A;  3E01 A;  4E1M A;  3T69 A;  4HVJ A;  1JCE A;  2NRH A;  1J53 A;  1Q18 A;  4LFB K;  1QSY A;  5E84 A;  3WEE B;  2O8B A;  4WQ5 C;  4A57 A;  4E7K A;  3OW2 M;  3V1Q A;  4J8F A;  1VSD A;  3DYA A;  1BL3 A;  2YCH A;  4PHT X;  3BUZ B;  1RT2 A;  1HKG A;  1KRP A;  2HBK A;  3SPZ A;  1N5Y A;  1DEJ A;  4N76 A;  3H3N O;  1O1W A;  2Z1J A;  1LCU A;  3V9W A;  2DPN A;  4CBU A;  2D0B A;  4BR7 A;  3JSM A;  4IXC A;  4KTQ A;  4H0V B;  3O5B A;  3PIP L;  1QVG M;  2FF6 A;  2OTJ N;  4IOC L;  1ILY A;  4E7I A;  1B9F A;  1SV5 A;  4YDU A;  3ID8 A;  2YJE A;  3KKR A;  3LWM A;  2HHV A;  4FZX C;  1EKE A;  3TR8 A;  4O8K A;  3CME N;  3BZK A;  2IC3 A;  4O4G A;  4QAG A;  4N5S A;  3AVF A;  5AQQ A;  2E6M A;  4QS7 A;  1NMN A;  3G4S N;  5SZT A;  1Z25 A;  2G8H A;  3MED A;  1CZB A;  5I3U A;  4EAH D;  1KFD A;  1TV6 A;  4F4K A;  1YJN N;  3CIP A;  3VQP A;  1U2V B;  4GVE A;  4NO7 A;  4CEF A;  3CCS N;  3KD5 E;  3ZSR A;  1RCH A;  1TKT A;  3WNE A;  3NCI A;  3ZT1 A;  3VQE A;  3DXK A;  4CGJ A;  2QWM A;  5BRH A;  1W9H A;  1S1T A;  5LMU K;  4GVM A;  5M1Q A;  1ITG A;  1S6P A;  4FLW A;  4DS4 A;  1JLE A;  4DSK A;  4DFK A;  3HM8 A;  3KZB A;  4WQ4 C;  4YOR A;  3V6D A;  5A2Q O;  1NGA A;  2VG5 A;  3CFR A;  3L2R A;  1RFQ A;  4E1J A;  1X9S A;  1U47 A;  3DXM B;  4CF8 A;  4NXM K;  4MO4 A;  3TAB A;  1W97 L;  5HRN A;  4AHC A;  4B1V A;  2AA4 A;  1W7A A;  1VQN N;  2F8S A;  1ATR A;  4LSL A;  3MWP A;  3CJ7 A;  3L4Q A;  5BPM A;  1RDU A;  1CZ9 A;  2W40 A;  3AA4 A;  4A2B A;  1GLD G;  1X3N A;  3TAQ A;  3HPG A;  1VQ7 N;  2FSJ A;  2NRX A;  4Z94 A;  1NJZ A;  3OBY A;  1YTA A;  1HKC A;  2YNH A;  1U49 A;  1IG9 A;  4KHN A;  1L3U A;  1UWB A;  3RMB A;  1SL2 A;  3VGK A;  1D4X A;  2YNF A;  1NOZ A;  3T7Z A;  4CJ4 A;  3DLR A;  1NWK A;  5EXW A;  3CCV N;  4E1N A;  2HNY A;  3V9X A;  3VEN A;  1WN7 A;  4Z4I A;  1K8A O;  3TTD A;  4KRE A;  2RN2 A;  2R7Y A;  3NVK A;  4ISF A;  4C8M A;  4Q0B A;  2O8D B;  1RBS A;  2BDP A;  3DLK A;  1C0T A;  3GL1 A;  4FJK A;  1S22 A;  1YXQ A;  3OTO K;  5C0Y A;  3RSE A;  4DQR A;  2E5L K;  2A42 A;  5AZJ A;  1IKV A;  1KLM A;  2UUC K;  1TL1 A;  3FGU A;  3WQU A;  3ZET B;  2P5G A;  3E9P A;  4E0D A;  4BE0 A;  3MN9 A;  3RWU A;  3HOT A;  3UIQ A;  3CHW A;  5AQJ A;  4B3R K;  1VQL N;  2O8E A;  1W0H A;  2HHS A;  1S9G A;  3MWT A;  3DLE A;  2HBL A;  4DV6 K;  4DR2 K;  2W41 A;  3K2P A;  5J2N A;  4M3U A;  3OA9 A;  2VG7 A;  1JCG A;  2ZWH A;  1TVR A;  4NCB A;  3IUC A;  3ZSZ A;  2GWJ A;  2NRV A;  3QNO A;  2JWL A;  4K42 A;  3RR8 A;  4R5P A;  4CJF A;  1REV A;  4OJR A;  4B3M K;  3J7A P;  1QE1 A;  4FLX A;  1VQ9 N;  4DCH A;  4LY7 A;  3B8A X;  4Z4G A;  4OLA A;  1RDA A;  3KLE A;  1NOY A;  2QWP A;  2P5O A;  3T1H K;  3G71 N;  3HBT A;  3TI0 A;  3M8Q A;  4EP4 A;  3S3O A;  1J5O A;  3D6R A;  5J2P A;  3B6O A;  4E7L A;  1Y97 A;  5KRS A;  3CC4 N;  4JRP A;  5JS1 A;  1QHA A;  1NK0 A;  4CJU A;  4H0X B;  3O08 A;  2E1Y A;  2YHA A;  4DV5 K;  4FK0 A;  4CZH A;  2P9P A;  4C1N I;  1HNI A;  3VEW A;  3I55 N;  1NLV A;  4JI8 K;  4A5A A;  3WXK A;  3V1O A;  2FBV A;  3N4P A;  1HNW K;  2QI2 A;  1CXU A;  3OS2 A;  4W5Q A;  1H1V A;  1QSS A;  1X3M A;  4B1X B;  3E9O A;  4KHY A;  3IFR A;  3ZEU A;  4B3S K;  4BRF A;  3S9H A;  2WOM A;  1S1V A;  4DV2 K;  3AVA A;  5T7B A;  2OYQ A;  4FWQ A;  3OS1 A;  4JV5 K;  3SBG A;  2BH1 A;  3P83 D;  4CJP A;  3OYL A;  4G9Z A;  4YDU C;  4CHY A;  1XHX A;  4NYN A;  4PL8 A;  3ZT4 A;  3HO1 A;  3AVN A;  4JKB A;  1BIU A;  3O9T A;  1YIT N;  5EU7 A;  4AHT A;  4OKJ A;  4JI3 K;  3U3G A;  3C65 A;  3LAN A;  3UE5 A;  3SQ0 A;  1ZBU A;  1YIJ N;  2YKM A;  4IOX A;  3ZX3 A;  4IFV A;  1KTQ A;  4K8X A;  3IG1 A;  3NH2 A;  3HPO A;  5JLF A;  1C0M A;  1HYZ A;  3SUO A;  4KTZ A;  3OYE A;  3FFK B;  4B9S A;  1BWF O;  4DHY A;  3SYZ A;  1XHZ A;  3HP6 A;  1IBM K;  3KK2 A;  3G0Z A;  4B1U B;  3UKU A;  2XY7 A;  2BE2 A;  1ASU A;  3HSC A;  2HMI A;  4N47 A;  4BRK A;  3IMX A;  2I7P A;  3NF9 A;  4WFN L;  1VQO N;  4KHP K;  5AQN A;  5LY3 A;  3LDN A;  3BF3 A;  2I5J A;  1HLU A;  4E19 A;  1RDW X;  1VSJ A;  4BRD A;  4DFP A;  2FSK A;  3ZX0 A;  1NK9 A;  2YKN A;  4IZ9 A;  1WOQ A;  1J5E K;  2OAN A;  3C94 A;  4B9V A;  4KB0 A;  4CBX A;  1U45 A;  2P9U B;  4FLV A;  1QVF M;  3MK6 A;  3HZ6 A;  4HWI A;  3ZSV A;  5KGX A;  2IS3 A;  3HJF A;  2HVH A;  4BGB A;  3O3H A;  2G8K A;  2QEX N;  3THY A;  2O8C A;  1T3V A;  4FWN A;  3QEX A;  1EP4 A;  2HHT A;  1JLC A;  1JJ2 M;  4DR6 K;  1VQP N;  1GLF O;  3UB5 A;  4JKG A;  3VOV A;  4TSX A;  1X1P A;  4CZG A;  4BDZ A;  3U3Y A;  1U4B A;  3NE6 A;  1WSI A;  4DR3 K;  4ELT A;  1S5J A;  1BCM A;  2FSN A;  1VSM A;  3DLL L;  3DJC A;  3F2K A;  4N41 A;  3C7N B;  3I56 N;  4FWP A;  3VQ6 A;  3VQC A;  5AQW A;  3TAM A;  1TKD A;  1IKW A;  4DTO A;  3QEP A;  4AHV A;  3FE1 A;  4KAZ A;  5M1N A;  1JLB A;  1KVC A;  3VER A;  4RCH A;  4DR4 K;  3RMC A;  3EL2 A;  5CZ2 A;  3OYD A;  2EHG A;  4FJ7 A;  4BRQ A;  2F9T A;  4M7Y A;  5GIO A;  1HNV A;  4JAX A;  4BR0 A;  3AVJ A;  5AQP A;  3TAG A;  3D2E A;  4GV3 A;  5IWA K;  1TUY A;  4FSV A;  4IJN A;  4IG3 A;  3WNH A;  3S3M A;  5AQR A;  4AF1 A;  3OYK A;  3VN5 A;  1U6Z A;  3FZF A;  5I9E B;  3E9L A;  4NLC A;  4WQ4 A;  4DTU A;  3QIP A;  3PO4 A;  1D9D A;  1R0A A; 
#chains in the Genus database with same CATH homology
 1J9A A;  2VWK A;  4CFA A;  3CQ8 A;  1NKB A;  1YT3 A;  4M3Z A;  3MEE A;  3LDS A;  1SKW A;  4E7K A;  1HJR A;  3V1Q A;  4CIG A;  5CYQ A;  5FRN A;  1WAJ A;  1VSD A;  4YNQ A;  3ISN C;  3BDP A;  2OZS A;  3DYA A;  1BL3 A;  2X74 A;  1KFS A;  4KI6 A;  4BDY A;  4CJQ A;  4KPY A;  5HBM A;  4M42 A;  4IFY A;  4M3X A;  4QOZ B;  3NGY A;  1RT2 A;  1KRP A;  4FCY A;  4CHP A;  3SPZ A;  3VQA A;  1XC9 A;  4FJH A;  3OS0 A;  1TK0 A;  2ZE2 A;  3NHG A;  1N5Y A;  4CED A;  4N76 A;  1O1W A;  2Z1J A;  3OYH A;  1IKY A;  3KD1 E;  1C6V A;  3D45 A;  3DLH A;  4W5R A;  2QKB A;  2E4L A;  3V9W A;  1BI4 A;  4OKE A;  3RTV A;  1L3S A;  3AVL A;  2D0B A;  4DS5 A;  1WAF A;  3JSM A;  3P1G A;  3F9K A;  4DWI A;  1TL3 A;  2YV0 X;  1S1W A;  1ZYQ A;  3NF7 A;  1JLG A;  1JLF A;  4KTQ A;  2HHW A;  4PWD A;  4DFM A;  1VRU A;  1RTD A;  2FBT A;  3LZJ A;  3NF6 A;  3SCX A;  3DRS A;  3AVG A;  3SV4 A;  2HW3 A;  4FJ9 A;  3DLG A;  4CJW A;  3ULD A;  4PA1 A;  4KO0 A;  4E7I A;  1B9F A;  1SV5 A;  3AO1 A;  4HCC A;  4OPJ A;  3LWL A;  5D3G A;  1B92 A;  4BAC A;  3KKR A;  3LWM A;  2HHV A;  1TGO A;  2QXF A;  3CM6 A;  4FZX C;  4M41 A;  4FJ8 A;  1EKE A;  3TR8 A;  4K8Z A;  4FVM A;  2IC3 A;  4O4G A;  4QAG A;  3MXJ A;  1MU2 A;  1WLJ A;  4N5S A;  4BE2 A;  1VSE A;  4AHR A;  3L2W A;  2E6L A;  1S1U A;  3SPY A;  2Z1I A;  3AVF A;  1F21 A;  1RT5 A;  1QTM A;  1WSF A;  2E6M A;  3KTQ A;  1U48 A;  3L2V A;  5HLF A;  1RDB A;  2OA8 A;  3QES A;  1U04 A;  4CJT A;  4RW8 A;  5SZT A;  1Z25 A;  4J2A A;  1S9E A;  3MED A;  2G8H A;  1CZB A;  3NGZ A;  1D5A A;  5I3U A;  4CHQ A;  4FJ5 A;  2FBX A;  2RKI A;  3OYJ A;  1KFD A;  1TV6 A;  4F4K A;  2BAN A;  4UQG A;  3AVC A;  2NUB A;  1YTU A;  3VQP A;  4CEF A;  3KD5 E;  1JLQ A;  2PYJ A;  3LAM A;  1RCH A;  1TKT A;  5FRO A;  3WNE A;  3ZSR A;  4KV8 A;  4IDK A;  3ZT1 A;  3NCI A;  4F2S A;  1IKX A;  1HPZ A;  3VQE A;  3MEG A;  3T1A A;  1UOC A;  4CGJ A;  3MAQ A;  4Q5V A;  4FM1 A;  3ASM A;  4KHQ A;  4AHS A;  3F73 A;  1W9H A;  1S1T A;  4FK4 A;  1DTQ A;  2BGG A;  4GVM A;  1ITG A;  1S6P A;  3ZSY A;  1BCO A;  1EX4 A;  4FLW A;  1NK8 A;  2OPR A;  3K5M A;  4DS4 A;  4CF9 A;  1JLE A;  1RBV A;  4DSK A;  4DFK A;  1SKR A;  4DTN A;  4CFB A;  1A5V A;  3OYN A;  2F96 A;  4C8O A;  3LP0 A;  4JS5 A;  2GUI A;  2YHB A;  2X6N A;  4B9N A;  4F3O A;  4J2E A;  4I2P A;  3ZSW A;  5J2M A;  3V6D A;  4Y1C A;  3ZSQ A;  2Z1G A;  3PX4 A;  1K6Y A;  2IOC A;  4WE1 A;  2VG5 A;  3HT3 A;  1WSE A;  2GBZ A;  3CFR A;  4DF4 A;  2Y1I A;  3L2R A;  1RBT A;  1DLO A;  4I2Q A;  4E3S A;  3TAR A;  1X9S A;  1U47 A;  3U6F A;  3CG7 A;  3L3V A;  4O5B A;  3VQ9 A;  4F8R A;  4CHN A;  4CF8 A;  3AO2 A;  1RBR A;  1XWL A;  3TAB A;  3A2F A;  5HRN A;  1RT7 A;  4AHC A;  1NK6 A;  1HYS A;  2HND A;  4Z0U A;  3L2U A;  1NKE A;  1D9F A;  4FJJ A;  2F8S A;  2DY4 A;  4JLH A;  4LSL A;  4CGG A;  3VA3 A;  5HRO A;  4DTX A;  4O44 A;  3RRH A;  1GOC A;  2ZQB A;  3KLH A;  4FJN A;  1CZ9 A;  2B4J A;  4O0I A;  3AA4 A;  3LAK A;  3V9Z A;  1WNS A;  3HPG A;  4E7J A;  3TAQ A;  4PUO A;  3T19 A;  2B5J A;  3QO9 A;  4Z4E A;  3SJJ A;  4IKF A;  1RDC A;  1NJZ A;  1YTA A;  4FK2 A;  3DRP A;  4DTR A;  4B8A B;  3K59 A;  2XY5 A;  2YNH A;  3IRX A;  1LWE A;  1U49 A;  1JXE A;  1I39 A;  1IG9 A;  4KHN A;  2FC0 A;  1L3U A;  3DMJ A;  1UWB A;  3NH0 A;  4O55 A;  3RMB A;  4M3R A;  4CEE A;  1SL2 A;  2GV9 A;  4DLG A;  4B3O A;  5J2Q A;  3MXI A;  2YNF A;  2ITG A;  3K58 A;  1NOZ A;  4CJ4 A;  3VQD A;  3DLR A;  3HM9 A;  4E1N A;  2HNY A;  3V9X A;  4NCA A;  5C24 A;  2A1S A;  1JKH A;  1LW0 A;  1WN7 A;  1UAX A;  4RW4 A;  3QNN A;  4Z4I A;  3C95 A;  4H8K A;  1UA0 A;  4KRE A;  1L3T A;  4CCH A;  1WSG A;  2RN2 A;  3G10 A;  3C6U A;  2R7Y A;  1S6Q A;  2DFE A;  3QIO A;  4B9L A;  4IBN A;  4C8M A;  1BQM A;  4Q0B A;  3CFO A;  5DMR A;  1RBS A;  3NGI A;  2BDP A;  2QKK A;  3OYA A;  3THV A;  3DLK A;  1C0T A;  1GOB A;  2PY5 A;  4FJK A;  3TAF A;  3VQ5 A;  2IAJ A;  4ZTJ A;  4DU1 A;  4Z4F A;  3KLG A;  2AJQ A;  1JXB A;  4DQP A;  4HTU A;  4FZY A;  1TKX A;  2ZD1 A;  2OPP A;  4OGC A;  4E89 A;  4DQR A;  4ZHR A;  4ELV A;  1HQU A;  1IKV A;  1VSH A;  1FKP A;  1S1X A;  3B6P A;  2HVI A;  3I8D A;  2LSN A;  1VK0 A;  4PY5 A;  1KLM A;  4CF1 A;  1TL1 A;  4DQQ A;  1QS4 A;  1J54 A;  4ZTF A;  2P5G A;  4E0D A;  4BE0 A;  3OYI A;  2KQ2 A;  4CES A;  3AVH A;  3LP3 A;  1L3V A;  4FW2 A;  1KVB A;  3HVT A;  2Y1J A;  1JL1 A;  3DOK A;  4CEA A;  3UIQ A;  3RWU A;  4PQU A;  4CJ3 A;  2X78 A;  2EX3 A;  3SI6 A;  1GOA A;  1RNH A;  2KTQ A;  3ZT0 A;  1B9D A;  1C1B A;  4CHO A;  2G8F A;  4FZZ A;  3NDK A;  1W0H A;  2HHS A;  1S9G A;  2RPI A;  3DLE A;  1D8Y A;  5J1E A;  1T05 A;  3K2P A;  1CLQ A;  3DI6 A;  1SUQ A;  4CER A;  5J2N A;  4M3U A;  1ZBH A;  1VRT A;  2VG7 A;  4KHS A;  3OYC A;  1HMV A;  4DTJ A;  1TVR A;  4NCB A;  3ZSZ A;  4F3T A;  1RTI A;  4KHW A;  3SQ2 A;  4RW6 A;  3QNO A;  3L2Q A;  4HCB A;  3RR8 A;  4R5P A;  4B9M A;  4CJF A;  1REV A;  2HHX A;  1ZBF A;  4OJR A;  4CGI A;  1SL1 A;  1RIL A;  1RT3 A;  1QE1 A;  4FLX A;  3LZI A;  1LV5 A;  1Z26 A;  3VQ8 A;  4LY7 A;  4EP5 A;  4Z4G A;  4C8K A;  3JYT A;  4OLA A;  4FM0 A;  1RDA A;  3KLE A;  4HUE A;  1NOY A;  3KLI A;  3H08 A;  2P5O A;  2KZZ A;  4Z4C A;  1TK5 A;  1TKZ A;  3TI0 A;  3VQQ A;  3AO3 A;  1KSP A;  3AA2 A;  3OYM A;  4KKO A;  1A5W A;  3M8Q A;  4EP4 A;  1LW2 A;  3S3O A;  4FLY A;  1J5O A;  3RRG A;  5J2P A;  3B6O A;  2XHB A;  4E7L A;  4HUF A;  3QET A;  1X9W A;  1Y97 A;  3V9S A;  5KRS A;  4B8C A;  4CK3 A;  1NK5 A;  4JRP A;  3D0P A;  5JS1 A;  3AVK A;  3AA5 X;  3KLF A;  1NK0 A;  1KLN A;  1ASV A;  4CJU A;  4M3T A;  3NH1 A;  3I0S A;  4CK2 A;  3OJU A;  4ELU A;  2QK9 A;  2YHA A;  3V1R A;  1CXQ A;  4FYD A;  4DSE A;  4M45 A;  4GW6 A;  4DTM A;  2JLE A;  4FK0 A;  3HPH A;  1JL2 A;  2O4G A;  4C8N A;  1HNI A;  1LWF A;  3ZSO A;  1FK9 A;  3OYG A;  1KCF A;  3RR7 A;  3HL8 A;  3KK1 A;  3OYF A;  4CJV A;  3LAL A;  5KGW A;  3V1O A;  2OPQ A;  3OJS A;  2FBY A;  2FBV A;  3TAN A;  1YVU A;  3O4Q A;  4MFB A;  2D0C A;  1VSI A;  1QSL A;  3DOL A;  4IG0 A;  1CXU A;  2ATQ A;  3AV9 A;  4CJL A;  3OS2 A;  1T7P A;  1L5U A;  1BHL A;  4W5Q A;  1IH7 A;  1QSS A;  3QLH A;  2HB5 A;  2HHU A;  1DTT A;  4DTP A;  1BI4 B;  2D5R A;  2ETJ A;  4F2R A;  2RF2 A;  1NJY A;  4FJM A;  4KHY A;  4W5N A;  1T8E A;  3SNN A;  4AHU A;  4LSN A;  3AO4 A;  2F8T A;  4CEZ A;  1RT4 A;  4HHT A;  1QQC A;  3DRR A;  5K14 A;  2WOM A;  3S9H A;  1S1V A;  4DSL A;  5HRS A;  3AVA A;  1BIS A;  4H4O A;  5T7B A;  2OYQ A;  2O4I A;  3QIN A;  3OS1 A;  4CEO A;  3I0R A;  2B6A A;  5SWM A;  3ZCM A;  4FXD A;  3OVN A;  4YFU A;  3P83 D;  3SUN A;  4CJ5 A;  1Q8I A;  4CJP A;  3OYL A;  2PYL A;  1TAQ A;  4DU4 A;  3VA0 A;  4NYF A;  1NK4 A;  4CHY A;  1XHX A;  4OLB A;  3VQB A;  1WSJ A;  4CF0 A;  4NYN A;  2DTU A;  4BE1 A;  1XI1 A;  1Q9Y A;  3ZT4 A;  4OPK A;  3HO1 A;  4CJK A;  2KFZ A;  3AVN A;  4HUG A;  1BIU A;  3SUP A;  2KFN A;  5EU7 A;  2IGI A;  4NCG A;  4Y1D A;  4B9T A;  3ZT3 A;  4OKJ A;  3FFI A;  4AHT A;  3AVI A;  4ID1 A;  4Z4H A;  3O3F A;  4DSF A;  3U3G A;  1RTJ A;  4KFB A;  5I42 A;  4RG8 A;  2G8V A;  3LAN A;  3NBP A;  2OPS A;  4AH9 A;  1NJX A;  3SQ0 A;  3K5N A;  1EET A;  1ZBU A;  3S3N A;  4EZ6 A;  2YKM A;  3PV8 A;  3PY8 A;  4OGE A;  4IFV A;  1X9M A;  1KTQ A;  4FLU A;  3K5L A;  4CIE A;  2XRI A;  3NF8 A;  3IG1 A;  4K8X A;  4DU3 A;  3PX0 A;  1SKS A;  3NH2 A;  3ZT2 A;  3HPO A;  1VSF A;  3P5J A;  1C0M A;  3SQ4 A;  5CZ1 A;  3SQ1 A;  1FKO A;  2XO7 A;  4GMJ B;  1HYZ A;  3SUO A;  4KTZ A;  3OYE A;  4LH4 A;  1NJW A;  2IDO A;  5HRR A;  4N56 A;  1HRH A;  3IAY A;  4B9S A;  3RMA A;  3SYZ A;  3O4N A;  1XHZ A;  3HP6 A;  1QHT A;  3KK2 A;  3G0Z A;  4BDP A;  4J2B A;  4DSJ A;  4BWJ A;  3BGR A;  2XY7 A;  3QEW A;  1TAU A;  2BE2 A;  4RW9 A;  1ASU A;  4CFC A;  3QEI A;  4KB1 A;  2HMI A;  1KVA A;  3SZ2 A;  4DFJ A;  4EZ9 A;  4N47 A;  3CM5 A;  4I7F A;  5DK5 A;  4FJG A;  3NF9 A;  3KKS A;  2HNZ A;  4FLZ A;  2YNG A;  2I5J A;  5HP1 A;  5C25 A;  2JGU A;  3MEC A;  4E19 A;  1LAV A;  2WON A;  5C42 A;  4DFP A;  1VSJ A;  3TWH A;  1RTH A;  2G8W A;  1VSK A;  1SL0 A;  3KJV A;  1TK8 A;  1NK9 A;  2YKN A;  4LD0 A;  2P51 A;  3PO5 A;  4CEQ A;  4LH5 A;  3C94 A;  4G1Q A;  2VWJ A;  4FM2 A;  4B9V A;  3LPT A;  4KB0 A;  4I9Q A;  5FRM A;  5HRP A;  4CGH A;  1U45 A;  2XY8 A;  4H4M A;  4MQ3 A;  1UA1 A;  4KTW A;  4FLV A;  3EZ5 A;  4DQI A;  4W5T A;  3TAE A;  3ZSV A;  4B08 A;  5KGX A;  2IS3 A;  3HJF A;  3AA3 A;  3L3U A;  5FDL A;  4RW7 A;  3O3G A;  3PX6 A;  2P1J A;  4CEC A;  2HVH A;  3O3H A;  4CIF A;  2VG6 A;  3KIO A;  3RMD A;  2Q3S A;  2G8K A;  4KI4 A;  4M3Y A;  1N6Q A;  3V81 A;  4FJL A;  1HQE A;  1RT1 A;  4CE9 A;  4FJX A;  4CK1 A;  3DLB A;  1C1A A;  4QCL A;  1NK7 A;  2OZM A;  3C6T A;  3CYM A;  1RT6 A;  4DQS A;  1EP4 A;  3QEX A;  2HHT A;  2XY6 A;  1JLC A;  3HK2 A;  1C0U A;  1ZBL A;  3V9U A;  1HYV A;  2PZS A;  1ASW A;  1LAW A;  4CEB A;  4TSX A;  1X1P A;  4J2D A;  4BDZ A;  3LP2 A;  3U3Y A;  3OY9 A;  3NE6 A;  1IO2 A;  1VSL A;  1WSI A;  1U4B A;  2DFF A;  4CGF A;  1T03 A;  1S5J A;  3K5O A;  1BCM A;  4L8R B;  3WNG A;  1VSM A;  4N41 A;  3AVB A;  3LP1 A;  3QER A;  4KHU A;  3HXM A;  3NAE A;  3CFP A;  2KW4 A;  2X6S A;  2YNI A;  3VQ6 A;  3VQC A;  4I9L A;  4ICL A;  2HHQ A;  4JS4 A;  3TAM A;  4CHZ A;  4E7H A;  1TKD A;  1IKW A;  3EYZ A;  4DTO A;  3QEP A;  4AHV A;  4DSI A;  4DG1 A;  4DMN A;  3VQ7 A;  4CF2 A;  5KTQ A;  4OVL A;  3K57 A;  4KAZ A;  3M8P A;  1JLB A;  4ID5 A;  1KVC A;  3AVM A;  5CY4 A;  4W5O A;  4FLT A;  1ZBI A;  3RMC A;  1Q9X A;  4C8L A;  2W42 A;  5CZ2 A;  1LWC A;  3VQ4 A;  4DF8 A;  5KRT A;  3OYD A;  3KK3 A;  1RDD A;  2EHG A;  3AO5 A;  3HP9 A;  4XIU A;  3M8R A;  3EY1 A;  4FJ7 A;  2KZM A;  1FXX A;  2DFH A;  3L8B A;  1BIZ A;  3TAP A;  3ALY A;  1HNV A;  4FW1 A;  4DLE A;  3HVR A;  5JS2 A;  4B9U A;  3T3F A;  1C1C A;  1BGX T;  3AVJ A;  3TAG A;  3ZSX A;  4CJR A;  5CYM A;  4DTS A;  3IS9 A;  5E41 A;  4CFD A;  2Z1H A;  3MXM A;  1RBU A;  3HYF A;  1EXQ A;  4AIL C;  4ELT A;  4FJI A;  3OYB A;  1WSH A;  3WNF A;  3QEV A;  4CJS A;  3LPU A;  4IG3 A;  1BQN A;  4O0J A;  3DM2 A;  4OKK A;  3WNH A;  3S3M A;  2A1R A;  1JLA A;  2G8I A;  2G8U A;  3SV3 A;  4M3W A;  1NKC A;  3OYK A;  1A5X A;  3NFA A;  3PUF A;  1G15 A;  1I3A A;  3VN5 A;  3V4I A;  3E01 A;  4E1M A;  4HVJ A;  4BWM A;  3HST B;  4DTU A;  1J53 A;  3QIP A;  3PO4 A;  4JRQ A;  5KI6 A;  4KRF A;  3M8S A;  4CJE A;  3SUQ A;  1D9D A;  1R0A A;  2D0A A;  1QSY A;  3ITH A;  4CGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...