1S6QA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r147681
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords POL polyprotein [Contains: Reverse transcriptase]
total genus 136
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s6qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6qA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6qA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s6qA05
4ED6A 1T03A 1UA0A 2IA6A 3TAEA 1C0TA 3HJFA 1MU2A 2XY8A 3JYTA 1JLEB 1BQNB 4M3XA 3CM5A 3SYZA 1ZBLA 1S6QB 4O3NA 2AGPA 1HMVB 4H8KA 4YNQA 1BQMA 4CHZA 2R7YA 4CEZA 3G6XA 4PA1A 1QE1B 4DG1B 3AO3A 3AVBA 4R5PA 3D45A 5KT2A 2EX3A 1VK0A 3DOLA 5FROA 1ASWA 3V9ZA 2OPQB 2VG6B 4Y2CA 4CGHA 3BDPA 3SV4A 4ZTFA 4B9NA 2DTUA 5KFJA 1T05B 3QGGA 2P51A 3CM6A 3KJVB 4H54A 3ULDA 3M8QB 2G8FA 1A5XA 1VSJA 3HM9A 4NCBA 3WNEA 3SFGA 1D5AA 1RT7A 1XR5A 1KLMA 4FJMA 4QWEA 3N6NA 4L8RB 1L5UA 3VQ8A 4CGFA 1ZBFA 5HRRA 2G8VA 4CHYA 1R0AA 3ZSOA 2JEJA 4BDZA 4WE1A 4ZPBA 5CZ2A 4M3RA 5DLFA 2D3ZA 5KGWA 4FJKA 4CJKA 2ETJA 1C0UA 3QLHB 1JLQA 3PW7A 2OH2A 4IRDA 4Z4FA 4C8MA 2G8KA 4U6PA 5JUMA 1TKDA 4DL7A 3NCIA 3KKSA 1JLAB 2HWHA 4NLXA 4CF0A 4ZPCA 2FC0A 1N6QA 4DSEA 3HP6A 4EZ9A 1S1VB 2A1RA 4KTQA 1RT3A 2YKNB 4YR2A 3AO4A 3CFRA 5CYMA 3RMAA 4OKKA 2B4JA 1XR7A 3NL0A 1UWBA 4KFBB 2R8IA 3F73A 3AO1A 2IM3A 3SFUA 1XHXA 5I3UB 4K4WA 3V6DA 3SPYA 4EP4A 3DLGA 1S1WA 4K4XA 1S1WB 4NLWA 4ELTA 3NH2A 2X6NA 5T14A 5J2MB 3DM2B 4RW6B 5HP1B 2C2RA 3O3FA 1N5YB 3IRXB 2B5JB 3OYJA 3BGRA 1RTHA 4IR1A 4LQ9A 3ZT2A 1QAJA 3H5YA 4FJHA 3DYAA 1S6QA 4IR9A 4K4ZA 2RF2A 1W9HA 3V9UA 1MU2B 1N6QB 1WAJA 1OS5A 4FLYA 3OL7A 5KFHA 4CHQA 3EYZA 4FJ7A 2PYLA 1N4LA 1VSKA 3MEGA 1RTDB 3EZ5A 3U3YA 4MFBB 1ITGA 2CKWA 4F3OA 4IG3A 4MK7A 2ASJA 3L3VA 1S48A 3BQ1A 4TY8B 4FBTA 4KV8A 5D3GB 3SQ2A 3DM2A 4JS5A 3PJXA 4F4KA 3UDLA 4DTUA 4IDKB 4K4UA 1S49A 4DWIA 3RRHA 4AHTA 3AA3A 2D0AA 3DLBA 1RT4B 4M3TA 4AHRA 2QKKA 4GC6A 1BGXT 2KW4A 2R2UA 4CJ5A 4ED2A 1CZBA 1S10A 2FVQA 2J6SA 2EHGA 4CK1A 4MH8A 2R8HA 3UR0A 3NBPB 3SQ1A 3QEPA 2G8IA 4FJXA 3HVTA 3TAGA 2WONA 1I3AA 4ICLB 2ATLA 4EP5A 1GOAA 3QNNA 1KHVA 2V0NA 4W5OA 3NF8A 1HQUA 1RTIB 3ZCMA 4ZP8A 4KHMA 1Q8IA 4RNNA 2XC9A 4K4SA 4W5TA 4FJGA 3LAMA 2DPIA 5E41A 2BDPA 3KMSA 3RB6A 2YNGB 4H4OA 5F8LA 3V1RA 1TV6A 4WZQA 4IFYA 2VA2A 4CGJA 4DTPA 3LAKA 4IFVA 3BSAA 3V4IB 2XHBA 4QPXA 4YQWA 4C8OA 5EUHA 4CFCA 1SL2A 2B43A 4BWJA 3AVGA 4HVJA 4IG0B 2IJNA 4M42A 2FLPA 1BISA 3BREA 1KTQA 2HHSA 4RW6A 1RT6A 3OJUA 2RDJA 3VA3A 1REVA 3KLEB 5KFPA 5F8GA 2AJQA 3DRRB 1CSJA 1QSSA 5KG0A 4CEQA 3VQ7A 2O4GA 3V6HA 5SZTA 5SWMA 2G8WA 4FZZA 2GV9A 2KZMA 3NH1A 3RMBA 3NAEA 4I2QA 1TVRB 4NLQA 2WB4A 1TQLA 5HBMB 1NK4A 4EO8A 4F50A 4RW4A 4DSIA 4F4XA 4DU4A 4FYDA 2D0BA 3KHGA 2D5RA 3KLIA 5KT6A 4ID1A 1SL1A 1VRTA 4E7LA 4JV1A 3UPFA 1K1QA 2UVWA 5KG3A 1HQEB 2KFNA 4XPEA 3S3MA 3ITHB 3KTQA 4KPYA 4CEEA 1NK7A 4ZHRB 5T7BA 3HP9A 4J9PA 3QYYA 3DRPB 1D0EA 1EP4A 3GIMA 4NYZA 4G1QA 1S0MA 1RT1A 4Q5VA 3CIZA 1TL1A 2HMIB 4CEFA 1R0AB 4H4MA 5L1KA 4HUGA 5KFIA 4CE9A 2HWIA 4CERA 2DFFA 4DS5A 2XCPA 4NLSA 1VSIA 1RT6B 3JSMB 3SI8A 4ZP7A 1ZTTA 4I9QA 4PQUA 3KJVA 4FM1A 5C24B 4IH5A 4IG3B 2FVSA 3GQCA 3NAIA 2RN2A 5HROB 3QEVA 2BRLA 2XI2A 4DQQA 3PZPA 1NJZA 2X74A 1EETA 4PWDB 4G3IA 3KLHB 3BSCA 5J2NA 2BE2B 3VQ5A 4O44A 1FKPB 3MXMA 4JRQA 3DDKA 1S6PB 1HMVA 2BANB 2RF2B 1BQNA 3KLFA 3I0SB 3B6OA 2VWJA 1QUVA 2JGUA 3I0RB 4QW9A 3L2RA 1TK8A 4E19A 4WFZA 2E9TA 2W9BB 4RW9B 3RBDA 3HPGA 3DI6A 2P5OA 1LWCA 5JXSA 3HXMA 4DQSA 3E01A 4CJLA 2X78A 3RRGA 2HHTA 5HRNA 4DSKA 3P5JA 1Q9YA 3NMAA 1TKZA 3QEXA 3HPOA 1CXUA 3VQ4A 1S9GB 2ZE2A 3NAHA 4ED1A 2VG5A 3UIQA 4ECUA 3T3FA 3NGZA 4B9LA 4ECRA 4CIGA 3V6KA 4DF4A 3HVWA 5KT4A 3L3UA 3QERA 3TAMA 2ALZA 3RB3A 5L1IA 4NRTA 4TY8A 1TKTB 3VQCA 4FBUA 2R8GA 1S1VA 1IKYA 4FLVA 1S1TB 5KT7A 4E7JA 3DLKA 3AVAA 4PUOA 3H4BA 3KLHA 2WHOA 1K6YA 4F2SA 4DLGA 1NOYA 5L1LA 1A5WA 1Z26A 3IGNA 3MEDA 2WCXA 4DFPA 4HCCA 4AHVA 2PY5A 3GIJA 3VA0A 4BDPA 2JC0A 2IM0A 3NDKA 1T94A 1BI4A 2HB5A 3ZSZA 2JEGA 1TKTA 3S9HA 3RBEA 3KLGB 4KAZA 5L1JA 3ZSXA 4HUFA 1RTHB 4Z4HA 4AHCA 4CHOA 3KHRA 3HVAA 3OL9A 4LSLA 4E0DA 5KFBA 3M8PA 5KTQA 3VQAA 2HW3A 3VQBA 3DMJA 4O3SA 3D5MA 1EP4B 3QIOA 4F2RA 1J5OA 3I8DA 5KG1A 5KFDA 3ZT3A 1FK9B 3AO5A 3ITHA 4RW9A 4TQSA 1KVCA 2FVRA 3V9XA 2HHWA 4I9LA 4XIUA 4KHSA 2BQUA 1VRTB 4ED7A 4N41A 3PV8A 3PUFA 5CYMB 2GUIA 3I0SA 1BQMB 2F8EX 4JLHA 2BANA 4ID5A 2ITGA 4CJTA 5JS2A 3IN5A 4M3UA 1JLEA 4CJQA 2FLNA 2AX0A 4I7FB 1JXLA 2E9RX 3RAXA 4Y2AA 3E51A 3ICLA 2YHAA 3RMDA 4FLUA 1T03B 1RCHA 4YR3A 4FLWA 3HVRA 1FK9A 3AVCA 2O5DA 3IAYA 5EWGA 2RKIB 3CJ2A 3NF6A 1RBUA 4CGIA 1JL1A 4BE1A 4NLGA 2AU0A 4NCGA 3EPIA 3K59A 2QKBA 1JL2A 3DMJB 4KKOB 1YT3A 3QGIA 1JLCB 3H5XA 5KFKA 4AHSA 1RILA 2A1SA 4J2EA 3I5BA 1TAQA 4LY7A 1NJWA 3DLEA 4O55A 4IH7A 4J9LA 3IS9B 4OKJA 2BGGA 4F3TA 4LH5A 4I2PB 4DTSA 4FJNA 1RDBA 4G1QB 3MFIA 1F21A 1D1UA 2PZSA 2W8LA 2DFEA 2YHBA 4BE2A 2YNGA 4Q44A 1RDCA 3PO5A 1W25A 2Y1JA 4R5PB 4M45A 4O3OA 4IH6A 2C2EA 1X9MA 5DGBA 3U3GA 1T8EA 4J9QA 1TL3A 2FBTA 4RUAA 4FJJA 4WYLA 3ZSVA 4B9VA 5KFWA 3V1OA 4DEZA 1ZBHA 2WK4A 4CJWA 5KRSA 3KMQA 1GOCA 5DG8A 4J9NA 3JYTB 4ZPAA 4FM2A 4MIAA 2Q3SA 3SJJA 3G10A 1ZYQA 1BHLA 4NYFA 4PY5A 2OPSB 3K5LA 4W5NA 2E6MA 3FFIA 3MAQA 4KTWA 2R8JA 4DTMA 5KFXA 2GIRA 1TK5A 1VSMA 2IAJA 2W9CB 5HRPA 3EZUA 3DLEB 3HPHA 5EWFA 2XGQA 1I6JA 1TK0A 2OZSA 3LP3A 4JUZA 4CJVA 3TQ1A 4CJ4A 1RBTA 4FS2A 5J2PA 3CJ0A 3LP1A 2FVCA 4CF2A 4M3ZA 1IG9A 3EPGA 3KLFB 3FQLA 3T5JA 1I39A 4DFMA 4GC7A 2I5JA 1QHTA 4NRUA 4O4GA 5I42B 3PVXA 2VG7B 2XCAA 3AVJA 3CJ3A 3HL8A 3V81B 3BQ0A 1S1XB 1EETB 3C6TB 3PX0A 4PUOB 1TL3B 5F9NA 2NUBA 4CJEA 3MR3A 4NLYA 1NKBA 4CHPA 4YMEA 4DTXA 1S5JA 4PQUB 3H5SA 4IQXA 1XHZA 4LH4A 1VSLA 4K8XA 1BIZA 4KSEB 4KB0A 3KK2B 2UUWA 2Z1HA 3Q8QB 4EBCA 1HNIA 4NLVA 4UQGA 5HRSA 3FDSA 3TABA 4KI4A 3NH0A 3PW2A 4ZVHA 4GW6A 2KZZA 3ZSQA 1DTTA 2D0CA 1YVUA 3AVIA 1HNVA 3VQDA 3WNFA 3LP2B 3OS1A 4CFBA 4HTUA 4CIEA 1C0MA 1RBVA 3ZSWA 1IKXA 3LDSA 1TKXA 3MEGB 1X9SA 3GYNA 3MECA 3V81A 4TLRA 4O44B 1RBSA 4DFKA 3V9SA 1S1TA 1K1SA 4N5SA 1JLBA 4J9RA 4Z0UA 2IBKA 2X6SA 5J1EB 1NJYA 2RDIA 4Q0BB 4CJFA 2IGIA 3DOKA 3M9MB 4KRFA 1IKVB 4J2AA 2ZE2B 1DTTB 3SPZA 5KFEA 2FVPA 4ED0A 1ASVA 1SL0A 4B9UA 1LWEB 3K5NA 2ZKUA 4Q45A 5I3UA 3M8PB 3AVNA 3K58A 1NKCA 4TYBA 2JLEA 4EBDA 1BI4B 3Q8SB 4CIFA 4TQRA 3VN5A 4Y3CA 3PW5A 2CJQA 5DG9A 1C0TB 4ZVGA 4YFUA 5KT3A 3MXIA 1WSHA 2GC8A 5KG5A 4IKFA 3LALA 5FRMA 2YNIB 3BR9A 2W8KA 3LPTA 3KK3B 3GV5B 3OL8A 4URQU 2ZQBA 4EYHB 3C6UA 1O1WA 4WFXA 3CFOA 1SV5B 1RYRA 4I2PA 4FCYA 1RT4A 3CJ5A 4O4RA 4DQPA 4CGDA 3TAQA 4FJLA 3PW4A 4FJ8A 2DY4A 3SUOA 4M3WA 4KV8B 5D3GA 1BIUA 1HYSA 3DRSB 1GX6A 4LSNA 1IH7A 1D8YA 1C1CB 4HHTA 3C6UB 1J53A 5K14A 1HRHA 3H08A 2C28A 1NKEA 4B9TA 4K8ZA 3FQKA 4EBEA 3P1GA 3V4IA 4MFBA 3O4QA 3DOLB 3S3OA 2W9BA 4RW7A 4KAIA 3PX6A 3LANA 3OVNA 3RB4A 3FRZA 4QWCA 3SV3A 1UA1A 4H4OB 1WAFA 1ZETA 4FM0A 3T1AA 1NOZA 3OS2A 4ID5B 3MTKA 5FDLB 5KT5A 1RTIA 4XO0A 3AVKA 4DTJA 4E1MA 4J2DA 3PO4A 4ICLA 1KCFA 4URGA 2VA3A 1NK0A 4LQ3A 3IRXA 4TN2A 1JXEA 3NGYA 3OY9A 4R8UB 5HP1A 4RNFA 1L3TA 3UQSA 5C5JA 1REVB 2KQ2A 3OYDA 4OPKA 2HHQA 3NFAA 3OSNA 3OYLA 3SQ0A 4Y1DA 3FSIA 1HYVA 1SUQB 3M9OB 4DLEA 4E3SA 3TVKA 3QIPB 3G86A 4E89A 4DSJA 4RNHA 4O5BA 4FS1A 5KFCA 4M3YA 2BQ3A 4KHQA 4KKOA 2XY6A 2E9ZA 3KK1A 1LAVA 4DFJA 4JV2A 1RDAA 3P83D 1QSYA 1TV6B 1S9EB 2RKIA 3T19A 3OYEA 4W5QA 1ZBIA 4FK2A 1S1UA 3PW0A 3L8BA 1HQEA 3MEEA 4IRKA 1S1UB 2ZD1B 3T5LA 1NK5A 1L3UA 3VQSA 1RT2A 2W7PA 4ECWA 3SCXA 2QV6A 1S97A 3ZSYA 2HHXA 1LW2B 2KFZA 1QSLA 1NHUA 2D3UA 4TXSA 3A2FA 1UOCA 1WN7A 3MF5A 4M41A 5KFSA 3AVMA 1SH2A 1NK9A 4O0JA 3DYAB 2DFHA 4OJRA 1JLFA 4ED3A 4CEDA 1KFDA 3KD1E 2B5JA 1RYSA 3U6FA 3THVA 4EO6A 1B9FA 3CQ8A 4DF8A 1RT7B 1XR6A 4J9KA 4CEBA 4CJPA 2XRIA 2VG5B 1S9GA 3N6MA 1S0NA 1LAWA 1XC9A 5KG2A 1J5OB 4DL2A 3OYKA 3DLGB 5L9XA 3E01B 2FBVA 4KBIA 2OPQA 2VG6A 4FJ5A 2W42A 4IG0A 1JXBA 4O3QA 4O3RA 2UVUA 2FBYA 1UWBB 3RWUA 3M8RA 3OJSA 3SZ2A 2FJWA 1NHVA 3SUPA 2OPPA 1JLBB 2AQ4A 1RA6A 3G6VA 5FDLA 3LWLA 4URSA 4IFYB 4CF9A 2XY5A 1BCMA 3OYMA 1RT2B 1WLJA 3AV9A 4CJRA 4ECQA 2VG7A 2WTFA 1J9AA 4DS4A 4JS4A 3MECB 2ZD1A 4BWMA 4RW8B 2WOMB 1S4FA 5F8IA 3BSOA 4QCLA 4RW7B 1HARA 1IKXB 1QQCA 2OPPB 4WXOA 3CDUA 1Z25A 4ECYA 1IKYB 5C24A 1FXXA 2ATQA 4LSNB 3TWHA 3NBPA 1L3SA 4GMJB 3SQ4A 2HHVA 3JSMA 3NF9A 3RAQA 4F4ZA 2HAIA 1Y97A 1G15A 3KLVA 3T5HA 2C2DA 4H4MB 3LWMA 5KFLA 4DQRA 5J2QB 2YV0X 4NLUA 2V4QA 2OPSA 3LZIA 3KIOA 4KFBA 3LZJA 3BQ2A 1JLFB 4EYIB 1LWCB 2QK9A 2Z1IA 4J9MA 4KO0A 4RUCA 3ZT4A 1WSFA 1LW2A 1EX4A 1N56A 1JLAA 1NK6A 3Q8PB 3LP0B 1KSPA 5KFZA 4EZ6A 1JKHB 4FVMA 4CFAA 4NCAA 2HNYB 2F8TA 4Z4EA 1HPZB 5HBMA 4MK9A 4CJUA 1S9EA 1SH3A 2OZMA 4C8LA 4OLBA 4WYWA 4ZPDA 3QO9A 3AVFA 3HK2A 4DTNA 1KLNA 4J2BA 5KG4A 4MKBA 4CK3A 4Z4IA 1C1BB 5K14B 3QIPA 4DTRA 3ZT0A 3LPUA 1Z4UA 4B8CA 2D7SA 4O0IA 3RTVA 1IKVA 3QZ8A 4FJ9A 4CFDA 3OSPA 1IO2A 3AO2A 3DLHA 4CJ3A 3L2VA 3H59A 1C1BA 4MQ3A 3HKWA 2IC3A 3I5CA 4B8AB 1KVBA 3VQ9A 3QO9B 3HHKA 4JV0A 1X9WA 1GX5A 3KK3A 3G6YA 4WZMA 4RNOA 2IS3A 1HPZA 2B6AB 2HNYA 1SKWA 1KHWA 4M94A 4RU9A 1S0OA 2WRMA 3LP0A 4ECSA 1U47A 4ED8A 3O4NA 1XWLA 2YKMA 1WSJA 2FLLA 4KB7A 2PYJA 3V6JA 1U49A 4FLTA 4CF8A 3OLBA 2C22A 1B92A 4N76A 4ZP9A 5KFNA 3RMCA 3OYFA 1U4BA 1A5VA 5J2QA 5DGAA 3IS9A 1YTUA 1C1AA 2FJXA 1MMLA 5C25B 4NLTA 4Y1CA 2YNFA 3K57A 1LWFA 4O3PA 2FBXA 3H4DA 3K5MA 2AWZA 1RNHA 5KFVA 4BE0A 1D9DA 5KFRA 4QWAA 4FW1A 3NGIA 4OLAA 4OPJA 1ASUA 4QWBA 5J1EA 3RR8A 3PY8A 4GVMA 3OYCA 4Z4CA 4F4WA 2YNIA 3ALYA 2HHUA 2UVVA 1U45A 1S1XA 1RTDA 1SKSA 1VSHA 5KG6A 4CGGA 3ZSRA 3B6PA 4DL6A 4DQIA 4ECXA 3OLAA 1C2PA 4HYKA 2JEIA 2J6TA 2ILZA 1LV5A 1QS4A 2XO7A 3M8SA 3TAFA 2O4IA 4BACA 5C42B 4OKEA 3L2WA 4KTZA 3QINA 3TAMB 1JX4A 2Z1GA 1UAXA 4ZP6A 2HNZB 5DG7A 1WSEA 2AGOA 3I5AA 3AVLA 4B9MA 2IAJB 1C1CA 2W9CA 1HYSB 3GV8B 3OS0A 5DQIA 1RBRA 3KK2A 3GIIA 3DOKB 2IJFA 2F8SA 3VQ6A 5C42A 3PR5B 4F4YA 4NLDA 4ZVEA 3N6LA 1SV5A 1RT3B 2YKNA 4FK4A 3G0ZA 1EXQA 3QEWA 3ISNC 3OHAA 3QEIA 2HVHA 4NZ0A 1KRPA 3MEEB 4AHUA 1RTJA 4FZYA 1EKEA 4RW8A 2ASDA 4KHWA 3T5KA 3SNNA 3V9WA 1KFSA 2QXFA 3HT3A 3NGDA 2F96A 3QETA 1U48A 4J9SA 1KVAA 3O3GA 4WE1B 3MFHA 5KFYA 3OYHA 5HLFA 3O3HA 4OGCA 4JRPA 3KHLA 3BGRB 2YNFB 2XWYA 4KHUA 1DLOB 4R0EA 3CYMA 3VQPA 1LWEA 1FKOA 1JLGB 1RT1B 3GIKA 4ZHRA 1J54A 3MR6A 4CEOA 3DI6B 4B3OB 4C8NA 2E4LA 2P1JA 2GIQA 4R8UA 4DSLA 5F8JA 3KOAA 3ASMA 4MIBA 1S6PA 3OHBA 4RW4B 4FW2A 4AH9A 3VQQA 1JIHA 2QE5A 1TVRA 3AA5X 4I2QB 4E7IA 3MXJA 2IM2A 5I42A 1X1PA 3C95A 2IDOA 2W7OA 2E6LA 4K50A 4KHRA 4FJIA 3OYGA 1TKXB 3C94A 4B9SA 3OYNA 3KLEA 3CDWA 2RPIA 4QOZB 4RNMA 3TI0A 3LP1B 3LP2A 3QGHA 1RT5A 1SH0A 3GV7B 1FKOB 4IOBA 4CECA 5KFQA 4K4TA 3DRSA 3WNHA 2R2TA 4LSLB 1DLOA 4NLRA 1BCOA 4Q8FA 1L3VA 1KLMB 3PR4A 3DLRA 3EY1A 1JLCA 4KHYA 4E7HA 1VSDA 3M8QA 2HNDA 1T05A 4MK8A 1TP7A 4J9OA 5F9LA 1ZTWA 4N56A 4FLXA 4ZTJA 4U7CA 4HCBA 5CYQB 5DLGA 2YNHA 3HYFA 2OPRA 3OYBA 3ISND 3AA2A 3KD5E 2BR0A 4TSXA 1QE1A 4DG1A 5DK5A 3TARA 4TY9A 1YVFA 4I7FA 4ECVA 4YR0A 3CO9A 4Y34A 3H2LA 3HSTB 1IKWB 2WONB 3IG1A 3C6TA 2B6AA 1LW0B 4IKAA 2XI3A 3SI6A 4F8RA 4OGEA 1S9FA 1N48A 2IMWP 4X2BA 3OYIA 2IC3B 5KFMA 2OYQA 4B3OA 3QESA 3CJ4A 1GOBA 3CDEA 3AVHA 2JC1A 4E1NA 1RA7A 1JLGA 5J2PB 4B08A 5KGXA 4W5RA 1BL3A 3IGVA 3F9KA 4CJSA 3L2QA 4DU3A 1HJRA 3QZ7A 4Z4GA 2OA8A 2ASLA 3KLGA 3I0RA 2V9WA 4IFVB 4CESA 5F8NA 3V1QA 3FFIB 3TAPA 3BSNA 4KHNA 4KREA 5KG7A 3NHGA 2DPJA 2WOMA 1NK8A 2P5GA 4OVLA 1WSGA 4AILC 1LW0A 2EC0A 2UUTA 3RB0A 4ELVA 1JKHA 4PWDA 5KFOA 1IM4A 1HQUB 1VSFA 1IKWA 5KFGA 4Q43A 1C6VA 1B9DA 4DU1A 4DTOA 1T7PA 3PX4A 4HUEA 3DLKB 1Q9XA 1RDRA 2G8UA 3SUNA 3D28A 2BRKA 1XI1A 3HVTB 4CF1A 4DSFA 4DMNA 4KO0B 1HNVB 2YNHB 4QW8A 4DL3A 4IRCA 3VQEA 1TAUA 5EWEA 1D9FA 1DTQA 1YTAA 3ZT1A 5JS1A 5KI6A 1SKRA 2VWKA 3MR5A 1U09A 2W9AA 5C25A 1TGOA 2ILYA 2UVRA 2R8KA 1TL1B 2HMIA 2G8HA 1HNIB 3PHEA 3OL6A 1TKZB 4IDKA 2XGPA 3H40A 2R2SA 1DTQB 4WXWA 5KRTA 4FZXC 5HLFB 3H5UA 5KFFA 4LD0A 4K4VA 4WFYA 3KNAA 4OL8A 2D41A 3RR7A 4Q0BA 2FJVA 4ECZA 4Q8EA 3MEDB 3K5OA 3KLIB 2J6UA 5F8HA 3KHHA 4N47A 3CFPA 3SUQA 4NYNA 3WNGA 3Q8RB 4FLZA 2R2RA 4HKQA 1JLQB 1FKPA 5CY4A 5F8MA 2V4RA 5KFUA 5FRNA 2KTQA 1WNEA 2I5JB 4CEAA 4E7KA 2GBZA 2Z1JA 1HYZA 4ZMMA 5HROA 1NNDA 4MKAA 4QAGA 2JEFA 1VSEA 1N5YA 3KKRA 2AX1A 1SUQA 5DQHA 3CG7A 4KB1A 1QAIA 1CXQA 2HVIA 2BQRA 3AA4A 1U04A 2Y1IA 5J2MA 1LWFB 1CZ9A 5DQGA 3NF7A 4CCHA 3D0PA 3V6DB 1WSIA 3K2PA 3HO1A 4IBNA 3NKYA 2LSNA 4ZVFA 5KFTA 4KE5A 3DRPA 2I1RA 4K4YA 4ELUA 4XPCA 1WNSA 4BDYA 3BJYA 4CK2A 4RG8A 4C8KA 3L2UA 3QIDA 3QNOA 3M9NB 4YP3A 2AGQA 2YKMB 3IG1B 1T3NA 1ZBUA 2BE2A 5J2NB 4DL5A 4TYAA 1RTJB 4M95A 2OPRB 3OYAA 3TANA 5CYQA 1C0UB 3QLHA 1VRUA 4KI6A 1NJXA 5KFAA 4FK0A 1W0HA 4O4GB 3KK1B 3GILA 3PJWA 2HNDB 5DMRA 5EU7A 5CZ1A 3TR8A 1CLQA 3NE6A 3CWJA 1QTMA 3H98A 3DRRA 4CHNA 2XY7A 3S3NA 3CVKA 3MR2A 4EEYA 1RT5B 4QWDA 2HNZA 1RAJA 4NCGB 4NLOA 4RZRA 4NLPA 2IM1A 1RDDA 4ECTA 5EDWA 2IOCA 1VRUB 4FXDA 4DL4A
chains in the Genus database with same CATH superfamily
4BR2A 2NLWA 1T03A 4XAKA 3QICA 3LA0A 2XHCA 2V8DA 3TAEA 2DGWA 3CC7N 1C0TA 3GJSB 3MWTA 1BQNB 1ZBLA 1OO0B 2AGPA 2OMOA 1P9QC 1KQSM 3OQ2A 3U7JA 2R7YA 3GPAA 4JI8K 4CEZA 4PA1A 4DG1B 3AVBA 1HD1A 1T9TA 4HWIA 3V9ZA 2OPQB 5TKYA 1FF2A 1HBNA 1K47A 1VK8A 1VQPN 5BRHA 5LXRA 2P9UB 3CM6A 3MPUB 2MXYA 1VSJA 1GMUA 3HM9A 3WNEA 2Z30B 4WWSA 1HR0J 4OFZA 4DZDA 5M1NA 3VWSA 4ED4A 5LM7E 1BD6A 3VQ8A 1ZBFA 5HRRA 2GGPA 3CD5A 3OT9A 1R0AA 4L6V3 2JEJA 4ZPBA 4X64J 4M3RA 5GAEI 2UUCK 1XK8A 3MN6A 2Z8QA 4OLOA 1JLQA 4OI4A 5ETRA 2E8AA 3LM2A 1X3MA 1K0TA 2DYAA 1F5AA 4PL7A 2B7CB 3QT6A 5B0FA 1YRUA 2D4WA 4QIWD 3MUVP 3OV7A 4B3MF 4V19J 2YKPA 1U24A 2AJFE 4DR7J 3AO4A 5EXWA 2D0OA 4P73A 1UWBA 4KFBB 3F73A 3AO1A 5AQWA 4JI5J 4DV0J 3POTA 4K25A 3TSUA 3V6DA 3M2VB 4WF9Q 4K4XA 1WEYA 4C97A 5GMDA 5T14A 2MKSA 3R5DA 4TU8A 2FF6A 1URRA 1XQIA 4X66J 5F1XA 1Y0HA 2B5JB 3OYJA 3BGRA 1RTHA 3HSZA 1FE4A 1QAJA 2CQCA 3B4DA 2IDLA 2KO1A 1JJHA 1XMQF 1RABB 3OPKA 4FKYA 4O8UA 2F5GA 1MU2B 4OHVA 2R7SA 1QM9A 3OL7A 3IDHA 5AJ3F 3DU5A 2PYLA 1N4LA 2I7PA 1RTDB 3GE1A 3TZXA 2IBOA 1FJEB 2CKWA 1AXQA 3D6HB 4M5IA 2HMPA 2CVIA 2G9OA 5FPDA 1FJ7A 2ASJA 1VI7A 4R25A 3QFUA 5IV4A 4CLPA 1S48A 2IA0A 4NX9A 1MDUB 3OTOJ 4KV8A 5D3GB 2Y9HA 5CZXA 4F4KA 4DTUA 3ENOA 2X3DA 2MGZA 2XNRA 4AHTA 3J7ZO 2DNPA 1HI8A 3FGVA 4AHRA 1URNA 1GTEA 2WFBA 2R2UA 4CJ5A 3FNNA 2OSQA 2HFSA 2HK2A 2EHGA 2B9EA 2R8HA 3QMLA 2G8IA 5RUBA 1NU4A 3KYLA 3HVTA 4P74A 2NUUG 3CEDA 1XNQF 4NE9C 3NOGA 1GOAA 2B0GA 1EWQA 4W5OA 2GJ2A 2CADA 2HHPA 3VGMA 3SMZA 3ZCMA 4KHMA 2XC9A 4W5TA 1WI8A 4FJGA 1LNQA 1FD8A 4X4TA 2LDYA 2FD2A 2EK1A 5M1OA 2RHKA 3BSAA 3CCLS 3V4IB 5AJ3K 2DXDA 3FKBA 2JRSA 6FDRA 1SL2A 2E2NA 5C2CA 4HVJA 4CTAA 2J0SD 5IFMA 4IG0B 2IJNA 4FYVB 1S72S 2ZJQQ 2M0GB 3OJUA 1WBDA 2QO3A 3L0QA 3KXDA 3VA3A 1F9HA 1REVA 2MSSA 3KLEB 5F8GA 5HOOA 1PJ6A 2MQOA 3V6HA 2ZHAA 5SZTA 2EFGA 4OZJA 2ZH8A 5F2RA 3ZYYX 2X1BA 2QEXS 3H42A 2GV9A 3ELHA 4FZZA 2KZMA 5K20B 3NAEA 2QLWA 1NK4A 1BY9A 5JICA 4F50A 5IWAK 4F4XA 4FYDA 3ENBA 2D0BA 4AXJA 1ZC6A 4ID1A 1NWKA 1VS3A 2BJ9A 1SL1A 5LMUK 4JV1A 3QSYB 1U1LA 1HQEB 3AFGA 5GADP 3TYTA 3D2EB 3R7BB 4XH4A 1UFWA 4ERDA 1T9YA 5T7BA 1H2UX 4J91A 3TPQA 1EP4A 3I6PA 1X31C 2O8CA 1S0MA 1TL1A 1VOMA 1R0AB 1EX8A 3LUYA 1ZAVA 2GIFA 1NLKL 3CHWA 2ZC4A 1MN9A 2DFFA 4H0TB 4JN4A 2E44A 1OY6A 4K5SA 3SI8A 4ZP7A 3OTEA 3NNAA 2MQPA 2MMYA 1UL3A 3VPZA 2QMWA 1BDGA 3R6LB 1UW9A 3K2YA 1NMDA 3GB0A 1T9VA 5B0BA 5HROB 3QEVA 2V8GA 3EDRB 4C6AA 3Q24A 4PWDB 3HI0A 4G3IA 5D78A 1EARA 2QLBB 2MHEA 1GFWB 5J2NA 1RZMA 1W2IA 4O44A 4ZJQA 4GKJK 2ITMA 1M5VC 5KOWA 1BQNA 3GDQA 3I0RB 4QW9A 3L2RA 4JI8F 4V19S 4M63A 3MCNA 2XBPA 2Q2RA 2AKWB 3GP9A 2ZH4A 3SBTA 3RBDA 1T6CA 5AQLA 2P5OA 1LWCA 2R7XA 4CJLA 3RRGA 1I5OB 1WKJA 3P5JA 5DM7L 1QDUB 3QEXA 2JX2A 3LDPA 2ZE2A 3DXSX 3ILLA 4WTYA 3NGZA 4CP5A 4BC7A 2VBYA 3TAMA 3RB3A 3O44A 3AJDA 4DV1J 5KPZA 1JNZB 1S99A 4FBUA 3ADAC 3GU0A 1IKYA 2R3VA 1S1TB 2DGQA 5KT7A 3B4MA 3TEGA 3AVAA 1K9MT 3PFEA 4D3GA 3IWNC 3CCLN 3P96A 2WHOA 1K6YA 3IFRA 3ENQA 4DV3J 2Y1LB 2IDEA 4GVBA 1A5WA 3AGKA 3GJTB 4BR9A 4AHVA 2PY5A 2NYHA 3GIJA 3PCOB 3VEXA 3W66A 4BDPA 1VBXA 1QHAA 3J80Y 2HB5A 3ZSZA 2LQ9A 2KKZA 4OPHA 3EEQA 2KG0A 1G3OA 4HUFA 3MN9A 1S4EA 1LKZA 4ZLNA 4OYBA 4CHOA 1ELOA 2FGCA 2IRYA 1GH8A 5CYJA 4E0DA 1V3RA 3JAMO 4HH1A 2NPFA 2RQCA 4FYXB 2HWTA 1EP4B 5C10A 5IC6B 4FYYB 4USTA 1J5OA 4XDCA 1G2EA 3I8DA 1WF0A 3ZT3A 2P9GA 3TP2A 3IMQJ 2HHWA 2CPXA 4BRKA 3GFYA 1RTZA 4IO9L 4I9LA 4PZVA 2O3DA 4W4MA 2BQUA 1VRTB 2MZQA 4N41A 2DD8S 3D6RA 4KBOA 1VBYA 3PV8A 1T9UA 3VGVA 1APSA 4HACA 5LY3A 2LU1A 4CIOA 4C8YA 1BUXA 4JV5J 2ITGA 5JS2A 4M3UA 2WSFC 5JVHQ 2E9RX 5GAGP 3CCUS 3O4WA 2ZM6K 4WJBA 1EQMA 3BO2A 2YHAA 3HT0A 1Y7PA 1RCHA 4YR3A 1VC6A 1ICEB 1HNWF 4CGIA 4BE1A 2H5IB 4K7QA 3DMJB 1D09B 1YT3A 2QWQA 4FWNA 1SIZA 1IVZA 5KFKA 1YDLA 3BBBA 4J2EA 2DT9A 1TAQA 3MM7A 2KHDA 1QLNA 4JI6K 2ACYA 3IS9B 1VQOS 2QWLA 4DN9A 3OTCA 2E7WA 2YNGA 1XN9A 2G2YA 5ETSA 2Y1JA 4R5PB 4M45A 3CNQP 2V52B 4LT6A 1UWAA 1DKGD 1T8EA 1TL3A 5CHIA 4QYZJ 1N36K 2WK4A 1VFJA 3KMQA 3NXZA 4WFAL 2RU9A 2Q3SA 1BHLA 2MQMA 3DWLA 1YX2A 1O51A 1X5TA 5KFXA 5HRPA 3EZUA 3D68A 4CLYA 4PYAA 4ALZA 1UETA 2RQ4A 2P9SA 5B0GA 2OZSA 5A0YA 4JP8A 2F3JA 4L75A 4JUZA 5G0RB 4DCOB 1Z2ZA 1RBTA 3S6EA 4CLKA 3TZZA 2GVDB 3AGRA 2C3OA 5AQTA 3R3LA 4OZ0A 4ZPTR 3LTOA 3H6EA 1N5SA 5GIOA 3KLFB 2ZH2A 3TZWA 4CI0B 3UI3A 5I42B 2VG7B 5C2FA 3BQ0A 1ROFA 3HLUA 3IFEA 2APOA 1EETB 3THXB 3VZHA 3CULA 2R9LA 2NUBA 4QBUA 3N4QA 2WBMA 4NLYA 1NKBA 2DGUA 4YMEA 5K9FA 4PQUB 1VQ5N 4X4OA 2OCEA 1KD1T 2NR0A 2UUWA 3Q8QB 1HNIA 4UQGA 1KN6A 2E1AA 3FDSA 1Z6RA 4KI4A 3U27A 1J5EJ 2H9ZA 1YVUA 4YOTA 3VQDA 1HI0P 1M5KC 3HFVA 3FE1A 4I6WA 2Y0SD 1GXLA 5LSOA 1C0MA 2QFIA 1O0PA 3Q7CA 1RCOB 3UKRB 5A2QO 3PM9A 3CJQA 2VQEF 3GYNA 1NSPA 2GHWA 4CZMA 5GAGU 3V9SA 4OV1A 2YWFA 3PG9A 4N5SA 4B1UB 1JLBA 4F3QA 4FZVA 4J9RA 1NCLA 3VAHA 5J1EB 4CJFA 3AB4B 1C4CA 2OTJN 4YOYA 1ZZNA 1IKVB 2O8EB 2HVDA 3CJAA 4KC5A 1DTTB 1TUVA 1OQ3A 4AQYJ 5KFEA 2ZH7A 4CWBA 4HVZA 1VK3A 4ED0A 3G87A 1MN7A 3K5NA 2HURA 5I3UA 4WK3A 3THYB 3M8PB 4NA1A 3HI9A 2ASYA 3K58A 5KPTA 5ADZA 2JLEA 4TQRA 4UZCA 4CNZA 2ZH1A 2NXNA 4Y3CA 2E7XA 3PW5A 2CJQA 1C0TB 3JQJA 1KP6A 3D7EO 2RAQA 4ZVGA 4YFUA 5KT3A 2U2FA 3CUNA 2VFRA 3MXIA 1Q86T 5AQVA 1RP5A 3HFKA 4Y2MA 3KK3B 1TL5A 3GV5B 4HLBA 4URQU 2BW2A 2VBXA 4EYHB 2NXJA 1O1WA 4FYWB 4WFXA 2RSQA 3ETMA 3F2KA 3M2UB 3MM5A 1YJUA 5EX0A 4O4RA 1M5HA 3DJCA 4USIA 3QRQA 5CCMA 1GX6A 4X4VA 1RB0A 2XSJA 5IT9Y 3CCES 3C6UB 1HRHA 3H08A 2C28A 1U1KA 5LJ5Y 4Q7AA 2W9BA 3OVNA 1IBMK 2QWRA 2Z58B 2A42A 3SV3A 1UA1A 4GV6A 4FPAA 1G99A 4FM0A 3MM6B 4DR6J 5JVGQ 3MTKA 2IVMA 4XO0A 3R1HA 3D3BJ 3M4XA 4DR5K 3DOMA 4E1MA 4J2DA 3PO4A 2UXCK 5DM6Q 5H9FK 3VETA 1FFGB 4LQ3A 3J7A1 5AFUA 4TN2A 2MDAA 5HP1A 4RNFA 1WORA 1SPBP 4CI6A 4F67A 2ZJRQ 4FO0A 4DV5J 2XSJB 1FNOA 2RB7A 2ZJPQ 2BXJA 5JLFA 2HVEA 4YORA 3EVMA 3O8MA 3DDNA 4DLEA 3QIPB 4DR2F 4E89A 3BN4A 5D4LA 4FS1A 5KFCA 5IV3A 4M3YA 1W7WA 4KHQA 2E9ZA 1ZH5A 1LAVA 4I67A 4C1NI 5B0AA 1DAXA 3T19A 4MLEA 2ASOA 3FZKA 2PA3A 1B7YB 1ZBTA 4M5MA 1E6YB 2GS8A 1ITPA 2ZD1B 1JCEA 1JCGA 1FRMA 3VQSA 2LXIA 2UUAJ 2W7PA 2QV6A 4AQYK 4BC5A 1OVYA 1QSLA 2D3UA 1AUDA 1WN7A 2FQQB 4P52A 3RYLA 3AA8A 1H98A 2QYGA 4MT1A 4F26A 3L3CA 1IBKK 2JZ5A 2E2OA 3W5XA 4ED3A 4W92B 5LSLA 2B5JA 2G0IA 2ZWHA 3L95X 3DDIA 1RT7B 1XR6A 1S7HA 3UD3P 5FIIA 2VG5B 2J9DA 1S0NA 3N6MA 3VHQA 3I9ZA 4F02A 1N34F 3W62A 3NEKA 3OVSA 3E01B 2FBVA 4KBIA 4IG0A 4A46A 1I94K 1PJ5A 3FC9A 3WX8A 4USMA 2VIHA 3SZ2A 1NHVA 3QPIA 3O2IA 3QBXA 4CLUA 1LFWA 1JLBB 3MCSA 2X7IA 4W98A 3M5RA 5FDLA 4L74A 4CF9A 4QQBA 3P38A 3D0HE 1N34J 2NRWA 2BBEA 3OYMA 3AV9A 2NSCA 3A4TA 4BWMA 2WOMB 5F8IA 3CCWA 4JOUA 4OPAA 2OPPB 2HVZA 4HHHA 4KHPJ 2YHWA 4U9RA 1Z25A 2V69A 4NMXA 2KFYA 3OVAA 4LSNB 3TWHA 4GMJB 3SQ4A 2H3GX 4DV6K 1GMWA 2FHOB 1BUPA 4UY85 2HAIA 2JH3A 4M7YA 5M1PA 4CH0S 2YV0X 4FWSA 4GO7X 1Y3KA 3LGNA 3KIOA 4FWQA 3OTOF 2VQFK 4FWKA 4JKBA 1PC4A 1JWWA 1WELA 3FK4A 3ZT4A 4BHQA 3DLLL 1LW2A 1RBOB 1EX4A 3I55S 3VAGA 3SAGA 1CS4B 3CO0P 1YJWS 3TTFA 1HWKA 3LP0B 2Q43A 4CZHA 1JKHB 1LOTB 5HBMA 2P6SA 4MK9A 3CSKA 2OIHA 2GMJA 2OZMA 4C8LA 2C2KB 2H1YA 3QO9A 1GXUA 1QY7A 4MKBA 3RUBL 3W61A 4Z4IA 1RADB 2VKZG 8AT1B 4MO5A 3OFHA 3LPUA 1YRTA 2F65A 1EWRA 3CCQS 2D7SA 4IEIA 3VAJA 5EX3A 2QA4S 5D4OA 4DPOA 2A2DA 5ELZA 4Y65A 2D3O1 3MX2A 4DBQA 3F5TA 1ZM2A 1VQ5S 3J81O 3L2VA 3R7SB 3H59A 2F9TA 2VYPA 3MAHA 2GMLA 2K3IA 2FGOA 1Z1ZA 2XMTA 2XEXA 3AXKA 2ZDOA 2ZITA 4UW2A 3IAM9 1HLUA 5DDPC 4M94A 5BRFA 2WRMA 3LP0A 1R59O 2ROGA 4ECSA 1IXKA 4ED8A 1XWLA 4CLLA 2YKMA 4DX5A 3D6MB 3BYPA 2RRNA 3OLBA 4FOIA 3G8TA 1H7XA 1B92A 4FDFA 3VTIA 4ITSA 5KFNA 2HLUA 1UFLA 4GMKA 3AARA 1F0XA 2JJ4D 5C25B 4FWPA 2UUAK 3SMPA 5B08A 4ES2A 2OLWA 1GLBG 2YHXA 4X62K 3O5BA 2AWZA 1RNHA 5KFVA 4BE0A 5IS2A 1RHKB 1IM6A 1NDCA 2RILA 2CJAA 2HGNA 3CF5Q 4J5OA 4OPJA 4OLAA 3RSEB 2J7KA 5E5NA 4ISFA 2CQ4A 3OYCA 4F4WA 3W8PA 2R7QA 4KYZA 1FWKA 2HHUA 5IM0A 1S1XA 3O5TB 1VSHA 3FLCO 1KXPA 3PHTA 1NAQA 4DL6A 4ES1A 4ECXA 4LFBJ 4HYKA 5BR8F 2ILZA 4ANDA 1UW4A 4OX9K 2XO7A 3VVTA 2E5JA 2XO6A 2JFKA 4GV9A 1NDPA 4JI2J 3K9JA 3EDQB 3IC1A 3EXCX 3QINA 5C15A 1K8AO 2Z1GA 3W9JA 4DV4J 3CCMN 2A5XA 3HULA 4X4SA 2BJEA 3AY0A 5HMZA 4OZ5A 1X4DA 1DBDA 4P9SA 4P72A 1WHWA 2F9JA 2IAJB 4C0OC 1UVNA 1UTAA 4KT0C 1FWPA 1X4BA 4BRCA 3R5CA 4LRFA 3CTRA 3DOKB 4EK2A 1CJTB 4P2XA 3VQ6A 4YDDB 4I1TA 4ZVEA 4OYPA 4FK4A 1FXRA 3AT1B 4KH0B 3ISNC 4JBCA 4QIFA 1WHVA 3QEIA 5FPEA 1N8RO 1FESA 2XMKA 4DV1F 4CO4A 1E6YA 1NLVA 4KHWA 3SJHA 4OYAA 1X9JA 3SNNA 1IR1A 1KFSA 3NGDA 2ZZNA 4J9SA 2IFXA 4WE1B 3MFHA 5CCLA 3TUZC 4EMDA 3OYHA 3PJ9A 3T7ZA 2QG9B 1Q8LA 2PD1A 4JKGA 2XWYA 4KHUA 5KOXA 1DLOB 3OXGA 4ZS6A 4KRWA 3U1NA 1RT1B 5B7WA 1VQ9S 2MPUA 4ZOSA 2HBZB 5DDRC 3EXYA 3UVJB 5CA5A 3VOVA 3IUCA 2HRYA 4PKGA 2V9KA 1AFIA 2J5AA 1GK8A 1SJQA 4EWTA 4IWVA 2U1AA 4WBFA 4ENOA 4M5LA 3K7RA 3FMBA 2EW9A 2ABYA 4RW4B 1B70B 1JIHA 2QE5A 1TVRA 4E7IA 2KM8C 2IM2A 3C95A 4KHRA 1YZ6A 4WCEL 1U1PA 4B9SA 3C2PA 4DX7A 2ZGYA 3VEYA 2QJ3A 2RPIA 4QOZB 4RNMA 3TI0A 3LP1B 3CCVS 4AF1A 5KFQA 4MKYA 3ETOA 1DLOA 4J9VA 5AE2A 3R8YA 2I38A 2FZGB 1F5CA 1NM1A 4KHYA 4E7HA 3O08A 3QWUA 5A8WA 3M30B 3MMAA 2AJ0A 1FX2A 3WBZA 1T05A 4MK8A 3QJPA 2G1HA 4J9OA 5F9LA 3WQTA 1AW0A 1ZTWA 4N56A 5GAEU 3HYFA 3ISND 1XBWA 3AA2A 5HN0A 3MM8B 2ZH3A 4ECVA 4YR0A 4Y34A 3HSTB 1X4HA 3J80U 1FNMA 2YX7A 1LW0B 3L4QA 4IKAA 4OGEA 5D6GA 3L7OA 2FHJD 3MGJA 4A8FA 2OTLN 2V7YA 2MKCA 3CDEA 1TU0B 5F3ZA 1S7IA 3M2RA 1RA7A 3Q2SC 3HFZB 4N7TA 4B08A 1FD2A 1WJ9A 1BL3A 3J7YU 4CJSA 1R6VA 4GKKK 3UDVA 3W65A 1NUEA 3DXMB 1U2VA 3KLGA 3MI7X 2V9WA 2KRBA 1D3WA 3V1QA 1P8GA 1QVFR 2ZKTA 5KG7A 1JJ2R 1NK8A 2QSWA 1ZPWX 4F04B 4WQ5C 2QL9B 2LDIA 2DBBA 1BE4A 1QTNB 2GVZB 4RBVA 1LW0A 2XZWA 3M1FA 3GFHA 3QFHA 2P9LB 3PTWA 2BJ3A 1B9DA 4DU1A 4TVAB 3C14A 2M88A 4HUEA 3DLKB 4Y2IA 1HNXF 2BRKA 1XI1A 3HVTB 2DNRA 1HNVB 3DRXA 3VQEA 3UKUB 2V2VA 5T41A 1YTAA 3ZT1A 4JKEA 1SKRA 3L6QA 4HDGA 2QGFB 3MR5A 1U09A 1VHFA 3KJFB 4YB6A 3EKSA 2ILYA 2UVRA 2WAQD 2E88A 2LMIA 3OL6A 2P6TA 4AM7A 4LRDA 3C6AA 2R2SA 3QT8A 4CDIA 1DTQB 4WXWA 1TTHB 3K9KA 3H5UA 2XMJA 4BRAA 2E1PA 4FNIA 2DNLA 2D41A 2MTLA 3RR7A 2FJVA 4ECZA 3KLIB 4AL7A 1J5EF 3ZX0A 3GLJA 2VJUA 3ZNJ1 4HKQA 3PXGa 2EFVA 1B7FA 3QQCD 1ILYA 5FRNA 1YSJA 1EO1A 4DX8H 2MLYA 1I3OB 2DHSA 4DV7J 4B3TJ 2GBZA 3CIMA 4UTGA 4NI2A 5HQMA 1CEZA 2JEFA 1N5YA 1CULA 2AX1A 5DQHA 1QZ5A 1QAIA 1CXQA 9RUBA 1CLFA 1U04A 2Y1IA 5IT9U 2K2PA 2RE2A 5DQGA 4DHVA 2CJBA 4CCHA 3V6DB 3W5YA 2YQ0A 2Z4PA 2QLJB 2LFVA 4ZVFA 5KFTA 3JAMU 4PR6A 2N3OA 2I1RA 4K4YA 3AH6A 4RKUC 4ELUA 4K42A 3B82A 4P6QA 4BQLA 3VERA 3W63A 3IG1B 1UEUA 1M5OC 3ZLJA 2PEBA 3N79A 3MCMA 2HIYA 2BE2A 3CD6S 3H20A 5D8HB 1C0UB 1VRUA 1TYQB 1RWWB 4FPBA 4FK0A 3U9DA 2EWHA 3KK1B 3MEKA 4OYIA 2HNDB 5DMRA 4O0NA 3WQPA 2YJEA 2K7KA 1SC1B 1XC3A 3CWJA 3DRRA 2XY7A 3S3NA 3CVKA 4Y00A 4G1IA 2Q0UA 4OLPA 1FW6A 4IJNA 2E5LK 1OSCA 2IM1A 4ECTA 1TYQA 4HH0A 3FVYA 2FJBB 3VAKA 1VQSA 4FXDA 4DL4A 2P9KB 1IJEB 1Z2LA 4YDUA 4ED6A 2H65B 1UA0A 2RHSB 3TRGA 2IA6A 4LF7J 3TA1A 3TA2A 3PLAA 1B64A 4G9ZA 2MKKA 2ERRA 4M3XA 4CHZA 1M1GA 3GJQB 3CXCR 4R5PA 1NGHA 4QIEA 1VK0A 3DOLA 5THWA 3FZFA 1QJHA 1Q79A 1ASWA 3FEZA 2QWOA 3BDPA 2YJFA 2HQCA 4K8RA 2HFUA 3UNYA 3KJVB 4H54A 2G8FA 3ISZA 2VICA 4YHHK 1XR5A 3QB0A 3MMVA 4FJMA 4L8RB 1L5UA 2G8VA 2O1PA 3U02A 3K17A 2DH8A 5CZ2A 4A2AA 4B1WB 3UFCX 3ZZOA 1MWQA 4FJKA 4CJKA 1NGDA 1C0UA 4H0YB 4JKDA 4JYAF 4CH7A 1YF5L 3SXLA 2KKHA 1DT9A 2MKYA 1SVDA 1JLAB 4NLXA 3C46A 2FC0A 1CS4A 1N6QA 3HP6A 2Z2ZA 3BYRA 3CETA 2OEKA 3NRBA 4KTQA 2YKNB 4C2MA 1XR7A 1DY3A 5E3PA 2R8IA 2CGJA 1CPZA 4JD2A 1E4GT 4DR7F 3M1VB 1U26A 3DGPB 1RISA 4LR7A 4AT1B 1XHXA 1MNEA 4MKVA 2M9KA 4YS2A 2FY1A 2Z56B 2W4CA 4RPFA 5AXMA 1S1WB 4JI0K 3ZFVA 1VAZA 1DURA 2X6NA 2ZH6A 3PIOQ 2VPWB 4RW6B 4JI3F 5LMNJ 5HP1B 2OJ3A 1DEJA 3MR7A 5ETMA 1N5YB 3IRXB 3ZC4A 4IR1A 4DR1K 3KUEA 3H5YA 4FJHA 3R8EA 3NCPA 2HQIA 1S6QA 4K4ZA 1W9HA 3CCVN 3C7NA 3JTOA 1VHXA 4FLYA 3GR1A 4NO7A 1N54B 1XMQJ 3VESA 1YHQS 1HBMA 3SEOA 4E98A 4NLBA 3OW2R 5AQIA 4NOHA 1PAEX 1IR0A 2L9WA 3CPWR 4IG3A 5EHHA 1YI2N 3F41A 2QWNA 5ITHA 5KQ8A 3BQ1A 2D0PA 3LL3A 2D0AA 4DV3K 3DLJA 3MM5B 3M2UA 1SJ4P 1BGXT 1TFYA 1S12A 4ED2A 1UFKA 3BO3A 4USKA 1UPPA 4FJXA 1NH7A 2OI2A 3TAGA 4C9DA 1I3AA 3THPA 2PAVA 1HWLA 3W60A 2PT0A 4NB4A 3NGUA 3LAMA 2DPIA 2CPYA 4JKFA 1BA1A 3W1YC 1RGIA 3I55N 1BOTO 4IFYA 1N33K 4DTPA 3VAIA 3J80O 4YN3B 4QPXA 4YQWA 4PRFA 5EUHA 3CC2S 2N4CA 4RU2A 1H74A 2EC2A 3AVGA 3RJMB 1WWHA 3G8SA 7AT1B 5KFPA 4YOEA 4LF6F 5CXTA 1QSSA 5KG0A 4ZVQB 3VR1A 2DGXA 4MAKA 2VBZA 5SWMA 2AEMA 2G8WA 2CPHA 2KJWA 3RMBA 3UWTA 2XULA 3T1HF 1TQLA 4KGVB 2R4FA 4RW4A 3W3DA 2GJIA 2D5RA 2GA7A 1XMOF 4IJAA 2EK6A 1K1QA 2M52A 3O1LA 1GLDG 3KTQA 2KRRA 4KPYA 1YJWN 4BBYA 4J9PA 3QYYA 3DRPB 3CCSS 4NYZA 1RT1A 1LEOA 4CEFA 2GJFA 4H4MA 4TU9A 4Y0WA 4TU7A 5HJXA 1IBLK 4DS5A 1HNWJ 4QIGA 2XCPA 1BWEA 3ULEB 3JSMB 4LF9K 1RLDA 3KG1A 2QT7A 2KHCA 4F7VA 2YWEA 4CTAB 4FM1A 2E1RA 4RO0A 4IG3B 2FVSA 3GQCA 3NAIA 4LBIA 2DNHA 2XI2A 2X74A 1EETA 5A8RB 5AQRA 3BSCA 3VQ5A 1FKPB 4UUXA 3BEGB 4G6VB 5BXIA 3PIPQ 1S6PB 2GEMA 1HMVA 4O23A 1HQ2A 3SAHA 3I0SB 2VWJA 4CBXA 3MM6A 1QUVA 2GNKA 1FRIA 1OPZA 2GO9A 4E19A 1J27A 1YGYA 4WFZA 2E9TA 3VGSA 2W9BB 4RW9B 3AAWB 5G0RA 2V34A 4WFBL 4DQSA 1FRKA 3BH7B 4ZCIA 2X78A 1K73T 5HRNA 3J7AP 4CNYA 1TKZA 1Y3JA 3W2VB 3G71S 1G6BA 3IR7B 2QWPA 1RLCL 2KT2A 3OA9A 5E26A 1CXUA 1S9GB 2CQ2A 4X4NA 4ED1A 1EQ0A 1GLJO 3UIQA 4L3NA 4B9LA 3N9UC 2C42A 3DGPA 3V6KA 4DF4A 5AXKA 3HVWA 1UVJA 3L3UA 2ALZA 1FKAF 5IT0A 5L1IA 4NRTA 5EVZA 3AJ2A 1TKTB 5AQOA 1MMDA 4IYQA 4USUA 4ZN1A 2UV8A 3P5TL 2PGCA 1RHJB 2CPFA 2E66A 2FY8A 3T6BA 4LIWA 5AT1B 3VV2B 3H4BA 3KLHA 4F2SA 2DB1A 4R79A 3MEDA 3VA0A 4C48A 5LJVA 2JC0A 2IM0A 2Q3PA 3IMXA 5M1FA 2JEGA 2GGPB 3D2WA 3RBEA 3TTCA 2DH9A 5E7OB 1RTHB 3OVBA 3D6TB 3KDOA 3OL9A 4LSLA 4PG4A 1YJRA 1OY9A 3M8PA 3VQAA 6AT1B 3CCMS 2HW3A 3R2DJ 3D5MA 2P9UA 3SSSA 1K9MO 1UEVA 3QIOA 4Y28C 3HZEA 5KG1A 2OHDA 5KFDA 1RWNB 4CLSA 5IQ6A 4TQSA 3V9XA 3J7AN 3BM7A 3PEHA 1X4FA 1VYAA 1FJGK 4XIUA 4KHSA 4ED7A 5L8RC 2FHJA 3PUFA 3M6UA 2F8EX 4JLHA 2BANA 2M8HA 4ID5A 4DUYJ 3X1LB 2F9WA 4CJTA 4FP9A 4A4JA 2I2YA 4CJQA 3I8BA 1JXLA 2GW8A 3UD5A 3L4IA 2YKQA 2P9CA 2YPYA 1U1QA 3LDLA 3VEVA 4A5AA 4H5WA 3RAXA 4BR0A 3ENVA 3E51A 4ILGB 4Z7CA 3U1MA 3RMDA 4FLWA 4HL9A 2RKIB 3A8EA 1RBUA 2DRAA 4IDHA 1JL1A 4NLGA 1WC3A 4H0PA 3I31A 1S3XA 4NCGA 5F0UA 3K59A 2QKBA 4KKOB 4NXMK 1B0PA 4EAHD 4JEPA 5ETQA 2MB0B 2WSCC 5C12A 1G7CB 4IH7A 2OFGX 1QUPA 3OXLA 3IBCB 3CCUN 2BGGA 4F3TA 4LH5A 4FJNA 2Q36A 4G1QB 3I33A 1D1UA 2PZSA 4LFAK 3BO4A 5ETNA 2DFEA 2YHBA 4WCEQ 4BC3A 4GVBB 1NPRA 3EJMA 1MROB 2Z2LA 2OMLA 2EXUA 1KONA 2C2EA 2RJZA 3V2UC 3OHRA 2FBTA 4FJJA 3WEEB 3ZSVA 2DGVA 4DEZA 5BYSA 4CJWA 5KRSA 4IO9Q 5DG8A 4HACB 4FM2A 4LF1A 4NYFA 1WDDA 3UCGA 3FFIA 2KT3A 4DTMA 1VSMA 2W9CB 2DHGA 2O8FA 1SBRA 3HPHA 3MM7B 5BYQA 4TNOA 3X3UA 1I6JA 3LM9A 1Q7YO 1TK0A 4P2SA 1NGBA 1YBUA 2VUGA 2KXFA 4DV0F 1VRQC 2PIIA 1RWUA 1YG0A 4ZVRB 2FVCA 4CF2A 4M3ZA 3SLCA 1ZAXA 1WB9A 4RL1A 3FQLA 2MKJA 1I39A 4DFMA 4GC7A 2DR7A 4QPTA 3TJ9A 1NGAA 2XCAA 3AVJA 4LF5K 5AE1A 4XDDA 2CQIA 4JI7K 3VF4A 3C6TB 3FSXA 4ILHA 2YPZA 3PX0A 1TL3B 5F9NA 3MR3A 3KVGA 4DTXA 2RNEA 4I4BA 3VGLA 2W4DA 3IA0A 4K8XA 1BIZA 2EEYA 1JJ2M 3KK2B 4EBCA 3BF1A 4DR5J 5HRSA 3TABA 3SBGA 2FLOA 3PW2A 4JI8J 3CMAS 3SQOP 1PSDA 4ISEA 3FZLA 3TX0A 3CCJN 2XS2A 5AQHA 2D0CA 4EUVA 2VC1A 5CZVA 3HX9A 3AVIA 1XTZA 4QR1A 5K8OA 4DV5F 1HNVA 4H0VB 1WKLA 3LP2B 3BH6B 5IC4B 3OS1A 3V5RA 2W2PP 2DCLA 4USHA 1VBZA 3LDQA 3ZSWA 1IKXA 2ZNZA 3LDSA 1DQ8A 4CT8A 4O44B 1XNQJ 3H2VE 2UU9F 4Q2LA 3HHLD 3QAUA 4HI2A 1QVGR 3MMBB 2VODA 4K43A 7FDRA 1CBKA 1NJYA 2RDIA 1VJWA 2IGIA 4U7UD 3P49B 2DNMA 5HL7L 3FCHA 1UVIA 1H1VA 2DEIA 1ASVA 3CPWM 1LWEB 2V4JB 4OHZA 4Q45A 4FWOA 4M7XA 3BGLA 1U6BA 1NKCA 2CQ0A 4PABA 1NH8A 1N0VC 4TYBA 3Q86A 5E3CA 1RU2A 3Q8SB 2OTJS 2VF3A 5DG9A 1E6VB 2HLTA 4LREA 2GC8A 5KG5A 1TL4A 3LALA 1RJJA 3N4WA 3W2WB 5FRMA 3LPTA 2MQ8A 2QZ8A 1TMMA 3C6UA 3CFOA 2RRBA 2BM1A 2P2CB 3CJ5A 3HD1A 3JB9k 4DQPA 4FJLA 4FJ8A 4U67L 4KV8B 5D3GA 1BIUA 1HYSA 2RDDA 5AR0A 1JQGA 1MSWD 1IH7A 1D8YA 1C1CB 1BO5O 5K14A 1WHXA 3CDAA 4LF8K 3TNVA 4B9TA 4B3RJ 5B8HA 2WC9A 1HHSA 3FQKA 3P1GA 3V4IA 1WSRA 2CNKB 4C3LA 3S3OA 4PKHA 4M5DA 2WUSA 4QWCA 4NLCA 4USWA 1WAFA 4YOWA 2O01C 1RFQA 1VQKS 2VB6A 3OS2A 2GUPA 5KT5A 5EY4A 3AVKA 2HHHK 3K8WA 4DR6F 4ICLA 2VA3A 3IRXA 1JXEA 2CQHA 3NGYA 4L3KA 3HBTA 3BKTA 1IJFB 5C5JA 1REVB 3OYDA 2HHQA 4OPKA 3OSNA 3OYLA 4P10A 3SQ0A 4LF4K 5HQLA 2FHKA 3FSIA 1SUQB 2I7NA 3CMEN 3TVKA 1RE1B 4DR4K 2HK3A 3VZIA 4DSJA 3IKMA 4O5BA 3R97A 2ZEJA 4BRGA 1CJKA 1VIOA 2LVWA 5HO4A 1XNRK 4ZIVA 2DNZA 5FLXY 4DFJA 1XJWB 3P83D 1QSYA 1S9EB 3OYEA 2CZVC 3CJRA 3UN2A 4FK2A 1S1UA 3MZIA 3T69A 1HQEA 1F2GA 1S1UB 3T5LA 3EKUA 2G13A 2HPUA 1RT2A 4ECWA 1S97A 2FJAB 2KFZA 1K8KB 3A2FA 1UOCA 5I9EB 3AD8C 3AVMA 3LW5C 3DYAB 1TUUA 2DFHA 1HNZF 1JLFA 1N36J 2XZTB 1KFDA 3THVA 1B9FA 4CEBA 2UXDF 2GV1A 4I56A 1YZ7A 2ZBCA 1LAWA 1XC9A 3R27A 3SCLE 1BG3A 3HKZD 4LF8J 2KI2A 3G4SN 2OPQA 2HHHF 4FJ5A 3EM1A 3L4BC 4U7UK 2W42A 1TL7B 1HL6A 2UVUA 5M1QA 4ZCLA 1UWBB 1VIXA 2DHAA 2O8DA 3M8RA 1QZ6A 2D74B 2CNNB 1GMVA 4WU2A 2HBMA 1N32F 2MZTA 2RRAA 5AFUH 2YQ3A 1CC7A 2H48B 4H0OA 5D77A 1BCMA 5BYRA 1WLJA 2LA4A 2WTFA 2CFXA 4DS4A 4LF8F 3EVOA 1HKCA 1S4FA 3CGIA 2P9IA 4RW7B 2K7JA 3M6XA 5IM0B 4DV4K 4J8FA 1Q4RA 4PG5A 3U1LA 1SZ2A 2AYBA 4KY3A 2GVDA 3GYXB 4O5FA 2ATQA 3W5ZA 4DQ8A 3ZTQA 3JSMA 2P9SB 4IQMA 4LF2A 1U1RA 3GE9A 2OO4A 1SI9A 2LCWA 4P2FA 1WC0A 4H4MB 2LECA 4DQRA 1SC3B 2OTLS 1SQFA 3D3CJ 1K0VA 3MAAB 3LZIA 1VISA 3BQ2A 2B9WA 4BROA 1PGZA 1SQGA 4KO0A 2XM3A 2X1FA 3W2WA 4CZGA 1R0BG 4CQ1A 5AXLA 1WSFA 1WBBA 3A3PB 4UOCA 3ZEUA 1DFDA 3PSFA 4A57A 2AF6A 3TR5A 1JLAA 3KNGA 3THXA 2DO4A 4KIAA 4LF7F 3H1VX 2KLAA 4FVMA 4BREA 4LFCJ 4Z4EA 5GVQA 2KVQE 1F6TA 2FTRA 3IBFB 3IR6B 4ZPDA 4DTNA 4J2BA 4CK3A 4B1YB 3Q2TC 4DTRA 4QS7A 1HD0A 4LJMA 3ZT0A 1F1BB 3ZZYA 2I8EA 4B8CA 3RTVA 4ED5A 3Q83A 1PBAA 4CFDA 3AO2A 1F3FA 2KT5A 1YIJN 4FF4A 4MQ3A 1ULRA 1WOQA 2IC3A 2QA2A 3HRGA 4B8AB 1YXQA 3QO9B 1WDTA 4JV0A 1GX5A 3G6YA 4WZMA 2IS3A 1HPZA 2B6AB 2BACA 2IPOB 4DV5K 3O8WA 2MZSA 2AD9A 2XB2D 4OJ1A 3QGPA 1CC8A 4JHDA 3RW6A 1OSDA 4JK8A 4CBWA 5E3QA 2FLLA 2DHHA 1FERA 3CXCM 2C22A 3J8AA 1R8AA 1CJVA 3QSIA 5DGAA 3ZZRA 3IS9A 1C1AA 5HVGA 2IVFB 1Y9OA 2GQ2A 2LEBA 3QWPA 3BKUA 3HSGA 3E1YA 2YBVA 2YNFA 1YTYA 3K57A 1LWFA 4O3PA 3S1TA 1AFJA 1KWMA 5KFRA 4JI7F 2FHMA 1Y64A 4RBTA 3NGIA 1YKWA 4LF5F 3RR8A 4UF4A 5M2RA 4JAXA 4QOTA 3CC2N 3ALYA 3T1YF 1SKSA 1FEHA 2CQ1A 4V19X 1T02A 3FBFA 5CR4A 2VDHA 2VH7A 2J6TA 5LXYA 2Q66A 2LQJA 3M8SA 1ZZFA 1CVJA 2CNLB 5C42B 4LF5J 1MWKA 4GNIA 2VGNA 4DUZK 4DPXA 4BRLA 1VLOA 1PYOB 3MM9A 5AZJB 4JI2F 3NG8A 1NZ8A 2V5HG 4DPWA 1GLEG 3LDNA 1FRHA 4ZP6A 3RBZA 2HNZB 4LFAJ 5DG7A 2Z2MA 4B9MA 1NSKL 1HYSB 4K0KK 3IO1A 1HR0F 2ZBIA 4IOCL 1CULB 3Q22A 2RUGA 3SQGB 3ZTSA 3UCZP 3RVCA 3QATA 1SV5A 2YKNA 2DJWA 3OBYA 4AD6A 3QMQA 2QI2A 4LFAF 2XLIA 4NZ0A 2DXFA 2Y8WA 1EKEA 4RW8A 2NCKL 3GG4A 3N5FA 4U7BA 2XG8A 2CPIA 4ZLLA 1U48A 3O3GA 3W9IA 2OUGA 3M30A 5EOYA 2QW9A 5KFYA 3NGKA 4NXMF 1T44A 2HQ3A 4JRPA 3ULEA 1SQKA 3CERA 2DGSA 3GFXA 3KKFA 4RR5A 2BOAA 4JK9A 3TUJC 3CYMA 3OTDA 1Q82T 1H72C 2K06A 4CLFA 3VQPA 3H8YA 1JLGB 3NGRA 1SAZA 1AUSL 1J54A 3MR6A 4PKDB 2DGTA 4C8NA 2P1JA 2MYFA 2GIQA 3MM9B 1ZM3A 3ZETB 2V68A 4U96A 3KOAA 5G4DA 2ZC3A 1VQMS 3R7NB 2YWWA 3ASMA 4CD3A 3HSCA 1FJGF 4P7TA 4CZFA 2UP1A 2NSBA 2QLXA 3G9CA 1N33J 4FW2A 3RW7A 1UJ6A 1NGFA 2J0XA 4AH9A 3V4MA 4BRNA 2IDOA 1T95A 4WFNQ 2E6LA 1F3VA 4FJIA 3OYGA 4X65K 2Y0BB 3UR3C 4LFBK 3KLEA 4BRPA 3FBEA 2A1BA 3LP2A 3QGHA 1ZXOA 1RT5A 3GV7B 3E9PA 4LIRA 4K4TA 4N8OA 3WNHA 3M32B 4MYTA 2R2TA 4LSLB 4NLRA 2HAFA 1BCOA 4Q8FA 1VCTA 1FEEA 3HSJA 3EY1A 3OTBA 3JQMA 4DPUA 3M8QA 2HNDA 3JAMY 1TFWA 4CZLA 1OWXA 4U7CA 5CYQB 2O67A 4HTJA 3HHLA 1PAUB 3OYBA 4B3SK 3SCKE 3KD5E 3ZZPA 3H25A 3BEXA 1M1KO 2Z0GA 1QE1A 5DK5A 3TARA 1YVFA 4I7FA 3H2LA 1IKWB 2UXBK 3IG1A 3C6TA 1VDHA 2CGKA 4USVA 3BZQA 2B6AA 2CPDA 2BE9B 1U6FA 3G4SS 2XI3A 1X4GA 1T3VA 4CYUA 2F4FA 4Z2XA 1N48A 3OYIA 4X2BA 3QAEA 3F44A 2J9CA 1OQ6A 3A8IA 2RS2A 3CQYA 2N4DA 2JC1A 4P7VA 2DTJA 3AOBA 2CIMA 2OGUA 5KGXA 3OR1B 4W5RA 4I6YA 1YI2S 4CRJA 2P9PB 4F0KA 1HJRA 3QZ7A 4Z4GA 5BR9A 2OA8A 2ASLA 4NXMJ 4FF1A 1Q53A 2IIRA 5F8NA 3FFIB 1T3OA 4KHNA 4X62J 4MTPA 4OVLA 1WSGA 1JJCB 2MJNA 3DGVA 4AILC 3K0JA 5J1PA 3C16A 3RB0A 4ELVA 1HQUB 4LF9F 3UKRA 4DJBA 2RH3A 1RDRA 2G8UA 3P4UB 3SUNA 4B3SJ 4DSFA 2YNHB 4QW8A 4DL3A 4IRCA 4UOFA 3LH2S 1RWMB 4PCQA 1DTQA 5DETA 3KHYA 2E5HA 2POKA 4DMZA 2VWKA 2WB1D 2UV8G 5C25A 1TGOA 2R8KA 2FJEB 2HMIA 1Q7LB 1GAOA 1OMSA 1HNIB 3PHEA 1BXNA 1TKZB 3MN5A 3CMQA 4A8XA 1XMOK 4EHTA 3CCEN 3I56N 4LBHA 5KFFA 4LD0A 2HQGA 4WFYA 2NZTA 4OL8A 3GMGA 4EI2A 4Q0BA 2DR5A 3MEDB 3K5OA 1RAHB 3D54A 5F8HA 4ANEA 3SUQA 3GOIA 3WNGA 3Q8RB 1LXNA 2GWKA 4KGKA 1VQ8S 3N0VA 2IIHA 2BYCA 3D4JA 4RWXA 4ZDNA 3BS9A 4LF6K 2HBLA 3GL1A 4KHPK 2V4RA 5KFUA 4BR7A 3CC4N 1UP1A 4CEAA 3A8KA 4E7KA 4U67Q 3HJVA 2Z1JA 2YTCA 3UO0A 3QRRA 3G82B 1KOHA 2IYGA 4MKAA 1VMBA 3QDKA 4QAGA 1RKJA 3I87A 3I4HX 1VSEA 3KKRA 1SUQA 1YJNN 4A8KA 2HVIA 4F36A 3PSIA 3HOSA 4FVCA 1MA9B 3OR1A 3LO3A 1CZ9A 2ZNYA 3SMSA 2RS8A 1REGX 1WSIA 3POTB 2P5VA 3DFEA 1HBOA 1DRZA 3VGKA 3DRPA 3B8AX 4MDAA 4QIVA 2DY9A 4XPCA 1R6YA 3CCRS 3DXKB 2X51A 2HF3A 4CK2A 4C8KA 3CJBA 4RG8A 1GQEA 2PN6A 3BGFA 2G4BA 4YOUA 3M9NB 2GX8A 1T3NA 5U47A 2HBJA 3RRKA 2B4OA 4TYAA 1RTJB 4C8ZA 5IQQA 3OYAA 4DV3F 4DDFA 5CYQA 4N8NA 4GRSA 4KI6A 1Q7YT 1ZM9A 1NJXA 3AAPA 4O4GB 2NRHA 3GILA 4HTIA 3PJWA 5EU7A 4GVLA 3E2EA 3NE6A 2W01A 2CG4A 3NS7B 4X66F 4EEYA 4LC9B 4DI6A 1RT5B 2XLJA 5DZ6A 4IOCQ 3IXQA 3GSIA 1VRUB 2JWNA 1VC5A 3ZO7A 4KGXB 4JI6J 3UE5A 1IBKJ 1KDNA 3JYTA 1JLEB 1S6QB 3GYGA 4O3NA 1HMVB 3H1QA 4JV5F 2AEJA 2MJUA 2GQQA 3G6XA 2DNOA 1QE1B 2CGLA 3AO3A 3D45A 5BJRA 2EX3A 3ZETA 3ZZZA 2VG6B 4Y2CA 4B9NA 4HEA9 2VPYB 2AHOB 3D66A 2GELA 2E20A 1T05B 3QGGA 2P51A 2JSXA 3M8QB 3ULDA 1A5XA 4NCBA 3MURP 3SFGA 3SDEB 1RT7A 4OZNA 1JXVA 1VC0A 4BRFA 2EKNA 4QWEA 3N6NA 5E3AA 3Q8UA 4CGFA 3ET6A 2CPEA 3NOCA 3ZSOA 4MIWA 4WE1A 4JYAK 3T41A 5KGWA 2ETJA 3QLHB 4TLQA 2KJVA 1Q5YA 4IRDA 4Z4FA 4A59A 2CDQA 4U6PA 1TKDA 2AT1B 5HSPA 3NCIA 3KKSA 2HWHA 4CF0A 3GFZA 4QZVB 3J81j 4EZ9A 2V8HA 1N0UA 4YHHF 2OD6A 3B6BA 2A1RA 4MLHA 1VQPS 4ILLA 4JI1K 5CYMA 2M4MA 4ZA1A 3RMAA 1NHKL 3NL0A 5D15A 2A2CA 2KDOA 4IXCA 4JB8B 2IM3A 2C3MA 3QT5A 3SFUA 3JXOA 3FR0A 4K4WA 1OYEA 5DS7A 4EP4A 3DLGA 3SPYA 1MWYA 1S1WA 4NLWA 1OH5A 4ELTA 3NH2A 3DM2B 4A48A 2KN4A 3O3FA 3M1VA 1ZOTA 3ZTOA 3CC4S 3KJNB 2O66A 4LQ9A 1KKHA 2ASMA 3WIVA 1JJ4A 7FD1A 2D1KA 2RF2A 2JHEA 2A18A 2B7BB 3C15A 2JVOA 5AQFA 3V9UA 1N6QB 1WAJA 2KYXA 2C3YA 1KR4A 1W7AA 5LJ3Y 5KFHA 3EX7B 3EYZA 1VSKA 4A8SA 3MEGA 3EZ5A 3U3YA 3PYEA 3ENWA 1N32J 1QAXA 4MDBA 2KB2A 3TUIC 4OX9J 1F60B 2ZUGA 5BN8A 3L3VA 4TY8B 4FBTA 3DM2A 3M2RB 1KAZA 4IDKB 4K4UA 2YKAA 3OBIA 4DWIA 3PRBA 4C11B 4B3TF 1NPKA 5AQYA 4B17A 2QKKA 4GC6A 2KW4A 1HIYA 1VR6A 3DU6A 1CZBA 1S10A 2FVQA 2J6SA 3FZMA 1YITN 3UR0A 2B4PA 4RCHA 3NBPB 4ZPVR 1R8HA 4B3TK 1B0TA 4WF9L 4ANCA 3O9TA 3TSQA 4DN0A 4CO0A 2XQCA 4RUHA 1RTIB 4ZP8A 1W2BM 3OFGA 1KOOA 1J2VA 1Y5NB 1FWLA 3A12A 3CF5L 2V2KA 1EKSA 2NZ4A 3I4PA 1NU0A 4UT4A 4ILJA 5F8LA 1FTRA 3V1RA 4WZQA 3BKFA 5L39A 4DOZA 4ER8A 2VA2A 4CGJA 2VV5A 3NMRA 3LAKA 2ZUAA 4IFVA 4PXCA 2XHBA 3NS6A 4C8OA 4BCAA 4CFCA 2B43A 2HSEB 4XH1A 1RKIA 2F40A 4XH5A 1Q78A 4DR1J 3R9PA 1D8ZA 4A8WA 3P4IA 1FNXH 2GHVC 2FLPA 1BISA 3BREA 1KTQA 4D3HA 1RT6A 2ZBQA 2RDJA 1GNKA 1IR2A 2X3GA 2UUCJ 3DXBA 1CSJA 2HYIB 4YEAA 4CEQA 4QJVA 4JI1J 3VQ7A 2O4GA 4PXBA 1UJ4A 1VQ8N 2DR6A 3CJKA 1R43A 5CABA 1TVRB 4NLQA 1WOOA 4EO8A 5ETTA 4WP3A 1R7IA 4DU4A 5BN9A 3KHGA 5K5MA 3KLIA 2NNWA 1HUXA 2R7UA 5BPLA 4JI1F 2KFNA 1Q18A 2R7RA 2JWKA 3ITHB 1NGEA 4XK8C 1NK7A 3R1XA 4ZHRB 4CEEA 3WC2A 1B3TA 5GAEP 3HP9A 3P6YC 2WBNA 3GIMA 1FJGJ 1KQSR 1HBOB 4Q5VA 3CIZA 2HMIB 3HHLC 4HUGA 1X5PA 3MTJA 3UCUP 3J7YI 2HWIA 2XHWA 2RQKA 1RT6B 1SC4B 3ZZ0A 3PACA 1ZTTA 4I9QA 4UZBA 4WYBA 4PQUA 6FD1A 4IOAQ 3IP0A 1F9FA 3A5OC 4NI2B 2RN2A 2A0FB 2BRLA 1DHMA 4CD1A 1NJZA 3L7PA 1NO8A 1U2FA 3RZAA 3KLHB 4C98A 1TELA 4ZIWA 2BOPA 2BE2B 2UUBJ 2PMWA 3EE9A 2B8PA 4WIIA 3DDKA 4GKKF 1YJTA 5M2PA 2BANB 3KLFA 1SJFA 3B6OA 5JMVA 2JGUA 1PIEA 2MQQA 1VQ7N 4JV5K 1EHWA 3HPGA 2P9KA 4QYRA 3DI6A 4FOEA 2BEFA 5JXSA 3E01A 4U8VA 2HHTA 4DSKA 3NMAA 3IWLA 4C0BA 3CMES 1S77D 2A3ZA 3VQ4A 1IV0A 3NAHA 1KC8O 2VG5A 3T3FA 4ECRA 3DHXA 2MSTA 5KT4A 3N28A 1CZAN 4TY8A 4X66K 5F3TA 3CJ9A 4HHUA 3VQCA 5HVHA 2W4PA 1S1VA 2NXEA 2M2BA 3R5BA 4E7JA 3DLKA 4PUOA 2D9PA 4PXDA 2JWLA 1Y4ZB 2RQMA 4DLGA 4YDUC 4ZLJA 1NOYA 1Z26A 2CYYA 3IGNA 1VQKN 1FDNA 2WCXA 4ZVUB 5D0EA 3NDKA 5HATA 1WACA 1FE0A 3THWB 4BG8A 1TKTA 3S9HA 3E9OA 1P6TA 3MHYA 5L1JA 3DXMA 3ZSXA 1Y00A 4CO3A 1VQ9N 4AHCA 1VQ4S 5BRDA 3HVAA 2V50A 3TSPA 3FCWA 5KFBA 3A3NB 2EBGA 2ASPA 5KTQA 1PKUA 1GMWD 4FPIA 3DMJA 4O3SA 1O8BA 4H5NA 4F2RA 3LQVA 4I64A 3U9ZA 3ITHA 2ALYB 1KVCA 2FVRA 1YBAA 1V9OA 2CPZA 5ETKA 3TJ8A 4F3MA 1RACB 3GONA 2QFJA 1BC6A 5CYMB 3I0SA 1BQMB 4Y2KA 2KH9A 1FHTA 2UXCJ 5B0DA 3T9NA 1CJUA 4MYUA 1SIWB 1K8KA 2FLNA 2AX0A 4I7FB 2GVZA 3JSRA 5GMKa 2L3MA 4Y2AA 3ICLA 4ZPWR 3OFEA 4FLUA 3AHPA 2BJ8A 1T03B 1V5IB 3HVRA 1FK9A 2O5DA 2K1RB 2XYHB 5EWGA 4KHPF 2ZJQL 4Q2MA 3EPIA 1EQYA 5H9EJ 1JL2A 1H0HB 2F8HA 3L9ZA 2ROPA 4MO4A 4AHSA 1RILA 3PFOA 2A1SA 3I5BA 2W6LA 2HFNA 3DLEA 4O55A 4J9LA 5GADI 3DKDA 4OKJA 4DV1K 3KK7A 2J9DE 1RDBA 2NRRA 2QMXA 2VC0A 1FTCA 3MFIA 3ID6A 1F21A 3I32A 1PYSB 5JLHA 3CCJS 3UKUA 3GTYX 4OYOA 3PO5A 4Z94A 2VPZB 2BJ1A 4O3OA 4IH6A 1HA1A 3R6MA 3U3GA 5HAOA 2DCUB 3ILIA 1ZBHA 2A6AA 5K8PA 4O8KA 2AJ4A 5IXUA 4J9NA 4C4WA 3JYTB 4ZPAA 1YITS 4MIAA 3SJJA 4PG6A 3UD4P 2NRTA 3SIPB 5DZ7A 2E6MA 1YJVA 2V94A 2L41A 3MAQA 1TK5A 3BBCA 4HR2A 2NPIA 4RTFD 2MQNA 2XGQA 2E1MC 2E29A 2DKOB 2HS3A 1WG5A 3MCAB 2YWGA 1SJ1A 2MKHA 3S7RA 4CJVA 2Y1RI 1Y10A 4L3QA 2G0JA 1FDAA 1NEEA 3CJ0A 3OW2M 4E2FB 3LP1A 1ATRA 3I82A 1NJIT 3UB5A 5C2GA 5ADXH 2WSEC 5GAHU 4AL6A 3THTA 1IG9A 5BREA 4ILMA 1HHTP 2EKYA 2HBQB 3EL2A 3T5JA 2XYPB 4KR0B 4O4GA 3PVXA 2PSZA 2EPIA 1U0HB 1GEHA 4MJKA 3CJ3A 4F0MA 4OX8A 1S1XB 4PUOB 2B9YA 4UOHA 4X62F 4CHPA 4FF3A 3EZWA 1W26A 3VALA 4IQXA 3CCSN 1XHZA 4LH4A 4HHJA 1VSLA 3SQGA 3FFKB 2UXBF 3CCRN 2OANA 2E1CA 2EFNA 4KB0A 1YBTA 2Z1HA 4WP9A 5F0WA 2R7OA 4NLVA 3NMUA 4B3SF 5L38A 4I68A 2CAJA 1CJVB 3MOZA 4HTLA 4GW6A 1I94J 4BGBA 1DTTA 4X65J 4KH4A 4CFBA 5B0EA 4CIEA 2CQPA 1N5VA 3QBWA 1WF2A 3CJCA 2SXLA 1WEZA 3MEGB 3OBWA 1X9SA 4FF2A 2NYIA 3MECA 4RLEA 5ADXA 4PKIA 4DFKA 4LFBF 1H2VZ 3CCZA 3C15B 1S1TA 4X65F 1K1SA 2GO8A 1M1HA 4ZK7M 8ATCB 3RBXA 3Q7BA 4IOXA 2E5GA 4LF4J 1OH6A 2X6SA 4Q0BB 3G8QA 2BW7A 3AAQA 2YXLA 4J2AA 2LA6A 1F5BA 2ZE2B 4M5JA 3SPZA 4CZEA 2M5YA 2FVPA 2NUHA 1SL0A 4B9UA 4YHHJ 1X60A 4BRDA 2ZBPA 3HHDA 3C3LA 2WZ1A 1Q0NA 2HZVA 4LMZA 1UJ5A 1FA0A 2NRVA 4LF6J 4EBDA 2XTJP 1T9WA 1BI4B 3EGNA 3A13A 4CIFA 4L73A 5BPNA 1Q82O 1W97L 2VQFF 1A9NB 3OTOK 1U02A 2GMHA 3T1HJ 2GTDA 3RG6A 5A8KA 1WSHA 3S01A 5A6PA 2D69A 4ZJOA 1S6UA 2NREA 4PG7A 4B1XB 1SV5B 1YLXA 4FCYA 2F8MA 1RT4A 3SSQA 4CGDA 3ULHA 3TAQA 2QL5B 1RHQB 3UW1A 3PW4A 2P9PA 3SUOA 1S59A 3DRSB 4BR4A 3D6FB 1J53A 2A6MA 4BG9A 4K8ZA 2O8FB 4A2BA 1PILA 2M8DB 3JSBA 1HR0K 4OJGA 3O4QA 5AZJA 3DOLB 4K0KF 4RW7A 1MWZA 1H3DA 3RB4A 3KWIA 3GCXP 1QD1A 4H4OB 1YRXA 3T9ZA 5A76A 4JI2K 1I94F 1NOZA 4ID5B 2PDAA 1RTIA 1O6XA 3VF6A 4DTJA 3WC0A 4DUZF 3TQEA 3MPDA 1KCFA 3CCTA 4PHTX 1FVSA 3K89A 3OD2A 4R8UB 1X8DA 2NRXA 1QAYA 4CM0A 2IRXA 1A0OB 4A8YA 3UQSA 1HKGA 3BDEA 4WFNL 2KQ2A 3C65A 3A1YG 2QC3A 3T1YK 4H5RA 2VGMA 1HYVA 2XMUA 3M9OB 2UZAA 4C7QA 4AQYF 2AYEA 4E3SA 1QQNA 3G2XA 2BKOA 2LXUA 4KKOA 2XY6A 3KK1A 1Q8BA 2XZDB 1RDAA 1LK7A 1FVQA 1TV6B 2RKIA 3VENA 4JK7A 1FRJA 2P9IB 3MEEA 2P8IA 1NK5A 2PC6A 3SCXA 4P75A 3VGUA 3IRWP 2HHXA 3ZSYA 1GXTA 4M41A 5KFSA 1SH2A 4A8QA 1NK9A 2J4RA 1EIYB 3I56S 4OJRA 1R0CB 1Q81T 4JI4J 4CEDA 1RYSA 2KVIA 4DF8A 3CJKB 3BBFA 4CJPA 2XRIA 2DR9A 1S9GA 1N5TA 2AP1A 2CJXB 2J8SA 1A7GE 1J5OB 3O80A 4DL2A 2MGZB 2UXCF 1P9YA 3LOUA 3EGWB 5L9XA 3FZBA 4YB5A 3TX8A 2RE1A 2FSNA 2B4UA 5GAHI 3VEWA 1RAGB 2HHHJ 3G82A 3OJSA 2FJWA