1S6QA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r147681
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords POL polyprotein [Contains: Reverse transcriptase]
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 136
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s6qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6qA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6qA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s6qA05
2OPPB 1UAXA 3V81B 3OVNA 4GW6A 3KD1E 1RTIB 3Q8SB 1FK9B 2KQ2A 1W25A 3QO9B 1ZTTA 4NLDA 4RW6A 2VA2A 2JEIA 2OPQA 1TKXA 1MMLA 4NCGA 2VWJA 3T5JA 3DRRA 3S3OA 2P5GA 1BQMA 2OH2A 1VRTA 2D0CA 3OY9A 4DFMA 4XIUA 3U3GA 5L1LA 1FKOB 4LY7A 1BCMA 1VSIA 2FC0A 1J9AA 2JC1A 4BWMA 3NGZA 4R5PA 5FRMA 1UWBA 4M3XA 2YNFA 2D7SA 4KPYA 1S9GA 4MKAA 5KFQA 4AHVA 4KBIA 4G3IA 4NCBA 4Q0BB 3DM2A 2R2TA 4NYFA 3IS9B 4K4SA 1VSKA 4QCLA 1S10A 3KK3A 3O3FA 2R7YA 2R8JA 4K8ZA 3VQEA 3QIPB 3SUOA 4B9MA 3T5HA 3RBDA 1DTQB 5KFXA 5L1KA 2D3ZA 4FZYA 5KG2A 2C2RA 2HVIA 4YFUA 4M3WA 2XWYA 4CE9A 2WCXA 3MXMA 5J2NA 4CHZA 1S1WA 3MTKA 3VQAA 1JLEA 4CHOA 4G1QA 3VQ5A 3RTVA 2ASLA 4FM0A 4M3YA 2CJQA 2Q3SA 3OS1A 1S1UA 5KFPA 5JS1A 3DRSA 1RT5A 4DU3A 1KVCA 4MFBA 1GOBA 1S6PA 3OHAA 4IG3B 2Y1IA 5KFAA 4KKOB 2E9RX 2P51A 4KTQA 3KHRA 2OA8A 1VSFA 4IH7A 4KI4A 2W8KA 1C1AA 4HCBA 4F4WA 4KB7A 2FVCA 4ED6A 4FZXC 5EWFA 1JLFB 1C0TA 3EYZA 3MECB 1WLJA 4CJVA 4EEYA 4PY5A 4DL2A 2IJNA 3NMAA 3NDKA 2DFFA 4C8OA 1Q9YA 5KFKA 1XR6A 2RPIA 3HVAA 3ZSRA 5FDLA 4CEOA 2HHWA 2J6UA 2IOCA 4BACA 2DTUA 2YV0X 1EXQA 4YMEA 3AO5A 3FRZA 5F8NA 1JXLA 3SV4A 2O5DA 3RR7A 3LPTA 3DYAB 1C1BA 3ZSXA 1S4FA 4TQRA 3OSNA 1XI1A 2IC3A 3KLEA 3KLHA 3BQ0A 4EYIB 4B9SA 2XI3A 4WE1A 2W9CA 1JL2A 4DTPA 1Z4UA 4I9QA 2QKKA 4KFBA 3NF9A 5KRSA 5HLFA 3VA3A 2E6LA 2HNZB 4H4OA 4O4RA 1HMVA 3H5UA 4F4XA 4WZMA 2RKIA 5C42A 3NE6A 3BQ2A 3U6FA 3PX0A 3PJXA 1LAWA 4H4MB 2UVWA 1SH2A 2ZE2A 5EWGA 2P1JA 4NZ0A 3KLIB 2FVPA 1XHZA 5DLFA 1SH0A 1RBVA 1J53A 1XC9A 1JLCB 2XC9A 3PHEA 4O0IA 3KHLA 1R0AA 3AVMA 4R0EA 1LW2A 4NYZA 1WSJA 4FK4A 3NBPB 4EP4A 4MKBA 1CSJA 4OKEA 1LV5A 4YP3A 4FLXA 2WOMA 5I42A 1L5UA 2FVSA 4B3OA 1Z25A 4DSFA 4TY9A 1QE1B 1QTMA 1K1SA 2ASJA 3V6KA 2BRKA 3NAHA 2CKWA 4DQPA 4ZPCA 4E7HA 1HJRA 3GIMA 2F8EX 4Y1DA 2R8GA 1WSEA 3IRXB 4DQIA 3MR5A 3CM5A 4AHUA 1B9FA 4NLYA 3VQ9A 1I6JA 2XGQA 3TAMB 1T03B 3HHKA 2RF2A 3QLHB 3KIOA 3AA4A 3KMQA 5KFJA 3JYTB 5HP1B 4OL8A 3TABA 1S6QB 4ID5A 3SUNA 3JSMB 4EO6A 3TANA 1N48A 4ICLB 5KTQA 1LWFA 1YT3A 2AX1A 3VQSA 1S1TA 4QPXA 2Z1JA 2XY8A 4NLTA 3KOAA 4E7JA 1SUQB 4CJLA 2XY7A 1ASVA 3CFPA 1U45A 1RT7A 3TAQA 1BQNA 4DSKA 5HROA 1EP4A 2O4GA 4IH5A 1EX4A 3KJVA 4YQWA 4FJ5A 3QESA 4HUGA 4DTJA 1HYZA 1DLOB 3OL8A 1RDCA 1HRHA 4BDYA 1RTDA 3GQCA 4YR2A 3S3NA 3K2PA 3MEGA 2I5JA 3AVAA 1L3VA 3MR6A 2BQUA 4IR1A 3LZJA 4I2QA 4I7FA 3PZPA 1NKEA 3DOKA 2UVUA 2BANA 1TKDA 1TQLA 2IM3A 3HM9A 2VG7A 4QWDA 4TYBA 3OYAA 3CQ8A 1KFSA 2XGPA 4FK0A 1WN7A 1RT3A 1RYRA 4KO0A 3CJ2A 3DI6A 3H5SA 4CJFA 3GIJA 3RR8A 3KK1A 1JKHB 4RW8B 1SKSA 2GV9A 4K4YA 2XRIA 1TL1B 3CJ0A 4GVMA 3S3MA 3PW0A 3DDKA 1KLMA 4DG1B 4FJ8A 3DLKA 4RNOA 4EBCA 1RT2B 2ITGA 3A2FA 4JS5A 1L3UA 2KTQA 5KG7A 5HBMA 1JLBA 2VWKA 4IOBA 4LD0A 3HPOA 5F8LA 1RTHB 3UDLA 3QNNA 2F8TA 1HNIB 1I39A 4J2DA 4FW1A 4O3NA 1JLGB 3PW5A 3RB4A 3V6DA 1S1XA 3I8DA 3LP0A 4NLVA 3SI8A 4FJ7A 1LWEB 4QW9A 4OLAA 4FBTA 4Q43A 4C8KA 4ZP6A 5C24B 1WAJA 2FJWA 4W5TA 4Z4HA 3AVKA 2D5RA 1S9EA 1TKTA 1VSLA 3OL9A 4RNHA 4CF0A 4RW6B 2OPQB 4YR0A 1BGXT 3HP6A 2KFZA 3DRRB 3CIZA 4ZVHA 3FQKA 2Z1GA 3NCIA 1HYSA 1VRTB 4FJHA 1CLQA 4O4GA 5KFSA 3QEVA 1QS4A 4LH4A 1JLAB 4CHPA 4R5PB 1D0EA 3BGRA 3T1AA 5F8IA 4KHNA 1S9GB 3SFGA 3PO5A 1C0UB 3AA2A 4E7LA 4QWAA 1RILA 5EDWA 1N56A 5J2MA 3FFIA 4ECSA 3H4BA 4B9UA 1QAJA 3OSPA 2HWIA 2KFNA 2AJQA 3DLRA 4F50A 2O4IA 4N5SA 2HB5A 3SPZA 1TK8A 3KK3B 4CHQA 3OYMA 3CDEA 1HPZA 1U47A 4JUZA 4HUEA 3OYKA 1S1VB 3QEIA 4L8RB 2X6SA 4E89A 5KFHA 1YVFA 4KHMA 3RAXA 1WSFA 3M8SA 3UPFA 4FJLA 4H54A 5L1IA 2I1RA 1S1WB 3V4IB 1IKVA 1RT1A 4WFYA 2V9WA 1I3AA 4BWJA 2ASDA 3DRSB 1RT5B 4MH8A 4RUAA 1KCFA 4RUCA 2YNIB 4NLRA 1X9WA 2ILZA 3DOLA 3TAPA 3QINA 2YKMA 1RA6A 4U6PA 2IS3A 1RTJA 1UOCA 2RN2A 1GOCA 4M95A 5I3UB 3I0SA 3MEDA 2HNYA 1S48A 1ASUA 1T8EA 2R8HA 4Y34A 3N6LA 2F96A 3M8QA 4J9RA 1TV6A 1Z26A 3SPYA 1NK7A 4BDPA 4RW4B 3BQ1A 5SWMA 3ZSOA 3NAEA 5F8MA 4FJXA 4C8NA 4Z0UA 3OYFA 4TN2A 4IQXA 1U4BA 4FLWA 4I2PA 4ECXA 5DQIA 1SH3A 2B4JA 3H4DA 2AU0A 4J9KA 3PW7A 2G8KA 3HPGA 4RU9A 4FLUA 2R8IA 1C1BB 4ZPBA 3KLEB 1QHTA 5J2QA 3GIKA 4CERA 4F3TA 5K14A 1FXXA 2W9CB 1Q8IA 1KTQA 1RDAA 2KW4A 1XHXA 4KFBB 5HLFB 2G8VA 3KLGA 3DLGA 3AO3A 4FW2A 4H4OB 4AHCA 4DS5A 2P5OA 4CK2A 1O1WA 3K5MA 3OYEA 2VG6A 4JV1A 4XPEA 3RWUA 4CJPA 4CHNA 4E7IA 2ZE2B 2FLPA 3H98A 1ZBFA 4B8AB 2IAJA 3BREA 3PW4A 4B9TA 4ZPAA 4IR9A 2R2RA 1EETB 1IKWA 4IDKB 1BI4B 3AVJA 1KSPA 2V4QA 3SV3A 4NLSA 3ZT4A 5J1EA 2ILYA 2ZKUA 3E01A 2ATLA 3G10A 4DL4A 4LSLA 5D3GB 5KFIA 3ZSVA 4RW9B 3HKWA 3EPGA 4LQ9A 3BJYA 1JL1A 3ICLA 2A1SA 4EZ6A 3VQPA 4ED2A 1NK6A 5I42B 2WK4A 4PUOA 1NK9A 3TAEA 4K4UA 3QGHA 1LAVA 4M45A 4IFVA 3L2VA 4FJGA 4PWDA 4TQSA 2WHOA 1KVBA 1TP7A 3VQBA 4CJKA 1NK4A 1RA7A 5KT7A 2HHTA 4NLPA 3V6HA 4J2BA 1WAFA 3LP2A 2OPSA 2IGIA 2EX3A 3AA3A 3K5OA 3Q8PB 3HP9A 2XY6A 1TL3A 4AHTA 4FM2A 1QUVA 3I0RA 1G15A 4KTZA 4PA1A 2XCPA 3I5AA 1YVUA 3D0PA 1DTTA 4TY8B 4ECUA 1N5YA 5F8JA 2YKNA 2RF2B 5KFLA 3PUFA 3V1QA 3OYDA 4DTOA 4K4WA 2ZD1A 1REVB 1LWCB 4ID5B 4DFPA 3LPUA 3PJWA 4MQ3A 1ITGA 1IKXA 3V1RA 4B9LA 3AA5X 1LWFB 1S1TB 4HYKA 4Q8EA 3V6JA 5DMRA 3ZT2A 4TSXA 4CGHA 3L2QA 4FLTA 3HL8A 4OLBA 1RBUA 3C6UA 5KG3A 1RT7B 3V81A 4W5NA 4RW7A 1BQNB 4TXSA 4FYDA 4ZHRB 1EP4B 4CGJA 5HRRA 3OLBA 4OPKA 5CYQB 4JS4A 3QO9A 4M94A 3CJ5A 2ALZA 1SKRA 2XO7A 1MU2A 3DLEA 4BDZA 4NLGA 2HHSA 4N47A 1KRPA 3M9NB 3UIQA 1RNHA 3V1OA 3HVWA 4OKKA 3AVCA 3ITHA 1RTDB 4M41A 4ZVFA 1SV5A 1NOZA 1T94A 5KFWA 3AVLA 3V9WA 1FKOA 4WFZA 4WZQA 4R8UA 3D28A 4U7CA 3M9OB 4I2QB 2B6AA 4KREA 4EBEA 2AWZA 2XHBA 2HNDA 4Q5VA 2BANB 2OZMA 4Y2AA 3RBEA 4Q0BA 1ASWA 2F8SA 2VG7B 3GIIA 3IS9A 3BR9A 5FRNA 3VN5A 1CZBA 2OZSA 2XI2A 1J5OB 3DI6B 3RMCA 3OYBA 4ED8A 2WONB 1GX5A 1S5JA 4ZP8A 2WB4A 5KFGA 5F8HA 5C25A 2VG5A 2FBTA 1DTQA 3IN5A 4CIEA 3N6NA 1KLMB 1HQEB 4ZP9A 3DLKB 4OVLA 1KVAA 3AO1A 4CGGA 4CEQA 4CK3A 5HBMB 1JLBB 2G8FA 1N6QB 2IM1A 4ZTJA 2BE2A 3WNFA 1WSIA 2PYJA 4EO8A 4M3UA 5CYMA 2W42A 3OYJA 3G6YA 4FXDA 4ED3A 1GX6A 3DRPB 3NF6A 3LP3A 1NJXA 2YNGA 3HSTB 2BRLA 3QERA 4LSNA 3PVXA 4ECTA 2E4LA 1S9EB 4X2BA 1TKTB 1U48A 3UR0A 1SL2A 3M8RA 4J9OA 3HVRA 2YNHA 2QXFA 5KG6A 4HVJA 2GBZA 3WNEA 2AQ4A 3PX4A 2IJFA 3PY8A 4F8RA 3BSOA 4KV8B 1CXQA 1C1CA 4PQUA 1VSMA 2BQ3A 5DG8A 1RT6B 1S9FA 4Q8FA 3QEWA 4M3ZA 5KFEA 3NGYA 3T3FA 2C2DA 1D8YA 1U09A 3ULDA 1ZETA 3BGRB 3L3UA 4DF4A 3SQ2A 3E51A 3OHBA 5L9XA 5E41A 1YTAA 5KT2A 3GV5B 2DFEA 1WNSA 5KFCA 3MEEA 5HRNA 4CEDA 1T05A 3S9HA 1FKPB 4CF2A 3ALYA 1JIHA 4KB0A 3AVNA 4KHRA 4RG8A 4WFXA 3U3YA 5KGWA 3SNNA 5KT6A 1X9MA 4CIGA 3HO1A 3SUQA 1HPZB 2BDPA 1A5VA 4WXOA 2HNZA 4IG0B 1NJYA 5KFYA 3ISNC 2JEFA 4CF9A 1RDRA 4CFDA 5KFRA 4N41A 2G8UA 5SZTA 4CGFA 1IKVB 1RT1B 1RT4A 3AVBA 3KLIA 3MR3A 4ECWA 2IM2A 4J9SA 4W5QA 4ZVEA 4C8LA 1HQUB 1RDBA 4IBNA 3H40A 3QIDA 1JLCA 1HNVA 3RMAA 4AHRA 3DOLB 2B5JA 2YKMB 2HVHA 2OPRB 4WYWA 2FBXA 5KI6A 3ZSYA 3ZSWA 1XR7A 4AH9A 2HHUA 3NBPA 3DMJB 5KG4A 3I0SB 3MEDB 3L2WA 2ETJA 2ATQA 2HMIA 3NGIA 3THVA 4NRTA 3M9MB 4FK2A 4EYHB 3NH0A 4K4XA 4ZP7A 5EWEA 1ZBLA 4KHSA 2E9TA 1A5WA 4NLXA 4E3SA 4DSJA 4ELTA 2HHQA 1TK5A 4Z4IA 4LH5A 2QE5A 4B08A 3OYHA 1KHWA 5J2QB 4NCGB 1TKXB 4URSA 4YNQA 4GC7A 1X1PA 4DSEA 5FROA 3VQ6A 3QGIA 4NRUA 4ID1A 4CCHA 1BQMB 3NGDA 4CEFA 3SUPA 3TAMA 3QZ7A 3RB3A 3RRGA 2W7PA 3TVKA 3QLHA 4BE2A 3JYTA 4N56A 3DLGB 1GOAA 3LAKA 1S6QA 4FM1A 5KFTA 1ZYQA 1UWBB 3ZT1A 4M3TA 2YNFB 4ICLA 4J9MA 2UVVA 1TVRA 1F21A 2VG6B 3PX6A 5T14A 4CGDA 2HW3A 4CJRA 3LANA 4LQ3A 4O55A 3DM2B 1SUQA 4J9LA 1IO2A 4DTMA 4QWCA 4HTUA 3HVTA 4CJEA 4DQSA 4NLOA 3AO2A 5KFZA 1NHVA 1JLQA 2HWHA 1IKWB 4KTWA 3B6PA 5F8GA 4B9VA 4Q45A 2HHXA 3CYMA 3BSNA 5J1EB 4QW8A 4DWIA 1DLOA 1S49A 3KLFA 5J2NB 4MK8A 4I9LA 1NJZA 1JLEB 4G1QB 4IH6A 4PUOB 1WSHA 1S1UB 4KSEB 4CEEA 3QGGA 4IFVB 3OYNA 3LALA 1XR5A 3AVHA 4E19A 4J2AA 4CGIA 3MAQA 4MFBB 4DLEA 3KD5E 2QK9A 4CJWA 4DQRA 1S6PB 4F2SA 5KFBA 1NK0A 3KK2A 4Y2CA 3NL0A 4O3QA 1NK8A 3TR8A 3OYGA 4KB1A 1KLNA 3GV8B 3MR2A 1VSHA 5DK5A 2GIRA 3O4NA 4CEAA 1TK0A 1JKHA 1C0TB 3AV9A 1TL1A 3V9XA 3I0RB 4B8CA 5J2PA 1D9DA 2QKBA 5KT4A 1N5YB 1RT2A 2YHBA 3KKRA 4IFYA 5FDLB 1SL1A 4AILC 4CIFA 3L3VA 1D9FA 3NAIA 1S0NA 4CF1A 2V4RA 3BSAA 4ED7A 3SZ2A 3SYZA 1HNIA 1IKXB 3QZ8A 4Z4EA 3AO4A 1JLGA 3CG7A 1TAQA 4MK7A 4O3OA 1WNEA 5KG5A 2IC3B 3KLHB 1TKZA 2DPIA 2BGGA 4WE1B 3C6UB 4CESA 5C24A 2C2EA 3GYNA 4RW7B 1BHLA 3VQ4A 2PZSA 2AGPA 1QSYA 2DFHA 1TAUA 5EU7A 4ELUA 3KNAA 1HARA 5KFMA 3KHGA 1NNDA 2JEGA 4WYLA 1S0MA 2IM0A 4FJNA 1VSJA 4IKAA 3LP1A 3LZIA 2LSNA 3DLBA 1HMVB 1MU2B 3DLEB 3CO9A 4DS4A 3CFRA 5F9NA 4FJJA 3B6OA 2HHVA 2RKIB 5C42B 4FLVA 3CDWA 3P5JA 4TYAA 3GILA 4DFKA 3ITHB 1YTUA 5KFFA 3I5CA 1SV5B 4ECVA 1CZ9A 1EKEA 4RZRA 1XWLA 1VRUA 1LW0A 2J6SA 2VA3A 4R8UB 1JLAA 5JUMA 2JGUA 4QAGA 4RNMA 4K4ZA 1IG9A 1C0UA 2B6AB 2FVQA 2HNDB 1C0MA 1R0AB 4N76A 4JRPA 3C6TA 3OL6A 1LW2B 3IG1A 2FJXA 3ASMA 1KFDA 3QNOA 2AX0A 2PYLA 4F4ZA 4Y3CA 2IMWP 2EHGA 2WOMB 4B3OB 4QWEA 2J6TA 1RBTA 4FS1A 3WNGA 5C25B 2VG5B 1IKYA 1S1VA 3OS0A 3K59A 3L8BA 4CF8A 4K4TA 1IH7A 4OGEA 4B9NA 4MIBA 2W9BA 3V4IA 2BE2B 3SFUA 1C6VA 1ZBHA 2UUWA 1RDDA 2W7OA 5CYMB 4DL7A 3M8PA 4DU4A 1U49A 2YNIA 2D41A 3SJJA 3HT3A 3AVIA 3OLAA 2DPJA 5DGAA 3G0ZA 3NF7A 4CJ4A 3NH1A 3OS2A 4QOZB 4DEZA 2YNGB 1W0HA 4KE5A 4URQU 4LSNB 5I3UA 4Z4CA 1TGOA 1JXBA 3PV8A 4M3RA 2QV6A 4O44A 3SQ0A 1RAJA 1J54A 3PO4A 3LWLA 2YNHB 4RNNA 5KG1A 3QEXA 2R8KA 4CJ3A 4WXWA 4ED1A 1C1CB 4PQUB 1C2PA 4RW4A 1K6YA 4K4VA 3K5NA 4EBDA 2OPPA 1WSGA 3KTQA 4HUFA 2NUBA 5HROB 4CFCA 4Z4GA 4NYNA 5KFDA 3H5YA 3UQSA 1RTIA 3H08A 1FK9A 4JLHA 4CJ5A 4Q44A 2IBKA 2GUIA 3SQ4A 3PR5B 3KJVB 4GC6A 2A1RA 4F4YA 4ELVA 1BIZA 3F73A 1JX4A 4IKFA 1NKBA 1D1UA 3MEEB 5DQHA 2PY5A 3ZT3A 4EP5A 1T05B 4KAZA 1D5AA 2W9AA 3LAMA 1CXUA 4DTUA 3ZT0A 4ZTFA 3VQQA 4FJIA 2FVRA 3L2UA 4CJQA 4DFJA 1W9HA 3MEGB 2RDIA 2I5JB 5C5JA 2Z1IA 1QAIA 4I7FB 2KZMA 4EZ9A 4O5BA 3DOKB 3TARA 3HJFA 1HYVA 4E1NA 4NLUA 5L1JA 1RYSA 1RT4B 4Y1CA 4CK1A 4K50A 1RT3B 2Z1HA 4KO0B 4M42A 3MFIA 2D3UA 3IGNA 2X74A 3MXIA 3CDUA 1EETA 4IDKA 1BI4A 1HNVB 1T3NA 3KK1B 5DQGA 3FSIA 4BE1A 3QIPA 2FBYA 4DSIA 2B5JB 4NLQA 1S97A 2G8IA 2DY4A 4DL5A 1QSLA 3OJSA 2HAIA 3K57A 3OYCA 5D3GA 4FJ9A 4JV2A 4RW9A 5KFUA 5EUHA 3GV7B 4DTNA 4IRCA 2HMIB 4FBUA 4E7KA 4HCCA 3D45A 4F4KA 4ECZA 4F3OA 2FBVA 3TI0A 3G6VA 4FVMA 4CJUA 3I5BA 2ZQBA 3V6DB 1S1XB 3LP0B 3H2LA 2BR0A 1NKCA 3TAGA 1UA0A 3KMSA 4IG3A 2Y1JA 4NLWA 3SQ1A 1IM4A 4KKOA 3BDPA 4KRFA 4KI6A 3AVGA 3VA0A 3QYYA 1QQCA 3DLHA 1NHUA 3PW2A 3CWJA 5JS2A 4DL6A 1JLFA 3MECA 4DTXA 2V0NA 2JC0A 4O3SA 1Y97A 3T5KA 4CEBA 4MIAA 4TY8A 1HYSB 2WRMA 5DGBA 2D0BA 3F9KA 3KHHA 4BE0A 1N4LA 4O4GB 2C22A 3MXJA 3TQ1A 5HRPA 1REVA 1LWCA 3BSCA 1VK0A 4KHUA 2JEJA 4JRQA 1VSEA 3D5MA 5KT3A 3Q8QB 4KHQA 1TVRB 3HPHA 4CEZA 3DYAA 4FCYA 2BQRA 3FQLA 5KRTA 2R2SA 5HRSA 4FJMA 3NF8A 4F2RA 5J2MB 3FFIB 3VQCA 4FJKA 1BCOA 3EZUA 3HVTB 4ZHRA 3O3GA 5CYQA 1JLQB 2GIQA 3N6MA 3ZSZA 2YHAA 4DQQA 2GC8A 1RCHA 1RBSA 4W5RA 4OPJA 3ZSQA 2X78A 1SL0A 3MFHA 3NFAA 3KLFB 1B92A 3RB0A 3K58A 1X9SA 3QIOA 1NOYA 4H4MA 3LDSA 4DL3A 4HKQA 3HK2A 3ZCMA 4UQGA 4TLRA 2UVRA 4YR3A 4E1MA 5KT5A 3CJ3A 1Q9XA 4FS2A 2B43A 4ZPDA 4NCAA 1BL3A 4J9QA 1RTJB 3KK2B 4DMNA 4CJTA 4CFBA 3V9UA 4URGA 4QWBA 3H59A 2HNYB 1J5OA 3G6XA 1L3TA 4ED0A 4Z4FA 1T7PA 4CFAA 2WONA 4MK9A 2RDJA 3L2RA 3LWMA 2C28A 1QE1A 5J2PB 2XCAA 3M8QB 3FDSA 5KFVA 1TV6B 1HQEA 3OYIA 4KHWA 4IFYB 4J2EA 4CECA 3G86A 4IRKA 2FLNA 1N6QA 3CFOA 3SCXA 2IDOA 3ISND 2E6MA 5JXSA 4I2PB 2FJVA 2G8HA 3CM6A 5T7BA 5CY4A 3K5LA 4AHSA 3IRXA 3DRPA 1TKZB 3KKSA 2OYQA 5DLGA 5K14B 2UUTA 1NK5A 3RAQA 3RMBA 1T03A 4H8KA 4ZMMA 4JV0A 3C95A 3P1GA 2X6NA 1NJWA 5HP1A 4DSLA 3KLGB 3HXMA 4ECQA 1QSSA 4ECYA 3LP1B 3JSMA 3IGVA 4FLYA 3CVKA 4KV8A 3EZ5A 4XO0A 1RT6A 5KFOA 4DF8A 3EY1A 3Q8RB 2D0AA 3VQ7A 3PR4A 3TAFA 1RBRA 1VRUB 1LW0B 2IAJB 2XY5A 3EPIA 5CZ1A 1OS5A 4O3RA 4IRDA 3O3HA 4ECRA 1VSDA 3T5LA 5KFNA 2EC0A 4KHYA 3RRHA 2AGQA 4KAIA 2FLLA 1BISA 5F9LA 3C6TB 3IG1B 3E01B 3NKYA 1UA1A 1JXEA 4LSLB 3T19A 1FKPA 3V9ZA 3OL7A 3CJ4A 5DG9A 2E9ZA 4OKJA 1KHVA 4CHYA 5KG0A 1L3SA 3TWHA 3NHGA 4IG0A 1IKYB 3O4QA 1BIUA 4FZZA 4RNFA 4PWDB 3C94A 4J9NA 4DTRA 4CJSA 3H5XA 1U04A 2W9BB 3P83D 4K8XA 4DU1A 5DG7A 4FLZA 3LP2B 2OPSB 3OYLA 3QETA 1HQUA 4DTSA 3M8PB 4HHTA 4E0DA 5KGXA 1S0OA 3IAYA 4XPCA 4RW8A 3OJUA 4GMJB 1TL3B 2WTFA 3RB6A 2OPRA 2R2UA 4J9PA 3NH2A 3V9SA 4DG1A 1DTTB 3DMJA 3AVFA 4DLGA 3VQDA 2YKNB 1K1QA 1ZTWA 3RMDA 4OJRA 3WNHA 2JLEA 4O44B 3HYFA 4O0JA 5CZ2A 1ZBUA 2KZZA 4OGCA 2ZD1B 3MF5A 1RTHA 3QEPA 2G8WA 1B9DA 3VQ8A 1SKWA 4C8MA 3SI6A 2AGOA 1A5XA 3KLVA 2W8LA 4ZVGA 2IA6A 4W5OA 1ZBIA 4O3PA 1LWEA
chains in the Genus database with same CATH superfamily
4OIXA 3DRXA 1KD1T 4LFCJ 2HMPA 3V81B 4Q2LA 1BQXA 3KD1E 1RTIB 3Q8SB 4KBOA 2O8DA 3OBYA 3QO9B 1ZTTA 3DC2A 2YPYA 4NASA 2OPQA 4NCGA 1MMLA 4WFAQ 5AJ3F 3ATUA 1ZA1B 1W2IA 3LH2S 3A5MC 5F41A 3OY9A 1VQ5N 3JTPA 4X62K 4DPTA 4NMXA 3IO1A 1BCMA 4OZ2A 1VSIA 2XMWA 2FC0A 1J9AA 2JC1A 4BWMA 4M3XA 4QIGA 4KBIA 2NNWA 1L3KA 2WTUA 4NCBA 2PC6A 3PYFA 3HMJG 1BWVA 4QCLA 4HWIA 1S10A 3O3FA 1RCXB 8AT1B 2RUSA 4UZCA 4I6YA 3VQEA 2YXLA 4J90A 2L41A 4AD6A 3T5HA 5DM6Q 1DTQB 5CYJA 3BZCA 4EIAA 3C6HA 5KFXA 1Q8BA 2XS5A 2HVIA 4CJ7A 1PGZA 4YFUA 4M3WA 3Q83A 4JI6K 2WCXA 1X31C 3MXMA 5BRFA 1S1WA 3MTKA 3UWTA 4FVCA 3W61A 2ASLA 3IWLA 1F1BB 4P2FA 3M30B 3TVZA 3OS1A 2W24A 4FWNA 3S01A 2QLWA 2VYPA 3T41A 4RO0A 4RUHA 3VAKA 4BG8A 2E9RX 2OA8A 1T0TV 1YZ6A 2ERRA 3N01A 4ED6A 1E3MA 5EWFA 2PFDA 1C0TA 1T9YA 3CD6S 2HRTA 4ZVPB 1WLJA 4EEYA 1CJVA 4DL2A 4C8OA 3RG6A 1Q9YA 3K9JA 3FZHA 3B6BA 3HVAA 4IZ9A 3ZSRA 2LP4A 2CJ9A 2IOCA 4V19X 3PKYA 1P1LA 2G2ZA 1EXQA 5CR4A 4DB3A 4YMEA 3J7A1 4OQJA 2YHXA 1RAHB 1NPPA 2IY5B 3KFWX 4W92B 3DYAB 1UEVA 3ZSXA 2POKA 3OSNA 4AXIA 3KLHA 4EYIB 1R59O 2W9CA 4WK3A 1DY3A 5IT9O 1UJ5A 4DTPA 4I9QA 2F3JA 1CS4A 3JSRA 1WHXA 1M5KC 5HLFA 1WBDA 1F2HA 1DRZA 3TO8A 2E6LA 4JI2J 2CGJA 3C16B 5KPZA 1IBLF 2HNZB 5DDRC 3CULA 1YBAA 5C42A 2QL5B 5AFUA 4FYYB 1SH2A 2C3UA 1N5VA 1P90A 2WBRA 3L4QA 3SSRA 2VGNA 2XYGB 5DLFA 4U7UD 4CI6A 4L3QA 1J53A 5IXUA 4DPWA 3HT0A 4NYOA 2D1CA 1DGKN 4JKAA 1Y5LB 3GP9A 2CQ0A 3PHEA 1R0AA 4R0EA 4WYBA 1LW2A 1WSJA 2HQIA 3PFEA 4FK4A 2D4WA 5T7LA 1U2VB 3IA0A 1CSJA 1XJWB 2VASA 3W64A 3MM7A 3IM8A 4FLXA 3CMAN 4WK1A 1MW7A 4BR5A 3W2WA 3BN7A 3TA2A 3F41A 1GQEA 1BUPA 4F25A 4Y28C 1QTMA 2R7VA 5AQOA 1P27B 4DR5J 2LDYA 2X1BA 5TKWA 5HATA 1HNZK 5AZJA 2KKHA 1HJRA 3GIMA 2F8EX 1HW9A 4AQYF 1FE4A 4Y1DA 1Q5YA 3UDVA 4B3RK 2WBNA 1WSRA 3ZFVA 3P4UB 2DY9A 1T03B 3QLHB 1Q79A 3MX2A 1V6HA 3DXKB 2DRDA 4OL8A 3R1LA 2DHGA 2NPIA 3IRWP 1RAGB 1N48A 4ICLB 3BBCA 5C2DA 2AX1A 4RWTA 2VUGA 5DZ6A 3CC2S 2XY8A 4LR7A 3VEZA 2XY7A 2V51B 1U45A 1Y11A 4KR0B 3R5DA 4U7UK 2R9LA 3MUTP 4C1NK 4DV6F 3ZZYA 2DBBA 1VJWA 4NA2A 4FN5A 1HYZA 1DLOB 5LL6d 3OL8A 1SQEA 3ATVA 1Q4RA 4BRLA 4YR2A 3AFGA 5A0YB 3UCUP 3MEGA 3AVAA 3OXLA 2GUPA 1L3VA 2G13A 2HGLA 4JI3K 4I7FA 1QVGR 5FPMA 5K8MA 2UVUA 3WEEA 5B0GA 1TQLA 2IM3A 2YHWA 3PLAA 4QWDA 3OYAA 4TYBA 3CQ8A 1YX2A 1KFSA 1VIXA 3SBTA 5K9FA 5GAGU 2FDNA 1WN7A 3ISZA 3I4HX 3RR8A 3KK1A 1JKHB 4I6MA 4RW8B 3G4SN 4M5GA 1B3TA 4GVMA 4LFCF 5M1QA 1KLMA 4DG1B 4FJ8A 4WF9L 1IBMJ 1TMJA 5HBMA 4DUZJ 4IOBA 3G82A 4LD0A 5F8LA 3CD0A 4FF3A 2H5JB 4EU0A 4J2DA 4O3NA 4DI6A 3PW5A 3RB4A 2I8EA 3M1VA 3V6DA 3QNWB 5AQWA 3MM5B 2K7KA 3LTOA 4DHVA 9ATCB 1VC5A 1KOHA 1WSVA 3N4WA 4ZP6A 5C24B 4OMFG 1WAJA 2MYFA 2FJWA 4Z4HA 3AVKA 2D5RA 1HBUA 3OTDA 3OPKA 2F5GA 1CVJA 2P9SB 3ET6B 4YR0A 4F26A 2PGCA 1I3OB 3R9PA 3DRRB 2YPZA 4RPFA 3FQKA 1HYSA 4GY2B 1VRTB 3EUNA 4USWA 3HRGA 1CLQA 2J7WA 4ZJQA 1QLNA 5KFSA 1WOOA 3QEVA 2MZJA 1D0EA 1S9GB 3WT0A 1HLWA 2DVIA 1B7YB 3SCKE 3PEHA 5J2MA 4B9UA 1UVNA 1QHAA 2KYXA 2DT9A 2OMLA 2PT0A 2AJQA 2NLXA 2EC2A 2VFVA 3HD1A 2HB5A 5DDQC 3FZKA 1TK8A 1GLDG 2KM8B 4CHQA 4H5WA 4P75A 3R1XA 4CZHA 2CNNB 2X6SA 4F67A 3M8SA 3RAXA 1WSFA 2HBKA 3D2FB 3MAAB 3GIRA 5AJ3K 2H51B 1B0TA 4WFYA 4K25A 2IDLA 5D0GA 2OTLS 1GXTA 3DRSB 4RUAA 1U1PA 3OR1B 4RUCA 2YNIB 2H5IB 2FXUA 4NLRA 3CD6N 1S7HA 3PIPQ 5A8WB 2JRSA 2NXUA 3TAPA 1K9MT 2BACA 4DX8H 5ETTA 3I0SA 3THWA 2HNYA 1S48A 1U2CA 1F3FA 3VF0B 3W2VB 4DZDA 2R7OA 4Y34A 4DU7A 2ASPA 1KAXA 4YDXA 1BO5O 1URRA 5AXNA 3WQPA 4X4SA 2CQDA 4J9RA 1Q16B 1VQYA 1LK5A 1UAWA 3ZSOA 4HACA 2NXCA 1KBRA 3IAS9 4C8NA 4Z0UA 3EO3A 5F3TA 4JI2F 1SQGA 4IQXA 2L9NA 3BGOP 4FLWA 4OHZA 3PTWA 5H9EK 5AQIA 1U26A 2KRRA 2J0XA 2AU0A 2B4JA 3F9MA 5K5MA 3HPGA 2BOAA 4RU9A 2R8IA 2B4PA 4OHYA 5D15A 3EKUA 3GIKA 2B56A 5I4MA 4KFBB 2A3ZA 4L3NA 2G8VA 1NO8A 4MMOA 4OJ3A 3EE9A 2JNJA 1RFQA 3ENBA 4CK2A 2P9UB 1O1WA 2BXJA 5A2QY 2VG6A 3MMJA 4XPEA 5L38A 2DPNA 3RAMA 2GW8A 2B4UA 2ZE2B 2BEFA 5CHIA 3H98A 1FNMA 4YDUA 3OXGA 4IR9A 3R6LB 2F7TA 1UPMB 4K7QA 1CBKA 3AVJA 4BR0A 4CH1A 1NDPA 2GX9A 1MWZA 3Q2TC 2ZKUA 4DR5F 2ATLA 1U7LA 4CZGA 3IXQA 3K2YA 3BJYA 4NA1A 2YBVA 1XNRJ 4MKVA 4Y0FA 1GNKA 2QFJA 3MM9B 1NK6A 3BS9A 4FOIA 1WELA 4K4UA 2CPZA 2XBPA 2NQPA 3CXCR 2PSZA 1H98A 2MQMA 4BRMA 4TQSA 2R7SA 1IBLK 2FLOA 2XNQA 1RA7A 1HHSA 4NLPA 5HQMA 3NGRA 6FD1A 4C97A 2QA4G 2CJXB 3MN7A 3F0NA 3VGLA 1TL3A 3RYLA 5F0UA 4H0VB 1G15A 3CC2N 1YVUA 1R27B 4ANDA 4PR6A 4X64J 4NZ7A 4O8KA 1NMDA 3PUFA 2L08A 5H9FK 3V1QA 2ZD1A 2RSQA 3J7AN 3FLCO 3T1HJ 3D6RA 1LWFB 4CTAA 5FLXO 2DNZA 4CGHA 4FLTA 1HD1A 4OLBA 1RBUA 2IYIA 1RT7B 3V81A 1HI0P 4RW7A 1JWWA 3OLBA 4OPKA 1C0GA 3QO9A 3MCOA 3BN4A 1M90O 1NGFA 2ZWPA 1NSQA 2P6SA 2P9IB 3M9NB 4AQYK 2Q97A 1RNHA 2CH6A 3TR5A 4OKKA 4RUBA 4M41A 4ZVFA 3V9WA 4QR1A 3D2EA 3K5PA 1OY6A 2P9KB 3D28A 2Z30B 4I2QB 1UWAA 2HAFA 4KREA 4EBEA 3D0HE 3HSDA 2XHBA 5HN0A 1IBMF 1V3ZA 2BANB 4DUZF 2MZ1A 1A0OB 1ASWA 3M6XA 1HJOA 2DNOA 2OGUA 1Q82O 3FZ2A 1J5OB 4LF1A 3OTOJ 3RMCA 1VBYA 3KWIA 2VQEJ 1B0VA 1U2RA 5KFGA 5C25A 1DTQA 2CJKA 3QDKA 1YJNN 4ZP9A 5HQ8A 4OVLA 1KVAA 4WQ4A 4KYZA 4CEQA 3ID6A 4CK3A 4DV6K 1SAZA 3P96A 4V19S 1T6CA 3PJ9A 1H74A 4C4WA 2BE2A 1WSIA 1RGIA 2YWWA 3M30A 5EOYA 2IMOA 1RAEB 4ED3A 1GX6A 3MXHP 2D9OA 2GGPB 2BJ9A 2BZ2A 3CCES 2BRLA 3M2RA 3SMPA 3K8WA 4ECTA 2E4LA 1S9EB 1RWNB 2QN6B 2W4DA 4ZK7M 2EK1A 3CCQS 4XEIA 2DR8A 4QYZK 2AQ4A 3NGSA 2COLA 2RHQB 3PY8A 2BQ3A 2QWMA 1BOTO 4LFCK 1R31A 1S9FA 4Q8FA 3SCJE 4BRIA 2C2DA 1U09A 1Q7YT 2W4PA 3OW2M 4ED4A 1T6DA 4OX9J 2DFEA 4X84A 3IKMA 2GVZB 5BXIA 2F8HA 4MO5A 3TA0A 2DHXA 1VIOA 4OYPA 1IM6A 2HQ3A 3ALYA 2ZDOA 1IV0A 4KB0A 4KHRA 4RG8A 4KIAA 3U3YA 5KGWA 3C16A 2BDPA 2HNZA 1U1OA 5KFYA 5GADP 3CCMN 4CFDA 2E66A 3HHDA 2XYHB 3FUYA 2B7BB 5KFRA 4N41A 4OJHA 4BQLA 5M1PA 2ROPA 2GNKA 1IKVB 2ZZNA 1GK8A 3J8AA 3A1YG 3VVTA 5MAOA 5LSRA 3MR3A 4ECWA 2IM2A 3CJCA 3HZ6A 4A57A 1HQUB 4IBNA 4PXEA 3H40A 4CZKA 4JEPA 3DOLB 2UU9J 1HWJA 2HVHA 2HHUA 5KG4A 3DOMB 4J9UE 4BREA 3MEDB 1U2VA 4PG5A 2ETJA 5BYQA 4EAHD 4HH0A 1EJ7L 3THVA 3CMES 3RGIA 5C0YA 2Z57B 1FTRA 5IFMA 1PAEX 2GIFA 3VEOA 4FZVA 3EWGA 3NH0A 4K4XA 5EWEA 3E9PA 2VC1A 1BWFO 1IQTA 3VR1A 3W9JA 3NNCA 2O8FA 4BGBA 3AXKA 2KJVA 4DSJA 2AP6A 4B08A 5GINA 3WX8A 3U1MA 3UE2A 3CD7A 4PG7A 3O1LA 3OTEA 4URSA 1WKKA 5FROA 2ZM6J 4C1NI 3QZ7A 3RB3A 3QLHA 3W3SA 1CLFA 3CD5A 4BE2A 1HBMB 1HHTP 4FM1A 3QJJA 4ICLA 3M8YA 1NB2A 1J5EJ 4C9DA 1WB9A 3EXCX 4BRQA 3GG4A 2HW3A 3LANA 2GFFA 1XNRF 2ABYA 5HJYA 4M5JA 3R5AA 5E26A 4ANEA 4QWCA 4LF9J 4DQSA 3C7NB 1OQ3A 4H4KC 4PWUA 3ZZRA 4OHXA 4X4OA 1JLQA 4JI2K 3MWPA 2A5XA 4GO5X 3NVMA 3BSNA 3B8AX 3CCWA 4DWIA 2IIHA 1XTZA 1DLOA 2ZVSA 3KLFA 1K8KA 5J2NB 3J80U 5A0YA 1JLEB 2ZOGA 4PUOB 2OO4A 4A8QA 3PNIA 4UY8T 3QGGA 1HD0A 3HSJA 5E84A 4X64F 1TFWA 4DQRA 4BR4A 2AV5A 2O67A 4Y2CA 3NL0A 1CPZA 1VQMN 3T1HF 1KLNA 3MR2A 1KWMA 2HBYB 4HHHA 2ACMA 1FNOA 4LFAJ 1JKHA 3OVAA 2DY1A 3AV9A 3V9XA 1RZMA 3RW7A 1AROP 1Q18A 2BKPA 3LM2A 3KKRA 4YB7A 5FDLB 3PYEA 2HQCA 1D9FA 4DR5K 3WX4A 1X3MA 4ED7A 3SYZA 1RWWB 3R7SB 4ZVUB 4NXNJ 2OLWA 1IKXB 3ZETA 2DHAA 4Z4EA 3CG7A 1TAQA 1MROA 2C3MA 3MM5A 1IWAA 3R6GB 2IC3B 2XSJA 5AQMA 2CQCA 3MD3A 3C6UB 1HKBA 5C24A 4QPTA 2PZSA 3QSIA 3KVGA 3VAFA 1TAUA 4ELUA 3KHGA 2R7UA 1VSJA 4NYPA 3DLBA 3DDIA 3DLEB 3CO9A 3CFRA 3B6OA 2HHVA 2CDQA 3AGKA 1VGYA 4TYAA 3GILA 2FSNA 1EB0A 1YTUA 3OTOF 5KFFA 4P74A 3G6ES 1SV5B 5D0RA 1CZ9A 3O5TB 1XWLA 1EKEA 4RCHA 2I2YA 3H1VX 3A8YA 1FVQA 2B6AB 1IG9A 4MKYA 2YWKA 4NI2A 2HNDB 1C0MA 3OQ2A 4OO1J 3VZHA 3IG1A 3ASMA 4FKXA 1K73T 2E2NA 4AF1A 2BJDA 3QNOA 1NJIT 1JQGA 2WOMB 3S41A 2J6TA 1RBTA 4ZLLA 2VG5B 1IKYA 2MJUA 1RWXB 1D9AA 1CULB 3MAAA 4B9NA 3BKUA 4MIBA 2DGXA 2W9BA 3B82A 3CETA 1ZBHA 2YHYA 4LSZB 2W7OA 3CCQN 3LPYA 5CYMB 3TUJC 2CPEA 4DU4A 2YNIA 3SJJA 2X3DA 2HGNA 5A8WA 2ITMA 3H3NO 2LU1A 3DLLL 2P5VA 3G0ZA 3NF7A 3NH1A 1E4GT 2YNGB 4KE5A 4OI6A 4URQU 1IBMK 4I67A 4DUZK 4M3RA 2QV6A 4O44A 1SIZA 1RAJA 2YNHB 1HBNB 5JJBA 4OX9F 1X4DA 2A0FB 1N8RO 3UDCA 3D1OA 4LIWA 3LA0A 2CA9A 2GMHA 4ED1A 1C1CB 4PQUB 1IWGA 1W2BR 4K4VA 2DIVA 2OPPA 3C8YA 5BJRA 3KTQA 4HUFA 1FRKA 3EXYA 4CFCA 5KFDA 3UO0A 3UQSA 1FK9A 2GVDA 2IBKA 2L9DA 5M1KA 4USTA 1G3OA 2XMAA 2A1RA 1BIZA 3EX7B 3F73A 4OV6A 1SI9A 1NKBA 1FX2A 2PY5A 3A13A 5AE2A 5CXTA 2K2PA 3LAMA 3O80A 1KVJA 4DTUA 3ZT0A 1YI2S 5BR9A 4M5NA 1AB8A 2M2BA 1W9HA 2I5JB 2KB2A 2ZJRQ 2UU9F 2W6KA 3LPEA 1R8HA 2P9UA 1QAIA 2KZMA 4EZ9A 2J4RA 2GQ2A 4O5BA 3M5RA 1TR0A 3L7PA 4C6AA 2LEBA 1FKAF 4U8VA 2Z2ZA 1RT4B 1R43A 4MAKA 1RT3B 2Z1HA 4KO0B 3MFIA 1WORA 3ZNJ1 2D3UA 3IGNA 2X74A 1WEZA 3I8BA 1Z1ZA 1HNVB 1T3NA 4BE1A 2MKCA 2QLXA 4DSIA 2FBYA 2B5JB 4NLQA 2G8IA 1UETA 5G0RA 4M63C 2RT3A 1RABB 4FJ9A 4DV2J 1UFWA 4Y00A 3Q24A 2JX2A 4IRCA 3TVYA 4C48A 4P7VA 2HMIB 4FBUA 3TTDA 4E7KA 3AXMA 1WEXA 4HCCA 5SUHA 3IR5B 2J0SD 3TSUA 1RTZA 3H2VE 4F3OA 1GXLA 3TI0A 1LQ9A 5AQSA 2ZM6F 2F8MA 2YX6A 2QM1A 4LRBA 4KGXB 3SQ1A 1IM4A 4KKOA 3NCQA 4KRFA 4LBHA 4U67Q 3VA0A 1X5TA 1QQCA 2QZ8A 1NHUA 1J5EF 3GPAA 3NMRA 2ROEA 5B0BA 1GLFO 4WQ5C 4O3SA 4LF9F 2BYCA 1U1LA 2VFUA 4B1UB 1H2TZ 4DX6A 2CNLB 5GIOA 1FX4A 1I1GA 3WIUA 1VK0A 3BSCA 1J27A 5KT3A 4KHQA 4Y2KA 1TVRB 3HPHA 3CF5Q 2AEMA 3FQLA 2VPYB 4FJMA 3OTBA 1NUEA 2X1GA 2YKOA 4WP8A 2F9JA 2DXDA 1JJ4A 2HYIB 4USJC 3O3GA 3B8HA 2YHAA 3P31A 1N5SA 4X4QA 1WOQA 1RBSA 2JOQA 3AB4B 2WAQD 3NVKA 3FC9A 1X9SA 1N52B 4BHQA 1YRXA 2ZBQA 4LFAF 2P9KA 1PSDA 2K1RB 3LDSA 4F3MA 4Y2IA 1JJ2M 4UQGA 3ZCMA 1I94J 4TLRA 4BR7A 4YR3A 4XH1A 1Q9XA 5LL6Z 1IN0A 2MHNA 2MLXA 4NEZA 2VU5A 4F0HA 4J9QA 3A5LC 3KK2B 5LMNJ 3UNYA 4GVLA 3QFHA 3H59A 4NXNF 1F2GA 3W5YA 1XNRK 4DPOA 4H0YB 1J5OA 3G6XA 1L3TA 3R5BA 4ED0A 3OBWA 1S22A 3KG1A 3L2RA 3LWMA 2BJ7A 1QE1A 3P38A 1FDDA 5FPEA 2OI2A 4IFYB 4J2EA 2NR0A 3R8YA 1JJ2R 2GHVC 3FFKB 3CFOA 3IM9A 2FJVA 2H3EB 3VTIA 3KJQB 2G8HA 3M2UA 2YWGA 4WFAL 1VQPN 5B09A 1UJ6A 5ELZA 1GTHA 3HHLC 1TKZB 2GGPA 4KHPJ 4C3MA 1VQLS 5K14B 3MM8A 3AARA 2B9YA 5E3CA 3RAQA 4X4TA 4X64K 4JV0A 2VV5A 5HMZA 5HP1A 1AUSL 3KLGB 3HXMA 4N8OA 4ECYA 4B17A 4PHTX 5JLHA 3T1HK 4X66J 3EGZA 4YUDA 3C3LA 1IJEB 5IT0A 3CVKA 3EZ5A 3QICA 3HCXA 3EY1A 5I3PA 1S5ZA 3PR4A 1E6VB 2DO0A 1VRUB 2IAJB 5CZ1A 2G0JA 1Q7LB 1T9UA 4IRDA 5DM6L 4ECRA 3I55S 3K8VA 3SXLA 2EC0A 4JNEA 3CJBA 2FLLA 3J81Y 2GVZA 3E01B 2HQGA 4LSLB 3W63A 4AM7A 5DG9A 1Q5VA 3KG4A 1KN6A 2E9ZA 1PJ6A 2E1ZA 4CHYA 3CPWR 1FFWB 3HLUA 3WXKA 2WFBA 2HVZA 2J0WA 3UKUB 3O4QA 1BIUA 5D0EA 5A8KB 3JAMY 1GEHA 3GFXA 4ES2A 4CJSA 1AZSA 5J1NA 3P83D 3VAMA 5GADU 4DDFA 2X1FA 1SS6A 4DU1A 5DG7A 1YK9A 3OTOK 2HIYA 3OYLA 1HQUA 3QETA 4ZJOA 4DTSA 2VQEK 1YJ7A 4HHTA 5KGXA 1KXPA 4GMJB 3C2PA 1WG1A 5CCMA 4PKIA 4K59A 4UQTA 3UDEA 2BMBA 1F9FA 3V9SA 1G4CA 3DOMA 1K1QA 4O0JA 1ZBUA 3SLCA 4OGCA 3N4QA 3IMQJ 2CNOB 2DR9A 1B9DA 2JLGA 2YCHA 4XTTA 2RRNA 3VALA 3AY0A 4OV1A 2IA6A 1RWVB 5T41A 2EW9A 4CZJA 1FXRA 3OVNA 2X7IA 3MN9A 1NZ8A 2KI2A 2VA2A 4WJBA 2EFQA 3V2UC 2JEIA 3A8IA 2BKOA 1YJ9S 3W8PA 2BA9A 2P5GA 2YX7A 2MKHA 1VFJA 2KVIA 5LJVA 4YY3J 3O9SA 1FKOB 4LY7A 1HBMA 2E29A 3PRVA 4JKDA 3Q89A 1CZAN 3RBZA 2KT5A 4R5PA 3JS6A 3FCWA 2D7SA 5KFQA 2EXUA 1YJUA 4G3IA 3EGVA 4DV2F 4OX9K 2OKQA 1KAYA 1DT9A 4Q0BB 1AFIA 2NPFA 3C7NA 4USHA 1YHQN 4JD2B 3CCTA 4K8ZA 3SUOA 2CPYA 2JVRA 1Z6RA 3C46A 1T9TA 2FPHX 1OMSA 5L1KA 1YIJS 2XB2D 5IT9Y 3N28A 2C2RA 4ZCKA 1UP1A 2XWYA 2VJUA 5J2NA 3VQAA 1JLEA 4CHOA 5BR8J 4M3YA 1MDUB 2CJQA 2V50A 2EEYA 5KFPA 1OPIA 1RT5A 4I68A 2N4DA 4KH1B 5DJBA 3N5FA 2UU9K 4CIOA 3HBTA 4A62A 4IG3B 5KFAA 4OX8A 4OZ1A 4IH7A 4HCBA 3D7EO 4FZXC 4X4RA 1JCFA 3MECB 1FJCA 2NRZA 4CBXA 4A8SA 5A2QO 2IJNA 3NDKA 1AA1B 3ELHA 3SEOA 5ETQA 2W2MP 3K0JA 2G0CA 5FDLA 4JK9A 4WIQA 3VAGA 3NXZA 2HHWA 1PIEA 1UFKA 2YV0X 5BN8A 3SCIE 1U8WA 3ZX2A 2PEBA 1JXLA 3D68A 3TWZA 3LPTA 4C3KA 2YJEA 1S4FA 3TTCA 2IC3A 4LRAA 2ZBCA 3EKSA 4B9SA 3SQOP 2R7QA 1JL2A 2ZM6K 1NAQA 4FVUA 4HHJA 3EVOA 1I94F 1MWQA 4ID8A 2BABA 2N7CA 4H4OA 2EI5A 4OZ0A 2VCPA 1J5EK 5LMNF 3PX0A 3U6FA 3PJXA 1LAWA 4H4MB 3ETMA 4LF9K 1S59A 1LOTB 1WF2A 4PL7A 3TSQA 3AVMA 5K8NA 3MWTA 2O8CB 2QYCA 3NBPB 3O44A 4EP4A 1VQ8N 1HWKA 4MKBA 4IEEA 1YITN 4OKEA 4CBUA 3M2VB 3BM7A 2GMJA 4YP3A 3GDQA 2WOMA 5I42A 4F02A 2FVSA 4P10A 2LKZA 4KHPF 4TY9A 1U1RA 4F7VA 2HG4A 1CULA 1MN9A 1VQLN 2X1AA 1U24A 1PYOB 1K1SA 2AIRB 4DHYA 3CO0P 3V6KA 1U8SA 2BRKA 1HWUA 1XQIA 2G0IA 2QG9B 1VMBA 1TZ0A 4YOEA 3OR2B 4X66F 3MM6B 3TTFA 4E7HA 5E3RA 2ZHAA 4NA3A 3QT7A 2Q66A 4LFAK 4YN3B 2R8GA 1WSEA 4DQIA 1T44A 4Q2MA 4AHUA 4NLYA 2MZQA 3KDOA 2E7XA 3VQ9A 4LMZA 3TAMB 3CJKA 3HHKA 2RF2A 3LGNA 4ZLJA 3KIOA 1NGBA 3U1LA 2UXBJ 2K3KA 3AA4A 5KFJA 3JYTB 1HBNA 2E7WA 5HMXA 4NXNK 3I55N 3JSMB 2QLBB 1S1TA 5IS2A 3JQKA 1NXIA 3NOGA 2MGZB 3KOAA 4D3HA 5LXYA 1RAFB 4BRNA 2VBWA 2OP5A 3CFPA 3TAQA 1ZM9A 1BQNA 2OEJA 4BC9A 4USIA 3I33A 1EP4A 2V8GA 1F9HA 1RLCL 4IH5A 4KGMA 4RBVA 1T9XA 2C2KB 1SBRA 3O2IA 1O8BA 4G9ZA 2E1PA 3A8KA 3QESA 2DR5A 1QY7A 3HULA 4ZS6A 3EL2A 1RDCA 2QGFB 3ZO7A 2PAVA 3C65A 4WCEQ 3GQCA 2O8BA 5L46A 3S3NA 3K2PA 2EPIA 5MLCV 4NO7A 2I5JA 3KG0A 1X3NA 3PIPL 4IR1A 2BQUA 4I6WA 1ROFA 2VQFJ 2VL1A 1NKEA 3OXFA 1TKDA 1FERA 3DN9A 3R7NB 3MDQA 2XGPA 3LGMA 1RT3A 4KO0A 3BV8A 2J8SA 1QVFR 2OD4A 3O6QA 2BJ1A 3BH7B 3S3MA 3PW0A 4B1VA 1UPPA 3MX5A 3DDKA 3CUNA 3L0QA 3L4BC 3MK6A 3ZZOA 4DU8A 2Z8QA 2AMCB 1IBCB 3DLKA 1N33J 1L3UA 4JS5A 4DV7J 5KG7A 1OY9A 1K9MO 3HPOA 1FJGJ 1RTHB 3QNNA 3WC2A 2ZH7A 4PQAA 3G8SA 1Z2ZA 3I8DA 4R0JA 2BW7A 4NLVA 1LWEB 1YJ9N 4YY3F 4Q43A 3CDAA 2QX0A 2YX1A 3NOCA 4W5TA 1S79A 5C2GA 1TKTA 4FWLA 2O8DB 3P6YC 1FJ7A 2HIQA 4RNHA 5HQLA 4CF0A 4A2AA 2OPQB 2AKWB 1VQ9S 3DDNA 1X5SA 2KFZA 3TZWA 3CIZA 2F9WA 1R8CA 3UKRB 2IVOA 2Z1GA 3C15A 4FJHA 5DDOC 2OUGA 1LNQA 4QIVA 4QOTA 3J7AP 1VQOS 3U1NA 1QS4A 4PL8A 5CD4H 1JLAB 5E7OB 4CHPA 3BGRA 2H4YB 3SFGA 3PO5A 1C0UB 4XH5A 1Z05A 4E7LA 1FXDA 1RILA 5EDWA 2N3OA 5F1XA 1KC8T 4ECSA 2DHHA 6AT1B 5BR8F 4RL1A 3DLRA 2CQHA 3QAUA 3SPZA 2DGTA 3J7ZT 4FF4A 1RUSA 1HKCA 3CDEA 1HPZA 4JKFA 5HI7A 4L73A 3OYKA 2KT2A 2VPXB 1VQ6S 3QEIA 2ZNYA 3GYXB 1VQNS 5L1IA 1S1WB 2DNYA 1KEKA 4BGAA 4FXVA 2J9DE 3HJVA 1TMMA 4ERDA 3G9CA 2J7KA 2K1RA 3QMQA 1B70B 2KN4A 1DKGD 2ILZA 4EI2A 2P9LA 5D78A 4LREA 3QB0A 2FIUA 4DV2K 3NLCA 1Y5IB 2FC9A 1Y9OA 5C12A 3EGWB 2HRYA 1RKIA 1HKGA 4G65A 3Q7BA 2R8HA 5CZVA 1ILYA 4FWPA 1CJVB 2XZDB 3SPYA 2QO3A 2FZKB 5AQNA 1NHKL 1P9QC 4CZCA 3NAEA 4FJXA 2HFZA 3M8WA 1SQFA 3ZTOA 2MDAA 5E2QA 2WVBA 2FSJA 4ECXA 2BTFA 4J9KA 2GS8A 2CJYB 4ZPBA 1Q81T 4JKHA 5J2QA 2CZ9A 3QGPA 4F3TA 5K14A 2W9CB 4DR4J 3MMAA 4A61A 1IR2A 1RDAA 4ES3A 1CS4B 2CFXA 1EKRA 3V5RA 5HLFB 2V8PA 2E44A 1ZXOA 3KLGA 3AO3A 4FW2A 2DGQA 2A6OA 4AHCA 3NNAA 4BC7A 1FA0A 1B4SA 5ETPA 4PG4A 2ROGA 1U6FA 3LOUA 4CJPA 4CHNA 3IMXA 4LBIA 1Q78A 1E6VA 3SAFA 3HM8A 2QWOA 4B8AB 2HHPA 2IAJA 3BREA 4UOHA 4ZPAA 3ENHA 4HT7A 1T11A 1KSPA 5FLXY 3I4PA 2HQDA 2A6MA 5J1EA 3E01A 3G10A 3RUBL 3CIMA 4LSLA 3D67A 5D3GB 2HFNA 5T7LB 3EPGA 4LQ9A 3KUHA 2ZUGA 2A1SA 2RQ4A 2N4CA 3VQPA 3MM7B 4DQ8A 1NM2A 2WK4A 4ZPTR 1UVKA 1NK9A 3CJ7A 2MLYA 1W97L 4FKYA 2V8DA 4QR2A 1I94K 4FJGA 5A8KA 2KU7A 1K44A 1SXLA 3RBXA 1TP7A 4OI1A 3VQBA 2V2VA 3GMGA 2UXBF 4LIRA 4CJKA 1NK4A 3G71S 5LMNK 2JDJA 2XM3A 1IJFB 1JCGA 1WAFA 5H1SQ 1QUVA 3I0RA 1OH5A 5IQQA 2MSTA 1HI8A 4KTZA 4PA1A 1FVSA 2OTJS 3IBCB 2XCPA 3I5AA 2DISA 2HVEA 1N5YA 2FC8A 5KFLA 3OYDA 3R1HA 1JNZB 2GQQA 3LPUA 2XG8A 3V1RA 1SCJB 3AA5X 3BBFA 2KG0A 2GJIA 4HYKA 3V6JA 1DEJA 2KYZA 5AQHA 3ZT2A 4KHPK 2P6TA 3ZX0A 5FJ4A 2RE2A 1BHNA 4W5NA 2AYBA 1TUUA 2VQFF 2QA4S 3CJ5A 3JS9A 1SKRA 2QMWA 3Q8UA 3GJTB 4X66K 2LXUA 2P9NB 1MU2A 2P9CA 4BDZA 4NLGA 2HHSA 1KRPA 2XQCA 3V1OA 2HLTA 3ITHA 4F36A 1FKOA 3DKDA 3LF0A 4R8UA 4CLLA 3MOJB 3MD1A 4EK2A 1ZZFA 2DNRA 4G6VB 2QT7A 1N33F 4YB1P 3ZYYX 4DV7F 2EFPA 4IEIA 2OZMA 4Y2AA 4P71A 4ALZA 4Q0BA 2F8SA 1FJGF 2Q36A 4LRDA 1OH8A 5FRNA 3TPQA 1CZBA 2OZSA 1FF2A 3OYBA 4JD2A 2CDRB 4I6MB 2WB4A 4N77A 2QMUB 3ZC4A 1F9EB 5M2UA 2P2CB 1KLMB 1R6VA 1PC5A 3EM1A 4B3SJ 1RSCA 4CGGA 2Q43A 1S6UA 3L7UA 2E7VA 3R5GA 5HBMB 1NGAA 3G82B 2IM1A 3LDQA 2W01A 2NRRA 4IO9Q 3JB9k 4LRFA 4PXCA 2W42A 4FDFA 3R2DJ 2I9SA 3M1VB 3VMFB 2HF3A 1VQ9N 2JH3A 3QWUA 2B7CB 3ETOA 3HSTB 1V5VA 1VHFA 4C7QA 1CG2A 1HBUB 3UR0A 1SL2A 3FCHA 1BUXA 3D54A 3HVRA 4UW2A 4BCAA 2GBZA 2QLJB 3WNEA 4HVJA 3PX4A 4GKKJ 3R5JB 4F8RA 1VSMA 4HTJA 2F1FA 4M5MA 5ETKA 3BR8A 3OFEA 4M3ZA 5KFEA 3NGYA 3U02A 3QFWA 1Y5NB 3ULDA 1ZETA 4DF4A 2RQMA 1GLBG 1HBOB 3E51A 3FZMA 3OHBA 2DITA 1VQ6N 1UJ4A 3TA1A 4HVZA 5KT2A 1VQNN 1PYSB 4ER8A 4ZVRB 5HRNA 3S9HA 1YUWA 4YY3K 1YJWN 1FNXH 2FD2A 3I96A 3HO1A 4I4BA 1H0HB 1A5VA 1X5PA 1Y4ZB 2X3GA 4IG0B 2V52B 3TSPA 1NJYA 3R2CJ 5HO4A 3ISNC 1DURA 1RWPB 1H7XA 4AUKA 2F7VA 2VFRA 5EHHA 5A2QU 3CCRS 1VC0A 2GO9A 4QIEA 4EWTA 2NUHA 2HRUA 1CC8A 2J9CA 5DM7Q 2V7YA 1RDBA 1KR4A 3VCDA 4IO1A 2MY8A 3RMAA 4AHRA 3ID8A 4WYWA 3ZSWA 3R9LA 1XR7A 3NBPA 5HVFA 3I0SB 3D6HB 4J91A 3SAGA 4DCHA 3QAEA 1S72S 5BR8K 3NGIA 2B9XA 3VF6A 4DR4F 4A8WA 3W8GA 4Z2XA 3NS5A 4HACB 4W4MA 3PACA 2LQ9A 1LK7A 4FPIA 4KHSA 3OR2A 4ELTA 4EMDA 2HHQA 5ETOA 3ZTQA 1BLUA 4ZCLA 3OYHA 5JLFA 2E2OA 1KHWA 1TKXB 4HLBA 1PC4A 2GELA 3PFOA 3VQ6A 3QGIA 4ID1A 2WC9A 1BQMB 3EVWA 3TAMA 5D4LA 3RRGA 3TVKA 2QWLA 3OA9A 2AZ1A 3MI7X 3JYTA 4N56A 3CEDA 3LAKA 2ZH5A 1F21A 1D09B 2VG6B 5T14A 1RHMB 4ILGB 4CGDA 2DB1A 3UCZP 4LQ3A 4O55A 3DM2B 3ONQA 4J9LA 2YKQA 4DTMA 4NE9C 3HVTA 3EZOA 4NLOA 1ZBTA 5IOLA 2VODA 3NRBA 4B9VA 2VBZA 4BRGA 4TLQA 3CYMA 3D6MB 4QW8A 3VEYA 4CLZA 1BXNA 2HSTA 4CW7B 1S49A 2UUAJ 3CIPA 4WBFA 1OJ4A 4MK8A 2NRXA 2FJBB 4DV0J 1G99A 1GMVA 1NJZA 4G1QB 2CAJA 4TNOA 4JK7A 1HR0J 1S1UB 2KXFA 3OYNA 3LALA 4E19A 3J81j 4CGIA 4MFBB 3KD5E 4U9RA 2OTJN 2VHGA 2ZWOA 4F2SA 2MKYA 1CJUB 1NH8A 4O3QA 3D7SB 2OSQA 1NK8A 2XTJP 4KB1A 4YEAA 1V4SA 5DK5A 2GIRA 3O4NA 4CEAA 2PEHA 3CC7S 4DR7J 4CO0A 2HF4A 3OVBA 3QMLA 1D9DA 4KPCA 4DN0A 1SC6A 3QFPA 3IP0A 4AILC 1H6KX 3PXGa 4OHVA 1R8AA 3DHXA 2CG4A 2K3IA 1RK8A 2V4RA 2QA4N 3BSAA 4CZMA 1ATSA 1S57A 2Z2YB 1MNEA 2VOPA 4ZLPA 4HEA9 3J81O 3JSYA 4WE1B 3VAHA 4CESA 4RW7B 2ZJRL 1DQ9A 1D8ZA 2GHPA 1QSYA 2DFHA 1V9OA 1EARA 1FRXA 2UXBK 1HARA 1NNDA 2JEGA 1S0MA 1BE4A 3LP1A 3LZIA 2ZGZA 1QQOA 4M7YA 1HMVB 4M5IA 4FJJA 1VQSA 3WZ0A 2RJZA 3UKRA 2HLUA 3JAMO 1JJCB 4DFKA 3ENQA 1KDNA 1T02A 1H7WA 2V63A 3GFYA 3UI3A 4DJBA 4ECVA 3D2EB 1G2EA 2J6SA 1YVNA 1JLAA 5JUMA 1ZAWA 4QAGA 1RQ0A 4B3SF 2CPHA 1C0UA 4BRDA 2FVQA 2AJ2A 3POTB 3VGMA 3C6TA 2OD6A 3LDNA 2ZH1A 3BBBA 3ZLJA 1MG7A 2HS3A 2VONA 3BKTA 2IMWP 4Y3CA 2QWNA 4Z94A 4DX5A 3AAWB 3ZEUB 1TL5A 4B3OB 2CPFA 2Z4PA 4FS1A 5C25B 2QEXS 2VQFK 2XS7A 4ILHA 4CF8A 4K4TA 1IH7A 4OYZA 1FRMA 4CI0B 4U67L 2ZEJA 4Y65A 3K7RA 2MKKA 4DN9A 3VGTA 4LJMA 2BE2B 3SFUA 1F3VA 3BDEA 4GKKF 1RDDA 2P9PB 3M8PA 1NRKA 4KQZA 2XS2A 1YBUA 3M7VA 4RR5A 4QOZB 1BY9A 3M2RB 2RS2A 4Z4CA 1N33K 4DV7K 3CJRA 4CLSA 2DNMA 2J0QD 2EG2A 2GEMA 3SQ0A 3CF5L 3LWLA 1FJGK 3WC0A 2DNGA 1VDHA 2R8KA 2WVDA 4CJ3A 2ZBIA 4HT5A 3HOSA 1HLUA 1Q95G 1K6YA 2ZFHA 4EBDA 1M1KT 1WSGA 2XHCA 5B0CA 5LSLA 4FNHA 3H08A 5AE3A 4JLHA 3QT6A 2CZ4A 3PR5B 4HL9A 1NBWA 3EN9A 1KVIA 4F4YA 2MLZA 2M52A 4IKFA 1D1UA 4LF2A 2CQBA 2ZITA 3CJQA 4WP9A 4FJIA 1EQYA 2RDIA 3LGHA 2Z1IA 4IXCA 2QA1A 3CHWA 3W9HA 4OPHA 4ZN3A 4OLPA 1K8AO 1EAYC 3TARA 2ZDPA 4E1NA 4C0OC 3FMBA 2RILA 2RQKA 1FD2A 3GSDA 4ISEA 2CNKB 4K50A 2GA7A 2VDHA 1S72N 5IWAJ 1Y0HA 1O13A 2E1CA 3QIPA 3TJAA 3FNNA 3M05A 3AJ2A 1S97A 4LFBJ 4N7TA 3OJSA 2HAIA 3K57A 5D3GA 4JV2A 3D0GE 4V1Ak 4A48A 3C0BA 5EUHA 2FY1A 3FK4A 2LXIA 1QD1A 1TU0B 3EZWA 4ECZA 2FBVA 4WQ4C 1I5OB 4ETZA 1IUJA 4CJUA 3GSIA 1S1XB 3LP0B 1NKCA 4XDCA 1AXQA 1EQMA 1UA0A 3EMTA 2H65B 3EGNA 1RDUA 3QBXA 1OO0B 2O8FB 3NNHA 4WQ5A 4EFHA 3CCUS 1NB7A 3DLHA 1JJHA 3GLJA 2HZCA 2XLIA 1JLFA 3KXDA 4DTXA 2V0NA 4CZIA 3CC4S 4A8KA 2O66A 3KHHA 2V34A 2FJDB 4O4GB 3AGRA 4JOUA 3UB5A 2JEJA 1M90T 3DCAA 2W6LA 4MLHA 1R0CB 2XMMA 4CEZA 3W62A 2IRUA 5AQGA 2UUAF 5BPMA 1OYDA 1R8BA 5HRSA 3NF8A 3MWBA 4DV0F 3FFIB 3TUIC 4JI8J 4DR4K 4ENOA 1JMTA 1HR0F 1BCOA 3EZUA 5H1SV 2DRAA 1QVGM 2D3O1 4EHUA 1JLQB 1V5IB 5F0WA 2GC8A 2P9NA 4DV3J 1NWKA 1WJ9A 3UE5A 4W5RA 3QT5A 1SL0A 1VBXA 4X4VA 1RHJB 3KLFB 2ZJQQ 3K58A 1MMNA 3BO3A 1NOYA 1K8KB 1Q82T 1Q8KA 4FL9A 3WXLA 4P7TA 1U6BA 4DR7F 2MY7A 2K7JA 1P6TA 2GV1A 2UVRA 4CLYA 4E1MA 2JFKA 2ZF5O 4ZPDA 2UXDJ 1RTJB 4J37A 5B0EA 3PRBA 4J8FA 4Z4FA 1ZS6A 1T7PA 1VQ7S 4CFAA 4JI5J 3CCZA 3FDSA 5KFVA 2LEPA 2LFVA 3OYIA 4KHWA 3UD3P 3OUYA 4B1XB 2SXLA 1ZA2B 2CJAA 2FLNA 5CE3A 3UD4P 3TJ8A 1MWKA 2ZH9A 2NRWA 3HHLA 4DX7A 3ZETB 4CZLA 2CQ3A 3OV7A 2KHOA 2HBRB 1LFWA 1MROB 4JKBA 5FPDA 4AHSA 3IRXA 2XSJB 2EKYA 1ZBSA 3KKSA 1MSWD 2OYQA 5DLGA 2QJ3A 2E5IA 3W9IA 5ADXH 4FWSA 2N3LA 2A2CA 3VWSA 3C95A 3P1GA 3ULEB 4ECQA 1QSSA 2DCLA 3BB5A 4DOZA 3LM9A 4W90B 1U1QA 3J7YU 1LFPA 1D4XA 3VQ7A 4E1JA 2E1RA 1QUPA 2XY5A 3EPIA 3GCWP 4O3RA 2GO8A 1VSDA 1NMNA 3NGTA 1HBOA 2DNLA 3U4LA 3MMBB 2QEXN 4KHYA 3RRHA 4NI2B 1BISA 5F9LA 3BPSP 3IG1B 2O1PA 3ZZUA 1V4TA 3D9BA 3NGKA 2PBDA 2VC0A 1Y3KA 3CJ4A 3OL7A 2RUGA 2NZTA 2C3YA 1FDAA 3W5ZA 1J2VA 2DNPA 3TWHA 4FWOA 5AQKA 3AD9C 5THWA 2QXLA 4IG0A 1IKYB 3JSBA 1GT8A 3KWMA 4FZZA 4PXBA 4YOXA 4P72A 2HBZB 3H5XA 1U04A 4PAAA 2W9BB 4F9OA 4C2MA 1U0HB 1Y10A 3KJNB 3R3LA 4FLZA 4CRJA 5IC4B 2OPSB 2E5HA 3BZQA 4XPCA 1TUVA 1M1GA 2FF6A 3MGJA 4B3SK 1DTTB 5AQUA 3VESA 3VQDA 4FF1A 3UN3A 4OJRA 4O44B 2FZCB 5CA5A 1WDDA 3NCPA 4LF4J 4R25A 4C8MA 4L76A 5AT1B 4FWQA 4MYUA 3EDRB 2W8LA 4ZVGA 5BRHA 1Y00A 1ZBIA 2ZC4A 4FXWA 2OPPB 1YXQA 5LOQA 4YOUA 1XMOJ 4G1PA 2H9ZA 1X60A 2Y1RI 3ZXWA 1FK9B 2GVDB 3R5CA 2KQ2A 5HMYA 5D6GA 4RW6A 4GKKK 2VWJA 1TKXA 3T5JA 1WEYA 4HTIA 3S3OA 3P3DA 1BQMA 5L39A 2D0CA 4DFMA 2P9EA 4IJAA 2XMUA 4XIUA 1DZ5A 4HTLA 3U3GA 5IWAF 3GU0A 5L1LA 4HDHA 1NU0A 4JBCA 4OX6A 4LFBF 3NGZA 5FRMA 3P39A 3GONA 4MKAA 2F63A 1VLOA 2ZJPQ 5CHCB 3H3OB 3O9QA 3DM2A 2R2TA 3CXCM 3O1BA 3IS9B 2VPWB 1SVDA 2PFFB 3P4IA 5EY4A 1N5TA 1VSKA 5AQQA 3Q0AA 3KK3A 3L9ZA 4PRFA 3HHNB 3BO4A 1UEUA 4B9MA 3RBDA 1ZH5A 2QTDA 3UFCX 5GMKa 2HBJA 2KM8C 5G0RB 4FZYA 3C66A 4CE9A 5E3AA 4CHZA 4ITSA 1YAGA 4G1QA 5AXKA 3CCUN 4FM0A 4X4PA 4RU2A 1QAXA 1S1UA 3VVUA 1HL6A 2RMLA 4O23A 3CC4N 4MFBA 1GOBA 3IBWA 1TYQB 4FYXB 3OHAA 2ZHBA 1CJUA 1U6ZA 4KKOB 4JI7J 4KTQA 2P51A 3CNQP 2RNEA 5I9EB 1UMJA 2VZ9A 1Y64A 2VBYA 4KB7A 2FVCA 2N82B 1D3WA 1WC3A 1GLAG 5ETRA 3FR0A 4JI8F 3KUEA 4ISGA 2ZWHA 2BVZA 3IC1A 5GAEI 2IDEA 1XR6A 2RPIA 4CEOA 1HNWJ 4A8YA 1B0PA 3MOZA 2DTUA 2IRXA 3AO5A 4ISFA 3FRZA 5F8NA 2VFSA 4DV3F 2YJFA 2O5DA 3RR7A 1C1BA 1LKZA 1X8DA 4YOWA 1XI1A 3KLEA 8ATCB 3BQ0A 4WCEL 4WE1A 5D77A 3CSKA 2F9DA 1Z4UA 2QKKA 3NF9A 3GE9A 2PMZD 4IOCQ 5KRSA 3VA3A 2FJAB 4GV9A 2M8HA 4O4RA 2J5AA 4A5BA 4JP8A 2UXDF 2IA0A 1HMVA 1EZZB 4WZMA 3ZX3A 2M0GB 3TZYA 3BQ2A 3D0IE 4P2MA 4FF2A 2NSBA 4JI5F 4NZ0A 2NRVA 1RKJA 3KLIB 1OYEA 1XHZA 1RACB 1GLCG 1SH0A 1RBVA 1XC9A 1JLCB 1P8GA 2XC9A 3X1LB 4O0IA 4AXJA 3POTA 2IJRA 5JMNA 1TUYA 4NYZA 3ILJA 2W2NP 3J81U 1N34J 1BMQB 1S4EA 3QWPA 4V19J 2UUAK 1RWOB 4LUBA 4DV0K 1LV5A 2A41A 3ZEUA 1NSKL 2ZVIA 4B3OA 2XMVA 1HR0K 4DSFA 1QE1B 5AQVA 1JB0C 1UVJA 4IWVA 1ZPWX 3A8JA 4YOYA 7AT1B 3JAMU 2WW4A 2Z2MA 3HFVA 2ASJA 1VI7A 2HFVA 4K2XA 3NAHA 2FHMA 4DQPA 1FRHA 1NCLA 3M2UB 2P9PA 2H48B 3DXSX 1N8RT 3TU5A 2D74B 1UKUA 4OYAA 2MXYA 4DR7K 1OQ6A 3MR5A 3CM5A 2A40A 3MM8B 3CQYA 1B9FA 3BO2A 1I6JA 2XGQA 1S0VA 4BR2A 2VBXA 7FDRA 2G9OA 5HP1B 3C14B 3GYGA 1WC4A 3TABA 1S6QB 4ID5A 3SUNA 3OBIA 5IM0A 4EO6A 1PAUB 2DIUA 3TANA 5KTQA 4OJGA 3OFFA 3VQSA 1J6ZA 4QPXA 4BRCA 2BUNA 2Z1JA 4NLTA 1RLDA 3UCGA 1YKWA 4DSKA 3DXMB 3FBFA 2O4GA 2M70A 1WG5A 3S1TA 2IHR1 4CWBA 2C3PA 1HPMA 4DCJB 4YQWA 4FJ5A 1SJ1A 4DTJA 3RU0A 3FJ2A 3FSYA 2UXCJ 2MHEA 1RTDA 3OFHA 2WBMA 5JVHQ 3DRYA 2EFVA 2OTLN 1RAAB 5DDPC 1HA1A 3NY0A 3MR6A 3S6EA 3LZJA 1ZM4A 3CERA 2M9KA 3I56S 1AZSB 1IVZA 1SKUB 1JK9B 2JFDA 3HM9A 2UV8G 2VG7A 2E88A 1APSA 1Q86O 4FK0A 4ZIVA 4ES1A 1RYRA 1LWXA 4LF4F 3CJ2A 3HFKA 3DI6A 3H5SA 4CJFA 1ZC6A 5AFUH 1SKSA 2Z56B 2GV9A 1X4CA 4K4YA 3CJ0A 3DXBA 4PYAA 3BF1A 2KXHA 3H7HB 4CLTA 2PD1A 1XMOF 2DEJA 2NZCA 1RT2B 5IT9U 2ITGA 3A2FA 3ENOA 2KTQA 1JLBA 2VJVA 2VWKA 3AY9A 2LA6A 3AT1B 5AQJA 5AQYA 2C2MB 5B0AA 1WC1A 1HNIB 3CMAS 2W2QP 1R7IA 3QPIA 1S1XA 3LP0A 3THXB 2FB0A 3I32A 1S77D 1VISA 4OLAA 2VICA 4C8KA 4CLFA 3GFHA 1RCOB 2HHHJ 3UD5A 2BKNA 1VQKS 3NWRA 4CM0A 1VSLA 2VKZG 1G7CB 5HVGA 2V2KA 4BC3A 3HP6A 2GZOA 5ETNA 4ZVHA 5RUBA 2H4WB 3NCIA 4USVA 4DCOB 4CH7A 3VGVA 4O4GA 2ZH2A 1WI6A 2CPDA 2HFSA 1DQAA 2UUBJ 4LH4A 1RBAA 4R5PB 2WSCC 5F8IA 4KHNA 4YOTA 1Y3JA 3KKFA 2DNHA 3FFIA 3H4BA 1QAJA 4JYAJ 2HWIA 4P9SA 3BF4A 3F44A 1BDGA 2J7UA 4F50A 2O4IA 2DD8S 3O9RA 4N5SA 5F2RA 4QU7A 3M6GA 2GJ2A 3HHLD 1AW0A 1EIYB 1MWYA 2AF6A 1RBOB 1N5QA 1S1VB 2QSFA 4E89A 5KFHA 2IYGA 1PBUA 4JI7F 1YVFA 4KHMA 3UPFA 4OZ3A 4WP3A 2QC3A 2R7RA 3V4IB 1RT1A 2U1AA 3MDFA 2AT1B 2WSFC 2XHWA 4GKJJ 2V9WA 5JVGQ 1I3AA 5IC6B 2ASDA 4MH8A 1RT5B 2CJBA 5IWAK 1KCFA 3ZNUA 5B0DA 3M8ZA 2YKMA 4LFBK 1HNWF 1RA6A 4U6PA 2DYAA 1RTJA 2AYEA 1UOCA 1C4AA 4M95A 5I3UB 2AHOB 3RSEB 2QIFA 4M5DB 2RQCA 3N6LA 1YJRA 2F96A 1NGGA 3D4JA 4BQZA 2KLAA 4GMKA 3G4SS 1Z26A 2Y1LB 4RW4B 1FFGB 3J7YI 4Z7YA 4C8YA 4OJ1A 4TN2A 4JI0J 5LSOA 4QBUA 1TUWA 3N4PA 2FUG9 3H4DA 3A5OC 4FLUA 5BPNA 3B78A 4DR1J 4CO2A 4Y6IA 2XLKA 3DAWA 4CERA 3W1YC 1Q8IA 1KTQA 2U2FA 2AEJA 2CWXA 1XHXA 3D2WA 4NLCA 3ULEA 3DLGA 2OEKA 2LA4A 2V4JB 4H4OB 4DS5A 2P5OA 1N34F 3O8MA 2FY8A 2AYMA 3WQUA 3UW1A 3Q86A 4E7IA 5GMEA 3SQGA 4JI8K 4QS7A 4CH0S 2VQEF 1ZBFA 4ZN1A 2RVJA 3SMSA 4B9TA 1PO6A 1IKWA 3MMBA 2HBMA 2HBQB 1GMWD 2V4QA 4NLSA 3CJ9A 2CPXA 3SIPB 1R0BG 4DV3K 2MKJA 1DARA 2WVCA 5KFIA 2OIHA 3HKWA 2EBEA 2Q1NA 3GG0A 4IO9L 4EZ6A 5C2CA 3IFRA 5D4NA 4ED2A 5I42B 3TAEA 1YWXA 4ZOSA 3PYGA 5K8PA 1Y7PA 4M45A 3TRGA 4IFVA 2KJWA 4U95A 3A3NB 3CI5A 2IBOA 1M5OC 1KVBA 3CCEN 2UXDK 2D69A 4F04B 2MQQA 3A0IX 1U0HA 3V6HA 4JKEA 4HHUA 2PI5A 2OPSA 1W2BM 4KGKA 5D4OA 2IGIA 4JI5K 2E1MC 4C0HA 2XY6A 1OH6A 4GO7X 4AHTA 4FM2A 4ZCMA 2NXEA 1M5VC 3TJ9A 2KG1A 2XSFA 5HAOA 1DTTA 2OFGX 4ECUA 4BC2A 2D9PA 3CJKB 2RF2B 4P2SA 2NYHA 1VS3A 2OJ3A 1YBTA 4K4WA 4CT8A 2HSEB 1EX8A 4DFPA 3IAM9 4MQ3A 4B9LA 1ITGA 5MLCQ 3I9V9 1S1TB 3LQVA 2GMLA 1IXKA 1NBEB 1UVMA 2UXCF 3KJFB 1YJTA 5DMRA 4TSXA 3HL8A 5KG3A 2E2QA 2NRHA 1BQNB 2HURA 5EX3A 4ZHRB 1EP4B 3X3UA 2WUSA 5HRRA 3H2UB 5CYQB 4JS4A 1YLXA 3FSXA 4JKGB 3FZBA 2XO7A 3I56N 1ZAXA 4N47A 1WBBA 3ZZTA 3PG9A 4LR9A 3THTA 3HSGA 3AVCA 2O8BB 5DM7L 2FGCA 1NOZA 1G6BA 1T94A 2DH7A 5KFWA 1RHQB 4WFZA 3VPZA 4DPUA 5E3PA 5HVHA 4U7CA 2BJ3A 4AYBD 4CZFA 1R89A 1V3RA 2AWZA 4UUWA 4Q5VA 5ETMA 3RBEA 2M7SA 2IRYA 4QQBA 2GWKA 4IYQA 3GE1A 3IS9A 3BR9A 2A6AA 2XI2A 1GLJO 2G1HA 1U02A 3CMEN 2R4FA 5HOOA 4ED8A 2Q3PA 5K8OA 1PKUA 4CO4A 2FBTA 3N6NA 2B8PA 2HHHF 3DLKB 2C2NA 1YSJA 2GCFA 1HQ2A 2MTLA 1B7FA 1HNXJ 1N6QB 3WNFA 1VQKN 2G2YA 4M3UA 2R42A 2OSRA 3OYJA 1TL7A 3Q2SC 1R6YA 3Q22A 1CJKA 3DRPB 1CC7A 1TYQA 1NJXA 1B99A 4FNIA 4PYDA 3MPDA 1Z2LA 4A46A 2YKPA 4LSNA 4PKGA 2UUBF 4YORA 3PVXA 1TKTB 1U48A 3J80O 4ZCIA 5BPLA 4K43A 4K42A 2VF3A 3EE3A 1W7WA 4K2JA 4LF4K 4JYAF 3U7JA 4KV8B 1CXQA 1WF1A 2ATCB 2YKAA 3AQPA 1ZPVA 2VB6A 1EWRA 5DG8A 1Q0NA 2Q6BA 3C15B 1RT6B 1GLLO 1YTYA 4PZVA 3QEWA 1XMOK 4AL5A 4I56A 1D8YA 3EE8A 2LDIA 4JK8A 3BGRB 3ULHA 1GXUA 2YX4A 5L9XA 2NLWA 2D0PA 5DETA 3GV5B 3GL1A 1NGDA 3AAPA 3MEEA 4GKJF 4CEDA 1T05A 2RDDA 1VCTA 1M5PC 2Y8YA 4CF2A 3MPUB 2DH8A 3AVNA 4CIGA 1HPZB 4GRSA 2C2ZB 4WXOA 4OI2A 1ZZNA 2ZGYA 2OANA 1RDRA 4A4JA 1FCAA 5SZTA 5FD1A 3KLIA 2LQBA 5IT4A 4UTGA 4J9SA 4ZVEA 2NXNA 3NS6A 3QIDA 3WIVA 1KP6A 1FDNA 1JLCA 1FEHA 2PMWA 5K20B 2P9LB 2OPRB 2FBXA 5FLXU 2QA2A 4FO0A 3DNCA 5KI6A 1LEOA 4JI0F 3D3CJ 4AH9A 1CQNA 1YDLA 4FYWB 2EFGA 3L2WA 2DNQA 2ATQA 4DR1F 4C98A 2CGLA 4PPDA 3TP2A 3MURP 4NRTA 4RJVA 4FK2A 4RBTA 4JHDB 1WC6A 3EEQA 4EYHB 3A12A 1YJNS 3VAIA 2V69A 4ZP7A 3RJMB 3HKZD 4H5TA 2E9TA 4PKHA 1A5WA 4JI7K 2MB0B 4NEYA 5LJ5Y 4E3SA 2B9EA 5GAHI 4WU2A 2YQ1A 3FKBA 4TU9A 1TK5A 4Z4IA 1BD6A 4YHHJ 4LH5A 2QE5A 4ZITA 3NWGA 4OI0A 3LDLA 3O5BA 3WDOA 5J2QB 2DHSA 2ZBPA 4YNQA 3MMAB 4NWBA 3NGDA 3QT8A 3ZZPA 4CEFA 3G6EN 3SUPA 5B8HA 3SK3A 4F0MA 2IIRA 1KD1O 1HNWK 3OT9A 1X0PA 3C14A 1GOAA 1S6QA 4UF4A 5L9NA 2MEWA 5KFTA 4I64A 3G8QA 1UWBB 1YRTA 3ZT1A 2YNFB 3Q7CA 2H54B 2UVVA 1NGCA 1F0XA 2NYIA 4ZA1A 3CPWM 1T3OA 4CJRA 2DXFA 3JTOA 2I38A 2E5GA 2CADA 4HTUA 2GX8A 4CJEA 3DXMA 4O0NA