1S6QA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r147681
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords POL polyprotein [Contains: Reverse transcriptase]
total genus 136
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s6qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6qA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6qA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s6qA05
2XY5A 1D0EA 3P1GA 3SJJA 2HB5A 2W9CA 2OPSA 4WXWA 3V4IB 5DGBA 4LD0A 5I42B 4F50A 2B4JA 4NCBA 3HJFA 4MIAA 4DL7A 3VQQA 3OYEA 4PQUB 4B8CA 4I9QA 5KFOA 1EETB 2IDOA 1SUQB 5DG8A 3OYAA 2FBYA 3SUPA 4KB7A 1EP4B 3DM2A 4KSEB 1I6JA 2XC9A 3CFPA 3G10A 4CJWA 4RZRA 3SZ2A 4OPJA 1IH7A 2G8WA 4IH7A 3Q8RB 3D28A 1NK8A 1HARA 3UIQA 5J2NB 4KI6A 4EBCA 2BANA 4M3ZA 5J2NA 3M9MB 4DWIA 2HHVA 2IJNA 2QKKA 4DL6A 3KK2A 4NCGB 3IGNA 1HNVB 4N5SA 3H5XA 3TWHA 2R8JA 1VSFA 5KG6A 3NCIA 2FJVA 5C25A 3QETA 3BQ0A 1NK7A 4KREA 5HROA 4M94A 1A5WA 4ED8A 3NGDA 2DFEA 1L3VA 3KIOA 3T19A 3PO4A 3PJWA 3V6DA 4KHQA 2KTQA 3BGRA 3HPGA 5KI6A 4HUGA 4F3TA 1TKZA 1S48A 4FJ5A 4NLSA 3DOLA 3CJ4A 4RW9A 4OKKA 4O55A 4MFBB 3CJ2A 2KZMA 4NYFA 2IA6A 4DFPA 2C28A 2XWYA 2Y1IA 2W9BB 4CFCA 4Z4GA 4N56A 3GV5B 4YR3A 3MF5A 2VA2A 4M42A 1S9GA 4KFBB 4ZP9A 1TL3B 4ZVHA 4HCBA 3ZCMA 3ZSVA 3AO1A 1Q8IA 4NLUA 4IG0B 1JLCA 4QOZB 4ZVFA 4QWDA 3NH1A 1HMVA 1SH3A 3L8BA 4DSEA 4CHPA 4OLBA 3GV7B 4YMEA 2BQRA 4E1NA 5DGAA 3OL9A 3QGIA 3QNNA 4X2BA 3V6DB 1JLFB 1RT7B 1TKTB 4I2PB 2AU0A 1TL1A 4EO6A 4CK2A 3KLIA 3RR7A 3GYNA 2X78A 1NJXA 4W5NA 4F4XA 4OLAA 4RNOA 4GC7A 2HNYA 4CEDA 4QW8A 3LP0A 2OPRA 4AHVA 3DOLB 3NBPA 4O3QA 2R8HA 3JYTA 4K4WA 4AHRA 3SFUA 3A2FA 4B9VA 1F21A 1BQNA 3DLBA 3KK1A 3AO3A 4W5RA 4AHUA 4CJEA 3U3GA 3RBEA 3AA3A 1L3SA 3MTKA 4Q45A 3OLBA 2UVUA 1S1TB 3G0ZA 1REVA 4CJFA 2B6AB 4DTSA 2KZZA 3NE6A 1QS4A 3DRSA 3LWMA 4B9TA 3PHEA 4CHYA 1NK6A 4CJRA 1ZBUA 3I8DA 3DRRA 5C24A 4Y3CA 5KG7A 5JS1A 4TSXA 3VQEA 1T03A 4DTOA 3M8PA 3IRXB 1T8EA 3L2WA 1RT2A 2ETJA 5KFBA 4PWDA 2AGOA 1QSLA 5HBMB 3EPIA 2IM3A 1S1VA 4ID1A 3QINA 4FJNA 3PX0A 3FDSA 4IOBA 4DF8A 5DK5A 4RW8A 4EYIB 4J2BA 3KMQA 2VWKA 2QE5A 5CYMB 1VK0A 1RA7A 5C42A 4ECZA 3IAYA 3C94A 1QQCA 2OA8A 1WSGA 4ED7A 3TABA 4IR9A 4ECTA 5KFCA 1CXQA 1FKPA 4OJRA 5KG2A 3SI8A 3VQ6A 2WK4A 4CGGA 3QGGA 4G1QB 3GIJA 2Y1JA 4Z4FA 1NK0A 2C22A 3SPYA 1JLGB 3QIDA 4YR2A 5F8IA 5KFNA 2O4GA 4E1MA 4QAGA 2JGUA 3KKSA 4W5TA 3L2QA 3H40A 3TR8A 1C0UA 4DTXA 1TQLA 3HVWA 1C0UB 3KNAA 1RTDA 4KRFA 3QEIA 2R2TA 2BQUA 3Q8SB 3S3MA 1EP4A 3ZSRA 4KPYA 3LAKA 1T05B 4E7IA 4DLGA 5FRMA 1VSLA 4CEEA 1VSJA 3OL6A 4CF1A 3V6JA 1KFDA 4E19A 3CFRA 4URSA 2ILYA 4CEQA 2E6LA 5DQGA 3KLEB 1JXLA 1BL3A 5KFTA 3L2UA 4FCYA 3PW4A 4RUCA 1TKDA 1NJWA 3NGIA 2ASJA 4PUOA 2FVSA 1UAXA 3CQ8A 1JLAB 1N6QB 4RU9A 4QWCA 3LZJA 2JEFA 3ISNC 3I0SA 5CZ1A 4TXSA 1U4BA 1TK5A 3H4BA 3EPGA 2VG6A 3OJUA 3VQ5A 3RR8A 2B5JA 3KLGB 1LWEA 3DRPA 1VSDA 2W42A 4KHYA 1O1WA 2X6NA 2W8LA 4B3OB 5FDLA 4F4YA 3KLVA 1NKCA 5FDLB 3ULDA 3QERA 2VWJA 3IGVA 1NKBA 4JLHA 3AVFA 1RBVA 3AA5X 3O3GA 3HT3A 5EWGA 3SYZA 3AVMA 2KQ2A 4IRDA 4CEZA 1REVB 1BIZA 3TAQA 2YHBA 3MXJA 1S0OA 1BI4B 4GMJB 3RRHA 3V81A 1S9GB 3O4NA 1S1XA 1BGXT 1VSHA 4K8ZA 4CJUA 4O3RA 5KT3A 1S0MA 4DG1B 4ECSA 3C95A 5SZTA 1KLMB 1N56A 4XIUA 1JLCB 5DQIA 4OVLA 5DG9A 2QKBA 1IKYA 1BHLA 2JLEA 5KFLA 3AO4A 4Z4CA 3V9SA 1NHUA 3CJ5A 3DDKA 3PW7A 4BE1A 4ZHRA 4C8KA 1GX6A 4K4YA 4ZHRB 4DQSA 1R0AB 1RT6A 4F3OA 1TL1B 3AVGA 2XGQA 3KJVA 1C1BA 1RBRA 2YKNA 1BISA 1FKOA 2HHUA 1MMLA 4IFYB 4PWDB 4EZ6A 2W9AA 4CJVA 4FZZA 2YKMB 2W7PA 3K57A 3VA0A 3OYJA 2ZE2B 2B6AA 5SWMA 4RW8B 4TY8A 2Q3SA 4DQPA 3E01A 1D9FA 2E9TA 4BDZA 3RAQA 4JV1A 1S6PA 4CF2A 4FLWA 4FZYA 4M3TA 5K14A 3NL0A 2I5JB 1W25A 1IO2A 4FVMA 4GVMA 2FVCA 1KLMA 2I5JA 3ALYA 4CK1A 4J9KA 5E41A 4DTJA 1TK8A 1ZBHA 5EDWA 1JLBB 5KG3A 3GIMA 4ECWA 2J6UA 4FLTA 1IKXA 2F8SA 4WFYA 1IKWB 2YV0X 2FLLA 4BWMA 2Z1JA 2D41A 4KTZA 3ZSQA 4IH6A 2BANB 4M95A 4XPEA 2YNGA 1SKRA 5F8HA 3S3NA 1TV6B 1C1CA 3ICLA 2BGGA 4J9LA 5L9XA 1VRUA 1LWCA 5F9LA 3TAGA 4NCGA 4KE5A 3RBDA 3T5HA 3HO1A 2O5DA 1LAWA 3NF9A 1JX4A 5KFWA 3KOAA 3M8SA 1VSIA 4DQRA 4OGCA 1IG9A 3I0SB 3HHKA 4Z4EA 1QTMA 2ATLA 3V4IA 3E01B 3WNGA 4K4SA 3GQCA 1YVUA 1Z26A 2IC3B 2YNHB 3NAHA 1KVBA 2IC3A 2YNHA 3RTVA 1K1SA 2IM1A 4CK3A 3TAPA 3LANA 5KFVA 3OYHA 3PW5A 4KTWA 2FVQA 2BRKA 4YNQA 4BACA 1DTTA 2BRLA 4FJJA 4WXOA 4DSLA 1TVRB 1N5YB 4DU3A 2DPJA 5DLFA 3VQ7A 3OYGA 4ELUA 3OS1A 2HWIA 3V1RA 4FJ9A 3OYMA 1ASWA 3MFHA 1Q9YA 2W7OA 1HPZA 1J5OB 1MU2B 4ZP7A 3OYBA 5KFSA 2F96A 1CLQA 4CEAA 3QEPA 3L2RA 5T7BA 5F9NA 1D9DA 4F4KA 3BR9A 4IH5A 2AGQA 3V9XA 4E7HA 1YVFA 1NNDA 1BQMB 2ALZA 3BDPA 3BSCA 1SH2A 3HSTB 4KHMA 2FBTA 1BCMA 1WNEA 4I2PA 5J2QA 1X9SA 2OYQA 4KI4A 1JLFA 1RT7A 4CFDA 4PY5A 3BREA 1LAVA 3OS2A 2RF2A 3LDSA 4EYHB 4HVJA 3QNOA 3QIPA 1X9MA 4LH4A 3KLHA 1N5YA 3T5LA 3T1AA 4DTNA 4MKAA 3BSAA 2PZSA 4CJ4A 4IR1A 4NLWA 4K4UA 3RB6A 3FRZA 5KFQA 3TARA 2YHAA 2IM2A 2VG7B 4JUZA 2KFZA 5K14B 3QLHB 1RTIB 4FLVA 4ED1A 1DTQA 1IKYB 2HNZA 4ZP8A 3L3VA 2HNZB 4Q5VA 5HLFB 1JXBA 5J1EB 3C6TA 5F8LA 3LP2A 4KO0A 1X9WA 2IS3A 2YNGB 4TYBA 4TQRA 5KFPA 1S10A 1HYZA 1SKWA 2WOMB 5C24B 1JXEA 2FBVA 1SL2A 2WB4A 1L5UA 2HAIA 1LWCB 3DM2B 3UQSA 4FM0A 5KT5A 1RT2B 2JC1A 2OPQA 4YQWA 3D0PA 2FVPA 3AVCA 1A5XA 4MQ3A 1RNHA 4EZ9A 1Y97A 4O5BA 4DLEA 3QO9A 3SV3A 3DLGA 3SI6A 1JLEB 2GIRA 4RW6A 4MIBA 3T5JA 1RT3A 4DQIA 3CYMA 3SUQA 1I39A 2YKNB 1S4FA 1TAUA 4ED6A 1NK9A 3KHHA 2X74A 3ASMA 1RYSA 5KG1A 4FBTA 3CFOA 3H5SA 4H4MA 1GX5A 3MR6A 2VG5A 4CIEA 3S3OA 1JLAA 1N6QA 3V1QA 3VQBA 5KG4A 1KTQA 3RWUA 4J9RA 3HPHA 3AVBA 1WSHA 2AGPA 3TANA 4U7CA 3D5MA 1VSEA 3LP2B 3VQCA 3LP1A 3MEGB 2ITGA 2XY6A 1Z25A 4J2EA 1RT4B 1QSYA 4I2QB 3TAMA 1RT4A 1IM4A 3I5AA 3NF8A 4B9UA 1JLBA 4WZMA 3V6HA 4K4TA 4NLXA 3G6YA 1U47A 1TK0A 1D1UA 3OYNA 2E4LA 5J2PA 1B92A 3I5BA 4DTPA 2G8KA 4O4GB 4JS5A 1S1XB 1RT3B 4DQQA 3M8QA 3V9WA 3AO2A 2KFNA 4ZPDA 4CIFA 2UVRA 3NF7A 4FJXA 1VRUB 1CXUA 3MR5A 4OL8A 1DTTB 2G8IA 3LWLA 1S5JA 1QAJA 2YNFB 3Q8QB 4DTRA 3MFIA 3MXMA 5CYQB 2XCPA 3NGZA 5J2QB 4G3IA 4B08A 2B5JB 3KLGA 4CFBA 4OPKA 3OY9A 3AVKA 3ZSWA 4W5QA 2P1JA 2XY7A 1FKOB 5KFZA 3KKRA 4ECRA 1VSMA 2HHTA 5F8MA 5T14A 1RCHA 4B9SA 4CHOA 1XC9A 2EHGA 3KD5E 5D3GB 4JRQA 4RW9B 5HRSA 1RDAA 2DFHA 1ASUA 3QEXA 4I7FA 2J6SA 3F9KA 4XO0A 4EBDA 1JLQA 2WTFA 4F2SA 1JLQB 3DLKB 3K5LA 4NLGA 3OSPA 2JEJA 2HVHA 3NH0A 4NLTA 3KD1E 4O3OA 4DL3A 4BDYA 1RBSA 4ZVGA 3OL8A 3RMDA 2BE2A 3FFIA 4J9SA 3TAFA 2AQ4A 4ECYA 3ITHA 3ZT3A 4KHSA 4RG8A 3ITHB 4CJQA 3K5NA 3QYYA 4Z4IA 4R5PA 3PX4A 2XHBA 1BQNB 4M45A 3LP3A 3MR2A 3LPUA 4DMNA 2V4QA 2D3UA 4CJKA 4IFYA 3OJSA 5EU7A 4ZPAA 1YTUA 2RPIA 1EKEA 4ECQA 1C1AA 3CDWA 4KHUA 1HQEB 4FJGA 1WSIA 2OZSA 4KAZA 2ZKUA 4RNNA 1RAJA 1LW2A 4CF8A 1TKXA 4CESA 5CYMA 4KAIA 2GIQA 4Q44A 3HPOA 1B9DA 2D0AA 2BDPA 4ZVEA 4FM1A 4FJHA 4C8LA 1U09A 1C6VA 3NF6A 4H4OA 2UUTA 3ZT0A 3SV4A 5KFIA 5EWEA 4NLYA 1T3NA 4EO8A 2GV9A 4HCCA 4J9QA 1RBTA 4OGEA 4J2DA 1S9EA 4DEZA 5L1IA 3FFIB 2YNIB 4O44A 3PV8A 4OKJA 2OH2A 4KV8A 4KB1A 1SV5B 4ZP6A 3MEDA 2FC0A 3WNEA 4TN2A 1C2PA 3KJVB 3WNFA 4O0IA 1QSSA 4DSKA 2V9WA 2DFFA 3V1OA 1RT1B 3TQ1A 3WNHA 1YTAA 2R7YA 3HKWA 3CJ0A 4B9MA 2VG5B 3TAEA 3DLGB 4NRUA 3VA3A 4IKAA 3VQSA 5HROB 4FS2A 4NRTA 4HYKA 4RW7A 1JLGA 3IG1B 3KLFA 3FSIA 4FLXA 4RNHA 2R8GA 1TKXB 3DLHA 3MAQA 3BQ1A 1S6QA 4EBEA 4QWEA 1UA1A 4KHWA 4CIGA 2AWZA 1J9AA 1UA0A 3CDUA 3N6NA 4E7KA 4E3SA 3AA2A 2GBZA 2RKIB 4R8UA 4H4MB 3MEEB 3IS9A 5KFMA 3ISND 3LP0B 3AVAA 3OYIA 1KFSA 4MH8A 3LZIA 4FK0A 3DMJB 1ZTTA 4G1QA 1RT5B 2HMIA 1A5VA 3DYAB 3HP6A 3QIOA 4O3PA 3OYDA 3KK3B 4KV8B 3QZ7A 4NCAA 3C6UB 3AVLA 1W0HA 3AVNA 4LH5A 1WSJA 4K50A 4AHTA 4DTUA 1RDCA 1NHVA 2HHWA 4WYLA 2RN2A 5KFHA 3NFAA 4HKQA 4CJTA 3DI6B 3H2LA 2HHSA 3ZT1A 4CEFA 4FZXC 1NOZA 1BQMA 4NLDA 4EP5A 1D8YA 4LQ3A 2VG6B 1R0AA 4H54A 2HVIA 1UWBA 3BGRB 3ZSXA 4F2RA 2BQ3A 3EZUA 4B3OA 3AO5A 1CZBA 3F73A 3HVAA 2UVWA 5KRSA 4AHCA 4XPCA 1S1VB 1NJZA 3PJXA 5KFUA 2E6MA 1T7PA 1W9HA 4ZTJA 1K6YA 1S1UA 3OHAA 4DL5A 3N6MA 1DLOA 1KHWA 2W9CB 3V81B 2XO7A 4DL2A 1HYVA 2OZMA 1NKEA 2AX1A 3QZ8A 4CERA 4C8NA 1KVCA 2CJQA 1JKHA 5DMRA 3HP9A 1UOCA 3QGHA 3OHBA 4GC6A 4IFVB 2D5RA 4DU4A 4IFVA 1U48A 4Q0BA 1IKWA 4NLVA 4FS1A 2HHXA 3H08A 5KFGA 3DRSB 5FRNA 2YNIA 2XGPA 1RTHA 4DU1A 4ECVA 1ZTWA 1LWFB 4M3YA 1C1CB 3GIIA 2FBXA 1EETA 4LSLB 3MEDB 4J9MA 4K4ZA 2R8KA 1GOAA 4F8RA 2Z1GA 4BWJA 3BSNA 4MKBA 4YP3A 3ZSOA 2O4IA 2WOMA 3D45A 4L8RB 1OS5A 1Q9XA 3L3UA 3SPZA 1VRTB 2OPPB 4TQSA 2A1RA 4PA1A 3VQDA 4BE0A 5KFYA 2IJFA 1BIUA 3EYZA 4TY9A 4ZTFA 3QO9B 4IDKA 2ILZA 3VQ4A 1SKSA 2WONB 4IKFA 3T3FA 3UR0A 3PO5A 3AVIA 3JSMA 4CHNA 1HQUB 1J54A 1HQUA 3CJ3A 4NLOA 2WHOA 5JUMA 2GUIA 3EZ5A 1SUQA 2D0BA 4O3SA 3QLHA 1Z4UA 5KFRA 4WE1B 1C0MA 4K8XA 4ZPBA 1WAFA 1D5AA 2C2RA 1RDRA 1L3UA 1KLNA 4O44B 4RW4A 3KMSA 4FJ7A 3B6PA 1HJRA 3LP1B 1LWFA 4KO0B 3M9OB 3PVXA 1C0TA 3CM6A 1KCFA 4N41A 1HNVA 2RKIA 4R8UB 3P83D 4R0EA 3K58A 1WN7A 1YT3A 5KT2A 4K4XA 4ID5A 1SL0A 4I7FB 4AILC 4E7LA 1XI1A 3OVNA 1U04A 5KFEA 3IG1A 1TV6A 2FJWA 4ELVA 4C8OA 2D7SA 3OLAA 4JRPA 3NGYA 2WRMA 2D3ZA 1MU2A 4ICLB 3ZT4A 5KRTA 2ASLA 2JC0A 4M3XA 5HP1B 3H5YA 1LW0B 1FXXA 3MEEA 5KGXA 3FQKA 3K5OA 1QE1B 2IBKA 3OL7A 3I5CA 3B6OA 3H98A 5KFDA 2BR0A 4B8AB 2FVRA 3KK3A 2CKWA 4OKEA 1EXQA 1C1BB 4ECUA 1ASVA 1QHTA 1TL3A 3M8RA 3V9UA 1FK9B 4HUEA 5F8GA 5D3GA 4WFZA 1QAIA 3VQ8A 4CJ5A 2W8KA 4MFBA 2RDJA 3DI6A 5FROA 4KB0A 3DYAA 4O0JA 1DLOB 4DSIA 2W9BA 5J2PB 3OS0A 4LSNA 4RUAA 2R2SA 4IQXA 5I3UA 3C6UA 1XHZA 4O4RA 4W5OA 2HHQA 3DLKA 1S97A 5J2MB 3KHGA 2Z1IA 4E7JA 1ZYQA 2AX0A 3KLHB 2HNDA 3L2VA 2HNDB 4Y2AA 3MR3A 3OYKA 3T5KA 5J1EA 2FJXA 1RTHB 4DFJA 3PW0A 1TKTA 3MXIA 3TI0A 4O3NA 4CJPA 3JSMB 2F8TA 1CZ9A 4N76A 2P51A 3H5UA 5L1JA 4CE9A 1FK9A 3CDEA 3K59A 4J9PA 4HHTA 3RB0A 2QV6A 1RTJA 3ZSZA 2HW3A 4B9LA 5KTQA 4DF4A 2JEGA 2IMWP 3NAEA 4HUFA 3JYTB 1HYSA 1NJYA 4NLQA 4FJLA 4Q0BB 2ZE2A 2I1RA 2G8HA 1J53A 4Q43A 5KG5A 4LSNB 1HRHA 2B43A 1L3TA 3N6LA 1KRPA 3K5MA 3RMCA 4PQUA 4JS4A 2C2EA 5HRRA 4Y1CA 2IAJB 1NOYA 3RRGA 3I0RB 4FJIA 4M41A 4J9NA 3I0RA 2F8EX 3OYFA 1VSKA 3TAMB 4WFXA 3CM5A 1FKPB 4CHZA 1DTQB 4CJ3A 1XR6A 5HBMA 3VQAA 5HLFA 1GOCA 3RB4A 3C6TB 2WONA 1RDDA 3LPTA 4I9LA 4RW4B 4DFKA 3HVTB 4DSJA 2E9ZA 4CJLA 1KSPA 1SH0A 3DRRB 2C2DA 4CHQA 1RA6A 4CGDA 1WSFA 1IKVA 4TLRA 4FW2A 4EEYA 2HWHA 4J2AA 4E89A 1LW0A 1HQEA 4PUOB 4ED0A 4CF0A 2YNFA 2E9RX 4QWAA 4RW6B 5KFKA 3G6VA 4QCLA 1T94A 3RB3A 3VQ9A 4TY8B 3CIZA 5C42B 1WLJA 1GOBA 3PW2A 1XR7A 2XCAA 4FBUA 4M3RA 2RF2B 1JL1A 2P5GA 3V6KA 3VN5A 3MECB 4DTMA 3GILA 4H4OB 4IG3B 2LSNA 4IG3A 1XHXA 3PZPA 5JXSA 4HTUA 4FM2A 3NBPB 3DMJA 5KGWA 5KFFA 2G8VA 1RT5A 2HMIB 4FK2A 3PR4A 3NMAA 4NLRA 4ED2A 3SUOA 3HK2A 3SQ1A 1RTDB 1RILA 2JEIA 1NK5A 4I2QA 3ZSYA 1RTIA 5F8NA 4LQ9A 4CGIA 1TAQA 4KTQA 5HRNA 3P5JA 4KHNA 1QUVA 3AV9A 3G6XA 5L1LA 3UDLA 2XI2A 1S1TA 1ITGA 2G8FA 2AJQA 5KT7A 2FLPA 4NZ0A 1JL2A 4QPXA 1BCOA 2D0CA 1RT6B 4CJSA 4ED3A 1B9FA 4DG1A 1UWBB 4M3UA 3CG7A 3KLIB 2ZQBA 1T03B 3FQLA 3NKYA 4NLPA 4ECXA 1HNIA 5JS2A 5HP1A 3RMAA 3NHGA 4UQGA 2EC0A 3M9NB 4DFMA 3QIPB 3K2PA 4FW1A 5F8JA 2ZD1B 1RTJB 1JIHA 4DS5A 3OSNA 1S1WA 2OPRB 1K1QA 5KT6A 1X1PA 2BE2B 1HYSB 3PX6A 4FLYA 3HYFA 2DY4A 1U45A 3KK1B 2R2UA 2FLNA 4KBIA 1ZBFA 4YFUA 2QK9A 1CSJA 4KKOB 3QEWA 1S0NA 3GV8B 3U6FA 4RNMA 2IOCA 1S49A 2IAJA 4Z0UA 3SFGA 3HXMA 3DLRA 4IRKA 4DSFA 1HMVB 3SQ4A 3AVHA 1TP7A 3AVJA 4F4WA 2IGIA 4Q8FA 3ZT2A 4WYWA 5I42A 1N48A 3O3FA 1WAJA 2KW4A 3NDKA 4ELTA 3HM9A 4BDPA 4LSLA 2PYJA 3IRXA 3CWJA 4CF9A 3VQPA 2OPPA 3SQ0A 3DLEA 2UVVA 1S1WB 3CVKA 4RNFA 4IRCA 3CO9A 1JLEA 1KHVA 3H59A 5EWFA 1S1UB 3DOKA 1LW2B 4R5PB 5DLGA 5KFXA 3SCXA 1IKVB 3BJYA 3KK2B 4Y1DA 4CCHA 4U6PA 4FYDA 4AHSA 4KHRA 2J6TA 4IBNA 4Y34A 1TKZB 4ZPCA 4K4VA 4E0DA 2DTUA 5C25B 1LV5A 3NAIA 1RYRA 4FJKA 3BQ2A 2RDIA 1WSEA 2P5OA 4FXDA 3HVTA 4JV2A 1S6QB 4FK4A 3MEGA 4KFBA 3QESA 4B9NA 2GC8A 4QW9A 1HPZB 1RT1A 4MK9A 2PYLA 4M3WA 3IS9B 3Q8PB 5L1KA 4ZMMA 3UPFA 4CEOA 4ID5B 4FLUA 2R2RA 4DS4A 1ZBIA 4C8MA 1TGOA 5CY4A 4O4GA 2ATQA 3RAXA 3DOKB 4RW7B 3KLFB 3PR5B 3THVA 1EX4A 3S9HA 4CEBA 2XI3A 3SUNA 4EP4A 3KLEA 4CGHA 3M8QB 2XRIA 5J2MA 4JV0A 4ICLA 2ASDA 3OYLA 5DQHA 3MECA 2V0NA 2Z1HA 1TVRA 4CGJA 1N4LA 4WE1A 2UUWA 3HVRA 1QE1A 4CFAA 3LAMA 2WCXA 4NYNA 1S9FA 4H8KA 4Z4HA 3AA4A 3KTQA 4N47A 5CYQA 2G8UA 4GW6A 2PY5A 1LWEB 3DRPB 2VA3A 1I3AA 2A1SA 5KFJA 1HNIB 4NYZA 1XWLA 1C0TB 1J5OA 2X6SA 3O4QA 1ZBLA 1JKHB 1WNSA 4WZQA 2V4RA 2DPIA 1T05A 4AH9A 4FJMA 5HRPA 1KVAA 3LALA 4YR0A 4DL4A 1NK4A 2OPSB 5DG7A 5C5JA 1BI4A 3BSOA 4F4ZA 3PY8A 1XR5A 2XY8A 3NH2A 4KKOA 1RDBA 5I3UB 3EY1A 4CGFA 4J9OA 1S6PB 4Q8EA 2VG7A 5KG0A 1U49A 4FLZA 4CECA 4MK8A 3TVKA 3IN5A 1SL1A 4MK7A 5EUHA 3M8PB 4IG0A 3H4DA 4TYAA 3U3YA 3QEVA 1VRTA 5KT4A 2EX3A 1IKXB 5CZ2A 2HNYB 2ZD1A 3DLEB 4FJ8A 1S9EB 3OYCA 3KHRA 3RMBA 3SNNA 4QWBA 1RBUA 5KFAA 2QXFA 1SV5A 2IM0A 3O3HA 1ZETA 2NUBA 3G86A 4URGA 4LY7A 3KHLA 3SQ2A 3E51A 3GIKA 1G15A 2R8IA 4BE2A 2OPQB 4Y2CA 3V9ZA 2YKMA 3HL8A 3PUFA 4URQU 4IDKB
chains in the Genus database with same CATH superfamily
4EFAC 1AXQA 1VQ5S 5F0WA 3AB4B 3OVBA 4OIXA 1NGHA 3P1GA 3J7ZO 1BG3A 4WXWA 5DGBA 5K8PA 1HBOA 3HJFA 3D2WA 4HACB 3AHPA 4PQUB 4CNYA 5L9NA 2CJAA 3EICA 3PYGA 2IDOA 5DG8A 2O8FB 2PN6A 3T7ZA 3C15A 1I6JA 5DJBA 2APOA 4ZLLA 2XC9A 3O6QA 4RZRA 3GG0A 2VBWA 1YITS 4PCQA 4DJBA 1X9JA 3Q8RB 2ZGYA 3D28A 5AQYA 3VAIA 1XK8A 4EBCA 2BANA 1RWWB 4B1VA 1BDGA 4ID8A 1CULA 2GVDB 4DV1F 3KK2A 3LF0A 3ET6B 3DN9A 3D0HE 4C98A 3H5XA 3ISZA 1HHTP 1VSFA 2L3MA 3L3CA 2HS0A 2LXFA 2PIIA 1NK7A 4KREA 2LFVA 1HKBA 4M94A 2XMUA 1A5WA 4ED8A 2DFEA 5E3QA 3RAMA 4FF1A 3K9KA 4BR9A 2BW2A 2QSWA 3MM9B 3K0SA 1F3FA 2PI4A 2ZZNA 2P8IA 3HTVA 1F5BA 1HKAA 2E1YA 4NYFA 3G82B 2YKAA 3VEXA 4DFPA 1FRMA 1H38A 1M90T 4X65J 5M1NA 2ZFHA 2VA2A 3NCQA 4NZ6A 5HJYA 4ZP9A 4LREA 5KOXA 3ZCMA 3E66A 4M5HA 4JI3K 3AO1A 5IM0A 1QLNA 4E8UA 3G6EN 4IG0B 2DNNA 4QOZB 4ZVFA 4QWDA 4PWWA 3MTJA 4JKCA 3FJ2A 3OVSA 4MLHA 3CQXA 2F7TA 1V3RA 1GLBG 3QGIA 5B0AA 4OYIA 1KC8O 2RHSB 1IG8A 1TKTB 3UDCA 4I2PB 2LXIA 2HBYB 2AU0A 5A0YA 4CK2A 3KLIA 3RR7A 3H1VX 4C0OC 5ETMA 2X78A 5L38A 4J7CA 3R5CA 1NMEB 4L73A 4OLAA 1UW9A 1WHYA 4RNOA 4BRPA 2HNYA 1YRXA 2X51A 4JKAA 4AHVA 2QIFA 4O3QA 3JYTA 1U1NA 4PRFA 4JI0F 1WDTA 3D3BJ 1F9FA 4YHHF 1BQNA 3DLBA 4XDCA 3K9JA 4GKJF 4AHUA 4CRJA 1H3DA 2A18A 3H1QA 3RBEA 1CLFA 1L3SA 3MTKA 4Q45A 3OLBA 3L9ZA 4CVNE 2ZNYA 1FE0A 1FI4A 2B6AB 2UU9J 4KH5A 3NE6A 4DTSA 3W3DA 1S99A 1Y3KA 4CJRA 3W65A 4A8OA 2Z57B 4Y3CA 4TSXA 3VQEA 4DTOA 4ZITA 1RT2A 1UPPA 5E3PA 5KFBA 1I1GA 4PWDA 1U1RA 1QSLA 3VEVA 2NREA 1S1VA 2OGUA 3K8VA 4AF1A 2RNEA 1G4CA 3CCQS 4IOBA 3MDFA 1FFGB 2RQMA 3C7NA 1RA7A 3Q2TC 3ILJA 2BABA 1WUUA 2L9DA 1FEHA 4DV4K 4CH1A 2KXFA 3EWGA 5LJ3Y 4B3TK 1CXQA 5KG2A 4CO3A 1U2VB 1AFJA 2BJEA 4CGGA 5F8IA 5KFNA 2FXUA 3FVYA 2CGKA 2LCWA 4W5TA 1C0UA 4DTXA 3HVWA 1C0UB 3MD1A 3KNAA 4KRFA 1U1PA 2FQQB 2ASPA 5E26A 1XTZA 1SQEA 2R2TA 2WSCC 3ZSRA 2QN6B 4FWKA 3HI0A 2FZCB 3LAKA 1T05B 1IBKF 2HHHK 1NGCA 4ZPTR 5HMYA 2D69A 3A13A 4CLPA 3ZEUA 1VSJA 3QAEA 4CF1A 3CFRA 3KFWX 3TJAA 4DR1F 3H3OB 1C0GA 1JXLA 1AZSB 3VEOA 1X4HA 1CQNA 4WP8A 4DV0F 1DAXA 3ZYYX 2C3YA 4C11B 1H6KX 2K3IA 4P52A 5E3RA 1TKDA 2I38A 3NGIA 1BUPA 2FVSA 1UAXA 3B6BA 3CQ8A 2CQ4A 2EI5A 4HTIA 1TMMA 3I0SA 4LVOP 1U4BA 2GGPB 4UOGA 4RO0A 5ADZA 1UCNA 1IBKJ 3B8HA 2B5JA 1G99A 1O1WA 1PC5A 5FDLA 4MLEA 5FDLB 3UNGC 3AD9C 4ANEA 3ULDA 2R7RA 4LFBF 3DC2A 4EGLA 5EWGA 3SYZA 3H2UB 2KYXA 4OHWA 4IRDA 3AAQA 2CPHA 1BIZA 1M1GA 3GJSB 2WBRA 3VPZA 1S9GB 1XBWA 3O4NA 4HTJA 3KKFA 3QFWA 2ZJPQ 3W2WB 1HBUA 4E98A 4A8WA 4CM0A 4CJUA 4ZVPB 5KT3A 3C95A 4DG1B 4ECSA 3QWUA 2O8FA 3W5ZA 3HHNB 4XIUA 2V6AA 2E1CA 5DG9A 4Q2LA 2QKBA 2P5VA 2QT7A 3B4DA 2HVEA 2QC3A 2PAVA 4I69A 2XLKA 3VTHA 3IFEA 3MOZA 1GX6A 1QDUB 3FCHA 1HWKA 1TL1B 1X4DA 2XGQA 3DOMB 4AM7A 4Z2XA 3O1WA 1FVSA 2MY8A 4DR1J 4EZ6A 4CJVA 2YKMB 3SMZA 4ERDA 2W7PA 3ZTOA 2NCKL 3VA0A 4HT7A 5SWMA 3T1HJ 3M6VA 1Q18A 4LF5J 2Q3SA 1X4AA 2CVEA 4LRDA 2E9TA 4WP9A 1S6PA 4M3TA 5K14A 4PXBA 3OTOJ 2BUPA 1TK8A 2AHOB 2MHNA 1VYAA 2GQCA 2HFOA 5KG3A 1Q86T 4WPAA 4B1ZA 2VFTA 3JS6A 1IKXA 1IKWB 2YV0X 4NE9C 3NNCA 1VQPN 2R7TA 2DGSA 2G0CA 2D41A 3PIOL 3ZSQA 2E5IA 4DCPB 4XPEA 1SKRA 2V9KA 4DV4F 2NYHA 5L9XA 3EMTA 5AJ3K 1DY3A 1VRUA 4P71A 4OMFG 4DV7F 2EC2A 3HO1A 4PXEA 5I3PA 3LDOA 4L72B 2K1RA 3M8SA 1V5IB 2MLXA 4FNIA 2PA3A 3O1BA 1U6FA 4OGCA 8RUCA 3HHKA 2MLYA 1QTMA 2EG1A 1VMBA 1RABB 2MKHA 2MQ8A 1VQLS 1Q7YT 4U95A 1REGX 4K4SA 3DWLA 2IC3B 3NAHA 2GMLA 2YNHA 1KVBA 3EEQA 3TAPA 5KFVA 5CCMA 3OYHA 2W6KA 3R6GB 3TSUA 4X4QA 2PA8D 3CIMA 3QT7A 3ONQA 3PTWA 3VGUA 3ZNUA 2DPJA 4QR0A 4YB7A 5KAKA 2QA1A 2A40A 4AUKA 2RS8A 2YWEA 1RLCL 2N7YA 3TA0A 3M1VB 2DGUA 3RGIA 1WEXA 1FJEB 2Z2ZA 4X4RA 3MFHA 1BU6O 4PKGA 3VGLA 4K59A 5AT1B 2Q1NA 3QBXA 2BJDA 4ZIWA 1N33J 1N32F 4DX5A 2HQCA 3BGOP 2XMVA 4JI8K 3W2VA 1DJ0A 5F9NA 3BR9A 2CQHA 4EMDA 1FJCA 1JNZB 1OY6A 4HI1A 1NNDA 2O66A 1IUJA 4O23A 3BH7B 1NU0A 2U1AA 3NGRA 2OYQA 2CNNB 1U7LA 3EZWA 4PY5A 1LAVA 1X5SA 3TTDA 1W26A 4LH4A 1HR0F 1RAGB 2DY9A 1N5YA 5A2QY 4V19J 3IRWP 5BREA 4NLWA 2ZC3A 3FRZA 2DXEA 4DOZA 2O1PA 2IM2A 2VG7B 3VHQA 4FWQA 2WSFC 3AAPA 3QLHB 2W1BA 2QWRA 1BE4A 4OZ1A 4JI2J 2N3LA 3SEOA 4OJ1A 3QJPA 3UFCX 3FSXA 4RJVA 3GJQB 4WU2A 2YI1A 3R1XA 3G71N 4QIWD 3ZFVA 5F8LA 1ZA2B 3CT9A 3MCMA 4JYAJ 2W2PP 2COLA 1HYZA 4YDUC 2FBVA 1JXEA 2OKQA 2WB4A 1L5UA 5E84A 3DM2B 5A6WA 2DR9A 1NSKL 4FM0A 5KT5A 1RT2B 4JYAF 2CJ9A 4YQWA 3D0PA 2BM1A 2FVPA 4CT9A 1A5XA 1FF2A 4EZ9A 4MQ3A 2ZOGA 1CJTA 4O5BA 4MMOA 3SI6A 5HQ8A 2R4FA 4DPUA 5CQGA 2Y3YA 4MIBA 1CC7A 1S79A 2UUAJ 3CYMA 4ANDA 1T9YA 1DEJA 1I39A 2YKNB 4LBIA 4LFBK 3KHHA 2X74A 4ISEA 2VBYA 3ASMA 3NCPA 5KG1A 2GX8A 2VZ9A 2ZOFA 3H5SA 3O44A 3QBWA 1DQ8A 3WDOA 1KTQA 3OW2R 3HOTA 4J9RA 2HRYA 2FDNA 2NPIA 1FWLA 4NA2A 4BR4A 3B78A 2DBBA 1UEUA 2ZZMA 4LT6A 1HUXA 1HWIA 2H54B 4B3MF 1GMWD 2CPDA 4CM2A 1X60A 1RT4A 2V8VA 2V2QA 5A8KB 1JLBA 3KWGA 4NLXA 3G6YA 1GMVA 4X4VA 3L4QA 2E4LA 3BM7A 4XK8C 3TZZA 3D1HA 2CXEA 2UXCK 1MWQA 4LR7A 3QJJA 3POTA 4CIFA 4YOYA 1SC6A 2FJAB 5CHCB 3CCTA 1I5OB 1S5JA 5AXKA 3ZLJA 5BYRA 1Q16B 4M1KA 2YNFB 3VVUA 2E44A 4FYYB 2HK2A 2P1JA 2XY7A 4PAAA 1FKOB 3KKRA 3G25A 5F8MA 1RCXB 3A8KA 4CHOA 5FJ4A 3JTNA 4WP3A 2EHGA 3KD5E 3K7RA 1Y4ZB 5I3QA 2QA4S 1HA1A 3F9KA 3FBBA 3VF2A 2CPYA 1RK8A 4X4OA 1IQZA 2RHKA 1JLQA 2DKOB 1VISA 1JLQB 2NRXA 5GAGP 2E5LJ 5IWAK 5D6GA 4BVOA 4NLGA 2UYTA 3RSEA 3FRYA 1I94K 5CZXA 1WB9A 4CYUA 1XMOF 1N33F 1RBSA 2E2PA 3CJ1A 3ZO7A 1OPZA 3RMDA 1GFWB 2OP5A 2P9UB 5THWA 1YI2N 3U27A 4ECYA 4KHSA 1PYOB 3ITHB 2G1HA 4F3QA 1PBAA 1Y5LB 2V4QA 4CJ7A 2D3UA 3BF4A 4GVEA 4CJKA 4DBQA 4BRFA 3CSKA 1IBKK 4IFYA 1G6BA 1LQ9A 1KVIA 5EU7A 3MMBA 5EX5A 3UD3P 2YHYA 4ECQA 5CCLA 2GWKA 1WJ9A 4RWTA 1PJ7A 4FJGA 4NZ7A 1N54B 2FJBB 2XEXA 3GR0A 3HD1A 1TTHB 1YJRA 1K73O 4KAZA 5A8WB 3CHWA 2Y0SD 1UVLA 4OZ3A 3CEDA 4IO8A 4ZLNA 4Q44A 5ETLA 3W2WA 4CIOA 4GNIA 4Q2MA 1U09A 3TU5A 3NF6A 4H4OA 4CZGA 3MWPA 4ZOSA 3BO3A 3RRKA 4EO8A 2Y8YA 1Y10A 5BN8A 4O0NA 4IXCA 3F2KA 1RBTA 2Q79A 3GYGA 1GTHA 3UKUB 1S9EA 2Q6CA 3ZETA 1VQ9N 3PV8A 3KZBA 3T41A 4KV8A 1EQ0A 2FC0A 3H8YA 4USKA 1C2PA 3WNFA 1QSSA 2V9WA 4CTAA 2IRXA 3OUYB 2R7YA 4OI6A 3TAEA 3DLGB 3PG9A 4FYVB 4I68A 2DXFA 4AQYJ 4HYKA 2Z2LA 1JLGA 4DR3J 2XULA 4EBEA 4QWEA 2WBMA 3G87A 5AE1A 3TVYA 4QQBA 3TX8A 2LU1A 2LP4A 2B4PA 4FK0A 1BWVA 1ZTTA 4G1QA 1A5VA 5LSRA 2AP1A 2UUBK 3OYDA 1R43A 3P31A 5CZVA 3QZ7A 2NRHA 2DGXA 5IOLA 1ZBSA 3DGVA 1T02A 2GVZB 3AVLA 1W0HA 3CJQA 3S8SA 4LH5A 4K50A 2LXUA 2QLWA 3ENVA 1NB2A 1RDCA 3HM8A 2HHWA 3MWTA 1H72C 4CEFA 1MLAA 2B7CB 2KJWA 3ENQA 1B7FA 2KL8A 2XBPA 1XN9A 4DUYK 1VQKS 3BGRB 3D67A 1QD1A 3EZUA 2BQ3A 1YRTA 3CJBA 3VEYA 2ROEA 3OBWA 4LRCA 3BZQA 1LOTB 1NJZA 3PJXA 5KFUA 2VBXA 1W9HA 9RUBA 2YKQA 4DL5A 2L9NA 3QRRA 3K5PA 3P5BP 4DL2A 3DGPB 1F6TA 2OZMA 3MOJB 4OYOA 1JKHA 3HHLD 2BX6A 2NZCA 3T6BA 3HP9A 5FPEA 4WU3A 1AB8A 3QGHA 2NRTA 1FRKA 3D4JA 3LGNA 2LKZA 5CABA 3C6HA 1U48A 1IKWA 4F04B 2IIHA 3SDEB 3WZ0A 5LMNJ 1K8KB 1GEHA 1RKJA 3BB5A 4TLQA 4NEYA 1ZTWA 1LWFB 4RPFA 4LSLB 3MEDB 4J9MA 4KH6A 3BSNA 4YP3A 4L8RB 2WSEC 2KXHA 1VRTB 2OPPB 4TQSA 2NRWA 4PA1A 4JV5K 1OH8A 3EYZA 1BIUA 2VGNA 4EI2A 3VAKA 1HW8A 4TY9A 2E1PA 3GFZA 1WORA 2ILZA 1CJTB 2HAFA 3AQOA 3CD5A 4K2XA 4JI4J 3AVIA 4DQ8A 3TUZC 1DQ9A 1HQUA 1KONA 2MQMA 3L4BC 2VFUA 2WHOA 2MXYA 5JUMA 4UY8T 2ZJQQ 4BC7A 1SUQA 1KVKA 4IEIA 1YHQN 4O3SA 4H5TA 2M4MA 3KXDA 2Q3PA 5KFRA 3KJNB 4ZPBA 2HQGA 2B4VA 2C2RA 4LC9B 4XTTA 4O44B 2JOQA 5HAOA 2HEKA 1RWVB 2IJRA 3LP1B 3P5TL 4U67L 1CBKA 3QDKA 3M9OB 1C0TA 5J1PA 1VHFA 1SI9A 4R0EA 2AJ1A 4HH0A 4S0MA 1YT3A 5LM7E 4JI2F 2Y1RI 2FHJA 4AILC 1S77D 5HMXA 3OVNA 4BGAA 5B08A 5IXUA 1U04A 4F7VA 2E8AA 4JI2K 5AQWA 3FZKA 4JRPA 2J0WA 1MG7A 3NGYA 1SBRA 3QJLA 3R3TA 1HNXK 1N8RT 2JC0A 1MA9B 3H5YA 3BS9A 1FXXA 3HDSA 1FO1A 2NPFA 4P7TA 3PIPQ 1BA1A 1MDUB 3NCRA 1QE1B 3OL7A 3B6OA 1HNWF 4L75A 3OBYA 2IHR1 2ROGA 5AQVA 4RBVA 4WQ5A 1YVNA 3M8RA 4PG5A 1NDPA 4X65K 4HUEA 2LQ8A 2VCPA 1S12A 5D3GA 4CLFA 2VQEF 4ED4A 4O0JA 4USTA 3JQMA 2LLZA 2R2SA 4ZCMA 3C6UA 1HBUB 3R2DJ 1RJJA 4O4RA 4W5OA 4DR2J 3DLKA 5AE3A 1S97A 1OY8A 4C11A 3CERA 1GLLO 1SQGA 2AX0A 3KLHB 2BJ1A 4ANCA 3HULA 2QRRA 3KNGA 3BEGB 2V67A 1XMOJ 2W4PA 3CMAN 2CQ0A 3TZXA 1Q81O 3TI0A 4O3NA 4CJPA 5IWAF 1NXIA 1XUPO 2XMKA 1FVQA 4U7UD 3ZNJ1 4JI0J 4CE9A 3PKMA 1W97L 3MM5B 4CLLA 2AYGA 3D6MB 2QV6A 3TP2A 2DIUA 2HW3A 1X4GA 3EUNA 2CQ1A 1HBMB 2I1RA 2G8HA 1U6ZA 3VGKA 2HBLA 3OXFA 2V51B 1J53A 4QBUA 1HRHA 2RE2A 5JLHA 3R2CJ 2C2EA 5HRRA 3RRGA 4B3MJ 3MPWA 4C3LA 1VSKA 3MN5A 1FKPB 5CD4H 4CHZA 2Y8WA 4FWLA 5BPLA 5HLFA 3ZZYA 4MIWA 1RDDA 4X4SA 2HSTA 4DR5K 2E9ZA 4G65A 4AL6A 2C2DA 1RA6A 2MTLA 2GIFA 5GAGI 2A3ZA 3EE3A 4J2AA 1IR2A 4X62J 2LYVA 1LW0A 2GQ2A 2DXDA 2UV8G 2IPOB 2YNFA 1NU4A 2E9RX 2E5LK 2WZ1A 3CCVS 4QYRA 2J9CA 2BJ9A 2IMOA 3PW2A 4M3RA 4HHUA 2F4FA 1I94F 1WACA 4H4OB 4LF9K 2LSNA 4WKRA 1XHXA 5JXSA 4FM2A 4DV3F 4O8KA 5KGWA 4FOIA 5KFFA 1YDLA 2G8VA 1IJEB 4ZK7M 2CWXA 3NMAA 4PKIA 1E3MA 3RVCA 3NP5A 2H48B 4WTOB 4Q7AA 3SQ1A 1T44A 2NXJA 1RILA 3LPYA 5ETRA 5BPMA 4LRBA 3UB5A 5C2DA 1RTIA 4CGIA 2D0PA 4CZHA 4KHNA 3O6WA 3AODA 4LRFA 2XI2A 1UJ6A 3H0PA 5CR4A 5GADI 2FLPA 4CD3A 3HHEA 1NZAA 4ZS6A 2DH9A 1T0TV 4DG1A 4M3UA 1PYSB 3CG7A 1CJKB 5JS2A 1JB0C 2IBOA 1RHQB 4DFMA 3PJ9A 3K2PA 4ITSA 3N79A 2LQ5A 1S1WA 4YHHJ 5KT6A 1X1PA 4FLYA 5HK4A 2DY4A 4ZJOA 3KK1B 1RE1B 1IBMF 2D9PA 1S0NA 5AZIA 3ULHA 1SB6A 4RNMA 5D77A 2UUBJ 3E8OA 1UVKA 4NB4A 3AQPA 2Z8QA 1WI8A 1HKCA 4TVAB 5T41A 4DSFA 4DXLA 2AW0A 1JCGA 3AVHA 2MQLA 4B3RJ 4Q8FA 3Q8YA 1K8KA 4F9OA 2XQCA 4FF2A 1RQ0A 4DV1K 1WAJA 4FF4A 1ZAWA 4ELTA 3VEWA 2A42A 2ZH7A 1X4BA 4BDPA 1FFSB 4PG7A 3PCOB 2RUGA 3UN2A 1S57A 2ZHOA 1IXKA 4IQMA 1KDNA 1VCTA 4H0PA 3DLEA 3ZZ0A 2O8EA 1VK3A 4OHZA 4U7UK 2F9TA 2V94A 4M5MA 1KHVA 2I7PA 2DNZA 2DEIA 4LSZB 1IBMK 3CCUN 1Q82O 4C0HA 5BR8F 2MYFA 4Y1DA 4U6PA 3RW7A 2KRBA 3R5BA 4KHRA 4IBNA 1NAQA 1YJ7A 4E0DA 5E33A 1GLAG 4ZLJA 2MKSA 4FJKA 2ZDPA 2YH0A 3CD6S 1WSEA 2P5OA 4BRHA 2G2ZA 1HIYA 4CP5A 1WOSA 2BACA 1S6QB 4AT1B 3HT0A 3MEGA 4CD1A 4KFBA 4JKGA 4E2FB 2XZTB 3QESA 1SZ2A 2DH7A 2GC8A 2NS1B 1HPZB 1RT1A 2BOAA 2CQIA 1OPIA 2ZBCA 4M3WA 1NGEA 3Q8PB 5L1KA 1N34J 2BUNA 3UPFA 3ATUA 2R2RA 4K2JA 4DS4A 1MSWD 4NOHA 2PT0A 4RLEA 3THVA 1EX4A 2CH6A 2XI3A 1UVNA 4EP4A 4CGHA 1P9YA 2XRIA 2F1FA 4GKJK 5J2MA 1IN0A 5DQHA 1HNXF 3GR1A 2YPZA 3O3LA 5M2RA 2C42A 3U1MA 4WE1A 2UUWA 2E5HA 4ES3A 5GIOA 4F67A 2WCXA 3X3UA 3D0GE 2UXDF 3ETMA 3LM2A 3S7RA 6AT1B 3LDNA 5KFJA 4NYZA 3ZXWA 1J5OA 3MM5A 1ZBLA 2DNMA 4JKBA 4WZQA 2V4RA 2AEJA 3HFKA 4DPOA 1RHRB 4WBFA 1NMDA 2HBZB 2CNLB 3GOIA 1PCAA 5HVHA 3BSOA 3PY8A 4KKOA 1Q8LA 1RDBA 4J9OA 3M2UB 4YOTA 3EJMA 3G96A 1U49A 4CECA 2IVOA 4IG0A 4FKYA 1VRTA 3MD3A 4FJ8A 2XSJA 5T7LB 3C0BA 3OYCA 2DTJA 3Q2SC 2HRUA 5KFAA 1BO5O 1SV5A 1NM1A 3MAAB 3L6QA 4ZVTB 1G1XA 3G86A 3KHLA 5AR0A 2R8IA 4DV3K 3V9ZA 2AYBA 2DGTA 1WEZA 3CETA 3TUJC 2XY5A 1D0EA 4USMA 3MUMP 4DB3A 3SJJA 2OPSA 3V4IB 5I42B 4NCBA 2PEBA 3OYEA 4LMZA 2R7QA 4KY3A 4ETZA 5KFOA 3O08A 1EETB 2DYAA 3MMAB 2HZAA 3SUPA 4KB7A 3MM7B 1EP4B 1ZM2A 3I87A 1U2VA 2FIUA 3PHTA 3PSIA 4K8RA 4ZVSB 1ZM3A 3HSGA 2QA4G 2W24A 2JNJA 4HDHA 1YJTA 1NK8A 1KXPA 5BRFA 4DV3J 4M3ZA 5J2NA 3A0IX 3S1TA 2HHVA 2IJNA 1F9HA 1FJ7A 2QKKA 4DV5J 2VJUA 2GTDA 2CJBA 1Y7PA 1EQMA 2R8JA 1D8ZA 4LFAF 4YOVA 5KG6A 4KHPJ 1NGIA 3M2RB 2FJVA 3N5BA 3QETA 3PYEA 3QNWB 1GLCG 2QSFA 3T19A 4BRCA 5LMUF 3M6UA 3V6DA 2ZH6A 4CI6A 4A8QA 3A8YA 4KHQA 2CJKA 1IBLK 1NUEA 3O9UA 1Q5YA 4CDIA 5KI6A 4FPIA 1HL6A 4BC9A 3SQGA 2ZH2A 3MEKA 2NXCA 1TKZA 2RRNA 5A8KA 3EL2A 3TA2A 1FRIA 3HRGA 4JI4F 3MGJA 4KH1B 4OKKA 3TUIC 4MFBB 2KZMA 3H42A 3IR7B 5KQ8A 4XAKA 3VAJA 3CPWR 4N56A 4YR3A 4M42A 1UWAA 1NSQA 4ZVHA 4Y2KA 3CCRS 3W8GA 3KG4A 2X1FA 1VBZA 4DR5J 3C3LA 2OELA 4NLUA 1WSRA 2J7WA 1UPMB 1HMVA 3L8BA 4CHPA 4OLBA 1UJ4A 4YMEA 4GKKF 3WEEB 2ZKTA 3QNNA 1G2EA 3OXGA 3R27A 1N0UA 3HHLB 3I56S 3UVJA 1TL1A 1Z05A 3M32A 4G6VB 1VQ6N 4W5NA 1VQ5N 2H4YB 1WC3A 2NLXA 3ZTRA 4OI2A 4CEDA 3ZZZA 4QW8A 4F36A 2OPRA 3HZ6A 2EKYA 2R8HA 4KBOA 4GV9A 2DGWA 3AOCA 4EIAA 4B3SK 2F5GA 3SFUA 3A2FA 1OVQA 1I51B 3KK1A 2YWKA 1Q5VA 3M7VA 2AMCB 2CQ3A 3UKRB 3QBCA 1SKUB 3GL1A 3AA3A 5HJXA 4OZNA 4I56A 1X4CA 4M5NA 2H1YA 3CC2N 3RBXA 2AJ0A 4CJFA 2LMIA 4B9TA 3KUHA 2RS2A 3OTCA 4QS7A 4CHYA 2OLWA 3I8DA 1E4FT 1YHQS 1KC8T 3GFXA 2BKNA 2FY8A 4DR3K 5KG7A 5JS1A 3M30B 1VBXA 1ATRA 2A41A 3IRXB 5BRDA 1WBBA 4C9DA 2KM8B 4CI0B 2ETJA 2A6OA 5HBMB 3EPIA 2DR5A 4DZDA 3MDQA 5HO4A 7AT1B 3FZ2A 5DK5A 4RW8A 4DU7A 4J2BA 3KMQA 2VWKA 3DHWC 1MN7A 1FXRA 2RVJA 1X3NA 4ECZA 4M5KA 2LQJA 2PBDA 1Q53A 2FJDB 5IT9Y 5KFCA 1EWRA 5FLXU 1FT8A 2KG0A 3SI8A 3VQ6A 2JLFA 2B51A 3GIJA 3VGVA 1NK0A 3SPYA 1JLGB 3QIDA 2O4GA 3O9RA 4E1MA 5D4OA 1F60B 1HBOB 3MCNA 3KKSA 3L2QA 4UTGA 1SCJB 4EUVA 3TR8A 3G6ES 1KQGB 5DM7Q 2H5IB 4L3NA 3KYLA 5LMNF 1W7AA 2BQUA 4WK3A 3Q8SB 3S3MA 4KPYA 1YZ7A 4A61A 1M1HA 4E7IA 4DLGA 3AY0A 1VSLA 4CEEA 3D6TB 4E19A 4BHQA 4URSA 3GSIA 4ISFA 5DQGA 3KLEB 2B4UA 3SBMA 4B02A 1NGJA 4X64F 1FRHA 4FCYA 3MCAB 3CJSA 2HWTA 1J5EF 1F5AA 3RU0A 5HSPA 3M6GA 3SAGA 3OPKA 2ASJA 1GMWA 2WW4A 1JLAB 1N6QB 3LZJA 5HOOA 2PE8A 1OY9A 1UZHA 4TXSA 1WKLA 3H4BA 1D09B 3EPGA 3IFRA 3OJUA 4H0TB 3HHLA 1VK8A 3UVJB 3KLGB 3AGKA 3DRPA 1VSDA 1RHUB 2X6NA 2M88A 2W8LA 3F9MA 1X8DA 2VC0A 2AIRB 3W3SA 2Z58B 4CLUA 2VWJA 3IGVA 3D9BA 4JLHA 1P27B 4MAKA 1RBVA 3AA5X 3O3GA 3U9DA 2RQCA 4NYOA 3AVMA 3QB0A 4DUZK 4FN5A 2KQ2A 1REVB 3TAQA 1QJHA 4Z7YA 1BI4B 4WCEL 2XSFA 3V81A 4LIRA 1S1XA 2QTDA 1E6VA 3MI7X 1EO1A 1F0XA 1VSHA 5SZTA 1S0MA 3TTCA 4R79A 4FYWB 3CDAA 1JLCB 2KG1A 2H5JB 3W2VB 2PFUA 1N33K 2JLEA 5KFLA 4JK9A 1YTYA 5IT9U 2H3EB 3V9SA 3CJ5A 2J0SD 1XEZA 2JWLA 3PW7A 1F1BB 4BE1A 4K4YA 1R0AB 3G8QA 2JWKA 3G2XA 4F3OA 4USIA 2V8GA 1YIJS 3AVGA 2DGQA 2KXNB 2YKNA 3M30A 1EJ7L 3GSDA 2VOPA 2HHUA 4UZBA 3CPWM 4P72A 3DRYA 1R8HA 2Z0GA 2DNGA 4KGZB 2B6AA 5GADP 2K2PA 4F0KA 4RW8B 5CHIA 2XYPB 2NYIA 4HDGA 1D9FA 4B3SF 5DM7L 4X65F 4DHVA 8ATCB 4CF2A 3SQGB 5J1NA 3ALYA 1IO2A 2I5JA 4CK1A 4J9KA 2GZOA 2VFVA 3PDNA 3GIMA 4ECWA 5AQSA 4FLTA 4WFYA 4YDUA 5MLCV 2Q97A 3NGTA 4DV2J 4KTZA 4M95A 4UOFA 1QAXA 5F8HA 3S3NA 1TV6B 1PO6A 4OHVA 3EXCX 4J9LA 4LF7J 4C0BA 2RB7A 2YJEA 1HLWA 2DY1A 2QMXA 3T5HA 4WFNL 4X66F 1JX4A 1OO0B 5AQPA 1M5SA 1EB0A 4ES2A 4N8NA 3M5RA 2OMOA 3WEEA 4LJMA 3I0SB 2ZZTA 2E5JA 2ATLA 2HPUA 5EX0A 3LDLA 3GQCA 1Z26A 4CO1A 1H7WA 2ZITA 3HD2A 3PW5A 4YNQA 1DTTA 2DNQA 3QFPA 4FJJA 2DNRA 2WVEA 4WXOA 4DSLA 1TVRB 1TUWA 4DU3A 2HQIA 3H45C 1K8AO 3O8MA 3G82A 2CQCA 1RKIA 5DM6Q 3LQVA 4FJ9A 3OYMA 4ZDNA 2DHHA 1CJVB 4OQJA 4DR4J 4I67A 4Z7CA 1MU2B 3JSBA 5FPNA 3OYBA 2F96A 5KFSA 1TL4A 2P9PB 2IVMA 1B0PA 3DJCA 2Q6BA 2ZVIA 2JL9A 3QEPA 3GP9A 4TU9A 5T7BA 1K9MT 1D9DA 4F4KA 4E7HA 4HI2A 1BQMB 1VC0A 3W9IA 3M4XA 1SH2A 3N9UC 3HSTB 2AJ4A 5IQQA 3FKBA 3SK3A 1H98A 2FBTA 1VQNN 5AQJA 5J2QA 1X9SA 1AZSA 1JLFA 1RT7A 4P10A 4CFDA 4KI4A 2MZSA 3FBCA 3BREA 1KOHA 1SJRA 4NYPA 4K42A 2HK3A 3OS2A 3LDSA 1SC3B 2KB2A 3QNOA 3CC4S 3KLHA 3OT9A 3T5LA 2F4VJ 1U26A 4H5NA 3N4PA 3CJKB 5H1SQ 3CCSS 1MW7A 4OZJA 2CAJA 4IR1A 4CNZA 4K4UA 3RB6A 2QLBB 2MJNA 2R42A 4OPAA 2K7KA 4GVBB 4GVBA 4JUZA 4NXMF 2KFZA 2GX9A 2M9KA 3CC7S 4ED1A 4C23A 2HNZA 2F63A 3L3VA 4ED5A 4KYZA 4Q5VA 1IVZA 1G7CB 3O9QA 3SCKE 1JXBA 2X1AA 3A5NC 2OTLN 4KO0A 2IS3A 2YNGB 4TYBA 2CDQA 1SKWA 1H2VZ 4BR2A 1LWCB 3SJHA 2B8QA 3J81O 1NDLA 5D15A 2OPQA 4CYUB 2HS4A 1RNHA 4DLEA 1ACMB 2P9GA 3Q86A 4RW6A 1XNRJ 3UE2A 4DQIA 3MURP 1AYEA 4JD2A 2FF6A 1TAUA 3MCSA 4GV6A 2MY7A 4OJHA 1RYSA 1AA1B 3CFOA 2D0OA 2F8MA 1GX5A 3B4MA 2VG5A 3S3OA 2XHCA 3EGZA 1BA0A 1JLAA 1N6QA 3V1QA 3R7NB 2XZDB 3VQBA 5KG4A 3UI3A 2VKZG 5CD4A 1DT9A 1P9QC 3HPHA 2NRZA 3AVBA 1CZAN 4JNEA 3GE1A 2V7ZA 1K44A 3LP1A 3EGVA 3QATA 1Q8BA 1WELA 4C97A 3MM9A 4J2EA 4DUYF 5M1KA 5ELZA 4I2QB 3TAMA 3NGUA 4BREA 1LXJA 4B3SJ 4NA1A 1CS4B 4K4TA 2J9DE 2I6WA 4PYDA 1U47A 1S0VA 2G2OA 4YS2A 1DFDA 2AZ3A 3V5RA 4O4GB 4CZMA 5L8RC 2O8BB 4JS5A 1Y5IB 1S1XB 1RT3B 1ZZNA 1JJ4A 4X4NA 3M8QA 1W2BM 4ZPDA 2UVRA 2FGCA 2DNLA 3MR5A 4B1WB 4OL8A 1NSAA 3CCWA 3LWLA 1TR0A 4BG9A 2OEMA 2ZM6K 4I6MB 4NL5A 2ITMA 4DUTA 2NUUG 1WOPA 5HATA 2AJFE 4IUFA 3MFIA 4X66K 3MPUB 4YUDA 2XCPA 3NGZA 4G3IA 3CJ7A 3ZSWA 4W5QA 3CJTA 3EDRB 5KFZA 3OR1A 4TU8A 1RCHA 2YWGA 2CG4A 5HMWA 5D3GB 4JRQA 5HRSA 1RDAA 1V3ZA 2DFHA 3NWRA 3QEXA 2FC9A 4I7FA 1NGFA 2O3DA 3UDVA 2ABYA 3CMES 3UE5A 1N34F 1B7YB 2CPJA 4EBDA 4ILMA 4GY2B 1WEYA 4F2SA 1U2FA 1MWZA 5DDRC 4NX9A 2W2OP 2Q43A 4NLTA 3KD1E 5CH7B 4O3OA 2JLGA 5ETTA 1SIZA 2L41A 3VF0B 5K8MA 2BJ7A 2UXDK 5HL7Q 3QYYA 2DNKA 2OJ3A 1BQNB 4M45A 4YHHK 3R7SB 3LPUA 3ZZOA 1IQTA 2ZDOA 4OYAA 3AJ1A 2UUCJ 3SLCA 1YTUA 2ZBIA 1EKEA 2V8PA 4KHUA 1WSIA 1LKZA 1VGYA 4HHJA 2H65B 4DR1K 3VETA 4RNNA 1FERA 2OFHX 4CESA 4DUZJ 5CYMA 1YAGA 2GIQA 1TUUA 1B70B 3KUEA 3I9ZA 4K5SA 4C8LA 1HX1A 2ZWPA 1C6VA 5HVGA 2UUTA 3SV4A 3KDNA 2H9ZA 2HHPA 3I32A 1T3NA 4J9QA 4OZ5A 4B1YB 2FSJA 5H1SV 4OYBA 3CTRA 3FFIB 3Q0AA 1FNOA 4DCHA 4OKJA 2OH2A 3U8XA 4KB1A 1SV5B 4LRAA 4RBTA 5IQ6A 2FTRA 4DSKA 4DX6A 4KGMA 1OYEA 1O13A 3V1OA 1RT1B 2VB6A 2RQ4A 3W63A 3WNHA 1IBMJ 1XQIA 5ETPA 2L08A 4PXCA 4C48A 5EHHA 4B9MA 3HHDA 4NRUA 4IKAA 3VQSA 4RW7A 3KLFA 4FSVA 2WC9A 1NBWA 4FLXA 4RNHA 2R8GA 1TKXB 1V6HA 4PZVA 1S6QA 1SXLA 2AF6A 2GCFA 1M5VC 2PEHA 2HFUA 4CW7B 1UA0A 3CDUA 3N6NA 3MEEB 4DX8H 4ZA1A 3LP0B 5GAHI 3SSQA 3M6XA 3DMJB 4OFZA 4O3PA 3KK3B 4AXJA 3CNQP 3C19A 1X0PA 2Y1LB 4NCAA 3GCXP 3LPEA 4RL1A 1PC4A 3C6UB 3AVNA 2J9DA 2W7AA 5I4MA 5AQRA 2B9EA 1R8PA 4BRKA 1VBKA 2ATCB 2GWJA 1NHVA 4WYLA 3P38A 2RN2A 4JI7K 9ATCB 4LF6J 4HKQA 4PEOA 3HSZA 3DI6B 2YX7A 3ZT1A 3T1YF 4FZXC 4HHHA 1NOZA 1GTEA 5B0EA 1D8YA 1VQ7S 4LQ3A 3CD7A 4H54A 2HVIA 5K8OA 3DXMA 1UWBA 2VQEJ 4N77A 2XMMA 3AO5A 1ZM9A 1CZBA 1XMQF 3TA1A 2ZNZA 2GJ2A 2PFFB 3HVAA 5AZJA 4BLGA 1CEZA 4AHCA 3QMQA 5AXMA 1S4EA 1N36F 1VC6A 4E1JA 3ZZUA 3THXB 1K6YA 3N6MA 3S6EA 5DM6L 2XYGB 1HYVA 2HBRB 3UKRA 2FB0A 1Y11A 1KVCA 2NXUA 4J5OA 4GC6A 5FLXY 5DZ6A 2D5RA 4DU4A 1S76D 2MZTA 4IFVA 1HBMA 4WF9L 4NLVA 4JHDA 1XERA 2YNIA 1RTHA 2UV8A 2X7IA 4M3YA 2ZWOA 4LFBJ 2Z4PA 4NXNK 3GIIA 3DU5A 3CPEA 4K4ZA 5LMUK 4MKBA 1KEKA 3ZSOA 3D45A 4RWXA 3EGNA 4HL9A 3SPZA 4UUXA 2A1RA 2KHOA 3CCLN 3LL3A 2UU9K 1RUSA 2MB0B 2N4DA 4ZTFA 4DR4K 3VQ4A 2WONB 3N0VA 4IOCQ 3UR0A 1XMOK 3PO5A 3E2EA 2M2BA 3JSMA 1J54A 3TRGA 3MMCA 4BY9C 3R1LA 1RGVA 4FL9A 2GUIA 2CPIA 3EZ5A 1VQ4N 3MMAA 3QSYB 2P9LA 1YITN 2Q1LA 5D4LA 3M2RA 4A46A 1HPMA 4KHPK 4K8XA 2NRVA 3NVMA 1D5AA 3D3CJ 1L3UA 2Q31A 1KLNA 4KGXB 3B6PA 1HJRA 5RUBA 1LWFA 4KO0B 1XMQJ 3PVXA 4OI3A 4MDBA 1UZDA 3THWA 1HNVA 4R8UB 3KJQB 3IC1A 3BGUA 1SAZA 2RU9A 3K58A 1KAZA 4FWOA 4USJC 3D6FB 2QGFB 5KT2A 4I7FB 3EX7B 4M5IA 1XI1A 1AW0A 1HJOA 1GAOA 4WQ4A 1OJ4A 1P6TA 1HBNB 1HBNA 2D3ZA 4MO5A 4GKKJ 4LF1A 5I9EB 4ICLB 4WF9Q 3ZT4A 4ENOA 5KRTA 2ASLA 2BTFA 4X62K 3IWLA 1HNWJ 3T6JA 1ZPVA 1JXVA 3FQKA 2FHKA 4JKFA 2KT2A 3H98A 1PJ5A 1NB7A 4MJKA 2FVRA 4OKEA 4DV7K 1UJ5A 1C1BB 4ECUA 2MGZA 3CCJS 1YZ6A 3TPQA 3SAHA 1NWKA 1V5VA 4WYBA 5JVHL 2RAQA 4OYZA 3J7AP 2V4JB 4DSIA 2W9BA 1WD6A 5SUHA 4LSNA 4RUAA 2W6LA 5H9EJ 1C0FA 4EK2A 3MMVA 2GVZA 2P9SA 1XHZA 2GELA 1MMDA 2HHQA 2Y9HA 1OVYA 5F0XA 1G3OA 4V19S 3ADAC 1R89A 3X1LB 2DRDA 2LU2A 3MUTP 4QU7A 1ZYQA 3BZCA 2HNDA 5G0RA 2K06A 2UUBF 1I94J 2HVDA 3M8YA 1APSA 1RTHB 2DNPA 5IV4A 1TYQB 1TYQA 2OAUA 1T95A 1J5EK 2FHJD 3GFHA 5GMDA 3TO8A 3GG1A 4N76A 3BKUA 4P75A 3VV2B 3H5UA 2B7BB 4F0MA 3K59A 1YK9A 4J9PA 3RB0A 1HHQA 1LK7A 2W2QP 3G8TA 1LFWA 3ZSZA 4DF4A 3A5OC 2CH5A 3JYTB 4FJLA 2ZE2A 4PG4A 1M5HA 3TEHB 3AAWB 1JJ2M 5E3CA 5KG5A 2B43A 3SXLA 1L3TA 3N6LA 2HOEA 2RSQA 4Y00A 4JS4A 2ZWHA 4Y1CA 2IAJB 4P73A 4J9NA 1NBEB 3OYFA 2DNOA 3TAMB 3MM7A 2I8EA 4CJ3A 4A2BA 3C16B 3Q7BA 1J5EJ 4OYWA 2R9LA 3C6TB 4I9LA 3DNCA 4RW4B 3IMQJ 2PI5A 4CJLA 5A6PA 2EFOA 1SH0A 4CHQA 2QX0A 1F3VA 3GBTA 3EO3A 1IKVA 5E3AA 4FW2A 1FX2A 3PXGa 4E89A 3V4MA 3IA0A 4JAXA 4M63A 4M5DA 2C2KB 3BH6B 4PUOB 3NVKA 2J7KA 2NRRA 2ZJRQ 4QWAA 4RW6B 2HZCA 4QCLA 2HG4A 3AXKA 4IEEA 3MUVP 2XLIA 3CIZA 4NXNF 4H4KC 5HI7A 5C42B 5AJ3J 4DV0K 1GOBA 5HN0A 4ER8A 1JL1A 3RYLA 2KVIA 3MECB 4IG3B 2P6TA 1DQAA 2H3GX 5B7WA 3PZPA 4BROA 4HTUA 1RAIB 4NXMK 1VHIA 1VR6A 3HFVA 1X4FA 3OHRA 4JEPA 2IVNA 2LDIA 2FGOA 1AUDA 3I4HX 3PR4A 1KWMA 2RUSA 2D3O1 4ED2A 3HK2A 1RTDB 5L46A 2MZQA 1NK5A 2ZH9A 4I2QA 5C15A 3JTPA 5F8NA 2N82B 3VGMA 3ID8A 4KGVB 1N5QA 3KWIA 5LSLA 5BRHA 1S1TA 1ITGA 2G8FA 4DV0J 1NCLA 5E7OB 2AJQA 5KT7A 1OH7A 1WI6A 4NZ0A 1TL5A 1JL2A 4OLPA 2D4WA 4A8MP 4QPXA 5AQLA 2D0CA 3G71S 3WT0A 3VOVA 5FPDA 2HF4A 4ED3A 1B9FA 3J80Y 1Q86O 2ZQBA 3NKYA 3FQLA 2E1MC 5HP1A 2R7WA 2CQDA 1XIQA 4KHPF 3M2VB 4UY8O 3BUZB 3M2VA 2GA7A 1VQMS 1RTJB 4DR3F 4DS5A 3OSNA 4OYPA 3BGLA 5DO2A 3NS6A 2E5GA 3PX6A 3ENAA 3HYFA 1U45A 2R2UA 2FLNA 4KBIA 4YFUA 1FNXH 2XNRA 1KBRA 4FPRA 2YJFA 3GV8B 2YVSA 3SCIE 4BQLA 1S49A 3GIRA 3VENA 4JP8A 3MHYA 3R9PA 4ILGB 5B0GA 4Y0WA 1L3KA 2CUYA 3A5LC 1GLJO 4UQTA 1U1OA 3D66A 3O9TA 2MLZA 2EK1A 1C4CA 4JI4K 2W2MP 3NOCA 3GB0A 1T11A 4A8FA 2ZBQA 2PFDA 3UO0A 2O8CA 2DISA 1NLVA 3FGVA 5AQIA 1IWAA 4FNHA 1MN9A 1JCFA 3SQ0A 4PPDA 2VQEK 1JJCB 2DO4A 1FTRA 2CGLA 3OA9A 1IJJA 1N52B 3CVKA 4RNFA 3M6WA 3PYDA 3H59A 5EWFA 1S1UB 5GMEA 4DV2K 4OO1J 1N5VA 3VWSA 1IM6A 2AYEA 4LF6K 1IKVB 3DOMA 4B3RF 4CCHA 4P2MA 3BBBA 3MM8A 4RCHA 1NH8A 3BYPA 3C66A 4ILHA 2GHPA 4X4PA 2J0QD 4AHSA 1TKZB 4L6V3 2DTUA 5C25B 2XNQA 1LV5A 3NAIA 1UVIA 1JQGA 2RDIA 2W01A 2MKJA 2DNYA 4DZ6A 3HVTA 4JV2A 3IMXA 4Y28C 5C2GA 1WKKA 1GLEG 4FK4A 1M1KO 2MSTA 1T9TA 4B9NA 3GDQA 2YPYA 1FX4A 2JZ5A 2PYLA 5E2QA 3IS9B 1B0VA 4NXNJ 5LMUJ 4LF7K 1KAXA 1JJHA 3BBFA 3H46O 3MN6A 4FLUA 1RWMB 4DV2F 1VQ8S 4NWBA 3A8IA 1R8BA 5A2QU 4O4GA 1FRJA 2ATQA 3OR2A 2I2YA 4C8YA 1CJVA 1K73T 4A48A 2AJ2A 1U24A 4ICLA 3OYLA 2ERRA 4U8YA 4LF8K 5CYJA 1VQ6S 1TVRA 4CGJA 3KUGA 2K7JA 3ZZTA 1RWPB 2KRRA 2M7SA 3U1LA 5TKYA 1Y64A 4JI5J 2WVDA 2C2ZB 2G8UA 2QWOA 4GW6A 4WTYA 1LWEB 5LL6Z 2VA3A 3NXZA 2W4DA 1W7WA 4XH5A 1YJWS 3BO4A 1HNIB 2X6SA 3O4QA 2VPXB 5DDOC 1T05A 3GG4A 3WBZA 4KT0C 1J2VA 5HRPA 3EZOA 3LALA 4YR0A 1S72S 1YKWA 1S5ZA 4DL4A 2NZ4A 2OPSB 4W4MA 5DG7A 5C5JA 1BI4A 3NH2A 3GFYA 3BN4A 5I3UB 3EY1A 4Z37A 2CGJA 4W92B 1S6PB 4NA3A 4EHUA 1VIXA 5KG0A 4MK8A 3TJ9A 2GW8A 3CB4A 1SC4B 3N01A 4PG6A 4A59A 3U3YA 1GK8A 1WF1A 3G9CA 2MQOA 3A1YG 3M8WA 1ULRA 1KVJA 5KT4A 1IKXB 2HNYB 2ZF5O 3DLEB 2FF3B 3A12A 3UNYA 1QQMA 1U1MA 4RUHA 2UXCF 2QWLA 2KM8C 6FD1A 3Q89A 2BEFA 4NEZA 2GGPA 3AD8C 3A3NB 2IM0A 1VQ9S 3O3HA 4YY3F 3D2FB 2NUBA 3A3PB 3VAFA 4MYUA 3OR1B 1G15A 4ZLPA 2BOPA 1E4GT 2F4VF 2CPZA 1U2CA 4ETXA 4I6WA 4URQU 3IUCA 1EKRA 4A8YA 2P9KB 1TELA 5F3TA 3ELHA 2HB5A 2W9CA 4LD0A 2B4JA 3VCDA 2XS7A 4DL7A 5AQFA 4B8CA 4I9QA 1NJIO 3ENOA 1YLXA 1SUQB 3JXOA 3OYAA 2FBYA 1XMBA 1B64A 4HWIA 4KSEB 5AQMA 1NDKA 3TWZA 3TSQA 3NNAA 2E2QA 4DV7J 3G10A 2CQGA 4IH7A 5B0CA 1EWQA 4F25A 4FPAA 2PMWA 2J76E 4KI6A 4ZJQA 5LSOA 3M9MB 1PYTA 3ZTPA 1CULB 4DL6A 5M2PA 3KJFB 4WFAL 3MAHA 3A8JA 1HWLA 3TWHA 1XNQJ 2OEKA 1JWWA 1TFWA 3NCIA 2U2FA 3BKFA 3BQ0A 5HROA 2YKOA 4O8UA 3NGDA 3ZX2A 2IVYA 3I55S 2P9NB 1WHWA 3BGRA 4HUGA 4AQYF 4DL0C 1X0FA 1B99A 1S48A 3C14B 4FJ5A 3CJ4A 1VQSA 4RW9A 4O55A 4F3MA 2IA6A 1Y00A 3PEJA 4LF4K 2XWYA 2R3VA 3ULEB 1PAUB 2W9BB 4Z4GA 3GV5B 5AQXA 4KFBB 4JKGB 3DLJA 4OI0A 5KPRA 2VFRA 3ZSVA 2EWHA 3LW5C 1JLCA 5AQKA 4M5DB 5K20B 1WKJA 1GQEA 2BQRA 1K0VA 4UOCA 4E1NA 2XWXA 5DGAA 4I0WA 5F1XA 3OVAA 3V6DB 3GYNA 2NSCA 1NJXA 5ETNA 5DS7A 1OH5A 1KOOA 3N4QA 4J91A 4GC7A 2N4CA 3FCWA 3LP0A 3DOLB 3J8AA 3NBPA 2DR8A 1R6YA 4K4WA 1F2GA 4CO0A 1Q79A 4AHRA 2IVPA 1ILYA 4B9VA 2YCHA 1F21A 1XNQF 3AO3A 3MMJA 4JI3F 3WQTA 4CJEA 3CMQA 3QFHA 3CCLS 4YDDB 3W1YC 3A8EA 2UVUA 1UEKA 2Q0UA 1S1TB 2MKIA 3FGUA 1REVA 2E5LF 2KZZA 1H0HB 1YJ9N 1QS4A 3DRSA 4DPYA 2V50A 3B54A 1KP6A 3M8ZA 1ZBUA 3DRRA 1T03A 3M8PA 2CG8A 1T8EA 5F0UA 2BA9A 4LVNP 2NR0A 2AGOA 5U47A 1OQ6A 3CXCM 2IM3A 3CCQN 1NNEA 3QINA 5JVGQ 4DF8A 1ICEB 4JI1K 3GU0A 2OI2A 2IY5B 5DDPC 5CYMB 1VK0A 2HQFA 2KH9A 5C42A 2LA6A 3H90A 4MKVA 2QO3A 1WSGA 4ED7A 4QYZK 4YY3J 4IR9A 4BCAA 4FKXA 1FKPA 4OJRA 2FHOB 3AOBA 3AD7C 3QGGA 4G1QB 2Y1JA 1WG1A 5ETSA 4MO4A 2EFQA 3KK7A 4YR2A 2Q0RA 3GWCA 3IR5B 4QAGA 4JBCA 4FZVA 4M5LA 4MTPA 1RTDA 3VVTA 1U1LA 2CA9A 4JI8J 1EP4A 4DV6F 1YRUA 5FRMA 1WC5A 3JAMY 3OL6A 3K0JA 3SMPA 1SIWB 1KTVA 1X3MA 2ZHAA 2BZ2A 4K41A 1BL3A 2GMHA 3L2UA 2DCUB 2Z30B 5BXIA 4KQZA 3PW4A 2WFBA 3HF5A 3DDIA 5JMVA 2MKCA 5CAAA 4PUOA 4AFFA 3DFEA 4WFAQ 4QWCA 1RLDA 3CC4N 3NGSA 3MPYA 4IO9L 2J0XA 3WIUA 4BRNA 2RT3A 2VG6A 3VQ5A 1EIYB 3J81U 3O80A 5A0YB 4NLCA 1LWEA 2W42A 1GXLA 3QERA 4CQ1A 1NKBA 3N4WA 1NHKL 3CC7N 3Q8UA 2GNKA 3FZFA 4CEZA 4PKHA 4YN3B 5FIIA 5AFUA 2YHBA 1VQKN 3U02A 1S0OA 4GMJB 3RJMB 4DPTA 3DXKA 3IDHA 4ZCKA 3ID6A 1Q0NA 3ZZRA 1BGXT 4K8ZA 1ZBTA 4WQ4C 2WB1D 3WXJA 5DQIA 1JJ2R 3FZMA 4JB8B 2GMJA 2QWPA 2C1EB 3AO4A 3U7JA 5FPMA 2OCEA 1NHUA 3DDKA 3THXA 4ZHRA 1VFJA 1RWNB 4ZHRB 4DQSA 3TQEA 1RT6A 2AEFA 3CDBA 1C1BA 1RBRA 1UP1A 1BISA 1YI2S 1V9OA 1PG5B 1RBLA 3ET6A 1IBLJ 1FKOA 3IR6B 1MMLA 4OHYA 4PWDB 2W9AA 1S7HA 4FZZA 3DLLQ 2F4VK 3WX8A 1QVGR 2ZH4A 2FPHX 2ZE2B 1HNZJ 4ZIVA 4CO4A 1NGBA 4BC4A 4TY8A 3MCPA 4TKTA 1U0HA 4BDZA 2EEYA 3RAQA 4JV1A 4FLWA 4FZYA 3NL0A 1SKSA 2FVCA 1KLMA 1WC4A 5LT5A 4G1PA 5E41A 1ZBHA 5EDWA 4DMZA 4L3QA 1VQPS 1F9EB 4UZCA 4GKKK 2F8SA 2FLLA 4H5RA 3OTOF 4QZVB 5GAGU 4RKUC 3CCUS 2QMUB 3IAS9 4QU6A 1I3OB 1O8BA 2YNGA 2WBNA 1YJNN 2O8CB 3ICLA 1C1CA 2BGGA 5C2FA 4OI1A 1LWCA 2RJZA 2UZAA 5F9LA 3W60A 5HL7L 3TZYA 2P9PA 1HNZK 2BJ3A 3KWMA 3HKZD 2O01C 4I6AA 3NF9A 4A47A 3P45B 3DXSX 5KFWA 4JI8F 2ZC4A 1VSIA 3Q7CA 4DQRA 2QWMA 3Q8VA 1SQFA 1P1TA 3E01B 3WNGA 2HYIB 2YNHB 2IC3A 2IDLA 4BC2A 1K1SA 2IM1A 3BPSP 3GONA 2ZHBA 2IFXA 2HHHJ 4KTWA 2BRKA 2BRLA 4H4KA 4BC5A 2OD6A 1XMQK 3ILOA 3US5A 4B3TF 2E88A 3CJKA 3OYGA 2ZM6F 4ELUA 4DN0A 2NZTA 3OS1A 3SQOP 2HWIA 4HH1A 4G9ZA 1ASWA 3L0QA 1Q9YA 1HNZF 1J5OB 2RIJA 4ZP7A 3AB2B 4C4WA 3G4SN 4DR7K 3L2RA 3CCMN 2V2VA 3T1HF 4DR2F 1FDNA 1IBLF 3V9XA 3BDPA 2ALZA 3BSCA 2BYCA 1OIAA 4BVPA 3W64A 1YUWA 1SC1B 3U9ZA 4BQZA 3TW0A 4OX9J 2YTCA 4YB1P 1X9MA 2DEJA 3M05A 3C8YA 3CGIA 4BR0A 4OYXA 5M1FA 4DTNA 4MKAA 1IR1A 3BSAA 2PZSA 4EAHD 3MM6A 3MM6B 4PL7A 3T9NA 2FJEB 3B8AX 1ZZFA 1FWKA 4NASA 5KFQA 3NEKA 4CLSA 1PKUA 5GAHU 2O67A 2QL5B 4M7YA 3H2VE 5A76A 1MROB 1IKYB 4XEIA 2DGOA 4FVUA 3BO2A 3BN7A 2KKZA 1WWHA 5HLFB 3PRDA 3PIOQ 2F9WA 1GT8A 2DR7A 3CD6N 1HW9A 3LP2A 3PEHA 4PR6A 4C6AA 1X9WA 3EDQB 4FWMA 5KFPA 3E9OA 2HKEA 1S10A 2BMBA 5A8RA 2WOMB 5D0GA 1SL2A 2HAIA 4LF4J 3H25A 2JC1A 2QYGA 3C2PA 4OX6A 1Y97A 4CBWA 2ZJPL 4XDDA 4QR1A 3T5JA 2MSSA 3D2FA 1RT3A 1NDCA 2CZ9A 3NS5A 1M90O 4ED6A 2MZ1A 4FBTA 1ZH5A 4I4BA 3KG1A 1YJUA 3FBFA 1VQ8N 4H4MA 2J8AA 1W2BR 1S6UA 1S3XA 3EE8A 2L48A 1Q82T 4GVLA 1K8AT 2XS2A 3CIPA 4W90B 4M5JA 2AGPA 3TANA 4U7CA 2ZEJA 2XY6A 1YBTA 3AXMA 1Z25A 1RT4B 1IM4A 3NF8A 5FD1A 4B9UA 4P74A 3V6HA 1FHTA 4X84A 5LOQA 3QT5A 3NS7B 1D1UA 3QPIA 4L76A 1W2IA 3CCVN 2UUCK 5J2PA 2CVIA 2HIYA 2G8KA 2F3JA 2JVRA 3V9WA 3AO2A 2KFNA 3NF7A 1AUSL 3O1LA 2UXBK 3D2EA 1EHWA 1N36K 1DTTB 1RISA 2RRAA 3W61A 2PSZA 2G9OA 1N32J 1QVFM 1ZAXA 2WVFA 5CYQB 4X64J 1S6OA 3D7EO 3KLGA 1X4EA 4CFBA 4OPKA 4BBYA 4C1NK 3O5BA 3AVKA 2RU3A 2EBGA 4A2AA 5G4DA 4ECRA 2OTJN 2HHTA 1R8CA 5T14A 3L7PA 4B9SA 1U1KA 2AD9A 4RW9B 2W4CA 1SQKA 1P8GA 3FEYB 3ZEUB 1ASUA 3AFGA 4KRWA 1DKGD 1QQOA 3OTBA 1WOOA 2QI2A 1FWPA 4XO0A 4DCOB 4IOCL 2UXBF 4ZPVR 2WTFA 2V52B 3WHIA 5AQZA 4PABA 3WXIA 3R8YA 2UU9F 5KOWA 3OSPA 4X64K 2HVHA 1YJVA 1HHSA 2B0GA 4DL3A 4BDYA 1FTCA 2AZ1A 3OL8A 4UW2A 2BE2A 3FFIA 4J9SA 3P39A 2AQ4A 3ITHA 3ZT3A 4PHTX 4Z4IA 4R5PA 4GV3A 2XHBA 5F2RA 3MR2A 4DV6J 1QUPA 2OHDA 2GFFA 4OZ2A 3VQTA 1FW6A 3RW6A 4ZPAA 4QIEA 2RPIA 2EFGA 1C1AA 3CDWA 3ZC4A 1HQEB 3PIPL 5LY3A 4UUWA 2LQ9A 1GH8A 1U02A 1RAJA 4CF8A 4K5RA 1TKXA 4HLBA 3RZAA 3HPOA 1UVMA 2D0AA 4ZVEA 4FM1A 4FJHA 3MM8B 2VWBA 2HURA 1FEEA 5KFIA 3U4LA 3JAMU 2UUAF 2JVOA 4OGEA 3HSCA 4J2DA 4DEZA 4LF8J 2YNIB 1ESVA 2UUAK 4GRSA 3VZHA 5AQNA 1V4SA 1PJ6A 1UEVA 3ENHA 4CZKA 4TN2A 4O0IA 4JD2B 2DFFA 2FSNA 3MWBA 4DR6K 2ZBRA 1YTAA 1CJUA 2OMLA 1T6DA 4BC3A 4ISGA 2VG5B 1DGKN 3TSPA 4Y0FA 3VA3A 1YF5L 2YX4A 5HANA 4A5AA 3IM8A 4M8LA 1TUVA 2HS3A 3OR2B 3IG1B 3FSIA 2DPNA 3PSFA 3C7NB 3MAQA 4KPCA 2M8DB 2JSXA 2VGMA 1UA1A 5M2UA 1OMSA 3GE9A 3UN5A 4CIGA 4WIIA 4ZVQB 4H0YB 4E3SA