2HB5A

Crystal structure of the moloney murine leukemia virus rnase h domain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
155
structure length
150
Chain Sequence
HGTRPDLTDQPLPDADHTWYTDGSSLLQEGQRKAGAAVTTETEVIWAKALPAGTSAQRAELIALTQALKMAEGKKLNVYTDSRYAFATAHLTSEGKEIKNKDEILALLKALFLPKRLSIIHCGHSAEARGNRMADQAARKAAITETPDTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Crystal Structure of the Moloney Murine Leukemia Virus RNase H Domain.
pubmed doi rcsb
source organism Moloney murine leukemia virus
molecule tags Hydrolase
total genus 38
structure length 150
sequence length 155
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hb5A00
2YNGA 3AVGA 3HPGA 4CJ3A 4K8XA 1BCOA 4E19A 4F3OA 4BDPA 3L3VA 3OYCA 4N41A 3DYAA 4RW8A 5CYMA 2RN2A 3DLEA 1U04A 2IAJA 4OKKA 3AVIA 4AHVA 4C8KA 4M41A 3AO2A 1KFSA 3DLBA 3K5OA 1Q8IA 1TK5A 4IKFA 1WSIA 4CJLA 4CEQA 4FCYA 4K8ZA 4CCHA 2OA8A 3NF6A 1VRTA 1G15A 1BQMA 2XRIA 3SPYA 4NYFA 1YVUA 5J2MA 1ZBLA 5K14A 4OKEA 1WNSA 4B9LA 3ZT4A 3VQCA 2DFEA 5CY4A 4CJUA 3CYMA 1KFDA 4JS4A 1XHXA 4E7KA 4DFPA 3AO4A 3AVFA 2D5RA 3OYAA 1DTTA 1TV6A 3C95A 4DQQA 1D9DA 3ZSVA 3HVTA 4O4GA 3OYBA 3VQ6A 1TGOA 1TKZA 3G10A 2G8UA 2ZE2A 4DS5A 2ETJA 2KQ2A 1C0UA 4LSNA 1VSMA 4E89A 3RRHA 1KLNA 4KB1A 2YKMA 4LH4A 3CM6A 1NK7A 3QNOA 3QNNA 1L3TA 1JL2A 2P51A 5HBMA 3NH0A 4M3TA 2HHSA 3QO9A 4DU3A 4IDKA 4C8OA 4RW9A 4FJ7A 1XC9A 2OZMA 3K5LA 2E6MA 2OPSA 4I7FA 3V1RA 1TAQA 4KHWA 1NKBA 2KZZA 3AA2A 4FLWA 3CFPA 3LZJA 2XHBA 3SQ1A 5HROA 1RDAA 5J2NA 1VSDA 1ZBIA 1IKWA 5CZ2A 4CEEA 3OYMA 3QERA 2DFFA 1RTIA 3TAGA 1NOYA 3RMCA 2ATQA 5CYQA 4CJSA 4CHZA 4CJTA 4KTQA 1TKXA 4FM2A 4DQSA 3HP9A 3CQ8A 3FFIA 4Z4CA 1W0HA 2QKBA 3NF7A 4PY5A 1ASVA 4EZ9A 2XY6A 1U47A 3QLHA 1KSPA 4F2SA 3EY1A 3S3MA 3BDPA 4MQ3A 1T03A 1JXEA 4KKOA 1RBSA 2P5OA 2OYQA 4OVLA 3VQAA 3DRSA 4E3SA 4IFVA 4W5RA 3QEVA 1TK8A 4DFJA 3ZT1A 3V9SA 5HLFA 3HO1A 4KHSA 5EU7A 2HHVA 1VSFA 4CIFA 4DTMA 4AHCA 4CJRA 2HHWA 4W5NA 3L2VA 1XHZA 1KRPA 1RT3A 1S9EA 2YKNA 2XY5A 4CHYA 4FW1A 3D45A 1LAVA 3AV9A 4CJEA 3MAQA 2P5GA 1SUQA 4OGCA 3VQ7A 4Z4IA 4O44A 4LD0A 4FJKA 4FJNA 3OYKA 1YTAA 4FZXC 2BE2A 4IBNA 3WNFA 2FC0A 4AILC 3DLHA 3MECA 4ELTA 2HHUA 1TAUA 3NGYA 4DLGA 1XI1A 2IC3A 3HM9A 3PV8A 2BDPA 5HRPA 4DSFA 3L8BA 4IG0A 1CXUA 4AHRA 4CIEA 4DTNA 4DSJA 1JXBA 3OYEA 1ZBHA 3WNHA 4DTUA 4M3ZA 4DQRA 1BGXT 3CG7A 4FXDA 3KKSA 3WNEA 1I39A 4E1NA 4CF2A 3QEIA 1B92A 1TVRA 5D3GA 1ASWA 1VSHA 1B9DA 2D0AA 3KIOA 2G8KA 4OPJA 3K59A 4KHQA 1EXQA 3QETA 5I3UA 3NCIA 1IKXA 3VN5A 1LWCA 4FJIA 2O4IA 4E7IA 2E4LA 4HUGA 1L3UA 3IAYA 3VA0A 4FJJA 2KW4A 4QOZB 2LSNA 4DSLA 3LAMA 3QEPA 3SPZA 2HNZA 3QIOA 1S6QA 3SV4A 1NK4A 4J2EA 2D0CA 4KTZA 4PQUA 3ZT3A 4DSKA 3DRRA 1HRHA 4EP5A 3NAEA 4J2BA 4CHPA 4W5TA 3OYLA 1VSJA 3AA5X 4JRPA 5E41A 2OPRA 1DTQA 5T7BA 3KLFA 2RPIA 3MXJA 3AO5A 1LW2A 1D5AA 3D0PA 4F2RA 1RT2A 2IGIA 3RTVA 4B9TA 4CF1A 3SUNA 4KI4A 3HL8A 3K2PA 1QE1A 4CJ5A 3AA4A 3V6DA 3PX0A 2ZD1A 3I0SA 1NJYA 2OPQA 2Z1IA 4C8NA 3H08A 2G8FA 1RILA 1RNHA 1BQNA 3RR8A 3NF8A 1HPZA 3OS2A 1TL3A 1RT7A 1ZYQA 2G8VA 4CJ4A 3LP3A 2KFNA 2Z1HA 4KPYA 4KI6A 4CHOA 4M42A 3VQPA 3NE6A 4QAGA 3PO4A 1U48A 4W5OA 1BI4B 4CK2A 3KK2A 2PYJA 1UA1A 1S1TA 3CM5A 2HHXA 3NH1A 3BGRA 2YNFA 1HQEA 1K6YA 2X6SA 4CEOA 3M8PA 4LSLA 1BL3A 1FKPA 3C6TA 4GMJB 1RT6A 4CF0A 4CE9A 4CESA 1O1WA 3OYNA 3TAEA 1D8YA 4DTOA 4CEZA 2HW3A 1EP4A 4BE0A 3I8DA 4M3YA 1TL1A 3KLIA 4FZYA 1QS4A 2HMIA 3I0RA 1KTQA 4FJLA 4E7JA 1D9FA 2AJQA 1EX4A 2X6NA 4KAZA 2OPPA 5C24A 1KVAA 3SUPA 2WOMA 3RMAA 3SQ0A 3AO3A 3PX6A 4CFAA 4CGIA 4Z4FA 3V9WA 1SL2A 1WAJA 3P83D 4KRFA 1KVBA 1ASUA 4CECA 4CEFA 4YNQA 4OGEA 2HHQA 4R5PA 1GOCA 3ALYA 4MFBA 4KTWA 4DQPA 5SWMA 2Y1IA 5KI6A 2G8IA 3EYZA 1HYVA 1WLJA 1ZBFA 1RBTA 2YNIA 3OYIA 4E7HA 3DOKA 4CK1A 1U4BA 4FJXA 1N5YA 2DTUA 1SKRA 1W9HA 3VA3A 1CZ9A 4Z4GA 4NCAA 3DI6A 2X74A 2F8TA 3TAPA 1X9SA 1KCFA 3OYFA 1JLGA 1HNIA 3LWMA 4Z0UA 3OJUA 3SJJA 3MXMA 2FBTA 1RTDA 3M8RA 1A5VA 1S6PA 4AHTA 5J1EA 4FLZA 4M3UA 3NGIA 3RR7A 1IG9A 4CGJA 2I5JA 3ZT0A 2X78A 3E01A 1VK0A 4O5BA 3G0ZA 4C8MA 4CEBA 3L2WA 3U3YA 4B8AB 1YTUA 2G8HA 3LAKA 4BE1A 2QKKA 5KGXA 3PUFA 3ZSXA 3DOLA 1REVA 4KV8A 4KO0A 3V9ZA 3DLGA 4M3XA 2JLEA 3L3UA 4I2QA 4CHQA 3TAQA 4ZTFA 2HVIA 2A1SA 3L2RA 3V9XA 1U45A 5JS1A 5CZ1A 3AVMA 4Q0BA 2P1JA 1X9MA 2VWKA 1J53A 4HCBA 2F96A 1IO2A 3VQ9A 4BE2A 4AHUA 1QSSA 3U3GA 2KFZA 3K5MA 1U49A 3QINA 3M8QA 4N5SA 3OS1A 1NK5A 2IDOA 1S5JA 3ZSOA 1ITGA 1VSKA 3KLHA 5HRSA 2W42A 1FXXA 2E6LA 4CJVA 2XY7A 3S3NA 4F4KA 4KHUA 3SNNA 4ICLA 4Y1CA 3VQEA 3HPOA 1A5WA 4CERA 4FYDA 1EETA 3AVKA 1SV5A 4QCLA 3T3FA 1VSEA 1X9WA 4B9UA 5KRSA 3P5JA 3IG1A 3LP2A 4OJRA 4JS5A 1NJZA 1T05A 3KK1A 2QK9A 4ZTJA 1TKDA 1JLBA 4J2DA 4N76A 3AO1A 3KJVA 1Z25A 3NBPA 4BWJA 3NHGA 2EX3A 4FLUA 1HNVA 1EKEA 1Y97A 1F21A 3CFRA 1LWEA 5FDLA 4EP4A 1NKEA 3DLRA 3O4NA 3TI0A 2RKIA 2ZQBA 1HQUA 4DU4A 1RTHA 4Q5VA 3LZIA 3SUOA 4M3WA 4DTRA 3NGZA 4DQIA 4HTUA 1J9AA 1WN7A 3P1GA 4OPKA 3TAFA 4I9LA 4HHTA 4FVMA 1L5UA 1JLQA 1S1XA 2GUIA 3OJSA 4FK2A 2JGUA 4BWMA 4DTJA 3LWLA 3K5NA 1RTJA 3CFOA 1ZBUA 4H8KA 4B9SA 5FRMA 2GV9A 3LPUA 3ZSZA 4DSIA 1JLFA 3VQ5A 2F8SA 1DLOA 5KGWA 1L3SA 3TABA 4DG1A 1Q9XA 1GOAA 1QSLA 3ZSQA 1CXQA 1TK0A 4J2AA 1S1UA 2QXFA 4E1MA 1BCMA 2B5JA 3KK3A 3HSTB 4LY7A 4M3RA 3ZT2A 1BISA 3TWHA 2KTQA 4DTXA 4B8CA 2O4GA 4FJMA 3L2QA 1CZBA 1RBVA 1RDDA 3V81A 1NKCA 1HYSA 4FJGA 4KFBA 3VQDA 3SUQA 3NH2A 4W5QA 4NCGA 4FJ5A 3S3OA 3SYZA 4DS4A 1TKTA 2YV0X 1LWFA 3TR8A 3LP0A 1JKHA 3V1QA 3NDKA 5FROA 4CJPA 1SL1A 3B6OA 4B08A 1HJRA 2IS3A 5JS2A 3DRPA 1IKYA 3VQBA 2R7YA 2G8WA 4CEAA 2NUBA 3L2UA 4DF8A 3V9UA 4IG3A 1UA0A 3S9HA 4CFCA 1SKWA 3TANA 1UWBA 4CFBA 3KD5E 4I9QA 1JLAA 1RBUA 1J54A 1NK8A 3IRXA 3MXIA 3TAMA 4F3TA 4Y1DA 4RW7A 4CJWA 4OLAA 4RG8A 2Y1JA 4F8RA 3C6UA 3TARA 5J2PA 1LW0A 4HCCA 1KVCA 1RDBA 4DF4A 1C1CA 3AVLA 2B4JA 3MEGA 3HXMA 1R0AA 5I42A 3SZ2A 3QESA 4E0DA 1BIZA 3K57A 3HJFA 4CIGA 4DMNA 4OLBA 4Z4HA 1C1AA 4GW6A 5KTQA 3PY8A 5DK5A 3NFAA 5C25A 3THVA 4Z4EA 3AVNA 3HP6A 3HPHA 5FRNA 1B9FA 3RMDA 2DY4A 1T7PA 2PY5A 3RWUA 4UQGA 4GVMA 4N47A 1KLMA 4B3OA 4PA1A 2HVHA 4CEDA 1LV5A 4CHNA 3OYDA 1L3VA 3UIQA 3ZSRA 1JLCA 3C94A 4ID1A 4WE1A 4DFMA 2Z1JA 1BHLA 1IH7A 3LALA 4FLYA 2OZSA 3AVHA 4B9MA 1I3AA 4ID5A 2XY8A 4FM0A 4EZ6A 3QEWA 3AA3A 1RT4A 1JLEA 3ZSYA 1UOCA 4BDZA 3AVAA 1QTMA 1FK9A 1FKOA 2RF2A 3WNGA 4DTPA 3SV3A 4O0IA 4KB0A 4PUOA 1VSLA 4DLEA 1S1WA 5J2QA 4CGFA 3LDSA 4FM1A 2FBXA 1LAWA 3EZ5A 4BDYA 3U6FA 3OVNA 3PX4A 1NJXA 4B9NA 4KHNA 3ZCMA 2VG7A 3ITHA 3OY9A 3KTQA 3OYHA 4N56A 5DMRA 4C8LA 4CJFA 1VSIA 4O55A 3KLEA 4KREA 2B6AA 5KRTA 4FZZA 1MU2A 4CJKA 3V4IA 3KKRA 3ASMA 5SZTA 1RCHA 3NF9A 1GOBA 1VRUA 3IS9A 2IOCA 5HP1A 2VWJA 2VG6A 1NK9A 1J5OA 3QEXA 4JLHA 2HHTA 3MEDA 4FLXA 4E7LA 1IKVA 4B9VA 4FK0A 1RDCA 1RT1A 3V1OA 2A1RA 3ULDA 3ZSWA 4CF9A 5HRNA 3K58A 1UAXA 4M45A 4FJ8A 1C1BA 2HNDA 2PYLA 3KD1E 1WSEA 4CGDA 2EHGA 3OYGA 3OYJA 4FK4A 4NYNA 3AVBA 3T19A 2Z1GA 1JL1A 1QQCA 5C42A 4HUEA 3SCXA 4L8RB 2VG5A 3AVCA 2KZMA 4HVJA 3MEEA 3F73A 4RW6A 4AH9A 3ISNC 1RT5A 3KLGA 2PZSA 1XWLA 4RW4A 3OS0A 4FLTA 1NK0A 4JRQA 3VQ4A 2ITGA 4DFKA 3A2FA 4G1QA 1HMVA 3VQ8A 2XO7A 4CJQA 1CLQA 1YT3A 4CK3A 4CGHA 2YHAA 3RRGA 3DMJA 4DSEA 1Z26A 3LANA 1C0TA 4ELUA 4KHYA 1QSYA 4IFYA 1X1PA 3DLKA 3HT3A 4FLVA 4CGGA 1BIUA 3T1AA 4TSXA 1WAFA 4FW2A 1RBRA 4DWIA 3O3FA 3M8SA 1NK6A 2Q3SA 1T8EA 1C0MA 3HK2A 4O0JA 1WSHA 4DU1A 4H4MA 1A5XA 4H4OA 3JSMA 4I2PA 3JYTA 4HUFA 4DTSA 3SQ2A 1QHTA 4OKJA 2D0BA 1SL0A 2WONA 3LPTA 3O3GA 1WSJA 3O3HA 4XIUA 3SQ4A 4CFDA 3F9KA 4AHSA 2HB5A 2FBVA 1S9GA 2FBYA 3DM2A 4ZHRA 4ELVA 3QIPA 1HYZA 3VQQA 3PO5A 4FJHA 2BGGA 1NOZA 1C6VA 4NCBA 3B6PA 3HVRA 4FJ9A 3O4QA 1BI4A 3RMBA 4BACA 3LP1A 4PWDA 1Q9YA 5HRRA 4LH5A 2BANA 1NJWA 3AVJA 2HNYA 1WSFA 1SKSA 1N6QA 3SI6A 4CF8A 2GBZA 3HYFA 4YFUA 2DFHA 1S1VA 2YHBA 1WSGA 2YNHA
chains in the Genus database with same CATH superfamily
3HPGA 1BCOA 3L3VA 1VQNN 4O5FA 2RN2A 1GLLO 5HOOA 3AO2A 3DLBA 2E1ZA 1GLFO 2VGNA 2OA8A 1YF5L 2ZWHA 4YOWA 3EKUA 5K14A 1ZBLA 1WNSA 4CJUA 2DFEA 4JS4A 1KFDA 4DFPA 4EAHD 3AO4A 1D9DA 2D5RA 3HVTA 4O4GA 2G8UA 2ETJA 2KQ2A 4E89A 1KLNA 3I33A 5AFUH 4YHHK 1JL2A 5HBMA 3AAPA 4FWLA 3QO9A 1J6ZA 5EY4A 4C8OA 4RW9A 3MCAB 4XEIA 4V19S 4JEPA 3CFPA 3LZJA 2PAVA 3J7YP 3CF5L 4H0YB 2O8DB 1VSDA 5AQNA 1IKWA 3QICA 1NOYA 3RMCA 2H3GX 3R9PA 3A0IX 3FR0A 3QFUA 4YOUA 5CYQA 3TTCA 5F1XA 5BR9A 2YJFA 2XY6A 4DR4K 3BDPA 3QBXA 4MQ3A 1T03A 4KKOA 2P5OA 1RBSA 4E3SA 4DV4K 1Q18A 2YX6A 4AHCA 2HHWA 3BEXA 2ZGZA 1S9EA 3K9KA 4CHYA 3UKUA 2P5GA 3THWB 3LDLA 4O44A 1U2VB 2NZTA 4FJKA 3U9DA 2QWMA 3SBTA 4IBNA 3MECA 5AQJA 4FWSA 3DJCA 3JXUA 1XI1A 5C2FA 3OW2M 3K0SA 3L8BA 1CXUA 4AHRA 4CIEA 4DTNA 1ZBHA 3DXKB 4DTUA 4FXDA 5LMNK 1GLBG 3RSEB 4LFAK 5D3GA 1QQMA 3KIOA 2G8KA 4KHQA 3QETA 3VN5A 1D4XA 4HTLA 2E4LA 1L3UA 1BO5O 3VA0A 2KW4A 5A2QO 4QOZB 1EWRA 1BWFO 3SAGA 3SV4A 1S6QA 1NK4A 4J2EA 3P4IA 1HRHA 3NAEA 4BC4A 3O4WA 4YDUA 4CHPA 2CGKA 4W5TA 3AA5X 3SLCA 1P8ZA 2OPRA 5T7BA 4EHTA 3MXJA 2IGIA 3VGLA 3CJCA 4JI3K 3V6DA 3AA4A 3I0SA 3TSUA 4C8NA 2A6AA 1HPZA 2I7PA 2G8VA 1RT7A 2JWKA 3LP3A 4CJ4A 4KPYA 3H46O 4QAGA 2E2NA 2A41A 3J8AA 2E88A 3KK2A 1UA1A 4GKJK 1EO1A 1YJWN 2HHXA 2ZGYA 4CEOA 1K6YA 3FE1A 3CCRN 1HKBA 1FKPA 4LF4K 4GMJB 4CE9A 1NMDA 2E8AA 4CEZA 3C0BA 4BE0A 3I8DA 4JYAK 2E20A 4M3YA 3KLIA 1SZ2A 4FZYA 1QS4A 2A40A 3I0RA 1KTQA 3WXMB 1EX4A 4PKGA 4BG8A 2OPPA 3SUPA 3SQ0A 3AO3A 4CGIA 1YXQA 4AM7A 1SL2A 3D7EO 1N34K 4CEFA 4BR2A 2HHQA 1GOCA 5B8HA 4DR5K 4KTWA 4DQPA 5SWMA 3KVGA 2OTLN 5M1FA 3SMPA 3OYIA 1RBTA 3ZEUA 4CK1A 4YOVA 1IBLK 1CZ9A 3CMAN 4Z4GA 4CZIA 2X74A 3TAPA 3OYFA 2QTDA 1JLGA 1HNIA 4BQLA 3CQXA 3I8BA 1RTDA 3NVKA 1A5VA 1KAXA 4B9QA 2P9IB 3NGIA 4LFBK 3RR7A 3O8MA 4CGJA 3ZT0A 3FLCO 2BUPA 4B8AB 1YTUA 2G8HA 2QWNA 1IV0A 3PUFA 1K9MO 3DOLA 3DLGA 4FVUA 1HJOA 3ZX0A 5JLHA 3L2RA 4JI7K 4XH5A 3VTIA 4DR1K 5CZ1A 3AVMA 3WXJA 3IMXA 4Q0BA 4HCBA 3MX2A 3VQ9A 1VQLN 4IO8A 4N5SA 3FZFA 3HZ6A 3CCJN 3ZSOA 3KLHA 1VSKA 5EVZA 5HRSA 1FXXA 4CJVA 2QM1A 4KHUA 3VQEA 3EE9A 4K0KK 4IJAA 4CZJA 4WQ5A 4BRKA 1SV5A 2ZJQL 4B9UA 3P5JA 3UKUB 3IG1A 3LP2A 4BVPA 4J2DA 4N76A 3NBPA 4ILHA 2EX3A 3CFRA 5FDLA 1QVFM 4L3QA 4DU4A 2F7TA 1Y64A 4BRFA 1R59O 1J9AA 1CZAN 4OPKA 4LFCK 3TAFA 2HF3A 2Q1NA 3OJSA 1S1XA 2JGUA 1NGHA 4DTJA 3K5NA 1RTJA 3CFOA 4EHUA 1ZBUA 4H8KA 4B1UB 3O08A 3ZSZA 4PL8A 2NRTA 2OTJN 1C0GA 1DLOA 1Q9XA 3GDQA 4DG1A 1GOAA 4NXMK 1S1UA 4JD2A 1IJJA 3HSTB 3ZT2A 3TWHA 2RHKA 4BRPA 3T1HK 5BPMA 4DTXA 4EFHA 3RVCA 5JICA 4B1VA 2I7NA 4W5QA 3ZYYX 1NNEA 3J7AP 3VEVA 3TR8A 4JI5K 1JKHA 1SL1A 5FROA 1S3XA 4BR9A 4B08A 1HJRA 3DRPA 1IKYA 2ZF5O 2R7YA 3LM2A 4CEAA 3G71N 4DR2K 2G8WA 1W7AA 3L2UA 3V9UA 4KHPK 3S9HA 2IVPA 1UWBA 3KD5E 1JLAA 1RBUA 4CBXA 1QQNA 3TAMA 3CD6N 4DR7K 4RG8A 4F8RA 2Q97A 4HCCA 1KVCA 2E2PA 2QA4N 5I42A 1HR0K 3TTFA 4CIGA 4DMNA 4OLBA 4H0TB 4GW6A 1NWKA 5AR0A 3L6QA 3NFAA 4B3TK 2P9UA 4IOAL 4BR7A 5BN8A 2DY4A 1Q81O 5AJ3K 4CEDA 4CHNA 3UIQA 3THVA 2YI1A 4WE1A 1IH7A 3AVHA 3C6HA 1IBKK 3ZEUB 4DV7K 5H1SQ 4DV5K 1X3MA 1UOCA 4B1YB 3AVAA 1QTMA 2RF2A 3VEWA 1VSLA 4DLEA 2HBJA 3JAMO 4FM1A 1LAWA 4JKHA 4WQ5C 3U6FA 3OVNA 4B9NA 3LDQA 3U8XA 5LJVA 3OY9A 3CJ7A 3OTOK 2D0OA 5DMRA 2D4WA 4C8LA 4O55A 3P39A 4FZZA 5GAEP 1MU2A 3KKRA 5SZTA 3THYA 3NMUA 1J5OA 3HBTA 4JLHA 4FLXA 4G9ZA 5F2RA 3WEEA 3V1OA 5M1NA 5JMVA 3P38A 5HRNA 4BRLA 4H5NA 4FJ8A 2PYLA 2UU9K 1WSEA 3VGMA 2EHGA 3D2FA 4LF7K 3MCPA 4YOXA 4O8KA 2VWBA 3MEEA 4M7XA 4XH1A 3F73A 2PZSA 1XWLA 1LOTB 4FLTA 4CZGA 3R8EA 2IVOA 4G1QA 1E4GT 2XO7A 1CLQA 4CK3A 4CGHA 2YHAA 3MWPA 3RRGA 4DSEA 1QSYA 4FLVA 1BIUA 3T1AA 5I9EB 3CERA 1RBRA 3M8SA 4BRDA 2Q3SA 2FLOA 1ILYA 1OVQA 4DTSA 3A5OC 3SQ2A 4OKJA 2D0BA 3CC4N 1SL0A 4YOYA 1WSJA 5M1KA 4H03B 1QHAA 4ZHRA 4JKAA 1P90A 3KZBA 1NOZA 4CZLA 3HVRA 4FJ9A 2O8BA 3F5TA 4BACA 4LH5A 2BANA 4YY3K 3AY9A 1NJWA 1SKSA 3SI6A 2O8FA 4YFUA 4DV0K 2DFHA 1S1VA 1WSGA 1JCEA 2IIRA 4K8XA 4R79A 4E19A 4MO5A 3OYCA 4N41A 1TYQA 3DLEA 2IAJA 4C8KA 3FZMA 4YORA 3K5OA 1Q8IA 2A3ZA 3CJBA 1TK5A 1HNXK 4WF9L 4CCHA 3NF6A 1BQMA 3SPYA 5AQSA 1YVUA 4H5TA 3KWIA 4B9LA 3ATVA 3CYMA 4WFNL 3AVFA 3OYAA 3ZSVA 1J5EK 2V52B 3OYBA 3VQ6A 4CBWA 1YITN 1TKZA 3G10A 4QS7A 2ZE2A 1BU6O 1VAZA 1VQ7N 2P51A 3NH0A 2P9LA 3G6EN 2GWKA 4WYBA 2GTDA 3K5LA 1TAQA 4WFBL 1HNWK 4DV6K 3KK7A 2FF3B 3WT0A 3TAGA 4ISGA 4CJTA 4A59A 1NGEA 1TKXA 3VF2A 3HP9A 4PY5A 1W0HA 4IEIA 1U47A 3FZKA 1BG3A 4F2SA 3S3MA 3ZETA 4A5BA 2OYQA 4OVLA 1NGBA 2RE2A 4IFVA 4W5RA 3KWGA 4LF5K 3E9OA 4DFJA 3ZT1A 3V9SA 3HO1A 2HHVA 4K25A 1VSFA 2P9KA 4DTMA 4WFAL 1KRPA 2YKNA 3CQYA 4FW1A 4CZEA 3D45A 4F9OA 5GADP 3BUZB 3MAQA 4OGCA 3VQ7A 4BR4A 3VPZA 4B1WB 3OYKA 1YTAA 4FZXC 3PSFA 4JKDA 5BN9A 3WNFA 2HHUA 5ELZA 5EOYA 2IC3A 3HM9A 5AQXA 3T69A 2BDPA 3TU5A 3WEEB 1JXBA 1W97L 3CG7A 2ZM6K 4NB4A 3P31A 3QEIA 1TVRA 1ASWA 1NJIO 4OPJA 2QWOA 3D2FB 3ULEA 1IKXA 5AQQA 4HUGA 4JHDB 5BR8K 2LSNA 3CCQN 2GELA 4DSLA 2NRWA 4JK8A 4PQUA 3QIOA 2YJEA 3OYLA 2CH6A 2WFBA 4JRPA 4AM6A 4MLHA 3VENA 3KLFA 1DTQA 2RPIA 1LW2A 3T7ZA 3SUNA 4KI4A 3K2PA 4PHTX 5E84A 1NJYA 3IKMA 2Z1IA 2ASOA 1XQSC 3LM9A 3H08A 3O1BA 4M63C 1RILA 1TL3A 3L0QA 2Z1HA 1BA0A 1Z05A 3VGKA 1U48A 2O8EA 2WBNA 3CM5A 1T44A 3NH1A 1WBDA 2O8FB 4LSLA 1BL3A 3SBGA 4CESA 3TAEA 1O1WA 1D8YA 3BZKA 1TYQB 3O9TA 4JI6K 4XH4A 2NRVA 4BREA 2X6NA 3OBYA 3RMAA 3PX6A 4Z4FA 3V9WA 1HKGA 3QDKA 1ASUA 4YNQA 5IT9O 2GX9A 1RDWX 3EYZA 1WLJA 3DOKA 4B3RK 1W9HA 1OVYA 5FPNA 1VQKN 4FWPA 3M6GA 1DEJA 2P9LB 1KCFA 2GWJA 1MA9B 4Z0UA 3OJUA 3SJJA 3M8RA 1S6PA 5DM7L 3CCEN 5LY3A 4FLZA 4M3UA 3E01A 4O5BA 3HOTA 4CEBA 3HRGA 3LAKA 5KGXA 1REVA 3L3UA 3PSIA 3TAQA 4GV6A 5BRFA 4ZTFA 2HVIA 1N33K 3S41A 3V9XA 1U45A 4JN4A 4BQZA 5AQYA 1X9MA 4A2AA 3ENBA 4BE2A 5M1PA 3U3GA 3K5MA 3ZETB 3H3NO 3OS1A 3UKRA 5GAGP 3SNNA 4Y1CA 4QCLA 3T3FA 4IDHA 3HTVA 2VGMA 3TPQA 3IFRA 1FJGK 1Z25A 2YHWA 1LWEA 3O4NA 5KPTA 1C0FA 5AQIA 1GLEG 4HTUA 1XUPO 4A61A 2UYTA 3GG4A 4HHTA 3O9UA 5BREA 4FVMA 1NGIA 4I6MA 3ULEB 3ID6A 3LPUA 4DSIA 2WUSA 3VQ5A 4O8UA 2F8SA 1JCGA 1YVNA 1L3SA 4FPBA 1CXQA 2QXFA 2QWQA 4M3RA 4LY7A 3CCUN 2V7YA 4DCHA 3EL2A 1K73O 1CZBA 1HYSA 1RDDA 1NKCA 4E1JA 2IVNA 4FJGA 3VQDA 3VESA 4NCGA 1ATRA 1TKTA 3CPEA 1LWFA 4C1NI 2VYPA 4DV3K 3V1QA 4CJPA 2E2OA 3N4QA 4DV1K 5BPLA 5KPRA 2NUBA 4DF8A 4IG3A 3L4QA 1UA0A 3W0LA 3O6WA 5JLFA 1SKWA 3TANA 2P9PA 2FSKA 3ZLJA 1NK8A 2O8EB 3IRXA 4Y1DA 4CJWA 2Y1JA 3TARA 5AQVA 5J2PA 1LW0A 5AQFA 4DF4A 4DUYK 5C2DA 3HXMA 1R0AA 4E0DA 1BIZA 3VEOA 3K57A 3HJFA 1NBWA 1C1AA 4BR0A 3MN9A 5DK5A 1QQOA 3MN5A 5C25A 1VQPN 4Z4EA 3I55N 3HP6A 1HKCA 3CXCM 3U4LA 4B3OA 4CZMA 1JLCA 3C94A 2Z1JA 3LALA 2OZSA 2Q31A 4ID5A 2XY8A 2EWSA 1YI2N 4MO4A 1VQON 1JLEA 4FWQA 3VEXA 4X65K 2O8CA 1FKOA 4PUOA 3CC2N 1S1WA 3LDSA 2FBXA 4BDYA 4RCHA 3DXMA 2P9SA 4LF8K 3ITHA 5AQRA 3OYHA 1E4FT 4N56A 2W6LA 1VSIA 3KLEA 3C7NA 5KRTA 4CJKA 5AQGA 3ASMA 1WUAA 1GLCG 4OX9K 5HP1A 3CCVN 1NK9A 1T6CA 3AAQA 1RDCA 2A5XA 1RT1A 3ZSWA 4CF9A 3SK3A 1GLAG 2HNDA 3R6MA 3ATUA 3OYJA 3T19A 5C42A 3UKRB 2KZMA 1DT9A 1NMNA 4AH9A 3KLGA 1VQ6N 1NGDA 3O5BA 4JRQA 2ITGA 4DFKA 1EWQA 1KC8O 5AQUA 3VQ8A 1NGGA 4CJQA 2QXLA 3A5MC 2HSTA 3DMJA 4BC3A 4ELUA 1ESVA 1KAZA 4IXCA 4KHYA 1IG8A 1X1PA 4CGGA 4GKKK 3GE1A 4FW2A 4BROA 1NK6A 3QFPA 4GV3A 4O0JA 3WXKA 4FWOA 4I2PA 3JYTA 4I6MB 4XIUA 3O9RA 3NVMA 2HB5A 2FBVA 2FBYA 3DM2A 4DR6K 3CMEN 3B6PA 2Q36A 3CCLN 1Q9YA 3LDPA 3R1XA 5HRRA 5TKWA 1N6QA 4CF8A 2GBZA 3HYFA 2YHBA 3AVGA 3I56N 4BDPA 3DYAA 4CZFA 1U04A 4OKKA 4K41A 3L4IA 1WSIA 4FCYA 4K8ZA 1VRTA 1G15A 2XRIA 4NYFA 1MWMA 2W40A 3ZT4A 3VQCA 3G4SN 2P9PB 2KHOA 1WOQA 4KB1A 4LH4A 1L3TA 3QNOA 4M3TA 4IDKA 4FJ7A 1XC9A 3IUCA 2OZMA 4BR5A 2E6MA 2OPSA 4I7FA 3V1RA 1NKBA 3AGKA 3AA2A 4FLWA 3SQ1A 4JKFA 4CD3A 1ATNA 2ZJRL 1VQ9N 5CZ2A 3QERA 2DFFA 1RTIA 3MN6A 1Z6RA 4CJSA 2FSJA 4DQSA 2BTFA 2QKBA 1ASVA 4EZ9A 5C12A 4BGAA 3QLHA 5AQHA 1KSPA 3EY1A 4YOTA 4WQ4C 2O8CB 4FOIA 3CJ1A 3QEVA 1TK8A 1GLDG 3MWTA 4BRCA 4KHSA 5EU7A 4CIFA 2HOEA 2GEMA 4W5NA 3L2VA 3CETA 1XHZA 3B8AX 4CJ7A 1YIJN 1LAVA 3AV9A 4IOXA 1SUQA 1K8KA 3AARA 4LD0A 1S72N 1BOTO 4AILC 1TAUA 3DLHA 4ELTA 4BRIA 3NGYA 3C65A 3VF4A 4DLGA 2D1KA 4H5WA 3WQTA 4IO9L 3ZX2A 5HRPA 4DSFA 5EX5A 4DSJA 1HX1A 3WNHA 1BGXT 3KKSA 1I39A 4E1NA 1VSHA 1B9DA 2D0AA 5I3UA 3NCIA 4U7BA 3VMFB 4FJIA 4E7IA 4IFEA 2HNZA 5AQZA 2D0CA 4KTZA 3ZT3A 4DSKA 3DRRA 4J2BA 1ZXOA 2F9TA 1NM1A 1VSJA 3K9JA 1YHQN 3AO5A 3RTVA 4B9TA 4CF1A 1QE1A 3PX0A 4FPAA 1HLUA 3F9MA 2ZD1A 4JD2B 2OPQA 2E2QA 2NRHA 2G8FA 1RNHA 3RR8A 3OS2A 2WC9A 3MDQA 2KLAA 3WUHA 4KI6A 4JKBA 4CHOA 3VQPA 4M42A 4W5OA 4FO0A 4CK2A 1S1TA 2AP1A 2D0PA 3BGRA 3MMVA 1HQEA 2X6SA 3EO3A 3M8PA 3ENOA 4CW7B 2Q0RA 4DTOA 1YJNN 1OH6A 3GL1A 3A5LC 3BZCA 4IOCL 4U67L 2HMIA 5AZJA 2AJQA 4JNEA 2WOMA 4JKEA 2J4RA 3FZLA 1WAJA 3P83D 4H5VA 4KRFA 4OGEA 4R5PA 3UE5A 4MFBA 5C0YA 1IBMK 2E5LK 2A42A 5HL7L 2Y1IA 2P9UB 2YNIA 4CZKA 1U4BA 5AQTA 3E9LA 1N5YA 1RDUA 5M1QA 4DKWA 3VA3A 4QS9A 4NCAA 1TUYA 4CZHA 1X9SA 4B1ZA 3M3ZA 3MXMA 2FBTA 4AHTA 2KKZA 3WQUA 2QEXN 2I5JA 2X78A 3U3YA 3Q7BA 3G0ZA 4C8MA 3J80O 3L2WA 2UXCK 1JCFA 3M5RA 3DWLA 4IJNA 3ZSXA 4KBOA 3E1YA 2VQEK 4KV8A 4M3XA 2JLEA 4ISEA 4I2QA 4CHQA 2Q0UA 3TSPA 2P1JA 2VWKA 3O9SA 4M7YA 2HBKA 2ASPA 4AHUA 1QSSA 1U49A 4LC9B 4Y0WA 3QINA 4BC5A 3THYB 1XMOK 3M8QA 1NK5A 1ITGA 2W42A 4F4KA 2E6LA 3S3NA 4ICLA 1A5WA 1EETA 3AVKA 1VSEA 2QWRA 1BDGA 4OJRA 1NJZA 3KK1A 3DXKA 3EN9A 5IWAK 1JLBA 3AO1A 3KJVA 3NHGA 4BWJA 3RSEA 1Q7YO 1EKEA 1Y97A 3M1FA 1F21A 1T3VA 5F0XA 1NKEA 3DLRA 2QI2A 2ZQBA 1HQUA 1RTHA 4M3WA 3SUOA 2Q2RA 1GLJO 4DQIA 1JJ2M 1WN7A 3CJAA 1HUXA 4I9LA 3O9QA 4B3MK 4FK2A 5AQWA 5FRMA 2GV9A 1JLFA 5FLXO 5KGWA 3TABA 1W2BM 1QSLA 4ILGB 4NXNK 3ZSQA 4WCEL 3U9ZA 4E1MA 1BCMA 3KK3A 3QMLA 4CI6A 4H0VB 4B8CA 4FJMA 3L2QA 1RBVA 3V81A 2V51B 1M90O 3A5NC 2O8BB 5AQMA 4KFBA 4LF6K 3SYZA 1O13A 2YV0X 3VTHA 1T05A 4FWMA 4BRNA 3B6OA 5JS2A 5ADXA 4JI1K 1NU0A 4QS8A 4F3TA 5FPEA 4JKGA 2W41A 2VCPA 2WTUA 1C1CA 3AVLA 2B4JA 3J7ZO 3SZ2A 3QESA 2UXBK 1BA1A 4Z4HA 5AZJB 3RMDA 1HNZK 1T7PA 2PY5A 4UQGA 2CH5A 1I94K 4N47A 3D6RA 4BRGA 5FPDA 3OYDA 5AQPA 1KD1O 4H0XB 3ZSRA 4DFMA 1N8RO 1BHLA 3E66A 4FLYA 1I3AA 4A2BA 5CHIA 3QEWA 1RT4A 4H0OA 2P9IA 3ZSYA 1X3NA 3VF6A 4DTPA 5J2QA 3HI0A 4CGFA 2VG7A 3KTQA 4KREA 2B6AA 3IDHA 4LF9K 1RCHA 1VRUA 4NLBA 2P9KB 1HPMA 2VWJA 3MEDA 4E7LA 4NLCA 4B9VA 1YAGA 2A1RA 4X66K 3ULDA 4BY9C 4RTFD 3CI5A 2BH1A 4CGDA 3OYGA 4FK4A 3AVBA 2Z1GA 4HUEA 3SCXA 4L8RB 3AVCA 2ZJPL 4HVJA 4RW6A 3ISNC 4RW4A 3OS0A 4AF1A 1NK0A 1SQKA 1BUPA 3VQ4A 3A2FA 3ID8A 1ATSA 1QZ5A 2P9NA 3HOSA 4MDAA 1YT3A 1LCUA 1Z26A 3LANA 1C0TA 4IFYA 3DLKA 3HT3A 5BRDA 1T8EA 3D2EA 1VQ4N 3LDOA 3JSMA 1QHTA 3OBWA 2QWLA 2WONA 3LPTA 3ENHA 1S9GA 4OO1J 1HYZA 2BGGA 4NCBA 3GOIA 3BF3A 1BI4A 2QWPA 3RMBA 1SS6A 3H1QA 3LP1A 2HF4A 4Z94A 4JKCA 3AVJA 2HNYA 1WSFA 1WB9A 1OKJA 4JI0K 3CC7N 2NNWA 2YNHA 2YNGA 3WXIA 1H1VA 4CJ3A 4F3OA 4RW8A 5CYMA 4X62K 4AHVA 3AVIA 3A8YA 4M41A 1KFSA 4IKFA 4CJLA 4CEQA 4IZ9A 5J2MA 2HHHK 4OKEA 5AZIA 5CY4A 3HM8A 4E7KA 1XHXA 3TTDA 3LDNA 4DQQA 1XNRK 3VOVA 1DTTA 1TV6A 3C95A 5LMUK 1K8AO 1TGOA 4JKGB 4FYDA 1NGFA 4DS5A 4LSNA 1C0UA 3RRHA 1VSMA 2YKMA 3CM6A 3MX5A 3QNNA 1YJ9N 1NK7A 3CHWA 2HHSA 4DU3A 4KH6A 5M1OA 4KHWA 2KZZA 3SAHA 4CVNE 2XHBA 2FXUA 4BC2A 1RDAA 3CCMN 5HROA 3R3LA 5J2NA 2VQFK 1ZBIA 4CEEA 4BG9A 3OYMA 3THXA 2FF6A 4GY2B 2ATQA 4CHZA 1S22A 4KTQA 4FM2A 3C6AA 5AQKA 4DQ8A 3CQ8A 3FFIA 4Z4CA 3NF7A 3KHYA 1N32K 3EEQA 3SAFA 3CJ9A 1VQ8N 1JXEA 2F9WA 3VQAA 3DRSA 4FSVA 5HLFA 2GUPA 4DB3A 4CJRA 1YUWA 3N4PA 4GVEA 1RT3A 4PKHA 5C15A 2XY5A 4CBUA 3H45C 5LJWA 4CJEA 1VHXA 1NGJA 5AFUA 4Z4IA 4DUZK 1NGAA 4WQ4A 4FJNA 1M1KO 2BE2A 2FC0A 3VEZA 5DM6L 4J8FA 3CPWM 3AGRA 4K42A 3PV8A 4UY8O 4IG0A 1KXPA 3OYEA 1WBBA 4M3ZA 4DQRA 5CE3A 4CF2A 3WNEA 1XMQK 3G25A 4YDUC 1B92A 2HMPA 3K59A 1EXQA 4BRQA 1N36K 1LWCA 2HBLA 4FWRA 2O4IA 3IAYA 4FJJA 4B1XB 5JVHL 2P9NB 3LAMA 3QEPA 3SPZA 4EP5A 4OPAA 5E41A 3D0PA 1D5AA 4F2RA 1RT2A 4FL9A 3D2EB 2YHXA 3HL8A 4CJ5A 5BRHA 4JI2K 1DKGD 1VQ5N 3DAWA 3MK6A 1BQNA 3NF8A 1ZYQA 5KPZA 2KFNA 1MWKA 1KQSM 3NE6A 4KH5A 3PO4A 1BI4B 1ZBSA 3Q7CA 2OCEA 2PYJA 2YNFA 2NLXA 1OH5A 3C6TA 4CF0A 4EIAA 3PIOL 3OYNA 4JK9A 2HW3A 1EP4A 1MDUB 5GIPA 1TL1A 5GINA 1DGKN 1RGIA 4FJLA 4E7JA 1T6DA 1D9FA 4KH4A 5C24A 4KAZA 1KVAA 1TUUA 4CFAA 1KVBA 2HBMA 4BRMA 4CECA 5AZIB 3ALYA 4RWTA 3EZWA 1QZ6A 3QB0A 2G8IA 5KI6A 1HYVA 1XNQK 1ZBFA 3F2KA 4E7HA 4FJXA 4A5AA 2DTUA 1SKRA 1G99A 3DI6A 2F8TA 2DPNA 4IWVA 3LWMA 1OH7A 2UUBK 5EXWA 4JAXA 1NLVA 5J1EA 3QBWA 3H1VX 1IG9A 1VK0A 3JS6A 3THXB 4BE1A 2QKKA 4ILJA 4KO0A 3W3DA 3V9ZA 3TSQA 3DXMB 2P9SB 5JS1A 2A1SA 5CR4A 4GV9A 4PL7A 4DV2K 1J53A 3C7NB 2F96A 1IO2A 4AQYK 4FWNA 2KFZA 2IDOA 1S5JA 2XY7A 1OH8A 5LL6Z 3HPOA 2NRRA 1KAYA 4CERA 4MLEA 4JI4K 3VETA 1X9WA 1V4TA 5KRSA 4JS5A 2QK9A 4ZTJA 1Q86O 5JVGL 1TKDA 5FPMA 4FLUA 1HNVA 5ADXH 4EP4A 3TI0A 2RKIA 3HSCA 3LZIA 4Q5VA 1EQYA 3H6EA 2UUAK 4DTRA 4BRHA 3NGZA 4JHDA 4FOEA 3H3OB 3P1GA 1V4SA 1E3MA 1RFQA 1U6ZA 1L5UA 1JLQA 2GUIA 4C1NK 4BWMA 3LWLA 4BGBA 4B9SA 4JK7A 1NGCA 3E9PA 2NRZA 4PKIA 1TK0A 4DHYA 4BRAA 4J2AA 2B5JA 1BISA 1FW6A 2KTQA 2QW9A 2O4GA 2PBDA 3WXLA 5MLCQ 3SUQA 3NH2A 4JV5K 4FJ5A 2ITMA 4ISFA 3S3OA 3DLLL 5AQLA 4DS4A 3SJHA 3LP0A 3NDKA 2IS3A 3VQBA 3EKSA 4A57A 4CFCA 3T1YK 4JI8K 4I9QA 4CFBA 3VEYA 2ASMA 1J54A 2F4VK 2CGLA 2V7ZA 3MXIA 4RW7A 4OLAA 3C6UA 1RDBA 3CCSN 2UUCK 3MEGA 5KQDA 5GIOA 1VQMN 3J81O 3PY8A 3ZX3A 5KTQA 3MN7A 2CGJA 2FSNA 4GNIA 3AVNA 3HPHA 5FRNA 1B9FA 2O8DA 3RWUA 4GVMA 1KLMA 4OPHA 1XC3A 4PA1A 2HVHA 3CIPA 1LV5A 2OANA 4BVOA 1L3VA 3GBTA 4ID1A 4B9MA 3PLAA 4FM0A 4EZ6A 3FFKB 3AA3A 4H0PA 3EE8A 4BDZA 1FK9A 4H5RA 3WNGA 3SV3A 4O0IA 4KB0A 1NJXA 2NRXA 3EZ5A 4KHNA 3PX4A 3ZCMA 2W6KA 3SMSA 1SAZA 5C10A 4CJFA 4CD1A 3THWA 4NO7A 1ZC6A 3V4IA 1U2VA 3NF9A 1GOBA 3IS9A 1QVGM 2IOCA 4K43A 2VG6A 2HHTA 2E1YA 3QEXA 3OA9A 2YHYA 1IKVA 4FK0A 4X64K 4FWKA 3OHRA 3K58A 1K8KB 1UAXA 4M45A 5AQOA 1C1BA 2AA4A 3KD1E 5TKYA 4NYNA 1JL1A 1QQCA 1X9JA 2VG5A 4C23A 4DR3K 1RT5A 4MDBA 2UXDK 1HMVA 4HWIA 3BY5A 3BF1A 4TSXA 1WAFA 5BPNA 1NG9A 4DWIA 3O3FA 1Q82O 3VERA 5GAHP 5KQ8A 1C0MA 3HK2A 4DU1A 1WSHA 2PFUA 1A5XA 4H4MA 4H4OA 3UB5A 3PIPL 4HUFA 3O3GA 3O1WA 3O3HA 3BP8A 3LL3A 4CFDA 3F9KA 4AHSA 3SQ4A 3FZHA 2JWLA 4ELVA 3QIPA 3VQQA 3PO5A 3O80A 4FJHA 1C6VA 5E26A 3O4QA 2YCHA 3FGUA 4PWDA 4B3SK 4A62A 4IEEA 1RT6A
chains in the Genus database with same CATH topology
2YNGA 3AVGA 3HPGA 4CJ3A 4K8XA 1BCOA 4E19A 4F3OA 4BDPA 3L3VA 3OYCA 4N41A 3DYAA 4RW8A 5CYMA 2RN2A 3DLEA 1U04A 2IAJA 4OKKA 3AVIA 4AHVA 4C8KA 4M41A 3AO2A 1KFSA 3DLBA 3K5OA 1Q8IA 1TK5A 4IKFA 1WSIA 4CJLA 4CEQA 4FCYA 4K8ZA 4CCHA 2OA8A 3NF6A 1VRTA 1G15A 1BQMA 2XRIA 3SPYA 4NYFA 1YVUA 5J2MA 1ZBLA 5K14A 4OKEA 1WNSA 4B9LA 3ZT4A 3VQCA 2DFEA 5CY4A 4CJUA 3CYMA 1KFDA 4JS4A 1XHXA 4E7KA 4DFPA 3AO4A 3AVFA 2D5RA 3OYAA 1DTTA 1TV6A 3C95A 4DQQA 1D9DA 3ZSVA 3HVTA 4O4GA 3OYBA 3VQ6A 1TGOA 1TKZA 3G10A 2G8UA 2ZE2A 4DS5A 2ETJA 2KQ2A 1C0UA 4LSNA 1VSMA 4E89A 3RRHA 1KLNA 4KB1A 2YKMA 4LH4A 3CM6A 1NK7A 3QNOA 3QNNA 1L3TA 1JL2A 2P51A 5HBMA 3NH0A 4M3TA 2HHSA 3QO9A 4DU3A 4IDKA 4C8OA 4RW9A 4FJ7A 1XC9A 2OZMA 3K5LA 2E6MA 2OPSA 4I7FA 3V1RA 1TAQA 4KHWA 1NKBA 2KZZA 3AA2A 4FLWA 3CFPA 3LZJA 2XHBA 3SQ1A 5HROA 1RDAA 5J2NA 1VSDA 1ZBIA 1IKWA 5CZ2A 4CEEA 3OYMA 3QERA 2DFFA 1RTIA 3TAGA 1NOYA 3RMCA 2ATQA 5CYQA 4CJSA 4CHZA 4CJTA 4KTQA 1TKXA 4FM2A 4DQSA 3HP9A 3CQ8A 3FFIA 4Z4CA 1W0HA 2QKBA 3NF7A 4PY5A 1ASVA 4EZ9A 2XY6A 1U47A 3QLHA 1KSPA 4F2SA 3EY1A 3S3MA 3BDPA 4MQ3A 1T03A 1JXEA 4KKOA 1RBSA 2P5OA 2OYQA 4OVLA 3VQAA 3DRSA 4E3SA 4IFVA 4W5RA 3QEVA 1TK8A 4DFJA 3ZT1A 3V9SA 5HLFA 3HO1A 4KHSA 5EU7A 2HHVA 1VSFA 4CIFA 4DTMA 4AHCA 4CJRA 2HHWA 4W5NA 3L2VA 1XHZA 1KRPA 1RT3A 1S9EA 2YKNA 2XY5A 4CHYA 4FW1A 3D45A 1LAVA 3AV9A 4CJEA 3MAQA 2P5GA 1SUQA 4OGCA 3VQ7A 4Z4IA 4O44A 4LD0A 4FJKA 4FJNA 3OYKA 1YTAA 4FZXC 2BE2A 4IBNA 3WNFA 2FC0A 4AILC 3DLHA 3MECA 4ELTA 2HHUA 1TAUA 3NGYA 4DLGA 1XI1A 2IC3A 3HM9A 3PV8A 2BDPA 5HRPA 4DSFA 3L8BA 4IG0A 1CXUA 4AHRA 4CIEA 4DTNA 4DSJA 1JXBA 3OYEA 1ZBHA 3WNHA 4DTUA 4M3ZA 4DQRA 1BGXT 3CG7A 4FXDA 3KKSA 3WNEA 1I39A 4E1NA 4CF2A 3QEIA 1B92A 1TVRA 5D3GA 1ASWA 1VSHA 1B9DA 2D0AA 3KIOA 2G8KA 4OPJA 3K59A 4KHQA 1EXQA 3QETA 5I3UA 3NCIA 1IKXA 3VN5A 1LWCA 4FJIA 2O4IA 4E7IA 2E4LA 4HUGA 1L3UA 3IAYA 3VA0A 4FJJA 2KW4A 4QOZB 2LSNA 4DSLA 3LAMA 3QEPA 3SPZA 2HNZA 3QIOA 1S6QA 3SV4A 1NK4A 4J2EA 2D0CA 4KTZA 4PQUA 3ZT3A 4DSKA 3DRRA 1HRHA 4EP5A 3NAEA 4J2BA 4CHPA 4W5TA 3OYLA 1VSJA 3AA5X 4JRPA 5E41A 2OPRA 1DTQA 5T7BA 3KLFA 2RPIA 3MXJA 3AO5A 1LW2A 1D5AA 3D0PA 4F2RA 1RT2A 2IGIA 3RTVA 4B9TA 4CF1A 3SUNA 4KI4A 3HL8A 3K2PA 1QE1A 4CJ5A 3AA4A 3V6DA 3PX0A 2ZD1A 3I0SA 1NJYA 2OPQA 2Z1IA 4C8NA 3H08A 2G8FA 1RILA 1RNHA 1BQNA 3RR8A 3NF8A 1HPZA 3OS2A 1TL3A 1RT7A 1ZYQA 2G8VA 4CJ4A 3LP3A 2KFNA 2Z1HA 4KPYA 4KI6A 4CHOA 4M42A 3VQPA 3NE6A 4QAGA 3PO4A 1U48A 4W5OA 1BI4B 4CK2A 3KK2A 2PYJA 1UA1A 1S1TA 3CM5A 2HHXA 3NH1A 3BGRA 2YNFA 1HQEA 1K6YA 2X6SA 4CEOA 3M8PA 4LSLA 1BL3A 1FKPA 3C6TA 4GMJB 1RT6A 4CF0A 4CE9A 4CESA 1O1WA 3OYNA 3TAEA 1D8YA 4DTOA 4CEZA 2HW3A 1EP4A 4BE0A 3I8DA 4M3YA 1TL1A 3KLIA 4FZYA 1QS4A 2HMIA 3I0RA 1KTQA 4FJLA 4E7JA 1D9FA 2AJQA 1EX4A 2X6NA 4KAZA 2OPPA 5C24A 1KVAA 3SUPA 2WOMA 3RMAA 3SQ0A 3AO3A 3PX6A 4CFAA 4CGIA 4Z4FA 3V9WA 1SL2A 1WAJA 3P83D 4KRFA 1KVBA 1ASUA 4CECA 4CEFA 4YNQA 4OGEA 2HHQA 4R5PA 1GOCA 3ALYA 4MFBA 4KTWA 4DQPA 5SWMA 2Y1IA 5KI6A 2G8IA 3EYZA 1HYVA 1WLJA 1ZBFA 1RBTA 2YNIA 3OYIA 4E7HA 3DOKA 4CK1A 1U4BA 4FJXA 1N5YA 2DTUA 1SKRA 1W9HA 3VA3A 1CZ9A 4Z4GA 4NCAA 3DI6A 2X74A 2F8TA 3TAPA 1X9SA 1KCFA 3OYFA 1JLGA 1HNIA 3LWMA 4Z0UA 3OJUA 3SJJA 3MXMA 2FBTA 1RTDA 3M8RA 1A5VA 1S6PA 4AHTA 5J1EA 4FLZA 4M3UA 3NGIA 3RR7A 1IG9A 4CGJA 2I5JA 3ZT0A 2X78A 3E01A 1VK0A 4O5BA 3G0ZA 4C8MA 4CEBA 3L2WA 3U3YA 4B8AB 1YTUA 2G8HA 3LAKA 4BE1A 2QKKA 5KGXA 3PUFA 3ZSXA 3DOLA 1REVA 4KV8A 4KO0A 3V9ZA 3DLGA 4M3XA 2JLEA 3L3UA 4I2QA 4CHQA 3TAQA 4ZTFA 2HVIA 2A1SA 3L2RA 3V9XA 1U45A 5JS1A 5CZ1A 3AVMA 4Q0BA 2P1JA 1X9MA 2VWKA 1J53A 4HCBA 2F96A 1IO2A 3VQ9A 4BE2A 4AHUA 1QSSA 3U3GA 2KFZA 3K5MA 1U49A 3QINA 3M8QA 4N5SA 3OS1A 1NK5A 2IDOA 1S5JA 3ZSOA 1ITGA 1VSKA 3KLHA 5HRSA 2W42A 1FXXA 2E6LA 4CJVA 2XY7A 3S3NA 4F4KA 4KHUA 3SNNA 4ICLA 4Y1CA 3VQEA 3HPOA 1A5WA 4CERA 4FYDA 1EETA 3AVKA 1SV5A 4QCLA 3T3FA 1VSEA 1X9WA 4B9UA 5KRSA 3P5JA 3IG1A 3LP2A 4OJRA 4JS5A 1NJZA 1T05A 3KK1A 2QK9A 4ZTJA 1TKDA 1JLBA 4J2DA 4N76A 3AO1A 3KJVA 1Z25A 3NBPA 4BWJA 3NHGA 2EX3A 4FLUA 1HNVA 1EKEA 1Y97A 1F21A 3CFRA 1LWEA 5FDLA 4EP4A 1NKEA 3DLRA 3O4NA 3TI0A 2RKIA 2ZQBA 1HQUA 4DU4A 1RTHA 4Q5VA 3LZIA 3SUOA 4M3WA 4DTRA 3NGZA 4DQIA 4HTUA 1J9AA 1WN7A 3P1GA 4OPKA 3TAFA 4I9LA 4HHTA 4FVMA 1L5UA 1JLQA 1S1XA 2GUIA 3OJSA 4FK2A 2JGUA 4BWMA 4DTJA 3LWLA 3K5NA 1RTJA 3CFOA 1ZBUA 4H8KA 4B9SA 5FRMA 2GV9A 3LPUA 3ZSZA 4DSIA 1JLFA 3VQ5A 2F8SA 1DLOA 5KGWA 1L3SA 3TABA 4DG1A 1Q9XA 1GOAA 1QSLA 3ZSQA 1CXQA 1TK0A 4J2AA 1S1UA 2QXFA 4E1MA 1BCMA 2B5JA 3KK3A 3HSTB 4LY7A 4M3RA 3ZT2A 1BISA 3TWHA 2KTQA 4DTXA 4B8CA 2O4GA 4FJMA 3L2QA 1CZBA 1RBVA 1RDDA 3V81A 1NKCA 1HYSA 4FJGA 4KFBA 3VQDA 3SUQA 3NH2A 4W5QA 4NCGA 4FJ5A 3S3OA 3SYZA 4DS4A 1TKTA 2YV0X 1LWFA 3TR8A 3LP0A 1JKHA 3V1QA 3NDKA 5FROA 4CJPA 1SL1A 3B6OA 4B08A 1HJRA 2IS3A 5JS2A 3DRPA 1IKYA 3VQBA 2R7YA 2G8WA 4CEAA 2NUBA 3L2UA 4DF8A 3V9UA 4IG3A 1UA0A 3S9HA 4CFCA 1SKWA 3TANA 1UWBA 4CFBA 3KD5E 4I9QA 1JLAA 1RBUA 1J54A 1NK8A 3IRXA 3MXIA 3TAMA 4F3TA 4Y1DA 4RW7A 4CJWA 4OLAA 4RG8A 2Y1JA 4F8RA 3C6UA 3TARA 5J2PA 1LW0A 4HCCA 1KVCA 1RDBA 4DF4A 1C1CA 3AVLA 2B4JA 3MEGA 3HXMA 1R0AA 5I42A 3SZ2A 3QESA 4E0DA 1BIZA 3K57A 3HJFA 4CIGA 4DMNA 4OLBA 4Z4HA 1C1AA 4GW6A 5KTQA 3PY8A 5DK5A 3NFAA 5C25A 3THVA 4Z4EA 3AVNA 3HP6A 3HPHA 5FRNA 1B9FA 3RMDA 2DY4A 1T7PA 2PY5A 3RWUA 4UQGA 4GVMA 4N47A 1KLMA 4B3OA 4PA1A 2HVHA 4CEDA 1LV5A 4CHNA 3OYDA 1L3VA 3UIQA 3ZSRA 1JLCA 3C94A 4ID1A 4WE1A 4DFMA 2Z1JA 1BHLA 1IH7A 3LALA 4FLYA 2OZSA 3AVHA 4B9MA 1I3AA 4ID5A 2XY8A 4FM0A 4EZ6A 3QEWA 3AA3A 1RT4A 1JLEA 3ZSYA 1UOCA 4BDZA 3AVAA 1QTMA 1FK9A 1FKOA 2RF2A 3WNGA 4DTPA 3SV3A 4O0IA 4KB0A 4PUOA 1VSLA 4DLEA 1S1WA 5J2QA 4CGFA 3LDSA 4FM1A 2FBXA 1LAWA 3EZ5A 4BDYA 3U6FA 3OVNA 3PX4A 1NJXA 4B9NA 4KHNA 3ZCMA 2VG7A 3ITHA 3OY9A 3KTQA 3OYHA 4N56A 5DMRA 4C8LA 4CJFA 1VSIA 4O55A 3KLEA 4KREA 2B6AA 5KRTA 4FZZA 1MU2A 4CJKA 3V4IA 3KKRA 3ASMA 5SZTA 1RCHA 3NF9A 1GOBA 1VRUA 3IS9A 2IOCA 5HP1A 2VWJA 2VG6A 1NK9A 1J5OA 3QEXA 4JLHA 2HHTA 3MEDA 4FLXA 4E7LA 1IKVA 4B9VA 4FK0A 1RDCA 1RT1A 3V1OA 2A1RA 3ULDA 3ZSWA 4CF9A 5HRNA 3K58A 1UAXA 4M45A 4FJ8A 1C1BA 2HNDA 2PYLA 3KD1E 1WSEA 4CGDA 2EHGA 3OYGA 3OYJA 4FK4A 4NYNA 3AVBA 3T19A 2Z1GA 1JL1A 1QQCA 5C42A 4HUEA 3SCXA 4L8RB 2VG5A 3AVCA 2KZMA 4HVJA 3MEEA 3F73A 4RW6A 4AH9A 3ISNC 1RT5A 3KLGA 2PZSA 1XWLA 4RW4A 3OS0A 4FLTA 1NK0A 4JRQA 3VQ4A 2ITGA 4DFKA 3A2FA 4G1QA 1HMVA 3VQ8A 2XO7A 4CJQA 1CLQA 1YT3A 4CK3A 4CGHA 2YHAA 3RRGA 3DMJA 4DSEA 1Z26A 3LANA 1C0TA 4ELUA 4KHYA 1QSYA 4IFYA 1X1PA 3DLKA 3HT3A 4FLVA 4CGGA 1BIUA 3T1AA 4TSXA 1WAFA 4FW2A 1RBRA 4DWIA 3O3FA 3M8SA 1NK6A 2Q3SA 1T8EA 1C0MA 3HK2A 4O0JA 1WSHA 4DU1A 4H4MA 1A5XA 4H4OA 3JSMA 4I2PA 3JYTA 4HUFA 4DTSA 3SQ2A 1QHTA 4OKJA 2D0BA 1SL0A 2WONA 3LPTA 3O3GA 1WSJA 3O3HA 4XIUA 3SQ4A 4CFDA 3F9KA 4AHSA 2HB5A 2FBVA 1S9GA 2FBYA 3DM2A 4ZHRA 4ELVA 3QIPA 1HYZA 3VQQA 3PO5A 4FJHA 2BGGA 1NOZA 1C6VA 4NCBA 3B6PA 3HVRA 4FJ9A 3O4QA 1BI4A 3RMBA 4BACA 3LP1A 4PWDA 1Q9YA 5HRRA 4LH5A 2BANA 1NJWA 3AVJA 2HNYA 1WSFA 1SKSA 1N6QA 3SI6A 4CF8A 2GBZA 3HYFA 4YFUA 2DFHA 1S1VA 2YHBA 1WSGA 2YNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YNG A;  3AVG A;  3HPG A;  4CJ3 A;  4K8X A;  1BCO A;  4E19 A;  4F3O A;  4BDP A;  3L3V A;  3OYC A;  4N41 A;  3DYA A;  4RW8 A;  5CYM A;  2RN2 A;  3DLE A;  1U04 A;  2IAJ A;  4OKK A;  3AVI A;  4AHV A;  4C8K A;  4M41 A;  3AO2 A;  1KFS A;  3DLB A;  3K5O A;  1Q8I A;  1TK5 A;  4IKF A;  1WSI A;  4CJL A;  4CEQ A;  4FCY A;  4K8Z A;  4CCH A;  2OA8 A;  3NF6 A;  1VRT A;  1G15 A;  1BQM A;  2XRI A;  3SPY A;  4NYF A;  1YVU A;  5J2M A;  1ZBL A;  5K14 A;  4OKE A;  1WNS A;  4B9L A;  3ZT4 A;  3VQC A;  2DFE A;  5CY4 A;  4CJU A;  3CYM A;  1KFD A;  4JS4 A;  1XHX A;  4E7K A;  4DFP A;  3AO4 A;  3AVF A;  2D5R A;  3OYA A;  1DTT A;  1TV6 A;  3C95 A;  4DQQ A;  1D9D A;  3ZSV A;  3HVT A;  4O4G A;  3OYB A;  3VQ6 A;  1TGO A;  1TKZ A;  3G10 A;  2G8U A;  2ZE2 A;  4DS5 A;  2ETJ A;  2KQ2 A;  1C0U A;  4LSN A;  1VSM A;  4E89 A;  3RRH A;  1KLN A;  4KB1 A;  2YKM A;  4LH4 A;  3CM6 A;  1NK7 A;  3QNO A;  3QNN A;  1L3T A;  1JL2 A;  2P51 A;  5HBM A;  3NH0 A;  4M3T A;  2HHS A;  3QO9 A;  4DU3 A;  4IDK A;  4C8O A;  4RW9 A;  4FJ7 A;  1XC9 A;  2OZM A;  3K5L A;  2E6M A;  2OPS A;  4I7F A;  3V1R A;  1TAQ A;  4KHW A;  1NKB A;  2KZZ A;  3AA2 A;  4FLW A;  3CFP A;  3LZJ A;  2XHB A;  3SQ1 A;  5HRO A;  1RDA A;  5J2N A;  1VSD A;  1ZBI A;  1IKW A;  5CZ2 A;  4CEE A;  3OYM A;  3QER A;  2DFF A;  1RTI A;  3TAG A;  1NOY A;  3RMC A;  2ATQ A;  5CYQ A;  4CJS A;  4CHZ A;  4CJT A;  4KTQ A;  1TKX A;  4FM2 A;  4DQS A;  3HP9 A;  3CQ8 A;  3FFI A;  4Z4C A;  1W0H A;  2QKB A;  3NF7 A;  4PY5 A;  1ASV A;  4EZ9 A;  2XY6 A;  1U47 A;  3QLH A;  1KSP A;  4F2S A;  3EY1 A;  3S3M A;  3BDP A;  4MQ3 A;  1T03 A;  1JXE A;  4KKO A;  1RBS A;  2P5O A;  2OYQ A;  4OVL A;  3VQA A;  3DRS A;  4E3S A;  4IFV A;  4W5R A;  3QEV A;  1TK8 A;  4DFJ A;  3ZT1 A;  3V9S A;  5HLF A;  3HO1 A;  4KHS A;  5EU7 A;  2HHV A;  1VSF A;  4CIF A;  4DTM A;  4AHC A;  4CJR A;  2HHW A;  4W5N A;  3L2V A;  1XHZ A;  1KRP A;  1RT3 A;  1S9E A;  2YKN A;  2XY5 A;  4CHY A;  4FW1 A;  3D45 A;  1LAV A;  3AV9 A;  4CJE A;  3MAQ A;  2P5G A;  1SUQ A;  4OGC A;  3VQ7 A;  4Z4I A;  4O44 A;  4LD0 A;  4FJK A;  4FJN A;  3OYK A;  1YTA A;  4FZX C;  2BE2 A;  4IBN A;  3WNF A;  2FC0 A;  4AIL C;  3DLH A;  3MEC A;  4ELT A;  2HHU A;  1TAU A;  3NGY A;  4DLG A;  1XI1 A;  2IC3 A;  3HM9 A;  3PV8 A;  2BDP A;  5HRP A;  4DSF A;  3L8B A;  4IG0 A;  1CXU A;  4AHR A;  4CIE A;  4DTN A;  4DSJ A;  1JXB A;  3OYE A;  1ZBH A;  3WNH A;  4DTU A;  4M3Z A;  4DQR A;  1BGX T;  3CG7 A;  4FXD A;  3KKS A;  3WNE A;  1I39 A;  4E1N A;  4CF2 A;  3QEI A;  1B92 A;  1TVR A;  5D3G A;  1ASW A;  1VSH A;  1B9D A;  2D0A A;  3KIO A;  2G8K A;  4OPJ A;  3K59 A;  4KHQ A;  1EXQ A;  3QET A;  5I3U A;  3NCI A;  1IKX A;  3VN5 A;  1LWC A;  4FJI A;  2O4I A;  4E7I A;  2E4L A;  4HUG A;  1L3U A;  3IAY A;  3VA0 A;  4FJJ A;  2KW4 A;  4QOZ B;  2LSN A;  4DSL A;  3LAM A;  3QEP A;  3SPZ A;  2HNZ A;  3QIO A;  1S6Q A;  3SV4 A;  1NK4 A;  4J2E A;  2D0C A;  4KTZ A;  4PQU A;  3ZT3 A;  4DSK A;  3DRR A;  1HRH A;  4EP5 A;  3NAE A;  4J2B A;  4CHP A;  4W5T A;  3OYL A;  1VSJ A;  3AA5 X;  4JRP A;  5E41 A;  2OPR A;  1DTQ A;  5T7B A;  3KLF A;  2RPI A;  3MXJ A;  3AO5 A;  1LW2 A;  1D5A A;  3D0P A;  4F2R A;  1RT2 A;  2IGI A;  3RTV A;  4B9T A;  4CF1 A;  3SUN A;  4KI4 A;  3HL8 A;  3K2P A;  1QE1 A;  4CJ5 A;  3AA4 A;  3V6D A;  3PX0 A;  2ZD1 A;  3I0S A;  1NJY A;  2OPQ A;  2Z1I A;  4C8N A;  3H08 A;  2G8F A;  1RIL A;  1RNH A;  1BQN A;  3RR8 A;  3NF8 A;  1HPZ A;  3OS2 A;  1TL3 A;  1RT7 A;  1ZYQ A;  2G8V A;  4CJ4 A;  3LP3 A;  2KFN A;  2Z1H A;  4KPY A;  4KI6 A;  4CHO A;  4M42 A;  3VQP A;  3NE6 A;  4QAG A;  3PO4 A;  1U48 A;  4W5O A;  1BI4 B;  4CK2 A;  3KK2 A;  2PYJ A;  1UA1 A;  1S1T A;  3CM5 A;  2HHX A;  3NH1 A;  3BGR A;  2YNF A;  1HQE A;  1K6Y A;  2X6S A;  4CEO A;  3M8P A;  4LSL A;  1BL3 A;  1FKP A;  3C6T A;  4GMJ B;  1RT6 A;  4CF0 A;  4CE9 A;  4CES A;  1O1W A;  3OYN A;  3TAE A;  1D8Y A;  4DTO A;  4CEZ A;  2HW3 A;  1EP4 A;  4BE0 A;  3I8D A;  4M3Y A;  1TL1 A;  3KLI A;  4FZY A;  1QS4 A;  2HMI A;  3I0R A;  1KTQ A;  4FJL A;  4E7J A;  1D9F A;  2AJQ A;  1EX4 A;  2X6N A;  4KAZ A;  2OPP A;  5C24 A;  1KVA A;  3SUP A;  2WOM A;  3RMA A;  3SQ0 A;  3AO3 A;  3PX6 A;  4CFA A;  4CGI A;  4Z4F A;  3V9W A;  1SL2 A;  1WAJ A;  3P83 D;  4KRF A;  1KVB A;  1ASU A;  4CEC A;  4CEF A;  4YNQ A;  4OGE A;  2HHQ A;  4R5P A;  1GOC A;  3ALY A;  4MFB A;  4KTW A;  4DQP A;  5SWM A;  2Y1I A;  5KI6 A;  2G8I A;  3EYZ A;  1HYV A;  1WLJ A;  1ZBF A;  1RBT A;  2YNI A;  3OYI A;  4E7H A;  3DOK A;  4CK1 A;  1U4B A;  4FJX A;  1N5Y A;  2DTU A;  1SKR A;  1W9H A;  3VA3 A;  1CZ9 A;  4Z4G A;  4NCA A;  3DI6 A;  2X74 A;  2F8T A;  3TAP A;  1X9S A;  1KCF A;  3OYF A;  1JLG A;  1HNI A;  3LWM A;  4Z0U A;  3OJU A;  3SJJ A;  3MXM A;  2FBT A;  1RTD A;  3M8R A;  1A5V A;  1S6P A;  4AHT A;  5J1E A;  4FLZ A;  4M3U A;  3NGI A;  3RR7 A;  1IG9 A;  4CGJ A;  2I5J A;  3ZT0 A;  2X78 A;  3E01 A;  1VK0 A;  4O5B A;  3G0Z A;  4C8M A;  4CEB A;  3L2W A;  3U3Y A;  4B8A B;  1YTU A;  2G8H A;  3LAK A;  4BE1 A;  2QKK A;  5KGX A;  3PUF A;  3ZSX A;  3DOL A;  1REV A;  4KV8 A;  4KO0 A;  3V9Z A;  3DLG A;  4M3X A;  2JLE A;  3L3U A;  4I2Q A;  4CHQ A;  3TAQ A;  4ZTF A;  2HVI A;  2A1S A;  3L2R A;  3V9X A;  1U45 A;  5JS1 A;  5CZ1 A;  3AVM A;  4Q0B A;  2P1J A;  1X9M A;  2VWK A;  1J53 A;  4HCB A;  2F96 A;  1IO2 A;  3VQ9 A;  4BE2 A;  4AHU A;  1QSS A;  3U3G A;  2KFZ A;  3K5M A;  1U49 A;  3QIN A;  3M8Q A;  4N5S A;  3OS1 A;  1NK5 A;  2IDO A;  1S5J A;  3ZSO A;  1ITG A;  1VSK A;  3KLH A;  5HRS A;  2W42 A;  1FXX A;  2E6L A;  4CJV A;  2XY7 A;  3S3N A;  4F4K A;  4KHU A;  3SNN A;  4ICL A;  4Y1C A;  3VQE A;  3HPO A;  1A5W A;  4CER A;  4FYD A;  1EET A;  3AVK A;  1SV5 A;  4QCL A;  3T3F A;  1VSE A;  1X9W A;  4B9U A;  5KRS A;  3P5J A;  3IG1 A;  3LP2 A;  4OJR A;  4JS5 A;  1NJZ A;  1T05 A;  3KK1 A;  2QK9 A;  4ZTJ A;  1TKD A;  1JLB A;  4J2D A;  4N76 A;  3AO1 A;  3KJV A;  1Z25 A;  3NBP A;  4BWJ A;  3NHG A;  2EX3 A;  4FLU A;  1HNV A;  1EKE A;  1Y97 A;  1F21 A;  3CFR A;  1LWE A;  5FDL A;  4EP4 A;  1NKE A;  3DLR A;  3O4N A;  3TI0 A;  2RKI A;  2ZQB A;  1HQU A;  4DU4 A;  1RTH A;  4Q5V A;  3LZI A;  3SUO A;  4M3W A;  4DTR A;  3NGZ A;  4DQI A;  4HTU A;  1J9A A;  1WN7 A;  3P1G A;  4OPK A;  3TAF A;  4I9L A;  4HHT A;  4FVM A;  1L5U A;  1JLQ A;  1S1X A;  2GUI A;  3OJS A;  4FK2 A;  2JGU A;  4BWM A;  4DTJ A;  3LWL A;  3K5N A;  1RTJ A;  3CFO A;  1ZBU A;  4H8K A;  4B9S A;  5FRM A;  2GV9 A;  3LPU A;  3ZSZ A;  4DSI A;  1JLF A;  3VQ5 A;  2F8S A;  1DLO A;  5KGW A;  1L3S A;  3TAB A;  4DG1 A;  1Q9X A;  1GOA A;  1QSL A;  3ZSQ A;  1CXQ A;  1TK0 A;  4J2A A;  1S1U A;  2QXF A;  4E1M A;  1BCM A;  2B5J A;  3KK3 A;  3HST B;  4LY7 A;  4M3R A;  3ZT2 A;  1BIS A;  3TWH A;  2KTQ A;  4DTX A;  4B8C A;  2O4G A;  4FJM A;  3L2Q A;  1CZB A;  1RBV A;  1RDD A;  3V81 A;  1NKC A;  1HYS A;  4FJG A;  4KFB A;  3VQD A;  3SUQ A;  3NH2 A;  4W5Q A;  4NCG A;  4FJ5 A;  3S3O A;  3SYZ A;  4DS4 A;  1TKT A;  2YV0 X;  1LWF A;  3TR8 A;  3LP0 A;  1JKH A;  3V1Q A;  3NDK A;  5FRO A;  4CJP A;  1SL1 A;  3B6O A;  4B08 A;  1HJR A;  2IS3 A;  5JS2 A;  3DRP A;  1IKY A;  3VQB A;  2R7Y A;  2G8W A;  4CEA A;  2NUB A;  3L2U A;  4DF8 A;  3V9U A;  4IG3 A;  1UA0 A;  3S9H A;  4CFC A;  1SKW A;  3TAN A;  1UWB A;  4CFB A;  3KD5 E;  4I9Q A;  1JLA A;  1RBU A;  1J54 A;  1NK8 A;  3IRX A;  3MXI A;  3TAM A;  4F3T A;  4Y1D A;  4RW7 A;  4CJW A;  4OLA A;  4RG8 A;  2Y1J A;  4F8R A;  3C6U A;  3TAR A;  5J2P A;  1LW0 A;  4HCC A;  1KVC A;  1RDB A;  4DF4 A;  1C1C A;  3AVL A;  2B4J A;  3MEG A;  3HXM A;  1R0A A;  5I42 A;  3SZ2 A;  3QES A;  4E0D A;  1BIZ A;  3K57 A;  3HJF A;  4CIG A;  4DMN A;  4OLB A;  4Z4H A;  1C1A A;  4GW6 A;  5KTQ A;  3PY8 A;  5DK5 A;  3NFA A;  5C25 A;  3THV A;  4Z4E A;  3AVN A;  3HP6 A;  3HPH A;  5FRN A;  1B9F A;  3RMD A;  2DY4 A;  1T7P A;  2PY5 A;  3RWU A;  4UQG A;  4GVM A;  4N47 A;  1KLM A;  4B3O A;  4PA1 A;  2HVH A;  4CED A;  1LV5 A;  4CHN A;  3OYD A;  1L3V A;  3UIQ A;  3ZSR A;  1JLC A;  3C94 A;  4ID1 A;  4WE1 A;  4DFM A;  2Z1J A;  1BHL A;  1IH7 A;  3LAL A;  4FLY A;  2OZS A;  3AVH A;  4B9M A;  1I3A A;  4ID5 A;  2XY8 A;  4FM0 A;  4EZ6 A;  3QEW A;  3AA3 A;  1RT4 A;  1JLE A;  3ZSY A;  1UOC A;  4BDZ A;  3AVA A;  1QTM A;  1FK9 A;  1FKO A;  2RF2 A;  3WNG A;  4DTP A;  3SV3 A;  4O0I A;  4KB0 A;  4PUO A;  1VSL A;  4DLE A;  1S1W A;  5J2Q A;  4CGF A;  3LDS A;  4FM1 A;  2FBX A;  1LAW A;  3EZ5 A;  4BDY A;  3U6F A;  3OVN A;  3PX4 A;  1NJX A;  4B9N A;  4KHN A;  3ZCM A;  2VG7 A;  3ITH A;  3OY9 A;  3KTQ A;  3OYH A;  4N56 A;  5DMR A;  4C8L A;  4CJF A;  1VSI A;  4O55 A;  3KLE A;  4KRE A;  2B6A A;  5KRT A;  4FZZ A;  1MU2 A;  4CJK A;  3V4I A;  3KKR A;  3ASM A;  5SZT A;  1RCH A;  3NF9 A;  1GOB A;  1VRU A;  3IS9 A;  2IOC A;  5HP1 A;  2VWJ A;  2VG6 A;  1NK9 A;  1J5O A;  3QEX A;  4JLH A;  2HHT A;  3MED A;  4FLX A;  4E7L A;  1IKV A;  4B9V A;  4FK0 A;  1RDC A;  1RT1 A;  3V1O A;  2A1R A;  3ULD A;  3ZSW A;  4CF9 A;  5HRN A;  3K58 A;  1UAX A;  4M45 A;  4FJ8 A;  1C1B A;  2HND A;  2PYL A;  3KD1 E;  1WSE A;  4CGD A;  2EHG A;  3OYG A;  3OYJ A;  4FK4 A;  4NYN A;  3AVB A;  3T19 A;  2Z1G A;  1JL1 A;  1QQC A;  5C42 A;  4HUE A;  3SCX A;  4L8R B;  2VG5 A;  3AVC A;  2KZM A;  4HVJ A;  3MEE A;  3F73 A;  4RW6 A;  4AH9 A;  3ISN C;  1RT5 A;  3KLG A;  2PZS A;  1XWL A;  4RW4 A;  3OS0 A;  4FLT A;  1NK0 A;  4JRQ A;  3VQ4 A;  2ITG A;  4DFK A;  3A2F A;  4G1Q A;  1HMV A;  3VQ8 A;  2XO7 A;  4CJQ A;  1CLQ A;  1YT3 A;  4CK3 A;  4CGH A;  2YHA A;  3RRG A;  3DMJ A;  4DSE A;  1Z26 A;  3LAN A;  1C0T A;  4ELU A;  4KHY A;  1QSY A;  4IFY A;  1X1P A;  3DLK A;  3HT3 A;  4FLV A;  4CGG A;  1BIU A;  3T1A A;  4TSX A;  1WAF A;  4FW2 A;  1RBR A;  4DWI A;  3O3F A;  3M8S A;  1NK6 A;  2Q3S A;  1T8E A;  1C0M A;  3HK2 A;  4O0J A;  1WSH A;  4DU1 A;  4H4M A;  1A5X A;  4H4O A;  3JSM A;  4I2P A;  3JYT A;  4HUF A;  4DTS A;  3SQ2 A;  1QHT A;  4OKJ A;  2D0B A;  1SL0 A;  2WON A;  3LPT A;  3O3G A;  1WSJ A;  3O3H A;  4XIU A;  3SQ4 A;  4CFD A;  3F9K A;  4AHS A;  2HB5 A;  2FBV A;  1S9G A;  2FBY A;  3DM2 A;  4ZHR A;  4ELV A;  3QIP A;  1HYZ A;  3VQQ A;  3PO5 A;  4FJH A;  2BGG A;  1NOZ A;  1C6V A;  4NCB A;  3B6P A;  3HVR A;  4FJ9 A;  3O4Q A;  1BI4 A;  3RMB A;  4BAC A;  3LP1 A;  4PWD A;  1Q9Y A;  5HRR A;  4LH5 A;  2BAN A;  1NJW A;  3AVJ A;  2HNY A;  1WSF A;  1SKS A;  1N6Q A;  3SI6 A;  4CF8 A;  2GBZ A;  3HYF A;  4YFU A;  2DFH A;  1S1V A;  2YHB A;  1WSG A;  2YNH A; 
#chains in the Genus database with same CATH topology
 3HPG A;  1BCO A;  3L3V A;  1VQN N;  4O5F A;  2RN2 A;  1GLL O;  5HOO A;  3AO2 A;  3DLB A;  2E1Z A;  1GLF O;  2VGN A;  2OA8 A;  1YF5 L;  2ZWH A;  4YOW A;  3EKU A;  5K14 A;  1ZBL A;  1WNS A;  4CJU A;  2DFE A;  4JS4 A;  1KFD A;  4DFP A;  4EAH D;  3AO4 A;  1D9D A;  2D5R A;  3HVT A;  4O4G A;  2G8U A;  2ETJ A;  2KQ2 A;  4E89 A;  1KLN A;  3I33 A;  5AFU H;  4YHH K;  1JL2 A;  5HBM A;  3AAP A;  4FWL A;  3QO9 A;  1J6Z A;  5EY4 A;  4C8O A;  4RW9 A;  3MCA B;  4XEI A;  4V19 S;  4JEP A;  3CFP A;  3LZJ A;  2PAV A;  3J7Y P;  3CF5 L;  4H0Y B;  2O8D B;  1VSD A;  5AQN A;  1IKW A;  3QIC A;  1NOY A;  3RMC A;  2H3G X;  3R9P A;  3A0I X;  3FR0 A;  3QFU A;  4YOU A;  5CYQ A;  3TTC A;  5F1X A;  5BR9 A;  2YJF A;  2XY6 A;  4DR4 K;  3BDP A;  3QBX A;  4MQ3 A;  1T03 A;  4KKO A;  2P5O A;  1RBS A;  4E3S A;  4DV4 K;  1Q18 A;  2YX6 A;  4AHC A;  2HHW A;  3BEX A;  2ZGZ A;  1S9E A;  3K9K A;  4CHY A;  3UKU A;  2P5G A;  3THW B;  3LDL A;  4O44 A;  1U2V B;  2NZT A;  4FJK A;  3U9D A;  2QWM A;  3SBT A;  4IBN A;  3MEC A;  5AQJ A;  4FWS A;  3DJC A;  3JXU A;  1XI1 A;  5C2F A;  3OW2 M;  3K0S A;  3L8B A;  1CXU A;  4AHR A;  4CIE A;  4DTN A;  1ZBH A;  3DXK B;  4DTU A;  4FXD A;  5LMN K;  1GLB G;  3RSE B;  4LFA K;  5D3G A;  1QQM A;  3KIO A;  2G8K A;  4KHQ A;  3QET A;  3VN5 A;  1D4X A;  4HTL A;  2E4L A;  1L3U A;  1BO5 O;  3VA0 A;  2KW4 A;  5A2Q O;  4QOZ B;  1EWR A;  1BWF O;  3SAG A;  3SV4 A;  1S6Q A;  1NK4 A;  4J2E A;  3P4I A;  1HRH A;  3NAE A;  4BC4 A;  3O4W A;  4YDU A;  4CHP A;  2CGK A;  4W5T A;  3AA5 X;  3SLC A;  1P8Z A;  2OPR A;  5T7B A;  4EHT A;  3MXJ A;  2IGI A;  3VGL A;  3CJC A;  4JI3 K;  3V6D A;  3AA4 A;  3I0S A;  3TSU A;  4C8N A;  2A6A A;  1HPZ A;  2I7P A;  2G8V A;  1RT7 A;  2JWK A;  3LP3 A;  4CJ4 A;  4KPY A;  3H46 O;  4QAG A;  2E2N A;  2A41 A;  3J8A A;  2E88 A;  3KK2 A;  1UA1 A;  4GKJ K;  1EO1 A;  1YJW N;  2HHX A;  2ZGY A;  4CEO A;  1K6Y A;  3FE1 A;  3CCR N;  1HKB A;  1FKP A;  4LF4 K;  4GMJ B;  4CE9 A;  1NMD A;  2E8A A;  4CEZ A;  3C0B A;  4BE0 A;  3I8D A;  4JYA K;  2E20 A;  4M3Y A;  3KLI A;  1SZ2 A;  4FZY A;  1QS4 A;  2A40 A;  3I0R A;  1KTQ A;  3WXM B;  1EX4 A;  4PKG A;  4BG8 A;  2OPP A;  3SUP A;  3SQ0 A;  3AO3 A;  4CGI A;  1YXQ A;  4AM7 A;  1SL2 A;  3D7E O;  1N34 K;  4CEF A;  4BR2 A;  2HHQ A;  1GOC A;  5B8H A;  4DR5 K;  4KTW A;  4DQP A;  5SWM A;  3KVG A;  2OTL N;  5M1F A;  3SMP A;  3OYI A;  1RBT A;  3ZEU A;  4CK1 A;  4YOV A;  1IBL K;  1CZ9 A;  3CMA N;  4Z4G A;  4CZI A;  2X74 A;  3TAP A;  3OYF A;  2QTD A;  1JLG A;  1HNI A;  4BQL A;  3CQX A;  3I8B A;  1RTD A;  3NVK A;  1A5V A;  1KAX A;  4B9Q A;  2P9I B;  3NGI A;  4LFB K;  3RR7 A;  3O8M A;  4CGJ A;  3ZT0 A;  3FLC O;  2BUP A;  4B8A B;  1YTU A;  2G8H A;  2QWN A;  1IV0 A;  3PUF A;  1K9M O;  3DOL A;  3DLG A;  4FVU A;  1HJO A;  3ZX0 A;  5JLH A;  3L2R A;  4JI7 K;  4XH5 A;  3VTI A;  4DR1 K;  5CZ1 A;  3AVM A;  3WXJ A;  3IMX A;  4Q0B A;  4HCB A;  3MX2 A;  3VQ9 A;  1VQL N;  4IO8 A;  4N5S A;  3FZF A;  3HZ6 A;  3CCJ N;  3ZSO A;  3KLH A;  1VSK A;  5EVZ A;  5HRS A;  1FXX A;  4CJV A;  2QM1 A;  4KHU A;  3VQE A;  3EE9 A;  4K0K K;  4IJA A;  4CZJ A;  4WQ5 A;  4BRK A;  1SV5 A;  2ZJQ L;  4B9U A;  3P5J A;  3UKU B;  3IG1 A;  3LP2 A;  4BVP A;  4J2D A;  4N76 A;  3NBP A;  4ILH A;  2EX3 A;  3CFR A;  5FDL A;  1QVF M;  4L3Q A;  4DU4 A;  2F7T A;  1Y64 A;  4BRF A;  1R59 O;  1J9A A;  1CZA N;  4OPK A;  4LFC K;  3TAF A;  2HF3 A;  2Q1N A;  3OJS A;  1S1X A;  2JGU A;  1NGH A;  4DTJ A;  3K5N A;  1RTJ A;  3CFO A;  4EHU A;  1ZBU A;  4H8K A;  4B1U B;  3O08 A;  3ZSZ A;  4PL8 A;  2NRT A;  2OTJ N;  1C0G A;  1DLO A;  1Q9X A;  3GDQ A;  4DG1 A;  1GOA A;  4NXM K;  1S1U A;  4JD2 A;  1IJJ A;  3HST B;  3ZT2 A;  3TWH A;  2RHK A;  4BRP A;  3T1H K;  5BPM A;  4DTX A;  4EFH A;  3RVC A;  5JIC A;  4B1V A;  2I7N A;  4W5Q A;  3ZYY X;  1NNE A;  3J7A P;  3VEV A;  3TR8 A;  4JI5 K;  1JKH A;  1SL1 A;  5FRO A;  1S3X A;  4BR9 A;  4B08 A;  1HJR A;  3DRP A;  1IKY A;  2ZF5 O;  2R7Y A;  3LM2 A;  4CEA A;  3G71 N;  4DR2 K;  2G8W A;  1W7A A;  3L2U A;  3V9U A;  4KHP K;  3S9H A;  2IVP A;  1UWB A;  3KD5 E;  1JLA A;  1RBU A;  4CBX A;  1QQN A;  3TAM A;  3CD6 N;  4DR7 K;  4RG8 A;  4F8R A;  2Q97 A;  4HCC A;  1KVC A;  2E2P A;  2QA4 N;  5I42 A;  1HR0 K;  3TTF A;  4CIG A;  4DMN A;  4OLB A;  4H0T B;  4GW6 A;  1NWK A;  5AR0 A;  3L6Q A;  3NFA A;  4B3T K;  2P9U A;  4IOA L;  4BR7 A;  5BN8 A;  2DY4 A;  1Q81 O;  5AJ3 K;  4CED A;  4CHN A;  3UIQ A;  3THV A;  2YI1 A;  4WE1 A;  1IH7 A;  3AVH A;  3C6H A;  1IBK K;  3ZEU B;  4DV7 K;  5H1S Q;  4DV5 K;  1X3M A;  1UOC A;  4B1Y B;  3AVA A;  1QTM A;  2RF2 A;  3VEW A;  1VSL A;  4DLE A;  2HBJ A;  3JAM O;  4FM1 A;  1LAW A;  4JKH A;  4WQ5 C;  3U6F A;  3OVN A;  4B9N A;  3LDQ A;  3U8X A;  5LJV A;  3OY9 A;  3CJ7 A;  3OTO K;  2D0O A;  5DMR A;  2D4W A;  4C8L A;  4O55 A;  3P39 A;  4FZZ A;  5GAE P;  1MU2 A;  3KKR A;  5SZT A;  3THY A;  3NMU A;  1J5O A;  3HBT A;  4JLH A;  4FLX A;  4G9Z A;  5F2R A;  3WEE A;  3V1O A;  5M1N A;  5JMV A;  3P38 A;  5HRN A;  4BRL A;  4H5N A;  4FJ8 A;  2PYL A;  2UU9 K;  1WSE A;  3VGM A;  2EHG A;  3D2F A;  4LF7 K;  3MCP A;  4YOX A;  4O8K A;  2VWB A;  3MEE A;  4M7X A;  4XH1 A;  3F73 A;  2PZS A;  1XWL A;  1LOT B;  4FLT A;  4CZG A;  3R8E A;  2IVO A;  4G1Q A;  1E4G T;  2XO7 A;  1CLQ A;  4CK3 A;  4CGH A;  2YHA A;  3MWP A;  3RRG A;  4DSE A;  1QSY A;  4FLV A;  1BIU A;  3T1A A;  5I9E B;  3CER A;  1RBR A;  3M8S A;  4BRD A;  2Q3S A;  2FLO A;  1ILY A;  1OVQ A;  4DTS A;  3A5O C;  3SQ2 A;  4OKJ A;  2D0B A;  3CC4 N;  1SL0 A;  4YOY A;  1WSJ A;  5M1K A;  4H03 B;  1QHA A;  4ZHR A;  4JKA A;  1P90 A;  3KZB A;  1NOZ A;  4CZL A;  3HVR A;  4FJ9 A;  2O8B A;  3F5T A;  4BAC A;  4LH5 A;  2BAN A;  4YY3 K;  3AY9 A;  1NJW A;  1SKS A;  3SI6 A;  2O8F A;  4YFU A;  4DV0 K;  2DFH A;  1S1V A;  1WSG A;  1JCE A;  2IIR A;  4K8X A;  4R79 A;  4E19 A;  4MO5 A;  3OYC A;  4N41 A;  1TYQ A;  3DLE A;  2IAJ A;  4C8K A;  3FZM A;  4YOR A;  3K5O A;  1Q8I A;  2A3Z A;  3CJB A;  1TK5 A;  1HNX K;  4WF9 L;  4CCH A;  3NF6 A;  1BQM A;  3SPY A;  5AQS A;  1YVU A;  4H5T A;  3KWI A;  4B9L A;  3ATV A;  3CYM A;  4WFN L;  3AVF A;  3OYA A;  3ZSV A;  1J5E K;  2V52 B;  3OYB A;  3VQ6 A;  4CBW A;  1YIT N;  1TKZ A;  3G10 A;  4QS7 A;  2ZE2 A;  1BU6 O;  1VAZ A;  1VQ7 N;  2P51 A;  3NH0 A;  2P9L A;  3G6E N;  2GWK A;  4WYB A;  2GTD A;  3K5L A;  1TAQ A;  4WFB L;  1HNW K;  4DV6 K;  3KK7 A;  2FF3 B;  3WT0 A;  3TAG A;  4ISG A;  4CJT A;  4A59 A;  1NGE A;  1TKX A;  3VF2 A;  3HP9 A;  4PY5 A;  1W0H A;  4IEI A;  1U47 A;  3FZK A;  1BG3 A;  4F2S A;  3S3M A;  3ZET A;  4A5B A;  2OYQ A;  4OVL A;  1NGB A;  2RE2 A;  4IFV A;  4W5R A;  3KWG A;  4LF5 K;  3E9O A;  4DFJ A;  3ZT1 A;  3V9S A;  3HO1 A;  2HHV A;  4K25 A;  1VSF A;  2P9K A;  4DTM A;  4WFA L;  1KRP A;  2YKN A;  3CQY A;  4FW1 A;  4CZE A;  3D45 A;  4F9O A;  5GAD P;  3BUZ B;  3MAQ A;  4OGC A;  3VQ7 A;  4BR4 A;  3VPZ A;  4B1W B;  3OYK A;  1YTA A;  4FZX C;  3PSF A;  4JKD A;  5BN9 A;  3WNF A;  2HHU A;  5ELZ A;  5EOY A;  2IC3 A;  3HM9 A;  5AQX A;  3T69 A;  2BDP A;  3TU5 A;  3WEE B;  1JXB A;  1W97 L;  3CG7 A;  2ZM6 K;  4NB4 A;  3P31 A;  3QEI A;  1TVR A;  1ASW A;  1NJI O;  4OPJ A;  2QWO A;  3D2F B;  3ULE A;  1IKX A;  5AQQ A;  4HUG A;  4JHD B;  5BR8 K;  2LSN A;  3CCQ N;  2GEL A;  4DSL A;  2NRW A;  4JK8 A;  4PQU A;  3QIO A;  2YJE A;  3OYL A;  2CH6 A;  2WFB A;  4JRP A;  4AM6 A;  4MLH A;  3VEN A;  3KLF A;  1DTQ A;  2RPI A;  1LW2 A;  3T7Z A;  3SUN A;  4KI4 A;  3K2P A;  4PHT X;  5E84 A;  1NJY A;  3IKM A;  2Z1I A;  2ASO A;  1XQS C;  3LM9 A;  3H08 A;  3O1B A;  4M63 C;  1RIL A;  1TL3 A;  3L0Q A;  2Z1H A;  1BA0 A;  1Z05 A;  3VGK A;  1U48 A;  2O8E A;  2WBN A;  3CM5 A;  1T44 A;  3NH1 A;  1WBD A;  2O8F B;  4LSL A;  1BL3 A;  3SBG A;  4CES A;  3TAE A;  1O1W A;  1D8Y A;  3BZK A;  1TYQ B;  3O9T A;  4JI6 K;  4XH4 A;  2NRV A;  4BRE A;  2X6N A;  3OBY A;  3RMA A;  3PX6 A;  4Z4F A;  3V9W A;  1HKG A;  3QDK A;  1ASU A;  4YNQ A;  5IT9 O;  2GX9 A;  1RDW X;  3EYZ A;  1WLJ A;  3DOK A;  4B3R K;  1W9H A;  1OVY A;  5FPN A;  1VQK N;  4FWP A;  3M6G A;  1DEJ A;  2P9L B;  1KCF A;  2GWJ A;  1MA9 B;  4Z0U A;  3OJU A;  3SJJ A;  3M8R A;  1S6P A;  5DM7 L;  3CCE N;  5LY3 A;  4FLZ A;  4M3U A;  3E01 A;  4O5B A;  3HOT A;  4CEB A;  3HRG A;  3LAK A;  5KGX A;  1REV A;  3L3U A;  3PSI A;  3TAQ A;  4GV6 A;  5BRF A;  4ZTF A;  2HVI A;  1N33 K;  3S41 A;  3V9X A;  1U45 A;  4JN4 A;  4BQZ A;  5AQY A;  1X9M A;  4A2A A;  3ENB A;  4BE2 A;  5M1P A;  3U3G A;  3K5M A;  3ZET B;  3H3N O;  3OS1 A;  3UKR A;  5GAG P;  3SNN A;  4Y1C A;  4QCL A;  3T3F A;  4IDH A;  3HTV A;  2VGM A;  3TPQ A;  3IFR A;  1FJG K;  1Z25 A;  2YHW A;  1LWE A;  3O4N A;  5KPT A;  1C0F A;  5AQI A;  1GLE G;  4HTU A;  1XUP O;  4A61 A;  2UYT A;  3GG4 A;  4HHT A;  3O9U A;  5BRE A;  4FVM A;  1NGI A;  4I6M A;  3ULE B;  3ID6 A;  3LPU A;  4DSI A;  2WUS A;  3VQ5 A;  4O8U A;  2F8S A;  1JCG A;  1YVN A;  1L3S A;  4FPB A;  1CXQ A;  2QXF A;  2QWQ A;  4M3R A;  4LY7 A;  3CCU N;  2V7Y A;  4DCH A;  3EL2 A;  1K73 O;  1CZB A;  1HYS A;  1RDD A;  1NKC A;  4E1J A;  2IVN A;  4FJG A;  3VQD A;  3VES A;  4NCG A;  1ATR A;  1TKT A;  3CPE A;  1LWF A;  4C1N I;  2VYP A;  4DV3 K;  3V1Q A;  4CJP A;  2E2O A;  3N4Q A;  4DV1 K;  5BPL A;  5KPR A;  2NUB A;  4DF8 A;  4IG3 A;  3L4Q A;  1UA0 A;  3W0L A;  3O6W A;  5JLF A;  1SKW A;  3TAN A;  2P9P A;  2FSK A;  3ZLJ A;  1NK8 A;  2O8E B;  3IRX A;  4Y1D A;  4CJW A;  2Y1J A;  3TAR A;  5AQV A;  5J2P A;  1LW0 A;  5AQF A;  4DF4 A;  4DUY K;  5C2D A;  3HXM A;  1R0A A;  4E0D A;  1BIZ A;  3VEO A;  3K57 A;  3HJF A;  1NBW A;  1C1A A;  4BR0 A;  3MN9 A;  5DK5 A;  1QQO A;  3MN5 A;  5C25 A;  1VQP N;  4Z4E A;  3I55 N;  3HP6 A;  1HKC A;  3CXC M;  3U4L A;  4B3O A;  4CZM A;  1JLC A;  3C94 A;  2Z1J A;  3LAL A;  2OZS A;  2Q31 A;  4ID5 A;  2XY8 A;  2EWS A;  1YI2 N;  4MO4 A;  1VQO N;  1JLE A;  4FWQ A;  3VEX A;  4X65 K;  2O8C A;  1FKO A;  4PUO A;  3CC2 N;  1S1W A;  3LDS A;  2FBX A;  4BDY A;  4RCH A;  3DXM A;  2P9S A;  4LF8 K;  3ITH A;  5AQR A;  3OYH A;  1E4F T;  4N56 A;  2W6L A;  1VSI A;  3KLE A;  3C7N A;  5KRT A;  4CJK A;  5AQG A;  3ASM A;  1WUA A;  1GLC G;  4OX9 K;  5HP1 A;  3CCV N;  1NK9 A;  1T6C A;  3AAQ A;  1RDC A;  2A5X A;  1RT1 A;  3ZSW A;  4CF9 A;  3SK3 A;  1GLA G;  2HND A;  3R6M A;  3ATU A;  3OYJ A;  3T19 A;  5C42 A;  3UKR B;  2KZM A;  1DT9 A;  1NMN A;  4AH9 A;  3KLG A;  1VQ6 N;  1NGD A;  3O5B A;  4JRQ A;  2ITG A;  4DFK A;  1EWQ A;  1KC8 O;  5AQU A;  3VQ8 A;  1NGG A;  4CJQ A;  2QXL A;  3A5M C;  2HST A;  3DMJ A;  4BC3 A;  4ELU A;  1ESV A;  1KAZ A;  4IXC A;  4KHY A;  1IG8 A;  1X1P A;  4CGG A;  4GKK K;  3GE1 A;  4FW2 A;  4BRO A;  1NK6 A;  3QFP A;  4GV3 A;  4O0J A;  3WXK A;  4FWO A;  4I2P A;  3JYT A;  4I6M B;  4XIU A;  3O9R A;  3NVM A;  2HB5 A;  2FBV A;  2FBY A;  3DM2 A;  4DR6 K;  3CME N;  3B6P A;  2Q36 A;  3CCL N;  1Q9Y A;  3LDP A;  3R1X A;  5HRR A;  5TKW A;  1N6Q A;  4CF8 A;  2GBZ A;  3HYF A;  2YHB A;  3AVG A;  3I56 N;  4BDP A;  3DYA A;  4CZF A;  1U04 A;  4OKK A;  4K41 A;  3L4I A;  1WSI A;  4FCY A;  4K8Z A;  1VRT A;  1G15 A;  2XRI A;  4NYF A;  1MWM A;  2W40 A;  3ZT4 A;  3VQC A;  3G4S N;  2P9P B;  2KHO A;  1WOQ A;  4KB1 A;  4LH4 A;  1L3T A;  3QNO A;  4M3T A;  4IDK A;  4FJ7 A;  1XC9 A;  3IUC A;  2OZM A;  4BR5 A;  2E6M A;  2OPS A;  4I7F A;  3V1R A;  1NKB A;  3AGK A;  3AA2 A;  4FLW A;  3SQ1 A;  4JKF A;  4CD3 A;  1ATN A;  2ZJR L;  1VQ9 N;  5CZ2 A;  3QER A;  2DFF A;  1RTI A;  3MN6 A;  1Z6R A;  4CJS A;  2FSJ A;  4DQS A;  2BTF A;  2QKB A;  1ASV A;  4EZ9 A;  5C12 A;  4BGA A;  3QLH A;  5AQH A;  1KSP A;  3EY1 A;  4YOT A;  4WQ4 C;  2O8C B;  4FOI A;  3CJ1 A;  3QEV A;  1TK8 A;  1GLD G;  3MWT A;  4BRC A;  4KHS A;  5EU7 A;  4CIF A;  2HOE A;  2GEM A;  4W5N A;  3L2V A;  3CET A;  1XHZ A;  3B8A X;  4CJ7 A;  1YIJ N;  1LAV A;  3AV9 A;  4IOX A;  1SUQ A;  1K8K A;  3AAR A;  4LD0 A;  1S72 N;  1BOT O;  4AIL C;  1TAU A;  3DLH A;  4ELT A;  4BRI A;  3NGY A;  3C65 A;  3VF4 A;  4DLG A;  2D1K A;  4H5W A;  3WQT A;  4IO9 L;  3ZX2 A;  5HRP A;  4DSF A;  5EX5 A;  4DSJ A;  1HX1 A;  3WNH A;  1BGX T;  3KKS A;  1I39 A;  4E1N A;  1VSH A;  1B9D A;  2D0A A;  5I3U A;  3NCI A;  4U7B A;  3VMF B;  4FJI A;  4E7I A;  4IFE A;  2HNZ A;  5AQZ A;  2D0C A;  4KTZ A;  3ZT3 A;  4DSK A;  3DRR A;  4J2B A;  1ZXO A;  2F9T A;  1NM1 A;  1VSJ A;  3K9J A;  1YHQ N;  3AO5 A;  3RTV A;  4B9T A;  4CF1 A;  1QE1 A;  3PX0 A;  4FPA A;  1HLU A;  3F9M A;  2ZD1 A;  4JD2 B;  2OPQ A;  2E2Q A;  2NRH A;  2G8F A;  1RNH A;  3RR8 A;  3OS2 A;  2WC9 A;  3MDQ A;  2KLA A;  3WUH A;  4KI6 A;  4JKB A;  4CHO A;  3VQP A;  4M42 A;  4W5O A;  4FO0 A;  4CK2 A;  1S1T A;  2AP1 A;  2D0P A;  3BGR A;  3MMV A;  1HQE A;  2X6S A;  3EO3 A;  3M8P A;  3ENO A;  4CW7 B;  2Q0R A;  4DTO A;  1YJN N;  1OH6 A;  3GL1 A;  3A5L C;  3BZC A;  4IOC L;  4U67 L;  2HMI A;  5AZJ A;  2AJQ A;  4JNE A;  2WOM A;  4JKE A;  2J4R A;  3FZL A;  1WAJ A;  3P83 D;  4H5V A;  4KRF A;  4OGE A;  4R5P A;  3UE5 A;  4MFB A;  5C0Y A;  1IBM K;  2E5L K;  2A42 A;  5HL7 L;  2Y1I A;  2P9U B;  2YNI A;  4CZK A;  1U4B A;  5AQT A;  3E9L A;  1N5Y A;  1RDU A;  5M1Q A;  4DKW A;  3VA3 A;  4QS9 A;  4NCA A;  1TUY A;  4CZH A;  1X9S A;  4B1Z A;  3M3Z A;  3MXM A;  2FBT A;  4AHT A;  2KKZ A;  3WQU A;  2QEX N;  2I5J A;  2X78 A;  3U3Y A;  3Q7B A;  3G0Z A;  4C8M A;  3J80 O;  3L2W A;  2UXC K;  1JCF A;  3M5R A;  3DWL A;  4IJN A;  3ZSX A;  4KBO A;  3E1Y A;  2VQE K;  4KV8 A;  4M3X A;  2JLE A;  4ISE A;  4I2Q A;  4CHQ A;  2Q0U A;  3TSP A;  2P1J A;  2VWK A;  3O9S A;  4M7Y A;  2HBK A;  2ASP A;  4AHU A;  1QSS A;  1U49 A;  4LC9 B;  4Y0W A;  3QIN A;  4BC5 A;  3THY B;  1XMO K;  3M8Q A;  1NK5 A;  1ITG A;  2W42 A;  4F4K A;  2E6L A;  3S3N A;  4ICL A;  1A5W A;  1EET A;  3AVK A;  1VSE A;  2QWR A;  1BDG A;  4OJR A;  1NJZ A;  3KK1 A;  3DXK A;  3EN9 A;  5IWA K;  1JLB A;  3AO1 A;  3KJV A;  3NHG A;  4BWJ A;  3RSE A;  1Q7Y O;  1EKE A;  1Y97 A;  3M1F A;  1F21 A;  1T3V A;  5F0X A;  1NKE A;  3DLR A;  2QI2 A;  2ZQB A;  1HQU A;  1RTH A;  4M3W A;  3SUO A;  2Q2R A;  1GLJ O;  4DQI A;  1JJ2 M;  1WN7 A;  3CJA A;  1HUX A;  4I9L A;  3O9Q A;  4B3M K;  4FK2 A;  5AQW A;  5FRM A;  2GV9 A;  1JLF A;  5FLX O;  5KGW A;  3TAB A;  1W2B M;  1QSL A;  4ILG B;  4NXN K;  3ZSQ A;  4WCE L;  3U9Z A;  4E1M A;  1BCM A;  3KK3 A;  3QML A;  4CI6 A;  4H0V B;  4B8C A;  4FJM A;  3L2Q A;  1RBV A;  3V81 A;  2V51 B;  1M90 O;  3A5N C;  2O8B B;  5AQM A;  4KFB A;  4LF6 K;  3SYZ A;  1O13 A;  2YV0 X;  3VTH A;  1T05 A;  4FWM A;  4BRN A;  3B6O A;  5JS2 A;  5ADX A;  4JI1 K;  1NU0 A;  4QS8 A;  4F3T A;  5FPE A;  4JKG A;  2W41 A;  2VCP A;  2WTU A;  1C1C A;  3AVL A;  2B4J A;  3J7Z O;  3SZ2 A;  3QES A;  2UXB K;  1BA1 A;  4Z4H A;  5AZJ B;  3RMD A;  1HNZ K;  1T7P A;  2PY5 A;  4UQG A;  2CH5 A;  1I94 K;  4N47 A;  3D6R A;  4BRG A;  5FPD A;  3OYD A;  5AQP A;  1KD1 O;  4H0X B;  3ZSR A;  4DFM A;  1N8R O;  1BHL A;  3E66 A;  4FLY A;  1I3A A;  4A2B A;  5CHI A;  3QEW A;  1RT4 A;  4H0O A;  2P9I A;  3ZSY A;  1X3N A;  3VF6 A;  4DTP A;  5J2Q A;  3HI0 A;  4CGF A;  2VG7 A;  3KTQ A;  4KRE A;  2B6A A;  3IDH A;  4LF9 K;  1RCH A;  1VRU A;  4NLB A;  2P9K B;  1HPM A;  2VWJ A;  3MED A;  4E7L A;  4NLC A;  4B9V A;  1YAG A;  2A1R A;  4X66 K;  3ULD A;  4BY9 C;  4RTF D;  3CI5 A;  2BH1 A;  4CGD A;  3OYG A;  4FK4 A;  3AVB A;  2Z1G A;  4HUE A;  3SCX A;  4L8R B;  3AVC A;  2ZJP L;  4HVJ A;  4RW6 A;  3ISN C;  4RW4 A;  3OS0 A;  4AF1 A;  1NK0 A;  1SQK A;  1BUP A;  3VQ4 A;  3A2F A;  3ID8 A;  1ATS A;  1QZ5 A;  2P9N A;  3HOS A;  4MDA A;  1YT3 A;  1LCU A;  1Z26 A;  3LAN A;  1C0T A;  4IFY A;  3DLK A;  3HT3 A;  5BRD A;  1T8E A;  3D2E A;  1VQ4 N;  3LDO A;  3JSM A;  1QHT A;  3OBW A;  2QWL A;  2WON A;  3LPT A;  3ENH A;  1S9G A;  4OO1 J;  1HYZ A;  2BGG A;  4NCB A;  3GOI A;  3BF3 A;  1BI4 A;  2QWP A;  3RMB A;  1SS6 A;  3H1Q A;  3LP1 A;  2HF4 A;  4Z94 A;  4JKC A;  3AVJ A;  2HNY A;  1WSF A;  1WB9 A;  1OKJ A;  4JI0 K;  3CC7 N;  2NNW A;  2YNH A;  2YNG A;  3WXI A;  1H1V A;  4CJ3 A;  4F3O A;  4RW8 A;  5CYM A;  4X62 K;  4AHV A;  3AVI A;  3A8Y A;  4M41 A;  1KFS A;  4IKF A;  4CJL A;  4CEQ A;  4IZ9 A;  5J2M A;  2HHH K;  4OKE A;  5AZI A;  5CY4 A;  3HM8 A;  4E7K A;  1XHX A;  3TTD A;  3LDN A;  4DQQ A;  1XNR K;  3VOV A;  1DTT A;  1TV6 A;  3C95 A;  5LMU K;  1K8A O;  1TGO A;  4JKG B;  4FYD A;  1NGF A;  4DS5 A;  4LSN A;  1C0U A;  3RRH A;  1VSM A;  2YKM A;  3CM6 A;  3MX5 A;  3QNN A;  1YJ9 N;  1NK7 A;  3CHW A;  2HHS A;  4DU3 A;  4KH6 A;  5M1O A;  4KHW A;  2KZZ A;  3SAH A;  4CVN E;  2XHB A;  2FXU A;  4BC2 A;  1RDA A;  3CCM N;  5HRO A;  3R3L A;  5J2N A;  2VQF K;  1ZBI A;  4CEE A;  4BG9 A;  3OYM A;  3THX A;  2FF6 A;  4GY2 B;  2ATQ A;  4CHZ A;  1S22 A;  4KTQ A;  4FM2 A;  3C6A A;  5AQK A;  4DQ8 A;  3CQ8 A;  3FFI A;  4Z4C A;  3NF7 A;  3KHY A;  1N32 K;  3EEQ A;  3SAF A;  3CJ9 A;  1VQ8 N;  1JXE A;  2F9W A;  3VQA A;  3DRS A;  4FSV A;  5HLF A;  2GUP A;  4DB3 A;  4CJR A;  1YUW A;  3N4P A;  4GVE A;  1RT3 A;  4PKH A;  5C15 A;  2XY5 A;  4CBU A;  3H45 C;  5LJW A;  4CJE A;  1VHX A;  1NGJ A;  5AFU A;  4Z4I A;  4DUZ K;  1NGA A;  4WQ4 A;  4FJN A;  1M1K O;  2BE2 A;  2FC0 A;  3VEZ A;  5DM6 L;  4J8F A;  3CPW M;  3AGR A;  4K42 A;  3PV8 A;  4UY8 O;  4IG0 A;  1KXP A;  3OYE A;  1WBB A;  4M3Z A;  4DQR A;  5CE3 A;  4CF2 A;  3WNE A;  1XMQ K;  3G25 A;  4YDU C;  1B92 A;  2HMP A;  3K59 A;  1EXQ A;  4BRQ A;  1N36 K;  1LWC A;  2HBL A;  4FWR A;  2O4I A;  3IAY A;  4FJJ A;  4B1X B;  5JVH L;  2P9N B;  3LAM A;  3QEP A;  3SPZ A;  4EP5 A;  4OPA A;  5E41 A;  3D0P A;  1D5A A;  4F2R A;  1RT2 A;  4FL9 A;  3D2E B;  2YHX A;  3HL8 A;  4CJ5 A;  5BRH A;  4JI2 K;  1DKG D;  1VQ5 N;  3DAW A;  3MK6 A;  1BQN A;  3NF8 A;  1ZYQ A;  5KPZ A;  2KFN A;  1MWK A;  1KQS M;  3NE6 A;  4KH5 A;  3PO4 A;  1BI4 B;  1ZBS A;  3Q7C A;  2OCE A;  2PYJ A;  2YNF A;  2NLX A;  1OH5 A;  3C6T A;  4CF0 A;  4EIA A;  3PIO L;  3OYN A;  4JK9 A;  2HW3 A;  1EP4 A;  1MDU B;  5GIP A;  1TL1 A;  5GIN A;  1DGK N;  1RGI A;  4FJL A;  4E7J A;  1T6D A;  1D9F A;  4KH4 A;  5C24 A;  4KAZ A;  1KVA A;  1TUU A;  4CFA A;  1KVB A;  2HBM A;  4BRM A;  4CEC A;  5AZI B;  3ALY A;  4RWT A;  3EZW A;  1QZ6 A;  3QB0 A;  2G8I A;  5KI6 A;  1HYV A;  1XNQ K;  1ZBF A;  3F2K A;  4E7H A;  4FJX A;  4A5A A;  2DTU A;  1SKR A;  1G99 A;  3DI6 A;  2F8T A;  2DPN A;  4IWV A;  3LWM A;  1OH7 A;  2UUB K;  5EXW A;  4JAX A;  1NLV A;  5J1E A;  3QBW A;  3H1V X;  1IG9 A;  1VK0 A;  3JS6 A;  3THX B;  4BE1 A;  2QKK A;  4ILJ A;  4KO0 A;  3W3D A;  3V9Z A;  3TSQ A;  3DXM B;  2P9S B;  5JS1 A;  2A1S A;  5CR4 A;  4GV9 A;  4PL7 A;  4DV2 K;  1J53 A;  3C7N B;  2F96 A;  1IO2 A;  4AQY K;  4FWN A;  2KFZ A;  2IDO A;  1S5J A;  2XY7 A;  1OH8 A;  5LL6 Z;  3HPO A;  2NRR A;  1KAY A;  4CER A;  4MLE A;  4JI4 K;  3VET A;  1X9W A;  1V4T A;  5KRS A;  4JS5 A;  2QK9 A;  4ZTJ A;  1Q86 O;  5JVG L;  1TKD A;  5FPM A;  4FLU A;  1HNV A;  5ADX H;  4EP4 A;  3TI0 A;  2RKI A;  3HSC A;  3LZI A;  4Q5V A;  1EQY A;  3H6E A;  2UUA K;  4DTR A;  4BRH A;  3NGZ A;  4JHD A;  4FOE A;  3H3O B;  3P1G A;  1V4S A;  1E3M A;  1RFQ A;  1U6Z A;  1L5U A;  1JLQ A;  2GUI A;  4C1N K;  4BWM A;  3LWL A;  4BGB A;  4B9S A;  4JK7 A;  1NGC A;  3E9P A;  2NRZ A;  4PKI A;  1TK0 A;  4DHY A;  4BRA A;  4J2A A;  2B5J A;  1BIS A;  1FW6 A;  2KTQ A;  2QW9 A;  2O4G A;  2PBD A;  3WXL A;  5MLC Q;  3SUQ A;  3NH2 A;  4JV5 K;  4FJ5 A;  2ITM A;  4ISF A;  3S3O A;  3DLL L;  5AQL A;  4DS4 A;  3SJH A;  3LP0 A;  3NDK A;  2IS3 A;  3VQB A;  3EKS A;  4A57 A;  4CFC A;  3T1Y K;  4JI8 K;  4I9Q A;  4CFB A;  3VEY A;  2ASM A;  1J54 A;  2F4V K;  2CGL A;  2V7Z A;  3MXI A;  4RW7 A;  4OLA A;  3C6U A;  1RDB A;  3CCS N;  2UUC K;  3MEG A;  5KQD A;  5GIO A;  1VQM N;  3J81 O;  3PY8 A;  3ZX3 A;  5KTQ A;  3MN7 A;  2CGJ A;  2FSN A;  4GNI A;  3AVN A;  3HPH A;  5FRN A;  1B9F A;  2O8D A;  3RWU A;  4GVM A;  1KLM A;  4OPH A;  1XC3 A;  4PA1 A;  2HVH A;  3CIP A;  1LV5 A;  2OAN A;  4BVO A;  1L3V A;  3GBT A;  4ID1 A;  4B9M A;  3PLA A;  4FM0 A;  4EZ6 A;  3FFK B;  3AA3 A;  4H0P A;  3EE8 A;  4BDZ A;  1FK9 A;  4H5R A;  3WNG A;  3SV3 A;  4O0I A;  4KB0 A;  1NJX A;  2NRX A;  3EZ5 A;  4KHN A;  3PX4 A;  3ZCM A;  2W6K A;  3SMS A;  1SAZ A;  5C10 A;  4CJF A;  4CD1 A;  3THW A;  4NO7 A;  1ZC6 A;  3V4I A;  1U2V A;  3NF9 A;  1GOB A;  3IS9 A;  1QVG M;  2IOC A;  4K43 A;  2VG6 A;  2HHT A;  2E1Y A;  3QEX A;  3OA9 A;  2YHY A;  1IKV A;  4FK0 A;  4X64 K;  4FWK A;  3OHR A;  3K58 A;  1K8K B;  1UAX A;  4M45 A;  5AQO A;  1C1B A;  2AA4 A;  3KD1 E;  5TKY A;  4NYN A;  1JL1 A;  1QQC A;  1X9J A;  2VG5 A;  4C23 A;  4DR3 K;  1RT5 A;  4MDB A;  2UXD K;  1HMV A;  4HWI A;  3BY5 A;  3BF1 A;  4TSX A;  1WAF A;  5BPN A;  1NG9 A;  4DWI A;  3O3F A;  1Q82 O;  3VER A;  5GAH P;  5KQ8 A;  1C0M A;  3HK2 A;  4DU1 A;  1WSH A;  2PFU A;  1A5X A;  4H4M A;  4H4O A;  3UB5 A;  3PIP L;  4HUF A;  3O3G A;  3O1W A;  3O3H A;  3BP8 A;  3LL3 A;  4CFD A;  3F9K A;  4AHS A;  3SQ4 A;  3FZH A;  2JWL A;  4ELV A;  3QIP A;  3VQQ A;  3PO5 A;  3O80 A;  4FJH A;  1C6V A;  5E26 A;  3O4Q A;  2YCH A;  3FGU A;  4PWD A;  4B3S K;  4A62 A;  4IEE A;  1RT6 A; 
#chains in the Genus database with same CATH homology
 2YNG A;  3AVG A;  3HPG A;  4CJ3 A;  4K8X A;  1BCO A;  4E19 A;  4F3O A;  4BDP A;  3L3V A;  3OYC A;  4N41 A;  3DYA A;  4RW8 A;  5CYM A;  2RN2 A;  3DLE A;  1U04 A;  2IAJ A;  4OKK A;  3AVI A;  4AHV A;  4C8K A;  4M41 A;  3AO2 A;  1KFS A;  3DLB A;  3K5O A;  1Q8I A;  1TK5 A;  4IKF A;  1WSI A;  4CJL A;  4CEQ A;  4FCY A;  4K8Z A;  4CCH A;  2OA8 A;  3NF6 A;  1VRT A;  1G15 A;  1BQM A;  2XRI A;  3SPY A;  4NYF A;  1YVU A;  5J2M A;  1ZBL A;  5K14 A;  4OKE A;  1WNS A;  4B9L A;  3ZT4 A;  3VQC A;  2DFE A;  5CY4 A;  4CJU A;  3CYM A;  1KFD A;  4JS4 A;  1XHX A;  4E7K A;  4DFP A;  3AO4 A;  3AVF A;  2D5R A;  3OYA A;  1DTT A;  1TV6 A;  3C95 A;  4DQQ A;  1D9D A;  3ZSV A;  3HVT A;  4O4G A;  3OYB A;  3VQ6 A;  1TGO A;  1TKZ A;  3G10 A;  2G8U A;  2ZE2 A;  4DS5 A;  2ETJ A;  2KQ2 A;  1C0U A;  4LSN A;  1VSM A;  4E89 A;  3RRH A;  1KLN A;  4KB1 A;  2YKM A;  4LH4 A;  3CM6 A;  1NK7 A;  3QNO A;  3QNN A;  1L3T A;  1JL2 A;  2P51 A;  5HBM A;  3NH0 A;  4M3T A;  2HHS A;  3QO9 A;  4DU3 A;  4IDK A;  4C8O A;  4RW9 A;  4FJ7 A;  1XC9 A;  2OZM A;  3K5L A;  2E6M A;  2OPS A;  4I7F A;  3V1R A;  1TAQ A;  4KHW A;  1NKB A;  2KZZ A;  3AA2 A;  4FLW A;  3CFP A;  3LZJ A;  2XHB A;  3SQ1 A;  5HRO A;  1RDA A;  5J2N A;  1VSD A;  1ZBI A;  1IKW A;  5CZ2 A;  4CEE A;  3OYM A;  3QER A;  2DFF A;  1RTI A;  3TAG A;  1NOY A;  3RMC A;  2ATQ A;  5CYQ A;  4CJS A;  4CHZ A;  4CJT A;  4KTQ A;  1TKX A;  4FM2 A;  4DQS A;  3HP9 A;  3CQ8 A;  3FFI A;  4Z4C A;  1W0H A;  2QKB A;  3NF7 A;  4PY5 A;  1ASV A;  4EZ9 A;  2XY6 A;  1U47 A;  3QLH A;  1KSP A;  4F2S A;  3EY1 A;  3S3M A;  3BDP A;  4MQ3 A;  1T03 A;  1JXE A;  4KKO A;  1RBS A;  2P5O A;  2OYQ A;  4OVL A;  3VQA A;  3DRS A;  4E3S A;  4IFV A;  4W5R A;  3QEV A;  1TK8 A;  4DFJ A;  3ZT1 A;  3V9S A;  5HLF A;  3HO1 A;  4KHS A;  5EU7 A;  2HHV A;  1VSF A;  4CIF A;  4DTM A;  4AHC A;  4CJR A;  2HHW A;  4W5N A;  3L2V A;  1XHZ A;  1KRP A;  1RT3 A;  1S9E A;  2YKN A;  2XY5 A;  4CHY A;  4FW1 A;  3D45 A;  1LAV A;  3AV9 A;  4CJE A;  3MAQ A;  2P5G A;  1SUQ A;  4OGC A;  3VQ7 A;  4Z4I A;  4O44 A;  4LD0 A;  4FJK A;  4FJN A;  3OYK A;  1YTA A;  4FZX C;  2BE2 A;  4IBN A;  3WNF A;  2FC0 A;  4AIL C;  3DLH A;  3MEC A;  4ELT A;  2HHU A;  1TAU A;  3NGY A;  4DLG A;  1XI1 A;  2IC3 A;  3HM9 A;  3PV8 A;  2BDP A;  5HRP A;  4DSF A;  3L8B A;  4IG0 A;  1CXU A;  4AHR A;  4CIE A;  4DTN A;  4DSJ A;  1JXB A;  3OYE A;  1ZBH A;  3WNH A;  4DTU A;  4M3Z A;  4DQR A;  1BGX T;  3CG7 A;  4FXD A;  3KKS A;  3WNE A;  1I39 A;  4E1N A;  4CF2 A;  3QEI A;  1B92 A;  1TVR A;  5D3G A;  1ASW A;  1VSH A;  1B9D A;  2D0A A;  3KIO A;  2G8K A;  4OPJ A;  3K59 A;  4KHQ A;  1EXQ A;  3QET A;  5I3U A;  3NCI A;  1IKX A;  3VN5 A;  1LWC A;  4FJI A;  2O4I A;  4E7I A;  2E4L A;  4HUG A;  1L3U A;  3IAY A;  3VA0 A;  4FJJ A;  2KW4 A;  4QOZ B;  2LSN A;  4DSL A;  3LAM A;  3QEP A;  3SPZ A;  2HNZ A;  3QIO A;  1S6Q A;  3SV4 A;  1NK4 A;  4J2E A;  2D0C A;  4KTZ A;  4PQU A;  3ZT3 A;  4DSK A;  3DRR A;  1HRH A;  4EP5 A;  3NAE A;  4J2B A;  4CHP A;  4W5T A;  3OYL A;  1VSJ A;  3AA5 X;  4JRP A;  5E41 A;  2OPR A;  1DTQ A;  5T7B A;  3KLF A;  2RPI A;  3MXJ A;  3AO5 A;  1LW2 A;  1D5A A;  3D0P A;  4F2R A;  1RT2 A;  2IGI A;  3RTV A;  4B9T A;  4CF1 A;  3SUN A;  4KI4 A;  3HL8 A;  3K2P A;  1QE1 A;  4CJ5 A;  3AA4 A;  3V6D A;  3PX0 A;  2ZD1 A;  3I0S A;  1NJY A;  2OPQ A;  2Z1I A;  4C8N A;  3H08 A;  2G8F A;  1RIL A;  1RNH A;  1BQN A;  3RR8 A;  3NF8 A;  1HPZ A;  3OS2 A;  1TL3 A;  1RT7 A;  1ZYQ A;  2G8V A;  4CJ4 A;  3LP3 A;  2KFN A;  2Z1H A;  4KPY A;  4KI6 A;  4CHO A;  4M42 A;  3VQP A;  3NE6 A;  4QAG A;  3PO4 A;  1U48 A;  4W5O A;  1BI4 B;  4CK2 A;  3KK2 A;  2PYJ A;  1UA1 A;  1S1T A;  3CM5 A;  2HHX A;  3NH1 A;  3BGR A;  2YNF A;  1HQE A;  1K6Y A;  2X6S A;  4CEO A;  3M8P A;  4LSL A;  1BL3 A;  1FKP A;  3C6T A;  4GMJ B;  1RT6 A;  4CF0 A;  4CE9 A;  4CES A;  1O1W A;  3OYN A;  3TAE A;  1D8Y A;  4DTO A;  4CEZ A;  2HW3 A;  1EP4 A;  4BE0 A;  3I8D A;  4M3Y A;  1TL1 A;  3KLI A;  4FZY A;  1QS4 A;  2HMI A;  3I0R A;  1KTQ A;  4FJL A;  4E7J A;  1D9F A;  2AJQ A;  1EX4 A;  2X6N A;  4KAZ A;  2OPP A;  5C24 A;  1KVA A;  3SUP A;  2WOM A;  3RMA A;  3SQ0 A;  3AO3 A;  3PX6 A;  4CFA A;  4CGI A;  4Z4F A;  3V9W A;  1SL2 A;  1WAJ A;  3P83 D;  4KRF A;  1KVB A;  1ASU A;  4CEC A;  4CEF A;  4YNQ A;  4OGE A;  2HHQ A;  4R5P A;  1GOC A;  3ALY A;  4MFB A;  4KTW A;  4DQP A;  5SWM A;  2Y1I A;  5KI6 A;  2G8I A;  3EYZ A;  1HYV A;  1WLJ A;  1ZBF A;  1RBT A;  2YNI A;  3OYI A;  4E7H A;  3DOK A;  4CK1 A;  1U4B A;  4FJX A;  1N5Y A;  2DTU A;  1SKR A;  1W9H A;  3VA3 A;  1CZ9 A;  4Z4G A;  4NCA A;  3DI6 A;  2X74 A;  2F8T A;  3TAP A;  1X9S A;  1KCF A;  3OYF A;  1JLG A;  1HNI A;  3LWM A;  4Z0U A;  3OJU A;  3SJJ A;  3MXM A;  2FBT A;  1RTD A;  3M8R A;  1A5V A;  1S6P A;  4AHT A;  5J1E A;  4FLZ A;  4M3U A;  3NGI A;  3RR7 A;  1IG9 A;  4CGJ A;  2I5J A;  3ZT0 A;  2X78 A;  3E01 A;  1VK0 A;  4O5B A;  3G0Z A;  4C8M A;  4CEB A;  3L2W A;  3U3Y A;  4B8A B;  1YTU A;  2G8H A;  3LAK A;  4BE1 A;  2QKK A;  5KGX A;  3PUF A;  3ZSX A;  3DOL A;  1REV A;  4KV8 A;  4KO0 A;  3V9Z A;  3DLG A;  4M3X A;  2JLE A;  3L3U A;  4I2Q A;  4CHQ A;  3TAQ A;  4ZTF A;  2HVI A;  2A1S A;  3L2R A;  3V9X A;  1U45 A;  5JS1 A;  5CZ1 A;  3AVM A;  4Q0B A;  2P1J A;  1X9M A;  2VWK A;  1J53 A;  4HCB A;  2F96 A;  1IO2 A;  3VQ9 A;  4BE2 A;  4AHU A;  1QSS A;  3U3G A;  2KFZ A;  3K5M A;  1U49 A;  3QIN A;  3M8Q A;  4N5S A;  3OS1 A;  1NK5 A;  2IDO A;  1S5J A;  3ZSO A;  1ITG A;  1VSK A;  3KLH A;  5HRS A;  2W42 A;  1FXX A;  2E6L A;  4CJV A;  2XY7 A;  3S3N A;  4F4K A;  4KHU A;  3SNN A;  4ICL A;  4Y1C A;  3VQE A;  3HPO A;  1A5W A;  4CER A;  4FYD A;  1EET A;  3AVK A;  1SV5 A;  4QCL A;  3T3F A;  1VSE A;  1X9W A;  4B9U A;  5KRS A;  3P5J A;  3IG1 A;  3LP2 A;  4OJR A;  4JS5 A;  1NJZ A;  1T05 A;  3KK1 A;  2QK9 A;  4ZTJ A;  1TKD A;  1JLB A;  4J2D A;  4N76 A;  3AO1 A;  3KJV A;  1Z25 A;  3NBP A;  4BWJ A;  3NHG A;  2EX3 A;  4FLU A;  1HNV A;  1EKE A;  1Y97 A;  1F21 A;  3CFR A;  1LWE A;  5FDL A;  4EP4 A;  1NKE A;  3DLR A;  3O4N A;  3TI0 A;  2RKI A;  2ZQB A;  1HQU A;  4DU4 A;  1RTH A;  4Q5V A;  3LZI A;  3SUO A;  4M3W A;  4DTR A;  3NGZ A;  4DQI A;  4HTU A;  1J9A A;  1WN7 A;  3P1G A;  4OPK A;  3TAF A;  4I9L A;  4HHT A;  4FVM A;  1L5U A;  1JLQ A;  1S1X A;  2GUI A;  3OJS A;  4FK2 A;  2JGU A;  4BWM A;  4DTJ A;  3LWL A;  3K5N A;  1RTJ A;  3CFO A;  1ZBU A;  4H8K A;  4B9S A;  5FRM A;  2GV9 A;  3LPU A;  3ZSZ A;  4DSI A;  1JLF A;  3VQ5 A;  2F8S A;  1DLO A;  5KGW A;  1L3S A;  3TAB A;  4DG1 A;  1Q9X A;  1GOA A;  1QSL A;  3ZSQ A;  1CXQ A;  1TK0 A;  4J2A A;  1S1U A;  2QXF A;  4E1M A;  1BCM A;  2B5J A;  3KK3 A;  3HST B;  4LY7 A;  4M3R A;  3ZT2 A;  1BIS A;  3TWH A;  2KTQ A;  4DTX A;  4B8C A;  2O4G A;  4FJM A;  3L2Q A;  1CZB A;  1RBV A;  1RDD A;  3V81 A;  1NKC A;  1HYS A;  4FJG A;  4KFB A;  3VQD A;  3SUQ A;  3NH2 A;  4W5Q A;  4NCG A;  4FJ5 A;  3S3O A;  3SYZ A;  4DS4 A;  1TKT A;  2YV0 X;  1LWF A;  3TR8 A;  3LP0 A;  1JKH A;  3V1Q A;  3NDK A;  5FRO A;  4CJP A;  1SL1 A;  3B6O A;  4B08 A;  1HJR A;  2IS3 A;  5JS2 A;  3DRP A;  1IKY A;  3VQB A;  2R7Y A;  2G8W A;  4CEA A;  2NUB A;  3L2U A;  4DF8 A;  3V9U A;  4IG3 A;  1UA0 A;  3S9H A;  4CFC A;  1SKW A;  3TAN A;  1UWB A;  4CFB A;  3KD5 E;  4I9Q A;  1JLA A;  1RBU A;  1J54 A;  1NK8 A;  3IRX A;  3MXI A;  3TAM A;  4F3T A;  4Y1D A;  4RW7 A;  4CJW A;  4OLA A;  4RG8 A;  2Y1J A;  4F8R A;  3C6U A;  3TAR A;  5J2P A;  1LW0 A;  4HCC A;  1KVC A;  1RDB A;  4DF4 A;  1C1C A;  3AVL A;  2B4J A;  3MEG A;  3HXM A;  1R0A A;  5I42 A;  3SZ2 A;  3QES A;  4E0D A;  1BIZ A;  3K57 A;  3HJF A;  4CIG A;  4DMN A;  4OLB A;  4Z4H A;  1C1A A;  4GW6 A;  5KTQ A;  3PY8 A;  5DK5 A;  3NFA A;  5C25 A;  3THV A;  4Z4E A;  3AVN A;  3HP6 A;  3HPH A;  5FRN A;  1B9F A;  3RMD A;  2DY4 A;  1T7P A;  2PY5 A;  3RWU A;  4UQG A;  4GVM A;  4N47 A;  1KLM A;  4B3O A;  4PA1 A;  2HVH A;  4CED A;  1LV5 A;  4CHN A;  3OYD A;  1L3V A;  3UIQ A;  3ZSR A;  1JLC A;  3C94 A;  4ID1 A;  4WE1 A;  4DFM A;  2Z1J A;  1BHL A;  1IH7 A;  3LAL A;  4FLY A;  2OZS A;  3AVH A;  4B9M A;  1I3A A;  4ID5 A;  2XY8 A;  4FM0 A;  4EZ6 A;  3QEW A;  3AA3 A;  1RT4 A;  1JLE A;  3ZSY A;  1UOC A;  4BDZ A;  3AVA A;  1QTM A;  1FK9 A;  1FKO A;  2RF2 A;  3WNG A;  4DTP A;  3SV3 A;  4O0I A;  4KB0 A;  4PUO A;  1VSL A;  4DLE A;  1S1W A;  5J2Q A;  4CGF A;  3LDS A;  4FM1 A;  2FBX A;  1LAW A;  3EZ5 A;  4BDY A;  3U6F A;  3OVN A;  3PX4 A;  1NJX A;  4B9N A;  4KHN A;  3ZCM A;  2VG7 A;  3ITH A;  3OY9 A;  3KTQ A;  3OYH A;  4N56 A;  5DMR A;  4C8L A;  4CJF A;  1VSI A;  4O55 A;  3KLE A;  4KRE A;  2B6A A;  5KRT A;  4FZZ A;  1MU2 A;  4CJK A;  3V4I A;  3KKR A;  3ASM A;  5SZT A;  1RCH A;  3NF9 A;  1GOB A;  1VRU A;  3IS9 A;  2IOC A;  5HP1 A;  2VWJ A;  2VG6 A;  1NK9 A;  1J5O A;  3QEX A;  4JLH A;  2HHT A;  3MED A;  4FLX A;  4E7L A;  1IKV A;  4B9V A;  4FK0 A;  1RDC A;  1RT1 A;  3V1O A;  2A1R A;  3ULD A;  3ZSW A;  4CF9 A;  5HRN A;  3K58 A;  1UAX A;  4M45 A;  4FJ8 A;  1C1B A;  2HND A;  2PYL A;  3KD1 E;  1WSE A;  4CGD A;  2EHG A;  3OYG A;  3OYJ A;  4FK4 A;  4NYN A;  3AVB A;  3T19 A;  2Z1G A;  1JL1 A;  1QQC A;  5C42 A;  4HUE A;  3SCX A;  4L8R B;  2VG5 A;  3AVC A;  2KZM A;  4HVJ A;  3MEE A;  3F73 A;  4RW6 A;  4AH9 A;  3ISN C;  1RT5 A;  3KLG A;  2PZS A;  1XWL A;  4RW4 A;  3OS0 A;  4FLT A;  1NK0 A;  4JRQ A;  3VQ4 A;  2ITG A;  4DFK A;  3A2F A;  4G1Q A;  1HMV A;  3VQ8 A;  2XO7 A;  4CJQ A;  1CLQ A;  1YT3 A;  4CK3 A;  4CGH A;  2YHA A;  3RRG A;  3DMJ A;  4DSE A;  1Z26 A;  3LAN A;  1C0T A;  4ELU A;  4KHY A;  1QSY A;  4IFY A;  1X1P A;  3DLK A;  3HT3 A;  4FLV A;  4CGG A;  1BIU A;  3T1A A;  4TSX A;  1WAF A;  4FW2 A;  1RBR A;  4DWI A;  3O3F A;  3M8S A;  1NK6 A;  2Q3S A;  1T8E A;  1C0M A;  3HK2 A;  4O0J A;  1WSH A;  4DU1 A;  4H4M A;  1A5X A;  4H4O A;  3JSM A;  4I2P A;  3JYT A;  4HUF A;  4DTS A;  3SQ2 A;  1QHT A;  4OKJ A;  2D0B A;  1SL0 A;  2WON A;  3LPT A;  3O3G A;  1WSJ A;  3O3H A;  4XIU A;  3SQ4 A;  4CFD A;  3F9K A;  4AHS A;  2HB5 A;  2FBV A;  1S9G A;  2FBY A;  3DM2 A;  4ZHR A;  4ELV A;  3QIP A;  1HYZ A;  3VQQ A;  3PO5 A;  4FJH A;  2BGG A;  1NOZ A;  1C6V A;  4NCB A;  3B6P A;  3HVR A;  4FJ9 A;  3O4Q A;  1BI4 A;  3RMB A;  4BAC A;  3LP1 A;  4PWD A;  1Q9Y A;  5HRR A;  4LH5 A;  2BAN A;  1NJW A;  3AVJ A;  2HNY A;  1WSF A;  1SKS A;  1N6Q A;  3SI6 A;  4CF8 A;  2GBZ A;  3HYF A;  4YFU A;  2DFH A;  1S1V A;  2YHB A;  1WSG A;  2YNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...