2HB5A

Crystal structure of the moloney murine leukemia virus rnase h domain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
155
structure length
150
Chain Sequence
HGTRPDLTDQPLPDADHTWYTDGSSLLQEGQRKAGAAVTTETEVIWAKALPAGTSAQRAELIALTQALKMAEGKKLNVYTDSRYAFATAHLTSEGKEIKNKDEILALLKALFLPKRLSIIHCGHSAEARGNRMADQAARKAAITETPDTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Crystal Structure of the Moloney Murine Leukemia Virus RNase H Domain.
pubmed doi rcsb
source organism Moloney murine leukemia virus
molecule tags Hydrolase
total genus 38
structure length 150
sequence length 155
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hb5A00
1RBSA 1HRHA 1Y97A 4CECA 2PYLA 4AHRA 3OS1A 2IOCA 1X9MA 2G8VA 4E3SA 4C8OA 2ZD1A 2HB5A 1U45A 1L3TA 3ISNC 4CJTA 1LWFA 1C1CA 4C8KA 3QLHA 4M3XA 4C8NA 1FK9A 1RT1A 3AO4A 3SV4A 1ZYQA 1YVUA 1BI4A 4CGHA 5D3GA 4W5OA 2YHBA 1YTUA 1K6YA 4CIGA 1S5JA 1W9HA 5HRPA 4XIUA 3OYJA 1TK8A 3OYKA 1SV5A 4CK3A 4E7JA 3AVIA 2GV9A 3NBPA 4GMJB 3WNHA 3L2QA 2B5JA 4PUOA 4FK4A 3BGRA 1WN7A 1IKXA 4BDYA 3QETA 2WOMA 2DFHA 3V1QA 3DM2A 4HVJA 4F4KA 4CEZA 4CJEA 3S3NA 4Z4IA 4CE9A 4Z4GA 3SYZA 1SKRA 4NCAA 3HYFA 3JYTA 2ITGA 1S6PA 1JKHA 3QINA 4AHSA 3LAKA 3IRXA 4BE2A 2Y1IA 3HXMA 4BDPA 4QOZB 4B9LA 3AVBA 3RTVA 5I42A 1NJZA 1EETA 1XWLA 1VSLA 4CJVA 4DTPA 3U6FA 4KI6A 3SUOA 3ZCMA 4M3UA 5KI6A 5J2PA 4W5QA 2YNFA 4OGCA 4CIEA 1NK5A 1RBRA 2HHTA 2OPSA 2W42A 1QSLA 1ZBHA 1NK8A 1NJXA 1KRPA 4HHTA 1WSHA 1WSEA 5JS1A 3DLGA 4DU3A 3T1AA 4KO0A 3KLIA 1BISA 4ICLA 2A1SA 2RF2A 3B6PA 4IDKA 4CJ5A 4Q0BA 2HVIA 4OPKA 1NKCA 5KGXA 4KTQA 4E89A 4FM2A 1RBVA 1J9AA 4BWMA 3SQ0A 3AV9A 1R0AA 1L3VA 1T03A 1IKWA 4F2SA 4B3OA 4IG3A 4B9VA 5EU7A 3SJJA 1EP4A 1FKOA 3QIPA 4M3RA 3TAQA 2NUBA 1RT4A 3SQ1A 3I8DA 3TAGA 3L2RA 1RTIA 4H8KA 3QEWA 3L2WA 4CHPA 4DS5A 4OGEA 3OVNA 4DFJA 1B9DA 3P83D 4CF1A 1WSJA 3VA3A 1EX4A 2B4JA 2D0CA 4B08A 3SUPA 1RDAA 2OA8A 4CEDA 3SUNA 3A2FA 2HNYA 3KLFA 3G10A 1TKXA 1HYZA 3M8PA 2VWJA 3S3OA 1Q9YA 2FBXA 3KD1E 3K5OA 2F8SA 3VQBA 3ZT0A 3KLEA 4B9NA 1LW2A 4Z4FA 4LH4A 4KTWA 2Z1HA 1KCFA 3CYMA 1QTMA 4ELUA 4KREA 3SZ2A 4FK2A 3O4NA 3L8BA 5CY4A 4FLWA 1X9SA 1RDDA 5KRTA 4FLXA 3SPYA 2F96A 1LAWA 3MXIA 4O0JA 3VQ9A 3V9XA 3KKRA 2VG5A 4ID5A 4CHYA 1HNIA 3PY8A 4FYDA 2KFZA 2EX3A 4LSNA 3ZSVA 1VSDA 1RDBA 4Z0UA 1RILA 1GOCA 4N47A 3HT3A 3V9ZA 2KW4A 1IKYA 4I9LA 1HYVA 3QEPA 4W5NA 2P1JA 2XRIA 3NFAA 5HP1A 4FZXC 2QK9A 1KSPA 3L2UA 4IFVA 4Z4CA 1ZBFA 4FK0A 4OKKA 3K2PA 1RTJA 3L3UA 4KHWA 4EP5A 4CERA 1IKVA 3NAEA 4M3TA 4RW9A 4DF8A 4AH9A 4F8RA 2HW3A 4IG0A 4CGIA 4JRQA 1KLMA 3MXJA 3SUQA 4NYNA 3L2VA 4DSLA 1L3UA 1S1WA 1SKWA 2DY4A 1O1WA 4R5PA 1VSJA 1GOAA 4Y1DA 4DQPA 2BGGA 3HJFA 2O4GA 4KPYA 3RMAA 4B9TA 4CFAA 4JS4A 4HTUA 4RW6A 3AVMA 2G8UA 3DOLA 1QHTA 1DTQA 1HMVA 4UQGA 3PUFA 2Z1JA 3M8RA 3ZSQA 3OYDA 3V1RA 3ZT3A 4CJRA 4J2BA 3RRGA 1GOBA 1BIUA 4BE1A 2P5GA 1TL1A 5FDLA 3RRHA 2XY7A 3AA4A 4AHVA 3NE6A 4BACA 2YNHA 3V9SA 4KV8A 5HRSA 3B6OA 4CF9A 5SZTA 3SQ2A 1U47A 4N5SA 3MEEA 1D9FA 2FBTA 1RNHA 5HBMA 1WNSA 2IS3A 1JLBA 3QNOA 1SUQA 4JS5A 1DTTA 3LWMA 4KHUA 3NF9A 1LAVA 2XY6A 1QS4A 3HPHA 1KTQA 4CJKA 1BGXT 5CYQA 3EY1A 3EZ5A 3SV3A 4FVMA 5I3UA 4L8RB 2OPPA 3KTQA 1U04A 3HPGA 1XC9A 1TVRA 3DYAA 2KZMA 3MEDA 4I7FA 3OYEA 3U3YA 1X1PA 4FCYA 1UA0A 4O44A 1TKDA 4K8XA 1TV6A 1BI4B 3LPTA 4FJKA 1QSSA 2DTUA 4KKOA 4DLGA 4WE1A 3THVA 1S9EA 1JL1A 1Z25A 5K14A 4ZHRA 4BE0A 1W0HA 2ZE2A 1BCMA 2YNIA 4CK1A 2QXFA 1JXEA 3SPZA 4DTMA 4FJLA 4NCGA 2QKBA 1C0MA 3WNFA 3ZT4A 1S1UA 3AVAA 3ZSYA 1VK0A 4DSEA 1TKTA 3CG7A 3RMDA 1U4BA 2X78A 4CHZA 1J53A 3NH0A 2E6MA 4DQIA 3OYIA 3SQ4A 1N5YA 4ID1A 1ZBUA 4N41A 4ZTFA 4CJSA 3MECA 4O55A 3VQ8A 1HPZA 3S9HA 1NOZA 3ZT1A 3CQ8A 3LZJA 1N6QA 2FBYA 3PX0A 4OJRA 3VQPA 4Z4EA 2A1RA 5KTQA 4DSFA 4M45A 3K59A 2DFEA 4JLHA 5J1EA 1B92A 3HPOA 1L5UA 3OYCA 2O4IA 3NHGA 4FZZA 2JLEA 4DFMA 4FLUA 1SKSA 1RBTA 3QEXA 4E7LA 3AVJA 1UOCA 1KLNA 4FZYA 4RW8A 2IC3A 4E7HA 3HP9A 1S1TA 4DFPA 1F21A 2BANA 4C8LA 4AHTA 2XHBA 3AA5X 4PY5A 1HNVA 5J2MA 1BQNA 1RCHA 1I39A 2VWKA 2RKIA 1WSGA 3VQCA 1KVBA 2HHSA 4DWIA 3V4IA 5CZ1A 4RW7A 4HUEA 4DSJA 1A5XA 1D9DA 2OYQA 2RN2A 4CEOA 1BL3A 4Q5VA 3V81A 1EKEA 1NKEA 2G8IA 4FXDA 1RT5A 2Z1GA 3LP0A 4DTOA 3TI0A 5HLFA 2IGIA 3LP2A 3LZIA 1WSFA 2XO7A 3L3VA 4RW4A 5CYMA 3QIOA 3TWHA 2G8KA 4CHQA 3IS9A 2G8FA 4YNQA 1BIZA 1U49A 3DRSA 1IG9A 2G8HA 3NF6A 1TKZA 3AVCA 4B8AB 3OJUA 2EHGA 4ZTJA 1U48A 5FRNA 3NH1A 3DRPA 4HUGA 4DSIA 1UWBA 5DK5A 4C8MA 3ZSXA 4DF4A 1JLGA 4DLEA 1TK0A 4FM0A 2HHQA 3DLRA 4DU1A 1C0UA 1D5AA 1JLQA 4FLZA 4AHCA 4CFDA 2X74A 1VSFA 4CGGA 4CJ3A 3F9KA 4M41A 1S6QA 1HQUA 1BQMA 3O3FA 4W5TA 4MFBA 3AA3A 1RT3A 4CJQA 1HJRA 4W5RA 4CIFA 4CF0A 2HVHA 4CJPA 2PY5A 3NGYA 3S3MA 1BCOA 1FXXA 3LP1A 1CZ9A 3HL8A 3SI6A 1C1AA 3AVKA 1BHLA 4Z4HA 4CHNA 5J2NA 1JXBA 3V6DA 3C95A 3LALA 3AVFA 4CJ4A 4DTJA 1KFSA 5C24A 4FJMA 4GW6A 2OPQA 1S9GA 3ZSWA 3KKSA 2HNZA 3KLGA 3MAQA 1VRTA 4DTNA 3RWUA 3HSTB 3VQDA 2E4LA 2E6LA 3TR8A 1IH7A 1D8YA 1LWEA 1A5WA 2IDOA 3WNEA 5C25A 4E0DA 3AO1A 5FRMA 1Z26A 4AHUA 4G1QA 1ZBLA 4J2AA 1TAUA 3V9WA 4DS4A 1L3SA 3KLHA 4DSKA 1WLJA 3HP6A 3VQ4A 2ATQA 3VQ6A 3F73A 1C0TA 4O0IA 2PZSA 2HNDA 2GUIA 4BDZA 2XY5A 4CJUA 3HO1A 4JRPA 3K5MA 4J2EA 1JLFA 3U3GA 1DLOA 2VG7A 3VQ5A 4CEEA 2R7YA 2QKKA 3WNGA 4B9MA 4CFCA 3RR8A 4OLAA 4OVLA 4CJFA 1NK7A 2PYJA 4B9UA 3HK2A 1QE1A 1FKPA 3NGZA 4MQ3A 4OKEA 2KQ2A 3IG1A 3KIOA 4GVMA 1QQCA 3LANA 1SL1A 2HHXA 3C94A 1VSKA 3JSMA 4IKFA 4KAZA 1G15A 3KD5E 1S1XA 3P5JA 4DQSA 3RR7A 1EXQA 1VSEA 1KFDA 3I0SA 4LY7A 1JL2A 4E19A 1C6VA 5HROA 4KB1A 3FFIA 4KFBA 1I3AA 3VQQA 4IFYA 3VQ7A 3ZSZA 4H4OA 3NH2A 3EYZA 4FM1A 4I9QA 3OYMA 1ZBIA 2ETJA 2X6SA 3TAMA 3CFRA 2YKNA 4E7IA 3NCIA 4RG8A 4KHSA 3DRRA 3MEGA 1TAQA 3CFPA 1B9FA 3OYHA 3OJSA 4EP4A 4N76A 2RPIA 4CF2A 3PO5A 1NK9A 4K8ZA 4CESA 3DMJA 2Z1IA 1J5OA 2OZSA 4QCLA 4O4GA 1RT7A 4HUFA 4B8CA 2BDPA 2GBZA 4KTZA 3OYBA 3KK1A 4FLYA 4OLBA 3VQEA 3DLEA 1CZBA 1NK0A 3CM6A 4LH5A 4CGDA 4E7KA 1IO2A 4PWDA 1LWCA 2I5JA 1NJYA 4YFUA 4F2RA 4E1MA 3NF7A 5KRSA 4FW2A 2F8TA 3O4QA 3DI6A 3ZSRA 1NK6A 2Q3SA 4FJIA 4FLVA 4M42A 2HHWA 1XI1A 3TAPA 4KHYA 4OPJA 3AVLA 3K58A 4CFBA 5T7BA 3VN5A 4DTUA 2YKMA 1NJWA 4Y1CA 1ASVA 4PA1A 3E01A 1JLCA 1S1VA 1YTAA 3RMBA 1LW0A 4DG1A 3P1GA 1NK4A 3AO2A 1VSMA 1A5VA 4EZ9A 3ITHA 1SL0A 3K5NA 3H08A 3T3FA 3QERA 4M3ZA 4QAGA 4FJ5A 1SL2A 3LPUA 4OKJA 1WSIA 3O3GA 3OYAA 4O5BA 4NYFA 2D5RA 4M3WA 4FJ7A 3AO5A 5C42A 1VSHA 4KRFA 3QNNA 4I2QA 1TGOA 3DOKA 1NOYA 4DQRA 3AVHA 5JS2A 1REVA 1WAFA 1C1BA 5J2QA 3LWLA 4FJHA 4F3OA 4FJNA 3I0RA 3K57A 3MXMA 4DMNA 1CLQA 1MU2A 2HHVA 2FC0A 4DQQA 4FW1A 3O3HA 3PV8A 3LAMA 3VA0A 3UIQA 4KHNA 4B9SA 2BE2A 3AO3A 4CEBA 4NCBA 4KI4A 1UAXA 3QO9A 4CEAA 3OYNA 1ITGA 4CK2A 2HHUA 2Y1JA 1RTHA 3CFOA 4H4MA 4DFKA 1T05A 1Q8IA 1JLEA 3DLHA 3HVTA 4DTXA 1RDCA 2P51A 3SNNA 1T7PA 2KFNA 3NDKA 3ASMA 3ZT2A 1QSYA 4CCHA 3OYLA 2YHAA 4I2PA 3QESA 3TAFA 1TL3A 3T19A 4FJXA 4FJ9A 4KHQA 1HYSA 3D45A 1VSIA 3C6UA 2FBVA 4FJJA 2DFFA 1RTDA 4PQUA 3NGIA 4CHOA 1Q9XA 3K5LA 4F3TA 1RBUA 4DTRA 4CEQA 3ALYA 4IBNA 3OYFA 5E41A 1ASWA 3KJVA 1HQEA 3OS2A 2YV0X 2D0BA 4KB0A 2WONA 2OPRA 1X9WA 1WAJA 3TABA 3LP3A 3PO4A 5HRRA 3OY9A 1T8EA 2KZZA 2XY8A 3HVRA 5DMRA 1ASUA 2P5OA 4FJ8A 2KTQA 3RMCA 5CZ2A 3LDSA 2X6NA 3QEVA 3M8SA 3ULDA 4DTSA 1J54A 4LSLA 2JGUA 3HM9A 3C6TA 2VG6A 2ZQBA 3OYGA 5FROA 3KK3A 4CJLA 2D0AA 2B6AA 4TSXA 1CXUA 2IAJA 3G0ZA 4CF8A 5SWMA 3PX4A 1VRUA 2LSNA 4AILC 3KK2A 4J2DA 2G8WA 4HCBA 4CGFA 3M8QA 1YT3A 3AVNA 4FJGA 3AA2A 4LD0A 1TK5A 4EZ6A 4DU4A 1JLAA 3TARA 4ELVA 3IAYA 3TANA 1UA1A 3TAEA 3SCXA 5KGWA 5HRNA 4BWJA 1CXQA 4CGJA 2OZMA 4CJWA 4ELTA 3QEIA 1RT6A 1RT2A 2YNGA 3ZSOA 1XHZA 4HCCA 2AJQA 4M3YA 4FLTA 3AVGA 3D0PA 1KVAA 1LV5A 4CEFA 3DLBA 1NKBA 3V1OA 3OS0A 3BDPA 4N56A 2HMIA 3NF8A 3V9UA 3PX6A 1KVCA 3VQAA 3CM5A 1XHXA 3DLKA 4E1NA
chains in the Genus database with same CATH superfamily
1HRHA 1Y97A 2PYLA 1L3TA 2P9KA 3BY5A 3CJBA 3ISNC 4DV6K 1LWFA 5AQPA 4C8KA 4M3XA 5HOOA 3AO4A 1YVUA 4BQLA 1YTUA 4DB3A 3OYJA 5HRPA 1NGBA 3AVIA 3NBPA 1WN7A 3O1BA 4BDYA 2WOMA 4U7BA 4PKHA 3S3NA 3EEQA 3O9TA 1JKHA 5F2RA 2Y1IA 3QBWA 4LFBK 4QOZB 2A42A 3AVBA 3TTDA 1XWLA 3FLCO 4JD2B 4JI5K 4CJVA 2F9TA 1Q82O 4M3UA 3QDKA 5KI6A 3PIPL 3UKUB 5J2PA 3CC7N 1QSLA 3IMXA 2OANA 1JJ2M 1KRPA 1WSEA 5JS1A 4DU3A 2UU9K 3T1AA 4KO0A 5TKYA 1HKBA 3KLIA 1SAZA 4ICLA 5AQQA 4U67L 3QMLA 5IT9O 1NKCA 1U6ZA 4KTQA 1J9AA 5FPMA 3BZCA 5JVGL 2HHHK 1EP4A 1FKOA 3AAPA 3QIPA 4M3RA 3TAQA 3O08A 1RT4A 3I8DA 3L2RA 3L2WA 4DS5A 4OGEA 5AFUA 1Y64A 4HTLA 2P9PA 3CI5A 2OA8A 1TKXA 1HYZA 2VWJA 3S3OA 1Q9YA 2FBXA 3SAGA 3KD1E 3TSUA 2UUCK 4YOWA 3ZT0A 2O8FB 4KTWA 4K41A 1KCFA 3CYMA 4FK2A 1X3MA 4JNEA 5CY4A 3G6EN 4JI3K 1RDDA 5KRTA 2F96A 3DXMB 4FWMA 3VQ9A 3U4LA 3MX2A 5AQKA 3PY8A 2EX3A 3ZSVA 4DV4K 5M1OA 5JMVA 3BEXA 3AAQA 1HNWK 2Q36A 4W5NA 3NFAA 2QK9A 1ZXOA 3L2UA 4JI4K 3CD6N 3K2PA 1RTJA 5LMNK 4F8RA 4DHYA 3SK3A 3L2VA 3CC4N 3CF5L 4LFAK 1SKWA 3MN7A 1O1WA 4DQPA 3WXIA 3HJFA 4BG8A 4WQ5C 4B9TA 2ASPA 3CJ7A 1RGIA 2W40A 2JWLA 5BRFA 1QHTA 2WC9A 3M8RA 3JS6A 3OYDA 1GOBA 1BIUA 3A5MC 3RRHA 5FDLA 1NGHA 4AHVA 4JI2K 3H3OB 4JKBA 5SZTA 4CF9A 1ATRA 2UXBK 3VGKA 1XMOK 4JS5A 1DTTA 1LAVA 2XY6A 1QS4A 4BR2A 1BGXT 3H6EA 3EY1A 3SV3A 5I3UA 3ZEUA 3J7AP 4H5NA 2OPPA 1U04A 3O6WA 3DYAA 4I7FA 4K8XA 3U3YA 1TUYA 1UA0A 4O44A 4FJKA 4Y0WA 1QSSA 3WEEA 4KKOA 1BG3A 1IG8A 1NU0A 1E4FT 2YNIA 2ZGZA 3SPZA 3ZT4A 2NRHA 2P9LB 1S1UA 2A3ZA 1S72N 1TYQB 4CD1A 1TKTA 2PBDA 1J53A 3NH0A 4H0PA 3SQ4A 4CJSA 3MECA 3L4IA 1OH6A 3SAFA 3VQ8A 4H0OA 3O4WA 3ZT1A 5MLCQ 1VQ4N 2DFEA 1B92A 3HPOA 4IJAA 1NBWA 2O4IA 3NHGA 3M1FA 2I7PA 3ZETB 1NGEA 4IZ9A 4RW8A 4DFPA 1S1TA 4BVOA 4Z94A 4C1NK 4C8LA 1VQ6N 2HF4A 1KVBA 3V4IA 4GKKK 2RN2A 3V81A 3PLAA 4DTOA 4B1XB 3TI0A 3LP2A 3LZIA 4WCEL 3BP8A 1DKGD 3IS9A 4YNQA 3DRSA 3OJUA 1QVFM 4HUGA 4DSIA 1YI2N 4C8MA 4CZGA 5LJWA 3DLRA 4DU1A 4IOCL 4CGGA 2A40A 2F9WA 4DUYK 4IOXA 3LDOA 3A5OC 4BRMA 3H3NO 3O3FA 4W5TA 3L6QA 1HJRA 3RSEA 4CIFA 2HVHA 4CJPA 3LP1A 4FWKA 4H5WA 3SMPA 2QA4N 3C95A 3LALA 5AQHA 4YDUA 4CJ4A 1HKGA 3KLGA 4DTNA 1VRTA 3HSTB 2NRVA 5AQRA 3WNEA 5FRMA 1ZBLA 5GIPA 3HP6A 3VQ4A 3VQ6A 1C0TA 2PZSA 2XY5A 4CJUA 3K5MA 4J2EA 2ZWHA 1DLOA 1ESVA 4B9MA 2QWPA 1BOTO 4OLAA 3R9PA 4CJFA 4B9UA 1FKPA 2KQ2A 3IG1A 4GVMA 4YOYA 2HHXA 3G4SN 4KAZA 2UXCK 1EXQA 3I0SA 1JL2A 4RWTA 1XHZA 3VQQA 3VQ7A 4H4OA 5AZIA 1ZBIA 3M6GA 4O8UA 4ILGB 4RG8A 3C6AA 4LF6K 1B9FA 5AJ3K 1NGJA 4JKAA 1EO1A 3LDLA 2Z1IA 2OZSA 4JN4A 3EL2A 1NNEA 2HOEA 5CHIA 2GBZA 3JXUA 3OYBA 3FGUA 3LM9A 3KK1A 2P9UA 2EWSA 1LWCA 2I5JA 3OBYA 4YFUA 4KH6A 4E1MA 1NGDA 5LY3A 3DI6A 2HHWA 1XI1A 1U2VA 5BPLA 1E4GT 3VN5A 4DTUA 4JKHA 1ASVA 2ASMA 4CBUA 4IOAL 1JLCA 1YTAA 1LW0A 4DG1A 1S3XA 4BRQA 4QS7A 2P9IA 1VSMA 1A5VA 3ITHA 4A5AA 3QERA 3KZBA 1HPMA 1ATSA 3DWLA 4GY2B 4O5BA 4NYFA 3E66A 2P9NA 4I6MA 4FJ7A 4GNIA 4DQRA 2NLXA 3AVHA 4FJNA 1WBDA 2FF3B 3JAMO 1N33K 2ZJRL 2VQFK 4JHDA 3WUHA 3VA0A 5AR0A 1X9JA 4KHNA 4LF7K 5TKWA 1UAXA 3P39A 2BUPA 4BRGA 3OYNA 1GLLO 2Y1JA 1RTHA 1T05A 1FJGK 1JLEA 1RDCA 3SNNA 1T7PA 2KFNA 3GG4A 3D2FB 1GLAG 3FR0A 4I2PA 3QESA 2Q0UA 4WQ4A 3HTVA 1YJWN 2FBVA 2FXUA 1RTDA 1BO5O 3CERA 4CHOA 1Q9XA 3I33A 1W2BM 4FPAA 4H0TB 3ALYA 3DAWA 3OYFA 5E41A 1ASWA 3N4QA 3DXKA 4GV3A 3TABA 5HRRA 4LFCK 2KZZA 5AQVA 4FJ8A 5DMRA 1ASUA 5CZ2A 3LDSA 2X6NA 3T7ZA 3QEVA 3ULDA 1YAGA 3KHYA 2JGUA 1EQYA 1QZ6A 4IFEA 3OYGA 5FROA 3HRGA 3MWTA 4DV2K 2IAJA 3FZFA 5M1PA 4WFBL 5SWMA 3O1WA 4JI8K 2LSNA 4IO9L 3AA2A 4DU4A 4EIAA 4ELVA 4JKGB 1MWMA 3BF1A 3IAYA 2GX9A 3TAEA 5HRNA 5I9EB 1RT2A 2AJQA 3PSFA 4CI6A 3AVGA 3D0PA 1KVAA 1LV5A 1NKBA 3V1OA 4G9ZA 1KVCA 5JLFA 3VQAA 1XHXA 4E1NA 4WFAL 4AHRA 2G8VA 4BR9A 4E3SA 3CJ1A 3CJAA 2ZD1A 4L3QA 1OH8A 4IEEA 3QLHA 4R79A 1TUUA 4KBOA 1BI4A 2O8DB 3G71N 3C7NB 1VQ7N 1VQMN 4E7JA 3L2QA 3CCQN 3WNHA 4GMJB 4FK4A 2B5JA 1IKXA 3QETA 3DM2A 1Z6RA 4Z4GA 3VEOA 2P9SB 5DM6L 4CE9A 1J6ZA 3VESA 4BDPA 4AHSA 1KXPA 3HXMA 3CPEA 1VSLA 4FWOA 2YNFA 3THYB 1NJXA 3DLGA 3ULEB 4FWQA 4DR6K 1NGAA 2RF2A 1K8KB 3B6PA 4M63C 4CJ5A 3ZX2A 3ENOA 2QTDA 4E89A 3CCVN 4F2SA 1IKWA 3CCEN 4B9VA 3SQ1A 2E8AA 1V4SA 1BA1A 3MDQA 4H8KA 4DV7K 3G25A 3EZWA 1NGCA 3U9ZA 3E9OA 5AQXA 1B9DA 4CF1A 1WSJA 3VA3A 4O5FA 2D0CA 5C0YA 3PIOL 1RDAA 4IWVA 3A2FA 5BPNA 3M8PA 4BRLA 3K5OA 2F8SA 3VQBA 4BRAA 2A6AA 4ILJA 5AQFA 1QTMA 3A0IX 3O4NA 1X9SA 3KK7A 3SPYA 4BC4A 5GAEP 1LAWA 2J4RA 3V9XA 2VG5A 3CCSN 4CHYA 4GV9A 3M5RA 4N47A 1SZ2A 2E5LK 1IKYA 4AQYK 2XRIA 4OPAA 3VMFB 4ISEA 4M3TA 4RW9A 4IG0A 4DR1K 1KLMA 5JICA 5AZJB 1L3UA 2DY4A 4R5PA 2BGGA 4BG9A 3CJCA 1RDUA 3ENHA 2HBMA 4KPYA 3RMAA 4HTUA 4A59A 3DOLA 1HMVA 2Q31A 2WUSA 3BZKA 2Z1JA 3MN5A 4BR5A 3ZT3A 3KWIA 3HOTA 3AA4A 5C10A 3NE6A 4CZFA 1LCUA 1OH7A 3MEEA 2D1KA 3UKRA 1WNSA 3WXMB 3LWMA 4KHUA 3HPHA 1KTQA 4CJKA 3EZ5A 3K0SA 4FVMA 4CVNE 4CJ7A 4L8RB 3KTQA 1TKDA 3EE8A 1W97L 4DLGA 4WE1A 1Z25A 4A61A 5K14A 1W0HA 4CK1A 4FJLA 5ADXH 2NRZA 1JXEA 2QKBA 5H1SQ 2PAVA 1QQMA 3H45C 4BR0A 4DQIA 2E6MA 1N5YA 3OW2M 4XH4A 3E9PA 1HPZA 3CQ8A 1VQLN 4BC2A 4IXCA 3PX0A 4OJRA 4Z4EA 2ZM6K 5KTQA 4M45A 3VEYA 1L5UA 3WT0A 3OYCA 5F1XA 4FZZA 3A8YA 2JLEA 5LMUK 3WXLA 3A5NC 4BR4A 4JD2A 2FLOA 2DPNA 1XMQK 3HP9A 3CCJN 1JCFA 2BANA 5E26A 2XHBA 3AA5X 3O8MA 5JLHA 1HNVA 2HHSA 4HUEA 2JWKA 1A5XA 4CEOA 1NKEA 3OTOK 3LP0A 2XO7A 4RW4A 5CYMA 4CHQA 1U49A 2GWKA 3NF6A 3AVCA 4ZTJA 2EHGA 3QB0A 1NM1A 3R3LA 4FO0A 4CFDA 2FSNA 4CBWA 4CJ3A 3F9KA 4B3RK 1S6QA 1BQMA 4CZLA 3D2EA 4BRKA 1DGKN 1RT3A 3R1XA 4W5RA 5AQNA 4CF0A 2O8FA 3S3MA 3HL8A 3QFUA 1C1AA 4M7XA 3AVFA 5C24A 3ZLJA 3CIPA 4X65K 2OPQA 1YF5L 3MAQA 3ZX0A 3RWUA 3VQDA 2NRXA 3O5BA 3TR8A 4BRPA 4C23A 5C25A 3IUCA 4AHUA 2FSKA 1TAUA 1P8ZA 3V9WA 4DS4A 4AM6A 3SMSA 3KLHA 4DSKA 5EX5A 5AQSA 2KHOA 4LF5K 3E9LA 4EFHA 4O0IA 2HNDA 3RVCA 2ZGYA 3HO1A 4JI1K 1HR0K 2OTLN 2QKKA 3RR8A 4CEEA 3EE9A 2O8EB 3HK2A 1CZAN 1QE1A 3NGZA 4MQ3A 4OKEA 4AM7A 3VEZA 5C2FA 1QQCA 4H0VB 3JSMA 3QFPA 3CCMN 5KPTA 1S1XA 4WQ5A 4DQSA 2G8IA 1VSEA 1KFDA 1I3AA 3Q7CA 3NH2A 3EYZA 4FM1A 5BR9A 1K8AO 4I9QA 3MK6A 2YKNA 3DRRA 3KVGA 3OJSA 3DJCA 4EP4A 3GDQA 4K8ZA 4CESA 2I7NA 4E1JA 1RT7A 1KAXA 3ZEUB 4GVEA 4DV1K 4FLYA 4OLBA 3DLEA 4LH5A 1IO2A 3F9MA 3WEEB 3NF7A 5KRSA 4M42A 4KHYA 4OPJA 2QWMA 3AVLA 5T7BA 1NJWA 2IVPA 4CZEA 1N8RO 4EHUA 1S1VA 5GAGP 3P1GA 3U9DA 3T3FA 4A62A 4JI0K 3ZX3A 1SL2A 3OHRA 4NO7A 2ASOA 3OYAA 1BU6O 4H5VA 4M3WA 4DR3K 3VETA 4I2QA 3DOKA 2UUAK 4B9QA 1VQKN 1C1BA 5J2QA 4FJHA 3I0RA 1C0FA 4OX9K 4DV3K 3MXMA 1W7AA 1MU2A 2FC0A 4FWNA 2ITMA 3AO3A 4KI4A 4OO1J 2FSJA 4CZHA 2QEXN 1K9MO 3D6RA 3DLHA 3HVTA 1MDUB 3ZT2A 4CCHA 3OYLA 3TAFA 3R6MA 4A2AA 3T19A 2UXDK 4ISFA 2W41A 4KHQA 1YJ9N 3C6UA 2CGLA 3NGIA 3K5LA 3TSQA 1X9WA 2OPRA 4DR7K 3LDPA 3F2KA 1T8EA 1BUPA 3VTHA 1YUWA 3T69A 3WXJA 1WOQA 1CXUA 4IJNA 5BRDA 1VRUA 4LF9K 4YOUA 5FPEA 2G8WA 3OA9A 1JLAA 1XQSC 1UA1A 3J8AA 5KGWA 3CXCM 5AZIB 2E2QA 1VQ5N 3I56N 4CEFA 3DLBA 2HMIA 3V9UA 4YHHK 3CM5A 5KPRA 1RBSA 3E1YA 4PL7A 3OS1A 3VGLA 1U45A 1XNRK 2P9UB 2VGMA 1MA9B 1OVYA 3I55N 1QHAA 4C8NA 1RT1A 3FZLA 2D0PA 2YI1A 3GOIA 3SV4A 1ZYQA 4PL8A 3WQTA 4W5OA 3NVKA 4V19S 1IV0A 4JYAK 1W9HA 4XIUA 3O9QA 4CK3A 2GV9A 4KREA 3BGRA 2DFHA 4F4KA 4CEZA 4K43A 3SYZA 5GAHP 1S6PA 3MN9A 4B9LA 3ENBA 3RTVA 1EETA 4DTPA 4KI6A 5GIOA 4W5QA 4BREA 4CIEA 1NK5A 2VQEK 1ZBHA 4HHTA 1WSHA 4IDKA 5M1FA 2HVIA 4OPKA 4DV0K 5M1NA 5KGXA 4FM2A 1RBVA 1IJJA 3H46O 4CBXA 4BWMA 3J80O 1R0AA 1R59O 2NRRA 4IG3A 5EU7A 1ATNA 5FLXO 5JVHL 4B3MK 4JHDB 3VF6A 3KWGA 4CHPA 2HBJA 3BF3A 3OVNA 4RTFD 3P83D 5ELZA 2KLAA 3SUPA 3VERA 3SUNA 3KLFA 3G10A 1EWRA 2D0OA 4UY8O 4QS9A 2WFBA 4B9NA 1ZBSA 4LH4A 2Z1HA 4ELUA 5AQMA 3P31A 3ATUA 3SZ2A 3D2FA 1WUAA 3L8BA 1KC8O 3DXKB 4O0JA 2KFZA 4LSNA 1G99A 4BRFA 1VSDA 1GLJO 2QWQA 4Z0UA 1YITN 5BRHA 3HT3A 3VEWA 1QQOA 2KW4A 3T1YK 4I9LA 1HYVA 4X62K 3QEPA 3P38A 1YHQN 4Z4CA 1ZBFA 1HKCA 3CQXA 3L3UA 4KHWA 2BTFA 4EP5A 3NAEA 1IKVA 5E84A 3EO3A 4DF8A 4AH9A 1DEJA 2HW3A 2UYTA 4CGIA 4JRQA 3MXJA 4NYNA 4DSLA 1NG9A 5AQUA 1GOAA 4Y1DA 2O4GA 4RW6A 1YVNA 3AVMA 2YHWA 1DTQA 4BQZA 3PUFA 5HL7L 3M3ZA 3O80A 3O9SA 3ZSQA 5LL6Z 3V1RA 3RRGA 2QW9A 4JKGA 2P5GA 3B6OA 4XH1A 3SQ2A 4MO5A 1U47A 4FVUA 2FBTA 1RNHA 4OPHA 5HBMA 2E88A 3QNOA 1SUQA 3NF9A 3THWB 3HI0A 3ATVA 2O8CB 5CYQA 4MO4A 2O8BB 1QQNA 3HPGA 1XC9A 2HMPA 3HZ6A 2KZMA 3CHWA 3OYEA 1X1PA 3CCRN 1TV6A 1BI4B 2DTUA 3UE5A 1C0GA 1S9EA 4ZHRA 4QS8A 3W3DA 1BCMA 2ZE2A 2QXFA 3R8EA 4CZIA 3ZSYA 1VK0A 3CG7A 3RMDA 1U4BA 4BRCA 2O8DA 3OYIA 3C7NA 4KH5A 4N41A 1ZBUA 1Q81O 4O55A 1N34K 4JK7A 1BWFO 3LZJA 5EVZA 2A1RA 3AARA 3L4QA 5AQTA 3K59A 4JLHA 5J1EA 2QWRA 2IVOA 4FLUA 1Q86O 4JAXA 1RBTA 3QEXA 4E7LA 1Q7YO 3AVJA 3NMUA 1KLNA 4FZYA 2IC3A 4AHTA 2RE2A 3THYA 1MWKA 1BQNA 1I39A 1T6CA 2RKIA 1WSGA 5CZ1A 4RW7A 2OYQA 2QWOA 1K8KA 2QWNA 4Q5VA 1EKEA 4FXDA 1RT5A 5HLFA 2E1ZA 2IGIA 1WSFA 3QIOA 3TWHA 2G8KA 3SBTA 1X3NA 2G8FA 1BIZA 1IG9A 2G8HA 4B8AB 3NH1A 3DRPA 5DK5A 3ZSXA 4DF4A 1JLGA 1GLFO 4FOIA 4DLEA 4FM0A 1TK0A 2HHQA 1C0UA 1GLEG 1JLQA 4DQ8A 1J5EK 4JK8A 4MDBA 1VSFA 3THXA 2V7ZA 4LF8K 2QI2A 4FWPA 1HQUA 2F4VK 3GL1A 4B1VA 5BREA 4BGBA 4MFBA 3AA3A 3MCPA 2YJFA 5KQDA 5B8HA 4KHPK 1FXXA 1CZ9A 1NJIO 3AVKA 4CHNA 1BHLA 4GKJK 1JXBA 1KFSA 4B1WB 4FJMA 4JKCA 4GW6A 1S9GA 3ZSWA 2HNZA 3IFRA 2E2NA 3LDNA 2E4LA 2E6LA 1IH7A 1D8YA 1LWEA 2IDOA 3O9UA 4E0DA 4G1QA 1WLJA 2ATQA 2HBLA 1JCEA 4KH4A 1QVGM 4BGAA 1HNXK 4JRPA 5EY4A 4K0KK 1JLFA 3U3GA 3VQ5A 2R7YA 1H1VA 3WNGA 4OVLA 1NK7A 5AZJA 3TSPA 4BY9C 2E1YA 2UUBK 1SL1A 1VSKA 4A57A 3KD5E 2E2OA 4KFBA 3ZSZA 2Q97A 3OYMA 3TAMA 3CFRA 2W6KA 4E7IA 5LJVA 3NCIA 3LL3A 4KHSA 3MEGA 2P9KB 4NLBA 3OBWA 1XC3A 1IBKK 3FFKB 2RPIA 4CF2A 1NK9A 1YIJN 1J5OA 5AQJA 1I94K 4O4GA 4HUFA 5A2QO 3TPQA 4FPBA 4E7KA 1KAYA 2VGNA 1NJYA 1HLUA 4F2RA 4FW2A 4FJIA 4FLVA 2WTUA 2YX6A 4CFBA 4DUZK 3MN6A 4PA1A 4XH5A 3E01A 3SLCA 3MWPA 3AO2A 4EZ9A 1SL0A 3K5NA 4M3ZA 2V7YA 2NRTA 2HBKA 3K9KA 1WSIA 4PHTX 3O3GA 3T1HK 2IIRA 2D5RA 3UKUA 4AF1A 4IDHA 3AO5A 5C42A 1VSHA 1JCGA 4O8KA 3QNNA 1TGOA 2QXLA 3CC2N 1NOYA 3S41A 5JS2A 1Q18A 1WAFA 4JV5K 2ZF5O 3LWLA 4CZKA 1QZ5A 4DMNA 1CLQA 2P9PB 4DQQA 3O3HA 3PV8A 2YHXA 3UIQA 2BE2A 4CEBA 3GE1A 3QO9A 4CEAA 2HHUA 3CFOA 2CH6A 4B3TK 4DTXA 1QSYA 4MDAA 1TL3A 1HYSA 3D45A 1VSIA 3D2EB 4WFNL 3CCLN 4PQUA 4MLEA 4DTRA 4CEQA 4IBNA 1SQKA 3H1VX 3MCAB 3DXMA 3KJVA 1HQEA 3OS2A 3J81O 4NB4A 4JI6K 2WONA 2OCEA 2QM1A 4X66K 3LP3A 3PO4A 3OY9A 5GINA 3HVRA 2IVNA 2P5OA 4JKEA 2KTQA 2A41A 5KPZA 4FWRA 5CR4A 4BRHA 2OTJN 4LSLA 3HM9A 3AGKA 2ZQBA 3ZYYX 3KK3A 4BC3A 2D0AA 4CF8A 4F9OA 3PX4A 4AILC 3SAHA 2GUPA 1Z05A 2E20A 4A2BA 4J2DA 3P4IA 3M8QA 1YT3A 3AVNA 1TK5A 4EZ6A 3TARA 3TANA 1NGIA 4JKFA 3FE1A 1RFQA 1CXQA 5AQYA 2Q0RA 4NXNK 4CD3A 4CGJA 2OZMA 3CJ9A 2O8EA 1RT6A 5EOYA 3ZSOA 4HCCA 4FLTA 5AQWA 2F7TA 3J7YP 3NF8A 3PX6A 3HSCA 3H1QA 2CGJA 1SS6A 4DV5K 1WB9A 4FWLA 4CECA 4JEPA 1X9MA 2IOCA 4C8OA 2HB5A 4CJTA 4DKWA 1C1CA 3J7ZO 4YOXA 1FK9A 5AQGA 1D4XA 4CGHA 5D3GA 2YHBA 5AFUH 1K6YA 4CIGA 1S5JA 1TK8A 1EWQA 4LC9B 3OYKA 1SV5A 1E3MA 2H3GX 4CW7B 2P9LA 4PUOA 1N32K 2NZTA 1TYQA 4B3SK 3V1QA 4HVJA 4BRNA 4Z4IA 4CJEA 4MLHA 1SKRA 4PKIA 1VQON 4NCAA 3HYFA 3JYTA 2ITGA 3QINA 3LAKA 3IRXA 4BE2A 1LOTB 1NGFA 3C65A 5C12A 2GWJA 1NJZA 5I42A 5C15A 3U6FA 4JKDA 4YOVA 3SUOA 3ZCMA 5EXWA 4OGCA 2HHTA 1RBRA 2OPSA 2W42A 3VGMA 1NK8A 1VQNN 4JI7K 3ZETA 1BISA 2A1SA 4K25A 4Q0BA 4DCHA 3HM8A 3SQ0A 3AV9A 1L3VA 4B3OA 1T03A 2FF6A 3TTCA 3SJJA 2NNWA 5AQOA 2NUBA 3VTIA 3TAGA 4FSVA 1RTIA 3QEWA 2ZJPL 1OKJA 4DFJA 4WF9L 1VQPN 2HF3A 1EX4A 2B4JA 4B08A 3MMVA 4CEDA 2HNYA 2PFUA 4H0YB 1S22A 4H5RA 4JK9A 3RSEB 3SBGA 1P90A 4PKGA 3KLEA 2E2PA 1LW2A 4Z4FA 4XEIA 4LF4K 4YDUC 5C2DA 4FLWA 4FLXA 2Q1NA 3MXIA 3KKRA 4ID5A 1HNIA 1RDBA 3VOVA 3EKUA 1RILA 1GOCA 3V9ZA 2VCPA 2QWLA 3O9RA 2P1JA 5HP1A 4FZXC 1KSPA 4IFVA 4FK0A 5FPDA 4OKKA 3A5LC 4EAHD 4CERA 2VYPA 3SUQA 1S1WA 4DR2K 1VSJA 3C0BA 4CFAA 4JS4A 2WBNA 2G8UA 5M1QA 3W0LA 4UQGA 5BN8A 2BH1A 4X64K 4J2BA 4CJRA 4BE1A 1TL1A 2XY7A 3EN9A 3HBTA 4BACA 2YNHA 3V9SA 4KV8A 5HRSA 4N5SA 1D9FA 2IS3A 1JLBA 1HX1A 1V4TA 1YJNN 3I8BA 1WBBA 3HOSA 2KKZA 2GEMA 1VHXA 5BR8K 4K42A 5BPMA 1TVRA 3MEDA 4FCYA 1U2VB 1GLBG 3LPTA 4J8FA 3THVA 1JL1A 3IDHA 4BE0A 2V52B 4DTMA 4NCGA 1C0MA 3WNFA 2P9IB 3AVAA 3LM2A 4DSEA 2X78A 4CHZA 3N4PA 5KQ8A 4ID1A 1M90O 4ZTFA 1K73O 3GBTA 5IWAK 3S9HA 1M1KO 1NOZA 3ID6A 2P9NB 4I6MB 1N6QA 2FBYA 4YORA 3VQPA 1NMDA 4DSFA 4FWSA 1DT9A 1KAZA 4BRIA 4DFMA 4BC5A 1SKSA 1UOCA 3WXKA 4E7HA 1F21A 3CETA 4PY5A 5J2MA 1RCHA 2VWKA 3VQCA 5GADP 1XNQK 4B1ZA 1KQSM 4DWIA 4DSJA 1D9DA 1BL3A 4FYDA 2Z1GA 3L3VA 4FOEA 3D7EO 3VEXA 1TKZA 3Q7BA 4WQ4C 4BR7A 1U48A 5FRNA 1YXQA 1UWBA 1RDWX 4ISGA 2A5XA 1D5AA 2CGKA 4FLZA 4AHCA 2X74A 3VF2A 4M41A 1NLVA 2W6LA 3F5TA 5F0XA 4CJQA 1OH5A 3K9JA 2PY5A 3NGYA 1BCOA 1KD1O 3SI6A 4Z4HA 2AP1A 5J2NA 4FL9A 3V6DA 4DTJA 2GTDA 2YCHA 3KKSA 1HUXA 5FPNA 4BVPA 1A5WA 3AO1A 5AQZA 1NGGA 1Z26A 4J2AA 1L3SA 3F73A 2AA4A 3DLLL 2GUIA 4BDZA 3MX5A 1IBLK 3BUZB 2VG7A 3ID8A 4CFCA 2CH5A 2PYJA 1T44A 3NVMA 3KIOA 1BA0A 3LANA 3C94A 4NXMK 1NWKA 4IKFA 1G15A 3P5JA 3RR7A 1XUPO 4LY7A 4E19A 5HROA 1C6VA 3TU5A 4KB1A 3FFIA 3CMEN 4IFYA 2HSTA 2ETJA 2X6SA 3AY9A 5DM7L 4H03B 1TAQA 3CFPA 3OYHA 2NRWA 4N76A 5M1KA 3PO5A 3SJHA 4C1NI 3DMJA 4ILHA 4QCLA 3L0QA 4B8CA 2BDPA 5AQLA 4KTZA 3VQEA 3THWA 1CZBA 1NK0A 3CM6A 4CGDA 1ILYA 3UB5A 2O8CA 4PWDA 2O8BA 2F8TA 3WQUA 2RHKA 3O4QA 4H5TA 3VF4A 2Q3SA 3QBXA 3ZSRA 1NK6A 3CQYA 3TAPA 1VAZA 3K58A 2YKMA 3VPZA 4Y1CA 3B8AX 3EKSA 3CCUN 3RMBA 4DR5K 2YHYA 2P9SA 1NK4A 3H08A 4QAGA 4EHTA 4FJ5A 3LPUA 3FZKA 4OKJA 4GV6A 1GLDG 1NMNA 4BRDA 3QICA 4KRFA 2ZJQL 1O13A 3TTFA 3ULEA 4BROA 4M7YA 3IKMA 1REVA 4DR4K 1N36K 3VENA 1IBMK 3LDQA 4F3OA 3FZHA 3K57A 3VEVA 5BN9A 1HJOA 3PSIA 2HHVA 5ADXA 4FW1A 3LAMA 1T6DA 4B9SA 4NCBA 1ITGA 4H0XB 4CK2A 4H4MA 4DFKA 1Q8IA 3AGRA 2P51A 4YY3K 3NDKA 3ASMA 3THXB 1VQ8N 2YHAA 4FJXA 4FJ9A 3C6HA 1HNZK 2D4WA 4YOTA 4FJJA 2DFFA 1BDGA 4F3TA 4IEIA 1RBUA 4IO8A 2YV0X 2D0BA 4KB0A 1WAJA 2XY8A 3RMCA 3U8XA 5CE3A 2YJEA 3M8SA 4DTSA 1J54A 1OVQA 3C6TA 2GELA 2VG6A 3CMAN 4CJLA 2B6AA 4TSXA 4HWIA 4A5BA 3G0ZA 1ZC6A 3KK2A 4HCBA 4CGFA 4FJGA 4WYBA 1VQ9N 4LD0A 3CPWM 2VWBA 4CZJA 3SCXA 4BWJA 4CZMA 3UKRB 4CJWA 4ELTA 2V51B 3QEIA 2YNGA 4NLCA 4M3YA 4B1UB 3OS0A 1FW6A 3BDPA 4N56A 3FZMA 5AQIA 1T3VA 2Q2RA 4RCHA 4B1YB 1GLCG 3DLKA
chains in the Genus database with same CATH topology
1RBSA 1HRHA 1Y97A 4CECA 2PYLA 4AHRA 3OS1A 2IOCA 1X9MA 2G8VA 4E3SA 4C8OA 2ZD1A 2HB5A 1U45A 1L3TA 3ISNC 4CJTA 1LWFA 1C1CA 4C8KA 3QLHA 4M3XA 4C8NA 1FK9A 1RT1A 3AO4A 3SV4A 1ZYQA 1YVUA 1BI4A 4CGHA 5D3GA 4W5OA 2YHBA 1YTUA 1K6YA 4CIGA 1S5JA 1W9HA 5HRPA 4XIUA 3OYJA 1TK8A 3OYKA 1SV5A 4CK3A 4E7JA 3AVIA 2GV9A 3NBPA 4GMJB 3WNHA 3L2QA 2B5JA 4PUOA 4FK4A 3BGRA 1WN7A 1IKXA 4BDYA 3QETA 2WOMA 2DFHA 3V1QA 3DM2A 4HVJA 4F4KA 4CEZA 4CJEA 3S3NA 4Z4IA 4CE9A 4Z4GA 3SYZA 1SKRA 4NCAA 3HYFA 3JYTA 2ITGA 1S6PA 1JKHA 3QINA 4AHSA 3LAKA 3IRXA 4BE2A 2Y1IA 3HXMA 4BDPA 4QOZB 4B9LA 3AVBA 3RTVA 5I42A 1NJZA 1EETA 1XWLA 1VSLA 4CJVA 4DTPA 3U6FA 4KI6A 3SUOA 3ZCMA 4M3UA 5KI6A 5J2PA 4W5QA 2YNFA 4OGCA 4CIEA 1NK5A 1RBRA 2HHTA 2OPSA 2W42A 1QSLA 1ZBHA 1NK8A 1NJXA 1KRPA 4HHTA 1WSHA 1WSEA 5JS1A 3DLGA 4DU3A 3T1AA 4KO0A 3KLIA 1BISA 4ICLA 2A1SA 2RF2A 3B6PA 4IDKA 4CJ5A 4Q0BA 2HVIA 4OPKA 1NKCA 5KGXA 4KTQA 4E89A 4FM2A 1RBVA 1J9AA 4BWMA 3SQ0A 3AV9A 1R0AA 1L3VA 1T03A 1IKWA 4F2SA 4B3OA 4IG3A 4B9VA 5EU7A 3SJJA 1EP4A 1FKOA 3QIPA 4M3RA 3TAQA 2NUBA 1RT4A 3SQ1A 3I8DA 3TAGA 3L2RA 1RTIA 4H8KA 3QEWA 3L2WA 4CHPA 4DS5A 4OGEA 3OVNA 4DFJA 1B9DA 3P83D 4CF1A 1WSJA 3VA3A 1EX4A 2B4JA 2D0CA 4B08A 3SUPA 1RDAA 2OA8A 4CEDA 3SUNA 3A2FA 2HNYA 3KLFA 3G10A 1TKXA 1HYZA 3M8PA 2VWJA 3S3OA 1Q9YA 2FBXA 3KD1E 3K5OA 2F8SA 3VQBA 3ZT0A 3KLEA 4B9NA 1LW2A 4Z4FA 4LH4A 4KTWA 2Z1HA 1KCFA 3CYMA 1QTMA 4ELUA 4KREA 3SZ2A 4FK2A 3O4NA 3L8BA 5CY4A 4FLWA 1X9SA 1RDDA 5KRTA 4FLXA 3SPYA 2F96A 1LAWA 3MXIA 4O0JA 3VQ9A 3V9XA 3KKRA 2VG5A 4ID5A 4CHYA 1HNIA 3PY8A 4FYDA 2KFZA 2EX3A 4LSNA 3ZSVA 1VSDA 1RDBA 4Z0UA 1RILA 1GOCA 4N47A 3HT3A 3V9ZA 2KW4A 1IKYA 4I9LA 1HYVA 3QEPA 4W5NA 2P1JA 2XRIA 3NFAA 5HP1A 4FZXC 2QK9A 1KSPA 3L2UA 4IFVA 4Z4CA 1ZBFA 4FK0A 4OKKA 3K2PA 1RTJA 3L3UA 4KHWA 4EP5A 4CERA 1IKVA 3NAEA 4M3TA 4RW9A 4DF8A 4AH9A 4F8RA 2HW3A 4IG0A 4CGIA 4JRQA 1KLMA 3MXJA 3SUQA 4NYNA 3L2VA 4DSLA 1L3UA 1S1WA 1SKWA 2DY4A 1O1WA 4R5PA 1VSJA 1GOAA 4Y1DA 4DQPA 2BGGA 3HJFA 2O4GA 4KPYA 3RMAA 4B9TA 4CFAA 4JS4A 4HTUA 4RW6A 3AVMA 2G8UA 3DOLA 1QHTA 1DTQA 1HMVA 4UQGA 3PUFA 2Z1JA 3M8RA 3ZSQA 3OYDA 3V1RA 3ZT3A 4CJRA 4J2BA 3RRGA 1GOBA 1BIUA 4BE1A 2P5GA 1TL1A 5FDLA 3RRHA 2XY7A 3AA4A 4AHVA 3NE6A 4BACA 2YNHA 3V9SA 4KV8A 5HRSA 3B6OA 4CF9A 5SZTA 3SQ2A 1U47A 4N5SA 3MEEA 1D9FA 2FBTA 1RNHA 5HBMA 1WNSA 2IS3A 1JLBA 3QNOA 1SUQA 4JS5A 1DTTA 3LWMA 4KHUA 3NF9A 1LAVA 2XY6A 1QS4A 3HPHA 1KTQA 4CJKA 1BGXT 5CYQA 3EY1A 3EZ5A 3SV3A 4FVMA 5I3UA 4L8RB 2OPPA 3KTQA 1U04A 3HPGA 1XC9A 1TVRA 3DYAA 2KZMA 3MEDA 4I7FA 3OYEA 3U3YA 1X1PA 4FCYA 1UA0A 4O44A 1TKDA 4K8XA 1TV6A 1BI4B 3LPTA 4FJKA 1QSSA 2DTUA 4KKOA 4DLGA 4WE1A 3THVA 1S9EA 1JL1A 1Z25A 5K14A 4ZHRA 4BE0A 1W0HA 2ZE2A 1BCMA 2YNIA 4CK1A 2QXFA 1JXEA 3SPZA 4DTMA 4FJLA 4NCGA 2QKBA 1C0MA 3WNFA 3ZT4A 1S1UA 3AVAA 3ZSYA 1VK0A 4DSEA 1TKTA 3CG7A 3RMDA 1U4BA 2X78A 4CHZA 1J53A 3NH0A 2E6MA 4DQIA 3OYIA 3SQ4A 1N5YA 4ID1A 1ZBUA 4N41A 4ZTFA 4CJSA 3MECA 4O55A 3VQ8A 1HPZA 3S9HA 1NOZA 3ZT1A 3CQ8A 3LZJA 1N6QA 2FBYA 3PX0A 4OJRA 3VQPA 4Z4EA 2A1RA 5KTQA 4DSFA 4M45A 3K59A 2DFEA 4JLHA 5J1EA 1B92A 3HPOA 1L5UA 3OYCA 2O4IA 3NHGA 4FZZA 2JLEA 4DFMA 4FLUA 1SKSA 1RBTA 3QEXA 4E7LA 3AVJA 1UOCA 1KLNA 4FZYA 4RW8A 2IC3A 4E7HA 3HP9A 1S1TA 4DFPA 1F21A 2BANA 4C8LA 4AHTA 2XHBA 3AA5X 4PY5A 1HNVA 5J2MA 1BQNA 1RCHA 1I39A 2VWKA 2RKIA 1WSGA 3VQCA 1KVBA 2HHSA 4DWIA 3V4IA 5CZ1A 4RW7A 4HUEA 4DSJA 1A5XA 1D9DA 2OYQA 2RN2A 4CEOA 1BL3A 4Q5VA 3V81A 1EKEA 1NKEA 2G8IA 4FXDA 1RT5A 2Z1GA 3LP0A 4DTOA 3TI0A 5HLFA 2IGIA 3LP2A 3LZIA 1WSFA 2XO7A 3L3VA 4RW4A 5CYMA 3QIOA 3TWHA 2G8KA 4CHQA 3IS9A 2G8FA 4YNQA 1BIZA 1U49A 3DRSA 1IG9A 2G8HA 3NF6A 1TKZA 3AVCA 4B8AB 3OJUA 2EHGA 4ZTJA 1U48A 5FRNA 3NH1A 3DRPA 4HUGA 4DSIA 1UWBA 5DK5A 4C8MA 3ZSXA 4DF4A 1JLGA 4DLEA 1TK0A 4FM0A 2HHQA 3DLRA 4DU1A 1C0UA 1D5AA 1JLQA 4FLZA 4AHCA 4CFDA 2X74A 1VSFA 4CGGA 4CJ3A 3F9KA 4M41A 1S6QA 1HQUA 1BQMA 3O3FA 4W5TA 4MFBA 3AA3A 1RT3A 4CJQA 1HJRA 4W5RA 4CIFA 4CF0A 2HVHA 4CJPA 2PY5A 3NGYA 3S3MA 1BCOA 1FXXA 3LP1A 1CZ9A 3HL8A 3SI6A 1C1AA 3AVKA 1BHLA 4Z4HA 4CHNA 5J2NA 1JXBA 3V6DA 3C95A 3LALA 3AVFA 4CJ4A 4DTJA 1KFSA 5C24A 4FJMA 4GW6A 2OPQA 1S9GA 3ZSWA 3KKSA 2HNZA 3KLGA 3MAQA 1VRTA 4DTNA 3RWUA 3HSTB 3VQDA 2E4LA 2E6LA 3TR8A 1IH7A 1D8YA 1LWEA 1A5WA 2IDOA 3WNEA 5C25A 4E0DA 3AO1A 5FRMA 1Z26A 4AHUA 4G1QA 1ZBLA 4J2AA 1TAUA 3V9WA 4DS4A 1L3SA 3KLHA 4DSKA 1WLJA 3HP6A 3VQ4A 2ATQA 3VQ6A 3F73A 1C0TA 4O0IA 2PZSA 2HNDA 2GUIA 4BDZA 2XY5A 4CJUA 3HO1A 4JRPA 3K5MA 4J2EA 1JLFA 3U3GA 1DLOA 2VG7A 3VQ5A 4CEEA 2R7YA 2QKKA 3WNGA 4B9MA 4CFCA 3RR8A 4OLAA 4OVLA 4CJFA 1NK7A 2PYJA 4B9UA 3HK2A 1QE1A 1FKPA 3NGZA 4MQ3A 4OKEA 2KQ2A 3IG1A 3KIOA 4GVMA 1QQCA 3LANA 1SL1A 2HHXA 3C94A 1VSKA 3JSMA 4IKFA 4KAZA 1G15A 3KD5E 1S1XA 3P5JA 4DQSA 3RR7A 1EXQA 1VSEA 1KFDA 3I0SA 4LY7A 1JL2A 4E19A 1C6VA 5HROA 4KB1A 3FFIA 4KFBA 1I3AA 3VQQA 4IFYA 3VQ7A 3ZSZA 4H4OA 3NH2A 3EYZA 4FM1A 4I9QA 3OYMA 1ZBIA 2ETJA 2X6SA 3TAMA 3CFRA 2YKNA 4E7IA 3NCIA 4RG8A 4KHSA 3DRRA 3MEGA 1TAQA 3CFPA 1B9FA 3OYHA 3OJSA 4EP4A 4N76A 2RPIA 4CF2A 3PO5A 1NK9A 4K8ZA 4CESA 3DMJA 2Z1IA 1J5OA 2OZSA 4QCLA 4O4GA 1RT7A 4HUFA 4B8CA 2BDPA 2GBZA 4KTZA 3OYBA 3KK1A 4FLYA 4OLBA 3VQEA 3DLEA 1CZBA 1NK0A 3CM6A 4LH5A 4CGDA 4E7KA 1IO2A 4PWDA 1LWCA 2I5JA 1NJYA 4YFUA 4F2RA 4E1MA 3NF7A 5KRSA 4FW2A 2F8TA 3O4QA 3DI6A 3ZSRA 1NK6A 2Q3SA 4FJIA 4FLVA 4M42A 2HHWA 1XI1A 3TAPA 4KHYA 4OPJA 3AVLA 3K58A 4CFBA 5T7BA 3VN5A 4DTUA 2YKMA 1NJWA 4Y1CA 1ASVA 4PA1A 3E01A 1JLCA 1S1VA 1YTAA 3RMBA 1LW0A 4DG1A 3P1GA 1NK4A 3AO2A 1VSMA 1A5VA 4EZ9A 3ITHA 1SL0A 3K5NA 3H08A 3T3FA 3QERA 4M3ZA 4QAGA 4FJ5A 1SL2A 3LPUA 4OKJA 1WSIA 3O3GA 3OYAA 4O5BA 4NYFA 2D5RA 4M3WA 4FJ7A 3AO5A 5C42A 1VSHA 4KRFA 3QNNA 4I2QA 1TGOA 3DOKA 1NOYA 4DQRA 3AVHA 5JS2A 1REVA 1WAFA 1C1BA 5J2QA 3LWLA 4FJHA 4F3OA 4FJNA 3I0RA 3K57A 3MXMA 4DMNA 1CLQA 1MU2A 2HHVA 2FC0A 4DQQA 4FW1A 3O3HA 3PV8A 3LAMA 3VA0A 3UIQA 4KHNA 4B9SA 2BE2A 3AO3A 4CEBA 4NCBA 4KI4A 1UAXA 3QO9A 4CEAA 3OYNA 1ITGA 4CK2A 2HHUA 2Y1JA 1RTHA 3CFOA 4H4MA 4DFKA 1T05A 1Q8IA 1JLEA 3DLHA 3HVTA 4DTXA 1RDCA 2P51A 3SNNA 1T7PA 2KFNA 3NDKA 3ASMA 3ZT2A 1QSYA 4CCHA 3OYLA 2YHAA 4I2PA 3QESA 3TAFA 1TL3A 3T19A 4FJXA 4FJ9A 4KHQA 1HYSA 3D45A 1VSIA 3C6UA 2FBVA 4FJJA 2DFFA 1RTDA 4PQUA 3NGIA 4CHOA 1Q9XA 3K5LA 4F3TA 1RBUA 4DTRA 4CEQA 3ALYA 4IBNA 3OYFA 5E41A 1ASWA 3KJVA 1HQEA 3OS2A 2YV0X 2D0BA 4KB0A 2WONA 2OPRA 1X9WA 1WAJA 3TABA 3LP3A 3PO4A 5HRRA 3OY9A 1T8EA 2KZZA 2XY8A 3HVRA 5DMRA 1ASUA 2P5OA 4FJ8A 2KTQA 3RMCA 5CZ2A 3LDSA 2X6NA 3QEVA 3M8SA 3ULDA 4DTSA 1J54A 4LSLA 2JGUA 3HM9A 3C6TA 2VG6A 2ZQBA 3OYGA 5FROA 3KK3A 4CJLA 2D0AA 2B6AA 4TSXA 1CXUA 2IAJA 3G0ZA 4CF8A 5SWMA 3PX4A 1VRUA 2LSNA 4AILC 3KK2A 4J2DA 2G8WA 4HCBA 4CGFA 3M8QA 1YT3A 3AVNA 4FJGA 3AA2A 4LD0A 1TK5A 4EZ6A 4DU4A 1JLAA 3TARA 4ELVA 3IAYA 3TANA 1UA1A 3TAEA 3SCXA 5KGWA 5HRNA 4BWJA 1CXQA 4CGJA 2OZMA 4CJWA 4ELTA 3QEIA 1RT6A 1RT2A 2YNGA 3ZSOA 1XHZA 4HCCA 2AJQA 4M3YA 4FLTA 3AVGA 3D0PA 1KVAA 1LV5A 4CEFA 3DLBA 1NKBA 3V1OA 3OS0A 3BDPA 4N56A 2HMIA 3NF8A 3V9UA 3PX6A 1KVCA 3VQAA 3CM5A 1XHXA 3DLKA 4E1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RBS A;  1HRH A;  1Y97 A;  4CEC A;  2PYL A;  4AHR A;  3OS1 A;  2IOC A;  1X9M A;  2G8V A;  4E3S A;  4C8O A;  2ZD1 A;  2HB5 A;  1U45 A;  1L3T A;  3ISN C;  4CJT A;  1LWF A;  1C1C A;  4C8K A;  3QLH A;  4M3X A;  4C8N A;  1FK9 A;  1RT1 A;  3AO4 A;  3SV4 A;  1ZYQ A;  1YVU A;  1BI4 A;  4CGH A;  5D3G A;  4W5O A;  2YHB A;  1YTU A;  1K6Y A;  4CIG A;  1S5J A;  1W9H A;  5HRP A;  4XIU A;  3OYJ A;  1TK8 A;  3OYK A;  1SV5 A;  4CK3 A;  4E7J A;  3AVI A;  2GV9 A;  3NBP A;  4GMJ B;  3WNH A;  3L2Q A;  2B5J A;  4PUO A;  4FK4 A;  3BGR A;  1WN7 A;  1IKX A;  4BDY A;  3QET A;  2WOM A;  2DFH A;  3V1Q A;  3DM2 A;  4HVJ A;  4F4K A;  4CEZ A;  4CJE A;  3S3N A;  4Z4I A;  4CE9 A;  4Z4G A;  3SYZ A;  1SKR A;  4NCA A;  3HYF A;  3JYT A;  2ITG A;  1S6P A;  1JKH A;  3QIN A;  4AHS A;  3LAK A;  3IRX A;  4BE2 A;  2Y1I A;  3HXM A;  4BDP A;  4QOZ B;  4B9L A;  3AVB A;  3RTV A;  5I42 A;  1NJZ A;  1EET A;  1XWL A;  1VSL A;  4CJV A;  4DTP A;  3U6F A;  4KI6 A;  3SUO A;  3ZCM A;  4M3U A;  5KI6 A;  5J2P A;  4W5Q A;  2YNF A;  4OGC A;  4CIE A;  1NK5 A;  1RBR A;  2HHT A;  2OPS A;  2W42 A;  1QSL A;  1ZBH A;  1NK8 A;  1NJX A;  1KRP A;  4HHT A;  1WSH A;  1WSE A;  5JS1 A;  3DLG A;  4DU3 A;  3T1A A;  4KO0 A;  3KLI A;  1BIS A;  4ICL A;  2A1S A;  2RF2 A;  3B6P A;  4IDK A;  4CJ5 A;  4Q0B A;  2HVI A;  4OPK A;  1NKC A;  5KGX A;  4KTQ A;  4E89 A;  4FM2 A;  1RBV A;  1J9A A;  4BWM A;  3SQ0 A;  3AV9 A;  1R0A A;  1L3V A;  1T03 A;  1IKW A;  4F2S A;  4B3O A;  4IG3 A;  4B9V A;  5EU7 A;  3SJJ A;  1EP4 A;  1FKO A;  3QIP A;  4M3R A;  3TAQ A;  2NUB A;  1RT4 A;  3SQ1 A;  3I8D A;  3TAG A;  3L2R A;  1RTI A;  4H8K A;  3QEW A;  3L2W A;  4CHP A;  4DS5 A;  4OGE A;  3OVN A;  4DFJ A;  1B9D A;  3P83 D;  4CF1 A;  1WSJ A;  3VA3 A;  1EX4 A;  2B4J A;  2D0C A;  4B08 A;  3SUP A;  1RDA A;  2OA8 A;  4CED A;  3SUN A;  3A2F A;  2HNY A;  3KLF A;  3G10 A;  1TKX A;  1HYZ A;  3M8P A;  2VWJ A;  3S3O A;  1Q9Y A;  2FBX A;  3KD1 E;  3K5O A;  2F8S A;  3VQB A;  3ZT0 A;  3KLE A;  4B9N A;  1LW2 A;  4Z4F A;  4LH4 A;  4KTW A;  2Z1H A;  1KCF A;  3CYM A;  1QTM A;  4ELU A;  4KRE A;  3SZ2 A;  4FK2 A;  3O4N A;  3L8B A;  5CY4 A;  4FLW A;  1X9S A;  1RDD A;  5KRT A;  4FLX A;  3SPY A;  2F96 A;  1LAW A;  3MXI A;  4O0J A;  3VQ9 A;  3V9X A;  3KKR A;  2VG5 A;  4ID5 A;  4CHY A;  1HNI A;  3PY8 A;  4FYD A;  2KFZ A;  2EX3 A;  4LSN A;  3ZSV A;  1VSD A;  1RDB A;  4Z0U A;  1RIL A;  1GOC A;  4N47 A;  3HT3 A;  3V9Z A;  2KW4 A;  1IKY A;  4I9L A;  1HYV A;  3QEP A;  4W5N A;  2P1J A;  2XRI A;  3NFA A;  5HP1 A;  4FZX C;  2QK9 A;  1KSP A;  3L2U A;  4IFV A;  4Z4C A;  1ZBF A;  4FK0 A;  4OKK A;  3K2P A;  1RTJ A;  3L3U A;  4KHW A;  4EP5 A;  4CER A;  1IKV A;  3NAE A;  4M3T A;  4RW9 A;  4DF8 A;  4AH9 A;  4F8R A;  2HW3 A;  4IG0 A;  4CGI A;  4JRQ A;  1KLM A;  3MXJ A;  3SUQ A;  4NYN A;  3L2V A;  4DSL A;  1L3U A;  1S1W A;  1SKW A;  2DY4 A;  1O1W A;  4R5P A;  1VSJ A;  1GOA A;  4Y1D A;  4DQP A;  2BGG A;  3HJF A;  2O4G A;  4KPY A;  3RMA A;  4B9T A;  4CFA A;  4JS4 A;  4HTU A;  4RW6 A;  3AVM A;  2G8U A;  3DOL A;  1QHT A;  1DTQ A;  1HMV A;  4UQG A;  3PUF A;  2Z1J A;  3M8R A;  3ZSQ A;  3OYD A;  3V1R A;  3ZT3 A;  4CJR A;  4J2B A;  3RRG A;  1GOB A;  1BIU A;  4BE1 A;  2P5G A;  1TL1 A;  5FDL A;  3RRH A;  2XY7 A;  3AA4 A;  4AHV A;  3NE6 A;  4BAC A;  2YNH A;  3V9S A;  4KV8 A;  5HRS A;  3B6O A;  4CF9 A;  5SZT A;  3SQ2 A;  1U47 A;  4N5S A;  3MEE A;  1D9F A;  2FBT A;  1RNH A;  5HBM A;  1WNS A;  2IS3 A;  1JLB A;  3QNO A;  1SUQ A;  4JS5 A;  1DTT A;  3LWM A;  4KHU A;  3NF9 A;  1LAV A;  2XY6 A;  1QS4 A;  3HPH A;  1KTQ A;  4CJK A;  1BGX T;  5CYQ A;  3EY1 A;  3EZ5 A;  3SV3 A;  4FVM A;  5I3U A;  4L8R B;  2OPP A;  3KTQ A;  1U04 A;  3HPG A;  1XC9 A;  1TVR A;  3DYA A;  2KZM A;  3MED A;  4I7F A;  3OYE A;  3U3Y A;  1X1P A;  4FCY A;  1UA0 A;  4O44 A;  1TKD A;  4K8X A;  1TV6 A;  1BI4 B;  3LPT A;  4FJK A;  1QSS A;  2DTU A;  4KKO A;  4DLG A;  4WE1 A;  3THV A;  1S9E A;  1JL1 A;  1Z25 A;  5K14 A;  4ZHR A;  4BE0 A;  1W0H A;  2ZE2 A;  1BCM A;  2YNI A;  4CK1 A;  2QXF A;  1JXE A;  3SPZ A;  4DTM A;  4FJL A;  4NCG A;  2QKB A;  1C0M A;  3WNF A;  3ZT4 A;  1S1U A;  3AVA A;  3ZSY A;  1VK0 A;  4DSE A;  1TKT A;  3CG7 A;  3RMD A;  1U4B A;  2X78 A;  4CHZ A;  1J53 A;  3NH0 A;  2E6M A;  4DQI A;  3OYI A;  3SQ4 A;  1N5Y A;  4ID1 A;  1ZBU A;  4N41 A;  4ZTF A;  4CJS A;  3MEC A;  4O55 A;  3VQ8 A;  1HPZ A;  3S9H A;  1NOZ A;  3ZT1 A;  3CQ8 A;  3LZJ A;  1N6Q A;  2FBY A;  3PX0 A;  4OJR A;  3VQP A;  4Z4E A;  2A1R A;  5KTQ A;  4DSF A;  4M45 A;  3K59 A;  2DFE A;  4JLH A;  5J1E A;  1B92 A;  3HPO A;  1L5U A;  3OYC A;  2O4I A;  3NHG A;  4FZZ A;  2JLE A;  4DFM A;  4FLU A;  1SKS A;  1RBT A;  3QEX A;  4E7L A;  3AVJ A;  1UOC A;  1KLN A;  4FZY A;  4RW8 A;  2IC3 A;  4E7H A;  3HP9 A;  1S1T A;  4DFP A;  1F21 A;  2BAN A;  4C8L A;  4AHT A;  2XHB A;  3AA5 X;  4PY5 A;  1HNV A;  5J2M A;  1BQN A;  1RCH A;  1I39 A;  2VWK A;  2RKI A;  1WSG A;  3VQC A;  1KVB A;  2HHS A;  4DWI A;  3V4I A;  5CZ1 A;  4RW7 A;  4HUE A;  4DSJ A;  1A5X A;  1D9D A;  2OYQ A;  2RN2 A;  4CEO A;  1BL3 A;  4Q5V A;  3V81 A;  1EKE A;  1NKE A;  2G8I A;  4FXD A;  1RT5 A;  2Z1G A;  3LP0 A;  4DTO A;  3TI0 A;  5HLF A;  2IGI A;  3LP2 A;  3LZI A;  1WSF A;  2XO7 A;  3L3V A;  4RW4 A;  5CYM A;  3QIO A;  3TWH A;  2G8K A;  4CHQ A;  3IS9 A;  2G8F A;  4YNQ A;  1BIZ A;  1U49 A;  3DRS A;  1IG9 A;  2G8H A;  3NF6 A;  1TKZ A;  3AVC A;  4B8A B;  3OJU A;  2EHG A;  4ZTJ A;  1U48 A;  5FRN A;  3NH1 A;  3DRP A;  4HUG A;  4DSI A;  1UWB A;  5DK5 A;  4C8M A;  3ZSX A;  4DF4 A;  1JLG A;  4DLE A;  1TK0 A;  4FM0 A;  2HHQ A;  3DLR A;  4DU1 A;  1C0U A;  1D5A A;  1JLQ A;  4FLZ A;  4AHC A;  4CFD A;  2X74 A;  1VSF A;  4CGG A;  4CJ3 A;  3F9K A;  4M41 A;  1S6Q A;  1HQU A;  1BQM A;  3O3F A;  4W5T A;  4MFB A;  3AA3 A;  1RT3 A;  4CJQ A;  1HJR A;  4W5R A;  4CIF A;  4CF0 A;  2HVH A;  4CJP A;  2PY5 A;  3NGY A;  3S3M A;  1BCO A;  1FXX A;  3LP1 A;  1CZ9 A;  3HL8 A;  3SI6 A;  1C1A A;  3AVK A;  1BHL A;  4Z4H A;  4CHN A;  5J2N A;  1JXB A;  3V6D A;  3C95 A;  3LAL A;  3AVF A;  4CJ4 A;  4DTJ A;  1KFS A;  5C24 A;  4FJM A;  4GW6 A;  2OPQ A;  1S9G A;  3ZSW A;  3KKS A;  2HNZ A;  3KLG A;  3MAQ A;  1VRT A;  4DTN A;  3RWU A;  3HST B;  3VQD A;  2E4L A;  2E6L A;  3TR8 A;  1IH7 A;  1D8Y A;  1LWE A;  1A5W A;  2IDO A;  3WNE A;  5C25 A;  4E0D A;  3AO1 A;  5FRM A;  1Z26 A;  4AHU A;  4G1Q A;  1ZBL A;  4J2A A;  1TAU A;  3V9W A;  4DS4 A;  1L3S A;  3KLH A;  4DSK A;  1WLJ A;  3HP6 A;  3VQ4 A;  2ATQ A;  3VQ6 A;  3F73 A;  1C0T A;  4O0I A;  2PZS A;  2HND A;  2GUI A;  4BDZ A;  2XY5 A;  4CJU A;  3HO1 A;  4JRP A;  3K5M A;  4J2E A;  1JLF A;  3U3G A;  1DLO A;  2VG7 A;  3VQ5 A;  4CEE A;  2R7Y A;  2QKK A;  3WNG A;  4B9M A;  4CFC A;  3RR8 A;  4OLA A;  4OVL A;  4CJF A;  1NK7 A;  2PYJ A;  4B9U A;  3HK2 A;  1QE1 A;  1FKP A;  3NGZ A;  4MQ3 A;  4OKE A;  2KQ2 A;  3IG1 A;  3KIO A;  4GVM A;  1QQC A;  3LAN A;  1SL1 A;  2HHX A;  3C94 A;  1VSK A;  3JSM A;  4IKF A;  4KAZ A;  1G15 A;  3KD5 E;  1S1X A;  3P5J A;  4DQS A;  3RR7 A;  1EXQ A;  1VSE A;  1KFD A;  3I0S A;  4LY7 A;  1JL2 A;  4E19 A;  1C6V A;  5HRO A;  4KB1 A;  3FFI A;  4KFB A;  1I3A A;  3VQQ A;  4IFY A;  3VQ7 A;  3ZSZ A;  4H4O A;  3NH2 A;  3EYZ A;  4FM1 A;  4I9Q A;  3OYM A;  1ZBI A;  2ETJ A;  2X6S A;  3TAM A;  3CFR A;  2YKN A;  4E7I A;  3NCI A;  4RG8 A;  4KHS A;  3DRR A;  3MEG A;  1TAQ A;  3CFP A;  1B9F A;  3OYH A;  3OJS A;  4EP4 A;  4N76 A;  2RPI A;  4CF2 A;  3PO5 A;  1NK9 A;  4K8Z A;  4CES A;  3DMJ A;  2Z1I A;  1J5O A;  2OZS A;  4QCL A;  4O4G A;  1RT7 A;  4HUF A;  4B8C A;  2BDP A;  2GBZ A;  4KTZ A;  3OYB A;  3KK1 A;  4FLY A;  4OLB A;  3VQE A;  3DLE A;  1CZB A;  1NK0 A;  3CM6 A;  4LH5 A;  4CGD A;  4E7K A;  1IO2 A;  4PWD A;  1LWC A;  2I5J A;  1NJY A;  4YFU A;  4F2R A;  4E1M A;  3NF7 A;  5KRS A;  4FW2 A;  2F8T A;  3O4Q A;  3DI6 A;  3ZSR A;  1NK6 A;  2Q3S A;  4FJI A;  4FLV A;  4M42 A;  2HHW A;  1XI1 A;  3TAP A;  4KHY A;  4OPJ A;  3AVL A;  3K58 A;  4CFB A;  5T7B A;  3VN5 A;  4DTU A;  2YKM A;  1NJW A;  4Y1C A;  1ASV A;  4PA1 A;  3E01 A;  1JLC A;  1S1V A;  1YTA A;  3RMB A;  1LW0 A;  4DG1 A;  3P1G A;  1NK4 A;  3AO2 A;  1VSM A;  1A5V A;  4EZ9 A;  3ITH A;  1SL0 A;  3K5N A;  3H08 A;  3T3F A;  3QER A;  4M3Z A;  4QAG A;  4FJ5 A;  1SL2 A;  3LPU A;  4OKJ A;  1WSI A;  3O3G A;  3OYA A;  4O5B A;  4NYF A;  2D5R A;  4M3W A;  4FJ7 A;  3AO5 A;  5C42 A;  1VSH A;  4KRF A;  3QNN A;  4I2Q A;  1TGO A;  3DOK A;  1NOY A;  4DQR A;  3AVH A;  5JS2 A;  1REV A;  1WAF A;  1C1B A;  5J2Q A;  3LWL A;  4FJH A;  4F3O A;  4FJN A;  3I0R A;  3K57 A;  3MXM A;  4DMN A;  1CLQ A;  1MU2 A;  2HHV A;  2FC0 A;  4DQQ A;  4FW1 A;  3O3H A;  3PV8 A;  3LAM A;  3VA0 A;  3UIQ A;  4KHN A;  4B9S A;  2BE2 A;  3AO3 A;  4CEB A;  4NCB A;  4KI4 A;  1UAX A;  3QO9 A;  4CEA A;  3OYN A;  1ITG A;  4CK2 A;  2HHU A;  2Y1J A;  1RTH A;  3CFO A;  4H4M A;  4DFK A;  1T05 A;  1Q8I A;  1JLE A;  3DLH A;  3HVT A;  4DTX A;  1RDC A;  2P51 A;  3SNN A;  1T7P A;  2KFN A;  3NDK A;  3ASM A;  3ZT2 A;  1QSY A;  4CCH A;  3OYL A;  2YHA A;  4I2P A;  3QES A;  3TAF A;  1TL3 A;  3T19 A;  4FJX A;  4FJ9 A;  4KHQ A;  1HYS A;  3D45 A;  1VSI A;  3C6U A;  2FBV A;  4FJJ A;  2DFF A;  1RTD A;  4PQU A;  3NGI A;  4CHO A;  1Q9X A;  3K5L A;  4F3T A;  1RBU A;  4DTR A;  4CEQ A;  3ALY A;  4IBN A;  3OYF A;  5E41 A;  1ASW A;  3KJV A;  1HQE A;  3OS2 A;  2YV0 X;  2D0B A;  4KB0 A;  2WON A;  2OPR A;  1X9W A;  1WAJ A;  3TAB A;  3LP3 A;  3PO4 A;  5HRR A;  3OY9 A;  1T8E A;  2KZZ A;  2XY8 A;  3HVR A;  5DMR A;  1ASU A;  2P5O A;  4FJ8 A;  2KTQ A;  3RMC A;  5CZ2 A;  3LDS A;  2X6N A;  3QEV A;  3M8S A;  3ULD A;  4DTS A;  1J54 A;  4LSL A;  2JGU A;  3HM9 A;  3C6T A;  2VG6 A;  2ZQB A;  3OYG A;  5FRO A;  3KK3 A;  4CJL A;  2D0A A;  2B6A A;  4TSX A;  1CXU A;  2IAJ A;  3G0Z A;  4CF8 A;  5SWM A;  3PX4 A;  1VRU A;  2LSN A;  4AIL C;  3KK2 A;  4J2D A;  2G8W A;  4HCB A;  4CGF A;  3M8Q A;  1YT3 A;  3AVN A;  4FJG A;  3AA2 A;  4LD0 A;  1TK5 A;  4EZ6 A;  4DU4 A;  1JLA A;  3TAR A;  4ELV A;  3IAY A;  3TAN A;  1UA1 A;  3TAE A;  3SCX A;  5KGW A;  5HRN A;  4BWJ A;  1CXQ A;  4CGJ A;  2OZM A;  4CJW A;  4ELT A;  3QEI A;  1RT6 A;  1RT2 A;  2YNG A;  3ZSO A;  1XHZ A;  4HCC A;  2AJQ A;  4M3Y A;  4FLT A;  3AVG A;  3D0P A;  1KVA A;  1LV5 A;  4CEF A;  3DLB A;  1NKB A;  3V1O A;  3OS0 A;  3BDP A;  4N56 A;  2HMI A;  3NF8 A;  3V9U A;  3PX6 A;  1KVC A;  3VQA A;  3CM5 A;  1XHX A;  3DLK A;  4E1N A; 
#chains in the Genus database with same CATH topology
 1HRH A;  1Y97 A;  2PYL A;  1L3T A;  2P9K A;  3BY5 A;  3CJB A;  3ISN C;  4DV6 K;  1LWF A;  5AQP A;  4C8K A;  4M3X A;  5HOO A;  3AO4 A;  1YVU A;  4BQL A;  1YTU A;  4DB3 A;  3OYJ A;  5HRP A;  1NGB A;  3AVI A;  3NBP A;  1WN7 A;  3O1B A;  4BDY A;  2WOM A;  4U7B A;  4PKH A;  3S3N A;  3EEQ A;  3O9T A;  1JKH A;  5F2R A;  2Y1I A;  3QBW A;  4LFB K;  4QOZ B;  2A42 A;  3AVB A;  3TTD A;  1XWL A;  3FLC O;  4JD2 B;  4JI5 K;  4CJV A;  2F9T A;  1Q82 O;  4M3U A;  3QDK A;  5KI6 A;  3PIP L;  3UKU B;  5J2P A;  3CC7 N;  1QSL A;  3IMX A;  2OAN A;  1JJ2 M;  1KRP A;  1WSE A;  5JS1 A;  4DU3 A;  2UU9 K;  3T1A A;  4KO0 A;  5TKY A;  1HKB A;  3KLI A;  1SAZ A;  4ICL A;  5AQQ A;  4U67 L;  3QML A;  5IT9 O;  1NKC A;  1U6Z A;  4KTQ A;  1J9A A;  5FPM A;  3BZC A;  5JVG L;  2HHH K;  1EP4 A;  1FKO A;  3AAP A;  3QIP A;  4M3R A;  3TAQ A;  3O08 A;  1RT4 A;  3I8D A;  3L2R A;  3L2W A;  4DS5 A;  4OGE A;  5AFU A;  1Y64 A;  4HTL A;  2P9P A;  3CI5 A;  2OA8 A;  1TKX A;  1HYZ A;  2VWJ A;  3S3O A;  1Q9Y A;  2FBX A;  3SAG A;  3KD1 E;  3TSU A;  2UUC K;  4YOW A;  3ZT0 A;  2O8F B;  4KTW A;  4K41 A;  1KCF A;  3CYM A;  4FK2 A;  1X3M A;  4JNE A;  5CY4 A;  3G6E N;  4JI3 K;  1RDD A;  5KRT A;  2F96 A;  3DXM B;  4FWM A;  3VQ9 A;  3U4L A;  3MX2 A;  5AQK A;  3PY8 A;  2EX3 A;  3ZSV A;  4DV4 K;  5M1O A;  5JMV A;  3BEX A;  3AAQ A;  1HNW K;  2Q36 A;  4W5N A;  3NFA A;  2QK9 A;  1ZXO A;  3L2U A;  4JI4 K;  3CD6 N;  3K2P A;  1RTJ A;  5LMN K;  4F8R A;  4DHY A;  3SK3 A;  3L2V A;  3CC4 N;  3CF5 L;  4LFA K;  1SKW A;  3MN7 A;  1O1W A;  4DQP A;  3WXI A;  3HJF A;  4BG8 A;  4WQ5 C;  4B9T A;  2ASP A;  3CJ7 A;  1RGI A;  2W40 A;  2JWL A;  5BRF A;  1QHT A;  2WC9 A;  3M8R A;  3JS6 A;  3OYD A;  1GOB A;  1BIU A;  3A5M C;  3RRH A;  5FDL A;  1NGH A;  4AHV A;  4JI2 K;  3H3O B;  4JKB A;  5SZT A;  4CF9 A;  1ATR A;  2UXB K;  3VGK A;  1XMO K;  4JS5 A;  1DTT A;  1LAV A;  2XY6 A;  1QS4 A;  4BR2 A;  1BGX T;  3H6E A;  3EY1 A;  3SV3 A;  5I3U A;  3ZEU A;  3J7A P;  4H5N A;  2OPP A;  1U04 A;  3O6W A;  3DYA A;  4I7F A;  4K8X A;  3U3Y A;  1TUY A;  1UA0 A;  4O44 A;  4FJK A;  4Y0W A;  1QSS A;  3WEE A;  4KKO A;  1BG3 A;  1IG8 A;  1NU0 A;  1E4F T;  2YNI A;  2ZGZ A;  3SPZ A;  3ZT4 A;  2NRH A;  2P9L B;  1S1U A;  2A3Z A;  1S72 N;  1TYQ B;  4CD1 A;  1TKT A;  2PBD A;  1J53 A;  3NH0 A;  4H0P A;  3SQ4 A;  4CJS A;  3MEC A;  3L4I A;  1OH6 A;  3SAF A;  3VQ8 A;  4H0O A;  3O4W A;  3ZT1 A;  5MLC Q;  1VQ4 N;  2DFE A;  1B92 A;  3HPO A;  4IJA A;  1NBW A;  2O4I A;  3NHG A;  3M1F A;  2I7P A;  3ZET B;  1NGE A;  4IZ9 A;  4RW8 A;  4DFP A;  1S1T A;  4BVO A;  4Z94 A;  4C1N K;  4C8L A;  1VQ6 N;  2HF4 A;  1KVB A;  3V4I A;  4GKK K;  2RN2 A;  3V81 A;  3PLA A;  4DTO A;  4B1X B;  3TI0 A;  3LP2 A;  3LZI A;  4WCE L;  3BP8 A;  1DKG D;  3IS9 A;  4YNQ A;  3DRS A;  3OJU A;  1QVF M;  4HUG A;  4DSI A;  1YI2 N;  4C8M A;  4CZG A;  5LJW A;  3DLR A;  4DU1 A;  4IOC L;  4CGG A;  2A40 A;  2F9W A;  4DUY K;  4IOX A;  3LDO A;  3A5O C;  4BRM A;  3H3N O;  3O3F A;  4W5T A;  3L6Q A;  1HJR A;  3RSE A;  4CIF A;  2HVH A;  4CJP A;  3LP1 A;  4FWK A;  4H5W A;  3SMP A;  2QA4 N;  3C95 A;  3LAL A;  5AQH A;  4YDU A;  4CJ4 A;  1HKG A;  3KLG A;  4DTN A;  1VRT A;  3HST B;  2NRV A;  5AQR A;  3WNE A;  5FRM A;  1ZBL A;  5GIP A;  3HP6 A;  3VQ4 A;  3VQ6 A;  1C0T A;  2PZS A;  2XY5 A;  4CJU A;  3K5M A;  4J2E A;  2ZWH A;  1DLO A;  1ESV A;  4B9M A;  2QWP A;  1BOT O;  4OLA A;  3R9P A;  4CJF A;  4B9U A;  1FKP A;  2KQ2 A;  3IG1 A;  4GVM A;  4YOY A;  2HHX A;  3G4S N;  4KAZ A;  2UXC K;  1EXQ A;  3I0S A;  1JL2 A;  4RWT A;  1XHZ A;  3VQQ A;  3VQ7 A;  4H4O A;  5AZI A;  1ZBI A;  3M6G A;  4O8U A;  4ILG B;  4RG8 A;  3C6A A;  4LF6 K;  1B9F A;  5AJ3 K;  1NGJ A;  4JKA A;  1EO1 A;  3LDL A;  2Z1I A;  2OZS A;  4JN4 A;  3EL2 A;  1NNE A;  2HOE A;  5CHI A;  2GBZ A;  3JXU A;  3OYB A;  3FGU A;  3LM9 A;  3KK1 A;  2P9U A;  2EWS A;  1LWC A;  2I5J A;  3OBY A;  4YFU A;  4KH6 A;  4E1M A;  1NGD A;  5LY3 A;  3DI6 A;  2HHW A;  1XI1 A;  1U2V A;  5BPL A;  1E4G T;  3VN5 A;  4DTU A;  4JKH A;  1ASV A;  2ASM A;  4CBU A;  4IOA L;  1JLC A;  1YTA A;  1LW0 A;  4DG1 A;  1S3X A;  4BRQ A;  4QS7 A;  2P9I A;  1VSM A;  1A5V A;  3ITH A;  4A5A A;  3QER A;  3KZB A;  1HPM A;  1ATS A;  3DWL A;  4GY2 B;  4O5B A;  4NYF A;  3E66 A;  2P9N A;  4I6M A;  4FJ7 A;  4GNI A;  4DQR A;  2NLX A;  3AVH A;  4FJN A;  1WBD A;  2FF3 B;  3JAM O;  1N33 K;  2ZJR L;  2VQF K;  4JHD A;  3WUH A;  3VA0 A;  5AR0 A;  1X9J A;  4KHN A;  4LF7 K;  5TKW A;  1UAX A;  3P39 A;  2BUP A;  4BRG A;  3OYN A;  1GLL O;  2Y1J A;  1RTH A;  1T05 A;  1FJG K;  1JLE A;  1RDC A;  3SNN A;  1T7P A;  2KFN A;  3GG4 A;  3D2F B;  1GLA G;  3FR0 A;  4I2P A;  3QES A;  2Q0U A;  4WQ4 A;  3HTV A;  1YJW N;  2FBV A;  2FXU A;  1RTD A;  1BO5 O;  3CER A;  4CHO A;  1Q9X A;  3I33 A;  1W2B M;  4FPA A;  4H0T B;  3ALY A;  3DAW A;  3OYF A;  5E41 A;  1ASW A;  3N4Q A;  3DXK A;  4GV3 A;  3TAB A;  5HRR A;  4LFC K;  2KZZ A;  5AQV A;  4FJ8 A;  5DMR A;  1ASU A;  5CZ2 A;  3LDS A;  2X6N A;  3T7Z A;  3QEV A;  3ULD A;  1YAG A;  3KHY A;  2JGU A;  1EQY A;  1QZ6 A;  4IFE A;  3OYG A;  5FRO A;  3HRG A;  3MWT A;  4DV2 K;  2IAJ A;  3FZF A;  5M1P A;  4WFB L;  5SWM A;  3O1W A;  4JI8 K;  2LSN A;  4IO9 L;  3AA2 A;  4DU4 A;  4EIA A;  4ELV A;  4JKG B;  1MWM A;  3BF1 A;  3IAY A;  2GX9 A;  3TAE A;  5HRN A;  5I9E B;  1RT2 A;  2AJQ A;  3PSF A;  4CI6 A;  3AVG A;  3D0P A;  1KVA A;  1LV5 A;  1NKB A;  3V1O A;  4G9Z A;  1KVC A;  5JLF A;  3VQA A;  1XHX A;  4E1N A;  4WFA L;  4AHR A;  2G8V A;  4BR9 A;  4E3S A;  3CJ1 A;  3CJA A;  2ZD1 A;  4L3Q A;  1OH8 A;  4IEE A;  3QLH A;  4R79 A;  1TUU A;  4KBO A;  1BI4 A;  2O8D B;  3G71 N;  3C7N B;  1VQ7 N;  1VQM N;  4E7J A;  3L2Q A;  3CCQ N;  3WNH A;  4GMJ B;  4FK4 A;  2B5J A;  1IKX A;  3QET A;  3DM2 A;  1Z6R A;  4Z4G A;  3VEO A;  2P9S B;  5DM6 L;  4CE9 A;  1J6Z A;  3VES A;  4BDP A;  4AHS A;  1KXP A;  3HXM A;  3CPE A;  1VSL A;  4FWO A;  2YNF A;  3THY B;  1NJX A;  3DLG A;  3ULE B;  4FWQ A;  4DR6 K;  1NGA A;  2RF2 A;  1K8K B;  3B6P A;  4M63 C;  4CJ5 A;  3ZX2 A;  3ENO A;  2QTD A;  4E89 A;  3CCV N;  4F2S A;  1IKW A;  3CCE N;  4B9V A;  3SQ1 A;  2E8A A;  1V4S A;  1BA1 A;  3MDQ A;  4H8K A;  4DV7 K;  3G25 A;  3EZW A;  1NGC A;  3U9Z A;  3E9O A;  5AQX A;  1B9D A;  4CF1 A;  1WSJ A;  3VA3 A;  4O5F A;  2D0C A;  5C0Y A;  3PIO L;  1RDA A;  4IWV A;  3A2F A;  5BPN A;  3M8P A;  4BRL A;  3K5O A;  2F8S A;  3VQB A;  4BRA A;  2A6A A;  4ILJ A;  5AQF A;  1QTM A;  3A0I X;  3O4N A;  1X9S A;  3KK7 A;  3SPY A;  4BC4 A;  5GAE P;  1LAW A;  2J4R A;  3V9X A;  2VG5 A;  3CCS N;  4CHY A;  4GV9 A;  3M5R A;  4N47 A;  1SZ2 A;  2E5L K;  1IKY A;  4AQY K;  2XRI A;  4OPA A;  3VMF B;  4ISE A;  4M3T A;  4RW9 A;  4IG0 A;  4DR1 K;  1KLM A;  5JIC A;  5AZJ B;  1L3U A;  2DY4 A;  4R5P A;  2BGG A;  4BG9 A;  3CJC A;  1RDU A;  3ENH A;  2HBM A;  4KPY A;  3RMA A;  4HTU A;  4A59 A;  3DOL A;  1HMV A;  2Q31 A;  2WUS A;  3BZK A;  2Z1J A;  3MN5 A;  4BR5 A;  3ZT3 A;  3KWI A;  3HOT A;  3AA4 A;  5C10 A;  3NE6 A;  4CZF A;  1LCU A;  1OH7 A;  3MEE A;  2D1K A;  3UKR A;  1WNS A;  3WXM B;  3LWM A;  4KHU A;  3HPH A;  1KTQ A;  4CJK A;  3EZ5 A;  3K0S A;  4FVM A;  4CVN E;  4CJ7 A;  4L8R B;  3KTQ A;  1TKD A;  3EE8 A;  1W97 L;  4DLG A;  4WE1 A;  1Z25 A;  4A61 A;  5K14 A;  1W0H A;  4CK1 A;  4FJL A;  5ADX H;  2NRZ A;  1JXE A;  2QKB A;  5H1S Q;  2PAV A;  1QQM A;  3H45 C;  4BR0 A;  4DQI A;  2E6M A;  1N5Y A;  3OW2 M;  4XH4 A;  3E9P A;  1HPZ A;  3CQ8 A;  1VQL N;  4BC2 A;  4IXC A;  3PX0 A;  4OJR A;  4Z4E A;  2ZM6 K;  5KTQ A;  4M45 A;  3VEY A;  1L5U A;  3WT0 A;  3OYC A;  5F1X A;  4FZZ A;  3A8Y A;  2JLE A;  5LMU K;  3WXL A;  3A5N C;  4BR4 A;  4JD2 A;  2FLO A;  2DPN A;  1XMQ K;  3HP9 A;  3CCJ N;  1JCF A;  2BAN A;  5E26 A;  2XHB A;  3AA5 X;  3O8M A;  5JLH A;  1HNV A;  2HHS A;  4HUE A;  2JWK A;  1A5X A;  4CEO A;  1NKE A;  3OTO K;  3LP0 A;  2XO7 A;  4RW4 A;  5CYM A;  4CHQ A;  1U49 A;  2GWK A;  3NF6 A;  3AVC A;  4ZTJ A;  2EHG A;  3QB0 A;  1NM1 A;  3R3L A;  4FO0 A;  4CFD A;  2FSN A;  4CBW A;  4CJ3 A;  3F9K A;  4B3R K;  1S6Q A;  1BQM A;  4CZL A;  3D2E A;  4BRK A;  1DGK N;  1RT3 A;  3R1X A;  4W5R A;  5AQN A;  4CF0 A;  2O8F A;  3S3M A;  3HL8 A;  3QFU A;  1C1A A;  4M7X A;  3AVF A;  5C24 A;  3ZLJ A;  3CIP A;  4X65 K;  2OPQ A;  1YF5 L;  3MAQ A;  3ZX0 A;  3RWU A;  3VQD A;  2NRX A;  3O5B A;  3TR8 A;  4BRP A;  4C23 A;  5C25 A;  3IUC A;  4AHU A;  2FSK A;  1TAU A;  1P8Z A;  3V9W A;  4DS4 A;  4AM6 A;  3SMS A;  3KLH A;  4DSK A;  5EX5 A;  5AQS A;  2KHO A;  4LF5 K;  3E9L A;  4EFH A;  4O0I A;  2HND A;  3RVC A;  2ZGY A;  3HO1 A;  4JI1 K;  1HR0 K;  2OTL N;  2QKK A;  3RR8 A;  4CEE A;  3EE9 A;  2O8E B;  3HK2 A;  1CZA N;  1QE1 A;  3NGZ A;  4MQ3 A;  4OKE A;  4AM7 A;  3VEZ A;  5C2F A;  1QQC A;  4H0V B;  3JSM A;  3QFP A;  3CCM N;  5KPT A;  1S1X A;  4WQ5 A;  4DQS A;  2G8I A;  1VSE A;  1KFD A;  1I3A A;  3Q7C A;  3NH2 A;  3EYZ A;  4FM1 A;  5BR9 A;  1K8A O;  4I9Q A;  3MK6 A;  2YKN A;  3DRR A;  3KVG A;  3OJS A;  3DJC A;  4EP4 A;  3GDQ A;  4K8Z A;  4CES A;  2I7N A;  4E1J A;  1RT7 A;  1KAX A;  3ZEU B;  4GVE A;  4DV1 K;  4FLY A;  4OLB A;  3DLE A;  4LH5 A;  1IO2 A;  3F9M A;  3WEE B;  3NF7 A;  5KRS A;  4M42 A;  4KHY A;  4OPJ A;  2QWM A;  3AVL A;  5T7B A;  1NJW A;  2IVP A;  4CZE A;  1N8R O;  4EHU A;  1S1V A;  5GAG P;  3P1G A;  3U9D A;  3T3F A;  4A62 A;  4JI0 K;  3ZX3 A;  1SL2 A;  3OHR A;  4NO7 A;  2ASO A;  3OYA A;  1BU6 O;  4H5V A;  4M3W A;  4DR3 K;  3VET A;  4I2Q A;  3DOK A;  2UUA K;  4B9Q A;  1VQK N;  1C1B A;  5J2Q A;  4FJH A;  3I0R A;  1C0F A;  4OX9 K;  4DV3 K;  3MXM A;  1W7A A;  1MU2 A;  2FC0 A;  4FWN A;  2ITM A;  3AO3 A;  4KI4 A;  4OO1 J;  2FSJ A;  4CZH A;  2QEX N;  1K9M O;  3D6R A;  3DLH A;  3HVT A;  1MDU B;  3ZT2 A;  4CCH A;  3OYL A;  3TAF A;  3R6M A;  4A2A A;  3T19 A;  2UXD K;  4ISF A;  2W41 A;  4KHQ A;  1YJ9 N;  3C6U A;  2CGL A;  3NGI A;  3K5L A;  3TSQ A;  1X9W A;  2OPR A;  4DR7 K;  3LDP A;  3F2K A;  1T8E A;  1BUP A;  3VTH A;  1YUW A;  3T69 A;  3WXJ A;  1WOQ A;  1CXU A;  4IJN A;  5BRD A;  1VRU A;  4LF9 K;  4YOU A;  5FPE A;  2G8W A;  3OA9 A;  1JLA A;  1XQS C;  1UA1 A;  3J8A A;  5KGW A;  3CXC M;  5AZI B;  2E2Q A;  1VQ5 N;  3I56 N;  4CEF A;  3DLB A;  2HMI A;  3V9U A;  4YHH K;  3CM5 A;  5KPR A;  1RBS A;  3E1Y A;  4PL7 A;  3OS1 A;  3VGL A;  1U45 A;  1XNR K;  2P9U B;  2VGM A;  1MA9 B;  1OVY A;  3I55 N;  1QHA A;  4C8N A;  1RT1 A;  3FZL A;  2D0P A;  2YI1 A;  3GOI A;  3SV4 A;  1ZYQ A;  4PL8 A;  3WQT A;  4W5O A;  3NVK A;  4V19 S;  1IV0 A;  4JYA K;  1W9H A;  4XIU A;  3O9Q A;  4CK3 A;  2GV9 A;  4KRE A;  3BGR A;  2DFH A;  4F4K A;  4CEZ A;  4K43 A;  3SYZ A;  5GAH P;  1S6P A;  3MN9 A;  4B9L A;  3ENB A;  3RTV A;  1EET A;  4DTP A;  4KI6 A;  5GIO A;  4W5Q A;  4BRE A;  4CIE A;  1NK5 A;  2VQE K;  1ZBH A;  4HHT A;  1WSH A;  4IDK A;  5M1F A;  2HVI A;  4OPK A;  4DV0 K;  5M1N A;  5KGX A;  4FM2 A;  1RBV A;  1IJJ A;  3H46 O;  4CBX A;  4BWM A;  3J80 O;  1R0A A;  1R59 O;  2NRR A;  4IG3 A;  5EU7 A;  1ATN A;  5FLX O;  5JVH L;  4B3M K;  4JHD B;  3VF6 A;  3KWG A;  4CHP A;  2HBJ A;  3BF3 A;  3OVN A;  4RTF D;  3P83 D;  5ELZ A;  2KLA A;  3SUP A;  3VER A;  3SUN A;  3KLF A;  3G10 A;  1EWR A;  2D0O A;  4UY8 O;  4QS9 A;  2WFB A;  4B9N A;  1ZBS A;  4LH4 A;  2Z1H A;  4ELU A;  5AQM A;  3P31 A;  3ATU A;  3SZ2 A;  3D2F A;  1WUA A;  3L8B A;  1KC8 O;  3DXK B;  4O0J A;  2KFZ A;  4LSN A;  1G99 A;  4BRF A;  1VSD A;  1GLJ O;  2QWQ A;  4Z0U A;  1YIT N;  5BRH A;  3HT3 A;  3VEW A;  1QQO A;  2KW4 A;  3T1Y K;  4I9L A;  1HYV A;  4X62 K;  3QEP A;  3P38 A;  1YHQ N;  4Z4C A;  1ZBF A;  1HKC A;  3CQX A;  3L3U A;  4KHW A;  2BTF A;  4EP5 A;  3NAE A;  1IKV A;  5E84 A;  3EO3 A;  4DF8 A;  4AH9 A;  1DEJ A;  2HW3 A;  2UYT A;  4CGI A;  4JRQ A;  3MXJ A;  4NYN A;  4DSL A;  1NG9 A;  5AQU A;  1GOA A;  4Y1D A;  2O4G A;  4RW6 A;  1YVN A;  3AVM A;  2YHW A;  1DTQ A;  4BQZ A;  3PUF A;  5HL7 L;  3M3Z A;  3O80 A;  3O9S A;  3ZSQ A;  5LL6 Z;  3V1R A;  3RRG A;  2QW9 A;  4JKG A;  2P5G A;  3B6O A;  4XH1 A;  3SQ2 A;  4MO5 A;  1U47 A;  4FVU A;  2FBT A;  1RNH A;  4OPH A;  5HBM A;  2E88 A;  3QNO A;  1SUQ A;  3NF9 A;  3THW B;  3HI0 A;  3ATV A;  2O8C B;  5CYQ A;  4MO4 A;  2O8B B;  1QQN A;  3HPG A;  1XC9 A;  2HMP A;  3HZ6 A;  2KZM A;  3CHW A;  3OYE A;  1X1P A;  3CCR N;  1TV6 A;  1BI4 B;  2DTU A;  3UE5 A;  1C0G A;  1S9E A;  4ZHR A;  4QS8 A;  3W3D A;  1BCM A;  2ZE2 A;  2QXF A;  3R8E A;  4CZI A;  3ZSY A;  1VK0 A;  3CG7 A;  3RMD A;  1U4B A;  4BRC A;  2O8D A;  3OYI A;  3C7N A;  4KH5 A;  4N41 A;  1ZBU A;  1Q81 O;  4O55 A;  1N34 K;  4JK7 A;  1BWF O;  3LZJ A;  5EVZ A;  2A1R A;  3AAR A;  3L4Q A;  5AQT A;  3K59 A;  4JLH A;  5J1E A;  2QWR A;  2IVO A;  4FLU A;  1Q86 O;  4JAX A;  1RBT A;  3QEX A;  4E7L A;  1Q7Y O;  3AVJ A;  3NMU A;  1KLN A;  4FZY A;  2IC3 A;  4AHT A;  2RE2 A;  3THY A;  1MWK A;  1BQN A;  1I39 A;  1T6C A;  2RKI A;  1WSG A;  5CZ1 A;  4RW7 A;  2OYQ A;  2QWO A;  1K8K A;  2QWN A;  4Q5V A;  1EKE A;  4FXD A;  1RT5 A;  5HLF A;  2E1Z A;  2IGI A;  1WSF A;  3QIO A;  3TWH A;  2G8K A;  3SBT A;  1X3N A;  2G8F A;  1BIZ A;  1IG9 A;  2G8H A;  4B8A B;  3NH1 A;  3DRP A;  5DK5 A;  3ZSX A;  4DF4 A;  1JLG A;  1GLF O;  4FOI A;  4DLE A;  4FM0 A;  1TK0 A;  2HHQ A;  1C0U A;  1GLE G;  1JLQ A;  4DQ8 A;  1J5E K;  4JK8 A;  4MDB A;  1VSF A;  3THX A;  2V7Z A;  4LF8 K;  2QI2 A;  4FWP A;  1HQU A;  2F4V K;  3GL1 A;  4B1V A;  5BRE A;  4BGB A;  4MFB A;  3AA3 A;  3MCP A;  2YJF A;  5KQD A;  5B8H A;  4KHP K;  1FXX A;  1CZ9 A;  1NJI O;  3AVK A;  4CHN A;  1BHL A;  4GKJ K;  1JXB A;  1KFS A;  4B1W B;  4FJM A;  4JKC A;  4GW6 A;  1S9G A;  3ZSW A;  2HNZ A;  3IFR A;  2E2N A;  3LDN A;  2E4L A;  2E6L A;  1IH7 A;  1D8Y A;  1LWE A;  2IDO A;  3O9U A;  4E0D A;  4G1Q A;  1WLJ A;  2ATQ A;  2HBL A;  1JCE A;  4KH4 A;  1QVG M;  4BGA A;  1HNX K;  4JRP A;  5EY4 A;  4K0K K;  1JLF A;  3U3G A;  3VQ5 A;  2R7Y A;  1H1V A;  3WNG A;  4OVL A;  1NK7 A;  5AZJ A;  3TSP A;  4BY9 C;  2E1Y A;  2UUB K;  1SL1 A;  1VSK A;  4A57 A;  3KD5 E;  2E2O A;  4KFB A;  3ZSZ A;  2Q97 A;  3OYM A;  3TAM A;  3CFR A;  2W6K A;  4E7I A;  5LJV A;  3NCI A;  3LL3 A;  4KHS A;  3MEG A;  2P9K B;  4NLB A;  3OBW A;  1XC3 A;  1IBK K;  3FFK B;  2RPI A;  4CF2 A;  1NK9 A;  1YIJ N;  1J5O A;  5AQJ A;  1I94 K;  4O4G A;  4HUF A;  5A2Q O;  3TPQ A;  4FPB A;  4E7K A;  1KAY A;  2VGN A;  1NJY A;  1HLU A;  4F2R A;  4FW2 A;  4FJI A;  4FLV A;  2WTU A;  2YX6 A;  4CFB A;  4DUZ K;  3MN6 A;  4PA1 A;  4XH5 A;  3E01 A;  3SLC A;  3MWP A;  3AO2 A;  4EZ9 A;  1SL0 A;  3K5N A;  4M3Z A;  2V7Y A;  2NRT A;  2HBK A;  3K9K A;  1WSI A;  4PHT X;  3O3G A;  3T1H K;  2IIR A;  2D5R A;  3UKU A;  4AF1 A;  4IDH A;  3AO5 A;  5C42 A;  1VSH A;  1JCG A;  4O8K A;  3QNN A;  1TGO A;  2QXL A;  3CC2 N;  1NOY A;  3S41 A;  5JS2 A;  1Q18 A;  1WAF A;  4JV5 K;  2ZF5 O;  3LWL A;  4CZK A;  1QZ5 A;  4DMN A;  1CLQ A;  2P9P B;  4DQQ A;  3O3H A;  3PV8 A;  2YHX A;  3UIQ A;  2BE2 A;  4CEB A;  3GE1 A;  3QO9 A;  4CEA A;  2HHU A;  3CFO A;  2CH6 A;  4B3T K;  4DTX A;  1QSY A;  4MDA A;  1TL3 A;  1HYS A;  3D45 A;  1VSI A;  3D2E B;  4WFN L;  3CCL N;  4PQU A;  4MLE A;  4DTR A;  4CEQ A;  4IBN A;  1SQK A;  3H1V X;  3MCA B;  3DXM A;  3KJV A;  1HQE A;  3OS2 A;  3J81 O;  4NB4 A;  4JI6 K;  2WON A;  2OCE A;  2QM1 A;  4X66 K;  3LP3 A;  3PO4 A;  3OY9 A;  5GIN A;  3HVR A;  2IVN A;  2P5O A;  4JKE A;  2KTQ A;  2A41 A;  5KPZ A;  4FWR A;  5CR4 A;  4BRH A;  2OTJ N;  4LSL A;  3HM9 A;  3AGK A;  2ZQB A;  3ZYY X;  3KK3 A;  4BC3 A;  2D0A A;  4CF8 A;  4F9O A;  3PX4 A;  4AIL C;  3SAH A;  2GUP A;  1Z05 A;  2E20 A;  4A2B A;  4J2D A;  3P4I A;  3M8Q A;  1YT3 A;  3AVN A;  1TK5 A;  4EZ6 A;  3TAR A;  3TAN A;  1NGI A;  4JKF A;  3FE1 A;  1RFQ A;  1CXQ A;  5AQY A;  2Q0R A;  4NXN K;  4CD3 A;  4CGJ A;  2OZM A;  3CJ9 A;  2O8E A;  1RT6 A;  5EOY A;  3ZSO A;  4HCC A;  4FLT A;  5AQW A;  2F7T A;  3J7Y P;  3NF8 A;  3PX6 A;  3HSC A;  3H1Q A;  2CGJ A;  1SS6 A;  4DV5 K;  1WB9 A;  4FWL A;  4CEC A;  4JEP A;  1X9M A;  2IOC A;  4C8O A;  2HB5 A;  4CJT A;  4DKW A;  1C1C A;  3J7Z O;  4YOX A;  1FK9 A;  5AQG A;  1D4X A;  4CGH A;  5D3G A;  2YHB A;  5AFU H;  1K6Y A;  4CIG A;  1S5J A;  1TK8 A;  1EWQ A;  4LC9 B;  3OYK A;  1SV5 A;  1E3M A;  2H3G X;  4CW7 B;  2P9L A;  4PUO A;  1N32 K;  2NZT A;  1TYQ A;  4B3S K;  3V1Q A;  4HVJ A;  4BRN A;  4Z4I A;  4CJE A;  4MLH A;  1SKR A;  4PKI A;  1VQO N;  4NCA A;  3HYF A;  3JYT A;  2ITG A;  3QIN A;  3LAK A;  3IRX A;  4BE2 A;  1LOT B;  1NGF A;  3C65 A;  5C12 A;  2GWJ A;  1NJZ A;  5I42 A;  5C15 A;  3U6F A;  4JKD A;  4YOV A;  3SUO A;  3ZCM A;  5EXW A;  4OGC A;  2HHT A;  1RBR A;  2OPS A;  2W42 A;  3VGM A;  1NK8 A;  1VQN N;  4JI7 K;  3ZET A;  1BIS A;  2A1S A;  4K25 A;  4Q0B A;  4DCH A;  3HM8 A;  3SQ0 A;  3AV9 A;  1L3V A;  4B3O A;  1T03 A;  2FF6 A;  3TTC A;  3SJJ A;  2NNW A;  5AQO A;  2NUB A;  3VTI A;  3TAG A;  4FSV A;  1RTI A;  3QEW A;  2ZJP L;  1OKJ A;  4DFJ A;  4WF9 L;  1VQP N;  2HF3 A;  1EX4 A;  2B4J A;  4B08 A;  3MMV A;  4CED A;  2HNY A;  2PFU A;  4H0Y B;  1S22 A;  4H5R A;  4JK9 A;  3RSE B;  3SBG A;  1P90 A;  4PKG A;  3KLE A;  2E2P A;  1LW2 A;  4Z4F A;  4XEI A;  4LF4 K;  4YDU C;  5C2D A;  4FLW A;  4FLX A;  2Q1N A;  3MXI A;  3KKR A;  4ID5 A;  1HNI A;  1RDB A;  3VOV A;  3EKU A;  1RIL A;  1GOC A;  3V9Z A;  2VCP A;  2QWL A;  3O9R A;  2P1J A;  5HP1 A;  4FZX C;  1KSP A;  4IFV A;  4FK0 A;  5FPD A;  4OKK A;  3A5L C;  4EAH D;  4CER A;  2VYP A;  3SUQ A;  1S1W A;  4DR2 K;  1VSJ A;  3C0B A;  4CFA A;  4JS4 A;  2WBN A;  2G8U A;  5M1Q A;  3W0L A;  4UQG A;  5BN8 A;  2BH1 A;  4X64 K;  4J2B A;  4CJR A;  4BE1 A;  1TL1 A;  2XY7 A;  3EN9 A;  3HBT A;  4BAC A;  2YNH A;  3V9S A;  4KV8 A;  5HRS A;  4N5S A;  1D9F A;  2IS3 A;  1JLB A;  1HX1 A;  1V4T A;  1YJN N;  3I8B A;  1WBB A;  3HOS A;  2KKZ A;  2GEM A;  1VHX A;  5BR8 K;  4K42 A;  5BPM A;  1TVR A;  3MED A;  4FCY A;  1U2V B;  1GLB G;  3LPT A;  4J8F A;  3THV A;  1JL1 A;  3IDH A;  4BE0 A;  2V52 B;  4DTM A;  4NCG A;  1C0M A;  3WNF A;  2P9I B;  3AVA A;  3LM2 A;  4DSE A;  2X78 A;  4CHZ A;  3N4P A;  5KQ8 A;  4ID1 A;  1M90 O;  4ZTF A;  1K73 O;  3GBT A;  5IWA K;  3S9H A;  1M1K O;  1NOZ A;  3ID6 A;  2P9N B;  4I6M B;  1N6Q A;  2FBY A;  4YOR A;  3VQP A;  1NMD A;  4DSF A;  4FWS A;  1DT9 A;  1KAZ A;  4BRI A;  4DFM A;  4BC5 A;  1SKS A;  1UOC A;  3WXK A;  4E7H A;  1F21 A;  3CET A;  4PY5 A;  5J2M A;  1RCH A;  2VWK A;  3VQC A;  5GAD P;  1XNQ K;  4B1Z A;  1KQS M;  4DWI A;  4DSJ A;  1D9D A;  1BL3 A;  4FYD A;  2Z1G A;  3L3V A;  4FOE A;  3D7E O;  3VEX A;  1TKZ A;  3Q7B A;  4WQ4 C;  4BR7 A;  1U48 A;  5FRN A;  1YXQ A;  1UWB A;  1RDW X;  4ISG A;  2A5X A;  1D5A A;  2CGK A;  4FLZ A;  4AHC A;  2X74 A;  3VF2 A;  4M41 A;  1NLV A;  2W6L A;  3F5T A;  5F0X A;  4CJQ A;  1OH5 A;  3K9J A;  2PY5 A;  3NGY A;  1BCO A;  1KD1 O;  3SI6 A;  4Z4H A;  2AP1 A;  5J2N A;  4FL9 A;  3V6D A;  4DTJ A;  2GTD A;  2YCH A;  3KKS A;  1HUX A;  5FPN A;  4BVP A;  1A5W A;  3AO1 A;  5AQZ A;  1NGG A;  1Z26 A;  4J2A A;  1L3S A;  3F73 A;  2AA4 A;  3DLL L;  2GUI A;  4BDZ A;  3MX5 A;  1IBL K;  3BUZ B;  2VG7 A;  3ID8 A;  4CFC A;  2CH5 A;  2PYJ A;  1T44 A;  3NVM A;  3KIO A;  1BA0 A;  3LAN A;  3C94 A;  4NXM K;  1NWK A;  4IKF A;  1G15 A;  3P5J A;  3RR7 A;  1XUP O;  4LY7 A;  4E19 A;  5HRO A;  1C6V A;  3TU5 A;  4KB1 A;  3FFI A;  3CME N;  4IFY A;  2HST A;  2ETJ A;  2X6S A;  3AY9 A;  5DM7 L;  4H03 B;  1TAQ A;  3CFP A;  3OYH A;  2NRW A;  4N76 A;  5M1K A;  3PO5 A;  3SJH A;  4C1N I;  3DMJ A;  4ILH A;  4QCL A;  3L0Q A;  4B8C A;  2BDP A;  5AQL A;  4KTZ A;  3VQE A;  3THW A;  1CZB A;  1NK0 A;  3CM6 A;  4CGD A;  1ILY A;  3UB5 A;  2O8C A;  4PWD A;  2O8B A;  2F8T A;  3WQU A;  2RHK A;  3O4Q A;  4H5T A;  3VF4 A;  2Q3S A;  3QBX A;  3ZSR A;  1NK6 A;  3CQY A;  3TAP A;  1VAZ A;  3K58 A;  2YKM A;  3VPZ A;  4Y1C A;  3B8A X;  3EKS A;  3CCU N;  3RMB A;  4DR5 K;  2YHY A;  2P9S A;  1NK4 A;  3H08 A;  4QAG A;  4EHT A;  4FJ5 A;  3LPU A;  3FZK A;  4OKJ A;  4GV6 A;  1GLD G;  1NMN A;  4BRD A;  3QIC A;  4KRF A;  2ZJQ L;  1O13 A;  3TTF A;  3ULE A;  4BRO A;  4M7Y A;  3IKM A;  1REV A;  4DR4 K;  1N36 K;  3VEN A;  1IBM K;  3LDQ A;  4F3O A;  3FZH A;  3K57 A;  3VEV A;  5BN9 A;  1HJO A;  3PSI A;  2HHV A;  5ADX A;  4FW1 A;  3LAM A;  1T6D A;  4B9S A;  4NCB A;  1ITG A;  4H0X B;  4CK2 A;  4H4M A;  4DFK A;  1Q8I A;  3AGR A;  2P51 A;  4YY3 K;  3NDK A;  3ASM A;  3THX B;  1VQ8 N;  2YHA A;  4FJX A;  4FJ9 A;  3C6H A;  1HNZ K;  2D4W A;  4YOT A;  4FJJ A;  2DFF A;  1BDG A;  4F3T A;  4IEI A;  1RBU A;  4IO8 A;  2YV0 X;  2D0B A;  4KB0 A;  1WAJ A;  2XY8 A;  3RMC A;  3U8X A;  5CE3 A;  2YJE A;  3M8S A;  4DTS A;  1J54 A;  1OVQ A;  3C6T A;  2GEL A;  2VG6 A;  3CMA N;  4CJL A;  2B6A A;  4TSX A;  4HWI A;  4A5B A;  3G0Z A;  1ZC6 A;  3KK2 A;  4HCB A;  4CGF A;  4FJG A;  4WYB A;  1VQ9 N;  4LD0 A;  3CPW M;  2VWB A;  4CZJ A;  3SCX A;  4BWJ A;  4CZM A;  3UKR B;  4CJW A;  4ELT A;  2V51 B;  3QEI A;  2YNG A;  4NLC A;  4M3Y A;  4B1U B;  3OS0 A;  1FW6 A;  3BDP A;  4N56 A;  3FZM A;  5AQI A;  1T3V A;  2Q2R A;  4RCH A;  4B1Y B;  1GLC G;  3DLK A; 
#chains in the Genus database with same CATH homology
 1RBS A;  1HRH A;  1Y97 A;  4CEC A;  2PYL A;  4AHR A;  3OS1 A;  2IOC A;  1X9M A;  2G8V A;  4E3S A;  4C8O A;  2ZD1 A;  2HB5 A;  1U45 A;  1L3T A;  3ISN C;  4CJT A;  1LWF A;  1C1C A;  4C8K A;  3QLH A;  4M3X A;  4C8N A;  1FK9 A;  1RT1 A;  3AO4 A;  3SV4 A;  1ZYQ A;  1YVU A;  1BI4 A;  4CGH A;  5D3G A;  4W5O A;  2YHB A;  1YTU A;  1K6Y A;  4CIG A;  1S5J A;  1W9H A;  5HRP A;  4XIU A;  3OYJ A;  1TK8 A;  3OYK A;  1SV5 A;  4CK3 A;  4E7J A;  3AVI A;  2GV9 A;  3NBP A;  4GMJ B;  3WNH A;  3L2Q A;  2B5J A;  4PUO A;  4FK4 A;  3BGR A;  1WN7 A;  1IKX A;  4BDY A;  3QET A;  2WOM A;  2DFH A;  3V1Q A;  3DM2 A;  4HVJ A;  4F4K A;  4CEZ A;  4CJE A;  3S3N A;  4Z4I A;  4CE9 A;  4Z4G A;  3SYZ A;  1SKR A;  4NCA A;  3HYF A;  3JYT A;  2ITG A;  1S6P A;  1JKH A;  3QIN A;  4AHS A;  3LAK A;  3IRX A;  4BE2 A;  2Y1I A;  3HXM A;  4BDP A;  4QOZ B;  4B9L A;  3AVB A;  3RTV A;  5I42 A;  1NJZ A;  1EET A;  1XWL A;  1VSL A;  4CJV A;  4DTP A;  3U6F A;  4KI6 A;  3SUO A;  3ZCM A;  4M3U A;  5KI6 A;  5J2P A;  4W5Q A;  2YNF A;  4OGC A;  4CIE A;  1NK5 A;  1RBR A;  2HHT A;  2OPS A;  2W42 A;  1QSL A;  1ZBH A;  1NK8 A;  1NJX A;  1KRP A;  4HHT A;  1WSH A;  1WSE A;  5JS1 A;  3DLG A;  4DU3 A;  3T1A A;  4KO0 A;  3KLI A;  1BIS A;  4ICL A;  2A1S A;  2RF2 A;  3B6P A;  4IDK A;  4CJ5 A;  4Q0B A;  2HVI A;  4OPK A;  1NKC A;  5KGX A;  4KTQ A;  4E89 A;  4FM2 A;  1RBV A;  1J9A A;  4BWM A;  3SQ0 A;  3AV9 A;  1R0A A;  1L3V A;  1T03 A;  1IKW A;  4F2S A;  4B3O A;  4IG3 A;  4B9V A;  5EU7 A;  3SJJ A;  1EP4 A;  1FKO A;  3QIP A;  4M3R A;  3TAQ A;  2NUB A;  1RT4 A;  3SQ1 A;  3I8D A;  3TAG A;  3L2R A;  1RTI A;  4H8K A;  3QEW A;  3L2W A;  4CHP A;  4DS5 A;  4OGE A;  3OVN A;  4DFJ A;  1B9D A;  3P83 D;  4CF1 A;  1WSJ A;  3VA3 A;  1EX4 A;  2B4J A;  2D0C A;  4B08 A;  3SUP A;  1RDA A;  2OA8 A;  4CED A;  3SUN A;  3A2F A;  2HNY A;  3KLF A;  3G10 A;  1TKX A;  1HYZ A;  3M8P A;  2VWJ A;  3S3O A;  1Q9Y A;  2FBX A;  3KD1 E;  3K5O A;  2F8S A;  3VQB A;  3ZT0 A;  3KLE A;  4B9N A;  1LW2 A;  4Z4F A;  4LH4 A;  4KTW A;  2Z1H A;  1KCF A;  3CYM A;  1QTM A;  4ELU A;  4KRE A;  3SZ2 A;  4FK2 A;  3O4N A;  3L8B A;  5CY4 A;  4FLW A;  1X9S A;  1RDD A;  5KRT A;  4FLX A;  3SPY A;  2F96 A;  1LAW A;  3MXI A;  4O0J A;  3VQ9 A;  3V9X A;  3KKR A;  2VG5 A;  4ID5 A;  4CHY A;  1HNI A;  3PY8 A;  4FYD A;  2KFZ A;  2EX3 A;  4LSN A;  3ZSV A;  1VSD A;  1RDB A;  4Z0U A;  1RIL A;  1GOC A;  4N47 A;  3HT3 A;  3V9Z A;  2KW4 A;  1IKY A;  4I9L A;  1HYV A;  3QEP A;  4W5N A;  2P1J A;  2XRI A;  3NFA A;  5HP1 A;  4FZX C;  2QK9 A;  1KSP A;  3L2U A;  4IFV A;  4Z4C A;  1ZBF A;  4FK0 A;  4OKK A;  3K2P A;  1RTJ A;  3L3U A;  4KHW A;  4EP5 A;  4CER A;  1IKV A;  3NAE A;  4M3T A;  4RW9 A;  4DF8 A;  4AH9 A;  4F8R A;  2HW3 A;  4IG0 A;  4CGI A;  4JRQ A;  1KLM A;  3MXJ A;  3SUQ A;  4NYN A;  3L2V A;  4DSL A;  1L3U A;  1S1W A;  1SKW A;  2DY4 A;  1O1W A;  4R5P A;  1VSJ A;  1GOA A;  4Y1D A;  4DQP A;  2BGG A;  3HJF A;  2O4G A;  4KPY A;  3RMA A;  4B9T A;  4CFA A;  4JS4 A;  4HTU A;  4RW6 A;  3AVM A;  2G8U A;  3DOL A;  1QHT A;  1DTQ A;  1HMV A;  4UQG A;  3PUF A;  2Z1J A;  3M8R A;  3ZSQ A;  3OYD A;  3V1R A;  3ZT3 A;  4CJR A;  4J2B A;  3RRG A;  1GOB A;  1BIU A;  4BE1 A;  2P5G A;  1TL1 A;  5FDL A;  3RRH A;  2XY7 A;  3AA4 A;  4AHV A;  3NE6 A;  4BAC A;  2YNH A;  3V9S A;  4KV8 A;  5HRS A;  3B6O A;  4CF9 A;  5SZT A;  3SQ2 A;  1U47 A;  4N5S A;  3MEE A;  1D9F A;  2FBT A;  1RNH A;  5HBM A;  1WNS A;  2IS3 A;  1JLB A;  3QNO A;  1SUQ A;  4JS5 A;  1DTT A;  3LWM A;  4KHU A;  3NF9 A;  1LAV A;  2XY6 A;  1QS4 A;  3HPH A;  1KTQ A;  4CJK A;  1BGX T;  5CYQ A;  3EY1 A;  3EZ5 A;  3SV3 A;  4FVM A;  5I3U A;  4L8R B;  2OPP A;  3KTQ A;  1U04 A;  3HPG A;  1XC9 A;  1TVR A;  3DYA A;  2KZM A;  3MED A;  4I7F A;  3OYE A;  3U3Y A;  1X1P A;  4FCY A;  1UA0 A;  4O44 A;  1TKD A;  4K8X A;  1TV6 A;  1BI4 B;  3LPT A;  4FJK A;  1QSS A;  2DTU A;  4KKO A;  4DLG A;  4WE1 A;  3THV A;  1S9E A;  1JL1 A;  1Z25 A;  5K14 A;  4ZHR A;  4BE0 A;  1W0H A;  2ZE2 A;  1BCM A;  2YNI A;  4CK1 A;  2QXF A;  1JXE A;  3SPZ A;  4DTM A;  4FJL A;  4NCG A;  2QKB A;  1C0M A;  3WNF A;  3ZT4 A;  1S1U A;  3AVA A;  3ZSY A;  1VK0 A;  4DSE A;  1TKT A;  3CG7 A;  3RMD A;  1U4B A;  2X78 A;  4CHZ A;  1J53 A;  3NH0 A;  2E6M A;  4DQI A;  3OYI A;  3SQ4 A;  1N5Y A;  4ID1 A;  1ZBU A;  4N41 A;  4ZTF A;  4CJS A;  3MEC A;  4O55 A;  3VQ8 A;  1HPZ A;  3S9H A;  1NOZ A;  3ZT1 A;  3CQ8 A;  3LZJ A;  1N6Q A;  2FBY A;  3PX0 A;  4OJR A;  3VQP A;  4Z4E A;  2A1R A;  5KTQ A;  4DSF A;  4M45 A;  3K59 A;  2DFE A;  4JLH A;  5J1E A;  1B92 A;  3HPO A;  1L5U A;  3OYC A;  2O4I A;  3NHG A;  4FZZ A;  2JLE A;  4DFM A;  4FLU A;  1SKS A;  1RBT A;  3QEX A;  4E7L A;  3AVJ A;  1UOC A;  1KLN A;  4FZY A;  4RW8 A;  2IC3 A;  4E7H A;  3HP9 A;  1S1T A;  4DFP A;  1F21 A;  2BAN A;  4C8L A;  4AHT A;  2XHB A;  3AA5 X;  4PY5 A;  1HNV A;  5J2M A;  1BQN A;  1RCH A;  1I39 A;  2VWK A;  2RKI A;  1WSG A;  3VQC A;  1KVB A;  2HHS A;  4DWI A;  3V4I A;  5CZ1 A;  4RW7 A;  4HUE A;  4DSJ A;  1A5X A;  1D9D A;  2OYQ A;  2RN2 A;  4CEO A;  1BL3 A;  4Q5V A;  3V81 A;  1EKE A;  1NKE A;  2G8I A;  4FXD A;  1RT5 A;  2Z1G A;  3LP0 A;  4DTO A;  3TI0 A;  5HLF A;  2IGI A;  3LP2 A;  3LZI A;  1WSF A;  2XO7 A;  3L3V A;  4RW4 A;  5CYM A;  3QIO A;  3TWH A;  2G8K A;  4CHQ A;  3IS9 A;  2G8F A;  4YNQ A;  1BIZ A;  1U49 A;  3DRS A;  1IG9 A;  2G8H A;  3NF6 A;  1TKZ A;  3AVC A;  4B8A B;  3OJU A;  2EHG A;  4ZTJ A;  1U48 A;  5FRN A;  3NH1 A;  3DRP A;  4HUG A;  4DSI A;  1UWB A;  5DK5 A;  4C8M A;  3ZSX A;  4DF4 A;  1JLG A;  4DLE A;  1TK0 A;  4FM0 A;  2HHQ A;  3DLR A;  4DU1 A;  1C0U A;  1D5A A;  1JLQ A;  4FLZ A;  4AHC A;  4CFD A;  2X74 A;  1VSF A;  4CGG A;  4CJ3 A;  3F9K A;  4M41 A;  1S6Q A;  1HQU A;  1BQM A;  3O3F A;  4W5T A;  4MFB A;  3AA3 A;  1RT3 A;  4CJQ A;  1HJR A;  4W5R A;  4CIF A;  4CF0 A;  2HVH A;  4CJP A;  2PY5 A;  3NGY A;  3S3M A;  1BCO A;  1FXX A;  3LP1 A;  1CZ9 A;  3HL8 A;  3SI6 A;  1C1A A;  3AVK A;  1BHL A;  4Z4H A;  4CHN A;  5J2N A;  1JXB A;  3V6D A;  3C95 A;  3LAL A;  3AVF A;  4CJ4 A;  4DTJ A;  1KFS A;  5C24 A;  4FJM A;  4GW6 A;  2OPQ A;  1S9G A;  3ZSW A;  3KKS A;  2HNZ A;  3KLG A;  3MAQ A;  1VRT A;  4DTN A;  3RWU A;  3HST B;  3VQD A;  2E4L A;  2E6L A;  3TR8 A;  1IH7 A;  1D8Y A;  1LWE A;  1A5W A;  2IDO A;  3WNE A;  5C25 A;  4E0D A;  3AO1 A;  5FRM A;  1Z26 A;  4AHU A;  4G1Q A;  1ZBL A;  4J2A A;  1TAU A;  3V9W A;  4DS4 A;  1L3S A;  3KLH A;  4DSK A;  1WLJ A;  3HP6 A;  3VQ4 A;  2ATQ A;  3VQ6 A;  3F73 A;  1C0T A;  4O0I A;  2PZS A;  2HND A;  2GUI A;  4BDZ A;  2XY5 A;  4CJU A;  3HO1 A;  4JRP A;  3K5M A;  4J2E A;  1JLF A;  3U3G A;  1DLO A;  2VG7 A;  3VQ5 A;  4CEE A;  2R7Y A;  2QKK A;  3WNG A;  4B9M A;  4CFC A;  3RR8 A;  4OLA A;  4OVL A;  4CJF A;  1NK7 A;  2PYJ A;  4B9U A;  3HK2 A;  1QE1 A;  1FKP A;  3NGZ A;  4MQ3 A;  4OKE A;  2KQ2 A;  3IG1 A;  3KIO A;  4GVM A;  1QQC A;  3LAN A;  1SL1 A;  2HHX A;  3C94 A;  1VSK A;  3JSM A;  4IKF A;  4KAZ A;  1G15 A;  3KD5 E;  1S1X A;  3P5J A;  4DQS A;  3RR7 A;  1EXQ A;  1VSE A;  1KFD A;  3I0S A;  4LY7 A;  1JL2 A;  4E19 A;  1C6V A;  5HRO A;  4KB1 A;  3FFI A;  4KFB A;  1I3A A;  3VQQ A;  4IFY A;  3VQ7 A;  3ZSZ A;  4H4O A;  3NH2 A;  3EYZ A;  4FM1 A;  4I9Q A;  3OYM A;  1ZBI A;  2ETJ A;  2X6S A;  3TAM A;  3CFR A;  2YKN A;  4E7I A;  3NCI A;  4RG8 A;  4KHS A;  3DRR A;  3MEG A;  1TAQ A;  3CFP A;  1B9F A;  3OYH A;  3OJS A;  4EP4 A;  4N76 A;  2RPI A;  4CF2 A;  3PO5 A;  1NK9 A;  4K8Z A;  4CES A;  3DMJ A;  2Z1I A;  1J5O A;  2OZS A;  4QCL A;  4O4G A;  1RT7 A;  4HUF A;  4B8C A;  2BDP A;  2GBZ A;  4KTZ A;  3OYB A;  3KK1 A;  4FLY A;  4OLB A;  3VQE A;  3DLE A;  1CZB A;  1NK0 A;  3CM6 A;  4LH5 A;  4CGD A;  4E7K A;  1IO2 A;  4PWD A;  1LWC A;  2I5J A;  1NJY A;  4YFU A;  4F2R A;  4E1M A;  3NF7 A;  5KRS A;  4FW2 A;  2F8T A;  3O4Q A;  3DI6 A;  3ZSR A;  1NK6 A;  2Q3S A;  4FJI A;  4FLV A;  4M42 A;  2HHW A;  1XI1 A;  3TAP A;  4KHY A;  4OPJ A;  3AVL A;  3K58 A;  4CFB A;  5T7B A;  3VN5 A;  4DTU A;  2YKM A;  1NJW A;  4Y1C A;  1ASV A;  4PA1 A;  3E01 A;  1JLC A;  1S1V A;  1YTA A;  3RMB A;  1LW0 A;  4DG1 A;  3P1G A;  1NK4 A;  3AO2 A;  1VSM A;  1A5V A;  4EZ9 A;  3ITH A;  1SL0 A;  3K5N A;  3H08 A;  3T3F A;  3QER A;  4M3Z A;  4QAG A;  4FJ5 A;  1SL2 A;  3LPU A;  4OKJ A;  1WSI A;  3O3G A;  3OYA A;  4O5B A;  4NYF A;  2D5R A;  4M3W A;  4FJ7 A;  3AO5 A;  5C42 A;  1VSH A;  4KRF A;  3QNN A;  4I2Q A;  1TGO A;  3DOK A;  1NOY A;  4DQR A;  3AVH A;  5JS2 A;  1REV A;  1WAF A;  1C1B A;  5J2Q A;  3LWL A;  4FJH A;  4F3O A;  4FJN A;  3I0R A;  3K57 A;  3MXM A;  4DMN A;  1CLQ A;  1MU2 A;  2HHV A;  2FC0 A;  4DQQ A;  4FW1 A;  3O3H A;  3PV8 A;  3LAM A;  3VA0 A;  3UIQ A;  4KHN A;  4B9S A;  2BE2 A;  3AO3 A;  4CEB A;  4NCB A;  4KI4 A;  1UAX A;  3QO9 A;  4CEA A;  3OYN A;  1ITG A;  4CK2 A;  2HHU A;  2Y1J A;  1RTH A;  3CFO A;  4H4M A;  4DFK A;  1T05 A;  1Q8I A;  1JLE A;  3DLH A;  3HVT A;  4DTX A;  1RDC A;  2P51 A;  3SNN A;  1T7P A;  2KFN A;  3NDK A;  3ASM A;  3ZT2 A;  1QSY A;  4CCH A;  3OYL A;  2YHA A;  4I2P A;  3QES A;  3TAF A;  1TL3 A;  3T19 A;  4FJX A;  4FJ9 A;  4KHQ A;  1HYS A;  3D45 A;  1VSI A;  3C6U A;  2FBV A;  4FJJ A;  2DFF A;  1RTD A;  4PQU A;  3NGI A;  4CHO A;  1Q9X A;  3K5L A;  4F3T A;  1RBU A;  4DTR A;  4CEQ A;  3ALY A;  4IBN A;  3OYF A;  5E41 A;  1ASW A;  3KJV A;  1HQE A;  3OS2 A;  2YV0 X;  2D0B A;  4KB0 A;  2WON A;  2OPR A;  1X9W A;  1WAJ A;  3TAB A;  3LP3 A;  3PO4 A;  5HRR A;  3OY9 A;  1T8E A;  2KZZ A;  2XY8 A;  3HVR A;  5DMR A;  1ASU A;  2P5O A;  4FJ8 A;  2KTQ A;  3RMC A;  5CZ2 A;  3LDS A;  2X6N A;  3QEV A;  3M8S A;  3ULD A;  4DTS A;  1J54 A;  4LSL A;  2JGU A;  3HM9 A;  3C6T A;  2VG6 A;  2ZQB A;  3OYG A;  5FRO A;  3KK3 A;  4CJL A;  2D0A A;  2B6A A;  4TSX A;  1CXU A;  2IAJ A;  3G0Z A;  4CF8 A;  5SWM A;  3PX4 A;  1VRU A;  2LSN A;  4AIL C;  3KK2 A;  4J2D A;  2G8W A;  4HCB A;  4CGF A;  3M8Q A;  1YT3 A;  3AVN A;  4FJG A;  3AA2 A;  4LD0 A;  1TK5 A;  4EZ6 A;  4DU4 A;  1JLA A;  3TAR A;  4ELV A;  3IAY A;  3TAN A;  1UA1 A;  3TAE A;  3SCX A;  5KGW A;  5HRN A;  4BWJ A;  1CXQ A;  4CGJ A;  2OZM A;  4CJW A;  4ELT A;  3QEI A;  1RT6 A;  1RT2 A;  2YNG A;  3ZSO A;  1XHZ A;  4HCC A;  2AJQ A;  4M3Y A;  4FLT A;  3AVG A;  3D0P A;  1KVA A;  1LV5 A;  4CEF A;  3DLB A;  1NKB A;  3V1O A;  3OS0 A;  3BDP A;  4N56 A;  2HMI A;  3NF8 A;  3V9U A;  3PX6 A;  1KVC A;  3VQA A;  3CM5 A;  1XHX A;  3DLK A;  4E1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...