3MEGA

Hiv-1 k103n reverse transcriptase in complex with tmc278
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords p66 Reverse transcriptase
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Etravirine (TMC125) and Rilpivirine (TMC278): Implications for Drug Design.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 148
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3megA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3megA05
3ZSXA 4B9NA 5FRMA 4IFYB 4ECRA 1REVB 3CJ3A 1WNEA 1WSIA 2UVWA 3TANA 3VN5A 1I39A 2ZD1A 3ZT2A 4DU1A 3MXIA 1TKZB 4RW9A 4PWDA 2IGIA 4R0EA 3TAGA 4DSJA 5F8HA 1HQEA 3OLBA 4ECYA 4FW1A 4FM0A 3OYFA 1GOCA 4DEZA 4TYBA 4J9LA 1VRTA 4PQUB 3KHLA 1HJRA 2WHOA 3OY9A 1B9FA 2W42A 3Q8SB 1IKVA 3HHKA 1GOAA 2W9BA 4EZ9A 1S9GA 4M3ZA 4OJRA 1FK9B 5L1IA 4MK8A 3MXMA 2HNDA 2XY5A 3KD5E 2XY8A 4FJ9A 4KAIA 4CEAA 5KG4A 3PW5A 3O4NA 3OYAA 4ZP7A 4TYAA 3NGIA 2ATQA 3C94A 4CF0A 3NHGA 4JRQA 4B9SA 3IS9A 2WB4A 4IDKB 3P5JA 2G8WA 3DOKB 3I5CA 3LP2B 1N56A 1KVBA 4F2SA 4FBUA 1J5OA 2QKKA 1J9AA 1L3UA 3ZSVA 3OHAA 3DDKA 4IRKA 3SUPA 2VG7B 4XPCA 1C1CA 2IS3A 2DFEA 3TAFA 4OGCA 4WFZA 3KJVA 3OYJA 4CGHA 3ULDA 4F4XA 1RTHA 3PO4A 4Y2AA 3OYHA 2D0AA 3K57A 3TI0A 1RBTA 1U04A 2HNYA 5KFCA 3BSAA 2ASLA 2IOCA 4JV1A 3MF5A 3N6MA 3OYIA 4ELUA 4CJRA 1ZBHA 1QUVA 1J53A 4M3WA 4MKBA 1JLEA 1S9EA 4Q45A 3SJJA 1RAJA 1JXEA 4JS5A 4IOBA 3MEEB 3DRRB 4KI4A 4LSLB 1A5XA 4FJNA 1RT3A 1LWFB 2EX3A 2QK9A 3N6NA 4RNHA 4DQRA 4FBTA 1JXBA 3D0PA 4URQU 1S1WB 4M41A 3C95A 4GC7A 1QTMA 5C24A 2ILZA 3HK2A 1HNVB 1VSKA 3DMJB 3AA3A 2KZZA 5DQHA 1ZBUA 1XR6A 1CXQA 2R2RA 2JC0A 4QAGA 3MEDA 4NLUA 1JKHB 5CZ2A 1KSPA 5J2NA 1YTAA 3KHHA 5KT5A 1Y97A 5KFRA 3OYLA 1RT6B 2R2SA 4KV8A 4QWCA 3UR0A 2B43A 4NLWA 4B3OB 4WFYA 2YKMA 4NLSA 2Z1GA 2GIRA 4J9NA 1TV6A 2HVIA 1B9DA 2G8UA 4IG0B 1VSIA 3KTQA 3TAMB 5KT7A 4KHSA 1LWCA 2UVRA 1SH3A 3V1OA 2BANB 2X6NA 1BQMB 4FM1A 3QO9A 3JYTA 1S1VB 4G3IA 4M3TA 2EC0A 1NNDA 3SQ0A 1TK8A 3C6TB 2OPPB 3L2WA 3VQQA 1TL3A 1Q9YA 2D3UA 1D1UA 4QW9A 4DL3A 1WNSA 5KTQA 1KHVA 2HNZB 4EZ6A 5CY4A 3D28A 5KFOA 4ECXA 1TKXA 2RF2B 4UQGA 3QIPA 2WONA 2R2TA 2OA8A 3PW2A 5KT3A 4TQSA 3ITHB 4CJSA 4LSNB 4I2PB 4MQ3A 3NGDA 5EU7A 2C2RA 4KKOA 3ZSRA 2ZE2A 2BE2A 5HBMB 1JIHA 4O3RA 2VA3A 2VWJA 3P83D 2JLEA 1S1UB 2Y1JA 4TLRA 1MU2A 3DRPA 3MXJA 4FLYA 1RYSA 4FJLA 3BQ2A 4J9RA 4DSFA 4B9TA 3DYAB 3I5BA 2Y1IA 3HPOA 3C6UB 4Z0UA 3TAEA 1GX5A 1T94A 2HWIA 1S1XB 4DU4A 1KLMA 1KHWA 4HUGA 3TQ1A 1C0UB 5KG7A 2BQ3A 2V4RA 3Q8QB 1F21A 3EPIA 4RUCA 4RNOA 3V81B 4JLHA 4N47A 1S0MA 4Z4HA 3RR8A 3BGRB 4Q43A 1JXLA 3CDEA 4GVMA 3QEWA 1L5UA 1EXQA 4NCGA 1KTQA 4NZ0A 4DS5A 1RT7A 3M8PA 4DL6A 2JEFA 3AV9A 4EEYA 2X6SA 4Z4FA 2FLPA 4J9MA 3NAHA 2ALZA 1Z25A 3RBEA 2DY4A 4AHTA 5JUMA 3E01B 3RBDA 3I0SB 2WRMA 1R0AB 3EZUA 2HWHA 4OVLA 2HHQA 3QEPA 3OSNA 3DLHA 4IFYA 2V9WA 3F9KA 1REVA 4K4ZA 4J2BA 3AA4A 4DFMA 4LY7A 2AU0A 1CXUA 2VWKA 1B92A 3G0ZA 4I9QA 4URSA 2FVCA 5KT4A 1ZYQA 4RNFA 3LP0B 1SH2A 4ICLB 4EYHB 2FBTA 3H59A 1DTTB 1U49A 4Z4EA 3KK2B 2GIQA 4NYFA 4PQUA 2NUBA 4EBEA 4NLRA 3SPZA 4KREA 5KFLA 4CJEA 2G8HA 4B9MA 3MFHA 5KFNA 4ZPBA 1GX6A 5KFEA 2DFHA 4DTPA 5J2PB 4KHUA 3NE6A 4NYNA 4ZP8A 3NFAA 1RNHA 4OPKA 3FQKA 3PUFA 5KG2A 4RZRA 4DSIA 4QCLA 1RBSA 3PV8A 4JV2A 2YNHB 4Q0BB 3M9NB 1WSFA 3MR6A 3TAPA 2ILYA 3VQPA 5HRSA 2R8IA 4WXWA 2IM0A 4HYKA 4IDKA 1TVRB 3FSIA 5J2QB 3DOKA 4CFCA 3LP2A 5KFTA 4M45A 1RDRA 4NCBA 3KHGA 5KRTA 2YKNA 1C0TB 2UVVA 4J9OA 2BRKA 3RAXA 4FK4A 1EP4B 4ZMMA 2VG7A 3KLGB 2E9RX 3VQ5A 3PX0A 3DLKB 3NF9A 4FW2A 1OS5A 3ZSQA 1RT1B 2IM1A 4TXSA 2CJQA 4FZYA 3T5JA 2VG6B 3TVKA 4KHQA 1TAQA 4KI6A 5KFZA 3VQ6A 1HARA 5KG6A 4Q44A 3L8BA 1RDCA 4CIEA 3TR8A 4B9UA 4QOZB 1TQLA 1C1AA 4BACA 2F8EX 3NMAA 1S49A 4W5QA 1UWBB 3MEEA 3DRRA 1JL2A 2XWYA 1VSJA 2I1RA 5T7BA 4J9QA 1LWFA 4CJFA 4QWAA 1RCHA 2KTQA 1C2PA 1U09A 2VG5B 3TWHA 2XGPA 4NLTA 4EYIB 4BDYA 3V4IB 1L3TA 1JLGB 2JEGA 3QZ8A 4Z4GA 1S48A 4E3SA 1JKHA 1RA7A 3NBPA 3KNAA 1RT6A 4Y1CA 4CERA 2B6AA 3BQ0A 3ISNC 3HL8A 1CLQA 2IAJB 1RDDA 4B3OA 1T3NA 3H5YA 4IKFA 5J2MA 3CJ0A 3ZSZA 2RN2A 3WNHA 1LAVA 4ZP6A 3BR9A 4IG0A 3CFOA 3TAMA 3ZT3A 4OKEA 1BCMA 3PW0A 3OS2A 3HKWA 4CEBA 1LV5A 4ECUA 4AHUA 1LW2B 1RTDA 4ZTFA 1TAUA 2BANA 1XR7A 4ECVA 1BQMA 4FLVA 4O44B 1Z4UA 2WK4A 3FQLA 3C6TA 2OPPA 4CK2A 5KFMA 4ECZA 5L1JA 1TKTB 3N6LA 2HNZA 4E1MA 5I42B 4NRUA 4NYZA 3KLHB 4CJLA 4FK0A 2RDJA 4ZVHA 4KHRA 4XPEA 1T05B 1K1SA 4EO6A 3RB3A 2QKBA 3MEGB 1CSJA 2PZSA 3SQ1A 2ATLA 4BE0A 3OL8A 4WE1B 5HLFA 3H5SA 4O0IA 4FM2A 4LSNA 2JEIA 5KFXA 4ID5B 3IG1B 1T8EA 1ASWA 1RBUA 2ITGA 5KFIA 4FVMA 3H4BA 5HBMA 3PHEA 1SUQA 3RMCA 3KK3B 3IGVA 2WTFA 3SQ2A 2IJFA 1S1UA 3HT3A 3M8QB 1ASVA 4C8MA 4KFBB 2ASJA 1DTQB 3AVJA 4E7IA 1FXXA 4BE2A 3G10A 4IG3B 3DYAA 2IM2A 5KG5A 1VSFA 3C6UA 4Y1DA 4F3TA 4U6PA 4F8RA 4CF2A 4GW6A 2B5JA 1S1XA 2X74A 4RW8A 3KLEB 3SV3A 5C42A 3QIDA 2IBKA 4KO0B 3OL6A 3CVKA 1C0UA 2E6MA 1S6PB 4CK1A 2QE5A 5L9XA 1S10A 3QINA 1NJZA 3M9MB 5HP1B 3CYMA 3Q8PB 3CFPA 4EBDA 3BGRA 4CHQA 3I0RA 2W9AA 4ZHRB 1VSDA 4I2QB 3HXMA 4J2DA 4OLBA 1RILA 4H4MA 5DG9A 4DS4A 4AHRA 3ZT0A 4CGJA 4CJPA 1NK6A 1IO2A 3AO1A 3QEXA 3FDSA 3GIMA 2HMIA 4PY5A 1SV5B 3VQAA 4WZMA 1ZBFA 1QSSA 1LWEB 4G1QB 1JLFB 3E01A 3NF7A 4DLGA 5SWMA 1D8YA 3RMDA 1IKXB 3I0SA 1R0AA 3KOAA 3UDLA 3PJWA 3PX4A 4ZVGA 2YNFB 3DOLA 2O4IA 3TABA 1BGXT 1TP7A 3AO2A 2A1RA 3BSNA 2FVPA 3SUQA 3B6PA 4DL2A 1U45A 1W0HA 2AGPA 3PX6A 1NK9A 3LP0A 4ICLA 4FJ7A 5CYMB 3SQ4A 1DTTA 3LALA 3KK2A 1FKOA 2PY5A 3MR2A 3T5KA 3CG7A 4YMEA 2RKIB 4YFUA 4IH6A 3DRSA 5J2PA 4F50A 2C28A 4FJJA 1Z26A 3L3VA 4CGDA 1RYRA 4IBNA 1NKBA 1RTIB 4KHMA 1C6VA 1TK5A 2GUIA 4DG1B 4C8NA 3NDKA 2IC3B 2X78A 2YNIB 1YVUA 3GIKA 3B6OA 4NLXA 5KG1A 4CEQA 2YNHA 2HHTA 4WXOA 3KIOA 1NK0A 3NGYA 3Q8RB 2P5GA 1Q8IA 2OYQA 3LWMA 3M8RA 3SFUA 3NKYA 1TVRA 5J2QA 3O3FA 4IH5A 2P1JA 4DTRA 3G86A 3SI8A 3AVCA 3HPGA 1NJWA 1C0TA 1KLNA 5KG0A 4FJKA 1EP4A 2IMWP 3KLGA 5KFJA 3VQEA 4DQPA 2JEJA 4HKQA 5HRNA 3DLKA 4JUZA 3LDSA 4N76A 3AVNA 1RT1A 2J6UA 1XWLA 4RNMA 1LW0B 4PUOA 1IG9A 3RB4A 2OPQB 2F8SA 4NLOA 4Z4CA 1FKPB 1N48A 3V1QA 1SKSA 4K50A 3QGIA 1QSLA 4E7KA 3LPUA 3L2UA 3OLAA 4KTWA 4J2EA 1RDAA 3CJ4A 3QIOA 2YHAA 1ZETA 3WNFA 3PJXA 4DWIA 1KRPA 3NAEA 3RTVA 3OHBA 4IH7A 4MFBB 3OYNA 1NK5A 5I3UB 2AGQA 4K4YA 1S9FA 2YNGB 4W5OA 3KMQA 3H98A 4KHNA 3KKSA 3K5NA 4MIAA 4IR9A 2VG5A 2RDIA 4HCBA 4RW6A 4ECWA 4DL7A 4DFKA 1RTJB 3U6FA 4C8KA 4DSKA 3V4IA 2HHWA 3FFIB 3T19A 4L8RB 2GBZA 4PWDB 2C2EA 1MMLA 5D3GB 2XCPA 4DLEA 4BDZA 4MK7A 2XC9A 4CFDA 4EO8A 3V9ZA 4MIBA 4RW4B 1RT4B 4DTOA 4CEFA 5EDWA 4CJ4A 3A2FA 2I5JB 2IAJA 4JS4A 2G8IA 4K8ZA 4NLVA 1LAWA 4ED6A 4Q8FA 1JLAB 2W9BB 5KFFA 4DTNA 3VQ4A 5KFWA 4NLGA 3QEVA 1QSYA 4ECTA 1JLBB 3VQBA 2HW3A 4CJQA 5C25B 2R8GA 3SYZA 3ZT1A 4ZPCA 3D5MA 2Z1HA 4O44A 4QWDA 4O3SA 4KE5A 1RT5B 1TL1B 1VRUB 4B8AB 4JV0A 2W9CB 4AHCA 1JLQB 2AQ4A 2BRLA 4CCHA 1TKTA 2E6LA 4XO0A 4CJ5A 4F2RA 5I42A 3ZT4A 3KLHA 3AVFA 3HVWA 2ASDA 4NRTA 3G6VA 3AA2A 1GOBA 3NH2A 4O3NA 4FLXA 1S1TB 1BISA 3VQ9A 1WLJA 2OPSB 4WE1A 1C1CB 1HMVB 2D5RA 4CK3A 1TKZA 3HP6A 4ZPDA 4W5TA 3UIQA 3K2PA 1RTHB 2O4GA 2D0BA 4E19A 1U48A 3EPGA 3IG1A 1KCFA 5FDLB 3VQCA 1ASUA 4ZP9A 2JC1A 3KK3A 4DTUA 4RG8A 4EP5A 4CJVA 4KFBA 4WYLA 1DTQA 1FK9A 4OLAA 2AWZA 3V9XA 3S3MA 3L2RA 3LPTA 4CEZA 3ZSWA 4H4OB 3KLEA 3DLRA 4KO0A 5K14B 3RRGA 3PO5A 1HNIB 1QQCA 3H2LA 1S6PA 2C22A 3LP3A 4DQSA 4J9SA 4RUAA 3ZCMA 4DSLA 5HP1A 3QYYA 4M42A 1WSGA 4CGGA 1T7PA 1IM4A 2XHBA 3MEDB 3NCIA 4ZHRA 4I2QA 5J2NB 5J1EB 2BDPA 3F73A 1VSMA 4DU3A 3DLEB 3RWUA 3HVRA 1NJYA 5JS2A 3T1AA 4O4GB 4KV8B 4TY9A 5DLGA 1J54A 5HROB 3VQSA 4KBIA 2YKMB 4O55A 1QAJA 2JGUA 4KB0A 1LWEA 4AHVA 5EUHA 1TV6B 1JLFA 1IKXA 1C0MA 2FLNA 4F3OA 4KTQA 2YNFA 1W25A 4TSXA 1EETB 4WZQA 5F8NA 3JYTB 3QESA 4O3QA 3NH0A 3OYMA 1U4BA 1TL3B 4Y3CA 5CYMA 4RW7B 2HHUA 3LWLA 4LSLA 3MFIA 3T5LA 3T5HA 4F4WA 2RKIA 3NGZA 3L3UA 4F4ZA 3AVIA 2KQ2A 3LP1B 2R2UA 1S1WA 1T03B 3K5MA 1IKWB 4KHWA 4F4YA 2WCXA 2F8TA 4J9PA 1HNVA 3DMJA 1QE1B 1RTIA 2FBXA 5T14A 2E9TA 1VSEA 4E89A 2IC3A 3HO1A 4NCAA 2IA6A 1TK0A 4FYDA 3GIJA 5KGWA 3SCXA 4KB1A 3EY1A 4CECA 4Y2CA 1UAXA 3OYDA 3OYBA 4AHSA 1G15A 3UPFA 3GYNA 2DTUA 2AGOA 2HB5A 3S3OA 3GV5B 5E41A 3BREA 1IH7A 1W9HA 4HTUA 3S9HA 3VA0A 2Z1JA 1KVAA 3BQ1A 2V0NA 4DQIA 4IRCA 1RBVA 5DGAA 4CJ3A 3AVMA 2E4LA 4FJMA 3PW4A 3NH1A 4CF8A 3MECB 4YNQA 4NLQA 4QPXA 1S1VA 3OVNA 4CHYA 2ZKUA 3KMSA 3V6KA 1QAIA 1FKPA 2KFZA 3K5LA 3KLFB 3V6JA 3HPHA 3HP9A 4Q8EA 3BDPA 4R8UB 4CHPA 5DGBA 2PYJA 2RF2A 1RT7B 3K5OA 4QWEA 1I3AA 5F8GA 3P1GA 2YHBA 1NKEA 3D45A 3V9SA 3NAIA 3ITHA 1L3VA 4FXDA 4DTSA 1BI4B 4C8LA 3V9WA 4I2PA 5I3UA 4ELVA 4C8OA 2YNGA 4B9LA 2HHSA 2XI3A 4KAZA 1XC9A 1ZTTA 5KFPA 1RTJA 3PY8A 3RB6A 1QHTA 3FFIA 4MK9A 4TY8B 3U3YA 2GC8A 3HVAA 3QLHB 2J6TA 4OGEA 5D3GA 1RDBA 3EYZA 4WYWA 1NOZA 1IKYB 1S4FA 3KLIB 5KFYA 3KKRA 1NOYA 2D41A 4RW4A 1RT4A 3S3NA 3V6DB 3L2VA 4ZVFA 4K4UA 1JX4A 2I5JA 3U3GA 3OYCA 4LD0A 5DQGA 4F4KA 4AILC 5HRRA 4W5RA 1RA6A 1JLAA 3AO5A 3DI6B 1XR5A 1NHVA 1KFDA 1NK7A 2ZQBA 3V81A 4KPYA 4M95A 3NF6A 1JLBA 3K58A 4E1NA 4FJ8A 3QEIA 3AVLA 5C25A 3HYFA 1JLCB 4ZTJA 2FC0A 4KHYA 2AX1A 3CO9A 2HHVA 4R5PB 3GIIA 4CJKA 4E0DA 1BIUA 5JS1A 1RT5A 3AVGA 2V4QA 5DMRA 1TL1A 1VRUA 2W9CA 2LSNA 3T3FA 1JLQA 3G6YA 3DM2B 4CEOA 4CFAA 4ED3A 2D3ZA 4HHTA 1YT3A 1N6QB 1BQNB 3OYGA 4O5BA 3RMBA 2YKNB 1WAFA 3HVTB 4TQRA 3AVHA 1S5JA 1WSHA 2XO7A 5DQIA 4ED1A 1N5YB 4WFXA 1S1TA 3CDUA 2FJWA 1D0EA 2OPSA 4CF9A 1S0NA 1HMVA 1I6JA 1TGOA 1C1BB 1ZTWA 4TN2A 1ZBIA 3H4DA 4B8CA 1WSEA 5FDLA 5DG7A 4NLDA 2IJNA 4DFPA 2QXFA 3OS1A 2XGQA 4CGFA 4GC6A 4FLUA 3CIZA 3LZJA 1S6QB 4MH8A 3ASMA 3O3GA 2A1SA 3LANA 3EZ5A 4E7LA 3JSMB 1RT2B 3ICLA 2P51A 4Y34A 2O5DA 3ALYA 4BWJA 4FJIA 4YR2A 2Q3SA 3V1RA 2XY7A 1HYZA 1A5WA 4H4OA 3HSTB 1D9FA 3VQ7A 3CWJA 4DL4A 5K14A 1HNIA 5KT6A 4LH4A 4DTXA 5F9NA 4M3YA 4Q0BA 3PR5B 1HYSB 5FROA 4OKKA 4N56A 3MR3A 2G8VA 3TAQA 2OPRB 2HAIA 4M3UA 5DK5A 3G6XA 4CJUA 5HRPA 2UVUA 3NBPB 3V9UA 3CM5A 5J1EA 3CJ2A 2R8HA 1N4LA 2FVRA 3DLEA 1VSHA 4IRDA 4CIGA 4DMNA 4O4GA 1D5AA 2F96A 2WOMB 4DTJA 3DLGB 2B6AB 4K4XA 3KK1B 1HPZB 5EWGA 5HROA 5F8IA 4ED8A 2IDOA 5CYQB 5J2MB 2AJQA 4CGIA 3AVBA 5KFGA 3PZPA 3L2QA 1HQUB 1ITGA 4LQ3A 1BIZA 4AH9A 2VG6A 4I7FB 2J6SA 4K8XA 1SKRA 2DPIA 4K4VA 1KFSA 4FJGA 1DLOB 1XI1A 3H5UA 3KLVA 3VA3A 4YR3A 1RTDB 4CE9A 3IRXB 1SL0A 1EETA 3NL0A 1UOCA 4DFJA 5F8LA 4LQ9A 3OL7A 4J9KA 3RAQA 3ZSOA 4IFVB 1K6YA 1UWBA 4XIUA 4RW7A 4N5SA 3VQDA 3SPYA 3QGGA 4ED2A 3O4QA 4NLYA 3HJFA 2R8KA 4K4WA 2FJVA 1X9MA 3THVA 3LP1A 1T03A 5SZTA 1UA1A 1IKWA 4Z4IA 4DTMA 2BGGA 1JLGA 4ECSA 1QE1A 5HLFB 3V6HA 2ZD1B 1ZBLA 4FJXA 1HYVA 3LAKA 5DG8A 5KGXA 4RW9B 5JXSA 3IGNA 2XCAA 1KVCA 4KRFA 1HQEB 4YR0A 1K1QA 1NK8A 1UA0A 1NJXA 2XRIA 1SUQB 1VRTB 3SZ2A 4FZXC 1IKVB 3CJ5A 1S9GB 2W7OA 4KB7A 2RPIA 4DSEA 3QETA 4GMJB 4Q5VA 4W5NA 3AA5X 2HNDB 3ISND 4CEDA 2DPJA 4FS2A 4OPJA 4ID1A 4HCCA 3CFRA 4H54A 3O3HA 3OYEA 3WNGA 3QERA 2B5JB 1EX4A 1LW2A 2FLLA 4RW8B 5C42B 4E7JA 4DF8A 3IAYA 3MTKA 3MECA 2W8KA 1QS4A 4BDPA 3K59A 2KW4A 1X9SA 4URGA 4RNNA 3ZSYA 2W8LA 1O1WA 3KLFA 3I0RB 3OJUA 2FVQA 3IS9B 3SUNA 3PR4A 4R8UA 5F8MA 4H4MB 2OH2A 1WSJA 1BL3A 3QNOA 1J5OB 4FZZA 2W7PA 4CHZA 1T05A 1S0OA 2HHXA 3MEGA 2HMIB 3FRZA 4M3XA 3BSOA 5KRSA 1BI4A 4CJWA 4CFBA 3MR5A 1X1PA 3KJVB 2HVHA 4ID5A 3SI6A 2FBVA 2R8JA 4HUFA 3M8SA 3QNNA 2G8FA 1BHLA 3SV4A 5KFBA 3QGHA 1JL1A 4FCYA 4M3RA 3DOLB 2HNYB 4TY8A 4YQWA 4FS1A 3M8QA 1WN7A 3QLHA 4DF4A 1JLEB 5KFQA 1S9EB 4IQXA 1EKEA 1IKYA 3KLIA 4IG3A 5F9LA 4OKJA 4EBCA 4KTZA 3WNEA 4O4RA 4J2AA 2BR0A 3V6DA 3OJSA 4E7HA 1FKOB 1CZ9A 4LH5A 4O3PA 1RT3B 5KFUA 4YP3A 2CKWA 3OL9A 3IN5A 3HM9A 1TKDA 3I5AA 1BCOA 3DI6A 3BSCA 3DRSB 4PA1A 5C24B 4ELTA 4MKAA 2OZSA 3I8DA 3RB0A 2B4JA 2FVSA 3H40A 3GQCA 2DFFA 3PVXA 1VK0A 1JLCA 3SFGA 3BJYA 4ECQA 5EWFA 4EP4A 5KFHA 4R5PA 2Z1IA 3GV7B 4DL5A 4KSEB 2FBYA 2D0CA 3AO3A 4X2BA 3KHRA 5KFAA 1SV5A 3CM6A 1NK4A 2XY6A 3OYKA 3DM2A 2EHGA 1X9WA 1YTUA 4G1QA 3CQ8A 4CJTA 2KZMA 3AO4A 1N6QA 1BQNA 3RR7A 3UQSA 3HVTA 4B08A 1RBRA 1LWCB 3MAQA 5KFSA 1N5YA 4CHNA 4FLWA 1VSLA 3SUOA 1WAJA 2AX0A 1C1BA 3QO9B 4PUOB 4K4TA 2BQUA 2P5OA 3OSPA 2KFNA 1U47A 4IR1A 2UUTA 4ZPAA 3RRHA 3H5XA 4O3OA 2IM3A 5KG3A 1NHUA 3GILA 4CEEA 4QW8A 1NKCA 1S6QA 1CZBA 3LZIA 1TKXB 3QIPB 2WONB 3LAMA 3JSMA 1RT2A 3KD1E 3VQ8A 4FK2A 4CHOA 1A5VA 4ED0A 4DG1A 3OS0A 2YNIA 4KKOB 2ZE2B 2D7SA 3SNNA 5KT2A 3CDWA 2BE2B 3M9OB 1XHXA 4FJ5A 4HUEA 4RW6B 4CIFA 1HYSA 4IKAA 4CESA 2C2DA 4FJHA 2PYLA 5L1KA 4CF1A 3QZ7A 3TARA 2OPRA 1MU2B 4FLZA 4DQQA 3DRPB 4BE1A 2XI2A 4HVJA 2OZMA 4B9VA 2E9ZA 2WOMA 3DLBA 3DLGA 3KK1A 1HPZA 1KLMB 2FJXA 2G8KA 1HRHA 4QWBA 5CYQA 1SL2A 3E51A 5KFKA 4RU9A 1HQUA 5EWEA 4OL8A 3AVAA 4NLPA 5C5JA 1LW0A 2UUWA 4ED7A 2OPQA 4H8KA 4I7FA 2VA2A 5L1LA 1S97A 4N41A 4I9LA 1SL1A 5DLFA 1L3SA 2BQRA 3RMAA 1DLOA 4U7CA 5CZ1A 5KFDA 4O0JA 1Q9XA 2ETJA 2YV0X 3IRXA 4ZVEA 1D9DA 4BWMA 3AVKA 4NCGB 5KFVA 2R7YA 5FRNA 2GV9A 3GV8B 5F8JA 3PW7A 4K4SA 3M8PB 4FLTA 3NF8A 1XHZA 4IFVA 1SH0A 5KI6A 1YVFA 1SKWA 4MFBA 4M94A 3H08A 4JRPA 2QV6A
chains in the Genus database with same CATH superfamily
1SJ4P 3CJ9A 3I82A 4LF1A 4ECRA 3CJ3A 3QRRA 3TANA 2QO3A 1N5VA 3MMAB 3MXIA 2GZOA 1TKZB 2I7NA 3R6LB 3OLBA 4FM0A 2UV8A 4XH5A 4JP8A 4J9LA 1F1BB 1VRTA 1HJRA 1QHAA 1T3OA 2WHOA 3OY9A 1HPMA 1YJWN 3NGRA 4F7VA 2ZDPA 2W9BA 4J37A 2CJXB 4DR6F 4WTOB 2DXEA 5IZHA 3VVUA 2P9PA 2Z8QA 2FHJD 4ED4A 2XY5A 3TTFA 3S01A 4DPXA 2DRAA 4FJ9A 2AA4A 1B3TA 3R2CJ 5KG4A 5M1KA 1YJ7A 4XH4A 3HFZB 5H9FK 4BREA 2GVDA 3QFPA 3ENBA 2N3OA 2JVOA 5AJ3J 3OYAA 1P8GA 2C3UA 3CF5L 3PXGa 4TYAA 4EI2A 5BR9A 1FNMA 4CF0A 4U9RA 4QS8A 4JRQA 4B9SA 3IS9A 2CG8A 2WB4A 4IDKB 3P5JA 3VENA 4PYDA 1N56A 3WXIA 1KVBA 1SC4B 4F2SA 4FBUA 2N82B 5D0RA 4NXNK 3DDKA 5AQOA 4DV1J 4AL6A 2NRZA 4FL9A 1WHXA 1C1CA 2DFEA 3MN7A 2W2MP 2D9OA 2E1RA 1D3WA 2ZDOA 4WFZA 4OGCA 4Y2AA 4YORA 2D0AA 2VBWA 1RCOB 3W9IA 2G2OA 2YX1A 4F0MA 2IOCA 2P9NA 3MF5A 1J53A 4H0PA 1S9EA 5B0GA 1MW7A 2A18A 2PA3A 2F9DA 1X5OA 2JSXA 1A5XA 4QIFA 4FJNA 2NS1B 2PAVA 1RT3A 1LWFB 4CO2A 2QK9A 3CSKA 2B9WA 4NO7A 3D0PA 4LFBK 4M41A 3HK2A 3DMJB 2CPZA 4DUYJ 2W2OP 1CXQA 2JC0A 4QAGA 1Z05A 1YQHA 4LFAJ 1Y97A 3OYLA 1RT6B 2B43A 4Y2IA 3RSEB 1UL3A 1Y5LB 1XMQK 1VHXA 4N7TA 3CCUN 4Y2MA 4OX7A 2HVIA 3TAMB 5KT7A 1YIJN 2AJ4A 3C15B 3HKZD 1M1GA 4C3KA 1SH3A 1NSKL 3QT7A 5BYSA 4CBXA 3M1FA 1N5QA 1BQMB 5IV4A 1OMSA 5JVHQ 4G3IA 4M3TA 1NNDA 1A9NB 4A61A 1TL3A 4DR5K 2AP6A 5LXYA 2DEJA 1G1XA 5I4MA 2X1BA 4QW9A 2YWGA 4GY2B 2RF2B 3LQVA 3LO3A 2OA8A 2ZJQQ 4M63A 5KT3A 2DNNA 4YN3B 2WUSA 4MQ3A 3LGHA 4V19X 4IOAQ 5AE2A 1N36F 5G4DA 3MWPA 3P4UB 2GELA 4O3RA 1FW6A 1C4AA 3PIOQ 2ZH9A 2Y1JA 2R7WA 4TLRA 3KDOA 4L76A 3HOSA 2RVJA 3NWRA 3MXJA 2O8DB 5B0BA 3CT9A 5DZ7A 4DSFA 3DYAB 1RLDA 5LXRA 2KDOA 3UVJA 1S0VA 3C65A 1EQMA 3TAEA 2HWIA 4TU7A 4C0BA 3TQ1A 1FD2A 2BQ3A 3IR7B 2V5HG 3Q8QB 3EPIA 4RUCA 1X3NA 1OH5A 1GEHA 4JI8J 1S0MA 5CCMA 1WEZA 4I6YA 1JXLA 2W4DA 3CDEA 2EK6A 1L5UA 4NCGA 2MLZA 4GVEA 2HPUA 2G4BA 2Z2YB 4NX9A 5JMVA 3M8PA 1IQTA 3UDVA 2FUG9 3AV9A 1C4CA 4Z4FA 3D2FB 1FRHA 1RGVA 3P8BB 2ZM6K 2DY4A 2CXEA 3RBDA 1R0AB 2CJBA 3QEPA 3OSNA 2J7UA 2WSEC 4K4ZA 4DX6A 2V8DA 3AA4A 2LDIA 4OZ5A 2WVFA 2AU0A 2VWKA 2VFTA 4DV3K 5KT4A 1CQMA 1DTTB 2Y1LB 1S72S 1XN9A 3VEYA 4PQUA 1SJFA 1UZHA 1U25A 1T02A 3MFHA 5KFNA 4ZPBA 4CNZA 2JFKA 2DFHA 2CJKA 2AJ0A 2K1RB 1Q81T 4NYNA 3NFAA 1RNHA 4OPKA 5A2QU 1YRXA 2QWQA 1E4FT 4DR4K 2L9NA 5KG2A 4DR2J 3BF3A 5J1PA 4KH0B 4QCLA 2EG1A 3PV8A 2YNHB 3M9NB 3DU5A 4L6V3 2O8EA 3R5GA 4DV2F 5GIPA 5J2QB 3LP2A 1PBAA 5KFTA 1RDRA 2FHKA 5IM0A 3C66A 3KHGA 3U7JA 4DR3J 4UY8O 2UVVA 3DU6A 3KLGB 4CZIA 5LOQA 4B3RF 1J5EK 3MM5A 1MN7A 4TXSA 1U26A 1H0HB 2VG6B 2QIFA 4R25A 2RE1A 3IA0A 1VAZA 4KHQA 5A8KA 4JI4F 5KFZA 4LMZA 3L8BA 1ZAXA 4C3LA 4Y0FA 3QB0A 1TQLA 1Z6RA 1C1AA 4KBOA 3CHWA 1QQOA 1S49A 1ZBSA 1T95A 2XWYA 3T6JA 2KO1A 4IJNA 3BKTA 4F0KA 4DBQA 3W3SA 2NXUA 4P52A 1C2PA 1U09A 2VG5B 1WTFA 4PKDB 3AAWB 4BDYA 4JB8B 4U7UK 3RGIA 1L3TA 2XSFA 2CDQA 2OD6A 1RA7A 2HZVA 3NBPA 3MXHP 4F4AA 1U7LA 1K9MT 2KT5A 3CCEN 4CERA 3IDHA 3O2IA 3ISNC 3HL8A 3OQ2A 3H5YA 3QWPA 3ZSZA 4H4KC 3CCWA 2FC8A 4LF8K 4ZP6A 1B0VA 2UUCK 2ROGA 1UVNA 4JYAJ 1EKRA 3CMAN 4RTFD 3OS2A 4ZVTB 4CEBA 4AHUA 1LW2B 4ZTFA 3WBZA 2GMLA 1HUXA 1XR7A 1SJ3P 4ECVA 1YITS 5G0RA 4JEPA 5KOXA 5CCLA 2E1AA 5LMUJ 3U1MA 4OIXA 3CJKA 4R79A 2HLUA 3RJMB 2UXCK 5E3PA 4ECZA 4B1ZA 1R27B 5L1JA 4NRUA 1E6YA 2LA6A 4BR7A 4MKVA 2RDJA 1TL7B 1YAGA 2NXNA 1FTCA 4KHRA 2KJWA 3RB3A 3MEGB 4JKBA 1SC6A 2B9YA 3OL8A 2YQ3A 2P9LB 4O8KA 5HLFA 3NS6A 3LDLA 3TQEA 1V5IB 5KFXA 2X1GA 4ER8A 1T8EA 1IXKA 2LXIA 2V2ZA 4P2XA 1RBUA 3FZHA 2W2QP 2AT1B 5HBMA 2B4VA 3PHEA 3EVMA 2MQNA 3IGVA 3SQ2A 3D3BJ 4WBFA 4IZ9A 3W2WB 2HK2A 2CGKA 4JD2A 3GPAA 2QN6B 4L3QA 3AVJA 1YUWA 4BE2A 1VSFA 4Y1DA 4AQYJ 4U6PA 1M5OC 4CF2A 1S1XA 3SV3A 1VK3A 4H5NA 1K73T 1FFGB 5AQUA 4CK1A 4FN5A 2QE5A 4CZLA 1MROA 1KC8T 3R7SB 2C2MB 2A0FB 1DBDA 4W98A 3M9MB 5HP1B 4CIOA 5GMKa 3Q8PB 1FERA 4ZHRB 1HR0J 4AYBD 1S22A 1RBOB 1UW9A 1XNRK 1IO2A 1HI0P 1WC3A 3AO1A 2HMIA 4NL5A 4BC9A 3WXMB 4DDFA 1JJCB 3V5RA 4PY5A 1N0UA 4JI5F 1M1KO 1R8PA 1JLFB 3E01A 1D8YA 3NF7A 5SWMA 1RE1B 2J0SD 2E1ZA 2I9SA 3THWB 1IBKK 2WZ1A 4I4BA 1S5ZA 1SCJB 2ZJPL 1G3OA 3B6PA 4CM0A 2AGPA 3CXCM 3LP0A 1D8ZA 2PE8A 5CYMB 4OJGA 2DNHA 5GMDA 2RNEA 1FKOA 2QL7B 2XBPA 1NXIA 3EO3A 4ILGB 3U1LA 3CG7A 4ZLNA 2R7XA 5I9EB 2VPWB 3IFRA 1F0XA 3WIVA 4BC7A 1HWKA 2VBXA 5KQDA 3T1HF 2IJRA 5J2PA 4F50A 3HSZA 2ZUGA 1PIEA 1WELA 1N32J 1B99A 1C0FA 1HBOB 1TK5A 1C6VA 4C8NA 3NDKA 4S0MA 3CD6S 4HHJA 1F6TA 2RILA 1URNA 1K0VA 1Q5YA 2I6WA 5KG1A 4FPIA 4WXOA 4HEA9 2WVCA 2HFSA 1NK0A 2P5GA 3P96A 3VGUA 2OYQA 3M2RB 3SCJE 3M8RA 3B4DA 2HIYA 3NKYA 1TVRA 3O3FA 4IH5A 3QICA 3MCOA 4DTRA 1OYEA 1N52B 3HPGA 1C0TA 5KG0A 3FGVA 1EP4A 2NPIA 4LIWA 1RWMB 2HKEA 1Q8KA 5HRNA 4MYTA 3CCVS 4N76A 2CPYA 2OJ3A 1LW0B 4PUOA 2F8SA 2OPQB 4NLOA 4BGAA 3V1QA 4JI6J 4K50A 5HVFA 3O6WA 4DN0A 2J9EA 5U47A 4PG7A 3OLAA 1WHYA 2MLYA 4J7CA 5IC4B 4DV4J 3TW0A 3CJ4A 3H2VE 1FJGJ 3IWLA 2D74B 5A2QY 3A3PB 3N4WA 1QY7A 1EQYA 1CJTA 3CD5A 1HNXJ 1FRLA 1RI7A 4FWLA 1T11A 2VIHA 1QD1A 2C3OA 3IR5B 1OH8A 4LRAA 2RDIA 1RKIA 4RW6A 4DL7A 3HLUA 4C8KA 3V4IA 2O1PA 1RUSA 3T19A 4A5BA 4Y2KA 1MMLA 4DV6K 2AYMA 2IIHA 5EX3A 2MZ1A 4DLEA 1P8ZA 1HD0A 2RB7A 2XC9A 2MKCA 3V9ZA 3W65A 2BW2A 1RHMB 2Z58B 5E7OB 2GFFA 2H54B 2NSBA 1WTBA 3QAUA 4OX9J 3HI0A 1WDDA 3D6TB 4JK8A 2HAFA 4ED6A 4Q8FA 2VUGA 2XMMA 1VYAA 2OO4A 2A1BA 4LF7K 5DRKA 1QSYA 4EHTA 5AQPA 2GMJA 2XB2D 1ATNA 3R5CA 4CH1A 4NXMJ 1KVIA 4BVPA 2R8GA 2P9KB 5IWAJ 2QYCA 4O44A 5H9EJ 3TUJC 1RBAA 4KE5A 1Q8BA 3VEWA 1VRUB 4J9VA 4B8AB 3KVGA 3O08A 4AHCA 2AYGA 2E6LA 3AVFA 3TR5A 4M63C 2YPZA 4NRTA 5LMNF 4RWXA 4RBTA 1F9FA 3NH2A 2Z0GA 1TFWA 1WF0A 4FLXA 4WE1A 4YDUA 1HWIA 2FZKB 1TKZA 2YKAA 3HP6A 4YOWA 2C2OB 4W5TA 4GO7X 4USUA 1RU1A 2A2CA 4JKGB 2U2FA 3QGPA 3ULHA 1ATSA 3UN3A 5CXTA 4ERDA 2VC1A 1WC0A 5BR8J 1DTQA 2DIUA 4OLAA 3S3MA 2N4DA 4C98A 2EPIA 3CCSN 4LF4F 3KLEA 3B78A 1AZSB 3CCJS 4CZCA 1S77D 3PO5A 5KAKA 3BP8A 1Y9OA 3EVWA 1S6PA 3LP3A 1VISA 3GCXP 2BJ3A 3FSXA 1RBLA 1X31C 1WSGA 1FNOA 4CGGA 3QBXA 2QZ8A 2XHBA 3VTIA 3MEDB 3NCIA 5J2NB 4DU3A 1VK8A 3DLEB 4IDHA 1NJYA 4O4GB 2RSQA 3BPSP 5DLGA 2OFHX 1VOMA 3ILIA 1J54A 5HROB 3VQSA 3J8AA 4KBIA 5AZIA 4EIAA 2E2NA 1LWEA 4K0KJ 4AHVA 1TV6B 1Y10A 1IKXA 2VD3A 4IO9L 4PKIA 1ZC6A 3FC9A 1NJIT 1FT8A 4F3OA 4NLCA 1NPPA 4C9DA 5JLFA 4YB5A 3R5DA 4TSXA 1EETB 3JYTB 3NH0A 2R7SA 3OYMA 3EWGA 1U4BA 1XEZA 5GAGU 3LWLA 2W24A 3T5LA 3T5HA 4BRMA 3NGZA 3M30B 1NGEA 3AVIA 1M5PC 3OT9A 5GAGI 3LP1B 1AUDA 3K5MA 5AQGA 2WCXA 4NYOA 4G1IA 3QNWB 5LY3A 3DMJA 4CZHA 1DRZA 1Q95G 1WBDA 1VSEA 3IO1A 1VQOS 1ZBTA 5GAHP 3MX2A 5K8MA 5KGWA 1FCAA 1XMBA 3C14B 3OYDA 4QJVA 3RSEA 1HBNA 3OD2A 3AXMA 1NUEA 2BZ2A 5IC6B 3GV5B 3DLLQ 4IOXA 4WP8A 1W9HA 4WF9L 4P74A 3S9HA 2ATCB 3BQ1A 1UJ5A 2LU1A 2M8HA 2WSCC 4IRCA 3VAGA 2W6KA 4WJBA 3ENQA 1VI7A 2E4LA 4FJMA 4CF8A 2X3GA 3MECB 4YNQA 2F5GA 4NLQA 3POTA 4TU9A 3KMSA 1FKPA 5AQFA 1H3DA 3K5LA 2WVEA 5GAEP 2PFUA 3MUTP 4DUYF 3HPHA 1YJ9N 3VAFA 4R8UB 5DGBA 2RF2A 4A48A 2C3YA 2DR8A 5F8GA 2YHBA 4FKYA 3R5BA 3VHQA 2FPHX 5DM6L 1SS6A 1IBCB 1UPPA 3SXLA 4BG9A 5I3UA 4C8OA 2HSEB 2XI3A 4KAZA 1LOUA 1ZM9A 3A4TA 1HKCA 1KR4A 4Z94A 1QHTA 3FFIA 3U3YA 3J7Z5 2GC8A 4OGEA 1KQSR 1RDBA 2O8DA 3R6MA 4A5AA 2O8CA 1BWEA 4ZJLA 3GB0A 1PCAA 4V1Ak 2XS5A 1Q81O 3D54A 3TYTA 2LEAA 4ZVFA 3UCGA 2P9IA 3OYCA 3FBCA 4F4KA 4AILC 2NZ4A 2GMHA 3R9PA 3AO5A 3WEEB 3VGKA 2GQCA 3R1LA 2EC2A 2P9SB 3TP2A 3CCQN 1RZMA 2AKWB 1UTAA 3FZFA 3AVLA 3S6EA 3HYFA 1JLCB 3F44A 1FJCA 2W4PA 4U7UD 1QVFM 4CJKA 1H72C 2V4QA 2JRSA 1TL1A 4W90B 4WYBA 3G6YA 3DM2B 3ELHA 2I0XA 1FTRA 4CEOA 3MGJA 4OLOA 4HHTA 5B8HA 2OEMA 4WFBL 2F3JA 5I3QA 4O5BA 4P10A 1S5JA 2V69A 5C7PA 1ZM4A 1Q8LA 2EVZA 4CLTA 2KG0A 1N5YB 2YKQA 4WFXA 1S1TA 1D0EA 2OPSA 4CF9A 1S0NA 1ZTWA 4BRAA 3UI3A 1EAYC 1WSEA 1M5KC 3QT6A 4NLDA 2IJNA 3CIMA 4JI8F 4GC6A 3CIZA 3HD2A 1I51B 1S6QB 4DPWA 3LANA 1WJ9A 2KHCA 3ICLA 2O8BB 4MLHA 2O5DA 2ZWPA 2MGZB 1S59A 4WP9A 3I31A 1LXJA 2UUBF 2XY7A 3A3OB 1A5WA 1W26A 4H4OA 3KJNB 1D9FA 3VQ7A 5K14A 3Q23A 4C6AA 2H3EB 5L9NA 3W2VA 2IIRA 5F9NA 2AYEA 3NWGA 4EAHD 1HYSB 5FROA 3HFKA 1NGIA 4X62J 2R7RA 2ASOA 2OAUA 2GVZB 3MMCB 3CM5A 1WKKA 4GMKA 3W7BA 1VSHA 2L08A 4CIGA 3IR6B 3I32A 4DTJA 3RBXA 2B6AB 1CLFA 5EWGA 1HPZB 4ED8A 2IDOA 5J2MB 3TZXA 2F9JA 4CGIA 3NNCA 2CDRB 3PZPA 4H5RA 2APOA 4LQ3A 2UXDK 2WBNA 2VG6A 4I7FB 1SKRA 2DHSA 1DLOB 2EI5A 1VQLN 4FF1A 3VA3A 1FXRA 2HQGA 4CE9A 2K8GA 3T1YK 4DR2F 1SL0A 1F3FA 4Q2LA 4BRPA 3C46A 4LBPA 1OJ4A 4DFJA 2RS2A 3ZSOA 4N8OA 4HWIA 2OI2A 4CLSA 3JTNA 3SPYA 3O4QA 4K4WA 2MQLA 2MKKA 4KY3A 5SZTA 4DR3F 1IKWA 3KZBA 2Z2LA 2PD1A 2HVEA 3ZETA 2VBZA 1IM6A 2JWNA 5RUBA 3LAKA 3IBFB 2KM8B 3IGNA 1QM9A 2VQFJ 1S6UA 1RGIA 1RACB 2GWJA 1UA0A 4CZGA 1NJXA 3SZ2A 4QQBA 4G6VB 1VQMN 1S9GB 2W7OA 4DV5F 3OFFA 1PKUA 4U95A 3VR1A 4DSEA 3KWIA 4GMJB 2VKRA 3CC2S 1HI1A 2GJIA 2DPJA 4ID1A 3C0BA 5FJ4A 3WNGA 1LW2A 3PYGA 4ZIWA 3TVZA 3MMBB 1M5HA 4N77A 4OYPA 4JI5K 4HACB 1SPBP 4B02A 4OHYA 1X9SA 2CQ4A 2W8LA 4RO0A 2E66A 1YTYA 2U1AA 2FVQA 2IPOB 4L73A 1UFWA 1UCNA 2OH2A 1BL3A 1TL7A 1S0OA 3MEGA 1NDPA 3DWLA 3J7AP 2V50A 2NRWA 3MR5A 4A47A 3KJVB 3JTOA 2MQQA 3W8GA 3QNNA 2G8FA 5IWAK 5J1NA 3SV4A 3WX8A 2G0IA 3T1HK 3HCXA 3Q22A 3MAAB 1KS2A 2HNYB 4YQWA 4P73A 3D66A 1HWLA 1WN7A 1I94K 4NEZA 3MN5A 2KU7A 3O5TB 2BUNA 3K7RA 2B3TB 2LQJA 3UDEA 3R1HA 4EBCA 3SBGA 3OJSA 1CZ9A 4LH5A 3HHLA 4O3PA 5KFUA 3NGKA 1KAYA 5D0HA 4YP3A 2CKWA 3GBTA 1TKDA 3DI6A 2V8GA 2MQOA 3TX8A 5A6PA 2UV8G 2H5EA 4DCJB 4Q2MA 4ELTA 2LVWA 1P27B 2RH3A 1WEXA 3GQCA 2VOPA 2FY1A 3M1VA 2O01C 5DZ6A 1VQPS 1QZ6A 1NM2A 2WW4A 4ECQA 4ZLJA 3QFHA 3H8YA 5KFHA 2W41A 3U9DA 1YRTA 4R5PA 2IVYA 1FRKA 1U02A 4KSEB 2FBYA 1R6VA 5FPEA 3BBCA 3UD3P 3OW2R 5KFAA 2XY6A 1NZ8A 3DDNA 3BR8A 4CJTA 2KZMA 4GV3A 1N6QA 5JICA 3THWA 5E26A 1BQNA 2CQCA 3HSCA 3DOMB 1YHQS 4AQYF 5A6WA 5KFSA 3SUOA 2QTWA 1FX2A 4KH6A 2RU3A 1U6ZA 1HKAA 3LUYA 3OSPA 1U47A 3CE8A 4O3OA 2MJUA 4GKKF 3OTOK 2G9OA 2OUGA 3BPDA 1VQ4N 4HI2A 2WONB 2V63A 3MPVA 2MYFA 3EMTA 2FLOA 4H0XB 4DQ8A 4OI6A 5EXWA 1HBOA 4JK9A 3CUNA 2V7YA 4GKJF 4X65F 2YH1A 3OS0A 1UJ4A 3OBIA 2D7SA 5KT2A 3CJ1A 2BE2B 1PC5A 3M9OB 3Q8VA 3DRYA 2YBVA 2PA8D 3VF6A 2C2DA 2PYLA 2YWEA 3M2RA 2OPRA 2CPEA 3DJCA 4FLZA 2ZBPA 4UZBA 3DRPB 1R8AA 1QLNA 5EX5A 1D09B 4UOFA 1KWMA 2WOMA 2EFOA 3R97A 3W8PA 3K89A 2HBJA 3C7NB 1KLMB 2G8KA 1NDKA 2H51B 5CYQA 2WB1D 3KDNA 3G71N 1ROFA 1LW0A 4ED7A 2OPQA 3HSGA 5DLFA 3UKUA 2BQRA 3AJ2A 3RMAA 3DGVA 4O0JA 1Q9XA 5BRHA 4BWMA 1RAHB 3D68A 3BKFA 1GXTA 1OVQA 4FDFA 1PO6A 1WG5A 5IT9O 4K4SA 4FLTA 1XHZA 4IFVA 3NS7B 5KI6A 2QA1A 1VQ8N 2LKZA 2YJEA 3SAHA 3SQGA 3H08A 3NMRA 2QV6A 1VCTA 2ZH3A 5ITHA 2H9ZA 1Q86O 4F25A 4B9NA 2OEJA 3BEXA 3LA0A 3VN5A 3NLCA 1LNQA 4DU1A 2OEKA 2FZCB 4RW9A 2IGIA 5D0EA 1EX8A 5F8HA 4FWPA 4FVUA 4ZN1A 1ULRA 1K44A 4DEZA 4TYBA 4I67A 3O4WA 3KHLA 3FMWA 4JI6F 2AIRB 4ZDNA 2CNOB 1IKVA 5CQGA 1UKUA 4DV4F 2VPXB 1G7CB 1FJGF 2RAQA 2J8SA 4KHPK 2EBGA 2HNDA 2A40A 2BJ8A 1HNXF 2XY8A 1TYQA 4DR7F 2NQPA 5HI7A 3T69A 4X4QA 2BOAA 2AJ2A 3ZEUA 3PCOB 1U1LA 5IT9U 2ATQA 3NGIA 2IRUA 3DHWC 3BZCA 3NHGA 1UJ6A 2VWBA 1IG8A 3DOKB 1J5OA 1WHWA 3W3DA 4G65A 1J9AA 2GJ2A 4IRKA 1NJIO 1BD6A 1S57A 4OX9F 2A6AA 2WSFC 2IS3A 4C1NK 3VF0B 3AA9A 3TAFA 4CBUA 3ULDA 4M5LA 4F4XA 4X84A 2ZH7A 2M0GB 3G4SN 4BQLA 2X1FA 4QS7A 1IWAA 2BM0A 4DPOA 3P45B 4UOHA 1Z2LA 2AHOB 2CGLA 1ZOTA 3KUHA 2OANA 4NXMF 1JCEA 4ELUA 3OYIA 4CJRA 1QUVA 3R7NB 4M3WA 1X4CA 1JLEA 2NSCA 2HRTA 3SJJA 1RAJA 1JXEA 3MEEB 4YHHK 3DRRB 1HLWA 3A5LC 4LSLB 5F0UA 3LF0A 4OI4A 3ZZRA 3G6ES 1AZSA 2MQPA 3CCTA 3ENAA 3GG1A 4DQRA 1SQGA 2O66A 3I56N 4QIEA 3QSIA 4QIVA 2F4VF 1HNVB 1XNQJ 1VSKA 1N0VC 1JJ2M 1ZBUA 5BPNA 3RAMA 3CPWR 2R2RA 3MEDA 1H2VZ 1T9VA 5J2NA 3KHHA 5KFRA 2QA4N 4Y65A 1OKJA 3UR0A 4FZVA 4B3OB 1K8KA 2XHCA 4EHUA 1HBUB 2Y1RI 3SCKE 2XSJB 4YY3F 2HS3A 1TV6A 1RABB 2PFDA 4IG0B 2N4CA 3KUEA 3I8BA 2HK3A 1LWCA 1WSVA 2A6MA 8AT1B 2A5XA 4ITSA 1RKJA 4FM1A 1ZPVA 2LCWA 3PDNA 3QO9A 3JYTA 4P75A 2E7VA 2ZHAA 4U8VA 4QYZJ 2OPPB 1AT1B 3L2WA 1B7FA 3CC7N 1Q9YA 5T7LA 3X3UA 1ZAVA 3UNYA 4DL3A 5KTQA 1KHVA 1WNSA 3AAPA 4BY9C 3D28A 1ELOA 1SC1B 4ILJA 3OTBA 4JHDA 1JJ4A 2CQ3A 3ITHB 2F1FA 3AJ1A 3OFGA 1XJWB 4CI6A 2WVBA 4K0KF 1BY9A 2VODA 2ZE2A 2HZCA 3AOAA 3C14A 3SSSA 4X64K 2VA3A 5BYRA 4P9SA 1MG7A 2BXJA 1S1UB 1NGFA 1MU2A 4I64A 1MA9B 4AT1B 1U24A 1Y5IB 3BGFA 1RYSA 4LF5J 4B3TK 5C15A 4J9RA 3SBTA 3NNHA 2KYZA 4B9TA 5KPTA 4AE5A 3O5BA 2Y1IA 2JHEA 3MHYA 3PSFA 4DU4A 1HLUA 4A8XA 1KHWA 5B0CA 4HUGA 2NRRA 1KQGB 5KG7A 1X8DA 4C8ZA 2H5JB 4OZNA 3JS9A 1KQSM 3RR8A 4Q43A 1N5SA 2VQEF 4GVMA 3THYB 3VF4A 4DUTA 3BN7A 4OI2A 4EEYA 2X6SA 2BV3A 4HL9A 2FLPA 2NRTA 3GP9A 4J9MA 1SZ2A 1BMQB 1Z25A 3RBEA 3B8HA 4AHTA 5JUMA 3P5TL 4AXJA 2ADBA 2BUPA 3I0SB 4OVLA 4AXIA 3DLHA 3ZFVA 2DRBA 4IFYA 4FP9A 2V9WA 1REVA 2E1YA 4I0WA 4J2BA 5ETPA 2XS7A 2KHDA 1CXUA 1B92A 4I9QA 2UUBK 2VFRA 1FE4A 2FVCA 1T44A 2BW7A 4RNFA 1U1KA 4ICLB 3ENHA 4EYHB 2FBTA 4C0OC 4PG4A 1VR6A 1OVYA 4A59A 4BQZA 2FF6A 4NLRA 4CJEA 3ZTSA 4B9MA 1GX6A 1KKHA 3AOCA 3TJAA 4DTPA 2F7VA 1XTZA 2YPYA 2F65A 4ZP8A 2HVDA 3QRQA 3PUFA 1HKGA 2RJZA 4RJVA 1H74A 2OD4A 4LF6K 2Q43A 1RBSA 6AT1B 4PXDA 3I4PA 3CQXA 4ZA1A 2V7ZA 3CMQA 3MR6A 3VQPA 2YH0A 3UKRA 1MMDA 4KR0B 5HRSA 2R8IA 4WXWA 2W7AA 4EFAC 4HYKA 4CFCA 3F41A 4UOGA 2Q66A 4CLKA 3QATA 4GVLA 3RAXA 4JI2K 2VG7A 2FJBB 2XMKA 3PX0A 2ZJRQ 2CIMA 1OS5A 1RT1B 2IM1A 2QLBB 3FSYA 3TVKA 2PBDA 3L3CA 3PJ9A 2OMOA 4K8RA 3VQ6A 1HARA 2CZ9A 4FWOA 2KKZA 4YUDA 1VLYA 5DM7L 4BRDA 4Q44A 4B9UA 4EMDA 3CCLN 1K8AT 1X5PA 3NMAA 2XG8A 5LSRA 3K9KA 1UWBB 3HTVA 5HANA 2MGZA 2L48A 3HHLC 2I1RA 5T7BA 1REGX 2J5AA 5EVZA 2E1CA 1L3KA 2MTLA 1VQ5S 3L0QA 1NO8A 2PI4A 1RCHA 3G2XA 2KTQA 5IT9Y 4H0OA 4DV5K 3TWHA 1NHKL 2JEGA 3GWCA 1JKHA 2CNLB 3KNAA 1WORA 2HGMA 2IYGA 1F5CA 4Y1CA 1T9UA 2B6AA 5E2QA 1CLQA 4U8YA 1CS4A 4IKFA 5J2MA 4ANDA 2DBBA 2LQ5A 2RN2A 5GMEA 3BR9A 1GLLO 5ETRA 3CFOA 3ONQA 3ZT3A 5AQJA 1BCMA 3RU0A 3M2UB 1LV5A 1TAUA 4OZ0A 2BANA 5AXMA 3U1NA 4RCHA 4FLVA 1EHWA 2E1PA 2WK4A 3FQLA 1X4GA 3C6TA 2N7CA 3IAM9 1BC6A 3L4BC 4CK2A 4X62F 4ZKAA 5KFMA 1TKTB 2HNZA 4E1MA 5I42B 3ZZYA 4NYZA 5CA5A 5IQQA 3KLHB 3NVMA 4CJLA 4XPEA 1T05B 3BN4A 1CSJA 2PZSA 1Q18A 2GUPA 3SQ1A 2ATLA 4BE0A 2P9CA 4OMFG 1GFWB 4O0IA 4FM2A 2CZ4A 4LSNA 1OY9A 2IYIA 4DPTA 2UUAK 1X5TA 4I6WA 1GMVA 2QRRA 4JI7K 1FD8A 1M5SA 3A0IX 3RMCA 2HVZA 3KK3B 1VLOA 1SQKA 3HT3A 2PSZA 4GNIA 3M8QB 1ASVA 3MEKA 2K7KA 1M0SA 3OR2B 4M5GA 3UB5A 2XNQA 2GGPA 4ES3A 3HHDA 3G10A 4IG3B 5M1NA 3C6UA 4F3TA 2O8FA 2X74A 4LF2A 3GDQA 3QIDA 1MNEA 4NXNJ 1C0UA 2E6MA 5CD4A 3I9V9 4HACA 2NXJA 5IFMA 1MDUB 2N7YA 4UQTA 3BBBA 3VESA 2B4UA 2GV1A 4WFNL 3BGRA 1SBRA 4CD3A 2KXNB 2GHWA 4DUZF 4I2QB 4OLBA 1RILA 5LJ5Y 1OPZA 1NK6A 3EGNA 4CT8A 3FDSA 2ZH4A 3GIMA 5I3PA 1CC8A 3AAQA 1PJ5A 2IRYA 2PN6A 1RAEB 4WZMA 1QSSA 1JJHA 1VQNS 3A8JA 4DLGA 3DCAA 2MJNA 3RMDA 3EDQB 3UDLA 4JKFA 4RBUA 3SIPB 2COLA 4JAXA 3PJWA 3NNAA 3THXA 4ZVGA 3WXJA 4DV0K 2YNFB 2O4IA 3TABA 4LFBJ 3LW5C 1TP7A 3AO2A 2A1RA 3I6PA 3BSNA 2FVPA 1R8HA 1UPMB 3PX6A 4LVOP 2VBYA 4DU7A 4FJ7A 2KFYA 4DCOB 3QJJA 4QR2A 3D7EO 3KK2A 3WQTA 1XK8A 1OQ6A 3M6WA 2BA9A 2PY5A 4YMEA 4OZJA 4FF2A 2B9XA 2VU5A 4IH6A 5IQ6A 4FJJA 1XMQJ 2LFVA 1RYRA 1NKBA 1QUPA 2GUIA 2YNIB 1YVUA 3DXKB 2HIQA 3SMSA 1H2TZ 4NLXA 3FZ2A 2ZF5O 1JQGA 1WG4A 2HURA 3Q8RB 3PFOA 4X4RA 4P72A 2DNZA 2GHVC 3TEHB 1BXNA 3QDKA 4KGMA 2X7IA 3SFUA 1NZAA 1HD1A 3P38A 4PQAA 4DR5J 1TELA 3GMGA 5E84A 2V2KA 4CZJA 3FBBA 3AVCA 1NJWA 3R8YA 3GONA 4P2FA 2QMUB 5KFJA 3DLKA 3LDSA 1R7IA 2J6UA 3SAGA 1YWXA 4UY8T 1FXLA 4QBUA 2XMTA 3JXOA 4PYAA 4JKDA 1RQ0A 3FEXB 3GG0A 4J2EA 2Z4PA 2IDLA 2Y9HA 3WNFA 3PJXA 4DWIA 5JVHL 1KRPA 3RTVA 1P90A 3OR1B 2QEXN 3M2VA 4DMZA 2A6OA 1NK5A 2AGQA 4K4YA 3KWMA 4KHNA 3KKSA 4MIAA 2HFOA 2DT9A 3CCMS 3H46O 4DFKA 3VALA 3HHEA 2WW8A 4YOXA 5C2GA 5E5NA 1YJNS 3PM9A 2GIFA 4DZDA 5AT1B 4LFCK 3EVOA 2Z2ZA 4IOAL 4DTOA 2G1HA 4CJ4A 4K2XA 2IAJA 1R0CB 4NLVA 1LAWA 2VONA 2OTJS 5KFFA 3VQ4A 3J7YP 2PT0A 2DEIA 5KFWA 4NLGA 4JKEA 2FQQB 2MZRA 2ZM6J 2ITMA 1JLBB 1HNWK 1P9QC 3ISZA 3RZAA 3IFEA 2OIHA 4W92B 1U2VB 3D3CJ 2QFJA 3SYZA 2CQDA 2Z1HA 2HBZB 1RFQA 3HHNB 4QWDA 4ZVRB 3D1HA 4ISEA 1RT5B 2B8PA 5M2UA 4JV0A 2W9CB 4DV3J 1JLQB 1RAAB 2AQ4A 3DNCA 3FEZA 1HNZF 2DNQA 3Q83A 4F2RA 2KLAA 1AROP 3L95X 3ATUA 2JX2A 4IEIA 1GOBA 1X5SA 3VQ9A 3NY0A 1OY6A 5AQMA 2D5RA 3CJBA 1TL5A 1E3MA 4ZPDA 3UIQA 1RTHB 4E19A 3IG1A 4WCEQ 3TVYA 5FDLB 2HFUA 4DR4J 4ZP9A 2Q6BA 2JC1A 2OMLA 3DXMB 2F4VK 2ZBRA 3EE9A 4RG8A 4CJVA 3I33A 3HSDA 4KFBA 3AJDA 4FNHA 5HATA 5CZXA 1Y7PA 2OTLS 3AH6A 3WZ0A 3DLRA 2LYVA 2LQ8A 3ZZTA 4KO0A 4N8NA 3LGMA 4F36A 1QQCA 5DO2A 2C22A 4J9SA 4RUAA 4AM7A 3NGUA 1X0PA 2CQ2A 3MD1A 3QYYA 4M42A 1T7PA 1IM4A 1VQ6N 3N28A 3MZIA 3IMXA 4X66K 3VAIA 4ZCIA 2HBRB 2MEWA 2BDPA 1VSMA 3HVRA 5JS2A 2J0QD 4TKTA 2J7KA 2C42A 3AD7C 3IWXA 4A4JA 4ZITA 2JGUA 3CXCR 4KB0A 1WC1A 3VGTA 1DAXA 5EUHA 4H4KA 3LDPA 3LM2A 2R7QA 1RWNB 2EFVA 2JFDA 4CH0S 5AQWA 3DN9A 3J81O 2RHSB 4QOTA 3SMZA 3G82A 5HN0A 1M1KT 2K3IA 4MT1A 4WZQA 3FCHA 3QESA 2P9EA 4D3HA 1HWJA 2HZAA 5E33A 3CJ8A 4RW7B 4LSLA 4U67L 2V9KA 3BGLA 2CVIA 4F4WA 2RKIA 3L3UA 3MM7A 3MM6A 4WPAA 1S7HA 3OXGA 2YX4A 4JI0K 1HNVA 2DNKA 1W97L 3D2EA 4V19J 1QE1B 1RTIA 4LF8J 2FBXA 4OPHA 4E89A 2IC3A 2IA6A 4FYDA 2UUCJ 3VAHA 2QFIA 2YKPA 1S7IA 1RWOB 2XO6A 4LJMA 4WU3A 4Y2CA 3T7ZA 1G15A 2D4WA 3C6HA 3GYNA 5GINA 2L9WA 2AP1A 3NG8A 4NPOA 5D77A 1NRKA 4WQ5A 2KH9A 1DQAA 2VQEK 3VA0A 2W1BA 2UXCJ 2Y0BB 2VC0A 4JN4A 3F56A 4DQIA 1LEOA 1NLVA 1YXQA 5K9FA 2B7CB 1VRQC 2BEFA 1R0BG 4YB7A 2Q36A 5DM6Q 2K3KA 3MX5A 2Z56B 1T3VA 1QAIA 1CJVB 3CETA 3AFGA 4FF4A 3TTCA 1R6YA 3KLFB 3V6JA 3HP9A 2EFQA 2RQKA 2WVDA 4K43A 2V94A 4F26A 5LSOA 4CO5A 3K5OA 4QWEA 1I3AA 4WU2A 1NKEA 3D45A 1N8RT 1X4DA 3V9SA 2LP4A 3ITHA 5A0YB 5EOYA 2ADCA 1L3VA 3R7BB 4DTSA 1BI4B 3V9WA 3BYPA 4ELVA 4ZOSA 2YNGA 4B9LA 2HHSA 2BJ9A 1SB6A 3UD4P 1ZTTA 5KFPA 1NDLA 3FZLA 1RTJA 3SDEB 3MCAB 2ZBIA 4TY8B 4MK9A 3M8YA 4ZCLA 2XYGB 2AF6A 5D3GA 4WYWA 4BG8A 1IKYB 1S4FA 5KFYA 2P9UB 1FRXA 4RW4A 1RWKB 1RT4A 2UZAA 2HBLA 4OPAA 2I5JA 1XNRJ 2CH5A 1JLAA 1EQ0A 2HF4A 4DL0C 1NK7A 4KPYA 1NH8A 3QEIA 5C25A 2NPFA 2XZWA 2QC3A 1IBKJ 2UU9K 3CO9A 4E0DA 5JS1A 1HWUA 2GA7A 1NGDA 4CFAA 4ED3A 2DISA 4L74A 2D3ZA 1BOTO 1N33K 4LF5F 3WT0A 2YKNB 1FXDA 1KN6A 4H0TB 3HVTB 4B3SK 3AVHA 4DR1K 4C8YA 4FO0A 4AFFA 5DQIA 1U0HB 1HMVA 1I6JA 1TGOA 1RADB 1U2CA 1FNXH 1N88A 1RHJB 3EN9A 4TN2A 1K8AO 4B8CA 2LDYA 5DG7A 1HBMB 2E7WA 3VGLA 2XGQA 4CGFA 4FLUA 2QT7A 3IC1A 5E0OA 3O3GA 3NOCA 1QTNB 2AW0A 2G2ZA 2AEMA 1IUJA 3Q86A 3GFXA 2VJUA 1RT2B 1O5JA 2P51A 1U1MA 3ALYA 4PKHA 4FJIA 3L9ZA 1YI2S 2ZHOA 3MM9B 5L8RC 4IO8A 3DHXA 3RBZA 2JVRA 1HYZA 1ZXOA 2GWKA 5BN8A 3CWJA 4ZIVA 1HNIA 5KT6A 3LTOA 5K8OA 4DTXA 3DLJA 4DKWA 4DOZA 4JV5K 3HD1A 4OKKA 3CMES 3MR3A 3BKUA 4NI2B 1FE0A 1ZM2A 3TAQA 2HAIA 1W7WA 3G6XA 5HVGA 4J8FA 5HRPA 2UVUA 2CJ9A 4I6MB 3CJRA 5J1EA 4KH4A 1F3VA 2FVRA 3H6EA 1WI6A 4ES2A 3ZTPA 1D5AA 2F96A 3DLGB 2BJ7A 1TUGB 3KK1B 3BM7A 2OSRA 2AJQA 2CQPA 4BCAA 2QXLA 2PI5A 3L2QA 3R3TA 5CHIA 4GV9A 2UXBK 4AH9A 2J6SA 3GFYA 5GAHU 1XI1A 3EGVA 1RTDB 5HL7Q 2GW8A 3CULA 3ZC4A 1AUSL 4DI6A 3I55S 5GAHI 1UOCA 4RU2A 2ROEA 4YOUA 3OL7A 3RAQA 2ZUAA 1K6YA 1UWBA 3TOQA 3D9BA 4DV6J 3KK7A 3R8EA 4ED2A 4NLYA 1I1GA 3BB5A 2RIJA 1SKUB 3EEQA 1X9MA 4M1KA 1TUYA 3MPUB 1J27A 1T03A 1RLCL 4CYUA 4DTMA 1OH7A 1NH7A 4ECSA 3HRGA 1ZBLA 2XMAA 1VQSA 1FX4A 3SQOP 2XCAA 4LF7J 1PYOB 1KVCA 1VBKA 5GAEU 1K1QA 4C7QA 3VTHA 3ET6B 3M32A 3O8WA 1MN9A 1SUQB 1VRTB 4DV7F 2JL9A 5GAEI 3H0PA 1N5TA 2GAHC 1T9YA 1VQ7S 3B82A 1QVGM 3D0GE 4DUZK 4LRDA 1SC3B 3D1OA 3LH2S 4W5NA 2LECA 2P9PB 3AA5X 3QWUA 1Z1ZA 1SIWB 2IBOA 4OPJA 2RRBA 3ZX0A 4H54A 4USWA 3O3HA 1WDTA 3M2UA 3QERA 2B5JB 1EX4A 2FLLA 4RW8B 5C42B 1CJUB 5C12A 4OZ2A 3I4HX 5D6GA 4DF8A 3MTKA 2W8KA 4KQZA 1CZAN 3E3XA 4BDPA 1SQEA 4RR5A 3K59A 5A2QO 2IRXA 4URGA 4J5OA 4OYOA 4M7YA 1S72N 3QMLA 3IS9B 2LMIA 1NPRA 4H4MB 1XIQA 1F60B 3H20A 3QNOA 3TO8A 3OBWA 1GLFO 1T05A 1OY8A 3FRZA 4M3XA 3BSOA 4CBWA 4OYBA 1WD6A 4CFBA 5HMXA 2HVHA 3SI6A 1RWPB 2FBVA 1P1TA 1GMWA 2R8JA 1LQ9A 4BRIA 3ETOA 3NCPA 2QTDA 1FEEA 3JB9k 1JL1A 4FCYA 3DOLB 4XK8C 3M8QA 5HJXA 2GEMA 2P9NB 3QLHA 3GYGA 2DIVA 1MWKA 4ZS6A 3ENWA 4GO5X 3UD5A 1S9EB 4FWSA 1IR0A 3KLIA 4IG3A 4OKJA 4KTZA 1WOPA 4O4RA 3J81Y 3V6DA 4ATNA 1RT3B 2Q1NA 1QVFR 1G2EA 1BCOA 1T0TV 3N79A 1YGYA 3DRSB 3MWBA 4MKAA 2OZSA 1APSA 3I8DA 2RUSA 1KXPA 4USTA 2AEFA 1VC0A 2B4JA 3TRGA 3B54A 3HDSA 3BJYA 3O8MA 2ROPA 4DL5A 1I3OB 1F5AA 4FWKA 3AO3A 4PRFA 1IBLK 2I7PA 1YTUA 3CQ8A 4H5TA 1X4AA 3AO4A 5CHCB 3THTA 2V8PA 3IM9A 4B08A 1PJ6A 1FFWB 1GLCG 2HBKA 1GXLA 2O67A 4CHNA 4FLWA 3ZNJ1 2YWWA 2AX0A 4NXNF 1C1BA 2NLWA 2MZSA 4L3NA 1BUPA 1XBWA 2BQUA 2NLXA 2KFNA 1RAFB 2M7SA 2UUTA 3TPQA 4RWTA 5H1SV 2EW9A 2IM3A 1V3ZA 5ETSA 3N5FA 4CEEA 1NKCA 3K2YA 5B0EA 4IO1A 1G99A 4FF3A 1B0TA 1SVDA 3MWTA 1NAQA 3E1YA 3LAMA 3JSMA 1JXVA 3TA1A 1DT9A 2BOPA 4LF9F 2DR6A 2IVOA 5AQLA 2ZBQA 2QGFB 2YNIA 1ZAWA 3A13A 2XMWA 2YX6A 5BN9A 3SNNA 1KONA 1YITN 4ZLLA 1XHXA 4HUEA 3C16B 2KN4A 4IKAA 2FF3B 5L1KA 4CF1A 4LFBF 4DQQA 2FYXA 1XMOK 2DGUA 3QRPA 4BHQA 5HOOA 4HVJA 2OZMA 3UVJB 1GT8A 3DLBA 2R9LA 3ILJA 2DXDA 3O9UA 2FJXA 3R2DJ 1HRHA 3HJVA 4RU9A 3ILOA 2MZJA 1VC5A 2W40A 1HQUA 3AHPA 4LRFA 1HNZK 2VA2A 1S97A 5MLCQ 4NMLA 4BRGA 5MAOA 3ULEA 3LPEA 3WC2A 1XMQF 4PZVA 4C3MA 2F8MA 5KFDA 2ETJA 2YV0X 3IRXA 5A8WA 4ZVEA 2ASYA 4WK1A 3AVKA 4NCGB 5KFVA 2DGOA 4LRCA 2GS8A 3PRDA 2GV9A 5F8JA 3O9SA 3PW7A 3M8PB 5AQXA 3EICA 3OR1A 1VBZA 1YVFA 4HTIA 1VGYA 3SCLE 4JRPA 3ZX3A 3A8EA 1CG2A 4NA3A 3JS6A 4JI3F 1QQMA 4WFAL 2CQBA 1N34K 5HQMA 1WNEA 2UVWA 3S1TA 3W5YA 1I39A 2ZD1A 3A8KA 3QPIA 3ZT2A 2AJ1A 3S7RA 1T9TA 3A8YA 1UWAA 1HI8A 4R0EA 3TAGA 4OJ1A 2NZTA 2Q3PA 1HQEA 4ECYA 2FDNA 3OYFA 1GOCA 5GIOA 1VFJA 2LQ9A 3MDFA 4PQUB 4PKGA 1LWXA 1B9FA 3CB4A 2MZQA 2W42A 4JI1K 2KJVA 4KC5A 3Q8SB 4WQ5C 1GOAA 4K25A 4M3ZA 1LFWA 3N01A 4ZK7M 2OELA 4MK8A 3MXMA 2WBMA 2ZNYA 4KAIA 3L7UA 4CEAA 1VJWA 3PW5A 4B3MK 3KJFB 3EM1A 4ZP7A 3BGUA 4ZVQB 3C94A 1WHVA 5LM7E 3I5CA 3LP2B 5DDQC 2QKKA 4YOTA 1L3UA 3ZSVA 3ZZUA 3OHAA 3SUPA 4XPCA 3LL3A 3W64A 1NDCA 1T9XA 3CCZA 3MM5B 2XS2A 3CD6N 4CGHA 1RTHA 4I69A 2GO9A 3WC0A 1T9WA 5A8KB 2PGCA 1CULA 2ZM6F 2QA2A 2VF3A 4H0VB 3E2EA 4AM6A 1RBTA 1U04A 4Z7CA 4RPFA 5KFCA 1LK5A 4MIWA 2W2NP 4JV1A 3GFHA 1FO1A 1RHRB 1NU4A 3RG6A 4NE9C 4MKBA 3BZKA 4QYRA 2E5LF 4JS5A 4IOBA 2HHHK 1S6OA 1V5VA 3A5NC 4HTJA 3OUYA 4DV3F 5E3RA 1NGGA 3GE9A 2EX3A 1RAGB 1JCFA 1XQSC 4RNHA 1JXBA 1S1WB 3C95A 1QTMA 5C24A 3AXKA 2ILZA 3TSPA 2KKHA 2UXDJ 4J91A 2D3O1 1KSPA 4DXLA 3TX0A 3CJSA 3JAMU 3K0JA 1S99A 2R2SA 1X4FA 4Q7AA 3CCRS 5IOLA 4DR4F 1VQKS 3T1YJ 5B7WA 3L7OA 1IBMK 4NLSA 5HMZA 2GIRA 4J9NA 1B9DA 2G8UA 1VSIA 1UEUA 5CYJA 5B0FA 1WB9A 2CADA 3AODA 2UVRA 2QW9A 2RQMA 2X6NA 2Q31A 1U6FA 1S1VB 2FSJA 1TK8A 2ABYA 3RW7A 3VQQA 1N8RO 3HX9A 4QR1A 3CJKB 4DJBA 2D3UA 1J5EF 1JMTA 1SJ1A 3WXKA 1KTVA 2I8EA 4EZ6A 2FJDB 1E6YB 3N9UC 3P39A 5F1XA 1TKXA 2HLTA 3QIPA 3VZIA 3BDEA 2R2TA 2PO4A 2AJFE 4CW7B 1SJQA 3PW2A 3C2PA 1MWYA 3HHLD 2AZ3A 3MCSA 4CJSA 2A3JA 4BRHA 4I2PB 3GJQB 3ILLA 3NGDA 3GR1A 3EUNA 2E5JA 2W4CA 5AQRA 2C2RA 4CD1A 4KKOA 4W4MA 2GCFA 2DNGA 5HBMB 4DR6K 1JIHA 1FHTA 3P83D 3W1YC 2JLEA 1FJ7A 3KFWX 4JI5J 1YG0A 4JD2B 4FLYA 4FJLA 2E8AA 1U0SA 3PHTA 1CJKA 4YEAA 3G96A 1S1XB 2HBMA 1ICEB 4HDGA 2LU2A 1WI8A 1MROB 3MMVA 1DQ8A 3H1QA 2V4RA 2DGWA 3MM8A 3PG9A 4JLHA 1TUWA 4N47A 2CJYB 4Z4HA 4OYZA 1O51A 4LF8F 3KYLA 4IUFA 3O6QA 3QEWA 1KTQA 3GSDA 3T1HJ 1YRUA 3VWSA 4DL6A 2JEFA 1SI9A 4BC2A 4IYQA 1I94J 4RWWA 2ALZA 4OX6A 5LT5A 3E01B 3CCJN 2ZZTA 2HHQA 3CD7A 2JLGA 3F9KA 3SDEA 4R0JA 1QAXA 4DFMA 3MMAA 4LY7A 3WUHA 2H4YB 1Q86T 1KNZA 3LP0B 3EX7B 1IJJA 1NBWA 2P9UA 2RHQB 3W9JA 4M5NA 1U49A 2GIQA 4NYFA 2DR5A 3SPZA 4M5JA 2FD2A 4F04B 2HQ3A 2YHWA 4YOYA 2Z30B 3FBFA 5J2PB 2BE9B 1NSPA 3CC4S 1A0OB 4OX8A 2YQ1A 3RVCA 3FQKA 2DGXA 5BPMA 2VPYB 4JKHA 4DSIA 4MTPA 3VETA 1YVNA 4UZCA 3FMBA 4Q0BB 1U1NA 4JKCA 3JXUA 1DQ9A 2ILYA 3ATVA 3KUGA 1CVJA 2IM0A 4IDKA 1TVRB 3FSIA 4M45A 1HHTP 5M2RA 4P71A 4NCBA 2YKNA 1M1HA 1C0TB 4M5KA 3OTOJ 4J9OA 4FK4A 1EP4B 3JTPA 4Y28C 1U0HA 2E9RX 5DDRC 5BREA 2FXUA 2HEKA 4HHUA 3NF9A 1VQON 4OI1A 1VIOA 1HKBA 2BH1A 1TAQA 4OJHA 1VQ6S 3VEVA 5KG6A 2KXFA 1SJRA 1KVKA 1RISA 1TL4A 4CIEA 3TR8A 1IBKF 1Z2ZA 2F8EX 2BKNA 2V4JB 5CD4H 1JJ2R 2BTFA 5AJ3F 1CJTB 5SUHA 1N36K 1JL2A 3CDBA 3MM9A 1YBUA 1VSJA 2KB2A 4BBYA 1AYEA 4J9QA 1LWFA 2YWFA 4B9QA 4CJFA 3PEJA 1JNZB 2V8HA 1DKGD 2VJVA 2XGPA 4NLTA 4EYIB 3V4IB 3H90A 4DV1F 1RDWX 4E8UA 2BJ1A 3QZ8A 4PR6A 3UWTA 3IAS9 3GSIA 1NPKA 2CWKA 2C3PA 1RT6A 2NYHA 1VQ9N 2L41A 4DCPB 5B09A 4M5DB 1DFDA 3P31A 4IQMA 2VICA 2IDEA 1LAVA 5K20B 3L09A 2BM1A 4FWMA 3TAMA 1CEZA 2GAGC 4HVZA 4OYIA 4O0NA 4AUKA 3PW0A 1Y0HA 3QT8A 3C15A 3EL2A 1FF2A 4WQ4A 3M05A 1RTDA 4C97A 5KQ8A 4PL7A 1BQMA 4O44B 3PYDA 1YF5L 2X1AA 4B17A 1Z4UA 3KWGA 1P9YA 6FDRA 5D4NA 2JZ5A 2YHYA 1FI4A 3HULA 1W2BM 4LF4J 3VZHA 2OHDA 4HT5A 4LFAF 5AR0A 9RUBA 2ZVSA 1IWGA 1K1SA 2DHAA 2RQ4A 4DX8H 1F2HA 3HM8A 3UFCX 3TEGA 2DGTA 4KT0C 2GX9A 4WE1B 4ZPVR 3ZX2A 1QAYA 4NEYA 2JEIA 3JAMY 4KHPJ 1ASWA 2ITGA 4FVMA 3ET6A 5KFIA 2J8AA 1SUQA 3DKDA 4MO5A 3DGPB 3EE8A 1NCLA 1YLXA 5D78A 2ASJA 3U8XA 2NRXA 4PXBA 4A2BA 1DTQB 4FYWB 4WFNQ 4E7IA 1ITPA 3DYAA 4CLUA 2XZDB 1Q82O 2FTRA 2XMJA 4MO4A 4CP5A 4DV6F 3QQCD 4GW6A 2B5JA 4RW8A 3KLEB 3ID8A 5C42A 3T9ZA 1CJUA 5DDOC 3CVKA 3WQUA 1S6PB 3JQJA 5ETQA 3D6FB 1S10A 4DV2K 3QINA 2CQ0A 3DAWA 3CYMA 5EGYA 3CFPA 4LRBA 1NGJA 1MMNA 2KI2A 2MY8A 4CHQA 2H48B 2W9AA 1HA1A 1GLDG 2FHMA 1WOQA 3HXMA 4HH0A 4H4MA 4LF7F 1XERA 4B3RK 1OSCA 4CJPA 4B1YB 3QEXA 3FK4A 1YJWS 4ZVOB 3D2FA 4JI4K 5AZIB 4DX7A 1LWEB 2NUHA 4G1QB 3CTRA 1TR0A 1IKXB 1R0AA 4YHHJ 1Y3JA 3TU5A 3HZ6A 3K8VA 2L3MA 4CVNE 3DOLA 4LF9K 3MTJA 1U45A 8RUCA 3A5MC 1NK9A 4OLPA 2J76E 4ILHA 3SQ4A 1DTTA 3LALA 1CBKA 2W01A 3M6UA 3T5KA 3W66A 5FPMA 3CEDA 5D8HB 1UW4A 2R7TA 2M5YA 3DRSA 4ZLPA 1O6XA 4OQJA 2K1RA 3OVAA 4KHMA 4DG1B 3S41A 1EO1A 5F0WA 3GIKA 4Z2XA 3WXLA 3O80A 3B6OA 4CEQA 3CD0A 5FLXO 4FXWA 2YNHA 3SK3A 1HBNB 1H38A 2VDHA 3LWMA 1UETA 3MMJA 4USMA 1EIYB 1Q53A 5J2QA 4WKYA 2P1JA 3QFUA 3G86A 4OZ1A 1NWKA 1GNKA 1M90O 1X60A 7FDRA 3KLGA 4DQPA 5TKYA 2MKSA 1KD1O 3POTB 3AVNA 1MWZA 1WOOA 1FKPB 1AA1B 1N48A 1SKSA 3GCWP 4JI3K 2GQ2A 2B0GA 3QGIA 1QSLA 3EKUA 5AZJB 3LPUA 3NCQA 4X64J 1RDAA 3GL1A 4OYXA 2EK1A 1U8WA 3UW1A 1S79A 4PG8A 3OHBA 3CC2N 4GVBB 2ACYA 3TZYA 3OYNA 4B3TJ 3CCUS 5F3ZA 5I3UB 2QWOA 1EARA 2JNJA 4PEOA 1S9FA 3C19A 3H98A 1YIJS 5DS7A 2A3ZA 2VG5A 1R3NA 3C16A 2BJDA 4ECWA 3KKFA 3U6FA 2I38A 2YXLA 1TMMA 3FFIB 5FLXU 3NS5A 4JOUA 1MWMA 4L8RB 2GBZA 4PWDB 5EHHA 2XCPA 4L3KA 2O8CB 3ZTOA 5L39A 4CFDA 4EO8A 3FVYA 3VEXA 4CEFA 4MDAA 2HF3A 2P9IB 4K8ZA 3HZEA 1FDBA 1YDLA 4DTNA 4C1NI 2M3DA 1C0GA 2D1KA 4ECTA 2ERRA 1YJUA 2UYTA 2XHWA 4C48A 4ZPCA 2FJAB 2E44A 4HT7A 1VC6A 2D0PA 4LBHA 2RRNA 1OH6A 2BBEA 5A8RB 4B1UB 1TL1B 4A8MP 4IFEA 2UUBJ 4NOHA 3SBMA 4QPTA 2BRLA 2CH6A 4XO0A 4CJ5A 4Z37A 3ZT4A 4PWUA 3HVWA 2DXFA 3WX4A 3ZLJA 2MLXA 3J7A1 3G25A 2ASDA 4QS9A 5M1PA 1NU0A 2XEXA 3AARA 3AA2A 3IBWA 4O3NA 1S1TB 5MLCV 1BISA 4JNEA 2E5LK 2OPSB 2P9LA 3BBFA 2A42A 4CK3A 2HBYB 5CE3A 3K2PA 2O4GA 5FIIA 1VQPN 3EPGA 2IFXA 4BR0A 1KCFA 4JYAF 1UVJA 2YWKA 1ASUA 2CQIA 2MSTA 4ZPTR 2XLIA 2XMUA 4LF6J 2DNYA 4DTUA 2R7OA 3OXLA 2ZKTA 4PPDA 3NGSA 2RDDA 3W2WA 1IV0A 1VBXA 1Q7YT 1BWFO 1N54B 2PIIA 3GE1A 3IP0A 4PCQA 5LMUF 3V9XA 4FOEA 1BDGA 3L2RA 1F9EB 3FCVA 3FZKA 4H4OB 1YHQN 1JB0C 5K14B 4MMOA 4H5VA 1NSAA 3SSRA 3H2LA 1V4SA 4H03B 3W2VB 4DQSA 4JI2J 4FYVB 5HP1A 3BF1A 3Q8UA 3FZBA 4ZHRA 1KBRA 4P6QA 3D67A 3QSYB 4CLFA 4ANEA 2A41A 3RWUA 3EXCX 2CAJA 3T1AA 2M4MA 4KV8B 4TY9A 3PFEA 1UVLA 5BXIA 2YJFA 4PG6A 3CIPA 1Q79A 2YKMB 4O55A 1JLFA 4WP3A 4DX5A 1C0MA 2A2DA 4X4SA 4DU8A 4U67Q 2QJ3A 2FLNA 2VB6A 4DCHA 3BEGB 1O13A 1YBAA 2MQ8A 4B1XB 3PLAA 1VBYA 4DV5J 4USVA 2XM3A 1RHUB 2BX6A 2E29A 2ZJRL 1HIYA 2KT3A 4UF4A 5CYMA 1ZPWX 2N3LA 2NRHA 3MFIA 2V52B 4NLBA 4MYUA 3UDCA 1PJ7A 1VJQA 3FE1A 1HR0F 4LUBA 3OA9A 2DD8S 1S1WA 1IKWB 4KHWA 2H4WB 2F8TA 3AGKA 3E9OA 3ZETB 5T14A 2E9TA 2PMHA 4ZCKA 3HO1A 4NCAA 1X4BA 3EZWA 4BC5A 2B4PA 3SCXA 2XLJA 2NNWA 3MPWA 4YDDB 1EB0A 3P6YC 3EY1A 2B56A 3O1WA 4OYMA 1UAXA 1GH8A 4M5MA 4AHSA 3UN2A 2DGSA 4HI1A 2AGOA 3S3OA