3MEGA

Hiv-1 k103n reverse transcriptase in complex with tmc278
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Etravirine (TMC125) and Rilpivirine (TMC278): Implications for Drug Design.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords p66 Reverse transcriptase
total genus 148
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3megA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3megA05
1S6QA 2G8WA 4CJUA 3LP1B 4FJGA 3MECB 4ICLB 1C1BA 1LWEB 4M42A 3KJVB 4MK7A 3FFIA 3MECA 3TAMA 4Q8EA 4CGFA 5KG2A 2FVRA 1ZETA 4RW7A 2HNDA 1YTAA 4I7FB 3RMBA 3L2RA 3PUFA 2YNFB 1QSSA 2C2EA 2FBXA 3MAQA 1WSFA 1S9EA 2OPQA 2Y1JA 4IG0A 4Z4CA 3F73A 2IMWP 4YQWA 3T5JA 1XHZA 4ECSA 5EUHA 1BCMA 4DSIA 4ECVA 1KFSA 3LWMA 3DLEB 4IH5A 3KMQA 5J1EA 1KSPA 1ZBHA 3ASMA 4KI4A 1IKVB 5J2PB 4ZP8A 2FJWA 4LSLA 4ED0A 2VG7B 1FKOA 2WCXA 4OL8A 5KFAA 3CFRA 1DTTB 2D41A 1S4FA 2AX0A 4O0JA 3KLIA 4DL4A 1QQCA 1CZBA 2XI2A 5F8MA 1RDAA 3DLBA 4RW4A 1CXQA 2JEGA 4Y34A 4J9KA 3BQ2A 4RW4B 2P5OA 3KK3B 4Y1DA 4ED2A 4FZZA 2KW4A 1CLQA 3HP6A 1B9FA 4RNOA 3PX6A 4E7KA 3ZT4A 4EP4A 1FKOB 2G8IA 2PY5A 4FZXC 4OVLA 5J1EB 3NGIA 3SUNA 1J54A 1SKSA 1D0EA 3L2VA 3MEGB 3H5SA 4Z4FA 2ATQA 3G6XA 5DQHA 4R5PA 3RRHA 4N47A 5JS2A 1SH3A 1NJYA 4C8NA 4AILC 3LAMA 1LWFA 5FDLB 4DS5A 1I3AA 4XPCA 4GC7A 4Z0UA 1EP4A 1JXBA 3AVJA 1JKHB 4B9UA 5KFVA 1LWCB 4ZPBA 3ICLA 2W8LA 3CDWA 4MK8A 3KLGA 2W7OA 5KT2A 4KB0A 3NBPA 3E01B 1RAJA 2UVWA 3CQ8A 4URGA 4WFXA 3PZPA 2HHSA 4U7CA 3OS1A 2UUWA 4Z4IA 5SZTA 4M3XA 3DOKB 3KLHA 4HTUA 4FM1A 3TARA 2X6NA 1IKXA 4CK1A 4E1NA 4ELTA 1K6YA 2O5DA 4GMJB 5K14A 2OA8A 3SZ2A 3SQ4A 4LD0A 1NK6A 2NUBA 3DYAB 4ZP6A 5HP1A 2F8TA 2YNIA 1S1XA 3GILA 2HW3A 4Y2CA 5CYQB 3CJ2A 2FVCA 1TAQA 3C6UB 5KFGA 5EU7A 4ED6A 3QZ7A 2I5JA 2ZD1A 1BL3A 2YHBA 3KHHA 2O4IA 1U04A 4AHVA 3HVTB 3H5YA 4CHNA 3ZSVA 3PJWA 3RMDA 3M9OB 3VQ6A 1BGXT 2FJXA 4DL7A 3L3UA 4EBDA 1BISA 4N56A 3SUPA 1S1XB 3DLGB 5I3UB 4CHZA 5KFMA 2PZSA 4DEZA 5C42A 4DTOA 1EXQA 3I0RA 4TXSA 2OZSA 2B43A 3OYAA 5KG1A 1RTIA 2IOCA 3M8PB 4CFCA 2XC9A 1XR5A 3AA5X 3AA4A 4OJRA 5C25B 3O3HA 2JEIA 2D3UA 4ECYA 3KK2A 4ZPCA 3NF6A 5KFTA 1K1QA 3OL7A 5JS1A 1TVRA 1LAVA 1T03A 2F8SA 3CJ4A 4Z4EA 4NLWA 3OSNA 3HVRA 5CYMA 1JLFA 1A5XA 1TL1B 1S0MA 1C2PA 4ZPAA 4J9LA 1N4LA 4AH9A 2XY7A 1NHVA 3AO2A 4NYNA 4HYKA 3DOLB 4NLTA 1SL2A 1U09A 3C6TB 2KTQA 1A5WA 4CJRA 2HWHA 1C6VA 3G6VA 3HPGA 3QNOA 4B9NA 2OPSA 1KRPA 4NLRA 4YNQA 2BE2A 4ZP9A 4BDYA 3IS9B 5DQGA 4DF8A 3VQCA 4CJ4A 1W9HA 4IKFA 2DY4A 3AVIA 4HUEA 2YKMB 3IG1A 3FDSA 2V0NA 4J9NA 3VQ4A 1L3SA 1JLBA 3O3FA 5KFDA 1SL1A 2FLLA 2IAJA 1S5JA 3RBDA 3OYHA 2W42A 4FM2A 5HRNA 1X9SA 1D8YA 4KHWA 3LP2B 3BJYA 2RKIB 4LSNB 3T5HA 3QIOA 2WB4A 3RTVA 3VQ8A 4KPYA 4YR0A 4H8KA 3GYNA 3NAIA 1EETA 2X74A 5J2QA 4J9RA 1JL1A 3NGDA 4MQ3A 4KHMA 3PO4A 2E6MA 3CJ0A 1IKWA 2R2RA 1TL1A 1QSYA 5KG6A 1DLOB 4CGHA 1UA1A 4JRQA 1JLAB 4KRFA 4CJ3A 4F4KA 3LALA 1W25A 1BQNB 3V6HA 4ZVEA 4LSLB 1RA6A 3LP2A 1I39A 1TV6A 4B08A 4CJVA 4ZPDA 5DLGA 1JLQA 3TAEA 2VG6B 4JLHA 3I5CA 1UAXA 3H40A 2WK4A 4O3NA 4EBCA 1ASWA 3OLAA 4FJMA 1VRTB 4KV8B 2OPPB 3QGGA 3PW5A 3N6NA 2OPQB 3LPUA 1L3UA 5KFCA 4O4GA 2EC0A 4N76A 2UUTA 3UQSA 2C22A 3GIJA 3CYMA 4FLUA 1JXEA 3GV7B 1KVCA 4DQPA 2HNDB 4M45A 1U4BA 4CGGA 2JC1A 4CEBA 4BE0A 1U48A 1HNIA 4H4OA 2RDIA 3TI0A 3TAQA 4DG1A 1Z26A 2WTFA 2IJFA 1EETB 3OSPA 2IC3A 3KKSA 3LP1A 3L8BA 4BDPA 1L3VA 2E9ZA 3D45A 2DFEA 3LP0B 3QIPB 1S1UB 2EHGA 4E1MA 1EP4B 1WSEA 3H08A 1S9FA 3V9XA 4RNHA 4FJHA 4M41A 3G86A 3NH2A 3RMCA 1XHXA 1RBVA 1RT1A 2IA6A 2IBKA 1VSKA 4ZMMA 4DTPA 1L5UA 4NCGB 3AVFA 4CERA 3NH1A 1RTHB 4FM0A 4CEDA 3RBEA 4DTXA 3SFUA 3DRSA 2ASDA 3PW4A 4FJ5A 1HQUA 3DLKA 3NF7A 5L1IA 4IFVA 4FLWA 5T14A 1TL3B 4OPKA 3NHGA 3UIQA 4OPJA 1T3NA 3LPTA 1GOBA 3PHEA 3MEDA 1ASUA 2FBYA 3K5MA 1RT5B 4F2SA 3AA2A 2ZKUA 5F9LA 2VA3A 3KHRA 5DK5A 3IGNA 1TK8A 4KHRA 5HRRA 3S3MA 4HUGA 2W9BA 5J2QB 3OHAA 4J2BA 2BQ3A 3SJJA 5FROA 4RNNA 2HHXA 3VQBA 2IM2A 3Q8QB 4EBEA 2HWIA 1TKTB 5C25A 4M3ZA 1SL0A 3V1OA 1VSEA 4WFYA 1ZBFA 4MKBA 1CSJA 3V81A 1NK4A 2R8IA 5L1KA 5C42B 4AHUA 1C0TB 1YT3A 2AGOA 2DPIA 3QESA 4RNFA 2IDOA 1SUQA 3V9WA 2UVRA 5F8LA 1X1PA 3VQDA 1SV5A 3V9ZA 2RF2B 4F4WA 4LH5A 3V4IA 3C6TA 1XWLA 3G6YA 4NYFA 4W5QA 2ILYA 2C2RA 1KHVA 3DI6A 1UWBB 1ASVA 4F3OA 1C1BB 1LWEA 5DGBA 3NDKA 3PW7A 1ZYQA 5EWEA 3ZSXA 2R8JA 5DG8A 1MU2A 4IOBA 3OYMA 3S3NA 2Z1IA 3BREA 1LWFB 4CEAA 4CJTA 3RMAA 4B9LA 4BACA 2VWJA 4EYHB 3FQLA 4F3TA 1RDDA 3AVGA 4B9VA 4FW2A 4E7LA 3BR9A 2R2TA 4MKAA 3ZCMA 1S9EB 2Z1JA 3I0RB 4DFPA 4KHUA 3SQ0A 4OLBA 5HLFB 1B92A 3IS9A 5F8JA 3WNEA 1NOZA 1K1SA 4ID5B 4FBTA 3LP0A 4H4MB 4CJEA 1W0HA 4HVJA 4W5TA 4FK0A 3RWUA 4O55A 3V9SA 4K8ZA 1KVAA 4QCLA 1XI1A 4I2QB 4XIUA 1U49A 4FJ8A 1QAIA 2XCPA 3AO3A 4KHYA 2ZD1B 1JLFB 4E89A 1S9GA 4YR2A 1TKXA 2RDJA 1N5YB 4QPXA 5KRSA 5KFWA 5FDLA 4C8MA 2FBVA 4RW9B 4FJJA 2V4QA 4G3IA 1RYRA 2AJQA 1LW2A 3FRZA 1RA7A 4PA1A 4DQIA 4BE1A 1HQEB 1VSDA 1WNEA 3HP9A 4B9MA 2GV9A 2AX1A 2WONA 3JSMB 3SUOA 4QWDA 5KTQA 3KLHB 3JYTA 3SV3A 3FSIA 5KG0A 1GOCA 4IDKA 3QNNA 1VSIA 3MFIA 3U3GA 1JLAA 5KI6A 1IKYA 5I42A 4DQRA 4BDZA 5DQIA 1JL2A 3KJVA 1XC9A 4WZQA 4B3OA 2OH2A 2I5JB 3HO1A 4OLAA 1S1VA 4C8LA 1HJRA 4FK2A 4UQGA 4O3QA 3HSTB 5DGAA 3B6OA 1TKZA 1F21A 2KFNA 4CE9A 1J5OA 4DQSA 1RBSA 4N41A 5KFFA 2IAJB 3MXMA 3H4DA 3VA0A 1C0MA 1VRUB 1JLBB 4F50A 1RTJB 1S48A 3KNAA 3HHKA 4IG0B 1D5AA 3MEGA 5HRSA 4DU1A 1RT3B 4K4WA 3M8RA 4IKAA 4CFAA 1SKWA 3N6LA 4DQQA 2YNFA 3NGYA 4DMNA 3QETA 1XR7A 3IRXA 1X9MA 4R8UB 5E41A 4LY7A 4CEQA 2ALZA 2AWZA 4KO0A 1FXXA 4RZRA 2D7SA 4O44A 5F8NA 2QK9A 3KLGB 1HPZA 4ZHRA 5D3GA 3ZT1A 4Y2AA 4PWDB 4AHRA 2QE5A 5KFHA 4IR1A 4WE1B 5CYMB 3D28A 3NKYA 2ZE2A 1S6QB 3MEEB 5HROB 4NLQA 4R8UA 4CJLA 3QGHA 2JGUA 4ZTFA 2P1JA 1QE1A 1NOYA 3H98A 3KK2B 3RR8A 2HHUA 3M9NB 1IKVA 2LSNA 4CJKA 4YMEA 4NLSA 3Q8RB 2OYQA 1XR6A 4F2RA 3IAYA 1RTIB 3OL6A 3V6DA 3MF5A 4EO8A 1IO2A 3CDEA 2UVVA 4X2BA 2JEJA 5KFRA 1J5OB 3PV8A 4ECZA 4K4SA 2GBZA 5KFEA 1HNVA 2IGIA 4AHSA 4E3SA 3V6JA 1U45A 1ITGA 1NK8A 1RT7B 4MK9A 3OYFA 4ECQA 4PY5A 4NLXA 3P5JA 1WLJA 3ZT2A 4RUAA 2OPRB 5HROA 4MIAA 4FLTA 2DTUA 3TAMB 4MFBB 2VG5B 4IH7A 3G10A 4W5OA 4ICLA 4Y3CA 4TQSA 2C28A 1FK9B 1LW0A 3SPYA 4FJIA 4DFMA 2G8FA 1RYSA 1JX4A 1VSLA 3BDPA 1RNHA 5HP1B 2XY5A 2B6AA 2GIQA 4H4MA 4IFVB 4C8OA 1BQMB 1KLMB 3U3YA 3SI6A 1S49A 4ED8A 1RT3A 2YV0X 3TANA 1IKXB 3H4BA 1LV5A 3IN5A 3CM6A 4ED3A 4RW8B 1VRUA 2HNZA 4ZVFA 3ZSQA 2UVUA 2VWKA 1R0AA 1BQMA 1KLMA 3E51A 4J2DA 5JUMA 4RNMA 3KK1A 3EZ5A 4FJNA 1D1UA 4KB7A 1TKXB 2QV6A 1S1UA 4DF4A 3LZIA 4ELUA 4BWMA 1NHUA 1Q9YA 4CEZA 4FLXA 1LAWA 3K58A 4OKKA 4CECA 1HPZB 4KSEB 4ZHRB 5D3GB 2BANB 2QKBA 2B5JA 4ZP7A 3PJXA 2R7YA 3LWLA 2ASLA 2FC0A 4M3TA 1T94A 1UOCA 3ZSYA 5KT4A 4O4RA 4NLPA 2HB5A 3BQ0A 2YNHA 4ED7A 4FJXA 4RUCA 4M3WA 3KLVA 4O4GB 4I9QA 3O3GA 3VQSA 1RCHA 1JLCB 2WONB 4K50A 4F4YA 5DG9A 1N48A 4DU4A 2XY6A 3GV8B 1U47A 2R8GA 3CFPA 3SQ2A 2HHTA 2P5GA 1KCFA 3ZT0A 3OYKA 1REVB 3T3FA 4M95A 1LW2B 4HCBA 4K8XA 1JLQB 3NAHA 1VSHA 2HVIA 2G8VA 1KVBA 1B9DA 3VQPA 3QEIA 5KFSA 4JS4A 3PR5B 2ZE2B 3MEEA 1NK7A 3K57A 4TLRA 4PQUA 1KLNA 4DTMA 1T8EA 4E0DA 1RBUA 5F8HA 4PQUB 1Z4UA 3QERA 3CJ3A 2IM0A 2AQ4A 3H59A 3IGVA 3UPFA 3BSCA 2A1RA 4NRUA 4LH4A 3ITHB 3KMSA 3V6KA 3OYBA 3LZJA 3RRGA 4LSNA 1G15A 1JLEA 2RKIA 2WHOA 3PY8A 4DSFA 4CFBA 3QO9A 3HK2A 1JLGB 4AHCA 2VA2A 2BRLA 5KFBA 1JXLA 4G1QA 3NH0A 2R8HA 4OKJA 1RTDA 4KTQA 4NLDA 2QXFA 2HHQA 3TVKA 5FRNA 4YFUA 3HL8A 1N5YA 4QWAA 4ECTA 4ED1A 3HXMA 3OL9A 2X78A 3ISNC 4WE1A 1CXUA 5HRPA 2ATLA 2HNYA 3FFIB 1SH0A 2BGGA 3L2QA 4KE5A 4TY8A 4DG1B 3BSOA 4FVMA 2V4RA 1J53A 1IKYB 5J2MA 1WSIA 4IFYB 3OYGA 1TL3A 1O1WA 4EP5A 1S1WB 1IH7A 2V9WA 4CF1A 4FLYA 1T03B 1SKRA 3JYTB 2DFFA 3K5NA 1S6PA 4ECRA 1NJZA 3LAKA 3C94A 4KTZA 4E7JA 1IG9A 1C0TA 5KRTA 1HMVA 3AVKA 2YKNB 3AVHA 1BIZA 3NCIA 3QEXA 1TAUA 1N6QB 3EZUA 1TV6B 1GX5A 3PO5A 1BI4B 4DLGA 3QLHA 3MR5A 5DLFA 3DLGA 2W9AA 3SUQA 3GV5B 1ZBUA 5L1LA 2IM1A 4FS2A 1FK9A 1LW0B 1HYSA 4DTJA 1C0UB 1S1VB 4DU3A 2IC3B 3OHBA 4KHSA 4KHNA 4FW1A 5C24A 5KFPA 3DI6B 2BQRA 4C8KA 4DSKA 4H4OB 1HNIB 4O3RA 4FLZA 3TAPA 2AGQA 2OPRA 3RR7A 1Y97A 4FK4A 3MEDB 4MH8A 4HKQA 1QUVA 5KFYA 2RF2A 4QWEA 2OZMA 3KOAA 4DSEA 2YNGA 5L1JA 3HM9A 4K4XA 4CFDA 2R8KA 5C5JA 3CO9A 4NZ0A 4O3PA 4TY9A 5HBMA 3AA3A 3DMJA 1BHLA 4HCCA 2OPPA 4DTRA 1NK5A 3KTQA 4B8AB 4KREA 4ZVHA 3V81B 1RT4B 3CFOA 2VG6A 3DDKA 1S1TB 1VSFA 4IG3B 3ALYA 4RG8A 2HMIA 3RB0A 3M8QB 4EEYA 3CG7A 1RT2A 1S6PB 1YVFA 3V1RA 3EYZA 2BE2B 4TN2A 4CJSA 2FVPA 1S9GB 2BRKA 4NCAA 3VQQA 4B8CA 2BR0A 5T7BA 2W9BB 4CJFA 3DM2B 2KZMA 3N6MA 3NBPB 1UWBA 4FJ7A 3HPOA 4KO0B 4URSA 3K2PA 2KZZA 2EX3A 4O5BA 5F9NA 2O4GA 3ULDA 1VSJA 4QW8A 3KD5E 4IQXA 1QS4A 4FJKA 1QHTA 2ITGA 3DRSB 2D0AA 4QWCA 1SUQB 1RT2B 1RTDB 1X9WA 4DFKA 5KFJA 4DTNA 2WRMA 2ETJA 4ID1A 4J2AA 4GC6A 3VQ9A 4J2EA 4N5SA 4KV8A 2AGPA 1S1TA 4IBNA 3NAEA 1RT1B 4Q5VA 3SI8A 3IG1B 3A2FA 1N56A 1OS5A 5KG4A 3TABA 4DTSA 3ISND 2XHBA 5HBMB 3AO4A 3PX4A 1TKDA 5KT3A 5KG3A 1BQNA 2OPSB 1S97A 4CHQA 3D0PA 4ECUA 5KGXA 1D9DA 3UDLA 4CHPA 3QGIA 3VQEA 4CIGA 2XRIA 3DOLA 3BQ1A 1J9AA 1NKCA 4FZYA 1EKEA 5C24B 3KIOA 3KLEB 4FBUA 3OVNA 3BGRB 3SPZA 1T05B 3C6UA 3VQ7A 4GVMA 5EDWA 3PW0A 4CEOA 1SV5B 4ECXA 4K4TA 1HARA 2B4JA 4IRKA 3I0SA 2VG7A 3T1AA 3JSMA 4TYAA 4KTWA 4DSJA 3M8QA 4FJLA 3MFHA 4PUOA 1NKEA 1HRHA 2XO7A 4IR9A 1RT4A 4NCGA 3M8PA 3DLHA 3PVXA 3AVNA 2YKNA 3DMJB 1UA0A 1HMVB 3OYIA 4FCYA 3VN5A 2AU0A 3BSAA 1TQLA 5I3UA 3EPGA 1D9FA 1WSJA 3H2LA 5CY4A 3OS2A 5F8IA 4M3UA 1EX4A 3PW2A 1S1WA 5KFZA 4RW6B 3CIZA 3KLEA 1RDRA 5F8GA 3VQ5A 5KFIA 2CKWA 4FYDA 4I9LA 2J6SA 1IKWB 3SCXA 2ZQBA 3L3VA 2C2DA 1RT5A 3ZSRA 1WNSA 3GIIA 4CJPA 2YHAA 4CJ5A 4WFZA 4U6PA 1NJWA 3RB4A 3DLKB 4L8RB 3PX0A 4DFJA 4KAZA 2GC8A 3MXJA 3VQAA 3SQ1A 1N6QA 4ZVGA 4IRCA 3DRRA 4XO0A 4NLOA 3TQ1A 4G1QB 3DRRB 1GX6A 2D5RA 2G8UA 4F4XA 2IM3A 3QO9B 3OLBA 3HPHA 4PUOB 5FRMA 1NK9A 4K4UA 2Y1IA 3QIPA 3LANA 4H54A 4NLYA 1JIHA 3NF8A 2JC0A 3BGRA 2D0CA 2R2SA 3NL0A 4O3SA 4CF0A 4JS5A 4XPEA 4GW6A 4IH6A 4M3RA 2HNYB 4B9SA 3MR3A 3H5XA 4ECWA 4DL6A 3PR4A 1FKPA 2GUIA 4FXDA 1SH2A 5EWGA 3WNHA 3KLIB 4DWIA 1DTTA 4DSLA 3D5MA 3NMAA 2G8KA 3DRPB 2DPJA 2FLNA 1HNVB 2KFZA 2HMIB 4J9SA 2CJQA 2FLPA 4Q45A 4JUZA 4M3YA 3DLEA 2IJNA 1VRTA 4Q0BB 1WN7A 3HKWA 3M8SA 3QEPA 3GQCA 2P51A 1VSMA 3K5OA 2HHVA 2YKMA 4TQRA 5KFLA 1BCOA 3QINA 1NJXA 4JV2A 3QEVA 3I0SB 3O4NA 4CCHA 3HVWA 4QW9A 4FLVA 1S10A 3I8DA 1T05A 3V9UA 2X6SA 3KD1E 4I7FA 1FKPB 1GOAA 1VK0A 2W9CB 4Q43A 1DLOA 4KI6A 2Z1GA 5J2MB 1WSGA 4ZTJA 4QOZB 1C1CA 3HVTA 3MR6A 1S0OA 4CIEA 1NK0A 4DL3A 4JV0A 3HJFA 4TY8B 4CEEA 3TAGA 2E4LA 3OYJA 3DM2A 3GIMA 1C0UA 4RU9A 1RT6B 1CZ9A 4KKOB 5CYQA 3MTKA 1LWCA 3Q8PB 3V1QA 3WNFA 3AVLA 1JKHA 3NE6A 3IRXB 1HQUB 3QLHB 1RBTA 3OJUA 2RN2A 5KGWA 4DTUA 3KK1B 3RAQA 3AO5A 4CEFA 1IM4A 3CVKA 5K14B 1REVA 3VA3A 1QTMA 3SYZA 1I6JA 3RB6A 3CWJA 4LQ3A 3CJ5A 2HAIA 4B9TA 2FVQA 1TP7A 4NYZA 5KFNA 1RTJA 2F96A 3DOKA 5CZ2A 1RDCA 3M9MB 1TKZB 2YNGB 2FJVA 3TWHA 1C1AA 3S9HA 1QAJA 4CF2A 5J2NA 4NRTA 4CHYA 4Q8FA 3EY1A 4B3OB 4WXOA 5KFUA 4HUFA 1S0NA 4Y1CA 4RW6A 3EPIA 1Q8IA 3ZSZA 5CZ1A 3UR0A 3K59A 1ZTTA 3OY9A 2BQUA 3GIKA 3ZSOA 4E7IA 4EO6A 3NGZA 4IDKB 1MMLA 4CK2A 3AVAA 3DYAA 2XI3A 3B6PA 4CGJA 3K5LA 4NLUA 1NKBA 2HNZB 4R5PB 2JLEA 4URQU 4K4VA 3DLRA 4Z4HA 4KFBB 5KT7A 1ZBIA 3KHLA 5EWFA 3V6DB 4QWBA 5KFOA 4WXWA 3AV9A 3LP3A 2PYLA 4KFBA 3P83D 1TK5A 1JLCA 3OYDA 3T5KA 2FBTA 2YNHB 1ZTWA 5KFQA 2ASJA 4BE2A 5KG5A 4NCBA 3HYFA 3I5BA 3FQKA 4RW7B 3KLFA 1KFDA 5KFXA 3OYNA 2I1RA 1WSHA 3KK3A 3SFGA 4O0IA 2ILZA 4HHTA 3H5UA 2XWYA 2JEFA 2HVHA 2B5JB 2E9RX 4TSXA 4R0EA 2KQ2A 4F8RA 1HYSB 3CDUA 1Q9XA 2XGQA 3RB3A 4EZ6A 5DMRA 4OKEA 2A1SA 4OGCA 2YNIB 1RT7A 1HYVA 4JV1A 3QIDA 4DS4A 5SWMA 1ZBLA 5J2PA 4CGIA 4CK3A 1R0AB 4OGEA 5HLFA 5DG7A 4JRPA 1RDBA 4EYIB 4F4ZA 3U6FA 3RAXA 1RILA 1YTUA 2W7PA 4I2PA 1Z25A 4YR3A 2DFHA 4M94A 4BWJA 4I2PB 3T5LA 1DTQB 2J6UA 2R2UA 5KT6A 2J6TA 3SV4A 1QE1B 4EZ9A 4FJ9A 3I5AA 4IFYA 3QYYA 2HHWA 3AVBA 4W5NA 2WOMB 4KKOA 3E01A 1RT6A 3OS0A 3HVAA 4NLVA 2D0BA 3THVA 3G0ZA 1T7PA 3MR2A 3C95A 2G8HA 4DLEA 2VG5A 4CJWA 1C1CB 2BDPA 4ELVA 4KHQA 3L2UA 4K4ZA 5L9XA 3O4QA 3KLFB 3AO1A 4O3OA 2W9CA 1TVRB 3V4IB 4MIBA 1KTQA 3ZSWA 3ZT3A 1DTQA 3KHGA 3MXIA 4IG3A 2XY8A 2E9TA 2QKKA 3AVMA 3AVCA 1HQEA 4DL5A 2RPIA 1RBRA 1JLGA 4QAGA 4W5RA 3LDSA 3P1GA 4Q0BA 3OYLA 3NF9A 1QSLA 3S3OA 3NFAA 4WYWA 1JLEB 2E6LA 4LQ9A 4DL2A 4TYBA 3TR8A 1KHWA 4J9MA 1TKTA 4RW9A 3ITHA 3DRPA 2B6AB 4NLGA 2XGPA 4Q44A 5KFKA 3KKRA 2GIRA 4FS1A 2Q3SA 4E7HA 1TGOA 4PWDA 4CF9A 4J9PA 1HYZA 1WAJA 4MFBA 4CIFA 2BANA 3TAFA 3OJSA 4AHTA 4O44B 5I42B 3L2WA 4I2QA 4YP3A 5J2NB 5KT5A 4IRDA 1YVUA 4E19A 2WOMA 2Z1HA 4KB1A 2PYJA 4CGDA 3QEWA 4CF8A 4WYLA 1NNDA 3F9KA 4WZMA 1BI4A 3OYCA 4ID5A 4KAIA 4J9QA 1WAFA 3SNNA 1BIUA 5JXSA 4Z4GA 2F8EX 3OL8A 4CHOA 3CM5A 2IS3A 1RTHA 2D3ZA 3WNGA 4K4YA 4RW8A 3BSNA 1TK0A 3QZ8A 3HT3A 4J9OA 1A5VA 3Q8SB 1L3TA 5KG7A 3T19A 4KBIA 4CESA 2FVSA 4CJQA 3OYEA 2XCAA 2W8KA 1MU2B
chains in the Genus database with same CATH superfamily
1S6QA 1BWEA 3S7RA 2IVOA 4CJUA 3LP1B 3MM5B 4ICLB 4LF8K 1FTRA 4I6YA 3Q23A 5LT5A 4X4RA 3IC1A 2R7UA 1YTAA 3SSRA 1V4SA 1QSSA 5BYRA 5B0DA 4GKJF 2C2EA 3BZQA 3RSEB 4G65A 4CZIA 3U8XA 4EMDA 2KT3A 4FF4A 5GAGP 4IG0A 2VD3A 3BY5A 2EI5A 4JI4K 3G82A 3DLEB 2XMAA 3KMQA 4CZEA 1IKVB 4ZP8A 3EICA 1FKOA 1YBAA 2WCXA 2QT7A 5KFAA 2ZH4A 3VAMA 2BJ1A 2CA9A 3FSXA 5LM7E 3GL1A 1QQCA 1CZBA 2DHHA 2ZC4A 1CXQA 4Z2XA 4M5HA 5LSRA 2DGTA 2Q36A 3BQ2A 4Y1DA 2KW4A 1N0VC 1CLQA 1R59O 4YEAA 1DURA 1B9FA 4K42A 1X3MA 3KUGA 1F3VA 1NDLA 5I4MA 1FKOB 2G8IA 3HHLD 2E5LF 4FZXC 3PIOQ 3VGSA 1J54A 1JJ2M 3L2VA 4LRDA 3MEGB 4WPAA 4DV7J 4OZ0A 1FA0A 5JS2A 4CT9A 3LAMA 1LWFA 5FDLB 1I3AA 1QD1A 3CE8A 1EP4A 1JXBA 3AVJA 1P27B 1JKHB 5U47A 2G0CA 2YPYA 1YJUA 3CDWA 4MK8A 1TYQB 5CH7B 3MX2A 1RAJA 2UVWA 3CQ8A 2VFTA 3IFEA 4DV5K 3NS5A 4FZVA 3UD3P 2BTFA 3N4PA 3OS1A 2F40A 3OXGA 2XYHB 4CO0A 2UUWA 2HHPA 2A2DA 1KVKA 5SZTA 4CLKA 3CCRN 4CLTA 4HACA 1ZM3A 4K7QA 3A3NB 1KP6A 5K14A 2B4UA 2VASA 3SQ4A 1NK6A 4OHZA 3W2WB 1VQNS 3KWIA 3M3ZA 3EX7B 1YJWN 4Y2CA 5CYQB 1RWKB 2FVCA 2IBOA 4PWUA 5KFGA 3QWUA 8AT1B 5HVHA 4LF6J 3QZ7A 2MKCA 3MM9A 1MROA 2NLWA 1D4XA 3M9OB 1HD1A 4CZLA 4OI2A 2DGSA 4DL7A 2ZEJA 4LRAA 3L3UA 2E5HA 1OH5A 2Y1RI 3P5TL 2QL7B 1W97L 4BR5A 4OPAA 2ITMA 1TL4A 5C42A 1E6YB 2IA0A 3I0RA 5FJ4A 3AJ1A 5KG1A 1NDPA 3OBIA 5A2QU 3DXSX 2O8CA 4DV1K 4OJRA 3TO8A 4RBUA 1S6UA 2GFFA 2D3UA 3G8SA 4ECYA 2QMWA 2W2PP 1Y3KA 1KQFB 3EE3A 5KFTA 1E4FT 2KH9A 1TVRA 3CJ4A 4Z4EA 1H1VA 3UN3A 1RWNB 3QICA 1T0TV 1JLFA 4YY3J 4A46A 1S0MA 4JI8J 2PMHA 4ZPAA 1N4LA 4DV0F 4CJ7A 1FXRA 4AH9A 1C0GA 3D2FA 4HYKA 2PE8A 7FD1A 3O8MA 1A5WA 3G6VA 2V8DA 1AT1B 4NLRA 2BE2A 4BDYA 2ATCB 2I8EA 3IG1A 2HGLA 2V0NA 3FDSA 4PZVA 3VQ4A 1M90O 1L3SA 1JLBA 3O3FA 2W2NP 5KFDA 3MMCA 4ATNA 1SL1A 3NGTA 2FLLA 1XBWA 3EMTA 4KYZA 2V50A 4YS2A 2W42A 3BJYA 4FWOA 3TTDA 2GW8A 4I0WA 4NYPA 2PFUA 1HKBA 3MN7A 3QIOA 3D3BJ 3VQ8A 2KVIA 3MMAA 4AQYK 3SMPA 4MT1A 2F4VK 3PYEA 3QGPA 2R7RA 2X74A 2VIHA 2V69A 3CCQN 4NL5A 2ZOGA 3S6EA 1EKSA 1CJTA 2NRTA 3D6FB 1QSYA 1U1OA 1NH7A 2GVZB 3HMJG 3UDEA 2GO8A 4HWIA 4KRFA 2ZH1A 1R8HA 3SCIE 3V6HA 2GVDA 1IUJA 1XC3A 1I39A 1TU0B 1RHQB 3I5CA 2WK4A 5HVGA 3J7YP 1ASWA 2WVEA 4HI1A 1TL5A 2I7PA 3PW5A 3N6NA 4JI7J 3ZX2A 1YBUA 2MKHA 4XAKA 3QRRA 4X65F 4F02A 4WCEL 1UP1A 3U1MA 3AH6A 4X62F 3BGFA 4DQ8A 3LDQA 4DCPB 3ZZPA 2RRNA 2DR8A 1BA1A 5L39A 1F60B 1SVDA 1U4BA 4X4PA 1NRKA 5G0RB 1HNIA 3RVCA 3QFUA 5DRKA 2RDIA 1VRQC 2YVSA 4DG1A 2K7JA 5HO4A 1Z26A 2L9WA 3EGNA 4ZVQB 3HHLB 3C6AA 3I55N 3KKSA 5M2UA 4ILHA 3L8BA 2HWTA 5GAEI 4BDPA 2UYTA 3FJ2A 3D45A 3LP0B 2QWOA 3R9PA 3PNIA 2EHGA 3OR1B 3QJLA 4BR2A 1VLOA 3EUNA 3N01A 3HF5A 3UO0A 1XHXA 1F2HA 5HAOA 1RT1A 3HJVA 1LFPA 2RILA 3OD2A 2IBKA 4OYMA 4JI7F 2P9IB 2LU1A 2VF3A 3MPWA 1EO1A 1RTHB 3RBEA 2BH1A 3DLKA 2R7WA 3NF7A 3CJ7A 5L1IA 4IFVA 2BZ2A 2NYHA 4RWXA 4DPUA 1X5PA 4OPJA 1AFIA 3NVMA 3MEDA 3ETOA 3OT9A 3K5MA 3EDRB 3AA2A 5DM6L 4PR6A 1HLUA 2VA3A 3IGNA 3IAM9 3Q0AA 1J6ZA 4HUGA 4J2BA 1CC8A 1UAWA 4KIAA 5AQHA 2VKZG 3AAWB 2HWIA 3C46A 5K8MA 4JI0J 1SL0A 4RR5A 4FOEA 5BRDA 1ZBFA 2CNLB 4MKBA 2DNRA 2ROPA 3D4JA 3IM9A 3TUIC 4WQ4C 5C42B 3IBWA 4DXLA 3BO3A 1YT3A 2DNPA 2AGOA 2IDOA 1WDTA 4ZS6A 3ZXWA 4GKJJ 5HOOA 2UVRA 2V63A 5F8LA 1X1PA 2KLAA 3OFHA 1EB0A 2RF2B 4F4WA 4K2XA 4RCHA 1HX1A 2NNWA 1GK8A 1XWLA 3G6YA 1H2TZ 1LWXA 4NYFA 1OIAA 3TA2A 2N82B 3OXFA 4TNOA 3DI6A 2C3UA 1I94J 1ASVA 5DGBA 3NDKA 3BKUA 4ED4A 1MG7A 1RAOA 1NNEA 1NDCA 4GO5X 2BABA 2IVNA 1O0PA 4JI0F 5A8KA 4FYVB 5K9FA 1MDUB 4ZVSB 1RWXB 1LWFB 2HF3A 3FEYB 1N5VA 5FLXY 3OUYB 2AW0A 2HQIA 2DGWA 4B9LA 3CB4A 4BACA 2MMYA 5M1NA 2VU5A 2XS2A 1RDDA 4B3RF 1B99A 4E7LA 3I9ZA 2R2TA 2Z1JA 4BVPA 2HQCA 3RRKA 4OLBA 1GMWA 1URRA 1J5EJ 3ZTQA 5M2RA 3WNEA 1NMNA 2Q2RA 1PIEA 1RZMA 2KU7A 4XTTA 2HSTA 5CZVA 4QCLA 5HK4A 2BOPA 4PKHA 4XIUA 3TA0A 1NWKA 1IWGA 2ERRA 1V5VA 3AO3A 2ZD1B 2VODA 4GY2B 2HZCA 3CT9A 3A5OC 1GTHA 1TKXA 1N5YB 3GG4A 4X66J 3SCKE 3L7PA 4QPXA 4ZJQA 5M1PA 5FDLA 4C8MA 1RACB 4LF9K 5IZHA 1ITPA 2CDRB 2MQPA 4FJJA 4G3IA 1N32K 1HNWK 3FRZA 1RA7A 1XMQF 4PA1A 3PLAA 3QRQA 1APSA 3AY9A 1TMJA 3TRGA 2MSSA 1WTFA 4IO9Q 5I3PA 1O13A 3HFZB 3MAAB 3SUOA 1S7HA 4QWDA 3H0PA 4H4KA 4TU7A 3KLHB 4IOXA 4RUHA 3FSIA 1WSVA 2G2OA 3MFIA 3EO3A 2BJ9A 2NZCA 3X1LB 4CO4A 2P9SA 5DDQC 1A7GE 4BDZA 4GKKF 4YHHJ 3QB0A 2MSTA 1SC3B 4WZQA 2I5JB 1MN7A 2V2VA 1OQ6A 3Q7BA 1UVIA 2P6SA 4TU8A 3B6OA 1TKZA 4J91A 3Q89A 3NWRA 4FYYB 3D0IE 3IR6B 1WHXA 1RBSA 4DQSA 4F3MA 3MXMA 2UXDK 4ZLLA 4PL7A 4CLLA 2GMHA 2R7VA 5LY3A 2VYPA 4IG0B 4LF2A 4B17A 2DKOB 1KQGB 3ZEUB 2VH7A 4K4WA 4B1VA 3NGYA 1MWYA 2PI5A 4FVUA 1X9MA 2MGZA 1GLLO 3AD9C 3T69A 1FXXA 4NPOA 4RZRA 1SJ4P 3K7RA 4O44A 3K2YA 4OHWA 1DHMA 5D3GA 4I56A 1BXNA 3MM5A 3ZT1A 1HWKA 3MM8B 4AHRA 3D28A 3MEEB 1S6QB 3DN9A 4K5SA 3QT5A 3M2UB 4X64J 4NXMJ 3P49B 1P9YA 1QE1A 1MMDA 3RR8A 2VFRA 3M9NB 2ZVIA 3UD4P 4CJKA 3LDPA 3P4IA 2OYQA 2PMZD 3IAYA 4NEZA 3R2DJ 1OY9A 4DCOB 3MF5A 2FSNA 3PSFA 2UVVA 2E66A 3M2VA 3MAHA 5IS2A 2IYGA 4L76A 5KFEA 1FWLA 2IGIA 2HLUA 3UCUP 1RUSA 3TJ9A 1HL6A 1RT7B 1U2RA 4MK9A 3OYFA 4GKJK 2Q79A 2NXEA 3P5JA 1KC8O 2EG1A 3T1HF 3W5XA 3UCZP 4AQYJ 2DTUA 1REGX 3UN5A 1B7YB 4DZDA 3MN6A 2RH3A 3AB2B 3QSYB 3G10A 4W5OA 2ZH3A 1U1PA 1WHYA 3VF0B 1NBWA 1PJ6A 2QI2A 4RWTA 4A2BA 1URNA 2B6AA 2GIQA 2CNKB 4C8OA 3BH7B 1KLMB 3SI6A 1C4CA 5D0GA 1RT3A 3D6TB 3WXLA 2YV0X 3TANA 3TZZA 5F0UA 3IN5A 3ZSQA 1RAHB 1FNMA 1R0AA 4BRPA 1KLMA 3E51A 4D3GA 4J2DA 2P9NA 5BR8K 4FJNA 5AQSA 3OTDA 1D1UA 4KB7A 2FC9A 4RTFD 5IWAK 2UZAA 4ELUA 1NHUA 5C7PA 4CEZA 1VQOS 1LAWA 3K58A 1KWMA 3SSSA 1PAEX 2E29A 4DJBA 1DJ0A 2B5JA 2QKBA 4OZ1A 5GADP 2R7YA 1U6ZA 5GADI 5IM0A 2WSCC 1HNXK 4DR1J 4FF3A 3NY0A 3AD8C 4M3TA 1W2IA 2MQMA 1UOCA 3ZSYA 3MMVA 3HM8A 5KT4A 4O4RA 3CJCA 5BR8J 1TR0A 9ATCB 3TX0A 3BQ0A 4FJXA 4RUCA 4M3WA 3KLVA 4O4GB 3KG0A 5IT9O 2O3DA 3O3GA 3VQSA 4I9QA 4EAHD 4OYXA 1YZ6A 1ESVA 3T3FA 3IFRA 2OANA 3VGLA 3FZBA 3QT7A 2P9LB 3NAHA 2QZ8A 1MWKA 2Z2MA 2G8VA 5EXWA 3QEIA 1RISA 1FRMA 3MEEA 3K17A 2UXDJ 2VQEK 2EFQA 3UKUB 1VQ5N 1RBUA 3B4DA 4CYUA 2Y1LB 1NXIA 5ELZA 3OBYA 2GTDA 2IM0A 3GYGA 1QVGR 2KKZA 3I33A 4DR7F 3IGVA 3BV8A 2CH6A 1JB0C 3I55S 3O80A 4CM2A 2RUSA 1WORA 2BM0A 4NRUA 1OYDA 2DY9A 3OTOF 2V34A 1G15A 1JLEA 2KYXA 3PY8A 4LFCJ 5H1SV 1G7CB 3FRYA 1WBBA 4AHCA 3EWGA 5LJ3Y 1KD1T 3T6BA 4DCJB 1RTDA 4KTQA 2P9UA 4CTAB 3G71S 4DBQA 2UUAK 5ETKA 2ZGYA 3HXMA 4A8OA 2X78A 4OYAA 4P2SA 2HNYA 3AGRA 4J37A 1VJQA 1ZC6A 4PKDB 2M4MA 4NA3A 2Z2LA 3MN5A 4DV5J 5GADU 4A61A 4QZVB 5KQDA 3LDNA 1TL3A 4Y65A 3R6GB 3GFXA 4AXIA 3GMGA 3SMZA 3IDHA 2V52B 3CDAA 1I3OB 1IG9A 2IDEA 4Y6IA 2IRXA 3AVHA 5TKWA 3HZEA 4IOCL 1U26A 1RWPB 4N8NA 1S57A 1TAUA 3QEXA 3CCMS 2ZM6J 2E1CA 2AD9A 4XH1A 1GX5A 3PO5A 1BI4B 4P2MA 2DHSA 5LMUJ 3MR5A 4JV5K 4QOTA 3QQCD 2HS3A 4DPYA 2VL1A 2V51B 3NNCA 1FK9A 1LW0B 1HYSA 5AQOA 1C0UB 1KQKA 2IC3B 3OHBA 5A8WA 4DDFA 2HS4A 4EHTA 3NLCA 4C8KA 3AARA 4FLZA 1K9MO 3TAPA 2VGNA 1VQYA 3MMJA 2DB1A 1MSWD 3N0VA 1VQLN 4MDAA 3QATA 4BQLA 2V94A 5L1JA 4UOCA 2VPXB 2R8KA 1P9QC 2JDJA 2MHEA 2MXYA 2OPPA 4O0NA 1NK5A 2YQ1A 1RT4B 1IR1A 3CFOA 2VG6A 3DDKA 1VSFA 1BG3A 2IVPA 3A8KA 3W5YA 3R9LA 3HFVA 1YVFA 3QWPA 2F9TA 3R7NB 1HNXF 2BRKA 4NCAA 1DGKN 1M5VC 2ASMA 2DGVA 3AB4B 5T7BA 3MDQA 4Y00A 4CJFA 5IT0A 5ETRA 3N6MA 5A6PA 2XMJA 4DR4F 2HG4A 4URSA 2KZZA 2BJDA 1IBLK 2EX3A 4QQBA 1L3KA 2BM1A 1HW8A 4QW8A 2QJ3A 1QS4A 4H0PA 2ITGA 3R3LA 3DRSB 4QWCA 1IJJA 3Q7CA 4DFKA 4M5IA 3MM7A 4CBXA 2WRMA 2ETJA 4KV8A 1S1TA 1R27B 3SI8A 3C7NB 4RJVA 5AQFA 2H5JB 1OS5A 5KG4A 3TABA 2F8MA 5IV3A 3IBFB 3AO4A 2Q66A 1CLFA 2A3ZA 5DJBA 2PT0A 1AUDA 1BQNA 1EQ0A 1S97A 2XLKA 3GJSB 4CHPA 1OH7A 2A3JA 3VQEA 1CJKA 2FHOB 4CIGA 2XRIA 3DOLA 1NKCA 3CCLN 1SB6A 4IO9L 1EKEA 3RG6A 5A0YA 2VBZA 3VZHA 4USKA 4MAKA 2RRAA 3SPZA 2J8SA 4YOVA 3M6XA 4CIOA 4GVMA 3PW0A 4ECXA 4K4TA 1IBKF 2B4JA 2QTDA 4LR8A 4KRWA 5E3CA 3M8QA 3O2IA 2WSFC 4NOHA 1OPZA 2Z2ZA 4J9VA 4W92B 3FBBA 2N3OA 5DZ6A 3VZIA 3Q2TC 4NI2A 4IR9A 4A47A 3AGKA 2YKNA 4JI7K 3C2PA 4FCYA 4DV7F 2W4PA 3BSAA 1QQMA 1VQ4N 1D9FA 5F41A 4OJ3A 3AAQA 3M8WA 5F0XA 4YDUA 4WF9L 2PEHA 3VALA 3VQ5A 5GAHP 1Q86O 4I9LA 1IKWB 2ZQBA 4JK9A 2DO4A 4DR3F 4ZA1A 4BRQA 4F7VA 4IZ9A 1Q8LA 4QJVA 4IXCA 4DR3J 4U6PA 3FNNA 3RB4A 5I9EB 3DLKB 5A76A 4KAZA 3QJJA 2O8DB 1JJCB 1V6HA 3SQ1A 4HT7A 1QVGM 3MURP 1PBUA 4IRCA 2M88A 1U0SA 2E5IA 2Y8YA 4G1QB 3DRRB 1GX6A 2D5RA 2G8UA 1RHKB 3SDEB 2DR5A 1GLJO 4K4UA 1VIXA 2DGXA 1M5KC 4AYBD 1RCXB 4DU8A 2Q97A 3BKFA 2D0CA 2EFPA 2Y0SD 3LDLA 5JLFA 5FLXO 2PFDA 4KC5A 3FBEA 5G0RA 1CJUB 1U2FA 1Y5LB 1NDKA 2GEMA 1UW4A 3WX4A 3H5XA 4DL6A 3PR4A 3NVKA 1FKPA 3ENBA 2E5JA 3KLIB 3P5BP 2I38A 2G8KA 2FLNA 1HNVB 3M8YA 4Q0BB 3MMCB 1WACA 1YIJS 2P51A 2HHVA 1WG4A 4BHQA 1OJ4A 5KFLA 2V2ZA 2DXDA 4JHDA 4KGMA 4CCHA 2J5AA 3FZMA 4FLVA 3DNCA 2B7CB 4I7FA 1FKPB 2W9CB 1RXOB 5ETTA 2XSJA 1VQPS 2HFNA 1WSGA 1M1HA 4ZTJA 3MHYA 2PA3A 3UVJA 1Q81O 3A12A 3HVTA 4Q7AA 1VQ8S 4JV0A 4TY8B 5ETVA 4F04B 3GG0A 4CLPA 3WXKA 2IVMA 3GIMA 2P9KB 5JVGL 5HJYA 1VMBA 1SIWB 4IEEA 3PACA 3MTKA 3Q8PB 5E0OA 2YY3A 3VAFA 4A8QA 3QBXA 3SCLE 2RN2A 4DTUA 3KK1B 2UUAJ 3RAQA 1IM4A 3NCPA 4B3RJ 1J27A 3H8YA 4PKIA 4B1UB 1NPKA 3SYZA 1I6JA 3RB6A 4LQ3A 3VETA 3CJ5A 1TP7A 3J7Z5 5KFNA 1J5EF 1RTJA 3O1LA 3W64A 2XHCA 1OY6A 3IAS9 3DOKA 2MQNA 3UD5A 4ISFA 3M9MB 3HCXA 2EKNA 3DC2A 4DU7A 3GJQB 3S8SA 1OKJA 2YNGB 2OELA 2FJVA 3WXIA 3TWHA 1G99A 4NRTA 2E1ZA 4D3HA 3UFCX 4AL5A 1ZH5A 2Z8QA 1FDDA 4Z7YA 2ZHAA 2F1FA 4ZN1A 3CJTA 2WB1D 1OVQA 3ZSZA 1EKRA 4AF1A 3A3PB 3K59A 2BQUA 3ZSOA 1MMLA 4YOXA 3MMBA 4ILMA 2V4JB 4NLUA 2C3OA 2RS2A 1GLEG 1NKBA 1IQZA 3SQGA 4R5PB 1TUGB 4K4VA 3ONQA 5AQQA 2OLWA 1RAAB 1E6YA 3O4WA 1AW0A 1YX2A 2GHVC 2G0JA 1WC0A 2EBGA 4DR3K 3A8IA 1OY8A 2FBTA 2EPIA 2AYMA 3MUTP 4BE2A 3TNVA 4PAAA 2DD8S 4NCBA 2CJKA 3I5BA 1Q8KA 1WSHA 1GQEA 1A6LA 3P39A 1OQ3A 2SXLA 2ZITA 4M5NA 3AAPA 4W90B 1ZBSA 1HR0K 1YRTA 5LMUF 2R9LA 1FRIA 3D2EA 2F5GA 2B8PA 3ENHA 4OGCA 3NOCA 4A62A 1HYVA 5AE2A 3VEWA 2QA2A 5J2PA 1O8BA 1DAXA 1PAUB 5DG7A 2FHJA 3U6FA 3RAXA 1WC3A 3K8WA 1YXQA 2DEIA 1WHVA 4CZCA 1X9JA 2R2UA 2J8AA 2Q31A 1IR0A 1VK8A 2NLXA 3VAIA 2HHWA 3AVBA 4JKAA 4FWQA 3I9V9 2JHEA 4ISEA 3HVAA 4NLVA 4B3TK 5CABA 4U9RA 3ENOA 3C95A 2VG5A 4DUZJ 3L2UA 3J7ZT 2IPOB 4Y2KA 5L9XA 2XSJB 3O4QA 4E1JA 2W9CA 4OI3A 3V4IB 1UKUA 4BRMA 5IT9Y 4OYBA 1DQAA 3CSKA 3ZT3A 5GAHI 1OMSA 2E9TA 4DV7K 3AVCA 1U24A 2XTJP 5JVHQ 4C7QA 4W5RA 1VK3A 3LDSA 2JZ5A 3FMWA 4Q0BA 3J8AA 4CP5A 5LJWA 3OYLA 4F36A 4OHXA 3S3OA 4LQ9A 4TYBA 4J9MA 2E7VA 1FI4A 5HL7Q 2NREA 4PYDA 4NLGA 4Q44A 2DH8A 3KKRA 4FS1A 2YXLA 3GFHA 2C3PA 2XNQA 4CF9A 1BO5O 3IXQA 1HYZA 2QYCA 3FFKB 4DR5F 1CC7A 1FEHA 1NSKL 1XEZA 3OFFA 2FHJD 2COLA 5I42B 3PYFA 4I2QA 4IRDA 4LF7J 4E19A 1J5EK 3C19A 3JTOA 4FWLA 4CGDA 4WYLA 3KDNA 1BI4A 4KAIA 1WAFA 4PG4A 5JXSA 2O66A 4CHOA 4UY8T 1DT9A 3E1YA 1NEEA 2D3ZA 3KWMA 3ENAA 2PFFB 4USJC 3JQJA 1TK0A 2BE9B 5LL6d 1YRXA 2A18A 3H1VX 4DR1K 1A5VA 3KHYA 3NXZA 3Q8SB 4KBIA 4DOZA 2XMVA 3ETMA 3QMLA 1VBXA 2KJVA 2IRUA 2HGNA 4WU2A 2XZTB 2EG2A 3QDKA 4DI6A 2GGPB 1RHJB 1LWEB 2C3MA 3GPAA 4M42A 4MK7A 4CGFA 1KAYA 1FERA 2P5VA 2FVRA 1ZETA 2LFVA 4KHPJ 4RW7A 3MD3A 2HNDA 3MM6B 1K8KB 3L2RA 3LGHA 3PUFA 5GVQA 2VZ9A 2LDYA 1UFKA 3MAQA 1WSFA 4U7UK 3TSQA 1BUXA 4Z4CA 3F73A 4YQWA 4ECSA 3W8GA 3D68A 1BCMA 4DSIA 4RL1A 4ECVA 3HHNB 3M1VB 1T44A 3EN9A 1ZBHA 3M05A 4KI4A 4LSZB 3WC2A 2FJWA 2PSZA 2QGFB 3BN7A 3V5RA 5ETMA 2FLOA 1DTTB 2BE7D 4O0JA 3W65A 4USUA 2LKZA 5AR0A 2XI2A 1YI2S 5F8MA 1RDAA 2JEGA 2J0SD 3MCAB 4J9KA 3KK3B 3BGLA 4A8KA 4E7KA 3LPEA 1G6BA 2JWKA 2CQPA 1LEOA 1M0SA 2EFOA 2WSEC 3VEZA 3SUNA 3TOQA 4X4VA 1Q18A 2HK3A 4Z4FA 2ATQA 4A5AA 4XK8C 4X65K 1VI7A 4WFAL 4CO1A 1JJ2R 3RRHA 1LXJA 4N47A 3UNGC 1HBOA 5C2GA 1SH3A 1YHQS 4IOAQ 2IRYA 4GC7A 4Z0UA 4OX8A 1T9TA 2X7IA 4B9UA 4X84A 1LWCB 1WUUA 4CBWA 2K06A 2QA4N 2LQ8A 5T7LA 4ZPBA 5D77A 2W8LA 5AZIB 3KLGA 4ILGB 1ZXOA 2ZUGA 5KT2A 3IRWP 2A5XA 2NCKL 4Z7CA 3C6HA 4DR6K 4Z4IA 1JCEA 4DV2K 3VR1A 3ET6B 5HVFA 2NRZA 2XZDB 3SIPB 4Y0WA 4FPIA 4FM1A 2AYBA 2HBKA 3EE8A 4ELTA 3CMES 2JVOA 5B09A 4BRGA 4DUYK 2O5DA 4GMJB 4ZKAA 3G8QA 2OA8A 3SZ2A 4LF7K 2O67A 4LD0A 2LU2A 1TUVA 1S79A 2NUBA 4ZP6A 5AQTA 1T3VA 4I1TA 3LUYA 3GILA 3FCWA 2RHKA 3R2CJ 2MEWA 3M32A 4ED6A 1WI8A 1HA1A 3W61A 3R6MA 4ZLPA 3RBXA 4AHVA 2XLIA 4OIXA 2IDLA 2BBEA 1UMJA 4CHNA 3OW2R 3VQ6A 2FJXA 4M5GA 4CLSA 1X4EA 2NRHA 4EBDA 3SUPA 1S1XB 5A8RA 1M1KT 3T9ZA 1U8WA 5I3UB 4CHZA 5KFMA 2DXEA 4DEZA 1ZZNA 3MWPA 3W63A 1EXQA 3OYAA 3I32A 2UXCF 3C16A 2V7ZA 2XC9A 1XR5A 3AA5X 3AA4A 5C25B 2VJUA 3O3HA 2JEIA 2E2QA 1BUPA 4LVOP 5A2QY 4ES1A 2HEKA 1K1QA 3B4MA 3HHLC 5JS1A 4GKKK 3IA0A 5AJ3J 2LLZA 3OSNA 4BRKA 3HVRA 1BE4A 3SK3A 3MM8A 1F2GA 4BR9A 3PYDA 3IO1A 1I5OB 1Q7YT 2MZTA 1SL2A 5HQMA 3C6TB 1NPPA 1RCOB 1WKKA 3R5AA 1C6VA 4B9NA 2OPSA 2Q0RA 3IS9B 2R7XA 4DF8A 3AVIA 5BR8F 1TL7B 4IJNA 4HUEA 4J9NA 1SBRA 2NPFA 3P6YC 1S5JA 1IV0A 4HHUA 4BRFA 5G4DA 4EWTA 1D8YA 5HRNA 4KHWA 3LP2B 3BF3A 4QR1A 3MPYA 3TUZC 4KPYA 1RABB 4L72B 1HWUA 5C10A 5AQLA 4YR0A 3GYNA 2CG8A 1T6DA 5J2QA 4BBYA 4J9RA 4H4KC 1ZAXA 2PAVA 3BN4A 3PO4A 1PKUA 2JWNA 2R2RA 3SSQA 1WI6A 5KG6A 1DLOB 4FVCA 4CGHA 2F4FA 1OO0B 3M32B 4HI2A 1IBCB 2MLZA 2BYCA 1FFGB 1IBMF 2BACA 3L09A 4IYQA 4LSLB 3EVOA 3BGOP 4JK7A 4CJVA 2VDHA 4JKCA 2OIHA 2H9ZA 1MN9A 1WBDA 4DV5F 4JLHA 2CPHA 3H40A 1M1KO 2VFUA 5BYSA 1VRTB 1UJ4A 2J9CA 2OPQB 1FJGK 2POKA 1SI9A 4O4GA 4QR0A 2UUTA 2XEXA 2DPNA 2QC3A 3CYMA 4FLUA 1VQ8N 4ZIVA 2VQFJ 2HVEA 4CH0S 4ETXA 4JD2B 4MO5A 1NJIT 4YOEA 4M45A 3S41A 1AA1B 1HUXA 2JC1A 3C8YA 1I51B 2NR0A 4BE0A 2F3JA 4H4OA 3TAQA 1GLDG 4DPTA 3D1HA 4DV4F 4F3QA 2CJ9A 1H72C 1JQGA 3KNGA 2LA4A 3SBGA 1PSDA 2WVFA 1L3VA 3D3CJ 2X1FA 3UE5A 4Z37A 4ZVTB 1WSEA 3A3OB 3R8EA 2PO4A 3EZOA 3ZZYA 1RBVA 3W9JA 2DIUA 2IA6A 1FDNA 4ZMMA 2HZAA 1L5UA 3AVFA 4C6AA 2ZDPA 4YB5A 3N79A 3BO4A 2BEFA 3PW4A 3T6JA 4DR7J 3H2VE 2O8BA 3M5RA 1W26A 1T3NA 3LPTA 1X4CA 1FHTA 3ULHA 3PHEA 2C42A 3NNAA 4M5LA 1IXKA 4F2SA 1KC8T 2GIFA 3BH6B 5EOYA 4WF9Q 5HRRA 3S3MA 2W9BA 4AD6A 2FSJA 3MTJA 2UV8A 2BQ3A 3OFEA 5C2CA 3EE9A 2GQ2A 2L41A 3OW2M 1YJTA 2HHXA 4PG8A 1TTHB 2X1GA 2WC9A 2GNKA 4MLEA 2RU9A 4FWKA 3U1LA 2ZH8A 3V1OA 3P38A 1VSEA 4WFYA 3V81A 1NK4A 4UY85 5E5NA 2CGJA 4AHUA 4LF8F 3QESA 4PXBA 1SUQA 4G6VB 3V9WA 2NRWA 3VQDA 1SV5A 4OV6A 1OYEA 2I6WA 4LH5A 2VKRA 3MM6A 1K8KA 2OTJN 1G3OA 4JI6J 3BBCA 3KFWX 3MI7X 1PBAA 3CCWA 2C2RA 3GONA 4O8UA 4HEA9 1VFJA 4F3OA 1LWEA 1GLAG 4X62J 2DK2A 2BJEA 5DG8A 3UI3A 1H2VZ 4IOBA 1YF5L 3OYMA 3BREA 3C0BA 4CJTA 2LEPA 2VWJA 2UV8G 3GWCA 3OTEA 4F3TA 3AVGA 3FBCA 1GTEA 2HQDA 4FW2A 2KN4A 4P72A 3O9TA 1HWLA 3ZCMA 4RUBA 4DFPA 4W98A 2D0PA 3SQ0A 1C4AA 5HLFB 2Z58B 1YTYA 4FBTA 3LP0A 4H4MB 5HQLA 2VQFK 4W5TA 3RWUA 4PXCA 2FF6A 4BGBA 1KVAA 2A6OA 4I2QB 2VGMA 2MPUA 3CW2C 4FJ8A 1QAIA 3NS6A 4KQZA 4J5OA 3VEXA 1O6XA 4NA2A 4KHYA 5AQZA 4I68A 3U02A 4E89A 3CO0P 2HFSA 1RKIA 2KYZA 2RDJA 1JNRB 5KRSA 3IWLA 4WK1A 1Q81T 2FZGB 3MAAA 5BPLA 4P52A 1LW2A 4LF9F 3ZTOA 4BRHA 1TMMA 4K25A 3VF2A 4OYWA 1EAYC 3GBTA 3HP9A 2FYXA 3GB0A 4B9MA 2AX1A 3JSMB 3UE2A 3H46O 2HFZA 4WQ5C 2YKQA 1HHTP 3JYTA 3SV3A 5KG0A 4IDKA 5AE1A 1VSIA 3U3GA 1FVSA 4JI2F 1UPMB 1IKYA 5I42A 5KPRA 3SXLA 3CGIA 3T7ZA 5DQIA 1JL2A 3I6PA 1XC9A 2AEMA 4B3OA 3HO1A 5L8RC 4UQGA 1M1GA 3KXDA 5H1SQ 1FW6A 3IMQJ 1U1LA 3WQTA 2X1AA 5AJ3K 2BMBA 2GQQA 5KFFA 3H4DA 4I67A 3SAGA 2GELA 1JLBB 4OZ3A 1S48A 2KJWA 3KNAA 3HHKA 1RQ0A 4DPWA 3HSGA 1WKJA 1Q78A 2ZH5A 3N6LA 1YK9A 4WIIA 1UEVA 3IP0A 3IRXA 5AQIA 3PCOB 4GKKJ 2KHCA 4LY7A 4CEQA 5B0CA 4LR9A 1XNRJ 4BG9A 8RUCA 1GXUA 2QK9A 4ZHRA 3JSRA 3DGPB 4PWDB 2Q6BA 5KFHA 2G4BA 1RHUB 2E1PA 3ZX0A 3NKYA 4NLQA 4R8UA 4CJLA 3GSDA 3QGHA 4ZTFA 1MMNA 1HWJA 3O5BA 3L7UA 2P9GA 3LPYA 3D2WA 2ZJRL 2HIQA 2WTUA 2LSNA 1DFDA 4NLSA 4OI0A 3Q8RB 2MQLA 1XR6A 2Y9HA 3OL6A 1FX4A 3GP9A 1IO2A 3DFEA 2H4WB 2C2MB 2RDDA 2GMLA 4U95A 2JEJA 3SBTA 5KFRA 5GAEU 1J5OB 2V4JA 1CULB 4AHSA 4B1WB 3V6JA 4E3SA 4WYBA 1FD8A 3HHEA 1ITGA 4ECQA 2MB0B 4PY5A 4BC4A 1WLJA 1IBKK 2D3O1 3J81O 1KKHA 2OPRB 4FLTA 1DY3A 2NSBA 2HQ3A 3TAMB 3OTBA 2EK6A 2DNQA 3VTIA 2VWBA 4H5TA 1ILYA 3THWA 4Y3CA 2AT1B 2GJ2A 3BR8A 1YHQN 1RYSA 3L4BC 1JX4A 1XN9A 2W41A 2YWKA 1RNHA 2XY5A 1FJCA 2FGOA 1HKGA 4IFVB 3TVYA 2DH7A 2V8GA 1GLFO 3ZX3A 2G0IA 3N5FA 4WTYA 2CFXA 1TUUA 2LQ5A 4IDHA 3AA9A 4PG7A 4RW8B 2D3OR 2MDAA 4P2FA 4QIEA 2VWKA 1BQMA 4O23A 1YIJN 2HS0A 3KK1A 6FDRA 4BR0A 4FPBA 2QV6A 2RAQA 4M63A 4BWMA 3LO3A 2QXLA 1KOOA 4ZHRB 1CBKA 2BANB 1NCLA 3J80O 4CO5A 3MPUB 3O1WA 4JYAJ 2G9OA 2R3VA 3PJXA 2DCUB 1KS2A 4CVNE 2HQGA 5HI7A 3LWLA 2KG1A 2ASLA 4X4QA 3AQOA 4YOYA 2YNHA 2NSCA 3ILLA 3GCXP 2AJ2A 1OVYA 4K50A 2D1KA 5HSPA 3A5LC 2LXUA 2R8GA 3VEOA 3WQPA 3CFPA 4BY9C 1LW2B 4HCBA 2E2NA 5AQRA 3M2RA 4MYUA 3MDFA 1RSCA 1NGIA 1KVBA 1B9DA 2KVQE 3VQPA 5KFSA 2CQBA 3FEXB 4UW2A 2HHHJ 2ZE2B 4BREA 1F6TA 3F41A 2KXHA 1T8EA 4DTMA 2G1DA 4PQUB 1Z4UA 3FZKA 4CM0A 4E2FB 1VBKA 2O8FA 3AXKA 3KMSA 3MK6A 2QLWA 1WB9A 4JHDB 3SBMA 4USMA 2MTLA 2UP1A 4DSFA 5DETA 4C1NI 3SDEA 2EWSA 2KDOA 3THXA 3M8ZA 5KFBA 4G1QA 1PILA 3HHDA 4WFNQ 3VMFB 2DHAA 4TU9A 4NLDA 2QXFA 2HHQA 5D0HA 5BPNA 2HRYA 1RP5A 4QS8A 5M1FA 3HL8A 4ZITA 2GAHC 3OTCA 4QWAA 1FWPA 3WC0A 2GX8A 4WE1A 1EARA 3BEGB 1VR6A 2BGGA 1R89A 4KE5A 2XULA 1JXVA 4J9UE 3BSOA 4FVMA 2V4RA 2B9XA 4ZCKA 5J2MA 1WSIA 3NS7B 3DGVA 1B7FA 3TTFA 1FVQA 1VGYA 1O1WA 1IH7A 2RE2A 1T6CA 2DFFA 2ASYA 1IBMK 4P74A 2OJ3A 1S6PA 4ECRA 3W3SA 1HKCA 1QUPA 2M70A 4C0HA 5KRTA 5ADZA 2YKNB 3TP2A 2O8CB 5JMNA 4OI1A 1F9HA 3I56S 2ZKTA 1HR0F 1GFWB 3EZUA 4MKYA 3CC2S 1TV6B 4IEIA 2O8DA 3C15B 3M30B 5DLFA 5CYJA 2W9AA 3SUQA 3FMBA 1ZBUA 3ADAC 2ASOA 1S1VB 5GIPA 4GMKA 4KHSA 4KHNA 4K5RA 4OZLA 3UKRA 2BQRA 2OAUA 2YX7A 1S77D 3UKRB 2N7YA 2C1EB 2R7SA 4KH0B 1XQIA 4QWEA 3KOAA 1F5AA 5KPZA 1YJ9S 2VPWB 1W2BM 2AEFA 5C5JA 3AA3A 4OQJA 4HCCA 3P45B 4B8AB 4KREA 3V81B 3JAMY 4PQAA 2XMUA 1S1TB 2XMTA 4IG3B 5CCMA 3ALYA 1BOTO 2ZJPL 3M8QB 3IWXA 4M7XA 3CG7A 4DR5K 1S6PB 3D67A 2BKNA 3V1RA 1B70B 3JAMU 2XQCA 4CJSA 1S9GB 2UXCK 4B8CA 2BR0A 2HBMA 2W9BB 1Q53A 2QFJA 4AL7A 3DM2B 4KH4A 3NGKA 2KZMA 4FJ7A 2JOQA 3HPOA 4KO0B 3ZZRA 3K2PA 1VQLS 3FKBA 4O5BA 3VQTA 1WD6A 1WF2A 3PKYA 3TQEA 4C23A 3PM9A 1SPBP 5F0WA 3S01A 2DTJA 4DTNA 4J2AA 3GDQA 4GC6A 4J2EA 1FX2A 2AGPA 1XNQK 4F0HA 3NAEA 4Q5VA 3QT6A 3THXB 1B0PA 3J7YU 4FKYA 4WKYA 2BOAA 2K1RB 1X4AA 2LA6A 2O8FB 2BJ7A 1D9DA 5KGXA 4ZN3A 5DZ7A 5ETOA 3UWTA 1T9VA 2FB0A 1BY9A 4JI3K 2YHWA 2W2OP 1UETA 1U8SA 2UXDF 3DWLA 3F2KA 3L9ZA 1NMEB 3BGRB 3EGWB 3C6UA 4JKFA 3VQ7A 3ULEB 4CEOA 4OPHA 3B8AX 4G1IA 4TYAA 3T1AA 2AJ1A 4FJLA 3MFHA 2ZOFA 2VOPA 5THWA 1XERA 1E6VB 3R1XA 1RT4A 4NCGA 3HKZD 3M8PA 4BRCA 1K47A 4C3MA 3OXLA 2J4RA 1NGBA 1WSJA 3RSEA 1SC6A 3OS2A 2YQ3A 1EX4A 2HYIB 3KLEA 1RDRA 2KHDA 4OMFG 3ZTSA 3D7SB 2CNNB 4FYDA 3SCXA 3X3UA 3L3VA 2GX9A 4C2MA 1RT5A 5AZJA 5A8WB 3GIIA 1WNSA 5C12A 5MLCQ 1H98A 4KHPK 4LC9B 5K20B 1WELA 2QWQA 3ID8A 4L8RB 3PX0A 9RUBA 2WBNA 1XMQJ 1U1QA 1N34F 2AIRB 4XO0A 4I64A 1GEHA 4DR1F 3CCVN 4A59A 1JCGA 3MCPA 1HD0A 5FRMA 1UVMA 2JSXA 1ZAWA 4ER8A 3LANA 4H54A 2DR9A 1Q7LB 4NLYA 1JIHA 2DITA 3NF8A 2UXCJ 2JC0A 3BGRA 1YITS 2DR6A 5M1KA 2DEJA 3TW0A 2X3GA 4OX7A 1DEJA 4IH6A 1MWZA 2FY8A 2HNYB 4PG5A 3M6UA 3CEDA 4XH5A 4LIRA 1SH2A 5EWGA 4P9SA 5C2DA 2C2NA 2GCFA 3KJFB 3NMAA 2YHXA 1QHAA 3SEOA 3IWNC 3HSDA 1BU6O 3FVYA 2HMIB 4A4JA 1RTZA 2CJQA 4M3YA 1PG5B 4OYIA 4OI4A 3ZETB 3GQCA 1E6VA 3K5OA 1VSMA 1JJHA 2XSFA 4JV2A 1N52B 3OVAA 2QL9B 1S59A 1R0BG 4QW9A 3I8DA 2JRSA 3V9UA 2X6SA 3KD1E 4CBUA 2FIUA 4Q43A 1T9UA 4ZLJA 1EJ7L 2ZF5O 4QOZB 2H1YA 2UUBK 2CPEA 1C1CA 4CIEA 1NK0A 3TAGA 2F9DA 3E3XA 3OYJA 4J90A 3DM2A 2R7TA 4DX8H 1HNZJ 3TJAA 2K1RA 1LWCA 1IBLJ 3WNFA 3AVLA 3IRXB 3PG9A 1HQUB 3EKUA 3QLHB 2L3MA 3PXGa 3OJUA 5KGWA 2H4YB 2P9LA 3AO5A 2XG8A 1KQSM 4EK2A 1SQKA 3VA3A 2RMLA 1Q16B 1WWHA 2HAIA 1MLAA 2LMIA 3VF4A 1CS4A 1FRXA 2BA9A 4R0JA 3CJKA 1K8AT 5FPEA 2ZNYA 3ATUA 3CD0A 1FNOA 1UJ5A 3CCQS 4DCHA 1C1AA 1NHKL 4CF2A 4JYAF 4CHYA 3O6QA 5IT9U 1RK8A 3NMRA 4B3OB 4WFBL 1N88A 4WXOA 6AT1B 2HBJA 3V2UC 4QIFA 3P3DA 4RW6A 5KPTA 1P1TA 3EPIA 4CI0B 2MYFA 1GMVA 3A1YG 1SQFA 2AMCB 1DRZA 3GIKA 4EO6A 4IDKB 3C15A 3M30A 3AVAA 3DYAA 2W4DA 1T9XA 4CGJA 1BHNA 1HBOB 1PYSB 2K3KA 4QYZJ 2OEKA 3M1VA 4A8XA 2VB6A 4LFBF 4JK8A 1ZBIA 4HT5A 2YI1A 5EWFA 3WDOA 5ITHA 3AJDA 3I8BA 5K8OA 3AV9A 3LP3A 2GMJA 1JLCA 3OYDA 3T5KA 2NRVA 4K43A 4I6WA 2ASJA 5KG5A 4RW7B 2JVRA 3KLFA 5FLXU 5KFXA 3UB5A 3QT8A 3KK3A 1Z6RA 3SFGA 2ILZA 4NMXA 2XWYA 2XMMA 4NA1A 4TSXA 4A8MP 4R0EA 4WK3A 3DKDA 4CH7A 3HSJA 4DMZA 3RB3A 1HNXJ 3W2VA 2QYGA 2A1SA 2YNIB 1RT7A 1UJ6A 4JV1A 4DS4A 3TUPA 5SWMA 4M5KA 4CGIA 5KQ8A 5HLFA 4JRPA 4RPFA 4EYIB 3SQOP 2EFNA 4H0VB 2YQ0A 3VGUA 4I2PA 1FXDA 4YR3A 2DFHA 4M94A 1BLUA 1OSCA 4BWJA 2F4VF 4I2PB 2QFIA 4UOHA 3BUZB 5AQGA 3CCES 2J6TA 3SV4A 3PTWA 1QE1B 2E88A 2NXUA 4FJ9A 2WVBA 3IM8A 1DZ5A 4OZ5A 2FTRA 4YB7A 3WXMB 2PEBA 1HQ2A 4KKOA 3TEHB 3E01A 3QFHA 3OS0A 4LT6A 1YJWS 2YX4A 5GIOA 4H0OA 3MR2A 3U4LA 2G8HA 2MKIA 4DLEA 4FWNA 2FF3B 2QA1A 3CCTA 3FSYA 4ELVA 2A40A 3OVSA 3CC2N 4CZMA 4PG6A 3GFYA 1S99A 4DUTA 3PIPL 3KLFB 2FHMA 4F4AA 3ZSWA 5C0YA 1U1MA 1ZPVA 3UDVA 3MXIA 3QPIA 3AOCA 4JB8B 2B8QA 5LJVA 2IY5B 2AEJA 3CIMA 3P1GA 2HIYA 3NF9A 1S3XA 3NFAA 5K5MA 3TR8A 1KHWA 2EFGA 4HHHA 4DV6F 1KNZA 2QWNA 3DRPA 1E4GT 2XGPA 5KFKA 3EL2A 2VPZB 3W2VB 4NXNJ 4OJGA 3AOAA 3TEGA 4Y2MA 4MMOA 5HANA 4C11A 1KBRA 3FLCO 4MFBA 2BANA 3OJSA 5JVHL 2MHNA 1YVUA 4FKXA 3QEWA 4F0KA 3WEEB 1NNDA 3H42A 4X4SA 4OJHA 2VBXA 2AJ0A 3M2RB 2J0QD 4Z4GA 1VQPN 2IS3A 2IYIA 4RW8A 4YORA 3QZ8A 1NB2A 1Z2ZA 1UFLA 1IJEB 5BPMA 4Q2LA 2E1MC 3EKSA 3OYEA 2AA4A 2YX1A 5IQ6A 2QX0A 3ILOA 4QIWD 1VQ5S 2G8WA 2KT2A 4PPZA 4HTJA 3CD6S 2HVDA 2MLXA 4CD3A 4NO7A 3KJVB 3DLLL 3CF5L 1YDLA 3CCJN 3MECA 4FPAA 4BC9A 4BLGA 3NMUA 3TAMA 2WBRA 5KG2A 3ZTRA 1K0TA 1S4EA 3W9IA 2YNFB 2E2OA 5B0EA 1P8GA 2P8IA 2X1BA 2FBXA 2LVWA 3HX9A 2QW9A 3CJKB 3O5TB 2N7CA 4DV6K 2OPQA 1KEKA 4RU2A 1Q1KA 3LF0A 1WG1A 3CERA 3LWMA 3H7HB 4IH5A 1KSPA 5J1EA 3O3LA 4CZFA 2KB2A 5J2PB 2C3YA 1SAZA 3C14B 1H3DA 4A48A 4LSLA 4ED0A 2DNHA 2VICA 3CFRA 4B3SK 2D41A 1JMTA 3DLBA 4RW4A 1BD6A 1VHFA 3DGPA 3ZLJA 3JS9A 4Y34A 5E7OB 4RW4B 3FGVA 2P5OA 1ZM9A 4ED2A 3UW1A 5JICA 4FZZA 4FF1A 3HP6A 2GWJA 4RNOA 4NXMK 4X64K 3ZT4A 5RUBA 5CQGA 1FXLA 5J1EB 3NGIA 1FJ7A 2D9PA 1SKSA 2F7TA 1U2CA 3H5SA 3ZETA 2J9EA 2A0FB 4R5PA 4X65J 4C4WA 4DR4J 4AILC 1VQ7N 2FY1A 1RFQA 4XPCA 3BZKA 4NASA 2KHOA 2FJAB 2Q3PA 2ZZMA 2W40A 1EHWA 2LDIA 2Z4PA 3ICLA 4B9QA 3H25A 3A5NC 2V8HA 4IJAA 2W7OA 1T9YA 4YN3B 2IHR1 4WFXA 3PZPA 4KT0C 2HHSA 5E2QA 2G1HA 4TLQA 2IMOA 3DOKB 1LNQA 4HTUA 4BVOA 4ILJA 1IKXA 4CQ1A 4CK1A 2NZTA 4ZJOA 4CLYA 1XJWB 1K44A 1FFSB 3EJMA 2E7WA 3OR1A 2QA4G 5HP1A 1S1XA 5A8RB 4LF5K 3W9HA 1TAQA 3C6UB 5EU7A 3PDNA 4UOFA 3HHLA 2DNMA 2GVZA 3CQYA 2YHBA 2O4IA 2HMPA 3HSZA 1U04A 1HNWJ 3HVTB 2M3DA 3PJWA 4ILRA 2RQKA 2Q43A 3HULA 1BGXT 2MKSA 2DNGA 3CQXA 3BDEA 2BJ8A 1ZZFA 1BISA 4LRBA 2HURA 3B78A 5HMXA 2PZSA 4PWWA 4DTOA 4TXSA 2VPYB 1Q5VA 2BUPA 3VV2B 3M8PB 1NSPA 1UCNA 1M5SA 4CFCA 1LQ9A 2FD2A 2J0WA 3CDBA 7AT1B 3EDQB 1EQMA 4DV1J 1H6KX 3KK2A 5AQUA 2O8EB 1R6YA 2L48A 3NF6A 3W66A 2RD5C 2W2QP 4DV1F 4ZOSA 2F63A 3R1LA 1RDWX 2JLGA 2VC0A 2IIRA 1G4CA 5AJ3F 2VONA 1CJUA 1A5XA 1C2PA 2CIMA 4FN5A 2XY7A 1NHVA 3EVMA 2ZNZA 3AO2A 4NYNA 1Z1ZA 2DISA 1HI8A 3I4HX 1HWIA 5AZIA 2H3GX 4UZCA 1VISA 5T7LB 3QNOA 3I87A 2V8PA 3AOBA 1O5JA 2OGUA 1T95A 5C2FA 2PI4A 1B64A 1F9FA 4ETZA 5DQGA 2KL8A 1BA0A 1WC4A 1VQ6S 3VQCA 4CJ4A 3ELHA 1H38A 2DY4A 1AUSL 3VVTA 2YKMB 4EFAC 3QJPA 2FJEB 1SQGA 1IVZA 4KJIA 1HIYA 3NEKA 4QU7A 2CQCA 1X5TA 3RBDA 1X9SA 2RKIB 2MKYA 4ZCMA 3T5HA 2JJ4D 1CEZA 2WB4A 3RTVA 3OPKA 2ZBIA 3AFGA 4OO1J 4H8KA 4G9ZA 1EETA 2F4VJ 5H9EJ 3TPQA 1KAXA 3V4MA 4KHMA 3CC4S 2E6MA 3CJ0A 1IKWA 4IFEA 1NUEA 3C65A 1UA1A 1TELA 1XMBA 1N0UA 2YWEA 1R6VA 4CJ3A 3LALA 3P8BB 3IBCB 1BQNB 4U67Q 1HBUA 3PFEA 4ZVEA 1KAZA 1RA6A 1NB7A 1TV6A 2H48B 4B08A 1KXPA 5DLGA 1JLQA 2J0XA 4M8LA 3AD7C 2IVYA 3VGMA 4FNHA 1UAXA 1DQ8A 1WEXA 4EBCA 3RW7A 3OLAA 4FJMA 1XIQA 4KV8B 3QGGA 3LOUA 4HACB 1HFEL 2VHGA 2RJZA 3PIPQ 1QDUB 4N76A 4USTA 4DB3A 2CPIA 2H3EB 3UQSA 4IOAL 3GIJA 3E8OA 1JXEA 3GV7B 3GE9A 4DQPA 2CJAA 2HNDB 3D7EO 3NGRA 1NMDA 2Y8WA 3CPWR 1U48A 3W1YC 4CNZA 3TI0A 4JYAK 2ROGA 2KRRA 4WP3A 3AT1B 3W8PA 3B6BA 1CQNA 1VJWA 1EETB 4HDHA 3OSPA 1TFWA 4U67L 4RO0A 2LYVA 4NMLA 2DFEA 3QIPB 1S1UB 4JKBA 1EP4B 1S9FA 3H08A 3V9XA 4RNHA 4FJHA 1YI2N 4M41A 1CS4B 3K8VA 2HSEB 4C97A 1VSKA 4ZVOB 3FE1A 4CERA 1GNKA 3DXMB 4FM0A 2NQPA 2FJBB 5H9FK 1FF2A 2GQCA 4DTXA 2BXJA 3DRSA 1X0FA 4FJ5A 1HQUA 4P71A 3THPA 4MDBA 3GJRB 4OPKA 3NHGA 3PIOL 2HHHK 3I4PA 3K0SA 4DV4J 1ASUA 5KAKA 5SUHA 2ZKUA 5F9LA 2G13A 3NG8A 4I6MA 4JI4J 1H7WA 3LA0A 4KHRA 1TK8A 3HD1A 4L3QA 1RKJA 5J2QB 5D4NA 4JNEA 5FROA 3ZZTA 4RNNA 3RAMA 1RAIB 3R1HA 3D1QA 4EBEA 5IT4A 1PC4A 1HHSA 5ADXH 4O5FA 4WQ5A 1CSJA 3AHPA 1V9OA 1FEEA 5L1KA 4FYWB 1Y5NB 4LFAF 1TL7A 2DPIA 4RNFA 2FXUA 4DX5A 2LQBA 2U1AA 1YBTA 1X4BA 1U7LA 3TYTA 3V9ZA 2QWLA 1KONA 1VQKN 3V4IA 2HQFA 3ZZZA 2E1RA 4JI4F 1BWFO 3C6TA 1ZS6A 1NH8A 4JOUA 4ZPTR 2ILYA 1PJ5A 1KHVA 3DHXA 4WU3A 3EZWA 1UWBB 1N36J 4OLPA 4EGLA 4CO2A 4FNIA 5LSOA 3PW7A 1QVFM 1ZYQA 4L73A 1VQ4S 1NPRA 3ZSXA 2JFDA 1MU2A 1YLXA 2X51A 2Z1IA 3K5PA 1M90T 2W2MP 4HH0A 4CEAA 5F2RA 3RMAA 1GT8A 4ANDA 4EYHB 3E9PA 3FQLA 3U9ZA 2LECA 3BR9A 1U0HB 1UWAA 4H0XB 2NYIA 1DKGD 4KHUA 3IS9A 3TZXA 2I9SA 4ID5B 2WVCA 4CJEA 1LXNA 1W0HA 4HVJA 3CCSS 2KT5A 1QLNA 4O55A 3V9SA 3LW5C 3D2EB 2ZH9A 1OH8A 1U49A 3THWB 1T9WA 1NSAA 4K0KK 2V67A 4OZJA 2XCPA 8ATCB 1XTZA 3THYB 1VQ9N 4OI6A 3KYLA 5GINA 1ZAVA 2KM8B 4YR2A 3I96A 2GHPA 4USHA 2OMLA 4OHVA 5KFWA 2CJBA 4DV6J 4P10A 2FBVA 4JKEA 4FWMA 1FFWB 3C14A 3HLUA 4HVZA 2LCWA 1RYRA 3DU6A 2AJQA 1VQ6N 3CMAS 1N32J 4CZKA 4A8WA 1R7IA 5E3PA 4NXNF 4DQIA 1GH8A 3CC7S 1RWVB 1PCAA 1HQEB 2CG4A 3ZYYX 4KR0B 2J7KA 2RQMA 3RU0A 5KTQA 3ET6A 2YBVA 1X7VA 2MQ8A 1GOCA 3ULEA 3QNNA 1JLAA 1H73A 3CTRA 3ENQA 4LF4K 2CQDA 3DHWC 3VAKA 3GR1A 3R7BB 2A10A 3CNQP 1Z05A 3KJVA 1VQMS 2ACMA 1FT8A 4C8LA 1HJRA 1T11A 1SXLA 5H9FJ 2BUNA 5AQNA 4O3QA 3HSTB 5DGAA 2JWLA 3K9JA 1VQMN 3DXBA 3M6GA 1GMWD 2DGOA 4C3LA 2KFNA 3FCVA 1J5OA 3BPSP 3DLLQ 2IAJB 4I69A 1C0MA 4F50A 1RTJB 4RX6A 1D5AA 5HRSA 1ZOTA 4IWVA 1RT3B 1K8AO 4CFAA 2PMWA 4N77A 4DQQA 2YNFA 4LBHA 1XMOK 1XR7A 1Y5IB 2KRBA 3NRBA 3DRYA 4R8UB 5E41A 3CJAA 2ALZA 2AWZA 4KO0A 2P9PA 2HPUA 4A8YA 5F8NA 3KLGB 1QAXA 3MOJB 4Y2AA 2VC1A 4IR1A 5CYMB 1X4HA 2A1BA 3MWBA 1N36F 3CCMN 3TZWA 2JX2A 2JGUA 2P1JA 3R6LB 2BV3A 3MD1A 3IUCA 5BYQA 1NOYA 3H98A 2A2CA 2HHUA 1GLCG 2DHXA 4BROA 2H5EA 3NNHA 5AQMA 4BC5A 4F2RA 1SJ3P 1RTIB 2QIFA 3AQPA 3JS6A 3CDEA 1NSQA 5B0BA 5L38A 3PV8A 4ECZA 4K4SA 1HNVA 3G4SS 1LCUA 3VENA 2YTCA 5BJRA 4RUAA 4JN4A 1NJIO 4MFBB 1KVIA 4DR6F 3BGUA 4A8SA 3OFGA 4BC7A 4WFNL 5ETPA 1DQ9A 4ANCA 4B3MJ 2PBDA 5LL6Z 4TQSA 4JI2K 2C28A 4FPRA 3SAFA 1QAYA 4FJIA 4DFMA 2H51B 3GR0A 1VSLA 4H4MA 2ABYA 3IR7B 2BX6A 3U3YA 2YCHA 3JSYA 2CZVC 1NU4A 4ED8A 2AYGA 4DUYF 4H0YB 4UUXA 2UU9K 3ATVA 3F0NA 2K8GA 2OI2A 2CH5A 1WEYA 4DHYA 3CUNA 3H4BA 3CJSA 4ED3A 3CM6A 4RWWA 2HNZA 2OTLS 3O9QA 2UVUA 5AQKA 4NWBA 5JUMA 1KTVA 4DR2F 1B0TA 1RB0A 4P7TA 2QMXA 4DF4A 5ADXA 1RAGB 3LZIA 4FLXA 2QTWA 3DXKB 4OKKA 5D3GB 3F56A 5GAHU 3ID6A 1AZSB 4ZP7A 1V3RA 5LXRA 3TSPA 1T94A 2BKPA 5DDOC 1HKAA 4NLPA 4XH4A 2HB5A 4LVNP 3W0LA 1SCJB 2VUGA 4ED7A 3GU0A 4CWBA 3LL3A 3ZEUA 1JLCB 3CMQA 5MAOA 4F4YA 2XY6A 1N48A 2ZOMA 3GV8B 3FR0A 1X4GA 2HHTA 1KCFA 3ZT0A 4X4OA 3OYKA 1REVB 3G2XA 3R3TA 4M95A 1ZPWX 2B7BB 4DV3J 5FPNA 1AXQA 1ICEB 2HVIA 4FSVA 1UVKA 3KJQB 4BC3A 4JS4A 1IJFB 3PR5B 4F0MA 2ALYB 3K57A 3Q83A 4PQUA 1RWWB 2J7WA 4F26A 2R4FA 4USIA 5F8HA 3TU5A 3D0GE 4FWPA 4M7YA 1RWOB 3CJ3A 5EY4A 4UT4A 3MUMP 2AQ4A 3HSCA 1CJKB 5JJBA 3H59A 3UPFA 3BSCA 2HBZB 4LH4A 3POTB 4CZGA 1VBZA 3LZJA 3RRGA 3MXHP 4LSNA 4IOCQ 2E2PA 5IV4A 5GAGI 1H74A 3HK2A 5AXNA 2LP4A 1Y00A 3SJHA 3F5TA 2KFYA 3SAHA 2V68A 4N8OA 3NH0A 2ROEA 2APOA 5CD4H 5FRNA 4K2JA 3J81Y 4YFUA 1N5YA 4BRNA 5A8KB 3OL9A 3ISNC 1X31C 3JB9k 3VEVA 1CXUA 5HRPA 3EXYA 3FFIB 1SH0A 2RNEA 3L2QA 3LGNA 2NUHA 2P9PB 1J53A 2XM3A 4NLCA 4QYRA 3ZNUA 4JI1J 2DR7A 3OYGA 3CC4N 1T03B 3CCLS 4NXNK 5FPDA 3C94A 5AQWA 1HMVA 3HD2A 4JEPA 1BIZA 4HHJA 3IKMA 4HLBA 4WBFA 1N6QB 3W62A 4C0BA