3MEGA

Hiv-1 k103n reverse transcriptase in complex with tmc278
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords p66 Reverse transcriptase
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Etravirine (TMC125) and Rilpivirine (TMC278): Implications for Drug Design.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 148
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3megA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3megA05
3V4IB 5HBMA 4M95A 3MTKA 3AO4A 4QCLA 3AO2A 3RRGA 3CJ5A 2HVIA 1N6QA 2ILYA 4ECZA 4CHZA 3A2FA 1S9GA 1RT5B 1VSDA 1WSGA 3QETA 4IFYA 3MXMA 4KTWA 4DL3A 1J5OA 3NE6A 3DYAB 2FVQA 4DTOA 2HVHA 2G8FA 3KLVA 1DTQA 3O4NA 2IBKA 1HRHA 2FJXA 4RNOA 4RW7A 1ZBUA 1L3SA 3TWHA 5KT6A 3NCIA 1RT7B 1VSLA 4B08A 1L3UA 1RT1B 4W5RA 4CJQA 3UR0A 4OPKA 5FDLB 2HHTA 5HP1B 4PUOB 4CJEA 4F3TA 3SJJA 2DTUA 3ZT0A 4KHMA 1TAUA 2OPPA 2XRIA 5KG4A 3HP6A 1G15A 1RTJA 1LV5A 3OL9A 1S0OA 3VQ5A 4CCHA 4KO0B 5F8NA 4OKKA 1B92A 4ELVA 2HAIA 1Z26A 4K4TA 3AV9A 5KFNA 3AVGA 1TP7A 4XPCA 4AHRA 3I0RB 3LZJA 4OLBA 5L1KA 5L1LA 2XCPA 2A1SA 1UA1A 3MAQA 2HHVA 2YHBA 1WNEA 2FBVA 2DFHA 2DFEA 3NF6A 1SUQB 2BE2A 2VA3A 2F96A 3IN5A 2YKNB 3V4IA 3LDSA 4M3WA 4CGIA 5KFLA 1VSHA 3VQSA 4TYBA 1JX4A 2Q3SA 4KHQA 3AVAA 2Z1JA 5DG7A 1RT5A 3PX6A 4EBCA 1RBVA 2R8KA 4JLHA 3TAPA 4QW9A 2OH2A 3QEVA 1LWFB 3DYAA 1SKSA 3NF7A 3ZT4A 1A5XA 3DLEA 1WN7A 3OSNA 3OYFA 4ZPDA 1VK0A 1WSFA 1HQEB 3M8SA 5D3GB 1RT7A 4MK8A 1T3NA 3BGRB 1JL1A 2F8TA 2FJVA 3IAYA 2X78A 5F9NA 1LAVA 5CZ2A 5C42A 5FDLA 4KREA 3PUFA 3NAEA 2AWZA 5HP1A 1U45A 4PUOA 5KFHA 1WSJA 1NJWA 2GC8A 3OYMA 3JSMA 1X9WA 1XR6A 4KHYA 2IC3B 3HJFA 2XY6A 3BR9A 4KI4A 2IM1A 2UUWA 3L2RA 1RTIA 2E6MA 3CJ0A 3CVKA 3T5HA 5EDWA 3CM5A 3AO5A 4ZPAA 4L8RB 4KO0A 1T7PA 4DU4A 3LAKA 2KFZA 4FJXA 2PY5A 5JS1A 3SUQA 4DEZA 4ECQA 4DQQA 3BJYA 5KRSA 3PX4A 4W5NA 3MXJA 3QIPB 4F2SA 4W5OA 1Q9YA 1QUVA 4R0EA 5KG7A 4O5BA 3N6LA 4EZ6A 2HNZB 4Y2CA 3RAXA 4ZHRB 1RCHA 1DLOB 2Z1GA 1SUQA 3TAGA 2YKNA 2Z1IA 3OHAA 4AHVA 3RB3A 2ZQBA 4ZP7A 2ATQA 3O4QA 3SUOA 4FJ9A 1W9HA 3DLRA 4HCBA 3QNOA 1YT3A 1LWFA 4XO0A 1MU2B 2X6NA 5SZTA 1B9FA 4O0JA 1HQEA 5D3GA 3K5NA 2YKMB 2IGIA 4FLZA 3BGRA 1C0TA 3K58A 3M8QB 3LWLA 3MEDB 4OPJA 2HHUA 4KB0A 1JLBB 3D45A 3VQ8A 1VSJA 2IC3A 2W8KA 5KT4A 3PW2A 1EETB 1NJZA 1BGXT 5KFDA 2JGUA 3KK2B 4DLGA 2EC0A 3V6KA 2WCXA 1KVCA 4IH7A 4IRCA 2W9BB 2B6AB 3ALYA 3SV4A 3HYFA 2AU0A 3C6TA 4F4XA 3I5BA 4J9KA 3SPZA 2XC9A 4GVMA 2AJQA 2GIQA 2VG7B 3GIJA 2KW4A 4YFUA 4NCAA 1S48A 2YNHA 4WXWA 2J6SA 4TN2A 5HRPA 4F4WA 4BDPA 3PO4A 1BQMB 1TKTB 2HNZA 3H4DA 3JYTB 4ZHRA 1DLOA 5CY4A 4E7LA 3IRXB 3QIOA 3SQ2A 3LP0B 1D5AA 3H5XA 4CEQA 2RDJA 4RW6B 3ZSYA 2D41A 3TQ1A 3NGYA 4MKAA 1NHUA 1WAFA 3OYEA 5C5JA 3SFUA 4NRTA 4QPXA 3RRHA 5C24A 2J6TA 1MU2A 3ZT3A 4DTSA 2UVVA 3DLKA 2JEGA 2LSNA 4LQ3A 3EPIA 2RKIB 1D1UA 3VQ9A 4CGDA 3VQPA 3DRPA 2A1RA 2YKMA 3PY8A 4DL5A 3DM2A 3VA0A 3NAHA 2EX3A 5KFJA 3SI8A 3M8QA 3CJ2A 4FJ8A 5J1EB 4IG3B 1GX6A 1GX5A 4CEFA 5KGXA 4H54A 5FRMA 3NGDA 4O3QA 2V0NA 3AA2A 4ZVGA 4FS2A 1NK8A 3OYNA 3T3FA 3KK2A 2ETJA 3CJ3A 2P1JA 3H2LA 4ED2A 5CZ1A 1A5WA 2BANB 1HJRA 1T8EA 2B6AA 4RW4B 4E7KA 4FW1A 3FQKA 1YVUA 4QWBA 1LWCA 4RW8B 4EP4A 2VG7A 3AVNA 3BREA 4JV0A 4J9RA 5HLFB 5DGAA 4C8KA 1HNVB 4IKFA 3OVNA 1T94A 1TL3B 5KI6A 1BQMA 1NJXA 1TKTA 1RTHA 3QIDA 3JYTA 2E4LA 2CKWA 3IRXA 3GIKA 4O44A 3E01B 4B9SA 3LP0A 4ID1A 4KTZA 1CXUA 4RW6A 1JLCB 2G8WA 4KFBB 5J2QB 1KVAA 1GOAA 4H8KA 1NNDA 2JEJA 1CLQA 3WNGA 4FJKA 2YV0X 2C2RA 5C25B 4Q8FA 4ICLB 3AVCA 3VQ4A 2BDPA 4Y1CA 2RKIA 3ZSZA 2R8GA 3QO9A 1KSPA 2XHBA 4NLYA 2GIRA 3ZSRA 4Y1DA 3KKSA 3ZSXA 1C6VA 3WNHA 3BDPA 4O55A 3OYGA 4CEDA 4IQXA 2VWKA 1HYSB 4CEOA 1W0HA 2GBZA 3OYIA 4QWEA 4DF4A 4DWIA 4IG3A 2X6SA 4DTMA 3LWMA 1NK0A 2V4RA 4EO8A 2ATLA 1LWEB 3BQ2A 4KSEB 2J6UA 4OKEA 3L3VA 3QERA 1WSIA 2PYJA 3E51A 2BANA 2FJWA 3L2WA 4RW4A 1RDCA 4DFMA 1TAQA 2YNIB 4RW8A 2XY5A 4K50A 4NLUA 5EU7A 5HLFA 3T5KA 5J2NB 2FVPA 3LP1B 3QZ8A 2AX0A 4IR9A 3WNFA 4IDKB 2DY4A 1ZTWA 1TL3A 3H59A 4EP5A 1FXXA 3V1RA 1N6QB 3RWUA 3PR4A 4R5PA 4HUGA 3VQEA 3E01A 1NK7A 3K5LA 1JLCA 4KFBA 1U04A 4ZVHA 5J2QA 1A5VA 3L2QA 1RT3B 2RF2B 1XR5A 5DQGA 2V4QA 1BCOA 4FLVA 1QS4A 1BCMA 4FK2A 4ED7A 2O4IA 5C25A 4ICLA 1RT2B 4AHSA 3TAQA 2HHWA 1REVA 1J9AA 1TK5A 2R8JA 4KKOB 3MFIA 1HYZA 1RDBA 4MKBA 3D28A 3DLGA 4O3SA 4IR1A 1HYSA 1CZBA 4GMJB 4KAIA 3VQ7A 3U6FA 3H5SA 3TI0A 1XWLA 3BSAA 4X2BA 3LAMA 1LWEA 3RMDA 2Y1IA 3RMBA 1TQLA 4DFPA 3TANA 4NYFA 1XR7A 4M3ZA 2FLNA 1KVBA 1SV5B 3TAEA 4FXDA 3TAMB 2XI2A 3CM6A 5KFGA 1KHWA 5KFUA 4K4SA 3GIMA 3GV5B 4HUEA 2YNIA 2D3ZA 1XC9A 3BSNA 3P83D 4M41A 5DQIA 4Q45A 4HCCA 2HMIB 4R8UA 4E0DA 4Z4GA 5J2NA 3V6DB 1UA0A 4NLXA 3LP1A 4Y3CA 4OGEA 4IDKA 3V9XA 5F8HA 4Y34A 3L2VA 1S49A 4FK0A 3HHKA 4FM1A 4N47A 3OS2A 1QAJA 3IGNA 5F9LA 1NKCA 3DLEB 4NLOA 4XPEA 2G8UA 1RT3A 2RF2A 3K2PA 3H4BA 4RU9A 1BHLA 4JUZA 3RMAA 3CDWA 4BACA 2OPSA 5KG5A 4LSNB 4K4WA 1KLMB 1UAXA 4OL8A 3Q8PB 4DL6A 1RT2A 2FVRA 4NLTA 3EY1A 5C42B 5KT5A 1EXQA 4DU1A 4Z4CA 2VG6B 2IM3A 4KKOA 3JSMB 4KHSA 3ZSOA 2D7SA 3RB0A 2IDOA 3Q8QB 1RTIB 3CG7A 3PR5B 1LW0B 4N56A 3AVKA 3PJWA 1X9MA 2WONB 3KNAA 1SH2A 4KE5A 4CFBA 2WHOA 4IRDA 4JV1A 1N56A 2WRMA 3OYJA 4JS4A 1SV5A 3G10A 4FJLA 1HARA 1IG9A 4ED3A 5KFIA 3TABA 3TAMA 4K4XA 4DSLA 1C2PA 3QGGA 1NJYA 4DFJA 4RNMA 2KFNA 3SQ0A 1Q8IA 4WFXA 2KTQA 1CXQA 4CJPA 3G6YA 3H08A 2HMIA 4YR0A 3V6DA 3AA4A 2AX1A 2IJNA 4KTQA 4Z4IA 3PW4A 4QAGA 3O3HA 4DTUA 3U3YA 5KFRA 1VSMA 3O3FA 3OYLA 4U7CA 4B9UA 4JS5A 1C0UB 1IKXB 4RZRA 1S5JA 2R2UA 4HUFA 3KHRA 3CO9A 2XY8A 3OS0A 2Y1JA 3PW7A 4LSNA 3SQ1A 2HHSA 4CJFA 3QZ7A 1KLMA 1K1SA 3IS9A 4FJJA 3MR5A 1C0TB 3ZT1A 3AVIA 2YNGB 2G8VA 1HYVA 2VG6A 3KHLA 3SQ4A 3MXIA 4O4GB 4NZ0A 5EWGA 4CF2A 3VQAA 3OYHA 5DLGA 4KHWA 4URQU 4DSFA 1S97A 1N4LA 4DL4A 1LW0A 4FJIA 1NHVA 3NAIA 5DGBA 4FS1A 2WONA 3CFPA 1BIZA 4J9SA 4IRKA 2BRKA 3C6TB 4ZVEA 1D9FA 1QSYA 4F2RA 5KGWA 4RNNA 4M3UA 4TXSA 2HHQA 2YNHB 3N6NA 4F4YA 3K5OA 1U49A 1WLJA 4TQSA 5DLFA 4LY7A 4LD0A 1S1XA 3KMSA 4RG8A 1U09A 3FQLA 2D0BA 4BE0A 4IFVB 4Z0UA 2R2TA 4ZP8A 3SFGA 2XY7A 2YNFB 2E9ZA 5C24B 1NK9A 1C0UA 1IKXA 5KFAA 1X9SA 2XO7A 4RUCA 1LAWA 4CERA 1C0MA 3KD5E 2IM2A 4JRPA 4DTPA 3DLKB 3KIOA 3HPHA 2OPQA 3DRPB 1VRUB 3DM2B 3IGVA 4ZP6A 1VSIA 2YNGA 5JUMA 1TK0A 4F4ZA 3TAFA 3OS1A 2KZZA 3RB6A 5F8JA 1CSJA 4O4GA 3KLIB 5CYQB 3F73A 4E7IA 1D0EA 5L1JA 3QLHB 2D5RA 4ECYA 2OZSA 3V1OA 3C94A 1YTAA 3ASMA 1TKDA 3CDEA 4I2PB 4FM2A 1LWCB 1ASUA 4FJHA 1JXLA 5EWEA 4KHRA 2JLEA 2KZMA 2FVSA 4CEEA 4CEZA 3ITHB 2ASJA 4FLYA 1RTHB 4KHNA 1Z25A 3UDLA 5KG3A 4WFZA 3T1AA 3AA3A 4O44B 3V6HA 4Y2AA 2D3UA 2R7YA 3QGIA 4J2EA 2OA8A 1L3TA 1ZBHA 2BGGA 5HRSA 4IFVA 4DSJA 2QK9A 3CJ4A 1S1WB 3KK3B 2YNFA 3OYCA 4EBEA 1D8YA 2E6LA 1SKWA 5KFPA 4IH6A 4RNHA 2HWIA 5CYMB 1TK8A 3QO9B 4I9QA 4J9NA 4CIGA 5KTQA 1VRUA 3FFIB 4CHOA 4OVLA 4I2QA 1S0MA 1RT4B 3AO3A 3AVMA 4EBDA 3H5YA 1UWBB 2ZKUA 4NYZA 4CESA 3KLIA 5CYQA 2EHGA 3Q8SB 3DRRB 1RNHA 3QLHA 4H4OA 1BL3A 4B9LA 3BSOA 4FLUA 4MK9A 4K4ZA 2XCAA 2QKBA 4HHTA 2B5JB 4LH4A 2JC1A 4KB1A 4FJMA 2HNDB 4CHPA 1U4BA 3PV8A 3UQSA 1S0NA 4WFYA 4I2PA 2OPRB 1JLQB 1KCFA 5KRTA 3OYDA 4DQSA 1IO2A 3EZUA 4NRUA 1DTTB 4E7HA 3EPGA 4DSKA 4NLPA 3KTQA 3ITHA 1FKPB 4ELUA 1KLNA 5DK5A 1XI1A 3SV3A 2UVRA 3I0SB 1NKBA 4R5PB 3BQ1A 4CJVA 2PZSA 2W42A 1BI4A 1IH7A 4CHNA 2HNYB 4MH8A 1RBSA 5KG2A 3M9NB 4CK3A 3G0ZA 3QINA 1YTUA 5L9XA 4E3SA 4NLVA 4FZYA 1HMVB 2IJFA 4QWCA 1S1WA 4KPYA 5KFQA 3KK3A 2FVCA 4NLSA 1IM4A 3B6PA 1FK9B 4N76A 4B9MA 3NGZA 5CYMA 4MIAA 3QEPA 2DPJA 1REVB 4J9MA 1TKXB 3FFIA 4WZMA 2IAJB 3V6JA 3DLGB 2IS3A 5JS2A 1QQCA 1NOZA 4CJLA 3GYNA 4EEYA 3HSTB 4B9TA 3GILA 1HNIB 1RT4A 2ILZA 4OGCA 2GUIA 1UWBA 3GIIA 3NH0A 3T5JA 1JLEB 3MEGB 1Z4UA 4FM0A 1S1TB 3DRRA 5KG1A 4DS5A 3Q8RB 1QSSA 1BIUA 3WNEA 2ALZA 4ECUA 1QTMA 2I5JB 4PWDB 4C8MA 3S3MA 3AVHA 4QW8A 2YHAA 3DOLB 2B5JA 1ZTTA 4Q5VA 2OZMA 2HNDA 1NKEA 3NF9A 2JC0A 3KLHB 4CHYA 2OPRA 1JLQA 4R8UB 3QEWA 2C2EA 1DTTA 1KFDA 1QHTA 2ASLA 4HKQA 3DOKB 3AO1A 1FKPA 3GQCA 1K6YA 3M9OB 3I0SA 3N6MA 1ASWA 5E41A 4K4YA 3HO1A 4OLAA 4I9LA 3OJUA 3V1QA 1RBUA 3GV7B 5KFBA 4CF1A 2HNYA 2KQ2A 4CF9A 5KT7A 4M3RA 3ZT2A 1S9FA 3KOAA 1HMVA 1ZETA 2F8SA 3T5LA 3AVLA 2OPSB 2HHXA 1S9EB 3OYKA 2G8KA 4ELTA 3EYZA 1RA6A 1S1VB 1KRPA 3FDSA 2O4GA 4DF8A 1FK9A 4DSIA 3NMAA 2VWJA 4FCYA 5EUHA 4CEAA 4ECXA 3KLGB 5KFTA 1TKXA 2X74A 3P1GA 1JXBA 2IAJA 5KFSA 5KFEA 5SWMA 4TY8B 1RTDB 1RYSA 4IKAA 1FKOB 1HNIA 2P5GA 3RTVA 1JLEA 3MEGA 4Q8EA 1S1TA 3RMCA 3G6XA 2W9AA 3AVFA 4DL2A 5KFZA 2I5JA 4PWDA 2BQRA 4FLTA 3CWJA 3RAQA 3PO5A 3HPOA 3DOLA 2W8LA 3NF8A 3KLHA 1S6PA 4KI6A 3K5MA 3G6VA 4F50A 3MR3A 4J9LA 4EYIB 1UOCA 4M45A 3PVXA 4O4RA 3DI6B 3ISND 5T14A 1S10A 3DOKA 5JXSA 1ZBIA 5J2PA 1JLGB 1JL2A 1Y97A 4FK4A 4ZMMA 4E19A 4YR3A 2R8HA 1XHZA 3EZ5A 1ITGA 1KFSA 3PZPA 4CJKA 4BE2A 4Q43A 1RT6B 1SL2A 3PJXA 2IOCA 3V81B 3QESA 2JEFA 4GC6A 5I42B 4FZXC 1S9EA 1TV6B 1W25A 3IS9B 3D5MA 3VN5A 2C28A 1S1VA 4GW6A 2CJQA 4PY5A 4BWJA 5DG8A 1C1AA 1BQNB 3OY9A 3NH2A 3QEIA 2UVUA 3KLGA 2RN2A 3MFHA 4C8OA 4IH5A 4CGHA 1RDDA 4DSEA 3QYYA 4DLEA 4TY8A 1RTDA 5FRNA 1FKOA 3SYZA 4OKJA 4NLQA 2XGQA 5I3UA 1JIHA 5L1IA 3K59A 5T7BA 4FW2A 4O3RA 3CQ8A 1NK4A 1L5UA 4NCGB 1RDRA 4M3YA 1S6QB 4WE1B 3DLHA 3SI6A 4ED1A 2FBXA 3NHGA 2IMWP 4FZZA 2JEIA 4BWMA 4N41A 1VSKA 1S1XB 5KFYA 3DI6A 1JLGA 4WYLA 4ECRA 3HPGA 4F8RA 1HQUB 3KHGA 1T03B 3M8RA 3HM9A 5F8MA 1XHXA 2FC0A 4N5SA 1BISA 4JV2A 4IBNA 1JXEA 1QAIA 3MF5A 2F8EX 4CE9A 3FSIA 1L3VA 3VQQA 3S3OA 4C8LA 3CIZA 1RT6A 2OPQB 3V81A 1JLAB 3PW5A 3V9UA 3MR2A 5I42A 3NBPB 1TV6A 4O3PA 3CFOA 4EO6A 4DU3A 4IG0B 4FVMA 1BQNA 3DLBA 4DTJA 2R2SA 1RYRA 3TR8A 5DMRA 3I5CA 2XWYA 4MQ3A 4CJRA 1N5YB 4J9PA 1NK5A 4CGJA 1JLFB 2FLPA 3RBEA 3OHBA 4B9VA 1T05B 2P51A 4ED0A 2W9CB 2B4JA 1RT1A 3F9KA 3SPYA 4ZTJA 2G8IA 5KG0A 4KAZA 4LH5A 1TKZB 3P5JA 3M9MB 3VQBA 3KJVB 3AVJA 4NCGA 4ECTA 3IG1B 4KBIA 1S6QA 4DFKA 4CK1A 4WE1A 2IA6A 1TGOA 4FJNA 2ZE2B 4CFDA 2FBTA 4CHQA 1NK6A 3L3UA 2RDIA 1VSFA 4YP3A 4E89A 2WTFA 3MECB 1SKRA 4TYAA 4URGA 1KHVA 4EYHB 4EZ9A 3NFAA 3VQDA 1TL1B 5K14B 4TQRA 3LPTA 1S4FA 4CFCA 2XI3A 4U6PA 3GV8B 4ED8A 3THVA 4FJGA 4J2BA 3I0RA 4MIBA 1NOYA 1HQUA 1EKEA 1T03A 1X1PA 2BRLA 4FLWA 4ZTFA 2QE5A 4DTNA 1U48A 5EWFA 4DMNA 5F8IA 4LQ9A 4M42A 3VQCA 4C8NA 2DFFA 2QXFA 4E7JA 4CJ5A 4B8CA 4K4VA 4BE1A 5HRRA 3QNNA 1JLAA 1D9DA 3NBPA 1WNSA 3NH1A 1IKWB 4IG0A 2UVWA 3V9ZA 3NGIA 2G8HA 4J2DA 3QGHA 4BDYA 2DPIA 1RA7A 4I2QB 4FBUA 3ICLA 1WSEA 1N5YA 4QWDA 1JLFA 4YNQA 3LANA 4H4OB 1T05A 4FJ5A 2QKKA 2W9CA 3KK1B 1EX4A 4CJWA 4M94A 3HK2A 1TKZA 4FBTA 3TVKA 1O1WA 2B43A 3KJVA 4CJ3A 3IG1A 3KD1E 3S3NA 3NL0A 4DQPA 1QE1B 4O3NA 3VA3A 3PW0A 3OLBA 3HVTB 1EP4B 2ZE2A 4QWAA 4CIEA 3LP3A 2BQ3A 2W7PA 2W7OA 1RBTA 1HPZB 3V9WA 4K8XA 4ID5B 4DQIA 3DMJB 3MECA 5KFCA 4ECVA 3FRZA 3PHEA 4Z4HA 1JKHB 1TL1A 5K14A 4I7FB 2ITGA 4AHCA 1BI4B 1CZ9A 1TVRB 3QIPA 4ED6A 4BDZA 4ZPBA 3KLFB 5KFWA 4FLXA 1ZYQA 1LW2B 2UUTA 4G1QB 3ULDA 1SL1A 4IOBA 2HW3A 4ZVFA 5KT2A 3B6OA 1R0AB 3HT3A 3HVAA 4YMEA 4KV8B 1IKWA 3AVBA 3UIQA 1WSHA 4MFBB 3PX0A 2AGQA 1I3AA 4CJSA 3H40A 3BSCA 3T19A 1ZBFA 2WB4A 3ZSVA 4JRQA 1WAJA 1RDAA 1RILA 4HTUA 2XGPA 2O5DA 2WK4A 3RB4A 4TLRA 1U47A 3KK1A 4CJTA 3M8PB 4WXOA 4E1MA 1VSEA 1N48A 3MEDA 3NKYA 3OL8A 1JLBA 4RW9B 5KFKA 1EETA 4AH9A 2VG5B 2WOMB 4Z4EA 1QE1A 1I39A 1C1CB 5DQHA 3OL6A 3ZSWA 3HVTA 1EP4A 4LSLB 4DTXA 4M3XA 3LALA 4DS4A 3VQ6A 4QOZB 2W9BA 3KKRA 1HPZA 3QEXA 4ID5A 2C2DA 3RR7A 1K1QA 3DMJA 4Q0BB 3O3GA 4NLGA 4K8ZA 3LPUA 1JKHA 1SH3A 2E9TA 4H4MB 3HP9A 3OL7A 4I7FA 3DDKA 4KRFA 4NLWA 4B9NA 1TVRA 3CYMA 4CF0A 3KLFA 3K57A 4NCBA 4O3OA 1LW2A 4NYNA 3HXMA 5KFFA 4G1QA 4J9QA 3L2UA 4O0IA 4CEBA 1RAJA 5HROB 4CECA 2GV9A 4AILC 1R0AA 2AGOA 4B8AB 1ZBLA 4B3OB 4KV8A 3HKWA 4ECSA 3OLAA 3C6UB 4Z4FA 3KHHA 4PQUB 1ASVA 4MFBA 5KG6A 3KLEB 4W5QA 3DRSB 3SUNA 3NDKA 3BQ0A 4FJ7A 1RBRA 2D0AA 1S1UB 3TARA 3S9HA 3I8DA 3RR8A 3ZSQA 4ZP9A 3OYAA 4YQWA 2D0CA 3M8PA 3CFRA 3H5UA 1IKYB 3MEEB 2ZD1B 5J1EA 3H98A 4WYWA 4RW9A 1GOCA 1J53A 3SZ2A 5KT3A 2ASDA 4J2AA 1VRTB 2VG5A 2WOMA 4AHUA 1S6PB 1IKVB 3LP2B 4RUAA 3ZCMA 1C1CA 5J2MB 4CJ4A 4LSLA 4OJRA 3OYBA 4TSXA 1SL0A 5J2PB 4G3IA 1I6JA 4HYKA 4Q0BA 4DG1B 2E9RX 2BQUA 4CJUA 4KHUA 4RNFA 2HB5A 4H4MA 3D0PA 1C1BB 5KFVA 4DL7A 4AHTA 4PA1A 3UPFA 2VA2A 1HNVA 5HBMB 3CDUA 4E1NA 4FYDA 5KFOA 2OYQA 2BR0A 1S9GB 4IFYB 1J5OB 2FLLA 4CGFA 1QSLA 2FBYA 3LZIA 2QV6A 1F21A 1KTQA 5HROA 5F8GA 1GOBA 1YVFA 2AGPA 4B3OA 1DTQB 3C6UA 1MMLA 4PQUA 3G86A 4RW7B 5KFXA 4NLDA 2NUBA 3KLEA 3DRSA 4M3TA 2HWHA 1OS5A 1S1UA 4HVJA 3MR6A 3KMQA 1B9DA 3HL8A 5I3UB 5DG9A 2R2RA 3L8BA 2Z1HA 4K4UA 4NLRA 5F8LA 2AQ4A 4MK7A 3OJSA 4F3OA 2OPPB 4Q44A 1IKYA 3MEEA 2ZD1A 4URSA 2P5OA 1RTJB 2RPIA 4CF8A 3OSPA 4YR2A 2R8IA 3SCXA 4GC7A 3SNNA 3V9SA 3HVRA 1VRTA 4XIUA 1IKVA 3LP2A 4ECWA 3I5AA 5KFMA 4DTRA 5FROA 2IM0A 5J2MA 4CFAA 3RBDA 4TY9A 3C95A 1J54A 3AA5X 2C22A 4KB7A 1Q9XA 2V9WA 3SUPA 4F4KA 3U3GA 2PYLA 3HVWA 4DG1A 4CIFA 4CK2A 1SH0A 4WZQA 4UQGA 4W5TA 4ZPCA 4CGGA 4DQRA 1C1BA 5HRNA 3ISNC 2I1RA 2BE2B 4J9OA
chains in the Genus database with same CATH superfamily
1GTEA 5E84A 3WUHA 1FDDA 3W2WA 1XBWA 2ILYA 4IFYA 3MXMA 3NE6A 3DYAB 3KLVA 1VJQA 5ETTA 1DTQA 3O4NA 2O8EA 1HRHA 2IIHA 3AAQA 1RT7B 1VSLA 1L3UA 1HR0J 2AKWB 2WVDA 4C98A 4CRJA 5FDLB 2W2MP 1WJ9A 1LWXA 1Q53A 5KG4A 3HP6A 1G15A 1U24A 2CPYA 4G9ZA 1YAGA 2AJ2A 3CC2N 3QNWB 3KVGA 1S0OA 3VQ5A 1NLVA 3OTEA 4DR7K 5F8NA 4ELVA 5C7PA 4H5NA 3D4JA 4DV7K 1MWKA 3KZBA 3BZKA 3AVGA 1X4BA 2AP6A 1CBKA 4AHRA 3I0RB 2XSJA 4OLBA 2KXHA 3N4PA 4MYUA 1NGJA 2XCPA 2DFHA 1KQKA 2WC9A 5BPLA 3V4IA 3K7RA 5BR8F 2YX7A 4CGIA 2J0SD 4C8ZA 3I56N 1R8CA 2CPZA 1RT5A 4NLBA 1SKSA 3CJ9A 3QEVA 2XMVA 3ZT4A 3W61A 1A5XA 2B4VA 4U8YA 3FCVA 3THTA 5M2RA 3VGVA 3WQUA 1GXTA 4EI2A 2A3JA 3RSEA 5D3GB 2VQFK 5HANA 1TUWA 5AQIA 5E3CA 1XNQK 4X4TA 3IAYA 1LAVA 3SMZA 5C42A 2J5AA 5B7WA 1NJWA 2ZGYA 4PUOA 3JSMA 2WB1D 1X9WA 3CW2C 1W7AA 2DNGA 3HJFA 3BR9A 4KI4A 4USKA 2UXCK 2LCWA 1RTIA 3OFHA 1YJTA 4WU2A 2E6MA 2RHQB 2EVZA 3T5HA 3HFVA 4U7UK 4KO0A 1PGZA 1T7PA 4DU4A 3UDCA 5JS1A 4DEZA 5GMKa 2V8GA 2AIRB 2F3JA 1KQSR 4F2SA 1QUVA 3FVYA 4R0EA 5KG7A 4O5BA 2HHHJ 4Y2CA 2XYHB 3RAXA 3BM7A 2E1MC 1DLOB 2GQCA 3H2VE 3W5ZA 5KPZA 1SCJB 2CG4A 5CCLA 4DV4J 3O4QA 1W9HA 4HCBA 3FE1A 3LDLA 5SZTA 4JKDA 2KT5A 1HQEA 1QVFM 2APOA 3AHPA 3IBCB 2RJZA 3M8ZA 3BGRA 3K58A 3M6UA 3LWLA 3M32A 5LMUJ 3K0JA 2HHUA 4KB0A 4YOXA 3QAUA 4UQTA 2IC3A 1IM6A 4OI2A 5KT4A 1ICEB 1NMEB 4ANEA 3J81Y 1VK8A 2CQIA 2KB2A 1BGXT 4QYZK 4FKXA 4A5AA 2MZRA 4P6QA 4CZHA 1FNMA 2WCXA 3EMTA 4FP9A 1KVCA 2GX9A 1CS4B 2W9BB 2AYMA 3HFKA 1QQOA 1FRLA 1BC6A 4X64K 4F4XA 2XC9A 2GIQA 3HHLB 4GVBB 4JV5F 3W9IA 2YNHA 2UUBF 4W4MA 2HG4A 5BN9A 3UB5A 1AFIA 1EAYC 4GRSA 2PAVA 1BO5O 3THYA 3PO4A 3J7A1 3MWPA 2HNZA 1NUEA 3JYTB 5IM0A 4ZHRA 5CY4A 3IRXB 3LP0B 2RDJA 3TQ1A 4LUBA 1G1XA 4MKAA 1WAFA 1RXOB 3SFUA 5JJBA 5M1KA 5IT9Y 2J6TA 3MCOA 3R5DA 2Q66A 1U1PA 2QMUB 3CC7N 2JEGA 2LSNA 2MY7A 2RKIB 4BRGA 1D1UA 1JJ2R 3IR7B 2I6WA 3VQ9A 3VQPA 3MEKA 4NA1A 2A1RA 3PY8A 6FD1A 4DL5A 1U8WA 1KQGB 2O8BA 2RHKA 2OKQA 3SI8A 4EIAA 4X4PA 2ZZMA 1GX6A 2F40A 2C2MB 3AA9A 1VHIA 1XJWB 4FYVB 4OPHA 5F3ZA 3QT7A 4YB5A 1QM9A 4P72A 3GIRA 3NGDA 2P9IA 3VMFB 4OYWA 1Q18A 3CJ3A 3IMQJ 4ED2A 2M52A 1JCGA 3MUMP 1HJRA 4F7VA 2B6AA 4RW4B 4E7KA 1VQON 4FW1A 1NZ8A 2RB7A 3FQKA 4DPXA 4K25A 3I56S 4RW8B 4IEIA 1HWUA 4J9RA 4P75A 2GJFA 5DGAA 1HNVB 3J81j 1T94A 5GAGU 3T6BA 4OV6A 1BQMA 3H25A 3NRBA 1TKTA 1NJXA 4FPBA 1HR0F 4U8VA 2CKWA 4ZCKA 3GIKA 1WHYA 4B9SA 1SC4B 5J2QB 1T02A 4LSZB 3OT9A 1GOAA 1NNDA 2JEJA 1CLQA 4BVPA 4FJKA 2YV0X 4WQ5A 3PIOQ 1WSRA 4OI4A 5C25B 4ICLB 3U4LA 3VQ4A 1Y10A 1HFEL 4USJC 4U96A 1YIJS 1SAZA 2UYTA 4WFAQ 2XHBA 4OX9J 5KQ8A 3KKSA 4A8YA 2CAJA 3BDPA 4CEDA 2CH6A 2DTJA 2GIFA 3SXLA 4CEOA 1O51A 2GBZA 1IJFB 1UAWA 3MCMA 1D9AA 1Q81T 1RE1B 2ATLA 4DX8H 5BYRA 3R1HA 3NEKA 4XTTA 2OANA 5IS2A 4KSEB 3N5FA 1VQ5S 3CCRN 2HBQB 2PO4A 1TYQA 3T41A 3PIPQ 3E1YA 2CQ4A 5CAAA 3E51A 2BANA 4DR6K 2NSCA 3G2XA 2YNIB 1EB0A 2ZUAA 3D3BJ 3V2UC 4NLUA 1FRXA 3T5KA 3D7SB 3LP1B 2AX0A 2NR0A 4JI5J 4CTAB 3WNFA 3EVMA 2KI2A 2UXDJ 1DZ5A 4EP5A 1FXLA 3NNHA 1FXXA 1I51B 1N6QB 3JTOA 5HL7Q 4DCPB 4Y6IA 1JLCA 2HSEB 3ZC4A 1FF2A 3OBIA 2KDOA 1A5VA 3ZTRA 1VQ4N 3CPWR 5FPEA 1TUUA 1QS4A 4ZPWR 2QLBB 2HK2A 4ZVSB 4N8NA 2VC1A 5K8NA 1P6TA 4HVZA 1EKRA 2KN4A 3VZHA 4C1NI 4CBUA 3H1VX 1G4CA 1HBUA 2LFVA 2R9LA 4J8FA 2MKJA 4KKOB 3LH2S 3DOMA 1HYZA 1VMBA 1HYSA 2VFSA 1MDUB 4WQ4A 4KAIA 3VQ7A 3U6FA 2YKQA 4X84A 1FI4A 1WF2A 5D78A 1XWLA 3BSAA 1LWEA 1CJVB 2HHHF 3FCWA 4USHA 1TQLA 4DFPA 3JXOA 2OSQA 4M3ZA 3LDOA 2FLNA 2CJBA 4Z2XA 4DV4F 4C23A 5GIOA 3P31A 3GE9A 1O6XA 2W1BA 1Z2ZA 3QSYB 4AE5A 3PRVA 1Y5LB 3MGJA 1B0TA 2HMIB 4E0DA 4KH0B 4Z4GA 3DAWA 4DPTA 4PAAA 2BYCA 5LXRA 4Y3CA 4I6AA 3J7Z5 5F8HA 1S7HA 4MO4A 2LKZA 1V4TA 4WYBA 4Y2KA 5LMUF 2COLA 3HHKA 4QR0A 4FM1A 2Q2RA 4GY2B 2XMKA 1E6VB 3VOVA 2HURA 2FDNA 2F4VJ 1RT3A 2RF2A 3BEGB 4CH1A 4RU9A 3IUCA 4DV5K 1BHLA 4BBYA 1FRHA 2D3OR 2L3MA 1KLMB 1WI6A 1UAXA 4U67L 3VF2A 1RT2A 4H0TB 1HUXA 2DNKA 4FNIA 3P96A 1AA1B 2X51A 5KT5A 3OVBA 1EXQA 2VG6B 1YK9A 4FN5A 4C7QA 2FSNA 2EWHA 1RWMB 1YKWA 3O9QA 3RB0A 2IDOA 4DPYA 1GK8A 3PR5B 4N56A 2F8MA 3AVKA 1YJNS 1F9EB 3R3LA 1EHWA 4KE5A 2WHOA 3WXMB 2O01C 2WRMA 2DRBA 3TW0A 4TU8A 1Y11A 3HHLD 2BM1A 1S59A 3UFCX 3L4BC 4DV3K 1C2PA 2ZWHA 3GB0A 2N4CA 3UNGC 4NYOA 3BBBA 5JVHL 3G6EN 3SQ0A 1Q8IA 4JD2A 2ASOA 3H08A 2LEPA 3P49B 4Z4IA 3HRGA 4BRLA 5F1XA 3OYLA 4B9UA 1RWUA 4C0BA 4RJVA 4NA3A 2HBRB 1C0UB 3P38A 4RZRA 1HNXK 3MM6B 2ZZTA 2DPNA 3FEXB 2XY8A 2LVWA 2Y1JA 1E6YA 2YWEA 3PW7A 4JI7F 2QLJB 4B3TK 3IMXA 2HHSA 1BUPA 1K1SA 5FLXY 1C0TB 3CCRS 1PYOB 2UV8A 3SQ4A 2G1HA 3HJVA 4NZ0A 2CUYA 1U1MA 1S97A 3MPDA 1N4LA 1U1RA 2HKEA 2ZBPA 1LW0A 3CJSA 2XEXA 2MEWA 4ZLNA 4Z7CA 4IRKA 1J5EK 3CD6N 5B0DA 3C6TB 4PG5A 3W9HA 1XN9A 4JKCA 4C3KA 1QSYA 3D6RA 1S0VA 5KGWA 4RNNA 4TXSA 2EXUA 3K5OA 2J7UA 3TZWA 4ZKAA 1X7VA 2FF6A 3U1MA 3QFWA 5H9FK 3TZYA 3THWB 4OX9F 4B3MK 3AOAA 3OFGA 3FQLA 2VKZG 4BE0A 3VV2B 4IFVB 4DR7J 4BG9A 2XY7A 3P39A 2GA7A 2K2PA 1ULRA 1X9SA 2NQPA 3GFXA 1C0MA 3SSQA 3KD5E 4DTPA 4GV9A 3DLKB 2IRUA 4MT1A 3M6GA 3HPHA 4WTYA 1T9WA 3DRPB 1X3NA 1VRUB 3DM2B 1HI8A 2HVEA 3EXCX 1TK0A 3GZ7A 2B8PA 2ZBRA 5F8JA 4QYRA 4O4GA 2VICA 3AY0A 5CYQB 1QHAA 1H7WA 5B0GA 5E7OB 1UETA 5EVZA 3F41A 5CYJA 2UXDF 3D0IE 2GWKA 1SJ4P 4CLTA 3O44A 2E1YA 3DGPB 1WOPA 2O8DB 1P1LA 1TKDA 2V8HA 2VQFJ 1LWCB 1XNQJ 2CNNB 1GAOA 2CDQA 2RSQA 2KZMA 4CEZA 3ITHB 2DNOA 2RUGA 4FLYA 2EFQA 4LBHA 2V51B 4IO9L 2UXCJ 4O44B 2YH0A 2B0GA 1NU4A 2D3UA 2R7YA 3QGIA 1FEEA 2HHPA 1PC5A 3K8WA 3ZZRA 5HRSA 2QK9A 2G2YA 4ZN1A 3CJ4A 4OJ3A 1S1WB 3QFUA 2VJUA 3KK3B 2YNFA 2NRTA 3CC4N 4TU9A 3QMQA 4N8OA 5B09A 4DR4J 1WG1A 1MWQA 4EWTA 4M5LA 5KFPA 2B4UA 3HKZD 5CYMB 2ZJPQ 3H2UB 2EKYA 1TK8A 4I9QA 2Z8QA 4J9NA 1U0SA 5GADU 1WC4A 2KM8C 2CQ1A 4KIAA 4CHOA 1UPPA 4DR3K 1NJIT 5T7LB 4DR5K 4G6VB 4YOEA 2NYIA 2DR5A 4I2QA 4OVLA 1UWBB 2VKRA 5IFMA 3R6LB 5CABA 2OI2A 3KKFA 1HKGA 4B9LA 3BSOA 2HAFA 2GCFA 3O9TA 3G96A 3ETOA 1K9MT 4K4ZA 3J81O 3FZLA 2XCAA 3KK7A 3MWTA 4K2JA 4JKGA 4KB1A 4FJMA 3DC2A 1U4BA 3UVJB 1S0NA 1UW4A 4DQSA 1WEYA 3OYDA 4JKFA 3U9ZA 3O6WA 3O5BA 1UWAA 1K9MO 4YOUA 4E7HA 3PLAA 1GNKA 3EDQB 4PXCA 2A6AA 3SV3A 2EG1A 4R5PB 4CJVA 2MLYA 3ZX0A 2I7PA 4JHDB 4YOTA 3H1QA 2P5VA 3BKFA 2BUPA 1NEEA 4TNOA 5ETPA 2ZDOA 4U9RA 4NLSA 3GCXP 1XMBA 4BR7A 3L4IA 4N76A 4B9MA 4OJ1A 1REVB 3OR1B 3GOIA 1VQ6S 4JKBA 1R3NA 2IDLA 3M5RA 1RJJA 3DLGB 1QQCA 1UVNA 3CD6S 3QJJA 1BU6O 3EICA 3R97A 3KUEA 1HNIB 4WF9Q 4GKKF 2VHGA 1S1TB 2MJNA 4DS5A 3CMQA 2BUNA 4YDUA 4K7QA 3QATA 1QTMA 2CZVC 1QVGR 3S3MA 2VU5A 2GVZA 3Q8UA 1ZTTA 4Q5VA 4UTGA 3UN5A 3VF6A 1P8ZA 4AQYK 2OZMA 1NKEA 3NGUA 2JC0A 1P9YA 4AL5A 2YX1A 2GHVC 4C48A 4DB3A 2P9UB 3T69A 3DOKB 1TELA 1I3OB 1ASWA 2MLZA 3HO1A 2GWJA 2B9WA 1WEXA 4DR1K 4I9LA 3OJUA 3V1QA 1RBUA 2MZ1A 2R7OA 3GV7B 4CF1A 3M2VB 3KOAA 1ZBTA 3T5LA 2OCEA 2HHXA 1BQXA 1NMNA 3C3LA 4DUZJ 3OYKA 2NZTA 3EYZA 1RA6A 1KRPA 2E7XA 1FK9A 2VH7A 4DSIA 1DURA 2KJVA 4FWSA 4IOCL 3AD8C 4FCYA 3T1HK 3I31A 4JP8A 1CZAN 2XBPA 5ADXA 3LGNA 4WFNL 1RTDB 4PG6A 1RYSA 4IKAA 1K73O 2P5GA 5L9NA 3HULA 2DD8S 4P74A 3RTVA 3J7YI 3MEGA 1TL5A 2ZH2A 4JEPA 2SXLA 3MMAA 2HBZB 1Y3JA 5DETA 2AV5A 2CPXA 5KFZA 2I5JA 4PWDA 2J4RA 2BQRA 4FLTA 2D9PA 3CWJA 3RAQA 1B70B 3MUVP 3PO5A 1R6VA 4DR7F 2W8LA 2EKNA 1S79A 1EWRA 4F50A 2FPHX 2I38A 2DXEA 2Z2LA 1XNRK 4EYIB 3CC4S 2BE7D 1KD1T 4M45A 5JXSA 1K8AT 2KLAA 4L3QA 1Y7PA 1JL2A 3ONQA 1Q8BA 3D66A 4E19A 3OTCA 1KONA 2R8HA 3W60A 2PD1A 3EZ5A 2QEXS 2ZBCA 3OTOK 1U2CA 4DR6J 1Q16B 4NEZA 3V81B 2JEFA 1TV6B 1VS3A 3Q22A 1UCNA 2W25A 1Y5IB 1LKZA 1V3SA 3QEIA 1GTHA 4DOZA 1UMJA 2UVUA 2VQFF 4DMZA 1NGDA 2YWHA 1XNQF 4DSEA 2OIHA 1KWMA 3OUYB 3QYYA 2QO3A 5FRNA 4KQZA 4OKJA 4NLQA 4ILHA 3JSRA 2F5GA 2V8PA 5T7BA 2H3GX 4PZVA 4F36A 2D1CA 1M5SA 5A2QY 2UXCF 3E9LA 2Q6BA 2DGSA 4BC9A 4H4KA 3ZNUA 4YB7A 3GL1A 5DZ7A 1O5JA 1ACMB 4B1YB 2XSFA 5GVQA 1KTVA 3TU5A 3U9DA 2JEIA 4FOIA 2IVMA 4DR4F 4DKWA 4BWMA 4N41A 2JNJA 4DU7A 3DI6A 3BBFA 3G82A 4X4SA 5KQDA 3MX5A 2QWMA 2G1DA 1JLGA 4BLGA 5H9EK 1HQUB 1YRXA 2FC0A 2MZJA 2F1FA 2CH5A 2E1PA 4LIWA 2F8EX 4A2BA 4CE9A 1FNOA 1L3VA 3JSBA 3HZGA 4C8LA 1JLAB 3V9UA 5GIPA 3NBPB 3HSZA 4IG0B 2YQ3A 1WUAA 2NPFA 3KG0A 4DTJA 2FJAB 1S4EA 2L41A 1NGHA 4MQ3A 1NK5A 2HOEA 1JLFB 4OI3A 2FLPA 1IBKK 3OHBA 4USUA 1T05B 1AUDA 1IBLK 1WHVA 2PMZD 3D3CJ 2BV3A 2I0XA 5D4LA 3F9KA 4P2SA 4HTIA 3M9MB 4DV5J 3VQBA 3ZTSA 1R8PA 2BVZA 4ECTA 3IG1B 1S6QA 1B4SA 1RK8A 1CULA 4WE1A 3WDOA 2IA6A 4EHUA 4CFDA 2IVOA 4CD3A 1NK6A 4CH7A 4LF8K 3FRYA 2WTFA 1LNQA 3M2RB 1BHNA 4TYAA 2HFOA 1RWWB 4URGA 2KRRA 2QSWA 1PBAA 4CFCA 1GFWB 4OHZA 4OHWA 2HGNA 1YUWA 3I0RA 4MIBA 1NOYA 3CUNA 4PXBA 2BRLA 4FWKA 2QE5A 1MN9A 2RD5C 1EQYA 3O80A 2BJ8A 2B9EA 2DFFA 5AQMA 3N01A 4DV3J 4KPCA 3ENWA 4ZJOA 3D2FB 2NRVA 4BE1A 2JZ5A 2QFJA 5HMWA 2EK6A 3GR1A 2G0IA 1WNSA 1IKWB 2D0OA 3CJRA 3QGHA 5CZXA 1RA7A 5FLXO 3F5TA 3FSYA 4DBQA 1N5YA 3MMJA 4H4OB 3EM1A 2QKKA 1YQHA 4ALZA 4BHQA 4KGMA 1IBCB 3WXIA 2DH9A 1T3VA 4KBOA 1TKZA 3MAHA 1YJ9S 4B3TJ 4CVNE 1NMDA 3KD1E 1QE1B 4CQ1A 4O3NA 2H4WB 3VA3A 3PW0A 3OLBA 2ZE2A 4KRWA 2VF3A 4PYAA 3LP3A 2W7PA 1GLBG 2KO1A 4DUZF 1RBTA 1HPZB 3O3LA 4ID5B 4DQIA 4CM2A 3CMEN 3FRZA 3IBWA 1RGVA 1XMQK 1TL1A 4I7FB 4W98A 3IDHA 1BI4B 1TVRB 2P9NA 2CVEA 3LUYA 3CCUN 4AF1A 5KFWA 1J5EJ 4FSVA 5GAGP 4LF4K 2HQCA 1LW2B 3MM9B 2QI2A 4ITSA 1HX1A 3ULDA 3WHIA 4E1JA 1Q95G 2PFUA 3B78A 2VOOA 1FFWB 2CNOB 3FEZA 4KV8B 4PKDB 2IYIA 3NLCA 3NS5A 4MFBB 1RAAB 2VB6A 3CI5A 2AGQA 3DXKA 5H9FJ 1ZBFA 4H0PA 3MUTP 4B3MJ 1WAJA 1RDAA 2Q6CA 2V69A 2WK4A 2XMTA 5HMXA 5D4PA 1X5PA 1FFSB 3KK1A 4LT6A 1FE0A 1KEKA 4PL8A 4WXOA 4OYXA 3ZZYA 5ETQA 2RAQA 4FPIA 2ZHAA 5KFKA 4WIQA 1S76D 5DJBA 5IOLA 3QDKA 5U47A 2DITA 3M6VA 4CZLA 4Z4EA 4I69A 2QTDA 3OL6A 4NZ7A 5M1PA 4DS4A 3OQ2A 2W9BA 3QEXA 1HD0A 1U1LA 4Q0BB 3O3GA 4NLGA 2QN6B 1EQMA 3LPUA 3R9PA 3PM9A 3L09A 3HP9A 1B99A 3R9LA 1VK3A 3HHLA 4B9NA 1N54B 2YY3A 3IWLA 1LOTB 4F0MA 4CF0A 2WBRA 3KLFA 5LJWA 1N8RO 2M5YA 4NCBA 3EXYA 5KFFA 4YEAA 2E88A 2VFTA 4O0IA 2F4FA 5HROB 2CPIA 3NWGA 1R0AA 4FF4A 4B3OB 3OLAA 3C6UB 4PQUB 3D2EB 4EFHA 5A76A 3ZETB 3ELHA 2JWNA 1RWOB 2OTLN 3BQ0A 1RBRA 3TUIC 3EX7B 4Z37A 4RTFD 4RPFA 3FSXA 3ZSQA 5LJ5Y 4GMKA 4YQWA 3OYAA 2D0CA 2QC3A 4OO1J 3M8PA 3CFRA 3H5UA 2LDYA 3ISZA 2CWXA 1U2FA 1GOCA 3R1XA 4LR7A 2MKSA 3SZ2A 1GH8A 2ASDA 4J2AA 3B6BA 4HI2A 3CCSS 2HBLA 4AHUA 1S6PB 1SI9A 3QQCD 2ZM6K 1C1CA 5J2MB 8ATCB 4DR5J 4CJ4A 4LSLA 4OJRA 2P9PB 3R7BB 3P45B 4OHVA 2DBBA 3MM7B 1SQFA 2E9RX 2MQOA 1FX2A 4AFFA 4RNFA 3GU0A 2HB5A 3CF5Q 2A10A 5KFVA 4DL7A 4C8YA 4AHTA 4PA1A 5CR4A 3BB5A 2YVSA 1F60B 1RQ0A 1HNVA 2E5IA 4E1NA 3ZZUA 4FYDA 3W2WB 4Y65A 3PIOL 2OYQA 4O0NA 1F5AA 4IFYB 4JK8A 4CGFA 2BTFA 4OJHA 1QSLA 3LZIA 4WFAL 4DV5F 3TA1A 1VQNS 1YVFA 2DEIA 4HWIA 1DTQB 2O8EB 3R5JB 2RU9A 3G86A 1T11A 4NLDA 2NUBA 3KLEA 4QPTA 3G71N 4M3TA 3O9UA 3MR6A 4HVJA 4LRCA 3KMQA 2ZH6A 5I3UB 2R2RA 2Z1HA 2UXBK 4NLRA 4Z7YA 4JI0J 3PIPL 4Q44A 3IC1A 3CMES 4URSA 2NXJA 2P5OA 1AW0A 5L39A 4XH4A 4YR2A 2R8IA 3O2IA 1VRTA 1RI7A 2DHSA 5B0BA 1IKVA 3LP2A 3CCUS 3I5AA 4DTRA 5FROA 3I8BA 4CFAA 3C6HA 4DV3F 5A0YA 2ZWPA 1MLAA 2V9WA 4KH6A 2XSJB 3D6FB 5HL7L 4UQGA 2QSFA 2X1AA 4ZPCA 4RWTA 3ENQA 1W2IA 2UUAF 5HRNA 2XWXA 1NDLA 2HFSA 3X3UA 1S72S 3W66A 2M4MA 2LDIA 3BO3A 5TKWA 3V4IB 4CTAA 5AXNA 1BOTO 4BQZA 4M95A 3VAHA 5K20B 3MTKA 4AQYJ 3AO4A 3CJBA 3AO2A 1NSPA 1N6QA 4ECZA 4OHYA 4CHZA 3UI3A 1RT5B 1WSGA 2VFUA 3ZFVA 4DTOA 4B3TF 2VODA 2G8FA 4YDDB 2IBKA 1UZHA 3OW2R 1L3SA 4JI6K 3RSEB 4BC7A 2GJIA 3TWHA 1DY3A 1KNZA 4NE9C 3AB2B 4GO5X 4CJQA 1PYSB 4OPKA 1LK5A 4PUOB 4ZCIA 2ERRA 4F3TA 2QA4G 2DTUA 3ZT0A 4KHMA 4A46A 2RMLA 3HTVA 1J5EF 2ZEJA 3T1HJ 3AJ2A 3OL9A 4CCHA 4KO0B 3QMLA 1B92A 1N33K 3MOZA 2HAIA 3AV9A 4K4TA 2O1PA 4JAXA 5KFNA 4J91A 3PYDA 3UD4P 5B0AA 2VBYA 3G87A 1SBRA 1ATRA 1HBMA 4OYIA 2V7ZA 4S0MA 3A8IA 2CZ9A 3MAQA 2XS7A 1Y0HA 4B3MF 5HQ8A 2DFEA 3BBCA 2BE2A 3O1WA 3IA0A 2CVIA 3LDSA 2VPXB 1I94K 3SLCA 2LXUA 3O9SA 4TYBA 1Q7LB 1XK8A 5DG7A 2Z1JA 5HAOA 5GINA 3CCVS 4KY3A 3RZAA 1HQ2A 2BZ2A 3BF3A 2W2OP 1HQEB 1S6UA 1X0FA 4MK8A 2OTJN 4CT9A 4OYPA 3BGRB 4C3MA 3VF0B 4KREA 4EK2A 3OTOJ 5HP1A 2QWRA 1WSJA 1FWPA 3N9UC 1XR6A 3I9ZA 1NXIA 2IC3B 4BRNA 2VUGA 1RSCA 4O23A 2UUWA 3MZIA 2RQMA 3NWRA 1R59O 2HS0A 3CVKA 2D69A 5EDWA 3CM5A 3OFEA 2HVDA 2WVBA 1KS2A 3I33A 1VIOA 4FJXA 2PY5A 3LGHA 4ECQA 4KT0C 5IT0A 2BOPA 4L73A 3BGLA 3QIPB 4I68A 3RAMA 1Q9YA 1UVKA 2QLFB 2MKHA 4HR2A 1EO1A 1FDNA 1OJ4A 1HL6A 2LECA 3K5PA 4EZ6A 4OZ1A 3THYB 4WIIA 3TA2A 2HNZB 1MN7A 5IM0B 4ZHRB 1RCHA 1SUQA 2IYGA 2Z1IA 3EO3A 2ZQBA 4ZP7A 4ZVOB 2FJEB 4FJ9A 3SUOA 2L9WA 3FBFA 3QNOA 1FVSA 3TO8A 5B08A 3G4SN 2W4PA 3U02A 1PAUB 4F67A 2GO9A 1IR0A 2X6NA 4C2MA 4PPZA 5LJ3Y 2OO4A 3C16A 1IN0A 3B54A 3K17A 1CJUA 5H9EJ 4DR5F 2BJEA 4ISGA 2IGIA 4FLZA 1C0TA 1FXRA 4OPJA 1JLBB 2FIUA 3CCMN 1VSJA 5D0EA 3HCXA 2V8VA 1OVYA 1EETB 4BC4A 4IOAQ 1NJZA 2P9IB 5B0CA 2UUCK 3A4TA 5DS7A 3HSCA 5KFDA 2HF3A 3GDQA 2VFRA 2DGTA 2EC0A 3NS6A 5D0RA 1K44A 3PFEA 2B6AB 1VQKN 3IP0A 3VGKA 3ALYA 1IBKJ 2ZZNA 2AU0A 3C6TA 4KYZA 2J7WA 1NDPA 3GIJA 1H98A 4NCAA 2BMBA 4F25A 2CDRB 2K7KA 5D15A 4NWBA 1BQMB 1RWVB 1TKTB 3H4DA 4DCOB 3THWA 4NPOA 5EN1A 3ZSYA 2D41A 3C19A 5KOWA 4JI0F 4UUXA 2CGKA 3OYEA 4LF8J 5C5JA 3RRHA 3UDVA 3WQTA 1OYEA 2UVVA 3DLKA 1HWLA 4OX6A 3A0IX 4DZDA 2NZCA 1VQ8S 3R3TA 5LOQA 1M90T 3DRPA 4CZCA 2YKMA 2HIYA 1WELA 3RJMB 3DM2A 3VA0A 2EX3A 2XQCA 2QA2A 3M8QA 1ZM9A 3C2PA 1R43A 3RRKA 3KHYA 5J1EB 5GAGI 2XM3A 4UT4A 4ZCMA 4H54A 3HF5A 5FRMA 4HH0A 1NPKA 3FR0A 1M5OC 1HLWA 1ZPVA 3Q2SC 1A7GE 3C8YA 1TYQB 1M90O 3N5BA 2ETJA 1CQNA 3F0NA 5CZ1A 4AQYF 1A5WA 2BANB 1VQLS 1WOSA 1OSCA 3NVMA 2O8DA 2AMCB 2YWGA 2FTRA 2G2OA 1N36J 5D8HB 4I6WA 1LWCA 2VONA 2VL1A 2VG7A 3AVNA 4JV0A 3TEGA 3DCAA 4C8KA 3KJFB 3G25A 1R7IA 2UUBK 2WVCA 4DX7A 3TX0A 4O44A 2OTJS 3NNAA 1JLCB 2X3GA 3L95X 4B9QA 1KVAA 3LTOA 4V19J 2KT3A 1M5PC 2N4DA 2V63A 3FC9A 5AXMA 5AE3A 1XMQJ 3T1HF 2BDPA 4Y1CA 4OZLA 1UFKA 1R8AA 4LF9J 1B7YB 3VWSA 4JI3J 2F9DA 3T9ZA 4NLYA 3ZSRA 1R0CB 3DOMB 2FGOA 3O9RA 5ETKA 4LF4J 4O55A 4GV3A 4FWQA 1HYSB 1U0HA 3R5CA 3EVWA 4DF4A 3TJ9A 5EY4A 2X6SA 4DPOA 3EKUA 4DTMA 1IVZA 4CJ7A 1LWEB 3VF4A 3RG6A 4X62K 3QERA 2QLWA 1X60A 4KR0B 1S3XA 2GMJA 3L2WA 1QZ5A 2PFFB 2AEJA 4DFMA 4WP9A 1H6KX 4Q7AA 3UKRA 4OI1A 4K50A 5AQOA 2PN6A 5EU7A 3R1LA 3QZ8A 4IR9A 3A8KA 2ZKTA 1TL3A 1OPZA 3ZZPA 3RWUA 3CD7A 3PR4A 4R5PA 4KGZB 1DQAA 2ASMA 4HTLA 3RW6A 2CQ0A 1U04A 4JHDA 4ZVHA 1WDTA 1RT3B 2RF2B 3VGTA 1XR5A 1S77D 5DQGA 2A41A 4FLVA 1BCMA 2MKIA 1GLAG 4YOWA 3NGKA 1RT2B 3H7HB 2KHCA 1REVA 1RDBA 4MKBA 2UU9J 1ESVA 3D28A 3DLGA 4O3SA 3TZXA 1VBYA 4OZJA 1CZBA 4A8SA 1UEKA 2FUG9 3CCZA 2J9CA 2Y0SD 4PR6A 3LAMA 4IO8A 2GVDB 3R5BA 4OZ2A 1RBLA 3RMBA 3TANA 1XR7A 1W2BR 4DN9A 1KVBA 2KYXA 3TAEA 2L9DA 1OY6A 2YKAA 2IPOB 1U7LA 1XC9A 4JD2B 3EZOA 2AYEA 4HCCA 1U02A 2P9UA 4P71A 4BRHA 3Q24A 4M5IA 4CH0S 3S6EA 2J9DA 4Y34A 1T6CA 3L2VA 4FK0A 4RKUC 5C2DA 2ZFHA 2YCHA 4NXMK 5F9LA 3RVCA 4NLOA 1SS6A 1TTHB 4XPEA 4PHTX 1E6YB 3FK4A 1LXNA 3CDWA 2BACA 3AGRA 4QR2A 4OL8A 4LRFA 3Q8PB 2FVRA 3FUYA 1WG5A 2E1CA 4CLSA 2IM3A 1U8SA 2DIUA 8AT1B 3ZSOA 4OZ3A 5L8RC 1OPIA 4W92B 1CJTB 4KJIA 2D7SA 4ISEA 3NCRA 2RU3A 1OH8A 2JOQA 3CG7A 1LW0B 4RWWA 2XHWA 2MQPA 4OV1A 3VAMA 4CFBA 4IRDA 4YUDA 2C3YA 2QL5B 3OYJA 2CGLA 1SV5A 2ZOMA 1X5OA 5GAEU 1UJ5A 5HVHA 3S8SA 4ED3A 2RT3A 2QL7B 1FJGF 4NMXA 4G65A 4HLBA 4LF8F 4DV4K 1KAYA 2UXBJ 4RNMA 2M0GB 5AJ3J 2M8HA 3HHNB 1CXQA 1RU2A 2DKOB 5ELZA 3G6YA 4CJPA 2OMLA 2NXCA 2I7NA 2K7JA 3V6DA 3AA4A 1NAQA 4KTQA 4QAGA 3O3HA 2QA4S 1NGAA 4I6YA 3KG1A 4P9SA 3PHTA 4WJBA 4JK9A 3J8AA 1L3KA 1TR0A 1RU1A 4QU7A 5CE3A 5IT9U 1KXPA 2E5HA 1HD1A 3HM8A 5LMUK 1VQYA 4GKJJ 2R2UA 1J6ZA 2J8AA 2CJKA 4BC3A 5CH7B 4LSNA 3JQMA 4NOHA 2MSSA 4BVOA 4U7BA 3MR5A 2GZOA 3ETMA 2YQ0A 3ID8A 4MKYA 4WTOB 3MXIA 2E66A 1UL3A 1N36F 4O4GB 2OSRA 2A1BA 5EWGA 1RLCL 1BDGA 4CF2A 2VWBA 4RBTA 5E3RA 4V1Ak 3SSRA 4FJIA 1EWQA 5DGBA 3A5LC 2OP5A 4EUVA 2BRKA 4JI6J 4PWUA 2VYPA 3QJLA 1YGYA 3KWMA 2ZGZA 3N6NA 2NYHA 2CQPA 4F4YA 2HRUA 3FLCO 4TQSA 1KVIA 1XMQF 2JL9A 4NL5A 3Q86A 3UE5A 4C4WA 4LY7A 4LF9F 4LD0A 4JI3F 2JHEA 5HATA 2DB1A 1GXUA 2N82B 4P52A 4LF4F 1D3WA 3UKUA 2R2TA 1YSJA 3O1LA 4ZP8A 1N33J 5K8MA 2YNFB 3TUPA 4AL6A 1NK9A 1IKXA 1R8BA 5KFAA 2QX0A 2LQBA 2VV5A 4HHUA 4RO0A 1KAXA 5I3PA 4JI7K 4E2FB 3T6JA 2EC2A 2H48B 2YNGA 3PFOA 3TAFA 3OS1A 2KZZA 4BRIA 1CSJA 2RE2A 5A6PA 1I94J 2EWSA 2CIMA 1D0EA 2EPIA 2HBYB 5L1JA 2M8DB 2ACYA 1N52B 1O0PA 2OZSA 3FZBA 1RB0A 2VBWA 5A8KA 4DPUA 2AHOB 2WSEC 4OFZA 5BYSA 2C2OB 1ZH5A 1JXLA 1DBDA 5EWEA 4PQAA 5GADI 4I6MA 2MQLA 4OPAA 2ASJA 5CHCB 1RTHB 1Z25A 2X1GA 4G1PA 1R0BG 2VPZB 4TLQA 4Y2AA 4LVNP 4J2EA 3KWIA 1M5KC 2MMYA 1L3TA 1VFJA 2BGGA 1X0PA 2UU9F 1Y9OA 5HVFA 3AAWB 3HMJG 1HIYA 3OYCA 2Y8WA 1GEHA 1SKWA 1IUJA 1U1QA 5E3PA 2R42A 2QZ8A 2XZTB 4PPDA 4BG8A 3CCJN 2JFKA 3AVMA 4EBDA 5MLCV 2ZKUA 4CESA 2EHGA 3Q8SB 2QXLA 4H4OA 1BL3A 3M6XA 2NNWA 3J80Y 4M5KA 2JDJA 1OQ3A 5I9EB 2GGPA 2GVZB 3NS7B 4YORA 2JC1A 3PV8A 4I2PA 2FXUA 2NRHA 5LM7E 1IO2A 5ADZA 1E4FT 2HS3A 1TL7A 4OQJA 2Q36A 3OBYA 1B3TA 4ELUA 1FA0A 5I4MA 2C42A 5DK5A 5DM7Q 3N0VA 3FZFA 1ZAXA 2UVRA 1NKBA 1WTFA 2UUCJ 1RP5A 1S22A 2PZSA 2MHEA 3IWNC 1BI4A 4CHNA 4MH8A 1RBSA 5L9XA 4FZYA 1HNZK 3W65A 3PXGa 4KPYA 5KFQA 2FVCA 2ZNZA 2ZVIA 3POTA 4DL0C 1IM4A 1FK9B 1RABB 2FC8A 2DPJA 4J9MA 3THXA 4BR4A 3W64A 1F1BB 1NOZA 4H5TA 1N32K 3WQPA 4CJLA 3GYNA 1T3OA 4EEYA 3HSTB 4OGCA 1RT4A 4FDFA 2UXBF 5AJ3F 4BRDA 3MEGB 4FM0A 4UY8O 4NZ6A 3DRRA 3BH7B 3US5A 1JJCB 2LXIA 1PO6A 3MMAB 1BIUA 2ALZA 1NO8A 4ED4A 2I5JB 4PWDB 2CJ9A 1X4HA 2KU7A 1Y3KA 2NS1B 4QOTA 4L3KA 3MWBA 2B5JA 4C6AA 2LQJA 4DUYJ 2EBEA 1S12A 2HNDA 2QM1A 1YTYA 3NGSA 3NF9A 2XLIA 1JLQA 4GKJF 2K3IA 2KKZA 4R8UB 2C2EA 1KFDA 4J9UE 5MAOA 2ASLA 5AZIA 1OO0B 1ZAWA 5D77A 3MTJA 3N6MA 4OLAA 5K5MA 5A8RB 5KFBA 1KC8O 2HNYA 4CF9A 1WHXA 4RUHA 3VERA 2YH1A 3KWGA 3W0LA 4BRAA 4LF6K 1ZETA 3EZWA 5G0RA 2MGZB 1VLOA 3M4XA 4FPAA 1JB0C 3DHXA 4U95A 3CDBA 3NOCA 1WBDA 2GHPA 1JXBA 2IAJA 2R7QA 2B9XA 4QS9A 5KFEA 3ZETA 2WZ1A 5SWMA 3HI0A 2AEMA 2Z4PA 1JLEA 3BP8A 1WHWA 4WP3A 3CIPA 4Q8EA 3EWGA 2AEFA 3L0QA 3R27A 2W9AA 3AVFA 4GKKK 2RUSA 1JK9B 1DKGD 4QS8A 1YBUA 5HI7A 5IC6B 2GTDA 4Y28C 3GP9A 3NF8A 5AQVA 1N33F 7AT1B 4EAHD 2XHCA 3KLHA 3CF5L 1S6PA 5GAHP 4KI6A 1IBMF 3G6VA 4J9LA 2P9PA 4CP5A 5BREA 4DPWA 3PVXA 3DI6B 1S10A 3G82B 1FDAA 1OH5A 1JLGB 5D0HA 4WU3A 7FDRA 4M5MA 5E26A 4X62J 4YR3A 5CHIA 1XHZA 4B1WB 1ITGA 3P4UB 4UOFA 1MROA 1XQSC 3MN6A 1SL2A 3PJXA 1RBAA 5LT5A 2QT7A 5G4DA 5DM6Q 4NI2B 4IEEA 4FZXC 1S9EA 4NMLA 1W25A 3IS9B 2CQGA 4GW6A 2CJQA 4A5BA 3OY9A 3OTBA 4ZOSA 2RN2A 2Z30B 4X66K 4C8OA 2DR7A 4OI6A 1Z2LA 2H1YA 4P2MA 4TY8A 4J9VA 1X4AA 2N7YA 5MLCQ 3LDNA 1FRIA 3WXLA 3EDRB 1LK7A 5I3UA 3HI9A 4A2AA 5JLHA 3CEDA 3Q2TC 4FW2A 2GQ2A 2WSFC 4Y00A 1FEHA 2GELA 1CG2A 1TUVA 1S6QB 1Q82T 1CULB 2LA6A 1GMVA 4WE1B 3U27A 1TMJA 4ED1A 2C2KB 4F26A 1RTZA 4YOVA 3CXCM 1KQSM 1ZZNA 2ZH5A 3MM5B 5K8OA 2QA1A 1S1XB 1U1OA 2DHXA 3FNNA 3A3OB 1Q82O 2A5XA 1RUSA 4FPRA 4ECRA 3E9OA 3KHGA 1H7XA 3NP5A 1G99A 5F8MA 4V19S 2BJ9A 1BISA 1S7IA 2DXDA 2MKKA 4IOXA 3VQQA 4K5RA 1U25A 1RT6A 4J5OA 3MR2A 4O3PA 3CFOA 4DU3A 3ULEA 2M7SA 4NASA 5EGYA 3JTPA 2ACMA 2YX6A 3M8YA 3DLBA 3WXKA 3EN9A 1RYRA 4YDUC 2L48A 3I5CA 2XWYA 1N5YB 1NBWA 3NGTA 3UD3P 3C66A 2P51A 1VQ9N 4PKIA 3MPWA 3CMAN 2B4JA 2DNNA 3CCLS 1AB8A 2OD6A 4FZVA 4NXMJ 1JJHA 2G8IA 1URRA 1RISA 1TKZB 1VI7A 4BGAA 4UF4A 4YY3K 5J1NA 2UUCF 3MN9A 4ISFA 3W3DA 4NCGA 2E1AA 2M3DA 4QIWD 3DKDA 1TGOA 4FJNA 2YHXA 5LMNJ 5AQXA 5BXIA 2ZE2B 3ZZZA 1VSFA 4YP3A 2B4PA 4K41A 2ALYB 1SKRA 4EYHB 1R27B 3NFAA 1TL1B 4DR4K 3L9ZA 4ED8A 4DCHA 3THVA 1VQPS 1VQMN 2P9NB 4J2BA 5K8PA 3ZLJA 2YJEA 1EKEA 1T03A 4FLWA 4ANDA 4ZTFA 2DHHA 4DTNA 5C0YA 3E2EA 3W8GA 4K2XA 4DMNA 1RLDA 5F8IA 4LQ9A 4M42A 1EZZB 3THPA 2QXFA 8RUCA 4CJ5A 4B8CA 4ZJLA 1XERA 2RNEA 2ASYA 2QIFA 3NGIA 2G8HA 1Q5VA 2P6SA 4DUYF 3BS9A 2F7TA 3DXKB 5C10A 1NGIA 5DDPC 2BA9A 4F3QA 4YNQA 1WC3A 1N0VC 4MDBA 5ETNA 1N34J 1VYAA 2W9CA 1EJ7L 3KK1B 4J37A 4CJWA 2BX6A 2DY1A 2MKCA 1SB6A 3HK2A 5ETMA 2XMJA 2DYAA 3ZZ0A 4HI1A 2B43A 2MPUA 2DNYA 3H46O 3CJ8A 3S3NA 3CQYA 4DQPA 5JVGQ 4JNEA 2MZSA 2QW9A 3TUJC 2BQ3A 4K8XA 3MECA 2P9LA 4Z4HA 4OX8A 4A57A 2Q3PA 2ITGA 3C15B 4DV2K 1Q86T 1HI1A 1RAHB 2HQIA 2QYGA 3QIPA 4BDZA 3I87A 4ZPBA 3CJKA 3MD3A 3KLFB 4FLXA 2UUTA 5DZ6A 3M3ZA 4DI6A 4ZVFA 3JB9k 1IWGA 3AOCA 3Q89A 1R0AB 3HVAA 1Q86O 3QWPA 1B64A 3AAPA 5HQLA 3CIMA 2XYGB 2NPIA 3H40A 2G2ZA 3MHYA 4JI4K 3DU5A 4IOAL 2FY8A 3CC2S 2O5DA 2CJXB 4TLRA 1U47A 3M1FA 3M8PB 2ABYA 4FWPA 1VSEA 1HNWK 3NKYA 1P9QC 3B8HA 1JLBA 1TUYA 4X62F 3KFWX 1EETA 2ZJRQ 4AH9A 2V7YA 4JI7J 1C1CB 5DQHA 4LSLB 3CTRA 1FXDA 4M3XA 3LALA 2RQCA 2KG0A 3KKRA 1K1QA 3DMJA 2A2CA 2UP1A 4DUZK 1V9OA 2Z56B 2E9TA 2Q0RA 3A13A 3QBWA 2BKPA 4FWNA 4IDHA 2DNRA 4FKYA 3IM9A 3IR6B 2ZC3A 4A48A 3CYMA 4B1UB 3K57A 4NYNA 2XZDB 1NDCA 4J9QA 1SJRA 5ETRA 1VQ9S 2BKOA 2H51B 1RAJA 5AQRA 4GVLA 4CECA 2GV9A 4ES1A 3MCAB 3HKWA 4ECSA 5M1OA 4FVCA 2EW9A 4Z4FA 3KLEB 4W5QA 3DDIA 3NDKA 2W2PP 5KPRA 3I32A 1V4SA 2D0AA 2KH9A 3I8DA 4CIOA 4HL9A 4Z94A 2HRTA 1DARA 4IUFA 5A2QU 2CPHA 3A3PB 4B3SJ 4CZKA 5J1EA 2YBVA 4WYWA 1NM1A 4RW9A 3UDEA 2O66A 1J53A 2YHYA 5KT3A 1VQMS 1VRTB 3H6EA 2WOMA 1IKVB 3LP2B 4RUAA 3GPAA 3GFHA 3SQGB 2WVFA 1VLYA 5A0YB 1SL0A 4TSXA 1GLDG 5J2PB 1SIZA 3ILJA 2AZ1A 4JK7A 3G9CA 2PDAA 2BQUA 3P3DA 2NZ4A 4H4MA 2CA9A 3W5XA 3FZKA 1WF1A 3HX9A 3UPFA 2VA2A 3W9JA 2H65B 2NSBA 1QD1A 2X7IA 2QRRA 3EJMA 4NXMF 3BZCA 1Q8LA 4CW7B 2DNZA 4FXVA 4CO1A 5F8GA 1GOBA 4CDIA 3K89A 2VZ9A 3QICA 4Y0FA 5LMNF 3DRSA 1LEOA 2VPYB 3HL8A 5DG9A 1SQKA 1NCLA 4L72B 1HNZJ 2G4BA 1XEZA 4DX6A 1IKYA 1UEVA 2ZD1A 4USTA 3EGVA 2MSTA 3HLUA 3OSPA 5B0EA 1W26A 3Q8VA 3QT6A 3QT5A 4K42A 2OEKA 5KFMA 1UVJA 2KYZA 4OYOA 2F9WA 2HPUA 2PEBA 4JB8B 3H90A 3RBDA 4O5FA 3C95A 1N32J 1J2VA 2WUSA 5GAEP 5KAKA 1LFPA 3W8PA 4DG1A 1HHSA 1HBMB 1SH0A 1WB9A 5JVHQ 4DQRA 1MW7A 2G13A 3SIPB 2BM0A 3A5NC 1C1BA 2PMWA 4WCEQ 1VC5A 1RCXB 4HDHA 1PC4A 2I1RA 2BE2B 2DCUB 1QAYA 1N34F 5AFUH 5HBMA 3CC7S 2IFXA 1LXJA 2HVIA 1HWKA 3A2FA 1RDWX 1S9GA 1VSDA 3QETA 3BH6B 4DL3A 3F2KA 2FVQA 4F0KA 2RRNA 3AD7C 1URNA 2HVHA 3TYTA 4BRKA 1YJWN 4KGKA 1U6BA 2FC9A 3TWZA 1ZBUA 4RW7A 2V2ZA 2X3DA 4CZFA 1F2HA 4FNHA 5KT6A 4B08A 1RT1B 4W5RA 3RW7A 3Q8YA 3UR0A 2E2PA 3K2YA 3E9PA 5HP1B 2P9SA 2R7WA 4CJEA 4LF6J 2Z58B 4A61A 2XRIA 1VQOS 3VVUA 4X65J 1O13A 1T95A 2C1EB 3PKYA 1RTJA 1LV5A 2GVDA 4MMOA 2GV1A 2OLWA 4OKKA 4LF7K 3VEXA 3WX8A 1Z26A 4CLWA 3IBFB 2IRYA 4XPCA 5DRKA 3LZJA 5L1KA 4UW2A 3VESA 2FYXA 3MD1A 3C7NA 1WKKA 4GKKJ 2LQ9A 2A1SA 1WNEA 2FBVA 4JI8K 3BKUA 3NF6A 1SUQB 2KVIA 2VA3A 3IN5A 2UUAK 4M3WA 1SJ1A 2FF3B 1VSHA 3VQSA 3GFZA 2Q3SA 1VCTA 4AL7A 3PX6A 4EBCA 3R2DJ 2R8KA 1RBVA 4JLHA 1WEZA 4QW9A 2E2QA 1PAEX 3JXUA 4ZPDA 1VK0A 3C16B 2WTUA 1YBTA 3M8SA 1A0OB 1CJUB 4M5DA 2BABA 3H8YA 4F04B 3ILLA 3G8SA 1T3NA 3TVZA 2FJVA 5CZ2A 4YOYA 4EU0A 4A8WA 3NAEA 2CNLB 3SCJE 2GC8A 1XC3A 2J0QD 2JRSA 1BA1A 4KHYA 1CJTA 3LOUA 1HWJA 3G8QA 1XTZA 3CJ0A 3OBWA 1LQ9A 4OX7A 1H3DA 4EMDA 5IWAK 2DGQA 4ENOA 5JMNA 2F65A 4X66J 3TOQA 3LAKA 2Q1LA 3DXBA 3FMWA 4DQQA 2LLZA 4AUKA 3IAM9 3BJYA 3E8OA 4W5NA 3MXJA 3Q83A 3P5TL 1M1HA 3P5BP 1VQ4S 3N6LA 2MQMA 2XMUA 1WSVA 1MSWD 2LA4A 3KDNA 3TAGA 2YKNA 1YITN 2NCKL 4TU7A 4AHVA 3AB4B 3TR5A 4AXJA 2ATQA 5LSRA 4B3SF 3BF4A 1G2EA 2Q31A 1LWFA 1VQSA 4XO0A 1T44A 2DNHA 3PYEA 1MWZA 2N7CA 1B9FA 4O0JA 2YKMB 2NLXA 3MK6A 2BW7A 3FZ2A 3M8QB 1V3ZA 5IC4B 3FMBA 3GCWP 2HGLA 1QY7A 2W8KA 5D6GA 3C6AA 3R5AA 5EOYA 2OD4A 2JGUA 2F63A 5ITHA 1RCOB 3W62A 3SV4A 4ATNA 4P2XA 3SPZA 2AJQA 2VG7B 2KW4A 2ZH9A 4PKGA 1X4DA 4BR0A 2QWOA 3VR1A 4YY3J 4F4WA 4BDPA 4DV6K 4E7LA 1RHQB 3TTDA 1HNZF 3CULA 3EE3A 2ZNYA 4L75A 4M5NA 2PT0A 4IFEA 2PE8A 1SZ2A 1M5VC 4JKHA 2K3KA 5JLFA 1VGYA 1MU2A 3VEVA 3LF0A 3BO4A 1ILYA 3EPIA 4LR8A 4F3MA 3SBTA 1GXLA 2EEYA 2I2YA 4JBCA 1N32F 4PG7A 3NAHA 1RWNB 5KFJA 4H0OA 4HT5A 4FJ8A 1U0HB 4OZ0A 1GX5A 3UO0A 3Q7BA 5KGXA 4M5JA 2DNQA 3KUHA 1FJ7A 1NK8A 1C0FA 2CRLA 3OYNA 1DJ0A 3KK2A 3G6ES 3LM2A 2P1JA 2YXLA 3PJ9A 1XMOF 2OFHX 2AZ3A 3UKRB 1OH7A 4FWRA 4IKFA 2OGUA 3OVNA 5EXWA 1TL3B 2W6LA 2E7VA 3R8YA 1RTHA 1ZA2B 3QIDA 1IG8A 2E4LA 1WUUA 3ZXWA 1HPMA 4ID1A 1VIXA 2EFNA 3RU0A 4RW6A 4YB1P 4LF6F 1R89A 4LRDA 3CETA 4X65F 4H8KA 2KXNB 4LR9A 4JI0K 3WNGA 3VGSA 1FHTA 1MWMA 2HVZA 4IJNA 4PXEA 3QSIA 2F8HA 4Q8FA 3AVCA 2DO0A 1GLJO 1RHRB 4DV2J 4M7YA 5IT9O 2E20A 2GHWA 4IOCQ 4M63C 2XYPB 3OA9A 3WNHA 4IQXA 2NXUA 3OYIA 4QWEA 4WFNQ 4DWIA 4IG3A 1AXQA 1NK0A 2V4RA 4I1TA 4EO8A 3ID6A 3BQ2A 1KP6A 3UNYA 1TFYA 3L3VA 2DXFA 2VQEK 3TQEA 4BRPA 1WSIA 3LQVA 1KN6A 1ZAVA 3ZTOA 3T1YF 3CB4A 2YTCA 4JI4J 3OXLA 4RWXA 5DM7L 4FYWB 4LFCK 3GBTA 1TAQA 5EX5A 1Q78A 2XY5A 1RKJA 3CDAA 5HLFA 1HNWJ 5T41A 3EVOA 2DR9A 1R6YA 3OVSA 2DY4A 1ZTWA 2V8DA 5AQPA 3V1RA 1SC1B 4HUGA 3VQEA 3E01A 2MJUA 1AROP 3K5LA 4KFBA 2RVJA 4CZIA 4ZLJA 4KHPF 2V4QA 1K73T 4ZIVA 2O4IA 4LFAJ 3B4MA 3U8XA 3GWCA 1JWWA 2HHWA 4X66F 1TK5A 3AGKA 3MFIA 3CQXA 5B0FA 3HZEA 5BJRA 4GMJB 1WF0A 3UR3C 3H5SA 4AYBD 2ZUGA 4FF2A 1WBBA 2QJ3A 4DZ6A 4X2BA 2DISA 4XH1A 4NYFA 3W7BA 2C3UA 3M6WA 5D4NA 2V4JA 1SV5B 2DK2A 5IV3A 4FXDA 3CPEA 5AQHA 1H2UX 1GLCG 3CM6A 5KFGA 1KHWA 4PL7A 1NHKL 4K4SA 3GIMA 4HUEA 3P83D 5DQIA 4NX9A 3MN5A 4R8UA 2ZH8A 5J2NA 3V6DB 1Q79A 3I9V9 4IDKA 3M1VB 3V9XA 5HVGA 3UE2A 2HLUA 2HRYA 3TVYA 2KXFA 1S49A 4H03B 4ZVUB 5A8RA 4ZVQB 1NKCA 3DLEB 2H5JB 4PG4A 3H4BA 4ZJQA 4FWLA 4LSNB 5GAEI 2MGZA 4OYMA 3GE1A 1U26A 4DL6A 3V4MA 4NLTA 4X4RA 2VGNA 1GMWD 1JQGA 4KHSA 3A12A 2Y0BB 4ZN3A 3AOBA 3Q8QB 4A47A 2Y9HA 3PJWA 1SJ3P 4YY3F 1H2TZ 3KNAA 3PDNA 1BLUA 4JV1A 2W4CA 3S01A 3F9MA 4RU2A 4ZVRB 1N56A 2YKPA 1VHXA 3G10A 4FJLA 1HARA 5GMDA 1IG9A 4DV1K 5KFIA 1NZAA 3TAMA 3VALA 1CLFA 4DSLA 3QGGA 1NJYA 3DXMB 4DFJA 2PSZA 1F9HA 2DVIA 2KFNA 9RUBA 3QPIA 4WFXA 2A42A 2J76E 3AH6A 1KAZA 1RWPB 3PW4A 1AT1B 2VJVA 1FTCA 4GNIA 5DM6L 1LOUA 3O3FA 3UKUB 3GSIA 4LRBA 4U7CA 1IXKA 4JS5A 1IKXB 3AJ1A 1UVIA 4C3LA 3CO9A 2FLOA 4O8KA 1DFDA 4AM7A 3MMCA 3SQ1A 4CJFA 4NI2A 4JI1K 3IS9A 3F56A 1JMTA 3QAEA 4FJJA 2ZJQQ 2YNGB 3MMBA 3CJTA 4JYAJ 4DHYA 4BC5A 5LL6Z 2R3VA 3OYHA 3VQAA 2VC0A 2C2ZB 2EG2A 3R7SB 2A2DA 1YIJN 3NAIA 1I1GA 2UZAA 3BO2A 4NXNJ 4FS1A 2WONA 3CFPA 3QRPA 1BIZA 5A8KB 1YDLA 1V5IB 4ZVEA 4NLCA 4D3HA 3CNQP 1FO1A 1ROFA 2FHMA 3M05A 4F2RA 3CXCR 1HBOA 1AZSB 4DDFA 4M3UA 3IRWP 3GYGA 2QMWA 4X4NA 1VQ5N 1FJGK 1U49A 5C2CA 3CHWA 1WLJA 4I6MB 3P8BB 1RAGB 4ILJA 5DLFA 4DV2F 1WKJA 4USWA 2WBNA 4A4JA 3MM5A 1S1XA 3U7JA 5LL6d 2CPFA 2O8CA 3KMSA 4RG8A 1U09A 2D0BA 3NY0A 4AM6A 4Z0UA 4LF7J 3SFGA 4CZMA 4LF1A 3UN2A 5C24B 1HHQA 3VAKA 2FHOB 1FD8A 1M1GA 2P9GA 4RUCA 1LAWA 1J27A 4CERA 2IM2A 3HSGA 3KIOA 1FRJA 2JWKA 1X4FA 1P1TA 2BEFA 3IGVA 4ZP6A 3TNVA 4RUBA 1VQ7N 4JI8J 4JI4F 2D3O1 2UUAJ 1UFLA 2JWLA 3A3NB 2MZQA 1N36K 4C97A 1HNWF 2AP1A 3K9KA 3C94A 3QJPA 3N79A 5AQYA 4X4UA 2VCPA 2GGPB 2DRDA 2Q1NA 2CZ4A 2PIIA 5D0GA 2KJWA 2ZH3A 1PIEA 3JTNA 1MMNA 2HFUA 4I2PB 4FM2A 1ASUA 3SBMA 4FJHA 3UN3A 2J7KA 1TL7B 3ET6A 3QT8A 4LFAF 5AQJA 2ATCB 4QIGA 3J7AN 3EL2A 3T1AA 2IA0A 2FZKB 3OXFA 2OA8A 4LF9K 1ZBHA 5IWAJ 4JI3K 3Q0AA 3AODA 1SJQA 3POTB 2ZH7A 4CBWA 1NBEB 4IH6A 2NXEA 3VEWA 2PI5A 3QO9B 3THXB 3SQOP 1OH6A 4NA2A 1ZC6A 1QVFR 1HA1A 5CXTA 3CO0P 3SJHA 3JQKA 2V68A 3CGIA 1RT4B 3AO3A 3H5YA 4NYZA 1Y5NB 3IWXA 3KLIA 4PRFA 3DRRB 3QLHA 4LIRA 5HMZA 3RUBL 5JVGL 1FJCA 3AQPA 1TMMA 3ZTPA 2ZBIA 5I3QA 2JLGA 4XDCA 4LFBJ 2B5JB 5ETOA 5AXKA 2HNDB 4F4AA 2Z2YB 4CHPA 4OJGA 3ENOA 5F41A 3B82A 3TJ8A 4WFYA 1NLKL 1JLQB 1KCFA 5KRTA 1YJNN 2N3OA 3O5TB 2BJ1A 3KDOA 1N8RT 5AZIB 3EPGA 4DSKA 3KTQA 1KLNA 1F3VA 1B7FA 3DLLQ 4OLPA 3C15A 2Q43A 3MI7X 1IH7A 2HNYB 1IR2A 4CK3A 5KG2A 3M9NB 3G0ZA 2IJFA 1UEUA 3DHWC 3ENBA 2DNPA 4QWCA 4KH1B 4BQLA 2UU9K 2C3MA 5G0RB 3MM8A 3WC2A 1Q4RA 3B8AX 3PEHA 2HQDA 3B6PA 2VFVA 3GSDA 2YWFA 2AJFE 2V67A 4I0WA 3FFIA 3HOSA 2IAJB 3V6JA 2IS3A 4DV6J 4B9TA 2ILZA 3DJCA 1CEZA 2GUIA 3GIIA 2HMPA 3T5JA 1JLEB 1Z4UA 2ZJRL 2IRXA 2HZVA 3FZMA 1S99A 5F0WA 1QUPA 4HACA 1H38A 1QSSA 3WNEA 1Y64A 4ECUA 2G0CA 3AVHA 1YHQN 4CYUA 1QAXA 2Z0GA 3LA0A 5A6WA 4E98A 3KLHB 3SAHA 3KG4A 2OPRA 1Q81O 1HW9A 3NCQA 2LYVA 1GMUA 1DTTA 2YJFA 3PCOB 4RCHA 1EX8A 4QIVA 3AO1A 3EE8A 1FKPA 1KKHA 5B8HA 1R8HA 1XUPO 2P6TA 3J7YP