3MEGA

Hiv-1 k103n reverse transcriptase in complex with tmc278
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
552
structure length
552
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords p66 Reverse transcriptase
molecule tags Transferase
source organism Hiv-1 m:b_hxb2r
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Etravirine (TMC125) and Rilpivirine (TMC278): Implications for Drug Design.
pubmed doi rcsb
total genus 148
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3megA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3megA05
1D9DA 4NRUA 1NOZA 3EPGA 5FRNA 3G6YA 2VG7A 4M3WA 4KAZA 2FVQA 1TKXB 4O44A 1EP4B 3CVKA 4ICLB 1I6JA 4RNNA 2VG6A 1L3TA 1SV5B 3AVAA 2F8TA 1RTJB 3T3FA 5HP1B 4B9UA 1ZBFA 4I9QA 4Z4HA 2O4GA 2BQUA 4YNQA 2WB4A 4IQXA 2DY4A 4CEEA 4Q0BA 5DG9A 4FK2A 1HNVB 3M8PA 2OPSA 1RYSA 1S6QA 2F96A 2R8IA 2IM1A 1JIHA 4RNHA 4J9KA 3SNNA 3V6JA 3NDKA 4CHQA 3LP1B 1JLCA 4E89A 1ZBIA 4EO6A 2XO7A 2WRMA 3V1QA 5J2PA 1QE1B 3K5MA 1HQUA 1JKHB 5J2QA 4M3ZA 2YV0X 1SL2A 1EETB 3CG7A 3HK2A 3IG1A 3RRGA 2W9CA 3QO9B 2ASLA 4DSFA 2C28A 2I5JB 4FK0A 1NK9A 3H4BA 4WXOA 2JEIA 3ZSOA 1Y97A 4ECRA 3G86A 1UAXA 1QQCA 2XWYA 2AU0A 4O0JA 4CFBA 2P1JA 2R8GA 3M9OB 4LSLA 5KFRA 1K6YA 1KVBA 4FLWA 3MEDB 3VQ9A 3LP0B 4ZTFA 1TV6A 1RT3A 4E7LA 3SZ2A 1BI4A 3V9WA 1DLOB 1HJRA 5HLFA 3TAPA 3KJVB 3E01A 3AVBA 1W25A 2UVRA 1NHVA 2VG5A 3N6MA 3OS0A 1CXQA 4DTOA 4ED7A 4KB1A 3QIDA 2JEGA 2XGQA 4ECTA 3LPUA 2UVVA 5HRSA 4CGIA 4DQRA 3VN5A 3LWLA 4CK3A 3VQEA 4CJQA 2WONA 4KHSA 1VSIA 3VQCA 4QWAA 4I7FB 3KK1B 4B08A 2PZSA 3KNAA 3V6HA 4H4MA 1UA1A 2IC3B 3QIPA 3KK2B 2Z1GA 1B9DA 2HHUA 2BR0A 4J9RA 3QGHA 2HWIA 3AVJA 4DTNA 2IGIA 4J9LA 3M8QA 1HYSB 4Q5VA 3IS9A 3VA3A 1KHWA 1S1VA 4LSLB 2A1SA 4ED8A 4YMEA 1DLOA 1ASWA 1BI4B 1ITGA 4E7HA 4TXSA 4B9TA 4FZXC 4U7CA 3NF8A 3PUFA 2ILZA 5K14B 4MK9A 3LP0A 4ZHRA 1CLQA 4CECA 3KOAA 3ZSQA 3L3UA 1L3SA 4DG1B 3QEIA 4BE2A 4KRFA 2G8IA 4FM0A 3EPIA 1NKBA 3QEXA 3Q8PB 1C0UA 3PVXA 2KFNA 4NLVA 3GV5B 3QO9A 3DLRA 3NFAA 1RT5B 5DLGA 1QHTA 4DFPA 4O4GB 4O3QA 1VRUA 3V9UA 3OJUA 4F50A 4Y1DA 1D0EA 4EZ6A 4N56A 4CEQA 1JLEB 4BDYA 3SUPA 3SQ0A 3QERA 3CJ3A 4Z4FA 4AHTA 5J2NB 3CJ0A 1HQUB 2YNIA 2AWZA 1QSSA 3PW0A 3VQ5A 2XY5A 1HNVA 1RYRA 2OPQA 2HMIB 3UR0A 4KB0A 5L1LA 3I5BA 3WNFA 4E19A 3OYNA 4J9QA 4AHUA 4PY5A 4I9LA 2HHQA 3MR2A 4LQ9A 5DMRA 1KRPA 1WN7A 1JLAB 1JLBB 3DRRA 1S48A 2D0CA 4QWCA 5KFLA 1RT1B 4O3SA 1RA7A 4Q43A 4KHUA 3RR8A 3G6VA 5JS1A 4MIBA 3AO2A 2X6NA 5KFTA 3F73A 4AHCA 2QK9A 1TKXA 4O44B 1S0OA 1U45A 2VG7B 1Q9XA 4CJFA 4EYIB 3KMQA 5KFKA 1OS5A 3OYIA 4RNMA 4KTZA 3RB6A 3QESA 3ISND 3OSNA 3PO4A 4QPXA 5KG6A 1HMVB 4F8RA 3K57A 1HARA 4CF9A 1J9AA 2Y1IA 4DL2A 4KREA 4IDKB 4RW8A 3THVA 4KE5A 4Q8EA 1RT1A 3IAYA 4E7IA 2W9BA 2W7OA 5KFEA 1S1WA 3O3GA 4HHTA 5KFVA 4BE1A 3D0PA 3S9HA 4J2EA 3MR6A 1UWBB 1BQNB 2HHXA 3DRPB 2F8SA 2HMIA 4F3TA 4R5PA 4ZMMA 5EU7A 4M3RA 3VQDA 2YNIB 1L3UA 1N5YB 1N56A 1CXUA 3SJJA 1T3NA 1K1SA 5SWMA 2JC0A 3OSPA 4JS5A 1HRHA 4O4GA 5KFDA 5J1EB 1SUQB 5KT5A 4J9MA 3SQ2A 1RBTA 1A5XA 1LWEB 3MECB 1RDBA 4WE1B 1YVUA 3QETA 4O5BA 4IR9A 3TAQA 3HYFA 4YFUA 4CF1A 3CFPA 4RW9A 2ATLA 4OPKA 3ZSZA 3AVNA 4J9SA 3QGGA 1T03A 4K4YA 1J5OB 3OS2A 4ECYA 4CFDA 3VQQA 4B8AB 3BSNA 4TQSA 4RW7A 4CJUA 1X9WA 3K58A 2YNHA 2BRKA 4GVMA 3VQ7A 1RDCA 3BSAA 4FJJA 4TYBA 4FZZA 2R2RA 3GILA 2BE2A 3D45A 4KFBB 3ZT2A 4JUZA 5KFPA 3BGRA 4FLVA 3DYAB 2CJQA 4ED6A 1HYVA 4NCGB 3QIPB 3FFIB 1RT2A 1TAUA 5KFZA 3M9MB 3KLFB 4O3PA 4KTWA 4CE9A 4ZP9A 5KFOA 4I7FA 3KK1A 2P5GA 2WONB 4E7KA 4DTXA 4WXWA 2JEJA 4CFCA 4FJLA 3UIQA 3DOKB 2G8FA 2Z1IA 1S97A 4XIUA 4EP5A 2R8KA 1BCMA 4FS2A 2B6AA 5KFHA 3V1OA 2ZE2A 5I42B 2Y1JA 3BR9A 1S1TB 5KI6A 5C24B 3MECA 3RR7A 2D0AA 4WZMA 5J1EA 3HKWA 3SUOA 3GV8B 2D41A 1BGXT 4TLRA 1RT3B 3H08A 2JLEA 4PWDA 3MEDA 3N6NA 4K4XA 3CWJA 4I2QB 3HVWA 4ED3A 3NH1A 1C6VA 2UVUA 4R5PB 1TP7A 4CF8A 1JLQA 4AH9A 4ECUA 1BQNA 3I5CA 4QAGA 2VWKA 3AVIA 4Z4CA 1C0TA 4KHMA 4E3SA 3RWUA 2KQ2A 5KFCA 3CJ5A 2W9BB 2DPIA 4Y2AA 1JX4A 3GIIA 3DLGB 5CYQB 2XI2A 3IGVA 4Z4EA 2B5JB 1WSEA 3DMJA 1S10A 1NK4A 2J6TA 4KHQA 4IFYA 4HTUA 5F9LA 4M3UA 3OYFA 4JV0A 1IG9A 4ECXA 3SFUA 5FRMA 1SH0A 3VQ6A 2J6UA 4CJVA 3KLVA 2Q3SA 4CESA 3ZT3A 4RW6A 2WK4A 3LZIA 1RAJA 4XO0A 4IRDA 4Q0BB 4CEFA 3C94A 4IH5A 3QEVA 5KFIA 1NK6A 3HXMA 3MR5A 1RTIA 4Q44A 4FXDA 1TKDA 3MEGB 4DLGA 4FJMA 2UVWA 3KLHB 1DTTA 1D1UA 1RT7B 3OLAA 4EP4A 3OYAA 1XHXA 4BWMA 4CJPA 2IOCA 3FQKA 4FM1A 2VWJA 1GX6A 3NH2A 4F4ZA 5KG4A 1IKYB 3DRSA 4K8XA 2BQRA 4C8KA 3SPZA 3L2VA 3CDUA 4G1QB 3V6DB 2FBXA 3I8DA 4CJ5A 2GC8A 5J2NA 1HQEB 5CYMA 1BL3A 3K5LA 3LPTA 4CF0A 4HCBA 4EBDA 4K4TA 4B9VA 2YKNB 2PYLA 3P5JA 3SI6A 1S6PA 1RT4B 1HYZA 5KG2A 4B8CA 5F8IA 1LW0A 3KLEA 3ZT1A 5KT3A 1TGOA 1JLQB 5EWGA 1EKEA 4NLYA 3SV3A 4NYNA 4DG1A 2VA3A 3KLIB 4IFVA 4NYFA 4I2QA 3K5OA 1C1CA 5K14A 1NJZA 5D3GA 4DTRA 1SKWA 3AO5A 2RKIB 1CSJA 3VQ4A 4OGEA 1X1PA 3Q8SB 4KHWA 3T5JA 3I0SB 4WFXA 3LANA 1UA0A 1TL1A 3M8QB 2DPJA 1W0HA 4WFZA 3KTQA 1QAJA 4M3XA 4DLEA 1WNSA 4DQIA 5KT2A 3MFIA 5DLFA 1TL3A 2G8VA 4DU1A 2D0BA 2RKIA 1NJXA 3I0RB 2ETJA 4MFBA 3KK2A 1TQLA 2FBYA 3LALA 3DOKA 3H5XA 3QEPA 3HPGA 4H4MB 1NHUA 5L1KA 4EYHB 3MF5A 2RF2A 3MXIA 2AJQA 4CEBA 1KFDA 2YNFA 2QKBA 4KHNA 2E6LA 4H54A 3ZCMA 2HNZA 1QAIA 3SUQA 1FKOA 1GOCA 1RT2B 4DU4A 2ASJA 1NKEA 1RT4A 4YR3A 3P83D 1I3AA 4DL3A 3BQ2A 3UPFA 4DS5A 2YKNA 3G10A 3ZSVA 4PUOA 3NGYA 3GIMA 4EO8A 3OL9A 3HO1A 4ELVA 1S0NA 4W5QA 4NCAA 3KHGA 1HQEA 4GC6A 1W9HA 1JLGB 4G1QA 3NCIA 5KFGA 4ECVA 3LDSA 1RNHA 4IG0B 4DU3A 3NMAA 2G8UA 2O4IA 5I3UA 5E41A 1O1WA 1REVB 4FJ5A 4PA1A 3V4IB 2GIQA 1ZTTA 1S9FA 2GBZA 4OGCA 4RG8A 2OPPA 2R8JA 5HROB 4HUEA 3H5UA 4KKOB 4RW4A 4G3IA 4LSNA 4CERA 3CM6A 2HNYA 1C2PA 4C8LA 1SKRA 3SI8A 2QXFA 1BISA 1VSKA 2RDIA 3RMBA 5KRSA 1BQMB 4ZPAA 2C22A 2KTQA 5KFJA 3EZ5A 1IKVB 1C1BB 3MAQA 1IKXB 1RTDA 3E51A 4CJRA 2KZMA 4CJKA 4CF2A 5J2QB 4M95A 1YVFA 1JXLA 1LWCA 3QZ7A 3NAEA 5JS2A 3TAMB 2XC9A 3LP2A 3RAXA 4JV2A 1RCHA 1NNDA 3OL6A 4OJRA 4DFKA 1UWBA 3HP6A 4ZVHA 1RDDA 4M42A 3BSCA 1LAWA 1T05A 2XCPA 4FJKA 1TKZB 3TWHA 4RUAA 4YR0A 3F9KA 4JRQA 3C6TB 4DMNA 4Z4GA 1S9EA 1J53A 3P1GA 1FK9B 3NBPA 3KLGB 3AVKA 1S6QB 2WTFA 4DF4A 3M8PB 5HBMA 1RDAA 3L2QA 4MK8A 2IAJA 2DFEA 1S9EB 3TARA 3HVRA 4F4YA 1RT6A 4Y2CA 3LZJA 2LSNA 4CHYA 4MQ3A 5C5JA 3TAEA 3PHEA 4YR2A 4B3OA 3CIZA 3VQSA 4LQ3A 3QNOA 1HMVA 1JL1A 1RTHA 1Z25A 2VG6B 4ZVGA 2W8LA 1RTDB 2E9ZA 4MKAA 4J2BA 1N4LA 5L9XA 4O3NA 4W5OA 2G8HA 3S3NA 2HWHA 3CQ8A 3D5MA 3M8SA 1TK8A 4QOZB 4NLXA 4M41A 3U3YA 2NUBA 4NRTA 2HNYB 2ALZA 4OLBA 4FBTA 2FVRA 3AV9A 5EWFA 4KI4A 4RUCA 1U47A 1JLBA 3QLHB 3DRRB 3DLHA 3G0ZA 4CIEA 4MH8A 1IH7A 5DQGA 3HVTB 5KGWA 3NE6A 1R0AB 4DTSA 1NK0A 4DSLA 2Z1HA 4OLAA 3H98A 4PUOB 3QIOA 2E4LA 3PW2A 2HHSA 1XR7A 4E1NA 5DK5A 4RNOA 2RN2A 3KD1E 5F8NA 5C42B 1QS4A 3LAMA 3OS1A 1RBVA 4OL8A 5F9NA 4ZP8A 5HRPA 4M3YA 3RAQA 3ZT4A 3L2UA 4FJGA 4K4VA 1RBRA 4OPJA 1NKCA 1L5UA 3SPYA 1LWFA 1VRTA 4O55A 3NGDA 1T8EA 2YNGB 2AGOA 1G15A 2EC0A 2XCAA 1TAQA 4CJEA 4MFBB 4Z4IA 3RB4A 2EX3A 3D28A 3PX6A 1TK5A 3MR3A 1YTUA 4DSJA 1TL3B 2XHBA 2ATQA 4DSEA 3SUNA 3DLKA 3JSMA 4CCHA 4E7JA 1TL1B 2C2RA 1C0MA 3HVAA 2FLPA 5HRRA 1ZBLA 4WE1A 4XPEA 5KFBA 1SH2A 2JC1A 4CK2A 1UOCA 2XRIA 4IR1A 4XPCA 3TR8A 1C1CB 4CJ3A 1LAVA 3O3HA 5C25B 4IFVB 5KG0A 1R0AA 4DEZA 4FLTA 4FVMA 3WNHA 3DRPA 3V9XA 4CJTA 4ELTA 3CDWA 4HCCA 4B9SA 1S6PB 3NL0A 4JS4A 1VSEA 1MMLA 3OYLA 5JUMA 4KI6A 4M94A 1ZTWA 4FZYA 2FVSA 3O4NA 2GUIA 3VQ8A 3PZPA 2HNDB 3SQ1A 3KJVA 4NLOA 5HLFB 4FLXA 1U48A 3SV4A 4Z0UA 5F8GA 3BQ0A 2ZD1A 1S1XA 3VQAA 3CFOA 5DGAA 3PR4A 4BWJA 3Q8RB 1IKWB 5KG3A 4F2SA 1RTHB 4ECQA 4TSXA 4NZ0A 3TAFA 4AHSA 4B3OB 1KLMB 2D3ZA 1KVAA 4DTPA 2BGGA 4H4OB 5KRTA 1CZ9A 3AA3A 4KO0B 2IM2A 3EZUA 2YKMB 2W9CB 2IAJB 4GC7A 3IG1B 2XY7A 4ID5B 2IM0A 4FJ7A 2ZQBA 3RMAA 3MEEB 3PX0A 1TKZA 4N76A 2AX0A 4OKJA 1NK5A 3VQBA 5J2PB 3AA4A 1NOYA 3OHAA 3VA0A 3PW5A 4DQSA 4NLTA 4KPYA 4KV8A 4U6PA 4QW9A 3MEEA 3PJXA 1KLNA 1D5AA 1JLEA 2OPSB 3FSIA 3QEWA 1C1BA 5KG5A 3DLGA 3T19A 1NK7A 1JL2A 2IJFA 4KO0A 4R0EA 1SH3A 3H59A 4AHVA 4CGJA 4M45A 2VA2A 3HPOA 4H4OA 4I2PB 3L2WA 3TAGA 4RU9A 3T5LA 5HP1A 1S9GB 2UUWA 4CJLA 5CZ1A 2XGPA 3L3VA 4F2RA 4ELUA 4DTMA 5HROA 4NLDA 1BCOA 3ZSWA 2BANB 2FLNA 3NF9A 3ZSXA 4WYWA 4ZHRB 1EP4A 1C1AA 1EX4A 3OHBA 4PWDB 1XWLA 1REVA 4ECZA 2X6SA 1DTQB 3OVNA 5C24A 2GV9A 3EYZA 3PR5B 4ZVFA 5CZ2A 3V9ZA 1WSFA 1XHZA 1JXBA 5I42A 2ZE2B 4KBIA 2V0NA 2F8EX 4BDZA 5KFSA 3PV8A 3MFHA 1S1XB 4YP3A 2QKKA 4TY8A 2DFHA 1JXEA 3QGIA 4N41A 2HNDA 1FXXA 3AVLA 2XY8A 1GX5A 4PQUA 1YT3A 2ILYA 3K5NA 4NLSA 4TQRA 1WSHA 4ZPBA 4ZPCA 3KLFA 3NAHA 1ZETA 1HNIA 4ZTJA 2YHBA 4ZP6A 4NCGA 2E6MA 3HSTB 3I0RA 2HHTA 1F21A 3KHLA 4KFBA 4R8UB 2BE2B 5C25A 1BHLA 1Z4UA 4O0IA 1N48A 3WNEA 2B4JA 2G8WA 4FW1A 1X9SA 4RZRA 4NLPA 1A5VA 5DQHA 2YNHB 1EXQA 2ZKUA 4FYDA 4RW7B 3PW7A 3PJWA 4ED0A 1TKTA 1IO2A 4QCLA 5F8LA 1NK8A 4MK7A 1FKPB 5KFWA 4F4XA 5KG7A 1B9FA 1VSFA 1VRTB 5J2MB 1LWFB 4IKAA 3HL8A 3OYHA 5J2MA 4JRPA 3NHGA 3U3GA 3GQCA 5F8HA 3RBEA 1BIUA 3M8RA 5KGXA 3L2RA 4GW6A 1FKPA 1IM4A 2R7YA 1XC9A 1ZBHA 3UQSA 3H4DA 4DL7A 1EETA 1QSYA 1XI1A 2D7SA 3ASMA 2UUTA 2HW3A 2I1RA 3TVKA 3H40A 1B92A 1N5YA 4IOBA 1JKHA 1ASVA 3V6DA 2DFFA 1XR5A 4CJ4A 4ZVEA 1VSDA 3G6XA 3ZT0A 1HNIB 1IKYA 4DF8A 3CYMA 1JLCB 4W5NA 1TK0A 1S1WB 3PW4A 2KFZA 2WHOA 4Y3CA 4CEOA 2D3UA 4W5TA 1RT7A 5DG8A 3HVTA 4HUGA 1S5JA 4DL5A 3MEGA 2W8KA 2ITGA 4UQGA 4IDKA 3S3MA 4DFJA 4NLGA 1NJYA 4TY8B 3AA5X 3ZSRA 4QWBA 3CJ2A 1WAJA 4AHRA 5KFNA 2YHAA 3ITHA 2EHGA 4CEDA 1RA6A 4J9NA 4KB7A 4IH6A 2ASDA 4ICLA 3AVFA 4F4KA 3IN5A 3GIJA 4EEYA 5F8MA 3KK3A 1DTQA 4J2AA 5CY4A 4Q45A 1Q9YA 3BQ1A 3SQ4A 4EBEA 4NLQA 3OY9A 4KHRA 3DMJB 1XR6A 2HB5A 2B5JA 2GIRA 2AGQA 4DTUA 4DTJA 1FK9A 3KLGA 3OYKA 3TQ1A 2IMWP 2V9WA 3ALYA 3DLEB 4URGA 4I2PA 4ZPDA 2IA6A 1T05B 3C95A 3RTVA 1WSIA 4CGDA 4GMJB 3PY8A 4DQPA 3KD5E 1TVRB 4TY9A 1K1QA 4AILC 1LWCB 4HYKA 5KFQA 4J9PA 2A1RA 3C6TA 4K4UA 3C6UB 2BDPA 3MXJA 3QZ8A 3NKYA 3K2PA 1KHVA 4MIAA 5FROA 1RT5A 1KFSA 1BQMA 4CHOA 4N5SA 1QSLA 1MU2B 2J6SA 3QINA 3KK3B 1D8YA 2E9TA 4MKBA 4IRCA 4FLZA 5DQIA 1IKXA 3H5YA 2XY6A 2WCXA 4W5RA 4RW4B 4FJIA 3OYEA 1YTAA 2AQ4A 2IBKA 2WOMB 4C8OA 4OVLA 2FJVA 3ISNC 1KLMA 2OZMA 3IRXA 3QNNA 4KSEB 2C2EA 4WYLA 4LSNB 4CHZA 3MXMA 4N47A 4KKOA 2XI3A 1RDRA 2OZSA 4JV1A 1IKWA 1A5WA 3IS9B 3AO3A 3HP9A 2OA8A 2HHWA 3BREA 3V4IA 1CZBA 2FVCA 4CIGA 2FBVA 2ZD1B 3VQPA 4IG3A 3BGRB 4ZP7A 1JLGA 1SKSA 1S4FA 2E9RX 3DM2B 1S1UB 4O4RA 2YNFB 3GV7B 1WSGA 2RF2B 4NLRA 2KW4A 3AVMA 3NGZA 3OYDA 4HUFA 3SCXA 1Q8IA 1FKOB 3HJFA 3DI6A 3LP3A 1JLFA 2VG5B 1T03B 3TI0A 4CIFA 3KMSA 3T1AA 3HT3A 1N6QA 3QYYA 4QW8A 2HAIA 2CKWA 4E0DA 3NF6A 2P5OA 4DSIA 1T94A 2FLLA 3CO9A 2V4RA 2OPRB 4FK4A 5HRNA 1J54A 1VK0A 4LH4A 4QWEA 1TV6B 5KFUA 3S3OA 3DLKB 3JSMB 1U49A 4CHPA 3O3FA 4R8UA 3KLIA 2P51A 3PX4A 2R8HA 2FC0A 4BACA 3RRHA 3DI6B 3OYBA 3RB0A 1S0MA 1WSJA 4FCYA 4FJXA 1VSMA 3LWMA 2YNGA 4ECSA 4F3OA 5F8JA 4CJWA 4BE0A 4CHNA 2AGPA 3BSOA 4NYZA 4K50A 2BQ3A 1VSJA 5L1JA 4K8ZA 1LW0B 3KLEB 3L8BA 4IG3B 2X78A 1WAFA 5KFYA 4K4WA 4E1MA 4DL6A 2IJNA 4ED1A 4L8RB 4NLWA 3KIOA 3T5KA 3LP1A 1BIZA 1SL0A 4TYAA 4IH7A 4NCBA 1RILA 4K4SA 5KT7A 4O3OA 3OJSA 4C8MA 5L1IA 1ZYQA 1ZBUA 3DLBA 1DTTB 3KLHA 4KHYA 3IRXB 4FJ9A 2RPIA 2OYQA 1RTIB 3DRSB 3CDEA 2D5RA 2DTUA 4J2DA 2W42A 3LAKA 2WOMA 2W9AA 1WNEA 4DSKA 4O3RA 3QLHA 2BANA 1RTJA 4KTQA 4CK1A 3DDKA 4CJSA 5T7BA 4DFMA 4LD0A 4LH5A 4BDPA 4RW6B 1GOAA 1S9GA 5EUHA 4ED2A 1JLAA 2FBTA 1SL1A 4DL4A 2Z1JA 3FQLA 5KFMA 2HVIA 4CGFA 2FJXA 4DWIA 2OPQB 4F4WA 2PY5A 3HM9A 4ID1A 3BJYA 2C2DA 4KV8B 5CYQA 3K59A 1VRUB 1TVRA 3SFGA 3AO1A 2FJWA 4IFYB 3RB3A 5DG7A 2G8KA 4CGHA 3O4QA 4Y1CA 1RT6B 1C0UB 5KT4A 2QV6A 3A2FA 3IGNA 1VSLA 5HBMB 4JLHA 2W7PA 4FS1A 4FJNA 4ID5A 3U6FA 3GYNA 1KCFA 3NBPB 3T5HA 3RMCA 2YKMA 5KFFA 2R2TA 1C0TB 3V81B 1VSHA 2JGUA 2IDOA 4LY7A 3BDPA 4KAIA 2OH2A 3AO4A 3OLBA 3AVHA 2QE5A 3LP2B 3TAMA 3FDSA 3TANA 1ASUA 3AA2A 3JYTA 1U09A 5KFAA 3CM5A 3V9SA 3TABA 1S1VB 4X2BA 1QUVA 4RNFA 1HYSA 1LW2B 2X74A 3ITHB 3OYJA 1IKVA 3EY1A 5KT6A 1KSPA 2B6AB 4IRKA 4K4ZA 3KHRA 4EBCA 1RBSA 2PYJA 3B6OA 2RDJA 2OPRA 1S1TA 2IC3A 1I39A 5FDLA 1N6QB 1HPZA 3SYZA 2OPPB 3V1RA 2KZZA 1JLFB 4C8NA 4IBNA 1KTQA 1X9MA 4OKKA 5I3UB 4FW2A 1D9FA 3DOLB 4IG0A 3KHHA 1GOBA 4J9OA 2HHVA 4CFAA 5KG1A 3E01B 1NJWA 4URQU 1S1UA 3DM2A 1T7PA 3NAIA 3FFIA 4M3TA 4NLUA 2R2SA 3MTKA 3DYAA 4QWDA 3FRZA 4WFYA 3GIKA 3DOLA 3I5AA 4FM2A 4TN2A 1RBUA 3H2LA 4CEAA 3OYMA 3OL8A 2HNZB 2JEFA 5KFXA 5DGBA 3ICLA 5SZTA 3H5SA 3B6PA 1J5OA 3HPHA 1LV5A 1HPZB 4EZ9A 3N6LA 4URSA 1Z26A 1KVCA 3OL7A 5FDLB 4ECWA 3OYCA 3AVGA 4DQQA 3PO5A 4DS4A 1TKTB 1LWEA 2I5JA 3ZSYA 4HKQA 3OYGA 3V6KA 5T14A 2FVPA 4H8KA 5EDWA 4YQWA 2V4QA 2AX1A 1LW2A 3KKRA 3WNGA 4RW9B 3KKSA 4FBUA 3I0SA 1U4BA 3UDLA 2IS3A 3JYTB 3RBDA 1QE1A 1MU2A 5JXSA 3Q8QB 1SUQA 2HVHA 5C42A 4B9LA 3CJ4A 5D3GB 3CFRA 2IM3A 3V81A 4IKFA 3C6UA 2O5DA 2B43A 4CEZA 4B9NA 4HVJA 4WZQA 4PQUB 3NF7A 1L3VA 3HHKA 4B9MA 4FLUA 5EWEA 4Q8FA 4FLYA 4OKEA 3ULDA 3RMDA 1QTMA 3DLEA 2BRLA 1U04A 3M9NB 3AVCA 3NGIA 3NH0A 1S49A 1SV5A 1WLJA 5KTQA 4FJ8A 4CGGA 4FJHA 5CYMB 2R2UA 4RW8B 4Y34A
chains in the Genus database with same CATH superfamily
4LRCA 2QG9B 3OA9A 4LFBJ 4ILRA 3FZMA 1WBDA 4CZMA 2DHSA 1HNXJ 3SEOA 3OUYB 1EP4B 1WOQA 4USIA 3CVKA 1VMBA 4PWUA 1U1QA 4ICLB 4WK1A 2QGFB 4C48A 1DHMA 3CJAA 1YF5L 4OFZA 3BBBA 5DDOC 3GE1A 2CWKA 2O4GA 2OSQA 2UXDF 1HA1A 4WCEQ 2WB4A 4KGZB 1YJ7A 3GLJA 4MLHA 3ILIA 2OPSA 1S6QA 4A8OA 4RNHA 4H03B 3V6JA 5AQWA 3MZIA 4E89A 1ZBIA 2WRMA 3V1QA 5HMYA 3MGJA 2UXCJ 3RVCA 5GAHU 3IM8A 2DRBA 4E98A 2NUHA 3FCHA 2B51A 1NAQA 3IRWP 1HNXK 4Y2KA 5CABA 2W9CA 3AHPA 2ASLA 4DSFA 4FK0A 4ILGB 4CTAB 2JEIA 1R27B 4B3TF 5FPDA 2XWYA 1NO8A 1WOSA 3ONQA 2AU0A 4O0JA 2CYYA 4KH4A 3M9OB 2F63A 1GFWB 3ENAA 3VZIA 3ZNJ1 4DV2K 5AR0A 3LP0B 2XNQA 2GHVC 4E7LA 3RGIA 2DEJA 2EFVA 4OYWA 1GTEA 1HJRA 4HT7A 4B1XB 4E1JA 3IC1A 1W25A 1SC4B 1NHVA 4M5LA 3TR5A 4IXCA 5IT0A 1YJVA 4NXMF 3CPWR 4ZVOB 3MCSA 2DGTA 1HWUA 3IKMA 1YLXA 2XGQA 3LPUA 5HRSA 1ZPWX 3LWLA 3W65A 1RHRB 3FCWA 3EMTA 3NMUA 1FX2A 4CJ7A 1XMQJ 2B4PA 4NA2A 2J0SD 5ETQA 3KNAA 4H4MA 1UA1A 3LQVA 2YKPA 3UI3A 4JI3F 3QIPA 4DR2J 4GRSA 2BR0A 1K8AO 1IVZA 1NSKL 1UVMA 3AVJA 5AQPA 2IGIA 2AV5A 3M4XA 3M8QA 2JFDA 3VA3A 5BR8K 6FDRA 2NR0A 3PDNA 1NU4A 3ULHA 2KH9A 4E7HA 3QFUA 4U7CA 1XMBA 3PUFA 4MK9A 4DU8A 3GP9A 1DBDA 3SCKE 4O0NA 4ISGA 2ALYB 1LK5A 4DG1B 3QEIA 5D77A 3C7NB 1XN9A 3MEKA 1QVGR 3GWCA 3Q8PB 4CM2A 4DHVA 2KFNA 2FUG9 4NLVA 4IJNA 1LWXA 3CJ8A 5EN1A 1IJFB 3QO9A 3QGPA 2AF6A 2KXHA 4DFPA 1KAZA 4UW2A 3V9UA 3RBXA 4L3QA 1S77D 4Y1DA 1D0EA 1JXVA 4AHTA 1FRJA 4P75A 1HNZF 1QSSA 3RUBL 3PW0A 2PFUA 2UUCK 3CMES 3SSSA 3H2UB 4AHUA 4PY5A 4I9LA 5ADZA 2R7WA 2GHPA 4WJBA 2GFFA 5DMRA 1JLBB 3DRRA 2D0CA 2AP6A 1FXRA 4KHUA 4WQ5A 1N0VC 2OTJS 1Y0HA 2YWKA 2HHPA 2XHCA 2QK9A 5HVHA 1S0OA 1MG7A 1Q9XA 4KJIA 4LF7J 3KMQA 3BPDA 3OYIA 4KTZA 4ETXA 3ISND 3VGVA 5JLFA 3K57A 4CF9A 4YS2A 2CPEA 4DL2A 1S0VA 2EFGA 3ZZPA 2HURA 2HZCA 2BYCA 4EMDA 4BG8A 4G1IA 3CCQN 2BM1A 3IO1A 4ZLNA 4FPRA 3J7YU 2JWLA 2DR9A 1PO6A 1FTCA 2BABA 3S9HA 1UWBB 1BQNB 4X66F 2F8SA 1R0CB 4R5PA 1HWKA 1GTHA 2HF4A 2HIQA 1CXUA 1EJ7L 1T3NA 2ZUAA 5SWMA 4P2FA 2QFJA 3DXBA 5KFDA 3EJMA 1N36K 1SUQB 4M5GA 1RDBA 3MECB 3QETA 2DGOA 3UKUA 4CF1A 1U2CA 1H7WA 4RW9A 3EKUA 3NG8A 4J9SA 4K4YA 1J5OB 3VF6A 3DXMA 4CFDA 4GV9A 5AJ3K 6FD1A 3Q89A 5B0BA 3BSNA 2R7OA 3C3LA 1EAYC 4CLLA 2QL5B 1PJ5A 4OHVA 4ANDA 4DR1F 4FZVA 3VQ7A 5D0HA 3Q23A 1RDCA 1XNQJ 4FJJA 1EIYB 2H4WB 4LF4F 2CJXB 3GILA 5IT9Y 3AAPA 4JUZA 4A48A 3BGRA 2G0JA 1NB2A 2ZH5A 2AJ0A 2M8DB 1TAUA 4HDGA 3NS5A 5M1KA 4OLPA 4ES3A 2P5GA 5BREA 3PIPQ 4DTXA 4WXWA 2KKZA 2RNEA 3DOKB 4B17A 2ZJPL 1HBOA 4PZVA 3C15B 2G8FA 1KWMA 4XIUA 3ILLA 4FS2A 3BB5A 2DNOA 3O9UA 2QSFA 2MTLA 1N32K 5KI6A 4HACB 1V3ZA 4FYXB 4JK9A 1LOUA 4WZMA 4Y65A 2D41A 1YJUA 4PWDA 2CQ2A 1U2RA 4GY2B 2JJ4D 3N6NA 3CJRA 4K4XA 3BV8A 4GVBB 4ED3A 1AZSB 5LMNJ 1NH8A 2PEBA 5KOWA 2ROGA 1VFJA 4CTAA 2VICA 4Z4CA 1FT8A 4AUKA 1UP1A 1C0TA 4E3SA 1ZBTA 3CJ5A 5KFCA 3EZOA 2CQIA 4X4SA 1FRLA 3MHYA 2M52A 1IBCB 3IGVA 2RDDA 5EX3A 4RO0A 4R25A 3I9V9 5C2DA 2ZZMA 2GA7A 3DMJA 3J81Y 4WP3A 5AFUH 4A8SA 2JZ5A 3KHYA 4J37A 5IWAF 1HNWK 4GMKA 4JV0A 2LQ8A 3O08A 1N32J 5FJ4A 3TZWA 3KLVA 2JNJA 3A4TA 4CESA 4IOCQ 2CH6A 4DMZA 1I94J 2ZVIA 3NNCA 3W60A 4A61A 5C12A 5BN8A 2VZ9A 4IH5A 3QEVA 3HXMA 3MR5A 3L09A 1RTIA 4F9OA 1SQFA 1D1UA 2HEKA 3ZLJA 2HBLA 4CJPA 4L75A 4DR5F 4FM1A 2Z56B 5LMNK 3NH2A 4F4ZA 5KG4A 3DRSA 2DCLA 2H65B 2BQRA 5H9FJ 4C8KA 2RRBA 1FNXH 1FA0A 4J9VA 5LXYA 1N32F 3V6DB 2FBXA 1YWXA 2ZUGA 5J2NA 1HQEB 4FWKA 4Y28C 5CYMA 1BL3A 3LPTA 3BP8A 2MQ8A 2CIMA 2YKNB 2NZCA 2F9TA 2WUSA 1VBZA 3GOIA 4UTGA 1BUXA 1S6PA 4EWTA 3ATVA 1Y5NB 5LSLA 1U8SA 4KPCA 4N7TA 4CZGA 2IVMA 3ZT1A 1RWMB 2WVEA 2H9ZA 1EKEA 3MM5B 3SDEA 3SV3A 4DV6J 2VA3A 4BG9A 2XWXA 2B0GA 3K5OA 1C1CA 5FLXY 2E1AA 5K14A 4C23A 1NJZA 1WC5A 4P72A 1SKWA 3QRPA 4DTRA 4A8MP 1VQNN 3VQ4A 4OGEA 1X1PA 4KHWA 1NSAA 3LO3A 4PXEA 1W0HA 4WFZA 3KTQA 1QAJA 4M3XA 1N5SA 1NNEA 3X1LB 2ZH8A 1HKCA 2BJ9A 2KI2A 3TJ8A 2V8HA 2ACYA 3S8SA 2ETJA 2DB1A 3KK2A 2G1DA 4FWLA 2XG8A 1Q5YA 1HBOB 2I38A 2OKQA 4PWWA 3DOKA 1ZPVA 3CCVS 3GPAA 4OZ3A 2AJQA 2YH0A 3NP5A 3HSGA 1U0HB 3CCZA 3CC7S 2HNZA 1QAIA 5AE3A 2V51B 1VBXA 2ZGYA 1GOCA 1RT2B 4DU4A 2ASJA 1RT4A 4YR3A 5GMEA 4DUZF 1KD1T 4C0BA 2RUSA 2HK3A 3ZSVA 5BR8J 3NGYA 1OH7A 1EHWA 5JLHA 4ELVA 5C0YA 3KHGA 3NCIA 1BQXA 5B0FA 3P4UB 4OO1J 4JI4K 5K5MA 1RB0A 4BROA 4RG8A 4NO7A 1QTNB 4CERA 3CM6A 1SKRA 3SI8A 1HWIA 4AQYK 3ZZ0A 3PIOL 1VSKA 2OO4A 2VGNA 5JVHL 3RMBA 4ALZA 4CYUB 2ZM6F 4ZPAA 3W9JA 1RCXB 2MY7A 4MO4A 3LUYA 4KIAA 4DPOA 3UDVA 3QZ7A 2FGOA 4P2SA 1Q86O 2XC9A 3RAXA 3T7ZA 1UWBA 3HP6A 1RDDA 2QEXN 2F1FA 4XDCA 4M42A 1YJRA 1T05A 2XCPA 1TKZB 4RUAA 3F9KA 3C6TB 4DMNA 3HT0A 4Z4GA 4J91A 3P1GA 3O44A 3VF2A 3SJHA 3M8PB 2H5JB 1RHQB 1X4AA 2Z2YB 5F0WA 3W64A 3HVRA 3FRYA 1S76D 4USHA 4Y2CA 3LZJA 4CHYA 3NEKA 3GCXP 1PYSB 3PHEA 3HSZA 4CO4A 2A0FB 3CIZA 1YRXA 2NRVA 1JL1A 5H1SQ 1HWJA 2VG6B 4F36A 2QWNA 1EARA 3SSQA 3CQ8A 1YHQS 3M8SA 2POKA 1TK8A 1RE1B 1WSVA 2MZQA 3OR1B 1NBEB 3IA0A 2HNYB 3D4JA 4DX6A 2DNPA 4RUCA 3DLHA 1JLBA 3DRRB 5T41A 1RQ0A 4CZFA 2HGMA 3R6LB 3C6AA 1RFQA 2UUCJ 4PKIA 4MH8A 2C2NA 1IH7A 4NWBA 1SC6A 5DQGA 3HVTB 4FWPA 3NE6A 2ZITA 5DZ6A 2F40A 1NK0A 1GLDG 3CJKA 3H98A 4PUOB 1QLNA 3PW2A 4E1NA 5DK5A 1ZA1B 5IFMA 2LP4A 1QS4A 4FNHA 2FJDB 2YY3A 1RBVA 4ZP8A 5HRPA 4M3YA 3HOSA 5EY4A 2F65A 3L2UA 2XZWA 1TELA 4K4VA 1OKJA 4EK2A 5B0EA 5LT5A 2DGUA 3KDOA 1VRTA 3J80O 4JYAF 1T8EA 2YPYA 2D3O1 2EC0A 4GKJF 1TAQA 4MFBB 4ILJA 2VC0A 2DITA 2LQJA 3PX6A 3MR3A 4DSJA 3VAIA 2XHBA 2L9DA 2OSRA 4QU7A 2WVDA 3N5FA 4NXMJ 5AQRA 2O66A 2Z4PA 2ZVSA 3D67A 1CG2A 1M5PC 1ITPA 3C6HA 1H1VA 5HRRA 4KGVB 4XPEA 3M30A 1E6YB 2G2ZA 4XH1A 4Z94A 4IFVB 3M2UA 5KG0A 4JI3J 1HUXA 5IWAJ 1WKJA 4BC4A 4FLTA 4ELTA 4CJTA 4G1PA 4HCCA 1BG3A 1T9WA 1QAXA 1RABB 4KI6A 4M94A 2P9SB 2NXUA 3AAQA 3KJVA 4NLOA 3OTOJ 5HLFB 1U48A 4FLXA 3BGOP 2HLUA 5F8GA 4JKFA 1PCAA 4EI2A 1VI7A 4X4TA 3J81j 1W2IA 4ZOSA 2EC2A 4YDXA 3Q8RB 2OFHX 5C10A 3L0QA 1RTHB 4DV3F 1K8AT 1S4EA 4TSXA 3ENQA 5AE2A 3NCPA 4DTPA 2BGGA 2O8FA 4H4OB 1U2VB 4KO0B 3F2KA 4BGBA 3LGNA 2XY7A 5LSRA 1Y11A 2HRYA 1Q95G 2IM0A 3PFEA 2ACMA 4K25A 5CH7B 2XNRA 3M8ZA 5C2CA 4JKEA 2M5YA 4LBPA 4XH4A 1NMNA 3VQBA 2QYCA 3GB0A 2ZH3A 4CD3A 2RRNA 2PMWA 4NLTA 1VGYA 4H0XB 1DQ8A 1VRQC 2GWKA 3D0HE 1JLEA 2OPSB 3ZX2A 3T19A 4JI2J 1RK8A 5D4LA 2VV5A 1SH3A 2QLBB 3MTJA 3LTOA 3PHTA 4AHVA 1YIJN 5H1SV 4I2PB 4RU9A 1JJ2M 2C2ZB 4DR1J 1BE4A 1S7IA 4IEIA 4ELUA 4DV1K 4ER8A 4DTMA 4NLDA 3OBIA 2FIUA 2RH3A 3ZSXA 3ID6A 4WYWA 1EZZB 1EP4A 1C1AA 3ZTSA 2NZ4A 1TL4A 3ISZA 4IEEA 1DTQB 4CZIA 3OVNA 2H5EA 5C24A 3EYZA 3FMBA 5BJRA 4H5WA 1XHZA 2OEKA 2ZE2B 3K7RA 1OMSA 3QAUA 2V0NA 5KFSA 2QKKA 1M5HA 2DFHA 2QRRA 2YQ1A 1JXEA 2KYZA 2L9NA 4PXBA 2VIHA 4CBUA 4PQUA 4LRAA 4C11A 3ZZZA 2LU1A 4OYAA 3FGUA 1YVNA 4TQRA 4ZPBA 3CCES 2DHAA 3ZZUA 3CCUN 4AXIA 2J8AA 2LLZA 2VL1A 4FN5A 2YHBA 2FJAB 2BX6A 4A57A 4CZLA 3I0RA 4PR6A 4R8UB 1NMDA 2D9OA 3MN9A 4BGAA 3M6UA 1MN9A 3OTEA 1VQLS 1YITS 1R59O 2UUBF 2YNHB 3W9HA 2CG4A 4RW7B 3PW7A 3PJWA 4YUDA 1IO2A 4JV5J 4QCLA 5F8LA 1UL3A 4KGMA 1XMQF 3TA1A 5KFWA 5KG7A 3GJRB 2G0IA 1SJ1A 3VGUA 3HL8A 4CZEA 4F26A 3OYHA 4JRPA 2XB2D 2LXIA 1BIUA 2Z8QA 4QIVA 5KGXA 4PAAA 3VEZA 4DUYK 4YDUC 2R7YA 2PI4A 4P9SA 4DUYJ 4B3MJ 2EPIA 4OLOA 1SJ4P 1QSYA 2D7SA 3ASMA 1Q81T 2HW3A 3BN7A 3H40A 2B9YA 1XR5A 3H46O 3EDRB 3O1BA 4DR1K 3G6XA 3ZT0A 1HNIB 1RWXB 3CYMA 3THTA 1TK0A 1G6BA 2QLWA 3ZO7A 1RUSA 2WHOA 4Y3CA 4CEOA 3VCDA 2DY1A 2M2BA 5G0RA 5JVGQ 5SUHA 2WFBA 4DL5A 3ET6B 2ZBIA 4FF4A 4ED4A 1NEEA 4DFJA 4V19X 1F2HA 1NUEA 2BA9A 1RBAA 1WAJA 3H20A 5KFNA 2YHAA 1HNXF 2EHGA 3NGSA 4ICLA 3AVFA 3PG9A 4X62F 2UXBF 3GIJA 4JI5J 1ZM3A 4DXLA 1X4BA 4NOHA 1F5AA 4OZ1A 3VTIA 2BKPA 5CY4A 5KPRA 3OY9A 2MJUA 4OPAA 3U9DA 2IBOA 3Q8VA 4A59A 1XR6A 2GIRA 4ILMA 3CMAS 3MCAB 4IO8A 3CC2N 4DTJA 3LM9A 3G25A 3TQ1A 1FJGF 1H73A 4BRNA 3MWTA 3K89A 1PYOB 1VIXA 2VPXB 3SSRA 3WEEA 4CW7B 4GMJB 4DQPA 4V19S 3D3BJ 1K1QA 1CJKB 3NS7B 1UJ4A 3M8YA 5KFQA 4J9PA 3H45C 3C6TA 5K9FA 2BDPA 2N4CA 1P1LA 3MXJA 1FRHA 2QZ8A 3NKYA 5AQHA 1XK8A 1X4FA 2PIIA 1T02A 2LQ5A 2P9NB 1QSLA 3VERA 4BRMA 3W8PA 3QINA 4DR4F 1O6XA 3WXKA 1CBKA 2D9PA 3AD7C 4MKBA 4IRCA 2XY6A 3HZ6A 2ZBQA 1JQGA 4RW4B 4ID8A 4OQJA 4YB1P 1U0SA 2AQ4A 3VVUA 1NPKA 2IBKA 4OVLA 2FJVA 2MB0B 3WQTA 4CHZA 5D0RA 4N47A 2XI3A 1RDRA 1K73T 4OI3A 1IKWA 4A8YA 3HP9A 2V67A 2OA8A 2A6MA 3V4IA 2FVCA 5I3PA 3OHRA 2FBVA 4PG7A 2ZD1B 3ID8A 4GNIA 4IG3A 4B3SK 1JLGA 2QA4S 1SKSA 2GX9A 2K8GA 3DM2B 1S1UB 5CA5A 1KOHA 1D4XA 3MM6B 1F5CA 2GQ2A 3ZTPA 3RRKA 1X3MA 1Y3KA 4LF5K 3R1HA 4HUFA 4I6YA 1Z05A 4PG5A 3O80A 3HJFA 3LP3A 1LFPA 3CC2S 1VLYA 1HD1A 1WC6A 1R6VA 2HS0A 2N7YA 3TA2A 2FZKB 3NVKA 3SQOP 2CQ0A 2GZOA 5D15A 4HI2A 1H72C 3L7UA 4QW8A 4V19J 2HAIA 2CKWA 1NG9A 3UKUB 5IQQA 3OTDA 1JJ2R 2GELA 2V4RA 2OPRB 3MX2A 5KQ8A 2E5HA 4QWEA 1TV6B 3S3OA 2A3JA 4UOCA 5BPNA 1YUWA 2YTCA 3VHQA 4R8UA 1Z2ZA 3KLIA 2YKAA 3IR7B 3THXA 3PX4A 1MN7A 1OY8A 1YI2S 5LMNF 1NGBA 2FC0A 1AROP 1GXLA 3RB0A 1S0MA 3M7VA 2YNGA 3W5ZA 2ZKTA 1Y64A 1DY3A 2GQQA 2CQ3A 5BPLA 3C16B 1XEZA 4JI2F 4A8XA 4DPYA 2AGPA 3JS6A 1SXLA 4PKDB 2DGWA 3P8BB 1OVQA 1HW8A 4K8ZA 4FWNA 3CJSA 2W01A 2J9DA 4E1MA 4LF5J 4CRJA 3M32B 3HTVA 3LP1A 2D3OR 2P9EA 4X65K 4TYAA 1RILA 4K4SA 5KT7A 1ZYQA 1DTTB 1TUYA 3KLHA 2HMPA 5LJWA 1S57A 4G65A 1I94K 5E0OA 1GNKA 2DIUA 3G96A 2V6AA 1WNEA 3CO0P 4DSKA 4O3RA 1RTJA 1YJWS 4CK1A 3DDKA 3CXCM 2AHOB 1WG1A 5KOXA 1YX2A 4BDPA 5EUHA 2PSZA 2FBTA 1SL1A 4DL4A 5LY3A 2FPHX 3CD6S 3JSYA 3UCGA 4DWIA 2NRHA 4CO0A 5LMUK 3C2PA 5LMUJ 1KQKA 3IMQJ 4F4WA 1CZAN 2PY5A 4JKHA 2BMBA 2QJ3A 4KV8B 5CYQA 2DH8A 2LEBA 2W41A 2QFIA 1T11A 2F7TA 3AO1A 2FJWA 1HQ2A 3C14A 3RB3A 5B0CA 3T1HJ 4EHTA 4WTYA 4OYIA 1WOOA 1UVKA 1RT6B 2OUGA 3R5CA 3PRDA 3Q24A 3CJQA 2NRXA 5HBMB 2HS3A 3PJ9A 2W7PA 4JLHA 1NGEA 3GYNA 4YOVA 1IM6A 4ANEA 5BXIA 3SCIE 2R2TA 1NDKA 1IBLK 1C0TB 2MHEA 1UAWA 1VSHA 2O8FB 2OH2A 2LVWA 3W3SA 3AO4A 4X4VA 3TANA 3JYTA 5KFAA 1Y10A 3CM5A 1CS4A 1QUVA 1IN0A 3HDSA 2G2YA 3ITHB 1IKVA 4C98A 3EY1A 4MT1A 1KSPA 1R8HA 1WI6A 2I7PA 2ZBRA 4IRKA 1HNZK 2RDJA 2HBMA 2DH7A 1OWXA 4WQ5C 3FGVA 2HBQB 3DDIA 4EFAC 4IOAL 1N6QB 2ZWHA 1VQ4S 2E1ZA 4LR7A 2AMCB 1V3SA 2E5LJ 3D2EA 1UMJA 2J7WA 5I3UB 1F2GA 3PKYA 3D6RA 1U7LA 5BYQA 1GOBA 4J9OA 2RS8A 2O8CA 3VEXA 2HGLA 1V6HA 5GAEU 3WUHA 4URQU 1T7PA 4JBCA 2OGUA 2Z2ZA 3NAIA 4M3TA 2R2SA 4DV3K 2MGZA 2MYFA 3K8WA 4QWDA 4DV2F 1A6LA 2ZDPA 1OH5A 1YK9A 3CJBA 5D4NA 4FM2A 2QMXA 4TN2A 3OL8A 2W4DA 5DGBA 2Y3YA 3OQ2A 5L9NA 2BEFA 2BJ8A 2XS5A 3HPHA 2BW2A 2P9PA 5M1FA 3N6LA 4URSA 2R3VA 1DFDA 2FC8A 2P6SA 2W1BA 3PO5A 2XYGB 4BR7A 3CCRS 2AD9A 3DXMB 1WTBA 2VASA 3FFKB 4ED5A 3Q0AA 3V6KA 4KHPJ 4H8KA 5DETA 4H0YB 2V4QA 2AX1A 3KKRA 3I0SA 1KBRA 1U4BA 2CQDA 3JYTB 2CJAA 1WWHA 1QE1A 3Q8QB 1N34K 1SUQA 2HVHA 2PA3A 5C42A 3THYB 5GADU 3V81A 4NEYA 2I8EA 3C6UA 4CLPA 5M1OA 4KH1B 4BC7A 2LEAA 2DNYA 3ULDA 3RMDA 1QTMA 2KG1A 3DLEA 3E9LA 1XC3A 3KNGA 3W62A 3AVCA 2P5VA 4DPUA 1S49A 4NX9A 4FJ8A 2MHNA 1PAUB 1L3KA 2KN4A 3CQXA 4RW8B 1KQSM 2HQDA 1RAFB 3O8MA 1NOZA 2AJ4A 2VG7A 2NXJA 2O8DA 2FVQA 1TKXB 2ROPA 2QTDA 4OPHA 1Q82O 4H0TB 4LFAF 4RNNA 1I6JA 1FD2A 1L3TA 1SV5B 5A8WB 5LJ5Y 3TUPA 3AVAA 1RTJB 3T3FA 5HP1B 4NI2B 4B9UA 4Z4HA 3OTBA 4OZ0A 4YNQA 1QJHA 3RU0A 4CEEA 4Q0BA 1Q8KA 4FK2A 3W2VB 1KOOA 1X5OA 2R8IA 2IM1A 4J9KA 1U1RA 3LP1B 3BYRA 2ZH9A 1N8RO 4FXWA 5J2PA 4ZPTR 4HLBA 3OR2A 1HQUA 1CC8A 2LQBA 3DRXA 2WW4A 1H98A 2LXFA 2GAHC 3QO9B 4LC9B 2C28A 3TZZA 1ATRA 1RWUA 4BRHA 3ZSOA 5CAAA 4ECRA 3G86A 4CLWA 1UAXA 2O8EB 2P1JA 5FLXU 5KFRA 4RJVA 3WQUA 2MQMA 3UWTA 3O8WA 4HH0A 3IDHA 3J81O 3VQ9A 3MCPA 1TV6A 1P6TA 2B4OA 4EIAA 3MCMA 1RT3A 3P49B 4WKRA 3V9WA 3R3LA 2JDJA 4U7UK 1EQMA 2DHHA 4D3GA 2WTUA 2QXLA 4PL8A 4DOZA 3CCMS 4KGXB 2C3OA 3NNAA 3K8VA 2Z0GA 2ZZNA 4A2AA 3EO3A 3VETA 1FXLA 1CXQA 3AY0A 4M5DA 3O9RA 4ECTA 2DGVA 2UVVA 4FVCA 5F3TA 4CVNE 3VN5A 1KQSR 2IRYA 3VQEA 2V8PA 2WONA 2PDAA 5AXMA 3I96A 3KK1B 4B08A 2PZSA 2OHDA 1T9UA 3G87A 3PYEA 3KK2B 1NH7A 5M1PA 4K8RA 4QR0A 2HWIA 2AJ2A 3SXLA 2MJNA 2V8DA 1RISA 4WK3A 4J9LA 1HYSB 4Q5VA 3A8IA 1RBOB 1OY6A 1UFWA 4BRLA 4ZVRB 2DJWA 2O8EA 4YMEA 2ZC3A 2GCFA 2YBVA 1MNEA 3GR0A 1ASWA 1BI4B 3DU5A 4FZXC 5KPZA 2ILZA 2R7QA 3BKFA 2DPNA 2K06A 3PRBA 1RDWX 1L3SA 3ZSQA 3Q22A 4QPTA 4OYPA 4FM0A 1NKBA 2P9UB 2CPFA 4AQYJ 4CLUA 2XMAA 2C3YA 3OR2B 2MLYA 3B4MA 2RB7A 3SMPA 3BKUA 4O4GB 1ZZNA 4O3QA 1FTRA 4JI6J 4F50A 4EZ6A 3SQ0A 3QERA 2CQBA 4YHHJ 5B0DA 1E6VB 2XY5A 1RYRA 1WDDA 3OYNA 2QI2A 3JSBA 4J9QA 1WC3A 1YG0A 3G6EN 1R89A 5CD4A 1UW9A 2A2CA 2OLWA 1JLAB 2XSJB 3GYXB 2A10A 1S48A 1RT1B 2CPHA 2GO8A 4IOCL 4BRCA 4Q43A 4B1YB 3F73A 4AHCA 3WHIA 3D2FB 4DQ8A 3MUMP 2DGQA 1TKXA 4JYAK 2Q79A 2IPOB 4EYIB 2UXCF 1OS5A 4DR7J 1MA9B 3N79A 4RNMA 2W40A 4CM0A 3RB6A 3QESA 3GG1A 3HLUA 3OSNA 3PO4A 3HFZB 3MAAA 3QJPA 5E33A 4F8RA 4HWIA 2MSTA 1MLAA 4FKYA 3U7JA 2MKKA 2Y1IA 3CULA 3U4LA 4WCEL 1J27A 2JSXA 3QBXA 2LDIA 1XNQK 4Q8EA 2V52B 4K2XA 3D1OA 1RT1A 1HNWJ 2HFZA 3M2RB 5KFEA 3O1WA 4HHTA 3D0PA 3PEJA 1FDBA 2QSWA 2V94A 4UF4A 2W2OP 1M1KO 2HHXA 3DRPB 1NRKA 4F3TA 1F9FA 1FERA 5D78A 3ZC4A 5EU7A 4DV4F 2YNIB 1WC4A 3I31A 1N5YB 3HHEA 1N56A 4ZVPB 1HHTP 5K8OA 5D6GA 4BRAA 2JC0A 2GGPA 3A3PB 4O4GA 1NDPA 4R79A 1N36J 1FNOA 3VZHA 2XO6A 1BWEA 3W1YC 1RHJB 4O5BA 3TAQA 3HYFA 4YFUA 4ZVQB 3SMSA 2ATLA 5MAOA 1DGKN 3ZSZA 4OPKA 3HHLA 4MDAA 3N28A 3D2WA 4S0MA 5F1XA 2IY5B 2X3GA 1W26A 2OCEA 2EVZA 4CNYA 4RW7A 1X9WA 2MGZB 4OJHA 2EFPA 5E3QA 4F4AA 2MY8A 3P5BP 1OPZA 4F3QA 4TYBA 2R2RA 1O13A 3HFKA 3D45A 4B02A 3DYAB 1U1KA 4WFNQ 3C65A 1HYVA 5BRFA 2YWEA 4X4OA 3VEWA 3G4SN 4PQAA 2J7UA 3FMWA 4O3PA 4CE9A 3KK1A 3FBEA 1FHTA 1JB0C 2W25A 4ZDNA 4FJLA 2O3DA 2PD1A 2Z1IA 1S97A 3HJVA 3BH6B 2WVBA 4DV6K 2UXCK 2NQPA 4LRDA 4FVUA 2R8KA 3OBWA 4RPFA 3B54A 3C0BA 2Z2LA 1BCMA 4ETZA 2C42A 2A42A 3HHDA 2P2CB 1CJTB 2AYMA 2ZE2A 1V4SA 5AQYA 1S1TB 3FC9A 1WB9A 1FXDA 5C24B 3DJCA 3MECA 1HR0F 2D0AA 3UO0A 5GINA 3HKWA 2M0GB 5D4PA 3GV8B 3I87A 2XHWA 1IWAA 2HHHJ 2NRTA 2VC1A 3K9JA 1TP7A 3T1YF 2ZWOA 4X4NA 3D3CJ 4AH9A 2JL9A 5LSOA 4ECUA 5FIIA 5D0EA 3J8AA 4X66J 3AVIA 1U6BA 3VWSA 4KHMA 5ITHA 3TU5A 3RWUA 3I4PA 4LFAK 2IVOA 2DPIA 4Y2AA 5CYQB 5ADXH 3W63A 4CI0B 2OIHA 5DO2A 2KU7A 1FWPA 4ISFA 4X62K 2J6TA 4HTUA 1X31C 1JCGA 4M3UA 3OYFA 5L8RC 3EL2A 3TVZA 3O9TA 2EWSA 2OEJA 3FEYB 4J9UE 2Q3SA 3OW2M 5A0YB 3GFZA 2ZOGA 3LZIA 4JNEA 1FDDA 4XO0A 1HLUA 4WWSA 2Y1RI 4CEFA 2ASPA 2R4FA 4DX5A 3G71S 3C94A 1K8KB 1NMEB 5CHCB 5KFIA 4RUHA 4Y2IA 4Q44A 3J7YI 2CVEA 4FXDA 4FJMA 1EX8A 3KLHB 3GG0A 1DTTA 1RT7B 1F1BB 3IMXA 4DUTA 2M88A 4PEOA 3OYAA 3BY5A 1XBWA 2FSKA 4BWMA 3MMJA 2IOCA 2V63A 1R6YA 2VWJA 5A6WA 2IYIA 2MMYA 3NWRA 1IBKF 2ZBPA 4CT8A 2D74B 3D7EO 3BGFA 4RWWA 3SPZA 3CDUA 3MDQA 3I8DA 1RU2A 2GC8A 1VJQA 3K5LA 4LF8J 4CF0A 1Q0NA 1S72S 2JHEA 3OW2R 4EAHD 4M5JA 2PYLA 2BM0A 2Q66A 3SI6A 5LXRA 1HYZA 4B8CA 1LW0A 3KLEA 5F0XA 3MM8A 3MM7A 1WF0A 4IFVA 3M2UB 1H0HB 4I2QA 4H0VB 1VQOS 5D3GA 4L73A 4CZJA 4X65F 4JKDA 3AO5A 4XDDA 3T5JA 4U95A 3I0SB 3GSIA 1KKHA 4WFXA 5IT9U 2AKWB 3LANA 2F9JA 4RBUA 3M8QB 2C2MB 3J80U 4BRGA 1Z1ZA 2QX0A 1RAAB 1AUSL 2BTFA 4DU1A 2D0BA 3D0IE 2RU9A 5AQXA 2E5JA 1TQLA 5BR9A 5KAKA 2UXDK 3FLCO 3HPGA 1NHUA 4GVLA 2IVYA 3MF5A 2RF2A 3UVJB 4CEBA 4P7VA 3N0VA 3MM7B 2H4YB 3SBGA 3N4QA 4QQBA 3J7A1 1RBLA 1FKOA 2VB6A 1HHSA 3LOUA 4RU2A 1RAIB 1Q16B 1NKEA 1RAEB 1Q4RA 3GZ7A 1I3AA 3IR5B 3CJ9A 1U02A 3G10A 1JWWA 3HO1A 1S0NA 5G4DA 2BUPA 1VBKA 3ZTRA 4CIOA 4JKGB 4ECVA 1YKWA 1RNHA 2HRTA 4IG0B 2NS1B 2B9WA 1O1WA 4FJ5A 2GIQA 3WDOA 2XMMA 1UPPA 1Q79A 2J9CA 2OD6A 3R9LA 1RSCA 3H5UA 4KKOB 4G3IA 3JQMA 4LSNA 3NGRA 4C8LA 1C2PA 3O6WA 5I3QA 1TYQB 4DX7A 1I3OB 1X7VA 1TU0B 3OR1A 4KY3A 1BISA 2I9SA 4K41A 5HOOA 2C22A 4HH1A 3TZYA 1ZH5A 3QFHA 2KRRA 1C1BB 3G8SA 3V5RA 3IR6B 2KVQE 3E51A 1P27B 2VJVA 4CJKA 4M95A 1YVFA 1LWCA 1T0TV 4JV2A 3S41A 1NNDA 3OL6A 4OJRA 4DFKA 3BSCA 1LAWA 3CEDA 5TKWA 4F0HA 1YTYA 2QL7B 4JRQA 1J53A 1ZAVA 3M1VB 4AM6A 1S5ZA 4MK8A 1TL7A 5CD4H 3TARA 2LSNA 4MQ3A 4YR2A 2HHHF 5ETRA 4LQ3A 3QNOA 2BUNA 4DZDA 1OO0B 3MAAB 2HPUA 1YGYA 3HSJA 3TYTA 2KFYA 2VFSA 1Z25A 4ZVGA 5F41A 4CBXA 3HF5A 3S3NA 3CCSS 1M5KC 2OP5A 4QOZB 4HEA9 5A2QU 4LMZA 4NRTA 3UW1A 2GJIA 1ZOTA 4FBTA 2G2OA 4CO1A 5AQZA 4KI4A 1U47A 3QLHB 4FWQA 3G0ZA 3BO3A 3IBCB 4CIEA 1Q78A 3KWMA 3B8HA 1E6VA 2HBJA 5KGWA 3A8JA 5CE3A 1I51B 1EWRA 3H3NO 2A3ZA 1UJ5A 2Z1HA 2HK2A 1FRIA 3QIOA 3E66A 1XR7A 2M70A 3MMAA 4RNOA 4X64K 3EDQB 3LAMA 3OS1A 2W24A 5F9NA 2IRUA 3RAQA 3RJMB 4JYAJ 4FJGA 3DLLL 4OPJA 5D0GA 4QYRA 3SPYA 3C16A 1VQ4N 3THWB 3RBZA 4W92B 2YNGB 3THWA 2KL8A 1YTUA 3L4BC 1TL3B 5DRKA 3THXB 1YJ9N 2ZWPA 3D0GE 2GW8A 1I5OB 3HVAA 1ZBLA 2OMOA 3M1FA 2JC1A 2DNLA 4CK2A 1UOCA 2DHGA 1RKJA 1B3TA 4NYOA 1Q1KA 1C1CB 1LAVA 1DKGD 4ZIWA 2MLXA 4K59A 3EGZA 4DEZA 3B82A 1VQ8S 4QIGA 4B3RJ 2VQFK 3DRPA 1LQ9A 1NGHA 3V9XA 4MYTA 4B9SA 1VBYA 4ZN1A 2KM8B 1MMLA 3OYLA 2D0OA 5JUMA 4H0OA 2FVSA 4BRIA 1UFLA 2BV3A 1Q81O 2JFKA 3FBFA 5IC4B 4LR8A 4Z0UA 3CCLS 4ENOA 2ZD1A 3NWGA 4DV0J 3CFOA 4DV4J 1VQPN 5DGAA 1EQ0A 4DV5J 1NGAA 4CI6A 4F2SA 4ECQA 4H5VA 4B3OB 2GWJA 1KVAA 2GVDA 5KRTA 3R1LA 2WBRA 2N3OA 1ZC6A 4GC7A 1VS3A 4B9QA 1AYEA 1SVDA 2FJBB 1SQKA 4IJAA 2HZVA 4FJ7A 2ZQBA 1YXQA 2L48A 2QN6B 3PKMA 4Q7AA 3FE1A 2PGCA 3R2CJ 1NK5A 3IBWA 5J2PB 3OHAA 5AXLA 3VA0A 4X62J 1SQEA 4YOTA 3AOBA 1NGDA 3TJ9A 4KPYA 2F4FA 4M63A 1TTHB 4U6PA 2DEIA 3CCLN 4LFBK 1C1BA 3GJQB 1EB0A 1ESVA 2ZC4A 4CGJA 4H4OA 3L2WA 1VQ6S 3TAGA 3T5LA 3AQOA 5HP1A 4NI2A 1SCJB 1FDNA 3VAHA 2RAQA 5H9EK 3AAWB 3AARA 2FLNA 1VK8A 4UY85 4ZHRB 1RAOA 1EX4A 2VQFF 2RHQB 1U1OA 1CPZA 1REVA 1R8PA 1UJ6A 4NL5A 3TO8A 2VKRA 5C2FA 3CF5Q 1UVIA 2NRZA 1VQON 2LU2A 3PR5B 5CZ2A 3VR1A 4P6QA 3V9ZA 1U8WA 2F8EX 4BDZA 2YX7A 3MFHA 4CO2A 4YP3A 4BRPA 2QA4G 4JI8K 2CZ9A 2DR6A 4KHPK 3HM8A 3SK3A 3OVSA 2VPWB 1GX5A 1WHVA 3AT1B 2ILYA 3K5NA 2VQEF 3PRVA 5A8KB 3KLFA 3R5AA 3NAHA 3THYA 5I4MA 4ES1A 4NCGA 3LDQA 4B1WB 2VFVA 2KT5A 1VQ8N 3MD1A 5C25A 2QC3A 4LBIA 1FWLA 2B4JA 3I82A 2HYIB 2GVZA 2G8WA 5GIOA 1X9SA 4NLPA 2VDIA 1EXQA 2QA2A 3GR1A 4RBVA 3MM9B 2HSEB 1APSA 2IVPA 4EHUA 2RVJA 2ZJQQ 2ZM6J 1HLWA 4HTIA 3W66A 2RUGA 2AYBA 3MURP 2HG4A 1LWFB 4JI0K 4IKAA 1R31A 5HJYA 5F8HA 2C1EB 2VBXA 3RBEA 2FSJA 1YJ9S 1IM4A 1XC9A 3UQSA 2AW0A 4OV6A 3OFFA 1S72N 3H4DA 3KUEA 4GV6A 1EETA 4D3HA 1CJUB 2FC9A 4OYXA 3J7Z5 4ZCIA 4IFEA 4QJVA 4GO7X 1JKHA 4IOBA 2E2QA 2Y8WA 3UN2A 2DFFA 2OJ3A 1HKBA 1KAYA 2ZJRQ 1VSDA 1IKYA 4W5NA 5B09A 3P38A 1IBMJ 1DQAA 1S1WB 4YY3K 3MMCB 3SAHA 2D3UA 3PYDA 3ZXWA 2FY8A 3C8YA 1SBRA 1RT7A 1VYAA 1FJCA 2DY9A 5AXNA 5HL7L 3BF1A 3EEQA 4UQGA 3S3MA 4NLGA 2QM1A 2QYGA 1NJYA 4TY8B 3CJ2A 4M5HA 4AHRA 5DJBA 1XERA 3ITHA 3CJCA 4CEDA 1RA6A 4J9NA 1S3XA 2DBBA 3IN5A 2LXUA 1RCOB 4EEYA 3DKDA 2V68A 3NOGA 1FF2A 4RR5A 4BR9A 3EE9A 4Q45A 1K9MT 3BQ1A 4EBEA 3CW2C 2HQGA 4JKAA 3KJQB 2ZBCA 2FDNA 5DM7Q 1QDUB 3MMBB 5B7WA 2J76E 3MCNA 2WAQD 1KVJA 1FK9A 3OYKA 3ALYA 1W2BM 3DLEB 4URGA 1WSIA 1PC5A 5IXUA 2DT9A 3HZGA 3IUCA 4AILC 4B1VA 1OSDA 3T1HF 2ZHOA 1BXNA 4UUWA 1B0TA 1BWVA 3DHXA 3DGVA 3QZ8A 3K2PA 4JI6K 3AY9A 2HAFA 1KHVA 3L9ZA 4GKJK 3Q2TC 3WC0A 3BF3A 4CYUA 3DAWA 2J6SA 3KK3B 3ENVA 2VHGA 2LKZA 2J8SA 1C4AA 2E9TA 3R5GA 4MO5A 1IKXA 4JN4A 3PSFA 3H5YA 5J1PA 2WCXA 2PFFB 5M2RA 4FYVB 3H25A 1V3RA 1YTAA 4JI6F 1AFJA 2Q1LA 1MMDA 4BLGA 1VOMA 2LDYA 4BC2A 4PCQA 2WOMB 2QWRA 4C8OA 4B1ZA 4DR6J 1FE4A 3C46A 3QNNA 4NXNK 3ATUA 2HBKA 3HRGA 1YAGA 4KKOA 2OZSA 4JV1A 2YWGA 4LF4J 1PKUA 5CHIA 1A5WA 3IS9B 2APOA 2GJ2A 4FO0A 2CQHA 3AO3A 3G4SS 3DXKB 3BREA 3FBCA 1CZBA 3VF0B 4LF7K 1QZ6A 3IXQA 2W2MP 4CO3A 3VQPA 3UDEA 4P7TA 4NXNF 4ISEA 1VQMN 1Q5VA 2E9RX 3JAMY 3CT9A 1HR0J 3TZXA 2YNFB 3I33A 3GV7B 2FLOA 1T9YA 4M5IA 1SQGA 1WF2A 3X3UA 2KW4A 1RHUB 3R6MA 1QQMA 3SCXA 2HVEA 4F02A 2Q97A 2B4UA 1F60B 2EK6A 1URRA 4C1NK 5IOLA 1T03B 3TI0A 3B6BA 3T1AA 1N6QA 3QYYA 2YH1A 1HBMB 1T94A 2XMWA 1B0VA 3CO9A 2WBMA 2H3EB 4MYUA 5GAGU 2KKHA 3GCWP 1FCAA 1UVJA 3M30B 2YVSA 1J54A 5HRNA 4LH4A 5AJ3J 1X5SA 2GVZB 5KFUA 2R7UA 3DLKB 3AJ2A 3PLAA 5HO4A 1X5PA 3VAKA 1BA0A 2J7KA 2KB2A 1OH8A 4I0WA 3DI6B 2FY1A 4FCYA 3CETA 5GAGI 3LWMA 3R1XA 2YWWA 2QA1A 2HVDA 4F3OA 3O4WA 1UZHA 4CJWA 2MKIA 4NYZA 3EM1A 1B99A 2DYAA 3OPKA 4Y00A 4DR4K 4USWA 3AODA 5E2QA 1U1LA 5AE1A 4L8RB 2IJRA 3T5KA 4QIFA 1SL0A 3KZBA 3CJKB 3FNNA 1WHWA 3MWPA 3LL3A 5JVGL 4MKYA 3RAMA 3IRXB 2RPIA 1H2TZ 3CPWM 1RTIB 2DTUA 3D2FA 1CULB 1X4GA 4KTQA 2NPFA 1HNZJ 5T7BA 4DFMA 5H9FK 5IV3A 4LH5A 4CZHA 1S9GA 4ED2A 1JLAA 2XSJA 2XLKA 2IDEA 2P9KB 4B1UB 2YCHA 2Z1JA 3CHWA 4X4RA 4CGFA 2FJXA 2OPQB 2V4JB 4WTOB 4DR4J 3CD5A 2C3PA 1AFIA 5AZJA 3J7ZT 3U1MA 1JNRB 5ETLA 4KH0B 3K59A 1KVKA 1IXKA 1VRUB 1T3OA 3ENOA 2J0WA 4B3SF 4DR7F 3Q8YA 5RUBA 4B3MK 5DG7A 3DLJA 4OX9F 4PG8A 1IUJA 1B7YB 2NXNA 4Y1CA 1C0UB 3KJNB 2DNKA 3A2FA 1LXNA 1B0PA 1JCFA 1RLCL 4ID5A 3PM9A 3O5BA 2U2FA 4MJKA 1KCFA 2YHXA 3NBPB 3R8YA 1KP6A 3RMCA 2JGUA 2IDOA 4LY7A 3FZBA 4KAIA 3OLBA 2Z30B 1OQ3A 1U09A 3TABA 4HACA 1S1VB 3G82A 4U9RA 4X2BA 4MLEA 3SMZA 4RNFA 1LW2B 1DJ0A 3OYJA 2B6AB 4K4ZA 2PYJA 1YBUA 4X64J 3QT6A 2OPRA 4DV0F 2CUYA 3NCQA 3V2UC 4ZCLA 2HF3A 2B9EA 4OI1A 2IC3A 1I39A 3NNHA 3CI5A 3T69A 2IVNA 7AT1B 3A8EA 1Q8BA 2PT0A 1JLFB 3M05A 4C8NA 3VALA 1O51A 4IBNA 2MKJA 5HQLA 3KHHA 1D8ZA 3EVWA 1WD6A 2HHVA 4HL9A 4LF8F 3UD4P 4CFAA 1NJWA 2QA4N 1S1UA 3DM2A 3QRRA 5HN0A 3DYAA 4WFYA 4BRKA 3GIKA 3I5AA 3BM7A 4OX6A 2GNKA 1RBUA 2HNZB 4OZLA 5KFXA 3ICLA 3H5SA 3DWLA 3B6PA 2UU9K 1ZAWA 6AT1B 1Z26A 5FDLB 1N5QA 5GAGP 2D69A 2Y8YA 4CP5A 4F0MA 1VC6A 4HKQA 2NRRA 2V8VA 4M8LA 2Q31A 4YQWA 1LW2A 3D6MB 4FBUA 2F4VK 3L95X 4J5OA 1WJ9A 2V34A 3RBDA 3BPSP 2KT3A 2EW9A 3H3OB 3VQTA 3AB2B 3CJ4A 1SJ3P 3J7AN 4IKFA 2DXFA 2O5DA 2X1AA 4HVJA 3F5TA 3CD6N 4PQUB 2PE8A 2NRWA 2Y9HA 4FLUA 2O8BA 4Q8FA 1X4HA 3D1HA 3W9IA 1BMQB 5JICA 2ZOMA 4B3SJ 1U04A 3BEGB 3NGIA 3NH0A 1WKKA 1WLJA 3CXCR 1XMOJ 1N36F 5CYMB 2R2UA 2CWXA 5AZJB 2QEXS 1D9DA 4NRUA 1RWOB 3NVMA 4M3WA 2Y0BB 3DNCA 4O44A 1VAZA 3WXJA 4FNIA 1XNRF 1WHYA 1AA1B 1Y00A 2EKYA 2F8TA 4FL9A 1FEEA 1Q7LB 3A3NB 3BKTA 2VJUA 3VEVA 1VK3A 2RE2A 4IQXA 3L4IA 2YKQA 1XNQF 3W2WB 1K0VA 4PRFA 5DG9A 1UPMB 1HNVB 3BO4A 2MQOA 1RYSA 2Q2RA 3P31A 4OX7A 4DCJB 4PABA 2ZM6K 1REGX 4EO6A 1GQEA 2XO7A 3AXKA 2A1BA 1DRZA 1QE1B 1DQ9A 1XJWB 2AEMA 2OI2A 3ZEUA 1N33J 2YV0X 3I55N 1EKSA 3C7NA 4KR0B 3HK2A 3CG7A 4YOUA 3F0NA 1NK9A 4WXOA 3BEXA 1IBLF 1QQCA 2FF6A 4CFBA 2RRAA 3SQGA 2R8GA 4QU6A 4LSLA 2HSTA 2X3DA 1ZAXA 3MEDB 4L74A 1ROFA 1Y5LB 2UUBJ 3QDKA 1ICEB 3SZ2A 4LF6F 1BI4A 1RACB 2QIFA 5EVZA 3I56N 2RD5C 2Z58B 1NGJA 5HLFA 3KJVB 3VAMA 1KQFB 5BPMA 4J7CA 2BOAA 4JP8A 2UVRA 2O8CB 1EO1A 4I6MB 3N6MA 3O6QA 4JK8A 3I8BA 4DTOA 4NYPA 1T9XA 4KB1A 3QIDA 5CXTA 1WSRA 2OD4A 3NOCA 4CGIA 3J7ZO 2PI5A 5IQ6A 4AL5A 1RHKB 2IMOA 4CJQA 2ADCA 4KHSA 1VSIA 3N5BA 4RCHA 2LECA 4QWAA 4I7FB 4N8NA 5IM0B 1Q8LA 3SCJE 3V6HA 5HK4A 3I9ZA 2Z1GA 1B9DA 2MZ1A 1MWMA 4J9RA 5DDRC 2XQCA 4DR6K 1U25A 2GQCA 3IS9A 2NREA 3CTRA 1KHWA 2GMHA 3VGKA 3A13A 4LSLB 3MI7X 1H38A 2A1SA 4ED8A 1HD0A 1YJNS 2CJKA 4M63C 4LF4K 1DLOA 1FD8A 4B9TA 4PPDA 1FFGB 3NF8A 2GV1A 4C3MA 3DXSX 2GTDA 1CLQA 3KOAA 9ATCB 4ES2A 3L3UA 3R7BB 4BE2A 3I55S 2HGNA 3OVAA 3IFEA 4WP9A 3VAGA 3AGKA 3QEXA 5K8PA 1DARA 3CCTA 1S12A 3PVXA 3BO2A 2RS2A 2IFXA 3DU6A 2C2OB 4LUBA 5B0GA 4F7VA 3OJUA 1VHXA 3ETOA 4HDHA 4N56A 4CEQA 1JLEB 2VODA 4BDYA 3SUPA 2KDOA 3CJ3A 5AQKA 4Z4FA 1IJJA 2HZAA 3CJ0A 1HQUB 2AWZA 1M5SA 2DNZA 4KB0A 1HNVA 3UR0A 4P10A 4IYQA 1GAOA 3I5BA 3KG4A 3MDFA 3ZZRA 4ERDA 2WVCA 1IBKJ 4BR0A 1WN7A 5KFLA 1I1GA 1ZS6A 4O3SA 3ZETA 2CNNB 1P90A 2P9CA 3IM9A 3AO2A 2GEMA 2I0XA 2Y0SD 4WPAA 4O44B 5LJVA 1U45A 4YOXA 4CJFA 1VCTA 1VQ5S 4QZVB 5KFKA 4DU7A 3U8XA 4QYZJ 1B7FA 4I68A 5LOQA 3BS9A 2A18A 3W0LA 2FHOB 4BHQA 4QPXA 2ZDOA 1BUPA 1J9AA 3OT9A 4LFCF 4G6VB 2JOQA 2W2PP 1F9EB 4IDKB 3NCRA 4RW8A 3R27A 4KE5A 1O0PA 1M90T 3GSDA 4DPTA 3IAYA 3A0IX 4E7IA 1N88A 1S1WA 3O3GA 3OFEA 5KFVA 4AL6A 2IHR1 3E3XA 3DFEA 4J2EA 2OTLS 5E5NA 2L9WA 4LF6K 3I6PA 4DPWA 4M3RA 4JI1F 4LRFA 3TEGA 4LIWA 4JI1K 5H9EJ 3A8KA 5KT5A 4J9MA 3SQ2A 1A5XA 2BBEA 4WE1B 4JKBA 1RTZA 1YVUA 2EBGA 4WYBA 1N34F 4NZ7A 3R97A 3RYLA 1VHIA 4JI7J 2VKZG 4QR2A 3MN6A 3AVNA 3CCQS 2BZ2A 2ZOFA 1H74A 3QSYB 2E1CA 1NDCA 3OS2A 4ECYA 4OYZA 1SJFA 2QWMA 4B8AB 1RWKB 5L38A 4CJUA 2CGLA 2BRKA 3UCZP 2N4DA 4GVMA 3R5JB 5AQFA 3CCMN 4FOEA 4FZZA 2VD3A 4GKKK 3ZT2A 5KFPA 3ZX0A 1FVSA 2VU5A 2CJQA 4ED6A 3T9NA 5IS2A 4NCGB 3QIPB 3FFIB 1RT2A 2GS8A 4H0PA 4MTPA 4WP8A 2OELA 5KFZA 3KLFB 1UW4A 4KTWA 3EN9A 3WXLA 1U0HA 4I7FA 2IVFB 4AM7A 4ZLJA 4E7KA 3NRBA 2FJEB 4JI0F 2QLJB 3NS6A 1H7XA 4EP5A 1X60A 2ATCB 3CD0A 1HI0P 4LF5F 3F44A 2OEMA 3A5LC 2D0PA 1F9HA 4LFAJ 2B6AA 3BN4A 4BRQA 1QVFR 1B70B 1CLFA 2Y1JA 4JI7K 3BR9A 3QATA 5HL7Q 4N8OA 1ZXOA 3RR7A 3CC4S 2P9NA 5J1EA 2IDLA 2OTLN 3H08A 3MEDA 3BBCA 3HVWA 4L3KA 4PKGA 2DNRA 2BE9B 3ZZTA 4L72B 3NH1A 1C6VA 1UWAA 2UVUA 4CF8A 1LNQA 3UNGC 2OANA 2HOEA 3BZQA 3I5CA 3Q2SC 2NXEA 4WFAQ 5EOYA 4QAGA 2V9KA 3UNYA 3M5RA 2LQ9A 2KQ2A 2FSNA 4I4BA 1XNRK 1G7CB 3EKSA 3ETMA 3QPIA 2W9BB 2P9LA 8RUCA 3DLGB 1VQ9S 5LL6d 4Z4EA 1PAEX 3L3CA 1WSEA 3PYGA 1H3DA 4CLFA 4Z37A 4IFYA 4LR9A 3AQPA 3SFUA 2RILA 3M6WA 1SH0A 3SCLE 4P71A 5FRMA 3H1QA 2FZCB 3VQ6A 4AYBD 4CJVA 1BWFO 2G4BA 4RW6A 2ZEJA 3ZT3A 3KVGA 2WK4A 3IFRA 1RAJA 3AB4B 2QWLA 4G9ZA 3CUNA 2XZTB 1R43A 2UUAJ 3TA0A 3KWGA 3KWIA 3MEGB 4DLGA 3T1YK 1Y3JA 1NHKL 2UVWA 2JH3A 3SIPB 1MDUB 5IZHA 5GVQA 3OLAA 2RHKA 3HHLC 4ILLA 3FQKA 2FGCA 4JK7A 4DV2J 2G0CA 4K8XA 3GDQA 2CQGA 1VQNS 1VQ5N 4EFHA 3TP2A 3L2VA 4A8QA 4G1QB 2MQNA 4OHXA 2WC9A 4CJ5A 3MUTP 2IRXA 4K4TA 2EK1A 2P9LB 3DRYA 2B4VA 3N01A 3LPEA 1HHQA 4K5RA 3P5JA 1RT4B 5KG2A 4DX8H 1SJRA 5F8IA 2XLIA 4DN9A 2XBPA 1YJNN 3OTOF 5EWGA 1N8RT 3VEYA 1GT8A 2FZGB 3KYLA 3FBBA 4BRFA 3AA8A 4OHZA 4GV3A 1CSJA 1SZ2A 1P8ZA 2BW7A 1YI2N 3ELHA 1LOTB 1QY7A 4CBWA 1UA0A 5AQNA 2DPJA 4ZK7M 4DLEA 1WNSA 1X9JA 4DQIA 5KT2A 3QT8A 5DLFA 5GMKa 1TL3A 2G8VA 4WBFA 3I0RB 3R9PA 2F8HA 5FD1A 4WF9Q 2FBYA 4EGLA 3LALA 3TSPA 3HZEA 3H5XA 1FRMA 3CJ1A 4EYHB 1HBUB 2BJ7A 4NEZA 3MXIA 2V7ZA 4K0KK 4C11B 1KFDA 2YNFA 3GG4A 5GAHP 4KHNA 3N9UC 3R5BA 3ZCMA 4HT5A 3SUQA 2H48B 5U47A 4FF1A 2W2QP 3BQ2A 2GIFA 4M5MA 3WQPA 2YKNA 2V2ZA 3MM6A 3KUHA 3VGSA 3GIMA 3IWLA 4EO8A 4CZKA 2BXJA 4W5QA 1HQEA 1RWVB 1UEUA 1JLGB 4G1QA 1IQZA 1RJJA 2O4IA 1HR0K 4PA1A 3V4IB 4NZ6A 1ZTTA 3OVBA 2KJVA 2GBZA 3FK4A 5IWAK 2K3IA 2R8JA 7FD1A 5HROB 4HUEA 1RAGB 4OX9J 5E3AA 1GLEG 2QXFA 2E5LF 1U26A 2RDIA 3HX9A 3TW0A 1BQMB 2KTQA 3CIPA 2RT3A 3LGHA 5E3PA 1KONA 1RTDA 4CJRA 2KZMA 1OIAA 5J2QB 2RMLA 3G82B 4K0KJ 5FLXO 1GLAG 1X5TA 2V2VA 5JS2A 3GYGA 2NXCA 3AOCA 4ZVHA 4FJKA 1FE0A 4AL7A 1TL7B 1FK9B 3NBPA 1VJWA 4DF4A 2LCWA 3W2VA 3M1VA 3L2QA 4OJ1A 2DFEA 4IO1A 1S9EB 1NSPA 3WEEB 3TX8A 4X65J 2DXEA 1P8GA 4A4JA 5C5JA 3TAEA 1IQTA 3MAHA 2BJDA 3TUIC 1VQ6N 3IAM9 1IR0A 4CQ1A 1RTHA 5F2RA 3U9ZA 4DI6A 2W8LA 2MZTA 4DR7K 4Z7YA 2E9ZA 4MKAA 1N4LA 5L9XA 4O3NA 2G8HA 2HWHA 3K9KA 1M1GA 3C66A 2DH9A 1T3VA 3EE8A 4NLXA 3VENA 2CPJA 3U3YA 1CJVA 4FWSA 4KQZA 4OLBA 1VLOA 2MKYA 3VF4A 3AV9A 5EWFA 1IBKK 4CH1A 5BN9A 1YRTA 4DV0K 1XTZA 2SXLA 4IQMA 4DTSA 4JHDA 1RU1A 1BD6A 2E4LA 4WFNL 4QIEA 2RN2A 5C42B 2HRUA 3U1NA 1UTAA 4YORA 2FD2A 2K2PA 1LWFA 3H90A 1D9AA 1VDHA 3BGLA 4O55A 5ETKA 2YI1A 1RADB 3HFVA 4DV4K 5A76A 2BH1A 4CJEA 4Z4IA 2EX3A 1UFKA 3D28A 3ULEA 2ATQA 4Y6IA 3QICA 3DLKA 4CCHA 2QT7A 1TL1B 2C2RA 2QWOA 1W97L 4WE1A 2P6TA 4Y0WA 5KFBA 1SH2A 2XRIA 4YB7A 4WFAL 2ZH1A 1RGVA 4XPCA 3TR8A 2VPYB 4AFFA 4CJ3A 3O3HA 1MROA 4B3MF 1G2EA 1WHXA 4ZJQA 3WX8A 1QM9A 3GJSB 2F4VF 3H7HB 2XS7A 3HULA 4NE9C 1PSDA 3CDWA 1ZBSA 4JS4A 1VSEA 1GXUA 1XMQK 3NY0A 5KPTA 2K1RB 2DO0A 1K0TA 4FZYA 1T9VA 3DOMA 2GUIA 3E9PA 3O4NA 1Q7YT 1S22A 3MN7A 1KN6A 1WEYA 1KR4A 3UD5A 3VQAA 3KJFB 5GAHI 3WC2A 4F25A 4DR2K 4BWJA 3G2XA 2GUPA 3BUZB 5AQLA 1NSQA 5KG3A 1J6ZA 2XLJA 1KAXA 4YOEA 3UD3P 3M8WA 4NZ0A 3TAFA 4M5KA 4AHSA 3D66A 3LF0A 2XMJA 3FEZA 4NMLA 4KBOA 4CD1A 3EZUA 2W9CB 1F3FA 3CSKA 1XMOK 4CLTA 1B4SA 3U02A 4UY8T 5A0YA 3MEEB 4TU9A 1TKZA 2YKOA 1UVLA 3AA4A 3C14B 1GMWD 3PW5A 4KV8A 1D09B 3H1VX 1YIJS 2JLFA 2WB1D 3CE8A 3PJXA 1KLNA 1D5AA 3QEWA 2F7VA 1WUAA 4C2MA 4AQYF 3W2WA 2IJFA 3ILOA 4R0EA 2J0QD 4BY9C 3TEHB 1OH6A 2HHHK 4JI5K 2EEYA 1U6FA 2MQPA 5THWA 1M5VC 4CJLA 5AXKA 5CZ1A 5HJXA 3GU0A 3GL1A 5HROA 1BCOA 5IT9O 2BANB 3MMBA 2V2QA 4JV5F 2EI5A