3MEGA

Hiv-1 k103n reverse transcriptase in complex with tmc278
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Etravirine (TMC125) and Rilpivirine (TMC278): Implications for Drug Design.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords p66 Reverse transcriptase
total genus 148
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3megA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3megA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3megA05
2OPPB 5HRSA 4RW6A 4R5PB 1X9WA 3QZ8A 3MEDA 4KAZA 4K4WA 3QYYA 2B4JA 2OYQA 4WZMA 5KG0A 1S1XB 1FKPB 4URQU 3VQ4A 2FVPA 1RDAA 4FS2A 3RB4A 4CEBA 3KLEB 1YVFA 4O44A 3ITHA 5DG7A 3RRGA 3THVA 4MK8A 4RW7B 3DRPB 1TKTB 5KTQA 3RBEA 4CESA 3OYMA 4B08A 5KG3A 2OPQB 3G6XA 3KHGA 1RILA 4EYHB 1T05A 4CFDA 2FBTA 1FKPA 2BRLA 1ZETA 1TK5A 1S9EB 3MECB 2ASLA 4CEOA 1NK9A 4DFKA 1C1CB 4O55A 1U48A 1RT6A 1LWCA 2ZE2A 1YTUA 3OLBA 2C22A 1HPZB 4CJPA 3I5CA 3IG1B 4MFBA 1JL2A 5EDWA 1S4FA 3RAXA 1D0EA 4M42A 1RA6A 3BDPA 4FM0A 4Q5VA 3F73A 1Q9YA 1S1XA 1VRTB 2X6NA 4RW9A 3V9WA 1S10A 3FSIA 4N56A 2FBXA 3DLGB 3M8PA 3WNGA 1HQEB 3LP1B 3AVAA 4LH5A 3DYAA 4HKQA 4CJKA 3DLEA 3RMBA 4RNHA 4H4OA 3D5MA 3NGZA 4E7IA 1NHVA 4Y1DA 2OA8A 3V9UA 4DS4A 4YR2A 1CZBA 4JRPA 1WSFA 3H98A 2X74A 3V6JA 1VSIA 5F8GA 1JXEA 3V6DB 3VQCA 3WNFA 3MFIA 4WE1A 5SWMA 3HVAA 1HARA 4B9VA 4W5NA 4NLDA 1HYSB 2CKWA 2WCXA 3PW2A 4ZTJA 4DSIA 4CE9A 1N4LA 4J9LA 4N47A 3DRSA 5HP1A 3QZ7A 5CZ1A 3V9ZA 3NAEA 4U6PA 2W42A 1L3UA 3HJFA 1QAIA 4ED3A 4DF4A 3CG7A 4YNQA 3C6UB 3C94A 4RW9B 3CYMA 1A5VA 4K4VA 3CJ5A 4ECQA 1EETA 4DTXA 3LPTA 3AVFA 4Y2CA 4CHZA 3TANA 4RW8A 5HBMA 4ZHRA 4FJ8A 1NJZA 4KBIA 4FJIA 3H40A 3IS9A 4IKFA 1KFDA 1SKWA 4B3OB 1WNEA 1JXLA 3RB0A 3K5LA 3FDSA 4E7HA 4M95A 3EZUA 2JEJA 2V4QA 1B9DA 1JLQA 2W7OA 4MK7A 3DDKA 3LWMA 2Q3SA 3ZSOA 4DQSA 4WYLA 3EPIA 3DM2A 1TV6A 1XC9A 3KK3B 2R2TA 4O4RA 4O0IA 4JRQA 4G1QB 2RPIA 3DI6A 1JLEB 1LWCB 1BISA 2X78A 2J6TA 1RTDB 5EWEA 4M3UA 1VSLA 1B92A 1VSFA 1RT1A 3BGRA 1XHZA 4IH7A 3VQ6A 1T8EA 4OPKA 4EBCA 2JEIA 3OYGA 2HNZA 4WE1B 2YNIA 1RDBA 4H4MB 1MU2A 4F4XA 2OPPA 3KJVB 2Z1GA 3NHGA 3OL7A 2G8WA 4H54A 1ZBUA 3LANA 4TYBA 1GOBA 4QOZB 3QGGA 5I3UB 3H4BA 2ALZA 2IM1A 1S0MA 2YHBA 1ZTWA 4M3TA 3RMAA 3TABA 2AX0A 1HYZA 3V9SA 1U4BA 4NRTA 3H08A 4I9LA 3SQ0A 3KHHA 3U3GA 4RG8A 4LSNA 2NUBA 4TLRA 2J6SA 3QIPA 3C6TA 1TKTA 4CK3A 2C2DA 3L2WA 4ECSA 3SUOA 2XI3A 5KFCA 4KFBB 1FXXA 2UUTA 1YVUA 5KRTA 3LALA 3VQPA 3O3FA 4NLPA 3JSMA 1J5OB 3N6LA 4AHTA 4IRDA 1RT5B 3LZIA 4Q43A 4IOBA 3TVKA 3GIIA 3TAQA 4IG0A 4RW6B 4R5PA 1U47A 3QETA 3T5JA 3SUPA 4NLTA 2DY4A 3V9XA 5KFHA 3MXJA 5FDLA 1IKVB 3KLHB 4F4ZA 2R2UA 4GW6A 4C8OA 3DOLB 4IDKB 4FJ7A 4HHTA 4QW8A 1Y97A 2YNHA 2FLLA 4OGCA 3KK3A 3KNAA 3E51A 1RT7B 5KG7A 1HQEA 3LP1A 4BE0A 4F3OA 2HMIB 1SL2A 4JS4A 2FJWA 3QLHB 3VQDA 5KFRA 4H4MA 3LP2B 1OS5A 1RCHA 3BQ0A 3PW5A 1D1UA 4PUOB 3KD5E 1SL0A 4FVMA 1NOZA 4FLVA 4Q0BA 3HPOA 4ELTA 1SKRA 3CJ2A 2B5JA 2WONA 3SPYA 3LWLA 1NNDA 4QWBA 2X6SA 3DLEB 4IRCA 3NH2A 2AGOA 3DI6B 2ILZA 4BDPA 5EU7A 4NYFA 3TWHA 4ELUA 3OVNA 2ASJA 1WSHA 5KFBA 2XY6A 3RWUA 3OYAA 5CZ2A 4ED1A 2HHXA 2VG5B 5J2NB 5KFQA 1XR5A 2AQ4A 3DM2B 3VN5A 5SZTA 3OSPA 4KB1A 3HO1A 4KB7A 2ZE2B 2B43A 4O3RA 4WFXA 4I9QA 4M3XA 5I3UA 3ISNC 1BCOA 3OYIA 2C2EA 4WYWA 3QEIA 1LW2B 4LQ9A 5DLFA 4OKKA 3AO2A 4ZPAA 4FJLA 3TAPA 1MU2B 4DL4A 3IRXB 3RB6A 4L8RB 2IAJB 1J54A 1JIHA 1QAJA 4RU9A 4ZHRB 4ZP8A 4CGHA 3DLGA 1RDCA 3K57A 2W8KA 4W5OA 4IQXA 1RT3B 4NCAA 4DF8A 3KOAA 4MKBA 3ZCMA 3UR0A 3HSTB 4WZQA 3KK2A 3AO5A 4ZPCA 2FVQA 4ECXA 1FK9A 1N5YB 1RAJA 5DK5A 1TKZB 4Z0UA 5KFVA 3OYEA 2HHTA 3GILA 4CERA 1RTHB 1S0NA 2OPSA 4TY8A 1LV5A 1GX6A 2RKIA 3U3YA 4NZ0A 3SPZA 2PYLA 3CFRA 4ZTFA 4B9NA 3KKRA 3QEXA 1VK0A 4CEAA 3CM6A 5KG1A 1IKYA 3GV7B 5L9XA 3ICLA 4CFCA 3DMJA 3CDUA 1QS4A 3OYBA 2D7SA 1DLOA 4Q45A 2IAJA 3QESA 3MR5A 3M8QA 4ZVHA 4OJRA 1HQUA 2FBVA 4M3ZA 3NKYA 3NH0A 2R8GA 3VQEA 2KZZA 2UVUA 1JLGB 4FLXA 4DG1B 5KG4A 4DU1A 3G10A 1L5UA 4IKAA 4E7KA 3V6DA 5D3GA 2XY7A 1VRUB 1S1TB 4JV0A 4K4TA 2O5DA 1NK7A 1L3SA 4IR9A 5HBMB 2HHUA 1JLEA 4DWIA 4CFBA 4CK1A 4ID5B 1L3TA 2G8HA 2WRMA 2AWZA 3E01A 3OYKA 1ZBIA 3L3UA 2D0CA 1IM4A 1T3NA 1RTJA 1WSGA 1IKWA 2CJQA 2DPJA 2E9ZA 3KLFA 1JXBA 2VG5A 2ZD1B 3PUFA 1SV5B 5CYMA 3RMDA 5T7BA 2QK9A 1RYRA 4BWJA 2F8TA 4HUGA 3T5KA 1QE1B 4RNFA 3FFIA 2HNYB 2B6AA 4B9TA 1CSJA 3PO5A 4MIAA 3SFGA 4FBTA 1RTJB 1LAWA 2G8IA 1X9MA 2HNDA 5DQHA 3C6UA 1S1VB 4CGDA 1JLQB 4I7FB 4AHRA 4O3OA 3QGIA 3IGNA 2HHWA 3P5JA 4ED6A 2OPSB 4ED7A 3S9HA 4CHQA 4DLEA 2GC8A 5KFAA 3B6OA 4FLWA 2P5GA 5JXSA 2DPIA 1NK0A 5J2NA 3NF9A 3OL8A 4CFAA 3CJ4A 3PHEA 5HRRA 4ICLB 3K5NA 2BRKA 3TARA 3ZSWA 4KO0A 3CDEA 4CCHA 3LP0A 4KPYA 1NJXA 4YR3A 3WNEA 2W7PA 1UA1A 4CJWA 3OS0A 1VSEA 1X1PA 2IM2A 4CF0A 3I8DA 4ID1A 4J2AA 2DFEA 4NLOA 5DGBA 4UQGA 3HVTA 3F9KA 3NBPB 5KFZA 2BGGA 3HKWA 5CYQA 5KT5A 3VA3A 4IH5A 3PW7A 4DTSA 1C0TA 5J2MA 3PV8A 5C42B 1C0UA 2VG6B 3HHKA 3V6KA 4DL7A 4JUZA 3AA2A 5EWGA 1EP4B 4R8UA 1RT7A 3AVIA 2D0AA 2D0BA 4C8MA 4KREA 4IFYA 2BANB 3HYFA 4O3PA 4DMNA 2FJXA 3FFIB 4TYAA 3KK2B 1YTAA 1JLGA 4FK0A 3HK2A 4F4YA 1ITGA 4FJKA 2ETJA 3HPGA 5KRSA 1WLJA 3CFPA 2G8FA 4ED2A 1QTMA 1TAQA 4DQQA 2KZMA 2RDJA 4E19A 2IC3B 4FJMA 3ZSQA 2ZD1A 3HXMA 3H4DA 1T03A 1VSHA 4FK2A 2Y1JA 4MH8A 1U09A 4LSLB 1HYSA 3OLAA 1HPZA 4O44B 4TQSA 4NLWA 2XRIA 4CHOA 1HMVA 1UWBA 4E0DA 2O4IA 3NDKA 4LY7A 3MEGB 4HUFA 3L2QA 4EBEA 1TGOA 1KLMA 3KLIB 5DQIA 1RTIB 3ASMA 4OL8A 2R8KA 5KFKA 4ECVA 2QKBA 2O4GA 5KI6A 3Q8PB 3RR7A 1S9EA 4ED0A 4KTWA 1S1WA 4FJ9A 3O4QA 1UA0A 1NJWA 1HNVB 3Q8RB 4F4WA 1TL3B 4Y1CA 4QPXA 5C25B 1Z4UA 4BDZA 4KE5A 1BL3A 3M9NB 1CLQA 2IOCA 3AO1A 2DFHA 1RT6B 3ULDA 4KO0B 1S9FA 4GC7A 4FZXC 3KLGB 4RZRA 4CF8A 2EC0A 5L1JA 1NK8A 1S6QB 5KFNA 4IFVA 1XWLA 2G8VA 4FJJA 3MF5A 2YKNA 2KW4A 4HUEA 2GBZA 4CEDA 4KKOA 3QEPA 3GYNA 1KHWA 5K14A 4CIGA 4RW4B 3MR6A 3DLKB 2EX3A 2YNHB 3BSAA 2I5JA 3KMSA 1WSEA 1S48A 2JLEA 4I7FA 3I0RB 3KJVA 4KAIA 5C5JA 1ASWA 1HMVB 4RW8B 1U04A 2HHVA 4DTUA 5L1LA 1BCMA 3PZPA 4WXOA 2FLNA 5JUMA 4X2BA 5HRNA 3FQKA 3HVWA 2YNGB 4DSKA 4E89A 1RT5A 4B9MA 2IBKA 5C25A 2WTFA 4TQRA 3OHBA 2HB5A 4ZP9A 3SV4A 2P51A 2XGQA 2FBYA 4KHYA 1X9SA 1S49A 2I1RA 3H5XA 1Q9XA 3HP9A 4JV2A 4CEZA 4Q8EA 4DL5A 2JEGA 4O0JA 4OVLA 4PWDB 2YNGA 4XPCA 4Q44A 1BIZA 4M3RA 2HMIA 2AGQA 4LH4A 4JS5A 4EEYA 3VQ7A 3I0SB 4FS1A 3NAIA 2W9CA 4ECWA 3MEGA 3O3GA 3UIQA 1S1TA 4DL2A 4NRUA 4QAGA 1QSLA 4F4KA 1T05B 1KLNA 3C6TB 3ALYA 3M8RA 4EP4A 4N5SA 4B9UA 1REVA 1TAUA 3VA0A 4FM1A 1VRUA 3LAMA 1IH7A 1IO2A 4KHRA 3N6MA 3KK1B 3OS1A 4EBDA 2D3ZA 3DRPA 1D9FA 1J5OA 4F2RA 1EKEA 3QINA 3Q8QB 4ID5A 4HCBA 1JLCB 3RR8A 3AVBA 3OYCA 2XY5A 4FJXA 1RT1B 5F8JA 1O1WA 2C28A 3OJSA 5KFWA 4PUOA 2R8JA 1SUQA 2W9BB 2GIQA 4QWAA 4ZP7A 1DLOB 3K59A 2VG7B 4YR0A 3RRHA 5I42B 1MMLA 2AU0A 2IJNA 5F8MA 1W25A 3H59A 1TKXB 5KT6A 2VWJA 4Z4HA 1GOAA 2IGIA 1FKOB 1UWBB 2HWHA 3NGYA 3TAFA 5KFYA 4WXWA 1RBUA 4B9SA 4Z4FA 4K4XA 3FQLA 5KFUA 4Z4EA 2R2SA 3TAMB 3AVKA 1EP4A 3PR4A 1ZYQA 1R0AA 3MAQA 4NLXA 4Y34A 2XC9A 3DRRA 1TQLA 4DSLA 1CXUA 3K58A 1RT4B 3PW0A 1RBRA 3AA3A 1NJYA 1DTQB 3NF8A 3MTKA 3UDLA 3DLHA 4K50A 4HTUA 2BQRA 3PJXA 4NLVA 5F8LA 4KHMA 4CEEA 4N41A 3EZ5A 2FLPA 2BQ3A 3V81A 3QNNA 5HROA 4ECYA 2Y1IA 3SQ4A 4E7LA 4NLQA 1RT4A 3SI6A 5HLFB 1RT3A 4NCGB 5HRPA 3CO9A 4Q8FA 1N56A 2E9RX 4WFYA 4CJQA 2XY8A 2AX1A 4FW1A 3I5AA 4CIEA 3VQSA 3T19A 4K4ZA 2VG6A 5KFIA 2W8LA 1RBTA 5J2PB 4DL6A 4FJGA 2A1SA 1D5AA 1TKZA 3SCXA 4CEFA 1C0UB 3OYFA 2KTQA 4NLYA 1NK6A 3KLEA 5J2QA 3H2LA 4CJTA 5KFMA 5CY4A 4TSXA 3M9MB 1IG9A 3QEWA 1RDRA 3C95A 4KI4A 3VQ9A 2D5RA 2VWKA 4PQUB 1ZBFA 2RF2B 2UUWA 2OPQA 3ZT4A 2YNIB 1QUVA 5F8IA 1SH0A 3OYJA 2WONB 5J2PA 3AA4A 1KLMB 3KLIA 4MIBA 4ICLA 4O3SA 3CM5A 4MQ3A 4CHYA 1S9GB 4G1QA 4KI6A 2D3UA 4KV8A 4DFMA 4DU3A 2JC1A 4CJ5A 3MFHA 4MFBB 4B8CA 4DTRA 3LDSA 3GIJA 1RT2A 5C24A 1LAVA 1RDDA 4CJ4A 1N5YA 3UPFA 1J53A 2B5JB 4C8NA 4AH9A 4ELVA 5KG5A 3V4IB 1ZBLA 3T5HA 1S9GA 5KFOA 3QIPB 3OYNA 1L3VA 4DU4A 2E6LA 5J2QB 1UOCA 2VA2A 4KHWA 4OKEA 2R8IA 2BANA 3LZJA 5KFGA 4NYNA 4KFBA 5EUHA 1Z25A 1K1SA 2QV6A 4QCLA 4QWEA 1A5XA 4BE1A 3ISND 1TVRA 2QE5A 3TQ1A 1LWEB 4DTPA 4BDYA 2PY5A 1S1UA 1SV5A 3AVMA 2IJFA 5HROB 3BQ2A 4DLGA 5KGWA 2ILYA 4M3WA 5KFXA 4FXDA 1K1QA 5DMRA 3NF7A 3QO9B 3PR5B 2V0NA 4DQIA 4DTJA 4J9RA 3KHLA 1J9AA 4CJFA 3SQ1A 3PX0A 1IKXA 4ZVFA 4Y2AA 3OYHA 4GVMA 1C1AA 1ASVA 3NMAA 3TR8A 4KHSA 5KFFA 2HNDB 1VRTA 3DOLA 4W5TA 3KLGA 5I42A 4DEZA 4CJ3A 4B9LA 4I2PB 3SYZA 4KV8B 4ECZA 4CEQA 3T3FA 4ZPDA 2PYJA 2XI2A 5F8HA 2HVIA 4M45A 1HQUB 3DLBA 2KQ2A 3L3VA 4GMJB 3L2UA 2E9TA 1WAJA 3V1QA 3D28A 3KLFB 1N48A 3SUQA 2P1JA 1BI4B 3PVXA 2I5JB 4NCBA 3V6HA 2XCAA 1TV6B 4FLTA 4IFYB 2WOMB 5EWFA 3OL6A 3MXMA 2WB4A 3QO9A 4B3OA 4PWDA 1KTQA 2RDIA 1JX4A 2HNYA 1C6VA 2GV9A 1BQNA 1QHTA 4TN2A 3G86A 2GIRA 2BE2A 1IKXB 1RBSA 4LQ3A 2BQUA 1U45A 1T03B 4FM2A 4PY5A 3ZSYA 1KVCA 3NGDA 5KFSA 4O4GA 3KK1A 2PZSA 3TI0A 3AO4A 2HVHA 4OLAA 2JGUA 2ASDA 4DTNA 1HNVA 4E3SA 2LSNA 4KHQA 3D0PA 4J9MA 4AHUA 4URSA 1N6QA 1IKYB 2W9CB 4TY9A 4XO0A 3PX6A 2IC3A 3MR2A 4J9SA 3TAGA 4WFZA 3RBDA 3ZSZA 1HNIB 3PW4A 1YT3A 1B9FA 3HP6A 2YKMA 1TK8A 3A2FA 1BHLA 3AA5X 1TKDA 4ZPBA 4KSEB 1Z26A 4RUAA 2Z1IA 1SH2A 4CJUA 3EYZA 1S5JA 3DLRA 3HVTB 4JV1A 3DRSB 5HP1B 1S1VA 4XIUA 4MK9A 1NKBA 3ZT1A 5KFEA 4IG0B 4G3IA 5D3GB 1CXQA 4EZ6A 1D9DA 1JLBB 3NF6A 3IRXA 3T5LA 4NLRA 4K4SA 4EP5A 3SQ2A 2YNFA 4PA1A 4CGFA 3OYDA 1XI1A 5JS2A 3OL9A 1RTDA 3NL0A 1BGXT 3SJJA 2XGPA 4DSJA 4Z4IA 2OPRB 2P5OA 4JLHA 3VQAA 2RF2A 1KFSA 4CF2A 4IBNA 1TL3A 2ATLA 2FC0A 2HW3A 1N6QB 1BIUA 3RAQA 4DQRA 4O5BA 3OJUA 2ZQBA 1ZTTA 4CJEA 4J9NA 5KT2A 2XO7A 4EYIB 4QW9A 3I0RA 1T94A 3QLHA 5KFJA 4F2SA 4Z4GA 2B6AB 4O3QA 3BQ1A 4CGJA 1W0HA 5KG2A 4KB0A 1GOCA 5C42A 1JKHB 1WSIA 1LWFB 1A5WA 5FDLB 2OH2A 3MECA 1S97A 2XHBA 5E41A 3G6YA 1DTTA 5CYMB 3V81B 1S6QA 5T14A 3K5OA 3QIDA 2QKKA 3KKSA 3SFUA 4OKJA 2WK4A 2ZKUA 4QWDA 4IG3A 4NCGA 3GIKA 3HL8A 1RA7A 3AVNA 4DTMA 3EPGA 3D45A 3DLKA 5L1KA 4J2BA 3LPUA 2HHSA 1JLFA 2YKMB 4R8UB 4HYKA 3NCIA 1TKXA 3DOKB 2YHAA 4OGEA 4ECRA 4R0EA 1VSKA 2FVCA 4ED8A 4BACA 3LAKA 4ECTA 4MKAA 3KD1E 4FJ5A 2KFZA 4FBUA 4RW4A 4HVJA 5FRNA 3IAYA 4H8KA 1JLAA 3M8QB 1EXQA 1XR6A 4YQWA 2J6UA 5J1EB 3N6NA 3ZSVA 4F3TA 1RYSA 2XWYA 5KGXA 4CGGA 2WHOA 2IS3A 2Z1HA 4E1MA 4IFVB 4BWMA 4LD0A 5KT4A 1QSYA 1JL1A 1FKOA 2YV0X 4FZZA 1LWEA 3IS9B 3MEEB 4ZVEA 3AO3A 3NE6A 1RTHA 3SNNA 3DMJB 4K4YA 3O4NA 1RNHA 5FROA 4E7JA 4XPEA 4TY8B 5F8NA 4J2EA 3NH1A 5J1EA 4RNMA 1EETB 2YKNB 4RUCA 4J2DA 1NOYA 1R0AB 2A1RA 2VG7A 3ZT3A 2IDOA 1S1WB 3HPHA 1I39A 2JC0A 2ATQA 2DFFA 4I2QA 1KVBA 3IN5A 1SL1A 4W5RA 2IM3A 3FRZA 2V4RA 3AVGA 3MEDB 1NK4A 4KHNA 3IGVA 4FJNA 2W9BA 4FLUA 5L1IA 4CHNA 4YP3A 3H5UA 2UVWA 1W9HA 1QSSA 3LP0B 3L2RA 4QWCA 4C8KA 2YNFB 3QIOA 4FLYA 3BGRB 1BQNB 1S0OA 5DG8A 3BR9A 3CFOA 3CIZA 1VSDA 3QEVA 3P1GA 2AJQA 1XHXA 4AILC 5KT7A 1RTIA 3UQSA 3GQCA 3CJ0A 4FLZA 1GX5A 4M94A 4N76A 3M8PB 1LW0A 1JLFB 1BI4A 1KCFA 3TAEA 3MXIA 5DLGA 5KFLA 1S1UB 3SI8A 4ZVGA 4E1NA 4H4OB 1C2PA 4CJRA 3O3HA 2IA6A 3RB3A 4NLGA 4U7CA 4EO8A 3OYLA 1KHVA 4C8LA 3M8SA 4ECUA 1S6PB 1JLAB 4J9KA 2G8KA 1VSMA 1HYVA 2W9AA 5KFPA 2E6MA 2KFNA 3KIOA 3VQ5A 3HVRA 1I6JA 4LSLA 4J9OA 1NKCA 1NHUA 1C1BA 3M9OB 3QERA 1JKHA 4NLSA 3LP2A 3CDWA 5C24B 4KKOB 1LWFA 4EO6A 4DFPA 2IMWP 1HJRA 2VA3A 4YMEA 5J2MB 4DSEA 1VSJA 5JS1A 4DSFA 4DQPA 3KMQA 1IKVA 3KLHA 1U49A 3G0ZA 2BR0A 2G8UA 4DS5A 1TP7A 4FJHA 2OZSA 4FYDA 4IDKA 1HRHA 3SUNA 1NKEA 1WSJA 3BJYA 1LW0B 3OS2A 4J9PA 2R7YA 2WOMA 4IG3B 1I3AA 5FRMA 2R8HA 3BSNA 3L2VA 4KRFA 2RN2A 4K4UA 5DQGA 3GIMA 4PQUA 4IRKA 2V9WA 1C0TB 1EX4A 4Y3CA 4CF1A 3NGIA 3PO4A 5DG9A 3PY8A 5CYQB 1FK9B 3BSCA 4DG1A 3MR3A 5KT3A 4F8RA 2DTUA 3BSOA 3V4IA 1CZ9A 1DTQA 3KLVA 1S6PA 4OPJA 3VQBA 1NK5A 3KHRA 2GUIA 2UVVA 1F21A 4FK4A 4K8XA 1BQMA 3OY9A 3K5MA 1C1CA 2OPRA 4K8ZA 3H5SA 4CGIA 3QNOA 3RMCA 3S3NA 5HLFA 4DTOA 3LP3A 4CJSA 4OLBA 3RTVA 3H5YA 4M41A 4CHPA 3SZ2A 1JLBA 3HT3A 3Q8SB 1HNIA 4RW7A 1RBVA 2F96A 1SKSA 3ZSXA 2ITGA 3KTQA 2OZMA 3MEEA 5F9LA 1C1BB 2FJVA 1G15A 4Z4CA 2UVRA 1WNSA 1TVRB 4B8AB 3JYTA 4AHCA 3S3OA 1SH3A 1KVAA 5KG6A 4O3NA 1UAXA 3GV8B 5F9NA 3WNHA 4CJLA 1SUQB 3CWJA 1T7PA 1DTTB 3EY1A 1D8YA 4CIFA 3BREA 4GC6A 3ZT0A 2HAIA 3E01B 3CJ3A 4RNNA 4KTZA 1ZBHA 2BE2B 3T1AA 4NLUA 1TL1A 3AV9A 4URGA 3NBPA 5K14B 1C0MA 4Q0BB 1LW2A 2JEFA 4RNOA 3CVKA 4O4GB 4M3YA 1WAFA 3PX4A 3QGHA 4KTQA 4I2PA 1BQMB 1REVB 1XR7A 5KFTA 3JSMB 3K2PA 1K6YA 3ZSRA 2RKIB 1TK0A 1KSPA 2HHQA 4I2QB 4YFUA 4CECA 3AVHA 4J9QA 3AVLA 1WN7A 2HNZB 1JLCA 2D41A 3S3MA 2QXFA 3NAHA 3SV3A 4LSNB 3AVJA 3L8BA 3VQQA 4FW2A 3JYTB 3GV5B 3TAMA 3B6PA 4KHUA 4IR1A 4W5QA 4CK2A 4DL3A 4NYZA 3DRRB 3OHAA 4AHVA 2IM0A 2HWIA 3DOKA 4TXSA 2Z1JA 3OSNA 4BE2A 2FVRA 2XCPA 2BDPA 2F8SA 4AHSA 3I0SA 4FCYA 4HCCA 1Q8IA 2EHGA 1RT2B 1ASUA 3V1RA 1QQCA 3I5BA 2C2RA 3CQ8A 3V1OA 3P83D 1KRPA 4ZMMA 4CF9A 3AVCA 2F8EX 5KFDA 2E4LA 5DGAA 3G6VA 4DFJA 1QE1A 4EZ9A 3ITHB 2AGPA 1TL1B 3IG1A 3ZT2A 3U6FA 3HM9A 2R2RA 3VQ8A 3DYAB 2FVSA 4IH6A 4ZP6A 4CJVA 4FZYA 1IKWB 4F50A 3PJWA 3NFAA
chains in the Genus database with same CATH superfamily
1U0HA 2OPPB 2IVYA 4RW6A 4X66K 3CPWR 4KAZA 3J7YP 2OYQA 3JTPA 1S1XB 2FDNA 3VQ4A 4C1NK 4WK3A 3KLEB 1F3VA 1N88A 2ZZMA 4GKJF 3EGWB 4L73A 3LTOA 4Y2MA 2EFOA 5LJWA 5KTQA 3OYMA 4B08A 5AQWA 2CQGA 4BR0A 3G6XA 1H2UX 1WTBA 3VENA 2DY1A 2MQOA 3C6HA 4M7YA 3W5YA 3VEWA 1ZETA 3PNIA 2ASLA 3CC7N 5BR8J 3W65A 1B4SA 1FHTA 2RNEA 4O55A 5K8NA 3IG1B 2RD5C 4FF1A 1IJEB 3UE5A 2DXEA 1GLFO 3RAXA 5B0EA 4C3KA 5T41A 2HS0A 2H4YB 5IM0A 2WBNA 5LMNF 3LDOA 1MROA 1U2RA 3WXIA 5BPMA 3F73A 4KQZA 4RW9A 5E84A 3V9WA 3O8WA 3FSIA 3UKRA 2GJFA 2FBXA 2EPIA 5BPNA 1VJWA 3WNGA 3LP1B 4ER8A 3FCHA 4Y2KA 1VQPS 3DYAA 2XG8A 4HTIA 7FDRA 4CJKA 2H4WB 1IN0A 3ZZZA 4RNHA 4M7XA 3D5MA 2MKCA 3NGZA 1NHVA 2QSFA 3V9UA 1W2BR 4YR2A 2MQNA 3J80U 4KH5A 1F9EB 4OI2A 3V6JA 3CF5L 1VSIA 3O44A 5IT9Y 3CPWM 2J9DE 2E7WA 1FNOA 3VQCA 2ERRA 1WELA 3RVCA 5SWMA 3HVAA 3MM5B 4NLDA 2N4CA 1HYSB 1HBUA 4CE9A 4K5RA 1RAEB 4KH4A 1B7YB 3V9ZA 3NAEA 2J0WA 3OHRA 2W42A 1L3UA 1QAIA 4ED3A 3HHLA 3C94A 3OR2B 3CYMA 5F0WA 4IJNA 1HI0P 1IWGA 1Y5LB 4IOAL 1EETA 2HGMA 4DTXA 2CPFA 3AVFA 1BWEA 1QUPA 4FJ8A 2ZC3A 5EX5A 2UZAA 4QIFA 3RB0A 1CJUA 4M95A 4E7HA 2J76E 2JEJA 1FX4A 3DDIA 1YG0A 4MK7A 3D6FB 3LWMA 5D4LA 3ZSOA 3EPIA 1Y9OA 2J9CA 1VFJA 2NXUA 1SVDA 4JRQA 1S59A 1IBKF 1FXDA 1BISA 2DY9A 2J6TA 1S7HA 1VSFA 3WDOA 1Q8LA 4IH7A 3BF4A 1T8EA 4NL5A 4OJGA 4EBCA 3CCSS 3OYGA 4WE1B 4AL6A 1RDBA 3C15A 4H4MB 1ZZFA 1BY9A 3C7NB 4OO1J 5A2QO 5DJBA 2Z1GA 3PFOA 1M90T 4TYBA 2NREA 5AZJA 2IPOB 3TU5A 1RHJB 5I3UB 1FXLA 2ALZA 2IM1A 2A42A 3DGVA 3QDKA 1UMJA 2YHBA 1G3OA 1RDWX 4M3TA 3RMAA 3TABA 4DV0K 2AX0A 1U4BA 1HYZA 3V9SA 5D0EA 2P9CA 4GV9A 3KHHA 3U3GA 4RG8A 2J6SA 3QIPA 3C6TA 5D0RA 3QICA 1TKTA 4CK3A 1M5VC 1MG7A 3L2WA 2OAUA 3MWBA 5KFCA 1Q16B 5KRTA 1UTAA 3LALA 3AFGA 1Q5VA 1HNWK 1VQ4S 2MKKA 1RT5B 2UP1A 3LZIA 4Q43A 4JI1J 1FD2A 3GTYX 4BR4A 3POTB 4R5PA 1U47A 1RABB 3OR2A 3T5JA 5AQGA 3SUPA 2QLJB 2DO0A 3VEXA 3V9XA 2HIQA 2R2UA 4QW8A 2UU9J 2YNHA 2FLLA 4P7VA 1P1LA 2FJWA 1WTFA 3Q22A 2G4BA 1F3FA 2CQPA 1IJFB 3M2RA 2HOEA 5GAEU 3KD5E 1SL0A 4FVMA 3HOSA 4ZN3A 3CJ2A 1VQ9S 3SPYA 4OJ1A 2GMHA 2X6SA 3AH6A 1XIQA 4DR5K 1SAZA 4IRCA 4RWXA 3DI6B 2ILZA 4Y28C 4PWUA 1R8CA 5EU7A 3AGKA 2V52B 3Q86A 4KR0B 4NXNJ 1NEEA 1RAHB 3PACA 1K8KA 1FVQA 3OYAA 2JWLA 4GV6A 1TL7A 5C2CA 2MYFA 3DJCA 4ED1A 4NXNF 2VG5B 5J2NB 2RHSB 3ZZTA 2VQEJ 1NM1A 1NDLA 2Y8YA 4JHDB 4ZVPB 5SZTA 1NJIT 3FGUA 4KB1A 4DR1F 3IAS9 4JYAJ 3TEGA 2B43A 4ZS6A 4RWWA 4O3RA 4PXDA 3ISNC 3L7OA 5LJ3Y 3KUGA 3SJHA 1BCOA 3E3XA 1LW2B 3R3LA 4LQ9A 2X51A 5KPRA 1NGFA 1UW9A 1PSDA 1MU2B 4OJ3A 3IRXB 3DRXA 1V3ZA 2GA7A 1SIWB 2NXNA 4LF6F 1XNQK 3JSRA 1X5TA 3K57A 2XLIA 2W8KA 1U6BA 2AKWB 2OCEA 2D69A 2HLTA 4X64J 3SBMA 3M32A 1ZH5A 3GDQA 3ZCMA 2IIRA 1JJ4A 4JI3F 4WZQA 1JCGA 1J5EJ 2FVQA 1RAJA 2ZZTA 1KOOA 1LCUA 4JI3J 3EVWA 3FBCA 3GILA 2VONA 1T6DA 5A2QY 2XLJA 3MM6A 2EG1A 1LXJA 1T3OA 1M5OC 1LV5A 4ZJOA 4B1ZA 2ZH5A 3OTBA 3TTDA 1IKYA 4A46A 4ILLA 5CQGA 1J27A 1RHKB 3CEDA 1JXVA 4K7QA 4Q45A 4O8KA 5CE3A 3BP8A 4OJRA 4M3ZA 3FZKA 3HKZD 3I87A 2FHKA 4DUTA 2DHGA 3HSJA 3RBXA 3MN7A 2KU7A 4X65K 1L5UA 4IKAA 2Q0UA 5D3GA 3TR5A 3NMUA 2P9SB 2HVZA 3FEZA 1HW9A 1HD1A 4IR9A 2W41A 1YHQS 3ZEUB 5HBMB 3S8SA 1P27B 1JLEA 3B54A 1HKCA 4ID5B 2G8HA 1S7IA 2AWZA 4DBQA 4GVEA 3OYKA 3VGMA 1ZBIA 4P2SA 5HK4A 1OQ3A 4BC4A 2NUHA 2M7SA 4Q2MA 3GR1A 5HJYA 3CETA 1JXBA 2EG2A 3PUFA 2PA3A 3MN6A 5T7BA 1KN6A 3J81j 2XLKA 1XK8A 3SSQA 1HNXF 5EGYA 1N36K 2F8TA 1SC4B 4HUGA 3T5KA 1N5TA 4DV2K 4B9TA 3NOCA 4ZPTR 3SFGA 1LAWA 2HNDA 3SMSA 2XMUA 4FPRA 1YVNA 2A10A 1JLQB 4AHRA 3MM8B 2DK2A 3R5CA 3MMCA 1TMMA 2PAVA 2Z4PA 4UZBA 4ED7A 4CHQA 3R6LB 2CPDA 3VGTA 4FLWA 2P5GA 4I6MB 4CBUA 2HRTA 2HK3A 2A2CA 5J2NA 3OL8A 4NZ6A 5M2PA 1F5AA 2A2DA 4AXJA 2WBRA 3PHEA 1AROP 4FN5A 1U6ZA 2QW9A 3UD5A 4WQ4A 5HRRA 3GYXB 2XYGB 2BRKA 4M5IA 3TARA 4OIXA 4WCEL 4CCHA 5D4PA 1U24A 1U1PA 1S6OA 4KGMA 4CJWA 2KXNB 3P4IA 2VOOA 2KYXA 1NGAA 3CD5A 4UQGA 3F9KA 5KFZA 3HKWA 5CYQA 1UPPA 3O9RA 3PV8A 4JI0K 3VGSA 4LFAF 4UT4A 4OHYA 4IFEA 3HHKA 2MGZB 5EWGA 3DDNA 3DXKA 4F7VA 2J7UA 3BN7A 2D0AA 2D0BA 3SLCA 4KREA 4CO5A 2FJXA 3THTA 4TYAA 5B8HA 1YTAA 3HK2A 4FK0A 4F4YA 4A57A 4FJKA 2QMWA 9RUBA 3CJAA 1QTMA 3AT1B 4A61A 4FJMA 3ZSQA 3HXMA 3H4DA 2R7QA 1T03A 1BUXA 2DTJA 3CUNA 1RWKB 5LSOA 3U02A 5HL7Q 3CJKB 1QVGR 3PYFA 3H90A 4CHOA 1HMVA 5MAOA 2E1AA 4RO0A 3NDKA 3PIOQ 4MDAA 2G1DA 3TJ8A 2QLBB 3CDAA 2NS1B 3WXLA 2MLYA 3ASMA 4X66F 2O4GA 3A5LC 3RR7A 5LJVA 2JJ4D 4ED5A 4KTWA 1JJ2M 3WIUA 1XQSC 3O4QA 2K06A 1HNVB 1HQ2A 3HI0A 2CWXA 4Y1CA 2YQ1A 1XERA 5C25B 2GIFA 2FF3B 1BL3A 2KHDA 2H9ZA 4JHDA 3AO1A 1RT6B 1S9FA 4GC7A 3D68A 3KLGB 4CF8A 4NMLA 3RU0A 2J0SD 1NK8A 4DOZA 2HSTA 2J4RA 1GXLA 1XWLA 2G8VA 1P9QC 3L6QA 2ADCA 5B0FA 5KAKA 4IEIA 3HULA 3CHWA 4NXMJ 4A8KA 1HJOA 2GWJA 3QEPA 2YPZA 3C16A 3KYLA 3CJ1A 3A4TA 3C19A 2P6TA 3MR6A 3DLKB 3ZZYA 2UUBJ 3BSAA 1Q5YA 4ES1A 2WSCC 2I5JA 5H9EK 2JLEA 3H6EA 3I0RB 3RSEB 3MM8A 2HURA 2EFGA 1U04A 2PC6A 2QL9B 5L1LA 2MB0B 1SS6A 1WKKA 2V7YA 3D0GE 1R8PA 5HRNA 2OMLA 3CCLN 3HVWA 2YNGB 4E89A 2CNNB 2IRXA 2GEMA 2IBKA 2WTFA 4TQRA 2UUAJ 1AXQA 4DHVA 4DUZF 2QTDA 3L3CA 3OBWA 3VAJA 3H5XA 2V2QA 2PD1A 3CB4A 3R1XA 4OX8A 4ZPVR 2CPXA 2V8VA 4JKCA 4PWDB 3EUNA 2YNGA 4M3RA 4LH4A 2LDIA 4JS5A 1F9HA 4FS1A 4KC5A 3FEYB 5T7LA 3O3GA 3UIQA 1R3NA 4NEZA 1R89A 1T05B 4ZIVA 1NU0A 3C6TB 3ALYA 4CLTA 3M8RA 4N5SA 5CZXA 5G4DA 1TAUA 1HHSA 4FM1A 3PYEA 3CC4S 1VDHA 3D2FA 3OS1A 1AB8A 1D9FA 1VK8A 4L3QA 1Q18A 2DHXA 1U02A 3H45C 3OTOK 4HCBA 3THXA 4F26A 3RR8A 2B4UA 2GZOA 1RT1B 4I1TA 5F8JA 4OI1A 4X4TA 2O8DB 5AQIA 4MDBA 2AYBA 4FYVB 2IVPA 4ZP7A 3K59A 4J8FA 1FVSA 5I42B 2AU0A 2UXBJ 3DNCA 5F8MA 3GFHA 2VWJA 3NNAA 1FKOB 1CJVA 2LECA 4WXWA 2GAHC 3FZBA 2PMWA 4B9SA 4Z4FA 3FQLA 4ZCLA 5KFUA 1HNZK 1VBZA 4JI6K 3MM6B 1YJ9N 3CCWA 1EP4A 3PR4A 3EE9A 3KJNB 1R0AA 4CT9A 1SKUB 2DO4A 1TQLA 3FKBA 1CXUA 3D7EO 3Q24A 3K58A 1RT4B 5AQUA 3PW0A 3AA3A 1DTQB 2AYEA 3MTKA 2P9UB 4DQ8A 3UDLA 3VR1A 4K50A 1N5VA 1DHMA 1WC6A 4KHMA 4CEEA 1YJVA 3EZ5A 4LFCK 4OLPA 3D1HA 1RBLA 2YJFA 1KVJA 4OZ2A 2QM1A 1RT3A 4N7TA 4DCJB 1N56A 4CJQA 5T7LB 1VQ5N 3T19A 5KFIA 4DL6A 3MAAA 5GMEA 3OYFA 2IJRA 3CPEA 3GWCA 1YBAA 5CY4A 4OHXA 1IG9A 4X4QA 2CYYA 4LFBK 1S22A 1DAXA 1KKHA 1IV0A 3VF0B 3RJMB 3NMRA 4PQUB 1D8ZA 2YNIB 1FX2A 2DHSA 1Q78A 3OFHA 1SH0A 2WONB 1KLMB 3KLIA 2Y9HA 4UUWA 1VQMN 5CCMA 4O3SA 1CJTA 4WU3A 3VF4A 4KI6A 1RACB 2NPIA 1Z05A 5IT9O 2LMIA 3GIJA 5C24A 2N7CA 3CCMS 2BJ1A 1KC8T 1RDDA 4P52A 3MMCB 2VKRA 3UPFA 3MMBA 5K5MA 1J53A 2B5JB 4C8NA 4NYPA 3UN2A 5GIPA 4LT6A 2E88A 1RWXB 4R25A 5AQNA 1S9GA 3UB5A 4Z7YA 3O8MA 2P8IA 2ZBIA 4L6V3 4DUZJ 2R8IA 2F9TA 4DR1K 3LZJA 5KFGA 4KFBA 5EUHA 1RAGB 4DJBA 1K1SA 1Z25A 1U2VA 4IJAA 2VCPA 4A5AA 2E1CA 4K43A 1LWEB 3MD1A 3MMBB 1SC6A 4DTPA 1NHKL 4CZIA 2PY5A 3BF3A 2RE1A 4BR5A 2IJFA 4MLHA 3EVOA 4M3WA 3ZZUA 5KFXA 3QO9B 1ULRA 2HQ3A 3CC7S 4JV5J 3M5RA 2DNMA 2VDIA 2EFQA 5AQKA 1ATRA 1U1KA 1CQMA 2DH8A 4KHSA 2GAGC 4FPBA 5KFFA 3OVSA 1VRTA 5BREA 3DOLA 1C4CA 5GAGI 3KLGA 5CXTA 3W8GA 4DEZA 3CJTA 4I2PB 2W2OP 4AQYK 2YBVA 3CI5A 4KV8B 3T3FA 4ZPDA 1LOTB 4MTPA 2XI2A 4YY3F 4DCPB 2KQ2A 4JOUA 2NZCA 5A8WB 3TO8A 3NGKA 3V1QA 3LDQA 1QTNB 2VQFF 1N48A 1BI4B 4CZMA 4KT0C 4I69A 2A6MA 3WHIA 1ZS6A 1OJ4A 1PC5A 2VQFJ 4XH1A 3KWMA 2WB4A 3P8BB 1KTQA 3I8BA 2W4CA 4QJVA 1JX4A 1KAXA 2W24A 1Q7YT 3HSDA 1E4GT 3CC2S 4TN2A 4DR2K 2HQFA 2J8SA 1U45A 2V2KA 4FM2A 3ZSYA 2HG4A 1AT1B 3W1YC 5AQRA 4PZVA 4F0KA 3AO4A 4EHUA 2C2OB 1HBMA 5HVGA 2HVHA 4DTNA 2YWWA 5EX0A 3LM9A 3ET6A 1N36F 3D0PA 2CH5A 3MUVP 3W61A 1HLWA 5E3CA 3UKUB 3NLCA 3MPWA 2P9NA 3PX6A 3RBDA 4U9RA 2QL5B 1YT3A 3RGIA 2YKMA 3ENQA 4KYZA 2PFFB 1BHLA 3HZ6A 1MN7A 4ZPBA 4KSEB 3JB9k 2AA4A 1Z26A 1M1HA 2LU1A 1EB0A 2DNGA 2Z1IA 4CJUA 1S5JA 4JV1A 3DRSB 4F02A 3M2VB 5A8RA 2HBMA 1NKBA 2NCKL 3MWTA 5ETRA 1P6TA 3IRXA 3T5LA 5C2GA 1MN9A 4RPFA 3DXBA 4CGFA 3GL1A 3P39A 1XI1A 3I9V9 3OL9A 2I7PA 3RG6A 3ZETA 3OA9A 2OPRB 4ZK7M 2VFTA 3CCRN 1WWHA 3HX9A 1BIUA 3RAQA 3QJLA 4DQRA 4C23A 2IVOA 4O5BA 1GMVA 2ZWOA 3CCQS 1EIYB 3R7NB 4J9UE 4ZVUB 2HRUA 4PYDA 5KT2A 2XO7A 4EYIB 3MOJB 3GG4A 4KB0A 4NMXA 5ETLA 2BJ8A 4H03B 3Q8YA 1H74A 2F8HA 4MT1A 4B3SK 4WFNQ 3PKYA 4UOFA 1Y3KA 3H2VE 2BKPA 3G6YA 2FJBB 1K73O 5AQJA 3K5OA 2V8PA 1TUUA 3I32A 4ED4A 1X3MA 3BS9A 2ZKUA 2FXUA 4UTGA 4IG3A 2HEKA 1Y4ZB 2MHNA 1QVFR 2Z58B 3DRYA 3HL8A 1RA7A 3AVNA 2KB2A 3DLKA 2D0PA 3VGLA 1JLFA 3ZX0A 3B4MA 3U9DA 2M2BA 2MMYA 1VAZA 3DOKB 2YHAA 2A1BA 2GV1A 2CZ9A 4OX9J 4X4OA 3LPYA 4JI0F 3OV7A 2FVCA 5I9EB 2HVDA 5JJBA 2BJ7A 4BACA 2ZGYA 1NSKL 4B9QA 1FNXH 3C7NA 4HVJA 1WORA 2HHHF 1NNEA 5FRNA 3IAYA 1EXQA 1XR6A 4DV4F 1VHIA 4LJMA 2L08A 3TA0A 2ZKTA 4KHPK 1ZAXA 4PABA 4A5BA 4LF6K 4LD0A 1JL1A 1FKOA 1CJVB 1RAOA 4FZZA 1LWEA 3MEEB 4A8QA 1BWFO 3NE6A 1RTHA 4A2BA 3DMJB 3ONQA 2ADBA 1R59O 4WKYA 1GFWB 2DR7A 4BLGA 3MM7A 4OI6A 2I2YA 1D09B 1NOYA 2VHGA 2IDOA 3MM9B 1S1WB 1YLXA 3ENBA 4QBUA 1I39A 2ATQA 1YSJA 3IM9A 2KRBA 4I6YA 1WBBA 4DHYA 1HW8A 3LW5C 1UFKA 5LXRA 2BJDA 1KQKA 1VQSA 2BZ2A 3MEDB 4GRSA 4BVPA 3IGVA 2E8AA 4IOXA 2DR5A 4M5DA 1OH5A 4CHNA 4FWMA 4F4AA 1W9HA 1QSSA 3LP0B 3BZCA 4W90B 3L2RA 2QC3A 1HKBA 1HI1A 2IRUA 3UE2A 3BR9A 3CFOA 4BQLA 2OLWA 4P74A 4RBVA 9ATCB 3QFWA 4HTJA 4H4KA 2O8BB 4KH1B 1IBLJ 3US5A 3CF5Q 2UXCF 1OY6A 3CJ0A 3MM5A 4FLZA 1LW0A 2DNNA 5DLGA 2XSJB 1S1UB 4OI0A 3LH2S 1N34K 3R9PA 3BKTA 1C2PA 3O3HA 2IA6A 4CVNE 4JKAA 4DX8H 4RWTA 3ENVA 1NH7A 4EO8A 3OYLA 3IFEA 3M8SA 2FPHX 1IBKJ 1JLAB 1BA1A 3ZNJ1 3D2EA 2M9KA 1HYVA 4DCHA 3TNVA 3KIOA 1G99A 3J7AP 3BO3A 4PPZA 1JKHA 4NLSA 1TFYA 4O8UA 1X4AA 4EO6A 2IMWP 5J2MB 3K8VA 2P9UA 4DSFA 1M5KC 3IP0A 4LF8F 3O1BA 2EK6A 2BR0A 3BY5A 3CMEN 4DS5A 1TP7A 3UFCX 3ILIA 1PBUA 3L7UA 1R0CB 5DM7L 1I3AA 3VETA 3BSNA 3L2VA 5GINA 2BYCA 2XWXA 4IYQA 4KJIA 3WBZA 3EX7B 1Q86O 4DR3F 4CF1A 4JKEA 3PO4A 3PY8A 1CZ9A 1DTQA 1PJ6A 3FBEA 1S6PA 2CJKA 2CPJA 4X4PA 4B1WB 4H4KC 2GMLA 4EFHA 1BQMA 1CZAN 1C1CA 4C3MA 2B9WA 4K8ZA 2D1CA 3KG4A 2R7VA 2JLGA 2FSNA 1U2CA 1WBDA 2OELA 5HLFA 3I56S 1OPIA 3RTVA 1Q7LB 4OZ3A 4ZOSA 2UUCK 4ZDNA 3HT3A 2DNRA 4ZIWA 2GWKA 3WIVA 4DV5J 1UJ5A 1WOSA 5BR8F 3HLUA 5M1NA 3M2UB 5F9LA 4TVAB 4Z4CA 5IXUA 1TUVA 2DXDA 2VUGA 2YWGA 4D3GA 3S3OA 4WP3A 1KVAA 3A5OC 3CJCA 4ZJQA 3T1YF 1AW0A 2CJXB 4RNNA 1PYSB 2XBPA 1O8BA 3T1AA 1FFGB 1TL1A 3DXMA 3AV9A 3M6WA 2QLXA 5K14B 3VALA 5JVHL 1BMQB 1BUPA 1XNRF 2RUGA 4CZHA 4P73A 1WAFA 2P9KA 4GKJJ 2MSSA 2QA2A 3M6VA 2YKQA 1QD1A 1XNRJ 1RSCA 4FWNA 4LREA 5AJ3J 5HI7A 5DDQC 2WTUA 2Y8WA 1K6YA 3ZSRA 3HHLB 2EC2A 4YHHK 3CD7A 1HR0J 4CZFA 5IQQA 1WN7A 3NP5A 4ZLNA 2D41A 2QXFA 4LSNB 4DV7F 4BBYA 4FW2A 3GV5B 3B6PA 1P1TA 4OYXA 1D3WA 3OHAA 2V69A 3MMAA 3OSNA 4AHSA 2KG1A 2ASOA 3QT6A 3V1RA 4OHZA 4WQ5C 2HWTA 4KGVB 1YQHA 5AXMA 3AVCA 2B4VA 2F8EX 4DFJA 5F3ZA 3W5XA 4EZ9A 3NG8A 1EO1A 4CLFA 3I96A 2FVSA 4IH6A 4ZP6A 4CJVA 1YJTA 5EX3A 3PJWA 1VYAA 3S3NA 2XTJP 1YI2N 5HRSA 1X9WA 2MZSA 3M05A 1KNZA 4PKDB 2N3OA 4K8RA 2B4JA 4WZMA 4JI7J 1FKPB 1LEOA 3M8ZA 5ELZA 4FS2A 3RB4A 2AD9A 2ZJRQ 2NSCA 4HDHA 1QQMA 4WIQA 5LMUK 5DG7A 2W2QP 3RRGA 2R7TA 2MZQA 2VU5A 2XNRA 4GVBB 3MPYA 4JI2J 2ZNYA 5KG3A 4FKXA 3ZZPA 2EFPA 2XMKA 4LF9K 2DXFA 1KXPA 4DV3K 2CIMA 1TK5A 1S9EB 2CVIA 2ZZNA 3DGPB 1Y7PA 1C1CB 4DR6J 2RS2A 1LWCA 2ZE2A 1NUEA 3UWTA 3PSFA 2C22A 3EN9A 4JP8A 1XMOJ 2OTLS 2QYCA 3Q23A 4WF9Q 2E1ZA 1D0EA 2X1GA 4CO2A 3CCZA 5TKWA 3TUZC 1E4FT 2PEHA 1VRTB 3U1NA 1TL5A 2X6NA 2LCWA 5ETOA 2AEMA 3DAWA 4N56A 2MZRA 4OYOA 1NWKA 4P71A 3M8PA 3X3UA 3AXMA 3AVAA 2DRDA 4LH5A 3FEXB 4RU2A 3TJAA 3NGSA 4HKQA 3CMAN 3RMBA 5AQHA 3H42A 3D9BA 1QZ6A 4WPAA 4H0PA 4CD1A 1CZBA 4JRPA 1WSFA 3J7YI 3VEYA 3H98A 4Y00A 2FB0A 1JXEA 1TELA 3V6DB 2I8EA 3MFIA 4WE1A 4FYXB 3A0IX 3U9ZA 4B9VA 3ZZ0A 4W5NA 1VISA 2WCXA 4ZTJA 4DSIA 1FRMA 3NXZA 4HVZA 3R5AA 3DRSA 3FZFA 3MMAB 3HM8A 1VQ9N 3CTRA 2VASA 5HSPA 3THXB 4YOTA 4YNQA 4CYUB 4YB5A 4RW9B 3T1HF 3NNHA 4H0YB 3A13A 3UR3C 1TR0A 4K4VA 1K0VA 1A5VA 1UFWA 3P96A 1UETA 2POKA 3THYA 3LPTA 4CLZA 2ZEJA 3CCTA 4RW8A 2ZVIA 4ZHRA 1Q95G 4KBIA 4CI6A 2OJ3A 4FJIA 3H40A 2V8GA 4BY9C 3IS9A 1GLBG 1CJKB 1WNEA 3K5LA 2F4VJ 2QT7A 4LIWA 3VHQA 4K0KK 1JLQA 2W7OA 4U7UD 2Q3SA 3F9MA 4DQSA 4YB7A 3CQYA 2R2TA 4OYZA 2QSWA 5HAOA 2RPIA 3DI6A 1JLEB 4M5JA 2ZF5O 4FO0A 2KJWA 2Q1NA 2RU9A 3BGRA 4WIIA 3A8KA 3TA1A 4H5VA 3EGNA 4H5RA 2YNIA 1Y3JA 4F4XA 2OPPA 2P9KB 3CCMN 3RSEA 1N0UA 3NHGA 3HFZB 4H54A 1KVKA 2JNJA 3OBIA 1DQAA 1S0MA 3DWLA 1W97L 5M1FA 1WDTA 1U1MA 4DX7A 4NRTA 3H08A 4I9LA 3SQ0A 3MCAB 3LGMA 1MLAA 1PCAA 2DD8S 4DR7J 2HHHK 2C2DA 2AP6A 2ROEA 3SUOA 2XI3A 4BGBA 3GZ7A 3ZXWA 1E6YA 2UUTA 1WKJA 5FPDA 4B3SF 1LK7A 1KONA 5MLCV 3O9TA 1RHQB 3TVKA 4JD2B 2DY4A 5KFHA 2K7KA 4L3KA 1I51B 4FJ7A 3DOLB 4IDKB 4HHTA 4IWVA 1Y97A 3JTNA 1FESA 2LKZA 1UPMB 2B56A 5B0CA 1LNQA 1V5VA 2Q6BA 3KNAA 1RT7B 3SSRA 2B51A 4DL0C 1CBKA 2M5YA 2MKHA 4JS4A 3PKMA 2RE2A 4BRGA 3EDRB 4H4MA 1S0VA 1WUUA 2HFSA 1OS5A 3DLLL 2E44A 4JB8B 2IYGA 3QPIA 1WEXA 1D1UA 1NOZA 3N0VA 4ELTA 5C2FA 1SKRA 2IIHA 2B5JA 3W2WA 2GTDA 1APSA 2BOAA 4FVUA 4QYZK 4CH7A 1HFEL 4R79A 1CEZA 2D0OA 5ETSA 1E6YB 1K73T 3TRGA 2CPZA 4ELUA 4K2XA 2QMXA 2XNQA 2LQ8A 4EI2A 1GTEA 1WSHA 5KFBA 2XY6A 4HH0A 5CZ2A 1VQYA 1YTYA 2HHXA 4WFBL 4F3MA 1Q8KA 1XR5A 2ZGZA 3L7PA 5J1NA 3OSPA 4H0XB 3H46O 2Q36A 3CC4N 1FI4A 4WTYA 4LVNP 1HL6A 3GPAA 2B9EA 3O6QA 1VQ6S 2D4WA 2C2EA 4DV6J 2DHHA 4WYWA 2O3DA 2VFVA 2BUPA 2JHEA 4ANDA 5DLFA 3CCES 4DR5F 2ROGA 2V8HA 2IY5B 2FSJA 3MR7A 1UVKA 4RLEA 2IAJB 1U6FA 1JIHA 1M90O 2KI2A 4RU9A 4CGHA 2E1MC 1RDCA 5GAEI 1BA0A 4W5OA 3MK6A 5A0YA 1RT3B 4RL1A 4MKBA 1RU1A 3UR0A 2E5IA 5EVZA 5E3QA 1JB0C 3HSTB 1VQON 4ZPCA 4PG8A 4UY8T 2V5HG 1N5YB 5DK5A 3MAAB 2HHTA 5KFVA 4CZJA 3DC2A 3OXLA 5B0BA 4BRQA 3R2DJ 1IBMF 3O80A 1OVQA 3AJ2A 4ID8A 3M4XA 2RKIA 3SPZA 3Q83A 3CFRA 1UJ6A 3QEXA 1WKLA 1NB2A 3IBCB 2DEJA 2HFVA 3GCXP 5IM0B 3C6AA 3ICLA 3T7ZA 3DMJA 3CDUA 1QS4A 4HACA 2CQ4A 3J7ZT 1RXOB 4ZVHA 3CC2N 1BU6O 4PL8A 2KG0A 1H98A 2Z56B 2KZZA 2Y1RI 4FLXA 2NR0A 2AF6A 1WG4A 1PJ7A 4M1KA 3G10A 1VQ5S 3V6DA 3SCIE 1VRUB 2XY7A 4JV0A 4K4TA 2O5DA 3U1MA 3J81O 1X8DA 1UZDA 4DWIA 4NA1A 4LF7J 2BEFA 1L3TA 4CK1A 3QT5A 1IBCB 2XULA 1AA1B 3SCLE 2KJVA 3VF6A 1IKWA 2DJWA 3DLJA 2E1RA 2CJQA 2DPJA 1NSQA 4ISFA 3PYDA 3TWZA 3MCMA 5CYMA 1P90A 4FF4A 4OYPA 3QWUA 1N8RT 1I94F 3CJKA 1K44A 2NXEA 2B6AA 3P6YC 1CPZA 1GQEA 4FBTA 1RTJB 4J90A 2MPUA 2EWHA 2IBOA 3MCPA 1S1VB 2BXJA 4I7FB 2VD3A 3QGIA 4ANCA 2E5LF 6FD1A 3S9HA 3Q89A 2JLFA 2D74B 4K0KF 4PPDA 3B6OA 2CQ2A 5JXSA 3EE8A 2GJIA 2QX0A 4L74A 3CJ4A 3NGRA 4JI5F 4FWLA 4ZVOB 3RW6A 1FJCA 3B78A 4OHVA 3ZSWA 2C3MA 4JI5J 2NRRA 4UY8O 4DV1J 3UVJB 3LP0A 3B4DA 1NJXA 5GMDA 3UW1A 4Y2IA 5IWAK 1VSEA 2IM2A 1FJGJ 2RQKA 1QVGM 3WC2A 3PYGA 2I38A 4ID1A 4J2AA 3K7RA 5DGBA 4LR9A 4JI8K 3SQOP 1Q7YO 5G0RA 3IXQA 1Q4RA 4CDIA 4KHPF 4DTSA 1XBWA 3QMQA 1C0TA 1EQ0A 5J2MA 5C42B 1C0UA 2F8MA 3VGVA 3V6KA 4IOCL 3CE8A 1Z6RA 1M5PC 4JUZA 1GAOA 2YTCA 4DR5J 1F6TA 3AVIA 4USUA 3T6JA 3WC0A 1YJ9S 3HYFA 4O3PA 3SQGB 1YJNN 3KK2B 1ITGA 5IFMA 4ED2A 4PCQA 2UUBF 2KZMA 3MN9A 2VQEK 1ELOA 2CH6A 2BABA 2HKEA 5DRKA 3MPDA 2B4PA 2DHAA 3BBBA 3OLAA 2WBMA 4TQSA 2XRIA 2CG8A 1UWBA 3ET6B 3ADAC 4CZCA 2HSEB 4YOWA 4HUFA 5C0YA 3L2QA 1TGOA 1KLMA 3KLIB 1GEHA 2F9JA 5AQYA 2RH3A 4B3MJ 4OL8A 3A8EA 2HFOA 4ECVA 1S9EA 3N28A 3I6PA 4FJ9A 1XNQF 3HI9A 4LF5K 5LMUF 4QOTA 1TL3B 2FTRA 3B82A 2RILA 3F0NA 1Z4UA 3LDPA 4KE5A 1CLQA 4B1YB 4U67L 1KQSR 3ULDA 4KO0B 1HUXA 2G0IA 4RZRA 5THWA 3MHYA 2EC0A 3R5BA 4ILRA 3O5TB 1VQ8N 2VL1A 3PDNA 2PT0A 3MF5A 2NRXA 3ELHA 1RWVB 3DU5A 4L75A 4BVOA 3GYNA 1KHWA 4CIGA 4RW4B 2FZGB 2KM8C 3JXUA 1RUSA 2XZWA 1G7CB 5AQLA 2LQ9A 5C5JA 1OQ6A 2HHVA 4DTUA 5AQOA 1BCMA 1T9VA 3C46A 3PZPA 4WXOA 2FLNA 4LSZB 4X2BA 4CZEA 2IMOA 3FQKA 3GSDA 1XQIA 2C2KB 2OMOA 4DV3F 5KOXA 3VAHA 3D6MB 1DKGD 1ZBSA 4HR2A 4MO4A 2FC9A 5AXNA 2HB5A 2ZH6A 1X60A 2FBYA 1S49A 3ID6A 1Q9XA 3HP9A 2N7YA 3EGVA 4CEZA 4Q8EA 3I56N 4O0JA 2WVFA 4Q44A 1Q86T 3GYGA 5LOQA 2H51B 2AGQA 4BGAA 4WQ5A 2EI5A 2O8FA 5IS2A 1PBAA 3R3TA 4AE5A 2W9CA 4ECWA 2V2ZA 4NWBA 3GJTB 3OTOF 3MEGA 1RCXB 1S1TA 3ZX2A 1QSLA 4QAGA 4F4KA 2D3OR 4EP4A 1F1BB 4X62K 1VMBA 2DGXA 1HNWF 2HAFA 3NOGA 4OZNA 1IO2A 1NAQA 3U8XA 2MLZA 2V34A 3VAIA 4EBDA 4YDUA 4BR2A 3DRPA 3FBFA 1J5OA 1RISA 4F2RA 3QINA 3H2UB 2YPYA 1TL7B 2RJZA 2IDLA 1K8KB 3OJSA 2R8JA 2FD2A 4JI6F 3Q2TC 4C98A 4YR0A 3RRHA 4A8YA 2I9SA 3G6EN 1CG2A 1GOAA 4F04B 2G2YA 2F9WA 3DXMB 2JFKA 3TAFA 3NGYA 3UNYA 1RBUA 2CJ9A 4PXBA 4TU9A 2R2SA 4J5OA 2B7BB 4TLQA 1NGIA 2QEXN 1Y00A 2HFUA 3L4IA 4HL9A 2VFSA 4NLXA 3G71N 3DRRA 4DSLA 1DQ9A 2RMLA 2PI5A 3O9SA 1B0TA 1Y11A 1RBRA 3NF8A 4OX9F 4BRHA 4JI0J 2QZ8A 1BOTO 4LF4K 2BQ3A 3V81A 1ZPWX 1RCOB 3AODA 1RWNB 3QNNA 4PXCA 4CWBA 2AIRB 2Y1IA 3SQ4A 3WEEA 4B3RF 4E7LA 1RT4A 2IVNA 4BREA 5HLFB 2B3TB 4DPUA 5HRPA 4ZPWR 1CS4B 2P9GA 3JQJA 2E9RX 5BYRA 4LBPA 3VWSA 1AZSB 5GADU 3I5AA 3VERA 4CIEA 3VQSA 5AQTA 3KUEA 5J2PB 2BA9A 3VTIA 4DMZA 2DISA 1D5AA 3D54A 3SCXA 5IQ6A 2HZCA 3KLEA 3T41A 4CJTA 2BJEA 2RRBA 3QEWA 3HOTA 4USKA 3B8HA 4BS2A 3C95A 3D1QA 3W3DA 5E7OB 1ZBFA 2RF2B 2OPQA 5A2QU 1QUVA 4CH0S 1QQOA 3OYJA 5J2PA 1MDUB 1FDBA 2ZWHA 1SB6A 2JX2A 3O9QA 3HDSA 3DGPA 4MIBA 1K47A 3D2EB 4MQ3A 3PEJA 4CHYA 1S9GB 1OSDA 1KQGB 3FE1A 4DFMA 4DU3A 2JC1A 4CJ5A 4DUYJ 5C2DA 3LDSA 3ENAA 2YKOA 1RADB 3ZTPA 2UYTA 4V19S 1N5YA 5K8MA 3WT0A 5KG5A 2GO8A 5HVFA 4DU4A 5J2QB 4KHWA 1OH6A 1WF0A 1IUJA 2J9DA 2ZBCA 2Z0GA 4NXMK 4UOCA 1A5XA 5CYJA 4CTAB 3VQTA 4FZVA 3KG0A 4LRCA 4BDYA 5FJ4A 3CJRA 3UN5A 2ZH9A 5H9EJ 2XS5A 1S1UA 1SV5A 3AVMA 3TZWA 4M5DB 2AYGA 2MKJA 5HROB 4QIWD 4DLGA 1YI2S 4USMA 4FXDA 1DURA 2KN4A 2V0NA 1FF2A 3CIPA 5FLXY 3KHLA 1J9AA 4CJFA 4CLSA 2UXDF 2DVIA 1KDNA 4GVMA 1C1AA 3I82A 5IT4A 3UD3P 2HNDB 2UXDJ 3J7A1 5BJRA 3W9HA 4RR5A 3MM7B 3SYZA 2QWMA 1FCAA 4ECZA 3FZMA 2HGNA 2J7KA 2KFYA 4BG9A 3G25A 2PYJA 3DOMA 3QNWB 1SPBP 3ZO7A 2Q31A 3L3VA 2CQCA 3K5PA 4FWKA 5JLHA 2E9TA 1MROB 4R0JA 3BDEA 1KEKA 2P1JA 2R7UA 1RI7A 3Q2SC 2I5JB 1GT8A 2XS2A 1SQFA 1URRA 3V6HA 2XCAA 3O4WA 1TV6B 4FLTA 5AE2A 1T44A 5EHHA 5EWFA 3MXMA 4B3OA 3TVYA 3GOIA 1C6VA 1BQNA 2LYVA 3CQXA 1N33J 3G86A 1EQYA 3FK4A 1RBSA 3GU0A 4LQ3A 3S41A 3FZLA 2Q79A 4P2FA 5HQLA 5AQMA 2PFUA 2VFUA 3BZQA 1AZSA 2COLA 3IUCA 4O4GA 1ZM2A 2X1AA 2O8EA 2QWPA 2XMVA 3KK1A 1N5QA 1NBWA 3W60A 1NBEB 4OLAA 2JGUA 2ASDA 1HNVA 2LSNA 4J9MA 1FXRA 3MCNA 3MMJA 4URSA 3WUHA 4FF3A 1N6QA 3N4PA 1KAZA 1IKYB 2VGNA 1M1KO 2VPXB 1HNZJ 4XTTA 1MWZA 4HACB 4J9SA 2CPEA 3ZSZA 3PW4A 1RBAA 3AD9C 3WX4A 1B9FA 3A2FA 1X4FA 3AA5X 4BC5A 1TKDA 1VCTA 3DFEA 1ZXOA 2IVFB 1SH2A 3EYZA 1PYOB 3KWGA 5IT0A 4CP5A 1BC6A 4MK9A 3VGUA 2J5AA 4LF2A 5KFEA 4JI4K 4IG0B 3RRKA 3C2PA 2RQ4A 1D9DA 1JLBB 2CQDA 2BBEA 2F40A 5HMWA 2FF6A 4LFCJ 3NF6A 2WVBA 1KS2A 3SQ2A 2YNFA 4PA1A 3D3BJ 4DKWA 1GTHA 1XC3A 3AQPA 5DS7A 5E2QA 1WEZA 1RZMA 2H3EB 3NL0A 3SJJA 1VQNS 3NNCA 4LFAJ 5A0YB 2W01A 3GMGA 4JK9A 4JLHA 3VQAA 4DV7J 4PYAA 1VQMS 4CF2A 4IBNA 2FC0A 2RSQA 4RX6A 4UF4A 1YKWA 3QFHA 1JNZB 4J9NA 4GO7X 3I0RA 3QLHA 4MO5A 3QQCD 1E6VA 3MURP 3R1HA 3BQ1A 1W0HA 5KG2A 4HHUA 5C42A 1OPZA 3OD2A 1S4EA 1LWFB 4BRFA 5FDLB 3UKRB 2CNLB 3T1YJ 1S97A 3J81Y 2XHBA 2CDRB 3UCGA 5E41A 3K9KA 1SJQA 2ZH4A 1B70B 1FE4A 2ZM6K 2QKKA 4PG7A 3KKSA 2R9LA 1WI6A 3JAMY 3EVMA 2WK4A 2OO4A 4DR4F 2XB2D 3NS7B 1DGKN 4NCGA 1VK3A 2NNWA 5A8RB 1FRJA 2E20A 3D45A 3QAUA 2DGWA 3BF1A 2CXEA 1IBMK 5L1KA 2BM0A 4J2BA 3LPUA 2VKZG 2YKMB 4R8UB 1HLUA 2VQEF 1Q82T 1WJ9A 4HYKA 2DCUB 1TKXA 4DR1J 2YX4A 4ECRA 1UVJA 1HWLA 4K42A 1TZ0A 1WHWA 1WHYA 4WP9A 2UXCJ 3KD1E 4FJ5A 4QR0A 2C2NA 3KDOA 4RW4A 4C3LA 1N32K 4H8KA 3M8QB 1Q1KA 4DB3A 4USWA 1IBLF 2DCLA 3N6NA 3M30B 1RYSA 2XWYA 5CHCB 1X4BA 2K7JA 3HD2A 1Q82O 1R27B 4USTA 2P6SA 2CDQA 4JV5K 5KT4A 1JWWA 4ZVRB 1UVMA 2YV0X 3M2UA 4K2JA 3ENHA 4K4YA 4E7JA 4NLCA 5GAHP 4TY8B 5F8NA 3Q8VA 4RUCA 4J2DA 3DXKB 4FSVA 5I3PA 2DR9A 3TYTA 1HNXJ 3HPHA 1NDCA 4MYUA 2GGPB 2A41A 1U7LA 5H9FK 4JI7F 2IM3A 1SQGA 5AQVA 4JBCA 5IC6B 8AT1B 3QRRA 2AJFE 1NK4A 2GUPA 3NVKA 2VQFK 3G6ES 5L1IA 2HZVA 4YP3A 3IRWP 1WF2A 3VAGA 4LBIA 4QWCA 4C8KA 4FLYA 3BGRB 4K25A 1UL3A 2A18A 2M70A 4CNZA 4A4JA 1K8AT 2ATCB 1BQNB 4DR2J 5DG8A 1XN9A 2GMJA 3T1HJ 3J7YU 2W4DA 3D3CJ 2WFBA 1VSDA 3EJMA 3W9IA 1XHXA 4AILC 3E2EA 4BQZA 1GX5A 4DR3J 2LLZA 4FWSA 4GKKK 1U8WA 4ETXA 5KFLA 3WEEB 2WVDA 1S76D 3SI8A 3BM7A 4YS2A 1WEYA 3IBFB 4ZVGA 2I7NA 3OUYB 3ZTQA 4PEOA 3CJBA 3S01A 4H4OB 2QIFA 1FWPA 3PRVA 3O9UA 2DNYA 1OYEA 2X7IA 4NLGA 4CLUA 3DU6A 2YWEA 4E1JA 2G8KA 4LMZA 2FZCB 3IMXA 3VQ5A 1I6JA 4LSLA 1SIZA 1NKCA 4JN4A 5DZ7A 3QERA 3LP2A 2NQPA 5C24B 1TYQB 4KKOB 1LWFA 4DFPA 3FBBA 4DPWA 2VA3A 4YMEA 4DSEA 1AUDA 1VSJA 2ZOFA 3KMQA 1IKVA 2BJ9A 3KLHA 1X5SA 3G0ZA 2GJ2A 2G8UA 1GMWD 1X4HA 2C2MB 4PQAA 4FJHA 2OZSA 1T9WA 2QLWA 3BJYA 1LW0B 1C0FA 4M5KA 4J9PA 2MTLA 1OH8A 2WOMA 4LF1A 2H65B 4V1Ak 4HT7A 2IYIA 2RN2A 2MHEA 4K4UA 3ETMA 1G4CA 3GIMA 1F2GA 4PQUA 1SJRA 4KPCA 3MCSA 2V9WA 1EX4A 4Y3CA 3NGIA 1BE4A 4X62F 4F8RA 1V4SA 1NRKA 5FD1A 2RQMA 5BXIA 3JQMA 1Q81O 4OPJA 1UCNA 3VQBA 2YH0A 2GUIA 2UVVA 3FUYA 4FK4A 3DN9A 4DR7F 4IO1A 3H5SA 2O66A 1V3SA 3GJRB 4CGIA 3P5TL 5AJ3F 2MQLA 3QNOA 1NLKL 4OZ0A 2CQBA 4AL5A 4CJSA 4OLBA 3MD3A 3NWRA 2AW0A 3H5YA 4M41A 4CHPA 2PI4A 1WG5A 3ETOA 1GLLO 5DDOC 4N8NA 1K9MT 4LC9B 1RBVA 4S0MA 2FJAB 2B9XA 5AR0A 2HBJA 2ITGA 3KTQA 3MEEA 1C1BB 2FJVA 4C11A 1EZZB 4DR6F 4J37A 2M88A 1G15A 4JKFA 5AE3A 4X64F 3OQ2A 1TVRB 1XMOF 4G1PA 4B8AB 3HD1A 3C15B 5LMNK 4O3NA 5HN0A 4H5TA 2MZTA 4OZLA 3HFVA 3NRBA 1EHWA 2DGTA 2GNKA 2V8DA 3U4LA 1DTTB 1D8YA 4CIFA 4OX9K 2BW2A 2MQ8A 4WP8A 2HAIA 2XQCA 4WK1A 3U27A 4NLUA 1CLFA 3NBPA 1YRXA 4ZA1A 1VQ7S 2QWLA 4ENOA 2P9PA 4Q0BB 1LW2A 3O6WA 2JEFA 4RNOA 1YF5L 1U1OA 3IDHA 2YWFA 4AD6A 1WB9A 5BR8K 3QGHA 1D9AA 4KTQA 4UUXA 3TJ9A 1XR7A 2UV8G 3ILJA 2CJAA 3NY0A 1IR1A 4MMOA 2RKIB 2OSQA 2VC0A 2J0QD 2HHQA 2GFFA 3OXFA 2B4OA 2MQMA 4BROA 3PIPL 1VBXA 3AVJA 4XH4A 2HFZA 3D6TB 3VQQA 5HMXA 3JYTB 2FSKA 3GG0A 3LM2A 2ZVSA 2A6OA 4IR1A 1C4AA 3HHLD 4CLKA 2MQPA 4NYZA 3BGFA 3DRRB 2C3PA 2IM0A 4F25A 4BE2A 3GR0A 2BDPA 2F8SA 4HCCA 1RT2B 3QT7A 3ATUA 1FRKA 3I9ZA 4KRWA 1QQCA 4XDCA 3CQ8A 2F9DA 1OYDA 4FF2A 4UY85 4CZGA 1FTCA 2QL7B 3I33A 1IQZA 5KFDA 4OI4A 2E4LA 3G6VA 1QE1A 4K41A 1E3MA 3JQKA 3ITHB 2AGPA 5IV3A 1TL1B 3ZT2A 2V7ZA 4E2FB 2R2RA 3VQ8A 3DYAB 1VLOA 3QWPA 4TKTA 2K3KA 3TX0A 5BR9A 1S72N 3GSIA 3NFAA 4R5PB 5AZIB 4FPAA 1IBLK 2MZ1A 3MEDA 3P3DA 4PAAA 4K4WA 4WFNL 1Q0NA 5GAHU 4IO9L 5KG0A 4URQU 2XM3A 2GVZA 4ZN1A 1YVFA 4O44A 3OR1B 2IA0A 1T9TA 3TQEA 5LL6d 2HQIA 4RW7B 1N34J 3DRPB 4I6MA 1TKTB 3RBEA 1Y5IB 4CESA 5GIOA 4ISGA 1TMJA 4IOAQ 2OPQB 4C0HA 3UCUP 3M2VA 3KHGA 4QU7A 4FL9A 1RILA 4U7UK 2PN6A 3O1LA 2FBTA 2BRLA 1IBKK 2KHCA 1YITN 2DGQA 4CEOA 4DFKA 5JVGL 4BR9A 1RT6A 3ZTSA 1YTUA 3IFRA 4DPYA 1VQKN 1HPZB 2WC9A 3UVJA 4CJPA 4MFBA 1JL2A 4J7CA 1S4FA 1VBYA 3H3NO 3HBTA 4NASA 3OUYA 4Q5VA 3G2XA 4NB4A 4B3TK 4OYWA 1S1XA 2VF3A 2PIIA 5D4NA 1S10A 3LA0A 1MSWD 4CLWA 4FXVA 4PHTX 3WXMB 3DLGB 3R6GB 4L72B 4B3RK 3QGPA 2RVJA 2E2QA 1SJ1A 3UI3A 3DLEA 3J80O 3BO4A 4UQTA 3R1LA 2OA8A 4DS4A 1O13A 3DHWC 3S6EA 4U96A 4DV0J 1CULA 1AFIA 4CO3A 1FWKA 2X74A 3J81U 5F8GA 2HF3A 3TW0A 3LGNA 1JMTA 3VEVA 3TSUA 1QLNA 3M7VA 2YQ0A 4FOEA 4JKBA 3MTJA 4Y6IA 3CCSN 2E5LJ 4J9LA 5HP1A 3QZ7A 1H38A 5D0HA 2YJEA 3HJFA 5A8WA 3CW2C 3CJSA 4W4MA 1FW6A 2XMMA 3NS5A 2ZDOA 5C7PA 2Z2LA 4X66J 5M1KA 3CJ5A 2UUCJ 3TZYA 1UJ4A 4DV5K 3TANA 5BN8A 3NS6A 5B0GA 1KFDA 1SKWA 4B3OB 2ZFHA 3FDSA 1B9DA 2MXYA 4P2XA 3DDKA 5D0GA 2R7XA 4YY3K 2YWKA 4WYLA 4RTFD 2NXJA 1X4GA 3KK3B 1T02A 4O0IA 1DRZA 4G1QB 1JK9B 3M32B 2X78A 3GB0A 4ZITA 1VSLA 2MKIA 3FMWA 1XHZA 4NXNK 2VJUA 3VQ6A 1H72C 3MAHA 3SAHA 2JEIA 4H0TB 3QRQA 1ATSA 3ZZRA 1UKUA 1MU2A 2C1EB 4CLPA 4GKJK 4OPAA 1F9FA 1NGEA 1XNRK 2CQHA 3KJVB 1W2IA 4JYAK 4YB6A 3PIOL 5AJ3K 4AM6A 3LANA 3H25A 4QOZB 3KXDA 4RCHA 1NGJA 1B7FA 3KVGA 1ZTWA 3EXYA 2DKOB 5HL7L 5FLXO 5M1PA 1WSRA 1FEHA 1HKAA 4A8OA 4LSNA 2YKPA 3AD7C 3ZTRA 2QJ3A 2NUBA 4TLRA 2V4JB 5ETVA 1FJGF 4XH5A 3AAWB 1W26A 3E9LA 1XNQJ 2EXUA 1HBUB 3A1YG 4U7BA 2EVZA 4X64K 2EK1A 3VQPA 2VPWB 1HBMB 3R6MA 4OX6A 2OI2A 3N6LA 4AHTA 3AAPA 1CVJA 4IG0A 4RW6B 1J5EK 1CC8A 2ROPA 3QETA 3W7BA 4NLTA 1X4CA 4CW7B 1SQEA 1IKVB 3KLHB 4OV6A 3TP2A 3VAFA 4F4ZA 4C8OA 1FRIA 1NMNA 4OGCA 2LQ5A 4RJVA 4F9OA 1FTRA 1U1NA 3FGVA 5KG7A 1Q79A 3LP1A 1YGYA 2HMIB 1SL2A 2OTJN 1RWWB 3VQDA 1PYTA 1UP1A 5KFRA 5C12A 1HD0A 4N77A 1RCHA 1WOQA 3PW5A 3HPOA 4UW2A 2E5JA 3EKSA 4HEA9 4QWBA 3DLEB 2BW7A 3VAMA 3NH2A 4Q7AA 4P10A 4BDPA 3FZ2A 4JI2K 4NYFA 5SUHA 4AYBD 3RWUA 1ROFA 3ENWA 2O67A 5KFQA 3IA0A 3A3NB 5FIIA 2AQ4A 4JNEA 1YBTA 3HO1A 6FDRA 4KB7A 2G9OA 5AXLA 3C65A 4WFXA 3NCPA 5I3UA 4BRDA 1LFWA 3OYIA 4OZ5A 3HT0A 4U8YA 4OZ1A 3I4HX 3QEIA 2VB6A 1S57A 3AO2A 4ZPAA 4FJLA 4JK8A 2ASYA 1XEZA 3TAPA 4DL4A 2A3JA 1J54A 1HX1A 4ZHRB 4ZP8A 1N36J 2V68A 5CH7B 4E8UA 4QR1A 2ASMA 2JWKA 1FFSB 2HK2A 3KOAA 2IFXA 4LF8J 2HRYA 4AT1B 2YKAA 2HPUA 4CZKA 4JI1K 4CYUA 3KK2A 3FJ2A 2EFVA 3WQTA 4ECXA 4OPHA 1FK9A 1WI8A 1TKZB 4CERA 3G8QA 1QM9A 5AT1B 2KXFA 4Z7CA 1S0NA 2UU9K 2OTLN 3H1QA 3U3YA 4NZ0A 4A8FA 3RAMA 4BG8A 4ZTFA 5GMKa 1VK0A 1S79A 4CEAA 1X5PA 2GX8A 1WG1A 2M4MA 3GV7B 2LDYA 1DLOA 2IAJA 3Q7BA 3QESA 3ZLJA 2XHWA 1HQUA 4CLLA 2FBVA 3NKYA 1Q81T 4B3TF 2AYMA 1UVLA 5ITHA 4QS9A 1JLGB 4LUBA 4WCEQ 5KG4A 1NDPA 3M2RB 4DU1A 5DZ6A 1NSAA 4E7KA 1S1TB 4YOXA 1VJQA 2HYIB 1NK7A 1L3SA 2JZ5A 3BUZB 5EOYA 2HHUA 2ZWPA 4YOEA 4DZ6A 4CFBA 4L76A 4HWIA 2WRMA 4DV1F 3LGHA 2XS7A 5CAAA 2ZNZA 4PG4A 2D0CA 4U8VA 7FD1A 1IM4A 1T3NA 1RTJA 1WSGA 2YCHA 2P9PB 4C0OC 2DGUA 2G2OA 2RIJA 3MCOA 3MXHP 1M5SA 4JKGB 3QRPA 2W6KA 5LT5A 1RGVA 1EWQA 3CD6N 4PG6A 2KLAA 1WC1A 3E9PA 4MIAA 5AQXA 1RLDA 3C16B 3IMQJ 4LRFA 3T6BA 1NH8A 5HJXA 1ZZNA 4RUBA 2G8IA 4ILGB 1X9MA 5DQHA 4OV1A 4JEPA 1VQPN 3C6UA 4CGDA 3GE9A 4JKGA 2JDJA 4JI3K 1RGIA 1U25A 1T9XA 4P9SA 2RT3A 2HHWA 3P5JA 4ED6A 2OPSB 5AZJB 1I1GA 3P38A 4NI2A 1YUWA 2DNHA 2RQCA 3NF9A 1ATNA 2AMCB 3AGRA 1YDLA 3D1OA 2DB1A 3VVTA 2LXIA 4ICLB 4PWWA 3K5NA 2E2PA 4KO0A 3CDEA 5FPNA 2P5VA 3I31A 4YR3A 1UA1A 4P6QA 3WNEA 3OS0A 3ULEB 4B3MF 1X1PA 2JRSA 4QIGA 4L3NA 1TUYA 4F67A 4CF0A 2BKOA 2KXHA 1SCJB 4NLOA 2N4DA 2CPYA 3HVTA 4UOGA 4C9DA 3VEOA 5KT5A 5L39A 3Q7CA 1X5OA 5B0AA 2CJBA 2UUBK 2VG6B 4DL7A 3C8YA 4R8UA 4H0OA 3R5DA 2EKNA 4IFYA 1IR2A 2V6AA 2L3MA 3FFIB 2HIYA 1JLGA 1Z2ZA 3WZ0A 1IWAA 4XK8C 3HPGA 5KRSA 2G8FA 1F5CA 1TAQA 4OLOA 2RUSA 2RDJA 1H7WA 4E19A 2IC3B 5IWAF 2UUAK 1A7GE 2ZD1A 3LQVA 1NGDA 4EWTA 2KRRA 3NCRA 2Y1JA 4MH8A 1U09A 3CCVN 4LSLB 1HYSA 2W2PP 3EDQB 2RHKA 1QAXA 1QY7A 3CNQP 5CZVA 4E0DA 3W0LA 1GMWA 2O4IA 4LY7A 3MEGB 5A8KB 2YQ3A 5K20B 4BRCA 3DXSX 2M52A 2ZITA 3THYB 3EGZA 2KT2A 2XHCA 5ADXA 4A59A 2VPZB 2QKBA 2QI2A 3Q8PB 3GE1A 2DT9A 4V19J 1S1WA 2BTFA 1NG9A 2D9OA 1HWIA 1MW7A 1UA0A 3ZNUA 4F4WA 1PAUB 3OTOJ 1KVIA 2HVEA 3L4QA 2G0CA 4TU8A 2F7VA 1MWMA 3M8YA 1M5HA 1DBDA 1N33F 1NDKA 4BDZA 3SMPA 5A6WA 2IOCA 1R43A 2DFHA 2G2ZA 4QIEA 4I68A 1XJWB 1QDUB 1LXNA 1RU2A 4FZXC 2P9LA 4OFZA 4JKHA 2CFXA 5IV4A 5KFNA 3CMQA 3LO3A 4FJJA 1SC3B 2X3DA 2HBKA 3TOQA 1RQ0A 3SBTA 3HSCA 4OQJA 1OSCA 2U2FA 4JD2A 2O8FB 3MM9A 1OKJA 4CEDA 1NMEB 1LQ9A 5B0DA 5K14A 3IR7B 4JI6J 4G65A 1T9YA 2YNHB 3KMSA 1WSEA 4I7FA 4G6VB 1UFLA 4OYBA 1HMVB 5E3PA 3FR0A 4ZKAA 3HMJG 3LL3A 1HIYA 5KQDA 2QA4G 1M1KT 4DSKA 2E1PA 4ZJLA 2YHXA 3U1LA 4CM0A 3OHBA 3FSXA 3IWLA 2XGQA 4KHYA 1X9SA 1HI8A 5CR4A 2IHR1 2K1RB 3Q0AA 2JEGA 1I5OB 4GVLA 4OVLA 1T95A 2O1PA 2CPIA 1BIZA 2B8PA 2HMIA 4EEYA 3VQ7A 4GVBA 3PRDA 3I0SB 3NAIA 5HMZA 2NYHA 1NMDA 2ACYA 4DL2A 2CRLA 4NRUA 4WFBQ 1K9MO 1H2VZ 1REVA 2ZBPA 3VA0A 1B64A 1VRUA 3LAMA 1IH7A 5BRFA 1NGCA 4C1NI 2QRRA 3KK1B 2V94A 4JI8F 1XMQK 4LFBJ 3M30A 3HHLC 1HHTP 2HF4A 3EEQA 3QAEA 2R42A 3AHPA 3AVBA 3OYCA 2WW8A 4FJXA 4IO9Q 2BOPA 1WC4A 1O1WA 2ZHOA 2X1FA 4PUOA 4BC9A 2NSBA 2YX1A 2XMAA 1R6VA 1FFWB 1NZAA 2GIQA 4M63C 4QWAA 1DLOB 2VG7B 4ILJA 2P9EA 2IJNA 2B8QA 4CD3A 5ETTA 1W25A 3H59A 1TKXB 5KT6A 1UAWA 3JSYA 2AJ0A 4V19X 5ADXH 4Z4HA 1C0GA 5BN9A 4YOYA 2F1FA 2JOQA 1UWBB 2HWHA 5KFYA 2JWNA 1HWJA 3OFEA 4K4XA 2IVMA 4Z4EA 3AVKA 2I0XA 2KKHA 3PEHA 5A8KA 5GAGU 4HLBA 5B09A 1FE0A 5U47A 4DPTA 1ITPA 3MAQA 3F56A 2JVRA 4M5HA 2Q1LA 4C2MA 1NJYA 2ZJQL 4BR7A 2P9NB 2BQRA 3PJXA 1U26A 5F8LA 4I0WA 4N41A 1EARA 2FLPA 1WOPA 1VQ7N 5HROA 4D3HA 2Q3PA 1QAYA 5CHIA 3SI6A 2KO1A 5ETMA 4WFYA