4BC4A

Crystal structure of human d-xylulokinase in complex with d-xylulose
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
525
structure length
525
Chain Sequence
RRCCLGWDFSTQQVKVVAVDAELNVFYEESVHFDRDLPEFGTQGGVHVHKDGLTVTSPVLMWVQALDIILEKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLSPDLRLHQQLQDCFSISDCPVWMDSSTTAQCRQLEAAVGGAQALSCLTGSRAYERFTGNQIAKIYQQNPEAYSHTERISLVSSFAASLFLGSYSPIDYSDGSGMNLLQIQDKVWSQACLGACAPHLEEKLSPPVPSCSVVGAISSYYVQRYGFPPGCKVVAFTGDNPASLAGMRLEEGDIAVSLGTSDTLFLWLQEPMPALEGHIFCNPVDSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSKALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDVEVRALIEGQFMAKRIHAEGLGYRVMSKTKILATGGASHNREILQVLADVFDAPVYVIDTANSACVGSAYRAFHGLAGGTDVPFSEVVKLAPNPRLAATPSPGASQVYEALLPQYAKLEQRILSQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords XYLULOSE KINASE
publication title Structure and Function of Human Xylulokinase, an Enzyme with Important Roles in Carbohydrate Metabolism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 181
structure length 525
sequence length 525
chains with identical sequence B, C
ec nomenclature ec 2.7.1.17: Xylulokinase.
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00370 FGGY_N FGGY family of carbohydrate kinases, N-terminal domain
A PF02782 FGGY_C FGGY family of carbohydrate kinases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4bc4A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4bc4A01
3AAQA 3CERA 3ZEUA 1YVNA 4BR4A 3UKRB 2E88A 2YJEA 3VF4A 4FOEA 3DXKB 2E2OA 3VEWA 3O80A 4C23A 3IUCA 1BOTO 2QM1A 5LY3A 3VERA 5ELZA 1KAYA 4BGBA 4BRAA 2QWNA 1ATRA 1GLBG 2YHXA 1H1VA 1JCFA 3LL3A 1XUPO 4GY2B 2I7PA 4XH5A 1JCEA 3SJHA 4CD1A 4CI6A 2E20A 4B1WB 1GLAG 2FSNA 4BRHA 3FZKA 2YI1A 5EY4A 4BR9A 2P9NB 5KQ8A 4PKHA 2PBDA 2NZTA 3C7NB 2DPNA 3FZHA 5AQRA 1Z05A 2HF3A 4BRQA 1BG3A 1ZBSA 2P9KB 4BVPA 3FFKB 1RGIA 2OANA 4CZLA 1BO5O 3ZETA 4CZIA 4CJ7A 4IJNA 3J8AA 5AQGA 3AY9A 2WUSA 3KHYA 2A40A 3MN7A 1DGKN 4CZHA 3QMLA 4AM6A 3EN9A 3GL1A 5BRHA 1NGEA 4H0XB 5BN8A 2D1KA 2H3GX 2QWLA 4DB3A 3L6QA 4BR7A 3O5BA 3HBTA 4Z94A 3O6WA 3CJ1A 4BR2A 3ZX3A 3VOVA 4BRLA 4WYBA 2FXUA 4KBOA 4RCHA 2ITMA 5F1XA 5AZIB 1GLLO 4B1UB 2ZF5O 3WUHA 2I7NA 3HZ6A 3O1WA 5FPMA 4EFHA 1NGGA 4A2BA 2HMPA 3LM2A 2F9WA 1NLVA 4WQ5A 1HJOA 2GUPA 4B1YB 1YAGA 2YCHA 3EO3A 3MN9A 2P9LB 4HWIA 2E2NA 3O4WA 3QB0A 4FSVA 2NLXA 5E84A 3EKUA 4I6MA 4EHUA 4QS7A 2AP1A 3JS6A 3LDOA 1GLEG 4H0PA 3UKRA 5AQUA 3FZLA 2P9IB 2A6AA 3LDPA 3A5MC 3LDLA 5AQXA 3C0BA 3HM8A 3FGUA 1HLUA 3LDNA 2QXLA 4FWKA 4JAXA 2VYPA 3JXUA 2IIRA 3WXLA 2KHOA 1NGDA 5AQZA 5BN9A 2UYTA 2Q97A 5AQNA 1QZ5A 4M63C 1TYQA 4B1XB 4HTLA 3WQTA 4PL7A 2P9SB 3MN6A 4IZ9A 3VGKA 3GG4A 3MMVA 4PL8A 2PAVA 4H0YB 2D4WA 5AQTA 1S3XA 1XQSC 5AQFA 3L0QA 3AAPA 3I8BA 2CGKA 1G99A 4WQ4C 2P9PA 4FWMA 1KAXA 3ULEA 1R59O 3A5OC 5F0XA 1IJJA 5AZJB 2QWRA 2GWKA 2ASMA 3O1BA 2P9NA 3A8YA 2CGJA 4ISGA 1NGFA 3M6GA 3UB5A 2P9KA 3U4LA 1CZAN 1U2VB 3TU5A 4BRPA 1U6ZA 3GDQA 4K25A 3MK6A 3TPQA 4CD3A 4IJAA 3IFRA 5AQQA 5AQMA 4AM7A 3WEEB 1GLDG 3WXIA 1TUYA 4K42A 2VWBA 5F2RA 2NRHA 3H3NO 3W0LA 5AFUA 5AQLA 4O5FA 1BU6O 4BVOA 4JD2B 4JHDB 1NM1A 1JCGA 2ASOA 5I9EB 1RFQA 3VF2A 4CZGA 4FWLA 4BR5A 4BC4A 4FPBA 4CZFA 5ADXH 1BA1A 2D0PA 3M3ZA 5AQVA 3RSEB 5B8HA 1HKGA 3D2FA 1T44A 5AQHA 1GLFO 3ZX2A 3SMSA 1X3MA 3UKUB 3VEYA 4H0VB 2CH6A 5JMVA 5JLFA 5FPNA 4QS9A 5KQDA 2IVNA 1K8KA 3VEVA 3H6EA 1D4XA 4H5WA 1DEJA 3HSCA 3BUZB 1P8ZA 1LCUA 2Q0RA 4FOIA 4IXCA 1QQNA 2P9UA 3O08A 3FZFA 4L3QA 3VGMA 2W41A 4H5NA 4FO0A 4IO8A 4YDUA 3ZEUB 4BRNA 4MLHA 3CETA 3D2EB 2VCPA 2FF3B 4CBXA 1SZ2A 2E2QA 4BREA 2QW9A 2A41A 4CZMA 2A3ZA 5EOYA 3WXKA 5CE3A 3VPZA 1KXPA 5EX5A 5BPNA 4FWRA 3QBWA 4LC9B 5FPEA 1KAZA 4XEIA 3G25A 1EQYA 5BREA 3CIPA 3D7EO 3H3OB 1RDWX 2GELA 4GNIA 3UE5A 5AQKA 2YJFA 1ATNA 4O8KA 3M1FA 3WXJA 4A61A 4H0TB 3MN5A 5EXWA 4CZKA 1QQOA 1Z6RA 3BEXA 5AQIA 4CBWA 3U9ZA 3WT0A 2FSJA 3EKSA 2BTFA 4H5RA 4FWNA 5AQYA 1S22A 1BA0A 4DCHA 1HX1A 1T6CA 1TUUA 4FWPA 4BGAA 3S41A 3ZETB 2IVPA 1MA9B 1C0GA 1NGBA 3DXKA 2E8AA 2A5XA 4XH1A 3LDQA 2GEMA 4BQZA 4BRDA 4MO4A 4M7YA 1NBWA 4XH4A 3EZWA 3QDKA 4FWSA 1C0FA 2ZWHA 1ZC6A 2QWMA 2E2PA 4JHDA 1HPMA 3QFUA 3H45C 2GTDA 2Q0UA 5JICA 3SK3A 4IWVA 4FWQA 4K43A 4ISFA 1X9JA 1T6DA 5AQJA 5LJVA 3A5NC 3L4IA 5BRFA 3SLCA 1NGCA 3C7NA 4K41A 4JN4A 4B1VA 3R6MA 1DKGD 1HUXA 2BUPA 4WQ5C 4H0OA 1MWKA 4FWOA 2Q2RA 4BQLA 2Q31A 4MO5A 5AQOA 3FR0A 5AQWA 4M7XA 2AA4A 3SMPA 3DJCA 2QWOA 1WUAA 3I33A 3ID8A 4EIAA 3VEZA 4I6MB 1QHAA 4EHTA 3VETA 3DXMB 4BRMA 3D2EA 1MDUB 1NGHA 1ZXOA 3B8AX 3DAWA 4BRCA 3H46O 1QZ6A 2CH5A 4NO7A 3QBXA 1MWMA 2D0OA 2IVOA 3VENA 3GE1A 5KPTA 3OHRA 2V7YA 4BR0A 3BF3A 1TYQB 3QICA 3CJCA 4BROA 5AQPA 1E4FT 5BR9A 3U9DA 5AZIA 4BRGA 4FL9A 1LOTB 1Q18A 3A5LC 1BWFO 4J8FA 5ADXA 2P9PB 4RWTA 3ATUA 4H5VA 3ULEB 4B9QA 1J6ZA 3P4IA 3IMXA 3FE1A 3VESA 3CQXA 4CZJA 3VGLA 4A62A 3U8XA 3CI5A 3EL2A 4RTFD 1NMDA 3CJ9A 3O8MA 3R8EA 4B1ZA 2P9LA 2YHYA 5KPZA 2V52B 2Q1NA 4BG8A 3GBTA 4JNEA 1HKCA 4BRFA 4DHYA 5FPDA 3GOIA 4A2AA 1V4TA 1Y64A 1IG8A 2P9IA 2YHWA 1GLJO 3CQYA 1E4GT 3H1QA 2FLOA 1ATSA 2ZGZA 2HOEA 3CJAA 4H03B 4NB4A 4PKIA 3ZX0A 3ENOA 4BRKA 2P9SA 5BPMA 4BC3A 3IDHA 3DWLA 5BPLA 1HKBA 1OKJA 4CZEA 3MDQA 3QFPA 5EVZA 3D2FB 1WOQA 2ZGYA 1SQKA 2ASPA 4QS8A 4BC5A 1V4SA 4WQ4A 3KVGA 1XC3A 3AARA 3LM9A 5BRDA 5AZJA 1K8KB 2EWSA 3ENHA 1SAZA 2FSKA 4EAHD 2W40A 1NGJA 2V7ZA 2E1YA 2P9UB 1BUPA 1U2VA 5AR0A 4BRIA 2Q36A 4YDUC 3VEXA 1BDGA 2E1ZA 2V51B 4BC2A 3W3DA 3BP8A 3WEEA 4ISEA 3MCPA 3CHWA 1NWKA 2A42A 1QQMA 5LJWA 2J4RA 2CGLA 3ATVA 1NGIA 4H5TA 3DXMA 4JD2A 2HF4A 5AQSA 5TKYA 2GWJA 3R9PA 3HI0A 2QWQA 3CJ7A 1YXQA 3H1VX 3RSEA 1X3NA 3CJBA 3HTVA 3BF1A 4F9OA 1NGAA 3F9MA 3VF6A 4Y0WA 4BG9A 3UKUA 3KZBA 1GLCG 2F9TA 2FF6A 4MLEA 4E1JA 2QWPA 5E26A 4PKGA 1YUWA 4CBUA 3FLCO 4DQ8A 4FPAA 1ESVA 3FZMA 5KPRA 5JLHA 3VEOA 3WQUA 3A0IX 5AFUH
chains in the Genus database with same CATH superfamily
4NXMK 3AV9A 3AAQA 1Y97A 3PV8A 1NJZA 4FJJA 5C12A 3VF4A 1C6VA 3DLKA 4FOEA 2E2OA 3E1YA 3IUCA 3OYGA 4KTQA 4CGIA 5JS2A 4IDKA 4NCGA 3T1HK 1HNWK 3O9UA 4X62K 2QWNA 3R1XA 4KHQA 3DLHA 1ATRA 3MEDA 1GLBG 5FRNA 1XUPO 2I7PA 1O1WA 3MEGA 3LALA 4CF0A 5C10A 3M5RA 1KVAA 4XH5A 1JCEA 2HHQA 2NRWA 4B1WB 3U6FA 1S6PA 4CF2A 1VQPN 5EY4A 4BR9A 5KQ8A 1LWCA 2NZTA 3FZHA 1X9MA 1CZBA 5E41A 4ILJA 3LAMA 1VQ9N 1C1CA 1UAXA 4K8ZA 5I3UA 1RT7A 5AQGA 2OPPA 4CEEA 1ZYQA 2A40A 1XNQK 4CZHA 1Z26A 3EN9A 1RDAA 1SL1A 2GX9A 4H0XB 4HVJA 3ZSZA 3SAHA 4K8XA 1TKZA 5BN8A 3E66A 4DB3A 1Q81O 3L6QA 4DV0K 3MECA 3SPZA 1RNHA 3AVBA 2WFBA 1RT2A 3HBTA 2Y1IA 4BR2A 3ZX3A 4M45A 5FLXO 3VTHA 4FK4A 3TI0A 2FXUA 4RCHA 1VSEA 5F1XA 3CM5A 2I7NA 5H1SQ 1JJ2M 4NLBA 4JV5K 2HMPA 4CHYA 4KTWA 4LY7A 3AVKA 3LM2A 4A5AA 2GUPA 5SZTA 2YCHA 2W6LA 2VWJA 2KLAA 2YNIA 2NLXA 2HNDA 4EHUA 2WTUA 1QSYA 4LSNA 3R3LA 3UKRA 4KKOA 1RDCA 2P9IB 3HM8A 1T3VA 3FGUA 2O8BB 1SKWA 2VYPA 4CESA 1RTIA 3F2KA 3RRHA 5AQZA 2GBZA 4E3SA 5AQNA 4M63C 4B1XB 5C42A 3WQTA 4H0YB 1IBLK 3TAFA 2NRVA 3I8BA 1G99A 4WQ4C 2P9PA 3CFOA 3NCIA 1KAXA 2IOCA 2YKMA 4LF8K 1EKEA 1IJJA 5AZJB 2ASMA 1VQKN 3TAGA 3SQ4A 1KFDA 4L8RB 1NGFA 1BL3A 3M6GA 4M3TA 2P9KA 2ZJPL 1U2VB 4BRPA 3OYEA 3ZSXA 3GDQA 3PSIA 3T1AA 4IJAA 1SKSA 1JLGA 4R5PA 1TK5A 2HW3A 4A59A 1NJWA 3H3NO 4O5FA 4DV2K 4JHDB 2VQEK 5I9EB 1RFQA 4FPBA 1BA1A 1KCFA 1BQMA 3U3YA 3SV4A 1RILA 4IOXA 1T44A 1N32K 5AQHA 1GLFO 3P38A 5JVGL 5JMVA 5JLFA 3L2RA 1QQCA 3ALYA 1QVGM 1T05A 3VEVA 3AVGA 4AF1A 4H5WA 3HSCA 5FROA 3CFPA 2P9UA 4L3QA 2DFFA 5CHIA 5HROA 4DFMA 3CETA 4OVLA 4YOUA 1D5AA 1SZ2A 4GV6A 4BREA 3F5TA 1UWBA 2QW9A 4CJSA 5EOYA 3HJFA 4FJMA 3VPZA 5BPNA 3IKMA 5FPEA 1ZBUA 1VQ5N 2PFUA 3PUFA 2G8KA 1WSHA 3LP2A 4GVMA 3G25A 1I3AA 1FKOA 1J53A 3H3OB 1RT5A 1KVBA 4PWDA 3KWGA 1J5OA 3AVJA 4EZ9A 1YF5L 3NDKA 4DV6K 2F96A 3MN5A 1N5YA 4B9VA 4CZKA 4WCEL 2O4IA 2E5LK 2FSJA 4OKJA 3CG7A 4JKGA 4B9NA 4FWNA 5AQYA 3DI6A 2FBTA 1TUUA 3S41A 4E7LA 2IVPA 2B6AA 5AJ3K 4FLXA 2JWLA 2E8AA 1EO1A 1YJ9N 3M8PA 3KLFA 4FJXA 3LP1A 1YI2N 2HVHA 4MO4A 4G9ZA 3LDSA 2OZSA 4XH4A 3NHGA 4FWSA 2OA8A 2ZWHA 3TTDA 1T8EA 3DLRA 1ZC6A 2E2PA 2VG7A 4CF9A 4GV9A 2GTDA 5GINA 4FLUA 5C15A 1S6QA 5LJVA 3L4IA 4DLEA 3SLCA 4UY8O 4K41A 4JN4A 4B1VA 3R6MA 2F8SA 1HUXA 2BUPA 4F8RA 4H0OA 4GW6A 4B9LA 4DS4A 2ZJQL 3QEIA 1HNVA 3IG1A 1MU2A 2Q31A 3AGKA 3LPTA 3DJCA 3HO1A 3OYLA 2OPSA 4CK3A 1D8YA 1BGXT 4EHTA 3D2EA 4NCAA 1ZXOA 3OBYA 4BRCA 4CEOA 3THXB 2CH5A 4FJ8A 4ZTFA 2D0OA 1Q9XA 4KHYA 4CJLA 1WNSA 4DV1K 3OS2A 1IBMK 3TAPA 4WF9L 3BF3A 1TYQB 3QICA 3O9RA 4HCBA 2DY4A 1FKPA 1RBSA 4BROA 5AQPA 3NBPA 4X64K 1WSJA 2YX6A 1LOTB 1YTAA 3A5LC 1BWFO 3QEWA 5I42A 1Q86O 5M1PA 5ADXA 1WB9A 2AJQA 4B9QA 4B9UA 4RW7A 3IMXA 4J2EA 4A62A 3U8XA 3OYNA 1S1XA 4O0JA 2P5GA 3EL2A 3VQ5A 4RTFD 5C24A 3NF8A 4RW4A 4CHNA 2XHBA 1HNZK 2Q1NA 3GBTA 1NK0A 1HKCA 3CD6N 3AA4A 5FPDA 4NCBA 3KK3A 3DRRA 1TKDA 4KHSA 3HT3A 1ILYA 2P9IA 3ZT1A 2QA4N 3WNGA 1KD1O 1X9WA 2O8BA 1ITGA 4FM0A 4NB4A 3L2VA 5D3GA 4DTNA 2UXCK 1JLBA 3EY1A 4A5BA 1YITN 5IT9O 3MEEA 1OH8A 4PQUA 3IDHA 4AHCA 3VQ8A 4CZEA 4RW9A 4W5NA 4CERA 5SWMA 1OVQA 3D2FB 4YOWA 3KLHA 1RBRA 2QI2A 4CJVA 3THVA 5BRDA 1XHZA 5AZJA 3T3FA 2RPIA 1SAZA 4M3UA 4RG8A 1NGJA 1N8RO 2B5JA 4CGFA 1B9DA 4FK0A 1U2VA 5AR0A 1NOZA 1IH7A 1C0UA 2IAJA 3VEXA 3MWTA 3NFAA 1DT9A 5MLCQ 3BP8A 2HMIA 4DU3A 4LF7K 2HHUA 3HRGA 3CCRN 3PO5A 3O3FA 1QTMA 4CJKA 4LH4A 1TK0A 1T7PA 4B3MK 3HVRA 2OPRA 3KK7A 3TTFA 1JLQA 3V81A 1U47A 1YXQA 4B3RK 3SZ2A 2E6MA 2NRRA 4C1NI 4JKAA 4FW2A 3QERA 1NGAA 3F9MA 4CCHA 1A5WA 4Y0WA 1GLCG 2HSTA 4ILGB 3JYTA 3VQQA 2QWPA 3G10A 4PKGA 1CZ9A 3TAMA 1YUWA 3HXMA 1BQNA 4FPAA 1ESVA 3VEOA 3WQUA 3NE6A 3OS1A 3P31A 3CERA 3AO2A 4DMNA 4IOAL 4BR4A 3UKRB 4DV5K 2E88A 2G8IA 4X66K 3VEWA 3O80A 1KLNA 1FXXA 4PY5A 2OCEA 5ELZA 3SUOA 2QXFA 4BGBA 4BRAA 2OTJN 1U4BA 3L8BA 4LF4K 2YHXA 3PO4A 4M41A 3AVAA 5T7BA 3TANA 2D0CA 4YNQA 2E20A 4JI4K 4PKHA 3SQ0A 3C7NB 3I56N 1KRPA 2DPNA 5AQRA 2HF3A 4CHOA 3K59A 1BG3A 2P9KB 4DR7K 4YY3K 3RMCA 5C0YA 1JLEA 4BVPA 3AVHA 3FFKB 4JKCA 2HHTA 1RGIA 3KLEA 4CZLA 1BO5O 1F21A 4CJ7A 3L4QA 4OGEA 2WUSA 4ICLA 3MN7A 4GVEA 4DQSA 4CJRA 3QMLA 3CCEN 1C1BA 3GL1A 4B8CA 4HTUA 3K5MA 3Q7CA 2D1KA 2QWLA 3TSQA 3H08A 3AVIA 3SBGA 1LW0A 4FJNA 4Z94A 3O6WA 3OJSA 4HHTA 1TKXA 3VOVA 1D9DA 4CJFA 4KBOA 2EX3A 2HVIA 3OYBA 1QE1A 4H4MA 4AHSA 1WAJA 4TSXA 4A2BA 1VQ7N 4JI5K 3J7AP 4E89A 2HHWA 2F9WA 4WQ5A 1HJOA 4B1YB 4H4OA 3MN9A 4DQRA 4DFJA 5GIOA 3T19A 5HRRA 1S5JA 4DFKA 3OS0A 2AP1A 3JS6A 1JLAA 4B08A 3THXA 1NK6A 2XO7A 3A5MC 3LDLA 2F4VK 3C0BA 1HLUA 2KHOA 4OKKA 2FBVA 4H8KA 4JI0K 1QZ5A 3DRSA 1TYQA 4HTLA 4GMJB 4LD0A 1IG9A 4IFYA 4Z4IA 3VGKA 2YNGA 4PL8A 5KGWA 2IC3A 1VSMA 2F7TA 3THYB 1S3XA 1XQSC 3L0QA 3OYDA 4E0DA 4FWMA 5F0XA 3A5OC 4CECA 3E9LA 4IG0A 1TVRA 5HRSA 4DR1K 1OH6A 1OVYA 2UUBK 4CK1A 4ISGA 3LAKA 3NH0A 4O44A 3U4LA 1U6ZA 3K2PA 4K25A 3MK6A 4FJLA 2BGGA 4DR3K 5AQQA 1Q82O 4AM7A 1GLDG 3WXIA 3C6HA 4K42A 1UA0A 2OTLN 4FJHA 5F2RA 2NRHA 3W0LA 5AFUA 4FZXC 1NK8A 4JKDA 3DM2A 3QINA 4JD2B 1BIUA 3ZSRA 4WE1A 1JXEA 4YOXA 4FWLA 4MFBA 4BC4A 5BR8K 3RSEB 3V9ZA 1HKGA 3ENBA 3D2FA 3VEYA 4W5OA 3EZ5A 1SL2A 4W5RA 4HUGA 5FPNA 3IRXA 5DM7L 4CJWA 4O5BA 1S72N 2JLEA 2XRIA 3G0ZA 3H6EA 4B3OA 1D4XA 1XNRK 1DEJA 2JGUA 1HYSA 1P8ZA 2E4LA 1W2BM 2DFHA 3FZFA 1OH5A 3MXMA 4LF9K 2W41A 3TTCA 1QSLA 4IO8A 4YDUA 4BRNA 4MLHA 3D2EB 2VCPA 1S1VA 4JRPA 2FF3B 3J7YP 2P1JA 1ZBIA 4LH5A 3CCMN 2O8DB 2GV9A 5CE3A 1KXPA 5EX5A 2OPQA 4LC9B 3QBWA 4PHTX 1KAZA 1IV0A 5DMRA 5BREA 3CIPA 3D7EO 1RDWX 2GELA 4HUFA 4DV3K 5AQKA 4CEDA 4DUZK 3SYZA 4LF6K 3CCUN 3M1FA 1VSKA 4B3TK 4H0TB 4KTZA 4F3OA 5TKWA 1QQOA 3NGYA 3M8QA 4BE0A 2BTFA 2DTUA 3SJJA 2NRZA 4OPKA 1NK7A 1S22A 1B9FA 4B3SK 1HX1A 1T6CA 5GAHP 3ZETB 1KSPA 3OW2M 1IKWA 4GKJK 1MA9B 3OYMA 3CXCM 4XH1A 1TAUA 1EXQA 3LDQA 4AH9A 4BQZA 1HPZA 3CC4N 4F2RA 1ZBHA 3K58A 5J2QA 1WSFA 1C0FA 2QWMA 3JAMO 2R7YA 3CCLN 3H45C 1QVFM 1KTQA 2Q0UA 3SK3A 4IWVA 1L3VA 4DKWA 1VQLN 3TARA 5BRFA 3RMDA 3C7NA 3Q7BA 3DOKA 4DR4K 1VQON 4DFPA 5FDLA 1MWKA 2Q2RA 4BQLA 4QOZB 1BCMA 5AQWA 1G15A 4M7XA 5DK5A 4CFCA 1VQNN 4I6MB 2ZE2A 2WONA 4B9MA 4BRMA 4DSFA 1MDUB 3B8AX 4ELTA 5GIPA 1QZ6A 3QBXA 3ZSWA 4X65K 2XY8A 3VENA 5GAGP 3GE1A 2E6LA 4FVMA 3OHRA 1DLOA 2V7YA 3ZYYX 3WNFA 4KH5A 4DU1A 4CIFA 1E4FT 5BR9A 3NF6A 4OPJA 4JI3K 4Z4GA 4RWTA 1TL1A 4H5VA 3ULEB 3S3OA 3P4IA 3FE1A 1LV5A 3VESA 4CZJA 3VGLA 3O3HA 3PY8A 4KI6A 4Z0UA 1S1WA 3R8EA 1NJYA 2V52B 3DLGA 4NYFA 4KH6A 3DLLL 3GOIA 4A2AA 1JL1A 4FM2A 1V4TA 4IFEA 3LANA 2YV0X 1VAZA 1NK9A 3PIPL 2A1RA 3HYFA 3THWB 4R79A 3UIQA 4CHPA 1RTDA 4BRKA 1RDBA 3HOSA 4C8KA 3DWLA 1HKBA 1D9FA 1UA1A 2ZM6K 3THYA 5M1OA 1WOQA 3ZSOA 1YVUA 2ASPA 4KFBA 4QS8A 4DV4K 3DYAA 3C95A 4WFAL 4WQ4A 1R0AA 3L2QA 2HBKA 3S3MA 1KC8O 3VA3A 2EWSA 3V6DA 3KK2A 1L5UA 3IS9A 2FSKA 4EAHD 4DTMA 1NKEA 4CIGA 2Q36A 2V51B 4IOCL 4I7FA 1WSEA 3OYIA 3P1GA 1O13A 1EP4A 3QEXA 1QQMA 4IO9L 3ZCMA 3BGRA 1XHXA 5J2PA 2CGLA 3ATVA 4JD2A 3KKRA 3DXMA 4H5TA 4CGDA 5TKYA 3CPEA 4CEZA 3WNHA 2QWQA 3KLGA 1K73O 3K9JA 3RSEA 3CJBA 3BF1A 4F9OA 4MQ3A 3EYZA 5EU7A 2BANA 3AO5A 4BG9A 4C1NK 3PSFA 2O8CB 2F9TA 2FF6A 4MLEA 4HUEA 3D6RA 3OVNA 4M3YA 3C94A 3CCQN 4EP4A 3VTIA 3FZMA 2BH1A 3RMBA 3A0IX 1BA0A 3DOLA 1YHQN 1K9MO 4KRFA 1ASUA 2KZZA 4XIUA 3U3GA 4Z4EA 3P39A 2YJEA 2OZMA 3DXKB 4C23A 2KW4A 3NGIA 1BOTO 5KTQA 2QM1A 5LY3A 2I5JA 2O8DA 3SNNA 1KAYA 5M1KA 1L3UA 2HNZA 4BDZA 2VQFK 1H1VA 3LL3A 3WXMB 5M1NA 4F4KA 3SJHA 4E19A 4CI6A 1WAFA 1GLAG 3FZKA 2VGMA 4CEFA 1Z05A 4BRQA 4JLHA 3BZKA 3RVCA 4KI4A 4CGJA 4CHQA 1U04A 3ZETA 4AHRA 4DTRA 3CMEN 2O8FB 1TAQA 3KHYA 4C8OA 2HBLA 4JEPA 2G8FA 1IKVA 4KAZA 5BRHA 1NGEA 4CF8A 1GOCA 4BE1A 1GOAA 3QNNA 2H3GX 4OKEA 3L3VA 4FXDA 3CMAN 5HOOA 3JSMA 1YT3A 1YJWN 3MCAB 1I39A 3O5BA 4MDBA 4BR7A 1TGOA 4U67L 5DM6L 4DTUA 4BRLA 1KFSA 2BDPA 2ITMA 1JKHA 4DTSA 2IGIA 5AZIB 2B4JA 3WUHA 2UUCK 1VSJA 3HZ6A 4O0IA 4E7KA 1NGGA 1LWFA 4FM1A 1RDUA 4CEQA 2HHHK 1W9HA 3ZSYA 4I9LA 4DLGA 3ZT0A 3EO3A 2OYQA 4HWIA 1RT6A 2RKIA 3QB0A 3AO4A 4DS5A 4I6MA 3RWUA 4JKBA 2F8TA 1S1UA 3AA3A 3LDOA 3QO9A 1GLEG 4DG1A 2KFZA 3N4QA 4E1MA 5CZ2A 5C25A 4CJ4A 3AVFA 1YTUA 3LDNA 2QXLA 5HRPA 5HLFA 3PLAA 2IIRA 3WXLA 1NGDA 5BN9A 2UYTA 2Q97A 4O55A 4OJRA 2Z1GA 3VQCA 3BDPA 3LWMA 1NOYA 5M1QA 2X6SA 3MN6A 3MMVA 5AQTA 4E7HA 4DSLA 3AAPA 3MXIA 1RT3A 3ULEA 2ATQA 3NAEA 3VQDA 3WNEA 3QEPA 2QWRA 4N41A 2GWKA 2D0BA 2WC9A 3O1BA 2P9NA 3A8YA 3ZT3A 3UB5A 4JKHA 4QAGA 1CZAN 3TU5A 3TPQA 4FLZA 4CD3A 3B6OA 3IFRA 1HNXK 1NU0A 5AQMA 1NNEA 1JL2A 4Y1DA 3WEEB 4NXNK 3BY5A 1TUYA 5J2NA 2VWBA 3NH1A 1IO2A 1HQEA 4DSIA 4Z4CA 5AQLA 1BU6O 4BVOA 1NM1A 3VN5A 2ASOA 3SI6A 4CZGA 3THWA 3O9TA 4BR5A 4Z4FA 5ADXH 4FZYA 3TAEA 4FLTA 5AQVA 4JS4A 1YJNN 3G71N 3QIPA 3SMSA 3ASMA 1X3MA 4GKKK 2NUBA 3UKUB 2W42A 4H0VB 2CH6A 3MX2A 1CXUA 1DTQA 5KQDA 2IVNA 1N36K 3CM6A 3B6PA 4J2DA 1N6QA 1U49A 4JRQA 1C1AA 1LCUA 2QKBA 4FOIA 4IXCA 4G1QA 4KHPK 2XY6A 1LAWA 3VGMA 4FO0A 3ZEUB 3OTOK 2QKKA 1C0MA 4CBXA 2E2QA 2Z1JA 2UXDK 5A2QO 1RT4A 2XY5A 3WXKA 3VQBA 3DLEA 4FWRA 3J80O 4N76A 4XEIA 3C6AA 4WFNL 4OLBA 3V1QA 1RTHA 4GNIA 3UE5A 4DQPA 1SKRA 4FZZA 1X1PA 3EE8A 3WXJA 2O8CA 3HPOA 1CLQA 1WLJA 1NKBA 5AQIA 3BEXA 1VSIA 4CBWA 5KGXA 4KHUA 3VQEA 3J81O 3EKSA 3NF9A 4H5RA 2XY7A 4BDYA 4JI8K 4DCHA 4BGAA 3SPYA 4DF8A 1C0GA 1NGBA 3DXKA 4NYNA 2A5XA 2ZJRL 3AVMA 3NMUA 2W6KA 4AHUA 4CJQA 1WBDA 3QNOA 2HNYA 1XWLA 3LZIA 3ITHA 3OJUA 1DTTA 2FBYA 4M7YA 1NBWA 2VG5A 4IEEA 4BE2A 2HHSA 3AO1A 1HPMA 4DSEA 3QFUA 1RBTA 2KQ2A 1SV5A 5JICA 2ZD1A 3HP6A 4PA1A 4K43A 4ISFA 3G6EN 1X9JA 1T6DA 2YHBA 4M3RA 4JK8A 1JXBA 1GOBA 1NGCA 1K6YA 1HYZA 3KD1E 1DKGD 4BY9C 4DV7K 4BACA 3K5OA 3BZCA 1BI4B 5AQOA 1VQMN 4CJ5A 5FRMA 2O8FA 2AA4A 4JI1K 2QWOA 1WUAA 3ID8A 4EIAA 1QHAA 3VETA 3DXMB 1B92A 5LL6Z 1P90A 1NGHA 2D5RA 2RE2A 1E3MA 3DAWA 3H46O 4NO7A 3HK2A 2VWKA 3D45A 3ZT4A 3AVLA 5KPTA 4C8LA 3OYJA 4CIEA 3SUQA 3SAGA 2VGNA 4FLYA 4CJ3A 1QSSA 4BR0A 3VQPA 1T03A 3CJCA 3QESA 5AZIA 4E1NA 3TSUA 4BRGA 1Q18A 4FLVA 4YOTA 2EHGA 1J6ZA 3AA2A 3CQXA 1L3SA 3CF5L 2Q3SA 4DU4A 2NRTA 3QEVA 1W7AA 3TR8A 3CJ9A 4B1ZA 2HHXA 2YHYA 3OYKA 4N47A 3O4QA 3SV3A 5KPZA 1RBUA 2JWKA 1Z25A 4JNEA 3SQ2A 1VQ4N 4FJ5A 3FFIA 2A1SA 1I94K 5HP1A 2X78A 2QK9A 1GLJO 4IG3A 4U7BA 3NVKA 1ASVA 3CQYA 4CFBA 4CFAA 2FLOA 4DF4A 1ATSA 2QTDA 3KD5E 4JKFA 3CJAA 4H03B 4CEBA 1RTJA 3ZX0A 3O9SA 2PY5A 4LFCK 4KHNA 5BPMA 4BC3A 1N34K 5BPLA 4KV8A 1X9SA 3MDQA 3CCVN 1TV6A 3CCSN 2ZGYA 2QEXN 1SQKA 1LAVA 4I2PA 4BC5A 1J5EK 2NNWA 5K14A 1QHTA 1Q9YA 3HVTA 4DTPA 1K8KB 4CHZA 3ZLJA 4ZHRA 2W40A 2V7ZA 2E1YA 3MAQA 3MWPA 4BRIA 4YHHK 2E1ZA 4BC2A 5HRNA 1S9GA 3W3DA 4JK7A 3ID6A 3WEEA 4CW7B 4ISEA 3MCPA 2O8EB 3OYFA 4J2BA 1VSFA 2J4RA 4B8AB 1VHXA 4N56A 3TABA 3TSPA 4YORA 3IAYA 3OY9A 3CJ7A 3HL8A 4DR6K 4IFVA 3NF7A 3VF6A 1KQSM 3UKUA 3LWLA 3KZBA 4E1JA 4CJUA 3L2UA 3O4NA 5E26A 4J2AA 3K9KA 4OX9K 4AHVA 4CBUA 3L2WA 1TL3A 3FLCO 4CJPA 3V9WA 4FJ9A 1RT1A 4LSLA 4Z4HA 5HL7L 1S1TA 5AFUH 1BIZA 1RDDA 3J7ZO 3ZEUA 1YVNA 3OA9A 1LWEA 5IWAK 5CY4A 3RR8A 1M1KO 1ZBFA 3VERA 3PX4A 2IS3A 5J2MA 2HBJA 2P51A 3PX6A 2PYLA 3RTVA 1JCFA 4FK2A 4GY2B 4CGGA 4CGHA 4OO1J 4ILHA 4ELVA 4CD1A 3HPGA 1NKCA 2G8WA 4EZ6A 4LF5K 2FSNA 4BRHA 2YI1A 4Q0BA 3LPUA 2KTQA 2P9NB 2PBDA 1SUQA 1ZBSA 4C8MA 3RRGA 4RW6A 4DQIA 4JI2K 2OANA 3HPHA 4CZIA 4IJNA 3J8AA 4O4GA 3AY9A 1DGKN 4B9TA 4AM6A 3PIOL 3O9QA 4FW1A 3HOTA 2YKNA 2PYJA 5HBMA 4DUYK 4CF1A 4IKFA 3QIOA 2G8UA 5JS1A 4DTOA 3CJ1A 3K0SA 2UU9K 4WYBA 3P5JA 3V1OA 1VQ8N 3CPWM 3I0SA 1GLLO 4B1UB 2ZF5O 3K5NA 1VRTA 3RMAA 3O1WA 5FPMA 4EFHA 1RCHA 4MDAA 4WFBL 3C6UA 5CYQA 1NLVA 3ZSQA 1ASWA 4GV3A 1YAGA 4F2SA 1BI4A 2Z1HA 2HBMA 1EWQA 2P9LB 4Y1CA 2E2NA 3O4WA 2UUAK 4FSVA 5E84A 3EKUA 4EP5A 4QS7A 3G4SN 3SUNA 4H0PA 3DLBA 5AQUA 3FZLA 5AQXA 2A6AA 3LDPA 4JI6K 4FJIA 3NH2A 4FWKA 4JAXA 4A57A 1KLMA 3JXUA 1REVA 2FC0A 4Q5VA 4CJTA 1QS4A 4PL7A 3I8DA 1HRHA 2P9SB 4JK9A 2WBNA 4IZ9A 3GG4A 4AILC 2PAVA 1XMQK 2D4WA 3HP9A 5AQFA 3F9KA 2YNHA 2CGKA 1WSGA 1HYVA 1IKXA 1R59O 1VSDA 4CEAA 3LP3A 4FJ7A 4OPHA 2P5OA 4KB1A 2CGJA 4UQGA 1Q7YO 3VQAA 2O4GA 3E01A 4YFUA 1NK4A 3V9SA 4W5QA 3SBTA 3I0RA 3T7ZA 2HB5A 1TKTA 4IEIA 5C2FA 1CXQA 1JCGA 4QCLA 3ZSVA 3VF2A 3CFRA 3NGZA 5CR4A 4CZFA 2KZMA 5J1EA 2D0PA 1A5VA 1A5XA 3EE9A 3M3ZA 4NLCA 3VA0A 4FYDA 4M3XA 3SQ1A 4CE9A 5B8HA 4DTXA 3OBWA 2NRXA 3HSTB 4IBNA 3ZX2A 1HR0K 4JI7K 1ZBLA 3AVNA 1NJXA 3V4IA 4M42A 4QS9A 1YIJN 3DMJA 1BCOA 1K8KA 3TWHA 3KKSA 4ID1A 1NMNA 4OGCA 5GAEP 1SL0A 4DTJA 4E7IA 3BUZB 2WOMA 2G8HA 2ZQBA 2Q0RA 3D0PA 1QQNA 3O08A 1LW2A 3C65A 4H5NA 3C6TA 1J54A 2O8EA 4OLAA 2A41A 4CZMA 4K0KK 2A3ZA 5LMNK 2X74A 4AQYK 2GUIA 3VMFB 3OYAA 4KH4A 4FLWA 1J9AA 1HNIA 3MX5A 5CYMA 5LMUK 2RN2A 1EQYA 4BDPA 3QETA 1RBVA 3M8SA 4F3TA 2Z1IA 1EX4A 1VSHA 2YJFA 1ATNA 3AVCA 5C2DA 4O8KA 5GADP 4FCYA 4A61A 4DSKA 1EETA 4LFAK 5EXWA 1Z6RA 1IKYA 3U9ZA 3WT0A 4DR2K 3S9HA 4I9QA 3M8RA 3KIOA 4M3WA 1S9EA 1IBKK 2X6NA 3V9UA 1JLFA 1XMOK 4FWPA 1U48A 1UOCA 3K57A 4CK2A 1FJGK 1JLCA 3L3UA 4KHWA 3ZT2A 3S3NA 3P83D 2GEMA 1VQ6N 4DQQA 3A2FA 1HMVA 3MXJA 4BRDA 3SUPA 4KPYA 1NG9A 3EEQA 3EZWA 3QDKA 1KVCA 4JHDA 5M1FA 2YHAA 4FWQA 5AQJA 2D0AA 3A5NC 2RHKA 1VRUA 3VQ9A 1VSLA 2G8VA 4WQ5C 4YOYA 4FWOA 1WN7A 4JYAK 4JKEA 1M90O 4MO5A 4BWJA 4I2QA 3FR0A 3T1YK 3DRPA 3V9XA 1XI1A 3SMPA 3I33A 3VEZA 3V1RA 1VK0A 3ULDA 4AHTA 3CC7N 2UXBK 1MWMA 2IVOA 3PX0A 3I55N 1BHLA 4IDHA 4M3ZA 4N5SA 5KI6A 3LP0A 2Y1JA 1U45A 4ELUA 3CCJN 4E7JA 3U9DA 3K5LA 5KRTA 4OPAA 4J8FA 2P9PB 3ATUA 3HM9A 4O8UA 2LSNA 3VQ7A 3AGRA 3CI5A 5JVHL 1K8AO 1NMDA 3O8MA 2P9LA 2VG6A 3CC2N 4BWMA 4C8NA 3KTQA 4BG8A 4BRFA 4DHYA 2DFEA 3SAFA 3CQ8A 1Y64A 1IG8A 3OYHA 2YHWA 1OH7A 1E4GT 3H1QA 5KRSA 4DWIA 4CJEA 3KK1A 1WSIA 1NK5A 2ZGZA 2KKZA 3LZJA 2HOEA 3QLHA 1Q8IA 3KWIA 4PKIA 2KFNA 3ENOA 2P9SA 1W97L 3NVMA 4KO0A 4CVNE 3CYMA 4W5TA 1OKJA 4B9SA 4FJKA 4JS5A 3QFPA 5EVZA 3ISNC 3E9PA 1V4SA 3OYCA 2BE2A 3KVGA 1XC3A 3AARA 3LM9A 3SCXA 1EWRA 3O3GA 3E9OA 1FW6A 3ENHA 3KLIA 1BISA 4CFDA 3RR7A 3TAQA 4FVUA 2PZSA 1FK9A 2P9UB 1BUPA 4ID5A 2YNFA 3KJVA 1TK8A 4YDUC 1BDGA 2IDOA 4DSJA 3T69A 1WBBA 2FBXA 3CHWA 4ZTJA 1N33K 3AO3A 1NWKA 4RW8A 2A42A 4PUOA 1L3TA 5LJWA 1XC9A 2RF2A 3VQ6A 1SS6A 1NGIA 4KB0A 2HF4A 5AQSA 2GWJA 4KREA 4HCCA 2ETJA 3R9PA 3HI0A 3AA5X 1W0HA 3H1VX 3VQ4A 1X3NA 3HTVA 4LFBK 4V19S 2ITGA 1NJIO 1HQUA 4DR5K 1HJRA 4FJGA 5CZ1A 4DQ8A 1C0TA 4JKGB 4YOVA 5KPRA 5JLHA 2HHVA 3F73A 3N4PA 4FL9A
chains in the Genus database with same CATH topology
1YHQN 1K9MO 3P31A 3AAQA 3CERA 3J7ZO 3ZEUA 4IOAL 1YVNA 4BR4A 3OA9A 3UKRB 2E88A 2YJEA 3P39A 3VF4A 5C12A 4FOEA 3DXKB 2E2OA 3VEWA 3O80A 4C23A 1M1KO 3E1YA 1BOTO 3IUCA 2QM1A 5LY3A 3VERA 5ELZA 1KAYA 2HBJA 3O9UA 4BGBA 4BRAA 5M1KA 2OTJN 2QWNA 3R1XA 1ATRA 1GLBG 2YHXA 1H1VA 1JCFA 3LL3A 1XUPO 4GY2B 2I7PA 3WXMB 5C10A 3M5RA 4XH5A 4OO1J 1JCEA 5M1NA 4ILHA 3SJHA 4CD1A 4CI6A 2NRWA 2E20A 4B1WB 1GLAG 2FSNA 4BRHA 3FZKA 2YI1A 1VQPN 5EY4A 4BR9A 2P9NB 5KQ8A 2VGMA 4PKHA 2PBDA 2NZTA 3C7NB 3I56N 2DPNA 3FZHA 5AQRA 1Z05A 2HF3A 4BRQA 1BG3A 1ZBSA 2P9KB 4ILJA 5C0YA 1VQ9N 3RVCA 4BVPA 3FFKB 4JKCA 1RGIA 2OANA 4CZLA 1BO5O 3ZETA 4CZIA 3CMEN 4CJ7A 4IJNA 3L4QA 3J8AA 5AQGA 3AY9A 2WUSA 3KHYA 2A40A 2HBLA 3MN7A 4GVEA 1DGKN 4JEPA 4CZHA 3QMLA 4AM6A 3PIOL 3CCEN 3EN9A 3GL1A 3O9QA 5BRHA 1NGEA 3HOTA 2GX9A 4H0XB 3SAHA 3Q7CA 5BN8A 2D1KA 3E66A 2H3GX 2QWLA 4DB3A 1Q81O 3TSQA 3L6QA 3CMAN 5HOOA 1YJWN 3MCAB 2WFBA 3O5BA 4MDBA 3SBGA 3HBTA 4BR7A 4Z94A 3O6WA 4U67L 3CJ1A 4BR2A 3ZX3A 5DM6L 3VOVA 3VTHA 4WYBA 4BRLA 2FXUA 4KBOA 4RCHA 2ITMA 5F1XA 1VQ8N 5AZIB 3CPWM 1GLLO 4B1UB 2ZF5O 3WUHA 2I7NA 3HZ6A 5H1SQ 3O1WA 5FPMA 4EFHA 1JJ2M 1NGGA 4NLBA 4A2BA 1VQ7N 2HMPA 1RDUA 4MDAA 4WFBL 3LM2A 2F9WA 1NLVA 4WQ5A 4A5AA 1HJOA 2GUPA 4GV3A 4B1YB 1YAGA 2YCHA 2HBMA 3EO3A 3MN9A 2P9LB 4HWIA 2E2NA 3O4WA 2KLAA 3QB0A 4FSVA 5GIOA 2NLXA 5E84A 3EKUA 4I6MA 4EHUA 4QS7A 4JKBA 3G4SN 2AP1A 3JS6A 3LDOA 1GLEG 3R3LA 4H0PA 3UKRA 5AQUA 3FZLA 2P9IB 2A6AA 3LDPA 3A5MC 3LDLA 3N4QA 5AQXA 3C0BA 3HM8A 1T3VA 3FGUA 1HLUA 3LDNA 2QXLA 4FWKA 4JAXA 4A57A 2VYPA 3JXUA 3PLAA 3F2KA 2IIRA 3WXLA 2KHOA 1NGDA 5AQZA 5BN9A 2UYTA 2Q97A 5AQNA 1QZ5A 4M63C 1TYQA 4B1XB 4HTLA 5M1QA 3WQTA 4PL7A 2P9SB 4JK9A 2WBNA 3MN6A 4IZ9A 3VGKA 3GG4A 3MMVA 4PL8A 2PAVA 4H0YB 2D4WA 5AQTA 2F7TA 1S3XA 1XQSC 5AQFA 3L0QA 3AAPA 2NRVA 3I8BA 2CGKA 1G99A 4WQ4C 2P9PA 4FWMA 1KAXA 3ULEA 1R59O 3A5OC 5F0XA 3E9LA 1IJJA 5AZJB 2QWRA 2GWKA 2ASMA 4OPHA 2WC9A 3O1BA 1VQKN 1OVYA 2P9NA 3A8YA 2CGJA 4ISGA 1NGFA 3M6GA 3UB5A 4JKHA 2P9KA 2ZJPL 3U4LA 1Q7YO 1CZAN 1U2VB 3TU5A 4BRPA 1U6ZA 3GDQA 4K25A 3MK6A 3TPQA 4CD3A 4IJAA 3IFRA 5AQQA 5AQMA 1Q82O 4AM7A 3WEEB 1GLDG 3WXIA 4A59A 1TUYA 3C6HA 2VWBA 4K42A 3SBTA 2OTLN 5F2RA 2NRHA 3H3NO 3W0LA 5AFUA 4JKDA 5AQLA 4O5FA 3T7ZA 1BU6O 4BVOA 4JD2B 4JHDB 4IEIA 1NM1A 1JCGA 2ASOA 5C2FA 5I9EB 1RFQA 3VF2A 4CZGA 4YOXA 4FWLA 3O9TA 4BC4A 4BR5A 5CR4A 4FPBA 4CZFA 5ADXH 1BA1A 2D0PA 3EE9A 3M3ZA 4NLCA 5AQVA 3RSEB 5B8HA 1YJNN 1HKGA 3ENBA 4IOXA 3OBWA 3D2FA 1T44A 2NRXA 5AQHA 1GLFO 3ZX2A 3SMSA 3G71N 1X3MA 3UKUB 3P38A 5JVGL 3VEYA 4H0VB 2CH6A 3MX2A 5JMVA 5JLFA 5FPNA 5DM7L 4QS9A 1YIJN 1QVGM 5KQDA 2IVNA 1S72N 1K8KA 3VEVA 3H6EA 5GAEP 4AF1A 1D4XA 4H5WA 1DEJA 3HSCA 3BUZB 1P8ZA 1LCUA 2Q0RA 4FOIA 1W2BM 4IXCA 1QQNA 2P9UA 3O08A 3FZFA 4L3QA 3VGMA 2W41A 3TTCA 3C65A 4H5NA 4FO0A 4IO8A 4YDUA 3ZEUB 4BRNA 5CHIA 4MLHA 3CETA 3D2EB 2VCPA 2FF3B 4CBXA 4YOUA 1SZ2A 4GV6A 2E2QA 3F5TA 4BREA 2QW9A 3CCMN 2A41A 4CZMA 2A3ZA 5EOYA 3WXKA 5CE3A 3VPZA 1KXPA 5EX5A 5BPNA 3IKMA 3VMFB 4KH4A 4FWRA 3QBWA 4LC9B 4PHTX 5FPEA 1VQ5N 1KAZA 2PFUA 3MX5A 4XEIA 3G25A 1EQYA 3C6AA 5BREA 3CIPA 3D7EO 3H3OB 4WFNL 1RDWX 2GELA 3KWGA 4GNIA 3UE5A 5AQKA 1YF5L 2YJFA 1ATNA 5C2DA 5GADP 4O8KA 3EE8A 3M1FA 3WXJA 3CCUN 4A61A 4H0TB 3MN5A 5EXWA 5TKWA 4CZKA 1QQOA 1Z6RA 3BEXA 5AQIA 4CBWA 3U9ZA 4WCEL 3WT0A 2FSJA 4JKGA 3EKSA 2BTFA 4H5RA 4FWNA 5AQYA 2NRZA 1S22A 1BA0A 4DCHA 1HX1A 1T6CA 1TUUA 4FWPA 4BGAA 3S41A 3ZETB 5GAHP 3OW2M 2IVPA 1MA9B 1C0GA 1NGBA 3DXKA 2JWLA 2E8AA 2ZJRL 2A5XA 1EO1A 3NMUA 3CXCM 1YJ9N 4XH1A 3LDQA 2GEMA 1YI2N 1VQ6N 4BQZA 3CC4N 4BRDA 4MO4A 4M7YA 4G9ZA 1NBWA 4XH4A 3EZWA 3QDKA 4FWSA 1C0FA 4IEEA 2ZWHA 3TTDA 1ZC6A 2QWMA 2E2PA 3CCLN 4JHDA 1HPMA 5M1FA 3QFUA 4GV9A 3H45C 2GTDA 1QVFM 5GINA 2Q0UA 5JICA 3SK3A 4IWVA 5C15A 4DKWA 4FWQA 4K43A 4ISFA 3G6EN 1X9JA 1VQLN 1T6DA 5AQJA 5LJVA 3A5NC 2RHKA 3L4IA 4JK8A 5BRFA 3SLCA 4UY8O 1NGCA 3C7NA 3Q7BA 4K41A 4JN4A 4B1VA 3R6MA 1VQON 1DKGD 4BY9C 1HUXA 2BUPA 4WQ5C 4H0OA 1MWKA 4YOYA 4FWOA 2Q2RA 2ZJQL 4BQLA 4JKEA 1M90O 2Q31A 4MO5A 5AQOA 3FR0A 5AQWA 3AGKA 1VQMN 4M7XA 2AA4A 3SMPA 3DJCA 2QWOA 1WUAA 3I33A 3ID8A 4EIAA 3VEZA 1VQNN 4I6MB 1QHAA 4EHTA 3VETA 3DXMB 4BRMA 3D2EA 1P90A 1MDUB 1NGHA 1ZXOA 2RE2A 3B8AX 3DAWA 3OBYA 4BRCA 5GIPA 3H46O 1QZ6A 2CH5A 4NO7A 3CC7N 3QBXA 1MWMA 2D0OA 2IVOA 3VENA 5GAGP 3GE1A 5KPTA 3I55N 3OHRA 4IDHA 3SAGA 2VGNA 2V7YA 3ZYYX 4BR0A 4WF9L 3BF3A 1TYQB 4KH5A 3QICA 3O9RA 3CJCA 3CCJN 4BROA 5AQPA 1E4FT 5BR9A 3U9DA 5AZIA 2YX6A 3TSUA 4FL9A 4BRGA 1LOTB 1Q18A 3A5LC 1BWFO 4OPAA 4YOTA 1Q86O 4J8FA 5M1PA 5ADXA 2P9PB 4RWTA 3ATUA 4H5VA 3ULEB 4B9QA 1J6ZA 4O8UA 3P4IA 3IMXA 3FE1A 3VESA 3CQXA 3CF5L 4CZJA 3VGLA 4A62A 3U8XA 3AGRA 3CI5A 5JVHL 2NRTA 3EL2A 4RTFD 1K8AO 1NMDA 3CJ9A 3O8MA 3R8EA 4B1ZA 2P9LA 2YHYA 5KPZA 3CC2N 2JWKA 2V52B 2Q1NA 4KH6A 4BG8A 3GBTA 4JNEA 1HKCA 3DLLL 4BRFA 4DHYA 5FPDA 3CD6N 3GOIA 4A2AA 1VQ4N 1V4TA 3SAFA 4IFEA 1Y64A 1IG8A 1ILYA 2P9IA 2QA4N 2YHWA 1GLJO 1VAZA 4U7BA 3NVKA 3CQYA 3PIPL 1KD1O 1E4GT 3H1QA 2FLOA 1ATSA 2QTDA 2ZGZA 2KKZA 4JKFA 2HOEA 3CJAA 4H03B 4NB4A 3KWIA 4R79A 4PKIA 3ZX0A 3O9SA 3ENOA 4BRKA 2P9SA 1W97L 3NVMA 4A5BA 3HOSA 5BPMA 4BC3A 1YITN 3IDHA 3DWLA 5BPLA 1HKBA 1OKJA 4CZEA 3MDQA 3QFPA 5EVZA 5M1OA 3CCVN 3D2FB 1WOQA 4YOWA 2ZGYA 3CCSN 1SQKA 2ASPA 4QS8A 2QEXN 4BC5A 2NNWA 3E9PA 1V4SA 4WFAL 4WQ4A 2QI2A 3KVGA 1XC3A 3AARA 3LM9A 2HBKA 5BRDA 1KC8O 5AZJA 1K8KB 2EWSA 3E9OA 3ENHA 1SAZA 2FSKA 4EAHD 2W40A 1NGJA 2V7ZA 1N8RO 2E1YA 4FVUA 3MWPA 2P9UB 1BUPA 1U2VA 5AR0A 4BRIA 2Q36A 4YDUC 3VEXA 1BDGA 2E1ZA 2V51B 3MWTA 4BC2A 4IOCL 3T69A 3W3DA 1DT9A 5MLCQ 3BP8A 4JK7A 3ID6A 3WEEA 1O13A 3HRGA 3MCPA 4ISEA 3CCRN 3CHWA 1NWKA 2A42A 1QQMA 5LJWA 4IO9L 1SS6A 2J4RA 2CGLA 3ATVA 1NGIA 4H5TA 3DXMA 4JD2A 2HF4A 5AQSA 3CPEA 5TKYA 2GWJA 3TSPA 3KK7A 4YORA 3R9PA 3HI0A 2QWQA 3TTFA 1K73O 3CJ7A 1YXQA 3K9JA 3H1VX 3RSEA 1X3NA 2NRRA 3CJBA 3HTVA 4C1NI 3BF1A 4F9OA 4JKAA 1NGAA 3F9MA 3VF6A 4Y0WA 1KQSM 4BG9A 3UKUA 4C1NK 1NJIO 3KZBA 1GLCG 2HSTA 4ILGB 2F9TA 2FF6A 4MLEA 4E1JA 2QWPA 3D6RA 5E26A 4PKGA 3K9KA 1YUWA 4CBUA 3FLCO 4DQ8A 4FPAA 3CCQN 3VTIA 1ESVA 4JKGB 3FZMA 5KPRA 4YOVA 5JLHA 3VEOA 5HL7L 3WQUA 2BH1A 3N4PA 3A0IX 5AFUH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAQ A;  3CER A;  3ZEU A;  1YVN A;  4BR4 A;  3UKR B;  2E88 A;  2YJE A;  3VF4 A;  4FOE A;  3DXK B;  2E2O A;  3VEW A;  3O80 A;  4C23 A;  3IUC A;  1BOT O;  2QM1 A;  5LY3 A;  3VER A;  5ELZ A;  1KAY A;  4BGB A;  4BRA A;  2QWN A;  1ATR A;  1GLB G;  2YHX A;  1H1V A;  1JCF A;  3LL3 A;  1XUP O;  4GY2 B;  2I7P A;  4XH5 A;  1JCE A;  3SJH A;  4CD1 A;  4CI6 A;  2E20 A;  4B1W B;  1GLA G;  2FSN A;  4BRH A;  3FZK A;  2YI1 A;  5EY4 A;  4BR9 A;  2P9N B;  5KQ8 A;  4PKH A;  2PBD A;  2NZT A;  3C7N B;  2DPN A;  3FZH A;  5AQR A;  1Z05 A;  2HF3 A;  4BRQ A;  1BG3 A;  1ZBS A;  2P9K B;  4BVP A;  3FFK B;  1RGI A;  2OAN A;  4CZL A;  1BO5 O;  3ZET A;  4CZI A;  4CJ7 A;  4IJN A;  3J8A A;  5AQG A;  3AY9 A;  2WUS A;  3KHY A;  2A40 A;  3MN7 A;  1DGK N;  4CZH A;  3QML A;  4AM6 A;  3EN9 A;  3GL1 A;  5BRH A;  1NGE A;  4H0X B;  5BN8 A;  2D1K A;  2H3G X;  2QWL A;  4DB3 A;  3L6Q A;  4BR7 A;  3O5B A;  3HBT A;  4Z94 A;  3O6W A;  3CJ1 A;  4BR2 A;  3ZX3 A;  3VOV A;  4BRL A;  4WYB A;  2FXU A;  4KBO A;  4RCH A;  2ITM A;  5F1X A;  5AZI B;  1GLL O;  4B1U B;  2ZF5 O;  3WUH A;  2I7N A;  3HZ6 A;  3O1W A;  5FPM A;  4EFH A;  1NGG A;  4A2B A;  2HMP A;  3LM2 A;  2F9W A;  1NLV A;  4WQ5 A;  1HJO A;  2GUP A;  4B1Y B;  1YAG A;  2YCH A;  3EO3 A;  3MN9 A;  2P9L B;  4HWI A;  2E2N A;  3O4W A;  3QB0 A;  4FSV A;  2NLX A;  5E84 A;  3EKU A;  4I6M A;  4EHU A;  4QS7 A;  2AP1 A;  3JS6 A;  3LDO A;  1GLE G;  4H0P A;  3UKR A;  5AQU A;  3FZL A;  2P9I B;  2A6A A;  3LDP A;  3A5M C;  3LDL A;  5AQX A;  3C0B A;  3HM8 A;  3FGU A;  1HLU A;  3LDN A;  2QXL A;  4FWK A;  4JAX A;  2VYP A;  3JXU A;  2IIR A;  3WXL A;  2KHO A;  1NGD A;  5AQZ A;  5BN9 A;  2UYT A;  2Q97 A;  5AQN A;  1QZ5 A;  4M63 C;  1TYQ A;  4B1X B;  4HTL A;  3WQT A;  4PL7 A;  2P9S B;  3MN6 A;  4IZ9 A;  3VGK A;  3GG4 A;  3MMV A;  4PL8 A;  2PAV A;  4H0Y B;  2D4W A;  5AQT A;  1S3X A;  1XQS C;  5AQF A;  3L0Q A;  3AAP A;  3I8B A;  2CGK A;  1G99 A;  4WQ4 C;  2P9P A;  4FWM A;  1KAX A;  3ULE A;  1R59 O;  3A5O C;  5F0X A;  1IJJ A;  5AZJ B;  2QWR A;  2GWK A;  2ASM A;  3O1B A;  2P9N A;  3A8Y A;  2CGJ A;  4ISG A;  1NGF A;  3M6G A;  3UB5 A;  2P9K A;  3U4L A;  1CZA N;  1U2V B;  3TU5 A;  4BRP A;  1U6Z A;  3GDQ A;  4K25 A;  3MK6 A;  3TPQ A;  4CD3 A;  4IJA A;  3IFR A;  5AQQ A;  5AQM A;  4AM7 A;  3WEE B;  1GLD G;  3WXI A;  1TUY A;  4K42 A;  2VWB A;  5F2R A;  2NRH A;  3H3N O;  3W0L A;  5AFU A;  5AQL A;  4O5F A;  1BU6 O;  4BVO A;  4JD2 B;  4JHD B;  1NM1 A;  1JCG A;  2ASO A;  5I9E B;  1RFQ A;  3VF2 A;  4CZG A;  4FWL A;  4BR5 A;  4BC4 A;  4FPB A;  4CZF A;  5ADX H;  1BA1 A;  2D0P A;  3M3Z A;  5AQV A;  3RSE B;  5B8H A;  1HKG A;  3D2F A;  1T44 A;  5AQH A;  1GLF O;  3ZX2 A;  3SMS A;  1X3M A;  3UKU B;  3VEY A;  4H0V B;  2CH6 A;  5JMV A;  5JLF A;  5FPN A;  4QS9 A;  5KQD A;  2IVN A;  1K8K A;  3VEV A;  3H6E A;  1D4X A;  4H5W A;  1DEJ A;  3HSC A;  3BUZ B;  1P8Z A;  1LCU A;  2Q0R A;  4FOI A;  4IXC A;  1QQN A;  2P9U A;  3O08 A;  3FZF A;  4L3Q A;  3VGM A;  2W41 A;  4H5N A;  4FO0 A;  4IO8 A;  4YDU A;  3ZEU B;  4BRN A;  4MLH A;  3CET A;  3D2E B;  2VCP A;  2FF3 B;  4CBX A;  1SZ2 A;  2E2Q A;  4BRE A;  2QW9 A;  2A41 A;  4CZM A;  2A3Z A;  5EOY A;  3WXK A;  5CE3 A;  3VPZ A;  1KXP A;  5EX5 A;  5BPN A;  4FWR A;  3QBW A;  4LC9 B;  5FPE A;  1KAZ A;  4XEI A;  3G25 A;  1EQY A;  5BRE A;  3CIP A;  3D7E O;  3H3O B;  1RDW X;  2GEL A;  4GNI A;  3UE5 A;  5AQK A;  2YJF A;  1ATN A;  4O8K A;  3M1F A;  3WXJ A;  4A61 A;  4H0T B;  3MN5 A;  5EXW A;  4CZK A;  1QQO A;  1Z6R A;  3BEX A;  5AQI A;  4CBW A;  3U9Z A;  3WT0 A;  2FSJ A;  3EKS A;  2BTF A;  4H5R A;  4FWN A;  5AQY A;  1S22 A;  1BA0 A;  4DCH A;  1HX1 A;  1T6C A;  1TUU A;  4FWP A;  4BGA A;  3S41 A;  3ZET B;  2IVP A;  1MA9 B;  1C0G A;  1NGB A;  3DXK A;  2E8A A;  2A5X A;  4XH1 A;  3LDQ A;  2GEM A;  4BQZ A;  4BRD A;  4MO4 A;  4M7Y A;  1NBW A;  4XH4 A;  3EZW A;  3QDK A;  4FWS A;  1C0F A;  2ZWH A;  1ZC6 A;  2QWM A;  2E2P A;  4JHD A;  1HPM A;  3QFU A;  3H45 C;  2GTD A;  2Q0U A;  5JIC A;  3SK3 A;  4IWV A;  4FWQ A;  4K43 A;  4ISF A;  1X9J A;  1T6D A;  5AQJ A;  5LJV A;  3A5N C;  3L4I A;  5BRF A;  3SLC A;  1NGC A;  3C7N A;  4K41 A;  4JN4 A;  4B1V A;  3R6M A;  1DKG D;  1HUX A;  2BUP A;  4WQ5 C;  4H0O A;  1MWK A;  4FWO A;  2Q2R A;  4BQL A;  2Q31 A;  4MO5 A;  5AQO A;  3FR0 A;  5AQW A;  4M7X A;  2AA4 A;  3SMP A;  3DJC A;  2QWO A;  1WUA A;  3I33 A;  3ID8 A;  4EIA A;  3VEZ A;  4I6M B;  1QHA A;  4EHT A;  3VET A;  3DXM B;  4BRM A;  3D2E A;  1MDU B;  1NGH A;  1ZXO A;  3B8A X;  3DAW A;  4BRC A;  3H46 O;  1QZ6 A;  2CH5 A;  4NO7 A;  3QBX A;  1MWM A;  2D0O A;  2IVO A;  3VEN A;  3GE1 A;  5KPT A;  3OHR A;  2V7Y A;  4BR0 A;  3BF3 A;  1TYQ B;  3QIC A;  3CJC A;  4BRO A;  5AQP A;  1E4F T;  5BR9 A;  3U9D A;  5AZI A;  4BRG A;  4FL9 A;  1LOT B;  1Q18 A;  3A5L C;  1BWF O;  4J8F A;  5ADX A;  2P9P B;  4RWT A;  3ATU A;  4H5V A;  3ULE B;  4B9Q A;  1J6Z A;  3P4I A;  3IMX A;  3FE1 A;  3VES A;  3CQX A;  4CZJ A;  3VGL A;  4A62 A;  3U8X A;  3CI5 A;  3EL2 A;  4RTF D;  1NMD A;  3CJ9 A;  3O8M A;  3R8E A;  4B1Z A;  2P9L A;  2YHY A;  5KPZ A;  2V52 B;  2Q1N A;  4BG8 A;  3GBT A;  4JNE A;  1HKC A;  4BRF A;  4DHY A;  5FPD A;  3GOI A;  4A2A A;  1V4T A;  1Y64 A;  1IG8 A;  2P9I A;  2YHW A;  1GLJ O;  3CQY A;  1E4G T;  3H1Q A;  2FLO A;  1ATS A;  2ZGZ A;  2HOE A;  3CJA A;  4H03 B;  4NB4 A;  4PKI A;  3ZX0 A;  3ENO A;  4BRK A;  2P9S A;  5BPM A;  4BC3 A;  3IDH A;  3DWL A;  5BPL A;  1HKB A;  1OKJ A;  4CZE A;  3MDQ A;  3QFP A;  5EVZ A;  3D2F B;  1WOQ A;  2ZGY A;  1SQK A;  2ASP A;  4QS8 A;  4BC5 A;  1V4S A;  4WQ4 A;  3KVG A;  1XC3 A;  3AAR A;  3LM9 A;  5BRD A;  5AZJ A;  1K8K B;  2EWS A;  3ENH A;  1SAZ A;  2FSK A;  4EAH D;  2W40 A;  1NGJ A;  2V7Z A;  2E1Y A;  2P9U B;  1BUP A;  1U2V A;  5AR0 A;  4BRI A;  2Q36 A;  4YDU C;  3VEX A;  1BDG A;  2E1Z A;  2V51 B;  4BC2 A;  3W3D A;  3BP8 A;  3WEE A;  4ISE A;  3MCP A;  3CHW A;  1NWK A;  2A42 A;  1QQM A;  5LJW A;  2J4R A;  2CGL A;  3ATV A;  1NGI A;  4H5T A;  3DXM A;  4JD2 A;  2HF4 A;  5AQS A;  5TKY A;  2GWJ A;  3R9P A;  3HI0 A;  2QWQ A;  3CJ7 A;  1YXQ A;  3H1V X;  3RSE A;  1X3N A;  3CJB A;  3HTV A;  3BF1 A;  4F9O A;  1NGA A;  3F9M A;  3VF6 A;  4Y0W A;  4BG9 A;  3UKU A;  3KZB A;  1GLC G;  2F9T A;  2FF6 A;  4MLE A;  4E1J A;  2QWP A;  5E26 A;  4PKG A;  1YUW A;  4CBU A;  3FLC O;  4DQ8 A;  4FPA A;  1ESV A;  3FZM A;  5KPR A;  5JLH A;  3VEO A;  3WQU A;  3A0I X;  5AFU H; 
#chains in the Genus database with same CATH topology
 4NXM K;  3AV9 A;  3AAQ A;  1Y97 A;  3PV8 A;  1NJZ A;  4FJJ A;  5C12 A;  3VF4 A;  1C6V A;  3DLK A;  4FOE A;  2E2O A;  3E1Y A;  3IUC A;  3OYG A;  4KTQ A;  4CGI A;  5JS2 A;  4IDK A;  4NCG A;  3T1H K;  1HNW K;  3O9U A;  4X62 K;  2QWN A;  3R1X A;  4KHQ A;  3DLH A;  1ATR A;  3MED A;  1GLB G;  5FRN A;  1XUP O;  2I7P A;  1O1W A;  3MEG A;  3LAL A;  4CF0 A;  5C10 A;  3M5R A;  1KVA A;  4XH5 A;  1JCE A;  2HHQ A;  2NRW A;  4B1W B;  3U6F A;  1S6P A;  4CF2 A;  1VQP N;  5EY4 A;  4BR9 A;  5KQ8 A;  1LWC A;  2NZT A;  3FZH A;  1X9M A;  1CZB A;  5E41 A;  4ILJ A;  3LAM A;  1VQ9 N;  1C1C A;  1UAX A;  4K8Z A;  5I3U A;  1RT7 A;  5AQG A;  2OPP A;  4CEE A;  1ZYQ A;  2A40 A;  1XNQ K;  4CZH A;  1Z26 A;  3EN9 A;  1RDA A;  1SL1 A;  2GX9 A;  4H0X B;  4HVJ A;  3ZSZ A;  3SAH A;  4K8X A;  1TKZ A;  5BN8 A;  3E66 A;  4DB3 A;  1Q81 O;  3L6Q A;  4DV0 K;  3MEC A;  3SPZ A;  1RNH A;  3AVB A;  2WFB A;  1RT2 A;  3HBT A;  2Y1I A;  4BR2 A;  3ZX3 A;  4M45 A;  5FLX O;  3VTH A;  4FK4 A;  3TI0 A;  2FXU A;  4RCH A;  1VSE A;  5F1X A;  3CM5 A;  2I7N A;  5H1S Q;  1JJ2 M;  4NLB A;  4JV5 K;  2HMP A;  4CHY A;  4KTW A;  4LY7 A;  3AVK A;  3LM2 A;  4A5A A;  2GUP A;  5SZT A;  2YCH A;  2W6L A;  2VWJ A;  2KLA A;  2YNI A;  2NLX A;  2HND A;  4EHU A;  2WTU A;  1QSY A;  4LSN A;  3R3L A;  3UKR A;  4KKO A;  1RDC A;  2P9I B;  3HM8 A;  1T3V A;  3FGU A;  2O8B B;  1SKW A;  2VYP A;  4CES A;  1RTI A;  3F2K A;  3RRH A;  5AQZ A;  2GBZ A;  4E3S A;  5AQN A;  4M63 C;  4B1X B;  5C42 A;  3WQT A;  4H0Y B;  1IBL K;  3TAF A;  2NRV A;  3I8B A;  1G99 A;  4WQ4 C;  2P9P A;  3CFO A;  3NCI A;  1KAX A;  2IOC A;  2YKM A;  4LF8 K;  1EKE A;  1IJJ A;  5AZJ B;  2ASM A;  1VQK N;  3TAG A;  3SQ4 A;  1KFD A;  4L8R B;  1NGF A;  1BL3 A;  3M6G A;  4M3T A;  2P9K A;  2ZJP L;  1U2V B;  4BRP A;  3OYE A;  3ZSX A;  3GDQ A;  3PSI A;  3T1A A;  4IJA A;  1SKS A;  1JLG A;  4R5P A;  1TK5 A;  2HW3 A;  4A59 A;  1NJW A;  3H3N O;  4O5F A;  4DV2 K;  4JHD B;  2VQE K;  5I9E B;  1RFQ A;  4FPB A;  1BA1 A;  1KCF A;  1BQM A;  3U3Y A;  3SV4 A;  1RIL A;  4IOX A;  1T44 A;  1N32 K;  5AQH A;  1GLF O;  3P38 A;  5JVG L;  5JMV A;  5JLF A;  3L2R A;  1QQC A;  3ALY A;  1QVG M;  1T05 A;  3VEV A;  3AVG A;  4AF1 A;  4H5W A;  3HSC A;  5FRO A;  3CFP A;  2P9U A;  4L3Q A;  2DFF A;  5CHI A;  5HRO A;  4DFM A;  3CET A;  4OVL A;  4YOU A;  1D5A A;  1SZ2 A;  4GV6 A;  4BRE A;  3F5T A;  1UWB A;  2QW9 A;  4CJS A;  5EOY A;  3HJF A;  4FJM A;  3VPZ A;  5BPN A;  3IKM A;  5FPE A;  1ZBU A;  1VQ5 N;  2PFU A;  3PUF A;  2G8K A;  1WSH A;  3LP2 A;  4GVM A;  3G25 A;  1I3A A;  1FKO A;  1J53 A;  3H3O B;  1RT5 A;  1KVB A;  4PWD A;  3KWG A;  1J5O A;  3AVJ A;  4EZ9 A;  1YF5 L;  3NDK A;  4DV6 K;  2F96 A;  3MN5 A;  1N5Y A;  4B9V A;  4CZK A;  4WCE L;  2O4I A;  2E5L K;  2FSJ A;  4OKJ A;  3CG7 A;  4JKG A;  4B9N A;  4FWN A;  5AQY A;  3DI6 A;  2FBT A;  1TUU A;  3S41 A;  4E7L A;  2IVP A;  2B6A A;  5AJ3 K;  4FLX A;  2JWL A;  2E8A A;  1EO1 A;  1YJ9 N;  3M8P A;  3KLF A;  4FJX A;  3LP1 A;  1YI2 N;  2HVH A;  4MO4 A;  4G9Z A;  3LDS A;  2OZS A;  4XH4 A;  3NHG A;  4FWS A;  2OA8 A;  2ZWH A;  3TTD A;  1T8E A;  3DLR A;  1ZC6 A;  2E2P A;  2VG7 A;  4CF9 A;  4GV9 A;  2GTD A;  5GIN A;  4FLU A;  5C15 A;  1S6Q A;  5LJV A;  3L4I A;  4DLE A;  3SLC A;  4UY8 O;  4K41 A;  4JN4 A;  4B1V A;  3R6M A;  2F8S A;  1HUX A;  2BUP A;  4F8R A;  4H0O A;  4GW6 A;  4B9L A;  4DS4 A;  2ZJQ L;  3QEI A;  1HNV A;  3IG1 A;  1MU2 A;  2Q31 A;  3AGK A;  3LPT A;  3DJC A;  3HO1 A;  3OYL A;  2OPS A;  4CK3 A;  1D8Y A;  1BGX T;  4EHT A;  3D2E A;  4NCA A;  1ZXO A;  3OBY A;  4BRC A;  4CEO A;  3THX B;  2CH5 A;  4FJ8 A;  4ZTF A;  2D0O A;  1Q9X A;  4KHY A;  4CJL A;  1WNS A;  4DV1 K;  3OS2 A;  1IBM K;  3TAP A;  4WF9 L;  3BF3 A;  1TYQ B;  3QIC A;  3O9R A;  4HCB A;  2DY4 A;  1FKP A;  1RBS A;  4BRO A;  5AQP A;  3NBP A;  4X64 K;  1WSJ A;  2YX6 A;  1LOT B;  1YTA A;  3A5L C;  1BWF O;  3QEW A;  5I42 A;  1Q86 O;  5M1P A;  5ADX A;  1WB9 A;  2AJQ A;  4B9Q A;  4B9U A;  4RW7 A;  3IMX A;  4J2E A;  4A62 A;  3U8X A;  3OYN A;  1S1X A;  4O0J A;  2P5G A;  3EL2 A;  3VQ5 A;  4RTF D;  5C24 A;  3NF8 A;  4RW4 A;  4CHN A;  2XHB A;  1HNZ K;  2Q1N A;  3GBT A;  1NK0 A;  1HKC A;  3CD6 N;  3AA4 A;  5FPD A;  4NCB A;  3KK3 A;  3DRR A;  1TKD A;  4KHS A;  3HT3 A;  1ILY A;  2P9I A;  3ZT1 A;  2QA4 N;  3WNG A;  1KD1 O;  1X9W A;  2O8B A;  1ITG A;  4FM0 A;  4NB4 A;  3L2V A;  5D3G A;  4DTN A;  2UXC K;  1JLB A;  3EY1 A;  4A5B A;  1YIT N;  5IT9 O;  3MEE A;  1OH8 A;  4PQU A;  3IDH A;  4AHC A;  3VQ8 A;  4CZE A;  4RW9 A;  4W5N A;  4CER A;  5SWM A;  1OVQ A;  3D2F B;  4YOW A;  3KLH A;  1RBR A;  2QI2 A;  4CJV A;  3THV A;  5BRD A;  1XHZ A;  5AZJ A;  3T3F A;  2RPI A;  1SAZ A;  4M3U A;  4RG8 A;  1NGJ A;  1N8R O;  2B5J A;  4CGF A;  1B9D A;  4FK0 A;  1U2V A;  5AR0 A;  1NOZ A;  1IH7 A;  1C0U A;  2IAJ A;  3VEX A;  3MWT A;  3NFA A;  1DT9 A;  5MLC Q;  3BP8 A;  2HMI A;  4DU3 A;  4LF7 K;  2HHU A;  3HRG A;  3CCR N;  3PO5 A;  3O3F A;  1QTM A;  4CJK A;  4LH4 A;  1TK0 A;  1T7P A;  4B3M K;  3HVR A;  2OPR A;  3KK7 A;  3TTF A;  1JLQ A;  3V81 A;  1U47 A;  1YXQ A;  4B3R K;  3SZ2 A;  2E6M A;  2NRR A;  4C1N I;  4JKA A;  4FW2 A;  3QER A;  1NGA A;  3F9M A;  4CCH A;  1A5W A;  4Y0W A;  1GLC G;  2HST A;  4ILG B;  3JYT A;  3VQQ A;  2QWP A;  3G10 A;  4PKG A;  1CZ9 A;  3TAM A;  1YUW A;  3HXM A;  1BQN A;  4FPA A;  1ESV A;  3VEO A;  3WQU A;  3NE6 A;  3OS1 A;  3P31 A;  3CER A;  3AO2 A;  4DMN A;  4IOA L;  4BR4 A;  3UKR B;  4DV5 K;  2E88 A;  2G8I A;  4X66 K;  3VEW A;  3O80 A;  1KLN A;  1FXX A;  4PY5 A;  2OCE A;  5ELZ A;  3SUO A;  2QXF A;  4BGB A;  4BRA A;  2OTJ N;  1U4B A;  3L8B A;  4LF4 K;  2YHX A;  3PO4 A;  4M41 A;  3AVA A;  5T7B A;  3TAN A;  2D0C A;  4YNQ A;  2E20 A;  4JI4 K;  4PKH A;  3SQ0 A;  3C7N B;  3I56 N;  1KRP A;  2DPN A;  5AQR A;  2HF3 A;  4CHO A;  3K59 A;  1BG3 A;  2P9K B;  4DR7 K;  4YY3 K;  3RMC A;  5C0Y A;  1JLE A;  4BVP A;  3AVH A;  3FFK B;  4JKC A;  2HHT A;  1RGI A;  3KLE A;  4CZL A;  1BO5 O;  1F21 A;  4CJ7 A;  3L4Q A;  4OGE A;  2WUS A;  4ICL A;  3MN7 A;  4GVE A;  4DQS A;  4CJR A;  3QML A;  3CCE N;  1C1B A;  3GL1 A;  4B8C A;  4HTU A;  3K5M A;  3Q7C A;  2D1K A;  2QWL A;  3TSQ A;  3H08 A;  3AVI A;  3SBG A;  1LW0 A;  4FJN A;  4Z94 A;  3O6W A;  3OJS A;  4HHT A;  1TKX A;  3VOV A;  1D9D A;  4CJF A;  4KBO A;  2EX3 A;  2HVI A;  3OYB A;  1QE1 A;  4H4M A;  4AHS A;  1WAJ A;  4TSX A;  4A2B A;  1VQ7 N;  4JI5 K;  3J7A P;  4E89 A;  2HHW A;  2F9W A;  4WQ5 A;  1HJO A;  4B1Y B;  4H4O A;  3MN9 A;  4DQR A;  4DFJ A;  5GIO A;  3T19 A;  5HRR A;  1S5J A;  4DFK A;  3OS0 A;  2AP1 A;  3JS6 A;  1JLA A;  4B08 A;  3THX A;  1NK6 A;  2XO7 A;  3A5M C;  3LDL A;  2F4V K;  3C0B A;  1HLU A;  2KHO A;  4OKK A;  2FBV A;  4H8K A;  4JI0 K;  1QZ5 A;  3DRS A;  1TYQ A;  4HTL A;  4GMJ B;  4LD0 A;  1IG9 A;  4IFY A;  4Z4I A;  3VGK A;  2YNG A;  4PL8 A;  5KGW A;  2IC3 A;  1VSM A;  2F7T A;  3THY B;  1S3X A;  1XQS C;  3L0Q A;  3OYD A;  4E0D A;  4FWM A;  5F0X A;  3A5O C;  4CEC A;  3E9L A;  4IG0 A;  1TVR A;  5HRS A;  4DR1 K;  1OH6 A;  1OVY A;  2UUB K;  4CK1 A;  4ISG A;  3LAK A;  3NH0 A;  4O44 A;  3U4L A;  1U6Z A;  3K2P A;  4K25 A;  3MK6 A;  4FJL A;  2BGG A;  4DR3 K;  5AQQ A;  1Q82 O;  4AM7 A;  1GLD G;  3WXI A;  3C6H A;  4K42 A;  1UA0 A;  2OTL N;  4FJH A;  5F2R A;  2NRH A;  3W0L A;  5AFU A;  4FZX C;  1NK8 A;  4JKD A;  3DM2 A;  3QIN A;  4JD2 B;  1BIU A;  3ZSR A;  4WE1 A;  1JXE A;  4YOX A;  4FWL A;  4MFB A;  4BC4 A;  5BR8 K;  3RSE B;  3V9Z A;  1HKG A;  3ENB A;  3D2F A;  3VEY A;  4W5O A;  3EZ5 A;  1SL2 A;  4W5R A;  4HUG A;  5FPN A;  3IRX A;  5DM7 L;  4CJW A;  4O5B A;  1S72 N;  2JLE A;  2XRI A;  3G0Z A;  3H6E A;  4B3O A;  1D4X A;  1XNR K;  1DEJ A;  2JGU A;  1HYS A;  1P8Z A;  2E4L A;  1W2B M;  2DFH A;  3FZF A;  1OH5 A;  3MXM A;  4LF9 K;  2W41 A;  3TTC A;  1QSL A;  4IO8 A;  4YDU A;  4BRN A;  4MLH A;  3D2E B;  2VCP A;  1S1V A;  4JRP A;  2FF3 B;  3J7Y P;  2P1J A;  1ZBI A;  4LH5 A;  3CCM N;  2O8D B;  2GV9 A;  5CE3 A;  1KXP A;  5EX5 A;  2OPQ A;  4LC9 B;  3QBW A;  4PHT X;  1KAZ A;  1IV0 A;  5DMR A;  5BRE A;  3CIP A;  3D7E O;  1RDW X;  2GEL A;  4HUF A;  4DV3 K;  5AQK A;  4CED A;  4DUZ K;  3SYZ A;  4LF6 K;  3CCU N;  3M1F A;  1VSK A;  4B3T K;  4H0T B;  4KTZ A;  4F3O A;  5TKW A;  1QQO A;  3NGY A;  3M8Q A;  4BE0 A;  2BTF A;  2DTU A;  3SJJ A;  2NRZ A;  4OPK A;  1NK7 A;  1S22 A;  1B9F A;  4B3S K;  1HX1 A;  1T6C A;  5GAH P;  3ZET B;  1KSP A;  3OW2 M;  1IKW A;  4GKJ K;  1MA9 B;  3OYM A;  3CXC M;  4XH1 A;  1TAU A;  1EXQ A;  3LDQ A;  4AH9 A;  4BQZ A;  1HPZ A;  3CC4 N;  4F2R A;  1ZBH A;  3K58 A;  5J2Q A;  1WSF A;  1C0F A;  2QWM A;  3JAM O;  2R7Y A;  3CCL N;  3H45 C;  1QVF M;  1KTQ A;  2Q0U A;  3SK3 A;  4IWV A;  1L3V A;  4DKW A;  1VQL N;  3TAR A;  5BRF A;  3RMD A;  3C7N A;  3Q7B A;  3DOK A;  4DR4 K;  1VQO N;  4DFP A;  5FDL A;  1MWK A;  2Q2R A;  4BQL A;  4QOZ B;  1BCM A;  5AQW A;  1G15 A;  4M7X A;  5DK5 A;  4CFC A;  1VQN N;  4I6M B;  2ZE2 A;  2WON A;  4B9M A;  4BRM A;  4DSF A;  1MDU B;  3B8A X;  4ELT A;  5GIP A;  1QZ6 A;  3QBX A;  3ZSW A;  4X65 K;  2XY8 A;  3VEN A;  5GAG P;  3GE1 A;  2E6L A;  4FVM A;  3OHR A;  1DLO A;  2V7Y A;  3ZYY X;  3WNF A;  4KH5 A;  4DU1 A;  4CIF A;  1E4F T;  5BR9 A;  3NF6 A;  4OPJ A;  4JI3 K;  4Z4G A;  4RWT A;  1TL1 A;  4H5V A;  3ULE B;  3S3O A;  3P4I A;  3FE1 A;  1LV5 A;  3VES A;  4CZJ A;  3VGL A;  3O3H A;  3PY8 A;  4KI6 A;  4Z0U A;  1S1W A;  3R8E A;  1NJY A;  2V52 B;  3DLG A;  4NYF A;  4KH6 A;  3DLL L;  3GOI A;  4A2A A;  1JL1 A;  4FM2 A;  1V4T A;  4IFE A;  3LAN A;  2YV0 X;  1VAZ A;  1NK9 A;  3PIP L;  2A1R A;  3HYF A;  3THW B;  4R79 A;  3UIQ A;  4CHP A;  1RTD A;  4BRK A;  1RDB A;  3HOS A;  4C8K A;  3DWL A;  1HKB A;  1D9F A;  1UA1 A;  2ZM6 K;  3THY A;  5M1O A;  1WOQ A;  3ZSO A;  1YVU A;  2ASP A;  4KFB A;  4QS8 A;  4DV4 K;  3DYA A;  3C95 A;  4WFA L;  4WQ4 A;  1R0A A;  3L2Q A;  2HBK A;  3S3M A;  1KC8 O;  3VA3 A;  2EWS A;  3V6D A;  3KK2 A;  1L5U A;  3IS9 A;  2FSK A;  4EAH D;  4DTM A;  1NKE A;  4CIG A;  2Q36 A;  2V51 B;  4IOC L;  4I7F A;  1WSE A;  3OYI A;  3P1G A;  1O13 A;  1EP4 A;  3QEX A;  1QQM A;  4IO9 L;  3ZCM A;  3BGR A;  1XHX A;  5J2P A;  2CGL A;  3ATV A;  4JD2 A;  3KKR A;  3DXM A;  4H5T A;  4CGD A;  5TKY A;  3CPE A;  4CEZ A;  3WNH A;  2QWQ A;  3KLG A;  1K73 O;  3K9J A;  3RSE A;  3CJB A;  3BF1 A;  4F9O A;  4MQ3 A;  3EYZ A;  5EU7 A;  2BAN A;  3AO5 A;  4BG9 A;  4C1N K;  3PSF A;  2O8C B;  2F9T A;  2FF6 A;  4MLE A;  4HUE A;  3D6R A;  3OVN A;  4M3Y A;  3C94 A;  3CCQ N;  4EP4 A;  3VTI A;  3FZM A;  2BH1 A;  3RMB A;  3A0I X;  1BA0 A;  3DOL A;  1YHQ N;  1K9M O;  4KRF A;  1ASU A;  2KZZ A;  4XIU A;  3U3G A;  4Z4E A;  3P39 A;  2YJE A;  2OZM A;  3DXK B;  4C23 A;  2KW4 A;  3NGI A;  1BOT O;  5KTQ A;  2QM1 A;  5LY3 A;  2I5J A;  2O8D A;  3SNN A;  1KAY A;  5M1K A;  1L3U A;  2HNZ A;  4BDZ A;  2VQF K;  1H1V A;  3LL3 A;  3WXM B;  5M1N A;  4F4K A;  3SJH A;  4E19 A;  4CI6 A;  1WAF A;  1GLA G;  3FZK A;  2VGM A;  4CEF A;  1Z05 A;  4BRQ A;  4JLH A;  3BZK A;  3RVC A;  4KI4 A;  4CGJ A;  4CHQ A;  1U04 A;  3ZET A;  4AHR A;  4DTR A;  3CME N;  2O8F B;  1TAQ A;  3KHY A;  4C8O A;  2HBL A;  4JEP A;  2G8F A;  1IKV A;  4KAZ A;  5BRH A;  1NGE A;  4CF8 A;  1GOC A;  4BE1 A;  1GOA A;  3QNN A;  2H3G X;  4OKE A;  3L3V A;  4FXD A;  3CMA N;  5HOO A;  3JSM A;  1YT3 A;  1YJW N;  3MCA B;  1I39 A;  3O5B A;  4MDB A;  4BR7 A;  1TGO A;  4U67 L;  5DM6 L;  4DTU A;  4BRL A;  1KFS A;  2BDP A;  2ITM A;  1JKH A;  4DTS A;  2IGI A;  5AZI B;  2B4J A;  3WUH A;  2UUC K;  1VSJ A;  3HZ6 A;  4O0I A;  4E7K A;  1NGG A;  1LWF A;  4FM1 A;  1RDU A;  4CEQ A;  2HHH K;  1W9H A;  3ZSY A;  4I9L A;  4DLG A;  3ZT0 A;  3EO3 A;  2OYQ A;  4HWI A;  1RT6 A;  2RKI A;  3QB0 A;  3AO4 A;  4DS5 A;  4I6M A;  3RWU A;  4JKB A;  2F8T A;  1S1U A;  3AA3 A;  3LDO A;  3QO9 A;  1GLE G;  4DG1 A;  2KFZ A;  3N4Q A;  4E1M A;  5CZ2 A;  5C25 A;  4CJ4 A;  3AVF A;  1YTU A;  3LDN A;  2QXL A;  5HRP A;  5HLF A;  3PLA A;  2IIR A;  3WXL A;  1NGD A;  5BN9 A;  2UYT A;  2Q97 A;  4O55 A;  4OJR A;  2Z1G A;  3VQC A;  3BDP A;  3LWM A;  1NOY A;  5M1Q A;  2X6S A;  3MN6 A;  3MMV A;  5AQT A;  4E7H A;  4DSL A;  3AAP A;  3MXI A;  1RT3 A;  3ULE A;  2ATQ A;  3NAE A;  3VQD A;  3WNE A;  3QEP A;  2QWR A;  4N41 A;  2GWK A;  2D0B A;  2WC9 A;  3O1B A;  2P9N A;  3A8Y A;  3ZT3 A;  3UB5 A;  4JKH A;  4QAG A;  1CZA N;  3TU5 A;  3TPQ A;  4FLZ A;  4CD3 A;  3B6O A;  3IFR A;  1HNX K;  1NU0 A;  5AQM A;  1NNE A;  1JL2 A;  4Y1D A;  3WEE B;  4NXN K;  3BY5 A;  1TUY A;  5J2N A;  2VWB A;  3NH1 A;  1IO2 A;  1HQE A;  4DSI A;  4Z4C A;  5AQL A;  1BU6 O;  4BVO A;  1NM1 A;  3VN5 A;  2ASO A;  3SI6 A;  4CZG A;  3THW A;  3O9T A;  4BR5 A;  4Z4F A;  5ADX H;  4FZY A;  3TAE A;  4FLT A;  5AQV A;  4JS4 A;  1YJN N;  3G71 N;  3QIP A;  3SMS A;  3ASM A;  1X3M A;  4GKK K;  2NUB A;  3UKU B;  2W42 A;  4H0V B;  2CH6 A;  3MX2 A;  1CXU A;  1DTQ A;  5KQD A;  2IVN A;  1N36 K;  3CM6 A;  3B6P A;  4J2D A;  1N6Q A;  1U49 A;  4JRQ A;  1C1A A;  1LCU A;  2QKB A;  4FOI A;  4IXC A;  4G1Q A;  4KHP K;  2XY6 A;  1LAW A;  3VGM A;  4FO0 A;  3ZEU B;  3OTO K;  2QKK A;  1C0M A;  4CBX A;  2E2Q A;  2Z1J A;  2UXD K;  5A2Q O;  1RT4 A;  2XY5 A;  3WXK A;  3VQB A;  3DLE A;  4FWR A;  3J80 O;  4N76 A;  4XEI A;  3C6A A;  4WFN L;  4OLB A;  3V1Q A;  1RTH A;  4GNI A;  3UE5 A;  4DQP A;  1SKR A;  4FZZ A;  1X1P A;  3EE8 A;  3WXJ A;  2O8C A;  3HPO A;  1CLQ A;  1WLJ A;  1NKB A;  5AQI A;  3BEX A;  1VSI A;  4CBW A;  5KGX A;  4KHU A;  3VQE A;  3J81 O;  3EKS A;  3NF9 A;  4H5R A;  2XY7 A;  4BDY A;  4JI8 K;  4DCH A;  4BGA A;  3SPY A;  4DF8 A;  1C0G A;  1NGB A;  3DXK A;  4NYN A;  2A5X A;  2ZJR L;  3AVM A;  3NMU A;  2W6K A;  4AHU A;  4CJQ A;  1WBD A;  3QNO A;  2HNY A;  1XWL A;  3LZI A;  3ITH A;  3OJU A;  1DTT A;  2FBY A;  4M7Y A;  1NBW A;  2VG5 A;  4IEE A;  4BE2 A;  2HHS A;  3AO1 A;  1HPM A;  4DSE A;  3QFU A;  1RBT A;  2KQ2 A;  1SV5 A;  5JIC A;  2ZD1 A;  3HP6 A;  4PA1 A;  4K43 A;  4ISF A;  3G6E N;  1X9J A;  1T6D A;  2YHB A;  4M3R A;  4JK8 A;  1JXB A;  1GOB A;  1NGC A;  1K6Y A;  1HYZ A;  3KD1 E;  1DKG D;  4BY9 C;  4DV7 K;  4BAC A;  3K5O A;  3BZC A;  1BI4 B;  5AQO A;  1VQM N;  4CJ5 A;  5FRM A;  2O8F A;  2AA4 A;  4JI1 K;  2QWO A;  1WUA A;  3ID8 A;  4EIA A;  1QHA A;  3VET A;  3DXM B;  1B92 A;  5LL6 Z;  1P90 A;  1NGH A;  2D5R A;  2RE2 A;  1E3M A;  3DAW A;  3H46 O;  4NO7 A;  3HK2 A;  2VWK A;  3D45 A;  3ZT4 A;  3AVL A;  5KPT A;  4C8L A;  3OYJ A;  4CIE A;  3SUQ A;  3SAG A;  2VGN A;  4FLY A;  4CJ3 A;  1QSS A;  4BR0 A;  3VQP A;  1T03 A;  3CJC A;  3QES A;  5AZI A;  4E1N A;  3TSU A;  4BRG A;  1Q18 A;  4FLV A;  4YOT A;  2EHG A;  1J6Z A;  3AA2 A;  3CQX A;  1L3S A;  3CF5 L;  2Q3S A;  4DU4 A;  2NRT A;  3QEV A;  1W7A A;  3TR8 A;  3CJ9 A;  4B1Z A;  2HHX A;  2YHY A;  3OYK A;  4N47 A;  3O4Q A;  3SV3 A;  5KPZ A;  1RBU A;  2JWK A;  1Z25 A;  4JNE A;  3SQ2 A;  1VQ4 N;  4FJ5 A;  3FFI A;  2A1S A;  1I94 K;  5HP1 A;  2X78 A;  2QK9 A;  1GLJ O;  4IG3 A;  4U7B A;  3NVK A;  1ASV A;  3CQY A;  4CFB A;  4CFA A;  2FLO A;  4DF4 A;  1ATS A;  2QTD A;  3KD5 E;  4JKF A;  3CJA A;  4H03 B;  4CEB A;  1RTJ A;  3ZX0 A;  3O9S A;  2PY5 A;  4LFC K;  4KHN A;  5BPM A;  4BC3 A;  1N34 K;  5BPL A;  4KV8 A;  1X9S A;  3MDQ A;  3CCV N;  1TV6 A;  3CCS N;  2ZGY A;  2QEX N;  1SQK A;  1LAV A;  4I2P A;  4BC5 A;  1J5E K;  2NNW A;  5K14 A;  1QHT A;  1Q9Y A;  3HVT A;  4DTP A;  1K8K B;  4CHZ A;  3ZLJ A;  4ZHR A;  2W40 A;  2V7Z A;  2E1Y A;  3MAQ A;  3MWP A;  4BRI A;  4YHH K;  2E1Z A;  4BC2 A;  5HRN A;  1S9G A;  3W3D A;  4JK7 A;  3ID6 A;  3WEE A;  4CW7 B;  4ISE A;  3MCP A;  2O8E B;  3OYF A;  4J2B A;  1VSF A;  2J4R A;  4B8A B;  1VHX A;  4N56 A;  3TAB A;  3TSP A;  4YOR A;  3IAY A;  3OY9 A;  3CJ7 A;  3HL8 A;  4DR6 K;  4IFV A;  3NF7 A;  3VF6 A;  1KQS M;  3UKU A;  3LWL A;  3KZB A;  4E1J A;  4CJU A;  3L2U A;  3O4N A;  5E26 A;  4J2A A;  3K9K A;  4OX9 K;  4AHV A;  4CBU A;  3L2W A;  1TL3 A;  3FLC O;  4CJP A;  3V9W A;  4FJ9 A;  1RT1 A;  4LSL A;  4Z4H A;  5HL7 L;  1S1T A;  5AFU H;  1BIZ A;  1RDD A;  3J7Z O;  3ZEU A;  1YVN A;  3OA9 A;  1LWE A;  5IWA K;  5CY4 A;  3RR8 A;  1M1K O;  1ZBF A;  3VER A;  3PX4 A;  2IS3 A;  5J2M A;  2HBJ A;  2P51 A;  3PX6 A;  2PYL A;  3RTV A;  1JCF A;  4FK2 A;  4GY2 B;  4CGG A;  4CGH A;  4OO1 J;  4ILH A;  4ELV A;  4CD1 A;  3HPG A;  1NKC A;  2G8W A;  4EZ6 A;  4LF5 K;  2FSN A;  4BRH A;  2YI1 A;  4Q0B A;  3LPU A;  2KTQ A;  2P9N B;  2PBD A;  1SUQ A;  1ZBS A;  4C8M A;  3RRG A;  4RW6 A;  4DQI A;  4JI2 K;  2OAN A;  3HPH A;  4CZI A;  4IJN A;  3J8A A;  4O4G A;  3AY9 A;  1DGK N;  4B9T A;  4AM6 A;  3PIO L;  3O9Q A;  4FW1 A;  3HOT A;  2YKN A;  2PYJ A;  5HBM A;  4DUY K;  4CF1 A;  4IKF A;  3QIO A;  2G8U A;  5JS1 A;  4DTO A;  3CJ1 A;  3K0S A;  2UU9 K;  4WYB A;  3P5J A;  3V1O A;  1VQ8 N;  3CPW M;  3I0S A;  1GLL O;  4B1U B;  2ZF5 O;  3K5N A;  1VRT A;  3RMA A;  3O1W A;  5FPM A;  4EFH A;  1RCH A;  4MDA A;  4WFB L;  3C6U A;  5CYQ A;  1NLV A;  3ZSQ A;  1ASW A;  4GV3 A;  1YAG A;  4F2S A;  1BI4 A;  2Z1H A;  2HBM A;  1EWQ A;  2P9L B;  4Y1C A;  2E2N A;  3O4W A;  2UUA K;  4FSV A;  5E84 A;  3EKU A;  4EP5 A;  4QS7 A;  3G4S N;  3SUN A;  4H0P A;  3DLB A;  5AQU A;  3FZL A;  5AQX A;  2A6A A;  3LDP A;  4JI6 K;  4FJI A;  3NH2 A;  4FWK A;  4JAX A;  4A57 A;  1KLM A;  3JXU A;  1REV A;  2FC0 A;  4Q5V A;  4CJT A;  1QS4 A;  4PL7 A;  3I8D A;  1HRH A;  2P9S B;  4JK9 A;  2WBN A;  4IZ9 A;  3GG4 A;  4AIL C;  2PAV A;  1XMQ K;  2D4W A;  3HP9 A;  5AQF A;  3F9K A;  2YNH A;  2CGK A;  1WSG A;  1HYV A;  1IKX A;  1R59 O;  1VSD A;  4CEA A;  3LP3 A;  4FJ7 A;  4OPH A;  2P5O A;  4KB1 A;  2CGJ A;  4UQG A;  1Q7Y O;  3VQA A;  2O4G A;  3E01 A;  4YFU A;  1NK4 A;  3V9S A;  4W5Q A;  3SBT A;  3I0R A;  3T7Z A;  2HB5 A;  1TKT A;  4IEI A;  5C2F A;  1CXQ A;  1JCG A;  4QCL A;  3ZSV A;  3VF2 A;  3CFR A;  3NGZ A;  5CR4 A;  4CZF A;  2KZM A;  5J1E A;  2D0P A;  1A5V A;  1A5X A;  3EE9 A;  3M3Z A;  4NLC A;  3VA0 A;  4FYD A;  4M3X A;  3SQ1 A;  4CE9 A;  5B8H A;  4DTX A;  3OBW A;  2NRX A;  3HST B;  4IBN A;  3ZX2 A;  1HR0 K;  4JI7 K;  1ZBL A;  3AVN A;  1NJX A;  3V4I A;  4M42 A;  4QS9 A;  1YIJ N;  3DMJ A;  1BCO A;  1K8K A;  3TWH A;  3KKS A;  4ID1 A;  1NMN A;  4OGC A;  5GAE P;  1SL0 A;  4DTJ A;  4E7I A;  3BUZ B;  2WOM A;  2G8H A;  2ZQB A;  2Q0R A;  3D0P A;  1QQN A;  3O08 A;  1LW2 A;  3C65 A;  4H5N A;  3C6T A;  1J54 A;  2O8E A;  4OLA A;  2A41 A;  4CZM A;  4K0K K;  2A3Z A;  5LMN K;  2X74 A;  4AQY K;  2GUI A;  3VMF B;  3OYA A;  4KH4 A;  4FLW A;  1J9A A;  1HNI A;  3MX5 A;  5CYM A;  5LMU K;  2RN2 A;  1EQY A;  4BDP A;  3QET A;  1RBV A;  3M8S A;  4F3T A;  2Z1I A;  1EX4 A;  1VSH A;  2YJF A;  1ATN A;  3AVC A;  5C2D A;  4O8K A;  5GAD P;  4FCY A;  4A61 A;  4DSK A;  1EET A;  4LFA K;  5EXW A;  1Z6R A;  1IKY A;  3U9Z A;  3WT0 A;  4DR2 K;  3S9H A;  4I9Q A;  3M8R A;  3KIO A;  4M3W A;  1S9E A;  1IBK K;  2X6N A;  3V9U A;  1JLF A;  1XMO K;  4FWP A;  1U48 A;  1UOC A;  3K57 A;  4CK2 A;  1FJG K;  1JLC A;  3L3U A;  4KHW A;  3ZT2 A;  3S3N A;  3P83 D;  2GEM A;  1VQ6 N;  4DQQ A;  3A2F A;  1HMV A;  3MXJ A;  4BRD A;  3SUP A;  4KPY A;  1NG9 A;  3EEQ A;  3EZW A;  3QDK A;  1KVC A;  4JHD A;  5M1F A;  2YHA A;  4FWQ A;  5AQJ A;  2D0A A;  3A5N C;  2RHK A;  1VRU A;  3VQ9 A;  1VSL A;  2G8V A;  4WQ5 C;  4YOY A;  4FWO A;  1WN7 A;  4JYA K;  4JKE A;  1M90 O;  4MO5 A;  4BWJ A;  4I2Q A;  3FR0 A;  3T1Y K;  3DRP A;  3V9X A;  1XI1 A;  3SMP A;  3I33 A;  3VEZ A;  3V1R A;  1VK0 A;  3ULD A;  4AHT A;  3CC7 N;  2UXB K;  1MWM A;  2IVO A;  3PX0 A;  3I55 N;  1BHL A;  4IDH A;  4M3Z A;  4N5S A;  5KI6 A;  3LP0 A;  2Y1J A;  1U45 A;  4ELU A;  3CCJ N;  4E7J A;  3U9D A;  3K5L A;  5KRT A;  4OPA A;  4J8F A;  2P9P B;  3ATU A;  3HM9 A;  4O8U A;  2LSN A;  3VQ7 A;  3AGR A;  3CI5 A;  5JVH L;  1K8A O;  1NMD A;  3O8M A;  2P9L A;  2VG6 A;  3CC2 N;  4BWM A;  4C8N A;  3KTQ A;  4BG8 A;  4BRF A;  4DHY A;  2DFE A;  3SAF A;  3CQ8 A;  1Y64 A;  1IG8 A;  3OYH A;  2YHW A;  1OH7 A;  1E4G T;  3H1Q A;  5KRS A;  4DWI A;  4CJE A;  3KK1 A;  1WSI A;  1NK5 A;  2ZGZ A;  2KKZ A;  3LZJ A;  2HOE A;  3QLH A;  1Q8I A;  3KWI A;  4PKI A;  2KFN A;  3ENO A;  2P9S A;  1W97 L;  3NVM A;  4KO0 A;  4CVN E;  3CYM A;  4W5T A;  1OKJ A;  4B9S A;  4FJK A;  4JS5 A;  3QFP A;  5EVZ A;  3ISN C;  3E9P A;  1V4S A;  3OYC A;  2BE2 A;  3KVG A;  1XC3 A;  3AAR A;  3LM9 A;  3SCX A;  1EWR A;  3O3G A;  3E9O A;  1FW6 A;  3ENH A;  3KLI A;  1BIS A;  4CFD A;  3RR7 A;  3TAQ A;  4FVU A;  2PZS A;  1FK9 A;  2P9U B;  1BUP A;  4ID5 A;  2YNF A;  3KJV A;  1TK8 A;  4YDU C;  1BDG A;  2IDO A;  4DSJ A;  3T69 A;  1WBB A;  2FBX A;  3CHW A;  4ZTJ A;  1N33 K;  3AO3 A;  1NWK A;  4RW8 A;  2A42 A;  4PUO A;  1L3T A;  5LJW A;  1XC9 A;  2RF2 A;  3VQ6 A;  1SS6 A;  1NGI A;  4KB0 A;  2HF4 A;  5AQS A;  2GWJ A;  4KRE A;  4HCC A;  2ETJ A;  3R9P A;  3HI0 A;  3AA5 X;  1W0H A;  3H1V X;  3VQ4 A;  1X3N A;  3HTV A;  4LFB K;  4V19 S;  2ITG A;  1NJI O;  1HQU A;  4DR5 K;  1HJR A;  4FJG A;  5CZ1 A;  4DQ8 A;  1C0T A;  4JKG B;  4YOV A;  5KPR A;  5JLH A;  2HHV A;  3F73 A;  3N4P A;  4FL9 A; 
#chains in the Genus database with same CATH homology
 1YHQ N;  1K9M O;  3P31 A;  3AAQ A;  3CER A;  3J7Z O;  3ZEU A;  4IOA L;  1YVN A;  4BR4 A;  3OA9 A;  3UKR B;  2E88 A;  2YJE A;  3P39 A;  3VF4 A;  5C12 A;  4FOE A;  3DXK B;  2E2O A;  3VEW A;  3O80 A;  4C23 A;  1M1K O;  3E1Y A;  1BOT O;  3IUC A;  2QM1 A;  5LY3 A;  3VER A;  5ELZ A;  1KAY A;  2HBJ A;  3O9U A;  4BGB A;  4BRA A;  5M1K A;  2OTJ N;  2QWN A;  3R1X A;  1ATR A;  1GLB G;  2YHX A;  1H1V A;  1JCF A;  3LL3 A;  1XUP O;  4GY2 B;  2I7P A;  3WXM B;  5C10 A;  3M5R A;  4XH5 A;  4OO1 J;  1JCE A;  5M1N A;  4ILH A;  3SJH A;  4CD1 A;  4CI6 A;  2NRW A;  2E20 A;  4B1W B;  1GLA G;  2FSN A;  4BRH A;  3FZK A;  2YI1 A;  1VQP N;  5EY4 A;  4BR9 A;  2P9N B;  5KQ8 A;  2VGM A;  4PKH A;  2PBD A;  2NZT A;  3C7N B;  3I56 N;  2DPN A;  3FZH A;  5AQR A;  1Z05 A;  2HF3 A;  4BRQ A;  1BG3 A;  1ZBS A;  2P9K B;  4ILJ A;  5C0Y A;  1VQ9 N;  3RVC A;  4BVP A;  3FFK B;  4JKC A;  1RGI A;  2OAN A;  4CZL A;  1BO5 O;  3ZET A;  4CZI A;  3CME N;  4CJ7 A;  4IJN A;  3L4Q A;  3J8A A;  5AQG A;  3AY9 A;  2WUS A;  3KHY A;  2A40 A;  2HBL A;  3MN7 A;  4GVE A;  1DGK N;  4JEP A;  4CZH A;  3QML A;  4AM6 A;  3PIO L;  3CCE N;  3EN9 A;  3GL1 A;  3O9Q A;  5BRH A;  1NGE A;  3HOT A;  2GX9 A;  4H0X B;  3SAH A;  3Q7C A;  5BN8 A;  2D1K A;  3E66 A;  2H3G X;  2QWL A;  4DB3 A;  1Q81 O;  3TSQ A;  3L6Q A;  3CMA N;  5HOO A;  1YJW N;  3MCA B;  2WFB A;  3O5B A;  4MDB A;  3SBG A;  3HBT A;  4BR7 A;  4Z94 A;  3O6W A;  4U67 L;  3CJ1 A;  4BR2 A;  3ZX3 A;  5DM6 L;  3VOV A;  3VTH A;  4WYB A;  4BRL A;  2FXU A;  4KBO A;  4RCH A;  2ITM A;  5F1X A;  1VQ8 N;  5AZI B;  3CPW M;  1GLL O;  4B1U B;  2ZF5 O;  3WUH A;  2I7N A;  3HZ6 A;  5H1S Q;  3O1W A;  5FPM A;  4EFH A;  1JJ2 M;  1NGG A;  4NLB A;  4A2B A;  1VQ7 N;  2HMP A;  1RDU A;  4MDA A;  4WFB L;  3LM2 A;  2F9W A;  1NLV A;  4WQ5 A;  4A5A A;  1HJO A;  2GUP A;  4GV3 A;  4B1Y B;  1YAG A;  2YCH A;  2HBM A;  3EO3 A;  3MN9 A;  2P9L B;  4HWI A;  2E2N A;  3O4W A;  2KLA A;  3QB0 A;  4FSV A;  5GIO A;  2NLX A;  5E84 A;  3EKU A;  4I6M A;  4EHU A;  4QS7 A;  4JKB A;  3G4S N;  2AP1 A;  3JS6 A;  3LDO A;  1GLE G;  3R3L A;  4H0P A;  3UKR A;  5AQU A;  3FZL A;  2P9I B;  2A6A A;  3LDP A;  3A5M C;  3LDL A;  3N4Q A;  5AQX A;  3C0B A;  3HM8 A;  1T3V A;  3FGU A;  1HLU A;  3LDN A;  2QXL A;  4FWK A;  4JAX A;  4A57 A;  2VYP A;  3JXU A;  3PLA A;  3F2K A;  2IIR A;  3WXL A;  2KHO A;  1NGD A;  5AQZ A;  5BN9 A;  2UYT A;  2Q97 A;  5AQN A;  1QZ5 A;  4M63 C;  1TYQ A;  4B1X B;  4HTL A;  5M1Q A;  3WQT A;  4PL7 A;  2P9S B;  4JK9 A;  2WBN A;  3MN6 A;  4IZ9 A;  3VGK A;  3GG4 A;  3MMV A;  4PL8 A;  2PAV A;  4H0Y B;  2D4W A;  5AQT A;  2F7T A;  1S3X A;  1XQS C;  5AQF A;  3L0Q A;  3AAP A;  2NRV A;  3I8B A;  2CGK A;  1G99 A;  4WQ4 C;  2P9P A;  4FWM A;  1KAX A;  3ULE A;  1R59 O;  3A5O C;  5F0X A;  3E9L A;  1IJJ A;  5AZJ B;  2QWR A;  2GWK A;  2ASM A;  4OPH A;  2WC9 A;  3O1B A;  1VQK N;  1OVY A;  2P9N A;  3A8Y A;  2CGJ A;  4ISG A;  1NGF A;  3M6G A;  3UB5 A;  4JKH A;  2P9K A;  2ZJP L;  3U4L A;  1Q7Y O;  1CZA N;  1U2V B;  3TU5 A;  4BRP A;  1U6Z A;  3GDQ A;  4K25 A;  3MK6 A;  3TPQ A;  4CD3 A;  4IJA A;  3IFR A;  5AQQ A;  5AQM A;  1Q82 O;  4AM7 A;  3WEE B;  1GLD G;  3WXI A;  4A59 A;  1TUY A;  3C6H A;  2VWB A;  4K42 A;  3SBT A;  2OTL N;  5F2R A;  2NRH A;  3H3N O;  3W0L A;  5AFU A;  4JKD A;  5AQL A;  4O5F A;  3T7Z A;  1BU6 O;  4BVO A;  4JD2 B;  4JHD B;  4IEI A;  1NM1 A;  1JCG A;  2ASO A;  5C2F A;  5I9E B;  1RFQ A;  3VF2 A;  4CZG A;  4YOX A;  4FWL A;  3O9T A;  4BC4 A;  4BR5 A;  5CR4 A;  4FPB A;  4CZF A;  5ADX H;  1BA1 A;  2D0P A;  3EE9 A;  3M3Z A;  4NLC A;  5AQV A;  3RSE B;  5B8H A;  1YJN N;  1HKG A;  3ENB A;  4IOX A;  3OBW A;  3D2F A;  1T44 A;  2NRX A;  5AQH A;  1GLF O;  3ZX2 A;  3SMS A;  3G71 N;  1X3M A;  3UKU B;  3P38 A;  5JVG L;  3VEY A;  4H0V B;  2CH6 A;  3MX2 A;  5JMV A;  5JLF A;  5FPN A;  5DM7 L;  4QS9 A;  1YIJ N;  1QVG M;  5KQD A;  2IVN A;  1S72 N;  1K8K A;  3VEV A;  3H6E A;  5GAE P;  4AF1 A;  1D4X A;  4H5W A;  1DEJ A;  3HSC A;  3BUZ B;  1P8Z A;  1LCU A;  2Q0R A;  4FOI A;  1W2B M;  4IXC A;  1QQN A;  2P9U A;  3O08 A;  3FZF A;  4L3Q A;  3VGM A;  2W41 A;  3TTC A;  3C65 A;  4H5N A;  4FO0 A;  4IO8 A;  4YDU A;  3ZEU B;  4BRN A;  5CHI A;  4MLH A;  3CET A;  3D2E B;  2VCP A;  2FF3 B;  4CBX A;  4YOU A;  1SZ2 A;  4GV6 A;  2E2Q A;  3F5T A;  4BRE A;  2QW9 A;  3CCM N;  2A41 A;  4CZM A;  2A3Z A;  5EOY A;  3WXK A;  5CE3 A;  3VPZ A;  1KXP A;  5EX5 A;  5BPN A;  3IKM A;  3VMF B;  4KH4 A;  4FWR A;  3QBW A;  4LC9 B;  4PHT X;  5FPE A;  1VQ5 N;  1KAZ A;  2PFU A;  3MX5 A;  4XEI A;  3G25 A;  1EQY A;  3C6A A;  5BRE A;  3CIP A;  3D7E O;  3H3O B;  4WFN L;  1RDW X;  2GEL A;  3KWG A;  4GNI A;  3UE5 A;  5AQK A;  1YF5 L;  2YJF A;  1ATN A;  5C2D A;  5GAD P;  4O8K A;  3EE8 A;  3M1F A;  3WXJ A;  3CCU N;  4A61 A;  4H0T B;  3MN5 A;  5EXW A;  5TKW A;  4CZK A;  1QQO A;  1Z6R A;  3BEX A;  5AQI A;  4CBW A;  3U9Z A;  4WCE L;  3WT0 A;  2FSJ A;  4JKG A;  3EKS A;  2BTF A;  4H5R A;  4FWN A;  5AQY A;  2NRZ A;  1S22 A;  1BA0 A;  4DCH A;  1HX1 A;  1T6C A;  1TUU A;  4FWP A;  4BGA A;  3S41 A;  3ZET B;  5GAH P;  3OW2 M;  2IVP A;  1MA9 B;  1C0G A;  1NGB A;  3DXK A;  2JWL A;  2E8A A;  2ZJR L;  2A5X A;  1EO1 A;  3NMU A;  3CXC M;  1YJ9 N;  4XH1 A;  3LDQ A;  2GEM A;  1YI2 N;  1VQ6 N;  4BQZ A;  3CC4 N;  4BRD A;  4MO4 A;  4M7Y A;  4G9Z A;  1NBW A;  4XH4 A;  3EZW A;  3QDK A;  4FWS A;  1C0F A;  4IEE A;  2ZWH A;  3TTD A;  1ZC6 A;  2QWM A;  2E2P A;  3CCL N;  4JHD A;  1HPM A;  5M1F A;  3QFU A;  4GV9 A;  3H45 C;  2GTD A;  1QVF M;  5GIN A;  2Q0U A;  5JIC A;  3SK3 A;  4IWV A;  5C15 A;  4DKW A;  4FWQ A;  4K43 A;  4ISF A;  3G6E N;  1X9J A;  1VQL N;  1T6D A;  5AQJ A;  5LJV A;  3A5N C;  2RHK A;  3L4I A;  4JK8 A;  5BRF A;  3SLC A;  4UY8 O;  1NGC A;  3C7N A;  3Q7B A;  4K41 A;  4JN4 A;  4B1V A;  3R6M A;  1VQO N;  1DKG D;  4BY9 C;  1HUX A;  2BUP A;  4WQ5 C;  4H0O A;  1MWK A;  4YOY A;  4FWO A;  2Q2R A;  2ZJQ L;  4BQL A;  4JKE A;  1M90 O;  2Q31 A;  4MO5 A;  5AQO A;  3FR0 A;  5AQW A;  3AGK A;  1VQM N;  4M7X A;  2AA4 A;  3SMP A;  3DJC A;  2QWO A;  1WUA A;  3I33 A;  3ID8 A;  4EIA A;  3VEZ A;  1VQN N;  4I6M B;  1QHA A;  4EHT A;  3VET A;  3DXM B;  4BRM A;  3D2E A;  1P90 A;  1MDU B;  1NGH A;  1ZXO A;  2RE2 A;  3B8A X;  3DAW A;  3OBY A;  4BRC A;  5GIP A;  3H46 O;  1QZ6 A;  2CH5 A;  4NO7 A;  3CC7 N;  3QBX A;  1MWM A;  2D0O A;  2IVO A;  3VEN A;  5GAG P;  3GE1 A;  5KPT A;  3I55 N;  3OHR A;  4IDH A;  3SAG A;  2VGN A;  2V7Y A;  3ZYY X;  4BR0 A;  4WF9 L;  3BF3 A;  1TYQ B;  4KH5 A;  3QIC A;  3O9R A;  3CJC A;  3CCJ N;  4BRO A;  5AQP A;  1E4F T;  5BR9 A;  3U9D A;  5AZI A;  2YX6 A;  3TSU A;  4FL9 A;  4BRG A;  1LOT B;  1Q18 A;  3A5L C;  1BWF O;  4OPA A;  4YOT A;  1Q86 O;  4J8F A;  5M1P A;  5ADX A;  2P9P B;  4RWT A;  3ATU A;  4H5V A;  3ULE B;  4B9Q A;  1J6Z A;  4O8U A;  3P4I A;  3IMX A;  3FE1 A;  3VES A;  3CQX A;  3CF5 L;  4CZJ A;  3VGL A;  4A62 A;  3U8X A;  3AGR A;  3CI5 A;  5JVH L;  2NRT A;  3EL2 A;  4RTF D;  1K8A O;  1NMD A;  3CJ9 A;  3O8M A;  3R8E A;  4B1Z A;  2P9L A;  2YHY A;  5KPZ A;  3CC2 N;  2JWK A;  2V52 B;  2Q1N A;  4KH6 A;  4BG8 A;  3GBT A;  4JNE A;  1HKC A;  3DLL L;  4BRF A;  4DHY A;  5FPD A;  3CD6 N;  3GOI A;  4A2A A;  1VQ4 N;  1V4T A;  3SAF A;  4IFE A;  1Y64 A;  1IG8 A;  1ILY A;  2P9I A;  2QA4 N;  2YHW A;  1GLJ O;  1VAZ A;  4U7B A;  3NVK A;  3CQY A;  3PIP L;  1KD1 O;  1E4G T;  3H1Q A;  2FLO A;  1ATS A;  2QTD A;  2ZGZ A;  2KKZ A;  4JKF A;  2HOE A;  3CJA A;  4H03 B;  4NB4 A;  3KWI A;  4R79 A;  4PKI A;  3ZX0 A;  3O9S A;  3ENO A;  4BRK A;  2P9S A;  1W97 L;  3NVM A;  4A5B A;  3HOS A;  5BPM A;  4BC3 A;  1YIT N;  3IDH A;  3DWL A;  5BPL A;  1HKB A;  1OKJ A;  4CZE A;  3MDQ A;  3QFP A;  5EVZ A;  5M1O A;  3CCV N;  3D2F B;  1WOQ A;  4YOW A;  2ZGY A;  3CCS N;  1SQK A;  2ASP A;  4QS8 A;  2QEX N;  4BC5 A;  2NNW A;  3E9P A;  1V4S A;  4WFA L;  4WQ4 A;  2QI2 A;  3KVG A;  1XC3 A;  3AAR A;  3LM9 A;  2HBK A;  5BRD A;  1KC8 O;  5AZJ A;  1K8K B;  2EWS A;  3E9O A;  3ENH A;  1SAZ A;  2FSK A;  4EAH D;  2W40 A;  1NGJ A;  2V7Z A;  1N8R O;  2E1Y A;  4FVU A;  3MWP A;  2P9U B;  1BUP A;  1U2V A;  5AR0 A;  4BRI A;  2Q36 A;  4YDU C;  3VEX A;  1BDG A;  2E1Z A;  2V51 B;  3MWT A;  4BC2 A;  4IOC L;  3T69 A;  3W3D A;  1DT9 A;  5MLC Q;  3BP8 A;  4JK7 A;  3ID6 A;  3WEE A;  1O13 A;  3HRG A;  3MCP A;  4ISE A;  3CCR N;  3CHW A;  1NWK A;  2A42 A;  1QQM A;  5LJW A;  4IO9 L;  1SS6 A;  2J4R A;  2CGL A;  3ATV A;  1NGI A;  4H5T A;  3DXM A;  4JD2 A;  2HF4 A;  5AQS A;  3CPE A;  5TKY A;  2GWJ A;  3TSP A;  3KK7 A;  4YOR A;  3R9P A;  3HI0 A;  2QWQ A;  3TTF A;  1K73 O;  3CJ7 A;  1YXQ A;  3K9J A;  3H1V X;  3RSE A;  1X3N A;  2NRR A;  3CJB A;  3HTV A;  4C1N I;  3BF1 A;  4F9O A;  4JKA A;  1NGA A;  3F9M A;  3VF6 A;  4Y0W A;  1KQS M;  4BG9 A;  3UKU A;  4C1N K;  1NJI O;  3KZB A;  1GLC G;  2HST A;  4ILG B;  2F9T A;  2FF6 A;  4MLE A;  4E1J A;  2QWP A;  3D6R A;  5E26 A;  4PKG A;  3K9K A;  1YUW A;  4CBU A;  3FLC O;  4DQ8 A;  4FPA A;  3CCQ N;  3VTI A;  1ESV A;  4JKG B;  3FZM A;  5KPR A;  4YOV A;  5JLH A;  3VEO A;  5HL7 L;  3WQU A;  2BH1 A;  3N4P A;  3A0I X;  5AFU H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...