4BC4A

Crystal structure of human d-xylulokinase in complex with d-xylulose
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
525
structure length
525
Chain Sequence
RRCCLGWDFSTQQVKVVAVDAELNVFYEESVHFDRDLPEFGTQGGVHVHKDGLTVTSPVLMWVQALDIILEKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLSPDLRLHQQLQDCFSISDCPVWMDSSTTAQCRQLEAAVGGAQALSCLTGSRAYERFTGNQIAKIYQQNPEAYSHTERISLVSSFAASLFLGSYSPIDYSDGSGMNLLQIQDKVWSQACLGACAPHLEEKLSPPVPSCSVVGAISSYYVQRYGFPPGCKVVAFTGDNPASLAGMRLEEGDIAVSLGTSDTLFLWLQEPMPALEGHIFCNPVDSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSKALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDVEVRALIEGQFMAKRIHAEGLGYRVMSKTKILATGGASHNREILQVLADVFDAPVYVIDTANSACVGSAYRAFHGLAGGTDVPFSEVVKLAPNPRLAATPSPGASQVYEALLPQYAKLEQRILSQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords XYLULOSE KINASE
publication title Structure and Function of Human Xylulokinase, an Enzyme with Important Roles in Carbohydrate Metabolism
pubmed doi rcsb
source organism Homo sapiens
total genus 181
structure length 525
sequence length 525
chains with identical sequence B, C
ec nomenclature ec 2.7.1.17: Xylulokinase.
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00370 FGGY_N FGGY family of carbohydrate kinases, N-terminal domain
A PF02782 FGGY_C FGGY family of carbohydrate kinases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4bc4A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4bc4A01
4FOIA 3O8MA 3VEVA 1NGAA 4IXCA 1XUPO 4AM7A 4BG9A 3L0QA 1MWMA 1GLDG 2YCHA 4A2AA 1HKBA 5AQNA 3JS6A 4J8FA 5AQOA 1BWFO 4MLEA 4PL8A 2OANA 2A6AA 4B1ZA 1J6ZA 2E2QA 4AM6A 3QFPA 5TKYA 2IVPA 4CBUA 2W40A 1HKGA 1RGIA 4IO8A 2A41A 3GBTA 1S22A 2W41A 4XH5A 2YJFA 4ISGA 3IUCA 4FWKA 3WUHA 3VEYA 2HF3A 3ZX0A 5KPRA 3CIPA 2PAVA 1Y64A 1NGFA 1NBWA 2P9IA 1JCEA 3EN9A 5AQRA 2E1ZA 2D1KA 1MDUB 3D2FA 3EZWA 3GL1A 5AQWA 2A5XA 4MO4A 3SMPA 4BR2A 3FZMA 3BUZB 3ZEUB 2UYTA 2WUSA 3C0BA 3BF3A 1RFQA 3IFRA 3KZBA 3IDHA 4A61A 3U9DA 3QFUA 3O4WA 2QWNA 5AQTA 4M63C 2I7PA 4FPBA 3D2EB 2E88A 3AAQA 2FF6A 2GUPA 3CI5A 2P9LA 4NB4A 3GDQA 2QWOA 5FPDA 2YI1A 3FZHA 1U2VB 5BN9A 1NLVA 3IMXA 4FWMA 5AQXA 2E8AA 2QXLA 4BRAA 1V4SA 5BRDA 2P9SB 5JLHA 1TUUA 3CJBA 1MA9B 4H0VB 1HX1A 3EKSA 2GELA 3OHRA 4O5FA 5ADXA 1GLBG 2ASPA 3WQUA 1HJOA 3VGLA 1SZ2A 2P9NA 4K41A 5LJWA 2CH6A 3JXUA 3ZX3A 4JD2B 4BRFA 1XC3A 4BRPA 2ASOA 3U9ZA 1EQYA 3R8EA 2YHXA 3QICA 3TPQA 5JMVA 3J8AA 3W3DA 2QM1A 3ZETA 1GLFO 4CZMA 4B1WB 1QHAA 3UKUA 2CGJA 3AAPA 3H3OB 4GNIA 2ASMA 2CH5A 4NO7A 2D0OA 3ID8A 4BRNA 4CZLA 4EFHA 4PL7A 2P9IB 5EX5A 3H3NO 3ZEUA 3P4IA 4BR4A 4ISEA 3FE1A 3KHYA 3U8XA 1OKJA 1NWKA 3CJ9A 5BPNA 1GLEG 4HTLA 4JHDB 2YJEA 3FR0A 2ZF5O 5BREA 5KPTA 4KBOA 1NGIA 3DXMB 2FXUA 5AQSA 5AFUH 2GTDA 3SK3A 3ENOA 4RTFD 3B8AX 1QZ6A 1ZC6A 2P9LB 2P9SA 2V52B 4M7XA 2IVNA 3M1FA 3CETA 4ISFA 3HI0A 1YUWA 1ZBSA 2GWKA 4BR5A 1MWKA 3FLCO 3UB5A 4CZHA 1BUPA 4BC5A 4CD3A 2HOEA 3LM2A 3R6MA 3HSCA 3F9MA 4JD2A 4WYBA 1HPMA 4Y0WA 4CBWA 4CZKA 4BRGA 3C7NA 2A3ZA 1E4GT 1ATNA 3FGUA 4WQ4A 4BRDA 2P9NB 3W0LA 2H3GX 5EY4A 3LDPA 4BRLA 5KQDA 1XQSC 4IWVA 2DPNA 4B1VA 4BRIA 1E4FT 1WOQA 4F9OA 4CD1A 2D4WA 2P9KB 3O80A 3HTVA 1KAZA 3CJCA 4LC9B 3ZETB 1KAXA 2P9UA 4CZJA 1H1VA 3BF1A 1NGGA 3UKUB 3LDNA 2P9PB 5AZJB 3VEZA 3FFKB 4H5RA 5AQIA 4BRKA 3MDQA 1DEJA 3M3ZA 1Q18A 4BGAA 3QBWA 1DGKN 5AR0A 4JHDA 5BPMA 3QB0A 3QBXA 4M7YA 4A62A 4BREA 1X3MA 2QWPA 3BEXA 5AQHA 1LOTB 5E84A 1SQKA 3DJCA 1ATSA 3DXMA 3LDOA 4FWSA 4BRCA 3VGKA 1BA1A 4K42A 3DAWA 3O08A 1V4TA 2GWJA 1T44A 3FZKA 3H45C 4H5TA 4QS8A 3UKRB 4EAHD 1ZXOA 2E2OA 3I33A 1C0FA 5AQPA 4YDUC 1ATRA 2ZGYA 3O1WA 1QQOA 1JCGA 3ENHA 1YVNA 5B8HA 5EXWA 4BROA 3SMSA 1KAYA 2Q31A 2Q2RA 4QS7A 4BRHA 1Z6RA 5JICA 4RWTA 2QWRA 3WXJA 3H6EA 4IJNA 3AARA 3VF4A 3C7NB 3H1VX 2AA4A 2Q97A 2I7NA 4L3QA 3A5NC 3GOIA 3S41A 1Z05A 3VESA 5EVZA 1IG8A 2P9KA 4FL9A 2D0PA 4PKGA 4C23A 4BR0A 5LJVA 2PBDA 3HZ6A 3WXLA 3MCPA 1NGJA 1YAGA 2P9PA 2QWQA 2E1YA 1TUYA 5AZJA 4FWQA 5ADXH 2P9UB 1NGDA 4EIAA 4FWNA 3WXIA 4H03B 5AZIB 3VENA 2V7YA 3CQXA 5AQJA 1R59O 4BC2A 3H1QA 2A40A 3CQYA 1DKGD 3ATVA 3WEEB 2ITMA 2BUPA 1NGHA 4FO0A 5JLFA 4H5NA 4EHUA 1QQMA 4IJAA 1BDGA 2Q36A 4DHYA 4K25A 5I9EB 1IJJA 5KQ8A 1BU6O 2CGLA 1K8KA 1P8ZA 3L6QA 2E20A 1HKCA 3UKRA 4CZFA 4BR9A 1T6DA 3ATUA 4K43A 2YHWA 5F2RA 2QW9A 2F9WA 5EOYA 3SLCA 1G99A 4QS9A 1SAZA 5AQUA 3CHWA 3VF6A 1QZ5A 4YDUA 5AQQA 4BC3A 5BN8A 5AQYA 1X9JA 3A0IX 4PKHA 5CE3A 3VETA 2IVOA 3DXKA 5AQLA 2QWMA 4JNEA 3QDKA 4B1XB 3SJHA 4DQ8A 2YHYA 3VERA 4BVPA 2GEMA 1QQNA 3O6WA 3A5LC 3FZFA 4XEIA 4PKIA 5AQZA 3VPZA 3GG4A 2Q0RA 4CZEA 4DB3A 3MK6A 3FZLA 2J4RA 3QMLA 2E2NA 3EO3A 3LM9A 2IIRA 4FWLA 4B1YB 4XH1A 5KPZA 2AP1A 5AQFA 1NMDA 5AZIA 2NLXA 3LL3A 4O8KA 1BOTO 1LCUA 1S3XA 3VGMA 1GLJO 4FSVA 3H46O 1U6ZA 1YXQA 3VEXA 2FSKA 3WEEA 3HBTA 1C0GA 3UE5A 3A5MC 4H5VA 3I8BA 3DWLA 4FWPA 3ULEB 3A8YA 1TYQA 2ZGZA 4FOEA 4B1UB 5F0XA 4RCHA 4CI6A 5E26A 4H0PA 3HM8A 4JN4A 2QWLA 4MO5A 4Z94A 5BRHA 5BR9A 2FSNA 3CJ7A 4E1JA 3MN6A 2VYPA 4DCHA 1K8KB 2E2PA 3KVGA 4GY2B 3ZX2A 2CGKA 3RSEB 1RDWX 2V51B 3LDLA 2KHOA 4BVOA 4EHTA 3G25A 4I6MB 2A42A 3WXKA 5FPNA 4BG8A 1D4XA 2VWBA 2HMPA 1NM1A 4FPAA 5AQGA 4WQ5C 1BO5O 1X3NA 2FLOA 3WQTA 3DXKB 4A2BA 3CERA 2NRHA 4H0OA 4BQZA 3O5BA 4CZIA 5FPEA 4B9QA 2ZWHA 2F9TA 2EWSA 4HWIA 1NGBA 2HF4A 4XH4A 1JCFA 5BPLA 3WT0A 4BQLA 3M6GA 4BRMA 4BGBA 4CBXA 3A5OC 3U4LA 3LDQA 4MLHA 3EL2A 1CZAN 5AQVA 4WQ4C 4FWOA 1WUAA 3GE1A 5AQKA 4H5WA 3ULEA 1NGEA 4H0XB 3EKUA 1GLAG 1ESVA 4BR7A 1BA0A 5BRFA 3L4IA 4IZ9A 2NZTA 5ELZA 4H0YB 4H0TB 3VOVA 1TYQB 1KXPA 3AY9A 1GLCG 5AFUA 2V7ZA 3RSEA 3MN9A 5LY3A 3TU5A 4CJ7A 1HUXA 3BP8A 3VEOA 4I6MA 3D2FB 3VEWA 1BG3A 2FSJA 3R9PA 5FPMA 4BC4A 3O1BA 2Q0UA 3MN7A 2VCPA 3MMVA 3CJAA 3D2EA 4BRQA 4JAXA 4FWRA 3VF2A 1GLLO 1HLUA 2BTFA 3MN5A 1U2VA 1T6CA 2FF3B 4CZGA 3CJ1A 3D7EO 4WQ5A 1NGCA 5AQMA 5F1XA 2Q1NA
chains in the Genus database with same CATH superfamily
3RR7A 4N47A 4K0KK 4B8AB 4IXCA 3ZSRA 2VG5A 4NCGA 1FJGK 1QSSA 4CHQA 4CJ3A 5HBMA 1RT7A 1GLDG 2YCHA 5DMRA 2O8EB 1TV6A 3E9LA 4DSJA 2FBXA 2G8WA 1HKBA 1BL3A 4EP4A 4K8XA 3NVMA 2E2QA 3JYTA 4DR1K 5TKYA 1RDUA 2IVPA 4CBUA 4FLXA 2OPPA 4ELTA 1KC8O 3S9HA 3KLEA 2A41A 3T1HK 4ISGA 3OA9A 2HF3A 1TGOA 4CJRA 2P1JA 5KPRA 1VSKA 4KI6A 4CIFA 4EZ6A 1WAFA 1NBWA 2P9IA 3EN9A 4Z4CA 3KK3A 5AQRA 4FK4A 1NK9A 2P5GA 2NUBA 3DLBA 3EZWA 3GL1A 3OY9A 4KH6A 3NHGA 4CHYA 2A5XA 4MO4A 2UXBK 3EY1A 2WUSA 3C0BA 3KZBA 2VQFK 2OCEA 4CIEA 3L3UA 3RVCA 3QFUA 3HPOA 1FW6A 2HVIA 4FPBA 3D2EB 2E88A 3AAQA 3HPGA 2O8CA 3CQ8A 4DR2K 2HMIA 3B6OA 4GKKK 2GUPA 2O8BA 5CYQA 4CJ4A 4FW1A 3CC7N 3C6AA 1NLVA 1HPZA 5AQXA 2QKKA 1U47A 3C95A 5BRDA 2P9SB 4CE9A 1UA0A 4PQUA 2QA4N 1RTHA 4KTZA 1MA9B 4ZTJA 1J5EK 4F3TA 1SUQA 2GELA 2HW3A 2WOMA 1GLBG 3V9UA 1SZ2A 1SL2A 4NXMK 2P9NA 1EWQA 1RBSA 2JWKA 4BRPA 4KHUA 1S5JA 3R8EA 1TL3A 2YHXA 4F3OA 3RMCA 5DK5A 4JV5K 2JLEA 5HP1A 3C6TA 1CZ9A 3AAPA 3H3OB 4ZHRA 3SQ4A 4M3YA 2P9IB 1WBDA 4DQQA 1J9AA 4OLBA 3KHYA 5EU7A 3SNNA 1OKJA 1NWKA 3CJ9A 3D45A 3AGKA 5BPNA 3ZT0A 3KTQA 3DM2A 3KLHA 1JLAA 3FR0A 3WNFA 3LZJA 2ZF5O 3CF5L 4KBOA 1NGIA 1S1TA 3P39A 3T3FA 1UWBA 3R3LA 3AVIA 3SV4A 2O8CB 1Q7YO 3J81O 4C1NK 1ZC6A 2V52B 1Q86O 1RT5A 4Q0BA 2PYLA 3CETA 4BR5A 4CJEA 1MWKA 3TAFA 3A2FA 4AHUA 3HK2A 4JKHA 3OYEA 2HOEA 4JI4K 1ZBHA 2XY5A 2W6LA 4CBWA 4CZKA 3V1QA 3RRHA 4BRDA 2P9NB 2HHXA 4JKDA 2DPNA 4B1VA 1KFDA 4O0IA 1E4FT 2P9KB 3RR8A 3K9JA 1KAZA 1VQ7N 2P9UA 2G8FA 1NGGA 1RCHA 3SQ2A 1HJRA 3DI6A 4B3SK 3SZ2A 4KHNA 1IO2A 3J7ZO 3NH2A 3OYNA 4DKWA 3NGIA 5C2FA 3QEPA 4OLAA 1NU0A 2E4LA 1S1WA 3QBXA 3CCJN 1I39A 1WSGA 5AQHA 4KKOA 5E84A 1SQKA 2FBTA 3V9WA 3VGKA 1BA1A 3QO9A 4CFBA 1V4TA 2A1RA 2RF2A 4PA1A 1NK7A 3AVMA 4DTJA 4H5TA 2DFEA 1J53A 5SZTA 4EAHD 3SUNA 3VQBA 1C0FA 4QAGA 2W6KA 5AQPA 1NK4A 4CJPA 1SV5A 2ZGYA 3K5MA 3O1WA 4JEPA 4E89A 4LF9K 3Q7CA 3SMSA 1KAYA 4OKJA 3THXB 5JICA 4CF0A 3SUOA 3ZLJA 1JLEA 3H1VX 1WSEA 3A5NC 3GOIA 3VESA 1Z05A 3RMDA 4BY9C 2RE2A 2YV0X 4C23A 2IGIA 4JI8K 4DR4K 2PBDA 3HZ6A 3OYHA 3MCPA 2KW4A 1NK0A 1RT1A 4M3RA 2P9PA 1LWEA 2EHGA 1Q9YA 3LZIA 4NLCA 1QSYA 2P9UB 1N5YA 3WXIA 4H03B 3TWHA 4DTPA 2A40A 1NKEA 4CGHA 3ATVA 2ITMA 3PX6A 5JLFA 1VQKN 1HYZA 3BGRA 2Y1IA 4IJAA 1BDGA 3KIOA 4JKAA 4KB0A 4K25A 1T03A 1KTQA 1BU6O 4FLUA 3T1YK 1K8KA 3S3NA 3UKRA 1T6DA 3ATUA 1XMOK 5I42A 4FZXC 4DV6K 3VA0A 4FK0A 5C15A 2F9WA 2E6MA 4J2EA 2IS3A 5J2MA 4DR6K 3NCIA 4AILC 1K6YA 3CHWA 4CEQA 3HVTA 5BN8A 2HHHK 4JKGB 3KWIA 3VQAA 3DXKA 4DTNA 3SJHA 2YHYA 3VERA 2GEMA 2OPSA 3FZFA 1LW2A 1RTIA 4LF8K 4IG3A 4CZEA 3MK6A 2OPQA 2J4RA 3L2QA 4GMJB 1JLCA 3VQ6A 1RDAA 4V19S 4CF2A 4DFPA 5KPZA 5AQFA 4B8CA 5AZIA 3DLHA 1S3XA 1ILYA 3TSPA 1UAXA 3DOKA 4FJGA 4LF7K 3CD6N 1BI4B 3VEXA 3WEEA 1YTAA 3OYCA 1KLNA 3A5MC 4E7IA 4FWPA 4FOEA 2Q3SA 4CGJA 4DTSA 5E26A 1NG9A 3HM8A 1IV0A 3EE9A 5DM7L 4CJLA 2ZM6K 3O3HA 1K8KB 2E2PA 3KVGA 2OZMA 3TAGA 1J5OA 3ZX2A 4DQIA 2F7TA 3NE6A 2V51B 1A5XA 4MQ3A 3WXKA 3P1GA 3G10A 4LFAK 2LSNA 2HMPA 2ZQBA 1WSJA 2Z1GA 5AQGA 4YOYA 1X3NA 3DXKB 3DLLL 1A5VA 1T05A 4H0OA 2WC9A 4BQZA 4CZIA 4LSLA 2I5JA 5T7BA 2ZJPL 4HWIA 3AVFA 2F8TA 3F5TA 2HF4A 3MXJA 1JCFA 3WT0A 3CPEA 4BGBA 4E1NA 4CBXA 4MLHA 5AQVA 3AO1A 1W97L 4WQ4C 3AO2A 4CJ5A 3ULEA 4H0XB 3EKUA 1GLAG 3AA5X 3MXIA 3C6UA 2Y1JA 2NZTA 1RTJA 3QINA 4H0YB 2R7YA 4PUOA 3J7YP 5M1PA 1OH8A 3CCEN 5BR8K 3AY9A 4ELVA 2V7ZA 3E1YA 3PY8A 1WLJA 4CJUA 3VEOA 3D2FB 1YJ9N 3R9PA 2YHBA 1O1WA 3MN7A 2VCPA 3P31A 1EXQA 3I55N 2QKBA 3OYGA 1CXUA 3ZSQA 4JKBA 1JLFA 3LDSA 3TSUA 3MN5A 3M8RA 4AQYK 4JI1K 1U2VA 5LL6Z 1XI1A 1N8RO 1NGCA 3CMAN 1KD1O 1Z6RA 1Q8IA 3ZT4A 4XIUA 3O8MA 4BG9A 4AM7A 3L0QA 3LP1A 1TK0A 3SCXA 1X9MA 4JK9A 4A2AA 2JWLA 5AQNA 1BWFO 2FBYA 4PL8A 4YORA 4B9NA 3CXCM 3CCMN 3CCRN 2Z1HA 1BHLA 4HUGA 3QFPA 1IKWA 3F9KA 2W40A 1HKGA 3JAMO 2PYJA 4DR7K 3GBTA 4CK2A 3D0PA 2HHUA 1W7AA 3ZSYA 3WUHA 3T7ZA 3VEYA 4DUZK 1Y97A 3CIPA 2E1ZA 2D1KA 4C8NA 5GAHP 4OKEA 3SMPA 2HNZA 3ZEUB 4YOWA 1YF5L 5M1KA 4OGCA 4A61A 3IDHA 3L3VA 5JS1A 4AHVA 3HRGA 1S6PA 5AQTA 4M63C 3N4PA 3K58A 1JXBA 3CG7A 4FLWA 4KB1A 3M8PA 2FF6A 2P9LA 5MLCQ 5FPDA 3UIQA 5J2PA 1U2VB 3IMXA 1Q82O 1V4SA 2HBJA 3ZT1A 3OYAA 3KJVA 1OH5A 4FJ8A 1GOCA 4IOXA 1HX1A 3MECA 5ADXA 1ZBUA 1IKYA 1BCOA 1HJOA 2ASPA 4B9LA 5LJWA 1NJWA 1JLGA 4BWMA 3TSQA 1D9DA 1FKPA 3U9ZA 2X74A 4LD0A 4JK8A 1QQCA 3J8AA 1HQUA 3ZETA 4DV7K 1BIUA 4CZMA 2WTUA 2CGJA 4GNIA 2ASMA 2D0OA 3ID8A 4EZ9A 4CZLA 2RKIA 5EX5A 4J2AA 3P83D 2YKMA 4GVEA 3KD5E 4FJKA 3AVKA 3K5OA 1GLEG 4HTLA 4JHDB 2YJEA 3G0ZA 4CGDA 5BREA 2F96A 5C0YA 4LY7A 4AHTA 1NKBA 3DXMB 2FXUA 4DQSA 2VWKA 3QIOA 1Z26A 2B5JA 4M42A 3SK3A 2VG7A 1L3TA 1QZ6A 3MXMA 2P9LB 2P9SA 4CFCA 1KVBA 3T1AA 1WB9A 4I7FA 4ISFA 1ZBSA 3V4IA 1YTUA 5H1SQ 3LM2A 3R6MA 3KWGA 1VHXA 4GV3A 4WYBA 1HPMA 3AA4A 3QLHA 2A3ZA 4IFEA 1E4GT 1HYSA 2YHAA 2G8UA 3O4NA 2H3GX 4BRLA 3LAKA 5IT9O 3J7AP 3BY5A 2PY5A 1WOQA 3CFOA 4CD1A 3SPYA 2D4WA 4CFAA 3HTVA 2OPRA 3NF9A 3CJCA 4LC9B 4OGEA 3ZETB 5JVGL 1H1VA 4RW9A 2UUCK 1T8EA 1OVYA 3LDNA 1Q9XA 4H5RA 5AQIA 4DQPA 3K5NA 4CVNE 4JI0K 4BREA 1LW0A 1X3MA 2NRZA 2WONA 3BEXA 2KFNA 1LOTB 5GINA 1M90O 3DJCA 4BRCA 4K42A 3O08A 3VQCA 2GWJA 3TI0A 3L2WA 3WNHA 3WNEA 4QS8A 5I3UA 3P38A 4FJHA 2E2OA 2YNGA 4DSKA 4DV2K 2HVHA 3PUFA 4KO0A 4AHRA 1YVNA 1XNQK 2VGMA 2Q2RA 3AVNA 2HHSA 4FJ5A 1YHQN 4BRHA 3ZCMA 4NYNA 2QWRA 4O8UA 4Z0UA 1LAVA 3CCUN 3H6EA 4IJNA 3MWPA 3VF4A 2AA4A 2Q97A 2I7NA 1RNHA 3O3FA 5EVZA 1IG8A 2P9KA 5E41A 4OVLA 4FL9A 4JKCA 2WFBA 4DV3K 2BANA 3WXLA 2VQEK 4C1NI 1NGJA 1VSIA 1YAGA 2KZMA 1TUYA 1VSHA 4N56A 1RTDA 4CF1A 4CJWA 4BE0A 4F2RA 1ZBLA 1VAZA 1LWFA 5M1FA 3LWLA 3TAEA 3DLGA 3CQXA 3LANA 3H1QA 4G1QA 4DLEA 3K5LA 4FK2A 1X9SA 4GVMA 2F8SA 4G9ZA 3AVHA 3NBPA 4CJTA 1LV5A 1MU2A 2KFZA 1YVUA 2QEXN 2NRWA 3G4SN 1RT2A 1HKCA 1RBVA 4JKFA 4FZZA 2QI2A 4M3XA 2YHWA 5F2RA 2QW9A 4UQGA 4UY8O 1U49A 4CFDA 3IAYA 5CYMA 4WF9L 4DTRA 2B6AA 1HNIA 3EE8A 2ITGA 1QZ5A 1CXQA 4DTXA 3THXA 5AQYA 4O44A 3VETA 2YNFA 1S6QA 3E9OA 3VPZA 3O6WA 3GG4A 4CK3A 1QVGM 3OYJA 4CK1A 4PY5A 3FZLA 1TK5A 3CM5A 2HHVA 1S1UA 3EO3A 4CJQA 2IIRA 3NFAA 2E5LK 1RDDA 4OPAA 4EP5A 2FBVA 3VGMA 2OTLN 3NGYA 3O9TA 4Z4HA 3LAMA 2G8IA 4FJJA 4I2QA 1GLJO 5C12A 4FSVA 3L4QA 3HBTA 5M1NA 1C0GA 4H5VA 4JI7K 4E7HA 5KRTA 4CIGA 1R0AA 3A8YA 4RCHA 2O4GA 2DFFA 4JN4A 2QWLA 4MO5A 4Z94A 1C1BA 5BRHA 4CHPA 3MX2A 3K0SA 3MN6A 2VYPA 2X6NA 2CGKA 3RSEB 4I9QA 1RDWX 3PLAA 3LDLA 3MCAB 1D8YA 4BVOA 4EHTA 3G25A 1KRPA 4JKGA 2A42A 4JI5K 4FZYA 3IG1A 4BG8A 1D4XA 3THYB 1RDCA 4C8OA 4FPAA 2JGUA 4YY3K 3HM9A 1L3SA 2PZSA 1N36K 1S1XA 5D3GA 4BWJA 4OPKA 2ZWHA 2F9TA 3L2UA 3TABA 1NGBA 4XH4A 1C6VA 4YHHK 3SBTA 4BQLA 3D6RA 3OYLA 3LDQA 1BI4A 3E01A 4E7KA 3THWB 1WUAA 1QHTA 5AQKA 4H5WA 4E0DA 1BA0A 4KPYA 3VN5A 5BRFA 3KK2A 5ELZA 4O0JA 4B9VA 1S72N 1HR0K 1GOBA 2KQ2A 5FRMA 1NKCA 3VOVA 3K57A 4CHZA 3SUPA 1KXPA 4W5TA 4H4MA 5AFUA 5LY3A 4M3ZA 1IBMK 1FXXA 1VQ4N 3BP8A 4YOTA 3KK1A 3HXMA 3ZYYX 1BG3A 3VQ5A 2FSJA 3DMJA 4BDYA 3QERA 1IBLK 3O1BA 2Q0UA 3CJAA 4CHNA 4LH4A 1RT3A 2BE2A 3CYMA 1NK5A 1JLQA 4BRQA 2O8DB 4FWRA 4LFBK 4CEEA 1GLLO 1HLUA 1EP4A 1XHZA 1T6CA 2Z1IA 3D7EO 4M45A 4DTMA 5F1XA 5HLFA 4FOIA 1IKVA 3VEVA 5KRSA 1HNVA 2A1SA 3IS9A 1L3VA 2AJQA 3SAGA 1MWMA 3PSIA 2VWJA 4FM1A 4J8FA 1EWRA 3AVAA 4MLEA 2BH1A 2A6AA 2OANA 4DSIA 4PHTX 1K8AO 1VSFA 2NRXA 3PIOL 1S22A 4XH5A 3IUCA 4FWKA 4BDZA 4F2SA 3ZX0A 4DMNA 5FROA 2VG6A 2B4JA 3NH1A 1MDUB 2YNIA 3DYAA 2ZE2A 3D2FA 1ASUA 4KI4A 5C42A 4CEOA 3VQDA 4ICLA 1OVQA 4BR2A 4CEZA 1VQON 2UYTA 3IFRA 4B3TK 1DTTA 3R1XA 4KHWA 5FDLA 1D5AA 3I0SA 3KKRA 3U9DA 4DU4A 2KTQA 4PWDA 2I7PA 3K59A 1NNEA 3BDPA 1BQNA 3V81A 3E66A 4NB4A 2NRVA 2YI1A 5HL7L 3SBGA 5BN9A 4DG1A 4FJNA 4FWMA 4DU3A 2E8AA 2QXLA 4BRAA 4AHSA 5JLHA 1NJZA 3CJBA 2DFHA 3VTIA 1VSJA 3PV8A 4H0VB 3OHRA 4O5FA 3TARA 4R5PA 3VGLA 2G8VA 3JXUA 3ZX3A 4JD2B 5HRPA 1W0HA 1XC3A 1JJ2M 3OJSA 4KHSA 3NMUA 1BQMA 3CCQN 4A57A 5JMVA 4AHCA 5C10A 3W3DA 4IOAL 2HHQA 1RILA 4B9UA 1WN7A 1GLFO 4NXNK 2YKNA 1QHAA 3HYFA 2CH5A 4NO7A 3G6EN 4DSFA 4BRNA 5JS2A 1WAJA 4PL7A 4DFJA 3BZCA 3AA3A 3I56N 3ZEUA 1KQSM 2HBKA 4IDHA 1HNZK 3TR8A 5GIOA 3U8XA 3MX5A 2IC3A 2XRIA 5HRSA 4JI3K 3TTCA 3BZKA 4LF6K 4KH4A 3SPZA 4JS4A 1VSLA 3K9KA 4R79A 3AV9A 1KSPA 1QTMA 4RTFD 1RBRA 2XO7A 3CFPA 1SL0A 1U48A 4M7XA 1C0UA 3M1FA 2HHWA 3HI0A 1YUWA 2GWKA 3FLCO 3UB5A 4CZHA 1BUPA 1KLMA 4BC5A 4CD3A 1J54A 4Y0WA 3L2VA 1YI2N 3TANA 3SV3A 3H08A 4KAZA 4F4KA 4GKJK 1ATNA 1KVCA 3FGUA 4WQ4A 3PX0A 5EY4A 3LDPA 5KQDA 1XQSC 3QIPA 4IWVA 3IRXA 4BRIA 4F9OA 3O80A 1KAXA 1FK9A 4MFBA 5AZJB 4CF8A 4CERA 1TK8A 3FFKB 4IEIA 4BRKA 4AH9A 3OYBA 4BGAA 1Q18A 1HMVA 3QBWA 1DGKN 5AR0A 4JHDA 4M7YA 4KFBA 3KKSA 2QWPA 4HHTA 3TAPA 3DXMA 1ATSA 3LDOA 4FWSA 2OZSA 5DM6L 3FZKA 1XC9A 3H45C 3AGRA 2NNWA 3M8SA 3J80O 1ZXOA 2XY6A 3I33A 4ZTFA 4GV6A 4CF9A 4DFKA 4O55A 2XY8A 1WBBA 4MDAA 1YIJN 1QQOA 5JVHL 5B8HA 5EXWA 4A5BA 5IWAK 3QESA 4QS7A 3OYMA 4RWTA 4C8KA 4CGFA 3TAMA 3AARA 4ILHA 3L8BA 1C1CA 3OYDA 3HOTA 1VQMN 4Y1CA 3OYFA 4QCLA 3ENBA 3I8DA 3O9QA 4L8RB 3V9XA 2ZD1A 2D0PA 4LF4K 4FJ9A 4PKGA 4X65K 4W5QA 5LJVA 1A5WA 1IG9A 3HPHA 3PO4A 4IFYA 2QWQA 4FWQA 4NYFA 1P90A 4KHQA 2ETJA 2OA8A 5ADXH 3HSTB 4DTOA 4EIAA 4FWNA 3T19A 5AQJA 4DQRA 3AVBA 4FVMA 2IOCA 2BUPA 1NGHA 2HSTA 3LP2A 3HT3A 4H5NA 1QQMA 1Q81O 2GUIA 2Q36A 4DHYA 1D9FA 1F21A 4HCCA 3CMEN 1IJJA 5KQ8A 1N34K 2FC0A 3L6QA 1P8ZA 1JXEA 2E20A 4CZFA 4A5AA 2D0BA 3OBWA 1XMQK 2GX9A 5EOYA 3NDKA 1VQ6N 4DS4A 1G99A 2O4IA 1NK6A 1GOAA 4WFNL 3KK7A 4Z4EA 4ILGB 4KHPK 1SAZA 5AQUA 4DR3K 4RW8A 1IBKK 3MEDA 5AQQA 4FJ7A 1S9GA 3SQ0A 4DTUA 5CE3A 3VA3A 2IVOA 2QWMA 2GBZA 4JNEA 4DQ8A 3ULDA 3E9PA 1QQNA 5AQZA 3A5LC 5HROA 4PKIA 4IKFA 3TAQA 3OBYA 2Q0RA 5KGWA 4HUEA 3S3OA 4DB3A 5GAGP 1NJIO 1VQPN 4KHYA 1TKDA 2E2NA 1KVAA 1RT4A 4O5BA 5FRNA 2DY4A 4X64K 1VRTA 4DUYK 4DV1K 2KLAA 5J2NA 4XH1A 2AP1A 1NMDA 2NLXA 3LL3A 2D0CA 1BOTO 4O8KA 1VQ8N 3RWUA 5KI6A 3THVA 1HNXK 3UE5A 4B3MK 4IO9L 1ZYQA 2HHTA 4NCAA 4B9SA 3VQ8A 1TYQA 4B1UB 3SAFA 3PSFA 1SKSA 1VQLN 4H0PA 1T3VA 4JI6K 1I94K 5BR9A 5CY4A 2FSNA 2RHKA 1NOYA 4DCHA 3SQ1A 4IG0A 4B9TA 2KHOA 3VQ7A 1ASVA 1VRUA 1DLOA 4FXDA 1XNRK 4I6MB 5CZ1A 4FCYA 5FPNA 2VWBA 4JRPA 2ATQA 4W5OA 4HTUA 1SS6A 4WQ5C 3JSMA 2D5RA 5C25A 4GW6A 1BO5O 1TKZA 4A2BA 3OTOK 2NRHA 3AVJA 3O5BA 4U67L 1HYVA 5FPEA 4B9QA 4E1MA 1C1AA 1I3AA 2XY7A 3ZT2A 3KLIA 5BPLA 3M6GA 4BRMA 5A2QO 1VQ9N 5LMNK 2PFUA 3A5OC 3MWTA 3U4LA 3SI6A 3EL2A 3HP6A 4DLGA 1EO1A 4A59A 2UUBK 1DTQA 3M5RA 4FWOA 3GE1A 1BISA 4ILJA 1TAQA 1TAUA 5FLXO 4BR7A 4JLHA 2P51A 3L4IA 4IZ9A 4YOXA 1NJXA 3NF6A 3O4QA 5HRRA 3OS1A 3VQPA 4H0TB 1TYQB 2OTJN 3CPWM 2UUAK 1GLCG 1U04A 1TKTA 4DS5A 3RSEA 3MN9A 3TU5A 4M3TA 3QNOA 2OYQA 3NF8A 3EYZA 3N4QA 4CJSA 3THYA 1N33K 3WNGA 4FVUA 4IBNA 3LPTA 4DR5K 4LSNA 4DWIA 3DRSA 3VQEA 3CM6A 1UOCA 1N32K 2FF3B 3AO4A 4WQ5A 3G71N 1VQ5N 3CCVN 2Q1NA 3LWMA 4FYDA 2O8BB 2HNDA 1JL1A 4DF4A 1NGAA 4CJFA 4CCHA 3PO5A 4KTQA 3SUQA 3RMAA 4GV9A 1XUPO 4C8LA 5C24A 3CCLN 4OPHA 3RRGA 2X6SA 3THWA 4FLZA 2EX3A 3JS6A 5AQOA 5GIPA 3QEXA 3CC2N 4B1ZA 1J6ZA 3V1OA 4AM6A 1RGIA 3ISNC 4KREA 3C65A 4IO8A 2WBNA 3C94A 2W41A 3LP0A 2YJFA 4DFMA 4M3UA 4I2PA 4CECA 4U7BA 1JLBA 2ZJRL 2PAVA 1Y64A 4FLYA 3QEWA 1NGFA 1JCEA 3AO5A 4J2BA 3QETA 3F73A 4IFVA 1SKWA 5SWMA 4FJLA 4QOZB 5AQWA 3BUZB 3FZMA 3HOSA 4I9LA 3V9ZA 3BF3A 1RFQA 1KFSA 1RT6A 4KRFA 2QXFA 1TVRA 1NJYA 2O8DA 2D0AA 3O4WA 1Z25A 2HBMA 2QWNA 4B3OA 1EX4A 4DF8A 1DT9A 3AO3A 1YT3A 2W42A 2X78A 3CI5A 1NMNA 3GDQA 2QWOA 4HCBA 4CEAA 3FZHA 3U6FA 3SJJA 3O9RA 4RW7A 5M1OA 1QSLA 4BE2A 4DV5K 1TUUA 1YJNN 1OH6A 1VSDA 3EKSA 3CFRA 3WQUA 4K41A 2CH6A 4BRFA 5J1EA 3C6HA 5CZ2A 2ASOA 1E3MA 4FW2A 4Z4FA 1EQYA 4W5RA 3QICA 3TPQA 2QM1A 5CHIA 3O9UA 1RBUA 4B1WB 3UKUA 4OJRA 1ASWA 3NAEA 3TTDA 5KTQA 5C2DA 4HUFA 4C8MA 1WSFA 3U3YA 4EFHA 3H3NO 3P4IA 4BR4A 4ISEA 4YFUA 4W5NA 1BIZA 3FE1A 3HL8A 4LFCK 4E19A 1N6QA 2YNHA 3OW2M 4Z4GA 4AF1A 5KPTA 4DV0K 5AQSA 5LMUK 1EETA 5AFUH 2GTDA 3ENOA 3MEGA 1T7PA 3B8AX 4Q5VA 3ZSVA 1LWCA 2IVNA 5CR4A 3ID6A 5GADP 1OH7A 1KCFA 1FKOA 3HSCA 3F9MA 4JD2A 4WCEL 1M1KO 2YX6A 4BRGA 3C7NA 1U4BA 1IH7A 2NRRA 1U45A 1RBTA 5J2QA 3W0LA 4ELUA 3ZSZA 4FJMA 4WFBL 4Y1DA 1C0TA 1RDBA 1VSMA 4F8RA 2P5OA 1XHXA 3DOLA 1VK0A 1NK8A 1CZBA 3SAHA 4CZJA 3QNNA 4ID1A 1VQNN 3BF1A 3UKUB 5HRNA 2P9PB 4FLVA 3VEZA 4MDBA 3MDQA 1TL1A 1DEJA 3M3ZA 3O9SA 3WXMB 5BPMA 4LF5K 3QB0A 4A62A 4TSXA 3B6PA 4CEFA 4JYAK 1WSIA 2IAJA 3VTHA 1CLQA 4FJXA 4BE1A 1W2BM 3DAWA 1TKXA 1X1PA 3OYKA 1T44A 3VQ4A 3U3GA 3ZSWA 3UKRB 4RG8A 4LH5A 2ZJQL 4N76A 3Q7BA 4YDUC 3DRRA 1ATRA 1ITGA 1HQEA 4RW4A 4CESA 4JI2K 1JCGA 3ENHA 1QS4A 3RMBA 1EKEA 4BROA 3OS0A 2Q31A 4KV8A 4YOVA 4O4GA 1WNSA 3AVLA 4DSLA 3WXJA 2UU9K 3C7NB 2QTDA 1SKRA 4L3QA 4M41A 3S41A 3QEIA 2KKZA 4CGIA 4BR0A 3ZSOA 3ITHA 1O13A 1B92A 1QVFM 5AZJA 2E1YA 4N41A 1L5UA 1NGDA 3NH0A 5AZIB 3VENA 2V7YA 3KLFA 4N5SA 1R59O 3V1RA 4BC2A 3CQYA 1X9WA 3OS2A 1DKGD 3I0RA 4H8KA 3WEEB 3QEVA 1YJWN 3PIPL 3OJUA 1UA1A 2GV9A 4FO0A 4CHOA 4EHUA 2UXCK 3F2KA 3ASMA 2HBLA 4B9MA 5I9EB 2CGLA 3HVRA 3ZSXA 4X62K 4BR9A 4K43A 4E3SA 3EZ5A 3S3MA 4JK7A 3SLCA 2NRTA 4CJKA 3IKMA 4QS9A 4B08A 4CJVA 1YITN 1VSEA 3KD1E 5TKWA 3VF6A 1JKHA 3V9SA 4YDUA 4BC3A 4CW7B 1X9JA 3A0IX 3LP3A 1S9EA 2RN2A 4PKHA 2O8FA 5AQLA 3QDKA 4B1XB 4IDKA 4BVPA 4M3WA 4X66K 5AJ3K 4XEIA 5HOOA 4OX9K 4HVJA 3K2PA 2UXDK 1L3UA 2E6LA 3T69A 4KTWA 3QMLA 2BGGA 3ZT3A 1W9HA 3LM9A 5M1QA 4FWLA 1JL2A 4Z4IA 1K9MO 4B3RK 3KLGA 4B1YB 3V6DA 1LCUA 3AVCA 1SL1A 3H46O 1U6ZA 1YXQA 2FSKA 4BACA 2KZZA 4FJIA 3I8BA 2Z1JA 3HO1A 3DWLA 3ULEB 5F0XA 2ZGZA 4FM2A 2RPIA 3OVNA 4CI6A 4WFAL 5KGXA 4FLTA 3MAQA 2VGNA 4JRQA 3CJ7A 4E1JA 1K73O 3DLRA 4NCBA 3ALYA 4GY2B 4OO1J 2BDPA 2HB5A 4WE1A 4E7LA 3FFIA 1BCMA 3P5JA 4ID5A 3DLEA 2HNYA 1QE1A 4DSEA 3AVGA 1NM1A 5K14A 1XWLA 1ZBIA 4RW6A 3TTFA 4YNQA 4JKEA 4IOCL 4H4OA 1WSHA 3AA2A 2O8FB 2FLOA 3WQTA 1IKXA 3CERA 4FM0A 1B9FA 4IEEA 4KH5A 3CC4N 2XHBA 3NVKA 2EWSA 3DRPA 3NF7A 4J2DA 1LAWA 2O8EA 4K8ZA 4CEDA 1ZBFA 1CZAN 3L2RA 1S1VA 2G8KA 1NGEA 1ESVA 3VQQA 1BGXT 2DTUA 2QK9A 3NGZA 3HJFA 2F4VK 3DLKA 1HRHA 3VQ9A 4CGGA 1G15A 4NLBA 3OYIA 4YOUA 3MEEA 3SYZA 4CJ7A 3HP9A 4DV4K 1NOZA 1HUXA 3EEQA 2G8HA 4I6MA 3VEWA 4OPJA 4JS5A 1REVA 2IDOA 3VMFB 5FPMA 4BC4A 4CEBA 3RTVA 3M8QA 1C0MA 3MMVA 3D2EA 4OKKA 3CCSN 4JAXA 5GAEP 4DU1A 4BDPA 3VF2A 3O3GA 3LPUA 2BTFA 3LALA 1B9DA 4CZGA 3CJ1A 4E7JA 5AQMA 1HNWK 3PX4A
chains in the Genus database with same CATH topology
4FOIA 3O8MA 3VEVA 1NGAA 4IXCA 4GV9A 1XUPO 4AM7A 4BG9A 3L0QA 3CCLN 4OPHA 1MWMA 3SAGA 1GLDG 2YCHA 4JK9A 4A2AA 3E9LA 2JWLA 1HKBA 5AQNA 3JS6A 4J8FA 5AQOA 1BWFO 4YORA 4MLEA 4PL8A 5GIPA 2BH1A 2A6AA 2OANA 4B1ZA 3CXCM 3NVMA 1J6ZA 2E2QA 3CCMN 4PHTX 3CCRN 4AM6A 3QFPA 5TKYA 1RDUA 2IVPA 4CBUA 1K8AO 2W40A 1HKGA 1RGIA 2NRXA 3PIOL 3C65A 1KC8O 4IO8A 2A41A 2WBNA 3GBTA 1S22A 2W41A 4XH5A 2YJFA 4ISGA 3OA9A 3IUCA 4FWKA 3WUHA 4U7BA 3T7ZA 3VEYA 2HF3A 3ZX0A 2ZJRL 5KPRA 3CIPA 2PAVA 1Y64A 1NGFA 1NBWA 2P9IA 1JCEA 3EN9A 5AQRA 2E1ZA 2D1KA 1MDUB 3D2FA 5GAHP 3EZWA 3GL1A 5AQWA 4KH6A 2A5XA 4MO4A 3SMPA 4BR2A 3BUZB 3FZMA 3HOSA 3ZEUB 4YOWA 1VQON 1YF5L 5M1KA 2UYTA 2WUSA 3C0BA 3BF3A 1RFQA 3IFRA 3KZBA 3IDHA 4A61A 3R1XA 3RVCA 3U9DA 3QFUA 3O4WA 2HBMA 2QWNA 3HRGA 5AQTA 4M63C 2I7PA 3N4PA 4FPBA 3D2EB 2E88A 3AAQA 1DT9A 2FF6A 2GUPA 3CI5A 2P9LA 3E66A 4NB4A 2NRVA 3GDQA 5MLCQ 2QWOA 5FPDA 2YI1A 5HL7L 3CC7N 3C6AA 3FZHA 3SBGA 1U2VB 5BN9A 1NLVA 3O9RA 3IMXA 4FWMA 5M1OA 5AQXA 1Q82O 2E8AA 2QXLA 4BRAA 1V4SA 2HBJA 5BRDA 2P9SB 5JLHA 1TUUA 2QA4N 1YJNN 3CJBA 3VTIA 1MA9B 3CC2N 4H0VB 4IOXA 1HX1A 3EKSA 2GELA 3OHRA 4O5FA 5ADXA 1GLBG 2ASPA 3WQUA 1HJOA 3VGLA 1SZ2A 2P9NA 4K41A 5LJWA 2CH6A 3JXUA 3TSQA 4JD2B 3ZX3A 3C6HA 4BRFA 1XC3A 1JJ2M 2JWKA 3NMUA 4BRPA 2ASOA 3U9ZA 3CCQN 4A57A 1EQYA 4JK8A 3R8EA 2YHXA 3QICA 3TPQA 5JMVA 5C10A 3J8AA 3W3DA 2QM1A 5CHIA 3ZETA 4IOAL 3O9UA 1GLFO 4CZMA 4B1WB 1QHAA 3UKUA 2CGJA 3AAPA 3H3OB 4GNIA 3TTDA 2ASMA 2CH5A 4NO7A 5C2DA 2D0OA 3G6EN 3ID8A 4BRNA 4CZLA 4EFHA 4PL7A 2P9IB 5EX5A 3H3NO 3ZEUA 3I56N 1KQSM 3P4IA 2HBKA 4IDHA 4BR4A 4ISEA 3FE1A 5GIOA 3KHYA 3U8XA 1OKJA 1NWKA 3MX5A 3CJ9A 4GVEA 3AGKA 5BPNA 3TTCA 1GLEG 4HTLA 4JHDB 2YJEA 3FR0A 3OW2M 4KH4A 4AF1A 2ZF5O 3CF5L 5BREA 5KPTA 4KBOA 5C0YA 1NGIA 3K9KA 4R79A 3DXMB 2FXUA 3P39A 5AQSA 3R3LA 5AFUH 2GTDA 3SK3A 3ENOA 4RTFD 1Q7YO 3B8AX 4C1NK 1QZ6A 1ZC6A 2P9LB 2P9SA 2V52B 1Q86O 4M7XA 2IVNA 5CR4A 3M1FA 3CETA 4ISFA 3HI0A 1YUWA 1ZBSA 2GWKA 3ID6A 4BR5A 1MWKA 3FLCO 3UB5A 5GADP 4CZHA 1BUPA 4JKHA 4BC5A 4CD3A 5H1SQ 2HOEA 3LM2A 3R6MA 3KWGA 3HSCA 4GV3A 3F9MA 4JD2A 4WYBA 1HPMA 4Y0WA 4WCEL 1M1KO 4CBWA 2YX6A 4BRGA 4CZKA 1YI2N 3C7NA 2A3ZA 4IFEA 1E4GT 2NRRA 1ATNA 3FGUA 4WQ4A 4BRDA 2P9NB 3W0LA 2H3GX 4JKDA 3LDPA 5EY4A 4BRLA 1XQSC 5KQDA 4IWVA 4WFBL 2DPNA 4B1VA 4BRIA 1E4FT 1WOQA 4F9OA 4CD1A 2D4WA 2P9KB 3O80A 3HTVA 3K9JA 1KAZA 3SAHA 3CJCA 4LC9B 3ZETB 1KAXA 2P9UA 4CZJA 5JVGL 1H1VA 1VQ7N 1VQNN 3BF1A 1NGGA 3UKUB 1OVYA 3LDNA 2P9PB 5AZJB 3VEZA 4MDBA 3J7ZO 3FFKB 4H5RA 4IEIA 5AQIA 4BRKA 4DKWA 3MDQA 5C2FA 1DEJA 3M3ZA 1Q18A 3O9SA 3WXMB 4BGAA 3QBWA 1DGKN 5AR0A 4JHDA 5BPMA 3QB0A 3QBXA 4M7YA 4A62A 4BREA 1X3MA 2QWPA 2NRZA 3CCJN 3BEXA 5AQHA 1LOTB 5GINA 5E84A 1M90O 3VTHA 1SQKA 3DJCA 1ATSA 3DXMA 3LDOA 4FWSA 4BRCA 3VGKA 1W2BM 1BA1A 4K42A 3DAWA 3O08A 1V4TA 2GWJA 1T44A 5DM6L 3FZKA 3H45C 3AGRA 2NNWA 4H5TA 4QS8A 3UKRB 4EAHD 1ZXOA 3P38A 2E2OA 3I33A 1C0FA 4GV6A 5AQPA 2ZJQL 3Q7BA 4YDUC 1ATRA 2ZGYA 4MDAA 3O1WA 1YIJN 1QQOA 4JEPA 1JCGA 3ENHA 1YVNA 5JVHL 5B8HA 5EXWA 2VGMA 4BROA 3Q7CA 3SMSA 1KAYA 2Q31A 2Q2RA 4A5BA 4YOVA 1YHQN 4QS7A 4BRHA 1Z6RA 5JICA 4RWTA 2QWRA 4O8UA 3CCUN 3WXJA 3H6EA 4IJNA 3AARA 3MWPA 3C7NB 2QTDA 2AA4A 2Q97A 3H1VX 4ILHA 3VF4A 2I7NA 3HOTA 4L3QA 3A5NC 1VQMN 3GOIA 3S41A 1Z05A 2KKZA 3ENBA 1IG8A 2P9KA 5EVZA 3VESA 4BY9C 3O9QA 2RE2A 4FL9A 4JKCA 2D0PA 2WFBA 4PKGA 4C23A 4BR0A 5LJVA 2PBDA 3HZ6A 1O13A 3WXLA 3MCPA 4C1NI 1NGJA 1QVFM 1YAGA 2P9PA 2QWQA 2E1YA 1TUYA 5AZJA 4FWQA 1P90A 4NLCA 5ADXH 1VAZA 2P9UB 1NGDA 5M1FA 4EIAA 4FWNA 3WXIA 4H03B 5AZIB 3VENA 2V7YA 3CQXA 5AQJA 1R59O 4BC2A 3H1QA 2A40A 3CQYA 1DKGD 3ATVA 3WEEB 1YJWN 2ITMA 3PIPL 2BUPA 1NGHA 4FO0A 2HSTA 5JLFA 4G9ZA 4H5NA 4EHUA 1QQMA 1VQKN 1Q81O 3F2KA 1BDGA 4IJAA 2Q36A 4JKAA 4DHYA 2HBLA 4K25A 5I9EB 3CMEN 1IJJA 5KQ8A 1BU6O 2CGLA 1K8KA 1P8ZA 2NRWA 3L6QA 3G4SN 2QEXN 2E20A 1HKCA 3UKRA 4CZFA 4JKFA 1T6DA 4BR9A 3ATUA 4K43A 4A5AA 2QI2A 3OBWA 2YHWA 5F2RA 2GX9A 2QW9A 2F9WA 4JK7A 5EOYA 5C15A 3SLCA 1VQ6N 1G99A 2NRTA 4UY8O 3IKMA 4QS9A 4WFNL 4WF9L 3KK7A 4ILGB 1YITN 1SAZA 5AQUA 3EE8A 3CHWA 5TKWA 3VF6A 1QZ5A 4YDUA 5AQQA 4BC3A 5BN8A 5AQYA 1X9JA 4JKGB 3A0IX 4PKHA 5CE3A 3KWIA 3VETA 2IVOA 3DXKA 5AQLA 2QWMA 4JNEA 3QDKA 4B1XB 3SJHA 4DQ8A 3E9OA 2YHYA 3VERA 4BVPA 2GEMA 3E9PA 1QQNA 3O6WA 3A5LC 3FZFA 4XEIA 4PKIA 5AQZA 3VPZA 5HOOA 3OBYA 3GG4A 1QVGM 2Q0RA 4CZEA 4DB3A 5GAGP 3MK6A 3FZLA 3T69A 1NJIO 2J4RA 3QMLA 1VQPN 2E2NA 3EO3A 3LM9A 2IIRA 5M1QA 4FWLA 1K9MO 4B1YB 2KLAA 4XH1A 5KPZA 2AP1A 4OPAA 1NMDA 5AQFA 5AZIA 2NLXA 3LL3A 4O8KA 1BOTO 1LCUA 1S3XA 3VGMA 3TSPA 3O9TA 1VQ8N 2OTLN 1ILYA 1GLJO 5C12A 3CD6N 4FSVA 3L4QA 3H46O 1U6ZA 1YXQA 3VEXA 2FSKA 3WEEA 3HBTA 5M1NA 1C0GA 3UE5A 4IO9L 3A5MC 4H5VA 3I8BA 3DWLA 4FWPA 3ULEB 3A8YA 1TYQA 2ZGZA 4FOEA 4B1UB 5F0XA 4RCHA 3SAFA 4CI6A 1VQLN 5E26A 4H0PA 3HM8A 4WFAL 4JN4A 1T3VA 2QWLA 3EE9A 4MO5A 4Z94A 5DM7L 5BRHA 2VGNA 5BR9A 2FSNA 3CJ7A 4E1JA 1K73O 2RHKA 3MX2A 3MN6A 2VYPA 4DCHA 1K8KB 2E2PA 3KVGA 4GY2B 4OO1J 3ZX2A 2CGKA 3RSEB 2F7TA 1RDWX 2V51B 3PLAA 3LDLA 2KHOA 3MCAB 4BVOA 4EHTA 3G25A 4I6MB 4JKGA 2A42A 3WXKA 5FPNA 4BG8A 1D4XA 2VWBA 2HMPA 1NM1A 4FPAA 5AQGA 3TTFA 4YOYA 4JKEA 1SS6A 4WQ5C 4IOCL 1BO5O 1X3NA 2FLOA 3WQTA 3DXKB 3DLLL 4A2BA 3CERA 2NRHA 4H0OA 2WC9A 3O5BA 4BQZA 4IEEA 4CZIA 4KH5A 4U67L 5FPEA 4B9QA 3CC4N 2ZWHA 2ZJPL 3NVKA 2F9TA 2EWSA 4HWIA 3F5TA 1NGBA 2HF4A 4XH4A 1JCFA 3SBTA 5BPLA 3WT0A 3CPEA 3M6GA 4BRMA 4BQLA 4BGBA 1VQ9N 2PFUA 3D6RA 4CBXA 3A5OC 3MWTA 3U4LA 3LDQA 4MLHA 3EL2A 1CZAN 5AQVA 1EO1A 1W97L 4A59A 4WQ4C 3M5RA 4FWOA 1WUAA 3GE1A 5AQKA 4ILJA 4H5WA 3ULEA 1NGEA 4H0XB 3EKUA 1GLAG 1ESVA 4BR7A 1BA0A 5BRFA 3L4IA 4IZ9A 4YOXA 2NZTA 5ELZA 1S72N 4H0YB 5M1PA 4H0TB 3VOVA 1TYQB 2OTJN 1KXPA 3CCEN 3AY9A 3CPWM 1GLCG 4NLBA 5AFUA 2V7ZA 3RSEA 3E1YA 3MN9A 4YOUA 5LY3A 3TU5A 4CJ7A 1VQ4N 1HUXA 3BP8A 3VEOA 4I6MA 4YOTA 3D2FB 3ZYYX 3VEWA 1BG3A 3N4QA 2FSJA 3VMFB 1YJ9N 3R9PA 5FPMA 4BC4A 3O1BA 2Q0UA 3MN7A 2VCPA 3MMVA 3CJAA 3P31A 3D2EA 3I55N 3CCSN 4FVUA 4BRQA 4JAXA 4FWRA 5GAEP 4JKBA 3VF2A 1GLLO 1HLUA 2BTFA 3MN5A 3TSUA 1U2VA 1T6CA 2FF3B 4CZGA 3CJ1A 3D7EO 4WQ5A 3G71N 1N8RO 1NGCA 1VQ5N 3CMAN 3CCVN 5AQMA 5F1XA 1KD1O 2Q1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FOI A;  3O8M A;  3VEV A;  1NGA A;  4IXC A;  1XUP O;  4AM7 A;  4BG9 A;  3L0Q A;  1MWM A;  1GLD G;  2YCH A;  4A2A A;  1HKB A;  5AQN A;  3JS6 A;  4J8F A;  5AQO A;  1BWF O;  4MLE A;  4PL8 A;  2OAN A;  2A6A A;  4B1Z A;  1J6Z A;  2E2Q A;  4AM6 A;  3QFP A;  5TKY A;  2IVP A;  4CBU A;  2W40 A;  1HKG A;  1RGI A;  4IO8 A;  2A41 A;  3GBT A;  1S22 A;  2W41 A;  4XH5 A;  2YJF A;  4ISG A;  3IUC A;  4FWK A;  3WUH A;  3VEY A;  2HF3 A;  3ZX0 A;  5KPR A;  3CIP A;  2PAV A;  1Y64 A;  1NGF A;  1NBW A;  2P9I A;  1JCE A;  3EN9 A;  5AQR A;  2E1Z A;  2D1K A;  1MDU B;  3D2F A;  3EZW A;  3GL1 A;  5AQW A;  2A5X A;  4MO4 A;  3SMP A;  4BR2 A;  3FZM A;  3BUZ B;  3ZEU B;  2UYT A;  2WUS A;  3C0B A;  3BF3 A;  1RFQ A;  3IFR A;  3KZB A;  3IDH A;  4A61 A;  3U9D A;  3QFU A;  3O4W A;  2QWN A;  5AQT A;  4M63 C;  2I7P A;  4FPB A;  3D2E B;  2E88 A;  3AAQ A;  2FF6 A;  2GUP A;  3CI5 A;  2P9L A;  4NB4 A;  3GDQ A;  2QWO A;  5FPD A;  2YI1 A;  3FZH A;  1U2V B;  5BN9 A;  1NLV A;  3IMX A;  4FWM A;  5AQX A;  2E8A A;  2QXL A;  4BRA A;  1V4S A;  5BRD A;  2P9S B;  5JLH A;  1TUU A;  3CJB A;  1MA9 B;  4H0V B;  1HX1 A;  3EKS A;  2GEL A;  3OHR A;  4O5F A;  5ADX A;  1GLB G;  2ASP A;  3WQU A;  1HJO A;  3VGL A;  1SZ2 A;  2P9N A;  4K41 A;  5LJW A;  2CH6 A;  3JXU A;  3ZX3 A;  4JD2 B;  4BRF A;  1XC3 A;  4BRP A;  2ASO A;  3U9Z A;  1EQY A;  3R8E A;  2YHX A;  3QIC A;  3TPQ A;  5JMV A;  3J8A A;  3W3D A;  2QM1 A;  3ZET A;  1GLF O;  4CZM A;  4B1W B;  1QHA A;  3UKU A;  2CGJ A;  3AAP A;  3H3O B;  4GNI A;  2ASM A;  2CH5 A;  4NO7 A;  2D0O A;  3ID8 A;  4BRN A;  4CZL A;  4EFH A;  4PL7 A;  2P9I B;  5EX5 A;  3H3N O;  3ZEU A;  3P4I A;  4BR4 A;  4ISE A;  3FE1 A;  3KHY A;  3U8X A;  1OKJ A;  1NWK A;  3CJ9 A;  5BPN A;  1GLE G;  4HTL A;  4JHD B;  2YJE A;  3FR0 A;  2ZF5 O;  5BRE A;  5KPT A;  4KBO A;  1NGI A;  3DXM B;  2FXU A;  5AQS A;  5AFU H;  2GTD A;  3SK3 A;  3ENO A;  4RTF D;  3B8A X;  1QZ6 A;  1ZC6 A;  2P9L B;  2P9S A;  2V52 B;  4M7X A;  2IVN A;  3M1F A;  3CET A;  4ISF A;  3HI0 A;  1YUW A;  1ZBS A;  2GWK A;  4BR5 A;  1MWK A;  3FLC O;  3UB5 A;  4CZH A;  1BUP A;  4BC5 A;  4CD3 A;  2HOE A;  3LM2 A;  3R6M A;  3HSC A;  3F9M A;  4JD2 A;  4WYB A;  1HPM A;  4Y0W A;  4CBW A;  4CZK A;  4BRG A;  3C7N A;  2A3Z A;  1E4G T;  1ATN A;  3FGU A;  4WQ4 A;  4BRD A;  2P9N B;  3W0L A;  2H3G X;  5EY4 A;  3LDP A;  4BRL A;  5KQD A;  1XQS C;  4IWV A;  2DPN A;  4B1V A;  4BRI A;  1E4F T;  1WOQ A;  4F9O A;  4CD1 A;  2D4W A;  2P9K B;  3O80 A;  3HTV A;  1KAZ A;  3CJC A;  4LC9 B;  3ZET B;  1KAX A;  2P9U A;  4CZJ A;  1H1V A;  3BF1 A;  1NGG A;  3UKU B;  3LDN A;  2P9P B;  5AZJ B;  3VEZ A;  3FFK B;  4H5R A;  5AQI A;  4BRK A;  3MDQ A;  1DEJ A;  3M3Z A;  1Q18 A;  4BGA A;  3QBW A;  1DGK N;  5AR0 A;  4JHD A;  5BPM A;  3QB0 A;  3QBX A;  4M7Y A;  4A62 A;  4BRE A;  1X3M A;  2QWP A;  3BEX A;  5AQH A;  1LOT B;  5E84 A;  1SQK A;  3DJC A;  1ATS A;  3DXM A;  3LDO A;  4FWS A;  4BRC A;  3VGK A;  1BA1 A;  4K42 A;  3DAW A;  3O08 A;  1V4T A;  2GWJ A;  1T44 A;  3FZK A;  3H45 C;  4H5T A;  4QS8 A;  3UKR B;  4EAH D;  1ZXO A;  2E2O A;  3I33 A;  1C0F A;  5AQP A;  4YDU C;  1ATR A;  2ZGY A;  3O1W A;  1QQO A;  1JCG A;  3ENH A;  1YVN A;  5B8H A;  5EXW A;  4BRO A;  3SMS A;  1KAY A;  2Q31 A;  2Q2R A;  4QS7 A;  4BRH A;  1Z6R A;  5JIC A;  4RWT A;  2QWR A;  3WXJ A;  3H6E A;  4IJN A;  3AAR A;  3VF4 A;  3C7N B;  3H1V X;  2AA4 A;  2Q97 A;  2I7N A;  4L3Q A;  3A5N C;  3GOI A;  3S41 A;  1Z05 A;  3VES A;  5EVZ A;  1IG8 A;  2P9K A;  4FL9 A;  2D0P A;  4PKG A;  4C23 A;  4BR0 A;  5LJV A;  2PBD A;  3HZ6 A;  3WXL A;  3MCP A;  1NGJ A;  1YAG A;  2P9P A;  2QWQ A;  2E1Y A;  1TUY A;  5AZJ A;  4FWQ A;  5ADX H;  2P9U B;  1NGD A;  4EIA A;  4FWN A;  3WXI A;  4H03 B;  5AZI B;  3VEN A;  2V7Y A;  3CQX A;  5AQJ A;  1R59 O;  4BC2 A;  3H1Q A;  2A40 A;  3CQY A;  1DKG D;  3ATV A;  3WEE B;  2ITM A;  2BUP A;  1NGH A;  4FO0 A;  5JLF A;  4H5N A;  4EHU A;  1QQM A;  4IJA A;  1BDG A;  2Q36 A;  4DHY A;  4K25 A;  5I9E B;  1IJJ A;  5KQ8 A;  1BU6 O;  2CGL A;  1K8K A;  1P8Z A;  3L6Q A;  2E20 A;  1HKC A;  3UKR A;  4CZF A;  4BR9 A;  1T6D A;  3ATU A;  4K43 A;  2YHW A;  5F2R A;  2QW9 A;  2F9W A;  5EOY A;  3SLC A;  1G99 A;  4QS9 A;  1SAZ A;  5AQU A;  3CHW A;  3VF6 A;  1QZ5 A;  4YDU A;  5AQQ A;  4BC3 A;  5BN8 A;  5AQY A;  1X9J A;  3A0I X;  4PKH A;  5CE3 A;  3VET A;  2IVO A;  3DXK A;  5AQL A;  2QWM A;  4JNE A;  3QDK A;  4B1X B;  3SJH A;  4DQ8 A;  2YHY A;  3VER A;  4BVP A;  2GEM A;  1QQN A;  3O6W A;  3A5L C;  3FZF A;  4XEI A;  4PKI A;  5AQZ A;  3VPZ A;  3GG4 A;  2Q0R A;  4CZE A;  4DB3 A;  3MK6 A;  3FZL A;  2J4R A;  3QML A;  2E2N A;  3EO3 A;  3LM9 A;  2IIR A;  4FWL A;  4B1Y B;  4XH1 A;  5KPZ A;  2AP1 A;  5AQF A;  1NMD A;  5AZI A;  2NLX A;  3LL3 A;  4O8K A;  1BOT O;  1LCU A;  1S3X A;  3VGM A;  1GLJ O;  4FSV A;  3H46 O;  1U6Z A;  1YXQ A;  3VEX A;  2FSK A;  3WEE A;  3HBT A;  1C0G A;  3UE5 A;  3A5M C;  4H5V A;  3I8B A;  3DWL A;  4FWP A;  3ULE B;  3A8Y A;  1TYQ A;  2ZGZ A;  4FOE A;  4B1U B;  5F0X A;  4RCH A;  4CI6 A;  5E26 A;  4H0P A;  3HM8 A;  4JN4 A;  2QWL A;  4MO5 A;  4Z94 A;  5BRH A;  5BR9 A;  2FSN A;  3CJ7 A;  4E1J A;  3MN6 A;  2VYP A;  4DCH A;  1K8K B;  2E2P A;  3KVG A;  4GY2 B;  3ZX2 A;  2CGK A;  3RSE B;  1RDW X;  2V51 B;  3LDL A;  2KHO A;  4BVO A;  4EHT A;  3G25 A;  4I6M B;  2A42 A;  3WXK A;  5FPN A;  4BG8 A;  1D4X A;  2VWB A;  2HMP A;  1NM1 A;  4FPA A;  5AQG A;  4WQ5 C;  1BO5 O;  1X3N A;  2FLO A;  3WQT A;  3DXK B;  4A2B A;  3CER A;  2NRH A;  4H0O A;  4BQZ A;  3O5B A;  4CZI A;  5FPE A;  4B9Q A;  2ZWH A;  2F9T A;  2EWS A;  4HWI A;  1NGB A;  2HF4 A;  4XH4 A;  1JCF A;  5BPL A;  3WT0 A;  4BQL A;  3M6G A;  4BRM A;  4BGB A;  4CBX A;  3A5O C;  3U4L A;  3LDQ A;  4MLH A;  3EL2 A;  1CZA N;  5AQV A;  4WQ4 C;  4FWO A;  1WUA A;  3GE1 A;  5AQK A;  4H5W A;  3ULE A;  1NGE A;  4H0X B;  3EKU A;  1GLA G;  1ESV A;  4BR7 A;  1BA0 A;  5BRF A;  3L4I A;  4IZ9 A;  2NZT A;  5ELZ A;  4H0Y B;  4H0T B;  3VOV A;  1TYQ B;  1KXP A;  3AY9 A;  1GLC G;  5AFU A;  2V7Z A;  3RSE A;  3MN9 A;  5LY3 A;  3TU5 A;  4CJ7 A;  1HUX A;  3BP8 A;  3VEO A;  4I6M A;  3D2F B;  3VEW A;  1BG3 A;  2FSJ A;  3R9P A;  5FPM A;  4BC4 A;  3O1B A;  2Q0U A;  3MN7 A;  2VCP A;  3MMV A;  3CJA A;  3D2E A;  4BRQ A;  4JAX A;  4FWR A;  3VF2 A;  1GLL O;  1HLU A;  2BTF A;  3MN5 A;  1U2V A;  1T6C A;  2FF3 B;  4CZG A;  3CJ1 A;  3D7E O;  4WQ5 A;  1NGC A;  5AQM A;  5F1X A;  2Q1N A; 
#chains in the Genus database with same CATH topology
 3RR7 A;  4N47 A;  4K0K K;  4B8A B;  4IXC A;  3ZSR A;  2VG5 A;  4NCG A;  1FJG K;  1QSS A;  4CHQ A;  4CJ3 A;  5HBM A;  1RT7 A;  1GLD G;  2YCH A;  5DMR A;  2O8E B;  1TV6 A;  3E9L A;  4DSJ A;  2FBX A;  2G8W A;  1HKB A;  1BL3 A;  4EP4 A;  4K8X A;  3NVM A;  2E2Q A;  3JYT A;  4DR1 K;  5TKY A;  1RDU A;  2IVP A;  4CBU A;  4FLX A;  2OPP A;  4ELT A;  1KC8 O;  3S9H A;  3KLE A;  2A41 A;  3T1H K;  4ISG A;  3OA9 A;  2HF3 A;  1TGO A;  4CJR A;  2P1J A;  5KPR A;  1VSK A;  4KI6 A;  4CIF A;  4EZ6 A;  1WAF A;  1NBW A;  2P9I A;  3EN9 A;  4Z4C A;  3KK3 A;  5AQR A;  4FK4 A;  1NK9 A;  2P5G A;  2NUB A;  3DLB A;  3EZW A;  3GL1 A;  3OY9 A;  4KH6 A;  3NHG A;  4CHY A;  2A5X A;  4MO4 A;  2UXB K;  3EY1 A;  2WUS A;  3C0B A;  3KZB A;  2VQF K;  2OCE A;  4CIE A;  3L3U A;  3RVC A;  3QFU A;  3HPO A;  1FW6 A;  2HVI A;  4FPB A;  3D2E B;  2E88 A;  3AAQ A;  3HPG A;  2O8C A;  3CQ8 A;  4DR2 K;  2HMI A;  3B6O A;  4GKK K;  2GUP A;  2O8B A;  5CYQ A;  4CJ4 A;  4FW1 A;  3CC7 N;  3C6A A;  1NLV A;  1HPZ A;  5AQX A;  2QKK A;  1U47 A;  3C95 A;  5BRD A;  2P9S B;  4CE9 A;  1UA0 A;  4PQU A;  2QA4 N;  1RTH A;  4KTZ A;  1MA9 B;  4ZTJ A;  1J5E K;  4F3T A;  1SUQ A;  2GEL A;  2HW3 A;  2WOM A;  1GLB G;  3V9U A;  1SZ2 A;  1SL2 A;  4NXM K;  2P9N A;  1EWQ A;  1RBS A;  2JWK A;  4BRP A;  4KHU A;  1S5J A;  3R8E A;  1TL3 A;  2YHX A;  4F3O A;  3RMC A;  5DK5 A;  4JV5 K;  2JLE A;  5HP1 A;  3C6T A;  1CZ9 A;  3AAP A;  3H3O B;  4ZHR A;  3SQ4 A;  4M3Y A;  2P9I B;  1WBD A;  4DQQ A;  1J9A A;  4OLB A;  3KHY A;  5EU7 A;  3SNN A;  1OKJ A;  1NWK A;  3CJ9 A;  3D45 A;  3AGK A;  5BPN A;  3ZT0 A;  3KTQ A;  3DM2 A;  3KLH A;  1JLA A;  3FR0 A;  3WNF A;  3LZJ A;  2ZF5 O;  3CF5 L;  4KBO A;  1NGI A;  1S1T A;  3P39 A;  3T3F A;  1UWB A;  3R3L A;  3AVI A;  3SV4 A;  2O8C B;  1Q7Y O;  3J81 O;  4C1N K;  1ZC6 A;  2V52 B;  1Q86 O;  1RT5 A;  4Q0B A;  2PYL A;  3CET A;  4BR5 A;  4CJE A;  1MWK A;  3TAF A;  3A2F A;  4AHU A;  3HK2 A;  4JKH A;  3OYE A;  2HOE A;  4JI4 K;  1ZBH A;  2XY5 A;  2W6L A;  4CBW A;  4CZK A;  3V1Q A;  3RRH A;  4BRD A;  2P9N B;  2HHX A;  4JKD A;  2DPN A;  4B1V A;  1KFD A;  4O0I A;  1E4F T;  2P9K B;  3RR8 A;  3K9J A;  1KAZ A;  1VQ7 N;  2P9U A;  2G8F A;  1NGG A;  1RCH A;  3SQ2 A;  1HJR A;  3DI6 A;  4B3S K;  3SZ2 A;  4KHN A;  1IO2 A;  3J7Z O;  3NH2 A;  3OYN A;  4DKW A;  3NGI A;  5C2F A;  3QEP A;  4OLA A;  1NU0 A;  2E4L A;  1S1W A;  3QBX A;  3CCJ N;  1I39 A;  1WSG A;  5AQH A;  4KKO A;  5E84 A;  1SQK A;  2FBT A;  3V9W A;  3VGK A;  1BA1 A;  3QO9 A;  4CFB A;  1V4T A;  2A1R A;  2RF2 A;  4PA1 A;  1NK7 A;  3AVM A;  4DTJ A;  4H5T A;  2DFE A;  1J53 A;  5SZT A;  4EAH D;  3SUN A;  3VQB A;  1C0F A;  4QAG A;  2W6K A;  5AQP A;  1NK4 A;  4CJP A;  1SV5 A;  2ZGY A;  3K5M A;  3O1W A;  4JEP A;  4E89 A;  4LF9 K;  3Q7C A;  3SMS A;  1KAY A;  4OKJ A;  3THX B;  5JIC A;  4CF0 A;  3SUO A;  3ZLJ A;  1JLE A;  3H1V X;  1WSE A;  3A5N C;  3GOI A;  3VES A;  1Z05 A;  3RMD A;  4BY9 C;  2RE2 A;  2YV0 X;  4C23 A;  2IGI A;  4JI8 K;  4DR4 K;  2PBD A;  3HZ6 A;  3OYH A;  3MCP A;  2KW4 A;  1NK0 A;  1RT1 A;  4M3R A;  2P9P A;  1LWE A;  2EHG A;  1Q9Y A;  3LZI A;  4NLC A;  1QSY A;  2P9U B;  1N5Y A;  3WXI A;  4H03 B;  3TWH A;  4DTP A;  2A40 A;  1NKE A;  4CGH A;  3ATV A;  2ITM A;  3PX6 A;  5JLF A;  1VQK N;  1HYZ A;  3BGR A;  2Y1I A;  4IJA A;  1BDG A;  3KIO A;  4JKA A;  4KB0 A;  4K25 A;  1T03 A;  1KTQ A;  1BU6 O;  4FLU A;  3T1Y K;  1K8K A;  3S3N A;  3UKR A;  1T6D A;  3ATU A;  1XMO K;  5I42 A;  4FZX C;  4DV6 K;  3VA0 A;  4FK0 A;  5C15 A;  2F9W A;  2E6M A;  4J2E A;  2IS3 A;  5J2M A;  4DR6 K;  3NCI A;  4AIL C;  1K6Y A;  3CHW A;  4CEQ A;  3HVT A;  5BN8 A;  2HHH K;  4JKG B;  3KWI A;  3VQA A;  3DXK A;  4DTN A;  3SJH A;  2YHY A;  3VER A;  2GEM A;  2OPS A;  3FZF A;  1LW2 A;  1RTI A;  4LF8 K;  4IG3 A;  4CZE A;  3MK6 A;  2OPQ A;  2J4R A;  3L2Q A;  4GMJ B;  1JLC A;  3VQ6 A;  1RDA A;  4V19 S;  4CF2 A;  4DFP A;  5KPZ A;  5AQF A;  4B8C A;  5AZI A;  3DLH A;  1S3X A;  1ILY A;  3TSP A;  1UAX A;  3DOK A;  4FJG A;  4LF7 K;  3CD6 N;  1BI4 B;  3VEX A;  3WEE A;  1YTA A;  3OYC A;  1KLN A;  3A5M C;  4E7I A;  4FWP A;  4FOE A;  2Q3S A;  4CGJ A;  4DTS A;  5E26 A;  1NG9 A;  3HM8 A;  1IV0 A;  3EE9 A;  5DM7 L;  4CJL A;  2ZM6 K;  3O3H A;  1K8K B;  2E2P A;  3KVG A;  2OZM A;  3TAG A;  1J5O A;  3ZX2 A;  4DQI A;  2F7T A;  3NE6 A;  2V51 B;  1A5X A;  4MQ3 A;  3WXK A;  3P1G A;  3G10 A;  4LFA K;  2LSN A;  2HMP A;  2ZQB A;  1WSJ A;  2Z1G A;  5AQG A;  4YOY A;  1X3N A;  3DXK B;  3DLL L;  1A5V A;  1T05 A;  4H0O A;  2WC9 A;  4BQZ A;  4CZI A;  4LSL A;  2I5J A;  5T7B A;  2ZJP L;  4HWI A;  3AVF A;  2F8T A;  3F5T A;  2HF4 A;  3MXJ A;  1JCF A;  3WT0 A;  3CPE A;  4BGB A;  4E1N A;  4CBX A;  4MLH A;  5AQV A;  3AO1 A;  1W97 L;  4WQ4 C;  3AO2 A;  4CJ5 A;  3ULE A;  4H0X B;  3EKU A;  1GLA G;  3AA5 X;  3MXI A;  3C6U A;  2Y1J A;  2NZT A;  1RTJ A;  3QIN A;  4H0Y B;  2R7Y A;  4PUO A;  3J7Y P;  5M1P A;  1OH8 A;  3CCE N;  5BR8 K;  3AY9 A;  4ELV A;  2V7Z A;  3E1Y A;  3PY8 A;  1WLJ A;  4CJU A;  3VEO A;  3D2F B;  1YJ9 N;  3R9P A;  2YHB A;  1O1W A;  3MN7 A;  2VCP A;  3P31 A;  1EXQ A;  3I55 N;  2QKB A;  3OYG A;  1CXU A;  3ZSQ A;  4JKB A;  1JLF A;  3LDS A;  3TSU A;  3MN5 A;  3M8R A;  4AQY K;  4JI1 K;  1U2V A;  5LL6 Z;  1XI1 A;  1N8R O;  1NGC A;  3CMA N;  1KD1 O;  1Z6R A;  1Q8I A;  3ZT4 A;  4XIU A;  3O8M A;  4BG9 A;  4AM7 A;  3L0Q A;  3LP1 A;  1TK0 A;  3SCX A;  1X9M A;  4JK9 A;  4A2A A;  2JWL A;  5AQN A;  1BWF O;  2FBY A;  4PL8 A;  4YOR A;  4B9N A;  3CXC M;  3CCM N;  3CCR N;  2Z1H A;  1BHL A;  4HUG A;  3QFP A;  1IKW A;  3F9K A;  2W40 A;  1HKG A;  3JAM O;  2PYJ A;  4DR7 K;  3GBT A;  4CK2 A;  3D0P A;  2HHU A;  1W7A A;  3ZSY A;  3WUH A;  3T7Z A;  3VEY A;  4DUZ K;  1Y97 A;  3CIP A;  2E1Z A;  2D1K A;  4C8N A;  5GAH P;  4OKE A;  3SMP A;  2HNZ A;  3ZEU B;  4YOW A;  1YF5 L;  5M1K A;  4OGC A;  4A61 A;  3IDH A;  3L3V A;  5JS1 A;  4AHV A;  3HRG A;  1S6P A;  5AQT A;  4M63 C;  3N4P A;  3K58 A;  1JXB A;  3CG7 A;  4FLW A;  4KB1 A;  3M8P A;  2FF6 A;  2P9L A;  5MLC Q;  5FPD A;  3UIQ A;  5J2P A;  1U2V B;  3IMX A;  1Q82 O;  1V4S A;  2HBJ A;  3ZT1 A;  3OYA A;  3KJV A;  1OH5 A;  4FJ8 A;  1GOC A;  4IOX A;  1HX1 A;  3MEC A;  5ADX A;  1ZBU A;  1IKY A;  1BCO A;  1HJO A;  2ASP A;  4B9L A;  5LJW A;  1NJW A;  1JLG A;  4BWM A;  3TSQ A;  1D9D A;  1FKP A;  3U9Z A;  2X74 A;  4LD0 A;  4JK8 A;  1QQC A;  3J8A A;  1HQU A;  3ZET A;  4DV7 K;  1BIU A;  4CZM A;  2WTU A;  2CGJ A;  4GNI A;  2ASM A;  2D0O A;  3ID8 A;  4EZ9 A;  4CZL A;  2RKI A;  5EX5 A;  4J2A A;  3P83 D;  2YKM A;  4GVE A;  3KD5 E;  4FJK A;  3AVK A;  3K5O A;  1GLE G;  4HTL A;  4JHD B;  2YJE A;  3G0Z A;  4CGD A;  5BRE A;  2F96 A;  5C0Y A;  4LY7 A;  4AHT A;  1NKB A;  3DXM B;  2FXU A;  4DQS A;  2VWK A;  3QIO A;  1Z26 A;  2B5J A;  4M42 A;  3SK3 A;  2VG7 A;  1L3T A;  1QZ6 A;  3MXM A;  2P9L B;  2P9S A;  4CFC A;  1KVB A;  3T1A A;  1WB9 A;  4I7F A;  4ISF A;  1ZBS A;  3V4I A;  1YTU A;  5H1S Q;  3LM2 A;  3R6M A;  3KWG A;  1VHX A;  4GV3 A;  4WYB A;  1HPM A;  3AA4 A;  3QLH A;  2A3Z A;  4IFE A;  1E4G T;  1HYS A;  2YHA A;  2G8U A;  3O4N A;  2H3G X;  4BRL A;  3LAK A;  5IT9 O;  3J7A P;  3BY5 A;  2PY5 A;  1WOQ A;  3CFO A;  4CD1 A;  3SPY A;  2D4W A;  4CFA A;  3HTV A;  2OPR A;  3NF9 A;  3CJC A;  4LC9 B;  4OGE A;  3ZET B;  5JVG L;  1H1V A;  4RW9 A;  2UUC K;  1T8E A;  1OVY A;  3LDN A;  1Q9X A;  4H5R A;  5AQI A;  4DQP A;  3K5N A;  4CVN E;  4JI0 K;  4BRE A;  1LW0 A;  1X3M A;  2NRZ A;  2WON A;  3BEX A;  2KFN A;  1LOT B;  5GIN A;  1M90 O;  3DJC A;  4BRC A;  4K42 A;  3O08 A;  3VQC A;  2GWJ A;  3TI0 A;  3L2W A;  3WNH A;  3WNE A;  4QS8 A;  5I3U A;  3P38 A;  4FJH A;  2E2O A;  2YNG A;  4DSK A;  4DV2 K;  2HVH A;  3PUF A;  4KO0 A;  4AHR A;  1YVN A;  1XNQ K;  2VGM A;  2Q2R A;  3AVN A;  2HHS A;  4FJ5 A;  1YHQ N;  4BRH A;  3ZCM A;  4NYN A;  2QWR A;  4O8U A;  4Z0U A;  1LAV A;  3CCU N;  3H6E A;  4IJN A;  3MWP A;  3VF4 A;  2AA4 A;  2Q97 A;  2I7N A;  1RNH A;  3O3F A;  5EVZ A;  1IG8 A;  2P9K A;  5E41 A;  4OVL A;  4FL9 A;  4JKC A;  2WFB A;  4DV3 K;  2BAN A;  3WXL A;  2VQE K;  4C1N I;  1NGJ A;  1VSI A;  1YAG A;  2KZM A;  1TUY A;  1VSH A;  4N56 A;  1RTD A;  4CF1 A;  4CJW A;  4BE0 A;  4F2R A;  1ZBL A;  1VAZ A;  1LWF A;  5M1F A;  3LWL A;  3TAE A;  3DLG A;  3CQX A;  3LAN A;  3H1Q A;  4G1Q A;  4DLE A;  3K5L A;  4FK2 A;  1X9S A;  4GVM A;  2F8S A;  4G9Z A;  3AVH A;  3NBP A;  4CJT A;  1LV5 A;  1MU2 A;  2KFZ A;  1YVU A;  2QEX N;  2NRW A;  3G4S N;  1RT2 A;  1HKC A;  1RBV A;  4JKF A;  4FZZ A;  2QI2 A;  4M3X A;  2YHW A;  5F2R A;  2QW9 A;  4UQG A;  4UY8 O;  1U49 A;  4CFD A;  3IAY A;  5CYM A;  4WF9 L;  4DTR A;  2B6A A;  1HNI A;  3EE8 A;  2ITG A;  1QZ5 A;  1CXQ A;  4DTX A;  3THX A;  5AQY A;  4O44 A;  3VET A;  2YNF A;  1S6Q A;  3E9O A;  3VPZ A;  3O6W A;  3GG4 A;  4CK3 A;  1QVG M;  3OYJ A;  4CK1 A;  4PY5 A;  3FZL A;  1TK5 A;  3CM5 A;  2HHV A;  1S1U A;  3EO3 A;  4CJQ A;  2IIR A;  3NFA A;  2E5L K;  1RDD A;  4OPA A;  4EP5 A;  2FBV A;  3VGM A;  2OTL N;  3NGY A;  3O9T A;  4Z4H A;  3LAM A;  2G8I A;  4FJJ A;  4I2Q A;  1GLJ O;  5C12 A;  4FSV A;  3L4Q A;  3HBT A;  5M1N A;  1C0G A;  4H5V A;  4JI7 K;  4E7H A;  5KRT A;  4CIG A;  1R0A A;  3A8Y A;  4RCH A;  2O4G A;  2DFF A;  4JN4 A;  2QWL A;  4MO5 A;  4Z94 A;  1C1B A;  5BRH A;  4CHP A;  3MX2 A;  3K0S A;  3MN6 A;  2VYP A;  2X6N A;  2CGK A;  3RSE B;  4I9Q A;  1RDW X;  3PLA A;  3LDL A;  3MCA B;  1D8Y A;  4BVO A;  4EHT A;  3G25 A;  1KRP A;  4JKG A;  2A42 A;  4JI5 K;  4FZY A;  3IG1 A;  4BG8 A;  1D4X A;  3THY B;  1RDC A;  4C8O A;  4FPA A;  2JGU A;  4YY3 K;  3HM9 A;  1L3S A;  2PZS A;  1N36 K;  1S1X A;  5D3G A;  4BWJ A;  4OPK A;  2ZWH A;  2F9T A;  3L2U A;  3TAB A;  1NGB A;  4XH4 A;  1C6V A;  4YHH K;  3SBT A;  4BQL A;  3D6R A;  3OYL A;  3LDQ A;  1BI4 A;  3E01 A;  4E7K A;  3THW B;  1WUA A;  1QHT A;  5AQK A;  4H5W A;  4E0D A;  1BA0 A;  4KPY A;  3VN5 A;  5BRF A;  3KK2 A;  5ELZ A;  4O0J A;  4B9V A;  1S72 N;  1HR0 K;  1GOB A;  2KQ2 A;  5FRM A;  1NKC A;  3VOV A;  3K57 A;  4CHZ A;  3SUP A;  1KXP A;  4W5T A;  4H4M A;  5AFU A;  5LY3 A;  4M3Z A;  1IBM K;  1FXX A;  1VQ4 N;  3BP8 A;  4YOT A;  3KK1 A;  3HXM A;  3ZYY X;  1BG3 A;  3VQ5 A;  2FSJ A;  3DMJ A;  4BDY A;  3QER A;  1IBL K;  3O1B A;  2Q0U A;  3CJA A;  4CHN A;  4LH4 A;  1RT3 A;  2BE2 A;  3CYM A;  1NK5 A;  1JLQ A;  4BRQ A;  2O8D B;  4FWR A;  4LFB K;  4CEE A;  1GLL O;  1HLU A;  1EP4 A;  1XHZ A;  1T6C A;  2Z1I A;  3D7E O;  4M45 A;  4DTM A;  5F1X A;  5HLF A;  4FOI A;  1IKV A;  3VEV A;  5KRS A;  1HNV A;  2A1S A;  3IS9 A;  1L3V A;  2AJQ A;  3SAG A;  1MWM A;  3PSI A;  2VWJ A;  4FM1 A;  4J8F A;  1EWR A;  3AVA A;  4MLE A;  2BH1 A;  2A6A A;  2OAN A;  4DSI A;  4PHT X;  1K8A O;  1VSF A;  2NRX A;  3PIO L;  1S22 A;  4XH5 A;  3IUC A;  4FWK A;  4BDZ A;  4F2S A;  3ZX0 A;  4DMN A;  5FRO A;  2VG6 A;  2B4J A;  3NH1 A;  1MDU B;  2YNI A;  3DYA A;  2ZE2 A;  3D2F A;  1ASU A;  4KI4 A;  5C42 A;  4CEO A;  3VQD A;  4ICL A;  1OVQ A;  4BR2 A;  4CEZ A;  1VQO N;  2UYT A;  3IFR A;  4B3T K;  1DTT A;  3R1X A;  4KHW A;  5FDL A;  1D5A A;  3I0S A;  3KKR A;  3U9D A;  4DU4 A;  2KTQ A;  4PWD A;  2I7P A;  3K59 A;  1NNE A;  3BDP A;  1BQN A;  3V81 A;  3E66 A;  4NB4 A;  2NRV A;  2YI1 A;  5HL7 L;  3SBG A;  5BN9 A;  4DG1 A;  4FJN A;  4FWM A;  4DU3 A;  2E8A A;  2QXL A;  4BRA A;  4AHS A;  5JLH A;  1NJZ A;  3CJB A;  2DFH A;  3VTI A;  1VSJ A;  3PV8 A;  4H0V B;  3OHR A;  4O5F A;  3TAR A;  4R5P A;  3VGL A;  2G8V A;  3JXU A;  3ZX3 A;  4JD2 B;  5HRP A;  1W0H A;  1XC3 A;  1JJ2 M;  3OJS A;  4KHS A;  3NMU A;  1BQM A;  3CCQ N;  4A57 A;  5JMV A;  4AHC A;  5C10 A;  3W3D A;  4IOA L;  2HHQ A;  1RIL A;  4B9U A;  1WN7 A;  1GLF O;  4NXN K;  2YKN A;  1QHA A;  3HYF A;  2CH5 A;  4NO7 A;  3G6E N;  4DSF A;  4BRN A;  5JS2 A;  1WAJ A;  4PL7 A;  4DFJ A;  3BZC A;  3AA3 A;  3I56 N;  3ZEU A;  1KQS M;  2HBK A;  4IDH A;  1HNZ K;  3TR8 A;  5GIO A;  3U8X A;  3MX5 A;  2IC3 A;  2XRI A;  5HRS A;  4JI3 K;  3TTC A;  3BZK A;  4LF6 K;  4KH4 A;  3SPZ A;  4JS4 A;  1VSL A;  3K9K A;  4R79 A;  3AV9 A;  1KSP A;  1QTM A;  4RTF D;  1RBR A;  2XO7 A;  3CFP A;  1SL0 A;  1U48 A;  4M7X A;  1C0U A;  3M1F A;  2HHW A;  3HI0 A;  1YUW A;  2GWK A;  3FLC O;  3UB5 A;  4CZH A;  1BUP A;  1KLM A;  4BC5 A;  4CD3 A;  1J54 A;  4Y0W A;  3L2V A;  1YI2 N;  3TAN A;  3SV3 A;  3H08 A;  4KAZ A;  4F4K A;  4GKJ K;  1ATN A;  1KVC A;  3FGU A;  4WQ4 A;  3PX0 A;  5EY4 A;  3LDP A;  5KQD A;  1XQS C;  3QIP A;  4IWV A;  3IRX A;  4BRI A;  4F9O A;  3O80 A;  1KAX A;  1FK9 A;  4MFB A;  5AZJ B;  4CF8 A;  4CER A;  1TK8 A;  3FFK B;  4IEI A;  4BRK A;  4AH9 A;  3OYB A;  4BGA A;  1Q18 A;  1HMV A;  3QBW A;  1DGK N;  5AR0 A;  4JHD A;  4M7Y A;  4KFB A;  3KKS A;  2QWP A;  4HHT A;  3TAP A;  3DXM A;  1ATS A;  3LDO A;  4FWS A;  2OZS A;  5DM6 L;  3FZK A;  1XC9 A;  3H45 C;  3AGR A;  2NNW A;  3M8S A;  3J80 O;  1ZXO A;  2XY6 A;  3I33 A;  4ZTF A;  4GV6 A;  4CF9 A;  4DFK A;  4O55 A;  2XY8 A;  1WBB A;  4MDA A;  1YIJ N;  1QQO A;  5JVH L;  5B8H A;  5EXW A;  4A5B A;  5IWA K;  3QES A;  4QS7 A;  3OYM A;  4RWT A;  4C8K A;  4CGF A;  3TAM A;  3AAR A;  4ILH A;  3L8B A;  1C1C A;  3OYD A;  3HOT A;  1VQM N;  4Y1C A;  3OYF A;  4QCL A;  3ENB A;  3I8D A;  3O9Q A;  4L8R B;  3V9X A;  2ZD1 A;  2D0P A;  4LF4 K;  4FJ9 A;  4PKG A;  4X65 K;  4W5Q A;  5LJV A;  1A5W A;  1IG9 A;  3HPH A;  3PO4 A;  4IFY A;  2QWQ A;  4FWQ A;  4NYF A;  1P90 A;  4KHQ A;  2ETJ A;  2OA8 A;  5ADX H;  3HST B;  4DTO A;  4EIA A;  4FWN A;  3T19 A;  5AQJ A;  4DQR A;  3AVB A;  4FVM A;  2IOC A;  2BUP A;  1NGH A;  2HST A;  3LP2 A;  3HT3 A;  4H5N A;  1QQM A;  1Q81 O;  2GUI A;  2Q36 A;  4DHY A;  1D9F A;  1F21 A;  4HCC A;  3CME N;  1IJJ A;  5KQ8 A;  1N34 K;  2FC0 A;  3L6Q A;  1P8Z A;  1JXE A;  2E20 A;  4CZF A;  4A5A A;  2D0B A;  3OBW A;  1XMQ K;  2GX9 A;  5EOY A;  3NDK A;  1VQ6 N;  4DS4 A;  1G99 A;  2O4I A;  1NK6 A;  1GOA A;  4WFN L;  3KK7 A;  4Z4E A;  4ILG B;  4KHP K;  1SAZ A;  5AQU A;  4DR3 K;  4RW8 A;  1IBK K;  3MED A;  5AQQ A;  4FJ7 A;  1S9G A;  3SQ0 A;  4DTU A;  5CE3 A;  3VA3 A;  2IVO A;  2QWM A;  2GBZ A;  4JNE A;  4DQ8 A;  3ULD A;  3E9P A;  1QQN A;  5AQZ A;  3A5L C;  5HRO A;  4PKI A;  4IKF A;  3TAQ A;  3OBY A;  2Q0R A;  5KGW A;  4HUE A;  3S3O A;  4DB3 A;  5GAG P;  1NJI O;  1VQP N;  4KHY A;  1TKD A;  2E2N A;  1KVA A;  1RT4 A;  4O5B A;  5FRN A;  2DY4 A;  4X64 K;  1VRT A;  4DUY K;  4DV1 K;  2KLA A;  5J2N A;  4XH1 A;  2AP1 A;  1NMD A;  2NLX A;  3LL3 A;  2D0C A;  1BOT O;  4O8K A;  1VQ8 N;  3RWU A;  5KI6 A;  3THV A;  1HNX K;  3UE5 A;  4B3M K;  4IO9 L;  1ZYQ A;  2HHT A;  4NCA A;  4B9S A;  3VQ8 A;  1TYQ A;  4B1U B;  3SAF A;  3PSF A;  1SKS A;  1VQL N;  4H0P A;  1T3V A;  4JI6 K;  1I94 K;  5BR9 A;  5CY4 A;  2FSN A;  2RHK A;  1NOY A;  4DCH A;  3SQ1 A;  4IG0 A;  4B9T A;  2KHO A;  3VQ7 A;  1ASV A;  1VRU A;  1DLO A;  4FXD A;  1XNR K;  4I6M B;  5CZ1 A;  4FCY A;  5FPN A;  2VWB A;  4JRP A;  2ATQ A;  4W5O A;  4HTU A;  1SS6 A;  4WQ5 C;  3JSM A;  2D5R A;  5C25 A;  4GW6 A;  1BO5 O;  1TKZ A;  4A2B A;  3OTO K;  2NRH A;  3AVJ A;  3O5B A;  4U67 L;  1HYV A;  5FPE A;  4B9Q A;  4E1M A;  1C1A A;  1I3A A;  2XY7 A;  3ZT2 A;  3KLI A;  5BPL A;  3M6G A;  4BRM A;  5A2Q O;  1VQ9 N;  5LMN K;  2PFU A;  3A5O C;  3MWT A;  3U4L A;  3SI6 A;  3EL2 A;  3HP6 A;  4DLG A;  1EO1 A;  4A59 A;  2UUB K;  1DTQ A;  3M5R A;  4FWO A;  3GE1 A;  1BIS A;  4ILJ A;  1TAQ A;  1TAU A;  5FLX O;  4BR7 A;  4JLH A;  2P51 A;  3L4I A;  4IZ9 A;  4YOX A;  1NJX A;  3NF6 A;  3O4Q A;  5HRR A;  3OS1 A;  3VQP A;  4H0T B;  1TYQ B;  2OTJ N;  3CPW M;  2UUA K;  1GLC G;  1U04 A;  1TKT A;  4DS5 A;  3RSE A;  3MN9 A;  3TU5 A;  4M3T A;  3QNO A;  2OYQ A;  3NF8 A;  3EYZ A;  3N4Q A;  4CJS A;  3THY A;  1N33 K;  3WNG A;  4FVU A;  4IBN A;  3LPT A;  4DR5 K;  4LSN A;  4DWI A;  3DRS A;  3VQE A;  3CM6 A;  1UOC A;  1N32 K;  2FF3 B;  3AO4 A;  4WQ5 A;  3G71 N;  1VQ5 N;  3CCV N;  2Q1N A;  3LWM A;  4FYD A;  2O8B B;  2HND A;  1JL1 A;  4DF4 A;  1NGA A;  4CJF A;  4CCH A;  3PO5 A;  4KTQ A;  3SUQ A;  3RMA A;  4GV9 A;  1XUP O;  4C8L A;  5C24 A;  3CCL N;  4OPH A;  3RRG A;  2X6S A;  3THW A;  4FLZ A;  2EX3 A;  3JS6 A;  5AQO A;  5GIP A;  3QEX A;  3CC2 N;  4B1Z A;  1J6Z A;  3V1O A;  4AM6 A;  1RGI A;  3ISN C;  4KRE A;  3C65 A;  4IO8 A;  2WBN A;  3C94 A;  2W41 A;  3LP0 A;  2YJF A;  4DFM A;  4M3U A;  4I2P A;  4CEC A;  4U7B A;  1JLB A;  2ZJR L;  2PAV A;  1Y64 A;  4FLY A;  3QEW A;  1NGF A;  1JCE A;  3AO5 A;  4J2B A;  3QET A;  3F73 A;  4IFV A;  1SKW A;  5SWM A;  4FJL A;  4QOZ B;  5AQW A;  3BUZ B;  3FZM A;  3HOS A;  4I9L A;  3V9Z A;  3BF3 A;  1RFQ A;  1KFS A;  1RT6 A;  4KRF A;  2QXF A;  1TVR A;  1NJY A;  2O8D A;  2D0A A;  3O4W A;  1Z25 A;  2HBM A;  2QWN A;  4B3O A;  1EX4 A;  4DF8 A;  1DT9 A;  3AO3 A;  1YT3 A;  2W42 A;  2X78 A;  3CI5 A;  1NMN A;  3GDQ A;  2QWO A;  4HCB A;  4CEA A;  3FZH A;  3U6F A;  3SJJ A;  3O9R A;  4RW7 A;  5M1O A;  1QSL A;  4BE2 A;  4DV5 K;  1TUU A;  1YJN N;  1OH6 A;  1VSD A;  3EKS A;  3CFR A;  3WQU A;  4K41 A;  2CH6 A;  4BRF A;  5J1E A;  3C6H A;  5CZ2 A;  2ASO A;  1E3M A;  4FW2 A;  4Z4F A;  1EQY A;  4W5R A;  3QIC A;  3TPQ A;  2QM1 A;  5CHI A;  3O9U A;  1RBU A;  4B1W B;  3UKU A;  4OJR A;  1ASW A;  3NAE A;  3TTD A;  5KTQ A;  5C2D A;  4HUF A;  4C8M A;  1WSF A;  3U3Y A;  4EFH A;  3H3N O;  3P4I A;  4BR4 A;  4ISE A;  4YFU A;  4W5N A;  1BIZ A;  3FE1 A;  3HL8 A;  4LFC K;  4E19 A;  1N6Q A;  2YNH A;  3OW2 M;  4Z4G A;  4AF1 A;  5KPT A;  4DV0 K;  5AQS A;  5LMU K;  1EET A;  5AFU H;  2GTD A;  3ENO A;  3MEG A;  1T7P A;  3B8A X;  4Q5V A;  3ZSV A;  1LWC A;  2IVN A;  5CR4 A;  3ID6 A;  5GAD P;  1OH7 A;  1KCF A;  1FKO A;  3HSC A;  3F9M A;  4JD2 A;  4WCE L;  1M1K O;  2YX6 A;  4BRG A;  3C7N A;  1U4B A;  1IH7 A;  2NRR A;  1U45 A;  1RBT A;  5J2Q A;  3W0L A;  4ELU A;  3ZSZ A;  4FJM A;  4WFB L;  4Y1D A;  1C0T A;  1RDB A;  1VSM A;  4F8R A;  2P5O A;  1XHX A;  3DOL A;  1VK0 A;  1NK8 A;  1CZB A;  3SAH A;  4CZJ A;  3QNN A;  4ID1 A;  1VQN N;  3BF1 A;  3UKU B;  5HRN A;  2P9P B;  4FLV A;  3VEZ A;  4MDB A;  3MDQ A;  1TL1 A;  1DEJ A;  3M3Z A;  3O9S A;  3WXM B;  5BPM A;  4LF5 K;  3QB0 A;  4A62 A;  4TSX A;  3B6P A;  4CEF A;  4JYA K;  1WSI A;  2IAJ A;  3VTH A;  1CLQ A;  4FJX A;  4BE1 A;  1W2B M;  3DAW A;  1TKX A;  1X1P A;  3OYK A;  1T44 A;  3VQ4 A;  3U3G A;  3ZSW A;  3UKR B;  4RG8 A;  4LH5 A;  2ZJQ L;  4N76 A;  3Q7B A;  4YDU C;  3DRR A;  1ATR A;  1ITG A;  1HQE A;  4RW4 A;  4CES A;  4JI2 K;  1JCG A;  3ENH A;  1QS4 A;  3RMB A;  1EKE A;  4BRO A;  3OS0 A;  2Q31 A;  4KV8 A;  4YOV A;  4O4G A;  1WNS A;  3AVL A;  4DSL A;  3WXJ A;  2UU9 K;  3C7N B;  2QTD A;  1SKR A;  4L3Q A;  4M41 A;  3S41 A;  3QEI A;  2KKZ A;  4CGI A;  4BR0 A;  3ZSO A;  3ITH A;  1O13 A;  1B92 A;  1QVF M;  5AZJ A;  2E1Y A;  4N41 A;  1L5U A;  1NGD A;  3NH0 A;  5AZI B;  3VEN A;  2V7Y A;  3KLF A;  4N5S A;  1R59 O;  3V1R A;  4BC2 A;  3CQY A;  1X9W A;  3OS2 A;  1DKG D;  3I0R A;  4H8K A;  3WEE B;  3QEV A;  1YJW N;  3PIP L;  3OJU A;  1UA1 A;  2GV9 A;  4FO0 A;  4CHO A;  4EHU A;  2UXC K;  3F2K A;  3ASM A;  2HBL A;  4B9M A;  5I9E B;  2CGL A;  3HVR A;  3ZSX A;  4X62 K;  4BR9 A;  4K43 A;  4E3S A;  3EZ5 A;  3S3M A;  4JK7 A;  3SLC A;  2NRT A;  4CJK A;  3IKM A;  4QS9 A;  4B08 A;  4CJV A;  1YIT N;  1VSE A;  3KD1 E;  5TKW A;  3VF6 A;  1JKH A;  3V9S A;  4YDU A;  4BC3 A;  4CW7 B;  1X9J A;  3A0I X;  3LP3 A;  1S9E A;  2RN2 A;  4PKH A;  2O8F A;  5AQL A;  3QDK A;  4B1X B;  4IDK A;  4BVP A;  4M3W A;  4X66 K;  5AJ3 K;  4XEI A;  5HOO A;  4OX9 K;  4HVJ A;  3K2P A;  2UXD K;  1L3U A;  2E6L A;  3T69 A;  4KTW A;  3QML A;  2BGG A;  3ZT3 A;  1W9H A;  3LM9 A;  5M1Q A;  4FWL A;  1JL2 A;  4Z4I A;  1K9M O;  4B3R K;  3KLG A;  4B1Y B;  3V6D A;  1LCU A;  3AVC A;  1SL1 A;  3H46 O;  1U6Z A;  1YXQ A;  2FSK A;  4BAC A;  2KZZ A;  4FJI A;  3I8B A;  2Z1J A;  3HO1 A;  3DWL A;  3ULE B;  5F0X A;  2ZGZ A;  4FM2 A;  2RPI A;  3OVN A;  4CI6 A;  4WFA L;  5KGX A;  4FLT A;  3MAQ A;  2VGN A;  4JRQ A;  3CJ7 A;  4E1J A;  1K73 O;  3DLR A;  4NCB A;  3ALY A;  4GY2 B;  4OO1 J;  2BDP A;  2HB5 A;  4WE1 A;  4E7L A;  3FFI A;  1BCM A;  3P5J A;  4ID5 A;  3DLE A;  2HNY A;  1QE1 A;  4DSE A;  3AVG A;  1NM1 A;  5K14 A;  1XWL A;  1ZBI A;  4RW6 A;  3TTF A;  4YNQ A;  4JKE A;  4IOC L;  4H4O A;  1WSH A;  3AA2 A;  2O8F B;  2FLO A;  3WQT A;  1IKX A;  3CER A;  4FM0 A;  1B9F A;  4IEE A;  4KH5 A;  3CC4 N;  2XHB A;  3NVK A;  2EWS A;  3DRP A;  3NF7 A;  4J2D A;  1LAW A;  2O8E A;  4K8Z A;  4CED A;  1ZBF A;  1CZA N;  3L2R A;  1S1V A;  2G8K A;  1NGE A;  1ESV A;  3VQQ A;  1BGX T;  2DTU A;  2QK9 A;  3NGZ A;  3HJF A;  2F4V K;  3DLK A;  1HRH A;  3VQ9 A;  4CGG A;  1G15 A;  4NLB A;  3OYI A;  4YOU A;  3MEE A;  3SYZ A;  4CJ7 A;  3HP9 A;  4DV4 K;  1NOZ A;  1HUX A;  3EEQ A;  2G8H A;  4I6M A;  3VEW A;  4OPJ A;  4JS5 A;  1REV A;  2IDO A;  3VMF B;  5FPM A;  4BC4 A;  4CEB A;  3RTV A;  3M8Q A;  1C0M A;  3MMV A;  3D2E A;  4OKK A;  3CCS N;  4JAX A;  5GAE P;  4DU1 A;  4BDP A;  3VF2 A;  3O3G A;  3LPU A;  2BTF A;  3LAL A;  1B9D A;  4CZG A;  3CJ1 A;  4E7J A;  5AQM A;  1HNW K;  3PX4 A; 
#chains in the Genus database with same CATH homology
 4FOI A;  3O8M A;  3VEV A;  1NGA A;  4IXC A;  4GV9 A;  1XUP O;  4AM7 A;  4BG9 A;  3L0Q A;  3CCL N;  4OPH A;  1MWM A;  3SAG A;  1GLD G;  2YCH A;  4JK9 A;  4A2A A;  3E9L A;  2JWL A;  1HKB A;  5AQN A;  3JS6 A;  4J8F A;  5AQO A;  1BWF O;  4YOR A;  4MLE A;  4PL8 A;  5GIP A;  2BH1 A;  2A6A A;  2OAN A;  4B1Z A;  3CXC M;  3NVM A;  1J6Z A;  2E2Q A;  3CCM N;  4PHT X;  3CCR N;  4AM6 A;  3QFP A;  5TKY A;  1RDU A;  2IVP A;  4CBU A;  1K8A O;  2W40 A;  1HKG A;  1RGI A;  2NRX A;  3PIO L;  3C65 A;  1KC8 O;  4IO8 A;  2A41 A;  2WBN A;  3GBT A;  1S22 A;  2W41 A;  4XH5 A;  2YJF A;  4ISG A;  3OA9 A;  3IUC A;  4FWK A;  3WUH A;  4U7B A;  3T7Z A;  3VEY A;  2HF3 A;  3ZX0 A;  2ZJR L;  5KPR A;  3CIP A;  2PAV A;  1Y64 A;  1NGF A;  1NBW A;  2P9I A;  1JCE A;  3EN9 A;  5AQR A;  2E1Z A;  2D1K A;  1MDU B;  3D2F A;  5GAH P;  3EZW A;  3GL1 A;  5AQW A;  4KH6 A;  2A5X A;  4MO4 A;  3SMP A;  4BR2 A;  3BUZ B;  3FZM A;  3HOS A;  3ZEU B;  4YOW A;  1VQO N;  1YF5 L;  5M1K A;  2UYT A;  2WUS A;  3C0B A;  3BF3 A;  1RFQ A;  3IFR A;  3KZB A;  3IDH A;  4A61 A;  3R1X A;  3RVC A;  3U9D A;  3QFU A;  3O4W A;  2HBM A;  2QWN A;  3HRG A;  5AQT A;  4M63 C;  2I7P A;  3N4P A;  4FPB A;  3D2E B;  2E88 A;  3AAQ A;  1DT9 A;  2FF6 A;  2GUP A;  3CI5 A;  2P9L A;  3E66 A;  4NB4 A;  2NRV A;  3GDQ A;  5MLC Q;  2QWO A;  5FPD A;  2YI1 A;  5HL7 L;  3CC7 N;  3C6A A;  3FZH A;  3SBG A;  1U2V B;  5BN9 A;  1NLV A;  3O9R A;  3IMX A;  4FWM A;  5M1O A;  5AQX A;  1Q82 O;  2E8A A;  2QXL A;  4BRA A;  1V4S A;  2HBJ A;  5BRD A;  2P9S B;  5JLH A;  1TUU A;  2QA4 N;  1YJN N;  3CJB A;  3VTI A;  1MA9 B;  3CC2 N;  4H0V B;  4IOX A;  1HX1 A;  3EKS A;  2GEL A;  3OHR A;  4O5F A;  5ADX A;  1GLB G;  2ASP A;  3WQU A;  1HJO A;  3VGL A;  1SZ2 A;  2P9N A;  4K41 A;  5LJW A;  2CH6 A;  3JXU A;  3TSQ A;  4JD2 B;  3ZX3 A;  3C6H A;  4BRF A;  1XC3 A;  1JJ2 M;  2JWK A;  3NMU A;  4BRP A;  2ASO A;  3U9Z A;  3CCQ N;  4A57 A;  1EQY A;  4JK8 A;  3R8E A;  2YHX A;  3QIC A;  3TPQ A;  5JMV A;  5C10 A;  3J8A A;  3W3D A;  2QM1 A;  5CHI A;  3ZET A;  4IOA L;  3O9U A;  1GLF O;  4CZM A;  4B1W B;  1QHA A;  3UKU A;  2CGJ A;  3AAP A;  3H3O B;  4GNI A;  3TTD A;  2ASM A;  2CH5 A;  4NO7 A;  5C2D A;  2D0O A;  3G6E N;  3ID8 A;  4BRN A;  4CZL A;  4EFH A;  4PL7 A;  2P9I B;  5EX5 A;  3H3N O;  3ZEU A;  3I56 N;  1KQS M;  3P4I A;  2HBK A;  4IDH A;  4BR4 A;  4ISE A;  3FE1 A;  5GIO A;  3KHY A;  3U8X A;  1OKJ A;  1NWK A;  3MX5 A;  3CJ9 A;  4GVE A;  3AGK A;  5BPN A;  3TTC A;  1GLE G;  4HTL A;  4JHD B;  2YJE A;  3FR0 A;  3OW2 M;  4KH4 A;  4AF1 A;  2ZF5 O;  3CF5 L;  5BRE A;  5KPT A;  4KBO A;  5C0Y A;  1NGI A;  3K9K A;  4R79 A;  3DXM B;  2FXU A;  3P39 A;  5AQS A;  3R3L A;  5AFU H;  2GTD A;  3SK3 A;  3ENO A;  4RTF D;  1Q7Y O;  3B8A X;  4C1N K;  1QZ6 A;  1ZC6 A;  2P9L B;  2P9S A;  2V52 B;  1Q86 O;  4M7X A;  2IVN A;  5CR4 A;  3M1F A;  3CET A;  4ISF A;  3HI0 A;  1YUW A;  1ZBS A;  2GWK A;  3ID6 A;  4BR5 A;  1MWK A;  3FLC O;  3UB5 A;  5GAD P;  4CZH A;  1BUP A;  4JKH A;  4BC5 A;  4CD3 A;  5H1S Q;  2HOE A;  3LM2 A;  3R6M A;  3KWG A;  3HSC A;  4GV3 A;  3F9M A;  4JD2 A;  4WYB A;  1HPM A;  4Y0W A;  4WCE L;  1M1K O;  4CBW A;  2YX6 A;  4BRG A;  4CZK A;  1YI2 N;  3C7N A;  2A3Z A;  4IFE A;  1E4G T;  2NRR A;  1ATN A;  3FGU A;  4WQ4 A;  4BRD A;  2P9N B;  3W0L A;  2H3G X;  4JKD A;  3LDP A;  5EY4 A;  4BRL A;  1XQS C;  5KQD A;  4IWV A;  4WFB L;  2DPN A;  4B1V A;  4BRI A;  1E4F T;  1WOQ A;  4F9O A;  4CD1 A;  2D4W A;  2P9K B;  3O80 A;  3HTV A;  3K9J A;  1KAZ A;  3SAH A;  3CJC A;  4LC9 B;  3ZET B;  1KAX A;  2P9U A;  4CZJ A;  5JVG L;  1H1V A;  1VQ7 N;  1VQN N;  3BF1 A;  1NGG A;  3UKU B;  1OVY A;  3LDN A;  2P9P B;  5AZJ B;  3VEZ A;  4MDB A;  3J7Z O;  3FFK B;  4H5R A;  4IEI A;  5AQI A;  4BRK A;  4DKW A;  3MDQ A;  5C2F A;  1DEJ A;  3M3Z A;  1Q18 A;  3O9S A;  3WXM B;  4BGA A;  3QBW A;  1DGK N;  5AR0 A;  4JHD A;  5BPM A;  3QB0 A;  3QBX A;  4M7Y A;  4A62 A;  4BRE A;  1X3M A;  2QWP A;  2NRZ A;  3CCJ N;  3BEX A;  5AQH A;  1LOT B;  5GIN A;  5E84 A;  1M90 O;  3VTH A;  1SQK A;  3DJC A;  1ATS A;  3DXM A;  3LDO A;  4FWS A;  4BRC A;  3VGK A;  1W2B M;  1BA1 A;  4K42 A;  3DAW A;  3O08 A;  1V4T A;  2GWJ A;  1T44 A;  5DM6 L;  3FZK A;  3H45 C;  3AGR A;  2NNW A;  4H5T A;  4QS8 A;  3UKR B;  4EAH D;  1ZXO A;  3P38 A;  2E2O A;  3I33 A;  1C0F A;  4GV6 A;  5AQP A;  2ZJQ L;  3Q7B A;  4YDU C;  1ATR A;  2ZGY A;  4MDA A;  3O1W A;  1YIJ N;  1QQO A;  4JEP A;  1JCG A;  3ENH A;  1YVN A;  5JVH L;  5B8H A;  5EXW A;  2VGM A;  4BRO A;  3Q7C A;  3SMS A;  1KAY A;  2Q31 A;  2Q2R A;  4A5B A;  4YOV A;  1YHQ N;  4QS7 A;  4BRH A;  1Z6R A;  5JIC A;  4RWT A;  2QWR A;  4O8U A;  3CCU N;  3WXJ A;  3H6E A;  4IJN A;  3AAR A;  3MWP A;  3C7N B;  2QTD A;  2AA4 A;  2Q97 A;  3H1V X;  4ILH A;  3VF4 A;  2I7N A;  3HOT A;  4L3Q A;  3A5N C;  1VQM N;  3GOI A;  3S41 A;  1Z05 A;  2KKZ A;  3ENB A;  1IG8 A;  2P9K A;  5EVZ A;  3VES A;  4BY9 C;  3O9Q A;  2RE2 A;  4FL9 A;  4JKC A;  2D0P A;  2WFB A;  4PKG A;  4C23 A;  4BR0 A;  5LJV A;  2PBD A;  3HZ6 A;  1O13 A;  3WXL A;  3MCP A;  4C1N I;  1NGJ A;  1QVF M;  1YAG A;  2P9P A;  2QWQ A;  2E1Y A;  1TUY A;  5AZJ A;  4FWQ A;  1P90 A;  4NLC A;  5ADX H;  1VAZ A;  2P9U B;  1NGD A;  5M1F A;  4EIA A;  4FWN A;  3WXI A;  4H03 B;  5AZI B;  3VEN A;  2V7Y A;  3CQX A;  5AQJ A;  1R59 O;  4BC2 A;  3H1Q A;  2A40 A;  3CQY A;  1DKG D;  3ATV A;  3WEE B;  1YJW N;  2ITM A;  3PIP L;  2BUP A;  1NGH A;  4FO0 A;  2HST A;  5JLF A;  4G9Z A;  4H5N A;  4EHU A;  1QQM A;  1VQK N;  1Q81 O;  3F2K A;  1BDG A;  4IJA A;  2Q36 A;  4JKA A;  4DHY A;  2HBL A;  4K25 A;  5I9E B;  3CME N;  1IJJ A;  5KQ8 A;  1BU6 O;  2CGL A;  1K8K A;  1P8Z A;  2NRW A;  3L6Q A;  3G4S N;  2QEX N;  2E20 A;  1HKC A;  3UKR A;  4CZF A;  4JKF A;  1T6D A;  4BR9 A;  3ATU A;  4K43 A;  4A5A A;  2QI2 A;  3OBW A;  2YHW A;  5F2R A;  2GX9 A;  2QW9 A;  2F9W A;  4JK7 A;  5EOY A;  5C15 A;  3SLC A;  1VQ6 N;  1G99 A;  2NRT A;  4UY8 O;  3IKM A;  4QS9 A;  4WFN L;  4WF9 L;  3KK7 A;  4ILG B;  1YIT N;  1SAZ A;  5AQU A;  3EE8 A;  3CHW A;  5TKW A;  3VF6 A;  1QZ5 A;  4YDU A;  5AQQ A;  4BC3 A;  5BN8 A;  5AQY A;  1X9J A;  4JKG B;  3A0I X;  4PKH A;  5CE3 A;  3KWI A;  3VET A;  2IVO A;  3DXK A;  5AQL A;  2QWM A;  4JNE A;  3QDK A;  4B1X B;  3SJH A;  4DQ8 A;  3E9O A;  2YHY A;  3VER A;  4BVP A;  2GEM A;  3E9P A;  1QQN A;  3O6W A;  3A5L C;  3FZF A;  4XEI A;  4PKI A;  5AQZ A;  3VPZ A;  5HOO A;  3OBY A;  3GG4 A;  1QVG M;  2Q0R A;  4CZE A;  4DB3 A;  5GAG P;  3MK6 A;  3FZL A;  3T69 A;  1NJI O;  2J4R A;  3QML A;  1VQP N;  2E2N A;  3EO3 A;  3LM9 A;  2IIR A;  5M1Q A;  4FWL A;  1K9M O;  4B1Y B;  2KLA A;  4XH1 A;  5KPZ A;  2AP1 A;  4OPA A;  1NMD A;  5AQF A;  5AZI A;  2NLX A;  3LL3 A;  4O8K A;  1BOT O;  1LCU A;  1S3X A;  3VGM A;  3TSP A;  3O9T A;  1VQ8 N;  2OTL N;  1ILY A;  1GLJ O;  5C12 A;  3CD6 N;  4FSV A;  3L4Q A;  3H46 O;  1U6Z A;  1YXQ A;  3VEX A;  2FSK A;  3WEE A;  3HBT A;  5M1N A;  1C0G A;  3UE5 A;  4IO9 L;  3A5M C;  4H5V A;  3I8B A;  3DWL A;  4FWP A;  3ULE B;  3A8Y A;  1TYQ A;  2ZGZ A;  4FOE A;  4B1U B;  5F0X A;  4RCH A;  3SAF A;  4CI6 A;  1VQL N;  5E26 A;  4H0P A;  3HM8 A;  4WFA L;  4JN4 A;  1T3V A;  2QWL A;  3EE9 A;  4MO5 A;  4Z94 A;  5DM7 L;  5BRH A;  2VGN A;  5BR9 A;  2FSN A;  3CJ7 A;  4E1J A;  1K73 O;  2RHK A;  3MX2 A;  3MN6 A;  2VYP A;  4DCH A;  1K8K B;  2E2P A;  3KVG A;  4GY2 B;  4OO1 J;  3ZX2 A;  2CGK A;  3RSE B;  2F7T A;  1RDW X;  2V51 B;  3PLA A;  3LDL A;  2KHO A;  3MCA B;  4BVO A;  4EHT A;  3G25 A;  4I6M B;  4JKG A;  2A42 A;  3WXK A;  5FPN A;  4BG8 A;  1D4X A;  2VWB A;  2HMP A;  1NM1 A;  4FPA A;  5AQG A;  3TTF A;  4YOY A;  4JKE A;  1SS6 A;  4WQ5 C;  4IOC L;  1BO5 O;  1X3N A;  2FLO A;  3WQT A;  3DXK B;  3DLL L;  4A2B A;  3CER A;  2NRH A;  4H0O A;  2WC9 A;  3O5B A;  4BQZ A;  4IEE A;  4CZI A;  4KH5 A;  4U67 L;  5FPE A;  4B9Q A;  3CC4 N;  2ZWH A;  2ZJP L;  3NVK A;  2F9T A;  2EWS A;  4HWI A;  3F5T A;  1NGB A;  2HF4 A;  4XH4 A;  1JCF A;  3SBT A;  5BPL A;  3WT0 A;  3CPE A;  3M6G A;  4BRM A;  4BQL A;  4BGB A;  1VQ9 N;  2PFU A;  3D6R A;  4CBX A;  3A5O C;  3MWT A;  3U4L A;  3LDQ A;  4MLH A;  3EL2 A;  1CZA N;  5AQV A;  1EO1 A;  1W97 L;  4A59 A;  4WQ4 C;  3M5R A;  4FWO A;  1WUA A;  3GE1 A;  5AQK A;  4ILJ A;  4H5W A;  3ULE A;  1NGE A;  4H0X B;  3EKU A;  1GLA G;  1ESV A;  4BR7 A;  1BA0 A;  5BRF A;  3L4I A;  4IZ9 A;  4YOX A;  2NZT A;  5ELZ A;  1S72 N;  4H0Y B;  5M1P A;  4H0T B;  3VOV A;  1TYQ B;  2OTJ N;  1KXP A;  3CCE N;  3AY9 A;  3CPW M;  1GLC G;  4NLB A;  5AFU A;  2V7Z A;  3RSE A;  3E1Y A;  3MN9 A;  4YOU A;  5LY3 A;  3TU5 A;  4CJ7 A;  1VQ4 N;  1HUX A;  3BP8 A;  3VEO A;  4I6M A;  4YOT A;  3D2F B;  3ZYY X;  3VEW A;  1BG3 A;  3N4Q A;  2FSJ A;  3VMF B;  1YJ9 N;  3R9P A;  5FPM A;  4BC4 A;  3O1B A;  2Q0U A;  3MN7 A;  2VCP A;  3MMV A;  3CJA A;  3P31 A;  3D2E A;  3I55 N;  3CCS N;  4FVU A;  4BRQ A;  4JAX A;  4FWR A;  5GAE P;  4JKB A;  3VF2 A;  1GLL O;  1HLU A;  2BTF A;  3MN5 A;  3TSU A;  1U2V A;  1T6C A;  2FF3 B;  4CZG A;  3CJ1 A;  3D7E O;  4WQ5 A;  3G71 N;  1N8R O;  1NGC A;  1VQ5 N;  3CMA N;  3CCV N;  5AQM A;  5F1X A;  1KD1 O;  2Q1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...