4BC4A

Crystal structure of human d-xylulokinase in complex with d-xylulose
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
525
structure length
525
Chain Sequence
RRCCLGWDFSTQQVKVVAVDAELNVFYEESVHFDRDLPEFGTQGGVHVHKDGLTVTSPVLMWVQALDIILEKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLSPDLRLHQQLQDCFSISDCPVWMDSSTTAQCRQLEAAVGGAQALSCLTGSRAYERFTGNQIAKIYQQNPEAYSHTERISLVSSFAASLFLGSYSPIDYSDGSGMNLLQIQDKVWSQACLGACAPHLEEKLSPPVPSCSVVGAISSYYVQRYGFPPGCKVVAFTGDNPASLAGMRLEEGDIAVSLGTSDTLFLWLQEPMPALEGHIFCNPVDSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSKALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDVEVRALIEGQFMAKRIHAEGLGYRVMSKTKILATGGASHNREILQVLADVFDAPVYVIDTANSACVGSAYRAFHGLAGGTDVPFSEVVKLAPNPRLAATPSPGASQVYEALLPQYAKLEQRILSQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Function of Human Xylulokinase, an Enzyme with Important Roles in Carbohydrate Metabolism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords XYLULOSE KINASE
total genus 181
structure length 525
sequence length 525
chains with identical sequence B, C
ec nomenclature ec 2.7.1.17: Xylulokinase.
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00370 FGGY_N FGGY family of carbohydrate kinases, N-terminal domain
A PF02782 FGGY_C FGGY family of carbohydrate kinases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4bc4A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4bc4A01
2HF3A 2P9NA 3FZKA 4H0OA 4BRIA 3R8EA 3KVGA 1IG8A 1Q18A 3H3OB 4CZHA 1R59O 4I6MA 1HKGA 1KAZA 1S3XA 5LY3A 4BRCA 1RFQA 3D2EB 3ZETA 2QWMA 2YHXA 2QWNA 3M1FA 1MWMA 3MN6A 5KPRA 3WQUA 1KAYA 2I7NA 3CJ7A 3H1VX 5AQOA 3EO3A 3MN7A 1ATRA 3WEEB 4PKGA 4WYBA 5AQZA 4RCHA 3CI5A 1GLDG 1MWKA 1YAGA 2Q0RA 3WXIA 4CD3A 4BC4A 2KHOA 3I8BA 5AQKA 1U2VB 3M3ZA 3ULEB 4FWOA 4MLEA 5E84A 2ZWHA 4ISGA 4DCHA 1NGGA 1SAZA 5AQTA 3O5BA 1E4FT 4BVPA 3HTVA 5AQMA 5I9EB 1BOTO 2ASMA 4ISEA 3QB0A 3UKUB 5AQLA 5BPNA 3VEXA 4AM7A 2P9UB 3BF3A 1XQSC 3LDNA 5LJWA 4B1VA 4BRDA 2V7ZA 3A8YA 4DB3A 2P9SB 3QBXA 2A42A 4HWIA 3VF4A 3C7NB 5KPTA 1YXQA 4K43A 5BRHA 3S41A 1SZ2A 4FWKA 3IFRA 3ZX2A 5ADXA 2A6AA 2NLXA 1HX1A 2E1YA 1NMDA 4WQ5C 4BQLA 5AQVA 3HBTA 1BA1A 1DGKN 2ZGZA 3D2FB 1LCUA 4BQZA 4FWPA 3A0IX 3L0QA 2Q2RA 2HF4A 4K25A 1C0GA 2CGLA 4K42A 3C0BA 3A5MC 2PAVA 5B8HA 1HLUA 5AQSA 3SMSA 3GE1A 3L6QA 2E2QA 3A5NC 2YHYA 3DAWA 3DXKB 4C23A 1TUUA 3W0LA 3H6EA 2P9SA 1QQOA 5ADXH 1RDWX 1ATSA 1NGHA 1HKBA 2YI1A 4WQ5A 1KXPA 4LC9B 2J4RA 3ZX3A 1NM1A 3CJ1A 5BPMA 2WUSA 2W40A 2F9TA 1J6ZA 1Y64A 5AQPA 4FOIA 1T6CA 2E20A 1WUAA 3F9MA 3VF6A 4B1YB 2QWPA 3LM9A 3U4LA 3CERA 4FWLA 4H5TA 1BWFO 3MN5A 5KQ8A 3FE1A 3LDQA 3DXKA 4BC2A 1JCEA 4BC5A 3O8MA 4XH1A 5BN9A 4QS7A 1QHAA 4A2BA 3JXUA 3WEEA 4JD2A 2GTDA 2NRHA 1V4TA 2QWOA 5JLFA 1QZ6A 2VWBA 1NGEA 4Z94A 1ATNA 4IWVA 1GLFO 4FL9A 1H1VA 3MCPA 2QWLA 3AARA 1HKCA 4FWNA 4BGAA 5AR0A 4FSVA 4H0TB 4QS8A 5AQUA 3R6MA 4BREA 4BR5A 3SK3A 4CZEA 1RGIA 3FLCO 3MDQA 4CD1A 2CH6A 5BN8A 1BDGA 2GWKA 3VEVA 3DXMB 2D1KA 3CIPA 1SQKA 5EXWA 4HTLA 5AZIB 1MDUB 1NGDA 2E2PA 4CZFA 5KPZA 4BR4A 2P9IA 2YHWA 5JMVA 3O4WA 3VETA 4JN4A 1ZXOA 2P9LB 3U9DA 3JS6A 3VGMA 2F9WA 1NGBA 3LM2A 3MN9A 3CJCA 4B1ZA 4BRKA 4B9QA 2YJEA 2FSNA 3UKRA 3ULEA 2FF3B 3CETA 3VENA 4BRPA 2GELA 4BR2A 1ZBSA 3D2EA 3FFKB 3HZ6A 2E8AA 1T6DA 5AQRA 1QZ5A 3ZEUB 2ASOA 4BR0A 1S22A 2QWRA 1KAXA 4MLHA 1XC3A 3LDOA 4BRAA 1D4XA 4CZGA 3GDQA 1NBWA 1HPMA 1Z05A 3ATVA 3GL1A 3O6WA 3RSEB 1BO5O 5AQWA 4Y0WA 4CZIA 2V7YA 5BRDA 4NO7A 1TUYA 3B8AX 4PL8A 2CGJA 4NB4A 3O08A 1BU6O 1U2VA 5AQYA 3WXKA 4F9OA 2V52B 4IJNA 4MO4A 1T44A 2D0PA 3DXMA 2FLOA 5AQQA 3QMLA 4IJAA 5AFUA 1E4GT 3ATUA 3L4IA 4CZLA 3VESA 5AQJA 4FWQA 4BROA 4L3QA 1HUXA 1NGFA 2P9KA 1K8KB 4JNEA 3G25A 3BF1A 3H46O 2A41A 2ASPA 1TYQA 2P9LA 4GY2B 3SMPA 2E2OA 2P9PA 2VYPA 2QM1A 4BR9A 4BRFA 2NZTA 2QXLA 5AQNA 2E1ZA 4H5VA 3QDKA 3UKRB 5AQGA 4AM6A 5CE3A 4M63C 3QBWA 3KHYA 2W41A 2ZGYA 5EOYA 3LL3A 1G99A 3VGLA 2P9NB 3FZHA 3FZMA 3MK6A 3EZWA 3QFUA 5JICA 5AFUH 1HJOA 2P9PB 5ELZA 2HMPA 5AQHA 1DKGD 3LDPA 4IO8A 1CZAN 2IIRA 2PBDA 1BUPA 2YCHA 2AP1A 4BRQA 3CJBA 3EKSA 2Q36A 5EX5A 1Z6RA 3KZBA 3VEWA 3AAPA 4RTFD 2QWQA 2Q1NA 4H5WA 5E26A 2P9IB 2BTFA 3DJCA 2EWSA 4WQ4A 3VEOA 4CJ7A 4EHUA 3VOVA 2BUPA 3AAQA 4QS9A 1C0FA 3D7EO 4BRNA 4CBXA 4EFHA 4H0XB 4BVOA 1U6ZA 5AQIA 2HOEA 4IZ9A 5BR9A 2A5XA 1XUPO 5F1XA 4H0VB 4IXCA 1YVNA 5AZJB 4BGBA 3BEXA 5AQXA 2OANA 4EIAA 3GBTA 5TKYA 1NGAA 1GLJO 4CI6A 4A2AA 4GNIA 5AZJA 1ESVA 2D0OA 1BG3A 4WQ4C 3GOIA 4BRHA 3FR0A 4A62A 2GEMA 4YDUC 1GLEG 2A40A 4I6MB 3U8XA 2FXUA 5FPEA 4BR7A 3UB5A 2E2NA 4CZMA 1NLVA 4XH4A 3AY9A 1GLLO 4FO0A 3CJ9A 2FSKA 4JAXA 3WXJA 3WQTA 2FF6A 4CZKA 1BA0A 3VPZA 3IDHA 4H5RA 4CBUA 2V51B 4JD2B 3H45C 2Q31A 4E1JA 1NGCA 1YUWA 2P9UA 4BRGA 3BUZB 3EN9A 1GLBG 3O1BA 5AZIA 2I7PA 3J8AA 4PKIA 2CH5A 3HI0A 1OKJA 4FWSA 3O80A 3ENOA 4H0PA 5KQDA 2Q97A 1LOTB 1QQNA 3ENHA 3ZETB 3QICA 3CQXA 3VEZA 1NWKA 1MA9B 5FPMA 3DWLA 4J8FA 2A3ZA 1JCGA 3FZFA 2YJFA 4BC3A 2AA4A 4FOEA 4B1UB 2UYTA 2E88A 4FWMA 4O8KA 4KBOA 4M7XA 4XEIA 4CBWA 3ZX0A 1QQMA 2GWJA 3FZLA 3R9PA 2IVNA 3WXLA 3SLCA 4MO5A 4RWTA 3C7NA 1NGJA 1X9JA 3FGUA 3OHRA 5LJVA 2D4WA 3D2FA 3W3DA 3WT0A 4BG9A 5BREA 4K41A 3H1QA 5EY4A 3EKUA 3ID8A 1TYQB 5BPLA 3RSEA 3A5LC 4M7YA 5AQFA 3UKUA 1V4SA 4CZJA 3IUCA 3LDLA 4H0YB 4BG8A 4EAHD 5BRFA 1P8ZA 1X3MA 1GLAG 4H5NA 2ITMA 2VCPA 4PL7A 4FPBA 3GG4A 3WUHA 4PKHA 3EL2A 5FPNA 3UE5A 2QW9A 2ZF5O 4EHTA 1EQYA 1K8KA 1NGIA 3CJAA 4DQ8A 4XH5A 3VERA 3H3NO 2IVPA 3IMXA 5JLHA 4H03B 1X3NA 5F0XA 1WOQA 1GLCG 3QFPA 4DHYA 4BRLA 3CHWA 3O1WA 4O5FA 5EVZA 4A61A 1ZC6A 2FSJA 3U9ZA 3VGKA 2GUPA 2H3GX 3A5OC 4B1XB 3SJHA 5FPDA 3BP8A 3MMVA 2IVOA 3I33A 3TPQA 4B1WB 2P9KB 3M6GA 3VEYA 2DPNA 3P4IA 3VF2A 1IJJA 3CQYA 4FWRA 1DEJA 3HSCA 4FPAA 3ZEUA 1JCFA 3TU5A 4JHDA 4BRMA 4ISFA 4YDUA 2Q0UA 3HM8A 5F2RA 2CGKA 4JHDB
chains in the Genus database with same CATH superfamily
4H0OA 2P9NA 4U7BA 1Q18A 3H3OB 5HRRA 1QQCA 2VWJA 4CZHA 2UUBK 2PYJA 4MQ3A 3U6FA 1DTTA 1VQ4N 1S3XA 3C6AA 1RFQA 4IFYA 3AA4A 3M1FA 1X9SA 4M42A 1MWMA 1EP4A 3TSQA 1KVCA 2I7NA 5JVHL 4DSLA 4FJ8A 4LFBK 3K9JA 4W5OA 3QIPA 1NJXA 4CHNA 1ATRA 4JKEA 4WYBA 1WSGA 2WTUA 2WONA 4JS4A 3OA9A 1MWKA 1S1VA 3IKMA 3CMAN 4CHOA 3LWLA 4CF8A 4GKKK 3ULEB 1NNEA 1NK4A 4DCHA 1NGGA 1SAZA 1JLGA 5M1NA 1U49A 5I9EB 5DM7L 1YF5L 2ASMA 1GOAA 3BZKA 3M5RA 3AVGA 4CJSA 4JKAA 1XQSC 5LJWA 4B1VA 3QBXA 4HWIA 3VF4A 3C7NB 4FW2A 1YXQA 3NBPA 4FWKA 3ZX2A 2A6AA 3ZT0A 4O4GA 3SUNA 3LAMA 4KHYA 2D0CA 4LF9K 5J1EA 5HLFA 1LV5A 3D2FB 1EETA 1I94K 4FJXA 2HHXA 4BQZA 4FWPA 4C1NK 4K25A 1N6QA 4KB1A 4B8AB 4CJQA 5B8HA 4CCHA 2E2QA 3A5NC 2YHYA 4C23A 4A57A 3W0LA 4B8CA 1RDWX 1NGHA 3O9QA 4WQ5A 4DQPA 4LC9B 1W9HA 3QINA 5DMRA 5T7BA 4CF0A 4PUOA 5SWMA 5AQPA 5KI6A 4NXNK 2DFFA 4R79A 3I55N 2QWPA 3LM9A 4QOZB 2UU9K 1VSIA 4J2AA 4FJ7A 3LDQA 4BC2A 1TK5A 4KHUA 1TVRA 2F8SA 1VSFA 4XH1A 4I2PA 4KHNA 1QHAA 4M3ZA 3JXUA 2GTDA 5JLFA 1QZ6A 4OPJA 1ATNA 4FL9A 3AVNA 1H1VA 1QE1A 4HCBA 2XY7A 3AARA 1HKCA 1S1XA 5AR0A 4FSVA 3R6MA 3EEQA 1QSYA 3SK3A 3SQ2A 2Y1IA 4CD1A 4NLCA 4FJNA 4O8UA 2HHHK 4AHVA 4E7KA 1J5OA 3DXMB 3CIPA 4DLEA 5EXWA 4HTLA 3ZLJA 1MDUB 2E2PA 1EWRA 1FKOA 3HXMA 2Z1IA 4DMNA 3E66A 5KPZA 3CMEN 3N4QA 4BR4A 2P9IA 1LW2A 4DWIA 4JN4A 1T03A 3DLLL 3HRGA 3U9DA 3I8DA 3JS6A 1NGBA 5HROA 4PA1A 1ZBHA 1O1WA 1S5JA 3LAKA 4B9QA 3LP0A 4IFEA 3UKRA 3OYHA 2QXFA 3VENA 3P39A 2BE2A 2GELA 2RF2A 4G9ZA 3AVLA 5J2QA 3K9KA 1QZ5A 3PIOL 2YKNA 4CJWA 4JI8K 4BR0A 1KAXA 5J2MA 5LMNK 4BRAA 3RVCA 1JLCA 3GDQA 3LPTA 3VQPA 1NBWA 3ZSZA 4N56A 1OH8A 4W5QA 5AQWA 2BANA 3AO3A 4CZIA 5I42A 1WNSA 3MWPA 4HTUA 1B9FA 4F2RA 5AQYA 4CGJA 3TTDA 3O9SA 2DTUA 2D0PA 3LP3A 3E9OA 5AFUA 1RDCA 1W7AA 3LALA 3NAEA 5AQJA 4BROA 4CEOA 1P90A 4FM0A 3E01A 4E89A 1VQPN 3VQCA 2XHBA 5LL6Z 5KRTA 5HOOA 3NMUA 3TSPA 2QM1A 2QKKA 4JS5A 1TKZA 4DTOA 4C8LA 5C25A 2E1ZA 3UKRB 4LSNA 1X9MA 4AHCA 1EWQA 4DV5K 4FK2A 4CGHA 3TAEA 3CCJN 3QBWA 3O3FA 4EP5A 2W41A 5EOYA 3LL3A 1VSMA 3OYLA 1G99A 3CCRN 3FZHA 4JKCA 3OS2A 3EZWA 3QFUA 5JICA 5AFUH 2P9PB 5ELZA 2XO7A 3HT3A 1BISA 3OS0A 4C8OA 1CZAN 2PBDA 1YJ9N 2QI2A 2AP1A 4BRQA 2YKMA 3NVMA 1BGXT 3VQ9A 1Z6RA 3KZBA 5HRNA 2IGIA 4RTFD 2QWQA 3KD1E 5E26A 1N32K 4KH6A 2BTFA 4EHUA 3V6DA 2BUPA 3KLFA 4EFHA 1U6ZA 5AQIA 2HOEA 5AZJB 1YVNA 4M3TA 2X6NA 2OANA 2VQEK 3SYZA 4JKFA 3VA0A 5AZJA 1TK8A 5GADP 4JKBA 3FR0A 2NRWA 3T69A 4CEQA 4B3SK 2NNWA 3LP1A 4LH4A 4IG0A 3QERA 1HNXK 1KLNA 2KZZA 5H1SQ 5KGXA 2E2NA 4CZMA 1U47A 4DQRA 4XH4A 3MX5A 1K8AO 4FLZA 4KTWA 3WQTA 3BGRA 1Q8IA 3VPZA 1TKTA 4CBUA 1L3VA 4JD2B 3MECA 1WBBA 1BQNA 4E1JA 2DY4A 1NGCA 1Z26A 1YUWA 2P9UA 4CJUA 1O13A 4WFNL 3QEVA 1B92A 2I7PA 4NCBA 1XNQK 3PX0A 4PKIA 2CH5A 4FWSA 3O80A 2VGMA 3ENOA 4X65K 2Q97A 3JAMO 4CJTA 3CQXA 3VEZA 4JI5K 2HBLA 3V81A 3DWLA 1EXQA 2A3ZA 3DLKA 2YJFA 3T1HK 4DSKA 3J81O 3Q7BA 2X74A 4HUFA 3VQAA 4XEIA 4OLAA 4E0DA 1CXUA 1XI1A 3FZLA 4RWTA 3ZYYX 3C7NA 1X9JA 5LJVA 4HUEA 3OVNA 2YHAA 3TAMA 1HNWK 1C1AA 2KKZA 5BREA 1HPZA 4FJKA 4IOCL 4CFCA 2BH1A 4XIUA 1Y97A 1VRUA 3A5LC 3IRXA 4OKKA 2EHGA 3NGZA 1ZBLA 3VQ6A 3K5OA 3THXB 3M8QA 2KW4A 1ZYQA 1P8ZA 1JLQA 4NYFA 1GLAG 1Q7YO 2NRXA 3KKSA 1VK0A 2XY6A 3QLHA 1XWLA 5GIOA 3LZIA 4BDZA 1K8KA 4DQ8A 4QAGA 3VQ4A 3TABA 2OTJN 3VERA 2IVPA 1T3VA 4KHQA 3CD6N 1SL1A 1WOQA 2JGUA 1RT2A 2VWKA 3DOLA 1I3AA 4CGDA 2QA4N 3WXMB 1VSDA 3SAGA 2W6KA 1CZBA 3A5OC 3TSUA 3KD5E 5FPDA 3BP8A 5CZ1A 4YOYA 5HL7L 1IJJA 4FPAA 1DEJA 2UUCK 4DFKA 2VQFK 3P5JA 1NJZA 2CGKA 5HP1A 3B6OA 1VSKA 5HBMA 1N36K 3FZKA 1B9DA 4Z4GA 1Q9XA 1R59O 1CXQA 4CEFA 1K73O 5FLXO 4LFCK 5MLCQ 4G1QA 4UY8O 4BRCA 4DKWA 1ZBIA 1SS6A 3ZETA 1BIUA 2YHXA 3KIOA 1NK8A 3WQUA 1KAYA 1G15A 3CJ7A 1NG9A 2BGGA 4JI1K 1NMNA 3SBTA 4PKGA 3CCSN 4RCHA 4JK9A 1OH7A 5CZ2A 3UIQA 1BI4A 3J7AP 1OVYA 4BC4A 1VSHA 3DOKA 2Z1HA 4FVUA 3M3ZA 2O4IA 2YNFA 3OYEA 2ZWHA 1VQNN 3KTQA 1YHQN 5AQTA 4FLUA 1QTMA 3U3YA 2YNIA 3UKUB 1Q9YA 1J5EK 5BPNA 4AM7A 3AO5A 2P9UB 3TAPA 3LDNA 1KRPA 3MXMA 4BRDA 2V7ZA 3A8YA 4DB3A 4O5BA 1FJGK 4CJLA 5BRHA 4OJRA 3S41A 5C2FA 3OYGA 3CCMN 5J2PA 1VQ7N 1SZ2A 4B3RK 3QNNA 3CPEA 2NLXA 4F3OA 1HX1A 2E1YA 3MWTA 3KWIA 4B9TA 3G71N 4FJJA 4K8ZA 1SL2A 3ULDA 4BQLA 3KLIA 4WE1A 3HJFA 4KI6A 3NHGA 3MEDA 4RW6A 3OYNA 4E1MA 1BA1A 1DGKN 2ZGZA 3AVMA 4E19A 1LCUA 4CFBA 3L3VA 2HF4A 2CGLA 4JEPA 4AHRA 5DK5A 1HLUA 3WNEA 4N76A 3ID6A 3G10A 3L6QA 3MEGA 4FLWA 1D9FA 1QQOA 5ADXH 2J4RA 3QETA 2IOCA 2HNDA 4AF1A 4KHPK 4YOVA 2WUSA 1KSPA 3CFOA 1I39A 4FOIA 2E5LK 3VF6A 1OH6A 5A2QO 4ILJA 3AVBA 4ELVA 1D5AA 4JI6K 1RT5A 1HQEA 1VQLN 5KQ8A 4OPAA 3FE1A 4WCEL 4CHZA 1HRHA 5GIPA 2OZSA 3AGKA 3SJJA 4IG3A 4KKOA 4DSIA 4KAZA 1JXEA 2D0BA 3CCQN 3DLRA 1W0HA 4CE9A 3RMDA 3ZSOA 5KRSA 4A2BA 1M1KO 2HMIA 3SAFA 1SV5A 4DR4K 4IWVA 1GLFO 4OO1J 3MCPA 3VQEA 1U4BA 3QESA 2RKIA 3SUPA 4HVJA 4GVMA 4QS8A 5AQUA 4W5TA 4BREA 4JKDA 1RBSA 1ASVA 3MDQA 4FJ9A 1TAQA 3HPOA 2GWKA 1QVGM 4J2BA 5CYQA 4OLBA 5AJ3K 4GV6A 3B6PA 1SQKA 3KK3A 4DV6K 4A59A 3TI0A 1FK9A 3OS1A 4DV3K 4M3WA 3ASMA 5JMVA 3P83D 1RT1A 1TK0A 4FW1A 1ZXOA 4DG1A 2O8DA 3LP2A 3WNFA 2G8KA 1S9GA 2F9WA 2E6LA 4B1ZA 1TL1A 2FF3B 3CETA 3D0PA 2FBXA 1M90O 3AA5X 1CLQA 2XRIA 1ZBSA 1C0UA 3I0SA 1LWCA 5TKWA 3OW2M 1W2BM 2ASOA 1S22A 2QWRA 3V1RA 1XMOK 1XC3A 3C65A 3LDOA 3S9HA 2ZQBA 3CCEN 3AV9A 2UUAK 3O6WA 3RSEB 4Y0WA 4DTPA 1JL2A 2V7YA 1LAWA 1RBTA 5BRDA 1L3SA 4NO7A 3T19A 3B8AX 3QEWA 3O9UA 2V52B 3TTFA 5C2DA 2O8EB 2FLOA 3ZSQA 3PO4A 4IJAA 1Q82O 3O9TA 2VG6A 4IEIA 1IG9A 1E4GT 2E6MA 4B9VA 4KB0A 2O8FA 4FWQA 3V9ZA 4R5PA 4CEZA 4JNEA 2ASPA 4DUZK 1X9WA 1L5UA 3KK7A 3L2WA 4GY2B 3ZSRA 1KC8O 1QHTA 4WFBL 1NKCA 2ZD1A 5AQNA 3QEPA 4H5VA 3QDKA 4KHWA 5AQGA 3IS9A 5M1PA 4B3MK 2PZSA 2WC9A 2A1SA 2ZGYA 2O8FB 3O4QA 4K8XA 1IKYA 1S6PA 4KTZA 3VGLA 2P9NB 1KFSA 3SAHA 4YHHK 3NE6A 2EX3A 1HJOA 2HMPA 4F2SA 4O44A 4NLBA 2IIRA 3WNHA 4LF8K 5EX5A 5FRNA 2Q1NA 4BDYA 1YVUA 3ALYA 3DJCA 4CJ7A 3VTHA 1D9DA 1RT3A 3AAQA 4OPKA 4QS9A 2OPPA 3D7EO 4CBXA 4IZ9A 1S72N 1XUPO 5F1XA 5CYMA 3NF6A 4BGBA 2Z1JA 5AQXA 4DS4A 2ETJA 5KGWA 1GLJO 4A2AA 4I2QA 4GNIA 2HB5A 5JVGL 3SQ0A 4JYAK 4KTQA 4JKHA 4A62A 1W97L 3RRHA 1J9AA 4KREA 5EU7A 3M8PA 4I6MB 4RW9A 4ZTJA 2FXUA 4GKJK 3UB5A 1IBLK 2OYQA 1RT7A 3THVA 4FO0A 1NU0A 3CJ9A 4JAXA 3C6UA 3WXJA 2WBNA 1BA0A 3JYTA 4YFUA 1NOZA 3VQ8A 4ZHRA 3QNOA 1FKPA 2ATQA 1IBKK 1C0TA 4GW6A 3AVKA 4KRFA 3L3UA 1VQMN 4BRGA 3VQQA 3BUZB 3QEIA 3EN9A 3V1OA 4OVLA 1SUQA 4CJ5A 1VQ5N 1IKVA 1JLFA 2IC3A 3HI0A 1OKJA 1WSJA 1NJIO 2P5OA 2FBTA 4H0PA 4DUYK 1UOCA 4CECA 5KQDA 1LOTB 5C12A 1NWKA 2JLEA 5FPMA 4J8FA 3QIOA 4DF8A 3DRRA 1JCGA 3CFRA 1FXXA 4U67L 4FM1A 4LF4K 4OKEA 3P31A 1RDDA 1TGOA 4KBOA 4CBWA 2HNZA 1JLEA 3ZX0A 1TAUA 3R9PA 2ZE2A 3SLCA 3NVKA 4Q0BA 3L2RA 3W3DA 3WT0A 2RE2A 5HRPA 3OYBA 3ZT1A 4ELTA 2HBJA 3BDPA 1S9EA 3ID8A 1TYQB 1KTQA 2VG5A 4KHSA 4M7YA 5AQFA 4FCYA 4ID1A 4H0YB 3EY1A 1JL1A 3K5NA 4DS5A 3OYMA 4IOAL 2O8EA 2RN2A 4FPBA 3GG4A 3WUHA 4LH5A 3V4IA 2QW9A 4X66K 3KLEA 3U3GA 4OKJA 4CJFA 1NGIA 3CJAA 2ITGA 3PSIA 5E41A 2IAJA 3IMXA 5JLHA 4W5RA 4YY3K 2ZM6K 5F0XA 5JS2A 3QFPA 4H4OA 2QTDA 4DHYA 2HHVA 4Z4HA 3HL8A 4O5FA 5EVZA 4A61A 4Q5VA 3EYZA 1ITGA 3LANA 5D3GA 2GUPA 4B1XB 3NH1A 3ZSYA 1QSLA 2IVOA 3I33A 3MCAB 4AHUA 4M3RA 3M6GA 2DPNA 3P4IA 4E7LA 4C8MA 3VF2A 3CQYA 1ILYA 3RTVA 4FWRA 4JHDA 4YDUA 2G8UA 3HM8A 1SKSA 4B3OA 4B3TK 2O8BB 4JHDB 1RDAA 2HF3A 1WBDA 1Q81O 4BRIA 4DQSA 3ZT4A 4CVNE 2HHWA 3NDKA 1UA1A 2OZMA 1NOYA 5LY3A 3ITHA 4DR1K 4DR3K 2OA8A 4QCLA 2QWNA 1RTIA 4H4MA 3CC7N 3H1VX 3EO3A 3HVRA 1WSFA 5AQZA 3J7YP 3OY9A 1JLAA 4RW8A 3V9XA 5IWAK 3H08A 3TANA 2G8WA 3DLEA 4CD3A 3S3MA 3I8BA 3V9WA 3NF8A 4MDBA 3C94A 4ISGA 4O0IA 2KLAA 1E4FT 3TTCA 4BVPA 4LSLA 4CHQA 1BOTO 2WOMA 2OTLN 4C1NI 2NRZA 3VEXA 3BF3A 2BDPA 3CC2N 4B08A 2P9SB 1HR0K 2A42A 4DV2K 3PSFA 3HOTA 4B9UA 2PYLA 4OGCA 5ADXA 3IAYA 1HMVA 1VQON 4JI7K 2D0AA 4CF1A 3EE9A 4DSJA 3DLHA 4DR7K 5AQVA 3T1YK 2XY5A 3SPYA 3C6TA 1N33K 3A0IX 3L0QA 2FBVA 3QEXA 1C0GA 3CCLN 2OPSA 2UXBK 3A5MC 4B9LA 4FJGA 2PAVA 3THWA 3SMSA 3GE1A 1TUUA 2HVIA 1HNIA 1XMQK 5K14A 4CERA 1HKBA 4NYNA 3ZX3A 1RNHA 1NM1A 4DV0K 1IKWA 3AVIA 3S3NA 3DI6A 2W40A 3K5MA 2F9TA 1NJYA 2NUBA 2E20A 3QO9A 4X64K 3SUOA 3CERA 4M3XA 3MN5A 5GAHP 3VQDA 5M1OA 1NKEA 5SZTA 1T7PA 2F96A 4DSEA 1BCMA 4MFBA 4BC5A 3SCXA 3JSMA 4NCAA 4IFVA 4L8RB 4NXMK 5BN9A 3E1YA 4QS7A 4CJKA 1NK7A 3J80O 3WEEA 3M8SA 3TARA 2NRHA 4Z4FA 1V4TA 4O0JA 3DLBA 2KZMA 2VWBA 1NGEA 3AVFA 4BACA 4FZYA 2UXCK 4Z94A 4CEEA 2YNHA 4PWDA 3O9RA 1VQ8N 4IBNA 4BGAA 3DRPA 3LDSA 5C15A 4RW4A 2YV0X 4BR5A 5HRSA 4CZEA 1RGIA 2HNYA 3FLCO 5BN8A 4J2EA 1YIJN 2YNGA 4Y1CA 3P38A 4CEAA 2HSTA 3DYAA 2G8FA 3THYA 2P1JA 4KI4A 1DTQA 4UQGA 3OBWA 4DTUA 3O4WA 3VETA 3CFPA 4JI0K 3L4QA 2P9LB 3N4PA 3PV8A 3HOSA 3HSTB 3LM2A 3F73A 2O8DB 4E1NA 2FSNA 3ULEA 4DQQA 3EE8A 3TAGA 1BHLA 4BRPA 1XC9A 3VQ7A 3J7ZO 2X78A 5AQRA 4DR5K 3T7ZA 4F8RA 4H8KA 4FYDA 5LMUK 4DQIA 3TAQA 2F7TA 3ATVA 1C6VA 1BO5O 2W42A 3CYMA 4FZZA 3HM9A 4DFPA 2RPIA 2RHKA 3E9LA 4PL8A 4NB4A 3O08A 1BU6O 1U2VA 3WXKA 3SPZA 4F9OA 1C1BA 3NCIA 4DTNA 1T44A 3MXJA 1LW0A 3DXMA 5AQQA 3QMLA 3SV3A 3BY5A 4FZXC 3ATUA 3L4IA 4DV1K 4CZLA 4FLXA 5FROA 3RMCA 4CJEA 5GAGP 3CPWM 3BZCA 2P9KA 4JK8A 1BCOA 4KH4A 3SNNA 1RBUA 1TYQA 2HW3A 3R3LA 3SMPA 4GV9A 2E2OA 2P9PA 1EO1A 4BR9A 4BRFA 1S6QA 4LF7K 1RT4A 1RTHA 2QXLA 2PY5A 2KFNA 4AM6A 4M63C 4CJVA 1TKXA 4BWJA 1U04A 3KHYA 4CGGA 3AVHA 3T3FA 4V19S 3KK1A 3KWGA 3AO1A 5C24A 1VRTA 3C6HA 3MK6A 5AQHA 4LY7A 3LDPA 4M41A 4IO8A 1NK6A 2YCHA 3CG7A 4FJMA 1T8EA 3EKSA 2Q36A 4YNQA 3VEWA 5M1FA 3A2FA 1ZBUA 1VQ9N 3TR8A 2F4VK 4NCGA 2HHTA 2EWSA 4WQ4A 3VEOA 3RR7A 4HCCA 3AVCA 3HVTA 3VOVA 2I5JA 1C0FA 4BRNA 3ZSWA 4FLTA 4BVOA 1WSIA 3CM5A 4JI2K 1YJWN 4Z4IA 5JS1A 5BR9A 2A5XA 4CGIA 3E9PA 4GV3A 3F2KA 4EIAA 3GBTA 2DFEA 4CI6A 1KD1O 5FRMA 3O3GA 1ESVA 4CESA 3VA3A 5DM6L 4M3UA 1BG3A 3GOIA 4BRHA 4YDUC 4FLVA 4FJ5A 3OYJA 3U8XA 4BR7A 4EZ9A 4I9QA 3PY8A 3AY9A 1GLLO 1JKHA 4ICLA 1QSSA 1NKBA 1VQKN 2B5JA 2FF6A 2O4GA 4CZKA 3I0RA 2GX9A 4B9NA 3H45C 4I7FA 5GINA 3HO1A 2IDOA 1VSEA 3DM2A 1GLBG 4K0KK 4PY5A 1KVBA 4FJIA 4DTSA 2IS3A 3OYCA 3ENHA 3ZETB 3QICA 4EP4A 2DFHA 2B6AA 4BC3A 1N34K 4KPYA 3KJVA 2E88A 4FWMA 1SKRA 3AVJA 4O8KA 4ELUA 4LF6K 4M7XA 2HHSA 4CK2A 3L8BA 4ILGB 2GWJA 3WXLA 2IVNA 3AGRA 1EKEA 3OYFA 1WSEA 1NGJA 4Z4CA 4Z0UA 3OHRA 2D4WA 4GMJB 4BG9A 4JRQA 1U48A 1ZBFA 4OPHA 2G8HA 3MX2A 4K41A 4E7IA 3K58A 3AA3A 5BPLA 4DV4K 3ISNC 1WSHA 3UKUA 3IUCA 3LDLA 4BG8A 3MXIA 1FW6A 3SV4A 1BQMA 1C0MA 3F9KA 4PKHA 3ZCMA 1RBVA 4DV7K 3EL2A 5FPNA 2KTQA 3UE5A 1Q86O 4TSXA 3OYAA 4EHTA 1IV0A 1GOCA 3K2PA 4B9MA 1K6YA 1UWBA 4AILC 3O3HA 3K59A 2ZJQL 4FJHA 2O8BA 4BDPA 4H03B 1X3NA 1NK5A 1HNZK 4IDKA 3C95A 2QKBA 3G4SN 3CHWA 3O1WA 2NRVA 1ZC6A 4DTRA 4OX9K 3TPQA 4FVMA 4B1WB 3KKRA 3VEYA 3EZ5A 2HVHA 3OYDA 3HSCA 1JCFA 3THYB 4ISFA 1TL3A 1YJNN 3PX6A 5F2RA 1J54A 4CEDA 1MU2A 3KVGA 3R8EA 1IG8A 3P1GA 1KCFA 5I3UA 4I6MA 2HBMA 1HKGA 3M8RA 1KAZA 1KFDA 4JI4K 4N5SA 1C1CA 3MEEA 1HYSA 4EZ6A 1R0AA 3D2EB 2QWMA 4ZTFA 3MN6A 5KPRA 2F8TA 4BE0A 5AQOA 3MN7A 2Q3SA 3MAQA 3WEEB 3CC4N 4CK1A 3CI5A 1GLDG 1YAGA 2Q0RA 3WXIA 2KHOA 5AQKA 1YITN 1U2VB 4LF5K 4FWOA 4MLEA 5E84A 2R7YA 3SQ1A 4A5AA 1IH7A 3HPHA 5C0YA 2JWLA 3O5BA 3ZT2A 3HTVA 3NGYA 5AQMA 1JJ2M 1HNVA 4ISEA 3QB0A 2AJQA 2D5RA 4DR6K 3D45A 5AQLA 3THWB 5FDLA 4A5BA 1YT3A 2WFBA 2NRTA 5KPTA 1YI2N 1NK9A 4K43A 3IFRA 4CGFA 4YOWA 1DT9A 4CJRA 5CR4A 1XHZA 1VHXA 1NMDA 2G8IA 2UXDK 3HPGA 4WQ5C 4DF4A 2QEXN 1JLBA 1KQSM 3V9UA 4I9LA 3HBTA 5M1QA 1N5YA 4HUGA 1BL3A 2Q2RA 1RTJA 4E7HA 4K42A 3C0BA 5AQSA 1VQ6N 3L2QA 4CIFA 1QS4A 3DAWA 3DXKB 4CW7B 3H6EA 2P9SA 4GVEA 3VMFB 5CHIA 3G0ZA 1LAVA 1ATSA 2YI1A 3ZSVA 3NGIA 1KXPA 1WN7A 3CJ1A 4FM2A 5BPMA 1J6ZA 1Y64A 4DTXA 3SQ4A 1A5VA 1RDBA 1T6CA 4W5NA 1WUAA 3F9MA 4B1YB 2GBZA 3D6RA 4E3SA 1RILA 3U4LA 3OJSA 4HHTA 4FWLA 4H5TA 1BWFO 2GUIA 3DXKA 3CCVN 1JCEA 1S1UA 4OGEA 4DU4A 2NRRA 3NF7A 1OVQA 3O8MA 4BY9C 1WAFA 1L3TA 1WLJA 4IOXA 3PLAA 3OYIA 1DLOA 4JD2A 2Z1GA 2QWOA 1RT6A 4CF2A 4BWMA 3PO5A 1UAXA 4X62K 3LZJA 3RR8A 3AVAA 4ILHA 2QWLA 3AA2A 4FWNA 4YOXA 1QVFM 2O8CA 4H0TB 2QK9A 3HK2A 1IO2A 3DMJA 4N47A 3Q7CA 4AH9A 4DU3A 2CH6A 2OPRA 1BDGA 3CCUN 3OBYA 3VEVA 1XHXA 3RWUA 2D1KA 3R1XA 4JRPA 5AZIB 4RG8A 4JV5K 1NGDA 1ASWA 4CZFA 4AHSA 4WFAL 1CZ9A 4F3TA 1T05A 2YHWA 1KVAA 4FK0A 1IBMK 3V9SA 4RW7A 3VGMA 2VGNA 3MN9A 3CJCA 2HHUA 3WNGA 4BRKA 2YJEA 4MDAA 3LWMA 2W6LA 3K57A 3K5LA 4BR2A 3D2EA 3FFKB 4DFJA 3HZ6A 2E8AA 1K9MO 1T6DA 1TKDA 3ZEUB 4MLHA 1REVA 4CJPA 4AQYK 1D4XA 4CZGA 1LWFA 1HPMA 1HJRA 1Z05A 3GL1A 1GOBA 4KV8A 4YORA 1TUYA 2FC0A 3LPUA 2KFZA 2CGJA 3ENBA 1VAZA 4IJNA 4DSFA 3RMBA 4MO4A 3KK2A 1Z25A 2E4LA 1JXBA 2X6SA 3I56N 4FLYA 3SUQA 3OYKA 1WAJA 1NK0A 3VESA 2PFUA 4L3QA 1HUXA 1NGFA 1K8KB 3OJUA 3G25A 3BF1A 3H46O 3T1AA 3NFAA 2A41A 2P9LA 4KO0A 4CF9A 3CM6A 2VYPA 4O55A 4AHTA 2NZTA 4M45A 3NF9A 5IT9O 3CF5L 4CFDA 4PHTX 3SZ2A 5CE3A 2P5GA 4IO9L 3F5TA 1A5WA 2KQ2A 1EX4A 4LD0A 3S3OA 1IKXA 4FXDA 2HHQA 4FJLA 3ZT3A 4CIGA 3ZSXA 1SKWA 3FFIA 1RCHA 4YOUA 3FZMA 4JI3K 2Y1JA 2GV9A 1VSJA 1DKGD 1F21A 1SL0A 1BUPA 4DFMA 1U45A 3CJBA 3AO2A 1BIZA 3OTOK 4BE2A 3AAPA 3HYFA 4H5WA 3PX4A 2P9IB 3SI6A 4CJ4A 4KFBA 4CJ3A 4CFAA 5CY4A 4JLHA 1RDUA 4Y1DA 4H0XB 5BR8K 4DU1A 4H0VB 4IXCA 1A5XA 3SBGA 4CIEA 4M3YA 3BEXA 3PUFA 4JK7A 2XY8A 4LFAK 5TKYA 1NGAA 3L2VA 1J53A 1S1WA 2D0OA 4DLGA 4WQ4C 2LSNA 1RTDA 2GEMA 1GLEG 2A40A 5FPEA 4KH5A 1TV6A 1UA0A 3IG1A 3DLGA 3VTIA 1VSLA 1NLVA 4CEBA 4F4KA 2FSKA 3RRGA 4C8NA 1YTUA 3IDHA 4H5RA 2V51B 4IEEA 2Q31A 3CXCM 5J2NA 2P51A 4E7JA 3G6EN 1NJWA 3O1BA 2O8CB 1E3MA 5AZIA 2FBYA 3J8AA 3VQ5A 3L2UA 4WF9L 4DTJA 1QQNA 1HYZA 1MA9B 4N41A 3NH0A 3FZFA 1N8RO 2AA4A 2YHBA 4FOEA 4B1UB 2UYTA 4BE1A 5M1KA 4IDHA 3K0SA 1QQMA 2G8VA 4J2DA 3KLHA 1ASUA 4MO5A 3FGUA 5GAEP 3D2FA 4ID5A 1BI4B 1HYVA 2VG7A 3H1QA 5EY4A 4CHYA 2YX6A 1S1TA 3EKUA 4CK3A 3VN5A 3RSEA 3THXA 4DTMA 1XNRK 4IKFA 3PIPL 1V4SA 4CZJA 4DR2K 2ZJRL 4EAHD 5BRFA 1X3MA 4H5NA 2ITMA 2VCPA 4PL7A 2A1RA 5C42A 1X1PA 2HBKA 4JKGA 3HP9A 2ZF5O 1EQYA 4Z4EA 4XH5A 4JKGB 3H3NO 5KTQA 3CQ8A 3VQBA 3HP6A 4PQUA 2B4JA 3TWHA 3O4NA 1GLCG 1WB9A 4FK4A 1HQUA 2JWKA 4YOTA 4BRLA 3AO4A 1D8YA 3TAFA 2OPQA 2FSJA 3NH2A 3U9ZA 3VGKA 3V1QA 2H3GX 5C10A 3SJHA 1YTAA 3MMVA 4C8KA 3RMAA 2P9KB 3DRSA 4B9SA 1KLMA 1RBRA 1OH5A 3ZEUA 3TU5A 4BRMA 2ZJPL 1L3UA 1LWEA 3KLGA 2Q0UA 2OCEA 4CHPA
chains in the Genus database with same CATH topology
4F9OA 2HF3A 2P9NA 3FZKA 4H0OA 4U7BA 1Q81O 4BRIA 3R8EA 3KVGA 1IG8A 1Q18A 3H3OB 4CZHA 1R59O 4I6MA 2HBMA 1HKGA 1KAZA 1K73O 5MLCQ 1VQ4N 4UY8O 1S3XA 5LY3A 4BRCA 3C6AA 1RFQA 4DKWA 1SS6A 3D2EB 3ZETA 2QWMA 2YHXA 2QWNA 3M1FA 1MWMA 3MN6A 5KPRA 3TSQA 3WQUA 3CC7N 1KAYA 2I7NA 5JVHL 3CJ7A 3H1VX 5AQOA 3EO3A 3K9JA 3MN7A 1ATRA 3WEEB 3CC4N 4JKEA 3SBTA 4PKGA 4WYBA 3CCSN 5AQZA 4RCHA 4JK9A 3OA9A 3CI5A 1GLDG 1MWKA 1YAGA 2Q0RA 3WXIA 3IKMA 1OVYA 3CMAN 4CD3A 4BC4A 2KHOA 3I8BA 4FVUA 5AQKA 1YITN 1U2VB 3M3ZA 3ULEB 4FWOA 4MLEA 5E84A 2ZWHA 4MDBA 1VQNN 4ISGA 4A5AA 4DCHA 1NGGA 1SAZA 2KLAA 5AQTA 5M1NA 1YHQN 2JWLA 5C0YA 3O5BA 1E4FT 3TTCA 3HTVA 5AQMA 4BVPA 5I9EB 5DM7L 1JJ2M 1YF5L 1BOTO 2ASMA 4ISEA 3QB0A 2OTLN 3M5RA 3UKUB 5AQLA 4C1NI 2NRZA 5BPNA 3VEXA 4JKAA 4AM7A 2P9UB 3BF3A 1XQSC 3LDNA 5LJWA 4B1VA 3CC2N 4A5BA 4BRDA 2V7ZA 3A8YA 4DB3A 2P9SB 2WFBA 2A42A 2NRTA 3QBXA 3C7NB 4HWIA 3VF4A 5KPTA 1YI2N 1YXQA 4K43A 5BRHA 3S41A 5C2FA 3HOTA 3CCMN 1VQ7N 1SZ2A 4FWKA 3IFRA 3ZX2A 5ADXA 2A6AA 3CPEA 2NLXA 4YOWA 1HX1A 2E1YA 1DT9A 3MWTA 3KWIA 3G71N 5CR4A 1VQON 1NMDA 3EE9A 4WQ5C 4BQLA 2QEXN 5AQVA 1KQSM 3HBTA 1BA1A 1DGKN 2ZGZA 5M1QA 3D2FB 1LCUA 4BQZA 4FWPA 3A0IX 3L0QA 2Q2RA 2HF4A 4K25A 4C1NK 1C0GA 2CGLA 4JEPA 4K42A 3C0BA 3CCLN 3A5MC 2PAVA 5B8HA 1HLUA 5AQSA 3SMSA 3GE1A 1VQ6N 3ID6A 3L6QA 2E2QA 3A5NC 2YHYA 3DAWA 3DXKB 4A57A 1TUUA 3W0LA 3H6EA 2P9SA 4GVEA 3VMFB 4C23A 1QQOA 5ADXH 1RDWX 1ATSA 1NGHA 1HKBA 2YI1A 3O9QA 4WQ5A 1KXPA 4LC9B 2J4RA 3ZX3A 1NM1A 3CJ1A 4AF1A 5BPMA 4YOVA 2WUSA 2W40A 2F9TA 1J6ZA 1Y64A 5AQPA 4FOIA 1T6CA 2E20A 1WUAA 3F9MA 3VF6A 4B1YB 4R79A 2QWPA 3I55N 3D6RA 3LM9A 4ILJA 3U4LA 3CERA 1VQLN 4FWLA 4H5TA 1BWFO 3MN5A 4OPAA 3FE1A 4WCEL 3LDQA 5KQ8A 5GAHP 3DXKA 5GIPA 3CCVN 3AGKA 5M1OA 4BC2A 1JCEA 2NRRA 4BC5A 3CCQN 3O8MA 4XH1A 4BY9C 5BN9A 3E1YA 4IOXA 3PLAA 4QS7A 1QHAA 4A2BA 3JXUA 1M1KO 3WEEA 4JD2A 2GTDA 2NRHA 1V4TA 2QWOA 3SAFA 5JLFA 1QZ6A 2VWBA 1NGEA 4Z94A 1ATNA 4IWVA 1GLFO 4FL9A 1H1VA 4OO1J 3MCPA 4ILHA 2QWLA 3AARA 3O9RA 1HKCA 4FWNA 4YOXA 1VQ8N 4BGAA 5AR0A 1QVFM 4FSVA 4H0TB 4QS8A 5AQUA 5C15A 3R6MA 4BREA 4BR5A 4JKDA 3Q7CA 3SK3A 4CZEA 1RGIA 3FLCO 3MDQA 4CD1A 4NLCA 2CH6A 5BN8A 1BDGA 3CCUN 2GWKA 4O8UA 3OBYA 1QVGM 1YIJN 3VEVA 4GV6A 3DXMB 2D1KA 3CIPA 3R1XA 1SQKA 5EXWA 3P38A 4HTLA 5AZIB 2HSTA 4A59A 1MDUB 1NGDA 2E2PA 4CZFA 5KPZA 3E66A 4WFAL 3N4QA 4BR4A 3CMEN 3OBWA 2P9IA 2YHWA 5JMVA 3O4WA 3VETA 4JN4A 1ZXOA 3L4QA 3DLLL 2P9LB 3HRGA 3N4PA 3U9DA 3JS6A 3HOSA 3VGMA 2VGNA 1NGBA 2F9WA 3LM2A 3CJCA 3MN9A 4B1ZA 4BRKA 4IFEA 4B9QA 2YJEA 2FSNA 4MDAA 3UKRA 3EE8A 3ULEA 2FF3B 3CETA 3VENA 3P39A 4BRPA 1M90O 2GELA 4G9ZA 4BR2A 1ZBSA 3D2EA 3FFKB 3HZ6A 2E8AA 5CHIA 3J7ZO 1K9MO 1T6DA 3K9KA 1QZ5A 5AQRA 5TKWA 2ASOA 3ZEUB 3T7ZA 4BR0A 3PIOL 3OW2M 1W2BM 1S22A 2QWRA 1KAXA 4MLHA 1XC3A 3C65A 3LDOA 4BRAA 1D4XA 3RVCA 4CZGA 3GDQA 1NBWA 1HPMA 1Z05A 3CCEN 2F7TA 3ATVA 3GL1A 3O6WA 3RSEB 1BO5O 5AQWA 4Y0WA 4CZIA 2V7YA 4YORA 5BRDA 3MWPA 4NO7A 2RHKA 1TUYA 3B8AX 3E9LA 4PL8A 2CGJA 3ENBA 1VAZA 1BU6O 1U2VA 3O08A 3O9UA 4NB4A 5AQYA 3WXKA 2V52B 4IJNA 3TTFA 3TTDA 3O9SA 1T44A 4MO4A 5C2DA 2D0PA 3DXMA 2FLOA 5AQQA 3QMLA 4IJAA 3I56N 3E9OA 3O9TA 4IEIA 5AFUA 1Q82O 1E4GT 3ATUA 3L4IA 4CZLA 3VESA 5AQJA 5GAGP 4FWQA 4BROA 2PFUA 3CPWM 4L3QA 1P90A 1HUXA 1NGFA 2P9KA 1K8KB 4JK8A 4JNEA 4KH4A 3G25A 1VQPN 3BF1A 3H46O 2A41A 2ASPA 1TYQA 3KK7A 2P9LA 3R3LA 4GY2B 5HOOA 3SMPA 4GV9A 2E2OA 2P9PA 2VYPA 3NMUA 1EO1A 3TSPA 2QM1A 4BR9A 4BRFA 2NZTA 1KC8O 4WFBL 2QXLA 3CF5L 5AQNA 2E1ZA 4H5VA 3QDKA 3UKRB 4PHTX 5AQGA 4AM6A 5CE3A 5M1PA 4M63C 4IO9L 3CCJN 3F5TA 2WC9A 3QBWA 3KHYA 2W41A 2ZGYA 5EOYA 3LL3A 1G99A 3KWGA 3VGLA 2P9NB 3CCRN 3FZHA 4YOUA 3FZMA 3SAHA 4JKCA 3C6HA 3MK6A 3EZWA 3QFUA 5JICA 5AFUH 1HJOA 2P9PB 5ELZA 2HMPA 5AQHA 1DKGD 3LDPA 4IO8A 4NLBA 1CZAN 2IIRA 2PBDA 1YJ9N 2QI2A 1BUPA 2YCHA 2AP1A 4BRQA 3CJBA 3NVMA 3EKSA 2Q36A 5EX5A 1Z6RA 3KZBA 3VEWA 5M1FA 3AAPA 4RTFD 2QWQA 1VQ9N 2Q1NA 4H5WA 5E26A 2P9IB 4KH6A 2BTFA 3DJCA 2EWSA 4WQ4A 3VEOA 4CJ7A 4EHUA 3VTHA 3VOVA 2BUPA 3AAQA 1RDUA 4QS9A 1C0FA 3D7EO 4BRNA 4CBXA 4EFHA 4H0XB 4BVOA 1U6ZA 5AQIA 1YJWN 2HOEA 4IZ9A 1S72N 5BR9A 2A5XA 1XUPO 5F1XA 3E9PA 4H0VB 4IXCA 4GV3A 3SBGA 1YVNA 5AZJB 4BGBA 3BEXA 3F2KA 5AQXA 4JK7A 2OANA 4EIAA 4JKFA 3GBTA 5TKYA 1NGAA 1GLJO 4CI6A 1KD1O 4A2AA 4GNIA 5AZJA 1ESVA 5JVGL 2D0OA 5DM6L 1BG3A 5GADP 4JKHA 3GOIA 4JKBA 3FR0A 4WQ4C 1W97L 4A62A 2NRWA 4BRHA 3T69A 2NNWA 2GEMA 4YDUC 1GLEG 2A40A 5H1SQ 4I6MB 3U8XA 2FXUA 5FPEA 4KH5A 4BR7A 3UB5A 2E2NA 4CZMA 3VTIA 1NLVA 3MX5A 4XH4A 1K8AO 3AY9A 1GLLO 4FO0A 1VQKN 3CJ9A 2FSKA 4JAXA 3WXJA 2WBNA 3WQTA 2FF6A 4CZKA 1BA0A 3VPZA 3IDHA 4H5RA 4CBUA 2GX9A 2V51B 4IEEA 3H45C 4JD2B 2Q31A 3CXCM 4E1JA 1NGCA 5GINA 1YUWA 2P9UA 1O13A 4WFNL 1VQMN 4BRGA 3G6EN 3BUZB 3EN9A 1GLBG 3O1BA 5AZIA 2I7PA 1VQ5N 3J8AA 4PKIA 2CH5A 3HI0A 1OKJA 4FWSA 3O80A 1NJIO 2VGMA 3ENOA 4H0PA 4WF9L 5KQDA 2Q97A 1LOTB 1QQNA 3ENHA 3ZETB 3QICA 5C12A 3CQXA 3VEZA 1NWKA 2HBLA 1MA9B 3NVKA 5FPMA 3DWLA 4J8FA 2A3ZA 1JCGA 3FZFA 4U67L 2YJFA 4BC3A 1N8RO 2AA4A 4FOEA 4B1UB 2UYTA 2E88A 4FWMA 3P31A 5M1KA 4O8KA 3Q7BA 4KBOA 4IDHA 4M7XA 4XEIA 4CBWA 3ZX0A 1QQMA 4ILGB 2GWJA 3FZLA 3R9PA 2IVNA 3AGRA 3SLCA 4MO5A 3WXLA 3C7NA 3ZYYX 1NGJA 1X9JA 3FGUA 5GAEP 3OHRA 5LJVA 2D4WA 3D2FA 2RE2A 3W3DA 3WT0A 4BG9A 2KKZA 5BREA 4OPHA 4IOCL 3MX2A 4K41A 2BH1A 2HBJA 3H1QA 5EY4A 2YX6A 3EKUA 3ID8A 1TYQB 5BPLA 3RSEA 3A5LC 4M7YA 5AQFA 3PIPL 3UKUA 1V4SA 4CZJA 3IUCA 3LDLA 4H0YB 4BG8A 2ZJRL 4EAHD 5BRFA 1P8ZA 1X3MA 1GLAG 4H5NA 2ITMA 4IOAL 1Q7YO 2NRXA 2VCPA 4PL7A 4FPBA 3GG4A 3WUHA 4PKHA 3EL2A 5FPNA 2HBKA 3UE5A 1Q86O 2QW9A 5GIOA 4JKGA 2ZF5O 4EHTA 1EQYA 1K8KA 1NGIA 3CJAA 4DQ8A 4XH5A 4JKGB 2OTJN 3VERA 3H3NO 2IVPA 1T3VA 3IMXA 5JLHA 2ZJQL 4H03B 1X3NA 5F0XA 3CD6N 1WOQA 1GLCG 3QFPA 2JWKA 2QTDA 4DHYA 4YOTA 3G4SN 4BRLA 3WXMB 2QA4N 3CHWA 3O1WA 4O5FA 5EVZA 4A61A 2NRVA 1ZC6A 3SAGA 2FSJA 3U9ZA 3VGKA 2GUPA 2H3GX 5C10A 3TSUA 3A5OC 4B1XB 3SJHA 5FPDA 3BP8A 3MMVA 2IVOA 3I33A 3TPQA 4B1WB 4YOYA 3MCAB 2P9KB 3M6GA 3VEYA 2DPNA 3P4IA 5HL7L 3VF2A 1IJJA 3CQYA 1ILYA 4FWRA 1DEJA 3HSCA 4FPAA 3ZEUA 1JCFA 3TU5A 4JHDA 4BRMA 2ZJPL 4RWTA 4ISFA 4YDUA 1YJNN 2Q0UA 3HM8A 5F2RA 2CGKA 4JHDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HF3 A;  2P9N A;  3FZK A;  4H0O A;  4BRI A;  3R8E A;  3KVG A;  1IG8 A;  1Q18 A;  3H3O B;  4CZH A;  1R59 O;  4I6M A;  1HKG A;  1KAZ A;  1S3X A;  5LY3 A;  4BRC A;  1RFQ A;  3D2E B;  3ZET A;  2QWM A;  2YHX A;  2QWN A;  3M1F A;  1MWM A;  3MN6 A;  5KPR A;  3WQU A;  1KAY A;  2I7N A;  3CJ7 A;  3H1V X;  5AQO A;  3EO3 A;  3MN7 A;  1ATR A;  3WEE B;  4PKG A;  4WYB A;  5AQZ A;  4RCH A;  3CI5 A;  1GLD G;  1MWK A;  1YAG A;  2Q0R A;  3WXI A;  4CD3 A;  4BC4 A;  2KHO A;  3I8B A;  5AQK A;  1U2V B;  3M3Z A;  3ULE B;  4FWO A;  4MLE A;  5E84 A;  2ZWH A;  4ISG A;  4DCH A;  1NGG A;  1SAZ A;  5AQT A;  3O5B A;  1E4F T;  4BVP A;  3HTV A;  5AQM A;  5I9E B;  1BOT O;  2ASM A;  4ISE A;  3QB0 A;  3UKU B;  5AQL A;  5BPN A;  3VEX A;  4AM7 A;  2P9U B;  3BF3 A;  1XQS C;  3LDN A;  5LJW A;  4B1V A;  4BRD A;  2V7Z A;  3A8Y A;  4DB3 A;  2P9S B;  3QBX A;  2A42 A;  4HWI A;  3VF4 A;  3C7N B;  5KPT A;  1YXQ A;  4K43 A;  5BRH A;  3S41 A;  1SZ2 A;  4FWK A;  3IFR A;  3ZX2 A;  5ADX A;  2A6A A;  2NLX A;  1HX1 A;  2E1Y A;  1NMD A;  4WQ5 C;  4BQL A;  5AQV A;  3HBT A;  1BA1 A;  1DGK N;  2ZGZ A;  3D2F B;  1LCU A;  4BQZ A;  4FWP A;  3A0I X;  3L0Q A;  2Q2R A;  2HF4 A;  4K25 A;  1C0G A;  2CGL A;  4K42 A;  3C0B A;  3A5M C;  2PAV A;  5B8H A;  1HLU A;  5AQS A;  3SMS A;  3GE1 A;  3L6Q A;  2E2Q A;  3A5N C;  2YHY A;  3DAW A;  3DXK B;  4C23 A;  1TUU A;  3W0L A;  3H6E A;  2P9S A;  1QQO A;  5ADX H;  1RDW X;  1ATS A;  1NGH A;  1HKB A;  2YI1 A;  4WQ5 A;  1KXP A;  4LC9 B;  2J4R A;  3ZX3 A;  1NM1 A;  3CJ1 A;  5BPM A;  2WUS A;  2W40 A;  2F9T A;  1J6Z A;  1Y64 A;  5AQP A;  4FOI A;  1T6C A;  2E20 A;  1WUA A;  3F9M A;  3VF6 A;  4B1Y B;  2QWP A;  3LM9 A;  3U4L A;  3CER A;  4FWL A;  4H5T A;  1BWF O;  3MN5 A;  5KQ8 A;  3FE1 A;  3LDQ A;  3DXK A;  4BC2 A;  1JCE A;  4BC5 A;  3O8M A;  4XH1 A;  5BN9 A;  4QS7 A;  1QHA A;  4A2B A;  3JXU A;  3WEE A;  4JD2 A;  2GTD A;  2NRH A;  1V4T A;  2QWO A;  5JLF A;  1QZ6 A;  2VWB A;  1NGE A;  4Z94 A;  1ATN A;  4IWV A;  1GLF O;  4FL9 A;  1H1V A;  3MCP A;  2QWL A;  3AAR A;  1HKC A;  4FWN A;  4BGA A;  5AR0 A;  4FSV A;  4H0T B;  4QS8 A;  5AQU A;  3R6M A;  4BRE A;  4BR5 A;  3SK3 A;  4CZE A;  1RGI A;  3FLC O;  3MDQ A;  4CD1 A;  2CH6 A;  5BN8 A;  1BDG A;  2GWK A;  3VEV A;  3DXM B;  2D1K A;  3CIP A;  1SQK A;  5EXW A;  4HTL A;  5AZI B;  1MDU B;  1NGD A;  2E2P A;  4CZF A;  5KPZ A;  4BR4 A;  2P9I A;  2YHW A;  5JMV A;  3O4W A;  3VET A;  4JN4 A;  1ZXO A;  2P9L B;  3U9D A;  3JS6 A;  3VGM A;  2F9W A;  1NGB A;  3LM2 A;  3MN9 A;  3CJC A;  4B1Z A;  4BRK A;  4B9Q A;  2YJE A;  2FSN A;  3UKR A;  3ULE A;  2FF3 B;  3CET A;  3VEN A;  4BRP A;  2GEL A;  4BR2 A;  1ZBS A;  3D2E A;  3FFK B;  3HZ6 A;  2E8A A;  1T6D A;  5AQR A;  1QZ5 A;  3ZEU B;  2ASO A;  4BR0 A;  1S22 A;  2QWR A;  1KAX A;  4MLH A;  1XC3 A;  3LDO A;  4BRA A;  1D4X A;  4CZG A;  3GDQ A;  1NBW A;  1HPM A;  1Z05 A;  3ATV A;  3GL1 A;  3O6W A;  3RSE B;  1BO5 O;  5AQW A;  4Y0W A;  4CZI A;  2V7Y A;  5BRD A;  4NO7 A;  1TUY A;  3B8A X;  4PL8 A;  2CGJ A;  4NB4 A;  3O08 A;  1BU6 O;  1U2V A;  5AQY A;  3WXK A;  4F9O A;  2V52 B;  4IJN A;  4MO4 A;  1T44 A;  2D0P A;  3DXM A;  2FLO A;  5AQQ A;  3QML A;  4IJA A;  5AFU A;  1E4G T;  3ATU A;  3L4I A;  4CZL A;  3VES A;  5AQJ A;  4FWQ A;  4BRO A;  4L3Q A;  1HUX A;  1NGF A;  2P9K A;  1K8K B;  4JNE A;  3G25 A;  3BF1 A;  3H46 O;  2A41 A;  2ASP A;  1TYQ A;  2P9L A;  4GY2 B;  3SMP A;  2E2O A;  2P9P A;  2VYP A;  2QM1 A;  4BR9 A;  4BRF A;  2NZT A;  2QXL A;  5AQN A;  2E1Z A;  4H5V A;  3QDK A;  3UKR B;  5AQG A;  4AM6 A;  5CE3 A;  4M63 C;  3QBW A;  3KHY A;  2W41 A;  2ZGY A;  5EOY A;  3LL3 A;  1G99 A;  3VGL A;  2P9N B;  3FZH A;  3FZM A;  3MK6 A;  3EZW A;  3QFU A;  5JIC A;  5AFU H;  1HJO A;  2P9P B;  5ELZ A;  2HMP A;  5AQH A;  1DKG D;  3LDP A;  4IO8 A;  1CZA N;  2IIR A;  2PBD A;  1BUP A;  2YCH A;  2AP1 A;  4BRQ A;  3CJB A;  3EKS A;  2Q36 A;  5EX5 A;  1Z6R A;  3KZB A;  3VEW A;  3AAP A;  4RTF D;  2QWQ A;  2Q1N A;  4H5W A;  5E26 A;  2P9I B;  2BTF A;  3DJC A;  2EWS A;  4WQ4 A;  3VEO A;  4CJ7 A;  4EHU A;  3VOV A;  2BUP A;  3AAQ A;  4QS9 A;  1C0F A;  3D7E O;  4BRN A;  4CBX A;  4EFH A;  4H0X B;  4BVO A;  1U6Z A;  5AQI A;  2HOE A;  4IZ9 A;  5BR9 A;  2A5X A;  1XUP O;  5F1X A;  4H0V B;  4IXC A;  1YVN A;  5AZJ B;  4BGB A;  3BEX A;  5AQX A;  2OAN A;  4EIA A;  3GBT A;  5TKY A;  1NGA A;  1GLJ O;  4CI6 A;  4A2A A;  4GNI A;  5AZJ A;  1ESV A;  2D0O A;  1BG3 A;  4WQ4 C;  3GOI A;  4BRH A;  3FR0 A;  4A62 A;  2GEM A;  4YDU C;  1GLE G;  2A40 A;  4I6M B;  3U8X A;  2FXU A;  5FPE A;  4BR7 A;  3UB5 A;  2E2N A;  4CZM A;  1NLV A;  4XH4 A;  3AY9 A;  1GLL O;  4FO0 A;  3CJ9 A;  2FSK A;  4JAX A;  3WXJ A;  3WQT A;  2FF6 A;  4CZK A;  1BA0 A;  3VPZ A;  3IDH A;  4H5R A;  4CBU A;  2V51 B;  4JD2 B;  3H45 C;  2Q31 A;  4E1J A;  1NGC A;  1YUW A;  2P9U A;  4BRG A;  3BUZ B;  3EN9 A;  1GLB G;  3O1B A;  5AZI A;  2I7P A;  3J8A A;  4PKI A;  2CH5 A;  3HI0 A;  1OKJ A;  4FWS A;  3O80 A;  3ENO A;  4H0P A;  5KQD A;  2Q97 A;  1LOT B;  1QQN A;  3ENH A;  3ZET B;  3QIC A;  3CQX A;  3VEZ A;  1NWK A;  1MA9 B;  5FPM A;  3DWL A;  4J8F A;  2A3Z A;  1JCG A;  3FZF A;  2YJF A;  4BC3 A;  2AA4 A;  4FOE A;  4B1U B;  2UYT A;  2E88 A;  4FWM A;  4O8K A;  4KBO A;  4M7X A;  4XEI A;  4CBW A;  3ZX0 A;  1QQM A;  2GWJ A;  3FZL A;  3R9P A;  2IVN A;  3WXL A;  3SLC A;  4MO5 A;  4RWT A;  3C7N A;  1NGJ A;  1X9J A;  3FGU A;  3OHR A;  5LJV A;  2D4W A;  3D2F A;  3W3D A;  3WT0 A;  4BG9 A;  5BRE A;  4K41 A;  3H1Q A;  5EY4 A;  3EKU A;  3ID8 A;  1TYQ B;  5BPL A;  3RSE A;  3A5L C;  4M7Y A;  5AQF A;  3UKU A;  1V4S A;  4CZJ A;  3IUC A;  3LDL A;  4H0Y B;  4BG8 A;  4EAH D;  5BRF A;  1P8Z A;  1X3M A;  1GLA G;  4H5N A;  2ITM A;  2VCP A;  4PL7 A;  4FPB A;  3GG4 A;  3WUH A;  4PKH A;  3EL2 A;  5FPN A;  3UE5 A;  2QW9 A;  2ZF5 O;  4EHT A;  1EQY A;  1K8K A;  1NGI A;  3CJA A;  4DQ8 A;  4XH5 A;  3VER A;  3H3N O;  2IVP A;  3IMX A;  5JLH A;  4H03 B;  1X3N A;  5F0X A;  1WOQ A;  1GLC G;  3QFP A;  4DHY A;  4BRL A;  3CHW A;  3O1W A;  4O5F A;  5EVZ A;  4A61 A;  1ZC6 A;  2FSJ A;  3U9Z A;  3VGK A;  2GUP A;  2H3G X;  3A5O C;  4B1X B;  3SJH A;  5FPD A;  3BP8 A;  3MMV A;  2IVO A;  3I33 A;  3TPQ A;  4B1W B;  2P9K B;  3M6G A;  3VEY A;  2DPN A;  3P4I A;  3VF2 A;  1IJJ A;  3CQY A;  4FWR A;  1DEJ A;  3HSC A;  4FPA A;  3ZEU A;  1JCF A;  3TU5 A;  4JHD A;  4BRM A;  4ISF A;  4YDU A;  2Q0U A;  3HM8 A;  5F2R A;  2CGK A;  4JHD B; 
#chains in the Genus database with same CATH topology
 4H0O A;  2P9N A;  4U7B A;  1Q18 A;  3H3O B;  5HRR A;  1QQC A;  2VWJ A;  4CZH A;  2UUB K;  2PYJ A;  4MQ3 A;  3U6F A;  1DTT A;  1VQ4 N;  1S3X A;  3C6A A;  1RFQ A;  4IFY A;  3AA4 A;  3M1F A;  1X9S A;  4M42 A;  1MWM A;  1EP4 A;  3TSQ A;  1KVC A;  2I7N A;  5JVH L;  4DSL A;  4FJ8 A;  4LFB K;  3K9J A;  4W5O A;  3QIP A;  1NJX A;  4CHN A;  1ATR A;  4JKE A;  4WYB A;  1WSG A;  2WTU A;  2WON A;  4JS4 A;  3OA9 A;  1MWK A;  1S1V A;  3IKM A;  3CMA N;  4CHO A;  3LWL A;  4CF8 A;  4GKK K;  3ULE B;  1NNE A;  1NK4 A;  4DCH A;  1NGG A;  1SAZ A;  1JLG A;  5M1N A;  1U49 A;  5I9E B;  5DM7 L;  1YF5 L;  2ASM A;  1GOA A;  3BZK A;  3M5R A;  3AVG A;  4CJS A;  4JKA A;  1XQS C;  5LJW A;  4B1V A;  3QBX A;  4HWI A;  3VF4 A;  3C7N B;  4FW2 A;  1YXQ A;  3NBP A;  4FWK A;  3ZX2 A;  2A6A A;  3ZT0 A;  4O4G A;  3SUN A;  3LAM A;  4KHY A;  2D0C A;  4LF9 K;  5J1E A;  5HLF A;  1LV5 A;  3D2F B;  1EET A;  1I94 K;  4FJX A;  2HHX A;  4BQZ A;  4FWP A;  4C1N K;  4K25 A;  1N6Q A;  4KB1 A;  4B8A B;  4CJQ A;  5B8H A;  4CCH A;  2E2Q A;  3A5N C;  2YHY A;  4C23 A;  4A57 A;  3W0L A;  4B8C A;  1RDW X;  1NGH A;  3O9Q A;  4WQ5 A;  4DQP A;  4LC9 B;  1W9H A;  3QIN A;  5DMR A;  5T7B A;  4CF0 A;  4PUO A;  5SWM A;  5AQP A;  5KI6 A;  4NXN K;  2DFF A;  4R79 A;  3I55 N;  2QWP A;  3LM9 A;  4QOZ B;  2UU9 K;  1VSI A;  4J2A A;  4FJ7 A;  3LDQ A;  4BC2 A;  1TK5 A;  4KHU A;  1TVR A;  2F8S A;  1VSF A;  4XH1 A;  4I2P A;  4KHN A;  1QHA A;  4M3Z A;  3JXU A;  2GTD A;  5JLF A;  1QZ6 A;  4OPJ A;  1ATN A;  4FL9 A;  3AVN A;  1H1V A;  1QE1 A;  4HCB A;  2XY7 A;  3AAR A;  1HKC A;  1S1X A;  5AR0 A;  4FSV A;  3R6M A;  3EEQ A;  1QSY A;  3SK3 A;  3SQ2 A;  2Y1I A;  4CD1 A;  4NLC A;  4FJN A;  4O8U A;  2HHH K;  4AHV A;  4E7K A;  1J5O A;  3DXM B;  3CIP A;  4DLE A;  5EXW A;  4HTL A;  3ZLJ A;  1MDU B;  2E2P A;  1EWR A;  1FKO A;  3HXM A;  2Z1I A;  4DMN A;  3E66 A;  5KPZ A;  3CME N;  3N4Q A;  4BR4 A;  2P9I A;  1LW2 A;  4DWI A;  4JN4 A;  1T03 A;  3DLL L;  3HRG A;  3U9D A;  3I8D A;  3JS6 A;  1NGB A;  5HRO A;  4PA1 A;  1ZBH A;  1O1W A;  1S5J A;  3LAK A;  4B9Q A;  3LP0 A;  4IFE A;  3UKR A;  3OYH A;  2QXF A;  3VEN A;  3P39 A;  2BE2 A;  2GEL A;  2RF2 A;  4G9Z A;  3AVL A;  5J2Q A;  3K9K A;  1QZ5 A;  3PIO L;  2YKN A;  4CJW A;  4JI8 K;  4BR0 A;  1KAX A;  5J2M A;  5LMN K;  4BRA A;  3RVC A;  1JLC A;  3GDQ A;  3LPT A;  3VQP A;  1NBW A;  3ZSZ A;  4N56 A;  1OH8 A;  4W5Q A;  5AQW A;  2BAN A;  3AO3 A;  4CZI A;  5I42 A;  1WNS A;  3MWP A;  4HTU A;  1B9F A;  4F2R A;  5AQY A;  4CGJ A;  3TTD A;  3O9S A;  2DTU A;  2D0P A;  3LP3 A;  3E9O A;  5AFU A;  1RDC A;  1W7A A;  3LAL A;  3NAE A;  5AQJ A;  4BRO A;  4CEO A;  1P90 A;  4FM0 A;  3E01 A;  4E89 A;  1VQP N;  3VQC A;  2XHB A;  5LL6 Z;  5KRT A;  5HOO A;  3NMU A;  3TSP A;  2QM1 A;  2QKK A;  4JS5 A;  1TKZ A;  4DTO A;  4C8L A;  5C25 A;  2E1Z A;  3UKR B;  4LSN A;  1X9M A;  4AHC A;  1EWQ A;  4DV5 K;  4FK2 A;  4CGH A;  3TAE A;  3CCJ N;  3QBW A;  3O3F A;  4EP5 A;  2W41 A;  5EOY A;  3LL3 A;  1VSM A;  3OYL A;  1G99 A;  3CCR N;  3FZH A;  4JKC A;  3OS2 A;  3EZW A;  3QFU A;  5JIC A;  5AFU H;  2P9P B;  5ELZ A;  2XO7 A;  3HT3 A;  1BIS A;  3OS0 A;  4C8O A;  1CZA N;  2PBD A;  1YJ9 N;  2QI2 A;  2AP1 A;  4BRQ A;  2YKM A;  3NVM A;  1BGX T;  3VQ9 A;  1Z6R A;  3KZB A;  5HRN A;  2IGI A;  4RTF D;  2QWQ A;  3KD1 E;  5E26 A;  1N32 K;  4KH6 A;  2BTF A;  4EHU A;  3V6D A;  2BUP A;  3KLF A;  4EFH A;  1U6Z A;  5AQI A;  2HOE A;  5AZJ B;  1YVN A;  4M3T A;  2X6N A;  2OAN A;  2VQE K;  3SYZ A;  4JKF A;  3VA0 A;  5AZJ A;  1TK8 A;  5GAD P;  4JKB A;  3FR0 A;  2NRW A;  3T69 A;  4CEQ A;  4B3S K;  2NNW A;  3LP1 A;  4LH4 A;  4IG0 A;  3QER A;  1HNX K;  1KLN A;  2KZZ A;  5H1S Q;  5KGX A;  2E2N A;  4CZM A;  1U47 A;  4DQR A;  4XH4 A;  3MX5 A;  1K8A O;  4FLZ A;  4KTW A;  3WQT A;  3BGR A;  1Q8I A;  3VPZ A;  1TKT A;  4CBU A;  1L3V A;  4JD2 B;  3MEC A;  1WBB A;  1BQN A;  4E1J A;  2DY4 A;  1NGC A;  1Z26 A;  1YUW A;  2P9U A;  4CJU A;  1O13 A;  4WFN L;  3QEV A;  1B92 A;  2I7P A;  4NCB A;  1XNQ K;  3PX0 A;  4PKI A;  2CH5 A;  4FWS A;  3O80 A;  2VGM A;  3ENO A;  4X65 K;  2Q97 A;  3JAM O;  4CJT A;  3CQX A;  3VEZ A;  4JI5 K;  2HBL A;  3V81 A;  3DWL A;  1EXQ A;  2A3Z A;  3DLK A;  2YJF A;  3T1H K;  4DSK A;  3J81 O;  3Q7B A;  2X74 A;  4HUF A;  3VQA A;  4XEI A;  4OLA A;  4E0D A;  1CXU A;  1XI1 A;  3FZL A;  4RWT A;  3ZYY X;  3C7N A;  1X9J A;  5LJV A;  4HUE A;  3OVN A;  2YHA A;  3TAM A;  1HNW K;  1C1A A;  2KKZ A;  5BRE A;  1HPZ A;  4FJK A;  4IOC L;  4CFC A;  2BH1 A;  4XIU A;  1Y97 A;  1VRU A;  3A5L C;  3IRX A;  4OKK A;  2EHG A;  3NGZ A;  1ZBL A;  3VQ6 A;  3K5O A;  3THX B;  3M8Q A;  2KW4 A;  1ZYQ A;  1P8Z A;  1JLQ A;  4NYF A;  1GLA G;  1Q7Y O;  2NRX A;  3KKS A;  1VK0 A;  2XY6 A;  3QLH A;  1XWL A;  5GIO A;  3LZI A;  4BDZ A;  1K8K A;  4DQ8 A;  4QAG A;  3VQ4 A;  3TAB A;  2OTJ N;  3VER A;  2IVP A;  1T3V A;  4KHQ A;  3CD6 N;  1SL1 A;  1WOQ A;  2JGU A;  1RT2 A;  2VWK A;  3DOL A;  1I3A A;  4CGD A;  2QA4 N;  3WXM B;  1VSD A;  3SAG A;  2W6K A;  1CZB A;  3A5O C;  3TSU A;  3KD5 E;  5FPD A;  3BP8 A;  5CZ1 A;  4YOY A;  5HL7 L;  1IJJ A;  4FPA A;  1DEJ A;  2UUC K;  4DFK A;  2VQF K;  3P5J A;  1NJZ A;  2CGK A;  5HP1 A;  3B6O A;  1VSK A;  5HBM A;  1N36 K;  3FZK A;  1B9D A;  4Z4G A;  1Q9X A;  1R59 O;  1CXQ A;  4CEF A;  1K73 O;  5FLX O;  4LFC K;  5MLC Q;  4G1Q A;  4UY8 O;  4BRC A;  4DKW A;  1ZBI A;  1SS6 A;  3ZET A;  1BIU A;  2YHX A;  3KIO A;  1NK8 A;  3WQU A;  1KAY A;  1G15 A;  3CJ7 A;  1NG9 A;  2BGG A;  4JI1 K;  1NMN A;  3SBT A;  4PKG A;  3CCS N;  4RCH A;  4JK9 A;  1OH7 A;  5CZ2 A;  3UIQ A;  1BI4 A;  3J7A P;  1OVY A;  4BC4 A;  1VSH A;  3DOK A;  2Z1H A;  4FVU A;  3M3Z A;  2O4I A;  2YNF A;  3OYE A;  2ZWH A;  1VQN N;  3KTQ A;  1YHQ N;  5AQT A;  4FLU A;  1QTM A;  3U3Y A;  2YNI A;  3UKU B;  1Q9Y A;  1J5E K;  5BPN A;  4AM7 A;  3AO5 A;  2P9U B;  3TAP A;  3LDN A;  1KRP A;  3MXM A;  4BRD A;  2V7Z A;  3A8Y A;  4DB3 A;  4O5B A;  1FJG K;  4CJL A;  5BRH A;  4OJR A;  3S41 A;  5C2F A;  3OYG A;  3CCM N;  5J2P A;  1VQ7 N;  1SZ2 A;  4B3R K;  3QNN A;  3CPE A;  2NLX A;  4F3O A;  1HX1 A;  2E1Y A;  3MWT A;  3KWI A;  4B9T A;  3G71 N;  4FJJ A;  4K8Z A;  1SL2 A;  3ULD A;  4BQL A;  3KLI A;  4WE1 A;  3HJF A;  4KI6 A;  3NHG A;  3MED A;  4RW6 A;  3OYN A;  4E1M A;  1BA1 A;  1DGK N;  2ZGZ A;  3AVM A;  4E19 A;  1LCU A;  4CFB A;  3L3V A;  2HF4 A;  2CGL A;  4JEP A;  4AHR A;  5DK5 A;  1HLU A;  3WNE A;  4N76 A;  3ID6 A;  3G10 A;  3L6Q A;  3MEG A;  4FLW A;  1D9F A;  1QQO A;  5ADX H;  2J4R A;  3QET A;  2IOC A;  2HND A;  4AF1 A;  4KHP K;  4YOV A;  2WUS A;  1KSP A;  3CFO A;  1I39 A;  4FOI A;  2E5L K;  3VF6 A;  1OH6 A;  5A2Q O;  4ILJ A;  3AVB A;  4ELV A;  1D5A A;  4JI6 K;  1RT5 A;  1HQE A;  1VQL N;  5KQ8 A;  4OPA A;  3FE1 A;  4WCE L;  4CHZ A;  1HRH A;  5GIP A;  2OZS A;  3AGK A;  3SJJ A;  4IG3 A;  4KKO A;  4DSI A;  4KAZ A;  1JXE A;  2D0B A;  3CCQ N;  3DLR A;  1W0H A;  4CE9 A;  3RMD A;  3ZSO A;  5KRS A;  4A2B A;  1M1K O;  2HMI A;  3SAF A;  1SV5 A;  4DR4 K;  4IWV A;  1GLF O;  4OO1 J;  3MCP A;  3VQE A;  1U4B A;  3QES A;  2RKI A;  3SUP A;  4HVJ A;  4GVM A;  4QS8 A;  5AQU A;  4W5T A;  4BRE A;  4JKD A;  1RBS A;  1ASV A;  3MDQ A;  4FJ9 A;  1TAQ A;  3HPO A;  2GWK A;  1QVG M;  4J2B A;  5CYQ A;  4OLB A;  5AJ3 K;  4GV6 A;  3B6P A;  1SQK A;  3KK3 A;  4DV6 K;  4A59 A;  3TI0 A;  1FK9 A;  3OS1 A;  4DV3 K;  4M3W A;  3ASM A;  5JMV A;  3P83 D;  1RT1 A;  1TK0 A;  4FW1 A;  1ZXO A;  4DG1 A;  2O8D A;  3LP2 A;  3WNF A;  2G8K A;  1S9G A;  2F9W A;  2E6L A;  4B1Z A;  1TL1 A;  2FF3 B;  3CET A;  3D0P A;  2FBX A;  1M90 O;  3AA5 X;  1CLQ A;  2XRI A;  1ZBS A;  1C0U A;  3I0S A;  1LWC A;  5TKW A;  3OW2 M;  1W2B M;  2ASO A;  1S22 A;  2QWR A;  3V1R A;  1XMO K;  1XC3 A;  3C65 A;  3LDO A;  3S9H A;  2ZQB A;  3CCE N;  3AV9 A;  2UUA K;  3O6W A;  3RSE B;  4Y0W A;  4DTP A;  1JL2 A;  2V7Y A;  1LAW A;  1RBT A;  5BRD A;  1L3S A;  4NO7 A;  3T19 A;  3B8A X;  3QEW A;  3O9U A;  2V52 B;  3TTF A;  5C2D A;  2O8E B;  2FLO A;  3ZSQ A;  3PO4 A;  4IJA A;  1Q82 O;  3O9T A;  2VG6 A;  4IEI A;  1IG9 A;  1E4G T;  2E6M A;  4B9V A;  4KB0 A;  2O8F A;  4FWQ A;  3V9Z A;  4R5P A;  4CEZ A;  4JNE A;  2ASP A;  4DUZ K;  1X9W A;  1L5U A;  3KK7 A;  3L2W A;  4GY2 B;  3ZSR A;  1KC8 O;  1QHT A;  4WFB L;  1NKC A;  2ZD1 A;  5AQN A;  3QEP A;  4H5V A;  3QDK A;  4KHW A;  5AQG A;  3IS9 A;  5M1P A;  4B3M K;  2PZS A;  2WC9 A;  2A1S A;  2ZGY A;  2O8F B;  3O4Q A;  4K8X A;  1IKY A;  1S6P A;  4KTZ A;  3VGL A;  2P9N B;  1KFS A;  3SAH A;  4YHH K;  3NE6 A;  2EX3 A;  1HJO A;  2HMP A;  4F2S A;  4O44 A;  4NLB A;  2IIR A;  3WNH A;  4LF8 K;  5EX5 A;  5FRN A;  2Q1N A;  4BDY A;  1YVU A;  3ALY A;  3DJC A;  4CJ7 A;  3VTH A;  1D9D A;  1RT3 A;  3AAQ A;  4OPK A;  4QS9 A;  2OPP A;  3D7E O;  4CBX A;  4IZ9 A;  1S72 N;  1XUP O;  5F1X A;  5CYM A;  3NF6 A;  4BGB A;  2Z1J A;  5AQX A;  4DS4 A;  2ETJ A;  5KGW A;  1GLJ O;  4A2A A;  4I2Q A;  4GNI A;  2HB5 A;  5JVG L;  3SQ0 A;  4JYA K;  4KTQ A;  4JKH A;  4A62 A;  1W97 L;  3RRH A;  1J9A A;  4KRE A;  5EU7 A;  3M8P A;  4I6M B;  4RW9 A;  4ZTJ A;  2FXU A;  4GKJ K;  3UB5 A;  1IBL K;  2OYQ A;  1RT7 A;  3THV A;  4FO0 A;  1NU0 A;  3CJ9 A;  4JAX A;  3C6U A;  3WXJ A;  2WBN A;  1BA0 A;  3JYT A;  4YFU A;  1NOZ A;  3VQ8 A;  4ZHR A;  3QNO A;  1FKP A;  2ATQ A;  1IBK K;  1C0T A;  4GW6 A;  3AVK A;  4KRF A;  3L3U A;  1VQM N;  4BRG A;  3VQQ A;  3BUZ B;  3QEI A;  3EN9 A;  3V1O A;  4OVL A;  1SUQ A;  4CJ5 A;  1VQ5 N;  1IKV A;  1JLF A;  2IC3 A;  3HI0 A;  1OKJ A;  1WSJ A;  1NJI O;  2P5O A;  2FBT A;  4H0P A;  4DUY K;  1UOC A;  4CEC A;  5KQD A;  1LOT B;  5C12 A;  1NWK A;  2JLE A;  5FPM A;  4J8F A;  3QIO A;  4DF8 A;  3DRR A;  1JCG A;  3CFR A;  1FXX A;  4U67 L;  4FM1 A;  4LF4 K;  4OKE A;  3P31 A;  1RDD A;  1TGO A;  4KBO A;  4CBW A;  2HNZ A;  1JLE A;  3ZX0 A;  1TAU A;  3R9P A;  2ZE2 A;  3SLC A;  3NVK A;  4Q0B A;  3L2R A;  3W3D A;  3WT0 A;  2RE2 A;  5HRP A;  3OYB A;  3ZT1 A;  4ELT A;  2HBJ A;  3BDP A;  1S9E A;  3ID8 A;  1TYQ B;  1KTQ A;  2VG5 A;  4KHS A;  4M7Y A;  5AQF A;  4FCY A;  4ID1 A;  4H0Y B;  3EY1 A;  1JL1 A;  3K5N A;  4DS5 A;  3OYM A;  4IOA L;  2O8E A;  2RN2 A;  4FPB A;  3GG4 A;  3WUH A;  4LH5 A;  3V4I A;  2QW9 A;  4X66 K;  3KLE A;  3U3G A;  4OKJ A;  4CJF A;  1NGI A;  3CJA A;  2ITG A;  3PSI A;  5E41 A;  2IAJ A;  3IMX A;  5JLH A;  4W5R A;  4YY3 K;  2ZM6 K;  5F0X A;  5JS2 A;  3QFP A;  4H4O A;  2QTD A;  4DHY A;  2HHV A;  4Z4H A;  3HL8 A;  4O5F A;  5EVZ A;  4A61 A;  4Q5V A;  3EYZ A;  1ITG A;  3LAN A;  5D3G A;  2GUP A;  4B1X B;  3NH1 A;  3ZSY A;  1QSL A;  2IVO A;  3I33 A;  3MCA B;  4AHU A;  4M3R A;  3M6G A;  2DPN A;  3P4I A;  4E7L A;  4C8M A;  3VF2 A;  3CQY A;  1ILY A;  3RTV A;  4FWR A;  4JHD A;  4YDU A;  2G8U A;  3HM8 A;  1SKS A;  4B3O A;  4B3T K;  2O8B B;  4JHD B;  1RDA A;  2HF3 A;  1WBD A;  1Q81 O;  4BRI A;  4DQS A;  3ZT4 A;  4CVN E;  2HHW A;  3NDK A;  1UA1 A;  2OZM A;  1NOY A;  5LY3 A;  3ITH A;  4DR1 K;  4DR3 K;  2OA8 A;  4QCL A;  2QWN A;  1RTI A;  4H4M A;  3CC7 N;  3H1V X;  3EO3 A;  3HVR A;  1WSF A;  5AQZ A;  3J7Y P;  3OY9 A;  1JLA A;  4RW8 A;  3V9X A;  5IWA K;  3H08 A;  3TAN A;  2G8W A;  3DLE A;  4CD3 A;  3S3M A;  3I8B A;  3V9W A;  3NF8 A;  4MDB A;  3C94 A;  4ISG A;  4O0I A;  2KLA A;  1E4F T;  3TTC A;  4BVP A;  4LSL A;  4CHQ A;  1BOT O;  2WOM A;  2OTL N;  4C1N I;  2NRZ A;  3VEX A;  3BF3 A;  2BDP A;  3CC2 N;  4B08 A;  2P9S B;  1HR0 K;  2A42 A;  4DV2 K;  3PSF A;  3HOT A;  4B9U A;  2PYL A;  4OGC A;  5ADX A;  3IAY A;  1HMV A;  1VQO N;  4JI7 K;  2D0A A;  4CF1 A;  3EE9 A;  4DSJ A;  3DLH A;  4DR7 K;  5AQV A;  3T1Y K;  2XY5 A;  3SPY A;  3C6T A;  1N33 K;  3A0I X;  3L0Q A;  2FBV A;  3QEX A;  1C0G A;  3CCL N;  2OPS A;  2UXB K;  3A5M C;  4B9L A;  4FJG A;  2PAV A;  3THW A;  3SMS A;  3GE1 A;  1TUU A;  2HVI A;  1HNI A;  1XMQ K;  5K14 A;  4CER A;  1HKB A;  4NYN A;  3ZX3 A;  1RNH A;  1NM1 A;  4DV0 K;  1IKW A;  3AVI A;  3S3N A;  3DI6 A;  2W40 A;  3K5M A;  2F9T A;  1NJY A;  2NUB A;  2E20 A;  3QO9 A;  4X64 K;  3SUO A;  3CER A;  4M3X A;  3MN5 A;  5GAH P;  3VQD A;  5M1O A;  1NKE A;  5SZT A;  1T7P A;  2F96 A;  4DSE A;  1BCM A;  4MFB A;  4BC5 A;  3SCX A;  3JSM A;  4NCA A;  4IFV A;  4L8R B;  4NXM K;  5BN9 A;  3E1Y A;  4QS7 A;  4CJK A;  1NK7 A;  3J80 O;  3WEE A;  3M8S A;  3TAR A;  2NRH A;  4Z4F A;  1V4T A;  4O0J A;  3DLB A;  2KZM A;  2VWB A;  1NGE A;  3AVF A;  4BAC A;  4FZY A;  2UXC K;  4Z94 A;  4CEE A;  2YNH A;  4PWD A;  3O9R A;  1VQ8 N;  4IBN A;  4BGA A;  3DRP A;  3LDS A;  5C15 A;  4RW4 A;  2YV0 X;  4BR5 A;  5HRS A;  4CZE A;  1RGI A;  2HNY A;  3FLC O;  5BN8 A;  4J2E A;  1YIJ N;  2YNG A;  4Y1C A;  3P38 A;  4CEA A;  2HST A;  3DYA A;  2G8F A;  3THY A;  2P1J A;  4KI4 A;  1DTQ A;  4UQG A;  3OBW A;  4DTU A;  3O4W A;  3VET A;  3CFP A;  4JI0 K;  3L4Q A;  2P9L B;  3N4P A;  3PV8 A;  3HOS A;  3HST B;  3LM2 A;  3F73 A;  2O8D B;  4E1N A;  2FSN A;  3ULE A;  4DQQ A;  3EE8 A;  3TAG A;  1BHL A;  4BRP A;  1XC9 A;  3VQ7 A;  3J7Z O;  2X78 A;  5AQR A;  4DR5 K;  3T7Z A;  4F8R A;  4H8K A;  4FYD A;  5LMU K;  4DQI A;  3TAQ A;  2F7T A;  3ATV A;  1C6V A;  1BO5 O;  2W42 A;  3CYM A;  4FZZ A;  3HM9 A;  4DFP A;  2RPI A;  2RHK A;  3E9L A;  4PL8 A;  4NB4 A;  3O08 A;  1BU6 O;  1U2V A;  3WXK A;  3SPZ A;  4F9O A;  1C1B A;  3NCI A;  4DTN A;  1T44 A;  3MXJ A;  1LW0 A;  3DXM A;  5AQQ A;  3QML A;  3SV3 A;  3BY5 A;  4FZX C;  3ATU A;  3L4I A;  4DV1 K;  4CZL A;  4FLX A;  5FRO A;  3RMC A;  4CJE A;  5GAG P;  3CPW M;  3BZC A;  2P9K A;  4JK8 A;  1BCO A;  4KH4 A;  3SNN A;  1RBU A;  1TYQ A;  2HW3 A;  3R3L A;  3SMP A;  4GV9 A;  2E2O A;  2P9P A;  1EO1 A;  4BR9 A;  4BRF A;  1S6Q A;  4LF7 K;  1RT4 A;  1RTH A;  2QXL A;  2PY5 A;  2KFN A;  4AM6 A;  4M63 C;  4CJV A;  1TKX A;  4BWJ A;  1U04 A;  3KHY A;  4CGG A;  3AVH A;  3T3F A;  4V19 S;  3KK1 A;  3KWG A;  3AO1 A;  5C24 A;  1VRT A;  3C6H A;  3MK6 A;  5AQH A;  4LY7 A;  3LDP A;  4M41 A;  4IO8 A;  1NK6 A;  2YCH A;  3CG7 A;  4FJM A;  1T8E A;  3EKS A;  2Q36 A;  4YNQ A;  3VEW A;  5M1F A;  3A2F A;  1ZBU A;  1VQ9 N;  3TR8 A;  2F4V K;  4NCG A;  2HHT A;  2EWS A;  4WQ4 A;  3VEO A;  3RR7 A;  4HCC A;  3AVC A;  3HVT A;  3VOV A;  2I5J A;  1C0F A;  4BRN A;  3ZSW A;  4FLT A;  4BVO A;  1WSI A;  3CM5 A;  4JI2 K;  1YJW N;  4Z4I A;  5JS1 A;  5BR9 A;  2A5X A;  4CGI A;  3E9P A;  4GV3 A;  3F2K A;  4EIA A;  3GBT A;  2DFE A;  4CI6 A;  1KD1 O;  5FRM A;  3O3G A;  1ESV A;  4CES A;  3VA3 A;  5DM6 L;  4M3U A;  1BG3 A;  3GOI A;  4BRH A;  4YDU C;  4FLV A;  4FJ5 A;  3OYJ A;  3U8X A;  4BR7 A;  4EZ9 A;  4I9Q A;  3PY8 A;  3AY9 A;  1GLL O;  1JKH A;  4ICL A;  1QSS A;  1NKB A;  1VQK N;  2B5J A;  2FF6 A;  2O4G A;  4CZK A;  3I0R A;  2GX9 A;  4B9N A;  3H45 C;  4I7F A;  5GIN A;  3HO1 A;  2IDO A;  1VSE A;  3DM2 A;  1GLB G;  4K0K K;  4PY5 A;  1KVB A;  4FJI A;  4DTS A;  2IS3 A;  3OYC A;  3ENH A;  3ZET B;  3QIC A;  4EP4 A;  2DFH A;  2B6A A;  4BC3 A;  1N34 K;  4KPY A;  3KJV A;  2E88 A;  4FWM A;  1SKR A;  3AVJ A;  4O8K A;  4ELU A;  4LF6 K;  4M7X A;  2HHS A;  4CK2 A;  3L8B A;  4ILG B;  2GWJ A;  3WXL A;  2IVN A;  3AGR A;  1EKE A;  3OYF A;  1WSE A;  1NGJ A;  4Z4C A;  4Z0U A;  3OHR A;  2D4W A;  4GMJ B;  4BG9 A;  4JRQ A;  1U48 A;  1ZBF A;  4OPH A;  2G8H A;  3MX2 A;  4K41 A;  4E7I A;  3K58 A;  3AA3 A;  5BPL A;  4DV4 K;  3ISN C;  1WSH A;  3UKU A;  3IUC A;  3LDL A;  4BG8 A;  3MXI A;  1FW6 A;  3SV4 A;  1BQM A;  1C0M A;  3F9K A;  4PKH A;  3ZCM A;  1RBV A;  4DV7 K;  3EL2 A;  5FPN A;  2KTQ A;  3UE5 A;  1Q86 O;  4TSX A;  3OYA A;  4EHT A;  1IV0 A;  1GOC A;  3K2P A;  4B9M A;  1K6Y A;  1UWB A;  4AIL C;  3O3H A;  3K59 A;  2ZJQ L;  4FJH A;  2O8B A;  4BDP A;  4H03 B;  1X3N A;  1NK5 A;  1HNZ K;  4IDK A;  3C95 A;  2QKB A;  3G4S N;  3CHW A;  3O1W A;  2NRV A;  1ZC6 A;  4DTR A;  4OX9 K;  3TPQ A;  4FVM A;  4B1W B;  3KKR A;  3VEY A;  3EZ5 A;  2HVH A;  3OYD A;  3HSC A;  1JCF A;  3THY B;  4ISF A;  1TL3 A;  1YJN N;  3PX6 A;  5F2R A;  1J54 A;  4CED A;  1MU2 A;  3KVG A;  3R8E A;  1IG8 A;  3P1G A;  1KCF A;  5I3U A;  4I6M A;  2HBM A;  1HKG A;  3M8R A;  1KAZ A;  1KFD A;  4JI4 K;  4N5S A;  1C1C A;  3MEE A;  1HYS A;  4EZ6 A;  1R0A A;  3D2E B;  2QWM A;  4ZTF A;  3MN6 A;  5KPR A;  2F8T A;  4BE0 A;  5AQO A;  3MN7 A;  2Q3S A;  3MAQ A;  3WEE B;  3CC4 N;  4CK1 A;  3CI5 A;  1GLD G;  1YAG A;  2Q0R A;  3WXI A;  2KHO A;  5AQK A;  1YIT N;  1U2V B;  4LF5 K;  4FWO A;  4MLE A;  5E84 A;  2R7Y A;  3SQ1 A;  4A5A A;  1IH7 A;  3HPH A;  5C0Y A;  2JWL A;  3O5B A;  3ZT2 A;  3HTV A;  3NGY A;  5AQM A;  1JJ2 M;  1HNV A;  4ISE A;  3QB0 A;  2AJQ A;  2D5R A;  4DR6 K;  3D45 A;  5AQL A;  3THW B;  5FDL A;  4A5B A;  1YT3 A;  2WFB A;  2NRT A;  5KPT A;  1YI2 N;  1NK9 A;  4K43 A;  3IFR A;  4CGF A;  4YOW A;  1DT9 A;  4CJR A;  5CR4 A;  1XHZ A;  1VHX A;  1NMD A;  2G8I A;  2UXD K;  3HPG A;  4WQ5 C;  4DF4 A;  2QEX N;  1JLB A;  1KQS M;  3V9U A;  4I9L A;  3HBT A;  5M1Q A;  1N5Y A;  4HUG A;  1BL3 A;  2Q2R A;  1RTJ A;  4E7H A;  4K42 A;  3C0B A;  5AQS A;  1VQ6 N;  3L2Q A;  4CIF A;  1QS4 A;  3DAW A;  3DXK B;  4CW7 B;  3H6E A;  2P9S A;  4GVE A;  3VMF B;  5CHI A;  3G0Z A;  1LAV A;  1ATS A;  2YI1 A;  3ZSV A;  3NGI A;  1KXP A;  1WN7 A;  3CJ1 A;  4FM2 A;  5BPM A;  1J6Z A;  1Y64 A;  4DTX A;  3SQ4 A;  1A5V A;  1RDB A;  1T6C A;  4W5N A;  1WUA A;  3F9M A;  4B1Y B;  2GBZ A;  3D6R A;  4E3S A;  1RIL A;  3U4L A;  3OJS A;  4HHT A;  4FWL A;  4H5T A;  1BWF O;  2GUI A;  3DXK A;  3CCV N;  1JCE A;  1S1U A;  4OGE A;  4DU4 A;  2NRR A;  3NF7 A;  1OVQ A;  3O8M A;  4BY9 C;  1WAF A;  1L3T A;  1WLJ A;  4IOX A;  3PLA A;  3OYI A;  1DLO A;  4JD2 A;  2Z1G A;  2QWO A;  1RT6 A;  4CF2 A;  4BWM A;  3PO5 A;  1UAX A;  4X62 K;  3LZJ A;  3RR8 A;  3AVA A;  4ILH A;  2QWL A;  3AA2 A;  4FWN A;  4YOX A;  1QVF M;  2O8C A;  4H0T B;  2QK9 A;  3HK2 A;  1IO2 A;  3DMJ A;  4N47 A;  3Q7C A;  4AH9 A;  4DU3 A;  2CH6 A;  2OPR A;  1BDG A;  3CCU N;  3OBY A;  3VEV A;  1XHX A;  3RWU A;  2D1K A;  3R1X A;  4JRP A;  5AZI B;  4RG8 A;  4JV5 K;  1NGD A;  1ASW A;  4CZF A;  4AHS A;  4WFA L;  1CZ9 A;  4F3T A;  1T05 A;  2YHW A;  1KVA A;  4FK0 A;  1IBM K;  3V9S A;  4RW7 A;  3VGM A;  2VGN A;  3MN9 A;  3CJC A;  2HHU A;  3WNG A;  4BRK A;  2YJE A;  4MDA A;  3LWM A;  2W6L A;  3K57 A;  3K5L A;  4BR2 A;  3D2E A;  3FFK B;  4DFJ A;  3HZ6 A;  2E8A A;  1K9M O;  1T6D A;  1TKD A;  3ZEU B;  4MLH A;  1REV A;  4CJP A;  4AQY K;  1D4X A;  4CZG A;  1LWF A;  1HPM A;  1HJR A;  1Z05 A;  3GL1 A;  1GOB A;  4KV8 A;  4YOR A;  1TUY A;  2FC0 A;  3LPU A;  2KFZ A;  2CGJ A;  3ENB A;  1VAZ A;  4IJN A;  4DSF A;  3RMB A;  4MO4 A;  3KK2 A;  1Z25 A;  2E4L A;  1JXB A;  2X6S A;  3I56 N;  4FLY A;  3SUQ A;  3OYK A;  1WAJ A;  1NK0 A;  3VES A;  2PFU A;  4L3Q A;  1HUX A;  1NGF A;  1K8K B;  3OJU A;  3G25 A;  3BF1 A;  3H46 O;  3T1A A;  3NFA A;  2A41 A;  2P9L A;  4KO0 A;  4CF9 A;  3CM6 A;  2VYP A;  4O55 A;  4AHT A;  2NZT A;  4M45 A;  3NF9 A;  5IT9 O;  3CF5 L;  4CFD A;  4PHT X;  3SZ2 A;  5CE3 A;  2P5G A;  4IO9 L;  3F5T A;  1A5W A;  2KQ2 A;  1EX4 A;  4LD0 A;  3S3O A;  1IKX A;  4FXD A;  2HHQ A;  4FJL A;  3ZT3 A;  4CIG A;  3ZSX A;  1SKW A;  3FFI A;  1RCH A;  4YOU A;  3FZM A;  4JI3 K;  2Y1J A;  2GV9 A;  1VSJ A;  1DKG D;  1F21 A;  1SL0 A;  1BUP A;  4DFM A;  1U45 A;  3CJB A;  3AO2 A;  1BIZ A;  3OTO K;  4BE2 A;  3AAP A;  3HYF A;  4H5W A;  3PX4 A;  2P9I B;  3SI6 A;  4CJ4 A;  4KFB A;  4CJ3 A;  4CFA A;  5CY4 A;  4JLH A;  1RDU A;  4Y1D A;  4H0X B;  5BR8 K;  4DU1 A;  4H0V B;  4IXC A;  1A5X A;  3SBG A;  4CIE A;  4M3Y A;  3BEX A;  3PUF A;  4JK7 A;  2XY8 A;  4LFA K;  5TKY A;  1NGA A;  3L2V A;  1J53 A;  1S1W A;  2D0O A;  4DLG A;  4WQ4 C;  2LSN A;  1RTD A;  2GEM A;  1GLE G;  2A40 A;  5FPE A;  4KH5 A;  1TV6 A;  1UA0 A;  3IG1 A;  3DLG A;  3VTI A;  1VSL A;  1NLV A;  4CEB A;  4F4K A;  2FSK A;  3RRG A;  4C8N A;  1YTU A;  3IDH A;  4H5R A;  2V51 B;  4IEE A;  2Q31 A;  3CXC M;  5J2N A;  2P51 A;  4E7J A;  3G6E N;  1NJW A;  3O1B A;  2O8C B;  1E3M A;  5AZI A;  2FBY A;  3J8A A;  3VQ5 A;  3L2U A;  4WF9 L;  4DTJ A;  1QQN A;  1HYZ A;  1MA9 B;  4N41 A;  3NH0 A;  3FZF A;  1N8R O;  2AA4 A;  2YHB A;  4FOE A;  4B1U B;  2UYT A;  4BE1 A;  5M1K A;  4IDH A;  3K0S A;  1QQM A;  2G8V A;  4J2D A;  3KLH A;  1ASU A;  4MO5 A;  3FGU A;  5GAE P;  3D2F A;  4ID5 A;  1BI4 B;  1HYV A;  2VG7 A;  3H1Q A;  5EY4 A;  4CHY A;  2YX6 A;  1S1T A;  3EKU A;  4CK3 A;  3VN5 A;  3RSE A;  3THX A;  4DTM A;  1XNR K;  4IKF A;  3PIP L;  1V4S A;  4CZJ A;  4DR2 K;  2ZJR L;  4EAH D;  5BRF A;  1X3M A;  4H5N A;  2ITM A;  2VCP A;  4PL7 A;  2A1R A;  5C42 A;  1X1P A;  2HBK A;  4JKG A;  3HP9 A;  2ZF5 O;  1EQY A;  4Z4E A;  4XH5 A;  4JKG B;  3H3N O;  5KTQ A;  3CQ8 A;  3VQB A;  3HP6 A;  4PQU A;  2B4J A;  3TWH A;  3O4N A;  1GLC G;  1WB9 A;  4FK4 A;  1HQU A;  2JWK A;  4YOT A;  4BRL A;  3AO4 A;  1D8Y A;  3TAF A;  2OPQ A;  2FSJ A;  3NH2 A;  3U9Z A;  3VGK A;  3V1Q A;  2H3G X;  5C10 A;  3SJH A;  1YTA A;  3MMV A;  4C8K A;  3RMA A;  2P9K B;  3DRS A;  4B9S A;  1KLM A;  1RBR A;  1OH5 A;  3ZEU A;  3TU5 A;  4BRM A;  2ZJP L;  1L3U A;  1LWE A;  3KLG A;  2Q0U A;  2OCE A;  4CHP A; 
#chains in the Genus database with same CATH homology
 4F9O A;  2HF3 A;  2P9N A;  3FZK A;  4H0O A;  4U7B A;  1Q81 O;  4BRI A;  3R8E A;  3KVG A;  1IG8 A;  1Q18 A;  3H3O B;  4CZH A;  1R59 O;  4I6M A;  2HBM A;  1HKG A;  1KAZ A;  1K73 O;  5MLC Q;  1VQ4 N;  4UY8 O;  1S3X A;  5LY3 A;  4BRC A;  3C6A A;  1RFQ A;  4DKW A;  1SS6 A;  3D2E B;  3ZET A;  2QWM A;  2YHX A;  2QWN A;  3M1F A;  1MWM A;  3MN6 A;  5KPR A;  3TSQ A;  3WQU A;  3CC7 N;  1KAY A;  2I7N A;  5JVH L;  3CJ7 A;  3H1V X;  5AQO A;  3EO3 A;  3K9J A;  3MN7 A;  1ATR A;  3WEE B;  3CC4 N;  4JKE A;  3SBT A;  4PKG A;  4WYB A;  3CCS N;  5AQZ A;  4RCH A;  4JK9 A;  3OA9 A;  3CI5 A;  1GLD G;  1MWK A;  1YAG A;  2Q0R A;  3WXI A;  3IKM A;  1OVY A;  3CMA N;  4CD3 A;  4BC4 A;  2KHO A;  3I8B A;  4FVU A;  5AQK A;  1YIT N;  1U2V B;  3M3Z A;  3ULE B;  4FWO A;  4MLE A;  5E84 A;  2ZWH A;  4MDB A;  1VQN N;  4ISG A;  4A5A A;  4DCH A;  1NGG A;  1SAZ A;  2KLA A;  5AQT A;  5M1N A;  1YHQ N;  2JWL A;  5C0Y A;  3O5B A;  1E4F T;  3TTC A;  3HTV A;  5AQM A;  4BVP A;  5I9E B;  5DM7 L;  1JJ2 M;  1YF5 L;  1BOT O;  2ASM A;  4ISE A;  3QB0 A;  2OTL N;  3M5R A;  3UKU B;  5AQL A;  4C1N I;  2NRZ A;  5BPN A;  3VEX A;  4JKA A;  4AM7 A;  2P9U B;  3BF3 A;  1XQS C;  3LDN A;  5LJW A;  4B1V A;  3CC2 N;  4A5B A;  4BRD A;  2V7Z A;  3A8Y A;  4DB3 A;  2P9S B;  2WFB A;  2A42 A;  2NRT A;  3QBX A;  3C7N B;  4HWI A;  3VF4 A;  5KPT A;  1YI2 N;  1YXQ A;  4K43 A;  5BRH A;  3S41 A;  5C2F A;  3HOT A;  3CCM N;  1VQ7 N;  1SZ2 A;  4FWK A;  3IFR A;  3ZX2 A;  5ADX A;  2A6A A;  3CPE A;  2NLX A;  4YOW A;  1HX1 A;  2E1Y A;  1DT9 A;  3MWT A;  3KWI A;  3G71 N;  5CR4 A;  1VQO N;  1NMD A;  3EE9 A;  4WQ5 C;  4BQL A;  2QEX N;  5AQV A;  1KQS M;  3HBT A;  1BA1 A;  1DGK N;  2ZGZ A;  5M1Q A;  3D2F B;  1LCU A;  4BQZ A;  4FWP A;  3A0I X;  3L0Q A;  2Q2R A;  2HF4 A;  4K25 A;  4C1N K;  1C0G A;  2CGL A;  4JEP A;  4K42 A;  3C0B A;  3CCL N;  3A5M C;  2PAV A;  5B8H A;  1HLU A;  5AQS A;  3SMS A;  3GE1 A;  1VQ6 N;  3ID6 A;  3L6Q A;  2E2Q A;  3A5N C;  2YHY A;  3DAW A;  3DXK B;  4A57 A;  1TUU A;  3W0L A;  3H6E A;  2P9S A;  4GVE A;  3VMF B;  4C23 A;  1QQO A;  5ADX H;  1RDW X;  1ATS A;  1NGH A;  1HKB A;  2YI1 A;  3O9Q A;  4WQ5 A;  1KXP A;  4LC9 B;  2J4R A;  3ZX3 A;  1NM1 A;  3CJ1 A;  4AF1 A;  5BPM A;  4YOV A;  2WUS A;  2W40 A;  2F9T A;  1J6Z A;  1Y64 A;  5AQP A;  4FOI A;  1T6C A;  2E20 A;  1WUA A;  3F9M A;  3VF6 A;  4B1Y B;  4R79 A;  2QWP A;  3I55 N;  3D6R A;  3LM9 A;  4ILJ A;  3U4L A;  3CER A;  1VQL N;  4FWL A;  4H5T A;  1BWF O;  3MN5 A;  4OPA A;  3FE1 A;  4WCE L;  3LDQ A;  5KQ8 A;  5GAH P;  3DXK A;  5GIP A;  3CCV N;  3AGK A;  5M1O A;  4BC2 A;  1JCE A;  2NRR A;  4BC5 A;  3CCQ N;  3O8M A;  4XH1 A;  4BY9 C;  5BN9 A;  3E1Y A;  4IOX A;  3PLA A;  4QS7 A;  1QHA A;  4A2B A;  3JXU A;  1M1K O;  3WEE A;  4JD2 A;  2GTD A;  2NRH A;  1V4T A;  2QWO A;  3SAF A;  5JLF A;  1QZ6 A;  2VWB A;  1NGE A;  4Z94 A;  1ATN A;  4IWV A;  1GLF O;  4FL9 A;  1H1V A;  4OO1 J;  3MCP A;  4ILH A;  2QWL A;  3AAR A;  3O9R A;  1HKC A;  4FWN A;  4YOX A;  1VQ8 N;  4BGA A;  5AR0 A;  1QVF M;  4FSV A;  4H0T B;  4QS8 A;  5AQU A;  5C15 A;  3R6M A;  4BRE A;  4BR5 A;  4JKD A;  3Q7C A;  3SK3 A;  4CZE A;  1RGI A;  3FLC O;  3MDQ A;  4CD1 A;  4NLC A;  2CH6 A;  5BN8 A;  1BDG A;  3CCU N;  2GWK A;  4O8U A;  3OBY A;  1QVG M;  1YIJ N;  3VEV A;  4GV6 A;  3DXM B;  2D1K A;  3CIP A;  3R1X A;  1SQK A;  5EXW A;  3P38 A;  4HTL A;  5AZI B;  2HST A;  4A59 A;  1MDU B;  1NGD A;  2E2P A;  4CZF A;  5KPZ A;  3E66 A;  4WFA L;  3N4Q A;  4BR4 A;  3CME N;  3OBW A;  2P9I A;  2YHW A;  5JMV A;  3O4W A;  3VET A;  4JN4 A;  1ZXO A;  3L4Q A;  3DLL L;  2P9L B;  3HRG A;  3N4P A;  3U9D A;  3JS6 A;  3HOS A;  3VGM A;  2VGN A;  1NGB A;  2F9W A;  3LM2 A;  3CJC A;  3MN9 A;  4B1Z A;  4BRK A;  4IFE A;  4B9Q A;  2YJE A;  2FSN A;  4MDA A;  3UKR A;  3EE8 A;  3ULE A;  2FF3 B;  3CET A;  3VEN A;  3P39 A;  4BRP A;  1M90 O;  2GEL A;  4G9Z A;  4BR2 A;  1ZBS A;  3D2E A;  3FFK B;  3HZ6 A;  2E8A A;  5CHI A;  3J7Z O;  1K9M O;  1T6D A;  3K9K A;  1QZ5 A;  5AQR A;  5TKW A;  2ASO A;  3ZEU B;  3T7Z A;  4BR0 A;  3PIO L;  3OW2 M;  1W2B M;  1S22 A;  2QWR A;  1KAX A;  4MLH A;  1XC3 A;  3C65 A;  3LDO A;  4BRA A;  1D4X A;  3RVC A;  4CZG A;  3GDQ A;  1NBW A;  1HPM A;  1Z05 A;  3CCE N;  2F7T A;  3ATV A;  3GL1 A;  3O6W A;  3RSE B;  1BO5 O;  5AQW A;  4Y0W A;  4CZI A;  2V7Y A;  4YOR A;  5BRD A;  3MWP A;  4NO7 A;  2RHK A;  1TUY A;  3B8A X;  3E9L A;  4PL8 A;  2CGJ A;  3ENB A;  1VAZ A;  1BU6 O;  1U2V A;  3O08 A;  3O9U A;  4NB4 A;  5AQY A;  3WXK A;  2V52 B;  4IJN A;  3TTF A;  3TTD A;  3O9S A;  1T44 A;  4MO4 A;  5C2D A;  2D0P A;  3DXM A;  2FLO A;  5AQQ A;  3QML A;  4IJA A;  3I56 N;  3E9O A;  3O9T A;  4IEI A;  5AFU A;  1Q82 O;  1E4G T;  3ATU A;  3L4I A;  4CZL A;  3VES A;  5AQJ A;  5GAG P;  4FWQ A;  4BRO A;  2PFU A;  3CPW M;  4L3Q A;  1P90 A;  1HUX A;  1NGF A;  2P9K A;  1K8K B;  4JK8 A;  4JNE A;  4KH4 A;  3G25 A;  1VQP N;  3BF1 A;  3H46 O;  2A41 A;  2ASP A;  1TYQ A;  3KK7 A;  2P9L A;  3R3L A;  4GY2 B;  5HOO A;  3SMP A;  4GV9 A;  2E2O A;  2P9P A;  2VYP A;  3NMU A;  1EO1 A;  3TSP A;  2QM1 A;  4BR9 A;  4BRF A;  2NZT A;  1KC8 O;  4WFB L;  2QXL A;  3CF5 L;  5AQN A;  2E1Z A;  4H5V A;  3QDK A;  3UKR B;  4PHT X;  5AQG A;  4AM6 A;  5CE3 A;  5M1P A;  4M63 C;  4IO9 L;  3CCJ N;  3F5T A;  2WC9 A;  3QBW A;  3KHY A;  2W41 A;  2ZGY A;  5EOY A;  3LL3 A;  1G99 A;  3KWG A;  3VGL A;  2P9N B;  3CCR N;  3FZH A;  4YOU A;  3FZM A;  3SAH A;  4JKC A;  3C6H A;  3MK6 A;  3EZW A;  3QFU A;  5JIC A;  5AFU H;  1HJO A;  2P9P B;  5ELZ A;  2HMP A;  5AQH A;  1DKG D;  3LDP A;  4IO8 A;  4NLB A;  1CZA N;  2IIR A;  2PBD A;  1YJ9 N;  2QI2 A;  1BUP A;  2YCH A;  2AP1 A;  4BRQ A;  3CJB A;  3NVM A;  3EKS A;  2Q36 A;  5EX5 A;  1Z6R A;  3KZB A;  3VEW A;  5M1F A;  3AAP A;  4RTF D;  2QWQ A;  1VQ9 N;  2Q1N A;  4H5W A;  5E26 A;  2P9I B;  4KH6 A;  2BTF A;  3DJC A;  2EWS A;  4WQ4 A;  3VEO A;  4CJ7 A;  4EHU A;  3VTH A;  3VOV A;  2BUP A;  3AAQ A;  1RDU A;  4QS9 A;  1C0F A;  3D7E O;  4BRN A;  4CBX A;  4EFH A;  4H0X B;  4BVO A;  1U6Z A;  5AQI A;  1YJW N;  2HOE A;  4IZ9 A;  1S72 N;  5BR9 A;  2A5X A;  1XUP O;  5F1X A;  3E9P A;  4H0V B;  4IXC A;  4GV3 A;  3SBG A;  1YVN A;  5AZJ B;  4BGB A;  3BEX A;  3F2K A;  5AQX A;  4JK7 A;  2OAN A;  4EIA A;  4JKF A;  3GBT A;  5TKY A;  1NGA A;  1GLJ O;  4CI6 A;  1KD1 O;  4A2A A;  4GNI A;  5AZJ A;  1ESV A;  5JVG L;  2D0O A;  5DM6 L;  1BG3 A;  5GAD P;  4JKH A;  3GOI A;  4JKB A;  3FR0 A;  4WQ4 C;  1W97 L;  4A62 A;  2NRW A;  4BRH A;  3T69 A;  2NNW A;  2GEM A;  4YDU C;  1GLE G;  2A40 A;  5H1S Q;  4I6M B;  3U8X A;  2FXU A;  5FPE A;  4KH5 A;  4BR7 A;  3UB5 A;  2E2N A;  4CZM A;  3VTI A;  1NLV A;  3MX5 A;  4XH4 A;  1K8A O;  3AY9 A;  1GLL O;  4FO0 A;  1VQK N;  3CJ9 A;  2FSK A;  4JAX A;  3WXJ A;  2WBN A;  3WQT A;  2FF6 A;  4CZK A;  1BA0 A;  3VPZ A;  3IDH A;  4H5R A;  4CBU A;  2GX9 A;  2V51 B;  4IEE A;  3H45 C;  4JD2 B;  2Q31 A;  3CXC M;  4E1J A;  1NGC A;  5GIN A;  1YUW A;  2P9U A;  1O13 A;  4WFN L;  1VQM N;  4BRG A;  3G6E N;  3BUZ B;  3EN9 A;  1GLB G;  3O1B A;  5AZI A;  2I7P A;  1VQ5 N;  3J8A A;  4PKI A;  2CH5 A;  3HI0 A;  1OKJ A;  4FWS A;  3O80 A;  1NJI O;  2VGM A;  3ENO A;  4H0P A;  4WF9 L;  5KQD A;  2Q97 A;  1LOT B;  1QQN A;  3ENH A;  3ZET B;  3QIC A;  5C12 A;  3CQX A;  3VEZ A;  1NWK A;  2HBL A;  1MA9 B;  3NVK A;  5FPM A;  3DWL A;  4J8F A;  2A3Z A;  1JCG A;  3FZF A;  4U67 L;  2YJF A;  4BC3 A;  1N8R O;  2AA4 A;  4FOE A;  4B1U B;  2UYT A;  2E88 A;  4FWM A;  3P31 A;  5M1K A;  4O8K A;  3Q7B A;  4KBO A;  4IDH A;  4M7X A;  4XEI A;  4CBW A;  3ZX0 A;  1QQM A;  4ILG B;  2GWJ A;  3FZL A;  3R9P A;  2IVN A;  3AGR A;  3SLC A;  4MO5 A;  3WXL A;  3C7N A;  3ZYY X;  1NGJ A;  1X9J A;  3FGU A;  5GAE P;  3OHR A;  5LJV A;  2D4W A;  3D2F A;  2RE2 A;  3W3D A;  3WT0 A;  4BG9 A;  2KKZ A;  5BRE A;  4OPH A;  4IOC L;  3MX2 A;  4K41 A;  2BH1 A;  2HBJ A;  3H1Q A;  5EY4 A;  2YX6 A;  3EKU A;  3ID8 A;  1TYQ B;  5BPL A;  3RSE A;  3A5L C;  4M7Y A;  5AQF A;  3PIP L;  3UKU A;  1V4S A;  4CZJ A;  3IUC A;  3LDL A;  4H0Y B;  4BG8 A;  2ZJR L;  4EAH D;  5BRF A;  1P8Z A;  1X3M A;  1GLA G;  4H5N A;  2ITM A;  4IOA L;  1Q7Y O;  2NRX A;  2VCP A;  4PL7 A;  4FPB A;  3GG4 A;  3WUH A;  4PKH A;  3EL2 A;  5FPN A;  2HBK A;  3UE5 A;  1Q86 O;  2QW9 A;  5GIO A;  4JKG A;  2ZF5 O;  4EHT A;  1EQY A;  1K8K A;  1NGI A;  3CJA A;  4DQ8 A;  4XH5 A;  4JKG B;  2OTJ N;  3VER A;  3H3N O;  2IVP A;  1T3V A;  3IMX A;  5JLH A;  2ZJQ L;  4H03 B;  1X3N A;  5F0X A;  3CD6 N;  1WOQ A;  1GLC G;  3QFP A;  2JWK A;  2QTD A;  4DHY A;  4YOT A;  3G4S N;  4BRL A;  3WXM B;  2QA4 N;  3CHW A;  3O1W A;  4O5F A;  5EVZ A;  4A61 A;  2NRV A;  1ZC6 A;  3SAG A;  2FSJ A;  3U9Z A;  3VGK A;  2GUP A;  2H3G X;  5C10 A;  3TSU A;  3A5O C;  4B1X B;  3SJH A;  5FPD A;  3BP8 A;  3MMV A;  2IVO A;  3I33 A;  3TPQ A;  4B1W B;  4YOY A;  3MCA B;  2P9K B;  3M6G A;  3VEY A;  2DPN A;  3P4I A;  5HL7 L;  3VF2 A;  1IJJ A;  3CQY A;  1ILY A;  4FWR A;  1DEJ A;  3HSC A;  4FPA A;  3ZEU A;  1JCF A;  3TU5 A;  4JHD A;  4BRM A;  2ZJP L;  4RWT A;  4ISF A;  4YDU A;  1YJN N;  2Q0U A;  3HM8 A;  5F2R A;  2CGK A;  4JHD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...