4BC4A

Crystal structure of human d-xylulokinase in complex with d-xylulose
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
525
structure length
525
Chain Sequence
RRCCLGWDFSTQQVKVVAVDAELNVFYEESVHFDRDLPEFGTQGGVHVHKDGLTVTSPVLMWVQALDIILEKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLSPDLRLHQQLQDCFSISDCPVWMDSSTTAQCRQLEAAVGGAQALSCLTGSRAYERFTGNQIAKIYQQNPEAYSHTERISLVSSFAASLFLGSYSPIDYSDGSGMNLLQIQDKVWSQACLGACAPHLEEKLSPPVPSCSVVGAISSYYVQRYGFPPGCKVVAFTGDNPASLAGMRLEEGDIAVSLGTSDTLFLWLQEPMPALEGHIFCNPVDSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSKALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDVEVRALIEGQFMAKRIHAEGLGYRVMSKTKILATGGASHNREILQVLADVFDAPVYVIDTANSACVGSAYRAFHGLAGGTDVPFSEVVKLAPNPRLAATPSPGASQVYEALLPQYAKLEQRILSQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Function of Human Xylulokinase, an Enzyme with Important Roles in Carbohydrate Metabolism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords XYLULOSE KINASE
total genus 181
structure length 525
sequence length 525
chains with identical sequence B, C
ec nomenclature ec 2.7.1.17: Xylulokinase.
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00370 FGGY_N FGGY family of carbohydrate kinases, N-terminal domain
A PF02782 FGGY_C FGGY family of carbohydrate kinases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4bc4A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4bc4A01
4EAHD 3FFKB 1GLFO 3SMPA 3GE1A 3MK6A 2P9LB 1J6ZA 4BR9A 4BC3A 5AZJA 4K43A 3M1FA 1X3MA 1Y64A 2QW9A 4H0PA 3SJHA 3VEVA 2QWRA 2V52B 3QFUA 4FSVA 4H0TB 3VEXA 3DJCA 3VENA 3L4IA 4BGBA 3WUHA 2FSJA 4Z94A 1NBWA 4FO0A 2A5XA 3HZ6A 3ZX3A 4RTFD 3ZEUB 4WYBA 2V7ZA 3HBTA 4FWPA 4HTLA 5ELZA 1NGBA 3P4IA 2YHXA 1DKGD 4EHTA 4WQ4A 1CZAN 2PAVA 2P9SA 5AQXA 1RGIA 2FF3B 2VYPA 2V51B 3EN9A 4B1WB 2ZWHA 1NM1A 5I9EB 3LDLA 4JHDA 4CBWA 3FGUA 4DCHA 5EVZA 3VEZA 5AQPA 1U6ZA 2P9PB 4M7XA 4M63C 1S3XA 4FWOA 3BEXA 2DPNA 5AQUA 4EIAA 3C7NB 5AQQA 2P9IA 4BRNA 1R59O 3LDNA 3H3OB 4A62A 3IDHA 4JD2B 3VPZA 3A8YA 2FSNA 1KAYA 4NO7A 2ZGZA 2GELA 3DXKB 1GLAG 1T6CA 3QDKA 3ZX0A 3UB5A 2D0OA 3A0IX 3LM2A 5BREA 4CJ7A 4CD1A 4CZHA 4O5FA 1YXQA 1XC3A 2FLOA 3CIPA 1NGHA 3U9DA 4EHUA 5BRDA 3U9ZA 1MWKA 3LL3A 2UYTA 4QS9A 3S41A 3HTVA 3CJ9A 4PKHA 2ITMA 1JCFA 2V7YA 3KHYA 1C0GA 3O6WA 5BN9A 2CGKA 3WQUA 3A5NC 3WEEA 1BG3A 1D4XA 3QICA 5LJWA 4HWIA 5LY3A 1ATSA 1NLVA 1HKGA 3H6EA 2IVNA 1SZ2A 2P9SB 3CQXA 1ATNA 2P9UB 1QQMA 3H45C 4H5TA 1RDWX 4LC9B 5EY4A 3CETA 3ATUA 1NGEA 4M7YA 1BU6O 3G25A 5FPEA 2E2QA 5FPNA 2HF4A 1HUXA 1GLJO 3DXKA 3HSCA 4J8FA 4H0VB 4FOIA 3R9PA 4BRDA 4EFHA 3VEYA 3DWLA 3AAQA 3EZWA 4BR2A 3WQTA 2NZTA 3JXUA 3C0BA 1BOTO 4K41A 3D7EO 2HMPA 4BRIA 5AQRA 2P9NA 2IVOA 2NLXA 3CJBA 4CD3A 5KPRA 3MN7A 1C0FA 3WXKA 3VGMA 3UKRB 4BRAA 1ATRA 3BP8A 3UE5A 3R6MA 1Z05A 5JLHA 2ASPA 2NRHA 4B1VA 4FWSA 2EWSA 4CBXA 1BUPA 3VGKA 4BR7A 4QS8A 3QMLA 5AQYA 2YHWA 1TYQB 2Q0UA 3VF6A 3FZLA 1QQNA 1K8KA 2ZF5O 4BRKA 3ATVA 2VWBA 1TYQA 3GG4A 5AQTA 3ZX2A 1GLLO 2F9WA 1WUAA 4ISGA 3A5LC 3BF1A 3O8MA 3AY9A 2QWLA 3SLCA 1YUWA 3WXIA 3EKUA 2A6AA 1XQSC 1IJJA 5KQDA 4KBOA 3VESA 4BRMA 2E2NA 1U2VA 1SQKA 1ESVA 2E20A 3MCPA 2QWNA 4CZJA 5AQZA 3BUZB 1BWFO 3RSEA 3D2FB 3RSEB 3OHRA 3H46O 1JCGA 4H03B 4BRHA 2CH6A 3H1QA 2P9KA 1QQOA 1DEJA 1H1VA 2QWOA 4A2AA 5TKYA 1P8ZA 2P9IB 3FE1A 2GWKA 2E88A 2ASOA 4ISFA 1TUUA 4BRFA 4CZEA 3HI0A 3D2EA 2AP1A 2YI1A 3DXMA 3VERA 1Q18A 4FPBA 5E26A 4I6MB 4IJAA 1TUYA 3WXLA 4C23A 4MO4A 3LDOA 4B1UB 5LJVA 3ZEUA 2I7NA 3L0QA 3H1VX 4A61A 4CI6A 2P9LA 2Q2RA 4FWLA 5AZJB 4A2BA 4XH5A 1KAXA 4IJNA 4FPAA 2YJFA 5F2RA 3I33A 3QBWA 3UKUA 4H0YB 1V4TA 2W40A 2QWQA 3O1WA 5AQOA 5EX5A 3WEEB 5KQ8A 3CERA 4CZIA 3O1BA 3A5MC 5JMVA 1QHAA 1YVNA 1ZC6A 1GLBG 2WUSA 4H5NA 4JN4A 3VOVA 2P9PA 3HM8A 4NB4A 3IUCA 3U8XA 1S22A 3J8AA 3FZHA 1G99A 2I7PA 4FWNA 3R8EA 4WQ5A 3O08A 3MN5A 4BG8A 3B8AX 1NGAA 5ADXH 5B8HA 4MO5A 2CGJA 5JLFA 5BPNA 3CJCA 1BDGA 3AARA 1HKCA 2P9KB 4DB3A 1NMDA 2E1ZA 1HKBA 2CH5A 5AZIB 1YAGA 3CJ7A 3QB0A 4Y0WA 4FWRA 4E1JA 4IO8A 4CBUA 1BA0A 4H0XB 4CZKA 4MLEA 1OKJA 3M6GA 3VGLA 1GLDG 3VETA 2E8AA 2VCPA 3GDQA 3GBTA 4GY2B 2J4RA 3MN9A 4BREA 3DAWA 5AQVA 5EXWA 2GUPA 4DHYA 4JNEA 2D1KA 2D0PA 2OANA 1NGDA 1U2VB 1SAZA 1ZBSA 2CGLA 2FF6A 5EOYA 3TU5A 5BRFA 1GLEG 3UKRA 5AQMA 5KPTA 2A40A 5AQJA 1BO5O 3ZETB 4H5RA 3VEWA 3VF4A 1BA1A 4IWVA 3IMXA 4L3QA 5FPMA 4JHDB 3CHWA 5AQFA 2HF3A 3C7NA 2FXUA 3EKSA 1ZXOA 2D4WA 3SK3A 4BVOA 5BR9A 4AM6A 2AA4A 5FPDA 4B1ZA 4MLHA 4K42A 5AFUH 2KHOA 2E2PA 2Q1NA 2F9TA 3VEOA 1X9JA 2Q97A 5AQGA 3KZBA 3W3DA 3O80A 3KVGA 4BGAA 3IFRA 4BVPA 2A42A 1MDUB 2YCHA 3ENHA 2YHYA 3TPQA 2GWJA 1JCEA 1XUPO 3I8BA 4XEIA 3FZMA 4CZFA 4DQ8A 2FSKA 4FWQA 1MWMA 4BC5A 4PL7A 5BRHA 4BRLA 4FL9A 3CJAA 4WQ5C 1T44A 1LCUA 4BG9A 2A41A 2Q31A 3A5OC 4H5VA 3FZFA 3QFPA 5BPMA 4IXCA 3DXMB 2P9UA 3U4LA 1DGKN 4BR0A 2GEMA 4YDUA 4H5WA 5AQSA 3GL1A 4BC4A 2Q0RA 3O5BA 5CE3A 1T6DA 4F9OA 1MA9B 1IG8A 1GLCG 5BN8A 3H3NO 3MMVA 5ADXA 3FLCO 3UKUB 4FWKA 4RCHA 3WXJA 3ZETA 4BRQA 2GTDA 4YDUC 1V4SA 5AQHA 5AFUA 3GOIA 3LM9A 1KXPA 4PKGA 3F9MA 4BROA 2W41A 5KPZA 2E2OA 4AM7A 4B1YB 2HOEA 1HJOA 1NGFA 4CZGA 2E1YA 4B1XB 4BQZA 1HLUA 1RFQA 1WOQA 3CQYA 3LDQA 3MDQA 4I6MA 4PL8A 3JS6A 3ULEB 1QZ6A 3AAPA 3QBXA 4BRGA 2QWMA 3FR0A 3W0LA 4CZLA 2QXLA 1HX1A 4BRCA 2ZGYA 4WQ4C 2BTFA 5AQKA 4GNIA 1E4FT 3CI5A 4BC2A 2Q36A 3D2FA 5AQNA 5AZIA 3VF2A 5BPLA 4O8KA 4K25A 1X3NA 4B9QA 5AQLA 4QS7A 3L6QA 1NGJA 3EO3A 3WT0A 5AQWA 4XH1A 1EQYA 1NGGA 2ASMA 4CZMA 3FZKA 5E84A 2QM1A 4RWTA 2QWPA 3SMSA 3EL2A 1NWKA 2P9NB 4BR5A 3D2EB 4H0OA 5F0XA 2A3ZA 4FOEA 5F1XA 3BF3A 4JD2A 2IIRA 4IZ9A 3O4WA 5AQIA 1E4GT 2BUPA 2IVPA 1KAZA 1NGIA 4ISEA 4BR4A 2PBDA 2YJEA 3LDPA 3ULEA 1QZ5A 1Z6RA 4JAXA 2H3GX 3MN6A 4XH4A 4BRPA 1LOTB 5JICA 4PKIA 3M3ZA 5AR0A 3CJ1A 1K8KB 4FWMA 4BQLA 3ENOA 3ID8A 1HPMA 1NGCA
chains in the Genus database with same CATH superfamily
3LDSA 1S9EA 3TI0A 3MK6A 1XC9A 1J6ZA 4ILGB 3BZCA 1X3MA 2QW9A 3SJHA 4NLBA 4FJIA 2NNWA 1K8AO 1IKVA 4FLXA 3NH1A 3MEGA 3HPGA 4KRFA 5GIOA 2BH1A 3SBGA 5HBMA 1HNXK 4DR7K 1TK8A 4Z94A 3J7YP 3ENBA 4HUGA 4MQ3A 4FO0A 4U67L 1WB9A 3HZ6A 4RTFD 4CJ3A 2F7TA 3ZEUB 4WYBA 4LFBK 1UA1A 2Q3SA 1S9GA 3AVNA 3HBTA 4HTLA 2HBJA 1KVCA 3ITHA 4DMNA 1NGBA 4KH6A 4A5AA 3OYMA 4G1QA 5AQXA 4KH4A 4FVUA 2VYPA 3EN9A 4B1WB 1ASVA 4M42A 3SUQA 1EETA 1F21A 4CJVA 4OPKA 2W6LA 4Y1DA 4J2BA 4M63C 4B9NA 1OVYA 1LWFA 1KSPA 4EIAA 3OYJA 2HHVA 3C7NB 1VQLN 4BRNA 1CZBA 3E9LA 3H3OB 4F8RA 2FBVA 1IBMK 1RDAA 4JD2B 2G8KA 1SL2A 1KC8O 3OYFA 4RW8A 2GELA 4B9VA 3QDKA 1T6CA 4ILHA 3OY9A 3E66A 2D0OA 3A0IX 4LF9K 1TKTA 4CD1A 3EE8A 4N5SA 4DU1A 2F8TA 4CHZA 3BDPA 1VSEA 3LL3A 3ZT0A 4CF8A 2ITMA 4CEDA 4GVMA 3RMDA 4JI4K 4DTUA 5BN9A 1NK5A 3A5NC 1WSFA 2G8VA 1D4XA 1RT7A 3QICA 3S9HA 4HWIA 5C12A 4ELVA 3AO2A 4DSIA 1ZBLA 4JKDA 3K5LA 1UA0A 1SZ2A 1SV5A 2P9SB 3CQXA 3VQQA 1SKRA 3NGYA 4AHTA 2E2QA 1L3TA 3ZT1A 5HLFA 3DYAA 1KCFA 1U4BA 1WSJA 3HVRA 3R9PA 4BRDA 4EFHA 5LMUK 4B9MA 3EZWA 3QO9A 5CZ2A 2NZTA 1B9DA 1IG9A 1BOTO 3SYZA 2A1RA 2HNYA 1NKCA 3I55N 1CXUA 1TVRA 2NLXA 1NNEA 4BE2A 3DOLA 1DTTA 2G8FA 4IOCL 3VGMA 1T05A 4FM2A 4BRAA 2X74A 3BP8A 4KO0A 4UY8O 2DTUA 4HHTA 4ELUA 4CHYA 4B1VA 3Q7CA 3LP2A 4I9LA 4FCYA 4CJTA 5HL7L 4LH4A 2WFBA 1RT6A 5AQYA 3KK2A 1KFDA 4R5PA 3VF6A 4IOAL 3FZLA 3VQ4A 1NU0A 2VWBA 2G8WA 3THWA 3ZX2A 1GLLO 2F9WA 4FZZA 3PSFA 3A5LC 4DR5K 2HHSA 2QWLA 1BQNA 2EX3A 3TAQA 2OPQA 3HO1A 2YKNA 3P83D 2A6AA 3M8PA 3K5OA 4KBOA 4YFUA 2E2NA 3BUZB 3RSEA 4W5NA 1Q8IA 4B9LA 1Q86O 4DSEA 3CC7N 3JSMA 1Q81O 3RSEB 2JWLA 4BRHA 2CH6A 2P9KA 1HMVA 5GAGP 1QQOA 4DV1K 3VA0A 1GOCA 5TKYA 1P8ZA 5C15A 4KI6A 3FFIA 1HNIA 3THXA 1VSJA 1TV6A 1YF5L 5I3UA 3CCJN 4CZEA 1ASUA 2UXBK 5E26A 1TUYA 3L2UA 3CM5A 4FLTA 3ZEUA 2RHKA 1ZBFA 1BCOA 3H1VX 2UU9K 2X78A 3NDKA 4XH5A 1J5EK 3WNGA 2YJFA 4A5BA 3OYBA 1V4TA 4G9ZA 2W40A 2DY4A 5AQOA 3L2RA 3CERA 3MX2A 4CF1A 5C2FA 3HM8A 1KLMA 3IUCA 4EZ9A 4Z4EA 4FWNA 4WQ5A 4FJKA 3AA3A 2CGJA 4FVMA 5JLFA 3J81O 2B4JA 4PUOA 4JKBA 1HYVA 3HRGA 2HHWA 3O9RA 3C94A 3TANA 3VQ5A 3QEPA 2CH5A 3CJ7A 3QB0A 4Y0WA 2G8UA 4FWRA 4CHQA 5SWMA 3ZSQA 1BA0A 4HTUA 4CZKA 3M6GA 3SQ2A 3VETA 4JKCA 4KHUA 2P5GA 2XY8A 4DTXA 4JI3K 3MN9A 4YOTA 1QHTA 5EXWA 3M8QA 3TTDA 2D0PA 2OANA 1U2VB 5BRFA 5EOYA 3TU5A 4AHVA 3NVKA 4CECA 1U48A 5KPTA 5AQJA 3VEWA 3HVTA 1X9WA 2F8SA 2FBXA 2PFUA 5FPMA 4OGCA 1SKWA 1D8YA 5AQFA 2P1JA 3CM6A 3IG1A 2FXUA 3EKSA 3V4IA 3OYNA 5FPDA 4YOVA 1A5VA 4K42A 2E2PA 3NCIA 4CEBA 5JVHL 1O1WA 3W3DA 3PX6A 3O80A 4I2PA 1BQMA 1HRHA 3KVGA 4EP4A 3IFRA 1SL0A 1L3UA 2PYJA 3O9UA 1MDUB 3ENHA 2GWJA 4CZFA 3RWUA 4OPAA 4FL9A 3OYEA 3HOTA 4B3TK 1CLQA 4WQ5C 5HROA 4B9TA 1VQ9N 2Q31A 2XHBA 3O3GA 3FZFA 3KKSA 3QNOA 4IXCA 4KTZA 1TKZA 2YNGA 4BDPA 4I9QA 4YDUA 1KTQA 4H5WA 4YHHK 4IG0A 3LAKA 4DTOA 4KTWA 4JS4A 3TWHA 3O9QA 1T6DA 1MA9B 5BN8A 1JJ2M 3H3NO 4H8KA 3FLCO 3UKUB 4RCHA 1TAQA 4BWJA 4YNQA 2O8EA 3ZSWA 2B5JA 2GTDA 3OYGA 4CJPA 3MWPA 3DLLL 2BANA 4KAZA 1SKSA 3F9MA 4C1NK 3MX5A 4AM7A 4B1YB 2D5RA 4HUEA 4Z4CA 1X9MA 3TSQA 1LW0A 4PL8A 1T7PA 3MDQA 3V1OA 3G4SN 1QZ6A 1VSKA 4CJWA 4CGJA 3NF6A 4K8ZA 2OTJN 4FM1A 3M5RA 4CZLA 3W0LA 1FXXA 2QXLA 2ZGYA 3QEWA 1E4FT 2Q36A 3OYIA 5BPLA 1ZBUA 3AVHA 3TAPA 1RDUA 4O8KA 5AQLA 4CIGA 4XH1A 4DV4K 1RT2A 2O4GA 3QNNA 4AF1A 1VQON 2P9NB 5F0XA 5H1SQ 3N4QA 3PIOL 4JD2A 4IFVA 2OCEA 4IZ9A 5SZTA 4KI4A 1VK0A 1BIUA 1FK9A 1KAZA 3CC2N 3CCQN 3PUFA 3K5NA 3G0ZA 4K0KK 3ULEA 1Z6RA 2YNHA 4EP5A 3SZ2A 1N36K 5JICA 4WF9L 4PKIA 5AR0A 1K8KB 1VSFA 3ENOA 2WC9A 1S1UA 1HNZK 3SQ4A 5J2QA 4LSNA 4EAHD 3QETA 3F2KA 1RBSA 4X62K 3M1FA 4RW6A 1HJRA 4H0PA 3QFUA 3EEQA 4FSVA 2X6NA 3K58A 5TKWA 4CGDA 1DLOA 4AILC 3VENA 3AVIA 3U6FA 2VG6A 1ITGA 2HNDA 1NBWA 4JK7A 1YJ9N 3HXMA 3O4NA 3QIOA 3PO4A 3ZX3A 2HHXA 3K9KA 4N41A 3ZT2A 1C0TA 1MU2A 5ELZA 1S1XA 3P4IA 2YHXA 4EHTA 1WLJA 1QSLA 2PAVA 1BL3A 1RGIA 2FF3B 3WNFA 3L2WA 2ZWHA 3LDLA 4JHDA 2P51A 3FGUA 4A59A 3CFRA 3OYAA 1VSMA 1YTAA 5AQPA 1XMQK 2WBNA 3VA3A 1U6ZA 2P9PB 4M7XA 1XNRK 4ID1A 1S3XA 3KJVA 3ZYYX 2P9IA 2GX9A 1R59O 3LDNA 4A62A 4CFAA 3NE6A 3IDHA 4AHSA 1Q7YO 4DUZK 3A8YA 1KAYA 4FJNA 4RW7A 2ZGZA 2O4IA 1TK0A 4E19A 1WSGA 4LF4K 3R3LA 5C25A 1ZYQA 2HW3A 4CZHA 4F2SA 4HVJA 2G8HA 2FLOA 3CIPA 1NGHA 1X1PA 3V1RA 4EHUA 5BRDA 5HOOA 1MWKA 4DF4A 3L3VA 2NRTA 2VQFK 4FLZA 3HTVA 3B6OA 1N32K 1JCFA 2IS3A 1C0GA 1SS6A 1XWLA 3DLRA 2W42A 3WEEA 4KV8A 4FLVA 4OGEA 4FZYA 3RRHA 3KK7A 3PO5A 2IDOA 1BISA 3Q7BA 2IVNA 4FW1A 3MXJA 2P9UB 4CERA 3CCUN 4H5TA 3VMFB 3SCXA 3ZSOA 2HB5A 3ATUA 1NGEA 4M7YA 4M3YA 1OH5A 3TR8A 4NCAA 4W5RA 1G15A 1HUXA 3SAGA 4M3WA 1LV5A 1C0MA 3RTVA 4DWIA 4CHNA 4DR6K 1VQ7N 3VEYA 4JLHA 4CJ5A 3LPTA 4BR2A 4YORA 1JKHA 3JXUA 3HT3A 3C0BA 4BRIA 5KGXA 5AJ3K 3CJBA 4LD0A 1TKXA 1IBKK 3AO4A 1HNWK 1RDBA 3SI6A 3C6HA 5DK5A 1FKOA 4QCLA 4NXNK 4CK2A 3UE5A 3RR8A 1Z05A 4CJLA 1XMOK 3ASMA 4ZHRA 1VQ5N 5KI6A 4CJKA 3AVKA 3DRSA 3VQ8A 4ICLA 2ETJA 4QS8A 3QMLA 3ZT3A 2Q0UA 3S3NA 4F2RA 4FJHA 1QQNA 4BACA 3AVMA 4Y1CA 3O8MA 4NLCA 3AY9A 1XHXA 2E4LA 4MDAA 3WXIA 4O0JA 1RILA 1N8RO 1N6QA 3VESA 4BRMA 1U2VA 1SQKA 2E20A 2QWNA 1YT3A 1FJGK 1BWFO 4BE0A 2YNIA 4CHPA 3HPOA 5IWAK 3CG7A 1XI1A 1K73O 3H1QA 1NK9A 2Z1IA 2QWOA 2OA8A 1S6PA 2P9IB 1W9HA 3FE1A 2E88A 2QK9A 3ZLJA 3AVFA 4M3UA 2YI1A 3HI0A 3DXMA 3VERA 1SL1A 1Q18A 1L3VA 3F5TA 3VQPA 3WXLA 3LDOA 1VSLA 2VG7A 4O55A 3S3OA 3L0QA 3G6EN 4WFNL 3CFOA 4CGIA 1IKWA 3HM9A 1I39A 5F2RA 3QBWA 4UQGA 4J2DA 2KQ2A 1IV0A 3KLEA 1WN7A 5KQ8A 3WEEB 3QIPA 5FRNA 1C0UA 4CZIA 4JI0K 2X6SA 1ZC6A 2WUSA 4JN4A 3VOVA 4DS5A 3MEEA 2P9PA 1VHXA 5CYQA 3J8AA 3FZHA 2I7PA 4CEQA 3O08A 3OBYA 3MN5A 4DFJA 5J2PA 3B8AX 5ADXH 3QEXA 1TK5A 4X64K 4AHUA 4CEOA 4FW2A 3QEVA 5BPNA 2E5LK 4E7KA 3AARA 3NF8A 4DB3A 4LF5K 1HKBA 3OYCA 4OX9K 3OJSA 4OPJA 4IO8A 1OKJA 1WSEA 3VGLA 2O8FB 2HHUA 2XO7A 2HMIA 3OYHA 3GDQA 1JLFA 3ISNC 3WNEA 2J4RA 2R7YA 4CFDA 3CCMN 1JL1A 2GUPA 4KPYA 4JNEA 3TSUA 1NGDA 3AVGA 2FF6A 5AQMA 4GW6A 3P31A 1QSSA 5M1FA 1QVFM 1NK4A 2GUIA 4FK4A 1JXBA 4IWVA 1NG9A 4KHYA 1ZXOA 3C6UA 2D4WA 5M1PA 4N56A 1IH7A 4B1ZA 4MLHA 4I2QA 3PLAA 3NHGA 3VQDA 2O8DB 3VEOA 3VTHA 2Q97A 5HRNA 1OH6A 3MXIA 3PX0A 3HOSA 4BVPA 1L3SA 3EE9A 2GV9A 4Z4GA 2PZSA 1LWCA 4OO1J 3FZMA 4FWQA 4CGGA 4NCGA 5FROA 5J2NA 4HCCA 5LL6Z 3T7ZA 3RVCA 3ZSYA 4BG9A 1I94K 3ZSVA 2A41A 3A5OC 2OZMA 4DS4A 2VG5A 5BPMA 2D0BA 2P9UA 1DGKN 4GV6A 4CJUA 4CJSA 3SUNA 3THYB 1OH7A 3ALYA 1B92A 2OPPA 4BC4A 1WBDA 2HVIA 3O5BA 3RMCA 5CE3A 1GLCG 4IOXA 1J53A 1KVBA 3MMVA 4BY9C 3DLHA 4FWKA 4CJRA 3ZETA 1LWEA 4CJ4A 1C1CA 3R1XA 2I5JA 2E6MA 3GOIA 2E6LA 1EO1A 3K2PA 2HHTA 5KPZA 2Z1GA 5JS2A 2ZJQL 4JI8K 3OVNA 4CEEA 3RMBA 4CZGA 4B1XB 4BQZA 1RFQA 3NH0A 3JS6A 1D9FA 2BDPA 4MDBA 3AAPA 4BRGA 3KLGA 2IC3A 1JL2A 2BGGA 2QWMA 4B08A 1VSIA 3FR0A 1RDCA 1HX1A 1NKEA 3D0PA 2BTFA 4F3OA 3F9KA 4M3TA 4CF2A 5AZIA 3SV3A 5CR4A 2BE2A 4O44A 1M90O 2QI2A 4QS7A 3L6QA 4CZMA 1EQYA 1B9FA 3FZKA 1TKDA 5E84A 4H4OA 4RWTA 2XY7A 2QWPA 3A2FA 4A57A 4BR5A 3T3FA 1GOAA 4FOEA 5F1XA 5LMNK 3O4WA 1EKEA 5M1OA 5AQIA 3QESA 2BUPA 3J7AP 1RBUA 2YJEA 4PWDA 1RCHA 4XH4A 2YHBA 4BRPA 4DSJA 3KWGA 3O3HA 4DTMA 3DI6A 4DV3K 1P90A 3ID8A 2HNZA 3TAFA 3FFKB 3ZSXA 3SMPA 3TTFA 1UWBA 2P9LB 4BR9A 4C8LA 4BC3A 2HBMA 4K43A 4JK9A 3HP9A 4FJMA 2JLEA 2V52B 1YVUA 4JKAA 1NMNA 4H0TB 3CCRN 3DJCA 3T1HK 2F96A 1NJXA 3L4IA 4CF0A 1C6VA 4BGBA 4CIEA 2YHAA 1QTMA 4IEIA 4DQSA 2ZE2A 2A5XA 1IKXA 2KKZA 2V7ZA 1HQEA 4ID5A 3TTCA 2YNFA 3NF9A 4WQ4A 1CZAN 1QVGM 4JKHA 5GAHP 4L8RB 1NM1A 3CC4N 4CBWA 5EVZA 1HYZA 5HRSA 1NK8A 3ZSZA 3MAQA 4X65K 3SQ0A 3DMJA 3IAYA 2Z1HA 4FWOA 2DPNA 2DFEA 3LP0A 5AQUA 4DTRA 2IGIA 4FK2A 4LFAK 3VPZA 5GINA 3BZKA 3LZJA 1KRPA 1NKBA 4KHNA 4DV7K 4E89A 4FJ5A 2W6KA 3UB5A 2QKBA 4FYDA 5BREA 4DLEA 4C8NA 4CJ7A 2XY5A 3L2QA 3TAGA 1XC3A 1Q9XA 4DTNA 1J54A 2IOCA 3VQ9A 2FBYA 4QS9A 3S41A 1RTHA 3CJ9A 3TSPA 1J9AA 3KHYA 4CJEA 3H08A 1QSYA 4YOYA 3O6WA 2CGKA 3WQUA 4LF8K 4Z0UA 4F4KA 1BG3A 3VQCA 5LJWA 3O9TA 3PIPL 1ATSA 4OKKA 1HKGA 1VQMN 3PSIA 4M45A 3VQBA 2VWKA 4LC9B 1RDWX 1NK6A 4LF6K 5EY4A 3SNNA 3V1QA 2NRZA 1U47A 1S5JA 4O4GA 1OVQA 1RTJA 5KRSA 3HK2A 4AHCA 3VQ6A 2UUAK 2HF4A 3AA2A 4RW4A 4X66K 3OTOK 3DXKA 1D5AA 1R0AA 3HSCA 1VSDA 5HP1A 3G10A 5GADP 2O8FA 3MEDA 3AAQA 3V9XA 3SAHA 3V9WA 1C1BA 1SUQA 5AQRA 4JKGB 1ZBHA 4CD3A 5KPRA 1N33K 1C0FA 1BI4B 1EX4A 3NAEA 3UKRB 2HSTA 5HRRA 4DFKA 1ATRA 1S1TA 4KREA 1YJWN 4QAGA 3CMEN 1BHLA 2ASPA 5JVGL 2NRHA 4E3SA 1QS4A 4CBXA 5C42A 1BUPA 3VGKA 4BR7A 4YOWA 4C8OA 1KFSA 2AJQA 3CPWM 1K8KA 2ZF5O 1HYSA 4DFPA 1JLEA 3GG4A 4IKFA 4W5TA 5EU7A 5C10A 3V9ZA 1YUWA 3EKUA 3JYTA 1HNVA 4GVEA 5KQDA 4EZ6A 4GKJK 2ZD1A 5FDLA 3AV9A 2KZZA 3HSTB 3AGRA 4TSXA 5AQZA 4N76A 3VN5A 3D2FB 4JV5K 4AHRA 3DLKA 1DT9A 5CYMA 1DEJA 1H1VA 4A2AA 3DLBA 1DTQA 2ASOA 4ISFA 1TUUA 3BGRA 3LALA 1TGOA 1NK7A 2KW4A 2AP1A 3D2EA 2D0CA 3KLHA 4FPBA 4IJAA 4CVNE 4B1UB 5LJVA 4WFBL 3KKRA 2I7NA 4A61A 4NCBA 3OYDA 2P9LA 2Q2RA 2QXFA 4DSLA 4FWLA 5AZJB 4A2BA 3U3YA 1YI2N 1KAXA 4IJNA 4J2AA 1XHZA 3U3GA 4RG8A 3UKUA 3L3UA 4B9SA 3O1WA 2GBZA 1RTIA 5EX5A 2RE2A 4CF9A 4E0DA 3O1BA 5JMVA 1QHAA 1YVNA 1GLBG 4JRPA 4CK3A 2IAJA 2HBKA 1RTDA 4M3RA 4JKGA 3U8XA 2KFZA 4DV6K 3KLFA 4V19S 1WAFA 1UAXA 4H4MA 4MO5A 4DV0K 4DLGA 1BDGA 1HKCA 1HQUA 3OS1A 2P9KB 3NVMA 3E1YA 2E1ZA 4JYAK 5AZIB 4XIUA 3IRXA 4CBUA 2XY6A 1U49A 1N5YA 2E8AA 2VCPA 3P1GA 1HPZA 3T1AA 3MXMA 4BREA 5AQVA 3J80O 3JAMO 3QLHA 4JEPA 4U7BA 1L5UA 4DHYA 4KFBA 2D1KA 1ZBSA 1T8EA 1TL1A 2NRWA 3T19A 2A40A 1BO5O 3ZETB 1GOBA 1REVA 5BR8K 4L3QA 3CHWA 1NOYA 4KKOA 1NJWA 2HF3A 1VQNN 4Q5VA 3SK3A 4C8MA 3AA5X 2HVHA 4AM6A 2AA4A 5C2DA 3VTIA 4B3RK 2F9TA 1U04A 1D9DA 4FJ9A 4FK0A 3LWLA 1RBVA 2LSNA 3LWMA 1VQ8N 3DM2A 4FXDA 4B3SK 4BGAA 4O5BA 3SUPA 1M1KO 2A42A 4CEZA 2KTQA 2FC0A 2YHYA 1JCEA 4DQ8A 1MWMA 1RDDA 1EWQA 4PL7A 5BRHA 4BRLA 1JLAA 1Q82O 3T1YK 3CJAA 3L8BA 4DV5K 3K59A 1LCUA 3P38A 1RBRA 4H5VA 3DRRA 3TARA 1WSIA 3DXMB 2O8BB 3U4LA 4AH9A 4BR0A 3J7ZO 3WXMB 4KHWA 1QQCA 5KTQA 3VQAA 4CFBA 3VQEA 4Q0BA 5AQSA 3GL1A 2Q0RA 3D6RA 1FW6A 1C1AA 4C1NI 2HHQA 1VRTA 2O8DA 4F9OA 1WSHA 1Z26A 4MFBA 1LAVA 3WXJA 4DR3K 1UOCA 3KTQA 4YDUC 3O3FA 5AQHA 4PHTX 5AFUA 3LM9A 4FJJA 4PKGA 2DFFA 4ILJA 4BROA 2W41A 1E3MA 2OTLN 4DFMA 1YITN 3NGIA 1HJOA 1NGFA 2E1YA 4YOUA 1HLUA 1WOQA 3CQYA 3LDQA 1LAWA 3RR7A 1IO2A 1VAZA 3CYMA 4DQIA 4B9UA 1Y97A 4BRCA 3ZCMA 3LAMA 2YX6A 4WQ4C 1LW2A 4GNIA 4JI7K 3CI5A 3OBWA 5AQNA 3VF2A 2PYLA 4K25A 4HUFA 3CCEN 4B9QA 3K57A 4M3ZA 2ZJRL 3EO3A 3TAMA 2ASMA 4CK1A 2QM1A 3PV8A 3SMSA 3EL2A 4JKFA 2QTDA 4FJGA 2QKKA 3D2EB 1A5WA 3BF3A 5M1KA 2OPSA 3KWIA 3E9OA 3KD1E 3AVBA 4PA1A 4DR1K 3NBPA 4BR4A 3CD6N 4BDYA 3QEIA 2PBDA 3LDPA 1QZ5A 4JAXA 2H3GX 3IKMA 3E9PA 1YTUA 3O4QA 3I0RA 1K6YA 3M3ZA 4BQLA 1TL3A 4OLBA 4DTPA 1NGCA 4CCHA 2UUBK 4FJ8A 1GLFO 1W7AA 1Q9YA 3GE1A 4DR2K 4E7HA 1OH8A 1JLBA 4IFYA 2B6AA 3QERA 5AZJA 4WE1A 5DM7L 1EWRA 3PY8A 1Y64A 3VEVA 3HYFA 2QWRA 4CEFA 2ZM6K 1WBBA 4DQRA 4M3XA 1ILYA 3VEXA 4C8KA 4OKEA 4FLWA 3WUHA 2RPIA 2FSJA 2FBTA 3LANA 2EHGA 1CZ9A 3HJFA 1IKYA 1S6QA 4FWPA 1DKGD 3QINA 3SAFA 1U45A 2P9SA 4B3OA 5I42A 4PQUA 4Z4FA 2V51B 1NJZA 4DG1A 1T03A 4OVLA 1J5OA 4AQYK 5I9EB 1JXEA 1BI4A 1VRUA 4DCHA 1I3AA 2JWKA 3LPUA 4BE1A 5C24A 3VEZA 3CFPA 3V6DA 3OA9A 2HHHK 3KIOA 3BEXA 1S72N 2Y1JA 5AQQA 4OKJA 3WNHA 1NK0A 2FSNA 4DSKA 4NO7A 3DXKB 1GLAG 3ZX0A 2OPRA 4JS5A 3DLEA 4KHPK 3ZSRA 1WAJA 3LM2A 3MCAB 4O5FA 1YXQA 2VWJA 3M8RA 3U9DA 3U9ZA 2UYTA 4PKHA 2V7YA 1JLGA 1RNHA 5FRMA 1ZBIA 4Z4HA 4DSFA 5IT9O 3CMAN 5LY3A 3KD5E 4KB0A 5C0YA 1KLNA 2QEXN 1NLVA 3SPZA 3H6EA 1YHQN 3EYZA 1ATNA 4DTSA 1QQMA 3PX4A 4Z4IA 3H45C 1ASWA 4R79A 1KQSM 3CXCM 1HR0K 3CETA 1BU6O 3G25A 5CY4A 5FPEA 3OYLA 5FPNA 4NYFA 1GLJO 1K9MO 4FJXA 1BGXT 3ID6A 4J8FA 3OS0A 3NH2A 4FM0A 4H0VB 3RMAA 3CCSN 4FOIA 3K9JA 3DWLA 3WQTA 3AVCA 4K41A 3D7EO 2HMPA 4KTQA 5GIPA 5J1EA 5DM6L 2P9NA 2IVOA 3M8SA 3MN7A 1YJNN 3WXKA 4DV2K 3TAEA 3N4PA 3KK3A 3LZIA 3R6MA 5JLHA 4FWSA 2EWSA 2Y1IA 2YHWA 1TYQB 2YKMA 4LSLA 2RN2A 2KFNA 2O8CB 4GMJB 4BRKA 3ATVA 2WONA 3L2VA 4LH5A 1TYQA 5AQTA 3B6PA 3OYKA 1WUAA 4ISGA 5FLXO 3OS2A 3BF1A 4CESA 1VQ4N 3SLCA 4DQQA 2G8IA 1XQSC 1IJJA 4HCBA 1BCMA 1RT5A 4YOXA 4J2EA 1X9SA 1ESVA 3MCPA 4CZJA 2OYQA 2KLAA 3OHRA 4DU3A 3H46O 1JCGA 1O13A 4H03B 3I56N 3THXB 3DRPA 3I8DA 2GWKA 4RW9A 2ITGA 3F73A 1VSHA 3HPHA 2QA4N 4BRFA 4CEAA 2UXDK 3C6AA 1VQ6N 1CXQA 3DLGA 4I6MB 4ZTJA 3SV4A 4ZTFA 4C23A 4CGHA 4MO4A 4K8XA 2WTUA 4E7LA 4CI6A 4FJ7A 3CPEA 3SJJA 1Z25A 4JI1K 3AVAA 4FPAA 3ULDA 3I33A 3K0SA 2VGMA 3TABA 4DUYK 4E1MA 4H0YB 2QWQA 1NJIO 3P39A 2ZQBA 1TAUA 3AO3A 3A5MC 3O9SA 4H5NA 3THVA 5HRPA 2RKIA 2XRIA 4NB4A 1S22A 2O8BA 3MWTA 1G99A 4IDKA 4KHQA 3R8EA 4BG8A 5GAEP 4NYNA 1NGAA 3SBTA 5B8HA 1NOZA 1EP4A 3CJCA 5J2MA 4DU4A 3CCLN 1NMDA 2ZJPL 1RT1A 1YAGA 4LFCK 4CFCA 4B3MK 4E1JA 4JKEA 4BDZA 4H0XB 5CHIA 4MLEA 1RT4A 1GLDG 5T7BA 3GBTA 1EXQA 3K5MA 4GY2B 3SPYA 4N47A 5M1QA 3DAWA 2WOMA 4FLUA 3MECA 4IG3A 2F4VK 4E7JA 4FJLA 3AVLA 1S1WA 4W5OA 5BR9A 4LF7K 4CJQA 1SAZA 2CGLA 4BWMA 1GLEG 3V9SA 4IDHA 4CGFA 4WCEL 3THYA 3UKRA 4OPHA 4H5RA 3VF4A 5MLCQ 1BA1A 3KLIA 3IMXA 1VQKN 4JHDB 2UXCK 4O8UA 1KVAA 4F3TA 3C7NA 4IO9L 4PY5A 4B8CA 4JI6K 3C65A 4BVOA 3V9UA 2O8EB 3AGKA 3D45A 2UUCK 3C95A 3IS9A 3T69A 4M41A 3ZT4A 5AFUH 2KHOA 3SQ1A 2Q1NA 4CW7B 3I0SA 1WNSA 1X9JA 5AQGA 3KZBA 4JI2K 3V81A 2VGNA 3LP3A 4DF8A 1BIZA 3HL8A 4KB1A 3C6TA 2YCHA 3CCVN 3TPQA 1N34K 4DKWA 1XUPO 4XEIA 3I8BA 3UIQA 2FSKA 4BC5A 4QOZB 4OJRA 1T44A 2PY5A 1W97L 4IBNA 1T3VA 4ELTA 1W0HA 3QFPA 5A2QO 3SUOA 4DQPA 2VQEK 4IEEA 4JRQA 2GEMA 2A1SA 4JI5K 4CJFA 3THWB 2NRXA 2JGUA 5KRTA 2NRRA 3E01A 4W5QA 1W2BM 4GV3A 1IG8A 5ADXA 3DOKA 4DTJA 4BRQA 1JLQA 1V4SA 3NMUA 2KZMA 2YV0X 2D0AA 1XNQK 5K14A 1KXPA 4E7IA 4IFEA 4OLAA 2E2OA 4CIFA 1FKPA 2HOEA 5D3GA 4I7FA 4NXMK 1A5XA 1JLCA 4I6MA 1QE1A 3ULEB 4KHSA 3QBXA 3OJUA 3VQ7A 3NGZA 2NRVA 1RBTA 2HBLA 3HP6A 1KD1O 3LP1A 5AQKA 3EY1A 2RF2A 4BC2A 3D2FA 3NFAA 5KGWA 3P5JA 1X3NA 1IBLK 4LY7A 2Z1JA 3KK1A 2DFHA 1NGJA 3WT0A 4DR4K 5DMRA 5AQWA 3RRGA 1NGGA 1VQPN 3CF5L 5M1NA 3NF7A 4FZXC 1NWKA 1NJYA 5JS1A 4YY3K 4H0OA 3S3MA 2ATQA 2A3ZA 1S1VA 4WFAL 1YIJN 3AO5A 2IIRA 2OZSA 5CZ1A 1E4GT 2IVPA 1NGIA 3AO1A 4ISEA 3G71N 3BY5A 2O8CA 4E1NA 4JK8A 2NUBA 3MN6A 4CHOA 1LOTB 4GV9A 4B8AB 1RT3A 4O0IA 4GKKK 3CQ8A 4KH5A 5E41A 3EZ5A 3CJ1A 4FLYA 4FWMA 2P5OA 1HPMA 3AA4A 3AVJA 3L4QA 3OW2M 4CE9A
chains in the Genus database with same CATH topology
4EAHD 3FFKB 1GLFO 3SMPA 3TTFA 3GE1A 3MK6A 3F2KA 2P9LB 1J6ZA 4BR9A 4ILGB 4BC3A 5AZJA 2HBMA 3M1FA 1X3MA 4JK9A 4K43A 1Y64A 5DM7L 2QW9A 4H0PA 3SJHA 3VEVA 4NLBA 2QWRA 2NNWA 1K8AO 2V52B 3QFUA 4JKAA 4FSVA 4H0TB 3CCRN 5TKWA 3VEXA 1ILYA 5GIOA 2BH1A 3DJCA 3SBGA 3VENA 3L4IA 4BGBA 3WUHA 2FSJA 4Z94A 3ENBA 1NBWA 4JK7A 1YJ9N 4FO0A 4IEIA 4U67L 2A5XA 3HZ6A 3ZX3A 2KKZA 4RTFD 3K9KA 2F7TA 3ZEUB 4WYBA 2V7ZA 3HBTA 4FWPA 4HTLA 2HBJA 5ELZA 1NGBA 3P4IA 2YHXA 1DKGD 4KH6A 3TTCA 4A5AA 4EHTA 4WQ4A 1CZAN 2PAVA 3SAFA 2P9SA 4KH4A 5AQXA 1QVGM 1RGIA 2FF3B 4FVUA 2VYPA 2V51B 3EN9A 4JKHA 4B1WB 5GAHP 2ZWHA 1NM1A 5I9EB 3LDLA 3CC4N 4JHDA 4CBWA 3FGUA 4A59A 4DCHA 2JWKA 5EVZA 3VEZA 5AQPA 2WBNA 3OA9A 1U6ZA 2P9PB 4M7XA 4M63C 1S3XA 1OVYA 4FWOA 3BEXA 1S72N 2DPNA 5AQUA 4EIAA 3C7NB 5AQQA 2P9IA 3ZYYX 2GX9A 3E9LA 4BRNA 1VQLN 1R59O 3LDNA 3H3OB 4A62A 3IDHA 4JD2B 1Q7YO 3VPZA 5GINA 1KC8O 3A8YA 2FSNA 1KAYA 4NO7A 2ZGZA 2GELA 3DXKB 1GLAG 1T6CA 3QDKA 3ZX0A 4ILHA 3E66A 3UB5A 2D0OA 3A0IX 3LM2A 3MCAB 3R3LA 5BREA 4CJ7A 4CD1A 3EE8A 4CZHA 4O5FA 1YXQA 1XC3A 2FLOA 3CIPA 1NGHA 3U9DA 4EHUA 5BRDA 3U9ZA 1MWKA 5HOOA 2NRTA 2UYTA 3LL3A 4QS9A 3S41A 3CJ9A 3HTVA 4PKHA 2ITMA 1JCFA 2V7YA 3TSPA 3KHYA 1C0GA 1SS6A 4YOYA 3O6WA 5BN9A 2CGKA 3WQUA 3A5NC 3WEEA 1BG3A 1D4XA 3KK7A 3QICA 5LJWA 3CMAN 4HWIA 5C12A 5LY3A 5C0YA 3O9TA 3Q7BA 1ATSA 1NLVA 1HKGA 3PIPL 2QEXN 3H6EA 2IVNA 4JKDA 1YHQN 1VQMN 1SZ2A 2P9SB 3CQXA 1ATNA 2P9UB 1QQMA 3H45C 4H5TA 1RDWX 4LC9B 3VMFB 3CCUN 4R79A 5EY4A 3CXCM 1KQSM 2NRZA 3ATUA 3CETA 1NGEA 4M7YA 1BU6O 3G25A 5FPEA 2E2QA 5FPNA 2HF4A 1HUXA 3SAGA 1GLJO 3DXKA 1K9MO 3HSCA 3ID6A 4J8FA 4H0VB 3CCSN 4FOIA 3R9PA 4BRDA 4EFHA 5GADP 1VQ7N 3VEYA 3K9JA 3DWLA 3AAQA 3EZWA 4BR2A 4YORA 3WQTA 2NZTA 3JXUA 3C0BA 1BOTO 3SAHA 4K41A 3D7EO 2HMPA 4BRIA 5GIPA 5DM6L 5AQRA 4JKGB 2P9NA 3I55N 2IVOA 2NLXA 3CJBA 4CD3A 5KPRA 3MN7A 1YJNN 1C0FA 3WXKA 4IOCL 3VGMA 3UKRB 3C6HA 2HSTA 4BRAA 3N4PA 1ATRA 3BP8A 1YJWN 4UY8O 3CMEN 3UE5A 3R6MA 1Z05A 5JLHA 2ASPA 5JVGL 2NRHA 4B1VA 4FWSA 1VQ5N 3Q7CA 2EWSA 4CBXA 1BUPA 3VGKA 4BR7A 5HL7L 4QS8A 4YOWA 2WFBA 3QMLA 5AQYA 2YHWA 1TYQB 2Q0UA 3VF6A 3CPWM 4IOAL 3FZLA 1QQNA 1K8KA 2ZF5O 4BRKA 3ATVA 2VWBA 1TYQA 3GG4A 5AQTA 3ZX2A 1GLLO 2F9WA 1WUAA 4ISGA 3A5LC 3BF1A 3O8MA 4NLCA 5C10A 1VQ4N 3AY9A 2QWLA 3SLCA 1YUWA 4MDAA 3WXIA 3EKUA 2A6AA 1XQSC 4GVEA 1N8RO 1IJJA 5KQDA 4KBOA 3VESA 4YOXA 4BRMA 2E2NA 1U2VA 1SQKA 1ESVA 2E20A 3MCPA 2QWNA 3AGRA 4CZJA 5AQZA 3BUZB 1BWFO 3RSEA 1Q86O 3CC7N 3D2FB 2KLAA 1Q81O 3RSEB 1DT9A 3OHRA 2JWLA 1JCGA 1O13A 3H46O 4H03B 2CH6A 3H1QA 2P9KA 4BRHA 1K73O 3I56N 5GAGP 1QQOA 1DEJA 1H1VA 2QWOA 4A2AA 5TKYA 1P8ZA 5C15A 2P9IB 3FE1A 2GWKA 2E88A 2ASOA 4ISFA 1TUUA 1YF5L 2QA4N 3CCJN 4BRFA 4CZEA 3C6AA 3D2EA 2AP1A 2YI1A 3DXMA 3HI0A 3VERA 1Q18A 1VQ6N 4FPBA 5E26A 4I6MB 4IJAA 1TUYA 3F5TA 3WXLA 4C23A 4MO4A 3LDOA 4B1UB 5LJVA 4WFBL 3ZEUA 2RHKA 2I7NA 3L0QA 3H1VX 4A61A 4CI6A 3G6EN 3CPEA 4WFNL 2P9LA 2Q2RA 4FWLA 5AZJB 4A2BA 4XH5A 1YI2N 1KAXA 4IJNA 4FPAA 2YJFA 5F2RA 3I33A 4A5BA 2VGMA 3QBWA 3UKUA 4H0YB 1V4TA 4G9ZA 2W40A 2QWQA 3O1WA 1NJIO 5AQOA 5EX5A 3WEEB 5KQ8A 2RE2A 3P39A 3CERA 3MX2A 4CZIA 3O1BA 3A5MC 3O9SA 5C2FA 1QHAA 5JMVA 1YVNA 1ZC6A 1GLBG 2WUSA 4H5NA 4JN4A 3VOVA 2P9PA 2HBKA 3HM8A 4NB4A 3IUCA 4JKGA 3U8XA 1S22A 3MWTA 3J8AA 3FZHA 1G99A 2I7PA 4FWNA 3R8EA 4WQ5A 3O08A 3OBYA 3MN5A 4BG8A 5GAEP 3B8AX 1NGAA 3SBTA 5ADXH 5B8HA 4MO5A 2CGJA 5JLFA 5BPNA 3CJCA 1BDGA 3AARA 1HKCA 3HRGA 4JKBA 3O9RA 2P9KB 4DB3A 3NVMA 3CCLN 3E1YA 1NMDA 2E1ZA 1HKBA 2ZJPL 2CH5A 5AZIB 1YAGA 3CJ7A 3QB0A 4Y0WA 4FWRA 3TTDA 4E1JA 4IO8A 4JKEA 1BA0A 4H0XB 4CBUA 5CHIA 4CZKA 4MLEA 1OKJA 3M6GA 3VGLA 1GLDG 3VETA 4JKCA 2E8AA 2VCPA 3GDQA 3GBTA 4GY2B 2J4RA 3MN9A 4BREA 5M1QA 3DAWA 3CCMN 5AQVA 4YOTA 5EXWA 2GUPA 4JEPA 4U7BA 4DHYA 4JNEA 2D1KA 2D0PA 2OANA 1NGDA 1U2VB 1SAZA 1ZBSA 2CGLA 2FF6A 5EOYA 3TSUA 3TU5A 1GLEG 5BRFA 3NVKA 4IDHA 4WCEL 2NRWA 3UKRA 5AQMA 5KPTA 3P31A 2A40A 5M1FA 1QVFM 5AQJA 4OPHA 1BO5O 3ZETB 4H5RA 3VEWA 3VF4A 5MLCQ 1BA1A 4IWVA 3IMXA 2PFUA 4L3QA 5FPMA 1VQKN 4JHDB 3CHWA 5AQFA 4O8UA 2HF3A 1VQNN 3C7NA 2FXUA 3EKSA 1ZXOA 4IO9L 2D4WA 5M1PA 3C65A 3SK3A 4BVOA 3AGKA 5BR9A 4AM6A 2AA4A 5FPDA 4B1ZA 4MLHA 4YOVA 3T69A 3PLAA 4K42A 5AFUH 2KHOA 5C2DA 2E2PA 2Q1NA 3VTIA 2F9TA 3VEOA 3VTHA 1X9JA 2Q97A 5AQGA 3KZBA 1VQ8N 5JVHL 3W3DA 3O80A 2VGNA 3KVGA 4BGAA 3IFRA 3HOSA 1M1KO 4BVPA 3EE9A 2A42A 1MDUB 3O9UA 2YCHA 3ENHA 3CCVN 2YHYA 3TPQA 2GWJA 4DKWA 4OO1J 1JCEA 1XUPO 3I8BA 4XEIA 3FZMA 4CZFA 4DQ8A 2FSKA 4FWQA 4OPAA 1MWMA 4BC5A 4PL7A 5BRHA 4BRLA 1Q82O 4FL9A 3HOTA 3CJAA 3T7ZA 4WQ5C 3RVCA 1T44A 1LCUA 4BG9A 1VQ9N 1W97L 3P38A 2A41A 1T3VA 2Q31A 3A5OC 4H5VA 3FZFA 3QFPA 5BPMA 4IXCA 3DXMB 2P9UA 3U4LA 1DGKN 4IEEA 4BR0A 3J7ZO 3WXMB 2GEMA 4GV6A 2NRXA 4YDUA 4H5WA 5AQSA 3GL1A 4BC4A 2Q0RA 2NRRA 3D6RA 3O5BA 4C1NI 5CE3A 1W2BM 3O9QA 1T6DA 4F9OA 1MA9B 1IG8A 1GLCG 4IOXA 5BN8A 1JJ2M 4GV3A 3H3NO 3MMVA 5ADXA 4BY9C 3FLCO 3UKUB 4FWKA 4RCHA 3WXJA 3ZETA 4BRQA 2GTDA 4YDUC 1V4SA 3R1XA 3MWPA 5AQHA 3NMUA 4PHTX 5AFUA 3DLLL 3GOIA 3LM9A 1KXPA 4PKGA 1EO1A 4IFEA 3F9MA 4ILJA 4BROA 2W41A 5KPZA 4C1NK 2OTLN 1YITN 2ZJQL 2E2OA 3MX5A 4AM7A 2HOEA 4B1YB 1HJOA 1NGFA 3TSQA 2E1YA 4B1XB 4BQZA 4CZGA 4YOUA 1HLUA 1RFQA 1WOQA 3CQYA 3LDQA 3MDQA 4I6MA 4PL8A 3JS6A 3ULEB 1QZ6A 3G4SN 1VAZA 4MDBA 3AAPA 3QBXA 4BRGA 2OTJN 2QWMA 3FR0A 3M5RA 3W0LA 4CZLA 2QXLA 1HX1A 4BRCA 2NRVA 2HBLA 2YX6A 2ZGYA 4WQ4C 1KD1O 2BTFA 5AQKA 4GNIA 1E4FT 3CI5A 3OBWA 4BC2A 2Q36A 3D2FA 5AQNA 5AZIA 3VF2A 5BPLA 5CR4A 1RDUA 4O8KA 4K25A 3CCEN 1X3NA 4B9QA 5AQLA 1M90O 2QI2A 4QS7A 3L6QA 2ZJRL 1NGJA 3EO3A 3WT0A 5AQWA 4XH1A 1EQYA 1NGGA 2ASMA 4CZMA 1VQPN 3CF5L 3FZKA 5E84A 5M1NA 2QM1A 4RWTA 2QWPA 3SMSA 4A57A 1VQON 3EL2A 1NWKA 4AF1A 4JKFA 2QTDA 2P9NB 4BR5A 3D2EB 4H0OA 1YIJN 5F0XA 2A3ZA 4WFAL 5H1SQ 3N4QA 3PIOL 4FOEA 5F1XA 3BF3A 5M1KA 4JD2A 2IIRA 4IZ9A 3KWIA 3O4WA 3E9OA 5M1OA 5AQIA 1E4GT 2BUPA 2IVPA 1KAZA 3CC2N 3CCQN 1NGIA 4ISEA 4BR4A 3G71N 3CD6N 4JK8A 2PBDA 2YJEA 3LDPA 3ULEA 1QZ5A 1Z6RA 4JAXA 2H3GX 3MN6A 4XH4A 4BRPA 3IKMA 1LOTB 3KWGA 4GV9A 5JICA 3E9PA 4WF9L 4PKIA 4KH5A 3M3ZA 5AR0A 3CJ1A 1K8KB 4FWMA 4BQLA 1P90A 3ENOA 2WC9A 3ID8A 1HPMA 3L4QA 3OW2M 1NGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EAH D;  3FFK B;  1GLF O;  3SMP A;  3GE1 A;  3MK6 A;  2P9L B;  1J6Z A;  4BR9 A;  4BC3 A;  5AZJ A;  4K43 A;  3M1F A;  1X3M A;  1Y64 A;  2QW9 A;  4H0P A;  3SJH A;  3VEV A;  2QWR A;  2V52 B;  3QFU A;  4FSV A;  4H0T B;  3VEX A;  3DJC A;  3VEN A;  3L4I A;  4BGB A;  3WUH A;  2FSJ A;  4Z94 A;  1NBW A;  4FO0 A;  2A5X A;  3HZ6 A;  3ZX3 A;  4RTF D;  3ZEU B;  4WYB A;  2V7Z A;  3HBT A;  4FWP A;  4HTL A;  5ELZ A;  1NGB A;  3P4I A;  2YHX A;  1DKG D;  4EHT A;  4WQ4 A;  1CZA N;  2PAV A;  2P9S A;  5AQX A;  1RGI A;  2FF3 B;  2VYP A;  2V51 B;  3EN9 A;  4B1W B;  2ZWH A;  1NM1 A;  5I9E B;  3LDL A;  4JHD A;  4CBW A;  3FGU A;  4DCH A;  5EVZ A;  3VEZ A;  5AQP A;  1U6Z A;  2P9P B;  4M7X A;  4M63 C;  1S3X A;  4FWO A;  3BEX A;  2DPN A;  5AQU A;  4EIA A;  3C7N B;  5AQQ A;  2P9I A;  4BRN A;  1R59 O;  3LDN A;  3H3O B;  4A62 A;  3IDH A;  4JD2 B;  3VPZ A;  3A8Y A;  2FSN A;  1KAY A;  4NO7 A;  2ZGZ A;  2GEL A;  3DXK B;  1GLA G;  1T6C A;  3QDK A;  3ZX0 A;  3UB5 A;  2D0O A;  3A0I X;  3LM2 A;  5BRE A;  4CJ7 A;  4CD1 A;  4CZH A;  4O5F A;  1YXQ A;  1XC3 A;  2FLO A;  3CIP A;  1NGH A;  3U9D A;  4EHU A;  5BRD A;  3U9Z A;  1MWK A;  3LL3 A;  2UYT A;  4QS9 A;  3S41 A;  3HTV A;  3CJ9 A;  4PKH A;  2ITM A;  1JCF A;  2V7Y A;  3KHY A;  1C0G A;  3O6W A;  5BN9 A;  2CGK A;  3WQU A;  3A5N C;  3WEE A;  1BG3 A;  1D4X A;  3QIC A;  5LJW A;  4HWI A;  5LY3 A;  1ATS A;  1NLV A;  1HKG A;  3H6E A;  2IVN A;  1SZ2 A;  2P9S B;  3CQX A;  1ATN A;  2P9U B;  1QQM A;  3H45 C;  4H5T A;  1RDW X;  4LC9 B;  5EY4 A;  3CET A;  3ATU A;  1NGE A;  4M7Y A;  1BU6 O;  3G25 A;  5FPE A;  2E2Q A;  5FPN A;  2HF4 A;  1HUX A;  1GLJ O;  3DXK A;  3HSC A;  4J8F A;  4H0V B;  4FOI A;  3R9P A;  4BRD A;  4EFH A;  3VEY A;  3DWL A;  3AAQ A;  3EZW A;  4BR2 A;  3WQT A;  2NZT A;  3JXU A;  3C0B A;  1BOT O;  4K41 A;  3D7E O;  2HMP A;  4BRI A;  5AQR A;  2P9N A;  2IVO A;  2NLX A;  3CJB A;  4CD3 A;  5KPR A;  3MN7 A;  1C0F A;  3WXK A;  3VGM A;  3UKR B;  4BRA A;  1ATR A;  3BP8 A;  3UE5 A;  3R6M A;  1Z05 A;  5JLH A;  2ASP A;  2NRH A;  4B1V A;  4FWS A;  2EWS A;  4CBX A;  1BUP A;  3VGK A;  4BR7 A;  4QS8 A;  3QML A;  5AQY A;  2YHW A;  1TYQ B;  2Q0U A;  3VF6 A;  3FZL A;  1QQN A;  1K8K A;  2ZF5 O;  4BRK A;  3ATV A;  2VWB A;  1TYQ A;  3GG4 A;  5AQT A;  3ZX2 A;  1GLL O;  2F9W A;  1WUA A;  4ISG A;  3A5L C;  3BF1 A;  3O8M A;  3AY9 A;  2QWL A;  3SLC A;  1YUW A;  3WXI A;  3EKU A;  2A6A A;  1XQS C;  1IJJ A;  5KQD A;  4KBO A;  3VES A;  4BRM A;  2E2N A;  1U2V A;  1SQK A;  1ESV A;  2E20 A;  3MCP A;  2QWN A;  4CZJ A;  5AQZ A;  3BUZ B;  1BWF O;  3RSE A;  3D2F B;  3RSE B;  3OHR A;  3H46 O;  1JCG A;  4H03 B;  4BRH A;  2CH6 A;  3H1Q A;  2P9K A;  1QQO A;  1DEJ A;  1H1V A;  2QWO A;  4A2A A;  5TKY A;  1P8Z A;  2P9I B;  3FE1 A;  2GWK A;  2E88 A;  2ASO A;  4ISF A;  1TUU A;  4BRF A;  4CZE A;  3HI0 A;  3D2E A;  2AP1 A;  2YI1 A;  3DXM A;  3VER A;  1Q18 A;  4FPB A;  5E26 A;  4I6M B;  4IJA A;  1TUY A;  3WXL A;  4C23 A;  4MO4 A;  3LDO A;  4B1U B;  5LJV A;  3ZEU A;  2I7N A;  3L0Q A;  3H1V X;  4A61 A;  4CI6 A;  2P9L A;  2Q2R A;  4FWL A;  5AZJ B;  4A2B A;  4XH5 A;  1KAX A;  4IJN A;  4FPA A;  2YJF A;  5F2R A;  3I33 A;  3QBW A;  3UKU A;  4H0Y B;  1V4T A;  2W40 A;  2QWQ A;  3O1W A;  5AQO A;  5EX5 A;  3WEE B;  5KQ8 A;  3CER A;  4CZI A;  3O1B A;  3A5M C;  5JMV A;  1QHA A;  1YVN A;  1ZC6 A;  1GLB G;  2WUS A;  4H5N A;  4JN4 A;  3VOV A;  2P9P A;  3HM8 A;  4NB4 A;  3IUC A;  3U8X A;  1S22 A;  3J8A A;  3FZH A;  1G99 A;  2I7P A;  4FWN A;  3R8E A;  4WQ5 A;  3O08 A;  3MN5 A;  4BG8 A;  3B8A X;  1NGA A;  5ADX H;  5B8H A;  4MO5 A;  2CGJ A;  5JLF A;  5BPN A;  3CJC A;  1BDG A;  3AAR A;  1HKC A;  2P9K B;  4DB3 A;  1NMD A;  2E1Z A;  1HKB A;  2CH5 A;  5AZI B;  1YAG A;  3CJ7 A;  3QB0 A;  4Y0W A;  4FWR A;  4E1J A;  4IO8 A;  4CBU A;  1BA0 A;  4H0X B;  4CZK A;  4MLE A;  1OKJ A;  3M6G A;  3VGL A;  1GLD G;  3VET A;  2E8A A;  2VCP A;  3GDQ A;  3GBT A;  4GY2 B;  2J4R A;  3MN9 A;  4BRE A;  3DAW A;  5AQV A;  5EXW A;  2GUP A;  4DHY A;  4JNE A;  2D1K A;  2D0P A;  2OAN A;  1NGD A;  1U2V B;  1SAZ A;  1ZBS A;  2CGL A;  2FF6 A;  5EOY A;  3TU5 A;  5BRF A;  1GLE G;  3UKR A;  5AQM A;  5KPT A;  2A40 A;  5AQJ A;  1BO5 O;  3ZET B;  4H5R A;  3VEW A;  3VF4 A;  1BA1 A;  4IWV A;  3IMX A;  4L3Q A;  5FPM A;  4JHD B;  3CHW A;  5AQF A;  2HF3 A;  3C7N A;  2FXU A;  3EKS A;  1ZXO A;  2D4W A;  3SK3 A;  4BVO A;  5BR9 A;  4AM6 A;  2AA4 A;  5FPD A;  4B1Z A;  4MLH A;  4K42 A;  5AFU H;  2KHO A;  2E2P A;  2Q1N A;  2F9T A;  3VEO A;  1X9J A;  2Q97 A;  5AQG A;  3KZB A;  3W3D A;  3O80 A;  3KVG A;  4BGA A;  3IFR A;  4BVP A;  2A42 A;  1MDU B;  2YCH A;  3ENH A;  2YHY A;  3TPQ A;  2GWJ A;  1JCE A;  1XUP O;  3I8B A;  4XEI A;  3FZM A;  4CZF A;  4DQ8 A;  2FSK A;  4FWQ A;  1MWM A;  4BC5 A;  4PL7 A;  5BRH A;  4BRL A;  4FL9 A;  3CJA A;  4WQ5 C;  1T44 A;  1LCU A;  4BG9 A;  2A41 A;  2Q31 A;  3A5O C;  4H5V A;  3FZF A;  3QFP A;  5BPM A;  4IXC A;  3DXM B;  2P9U A;  3U4L A;  1DGK N;  4BR0 A;  2GEM A;  4YDU A;  4H5W A;  5AQS A;  3GL1 A;  4BC4 A;  2Q0R A;  3O5B A;  5CE3 A;  1T6D A;  4F9O A;  1MA9 B;  1IG8 A;  1GLC G;  5BN8 A;  3H3N O;  3MMV A;  5ADX A;  3FLC O;  3UKU B;  4FWK A;  4RCH A;  3WXJ A;  3ZET A;  4BRQ A;  2GTD A;  4YDU C;  1V4S A;  5AQH A;  5AFU A;  3GOI A;  3LM9 A;  1KXP A;  4PKG A;  3F9M A;  4BRO A;  2W41 A;  5KPZ A;  2E2O A;  4AM7 A;  4B1Y B;  2HOE A;  1HJO A;  1NGF A;  4CZG A;  2E1Y A;  4B1X B;  4BQZ A;  1HLU A;  1RFQ A;  1WOQ A;  3CQY A;  3LDQ A;  3MDQ A;  4I6M A;  4PL8 A;  3JS6 A;  3ULE B;  1QZ6 A;  3AAP A;  3QBX A;  4BRG A;  2QWM A;  3FR0 A;  3W0L A;  4CZL A;  2QXL A;  1HX1 A;  4BRC A;  2ZGY A;  4WQ4 C;  2BTF A;  5AQK A;  4GNI A;  1E4F T;  3CI5 A;  4BC2 A;  2Q36 A;  3D2F A;  5AQN A;  5AZI A;  3VF2 A;  5BPL A;  4O8K A;  4K25 A;  1X3N A;  4B9Q A;  5AQL A;  4QS7 A;  3L6Q A;  1NGJ A;  3EO3 A;  3WT0 A;  5AQW A;  4XH1 A;  1EQY A;  1NGG A;  2ASM A;  4CZM A;  3FZK A;  5E84 A;  2QM1 A;  4RWT A;  2QWP A;  3SMS A;  3EL2 A;  1NWK A;  2P9N B;  4BR5 A;  3D2E B;  4H0O A;  5F0X A;  2A3Z A;  4FOE A;  5F1X A;  3BF3 A;  4JD2 A;  2IIR A;  4IZ9 A;  3O4W A;  5AQI A;  1E4G T;  2BUP A;  2IVP A;  1KAZ A;  1NGI A;  4ISE A;  4BR4 A;  2PBD A;  2YJE A;  3LDP A;  3ULE A;  1QZ5 A;  1Z6R A;  4JAX A;  2H3G X;  3MN6 A;  4XH4 A;  4BRP A;  1LOT B;  5JIC A;  4PKI A;  3M3Z A;  5AR0 A;  3CJ1 A;  1K8K B;  4FWM A;  4BQL A;  3ENO A;  3ID8 A;  1HPM A;  1NGC A; 
#chains in the Genus database with same CATH topology
 3LDS A;  1S9E A;  3TI0 A;  3MK6 A;  1XC9 A;  1J6Z A;  4ILG B;  3BZC A;  1X3M A;  2QW9 A;  3SJH A;  4NLB A;  4FJI A;  2NNW A;  1K8A O;  1IKV A;  4FLX A;  3NH1 A;  3MEG A;  3HPG A;  4KRF A;  5GIO A;  2BH1 A;  3SBG A;  5HBM A;  1HNX K;  4DR7 K;  1TK8 A;  4Z94 A;  3J7Y P;  3ENB A;  4HUG A;  4MQ3 A;  4FO0 A;  4U67 L;  1WB9 A;  3HZ6 A;  4RTF D;  4CJ3 A;  2F7T A;  3ZEU B;  4WYB A;  4LFB K;  1UA1 A;  2Q3S A;  1S9G A;  3AVN A;  3HBT A;  4HTL A;  2HBJ A;  1KVC A;  3ITH A;  4DMN A;  1NGB A;  4KH6 A;  4A5A A;  3OYM A;  4G1Q A;  5AQX A;  4KH4 A;  4FVU A;  2VYP A;  3EN9 A;  4B1W B;  1ASV A;  4M42 A;  3SUQ A;  1EET A;  1F21 A;  4CJV A;  4OPK A;  2W6L A;  4Y1D A;  4J2B A;  4M63 C;  4B9N A;  1OVY A;  1LWF A;  1KSP A;  4EIA A;  3OYJ A;  2HHV A;  3C7N B;  1VQL N;  4BRN A;  1CZB A;  3E9L A;  3H3O B;  4F8R A;  2FBV A;  1IBM K;  1RDA A;  4JD2 B;  2G8K A;  1SL2 A;  1KC8 O;  3OYF A;  4RW8 A;  2GEL A;  4B9V A;  3QDK A;  1T6C A;  4ILH A;  3OY9 A;  3E66 A;  2D0O A;  3A0I X;  4LF9 K;  1TKT A;  4CD1 A;  3EE8 A;  4N5S A;  4DU1 A;  2F8T A;  4CHZ A;  3BDP A;  1VSE A;  3LL3 A;  3ZT0 A;  4CF8 A;  2ITM A;  4CED A;  4GVM A;  3RMD A;  4JI4 K;  4DTU A;  5BN9 A;  1NK5 A;  3A5N C;  1WSF A;  2G8V A;  1D4X A;  1RT7 A;  3QIC A;  3S9H A;  4HWI A;  5C12 A;  4ELV A;  3AO2 A;  4DSI A;  1ZBL A;  4JKD A;  3K5L A;  1UA0 A;  1SZ2 A;  1SV5 A;  2P9S B;  3CQX A;  3VQQ A;  1SKR A;  3NGY A;  4AHT A;  2E2Q A;  1L3T A;  3ZT1 A;  5HLF A;  3DYA A;  1KCF A;  1U4B A;  1WSJ A;  3HVR A;  3R9P A;  4BRD A;  4EFH A;  5LMU K;  4B9M A;  3EZW A;  3QO9 A;  5CZ2 A;  2NZT A;  1B9D A;  1IG9 A;  1BOT O;  3SYZ A;  2A1R A;  2HNY A;  1NKC A;  3I55 N;  1CXU A;  1TVR A;  2NLX A;  1NNE A;  4BE2 A;  3DOL A;  1DTT A;  2G8F A;  4IOC L;  3VGM A;  1T05 A;  4FM2 A;  4BRA A;  2X74 A;  3BP8 A;  4KO0 A;  4UY8 O;  2DTU A;  4HHT A;  4ELU A;  4CHY A;  4B1V A;  3Q7C A;  3LP2 A;  4I9L A;  4FCY A;  4CJT A;  5HL7 L;  4LH4 A;  2WFB A;  1RT6 A;  5AQY A;  3KK2 A;  1KFD A;  4R5P A;  3VF6 A;  4IOA L;  3FZL A;  3VQ4 A;  1NU0 A;  2VWB A;  2G8W A;  3THW A;  3ZX2 A;  1GLL O;  2F9W A;  4FZZ A;  3PSF A;  3A5L C;  4DR5 K;  2HHS A;  2QWL A;  1BQN A;  2EX3 A;  3TAQ A;  2OPQ A;  3HO1 A;  2YKN A;  3P83 D;  2A6A A;  3M8P A;  3K5O A;  4KBO A;  4YFU A;  2E2N A;  3BUZ B;  3RSE A;  4W5N A;  1Q8I A;  4B9L A;  1Q86 O;  4DSE A;  3CC7 N;  3JSM A;  1Q81 O;  3RSE B;  2JWL A;  4BRH A;  2CH6 A;  2P9K A;  1HMV A;  5GAG P;  1QQO A;  4DV1 K;  3VA0 A;  1GOC A;  5TKY A;  1P8Z A;  5C15 A;  4KI6 A;  3FFI A;  1HNI A;  3THX A;  1VSJ A;  1TV6 A;  1YF5 L;  5I3U A;  3CCJ N;  4CZE A;  1ASU A;  2UXB K;  5E26 A;  1TUY A;  3L2U A;  3CM5 A;  4FLT A;  3ZEU A;  2RHK A;  1ZBF A;  1BCO A;  3H1V X;  2UU9 K;  2X78 A;  3NDK A;  4XH5 A;  1J5E K;  3WNG A;  2YJF A;  4A5B A;  3OYB A;  1V4T A;  4G9Z A;  2W40 A;  2DY4 A;  5AQO A;  3L2R A;  3CER A;  3MX2 A;  4CF1 A;  5C2F A;  3HM8 A;  1KLM A;  3IUC A;  4EZ9 A;  4Z4E A;  4FWN A;  4WQ5 A;  4FJK A;  3AA3 A;  2CGJ A;  4FVM A;  5JLF A;  3J81 O;  2B4J A;  4PUO A;  4JKB A;  1HYV A;  3HRG A;  2HHW A;  3O9R A;  3C94 A;  3TAN A;  3VQ5 A;  3QEP A;  2CH5 A;  3CJ7 A;  3QB0 A;  4Y0W A;  2G8U A;  4FWR A;  4CHQ A;  5SWM A;  3ZSQ A;  1BA0 A;  4HTU A;  4CZK A;  3M6G A;  3SQ2 A;  3VET A;  4JKC A;  4KHU A;  2P5G A;  2XY8 A;  4DTX A;  4JI3 K;  3MN9 A;  4YOT A;  1QHT A;  5EXW A;  3M8Q A;  3TTD A;  2D0P A;  2OAN A;  1U2V B;  5BRF A;  5EOY A;  3TU5 A;  4AHV A;  3NVK A;  4CEC A;  1U48 A;  5KPT A;  5AQJ A;  3VEW A;  3HVT A;  1X9W A;  2F8S A;  2FBX A;  2PFU A;  5FPM A;  4OGC A;  1SKW A;  1D8Y A;  5AQF A;  2P1J A;  3CM6 A;  3IG1 A;  2FXU A;  3EKS A;  3V4I A;  3OYN A;  5FPD A;  4YOV A;  1A5V A;  4K42 A;  2E2P A;  3NCI A;  4CEB A;  5JVH L;  1O1W A;  3W3D A;  3PX6 A;  3O80 A;  4I2P A;  1BQM A;  1HRH A;  3KVG A;  4EP4 A;  3IFR A;  1SL0 A;  1L3U A;  2PYJ A;  3O9U A;  1MDU B;  3ENH A;  2GWJ A;  4CZF A;  3RWU A;  4OPA A;  4FL9 A;  3OYE A;  3HOT A;  4B3T K;  1CLQ A;  4WQ5 C;  5HRO A;  4B9T A;  1VQ9 N;  2Q31 A;  2XHB A;  3O3G A;  3FZF A;  3KKS A;  3QNO A;  4IXC A;  4KTZ A;  1TKZ A;  2YNG A;  4BDP A;  4I9Q A;  4YDU A;  1KTQ A;  4H5W A;  4YHH K;  4IG0 A;  3LAK A;  4DTO A;  4KTW A;  4JS4 A;  3TWH A;  3O9Q A;  1T6D A;  1MA9 B;  5BN8 A;  1JJ2 M;  3H3N O;  4H8K A;  3FLC O;  3UKU B;  4RCH A;  1TAQ A;  4BWJ A;  4YNQ A;  2O8E A;  3ZSW A;  2B5J A;  2GTD A;  3OYG A;  4CJP A;  3MWP A;  3DLL L;  2BAN A;  4KAZ A;  1SKS A;  3F9M A;  4C1N K;  3MX5 A;  4AM7 A;  4B1Y B;  2D5R A;  4HUE A;  4Z4C A;  1X9M A;  3TSQ A;  1LW0 A;  4PL8 A;  1T7P A;  3MDQ A;  3V1O A;  3G4S N;  1QZ6 A;  1VSK A;  4CJW A;  4CGJ A;  3NF6 A;  4K8Z A;  2OTJ N;  4FM1 A;  3M5R A;  4CZL A;  3W0L A;  1FXX A;  2QXL A;  2ZGY A;  3QEW A;  1E4F T;  2Q36 A;  3OYI A;  5BPL A;  1ZBU A;  3AVH A;  3TAP A;  1RDU A;  4O8K A;  5AQL A;  4CIG A;  4XH1 A;  4DV4 K;  1RT2 A;  2O4G A;  3QNN A;  4AF1 A;  1VQO N;  2P9N B;  5F0X A;  5H1S Q;  3N4Q A;  3PIO L;  4JD2 A;  4IFV A;  2OCE A;  4IZ9 A;  5SZT A;  4KI4 A;  1VK0 A;  1BIU A;  1FK9 A;  1KAZ A;  3CC2 N;  3CCQ N;  3PUF A;  3K5N A;  3G0Z A;  4K0K K;  3ULE A;  1Z6R A;  2YNH A;  4EP5 A;  3SZ2 A;  1N36 K;  5JIC A;  4WF9 L;  4PKI A;  5AR0 A;  1K8K B;  1VSF A;  3ENO A;  2WC9 A;  1S1U A;  1HNZ K;  3SQ4 A;  5J2Q A;  4LSN A;  4EAH D;  3QET A;  3F2K A;  1RBS A;  4X62 K;  3M1F A;  4RW6 A;  1HJR A;  4H0P A;  3QFU A;  3EEQ A;  4FSV A;  2X6N A;  3K58 A;  5TKW A;  4CGD A;  1DLO A;  4AIL C;  3VEN A;  3AVI A;  3U6F A;  2VG6 A;  1ITG A;  2HND A;  1NBW A;  4JK7 A;  1YJ9 N;  3HXM A;  3O4N A;  3QIO A;  3PO4 A;  3ZX3 A;  2HHX A;  3K9K A;  4N41 A;  3ZT2 A;  1C0T A;  1MU2 A;  5ELZ A;  1S1X A;  3P4I A;  2YHX A;  4EHT A;  1WLJ A;  1QSL A;  2PAV A;  1BL3 A;  1RGI A;  2FF3 B;  3WNF A;  3L2W A;  2ZWH A;  3LDL A;  4JHD A;  2P51 A;  3FGU A;  4A59 A;  3CFR A;  3OYA A;  1VSM A;  1YTA A;  5AQP A;  1XMQ K;  2WBN A;  3VA3 A;  1U6Z A;  2P9P B;  4M7X A;  1XNR K;  4ID1 A;  1S3X A;  3KJV A;  3ZYY X;  2P9I A;  2GX9 A;  1R59 O;  3LDN A;  4A62 A;  4CFA A;  3NE6 A;  3IDH A;  4AHS A;  1Q7Y O;  4DUZ K;  3A8Y A;  1KAY A;  4FJN A;  4RW7 A;  2ZGZ A;  2O4I A;  1TK0 A;  4E19 A;  1WSG A;  4LF4 K;  3R3L A;  5C25 A;  1ZYQ A;  2HW3 A;  4CZH A;  4F2S A;  4HVJ A;  2G8H A;  2FLO A;  3CIP A;  1NGH A;  1X1P A;  3V1R A;  4EHU A;  5BRD A;  5HOO A;  1MWK A;  4DF4 A;  3L3V A;  2NRT A;  2VQF K;  4FLZ A;  3HTV A;  3B6O A;  1N32 K;  1JCF A;  2IS3 A;  1C0G A;  1SS6 A;  1XWL A;  3DLR A;  2W42 A;  3WEE A;  4KV8 A;  4FLV A;  4OGE A;  4FZY A;  3RRH A;  3KK7 A;  3PO5 A;  2IDO A;  1BIS A;  3Q7B A;  2IVN A;  4FW1 A;  3MXJ A;  2P9U B;  4CER A;  3CCU N;  4H5T A;  3VMF B;  3SCX A;  3ZSO A;  2HB5 A;  3ATU A;  1NGE A;  4M7Y A;  4M3Y A;  1OH5 A;  3TR8 A;  4NCA A;  4W5R A;  1G15 A;  1HUX A;  3SAG A;  4M3W A;  1LV5 A;  1C0M A;  3RTV A;  4DWI A;  4CHN A;  4DR6 K;  1VQ7 N;  3VEY A;  4JLH A;  4CJ5 A;  3LPT A;  4BR2 A;  4YOR A;  1JKH A;  3JXU A;  3HT3 A;  3C0B A;  4BRI A;  5KGX A;  5AJ3 K;  3CJB A;  4LD0 A;  1TKX A;  1IBK K;  3AO4 A;  1HNW K;  1RDB A;  3SI6 A;  3C6H A;  5DK5 A;  1FKO A;  4QCL A;  4NXN K;  4CK2 A;  3UE5 A;  3RR8 A;  1Z05 A;  4CJL A;  1XMO K;  3ASM A;  4ZHR A;  1VQ5 N;  5KI6 A;  4CJK A;  3AVK A;  3DRS A;  3VQ8 A;  4ICL A;  2ETJ A;  4QS8 A;  3QML A;  3ZT3 A;  2Q0U A;  3S3N A;  4F2R A;  4FJH A;  1QQN A;  4BAC A;  3AVM A;  4Y1C A;  3O8M A;  4NLC A;  3AY9 A;  1XHX A;  2E4L A;  4MDA A;  3WXI A;  4O0J A;  1RIL A;  1N8R O;  1N6Q A;  3VES A;  4BRM A;  1U2V A;  1SQK A;  2E20 A;  2QWN A;  1YT3 A;  1FJG K;  1BWF O;  4BE0 A;  2YNI A;  4CHP A;  3HPO A;  5IWA K;  3CG7 A;  1XI1 A;  1K73 O;  3H1Q A;  1NK9 A;  2Z1I A;  2QWO A;  2OA8 A;  1S6P A;  2P9I B;  1W9H A;  3FE1 A;  2E88 A;  2QK9 A;  3ZLJ A;  3AVF A;  4M3U A;  2YI1 A;  3HI0 A;  3DXM A;  3VER A;  1SL1 A;  1Q18 A;  1L3V A;  3F5T A;  3VQP A;  3WXL A;  3LDO A;  1VSL A;  2VG7 A;  4O55 A;  3S3O A;  3L0Q A;  3G6E N;  4WFN L;  3CFO A;  4CGI A;  1IKW A;  3HM9 A;  1I39 A;  5F2R A;  3QBW A;  4UQG A;  4J2D A;  2KQ2 A;  1IV0 A;  3KLE A;  1WN7 A;  5KQ8 A;  3WEE B;  3QIP A;  5FRN A;  1C0U A;  4CZI A;  4JI0 K;  2X6S A;  1ZC6 A;  2WUS A;  4JN4 A;  3VOV A;  4DS5 A;  3MEE A;  2P9P A;  1VHX A;  5CYQ A;  3J8A A;  3FZH A;  2I7P A;  4CEQ A;  3O08 A;  3OBY A;  3MN5 A;  4DFJ A;  5J2P A;  3B8A X;  5ADX H;  3QEX A;  1TK5 A;  4X64 K;  4AHU A;  4CEO A;  4FW2 A;  3QEV A;  5BPN A;  2E5L K;  4E7K A;  3AAR A;  3NF8 A;  4DB3 A;  4LF5 K;  1HKB A;  3OYC A;  4OX9 K;  3OJS A;  4OPJ A;  4IO8 A;  1OKJ A;  1WSE A;  3VGL A;  2O8F B;  2HHU A;  2XO7 A;  2HMI A;  3OYH A;  3GDQ A;  1JLF A;  3ISN C;  3WNE A;  2J4R A;  2R7Y A;  4CFD A;  3CCM N;  1JL1 A;  2GUP A;  4KPY A;  4JNE A;  3TSU A;  1NGD A;  3AVG A;  2FF6 A;  5AQM A;  4GW6 A;  3P31 A;  1QSS A;  5M1F A;  1QVF M;  1NK4 A;  2GUI A;  4FK4 A;  1JXB A;  4IWV A;  1NG9 A;  4KHY A;  1ZXO A;  3C6U A;  2D4W A;  5M1P A;  4N56 A;  1IH7 A;  4B1Z A;  4MLH A;  4I2Q A;  3PLA A;  3NHG A;  3VQD A;  2O8D B;  3VEO A;  3VTH A;  2Q97 A;  5HRN A;  1OH6 A;  3MXI A;  3PX0 A;  3HOS A;  4BVP A;  1L3S A;  3EE9 A;  2GV9 A;  4Z4G A;  2PZS A;  1LWC A;  4OO1 J;  3FZM A;  4FWQ A;  4CGG A;  4NCG A;  5FRO A;  5J2N A;  4HCC A;  5LL6 Z;  3T7Z A;  3RVC A;  3ZSY A;  4BG9 A;  1I94 K;  3ZSV A;  2A41 A;  3A5O C;  2OZM A;  4DS4 A;  2VG5 A;  5BPM A;  2D0B A;  2P9U A;  1DGK N;  4GV6 A;  4CJU A;  4CJS A;  3SUN A;  3THY B;  1OH7 A;  3ALY A;  1B92 A;  2OPP A;  4BC4 A;  1WBD A;  2HVI A;  3O5B A;  3RMC A;  5CE3 A;  1GLC G;  4IOX A;  1J53 A;  1KVB A;  3MMV A;  4BY9 C;  3DLH A;  4FWK A;  4CJR A;  3ZET A;  1LWE A;  4CJ4 A;  1C1C A;  3R1X A;  2I5J A;  2E6M A;  3GOI A;  2E6L A;  1EO1 A;  3K2P A;  2HHT A;  5KPZ A;  2Z1G A;  5JS2 A;  2ZJQ L;  4JI8 K;  3OVN A;  4CEE A;  3RMB A;  4CZG A;  4B1X B;  4BQZ A;  1RFQ A;  3NH0 A;  3JS6 A;  1D9F A;  2BDP A;  4MDB A;  3AAP A;  4BRG A;  3KLG A;  2IC3 A;  1JL2 A;  2BGG A;  2QWM A;  4B08 A;  1VSI A;  3FR0 A;  1RDC A;  1HX1 A;  1NKE A;  3D0P A;  2BTF A;  4F3O A;  3F9K A;  4M3T A;  4CF2 A;  5AZI A;  3SV3 A;  5CR4 A;  2BE2 A;  4O44 A;  1M90 O;  2QI2 A;  4QS7 A;  3L6Q A;  4CZM A;  1EQY A;  1B9F A;  3FZK A;  1TKD A;  5E84 A;  4H4O A;  4RWT A;  2XY7 A;  2QWP A;  3A2F A;  4A57 A;  4BR5 A;  3T3F A;  1GOA A;  4FOE A;  5F1X A;  5LMN K;  3O4W A;  1EKE A;  5M1O A;  5AQI A;  3QES A;  2BUP A;  3J7A P;  1RBU A;  2YJE A;  4PWD A;  1RCH A;  4XH4 A;  2YHB A;  4BRP A;  4DSJ A;  3KWG A;  3O3H A;  4DTM A;  3DI6 A;  4DV3 K;  1P90 A;  3ID8 A;  2HNZ A;  3TAF A;  3FFK B;  3ZSX A;  3SMP A;  3TTF A;  1UWB A;  2P9L B;  4BR9 A;  4C8L A;  4BC3 A;  2HBM A;  4K43 A;  4JK9 A;  3HP9 A;  4FJM A;  2JLE A;  2V52 B;  1YVU A;  4JKA A;  1NMN A;  4H0T B;  3CCR N;  3DJC A;  3T1H K;  2F96 A;  1NJX A;  3L4I A;  4CF0 A;  1C6V A;  4BGB A;  4CIE A;  2YHA A;  1QTM A;  4IEI A;  4DQS A;  2ZE2 A;  2A5X A;  1IKX A;  2KKZ A;  2V7Z A;  1HQE A;  4ID5 A;  3TTC A;  2YNF A;  3NF9 A;  4WQ4 A;  1CZA N;  1QVG M;  4JKH A;  5GAH P;  4L8R B;  1NM1 A;  3CC4 N;  4CBW A;  5EVZ A;  1HYZ A;  5HRS A;  1NK8 A;  3ZSZ A;  3MAQ A;  4X65 K;  3SQ0 A;  3DMJ A;  3IAY A;  2Z1H A;  4FWO A;  2DPN A;  2DFE A;  3LP0 A;  5AQU A;  4DTR A;  2IGI A;  4FK2 A;  4LFA K;  3VPZ A;  5GIN A;  3BZK A;  3LZJ A;  1KRP A;  1NKB A;  4KHN A;  4DV7 K;  4E89 A;  4FJ5 A;  2W6K A;  3UB5 A;  2QKB A;  4FYD A;  5BRE A;  4DLE A;  4C8N A;  4CJ7 A;  2XY5 A;  3L2Q A;  3TAG A;  1XC3 A;  1Q9X A;  4DTN A;  1J54 A;  2IOC A;  3VQ9 A;  2FBY A;  4QS9 A;  3S41 A;  1RTH A;  3CJ9 A;  3TSP A;  1J9A A;  3KHY A;  4CJE A;  3H08 A;  1QSY A;  4YOY A;  3O6W A;  2CGK A;  3WQU A;  4LF8 K;  4Z0U A;  4F4K A;  1BG3 A;  3VQC A;  5LJW A;  3O9T A;  3PIP L;  1ATS A;  4OKK A;  1HKG A;  1VQM N;  3PSI A;  4M45 A;  3VQB A;  2VWK A;  4LC9 B;  1RDW X;  1NK6 A;  4LF6 K;  5EY4 A;  3SNN A;  3V1Q A;  2NRZ A;  1U47 A;  1S5J A;  4O4G A;  1OVQ A;  1RTJ A;  5KRS A;  3HK2 A;  4AHC A;  3VQ6 A;  2UUA K;  2HF4 A;  3AA2 A;  4RW4 A;  4X66 K;  3OTO K;  3DXK A;  1D5A A;  1R0A A;  3HSC A;  1VSD A;  5HP1 A;  3G10 A;  5GAD P;  2O8F A;  3MED A;  3AAQ A;  3V9X A;  3SAH A;  3V9W A;  1C1B A;  1SUQ A;  5AQR A;  4JKG B;  1ZBH A;  4CD3 A;  5KPR A;  1N33 K;  1C0F A;  1BI4 B;  1EX4 A;  3NAE A;  3UKR B;  2HST A;  5HRR A;  4DFK A;  1ATR A;  1S1T A;  4KRE A;  1YJW N;  4QAG A;  3CME N;  1BHL A;  2ASP A;  5JVG L;  2NRH A;  4E3S A;  1QS4 A;  4CBX A;  5C42 A;  1BUP A;  3VGK A;  4BR7 A;  4YOW A;  4C8O A;  1KFS A;  2AJQ A;  3CPW M;  1K8K A;  2ZF5 O;  1HYS A;  4DFP A;  1JLE A;  3GG4 A;  4IKF A;  4W5T A;  5EU7 A;  5C10 A;  3V9Z A;  1YUW A;  3EKU A;  3JYT A;  1HNV A;  4GVE A;  5KQD A;  4EZ6 A;  4GKJ K;  2ZD1 A;  5FDL A;  3AV9 A;  2KZZ A;  3HST B;  3AGR A;  4TSX A;  5AQZ A;  4N76 A;  3VN5 A;  3D2F B;  4JV5 K;  4AHR A;  3DLK A;  1DT9 A;  5CYM A;  1DEJ A;  1H1V A;  4A2A A;  3DLB A;  1DTQ A;  2ASO A;  4ISF A;  1TUU A;  3BGR A;  3LAL A;  1TGO A;  1NK7 A;  2KW4 A;  2AP1 A;  3D2E A;  2D0C A;  3KLH A;  4FPB A;  4IJA A;  4CVN E;  4B1U B;  5LJV A;  4WFB L;  3KKR A;  2I7N A;  4A61 A;  4NCB A;  3OYD A;  2P9L A;  2Q2R A;  2QXF A;  4DSL A;  4FWL A;  5AZJ B;  4A2B A;  3U3Y A;  1YI2 N;  1KAX A;  4IJN A;  4J2A A;  1XHZ A;  3U3G A;  4RG8 A;  3UKU A;  3L3U A;  4B9S A;  3O1W A;  2GBZ A;  1RTI A;  5EX5 A;  2RE2 A;  4CF9 A;  4E0D A;  3O1B A;  5JMV A;  1QHA A;  1YVN A;  1GLB G;  4JRP A;  4CK3 A;  2IAJ A;  2HBK A;  1RTD A;  4M3R A;  4JKG A;  3U8X A;  2KFZ A;  4DV6 K;  3KLF A;  4V19 S;  1WAF A;  1UAX A;  4H4M A;  4MO5 A;  4DV0 K;  4DLG A;  1BDG A;  1HKC A;  1HQU A;  3OS1 A;  2P9K B;  3NVM A;  3E1Y A;  2E1Z A;  4JYA K;  5AZI B;  4XIU A;  3IRX A;  4CBU A;  2XY6 A;  1U49 A;  1N5Y A;  2E8A A;  2VCP A;  3P1G A;  1HPZ A;  3T1A A;  3MXM A;  4BRE A;  5AQV A;  3J80 O;  3JAM O;  3QLH A;  4JEP A;  4U7B A;  1L5U A;  4DHY A;  4KFB A;  2D1K A;  1ZBS A;  1T8E A;  1TL1 A;  2NRW A;  3T19 A;  2A40 A;  1BO5 O;  3ZET B;  1GOB A;  1REV A;  5BR8 K;  4L3Q A;  3CHW A;  1NOY A;  4KKO A;  1NJW A;  2HF3 A;  1VQN N;  4Q5V A;  3SK3 A;  4C8M A;  3AA5 X;  2HVH A;  4AM6 A;  2AA4 A;  5C2D A;  3VTI A;  4B3R K;  2F9T A;  1U04 A;  1D9D A;  4FJ9 A;  4FK0 A;  3LWL A;  1RBV A;  2LSN A;  3LWM A;  1VQ8 N;  3DM2 A;  4FXD A;  4B3S K;  4BGA A;  4O5B A;  3SUP A;  1M1K O;  2A42 A;  4CEZ A;  2KTQ A;  2FC0 A;  2YHY A;  1JCE A;  4DQ8 A;  1MWM A;  1RDD A;  1EWQ A;  4PL7 A;  5BRH A;  4BRL A;  1JLA A;  1Q82 O;  3T1Y K;  3CJA A;  3L8B A;  4DV5 K;  3K59 A;  1LCU A;  3P38 A;  1RBR A;  4H5V A;  3DRR A;  3TAR A;  1WSI A;  3DXM B;  2O8B B;  3U4L A;  4AH9 A;  4BR0 A;  3J7Z O;  3WXM B;  4KHW A;  1QQC A;  5KTQ A;  3VQA A;  4CFB A;  3VQE A;  4Q0B A;  5AQS A;  3GL1 A;  2Q0R A;  3D6R A;  1FW6 A;  1C1A A;  4C1N I;  2HHQ A;  1VRT A;  2O8D A;  4F9O A;  1WSH A;  1Z26 A;  4MFB A;  1LAV A;  3WXJ A;  4DR3 K;  1UOC A;  3KTQ A;  4YDU C;  3O3F A;  5AQH A;  4PHT X;  5AFU A;  3LM9 A;  4FJJ A;  4PKG A;  2DFF A;  4ILJ A;  4BRO A;  2W41 A;  1E3M A;  2OTL N;  4DFM A;  1YIT N;  3NGI A;  1HJO A;  1NGF A;  2E1Y A;  4YOU A;  1HLU A;  1WOQ A;  3CQY A;  3LDQ A;  1LAW A;  3RR7 A;  1IO2 A;  1VAZ A;  3CYM A;  4DQI A;  4B9U A;  1Y97 A;  4BRC A;  3ZCM A;  3LAM A;  2YX6 A;  4WQ4 C;  1LW2 A;  4GNI A;  4JI7 K;  3CI5 A;  3OBW A;  5AQN A;  3VF2 A;  2PYL A;  4K25 A;  4HUF A;  3CCE N;  4B9Q A;  3K57 A;  4M3Z A;  2ZJR L;  3EO3 A;  3TAM A;  2ASM A;  4CK1 A;  2QM1 A;  3PV8 A;  3SMS A;  3EL2 A;  4JKF A;  2QTD A;  4FJG A;  2QKK A;  3D2E B;  1A5W A;  3BF3 A;  5M1K A;  2OPS A;  3KWI A;  3E9O A;  3KD1 E;  3AVB A;  4PA1 A;  4DR1 K;  3NBP A;  4BR4 A;  3CD6 N;  4BDY A;  3QEI A;  2PBD A;  3LDP A;  1QZ5 A;  4JAX A;  2H3G X;  3IKM A;  3E9P A;  1YTU A;  3O4Q A;  3I0R A;  1K6Y A;  3M3Z A;  4BQL A;  1TL3 A;  4OLB A;  4DTP A;  1NGC A;  4CCH A;  2UUB K;  4FJ8 A;  1GLF O;  1W7A A;  1Q9Y A;  3GE1 A;  4DR2 K;  4E7H A;  1OH8 A;  1JLB A;  4IFY A;  2B6A A;  3QER A;  5AZJ A;  4WE1 A;  5DM7 L;  1EWR A;  3PY8 A;  1Y64 A;  3VEV A;  3HYF A;  2QWR A;  4CEF A;  2ZM6 K;  1WBB A;  4DQR A;  4M3X A;  1ILY A;  3VEX A;  4C8K A;  4OKE A;  4FLW A;  3WUH A;  2RPI A;  2FSJ A;  2FBT A;  3LAN A;  2EHG A;  1CZ9 A;  3HJF A;  1IKY A;  1S6Q A;  4FWP A;  1DKG D;  3QIN A;  3SAF A;  1U45 A;  2P9S A;  4B3O A;  5I42 A;  4PQU A;  4Z4F A;  2V51 B;  1NJZ A;  4DG1 A;  1T03 A;  4OVL A;  1J5O A;  4AQY K;  5I9E B;  1JXE A;  1BI4 A;  1VRU A;  4DCH A;  1I3A A;  2JWK A;  3LPU A;  4BE1 A;  5C24 A;  3VEZ A;  3CFP A;  3V6D A;  3OA9 A;  2HHH K;  3KIO A;  3BEX A;  1S72 N;  2Y1J A;  5AQQ A;  4OKJ A;  3WNH A;  1NK0 A;  2FSN A;  4DSK A;  4NO7 A;  3DXK B;  1GLA G;  3ZX0 A;  2OPR A;  4JS5 A;  3DLE A;  4KHP K;  3ZSR A;  1WAJ A;  3LM2 A;  3MCA B;  4O5F A;  1YXQ A;  2VWJ A;  3M8R A;  3U9D A;  3U9Z A;  2UYT A;  4PKH A;  2V7Y A;  1JLG A;  1RNH A;  5FRM A;  1ZBI A;  4Z4H A;  4DSF A;  5IT9 O;  3CMA N;  5LY3 A;  3KD5 E;  4KB0 A;  5C0Y A;  1KLN A;  2QEX N;  1NLV A;  3SPZ A;  3H6E A;  1YHQ N;  3EYZ A;  1ATN A;  4DTS A;  1QQM A;  3PX4 A;  4Z4I A;  3H45 C;  1ASW A;  4R79 A;  1KQS M;  3CXC M;  1HR0 K;  3CET A;  1BU6 O;  3G25 A;  5CY4 A;  5FPE A;  3OYL A;  5FPN A;  4NYF A;  1GLJ O;  1K9M O;  4FJX A;  1BGX T;  3ID6 A;  4J8F A;  3OS0 A;  3NH2 A;  4FM0 A;  4H0V B;  3RMA A;  3CCS N;  4FOI A;  3K9J A;  3DWL A;  3WQT A;  3AVC A;  4K41 A;  3D7E O;  2HMP A;  4KTQ A;  5GIP A;  5J1E A;  5DM6 L;  2P9N A;  2IVO A;  3M8S A;  3MN7 A;  1YJN N;  3WXK A;  4DV2 K;  3TAE A;  3N4P A;  3KK3 A;  3LZI A;  3R6M A;  5JLH A;  4FWS A;  2EWS A;  2Y1I A;  2YHW A;  1TYQ B;  2YKM A;  4LSL A;  2RN2 A;  2KFN A;  2O8C B;  4GMJ B;  4BRK A;  3ATV A;  2WON A;  3L2V A;  4LH5 A;  1TYQ A;  5AQT A;  3B6P A;  3OYK A;  1WUA A;  4ISG A;  5FLX O;  3OS2 A;  3BF1 A;  4CES A;  1VQ4 N;  3SLC A;  4DQQ A;  2G8I A;  1XQS C;  1IJJ A;  4HCB A;  1BCM A;  1RT5 A;  4YOX A;  4J2E A;  1X9S A;  1ESV A;  3MCP A;  4CZJ A;  2OYQ A;  2KLA A;  3OHR A;  4DU3 A;  3H46 O;  1JCG A;  1O13 A;  4H03 B;  3I56 N;  3THX B;  3DRP A;  3I8D A;  2GWK A;  4RW9 A;  2ITG A;  3F73 A;  1VSH A;  3HPH A;  2QA4 N;  4BRF A;  4CEA A;  2UXD K;  3C6A A;  1VQ6 N;  1CXQ A;  3DLG A;  4I6M B;  4ZTJ A;  3SV4 A;  4ZTF A;  4C23 A;  4CGH A;  4MO4 A;  4K8X A;  2WTU A;  4E7L A;  4CI6 A;  4FJ7 A;  3CPE A;  3SJJ A;  1Z25 A;  4JI1 K;  3AVA A;  4FPA A;  3ULD A;  3I33 A;  3K0S A;  2VGM A;  3TAB A;  4DUY K;  4E1M A;  4H0Y B;  2QWQ A;  1NJI O;  3P39 A;  2ZQB A;  1TAU A;  3AO3 A;  3A5M C;  3O9S A;  4H5N A;  3THV A;  5HRP A;  2RKI A;  2XRI A;  4NB4 A;  1S22 A;  2O8B A;  3MWT A;  1G99 A;  4IDK A;  4KHQ A;  3R8E A;  4BG8 A;  5GAE P;  4NYN A;  1NGA A;  3SBT A;  5B8H A;  1NOZ A;  1EP4 A;  3CJC A;  5J2M A;  4DU4 A;  3CCL N;  1NMD A;  2ZJP L;  1RT1 A;  1YAG A;  4LFC K;  4CFC A;  4B3M K;  4E1J A;  4JKE A;  4BDZ A;  4H0X B;  5CHI A;  4MLE A;  1RT4 A;  1GLD G;  5T7B A;  3GBT A;  1EXQ A;  3K5M A;  4GY2 B;  3SPY A;  4N47 A;  5M1Q A;  3DAW A;  2WOM A;  4FLU A;  3MEC A;  4IG3 A;  2F4V K;  4E7J A;  4FJL A;  3AVL A;  1S1W A;  4W5O A;  5BR9 A;  4LF7 K;  4CJQ A;  1SAZ A;  2CGL A;  4BWM A;  1GLE G;  3V9S A;  4IDH A;  4CGF A;  4WCE L;  3THY A;  3UKR A;  4OPH A;  4H5R A;  3VF4 A;  5MLC Q;  1BA1 A;  3KLI A;  3IMX A;  1VQK N;  4JHD B;  2UXC K;  4O8U A;  1KVA A;  4F3T A;  3C7N A;  4IO9 L;  4PY5 A;  4B8C A;  4JI6 K;  3C65 A;  4BVO A;  3V9U A;  2O8E B;  3AGK A;  3D45 A;  2UUC K;  3C95 A;  3IS9 A;  3T69 A;  4M41 A;  3ZT4 A;  5AFU H;  2KHO A;  3SQ1 A;  2Q1N A;  4CW7 B;  3I0S A;  1WNS A;  1X9J A;  5AQG A;  3KZB A;  4JI2 K;  3V81 A;  2VGN A;  3LP3 A;  4DF8 A;  1BIZ A;  3HL8 A;  4KB1 A;  3C6T A;  2YCH A;  3CCV N;  3TPQ A;  1N34 K;  4DKW A;  1XUP O;  4XEI A;  3I8B A;  3UIQ A;  2FSK A;  4BC5 A;  4QOZ B;  4OJR A;  1T44 A;  2PY5 A;  1W97 L;  4IBN A;  1T3V A;  4ELT A;  1W0H A;  3QFP A;  5A2Q O;  3SUO A;  4DQP A;  2VQE K;  4IEE A;  4JRQ A;  2GEM A;  2A1S A;  4JI5 K;  4CJF A;  3THW B;  2NRX A;  2JGU A;  5KRT A;  2NRR A;  3E01 A;  4W5Q A;  1W2B M;  4GV3 A;  1IG8 A;  5ADX A;  3DOK A;  4DTJ A;  4BRQ A;  1JLQ A;  1V4S A;  3NMU A;  2KZM A;  2YV0 X;  2D0A A;  1XNQ K;  5K14 A;  1KXP A;  4E7I A;  4IFE A;  4OLA A;  2E2O A;  4CIF A;  1FKP A;  2HOE A;  5D3G A;  4I7F A;  4NXM K;  1A5X A;  1JLC A;  4I6M A;  1QE1 A;  3ULE B;  4KHS A;  3QBX A;  3OJU A;  3VQ7 A;  3NGZ A;  2NRV A;  1RBT A;  2HBL A;  3HP6 A;  1KD1 O;  3LP1 A;  5AQK A;  3EY1 A;  2RF2 A;  4BC2 A;  3D2F A;  3NFA A;  5KGW A;  3P5J A;  1X3N A;  1IBL K;  4LY7 A;  2Z1J A;  3KK1 A;  2DFH A;  1NGJ A;  3WT0 A;  4DR4 K;  5DMR A;  5AQW A;  3RRG A;  1NGG A;  1VQP N;  3CF5 L;  5M1N A;  3NF7 A;  4FZX C;  1NWK A;  1NJY A;  5JS1 A;  4YY3 K;  4H0O A;  3S3M A;  2ATQ A;  2A3Z A;  1S1V A;  4WFA L;  1YIJ N;  3AO5 A;  2IIR A;  2OZS A;  5CZ1 A;  1E4G T;  2IVP A;  1NGI A;  3AO1 A;  4ISE A;  3G71 N;  3BY5 A;  2O8C A;  4E1N A;  4JK8 A;  2NUB A;  3MN6 A;  4CHO A;  1LOT B;  4GV9 A;  4B8A B;  1RT3 A;  4O0I A;  4GKK K;  3CQ8 A;  4KH5 A;  5E41 A;  3EZ5 A;  3CJ1 A;  4FLY A;  4FWM A;  2P5O A;  1HPM A;  3AA4 A;  3AVJ A;  3L4Q A;  3OW2 M;  4CE9 A; 
#chains in the Genus database with same CATH homology
 4EAH D;  3FFK B;  1GLF O;  3SMP A;  3TTF A;  3GE1 A;  3MK6 A;  3F2K A;  2P9L B;  1J6Z A;  4BR9 A;  4ILG B;  4BC3 A;  5AZJ A;  2HBM A;  3M1F A;  1X3M A;  4JK9 A;  4K43 A;  1Y64 A;  5DM7 L;  2QW9 A;  4H0P A;  3SJH A;  3VEV A;  4NLB A;  2QWR A;  2NNW A;  1K8A O;  2V52 B;  3QFU A;  4JKA A;  4FSV A;  4H0T B;  3CCR N;  5TKW A;  3VEX A;  1ILY A;  5GIO A;  2BH1 A;  3DJC A;  3SBG A;  3VEN A;  3L4I A;  4BGB A;  3WUH A;  2FSJ A;  4Z94 A;  3ENB A;  1NBW A;  4JK7 A;  1YJ9 N;  4FO0 A;  4IEI A;  4U67 L;  2A5X A;  3HZ6 A;  3ZX3 A;  2KKZ A;  4RTF D;  3K9K A;  2F7T A;  3ZEU B;  4WYB A;  2V7Z A;  3HBT A;  4FWP A;  4HTL A;  2HBJ A;  5ELZ A;  1NGB A;  3P4I A;  2YHX A;  1DKG D;  4KH6 A;  3TTC A;  4A5A A;  4EHT A;  4WQ4 A;  1CZA N;  2PAV A;  3SAF A;  2P9S A;  4KH4 A;  5AQX A;  1QVG M;  1RGI A;  2FF3 B;  4FVU A;  2VYP A;  2V51 B;  3EN9 A;  4JKH A;  4B1W B;  5GAH P;  2ZWH A;  1NM1 A;  5I9E B;  3LDL A;  3CC4 N;  4JHD A;  4CBW A;  3FGU A;  4A59 A;  4DCH A;  2JWK A;  5EVZ A;  3VEZ A;  5AQP A;  2WBN A;  3OA9 A;  1U6Z A;  2P9P B;  4M7X A;  4M63 C;  1S3X A;  1OVY A;  4FWO A;  3BEX A;  1S72 N;  2DPN A;  5AQU A;  4EIA A;  3C7N B;  5AQQ A;  2P9I A;  3ZYY X;  2GX9 A;  3E9L A;  4BRN A;  1VQL N;  1R59 O;  3LDN A;  3H3O B;  4A62 A;  3IDH A;  4JD2 B;  1Q7Y O;  3VPZ A;  5GIN A;  1KC8 O;  3A8Y A;  2FSN A;  1KAY A;  4NO7 A;  2ZGZ A;  2GEL A;  3DXK B;  1GLA G;  1T6C A;  3QDK A;  3ZX0 A;  4ILH A;  3E66 A;  3UB5 A;  2D0O A;  3A0I X;  3LM2 A;  3MCA B;  3R3L A;  5BRE A;  4CJ7 A;  4CD1 A;  3EE8 A;  4CZH A;  4O5F A;  1YXQ A;  1XC3 A;  2FLO A;  3CIP A;  1NGH A;  3U9D A;  4EHU A;  5BRD A;  3U9Z A;  1MWK A;  5HOO A;  2NRT A;  2UYT A;  3LL3 A;  4QS9 A;  3S41 A;  3CJ9 A;  3HTV A;  4PKH A;  2ITM A;  1JCF A;  2V7Y A;  3TSP A;  3KHY A;  1C0G A;  1SS6 A;  4YOY A;  3O6W A;  5BN9 A;  2CGK A;  3WQU A;  3A5N C;  3WEE A;  1BG3 A;  1D4X A;  3KK7 A;  3QIC A;  5LJW A;  3CMA N;  4HWI A;  5C12 A;  5LY3 A;  5C0Y A;  3O9T A;  3Q7B A;  1ATS A;  1NLV A;  1HKG A;  3PIP L;  2QEX N;  3H6E A;  2IVN A;  4JKD A;  1YHQ N;  1VQM N;  1SZ2 A;  2P9S B;  3CQX A;  1ATN A;  2P9U B;  1QQM A;  3H45 C;  4H5T A;  1RDW X;  4LC9 B;  3VMF B;  3CCU N;  4R79 A;  5EY4 A;  3CXC M;  1KQS M;  2NRZ A;  3ATU A;  3CET A;  1NGE A;  4M7Y A;  1BU6 O;  3G25 A;  5FPE A;  2E2Q A;  5FPN A;  2HF4 A;  1HUX A;  3SAG A;  1GLJ O;  3DXK A;  1K9M O;  3HSC A;  3ID6 A;  4J8F A;  4H0V B;  3CCS N;  4FOI A;  3R9P A;  4BRD A;  4EFH A;  5GAD P;  1VQ7 N;  3VEY A;  3K9J A;  3DWL A;  3AAQ A;  3EZW A;  4BR2 A;  4YOR A;  3WQT A;  2NZT A;  3JXU A;  3C0B A;  1BOT O;  3SAH A;  4K41 A;  3D7E O;  2HMP A;  4BRI A;  5GIP A;  5DM6 L;  5AQR A;  4JKG B;  2P9N A;  3I55 N;  2IVO A;  2NLX A;  3CJB A;  4CD3 A;  5KPR A;  3MN7 A;  1YJN N;  1C0F A;  3WXK A;  4IOC L;  3VGM A;  3UKR B;  3C6H A;  2HST A;  4BRA A;  3N4P A;  1ATR A;  3BP8 A;  1YJW N;  4UY8 O;  3CME N;  3UE5 A;  3R6M A;  1Z05 A;  5JLH A;  2ASP A;  5JVG L;  2NRH A;  4B1V A;  4FWS A;  1VQ5 N;  3Q7C A;  2EWS A;  4CBX A;  1BUP A;  3VGK A;  4BR7 A;  5HL7 L;  4QS8 A;  4YOW A;  2WFB A;  3QML A;  5AQY A;  2YHW A;  1TYQ B;  2Q0U A;  3VF6 A;  3CPW M;  4IOA L;  3FZL A;  1QQN A;  1K8K A;  2ZF5 O;  4BRK A;  3ATV A;  2VWB A;  1TYQ A;  3GG4 A;  5AQT A;  3ZX2 A;  1GLL O;  2F9W A;  1WUA A;  4ISG A;  3A5L C;  3BF1 A;  3O8M A;  4NLC A;  5C10 A;  1VQ4 N;  3AY9 A;  2QWL A;  3SLC A;  1YUW A;  4MDA A;  3WXI A;  3EKU A;  2A6A A;  1XQS C;  4GVE A;  1N8R O;  1IJJ A;  5KQD A;  4KBO A;  3VES A;  4YOX A;  4BRM A;  2E2N A;  1U2V A;  1SQK A;  1ESV A;  2E20 A;  3MCP A;  2QWN A;  3AGR A;  4CZJ A;  5AQZ A;  3BUZ B;  1BWF O;  3RSE A;  1Q86 O;  3CC7 N;  3D2F B;  2KLA A;  1Q81 O;  3RSE B;  1DT9 A;  3OHR A;  2JWL A;  1JCG A;  1O13 A;  3H46 O;  4H03 B;  2CH6 A;  3H1Q A;  2P9K A;  4BRH A;  1K73 O;  3I56 N;  5GAG P;  1QQO A;  1DEJ A;  1H1V A;  2QWO A;  4A2A A;  5TKY A;  1P8Z A;  5C15 A;  2P9I B;  3FE1 A;  2GWK A;  2E88 A;  2ASO A;  4ISF A;  1TUU A;  1YF5 L;  2QA4 N;  3CCJ N;  4BRF A;  4CZE A;  3C6A A;  3D2E A;  2AP1 A;  2YI1 A;  3DXM A;  3HI0 A;  3VER A;  1Q18 A;  1VQ6 N;  4FPB A;  5E26 A;  4I6M B;  4IJA A;  1TUY A;  3F5T A;  3WXL A;  4C23 A;  4MO4 A;  3LDO A;  4B1U B;  5LJV A;  4WFB L;  3ZEU A;  2RHK A;  2I7N A;  3L0Q A;  3H1V X;  4A61 A;  4CI6 A;  3G6E N;  3CPE A;  4WFN L;  2P9L A;  2Q2R A;  4FWL A;  5AZJ B;  4A2B A;  4XH5 A;  1YI2 N;  1KAX A;  4IJN A;  4FPA A;  2YJF A;  5F2R A;  3I33 A;  4A5B A;  2VGM A;  3QBW A;  3UKU A;  4H0Y B;  1V4T A;  4G9Z A;  2W40 A;  2QWQ A;  3O1W A;  1NJI O;  5AQO A;  5EX5 A;  3WEE B;  5KQ8 A;  2RE2 A;  3P39 A;  3CER A;  3MX2 A;  4CZI A;  3O1B A;  3A5M C;  3O9S A;  5C2F A;  1QHA A;  5JMV A;  1YVN A;  1ZC6 A;  1GLB G;  2WUS A;  4H5N A;  4JN4 A;  3VOV A;  2P9P A;  2HBK A;  3HM8 A;  4NB4 A;  3IUC A;  4JKG A;  3U8X A;  1S22 A;  3MWT A;  3J8A A;  3FZH A;  1G99 A;  2I7P A;  4FWN A;  3R8E A;  4WQ5 A;  3O08 A;  3OBY A;  3MN5 A;  4BG8 A;  5GAE P;  3B8A X;  1NGA A;  3SBT A;  5ADX H;  5B8H A;  4MO5 A;  2CGJ A;  5JLF A;  5BPN A;  3CJC A;  1BDG A;  3AAR A;  1HKC A;  3HRG A;  4JKB A;  3O9R A;  2P9K B;  4DB3 A;  3NVM A;  3CCL N;  3E1Y A;  1NMD A;  2E1Z A;  1HKB A;  2ZJP L;  2CH5 A;  5AZI B;  1YAG A;  3CJ7 A;  3QB0 A;  4Y0W A;  4FWR A;  3TTD A;  4E1J A;  4IO8 A;  4JKE A;  1BA0 A;  4H0X B;  4CBU A;  5CHI A;  4CZK A;  4MLE A;  1OKJ A;  3M6G A;  3VGL A;  1GLD G;  3VET A;  4JKC A;  2E8A A;  2VCP A;  3GDQ A;  3GBT A;  4GY2 B;  2J4R A;  3MN9 A;  4BRE A;  5M1Q A;  3DAW A;  3CCM N;  5AQV A;  4YOT A;  5EXW A;  2GUP A;  4JEP A;  4U7B A;  4DHY A;  4JNE A;  2D1K A;  2D0P A;  2OAN A;  1NGD A;  1U2V B;  1SAZ A;  1ZBS A;  2CGL A;  2FF6 A;  5EOY A;  3TSU A;  3TU5 A;  1GLE G;  5BRF A;  3NVK A;  4IDH A;  4WCE L;  2NRW A;  3UKR A;  5AQM A;  5KPT A;  3P31 A;  2A40 A;  5M1F A;  1QVF M;  5AQJ A;  4OPH A;  1BO5 O;  3ZET B;  4H5R A;  3VEW A;  3VF4 A;  5MLC Q;  1BA1 A;  4IWV A;  3IMX A;  2PFU A;  4L3Q A;  5FPM A;  1VQK N;  4JHD B;  3CHW A;  5AQF A;  4O8U A;  2HF3 A;  1VQN N;  3C7N A;  2FXU A;  3EKS A;  1ZXO A;  4IO9 L;  2D4W A;  5M1P A;  3C65 A;  3SK3 A;  4BVO A;  3AGK A;  5BR9 A;  4AM6 A;  2AA4 A;  5FPD A;  4B1Z A;  4MLH A;  4YOV A;  3T69 A;  3PLA A;  4K42 A;  5AFU H;  2KHO A;  5C2D A;  2E2P A;  2Q1N A;  3VTI A;  2F9T A;  3VEO A;  3VTH A;  1X9J A;  2Q97 A;  5AQG A;  3KZB A;  1VQ8 N;  5JVH L;  3W3D A;  3O80 A;  2VGN A;  3KVG A;  4BGA A;  3IFR A;  3HOS A;  1M1K O;  4BVP A;  3EE9 A;  2A42 A;  1MDU B;  3O9U A;  2YCH A;  3ENH A;  3CCV N;  2YHY A;  3TPQ A;  2GWJ A;  4DKW A;  4OO1 J;  1JCE A;  1XUP O;  3I8B A;  4XEI A;  3FZM A;  4CZF A;  4DQ8 A;  2FSK A;  4FWQ A;  4OPA A;  1MWM A;  4BC5 A;  4PL7 A;  5BRH A;  4BRL A;  1Q82 O;  4FL9 A;  3HOT A;  3CJA A;  3T7Z A;  4WQ5 C;  3RVC A;  1T44 A;  1LCU A;  4BG9 A;  1VQ9 N;  1W97 L;  3P38 A;  2A41 A;  1T3V A;  2Q31 A;  3A5O C;  4H5V A;  3FZF A;  3QFP A;  5BPM A;  4IXC A;  3DXM B;  2P9U A;  3U4L A;  1DGK N;  4IEE A;  4BR0 A;  3J7Z O;  3WXM B;  2GEM A;  4GV6 A;  2NRX A;  4YDU A;  4H5W A;  5AQS A;  3GL1 A;  4BC4 A;  2Q0R A;  2NRR A;  3D6R A;  3O5B A;  4C1N I;  5CE3 A;  1W2B M;  3O9Q A;  1T6D A;  4F9O A;  1MA9 B;  1IG8 A;  1GLC G;  4IOX A;  5BN8 A;  1JJ2 M;  4GV3 A;  3H3N O;  3MMV A;  5ADX A;  4BY9 C;  3FLC O;  3UKU B;  4FWK A;  4RCH A;  3WXJ A;  3ZET A;  4BRQ A;  2GTD A;  4YDU C;  1V4S A;  3R1X A;  3MWP A;  5AQH A;  3NMU A;  4PHT X;  5AFU A;  3DLL L;  3GOI A;  3LM9 A;  1KXP A;  4PKG A;  1EO1 A;  4IFE A;  3F9M A;  4ILJ A;  4BRO A;  2W41 A;  5KPZ A;  4C1N K;  2OTL N;  1YIT N;  2ZJQ L;  2E2O A;  3MX5 A;  4AM7 A;  2HOE A;  4B1Y B;  1HJO A;  1NGF A;  3TSQ A;  2E1Y A;  4B1X B;  4BQZ A;  4CZG A;  4YOU A;  1HLU A;  1RFQ A;  1WOQ A;  3CQY A;  3LDQ A;  3MDQ A;  4I6M A;  4PL8 A;  3JS6 A;  3ULE B;  1QZ6 A;  3G4S N;  1VAZ A;  4MDB A;  3AAP A;  3QBX A;  4BRG A;  2OTJ N;  2QWM A;  3FR0 A;  3M5R A;  3W0L A;  4CZL A;  2QXL A;  1HX1 A;  4BRC A;  2NRV A;  2HBL A;  2YX6 A;  2ZGY A;  4WQ4 C;  1KD1 O;  2BTF A;  5AQK A;  4GNI A;  1E4F T;  3CI5 A;  3OBW A;  4BC2 A;  2Q36 A;  3D2F A;  5AQN A;  5AZI A;  3VF2 A;  5BPL A;  5CR4 A;  1RDU A;  4O8K A;  4K25 A;  3CCE N;  1X3N A;  4B9Q A;  5AQL A;  1M90 O;  2QI2 A;  4QS7 A;  3L6Q A;  2ZJR L;  1NGJ A;  3EO3 A;  3WT0 A;  5AQW A;  4XH1 A;  1EQY A;  1NGG A;  2ASM A;  4CZM A;  1VQP N;  3CF5 L;  3FZK A;  5E84 A;  5M1N A;  2QM1 A;  4RWT A;  2QWP A;  3SMS A;  4A57 A;  1VQO N;  3EL2 A;  1NWK A;  4AF1 A;  4JKF A;  2QTD A;  2P9N B;  4BR5 A;  3D2E B;  4H0O A;  1YIJ N;  5F0X A;  2A3Z A;  4WFA L;  5H1S Q;  3N4Q A;  3PIO L;  4FOE A;  5F1X A;  3BF3 A;  5M1K A;  4JD2 A;  2IIR A;  4IZ9 A;  3KWI A;  3O4W A;  3E9O A;  5M1O A;  5AQI A;  1E4G T;  2BUP A;  2IVP A;  1KAZ A;  3CC2 N;  3CCQ N;  1NGI A;  4ISE A;  4BR4 A;  3G71 N;  3CD6 N;  4JK8 A;  2PBD A;  2YJE A;  3LDP A;  3ULE A;  1QZ5 A;  1Z6R A;  4JAX A;  2H3G X;  3MN6 A;  4XH4 A;  4BRP A;  3IKM A;  1LOT B;  3KWG A;  4GV9 A;  5JIC A;  3E9P A;  4WF9 L;  4PKI A;  4KH5 A;  3M3Z A;  5AR0 A;  3CJ1 A;  1K8K B;  4FWM A;  4BQL A;  1P90 A;  3ENO A;  2WC9 A;  3ID8 A;  1HPM A;  3L4Q A;  3OW2 M;  1NGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...