4LSLA

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-(4-chloro-2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj476), a non-nucleoside inhibitor
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
548
structure length
548
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Structure-Based Evaluation of C5 Derivatives in the Catechol Diether Series Targeting HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 133
structure length 548
sequence length 548
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4lslA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4lslA05
2WHOA 2AX0A 3PR5B 1BCOA 1O1WA 3QINA 4EBCA 3OLBA 2IAJA 4PA1A 2DPJA 5KG1A 4NLDA 4I2PB 5KGXA 4Q8FA 4OJRA 4O3PA 3WNGA 3IG1B 4CEZA 1S97A 1RAJA 4IDKA 4RW7B 5FROA 4DL4A 2KTQA 4R0EA 1NJZA 2JEIA 1BQNA 3M8PA 4PWDB 2OZSA 2R8KA 3LDSA 1JLEA 3PX4A 3NBPB 5J2PA 4EO8A 3MR6A 4FBTA 4KTWA 5DGAA 1ZETA 4CEDA 4DFJA 5J2NB 4B8CA 4HYKA 1DLOB 3DYAA 4G3IA 3Q8PB 2G8WA 3BGRB 3K5OA 4B9VA 3OSPA 3D45A 2IM0A 4CE9A 4C8KA 4AHUA 2FVSA 3NCIA 3AO2A 3G10A 1SKWA 1TV6A 3LZIA 3AO3A 1LV5A 4MKBA 4AHRA 1D1UA 5KFCA 1LAVA 4CHOA 4QWBA 1S9FA 1KFDA 5KFAA 5KFVA 2YNGB 2IM2A 4IG3A 4FJ7A 3KHLA 4W5TA 1U48A 2D0AA 1U47A 5T14A 5J2QA 3NH1A 3MFIA 4NYFA 4DG1A 4DSKA 4Y34A 4FS2A 4AHCA 1GOBA 4K8ZA 5F8IA 1LWEB 4F4YA 1BQMB 4J9SA 1T8EA 3BJYA 4CJLA 4I9LA 4F3TA 4BE0A 4EYHB 1NJWA 2I5JA 3MEDA 3SV4A 1RDBA 4AILC 4LSNB 3OLAA 4ECRA 5KG3A 1YVUA 4CFCA 2QE5A 5HLFB 3DLHA 4Z4GA 2XY8A 1XR5A 3RB0A 3N6LA 2P1JA 4R5PB 2F96A 3KMSA 4CJWA 2OPPB 4FVMA 4HCCA 4O3OA 4FLZA 3EZUA 3CG7A 4CESA 4JS4A 3NDKA 3G6YA 1TK8A 2GV9A 2YKMB 3K57A 1W9HA 4CFBA 2XRIA 5KT7A 4IFYA 3HPGA 1CSJA 1HYSB 4WFZA 4F4WA 2B4JA 4OGEA 5CYMA 4M3RA 3OJSA 4DL5A 4E7IA 4NCAA 1WNEA 5DLGA 4KBIA 3RAQA 1FK9B 3PW7A 4XPEA 2YV0X 4XO0A 5DLFA 2W9CB 2GUIA 3FSIA 4NCBA 3GIJA 5DQHA 3CVKA 1TKTA 4DFKA 4R8UA 2VG5A 5D3GA 2A1RA 3VQ9A 1SL1A 3O4QA 3M9OB 3NGZA 4M3WA 3V1RA 4Z4EA 5CYQB 3ULDA 3TVKA 3OS0A 3PW0A 4ICLA 2QV6A 1JKHB 4FZZA 4AH9A 4CK3A 4MK9A 4NLTA 4H4OB 4IG0B 3WNFA 3NH2A 3PW4A 3CIZA 3RTVA 2C2DA 2JLEA 3KK2B 3QO9B 5HRRA 2ZD1A 2AQ4A 3AVAA 3ITHA 3H98A 4W5OA 1SH3A 2VG6B 2IM3A 1TQLA 1DTQB 1QSLA 4EEYA 2GIRA 1S10A 3WNEA 1KLNA 4ECUA 4OVLA 5FDLB 3T1AA 4N5SA 1HARA 3LAKA 1KVBA 4CJVA 1MU2B 4KI6A 5KG0A 3QIDA 3MR2A 4C8MA 1W0HA 5HRPA 1RYSA 3OHAA 5J1EA 1BISA 3MR3A 3L2QA 2D41A 4IH6A 4DTMA 4DS5A 4IFVA 2UUTA 3K2PA 1XC9A 1HPZA 3BQ1A 1TVRA 4KTQA 2AGPA 5I3UA 2D5RA 3AVIA 3HK2A 3KLEB 2W7OA 1VSIA 3HL8A 2F8EX 4DS4A 4TYBA 1KFSA 5DQGA 3SCXA 3FQKA 2B6AA 4ECSA 5KT3A 1RDRA 4Q45A 1FKOB 4KHQA 1RT7B 1S1WA 4DFMA 3ZSQA 4WE1A 4J9PA 4K4SA 2HMIB 1S1XA 1R0AA 3QGIA 1RBUA 3UQSA 2DFHA 2FLNA 1Y97A 4M45A 3LP0A 2V4RA 4M42A 3KLGB 1S48A 4ZPAA 4ED7A 4FM1A 3QNOA 3ISND 1I3AA 3GIMA 1LW2B 1VSLA 5KGWA 3KD5E 3IRXB 3IS9A 3OL7A 2YNHB 4EZ6A 3S3MA 3MEGA 4Y1DA 4K4XA 1CZBA 2FBXA 2J6UA 3GV5B 5KFFA 2ZQBA 2HVHA 1XHZA 1C0UA 5KFYA 4ED3A 3NAIA 1JLFA 4KHWA 2OPRB 3HKWA 2OZMA 3HT3A 5EDWA 4K4WA 3LP1A 1JL2A 3KLFB 4YP3A 4MKAA 5T7BA 2WB4A 3DRPB 2HWIA 3EZ5A 2F8TA 4NZ0A 4ZPCA 2BQUA 3AA5X 4ECTA 3QGGA 2XCAA 1TAQA 1RT3A 1QE1A 4ECZA 1TGOA 3I0RB 2HVIA 1JLBB 5L1LA 3E51A 1IKXB 4FJXA 3KHRA 3AO1A 4QAGA 1I39A 1VRUA 4HTUA 4RW6A 2RDIA 2E6LA 3ZSVA 3LWLA 2R8JA 1BI4A 4B3OA 2HNYA 4FJHA 4N47A 4ED6A 2R2UA 2PY5A 1NK4A 4NLGA 4TY8A 3QGHA 3VQ8A 2YNFB 2W8LA 4KV8B 4UQGA 2HWHA 4H8KA 3U3YA 3OYLA 3MXJA 3DLKB 3EY1A 1TAUA 4OPKA 3ZT2A 3TAPA 3DRSA 3DOLA 4CGJA 1IKWB 4KO0B 1EKEA 4ZHRB 4ZMMA 4BE1A 4RU9A 5C42B 1NOZA 4IH5A 1XWLA 4KB0A 4KB7A 1HMVA 2DFFA 4J2EA 5K14A 1UWBA 3G6XA 3O3FA 3PHEA 2OPSB 3M8QA 3CWJA 1BIUA 1S6PB 1D9FA 4FZYA 1RA7A 1Z4UA 4FJ5A 5C25B 4FW2A 3C6UB 2BR0A 3OYJA 1JLGA 4IH7A 1S1TA 2FC0A 3VN5A 2ALZA 1J53A 1WSHA 2E9TA 4E7JA 1N6QB 3RAXA 3KTQA 3TAFA 3DLBA 1TL1B 1UAXA 3OSNA 4CHYA 4NLRA 4F4XA 3E01A 3DMJA 3H4DA 2YNIB 4W5NA 4OL8A 1IG9A 3IGNA 4RW4B 1LWCA 1T03B 4DQRA 3MECA 3KLVA 4JV1A 4O55A 3G0ZA 3SUNA 3DRRB 5C24A 2WOMA 3HJFA 5KFRA 1TKXA 3AVLA 2Z1HA 3SPZA 4K50A 1TL3B 4ELVA 4I9QA 3HO1A 3LPTA 4I7FA 3KKRA 3QEVA 4FS1A 4N56A 3RMCA 1WSIA 3S3OA 5KT5A 2CJQA 1RT6A 4HKQA 1S9EA 4WXWA 2J6TA 3MXMA 1C0TA 5KFTA 5KG5A 4ECWA 4CHNA 2E6MA 2BANA 2O5DA 4QWAA 2R2SA 2DFEA 4Q0BB 2HNDA 4E89A 4BACA 3C6TA 4GC7A 3V9ZA 4KPYA 2Z1JA 1K6YA 2O4IA 4QWDA 3UPFA 4KHNA 1WN7A 4PUOA 1BHLA 2LSNA 4O0JA 3CQ8A 1Q9XA 4DEZA 2YHAA 3LP3A 3L3VA 1NK0A 4CEBA 3LPUA 2V0NA 1U49A 3KLHA 3LALA 4RG8A 3JSMA 1RT5A 3Q8RB 1HQEA 4J9OA 4B9LA 1S49A 1S1UA 3G6VA 3HYFA 1QSYA 4EZ9A 2G8IA 4J2DA 3DM2B 4IRKA 4CF1A 1ZBIA 1KLMA 1U04A 1C1BB 2ZE2A 2KQ2A 3H2LA 3SUQA 2QKKA 1J5OA 3GV8B 3NGDA 3K5NA 1C2PA 4DFPA 2AJQA 1X1PA 3UIQA 3OYIA 3OS2A 2GC8A 4TY9A 1ZYQA 4I2PA 4O3QA 2XI3A 4DL2A 1RT1A 4JRPA 3OYGA 4PQUA 2CKWA 2P5OA 4E0DA 1SL0A 4BE2A 2X74A 1RTJA 1C1AA 2C28A 2RN2A 1RDDA 4E19A 3PV8A 3D0PA 1T7PA 1SV5A 1JLCA 3OYMA 3SQ2A 4FZXC 5KFPA 2D7SA 4TXSA 4K4UA 2BRKA 1QUVA 1NJYA 3ZSZA 3LWMA 4MK8A 1ZTTA 1A5VA 2BGGA 4O3RA 3QIPA 1BL3A 4NRUA 4E7HA 2XY6A 4FJKA 4J9QA 3V9SA 3BDPA 1CXUA 4M41A 4URSA 4ZVHA 4LQ3A 1VK0A 4QWEA 4U7CA 4ZPDA 3F9KA 2IAJB 2R8HA 1RYRA 1J9AA 3KJVA 2D3ZA 3ZT0A 3TAQA 1MMLA 4Q8EA 5KG6A 2G8KA 2YNGA 4IDKB 2VG7B 3N6NA 5F8LA 4IR9A 3GV7B 3MXIA 3EPIA 5KRSA 4ZVFA 5SWMA 1YT3A 1BQNB 3M8PB 4KFBA 4QW8A 4Y1CA 3U3GA 2ITGA 3AVCA 3M8RA 4B9NA 4RNMA 1JLEB 2FJWA 4CEOA 1X9SA 3ZT1A 1NHUA 5J2PB 3NGIA 5HP1A 4CGIA 3ASMA 4FXDA 4CJQA 4Y3CA 5E41A 1IKYA 1HRHA 4KHUA 3DYAB 2DPIA 4Z4IA 2V4QA 4QCLA 4H4MB 5HRSA 4ZP9A 5JS2A 4RNNA 1TV6B 5KFUA 1DTTA 4R5PA 1QAJA 5CZ2A 2OPPA 3BSAA 3HVTA 3C94A 4IG3B 3CDWA 2YKMA 4WFXA 1SUQA 3DLEA 1NKEA 5J2QB 3VQSA 2RKIA 4DG1B 4ZP8A 1RDCA 5KFXA 5KT2A 1EP4A 3VQ7A 3DI6B 3TQ1A 5KG7A 2OH2A 4X2BA 4BDPA 3HHKA 4RZRA 2HAIA 4BDYA 2I5JB 3MEDB 2G8FA 3N6MA 4ZVGA 2R2RA 5HBMA 1WSJA 4OPJA 4H54A 4JV0A 4K4YA 1B9FA 4K4VA 3TARA 3BR9A 3V6JA 3I0SA 4CERA 4DTSA 5KT4A 2KW4A 4CFDA 3HVRA 1WSFA 4KAIA 2JGUA 4IFYB 3V81A 4ED1A 5KFGA 3VQBA 3JYTA 1NJXA 2AWZA 1WNSA 3HPOA 3ISNC 1JXBA 1L3SA 1NK8A 3NAEA 5KFIA 3UR0A 3RB4A 2AX1A 1UOCA 2UUWA 2XO7A 4DL7A 3NF9A 4ZP6A 3KKSA 5DG7A 3RMBA 1TKTB 2Z1IA 4R8UB 2VG5B 5D3GB 1EXQA 3U6FA 4Q5VA 3DLGB 3M9MB 4FJJA 5KI6A 4URGA 3FDSA 4ICLB 2E9ZA 3SI6A 2XGPA 1HNIB 2VWJA 2YKNA 1EETA 3QNNA 3KD1E 2IM1A 4O4GA 4C8OA 4NCGB 1Z25A 1C6VA 2HHXA 2VA3A 1XI1A 3H5UA 1RBVA 4B9MA 4RW9A 3LP2A 4J9RA 4JLHA 4Z4FA 3QETA 4O4RA 3TI0A 2JEGA 5DQIA 3OYKA 3I5BA 3QZ8A 3RBEA 1FKOA 3FFIB 1RT7A 5DK5A 3HXMA 3ZSYA 4NLPA 4CIFA 2W9BA 3KLIB 4WFYA 2ASDA 2FVRA 4DLGA 3CM5A 4GVMA 3KLGA 5J1EB 4B08A 4IRCA 4LSLA 4IFVB 4DSFA 2OPQA 1RTIA 3NF7A 5KFHA 3Q8QB 1HPZB 1TVRB 3HVAA 5I3UB 4CF8A 1GOAA 2WK4A 5CZ1A 3H4BA 4CJEA 4CFAA 3AV9A 3I5CA 1SL2A 2AGQA 4J2AA 3KK3A 4QWCA 1IO2A 4FJNA 4TQRA 2A1SA 2JC1A 2W9AA 3PUFA 3NH0A 2OYQA 1N4LA 2B6AB 3KK1A 3HP6A 4FLVA 3ZCMA 3THVA 1S1WB 1YVFA 1REVA 4CGHA 1JXLA 3V4IA 4WE1B 4FCYA 2IA6A 3AVMA 1T3NA 4RUAA 4CCHA 5F8NA 3LP0B 2IJFA 4DQPA 4DSEA 3CJ4A 1S1VB 4JV2A 2XGQA 4Q44A 1S9GB 4G1QA 3BQ2A 1SKSA 4IOBA 3T5LA 4FJGA 2WRMA 3D28A 3TAEA 4YFUA 1JLBA 1T05A 4FJIA 4KI4A 1RT4A 3O4NA 4J2BA 4Z0UA 4CECA 5KFSA 1C0UB 2FVCA 1JLFB 1XR6A 5KFBA 1GX5A 2KZZA 2R8GA 3QLHA 3QEIA 4I2QA 2V9WA 3PZPA 5KRTA 3LP1B 1VSMA 1X9WA 5KG2A 3V6DA 3V1QA 3B6PA 1IKWA 3QERA 3CJ0A 3WNHA 4JUZA 3IAYA 3RWUA 1N5YA 4C8NA 4K4ZA 2HB5A 2PYLA 4F2RA 1RT3B 1QE1B 1HQUA 2OPSA 1S6QA 1JX4A 1S6PA 4KRFA 4FW1A 1VRUB 4RW6B 3MAQA 5L1KA 3OYCA 3P83D 1Q9YA 3O3HA 2AU0A 4B3OB 2HNYB 5L9XA 2KFZA 4RW8A 4WYWA 3HVWA 3SFUA 2X6NA 4E7LA 3RB6A 3VQPA 1EX4A 3QEXA 3MFHA 1TK5A 4O3SA 4JS5A 3DRSB 1JLAA 3BQ0A 3QZ7A 3DOLB 4WYLA 4KTZA 1BIZA 4HHTA 3HPHA 4HUFA 2YNIA 2C2RA 3CYMA 4CEQA 4F2SA 2X6SA 4MK7A 5KFWA 3V6KA 5K14B 4NLSA 3DDKA 1UWBB 1HNVA 3OJUA 4XPCA 3NGYA 4QW9A 2D3UA 2WONA 4GC6A 2HNZB 3M8QB 3H5YA 2P51A 3KOAA 4AHTA 4LD0A 4DU1A 1RT2A 3MF5A 2W8KA 3OVNA 1IKVA 1LWFB 5FRNA 4ID5A 3G86A 3AA3A 1TKZA 2AGOA 1JLGB 3KIOA 2FVPA 1LW0A 1KTQA 5J2MA 1S1TB 1KHVA 2XCPA 3AVNA 1C1CA 1FKPA 2IC3B 3ZSOA 4KHRA 2B5JA 4EP4A 3FRZA 3E01B 3DMJB 4DTXA 2G8HA 3SUPA 2BE2B 4Q0BA 2GIQA 1N56A 1LWCB 2FJVA 3TAMA 3MECB 1VSHA 2C22A 3MEEA 1JL1A 4ZTJA 5C24B 1VRTA 2WOMB 3DOKA 5KFLA 5EUHA 4CGFA 3LAMA 1TKXB 2W42A 3RMAA 2VWKA 1RTHA 3AA4A 4DLEA 4DQIA 3NF6A 3ZT4A 4RNOA 4B9TA 4MFBB 2RF2B 4I7FB 3T5HA 1Q8IA 3LANA 1WLJA 4DTPA 3SUOA 3AVHA 4WXOA 4O44A 3PW2A 3I5AA 2D0CA 2ETJA 1JLQA 3AA2A 1RT6B 3ICLA 1VSJA 2Y1JA 4FK4A 4KKOA 1JXEA 1S9EB 3VQQA 1RBTA 4IRDA 4FLXA 1C0TB 5DG8A 2BANB 1VSFA 3CO9A 1C1BA 1B92A 2HNDB 2KZMA 2G8UA 2O4GA 1WSEA 5DMRA 3C6TB 1RBSA 4CJSA 3OL8A 3CM6A 4E7KA 4CHZA 1KRPA 4KSEB 4DU3A 5C5JA 4DL6A 4NLVA 3GQCA 4LH5A 4ECYA 4PUOB 3EYZA 1RTDA 4CHQA 5HROA 3K5MA 2EHGA 4EBEA 2ASJA 3KLHB 3CDUA 1RT5B 4CEAA 1HQEB 3SFGA 4BWMA 3L2UA 2G8VA 1S1UB 5KFMA 4M94A 2ZKUA 3PO5A 3QEPA 1ZBFA 3VA3A 3IG1A 5EU7A 1CLQA 1SKRA 4FJMA 4RW7A 2IDOA 4J9NA 2ZE2B 4IKFA 5KFKA 3ZSRA 4PWDA 3KNAA 1J5OB 3OYHA 4OLBA 3AVBA 3VQ5A 4QOZB 4TSXA 4CIEA 3CDEA 3NBPA 2I1RA 4CGGA 3TANA 2NUBA 1RT1B 5J2NA 4DTJA 2FBYA 4PQUB 4F4KA 5I42B 5L1JA 2QKBA 4XIUA 4CJ5A 1DLOA 1RTJB 3BGRA 2P5GA 4NLUA 4GMJB 2HHWA 1XR7A 2VG7A 4MIBA 3CFOA 1SV5B 1JLCB 2FVQA 4AHSA 2WTFA 1L3TA 1TKDA 1W25A 1JIHA 4B9UA 4ED0A 4OLAA 2R2TA 2EX3A 3IGVA 2PYJA 4IKAA 3QIPB 3VQAA 4RNHA 2XHBA 1SH0A 2VA2A 4Y2AA 3OS1A 2J6SA 4HVJA 4BWJA 4CJRA 4N41A 2HW3A 1LWEA 4ECXA 1S0MA 2FLLA 3VQ6A 1BQMA 4K4TA 4Y2CA 4H4MA 1BCMA 1U45A 4CJ3A 1HYZA 3KJVB 1LAWA 5HRNA 5KFDA 4FBUA 4LSNA 3HP9A 2FJXA 5HLFA 1QAIA 2BRLA 1NNDA 3OYNA 3NFAA 4ELUA 1ZBLA 4KFBB 3H59A 3PJWA 2JEFA 3PW5A 4DF8A 4GW6A 3CJ3A 4NLOA 2OA8A 2ATLA 5EWFA 2E9RX 1C0MA 3DI6A 4F8RA 4DSJA 2BQ3A 2UVWA 3ZT3A 1IM4A 4Z4HA 5HP1B 3NHGA 1HYSA 1IKYB 1NKBA 5F9NA 3AVFA 3OYAA 4M3UA 3SQ4A 1FK9A 3BREA 4ZP7A 3V1OA 1DTTB 3L2WA 1QSSA 5F9LA 2FBTA 1RA6A 2W9CA 3HVTB 1OS5A 3VA0A 1SUQB 3DLEB 2QXFA 2RKIB 3I8DA 1HJRA 4TN2A 4FJ9A 4KB1A 1ZBHA 5CYQA 1EP4B 1JKHA 3M8SA 1UA0A 4H4OA 4IG0A 3RR8A 4EBDA 3KK2A 3QO9A 4FM2A 4OGCA 1GX6A 4WZQA 2UVVA 5CYMB 5HBMB 2VG6A 5KFJA 5FRMA 3VQCA 3OYEA 5L1IA 3I0SB 1DTQA 3DLGA 4FLYA 2C2EA 4CJKA 1T94A 3SJJA 1KVAA 3S9HA 1QTMA 5FDLA 4TLRA 1HNIA 2UVUA 3H40A 4FLWA 1MU2A 2D0BA 1K1QA 4NCGA 3V81B 3JYTB 3SV3A 4KAZA 3AO4A 3KHHA 4IBNA 3ZSWA 3PR4A 4KREA 3KLEA 2ZD1B 3ITHB 2BQRA 3B6OA 1B9DA 1BGXT 4L8RB 3FFIA 4NRTA 3OYFA 3SI8A 4MQ3A 4WZMA 4CF2A 2IGIA 3T5JA 4MIAA 3T3FA 3KLIA 4CGDA 4EP5A 5KFOA 1NK9A 4DTUA 3CJ5A 3DLRA 4DTNA 4ZTFA 4K8XA 1NK6A 2HMIA 1QS4A 2YKNB 1EETB 5CY4A 2RDJA 2JEJA 2HHTA 4O4GB 5SZTA 4HUEA 4FM0A 4DF4A 4FK0A 1ASUA 1RILA 3SQ0A 4DWIA 3MTKA 4NYZA 2W7PA 4F4ZA 4NLQA 4RW9B 3LP2B 1IH7A 1LW2A 4IR1A 4FLUA 4DSLA 1VSDA 4EO6A 4HUGA 3H5SA 1G15A 2XI2A 3IRXA 4YQWA 4B8AB 4HCBA 4M95A 3O3GA 1F21A 3AVJA 3TWHA 2YNHA 1CXQA 5F8JA 3PX0A 4FJLA 3RMDA 2B43A 4TYAA 1VSEA 3EPGA 4LQ9A 4F3OA 1QHTA 2XY5A 2UVRA 1KHWA 2W9BB 4CF9A 5F8MA 3PY8A 2ASLA 4W5RA 1S1VA 1D9DA 2OPRA 1S1XB 2ATQA 4LSLB 1XHXA 1S9GA 1R0AB 4W5QA 2OPQB 1RTIB 2FLPA 2EC0A 1UA1A 3KLFA 3DRPA 1WSGA 1QQCA 1S0NA 1NK5A 3GYNA 3HSTB 4QPXA 3L8BA 4NYNA 3KK3B 4DTRA 3VQEA 3BSNA 4YMEA 3IS9B 3Q8SB 2R8IA 4BDZA 3KK1B 4FLTA 3MEGB 1S4FA 4CEFA 4DL3A 3I0RA 4PY5A 1REVB 3V4IB 1IKXA 4M3ZA 4O3NA 4NLXA 1VSKA 1NHVA 1N48A 4LY7A 3D5MA 3GILA 5KFNA 1WAJA 1KSPA 4ECVA 4M3XA 2YNFA 3TABA 4KV8A 5JS1A 4G1QB 2IMWP 4KHMA 2IJNA 5DGBA 3DLKA 5F8GA 3P5JA 4B9SA 3GIIA 4CIGA 4CF0A 3LZJA 4Q43A 4ZHRA 4KO0A 4OKEA 3QEWA 5KFZA 4O0IA 5C42A 3NMAA 1KVCA 2E4LA 1T05B 1RT4B 2X78A 1RDAA 4YR2A 4CJPA 3VQDA 4ZVEA 4YR3A 3RRHA 4KE5A 4YR0A 3QLHB 1ASWA 4CJUA 3SNNA 4M3TA 4I2QB 1BI4B 5C25A 1L3UA 3C6UA 3ZSXA 3T5KA 3BSOA 3V6DB 4TY8B 1HYVA 3H5XA 4DQSA 2HHSA 5DG9A 5JUMA 1N6QA 1I6JA 1TL1A 4OKJA 2BDPA 1YTUA 3IN5A 3V9XA 2DTUA 3UDLA 1N5YB 3V6HA 3C95A 3NE6A 3SZ2A 2QK9A 3NKYA 4TQSA 1FXXA 4ED2A 5EWEA 1HQUB 2HHUA 5KT6A 2HNZA 1A5WA 1S6QB 4CJTA 1TP7A 1D5AA 4RW4A 2PZSA 3RR7A 1T03A 1HMVB 1X9MA 4RUCA 4FJ8A 3OHBA 1LWFA 4AHVA 3NL0A 4IQXA 3SPYA 4CHPA 3DRRA 4CJ4A 3BSCA 4ELTA 4DU4A 1J54A 4RW8B 3RB3A 2IC3A 2IS3A 1YTAA 3QYYA 1TL3A 2HHVA 1ITGA 5EWGA 4E3SA 2DY4A 3PJXA 3QIOA 3SQ1A 1JLAB 4ECQA 4O5BA 3PX6A 4J9KA 4J9MA 3H08A 4URQU 4RNFA 3V9UA 4KHSA 2BE2A 3ALYA 1S5JA 2RPIA 4E1NA 3S3NA 1KCFA 4CJFA 2ILYA 3SYZA 1HNVB 1RBRA 3V9WA 3TAGA 2ILZA 4Z4CA 3A2FA 4DMNA 2WONB 2XWYA 4CK1A 3CFPA 3CJ2A 3K59A 1RT2B 1IKVB 1NKCA 4ID5B 4MFBA 2RF2A 1CZ9A 3L2VA 3RRGA 4NLWA 1TKZB 4KHYA 1NK7A 1L5UA 3AO5A 1LW0B 3NF8A 5J2MB 3AVGA 4C8LA 1C1CB 3QESA 1FKPB 2R7YA 4ZPBA 3AVKA 5KFEA 3CFRA 2YHBA 1SH2A 2B5JB 4ED8A 3T19A 5KFQA 4F50A 4CK2A 1U4BA 4MH8A 5F8HA 2GBZA 3FQLA 3OL6A 3TAMB 4DSIA 3TR8A 3DM2A 1S0OA 3MEEB 1TK0A 2IBKA 2Y1IA 1VRTB 3DOKB 2Z1GA 3L2RA 3KHGA 2XC9A 3OYDA 2WCXA 3VQ4A 3L3UA 2F8SA 5KG4A 1RTHB 4DTOA 4JRQA 4LH4A 3OY9A 1ZTWA 3GIKA 3NAHA 4O44B 3K58A 3RBDA 1RCHA 3K5LA 4OKKA 3F73A 4YNQA 1JLQB 4DQQA 3OL9A 4KKOB 5KTQA 3PO4A 4FYDA 3MR5A 4EYIB 2KFNA 3JSMB 1GOCA 3KMQA 3P1GA 1RNHA 3OYBA 3M9NB 2XY7A 4FK2A 4J9LA 1A5XA 1NOYA 1D0EA 1U09A 1Z26A 3PVXA 1D8YA 4M3YA 1ZBUA 1ASVA 2JC0A 1KLMB 1WAFA 2Q3SA 4N76A 2FBVA 4ID1A 1K1SA 4CEEA 5JXSA 2IOCA 3HM9A 4E1MA 1RTDB 5HROB 4U6PA 1L3VA 2HHQA 4NLYA 5I42A
chains in the Genus database with same CATH superfamily
2WHOA 2IAJA 3BYPA 4PA1A 3E2EA 2DPJA 3SSSA 4YHHK 3NCQA 3TTDA 1N36K 3IFRA 1N32F 2VICA 4X62K 2JLFA 4HR2A 4NA1A 2EFOA 5E7OB 1BDGA 1YRTA 4NO7A 2KTQA 1BQNA 4LRDA 2QM1A 4X64K 1VQSA 2QA2A 3LDSA 1U2CA 4CI0B 1T3OA 3LGNA 4EO8A 4FBTA 4KTWA 4G9ZA 3MZIA 4N7TA 2E2PA 4B8CA 1F6TA 2H51B 4C0OC 5H9EK 5ETRA 2C3YA 4DR6J 1DLOB 2G8WA 3GONA 4XH5A 3OSPA 2IM0A 2V8VA 4CE9A 3AO2A 3DAWA 3O9QA 3MCNA 4CHOA 5DM7L 1X5TA 1QTNB 4C11A 4FNIA 4FJ7A 2WVBA 1U2VB 3DGPA 3MFIA 4NYFA 3J7AP 4Y34A 4FS2A 2OSQA 2ZJRQ 2VFTA 4MIWA 1QHAA 5ADXA 4LF5J 1N33F 5BYRA 5AJ3J 1BXNA 3WQPA 3UCUP 2GO9A 3DXBA 4DPOA 3KDNA 2G0JA 4I9LA 2VKRA 4GV6A 1VQLN 4AILC 4LSNB 2KJWA 3EX7B 2NS1B 1Y3JA 3BN7A 2R7UA 1XR5A 2QC3A 1AT1B 5JICA 3EGNA 2F96A 1R89A 2RHKA 4CJWA 3QDKA 4ZKAA 4IOCL 3CG7A 3HMJG 5E3AA 3G6YA 2GV9A 1VQNN 3FC9A 2YKMB 3CCRS 1ZBSA 1W9HA 2P6SA 1CSJA 4WFZA 4F4WA 2V5HG 4IOXA 2HBMA 4ZVOB 4CLLA 5H1SQ 2E5IA 5AZIA 4E7IA 1B4SA 3RAQA 3QT5A 1FK9B 3M3ZA 3PW7A 1VK3A 2OUGA 4ZDNA 2GHPA 5DLFA 2V50A 1IWGA 3GIJA 3C16A 4KHPJ 3CVKA 4QYZJ 2A1RA 3PTWA 1FFSB 1XNRJ 2V94A 2H4WB 1SL1A 4JV5K 3M9OB 5D0RA 3OD2A 3TVKA 5BYSA 5IFMA 3PW0A 4C8YA 3TPQA 1JKHB 4FWLA 5E33A 4MK9A 4BRGA 4NLTA 2JJ4D 2KI2A 1HNXK 3JB9k 4RJVA 4M5NA 3O9UA 3CC2S 1KR4A 3RTVA 5BREA 2ZD1A 3AVAA 3CSKA 4W5OA 3ZTQA 4AM7A 1JWWA 2MSSA 3N01A 1TUGB 5AQYA 1FRXA 1F9EB 4XAKA 4N5SA 1VC0A 2A41A 1UPMB 4C8MA 4YDUC 5HRPA 4NLBA 5J1EA 1BISA 2ZH4A 1KQKA 1NDCA 2D41A 2EWHA 1DEJA 4KTQA 3BQ1A 2J8SA 4AQYK 4HI2A 2DGXA 3SMSA 5BR9A 4BG9A 3HI0A 2F65A 1UEVA 3GJSB 3SAHA 4DR1K 4L75A 1KFSA 3A8YA 1NXIA 4ZPVR 3D2EB 4HEA9 4C48A 4ECSA 4K8RA 1RDRA 5IT9Y 1FKOB 3MI7X 3FZ2A 2DNNA 4WE1A 4J9PA 1NHKL 2HMIB 1S1XA 2PEHA 3UE2A 4KH6A 4JI1K 4A2AA 3EM1A 3KWMA 3NY0A 2FLNA 1FO1A 3KLGB 1S48A 4OJHA 1GTEA 3QNOA 2Q6BA 1I3AA 2RAQA 1LW2B 3OT9A 4U8VA 2COLA 5KPTA 2PA3A 1YSJA 3OL7A 2FJEB 1SIWB 4K4XA 4PG8A 4A61A 2KKHA 1CZBA 2RD5C 2J6UA 3HSDA 2CFXA 2P9CA 5AQGA 2HVHA 2HFNA 1JLFA 4KHWA 2OPRB 4CLUA 5EDWA 2O8EA 4YP3A 2WSCC 1H7WA 1BOTO 5ETLA 2F8TA 1GNKA 2AJ2A 3M2UA 3SBTA 2XYGB 1LNQA 2GX8A 2XCAA 4C3LA 4I1TA 3PKYA 3W8GA 2F4VJ 3A5LC 3I0RB 3W2WB 1C0GA 3ZLJA 1DJ0A 2RDIA 2E6LA 3CCWA 4B3OA 2HNYA 4DZ6A 1IBLK 2P9NB 4N47A 3U9DA 2CJ9A 2W8LA 4KV8B 3CPWR 4NEZA 3EJMA 2ZFHA 3U3YA 3H0PA 2Y1LB 4IJNA 3MXJA 2JWKA 3EY1A 2L9NA 2ZJQL 2GW8A 2QJ3A 4CZEA 4BE1A 2UXBF 4K2XA 3X1LB 2PD1A 4OX9J 4J2EA 4KIAA 1WDTA 4FOEA 3O3FA 4KPCA 2P9EA 3MM7B 1DQAA 3M8QA 2ABYA 1GT8A 3SDEB 3FR0A 1RA7A 4FJ5A 2WVDA 3FRYA 4OI0A 2R42A 1JLGA 3OHRA 3QJJA 2E1CA 2FC0A 2ALZA 3PKMA 1RFQA 1IJJA 2JWLA 3DLBA 3VV2B 2XLIA 2ITMA 2DNLA 1NZAA 4F4XA 2B9XA 3NGRA 3DGVA 3DMJA 4EMDA 3H4DA 4GVBA 1S76D 3KLVA 4JV1A 1FT8A 2MHEA 5ETTA 3SUNA 1EHWA 3VAJA 3BBFA 8RUCA 4FYWB 3HJFA 4I0WA 4OYXA 3L3CA 2Z1HA 4DB3A 4K50A 4ELVA 3L0QA 3ULEA 3HO1A 2JSXA 3SBGA 4I9QA 2KRRA 3G71N 3GB0A 3NGKA 3KKRA 3QEVA 1VQ9S 4QU6A 3BGOP 3SAGA 2CNNB 1S9EA 5AE1A 3OUYA 3FSYA 2BANA 1V4TA 1BG3A 1H0HB 1YJ7A 3Q8UA 1U6ZA 1ZA2B 5B8HA 3FSXA 3DCAA 2AD9A 1WN7A 2LSNA 4X4VA 3CQ8A 3R5DA 1YZ7A 3I55S 1U1PA 3CIPA 3MX2A 4CEBA 2AV5A 3JSMA 3PM9A 1I94K 1Y0HA 1HQEA 3GG1A 4X4NA 2XMMA 3CB4A 4AL7A 1S1UA 2UUBJ 2VC0A 4JI8J 2ASOA 3JXUA 2A3JA 4ATNA 2ZE2A 2EVZA 3AA9A 3DOMB 2POKA 4ID8A 3SUQA 2P9UA 2QKKA 3CCLN 4Z7YA 3WEEB 3R5BA 5F41A 1C2PA 2QLJB 3CIMA 2DXDA 4ZJLA 4DV3K 3OYIA 2FY8A 3OS2A 4C1NK 4OI3A 1BD6A 4I2PA 1RT1A 4NYOA 2GVDB 4JRPA 2VU5A 4PQUA 2CKWA 1SL0A 4BVOA 4BE2A 2ZH8A 4OYAA 1RTJA 4GKJK 4Y2IA 3DHXA 1N32J 1RDDA 3MN6A 3B54A 1SV5A 3W0LA 4JBCA 4K4UA 2BRKA 2HBYB 1NM2A 1ZTTA 2BGGA 3H46O 4NRUA 2XY6A 4E7HA 4JI2K 1E6YB 2P9PA 2MKKA 3BDPA 3V9SA 5D77A 1CXUA 1VIOA 1BHNA 2ZZNA 4DHVA 1VK0A 3M32B 2ZBPA 3IDHA 2P6TA 3IBFB 4ILMA 3DXKA 1JNRB 3KG0A 3CGIA 3OBYA 3UVJA 2WBRA 3KJVA 2D3ZA 3TAQA 2VG7B 1OH7A 3N6NA 5F8LA 3W62A 3GV7B 3EGZA 3M7VA 5AZJB 3VF6A 5KRSA 2YWEA 5SWMA 2HQ3A 2DO0A 3M8PB 3H7HB 1H73A 2B9EA 2E5LK 3U3GA 4CLZA 3AVCA 4B9NA 1CQMA 4CEOA 3ZT1A 1NHUA 3MPWA 3B78A 5J2PB 3BO3A 2PGCA 3NGIA 1CJVA 5AQVA 2G0IA 5HP1A 3R6GB 2HZVA 4ZN1A 1IN0A 2M7SA 3O1BA 2ZM6K 3M6VA 3C66A 4PRFA 4FXDA 2QEXN 5DS7A 2FC9A 5H9FK 4QCLA 3D7EO 5HRSA 4JN4A 3LDQA 2F7VA 1TV6B 4R5PA 1HKGA 4YDDB 4UUXA 1MN9A 3BSAA 4QJVA 4CBWA 3GG4A 2CWKA 3CDWA 1OH8A 5KFXA 2B4OA 4CZIA 1EP4A 3GMGA 5K8OA 3ISZA 3TQ1A 3MM5B 2OH2A 4BDPA 4RZRA 2HAIA 3U1MA 4IOAQ 3N6MA 1ZAWA 1NSPA 4HACA 5CA5A 3MPVA 4H54A 1B9FA 2FPHX 3FMWA 4DTSA 1S0VA 2KW4A 1F5BA 1VYAA 3IMQJ 4USKA 1R27B 3SXLA 3SK3A 4YY3J 4P75A 2XS2A 2LQ8A 1N8RT 2ZH2A 4LF4F 4YORA 3ISNC 4IYQA 1Q16B 1NK8A 2IYGA 2ZH5A 3RB4A 4UOCA 1XMOK 4JI6J 4QR1A 2XO7A 3NF9A 1BY9A 3QFUA 5IC6B 4ZP6A 3KKSA 5DG7A 4YOXA 2BH1A 3VMFB 2CDRB 4R8UB 5D3GB 3DLGB 4M5MA 3M9MB 1FJCA 3AY0A 1ITPA 3FBBA 1S4EA 3IMXA 2QO3A 2HBLA 2HHHF 3CD6S 5HN0A 2FUG9 4F67A 2GQQA 3QNNA 3KD1E 4O4GA 4PL7A 3CC7N 3CMAN 3MHYA 1RBVA 3TWZA 3L4IA 2J7UA 3HF5A 1X4BA 1FJGJ 1LEOA 4MTPA 4DV0F 2E20A 2VBWA 3D9BA 3SQGA 2JLGA 5LMNF 2HWTA 5ETPA 1UAWA 3FFIB 5A8KB 1V3SA 3RZAA 3AQOA 3A12A 4LF8K 3PJ9A 3IKMA 3UWTA 1SQKA 1SQEA 3KLIB 4B3RJ 3FZKA 4CP5A 2KT3A 3UN5A 3CJCA 2HIYA 4CLPA 1DGKN 4IFVB 2OPQA 4EK2A 3HVAA 5A8WB 1FJEB 5I3UB 1GOAA 2WK4A 2CZ9A 4OFZA 4CJEA 3THTA 3I5CA 2AGQA 3ADAC 4FVUA 4J2AA 5AQXA 4BLGA 4QWCA 3PUFA 2B6AB 4WQ4C 4DR6K 4FLVA 3CJAA 3OTCA 4CGHA 3V4IA 2RH3A 1WC1A 5BYQA 3RYLA 2MGZA 1AZSA 4F0KA 3MXHP 2DYAA 5F8NA 4DQPA 1YI2S 4G1PA 2DISA 4U7BA 4PKDB 3CDBA 1VHIA 4C7QA 4X84A 3T5LA 4CLFA 3OXLA 2MKHA 3H6EA 1U1NA 3QBCA 4LF5K 2YWHA 1KQFB 1YF5L 5AJ3K 2IVOA 3HKZD 4LR8A 4YDXA 4KGXB 4KI4A 3BR8A 3C15B 2P9IA 4GNIA 2W4PA 2KZZA 2FDNA 3QLHA 2AJ4A 4XDDA 3QNWB 3QEIA 1MNEA 3N5FA 5GADI 3LP1B 3V6DA 4MAKA 3V1QA 2YPYA 1HHTP 2OLWA 5LOQA 2O8DB 4K0KJ 4M5DB 3CNQP 3NGUA 5DRKA 2OPSA 3MMCA 2VPXB 1GLJO 3T1YJ 4KRFA 3MAQA 2BYCA 4ZCMA 3N4WA 2AU0A 4KHPK 4LR7A 4QYZK 2PBDA 2WVCA 4WYWA 4M5HA 2NLXA 2X6NA 1TL7B 4ETZA 1XNRK 1EX4A 3MFHA 4QR2A 3DRSB 3DOLB 2LXFA 5M1FA 3A5NC 5M1OA 1NBWA 4CEQA 3WZ0A 1UJ6A 1LKZA 2P9SB 5AQTA 2AEMA 3DDKA 2CVIA 1HNVA 3OJUA 4JI3J 3NGYA 2B7BB 1S72N 1NG9A 4GC6A 2HNZB 3H5YA 2DNPA 2EC2A 3LH2S 2QLWA 1PO6A 1RT2A 3MF5A 3PHTA 3VAHA 3AA3A 1TKZA 2AGOA 1U26A 5J2MA 1KHVA 3AVNA 1IWAA 3M8YA 4P7TA 1C1CA 4JNEA 3ZSOA 3A5OC 4PABA 3OR2B 3O80A 2F8MA 2FQQB 4WFAQ 3K5PA 5IT0A 2VOPA 4DTXA 2G8HA 5GAGU 3QMLA 2BE2B 2GV1A 1HPMA 2H9ZA 3UR3C 3QAEA 3TAMA 1M1GA 1VSHA 4IFEA 5KAKA 4C0HA 1G2EA 2WOMB 3O8WA 4WQ5A 3ENVA 2W42A 2IPOB 5LMUF 4MYTA 2KN4A 1RTHA 2DY1A 4FF1A 3ZT4A 2Y8YA 2MB0B 2BJ7A 3NCRA 3BH6B 2YKQA 1O51A 2RU9A 4L73A 2X1GA 1X4DA 2D0CA 2V8GA 4A48A 4FK4A 4KKOA 5M1PA 1RBTA 4IRDA 5LJVA 1C0TB 4HH1A 1Y7PA 2RRNA 5DG8A 2IHR1 1NH8A 5L38A 3VEOA 1VSFA 4YB7A 3D0HE 2ROPA 1T9TA 5FIIA 2HNDB 2KZMA 3R8YA 2DY9A 2O4GA 2ZHBA 3C6TB 2NCKL 1RBSA 4CJSA 3CM6A 1W2BR 5KOWA 3GIRA 1CZAN 2IY5B 4LH5A 3GJTB 4PUOB 3EYZA 4FPIA 4CHQA 3KLHB 2JDJA 5GAHI 3SFGA 3OVBA 2J7KA 1VQ4N 1ZM2A 3NS5A 5AQNA 1RB0A 1YG0A 2HS4A 4CTAB 3VA3A 1K47A 5IWAF 3CJQA 1CLQA 2IDOA 3VAIA 2DB1A 2DXFA 1HUXA 3KG1A 4P2MA 2R7QA 3KNAA 3PIPL 3OYHA 3AVBA 3GZ7A 7FD1A 2F4VK 2K06A 3W1YC 4C6AA 2GJ2A 4V19X 3R5GA 2QTWA 5GMKa 2NUBA 1L3KA 4DTJA 3A0IX 3Q83A 4F4KA 5L1JA 2B7CB 1DLOA 3VAMA 2UUAF 2QWLA 3G25A 4ANDA 4YOYA 4H0OA 4A8FA 1YVNA 1JLCB 3C19A 4OV1A 2C42A 2MKJA 4OLAA 2R2TA 3FK4A 1KKHA 4JD2A 4AF1A 2G9OA 1XMQJ 2LCWA 3CI5A 4RNHA 2XHBA 3GSDA 2VA2A 4A46A 4Y2AA 3OS1A 3LPEA 3RJMB 2IVFB 1HR0F 4JKDA 5HO4A 1OQ6A 2NSCA 1S0MA 4DV4J 5AXLA 1IR0A 4CJ3A 5HRNA 4FZVA 1VQMS 4LSNA 2MHNA 4PL8A 3L7OA 3B8AX 1NSKL 2DR8A 4WFNL 1HBNB 5D4NA 2LVWA 3OYNA 4ELUA 1ZBLA 4BRLA 1VISA 4PAAA 2HGLA 3H59A 4GW6A 1KEKA 2ATLA 4H5WA 1C0MA 3ZT3A 1T44A 1QVGR 3ID6A 4DV7J 3CD7A 2CADA 3AVFA 3PRVA 2MY8A 2ZHAA 2XM3A 2UUCF 1WKJA 4PG7A 1FK9A 4ZP7A 3ENBA 5F9LA 3I56N 1HA1A 1OS5A 4PR6A 4Y28C 1WJ9A 1J5EK 2RKIB 2CYYA 3ZTPA 4KB1A 4BHQA 5B0BA 1JKHA 1SBRA 5AQFA 3A8JA 2EPIA 1FRMA 5F3ZA 2DPNA 4FM2A 2HLUA 4B1ZA 1VR6A 3VVTA 1FTCA 5JJBA 5CYMB 5HBMB 3OTBA 2X1BA 5FRMA 3OYEA 2F8HA 4FLYA 1ELOA 2C2EA 2YX7A 4PXCA 2QL7B 3SJJA 3CPEA 5ETQA 2DIVA 1Q4RA 4LF2A 3GOIA 1WC0A 1HNIA 2AKWB 4XTTA 2UUBK 4DV5F 3T9NA 4JI8K 1R0BG 2HHHJ 4X4PA 4OJ1A 5IT4A 2BM0A 1U6FA 3KFWX 3UNGC 4DX5A 1VLOA 4WTYA 4DV0J 3EO3A 2E5HA 1BGXT 1B9DA 4L8RB 3S8SA 4DUZF 2D3O1 1FRLA 4N8OA 2FY1A 2ZUGA 1CC8A 1FFWB 3D2EA 2KT5A 1NK9A 1WOOA 2A2CA 2R7OA 2MKSA 3SCIE 3P96A 4DTNA 2E88A 1N32K 2HMIA 1QS4A 4YDUA 2YKNB 5HATA 1EETB 3LDNA 2HHTA 4FK0A 2CPDA 3IR5B 3LP2B 4DR2F 1LW2A 3A8EA 4DSLA 2Y9HA 4EO6A 1RABB 1Q7LB 3BZCA 3H5SA 1NMNA 3J7YI 1NWKA 4YQWA 4B8AB 4BR0A 3O3GA 1CXQA 2XEXA 5LL6Z 4TYAA 4FSVA 2L41A 1NPPA 1IQZA 2XY5A 2UVRA 3R2CJ 1NGDA 3PY8A 2OPRA 1RWKB 2ATQA 3WBZA 2ZWPA 1S9GA 5EX0A 2FLPA 1VQ6S 4CZJA 3PEHA 2DKOB 4GRSA 1S0NA 3GYNA 3HD2A 2OSRA 3HSTB 1OKJA 4I68A 4QPXA 3L8BA 3LM9A 3VQEA 2JX2A 3BKFA 3BSNA 4W92B 3IS9B 2O3DA 2NYIA 3G87A 4GKKF 1R31A 4A5AA 4BDZA 3MEGB 5AT1B 3FZMA 4CEFA 1UFKA 4CH0S 3I0RA 4PY5A 2DRBA 1EWQA 1OYDA 1Y9OA 4M3ZA 2OFGX 1EQ0A 4XK8C 3JQMA 4CWBA 4OLPA 2P9NA 4LY7A 4MDBA 4P52A 3TW0A 4MKYA 4ECVA 3DJCA 4M3XA 4KV8A 5JS1A 1WG5A 2IMWP 4HTIA 4OI4A 2QL5B 3OBWA 5F8GA 3P5JA 2HS3A 4LVOP 2B56A 4DCHA 2BTFA 3GL1A 3QEWA 1SIZA 1KVCA 4FF3A 3TJ8A 4U96A 2XG8A 5DZ7A 3KUGA 1H98A 4CD1A 4J91A 3MN7A 4BVPA 4YHHF 3HM8A 3SDEA 2O8FB 2MQLA 4YR0A 4DUTA 3UFCX 1Q18A 2W24A 1N36F 1YUWA 4QR0A 4I2QB 3HJVA 4X62F 5MLCQ 4K42A 3ZSXA 3T5KA 4FWRA 2V69A 3BSOA 3OXFA 3LM2A 3VZIA 5JVHL 1I6JA 4YY3K 4AXIA 4CH7A 1B3TA 3SZ2A 1EO1A 4K25A 3TZXA 3TSPA 4ZS6A 1FXXA 4WIQA 1UETA 1HQUB 1GMVA 2HHUA 1S6QB 1TUWA 3ILJA 4JI6K 1HMVB 1X9MA 2OTJS 4FJ8A 4IQXA 3AJ2A 4CJ4A 5GAEU 4ELTA 4DU4A 1J54A 4RBTA 3UCGA 3CC4N 3HFVA 2IC3A 5BXIA 2HHVA 3QWUA 1SZ2A 1FRIA 2KXHA 5HQLA 3PJXA 4AD6A 3QAUA 4ECQA 3PX6A 2N3OA 4J9KA 3H08A 2YJFA 2J9EA 2YQ3A 3O4WA 4KHSA 3DC2A 5JLHA 2LLZA 3IBWA 2ILZA 3A2FA 4DMNA 2WONB 1FJGK 2VYPA 2XWYA 2M70A 1NKCA 4DMZA 3CF5L 4ID5B 1M5SA 3RRGA 5LMUJ 1L5UA 4U95A 1PJ6A 4KH1B 1FKPB 3MCMA 4ZPBA 1V9OA 4B3RK 3CFRA 2YHBA 3RUBL 2B5JB 1PYTA 2W7AA 2FHKA 2F9WA 3VAKA 3CJTA 4CK2A 3CJKA 1X5PA 1U4BA 1OY8A 1ZAVA 5F8HA 3VGMA 5KPRA 1IBKJ 2GBZA 1SJ1A 4EGLA 2OAUA 3TR8A 1FI4A 2E7XA 4K2JA 1TK0A 2IBKA 2Y1IA 3DOKB 3L2RA 3DOMA 1K8KB 1RBAA 3VQ4A 3L3UA 4ZK7M 1YK9A 5D6GA 3OW2R 4NZ6A 1T6CA 4JP8A 4JRQA 3CJ1A 3GIKA 3RBDA 3RBZA 4JV5F 2JWNA 4DQQA 1EJ7L 2GVDA 3AH6A 3CCSS 4ISGA 3M2RB 2VJVA 1HNXF 1DHMA 2YQ1A 2UV8G 7AT1B 2KU7A 3M9NB 4I4BA 4ERDA 4J9LA 5IWAJ 1H1VA 4KRWA 1MWZA 1ASVA 2JC0A 1KLMB 2FIUA 2FBVA 1S7IA 1R8HA 2CQ4A 1E6YA 2NREA 2RHQB 1L3VA 3R2DJ 1YJWN 1XBWA 2VONA 5B09A 4NLYA 5I42A 1BCOA 3EZWA 2W2QP 3D4JA 2FHJD 1DQ9A 1RTZA 2UUAJ 4DHYA 4OJRA 3CQYA 3LUYA 3WNGA 3HX9A 3G9CA 4LBHA 3IG1B 4RCHA 5EXWA 2OTLN 4AQYF 4R0EA 5AZJA 1NJZA 3RW7A 4K0KK 3HI9A 3EEQA 2QA4G 3M8PA 3C7NA 2QYGA 4DR3F 2ZEJA 2R8KA 4DR1F 2F5GA 1W97L 4DCOB 3T1YK 3PX4A 5J2PA 5DGAA 3O08A 2DNRA 4M5GA 1WHXA 4G3IA 4JI1F 3BGRB 2HFZA 4B9VA 3CJBA 1VQ5N 4AHUA 4QS8A 1TV6A 1T0TV 2AW0A 3LZIA 3AO3A 1UW4A 1LV5A 1LAVA 1RXOB 3H45C 4QWBA 3AHPA 3L7UA 2ZF5O 2A40A 5KFAA 4IEEA 5EVZA 4W5TA 1OYEA 1U48A 1KQSM 3P4UB 3OFHA 2NRHA 4JI3K 1AYEA 4BRQA 3MX5A 3UD4P 1AA1B 4F4YA 1QQOA 3MM5A 2XWXA 3E8OA 1T8EA 3J8AA 4CJLA 1NGHA 2DTJA 1Q79A 2F1FA 5DM7Q 4F3TA 3H42A 2E7WA 3SV4A 1RGIA 1ZZFA 1EAYC 4ECRA 4LF6F 5HLFB 3RB0A 3N6LA 2P1JA 1WI6A 3VR1A 4IO9L 2O1PA 2I7PA 4HCCA 1C4CA 4FLZA 3EZUA 4CESA 1LXJA 1LOTB 2DXEA 3CDAA 3K57A 3P49B 3CCVN 3Q89A 3HPGA 1FW6A 1HYSB 4BBYA 1M5VC 3VESA 2B4JA 1HHQA 2C3MA 4QIFA 4DL5A 1Q1KA 1IBLF 4KBIA 4IOCQ 3GSIA 3GR1A 2DGWA 4B1VA 3PIOQ 5AFUH 3FSIA 4NCBA 1WC5A 4QZVB 5DQHA 2V7ZA 1ILYA 4R8UA 5D3GA 2NR0A 3BBCA 3OTEA 3O5TB 2N82B 3FFKB 3V1RA 3SSRA 3ULDA 3EKUA 2QV6A 4DV5J 2PT0A 4CK3A 3B6BA 4HHJA 3MM9B 4H4OB 4IG0B 2XS5A 3HSGA 3P31A 3PACA 3TTFA 3QO9B 4DPTA 2AQ4A 3K9KA 3ITHA 3W9JA 4H0PA 1SKUB 4DCJB 2RE2A 1I1GA 2XSJB 4RU2A 2VG6B 2IM3A 3DDNA 4L76A 4UY8O 5E3CA 2FYXA 1PGZA 2YWKA 4W90B 1S10A 3AODA 4ECUA 2MPUA 3T1AA 3I32A 1TZ0A 3H8YA 1SQFA 1FESA 1I5OB 4AM6A 1MU2B 1N5VA 5KG0A 1W0HA 5IC4B 2RNEA 3M6UA 3CHWA 3MR3A 3L2QA 1F9FA 1NU4A 4DS5A 4IFVA 3HHEA 4A8YA 2UUTA 4KGMA 3AGRA 3K2PA 5A8WA 5I3UA 2D5RA 3HK2A 3AVIA 1YBTA 1JJ2M 1T11A 1UVMA 4OYZA 5GIPA 4F0MA 4KBOA 1P8GA 2W1BA 5I3QA 2B6AA 2M52A 2OMLA 4OX8A 4Q45A 4KHQA 1RT7B 4CBUA 3IXQA 4DFMA 1U1QA 1FFGB 3H3OB 3K8WA 5AQRA 1R0AA 3CCES 4H0TB 3UQSA 3DLJA 4OI6A 2VC1A 2V4RA 1UFWA 4ZPAA 4ED7A 4FM1A 1XMQK 3GIMA 1WSVA 5FLXU 1VSLA 1DFDA 3MPYA 3IRXB 3A1YG 3BS9A 2EFGA 4B9QA 1RJJA 3OTDA 2YNHB 4EZ6A 3S3MA 4Y1DA 1RZMA 2FBXA 2BBEA 2OO4A 2KHOA 3JSRA 4DV4K 3FCWA 3GV5B 4WQ4A 3EVWA 1T9XA 2VPZB 2ZQBA 1PC4A 1QZ6A 1TUYA 4IZ9A 4ED3A 1I94F 3NAIA 3C15A 1EX8A 5BR8J 5F3TA 2NXNA 1TFWA 3HKWA 1X4FA 1KVKA 2OZMA 3HT3A 3G4SN 3LP1A 1PYOB 1EKSA 1JL2A 3KLFB 3DRPB 2DT9A 4OZ3A 2RHSB 3EZ5A 5ITHA 5FD1A 2GVZA 2O8DA 4DV7K 4M5DA 3J80U 4DV3F 2MYFA 2QT7A 4ECTA 3QGGA 1TAQA 3JAMU 2P9LA 1TGOA 3CCMS 1OMSA 1M5KC 2YI1A 3FEZA 1IKXB 2XMWA 3KYLA 3FZHA 4FJXA 1I39A 3UDVA 2YPZA 2E1YA 3LWLA 3ZSVA 2R8JA 3HT0A 1BI4A 3CCJN 4MKVA 4GKJF 4ED6A 1ZAXA 3TEGA 1N36J 2PY5A 4TY8A 1JB0C 4D3GA 5AQLA 1RWNB 1TL7A 2A18A 4MT1A 4OV6A 5BPMA 3OYLA 3GP9A 3DRSA 3DOLA 2RE1A 4CGJA 4ILRA 2M8DB 1EKEA 2E5GA 2BACA 2E2NA 2M9KA 4LUBA 2YCHA 1NMEB 2H3EB 1NOZA 4Z94A 2P9SA 1NUEA 3EDQB 9ATCB 1U2FA 3AD9C 4FZYA 2EG1A 2ZJQQ 4Y65A 1Z4UA 3W66A 3CXCM 3E66A 3C6UB 1HWUA 1YJ9S 3IO1A 3EXYA 4FVCA 2E2OA 2GJFA 1J53A 2CWXA 3MM6B 2E5LF 2YVSA 3OR2A 2J4RA 2HHHK 4CHYA 1FRKA 4CLWA 5DJBA 2NPFA 2PO4A 1S77D 4IEIA 3ONQA 4OL8A 1IG9A 4FN5A 3IGNA 4NB4A 2ZM6F 3OTOJ 4DV0K 3DRRB 2WOMA 1SJFA 2VQEJ 1WELA 3ILLA 4JKAA 3AB2B 4DDFA 3LPTA 3QBWA 3B4DA 3THYB 1VQ8S 4FS1A 3FE1A 3LOUA 1MA9B 3VGKA 2V4JB 3RMCA 1HHSA 1WSIA 5KT5A 2CJQA 1APSA 1SVDA 2JL9A 2W41A 1C0TA 5KFTA 4CHNA 2O5DA 4QWAA 2R2SA 2DFEA 4Q0BB 2HNDA 3C6TA 5DDOC 3G8SA 4GC7A 3V9ZA 4KPYA 2VFUA 1NB2A 1URRA 2Z1JA 2MSTA 1NGIA 2DNMA 2FF3B 1K6YA 1RQ0A 3C46A 4QWDA 3NP5A 4KHNA 3VAGA 4PUOA 4ER8A 4O0JA 4DEZA 4WCEL 4JKCA 3LP3A 2D1CA 1SC4B 1NK0A 4ES3A 1U49A 3LPUA 3DN9A 4JV5J 3KLHA 4BRIA 1JJHA 5D0GA 3Q8RB 2C3OA 1SJQA 4B9LA 3U27A 3KJFB 3G6VA 1HNXJ 3OV7A 2G8IA 4J2DA 1TYQB 4CF1A 2EI5A 1Q7YO 5AE3A 3VGTA 1XMOF 3HOTA 1ULRA 3DFEA 2XMUA 3WXJA 4DFPA 3GFYA 1X1PA 4E2FB 4RR5A 2JOQA 4RUBA 2GC8A 2PFFB 2GQCA 4TY9A 4PCQA 4DL2A 1FX2A 3KWIA 4LBPA 2X74A 4P2FA 1C1AA 2C28A 2CPYA 3PV8A 1HWIA 1JLCA 3OYMA 2KDOA 4LC9B 3CCRN 4J5OA 2D7SA 3MMJA 4TXSA 4BREA 3M1FA 1QUVA 5RUBA 2ZWOA 3A8IA 4NASA 1NGJA 3EZOA 4AUKA 1A5VA 2VGMA 1BL3A 4FJKA 4DR3J 4BCAA 2ZGZA 5AQZA 4DR1J 2P9GA 1ZOTA 2K2PA 1NMDA 5JMVA 3J81U 4J90A 4ZVHA 2CQHA 2KVIA 4KGVB 4BROA 3AAWB 4LF8F 1U1LA 2HMPA 1LFPA 1FJ7A 4I6MB 2A6OA 1HBOB 1RYRA 2OCEA 4XH1A 4OZLA 1QLNA 4OX6A 1MMLA 4Q8EA 2G8KA 1FRJA 2YNGA 4IR9A 4LRFA 1HBNA 5CD4A 1O6XA 4DPXA 1NGGA 1NPRA 4Z37A 1YT3A 3CC2N 2XTJP 2IVMA 4Y1CA 2ITGA 5E2QA 4FXWA 1JLEB 5IQ6A 2HK2A 3MMBB 3MUTP 1NDPA 3ASMA 4DR6F 5BPLA 2ASYA 3VEXA 1LWXA 5B0EA 4CJQA 1QY7A 2KXFA 2C2OB 3DYAB 4Z4IA 4B3TJ 4QIWD 3LDLA 4ZP9A 3AXKA 3DRXA 4LF6J 4JOUA 2OPPA 1FWLA 3RVCA 4P74A 3P6YC 3C94A 1M5OC 1N5SA 3KZBA 1OPIA 4B1UB 1LCUA 2RKIA 4DG1B 4ZOSA 1RDCA 3RGIA 5KT2A 1GLCG 4LF5F 5AJ3F 3VQ7A 4DPYA 3DI6B 4N8NA 3U1LA 2QWRA 2NXCA 2ROEA 1NDKA 4YOUA 4RTFD 1H7XA 2N7CA 2IFXA 5HOOA 3MEDB 5LMUK 2BV3A 4ZVGA 2CGKA 5HBMA 3GPAA 1WSJA 4OPJA 1FD2A 3QT7A 4K4YA 4GY2B 2VFVA 3VGUA 3BEXA 4K4VA 1IQTA 1RWXB 1IR2A 1R6YA 3L7PA 4CERA 2PIIA 1SJ3P 1WC4A 3CCZA 3HVRA 3L4QA 1IBKK 1HBUB 3HSJA 5KFGA 3VQBA 1YKWA 3WXIA 2LU1A 2AWZA 1WNSA 1ATRA 2BVZA 3HPOA 3F5TA 4K41A 4CZHA 1A9NB 1L3SA 3UKRB 2QL9B 5KFIA 2HVEA 2BA9A 2AX1A 1UOCA 1FXRA 4KHPF 1RBOB 1XNRF 2GUPA 2AIRB 4TNOA 2Z1IA 4J7CA 1EXQA 2RQCA 3T1HJ 2KVQE 4OYOA 4C0BA 2I6WA 2YKOA 4URGA 3FDSA 1VQYA 3A3OB 2DGSA 3F2KA 1FNMA 1ICEB 3J81j 2YKNA 1EETA 4NXNJ 3D1QA 3C8YA 4F02A 3H90A 2CJAA 2MEWA 2R7SA 1VQPS 3BP8A 4B9MA 2GELA 2PA8D 1U1KA 3LP2A 1QVFR 4Z4FA 4OZ1A 1CJKB 2ZBIA 3HXMA 5EX3A 1M0SA 3ZSYA 3IWLA 2IDLA 4DPUA 1DURA 2UUAK 2QA4S 1CEZA 4WFYA 3KJQB 3L95X 2ASDA 4DLGA 3CM5A 1QVFM 4USWA 4BC2A 1Y5NB 3CETA 2F9TA 3TP2A 1P90A 5E26A 2K7JA 4NZ7A 2UXDK 5CHCB 2EKYA 1OJ4A 5KFHA 3J7AN 1MW7A 3AV9A 1E3MA 2P8IA 4JI4J 3R9LA 5DO2A 2A1SA 1PBAA 2JC1A 1HJOA 2OYQA 3O6WA 2XYHB 1TUVA 3QSYB 3HP6A 3THVA 3UNYA 1YVFA 1WOPA 2CIMA 2HQGA 4S0MA 5GAGI 2HZCA 3I96A 1T3NA 2MLZA 4F04B 1WSRA 4HTJA 4CCHA 3CCQS 4NI2B 1X4HA 2D0PA 4CIOA 1S1VB 1UVKA 4JV2A 1SKSA 2IRUA 2PC6A 1XQSC 1N88A 3VEYA 4X66J 3EWGA 1RAHB 3NGTA 3TAEA 4E98A 4YFUA 1JLBA 1MG7A 4J2BA 2V51B 4Z0UA 4CECA 5E3PA 2LQBA 1X8DA 1VIXA 1RUSA 1F60B 4DV6J 1R7IA 1D3WA 1VQ9N 1RWMB 4TKTA 1GX5A 2O8FA 2R8GA 2OD6A 1X4EA 4I2QA 2V9WA 1X5OA 5KRTA 4PKGA 3LA0A 1VSMA 1X9WA 2XMTA 1IKWA 5C15A 1NJIO 3T69A 3WNHA 3IAYA 3FZBA 2FLOA 2F4VF 4C8NA 3U1NA 1SC1B 2IBOA 3ZZ0A 1QE1B 1S3XA 1HQUA 3JTPA 1S6QA 1S6PA 1MSWD 1HBMB 1NO8A 3DKDA 1G1XA 3I55N 3RU0A 1GMWA 2CQDA 4E7LA 3RB6A 4JS5A 3TUPA 3FBFA 4KTZA 1Y5IB 2MZJA 4DV5K 2JVRA 2BJ3A 1BIZA 2OEKA 2YNIA 3ZTRA 3CYMA 1KS2A 4KGKA 1U0HA 3P5BP 4F2SA 3KNGA 5M1KA 4MK7A 1M5HA 2J9DA 4OQJA 3FCVA 3TYTA 1RAGB 4BGBA 4FXVA 2WONA 3PSIA 1X5SA 3J7YU 3KOAA 3D0GE 4DU1A 2W8KA 1LWFB 4ID5A 2ZVSA 3W2VB 2J0QD 2A6AA 3KIOA 2FVPA 2XZDB 1NB7A 3RSEB 1FKPA 1WHVA 2CGJA 1A0OB 2B5JA 5F2RA 2DGVA 3FRZA 2LDIA 3E01B 2UZAA 4UY8T 3CO0P 1LWCB 1NGBA 1HWKA 1Y64A 3PRBA 3MECB 3D6TB 2ZBRA 3DOKA 5EUHA 4G1IA 3M8ZA 5AQSA 3LAMA 3M05A 1NU0A 4OYIA 2VWKA 4DQIA 5LSOA 4MFBB 2RF2B 4I7FB 3SUOA 3LANA 1WLJA 1NAQA 3TX0A 5F1XA 2J0XA 1J5EF 2H3GX 2ETJA 2FHJA 1XC3A 2QLFB 3AA2A 1RT6B 1VSJA 3P8BB 3FGUA 3VQQA 4FLXA 4C4WA 4QIGA 3M2RA 3C2PA 1ZZNA 1H2TZ 1C1BA 1B92A 2B4UA 2PEBA 2HGMA 4CYUB 5HQ8A 1CG2A 4BQZA 3LDPA 4BR4A 1RWUA 4A4JA 2OEJA 4CHZA 1ZM9A 1VCTA 3GQCA 5A6PA 3CMES 1FXLA 1SC3B 2RIJA 4ECYA 3S41A 2KLAA 2QSWA 3MUVP 4RL1A 2EHGA 1WOSA 2XMAA 5IOLA 3FVYA 2YWFA 5BR8K 2UUBF 3CDUA 2IVPA 4OHWA 4CEAA 4JI8F 2FB0A 1CLFA 3EVMA 3H2UB 2G8VA 3GU0A 3DWLA 2KG1A 4M94A 2ZKUA 4LIRA 3PO5A 3MAHA 2D0OA 3QEPA 4P72A 1HI8A 3IG1A 5EU7A 1SKRA 1VJQA 4FJMA 1FVSA 4J9NA 5CHIA 4IKFA 3GYXB 2J0WA 2F40A 4IQMA 2H54B 2PI4A 2OHDA 1B70B 4TSXA 4ZCKA 2B3TB 2L9WA 1JK9B 4CGGA 1TL5A 4LF8J 3AY9A 3KVGA 2FBYA 3W60A 2H65B 4XIUA 4FL9A 3BGRA 2P5GA 4GMJB 2G2ZA 2AEJA 3M5RA 3PIPQ 1L3TA 2QFJA 5FPNA 2I9SA 1YJUA 3DNCA 1P8ZA 4IKAA 2PYJA 3QIPB 1CBKA 3TA0A 3GG0A 2A10A 3IM8A 1SH0A 1URNA 2Z2ZA 5KQDA 2RQMA 2A0FB 3CUNA 1WC6A 3CJ8A 2QWMA 4ILLA 3R6MA 2FLLA 3VQ6A 3CERA 4W4MA 4H4MA 4X65J 1BCMA 3V2UC 4BRAA 4CLYA 1MWKA 5FLXY 1SS6A 4X4TA 4MLHA 1TR0A 2D9OA 2VBYA 5HLFA 2BRLA 3AD7C 4LF9J 3NFAA 3CD6N 1X4CA 4QYRA 4MYUA 3LDOA 2JEFA 3GJQB 3PW5A 3CJ3A 4NLOA 2E9RX 2FGOA 4F8RA 1M1KO 4DSJA 3JQJA 3OTOK 1JJCB 1HYSA 2Y8WA 4WFNQ 4WBFA 3VZHA 1NKBA 2VQEK 4DV1J 2MQPA 2ZH3A 2GWJA 2MJUA 3WDOA 2QN6B 1K0VA 4K7QA 4GVEA 3EDRB 3GFZA 3ZZZA 2QI2A 5A2QO 3J80Y 4PYDA 2KT2A 2H5JB 3PIOL 2NRTA 3T41A 1HX1A 1SC6A 1SUQB 3DLEB 3N79A 5HJXA 3VETA 1YXQA 4FJ9A 4C97A 2QW9A 3TTCA 2P5VA 3MM9A 4H4OA 4IG0A 4DN0A 4CNYA 5GINA 2GMHA 3PCOB 3QO9A 1F0XA 3L4BC 2EFQA 4JYAJ 1GX6A 4PXDA 4BY9C 2VG6A 5AZIB 1ZC6A 3N0VA 2IA0A 2F7TA 4YY3F 1YI2N 1QTMA 3S7RA 2UVUA 5D4LA 3H40A 4FLWA 3I33A 4ZLNA 1MU2A 3M6GA 4NCGA 2LA6A 4C98A 3JYTB 4CDIA 3QT6A 5DETA 3E9PA 4ITSA 3KHHA 4JI6F 4JB8B 1FHTA 1VQ7S 4PG5A 2G0CA 2ZD1B 3TUIC 1NSAA 1R59O 4NRTA 4K43A 1XNQJ 3SI8A 4OIXA 4MQ3A 2C2NA 3E1YA 4WZMA 2D1KA 5HVHA 2WZ1A 4MIAA 3T3FA 4CGDA 5KFOA 1Q7YT 4DTUA 3CJ5A 3CQXA 3DLRA 4ZTFA 4BGAA 4BR7A 3MD3A 3RAMA 5CY4A 2RDJA 5IV3A 2J76E 4HUEA 4PG6A 1FJGF 4DWIA 1FNOA 3SQ0A 4DR3K 4F4ZA 4X4OA 2XYPB 4NLQA 5GAEI 5CE3A 1PJ7A 2WW4A 1WKKA 3VF0B 1KC8O 5AQJA 3O1LA 3IRXA 4HCBA 1GH8A 3AVJA 3TWHA 2YNHA 1B0PA 1S6UA 3GJRB 3PX0A 2IVNA 2LKZA 3RMDA 3F56A 4B3RF 1ZXOA 3EPGA 4LQ9A 1QHTA 2GNKA 5DDQC 4RWXA 1KHWA 2W9BB 2GAHC 4P71A 3QBXA 2ASLA 4LFAF 4W5RA 1D9DA 1S1XB 4LSLB 3IR6B 2BUPA 4NLCA 4W5QA 1FVQA 4JI0J 4DU8A 2EC0A 1JJ4A 3KLFA 2E8AA 3DRPA 4UZBA 1TFYA 1NK5A 2LQJA 3HBTA 4NYNA 3KK3B 4I69A 5E3QA 3CCUS 2R8IA 4AE5A 5ETSA 4FLTA 1S4FA 4H5VA 1RHJB 4DL3A 3CD5A 4B3TK 1IKXA 4NLXA 1O0PA 3UD3P 2CQPA 4PKHA 4LF6K 3C14B 1HNZJ 1VSKA 1KWMA 3QICA 4RX6A 5KFNA 2DEJA 3F44A 3TABA 3AFGA 1RBLA 3FEXB 3THWB 2PDAA 2DHAA 4KHMA 3N28A 4CVNE 4DU7A 1Y10A 4Q43A 3ETMA 4OKEA 1BE4A 1RAAB 4F3MA 4O0IA 2ALYB 5ETVA 3NMAA 3W65A 4Y0WA 1T05B 4ZVPB 1RDAA 1SJ4P 4P2XA 4EHUA 4M7YA 3IP0A 1GLFO 4DOZA 3VQDA 1Y3KA 1GK8A 4J9UE 3A3NB 2DNGA 4KE5A 3D67A 3GFXA 5CCMA 4M1KA 1PG5B 5D8HB 4M3TA 1L3UA 3C6UA 1TELA 2CXEA 3J81Y 5JUMA 2PI5A 1ACMB 3QFHA 4K0KF 1JQGA 3MM6A 2CG8A 2PMZD 2BDPA 3V9XA 2DTUA 1N5YB 4J8FA 1EIYB 3CPWM 3T1YF 2BOPA 4TQSA 1BWVA 5EWEA 2CH6A 1FXDA 1GXTA 1S12A 3L09A 1D5AA 4RUCA 5EGYA 3OHBA 3D1OA 3NL0A 3DRRA 5AE2A 3D66A 5JVHQ 1U24A 2OKQA 3EN9A 4FWMA 3T1HK 3QYYA 3NWGA 3UW1A 1QDUB 4JKHA 3QIOA 3THYA 2YX6A 1JLAB 1MLAA 1ZBTA 4O5BA 1O8BA 4PKIA 4OYPA 2RQKA 2V4JA 3IWXA 4URQU 3V9UA 4NXNK 1U8WA 3ALYA 4JI3F 4HTLA 4AXJA 3I31A 2ILYA 3HZGA 3SYZA 1RBRA 3V9WA 3TAGA 2K3IA 2EWSA 3IR7B 4OLOA 1XTZA 5AQOA 1VC5A 1CZ9A 4NLWA 2RJZA 1NK7A 1R8AA 4OZJA 3AVGA 2R7YA 1EB0A 2NZTA 3AVKA 3U7JA 1H72C 5GAGP 2FD2A 4V1Ak 1KAZA 1J5EJ 4ANEA 5A6WA 4ED8A 2GS8A 3T19A 2R7WA 1N54B 4USIA 2C3UA 2LQ9A 3CT9A 1RHUB 3CF5Q 2Q31A 3US5A 1TYQA 2B8QA 3OUYB 3MEEB 2VOOA 1EQYA 3MCAB 3P4IA 2K3KA 4MLEA 1VRTB 1S7HA 3ZC4A 4JI4K 3SLCA 1XIQA 3I9ZA 2OJ3A 2HIQA 3H2VE 3OFEA 1RWWB 2MQMA 3GCXP 2GMJA 4LH4A 3OY9A 1ZTWA 4OHYA 3NAHA 2XULA 4O44B 1VQMN 3K5LA 3THXB 4OKKA 1BMQB 3DHWC 1MMDA 2EW9A 1JLQB 5B0GA 3EXCX 2WBMA 5KTQA 4FYDA 2HFOA 2MLYA 3NEKA 1BUXA 3JSMB 3R5JB 2YHXA 2YX4A 2XY7A 1A5XA 1HKCA 2F4FA 5JLFA 2PN6A 2M2BA 4X66K 3OFFA 2Q3SA 2ZJPQ 4CEEA 5JXSA 3D2FA 1P6TA 1X0PA 3HM9A 3VEWA 4QOTA 3EVOA 4IO8A 3HOSA 4O8KA 1PKUA 5HROB 1LQ9A 2BJ9A 4DV6K 1WC3A 2HHQA 4MDAA 2HBQB 2AX0A 3PR5B 1F5CA 4BS2A 4CO3A 1Q82O 3GCWP 4CRJA 5KG1A 4NLDA 4I2PB 2KH9A 4I6MA 1HBOA 5AQIA 3K0JA 2DNZA 2ASPA 2DD8S 1WBDA 3SIPB 4X4QA 4YS2A 2Q1NA 3Q8YA 1S97A 4CEZA 1RAJA 3TJ9A 2FSJA 5FROA 3FMBA 1A7GE 2JEIA 4PWDB 2OZSA 2E5JA 5BRHA 3TUJC 1VJWA 4USMA 1JLEA 3JXOA 5A0YB 2KO1A 3MMBA 2SXLA 2NUHA 3MR6A 2QWQA 2M88A 2DK2A 4CEDA 3M1VB 1T9YA 2ROGA 3Q7CA 4HYKA 4ZLPA 1NJIT 3DYAA 4JKEA 2E1PA 2I7NA 2VQFJ 3BPSP 2Z4PA 3D45A 1M90O 3VWSA 4C8KA 2FVSA 3NCIA 4F0HA 1RDUA 3UVJB 3VGSA 4MKBA 4AHRA 1D1UA 5KFCA 1XMQF 4P9SA 1S9FA 3J7ZO 3M30B 4OX7A 3KHLA 1U47A 4DG1A 4BRFA 1VRQC 4AHCA 4I6YA 1N5TA 5K8NA 2WTUA 3FLCO 4DV4F 4GV9A 1BQMB 2R3VA 3BJYA 4USUA 2HVZA 4DR7J 4BE0A 2M0GB 1NJWA 3MEDA 3ZXWA 1RDBA 1T95A 1PIEA 5KG3A 2CPXA 3QT8A 4CFCA 2QE5A 3DLHA 4Z4GA 2XY8A 3AT1B 4R5PB 4DJBA 1AUSL 3H1VX 1G4CA 4FVMA 4O3OA 4UQTA 4JS4A 3NDKA 2IMOA 2Y0SD 3TJAA 4ES2A 4DV7F 5AQPA 4YB5A 2XRIA 5KT7A 4C9DA 3KJNB 1HBUA 2CQIA 3AQPA 3PRDA 1WORA 3IBCB 4OGEA 1R8BA 1UKUA 1UL3A 4M3RA 3BGUA 2VUGA 5LT5A 2V9KA 4IO9Q 3UKRA 4NCAA 5DLGA 3JS9A 1FE0A 2AJFE 2I8EA 1ESVA 1YITN 4XO0A 2W9CB 2GUIA 3J80O 1KP6A 2HOEA 2UU9K 1DT9A 3RW6A 4DQ8A 4DFKA 3UKUB 2VODA 3VQ9A 3BM7A 1Q5VA 2RUGA 4ALZA 2PMHA 3NGZA 4M3WA 2VV5A 3OS0A 1VQ6N 3E3XA 4FZZA 3QRQA 3WNFA 1NGCA 3FJ2A 3NH2A 3PW4A 5ADXH 3CIZA 1P1LA 2B8PA 1S79A 2X51A 3CEDA 1KONA 4CQ1A 5HRRA 3TVYA 2VWBA 1I3OB 1SH3A 2GCFA 3PXGa 4CZLA 4I6AA 2XMVA 3MR7A 2HF3A 1CJKA 2YXLA 1UEUA 1KLNA 3WNEA 3IC1A 2BW2A 1K9MO 4RWTA 4LJMA 5FDLB 4JK7A 1HARA 5IS2A 3QFWA 1KVBA 4KI6A 3QIDA 3MR2A 1RYSA 3OHAA 3JSBA 5EX5A 1JMTA 3OBIA 2DRAA 2APOA 4IH6A 5ETKA 3BGLA 1XC9A 4V19J 2AGPA 3KLEB 2W7OA 1VSIA 2MKYA 1VBKA 1WOQA 2F8EX 4DS4A 4TYBA 2Y1RI 4DUYJ 1LXNA 3FQKA 3VF4A 4CJ7A 3MWTA 3ZSQA 3CJRA 4TLQA 2ERRA 1OIAA 4K4SA 2DNHA 1WEZA 2IIHA 3QGIA 1RBUA 4LFAJ 1V5VA 3EE8A 2DFHA 2GQ2A 4M45A 1E4FT 4M42A 1KOOA 3ENQA 1NLVA 1YIJS 3ISND 4DX7A 2RSQA 4HDHA 2O67A 5KGWA 4EAHD 3KD5E 3N4QA 2VD3A 2OTJN 3BKUA 5IT9O 2XLKA 4X65K 2YHYA 4JKBA 4BC4A 1U2RA 1XHZA 5KFYA 2D74B 2HQFA 5D78A 4LF9K 2MGZB 1VK8A 5G4DA 4M7XA 2I0XA 4MKAA 2WB4A 3KWGA 4H0VB 1VFJA 1CJUB 4NZ0A 2BQUA 3AA5X 1FDNA 3W5YA 2CPHA 2HFSA 4ZVUB 2F63A 3BDEA 3C6AA 2O8BB 1QE1A 4JI5J 4DV1K 5L1LA 4PQAA 4WWSA 3KHRA 5L46A 4KH5A 4HTUA 1KOHA 1HBMA 1YQHA 2FC8A 4DR5K 1V5IB 2HGNA 2DGTA 2R2UA 4NLGA 1M1KT 2ZH1A 3VQ8A 3BPDA 4MJKA 4H8KA 2CQCA 4ZIVA 4U9RA 3ENOA 2KYXA 3DLKB 1TAUA 4OPKA 2VBZA 1KAXA 4E1JA 4ZHRB 4KO0B 4ZMMA 3WHIA 1FF2A 4KH4A 2E44A 4A2BA 5D15A 4IH5A 2VIHA 4NYPA 3H1QA 2DFFA 2DGUA 4JYAK 2E1ZA 3AXMA 3PHEA 2L9DA 2MZQA 4TU9A 2ZITA 1NBEB 4GV3A 2OPSB 3CWJA 4OHVA 3MCPA 1D9FA 1MWYA 1PCAA 3BF4A 3W64A 3O8MA 4A8KA 2NXEA 4QQBA 3OYJA 3W2VA 1WBBA 4IH7A 3CCSN 3J81O 1RACB 3VN5A 3KXDA 4E7JA 1N6QB 1AXQA 3TAFA 1TL1B 2E1AA 1G3OA 3OSNA 2HFUA 2VBXA 3P38A 3E01A 1XQIA 1P9YA 5HL7L 1OSCA 4FWSA 2FGCA 3O1WA 1LWCA 4CZCA 5D4OA 1T9UA 4ES1A 3MECA 3G0ZA 5F0WA 1RAIB 1XNQK 1HLWA 3AVLA 3R1XA 3SPZA 1TL3B 2W6KA 3O2IA 4BG8A 4U67L 4I7FA 2QZ8A 2V7YA 4LF7J 2Q43A 5AQWA 4B3SJ 3S3OA 5KPZA 3NGSA 1RT6A 1NM1A 5CR4A 4HKQA 4LRAA 5B08A 4EFHA 3MXMA 5KG5A 4A8WA 4ECWA 2X3GA 2C1EB 3PYGA 3VAFA 3GWCA 4CYUA 2VHGA 4E89A 2W4CA 4BACA 2HBKA 2GIFA 4A8QA 1F9HA 3L9ZA 2E1RA 2ZUAA 1KBRA 5AQHA 1JCGA 2O4IA 1YGYA 5E0OA 2CPJA 2MLXA 4NMXA 2D4WA 1NSQA 1Q9XA 4NXMJ 3L3VA 3I4PA 1E4GT 2V0NA 4JI7J 1HIYA 3UN3A 1IBKF 1KC8T 5EY4A 3QATA 4JI0K 1QSYA 4EZ9A 3HYFA 1TMMA 1GLEG 1UZHA 4WKYA 4B3MK 2KG0A 3TOQA 1ZBIA 3MURP 5IM0B 3UO0A 2KQ2A 4WCEQ 2BXJA 3H2LA 2ZH6A 3ZNJ1 1Z05A 2O8CB 4RBVA 1X60A 2CQBA 3NGDA 3A8KA 1E6VB 2R9LA 3UIQA 2B51A 3OXGA 2DEIA 2P9KB 1FD8A 1BWFO 1ATSA 1RDWX 1W2BM 2ZKTA 1HNZK 3Q8VA 3R7SB 3FGVA 2RUSA 3B8HA 4BR9A 3CE8A 2KB2A 3HCXA 4DXLA 3P39A 1MROB 4E19A 3J7Z5 5DDPC 1YHQS 5H1SV 1QUPA 3ZTSA 2ZZTA 5KFPA 3BH7B 2LXIA 2BZ2A 1X0FA 1NJYA 1X3MA 4MK8A 3MTJA 3QIPA 3MM8B 3SSQA 4J9QA 1YRXA 1RK8A 3ENWA 4URSA 2WW8A 4LFCF 2OI2A 1WI8A 4QWEA 4U7CA 2PFUA 2R8HA 3DU5A 1R3NA 5ELZA 4KQZA 2XMKA 3ZT0A 4C3MA 5LM7E 3DXSX 4F25A 2UXDF 4IDKB 4PHTX 2FSNA 3EPIA 2V67A 1U2VA 4ZVFA 1H2UX 4QW8A 1IG8A 5CCLA 4JD2B 2KXNB 2FJWA 2ADCA 5G0RB 4KJIA 1AROP 3NNHA 3Q0AA 2QWPA 4GO7X 4OYWA 4CGIA 1KDNA 2DR6A 2XZWA 1VC6A 5E41A 3GYGA 4KHUA 1UEKA 2DPIA 5LL6d 2V4QA 1R6VA 4HH0A 1HLUA 2NZCA 5JS2A 5HMXA 4RNNA 5KFUA 3W9IA 1QAJA 5HI7A 4PZVA 1QAXA 2KL8A 4IG3B 2K7KA 2YKMA 2CA9A 2XB2D 4HWIA 1SUQA 3DLEA 1Q78A 5J2QB 4FO0A 4ZP8A 1SQGA 2X7IA 5KOXA 3T9ZA 4X2BA 4BDYA 1TU0B 1N34F 4FPBA 2I5JB 2YJEA 1XUPO 1HD1A 3EGVA 4JV0A 1QVGM 1CS4B 3Q23A 5C2FA 5JVGL 3LO3A 3O5BA 3VCDA 3CCEN 2OMOA 3WQUA 5KT4A 3WT0A 3ZX2A 2XO6A 1RHRB 4CFDA 4OJGA 3VGVA 2F9JA 1WSFA 3ZO7A 4WF9L 4YEAA 1HKAA 4WIIA 4LFBJ 4KAIA 1NGEA 2JGUA 4IFYB 1F3VA 4B1YB 3JYTA 3AOBA 1Z1ZA 1RKIA 1NJXA 3W5XA 1RSCA 4NPOA 1LK7A 3F0NA 1DRZA 4DL7A 3TSUA 3Q7BA 3M2VB 4EWTA 1TKTB 2VG5B 2O66A 3U6FA 2FJBB 3Q22A 4KY3A 4FJJA 3IWNC 3I4HX 1MDUB 5KI6A 2K1RB 4ICLB 2E9ZA 2XGPA 1HNIB 2VWJA 4RWWA 4OHXA 1VQOS 2IM1A 3SMZA 4IDHA 2M5YA 3MMAB 3H5UA 2FSKA 3FZFA 4C23A 3CCMN 4J9RA 1F2HA 4JLHA 3TSQA 1GXLA 2ADBA 4P7VA 3QETA 3D2WA 2JEGA 2DIUA 5DQIA 1RWOB 2BABA 3I5BA 3OYKA 4FPRA 3RBEA 1FKOA 1R8PA 2DNOA 1UTAA 3FBCA 3QWPA 4FYVB 3AB4B 3K9JA 1AFJA 3G8QA 4WP8A 2VCPA 2W9BA 4CH1A 4NL5A 4FWNA 3KLGA 2VFRA 4UOFA 4IRCA 1WG1A 4LSLA 4I6WA 4RUHA 2IRYA 1HPZB 1TVRB 5K8PA 5AR0A 2ZBQA 5CZ1A 3H4BA 4CFAA 1SL2A 3ET6B 4HT7A 1Q82T 3LW5C 3KK3A 1H2VZ 5T7LB 3AGKA 1N4LA 1YITS 1GFWB 4D3HA 3ZCMA 1S1WB 4Z7CA 2RDDA 2VQFK 2LQ5A 1YJ9N 1JXLA 5FPMA 4WJBA 3Q2TC 3C14A 4RUAA 1QD1A 2ATCB 3VVUA 3LP0B 2IJFA 4PPDA 3R97A 4DSEA 3CJ4A 2XGQA 1S9GB 3THWA 4IOBA 4FJGA 3MK6A 2HK3A 2AEFA 2CGLA 2V2ZA 3MOJB 1CJTB 3D28A 1M90T 1T05A 4FJIA 3W2WA 2EBGA 1SCJB 4DR7K 5BR8F 3J7ZT 4PEOA 1C0UB 1KD1O 1DBDA 3MOZA 1XR6A 2NNWA 1VQ8N 4BQLA 4DR4K 3BZKA 4GVLA 4ZLLA 1BWEA 4A8XA 5HMZA 4UOHA 5KG2A 3BBBA 3B6PA 4N77A 1OH6A 3QERA 2AMCB 2ZH7A 1YJNS 3A3PB 2ZNZA 4OI2A 4DX6A 1N5YA 4K4ZA 2HB5A 2PYLA 4F2RA 3H25A 1RT3B 3MM7A 5JMNA 4FW1A 1VRUB 4RW6B 2CJXB 3PLAA 5I4MA 3O3HA 3G6ES 2DVIA 2Q3PA 2RB7A 3HFZB 1YTYA 2DGOA 2KFZA 2CJKA 3K17A 3VQPA 4A59A 2C3PA 3DLLL 2QRRA 2JZ5A 2UXCJ 1JLAA 4MO5A 2HVDA 4WYLA 3WIVA 1C0FA 2C2RA 2R7XA 4USJC 1Z2ZA 2OANA 4CZFA 5K14B 1YAGA 1WKLA 1UWBB 3K2YA 4XPCA 3OA9A 3KDOA 2D3UA 4JKFA 4AHTA 1QAYA 3S01A 3OVNA 5J1PA 1MMNA 2N3LA 1D4XA 1KTQA 3HHLC 2XCPA 1S1TB 4CT9A 3VEVA 2IC3B 2BX6A 4R0JA 1C4AA 1SJRA