4LSLA

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-(4-chloro-2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj476), a non-nucleoside inhibitor
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
548
structure length
548
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Structure-Based Evaluation of C5 Derivatives in the Catechol Diether Series Targeting HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 133
structure length 548
sequence length 548
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4lslA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4lslA05
1RT7B 4DTNA 1RT6A 1TV6A 3NL0A 2XGQA 2QE5A 2KW4A 4ZVEA 5T14A 3VQ5A 3O4QA 2UUTA 3CYMA 3SFUA 4C8MA 3NGDA 2GIRA 4KHYA 5KGXA 2RF2B 3ITHA 3BSOA 1Y97A 4Q8FA 4WFYA 3ZSYA 1YTAA 2A1RA 2KQ2A 4GC6A 1UA0A 4CJLA 3OYGA 3KLFA 1Q8IA 4O3RA 4TY8A 5HP1B 4W5QA 3RTVA 4IG0A 2G8UA 3CJ0A 5KFLA 4DLEA 1RBTA 2G8WA 4O4RA 1VSIA 4DSFA 3V1RA 2KFZA 4FZXC 1S97A 3RRGA 2HMIB 3IS9A 3OYEA 1KLMB 4CF8A 5KFJA 2GIQA 3GILA 2R8JA 4J2AA 5C24A 2VA2A 3TAMA 3ASMA 3QEVA 3P5JA 1RT7A 4O3NA 2XRIA 2E9TA 4ECZA 4RNMA 4K50A 2B43A 4KB0A 3AVAA 3VQDA 4ZP7A 4MKBA 5KFHA 1LAWA 4O4GB 1EP4B 5KFSA 4BE0A 5KG2A 2FJVA 2KZZA 3M8SA 2RF2A 2YV0X 3HKWA 3UR0A 4LQ9A 2PY5A 3O3HA 3LAMA 1U49A 3RMBA 1K1QA 4YR3A 2IA6A 4LQ3A 5HP1A 3K59A 3V81B 1I39A 3TAPA 4R8UB 4CHOA 3IAYA 1S1WB 3MTKA 3Q8PB 4DTUA 3HK2A 1JL1A 4J9QA 4PUOA 2C22A 2HMIA 2VWKA 1KLMA 1TKZB 3OYJA 2KTQA 1FKOB 4ZPDA 4NZ0A 2D41A 4E0DA 2UVUA 4DU4A 4FJIA 1BI4B 3DLEA 1XR5A 2FBTA 4BACA 1TAUA 3LZIA 4O0IA 2R2UA 4DTJA 4ZHRA 4O4GA 1EP4A 1N48A 3DLGB 1KLNA 4B3OB 1X1PA 4ID1A 4F8RA 4N47A 3TANA 1RCHA 3AVMA 4KHUA 2WK4A 3PX6A 1S49A 2EC0A 3BR9A 4DF8A 4KV8B 1DTQB 4DL2A 1L3SA 3SNNA 3BSCA 4B9LA 3V81A 4Y1DA 4NLSA 4CJFA 4R8UA 4JV1A 5DQGA 4RNFA 4E7IA 3DLKB 1SKRA 4K4TA 4JUZA 4JV2A 1TKZA 3DRRB 3PVXA 4NLOA 4FLYA 1FKOA 3T5JA 4FK0A 4H54A 2Q3SA 3SCXA 2DFHA 4CFDA 1VRUB 1BI4A 5KFEA 1NOZA 3EPGA 5KFBA 4URQU 1RBRA 3PY8A 3DLGA 3N6LA 3DLBA 4B3OA 3QERA 1WLJA 3T19A 2BQ3A 3WNHA 4J9KA 3V9WA 1NKCA 4IH6A 4KV8A 1DTQA 4FS1A 3HPHA 3L3UA 4TYBA 3LP0A 2ILYA 1CZBA 1SH3A 3ZSOA 2BDPA 3KLHB 3DLKA 2VG5B 4ZVHA 4DL6A 1S1TB 4WE1B 3L2QA 2XI3A 3DRRA 1B92A 4ECQA 3BQ1A 5KFQA 4W5NA 1LWFB 1NK9A 2Z1HA 1VRUA 3HJFA 4R5PB 3T1AA 2HAIA 3NAHA 3LP2B 3PR4A 3ZT0A 4DL7A 1XI1A 2IM2A 3L2RA 3CJ3A 3T5HA 4H4OB 3NMAA 4M41A 4EEYA 5I3UB 3NHGA 4DQPA 3CJ5A 4G1QB 4ZP9A 4RUAA 5L1KA 3TABA 1BHLA 1RT3B 4FJHA 3O4NA 1B9DA 4ELTA 1KHVA 4O3QA 5KFCA 4Q44A 3KLHA 2R2RA 2VG5A 4C8OA 4EP4A 1S1TA 5KG0A 1WSFA 4WE1A 1JLAB 3H5XA 4IFYB 4DFMA 3GIIA 4CJVA 4FZYA 1CSJA 4DQSA 3AA4A 2VWJA 1LWFA 3U3GA 1TK5A 2OPSB 1D5AA 5DGAA 3UQSA 4R5PA 1VSJA 3LP2A 1DLOB 4GC7A 4CESA 4IG3B 4PWDB 3CWJA 4MIAA 4CF0A 4BE2A 1JLEB 3CJ2A 1A5WA 2IOCA 4EYHB 4H4OA 2UVWA 3HVRA 2W8KA 5I3UA 4J9RA 4MKAA 3KD5E 3KKSA 3OYDA 1RDRA 1BL3A 4FLTA 4DLGA 3DLHA 2AJQA 4IR1A 3CJ4A 1RT3A 5KFWA 3KJVA 4RW8B 3SFGA 4DL3A 4EBCA 4CFCA 2I5JA 1TVRB 4ECSA 4BWMA 3UDLA 4KHSA 1X9SA 2XY7A 2FBXA 2D3ZA 4OJRA 3VQ7A 2PYJA 3Q8QB 4IFYA 4QWBA 4IQXA 3PW5A 1KSPA 4CEBA 1NKEA 1TKTB 1LW0B 3I0SB 1GOCA 2OPSA 4BE1A 4F4YA 4ECXA 4OLBA 3QINA 3K5NA 4IG3A 2FVPA 3L8BA 4M95A 1HNVB 1JLEA 3U3YA 5KT6A 2CJQA 3PUFA 3GV5B 3TQ1A 3IGVA 5FROA 5CZ2A 4AILC 3KIOA 1NNDA 2YHAA 4CJEA 3ZSQA 2EHGA 2FBVA 3VQCA 4RW8A 2D0BA 3OS0A 3NGIA 2XI2A 3GYNA 4QOZB 2W9CB 1TVRA 4I9LA 4CEZA 3RMAA 2P5GA 4OLAA 3MEGB 3RB0A 3HT3A 1C0UB 5DMRA 1QHTA 3ZT3A 4EYIB 1C1AA 4EZ9A 4Q5VA 1RAJA 1S4FA 1TKTA 1LW0A 3DMJB 3I0SA 1B9FA 4CJTA 3OLBA 2OH2A 4IH5A 2EX3A 1HNVA 4YP3A 4ECUA 4K4VA 4CIFA 4KKOB 3KLGB 4QPXA 4DEZA 1JXEA 1X9WA 1HJRA 3THVA 3V9UA 1TK8A 5SZTA 5F8IA 2W9CA 2VA3A 1CXUA 3CFOA 3G6XA 1WNSA 2F8TA 3F73A 2OA8A 4R0EA 3MEGA 1BGXT 4CF2A 2YNIB 5L1IA 3D28A 1C0UA 1WN7A 3HHKA 4RU9A 3UPFA 2DFEA 1FXXA 4NLTA 3DMJA 5KFUA 1QSLA 2YHBA 1D0EA 4CEEA 4CHQA 4PA1A 1RYSA 4J9NA 3QO9B 1IO2A 4CJQA 3VQEA 3OY9A 2GV9A 1RA6A 4F4WA 4KKOA 2ASJA 3KLGA 3H5YA 4ZTFA 4TQSA 3QEWA 2IAJB 1NJZA 4Z0UA 1U04A 3M8PA 1JL2A 4CJRA 1GX5A 3OYFA 3V4IB 3CG7A 2UVVA 3LP1B 2IGIA 1NOYA 3QZ7A 4DSKA 2ITGA 1T7PA 4IRCA 2YNIA 4FVMA 5HRNA 1HQEB 1NHVA 2RKIB 3V1QA 3VQAA 3FQKA 3TAQA 1VSKA 2HHQA 3QO9A 3KHLA 3D45A 4XPCA 2UUWA 3DDKA 1BQNA 3DM2B 3KK3B 2XCAA 2XHBA 4Q8EA 2RDIA 3H2LA 2XCPA 4NRTA 5FRNA 2XY5A 2RN2A 2IAJA 3B6PA 3MXMA 1C1BB 1K1SA 2FBYA 2QV6A 4DSLA 3V4IA 2FVSA 2DTUA 1ZBLA 2ILZA 3LP1A 3KNAA 3E51A 2P5OA 3TARA 5DG8A 1ASUA 1RT4B 2R8KA 1HQEA 3K5LA 3RMCA 3UIQA 3NH0A 1LWCA 2R8GA 2RKIA 5DLFA 2XO7A 2QKKA 1ZYQA 3I5AA 3RB6A 2OPPB 4W5RA 1L3VA 5KRTA 2G8HA 1JLFB 1S9GB 3LZJA 2YNFB 2WONB 4LSLB 1RT5B 4FM1A 3DM2A 3KK3A 4B9NA 2HHUA 3HVAA 4FM0A 5JUMA 3FSIA 5KFDA 2ASDA 4K4YA 1C1BA 1RA7A 4RUCA 2DPJA 1OS5A 3C6UB 1YTUA 1IM4A 3NF7A 4DSIA 3WNGA 4CHNA 1UOCA 3VQBA 4M3RA 4CF1A 4O3SA 4I7FB 4QWCA 1RT4A 5L1LA 3AVIA 4K4XA 3OYAA 1Q9YA 3G10A 4BDYA 2RPIA 3QGIA 3ZT2A 2BR0A 4WZMA 5KFAA 4CK1A 5JXSA 1J53A 4CFAA 3V9SA 2FVCA 3N6MA 3AO3A 1RILA 2OPPA 4GMJB 4K4UA 1HQUA 1S9GA 3OS2A 4DS5A 4H4MB 2JEFA 2WONA 4LSLA 1RT5A 2XC9A 4FJGA 1GX6A 4CK3A 2V4RA 4E1NA 4URSA 3PW7A 5EUHA 5J2MB 3RB3A 4C8LA 2YNHB 3QLHB 2FLNA 3I8DA 2HWIA 1S48A 4LY7A 2YKMB 4B9UA 3C6UA 5KI6A 3GQCA 2XY6A 1NJWA 2IM1A 1RT2B 3KMSA 3S3MA 3ISNC 2Y1JA 2PYLA 4QWEA 5KG7A 2C28A 2R8IA 3PZPA 4KHNA 5DGBA 1HPZA 5EWEA 2WOMB 1HMVB 3AO5A 3NH2A 4JRQA 5KFVA 4LSNB 1QTMA 4ECTA 1YT3A 1TKXA 4HVJA 3NF6A 2ATQA 4H4MA 2IJNA 3H4DA 4DQIA 4J9MA 3D0PA 5KG5A 1ASWA 2IDOA 4FLZA 1JKHB 2FJXA 4E7JA 3K2PA 3VQ8A 1RTIB 4Q43A 4OKJA 3VA3A 1TQLA 2JEIA 3QLHA 1IKWB 1IH7A 3DRPB 3H59A 2YKMA 4KFBB 1J5OB 3LPUA 2AWZA 4F3OA 3O3FA 5KG4A 2F8SA 1L3UA 4URGA 2IM0A 1NJYA 2AU0A 4ED3A 2WOMA 1HMVA 5FDLB 1TP7A 4AHRA 1LWEB 4LSNA 5T7BA 3V9XA 1C0TB 4CJ4A 2B6AB 3SUOA 1EX4A 1Z26A 5KFTA 4WFZA 4YR0A 4EP5A 1KHWA 4K4WA 4C8KA 4ED7A 3T5KA 1JKHA 5KGWA 4AHCA 2AX1A 3CDEA 1BQMB 4CCHA 1HARA 1C2PA 1S6PB 3BSAA 3OHAA 3G6YA 1RTIA 1VSDA 1U47A 4FYDA 5C25B 1RBUA 4NLDA 3DRPA 3I5CA 4FJ9A 3ALYA 4KFBA 4E19A 1J5OA 1XWLA 3V9ZA 4NYZA 4JRPA 3CFPA 1W0HA 4WZQA 1QS4A 4IOBA 5C5JA 1N5YB 2QXFA 3VQQA 1UAXA 3LALA 4KBIA 4IR9A 4K4SA 1WAFA 3ZT4A 2HW3A 4WYLA 1SKWA 1S0OA 4YNQA 1S1WA 2R7YA 3ZSZA 1LWEA 4O44B 1C0TA 2B6AA 3SUNA 4J9LA 2X6NA 2BRKA 2XY8A 4DG1B 3L2WA 2W9AA 3DOKB 1BQMA 3S9HA 1S6PA 3ZSWA 4B8AB 3DLRA 3BQ2A 1EETB 1QE1B 5J2NB 3CDWA 3OJUA 4IH7A 4Q0BB 1RNHA 1ASVA 2FJWA 2ETJA 3KLIB 2IBKA 1JLCB 1TL1B 1SL2A 1S1VB 4O5BA 4O44A 3DYAB 1DTTB 1XR6A 4EO6A 5KFXA 4F4XA 2HHXA 4DG1A 4RW4B 3DOKA 1WSGA 3D5MA 5C42B 1S1UB 2FC0A 4FW1A 4QWAA 3G6VA 4RZRA 1EETA 3L2UA 1WNEA 2X78A 1QE1A 5J2NA 3LDSA 2JGUA 4AHTA 3NGZA 2B4JA 3SUPA 4Q0BA 3PO4A 2IM3A 4OPKA 4ICLB 2JC1A 3KLIA 2F96A 3MR2A 3CM5A 3MFHA 4FLXA 1JLCA 3G0ZA 4KHQA 1TL1A 3AVFA 1S1VA 3SZ2A 3PJXA 3AA5X 3DYAA 4DTOA 4W5TA 3QEPA 1DTTA 3VQSA 4FBUA 1O1WA 1TGOA 3SQ4A 1ZBFA 4F4KA 2ASLA 4RW4A 3GIJA 4ECVA 4NCGB 1R0AB 5HROB 4NLQA 5C42A 5KFOA 1S1UA 4QAGA 3F9KA 3VQ4A 3OLAA 4CE9A 4FJ8A 2W42A 1ITGA 4O3PA 4G1QA 2XGPA 2D3UA 4FLWA 4J9PA 3KTQA 4KRFA 1W25A 3SYZA 3SQ1A 4CGJA 2BQRA 4JS4A 5DK5A 3VQ6A 1SL0A 4FJNA 1JLAA 5F8MA 3BQ0A 4CJSA 3CVKA 4HCBA 1DLOA 2IS3A 5DQHA 4NCGA 1RT1B 5HROA 1R0AA 4PWDA 1S9FA 4PY5A 5F8HA 3HL8A 4ECWA 4CJPA 3H5SA 1RDBA 3NH1A 3H4BA 3QETA 4ZVFA 4M3TA 3BSNA 4E7HA 2Z1IA 5KG3A 1SL1A 4BWJA 1QSYA 2FLLA 4FM2A 2HHWA 5CYMB 1HNIB 3KKRA 1S0NA 1WSEA 2A1SA 4DFPA 2ZKUA 1RTJB 1T03B 2G8FA 1S5JA 3I5BA 2C2DA 3ULDA 4ZP6A 5KT5A 1KCFA 3RBEA 1NK8A 2W9BB 4N56A 3LWMA 1D1UA 3NCIA 3H40A 1RT1A 3V6DB 4E7LA 1NK4A 3JYTB 3ZCMA 4LH5A 4IBNA 4DSEA 4KTQA 3AA3A 4DTPA 3NGYA 2J6TA 1KVBA 4M94A 4NCBA 4F2SA 4DFKA 3CDUA 4YQWA 1A5XA 4KHRA 4NRUA 5KRSA 4KTWA 3HSTB 1HNIA 4CFBA 4HCCA 1LW2B 4TQRA 3TAGA 2D0AA 4EBDA 1RTJA 1T03A 4E89A 4NLRA 3QZ8A 3E01B 3U6FA 4K8ZA 1KFDA 4DTRA 1VK0A 3V6DA 3PX0A 5CZ1A 4Y2CA 3CIZA 5KTQA 2O4IA 3JYTA 3EY1A 3PV8A 3AVHA 4ELVA 1XHZA 4FS2A 3OYHA 4NLVA 3PO5A 3QIDA 3I0RB 4F2RA 4MK8A 4C8NA 4HUGA 5KFIA 1RBVA 3C95A 1WSJA 5FRMA 3CO9A 5EDWA 4RW6B 3S3OA 1NK6A 1LW2A 4KI4A 2Z1GA 3M8QB 3NAIA 4E7KA 2CKWA 4G3IA 4OVLA 1ZTTA 5EWGA 1SUQB 1UWBB 1WSIA 1J9AA 1TKDA 4CF9A 1WSHA 3E01A 3AO4A 5KT7A 1G15A 4CK2A 4AH9A 5KFMA 4FJKA 1N6QB 3PX4A 4TSXA 4CHYA 4CGIA 3V6JA 3TI0A 1IKYB 3M8RA 2HNDB 1S9EB 4RW6A 4NLYA 3B6OA 5KT2A 3OS1A 4FK2A 1U48A 1RTDB 1VSLA 3M8QA 3MR3A 3RAXA 4BDZA 1NJXA 4ED0A 2GBZA 3LP3A 4DSJA 1SUQA 3C94A 1UWBA 2BE2B 2P51A 4OGCA 2C2RA 4RNNA 2IC3B 4IFVB 2WTFA 4FW2A 3OYCA 3KLEB 3OHBA 3RR7A 4QW8A 3MEDB 3NF8A 1A5VA 4OKEA 3OYMA 4GW6A 3JSMB 2C2EA 4NLPA 2RDJA 4EZ6A 2YNGB 1IKYA 4I2PB 3SUQA 1SH0A 4AHSA 1S9EA 4KTZA 1RTDA 3SV4A 5K14B 4DTXA 4FJXA 4DL5A 5DQIA 4KPYA 2HHVA 3BGRB 4QCLA 5D3GB 4XIUA 4KREA 3DRSB 4KO0B 4CGDA 1C0MA 4J2DA 4FJ7A 1JLFA 2E6MA 2IMWP 2IC3A 4IFVA 3KLEA 1YVFA 3H98A 2YNFA 2VG6B 3MEDA 4ELUA 1RDAA 3KLFB 2HWHA 3KLVA 3JSMA 1LV5A 2WRMA 4TY9A 4FXDA 4DQRA 4IKAA 3EPIA 4CJWA 1QAIA 4I2PA 2Z1JA 2X74A 1CXQA 4GVMA 5KFGA 1U09A 3V6HA 5C24B 4QWDA 1S1XB 3SI8A 1C6VA 4I7FA 4N41A 4ZPBA 4OKKA 5K14A 1F21A 1ZBHA 2O5DA 1U45A 5J2QB 2BANB 3BGRA 5D3GA 3DRSA 4KO0A 4Q45A 4DTMA 4CJ5A 2D5RA 4Z4GA 2VG6A 3TAFA 4DL4A 4B08A 3AA2A 4CEQA 1C1CB 4OGEA 4IRDA 3OJSA 3SV3A 5J2MA 3K5MA 4CEAA 2YKNB 3TR8A 4CEOA 4PUOB 2YNHA 4CECA 3AVGA 2BRLA 2V4QA 3MXIA 1RT2A 1S1XA 4NLWA 4QW9A 3DLEB 1QQCA 2NUBA 3SI6A 2AGOA 4HKQA 4OPJA 4JS5A 4ZHRB 5J2QA 2BANA 4MK9A 2PZSA 4IRKA 1J54A 4BDPA 1W9HA 4ZMMA 3S3NA 2KZMA 3GV8B 4ZVGA 4ID5B 3MECB 1D9FA 3QGGA 3HM9A 3DI6B 4NYFA 1YVUA 3MEEB 2IJFA 1IKVB 1C1CA 2Y1IA 5KG1A 1BISA 2YKNA 3Q8RB 2P1JA 1IKWA 1EXQA 4F3TA 5KT3A 3HXMA 3HP9A 3MFIA 2ZE2B 4CGGA 4HYKA 3SPYA 4IDKB 1T94A 4J9SA 4EBEA 4Z4CA 2HVIA 2W7PA 4U7CA 2UVRA 3OL6A 4Z4FA 4F50A 3KD1E 4CIGA 2WCXA 4B8CA 3PJWA 3RBDA 1HYSB 2R2TA 5F9LA 5FDLA 3OSNA 3OVNA 4WXOA 3P83D 1S6QB 4O3OA 2GC8A 3CQ8A 1BCOA 4ID5A 3RRHA 3MECA 4WXWA 3DI6A 4E1MA 4MIBA 2DFFA 1XC9A 3OYBA 3MEEA 2J6UA 4DS4A 3LP0B 1IKVA 4DMNA 4NCAA 4NLUA 2D0CA 1S10A 3AVLA 4MFBB 4DU3A 1REVB 1XHXA 5C25A 4K8XA 3DOLB 4ZPAA 5KT4A 2ZE2A 4N76A 3OYKA 1CZ9A 4IDKA 1SH2A 2XWYA 2HB5A 5F8LA 5KFZA 4FJMA 4DU1A 1X9MA 1EKEA 1N5YA 2OZMA 2HHSA 4WFXA 1T05B 1HYSA 5F8GA 2D7SA 1KRPA 1S6QA 3MF5A 4O0JA 3QEXA 2DY4A 2E9ZA 4YR2A 3ZSXA 3HP6A 1TL3B 4KAIA 2GUIA 3KMQA 5F8NA 3C6TB 3NKYA 4K4ZA 2X6SA 4CHZA 4MFBA 4Z4EA 1REVA 4CERA 2JLEA 5CYQB 4W5OA 3L2VA 3DOLA 3QNOA 4CJKA 5KFRA 3PW0A 2DPIA 2AX0A 4B9MA 5HBMB 3IRXB 1NK7A 4M3UA 2WB4A 1Q9XA 3PR5B 3HO1A 3FFIB 4TXSA 4B9SA 1WAJA 5HRSA 3IG1B 3TAEA 4HUFA 5HLFB 1T05A 5E41A 4DWIA 3SQ0A 4WYWA 4X2BA 4CGFA 4RW9B 1NHUA 4DF4A 5I42B 3IN5A 2FVQA 3MR5A 2G8IA 2I1RA 3TVKA 1TL3A 3M9MB 3AO1A 5EU7A 3KJVB 3C6TA 4RNHA 3VQPA 1CLQA 3EYZA 3KK1B 4FJLA 3VA0A 2I5JB 1T8EA 2O4GA 3PW2A 2LSNA 5CYQA 4XPEA 3RMDA 3CM6A 3HPGA 3MR6A 2JEJA 3OYLA 2FVRA 5DLGA 3WNFA 5HBMA 3IRXA 4RNOA 4ICLA 1NK0A 2HHTA 3AVKA 3FFIA 3K58A 3IG1A 3HPOA 2JEGA 5HLFA 5J2PB 4ED8A 1SV5B 3NFAA 4RW9A 3KHRA 3LANA 5I42A 2BGGA 3OYNA 3HVTB 5DG9A 4KI6A 4DFJA 4CJUA 4FLVA 2HNYB 1I6JA 1JLGB 3QIPB 3H08A 1Z25A 2OYQA 3KK1A 2W8LA 4UQGA 4JLHA 4DQQA 3GIKA 4ED6A 3L3VA 4TYAA 2ALZA 4HHTA 5KG6A 4EO8A 1TAQA 5KFPA 1RDCA 1KVAA 4I2QB 1BCMA 5L1JA 3V6KA 3AVBA 3RR8A 4CEDA 5J1EB 3MAQA 4YFUA 5DG7A 4KB7A 3NE6A 5J2PA 3LAKA 4IKFA 2G8VA 1D8YA 5KFNA 1SV5A 4ZPCA 3KHGA 3NBPB 4YMEA 4H8KA 1FK9B 2V9WA 3HVTA 4M45A 2OPQB 4FZZA 2HNYA 2OPRB 3AVJA 1JLGA 3QIPA 4CIEA 1JXBA 3QYYA 1QUVA 1ZTWA 1MMLA 5HRPA 3KOAA 4DTSA 4I2QA 1IKXB 2QK9A 5JS2A 4L8RB 4M3XA 4MH8A 2G8KA 3ISND 5J1EA 1XR7A 4KAZA 3RB4A 1U4BA 1L3TA 4ECYA 4XO0A 3K5OA 5F9NA 3AO2A 1RTHB 5CYMA 3QIOA 3RWUA 3NBPA 2VG7B 1K6YA 4J2EA 1FK9A 1RBSA 4CGHA 1L5UA 2JC0A 4Z4HA 3NF9A 3N6NA 3QNNA 3KK2B 2OPQA 4M3YA 3M8PB 5L9XA 3HVWA 1D9DA 3OSPA 2OPRA 1HYVA 2W9BA 4M3ZA 2R8HA 1HYZA 1NKBA 1JIHA 4TLRA 5KFKA 3FRZA 3QESA 4M42A 4AHVA 2OZSA 5HRRA 4NLXA 3OL7A 4O55A 3AV9A 3LWLA 1JLBB 3VN5A 2F8EX 1IKXA 3ZT1A 2J6SA 3VQ9A 1QSSA 3GIMA 5EWFA 4F4ZA 1RTHA 2FLPA 1JLQB 3TWHA 1UA1A 1BQNB 4E3SA 4LD0A 2V0NA 2VG7A 3WNEA 3HYFA 1RYRA 1RDDA 1MU2B 4B9VA 3LPTA 3KK2A 3AVNA 3BJYA 3QEIA 1LAVA 4JV0A 3SQ2A 3EZUA 4KHWA 1TK0A 1ZETA 4ED1A 4FJJA 4KB1A 4ZP8A 2ZQBA 3Q8SB 4FCYA 1LWCB 2WHOA 1JLBA 2W7OA 5JS1A 1VSMA 3I0RA 4KHMA 1KTQA 4CEFA 2AGQA 2HNZB 5SWMA 1VSHA 3AVCA 1VRTB 4J9OA 1JLQA 4ZTJA 1IG9A 4OL8A 4M3WA 1ZBIA 1MU2A 1VSEA 4U6PA 2ZD1B 2AGPA 1QAJA 1BIUA 2B5JB 4I9QA 3OL8A 2E6LA 4CJ3A 1GOBA 3MXJA 2E9RX 1BIZA 5F8JA 1NK5A 3BDPA 1GOAA 1VSFA 3PHEA 3PW4A 3H5UA 4PQUB 3G86A 1N6QA 4RW7B 4FJ5A 4Y1CA 2QKBA 2HVHA 1HRHA 3FDSA 4TN2A 2BQUA 4KSEB 4KE5A 4MQ3A 2HNZA 3FQLA 3SPZA 2E4LA 2ATLA 4NLGA 1HQUB 4B9TA 3T5LA 1VRTA 1FKPB 2HNDA 3IGNA 4NYNA 4FK4A 2KFNA 3V1OA 1I3AA 1KVCA 3CFRA 4FBTA 1RT6B 5CY4A 1TV6B 3EZ5A 4RG8A 4HUEA 4Z4IA 3ZSRA 1T3NA 4ED2A 3SJJA 1JXLA 4LH4A 1N56A 2ZD1A 3O3GA 2R2SA 2B5JA 5KFFA 2BE2A 1KFSA 3ITHB 1S0MA 3BREA 3RAQA 4N5SA 3OYIA 4MK7A 1ZBUA 3NDKA 3M9NB 1Z4UA 3NAEA 3ICLA 4PQUA 5KFYA 4AHUA 4Y34A 4J2BA 4RW7A 1JX4A 4TY8B 3OL9A 3T3FA 3ZSVA 3K57A 4FLUA 4ECRA 4IG0B 3M9OB 1HPZB 3A2FA 3QGHA 1N4LA 4Y3CA 4CHPA 4Y2AA 1TKXB 3IS9B 3P1GA 2YNGA 4HTUA 1SKSA 3KHHA 2AQ4A 1FKPA 3TAMB 3GV7B
chains in the Genus database with same CATH superfamily
3S01A 1RT6A 2XGQA 2DHAA 3RRKA 2I0XA 5T14A 2QXLA 3O4QA 1RTZA 3CYMA 1LFPA 4OZ5A 2P9IA 2VPYB 2HGMA 3NGDA 4LFCJ 4KJIA 5KGXA 3ITHA 1K9MO 3EICA 2EFGA 2XMVA 5C12A 1S5ZA 5GADU 1N36J 2A1RA 1O51A 2A1BA 1UA0A 3EE9A 1FEEA 3BKFA 4WQ4A 1HI8A 2XLKA 4EIAA 3HI9A 4O4RA 4DSFA 3PRDA 3V1RA 4FZXC 1S97A 2HMIB 1XMQK 3IS9A 1BWFO 4FPAA 2OIHA 1KAXA 3C8YA 4CF8A 4NOHA 2GIQA 4LBPA 2R8JA 4AF1A 1HNXK 2F9JA 2VA2A 2E66A 3ASMA 4C7QA 3P5JA 4K50A 4KB0A 4RBTA 3VQDA 2ROPA 4ZP7A 4AL7A 4MKBA 2ZBPA 1Q81T 1EP4B 1PBAA 1JJCB 5KG2A 2KZZA 4HTLA 2RF2A 1WJ9A 3ZZPA 3HKWA 1UEUA 1OJ4A 3HOTA 1YJRA 3CMES 3RMBA 1K1QA 3J7YI 4LQ3A 2HF4A 4HHHA 5IXUA 2R3VA 1O5JA 3V81B 3HK2A 2GTDA 3CPWR 3QBWA 2MJNA 1KLMA 4ZPDA 4NZ0A 2P9LB 2D41A 4E0DA 4DU4A 1BI4B 1XR5A 3M6GA 3LZIA 4LIRA 4TLQA 3CPWM 1R3NA 1VHFA 3K17A 4KHUA 2WK4A 1S49A 4MTPA 1HD0A 3A4TA 4KV8B 3BV8A 3SNNA 2HMPA 4JI2K 2E1PA 4KHPJ 1SIZA 5IV3A 4JI4J 1Z1ZA 4CJFA 4R8UA 4JV1A 5C2DA 3BPDA 4E7IA 3DLKB 1WC1A 1SKRA 3S7RA 3IA0A 4K4TA 2HURA 4JV2A 4LF4J 4NLOA 1H74A 4ILRA 5KFEA 1I94J 1MMNA 3PY8A 3N6LA 4DV0J 1U1QA 3T19A 4LSZB 4J9KA 3FCWA 2H4WB 1NGCA 1KONA 5LMNK 3DXKA 1VDHA 4IH6A 1NPRA 4FS1A 3KFWX 4TYBA 4BR4A 2E5LK 4RBVA 2HBZB 3SIPB 3C3LA 2BDPA 1VRQC 2CGJA 2FPHX 4JKFA 5KOWA 4XH5A 4BRHA 4GKKK 2M88A 3H3NO 3R6GB 1Q4RA 3RAMA 2P9UA 5CYJA 3NG8A 3IUCA 3J7A1 3RZAA 4I6AA 1HQ2A 4R0JA 1YIJS 4LF7F 3QRQA 5EX0A 3WC0A 1VRUA 1HUXA 2Z1HA 2BUNA 3O8MA 2LXFA 1UZDA 3CCJN 2FYXA 4K42A 1R8CA 1XI1A 2IM2A 2YH0A 4J7CA 4LIWA 3L2RA 1RWOB 3CJ3A 1TUVA 4EEYA 1RLDA 3NHGA 3TR5A 3PIPQ 4LT6A 4LF9F 1S0VA 4DR5J 3TABA 5B09A 1BHLA 1TL7A 1RT3B 3O4NA 2BMBA 4ELTA 1KHVA 2OGUA 2HQ3A 3P5TL 3G82A 1T9VA 3KLHA 2VG5A 4JI0F 4C8OA 4EP4A 5KG0A 1WWHA 4XDDA 4OYPA 3W2WA 3VTIA 3TTDA 4DQSA 2Y3YA 3LP2A 3O3LA 3AB2B 2RUGA 3CWJA 4MIAA 4BE2A 3J7AN 1A5WA 3W9IA 3HVRA 1NCLA 1OKJA 4NO7A 4P72A 1NWKA 3KKSA 1RDRA 4IR1A 2XTJP 5GAHI 2WBMA 1G2EA 2IRUA 3WEEA 2EW9A 4DL3A 4EBCA 4GVBA 1YZ6A 4DR6F 4CFCA 4M5GA 1NSQA 4JYAK 4JI1F 1O6XA 2OTLS 4OJRA 4IFYA 4QWBA 5AJ3F 1KSPA 3OFFA 1LW0B 3I0SB 1Q7YT 2YKAA 3MM8B 5LJ3Y 4OLBA 3QINA 3J7AP 4U8YA 3K5NA 4IG3A 3WQUA 1JLEA 1U25A 1HBOA 1KN6A 2U1AA 3CETA 3SCJE 4H5TA 4O8KA 4MLEA 2FBVA 3VQCA 4RW8A 3CXCR 2XI2A 1N33J 4CO5A 1IUJA 4D3HA 1X4AA 3RMAA 2P5GA 5AFUA 1UVLA 1ZH5A 4YDDB 4OZ1A 3MEGB 1UETA 3HT3A 1IBCB 3IMQJ 1M90T 4CH1A 5FLXY 5M1QA 4EYIB 3D2EB 1U1KA 1C1AA 3MXHP 1WKKA 3DMJB 1VQ4S 3V2UC 1B9FA 4M5MA 1OH6A 2ZWOA 4IEIA 2ZUGA 1UPPA 2BKOA 3EMTA 1GLDG 4DEZA 3I96A 1X9WA 2XMWA 4A57A 3D6MB 3QBXA 3HT0A 3VALA 4C1NI 1RAFB 1IBKK 1VC0A 5F8IA 2VA3A 4NXMJ 1OY9A 1SS6A 1KEKA 3QDKA 4R0EA 2EFOA 2Z2YB 2EEYA 2KXFA 2VJVA 2YNIB 1LQ9A 3HHKA 1FWPA 4FYWB 1GXTA 4O0NA 2YHBA 4PA1A 1RYSA 4DX8H 4J9NA 4X66F 1Q82T 1D09B 4CJQA 3CQYA 3CTRA 4KKOA 3JQMA 2VKZG 3KJNB 5ETLA 4AL6A 2YPYA 2OHDA 1N0VC 5JLHA 4OYBA 3QEWA 1F3VA 1NJZA 5IC4B 4ZIWA 4J91A 4WQ5C 1DY3A 5LMUK 1RHRB 3LP1B 3MD3A 3DLLL 1NOYA 3QZ7A 4DMZA 2HZAA 1YI2S 4FVMA 1HQEB 3RG6A 1DGKN 2RKIB 2MZTA 4A47A 2B8QA 4X65K 4DR4J 3OTOK 3TAQA 4DV2K 4LF6J 2DR5A 1H3DA 4KH0B 4XPCA 4YB5A 2UUWA 3G96A 1VQPN 3DM2B 2EWSA 5H1SQ 2AF6A 4OHXA 2J7KA 2QFIA 4KH5A 2XCPA 2MMYA 1X5SA 1SJFA 3B6PA 2RQCA 2W01A 1C1BB 1K73T 1PJ5A 4PG8A 4HH0A 1YK9A 3LGMA 2HG4A 3TARA 2GVZB 1FESA 2LKZA 5DG8A 2K2PA 1RT4B 2R8KA 1UVIA 3UIQA 3NH0A 1LWCA 2AZ3A 4A2AA 2NUUG 3MMBB 1GLAG 1TU0B 3D4JA 2XO7A 1ILYA 4DR1F 2CUYA 2FGOA 3I5AA 4UQTA 2DGTA 1XTZA 1U24A 5KRTA 3LZJA 5D6GA 4FM1A 2J0QD 4YHHJ 4X4QA 4ZS6A 3KK3A 4G1IA 2ACYA 1JCEA 4FM0A 3VF2A 5KFDA 2ASDA 4BGAA 4K4YA 3DRYA 4RUCA 1OS5A 4YDXA 1IM4A 3NF7A 1YTUA 1IJJA 4QR1A 4CHNA 3MDQA 4CF1A 4O3SA 2JZ5A 4N8OA 4ZLNA 1J5EJ 1Q9YA 4FNIA 4JBCA 3CHWA 1NGDA 3I56S 3QGIA 3ZT2A 4CK1A 4CFAA 3UE2A 2FVCA 3N6MA 2KH9A 3BO4A 1RILA 4ILHA 1NSKL 1HQUA 3BF1A 1E6YA 2JEFA 5ADXA 4FJGA 2M0GB 1NGIA 2V4RA 4E1NA 2V2KA 3AY9A 5B8HA 4PG4A 1JJ4A 5J2MB 1RAIB 3NVKA 2E1YA 3JQJA 3ILIA 3CJBA 3GQCA 3GE1A 1NJWA 1KAYA 2IVNA 2V8HA 2VOPA 3D3CJ 2DKOB 2HBYB 2FIUA 2QA1A 3EGNA 3WQTA 3W64A 1MNEA 4HT5A 2C28A 5EWEA 3AOBA 4A5BA 1HMVB 3AO5A 3FBCA 1WSVA 1VAZA 3ID6A 5AXNA 2HSTA 1K47A 2LU2A 4H4MA 2IJNA 1GXLA 5IWAF 4J9MA 4PKDB 2C1EB 3T1HF 5DDPC 3GYXB 2FJXA 1YVNA 1KR4A 5AQZA 3K2PA 3VQ8A 4OKJA 1SJ3P 1QAXA 3D6TB 1TQLA 2JEIA 3QLHA 1IKWB 4IZ9A 3RSEB 2EBGA 3H59A 2P5VA 2KM8B 3HZ6A 1R43A 2IYGA 4C2MA 3O1WA 3UKRB 4PG5A 2FJBB 3O3FA 1L3UA 1ZBSA 2E7VA 4URGA 2IM0A 4RWXA 3CF5Q 2YX1A 1TP7A 4AHRA 2F8HA 1Q81O 5IOLA 4CJ7A 1GLLO 3JS9A 2MKJA 4OX9J 1XNQJ 1EX4A 2UXCJ 5AZIA 2E1MC 1YJWN 4WFZA 2QI2A 1HNWK 3GBTA 4NL5A 1JKHA 3WXIA 4PPDA 5GAEU 3I31A 3CCEN 4B3MK 3ZYYX 1RTIA 1U47A 1JQGA 4FYDA 4DUYK 1U0SA 3UE5A 4CP5A 4BS2A 2JWNA 2UV8A 1YBTA 4UF4A 1U1LA 3ZETA 1UPMB 4JKEA 1M0SA 2DK2A 3JSYA 4IR9A 1KKHA 1CQMA 2HSEB 2GV1A 4WYLA 5CR4A 3HF5A 3NCRA 1S0OA 2R7YA 1S1WA 4K8RA 2A3ZA 2MSTA 2B6AA 3B4DA 3FCHA 5DO2A 3SQOP 2E8AA 3DGPA 3VTHA 4DG1B 2EG2A 1E4FT 3W7BA 2O8BA 4HACB 5BJRA 3DOKB 4JI3K 1BQMA 4RWWA 1WHYA 1C4CA 4ZVSB 2QRRA 4B8AB 1PYSB 3MCOA 1NJIO 2J9DA 1EZZB 5J2NB 3OJUA 2ZBQA 2FJWA 2H5EA 2M9KA 3KLIB 3AGKA 4BRNA 2QMWA 4ALZA 3MUTP 1P27B 1S1VB 5AXMA 4FZVA 3MPWA 3UVJB 4GMKA 1XR6A 5KFXA 1FE0A 1NDPA 3VAGA 1OQ3A 1F2GA 2YWFA 1FNMA 3DGVA 1S1UB 2UP1A 2G0JA 3WUHA 1EETA 2GVDB 1HNZK 1WNEA 4A8KA 5EXWA 4UY8T 4AXJA 5JJBA 1GAOA 4FWPA 2IA0A 4Q0BA 3VGUA 4CBUA 3H6EA 1X4EA 1R0BG 1RDUA 2F96A 1FJGJ 3IWLA 3HJVA 1VOMA 2QWLA 3CJRA 4AQYK 3P3DA 1TZ0A 3AA5X 1SQGA 2XMAA 1KOOA 3QEPA 4F67A 1DTTA 1RWXB 2Z8QA 5GIPA 1S59A 2BKPA 1BMQB 5KQDA 4QU7A 3R97A 2RRNA 5AQVA 1FT8A 3O2IA 2E5IA 1KVJA 3BN4A 2JFKA 5HROB 3MR7A 5C42A 2C2ZB 2BVZA 3LTOA 3F9KA 1VISA 3OLAA 5A8RA 4NYPA 1FFSB 2CPXA 1HW9A 4J9PA 3KTQA 4L72B 2WBRA 4NB4A 4F4AA 2BQRA 4DN0A 4JS4A 5DK5A 3EDQB 1SL0A 3VQ6A 4CI6A 3T7ZA 2N82B 2CPDA 2WFBA 5RUBA 4CJSA 3MDFA 5JVGQ 3A3OB 4NCGA 3GZ7A 1S9FA 4PY5A 3H2VE 3HL8A 2L48A 1RDBA 3NH1A 3W9JA 2CNNB 1ZPVA 2QYCA 1UTAA 2DISA 4M3TA 3ISZA 4A4JA 4PXCA 1SL1A 2Z1IA 1WI8A 2GS8A 1LXNA 1N34F 1Q7YO 1QSYA 2QN6B 4JI8K 4DV1F 1QVGR 4FM2A 3M1VA 1VQOS 4MKVA 3O08A 1HNIB 2R7SA 1WSEA 4DFPA 2M52A 2ZKUA 1XK8A 2G8FA 1UMJA 2ZH5A 4ZP6A 2MEWA 1NK8A 2E5GA 3FSYA 4M1KA 2HFOA 2RS2A 1RACB 4BRPA 2J6TA 3A8JA 4B1XB 2G2ZA 1SJ1A 1M90O 1VQ5S 5LM7E 3AJDA 3ZTRA 4DR2J 4BC9A 4NYOA 4YQWA 1VQNS 4BR9A 4KHRA 1YBAA 5KRSA 4BQZA 4GV6A 3QFPA 4CFBA 1R8AA 4OZ0A 1UW9A 4HI1A 2CNOB 2DT9A 2LP4A 4A8YA 2DNKA 3EO3A 3U6FA 3T9ZA 4K8ZA 2CQCA 2UXBJ 1VK0A 2O4IA 3JYTA 4IO1A 3EY1A 3Q2TC 3OYHA 3W8GA 1FRMA 3QIDA 1RBOB 5JMNA 4F2RA 2Y1LB 3H1VX 4C8NA 1NRKA 3TZYA 5KFIA 2CGKA 2DNYA 4PXBA 5I3QA 3QB0A 2P9CA 3W5ZA 3C95A 2C3OA 5IQQA 1Q82O 2ADCA 1MMDA 4KI4A 2Z1GA 4B3RF 1Y00A 4G3IA 2F40A 4B3SK 4ZK7M 1JNZB 5EWGA 2JWKA 4GV3A 3U7JA 1J9AA 1WSHA 1VJWA 1G15A 3OA9A 1KDNA 1YITN 4CK2A 3OVBA 4AH9A 4GKJJ 3HHLA 5HK4A 5KFMA 1ESVA 3PX4A 2J0SD 3Q24A 4WP8A 4FF3A 3CJ7A 4CGIA 2QC3A 2Z2ZA 5JVHL 2GHVC 4USTA 4RW6A 4NLYA 1XNRF 5KT2A 1RTDB 4KHPF 2KM8C 4JI4F 2RMLA 4RKUC 1NGHA 1IR0A 2ZZMA 1SUQA 1UWBA 1JK9B 4L3QA 2P51A 3W0LA 3MCSA 1YWXA 2DTJA 4C11A 4LF4F 3QJJA 1K73O 2IC3B 5A8WA 4FW2A 2K8GA 4C98A 4QW8A 3O5BA 3NF8A 2IHR1 1TL5A 1DQ8A 1FO1A 2DNQA 3EWGA 2ALYB 3JSMB 4CW7B 5AQXA 1X31C 2CG4A 1WC0A 1IKYA 3TJ9A 2HGNA 1ZA2B 1I5OB 2MY7A 2OI2A 2N7CA 2ADBA 2BUPA 2BACA 4DV7K 2LQ9A 3SV4A 2F3JA 4KR0B 4ILJA 4XH4A 5DQIA 1GFWB 3GYGA 4GO7X 3LA0A 1UKUA 2U2FA 4O8UA 4J2DA 4FJ7A 4JP8A 3CMQA 3KLEA 1Q7LB 1YVFA 2YNFA 3H98A 3R1HA 2KN4A 3T1YJ 4USIA 1RAOA 4Y28C 2B51A 1WKJA 2PFFB 2YHYA 2P6TA 3KLVA 4U95A 1X9JA 3PYFA 4A8OA 4DPWA 3EPIA 3AOCA 4M5LA 4OZ3A 2PT0A 1QAIA 4Q7AA 2B9XA 2EK6A 3CC2S 4TU8A 2ZOMA 3RGIA 2MSSA 1R27B 5ETNA 3IM9A 4I7FA 4OKKA 3ZTQA 1BWVA 3PSIA 3MAAA 2IYIA 4UOHA 3BGRA 5D3GA 2RUSA 2UUAK 3OT9A 2QJ3A 4I6WA 4KO0A 1GQEA 4PYAA 2MJUA 4KH4A 4DTMA 2LEPA 2OJ3A 2D5RA 1HBUA 1S12A 1VQYA 2KKZA 3HTVA 5AQKA 4DUZK 2FJDB 1FD8A 4U9RA 2BRLA 3PKMA 2MTLA 3IKMA 5CH7B 4DCHA 1SXLA 1S1XA 3HKZD 2B9WA 2CG8A 4M5JA 1YJ7A 5BYRA 3CNQP 3ZC4A 3J8AA 4FWKA 4IRKA 4BDPA 2D1CA 4C4WA 1W9HA 8AT1B 3ENVA 3O6QA 2BE9B 3A5MC 3GV8B 2Z30B 5LXRA 4ZVGA 1TFWA 3QPIA 2BJ1A 4FXWA 3H42A 4NYFA 3FBBA 1YKWA 3MEEB 3A8EA 1O13A 4WCEQ 2PMWA 1C1CA 1NDLA 3CW2C 2O66A 5KG1A 2X1GA 4FWLA 2AEMA 3MM9B 2XMJA 3KKFA 4F3TA 2ZH7A 3HXMA 3MFIA 4FOEA 2ZZTA 3EVMA 4CGGA 3HOSA 4IDKB 1X7VA 2DNMA 2GJ2A 2HBMA 2HVIA 2UVRA 4CIGA 2HQCA 4B8CA 2DHSA 1VBXA 4BRDA 1HYSB 5LJWA 2R2TA 5FDLA 3OSNA 5GMDA 4O3OA 1S79A 1RBAA 1T3VA 3DI6A 4QYZK 3S8SA 2R9LA 1YBUA 2CA9A 5ETOA 4JK7A 3LP0B 1IKVA 4NCAA 3R7NB 4DU3A 3AB4B 3TWZA 3MOZA 1HKCA 3OYKA 1CZ9A 2QWPA 2XWYA 4DU1A 1X9MA 2UU9K 3JB9k 1F60B 1AB8A 3N01A 2AJ4A 1CLFA 4FPRA 1KRPA 3BY5A 1S6QA 4LJMA 2VQEJ 1YJ9N 1HHSA 3AQOA 2E9ZA 2FGCA 3LW5C 1WHXA 4OI6A 2V63A 3HP6A 1IBLK 1UJ4A 4NX9A 4KAIA 1WORA 3C6TB 4USMA 3NKYA 4IO9Q 4CHZA 1HJOA 3A5OC 3CCVN 5GIOA 4H0XB 5CYQB 3DOLA 2V51B 1NGEA 4LRCA 2AX0A 4F3MA 2F4VF 2WB4A 3CULA 2EG1A 5BRHA 3AD8C 4TXSA 3IG1B 4X4VA 4M5IA 2HHHJ 3US5A 2BOPA 2RU3A 3OBWA 2ZBRA 5I3PA 4X2BA 4EMDA 4NI2A 1WG1A 4DF4A 5DDRC 3IN5A 3MR5A 4UY8O 2IJRA 1HR0K 3HULA 4DPXA 4ZITA 3KJVB 2I6WA 3VQPA 2DGWA 4AD6A 3VA0A 2I5JB 2O4GA 2E1CA 2W4PA 1FX4A 4K0KF 3NMUA 3HHDA 1B0PA 3QMLA 1WOQA 4NMLA 3F9MA 2JEJA 2W2NP 5BR8J 2BX6A 4RNOA 1NU0A 5HQ8A 4RPFA 3K58A 4Q2MA 3A5NC 2DJWA 4D3GA 4YY3K 5B0AA 4C8ZA 1AFJA 5D0GA 3HCXA 1BA0A 1U02A 4H0YB 3LPYA 4IJNA 1Q18A 3PLAA 2O67A 4JI7F 4KI6A 4LRAA 1OH8A 3T6JA 4FLVA 5ETSA 2CJBA 1VQ7N 2XG8A 3DDIA 5KPZA 3QIPB 3M5RA 3KK1A 4CI0B 3GDQA 5GAGU 4DQQA 2HRUA 2DH9A 1M5SA 1OMSA 1I3OB 2JHEA 2MY8A 5KG6A 3CCMS 2J4RA 3FMWA 2CQGA 2WUSA 3J81U 5L1JA 2KI2A 3L6QA 3CJCA 3MGJA 3ULEB 1AUDA 2BJ8A 4KB7A 3NE6A 5J2PA 3LPEA 2KDOA 1X3MA 2G8VA 5AFUH 3QT6A 2YVSA 1SV5A 3KHGA 1VHIA 3U1NA 1EB0A 4YORA 3R5JB 4ZN1A 4YEAA 1J5EF 2C3MA 4IEEA 4USVA 4M45A 2OPQB 5KPRA 2OPRB 1JLGA 5LL6Z 5B0GA 1SC3B 4CIEA 5ELZA 3QYYA 2EFVA 1ZTWA 1MMLA 2VHGA 1PGZA 3U1MA 3K89A 2HRTA 1TL4A 3GL1A 2KJWA 3HFZB 3KOAA 2FY8A 4I2QA 1IKXB 2GJFA 5JS2A 3W8PA 3ISND 4KAZA 1XR7A 4CLPA 2HVDA 5C10A 1RTHB 3W3SA 3L9ZA 3RWUA 3NBPA 5ETKA 4J2EA 1W26A 1L5UA 4Y00A 4CO0A 4UY85 2CH5A 3QNNA 4CWBA 1Y7PA 4FWQA 4HHJA 4H0PA 4X4RA 2P6SA 3OSPA 3HSZA 2P9PB 1TUUA 1AROP 3LGHA 4YOEA 1AXQA 1FRLA 1JIHA 2Q1LA 2KYXA 2J7UA 4Y65A 4AHVA 3AJ1A 4O55A 4IDHA 3H3OB 3LWLA 3IR7B 1JLBB 1B64A 1OYEA 1VQ8N 2QL7B 2V2ZA 3UCZP 1FDBA 4PL7A 2XBPA 2VIHA 2J6SA 1KOHA 3VQ9A 1XMOF 3GIMA 1XMQJ 2FLPA 4E3SA 3CJKB 1CS4A 1HNXJ 3KVGA 3HYFA 4YUDA 2GMLA 3KK2A 5HVFA 3QEIA 1TK0A 4JOUA 9ATCB 4OX9F 1XNQF 2UXCF 3THPA 2BW2A 4MYUA 5G0RA 5HMYA 4KHMA 4CEFA 2ZOGA 3KUHA 2HNZB 1KTVA 5SWMA 3VHQA 1NGAA 2CJXB 2KU7A 1S72N 3UI3A 3BZCA 2O8FA 2DHHA 3EL2A 2RQKA 3NGTA 3U1LA 2P8IA 1QHAA 4JKGA 1R89A 2LYVA 3FNNA 3Q89A 2VB6A 1MU2A 1B4SA 4U6PA 1F5CA 1QAJA 2B5JB 2E6LA 4CJ3A 2ZF5O 1GOBA 2RAQA 1G99A 3R8EA 3MPUB 3PYGA 4NASA 3MWPA 2BM0A 3PHEA 4QU6A 2VONA 4E8UA 1HLUA 4Y1CA 5CHIA 2HVHA 5HMWA 2BQUA 4ZA1A 4JI2J 2LEBA 4ISFA 4ES2A 1RP5A 2EFPA 2IFXA 4BC4A 1VRTA 2Y9HA 3IGNA 4FK4A 4U67L 5EY4A 3V1OA 1I3AA 2DB1A 3CFRA 1RT6B 4MAKA 4I64A 4Z4IA 1NMNA 2ZJQQ 1U8SA 4IFEA 1FD2A 1T3NA 4HEA9 4ED2A 3SJJA 4CO4A 2MQPA 4LH4A 1QQOA 2P9IB 3O3GA 1KD1T 4DKWA 3ITHB 2VOOA 2MZJA 2NRZA 4MT1A 3RAQA 1OPIA 3E2EA 5LJ5Y 1VQMS 1ZBUA 3NDKA 1Z4UA 4J5OA 3T69A 5LMNJ 4J2BA 1Y0HA 1JX4A 3T3FA 1RCXB 4C3KA 3B78A 5FPDA 4JHDA 5EVZA 5THWA 4MYTA 2E5LJ 4LR9A 2KG1A 1N4LA 4CHPA 1NMEB 3IS9B 3BO3A 1V3SA 1SKSA 2YWHA 1FKPA 4GKKJ 3GV7B 1Q16B 2DGQA 4DTNA 5HANA 5HI7A 4ER8A 3NL0A 4DPTA 3TA2A 2NXUA 3TSPA 3G4SS 1JCFA 3I87A 3OTDA 4C8MA 2QG9B 2GIRA 2P9KA 2RF2B 1X8DA 3R3LA 2QA4N 4Q8FA 2EFQA 4OJGA 4WFYA 2AKWB 3FK4A 1YTAA 1PSDA 1YQHA 2Z58B 2CXEA 3M6XA 3D7EO 2GHWA 1TUWA 4O3RA 4W5QA 2VGMA 3CJ0A 4DLEA 3CC4N 1MSWD 5BPNA 2KFZA 4A8SA 3RRGA 1TELA 3AD7C 1KLMB 5KFJA 4IOAQ 1BHNA 4J2AA 5C24A 3TAMA 3QEVA 1Q78A 1RT7A 4O3NA 1QLNA 2BOAA 3KUGA 2E9TA 4LF9K 4ANCA 3VAHA 3O44A 6FDRA 5KFHA 1IM6A 1LAWA 1DKGD 2FJVA 1IBMK 2YV0X 4M63A 1EJ7L 4JI0K 4A46A 4LR7A 2PY5A 3LAMA 2NZ4A 2DITA 3Q83A 1EX8A 3I32A 1WB9A 2HFZA 4FWOA 2AYMA 3TAPA 4R8UB 1PILA 4PR6A 3IAYA 2ZC4A 1WBBA 2A42A 2QWMA 2J0XA 5J1NA 1WUAA 2VWKA 3D3BJ 1MN9A 3OYJA 4JYAJ 2AIRB 2EKNA 2UVUA 4FJIA 3DLEA 2FBTA 3A3PB 4FYYB 4O0IA 4DTJA 1Z2ZA 1UVMA 1N48A 4M8LA 1HI0P 4P74A 4RU2A 1N32J 2LQ5A 2NXCA 4ID1A 3J81O 4F8RA 3KK7A 2COLA 4N47A 1RCHA 3AVMA 4JI1K 3DXKB 2JLGA 2CAJA 2APOA 3GSIA 2OTJS 5L39A 3SCLE 5HQMA 5AJ3K 1Y64A 4I6YA 1YXQA 3ZNUA 4B9LA 4NLSA 1NM1A 4RNFA 4DV3F 1FRHA 2NZCA 2V34A 1TKZA 4DCOB 2JJ4D 3PVXA 3SSQA 3WIVA 3T5JA 3HI0A 4FK0A 1B0TA 4H54A 1NAQA 4TVAB 2DFHA 3HHNB 1VRUB 4DR2F 2A3JA 1NNEA 2B8PA 2JFDA 2DH8A 3DLGA 1FDDA 2M3DA 3K8VA 4PRFA 2H4YB 3PFEA 2BQ3A 1XN9A 3H90A 1NKCA 1DTQA 2WVBA 2MKKA 4L6V3 1TL7B 3K7RA 3RYLA 3HSDA 3SMSA 1X5OA 2ILYA 2OANA 1FHTA 1SJRA 3G82B 3KLHB 2VG5B 4DL6A 5FPNA 3NGRA 3L2QA 4LF5K 3DRRA 2MKHA 4G6VB 3EX7B 5KFQA 2D1KA 3HJFA 3T1AA 3LP2B 3PR4A 3ZT0A 2HVEA 3I4PA 4OMFG 1YJNS 2HBRB 3T5HA 2F1FA 2Q43A 2FUG9 4DQPA 4G1QB 3UD3P 4CZIA 4ZCIA 3ELHA 4K5RA 4ISGA 3WEEB 2CWXA 4GVBB 1BQXA 3LQVA 5LMUJ 1S99A 1KQSM 2R2RA 4GKJF 3B4MA 4X66K 1S1TA 4IFYB 4DFMA 3GIIA 1OYDA 4CJVA 1R59O 4J9UE 1LWFA 1TK5A 1D5AA 3HZGA 3UQSA 4R5PA 1PAUB 1DLOB 2CPZA 4X65J 3OTOJ 4IG3B 1P8ZA 4DV2J 1JLEB 3CJ2A 1HBOB 3TX8A 2V8PA 2IOCA 4EYHB 2XLIA 2UVWA 3L95X 1WOSA 3N0VA 5I3UA 5GINA 5KAKA 3NGSA 4R25A 3DLHA 4FLTA 2AJQA 4V19S 4J37A 4OYMA 2MQNA 4BHQA 1HKAA 1R7IA 4CLUA 4RW8B 3SFGA 4F02A 4BWMA 3UDLA 2BW7A 4KHSA 2F7VA 3UCUP 2D3ZA 3VQ7A 1E6VA 2GZOA 4YOWA 2Q79A 2ZJRQ 3HBTA 3DJCA 2DXDA 4OJ1A 2OPSA 4S0MA 2OFGX 3D6HB 4F4YA 1HKGA 2CQPA 2FVPA 4CZHA 3CT9A 2QWOA 3QICA 2EC2A 5FROA 2UXDF 1HWLA 3EKUA 3ZSQA 2EHGA 2XM3A 1FJ7A 2XYGB 2R7QA 3NGIA 1TVRA 4CO1A 4I9LA 3R7BB 4OLAA 5DDQC 4WFAL 5DMRA 1S4FA 3UN5A 4CJTA 4AFFA 1CULA 4G9ZA 2LVWA 1HNVA 4K4VA 2IBOA 2GGPA 3NS7B 4CIFA 4KKOB 3QBCA 3PNIA 3TZXA 2Q36A 1RWNB 2FSKA 1HJRA 5AQUA 3SQGA 3THVA 3OQ2A 1HWJA 2WVDA 2PA8D 5BYSA 5SZTA 2XULA 3IC1A 2W9CA 1CXUA 3CFOA 1YHQS 2OA8A 2G0IA 2I7NA 1C0UA 2NZTA 1WG5A 3VEYA 2DFEA 4NLTA 1QSLA 3CMAN 2CPFA 3FMBA 2FXUA 1MDUB 2HFUA 1RWWB 3VQEA 3N4PA 1RA6A 2GA7A 1JWWA 2ASJA 3KLGA 4C6AA 2VD3A 4OV6A 3H5YA 4ZTFA 2V69A 4TQSA 4B1UB 5E3RA 1EWRA 2RT3A 1GX5A 3OYFA 3B8HA 2UVVA 3BP8A 1N0UA 3FRYA 2ATCB 3M4XA 3ZXWA 4WK1A 2IGIA 1S7HA 3BEXA 2VWBA 5IWAK 2G13A 1NHVA 3TSQA 4PAAA 4A8WA 2YQ0A 3T41A 3AGRA 1K0TA 3FQKA 1VGYA 3I55S 3CQXA 2HHQA 5GVQA 2Q97A 3DDKA 3KK3B 2QMXA 2YHWA 2XMKA 4USHA 1HNWJ 1U0HA 1FRXA 2IAJA 3CCUS 1GLJO 1K1SA 4B3MJ 2FBYA 2FVSA 2ILZA 2RQMA 4LFBK 4JD2A 3KNAA 1R6YA 1IWGA 4PWWA 1ASUA 3MPYA 2FHMA 4WU2A 4BC5A 3I33A 4NXNF 2QKKA 1VBKA 5DZ6A 4MLHA 2QL9B 3OVAA 1L3VA 3VF4A 1VBZA 1JLFB 2HQFA 3N28A 5LL6d 1E6YB 4X64F 5DM7L 2YKPA 3NNHA 4QOTA 4DR7K 2HHUA 3WXMB 3HVAA 3D6RA 4CZEA 5D0RA 1SZ2A 2VQEF 5BYQA 8ATCB 4Z2XA 1BXNA 1RDWX 2LDYA 1KVKA 1WF2A 2CQ1A 4F0KA 1PYOB 4GNIA 3EXCX 3AVIA 4WFNQ 4BDYA 5KFAA 2NQPA 2MYFA 1J53A 1NB7A 3AO3A 4GMJB 3X3UA 2ZNYA 2OP5A 1S9GA 3ZTPA 4H4MB 2ZJPQ 2VF3A 2SXLA 2XC9A 1G1XA 4P9SA 4URSA 2HHHF 5EUHA 4F9OA 1K9MT 2KG0A 4BRCA 3SCIE 2YNHB 3QLHB 4CQ1A 3MMVA 3I8DA 1NUEA 1SJQA 4B9UA 3C6UA 1J2VA 3MCMA 5KI6A 3O6WA 4I69A 1HNZJ 1VCTA 3KMSA 3S3MA 2WVEA 5C0YA 2Y1JA 3MM6A 3JTNA 4DV5F 3K5PA 1HPZA 3D2WA 3R9LA 4AQYJ 4X4UA 3LDNA 3ETMA 1RUSA 3NS6A 3NF6A 5AZIB 4WQ5A 2FLOA 3O9RA 3A1YG 2V50A 4IUFA 3D0PA 2CADA 5KG5A 1JKHB 2W41A 4JNEA 1UVJA 3M32A 2E2NA 1RTIB 3HD2A 3VA3A 3AA9A 2CZ9A 4KH1B 1DZ5A 2YKMA 2H3GX 4U8VA 2ROEA 4ZOSA 4F3OA 4P2SA 2ZOFA 5KG4A 1MW7A 4DUTA 3LDLA 1K44A 1Q5VA 2AU0A 2N7YA 2WOMA 1PKUA 5C15A 4X4OA 2B6AB 3SUOA 1WEXA 3DGPB 1Z26A 5KFTA 4YR0A 3OXGA 2O8BB 3BUZB 1RGIA 5KGWA 3CDEA 2L41A 4MMOA 1BQMB 3CD6S 3BSAA 3G6YA 1LFWA 4OPHA 1RBUA 3U9ZA 3I5CA 3KNGA 1J5OA 4CVNE 3CFPA 1U26A 3OD2A 3BBBA 5D77A 3VQQA 3LALA 4KBIA 2YY3A 1QZ5A 2Q6BA 3N5FA 4Q2LA 1C0TA 4JI8J 3SUNA 4J9LA 2X6NA 3M6UA 3R7SB 2AV5A 3W65A 4QIGA 1WOOA 3PXGa 1S6UA 1S6PA 2LMIA 2PAVA 4CLZA 3TTFA 1N34K 3LM9A 3DLRA 1EETB 1WC6A 4DV1K 3R8YA 2M4MA 3CDWA 1JB0C 3Q7CA 3K0SA 2I9SA 1MWYA 2FF6A 3W9HA 4Q0BB 4DDFA 4ZJOA 1JCGA 1BLUA 2QX0A 4PYDA 2DPNA 3KG0A 4UUWA 1SL2A 5B0FA 4O44A 5AQTA 3CC7S 2YKQA 1H2UX 2N3LA 1DTTB 2CH6A 4EO6A 3S41A 4E1JA 3C19A 3SLCA 3D7SB 3UDVA 2DR8A 3D5MA 4BRAA 5C42B 4FW1A 4RZRA 4BC3A 2RRAA 1SQFA 5A8RB 4DX6A 3NGZA 5A2QU 3SUPA 2PI4A 4L74A 3CCZA 2DR7A 3R2DJ 4EGLA 4DV6F 1HA1A 3PYEA 4WK3A 3FE1A 3THYA 3MFHA 1P9QC 2JLFA 1JLCA 4K7QA 3D1QA 3G0ZA 1GTHA 2Q0UA 3AVFA 1UVNA 2UZAA 3PJXA 4I4BA 3DYAA 4DTOA 1NDCA 3PRBA 1RE1B 3VQSA 3TA1A 1TGOA 4F4KA 1SCJB 4CNYA 1X0PA 2HFSA 4B3SJ 4NCGB 2HEKA 4MIWA 3CCRN 2W42A 5HATA 2CQ2A 4XTTA 3AY0A 4O3PA 2XGPA 4B3RK 1T9TA 3CJ8A 5K8MA 4U7BA 3SYZA 4LRFA 3M1VB 1YDLA 4FJNA 1M5VC 1M1GA 1QY7A 3G2XA 5B0BA 3C66A 3NRBA 2EBEA 1MA9B 3CGIA 3J81Y 3AT1B 5F8MA 4JI2F 2BJ3A 4PXEA 3G6EN 3QSIA 4HCBA 4OZLA 4CD1A 1HIYA 2IS3A 2DYAA 5MAOA 2RDDA 1XNRK 2QW9A 3QETA 2GX9A 3TJAA 1JJ2M 2QYGA 2W24A 2KVIA 3B6BA 3LF0A 2HHWA 5FIIA 1IWAA 3V5RA 3OTCA 2DEJA 3MN6A 4DV7J 5IQ6A 1YTYA 3FJ2A 3LWMA 2W9BB 1TYQA 1RT1A 4E7LA 3JYTB 4ES3A 3ZCMA 4IBNA 1V9OA 1Y5LB 1Y4ZB 2CQ3A 3L0QA 4NCBA 1GLCG 1FXRA 4JKBA 3W1YC 4H0VB 3IR5B 3THWB 2BBEA 2P9NA 1R8PA 1WD6A 4NZ6A 1A5XA 4FN5A 1YRXA 3G8QA 4KTWA 4OI1A 1YZ7A 4HCCA 3BKUA 4TQRA 3Q8VA 2D0AA 1VK8A 2X1BA 1RTJA 4E89A 2MKYA 4ZCKA 4NLRA 3PX0A 2HBJA 4Y2CA 2DXFA 2PMZD 4ELVA 3AVHA 1XHZA 1N8RO 2Z2LA 3I0RB 4MK8A 3NGUA 3NEKA 4HUGA 4M5DA 4AT1B 1X5TA 4DUZJ 1RBVA 4O23A 1WSJA 5FRMA 5D4OA 1B0VA 3QRPA 1SQEA 3KWMA 3TOQA 1XMBA 2FY1A 4L3NA 4RW6B 4ES1A 1LW2A 3DOMA 2CKWA 3J7YU 2MQMA 1AT1B 3A13A 4OVLA 3FZ2A 2WTUA 1NZAA 1SUQB 1OQ6A 1UWBB 2Z56B 4ANEA 4C11B 3VZIA 2ASMA 4JYAF 5A8WB 4C8YA 2J8SA 4TSXA 4CLLA 4IO8A 4IOXA 2FDNA 4CHYA 2O8EA 4KT0C 1N32F 3TI0A 4WFBQ 1IKYB 3M8RA 3ADAC 5IM0A 2AZ1A 2XHWA 3OS1A 3TZWA 3OV7A 1U48A 1U2VA 4BR5A 1ZS6A 2GBZA 2B4OA 3CMEN 1RWUA 2BE2B 4FF2A 4OGCA 1IG8A 1U8WA 4ZPWR 3KLEB 3OYMA 5LOQA 2HIYA 4QYZJ 5DS7A 2HHPA 3HFKA 3HRGA 2C2EA 4MDAA 3MMAA 1H73A 5F0XA 1Q5YA 3SUQA 5D4LA 1YJTA 1S9EA 3MI7X 3I82A 3M2UA 1ROFA 3W62A 2C3UA 1B7YB 3C7NA 2UU9J 3QSYB 2PE8A 3MAAB 4KPYA 2F9DA 3BGRB 2DNGA 5D3GB 2A6MA 2E7XA 4KREA 2W2MP 4KO0B 3FEXB 3UD5A 2E6MA 2IMWP 3ZZOA 4E2FB 3MEDA 2XZTB 4QIWD 3KLFB 4JAXA 2VJUA 1LV5A 2WRMA 1IBLJ 2JL9A 3CCSS 4JV5K 2QWNA 1BA1A 2Z1JA 4I2PA 1F0XA 1CXQA 3V6HA 1S1XB 3P38A 4DX7A 2O8CA 2B0GA 2YXLA 4A8MP 1PJ6A 4ZPBA 2RQ4A 3TYTA 4B3TF 4JK8A 4YB6A 1U45A 5LMUF 1L3KA 2ACMA 3JXUA 5A2QO 3R1LA 2Y8WA 1WEYA 4CJ5A 2VG6A 1PJ7A 1SC4B 4M5KA 4BC2A 4LF8F 1C1CB 2F4VK 5H9EK 3TUPA 1HR0J 4OGEA 5HAOA 3OJSA 5J2MA 2ROGA 4X62F 1YIJN 4CEOA 4PUOB 4YB1P 3IMXA 1P9YA 5AQHA 3MXIA 5L38A 1FRKA 1LWXA 3H0PA 1HBNA 1BUXA 5GAHU 3SI6A 4OPJA 1S3XA 2UYTA 4ZHRB 5J2QA 2J8AA 4MK9A 5E3QA 2V52B 2XMUA 1J54A 1KQGB 4YY3J 4P10A 3CDBA 3MM5A 1BDGA 4K0KK 2CQHA 3DNCA 2E1ZA 3CJTA 2ZH8A 3QGGA 1D9FA 4IQMA 3DI6B 3PRVA 2CWKA 2XYHB 3N4WA 2NR0A 3TQEA 1IKVB 4UZBA 3I6PA 5JVGL 5JVHQ 5GADP 4CIOA 2CVIA 1IKWA 1EXQA 5KT3A 3ZZYA 1GLFO 3SPYA 1T94A 3ENWA 4EBEA 4Z4CA 4U7CA 3OL6A 4JI7K 2GWKA 4F50A 2VQFF 3RJMB 1U1NA 3QJPA 4F7VA 3TUZC 5LSLA 2YWEA 2X1AA 5F9LA 2R7WA 1OPZA 4WXOA 3OBIA 3FBFA 1S6QB 3N79A 3PM9A 4J90A 4QIFA 2AA4A 2NRRA 3MECA 5M1FA 2M8HA 4WXWA 4B1ZA 1XC9A 3TSUA 3SXLA 2OTLN 3AQPA 4DU8A 2D0CA 1NJIT 3AVLA 1VC5A 4PPZA 4ZIVA 3A0IX 5LY3A 4K59A 3DOLB 2ZE2A 4BGBA 3FEYB 3C14A 3NNCA 2HB5A 5F8LA 5KFZA 4FJMA 3TVZA 3PEHA 1UFWA 3GB0A 4PWUA 3CUNA 4KGZB 2OUGA 3VGSA 5F8GA 1RKJA 2C2NA 3GR1A 2DY4A 4NI2B 2R4FA 3FZBA 1PC5A 4YR2A 1NPPA 4HVZA 1MWQA 2GUIA 4HACA 5F8NA 1W7WA 3VGKA 4P71A 1RWVB 4MFBA 1VQ4N 4Z4EA 1REVA 3GG1A 4NE9C 4CERA 2MGZA 2JLEA 1QAYA 2DR6A 2V8DA 3GSDA 3L2VA 2Q6CA 4CJKA 3PW0A 4Y2IA 1NK7A 4YOUA 4NEYA 3HO1A 3W3DA 1WAJA 5E41A 1FW6A 1S22A 4DWIA 1IR2A 1NHUA 2NSBA 3E3XA 4IYQA 4I67A 2I1RA 3TVKA 3M9MB 3SSSA 4HI2A 4OZ2A 3EYZA 3KK1B 2VL1A 4FJLA 4BRKA 3PW2A 1XMOK 1FCAA 3CM6A 1HNWF 5CD4A 1X4CA 2FVRA 3WNFA 5HBMA 4CO3A 5K5MA 2B3TB 3VWSA 2HHTA 4B3MF 3AVKA 3FFIA 2FHJA 3Q8UA 2AMCB 2QFJA 5J2PB 2UUBF 3MCPA 2I8EA 1SV5B 4PKIA 4RW9A 3KHRA 3OHRA 3LANA 1QM9A 5DG9A 1DBDA 1YI2N 4B02A 4NLCA 1I6JA 1K8AT 3NMRA 1JLGB 2W8LA 2DNOA 2A6OA 1Y11A 4JLHA 1X4HA 3GIKA 3L3VA 3M6WA 4HHTA 1XQSC 3IFEA 5KFPA 4K25A 5FPMA 3Q7BA 4I2QB 1BCMA 4Z7CA 3AVBA 2CPHA 5HL7Q 5JMVA 4YFUA 3O80A 4GO5X 1N54B 3PG9A 1OSCA 3WXLA 1VQ6S 3NBPB 1U1OA 2MPUA 4CT8A 4YMEA 2AJ0A 1SBRA 2PEHA 3HVTA 4ZN3A 5M2UA 6FD1A 1DURA 3AVJA 3MOJB 2V2VA 3NLCA 2NPIA 3VR1A 3P5BP 2ZH2A 3GFYA 4DX5A 5D0EA 1QD1A 1R0CB 2QK9A 5EX5A 2RIJA 2YWKA 1DHMA 3CCTA 4CLSA 1U4BA 5CA5A 3M8ZA 4XO0A 2VPWB 2CDQA 3MX5A 2MZRA 1B3TA 3QIOA 1CS4B 2GAGC 1GH8A 3BKTA 4Z4HA 1WG4A 3KK2B 5EHHA 3GJRB 4DU7A 3M8PB 4KIAA 5L9XA 3AD9C 3HVWA 4AQYF 2JDJA 4HL9A 3I56N 1PO6A 5G0RB 3QESA 1WC5A 5E33A 4NLXA 3OXFA 3OL7A 3NOCA 1HWKA 1RGVA 1GMWD 5H9FK 1YRTA 3TNVA 3HSCA 2O8FB 2PFUA 4PABA 1BQNB 2E5JA 1FVQA 3PCOB 2V0NA 4YOYA 3WNEA 5M1OA 3EKSA 4JKGB 3AODA 1MU2B 4B9VA 2W2PP 3AVNA 4LF9J 3IWNC 4JV0A 3SQ2A 3EZUA 2HOEA 3HMJG 4LRBA 4C1NK 4FJJA 1GLBG 4KB1A 1QQMA 4I0WA 1CJTA 3D0HE 2ZQBA 1IBMJ 3D0GE 4ITSA 2DRBA 2VUGA 1LKZA 4JI0J 2W7OA 3UWTA 5JS1A 2DRDA 1VSMA 3P96A 4DHYA 2HQIA 1VSHA 1RKIA 1Y10A 1VRTB 1JLQA 2DNRA 3FZLA 4OL8A 4FF4A 2KJVA 4M3WA 2AGPA 1EO1A 5CE3A 4JI8F 2JH3A 3NP5A 4OHZA 2ZHOA 1RAAB 4RX6A 2R7TA 3BDPA 5ETMA 2KHCA 3BF4A 3PW4A 4L76A 4JI1J 3JSBA 1D4XA 1Y3JA 3MN9A 4CYUA 4JHDB 5AJ3J 4KE5A 4MQ3A 5F2RA 4IOCQ 4QQBA 2E4LA 4FWMA 2NSCA 3T5LA 1FKPB 3KDOA 2RHKA 5JLFA 1AYEA 4FBTA 5CY4A 2NXNA 4RG8A 3CJAA 2BV3A 3ZSRA 2F7TA 5CCMA 1U2RA 5IT9U 2ZD1A 1V4SA 2BXJA 2P9KB 4Z37A 3EVOA 1B70B 5M2RA 3BREA 1H98A 4DV3K 4N5SA 3TRGA 3TVYA 2CGLA 3NAEA 3ICLA 4AHUA 4Y34A 4QS9A 4RW7A 3K57A 3BYRA 4ECRA 4KYZA 1X4DA 2GMJA 3EE8A 4Y3CA 2NLXA 1TKXB 3P1GA 2QLWA 2AQ4A 2ZKTA 3TAMB 2H9ZA 5ETQA 1RT7B 2DGXA 4LF5J 3VVTA 1VLOA 4OZJA 3SEOA 1UAWA 4BRFA 1UVKA 2QE5A 4ZVEA 2LEAA 4DR3J 5E3AA 3BDEA 2UUTA 3M2RA 1ACMB 3AXMA 4PQAA 4KHYA 5CABA 2P9SA 2CZ4A 3ZSYA 4FVCA 2KQ2A 2DD8S 3ATVA 5D4NA 2HGLA 4B3SF 2POKA 3RTVA 3C2PA 2LQJA 4F04B 1VSIA 3WC2A 3OYEA 3HHLD 1RAEB 4X66J 2MZQA 4EU0A 4DV4K 5DRKA 2YBVA 5H1SV 1H2TZ 1RU2A 4F0HA 4RCHA 3CJ9A 4DHVA 4LFAJ 1U7LA 2R7OA 3UR0A 2EWHA 3MHYA 3HFVA 1P8GA 3O3HA 4OQJA 1U49A 2ZC3A 5F41A 5HP1A 3WT0A 3K59A 1I39A 1T6CA 4DTUA 4B1VA 2HAFA 1CJKB 2C22A 4ATNA 2IVPA 2VH7A 2FZCB 1TKZB 3GU0A 4DQ8A 2A10A 4PG6A 3P4UB 3DAWA 4BACA 1IXKA 2YX4A 3WXKA 4O4GA 4HTJA 3DLGB 2O3DA 4JI5K 2M8DB 1X1PA 2PD1A 1ZM4A 2RHQB 3VPZA 3TANA 4LUBA 1FXLA 4KQZA 3BR9A 4DV7F 1DTQB 1SC1B 2M70A 1IR1A 1L3SA 2VODA 2ZH6A 3IAM9 2J9EA 2VBWA 1YLXA 4Y1DA 4BR0A 1SQKA 5DQGA 4KH6A 4FXVA 2A6AA 4X4SA 3DRRB 1H72C 3GCXP 3IFRA 4FLYA 1FKOA 1HBMA 2Q3SA 3SCXA 2UXDK 3NWRA 1NOZA 2NRWA 2XHCA 1RBRA 3FKBA 1RLCL 3DLBA 4CT9A 4B3OA 4PKHA 4WF9Q 3DU6A 4CZJA 4WJBA 2W7AA 2DY9A 1PIEA 2F5GA 5GAEP 3V9WA 1VQON 1GMVA 1WDDA 2Z0GA 3LP0A 3SDEA 1XQIA 2AEFA 4FYVB 3OPKA 1CZBA 3C15A 2OAUA 3FZFA 1EQMA 5KQ8A 4ISEA 1N5VA 1S1TB 4C48A 5F0UA 5A2QY 2XI3A 2N4CA 3G25A 2G4BA 2MQ8A 3NS5A 1LWFB 3N4QA 1NK9A 2MQLA 4R5PB 2HAIA 3NAHA 1NPKA 2UUCK 4LF1A 3NMAA 3CJQA 4BRGA 3MTJA 1VQNN 5I3UB 3CJ5A 4ZP9A 3SAGA 4QJVA 3EZOA 4Y0WA 3KXDA 3KZBA 3UN2A 4W90B 3PHTA 5KFCA 1AZSB 3OFGA 4H03B 4WE1A 1JLAB 1E6VB 3N5BA 3H5XA 3BR8A 3ZEUA 1OWXA 3U8XA 4FZYA 3G71S 3AA4A 3CCLS 1RU1A 4DCJB 5IWAJ 2VWJA 3U3GA 1VQ9S 2OPSB 4A48A 4CESA 2EFNA 4PWDB 2MQQA 2XS7A 1GMWA 2L3MA 4CF0A 2D4WA 3R3TA 3LO3A 4ZVTB 4H4OA 2HFVA 5D15A 4P2FA 5HVHA 3CCQS 3KD5E 1BL3A 4DLGA 2ZH9A 1Q8LA 4M7YA 3KJVA 4ZVPB 4QS7A 2QZ8A 5AQWA 2I5JA 1TVRB 5F3TA 3MD1A 1FRJA 2GUPA 1S77D 1X9SA 2XY7A 4EHTA 2VCPA 4LFBJ 3OW2M 3H20A 4KGMA 3IXQA 3Q8QB 3EGWB 2RH3A 4M5NA 1NKEA 1WHVA 1NEEA 1EQ0A 1FEHA 4C9DA 3KYLA 1YGYA 4ECXA 1CULB 1WC3A 2VYPA 5IC6B 1K8AO 4M95A 1HNVB 2AP6A 3U3YA 2GGPB 4M5HA 3GCWP 5K8PA 3PUFA 3GV5B 3O5TB 1BU6O 3TQ1A 2UU9F 3ZFVA 5CZ2A 4DR7J 1NNDA 4PL8A 5A8KA 1H6KX 3SQGB 2V8GA 4ED4A 4NXNK 4H0OA 1R8BA 3ZZRA 3OS0A 1A0OB 5E5NA 2W9CB 1N5QA 2XEXA 4MO4A 3JAMU 4CEZA 3VAMA 2WSFC 3VENA 4X64K 3C6HA 1C0UB 5IT9O 3ZT3A 2GWJA 4EZ9A 4L73A 1RHJB 1J27A 1TKTA 4IWVA 2AW0A 2KB2A 2H65B 4A5AA 3OLBA 3ULEA 3VF0B 4IH5A 2EX3A 1VQKS 1ELOA 2KT3A 3KLGB 1PC4A 4QPXA 1JXEA 2W40A 4NA3A 3OUYA 4LFCF 2MQOA 3V9UA 1BUPA 2FTRA 1N36F 3G6XA 1WNSA 3TU5A 4FF1A 3F73A 3QATA 3NY0A 5AR0A 1BGXT 4CF2A 6AT1B 5DM6Q 1HR0F 3UPFA 5KFUA 1D0EA 4MO5A 2O01C 3IBFB 2CPIA 2GV9A 2ZDPA 4F4WA 4IOAL 3PYDA 4H5NA 1U0HB 3CC2N 4CRJA 3C0BA 3D2FB 2IAJB 2IDEA 1U04A 1JL2A 4DV5K 4CJRA 1QQNA 3SSRA 4JD2B 4JK9A 4ZVRB 3C16A 4IRCA 2FZKB 1RB0A 2H5IB 2QGFB 3C46A 2NREA 4OX7A 5F0WA 3V1QA 1FE4A 3VQAA 4A8FA 1H7XA 3W60A 3QO9A 2PO4A 3O8WA 2XMMA 3QFUA 2IRYA 4HDHA 4Q8EA 2OCEA 4PCQA 2ZWHA 3OFEA 2RN2A 4JN4A 1ZZNA 4DPUA 3CIPA 4DSLA 2QV6A 3CJSA 3V4IA 5AE2A 1ZBLA 2BZ2A 2FQQB 1FA0A 2OFHX 3E51A 1T44A 2P5OA 3M3ZA 7FD1A 3K5LA 3RMCA 2K7KA 5DLFA 4NMXA 3SBTA 1CJUA 3RB6A 4BVOA 4W5RA 3GFZA 3QFHA 1NG9A 2G8HA 1UCNA 1S9GB 1T9XA 2XSJB 1VIXA 3PIOQ 4JKDA 1X4GA 2Q31A 1I94F 5JUMA 2DNLA 4DV0F 1MROA 2I2YA 1RA7A 5C2CA 2DPJA 2NLWA 3C6UB 2X1FA 1N34J 4DSIA 2F65A 3WNGA 3ULHA 1UOCA 4DV1J 3VQBA 3ETOA 4RL1A 4QWCA 5D8HB 4V1Ak 4A59A 3MM6B 3OFHA 4J9VA 1WUUA 3V9SA 1OY8A 3F0NA 4L75A 3UKUA 5L9NA 1Y9OA 3AH6A 2OPPA 2A18A 3UFCX 4K4UA 4WIQA 2WONA 2IVMA 4LSLA 1RT5A 2LFVA 1T9UA 4YDUA 4H5RA 1GX6A 4CK3A 4QBUA 2B56A 3C6AA 2XLJA 1KC8T 3M32B 3RB3A 2B4UA 2NNWA 4CLWA 4C8LA 2YKMB 1DARA 3FEZA 3LL3A 2OKQA 2FJAB 3GLJA 1RT2B 4DR5F 2GX8A 5C2GA 3ISNC 3VGVA 2QLBB 4QWEA 4OX8A 3PZPA 5DGBA 2WOMB 5G4DA 3RVCA 3AAQA 3NH2A 5KFVA 1QTMA 4ECTA 1YT3A 4HVJA 3QJLA 2GNKA 5IT0A 2ATQA 4OI2A 2AD9A 3Q23A 4FLZA 4I56A 2NYIA 4E7JA 5AZJB 4DV6K 1X60A 4Q43A 2VKRA 3POTA 1TMJA 3ZZZA 1J5OB 3GJSB 1EIYB 2AWZA 2F8SA 3UDEA 1HHQA 4B3RJ 2ZBIA 2WVCA 1VQLS 3GPAA 3UW1A 5AQPA 1BE4A 1D9AA 2AJFE 2DGOA 3BS9A 4LSNA 5T7BA 1C0TB 3MMJA 3ILOA 2CJKA 4B17A 2VU5A 5ETPA 4K4WA 5E3CA 4C8KA 2Q2RA 4OZNA 3T5KA 2RU9A 1W2BR 4AHCA 2ZJRL 4CCHA 1C2PA 1S6PB 1Q86T 3VMFB 2QSFA 4DCPB 5C25B 3VESA 4NLDA 1NLVA 3DRPA 4KFBA 4E19A 2QEXS 3WX8A 2GO9A 4NYZA 4W92B 1W0HA 1ZM9A 2WZ1A 1QS4A 4IOBA 1XNRJ 1W2BM 5C5JA 1N5YB 1NGBA 1QVFR 1N33F 1UAXA 4K4SA 1WAFA 2HW3A 3ZT4A 3H25A 1SKWA 4UOCA 4YNQA 5CZXA 3ZSZA 2W2OP 3MX2A 1LWEA 4O44B 2KXNB 3PSFA 4IXCA 3T6BA 4ANDA 1LK5A 5DM7Q 2BRKA 5F1XA 2XY8A 3L2WA 1SJ4P 1K8KA 3GP9A 4OYXA 3CCMN 3UDCA 1QVFM 2DHXA 4Y2MA 1B7FA 3F2KA 3JAMO 4BG9A 3ZSWA 2QLFB 3E9LA 3F44A 3TJ8A 5F3ZA 3VAJA 3BQ2A 3KWIA 4KBOA 2GCFA 3DU5A 4IH7A 3DLJA 2FJEB 1ASVA 2R7VA 1BWEA 3THYB 2VDIA 2IBKA 4NXMF 1XJWB 1JLCB 1FDNA 4O5BA 3M05A 3DYAB 1TMMA 2B4VA 2QWRA 4F4XA 3R2CJ 3J7ZT 2ITMA 4GY2B 2EI5A 2RRBA 4Z94A 2VASA 3ENBA 4QWAA 2QA4G 2OEJA 4W98A 2OD4A 3L2UA 1QE1A 4P7TA 3LDSA 2JGUA 3SK3A 4EI2A 3ET6A 2E2OA 1NDKA 3CD7A 3PO4A 1TUGB 4OPKA 4ICLB 2JC1A 5ETRA 4CTAA 3CM5A 1Q53A 2G1HA 4FLXA 2OO4A 1TL1A 1IBMF 3SZ2A 4ZPVR 4MDBA 3IO1A 4FDFA 4W5TA 5HJYA 5GADI 2Z4PA 5E7OB 5CD4H 2YCHA 4FBUA 3OVSA 3SQ4A 1W97L 1Q95G 4DR4F 4RW4A 4WP3A 4LF6F 2ASYA 4H4KC 3GIJA 1CC8A 4ECVA 3KJFB 4NLQA 4QR2A 5KFOA 4E98A 4QAGA 3QFWA 3OR2A 3D68A 2ZZNA 3VQ4A 1D8ZA 1DAXA 1OVQA 4G1QA 3GOIA 2W6KA 3GR0A 1CPZA 5EOYA 1RHMB 4KRFA 4TU9A 1W25A 3TZZA 2BE7D 4CGJA 2BTFA 1RJJA 2YKOA 3D9BA 3IM8A 2CRLA 3CSKA 1EHWA 1PCAA 4BREA 3VERA 3CVKA 5E26A 1F9FA 2O8DA 2W2QP 1DLOA 2Y8YA 1TYQB 1RT1B 1R0AA 2CDRB 1N32K 4YHHF 5KOXA 1UFKA 1CJVA 4CJPA 3H5SA 8RUCA 4ZVFA 3BSNA 5AQJA 2P9NB 2BA9A 2H48B 1VC6A 1GMUA 3A5LC 1WOPA 2OLWA 4N77A 2GELA 5CYMB 2WB1D 3KKRA 1S0NA 3AFGA 2RE1A 3ILLA 3I9V9 3DN9A 1RTJB 1S5JA 3VEXA 1LNQA 4WFNL 5I9EB 1N52B 3RBEA 3TUIC 2V94A 3CXCM 1D1UA 3BPSP 2UV8G 3NCIA 3H40A 2G0CA 2NXEA 1HPMA 2YQ3A 4CZCA 2KL8A 5HN0A 4LH5A 4LF5F 4DSEA 1NBWA 2V2QA 2ZJPL 3TW0A 3LOUA 4DR3F 4M94A 3CCJS 4M5DB 5GAGP 4P7VA 4WYBA 1CQNA 4NRUA 4W4MA 4JV5J 2Q0RA 1LW2B 1FERA 3DOMB 1VQMN 4X4TA 2ZM6K 1T03A 1XBWA 1Z2LA 2YWGA 5BXIA 3QZ8A 1APSA 3IDHA 2KLAA 1ZAWA 3IAS9 1KFDA 3B82A 4BRLA 3V6DA 5CZ1A 5KTQA 3CIZA 4JI6K 1F5AA 2ZVSA 2IIRA 2VFVA 1S6OA 2XS5A 3DRXA 2LCWA 3BB5A 1T3OA 1N5TA 2F4VJ 4B3TK 2O8EB 4LFAF 5H9EJ 2B9YA 4WKYA 3G4SN 2D9OA 3VAKA 4CZLA 4GV9A 5IM0B 3CO9A 5EDWA 3S3OA 1NK6A 1XEZA