4LSLA

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-(4-chloro-2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj476), a non-nucleoside inhibitor
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
548
structure length
548
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Evaluation of C5 Derivatives in the Catechol Diether Series Targeting HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 133
structure length 548
sequence length 548
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4lslA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4lslA05
4R8UB 4FM1A 1QE1B 4WFXA 2OH2A 4OL8A 3RWUA 4Y1DA 2FVQA 1S48A 3I5BA 1VSJA 3PX4A 1RT3A 4DL3A 2FLPA 3PW2A 2DPJA 1TL3A 3H4BA 4FM2A 3A2FA 1FKOB 3ZCMA 3B6OA 4DSKA 1BI4A 3V9SA 3DMJA 3HVAA 3HO1A 1RBRA 3QNOA 4B9UA 1LAVA 3ZT0A 1HQEA 4CFCA 2XI2A 1S0NA 3MEEA 2AJQA 2XY6A 4NLTA 1XR7A 4QWAA 4FJKA 1ASVA 1S0MA 3GIJA 4CF0A 1GOBA 1T05A 5KFCA 3LP2B 1HNIA 3SQ0A 3BGRA 3TAMB 4IOBA 4WXWA 2WK4A 3OHBA 3CJ2A 2CKWA 3TANA 3OL6A 1RBSA 2P51A 1RT5A 1W25A 3ISND 3ZSVA 3TAGA 5C42A 1KVCA 3HPHA 1HNVB 1RTHB 4E19A 3AA5X 1T94A 4JS5A 4NLDA 3AVNA 5L1LA 4QPXA 4Y34A 4NLOA 3HP6A 3H5UA 3K5LA 1I39A 3BDPA 2B6AA 1NK8A 1LW0B 1GX6A 4RUCA 4B9NA 4Q0BB 4H4MB 4OLAA 4O55A 4CIFA 3L3VA 4CJEA 5F8IA 3K5OA 3QINA 3MFHA 3QESA 2VA3A 1XR6A 4FJGA 3NGIA 2OA8A 3OYNA 4XIUA 3OYHA 3AO2A 4I7FB 5DGBA 4H4OA 2C2RA 4KRFA 5SWMA 3DOLB 4CJSA 4K4YA 4F4YA 4Q8EA 1VSDA 4DSFA 2IC3A 4KV8B 3RR7A 3IS9B 4CK1A 1QHTA 3NCIA 2KW4A 1TV6A 4JV2A 1LWCA 4C8MA 3HL8A 3PR4A 5KFRA 5I42B 2UVUA 1JLCB 2AGOA 2D0CA 2WOMB 3E51A 4N56A 1CLQA 2IAJB 3MTKA 3FQKA 3HVWA 1TP7A 1NKBA 4CJTA 3N6LA 1C0UA 3I5CA 4O3NA 3AVFA 1S4FA 3FRZA 4CESA 1WSEA 2R2SA 3KK1B 4DLGA 3O3HA 2WOMA 1S1XA 2ASJA 1BIUA 2J6SA 4HUGA 1JKHA 3F73A 4TQRA 1N5YA 4JS4A 1WSHA 3CO9A 4ECQA 4FS2A 4O3RA 1HPZB 3PR5B 3UIQA 4MIBA 2R2UA 1JLAB 1NK6A 2QKKA 3OY9A 3M8SA 1S6QB 2A1SA 1IKWA 4OKJA 1NOZA 4CJQA 4FLXA 5KT2A 3KKRA 3K59A 2XGPA 4NCGB 5CYQA 3SUPA 4CGGA 4ZPCA 2C2EA 5C24A 5J2MB 4IRDA 2ZKUA 4RNNA 1Q9YA 3V9ZA 1T03B 1KHVA 1JXLA 1HJRA 4QW9A 1J53A 3NAEA 1W9HA 3MEDA 5J1EB 1WNEA 1HQUA 2IJFA 3QETA 1TVRB 1KCFA 2RKIB 1LWEA 2HVHA 1RBVA 2D3ZA 3G86A 2DFFA 3ZT1A 4MH8A 4IH6A 3V1QA 3CJ4A 1QSYA 3GQCA 5HLFB 4O4GA 1D9DA 3T5KA 4E7JA 1ZBIA 5C25B 4ZMMA 1A5VA 4ED1A 2C28A 2X78A 5KFZA 3OS0A 3S3NA 1S1VA 5D3GA 4Y3CA 1XC9A 1RTDB 4DTUA 1RDAA 2AX0A 1SL1A 1IO2A 3CWJA 2DFHA 2KQ2A 1TAUA 5EWFA 4MKAA 2YKMA 3NAHA 3SFGA 4CEOA 2JEFA 4GMJB 2V9WA 3KLVA 2ZE2B 1C1CB 4G1QA 4FLTA 3VQ5A 2WRMA 4ECYA 3OYFA 5DLFA 4YMEA 1KTQA 1C0MA 1S1XB 4Z4EA 5HP1B 3KD5E 3NH0A 1VSLA 3SV3A 1RT6A 3KLEA 3OYBA 2D7SA 4YQWA 3RBDA 3WNFA 5C5JA 4FLWA 2OPPA 4NLYA 2C2DA 1C1AA 1KLNA 4RNHA 3C94A 3OVNA 2PYJA 1ASWA 4CHNA 3ZSWA 1C2PA 4DFKA 4KHWA 3QGIA 5DLGA 3PW0A 1TL3B 3ZSXA 1WLJA 3MXJA 1N48A 3BJYA 3MXMA 3JYTB 4KKOA 5KFLA 3QEWA 1RYSA 4TYBA 2OZSA 1C1BA 1N4LA 2VA2A 4K4SA 3AO5A 1RYRA 4M3XA 2R2RA 2UUTA 3P5JA 4RNMA 4CFBA 2VG7B 5J2QB 4YP3A 4PWDB 2PZSA 2VG6B 3L2UA 5DQIA 3BQ1A 2PY5A 1C1BB 1MU2B 1RTJA 1S6PA 4O4GB 4GC7A 4J9MA 4ZVFA 3D0PA 4CGDA 1BL3A 3PW4A 3V6DA 1T8EA 1X9WA 1ZBHA 5F8HA 3V6JA 2ZQBA 2RN2A 4CF8A 4ED7A 4CFDA 3PO5A 4KHUA 3ZT4A 1SV5B 2O4GA 4CHZA 2JC1A 4FW2A 3DRRA 4RW8A 4QWCA 1C0TB 1VSEA 1UOCA 2YNIA 3L2RA 3SCXA 3ISNC 3VQDA 1NK9A 1REVA 4ZPDA 1SH3A 4K4XA 4O4RA 4Q45A 4DSJA 5HRPA 4DL6A 4DQQA 4KSEB 3MF5A 5DMRA 3NGYA 4K4ZA 2JGUA 3SPZA 4RW8B 2HB5A 3LWLA 2DY4A 4OLBA 1TL1A 4ECXA 2IJNA 2G8VA 1S5JA 2XC9A 5I3UB 4CJVA 5HRNA 2B43A 1JLGA 4PY5A 2OPRA 5KG5A 2BE2A 3NKYA 4HCBA 3ZSQA 3QYYA 5CYMA 2BDPA 1CXQA 3AA2A 3ZSYA 1XI1A 1JLFA 2G8WA 2O4IA 3E01B 1U49A 4DF8A 4KTWA 4TYAA 4KHYA 4QW8A 3SQ1A 4QWDA 2OPRB 2HHQA 3MXIA 1MMLA 1T05B 4Y2CA 1SKSA 4E7KA 2ATLA 2HAIA 2HNDA 5KFAA 3DOKB 3N6MA 4CHPA 1VSIA 2E4LA 3DRPB 3HSTB 2BGGA 4XPEA 1RTIB 4EZ9A 2IAJA 1NKEA 3MR6A 2DTUA 5J2QA 2BANB 3I0RB 4AH9A 1S1TB 2BQ3A 1S1UA 4B8AB 2HHSA 1YVFA 3MR2A 3OYJA 3OYDA 1RT1B 4B9SA 3WNGA 1FKPB 3C95A 1L5UA 4Z4GA 5KG1A 3CJ3A 3V6KA 4OPJA 3RB4A 4RNFA 2VG7A 2BANA 2HHWA 4FJLA 1LW0A 1SV5A 2W8LA 4E7IA 2YNHA 3P1GA 4E3SA 2YKNB 4J9SA 2EX3A 3SJJA 1NJYA 5J2NA 1L3VA 5KFTA 2EC0A 3NF8A 3FFIB 4CJ4A 3SUQA 1O1WA 2WCXA 1D5AA 4R5PB 4EO6A 1TK5A 2ITGA 3EY1A 1HYZA 2IDOA 3PY8A 4DFPA 4RW4B 4XO0A 3I5AA 1N56A 1HYSB 4ID1A 4EBEA 5C42B 3RMDA 1MU2A 4OJRA 4OKKA 2ALZA 5HRRA 4TY8A 3JSMB 3D28A 3KD1E 1EP4B 3PW7A 3OYGA 3PV8A 3DLGA 4CGHA 2B6AB 1S9GB 5KFYA 2IA6A 1JIHA 3SYZA 4MIAA 2FBXA 5EWEA 4Y2AA 2UVVA 3QIDA 4CF9A 1K1QA 2R8IA 4TLRA 4M3TA 4ZP7A 4CIEA 4H8KA 2FVPA 2D3UA 1TKZA 5JS2A 4CJ3A 4RW7A 1U04A 3E01A 4DQIA 4J2EA 2ZD1B 4ZP6A 4Z4CA 2OPSA 4MFBB 2IM1A 3DLKB 1JXBA 1C1CA 4KV8A 4DU4A 5KT5A 5KFBA 3TAEA 1NJXA 4OGEA 1HRHA 4K4WA 4EYIB 4IDKA 3KLHB 4DLEA 2J6UA 4GC6A 4ED0A 3SI8A 3C6UB 1SKRA 4CJ5A 4ELTA 1RDDA 4FJJA 1JLCA 1C6VA 4DF4A 4F8RA 4FM0A 2YNGB 2AWZA 1Q9XA 3QLHA 4B3OA 4K50A 3TAPA 4B9LA 1TK8A 2RF2B 1FKOA 3TAMA 3NL0A 4ZP9A 3LP1B 4HKQA 3V4IB 5KRTA 5F9NA 1U47A 4FJIA 2AX1A 5L9XA 5DGAA 2YV0X 3DRPA 4FJ7A 1RT5B 3AO4A 1CZBA 4FK0A 4KHMA 4RU9A 1XHXA 1IKYA 3PJXA 3TARA 1NOYA 1S1TA 2I5JA 2E9TA 3QIPB 4CERA 3KNAA 1RNHA 1JXEA 1TKXA 3MEDB 3LP2A 2D0BA 1GX5A 4ECTA 1VSHA 4FLUA 5KTQA 1DLOA 4C8OA 3ZT2A 4O44B 4H4MA 1WSGA 3RTVA 4X2BA 1LWEB 5FDLB 4KE5A 2Y1JA 4E1MA 4IH5A 3RMBA 3HM9A 1NKCA 3MEGA 4Q43A 4DU3A 5T7BA 4CK2A 1RAJA 4F4WA 2P5OA 3KK3A 4ECSA 4CCHA 1ZBFA 3VQCA 1K1SA 3AV9A 3T3FA 3Q8PB 4DTSA 3QO9B 2RKIA 2R8GA 1S97A 1VSKA 4BDYA 4FBUA 1QAIA 4FJMA 3ZT3A 2V0NA 5KG7A 3HYFA 5KI6A 5K14A 1J9AA 4DTJA 1TKZB 4NRTA 5KFEA 1JL2A 1CZ9A 3V81A 3VQ4A 2W42A 4URSA 3AVCA 4H54A 4FK4A 1EETB 2FLNA 1RT7A 3OS2A 3AA3A 4KTQA 1Q8IA 4BE1A 3NMAA 3OHAA 2ETJA 2P5GA 3T5HA 1U45A 1TKTA 2RPIA 2HHVA 1ASUA 3S3OA 1RDBA 4AHUA 3OYMA 3PX0A 4WFZA 3MEEB 3H5SA 3KJVA 4F2RA 5EDWA 3OS1A 3H08A 1RBUA 3VQBA 3QIPA 2UVRA 4HVJA 3EZUA 1IKXB 3PX6A 2DFEA 4FBTA 2F8EX 3TWHA 3HKWA 3ICLA 3HHKA 4ED6A 1NJWA 4QOZB 5C24B 5J2MA 5DQHA 3CG7A 1KFSA 1ZTTA 4ID5A 4CJLA 3KOAA 4IFVA 4K4UA 2IS3A 4QWEA 4OPKA 2GV9A 4ED8A 1S6QA 2R7YA 1FKPA 4KB1A 3V1OA 3IGVA 4RG8A 1KLMB 4DFJA 3NF6A 3IGNA 1TL1B 3TQ1A 5JUMA 3CYMA 1D0EA 4CECA 4JRQA 3ZSZA 2PYLA 4HTUA 3WNEA 2R8KA 1BCOA 3O4QA 1DLOB 4MK8A 1A5WA 4O3PA 5HRSA 4B9MA 1JLEB 3DOLA 2YNIB 2W9CB 4Q5VA 2XCPA 2BR0A 4ELVA 4CEQA 3T19A 2FBVA 4RW6A 2V4QA 2FVSA 3LPUA 1DTQB 1U4BA 3CJ0A 3DOKA 4PUOB 3QIOA 4Z4HA 5CYMB 2G8FA 4DTPA 1S10A 4MK9A 4IRKA 3LZIA 4KI6A 1VK0A 2IC3B 1UWBA 3WNHA 4DS4A 4ZHRB 4E7HA 3KHHA 4DWIA 2ASDA 5T14A 3GIMA 1EXQA 2W9BA 5F8LA 3KTQA 3VQEA 4FJ9A 1R0AB 3KK1A 1JLFB 1RT1A 4NCAA 4EYHB 4NLXA 4RW7B 3ZSRA 5KFUA 3HVTB 4PQUB 3MFIA 1S49A 2X6SA 4J9PA 5F8JA 1D1UA 1C0UB 3KHGA 2WTFA 1NK5A 4DSEA 3MECB 5HBMB 3SV4A 1BHLA 4IFVB 3GV7B 1EETA 1HNIB 4I9LA 2LSNA 3ASMA 3TVKA 4IG3A 4LQ3A 5KFPA 5J2PA 4IKAA 4DMNA 2HNDB 1EKEA 3QEXA 5HROB 4WFYA 4I9QA 3DLEB 3RB0A 1ZBLA 4LSLA 3VA3A 4GVMA 4BE0A 4BACA 1HYVA 1HYSA 3LP0A 1S0OA 4KO0A 2HNYB 3PUFA 4I2PA 4KAIA 4EP4A 4FW1A 1RT2B 4CIGA 1KLMA 5JS1A 3M9MB 2D0AA 3M8RA 1BGXT 4URGA 3ULDA 3SUOA 4WZQA 4YR3A 2Z1HA 4J2BA 2FC0A 1S9EA 3GILA 1WN7A 4C8KA 1RCHA 1SKWA 5FDLA 1DTTB 1UWBB 5I3UA 4MK7A 4RW9A 4Q44A 2G8HA 4IFYB 2W8KA 4J9KA 3DDKA 2F8TA 3UPFA 1LWCB 2WONA 2W9BB 3NF9A 3NBPA 4W5RA 3NGZA 2CJQA 4IR9A 4EBCA 1S9FA 3LWMA 2V4RA 1RT3B 3OL8A 2GUIA 2HW3A 4J9OA 4CFAA 1BISA 4R0EA 1YT3A 2HNZA 4FJNA 2E9ZA 3LP3A 4PA1A 3JSMA 2HWHA 4KPYA 3H5YA 4DSLA 1RT6B 5JXSA 4FYDA 1TKDA 2O5DA 2YHBA 3N6NA 2IM0A 3AO1A 5KFVA 4NLSA 3CIZA 4MQ3A 4CHYA 2R8JA 1K6YA 3RRHA 4FLVA 1ZETA 3ITHA 4LY7A 2QK9A 1JL1A 3UQSA 5L1KA 3VQAA 4DL2A 3OYIA 3QEIA 4K8XA 2Q3SA 4KHRA 1T3NA 4O44A 4N41A 4OVLA 3DLRA 1QUVA 3AVKA 3BSCA 3V1RA 1KSPA 1RTHA 3OYEA 1TK0A 4F4XA 3CJ5A 4Z0UA 4CGFA 1RBTA 2R2TA 1NHVA 3BSOA 3BGRB 3OJUA 1U48A 1CXUA 2X6NA 4IG3B 3PVXA 4O0JA 3BREA 4ZVGA 3KLFA 3HPOA 5KFFA 5L1IA 3QGGA 4HYKA 3DLEA 3PJWA 3NF7A 3FDSA 1NJZA 5EU7A 4NCGA 5CYQB 1IG9A 4ED2A 2FJWA 2HWIA 1C0TA 2AGQA 1FK9A 1SUQA 4BDPA 3HT3A 4E7LA 1S1VB 5D3GB 3KLFB 4QAGA 4CJRA 4I7FA 4CJPA 1S9GA 4RW4A 2QE5A 2WB4A 5KFNA 4CF1A 1D9FA 3OSPA 1EX4A 5KFMA 2GBZA 1Y97A 3SFUA 1KHWA 1OS5A 3KMSA 3O4NA 3GIKA 3D5MA 3L2QA 1RDCA 1RTDA 1CSJA 3K2PA 2OPSB 4MFBA 1ITGA 2XGQA 2W9CA 4CEEA 2XY5A 5KFDA 4G1QB 5F8GA 4RW9B 1LW2A 3HK2A 3SI6A 4J9QA 4DTXA 3V6HA 4R8UA 4NLUA 2P1JA 1Z4UA 1BI4B 1JKHB 5KGWA 3NBPB 4FS1A 3TR8A 1VRTB 5HP1A 3Q8RB 4YNQA 3VA0A 2ZD1A 4C8NA 3QEPA 1YVUA 4M42A 1LW2B 2BQRA 3QZ7A 5DG8A 1KRPA 4KKOB 2Z1JA 3SZ2A 4EEYA 4DQSA 2XHBA 3LDSA 4B8CA 1QAJA 3RAQA 3K5MA 1RTIA 3UR0A 4M45A 3KLGB 3I0RA 1Z26A 2XO7A 4E89A 4DQRA 3RMCA 2OYQA 4OGCA 3AVBA 1IKVB 2YNFB 4LD0A 1BQNA 3IG1A 3LPTA 4NLQA 1SL0A 4K4TA 3M9NB 4ZTJA 3DYAB 4M94A 4ZP8A 1RT4B 3GV5B 2BQUA 1X9SA 1JLEA 5DG9A 3OYLA 2VG5A 3OYCA 4M3UA 1QSLA 3KLIB 3DM2A 2XY8A 1T03A 5C25A 5KG2A 1UA0A 4B08A 5HLFA 2FLLA 4WYWA 3CM5A 4RNOA 5EUHA 2D5RA 3CDWA 3M8QB 4JV1A 4N5SA 4DTRA 3LAMA 1EP4A 4NLPA 4NYZA 4ZVHA 4JRPA 2YHAA 3H4DA 1VSMA 3MR3A 4IG0A 2YKMB 4RZRA 3I0SB 4AHSA 4KFBA 4F4KA 1REVB 4ECRA 1BQMB 3KK3B 4E1NA 3PW5A 4DSIA 2KTQA 4F3TA 4K4VA 3DLGB 2HHXA 2HVIA 4WE1A 3HJFA 4M3ZA 4NYNA 2GIQA 5CY4A 2GC8A 2XCAA 3AA4A 5KFGA 5KFHA 2Y1IA 4LSNA 4LQ9A 1QQCA 3S3MA 1BIZA 4W5TA 2NUBA 1JLGB 3RB3A 4Z4IA 4FJ5A 4M3WA 1QE1A 4DS5A 4K8ZA 4TSXA 4NRUA 4YR0A 3F9KA 1JLAA 1LV5A 3AO3A 2IMWP 2Z1GA 3IG1B 3ZSOA 2BRLA 3DI6B 4L8RB 4C8LA 4CEDA 3H5XA 3VQPA 4DG1A 3MR5A 2ASLA 4ZPBA 3SPYA 3DYAA 3G6YA 1W0HA 2QKBA 2RDIA 3C6TB 1BCMA 2QV6A 2HHUA 3KJVB 1KVBA 1D8YA 3T5LA 3DI6A 3MAQA 1I6JA 4ECUA 4HUFA 3EPGA 4B9VA 2FJVA 1UA1A 1YTAA 1TGOA 1RTJB 4I2PB 2Z1IA 4AHCA 1I3AA 1WAJA 2XY7A 1QTMA 2YNHB 1RT2A 2VWKA 2YKNA 3KHLA 1SH0A 1ZYQA 1KFDA 4FLYA 4CEFA 4FCYA 3I8DA 3Q8QB 1ZBUA 4DTOA 4O3OA 3H2LA 3DLBA 4IG0B 4ZTFA 1IKVA 3OYKA 2GIRA 2G8IA 2UUWA 3DLHA 1BQNB 3NGDA 3LZJA 1S1WB 4ICLA 3CFOA 4Y1CA 3M9OB 4I2QB 3DRRB 1LWFA 1NHUA 4W5QA 3SNNA 2F8SA 4ED3A 4GW6A 4YFUA 4ZVEA 1WNSA 3S9HA 4TY8B 3CM6A 3GIIA 2IM2A 3L8BA 1XHZA 3IRXA 2ILYA 4O0IA 1S9EB 2BRKA 3H40A 1SH2A 3BQ2A 3AVAA 3UDLA 4CK3A 3KMQA 3HPGA 3H98A 4E0DA 3IS9A 5KG3A 1GOAA 5KFOA 4IDKB 1N6QA 3PZPA 5KFKA 3G0ZA 3OL9A 3VQ9A 1WAFA 4J2AA 1VSFA 3G6XA 1QSSA 2HMIB 3QLHB 4ZPAA 4IRCA 1VRUB 4MKBA 3G6VA 1X1PA 2W7OA 4TQSA 4LSNB 4DTNA 4OKEA 3C6UA 5KFIA 4URQU 1IKXA 2AGPA 1R0AA 4FK2A 2A1RA 1HQEB 4KI4A 4B3OB 2J6TA 4YR2A 1VRUA 4LH5A 2I5JB 2IM3A 4NZ0A 3AVJA 4FJ8A 5DK5A 3SQ2A 3GYNA 3ITHB 3L2VA 1XWLA 3L3UA 1IH7A 4J2DA 1HNVA 2R8HA 1S6PB 2UVWA 4NLRA 3FFIA 3LP1A 3EZ5A 1HMVB 3V4IA 4U7CA 1ZTWA 4PWDA 3TAQA 4I2QA 1YTUA 1J54A 3TI0A 4DFMA 1IKYB 4CHQA 5KFXA 2E9RX 3LP0B 4J9RA 4N76A 1NK4A 3CDEA 4R5PA 4J9LA 2X74A 2W7PA 4CJWA 1JLBB 3DRSB 3OSNA 3U3GA 4DQPA 1WSIA 1FXXA 4Q0BA 2W9AA 4DTMA 3NAIA 4JLHA 2B4JA 3NE6A 4W5OA 5FRMA 3Q8SB 5FRNA 5E41A 2B5JB 2WONB 4DU1A 4B9TA 4FZZA 1JLBA 3DRSA 3OLBA 2KZZA 4O3QA 3HP9A 5KFJA 1S1WA 4ICLB 4EP5A 3LAKA 1LAWA 2HNZB 5I42A 1RILA 1VRTA 1KVAA 5DQGA 4ECVA 5K14B 4FZXC 2HMIA 2B5JA 1JLQA 5KFSA 3SUNA 4KBIA 4QCLA 5DG7A 2ILZA 3T1AA 4CJUA 2ATQA 3FSIA 5KFQA 3IN5A 3KK2B 2JEIA 1J5OB 4KFBB 3KLHA 1N6QB 1BQMA 3B6PA 3LANA 4Z4FA 3TABA 1NK7A 3AVIA 3V81B 2EHGA 2OPQA 2AU0A 1TKTB 3GV8B 2FVCA 4RUAA 1A5XA 4WE1B 3OJSA 2JEGA 3KLGA 4TY9A 3PO4A 1RT7B 4WYLA 2FJXA 2D41A 3KK2A 1Z25A 3AVHA 1TV6B 4XPCA 4O3SA 3MECA 1B92A 3OL7A 3EPIA 2OPQB 5KFWA 4KREA 3QGHA 1U09A 2C22A 3U6FA 2E6MA 5HROA 1RT4A 1QS4A 4NLWA 3K5NA 4KB7A 2YNGA 1GOCA 5HBMA 3VQ6A 4QWBA 5KT4A 3KHRA 1TVRA 3RAXA 1T7PA 4KO0B 4BDZA 3THVA 4F3OA 5SZTA 5J1EA 1HMVA 1N5YB 3OYAA 1F21A 3BQ0A 3C6TA 1HPZA 5J2NB 4CGJA 2VG5B 4EBDA 2F96A 2JLEA 1L3UA 1X9MA 4WXOA 3KKSA 2HNYA 1IKWB 4NLVA 4KB0A 4JUZA 3I0SA 5F9LA 2YNFA 5KT7A 3RB6A 4EO8A 4WZMA 4KHSA 3BSNA 3ALYA 4IQXA 3QO9A 1HARA 2AQ4A 4BWJA 2FVRA 4W5NA 4M95A 3L2WA 3QZ8A 3DM2B 5KGXA 3HVRA 4NYFA 4FVMA 3VQSA 4J9NA 4AHVA 3KIOA 4IFYA 4KTZA 3BSAA 4ELUA 4HUEA 1G15A 2ZE2A 1SL2A 4O5BA 4F2SA 3G10A 4AILC 3T5JA 3V9UA 4FJXA 2DPIA 5KRSA 3CFRA 4Q8FA 2G8KA 3VQ8A 4IBNA 1IM4A 2I1RA 2WHOA 5KG6A 4FJHA 2G8UA 4G3IA 3EYZA 4ECZA 1J5OA 4BWMA 5F8MA 4DL4A 4FLZA 3DMJB 3IAYA 1UAXA 4RW6B 3CVKA 3O3FA 3U3YA 4TXSA 4CJKA 5KT6A 1L3SA 2KFNA 2OPPB 5CZ1A 4CGIA 4CF2A 3K57A 5KT3A 3VQQA 4ZHRA 3HVTA 4PQUA 2VWJA 4PUOA 5EWGA 3V9XA 3M8PB 4KAZA 3K58A 1TQLA 3NH2A 3V9WA 1S1UB 3DLKA 1JLQB 2RDJA 4KHQA 4EZ6A 3CFPA 4HHTA 4M3YA 3VN5A 4CEAA 5L1JA 4DL7A 4NCBA 5KG4A 3QERA 4FZYA 3CQ8A 3HXMA 2VG6A 3KLEB 3PHEA 1B9DA 3BR9A 4FXDA 5KG0A 1RA7A 2RF2A 4BE2A 3CDUA 4DL5A 3D45A 2IGIA 5J2PB 3OLAA 4ID5B 4DG1B 1HQUB 4AHRA 4M3RA 1WSJA 4LSLB 3V6DB 2IBKA 4CHOA 4JV0A 1B9FA 1L3TA 1WSFA 3RMAA 2XI3A 4UQGA 3AVGA 1TAQA 3JYTA 3QNNA 4F50A 1TKXB 3RR8A 3RRGA 1XR5A 3MEGB 4F4ZA 4N47A 3NDKA 3AVMA 3NH1A 1RDRA 1FK9B 4U6PA 3M8QA 1SUQB 3H59A 3AVLA 4TN2A 4IH7A 2E6LA 4IR1A 4HCCA 3RBEA 3KLIA 4M41A 2JC0A 2XRIA 3NHGA 3O3GA 3QEVA 1JX4A 4H4OB 2FBTA 3TAFA 1NK0A 2BE2B 3LALA 4DEZA 4ECWA 2JEJA 5F8NA 3NFAA 4CE9A 2IOCA 1NNDA 3M8PA 4LH4A 4NLGA 5CZ2A 1RA6A 4CJFA 1DTTA 4CEBA 4IKFA 3P83D 2QXFA 4CEZA 1LWFB 4AHTA 2XWYA 3FQLA 2FBYA 2KZMA 2KFZA 3SQ4A 5FROA 2HHTA 4KHNA 1DTQA 3IRXB 3VQ7A 2OZMA
chains in the Genus database with same CATH superfamily
4R8UB 4FM1A 3UCGA 3MXHP 3LW5C 3PEHA 4OL8A 2X3GA 2KU7A 3I5BA 4CLLA 1RT3A 3OVSA 2VFRA 3H4BA 1DBDA 1FKOB 4DV6K 3HX9A 2B7CB 4DSKA 3B6OA 2KKHA 3EO3A 3MCPA 3HVAA 3WIVA 4JI5J 2UXCJ 3QNOA 4B9UA 1F5CA 1X4AA 4YOVA 4DV5K 2L9DA 1QD1A 1KWMA 2XI2A 3FK4A 4HL9A 1NG9A 3W64A 4BHQA 4IO9Q 2Q79A 3MN5A 4JI2J 4CF0A 1Y9OA 1RXOB 2FJEB 2GHWA 5AQMA 3OHBA 3M6GA 1WI6A 1Q78A 4CLKA 3ISND 3EWGA 3PIOL 1Q81T 2C3UA 1XUPO 1HNVB 3VZHA 4E19A 2VB6A 1B64A 4JS5A 3AVNA 3D6TB 1HKBA 4QPXA 2VPYB 4Y34A 3EZWA 1HNZJ 3BDPA 2B6AA 1NK8A 1LW0B 4QZVB 2NLXA 3I4PA 4N7TA 2BVZA 4O55A 3KWIA 5K8OA 5BN8A 4O0NA 2BJ8A 1RK8A 4EAHD 1DQ9A 2IFXA 2E1CA 5JLHA 3OYNA 3OYHA 3FEZA 3QBCA 1VQLN 4FF4A 2AYEA 4XTTA 4E8UA 5SWMA 4CYUB 4B3RF 4B3RK 4K4YA 1M5SA 4X84A 3O1WA 4KV8B 3CJBA 4RU2A 2EBEA 3NCIA 1K9MO 1NM1A 2JFKA 3D6RA 3HL8A 4X4PA 1U1PA 4QR1A 1ZM2A 2AGOA 3I87A 5FJ4A 2D0CA 4JP8A 4A48A 2Y0SD 2XSJA 4DU8A 3FRZA 1HNXK 4RWXA 2W1BA 4MO5A 1U1RA 1RSCA 2R2SA 4KH6A 1SPBP 1REGX 2WOMA 1HA1A 2J6SA 2UXBK 1JKHA 1N5YA 4JS4A 4DV0J 3IWXA 1NGGA 2R2UA 3GL1A 3JAMO 2VOOA 3M8SA 1H2TZ 6AT1B 1S6QB 5M1OA 2A1SA 3G71S 1ITPA 4CJQA 3LDOA 2HRTA 1WC1A 2QFIA 4WFBQ 2IVOA 5CYQA 4ZPCA 4IRDA 1KHVA 3NAEA 1W9HA 2K1RA 4JI8K 1S72N 3JS6A 4GVBA 3QETA 1TVRB 3ZEUA 5CHCB 1YJTA 1FTRA 1UAWA 2D3ZA 3K8WA 4PXCA 4IH6A 3V1QA 4WP8A 2ZGYA 5HLFB 1ZM4A 2LU1A 4V19X 3T5KA 3CXCM 2X78A 3VGSA 2C28A 3LL3A 5KFZA 3EE3A 4PKHA 1S1VA 4BY9C 2PBDA 4M63A 4JI8J 4DTUA 1RDAA 4X4UA 5A2QO 3G82B 2V8PA 3ULEB 1K9MT 2YKMA 3S6EA 1XNQJ 1C4AA 5LJ5Y 3DXSX 3KLVA 2QN6B 3HSZA 4AM6A 3J7YU 4OHVA 2F4VJ 2IDEA 1KTQA 1S1XB 2D9PA 3PTWA 4Z4EA 3NH0A 2AEJA 5E3CA 4JK7A 1X8DA 5GIPA 1VSLA 1RAAB 1SCJB 3SV3A 1MA9B 2LXIA 2DNQA 1HX1A 1N88A 1WORA 1RT6A 3PRVA 2D7SA 4AXIA 3ZX2A 2DNGA 3VWSA 2HQDA 1Q82O 2V68A 4OZJA 5IV4A 3OA9A 4A8SA 1ASWA 4CHNA 2ZC4A 5IWAK 4WQ5A 3CCMN 3NRBA 3F5TA 3ZSXA 1WLJA 3EVOA 3MXJA 4RWWA 3I55N 4FWPA 3JYTB 1BWEA 4A5AA 4KKOA 3H1QA 2OO4A 1N4LA 2VA2A 2QLFB 3AO5A 3LPEA 4TVAB 1FNXH 3W9JA 1PBUA 3P5JA 1VJWA 3MUTP 3KKFA 3GIRA 3CQXA 4PWDB 2VG6B 1JXVA 5DQIA 3W2WA 4FVUA 2QIFA 2CQ4A 2PY5A 3K0JA 2CNOB 4PKIA 1S6PA 4O4GB 3TUPA 3QATA 4J9MA 2QA1A 3KJNB 1WEXA 3RW7A 4CGDA 3TSQA 1T8EA 1X9WA 2FIUA 2AD9A 1ZBHA 3AFGA 2XM3A 3PO5A 4KHUA 2O4GA 4CHZA 2JC1A 4FW2A 3WQPA 3R2CJ 2NXNA 2FYXA 4I6WA 4OI0A 3SCXA 3VQDA 1REVA 3BZKA 2P9GA 1YJUA 4Q45A 5D0GA 2BX6A 3OTBA 5DMRA 3SPZA 2V9KA 2CJYB 3LWLA 2YKOA 2W01A 3MMAB 4KYZA 1NCLA 2CA9A 2CH5A 1KQGB 5HRNA 1V5VA 2B43A 5D8HB 3VHQA 2M7SA 4ES1A 2OFGX 2AZ3A 3S01A 2BE2A 3ZSQA 3QYYA 3DRXA 2JWKA 5HMZA 1NPPA 3PFEA 3UE2A 2VQEJ 4IO1A 5FLXO 4V19J 1RHUB 2X7IA 1CXQA 3AA2A 3G6EN 1XI1A 1XMBA 1U49A 3QB0A 5H1SQ 4TYAA 2BW2A 3SQ1A 2VPZB 4QWDA 2OPRB 1XNRJ 1VQSA 4D3HA 3A3PB 3IBFB 2E4LA 1AW0A 2BGGA 2CZ4A 4EZ9A 3C6AA 2IAJA 2LXFA 3MR6A 2DTUA 3VGTA 2GZOA 4AH9A 2NYIA 3PYDA 2ZHBA 1DT9A 1FDBA 2DIUA 4B17A 3OYDA 1RT1B 2ROEA 3WNGA 4DV2J 4Z4GA 5GIOA 1ZAXA 2QW9A 3RB4A 4RNFA 2HHHF 4CD1A 1YI2N 1SV5A 5LOQA 2W8LA 4YY3F 5AFUA 3DU5A 2EX3A 1NJYA 3SJJA 1L3VA 3NF8A 5AXKA 3W2VB 5BRDA 1FRIA 3CE8A 1TK5A 4WJBA 3MM8B 4DFPA 2DH8A 4RW4B 2CFXA 3SQOP 1RHMB 2O8EA 3I5AA 2H65B 1N56A 3VTHA 4ID1A 2MQMA 1FRXA 1KVJA 1A0OB 5C42B 3VGMA 4CNZA 1IBKK 2DR9A 3RMDA 2VC0A 1EQMA 2MQOA 1OPZA 4AL7A 2J4RA 3Q83A 4IEIA 2O8DB 3JSMB 3D28A 3KD1E 4F25A 3TVZA 3PW7A 1Y3KA 1VQPS 4CGHA 3ZZPA 3SYZA 3OVBA 4Y2AA 2UVVA 1CG2A 2EW9A 3KVGA 3BR8A 5BPNA 4DKWA 1VDHA 4TLRA 3EKUA 4M3TA 1RCXB 4CIEA 3IWNC 3VF6A 3M2RB 4CJ3A 4DZDA 3E01A 4DQIA 2ZD1B 4KGZB 4DXLA 3ULEA 1AXQA 2HIQA 2IM1A 1WOOA 1EQYA 3T1HK 1OVYA 1C1CA 3CF5Q 4DU4A 3I55S 4JI4F 4JI1F 1HRHA 3UW1A 2J6UA 1KQSR 1SKRA 4CJ5A 2DXEA 4L3KA 4FJJA 4CH7A 1JLCA 1AA1B 2O8BB 4F8RA 1Q9XA 3OD2A 5AJ3J 3HRGA 4K50A 1TK8A 2YBVA 2KFYA 4FL9A 3GOIA 2UXDK 3NL0A 5EY4A 3C7NB 8RUCA 5F0UA 4J7CA 5F9NA 3ULHA 4PQAA 3ZO7A 4FJ7A 1CZBA 4TU9A 1PBAA 1IKYA 3TARA 2ATCB 4TU8A 2E9TA 4CERA 3MWTA 1QVGM 4DZ6A 1FJCA 1TKXA 3MEDB 2CJKA 4NI2B 2XEXA 4JBCA 1VQMS 1DLOA 1U6ZA 4H5WA 3UO0A 1OH6A 4H4MA 4CDIA 4K7QA 1CULA 1NSQA 3O8WA 3ET6A 4OYXA 3TTDA 4Q43A 4DU3A 1MNEA 1S7IA 3J7AP 1K1SA 3QNWB 2Y8YA 1VFJA 1TFYA 1VQMN 1VSKA 1ZZFA 1U25A 2C2OB 4UUXA 3MM9B 2V0NA 2P5VA 5KI6A 2UXDF 1UCNA 4WCEQ 3OUYA 1TKZB 3BM7A 5KFEA 2MHNA 1CZ9A 5DO2A 3WXLA 2I0XA 1V4SA 3V81A 4URSA 3PYGA 4DUZK 3R5BA 4H0PA 3AVCA 3MGJA 1ZA2B 4UT4A 1WHYA 2XZTB 4WTOB 2M2BA 5LT5A 1Q8IA 4USHA 2ETJA 3HULA 1WC5A 3JTOA 3OYMA 4WFNL 3H5SA 1CJVA 3KJVA 2D4WA 5EDWA 3VQBA 3QIPA 4OIXA 3N79A 5GINA 2K3IA 3PX6A 5LMUK 1VJQA 2DFEA 3NGRA 2F8EX 2FY8A 3HKWA 3HHKA 5C15A 2XHCA 2HFVA 3FVYA 1VHIA 3HM8A 1B0PA 5D0RA 4ANDA 2NLWA 3GJQB 3Q2SC 4FPBA 1FRHA 4IFVA 1WC4A 3IKMA 5AQGA 3R9PA 4ED8A 4KB1A 3ZTOA 2WB1D 3VVTA 4JI1K 1JJCB 2VODA 2GV1A 3NF6A 3TQ1A 4YB1P 3H25A 2W4CA 3WNEA 2M70A 3TVYA 2R8KA 1BCOA 2CVIA 3NWRA 2M9KA 4MK8A 1R89A 4NXNF 3DOLA 1X5PA 2W9CB 1WF0A 4Q5VA 2Z0GA 5FPMA 4EHUA 3T19A 1YIJN 4ZJLA 1U4BA 1N36K 1B3TA 5CYMB 4UZBA 3O9SA 2AJ1A 2A42A 4DS4A 3WNHA 3CCRN 2I7PA 3TRGA 2YX7A 4E7HA 3KHHA 5EX5A 2ASDA 2VFTA 3GIMA 1RU2A 2QYGA 4IOCL 3HT0A 2W9BA 4GKKK 5F8LA 3TQEA 3VQEA 1ILYA 2YKPA 1ROFA 3TSUA 4NCAA 4JKEA 4NLXA 2E8AA 3QWPA 1S49A 2HS4A 4QBUA 2YHWA 5JMVA 2YY3A 1NH8A 1T95A 4DSEA 2CQ0A 3MECB 5HBMB 3SV4A 5CZVA 4IFVB 3GV7B 3QT5A 4IG3A 5KFPA 4ISGA 3THYB 3BEGB 4IKAA 4QIGA 4H0VB 4DMNA 5HROB 4RBUA 4WFYA 4I9QA 3DLEB 3RB0A 1BMQB 1UP1A 5ADXH 4BE0A 4BRCA 1HYSA 1XMQK 1S0OA 3W2VA 1JB0C 4ZITA 1VQ4S 4JI5F 4FWSA 2AEFA 1M5HA 2RRBA 3P4UB 3L0QA 2EWHA 1YTYA 4FW1A 4Q2LA 1HBNA 1SC4B 4Z94A 4BQZA 5C0YA 1ZZNA 4XAKA 3M8RA 2D0AA 3CJ1A 4KHPJ 2EK6A 4YR3A 4L3NA 3HHLA 4J2BA 2DH7A 4OHXA 2MY7A 3GILA 5CE3A 3DLLL 5D4LA 1RCHA 3LDPA 1SKWA 2QSWA 5LMNK 2PDAA 1DTTB 2QLJB 4YDXA 2R9LA 2WBRA 3EL2A 5A8WA 3UPFA 2Y8WA 1WB9A 2W9BB 1WG1A 3NF9A 1PILA 4DR5K 4QS7A 4W5RA 3NGZA 3VESA 4EBCA 4U67L 1RT3B 3E9PA 2HW3A 2YH0A 4ER8A 4J9OA 1P8GA 4FJNA 2E9ZA 3LP3A 2B9EA 4DR1J 1RKIA 3H5YA 4X65F 3IR7B 1RT6B 3KG1A 2CPEA 5G0RA 3N4WA 2FHOB 5CD4A 5H9FJ 5DM6L 2CXEA 2YWHA 8AT1B 2RQKA 3CCLN 2NYHA 5AQHA 5ETOA 4V19S 3ITHA 3VVUA 1UMJA 3UWTA 1WACA 2IVYA 3J81U 3QFPA 4DHVA 3OYIA 1FFSB 3DOMB 3QEIA 3AJ2A 5KOWA 1R0CB 4O44A 5B0FA 5EVZA 4MKYA 3P39A 1FNOA 2E1ZA 5GMEA 3C7NA 2P9KB 5A0YB 1T0TV 3RSEB 4QIEA 3R6LB 1B7FA 1RBTA 1SI9A 3BSOA 3BGRB 4L72B 1I5OB 1U48A 3MM7A 2IIRA 4M7YA 3NGSA 2KG0A 4HYKA 3DLEA 5KQ8A 2WSCC 1NJZA 4NCGA 1IG9A 3HHEA 4NI2A 4F67A 3DXKB 1FK9A 2RDDA 4ZVTB 3HHDA 3HT3A 1S1VB 4QAGA 5BYQA 4CJRA 1S9GA 1SJ4P 2PFUA 2QE5A 1UW9A 4L73A 1R7IA 1G6BA 2GQQA 2E2PA 5KFMA 2V2QA 4OQJA 3FLCO 2Z2MA 4NASA 1OS5A 5F3TA 3KMSA 3HHLD 4KGKA 3SJHA 3GIKA 3C65A 3MURP 5LJ3Y 1CSJA 1IUJA 2W9CA 2LQ8A 2XY5A 2XS7A 1XTZA 1ZOTA 3G2XA 4I56A 1LW2A 4LFBF 3VEZA 4F0HA 2LECA 4G1IA 1BOTO 1WOSA 2P1JA 5B7WA 1Z4UA 3JQKA 5AQPA 5HP1A 3Q8RB 5I9EB 4IUFA 1XEZA 1LW2B 1UVLA 2BQRA 3QZ7A 3D6MB 1R8CA 5D0HA 2FGCA 4KKOB 2ASMA 1K0VA 1BQXA 4DR4F 3KLGB 3I0RA 2ROGA 2GVZA 2HGMA 3FCHA 2XMUA 5CR4A 3BKFA 3BPDA 1NGDA 2YNFB 4LD0A 1IG8A 4NLQA 3VAGA 3IMQJ 4DPUA 2GFFA 4BRDA 1T9VA 1RT4B 4ZP8A 4CLYA 3CEDA 1K73T 1KONA 4LR9A 1G2EA 1S57A 4Z7YA 1EWQA 3OYCA 1QSLA 1T3OA 2XY8A 3MMVA 3OXGA 1I94F 3I32A 4PL7A 4B08A 4WYWA 3CM5A 3US5A 3W61A 3BV8A 2D5RA 2PN6A 2VFUA 4JV1A 2A10A 3WBZA 1MW7A 1JCFA 1EP4A 4NLPA 2KL8A 4JRPA 2YHAA 5BR8F 5LJWA 2ASOA 3WUHA 3UN5A 3T1HF 3K5PA 2CUYA 1PIEA 1TZ0A 4FWLA 5AQUA 4E1NA 5LMUF 3NWGA 1RLDA 3AAQA 2MQLA 2OKQA 1NSAA 5DDRC 3SSQA 1PAUB 2NRWA 4PYDA 5KFHA 4I6MA 4LSNA 2MQPA 1QQCA 2UV8G 4ED4A 2NUBA 1JLGB 2OLWA 3RB3A 1FERA 2MZRA 2YWKA 3HOSA 3THTA 2YTCA 2QWQA 2FD2A 4FKYA 4QIWD 3F9KA 3H1VX 2R7UA 1OQ3A 1VQ9S 2CDRB 3Q8VA 1JLAA 1GFWB 2J9DE 2NZ4A 1EJ7L 5D78A 4L8RB 2P6SA 1R8PA 4Y65A 2ASLA 1F6TA 1WEYA 3EX7B 2EC2A 4YHHK 3QGPA 4BC2A 1VISA 3MM6B 1NSPA 4DOZA 2RDIA 4YS2A 1BCMA 1NUEA 2QV6A 4YN3B 4JI7K 1NWKA 1O8BA 2JLFA 2VC1A 4NLBA 1F3FA 2JNJA 3H20A 3AXMA 4ECUA 4PAAA 4CZIA 3L9ZA 1YTAA 4I6YA 1XC3A 2Z1IA 4AHCA 4ATNA 1I3AA 3DWLA 2YNHB 4B02A 3KHLA 3HFKA 4CEFA 3I8DA 4P2MA 1CQMA 3H2LA 3DLBA 4IG0B 4ZTFA 3M6VA 2GMLA 3DLHA 2PFDA 2D3O1 1S1WB 3IO1A 2R3VA 4A47A 2VBXA 3ZTPA 2Z57B 4CT9A 3OV7A 2NUUG 3OBYA 3DRRB 3AA9A 1RAHB 1LWFA 4LBIA 2IVFB 1NHUA 5A8KB 2O67A 5HSPA 1GNKA 2P6TA 3CJCA 3DXKA 3CM6A 2LQ9A 2FC9A 3CI5A 1YRXA 3GPAA 3ENAA 3WXKA 4CK3A 1R27B 4CWBA 5J1NA 5LXRA 4RPFA 4X4OA 3IS9A 4HT5A 5KG3A 4IDKB 3MUMP 3GU0A 5KFKA 3VQ9A 2NRHA 3O8MA 2WSFC 4BRAA 1HLWA 4J2AA 4EU0A 3CMAS 2ZHAA 2HMIB 3EXCX 1VRUB 2MGZB 4MKBA 1X1PA 3WXJA 4LSNB 1QM9A 2HBZB 4BLGA 4NL5A 3D4JA 1WBDA 4CBXA 1R0AA 1OSDA 4A8KA 1GH8A 2QX0A 4B3OB 2W2QP 4FWRA 4C3KA 5GAHU 4XH4A 1MWQA 4FJ8A 5DK5A 3GYNA 1X4HA 2XNQA 5BYRA 1MMDA 4J2DA 2W4PA 2R8HA 1U1QA 5K8MA 2VQEK 3BEXA 1N32F 2KDOA 3EZ5A 4GV9A 2FB0A 3AOCA 3V4IA 3HFZB 4B3SK 4U7CA 4JHDB 1ZTWA 3E1YA 3G4SN 2QA4N 1J54A 3CD6N 3D3BJ 3J7AN 2GIFA 3TI0A 5KFXA 4NXMF 1T6DA 2F40A 4J9LA 5IM0A 2W7PA 3LGMA 3U3GA 4ZCLA 1FXXA 5IT9U 2IA0A 5GADU 4JKAA 1OSCA 1U1OA 3CW2C 2LCWA 4W5OA 3O44A 5FRMA 5E41A 4DR3J 1UVKA 3CCTA 4RBVA 1VQ8S 3CQYA 4G9ZA 2KZZA 2SXLA 5KFJA 3GJTB 1LAWA 5IFMA 2AIRB 4C0BA 1VRTA 2HEKA 5DQGA 1N54B 2QWNA 2Q43A 1JLQA 3SUNA 4KBIA 4QCLA 3T1AA 4CJUA 3KK2B 1FESA 4LF5K 3TZWA 1CC7A 3B6PA 1X0PA 4XDDA 2RQMA 2G2OA 1KD1O 4LRFA 5JVHQ 4M5KA 2OPQA 4DR5F 2AU0A 2E7VA 1W2BM 4OX6A 3F56A 3OJSA 1U0HA 4WYLA 1Y3JA 3AVHA 3KK2A 1RHRB 4JKDA 1TV6B 2MZ1A 3BGFA 3MECA 1B92A 5ETQA 3EPIA 2PGCA 1PGZA 3H3NO 5AE3A 3FMBA 2L9NA 2MPUA 4DR1K 2OSRA 5HROA 1OJ4A 3M1FA 3K5NA 4KB7A 3GTYX 1Q16B 1B70B 2JLGA 4ID8A 4ZLLA 2C2MB 5KT4A 3ZZZA 1NMEB 1T7PA 3EICA 3THVA 4W92B 4GKJF 5SZTA 4NMXA 3TEHB 5J1EA 1HMVA 1UL3A 4PL8A 2C3OA 1KAZA 3DC2A 3OYAA 3MD1A 2HSTA 5J2NB 4EBDA 2GELA 2F96A 5KPZA 1B99A 5M1PA 2JLEA 1X9MA 4WXOA 3PXGa 1VQKN 3J80O 3I0SA 5KT7A 3RB6A 4EO8A 3K2YA 3BSNA 2JWNA 4DR2K 3O9QA 4M95A 2QMUB 1IBMF 3HVRA 2C1EB 4FVMA 2NRVA 3UKUB 3QDKA 2W6LA 4AHVA 2FHMA 3KIOA 1FJGK 1SQFA 3W0LA 4KTZA 4ELUA 2O3DA 1MLAA 2XMTA 2PI5A 3CFRA 5KRSA 3GFZA 3VQ8A 1MWZA 2DNRA 2OMLA 4ECZA 1J5OA 1SIWB 2U1AA 5F8MA 4FLZA 1FWLA 3W5YA 4CJKA 1L3SA 1VI7A 2OPPB 5CZ1A 2GMJA 4USMA 3VQQA 3T1YJ 4PUOA 4YDDB 3UE5A 4KAZA 5A8RB 2XULA 3L7PA 3DLKA 2D0PA 1JLQB 4JKBA 3AY0A 1HWJA 4DBQA 3CFPA 1G4CA 3W8PA 4NCBA 2GAHC 1HWUA 3KLEB 1T9YA 4QIVA 5KG0A 2R7VA 1RA7A 1YZ7A 2RF2A 4U7UK 2UXDJ 1HW8A 1N0VC 2P9PA 2QMWA 3FBFA 4AT1B 2F7TA 3PJ9A 4LSLB 4DR4K 4U7UD 1RZMA 3FFKB 3EJMA 2V34A 2EKNA 5D77A 1XR5A 4KT0C 4F4ZA 3NDKA 4WYBA 1RDRA 1W97L 3HKZD 3H59A 5DS7A 2HBJA 1N8RT 3CC7S 4X62K 2D3OR 4DV5F 3RBEA 3TO8A 4J9UE 2EK1A 1IR1A 2CNKB 5A8WB 3J81j 3NHGA 4J9VA 3QJLA 4H4OB 1IN0A 2P9LA 4ECWA 3C14B 5F8NA 4CE9A 1CPZA 1Z1ZA 2XMMA 2HGLA 3AARA 1BXNA 4NXMJ 4CEBA 4LF8F 4N77A 3CIPA 2KZMA 3J80Y 1DTQA 3IRXB 5AQQA 3TZYA 4J5OA 2WVBA 2HSEB 4QIFA 2G0JA 5ETSA 2JVRA 2YWFA 5B09A 1S48A 5EHHA 1VSJA 1IWGA 4DL3A 2FLPA 1ZBSA 2DPJA 1TL3A 1J27A 3RYLA 3G9CA 1BI4A 2A3ZA 3HO1A 5E3QA 4A8MP 3TEGA 1IR2A 2DIVA 1NEEA 1S0NA 2AJQA 1XIQA 2XY6A 4H4KA 5ETNA 5M1QA 4YORA 2CQBA 1ASVA 3TUZC 4DDFA 4P72A 1T05A 3LP2B 5FLXY 3ZTQA 4ILJA 4YHHF 4CVNE 3SQ0A 1N34K 3HBTA 2WK4A 3CJ2A 4DHYA 3OL6A 1RBSA 5IZHA 3O4WA 2EWSA 1RT5A 1W25A 2BE7D 1RWMB 1QQOA 4OI3A 3AAPA 4B3RJ 2YKAA 4BRGA 4IJNA 1OY8A 1RTHB 1N33F 1T94A 4PHTX 1F3VA 4M5DB 2M5YA 3HP6A 3H5UA 3Q89A 1N8RO 1ZH5A 1WOPA 4JOUA 4JYAF 1Y64A 4B9NA 1YK9A 2PO4A 2Y0BB 4H4MB 1UJ4A 5LXYA 2YQ1A 5CA5A 4EFAC 2LQ5A 2XLJA 2VA3A 4K42A 4FJGA 2N82B 3VCDA 1NO8A 2OA8A 2DGUA 4XIUA 4I7FB 5DGBA 5E26A 4WKYA 3R6GB 4WPAA 2K7JA 5AQXA 5DDQC 4DV4J 3N9UC 1NMNA 5B0EA 3PCOB 1RHJB 4B1WB 4DSFA 2IC3A 5IT9Y 5IV3A 3IS9B 2OJ3A 4JV2A 3PEJA 2ASPA 3CNQP 3J7Z5 3PR4A 3C15B 4DR6F 2P9NB 4A57A 2WOMB 2NS1B 4N56A 1VQ5S 1CLQA 3MTKA 1NKBA 1KN6A 4WQ5C 4DV4K 1C0UA 3I5CA 4O3NA 4FWKA 4CESA 5M1NA 2G4BA 1WSEA 2HQIA 4WK1A 1NGHA 2A3JA 2ASJA 2VU5A 3W8GA 1M5OC 4DX5A 3VQTA 1GMVA 2KRRA 3R9LA 2H48B 4RLEA 4FS2A 3F9MA 4LFBJ 2J76E 2M52A 3TZXA 2QKKA 3OY9A 1V5IB 2NREA 3DNCA 4JKFA 1IKWA 2NSBA 1VMBA 4FWMA 3C0BA 4FSVA 3R5JB 2YXLA 3GB0A 3VMFB 1IBCB 3A8YA 3K59A 2XGPA 2FHJD 4HEA9 2HZCA 4X65J 2C2EA 4PZVA 4BRKA 4M5LA 4LIWA 1JXLA 4A62A 1FFGB 5K8NA 3MEDA 3SBGA 1U2FA 4FWOA 5HQMA 4PXDA 4LFCF 1KCFA 5DRKA 2XMWA 4JI8F 4TKTA 4MH8A 1IJEB 1YX2A 3CJ4A 1EB0A 3GQCA 2ZOMA 4O23A 1HL6A 4X4SA 4ED1A 3OS0A 4B3TJ 5D3GA 3NMUA 4DR3K 1YQHA 1IO2A 3ELHA 2KQ2A 1Q8BA 2ZOGA 3VENA 3SFGA 2JEFA 4GMJB 1I94J 3DKDA 1LOUA 2O8FB 1S99A 4K41A 2ZE2B 2YX1A 1WF1A 4G1QA 2H3EB 4GVEA 2ZZNA 1C0MA 2M8HA 1P8ZA 3VF4A 1BWVA 2H1YA 2VCPA 4RUHA 5U47A 2XLKA 1QDUB 2C3YA 3PRDA 1UJ5A 4M5NA 2KHDA 2C2DA 3PKYA 1C1AA 3C94A 3OVNA 4UW2A 2NZTA 2LU2A 3L7UA 5AQIA 1DRZA 3M32B 1C2PA 4DFKA 4HHJA 3NY0A 1TL3B 3EE8A 3BJYA 2XSJB 3MXMA 1NB7A 5KFLA 3ZETB 1RI7A 2OZSA 4M3XA 4F0MA 2R2RA 3TP2A 2BH1A 4WKRA 5J2QB 4B3MK 2V67A 3VAMA 1QHAA 1VBXA 4M5HA 1FF2A 3MK6A 2GO9A 3TJ9A 1C1BB 1MU2B 2V2VA 2A5XA 3NGUA 2O8CA 4ZVFA 4LF7K 3PW4A 3V6DA 5E33A 3ETOA 3V6JA 2ZQBA 4PG5A 5CHIA 2RN2A 1U2RA 4ED7A 4CFDA 5H1SV 1HBOB 4AXJA 1NHKL 4HHHA 4RW8A 2D74B 2O8EB 1C0TB 1UVJA 1VSEA 2YNIA 3L2RA 4BC7A 3NS6A 1NK9A 4EI2A 3Q8UA 4O4RA 4ZVUB 2ERRA 1EHWA 2EVZA 4LFAF 2DRDA 2P9EA 1T9UA 4KSEB 5E5NA 3NGYA 5HVGA 2JGUA 1OWXA 4RW8B 1OVQA 2DY4A 4FNHA 2DEJA 1TL1A 4ECXA 1S4EA 2XMAA 2DISA 2XC9A 2J7WA 3KUEA 4CJVA 2NUHA 3B82A 2BKPA 2OPRA 5KG5A 2E5HA 4HCBA 1KC8O 3FMWA 2HF4A 5CYMA 2G8WA 2P9CA 2Z56B 2B56A 2KM8C 2GNKA 4KTWA 4U95A 4KHYA 4GKKF 4PG8A 2HHQA 3MXIA 1MMLA 4NYPA 5T7LA 1FVQA 2HAIA 3DOKB 1BHNA 5E0OA 2YVSA 4DJBA 3MWBA 3X1LB 2F1FA 3G87A 3K7RA 4XPEA 4BR5A 1NKEA 5J2QA 3LA0A 4LF8K 3IA0A 2BQ3A 2NXUA 1NDCA 2V52B 1H3DA 1YVFA 2R4FA 2MDAA 3MR2A 3ISZA 1FT8A 2QL5B 1Q81O 2E5LF 2D1KA 4B9SA 1IBLK 1NZAA 1FKPB 5KG1A 3CJ3A 3V6KA 4OPJA 2VG7A 3T1YK 1K73O 2BANA 4FJLA 1LW0A 1MMNA 1NNEA 4PABA 4E3SA 2Q6BA 2YKNB 1P9YA 4J9SA 4YOTA 3JSYA 4CJ4A 2FF3B 2WCXA 3A3NB 1D5AA 4MKVA 2KXNB 5HK4A 5B08A 4H0YB 3V4MA 1YBTA 2RQCA 1X3MA 2NPFA 4EBEA 3T41A 4K0KK 3LPYA 3MMCB 3JAMY 2HBLA 5IWAF 3EE9A 2HVEA 3QICA 5D4NA 1N36F 3C6HA 3BBFA 2IVMA 4TY8A 3S41A 3PV8A 4KJIA 3DLGA 5GAGP 2B6AB 1S9GB 5KFYA 3ILOA 2IA6A 1JIHA 3B54A 2FSNA 5BREA 2B9YA 5EWEA 4H5NA 1T02A 3CUNA 4CF9A 1FJGF 1FCAA 4C0OC 5AXMA 5AQNA 1X4FA 1SJQA 1CEZA 3MPDA 2YI1A 5JS2A 1OO0B 1Y5LB 4J2EA 2ALYB 5JMNA 5AFUH 3ZFVA 3H42A 3I8BA 2GGPB 1PKUA 1S12A 4OZNA 1CJUB 3H2UB 3DLKB 3BO3A 2A0FB 3TAEA 3D67A 4EYIB 2CPXA 3KLHB 4DLEA 3D68A 3SXLA 4GC6A 4ED0A 1CJKA 3C6UB 2KT3A 2CGKA 4ELTA 1RDDA 5K20B 2ZJQQ 1C6VA 3GWCA 3SMPA 4FF3A 4J37A 4OV1A 4WQ4A 3UD5A 1H73A 3CD0A 4G65A 4ZP9A 2QLBB 4LFCK 1U47A 5DGAA 2XNRA 2YV0X 1WC3A 3TNVA 1RT5B 1XNQK 1DHMA 3SCLE 4KC5A 5AE1A 1NGAA 1KEKA 3PJXA 1M5KC 1NOYA 4QYZJ 2UP1A 2I5JA 1NM2A 2C2NA 4OJ1A 5ETRA 3KNAA 1RNHA 1NDPA 4M5DA 2D0BA 1GX5A 2DGSA 5IT0A 3WZ0A 5KTQA 3HFVA 1VC6A 2CQCA 3FKBA 3ZT2A 1WSGA 4X2BA 4X4RA 5FDLB 4UOGA 4E1MA 1WHVA 4MLEA 1NGBA 3DU6A 3HM9A 2A2CA 4AE5A 1NKCA 3MEGA 2EG2A 4A61A 3SCJE 4CK2A 1RAJA 4F4WA 2VZ9A 4ECSA 1ZBFA 3AV9A 2DPNA 3O3LA 3CPWR 1AB8A 2RKIA 2R8GA 1S97A 4FJMA 2HZAA 1MROB 2EFPA 4CI0B 4DL0C 4XH1A 2EFQA 5AQOA 2CQ1A 3F0NA 1WSRA 4DN9A 3DAWA 1U0SA 2OEMA 4M7XA 4CH0S 4DB3A 3EKSA 2LQBA 4FK4A 1CJVB 4LF2A 3SMSA 2PFFB 3OS2A 2L3MA 1U1LA 3BH7B 3AGRA 1NPRA 1TKTA 2E44A 4LF7F 2RPIA 1RDBA 4AHUA 1PYSB 3PX0A 4WFZA 4NWBA 3X3UA 5A76A 1R3NA 4FF2A 3E66A 3OS1A 1RKJA 3R3TA 1RBUA 3H08A 3D2EA 4DV7K 3SSRA 4ZDNA 2Y9HA 2RH3A 2VASA 1IKXB 3VGUA 3CHWA 3A12A 2G1DA 2V6AA 4ED6A 4QOZB 5C24B 1NAQA 3KK7A 3CG7A 2IPOB 2KG1A 3L09A 2V4JB 4CJLA 2DGTA 4EFHA 2HLUA 1N33J 4OPKA 1S6QA 2R7YA 1FKPA 2VBZA 3V1OA 2RD5C 2N3LA 2FHKA 3PHTA 1HW9A 3M6UA 4DFJA 1YJ7A 1I94K 3KZBA 3SAHA 4FYWB 3IGNA 2GEMA 5JUMA 2KKZA 1D0EA 3ZZUA 4CECA 4JRQA 1DJ0A 3ZSZA 2MQNA 4HTUA 4NLCA 3OFGA 3CD7A 4JI0J 5L39A 2ACMA 1DLOB 5L8RC 3TR5A 1JLEB 3WDOA 5GADP 2V8DA 2XCPA 1KNZA 5AQZA 4RWTA 4OX9F 2FBVA 4JD2B 4RW6A 1RU1A 2V4QA 1RQ0A 4USVA 1UEKA 1NJIT 1LFWA 2E7WA 4NZ7A 1DTQB 3CJ0A 2ZDPA 4PUOB 4CTAA 1S10A 4OPHA 4IRKA 4OYZA 3GYGA 3LZIA 4KI6A 4J90A 1YHQS 4TLQA 1UWBA 3TTFA 4ZHRB 5FD1A 3R1LA 3QBXA 1VQ9N 1GMWD 4H5TA 3CDBA 3B78A 4ZPVR 4FJ9A 4EYHB 3ZSRA 4CLUA 3IAS9 4OX8A 4OZ5A 2X6SA 4X4TA 3OTCA 4DV7F 2WTFA 3CJ9A 2PI4A 3BGUA 2ZJPQ 1FJGJ 4PCQA 2L41A 1SJ1A 3A5LC 2P9PB 1HHTP 3RJMB 2LSNA 2JRSA 4IOAL 3I9ZA 5IQQA 3C2PA 4LQ3A 5J2PA 3CCUN 2HNDB 1EKEA 4IOCQ 2QGFB 1ZBLA 3VA3A 3QRPA 4GVMA 4LF6F 5ADZA 3LP0A 2RHSB 1UFLA 2MLYA 2HNYB 3DHWC 3BN7A 4EP4A 4LF6K 3RU0A 2RMLA 1KLMA 3M30A 5JS1A 2RE1A 4ETZA 4URGA 3ULDA 1NB2A 1Q5YA 1NGIA 3W2WB 3H7HB 2HF3A 2Z1HA 1G1XA 1Z2LA 4NE9C 2UV8A 3ATUA 4LC9B 4DR6K 4PPZA 2PE8A 5H9FK 4DV2F 4B1UB 3UNGC 1UWBB 3QRRA 2AP1A 2XMJA 4IJAA 3R8EA 1VQKS 1TTHB 4Q44A 1FI4A 3JB9k 2W8KA 3DDKA 1Z2ZA 3HI9A 2WONA 3NBPA 1FRLA 4BC9A 2GMHA 2P9NA 3UN3A 4WIIA 1S9FA 1VRQC 2MJUA 4CLSA 4KR0B 1GXLA 1BISA 4LF8J 2NXEA 4CFAA 3JSMA 3QPIA 3OW2R 1FJ7A 5ETTA 2BXJA 5JXSA 4OZ3A 4FYDA 1TKDA 2ZBCA 4CM2A 4HT7A 4X66F 2WVCA 3N6NA 4NLSA 3CIZA 5EOYA 1WG5A 3AQPA 2BJ9A 4CHYA 2ZGZA 2R8JA 4AL5A 5DDOC 1K6YA 3E9OA 1HWIA 4HH1A 3A8KA 4LY7A 1Q86O 2HBRB 3VAIA 2QWLA 2QK9A 1CBKA 1B0VA 1LEOA 3OFHA 2VBWA 4KHRA 4JK9A 3D66A 1T3NA 3CCLS 3CCEN 1QUVA 3POTB 3BSCA 1RTHA 1SC3B 3T6BA 4EK2A 1OY6A 3DHXA 4BRHA 2HVDA 4Z0UA 2AHOB 2R2TA 1NHVA 1IXKA 1AUSL 2B4PA 4CIOA 4WF9Q 1RTZA 4LJMA 1CXUA 4IG3B 3PVXA 3BF3A 3HPOA 3RG6A 5KFFA 5L1IA 4FYVB 1Q7LB 3M8YA 3PJWA 3NF7A 4YOUA 3IP0A 1JJHA 5EU7A 2FJWA 2YWWA 3CMQA 1FXRA 2ZM6J 5AJ3K 2UYTA 3CMAN 1SUQA 1JNZB 5D3GB 3TOQA 4RW4A 2WB4A 1O13A 3EZOA 4EHTA 2VPWB 2JFDA 3OT9A 4IO8A 5E3PA 1D9FA 1EX4A 3R3LA 1Y97A 3O4NA 1FD2A 3JS9A 1NXIA 3I96A 3L2QA 1RDCA 1RTDA 3K2PA 3GE1A 1M5VC 1AZSA 2CG8A 2WTUA 3THWB 2EI5A 3HK2A 4ZLNA 3V6HA 1ACMB 3NS5A 3OTOJ 1EAYC 3DOMA 1JKHB 3NBPB 4FS1A 1WBBA 3HZGA 4BC4A 4YNQA 3PLAA 2ZD1A 1XBWA 1YVUA 1KS2A 3QT8A 4M42A 3U27A 5DG8A 2HFOA 1KRPA 3CCUS 1U8WA 2R7SA 2H9ZA 2Z1JA 4EEYA 3ENWA 3LDSA 2COLA 1QAJA 2V8HA 3K5MA 2ZBQA 1RTIA 3JSBA 5DM7Q 4M45A 4HTJA 4ENOA 1AROP 2XO7A 1IKVB 2HS0A 1BQNA 2QM1A 5BRHA 3LPTA 2UXBF 5HL7Q 3VEWA 2C3PA 3M3ZA 3D54A 3DYAB 2DGXA 4B3MF 2BQUA 1X9SA 3OYLA 2NXJA 4M3UA 3AQOA 3KLIB 3UR3C 3DM2A 4LRCA 4CM0A 4KHPF 5GAEP 1UA0A 2KJWA 1F2GA 4JI1J 3P8BB 4RNOA 5EUHA 2DKOB 3NVMA 1OKJA 4RBTA 1NJIO 5LMUJ 3WQUA 4ZCIA 4N5SA 3MOJB 2QG9B 3LAMA 4A2BA 2W2OP 2FXUA 4ZVHA 2CZ9A 1VQOS 2A40A 3MR3A 3WXMB 2YKMB 4RZRA 2HS3A 2RUGA 4AHSA 4BG8A 3MCNA 4ILRA 4A46A 1BU6O 2HBKA 3N4QA 2HZVA 2KTQA 4K4VA 2ZUAA 4DV1J 2HHXA 4WE1A 1HD0A 3HJFA 2IVNA 4M3ZA 3DCAA 4YHHJ 2GIQA 4NYNA 5CY4A 2GC8A 1UW4A 3ZZ0A 4LQ9A 1BIZA 5IWAJ 4ZIVA 4JYAK 3E2EA 3QFUA 3FEXB 4RR5A 2MKHA 5K9FA 3P31A 1SJ3P 4NRUA 1OIAA 2NPIA 3D2EB 4YR0A 5BR9A 4WP3A 3AO3A 2Z1GA 1TL5A 2DVIA 4CEDA 4IWVA 4DG1A 2EBGA 2LKZA 3MR5A 4OJHA 4A8OA 3LF0A 2O8BA 2HIYA 3AHPA 1SKUB 1HKAA 5HANA 3KJVB 4BR7A 1D8YA 1I6JA 4M63C 3HZEA 1IQZA 1RTJB 4I2PB 3AJDA 4XK8C 2Z58B 2FZCB 4WK3A 5E7OB 4KIAA 2XY7A 2VWKA 1JK9B 1IBMK 4LF4F 1SH0A 1SIZA 4C7QA 4W90B 4FCYA 2VHGA 3U9DA 3A8IA 1ZBUA 4O3OA 3FC9A 3UN2A 2DRAA 5JLFA 2HFUA 1YF5L 2GIRA 4IFEA 2G8IA 2UUWA 1MDUB 3Q86A 3NGDA 3LZJA 2IRUA 3EMTA 2UU9F 3CFOA 1QLNA 3M9OB 3MM5B 5BRFA 3MMAA 4LF9J 3CXCR 4I2QB 2XS2A 1R8HA 4QPTA 4W5QA 3SNNA 1RWNB 3R5AA 4GW6A 1N32J 1NDKA 4ZVEA 5ADXA 3S9HA 1IM6A 3GIIA 2IM2A 3DGPA 4HLBA 4O0IA 1S9EB 5AZIA 3H40A 1SH2A 5HO4A 3BQ2A 2RHKA 2Q97A 4RO0A 4OHWA 2L08A 3KMQA 1H7XA 3HPGA 3H98A 3M4XA 3MTJA 3KFWX 3A5MC 4EUVA 1MWYA 3ENQA 4BRIA 3PZPA 1N6QA 3J7YI 1URRA 5LL6Z 2M3DA 1YJRA 5HMYA 4B3SJ 1QSSA 2AYGA 4IRCA 3OR2B 5C2GA 3GFXA 4TQSA 3QJPA 2MKCA 2CWKA 4OKEA 2VF3A 5KPTA 1UJ6A 5KFIA 1HQEB 4DPOA 1PO6A 4KI4A 5CD4H 2XYHB 2J6TA 3R7SB 4CZCA 4YR2A 2BJ3A 2I5JB 4NZ0A 2MHEA 2XBPA 5B0GA 3ITHB 3G8QA 1XWLA 3TUIC 1S6PB 3N01A 2UVWA 4NLRA 3BBCA 3GCXP 3FFIA 3LP1A 3AXKA 5IXUA 1RUSA 1Y11A 5IM0B 2G2YA 4BRQA 4ZJQA 2GHPA 3IFRA 3MM6A 3QJJA 1YTUA 2KN4A 2ZH5A 4DFMA 4MT1A 1X9JA 1ZBTA 1X4EA 2AEMA 4N76A 2APOA 1VQON 4PKGA 3HJVA 2LA4A 5I4MA 4R5PA 5CQGA 5DDPC 5TKWA 4DQPA 1CC8A 2NNWA 1YITN 4JLHA 4E1JA 2B4JA 2FF6A 3NE6A 4ED5A 3CETA 2B5JB 1U7LA 2B7BB 2WONB 3I9V9 4CH1A 1KC8T 2DXDA 5JVHL 3N5FA 4DU1A 2C3MA 3OLBA 1O51A 6FDRA 1O0PA 4Z7CA 4A4JA 1S1WA 2HQ3A 4GKJJ 3R6MA 2IY5B 2LEPA 1YJWN 5I42A 1FWPA 4P71A 2J8SA 5CXTA 1MG7A 5K14B 2HMIA 2B5JA 2QJ3A 5KFSA 3AH6A 3BO4A 5HN0A 2OFHX 3FSIA 2JEIA 1J5OB 5DM7L 4P73A 4FNIA 4YB5A 4Z4FA 3GFYA 4MAKA 3V81B 2EHGA 5L38A 3W5XA 1F9HA 3KLGA 4QR0A 3S8SA 3CCWA 2AA4A 1RT7B 4K0KJ 3TUJC 3CSKA 1N5QA 4XPCA 4JKGA 3D6HB 2OI2A 1Y4ZB 2K7KA 3FZBA 2BACA 1FDAA 3CC4S 1SBRA 4DPTA 1K8KB 3U6FA 4KGXB 4X64K 1Q86T 5GMDA 1RT4A 1QS4A 2F5GA 1VBKA 2YNGA 2K2PA 3AB4B 5HBMA 3VQ6A 2E5GA 4FXVA 1VS3A 4C4WA 4F3OA 4CO0A 3IFEA 1QJHA 2HLTA 4KY3A 1N5YB 1SJFA 2CQPA 1HPZA 4S0MA 2DHXA 2UUCF 3IAM9 4CGJA 1VHXA 4G1PA 1CS4A 4KGMA 4DUYJ 4KB0A 5F9LA 2YNFA 1QAYA 3CCVS 5M2PA 5B0CA 3ALYA 3GR0A 4IQXA 3Q24A 4X4VA 2AQ4A 2FVRA 2QT7A 3QZ8A 3DM2B 5KGXA 2YPYA 1RWUA 4NYFA 4P74A 1CS4B 1BY9A 1EKRA 1D3WA 2G0IA 1J5EF 1W2IA 4OX9J 2DHSA 2XTJP 1RISA 3SBMA 2HFNA 1G15A 1NRKA 1LNQA 3C16B 3G10A 4AILC 5LL6d 2G8KA 1F2HA 4IBNA 4RTFD 1O6XA 5KG6A 1YXQA 4G3IA 3NCPA 1WTBA 2ZM6K 1RABB 3KUHA 2CAJA 2QSFA 3CVKA 3U3YA 1IVZA 4P9SA 2E66A 5KT3A 4ILHA 2VWJA 3AD9C 3V9XA 2DNMA 3B4MA 1HHSA 3M8PB 3K58A 3V9WA 1S22A 4O5FA 4B1XB 3CJAA 2UUAK 2GWKA 4U9RA 4H4KC 4KQZA 4KHQA 4NXNK 1RHKB 1Q79A 5LMNF 5C7PA 4M3YA 3VN5A 2NXCA 2DO4A 3HXMA 4CLTA 3PHEA 5M1FA 4HDGA 4FXDA 2F4FA 1KXPA 3POTA 4BE2A 2J9DA 3RVCA 3WEEA 4DG1B 4OHZA 1HQUB 2U2FA 2FJBB 1Q1KA 1I51B 2IBKA 1B9FA 1RGIA 2XZDB 1HNWJ 1L3TA 1FW6A 4WBFA 2GVZB 4UQGA 3OXLA 3QNNA 5ETMA 3ENVA 3VEVA 1FK9B 3MX2A 3DJCA 3M8QA 1SUQB 4JI3K 3AVLA 4TN2A 2UXBJ 2HRYA 1XMQJ 3CJQA 4IR1A 1RWWB 2ZEJA 2DT9A 2HG4A 2ZITA 3L7OA 4M41A 3GJSB 3O3GA 2X1FA 4LF4J 3M2UA 3TYTA 2VV5A 2E5IA 4JN4A 2GHVC 2JEJA 3P38A 4IKFA 2QXFA 1LWFB 2XWYA 3FQLA 2FBYA 3VQ7A 2FSJA 1F1BB 3ZXWA 3RWUA 4I68A 3T9ZA 4K59A 3IWLA 3CCRS 1RDWX 3F41A 4UUWA 5IT4A 1PAEX 1LFPA 3ZCMA 1CJUA 3FSYA 4UOHA 1U1KA 3FBCA 1IBMJ 1LAVA 3ZT0A 1HQEA 4CFCA 5HMWA 3MEEA 4NLTA 1GLJO 4QWAA 1RGVA 2F9JA 2IVPA 1S0MA 1V3ZA 5KFCA 1HJOA 1HNIA 5HJYA 3BGRA 3W5ZA 4IOBA 2ZC3A 1Q53A 4MYTA 3TANA 2CKWA 2P51A 3CULA 3TAGA 2POKA 3O9UA 4LR7A 1G99A 1N32K 3MEKA 3HPHA 2OTJS 4NLDA 3ID8A 5DJBA 5L1LA 4HH0A 2Q31A 4NLOA 3C46A 5LMNJ 3JTNA 3A13A 1GX6A 3BGOP 4RUCA 1O5JA 4F04B 4OLAA 4CIFA 1HNWF 3L3VA 4CJEA 1D9AA 5F8IA 4HTLA 3FBBA 1TFWA 3OBWA 2DYAA 1VIOA 1BD6A 1GMWA 4BRFA 3SSSA 4NMLA 2O66A 4MIWA 5AQWA 2C2RA 4FOIA 4KRFA 2E7XA 1YRUA 5H9EK 3D6FB 4BC3A 3R1XA 4CJSA 3HD1A 5CZXA 4Q8EA 1VSDA 1B7YB 4LSZB 3B8HA 4L76A 4CK1A 3HF5A 5GAGU 2A6MA 2KW4A 1TV6A 2LLZA 1LWCA 4Y2MA 4CZMA 4YY3K 2VQFF 1TR0A 4NA1A 3RAMA 5CH7B 4PWUA 3SDEA 4DV3F 1TP7A 5FIIA 2HHHK 3N6LA 2QL9B 1N5VA 3C66A 2QYCA 1S4FA 3CMES 3H2VE 4DR1F 3GJRB 1X5TA 3KK1B 1X4GA 4C1NI 1RAFB 1VQ7N 2ZH4A 3M5RA 4TQRA 4BBYA 4F36A 3CO9A 1XMQF 1VQ6S 4ECQA 2BM1A 4WWSA 5F2RA 4DN0A 3UIQA 4MIBA 2VBYA 4AUKA 2W41A 2F63A 2OEJA 4TU7A 1UPMB 2E2OA 2ZH2A 4OKJA 4FLXA 2YHXA 4BR2A 5KT2A 3KKRA 4NCGB 3SUPA 5C24A 1Q9YA 3V9ZA 1HJRA 2CPZA 2N3OA 2OEKA 5J1EB 4JI4J 2ZH7A 1WNEA 2Q6CA 2XMKA 5EX3A 2P9UB 1QSYA 4DV6J 1WKKA 2I38A 1FA0A 4AM7A 3J7ZO 1ZBIA 1N5TA 4ZMMA 1A5VA 3S3NA 1TL7A 5E3RA 2UXCK 3V2UC 3C15A 1RTDB 4CZEA 4JI4K 2X1BA 1U1MA 1SL1A 3CWJA 2DFHA 4ZPTR 3EM1A 1TAUA 1IV0A 2QA4G 4L74A 3NAHA 2M8DB 1HBUB 1WDTA 1DGKN 2V9WA 5AQLA 3KYLA 1GTEA 1GLDG 4FLTA 5DLFA 4G6VB 3PKMA 3CO0P 5C12A 4RJVA 5HP1B 2E88A 3KD5E 3AJ1A 5ETKA 4FOEA 4WIQA 1JQGA 1NPKA 3KLEA 4RX6A 2GA7A 4DR2J 2RIJA 4K5RA 1RAGB 1PC5A 3MN9A 3RBDA 5AZJB 3WNFA 4FLWA 2OPPA 3UD4P 1KLNA 1GLBG 4RNHA 1QY7A 2B4UA 3MCOA 2DNHA 2BJ7A 3ZSWA 2E29A 4DR4J 1VC0A 4AFFA 2RS2A 4KHWA 3R97A 2GJFA 5DLGA 3PW0A 5FPEA 1UWAA 2BTFA 1N48A 2V51B 4FXWA 3IRWP 2ITMA 1E6YA 2MMYA 3LUYA 3J81Y 1RYSA 1C1BA 5MLCV 1RYRA 4FKXA 2AT1B 3M1VB 1F9EB 2UUTA 3FE1A 2VG7B 3EEQA 1C0FA 2A6OA 4YP3A 2BW7A 3U8XA 2F8MA 4QJVA 3BQ1A 1S7HA 3QQCD 3T1HJ 4WFNQ 3D0PA 1K47A 1UFKA 3ZT4A 5BPMA 3DRRA 4PG4A 3MD3A 1J6ZA 1UOCA 1Y7PA 4P7VA 4Z2XA 1XQIA 1L3KA 2AKWB 2QL7B 2ZOFA 1SH3A 4K4XA 4DSJA 3HD2A 5DZ7A 1WEZA 2HBYB 3MCAB 5HRPA 4DL6A 1SJRA 3MF5A 3GBTA 4K4ZA 2HB5A 2VICA 1VQNS 1S5JA 3RRKA 1W2BR 1QVFR 4JV5J 4DUYK 1JLGA 1Q4RA 3BO2A 2UZAA 4YOWA 1JJ2M 4C1NK 5CCMA 4CTAB 5AQJA 1TUGB 2BDPA 1JLFA 2O4IA 3LTOA 1BA0A 3E01B 1S0VA 3G8TA 2Q0UA 3UDEA 4NA2A 2D0OA 4Y2CA 2ZWHA 3QSYB 3M8ZA 2ATLA 3D0HE 5AQSA 3DRPB 2EEYA 3MHYA 3VERA 3PIOQ 4F26A 5GAHI 1WC6A 2VFSA 2BANB 1S1TB 3PM9A 2MSTA 1S1UA 1FDNA 4B8AB 4CNYA 1UETA 3OYJA 1HBNB 4R0JA 5I3QA 2HQGA 1M1HA 2A1BA 3O2IA 3C95A 4DV1K 2XLIA 2IRYA 2HHWA 2DNNA 2RS8A 3DFEA 5CYJA 4E7IA 2XSFA 3P1GA 4YOEA 3M8WA 4Q2MA 2UUAJ 5J2NA 4OYOA 5KFTA 2WBMA 1O1WA 3SUQA 2JZ5A 1Y5IB 3QAUA 4MYUA 1C4CA 4EO6A 3EY1A 1HYZA 1Q5VA 2IDOA 1NSKL 3HTVA 2MKYA 3VF0B 2XZWA 5A8KA 1ZXOA 2OD6A 5I3PA 1H74A 1IJFB 4PR6A 2DR6A 3PDNA 1KVKA 2VFVA 1BUPA 1CLFA 1X60A 1MU2A 2ZM6F 3IBCB 2ALZA 9ATCB 3SLCA 3OYGA 4QR2A 3EDRB 2PIIA 4QYRA 1RAOA 2XQCA 3QIDA 1K1QA 1TL4A 3CD5A 3GFHA 4M8LA 1H7WA 5L9NA 3EDQB 4H8KA 2FVPA 2D3UA 1TKZA 2LP4A 4X65K 1DY3A 1IQTA 4CJ7A 3OBIA 4BRLA 2W2MP 3AD8C 4NEZA 4Z4CA 2HAFA 4MFBB 4PPDA 1W7AA 3EUNA 3A5NC 1UFWA 2UUBK 2DHAA 3MPWA 4QYZK 1JXBA 4KV8A 4E98A 3D2FA 2QWOA 3KDNA 5KT5A 5RUBA 2NRRA 4OGEA 1S5ZA 4K4WA 1RCOB 1XMOK 2MLZA 4KH5A 3SI8A 4A8WA 4EMDA 4OZ0A 1UEVA 4DF4A 4OO1J 4FM0A 2YNGB 4R25A 1JNRB 3TAPA 4K5SA 3HSCA 2J0SD 2RF2B 1FKOA 3TAMA 4DR7F 1HWLA 3ILLA 3V4IB 5KRTA 2PAVA 1WJ9A 2PC6A 2AX1A 1R6YA 5L9XA 3CF5L 3DRPA 1EKSA 2E5LK 2DEIA 2OANA 2BJDA 4ZA1A 4CZHA 1XHXA 2WW4A 2JX2A 1ULRA 1S1TA 2ZNYA 1RBOB 2CQHA 1JXEA 1PC4A 5GVQA 3LP2A 3TPQA 1VSHA 3NP5A 2LEAA 5HOOA 4FLUA 4C8OA 5ETPA 2GVDB 2CPYA 4O44B 1U2CA 1LWEB 2Y1JA 2WBNA 3UB5A 1KP6A 3NNHA 1ZPWX 1LWXA 2C42A 1NGFA 3RMBA 2M88A 2Q66A 5T7BA 3ZNUA 3BKTA 4CCHA 3KK3A 2OP5A 4O8UA 3T3FA 1UTAA 1UZHA 3M7VA 2PMZD 3Q8PB 3QO9B 3C14A 2RAQA 3ZNJ1 1GLAG 3KUGA 4FBUA 5KG7A 3HYFA 2A2DA 5G4DA 1FTCA 1X7VA 3RBZA 2X1AA 4JEPA 4FWQA 2H3GX 1K0TA 4NRTA 1JL2A 2DGQA 2Q2RA 1CJKB 1ZPVA 1MWMA 1WKJA 2W42A 1SXLA 3A0IX 3NOCA 3SEOA 1EETB 2DY1A 3IMXA 2BYCA 4KTQA 3AA3A 4JNEA 4BE1A 2QA2A 5HJXA 3NMAA 2V7ZA 4I4BA 5LSRA 4LT6A 4WCEL 4CBWA 2HHVA 3BN4A 1ASUA 3S3OA 1YJNN 3QMLA 1BLUA 1T44A 3IBWA 3MEEB 4JK8A 4XH5A 3FJ2A 3S1TA 7FD1A 3EZUA 4FPIA 4H0TB 4FBTA 2CQ2A 3TWHA 4JI3F 4H5RA 2RHQB 1Q18A 1UZDA 5J2MA 3WC2A 2V8GA 4ID5A 1Q0NA 2Q36A 3UCZP 1DKGD 3M1VA 2IS3A 1YG0A 2AJ0A 4QWEA 1YKWA 1FVSA 2D1CA 4AF1A 4YDUA 2UU9J 2B3TB 3D3CJ 3IGVA 1BUXA 4ILLA 2P9IA 1TL1B 2VONA 2LFVA 1FKAF 2F65A 2DCLA 2PYLA 2ZH9A 2Z4PA 1ZS6A 4LRAA 5AR0A 2YHYA 1APSA 2CDQA 1A5WA 4B9MA 3CC2N 2YNIB 2UUAF 2BR0A 4ELVA 2RRNA 1U02A 1LK7A 2E20A 3CJTA 2FVSA 4DX6A 3LPUA 1YJ9S 2QTDA 4D3GA 5B0AA 3QIOA 2G8FA 2YJFA 4DTPA 4MK9A 1X5SA 1VK0A 2ZJPL 3ATVA 2IC3B 2QXLA 1TUWA 4HHUA 4C6AA 2EFGA 2V50A 4DWIA 2D9OA 4F3QA 2R7RA 3L4IA 1YZ6A 3KTQA 2NQPA 1R0AB 4FWNA 4FDFA 4BQLA 3TX0A 1RT1A 1IBLJ 3HVTB 3MFIA 4Y6IA 4BS2A 2MXYA 3KWGA 4J9PA 2CGLA 2ABYA 1C0UB 4FPRA 2KLAA 2VGNA 1J5EK 4FVCA 1NK5A 1V9OA 4DMZA 1T11A 1EETA 3ASMA 2JDJA 3TVKA 3WIUA 3O5BA 2FJAB 3ZZOA 1CZAN 2KT5A 3GYXB 3MM8A 4ZVQB 3W3SA 4LSLA 5BR8J 2H5IB 2C2ZB 2H5EA 4K2JA 1WOQA 2DNZA 2BZ2A 3R8YA 3IR6B 2KVQE 4MDAA 1SAZA 4I2PA 3PUFA 3R5GA 4OYWA 4USJC 1LOTB 2NSCA 2IHR1 4IOAQ 2ZJRL 2E1MC 3FUYA 3QT7A 2F9TA 2FHJA 1XNQF 1BGXT 4DUZJ 3K0SA 4IOXA 2G9OA 3EGNA 4WZQA 1VAZA 4DCOB 4WQ4C 4KPCA 1XK8A 2E1PA 1HNZK 4QOTA 5FDLA 2V5HG 3IR5B 2IBOA 4GMKA 1JWWA 2ZJRQ 3NEKA 4MK7A 4RW9A 4JI7F 1H38A 2RT3A 2G8HA 2HMPA 5FPDA 4U8YA 2F8TA 3CCVN 2CQGA 4K2XA 1LWCB 1E4GT 1HUXA 1R0BG 2ZJQL 3IM9A 4IR9A 2NCKL 2V4RA 3OL8A 2GUIA 3DLLQ 1YT3A 4PA1A 2HWHA 1AFIA 4OLPA 4DSLA 1AZSB 1I3OB 4CZJA 3I56S 4CO2A 4RL1A 2O5DA 1AUDA 4WU3A 5HQ8A 3VETA 5KFVA 1M1GA 4CO1A 3CCMS 4MQ3A 3RRHA 4FLVA 1H0HB 3CPEA 3GZ7A 1JMTA 2VJUA 4B1YB 4HI2A 1JL1A 2OSQA 5L1KA 4CI6A 1SQEA 2DCUB 1HNXJ 3VQAA 5IT9O 3RW6A 2OMOA 3E8OA 2I6WA 5TKYA 4JI6J 2QFJA 4K8XA 4HACA 2Q3SA 3D2WA 5KOXA 4N41A 3G71N 4OVLA 3VZIA 1K8KA 3AVKA 1V4TA 3OYEA 2J7UA 4DV0K 1TK0A 2E1AA 3QFHA 1H6KX 3OJUA 3BDEA 2X6NA 4B3TF 1X4CA 4O0JA 3BREA 1QZ5A 4ZVGA 4K25A 1QVFM 4PG7A 3KLFA 2DR5A 2ZDOA