4LSLA

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-(4-chloro-2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj476), a non-nucleoside inhibitor
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
548
structure length
548
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Structure-Based Evaluation of C5 Derivatives in the Catechol Diether Series Targeting HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 133
structure length 548
sequence length 548
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4lslA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4lslA05
4QWAA 1TKTB 3MTKA 1ASWA 1HQUA 3S3OA 2PZSA 4K4WA 1R0AA 3G0ZA 1KSPA 4IG0A 5HRSA 3Q8SB 4IR1A 1RT6A 5KFRA 3QLHA 4BDPA 4K4TA 4F2RA 4CHQA 5L1LA 5KFTA 1RT7A 2FBXA 1UAXA 1C1BA 4RNFA 4NLUA 4K4YA 1WAJA 4MFBA 1D1UA 5I42A 4CJFA 1TL3A 1TP7A 4HCCA 1KTQA 1FKOB 3LAKA 1TAUA 1B9DA 1JLCA 1RBTA 4PY5A 3T5LA 2V0NA 1K1SA 4OLBA 4ID5B 1SH0A 1NK9A 1LW2B 2ILYA 2R2UA 4YQWA 3SUNA 4DQIA 1J9AA 3HVTB 3ICLA 3KLFB 2Q3SA 2HB5A 3ZSOA 5HBMB 4FBTA 4CEDA 3G86A 1RTIA 4LH4A 3NGDA 2IBKA 1YVUA 2E6LA 5C5JA 2HWHA 4DU4A 4OKKA 5KFUA 4IR9A 1S0OA 5SZTA 4E0DA 1JIHA 4J9PA 1JLEB 4RW4B 3IG1A 3MAQA 5KFGA 3OLBA 1U09A 2IMWP 1T05A 3FFIB 3DM2A 1KHWA 2P51A 1S1UB 3VQ8A 1LW0A 3NE6A 1IKVB 2UVWA 4URSA 3VN5A 4MK7A 1T7PA 5J2NB 4JV0A 3V1OA 3AVJA 4KREA 5J2PA 4CHNA 4I2PB 3AVLA 4JUZA 1N6QA 1VSDA 1JLFB 3V1QA 4H4OA 4DS4A 2KZMA 1IO2A 4J2EA 4KTZA 1HNVB 3RMDA 3QESA 5KFZA 3GV7B 1U49A 4FK0A 4FLVA 2D41A 3PZPA 1ITGA 4F4WA 3L2VA 4KHYA 3TVKA 1RBUA 3C6UA 4Y3CA 4HKQA 4EBEA 2FJXA 1Z4UA 5FROA 3PW7A 4LD0A 4B9TA 4KV8B 4LQ9A 3MEEB 4I7FA 2AGPA 4K4UA 4OKJA 3CFPA 3TWHA 1S48A 4DFKA 2BGGA 4RW6A 4DTUA 4O3PA 3M8SA 2ZD1B 2ZQBA 1BI4A 5F8JA 1BL3A 1RBVA 3TAEA 5DGAA 4NYZA 4FZZA 4IKAA 3NF9A 1NJWA 3PW4A 3EYZA 4IFVA 3WNGA 4F50A 3O3GA 1C0UB 4CGFA 1GX6A 2R2RA 1RTHB 3MFHA 4LSLB 4TQRA 4R5PA 2Z1GA 4DL6A 3DRRA 4CGHA 4PWDB 3GV8B 1XI1A 5KG0A 4NYNA 1NK5A 1XHXA 1XWLA 2AGOA 4JS4A 5K14A 4J9OA 3LP2B 3MECA 3P1GA 3GIMA 3LDSA 4CJUA 3OYNA 5JS1A 4FLXA 2A1SA 3DLEB 3N6MA 3OYLA 4BDZA 2DFFA 4ED2A 2JC1A 1TK8A 3CVKA 5L1IA 1JLBA 4ECSA 2HNZA 1TK0A 1S1TB 1IKYB 3NH0A 3GYNA 3C94A 4R0EA 1BQMB 4EYHB 2W9BA 2OPSB 2VG7A 4B9NA 3OYBA 1FK9A 2XHBA 3OS1A 4Z0UA 4WE1B 2E9TA 5DGBA 3FRZA 4K50A 3EPGA 3HM9A 4EZ9A 4NLXA 3ZSWA 4DQRA 4IFYB 1Q9YA 4NCBA 3K5OA 4IDKA 4DS5A 4FK4A 1QS4A 4CIFA 1S9FA 4M3ZA 3NGZA 1EXQA 3OYCA 1HYSB 4ID1A 2YNGA 1RCHA 4QOZB 4CJ5A 3LAMA 1RT3B 4IG3B 1LWFB 1L3UA 4WZMA 1TVRA 4B9MA 1GOBA 1ZYQA 3KHLA 2HWIA 4ZVHA 1WNSA 3NF7A 4CJSA 4PUOA 3GILA 3ASMA 1RBRA 1W0HA 5KGWA 4E19A 1HQUB 5DK5A 1R0AB 3NH2A 1VK0A 2XWYA 4NRUA 4JS5A 3HVAA 5KT2A 1VSKA 2OPRB 1RT6B 3IRXB 5DMRA 4W5RA 4O4GB 3ZCMA 4HUEA 1C1BB 5KFLA 3VQ7A 2ETJA 1NJYA 3M8PA 1TKTA 4ED0A 1ZBFA 3QZ8A 3M9MB 3VQ5A 3ZT3A 1ZBIA 4KE5A 1TL3B 4M42A 3L3VA 4H8KA 1IH7A 4PQUB 1ASVA 4RNOA 4GW6A 4IKFA 3TAGA 3U3YA 3E51A 4DTJA 3AVKA 3UDLA 4KTWA 5KFHA 3OS0A 3DI6B 1KLMA 1B92A 1RYSA 2G8WA 3MF5A 1S10A 2ILZA 1J5OB 1SH3A 3SFUA 2GIRA 4FJMA 4E1MA 3G6VA 5HLFB 4Q8EA 1S49A 4HUGA 4NLOA 3KD1E 3ZT0A 1HNIB 1FKOA 2PYJA 4TYBA 2BQRA 2R8JA 2RPIA 4AHSA 3CQ8A 2KQ2A 2RDIA 4CF1A 4HYKA 1T05B 4IH6A 3HVTA 4WFXA 3DM2B 3OYEA 2IC3B 2WK4A 5HBMA 2X6NA 4AHUA 1Q8IA 5F8IA 3NF6A 2D0BA 4LY7A 2KZZA 1QUVA 4FJXA 4Z4GA 4KHSA 2BRKA 3PUFA 2IM0A 1N4LA 4ED8A 3BJYA 3I5CA 4J9LA 3QO9A 1JLEA 4ECVA 4FJ9A 2D3UA 4H4OB 4W5TA 1L3VA 2J6UA 3NAEA 4HCBA 3FFIA 3AVMA 2Y1JA 1S1UA 2E9ZA 1IKVA 2EX3A 4I2QA 4E7IA 4DTXA 4CEFA 3T5HA 2CKWA 5J2NA 1S1XA 3KHRA 3T19A 4I2PA 4QWCA 4IRKA 1WSHA 4TYAA 2Y1IA 4WZQA 3BR9A 1JLFA 2I1RA 3HK2A 3AA4A 4J2BA 4B3OA 2E6MA 1HNVA 4DTRA 3CJ2A 3GIIA 2JLEA 3HPHA 5DLGA 4FBUA 2ITGA 4O5BA 4NLDA 5EU7A 4NLVA 1BIZA 3E01B 3LWMA 1QSLA 4ECWA 1BCOA 4Q43A 1CZBA 4DL2A 1J54A 4IFVB 3QYYA 5J2MA 4NLQA 3ZSVA 2UVRA 4F3OA 2VWKA 5FDLA 2HAIA 2OA8A 4Z4IA 1LWEB 3OSPA 4AHTA 4G1QA 4F3TA 3DRRB 3VQCA 5KG1A 3BQ0A 2G8HA 2G8FA 3KLVA 5CYMA 4CGIA 4M3UA 2DTUA 3EPIA 4CEZA 4NLSA 4J9MA 1WNEA 1FXXA 4K4SA 3MECB 3O4NA 1BCMA 4JRPA 3ZSZA 4AH9A 4UQGA 3KJVB 5KG7A 4Q8FA 4E7JA 4LSNB 5HROA 1RTHA 4TXSA 3PHEA 4G3IA 1VRTA 2RF2A 4RW7B 1JLBB 4K8ZA 4EZ6A 3DOLA 5KTQA 2VG5B 3UR0A 2W9BB 2VG7B 3OS2A 3PV8A 2GV9A 1FK9B 4CJ3A 2YNIB 3LANA 4Z4HA 3K5NA 2JEIA 5KG3A 1S5JA 4O44B 1KFSA 2O4IA 3GQCA 4KPYA 4GMJB 4CJVA 1IKYA 4E89A 2OPSA 1L3TA 1JLGA 5F8HA 4HUFA 4IDKB 5KFAA 4FJLA 2JEJA 1RDBA 2IA6A 3OVNA 4WE1A 2OYQA 1HQEB 4FS2A 4FLYA 3AA5X 4DQPA 3RRGA 3NAHA 2AGQA 2KFNA 5F9LA 2BDPA 2IJFA 1KLNA 2YNGB 3PR5B 4MK8A 3CG7A 4DSFA 3K59A 3AVGA 1LWCB 3FQKA 2XGPA 2Z1IA 3S3NA 5CZ1A 1RA6A 4KKOB 4CEOA 1T03B 1S6PA 1NK7A 5KFWA 1N5YA 3SUPA 4PUOB 1Z26A 4QWEA 2HHQA 1TKZA 4NLYA 3U3GA 3V9SA 2XC9A 1HYSA 2IJNA 3KKRA 4ZP7A 4FZYA 1LWFA 2YNFA 4FS1A 2W9CA 1HJRA 2UUWA 3AVCA 3LPTA 3Q8RB 4EBDA 1BHLA 4I9QA 4O0IA 1NJZA 2WRMA 1QAIA 3OHBA 5HP1B 3PX4A 4ZPBA 4DSEA 3VQBA 5I3UA 1BQNB 3L2UA 2OPRA 3IRXA 2E4LA 3UQSA 4O4GA 1RDCA 2KTQA 3ZT2A 1KLMB 1VRUA 3ALYA 1Y97A 4DG1B 2O5DA 3F73A 2R2TA 3Q8QB 2P1JA 3DLHA 5C42B 1EKEA 1HYVA 4CF0A 4KAZA 3V9XA 4PQUA 1U48A 2YNHA 3MR3A 1UOCA 4K4ZA 1GOAA 1HARA 1QAJA 5E41A 3LP3A 3DI6A 3UPFA 4YMEA 2HHVA 3RR7A 3OL6A 3HP9A 1J5OA 3QETA 4K4VA 1S9GB 3MR6A 5HLFA 1GOCA 3SQ1A 5HRPA 5KFXA 1JKHB 3LP0A 4F8RA 1JLAB 3QIPA 1HNIA 1MMLA 4QW9A 4CJTA 1XR7A 3DLGB 4RW9B 1W9HA 4QAGA 3QO9B 3TAMB 4CK3A 4TY8B 3RAQA 3K57A 3BSCA 2YKNB 2HMIA 3QEWA 3K5MA 2IC3A 1RNHA 2DFEA 4AHRA 3BQ2A 4I2QB 3EY1A 1VSFA 1C1AA 3GIJA 1C0TA 1T3NA 2C22A 4CESA 1S1XB 4O3RA 3SFGA 3HL8A 4QCLA 3AVAA 4HHTA 4B3OB 3M8QB 4Q5VA 4O3OA 3V9UA 2LSNA 3OL9A 2JGUA 4C8NA 1RAJA 3NGIA 2C2RA 4PA1A 4BDYA 2JC0A 3PR4A 2JEGA 4DFJA 1EX4A 5KFJA 3OYMA 3CM5A 3KLHA 5J2MB 4B9UA 4M41A 4DFMA 1A5XA 3NF8A 1LV5A 5KFFA 5FDLB 4O3NA 1ZTWA 4G1QB 1FKPA 4NCGB 3LP1B 3E01A 3HKWA 3PW0A 5CYMB 4DL4A 5CZ2A 2IM1A 4NCAA 3KHHA 3I8DA 2W8KA 1YTAA 3AVHA 3JYTB 3OLAA 3SV3A 3SPYA 2FVCA 3GIKA 1IKWB 3ITHB 5HROB 4NLGA 3IS9B 3AO3A 5L1KA 3CDUA 1LWEA 4I9LA 1VRTB 3KMQA 2RF2B 3SQ4A 3NHGA 3DOLB 2QKKA 2G8VA 1GX5A 1SL2A 4YR3A 5KFNA 3KJVA 4DQQA 4YR0A 3KKSA 4LSNA 3K2PA 4RZRA 1TGOA 4XIUA 3I0SB 1ZETA 4RW7A 4MKBA 4CFBA 4CJLA 3H59A 4QWDA 2XCPA 2OPQA 2OH2A 2VG5A 3RMAA 4KSEB 1JLGB 3DMJB 2B4JA 3KIOA 1X9MA 1WSGA 3PX0A 2QE5A 3CJ4A 2YNIA 2UUTA 1ASUA 4FZXC 4GC6A 4ZP6A 4O44A 2D7SA 3H4BA 4M45A 4ED6A 2WB4A 2ASDA 4EBCA 3P83D 1REVA 4CK2A 5DG8A 3EZUA 3TAPA 3PJXA 1N48A 3T3FA 2W7OA 2V9WA 1S6PB 1LAWA 3ZSRA 1NK6A 1SH2A 1HMVB 1C6VA 1N5YB 1HQEA 4E7HA 2V4QA 1RTJA 1TKZB 3P5JA 1XR6A 3VQEA 2PY5A 4N47A 4FJNA 3RBEA 2BR0A 4OPKA 5KFBA 1LWCA 1WSJA 4CECA 3BREA 1C2PA 2YNFB 2BRLA 4KKOA 4Y1DA 2FBTA 1T03A 2IM2A 4Y2CA 4CERA 3T5JA 3NKYA 2W9CB 1S1VB 2OPPA 4FYDA 2BANB 3H5UA 2B43A 4QPXA 2ATQA 2FLNA 4F2SA 3ZT1A 2XI2A 1RT5B 3CDWA 2KW4A 3NDKA 3WNFA 1RT1B 4CEAA 5I3UB 3KLGB 4DQSA 3HVRA 4ECXA 5KT3A 3RB4A 1SL0A 3HYFA 3M9NB 5T7BA 1N56A 1VRUB 4ECRA 3O3FA 1T8EA 5F8GA 4ELVA 3V81A 1A5VA 2R8GA 1NNDA 1JL1A 4KBIA 5HP1A 3S9HA 2XI3A 3SI8A 1VSEA 3V6KA 5KG6A 1S6QB 1BQNA 3AVFA 2YNHB 3G6XA 5KFKA 4ICLA 4JLHA 1SKSA 3HHKA 4IOBA 1I6JA 2IGIA 3H5YA 4DG1A 5KFVA 4TQSA 2EC0A 1NK8A 3BSOA 5C42A 3N6LA 5EUHA 1JXBA 2AX0A 4ZPCA 4KB7A 3LP0B 4BE0A 3QIPB 3PW2A 3MEDB 4QW8A 4ELTA 2YHBA 3MXIA 4FW2A 4M3RA 2C2DA 1S9EB 3SV4A 1VSHA 4CF2A 5KT5A 1RTDA 3VQ4A 4C8KA 3BSAA 2DPJA 1C0MA 1O1WA 2HMIB 4DSJA 1S9GA 3L2WA 4FK2A 4WYWA 3NGYA 2W42A 1JKHA 4FJ5A 1JLAA 1C0TB 5KFIA 3B6OA 4TN2A 4IRDA 3DLGA 3OL8A 4RW9A 3H5SA 2XGQA 3AO2A 1WAFA 1U4BA 4CGDA 2IOCA 3TAMA 2B5JA 1I39A 5KFSA 4TY8A 1D8YA 4KFBB 5CYQB 2YKNA 4NLPA 2UVUA 2X78A 3HT3A 2Z1JA 1QQCA 4OGEA 1JL2A 4ZP9A 3U6FA 1NKCA 4E7LA 5KFCA 2AX1A 2FJWA 2W8LA 1VSLA 5C25B 3LALA 2HW3A 5DQIA 3KLHB 3TARA 3M8QA 4DL3A 1ZBLA 4Z4CA 5D3GA 3KK3A 3TABA 1JLQA 4CJQA 1FKPB 5KT7A 2J6TA 4B9VA 2HHUA 3VQDA 5KFMA 4RG8A 1KHVA 3SUOA 2DFHA 4YFUA 1S1WB 1TKXB 4XPCA 2C2EA 2ASLA 2R2SA 4MIBA 4DSIA 3VQAA 4U6PA 3QIOA 1YT3A 4K8XA 3L8BA 4DSKA 2WTFA 5J1EA 3QNNA 4EP5A 4ZTFA 4DLEA 4RU9A 2G8IA 3DRSB 4NCGA 2A1RA 1KVAA 2W7PA 4FM2A 3LP1A 3G10A 4ZPAA 2HHWA 1QTMA 1C1CB 3KNAA 1RDDA 3NMAA 4DL7A 3C95A 3LPUA 4L8RB 1U45A 4RNHA 4N41A 3JYTA 3DLKB 3V9WA 3G6YA 1IKWA 3ITHA 4ED7A 4H54A 3IS9A 4DF4A 2YKMB 2PYLA 4OGCA 1EP4A 4O0JA 1TKDA 3BSNA 4K4XA 4X2BA 2OPQB 3SJJA 2IDOA 3LZIA 3QGIA 4E1NA 1XC9A 4FJ7A 2I5JB 4B9LA 3CM6A 4FJHA 1IG9A 4HVJA 2UVVA 1T94A 4M3WA 3I0SA 4IQXA 4MIAA 3C6TB 3PX6A 4KO0B 3VQ6A 4CHOA 1REVB 2P5GA 4CJPA 1BISA 3I5AA 4BE1A 3CFRA 3DMJA 2VG6A 1RDRA 4KHUA 3KOAA 3QEVA 2O4GA 3SZ2A 4Y1CA 4OPJA 4OLAA 1RTJB 4C8MA 1KFDA 2QKBA 4JRQA 4F4KA 2V4RA 4DMNA 4CEBA 1CZ9A 3AVNA 1SV5B 3K5LA 1WN7A 1VSMA 3I0RB 3KLIA 5EDWA 1HMVA 3D5MA 4OVLA 2OPPB 1RBSA 2F8TA 2X6SA 4FJKA 3DLRA 1NKEA 1RT2A 4WYLA 1UWBB 1NJXA 3V4IB 5KFPA 3CJ0A 1A5WA 1TAQA 4Y34A 2FLLA 3H5XA 1RDAA 4JV2A 1NHUA 1SKRA 4DFPA 1S1VA 2RKIB 5DQHA 2BANA 4E7KA 3V81B 4RW8A 2R8HA 3CYMA 1ZBUA 4YR2A 4KI6A 1RT5A 1L3SA 3QZ7A 3KTQA 1BGXT 1RT1A 3KLGA 5EWFA 4W5OA 3O4QA 3KK1A 4EO8A 4CJRA 1HRHA 4CIGA 4ECUA 4ICLB 5KG2A 1OS5A 2VA2A 2FBYA 4M3YA 5HRRA 4AILC 1W25A 3H98A 3BQ1A 1RT4B 3OYJA 1DLOB 5SWMA 1TK5A 4FVMA 4AHVA 3DYAA 3QEXA 3KK2A 1U04A 3RR8A 4CE9A 2HNDB 5J2QA 5KGXA 4FXDA 1S6QA 2C28A 4J9QA 4BWMA 4LQ3A 4RNNA 4CIEA 2XY7A 3V6DA 5KFYA 1RTDB 5DLFA 5KT4A 4J9KA 4XPEA 4M95A 4FJ8A 4ZPDA 3CO9A 3MR5A 3RB3A 3PW5A 4CK1A 3MEDA 3OYKA 3OJUA 3ZSQA 2F8SA 3IAYA 3HSTB 3QNOA 3DRPA 1S9EA 3OY9A 1RILA 4ZP8A 2B5JB 1TV6B 3PO5A 4W5NA 4KHMA 1TL1A 3N6NA 3OJSA 3BGRA 5DG7A 2F8EX 2BQUA 4M94A 2FVRA 3BDPA 3S3MA 5FRNA 1NOYA 4N76A 1B9FA 2WCXA 1NK0A 2WONA 1KVCA 3HXMA 3SUQA 2AQ4A 1SL1A 5D3GB 4IRCA 3KK3B 4KFBA 5CYQA 4DLGA 1NKBA 4U7CA 1JLQB 2HNYB 5DQGA 5KFDA 1D0EA 3QERA 4DF8A 2D5RA 3VA0A 3JSMA 1JX4A 4M3TA 1VSJA 3I5BA 5C25A 1YTUA 4R8UB 1SUQB 2R7YA 2NUBA 4CHZA 4CCHA 2RN2A 3O3HA 5J1EB 2G8KA 5HRNA 3NFAA 1XHZA 4EEYA 5EWGA 1DTTB 2GUIA 4WFZA 3MR2A 4DWIA 4XO0A 5T14A 3TQ1A 4KAIA 3OL7A 3VQSA 1S1WA 1TKXA 4ZVGA 1JXEA 3D0PA 3RWUA 2G8UA 4NRTA 4Q0BB 4GC7A 1UA1A 4IH7A 5JUMA 1IKXA 1D5AA 4Y2AA 3HP6A 4ECYA 3DRSA 1EP4B 3VA3A 3RMCA 3NBPA 4FM1A 4EP4A 1HPZA 4H4MA 4CJEA 1C1CA 4CFAA 4F4YA 3IN5A 2XCAA 3NL0A 4FCYA 4E3SA 2W9AA 4ELUA 2WOMB 4URQU 3PO4A 4J9NA 4J9SA 3NCIA 3DLKA 2B6AA 3RTVA 1VSIA 3M9OB 4CF9A 4RUAA 5F8LA 1K6YA 2YKMA 3CJ3A 2GC8A 2XO7A 2AU0A 2GBZA 4FLTA 2VG6B 3FDSA 3DOKB 2I5JA 4KHRA 3ISNC 4ZMMA 3V6JA 1CSJA 1NK4A 4C8OA 4ECQA 4M3XA 3ZSYA 3KLEA 3CJ5A 3OSNA 5FRMA 3QEIA 1DTQB 3IGNA 3C6TA 1WLJA 4KO0A 2D0CA 3V6HA 2FVSA 3FSIA 3SQ0A 3KLIB 2HVHA 3AA2A 4CHYA 1S4FA 4CJ4A 3KD5E 3B6PA 3QINA 4O3QA 2QXFA 3MEGB 3KHGA 3ULDA 4FJIA 2OZSA 4F4XA 3H08A 1RT2B 4FM0A 4KTQA 3K58A 3V1RA 4B8AB 1SV5A 5CY4A 1SKWA 3EZ5A 1MU2A 2BE2B 2VA3A 3I0RA 2DPIA 3OYHA 5C24B 3QGHA 1WSFA 4DSLA 3IGVA 3PVXA 2IAJA 5KFQA 3DDKA 4ZHRB 3GV5B 2J6SA 1Z25A 4DTSA 3CDEA 4OKEA 2P5OA 1XR5A 4RW8B 1EETA 1I3AA 4O4RA 3RB0A 5L9XA 3SCXA 2AJQA 4DU1A 4CGJA 1D9DA 1UWBA 2FVQA 3V4IA 2ASJA 2XRIA 5KFEA 2Z1HA 3KK1B 4F4ZA 4W5QA 5KFOA 4IBNA 4C8LA 4KHWA 1X9SA 2RKIA 3TR8A 4CJKA 3AO5A 4CFCA 1G15A 4WXOA 2ZE2A 4TSXA 2RDJA 5KRSA 4B08A 3DYAB 2WHOA 5F9NA 2ALZA 4KHNA 2FVPA 4IG0B 3KK2B 2VWJA 3SQ2A 4HTUA 3V9ZA 1KVBA 4NLTA 3RAXA 5J2QB 4DU3A 3FQLA 3KMSA 3QLHB 4CHPA 4WFYA 4KI4A 1RT7B 1QE1A 1L5UA 3UIQA 3OYGA 3V6DB 1RT4A 4MFBB 3CWJA 1DLOA 2GIQA 4TLRA 5I42B 3M8RA 3LZJA 4DTOA 3L3UA 4EO6A 2CJQA 3MFIA 2HNDA 1JLCB 2F96A 1D9FA 1KRPA 2ATLA 1WSEA 4DTMA 4O3SA 3TI0A 3DRPB 3D28A 2X74A 2XY5A 5JXSA 3RMBA 3ISND 2JEFA 1RTIB 1TL1B 1F21A 3HJFA 1NHVA 4B9SA 3BGRB 1RYRA 4WXWA 1CLQA 4ID5A 5F8MA 3PJWA 1LW2A 3IG1B 1ZBHA 1JXLA 2WONB 3AVIA 4FJGA 3NH1A 1TV6A 3KLFA 3HO1A 3LWLA 1LW0B 3OHAA 1X1PA 4ECTA 4CJWA 2HHXA 2R8KA 3JSMB 4QWBA 2EHGA 5J2PB 3ZT4A 3PY8A 1ZTTA 3L2RA 1X9WA 1N6QB 4RW4A 1LAVA 3WNEA 4YP3A 4TY9A 3THVA 4IH5A 2XY8A 1Q9XA 3AA3A 3SNNA 3AVBA 2HNYA 3AO4A 4Q44A 3C6UB 4ED3A 2QV6A 2IM3A 3CIZA 5L1JA 1UA0A 1QSYA 3VQQA 4I7FB 4R8UA 4DTNA 1SUQA 4CFDA 4RW6B 4JV1A 1IKXB 1BI4B 5DG9A 3H2LA 4RNMA 2BQ3A 4NLRA 3CFOA 1DTTA 3NBPB 1HPZB 4DL5A 4CGGA 4BACA 3HPGA 4KHQA 4H4MB 3MXJA 1TQLA 2QK9A 4GVMA 2YV0X 4MKAA 4KV8A 1CXUA 2YHAA 3A2FA 3MEEA 4N5SA 4Q0BA 3OYAA 4ZTJA 3HPOA 3SPZA 2B6AB 2FLPA 2ZD1A 3H40A 3OYFA 4R5PB 1QHTA 1U47A 4Z4EA 2FC0A 4URGA 4Z4FA 3H4DA 5K14B 2HVIA 3D45A 4OJRA 2E9RX 4EYIB 1K1QA 2WOMA 4O55A 2D3ZA 1C0UA 3AO1A 5KI6A 4LSLA 2FJVA 2R8IA 3RB6A 1J53A 3KLEB 5KG5A 4LH5A 4ED1A 5F8NA 4CEQA 4PWDA 4RUCA 2HNZB 5JS2A 4NYFA 3L2QA 1BIUA 3SI6A 3HVWA 3LP2A 2HHTA 4FLUA 4YNQA 3OYDA 4ECZA 3ZSXA 3DOKA 4FJJA 1QSSA 1WSIA 3TAQA 3DLEA 2IS3A 4CF8A 4J9RA 3QGGA 1KCFA 4FLZA 2HHSA 3VQPA 1IM4A 3F9KA 4MH8A 1S0NA 2FBVA 2OZMA 4FLWA 1DTQA 1S1TA 5KG4A 4NLWA 1BQMA 4Q45A 3DLBA 4BWJA 1MU2B 3NAIA 4ZVFA 3MXMA 3T1AA 4J2AA 5EWEA 3TAFA 2IAJB 1YVFA 3RRHA 3QEPA 3RBDA 4ZVEA 2ZKUA 2XY6A 4KRFA 3MEGA 3OYIA 1EETB 3WNHA 4DEZA 4B8CA 2DY4A 1RA7A 1HYZA 4IFYA 1TVRB 3QIDA 2BE2A 4AHCA 3AV9A 5KRTA 5C24A 5KT6A 4OL8A 4ZHRA 1S97A 4KB1A 3T5KA 1S0MA 4FW1A 4DTPA 4KB0A 2AWZA 2ZE2B 4NZ0A 3SYZA 4MK9A 1RT3A 4IG3A 4N56A 4J2DA 2D0AA 4BE2A 3VQ9A 4MQ3A 1NOZA 2KFZA 1QE1B 3Q8PB 4CEEA 3TANA 1CXQA 3M8PB
chains in the Genus database with same CATH superfamily
1TKTB 1HNXJ 3C7NA 5CZXA 1R0AA 1Y7PA 1UETA 1VQPS 3Q8SB 3X3UA 2QX0A 4C98A 4IR1A 1RT6A 2PMWA 4EGLA 3TUZC 3RZAA 4K4TA 4F2RA 5L1LA 3ZXWA 1RT7A 4MJKA 3C3LA 4NLUA 4K4YA 4DCOB 4MFBA 2G13A 2RJZA 2V9KA 4O23A 1TP7A 4DDFA 4HCCA 3CW2C 1EWQA 1AUDA 1FKOB 2E5LK 2F9JA 2HVEA 1JLCA 2IVPA 1KDNA 4WIIA 4G1PA 3EGVA 1K1SA 4DUTA 3MM8B 4M5DA 3I96A 1SH0A 3J81j 2ZH5A 2ILYA 2ZH7A 4DR2J 3TRGA 2R2UA 4Y0FA 2D9PA 1VQKS 3KG0A 3KLFB 3S7RA 2HB5A 5HBMB 2JJ4D 3VZIA 2IBKA 2HWHA 1M5OC 5HMWA 2AJ2A 3GLJA 5KFUA 2W2PP 1F2HA 1RB0A 4F4AA 4JI5K 1T05A 1XMOK 1F2GA 1S1UB 1F0XA 3U7JA 3DU6A 5IXUA 1OQ6A 5LMNJ 4BGBA 3H8YA 1RGIA 1HBNB 4HEA9 2ZWOA 3QESA 1ZA2B 4WQ5C 4EWTA 4DV6K 3SK3A 1U49A 2E20A 4FLVA 2D41A 5B0AA 1ITGA 3CCSS 3TVKA 1YRUA 2SXLA 1MMDA 4Y3CA 1PSDA 2PFUA 4EBEA 3PW7A 3QDKA 5A8KB 2YJEA 2OFHX 4YOWA 2BGGA 2ZHAA 4DTUA 1R59O 3I87A 4WK3A 5F8JA 3ZLJA 3QGPA 4NYZA 3EE8A 3THTA 3V2UC 4BRAA 1TYQA 3NF9A 1HNXF 3EYZA 4I6YA 5KPRA 2VFTA 3DGPB 2D3O1 2FDNA 1RTHB 2J7WA 3MGJA 4S0MA 1ZAXA 2AEFA 3D7EO 4OZ1A 4PWDB 5A8WB 1U1RA 3EJMA 3DGVA 4OYOA 3LP2B 1GK8A 1H2UX 1O6XA 4JI1F 4WFAQ 3C66A 3DLEB 1BU6O 3DAWA 1JJCB 3M2UA 2ZNZA 5AQIA 2F7TA 5KPTA 2QWMA 5JVHQ 1TK0A 1BUXA 1GMWD 3NH0A 4UOCA 2RD5C 2HZVA 4LFAJ 3OYBA 2HSEB 1NH8A 1Y9OA 4U95A 1FXRA 4NI2B 2M70A 2BOAA 2QA1A 2E1RA 2HQIA 7FDRA 4EZ9A 1ZS6A 1F5AA 4YOUA 1MSWD 1LCUA 3ZSWA 2FZKB 1Y3KA 2VJVA 2D69A 2MY7A 3IWLA 3ZZUA 4FK4A 2ASMA 5A8RB 3W9IA 5B0DA 2Q0RA 2KL8A 2RSQA 4ZDNA 2Z58B 4M3ZA 2V8GA 1EXQA 3OYCA 4A8KA 1HYSB 1X4HA 3MM5B 2VWBA 4CW7B 1QVGM 4W90B 3LAMA 5E33A 1RT3B 4IG3B 2V2KA 4K2JA 1LWFB 3I82A 2Q36A 3QAUA 6FD1A 3KHLA 5M2PA 4CJSA 3SAGA 3ASMA 4P75A 1HI1A 3ZC4A 3JSBA 5T7LA 2P9UA 5DK5A 2I38A 1GLLO 1V3SA 2XMVA 4Y2IA 1VK0A 1GH8A 3ENQA 3THXA 1Y5IB 2VCPA 2O8CA 4NRUA 3D0GE 2PIIA 4CD3A 5DMRA 1A7GE 3OR2A 2HQCA 1FDBA 1CLFA 3M8PA 2O67A 4C97A 4ZVPB 4ED0A 1JJHA 1ZBFA 4KE5A 3CB4A 4M42A 5GMDA 4H8KA 4FWOA 4H0TB 4PQUB 1HQ2A 1DHMA 2O8DB 3TAGA 4IO1A 3U3YA 3WC2A 2GHPA 2NRZA 2VC0A 4CO4A 1B92A 2G8WA 3MF5A 3CCRS 3CT9A 1RABB 4FJMA 5GAEI 2M2BA 3EKSA 3KJQB 4WFNL 4NLOA 3KD1E 3WC0A 5FPMA 1PCAA 1HNIB 3JSYA 2VB6A 4UY8T 1EAYC 3ULHA 1AA1B 4Y65A 3AJ2A 5B0CA 3HFKA 3ULEA 4OI4A 2V52B 4CF1A 3HVTA 4LFAF 3DM2B 4J37A 2IC3B 3ILIA 5BRHA 1SCJB 4AHUA 1Q8IA 1RWPB 2QWOA 1VFJA 2LFVA 4LY7A 4Z4GA 5LJVA 1X4DA 4ECVA 3K7RA 2V69A 3OUYA 3W2VB 3CE8A 4H4OB 2VBWA 2W4PA 3VPZA 4Z94A 3R8EA 3NAEA 4HCBA 3FFIA 4DPWA 3L09A 5CZVA 5B09A 3G4SN 2C3MA 1KC8T 4BRNA 2E9ZA 3PEJA 2WSFC 4DTXA 2KRRA 4DV3K 4H5NA 1AZSB 3PKMA 1MLAA 3CCMS 2I1RA 2ZITA 1HJOA 1ZC6A 4U96A 4USHA 3MN5A 5IT9Y 4JD2A 4TLQA 3LWMA 2QN6B 1OH8A 2NZCA 1WBBA 3FMWA 4C11A 4IFVB 3HD2A 5BR8J 4KYZA 3CUNA 3ZSVA 3TA0A 3CCLS 3CJKA 3Q22A 4OV6A 4H5RA 4CO0A 2A42A 3OSPA 2FZGB 3DRRB 3VTHA 5CYMA 2XULA 3EPIA 4JEPA 4FYXB 1FXXA 1J6ZA 1TFWA 4LIWA 4JRPA 1VJQA 3NGKA 3KJVB 4Q8FA 3MWTA 2AJ4A 4LSNB 2ZOMA 4OI0A 5HROA 9ATCB 2RF2A 3BO4A 4DHYA 2ACMA 4CLZA 2W9BB 1FK9B 2GZOA 3OBWA 4BBYA 3K0SA 3I55N 1VQ7N 1Y3JA 1S5JA 1AFIA 4B1ZA 1KFSA 3UVJB 4PQAA 4X4RA 4ED4A 1IKYA 4E89A 3W5YA 2OPSA 5F8HA 4HUFA 5KFAA 4FJLA 2JEJA 2VFRA 3OVNA 4WE1A 5HMYA 3OFHA 2VUGA 1VQ4N 4LRFA 3AA5X 2CFXA 3NAHA 2AGQA 4L74A 4DSFA 2ZGYA 3K59A 1R0CB 2Z1IA 3M2RA 1DT9A 1NM1A 2RT3A 4PYDA 4CIOA 3SXLA 1NK7A 1N5YA 1YVNA 1DBDA 4PUOB 2HHQA 1TKZA 4P2XA 1BO5O 4FZVA 3U3GA 5G0RB 3V9SA 2XC9A 2C3YA 3ENAA 2IJNA 3NS6A 5D4LA 3VEWA 3QJLA 4J9UE 4UUXA 2OEMA 4FZYA 2DRAA 4LF5K 2N4DA 2CPHA 1HFEL 1HJRA 2LU2A 3IO1A 1HHQA 3Q86A 1IBKK 3Q8RB 4B1VA 3ENHA 1TUYA 4EBDA 1BHLA 2IYIA 2HS3A 1NJZA 2ZJQL 3FEYB 3GR0A 5BR8F 1VQPN 1XMQK 4DSEA 3W62A 3VQBA 2UU9K 1IVZA 2XMWA 1BQNB 3L2UA 3R6LB 3MM6A 4LFBJ 1U1KA 4M5KA 1RDCA 3ZT2A 5DM7L 3NWRA 3Q8YA 5A6PA 1VRUA 3ALYA 2O5DA 3U1NA 4K0KJ 2J8SA 2R2TA 4J7CA 2YH1A 5C42B 4FPRA 2WTUA 1EKEA 2RU3A 1FX2A 1MROB 3BGLA 3V9XA 2OLWA 3EEQA 1ZM2A 1UOCA 3D66A 5D4OA 2IVFB 3DXKA 1D3WA 1I3OB 2V2QA 5C2GA 3LP3A 1VQKN 4YMEA 3OL6A 1IQZA 5HMXA 3LOUA 1J5OA 2HHHJ 1S9GB 3MR6A 1R7IA 3VGUA 1RK8A 2BV3A 1JB0C 2H4YB 2OGUA 1U6BA 5KFXA 3LPEA 1JKHB 3GOIA 2CZ9A 4FWSA 1AUSL 1PJ7A 1ZPVA 3EN9A 4M7XA 3DXMB 2P9LA 1Q95G 4CK3A 3CD0A 2HMIA 3QEWA 4CYUB 1PIEA 2YJFA 1URNA 3CGIA 4I2QB 2KO1A 1SC6A 3N5FA 2YQ3A 4DCHA 2C22A 5HQMA 4CESA 2BUNA 2ZM6K 3AVAA 3K2YA 4O3OA 4C8NA 1RAJA 2RRAA 5AFUH 3R5GA 3CCSN 2UP1A 2BE9B 2Z2ZA 2C2RA 1K8KB 2KKZA 4BDYA 3F41A 2L08A 4AL7A 4WCEQ 4FKXA 2GQCA 4DR3J 2ZDOA 3OTCA 1EX4A 5DO2A 1FVQA 3CM5A 3NNCA 3KLHA 3SMPA 5J2MB 1OPZA 2QMUB 4DFMA 1A5XA 2HVZA 1HD1A 4EAHD 5AJ3K 5IFMA 1LV5A 4DR4K 2LA6A 4KRWA 5IZHA 1FKPA 4NCGB 3EO3A 4BRFA 2V6AA 2H1YA 3LP1B 2G0IA 1LQ9A 4B3MK 4B3SK 3GTYX 5CZ2A 2IM1A 1BLUA 4OHXA 4ZCIA 2PE8A 4PXDA 3FR0A 1YTAA 3SCIE 5ETQA 7AT1B 3GIKA 1WUUA 3OTEA 1VQ5S 1KQSR 4LFBF 1VRTB 4DPTA 2JVRA 3DOLB 5CD4H 2K8GA 4LFCK 4LBHA 1BHNA 3WIVA 1S3XA 1RQ0A 4BRPA 2VKRA 1GQEA 1U24A 5IWAJ 4RZRA 5F2RA 1TGOA 4M7YA 2K3IA 3AJDA 4RW7A 2A41A 2QA2A 4QWDA 3CCWA 5HQ8A 2W2NP 1N36K 3RMAA 5IT9U 1WSGA 3PX0A 1ELOA 1J2VA 4FZXC 4N8OA 3PLAA 4O44A 3H4BA 2YWKA 1HBUB 4EBCA 2G2OA 3W65A 3O9UA 3TAPA 2IRYA 1VQSA 3VAKA 1FXLA 3T3FA 1LAWA 1NXIA 2IIRA 2KKHA 5JVGL 1QQMA 3MMAA 1HQEA 2E7VA 3TX0A 1XR6A 3VQEA 2PY5A 2DNLA 4N47A 2M88A 3RBEA 3N4WA 3CERA 3KWGA 1IR1A 3LDOA 2HFOA 5EOYA 3SIPB 1XNQJ 3DJCA 3VV2B 2BJ1A 4JHDA 4CECA 1GLFO 4KKOA 3MCSA 5AQQA 2W9CB 4HH1A 4FYDA 1HUXA 1VIOA 4DR3F 3H5UA 4QPXA 2FLNA 1V9OA 3ZT1A 4H4KA 3A0IX 2DGUA 2ZOFA 1RT5B 1TFYA 3H1VX 2DNMA 3WNFA 1RT1B 1S6UA 1U2VB 3HVRA 5KT3A 4YOYA 1P90A 1RJJA 1SL0A 4UZBA 5HK4A 3ZFVA 4USUA 4ECRA 2CQBA 1NLVA 3O3FA 3BEGB 3MMJA 5HP1A 3E9OA 2VODA 3D1QA 2XI3A 1VSEA 1HBMA 2M52A 2MKYA 3JTPA 3MOZA 2J0SD 1IBCB 1TMMA 2YNHB 3KUHA 5KFKA 4ICLA 4JLHA 3HCXA 2PAVA 3MAAA 3MX2A 1YZ6A 2KDOA 7FD1A 4OYBA 4FPAA 2RH3A 4PKIA 3CCRN 3H5YA 4TQSA 3L4QA 1WTBA 5AZJA 3BSOA 2EW9A 2AYGA 4OO1J 4DV1K 3BF4A 3MEDB 5IWAF 1KAYA 4ELTA 4RKUC 2C2DA 1S9EB 5E3PA 4A8OA 2XMTA 1VMBA 3BSAA 3GR1A 2DPJA 4PKDB 2CQ4A 5J1PA 4ZJOA 2B9YA 2HBZB 2FD2A 3Q7BA 1M0SA 1Y64A 4C3LA 4LF4K 4IRDA 3DLGA 3OL8A 1WAFA 4JKHA 2CDRB 4CGDA 5G4DA 1NU4A 4UY8O 2FHJA 3TAMA 1I39A 5KFSA 4QR2A 5CYQB 2F5GA 2YKNA 4HT7A 1NKCA 2W2MP 3OPKA 2AX1A 3WX8A 2AEMA 3MX5A 4L72B 2COLA 3CCMN 3NOCA 3JQMA 4UF4A 1U0HA 4Z4CA 3I6PA 3TABA 5E5NA 1JLQA 1VRQC 4X4SA 5KT7A 1VHFA 1JJ4A 1WOOA 2DFHA 3S6EA 4YFUA 1S1WB 4HTIA 1WOPA 4XPCA 1Y10A 2RE2A 1FERA 4JKCA 2DIVA 4U6PA 3M6UA 1YT3A 3L8BA 4E2FB 5BR9A 1WC1A 2E1ZA 3QNNA 4DV5J 4EP5A 3EUNA 4DLEA 2GCFA 2ZHBA 9RUBA 2W7PA 2DRBA 2KH9A 1H72C 3UCUP 3KNAA 2I7PA 4DL7A 2RILA 4L8RB 1U45A 1SJ3P 4JV5F 1IKWA 3T6BA 3D7SB 3C46A 4HACB 4OYXA 3T1HK 4DF4A 4FSVA 2F1FA 3E9PA 3IMXA 1SJ1A 4CT9A 2XS5A 2LA4A 1VDHA 4I6WA 3QRQA 2XYHB 4E1NA 3X1LB 3DHWC 4OZ0A 1J27A 3FZKA 2J8AA 3L4IA 5L38A 2UVVA 4M3WA 3I0SA 4IQXA 2O8BB 3DNCA 3AXKA 4WF9Q 3CFRA 2C2ZB 1SQEA 3KOAA 3SZ2A 3C0BA 3BO3A 2IMOA 3US5A 4CM0A 4OHYA 2QKBA 2NYIA 2QI2A 2V4RA 4DMNA 2CPYA 2FLOA 1IJEB 3AVNA 1IJJA 3F5TA 1VSMA 3I0RB 2OPPB 3FLCO 2ZH4A 1BWFO 1C0GA 4ZVQB 1VQLS 5F0UA 5IS2A 1P8ZA 1UWBB 3PEHA 1NJXA 4M1KA 4TU9A 5KFPA 3S41A 1DQ9A 3T69A 2LCWA 3H5XA 1NHUA 1SKRA 3PCOB 4DFPA 1PKUA 3FSYA 2MQNA 3NWGA 4ANEA 2Q1NA 3RJMB 3CYMA 3EGZA 1ZBUA 4X66J 4BLGA 2B7CB 2V2VA 4CTAA 3QZ7A 1BGXT 3ZZTA 3GJQB 3KLGA 4EO8A 4CIGA 8ATCB 4AL6A 4L73A 3WT0A 1OS5A 2VA2A 1U0SA 3H98A 2YHYA 1GMWA 1RT4B 3DLJA 3NRBA 3CNQP 1HNXK 2HF3A 2B51A 5KGXA 2D9OA 1S6QA 4F3MA 2E5IA 2DXDA 2H48B 1UAWA 4YUDA 4CIEA 2XY7A 2EVZA 2JWNA 5DLFA 2OSQA 2HK3A 1YUWA 3W0LA 4RTFD 5BPLA 4J9KA 4XPEA 1WC6A 1FNXH 2ZBCA 2AEJA 2BJ8A 3OYKA 2UYTA 5TKWA 3OJUA 3M8ZA 1PC5A 3U02A 3F9MA 1NDPA 2VV5A 3QNOA 2CWXA 3DRPA 2NXUA 3CCJS 3OY9A 3GFHA 4FWLA 2B5JB 4BCAA 4DR2K 1TV6B 1HLUA 1XUPO 4KHMA 3ATVA 2R42A 3J81O 3VF2A 5D0EA 2BTFA 5HANA 3BGRA 2BQUA 3IFEA 2FVRA 3BDPA 3S3MA 4RU2A 1B9FA 4GV9A 3K0JA 2U2FA 3HXMA 1M90O 3HHLB 4F0HA 3LM2A 3KK3B 4KFBA 4DLGA 4U7CA 2HNYB 2D5RA 2RQCA 1KTVA 4PR6A 2CADA 1Z1ZA 4M3TA 1VSJA 3L3CA 4QYZJ 1KAXA 3O9SA 3UB5A 1T9VA 1JK9B 2O8FA 2PSZA 3CC2S 4R8UB 5LMNK 4DCJB 4AE5A 3O3HA 2V7YA 5J1EB 2G8KA 5HRNA 1XHZA 4EEYA 2GW8A 3M7VA 4KAIA 3OL7A 3OVSA 5FIIA 2ZVIA 2G8UA 4X66F 4Q0BB 2CPJA 3N5BA 4ISEA 2YXLA 4I68A 1EQYA 3OT9A 4OJGA 4Y2AA 4ECYA 1EP4B 4Y28C 1OQ3A 1C1CA 4XK8C 2QLFB 4FCYA 4URQU 1CS4B 1WKLA 5C2CA 3CC7N 5A76A 2B6AA 2WVDA 1VSIA 3M9OB 4CF9A 4PG8A 4RUAA 3O80A 2F9WA 4TNOA 1NB7A 2I0XA 2HMPA 3NS7B 2VG6B 3DOKB 1QUPA 4IEEA 5C2DA 5BYRA 3ISNC 4OI2A 4PG5A 4BQLA 3PTWA 4C23A 1R8AA 3KLEA 2Q0UA 3OSNA 1RGVA 5AT1B 3QEIA 1GXLA 2RVJA 3IGNA 3C6TA 4RO0A 1WLJA 2JX2A 3TVZA 3LW5C 3NMUA 4MDBA 3CETA 4CJ7A 3SQ0A 1HKCA 3KLIB 5AQZA 1NNEA 4LFAK 2W4DA 3IAM9 4O3QA 3MEGB 1M5VC 3ULDA 1WDTA 2CPFA 4FJIA 4F4XA 2WBNA 2IYGA 1RT2B 2ASPA 4FM0A 2QW9A 2H51B 3U4LA 3V1RA 3P4UB 5GAGU 3EZ5A 3P39A 3OYHA 1WSFA 4Y2KA 2IAJA 5KFQA 3MMCB 3DDKA 4ZHRB 4DTSA 1YXQA 3A13A 1ROFA 1I3AA 4IOAQ 4DR1F 2E1PA 2JLFA 3M2VA 2FVQA 1YDLA 1X4FA 4KQZA 1VAZA 4GV3A 3D1OA 3AJ1A 3N9UC 4C8LA 2O8EA 3VEVA 1YI2S 2HAFA 2RKIA 3HSZA 3L7UA 2HGLA 4U67Q 3C7NB 4FWMA 3GFXA 2RDJA 5KRSA 4B08A 2WHOA 3LGNA 2B56A 3MDFA 4PPDA 5EX3A 4HTUA 3V9ZA 1KVBA 4NLTA 4USWA 1Z6RA 2MQQA 1FTCA 2ROGA 4CHPA 4RBVA 1RT7B 4YB1P 2RAQA 3C15B 1NRKA 3V6DB 3MR7A 4MFBB 2FTRA 3CWJA 4TLRA 3TEGA 3L3UA 2UUCJ 3NGSA 2CJQA 1XIQA 4OX6A 2GX8A 3MFIA 2HNDA 1JLCB 5AQTA 4J90A 2F96A 1D9FA 5JICA 1S76D 3DCAA 1Q8BA 2V8VA 4M5DB 4FOEA 4P73A 3D28A 4GKJJ 1B0VA 2NNWA 3KWMA 3P31A 5EVZA 1N5VA 4UQTA 2R4FA 3C6AA 1FE4A 5IT0A 2JEFA 3TVYA 4W92B 2KRBA 3HBTA 5KPZA 2CDQA 1UEVA 3W3DA 1RYRA 2E2NA 3EVMA 1JNRB 4WXWA 1CLQA 3MM8A 5F8MA 2IDLA 3PJWA 2W7AA 3M6VA 3KLFA 3OTOJ 3OHAA 5IQQA 1X1PA 5K8MA 1EB0A 2IRUA 2VQFJ 4JKGB 3QMLA 1FI4A 1PAEX 1ZTTA 3A4TA 3L2RA 3GG1A 2QLJB 3WNEA 1VGYA 3MUTP 1KP6A 4IH5A 3VAGA 1M5KC 3M8YA 4NXMJ 2XY8A 1K8AT 1NLKL 3SNNA 3AVBA 3O08A 4YDDB 1Q7YT 3U9ZA 1H1VA 3EL2A 2FSJA 3M1VB 4LRAA 1C4CA 4TU7A 1EHWA 1I5OB 1SUQA 1HBNA 4FNHA 4DR7F 4BREA 4JV1A 1IKXB 1VQOS 2BQ3A 4YB6A 1DTTA 3NBPB 4OLOA 1HPZB 4DL5A 4CGGA 4BACA 4GRSA 3MXJA 1TYQB 5AQNA 4GVMA 4I64A 5A8KA 4MKAA 5K8NA 3TPQA 3MTJA 3HPOA 5E3QA 3SPZA 2HBMA 4X84A 2ZEJA 2CNKB 2D1KA 2NPFA 3AY0A 1H38A 4CLUA 2FC0A 2NR0A 4Z4FA 1MNEA 4V1Ak 3D45A 4JYAJ 1NMDA 2WOMA 1Q7LB 3PIOL 1S12A 2ZBRA 3G25A 3T7ZA 1EQMA 1X5OA 3RB6A 1H6KX 2D1CA 1J53A 4NMXA 4ZCMA 4ED1A 3FMBA 2LQ9A 4AM7A 4PWDA 4EFHA 2OSRA 4RUCA 2D4WA 1CC8A 4BRDA 4GKJF 3L2QA 2I6WA 1BIUA 4PG6A 3LP2A 4FLUA 2VH7A 3C6HA 1AW0A 1RLCL 2B4OA 4FJJA 3DLEA 5AFUA 3QGGA 1KCFA 4FWNA 3VQPA 3W8GA 3OXLA 3F9KA 1YITN 3AD7C 4IOCL 1DTQA 3VGTA 5A0YA 1MU2B 3NAIA 4ZVFA 4J2AA 4NI2A 3EGNA 1XNRF 2KXFA 2V5HG 3AGRA 4CNZA 1R6VA 4KRFA 2DTJA 1MN9A 1VQLN 1X5SA 3WNHA 3AFGA 5K5MA 4DEZA 4B8CA 4X62J 4YB5A 3VEYA 1B7YB 5A8RA 4NXMF 3VF0B 4M5GA 5F3ZA 4OL8A 4AQYJ 4B1UB 3NGUA 4IOXA 1KAZA 2P9UB 3MM5A 2GUPA 2QLWA 4KB0A 4X4VA 2GV1A 5T41A 5ELZA 4MK9A 3M05A 1RT3A 3THXB 4IG3A 4N56A 2O8CB 4J2DA 4F02A 2LQ5A 3TP2A 3J7YU 3VQ9A 2DY9A 2FC9A 1VCTA 1NOZA 2DGWA 2F8MA 3M8PB 5LXYA 3UD5A 3MTKA 3IDHA 2PZSA 3S3OA 3JAMY 3QNWB 3ZTPA 2A5XA 2QWPA 5LJWA 3A8IA 4IG0A 3HHLD 5B0EA 4BC9A 4CLLA 2VPZB 2E1YA 1KKHA 5E3CA 3T1YJ 4CHQA 3U9DA 1H98A 1LK5A 2PFDA 2DKOB 5ADZA 2GGPA 4LFBK 5B0BA 3DRYA 1WAJA 3QT5A 3UKUA 2FJDB 1FRJA 4LBIA 3SLCA 4K0KK 2XLKA 3PYDA 4WFBQ 1KTQA 1MWMA 3LAKA 3DLLQ 3IAS9 1TAUA 2VGNA 1B9DA 3T5LA 1YLXA 4ID5B 3CCJN 3ULEB 4NOHA 4DL0C 3SUNA 2E8AA 3VR1A 3E9LA 5BN8A 3HVTB 3ICLA 4FBTA 2R7QA 1YVUA 2W6LA 2E6LA 2HHHK 4F9OA 2DHHA 5SZTA 4E0DA 1JIHA 1TR0A 1KNZA 2ZWHA 2GVDA 3OUYB 2DISA 3MAQA 1TMJA 2DGSA 1U09A 2IMWP 1BQXA 3FFIB 4H0YB 4RWTA 3DM2A 1KHWA 2OANA 4KGVB 4V19J 3VQ8A 1UP1A 1SQGA 3V1OA 3CF5L 3AVJA 3PFOA 4BC4A 3CC2N 3AVLA 1N6QA 3CJQA 5D0RA 4CBXA 4MMOA 4H4OA 5DRKA 4X62F 1FNOA 4WTYA 1Q8LA 1RZMA 2LLZA 4LF6F 3RMDA 3CXCR 3GV7B 4BRQA 4FK0A 2ZJRL 1YJWN 4F4WA 3L2VA 2HURA 1RBUA 4HKQA 1W97L 1OY6A 1N0UA 5FROA 4MLHA 1QY7A 4DR3K 1BMQB 3EE9A 4B9TA 4LD0A 3CFPA 1S48A 2ZKTA 1HKBA 2Q1LA 2RUSA 4LF9J 2VFUA 2ZD1B 2ZQBA 1TUUA 2XZDB 2HPUA 5DGAA 2VYPA 1S7HA 4EI2A 1OVYA 2CH6A 1E4GT 4P7TA 2QFJA 2P9KA 4IFVA 3PRBA 3WNGA 4M8LA 2CJBA 1C0UB 1JXVA 1OIAA 3MFHA 5LY3A 3HOTA 1C4AA 3RU0A 1FRXA 3D67A 4J91A 3T41A 3T1YF 4R5PA 3FGVA 5M2RA 4DL6A 3DRRA 1M5SA 4CGHA 2FGCA 2EWSA 4NYNA 1NK5A 1RXOB 2Q66A 4JS4A 1EKSA 3MURP 1YJTA 4C0HA 1N0VC 3LDSA 2EBEA 1KS2A 5JS1A 2A1SA 2YKPA 4WQ4A 1RE1B 2JC1A 1TK8A 5L1IA 4ECSA 5A6WA 5IWAK 1X0FA 1S1TB 2LEAA 1G99A 1IKYB 3GYNA 4EYHB 2W9BA 2OPSB 1CJVB 4RX6A 1FK9A 4Z0UA 4WE1B 2E9TA 1HW8A 3K8VA 3FRZA 2R7SA 3HM9A 5BYSA 4AT1B 4NLXA 2NSBA 1XMOF 1FWLA 2JFKA 3HZ6A 3M2RB 5IM0A 2QWNA 5C0YA 3POTA 4NCBA 3K5OA 4DS5A 3PHTA 1QS4A 4KPCA 4CIFA 8AT1B 2DEJA 1JJ2R 4RLEA 2UXBJ 4DR5J 2G0JA 4JI6J 2DO0A 4ES1A 4CJ5A 3RUBL 1U2RA 3NCQA 2FSNA 2CQIA 3DDIA 1XNQK 1YI2N 2GX9A 4PUOA 3GILA 2FGOA 1RBRA 3SBMA 4CI0B 5L9NA 2DNZA 2FJAB 4XDDA 3UO0A 3ETMA 1E6YB 1WSRA 3DFEA 3PYFA 3NH2A 4ITSA 2RQ4A 1X3NA 3HVAA 3TW0A 5KT2A 3MM6B 3CDBA 4LF9F 3MCPA 5H1SV 3N79A 2ZH2A 3VQ7A 5KFLA 4ER8A 5LT5A 2H9ZA 4C1NK 5K8PA 2JRSA 2R7TA 1NU0A 3VCDA 1TL3B 3HOSA 1B70B 1GXTA 4GW6A 2JOQA 4IJAA 1IXKA 3LGHA 5CHCB 1BDGA 5KFHA 3H20A 1SQFA 1A0OB 1DQAA 1J5OB 3ZO7A 4AXIA 4E1MA 1S49A 2F40A 1MROA 1FRKA 1FRMA 3HMJG 4DV2J 1WB9A 3CQ8A 2HLUA 3CULA 1RCXB 2RDIA 3CC4S 2CPDA 2DBBA 1PILA 1NAQA 4IH6A 5DZ6A 3ZZPA 3CO0P 2NXJA 5F8IA 3I33A 5C10A 4K41A 2D0BA 2KZZA 1QUVA 3MHYA 1RAGB 3JAMU 2BRKA 3PUFA 1SZ2A 1NM2A 2IM0A 3P6YC 4ED8A 1DKGD 2WUSA 3DXMA 2C2MB 1NPPA 2VQEJ 2OHDA 2CGKA 4OYZA 3Q7CA 4CYUA 1IKVA 2EX3A 4I2QA 3D68A 4M63A 1HX1A 4CEFA 1HWLA 3T5HA 2CKWA 5J2NA 4IYQA 4DR5F 3KHRA 4IRKA 4ZJLA 2Y1IA 3A12A 4WZQA 3FCHA 3BR9A 1VQON 3GIIA 4DV0J 3UDVA 3AGKA 1YJVA 1OVQA 4ZLPA 4FBUA 3BH7B 5EU7A 1QSLA 1OO0B 3P8BB 4Q43A 2P5VA 4CZIA 4NA3A 1Q7YO 5J2MA 4NLQA 4ISGA 1FXDA 4KGMA 4F3OA 4NA1A 4Z37A 3HHLC 3JS9A 4FWQA 3BQ0A 2G8HA 4I69A 2G8FA 4DV5K 3KLVA 4CGIA 1U7LA 2RRBA 4M3UA 2WVCA 1CBKA 4NLSA 4NWBA 3MECB 1YRXA 1TTHB 4UQGA 4OYMA 4ERDA 4ZITA 4E7JA 4PG4A 2XNRA 1FFWB 4TXSA 3PHEA 4G3IA 2V4JA 1VRTA 4WYBA 4RW7B 1JLBB 4K8ZA 4KH5A 4EZ6A 2POKA 3DOLA 5KTQA 4A4JA 3MCOA 1M5HA 3A5MC 2UUBJ 2VG7B 2LQ8A 2MKHA 1YJ9S 3PV8A 1S99A 3LANA 2DHSA 2LYVA 3BBBA 2XQCA 4Z4HA 1ZXOA 3G8QA 5KG3A 4O44B 2C42A 2QMXA 4DV2F 3GQCA 4NL5A 2I7NA 1MW7A 4PYAA 2Y3YA 1GLCG 1L3TA 3BY5A 1FCAA 5AQVA 1RDBA 3WQPA 3QAEA 3MMAB 1HQEB 2J0QD 1NSPA 5HVHA 1OWXA 2IJFA 4DN9A 3RGIA 1KLNA 2YNGB 5D6GA 3CD6S 2P2CB 4IFEA 1N8RT 4GVBA 2VQEF 4C8ZA 2LU1A 4KKOB 3KXDA 4EUVA 4DV3F 4NLBA 1JCGA 5KFWA 3SUPA 1Z26A 4NLYA 3O6QA 4H5WA 3BZCA 3TJAA 5D77A 4P6QA 3IBCB 3NCRA 3GG4A 2O01C 3NOGA 2Z2MA 3D2WA 1UFWA 1U8WA 4DV0F 4FS1A 5AQUA 4AF1A 2W9CA 3CCQS 3DDNA 3AVCA 2NZTA 2EEYA 1VBXA 4I9QA 4XEIA 4O0IA 1RAAB 1Q5VA 5HP1B 2D0PA 3PX4A 4ZPBA 2W2QP 3A8YA 4HHHA 2QC3A 4X66K 1U2VA 3VAHA 3MAAB 3W3SA 3UQSA 1KLMB 3K89A 2YKOA 3UKRA 5KQDA 1VLYA 1WUAA 3Q8QB 2P1JA 3EMTA 4LUBA 2QEXS 1WOQA 2DR7A 1HYVA 4WFNQ 3W8PA 4KAZA 1U48A 2WW8A 2YNHA 2DNNA 4K4ZA 1GOAA 4NXNJ 1HARA 2CG8A 1GAOA 1UJ5A 2JWKA 4FYYB 4PEOA 1O13A 3QETA 2HF4A 2DCLA 2YTCA 1I94J 4CJTA 1XERA 5FPNA 3DLGB 3CSKA 1KQSM 3D3CJ 1H7XA 1YKWA 2QMWA 3EXCX 2A40A 3EWGA 3TAMB 3CD5A 3ENWA 3G71N 2ZH8A 3BSCA 2YKNB 4ID8A 1RNHA 4JBCA 4Z7CA 4AYBD 4AHRA 3V5RA 3QBXA 3D0HE 1T3NA 3L6QA 4O3RA 2FSKA 3MDQA 2LMIA 4WU3A 4HHTA 4B3OB 1U0HB 4Q5VA 3OL9A 2JGUA 3EVOA 1TL7B 4WPAA 4IO9L 2JC0A 2ZF5O 5KOXA 2LQBA 1PAUB 3MZIA 5KFJA 3THWB 4MIWA 5GADP 5KQ8A 4LF5F 2RMLA 3W66A 1HA1A 2CZVC 4QYZK 4B9UA 4M41A 3NF8A 4G1IA 3M6GA 2IVOA 1NGIA 4G1QB 3MI7X 4G65A 2L9NA 3QMQA 5HJYA 1VBKA 1XMQF 4NCAA 1CC7A 5FPEA 3KHHA 1R3NA 4OX7A 3BM7A 3AVHA 1BUPA 2FVCA 1IKWB 4NLGA 1BC6A 5L1KA 3TO8A 3OA9A 3SQ4A 1U8SA 2YWGA 4JAXA 4LR8A 2QKKA 2G8VA 1T9YA 1TUWA 3D6HB 3BV8A 3W9JA 1IUJA 3HZGA 1YX2A 2GQ2A 5HMZA 4DOZA 5KFNA 2GWJA 1T95A 4DQQA 4BRHA 2ATCB 2FC8A 5IT9O 3WQTA 4HACA 4XIUA 4I6MA 3I9ZA 3I0SB 4NXNF 1F5BA 4MKBA 3H59A 3UR3C 1ATNA 3BGUA 2GO9A 2VG5A 1RAOA 1JLGB 2GJFA 3FJ2A 2B4JA 3R5DA 2KT3A 1X9MA 2LQJA 3UNYA 3CHWA 2YNIA 2UUTA 1I94F 4YORA 3ID6A 3SAFA 4ZP6A 1UEKA 2H3GX 4ED6A 5CAAA 4CLYA 3P83D 1N88A 5FD1A 2NRRA 2BEFA 3IR6B 1OYDA 2EFNA 5GAEU 3D4JA 1RLDA 2YPZA 3EKUA 1S6PB 3ZSRA 1NK6A 1SH2A 2FHMA 3A3NB 1C6VA 4B02A 4I6AA 4E7HA 2XLIA 2V4QA 3P5JA 4JP8A 2MGZA 2DHGA 4A5AA 1V5VA 4X64J 2WFBA 2EFPA 1LWCA 2VOOA 5GAGP 2XMUA 1WORA 3BREA 2YNFB 1NSKL 5AQWA 4CO3A 2W24A 4Y1DA 4Y2CA 3BR8A 1RUSA 1BA0A 4CERA 3T5JA 3NKYA 3PSFA 1FDAA 1UVNA 2ZOGA 2OPPA 2DNQA 3BS9A 2E2PA 3TNVA 2B43A 3LTOA 3HM8A 2KG0A 1Q86O 2XI2A 2VFVA 1PYTA 2ZJQQ 3CDWA 4RWWA 2RQMA 3SCJE 3CPEA 1UVKA 1X31C 4CTAB 4DR4F 5AQOA 4B1XB 1S77D 5I3UB 3KLGB 3SSQA 4ZA1A 4GVLA 4DQSA 4O0NA 3ZEUB 4B3MF 4B3SF 2FF6A 4B3RJ 1SC1B 3M9NB 5DM7Q 5T7BA 4Q2LA 1Q1KA 2LVWA 3S9HA 4GMKA 3K5PA 3VHQA 1S6QB 3Q89A 3AVFA 5FLXY 1VQNS 4LF8J 4LFCF 4QS8A 5HO4A 3W5ZA 1V4TA 1F60B 3N6LA 1JXBA 2MZQA 4ZPCA 3NCPA 3GYXB 3LP0B 3PW2A 3H1QA 1RHMB 2UUCK 5IV3A 3CQXA 3O9RA 3MXIA 1N36F 1EWRA 3CC4N 3SV4A 1VSHA 1G4CA 3THYA 5KT5A 1PJ5A 2CQ0A 1B99A 3VQ4A 4C8KA 4MTPA 3GP9A 1C0MA 3A8KA 4GKJK 3I8BA 1O1WA 3J80Y 2PMHA 3AH6A 4WFBL 3L2WA 3NGYA 2W42A 1C0TB 2RQKA 2RHQB 4TN2A 4A2AA 1UCNA 3H5SA 3ZNUA 1N33J 5F41A 4OX8A 3U1LA 2B5JA 2QTDA 5CQGA 1KVKA 4NASA 4TY8A 1QQOA 2HG4A 4KFBB 4NLPA 4N7TA 1YWXA 3JXUA 3OTOK 2W8LA 1VSLA 4GNIA 2AYEA 3LALA 1DZ5A 1S4EA 3NY0A 2LKZA 2VQFK 2CJKA 3KWIA 1N32J 5DS7A 1HW9A 2RU9A 3HHLA 3KK3A 2HFNA 4OZJA 2H4WB 2WBRA 4PG7A 3R5BA 2KXNB 2HHUA 4B9VA 4NXMK 4ZN3A 5KFMA 3SUOA 3O1LA 2LEBA 2HQDA 1K44A 2NREA 4EFAC 2V8HA 3QIOA 4K8XA 4DSKA 5J1EA 2YY3A 3ZYYX 2FHOB 4B3RF 1Z05A 2HHWA 1QTMA 1C1CB 1K0VA 1RDDA 2K1RB 1D8ZA 2GAGC 2D74B 5GIPA 1UZHA 2B7BB 4N41A 3JYTA 3SAHA 2DR9A 3V9WA 2QWLA 1U1MA 4CZFA 5AXNA 2Z8QA 3B8HA 1KVIA 4LF8F 1EP4A 3CJSA 3D3BJ 3DWLA 4K4XA 1YJ9N 4X2BA 2OEJA 1Q8KA 1YIJS 2IDOA 3QGIA 2XB2D 1CS4A 3FBBA 1KQGB 1NGEA 1FKAF 4JYAK 3W5XA 3D9BA 4P74A 1NDCA 3HLUA 1IG9A 1UW4A 1ZM9A 1VLOA 3VVUA 3C6TB 3PX6A 4ENOA 3G2XA 4CJPA 3B8AX 3I5AA 1VQMS 3FZHA 3B4DA 2VASA 2IDEA 2VG6A 2GMJA 4LF4F 2M8HA 1RTJB 4C8MA 1Z2ZA 1RADB 1KFDA 2OEKA 1N33F 1CZAN 5THWA 4F4KA 4JRQA 2BXJA 2HRUA 2MPUA 1VJWA 2DHXA 3KLIA 1HMVA 1R8HA 2Z57B 1RBSA 3FZ2A 3KJNB 1ACMB 1F1BB 4H0VB 3DLRA 3CJCA 4OZNA 1ZOTA 1RT2A 4PXBA 3G6EN 4WYLA 1N32F 3M4XA 2J0WA 3TUPA 4X62K 1TAQA 4Y34A 4C9DA 3CCQN 1RDAA 3OFEA 2O8EB 3MMCA 1S1VA 4BR0A 2RKIB 1XN9A 3O6WA 2E2QA 4KHPJ 4AQYK 5AE3A 4YR2A 3CCZA 4KI6A 2KN4A 2FHJD 2F9TA 2GS8A 1CEZA 3U27A 4W5OA 5LL6Z 4CJRA 2Q6CA 4MKYA 3QWUA 5HRRA 4AILC 3LUYA 4FF2A 3OHRA 1L3KA 3PIPL 2QEXN 2ZUGA 2J9EA 3T1HF 1U04A 3RR8A 1YZ7A 2HNDB 5DM6L 3SEOA 1CPZA 2L9DA 4RNNA 3C15A 3T1YK 3V6DA 2C2NA 4BVOA 1M1GA 2B8PA 4M95A 4M5LA 4RWXA 3T9NA 2M7SA 4B1YB 4DPXA 2F8SA 3W60A 1NBWA 3BBCA 1RILA 4FKYA 3BB5A 2VZ9A 4W5NA 4W4MA 4NZ7A 4PCQA 1YG0A 1TL5A 2BJEA 5DG7A 2B9WA 2BVZA 2MQMA 1R8BA 1S79A 1NDKA 3GCWP 4K5SA 3PRDA 3DXSX 1NK0A 4DX7A 2VGMA 3SUQA 5FLXU 3C19A 1SL1A 2YH0A 2YWEA 2B9XA 5D3GB 4IRCA 4CD1A 5KFDA 2ADBA 2DPNA 4DF8A 1SI9A 1BA1A 3D6RA 4JKGA 1JX4A 1WC5A 2JWLA 5C25A 3FNNA 2DNPA 3FGUA 1YTUA 3D2FB 2WC9A 1FDNA 1SUQB 1FRIA 3RVCA 1ZBSA 4CCHA 2OMOA 4USVA 1BOTO 5EWGA 1W2IA 1DTTB 2YX1A 2GUIA 4HDHA 3ATUA 2A0FB 1YJUA 3M1VA 3J80U 1TKXA 1JXEA 4ZVGA 3K17A 4KHPF 4KJIA 1X8DA 2PA8D 1KWMA 4GC7A 4FF3A 2N7CA 4DKWA 5H9EJ 5JUMA 1QM9A 1IKXA 3WXJA 3UN3A 2DGQA 4BG8A 1KONA 2BABA 3PYEA 4LF9K 3NBPA 1HPZA 3CCVS 2XYPB 4CJEA 1RKJA 1VISA 3IN5A 4ELUA 2RB7A 3A1YG 2WOMB 2QL9B 1ATRA 1P27B 4GKKJ 5F8LA 2FXUA 1O0PA 4DUYJ 1HHTP 4YHHJ 2GC8A 2XO7A 2KB2A 4XH4A 2QLXA 2M3DA 3CMEN 5F0WA 4ZMMA 3V6JA 1CSJA 3KYLA 3A5NC 1V6HA 3ZSYA 4OYPA 2VICA 3CJ5A 4DR2F 1DTQB 2ZC4A 1N34J 4KO0A 5GADI 3IWXA 3NEKA 2FVSA 5A0YB 4DHVA 1WSVA 5MLCQ 4ZKAA 3W9HA 4OZ5A 1ZAVA 2LECA 3KD5E 3QINA 2QXFA 2UXDJ 4QBUA 3CMAS 4B8AB 4JKAA 2G2ZA 1MU2A 2VA3A 4OX9J 3QGHA 3LM9A 4DSLA 3PVXA 2DNOA 5LMNF 3LF0A 2V51B 4KIAA 2PC6A 3RRKA 4MT1A 2UXBK 4DR5K 2DGXA 1X4EA 4BRIA 4DU1A 3OFGA 1T9XA 3HHEA 1QZ5A 4JI6K 5KFEA 1RWNB 2Z1HA 3KK1B 2UZAA 4F4ZA 1UPPA 4W5QA 2CVIA 3QPIA 2R7UA 3LDPA 4IBNA 3O1WA 4V19S 4GY2B 4C1NI 1WKJA 4CFCA 1G15A 1HR0J 3DYAB 5F9NA 4IG0B 3KK2B 2C3OA 3SQ2A 5B0GA 2FYXA 3RAXA 5J2QB 4DU3A 1VQNN 4WBFA 3J81Y 3M32A 4WFYA 5D0GA 4KI4A 1K73O 3UIQA 5CABA 3OYGA 2GGPB 5HVGA 2D0OA 4KR0B 1DLOA 1X60A 2HRYA 2Z4PA 3UKUB 3M8RA 5HOOA 4DTOA 4H4KC 4QIEA 5A2QO 2ZNYA 2OKQA 3UE5A 1I51B 2GMHA 2R7RA 4GKKF 2MQ8A 3MMBA 1GT8A 3HI9A 2X74A 4YHHF 4L6V3 1ZBTA 3RMBA 2LEPA 5GAGI 1F21A 4H0OA 5AR0A 2HQFA 4B9SA 1W7WA 1UZDA 2CH5A 2MZJA 4ID5A 3QBWA 1IBMJ 2GVDB 2DNRA 1N34F 4DV2K 2HHPA 4ED5A 3WUHA 1FEHA 3LWLA 1R43A 2XSJA 5EX0A 2B4PA 5BN9A 2HHXA 4DQ8A 3R7BB 3ZT4A 1S5ZA 4NYOA 1N6QB 1H74A 1N5QA 1LAVA 3W2WB 5AQSA 2AJ0A 2GIFA 4GO7X 1FT8A 3EDQB 3D6FB 5D15A 3DKDA 4OX9F 2VQEK 3QATA 4HL9A 4ED3A 4USIA 5L1JA 1UA0A 1QQNA 1EKRA 4DTNA 3R5CA 4BRKA 2ZBPA 3OW2R 3R9LA 3IWNC 1FFSB 2HIQA 2B4VA 4DV0K 2J4RA 1X3MA 2MJNA 1CJTB 5EXWA 2P9KB 1SQKA 2ZBQA 2ZHOA 1CXUA 2YHAA 2X1AA 2FLPA 2ZD1A 3H40A 2X3GA 4R5PB 1U47A 3CJRA 1SVDA 4Z4EA 5AQJA 1YIJN 3H4DA 2HVIA 4O55A 3JS6A 2YX4A 1U2CA 1F5CA 1C0UA 1SC3B 2E7XA 5GAHP 5IC4B 2FJVA 2DHAA 4QR1A 2P9NB 4FN5A 4K8RA 3GG0A 2BACA 3R9PA 5JS2A 3ZZOA 1B0TA 1OJ4A 2X1BA 1VQMN 1LXNA 5HL7L 3HVWA 3R1LA 3FVYA 4YNQA 2UUBK 4J9RA 2V8DA 2MKIA 3QT7A 4BRGA 1IBMF 1S0NA 2FBVA 1S1TA 5KG4A 3O5BA 3E66A 5IM0B 3BKTA 2VOPA 3MEKA 1F3FA 3POTB 1CJVA 5I4MA 4BC5A 5DDQC 3TAFA 5E2QA 4DV4J 1LKZA 2HBYB 3NS5A 2CGLA 3OVBA 4ZVEA 3OYIA 1EETB 1HNZJ 2BJDA 2EG2A 2BX6A 1RSCA 3TQEA 4USMA 4ILHA 3PYGA 2L48A 2IJRA 2BE2A 4BVPA 4AHCA 5KRTA 3FEXB 5KT6A 4FF4A 2OTJS 1VBYA 1TL4A 3T5KA 1S0MA 4FW1A 5HN0A 1WC0A 3MM7B 2H5IB 3FC9A 3IR7B 2ZE2B 5EX5A 4NZ0A 1KR4A 3KNGA 3BYPA 3VMFB 4OYIA 1S0VA 2D0AA 4OI3A 1IWAA 3MPVA 3RSEA 2A3JA 5F0XA 1OKJA 1O5JA 2DEIA 4QWAA 4OIXA 3R2DJ 2DITA 1ASWA 1E6YA 3I32A 5J1NA 1KSPA 3G0ZA 2PA3A 1YSJA 4LF7J 5AQHA 1GLBG 4CZJA 3SCLE 1QHAA 3EX7B 4UTGA 3QLHA 4BDPA 5KFTA 1FA0A 2FBXA 4RNFA 4ILLA 1BWEA 1D1UA 4WP3A 2I2YA 1TL3A 1WC4A 3O9TA 1RBTA 4DPYA 3AOCA 4BGAA 2CPXA 4L76A 1WKKA 1FWKA 1LW2B 4YQWA 3MPWA 4DZ6A 1J9AA 1RHQB 1FNMA 3MCAB 4NXNK 1VQ6S 2Q3SA 3ZSOA 1KQFB 4CEDA 3G86A 4LH4A 1NUEA 3NGDA 1U1OA 3IP0A 4OKKA 2P9PA 1I94K 1S0OA 1RBOB 1M90T 4J9PA 4RW4B 3IG1A 4DCPB 3N28A 4F25A 3J81U 3OLBA 1HWJA 4BR2A 1LW0A 3NE6A 1IKVB 2OCEA 2UVWA 4HI1A 4OHWA 2F4VJ 3GCXP 3H90A 1T44A 2F65A 5J2NB 5J2PA 4CP5A 3UD4P 4JUZA 2DH9A 3V1QA 3M6XA 3FSXA 4DS4A 2KZMA 1IO2A 2R7VA 3DHXA 1U1QA 1ZH5A 3PZPA 3RW6A 2L9WA 4YOVA 1HNWJ 4KHYA 4C0OC 3WBZA 2M4MA 4F67A 2FJBB 3EICA 4KV8B 4LQ9A 4BR5A 1EZZB 4K4UA 3J7Z5 4RW6A 5LOQA 1RWUA 3VEXA 1BI4A 3QRPA 3TAEA 3CCVN 4IKAA 4JI0J 2ZH6A 4UUWA 4IDHA 1JJ2M 3M6WA 1NJWA 3QWPA 4F50A 3O3GA 3PIOQ 4NX9A 4LF7F 4A59A 4CGFA 1GX6A 3ZX2A 4LSLB 2V4JB 2Y9HA 2C2OB 2DR5A 3GV8B 5CH7B 5KG0A 5EHHA 1XWLA 2AGOA 4K0KF 5K14A 4J9OA 3MECA 2YHXA 3LDLA 3P1GA 3GBTA 3GIMA 2E2OA 1PJ6A 4CJUA 2MZTA 3N6MA 2OIHA 3OYLA 4TU8A 3DXBA 1W7AA 3CVKA 2WBMA 1JLBA 3QICA 2RE1A 4IOCQ 1F6TA 2VG7A 4B9NA 2ZH1A 2XYGB 2XHBA 2HHHF 5CYJA 2E7WA 2XS7A 3EPGA 1T6DA 3IR5B 1OY8A 3D0IE 3P96A 3CMAN 3GIRA 1Q82T 1UKUA 1RHJB 2GTDA 2IFXA 3ZX3A 1KD1T 4GVBB 4IFYB 1Q9YA 4JK8A 1H0HB 3I56S 2QL7B 4M5MA 2F4VF 3GMGA 1S9FA 1GMVA 3K9KA 2EFQA 3NGZA 4ID1A 4MDAA 2YNGA 5D78A 4QU7A 4QOZB 2Z56B 1L3UA 4X64K 5LL6d 3N4QA 1VOMA 3KDNA 1RDUA 1GOBA 2MB0B 3ISZA 2HWIA 1E6VB 1ZM4A 4QOTA 2CPEA 4ZVHA 3W64A 3NF7A 2OELA 5AQGA 1S7IA 3GJSB 5M1FA 4CH7A 1HQUB 5BREA 2ZZMA 3B4MA 2PEBA 2MY8A 5E26A 1V3ZA 1VSKA 4QYRA 1HIYA 1B3TA 3UE2A 1YTYA 3ZCMA 4HUEA 1FJGJ 1C1BB 2ETJA 1NJYA 3UKRB 4KH0B 3QZ8A 2P6TA 3VQ5A 4B3RK 3ZT3A 1ZBIA 2YKAA 3L3VA 4ZPTR 2MMYA 2CPZA 3MCNA 1IH7A 5EY4A 1ASVA 4RNOA 4LIRA 4ZIWA 1UVIA 4IKFA 3IFRA 4DI6A 1R8PA 4NMLA 4RJVA 5B0FA 2P9IB 3QT8A 1G2EA 3AVKA 1KLMA 1RYSA 4LF8K 1S10A 2ILZA 1NGGA 3SFUA 2YX6A 2AKWB 2GIRA 2FY1A 3G6VA 1NZAA 4Q8EA 2CQ2A 2DR6A 4HUGA 1RHUB 2FZCB 4F04B 1NPRA 5AE2A 3SBTA 3ZT0A 3OBYA 1GFWB 2BQRA 2RPIA 2R8JA 2EKYA 3KUGA 4NPOA 2IIHA 2KQ2A 3JAMO 2GWKA 4WFXA 3OYEA 3D6TB 3AAWB 3NF6A 2LP4A 4FJXA 4KHSA 2W25A 3LGMA 3CF5Q 4JI4J 4FJ9A 1JLEA 4E8UA 1F3VA 2D3UA 3W7BA 4W5TA 4JI2J 2J6UA 4TKTA 1N33K 3ZTQA 3H6EA 3AVMA 4KGKA 2Y1JA 3BPDA 2WSEC 2Y1RI 3K9JA 2ZJRQ 1W2BR 1T0TV 5ETKA 4I2PA 4CH0S 1WSHA 1JLFA 3AA4A 3IUCA 1XNQF 2HSTA 4B3OA 2E6MA 5F1XA 1HNVA 1OSCA 3CJ2A 1N32K 2JLEA 1ITPA 1I1GA 5DLGA 1TL7A 1QAYA 4NLDA 3NMRA 1NZ8A 2G1DA 2W2OP 2DNGA 1H73A 3ZTOA 3THWA 4ECWA 2UUAJ 4DL2A 1J54A 4XH1A 2DXEA 3VEZA 3TA2A 4GVEA 4AUKA 1LK7A 1WEZA 3CCLN 2P6SA 4DB3A 3VWSA 2ACYA 2BE7D 2UVRA 2VWKA 3M1FA 4AHTA 4G1QA 4F3TA 5KG1A 1FJGF 1CJUA 3ID8A 4A61A 4ILGB 2KJWA 3CCTA 3M5RA 4CEZA 3Q8VA 1WNEA 2YHWA 3O4NA 4LRCA 2XMAA 3ZSZA 4AH9A 8RUCA 3VVTA 5KG7A 3HKZD 4HTLA 1TU0B 2LDYA 4GO5X 2W4CA 4I6MB 3QRRA 1NJIO 3O3LA 2PGCA 2VG5B 4DV7J 3UR0A 3MN7A 2XO6A 3OS2A 4LVOP 1JCFA 2YNIB 2MZ1A 4FL9A 3EZWA 2GVZA 2JEIA 5B7WA 1VQ7S 4L3NA 2O4IA 1JWWA 4I1TA 1RU2A 4KPYA 4JI3K 4PL7A 3Q8UA 1MDUB 2QSWA 2HQ3A 4BC3A 1WACA 1JLGA 2XZTB 4IDKB 1LXJA 2IA6A 5AQLA 3TA1A 3HRGA 4J9VA 4DQPA 2MZSA 1Q53A 2KFNA 3A5LC 3GZ7A 2BDPA 2MGZB 2G2YA 2V63A 1NGJA 1GLAG 4MK8A 1DGKN 1H2VZ 3Q2SC 1LWCB 4A47A 4JI2F 3S3NA 1IR2A 1RP5A 1S6PA 2XMMA 2K7JA 3OV7A 2OTJN 4QWEA 3AODA 2BUPA 4C6AA 2WW4A 3WZ0A 2YNFA 3OTBA 2KI2A 1RWWB 3IKMA 5GAHI 1RWVB 2UUWA 3BKUA 1X4GA 3R3LA 5AQRA 3DOMB 1WD6A 4DX5A 4RR5A 3AB4B 5DDRC 2K7KA 2UUAF 2WRMA 1QAIA 3OHBA 5I3PA 4BRLA 1K9MO 2P9SA 4KHPK 1OYEA 4U9RA 3ZETA 3DRXA 3SCKE 5I3UA 4WWSA 2OPRA 3HSCA 3IRXA 4DV5F 3ZEUA 4O4GA 1ZPWX 2A3ZA 4FDFA 1T9WA 3F73A 3DLHA 4JI1J 4IWVA 3THPA 1S72S 5IOLA 3HTVA 3MR3A 2XNQA 4CZKA 3THYB 3DI6A 1R8CA 3QBCA 2HHVA 3RR7A 1VQ6N 3HP9A 4DV7F 1UPMB 5DDPC 2MHNA 2AJFE 5HLFA 3PM9A 1GOCA 1FD2A 4CLKA 3LP0A 4F8RA 3VZHA 1MMLA 4QW9A 1XR7A 1NG9A 1X5TA 1W9HA 4QAGA 3BF1A 3QO9B 3GE1A 4RBUA 5SUHA 3VERA 4TY8B 3RAQA 4FP9A 3K5MA 4PKGA 4LRBA 3B78A 2DFEA 2XHWA 4JI8J 3BQ2A 4J8FA 2JDJA 4O8UA 1VSFA 3CDAA 2V67A 1C1AA 1VIXA 1C0TA 3GIJA 4H5VA 3SMSA 1S1XB 3SFGA 2ZJPL 3HL8A 3MUMP 1PG5B 2HBRB 3KG4A 1WOSA 2LSNA 3P3DA 3NGIA 3I4HX 3J8AA 4PA1A 3ZTRA 3E1YA 4G6VB 3PR4A 2JEGA 4DFJA 4C2MA 3OYMA 3I31A 4YOEA 2BW2A 4D3HA 2H3EB 1V5IB 2M5YA 5BXIA 1OMSA 4ZVSB 5FDLB 5KFFA 4O3NA 1AT1B 3TZYA 4X65J 3UCZP 3ILLA 3E01A 3PW0A 4CLWA 4DL4A 3L4BC 4DN0A 4USKA 3I8DA 3VAJA 3C14A 2RHKA 2XMJA 4P2SA 3JYTB 1OY9A 1U2FA 2W01A 1C0FA 1VQ5N 4HVZA 5H9EK 3S01A 3CDUA 1LWEA 2VBZA 3KMQA 2MDAA 1CJKA 3NHGA 2WVBA 2K1RA 1TUGB 4KH1B 4X4PA 3PKYA 2OD6A 2APOA 4ALZA 2MQPA 3KKSA 5JJBA 1JNZB 2DNYA 4Y0WA 2IY5B 3K2PA 2XTJP 2JFDA 4JKBA 5CXTA 4WJBA 6FDRA 1ZETA 2F3JA 4GKKK 4OPAA 3QQCD 3TTFA 2OH2A 4DUYK 2NCKL 4KSEB 1WG4A 4YHHK 3KIOA 4DU8A 2QE5A 3CJ1A 4PAAA 2NRTA 2MKJA 1ASUA 4GC6A 1KOOA 3GL1A 4W98A 5ETNA 2VONA 3TSUA 4C7QA 5DG8A 3EZUA 3I56N 2CJYB 1N34K 1N48A 2V9WA 1XQSC 3BH6B 4ZPVR 1UTAA 1HMVB 1QVFR 1RI7A 1VK3A 4JI8F 4H0XB 1RTJA 3QJPA 4RCHA 2FF3B 4FJNA 3HSGA 2JH3A 3LO3A 4WQ4C 2UXDK 5KFBA 1Q82O 3UI3A 1WSJA 3SSSA 2R3VA 2BRLA 4OI6A 1KD1O 2FBTA 1T03A 2IM2A 1S1VB 1HD0A 1NHKL 4OX9K 2DGVA 4AL5A 1U6ZA 3OQ2A 1U1PA 3VAMA 4ZIVA 1AFJA 1FTRA 2J7KA 2AW0A 2KW4A 1B64A 3CCES 4K25A 1WHXA 3RB4A 4CBWA 4X65F 4LREA 5F8GA 1A5VA 1JL1A 1NNDA 4A8WA 3EZOA 2PI4A 3Q83A 4CZEA 1HR0K 3V6KA 4P2MA 1QD1A 4XAKA 1SKSA 3HHKA 2NRXA 4IOBA 1SC4B 1YJ7A 2IGIA 4DG1A 5KFVA 1NK8A 1MN7A 1SJ4P 5EUHA 3BZQA 2Q43A 3QIPB 4OI1A 4CZGA 5LJ5Y 2EFGA 4FW2A 4M3RA 3TSPA 4QPTA 2PN6A 2QYCA 3HI0A 3RBXA 1RACB 1YJNS 1WHYA 4FK2A 1HPMA 1WJ9A 4FJ5A 1JLAA 5GMEA 1V4SA 3B6OA 2FQQB 3UNGC 4RW9A 3C16A 1U4BA 5BPMA 1IBMK 1VK8A 2X78A 3Q23A 3HT3A 3VOVA 2Z1JA 1XTZA 2X3DA 3FZBA 4A8QA 1JL2A 4IO9Q 3U6FA 4N77A 4G9ZA 5C25B 3UD3P 2HW3A 5DQIA 4X4NA 2B8QA 1DURA 2HRTA 4MLEA 1WG1A 1M5PC 3M8QA 1FWPA 2C3UA 4DL3A 4FWKA 1ZBLA 5D3GA 2YKQA 4FO0A 2QGFB 2J6TA 2CZ4A 4RG8A 1KHVA 3HFZB 1TKXB 2C2EA 2ASLA 5D0HA 4CM2A 3D2FA 3D2EA 4MIBA 2HIYA 2WTFA 3O9QA 2DRDA 4ZTFA 2G8IA 2A1RA 4FM2A 5IQ6A 3L7OA 4ZPAA 1IBLJ 1X7VA 2OTLS 2MHEA 4M63C 1FESA 3NMAA 2HGNA 5LSLA 3JQKA 3C95A 3J7ZT 3LPUA 2H65B 4R0JA 4RNHA 3TZWA 3HT0A 2HK2A 3ITHA 4CO2A 2DY1A 2Q2RA 4DXLA 4ED7A 3IS9A 2H5JB 2ROEA 5CCMA 2J9DA 1S22A 4O0JA