4LSLA

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-(4-chloro-2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj476), a non-nucleoside inhibitor
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
548
structure length
548
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Structure-Based Evaluation of C5 Derivatives in the Catechol Diether Series Targeting HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 133
structure length 548
sequence length 548
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4lslA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lslA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4lslA05
1TKZB 1S5JA 3QLHB 3SQ4A 4ICLA 2D3UA 2F8TA 2OPSB 4FM0A 1HQEB 1S1TA 3SNNA 5HRRA 2FLLA 1UOCA 2I5JA 2RN2A 2VG5B 5HLFB 1RT3B 4DTRA 2F96A 1RT7A 4B9UA 3H98A 4ECVA 4KB7A 4CF9A 2IAJA 1SL1A 3TAGA 2OA8A 4IH6A 3TWHA 2JC1A 4DFPA 4BDPA 1D8YA 1X1PA 1CLQA 4O3SA 3WNGA 3PW2A 1CSJA 3OYAA 3OYBA 3GIKA 4MIAA 1JXBA 4O3NA 1WSEA 5KFDA 4URGA 2GV9A 3AVGA 4FM2A 4KTZA 1NK0A 1OS5A 1S97A 2ITGA 3ZSRA 4LH5A 3DMJA 3O3FA 4DL7A 3L2VA 3DMJB 3KLGA 4PA1A 4O4GB 1WNSA 3FSIA 4ECQA 1S1XA 4DF8A 1T8EA 3KLGB 3DLKA 5JS1A 3P83D 5CYMA 3FQKA 3OHBA 2HHXA 4FLUA 3CYMA 1XWLA 3MR2A 3B6OA 3RRGA 2D0BA 4HUGA 4H8KA 3FQLA 3KHLA 4CFBA 3HKWA 3KLFA 1FKPA 1WN7A 1KHVA 5F9NA 5KRSA 3TI0A 4FK0A 2HNZB 1S9EB 3LZIA 3PHEA 5FDLA 2IA6A 3OS2A 1Q9XA 4NLXA 4MFBB 5FDLB 4CECA 2Q3SA 1TK0A 4EO6A 4KTQA 3NBPA 3TAMB 2ILYA 3JYTA 2OPQB 3NBPB 2E6MA 4HCCA 5L9XA 3M9MB 1VSFA 2AGOA 4BE2A 2WOMA 5C42B 1HYZA 1RTHB 2KZMA 3C6TB 3MEEA 3JSMA 4RW8A 2XCAA 5CYQA 2WOMB 3CM6A 4BACA 3ASMA 4FJ5A 4RW7A 4M3XA 4CEDA 4I7FB 4DTPA 3H5SA 2YHAA 3PX4A 1WSHA 1C0UA 3OSNA 4E89A 4TY8A 3AA2A 3UQSA 5KFEA 1S6QB 2OPRB 4QW8A 1IKWA 4ZVFA 1K1QA 5KGWA 1JLEA 1X9MA 3I0RB 4CEZA 4K4VA 4HCBA 5DGAA 4K4XA 4CESA 2IC3A 1BI4A 4KAIA 2Z1JA 3NF7A 2J6UA 4EO8A 2CJQA 4WYLA 1A5VA 3H2LA 1NHVA 2LSNA 1UA0A 4CJPA 3IG1A 4PQUB 5KFUA 3KLIB 3VQ7A 3QYYA 4NLUA 4MKAA 1RBSA 3HVRA 4F4YA 4BE0A 4TY9A 4I9LA 2ASLA 4KFBB 4KKOA 2E6LA 4HUEA 2W7PA 1MU2B 3E01A 1TK5A 1S9FA 1SH3A 4B3OB 4FJGA 4IRDA 1KHWA 3L2WA 1FK9A 4HKQA 4ZTFA 2XY6A 4WYWA 4FK4A 1I6JA 1S1VB 4F4ZA 2BR0A 5KFWA 3I0SB 3BGRB 1R0AA 3V6HA 4CJSA 2RKIA 1L3UA 4OJRA 1D9DA 3DLRA 2FJVA 2AGPA 3N6MA 2ATLA 2QKKA 3WNFA 4LSNA 1J5OA 4CJWA 4M41A 4NLVA 4GW6A 4DSJA 1QSYA 2E9RX 1N6QA 4JV0A 2A1SA 3SUOA 4M3ZA 2R2UA 1TL1A 1JLFB 3CDEA 3B6PA 4DTUA 4LQ9A 4M3UA 1NK6A 2ZD1A 3OYMA 1T03A 3PV8A 2YNIA 2CKWA 1C6VA 1RT5B 4KSEB 3VQ6A 1T03B 4FBTA 4DSLA 3K57A 4E7IA 3RMAA 4I2PB 4OLBA 4AHRA 1CXUA 4NRTA 1D5AA 4DU4A 1ZBUA 3CJ2A 4IKFA 3ZT0A 1TKDA 4OKJA 3OL9A 2IM0A 2YNHB 1N56A 4NLDA 1A5XA 2Y1JA 4JS4A 4DTOA 5KG0A 3D45A 1XHZA 3CDUA 3PO4A 3CDWA 3EY1A 2JGUA 4DSKA 4KREA 3IS9B 3KNAA 4E3SA 2ILZA 2WHOA 5F8HA 3OYEA 2OH2A 3ZT3A 1ZBIA 3P5JA 4CEQA 2QV6A 1RILA 4K4WA 4CF2A 5D3GB 3BQ1A 2P5OA 3H5YA 4IDKB 4IFYB 3DLEB 2O5DA 3ISND 2FBYA 3S3NA 1LW2B 5J2QB 4B08A 1L3TA 1ZYQA 4GC7A 3MECA 1KSPA 4FW1A 2OYQA 3CJ3A 4C8NA 3DOLB 4FK2A 2G8UA 3MECB 3FDSA 3V6DB 4J9NA 3VQ9A 3P1GA 2E4LA 3V9SA 1RT1A 1S1UA 1RDAA 4H54A 3MAQA 4UQGA 1TVRA 4EP5A 1S1UB 4M94A 4MIBA 5KRTA 3HM9A 3QIOA 1KRPA 4ED6A 1N4LA 4URSA 1K6YA 2I1RA 4HTUA 4N41A 4CGJA 2YKMA 4RW4A 4O3QA 4CF0A 3OJUA 1QTMA 1U45A 1BQMB 3HVWA 1JLBB 4RG8A 1NK5A 4WXWA 5HRPA 4ECXA 4C8OA 5FRMA 4ECYA 3HO1A 4GC6A 5KT2A 4G1QA 1W25A 4ZHRA 3PW7A 1NNDA 4JUZA 3DRSB 3V4IB 1S4FA 3RB3A 4ZHRB 3FFIA 3EZUA 1JKHB 2WONA 4K4YA 1IM4A 2RDJA 5DMRA 2X6NA 1JXLA 2HMIB 3UPFA 4CGHA 3T19A 1CXQA 4KHYA 3I8DA 4H4MB 3NAIA 2BQ3A 1Q9YA 4CGFA 4TSXA 3G0ZA 3K58A 2D7SA 2G8IA 3AO2A 4LSLB 1U04A 2A1RA 2HHVA 3ITHA 1QE1A 3BDPA 2FLPA 4DQQA 4NYFA 2HHSA 4BE1A 3LP3A 1X9WA 2GIRA 2B43A 4PWDB 2ZKUA 2EC0A 3V81A 4CHZA 4KV8A 4KI6A 5KFNA 1JL1A 4KV8B 5FRNA 4O3OA 1WSFA 1QSSA 1HYSB 3KHGA 5EWFA 3NFAA 4WFZA 1RT6B 1HJRA 3TAQA 2BRKA 4Z4CA 4KBIA 3K5OA 4RNNA 3CFPA 2EHGA 3NDKA 4OL8A 4NCGB 3NF6A 2WRMA 4ZPAA 3PY8A 3DRPA 2KFNA 3CFOA 1NK8A 4ZP8A 4IFVB 1GOCA 3DRPB 4B9NA 1BIUA 1IKYB 2RDIA 4KHNA 5C25A 4U7CA 1TL3A 3OL6A 5KFOA 3KMQA 3SV4A 2XI2A 1S48A 3DLBA 3HVTB 1JLAB 5F8GA 2GUIA 3AO4A 3EZ5A 1T7PA 3L8BA 4Z4HA 3MF5A 1RTDB 1RDDA 1BQNA 3V9XA 1JLGA 4TYAA 5DQHA 5JXSA 4FVMA 4CEFA 3HSTB 1RT4A 5F8NA 2X6SA 1HNIB 4NLOA 3RAQA 2PYJA 4NCAA 5J2NB 2W42A 1KVCA 4IBNA 1KCFA 1W9HA 1NJZA 3RTVA 3D5MA 3QETA 3VQCA 3EPIA 5DQIA 3LANA 3OL7A 3KLEA 4N47A 3QEWA 1RBUA 1VSDA 2UVRA 4AHUA 3AVJA 1JLCA 2G8VA 4Y2CA 3KLHA 4CHPA 3K59A 2Y1IA 4DL5A 2R8GA 3KIOA 4FJLA 3DI6A 3MEDA 3GV5B 1N5YA 4DTMA 3DM2B 1N48A 2YKNB 3LALA 2HHWA 3QERA 2C2EA 4RU9A 4K4UA 1EP4B 4YFUA 4KO0A 1D0EA 4AHTA 4MK8A 5KFCA 1C0TA 3TAEA 3IGNA 3PJXA 4N5SA 4QWCA 1S6PB 3MFIA 5HRSA 4KHWA 3SI6A 2HHTA 2E9ZA 1FKOA 2FVSA 2UUTA 4B8CA 4DFKA 3K5MA 4ICLB 3LPUA 4DQPA 1S1TB 2XCPA 3A2FA 4WE1A 4NYZA 4OGEA 2I5JB 1B9DA 1NOZA 4J9PA 1U09A 3NGDA 1RT7B 4H4OA 3TQ1A 3NF8A 2IAJB 2YNFA 4AHSA 2IJFA 4CJ3A 3CFRA 5JS2A 2KW4A 1XR5A 3SUPA 5K14A 4Y1CA 4CGDA 4Z4EA 1C1CA 2RF2A 3C6UA 4IOBA 3PW4A 3AVKA 2JEIA 1Z4UA 1HNVA 4J9KA 3Q8RB 1LWCA 3V6KA 3N6LA 2IM3A 1SV5A 1SV5B 1S1XB 3DRRA 4AHCA 3DLKB 1RCHA 1Z25A 1IH7A 4PY5A 3NGZA 1IG9A 5CYMB 2QXFA 4IRKA 4IG0A 5KG4A 3C94A 4Q45A 1UA1A 4WXOA 1QQCA 2XHBA 4ZVGA 3VQSA 5CY4A 4CEOA 3KLFB 3G86A 3GV7B 1FKPB 1DTTA 3LDSA 1KFSA 3VQ8A 4EYHB 1DTTB 4ECSA 4DL3A 2R2SA 2XWYA 3DDKA 4XPEA 4KPYA 3JYTB 2B6AA 3PW0A 2BANA 3QGGA 1VSIA 4FJNA 2E9TA 3PVXA 3OYFA 4CF1A 3TABA 3MEEB 4FCYA 3JSMB 4RW8B 3RBEA 3VQPA 5CYQB 4RW7B 3OYHA 5EU7A 4DQIA 3U3GA 1KLMA 1HYVA 3H59A 1C0UB 4BDZA 5KFBA 2VG6A 4M3YA 4EYIB 2VA2A 2HNDA 2AX1A 5C5JA 4RZRA 3DYAA 4TY8B 4DTSA 3HPHA 3PX0A 1I3AA 1IKWB 3AVLA 1TV6A 3OYGA 1Q8IA 1VK0A 1JLEB 4AILC 4FLVA 4KE5A 3OJSA 4NLYA 1RT2A 2DFFA 3ZSVA 1HQUA 2KFZA 4FLWA 3Q8QB 2IC3B 4CCHA 1BI4B 3V1RA 3CM5A 3KLVA 4R5PA 3IGVA 3G6YA 1NOYA 3OLAA 5HBMA 1T3NA 2ALZA 4NLSA 3SI8A 3KHRA 3OYIA 1SL2A 2HW3A 1HMVA 2FC0A 3IG1B 3AVAA 3LP2A 4PUOA 4KKOB 3LP2B 1JLQA 3AVCA 1TQLA 4PUOB 4ECWA 1LWFA 3E01B 5T7BA 1LWFB 1FK9B 1YT3A 4Z4FA 3OYJA 3GIIA 3TAPA 3AVBA 1DTQA 2V4RA 1QS4A 1R0AB 3LP0A 4E7LA 2RKIB 4E7KA 1DTQB 4G3IA 1Z26A 5KFPA 1TAQA 3MR3A 2AQ4A 3LAMA 4KI4A 4LSNB 2R8IA 1J5OB 5KG3A 1ZTWA 3ZT1A 3SYZA 3OYLA 3SFGA 3VQAA 1SKRA 4YR3A 4F8RA 3L2UA 1N6QB 4DU3A 3KK1A 4CJKA 3U3YA 3PR5B 1TL1B 4AH9A 4CJVA 3KKSA 1CZ9A 4ZPDA 4LD0A 3S9HA 3AVFA 2ZD1B 4F3TA 2YNIB 5L1KA 3THVA 1RBRA 5J2MA 4FJ8A 5KI6A 4FYDA 5DLGA 3Q8SB 2DFHA 4ED8A 3TARA 5J2PA 2C28A 1RTIA 4JV1A 3SJJA 4FJIA 3ZSQA 2IJNA 1VSEA 4IRCA 2FVRA 3NH2A 1IKXA 2QE5A 4RNMA 1S1WA 5KFIA 4OGCA 1NK4A 1S1WB 5F8LA 3VQ4A 3PW5A 3QZ7A 4O55A 5I42A 3M8PA 1GX5A 1BL3A 4EBCA 4TYBA 3M8PB 3BSOA 2FBVA 3V9UA 5C24A 3KD1E 4WFXA 3NMAA 2IBKA 3LPTA 1REVA 5CZ2A 5T14A 3GIMA 3WNEA 4W5TA 1KTQA 5J1EA 2VWKA 4KB0A 3ULDA 3KHHA 3AO3A 3SV3A 3AV9A 3FRZA 3BSAA 4HYKA 3H4DA 4MQ3A 4QWEA 3ZSOA 3OY9A 4DTNA 4CJRA 1HRHA 3VQQA 4CERA 3M8QA 1RT1B 1TVRB 1JIHA 5KFQA 4CK3A 1NKEA 1WAFA 3HPOA 2YV0X 2AWZA 1VRUA 3ZSZA 4CFCA 2P5GA 1EETA 2IDOA 4ZVHA 3O4QA 5KG1A 2UVUA 3OYCA 1O1WA 4O3RA 2UVWA 1ASVA 2YKMB 4RW4B 3MXMA 2OZSA 4HVJA 2R2RA 4J9MA 5DG8A 4EEYA 2VG7A 1X9SA 5HRNA 3QESA 1C0MA 4B9SA 3SQ1A 2B5JA 5KFSA 2OZMA 2VG7B 1VRTA 3LWMA 2IM1A 2IMWP 3F73A 4QAGA 3ZSWA 4B8AB 1C1BA 1C2PA 2HAIA 4K50A 3PX6A 4F2SA 4TQRA 4G1QB 2HVHA 4TLRA 4LY7A 4J9OA 4TQSA 1BGXT 3FFIB 3HYFA 2WONB 4F4XA 2O4GA 5KTQA 1LAWA 1S9GA 4DG1A 3I5CA 3LP1A 3ZT2A 1W0HA 1KVAA 3KK3A 3HP6A 4DG1B 4Q0BA 1I39A 2O4IA 3MR6A 4GVMA 3GV8B 1WSGA 4RNHA 2W9AA 1TAUA 4M42A 1T05A 4NLPA 3Q8PB 2KQ2A 3G6XA 3OVNA 1BISA 3RB6A 3ITHB 1QE1B 3CWJA 1QUVA 4CHNA 3ZCMA 1GOBA 4CIGA 2WK4A 1S0OA 4CHYA 2XI3A 2W8LA 3KOAA 3IRXA 5I3UA 4OPJA 2R8JA 3HPGA 3CG7A 3NF9A 5KFFA 3QNOA 2IOCA 1NJYA 1LV5A 3V81B 1LWEA 1RA7A 4QW9A 1VSLA 3AO5A 3SQ0A 4J2BA 4NYNA 2X78A 4O5BA 4FLZA 2V9WA 3UDLA 4CGIA 1SH2A 2XGQA 3NL0A 3CVKA 4O0JA 3QIDA 3OHAA 2B4JA 4OLAA 2FLNA 3MEGA 4XPCA 3RBDA 3QNNA 5F8JA 1BIZA 1UWBA 4DL2A 1U49A 3MEGB 3D0PA 3D28A 4EBDA 4M3TA 4RW9A 3I5BA 5HROA 1XC9A 3NHGA 2G8HA 5F8IA 4NLGA 2HNYA 4R8UA 4KB1A 3H08A 5HROB 3KTQA 2P1JA 3QIPA 4LH4A 4ELUA 2HB5A 5KT6A 3RR7A 4BWMA 4ED0A 3EPGA 1QAIA 5L1IA 2BE2A 5C25B 3HVAA 2F8SA 4KRFA 3QEXA 4CK2A 1TL3B 2EX3A 4O0IA 2BE2B 3QEPA 1SUQA 3AVMA 3GIJA 2PYLA 3G6VA 1JL2A 1ZBFA 1BQNB 4IH7A 4ELVA 1JLGB 1RAJA 1S0MA 4CGGA 1RT4B 1KVBA 4FJMA 4B9MA 4YNQA 1TKTA 1J9AA 1Y97A 1TP7A 1HPZA 2D41A 4K8ZA 4RNFA 2FJWA 4FLYA 4I2QA 1KLNA 2OPPA 4M45A 3AA3A 4ED7A 2OPPB 2IGIA 3OS0A 2V4QA 3GILA 4FJXA 1RTJA 4NLRA 4RUCA 3DLGA 3KLEB 3TAFA 3QO9A 3LWLA 1GOAA 2AGQA 3HL8A 4YP3A 3DLGB 5KG6A 2C22A 4DMNA 1JLCB 4C8MA 1IKVA 3OYNA 3KLHB 3SFUA 2W7OA 5F9LA 1IKVB 3DI6B 4NLWA 2W9BA 5HP1A 3AVNA 3MEDB 3AA5X 1N5YB 2W9BB 1XR6A 1U4BA 3KK2A 2FBXA 3GQCA 4FJ9A 2JLEA 1T94A 1S10A 1TKXA 4KO0B 4DQRA 5KG2A 1XHXA 1J53A 4NCBA 1C0TB 4RW6A 4CEAA 2J6TA 4J2DA 3HK2A 3M9OB 4Q8FA 4F50A 2BQUA 4CJ4A 1SL0A 3L2RA 4E7HA 1B9FA 4CHQA 4E1MA 4K8XA 1WSJA 4ZVEA 1S49A 3BREA 1FKOB 1BCOA 4FLTA 2DY4A 4HHTA 2W9CA 4URQU 4JRPA 2XGPA 4ED3A 4EBEA 5KFAA 3AVHA 1TKZA 4WE1B 3SCXA 2KTQA 3OYKA 3QLHA 2OPSA 3SZ2A 3PR4A 1HQEA 1ASUA 3LAKA 4H4OB 3KD5E 5KFYA 3ZSYA 2VG5A 5HLFA 1RT3A 3AVIA 1JX4A 2YNFB 4ZTJA 4DTXA 3LZJA 5DK5A 4DSFA 5K14B 4FXDA 1KFDA 1C1CB 2RF2B 3O4NA 3C6UB 4DL6A 2WCXA 1HNVB 3AO1A 1NJXA 2WB4A 1LWCB 2AX0A 1QAJA 3N6NA 3KKRA 2GBZA 5EWEA 2GIQA 3MTKA 2R8KA 3T3FA 2BQRA 1G15A 3KJVA 4ECRA 3DRRB 3NH0A 3M9NB 2ASJA 3RMBA 3KJVB 4O4GA 4IG0B 4QOZB 4WFYA 1U48A 4Q8EA 1VSKA 3CJ4A 2X74A 4CJEA 4YR0A 4CFAA 4I9QA 4L8RB 1J54A 4YR2A 3PZPA 5KT7A 3DLHA 3UR0A 1YTUA 1WLJA 4NRUA 5F8MA 4ECUA 3CJ5A 2HNZA 1S9EA 5EDWA 2JEFA 1YTAA 4M95A 4MFBA 4ED2A 4K4ZA 1F21A 3HXMA 2B6AB 1WAJA 2BANB 3KMSA 4FJJA 4F3OA 2ETJA 1FXXA 3TAMA 2HWIA 2OPQA 3TVKA 4NLQA 2XRIA 2R7YA 4Y1DA 4Z4IA 4CJUA 3L3UA 4QWBA 5C42A 1RTHA 1KLMB 3C6TA 4Q43A 4QWDA 4Q5VA 2VG6B 3NGIA 4I7FA 1CZBA 4JS5A 2HNDB 4E7JA 3DYAB 3HP9A 4FS2A 4E0DA 1TV6B 1ZTTA 1S6QA 2OPRA 4O44A 4OKKA 1DLOA 1RT2B 1HQUB 4KAZA 4O44B 1WNEA 1DLOB 3M8SA 3I0RA 4R5PB 3WNHA 1L3SA 4DFJA 3RMCA 5HBMB 1RBTA 4C8LA 2GC8A 4DEZA 4CJFA 2AJQA 4MH8A 3BQ2A 4FW2A 1HMVB 4ECTA 4ZP6A 4CJTA 4FJHA 4FJKA 4IH5A 1SH0A 2VA3A 1EX4A 3ALYA 4PQUA 3KLIA 1JLQB 2R8HA 4EZ9A 5KFJA 4FJ7A 4KFBA 5DG9A 1MU2A 3T1AA 4Z0UA 4B3OA 5KT4A 1RDBA 3H4BA 2D5RA 4Y3CA 3CIZA 3LP0B 2Z1HA 3V6JA 2Z1IA 1S1VA 3I0SA 3QEIA 3BGRA 3VQDA 2NUBA 4ELTA 3RR8A 4X2BA 3OL8A 3V9WA 3KK1B 4J9RA 3RB4A 4J9LA 4IQXA 2RPIA 4W5QA 3BSCA 2FBTA 1TK8A 2BGGA 5KT5A 4W5RA 4RNOA 4KHQA 4ZP7A 3O3HA 1VSMA 5CZ1A 5DGBA 1JLFA 4DS4A 3VA0A 4IR9A 1RNHA 5J2MB 2FVPA 4DFMA 4RUAA 1RT5A 2JC0A 2ZE2A 4KTWA 4I2PA 1LAVA 5J2PB 4CE9A 2ZE2B 4Z4GA 1RA6A 3I5AA 1RTIB 5JUMA 4EZ6A 2FJXA 5KFZA 1ZETA 3ISNC 1NK7A 5EWGA 2YNHA 1IKXB 3RRHA 3CJ0A 4J2AA 3IAYA 1YVUA 5I42B 3IN5A 1B92A 3V1OA 1ITGA 2FVCA 3IS9A 5C24B 1BCMA 4KHRA 1YVFA 4LQ3A 4FS1A 2UUWA 1REVB 3ICLA 4FZXC 5D3GA 1RDCA 4XIUA 3TANA 5J1EB 4IDKA 1A5WA 4IFYA 4B9LA 1GX6A 3QINA 3DLEA 3T5LA 5KFMA 3HT3A 4C8KA 1MMLA 1LW2A 5J2QA 4FLXA 3MXIA 4KHSA 3DOLA 3M8QB 1HARA 5KFRA 5L1LA 2D0CA 3CO9A 1NHUA 5DQGA 3RB0A 1NJWA 4O4RA 1D9FA 3V6DA 2C2RA 5EUHA 4NZ0A 4F4WA 5DLFA 2PY5A 1VRUB 5KFGA 1RYRA 2ZQBA 4CK1A 3S3OA 1EETB 2JEJA 2DPJA 4CHOA 2DTUA 3L2QA 1NK9A 2FVQA 4J9SA 3PUFA 3ZSXA 1ZBHA 1IO2A 2G8FA 5KFLA 1RBVA 4QCLA 4Y34A 4WZQA 2HVIA 3DOKA 4F4KA 2XY7A 4R0EA 3K2PA 2DFEA 3MXJA 2B5JB 1VRTB 3DOKB 1S0NA 1D1UA 3HHKA 1BQMA 1C1BB 3SPYA 1JLBA 4WZMA 3V1QA 1SKWA 4NLTA 4W5NA 3DRSA 3V4IA 1S9GB 1XR7A 1VSHA 3LP1B 3KK3B 4AHVA 4XO0A 4U6PA 3H5XA 4Q0BB 1JKHA 4JRQA 4DLGA 3C95A 3NGYA 1WSIA 3QGIA 2HMIA 2V0NA 4ZP9A 4Q44A 3T5KA 4DL4A 2AU0A 1VSJA 3S3MA 1QSLA 1T05B 4DTJA 3EYZA 2W8KA 4H4MA 3CQ8A 4K4TA 3E51A 4CJLA 1UAXA 3GYNA 5KGXA 3VQBA 1SKSA 3AA4A 4LSLA 1NKBA 4CJ5A 1NKCA 4MKBA 3IRXB 5I3UB 3BQ0A 4CF8A 1RDRA 1JXEA 2HWHA 4DQSA 4JV2A 4QWAA 3T5HA 3L3VA 1LWEB 4JLHA 4MK7A 2BDPA 5KG5A 1XI1A 4PWDA 1QHTA 4EP4A 3QZ8A 3MFHA 1TGOA 4DF4A 4FZYA 4DU1A 4W5OA 3PO5A 3O3GA 3OS1A 3TR8A 1UWBB 4K4SA 1C1AA 3NH1A 3HJFA 1HYSA 1L5UA 3H40A 4CIEA 3BJYA 1RT6A 4RW9B 1EKEA 5KFHA 2BRLA 1RYSA 3ZT4A 3UIQA 2HNYB 4R8UB 4DS5A 3U6FA 4KHMA 3QIPB 3V9ZA 2PZSA 4F2RA 4DWIA 5KFTA 4M3WA 2ATQA 4B9VA 1BHLA 2D3ZA 2IS3A 2YNGA 3NKYA 4B9TA 2VWJA 4NCGA 3PJWA 4YMEA 5E41A 2YNGB 3RAXA 4BWJA 4IFVA 3BSNA 4KHUA 2HHQA 4OPKA 5DG7A 4IR1A 1SUQB 1LW0A 3QEVA 1IKYA 1LW0B 4FZZA 1K1SA 3HVTA 4Y2AA 1JLAA 5SWMA 5KFXA 4ED1A 1RTDA 1ZBLA 5FROA 4TN2A 2D0AA 4GMJB 1TKTB 3VQ5A 2Z1GA 3VA3A 4MK9A 3OLBA 3RWUA 1HPZB 5L1JA 3SPZA 1HNIA 2F8EX 2YHBA 2XO7A 5J2NA 4I2QB 3SUQA 4OVLA 3SUNA 4BDYA 4CJQA 4N76A 2QK9A 3K5LA 2C2DA 2KZZA 1L3VA 2J6SA 4O3PA 3VN5A 4HUFA 1RTJB 2IM2A 3QO9B 4ZMMA 4FM1A 2G8KA 1ASWA 4IG3A 4DSIA 3RMDA 5SZTA 4J9QA 2R2TA 4IG3B 5KG7A 3NAHA 2HHUA 3T5JA 5HP1B 4ZPCA 5KFKA 3VQEA 2QKBA 2ASDA 3F9KA 2DPIA 3SQ2A 3KK2B 4E19A 4E1NA 4CIFA 4DSEA 4OKEA 4IKAA 3OSPA 2G8WA 3DM2A 4CEBA 2YKNA 4CFDA 1TKXB 2WTFA 4ID1A 4YQWA 3G10A 1EP4A 4RW6B 4ZPBA 4ECZA 2P51A 4J2EA 3NCIA 3M8RA 5KT3A 3MR5A 3QGHA 2XC9A 3K5NA 4N56A 5KFVA 3NAEA 4TXSA 1EXQA 3H5UA 1S6PA 3BR9A 4M3RA 4FBUA 4ID5A 2XY8A 2XY5A 3OYDA 2UVVA 4ID5B 4QPXA 2W9CB 3NE6A 2JEGA 4DLEA 4CEEA 1U47A
chains in the Genus database with same CATH superfamily
1TKZB 4H0TB 4C23A 5BPNA 1X31C 2D3UA 4K0KJ 2F8TA 2OSQA 3RAMA 1HQEB 2LVWA 1NU0A 4DPUA 3ATUA 4J7CA 2I5JA 2VG5B 3PEHA 2QG9B 2PI4A 4DR6F 1OYDA 4CF9A 1DJ0A 2V4JB 4IO9Q 3TTCA 2JC1A 2VDHA 4C0BA 2LXFA 4BRAA 4O3SA 4LVNP 5IZHA 3U7JA 1ILYA 3OYAA 3OYBA 2VICA 1S72S 1JXBA 1UVKA 3A3OB 4O3NA 3C14A 4KTZA 4CBWA 2BJ3A 1WHYA 1VGYA 3J7AN 3ZSRA 4JKBA 1KOOA 1RHJB 2OKQA 1CC8A 3EXYA 4LMZA 3UKRB 4A8QA 1WNSA 3FSIA 3RZAA 1YIJN 3UDVA 6FD1A 2O8BA 1I5OB 1U1OA 2XMKA 4FLUA 3MR2A 3B6OA 3J81Y 3RRGA 4O23A 3MM6B 3FQLA 1SQEA 2E1RA 3KHLA 3HKWA 1QAYA 2XNRA 3M6UA 3J81U 4PG6A 2HNZB 1E6YA 3LZIA 2XMMA 3PHEA 1WUUA 1FERA 4MFBB 2PIIA 2HMPA 1TK0A 5BN8A 3BGFA 3L3CA 2ILYA 4OJGA 2F9DA 2E6MA 1SC1B 3TJ9A 5L9XA 4DV5J 2FHOB 2QRRA 2KZMA 4LUBA 4LF7J 3MEEA 3OTOF 1R8HA 5CYQA 2WOMB 2OI2A 4Z37A 4BACA 4RW7A 5AQTA 1U8SA 5KPZA 3KUGA 1TTHB 4XH1A 2KT2A 4X4VA 1UAWA 2LQ5A 1EARA 5H1SQ 4LVOP 2QWOA 1IKWA 5MLCV 1SC4B 4PR6A 1X9MA 4CEZA 3MAHA 4FPAA 1T02A 2MGZA 1K8AT 4CESA 2Y0BB 1KONA 5DDOC 2PSZA 2Z1JA 2YQ0A 2A1BA 2HIQA 3O9SA 5JVGL 2A6AA 4WIIA 3ATVA 3H2LA 4KQZA 4I6WA 4LFAF 4CJPA 3IG1A 1T3OA 1Q78A 2HG4A 5KFUA 3VQ7A 3QYYA 4NLUA 4ZVPB 1QZ6A 2IY5B 2CQHA 5T7LB 2W4CA 2R7XA 4F4YA 4KFBB 3ZEUB 5GMEA 2E6LA 5IT0A 4AQYJ 3IAM9 1MU2B 3DKDA 2M8HA 3AT1B 1S9FA 2VQEK 1NZ8A 4FJGA 1MWQA 1KHWA 3Q22A 3BGLA 3A12A 3L2WA 1FK9A 4C11B 1RHUB 3O08A 2BR0A 5KFWA 1MWKA 3BGRB 1RK8A 4CJSA 4BLGA 2RKIA 3E2EA 2VJVA 3GTYX 3VEXA 3IXQA 3WNFA 1S99A 2KJWA 1S5ZA 4M41A 5CQGA 2A0FB 5BRFA 3WX8A 2C2OB 2R2UA 1VIOA 2WBNA 4JI8K 4N8NA 4LQ9A 3CCLN 2ZD1A 1T03A 1JCEA 2DNOA 2FZKB 1PO6A 4FBTA 3MUTP 3SK3A 2XLKA 1M1HA 4AHRA 4QIEA 1TUGB 1CXUA 1D5AA 4DU4A 4CD3A 4IKFA 3MAAB 3D66A 3K89A 3PTWA 1DT9A 2GO9A 3FZ2A 1TKDA 1Q18A 4OKJA 2YNHB 1CPZA 1FJGK 2D1CA 1A5XA 4JS4A 4DR2K 5KG0A 3D45A 5LJ3Y 3UR3C 2K3KA 2V2ZA 3CGIA 2RE2A 2JGUA 4JKEA 4KREA 3L4QA 3I55S 3KNAA 2WBMA 2A6OA 2ILZA 2WHOA 3OYEA 2OH2A 1ZBIA 1IQTA 1YQHA 5EX0A 4YY3J 4CF2A 3PJ9A 4ZN1A 2DRDA 2ZH7A 2Q0UA 3CD5A 4WQ5C 3H5YA 2WW8A 4IDKB 3U8XA 4IFYB 2XTJP 2FBYA 2D9OA 2EBGA 4FW1A 2WBRA 3DOLB 3PFOA 1ZS6A 3MECB 3NGSA 2UU9J 3V6DB 2FC9A 2E4LA 3EMTA 2HGNA 4Y2IA 1KC8O 1S1UB 4M94A 3HM9A 1KRPA 2P9NA 2VH7A 1BE4A 1N4LA 1DZ5A 1K6YA 2HHPA 1SBRA 5DDQC 2I1RA 5HOOA 4O3QA 3UKUA 3OJUA 1KNZA 2O8CA 1M1KT 1U45A 1BQMB 3AY9A 4BC5A 4JAXA 3SMSA 2KG1A 3T1YF 5FRMA 3HO1A 5KT2A 1W25A 3DNCA 2R3VA 3C7NB 4CWBA 4ZHRB 3EZUA 1YZ7A 2NXCA 3ONQA 4ZN3A 4B3MJ 1MWYA 5DMRA 1KAYA 4BQLA 1JXLA 2HMIB 3UPFA 3T19A 4KGXB 3B78A 2EG1A 4WFNQ 3I8DA 2BM0A 3NAIA 1WOOA 3D3BJ 3GP9A 3G0ZA 3K58A 2D7SA 4USVA 2KVQE 3M2VA 2AJ0A 3M7VA 1U04A 1FXLA 5H9FK 3WBZA 2FLPA 4DQQA 2DIUA 4H5NA 3UI3A 4Q2LA 2X1BA 3LGNA 1FE4A 3FEYB 1FDNA 1RWMB 3V81A 2XULA 1C0GA 4DR1J 4KV8A 3ZZTA 4WCEQ 4LF5F 1X5SA 4FWSA 4WPAA 5FRNA 2ERRA 1QVFR 4LF6K 4ZITA 4H0XB 2Z2LA 1QSSA 2VFUA 2FZGB 1HYSB 2G1DA 4Z94A 1JNZB 3TAQA 1MWMA 2BRKA 2P9SB 3BYRA 4IO1A 1HW9A 2CPZA 3K5OA 1FFGB 5M1QA 3RRKA 3NDKA 4NCGB 1NGHA 4JI4K 2WRMA 1NK8A 4ZP8A 4XDDA 3NNAA 4B9NA 1IWGA 1VQKN 1IKYB 2RDIA 2RHQB 5C25A 2Z2ZA 4U7CA 1O0PA 5KFOA 3I9ZA 3SV4A 2XI2A 2G0CA 3HHLD 4J37A 3DLBA 4A8XA 3EZ5A 1BQNA 3V9XA 4Y2MA 1U6ZA 5DQHA 1K0TA 1Y64A 4NOHA 1RT4A 1ACMB 2F8MA 2X6SA 1OKJA 4NLOA 1RLCL 4B02A 4NCAA 2W42A 1NPRA 3UO0A 4A2AA 2MJUA 2EC2A 3CJTA 4GVLA 1OJ4A 4GKKJ 1RHMB 2ZITA 3OTDA 3I33A 5GAEU 3F41A 3OXGA 4N47A 3QEWA 3AY0A 3DJCA 1VSDA 2A6MA 2Q43A 1ZBTA 3AVJA 4LF8J 2FSJA 4FPRA 2FF3B 1HPMA 2E20A 2JL9A 4DL5A 4DCHA 2R8GA 3DI6A 2W2PP 2APOA 5C2GA 2MSTA 1F9HA 3I31A 3GV5B 1N5YA 1UEKA 1FE0A 2L48A 3TSQA 4X64K 4CZCA 2ZH1A 2XHWA 4KO0A 1V9OA 1JWWA 4A48A 1C0TA 4OZ0A 1VK3A 3TAEA 4DV0F 4RJVA 1S77D 4DV2F 3D7EO 4QWCA 1S6PB 2ZWHA 4QS9A 5LMUF 4J91A 2W2OP 5CCLA 1N32F 4C8ZA 2HF4A 4WFAQ 4NXNK 3KWMA 5BR8J 2FVSA 3R97A 1Y3KA 2CQDA 1FESA 4DFKA 2OP5A 1CVJA 3K5MA 4BR5A 4ZPVR 2P9UA 2K1RA 5AJ3F 2XCPA 2WFBA 4WE1A 1N33J 2I5JB 1B9DA 1NOZA 1OYEA 1SXLA 4J9PA 5FPDA 2R7RA 3OW2M 3FC9A 1ZM3A 4YDDB 2H51B 5GADU 3SAGA 4AHSA 2H3GX 4CJ3A 3CFRA 2GWJA 5JS2A 2E66A 3ENWA 3R5CA 3CW2C 2MQNA 2AYGA 3R3TA 4Z4EA 2ABYA 3J7YP 1U1RA 4ZIWA 3A1YG 3C14B 1GFWB 1Z4UA 4X4TA 2E2PA 2YWKA 4KH1B 4IEIA 4JK9A 4DR1F 1RACB 2MPUA 4QU7A 1BU6O 1I1GA 1KQSR 2ZF5O 1SV5B 1Q81O 3ZTQA 2KH9A 1RCHA 1Z25A 3W8PA 2QXFA 4IRKA 4H0OA 4IG0A 4EFAC 4Q45A 2P9PA 1PYTA 4CLYA 3FBFA 4ZVGA 1WUAA 5HMWA 1N88A 1YJTA 2LKZA 3CC4S 1NDPA 3GV7B 4C1NI 1XTZA 4M5DA 4IOAL 1GLJO 1V4SA 2N82B 4OI0A 3RW7A 1WC1A 1OPZA 4DL3A 4LR8A 2XWYA 3QSYB 1YJNN 3IFRA 4OHVA 4YEAA 2BANA 4FP9A 4CQ1A 3OTCA 3QGGA 4DZDA 4I4BA 3TVZA 5C2CA 2E9TA 3OYFA 4CF1A 3TABA 3MEEB 3CC2N 5CYQB 4RW7B 1J6ZA 3OYHA 1YKWA 4DQIA 2JVRA 1R89A 2YX1A 5F1XA 3H59A 3SCKE 2JZ5A 3W3DA 4P7VA 2VA2A 3MDFA 3K0JA 2CG8A 2IVNA 1IKWB 3CE8A 4MT1A 1VK0A 4HI1A 3KKFA 4AILC 4FLVA 3FBEA 2DBBA 2UV8G 3ZSVA 2MGZB 2KFZA 2OUGA 3KLVA 1MG7A 3IGVA 3Q0AA 5EY4A 1L3KA 4CLTA 3OLAA 3NOCA 4C2MA 4AXJA 1SL2A 3VOVA 2FC0A 3IG1B 4JKHA 2EW9A 2E1ZA 2OJ3A 3AVAA 4IOCQ 4ILMA 1YLXA 2O8DA 1I94K 2SXLA 5BJRA 4LIWA 3LP2B 3AVCA 1TQLA 4PUOB 4ECWA 1LWFA 5EX3A 4KH5A 1FK9B 4Z4FA 4YOXA 3IFEA 1YIJS 2YY3A 3LP0A 4E7LA 2DGTA 2RKIB 2QWMA 2KXHA 2CQ0A 4O0NA 4YN3B 3MR3A 2MDAA 2YX7A 1YJWN 1YHQS 1IBMK 3Q86A 5KG3A 3SYZA 1T3VA 1M5VC 2B51A 3SFGA 3SEOA 1NM2A 2NXJA 2DD8S 4PYDA 3QMLA 1F5AA 2ZBPA 4LFBF 3EWGA 3PR5B 3N4PA 2VWBA 2ZD1B 2B4UA 3D3CJ 5KOXA 3KK7A 2KM8B 3CF5L 1IG8A 3ENQA 5EVZA 4X65K 3SCJE 1OO0B 2M8DB 3Q8SB 1YF5L 3MCOA 3BGOP 2DFHA 1HR0K 3OVSA 2CZ4A 2XMJA 5J2PA 4JV1A 3ENAA 3MMAA 1YDLA 1T0TV 2A40A 1TL7A 2OLWA 1VSEA 4IRCA 2FVRA 4KPCA 5CHIA 4RNMA 1S1WA 2XM3A 2CWXA 4RBVA 2DXEA 4OGCA 2DNPA 1N34K 3KG1A 4EBCA 1BL3A 5BRDA 5CABA 4L3KA 2I2YA 2YBVA 4J90A 4ZJOA 3NCRA 1REVA 1MNEA 4KGVB 3AOAA 3G87A 5T14A 2XZTB 2GHVC 4PL7A 4KB0A 3SV3A 3AO3A 3AV9A 3FRZA 3WQUA 5DJBA 4FWNA 1KQSM 1NLVA 2ROEA 4MQ3A 4QWEA 1HRHA 4JI7K 2DR9A 1VQ5N 1N36F 4CK3A 1ATSA 3OXFA 5GMDA 3A8IA 2YV0X 2ZNYA 2DRBA 2P9NB 4CFCA 2H48B 5KG1A 1UFWA 4EFHA 2YWFA 2RU9A 1X4CA 3JTOA 3MXMA 4X4PA 2OZSA 2HZVA 2N4DA 4B1XB 4J9MA 2O8CB 2CPXA 3LUYA 4JI0F 1LK7A 3QESA 4JI2K 1N8RT 2P8IA 4WFBL 1VRTA 2ZOGA 2UXBF 3LWMA 2YJFA 4DV3F 3BO2A 1NPPA 4F2SA 2Q31A 4DR4F 2L9NA 3B54A 4LY7A 1U2RA 2KI2A 3LO3A 1BGXT 1NM1A 1SQFA 2FSNA 3NVMA 3HYFA 2KKHA 1IBKJ 4ERDA 1S9GA 4DG1A 3UCGA 4H4KA 4JYAF 4A47A 1I39A 4L3NA 2O4IA 3A5MC 1RAFB 3ZZ0A 4GVMA 4LBPA 4RNHA 4EU0A 2JLFA 3FSYA 4K42A 4KHPJ 4M42A 1T05A 3G6XA 3O1BA 3OVNA 3M2VB 3MM8B 4D3HA 3ETMA 4RUHA 4ZVRB 2NNWA 5HQMA 3BUZB 4X62K 2YKAA 3BEXA 1S0OA 2A5XA 3KOAA 3IRXA 2A42A 3FZFA 5I3UA 2R8JA 2A3ZA 4OZ3A 4CD1A 3V81B 3J80Y 4QW9A 3AO5A 1J5EK 3ENHA 4CGIA 4OLOA 3U1NA 1SH2A 5EX5A 1X4GA 4Z7CA 3JSBA 1QM9A 3W7BA 1U1KA 1O5JA 2X7IA 3DU5A 2F4VF 2KB2A 4JI5F 4CZEA 1RHKB 3J80U 4UZCA 3RBDA 5F8JA 2QWLA 4DL2A 1U49A 3R9LA 2M0GB 4ZKAA 5ADXH 3HKZD 2MQQA 1NH8A 3CJ9A 4Y6IA 3N5FA 1HBOA 5B0GA 3U27A 1LQ9A 1S12A 1SCJB 4KB1A 2H3EB 4P73A 1B0PA 5CA5A 3QIPA 2HB5A 4MDBA 2LYVA 2Z4PA 4OJHA 3VHQA 1BDGA 3D0GE 4BWMA 4P2MA 3AXMA 5BXIA 1UEVA 4U67L 5A8WA 5C25B 3HVAA 2I7NA 1BUXA 3DRXA 2BE2B 4CLWA 5AZJA 3QEPA 3PIPL 1SUQA 2QI2A 3GIJA 3LH2S 4DUYF 4RU2A 1ZBFA 1BQNB 4IH7A 2E2QA 1GT8A 3KDOA 3I9V9 4QR1A 3SAHA 4CGGA 4Z2XA 1RT4B 3SCLE 5M1PA 5C15A 1TKTA 1WF0A 1Y97A 1RU1A 2D41A 2DTJA 1XNRK 1VQNN 2DITA 4F3QA 4FLYA 4GKJK 2ATCB 4M5HA 2QEXN 2QA4G 3IMXA 3AA3A 4ED7A 4BS2A 3VF4A 5G0RA 1FF2A 3EE8A 1IR1A 1AUSL 2MKYA 4FJXA 1RTJA 3DLGA 2B8PA 5A2QY 4BRNA 5ETQA 1GOAA 3BGUA 3HL8A 3L09A 4YP3A 3HHLA 5LMNK 4B3TJ 2GX9A 3OYNA 3EGNA 5F9LA 4R0JA 3DI6B 1IN0A 1M90T 2DO0A 3QQCD 5A2QU 1RI7A 1N5YB 4OLPA 1KKHA 3J7A1 5F3ZA 1U4BA 2EFGA 5BPLA 2EI5A 1MN9A 2R4FA 3MOZA 4KO0B 2ZVSA 4LBIA 4NCBA 2UUCJ 1C0TB 1Y9OA 2J6TA 4IYQA 3M9OB 3N01A 1HUXA 4LF2A 3C65A 2B7BB 4W90B 5LSOA 4ETZA 3N9UC 4ANEA 4E7HA 1B9FA 4E1MA 1WSJA 1UJ6A 3CUNA 1GLEG 5HK4A 4K7QA 2V2VA 1BCOA 2EKNA 2J0QD 2W9CA 4DR3K 1WEZA 2MLZA 2P9UB 2XGPA 2K1RB 4JRPA 5KFAA 3AVHA 4BR4A 4WE1B 2KTQA 3DLLQ 2OPSA 2Q0RA 1ASUA 5DM6Q 4ZVQB 3EX7B 5JMVA 1P8ZA 3MPWA 2COLA 4CP5A 3N0VA 2Y8WA 4DTXA 5DK5A 3O9UA 1Q86O 5M2PA 3O4NA 5HANA 1DFDA 4A5BA 2QWQA 4A8KA 4DL6A 3R7SB 3QICA 2XZDB 1HA1A 3EL2A 3IO1A 1CJUA 1URRA 3DU6A 2AX0A 3KKRA 1WSVA 3X3UA 5AT1B 4RL1A 2GHPA 3OQ2A 3VEYA 3M9NB 3DAWA 1W7AA 2EWHA 3KJVB 1A9NB 2Z8QA 4IG0B 3H46O 5F2RA 4WFYA 2GQ2A 1F9FA 4DV4F 2P9PB 3CJ4A 5D4OA 2F7VA 4W98A 2ITMA 4JI6F 3SDEA 4YR2A 4DR6K 1RBAA 3KDNA 3VVUA 4ZVTB 3UR0A 1YTUA 2FLOA 3TX8A 4I56A 4Y00A 3MM9A 2HSTA 4ENOA 4ECUA 2QLBB 3CPWM 1H38A 4AFFA 3I87A 4B1WB 5GAGP 1XMQK 4X4OA 4M95A 1XK8A 4K43A 2BANB 3KMSA 1RSCA 4USKA 4F3OA 2ETJA 4KT0C 2D0OA 4BCAA 2ZJPQ 3BF1A 4CJUA 2XMAA 4QWBA 4LREA 1XERA 4B1VA 3J8AA 4NB4A 5C42A 4F4AA 3SSQA 3H90A 3KG0A 4QWDA 3AJDA 5HMXA 3US5A 3NGIA 2V63A 1CZBA 3UCUP 3O1LA 3HP9A 4EHUA 2QMXA 2JRSA 1SJRA 1ZTTA 1HBNA 4OKKA 1TUVA 1B99A 7AT1B 3QRRA 1DLOB 1WNEA 4UQTA 1EB0A 3ID8A 1L3SA 1G7CB 2GC8A 3ULHA 2G2OA 4MH8A 3QJJA 3FR0A 2CNLB 3OTOK 5CD4H 2O8DB 3CETA 4RTFD 4CZGA 4PQUA 3QMQA 2Y1LB 1YWXA 1OY6A 4DCOB 4JI3J 4FJ7A 4ILRA 3A8JA 3BM7A 3DFEA 2BJ9A 4Z0UA 4CLSA 3LP0B 4GMKA 1VMBA 3PFEA 2IYGA 2E5HA 3BN7A 3HT0A 5BPMA 1XNQK 4X2BA 3OL8A 2E1AA 1JJ4A 1O51A 1K47A 2GJ2A 3PRBA 2MQMA 2KHCA 4J9RA 3J81O 3RB4A 4LFAK 2ZUGA 3KJQB 2B0GA 4KHQA 2IYIA 2FJDB 2NCKL 4IR9A 1DQ8A 3SBMA 3L9ZA 2Z58B 3TTFA 1RT5A 4M5GA 3WZ0A 4BVOA 6AT1B 4DV6F 4I2PA 3FJ2A 5J2PB 4CE9A 4BY9C 3I5AA 3ZFVA 4ES2A 3CCVS 3MMAB 2Y9HA 1JK9B 4WJBA 4OX9F 5KFZA 2RS2A 2RQKA 2J7WA 1A6LA 4JI1J 1VLYA 5EWGA 1Z05A 1HNZJ 4K0KK 2R7VA 1B92A 3DCAA 2KRRA 3F56A 3IS9A 4PKDB 4GV9A 1VQMS 1WDTA 1KQGB 4J9VA 5ITHA 1YVFA 3CJKA 1B3TA 1REVB 2YWWA 5D3GA 3HSCA 4XIUA 1AROP 1GLFO 3M2UA 5AZIA 1YRTA 3T5LA 2LU1A 5ETMA 1PG5B 2E5LF 5J2QA 3MXIA 2B7CB 4DN0A 3QAEA 4F04B 5L1LA 2MQOA 4OYXA 2ACMA 4WBFA 1HIYA 3MPYA 3UDEA 5KFGA 3H7HB 2EPIA 4JV5F 3W66A 1NK9A 3M6VA 4J9SA 2N4CA 3T6BA 1GQEA 1IJJA 4UY8T 4WZQA 3DOKA 4BREA 3K2PA 1YJUA 1VRTB 3EZWA 1D1UA 4A8MP 3SSSA 1YJWS 4USTA 4WZMA 4ES1A 3V1QA 1X4DA 3TW0A 1OIAA 4OYBA 2NRHA 1S9GB 4AHVA 4U6PA 3ULEA 3VTIA 4JKAA 4DLGA 4QPTA 3R6GB 1WSIA 3EUNA 5E3CA 2AU0A 1QSLA 1T05B 4DTJA 1G2EA 4DV5K 1RUSA 1RKJA 3U1LA 3TJAA 2WSFC 4CJLA 4NXMJ 1RKIA 1SKSA 4ZOSA 4LSLA 2CPJA 6FDRA 1NKBA 1NKCA 2K7JA 3R5JB 3IRXB 2CQ4A 5I3UB 5B7WA 3BQ0A 1RDRA 2VQFF 1JXEA 2HWHA 4JV2A 3L3VA 1YRXA 3RBZA 4Y0FA 3W2WA 3IUCA 4MK7A 2BDPA 2R7QA 4PWDA 4N77A 1VQ8N 4CBUA 5B0DA 3QZ8A 3MFHA 3TZYA 3NCPA 1JQGA 3MCMA 3O3GA 3D2FB 3TR8A 2VYPA 1QQOA 4LFCF 1HI0P 1YITS 3BJYA 3BPSP 1RT6A 1RGVA 4KH0B 1HBOB 1F5CA 4MMOA 5KFHA 2BRLA 3ZT4A 2BBEA 2I38A 3U6FA 2HKEA 2Z57B 4IEEA 3QIPB 2B3TB 3R2DJ 4AQYK 2ATQA 2DVIA 2YNGA 2IS3A 4DV7J 4B9TA 2VWJA 4HHUA 3AH6A 3RAXA 5A8WB 3HD1A 4IFVA 4KIAA 5DG7A 2VF3A 1SUQB 3NXZA 4CLZA 4P72A 3MPDA 3AD9C 1EHWA 3G2XA 2O66A 1QQMA 1RTDA 4NYOA 3D6MB 1KTVA 1TKTB 2NXEA 2Z1GA 2WAQD 3VA3A 4A62A 3ELHA 3CMAS 4AM6A 3PIOQ 2ZBRA 2BABA 5KPTA 5GIOA 4CJQA 2B9YA 2ZDOA 2ZBIA 3K5LA 5G0RB 3C66A 3VN5A 4HUFA 1RTJB 1MW7A 1ITPA 3JSRA 4FM1A 4ZCMA 7FDRA 4CYUA 3HHLB 1ASWA 2J0SD 2IFXA 4IG3B 5KG7A 3T5JA 4AL5A 5THWA 3IBWA 5KFKA 5IFMA 3QPIA 2C2KB 2ASDA 3F9KA 2PO4A 2OGUA 2IRYA 5C10A 3LW5C 4E19A 4E1NA 1BHNA 4OKEA 4IKAA 3QNWB 2CJYB 1CBKA 3DM2A 2OEMA 5HMZA 2ZBQA 3CCQS 5AQWA 3R1XA 4YY3K 2U1AA 3K7RA 3HULA 5AQPA 3SIPB 2FSKA 2PC6A 2W7AA 2ZJQL 4RPFA 3QGHA 1Q7YT 1OVQA 3NAEA 4TXSA 4M3RA 2VBZA 2BW7A 2XY5A 4ID5B 2UU9K 3EVMA 4QPXA 2W9CB 3NE6A 1QHAA 4DLEA 4CEEA 4K41A 1S5JA 5DETA 2OPSB 4CJ7A 2VONA 4DQ8A 3QT7A 3SNNA 1F5BA 3R6LB 2RN2A 2F96A 1RT7A 4BROA 3FSXA 2KXFA 4K8RA 4ECVA 3KZBA 4YB1P 1JXVA 3TZZA 3TAGA 3EGZA 2OA8A 2G13A 4DV2K 4DFPA 2EFVA 1CLQA 3SMPA 4A59A 3GIKA 3FEXB 4MIAA 3CCRN 1CJUB 3FKBA 1LOTB 2GV9A 3AVGA 3VGMA 3WXKA 4LH5A 3DMJA 3QBWA 3TTDA 1ZOTA 3L2VA 4B3MK 2HFNA 1YSJA 4CH1A 5AJ3K 3P5BP 4ECQA 2QEXS 4DF8A 3UW1A 2J7UA 3W9HA 4BG9A 3KLGB 2C3MA 3P83D 5CYMA 3FQKA 2GELA 4E2FB 3SDEB 3NWRA 2HHHF 3VF2A 4UF4A 4HUGA 4FXVA 2QA2A 5K9FA 4OHWA 2FJBB 3H20A 1ROFA 3KLFA 3VGUA 1KHVA 2HBLA 2FHJD 2QIFA 2IA6A 2ZH3A 3LDQA 1Q9XA 2ROGA 4NLXA 5FDLB 4DR1K 5AQRA 2MKHA 3F44A 1FTCA 3JYTA 3PYGA 3NBPB 1FNOA 1YJRA 3M9MB 5C42B 4NI2B 2ZZMA 2XCAA 4M3XA 2QWNA 2GVZA 5M1FA 5DS7A 4OZLA 1C0UA 1ZM4A 4GY2B 2U2FA 3OSNA 2GJFA 4TY8A 1TUYA 5KFEA 4X4QA 1HBNB 3W2VA 4ZVFA 1K1QA 4LF9J 2MY8A 3DDIA 3OR1A 2VFTA 2XS5A 4JOUA 4K4VA 5AXLA 2ASYA 3VENA 2IC3A 4F26A 3AOBA 2MKIA 4JP8A 3UD5A 3NF7A 3VF6A 2L9DA 1M0SA 4CNZA 1U6BA 1UTAA 3MM5A 4LF6J 2GMLA 3SXLA 3G82A 2WSCC 1NHVA 1VOMA 4OZ2A 4PQUB 3M6GA 4B17A 3R7BB 4DJBA 2XSFA 4C9DA 4DB3A 4UT4A 4KKOA 1V4TA 2RVJA 5AE2A 3E01A 3E3XA 5F0WA 4BBYA 4CTAB 1S57A 2RH3A 3CCZA 4IRDA 2XYGB 1PYSB 4GKKK 1QVGR 4ZTFA 2XY6A 1I6JA 2PMZD 3PDNA 4DDFA 2HVDA 3G4SN 3U02A 3V6HA 4OJRA 1R0BG 1D9DA 2NYIA 1CZAN 2AGPA 2XMVA 4UOGA 4LF8K 1EIYB 4LSNA 4CJWA 5D4LA 2YKOA 2ZH6A 4NLVA 2V69A 2K3IA 3TA2A 3J7ZT 1DGKN 3SUOA 3IM8A 3CD6N 3BZKA 1TL1A 2BJEA 1UW9A 4M3UA 2XNQA 4RLEA 3R6MA 4BVPA 3OYMA 1BY9A 3GU0A 1WBBA 4L73A 4OFZA 1UCNA 1C6VA 3H8YA 1RT5B 3VQ6A 3AA9A 4KR0B 4FWOA 4I2PB 3OFGA 4MAKA 4G65A 3HFVA 1ZBUA 2H1YA 4FZVA 5JVHQ 3E9LA 3OL9A 1N56A 1GLBG 2RQMA 4ITSA 3WXMB 4NLDA 5BR8K 1HFEL 1WOQA 4BRIA 3PO4A 3EY1A 3QAUA 2B9XA 3JQMA 3HD2A 3IS9B 3S41A 5GINA 3J7YU 1HLUA 4YB6A 4CZMA 4E3SA 1FFWB 4LFBK 1N33K 1NBWA 4C0OC 2P5VA 3ZT3A 3P5JA 4CEQA 1TFWA 2MHNA 4K4WA 4WTOB 1FT8A 3CJKB 2A2CA 2POKA 4P9SA 1IWAA 5D3GB 2P5OA 3M2UB 5AZIB 3E9OA 5J2QB 4B08A 1NWKA 2W4DA 2OYQA 1HKAA 1OY8A 2HWTA 4FK2A 1WEXA 3FDSA 1FCAA 3TEHB 1UETA 3V9SA 1RT1A 3MAQA 2H65B 1RDAA 1TVRA 3FBCA 4EP5A 4OJ1A 5KRTA 5AXKA 3QIOA 2YX4A 5L39A 5HVHA 4N8OA 1SIZA 2Q2RA 2X3GA 4F3MA 3PRDA 4N41A 3L7UA 3ILLA 3DXKA 4PWUA 1QTMA 3EE9A 2MXYA 4RG8A 1NK5A 5EHHA 1FJCA 3TJ8A 4C3LA 1X4BA 2NS1B 3AOCA 4ECYA 3B8HA 4G1QA 5J1PA 4GV3A 3I56S 3K8VA 2OMLA 4ZPTR 1N36K 3GJTB 1F2HA 3ULEB 2FY1A 4CGHA 1MROA 5DM7L 4KHYA 3CCMS 2UUAJ 1IQZA 1Q9YA 4CGFA 1VCTA 4DCJB 3UVJA 5LY3A 1FVQA 2E7WA 1X4EA 3IKMA 4LSLB 1RTZA 4JI0K 2EFPA 3LF0A 1ZPVA 5I9EB 3BYPA 2UXBK 4OI1A 3W61A 4XDCA 3W2WB 2MZTA 3ZZUA 4OI2A 4PWDB 2ZKUA 4BC2A 3T6JA 3MMJA 1NMDA 2EC0A 2WVCA 4ISFA 1FO1A 1JL1A 4O3OA 2UUBF 4KYZA 1F9EB 3IR7B 3KHGA 1HI8A 1RT6B 2DYAA 2HURA 3BF3A 2CGLA 4Z4CA 2JWLA 1LNQA 2VPYB 4RO0A 1S6UA 4OL8A 4ZPAA 3PY8A 2IMOA 2W01A 2GEMA 3CFOA 4IFVB 1GOCA 1W97L 3DRPB 1SPBP 2XMTA 3LGHA 1TL3A 1NB2A 3KMQA 1K9MO 2CDQA 1FXDA 3AO4A 1T7PA 3L8BA 3J81j 3M32A 2DHXA 1RTDB 4QJVA 1JLGA 3SAFA 2M3DA 2LEBA 3MEKA 3TU5A 4CZJA 4L76A 2YH1A 2XO6A 2D74B 4JD2A 3WXLA 1KCFA 1I94J 1W9HA 2RRNA 3WXJA 1YI2S 3DGPA 3LPYA 3SCIE 2G0JA 1ZAVA 2HZCA 2VJUA 3EPIA 4CYUB 5DQIA 3CPEA 3OL7A 1HHTP 1V3RA 3FZLA 2Q36A 4BR9A 2UVRA 1P9YA 4R79A 2G8VA 4Y2CA 3K59A 3CT9A 2K2PA 3BKFA 1TL5A 2BOPA 3DM2B 1K44A 4IDHA 1X8DA 3HHEA 3Q89A 5ETVA 4YFUA 4U9RA 2ZH5A 2JLGA 1XMOF 2UXDF 4AHTA 4UUXA 1LK5A 2W24A 4M63C 4FF1A 3KXDA 3J80O 3A13A 4N5SA 4OV1A 5HO4A 2YTCA 1IJFB 3FZKA 1HNXF 4KHWA 1AFJA 4HT7A 3SI6A 8AT1B 1FI4A 4BHQA 1DY3A 2GUPA 4A8SA 3A2FA 4OGEA 4YDUA 2NRTA 3OBYA 1N34J 1RT7B 1YRUA 2KHOA 2DGQA 2IJFA 1KS2A 1M5SA 3WUHA 3SUPA 5K14A 4MYTA 1C1CA 2RF2A 3IDHA 3DXMA 2E1YA 4IOBA 3PW4A 3AVKA 2CIMA 2RSQA 3BPDA 4F36A 3Q8RB 1YZ6A 1LWCA 2F40A 1PJ5A 1NDLA 3DRRA 3IBFB 5CYMB 5HJYA 3BH7B 3E1YA 4KHPK 3CJSA 3CULA 1UA1A 5GAHI 3VQSA 5CY4A 3ZETA 3MI7X 5A2QO 3KLFB 3G86A 3G6EN 4JI2J 1QQNA 3VGSA 1DTTA 4EYHB 2FB0A 1VBYA 3R8YA 2HLTA 2V2QA 4XPEA 2LU2A 3JYTB 2EK6A 2B6AA 4M1KA 3PW0A 4YOVA 1S76D 1YJ9S 5B08A 1VQPS 4FJNA 4CO1A 2FPHX 3PVXA 1S6OA 4P2XA 4FCYA 4BGAA 4DV4K 3VQPA 2GVZB 2G4BA 4JI6K 3SBGA 1C0UB 2LMIA 2O8EA 2PFDA 3W5YA 2AX1A 5C5JA 4TY8B 3TA0A 1R8AA 3PX0A 1I3AA 3W2VB 1Q8IA 4NZ7A 3OR1B 3OJSA 2IIHA 1NDKA 1HQUA 2QM1A 2IC3B 3GR0A 4DXLA 4USMA 5E0OA 3G25A 1HNWJ 2IVFB 4KC5A 3MM5B 2GAHC 3OYIA 2HW3A 3IWLA 3LPEA 4BRMA 3FBBA 1WG1A 2HQCA 1I3OB 4I6AA 4KKOB 5E3QA 3E01B 2J4RA 3ET6A 1UVMA 2IVOA 1YT3A 1N5SA 3OYJA 3GIIA 1SJ3P 3TUJC 3TAPA 3F9MA 3MUMP 1DTQA 3FFKB 1NDCA 3VAKA 2P9LA 2C2NA 3EDRB 5KFPA 4B3TK 3LAMA 1GNKA 4KI4A 4FKXA 5E5NA 4LSNB 3P45B 1ZTWA 4RKUC 3ZT1A 3VQAA 3VZHA 2FD2A 4LRAA 3HMJG 4F8RA 3L2UA 4DU3A 1VBKA 4YUDA 2PFFB 4CJKA 1Q82O 1TL1B 4NLBA 4A8OA 1VC6A 3P4IA 2HFOA 3GJQB 1TYQA 1HI1A 4OYPA 4F3TA 4M5NA 1SC3B 2UUCK 5J2MA 3GG0A 4FJ8A 3S8SA 3D6TB 3BY5A 1RCXB 3DOMA 5L9NA 3MM7A 4DL0C 3AAQA 3TARA 1ZAWA 3GFYA 4NA3A 3VGVA 3OFHA 3T69A 2GFFA 4TLQA 2NSCA 4FJIA 3CJQA 2BJ8A 5LMNJ 1Q8LA 2D0PA 4BRQA 5F8LA 4O55A 1FRKA 3RGIA 3M8PB 1NGJA 3MD3A 2FBVA 4BC9A 1SJ1A 3V9UA 1UP1A 5C24A 1H1VA 3KD1E 4WFXA 2IBKA 4IXCA 2BJDA 1KN6A 3EGVA 1HX1A 5J1EA 3CHWA 4OPAA 3BSAA 1CJKA 4I6MA 3H4DA 3CQYA 2LFVA 4OX9K 2MJNA 2PMHA 3M8QA 1RT1B 3RYLA 1TVRB 5KFQA 2Z2MA 1WAFA 2AYMA 3L7OA 4PHTX 3M8YA 3HCXA 1EX8A 4WQ4C 3OYCA 1O1WA 2PT0A 2VUGA 1W2BR 3C15A 2A41A 2D4WA 3DXKB 1JMTA 2ACYA 5GAGU 4HVJA 4DV1F 3G4SS 3A5OC 5K8MA 2GVDB 2LLZA 1NUEA 2G9OA 5ETLA 2DNZA 2OZMA 2VG7B 3ZSWA 4K50A 1C2PA 1HWLA 3W62A 4G1QB 3LDLA 4J9OA 1YGYA 3CD6S 4LRDA 5KTQA 2O4GA 1WOPA 1KVAA 3KK3A 3HP6A 1MROB 4TU7A 5E3RA 1HNWF 1PCAA 5AQVA 3GV8B 4OYAA 4J5OA 5ETNA 1SC6A 2VB6A 1WTBA 1XIQA 3UVJB 4NLPA 2KQ2A 3ZTSA 1N5QA 5BYRA 3ZNUA 5B0EA 3RB6A 2RHSB 3CWJA 1QUVA 2PBDA 4DR6J 1FD8A 4FWKA 3PLAA 4USJC 2WK4A 4CHYA 1X5TA 2XI3A 2KN4A 3CXCM 4LF4F 4H5WA 2W41A 3THPA 3NF9A 4OZNA 1RA7A 1VSLA 4J2BA 5G4DA 4NYNA 2ZH4A 3UDLA 4UY85 3H3OB 2CJKA 3MWPA 3FGVA 1N0VC 3CVKA 5D6GA 3OHAA 4PG5A 2FUG9 3TVYA 1ZH5A 4QOTA 3MEGA 1LXJA 2XLIA 2ZZNA 2DH9A 3D0PA 3D28A 3M8WA 3O6QA 1EQMA 4ETXA 3G8SA 1B64A 1VISA 3I5BA 5ADXA 1XC9A 3NHGA 2G8HA 3M1FA 4NLGA 5HROB 2P1JA 3M2RA 4ELUA 2DO4A 4JI3K 2DNYA 2RIJA 3FCWA 3RR7A 4ED0A 2VFRA 5L1IA 1U0SA 4FKYA 3QEXA 4CK2A 1TL3B 4O0IA 1WC4A 1IBLF 1Q79A 1KC8T 1OH5A 3LTOA 3AVMA 3MZIA 1JL2A 2DGOA 3M32B 4X66F 3KJFB 4P10A 1JLGB 1RAJA 2HYIB 2CH5A 1ATRA 5HQ8A 4YNQA 1J9AA 4TKTA 1KD1O 4KY3A 1TP7A 4JD2B 5ADZA 3OTOJ 1HPZA 1BQXA 4K8ZA 1K0VA 1RABB 3OR2A 5H1SV 5LT5A 5CCMA 4I2QA 3DGPB 4M45A 3VTHA 5GVQA 2ZM6F 1LEOA 3LM9A 2OPPB 3H6EA 2IGIA 3OS0A 4WKRA 2UXCF 3VAHA 3A8EA 3QO9A 5D0GA 4QZVB 5K8PA 2RQCA 4DMNA 1FFSB 3SFUA 2A18A 4JI1K 2W7OA 2Q1NA 1IKVB 2W9BA 5HP1A 1P8GA 3CC4N 3AA5X 3FEZA 1XR6A 4ID8A 3KK2A 1FX4A 2FBXA 4PYAA 1J27A 5AQXA 4LFAJ 5C2DA 4DQRA 5KG2A 4RW6A 1RFQA 3KWGA 4Q8FA 2BH1A 5AFUH 4CJ4A 4W4MA 4WF9Q 2AD9A 3RSEB 1M5OC 4K8XA 2YPZA 1PJ6A 4QYZK 2E5JA 1F1BB 5M2UA 1UKUA 3VF0B 4K2XA 4FLTA 4CZHA 5E3AA 4HHTA 3X1LB 1TUWA 3QLHA 1BWVA 3FZHA 1WJ9A 3QWPA 2RRBA 1UJ4A 1PYOB 3LAKA 2Q97A 4QQBA 3ZSYA 1RT3A 3QBCA 5CZVA 1S0VA 2LXIA 4F02A 2WVBA 4DSFA 5K14B 4FXDA 1C1CB 2RF2B 3DXMB 2YWHA 3HLUA 5A6PA 2MHEA 1VC0A 2YX6A 3HI0A 5HI7A 3VQTA 3AGKA 1NJXA 1LWCB 2GBZA 1G6BA 3MTKA 2R8KA 3T3FA 2AHOB 4RBUA 3DRRB 1X9JA 5HL7L 3RMBA 2XBPA 3N4WA 3NMUA 2F65A 1VSKA 2HOEA 5L38A 4QS7A 4ES3A 1AW0A 4NXMK 4C97A 5KT7A 3ZETB 1YHQN 2F3JA 3GL1A 4JEPA 2MEWA 3WXIA 2L3MA 1WOSA 5F8MA 5ETRA 4DOZA 5KQDA 3M4XA 4A61A 4JNEA 3VAJA 1R59O 1S9EA 4PXBA 2JEFA 4K4ZA 4ED2A 3HXMA 2B6AB 4FJJA 1S3XA 1FXXA 1RISA 2HWIA 2XRIA 3BBFA 4Y1DA 4Z4IA 3L3UA 4LRFA 4JB8B 2VU5A 1U1LA 4C48A 1WI6A 2O8EB 3KWIA 2DXFA 3ZX2A 2VQEF 1AFIA 2BUNA 5EGYA 3R9PA 1JB0C 1NPKA 4G9ZA 3NS7B 2OMOA 4FS2A 4E0DA 5T41A 3TUPA 4DV7K 2IHR1 1S6QA 1H98A 1PC5A 4TU9A 3T1YJ 1HQUB 2DRAA 4CH7A 2QMWA 2F63A 4O44B 2L08A 2KM8C 3HF5A 4I1TA 1T9TA 3N4QA 3N5BA 4DFJA 3AD8C 3RMCA 4C8LA 1F3FA 2AJQA 3BQ2A 3QFPA 3AJ1A 5D0EA 1UFKA 2CQ1A 4JI8F 4FJHA 1NU4A 2HAFA 1SH0A 4M7YA 2VA3A 5D4PA 4DUZF 2ZOFA 2ZZTA 4BRDA 3KLIA 2DHSA 3TZXA 5CD4A 3ET6B 3H25A 1IXKA 1VQ7S 1H0HB 3H4BA 1ZXOA 3V6JA 2P9LB 2Z1IA 1S1VA 1SB6A 1S7HA 2MZQA 1FJGF 2EWSA 4DR2F 1DRZA 1JJ2M 1Q81T 4DBQA 1SQKA 3CJ8A 4LF5J 3V9WA 3Q83A 3QRPA 2HK2A 3GDQA 3G6ES 1VBXA 4J9LA 1TK8A 4W5QA 3MDQA 4ZP7A 1TYQB 2VPZB 3O3HA 3THWA 5CZ1A 4P75A 5J2MB 1Y0HA 2J8AA 1KVJA 3DOMB 1VQ9N 5A8RA 2DR5A 3MM7B 2LQJA 2Y1RI 2H54B 2LDYA 1FDAA 4FYXB 2JC0A 2ZE2A 4DUTA 4KTWA 3H2UB 4Z4GA 2FJXA 2KYXA 1ZETA 3ISNC 2QLFB 1WKKA 3EDQB 2AMCB 4NO7A 3IRWP 2NXUA 1FRJA 4J2AA 5K8OA 3IN5A 1HHQA 3D6RA 3ISZA 3LA0A 2NREA 3BZCA 5C24B 2HBRB 2AT1B 4KHRA 2HF3A 1P6TA 2GS8A 2NR0A 3ICLA 4FOIA 4FZXC 5LL6Z 5J1EB 4B9LA 1CEZA 3C46A 2P6SA 3KYLA 1CJKB 1LW2A 4IO8A 4FLXA 4I6MB 1Q0NA 4P7TA 3J7Z5 2D1KA 4KHSA 1KBRA 3GE1A 3M8QB 4IUFA 1HARA 5DQGA 1ZA2B 4IO9L 2C2RA 1RBLA 5DLFA 2ZQBA 4HT5A 3O8MA 4CHOA 2ZFHA 2DTUA 4ER8A 1YUWA 2ASMA 3L2QA 4USHA 2FVQA 3C15B 1IO2A 1GLAG 5KFLA 1RBVA 1U2CA 2GW8A 1OQ6A 2QTDA 1D09B 2XY7A 3GFZA 4JBCA 3MXJA 1S0NA 1BMQB 4DV0J 2X3DA 1JLBA 2RNEA 4DV2J 2RT3A 4OHYA 1SKWA 4NLTA 4DU8A 5LMUJ 1N32J 4FWMA 1NLKL 3V4IA 1XR7A 1GXTA 4C3KA 3KK3B 1NGDA 3MX5A 3H5XA 5RUBA 1LFPA 3CD0A 2Y8YA 5K20B 4JRQA 4JN4A 3NGYA 4CM2A 2CGKA 4DL4A 3QGIA 4Q44A 3S3MA 1VHXA 1C0FA 3U9DA 5AJ3J 4H4MA 3ID6A 4ISEA 4F67A 4P71A 1FWLA 1CJTA 1Y5LB 4P52A 1EQ0A 4DPTA 4JI4F 2FDNA 2GQCA 3AA4A 1OSCA 3PRVA 4HTIA 1DAXA 2FC8A 4DQSA 4KGKA 2B9EA 2V5HG 2PDAA 3MMVA 4LF9K 5KG5A 1OVYA 3NGTA 1QHTA 1KWMA 1S59A 3R5GA 1JCGA 2GAGC 4FZYA 1NNEA 3PO5A 2O8FA 4K4SA 1FRHA 3VALA 2J0XA 1D8ZA 4OYZA 3HJFA 1L5UA 3R3LA 2XYHB 4BR0A 1FA0A 2PZSA 1PC4A 3M2RB 4F7VA 4DWIA 5KFTA 4B9VA 2ALYB 1RHQB 2ZH9A 2CAJA 3PJWA 2J5AA 2NRRA 4DX8H 3BSNA 4KHUA 4BGBA 4IR1A 1LW0A 5HQLA 3FMBA 1VC5A 2KO1A 3VEWA 4HHJA 4ISGA 2PEBA 4FZZA 4YOEA 4CO2A 3HVTA 1R27B 3JQJA 3NS5A 4X64F 5IOLA 2N3OA 2D0AA 4B3SF 3H1QA 1K73O 2PE8A 4MK9A 3OLBA 3RWUA 1HPZB 1XQSC 1HNIA 2F8EX 4K59A 4WYBA 4I2QB 3WQTA 4DCPB 5CH7B 1KQKA 1T6DA 3R5BA 2CA9A 5CYJA 4O3PA 4LRBA 1Y5IB 3QO9B 3NEKA 4NXNF 4DSIA 3ZZZA 5SZTA 4J9QA 5AE1A 2R2TA 5HP1B 3VQEA 2Q6BA 2Z56B 2NPIA 1U25A 2DPIA 3WIVA 2QJ3A 3KK2B 4CIFA 4HWIA 3OTBA 3OUYA 4WKYA 1VQSA 2G8WA 4CEBA 2YKNA 3R7NB 3H42A 2ZJRQ 4HL9A 4RW6B 3TX0A 1C4AA 3E9PA 2P51A 3H2VE 1GTHA 2AIRB 2K7KA 4TVAB 5DO2A 3FMWA 1EXQA 1UW4A 1NSAA 4F25A 3U4LA 1UPMB 1QDUB 1UWAA 3W9JA 3U9ZA 3UD3P 5F41A 3Q7CA 1WHWA 2H9ZA 3OXLA 3QLHB 3SQ4A 3NVKA 4ICLA 2ADCA 4B1UB 1S1TA 2DNHA 5HRRA 3UCZP 1RT3B 5A6WA 4LFBJ 5E84A 3GJRB 4YHHF 3H98A 2UXDK 1XMOK 4BC3A 2VPXB 4R25A 4EHTA 1R8BA 4IH6A 3EGWB 1D8YA 1X1PA 3WNGA 4RWTA 5ETKA 4OO1J 2J8SA 1HNXK 5KFDA 4URGA 1VR6A 2NPFA 2B4PA 4ZA1A 3O3FA 4AD6A 4DL7A 1WC5A 4PA1A 3UE2A 3DLKA 4YOWA 4ZPWR 3TUIC 2UUAK 3OHBA 3BKUA 2D69A 2O8BB 5D77A 1XWLA 3MM6A 2XYPB 3ZYYX 3OFFA 2VBYA 4H8KA 2PMWA 4WFNL 2DHHA 4BG8A 1WN7A 2H4YB 1TMJA 5F9NA 3O1WA 5KRSA 1VAZA 1S9EB 1X5PA 3V4MA 1E6YB 1QVFM 3MGJA 4KTQA 5AQIA 1N36J 4DR5F 2I7PA 1ULRA 3PHTA 4JHDA 4BE2A 2WOMA 1HYZA 2R7UA 4WCEL 2YJEA 2CNNB 3CM6A 3ASMA 3CCVN 3HI9A 3W1YC 4CEDA 1Q1KA 3J7AP 2QWPA 3H5SA 1IR2A 3L0QA 2CJAA 3CCJN 1WSHA 1U1NA 4E89A 4JI0J 1S6QB 3ZO7A 2UXBJ 1V6HA 2MQLA 2K8GA 4DV3J 1VQMN 4DU7A 4DR4J 3C6AA 4USIA 5AQGA 2XHCA 1IBMF 1CG2A 4FVCA 1PJ7A 2LP4A 4ZCLA 4KAIA 5AQHA 2LEAA 2CQ2A 2J6UA 4JYAJ 2KG0A 3AODA 1SIWB 4PCQA 2LSNA 1UA0A 3NWGA 3KLIB 2V51B 2QFJA 1F3VA 4FNIA 1RBSA 3CCUN 4BE0A 4I9LA 2ASLA 2IVYA 3NNCA 4X65F 1WEYA 2AEFA 2W7PA 1GEHA 3TWZA 1TK5A 2BZ2A 5E3PA 4C11A 4A8FA 1HR0F 3G8TA 2J0WA 3FLCO 3GG4A 4FK4A 1S1VB 4F4ZA 5EXWA 4NA2A 3BO4A 2DKOB 3N6MA 2HIYA 2ATLA 2FGCA 4QIWD 2QKKA 4WP8A 2HBJA 1J5OA 1M5KC 2OD6A 3D9BA 2ZHOA 3C0BA 2F7TA 2WVEA 3WEEA 2F4VJ 2OTLS 4JI5J 3MCAB 2D3OR 1QSYA 3DN9A 1N6QA 4JV0A 2M4MA 4M3ZA 5D8HB 3THWB 3B6PA 1ZZNA 3S6EA 2MMYA 3PV8A 2YNIA 2GJIA 5A8RB 3THXA 2CKWA 1A0OB 4IQMA 4KSEB 1T03B 3EVOA 2CVIA 3HBTA 4E7IA 2MZRA 4OLBA 3TSUA 1PAUB 4JI7F 3ZT0A 2IM0A 3UWTA 4UOHA 2Y1JA 1X60A 1K8KA 2HLUA 4DUYJ 3CDUA 5IC4B 3H45C 3SQOP 3CDWA 2GTDA 2GX8A 2RB7A 3C16A 3MMBA 4DSKA 4QR2A 1NJIO 2G1HA 3QGPA 1IV0A 5F8HA 1UVLA 4H4KC 1MA9B 4WFAL 1YXQA 4M5LA 5M1NA 3D68A 4KH6A 2CVEA 2DNGA 4KJIA 3ZXWA 4L75A 2O5DA 2ZWPA 3ISND 1Y10A 2ROPA 1LW2B 1L3TA 1ZYQA 3MECA 3G9CA 2LCWA 3CJ3A 4PXEA 1YITN 1MWZA 3K9JA 3W0LA 3P1GA 2ADBA 1S1UA 1QZ5A 4H54A 3Q23A 4UQGA 3NLCA 5M2RA 3AB4B 4MIBA 3A0IX 2PEHA 4UOFA 1X3NA 4URSA 2OSRA 4HH1A 2X1FA 4CGJA 4CF0A 4X62F 2XQCA 2C2ZB 4AL7A 1CJVA 1BC6A 3UKUB 2CXEA 1JLBB 5HRPA 4CM0A 2R9LA 4C8OA 3C2PA 1N52B 1J5EF 2E2NA 4FL9A 2LEPA 2A2DA 2KYZA 4GC6A 4HACA 3ENVA 3PW7A 4ZHRA 3C7NA 1NNDA 3PYDA 4JUZA 3CMAN 3V4IB 3ILJA 3RB3A 4QS8A 2QC3A 3FFIA 1RWWB 2DY1A 1RAAB 4K4YA 1IM4A 2RDJA 3B82A 1NGEA 2X6NA 2HPUA 3EJMA 1CXQA 2VBWA 3F5TA 3VGLA 1VQ9S 4DHYA 2E88A 4I68A 2V8GA 4H03B 4H4MB 2BQ3A 4TSXA 1RWXB 5K5MA 1RWKB 1CJTB 4E8UA 2G8IA 2CJXB 4DPOA 3AO2A 4UZBA 2HHVA 1QE1A 1T11A 2LQ8A 1ZC6A 2FZCB 2P9CA 3EXCX 1SJ4P 1UVJA 1FWPA 4BE1A 1RAEB 2GIRA 2B43A 4M8LA 3HFZB 3CCQN 2QTWA 1VQ6N 5GAEI 4KI6A 1RP5A 2YHXA 3VAGA 4KV8B 1VDHA 4AF1A 1HNWK 3E8OA 4B3RF 2C3PA 1WSFA 3HDSA 3R5DA 2O8FB 4BC4A 4NE9C 4JKCA 2ZVIA 3HHLC 5I3QA 5EWFA 3NFAA 4WFZA 1HJRA 4MLEA 1XNRF 2AYBA 1JJHA 2KKZA 3LM2A 4DV4J 4GKJF 4CLUA 4RBTA 4KBIA 4FF2A 2BXJA 4GO5X 4RNNA 4JI6J 1KXPA 3CFPA 3NF6A 2KFNA 3QBXA 4IOCL 2DGSA 5JVGQ 1V3SA 2L41A 3PXGa 4KHNA 3VESA 3OL6A 4XK8C 1S48A 3HVTB 3GPAA 4Z4HA 2AW0A 3KHYA 2HQIA 1S22A 2OEKA 4CEFA 3HSTB 2QSFA 1HNIB 1SVDA 3O80A 2PYJA 3AB2B 4IBNA 2CDRB 2E5IA 1MSWD 2CH6A 1FDDA 5GADI 3HM8A 3QETA 2DCUB 2OFGX 2P6TA 4OIXA 1ICEB 3NP5A 3VQCA 4MLHA 3QWUA 1U7LA 1N0UA 1F6TA 4KGMA 1RBUA 4AHUA 1JLCA 3LDNA 2Y1IA 2VIHA 4FJLA 3VGKA 2GO8A 2EG2A 3TO8A 3MEDA 1GLCG 5AR0A 1U6FA 4DTMA 5FIIA 1S7IA 3I6PA 1N48A 1HWUA 2YKNB 2Z30B 4QBUA 2HHWA 3QERA 3CMQA 2C2EA 4ZVSB 2N3LA 2ZGZA 2H5IB 2RRAA 1D0EA 2VKRA 2ASPA 4MK8A 2BUPA 3IGNA 1R6VA 1QJHA 1URNA 4AL6A 1H2TZ 2KVIA 3C8YA 2E1MC 3MFIA 3IR6B 4LIRA 5HRSA 2F5GA 3FCHA 3AFGA 2HHTA 2WC9A 2E9ZA 3R2CJ 3VR1A 3ILIA 1O6XA 4B8CA 2DGVA 3A5NC 4PPZA 4ICLB 4DQPA 2WW4A 1Z6RA 1S1TB 2N7YA 1F2GA 2MLXA 1PILA 1U09A 2VOOA 4H4OA 2JWKA 3CQXA 3NF8A 1P9QC 2CQGA 2YNFA 4A5AA 3P8BB 4UUWA 2KW4A 1XR5A 2VV5A 1RJJA 1OMSA 2H4WB 4DV6J 2JEIA 1XMQF 2AEMA 3EE3A 4OX9J 3V6KA 3N6LA 2IM3A 3JAMY 3CC7N 2V67A 1SV5A 4HVZA 4NX9A 5KQ8A 3VEOA 4YOYA 2DHGA 3DLKB 5GIPA 1IH7A 5IV3A 4PY5A 3NGZA 3OBWA 1IG9A 1YBUA 2A10A 4CI6A 3JAMU 1P1TA 3PCOB 4PKIA 5KG4A 3C94A 2J9CA 1QQCA 2XHBA 1XQIA 5AQZA 4CW7B 2OANA 1ZM9A 2BM1A 2GWKA 2DIVA 4JKDA 5LJ5Y 3ADAC 1BWFO 2XEXA 5AQQA 1FW6A 1KFSA 1D3WA 3VQ8A 1PIEA 2V34A 4M5DB 3CMEN 4ZDNA 2E5LJ 1X7VA 4ECSA 2R2SA 1T9YA 3DDKA 4IZ9A 2E44A 5AE3A 3BBBA 1WC6A 4JHDB 4U95A 4ZLLA 1F0XA 3RBEA 2O3DA 5IS2A 4JV5J 1ZA1B 3IWNC 4OYMA 4DR7F 2YWEA 4DI6A 2E29A 3TR5A 5KFBA 4GV6A 4Q2MA 2KXNB 4ED5A 4L3QA 4M3YA 4EYIB 4XEIA 2E5GA 3DYAA 4RZRA 3TPQA 4DTSA 5IWAF 3HPHA 2QSWA 3AVLA 1TV6A 3R1LA 4NLYA 1RT2A 2DFFA 1XNQF 4NMLA 4BRLA 4CCHA 1VHIA 3CM5A 2P9GA 3MN6A 3G6YA 7FD1A 1NOYA 5EOYA 4WIQA 5HBMA 1T3NA 2DNRA 3SI8A 2HGLA 1RWNB 4XTTA 1HMVA 1H2UX 4IJAA 4OYIA 4BRFA 2HQ3A 3SLCA 3LP2A 4PUOA 1X0FA 4Y65A 2EFOA 3AA8A 1LWFB 3POTA 4OYWA 1N5TA 4MKVA 3FE1A 3THTA 2VQFJ 2V4RA 1QS4A 3IBCB 1BWEA 2DNQA 4E7KA 4G3IA 1TAQA 4K5RA 2AQ4A 1MLAA 2R8IA 3D1QA 1J5OB 4K0KF 2GMJA 4OPHA 3OYLA 3WEEB 4CO3A 2EEYA 1ZZFA 1N6QB 1CLFA 4AH9A 4CJVA 2AYEA 4DUZK 1NSKL 4LFCJ 5AQLA 4ZPDA 3S9HA 3K9KA 1VQOS 3I56N 2PA8D 2M88A 2YNIB 5LXYA 3THXB 3THVA 1RBRA 1WDDA 4EWTA 2Q79A 5KI6A 2C3YA 3CCMN 3OBIA 1RTIA 1TU0B 3SJJA 3FCVA 1UMJA 1K8KB 4HTLA 1EO1A 3NH2A 5FLXY 1IKXA 2QE5A 1TL7B 2DXDA 3CCJS 3C16B 3MMBB 4EUVA 1XN9A 1SZ2A 3JS6A 2LXUA 1S1WB 1NK4A 3VQ4A 3QZ7A 5I42A 2Q66A 3EICA 1XEZA 1BLUA 5FLXU 3D1OA 2F9TA 2DGUA 4PZVA 4CNYA 3U1MA 2NXNA 2IBOA 3DLLL 3JXUA 3LPTA 4BRKA 5CZ2A 3GIMA 1T9VA 3WNEA 4W5TA 2VWKA 3ULDA 4PL8A 5DM6L 3VGTA 3SJHA 1RWVB 4CJRA 2YCHA 4QYZJ 4CERA 2HS0A 4HR2A 2V7YA 3HPOA 5D15A 3CCUS 5JJBA 4PKHA 4DV5F 1VRUA 3ZSZA 3RU0A 1HQ2A 2P5GA 1EETA 2IDOA 4LF7F 2R7SA 1U26A 1YG0A 5DZ6A 4BR7A 1NEEA 1TELA 2BYCA 2JJ4D 1OH7A 2CPIA 1MMNA 4WP3A 2UVWA 1ASVA 3MD1A 1OH6A 2D9PA 5JLFA 5LL6d 2QN6B 4O8KA 2EBEA 4EEYA 1CJVB 1X9SA 4B9SA 5HRNA 1C0MA 3OW2R 1YTYA 2YWGA 5KFSA 1G4CA 4FNHA 4H0YB 1VQYA 2IM1A 3PX6A 3Q8VA 5F0UA 2ZBCA 3UN5A 4TQRA 4HACB 2HVHA 3OPKA 1FRIA 4TQSA 3O9RA 3FFIB 5MLCQ 1Q8KA 2M52A 4MIWA 4F4XA 5C2FA 1LAWA 2HBZB 4QR0A 1ESVA 3I5CA 1H3DA 3LP1A 3ZT2A 2QZ8A 2HBYB 4DG1B 4HDGA 4X4SA 1YI2N 4F9OA 1WSGA 1HWIA 2AV5A 1WB9A 4WQ5A 1TAUA 4DMZA 3MM8A 4IOAQ 1G99A 3Q8PB 4TU8A 1WF1A 4EAHD 4AQYF 1BOTO 1QE1B 3ZCMA 2ZJPL 2EXUA 3GFHA 3CCSS 4CIGA 2CG4A 2FTRA 2GCFA 5L46A 3HPGA 3CG7A 5KFFA 2W2QP 2IOCA 1NJYA 1LV5A 3QRQA 4DHVA 3T1YK