2RF2A

Hiv reverse transcriptase in complex with inhibitor 7e (nnrti)
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
557
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7
publication title Novel indole-3-sulfonamides as potent HIV non-nucleoside reverse transcriptase inhibitors (NNRTIs).
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 157
structure length 554
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2rf2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rf2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rf2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rf2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2rf2A05
3LANA 1C6VA 1L5UA 4CF1A 5KI6A 1KFSA 4KKOA 4DQPA 3GIKA 3KHHA 4DFPA 4JUZA 5I3UA 3K5OA 2XY8A 4ED8A 4E7HA 1S6QB 4I7FB 4NYFA 4OKJA 3L2QA 3QEPA 4W5OA 4CK3A 1YVUA 4Z4FA 1SL2A 4F50A 4RW8A 3AVMA 3M8QB 3QGIA 2AU0A 4NLOA 4OLAA 4DSIA 4ZTJA 1TAUA 2JEFA 4DTPA 1QSSA 4O44B 4J2EA 4DL6A 2Z1GA 4KO0A 5KFLA 4KHYA 1HMVA 4C8NA 2ASLA 1QE1A 3DMJA 4CHZA 3ZT3A 4I2QA 4CESA 4C8LA 1HNIB 4DTJA 4RW7B 2ATQA 4K4XA 5DG7A 3NAEA 4FYDA 4IDKB 1RT3B 1S6PB 5D3GB 1VRUA 4Z4CA 4LQ3A 4O4GA 3MFHA 2WCXA 3KD1E 3PZPA 4IH6A 1U45A 4DWIA 1RYRA 4CF2A 1FKOB 4HCCA 4CJRA 3TAPA 2C2EA 2QKBA 3OS0A 4ED3A 2QXFA 3K5LA 1RCHA 1JLGB 4ZPBA 5J2PA 3VQEA 2YNHB 3B6OA 2YNGA 3EZUA 4RNNA 3LAKA 5CYQA 5K14B 3EZ5A 2DFEA 3CJ2A 1QAJA 3JSMA 3V1QA 2Z1HA 2W9AA 4J9OA 1TL3A 4QWBA 3DRSB 4KHQA 2GV9A 3KMSA 3RAXA 1S1WB 4ECXA 1YT3A 4K4UA 1CLQA 2DPIA 1HRHA 4CJ3A 4W5TA 4MIAA 3V4IB 3WNEA 2G8WA 3N6NA 3EYZA 1BHLA 1RNHA 1N4LA 4F4XA 3CYMA 2P51A 2WB4A 3AA5X 1HNVA 5I3UB 4EZ6A 1QSYA 3HP9A 1IM4A 4KAIA 2FLPA 4E0DA 4TYAA 2F8TA 2VG6A 1NK9A 4RW4A 1HQUB 4CEZA 1C1BA 3QEWA 1T03A 4ZPAA 1CZBA 1NHUA 1KLMA 4EO6A 4RW8B 4EO8A 2ATLA 3QINA 1UWBB 4U7CA 3VQ9A 3O4QA 2XO7A 1C0UA 5KT6A 3ZSVA 3CDWA 4GC7A 3CVKA 3NMAA 4NLPA 4DQRA 2GIQA 3TABA 4EP4A 2O4IA 1QE1B 4AHSA 3DMJB 1REVA 5KFQA 1RDDA 4CJUA 3NGIA 4I2QB 4KFBA 1KHVA 2Z1IA 3RBEA 3WNFA 3KHRA 3H5UA 5HROA 3MXMA 4MIBA 3V1RA 1VRUB 4O4GB 2JEJA 1L3VA 1LAVA 5KFSA 1DTTB 3KK2B 4KB7A 4R5PA 3QIOA 1J9AA 2JEGA 3L2WA 2KZMA 3BGRB 3L2VA 5J2PB 4ECYA 1HYZA 4ECZA 4JS5A 2YNGB 3BQ0A 4J9NA 3LPTA 3OSPA 4Y1CA 2IJFA 5CYQB 4EP5A 4DTUA 1A5VA 1D9FA 3N6MA 3NKYA 1TL3B 4CEOA 3HJFA 4ZMMA 3F73A 3AO2A 2FVRA 1ITGA 1RT7B 3NHGA 3MEEB 2G8UA 2AGPA 4EZ9A 4CGHA 3KK3A 1HNVB 5L1JA 2IA6A 4BWMA 1K1SA 4YMEA 4NLSA 2XY6A 1NJWA 2LSNA 1X9WA 2VG6B 4LSNB 1ZBUA 4B9UA 1BIZA 1Z26A 4XO0A 4XPEA 1SV5B 4FJMA 3KHGA 4O3NA 2IDOA 4QW9A 4KB0A 2FJWA 3IRXB 5KGXA 3GV8B 4KB1A 3PHEA 3OY9A 2OYQA 4OVLA 4OGCA 1REVB 2HW3A 1B9DA 4KFBB 1A5XA 5EWGA 4ZPDA 2PY5A 4DLEA 5HROB 5I42B 4Y3CA 1S5JA 3HYFA 4KI6A 3MECA 3G86A 4R5PB 4R0EA 3E51A 3S3OA 3EY1A 4NCAA 5KT4A 2YKMB 3V9UA 1W0HA 1NOYA 3CJ5A 4K8XA 2ILZA 3I0RA 3UPFA 1S0OA 1JLFA 4PQUA 5FRMA 4LD0A 3QZ7A 1WN7A 4RW6A 4KI4A 2V9WA 2F8SA 5KFCA 3DRRB 4YP3A 3SQ1A 3ZT0A 4FM1A 3HKWA 4C8OA 4AHCA 2HNYA 3NBPB 1WSGA 5JUMA 1IKWB 2ETJA 5KFOA 4K50A 3CWJA 1ASUA 4WFZA 2ASJA 1J53A 2ZD1A 2F96A 4DTOA 2YNIA 3AVNA 3D45A 1SH3A 3DLKA 2AJQA 1WNEA 1G15A 4ZPCA 1S1XB 2B43A 3NF7A 5DLFA 4NCBA 4FJNA 3QO9A 3KK3B 2HWIA 1RT6A 4K4WA 2R8KA 1SKSA 4Q8FA 3V6KA 4FJKA 1TKZB 4FK4A 1NJZA 4PWDA 4ZP7A 5C42A 4XIUA 1Z4UA 3KLGB 4DF4A 1C1CA 2D3UA 4KHUA 1HYSA 3MEGA 3BSNA 2QK9A 1KVCA 3QGHA 1TGOA 3PJXA 3KLEA 4I9LA 1S1UA 1Q8IA 1WLJA 4FLUA 4FLWA 2E9RX 2W42A 4Y2CA 5HRSA 5KG6A 3CO9A 3SCXA 3AO5A 5JS2A 3AO4A 4YNQA 3LP1B 1J5OA 4J9QA 4JLHA 3MECB 3VQ8A 2DFHA 4OKEA 5HBMA 4C8MA 3C94A 2JEIA 5KFFA 4WZQA 2VWJA 5F8MA 5FRNA 3L3UA 3PW5A 3I0RB 1JLFB 3LP3A 4DU3A 2RN2A 4RW6B 4LSLA 3SYZA 3HSTB 2CJQA 1HPZA 5KT2A 2IS3A 3PW7A 2HNYB 4ZP9A 2BQUA 4DU1A 2YNIB 3SFGA 2E6MA 3AO1A 3DLKB 3VQ6A 4CF8A 4CEQA 1RTJB 4JV2A 5J1EA 4FM0A 3IS9B 4FJ5A 3EPIA 4O5BA 2DTUA 1SL0A 2FBTA 4QPXA 4HUFA 2WRMA 3CIZA 3RB4A 3P83D 1ASVA 4B9LA 3QO9B 1RT6B 1S97A 1IKVB 5F8LA 2XWYA 4IKAA 1TKDA 1B92A 4FLYA 1RTIB 4CF9A 3PW0A 3VQCA 5HRPA 4O0IA 1SKRA 3VQ7A 3AO3A 2KTQA 2C28A 4DL4A 4PWDB 3AVJA 5C42B 4JV1A 3LDSA 2RF2A 4DLGA 3ZSXA 5C24A 1DLOA 3QIPB 4EBDA 1HYSB 4B9VA 2UVRA 3G6XA 3QNOA 3DOLA 4AHUA 1L3TA 2J6UA 1IKXA 5KFGA 3U6FA 3KMQA 5JS1A 1LWCA 1NNDA 3ZT4A 2FBYA 3LP2A 1RT2B 1BISA 1TKTA 4DSLA 3HPOA 1EETB 1BQNA 1GOBA 4FXDA 1GOAA 2OPPA 5DGBA 2R2UA 4HTUA 2D5RA 3KK1B 1UOCA 5KFWA 1NJYA 1Y97A 3AVFA 1S48A 1VRTA 3M8PA 5J2MB 3ZSWA 2E9ZA 4WFXA 3U3GA 3VQBA 4CHYA 1RT4A 4E7JA 1ZTWA 4LSLB 3VQQA 4FZYA 4KPYA 2HHUA 4CEEA 4H8KA 3NGYA 4Q0BA 3FFIA 3CJ0A 3K2PA 3DOKA 3RB6A 4M94A 3SUOA 4ZHRA 2J6SA 3SPYA 1L3SA 1JXEA 4ZVFA 2AWZA 4IQXA 4TN2A 1JLEB 4Q45A 2W9BB 4ZP6A 3AVHA 5T7BA 3B6PA 1RT1A 5CYMB 5J2NA 1TQLA 2IM1A 2EHGA 4HVJA 2GC8A 4HHTA 4Z4HA 1KVAA 3CM6A 2UUWA 1NK7A 1S9EA 2KFZA 1T8EA 3NFAA 2ASDA 1RA7A 3UDLA 4AHVA 4ID1A 4YQWA 4CGIA 4BWJA 3IGVA 3TR8A 5KFTA 5EUHA 2OA8A 5DQGA 3L3VA 4CEDA 4DS4A 1JKHA 1NKCA 3DLGA 1WSEA 3JYTA 4KTZA 1DLOB 5KFBA 4FJJA 1SH2A 1VSLA 4K4VA 4EBEA 4M42A 1GOCA 3BSCA 4CJEA 1IKXB 1JL2A 3SI8A 4O3PA 5KFUA 1LWCB 1VSDA 3AA3A 4J9MA 3I5BA 3RBDA 4CE9A 3KLVA 4NLUA 3CQ8A 1BQNB 1RBRA 3MF5A 2VG7A 1KSPA 2OPPB 1QSLA 2W7OA 4OLBA 4RW9B 3UR0A 2I5JA 5L1KA 4YR3A 4IH5A 2E9TA 2Y1IA 4ED1A 1K6YA 3QERA 1TP7A 3DI6A 1WAJA 1VRTB 3M8PB 2WHOA 3MAQA 2AX1A 4URSA 4J2BA 2Q3SA 2HMIA 2P1JA 3VQ5A 5KFNA 4EEYA 1WSIA 1JXBA 4OJRA 3THVA 4Q5VA 2FVCA 3TVKA 2AQ4A 4Q0BB 4NYNA 3IG1A 3FFIB 4N41A 1C1AA 4CJPA 3KKSA 4FZZA 1BI4B 4OPKA 4FJGA 2P5OA 3KJVA 4CIGA 1QUVA 4Y2AA 3HVTA 3F9KA 3HM9A 1KCFA 4CF0A 2G8IA 1RT5B 1TAQA 2YNFA 1IKYA 3OYNA 4E89A 1NJXA 2RDJA 5KT3A 1LW2A 1RT1B 3PR4A 4NLTA 4CECA 3GIIA 4Z4IA 1C2PA 4ECRA 2FBVA 1DTQA 1S9EB 1D0EA 5KG7A 2FVPA 3GYNA 4R8UA 3NL0A 2P5GA 4Q43A 4NZ0A 4KKOB 1RTDA 4Q8EA 4FCYA 3TI0A 4BE0A 3AVAA 1RDRA 3OYJA 3DM2A 1L3UA 1T94A 1XHZA 3OHAA 1JL1A 2RKIA 1T3NA 3ISNC 3TAEA 3CG7A 1N56A 1NK5A 2YHBA 3CDUA 3SFUA 4JRQA 1JLCA 1NKEA 3RRHA 1XR5A 4KO0B 1WNSA 1HMVB 2YV0X 1TKXA 4CJKA 4B9TA 3RAQA 3RB3A 5F9NA 4CEFA 3M8SA 2VG7B 4RU9A 4G1QA 4AILC 4TQRA 2C2DA 4B9NA 3OYHA 5KFXA 1KRPA 5FDLA 2X6SA 5DMRA 2BQRA 3DI6B 5KFHA 5KFPA 4CGGA 5KG0A 2OPRA 4TSXA 2HMIB 3T1AA 4AHRA 1R0AA 5HRNA 1RTHA 5F8JA 4E3SA 3ZSYA 4FJLA 4J9SA 2JGUA 3IG1B 4CFDA 4IFYA 4KRFA 1RYSA 4QCLA 3OYCA 3HVRA 3JSMB 3LZJA 1XHXA 3V6JA 3HVTB 4O3OA 3QEXA 4DTXA 3SUPA 3MEDA 2F8EX 3CJ4A 3PVXA 4W5NA 1T05A 2YNFB 1IKYB 4G3IA 3OL9A 1U48A 4MFBA 4KHNA 1FK9A 1CSJA 4PA1A 3KNAA 3VQDA 2AX0A 3I5AA 1DTQB 4CIFA 3MR3A 1X9SA 2UVUA 4ID5A 1RDCA 3SQ2A 2OPSA 3NGZA 1LW0A 2QV6A 1HARA 1RBSA 2XI2A 4M3XA 3BREA 1EP4A 3RB0A 4RW4B 1VSHA 4DL7A 4GMJB 4DTRA 5DG8A 4FLTA 2XGPA 3TAGA 5KFMA 1C1BB 3PJWA 1T03B 2RKIB 5F9LA 1B9FA 1KLMB 4DFJA 4IG0A 4ZP8A 3K5MA 2G8VA 3K5NA 5EU7A 2IC3A 4WYWA 4IG3A 4FW1A 2XGQA 4IRKA 3RR7A 3OLAA 5DGAA 1C0UB 4QOZB 4GC6A 1QHTA 1KLNA 5KFKA 1I6JA 4MK8A 1TKXB 3SQ4A 4FS2A 2BQ3A 2ZE2A 1WAFA 2EC0A 4ELUA 4G1QB 4UQGA 1LWEA 3OYGA 2YKNA 1TVRA 1S0NA 1WSJA 4PY5A 5FDLB 3O3FA 3MR5A 2G8HA 3U3YA 3ISND 3C6UA 4OKKA 4JRPA 1O1WA 3DDKA 2BRKA 3PO5A 5KFIA 4DMNA 4F2RA 2OPRB 3V81A 4KHWA 4K8ZA 1I39A 1CXQA 3HVWA 4LY7A 2PYJA 3H2LA 3OVNA 1FKPA 3KLIA 3OHBA 1N48A 3NH0A 5EWEA 3D0PA 3OYDA 2KQ2A 4F2SA 4J2AA 4IFYB 4M45A 3FSIA 2HNDA 5KG2A 1UA1A 4NLQA 3A2FA 4DTNA 4Y34A 1RAJA 4ELTA 5DQHA 4FLXA 1XR6A 4KAZA 3OYIA 4BDYA 1S0MA 1GX6A 2YHAA 2VA3A 1FK9B 4DU4A 4KV8A 4NYZA 4ECQA 3DLBA 2HHSA 4CEBA 2W9CA 3NF8A 2OZSA 3HT3A 2VG5A 3IAYA 4ID5B 2C2RA 4J9LA 1SUQA 3O4NA 3T3FA 3PV8A 4URGA 3S3NA 2OPSB 3Q8PB 4NLDA 1JX4A 3M8RA 3RTVA 3DLHA 5CY4A 4F3TA 1EP4B 4U6PA 4FJHA 3C6TA 5KFDA 4CK1A 4KHRA 4QWAA 3NGDA 4ED0A 4I9QA 3NAIA 2IC3B 3NAHA 4IG3B 3UIQA 4KHMA 5C25A 1KHWA 3KD5E 4OL8A 3KLFA 3V1OA 3ICLA 1EXQA 4N47A 3AVGA 3GV5B 1IH7A 3OL8A 4B9MA 4DL3A 2FJXA 3O3GA 4JV0A 3PX4A 4WXOA 1W9HA 4WXWA 4CCHA 3L8BA 2HHXA 3QNNA 3GQCA 2Z1JA 1LWEB 1U04A 3ZCMA 4ECSA 2IJNA 2YKNB 1TVRB 4NLXA 3V6DA 5SZTA 2G8KA 2W8KA 4E19A 3MR2A 2JC0A 4FJXA 5KFVA 4FLZA 3HL8A 3C6UB 4N5SA 2CKWA 3NH1A 4IFVA 3BDPA 1YTAA 3V81B 2R8HA 4DQIA 3T5JA 3TWHA 4K4TA 3KLIB 3TAMA 1JLQA 4PQUB 4RUAA 4KE5A 1S9GA 4CHNA 3BQ2A 2QKKA 3LALA 3H4DA 2HNDB 3QLHA 2DPJA 2ITGA 3GIMA 2QE5A 1S1VA 1U4BA 4MKAA 1ZBIA 4WFYA 4PUOA 3Q8QB 3MR6A 4WE1A 4FLVA 4B3OA 4DSJA 4J2DA 1BQMA 2AGQA 5KRSA 2ZD1B 4CEAA 3FRZA 4KV8B 2FVQA 4TYBA 4F8RA 1A5WA 3V9WA 3OL6A 1BGXT 4DL2A 4M95A 1QAIA 1XWLA 1SUQB 2XY7A 3V6HA 3PX6A 5HP1A 1UAXA 4M41A 4FJ8A 3K59A 5KFAA 4J9KA 2D0AA 3MXIA 2BANA 3CM5A 3C6TB 4H4OA 4FZXC 1BL3A 5L1IA 2HHTA 4K4ZA 3NCIA 4Y1DA 1XR7A 2HVHA 3RWUA 4MK9A 4KHSA 4FK0A 1C1CB 4K4SA 3SV4A 2R8JA 2B5JA 3MEGB 1EX4A 3VA0A 5DK5A 5KT7A 1J54A 3KLEB 1I3AA 1S1UB 2Y1JA 1F21A 3AVIA 4GVMA 5FROA 3V9SA 3V6DB 2BR0A 5CZ2A 3M8QA 4BDZA 4FJ9A 4B8CA 3VN5A 1J5OB 2PYLA 5HBMB 4LQ9A 3CDEA 3PR5B 1JIHA 5EWFA 4O44A 2HB5A 4CFCA 2BDPA 1MU2A 1JLQB 2FJVA 1S1TA 4CFAA 4NLRA 5E41A 4I2PA 4BE2A 2ZQBA 4FW2A 3P1GA 3AA4A 3KOAA 1RT3A 1S6PA 2W7PA 2IGIA 1HPZB 2HVIA 3H5XA 4YR0A 2HNZA 5KTQA 4PUOB 4B3OB 1FKOA 1BQMB 2FBXA 1RDAA 3LAMA 4WZMA 1NK4A 4HUGA 5KGWA 1HQEA 3K58A 2WONA 4QAGA 5J1EB 4E1NA 4E7IA 4CGFA 4BE1A 3TAFA 2JC1A 4OGEA 2FC0A 3GIJA 4FBUA 2R2TA 5HLFA 1CZ9A 2BANB 2D41A 4DEZA 4TY8A 3Q8RB 4ED6A 3HPHA 2W8LA 3KIOA 1OS5A 4DSKA 5F8NA 4QWCA 2C22A 2RF2B 4MQ3A 5C24B 3V4IA 2O4GA 2B5JB 1D1UA 4ELVA 3DOLB 2XCAA 4M3WA 2D3ZA 4DSFA 4F4YA 4CIEA 3LP2B 4M3RA 2BRLA 3SZ2A 1HQUA 2X6NA 1TKTB 4L8RB 1SL1A 3AA2A 2RPIA 3G6YA 3TANA 1UWBA 2J6TA 3QEIA 3CFPA 5CZ1A 1ZBLA 3ZT2A 1TV6A 3BSAA 3TARA 3AVKA 2WOMA 3PX0A 3FQLA 1MU2B 1K1QA 4FK2A 1S1TB 4I2PB 4ICLA 1RT4B 3CFRA 1XI1A 3SUNA 3ZSOA 3HPGA 1S10A 3OLBA 1W25A 2BE2A 3M9NB 2KFNA 4URQU 1CXUA 4LH4A 2HNZB 3SUQA 3VQSA 4IRDA 2X74A 1DTTA 3KK2A 3H5SA 1N6QA 4DTMA 3DOKB 3UQSA 3VQ4A 4ZVGA 2UVWA 2A1SA 3PY8A 4ZHRB 4NLVA 2IM3A 3BGRA 1HQEB 4J9PA 2WONB 3DYAA 1X1PA 4DTSA 1SKWA 4CJ4A 3GILA 3KTQA 4GW6A 4FS1A 5J2NB 4MKBA 3H4BA 4K4YA 4QWDA 4FM2A 2RDIA 4KREA 1NK0A 2V0NA 5HLFB 1S49A 4MK7A 4TY8B 1Q9YA 4O3QA 5KG3A 1NKBA 4DS5A 1TK8A 1RBVA 3D28A 4EBCA 3QYYA 1JKHB 3HXMA 3DLGB 2FVSA 1ZBHA 1ZYQA 2A1RA 1RT7A 3JYTB 4BDPA 1RILA 4F4WA 3LWMA 3MEEA 2KZZA 3E01A 2X78A 3HP6A 2O5DA 5KFYA 4ZVHA 4KBIA 4IBNA 4ECUA 3M9MB 4DSEA 4LSNA 2R8GA 3TAQA 3OJUA 4HYKA 1SV5A 4ECVA 4CFBA 2XRIA 2IBKA 3VQAA 4XPCA 3IRXA 2I5JB 5KG1A 1XC9A 3RRGA 4Z4GA 1TV6B 4E7LA 3M9OB 2WOMB 4OPJA 2V4QA 2I1RA 4TXSA 3WNGA 1KVBA 3PO4A 4ICLB 5KG4A 3OYKA 4O4RA 4Z0UA 4CHQA 2BE2B 1BIUA 5I42A 4M3ZA 2VA2A 2IM0A 4DQQA 4IOBA 1N6QB 3KJVB 2D0CA 3ALYA 2B6AA 2E4LA 2YKMA 2ILYA 2NUBA 4IR9A 3I5CA 4W5QA 1RA6A 4DL5A 3DYAB 4H4MA 1LW2B 1JXLA 3OSNA 2V4RA 3DRRA 5JXSA 5EDWA 4F3OA 4R8UB 1SH0A 3NBPA 1RBTA 1IKWA 3OYEA 1RTDB 4CJTA 3RMCA 3I0SA 2HAIA 4ZTFA 4CGJA 3DM2B 2WK4A 3RMAA 1KFDA 2DFFA 1HYVA 3EPGA 1S1XA 4QW8A 2EX3A 1T7PA 2WTFA 2XHBA 4AH9A 3H59A 3E01B 3QZ8A 1JLAA 3NF9A 2OH2A 2ALZA 1WSHA 3AVBA 3QIDA 3KKRA 3H98A 4DFMA 5KFRA 1JLCB 3OS2A 5DQIA 1KTQA 3SPZA 4DG1A 4YR2A 4ED2A 1TKZA 1C0TA 2D0BA 2IAJA 1NK8A 5L9XA 4E7KA 3VQPA 3RMDA 3NE6A 3KLGA 3SQ0A 4B9SA 3ZSRA 3MTKA 3O3HA 1LAWA 4BACA 1VSIA 1TL1A 4RG8A 3L2UA 3QESA 3SI6A 4X2BA 1GX5A 4RNOA 4H54A 4WYLA 3N6LA 4TY9A 4E1MA 4JS4A 4MH8A 4CJVA 2HHQA 3OYMA 3ITHA 1R0AB 4N56A 1RBUA 1RTHB 1LV5A 1S4FA 1TK0A 4HKQA 4DF8A 1NK6A 3LP1A 3HK2A 3G0ZA 3VA3A 3PW4A 2B6AB 1IO2A 1VSMA 3MEDB 3H5YA 3PW2A 3NDKA 1T05B 4MFBB 4J9RA 4H4MB 1ZBFA 2IM2A 3OL7A 4TLRA 1JLBA 3NF6A 5KFZA 4W5RA 1WSFA 3OYBA 4F4KA 1HJRA 1LW0B 3H40A 3DLRA 3LP0A 5J2QA 3I0SB 3FDSA 1QTMA 3IN5A 4NCGA 4CHOA 4CJSA 1U09A 1RTJA 3GV7B 3OYAA 4CJLA 5KRTA 2OZMA 3OYFA 3IS9A 1YTUA 4IG0B 4ECWA 5KG5A 3QGGA 1JLAB 3C95A 5C5JA 1FXXA 3OS1A 4RNHA 1IKVA 1N5YA 1RTIA 2D7SA 4NLYA 3G6VA 3CFOA 3ZSZA 2JLEA 3DLEA 4RNFA 3D5MA 4DG1B 2R8IA 4CHPA 1C0TB 2ZE2B 3FQKA 3T5LA 2IAJB 3DRPA 4F4ZA 2UVVA 3L2RA 3PUFA 3KHLA 4QWEA 1RDBA 3RMBA 2R2RA 3QIPA 4B8AB 2BGGA 1TL1B 3T5KA 2DY4A 4IKFA 3SV3A 5F8HA 1D9DA 1U49A 4IRCA 4KSEB 4Z4EA 4FBTA 1TK5A 3ITHB 3WNHA 1RT2A 4HUEA 1FKPB 3CJ3A 1EETA 1YVFA 2R7YA 4AHTA 1VSKA 4EYIB 4HCBA 1VK0A 2XI3A 3KK1A 3BSOA 3MXJA 2GIRA 5KT5A 4CK2A 2G8FA 1MMLA 5J2MA 2KW4A 4CJ5A 1S9FA 4Q44A 1U47A 4ZVEA 3V9XA 5KFEA 1C0MA 3TQ1A 4FJ7A 5SWMA 3ZT1A 2W9CB 1JLBB 4M3TA 2VG5B 2R2SA 4EYHB 1VSFA 4TQSA 4CJQA 4ECTA 3HVAA 3LP0B 5J2QB 2XCPA 4NLWA 4NRTA 4NCGB 4DFKA 5KFJA 1QS4A 3NH2A 1LWFA 2ZKUA 3Q8SB 3KLHA 4IR1A 3LWLA 4YFUA 2FLLA 4CJFA 1X9MA 4O55A 2XY5A 1EKEA 1JLEA 2UUTA 2W9BA 2IMWP 1D8YA 1ASWA 2OPQA 5CYMA 3I8DA 3G10A 1VSJA 4CJWA 1Z25A 4IH7A 5L1LA 1ZETA 5C25B 1ZTTA 3KLFB 3T5HA 1N5YB 4DQSA 3DLEB 4O3RA 3H08A 3HO1A 1IG9A 2PZSA 3SNNA 3T19A 3IGNA 5DLGA 3BJYA 3P5JA 3LZIA 3DRPB 4B08A 1S6QA 2HWHA 2XC9A 4I7FA 2VWKA 1NOZA 1BCOA 3K57A 3ASMA 3S3MA 4CGDA 3HHKA 3S9HA 3AVCA 2FLNA 3OJSA 3ZSQA 4CERA 4IFVB 4KTQA 4O0JA 3QEVA 1VSEA 3ULDA 3SJJA 3BQ1A 2IOCA 4N76A 2AGOA 3TAMB 4RUCA 3AV9A 1BCMA 1S9GB 4M3UA 1HNIA 5DG9A 4C8KA 5F8IA 4RW7A 3QLHB 3OYLA 4RW9A 4IDKA 1S1VB 2GUIA 5D3GA 1NHVA 5T14A 4FJIA 2B4JA 1Q9XA 3LPUA 4WE1B 3AVLA 4ED7A 1QQCA 3V9ZA 1JLGA 3RR8A 4O3SA 2YNHA 5F8GA 1BI4A 1D5AA 4LH5A 5K14A 5HP1B 4RNMA 3BR9A 3MFIA 2E6LA 4KTWA 2GBZA 4FVMA 1LWFB 3KLHB 1UA0A 4H4OB 1RT5A 3DRSA 4NLGA 2HHWA 4NRUA 1S1WA 2OPQB 5HRRA 3QETA 2HHVA 4M3YA 4RZRA
chains in the Genus database with same CATH superfamily
3LANA 2GGPA 1L5UA 2I6WA 1VQYA 3GIKA 1BHNA 1NGCA 5DM6L 3FZHA 2ZH7A 3J80U 3J80Y 4BCAA 2M52A 3BZKA 2W4DA 1HWKA 1H7WA 3MM5B 1SL2A 5F41A 1Q86T 4DR7F 4ZTJA 4J2EA 4KHYA 5AE2A 5CH7B 2N4CA 3HHNB 2F4FA 4NYPA 3DMJA 4CHZA 3Q7BA 3ZT3A 4JI0J 1R8PA 3NS5A 4DTJA 3H90A 1RT3B 1RWKB 2BBEA 1LK7A 2UUCK 2WCXA 4M8LA 1U45A 2UXBJ 1OYEA 4CZMA 4N8OA 4CJRA 3OS0A 4ED3A 4FYXB 1PO6A 1RCHA 1WWHA 1WC5A 2CFXA 2LQBA 4HEA9 4MIWA 3VQEA 2LQJA 1A0OB 1CEZA 2GNKA 1BLUA 4G65A 3LAKA 5CYQA 1YF5L 1QAJA 1XNQJ 5EVZA 4ILMA 3V1QA 4W4MA 2AJ4A 2BX6A 2Z1HA 5LOQA 3SLCA 1VLYA 1UFLA 4QWBA 4F04B 3ID8A 1YT3A 3CCJN 3AD7C 2DNNA 5B08A 4CIOA 4DUZK 8ATCB 3IRWP 3O9QA 4CJ3A 4IO8A 4MIAA 2G8WA 2UP1A 2QMWA 5KQ8A 1BHLA 1RNHA 2NZCA 4F4XA 2P51A 3EM1A 1HNVA 5I3UB 4FF1A 3FBBA 4TYAA 2OANA 3O9RA 4GKJK 3DXMB 2HIQA 4JB8B 2V68A 4CEZA 4D3HA 1C1BA 3QEWA 4LF2A 1KLMA 3W66A 1BY9A 3QINA 1LK5A 1F5CA 1FRXA 1BWFO 3O4QA 3O8MA 5J1PA 2HHHK 3TZWA 1PC5A 3CERA 3MXHP 4IOCL 5G4DA 4NLPA 4DQRA 2MQLA 2BTFA 1REVA 2MKIA 3NGIA 3MM9B 3ZTPA 1UWAA 4PG7A 2RRBA 3H5UA 2HG4A 4MIBA 3V1RA 1VRUB 4O4GB 2KO1A 2JEJA 2K3IA 1Q5VA 4DR7J 3R5CA 4CZLA 4B02A 3QIOA 1J9AA 2B7BB 3L2WA 3DNCA 4DL0C 4IJNA 1GLBG 2NS1B 4OZNA 5HMXA 5J2PB 4ECYA 3CJCA 3FK4A 3FSYA 4HHJA 2YNGB 3BQ0A 1UL3A 2XO6A 3THWA 1VQ7S 3OSPA 1CJVB 4Y1CA 4EP5A 4DTUA 2GQ2A 3QRPA 1A5VA 4LFCF 3N6MA 5EN1A 3ZNUA 2GS8A 6AT1B 4CEOA 4RWWA 3HJFA 4H5VA 1RHMB 2FVRA 3MAAA 3NXZA 1OMSA 4DDFA 1DRZA 1MDUB 1FD2A 1YDLA 1NSPA 2G8UA 3GTYX 2Z2MA 4EZ9A 1ZAVA 3CCUS 2IA6A 2KG0A 3CJTA 1HHTP 1GMUA 2Q6CA 4NLSA 3WEEB 1GMWA 2BV3A 1REGX 2NYIA 3P5TL 1BIZA 4YDDB 2NXCA 4WWSA 1SV5B 4FJMA 1UEVA 2CPEA 1UETA 1NGBA 2EG1A 4AXJA 3OTOK 1BWEA 3IRXB 3EJMA 5KGXA 4PPZA 1LFPA 4JV5F 1EARA 4FF3A 1FRHA 2BM1A 1B9DA 3MK6A 4Y3CA 2F9DA 2ZZNA 3R5DA 5KT4A 3HX9A 3V9UA 1NOYA 5IT9O 2NRXA 2ILZA 3UPFA 2W25A 1KVKA 2RU9A 2JWLA 2AIRB 4RW6A 3RBZA 4A8OA 3UW1A 4DR5K 5ELZA 4MAKA 4FYWB 3NBPB 4ZA1A 3CWJA 1U24A 1ASUA 1J53A 4DPOA 4OYXA 4FXWA 2EFQA 2B8PA 3RW6A 4ZPCA 1HWUA 4HH0A 2J7KA 4BC5A 5AXLA 1ROFA 4NCBA 3VEXA 3VV2B 1SKSA 2OEJA 3EXYA 5AQSA 2D0PA 1TKZB 3H3OB 2XEXA 4FK4A 2FHJA 1ELOA 5JVGQ 1RTZA 3KLGB 1HI8A 4OZLA 4CO2A 5JJBA 4WP8A 3ET6A 1HD1A 1XNRF 4XH4A 3UN5A 2NRWA 4BR0A 3MEGA 3JTNA 1OH7A 3WX4A 3MUTP 4QQBA 1KVCA 1PJ5A 5GAHU 1GLCG 3VGSA 1T3OA 2OHDA 3R7BB 1TUYA 2ZGZA 3O6WA 4FLUA 1WBDA 3PNIA 4FLWA 5HRSA 4OPHA 4YOYA 4M5MA 2NRRA 3C65A 2UZAA 3SCXA 1PKUA 4JLHA 3MECB 2YKOA 5HBMA 5CYJA 2QT7A 4KIAA 2JEIA 5KFFA 3FMWA 1RGVA 2FSNA 3JS6A 3L3UA 2P9PA 5C10A 3I0RB 1WHXA 4DZDA 5KAKA 1WOQA 4JV5J 3BGFA 1U1LA 3ZTRA 2YQ3A 3PYFA 2QG9B 3K9KA 2H54B 3PW7A 2HNYB 2BUNA 2A1BA 1IJEB 1FNXH 2CZ4A 2YJEA 3DLKB 1M90O 4JV2A 2CGJA 3C14B 3OR2A 2FGCA 1GLLO 1SL0A 4QPXA 3CGIA 3RB4A 1WEXA 3DLLL 3QO9B 1HPMA 1TKDA 5A8WB 3BZQA 1NUEA 3ENAA 4JI0K 3VQ7A 2R7TA 3AVJA 2DR5A 2DT9A 3OTEA 4HT5A 4ZLJA 2MY7A 4PWUA 3QIPB 1J6ZA 1EQYA 3I96A 1HYSB 4MT1A 2NSBA 2V50A 3DOLA 2AD9A 4LF9F 2J6UA 2ZOFA 3U6FA 3P45B 1KDNA 3LP2A 1VS3A 1IUJA 4DSLA 3R9LA 3HPOA 3OPKA 5M1NA 1WG1A 1XNQK 4FXDA 2PEBA 1OYDA 4HTUA 2NXJA 2HBYB 1S59A 4A61A 1S0VA 3T1HF 2BM0A 3TNVA 5KFWA 3D2EB 1XNRJ 5EHHA 3M8PA 3VQBA 1YJTA 5AQJA 2W2NP 1YRTA 2BUPA 2K1RB 3D66A 3VQQA 4KPYA 4FZYA 4USIA 2QMXA 4QIEA 4Q0BA 1VQON 2RS2A 4WFAQ 3FFIA 3K2PA 3P49B 3RB6A 1E6YB 1FNMA 2X7IA 4A8XA 4ZHRA 2J6SA 3SPYA 1L3SA 2RRAA 2EW9A 2W9BB 1HBUB 4I0WA 1HQ2A 5CYMB 3L9ZA 4CWBA 2V52B 3A5LC 2IM1A 2EHGA 2MB0B 4K7QA 1NK7A 2GHWA 2KFZA 1FNOA 1T8EA 5D0HA 1RA7A 3JXOA 5BPMA 2I7PA 2D9PA 3LGMA 3JSRA 3MCNA 5EUHA 2OA8A 1P90A 4CEDA 3DLGA 3QBXA 1U6FA 3KZBA 1RWOB 3JYTA 1DLOB 4OZ5A 3RBXA 3D68A 3BSCA 2K3KA 4AT1B 4LBIA 4ES2A 4I6MB 5DZ6A 2MQQA 2M8DB 3AA3A 4J9MA 3MM6B 2VODA 3RBDA 4E1JA 3CQ8A 5BPLA 3MMBA 1BQNB 3MF5A 2OPPB 2W7OA 4OLBA 4UZBA 2E9TA 1UVKA 2XG8A 1T0TV 3QERA 1VK3A 1X5PA 2WHOA 5D4NA 4LF9J 3NCPA 3RYLA 3EVWA 5KFNA 4EEYA 1WSIA 3HSZA 2PMZD 3EE3A 1WC1A 3QGPA 3DHXA 4NYNA 2CQ0A 1C1AA 4OX7A 4OMFG 4KQZA 4OPKA 4CH1A 3KJVA 4CIGA 3BDEA 3HVTA 3T1HJ 1CLFA 3CCSN 4YY3J 5A8KB 2E1RA 1RHRB 2B51A 1LW2A 4Z4IA 2FBVA 3CMES 1DTQA 1S9EB 2IVPA 1K8KA 5LY3A 4R8UA 4Q43A 4NZ0A 2E29A 4PKHA 4FCYA 4BE0A 3P38A 3HHDA 3MX5A 4AFFA 3I8BA 3DM2A 1L3UA 1VQPN 3TRGA 3OHAA 2RAQA 1T3NA 3ISNC 2ZH2A 2PO4A 1JJ4A 4CLLA 4WBFA 3WXLA 1JLCA 4QS8A 1NKEA 2PMWA 3F41A 3H1QA 1WNSA 2IVMA 2YV0X 4Y0FA 4H4KA 3AXKA 4JYAK 1APSA 5F9NA 2VG7B 2QN6B 1KAYA 2H5EA 2CWKA 5FDLA 2X6SA 4Z7YA 1U26A 2BQRA 4MYTA 5KFHA 4JI7F 1SQFA 2HGMA 4B3TF 3G71S 3QFUA 1QQOA 2HMIB 2RQMA 4C8YA 1WJ9A 4H0TB 5MLCV 4EHUA 4FJLA 4CFDA 4IFYA 1ZOTA 2EC2A 4QCLA 2YHWA 5AQVA 2WW8A 1ZA1B 3V6JA 5H9EJ 3QEXA 2CIMA 2XMAA 4W5NA 4I64A 3CC2N 4PZVA 1KQSM 3SSSA 4ETZA 2AX0A 3I5AA 3MR3A 4RWXA 4C8ZA 1HW9A 2OPSA 1U1RA 4CYUA 3QRRA 4M3XA 3BREA 1EP4A 3UFCX 3RB0A 4UOCA 3L6QA 5AQPA 3H7HB 3H2VE 4DL7A 3TAGA 1Q7LB 5KFMA 1C1BB 2RKIB 1VBKA 1KLMB 4ZP8A 3K5MA 2EKNA 4F25A 4FW1A 2XGQA 4FVCA 3RR7A 3OQ2A 5DGAA 3GP9A 4K2JA 3PIOQ 3UD3P 1KLNA 1NJIO 1I6JA 4I68A 3SQ4A 2FJEB 3N9UC 4JV5K 3BN7A 4CH0S 1V4TA 1RBLA 5AT1B 1H98A 4ELUA 3CCJS 1BE4A 1TVRA 4PY5A 3MR5A 3U3YA 2KKZA 4WCEL 3C6UA 4L3KA 3WQUA 1HWJA 4CM0A 3IR6B 3DDKA 3G8SA 3KWMA 4WP9A 3VEWA 2XZDB 4K8ZA 3C3LA 1I39A 1CXQA 3H2LA 3UKUA 4PXEA 3HSDA 4CO4A 3AA8A 3OHBA 3NH0A 4JN4A 3THWB 1BG3A 2HNDA 1UA1A 2I2YA 1SPBP 3AB4B 1R43A 4CLTA 3V4MA 3FEYB 2R42A 1N52B 1UZDA 3FRYA 1C0FA 5DDRC 4K8RA 1JMTA 4DU4A 4BG9A 3GFHA 1Q81T 3MAAB 3S8SA 2GO9A 4M7YA 1FO1A 3A3NB 5BRFA 4L73A 4ZKAA 1UP1A 3ZETA 2C2RA 3K89A 3PV8A 4URGA 3RSEA 3S3NA 1BXNA 4U7UK 3RTVA 3HOTA 4Z94A 4FJHA 4Y28C 2HZVA 2Q79A 1M5VC 2JVOA 3PSIA 2IC3B 1KXPA 4KHMA 1CPZA 3KD5E 1H7XA 2KFYA 2BOAA 2LEPA 3HT0A 2P9GA 4BG8A 2KDOA 3OL8A 4DL3A 2CA9A 4DV7F 2D69A 5GAEU 4WXOA 2K7KA 3QNNA 2AMCB 2HBRB 1LWEB 3ZCMA 4BC4A 3OFHA 2IJNA 2YKNB 4DV0F 1IV0A 1X4EA 5SZTA 4E19A 1F0XA 3MR2A 2M88A 1S6UA 4FJXA 1O0PA 1HKGA 5J1NA 4PKGA 1JWWA 2GIFA 2AYGA 1YTAA 2R8HA 1IVZA 2Z56B 4NXNF 3WXIA 3TWHA 1CZAN 5CQGA 3HTVA 3CC7N 3TAMA 2MKCA 3I4HX 3OVBA 4QR0A 2FQQB 2QKKA 2VHGA 3ETMA 3H4DA 1ZM9A 1VQNS 2EK6A 2ITGA 2QE5A 5JLHA 1NM1A 3SSQA 4MKAA 1E4FT 1ZBIA 3Q8QB 3MR6A 4DR6J 2ZJPQ 2P9SB 4FLVA 2B9YA 2PMHA 1DQ8A 2EBGA 1NGFA 2FVQA 4YHHJ 1NZ8A 3EL2A 1A5WA 3V9WA 1F2HA 4DL2A 3M32B 1SUQB 1EWRA 5KPZA 4BBYA 3EXCX 4J9KA 5E3RA 2D0AA 1A7GE 4H4OA 4DPTA 3C16B 1VQ5N 2HVHA 4HWIA 1VYAA 3HZGA 5HQLA 4FK0A 3W9HA 2QL5B 4BY9C 3AODA 3MEGB 3D67A 4NMLA 1OSDA 4DN9A 3JAMU 4HH1A 3JAMY 5KT7A 1XMOJ 4CLPA 2B9WA 2PBDA 3LM9A 5AXKA 4GVMA 5GADI 5FROA 1UAWA 4BDZA 4FJ9A 2NLWA 4B8CA 4JKCA 4FKXA 3T1HK 1N36F 5HBMB 2DH9A 2MQ8A 3PR5B 4YY3K 1ZH5A 5EWFA 5BRHA 3U1MA 2HB5A 3W2WA 4DPXA 2DHAA 2BJ3A 1MU2A 1JLQB 4CFAA 4NLRA 4DV7J 1H38A 5KOWA 2A10A 2ZQBA 4FW2A 3AA4A 3J80O 3OR1A 1WC6A 2IGIA 1MWKA 2XYPB 3M2VA 4DV0J 2HVIA 2JOQA 2Q2RA 3GG4A 3J7AN 2EWHA 2XMJA 5KGWA 3EEQA 4E7IA 4CGFA 1F5AA 1RI7A 1YZ6A 2E1AA 4FPAA 4DR2J 1KTVA 1PAUB 2E88A 3T7ZA 4M63C 2HKEA 1NGDA 2EKYA 3FGUA 2W8LA 2ZOMA 3O80A 1NDPA 2C22A 1HBOB 4L74A 3DOLB 4M3WA 4BRDA 4DSFA 3GJTB 3MMAA 2R7QA 2VOPA 3DRXA 3LP2B 4M3RA 3D1HA 4C4WA 3MPYA 2DNKA 4CTAA 5H9EK 1UWBA 3J81U 2QZ8A 4Y2KA 3J81Y 3BF1A 4DCHA 5EX5A 3TARA 8AT1B 2PE8A 4IDHA 3S7RA 3IWNC 3ZZPA 4RBVA 4LFBF 3SIPB 4BRAA 1Q86O 1AROP 2J7UA 3GR1A 3OFFA 5E3CA 2KFNA 2LFVA 1MN9A 1CXUA 4H5TA 2HNZB 4X62F 3THXA 3PG9A 2A1SA 3CCVS 1U25A 2FHMA 1N36J 4ZHRB 2NLXA 4NLVA 1B99A 2IM3A 3D0GE 2W41A 4AL6A 1NMEB 1SKWA 4L75A 4CJ4A 4H0VB 3FCVA 4HTIA 4FS1A 2C2OB 2GJIA 1W2BR 3ZZYA 4IOAQ 2BA9A 1AUSL 1UEKA 2V0NA 2FF6A 3NMUA 2L3MA 3TA2A 1ZS6A 5KG3A 5B0DA 3DGPA 5CCLA 3HXMA 3DLGB 2FVSA 5DJBA 3AAPA 3JYTB 4ZLNA 3CJKB 3UR3C 3TJ8A 4NXMF 3CC4S 3E01A 5IQ6A 2KL8A 3M8WA 4BC9A 3CQYA 3LO3A 1EQ0A 4IBNA 5LM7E 2BJ9A 4LSNA 3B8HA 3AXMA 1Y4ZB 3MM8A 2FF3B 4YB5A 1XK8A 3VAJA 3MMBB 2J0XA 2XRIA 4TU7A 3VF4A 2RHSB 4XPCA 1KP6A 1YJRA 3SBTA 5AZIA 3AD9C 3KDOA 5A8RB 2ZZMA 2LCWA 5KG1A 4CRJA 4Z4GA 3M9OB 2WOMB 2I1RA 3WNGA 1KVBA 2B9EA 4ICLB 3OYKA 1PBUA 2P5VA 3P6YC 1KQKA 2KT5A 4CHQA 4Z37A 2OIHA 5F1XA 2LXIA 3BBFA 3PACA 4M3ZA 3QJPA 2HVZA 4DQQA 3W7BA 5RUBA 4IOBA 3KJVB 2D0CA 1HKBA 4DHVA 1XN9A 3BP8A 4JOUA 2DNOA 2FSJA 1LW2B 1JXLA 4O23A 2ZHBA 4YEAA 2LMIA 5EDWA 4HT7A 4R8UB 4OJ1A 3CCLN 3RUBL 5HSPA 4X62J 2AZ3A 4BRKA 5AXNA 4CZHA 3DM2B 1Y5IB 1HYVA 4NL5A 3I4PA 5H9FJ 3U02A 2FXUA 1T7PA 2XHBA 4AH9A 3H59A 5EGYA 2P9UA 3KKRA 4LF5F 3G4SS 8RUCA 1JLCB 1X3MA 4J37A 3QT8A 2ZH8A 3OS2A 3WXKA 3VVUA 2XBPA 2WBNA 1FXRA 4LF4K 5B0BA 3BEGB 3VQPA 2V4JA 5DDQC 1WBBA 4N77A 3MTKA 4CD3A 4DR6K 1S3XA 4YS2A 1LAWA 4BACA 3L2UA 2ITMA 5L9NA 2KN4A 4NXMJ 4AQYF 1GX5A 4RNOA 4YOVA 4H54A 4YHHK 5KQDA 5AQUA 4WIQA 3PLAA 4MH8A 3OYMA 4N56A 5HQMA 1VR6A 1N34F 1LV5A 3GOIA 2MPUA 4U67Q 3J81j 2RDDA 3BB5A 4DV2F 4KC5A 3HK2A 2H3GX 4LRCA 3GCXP 1RSCA 1WEZA 1CVJA 2B6AB 2GA7A 1ITPA 3ILJA 7FD1A 3PW2A 4WQ4A 3EZWA 3E3XA 4LF1A 3TQEA 2IYIA 3VQTA 4H4MB 4NEYA 1T9WA 1YLXA 3OL7A 2W40A 5KFZA 3CUNA 3J7Z5 2VL1A 5BR9A 1K73T 1XMOK 4M5DB 1WSFA 3OYBA 2DNRA 3H40A 5FPDA 5J2QA 3FDSA 4YOWA 4I69A 1FJCA 2KYZA 4RL1A 3TEHB 5KRTA 4H0YB 1X60A 1GMWD 4Y6IA 2NRVA 4BR4A 3IS9A 1YTUA 4ECWA 3VZHA 5KG5A 1JLAB 4JI3K 4ZIWA 1RLDA 4HDHA 2ZM6F 1DY3A 2YBVA 1N5YA 2LDYA 1RTIA 2GQQA 4NLYA 3DLEA 1GXUA 4DG1B 3UWTA 2ZBRA 3T5LA 4FWRA 4F4ZA 1HNZJ 2ZUGA 2UVVA 3SAGA 3KHLA 4QWEA 3FBCA 2R2RA 4DKWA 3J7YI 4YOEA 3GU0A 2ZITA 2H9ZA 4IKFA 4FF2A 1BOTO 4JHDA 2CNOB 1U49A 4H5RA 1N54B 4WF9L 3NNAA 2VIHA 3CJ3A 3F56A 4DR2K 1R3NA 2R7YA 7FDRA 2VDIA 1VSKA 5IWAK 4EYIB 1H1VA 1X4DA 2ROPA 3BSOA 5G0RA 3CDBA 2PD1A 3PYEA 1Z1ZA 5J2MA 1SC4B 2KW4A 2ALYB 2OAUA 1U47A 3IAM9 2XS7A 4FJ7A 4I6WA 5SWMA 4NYOA 1JLBB 1SCJB 1N34J 3ZETB 5ITHA 3T6BA 3RSEB 4TQSA 1U2FA 2HZCA 2FUG9 3THYB 3VAIA 3F44A 3NLCA 2XCPA 4J91A 4NCGB 5T41A 2GWKA 3HJVA 3Q8SB 3KLHA 1VQLN 2QLBB 4F36A 4CJFA 1WDDA 4O55A 1EKEA 1JLEA 4B1WB 5GADU 1WF2A 1U02A 2FHJD 4DHYA 5C12A 1LWXA 5GINA 1T9YA 3UE5A 1EAYC 1FXLA 1WDTA 3FZBA 3SCKE 2NZ4A 2XZTB 3HO1A 3K0SA 3MOJB 4P73A 4KBOA 3QJJA 3P5JA 2Q31A 2CXEA 1BCOA 2QFIA 4H0OA 1R8CA 3ASMA 2LEAA 3SK3A 3HHKA 1PJ7A 3ZSQA 4F0KA 2FGOA 4CNYA 4ZDNA 3ULEB 4KTQA 2RQCA 2ZM6J 4O0JA 4QPTA 4OZJA 3ULDA 4OYIA 1YJNN 2KU7A 2IOCA 2VFSA 3ENHA 3TAMB 1S76D 2QWRA 2X3GA 5DG9A 4RPFA 3UCUP 4I1TA 3OYLA 3IWXA 5D3GA 1NHVA 2A3JA 2B4JA 3LPUA 4KT0C 1MWQA 3QAEA 2EFPA 2ABYA 1G3OA 3Q22A 5BYSA 2B3TB 3KG4A 3HD1A 1Y9OA 1JLGA 2KT3A 1KN6A 4X84A 1NBWA 3GG1A 5K14A 3NCRA 3MFIA 1QAYA 2C2MB 1KQFB 2E6LA 4KTWA 1LWFB 4H4OB 2Y9HA 1RE1B 1RT5A 5FJ4A 5B0AA 1S1WA 2AZ1A 2MGZA 3A8JA 2BE9B 4JUZA 5F3ZA 2ZC3A 2U2FA 4ED8A 4E7HA 5IQQA 1S6QB 4I7FB 2V7ZA 3C8YA 4CZEA 1P1LA 4W5OA 4CK3A 2POKA 3A3OB 1AW0A 2WBRA 4NLOA 4OLAA 4DSIA 1TAUA 2JEFA 4DTPA 4LFAF 2QWLA 2Z1GA 3W2WB 4KO0A 1WC4A 5AZJB 1EX8A 2ZJQL 2ERRA 3EZOA 4DV4J 3NVKA 4CESA 4C8LA 4ZCLA 1HNIB 4RW7B 4X4VA 3D7EO 1RWUA 2NSCA 1YX2A 2QYCA 4IDKB 2ZNYA 4DX6A 2QFJA 4WFBL 3M2VB 5EOYA 1EZZB 3KD1E 4IH6A 3W61A 3DC2A 1RYRA 4HCCA 3BGUA 5GMKa 3TP2A 3U9DA 2GFFA 5H9FK 1E4GT 2G4BA 3BPSP 2BYCA 2YNHB 4MO4A 4RNNA 4FWMA 2DFEA 1CQMA 2HFZA 3JSMA 2NNWA 4UOHA 1BA0A 4YORA 3I32A 3DRSB 1VQ9N 2GV9A 3KMSA 4ECXA 2CVEA 4DV6F 1F2GA 4BRFA 4A8QA 2MHEA 3WNEA 4NXMK 2BJEA 1N4LA 3W3DA 3CYMA 2WB4A 3AA5X 5C2DA 4G6VB 1GLEG 3VALA 2LDIA 3OXFA 3CCRN 2FLPA 3DDIA 3KG1A 4RW4A 4K0KK 1YITS 2B4OA 2V2VA 4FYVB 3R2CJ 4O8UA 1KD1T 1NHUA 4RW8B 4EO8A 4BR9A 1UWBB 3VQ9A 1HL6A 4J7CA 4M5KA 3K0JA 1RWWB 1ZAXA 3VESA 2J9CA 2GIQA 3TABA 4EP4A 2O4IA 1QE1B 4AHSA 4HI1A 4I2QB 1VFJA 4KFBA 2Z1IA 2W01A 4AYBD 5IT4A 2BH1A 3RBEA 1XEZA 3HLUA 5BYQA 3WNFA 3MXMA 4FPBA 3HDSA 1VC0A 4M5JA 2G2YA 3PCOB 3WHIA 1L3VA 4KB7A 4R5PA 4OLPA 2OELA 4B1ZA 3Q23A 1VBYA 2WVFA 4LFAJ 3L2VA 1SIZA 4J9NA 1SJFA 2JFDA 1HWIA 3EDQB 3L7UA 3LPTA 2Y1RI 2XHCA 1HNZK 1TL3B 1RU2A 3DGPB 3EO3A 3MWBA 3M6GA 2MEWA 1H2UX 1U0HA 4JI8F 2DBBA 2C3MA 3FJ2A 3KK3A 1J2VA 4WIIA 4BWMA 1K1SA 2MMYA 1ULRA 3MN6A 2YWGA 3FZKA 4UOGA 2VG6B 4LSNB 1LXJA 2XYHB 4B9UA 4XPEA 4F02A 4A5AA 5AZIB 4DV6J 5L38A 3GV8B 2OYQA 3LGNA 4DQ8A 1QDUB 4ISGA 4C11B 1A5XA 3HFKA 1XERA 5JVHQ 3IFRA 5HROB 2CNLB 2QWOA 1S5JA 4MLHA 2E5JA 1SJQA 3JS9A 3HYFA 1PJ6A 4B1YB 3OFGA 4R0EA 3S3OA 3EY1A 4ZVQB 1DJ0A 2CADA 1W0HA 1FX2A 1PC4A 1P9YA 2D4WA 4MMOA 1S0OA 2OTJN 3UI3A 2DRBA 3QZ7A 1WN7A 4KI4A 3CJ1A 4OX6A 2EXUA 4YP3A 3G8QA 5E3QA 2YX6A 3UNYA 3V5RA 2W4PA 1HFEL 2LKZA 3ZTOA 3KJFB 4K50A 2DCLA 1GAOA 2F96A 2UV8G 4DTOA 2DXFA 2CGKA 2M70A 1F3VA 1WNEA 1I3OB 3N4QA 3PYGA 1XIQA 1LNQA 2H65B 1BC6A 1SAZA 3BF3A 3ENVA 5DETA 1NPKA 3NF7A 2AEMA 4NI2B 3PRVA 3TO8A 1Z6RA 3J7YU 1E6VA 4Q8FA 3V6KA 1B3TA 2MXYA 1Q81O 2GEMA 2IBOA 1NJZA 3QWUA 4M1KA 4ZP7A 2GVDB 4CH7A 2V4JB 1FDDA 2JFKA 4DF4A 4KHUA 4X65J 1OY8A 3W60A 3UDEA 4K25A 4JI8J 2B4VA 1NDLA 5C7PA 4GY2B 3QGHA 3PJXA 4RUBA 3KLEA 1YJ9S 4I9LA 1S1UA 2FIUA 5FPMA 3MZIA 3F0NA 3RAMA 2W42A 1UW9A 2D3O1 2D0OA 3BH7B 1OH6A 4DV1F 5JS2A 1U1MA 3TJAA 4CLFA 3AAWB 1ESVA 3TSQA 4K59A 3C94A 1HBMB 4WZQA 2VWJA 1NDKA 3UD4P 5BR8F 3PW5A 1ZBSA 3EICA 3VEYA 1JLFB 2ZH4A 3JAMO 3THPA 5GAHP 2DNQA 1M1KT 4LSLA 2F9WA 4DV5F 3BV8A 3T69A 2IS3A 4ZPVR 4X4PA 4AL5A 3U1LA 2H4YB 3VMFB 4P2FA 2YNIB 3SFGA 5F2RA 4DV3K 4CDIA 4CF8A 4CEQA 2QA2A 3THTA 1R59O 2IDEA 3BKFA 4FM0A 1I51B 3IS9B 1EJ7L 2HWTA 1ZPWX 4HUFA 3P83D 1ASVA 1RT6B 1S97A 4GV9A 3MPDA 4ANDA 3HSCA 4U7UD 3GJQB 4FLYA 1RTIB 3VQCA 4USWA 4DV4K 4O0IA 4Y2IA 5HRPA 5ETRA 2YH1A 3I31A 3LTOA 1TL7B 1SKRA 3DWLA 2GW8A 3HHLD 4DL4A 4PWDB 5C42B 1VBXA 4DLGA 1YHQN 3ZSXA 2XM3A 2DR9A 3P31A 2ASPA 3G82B 1G99A 4BRCA 4B9VA 3AGKA 2UVRA 1X4GA 3QNOA 3AJ1A 3RG6A 4FWSA 1IKXA 5KFGA 1MWMA 3KMQA 4JHDB 1LWCA 3ZT4A 1BISA 1TKTA 2KRBA 2M0GB 1GOAA 3ONQA 3TR5A 3F2KA 2RS8A 3H0PA 3IBWA 3J7ZT 5G0RB 1RZMA 2DGQA 3A12A 1VRTA 4M5GA 5J2MB 3M05A 1UMJA 5TKYA 1VDHA 5CE3A 3CJRA 4E7JA 3MMJA 3R1LA 2JNJA 2F9JA 1Z2ZA 3DXKB 4DR1J 2GVZB 4H8KA 4BR7A 4FF4A 1JJ2M 3R8YA 2MDAA 2MHNA 3DOKA 2XLJA 5CZXA 3K8VA 3J81O 3FCWA 3I9ZA 2AWZA 5BXIA 1JLEB 4Q45A 5BR8J 1Q82T 2QIFA 3AVHA 3B6PA 5BYRA 5J2NA 3MDQA 4HVJA 2GC8A 1P1TA 3CM6A 2UUWA 4FWKA 3NFAA 2V63A 4DV5J 2VKRA 5HVFA 2HAFA 4YQWA 1Q53A 4P7TA 4DOZA 4CGIA 1WC0A 1K9MT 1WKKA 3VGVA 4DPUA 3TR8A 5DQGA 1HD0A 4IOXA 1WSEA 2CQGA 4FJJA 4B3RF 1ATRA 4QOTA 4KHPF 4A48A 5ETQA 4LFAK 3SMPA 4HL9A 1U8WA 3A8IA 3SMSA 4CE9A 1JCFA 4P74A 5A6PA 5C15A 3T1YF 2DVIA 4NLUA 1XQSC 1R27B 1RBRA 1MMDA 2HFSA 1RK8A 5JVGL 5E5NA 1PYSB 2YVSA 4YR3A 4IH5A 4ED1A 5DZ7A 4I67A 5KOXA 3DI6A 2GZOA 3Q89A 3ZXWA 3O9SA 4URSA 4J2BA 3GBTA 3FZFA 3SDEA 1G2EA 3NGKA 3QATA 3TVKA 4N41A 4CJPA 4FZZA 2VICA 2UUCF 2XNRA 1FRLA 4FJGA 1NRKA 4A8FA 3E2EA 4Y2AA 4NMXA 1KCFA 4CF0A 2DRDA 3FR0A 2YKQA 3F5TA 1RT5B 1IKYA 4E89A 2RDJA 2VGNA 2MGZB 3IMQJ 1RT1B 4H4KC 1IQZA 4NLTA 3GIIA 4YOTA 1RHKB 3HOSA 4C0HA 1C2PA 4ECRA 4OYMA 1GT8A 1VC6A 4CBWA 1QZ5A 2FVPA 3FFKB 2P5GA 5MLCQ 3W2VA 4GO7X 1RTDA 1NZAA 2VQFJ 3K2YA 1JNZB 4JI1K 1XC3A 5AQZA 2J8AA 4JKEA 4NZ6A 2BABA 3VETA 2AYBA 4DUZF 4UZCA 1VOMA 3GJSB 1HIYA 1W7AA 1NXIA 2UU9F 3CG7A 1NK5A 2YHBA 4PYDA 4OYOA 2AYMA 2QTDA 4KO0B 1PYOB 1IXKA 1TKXA 3QSYB 1GLFO 4C1NI 3CD6S 4GKJF 3QMLA 2E2OA 4DMZA 1QZ6A 2QEXN 5B09A 1LOUA 2C2DA 4B9NA 3R1HA 3FBFA 3OYHA 1R0CB 5A6WA 4FNHA 2PGCA 2HHHF 5DMRA 4ES3A 4B3RJ 4CGGA 3CETA 3BY5A 4KHPJ 2DIUA 4KGXB 2NREA 2CGLA 1CJTA 2HURA 4AHRA 1R0AA 2DKOB 2YQ0A 2QSWA 3G6ES 5F8JA 3ZSYA 4PG6A 2YWKA 3T1YJ 2AJ2A 3IG1B 5ETSA 4KRFA 5HK4A 3DLLQ 1HI1A 2GX9A 3OYCA 3OBYA 3VGUA 4A46A 4GVLA 2AA4A 2VQEJ 3JSMB 3EX7B 4PKDB 3UNGC 1WD6A 3VAMA 4DTXA 3SUPA 2F8EX 3OTDA 2GHVC 2QXLA 2ZBQA 1T05A 2YNFB 3CMQA 2YX7A 3OL9A 4KHNA 4NB4A 1CSJA 1B4SA 4X65K 5F0UA 2JLFA 3ZC4A 4PA1A 4JI8K 3VAHA 3A3PB 4OHZA 3HSGA 2Y0SD 4ID5A 4WFAL 5E2QA 4J9UE 3A5OC 1YGYA 2UUCJ 1X0FA 3CCES 4RW4B 2KVQE 3D0IE 4FLTA 4F26A 1I94K 5F9LA 2PIIA 5LL6Z 1IJFB 5HL7L 5EU7A 2VB6A 2PI4A 3CPWM 3OLAA 1S12A 2KH9A 3JQMA 4QOZB 1RWVB 1PGZA 4GC6A 1QHTA 2DB1A 2YWWA 4BS2A 1YTYA 5IXUA 1D4XA 4G1QB 4UQGA 4Y0WA 3OUYB 2HS0A 2VOOA 1T9VA 1S0NA 1NH7A 2IYGA 3OTOF 4DUZJ 3O3FA 3HCXA 3UVJA 4JRPA 2WUSA 2XLIA 4OQJA 1QY7A 6FDRA 4OI3A 2UU9J 3PO5A 4JKDA 1YK9A 1HR0J 2OPRB 4F2RA 3CCRS 1NGHA 2YHYA 4KHWA 2GTDA 3LQVA 2MKJA 2Y1LB 4LY7A 3OVNA 1FKPA 5JMNA 1FWLA 2CRLA 5EWEA 3OYDA 2KQ2A 4PWWA 2BXJA 4M45A 3P4IA 4NLQA 4DTNA 2CQCA 3D0HE 4OLOA 4EGLA 3R2DJ 4ELTA 4PEOA 2OMOA 3OYIA 4BDYA 3CMAN 2VA3A 1FK9B 1X31C 3MCAB 2OKQA 4KV8A 4ECQA 1GLJO 2Q0UA 3VERA 4CEBA 2VDHA 4DR5F 3R5JB 4BGAA 2VG5A 3IAYA 2E66A 2YWHA 3O4NA 3T3FA 3Q8PB 4BREA 2EI5A 2QLFB 3R5GA 4GO5X 2B9XA 2OEKA 2XSJA 5F0XA 4TNOA 4OZ0A 2HGNA 2ZF5O 2OTLN 3C6TA 3ENOA 2DGVA 2I9SA 4QWAA 4KR0B 2HOEA 1FT8A 4C3KA 4I9QA 3NAIA 4IG3B 2GHPA 1K73O 3V1OA 1C4AA 1H2TZ 1NSQA 1EXQA 3AVGA 2Z2LA 1IH7A 2FJXA 3G87A 1HKCA 2X1AA 5HOOA 3L8BA 2NPIA 4DR1K 1JB0C 3TU5A 1U04A 4ECSA 5A2QU 2P9NB 3KWGA 4NLXA 3V6DA 4MTPA 2W8KA 3SJHA 2CJYB 2EFOA 2E2PA 1UFKA 3VTHA 4P75A 1F3FA 2Y0BB 4V1Ak 1BUXA 4OX8A 5K8MA 1FVQA 3V81B 5AQQA 1F9EB 2E8AA 3TSUA 3KLIB 1S72N 3WIUA 3GYXB 4KE5A 3KG0A 3LDOA 2UYTA 4DV5K 4ER8A 5GAEP 1J27A 1ZM3A 3POTB 3W9JA 4FKYA 3HBTA 4LIWA 4WFYA 4KY3A 2MKYA 4DSJA 4XH5A 3R7SB 2ZWPA 1CS4A 1CJKA 3I56N 1NSKL 3FRZA 4MDAA 1C4CA 3WT0A 1IR0A 3P96A 1KOOA 3W3SA 2HQGA 3AARA 2WFBA 2QWNA 3CCMN 4EHTA 3BYPA 5IM0A 2XY7A 5HP1A 1UAXA 3UO0A 4B1XB 3K59A 5KFAA 2YWFA 1E6VB 2CQ3A 3CM5A 3LDQA 4WYBA 3MCSA 4GNIA 1NPRA 4NZ7A 1FDBA 3WXJA 2NUUG 1XR7A 2F1FA 2FC8A 3RWUA 1Z05A 3PYDA 2GJFA 4K4SA 2R8JA 3HRGA 2YTCA 3C46A 4DR5J 5DK5A 3DXSX 3CULA 3OFEA 4KRWA 3KLEB 4ZLPA 3O1WA 1S1UB 2G1DA 2Y1JA 2ZH5A 1VQ8S 4Q2MA 3T9ZA 1UZHA 3LUYA 3ENBA 3CDEA 1JIHA 2CQ2A 4O44A 3PIOL 4CFCA 3ILLA 2BDPA 3BZCA 3LL3A 3SAFA 5K8NA 1S1TA 1RWNB 1RP5A 2G0CA 5E41A 4I2PA 4OFZA 3F9MA 3AJ2A 1J5EF 1B0PA 1OO0B 4K42A 2Z2ZA 1XNQF 4DZ6A 1KOHA 3KK7A 4JKGA 3HKZD 3NNCA 2VQFK 3MGJA 3H5XA 3KFWX 2CDRB 2C2KB 1FW6A 4PUOB 4B3OB 3C15A 1BQMB 3PRBA 2GO8A 2FBXA 3LAMA 2RB7A 4WZMA 4HUGA 1HQEA 2OEMA 3K58A 2WONA 4LF6J 1XJWB 1RGIA 2C42A 2QL9B 2PFUA 1AA1B 2JC1A 3CCQN 1VIXA 4C0BA 4X4QA 1GNKA 2R2TA 1GXTA 2FHOB 1CZ9A 2BANB 1ZM2A 3VTIA 3DFEA 3KIOA 5F8NA 4ZVPB 5FIIA 2CPIA 4B3RK 2OD6A 4FL9A 4C6AA 2B5JB 2IRUA 3HD2A 4KHPK 3OHRA 4LVOP 2XS5A 4N7TA 1C0GA 3CJAA 3QICA 2JH3A 3MPVA 2VV5A 1FFWB 4F4YA 1GK8A 3T1YK 3SZ2A 4UTGA 1TKTB 3CTRA 3L09A 4IO9Q 2VQEK 1ACMB 4O5FA 5LMUJ 2E2QA 1I5OB 3I9V9 2Z0GA 3QEIA 3CFPA 4JK8A 3U8XA 1VQKS 3VGKA 2DHSA 3AVKA 3PX0A 2COLA 3CXCM 1VQ6N 2UUAJ 1NB2A 1XI1A 1FRJA 1W7WA 2Z30B 1W25A 2KRRA 3M9NB 1EB0A 2RUGA 1RAOA 3SUQA 3VQSA 2WVDA 2BKNA 4IRDA 4ZLLA 2X74A 4RKUC 3KK2A 2ZWHA 1N6QA 4DTMA 3DOKB 4ILHA 3UQSA 3VQ4A 3WQTA 1GLAG 1OJ4A 3BGRA 4J9PA 3UB5A 2JRSA 1X1PA 4XDCA 1JCGA 4FPIA 4GW6A 1SC1B 4DPYA 4PAAA 4ERDA 5J2NB 4MKBA 2YHXA 4DX7A 3VAKA 3BBCA 3MHYA 3H25A 1J5EJ 2Q97A 1M5HA 2HIYA 3QAUA 3FBEA 4KREA 1MSWD 5HLFB 3D7SB 4WU2A 4TY8B 2ZJPL 2GWJA 3D28A 3QYYA 2YPYA 1DGKN 1Y00A 2O8CA 2VJVA 4LREA 4R0JA 3MEEA 3ZZUA 2UU9K 1YIJN 2KZZA 4W90B 1HR0K 1VIOA 3IA0A 2CZ9A 5KFYA 4ZVHA 3M9MB 1NU4A 2N82B 2W7AA 3TUZC 2M8HA 2R8GA 3W8PA 3M2RA 5B0GA 1P8ZA 4J90A 4CFBA 4DX5A 5EX3A 4GKKK 2OI2A 2FJBB 3NP5A 3I55S 1QTNB 1TV6B 4QR1A 1TFWA 5LMNJ 5GIOA 1RBAA 2V4QA 5D15A 2DNYA 3GFXA 3PO4A 4P7VA 4JYAF 4QIVA 1KD1O 3D2FA 3KNGA 6FD1A 3DXBA 3SQGA 2BE2B 1DKGD 1YRXA 3D6MB 2IM0A 3TUPA 2HFNA 5ADXA 3NOCA 1T95A 3R3TA 4O0NA 4ZPTR 2ILYA 2DTJA 3I5CA 4W5QA 2PEHA 1JJ2R 1UVNA 3ZFVA 2IA0A 3R9PA 1VQ4S 2C3UA 4DL5A 3DYAB 2F40A 2X3DA 1FRKA 3D6RA 4XK8C 1W2IA 5I4MA 3OSNA 2O8FA 3C7NA 1FWPA 4CLZA 1YI2S 2V4RA 3DRRA 5ETNA 5K8PA 3W2VB 2NQPA 1RBTA 1IKWA 3OYEA 1RTDB 4CJTA 1S7IA 3RMCA 2O8DA 3I0SA 3MD3A 4U8YA 2HAIA 3GPAA 1NWKA 2DY1A 4ZTFA 1S57A 2DFFA 1WOOA 3WBZA 4RBTA 1A9NB 1S1XA 1U1KA 1YWXA 4KGZB 3NF9A 1U1PA 1WSHA 1OIAA 3AVBA 3QIDA 5THWA 3K17A 5KFRA 2F7TA 3A4TA 3SPZA 2F9TA 1V3SA 4YR2A 1R6YA 2D0BA 4WQ4C 4UW2A 4ISEA 2F4VK 2FSKA 1NGEA 2JWNA 2ZBCA 4B9SA 3ZSRA 3O3HA 4OX9K 2ZOGA 2AEJA 2WVBA 1VSIA 3U4LA 2Q3PA 3GCWP 3Q86A 4JKBA 3IXQA 4JI2K 4TY9A 2HHQA 2VCPA 5ETMA 4CZFA 3ITHA 2B8QA 3IO1A 1R0AB 5AE1A 5FLXU 1OWXA 2M5YA 5FLXY 1TK0A 1K8AT 5CD4H 5B0CA 3M2UA 3G0ZA 3VA3A 3MR7A 4F4AA 3JB9k 3NDKA 1Q7YT 2AJFE 1T05B 3AOCA 4P72A 1O13A 4B3MF 2KM8B 3HMJG 5M1PA 2IM2A 4JYAJ 2W2QP 2ZDOA 3OV7A 1NLVA 3AAQA 4CLWA 4TLRA 5E0OA 4GMKA 3NF6A 3UKRA 1N32F 1VAZA 3BKUA 2PI5A 1FDNA 3DLRA 3QBCA 5JICA 1QTMA 4QYRA 1LFWA 1BO5O 4KH6A 3OYAA 3GV7B 4CJLA 3ID6A 2DEIA 1VQMS 5H1SV 3OYFA 2MJNA 5C5JA 1FXXA 4RNHA 3EKSA 4H5NA 1IKVA 5IT9U 4IOAL 2O67A 5BN8A 2D7SA 3G6VA 5IT0A 2JLEA 3D5MA 5FPNA 2QYGA 3TJ9A 4CHPA 1C0TB 1HNWK 1N0UA 2IAJB 3RW7A 1OSCA 3DRPA 3C0BA 4K5RA 3PUFA 1RDBA 1R7IA 2BGGA 4DR4J 4USUA 3UVJB 1TL1B 4BVPA 3T5KA 2E7VA 2H3EB 5AQYA 3K7RA 4DUYF 3FGVA 2CPXA 3SV3A 4OI4A 1D9DA 4LF6K 1GTEA 1S79A 4KSEB 2Y3YA 1BU6O 1RT2A 3TUJC 1FKPB 4TU9A 1YVFA 2KKHA 2JJ4D 3CHWA 3PIPL 2YX1A 3M1VA 3LF0A 2CH5A 1Q16B 2ASMA 2DGTA 2KLAA 1V4SA 2G8FA 1MMLA 1FTCA 4CJ5A 1S9FA 4Q44A 2Z58B 2CPYA 4ZVEA 3V9XA 5KFEA 1NGAA 3TTFA 3JTPA 3MM7B 2UXCK 1EQMA 2P2CB 2VG5B 4CZCA 1CJUB 3CCZA 2GJ2A 2XSFA 2DH8A 3LP0B 5AQHA 2XSJB 4NRTA 4CZKA 3MUMP 1TL5A 2ZKUA 4IR1A 4HVZA 3K5PA 1W2BM 2FLLA 5LMUK 2XY5A 3H46O 2VFUA 2P9LB 3HFVA 1M1KO 4HTLA 2IMWP 4PR6A 3BN4A 2OPQA 2V5HG 3PKMA 1VSJA 4CJWA 4IH7A 4CZGA 4CP5A 1FD8A 2XB2D 1ZETA 4B3MJ 1ZTTA 2V34A 2F3JA 3T5HA 4I4BA 4I56A 5IS2A 4DQSA 1UTAA 1N32J 1YQHA 2UUAK 1IG9A 4R79A 3CPWR 2PZSA 3HM8A 2DR7A 3IGNA 5DLGA 4FWOA 2CAJA 2XC9A 3SQOP 4ZN1A 1NOZA 2VWKA 3K57A 3MM5A 2MSTA 4CGDA 2E1ZA 3S9HA 3AVCA 3OJSA 4CERA 5GADP 2XMKA 1ZZFA 1WOPA 2K2PA 4AF1A 5U47A 3BQ1A 4N76A 3L3CA 3AV9A 1BCMA 1J5EK 1X4HA 2CQIA 2VF3A 5F8IA 2JLGA 4RW9A 3DHWC 2GUIA 4Y00A 5T14A 4YY3F 3NY0A 4QBUA 1N33F 2VC0A 1OQ3A 2E5LK 4ED7A 4EAHD 1U2VA 4DUYJ 4HLBA 5AQRA 3RR8A 3VEVA 3CQXA 1X5OA 4UUWA 2NR0A 1V5VA 3J7ZO 1X0PA 1YJWS 5D78A 1BI4A 1D5AA 2V94A 5HP1B 3TVYA 2GBZA 1UA0A 4IYQA 5CAAA 2IJRA 3DOMB 3ENWA 2JWKA 2KJWA 4B1VA 1MROA 5HRRA 3M8YA 3WQPA 5LMNK 3D1QA 4CF1A 4JI5K 2BMBA 4DQPA 5I3UA 4BRHA 2FDNA 1Q82O 4FOEA 3L95X 1RHJB 4NYFA 4OKJA 3L2QA 1A6LA 2EG2A 4Z4FA 4C7QA 3QGIA 1VQ7N 2V6AA 1RBOB 1K9MO 2DO0A 3JXUA 1QSSA 4Z7CA 3IKMA 3OBWA 4O44B 4DL6A 3FVYA 2MJUA 1TR0A 4C8NA 3CDAA 4CT8A 2QX0A 1HUXA 5M1FA 1B64A 3MM9A 2WVCA 2ATQA 4K4XA 2MZJA 3NAEA 4FYDA 4JKGB 1VRUA 4Z4CA 1DAXA 4O4GA 3W5ZA 3MFHA 1UPMB 1T9UA 4DWIA 3CCUN 3TAPA 2C2EA 3O08A 3K5LA 2WTUA 5AJ3F 1H74A 4X64K 4DJBA 4ZPBA 5J2PA 2YNGA 2HSEB 2M2BA 3EZUA 4PXDA 3GZ7A 1CJVA 1HHQA 3EZ5A 5HVHA 2C2ZB 4J9OA 2P9KB 3TTCA 3GJRB 3RAXA 1N33J 3M6XA 2F8HA 1RAEB 2MZTA 4K4UA 4MKVA 2LQ8A 2D1CA 2DPIA 2YH0A 4W5TA 4QYZJ 2GGPB 3N6NA 2V8VA 1DARA 2XMMA 1GQEA 4QJVA 2IVOA 4KAIA 2I8EA 4E0DA 5FD1A 2F8TA 2BJDA 3WEEA 1ILYA 7AT1B 2P8IA 3EDRB 1TUVA 5I3QA 3AD8C 3KJQB 1X5TA 3IC1A 4JBCA 2R3VA 3I87A 2XO7A 2VFRA 2IRYA 1C0UA 3ZSVA 5CHIA 3CDWA 4Q2LA 1T9XA 2FPHX 3CVKA 2APOA 2V9KA 3R1XA 3DMJB 4OV1A 1WACA 3EGWB 1VHXA 4C2MA 4DXLA 4KGVB 3HULA 2AHOB 3KHYA 2LQ5A 2O8BA 5LSOA 1DT9A 3KK2B 3OW2M 5LJVA 3MMVA 5ETLA 2JEGA 1FCAA 1DBDA 4CI0B 3BGRB 1HYZA 4ECZA 2K06A 4JS5A 4P6QA 4JD2A 5E7OB 3MAHA 3H3NO 3S6EA 3QBWA 2IJFA 5CYQB 2J7WA 3FE1A 4ITSA 3CO0P 1D9FA 1U6BA 2RMLA 2HSTA 4NPOA 3F73A 2DISA 2XQCA 3MPWA 4A5BA 4DR4K 4PG4A 5AJ3J 3TX0A 3NHGA 2KB2A 4KGMA 1PBAA 3MEEB 2AGPA 4CLSA 2CPFA 1HNVB 4MKYA 1JJCB 4NWBA 2YI1A 2LSNA 1X9WA 4C23A 1EKRA 3ZTQA 3KUGA 2MZSA 3R97A 3MI7X 1Z26A 2Q1LA 4XO0A 3J7A1 3KHGA 2WBMA 2MLYA 4O3NA 2B4PA 2CQ4A 4QW9A 4RWTA 3I82A 4KB1A 3PHEA 2P9EA 2JZ5A 4LR8A 4ALZA 2QSFA 5I9EB 2HVEA 2HPUA 4C97A 4OGCA 1REVB 5IC6B 4N8NA 1F60B 4LF4F 1LOTB 3TZXA 3SQGB 4FP9A 1NDCA 1N0VC 3CXCR 4DR6F 1TL4A 4KI6A 3MECA 2DGXA 3G86A 3E51A 4NCAA 4JI6J 4PL7A 4YHHF 3PXGa 2DO4A 3GB0A 3O8WA 3VEZA 4FDFA 4K8XA 1RADB 1P27B 4YDXA 4ZIVA 3I0RA 4PQUA 4B3MK 2FD2A 4LD0A 1UKUA 3MTJA 1R8HA 4OHWA 3C7NB 2DY9A 2F8SA 5K5MA 4LBPA 1N32K 3DRRB 4FM1A 3HKWA 4C8OA 2HNYA 1WSGA 1TYQA 1IKWB 5KFOA 2O8DB 4JI4K 2QO3A 3EGNA 2ZD1A 3AVNA 3D45A 1NG9A 1SH3A 3DLKA 3NRBA 1G15A 5AQLA 4J9VA 5ETVA 4LF7F 2HK2A 5E84A 1S1XB 5M2RA 1ZBTA 1WUUA 5DLFA 5CHCB 4OI6A 1XMOF 4FJNA 3QO9A 2HWIA 4X66F 4U9RA 5A8WA 2HBMA 1WORA 5M2PA 1NLKL 4FJKA 1IBLJ 3D4JA 2ZJQQ 1X9JA 4XIUA 3E9OA 1AT1B 1Z4UA 1S5ZA 4JI3F 1C1CA 2D3UA 5AQFA 1HYSA 4CQ1A 1FJGJ 3MD1A 1RLCL 3HHLA 4GV6A 4DUYK 2QK9A 3BBBA 3HSJA 3U9ZA 2J0QD 1FESA 2G0IA 1S77D 2IVNA 1T44A 3CF5Q 1Q8IA 1WLJA 1IBKJ 4WQ5A 3VGLA 2E9RX 4Y2CA 4HDGA 4HTJA 1L3KA 3CO9A 1HLUA 1N5SA 1FFGB 2DR8A 3AO5A 5HN0A 1VLOA 3VQ8A 3M2UB 2DFHA 4BRPA 3GR0A 1NSAA 2Q43A 4USHA 2A6AA 5GAHI 4ZVOB 5FRNA 3GL1A 4OO1J 1KKHA 5TKWA 4LMZA 1MWZA 4DR2F 4CBUA 2FHKA 3QMQA 2VD3A 1JQGA 1X3NA 2RN2A 2K1RA 4RW6B 3CIMA 5BJRA 4LF4J 3SYZA 5IWAF 1HPZA 5KT2A 3PTWA 5BRDA 2YCHA 1BWVA 2HLTA 4ZPWR 2AEFA 1OVYA 3ELHA 1YVNA 5T7LA 3AO1A 1O8BA 5LJ5Y 2MZ1A 3SCIE 1HBUA 5HMWA 4FJ5A 3EPIA 2LXFA 2CPZA 2WRMA 4KH4A 1IKVB 2XWYA 1CULA 3H8YA 1Y5NB 2DJWA 3EVMA 4ID8A 2E5HA 2Y8WA 2LU1A 2WZ1A 4IZ9A 1KR4A 3W9IA 1E3MA 3QT5A 2W2OP 1Q79A 2KTQA 2C28A 3LDSA 4JV1A 2RQKA 2RF2A 4FN5A 2KI2A 3PFEA 1DLOA 4EBDA 3LDLA 2ZEJA 3ET6B 4A8YA 1S4EA 4LF7J 3G6XA 3EGZA 4WKRA 4AM7A 4DB3A 3PEJA 1L3TA 1FE4A 1VJQA 1P8GA 2KG1A 1FEHA 2DNHA 5JS1A 5DS7A 4X66J 4OJGA 4A4JA 3SCJE 3MM6A 1AZSA 1RT2B 2J9DE 4BC7A 1V3ZA 2XTJP 1X7VA 1RCOB 3P4UB 1BQNA 1NU0A 4AXIA 2OPPA 5DGBA 3FEXB 4Y65A 2R2UA 3CMEN 2DIVA 2D5RA 2AKWB 4JI3J 2DYAA 1NJYA 1N33K 4LR7A 2P9PB 1S48A 1X4BA 3DU6A 4Y2MA 3FUYA 3JQKA 3ZSWA 2E9ZA 4WFXA 3U3GA 4A8MP 4QYZK 1B7FA 3ULHA 1RT4A 1KS2A 3TWZA 1ZTWA 1G6BA 1KAZA 2HHUA 3JSYA 4CEEA 3NGYA 1AB8A 1HHSA 1RAFB 5LSLA 2OGUA 4M94A 1FXDA 5KPTA 3S41A 3SUOA 1Y7PA 1JXEA 4ZVFA 1CQNA 4ZVTB 5A8KA 1SBRA 3VF6A 3OR2B 5T7BA 3D6HB 4Z4HA 1S9EA 3C6AA 2ASDA 5IWAJ 1GTHA 3HZ6A 4AHVA 3FSXA 4ID1A 3G71N 4DS4A 1GH8A 3L3VA 3TZZA 3KYLA 2HRUA 1WI6A 3QRQA 2XWXA 1B0VA 4EBEA 2CVIA 1GOCA 4IO1A 3P8BB 4FSVA 1JL2A 5KFUA 1HNXJ 3VR1A 2FZKB 3KLVA 5M1OA 2VG7A 2MQMA 1KSPA 2LQ9A 4HHUA 4LIRA 1SI9A 2R7SA 1QSLA 1RKJA 4RW9B 5EXWA 3UCGA 3UR0A 5L1KA 3MEKA 1K0VA 4M7XA 3Q8YA 4EFAC 2O8EA 1WAJA 3M8PB 3E9LA 5AJ3K 1U2VB 1SJ3P 2HMIA 2P1JA 3A8EA 2EWSA 3LH2S 3MOZA 3NWRA 4WKYA 2Q66A 1MN7A 2M9KA 4OJRA 4Q5VA 2AQ4A 4Q0BB 3FFIB 3KKSA 1BI4B 2VBZA 3DAWA 1QUVA 1GMVA 3F9KA 1IR1A 2HBJA 2QL7B 2DNZA 3OYNA 1NJXA 5KT3A 1WHYA 1MROB 2FTRA 4A8SA 1T02A 2CQPA 1D0EA 3GYNA 4DN0A 2VASA 3KUEA 3TI0A 2IVFB 2YWEA 3IAS9 3AVAA 3OYJA 4ED5A 2DNMA 2L08A 3R27A 1WKLA 2JHEA 4JP8A 3IBCB 2RKIA 1RAHB 1VQOS 4JI6K 3TAEA 1X4CA 1N56A 2D9OA 3CDUA 1GEHA 3SFUA 4A8WA 3RRHA 1XR5A 2OMLA 3VGMA 1YBUA 4B9TA 3WC2A 2W2MP 2D3OR 4K0KF 1WSRA 3M8SA 4MLEA 1UPPA 4RU9A 2ZWOA 4AILC 4TQRA 2V8DA 3WXMB 3CCWA 5B7WA 2KM8C 4PXCA 4BROA 1BDGA 2CWXA 1RDUA 1RISA 5DM7L 5KFPA 5LJWA 1TELA 3IMXA 4KJIA 4H5WA 4TSXA 3H2UB 2ACYA 1WI8A 2R7OA 1RAGB 1PILA 2NRHA 3HF5A 3UE2A 1RTHA 4PYAA 4E3SA 3QNWB 4J9SA 2JGUA 1EWQA 1T9TA 3HVRA 1YJUA 1Y3JA 1IBLK 3LZJA 3HVTB 3W64A 3MEDA 5B0EA 3ZZZA 3CJ4A 3ZX3A 4G3IA 1U48A 3BS9A 4MFBA 4G1IA 3GSDA 2WSFC 2FY8A 1FJGK 5CXTA 3KNAA 3VQDA 1CBKA 1M5KC 1DTQB 3W65A 4CIFA 1K8KB 2Z4PA 1RDCA 3NCQA 3Q7CA 3SQ2A 5FLXO 2GAHC 3ZZTA 3A13A 1HARA 1HNZF 1RBSA 1IBKK 2VONA 4IEIA 2I0XA 1VSHA 3Q8VA 4HI2A 5DG8A 2XGPA 2NRTA 3DDNA 2PA3A 3IWLA 1YSJA 1NGGA 2CZVC 3N79A 4IG0A 2IC3A 3PKYA 1VQNN 4IRKA 1OPIA 1C0UB 2BVZA 2EBEA 3SXLA 2RQ4A 3ZZRA 4FS2A 3WX8A 3CCSS 3T41A 2ZE2A 2Q1NA 1U1OA 1WAFA 2EC0A 5HAOA 3TW0A 2MKKA 1LWEA 4BVOA 2M7SA 3OYGA 2YKNA 2MLZA 2HK3A 5FDLB 4O8KA 2O8BB 3ISND 1M0SA 1U1NA 1RWXB 4DMNA 4WP3A 3W62A 3EN9A 3GSIA 3NS6A 5GAGI 1YBAA 2JDJA 1VQPS 4JD2B 2ZUAA 4K0KJ 4J2AA 1BMQB 4IFYB 2YKPA 2G9OA 3Q2TC 4I6YA 5KG2A 3A2FA 4Y34A 3CB4A 3KJNB 1RAJA 4DPWA 3CJBA 5DQHA 4FLXA 2P9SA 2GV1A 3TA0A 4CO0A 4NYZA 1K8AO 4USVA 3IDHA 2KT2A 4LF7K 2HHSA 4OYBA 3NMRA 3MURP 2W9CA 2ADBA 2G1HA 3M32A 1SUQA 1S7HA 4X66K 2OPSB 4CYUB 3M8RA 3DLHA 5HQ8A 3VEOA 1Q7YO 5CY4A 4F3TA 1EP4B 4LFCJ 1WF1A 3OD2A 1NMNA 1SKUB 4CZJA 4U95A 3C16A 5M2UA 2Q6BA 2IIRA 1BUPA 3OVAA 3NAHA 2PDAA 2BACA 5C25A 1KHWA 2NPFA 2CH6A 2MQNA 5IV3A 4N47A 3AY0A 3GV5B 2DD8S 3O3GA 3PX4A 1W9HA 4WXWA 1X4FA 4JKFA 3CC2S 3GQCA 2Z1JA 1TVRB 4ZVUB 1NNEA 2G8KA 2JC0A 1AYEA 5KFVA 4FLZA 3C6UB 3IFEA 1XMBA 1QHAA 2CKWA 4IFVA 3IM9A 5GAEI 3JTOA 3T5JA 3FKBA 2B7CB 3UKUB 3OW2R 1JLQA 1WELA 3CT9A 4PQUB 5DO2A 4RUAA 1S9GA 3BQ2A 2E7XA 1RQ0A 3VAGA 1RACB 2HNDB 3QLHA 3MN7A 2DPJA 3GIMA 2FC9A 1S1VA 1YZ7A