2RF2A

Hiv reverse transcriptase in complex with inhibitor 7e (nnrti)
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
557
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel indole-3-sulfonamides as potent HIV non-nucleoside reverse transcriptase inhibitors (NNRTIs).
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7
total genus 157
structure length 554
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2rf2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rf2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rf2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rf2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2rf2A05
1EETA 3V9SA 4DTUA 1LWFB 1NJXA 4LQ3A 1HQUA 4DU4A 4CEFA 2FBTA 5J2QA 5HP1A 2R2TA 5JUMA 2WB4A 1F21A 2XGPA 4Z4FA 2BQUA 2IA6A 2UVRA 4WXOA 4DL2A 1VSHA 3AO4A 1ASVA 2IDOA 4IDKB 1XHXA 2ITGA 4RW8B 3LWLA 1JLQB 1BCOA 2ILYA 3A2FA 3HVRA 3G10A 1TKTA 4ED6A 1XR5A 1RBTA 3HKWA 3RWUA 4KB0A 5F9LA 5KT6A 3KIOA 5F8GA 3BGRA 4NLXA 3SFUA 3SQ1A 4ED3A 1RAJA 2A1SA 4AHTA 3ISNC 3F9KA 1TKZB 4Q44A 3G6VA 5HLFB 2X6NA 1A5VA 3DOKA 3QLHB 4F3OA 4NLOA 4J9OA 3DOLA 4YFUA 5KFJA 2WK4A 4DQSA 3PUFA 3NAEA 4G3IA 4QWDA 3QEPA 4FS2A 1IO2A 5KRTA 1N4LA 4IG0A 2RF2B 2O4GA 3ZSRA 5C25A 2PYLA 4K50A 2IM2A 1HYVA 3NF7A 3CFRA 4DS4A 4JV1A 2FVPA 3SUNA 3PX4A 2B6AB 5SZTA 1JLFA 4ZVHA 4DL6A 4CF0A 4M3XA 3BDPA 1S6QB 3TVKA 4Y3CA 1QSSA 2FJWA 1IKXA 4KV8B 2W9CA 2HNZB 4QWCA 4LQ9A 2VWJA 3QERA 3SPYA 4RW6A 3MXIA 2I5JA 3TAPA 5DLFA 3QIPA 3KK3B 1KHWA 3WNHA 5CYMA 3EZUA 4FJGA 4IRKA 5L1IA 3I0SA 2HVHA 3K5NA 3AA2A 1S48A 4CJKA 1U45A 2C22A 5F9NA 4FLVA 3QO9B 3HSTB 1XR7A 1O1WA 5CY4A 1JXBA 3QZ8A 1HYSB 1IH7A 1RCHA 3C6TB 4FK2A 4QWEA 3ZSZA 2AU0A 4GC6A 3M8PA 1REVB 5KFTA 4CERA 3FFIB 1SL0A 3CFPA 3L2RA 1TQLA 3GILA 4FJ7A 4KHNA 1CXQA 2VA2A 4J9QA 2KTQA 1WLJA 2IM3A 3MR2A 5I42A 1N6QB 4JS4A 3RTVA 3FRZA 4MK7A 1N56A 3L2QA 1MU2B 1DLOB 4DMNA 3RR7A 3T3FA 3IRXB 2AX0A 3IG1A 3FFIA 4EBEA 1KRPA 4NLPA 4PWDB 4LSLA 4ED1A 2DY4A 3QYYA 4QWBA 1S9EA 3CYMA 4K4UA 4F4XA 3O4QA 2P5OA 2YNGA 1S1VB 3IS9A 3ZSQA 4NLQA 3LP0B 3GIMA 3QEVA 3BQ0A 4EYHB 5KT4A 1S1TB 4ZVGA 1IKWA 2HHSA 4O4GA 3VQDA 3G6YA 1TKXA 5DGBA 2IOCA 4PUOB 1ZTWA 1QHTA 1TL3B 3CJ2A 2D3ZA 3E51A 5DQHA 1NOYA 4ID5B 2OPRB 2UVWA 1ZBHA 4FJLA 3TANA 3NGIA 2FBXA 4BDYA 4M42A 1RT7B 3OYFA 2E9ZA 3PW7A 2IC3A 1IG9A 1S49A 1WNEA 3MXJA 1S1XB 3DRSB 1YTAA 2V4QA 2G8KA 4ELTA 4G1QA 4E7KA 2O4IA 4B9TA 4F3TA 4ED0A 1JLAA 1W0HA 4M41A 4E89A 4B9LA 2RKIB 3L2VA 1SL2A 3T5HA 1C0TB 4WXWA 4H4MB 3TARA 3DYAA 3H5SA 5KG3A 1L5UA 2WHOA 3TAMA 1XR6A 4ZPDA 1RTJA 3PR4A 4Q43A 4FLTA 3OL9A 4AHSA 2BE2A 3M9MB 2BRKA 2OPPB 2R8GA 1BHLA 3BGRB 4DFMA 4KB7A 4TYBA 4J9LA 3HVTA 4FK4A 1JLBA 5KFIA 4WFZA 1SV5A 4RG8A 2B5JA 3IG1B 4WYLA 2PZSA 3HXMA 3AO3A 4CGFA 4FZXC 1MU2A 3MR3A 4LH4A 1JXEA 4IDKA 3KK3A 1RBUA 1LWCA 4ZMMA 2RDIA 4DFJA 1I3AA 5KFWA 2ILZA 4ZPCA 2AQ4A 3ZT1A 3D28A 4ELVA 4TY9A 1FKPB 2C2EA 4DSJA 5KFEA 2OA8A 5KFHA 4N5SA 3KHLA 3FSIA 4IH6A 1SUQA 2ASJA 3TAFA 2W9BB 3ZSYA 4CE9A 4CK3A 2Q3SA 1S6PA 1K1QA 3SQ2A 4DQIA 4NLGA 2HHQA 3AO1A 3L2WA 1A5XA 4CJLA 4FJHA 2B43A 1RT6A 4K4YA 4JLHA 4LSNA 1DTTB 4RW7A 1VSDA 3BSOA 5C24B 5J2PA 2OZMA 2XCPA 4I2QA 5DGAA 1TK0A 4DSLA 3N6NA 1SUQB 4FJ8A 4F4YA 3DOLB 2XC9A 4E0DA 3DMJB 5FDLA 1D1UA 1GOBA 2DPJA 2AX1A 3NAIA 4CIFA 1FK9B 3VQAA 5DK5A 4O44A 1L3SA 1DTQA 3ZSVA 1N5YB 3AVCA 4FZZA 3OYLA 1X9SA 4ECSA 1SV5B 5KG0A 1NKBA 4Z4HA 3LP3A 3OYDA 3KLEA 2XWYA 1VRTB 2ZE2B 4KTZA 2GBZA 3K5OA 2J6UA 3HPHA 1KVAA 1JLEA 4IFYB 4EBDA 4R5PB 1RYRA 3QNOA 3V6DA 4B9MA 5I3UB 3NF6A 2HW3A 3G86A 2EX3A 3BSCA 1VSFA 3NE6A 4EZ9A 3VQCA 5C42A 1RDRA 1TL3A 4CHYA 2OPPA 3V6HA 1L3TA 3QIPB 4GW6A 3CM6A 2DFFA 4K8XA 5KTQA 3KLVA 4MKAA 4BWJA 1QE1A 2P51A 4KI6A 3LP1B 1S4FA 3H4BA 4CGJA 2YNIA 1I6JA 5KFZA 4CECA 1RDBA 1ZTTA 4FJXA 2AJQA 1B92A 4O3SA 2OZSA 2RKIA 5EWEA 4CHQA 3M8PB 3DRSA 4QOZB 2VG7B 5KG2A 4HVJA 4Z4EA 4CEEA 3QINA 4LY7A 3ITHB 4FJIA 2IAJB 4EYIB 4MIAA 4HUEA 5KG5A 2W7PA 3C94A 4FJJA 1QQCA 4AHRA 1N5YA 4CGDA 3QIDA 3ITHA 3G6XA 2AGOA 3LZJA 3AVJA 1HPZA 4XO0A 5DQGA 4HYKA 4CK1A 4B8CA 4CIGA 3QEXA 1S6PB 4OKJA 3NH0A 4R0EA 1ZBUA 3V6KA 1IKXB 2W9CB 3NH2A 3C6UA 4C8MA 4NCGA 3QIOA 4Q5VA 2WTFA 5FRNA 4WE1B 4ZPAA 2QE5A 2FBYA 4TY8B 3CFOA 4ECWA 3OYCA 1T7PA 1JLCA 1YVFA 5KT2A 2J6TA 3GIJA 4CJVA 4CIEA 3EZ5A 3LAKA 4ECQA 5HRRA 1I39A 3PY8A 1LWCB 4JUZA 2WRMA 3BQ1A 3KLFB 1HPZB 1S1VA 3CJ4A 4M3YA 1W25A 5EDWA 1JX4A 1C0UA 4FK0A 1S1UB 1NKEA 3UIQA 4M3UA 2VG7A 1BIUA 4KE5A 4F50A 2NUBA 2HHWA 4W5OA 4DS5A 2P5GA 3MR5A 4ZVEA 4CK2A 4KV8A 4RZRA 4CEOA 3V9WA 3KLHA 1NK7A 4YNQA 2DFHA 3BJYA 4ZP8A 3K59A 5DQIA 4DQPA 1G15A 3KKRA 2Y1JA 4NRTA 4Y2CA 1S0MA 4AHVA 4BDZA 1BL3A 2CJQA 1OS5A 1QAIA 4F8RA 1NK8A 3LANA 3RAQA 1HYSA 3SUPA 1CSJA 1WN7A 3UPFA 1IKWB 4FBUA 4H8KA 1MMLA 3LPUA 1R0AA 3ISND 1BCMA 3FDSA 4RW9A 3OYBA 1XHZA 2JLEA 1NK4A 1S0NA 4KO0B 1C1BB 2E6LA 2C28A 1T8EA 4NLUA 4EO6A 1JLGB 3RAXA 4O55A 5KFVA 4PWDA 4OJRA 2IJNA 4K8ZA 4GVMA 1T3NA 3H98A 2UVVA 1FK9A 3KJVB 5T14A 3PW5A 4QCLA 1VSMA 3GV8B 4CF1A 2E9RX 2X78A 4N76A 2ALZA 5F8MA 4TN2A 4KKOA 4JS5A 3KLIB 3PR5B 5JS2A 1VSIA 2XO7A 3LP2B 3CIZA 3AVAA 3ZT4A 2EC0A 1ITGA 1HRHA 1SKRA 3THVA 4NLRA 3AO2A 3VQ9A 2W42A 1QSYA 2IM0A 3OL6A 3HL8A 1NOZA 3RB6A 3DLKA 1S0OA 4DQQA 4MQ3A 4FJKA 1IKYB 4J9KA 1RBVA 1RT7A 4CEDA 2RDJA 1VSJA 3PHEA 3RB3A 1JKHB 3V9XA 3MAQA 1NJWA 4I7FA 1CZBA 3MEEA 1RT2B 3H2LA 3OLBA 1HMVB 4E7LA 3U3YA 3H40A 1TL1A 2W9BA 5KG1A 2F8SA 2XY7A 2WOMB 3TAMB 4RNFA 4B3OB 2ASDA 4BE0A 1J54A 2YV0X 1HNVA 4JV0A 4DTMA 2OPSA 1WSEA 2E9TA 4O3NA 1T94A 2QKKA 2EHGA 3AVIA 5KFGA 3DLGB 4GMJB 1S9EB 5CZ2A 1RBRA 4C8LA 4DFKA 4RNMA 2O5DA 2OPQA 4NYZA 4RUCA 3JYTB 4KHQA 1DLOA 2FLNA 3V4IA 5HRNA 3QNNA 1HNVB 3OS2A 3SI6A 4M3ZA 2LSNA 3DRPB 4K4SA 4K4VA 4URQU 2DPIA 4CJQA 4FYDA 2AWZA 1RTJB 4L8RB 4DF4A 2VG6A 1LAVA 2KFZA 1HQEA 3KLGA 4ZVFA 3CJ5A 4W5RA 4FLZA 3MEEB 4FLXA 1LW0A 3BREA 3KK1A 2YKMA 5HBMA 1S97A 4EEYA 3ALYA 1SH3A 1TP7A 3TR8A 4CF9A 4MIBA 4I2PB 5DG9A 4DSIA 1LWEB 3LP2A 4CJ3A 1Z25A 4DTPA 3DM2B 3NCIA 3DI6A 3SZ2A 1WAJA 3PX0A 3VA3A 2ZKUA 4I9QA 3I5AA 2IMWP 3OL8A 3DLGA 3H59A 4ID1A 3KK1B 1UWBB 2HNZA 2FJVA 4N47A 4FJMA 4ID5A 4CEZA 4YMEA 5HLFA 4KTWA 3PVXA 3ZSWA 4KHRA 3K5LA 1BI4B 1RA7A 3VQ4A 1WNSA 4MFBB 1NNDA 1JLGA 1RYSA 4J9SA 3DI6B 1BQNB 3QETA 3DM2A 1YTUA 2HHUA 2ATQA 4CF2A 2YNHB 3KHRA 5KFRA 1RT2A 3BQ2A 3NH1A 2RF2A 3NGZA 4CESA 4G1QB 1J9AA 1Z4UA 1QTMA 4IFYA 2YNGB 4R8UA 5KFPA 4XIUA 2YKMB 4BE1A 4DLEA 4JRPA 3QO9A 5KT3A 5KG7A 3UQSA 4RNOA 4B08A 4EO8A 4ZP9A 1BI4A 3L3VA 4FXDA 1HQEB 4CJTA 3NKYA 3L3UA 4WE1A 3Q8QB 1ZYQA 4NYFA 2F96A 2Y1IA 3MEGB 3LWMA 3EY1A 3K57A 3PX6A 3AVHA 5EUHA 5J2QB 1SH2A 1D9DA 3ZT3A 2HNDB 2V9WA 2ZQBA 3PJXA 3HHKA 2D5RA 3OYHA 3IGVA 4NZ0A 2D0CA 4N56A 1HJRA 2RPIA 2WONA 5I3UA 3KD1E 1SH0A 4AHCA 4MH8A 3LZIA 3M8QA 2XI2A 2IAJA 4M45A 3C6TA 4CJFA 5KGXA 1WAFA 3WNFA 3RR8A 3CQ8A 3DRRA 1NJZA 2G8HA 1VSKA 1Z26A 3VQBA 3NFAA 2OPSB 4EBCA 1JLCB 3OHAA 1QAJA 1HARA 2OPRA 5HBMB 2I5JB 2IGIA 4RW6B 1B9DA 4FJNA 4M3WA 3T5LA 4FS1A 5I42B 4HTUA 2HB5A 5KFLA 1U48A 3LAMA 4Q0BA 1C6VA 4DTOA 2RN2A 3O3GA 1RTDA 4J9MA 1RTIA 4E7IA 2UVUA 3VQSA 3KHHA 2OPQB 2G8WA 5JXSA 5EWFA 3WNEA 4ECVA 3UDLA 3NBPA 5J2NB 3B6PA 3HP9A 4IBNA 5KFDA 3T1AA 3VA0A 3I5BA 4PQUB 4KFBB 4IFVA 3PW2A 3KLEB 4ZTJA 2ATLA 1QS4A 1T05A 1K6YA 1WSIA 4PQUA 3TAQA 1KHVA 5KI6A 2I1RA 1UAXA 1KCFA 5SWMA 1J5OB 2VA3A 1VRUA 3CVKA 4LH5A 1N6QA 1QSLA 3EYZA 1ZETA 3AV9A 4E3SA 4DSFA 4XPEA 2KFNA 1TKZA 2XRIA 1LAWA 1N48A 2IS3A 5EWGA 3Q8SB 4DG1A 4KHUA 1LWFA 3AO5A 4CGHA 3BSNA 1REVA 5E41A 4Z4CA 4URSA 5CYQB 3ZSXA 2X74A 3IGNA 2CKWA 3PJWA 3LALA 4ELUA 3OYMA 5KFAA 4ECXA 5FROA 4EZ6A 2R2SA 4IG3A 2ZD1B 2HMIB 4O44B 1UA1A 1XC9A 4X2BA 4B9UA 4ZP7A 5DG8A 4KREA 4HUGA 3P83D 3RRHA 2WONB 4WZQA 3BR9A 3MXMA 2XHBA 2D0AA 3O3FA 2KW4A 1RT5A 5C5JA 3KD5E 4GC7A 4DTSA 4DF8A 5KRSA 3AVKA 1EXQA 4EP4A 1EETB 1VRUB 1YVUA 4CHZA 2HMIA 4FW1A 4IG3B 1U47A 5C24A 5J2PB 4AHUA 4CFCA 1DTTA 2QKBA 1S1TA 4ECYA 4RW9B 1S1UA 1Y97A 4O3PA 4J2EA 5C25B 2VG5A 3JYTA 2Z1JA 2B4JA 4IG0B 3NGYA 4FM0A 1IKYA 4DSKA 3MF5A 5D3GB 4NLYA 4ED8A 2QXFA 4OLBA 3RRGA 3TQ1A 3KLIA 3N6MA 1DTQB 4H54A 2Z1HA 5KFFA 1YT3A 2GIRA 4ICLA 2BANA 5KFSA 3SV4A 3O4NA 2KQ2A 4Q8FA 1D8YA 4ED2A 1S9FA 4ED7A 3RB0A 3V6DB 3NGDA 3P5JA 3S3NA 2E4LA 4MKBA 3O3HA 3SYZA 4DWIA 4U7CA 3LDSA 4F2SA 3CDUA 2ETJA 3SUQA 1C1BA 4Y1CA 4B9NA 4IRDA 4K4ZA 4KHMA 3HYFA 4LD0A 3GYNA 1HNIA 4CHOA 2HHXA 3KK2B 3DLEA 1U04A 1ASWA 4CJ4A 4CFBA 3NL0A 3GQCA 2BANB 1J53A 2YNIB 4RNHA 2GIQA 1TGOA 3LP1A 4KKOB 1JXLA 4FM2A 3MFIA 4ECRA 3T19A 4B9VA 1NHVA 3QGHA 5K14B 4CJ5A 4KHWA 3M9NB 3ZCMA 3KOAA 1RT3B 1T03A 3PZPA 3HPOA 4Z4IA 3MEDB 4OL8A 3RMCA 4LSNB 3IS9B 2IC3B 3DLBA 1L3UA 3MEDA 4HHTA 2JC0A 2QK9A 3FQKA 1TV6B 4O3RA 4CHNA 4IKFA 2B5JB 1RT4B 4FBTA 4OPJA 4ECTA 2XCAA 4K4XA 2JGUA 5K14A 3SCXA 1X9MA 1RNHA 4K4WA 4DU1A 2W9AA 4DTNA 4O4RA 1SKWA 4W5QA 2Z1IA 3UR0A 3TI0A 3DYAB 4CCHA 4H4MA 4QW9A 2D7SA 2QV6A 4E19A 1UWBA 1WSGA 2G8UA 4IR9A 2IJFA 2AGQA 3QZ7A 1J5OA 1W9HA 1JLEB 1HMVA 4OKKA 4FLWA 3K58A 4M3TA 3ZT2A 1UOCA 4C8KA 3AVGA 4CEQA 2FBVA 1FKOA 4W5NA 4HUFA 4NLWA 3V1RA 4TLRA 3Q8RB 4DTXA 1RT1B 5HRPA 3E01A 1VSEA 3P1GA 3QEIA 2HWHA 3AVFA 3SPZA 1S5JA 1RBSA 3RMAA 3AVLA 2R8KA 3K2PA 2FJXA 3HM9A 4C8NA 1C0TA 4TSXA 4J2AA 3U3GA 4NCGB 3SUOA 1IKVA 1BGXT 3MECA 5F8LA 4ZHRA 3V6JA 5KT5A 3OVNA 1Q9XA 4O3OA 5FRMA 3VQEA 1LW2A 3V9ZA 1C1AA 1TKXB 5L1KA 3DRPA 1Q8IA 2W7OA 1NKCA 2AGPA 1EKEA 4YR3A 3PO4A 2BQ3A 3HVTB 4QWAA 4I2PA 4I2QB 3H4DA 1GX6A 3OS0A 3KKSA 1JLQA 2GV9A 4CJEA 2R8JA 1X9WA 2D41A 1KVBA 3RMDA 3M8RA 2YHAA 2XGQA 3H5UA 4KAZA 4ZPBA 3PW0A 1LW2B 4FW2A 3VQ7A 1NK0A 4F4WA 4TY8A 4CJPA 1TVRB 3I5CA 3OYEA 4NCBA 2HNDA 2BR0A 4XPCA 4PUOA 2ASLA 2GC8A 4IH7A 3HPGA 2DTUA 4DFPA 3HO1A 3OHBA 3GIIA 3MR6A 4CJSA 2HNYA 4DEZA 4F4KA 5KGWA 3V4IB 2JEGA 1NK6A 2YKNB 3QGGA 2JEIA 5KFYA 5HROB 4JRQA 3SQ4A 4KBIA 3LP0A 4WZMA 3GIKA 3WNGA 1KFSA 2V4RA 2V0NA 4ECZA 1TKTB 4KFBA 1EP4A 3HVAA 1CXUA 4RW7B 1WSJA 2HHTA 3QEWA 3CJ3A 3MFHA 4Y2AA 3N6LA 1K1SA 5L9XA 3GV7B 3K5MA 3I0SB 4ICLB 2C2DA 4E1NA 1QE1B 2HNYB 1BIZA 3D45A 4B9SA 4B3OA 1RILA 4CFAA 3ZT0A 1XWLA 4MFBA 3OL7A 4Q8EA 3KMQA 5KG6A 2JEFA 3M9OB 1JL1A 4F2RA 4O4GB 4NYNA 3T5KA 2HHVA 3BSAA 1HNIB 1FKPA 3OSNA 2OYQA 5T7BA 5KG4A 4M94A 3HK2A 3DLRA 3AVMA 4IFVB 3E01B 4FZYA 1NK5A 4R8UB 3PV8A 3CDEA 3HP6A 1RDAA 2YHBA 4C8OA 4M3RA 4RW8A 2Z1GA 4HCCA 5J1EA 4YP3A 4CFDA 4TXSA 4DU3A 4M95A 4DL3A 4YQWA 2J6SA 4J9NA 1BISA 1U09A 5F8IA 2VWKA 1KLMB 2R2UA 3KMSA 4IRCA 3NMAA 3SV3A 1KLNA 4WYWA 5F8HA 4DTJA 2IM1A 4PY5A 4KAIA 4AH9A 3AVBA 4J9RA 4DL7A 3HT3A 2BE2B 3NF8A 5FDLB 4IQXA 4CEAA 3DMJA 4QAGA 3KTQA 1GX5A 1SL1A 1TKDA 4Z4GA 4TQSA 2B6AA 5F8JA 2UUTA 3VQPA 3CDWA 4CGIA 4FJ5A 3PW4A 2D0BA 1C2PA 3MTKA 3DLEB 2KZZA 4H4OB 3EPIA 3OJSA 4DQRA 2R8IA 1TK5A 3L8BA 4BE2A 5L1JA 1TV6A 3QESA 2FVQA 4J2DA 2FVSA 2FLPA 4KRFA 3OLAA 1VRTA 5EU7A 1BQMA 4B8AB 4O0IA 4DG1B 4URGA 1D0EA 1RT5B 3AVNA 4WFXA 5L1LA 3NHGA 3SNNA 3C6UB 1JLFB 4KSEB 2HAIA 3ASMA 5HP1B 2D3UA 4CJWA 3ICLA 2A1RA 1HQUB 3H5YA 4I9LA 3S3OA 1TVRA 1JKHA 4FJ9A 3JSMB 3VQ5A 3OYIA 4KPYA 4TYAA 4KB1A 3ULDA 5D3GA 4ZTFA 5KFQA 1C0UB 2WCXA 2XY6A 4Q45A 2YNHA 3CJ0A 3OY9A 5KFOA 4DLGA 1S9GB 4F4ZA 3OYKA 1X1PA 4RW4A 3TABA 3IN5A 4LSLB 1KTQA 4NLVA 4OGCA 4EP5A 3U6FA 5CYMB 2XY5A 4MK8A 4K4TA 4KI4A 3V9UA 2JC1A 3OYGA 4MK9A 2E6MA 2JEJA 1A5WA 3VN5A 3OYNA 4OVLA 1XI1A 3QGIA 4YR2A 3D0PA 3V1QA 4RW4B 1GOAA 3KK2A 1KSPA 4E7JA 3SQ0A 4OGEA 3F73A 1UA0A 1RT1A 1GOCA 5CYQA 3OSPA 4HCBA 4FM1A 3CG7A 4CHPA 1C0MA 4KTQA 5DLGA 4OLAA 2R8HA 4CJUA 2UUWA 1WSFA 4Y34A 4RNNA 1KFDA 4IR1A 4E7HA 1C1CB 5HRSA 2XI3A 1TAUA 3T5JA 1LW0B 2YKNA 4OKEA 5J2MB 3VQ8A 4ZP6A 3ZSOA 1EX4A 2HWIA 5KFBA 1TK8A 5JS1A 4RU9A 2FVCA 2P1JA 1BQNA 4AILC 2X6SA 3MEGA 2W8KA 4YR0A 1KVCA 2BDPA 1QUVA 1ASUA 3DOKB 3KLHB 5KFXA 4NLTA 4CF8A 1CLQA 3OS1A 1ZBLA 1RDCA 1C1CA 1ZBFA 4FCYA 2BGGA 2YNFB 4KO0A 4Z0UA 3OYAA 3SJJA 3M8QB 3RBEA 1EP4B 2OH2A 3I8DA 2ZE2A 4NLDA 3GV5B 2KZMA 1S10A 3IRXA 1RT6B 3C95A 1LV5A 2IBKA 1TAQA 3HVWA 1CZ9A 3OJUA 4UQGA 4DL5A 1FXXA 1RT3A 1T03B 1RTIB 3KHGA 1TL1B 3EPGA 4J9PA 1IKVB 3B6OA 3KJVA 5J2MA 3CM5A 4I7FB 3AA4A 2PY5A 1NJYA 3V81A 1S1WB 1SKSA 2VG6B 3Q8PB 1S6QA 3AA3A 4FLUA 4FVMA 1KLMA 4WFYA 1JLAB 3DLKB 3SFGA 4BDPA 4O0JA 1LWEA 4CJRA 4DSEA 2VG5B 4J2BA 3CWJA 3RBDA 1D5AA 3RMBA 4CGGA 1R0AB 1S1XA 4HKQA 3CO9A 3G0ZA 5CZ1A 1JLBB 4BWMA 4TQRA 1RTHB 2XY8A 1JL2A 4QW8A 3HJFA 5KFNA 4O3QA 4CEBA 2YNFA 3NAHA 4BACA 1S1WA 3I0RA 2W8LA 4FLYA 4ZHRB 3MECB 3TAEA 4W5TA 5KFUA 5KFCA 1D9FA 4Q0BB 4KHYA 5F8NA 2BQRA 2WOMA 3LPTA 2C2RA 4IKAA 5KT7A 1S9GA 4Y1DA 3H5XA 3OYJA 5KFMA 3PO5A 1BQMB 1RTHA 3H08A 1JIHA 3D5MA 1WSHA 3S3MA 1RA6A 2FC0A 5J1EB 1RT4A 1FKOB 1T05B 3FQLA 2G8IA 3S9HA 2R2RA 4R5PA 4IOBA 1VK0A 2F8EX 4OPKA 2G8FA 3AA5X 1Q9YA 1ZBIA 2FVRA 3L2UA 5DMRA 2FLLA 2F8TA 1B9FA 2DFEA 3NDKA 4NCAA 5HROA 4JV2A 4KHSA 4ECUA 1RDDA 3QLHA 3KNAA 3KLGB 3M8SA 1RTDB 4QPXA 1U4BA 3SI8A 2GUIA 3TAGA 1NK9A 3VQQA 3V1OA 4O5BA 3NF9A 2PYJA 2HVIA 5C42B 1HYZA 4U6PA 4NRUA 1L3VA 3I0RB 3RB4A 2BRLA 1NHUA 4DL4A 4H4OA 4N41A 3IAYA 4PA1A 3DLHA 3DRRB 2ZD1A 3NBPB 5J2NA 2R7YA 3KLFA 4E1MA 3TWHA 1U49A 1IM4A 3DDKA 1VSLA 3VQ6A 3V81B 5DG7A 4DTRA 5KFKA 3JSMA 4NLSA 4RUAA 4IH5A 2G8VA
chains in the Genus database with same CATH superfamily
4FPBA 1EETA 3V9SA 4LQ3A 2WB1D 3PIPQ 4DU4A 4FOIA 1SQGA 5AZJB 1F21A 4A8XA 4OIXA 3T9ZA 4DV7J 1DHMA 5GADI 5DM6L 4DL2A 2FY8A 1X5SA 1XHXA 3JS9A 3CMEN 2ITGA 3PRDA 1HX1A 3H45C 2YWKA 3A2FA 1NCLA 3M2UA 1RWOB 4DV0F 2N4DA 1N88A 3NOCA 1RBTA 3HKWA 3RWUA 3F9MA 1VR6A 5F9LA 1D4XA 1T6CA 1MROB 3K5PA 3ET6A 2PAVA 1I3OB 1KONA 2M3DA 3BY5A 3TUZC 1R59O 1E4GT 4AHTA 3IKMA 2Y0SD 4GVLA 3F9KA 1VQMN 5AQOA 5A8KB 3DOKA 3UVJB 4J9OA 4YFUA 2ROEA 1BD6A 1IJJA 3CMAS 1MMNA 3OTOK 3NAEA 1ZM9A 1Q53A 3ENBA 3UNYA 3MCSA 2KG0A 1NMEB 5GIPA 3O1BA 2AJ1A 3ZSRA 1NSAA 2W41A 3MCMA 3NF7A 3HTVA 4DS4A 4P2SA 3OVSA 1U1KA 2FVPA 1RXOB 1RB0A 4OHZA 3US5A 2BW7A 1JLFA 4ZVHA 4PPZA 2QI2A 2CDQA 4DL6A 5C2DA 4M3XA 5DETA 1S6QB 1G4CA 3ZZOA 4Y3CA 2O8DB 2FJWA 1UL3A 2XQCA 2W9CA 1HUXA 3NVKA 4QWCA 1VQ8S 1DARA 1RDWX 2Q97A 3SPYA 3MXIA 2I5JA 3TAPA 1PKUA 5DLFA 4CQ1A 1N52B 3KK3B 2YKAA 1F5AA 5CYMA 2Z2YB 3I0SA 4DB3A 2P9KB 4L75A 2P5VA 1YI2N 5F9NA 4FLVA 1O1WA 5CY4A 3VEZA 1HYSB 2R7VA 1RCHA 3CJSA 2QFJA 4A8KA 4GC6A 3M8PA 5KFTA 4CERA 2P9UB 2G0CA 4JV5J 2E8AA 3FFIB 1FRXA 3OFEA 1SL0A 1AT1B 3L2RA 3TNVA 5CXTA 5AZIA 4FJ7A 1M1KO 3WQTA 2KTQA 2RS8A 4X62K 1SAZA 2XSJB 1FNMA 2L9WA 3FRZA 3MR7A 1DT9A 1DLOB 4YN3B 3FEYB 2DGWA 1RJJA 4ZIVA 2CQGA 3TVZA 2AX0A 1BG3A 5IQQA 3IG1A 2HQIA 4M5DB 4LSLA 2CNNB 2DH8A 4K4UA 4F4XA 3G71N 2E1PA 3C14B 2YNGA 1S1VB 4KGKA 1BUPA 3GIMA 4DV5J 3QEVA 3BQ0A 2EPIA 5MLCV 2VICA 4ZCIA 4Z37A 2W1BA 1RSCA 2HAFA 3G6YA 5HVGA 3P5TL 3WXIA 1TKXA 3R27A 2IOCA 1VQ7N 4PUOB 1Q81T 4ITSA 2D3ZA 2R7SA 3E51A 2GGPA 4LFBF 3OD2A 5DDQC 2UVWA 1S76D 2QEXN 2DNYA 4FJLA 1ZBHA 3TANA 3NGIA 1QD1A 4M42A 5A2QU 4LF5F 2F7TA 2ZH7A 4M7XA 5AJ3J 3D6FB 4K0KK 1S49A 1WNEA 1ZS6A 1TL4A 4WFBL 1S1XB 2DR9A 1MNEA 4USHA 1KQKA 3I56N 2G8KA 1U1RA 1NDLA 2O4IA 1W0HA 4X4TA 4B9LA 1IXKA 1B3TA 3R5AA 1BE4A 3L2VA 4B3RJ 4L3QA 3FJ2A 1MN9A 3TARA 1L5UA 4JD2A 2WHOA 3CQYA 3TAMA 3B82A 4HTJA 4OYAA 4Q43A 1U2VA 2R8GA 3BGRB 3FLCO 5BR8F 5AQZA 4HI1A 3E3XA 3U1NA 4A62A 1XN9A 4WFZA 4RTFD 2FGOA 3IG1B 4WYLA 3WXKA 2JZ5A 2E5LJ 4CGFA 5DDRC 4LH4A 4WJBA 5KPZA 4LF8F 5DS7A 2ZGZA 4V19S 5DM6Q 5K20B 3ZT1A 4MYUA 1HWIA 3W2WB 5D4OA 2CPEA 4M5IA 1DZ5A 3VAKA 2ZJPL 3KHLA 3OTOF 4OX8A 2LA6A 1SUQA 5IT9Y 2GX9A 3TAFA 4RO0A 2W9BB 4JKGA 3D0IE 2R7XA 3F2KA 1WC6A 4DQIA 5HVHA 4Y28C 2B43A 4IO9Q 4Y0WA 4PYAA 3GR0A 2M9KA 5J2PA 2OZMA 4NI2A 5HMYA 5JVGL 3UE2A 1VBKA 2LU1A 4FJ8A 3LUYA 4RL1A 3DOLB 4BHQA 2O8CA 4OI3A 4ZLLA 3CJAA 4BRCA 4ZKAA 4FO0A 3DKDA 4K0KJ 4CIFA 1YJ9S 2MY7A 3T6JA 3VQAA 3BZQA 1DTQA 3AVCA 1VQLS 1VQSA 2GMLA 1F5BA 1Y0HA 3AODA 1SV5B 1WDDA 3FZBA 3A8KA 2GZOA 2RSQA 2AHOB 3IAS9 1VRTB 4KTZA 2M5YA 2LQ5A 1I94J 3HPHA 1RYRA 3MAAB 3V6DA 3AQOA 1KBRA 4JI5K 2C2OB 5IOLA 1YQHA 4EZ9A 5ETVA 5C42A 1XMQK 3EZWA 2QLBB 1GXUA 5GAGU 3QIPB 4J90A 4BWJA 4KI6A 3LP1B 1Q86O 3EZOA 4LFAK 2P9PB 1Q1KA 4U67L 3BGLA 3TA0A 1K8AT 1XEZA 5AXKA 2DGXA 2H5JB 2GJ2A 1NUEA 2MB0B 2VG7B 5DDPC 5KG2A 1F60B 4CO2A 3SAHA 3QINA 4LY7A 3BO3A 3CCSN 4FJIA 2IAJB 4HUEA 3H2VE 1I51B 2AZ1A 3QIDA 4FF1A 2AGOA 3AVJA 2EKYA 3OFHA 5DQGA 1EJ7L 3HHNB 4CK1A 1U6FA 4B8CA 1FXRA 4R0EA 2W9CB 3NH2A 4LRBA 4Q5VA 3ATVA 2APOA 2QE5A 2FBYA 4TY8B 1XC3A 3CFOA 2VFUA 1YVFA 3MMJA 5B7WA 2VIHA 2DH9A 3LAKA 2L41A 1IBLK 5HRRA 1LWCB 4JUZA 4LFCJ 2PE8A 3O9SA 3CJ8A 1HPZB 3QRPA 2W6LA 1W25A 3ENWA 1S1UB 3ENOA 3POTA 4GMKA 2FQQB 1NKEA 4IXCA 3C0BA 4M3UA 3KKFA 4FNIA 3ZTOA 3W9JA 2MGZB 1S99A 4KE5A 3LF0A 4W5OA 4DS5A 3FSXA 1WKLA 2P5GA 1VBXA 1HI0P 4IWVA 2VKRA 2E5GA 4FWOA 1YXQA 4CLZA 4YNQA 1RHMB 1Y11A 2DFHA 3BJYA 4DV1F 1OYEA 4QS9A 1KEKA 1F9EB 3FRYA 4NRTA 4B3MJ 2FF3B 4QIFA 3MMCA 4BDZA 1GMWD 5HQMA 2CJQA 4F02A 1BWFO 3CO0P 4F8RA 2V4JB 3RAQA 3LANA 1HYSA 2GVZA 1UKUA 2CA9A 2B4PA 3U02A 1GAOA 1WN7A 2VFVA 3OFFA 4H8KA 4ES3A 1BCMA 3FDSA 4RW9A 3OYBA 3FCWA 5GMKa 2GA7A 1VHXA 3WC0A 2QSWA 1NK4A 4ZPTR 1TFYA 2RH3A 4EMDA 3P45B 4DJBA 4QYRA 2C28A 1T8EA 3Q8UA 1JLGB 5IS2A 3RAXA 3R5GA 5KFVA 2AEJA 3CC4N 3FGVA 3L9ZA 2IHR1 4RLEA 3J7YP 1UW9A 4YOVA 3AY0A 3GV8B 1TL7A 4N76A 2HIYA 1R8BA 1HI8A 4DV6K 3ENQA 2ZBCA 2CQ0A 5JS2A 2EK1A 3W9IA 1VSIA 2P9SA 3ZT4A 3AVAA 1HRHA 4BREA 4FF2A 4BRNA 1QSYA 1T6DA 4AE5A 1NOZA 2EG1A 2F8HA 3AARA 2NLWA 5LSOA 4DQQA 3R7BB 2A1BA 4CEDA 1VSJA 2KRBA 3V9XA 3MAQA 2RHKA 1NJWA 4I7FA 2NXUA 1RT2B 3OLBA 2FGCA 1UVMA 4ATNA 1DEJA 2W9BA 1LOTB 3PTWA 2XY7A 3TAMB 2NR0A 1PO6A 2OSQA 3LH2S 3UDVA 3HHEA 3FZ2A 1T94A 1HKAA 3AXMA 3AVIA 4USKA 3KWIA 1C0FA 4WQ4A 4P2MA 1ATNA 4M5KA 2DRDA 2NRXA 4C8LA 3O9UA 3BH6B 2O5DA 3AD7C 4KHQA 1CQMA 4FXWA 3SI6A 1R43A 2LSNA 1ELOA 4YEAA 3RAMA 5HAOA 1SC3B 1VQ9N 4L8RB 1LAVA 4ZVFA 1O0PA 3CJ5A 2A2DA 4LFBK 2LFVA 3JXUA 4H5TA 3IUCA 1O5JA 2HS0A 3IR5B 3C3LA 5GAGI 4PG4A 4NMXA 2ZITA 3FMBA 3ZETA 2VGNA 4MT1A 1CJTA 2X1AA 2V6AA 3TR8A 4MIBA 4DSIA 2G13A 1GLJO 1VQ7S 3BM7A 3QBWA 1Z25A 1Z2LA 3DI6A 2XMVA 4PWWA 1IBCB 1UZHA 3PX0A 3VA3A 4I9QA 2EWHA 1JNZB 3H59A 2QWRA 1WOPA 3CJRA 4FDFA 4CEZA 3H7HB 1NJIO 3RG6A 4FWLA 3PVXA 3IC1A 1RA7A 4HR2A 4MFBB 2E2OA 1JLGA 3CJKB 1U26A 2RVJA 3MWBA 2YNHB 3LPYA 1M5VC 3QFUA 1FXDA 3NH1A 2YPYA 4G1QB 1TYQB 5LJVA 1J9AA 2P9UA 3KJFB 2ZH3A 3ZX0A 3PRVA 4A8MP 3HF5A 5EGYA 4R8UA 1BC6A 2VWBA 3PHTA 1REGX 4USVA 2Q6BA 5KG7A 3VOVA 4IDHA 4ZP9A 4EIAA 1X8DA 1P9QC 5E2QA 1HR0J 2W4PA 1ZYQA 5J1PA 3JAMY 1VQKS 3LWMA 5EUHA 2XYGB 3FFKB 3ZT3A 1GLCG 2A0FB 4DR2K 5E3PA 2D5RA 5KQ8A 1QZ6A 2BJEA 1HNZJ 1UVKA 1X4EA 3NCQA 3Q8YA 1HJRA 2RPIA 3LDNA 2WONA 5CR4A 3ONQA 2IYGA 5I3UA 3GJTB 1UPPA 2YQ0A 5L8RC 2EG2A 2IAJA 4QIWD 4M45A 1VQOS 2A3ZA 1N33J 2N82B 2Q79A 1F0XA 2MQQA 3WUHA 4DZDA 3WNFA 2G8HA 1AROP 1VSKA 3CETA 2NNWA 4FWNA 2UUCK 1JMTA 3VQBA 2OPSB 3U1MA 2KU7A 2GNKA 2VOOA 4EBCA 2LDIA 1QAJA 2OPRA 2I5JB 5BRHA 4FJNA 1IR0A 1V5IB 2DGSA 5I42B 4HTUA 3T69A 1QY7A 5AR0A 1ROFA 3IMXA 4Q0BA 1C6VA 3DOMA 3O3GA 1RTDA 3GIRA 1RTIA 2UVUA 2XO6A 3VQSA 4DCPB 2J4RA 2OPQB 1GLAG 4JI6K 3WNEA 3CJBA 5J2NB 4EWTA 5EOYA 3B6PA 2BJ7A 3CUNA 4PQUB 4KFBB 4ZTJA 1VQ5S 2ATLA 4RBUA 3DAWA 1WSIA 2Q6CA 2I1RA 1ZAXA 1J5OB 1YJNN 3GB0A 4C0OC 1TL7B 1WOOA 1VRUA 4C98A 3R5JB 5HJXA 1URNA 2P9IB 3L7PA 4DSFA 3KDOA 4XPEA 1TKZA 3QATA 2XRIA 1N48A 2D0PA 2W6KA 4OQJA 1LFWA 3P4IA 4DG1A 4U9RA 3MPWA 4KHUA 4JK8A 1DURA 1AXQA 1ZXOA 4CGHA 3BSNA 1REVA 3F56A 4JI8F 5KQDA 2V34A 1XMBA 1WOQA 4ER8A 2CZVC 4DV3J 3LALA 2PMZD 5FROA 4M5MA 4EZ6A 3CHWA 3S41A 3OA9A 3HHLC 4JI3K 3OBYA 1PBUA 1FDDA 2DHXA 1HNZK 1ZPWX 2LQJA 2XHBA 2DNOA 4DPYA 4GC7A 4DTSA 4QYZJ 3PG9A 1HBUB 1TUGB 2PBDA 3M2RB 3CD0A 4IG3B 1U47A 2HBYB 2VC1A 4CFCA 2MLZA 2QKBA 1S1TA 3P6YC 4ECYA 5KPRA 1Y97A 4O3PA 2V7ZA 4J2EA 2J8AA 2EW9A 4P75A 3B54A 3MCPA 5D3GB 3RW6A 2E1RA 2G2OA 3VGLA 1X4DA 3GR1A 1KWMA 4OX9K 1NNEA 2HHHF 3A5LC 4H54A 2O1PA 2FHJA 5KFSA 3SV4A 2BTFA 4CRJA 3NGDA 3MAAA 2E4LA 4E2FB 3LDOA 4P74A 1K73T 1C1BA 4ZLJA 5AT1B 3H20A 4X64J 3TZWA 2ZBIA 1E6YB 1YKWA 4CJ4A 3UCGA 2F9DA 4ZN1A 3GQCA 1J53A 3I4HX 3H8YA 4GKJJ 5M2UA 1TGOA 3LP1A 3JQMA 1PYTA 3EL2A 3WT0A 4FM2A 3O5BA 1NRKA 3AA9A 1NGIA 3OFGA 3JAMU 1KVKA 4ZCKA 2J0QD 3CCEN 3QGHA 1YIJS 1TTHB 1AUDA 2IVFB 4X66J 2MQLA 2V8GA 3W63A 3KOAA 1T03A 3PZPA 3HPOA 4Z4IA 5AE2A 3MEDB 3UKUB 3RMCA 4F3MA 2BKPA 1RKIA 3C66A 3P5BP 5I4MA 1IBKK 4CHNA 4IKFA 2B5JB 2RT3A 1UJ5A 3DXBA 3TSQA 1BUXA 1OH6A 6AT1B 2CGJA 1S6OA 5T7LB 4BG9A 5K14A 3SCXA 4X66K 1S7IA 4NA2A 2L3MA 4DU1A 3ILLA 2PEHA 4AXJA 2NXJA 2HF3A 4L74A 5IWAF 4CCHA 4QW9A 2D7SA 2QV6A 1WSGA 4IR9A 4C97A 2RE1A 4NPOA 3F5TA 1HMVA 2E5IA 4FLWA 4HEA9 4JHDA 3K58A 2IPOB 3QNWB 4NO7A 4C8KA 1EKSA 1FKOA 2ROPA 1RWKB 3HMJG 4A61A 4B3SK 3Q8RB 4DV4F 3GMGA 1RT1B 2CPXA 5HRPA 4O0NA 2B9EA 5FLXO 3QEIA 1RBSA 4GKKK 3W2VA 3HBTA 3THWB 4UY85 4QU6A 2R8KA 3U3GA 1BGXT 5F8LA 4ZHRA 2KYZA 3HHLD 5BYSA 4OLOA 1C1AA 5LM7E 4UF4A 5AJ3K 3IP0A 3DRPA 1Q8IA 5AQSA 5ETQA 1NKCA 1V4TA 2W01A 4JP8A 4TU7A 2BQ3A 5BN9A 3S1TA 3LQVA 1VQ9S 4I2PA 4I2QB 2IVPA 3H4DA 5ADXH 4CJEA 3CCVN 3R3LA 2P8IA 1HBUA 3H5UA 1D09B 5ETTA 3PW0A 4A5AA 1LW2B 1NK0A 4F3QA 4O23A 4TY8A 4BRAA 4NCBA 2CH6A 4IJNA 4XPCA 4I6WA 4JYAK 2GC8A 1FA0A 2DTUA 2CVIA 3OHBA 2P2CB 1QAYA 3G8TA 4CJSA 2GO8A 4IOCL 1WHWA 4DEZA 3CGIA 4PG7A 1XNQJ 8AT1B 2ACYA 3CPWR 1BXNA 4JRQA 3SQ4A 4KBIA 5HVFA 2J0XA 3QWUA 4KFBA 3HOTA 3D0GE 2QC3A 3HVAA 1CJKA 2LQ8A 3HM8A 3NEKA 2LMIA 2YQ3A 1PYOB 2OKQA 1CJUB 3CJ3A 3MFHA 2CUYA 4DR2J 3GV7B 4OJHA 3RU0A 1T02A 4M5LA 3D45A 2CDRB 3GJSB 1RILA 2K2PA 3K8VA 3GU0A 2ADCA 3KMQA 5KG6A 1GXTA 2Y9HA 3BSAA 2A42A 2OYQA 5T7BA 3TX8A 2ZHBA 3CC2S 1FHTA 3HK2A 2ASMA 3DLRA 3VESA 3G87A 3CDEA 1CS4A 5A6PA 1RDAA 2DKOB 4LSZB 4DR1F 1YG0A 4RW8A 3S8SA 4OI6A 5JMNA 4DV1K 4X4UA 3MM9A 3SSSA 5IT4A 1HNXF 1Q7YT 4J9NA 3S6EA 3SBTA 5LMUK 1DKGD 4KGZB 2IM1A 1TUVA 3D2FB 3AVBA 2DNPA 1P27B 3NF8A 3HI9A 4WF9L 3CJTA 4RWWA 4WK3A 3IWXA 1LNQA 2P9GA 3LTOA 2B6AA 5AE1A 2CQCA 1N33F 3JXOA 4PXBA 4CGIA 3WEEB 3PW4A 3DRXA 2D0BA 4B1YB 1VBYA 2HURA 1T95A 2F65A 3OJSA 2ZC3A 3IFRA 1TV6A 4JI7J 2FVQA 2NS1B 1PBAA 3UE5A 1VRTA 2CNLB 1HQ2A 1FNOA 4I68A 2K3KA 3VGVA 2UU9K 3EKUA 5C10A 2MZQA 1D0EA 4M7YA 5AQJA 3ID8A 5L1LA 5AQKA 2MQPA 3T6BA 3NHGA 3MURP 1YJ9N 4X4SA 3NNCA 5HP1B 4QIEA 4CJWA 1QHAA 4DX8H 1T9UA 2B7CB 2YKPA 4EI2A 1DQ9A 3E1YA 1TVRA 3S3OA 3VZHA 4FJ9A 3JSMB 1H7WA 4K2JA 3H25A 4DR6F 3OYIA 4OZ3A 4WFBQ 4L76A 1XIQA 2HBLA 1RAFB 3ULDA 4UUWA 2EVZA 1C0UB 2WCXA 2XY6A 3KUEA 2BX6A 2FIUA 4H0YB 3TUIC 2O01C 2OAUA 5KFOA 4EU0A 2WW4A 4DN9A 3NGUA 4F4ZA 1X1PA 3HFZB 1UEKA 3THYA 2IDEA 3U6FA 4X65K 2R7TA 1C0GA 4NA1A 5A76A 3T7ZA 4K4TA 3PKYA 2QMXA 2LVWA 2DR6A 4OJ1A 1A5WA 2VBXA 3VN5A 4FWPA 4OVLA 1XI1A 1FJEB 4DR5F 3D0PA 5LMUJ 3VPZA 5BXIA 3KK2A 4WFNL 4WPAA 1FRJA 5L39A 1NB7A 1QDUB 4I64A 4LRAA 5CYQA 3AAWB 4ED4A 4KTQA 4B3SF 2E1MC 3CG7A 4CHPA 4OLAA 3TTFA 4CJUA 1WSFA 4E7HA 1C1CB 2XI3A 2HQDA 1LW0B 5J2MB 4FN5A 4ZP6A 1V4SA 1EX4A 2PN6A 1TK8A 1R8CA 3CCQN 4FVUA 3G8QA 3N4WA 3BF1A 4USWA 2X6SA 1ATRA 2DCUB 1OSDA 2W8KA 1S79A 3VF0B 1QUVA 1ASUA 3KLHB 1Q4RA 4P7TA 3W8GA 4OYZA 3CT9A 4CF8A 4OZ1A 1X3NA 1ZBLA 4Q2LA 2DTJA 2ZHAA 1ZBFA 3CDAA 3CJ1A 4JI4K 1IWAA 3SCJE 4JI4F 3I8DA 5GAEI 1A9NB 4JI0J 1S10A 3VENA 1LV5A 2E1AA 4UOCA 2XB2D 3HVWA 4QU7A 4JKCA 1MA9B 4BROA 4MMOA 1VLOA 1RAGB 4Z94A 2DGUA 2OD4A 2BM1A 1RTIB 2YCHA 4YOEA 4MO5A 4BRQA 4NLBA 2QM1A 3P4UB 4I7FB 2PY5A 2C3PA 1S1WB 3SQOP 2CVEA 3Q8PB 3B6BA 3O9QA 4BBYA 1Y5NB 5HJYA 3BKUA 3AGRA 1JLAB 4G1PA 4DX5A 4DV5F 4CD1A 1LWEA 1U6BA 4P73A 2M0GB 5LJWA 4C8ZA 1R0AB 3D7EO 3TZYA 2I9SA 1JLBB 1Q5YA 1RTHB 4TQRA 1YX2A 1OWXA 4QS8A 3D1OA 3TTDA 2HGMA 3HJFA 3RSEB 4OZ5A 4OYWA 5KFNA 4O3QA 4CO4A 2HBZB 3D2WA 4CEBA 3W5ZA 3W5XA 3NAHA 2CJKA 2RUGA 4ZHRB 2O8BA 3MECB 4HVZA 1RU1A 2RE2A 3TAEA 1WJ9A 4W5TA 3UDCA 3WIUA 3OUYB 2VCPA 2KJVA 1K73O 1FKAF 2HEKA 2ZWPA 3Q83A 2QL5B 2BZ2A 5C2GA 5KFMA 3M6GA 3H08A 1JIHA 1H38A 3D5MA 2FY1A 4WIQA 1WSHA 3S3MA 2WBRA 3L7OA 5J1EB 5AXNA 2GQ2A 1RT4A 2G8IA 2R2RA 2G8FA 4JK7A 1CJKB 3RZAA 2Y8WA 3N5FA 3UKRB 3L2UA 5DMRA 1MWKA 3C2PA 1RHUB 3SCIE 2KKZA 1VI7A 5HROA 4JV2A 3SDEA 4ECUA 1RDDA 4PXEA 3QLHA 4NEZA 4J5OA 1GXLA 4PCQA 2DO4A 4FZVA 4WTYA 2MQ8A 4CDIA 3OXLA 4QOTA 1NPPA 5K8OA 3GFHA 4H5RA 3Q24A 5AQHA 3ZZTA 2COLA 5H9FJ 4PABA 3J7ZT 3RB4A 2BRLA 2SXLA 4N41A 3IR7B 4JI3F 3IAYA 2ZD1A 3NBPB 1XMQF 3KLFA 4YB7A 4QR1A 1N33K 3L95X 3TVYA 3LM9A 3DDKA 3VQ6A 3PRBA 5DG7A 4P2FA 1E6VB 4IH5A 4FP9A 2LA4A 2DNHA 4B3MF 1NJXA 4FSVA 3SMPA 5EVZA 1P6TA 2FBTA 4WP3A 5J2QA 3T1HF 2R2TA 2WVBA 2WB4A 3O44A 2IBOA 4Z4FA 2YKQA 2IA6A 2UVRA 3MD1A 1BMQB 2ZJRQ 2XG8A 4WXOA 4AUKA 2CPIA 1ASVA 4MLHA 3GLJA 1V3SA 4DR4F 4IOCQ 4DUZK 3N4QA 3LW5C 1H2VZ 4RW8B 1CC8A 1RCXB 1KQSM 3ZZUA 3G10A 4YOWA 3MMAB 4OZ2A 1NAQA 1TKTA 4ED6A 5GMDA 2ZUGA 2MLYA 1Q78A 3WX8A 1CG2A 4WU3A 2J0SD 2IDLA 3HJVA 1F2HA 5KT6A 3BGRA 4DMZA 4J91A 3SFUA 3SQ1A 4CM2A 4JI6F 1RAJA 1KQSR 1BA0A 3W5YA 1G2EA 3M32B 3ISNC 3EDQB 1Z05A 3D54A 3G6VA 5HLFB 1A5VA 4WTOB 3QLHB 2P9IA 4IYQA 2DHSA 2RAQA 2WK4A 4DQSA 2RU9A 3W62A 3SJHA 4G3IA 2V8PA 5HI7A 4IG0A 4WKRA 3GJRB 4Y2MA 2BKNA 1RWPB 5C25A 2BOPA 2NPIA 1NXIA 4AXIA 4C3MA 3EGWB 2Z58B 2Z0GA 3EXCX 4J9VA 2G1HA 3PX4A 1IJFB 3J7YU 1CEZA 1HWLA 5D0EA 4UOGA 1G3OA 1CULA 2G0IA 5ETOA 3UN2A 2DGOA 4BQZA 1IKXA 4KV8B 4LQ9A 2WSCC 2DRAA 3QIPA 2W2PP 1IM6A 2MDAA 3DGPB 4FJGA 3A5NC 3K5NA 4CJKA 1CZAN 2C22A 2MKJA 2DY9A 3HSTB 3J7AP 1XR7A 4H0PA 3QZ8A 1RHJB 3C19A 1KKHA 5D77A 4Y0FA 4FOEA 3ZSZA 3HSDA 4OYIA 1REVB 4CLPA 5HQLA 2OTJN 2E1ZA 2GAHC 3TSPA 3CFPA 4JKDA 3VGTA 4KHNA 1CXQA 4W98A 1WF1A 1VS3A 1VQ4N 3PIOQ 3PSIA 3MR2A 2HZVA 1T9YA 2UXBK 1N6QB 5FIIA 3FZLA 4X4QA 1MU2B 4DMNA 3KG0A 1RWVB 3FZFA 2CZ4A 3RR7A 1Q16B 3DXKB 1VOMA 4EBEA 4PWDB 1EWQA 2D3OR 2DY4A 3QYYA 4QWBA 1FE0A 2P5OA 2CQPA 3OQ2A 1NGDA 3IS9A 4B3RK 4LF6J 5HSPA 4KYZA 1F9HA 1WHVA 3JSBA 2FD2A 4M5DA 5AQUA 4EYHB 1S1TB 2QRRA 4ZVGA 4HTIA 2DR5A 2KVIA 3CEDA 4ZVSB 5DO2A 3HFVA 3DDNA 3J81O 1J27A 4DR5J 3D9BA 3CPEA 2BJ8A 2UXDK 2R42A 1NOYA 3HULA 4JI2F 1NM1A 1WBDA 4KJIA 4BDYA 3RW7A 1RT7B 4P2XA 1FTRA 2ZOMA 4DV1J 3OYFA 3QAUA 4ISEA 2YXLA 1VHIA 4OI4A 3MM9B 3ZZPA 3DRSB 1SJ4P 4S0MA 2DNMA 2LKZA 1KN6A 4E7KA 3KK7A 2OFGX 5EX0A 4JAXA 4E89A 2YWFA 1N8RT 3J7ZO 2RKIB 2EK6A 4QR2A 2HKEA 1C0TB 4MDBA 3W61A 5BYQA 3PR4A 2BE2A 2OEMA 4BRMA 4DFMA 4OHYA 1HBNA 4TYBA 2BYCA 3HVTA 4FK4A 1HNWK 1JLBA 1UFKA 4RG8A 2DIVA 3FBEA 1YITS 1U1QA 3TJAA 1WKJA 3JSRA 5D15A 1K8KB 1W26A 4IDKA 3UKUA 1LWCA 1WWHA 2RDIA 5KFWA 5FLXU 2AQ4A 1V5VA 2BEFA 2F9WA 1U8WA 3O6QA 4DSJA 2VBWA 5IV4A 2OA8A 1OH7A 3QT5A 2FXUA 4IH6A 2HLTA 1PAEX 4CE9A 4UOFA 4CZHA 1S6PA 1V3RA 1MMDA 1K1QA 4E8UA 3MWTA 3AO1A 1UP1A 2PA3A 4WWSA 4CLLA 1JJHA 1APSA 1S3XA 4DV7F 4HDHA 1RT6A 4K4YA 4JLHA 3NGRA 2V2KA 4RW7A 4O8KA 3R9LA 1TK0A 4CZKA 4DN0A 1NMNA 1ZBSA 2YX6A 2NCKL 3VAMA 3MX2A 5H9EJ 3MN6A 5FDLA 1D1UA 4CZGA 3NS7B 1FESA 5IV3A 1G6BA 1R6YA 1CC7A 4YHHF 2GQCA 1JQGA 2F63A 2QGFB 4HACB 1FK9B 3JQKA 4KGXB 2JJ4D 5DK5A 2MSSA 3HSJA 2M70A 3ZSVA 4BC5A 1X9SA 2NRWA 1YHQS 2IVNA 1XNQK 1NKBA 1UJ6A 4KH1B 3GONA 2XWYA 2ZE2B 1DGKN 2HQ3A 4BC9A 4OYOA 4NZ6A 4EBDA 4R5PB 2H4WB 3KUHA 3GFYA 1K47A 4TNOA 1VSFA 1VMBA 3A12A 1A7GE 2R7WA 1KVJA 1RDRA 2ZHOA 2NYHA 3VAHA 3D2EA 3V6HA 4ZPWR 5FPEA 5EXWA 3CM6A 2DFFA 3FEXB 4K8XA 4JOUA 2RDDA 3E2EA 4WCEL 2DHAA 5L46A 1QTNB 4CGJA 1H6KX 1B70B 3PSFA 5KFZA 4CECA 3PIOL 2Y1RI 1RDBA 4FJXA 2I6WA 2JWKA 3UD5A 2HYIB 4O3SA 4DR6K 2RKIA 3N4PA 4CHQA 5BRDA 3M8PB 3R6MA 4ISFA 1Q95G 1RDUA 2VB6A 3THXA 3ITHB 4EYIB 2K1RB 2W7PA 3HI0A 1TELA 2HHHJ 2X3GA 4OI0A 4CGDA 4WK1A 3IFEA 1ZPVA 4XO0A 2CQ4A 3CI5A 3H90A 1S6PB 3QEXA 2D1CA 1ZBUA 3QJPA 1IKXB 1S72S 4OZJA 4NCGA 4IJAA 4GVEA 4WE1B 3GYXB 4ZPAA 4CM0A 4ECWA 1T7PA 4LFAF 1JLCA 2J6TA 2J7KA 4CJVA 5EX3A 3M1VA 2O8FB 3A8JA 1S1VA 3BO4A 3SEOA 3AOCA 1VQNN 2A6OA 1CLFA 4FK0A 3FE1A 4IUFA 5AQPA 3OR1A 5D4LA 4EAHD 3VAFA 2P9EA 4D3HA 2VG7A 1BIUA 5CHIA 4X4RA 2NUBA 4WIIA 4DU8A 2LXIA 1LWXA 4XTTA 4CK2A 2FC8A 3CPWM 2HSTA 5FLXY 3KLHA 2VFTA 2VPYB 1W97L 1VBZA 2KHDA 2VD3A 4JD2B 3N01A 2GO9A 4FPRA 3K59A 3NVMA 4DQPA 1UVIA 2R3VA 2ZZNA 2LECA 3I31A 1FCAA 4Y2CA 4MO4A 4AQYK 1S59A 3SAGA 3EGZA 4GO5X 4BGAA 1BL3A 1OS5A 1QAIA 4NB4A 3FBFA 1N5SA 1WEXA 3UPFA 2QFIA 1IKWB 4FBUA 2MYFA 3ISND 3HZ6A 3AAPA 2JLEA 3O9RA 1TFWA 1S0NA 1LQ9A 2CYYA 4KO0B 1C1BB 1HKCA 4YOUA 3VHQA 4UQTA 4H0VB 2AKWB 2KH9A 4B1VA 1M90T 4K8ZA 5A8KA 4BR5A 1T3NA 2UVVA 3KJVB 2UZAA 1SVDA 3M6WA 5ETRA 2VKZG 3DJCA 1FRIA 2HLUA 3PM9A 1VSMA 4EUVA 1YJRA 3MM5B 2VODA 4IO8A 1P9YA 5F8MA 4I69A 4TN2A 4KKOA 3KLIB 3PR5B 4FWMA 2EC0A 4ILMA 1Y4ZB 4I67A 3THVA 3UD4P 2GQQA 3VQ9A 2W42A 3IM9A 3CCUS 3DHXA 2IM0A 2GIFA 2N3LA 4YDXA 2W4CA 2PD1A 3CCLS 1FNXH 1ZM3A 4MQ3A 4FJKA 1IKYB 1RBVA 4X4VA 2NPFA 5F3TA 2I8EA 2R4FA 3PHEA 1Q5VA 3FCVA 4DV2K 3BN4A 1NLVA 3H40A 3P39A 2DVIA 2P9PA 2RJZA 2F8SA 3JTNA 2Q1LA 3CCRN 4RNFA 2CH5A 4B3OB 2ASDA 3O1LA 5C2CA 4DTMA 2OPSA 2E9TA 4K8RA 2EHGA 4M63A 3VGKA 5KFGA 3EX7B 3K2YA 2HPUA 5KOXA 1IUJA 3W3SA 1PJ5A 4DFKA 3ZEUA 2CQHA 2DT9A 3JYTB 4F9OA 3HSZA 1URRA 2J9EA 1DLOA 2FLNA 1HNVB 1SZ2A 2Y0BB 1YJWN 5GMEA 2DPIA 1BLUA 2FTRA 4FYDA 4DCJB 2AWZA 1TL5A 1NU0A 2H3GX 5GAHI 4USUA 2VG6A 3ZZYA 2KFZA 1HQEA 3KLGA 1NZ8A 4MTPA 1M5OC 2A5XA 4W5RA 1LW0A 1RABB 4Y2IA 3TA1A 4CIOA 2MKHA 4NA3A 4BRFA 1BHNA 4EEYA 1VQPS 4DI6A 1SH3A 2KYXA 4B1ZA 1N32K 5BYRA 4I2PB 1A6LA 4LBIA 2FZKB 3ATUA 1LWEB 1SJFA 2AJFE 4IOAL 2B56A 4RBTA 1WAJA 2YJEA 2WVDA 2IMWP 3OL8A 3KK1B 5FD1A 1A0OB 2PC6A 4X66F 4FJMA 4CZJA 4E1JA 3L0QA 2VFRA 3CJ7A 3TRGA 2LCWA 1BI4B 3VQ4A 2YVSA 1RYSA 4J9SA 1Q81O 1BQNB 2ZDPA 3QETA 5KAKA 1K8AO 2ATQA 2GS8A 1HW9A 5KFRA 3BQ2A 3THTA 3NGZA 1Y7PA 2HBJA 2PFUA 2M4MA 3HZGA 3M30A 4DLEA 3VCDA 3QO9A 5KT3A 3D6MB 4BRIA 3UQSA 4RNOA 4DR7F 4EO8A 1KAYA 3VVUA 2E2QA 3UR3C 4KPCA 2QA2A 4DR1K 1K0TA 4A59A 3K57A 3PX6A 3PCOB 5JVHL 1HBMA 4OHWA 1X31C 3ZX3A 2V9WA 3PJXA 1VQ5N 2OIHA 4UTGA 2UP1A 2J9DE 1OJ4A 2O8BB 4N56A 2MPUA 2KT2A 4AHCA 3NWRA 4DCHA 3LZIA 2GTDA 4YB5A 3A0IX 3BN7A 3N28A 2H1YA 1NSQA 4CJFA 4KC5A 3EE9A 3UKRA 3LA0A 3UW1A 2ZH4A 3ETMA 1JLCB 2CPYA 3LDPA 4JI0F 5HBMB 2W25A 3SIPB 4RW6B 3MXHP 3CF5Q 1NHKL 2MJNA 1DBDA 3V2UC 3MOJB 2DNKA 2VQEK 4DHYA 4NLCA 3C15A 1IWGA 3GFXA 3W2VB 4YDUA 3CB4A 3VF2A 4J9MA 4E7IA 3PYEA 2PO4A 2JDJA 5MLCQ 4JKEA 2E2PA 3TX0A 5D78A 1VJWA 1R31A 4ZS6A 5ETSA 4RCHA 1C4AA 3T1AA 3VA0A 4CO5A 4WU2A 4BC7A 3KLEB 5ETPA 1T05A 4PRFA 2CQDA 3AXKA 4PQUA 3MMAA 5FJ4A 2YJFA 4A8SA 1UAXA 5SWMA 2KLAA 3LM2A 1BY9A 3A5MC 1FDBA 4PQAA 2VA3A 3K0JA 4TU9A 1N6QA 1QSLA 1IBMJ 2CXEA 1ZETA 3AV9A 3IM8A 4PR6A 3KVGA 5HATA 1VISA 5AJ3F 3A8EA 4LR7A 1JCFA 4LVOP 1CJUA 5EWGA 4B17A 3AO5A 1FT8A 4URSA 3G4SS 3N9UC 5CYQB 3ZSXA 4LR9A 3ZTPA 3QJLA 2M8HA 5BPNA 2F9TA 3G8SA 5KFAA 3P8BB 4ECXA 5D8HB 4CBWA 4I6MB 2EBGA 3NNHA 2R2SA 2ZD1B 1ZM4A 1NGEA 4BVOA 3PYFA 1QAXA 1XC9A 1UA1A 4X2BA 2CNOB 5DG8A 3PFOA 2VF3A 3RRHA 1Q79A 4ZITA 2F5GA 3KWGA 2GGPB 4WF9Q 3O3FA 1AUSL 1RT5A 4KHPK 3KD5E 4PYDA 2B4OA 3AVKA 3U1LA 4ALZA 1VRUB 4JEPA 2HMPA 2HMIA 1PAUB 5J2PB 3GWCA 1DTTA 1KD1T 2YBVA 4FYWB 2V2QA 5F1XA 2CQBA 1JWWA 1V9OA 1VDHA 1T9VA 1QVGR 1RGVA 2B4JA 3NGYA 1SPBP 3GJQB 1IKYA 3I6PA 5I3PA 3MMVA 1NGFA 3MF5A 4TVAB 3B78A 4NLYA 2HF4A 2O66A 4X65J 3L4IA 4JI0K 5F2RA 2UV8A 3BO2A 3TQ1A 2PMWA 3W9HA 2JLFA 1DTQB 4KGVB 1NH7A 5JLHA 3D1HA 3A3OB 1EZZB 5KFFA 2UUCF 1YT3A 4ANCA 3E9PA 4I56A 1XJWB 4CZLA 1F3VA 3M3ZA 1NSPA 3ZZZA 2GHWA 2BANA 3TO8A 2Z56B 2OMLA 1FERA 2VQFF 1D8YA 3PLAA 4ED2A 1S9FA 4ED7A 4LREA 3RB0A 3V6DB 1JK9B 2NXNA 2ZKTA 3O3HA 3BV8A 4DWIA 3H1VX 1U0HB 4F2SA 3CDUA 1X4HA 1NGCA 1N5TA 3CCMN 4B9NA 3Q2TC 4YDUC 1VIOA 4F26A 2QA4S 2HHXA 4RBVA 1ASWA 4L72B 2RQKA 4MJKA 2BJ1A 5M1NA 3LGNA 4PG5A 2HBKA 2HK3A 5AQGA 3CF5L 2ZVIA 2DNRA 2CPDA 1X7VA 2R7OA 1Z6RA 4G9ZA 2NUHA 1RT3B 5DZ6A 2POKA 2K1RA 1WORA 4OL8A 3H0PA 4DV2J 3M30B 4EHUA 3DLBA 4OX9F 1RP5A 3MEDA 4HHTA 4U95A 2X1BA 4I1TA 2QK9A 1YVNA 2FZCB 4JI5J 5C7PA 2QTDA 2OP5A 4K4XA 2JGUA 3GG0A 1RNHA 3LO3A 5LT5A 3CC4S 4DV6J 3QMQA 3MI7X 2W9AA 1H3DA 5H1SV 1YJVA 1KVIA 5AE3A 2Z1IA 3UR0A 1FI4A 4C9DA 2FPHX 2FJBB 2DK2A 4ANEA 4K43A 1UWBA 2G8UA 2BH1A 1YGYA 2AGQA 4LC9B 1RAIB 1JLEB 3P38A 1IR2A 3CJQA 3EVOA 3FKBA 4OYXA 1UOCA 3AVGA 1HNZF 5FPDA 3R9PA 4CH0S 4HUFA 4X4PA 5IC6B 3CCRS 4ZVRB 3TSUA 1YK9A 5ETNA 3P1GA 4JI7K 1S5JA 2QA1A 4X4NA 2FJXA 2RD5C 4C8NA 1C0TA 1YJUA 2JVRA 4J2AA 3V6JA 3OVNA 1Q9XA 5FRMA 3VQEA 1LW2A 3ENHA 3RUBL 2F8MA 4YS2A 3VEOA 2XNQA 2UUCJ 2KL8A 2LEAA 2QL9B 2AGPA 1TUUA 3HVTB 4GV3A 3ZTQA 2VQFJ 2Q66A 1BA1A 3KKSA 1JLQA 2R8JA 1KVBA 5IXUA 3UDEA 2XGQA 5GAHP 4KAZA 1HLWA 3DU5A 8RUCA 5AQIA 3VQ7A 2C2NA 4CJPA 1TVRB 5GAEU 3DC2A 3S7RA 2HNDA 1YRTA 3HPGA 4U67Q 4DFPA 4OZNA 1FDAA 3MR6A 3WZ0A 3U8XA 3HKZD 4BR4A 1FRHA 2CPZA 2YKNB 2JEGA 3MMBB 3QGGA 2CFXA 1ESVA 3AJDA 5D0RA 3LGMA 3WNGA 2V4RA 2I38A 4ECZA 1TKTB 4DR7J 1J5EJ 1EP4A 4M5JA 4OI1A 3PIPL 1N5QA 4RW7B 1RFQA 3KXDA 1WSJA 2HHTA 2XZWA 3QEWA 1VHFA 2KT3A 4ZK7M 3K5MA 3DLJA 4E1NA 2HNYB 1BIZA 2U1AA 4Q8EA 1G7CB 1JJ4A 4KRWA 3TYTA 1JL1A 4O4GB 3ADAC 4OHVA 5JICA 3QBXA 3T5KA 2NUUG 5AQXA 1HJOA 1FKPA 3OSNA 2QSFA 2KM8B 5KG4A 4IFVB 1AZSB 4FZYA 3D7SB 4R8UB 2W2MP 1WC0A 2BACA 2Z1GA 1YTYA 4HCCA 3POTB 4RWXA 1U1PA 4M1KA 2HFZA 1WC4A 1WELA 4DU3A 4DL3A 1CS4B 2V52B 2J6SA 2IRYA 1BISA 2VWKA 2R2UA 3KMSA 1KLNA 5HOOA 4DTJA 1XNRK 1X60A 4AH9A 3A3NB 4DL7A 2ASOA 4CEAA 1CBKA 4H0TB 2ZWHA 4C1NI 2ADBA 5IM0A 4TQSA 2WC9A 3NCRA 3A8YA 2AJ4A 1RQ0A 1YBAA 2J9CA 4YDDB 4FJ5A 3MTKA 3ETOA 3ZO7A 2MMYA 2MZJA 5THWA 5B0AA 4H4OB 1TK5A 3FSYA 4XDCA 2R8IA 4DQRA 4BE2A 2YX1A 5L1JA 3SMZA 3QESA 3I55N 2FVSA 4CZIA 4P71A 4GVBB 3D66A 4B8AB 3M7VA 4DG1B 3SCLE 1YBUA 3NLCA 2DD8S 1IBLJ 2HFOA 3I32A 3R7SB 1T9TA 3C6UB 3CD6N 4GKJF 1JLFB 3C65A 1UEVA 3ASMA 2L48A 4AYBD 3ENVA 3BEGB 1NGBA 1RWWB 3ICLA 4OFZA 3FNNA 4JYAF 2A1RA 2ITMA 2OLWA 5K9FA 2GWJA 4R25A 1HKBA 4WKYA 2VUGA 1JKHA 3BF3A 2E7WA 4KPYA 4TYAA 3KHYA 1YI2S 4LF5J 4BS2A 3R1HA 3FZKA 4PG6A 4CZEA 3OHRA 4BRDA 3EJMA 4DLGA 4N77A 1DY3A 2KXHA 2E44A 4DR3J 3I33A 2DEIA 4A48A 2A18A 1KTQA 4NLVA 4OGCA 4C11B 5IWAJ 4J9UE 4EP5A 5CYMB 3M2RA 4MK8A 4KI4A 3OYGA 2E6MA 2JEJA 1R8AA 2F7VA 4G1IA 1IQTA 2BJDA 1Q82O 4YR2A 4ETZA 4GKKF 3V1QA 1Q7YO 4YB6A 1FRMA 3J80Y 1U0SA 3RVCA 4HCBA 1SQKA 2LXUA 5DLGA 2F4VJ 2R8HA 1H72C 2VDHA 1WC3A 2RQCA 2N7YA 2FHJD 4YHHK 5HRSA 1TAUA 2YKNA 2O67A 5BR9A 4AF1A 3IBFB 4IQMA 2H65B 1BQNA 4AILC 2K06A 3CD5A 1KVCA 4LF8J 4CLTA 5KFXA 4PL7A 4DV3K 3TW0A 4NLTA 3TOQA 4USIA 1CLQA 1RDCA 2P9NA 1RHRB 1WC1A 1UWAA 3J8AA 3M6VA 2YNFB 2AEMA 2FZGB 1N36F 4IZ9A 1RCOB 3GZ7A 2OH2A 1K9MO 2ZE2A 1FD2A 3IXQA 1IBKF 3C95A 1TAQA 4ZVQB 3FMWA 4UQGA 2MKYA 3W3DA 1FXXA 1Y5LB 1T03B 2MEWA 2M7SA 4J9PA 4F25A 2V67A 3B6OA 3IRWP 2K3IA 5E5NA 5J2MA 2WZ1A 3VF4A 3V81A 2I0XA 1SKSA 2I2YA 2VG6B 3AA3A 3P31A 3E8OA 1UTAA 2VL1A 1PC4A 3DLKB 3CERA 4O0JA 4CJRA 4J2BA 2VG5B 1QQOA 3QT7A 4I6MA 1D5AA 2UXCF 4CGGA 2WSEC 4HKQA 1UVJA 4LFCK 2ZVSA 2E66A 9ATCB 4QW8A 2B4UA 4NYOA 2O8EA 5ETLA 2E20A 2YNFA 2DYAA 1U2VB 2VGMA 3DXMA 1U25A 1WACA 2W8LA 4FLYA 4JI2J 5M1KA 4BRKA 5KFUA 4NXMJ 1D9FA 1V6HA 4Q0BB 3HRGA 4EK2A 2Q31A 3QFHA 2WOMA 3LPTA 4JI1F 4IKAA 3H5XA 1RTHA 2DNNA 2CG4A 1IV0A 2YH0A 3K8WA 1B4SA 2B3TB 2FC0A 2ZBQA 3EN9A 1T05B 2AMCB 3S9HA 4ED5A 4R5PA 4IOBA 5E3CA 2F8EX 2JWLA 1KOHA 3AA5X 5CAAA 1ZBIA 2V4JA 3BYPA 2PFDA 2V8HA 5H9EK 5AQMA 4KGMA 1HR0K 4KHSA 6FDRA 3OTOJ 5AQQA 2F4VF 1Y9OA 3M8SA 2UUBF 4QPXA 4LF7F 3NS6A 4MYTA 3R97A 2GUIA 3TAGA 1KQFB 1NK9A 3SXLA 4KHPJ 3V1OA 3NF9A 2PYJA 3SQGA 4LR8A 2OD6A 3NRBA 5U47A 4BVPA 2ZDOA 3OR1B 1E6YA 1F1BB 3DLHA 4H5VA 1I1GA 3M5RA 5J2NA 1GMUA 4DPOA 1VC0A 4UY8T 3TWHA 1KNZA 3MN7A 1CVJA 5CA5A 1IM4A 3V81B 4DTRA 4NLSA 1MW7A 2IY5B 2UUAK 4W4MA 1LWFB 4U8YA 1YRUA 4CEFA 1XNRF 5HP1A 2XLKA 1SS6A 2HFVA 2GVDA 1QQNA 3TEGA 4NX9A 3P96A 2BQUA 3CC2N 1FJGK 3AO4A 3OPKA 1NDKA 2FHOB 4IDKB 2W2NP 1NM2A 4V1Ak 1EO1A 1BCOA 2ILYA 3W65A 2QWQA 2XHWA 3IBCB 4ZCMA 2VHGA 4FKYA 4H5WA 5HL7L 1FE4A 3AJ1A 4GY2B 1GLDG 3KIOA 4DPXA 5F8GA 4KY3A 4NLXA 3EM1A 4Q7AA 2A1SA 3SBGA 3AHPA 2RS2A 3WXLA 3D3BJ 3BBCA 2X6NA 1X4CA 3U9DA 4NLOA 3VAIA 3NXZA 3L7UA 4LF1A 1GEHA 2EI5A 1L3KA 1J5EF 1VQYA 4FWRA 2AJ2A 4CVNE 3R1XA 1MROA 1IO2A 3AT1B 4ES1A 2AF6A 1FWKA 4BCAA 5KOWA 5SZTA 3MAHA 3KUGA 3OUYA 4CF0A 1AA1B 3M2VA 4JNEA 4CBUA 1DRZA 2HNZB 4DR2F 3VEVA 3AY9A 4LF9F 2ZFHA 2VWJA 4WYBA 4AM7A 3UO0A 4RW6A 2AYBA 4AT1B 2E29A 3IA0A 1S12A 4IRKA 2V68A 4I6AA 3VVTA 2HVHA 1VJQA 2E5LF 3AA2A 4DR4K 1S48A 1OYDA 3IDHA 4BRHA 2XMWA 4IOAQ 4DR7K 1WUAA 1JXBA 2E5HA 3O5TB 1IH7A 4LMZA 2P9LA 4QWEA 2ZOFA 2HFNA 1SJRA 1B99A 1FVSA 3NGTA 4LIRA 2LEPA 3BPDA 2UUAF 1C4CA 3GILA 3UCUP 4J9QA 2LQBA 1WLJA 4KT0C 1UFLA 5D4NA 4QPTA 3ZLJA 2FC9A 2IRXA 5I42A 3RTVA 1KDNA 4MK7A 3D67A 1U1MA 4LF5K 5GIOA 3I55S 1XMOJ 3T3FA 1VFJA 2D9OA 4ED1A 3EKSA 4ZVUB 3CYMA 3O4QA 3ZSQA 4NLQA 3CCVS 3LP0B 2NRRA 3RGIA 3UD3P 5KT4A 1N32J 4OPHA 2H54B 2RQMA 1BDGA 3MD3A 1M1GA 1FFGB 2AZ3A 2M8DB 1JB0C 2X51A 3NCPA 3G6EN 1JNRB 2C42A 4GKKJ 1ZTWA 3CJ2A 1TL3B 1QHTA 5DQHA 2ZM6K 5C2FA 5LXRA 4ID5B 4C3LA 4OHXA 3MM8A 4M8LA 1ZZFA 1MDUB 4F7VA 2IC3A 1RACB 5F3ZA 1IG9A 4LRFA 1SB6A 3MXJA 4ZOSA 4A47A 4JI1K 2FB0A 1QUPA 2XYHB 3H3NO 2GHPA 2UYTA 1YTAA 4NXMK 5HMXA 5B8HA 3C7NB 3AJ2A 4F3TA 1EQYA 1Q8BA 3DXSX 4PWUA 2MZ1A 3NGSA 1LXJA 1I94K 3QB0A 1HBMB 3G2XA 3NS5A 1KOOA 2GELA 4NXNK 4H4MB 3DYAA 3H5SA 4RKUC 5J1NA 1GQEA 2B0GA 4GV9A 4CH7A 2Z4PA 2YWGA 1YJTA 5E3RA 4USTA 4TU8A 2OPPB 1BHLA 2QO3A 4WFAQ 4KB7A 4J9LA 1RISA 2PFFB 5KFIA 1SV5A 2AW0A 3HXMA 4DX7A 4FF3A 3AO3A 2ZF5O 4FZXC 3PYDA 1NZAA 1UETA 3MR3A 2QA4N 4FKXA 3M1VB 2O8FA 4DFJA 3A8IA 2ZM6J 3VEXA 3D28A 4ELVA 4C0HA 2BXJA 1FKPB 4LJMA 3T9NA 2C2EA 4RPFA 2ATCB 2QWPA 2BJ3A 2YWWA 5KFHA 4N5SA 3FSIA 1J5EK 3L4BC 2QWMA 3SQ2A 2HHQA 4CJLA 3U4LA 2D69A 4YOYA 4LSNA 3VEYA 2ZC4A 1VSDA 3BSOA 5C24B 4I2QA 1U1NA 2B51A 3HX9A 3O4WA 3N6NA 4MAKA 1SUQB 3BKTA 4F4YA 2XC9A 2QLJB 1HPMA 4UOHA 1GOBA 1OVQA 2XYPB 3LL3A 3OBWA 3NAIA 1YSJA 1WKKA 2IYIA 3MM7A 4O44A 1L3SA 2VFSA 3OYLA 3WIVA 1KR4A 4ECSA 4Z4HA 3OYDA 3KLEA 3Q0AA 4C2MA 8ATCB 2OEJA 1DQ8A 3K5OA 2V8DA 2J6UA 4UT4A 1EWRA 1JLEA 4IFYB 5LL6Z 4V19J 5I3UB 4R0JA 2HW3A 1FXLA 2BM0A 3G86A 2QEXS 2EX3A 3DHWC 2Q3PA 3VQCA 4CHYA 3UWTA 4X64K 2OPPA 4YY3J 3H42A 4GW6A 5HMWA 5KTQA 3KLVA 4Y65A 3A1YG 4MKAA 1S4FA 5GADU 2YNIA 3L6QA 3FZMA 1ZTTA 2AJQA 5CYJA 5A8WB 1XMOK 3EE3A 1SJ1A 1B92A 4AL6A 5JJBA 5EWEA 3DRSA 3CNQP 2G4BA 4JB8B 2ZH5A 2XWXA 4Z4EA 4CLFA 4CEEA 4FYVB 4WQ5A 1WG5A 1YZ6A 1N0VC 3PNIA 5KG5A 4FJJA 3GL1A 1QQCA 2NXCA 2PMHA 4AHRA 3MCOA 4DUTA 3ITHA 3G6XA 3LZJA 4U7UD 4OO1J 1HPZA 3CCJN 1NGHA 1FD8A 1RBOB 4HYKA 4A5BA 4CIGA 4OKJA 3CIMA 1WHYA 4LF4K 2MQMA 1OIAA 3T1YF 5F0WA 4U7UK 4C8MA 3QIOA 1NU4A 1R0CB 2WTFA 3FCHA 4F0HA 5B0GA 2X7IA 5SUHA 1CJVB 5KT2A 3GIJA 2WSFC 4CIEA 2AP6A 4USMA 4ZA1A 5HO4A 4CLKA 4ECQA 3G9CA 3PY8A 3KLFB 2XMAA 5EY4A 4M3YA 1JX4A 5EDWA 1C0UA 4CJ7A 2CADA 1VGYA 2XEXA 1VK3A 3EWGA 4MIWA 3K89A 3J80O 3DN9A 2D74B 2ASPA 1HKGA 1HL6A 3M6XA 1NGGA 1OMSA 4F50A 3C46A 4ZVEA 5M1FA 1K0VA 4CEOA 2FF6A 3DLLL 4IO9L 1YLXA 2OI2A 5B0FA 4ZP8A 1G15A 5GAEP 3KKRA 2RU3A 3NWGA 4AHVA 4OX9J 2R7UA 1F9FA 3OR2B 1U1OA 3SUPA 1CSJA 2J5AA 1VQ4S 1MMLA 3LPUA 2E2NA 1XHZA 1HD0A 3GCWP 5FPNA 1R8HA 1Y64A 4NLUA 4EO6A 3MX5A 4NE9C 5K8MA 4OJRA 2W2OP 4C23A 3EGVA 3H98A 5HMZA 1FK9A 3PW5A 1MWMA 1SC1B 1N36K 5JVHQ 1YUWA 3WQPA 2E9RX 2ALZA 4UZBA 1ZZNA 3MPVA 2YQ1A 2DXFA 1FJGJ 4JS5A 4XH5A 3W1YC 2PI4A 5KPTA 2DIUA 1SKRA 5RUBA 5IQ6A 3SSRA 1K8KA 3OL6A 3MM6A 5A8RA 3H3OB 2ASYA 1HIYA 1RBLA 3K17A 4XDDA 1JKHB 2BKOA 1HNWF 2KRRA 1CZBA 3MEEA 2A40A 2MKCA 1XK8A 1R3NA 2MZRA 4DUZJ 2GVDB 3V4MA 1TL1A 5KG1A 1OVYA 9RUBA 3BZCA 2QN6B 4BE0A 1HNVA 4BC3A 1WSEA 4O3NA 2QKKA 2MXYA 1M5KC 3DLGB 4GMJB 1S9EB 3CD7A 1U6ZA 5CZ2A 1RBRA 4X65F 3CCZA 3I56S 2OGUA 3TPQA 2OPQA 4NYZA 4ZLPA 2JRSA 1Y00A 2EFVA 2QX0A 4BC4A 2GFFA 3V4IA 5HRNA 3QNNA 3OS2A 2ZH9A 4M3ZA 3VWSA 1FJCA 1VYAA 4U96A 1WEYA 4K4VA 4CJQA 4CP5A 4HT5A 2VDIA 3WX4A 2CQ3A 4DF4A 4HWIA 1H73A 1VQ6S 1HW8A 2ZM6F 4FLZA 1QQMA 2ZNYA 5TKYA 1MN7A 3I8BA 2YKMA 1S97A 2D3O1 3QFPA 3CCWA 5AQLA 2YY3A 1WSVA 4FPAA 2BJ9A 4CF9A 5DG9A 2WTUA 3EUNA 3G6ES 1RBAA 5MAOA 4CBXA 2XS2A 1RAHB 4CJ3A 3HHLB 1X4AA 4I6YA 3DM2B 3NCIA 4B3RF 3SZ2A 3IO1A 2ZKUA 3FEZA 3I5AA 1RU2A 5E84A 3DLGA 1EHWA 1JJCB 4ID1A 2HNZA 4NL5A 3DXKA 2J76E 2ZJQL 1FDNA 5E26A 3TR5A 4YMEA 3AH6A 5HLFA 4KTWA 3THWA 4FL9A 3VF6A 4KHRA 4A46A 3K5LA 1WNSA 1NNDA 3CXCR 2Y1LB 2E7VA 3JS6A 3EICA 1QJHA 1YTUA 2HHUA 3AOBA 2B8PA 3KHRA 4C0BA 1RT2A 1VC6A 5AFUH 2G1DA 4O8UA 1OKJA 4IFYA 3J7YI 3EE8A 2WW8A 1YBTA 2MTLA 2YNGB 5LY3A 2QTWA 3J80U 2IA0A 4JRPA 4M5HA 2FLOA 3A5OC 2G2ZA 3L3VA 4PG8A 1CQNA 4L6V3 3MTJA 3BZKA 4AM6A 2NREA 4WE1A 4CT9A 3G25A 3Q8QB 3VTHA 4NYFA 3MEKA 1Q18A 1SXLA 3EY1A 1RAOA 3DDIA 5J2QB 1MWZA 1QVGM 1D9DA 3HHKA 5LMNJ 3BB5A 1SC6A 3Q86A 1M5PC 2D0CA 2DNZA 1H98A 3CCJS 2XS7A 2H5IB 2JFKA 1SH0A 4MH8A 3PXGa 3M8QA 2XI2A 4QYZK 2XZTB 5KGXA 4L3KA 1GTEA 3KZBA 1IBLF 3RR8A 3CQ8A 2ZWOA 1UW4A 2BW2A 3HT0A 4Z7YA 3HDSA 2IGIA 1D3WA 1B9DA 5E3AA 4LF4F 4FS1A 4ZPVR 5KFLA 1M90O 1GT8A 1KC8O 1RWUA 4C1NK 3J81Y 4LF6F 3BUZB 3KHHA 3R6LB 2G8WA 5EWFA 4ECVA 3CJCA 3DWLA 1Q7LB 2CGLA 5KFDA 1HWKA 3I5BA 1NH8A 2H48B 1K6YA 3TAQA 4HH0A 3LDLA 1KCFA 2UXCJ 1H1VA 2DXDA 4L3NA 3MM5A 3QJJA 4H0XB 4NMLA 4CLYA 1S72N 1HHSA 1T3VA 5AQYA 3RBZA 2KFNA 3R8EA 3TEHB 2ALYB 3WDOA 5I3QA 1LAWA 1RLDA 2GMJA 5CQGA 3Q8SB 1LKZA 1LWFA 3F0NA 1NPKA 4DX6A 4OV1A 2WVFA 5E41A 4JN4A 3MUMP 3KWMA 1YJNS 2QL7B 2CGKA 4CLUA 2FSNA 3IGNA 2CKWA 3PJWA 2B9XA 3VAJA 2DGTA 4ELUA 2GW8A 1ZOTA 5H1SQ 2YTCA 3WEEA 2HMIB 2IIRA 4B9UA 1VQPN 1AZSA 4KREA 3L4QA