2RF2A

Hiv reverse transcriptase in complex with inhibitor 7e (nnrti)
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
557
structure length
554
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7
publication title Novel indole-3-sulfonamides as potent HIV non-nucleoside reverse transcriptase inhibitors (NNRTIs).
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 157
structure length 554
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2rf2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rf2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rf2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rf2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2rf2A05
1YVFA 3G10A 3LPUA 3DI6B 2HHQA 5HROA 4DTJA 4FBUA 5DQHA 3SQ4A 1W9HA 3AVFA 1G15A 3QZ7A 4LH5A 3C6TA 4PA1A 4B08A 3K5MA 1KFDA 1C1AA 4U6PA 3SI8A 3H5XA 3SPYA 4IFVB 2ATLA 3AA4A 3DLGB 3GIKA 1GOBA 3H98A 5F9NA 4ICLB 1UA1A 1K1QA 1LV5A 2KFZA 2XI2A 3OHBA 2VA3A 1JLCB 3CWJA 5HRNA 1UOCA 3CFRA 4J9OA 1WNSA 4QCLA 5KFTA 3U3GA 3OYLA 1VSEA 3KD1E 1S9EB 3ITHA 4NCBA 4DSFA 3ALYA 3NL0A 2G8KA 3PW4A 1C1BA 1R0AB 3AA3A 3TAQA 3BGRB 4HVJA 3S3MA 4FJHA 2V4QA 2RN2A 2X74A 3SCXA 4JS5A 2YNIA 2VG6B 1RNHA 2ZQBA 4OGCA 3MXJA 1D1UA 3KOAA 2YNFB 3NDKA 4DQQA 1HQUA 3QO9A 1L3UA 4O3PA 2HHTA 1SV5A 3K5LA 4O4RA 3G6XA 2IM0A 3G0ZA 3MECB 2HNDB 4J2AA 3AVIA 4O5BA 4Z4FA 5C25B 3QESA 3K5OA 1UA0A 3Q8QB 1FKPB 3K2PA 3M9MB 3CFOA 4WZQA 4FVMA 1QSYA 5F8MA 5KFJA 2F96A 5DGBA 4DG1B 3OL9A 3OYEA 5KG3A 1W25A 3D45A 3BQ1A 4IDKB 2IM3A 3CJ0A 4GVMA 3SQ0A 3HHKA 1S1UB 2YKMB 4DSIA 2WK4A 2I5JB 3O4NA 3HPOA 1XI1A 4IG0A 1LWEB 3SV3A 3IN5A 5K14B 3RB0A 4JLHA 1T05A 4DTXA 2W9AA 1X9WA 1N4LA 3IS9A 3ICLA 1S10A 1RYRA 5JS2A 5KFQA 4QW8A 4CJFA 3V9SA 4MQ3A 2V0NA 4MKAA 3KLEA 5T7BA 4IH7A 5DG9A 3H4BA 3KLIA 3WNEA 1RBVA 4F50A 4FJGA 3KK3A 1A5VA 5KG6A 4ECRA 2GV9A 1DTQB 2ASDA 1NJYA 1RT1A 4J9LA 5I3UA 4B9SA 2HNYA 1ZBUA 4FXDA 2D0BA 4NLGA 5KT5A 4DEZA 3D28A 3HYFA 1EP4A 1L5UA 3MAQA 1GX5A 4I7FA 3NH0A 1T7PA 2XCPA 1CXQA 3QIPB 2UVRA 1KLMA 4K8ZA 4CJ3A 5J2MB 3OL8A 4RNNA 3LAKA 3KK2B 2QV6A 4BACA 1KVCA 2DFHA 4OPKA 2GC8A 2ETJA 1FXXA 5DMRA 3ZSWA 4CJLA 4WE1A 1Y97A 4Y34A 3OS0A 1BIUA 3TAMA 3SJJA 4FLUA 3AA5X 4E7KA 3PV8A 3O3GA 3PJWA 2FJXA 3ZT0A 3F73A 2ASLA 2I1RA 4CEBA 4QWBA 4X2BA 2D41A 1JL2A 2WRMA 1VSMA 1HYZA 4OL8A 5C24B 4WXWA 1HNVB 5L1LA 1Q9XA 1I39A 2XHBA 2HHXA 2IC3B 4EO8A 5KFNA 1WNEA 1SKWA 3DRSB 4ZHRB 2W9BA 2YNHB 3OYMA 4EP4A 3PVXA 4FK2A 4Q5VA 1S1XA 3DLEB 3DLKB 2XWYA 4CJTA 3AVKA 4IRDA 4PQUA 2JEIA 5FDLB 4YR3A 1NJWA 4J9QA 1NK7A 4MK7A 5J2QB 4MKBA 3T5LA 1YTUA 3NCIA 4N41A 4CGHA 3E01A 1IKWA 1J54A 4RNMA 4XIUA 4DLEA 2RF2B 4DF4A 4K4SA 4PWDB 1SH2A 3TANA 3IG1B 1HMVA 1RTDB 1LW2B 1JLEA 3KHHA 1BISA 4CEZA 4M45A 2OPQA 3FQKA 1C0UA 4ZMMA 2BQRA 3UDLA 2FVQA 3HSTB 3EY1A 4XO0A 1ZBHA 2J6UA 3ZCMA 2OA8A 2WCXA 3L2VA 2P1JA 3HPHA 1U09A 4CFAA 3IRXB 5F8GA 4PUOA 4Z4EA 3VQCA 3HVWA 1FKOB 4IKFA 1TK5A 4YR2A 5I42B 2IMWP 2Y1JA 3L2RA 4TN2A 1S6PB 3T5KA 3HL8A 3ZSQA 3NBPA 4FS2A 4DL5A 1RT6A 3DMJB 1C1CB 4RZRA 3NKYA 3HVTA 2O4IA 3LWMA 3BSCA 4CHNA 1YT3A 2A1RA 1SL0A 4DS5A 2QK9A 5KG0A 3VN5A 4ZPCA 1ZBLA 3HP9A 5FRNA 4CHQA 3BQ0A 1QQCA 1SUQA 4FLZA 3LP2A 3EPGA 4YNQA 3CFPA 4G1QA 1NK4A 3CDUA 4IFYB 2DPJA 4M3RA 3C6UA 2ILZA 1JKHA 4NZ0A 4RW9A 4M94A 3MFIA 1HQEA 4DL2A 1IKYA 2P5GA 2AQ4A 4FJLA 5CYMB 3L8BA 1S0MA 4LY7A 1NK5A 3MEDA 3H08A 3L3VA 3Q8PB 1CXUA 4FZXC 3VQPA 3BDPA 4HCCA 1D0EA 4ED1A 3UIQA 4I2PA 1RTIA 2AWZA 4MFBA 2G8FA 4C8NA 1JLFA 3PW7A 3ZSZA 4R8UA 3GIMA 3DOKB 5D3GA 4U7CA 1TKTB 3QETA 5KRSA 3V6DB 3NAHA 5EWEA 3HO1A 2ZD1B 1JLAA 1DTTB 4IQXA 3MEGB 3QEWA 5EUHA 4HCBA 3BJYA 1TKXA 4CERA 1Z25A 1REVA 1FK9B 4KFBA 2YKNA 2E9TA 4C8MA 2UVWA 4CIGA 2BE2B 5KFCA 3EZ5A 3THVA 5KG5A 1UWBB 1SH0A 3KK1B 3DRRB 4Q44A 1TKZB 3I0SA 2JEJA 4Y2CA 4DLGA 1WSHA 1QHTA 4FJ5A 4CIFA 4B9NA 3SUOA 4ID5B 4WXOA 5SZTA 2R8JA 4KB0A 2UVUA 4WFYA 1ZYQA 2XGQA 4EEYA 4TYAA 3TAFA 2RKIB 1S5JA 4TY9A 5DG8A 5HLFA 3PZPA 1BQMB 4OKJA 3O4QA 1RT3B 1LWFB 5J2NB 2HVHA 4KTZA 5KFBA 4M95A 1RAJA 2QE5A 3H5SA 1JL1A 3SZ2A 4KHUA 4BDZA 4RUAA 2Q3SA 3KHGA 1U47A 1U04A 4GMJB 1RTHA 3TABA 2JC0A 2YNGA 4O4GA 3SFUA 4CJEA 2PY5A 3N6MA 2BRLA 4W5NA 1ASWA 3SUPA 3MR3A 1QE1B 3KLIB 3AO1A 2OZMA 4CF2A 2JC1A 4ZPAA 4J9NA 1X9SA 3FFIB 3QIDA 2OPSA 2OYQA 3NF9A 3DOLB 4I2QB 1LW0A 4M3YA 4LSLB 3TAEA 4F3OA 3NE6A 4ECSA 1KSPA 2FC0A 2G8HA 1HARA 3DDKA 2JGUA 2P51A 4OLAA 1WSEA 3CJ3A 4RW7A 4ECTA 4B9TA 1WN7A 5F8IA 3AO2A 3P5JA 3NF8A 4CF0A 3AA2A 1C6VA 3DRPA 5C5JA 4ED6A 2IGIA 2IAJB 3ISND 5HBMA 1C0TB 4RW8A 3M8PB 4CHPA 1S9GB 3PHEA 4QWEA 2E9ZA 4NLRA 4QWAA 3SUNA 4CEQA 5KFFA 4KSEB 1VSLA 4QAGA 4EYIB 2HAIA 3G6YA 4CGFA 4TQSA 4Q43A 2GIQA 5KFHA 1CLQA 3QEVA 1JLBA 1IH7A 2LSNA 2QKBA 3VQ5A 3NF7A 4ED2A 4FJXA 1HRHA 3ZT3A 5HP1B 1TVRA 4J2EA 4RNHA 1IKXB 3QEIA 1IO2A 4PQUB 5KG1A 4CIEA 3OYNA 3V1RA 4FCYA 4O44A 4W5TA 3I0RB 3K57A 3GIJA 4OLBA 4KREA 1LAVA 4DQRA 1QUVA 1NK0A 4E1NA 4KB1A 1F21A 2IJNA 1RA6A 4E1MA 3GILA 3PR4A 1T03B 1K6YA 1JLGA 2HHWA 4DU4A 5KG7A 4FK0A 1XR5A 4RW4A 1TL1A 4EO6A 2WOMA 3MEEA 3QNNA 1TK0A 3RMCA 4WFXA 2W7OA 4QWCA 3I5BA 2J6SA 4C8KA 3T1AA 2D5RA 4Q8FA 4FJ8A 1QSLA 4K4UA 5CYQB 3OYHA 1GX6A 4IRKA 2E6LA 2F8TA 1X9MA 4IKAA 1J9AA 1TV6A 4KE5A 5J1EB 1ZTTA 3FRZA 3RAXA 3DLHA 1WLJA 3PY8A 5L1KA 1HNIB 2QXFA 3VQSA 1VRTA 1T3NA 4ZP6A 1WAJA 3I8DA 4HUGA 1D9DA 3KLFA 1IM4A 4EBCA 1KLNA 2DFEA 5CZ1A 3HVTB 3OVNA 4Y1CA 2R2UA 4E0DA 1KHWA 2UUTA 3LP0B 3G86A 3ZSVA 4Q0BB 1VSHA 1EETA 5KFSA 3KMQA 2OPRA 2IM1A 5KGXA 4DTPA 3B6OA 4FW1A 1VRUA 3K5NA 3M8QB 4B3OA 5J2PA 3DYAA 3KLGB 4RW6A 4OKKA 4ECUA 3L2QA 4CHYA 3OL6A 3VQ7A 1JIHA 2WONA 3T3FA 4F3TA 5E41A 3KJVA 4FZYA 1S1WA 4DFMA 4ZVEA 2R2RA 2HVIA 4RG8A 2ASJA 2G8UA 4DQSA 4Y1DA 4C8OA 1RT5B 5KFDA 3GV8B 2XI3A 4IR1A 1S0NA 5KT6A 4DTOA 1CZ9A 3WNGA 5JS1A 4H8KA 5KG2A 4IBNA 1LWCA 5C42A 4KPYA 5KT2A 1SL2A 3OY9A 3L2WA 4TY8B 1RBTA 2HMIB 1VSKA 2ZE2B 3S3NA 4H4OB 1KTQA 3TVKA 3CDEA 1S1VA 4CJWA 4R5PB 5L1IA 4NLOA 3RMAA 4K50A 1S9FA 4NCGB 3HVAA 2R8GA 4QWDA 2OPPB 2CKWA 1JLQB 3OYJA 1D8YA 3NMAA 4IH6A 2RPIA 4ZP7A 3MR5A 4LQ3A 3KLHB 3KIOA 3OYGA 2AX0A 4NLSA 3QEPA 4F2SA 3PO4A 5L1JA 4M3XA 3VQ4A 4K4XA 3BSOA 3PO5A 1XHXA 4FJ9A 2YHAA 3H5YA 1KCFA 2KZMA 3VQQA 3PR5B 1TL3A 4H4MA 4FM2A 2VG5B 1BQNA 4TXSA 3V9XA 3NGDA 3SYZA 1U48A 1S1TB 1U4BA 2VG7A 4DTSA 1RA7A 1HPZB 4CK3A 4RNFA 2AX1A 4TYBA 1TK8A 1NK9A 3QLHB 2GIRA 4K4YA 2C2EA 4ZTJA 4R0EA 3V9UA 4FJ7A 1RT2A 4FJIA 2A1SA 4OVLA 3JSMB 5KFUA 4M3TA 4CEAA 4FK4A 1IKVA 5KG4A 1BI4A 3LP1B 4KO0B 4KV8B 3CG7A 3AVNA 4O3RA 1N5YB 3GIIA 3HVRA 1N6QA 1RTJB 4ECYA 1RYSA 1TAUA 2BANA 2B5JA 2W9CA 1RT7B 3U3YA 1TGOA 3ZT4A 4TQRA 3OSPA 1JXEA 4RU9A 1B9DA 4NLXA 2B6AA 3OYCA 1HYSB 4BWJA 2IDOA 3C94A 4J9MA 4DTMA 1RBUA 3DI6A 4KHWA 3AVBA 5JUMA 4CJUA 1MU2B 3JYTB 3I5CA 5FRMA 2V9WA 4DL7A 1Q9YA 2VWJA 2WHOA 3DM2B 4B9MA 2R2TA 4CGIA 2D3UA 4NRUA 4W5QA 1RT4B 4EP5A 4TLRA 4IFVA 4LQ9A 5F9LA 5KFZA 2HNZB 4ZVFA 4NLDA 4DQPA 1U45A 1GOCA 4Z4HA 3OYFA 4ICLA 4F8RA 3RMDA 4KKOB 1DLOB 3NAIA 4M42A 3V81B 3AVGA 1J5OB 1ZTWA 4LSNB 1JLCA 4KHQA 3OSNA 1ASVA 4YP3A 2QKKA 3M8SA 1D9FA 3PX6A 1S6QB 3MXMA 3GV7B 5KFIA 3ZSYA 5DLFA 1S9EA 4G3IA 3ISNC 5HROB 2XGPA 1RBSA 3H5UA 2HWIA 4F4YA 3ZSXA 2XY5A 3BGRA 3H2LA 1NKBA 3HPGA 3NGIA 3KD5E 3C6TB 3FSIA 3PW0A 3HK2A 4J2BA 3EYZA 2VG6A 4N47A 2HHUA 1JXBA 3S9HA 2DTUA 2ILYA 4Z4GA 3FDSA 2XO7A 4CJVA 4J9PA 1EKEA 4YR0A 2YNFA 1N48A 4QPXA 3AV9A 4PY5A 3B6PA 1KFSA 3LZJA 1HJRA 4DSJA 4ZP8A 3QIOA 3L2UA 3VA3A 2HNDA 4CJSA 4B9UA 3KHLA 4O55A 3OJSA 5C25A 4KHRA 3ITHB 1BHLA 3CM6A 1VRTB 1FKPA 1C1BB 4I9LA 4JV1A 4DG1A 5KFRA 2YHBA 4NLVA 4IRCA 4ED7A 2YNIB 2AJQA 4IDKA 3QYYA 3RB3A 1X1PA 4J9SA 1N56A 3V4IA 2CJQA 1S1UA 3QGHA 2YKMA 3MXIA 3KLVA 5CY4A 1HQUB 1EETB 2I5JA 3QO9B 2D7SA 4CF8A 1SV5B 1LWEA 2G8VA 4CK2A 5K14A 4ED0A 3WNFA 4CGJA 2X6SA 3M8RA 2R8KA 3OYDA 1NKCA 4ELUA 3T5HA 3H4DA 3CDWA 4ED8A 3SQ1A 4KTQA 5KFXA 2E4LA 3NAEA 4B9LA 3SNNA 2Z1JA 1QSSA 1DTQA 4XPEA 3E51A 1UAXA 4O3OA 4NYZA 1S97A 4O3QA 3NF6A 4IG3A 3TAPA 2DFFA 4ZVHA 4IG0B 3KMSA 3QIPA 1T05B 4DSEA 1Q8IA 3KK2A 3IS9B 2AGQA 3QINA 3V6HA 4CJPA 2Y1IA 3KTQA 3VQ8A 3OLAA 1RDAA 2FBVA 4CHOA 1A5WA 4JRPA 5FROA 4ZP9A 3KLEB 4CJKA 3HXMA 2KZZA 3U6FA 3KK3B 4FJMA 4NLWA 1NKEA 3RB6A 4AHCA 1U49A 4M3ZA 1TP7A 1RT1B 4HYKA 2FBXA 5C24A 5I3UB 4NLUA 3AVCA 2HNYB 2IC3A 4CJ4A 3NGZA 4CFCA 1NJZA 1EP4B 4ZHRA 2YNHA 4Z4IA 4I7FB 4IH5A 3DLEA 3DLKA 4JS4A 2F8EX 3OYKA 4DTNA 1KLMB 5FDLA 2G8WA 1TAQA 3CQ8A 4BE0A 4WFZA 2BDPA 4OPJA 5J2QA 3HKWA 4WE1B 2FBTA 4NLQA 3TAMB 1WSFA 4O3NA 1VSFA 3MR6A 3I5AA 2IJFA 3LDSA 1SKSA 3SFGA 4N76A 2FLLA 4FLYA 1XC9A 4ID1A 4YQWA 2RF2A 4KHSA 2GUIA 1ZBFA 4URQU 1W0HA 4PWDA 2PYJA 3SUQA 3IG1A 1RTDA 3RTVA 3SQ2A 4FLTA 1LW2A 1Z4UA 3S3OA 3C95A 5KFLA 3SV4A 1BGXT 1RCHA 2UVVA 4NYFA 1A5XA 2W9BB 4BWMA 4K4WA 1S1XB 3BSNA 4F2RA 4J9KA 4CGGA 2O5DA 2FBYA 2HB5A 4ECQA 4CGDA 3LWLA 3IRXA 3GYNA 4HUFA 3AVJA 1FKOA 3VQAA 5KI6A 2HW3A 4K4VA 5I42A 3V6KA 1S6PA 1WSJA 4DL4A 3RBDA 4KI4A 3E01B 1IKWB 2B4JA 2Z1HA 2FVPA 3AVMA 3EZUA 3DMJA 4Y3CA 1C1CA 4UQGA 3QERA 2FJWA 4CF1A 1HMVB 1J53A 4DFPA 1JLEB 4DTRA 2OPQB 1C0UB 2J6TA 3P1GA 4I9QA 1C0MA 1SL1A 1XR7A 3CO9A 4IR9A 3T5JA 3N6LA 5DK5A 4M3UA 5DG7A 5KGWA 3AVLA 2ZKUA 4IFYA 4J2DA 4YFUA 4AHVA 3BREA 4PUOB 4CJRA 2NUBA 4Y2AA 4ZPDA 3QGGA 2RDIA 4FLXA 4EZ6A 5CYMA 1WSIA 2AGPA 4ELVA 3NBPB 2C2RA 1ZBIA 2UUWA 3OLBA 4F4KA 1RT6B 4JV2A 1NOYA 4CEEA 4EZ9A 3V1OA 1KVAA 3PUFA 3ZT1A 4KHNA 2Z1GA 4DFKA 2IOCA 4KHYA 2HHSA 1RBRA 2R8IA 3V1QA 1ZETA 4K4ZA 3K59A 4JRQA 4BE2A 3DOKA 2WTFA 1TKTA 3M9NB 1NJXA 2ATQA 5EU7A 1SUQB 1T94A 4FJJA 3V6DA 1L3VA 3LP2B 2ZD1A 4G1QB 4HHTA 4FLWA 4F4ZA 1DTTA 3O3HA 4RUCA 4WYLA 3MEGA 5KFKA 3MF5A 3C6UB 3OL7A 1JKHB 2FLNA 2EX3A 4QW9A 3A2FA 4RW9B 1HQEB 1FK9A 1IKYB 3M9OB 3VQ6A 2AGOA 3V9ZA 2KFNA 4KAZA 2BE2A 3MEDB 2DY4A 4MK9A 1RDCA 1UWBA 3OYIA 4I2PB 3KK1A 3DRRA 3TR8A 4KBIA 1RTIB 5EWGA 1TKZA 4MFBB 4WYWA 1EXQA 5JXSA 4Q8EA 1JLFB 4KB7A 3F9KA 2ITGA 4BE1A 4YMEA 4R8UB 4DWIA 4OGEA 4CFBA 4ID5A 3HJFA 1KHVA 2XY6A 5D3GB 4JUZA 2KQ2A 3OS1A 3V6JA 3ULDA 4CEDA 2RKIA 1JLAB 1B92A 3RBEA 1VK0A 1BQMA 1GOAA 3NH2A 2WB4A 2OH2A 1NHUA 1RT3A 2FVSA 1LWFA 5J2NA 4NLPA 1TKXB 3V4IB 1REVB 4E19A 4KFBB 1ASUA 2YKNB 1RDRA 4E7HA 1L3SA 2E6MA 2HHVA 4E7JA 3RRHA 2HWHA 3QEXA 3LANA 4FM1A 1QAJA 4J9RA 4EBDA 3I0SB 3VA0A 1YVUA 4CE9A 3P83D 4N5SA 3FQLA 4URGA 3OJUA 2W7PA 1QE1A 4DL6A 2VA2A 3ZT2A 5KFAA 4ECWA 3D5MA 3LAMA 5HLFB 3BSAA 2D3ZA 1TKDA 3FFIA 4MIAA 4Q45A 3TAGA 1O1WA 3DOLA 4I2QA 1JX4A 4LSLA 4DSKA 4IG3B 2W8LA 3SI6A 4E3SA 5SWMA 3OS2A 4L8RB 3HT3A 3AO5A 1QTMA 1CZBA 3NGYA 1RTHB 2YNGB 5KT3A 2X78A 4O4GB 3LPTA 3PJXA 4LH4A 4EYHB 2C28A 4B8AB 1S48A 4NRTA 2D0CA 2JEGA 2IAJA 1C0TA 3M8PA 3LALA 3QZ8A 4QOZB 2JEFA 4HKQA 4O0IA 1S9GA 3PX4A 4CJQA 4GW6A 3PW2A 3DLRA 2Z1IA 3CJ2A 5KFEA 4MH8A 4O0JA 1T8EA 3WNHA 3IGVA 5L9XA 2IM2A 4ZVGA 3KHRA 3LZIA 2OPSB 1I3AA 4FJKA 4DTUA 5HRSA 3CM5A 1LW0B 4ZTFA 1BCMA 3H40A 3NH1A 5HP1A 4FJNA 2KW4A 1IKXA 4F4WA 3CVKA 4KHMA 4CEFA 4AHUA 4N56A 5KT7A 2E9RX 4RW7B 2W8KA 3H59A 3BQ2A 4H54A 1YTAA 4WZMA 3T19A 3I0RA 3CJ5A 3MFHA 2F8SA 3ZSRA 3DRPB 5HBMB 4RW8B 1XHZA 4AH9A 1WSGA 1JXLA 1KVBA 2B43A 1T03A 4CHZA 2JLEA 3G6VA 2O4GA 3DLGA 3VQDA 1QAIA 5DGAA 4B9VA 5EDWA 3RR8A 4CCHA 1JLBB 2DPIA 3AVHA 2XCAA 4CK1A 5KFGA 2XC9A 4CECA 4MK8A 1TVRB 5KFMA 1ITGA 5CYQA 4ECVA 2GBZA 1WAFA 3OHAA 3GV5B 1VSIA 5J1EA 2BRKA 4O44B 3RMBA 4K8XA 4AILC 1HNIA 2IS3A 5F8HA 1R0AA 4ED3A 3KKRA 5DQGA 4CJ5A 4E7IA 5EWFA 4FS1A 4NLYA 1OS5A 3HP6A 1JLGB 5F8JA 5CZ2A 3IAYA 3LP0A 3RB4A 2EC0A 2FVCA 4RW4B 4AHTA 1TL1B 4NCAA 2WOMB 3TQ1A 3KNAA 3MEEB 4FBTA 4Q0BA 2XY7A 4FW2A 3CYMA 3RWUA 4TSXA 2X6NA 3MECA 2RDJA 4EBEA 4O3SA 4ZPBA 3Q8SB 2FVRA 4JV0A 1TV6B 5KTQA 1LAWA 4OKEA 3M8QA 3UR0A 2ALZA 3KLGA 3EPIA 1SH3A 3KLFB 1B9FA 2IBKA 4B8CA 5F8NA 3MTKA 1NK6A 4OJRA 2BQ3A 2VWKA 2R2SA 3IGNA 3O3FA 2PZSA 4DSLA 3D0PA 4DQIA 1RT5A 3N6NA 3CJ4A 4KAIA 4CEOA 4MIBA 2C22A 5KFVA 4DL3A 2OPRB 3ZSOA 3QNOA 4NYNA 3OYAA 1BIZA 3TWHA 2D0AA 1VRUB 1RDBA 1KRPA 4B3OB 3KKSA 5J2PB 3DYAB 3OYBA 4TY8A 4E7LA 2HMIA 4RW6B 1CSJA 2W42A 2ZE2A 3AO3A 3NHGA 1VSJA 1Z26A 4H4OA 4FZZA 2WONB 4FYDA 3KJVB 3VQBA 4R5PA 2P5OA 1XR6A 2BQUA 1S1WB 2C2DA 4NCGA 2IA6A 2V4RA 1NOZA 1NK8A 4M3WA 4DMNA 2OPPA 5F8LA 4CESA 1JLQA 4CFDA 3Q8RB 4F4XA 1BCOA 4AHSA 3UQSA 2G8IA 4GC6A 3KLHA 2BR0A 5DLGA 5KFPA 5J2MA 3RAQA 4C8LA 1QS4A 3CIZA 1EX4A 2FJVA 5KFWA 1LWCB 2XRIA 5C42B 3RR7A 4E89A 1S4FA 3PX0A 3AVAA 2VG5A 1RDDA 3K58A 4DU3A 4K4TA 4KRFA 5HRPA 1S1TA 3MR2A 3TARA 2OZSA 1HPZA 1S1VB 4NLTA 4XPCA 1NHVA 4M41A 4CF9A 3L3UA 1HNVA 4HTUA 4BDPA 3QLHA 1K1SA 2R8HA 1S49A 3DRSA 1D5AA 5KFYA 3VQEA 4FM0A 2R7YA 2BGGA 4W5OA 3JSMA 5DQIA 1RILA 3SPZA 4FLVA 1TQLA 3RRGA 4ECZA 3GQCA 1C2PA 3HM9A 2PYLA 4GC7A 5HRRA 4AHRA 4W5RA 3LP1A 4KO0A 4KV8A 1N5YA 1RTJA 4KI6A 1TL3B 5T14A 1RT7A 4H4MB 2AU0A 1BQNB 3BR9A 4LD0A 4KTWA 3NFAA 3AO4A 2YV0X 2VG7B 1HYVA 1HYSA 2XY8A 4DFJA 5KFOA 1I6JA 4DU1A 4ELTA 4URSA 4DF8A 1MU2A 3JYTA 4HUEA 1RT2B 1NNDA 3DM2A 3VQ9A 3QGIA 1MMLA 3ASMA 4Z0UA 4Z4CA 4IOBA 2EHGA 4DS4A 1RT4A 3DLBA 1XWLA 2HNZA 3V9WA 5KRTA 4ECXA 1IKVB 4RNOA 2KTQA 5KT4A 1BI4B 1SKRA 1L3TA 1IG9A 1S0OA 3LP3A 1N6QB 4KKOA 1DLOA 2FLPA 2BANB 3V81A 2B5JB 1BL3A 1VSDA 2W9CB 1J5OA 3TI0A 4LSNA 3PW5A 4BDYA 2B6AB 3UPFA 1S6QA
chains in the Genus database with same CATH superfamily
3ADAC 4A2AA 4R25A 2DY1A 2OAUA 4HHJA 4BVOA 3HSGA 5A0YB 4F7VA 5HROA 2OD4A 5H9EJ 2JL9A 5AQHA 1W9HA 1PYOB 2XTJP 3EJMA 3FBEA 4CM2A 1YG0A 2BM1A 3IP0A 3QZ7A 2E5IA 4JKAA 3K5MA 4IFVB 3GIKA 2GJIA 2V5HG 4QR0A 1BWFO 5M1PA 1IBKJ 2IVMA 1UA1A 1PAUB 1RU1A 4AFFA 1LV5A 2GJFA 4GKJK 1JLCB 4BLGA 3CFRA 4J9OA 2PA8D 1TL5A 4DUTA 2KVIA 3W62A 5D4NA 3M3ZA 2GWKA 3U3GA 1SJ3P 1S9EB 4NCBA 4DSFA 4U96A 2UU9J 4B3RF 1C1BA 1R0AB 3LF0A 1RHKB 3CJCA 3OW2M 2XS2A 1HJOA 3HFVA 4ILMA 2OEJA 4UUWA 1VQOS 1HBUB 4KYZA 3JQJA 2G1HA 4LFBF 1GNKA 3VTHA 3T41A 2PA3A 2QA2A 2ZGYA 1VYAA 2WBMA 4YOEA 2IM0A 2VQFJ 1NDLA 5ADZA 3GR1A 1WSVA 4K5RA 3AVIA 3DXSX 1QDUB 3D2EB 3QESA 2H5IB 4LT6A 1WHYA 1UA0A 3CCWA 4M5DA 3DGPB 1Q78A 1ZM4A 1UVJA 5HANA 1JNZB 5KFJA 3PJ9A 5CYJA 2N7YA 4GRSA 4ZCIA 4WBFA 4IDKB 3DWLA 3AD8C 2IM3A 3CJ0A 4DR6K 3SQ0A 1Q86T 3DXMB 2YKMB 4DSIA 1RISA 3O4NA 1D09B 2NLWA 1LWEB 3IN5A 3A8EA 1RAEB 3RB0A 3MWPA 4DTXA 4DV1K 1VQ7S 1N4LA 2CGKA 1WDDA 4F0KA 5AQTA 5GAGP 3K9KA 2R7XA 4MQ3A 7FDRA 5DG9A 3H4BA 4DUYF 1CULA 2HBRB 3MWTA 3P5TL 5LJVA 4DB3A 3MPDA 4WKRA 4ECRA 4CZCA 1NSQA 2ZNYA 2VICA 3M2UA 4FZVA 4BRIA 1WD6A 4B9SA 4X66K 4C8ZA 2NSCA 4V1Ak 4FXDA 2D0BA 3UNYA 4NLGA 2ZEJA 2MXYA 1AUDA 1PCAA 1GX5A 3NH0A 4B3SF 3N01A 1CXQA 3QIPB 1HKGA 2WUSA 4C2MA 2QV6A 4OYXA 3EL2A 2GVDB 2GC8A 2NZ4A 4X4SA 4KR0B 1Y97A 4CJ7A 4FWRA 3D3BJ 3OS0A 3TAMA 3KXDA 2EKYA 3JS9A 3PV8A 3O3GA 4K7QA 1OMSA 1BMQB 3CCJN 3QAUA 4CEBA 3JTNA 2WRMA 3RW7A 4WXWA 5L1LA 1Q9XA 1I39A 2HHXA 2PN6A 4O8KA 3DRSB 2J76E 1IBLJ 4ZHRB 2R7UA 3OYMA 2CQGA 3G8QA 5F41A 4Q5VA 1S1XA 2XWYA 4WFAL 1NCLA 2NZCA 1GMWA 3GFYA 3VF4A 4AE5A 1WF2A 4YUDA 4A59A 4AM7A 8AT1B 4CGHA 3E01A 3AD7C 3QAEA 2E5JA 4RNMA 5H9FK 2LMIA 3FEYB 5A6PA 1FRJA 4DV2F 5AE1A 4CI6A 2EBEA 1DHMA 5M1NA 4YHHJ 1YZ6A 1BC6A 1HBNB 3EGWB 1JLEA 1T95A 3A3PB 2K3KA 4UY85 1P6TA 2A42A 4HLBA 1FFGB 3M8WA 3HSTB 3E3XA 1HR0F 1VBZA 1ZBHA 3M2RB 2OA8A 2F4VJ 2ZBCA 5AQFA 4FPAA 4PUOA 3HVWA 1FKOB 5DZ7A 3K5PA 2C2MB 4CO1A 3M2VA 5ETPA 3L2RA 3P45B 4TN2A 2IRUA 1S6PB 2L48A 1SPBP 1XNQF 3HL8A 3KJNB 3KWIA 4AQYF 4KH1B 2O4IA 4NB4A 2CQ4A 1N34J 3P6YC 3VMFB 4DS5A 2XMKA 1B7YB 5KG0A 1U1NA 2CPXA 4ZPCA 1A0OB 1ZBLA 4KGKA 5FRNA 3D3CJ 1S59A 1NBWA 1Q4RA 4NL5A 4YNQA 2P9GA 1NK4A 1K8KA 1MG7A 1ZS6A 3EVWA 3M32B 1CJUA 5B08A 4RW9A 2P5GA 1X5OA 3N5FA 1VQ5S 2HHPA 2IIRA 3H08A 4HR2A 3BDPA 3IA0A 4ED1A 2Y8WA 2Q79A 2HQ3A 2ROGA 2GGPB 1BWVA 3PW7A 2DH7A 1GXLA 4YY3F 5HATA 4ZPVR 3NAHA 2BEFA 3HO1A 2EK6A 1JLAA 4F25A 4NXMF 4LF5K 1WJ9A 3MEGB 3QEWA 2P6SA 2V2VA 4FKYA 3BJYA 4U9RA 1N36F 4RTFD 3WXLA 1REVA 1N32J 4MMOA 4FYXB 3ATUA 2E9TA 5HL7L 3MM5A 2UVWA 3O4WA 4DPOA 4JI5F 2DO4A 5L9NA 1OPZA 4UQTA 1SH0A 3EE8A 3KK1B 3DRRB 4Q7AA 4ER8A 4BRFA 3UKUA 1YJWS 5CABA 4DLGA 4LR9A 1WSHA 4CIFA 4CNYA 1FA0A 3VEZA 3LUYA 1RGIA 1YJNN 3HT0A 2QWRA 1RWMB 2F1FA 4OX8A 5AE3A 2R8JA 4KB0A 1IUJA 4EEYA 3U02A 1AYEA 1OSDA 4DX8H 3TTFA 4NXNF 3V5RA 4OI3A 4TKTA 4OKJA 3TUPA 2HF4A 2HFUA 4M7YA 2EWSA 2G4BA 1RT3B 1LWFB 2VKZG 2HVHA 2F63A 3C14A 2JLGA 3BUZB 3ZTPA 2JX2A 1XMQJ 1U6FA 3HI9A 2VFUA 3J7AP 3CPEA 5GADI 3JSBA 4G65A 4UZBA 4CJEA 1MWYA 3FCHA 4W5NA 3EGVA 3SUPA 3KLIB 1HKCA 2F5GA 1NM2A 4NEZA 3MURP 2OP5A 1TFWA 5LL6d 2E7XA 5AZIB 2OZMA 2YX1A 3SSRA 4C97A 4CF2A 2E5LK 1S99A 4ZPAA 3CCQN 3QQCD 1HBOA 3QIDA 2H3EB 2GNKA 3DOLB 2X1BA 2VJVA 1I94F 4BRLA 2OFHX 4M3YA 1P9YA 2JVOA 1RAHB 1FD8A 1YI2N 1HARA 1FRMA 1V3RA 3SCIE 4NLBA 2ZM6J 4CZJA 2MZTA 1KTVA 3R5GA 1CC8A 5ADXH 3Q8UA 4RW7A 2DR5A 4FNHA 2Q3PA 2D9OA 2V4JA 3ETMA 3P5JA 4CF0A 5FLXU 2DGWA 4DPWA 3DRPA 2P9IA 1WG5A 2IAJB 5HBMA 3BN7A 1O0PA 2GMJA 2BE9B 2NUHA 5CD4H 3PHEA 2DT9A 3SJHA 5LMNK 4NLRA 4YORA 4QWAA 3OHRA 2AJ2A 1NU0A 4DZDA 1VSLA 1UTAA 4QAGA 4EYIB 1BXNA 2RQKA 2ZJPL 3CJQA 2GIQA 4QU6A 1JLBA 1IH7A 3BF4A 2CQPA 4WP8A 3A4TA 4FJXA 2VYPA 4RNHA 1IKXB 3O5BA 4PQUB 1V3SA 3OYNA 2G13A 3CETA 1HNWK 4JKEA 2QTWA 4O44A 3GIJA 2H65B 2I7NA 2Y1LB 4QS7A 1NK0A 3R7BB 3MCAB 3FEXB 1RA6A 3CNQP 1K6YA 2HBJA 3FMWA 5GAEP 2M3DA 1JLGA 2GQCA 3WXMB 1ZM3A 4DU4A 5KG7A 2IPOB 4RW4A 1TL1A 2WOMA 2DHAA 1R8AA 3HHLC 2EXUA 4QWCA 1J5EK 3I5BA 2J6SA 2BE7D 1X4BA 4JHDB 2FIUA 2KXFA 2VBXA 4EAHD 4K4UA 1GX6A 4DR7J 4IRKA 1X9MA 3TEHB 1J9AA 9ATCB 1TV6A 1MROA 4Y2MA 3FRZA 1WKLA 4ES1A 3DLHA 3PY8A 3VQSA 4JYAJ 4H4KA 3BF3A 1APSA 3C66A 4P2FA 3KLFA 1IM4A 4EBCA 1KLNA 2DFEA 4UOHA 4FWOA 4DXLA 3OVNA 1S77D 4Y1CA 1KP6A 2PMHA 1KBRA 3AHPA 2R2UA 5L46A 4PHTX 3LP0B 3PYEA 4ED5A 1VQMS 4X66F 3UD3P 3MEKA 4Q0BB 1YBTA 5KFSA 3PG9A 5EY4A 3CC4N 4L3KA 1KQGB 1NNEA 1URNA 2EFPA 2IM1A 5KGXA 4B9QA 4FW1A 1OIAA 5E7OB 3EO3A 4JI4J 2NRTA 5J2PA 1GXUA 1SJ4P 1U1LA 3KLGB 4RW6A 3J7YI 4V19J 3UNGC 4CHYA 3EVOA 1F5BA 4LUBA 3IBWA 4F3TA 5E41A 4FZYA 4ZVEA 4ES3A 5CHIA 2G8UA 1YHQN 1S0NA 1KN6A 2VB6A 3PRDA 1CZ9A 3TRGA 2POKA 1Y9OA 4H8KA 3FZBA 1VBXA 1D8ZA 2QG9B 4IBNA 3C65A 2MQPA 3TPQA 3R5AA 3HHLB 1SC4B 3KG0A 4KPYA 1KKHA 2W4DA 2DBBA 1V9OA 1SL2A 2CYYA 2EKNA 3T69A 5IFMA 3L2WA 1HWUA 5F3ZA 5HK4A 2RDDA 2AV5A 5AR0A 3G71N 2J4RA 2L9NA 3S3NA 5AQVA 3TVKA 3CDEA 1S1VA 4CJWA 1EWRA 4GVEA 5IXUA 5ITHA 3R27A 2AEFA 2CA9A 3HVAA 1JLQB 3OYJA 3CMAS 1D8YA 1NO8A 1QLNA 2R7TA 3KLHB 3LGHA 5L1JA 1QAXA 1G7CB 1LFWA 4OO1J 3ENBA 3PO5A 4ZN1A 1XHXA 4FJ9A 2VQEK 3PR5B 1TL3A 2J8SA 4DV6K 2FJDB 4TXSA 4P2XA 4UZCA 4GNIA 4D3GA 3SYZA 1RLCL 4X64J 5GAHI 1S1TB 2VG7A 1WEXA 2GO9A 1HPZB 5JLHA 3RUBL 5ADXA 2MKHA 4MYUA 3HZ6A 4DOZA 2C2EA 2DR8A 3V9UA 2XLJA 5C2GA 2O8BA 4DV7J 2E66A 4M3TA 4CO4A 1S72N 2FB0A 2LEPA 1IN0A 1NLVA 4QIFA 3D1QA 4CEAA 3HHEA 5HMZA 2XULA 4EMDA 3CCLN 5KG4A 3WDOA 4AXIA 1YJ9N 1WHVA 2ZC3A 2GHWA 4ECYA 2WB1D 4H0VB 3FMBA 2B5JA 4X4OA 5MLCQ 1TGOA 2COLA 4DV0F 3OSPA 2I2YA 5B0AA 1JXEA 4RU9A 4XEIA 3GYGA 5FPNA 1LWXA 1KQFB 5CAAA 2RAQA 5D78A 2DNZA 1ICEB 3VR1A 3GFZA 1HYSB 3TNVA 5AQSA 2IDOA 3UE2A 3C94A 2DKOB 4J9MA 2ROPA 4LF9J 1MU2B 3I5CA 5A0YA 5FRMA 4QS9A 4DL7A 1SIWB 2WHOA 2DGSA 2KKZA 3HZGA 2H48B 5H9EK 4BREA 4CGIA 2D3UA 4NRUA 4RWWA 2HQCA 4IFVA 5E3PA 2XLKA 2HNZB 2KDOA 1VQKS 5E3AA 3Q22A 4LF5F 1KD1T 3LA0A 1QD1A 2VWBA 1JLCA 4KHQA 4LF7J 1F60B 1M90T 1D9FA 1SI9A 4C0HA 3MXMA 1S9EA 4WFBQ 1B0TA 4RX6A 1NJIO 3ZSXA 3KJFB 2PDAA 3KD5E 3N4QA 2YPZA 3PW0A 3HK2A 3EYZA 2HHUA 2DTUA 1AZSB 2ILYA 1HBUA 2PC6A 3FDSA 2ROEA 5FLXO 3UO0A 2V2QA 4NYPA 2XO7A 4CJVA 4J9PA 1EKEA 3CUNA 1JCFA 3B6PA 1FERA 1KFSA 2DH8A 4JI3K 1VC5A 4DSJA 3L2UA 1S4EA 4YN3B 3NG8A 4ANDA 1KAYA 3DKDA 3KHLA 3CT9A 2VQFK 3OJSA 2E2PA 2WVDA 3D2EA 1VRTB 2OTLN 5E2QA 3DGPA 4OV6A 4I9LA 3TZWA 1VQSA 2HRUA 3WX4A 2W01A 3DRXA 2ZBQA 4IRCA 5ETRA 2YNIB 2KYXA 3BZCA 3CD5A 4IDKA 2R7VA 3RJMB 5LSOA 5ETSA 2IY5B 1N5QA 3V4IA 2JH3A 1KXPA 3QGHA 2YKMA 2E5LF 3MXIA 4Z7YA 3KLVA 5CY4A 1LWEA 2G8VA 2JWNA 2FQQB 4CGJA 2X6SA 3D9BA 4CZHA 2G0JA 1YSJA 2OLWA 2WZ1A 4ELUA 4IOAQ 3H4DA 4K2XA 2CNLB 4MIWA 3FGUA 2MMYA 2E4LA 1W2BM 1E3MA 1J6ZA 2J9CA 3SNNA 1T9UA 1BWEA 3E2EA 3M6XA 3NXZA 2CQ1A 4XPEA 3W2VB 5C7PA 3H6EA 2X3DA 2IVNA 5A8WB 2NXNA 4NYZA 4BRPA 1Y4ZB 4O3QA 3NF6A 1X0FA 2DFFA 2OMOA 3QIPA 3O9TA 3L4IA 2GVDA 2M52A 2AGQA 3SBTA 4CJPA 5AQRA 3AGKA 2ZJQL 3GIRA 2VIHA 2M9KA 1RDAA 5AJ3K 3J81Y 1A5WA 4JRPA 4K0KK 3DRYA 3VHQA 5KAKA 2E2QA 2MLZA 3HXMA 1G2EA 3H0PA 5CE3A 2CDQA 4NLWA 3CD6N 4AHCA 1U49A 4M3ZA 1OH7A 2BABA 2HBYB 4NLUA 5L38A 4U67L 2HNYB 4CZFA 4CJ4A 1WG1A 5M2RA 3DDIA 1EP4B 4BROA 1F6TA 4ZHRA 2MLYA 3WXKA 1VQLN 1IBLK 2FGOA 4BE0A 1J5EF 1UZHA 2BDPA 2DH9A 1FFWB 2A0FB 3HRGA 2HBLA 1OY9A 4NLQA 2OJ3A 3A12A 5K5MA 1VSFA 4CZKA 2DNKA 3LDSA 4TU9A 4ATNA 2FLLA 4FLYA 3L7PA 1NUEA 2UUAJ 4ZLNA 4XK8C 5LT5A 1TUWA 4KHSA 2VU5A 2W40A 2NXCA 1JJ2R 2ZVSA 4ZJLA 3SUQA 2KM8C 5K9FA 1HBNA 3S3OA 4FLTA 1WOPA 5KFLA 3SV4A 4YHHK 3TUJC 3NOCA 4K4WA 4JI6F 3O08A 4ILJA 3BSNA 2BJEA 4CGGA 2O5DA 3M2RA 3S8SA 2HB5A 3H1VX 2UP1A 4CGDA 2YTCA 2F4VK 3AVJA 1FKOA 2LKZA 4OJ3A 2HW3A 4K4VA 3HHDA 3WIVA 2AP1A 2D1CA 1VR6A 2MZ1A 4YOUA 1U1RA 1S6PA 4H5TA 2A6OA 3RBDA 3MD3A 3AVMA 3TZXA 3J7AN 2J8AA 3R2DJ 4UQGA 3QERA 4RBVA 2HOEA 1FWKA 2FJWA 1HNXF 2KXHA 4DFPA 1N34K 2OPQB 2VD3A 4I9QA 2DGXA 5IC4B 1SL1A 3CO9A 3CCLS 3FNNA 5DK5A 2Z58B 4M3UA 5KGWA 3AVLA 2DYAA 1ZOTA 3L9ZA 2AA4A 3SMPA 1HNZJ 4JI8J 2A10A 3QGGA 2G1DA 2LLZA 3WIUA 2HBQB 5LJ3Y 5KPZA 1WSIA 3QBWA 4ELVA 2V9KA 1UKUA 1GLLO 2B7BB 1RT6B 4JV2A 1NG9A 1NOYA 3I4HX 2GGPA 3R1XA 2DVIA 2Z1GA 2IOCA 5FJ4A 1UJ5A 1RBRA 2WFBA 1SKUB 3K59A 2QIFA 4BE2A 3UR3C 2ATQA 4HI1A 1P8GA 1RABB 2GAGC 3LP2B 5GMEA 3GE1A 2KM8B 5BN9A 4F4ZA 2GCFA 4JI1J 3MEGA 4GO5X 5FIIA 5FPEA 3C6UB 4ILHA 2J0QD 3BF1A 4CT8A 3V9ZA 2VV5A 4KAZA 3B82A 1N32K 3ZZYA 3MEDB 4CNZA 5AQJA 4JK9A 3ZETB 3WQUA 4I2PB 3KK1A 3DRRA 5CA5A 4KBIA 5EWGA 4DV6F 1CLFA 4LF6K 3RG6A 1H72C 1JXVA 1JLFB 4KB7A 5H1SV 2E2NA 2IIHA 4A48A 2KQ2A 3CJ7A 3CIMA 3V6JA 1B92A 1VK0A 1GOAA 2RS8A 3DHXA 4KGXB 1RT3A 2FVSA 1LWFA 1JMTA 2J0WA 2CGJA 3EGZA 3BN4A 4E19A 4KFBB 5B0EA 1RDRA 4E7HA 1L3SA 4U7BA 1K9MO 3NNHA 1VHXA 4E7JA 1RWKB 1QVFM 3O1BA 4LR8A 3RRHA 2HWHA 3QEXA 4J9RA 2PMWA 4S0MA 3I0SB 4OZ3A 5IWAJ 1X60A 4KHPK 2FHMA 3LO3A 2W7PA 2PI4A 4RUHA 2QEXS 1V6HA 3P31A 1LOTB 5AZIA 3Q7CA 3NGRA 3LAMA 4I0WA 5L39A 1DAXA 5L8RC 3GP9A 1FNXH 3ZXWA 3Q0AA 1LQ9A 3DOLA 3R1LA 5HO4A 1JX4A 1TUGB 1WELA 2O8DB 3SI6A 4USJC 3AO5A 5U47A 3ZFVA 1H2VZ 2CZ9A 1CZBA 1ILYA 1IBKF 4M7XA 3NGYA 2IBOA 2IVOA 5LJ5Y 3LPTA 3PJXA 4WQ5C 2IAJA 3LDNA 4DN0A 2J9DA 4O0IA 2QM1A 4CJQA 3PNIA 4PXBA 5HI7A 2Z1IA 3TA2A 1SJFA 2UU9F 3K0JA 2OPSB 1I3AA 4DTUA 3PIPQ 1DARA 1VJWA 5HRSA 1WKJA 4KBOA 2Q6CA 1IKXA 3A0IX 5BJRA 3CVKA 4TLQA 2DIUA 3MPVA 1IR2A 3PM9A 2Q66A 3EGNA 4X4VA 3BQ2A 1JQGA 4FWSA 1LOUA 3AJDA 3CI5A 3CJ5A 3EKSA 2VQFF 1NJIT 3EM1A 1P27B 2UXBJ 4AH9A 1XHZA 2MKCA 1KC8T 1B70B 2B43A 1OQ3A 3DLGA 3AODA 1QAIA 2R7WA 2M0GB 3RR8A 2DPIA 4HTLA 3AVHA 2XCAA 1TVRB 1LCUA 4MO4A 3QT6A 1YVNA 4JHDA 4ZLJA 1ITGA 4DX7A 2GBZA 4YDXA 2IYIA 4WWSA 2HRTA 3QRPA 3ZZ0A 3RMBA 3CPWR 4DR7K 2B8QA 4DCOB 4AILC 4QZVB 2H1YA 1XC3A 5HVGA 3WT0A 3E66A 2E1CA 3DGVA 2DTJA 2DRBA 1SQKA 4CJ5A 2VFSA 4DR1J 2E8AA 4JYAK 4A8WA 2LDIA 1Q5VA 1HD1A 4WKYA 3Q83A 5ETMA 1RHQB 5CZ2A 1NEEA 3LP0A 1T9YA 1X8DA 2Y9HA 4FBTA 4Q0BA 1FJGJ 2QFIA 2KT2A 3QWUA 2FY8A 4EBEA 1U0HB 4ZPBA 3GSIA 2ZH5A 2Q6BA 3PEHA 1KS2A 3KLGA 1Z2LA 4JI4K 2IBKA 4B8CA 3LM2A 2VDHA 1H7XA 1NK6A 2B56A 2BQ3A 2VWKA 4DSLA 1DT9A 3TJ9A 4WK1A 4QR1A 3M30B 1Q1KA 2MKIA 5KFVA 4IFEA 3GFHA 2YX7A 3BO3A 5E0OA 2MQLA 1IBLF 4NYOA 4K25A 3HHLA 3OYAA 2CADA 3ONQA 3R7NB 1VRUB 5D8HB 1FJEB 3KKSA 5B0BA 5HMYA 2M5YA 2EW9A 2W42A 3OUYB 1EQMA 1VDHA 3TX0A 1VSJA 1Z26A 5AQUA 4FZZA 4QBUA 4RUBA 3IDHA 2WONB 3LM9A 4CH7A 5AQPA 1XR6A 1S1WB 3A1YG 2XZWA 4BG8A 4M3WA 1YIJS 4DMNA 5F8LA 3GG0A 1JLQA 3C16B 3AAQA 4F4XA 5DS7A 4YHHF 3KLHA 2QI2A 5DLGA 3TW0A 3RVCA 4BGAA 5D6GA 1QS4A 1WF0A 3CIZA 1YRXA 2EBGA 3DFEA 3D66A 2PSZA 2XRIA 1JJ2M 2M7SA 2N3LA 4YDDB 4E89A 4ISEA 2F4VF 3D7EO 4B3TJ 1DQAA 3JAMU 4RR5A 1TELA 1RDDA 1WC6A 1DQ9A 2GTDA 2VUGA 3BY5A 4KRFA 2A40A 1S1TA 3MR2A 2IVFB 1TUYA 3CD0A 4LFCJ 1HPZA 4M41A 4CZEA 2VFVA 1S49A 4NX9A 3J80O 1N0UA 3THXA 1OVQA 2CVIA 4YOXA 3OVBA 3ENAA 4FLVA 1N34F 4TNOA 3RRGA 4DV7K 3LQVA 2ZBRA 3HM9A 4WFNQ 4GC7A 1PGZA 4DZ6A 5LSRA 5HRRA 4NEYA 2CPEA 5T14A 3M8ZA 3MTJA 3SQOP 2AU0A 4AL6A 5AXMA 4KH6A 3AQPA 5AQWA 3N0VA 4QIWD 3SIPB 4Q2LA 2YV0X 1HYVA 1HYSA 2XY8A 2CQIA 1J27A 1U1QA 2B7CB 2PIIA 4URSA 1TL4A 1HL6A 1UFLA 1MU2A 4HUEA 5HQMA 3ZC4A 4LF9K 4HH1A 2Y3YA 3ASMA 3B54A 4WTOB 3DLBA 2QLFB 2LXIA 2HNZA 2E5HA 4ECXA 1SVDA 1IKVB 2DK2A 2VONA 2MQNA 4YOVA 4FPBA 2KTQA 1BI4B 3LP3A 4OYMA 1N6QB 3KG1A 2FLPA 2K7KA 1RTZA 4DV5J 4LVOP 4LJMA 4LF7K 3SCKE 5HJYA 3AD9C 5IQ6A 2XMUA 3LPUA 3I55N 1VC6A 2YCHA 1UFKA 2XMWA 2BW7A 3AVFA 3NY0A 3WXJA 1DFDA 4PA1A 4U6PA 4J5OA 3SI8A 3H5XA 4JI0J 4USWA 1F2HA 3G87A 2E20A 1AZSA 1Y3KA 4U95A 3E9PA 2LYVA 3H98A 1QJHA 5F9NA 3JQKA 3TU5A 3OHBA 3CWJA 4P7TA 1NBEB 4MKVA 1S7HA 3NNCA 4X65F 5KFTA 2BTFA 1XMQF 3TUIC 2RQMA 2AYMA 3C6HA 4FJHA 3JTOA 1SQEA 2RN2A 4FOIA 1Y0HA 2W2QP 3SCXA 4P52A 2YNIA 2VG6B 2H5JB 2A5XA 5HMWA 3QT8A 4USIA 1F0XA 3O8MA 3KOAA 3NDKA 4DQQA 4O3PA 3K5LA 3LDPA 4CYUA 2O8FB 2KHDA 4AXJA 3MECB 1GLBG 2L08A 4DR4J 2HNDB 1RSCA 2UZAA 3AFGA 4Z4FA 5C25B 2ZM6F 3VAGA 3Q8QB 3S41A 4WZQA 3UCGA 6FDRA 2RQCA 3BM7A 3THYB 4DG1B 3DXKB 4LF4J 3R8YA 1SQGA 2V8GA 3BYPA 5KG3A 3HFZB 2EG1A 5A8WA 2XS5A 1WF1A 2CUYA 1FDBA 1VBKA 1NZAA 2FPHX 3F44A 1OY6A 1U1KA 2WVEA 5K14B 4JLHA 3Q2SC 5GADU 2HQDA 1L3KA 1FXRA 3JXOA 1S10A 1RYRA 4CO3A 4OYBA 3AJ2A 3F0NA 3WNEA 3O9SA 1G99A 4FJGA 2QFJA 4LF1A 4CBUA 1NJYA 1W26A 5ETQA 1JJ4A 1LFPA 5E26A 2PFDA 2MDAA 2HNYA 1ZBUA 3R3LA 1Y5NB 1CVJA 3D28A 1EP4A 4ZCLA 4OLOA 1T9XA 1GFWB 2WBRA 5B0DA 4CJ3A 3OL8A 4BACA 3U1MA 2DFHA 2ETJA 5DMRA 4HVZA 4WQ4C 4FLUA 3AB2B 4FXWA 4DR7F 3ZT0A 3QWPA 2DNMA 4QWBA 4L6V3 2ZH7A 2F3JA 2ADCA 3GJQB 2WVCA 1RXOB 2UUAK 2RHKA 1HNVB 3O44A 1RDUA 4MYTA 4EO8A 5KFNA 1S6UA 4TU7A 1AW0A 2XMVA 4AD6A 4EP4A 3PVXA 5LY3A 4FK2A 4FNIA 1KONA 1ZAVA 4CJTA 3AVKA 4IRDA 5C2FA 1U6BA 2ZH3A 2BOPA 5FDLB 3S7RA 1IV0A 3VEVA 3DNCA 1T3OA 4RJVA 1S57A 5E3CA 5AQQA 1MWQA 3NCIA 4LRCA 4HHUA 1J54A 5AFUH 2PEBA 1Q79A 2DNGA 2HFSA 4DLEA 2RF2B 4JI4F 3H3NO 3EVMA 4K4SA 3KYLA 3CC2S 2MQ8A 3CMEN 3IG1B 1RTDB 1LW2B 2AT1B 2OPQA 3VWSA 1R6YA 4OHYA 2FVQA 3EY1A 4XO0A 3BV8A 3ZCMA 2WCXA 1VQ9N 4CFAA 1EKSA 2APOA 4ID8A 4Z4EA 3VVTA 4IKFA 1DBDA 2IMWP 2Y1JA 4WFBL 3HLUA 1HNZK 2E5GA 3C46A 1SC1B 3T5KA 3ZSQA 3FBBA 1G3OA 1RT6A 2C3YA 4UOCA 2CNKB 3NKYA 3HVTA 3EUNA 3LWMA 5DDOC 2A1RA 3HJVA 1SL0A 4DU7A 1V3ZA 2CJ9A 3VN5A 1VQPN 3G8SA 4CHQA 3TA1A 3BQ0A 1N8RO 4FLZA 3LP2A 4DX5A 4H0TB 2G9OA 2IRXA 1K73O 4USMA 2DPJA 1HHQA 2UXDK 3D1HA 3AQOA 2RU3A 3C6UA 1UMJA 3QMLA 2P8IA 4JI1K 3LOUA 3IWNC 2E88A 2AQ4A 3L8BA 2ZC4A 4LY7A 4K43A 3MEDA 3J7YU 4V19X 1CXUA 3VQPA 3ZETA 5M1KA 3UD4P 1D0EA 4I2PA 5HQLA 2AWZA 2G8FA 3CCSN 3W8PA 4C8NA 1H38A 3ZX2A 4QIGA 1JLFA 4LIWA 4IDHA 4M8LA 3ZSZA 3GIMA 1Q8BA 3I56S 2N3OA 3H25A 2K1RB 3DOKB 4X64F 5AXLA 2CJBA 4B3MK 1YITN 3V6DB 4FN5A 2ZD1B 3HMJG 2AHOB 1RGVA 3GR0A 4AM6A 2RE1A 4KH4A 4CERA 1Z25A 2HHHJ 4KFBA 4IOAL 5AXNA 2J9DE 2MY7A 2LA6A 3H8YA 1BLUA 5KFCA 3EZ5A 3THVA 2AIRB 4M5NA 3I0SA 3O9RA 1RE1B 3NGUA 4B9NA 3L3CA 3CJ9A 2YPYA 4WXOA 3OR2B 2WBNA 4TYAA 2SXLA 1ZZFA 3EZOA 3TAFA 3JTPA 4Y6IA 4LF9F 1BQMB 2FC9A 2ZOMA 3O4QA 4WIQA 3Q7BA 5J2NB 5HMXA 4OZ0A 3M5RA 4KTZA 5KFBA 3C6AA 3DN9A 4P72A 1RAJA 2CPZA 2R9LA 1ACMB 4K42A 2O8DA 2D0OA 4DV1J 3R3TA 1RBOB 4BDZA 5GAHU 4XDDA 3SSSA 5IT0A 2GELA 1ZPVA 3MCSA 5D4OA 4LBHA 2RD5C 2AYEA 3JB9k 3N6MA 1IJFB 2BRLA 1S5ZA 1ASWA 4J7CA 4LF7F 1Y10A 1Q7YT 3IWXA 2FTRA 1ZM2A 3KJQB 3F41A 4FVUA 5AQIA 2OPSA 2OGUA 4L72B 4I2QB 3J8AA 3TOQA 4ECSA 1KSPA 3DDKA 3OXFA 3CJ3A 3VZHA 4FF3A 3K8WA 5F8IA 3PXGa 3AO2A 1O13A 3I9V9 1B0VA 2DGTA 3IR7B 3MGJA 3MX5A 2OEKA 2OHDA 3IAM9 3ISND 4QWEA 1FI4A 2B4UA 5AE2A 2KG0A 2E9ZA 3G4SN 5LOQA 1KOHA 5DDQC 4W4MA 4CEQA 4KSEB 2UXBK 4I68A 3G6YA 1S3XA 1ZC6A 2YQ3A 3O80A 2AMCB 4BC7A 4OIXA 2QKBA 5GIOA 5JMVA 1A6LA 3VQ5A 3NF7A 4ED2A 5ETVA 1NGJA 1TVRA 3QEIA 1IO2A 5KG1A 3HF5A 2KYZA 3V1RA 1SJ1A 4FCYA 1RAAB 4H5NA 4W5TA 3SMSA 1M5OC 3HZEA 3I0RB 3AT1B 3FC9A 2YWHA 2ALYB 3H90A 2ERRA 5LJWA 4FF2A 2CG8A 4E1MA 4DR1K 2MLXA 4WQ5A 4X84A 2QTDA 4CLUA 5HOOA 2CJYB 4FK0A 5B8HA 5ELZA 5BPLA 2N4DA 3W8GA 2OUGA 3NS6A 3CULA 2IYGA 4C8KA 1YXQA 2DY9A 2DNQA 3T1AA 2D5RA 4YDUA 5JVHQ 3MCOA 4HL9A 3MUVP 1U0HA 5IM0B 2XSJB 1ZTTA 1FVSA 4DCPB 2EI5A 1HNIB 3ILLA 2NRRA 1MDUB 1G1XA 4ZP6A 4C1NI 1GMUA 1Q16B 2ZH6A 3QNWB 4ZS6A 2QMUB 1OH5A 4KY3A 2ASPA 2NPFA 1VQ9S 2HS0A 1MW7A 4PKIA 2EFOA 3M30A 4KT0C 4GV9A 1M5VC 3K7RA 2YWGA 2EG2A 1CBKA 4DTPA 2BA9A 1VRUA 1FDDA 2CJAA 2OANA 1IG8A 3I96A 3EN9A 3OUYA 4OKKA 3ETOA 2XMAA 4N77A 1BU6O 2DHHA 4ZLLA 1JIHA 2WONA 1X4AA 3T3FA 1TR0A 3D6HB 3SXLA 3VESA 4K59A 1OQ6A 1S1WA 4M5MA 4DFMA 2R2RA 3N79A 4WF9Q 2ASJA 2E2OA 1CQNA 2MKSA 3OTEA 1I1GA 5KFDA 3C16A 5KT6A 2F9WA 2PAVA 1S0VA 1CC7A 5FD1A 1WOSA 3SCJE 4ZPWR 4EUVA 2RB7A 3OY9A 3H1QA 3NGKA 1DY3A 1NGEA 4TY8B 2HMIB 1VSKA 2HZCA 2ZE2B 1GTHA 1IWAA 1E4GT 4B3TK 3O5TB 1RHJB 4X4QA 1EJ7L 3O2IA 5L1IA 2HYIB 1H0HB 2P5VA 4QJVA 1S9FA 1U26A 5A8RB 2OPPB 5E3RA 4DR3J 2E7WA 1VRQC 4HH0A 3R5BA 3ILIA 4ZP7A 3MR5A 4LQ3A 1YWXA 4EIAA 2AX0A 3FZHA 2O8CB 2PT0A 3H5YA 2BYCA 3TYTA 1KCFA 4CLFA 4OPAA 5AQMA 2VG5B 2KH9A 3V9XA 2GO8A 1XBWA 3CCEN 2N7CA 3FSYA 1U48A 1MN9A 1HNZF 4JI8F 1V5IB 3UCZP 3T1HK 1RA7A 4CK3A 4RNFA 4OYWA 2KL8A 4TYBA 4ZVUB 5T41A 2GIRA 4JI7J 4R0EA 3PIPL 2AF6A 2IVYA 1ZAXA 2J9EA 4OVLA 3JSMB 2E29A 3C2PA 3IUCA 4A8XA 1IKVA 2KO1A 3LP1B 1BI4A 4O3RA 1N5YB 3HVRA 1N6QA 1RTJB 1PBAA 1RWUA 2C2OB 1TAUA 2MYFA 3MHYA 2V6AA 2RMLA 3ZT4A 4TQRA 1OKJA 1B9DA 3CQYA 2P6TA 4DV5K 3VF0B 3OYCA 2VBWA 1IQTA 4DTMA 2MQQA 4PXCA 2FZCB 3BB5A 2V9WA 1BHNA 2IFXA 3BEGB 5LMNJ 4B9MA 2CWKA 1N8RT 1RT4B 1X7VA 2QWMA 4TLRA 3ZZZA 1IJJA 2NYIA 3EE3A 1HWKA 4DQPA 2O66A 1GOCA 4JI0K 4B1XB 2MSSA 4Z4HA 2Y0BB 3M6WA 1RP5A 4YB6A 4XDCA 4M42A 3V81B 2XYPB 1KNZA 3AVGA 1J5OB 4DV3K 4LSNB 5I4MA 2DITA 2O01C 1HNWJ 4YP3A 1N33K 3C15B 1FJ7A 3ZSYA 3W66A 4CTAB 3G4SS 2YKQA 3ISNC 3KKFA 3R6LB 2Z4PA 3HX9A 3R2CJ 1H3DA 4H5VA 4FYWB 2G0IA 1OO0B 2KFYA 2ASYA 2P2CB 5IWAF 2VG6A 4ZVRB 3W0LA 4Z4GA 2NNWA 2KG1A 3J7ZO 3M7VA 3ZNJ1 5BN8A 4QPXA 3AV9A 1AFIA 3LZJA 1HJRA 2O8FA 1EO1A 4ZP8A 2Q31A 2HNDA 4CJSA 4B9UA 2YWFA 1O6XA 4BRNA 2YWEA 4DR4K 5C25A 4KHRA 4M5IA 3ITHB 4LRFA 1BHLA 3B4MA 2ZITA 3IC1A 2W4CA 1HW9A 3THYA 4DG1A 3DXKA 2YHBA 3D6MB 4ED7A 3CTRA 1BD6A 4LF4K 3RB3A 5F2RA 4CLKA 4YS2A 2CJQA 3PYDA 3AXKA 1HI0P 3QO9B 2D7SA 4CK2A 5K14A 4U8VA 3M8RA 4IYQA 4H5RA 2GQ2A 3HULA 2R8KA 3OYDA 4F02A 1NKCA 2YH0A 3T5HA 4FF4A 4KIAA 3CDWA 3VAMA 3M6GA 2CNNB 2W7AA 5GAGI 3L4QA 1UWAA 1HQ2A 2YX4A 3GJRB 4BY9C 2NRXA 2DISA 4A8FA 2ZUGA 3RAMA 5D15A 3U7JA 4W90B 4USTA 2VBYA 4ISGA 1OVYA 2KRRA 4PKGA 3TZYA 2UXBF 3R97A 1UPMB 2F7TA 3AGRA 3ISZA 2Y8YA 3CE8A 3LGMA 4B3RJ 2WSFC 4A2BA 5T7LB 3D0HE 3V6HA 4FWMA 3GJTB 2Y1IA 3KTQA 3OLAA 2OD6A 4CHOA 3KLEB 4CJKA 3M1FA 2B9EA 3KK3B 1YK9A 1Z2ZA 1RT1B 2F40A 2FBXA 2DO0A 4WFNL 3T9NA 1RAOA 5ETKA 2V8PA 2VFTA 2CVEA 2D3OR 3MM7B 1RACB 2J5AA 2Z2MA 4I7FB 4BRHA 2HIYA 4JV5F 2F8EX 4DTNA 5FDLA 3SMZA 5DM7Q 4KRWA 3O3LA 1TAQA 4BVPA 4FWNA 4HACB 1FJGF 4G9ZA 3HKZD 5HQ8A 4WE1B 2GX9A 1VHFA 3UN3A 3I32A 1DGKN 3MN9A 1SKSA 2NS1B 4OZ5A 2GJ2A 4PL7A 3QSIA 3OA9A 4ID1A 1TTHB 2RILA 2RF2A 2FHOB 2GUIA 4L75A 3TA0A 3MCMA 1VQNS 3IG1A 1RTDA 1LW2A 1BGXT 3I6PA 2LECA 2UVVA 4NYFA 1Y3JA 2FHJA 2O8BB 2DNRA 5KPRA 1U24A 1AXQA 3GB0A 1T6DA 4J9KA 1S79A 3LWLA 2GEMA 3GYNA 5FPDA 1RADB 1U2CA 3VENA 1IQZA 2FJAB 2NUUG 3TVYA 2B4JA 2Z1HA 2XG8A 3AXMA 1KQKA 1RKJA 3D0GE 3CCMN 1VK3A 4Y28C 1C0UB 2P9CA 3P1GA 4UY8O 1I3OB 1EIYB 3N6LA 4PXDA 5TKWA 4EU0A 1URRA 4JKDA 3BH6B 3J7Z5 2QWQA 5AQKA 4QOTA 4Y2AA 4ZPDA 4EZ6A 5CXTA 4FSVA 4KGZB 4C1NK 4QS8A 3WUHA 1UEKA 2DCLA 4OFZA 1UW9A 4E2FB 1XNRJ 2BKNA 2AGPA 3NBPB 3TO8A 2UUWA 3JSYA 3I31A 3V1OA 4DFKA 4FF1A 3A5OC 2WW4A 4RBTA 4B3TF 3RW6A 5K20B 3V1QA 2K1RA 2GUPA 3DOKA 3M9NB 1NJXA 1SUQB 1T94A 4XH1A 1FDNA 4LFCF 3P8BB 3V6DA 1WUUA 2ZD1A 4G1QB 1M0SA 1GMWD 5KFKA 4FYVB 1JKHB 2OELA 3A2FA 1HQEB 3M9OB 2AGOA 3LDQA 3UKRB 4JI3J 2HMPA 3P3DA 2HHHK 3VEOA 1NGDA 5FLXY 3TR8A 1NDKA 1RTIB 2K8GA 5JXSA 4IO9L 4CZLA 4BR2A 4BE1A 4YMEA 4R8UB 4OGEA 3PLAA 3OR2A 1KHVA 2LEAA 5D3GB 3CCVN 4ILGB 3MM9B 1LEOA 3ULDA 3CCUS 2M88A 4IOCQ 1ATNA 1BQMA 1XNQJ 3KHYA 2AZ3A 1NHUA 3C3LA 1GLFO 4NLPA 5J2NA 1TKXB 3V4IB 4OHZA 3OVAA 5E5NA 1ASUA 3LDOA 1N88A 5CCMA 3W60A 3GYXB 4OI6A 3VAIA 3VGTA 1H7WA 4JAXA 3FR0A 3K0SA 3TJAA 2HQFA 1J2VA 3PACA 1YVUA 3OXLA 1VLOA 2AJ0A 2V63A 1GEHA 4OZ1A 4DV5F 2ZZNA 4MAKA 4JD2A 4DL6A 2VA2A 5KFAA 3ZNUA 4ZJQA 3BSAA 3HFKA 1N5TA 2BBEA 1NLKL 3A8JA 3LL3A 1O1WA 4I2QA 1FXDA 4E3SA 2DXEA 4JI0F 3OS2A 4MT1A 4L8RB 1B64A 3GBTA 2VH7A 4IZ9A 5AJ3J 1RTHB 2V8VA 4K0KJ 2YWWA 4O4GB 4NXMJ 1OH6A 5DDRC 4EYHB 4LR7A 2C28A 3FE1A 2J0XA 2JEGA 4IEEA 5IC6B 4YOTA 3LALA 2EWHA 4HKQA 3MX2A 4E1JA 1T8EA 4O0JA 4USHA 4O0NA 3WNHA 1YAGA 4ZVGA 1MWZA 2D1KA 4FWQA 3QFUA 4ZVOB 4FJKA 1RUSA 3W2WB 3EEQA 4DPXA 1LW0B 1X4DA 3SAGA 4ZTFA 1R89A 3DLJA 4FO0A 4FJNA 3MM6B 4AHUA 1F9FA 4UOGA 4O5FA 2FZKB 1Q53A 4E8UA 2W8KA 3PDNA 4H54A 4WZMA 2YKAA 3DDNA 3T19A 4CLYA 3I0RA 2XMMA 2Z8QA 2F8SA 1U8WA 5JJBA 4RW8B 4DR4F 2GV1A 1ATSA 3A3NB 1H2TZ 1WSGA 1JXLA 4CLWA 1KVBA 2Z2LA 4CHZA 4YOYA 2JLEA 3D6RA 2P9NB 1U8SA 3EXCX 1FESA 4Z37A 4B9VA 1CJTB 3Q8VA 1WDTA 5GAEI 1WHWA 4HDHA 2ZVIA 4LF4F 4CK1A 3M05A 2XC9A 3I87A 4CECA 5D77A 3L6QA 3EDQB 2RHQB 5KFMA 3B8AX 5D0RA 3GV5B 5IM0A 2XSJA 2YHWA 1YQHA 4F4AA 1BA1A 2BRKA 4QIVA 4K8XA 3BZKA 1HNIA 4PYAA 4ED3A 2KHOA 2YY3A 5DQGA 1I94J 2IVPA 2CWXA 2RU9A 1HPMA 1VJQA 2ZWOA 2P9LB 2FZGB 4BC3A 4NLYA 3OT9A 3H42A 1JJCB 2EC0A 4ISFA 1M1KT 1VAZA 4AHTA 1YBUA 1NGIA 3MI7X 3OTOJ 3OR1B 4HEA9 3MEEB 3TQ1A 1HX1A 4PR6A 3SLCA 4CZMA 4W92B 1Q5YA 2N82B 3RWUA 1PC4A 3O1WA 2X6NA 4C3MA 2RDJA 4O3SA 1PYSB 3Q8SB 4H5WA 1XK8A 2LFVA 5D0GA 3Q24A 2ALZA 4Y2KA 2D0PA 3N5BA 4CO0A 3W9IA 5JVGQ 4A57A 1TZ0A 4AL5A 1NXIA 1B9FA 3CJ8A 5C0YA 2DNOA 1QQMA 2KVQE 3D54A 3W65A 3W9JA 2MGZB 1G4CA 1WUAA 4WYBA 2IRYA 2R2SA 3CJKB 3O3FA 2PZSA 5F0XA 3D0PA 4DQIA 1BUXA 4KAIA 4MIBA 2DB1A 2C22A 1XMOJ 2C2KB 3QNOA 2VODA 4EFAC 1NWKA 3OBYA 3TWHA 3I4PA 3F56A 2MQOA 1RDBA 1K8AO 4UW2A 3E8OA 5HL7Q 1AT1B 4TY8A 4E7LA 1RAFB 1HI1A 1NPRA 2HMIA 2ZE2A 1Q8LA 3NHGA 2VC0A 1KQSM 4LF6J 4ZN3A 3QJJA 2ZWPA 3WQTA 2VDIA 1U6ZA 3OV7A 4FYDA 3KJVB 3VQBA 4JBCA 4OHVA 1E6VB 4G6VB 2IA6A 3A3OB 1NOZA 4OYOA 3CD7A 5A8RA 2OPPA 3PKMA 1VI7A 4CESA 4CFDA 3NS5A 3S01A 3UQSA 4DR3K 5KFPA 5J2MA 4C8LA 2JVRA 1LWCB 2O8CA 3HOSA 3M6UA 2RUSA 4NZ7A 5THWA 2KRBA 3G96A 2VG5A 4Y2IA 4K4TA 2OZSA 3MWBA 1NHVA 4KHPJ 2D4WA 4BDPA 4HTUA 3NLCA 1FE0A 1I51B 2B9YA 2NRWA 1D5AA 3VQEA 4JI7K 1DJ0A 3HHNB 2W2PP 2V8HA 3JSMA 5DQIA 1RWNB 7FD1A 2YHYA 4H0XB 2A6AA 2RH3A 2PYLA 4W5RA 3LP1A 2WVFA 4JOUA 1N5YA 1RTJA 1H74A 1WI6A 2ZOFA 1C0FA 1F2GA 1BQNB 3BR9A 5I3QA 3B8HA 4LD0A 4C23A 4KTWA 1DEJA 4B1WB 4DFJA 5KFOA 3MAAB 5RUBA 4GKJF 5BPNA 1D4XA 5AXKA 4DU1A 4DF8A 2HGLA 2GHVC 2ZZTA 1RT2B 4MKYA 1M5KC 2YHXA 2MZRA 3S1TA 4QIEA 1MMLA 4LVNP 2OFGX 1RT4A 4DN9A 2KT5A 3QJLA 4N8NA 5DZ6A 3EKUA 1SKRA 1L3TA 2A18A 1IBMJ 3D2WA 4LFAK 2HZAA 2QLXA 3V81A 1BL3A 3PEJA 1VSDA 1J5OA 4LSNA 2W2MP 3T9ZA 3GCXP 3C15A 5AQYA 2B6AB 4R79A 3TP2A 1YVFA 4DDFA 1P90A 2A41A 4V19S 4JNEA 3G10A 2V51B 3CCJS 4MDAA 3Q89A 4CTAA 2HHQA 4DTJA 1FCAA 5DQHA 3SQ4A 3O9UA 4LH5A 4DV4K 5HAOA 4B08A 1KFDA 3SPYA 2HBKA 1NMEB 3DLGB 1SJRA 2BUNA 3ILOA 1GOBA 1WG4A 4ICLB 1K1QA 3O8WA 4DR6F 3GG1A 2VA3A 1SC3B 5HRNA 1UOCA 3IMQJ 1WNSA 2O1PA 2M8HA 1IBCB 3PHTA 1EAYC 3OYLA 4DV1F 3KD1E 1YGYA 3ITHA 2XYHB 2G8KA 1GLCG 4ZK7M 3TAQA 3AA3A 3BGRB 1T3VA 2HK2A 4HVJA 2E44A 4OMFG 3ENHA 3T1YK 3S3MA 3CF5Q 5M2PA 3WZ0A 2V4QA 3Q2TC 2X74A 1WC0A 4JS5A 4DV0J 5EVZA 2C3MA 4USUA 4OGCA 1X9JA 2XMTA 3MXJA 1D1UA 3QO9A 5EX3A 2V7ZA 4O4RA 5LL6Z 3IKMA 2MZSA 3MDFA 5F0WA 1VK8A 5KOXA 2W24A 4WF9L 2B9XA 2X51A 2DXDA 1FKPB 3K2PA 3M9MB 2EEYA 3TSUA 5DGBA 3PSFA 4CDIA 3OYEA 1NGAA 1NB7A 1W25A 3D45A 1MNEA 1X5SA 3BQ1A 3VTIA 4MJKA 3AAWB 4P73A 3HHKA 1S1UB 2D69A 4ZVPB 4JKGB 5C2DA 5IT9U 2I5JB 3IR5B 1EKRA 4QU7A 3SV3A 5A8KB 1D3WA 5T7LA 2W9AA 2I7PA 1FDAA 1X9WA 3ICLA 3VZIA 4B3RK 5JS2A 5KFQA 4CJFA 3V9SA 2FSJA 3GJSB 2N4CA 4MKAA 3KLEA 5T7BA 1RBVA 2C42A 3NVMA 3KK3A 3U9ZA 3A13A 3CCRN 3QBXA 2HEKA 4IJNA 2GV9A 1DTQB 2ASDA 4LFBK 1RT1A 4J9LA 1Q86O 2Z30B 3MM7A 4DEZA 1L5UA 3MAQA 3IXQA 2XB2D 4I7FA 3MR7A 1T7PA 4JI2J 2UVRA 4RNNA 3KK2B 3AB4B 5B0GA 2LU1A 3DXBA 3CQXA 4ZJOA 3WQPA 1FXXA 4HACA 4IUFA 2D74B 4CJLA 2Z2ZA 4WE1A 2JHEA 4BCAA 4DL0C 3H7HB 4Y34A 1FRHA 1HBMB 1BIUA 1W7WA 3AA5X 4E7KA 2FJXA 9RUBA 4NMXA 5C15A 2ASLA 2I1RA 1YJNS 4QYZJ 1VSMA 1HYZA 2AYGA 2KB2A 1XUPO 3F9MA 1PKUA 2IC3B 3PSIA 4B1YB 3THXB 2YNHB 1TMJA 3KZBA 3DLKB 3SCLE 5CD4A 2DR7A 3FZLA 2UV8G 2X7IA 1H6KX 5JICA 3D4JA 1NK7A 4MK7A 4DUYK 1QVGR 1FRIA 4LMZA 4NI2B 4LF8J 4N41A 1Q18A 3FUYA 3OPKA 2ZZMA 3MM8B 1BG3A 1FO1A 3CCTA 3IMXA 4XIUA 4DF4A 3IWLA 1RCOB 4PWDB 3TANA 3R5JB 5G0RA 4B3SK 1BISA 4CEZA 2F9JA 3FQKA 1C0UA 3K89A 2BQRA 4DHYA 2CH6A 1WTBA 3CCQS 1Q81O 1VQON 5D4PA 4KQZA 2J6UA 3NMUA 1PJ7A 1K0VA 3HPHA 2AP6A 1U09A 4DX6A 4BR9A 1WI8A 2B51A 1YI2S 2Q0UA 5TKYA 1NU4A 4L73A 1TK5A 5I42B 5I9EB 2DGVA 6FD1A 4KJIA 3NBPA 1FHTA 4FS2A 3NS7B 1UJ6A 4CI0B 1XNRK 3TWZA 3BSCA 4CHNA 3SQGB 3IFEA 4OX6A 1SB6A 2QYCA 2VOPA 4DHVA 3BKTA 1SUQA 4NWBA 3Q23A 2LXFA 3EPGA 3CFPA 4G1QA 3GFXA 3CDUA 3BGLA 2JDJA 2ILZA 1JKHA 4IOXA 3VF6A 3P5BP 4DR3F 1WOQA 1HQEA 4NOHA 4JP8A 1PJ5A 4X4NA 4FJLA 5CYMB 3UKRA 4DV2K 2X1AA 1S0MA 3UE5A 4OZ2A 1NK5A 2W2OP 3L3VA 3Q8PB 4FZXC 5DJBA 4HCCA 3L4BC 3DAWA 5C10A 3UIQA 4OHXA 1RTIA 2CXEA 3FCVA 1K47A 2M70A 4OZJA 4IQMA 1WBDA 4R8UA 5JMNA 5K8NA 5D3GA 4OI0A 1TKTB 3MM9A 4FP9A 3QETA 3PIOQ 2QA4G 2YI1A 5EWEA 1WSRA 2YX6A 4JI7F 1TYQB 4XAKA 4BR4A 3E1YA 1XNQK 3W9HA 1TKXA 2XSFA 1FK9B 3ZTQA 2KJWA 4AQYK 3I8BA 3CMQA 4CIGA 2BE2B 1TFYA 3W3DA 4CYUB 4FWPA 1WC3A 4PEOA 2ZBIA 2JEJA 4Y2CA 3TTCA 3LH2S 1QHTA 4FJ5A 4PL8A 3SUOA 4ID5B 2YJFA 2UVUA 4FWLA 3BP8A 2O67A 2UUCJ 2H4YB 2PMZD 3BBFA 3LW5C 2RKIB 1S5JA 5DG8A 3BBCA 3PZPA 1WC4A 4YEAA 5LMNF 1EHWA 1MSWD 3CC4S 4M95A 1PG5B 3WX8A 1ZXOA 1FE4A 3H5SA 1JL1A 2QW9A 4KHUA 4RUAA 3MDQA 3N9UC 3FZ2A 1U47A 4DU8A 1UVKA 1RTHA 3TABA 2JC0A 4YY3K 2FHKA 4O4GA 3SFUA 1EARA 1HNWF 4BRCA 4NXMK 4EWTA 2GVZB 3AO1A 2Q0RA 4ZIVA 3FLCO 5DM7L 1YHQS 5M1OA 4GO7X 4J9NA 3QRRA 1X9SA 3FFIB 3NF9A 3W2WA 1NSAA 2XHCA 3MUMP 1LW0A 3EDRB 3TAEA 2CPJA 2VPZB 1YRUA 1T44A 2IDEA 2JGUA 2P51A 3IR6B 3MM6A 3W7BA 4OLAA 4PPZA 4ZKAA 1WSEA 2HAFA 4ECTA 3G71S 1WN7A 1YKWA 2ZJRL 4HHHA 2XEXA 3VGSA 3CCRS 3NF8A 3AA2A 4NXNK 5IT9O 5C5JA 2E1YA 4Y65A 4ED6A 2IGIA 2P9KB 1C0TB 4RW8A 3M8PB 4CHPA 1S9GB 5HSPA 2C1EB 2DRAA 3SUNA 2P9NA 4DR5J 1CJTA 1CLQA 3QEVA 2ZWHA 2JSXA 1B99A 5HP1B 4J2EA 4N8OA 2MKJA 1M5SA 4CIEA 1VQ5N 2W6LA 1AUSL 2CNOB 1FWPA 4L76A 2GMHA 3K57A 4USVA 3KVGA 4KREA 2JWLA 4DQRA 3V2UC 4K41A 4E1NA 1V4TA 4GY2B 2P9LA 4PWWA 3GILA 3PR4A 1I94K 1T03B 2QWLA 2M8DB 2DGUA 1S72S 4CO2A 1XR5A 3MXHP 3LPYA 1RBLA 3OR1A 3MEEA 3QNNA 4PYDA 3OTOK 1YJ9S 4FJ8A 1QSLA 1ROFA 3SSQA 2E6LA 4A46A 4YOWA 4IKAA 3JAMY 4KE5A 5J1EB 1SCJB 2IHR1 3DOMB 1WLJA 5HVFA 1WAJA 3NEKA 1VHIA 1YJWN 1D9DA 3UVJB 4PQAA 4PXEA 3M8YA 1YRTA 4FYYB 1U2VB 1MWMA 5CZ1A 3HVTB 1XTZA 1Y5LB 2MGZA 1KHWA 2UUTA 1Q95G 3G86A 3CJKA 1VSHA 2RRAA 1EETA 3FSXA 2UXDJ 1UJ4A 3UN5A 2L41A 3VF2A 4AT1B 3VQTA 3B6OA 2Q2RA 1I5OB 4H0PA 1XMOK 3K5NA 5K8PA 3J80U 3M8QB 4Y0FA 3LDLA 2MSTA 3ZTOA 5GAGU 3GDQA 2QL5B 2F9TA 1NGGA 4IOCL 2VQEF 2JRSA 2ASOA 5IZHA 4OZLA 3VQ7A 3VCDA 2A2DA 3KJVA 3BGUA 3MN5A 4WIIA 2GWJA 5DDPC 1X0PA 3KK7A 1E6VA 2HVIA 1H98A 4B3MJ 1VC0A 3CJSA 2BH1A 4C8OA 3GV8B 2XI3A 3THTA 2VCPA 1F5AA 4MDBA 2XHWA 2NYHA 4DTOA 3WNGA 1Y00A 5JS1A 1SS6A 1XN9A 1U2FA 3BS9A 1LWCA 1YZ7A 1O8BA 1VGYA 2EPIA 3ZX3A 1PAEX 2FUG9 2VGNA 2LVWA 2ZF5O 2F4FA 2OTLS 4M5LA 4IXCA 2YBVA 4ETZA 1QVGM 5AQOA 2MZJA 4QWDA 1KEKA 2CKWA 3NMAA 4IH6A 2MEWA 1ZPWX 2QA4N 3OYGA 3UI3A 3QEPA 2ABYA 4ZVSB 3VQ4A 3BSOA 3KUHA 4F36A 2Q97A 5E33A 1NGCA 3VQQA 4FM2A 1BQNA 1FFSB 2CJXB 2HRYA 2Q1LA 2CQ2A 3NGDA 3EMTA 1U4BA 1R8PA 1GLEG 2IA0A 4UF4A 3MAAA 2AX1A 2A2CA 4A8MP 3DLLQ 1TK8A 1JCGA 2CGLA 1NK9A 3QLHB 4B1VA 3R5DA 4ZVQB 3OFHA 3AJ1A 1XNRF 1RT2A 2AYBA 3BH7B 2A1SA 1PILA 1R0CB 3FKBA 2QLJB 2XMJA 1Q81T 3HHLD 2DNHA 4M63C 4KO0B 4KV8B 5DETA 3CG7A 2OTJN 1RHMB 6AT1B 4U7UD 1RYSA 2F7VA 2I6WA 3U3YA 1IBMK 2V2ZA 2JNJA 4ZOSA 3A8IA 4DMZA 1SXLA 2DRDA 2B6AA 3VEYA 2XWXA 4BWJA 2H4WB 1T9TA 4JI3F 1RBUA 4KHWA 3AVBA 5JUMA 4CJUA 3JYTB 4L3NA 3CD6S 3MPYA 4J37A 4ILRA 2R2TA 1ZH5A 1VQMN 2HVZA 4MO5A 4LQ9A 5F9LA 1VQLS 5KFZA 1HLWA 4OI4A 4NLDA 4A62A 4AUKA 4ICLA 4F8RA 3RMDA 3GMGA 1DLOB 1RHUB 2C3UA 4U8YA 2ZKTA 2P9PB 1ZTWA 2F65A 1QZ6A 2B4OA 1AROP 3OVSA 1S6QB 1LK5A 5BRFA 5BYSA 5KFIA 3FZFA 5DLFA 1DZ5A 4G3IA 1X5TA 5A2QO 1RBSA 3H5UA 1PYTA 2HWIA 2XY5A 3BGRA 3H2LA 3HPGA 3J81j 4I67A 3G9CA 3C6TB 2AJFE 3FSIA 4CRJA 4BC2A 4J2BA 1JXBA 4WJBA 1KD1O 1JNRB 4DV0K 2QX0A 3UDCA 3I82A 4YR0A 2E1MC 1N48A 1FEEA 4PY5A 5M1FA 4BG9A 5JVGL 3GONA 3CCZA 5B0FA 4F3MA 1M90O 3SDEB 4JKBA 2MPUA 4OX9J 3VA3A 3TEGA 3AOAA 2BOAA 3MMAB 4ETXA 1WTFA 2K2PA 3CM6A 1FKPA 3RRKA 3RYLA 5AJ3F 1WB9A 3D68A 4JV1A 4MLEA 2RNEA 4K0KF 2GS8A 4ZLPA 1X1PA 3W5YA 3CMAN 4FWKA 2RHSB 4AYBD 4J9SA 1N56A 1S1UA 4JKGA 4C11B 2GFFA 4A8YA 1HQUB 2I5JA 2R7QA 3KUGA 1CS4B 2CQDA 1SV5B 4OYZA 4ES2A 3C7NA 1ZM9A 4B1ZA 4ED0A 4OZNA 5A8KA 2MY8A 2OIHA 4ZITA 4CD1A 4LIRA 5IV3A 2R7RA 1NH8A