2RF2A

Hiv reverse transcriptase in complex with inhibitor 7e (nnrti)
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
557
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel indole-3-sulfonamides as potent HIV non-nucleoside reverse transcriptase inhibitors (NNRTIs).
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7
total genus 157
structure length 554
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2rf2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rf2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rf2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rf2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2rf2A05
4HCCA 1UAXA 2XRIA 4I2QA 4KHQA 4JLHA 1C6VA 4KTQA 1BISA 4O44B 4U6PA 3Q8QB 2IM2A 4DTOA 4K4YA 1SL2A 5KT4A 3H5XA 4IRKA 4DQSA 1KSPA 2FBYA 4CFCA 3DOLA 4NLGA 4FLZA 1J5OB 2C22A 3LDSA 2DTUA 4WFYA 1IKVB 4KO0B 4MK9A 2IM0A 4CJQA 1XI1A 1QQCA 4K50A 2QV6A 3TAMA 4I7FA 3IAYA 2XWYA 3BQ1A 2FVSA 4LSLB 1GX6A 4E7JA 4W5QA 3BSCA 1T05B 3MFHA 3VQQA 2DFHA 1X9MA 1MU2A 3IG1B 1N56A 4J2EA 3VA0A 4IKAA 3D28A 4WZQA 1VSFA 4NLSA 1WSIA 5J2NA 1NOZA 3PVXA 4LD0A 1DTTA 3DLKB 5DG7A 1TK8A 2FJVA 1UWBB 4AILC 1Q9XA 5KGXA 3CWJA 4ECVA 3NDKA 2VG7B 1IM4A 3KMSA 3BR9A 1WSHA 3TI0A 1C0MA 3PHEA 3LZIA 4BDPA 3HJFA 3GV8B 2HW3A 3ZT2A 2R8KA 4C8KA 1D5AA 3ZSQA 4BWMA 3AO1A 4OKEA 3FFIB 2WTFA 4DLEA 2F8SA 4WE1B 4DFPA 5KFDA 3BSOA 2G8VA 3KTQA 3DI6A 3FSIA 3UQSA 5L1JA 2JGUA 2Y1IA 3CFOA 1RCHA 3G10A 3NAIA 1TVRB 4CJSA 5E41A 3VQBA 3AA4A 3BREA 2UUWA 4ECUA 2EC0A 4FS1A 1RT4B 2GC8A 3NF7A 4Z4GA 3HP9A 1BCOA 3QEXA 1VRUA 2OPSA 3QIPA 1JLFB 1ASVA 3H5UA 2BE2B 3DRPA 2JEGA 5DG9A 3O4NA 4O55A 2V0NA 1VSEA 5DQGA 4FZXC 1K1SA 3DRSB 4YR3A 3IN5A 3ZT3A 3KJVA 5KT3A 2JEFA 4DFMA 4PWDB 4PA1A 1ZBFA 2B6AA 4CEFA 1B92A 4CHOA 3BGRB 5HBMB 2A1SA 4DSJA 2UVVA 4DQRA 4FZYA 4KHNA 4RW4B 2R2RA 4NLDA 4EYHB 2ETJA 1QS4A 3T3FA 5KFBA 1C0UA 1JLBA 5F8IA 1KCFA 4TQSA 2ALZA 5I42B 4DQPA 4B8AB 3THVA 4LSLA 2DPJA 2R2TA 1W25A 4FS2A 3HT3A 4KHUA 3AA5X 4CJFA 2FJXA 2BQRA 3GQCA 2VA3A 3OYHA 2R2UA 4E0DA 4DFKA 3V1QA 4CJ3A 2XY6A 2AJQA 2OPPA 4HUGA 4YR2A 2HNDA 2OH2A 4K4ZA 5F8JA 1JLEA 2FBVA 3LAMA 1HQUA 1S1XA 3PW4A 3HKWA 4ZP6A 3OL9A 3N6MA 4O3RA 3K5LA 3G6YA 1RYRA 3HHKA 4NCGB 5KFUA 4CK2A 2HHUA 4ZHRA 5C42B 3NCIA 1TKDA 3CVKA 3MXJA 5I3UA 3M9OB 1LW0A 1W9HA 2OPRA 4FJGA 3KLFA 3K5OA 2YNFA 4FLTA 2ZQBA 3QERA 4ZPBA 2DY4A 1JLQB 4G1QA 3TWHA 4RW8A 4RG8A 1FK9A 5L9XA 2Y1JA 4YR0A 4NLXA 4F4WA 3I5AA 1JIHA 3OHBA 1RT3B 1D9FA 4FJMA 3T5LA 3AVHA 4B9NA 3KK3A 1CSJA 2HHVA 2FVCA 3OS0A 1X9SA 2YNHA 4DSKA 3OJUA 2QKBA 3Q8RB 5HLFA 4DQIA 2GUIA 3SV4A 4TSXA 3ITHA 2W9CB 3SCXA 3PW0A 3I8DA 2O4GA 2FLPA 4B9LA 2PYLA 1HYVA 4FJNA 1SL1A 4CFBA 2E9ZA 1LWEA 1WAJA 3BDPA 3VQ9A 2UVUA 2JEJA 1LAWA 1WNSA 3DLKA 2G8UA 4ED3A 4ZMMA 1TKZB 4XPCA 3AVIA 1TVRA 3V4IB 4FJ5A 4NYFA 2D0AA 3V1OA 3HL8A 5I3UB 3NL0A 4F3TA 3OYGA 1YTAA 4EBCA 2EHGA 1S1UA 2A1RA 3QO9B 4ID5B 1RDRA 1EKEA 3KK2A 4AHRA 5KFWA 1VSLA 3P83D 4CJ4A 3OS2A 3OYLA 1JLEB 1SV5B 3TABA 4K4UA 2Z1JA 4HVJA 4H54A 1TKTB 3G6XA 2IM1A 2HMIB 2HWIA 4UQGA 3RAXA 4AHUA 4ECSA 5DK5A 4I9QA 3SUPA 1REVB 1GOAA 4FK0A 4O3PA 1T94A 3DRRB 1C0TB 4FJIA 1RYSA 1JX4A 4DTMA 2X6NA 4ZPDA 4M42A 5T7BA 4Q8FA 3SYZA 1NK8A 5CYMB 4M3WA 4DTSA 3N6NA 3O3GA 4F2SA 2WRMA 3MR5A 2HB5A 4LQ9A 5L1IA 3TAQA 3PO4A 3KLFB 3T5KA 4IFVA 1N5YA 4PWDA 1TQLA 4F4ZA 4GW6A 1MMLA 1RTJB 4DL7A 1TAQA 5CZ2A 3B6PA 2VG5B 2FJWA 4B08A 4DFJA 3KLHB 5J1EA 3OYJA 1TKTA 4MKBA 5KFPA 1QE1B 1YT3A 4ZPCA 3WNFA 3CJ2A 3RRHA 2F8TA 4CF9A 4I9LA 1XC9A 1FKOA 1RT4A 1BIZA 1REVA 1RT6B 3BJYA 4N47A 1VRUB 2OPSB 1JLGA 4DL4A 3AVCA 3KK1A 4CEAA 4EBDA 5JUMA 1EX4A 5HROA 3H5YA 4B3OA 1L3VA 1L3UA 1DTTB 2GV9A 4DF8A 4BACA 1KLNA 1SKSA 2W7OA 1XHZA 2W42A 1VRTA 3HK2A 3CIZA 3FFIA 2OZMA 2HAIA 5CY4A 1SUQB 4FW1A 2PZSA 3S3OA 2IAJB 1W0HA 2P5OA 3ZSZA 1WNEA 3QZ8A 1NK7A 4KKOB 2IM3A 2O5DA 3KHRA 4AHSA 4CHYA 4ECRA 4JV1A 3C6UB 3RB6A 4WE1A 4RW9A 4C8MA 1TL1A 4KB1A 3MEEA 3MR6A 5HRPA 5C42A 4O3SA 3L3VA 2JEIA 1R0AA 2AU0A 1RDDA 1O1WA 3P5JA 4K4WA 4WFZA 3SQ0A 4E19A 2FVQA 1G15A 3G0ZA 3OYAA 1IKXB 2WONB 4DL5A 2CJQA 2HNYB 3TAMB 3PX4A 3MR3A 3T5HA 2AX0A 3LP2A 5HP1B 5I42A 3L3UA 4ED7A 1NJZA 4K8XA 2BQUA 4FBTA 4ZTFA 4DG1A 1A5XA 4J9QA 1VK0A 4MIAA 3IRXB 1S1VB 3VQEA 3OYIA 2IJFA 1S0OA 3ALYA 3KK3B 1LW2A 2DFEA 4FJKA 3OL6A 3AA3A 1N5YB 3KOAA 3OYEA 1KRPA 2B5JA 1T03A 3H98A 3OYNA 2ASLA 3AO2A 5EU7A 1NK5A 1JLQA 1TGOA 4C8OA 3CQ8A 3TANA 3QIPB 4N56A 3OJSA 4BE1A 3HP6A 5KFYA 3RR8A 3H2LA 3ZSVA 2JLEA 3DLEB 3GIKA 4DTNA 1TL3A 4QAGA 5KG3A 1IKXA 1WAFA 1RBRA 1IKWB 3ISNC 4IR9A 4HKQA 2R8IA 3Q8SB 4FCYA 3QEPA 2ASDA 4B9MA 2IC3A 3NKYA 1D9DA 1D1UA 1S97A 3KMQA 4CF8A 5KFCA 4EYIB 4CEOA 3OSNA 4O5BA 4URQU 5FRMA 1Y97A 3K59A 4ZTJA 3SPYA 1Z25A 3MXIA 3MF5A 1HJRA 2FBXA 4NLVA 1C0UB 5DQHA 1JLFA 2HHQA 1A5WA 2X78A 4Y2CA 4NLQA 2IAJA 4ZVGA 4W5TA 4F50A 4IG3B 3RAQA 1VSJA 4K4SA 3OL8A 4LY7A 5HRNA 4O44A 1RAJA 4RW7A 3PX0A 4MFBB 5J2QA 2LSNA 3ZCMA 3GYNA 5JS2A 4YP3A 4DU4A 1GX5A 4ED1A 3NH2A 1RT7A 1ZBHA 3DDKA 3MEGA 2YKNA 3V9SA 4CECA 3S9HA 2V4RA 4FK4A 2R2SA 3D45A 3VQDA 4DSFA 2KQ2A 5DLGA 3CJ5A 1JXEA 1NK0A 3K58A 1BL3A 1RTHB 4IR1A 2R8JA 1SH2A 1I3AA 5C5JA 4RUCA 2VG6B 2ILYA 3V9XA 5KFGA 5KFMA 1K6YA 5KTQA 2C28A 4OJRA 2R8GA 1HYSA 3KLHA 4CGIA 3HM9A 4GC6A 2E9RX 3AVKA 2XCAA 4KB7A 2RDIA 2J6UA 3ASMA 1RILA 3PR4A 3I5CA 4CJPA 2RPIA 1RT1A 3WNEA 4YFUA 3MEDA 1F21A 4HCBA 2ATLA 1B9FA 2Z1GA 3U3YA 4EO8A 2BGGA 3DOLB 4NCGA 1UOCA 1LWCB 2W9BB 1J5OA 4TY9A 4YQWA 4ED0A 5CYQB 3HVTA 3RMAA 1LV5A 5KI6A 1WSEA 1TK5A 1S9FA 2YKMB 5KG7A 4NLRA 5C24A 1B9DA 5JS1A 4IG3A 1XR5A 4DS4A 4B9TA 3KHGA 2AGQA 3Q8PB 1N6QB 4PUOA 3MECA 3DM2B 2D5RA 1N48A 3OLBA 3KK2B 4Q44A 1MU2B 1S1TB 3IG1A 4O4GB 1CZ9A 3CM6A 4ICLB 1JLCA 1YVUA 3AA2A 3SNNA 3L2RA 1KHWA 3UIQA 2UVRA 1S9EB 5J2MA 3BSNA 5C24B 4FLVA 1S48A 4FJJA 3NGYA 3CM5A 1VSMA 3QLHB 1L3SA 3VQ7A 5KFQA 4W5RA 1EXQA 1VSHA 3V81B 4JUZA 3C95A 4DTUA 1SKWA 4RZRA 3A2FA 4LSNB 5F9LA 1T7PA 4AH9A 2FC0A 4GC7A 4ECTA 2O4IA 4MKAA 4KHSA 1RA6A 4I2PA 1TV6A 3KJVB 2XI3A 1NNDA 4CERA 2RKIA 4KFBB 4CEQA 4C8LA 4TQRA 3EPGA 1KFSA 3RR7A 3LP0A 4Z4IA 4OLBA 2QXFA 5F8MA 3AVGA 1DLOB 1SKRA 1HPZA 1QAJA 3F9KA 1EP4B 2WCXA 1U09A 4R5PB 1KFDA 5D3GB 3KD5E 1ZTWA 5KGWA 3FDSA 4KKOA 3PO5A 4GMJB 4QW9A 1WLJA 3NF8A 3C6TB 1RBUA 3DRSA 1J9AA 4DSEA 2OPQB 2E6LA 3U3GA 3OS1A 3AO4A 3DOKA 3NAHA 4ID1A 1L5UA 3HSTB 4QWBA 4CJVA 2BANB 1EETB 1C2PA 3RB3A 1UA0A 3QO9A 4E7IA 4PUOB 3M9NB 3NMAA 4CGGA 4E89A 3L2QA 4PQUA 2IMWP 3T1AA 2I1RA 2W8LA 1HQEB 5KFEA 3ZT1A 3QZ7A 1Q9YA 2KW4A 3KHHA 2VA2A 2OPQA 1TP7A 3I0RB 5HLFB 4R0EA 1RT7B 1R0AB 3SI8A 1FK9B 4R8UA 3V6KA 1CLQA 3QGIA 3E01B 3KLVA 1U49A 2VWKA 2HHWA 1N4LA 4ZPAA 1RBSA 2ATQA 3MFIA 3DLRA 4E1NA 5KG0A 3H4BA 3M9MB 4CEEA 3RWUA 1WN7A 4KAIA 5L1LA 2G8HA 4FW2A 4JS5A 4N5SA 1RT6A 3V6DA 2D0BA 4MFBA 1LW2B 3CFPA 1NOYA 3L8BA 4J2BA 1CXQA 4M3UA 1T8EA 1HMVB 2YNGA 2FLNA 1KVCA 5EWGA 2W9AA 1UA1A 1NKCA 1BQNB 1K1QA 4J9NA 4ZHRB 3QNOA 3NHGA 3TAEA 4ECQA 3H5SA 3DM2A 2XO7A 1RDBA 4G1QB 4F3OA 2RKIB 4KFBA 4O3QA 4YMEA 1BI4B 1HARA 4F4KA 3VQ8A 2YNGB 5KT2A 4QWEA 2IGIA 3H59A 4Q43A 4Y1DA 3NF9A 4DEZA 3OHAA 2E9TA 1N6QA 1BQNA 4RW6A 2YHBA 1QAIA 3DMJA 1QUVA 4EZ6A 4NCBA 3GIIA 1HNVB 3CO9A 2OZSA 5KG2A 4FLWA 4B9VA 1S1TA 3NE6A 1RT1B 1BHLA 4KV8A 1BI4A 1J54A 3QINA 4OPJA 2C2RA 5KFAA 5KFHA 3MAQA 4CEDA 1NK6A 4RNHA 4M3TA 3WNGA 2P51A 1S9EA 5J2MB 3AVLA 2WONA 3EYZA 3RMDA 4L8RB 4ELUA 1IKYB 4M3YA 3PR5B 1JKHA 2YKNB 4CE9A 3V6JA 4ZP9A 3MEDB 3KHLA 3JSMA 3KIOA 3OSPA 3C6TA 4XIUA 5C25A 3LZJA 2RF2A 1TL1B 2WK4A 3K5NA 1NK4A 3V6DB 3EZUA 2D0CA 4CF0A 4NLPA 4Z4FA 3HVTB 1IG9A 4CGJA 4AHCA 1JLBB 3AVNA 2QE5A 2FVRA 3VQ6A 2VWJA 1S9GA 4DWIA 2HNYA 4IG0A 4KRFA 4C8NA 4H4OB 3PJWA 2YNIA 4QW8A 4OGCA 3V9UA 3RMBA 4KHWA 3PJXA 3QEWA 1JL1A 4OKKA 4TY8A 4ED8A 4Z0UA 1TKXA 4Y1CA 2F8EX 4DMNA 4K8ZA 3LP3A 1S1WA 2I5JB 3GILA 5KRSA 3DOKB 3NH1A 4NZ0A 1WSFA 5K14B 4CF1A 3OL7A 1OS5A 4BDYA 3QLHA 2XGQA 2KZMA 2Z1IA 5KFFA 3MEGB 4IH7A 3QYYA 4E3SA 4IH6A 3FQLA 4EO6A 2XY8A 1ITGA 4CJRA 1C1BB 3SJJA 3ZT4A 4E7LA 3PUFA 4O3OA 2YV0X 3I0SB 3RB0A 4KI4A 1Z26A 3LWLA 4HHTA 3V9WA 3DLEA 2JC1A 1RT2A 2CKWA 4I7FB 3V6HA 1NKBA 4H8KA 3HPHA 4CHPA 3JSMB 2ZD1A 2HVIA 1S6PA 5KFTA 3UR0A 3KK1B 4HUEA 4M41A 4CHQA 2YNIB 3SV3A 5CYMA 4MK8A 1YVFA 5FDLB 3ZSXA 3L2WA 1ZBLA 3LP1B 3DYAA 3NBPA 1IO2A 4IFVB 4KV8B 3F73A 3H08A 3PZPA 3VQ5A 4FK2A 1TV6B 3ULDA 3RBEA 4EEYA 2IDOA 1NJWA 1HMVA 2YHAA 4B8CA 5F8GA 1BQMB 4RNOA 4Z4EA 2XY7A 3MR2A 5SZTA 1S6QB 2F96A 4B9UA 4GVMA 1S1XB 2BRLA 1I6JA 3L2VA 4ZVFA 3RBDA 2GIQA 4F4XA 4J9OA 2C2DA 1KLMA 2XC9A 3SFGA 5KFSA 1RNHA 1U47A 4Z4CA 4KI6A 3T5JA 4XPEA 1KTQA 4FM2A 2D3UA 3N6LA 4WYLA 1X1PA 1U04A 2KTQA 4MK7A 4K4XA 3K2PA 5FRNA 1GOCA 4KPYA 2XGPA 4NYZA 4FBUA 3D5MA 4O0IA 4TN2A 2X74A 1HQEA 4NLYA 4CK3A 4CJLA 3HPOA 3IRXA 1S1UB 4QWDA 4CESA 1KHVA 4IBNA 1SUQA 5SWMA 3QIDA 3IGVA 4PY5A 4OGEA 3S3MA 2B6AB 4DS5A 1D8YA 4CEBA 4FM1A 2RN2A 2HNZB 3CDWA 4CCHA 4ZP8A 1JL2A 3AV9A 1JXBA 4FLYA 1VSKA 4FZZA 3MEEB 2D3ZA 4NLWA 2UUTA 3U6FA 3AVJA 1SL0A 4YNQA 1C1BA 5KT6A 4N76A 1JLGB 1TK0A 2IA6A 4H4MB 5CYQA 3S3NA 4R5PA 4EP4A 1LW0B 3ISND 1S1WB 2B43A 3SUOA 5HP1A 2E6MA 4RUAA 4N41A 5KT7A 1SH3A 1XHXA 3IS9B 2QKKA 3KLEB 3WNHA 4IFYB 4RNNA 3EZ5A 4TXSA 3CYMA 2VG5A 2R7YA 5KFXA 2RDJA 5C25B 1JXLA 3AVAA 3L2UA 2E4LA 4URSA 4IRCA 2VG7A 3LANA 1T03B 3QESA 3H40A 3BQ0A 3SUQA 1DTQA 3SQ2A 4O0JA 1NKEA 4CJUA 3SPZA 3ZT0A 4AHVA 4J9RA 1IKWA 3GV5B 4IH5A 5F9NA 4WZMA 3QEIA 1RTIB 4ED2A 4M94A 1U45A 1TL3B 3QIOA 3VA3A 2DFFA 1RBVA 4NCAA 4ECWA 3LP0B 2X6SA 1RDCA 4Q45A 4NRUA 1S6QA 4FLXA 4ID5A 3VQ4A 4ECXA 3MXMA 3G6VA 1S6PB 1KVAA 2IC3B 2AWZA 1C1CA 1BQMA 4ELVA 4M3RA 4XO0A 3ICLA 2IOCA 1QHTA 4CJEA 2V4QA 4KREA 2G8KA 2FVPA 3V4IA 4WFXA 2ZE2A 4CIGA 4TYBA 3C6UA 3LAKA 3SFUA 3EPIA 3V9ZA 3TARA 4J9KA 4F8RA 1XWLA 3QETA 2W9BA 2XHBA 3EY1A 5EWFA 1HNIA 4KSEB 4KHRA 4CFAA 1ASUA 3VQCA 3KLGA 3NGZA 2R8HA 3T19A 3UPFA 3HVWA 3LP2B 4DTJA 1LAVA 5KG1A 4KE5A 3DMJB 1LWCA 3PW5A 3KKSA 4HTUA 4CJ5A 4ECYA 4KTZA 4J2DA 1KVBA 1NK9A 3MTKA 1BGXT 2WOMB 5F8NA 4CGHA 2VG6A 3IS9A 3AVBA 4OVLA 2W7PA 4BE0A 2DPIA 4H4MA 1RTIA 4RNFA 4NLTA 2ZKUA 3G86A 4Y3CA 4KHYA 2BE2A 1IH7A 3NH0A 2HMIA 4EP5A 4KB0A 4HUFA 5KG4A 1S5JA 3O3HA 4M3ZA 4NLOA 1SV5A 4DL2A 2OPRB 1QTMA 4IFYA 1ZYQA 3ZSOA 2W8KA 2D7SA 1S9GB 2HNZA 5KRTA 4B3OB 2HVHA 3QEVA 3V1RA 2XCPA 3KLIB 4RW8B 3QGGA 4KBIA 4DLGA 3I0RA 3HVAA 2IBKA 5FROA 5KFZA 1TKXB 4AHTA 4Y34A 2YNFB 3IGNA 4X2BA 1RT5B 5KFIA 5F8HA 4BE2A 4F2RA 3GIMA 5KFLA 3NFAA 2IJNA 3AVMA 3OYBA 3PV8A 2BANA 4DL6A 5J2PB 3H4DA 4DSIA 1WSJA 3FQKA 3M8PA 3CG7A 4J9MA 3D0PA 4FLUA 1HRHA 4JRQA 1NJYA 2J6TA 1XR7A 2HNDB 4ZVHA 1YTUA 3SI6A 3B6OA 3HYFA 3ZSRA 2WOMA 3M8QA 1EETA 4BWJA 5J2NB 1IKYA 4JS4A 1S4FA 2JC0A 1HNIB 5J1EB 4MIBA 4DU3A 1I39A 3KLGB 4WXWA 4LSNA 1NJXA 4CFDA 3DLHA 5EUHA 5DGAA 1RT3A 5D3GA 1RT2B 1GOBA 3M8QB 4CHNA 4ICLA 2AGOA 1KLMB 1HPZB 4MQ3A 1T3NA 2OYQA 4FJLA 1NHVA 4KHMA 4NLUA 5DLFA 1C1CB 5EDWA 3KLEA 1ASWA 3TR8A 4IDKB 3E51A 3CJ0A 1RBTA 4O3NA 4ZVEA 2ZE2B 5KFOA 2QK9A 3AVFA 1S0NA 2FLLA 3SUNA 1S0MA 2KFNA 3LPTA 1LWEB 3KKRA 4FJXA 3TAFA 1LWFB 1DTQB 4I2QB 1L3TA 4CIFA 3DYAB 3NBPB 4MH8A 4ECZA 2FBTA 1TKZA 4O4RA 3GV7B 4G3IA 4R8UB 3DLGB 3AO3A 4J9SA 4KAZA 3DRRA 5DGBA 3K57A 3HO1A 4B9SA 1CXUA 2HHSA 1CZBA 4ELTA 5KT5A 5KFRA 2P1JA 5KFJA 2ZD1B 4K4TA 1RTDB 1RA7A 3M8RA 4IG0B 4OPKA 4M95A 3LALA 4OLAA 4ED6A 3TQ1A 4FJ8A 4M45A 3NGDA 1QSLA 1S49A 3M8PB 3DLBA 3ITHB 2W9CA 3VQAA 3AO5A 2WHOA 3PX6A 2RF2B 2I5JA 4IRDA 3JYTB 1UWBA 4PQUB 3GIJA 1RTDA 1ZBUA 3PY8A 3E01A 1QSSA 1QE1A 4FJHA 4WYWA 3C94A 1RT5A 2BRKA 2Q3SA 5HROB 3O3FA 4FXDA 1FKOB 4CHZA 4QWAA 1T05A 1ZETA 3DLGA 2B4JA 3KLIA 5KG6A 3LPUA 2D41A 4M3XA 1EP4A 1VRTB 3PW2A 2J6SA 3OYKA 3OVNA 4DU1A 1XR6A 4DTRA 1RDAA 3OYMA 2KZZA 4RW6B 4JRPA 1ZTTA 3BQ2A 3VQSA 4TY8B 4EBEA 4OL8A 4IDKA 4RNMA 4FYDA 4DL3A 3KD1E 2OA8A 3SQ4A 4HYKA 1U4BA 4FM0A 2EX3A 3RMCA 2OPPB 4J9LA 2V9WA 1BIUA 4DQQA 4E1MA 4FVMA 2KFZA 4Z4HA 1JKHB 1DLOA 2P5GA 4ZP7A 4RW4A 4CJWA 2XI2A 4KO0A 5KFVA 3CFRA 2HHTA 4DSLA 4BDZA 1FKPB 3SZ2A 4FJ9A 4QPXA 4DG1B 1HNVA 5KFKA 1WSGA 4CJKA 3HPGA 3VQPA 1S1VA 4IKFA 5DQIA 3VN5A 3OYDA 4Y2AA 1A5VA 2YKMA 3RRGA 2Z1HA 3DRPB 3NGIA 4K4VA 5JXSA 2BR0A 2B5JB 3OY9A 5DG8A 1TAUA 1HQUB 5J2PA 5DMRA 1VSIA 2G8IA 3LP1A 4OKJA 2GIRA 5F8LA 4EZ9A 1Q8IA 4W5OA 4DF4A 5FDLA 4QOZB 2UVWA 4CJTA 3I5BA 4Q0BB 3TAGA 2XY5A 3K5MA 3O4QA 3BGRA 5HBMA 4LH4A 3NAEA 5KFNA 1X9WA 3CDUA 2G8WA 4CEZA 1JLAB 2AGPA 1QSYA 2ITGA 3I0SA 4Q8EA 2ILZA 4RW9B 4IOBA 5EWEA 2ASJA 4NRTA 4CK1A 1S10A 5KG5A 4Q0BA 3OYCA 4LQ3A 1FXXA 4FJ7A 2C2EA 3JYTA 3QGHA 2HWHA 3MECB 3BSAA 4JV0A 1RTHA 3M8SA 2WB4A 5HRRA 1VSDA 2AX1A 3LWMA 1SH0A 1C1AA 4W5NA 1JLAA 3P1GA 3HVRA 3NF6A 4CGFA 3HXMA 5K14A 3PW7A 4KTWA 1IKVA 4CF2A 1HYSB 4E7HA 3TAPA 1RTJA 1Z4UA 1ZBIA 4WXOA 3UDLA 3DI6B 4IQXA 4CGDA 2HHXA 2BDPA 4RW7B 4DTXA 2IS3A 4DTPA 3CJ3A 3TVKA 4U7CA 5L1KA 5J2QB 4NYNA 3FRZA 2GBZA 2BQ3A 3ZSYA 1J53A 4E7KA 3OLAA 1LWFA 4QWCA 3V81A 5CZ1A 2NUBA 2AQ4A 4J2AA 5HRSA 4URGA 1BCMA 3ZSWA 1D0EA 3CJ4A 2YNHB 4J9PA 4JV2A 3QNNA 3RB4A 1U48A 1C0TA 4I2PB 3OYFA 2G8FA 4TYAA 3SQ1A 1FKPA 4TLRA 3RTVA 4F4YA 2PY5A 2PYJA 4QCLA 3KNAA 5T14A 4O4GA 1NHUA 4Q5VA 4RU9A 4H4OA 1JLCB 3CDEA 4CIEA 4LH5A 1HYZA
chains in the Genus database with same CATH superfamily
1BG3A 3KG4A 4FWMA 3CF5Q 3MAAB 2ZZMA 1ZA2B 1TMJA 2E5JA 5CYJA 4K0KK 3GSIA 1SL2A 3MWBA 5KT4A 4FPAA 5A8RB 1TTHB 4USTA 4WFYA 4KO0B 3LL3A 3SDEB 3IAS9 1H73A 4CJQA 1XI1A 1QQCA 3NG8A 3TAMA 3PXGa 1I94J 1N88A 5C2DA 1Q82O 2IVMA 4NYPA 1KOHA 2NXUA 5T7LB 2C2NA 2DNPA 1T05B 1MU2A 2VBWA 2H5JB 3KJNB 2XB2D 4QYZK 3D28A 1VSFA 4NLSA 5CA5A 3PSFA 5J2NA 4OZ5A 3CCMS 2NZTA 1EO1A 2QEXS 2IIRA 3DLKB 3O44A 2MKYA 1VQ5N 4AILC 1Q9XA 2NNWA 2D69A 4DCJB 3MCOA 5C12A 1FHTA 1VOMA 3KMSA 5FD1A 1UJ4A 4ZIVA 1KQKA 4BDPA 3HJFA 3GV8B 2R8KA 1KAZA 4C8KA 4BWMA 2FXUA 2Q1NA 3AO1A 2LDYA 3R6GB 4I56A 2WTFA 2BBEA 5MLCV 4DLEA 4NEZA 3SSQA 4FNIA 4DFPA 1NO8A 2XS2A 5IFMA 3BSOA 1U1KA 2ZHBA 1YITN 3CCEN 3Q23A 1LOTB 2FUG9 2JGUA 2RIJA 1ZH5A 4IO9L 3GJSB 2Y1IA 3CCQS 2FHOB 4CJSA 3TOQA 2IRUA 3VQBA 3MTJA 4KIAA 4ED4A 2UUWA 2EC0A 4FS1A 1RT4B 1VLYA 4FF4A 3VPZA 4OZNA 4CLZA 2OPSA 3QIPA 1WF0A 1HNWJ 1JLFB 2VDIA 4LF9K 5DG9A 4DV2J 3OW2M 3UI3A 2QMWA 2V51B 4H0PA 4O55A 1F3VA 2A10A 3NNCA 3WHIA 3IN5A 5HMWA 5HQLA 3ZT3A 4FPBA 4DFMA 1X31C 1X4FA 1ZBFA 5ETOA 3U8XA 2HBLA 2VFVA 4KHPF 2UVVA 4DQRA 4FZYA 1VJQA 4KHNA 5AQVA 1N32F 1IV0A 3CQYA 1YRUA 3M8YA 1QS4A 4PR6A 2JNJA 2R42A 5F8IA 4DR3F 2FJEB 4LRCA 1R8BA 4OI0A 1RLCL 4PYAA 4OLOA 2QI2A 2B3TB 1FNMA 3ET6A 3OVAA 5JVHL 1T95A 2F1FA 4U7UK 4NL5A 4CJ3A 2XY6A 2AJQA 1RCXB 2A0FB 2OPPA 4ZLJA 1CQNA 4YR2A 4ZVTB 3TEHB 1VQMN 2E5LF 3HKWA 4O23A 2XHWA 3DDNA 3N6MA 3K5LA 1NB7A 3FSYA 5KFUA 4PXBA 1X8DA 1B4SA 1VQMS 2ZM6K 1YI2S 5I3UA 1X4HA 1W9HA 3BP8A 3RUBL 2RNEA 3KLFA 2YNFA 4XH1A 4C4WA 3WUHA 3A3NB 4I68A 2DY4A 1IBMJ 2CQDA 1FWKA 5EY4A 3OTOK 4GMKA 5L9XA 1KOOA 1FW6A 1NGEA 4NLXA 3C66A 2VODA 2P9NA 1XBWA 1D9FA 2LQ5A 4B3SK 4NX9A 4FJMA 2ZJPL 1OH8A 4UUWA 1NH7A 3RZAA 2UUCF 1CS4B 4DR5K 1V5VA 3OS0A 2P9PB 2AHOB 3S41A 3CCSS 2JL9A 3Q8RB 2W24A 2UUCJ 1PAEX 4TSXA 3ITHA 3J7AN 2DRDA 2PDAA 3AD9C 2O8BA 3LGNA 1SC3B 2CQ3A 1HYVA 1SL1A 2E9ZA 1MNEA 5IC6B 2WW4A 4HACB 2B56A 2CZ9A 1BXNA 5EX3A 3WQPA 2V52B 1TKZB 1ZBTA 4XPCA 2PMZD 2P9KB 2CG4A 3HL8A 5E84A 1WACA 2FQQB 3G6ES 4IJAA 3G82A 4F3TA 2NRWA 3OYGA 1Y64A 4ID5B 3VESA 1R8AA 1RAAB 3KK2A 2DGXA 2KXNB 3KHYA 4M7YA 1QQMA 4K4UA 4JKGA 3N5BA 5IQ6A 2JHEA 4H54A 3G6XA 5DS7A 3FBCA 1R8PA 2HWIA 1LFPA 3PRVA 3FGVA 1HIYA 2EKYA 4CH1A 1FVSA 3SUPA 2QWPA 3ATVA 4FJIA 2GTDA 2EG2A 1NSPA 3SMPA 3JS9A 4NO7A 1GTHA 1RQ0A 1VQKS 4P52A 3OR1B 7AT1B 4M42A 4YOTA 2JVOA 5F0UA 2UU9K 2AZ3A 1F2GA 2OTLS 3W9JA 4LQ9A 4ZVQB 5L1IA 2O8EA 2F9DA 3D6RA 2RDDA 2ROEA 4PWDA 3JS6A 4ES2A 2W40A 4K5SA 2JH3A 4F4ZA 3VENA 2R7SA 4HEA9 5M1NA 1MMLA 4U8VA 2WVCA 5CZ2A 2EWSA 3C2PA 3VAKA 2FJWA 1UEUA 3HM8A 3OYJA 2ROGA 4QOTA 4JI4K 3CJ2A 2ZNZA 2F8TA 4UF4A 1ACMB 2YWKA 1XC9A 4OYBA 3RBXA 1FXLA 2C3PA 1RT4A 2DR7A 4IOAQ 1JNZB 1RT6B 4QJVA 2E1CA 1VRUB 1H2UX 1JLGA 2I8EA 2YKAA 4CBXA 1Q18A 4TVAB 2GW8A 4OYZA 3UD3P 3QBWA 2FIUA 4DV4F 3O9TA 1SKSA 2E7XA 3DHXA 2ZJPQ 2OZMA 2HAIA 6AT1B 3G2XA 3ZYYX 2RQKA 1K47A 2P5OA 3SMSA 4HTIA 4OYXA 3N28A 3QZ8A 1UVMA 3FEZA 2O5DA 2IM3A 3HSJA 4ECRA 4L76A 2BUPA 3R3LA 5JMVA 4C8MA 2MQOA 2KDOA 1N0UA 3W9HA 2JEIA 1R0AA 4J9UE 5E3RA 2AU0A 2GZOA 2GX9A 4YHHK 3MMAB 3L09A 4KYZA 2ZBPA 2XG8A 1H74A 3BGOP 5AXKA 1IKXB 4F4AA 2KG0A 2HNYB 5IS2A 2GHWA 2XZDB 4H5VA 5HP1B 4JI0K 1ULRA 2GO9A 4BC5A 5IZHA 1N36J 3FGUA 4K8XA 1FA0A 1HI8A 4PG7A 3QNWB 4J9QA 2P9IA 1ATSA 4DUTA 4MIAA 3FSXA 1SAZA 3KK3B 1LW2A 2DFEA 1HBMB 3A13A 3OL6A 5M1QA 4UZCA 2H51B 4DR6K 2EFOA 5FIIA 1KRPA 1OJ4A 4LUBA 3H98A 2LLZA 3UKUB 3BBBA 4JI6K 3OYNA 4ZVOB 5GIPA 1LK5A 1WORA 1NK5A 1D09B 4RWWA 3CQ8A 4CQ1A 3TUJC 5HMXA 4N56A 1X7VA 3BGFA 2I38A 1VQOS 4LFAK 1KQFB 3MMAA 3HP6A 3RR8A 3GIKA 1TL3A 1SB6A 1SIWB 2M2BA 5KG3A 1KWMA 2CQPA 4J90A 4LFBK 4HH1A 3P8BB 5AZIA 1RBOB 1Q4RA 1ZS6A 4A8WA 1T3VA 2IC3A 2V67A 3NKYA 4DL0C 3BH7B 3HSCA 3MM7A 4FP9A 3C8YA 1X4CA 1N32J 4LBHA 4CF8A 4CEOA 3OSNA 5AR0A 4FZVA 5LXYA 3K59A 4ZTJA 3PACA 3MM9A 2JRSA 1GH8A 1OY6A 3J7Z5 3FBBA 2UUAF 1JJCB 3CCES 4NLQA 1U2VA 3ZX3A 3HHLD 3OL8A 4O44A 3GJQB 3MPDA 5J2QA 1RWOB 4EMDA 2LSNA 3A5MC 4PRFA 4WQ5C 3O6QA 5SUHA 1CPZA 1HBUA 1QZ6A 2C2KB 3IWLA 5EN1A 3VGKA 1N5TA 2YKNA 2DKOB 4BRPA 4CECA 3D45A 4Z7CA 5E26A 1EKSA 2KQ2A 3CJ5A 4MAKA 1BUXA 3W5YA 1BL3A 1SH2A 1I3AA 5C5JA 2VG6B 1IR2A 1P1TA 5KFGA 2J0QD 5KTQA 2C28A 2AIRB 3SBGA 3I31A 4F04B 3KLHA 4CGIA 3HM9A 2H4YB 3RJMB 2E9RX 2DNQA 2X1FA 3CMES 4KB7A 1HLUA 1YKWA 4LJMA 2ZH6A 3ASMA 3DCAA 3PR4A 3KJFB 2LQ9A 4YFUA 3G71N 1F21A 1DARA 2ATLA 1B9FA 3G8SA 3U3YA 2MQNA 3Q2SC 3DOLB 3KG0A 2UYTA 4B3TJ 2P5VA 3T9ZA 3AT1B 1J5OA 1CJTA 2J7KA 3TWZA 1D4XA 3VV2B 3RMAA 2ZBRA 1G99A 1WSEA 1TK5A 2IIHA 1BO5O 2Z57B 5AE3A 2V8HA 5FPMA 5E7OB 1N6QB 1WOPA 4LBIA 4OJHA 1N48A 2PEBA 2A18A 1JLCA 1U2FA 1WEXA 1E3MA 3R5BA 3L2RA 2FSKA 2ZITA 4CRJA 5C24B 4FLVA 1KD1O 2AJ0A 4FJJA 3CM5A 2J7WA 3NVKA 2HBMA 4RLEA 1L3SA 1F5BA 1RWKB 1SKWA 1Y11A 4RZRA 3A2FA 1A6LA 4LSNB 4ECTA 5AQOA 5D8HB 1KR4A 3EM1A 1TV6A 1Y5IB 1N36F 2RKIA 3DNCA 3S8SA 3DFEA 2DHGA 3F9KA 1QHAA 1S6UA 1EP4B 6FDRA 3C7NA 1KS2A 2YBVA 1HKAA 2VF3A 3KD5E 3QDKA 2WC9A 3FEYB 2F4FA 2DITA 1XQSC 2ADBA 1HNXF 3GFYA 4X62F 2YX4A 2HAFA 3W66A 3WIVA 2E6LA 2A2CA 3AO4A 4CNZA 4ID1A 3HSTB 2BANB 1C2PA 4DV1K 3RB3A 4DBQA 3M9NB 1HHQA 3AFGA 2O8FA 2V34A 4CGGA 1BD6A 3E9OA 1GLDG 3L2QA 2IMWP 2XMKA 2I1RA 2OSRA 4G1PA 1HQEB 3F2KA 1H0HB 4ZCKA 3ZT1A 3CCJN 3QZ7A 2J9DE 3D6TB 2KW4A 1O13A 2OPQA 3P39A 1R0AB 1SCJB 4BREA 2HWTA 3V6KA 3E01B 1N52B 2B8PA 3EE8A 2VWKA 3TTCA 2NZ4A 1RBSA 3DXKA 1MW7A 3I9ZA 3MFIA 3TJ8A 4X65J 1UPMB 2UUAJ 3AAPA 3OW2R 3DLRA 3H4BA 1FJGK 1HQ2A 3RWUA 5L1LA 4ANCA 2I2YA 3W8GA 4FW2A 4N5SA 3ZZZA 3V6DA 2FHMA 5FPDA 4MFBA 2J0XA 4RUBA 1LW2B 2YPZA 4J2BA 4JYAK 1CXQA 1CC7A 1VGYA 1Q95G 1T8EA 1HMVB 2ZGZA 2YNGA 2FLNA 1VQKN 2W9AA 5JVGQ 1VQPS 4ZHRB 3NNHA 5H9EJ 1RDBA 3HD1A 4F3OA 2HRYA 2OANA 3CJ8A 5KOXA 2VPZB 1NNEA 3VQ8A 4TKTA 1UWAA 1ZXOA 3H59A 2UUBK 4DEZA 3UO0A 2HQDA 1BQNA 2YJFA 2YWEA 3EDRB 2YHBA 3DMJA 3L4BC 1QUVA 1FXDA 1CLFA 1HNVB 5KG2A 3CT9A 2QIFA 2BX6A 2C2RA 5KFAA 5KFHA 3MAQA 1NK6A 3M6WA 4P2MA 2P51A 2HF4A 1S9EA 3EYZA 4L8RB 2YTCA 4BC4A 4M3YA 3PR5B 1KC8T 2UXBK 2YKNB 3S6EA 3V6JA 1WC0A 3MEDB 4JHDA 3JSMA 4DX6A 2QWMA 3LZJA 4OX8A 2DH7A 3D7EO 2GQCA 2WK4A 2W01A 3EZUA 3ADAC 4C8ZA 1W7WA 3L4IA 4AHCA 3D9BA 1WKKA 2R9LA 2VWJA 2MKHA 1QDUB 4KRFA 1QM9A 1F60B 3PJWA 1NXIA 4QW8A 1XNRJ 5IWAF 3RMBA 2WSFC 4OKKA 3VGLA 1BOTO 3M30A 1G6BA 4Y1CA 4DMNA 4K8ZA 4QR1A 2I5JB 4BRGA 4H5TA 4B3RK 2N82B 1O5JA 3OL7A 4LF6K 1NBWA 2J7UA 4C7QA 3QLHA 1VR6A 4C1NK 4IH7A 3VEYA 4HDGA 1ATRA 1VISA 2V7ZA 4IH6A 2DK2A 3FQLA 3AJDA 5CE3A 4LRBA 3A3PB 1ITGA 4CJRA 3SJJA 3ZT4A 3B54A 1HWUA 2NZCA 4O3OA 5MAOA 5A6PA 3J81Y 4DHVA 1U2VB 3V9WA 4ENOA 3V6HA 4M5DB 5HVGA 4YDDB 3R2DJ 4Q7AA 3U1NA 3J7AP 3D2EA 4DX8H 3SV3A 1V5IB 1YVFA 4ER8A 5FDLB 2GJ2A 5BPLA 2A3JA 3DYAA 3H08A 1TV6B 1H7WA 3T1YF 4EEYA 2RRNA 1HMVA 3PCOB 2YHAA 1BQMB 5CD4H 3D3CJ 1ESVA 4LFCF 2H65B 1VQ9S 3UE5A 1O0PA 3MR2A 1SI9A 3GPAA 3VWSA 4RL1A 1Z05A 1I6JA 3MN9A 5HOOA 3D6MB 4ZVFA 4ZOSA 4AL7A 4F4XA 1JQGA 4WIQA 2XS5A 2C2DA 4HHUA 4I6WA 1HBOB 1RNHA 1F1BB 2AEJA 3JAMO 4WYLA 1U04A 2QA2A 5FRNA 1GOCA 1AT1B 2P9SB 3IXQA 5IT4A 3V2UC 2XGPA 4AM6A 2FYXA 1M90T 4FBUA 3D5MA 2OTJN 1KONA 3OFFA 2VICA 4P75A 1HQEA 2X1AA 4NLYA 4BR4A 4H03B 3RSEA 4QWDA 4IBNA 3VQTA 2O1PA 3QIDA 5SWMA 1FD8A 5CZXA 4PY5A 1RWUA 1T0TV 5GAHP 5D0RA 4OX6A 4TNOA 2PBDA 2HMPA 2KKZA 3CDWA 2DNNA 4ZP8A 1RAGB 1VSKA 4FZZA 4K0KF 2RB7A 4JI3F 1CQMA 3AVJA 1GMWD 2P9UB 4N76A 4AL5A 3U1MA 4EP4A 2ZFHA 1QAYA 1TU0B 1T44A 3SUOA 3AD8C 2E6MA 1FRJA 3ZNJ1 5KT7A 2ZF5O 3KUGA 4KH1B 3IS9B 3J81U 3CCLN 2FSNA 2EWHA 1YRTA 3MOZA 5IT9U 3EZ5A 1VC6A 1YX2A 1JCGA 5E2QA 5KFXA 3SCJE 5LJVA 1E6YA 4U67Q 2P9CA 4MYTA 4BRQA 4WWSA 2HSTA 2DNLA 1MROB 2YWWA 3CCUN 5AE1A 2ZJRQ 2F63A 3SUQA 1HKBA 4CP5A 2DNGA 1U8SA 4O0JA 1NKEA 3SPZA 2VGMA 3LGMA 2ZHAA 2OUGA 4WBFA 4WZMA 5F9NA 1B99A 2XLIA 2DR5A 1RTIB 2LVWA 3GIRA 3DRYA 4DR7J 1U45A 3T9NA 2DFFA 4MIWA 2GGPB 4LFAJ 4NCAA 4X4UA 3HD2A 2VH7A 3LP0B 4IO9Q 2V7YA 4H5NA 3NCQA 1RXOB 4ID5A 4P2SA 2NS1B 1S6PB 1ELOA 1KVAA 3BKFA 1WC3A 5LJ3Y 7FD1A 1QHTA 2OKQA 4UOCA 4W90B 1XIQA 4NMXA 5AQLA 3G8QA 1FRIA 1FDAA 5GINA 3D66A 4CIGA 3C6UA 5A0YB 3EPIA 4J9KA 4F8RA 3BKUA 3G82B 4LF9F 1VCTA 5EWFA 1R7IA 3QB0A 4X66K 5E3QA 2A1BA 2R8HA 1TUVA 2YWGA 3UPFA 3BS9A 2NRTA 3VTHA 3PW5A 3KKSA 2DNOA 4HTUA 2B9EA 4PXCA 2EK1A 2LXUA 2WAQD 4CD3A 1KVBA 2EXUA 4M7XA 3G6EN 4KJIA 2BOAA 4MDAA 2MZQA 2G1DA 5F8NA 1XK8A 3VAJA 2VQFJ 3W8PA 2CJYB 1IBLJ 5IC4B 2MQ8A 2W7PA 4BE0A 4ZCMA 2NYIA 1UJ6A 3ENOA 4A8YA 2RHQB 2GWJA 3NH0A 2HMIA 1UFLA 4EP5A 1UCNA 4KB0A 5KG4A 4DV7J 1TUGB 3VGMA 3ZSOA 1O51A 2E7VA 4BRIA 3WEEB 5KRTA 5AQRA 3O9RA 4QIWD 3V1RA 2W6KA 2XCPA 2CNNB 2HBYB 3AB2B 1WKJA 2PIIA 1YJWS 2IBKA 5FROA 3ENHA 3ZX2A 2YQ1A 2QA1A 2H4WB 1RT5B 3KJQB 5F8HA 4AUKA 3HHLA 4F2RA 3OYBA 5FLXU 5L46A 2BANA 1XMOF 1FWLA 2OSQA 1BWFO 1EAYC 2VGNA 2J6TA 4RR5A 2HNDB 4ZVHA 1YTUA 3JTNA 2N7YA 5AQHA 4YORA 1EETA 4BWJA 5J2NB 1VQYA 2XEXA 3H7HB 4KGKA 4JS4A 4DU3A 3LOUA 3LPEA 3BKTA 4KT0C 3M30B 2OI2A 2HIYA 3AB4B 2Y9HA 2Q2RA 1K73O 1XMQK 5D3GA 3M8QB 2M9KA 2Y1LB 4ICLA 2NRVA 2PMHA 2BKOA 4USKA 4EU0A 3FZBA 4BG8A 1REGX 4BC2A 5DLFA 1C1CB 1M1KT 4X65K 4BRMA 3QRQA 3M32A 1OVQA 2VHGA 4ZVEA 5HQ8A 1K8AT 2KB2A 1URNA 4USWA 2KLAA 3DXMA 3GONA 2QA4N 3PRBA 2AJ2A 2NXJA 1HBNB 1S0MA 1EKRA 4DV6J 3LPTA 4FJXA 4QIGA 1LWFB 2E7WA 4OO1J 4I2QB 1NB2A 3ZETA 3THPA 1XC3A 3FZLA 4CIFA 5BYQA 5HJYA 1NZ8A 3DYAB 4ECZA 4O4RA 3GV7B 4G3IA 3AO3A 1M1KO 1Y10A 3HO1A 2I6WA 1CXUA 2JSXA 2HHSA 1B7YB 2KYZA 5KQDA 3OXFA 1TYQA 1NSKL 1S57A 5LL6d 1RCOB 3THTA 2WTUA 2IDEA 3W5XA 7FDRA 4OPKA 1WWHA 2HRTA 4M95A 4ED6A 5GMEA 3TQ1A 3ZTSA 3MCPA 3CC2N 2J0WA 3R8YA 3AJ1A 2J9DA 3ITHB 4GVLA 1RHJB 4OHWA 2I5JA 3F5TA 2CNLB 3ENVA 3HX9A 1ZBUA 2L3MA 3C0BA 3E01A 3M2RA 4YOXA 5DRKA 3D6FB 4WYWA 3C94A 1RT5A 1YQHA 5D78A 2QL9B 1JJ2R 2HS0A 1SC1B 2GFFA 3KZBA 4FXDA 1Q53A 1VFJA 3DLGA 2ADCA 5IQQA 1G2EA 3T1HJ 4DV5K 3LTOA 1VRTB 2J6SA 3OVNA 4X64F 5D6GA 2KYXA 3WDOA 3C65A 4OPHA 2YWFA 2KZZA 1V4SA 3FZMA 3T69A 3PG9A 4NLCA 3BQ2A 1Y0HA 3VQSA 3SLCA 5M1PA 1U0HB 3SQ4A 4PYDA 4Y0FA 2RRAA 3CEDA 2ACYA 1U4BA 1AB8A 2JDJA 2OPPB 4J9LA 1RBLA 5LT5A 2KRBA 1S79A 4AXIA 1JKHB 3VEZA 4ZP7A 1XNQF 1CJVB 1I5OB 2PGCA 3M1VA 4UOHA 4CJ7A 1S99A 3PTWA 3OXLA 1Y00A 1WOOA 4BDZA 1KQSM 4FF2A 3RW6A 5EHHA 1RK8A 3H25A 5A8WB 2XNRA 4M8LA 2DHXA 2AKWB 3VQPA 2BOPA 4B1YB 2QEXN 4IKFA 2GAGC 3OHRA 3A4TA 1NDKA 2BR0A 2KHDA 4MJKA 2FTRA 4JI0F 4JI2K 4W4MA 1HQUB 4NWBA 2VJUA 2G8IA 3F44A 3D3BJ 4W5OA 2UVWA 1X5TA 5AJ3K 1FX2A 3H42A 2V63A 4WP3A 1M5HA 1VQ7N 1X9WA 3CDUA 4DR6F 3B8HA 2C3YA 3VETA 4CLTA 1JLAB 3I0SA 4IOBA 3BDEA 4JI6F 1E6VB 1U2CA 4NRTA 1S10A 2OFGX 5KG5A 1FXXA 2G13A 3JYTA 4FVUA 3MECB 4JV0A 4LFAF 3HFZB 1VJWA 3Q7CA 2WB4A 5BRFA 2AX1A 1X4AA 1C1AA 1VIXA 2M0GB 3P1GA 4JKEA 3HXMA 3F56A 3I55N 4KTWA 4E7HA 4CF2A 2IRYA 1RTJA 4P74A 1OH7A 2LYVA 3M2RB 4WXOA 3UDLA 4IUFA 4LFCJ 4CGDA 2ZZTA 3R5GA 1NGCA 2JJ4D 2B0GA 2D3O1 2IS3A 2BZ2A 3PIPL 4DTXA 4QIVA 3ZSYA 3PFOA 4WP9A 1OSDA 4FF1A 1NM1A 4GKJF 3N4WA 3D7SB 3WBZA 5HRSA 1BCMA 1D0EA 3CJ4A 4KY3A 5LMNF 1U48A 4I2PB 1RP5A 2G8FA 3CJAA 1M5VC 4TLRA 1EJ7L 1MWKA 2PY5A 4L3QA 1T9TA 4QCLA 3KNAA 5T14A 1NHUA 4RU9A 1JLCB 3M6UA 4P2XA 5H9FJ 4LH5A 1F5CA 2QSWA 3CULA 2XRIA 4I2QA 2LFVA 3EN9A 1C6VA 4JLHA 3CCRS 2FLOA 2CYYA 3A8JA 4FWSA 3P49B 4DTOA 2VOOA 3H5XA 1KSPA 3L7OA 4NXMK 4FLZA 1J5OB 1CJTB 2ZH5A 4DR1F 2C22A 3LDPA 3LDSA 2DTUA 1IKVB 1UMJA 1NGGA 4MK9A 2DO4A 2WBMA 2NSCA 4MMOA 1RWMB 2QV6A 4A59A 3CCLS 4QQBA 4DPYA 1GQEA 3GL1A 3JSBA 2MXYA 4LSLB 5B0FA 4WPAA 2XS7A 1IN0A 3UN5A 1X9MA 4J2EA 3J80O 3FZHA 1Y5NB 5K20B 2IFXA 2K1RB 3HF5A 2RUGA 1S7HA 1FESA 2Z4PA 3ZZUA 2FJVA 1HUXA 3VF2A 2QX0A 1SJ3P 4C48A 2PAVA 3CWJA 3P31A 2V2KA 2F9JA 4ECVA 3T6JA 4JI0J 5K8MA 1IM4A 2NPIA 1U0HA 3FFKB 2LQBA 3BR9A 4GVEA 2HLTA 3LZIA 1ZM3A 1KAXA 4OKEA 3FFIB 1NEEA 4RO0A 3W2VB 1A9NB 1T11A 2F8SA 2YHWA 2W4CA 2V2VA 4CT8A 3CDBA 2DISA 3D0IE 3DI6A 3QT7A 4FSVA 3MHYA 3Q8YA 2XYPB 4JI6J 4A8XA 3G10A 3CGIA 2CPEA 1VK8A 4FPRA 3NF7A 4Z4GA 4CZIA 2OD4A 3L9ZA 1VRUA 2BE2B 2ZH7A 1FTRA 2GJIA 2V0NA 3BBCA 3K0SA 3ZZYA 4NA1A 3ZZPA 2Q97A 3OUYB 4FZXC 1K1SA 4YR3A 3CJCA 1GMWA 4AL6A 5KT3A 2A40A 1HNXK 2B51A 1B92A 5IOLA 4DSJA 3GTYX 2LKZA 2LA4A 1RTZA 4M63C 1F9FA 4EYHB 3A1YG 3T3FA 5KFBA 1C0UA 4DV5J 3T1HK 1WUUA 1KCFA 4TQSA 2ALZA 2CVIA 1TUUA 3QFUA 4Y0WA 4B8AB 2N4DA 5I4MA 2QGFB 3EE9A 2R2TA 1RADB 4FWKA 3VGUA 1J27A 1FI4A 1GLFO 2FGOA 4OZ3A 2DGOA 1VBXA 4E0DA 2IRXA 1EQ0A 3ZLJA 4JAXA 4WF9Q 2FHJD 1O8BA 4K4ZA 3LAMA 4CIOA 3ZNUA 2ZWPA 3GFZA 3PW4A 2QM1A 3OL9A 3CD7A 3G6YA 2GJFA 1RYRA 4CK2A 4QIEA 3OR1A 4ZHRA 3M8WA 3MOJB 3DXMB 4CLLA 1WHXA 3CVKA 1W2IA 1IBLF 3M9OB 1LW0A 2WFBA 1VBYA 2J76E 2CH5A 2X7IA 3CC4N 3BEXA 3K5OA 4FLTA 2IDLA 4CH0S 3HSGA 3X3UA 2YQ0A 3O5TB 4RG8A 1FK9A 1JB0C 2GAHC 4A8SA 4CI0B 1LWXA 4KBOA 4RPFA 4S0MA 3UFCX 4UOFA 3M6GA 3L7PA 1IR1A 2UUBF 1MG7A 3WC0A 3TA1A 2XMMA 3WXIA 2O8BB 1CSJA 1VMBA 2F4VJ 1OPZA 2E1ZA 2FVCA 3N4PA 4DSKA 2NSBA 3UKRA 4NEYA 3K0JA 1FDBA 1KAYA 3SCXA 4F0HA 3HJVA 2O4GA 4FJNA 2RS2A 5EOYA 1GXUA 3BDPA 2VQEK 3ZTRA 4PKIA 2JEJA 5GADP 1N0VC 2BACA 3AVIA 3V4IB 4MKYA 4AQYF 4PHTX 2RS8A 4RCHA 3M32B 2GIFA 3DOMB 8ATCB 2L08A 1S1UA 1RDRA 3SXLA 2OEMA 1EKEA 1EARA 3NP5A 4AQYJ 3P83D 3M05A 2QWRA 5BXIA 4UOGA 5LSOA 4ZJQA 3QPIA 3HZEA 1UZHA 4JI8K 2Y0SD 3TRGA 4ECSA 2VQFK 1GOAA 4O3PA 1T94A 4JI5J 1C0TB 1JX4A 4USIA 2QN6B 4DR4K 2X6NA 1UL3A 1N33J 1XERA 2AW0A 2GWKA 1WJ9A 3SYZA 4DPOA 3N6NA 2M3DA 2HB5A 3MR5A 4LR8A 3O1BA 3PO4A 3BYRA 1V3SA 4X66J 4LF6J 2A3ZA 4BRKA 5D4NA 1SJ4P 2GS8A 4GW6A 1K8KA 1TAQA 2VG5B 1Z1ZA 3KLHB 5J1EA 2PC6A 4H0TB 3K5PA 4MKBA 4ZPCA 3H6EA 3WNFA 4U7UD 3FE1A 2XHCA 4I9LA 5A0YA 3HHLB 4N47A 1FRHA 1AW0A 2YXLA 3DRXA 1U1LA 3H5YA 1DJ0A 4B3OA 2GV9A 2P9GA 3JAMY 3EVMA 3CCVS 4LF5F 1XHZA 3K89A 3HK2A 1J5EK 2EVZA 5CY4A 4MO5A 3QT5A 4N7TA 4YOUA 2IA0A 2K7KA 3VF0B 4CZCA 2H48B 5A6WA 4P9SA 4L73A 1IJFB 3C6UB 3CXCR 2C2OB 3MEEA 3MR6A 4CZGA 5C42A 1DY3A 3R6MA 1DKGD 1UW9A 4CZFA 1IR0A 5GVQA 5K5MA 2ZJRL 4WFZA 1M5OC 4LRFA 3MD3A 2J9CA 3G0ZA 3OYAA 5DM7Q 2WONB 4DL5A 3T5HA 5GAEP 3LP2A 1R0CB 1GLBG 4DV7K 2JWNA 2LQ8A 1UVJA 2E1YA 3CJTA 2MGZB 4ZTFA 5F2RA 1OQ3A 4DG1A 4BRFA 1VK0A 3U4LA 1S1VB 4M1KA 4GKKK 1S0OA 4K41A 2EEYA 3CPWR 3ALYA 4AT1B 4FJKA 3HMJG 3D1OA 1VS3A 3KOAA 1V4TA 5M2PA 4O8UA 5TKYA 2ASLA 3D2WA 1IJEB 3IR7B 1PAUB 4ETXA 1TGOA 3TSQA 4XEIA 2EPIA 2RVJA 4X4OA 1LXJA 2VU5A 1VRQC 3H2LA 4WKYA 3Q86A 5GAHI 1IKXA 1WAFA 1UW4A 1RBRA 2P9SA 1IKWB 3ISNC 5DDRC 2R8IA 1HR0F 3Q8SB 2Z2YB 5ETRA 4FCYA 3QEPA 4DV3K 4USVA 4B9MA 3FR0A 1OYEA 1D9DA 1TL4A 2DIVA 3LQVA 2QWOA 3GCXP 4BROA 2IVFB 3AD7C 3KMQA 3GCWP 5KFCA 1EZZB 4EYIB 3JXOA 4C0BA 1Y97A 1NU4A 2YX1A 3KWGA 3SPYA 1X5OA 1Z25A 3MF5A 2FBXA 1DFDA 4NLVA 1C0UB 3DU5A 5DQHA 3W3SA 1C0FA 4Y2CA 1VQPN 4JKCA 4JKFA 4X4TA 2BVZA 3RAQA 1VSJA 2X1BA 4LY7A 2RSQA 3LDOA 2DGWA 5HRNA 1PKUA 3PX0A 4MDBA 4MFBB 1NG9A 3ZCMA 3GYNA 5JS2A 4GRSA 4YP3A 4BR7A 4J37A 2MQLA 3PIOL 3GMGA 2FC8A 3B82A 2KO1A 3W7BA 2V4RA 1VAZA 2R2SA 4DSFA 4X66F 3BN4A 4RWXA 2EFPA 1YJWN 3K58A 2R8JA 3BY5A 2CIMA 1BU6O 3OFHA 1LXNA 4OYOA 3V9XA 3MWTA 5KFMA 3H1VX 4OJRA 2UXBJ 2GCFA 3R7NB 2NYHA 1HYSA 1N8RT 1WC5A 2DVIA 3JB9k 3E9LA 4CBWA 3M8ZA 2KHOA 3PIOQ 1SKUB 4L6V3 1NDPA 4PKDB 2IHR1 3O9QA 3BO4A 2CQ0A 2YX6A 2Z1GA 3I6PA 2HQGA 4ZJLA 1HNZF 4ITSA 3Q24A 3VALA 5ETVA 4NCGA 1LWCB 2W9BB 1UOCA 1Q81O 4TY9A 4ED0A 3VAIA 1BE4A 3HVTA 1S9FA 2AMCB 4W92B 5C24A 2OO4A 4IXCA 1QVFR 5JS1A 4IG3A 2DH9A 4KH0B 4DS4A 2E5HA 2AGQA 2QWNA 2HGNA 3J8AA 2LEAA 3B4MA 2GHVC 3IG1A 1S1TB 1CZ9A 4O4GB 1YVUA 3AA2A 3SNNA 1VQ6S 2DHHA 1KHWA 4B1ZA 2DGUA 3NGYA 1KN6A 3MX5A 5GIOA 2B7CB 1OPIA 4H0VB 1EXQA 2E8AA 3V81B 3BM7A 4JI5K 2FC0A 4GC7A 5BYRA 2RU9A 3HZGA 3FBEA 4I2PA 3KJVB 4K5RA 2QYGA 1RKJA 1Q7YT 1KFSA 4Z4IA 1TL7B 2CGLA 1VK3A 2ZOMA 2WVEA 3MM5B 3IO1A 3NGSA 1NMDA 2WCXA 4Y28C 1KFDA 5D3GB 1ZOTA 5KOWA 5KGWA 4RU2A 2CPZA 1FXRA 1VQLS 4ZVRB 1BMQB 5HI7A 2Q43A 2YH0A 4BC9A 3DRSA 1JXVA 1J9AA 4DSEA 2OPQB 2RAQA 3W62A 3DOKA 4WKRA 3HHLC 1WOQA 3TVYA 2ZH4A 4J9VA 4E7IA 4DCPB 4PUOB 3NMAA 5K8OA 4OYAA 3T1AA 3V4MA 5DM7L 5EX5A 4Z2XA 3JQJA 4DV0K 3GJTB 4AF1A 2BJ7A 3TX8A 4LF8K 4H4KC 5DETA 3SI8A 4R8UA 2Q1LA 3QGIA 1CLQA 2J0SD 1TL7A 2DY1A 1CBKA 4MTPA 2IBOA 4FF3A 4DOZA 4ZPAA 2BYCA 1TELA 2Z2MA 5KG0A 3Q83A 2MKKA 2KXHA 4BGAA 2P9NB 3WXMB 1WN7A 3EGNA 2G8HA 3ILOA 2XTJP 2I7NA 2P9PA 4KRWA 3C6HA 1CZAN 5KPZA 3AGRA 2D0BA 3IWNC 1IBKJ 3L8BA 2F40A 2UXCK 1F9EB 1KVCA 2H3EB 5EWGA 3GOIA 3M2VB 3IM9A 3WQTA 1HNXJ 2CJBA 3GG0A 1WBDA 2XO6A 3TAEA 3DM2A 1VQ9N 4G1QB 2RKIB 3SIPB 4O3QA 1BI4B 4JI1K 5ELZA 2O8CB 5KT2A 4QWEA 3PEHA 2V68A 4HH0A 4DN0A 1HD1A 2E9TA 2ZEJA 1N6QA 1IXKA 4RW6A 2IYGA 1P1LA 2ZNYA 2CNOB 1OMSA 3CJKA 5DJBA 1LCUA 3OVBA 3MUMP 1S1TA 3CD0A 1RT1B 3NE6A 1J54A 3VEXA 4OPJA 2LP4A 4DV5F 1RACB 4CEDA 4RNHA 2EW9A 2WONA 3T7ZA 4X64K 2VC0A 1JCEA 3BB5A 1NH8A 4K8RA 1U1QA 4B1VA 3OTCA 5AQFA 4CE9A 2OCEA 3PNIA 3JQKA 2VPWB 3C6TA 3OSPA 2E1RA 1GLJO 1OSCA 4UUXA 3ZTQA 1TL1B 4IOXA 1NK4A 4CF0A 4NLPA 2O8DB 2RJZA 1IG9A 1RWWB 4CGJA 2QE5A 2B9WA 2HNYA 5CXTA 1RU2A 1WELA 3V9UA 3D1HA 4TU9A 1JL1A 4Y2MA 4ED8A 4DCOB 2F8EX 4UY8O 2Q66A 4X62J 4BR0A 3DOKB 3NH1A 4NZ0A 1WSFA 3EXYA 4BRNA 4H0YB 5K14B 2D4WA 1Q82T 2XGQA 3MEGB 3O9UA 2NXCA 1RHUB 1FJCA 4PG5A 4EO6A 3IWXA 3H3OB 2PA3A 4GV6A 2OEJA 1C1BB 3PUFA 1UJ5A 2CG8A 3I0SB 4KI4A 4CLUA 3DLEA 2JC1A 2P9LB 2CKWA 2E20A 4CHPA 2ZD1A 3WXJA 1SS6A 1RAIB 4HUEA 4JI2J 3MM6A 4MK8A 3K9KA 5B0CA 3O80A 4P6QA 2LQJA 3ZSXA 3L2WA 3OBWA 1ZBLA 1VQ5S 1LFWA 3C16B 2MGZA 3NBPA 2RHSB 3IDHA 4IFVB 2KT2A 4YOYA 5M1OA 4ZLNA 4B3MF 3ULDA 3RBEA 3VTIA 1FFSB 4B8CA 5F8GA 3L95X 1RWNB 1PJ5A 1S12A 2QG9B 2HGMA 3FCVA 2DR9A 4Z4EA 1IBKK 5KPTA 2F96A 3DLLQ 1FEHA 4GVMA 1S1XB 2EFGA 3CIMA 1M0SA 3CMQA 3RBDA 3MMVA 5H1SQ 4J9OA 4IYQA 1KLMA 2DXEA 3SFGA 1WC6A 2CZVC 5KFSA 1U47A 4FM2A 4V1Ak 5AQYA 1VIOA 4F25A 1X1PA 1N5SA 3UCUP 3K2PA 5BR8J 4OV6A 4JI1J 5EXWA 3G96A 4EFHA 3LGHA 3GG4A 2C2ZB 4O0IA 3EVOA 3I56N 4A5BA 4JBCA 4CJLA 1WF2A 2AF6A 2OAUA 1KHVA 1SUQA 4KHPK 2GMHA 5D4OA 1ZM2A 3ZTPA 4JKGB 1U25A 3K9JA 2QC3A 2VFTA 4FM1A 2HNZB 2NREA 3TZYA 1JXBA 3TZZA 4FLYA 2VV5A 4DPUA 4NLWA 5AQJA 1G1XA 2BJEA 1C1BA 3OQ2A 2HHHJ 1K9MO 2HZVA 4YHHJ 1ZAVA 4I64A 4H4MB 5CYQA 1UVIA 5FLXY 3S3NA 1LW0B 2GELA 1Q79A 1S1WB 3GFXA 3QRRA 4H0OA 5HP1A 1SH3A 2DGVA 1W7AA 5AQUA 1BY9A 2QKKA 3BN7A 4U8YA 2E5LK 2RQ4A 3DGPA 4IFYB 5B7WA 2C42A 2VG5A 3BPDA 2R7YA 2F9WA 1FO1A 2AJ4A 1NU0A 3FVYA 5C25B 3AVAA 2LXFA 3L2UA 2E4LA 4URSA 3LANA 1TMMA 4DR7F 3VEVA 1Q16B 3OTOF 1U0SA 4CJUA 4PKGA 3ZT0A 4DUYJ 4J9RA 1IKWA 4CO3A 4OHZA 2CADA 3ZX0A 1FRKA 1KXPA 5J1NA 3QIOA 1P8GA 1X3MA 2F9TA 3M2UB 1YJVA 4MLEA 4Q45A 4NRUA 1S6QA 4DN9A 4FLXA 1KC8O 2UUCK 2ZBQA 4B17A 4CO1A 3ICLA 2IOCA 3E1YA 2R7XA 4JK9A 3ID6A 4KREA 4MKVA 3V4IA 2ZE2A 4TYBA 3KWIA 3MI7X 3LAKA 4OZ0A 3SFUA 3TP2A 3V9ZA 1ROFA 4WU2A 3QETA 3AQPA 4NA2A 3EY1A 4FWLA 2MDAA 2HG4A 2BXJA 4ZN1A 2NXEA 5AFUH 4YDUA 4CNYA 5CCLA 4FWRA 1S5ZA 2VZ9A 3LP2B 5KG1A 4JP8A 3R9LA 2D1KA 2V4JB 2J8SA 1AFJA 4RBUA 3CCTA 1S7IA 4A4JA 3NS6A 4J2DA 1CJKB 2WOMB 3P96A 4V19X 4CGHA 2VG6A 1Z2ZA 2JLGA 5LL6Z 2QXLA 2HFOA 4OVLA 2MQMA 3BZQA 1RTIA 3CW2C 2MZJA 2K7JA 3Q8UA 1IH7A 2H5EA 2OHDA 1HBUB 3J7YU 4NLOA 4BC3A 4K25A 1SV5A 4DL2A 1ZYQA 4H0XB 4X4VA 1X4GA 2D7SA 2HYIB 1S9GB 2HNZA 3X1LB 4B3OB 2GHPA 3EDQB 1DQAA 4A5AA 1J5EJ 4OV1A 4DLGA 4KBIA 2L41A 4LIRA 3I0RA 1H6KX 2W2QP 3VVUA 1TKXB 4LVOP 4AHTA 1JJ4A 1FEEA 2BJ9A 4X2BA 5JVGL 1AROP 1R8CA 1RAOA 4XDCA 2CQ4A 3IMXA 4DL6A 4WYBA 1XN9A 5J2PB 4DSIA 2DO0A 5BRHA 3CG7A 2D1CA 3P4IA 4JRQA 1NJYA 5CHCB 3SI6A 1H1VA 4GO5X 2BMBA 4MO4A 3HYFA 4OZ2A 3M8QA 3OA9A 4P72A 1IKYA 1M1HA 3HI9A 3S1TA 4PL7A 2R4FA 1M5PC 3I33A 1T9WA 1RSCA 1HNIB 5J1EB 4B1UB 4ILLA 1S6OA 2UV8G 1TZ0A 5D15A 1I39A 3EGVA 4USUA 1CEZA 4YOVA 4CFDA 1NZAA 3AXMA 4JV5K 4CT9A 1OH5A 3R1HA 5EUHA 1KLMB 2WSCC 3CCMN 3J7A1 1HPZB 2XZWA 4WFBQ 3M5RA 5AQWA 3IBWA 2VQEF 3VAFA 2OYQA 4FJLA 4NLUA 5EDWA 5C7PA 1ASWA 4WCEL 1RBTA 4JKDA 2ZE2B 3C19A 4AQYK 1D9AA 4GNIA 3AVFA 3DAWA 2KFNA 2FSJA 4IJNA 4IOCQ 3H0PA 4JK7A 3TAFA 3F9MA 3IP0A 1XTZA 3KWMA 4BBYA 3FZKA 3NBPB 4MH8A 3W2VA 3H8YA 3T41A 4B3TF 2FBTA 1F5AA 1TKZA 1P6TA 4J9SA 1OYDA 3K57A 4ELTA 5CD4A 3IFEA 1H2VZ 2B4PA 3LO3A 3UVJA 1PYOB 5EX0A 2R7TA 4X4RA 4PQAA 2RMLA 3AHPA 3OFGA 1SPBP 1UPPA 2HFSA 2COLA 1RA7A 4UZBA 3M8RA 2ZVSA 1ZZFA 3MUTP 4CZLA 3LALA 2O8FB 2FHJA 4OLAA 4OJGA 2CJAA 2X1GA 4BRLA 3VAHA 3DLBA 3AAWB 4B3SJ 2M4MA 2CPYA 3AO5A 2AYEA 3PX6A 5BR8F 1F0XA 3JYTB 1UWBA 3GIJA 3B4DA 1RBAA 1NDCA 1NUEA 2Y3YA 1JJ2M 1OKJA 4LFBF 5A76A 1TUWA 4FJHA 1RB0A 4NE9C 4F3QA 4WK1A 5KAKA 1T05A 2FZKB 1ZETA 2B4JA 3LPUA 4XAKA 1QLNA 2D41A 4M3XA 3CJBA 1XR6A 4DTRA 1RDAA 3ZETB 2UUAK 5HANA 1RLDA 3EGWB 4JRPA 3NGTA 3MXHP 1AUSL 4N8OA 2NLXA 4EBEA 4YB5A 4OL8A 4RNMA 4NLBA 1NSAA 1BA0A 1JK9B 4QZVB 2V9WA 1BIUA 1J5EF 3VEWA 5ETSA 2P5GA 1SBRA 4UY8T 3W2WB 4RW4A 4CJWA 3CFRA 2HHTA 4DR2J 2HHHK 3W5ZA 4DR2K 1YZ7A 3CCQN 3HCXA 4NI2A 1X9JA 3GE1A 4QR2A 2W41A 2PFDA 1HNVA 1NPRA 3CI5A 3D4JA 1YLXA 2OTJS 2XMUA 3O9SA 2IVOA 4Y2AA 5IV4A 2KJVA 4BQLA 3NGIA 3G4SN 5GMDA 4K4VA 2QWQA 2QMUB 3OY9A 1HPMA 1IWGA 3CHWA 3AY9A 1WB9A 1VSIA 2M70A 4EZ9A 4DF4A 5FDLA 4QOZB 3I5BA 3QSYB 3S7RA 1NGAA 2XY5A 1OH6A 3K5MA 4LC9B 3KKFA 3AA9A 1Q8LA 1L3KA 1RE1B 4CEZA 2CGJA 2ILZA 5C2CA 1RHMB 3JTOA 1FJEB 3I32A 3W65A 4Q0BA 3OYCA 2LDIA 4FJ7A 2C2EA 5IT9Y 2HWHA 4DV3J 4V19J 3US5A 1KDNA 2JLFA 1KP6A 1VSDA 4A8OA 3UDEA 3HVRA 4CTAB 4W98A 3NF6A 3R5JB 2G9OA 2ZDOA 4E2FB 2BJ1A 1HYSB 4EHTA 4DV3F 1X0FA 1PC5A 3DI6B 4IQXA 2BDPA 4PKHA 3A12A 4ZVSB 1SC4B 3CJ3A 2LU1A 2QYCA 5L1KA 5J2QB 4NYNA 2W2MP 3FRZA 4HI1A 2GBZA 4FWPA 1J53A 4P73A 3OLAA 4KC5A 4CI6A 1LWFA 4M5LA 4CZHA 4QWCA 3V81A 3R97A 2NUBA 1HD0A 4DXLA 3ZSWA 5FLXO 2KU7A 3QNNA 3RB4A 4M5NA 5AZIB 3A8IA 4C3MA 3SQ1A 1FKPA 3UDVA 3R2CJ 1Q7YO 3K8WA 3RTVA 1FNOA 1YDLA 1KEKA 2PYJA 4O4GA 4Q5VA 2FF6A 3M2UA 5DDQC 4CIEA 3GDQA 2B9YA 4B02A 4AHVA 2NPFA 3IA0A 4HCCA 2ZH1A 1XNRF 5GMKa 3A8EA 4KHQA 1WTBA 1BISA 3W63A 3AGKA 2XYGB 4NXMJ 4IRKA 2OLWA 3R27A 2KVIA 2XMJA 3CJQA 4CO2A 4DHYA 1CJVA 1X4EA 2IM0A 5F0XA 1SQGA 3TYTA 4K50A 3Q2TC 4KGXB 5ITHA 2XWYA 2C2MB 1QTNB 2FVSA 1E4GT 3UWTA 3VQQA 2DFHA 3IG1B 2XNQA 3B8AX 4BVPA 4WZQA 1BWVA 1K8AO 4LD0A 1NOZA 3PVXA 1DTTA 1R31A 3JSYA 4NXNJ 4JYAF 1HFEL 5DG7A 2ZBIA 1UWBB 1RWXB 1WUAA 5KGXA 4BHQA 4CO0A 2CWXA 3A0IX 5AQXA 2VG7B 1WSHA 1EX8A 1C0MA 1WG5A 2V8VA 1H7XA 3ZSQA 4A8KA 4DUYF 2DNHA 2GX8A 4QS8A 4JV5J 3KTQA 2W2OP 4B3RJ 2DYAA 2R7RA 4LR7A 5L1JA 4F9OA 3VR1A 3OPKA 1TVRB 3IBFB 5E41A 3IR5B 2HBQB 3AA4A 4CM2A 4A57A 4ECUA 4F7VA 1X5PA 4ZPTR 2GC8A 2MB0B 3HP9A 1Y3KA 1BCOA 4YB1P 2VKZG 1ASVA 3EZOA 3H5UA 3RGIA 2HSEB 2VL1A 3O4NA 3HFVA 1FCAA 1VSEA 1MWYA 5DQGA 1Y9OA 3DRSB 1B7FA 4CVNE 2G4BA 4DZ6A 3MMCA 4PWDB 4NI2B 4OMFG 4BVOA 1Q8KA 1AFIA 3TTFA 2B6AA 4CEFA 2ZOGA 2A1SA 4UTGA 1IBCB 5IT9O 4C2MA 1WTFA 2FZCB 4RW4B 2ETJA 3QJJA 1JLBA 2CQ2A 5I42B 3D0GE 5AQGA 3THVA 1AXQA 4LSLA 4XH4A 2E5IA 3A8YA 3HT3A 8RUCA 3B78A 4KHUA 2VDHA 4ZN3A 1AYEA 3VAGA 2BQRA 4UT4A 3OYHA 2Z2LA 2R2UA 2M5YA 2QLWA 4DFKA 3V1QA 4CLFA 3P38A 4HUGA 1DZ5A 2HNDA 2QW9A 5F8JA 4J7CA 3MPWA 3TA0A 1JLEA 1C4CA 4BR2A 5LY3A 1HQUA 4ATNA 1S1XA 5A8KB 2DXDA 2CFXA 4ZCLA 4X84A 2HHUA 4HHHA 5C42B 4F36A 4WJBA 3NCIA 2CDQA 1TKDA 3AQOA 5LJ5Y 3EL2A 3UW1A 3M2VA 3CC4S 1DQ9A 2UXCF 2CA9A 1ATNA 3PYFA 5F3ZA 3LW5C 2ZQBA 3QERA 4IO1A 4ZPBA 2HBKA 3SAGA 3L7UA 3HHDA 4G1QA 4RW8A 1RZMA 3QT6A 4Y2IA 2Y1JA 1FJGJ 3QBXA 2AEMA 1N34K 1ZM4A 2CZ4A 1EQYA 4LF7K 3FNNA 2PE8A 1RT3B 2KKHA 3OHBA 3PDNA 3KK3A 2XZTB 3KUHA 4DPTA 3A5LC 3C14A 3E8OA 3QFHA 3QSIA 3DXSX 3MEKA 2QKBA 3PRDA 3HBTA 5HLFA 3SV4A 2KRRA 3U9ZA 2J9EA 3H2UB 2MY7A 2W9CB 4WFNL 3PW0A 3H20A 3I8DA 4ZIWA 4CFBA 1WAJA 1LWEA 4OX9K 2UVUA 1WNSA 4ZA1A 3DLKA 1V9OA 3RU0A 2G8UA 2VBXA 4ZMMA 1C0GA 1T9XA 1CC8A 1TVRA 4FJ5A 1WBBA 4NYFA 2D0AA 3ZXWA 3V1OA 4CTAA 5I3UB 4I0WA 2OD6A 1BQXA 2BW2A 4HTLA 5HVFA 2EFNA 3GR0A 4OI3A 2QFJA 1YXQA 1SQKA 3W3DA 1YTAA 4EBCA 2EHGA 3U1LA 3RSEB 2A1RA 4M5IA 3QO9B 4WF9L 4FYYB 2HEKA 4AHRA 4FWNA 4CJ4A 4P71A 3OS2A 3OYLA 1JLEB 1SV5B 3TABA 4ETZA 2BH1A 2Z1JA 1X5SA 5AQSA 5ETPA 1TKTB 1Q0NA 1OQ6A 5AQMA 2GQQA 4UQGA 1PJ6A 3OTBA 5AQQA 4AHUA 2XLJA 1GAOA 5DK5A 2O66A 4I9QA 3QJPA 3I9V9 4FXVA 3DRRB 1Q5YA 4J5OA 3I4HX 4LF8J 2W7AA 3M1VB 1VQSA 2YVSA 4ZPDA 2IVYA 3L0QA 3TZWA 5CYMB 4ZS6A 4M3WA 1ZAXA 2JOQA 3KVGA 2WRMA 3TAQA 2ZUGA 5AFUA 3BZKA 4RKUC 1QUPA 3PHTA 2KT3A 1YJNS 1FFGB 1TQLA 2HZCA 5MLCQ 1U24A 3W1YC 4JI3J 4IQMA 2B7BB 1RTJB 1XQIA 2I7PA 2PI5A 2HQCA 4LFBJ 4PPZA 4X4PA 1XEZA 3TPQA 3MPVA 3BGUA 4HLBA 4M5KA 3HTVA 1R59O 1EQMA 1UEKA 3RRHA 3DLJA 4CF9A 3TU5A 5L38A 4WFAQ 1BIZA 5HJXA 2ALYB 1CJKA 4BG9A 3KK1A 2W6LA 4CEAA 5CHIA 1IBKF 5JUMA 1YI2N 5HL7Q 5ETKA 1VQNN 4PG6A 1L3UA 1DTTB 4DF8A 1KLNA 4BACA 2ZOFA 2Z30B 3TR5A 3KFWX 2CVEA 2W42A 3GR1A 3O08A 3CIZA 4QPTA 1AZSB 2W4DA 4FW1A 3S3OA 1W0HA 2BW7A 1H38A 3ZSZA 1WNEA 4AHSA 1K0TA 3I8BA 4CHYA 4JV1A 2XMAA 3LDQA 3TW0A 2ZH2A 3L3VA 1GXTA 4YDXA 1B70B 1RDDA 1O1WA 1MWQA 4WCEQ 1G15A 1R89A 1PG5B 2CJQA 3TAMB 4CLSA 3MR3A 2AX0A 1D3WA 4NXNK 1U6FA 1HL6A 3TNVA 2BQUA 2MHEA 1QVFM 1XNQJ 4FBTA 4C8YA 4CWBA 5JMNA 3NLCA 3K7RA 4KGZB 3UE2A 4RWTA 5CABA 5BJRA 3IRXB 1VQ8S 2IJFA 2XSFA 3MZIA 1UVNA 2VWBA 2BJ3A 3MMJA 4LF4J 3OYEA 2NLWA 1T03A 4JKHA 5AJ3J 3J80U 2ZVIA 4I67A 3OTEA 3GFHA 2F65A 4DX5A 5D0HA 1YGYA 1HR0J 3NGRA 3TANA 2FY8A 2KJWA 5KFYA 5AQZA 2JLEA 2GGPA 1U1RA 1JWWA 4JNEA 1QQNA 4DR7K 3UCZP 1ZAWA 5AZJB 2XMWA 5KPRA 3CJ9A 1XMOK 2LU2A 2N3OA 2P9KA 1S97A 4O5BA 3BF4A 5FRMA 1RWVB 1MROA 1KD1T 3MXIA 3AXKA 3I82A 5DZ7A 1JLFA 4ZVGA 2IAJA 3R7SB 4W5TA 3TUZC 4QBUA 1N5QA 4RW7A 1RGVA 3C15A 5M1FA 4LF1A 1XMQF 3OR2B 2V6AA 4IDHA 4FYVB 4DU4A 1GX5A 2QTDA 1RT7A 1GT8A 3VZHA 5F0WA 3V9SA 3S9HA 1EWQA 2PA8D 1NK0A 1RTHB 4X65F 2QLXA 2WUSA 3CO0P 3WZ0A 2NRHA 1K6YA 4USMA 1FJ7A 1W2BM 1HWIA 3O2IA 4GC6A 4HHJA 4ISEA 2G1HA 3OVSA 3NNAA 3AVKA 5BN8A 5FJ4A 2R7QA 3HI0A 2XCAA 5IM0B 4CZKA 5K8PA 2J6UA 1RILA 3I5CA 4CJPA 2QTWA 2RPIA 1YIJN 2VYPA 4WQ4A 4EO8A 2BGGA 1GEHA 2W2NP 2Z0GA 4ANDA 5HL7L 3UDCA 4TU8A 1X4BA 4GV3A 3G9CA 3MCAB 4YQWA 3LPYA 1SJFA 4YOEA 3ZFVA 4WQ5A 3SDEA 4NLRA 2JWLA 3M6VA 3EXCX 3KHGA 3Q8PB 3MECA 4G1IA 3DM2B 5GADI 3KK2B 1QY7A 1TFWA 2YHXA 5AE2A 1H2TZ 3CD6S 2POKA 1Y7PA 4PWUA 5J2MA 1S48A 1R8HA 3BBFA 1UVLA 4C98A 3N0VA 1LEOA 3WX4A 1N54B 3IFRA 1U1OA 1XMOJ 3CXCM 1WSRA 3I55S 4OFZA 4W5RA 2K06A 2NRXA 3OUYA 4TLQA 3C95A 4DTUA 3FZFA 3W60A 5A8RA 3HDSA 4Z37A 4MKAA 2Q36A 4L75A 5FPNA 8AT1B 2DHSA 2XI3A 4CERA 4KFBB 2E66A 3SCLE 4M5GA 4ED5A 3LP0A 4OLBA 2QXFA 5F8MA 4R0JA 4GVBA 1HPZA 1QAJA 3SSSA 5L39A 2Z8QA 1U09A 1HNWF 1NBEB 4DPXA 2GMJA 4IZ9A 2ZC3A 1M5SA 4DV6F 3CMAS 4KKOA 4JV5F 3PO5A 4GMJB 3O3LA 4QW9A 3NF8A 3C6TB 2E44A 3FMWA 1DQ8A 3LM2A 1YG0A 3OS1A 3NAHA 1L5UA 1XNQK 1QD1A 2HBJA 3N79A 3VF6A 2B4OA 4CM0A 1M90O 2ZZNA 1N33K 2ZH3A 2Y8YA 2FZGB 3OR2A 3E66A 5HN0A 3ULEA 2R3VA 3KHHA 1KKHA 2XM3A 3CIPA 4R0EA 1RT7B 1FK9B 2BABA 2MTLA 1U49A 3DDIA 2HHWA 3NRBA 4A2BA 1N4LA 2PSZA 2VD3A 2UXDK 3MDQA 4JI2F 4X4SA 4E1NA 3M9MB 2IPOB 4CEEA 3J7YI 3UN2A 4YN3B 5AJ3F 4KAIA 3BZCA 3CCZA 3RVCA 2R7UA 2DNMA 2ZJQL 5CR4A 2WBRA 3GJRB 3MM9B 4DV1J 2QFIA 3CFPA 1NOYA 2V2ZA 4M3UA 5B09A 2HGLA 1DRZA 1G7CB 2IYIA 2O8CA 3BH6B 4LIWA 4P7TA 3A5OC 1U1MA 1YJUA 3G87A 4BGBA 1BQNB 1K1QA 3EGZA 4ZKAA 1EHWA 2GVDB 3NHGA 1RAFB 3H5SA 1YBUA 4WTYA 5BR8K 5AQNA 4CO4A 1HARA 2V69A 2PI4A 1TYQB 2IGIA 4Q43A 4Y1DA 3NF9A 3OHAA 1FTCA 2Q6BA 2D0OA 5M2UA 1WC4A 1NGHA 3OXGA 3V5RA 2DTJA 1W2BR 1QAIA 3VF4A 3M6XA 5B8HA 4NCBA 3GIIA 2F4VF 2OZSA 1AA1B 3NOGA 2PMWA 2JWKA 1FWPA 3QINA 5G4DA 4OHYA 2B4UA 1X60A 3G25A 4M3TA 4OYIA 3WNGA 2XQCA 3AVLA 2N4CA 1YJRA 4ELUA 2FJAB 3EX7B 2FJDB 2XULA 2E2OA 3MDFA 1JKHA 2CPXA 3W2WA 4V19S 3KHLA 4LBPA 5LMNK 3ZTOA 4K42A 2AP6A 4I6MA 5C25A 1Z2LA 3K5NA 4JOUA 3V6DB 2HFZA 2D0CA 1FRMA 4Z4FA 2ZGYA 3HVTB 1RI7A 4OHVA 1IG8A 4FKYA 2C1EB 2MZ1A 3NVMA 1OIAA 3VQ6A 4ISFA 3DKDA 1S9GA 1U8WA 3W9IA 2Q0UA 4IG0A 4C8NA 4H4OB 2PO4A 2GA7A 2YNIA 2BE7D 4KHWA 4YOWA 4BQZA 1GFWB 3PJXA 3QEWA 4TY8A 1VHFA 1TKXA 4R79A 5ADXH 1S1WA 4PPDA 2P9IB 4NXMF 3GILA 3TTDA 4PEOA 1OS5A 4FKXA 2DRBA 4P7VA 2Z1IA 3MGJA 1FVQA 2HFUA 5KFFA 3CSKA 1S77D 3F41A 5ETNA 1SIZA 4BRDA 4DZDA 1KBRA 2XY8A 3NWRA 1RAHB 3PLAA 2VKRA 3FUYA 3LWLA 3D0HE 4I7FB 1NKBA 4H8KA 3HPHA 3JSMB 2V8PA 2VFSA 2HS4A 5KFTA 2WVFA 5IXUA