2RF2A

Hiv reverse transcriptase in complex with inhibitor 7e (nnrti)
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
557
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel indole-3-sulfonamides as potent HIV non-nucleoside reverse transcriptase inhibitors (NNRTIs).
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7
total genus 157
structure length 554
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2rf2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rf2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rf2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rf2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2rf2A05
1B9FA 4H4MA 5CYQA 4CEBA 4DU4A 4DFMA 5KG3A 4CJLA 2HNYA 3WNHA 1VRTB 3ZSQA 2HVIA 4M42A 3HXMA 1RDRA 2E9RX 2XCAA 4H4MB 4CF2A 3V9WA 5KFPA 3KLFA 2YHAA 4DLGA 4MKBA 5C5JA 3I0RB 1J53A 4FLWA 3QIDA 4F8RA 1S0NA 3M8QA 1VRUA 3QZ7A 4AHVA 4DL4A 4AHTA 4CHQA 4WFYA 4BE1A 1WSIA 4O5BA 1JLBA 4DL3A 3QESA 3KLHB 3KJVA 4RNHA 2W9AA 3CWJA 4PQUB 4DG1B 2RF2A 2Y1JA 3HPOA 4QWBA 3RMCA 3FQKA 5F9NA 2Z1IA 2AX0A 3SZ2A 4K8XA 3T5JA 3ALYA 3V4IB 4KV8B 2BDPA 5KRSA 4J9QA 3I5CA 1RTHA 2FC0A 4NLRA 3LP1A 4CJUA 1KHWA 3V1OA 1SH3A 2RF2B 5KG2A 3M8QB 5EWGA 4WFXA 4PUOB 1ZBHA 2P1JA 4DTXA 4Q8FA 3CJ3A 2IJNA 3DLGA 1REVB 3CJ0A 2XGPA 2JEIA 3OYBA 1SUQB 2DFFA 3SFUA 1QTMA 3OSPA 2HNYB 3LP0A 3PV8A 3MECB 4DSKA 4B9MA 1RT7A 2FLNA 1HRHA 1VSFA 4NLXA 4JV2A 1TAUA 3WNEA 1S6QA 3RB0A 3HO1A 3DOLA 3T5HA 3JYTB 1X1PA 3LWLA 1C1BA 2R2TA 1QSLA 3U3GA 1JL1A 4BE0A 1SL0A 3KJVB 4YMEA 1KVAA 4RUAA 2HB5A 1VSHA 2ASDA 4RW6A 1EP4B 4JS4A 4DL2A 3G6YA 4ZMMA 4E1MA 4CHYA 2HNZB 2FVPA 2BR0A 3CFRA 1NK0A 2HNDA 1QSYA 3MEGB 1LV5A 4CFCA 1UWBB 2QK9A 3DMJB 4FJHA 4E0DA 3KNAA 4ECYA 4Q45A 4BWJA 3ZT4A 5KFGA 3LAKA 1RNHA 5I42B 3I0RA 4CIEA 1NKEA 2G8KA 3FFIA 5F8IA 4G1QB 1ZBUA 2OZMA 5F8GA 3GV7B 4CJKA 3MEEB 4LQ9A 4NRTA 1XR5A 5DQGA 3RWUA 3QZ8A 3I5BA 4FXDA 4CHNA 4W5TA 5FRNA 4CJEA 1SL1A 3L2VA 1WAJA 2ZQBA 3KD5E 4LSLB 1SKWA 5HRNA 4YNQA 4Z4CA 2O5DA 3SYZA 3SUNA 4EYIB 4ED3A 4KHQA 2V0NA 4B9SA 4FM0A 3NBPA 2XRIA 4FJIA 2RDJA 5EU7A 4K50A 1D0EA 4E7LA 1K1SA 1GX6A 5DG7A 3MR5A 5HBMA 5J1EA 1BI4B 1WSHA 2HNZA 1UA1A 5DLGA 3V9UA 4HKQA 3QETA 1QUVA 1IM4A 4CIFA 3KKSA 5KT5A 2B5JB 2IA6A 5C25A 2G8FA 4ZP6A 3T3FA 3TI0A 5J2PB 2AGOA 4F2SA 5HROB 3PW4A 3AVCA 3BGRB 2ATLA 3KK1B 3OVNA 4DTNA 3KMSA 1D9DA 4CGDA 1NKCA 3KHGA 1TKZB 3G6XA 5F8NA 1C0TA 1S9EA 4RW4A 4O3NA 3KHRA 5C25B 5JS2A 3B6OA 1IH7A 5J2PA 2PZSA 4CEDA 3IRXB 4N41A 4K8ZA 3L2UA 3K58A 3BGRA 1U49A 3M8PB 2DFEA 4ZP7A 4RNMA 2RDIA 5KFBA 4NLWA 1NJXA 3AO5A 1RT1A 4I7FB 4IR9A 4TQRA 2KQ2A 4U7CA 5KTQA 4KAIA 2D0AA 2YNGA 4FYDA 2J6UA 2IOCA 3MEDB 5JUMA 5DMRA 1WSJA 4DS5A 3E51A 2OPQA 5KRTA 4XPEA 4AHSA 4KB0A 1KVCA 3HYFA 4KSEB 1WNSA 1X9WA 1RA7A 3MEDA 1K1QA 2F8SA 4TYBA 2XCPA 4M3ZA 3U6FA 3DLEA 4O3RA 1DTTA 4DL7A 2LSNA 2BQ3A 4ED1A 1CSJA 4E7JA 4EO8A 3I5AA 4EP4A 4CEEA 2XO7A 4NYFA 3PW5A 4ID5B 4FJ9A 2HHQA 1S48A 4J2EA 4TYAA 1HYSA 1NJZA 4CE9A 1D8YA 3MR2A 3ZSOA 3AVNA 2OYQA 3OYJA 1TK0A 4EZ6A 4OGCA 4MK7A 3NGDA 3GIIA 1ASUA 1NJYA 3ZSRA 3DLKB 4FS1A 1J5OB 4KFBB 3PY8A 1HYVA 3LALA 3QEPA 4I2QB 4JRQA 4URQU 1S6PB 1NHVA 1S1WB 5D3GB 3OHAA 4M3XA 4DFJA 4TSXA 1N5YB 3O4NA 3BR9A 4CECA 4ECTA 4FJJA 3DOKA 1WNEA 3GIKA 3DRPA 4Z4EA 3BREA 5KFDA 3CG7A 3HPGA 4IRDA 4NCAA 3PJWA 2VG5B 1DLOA 3VA0A 3DM2B 1HQUA 4K4SA 4NRUA 2R2SA 1S1TB 2VG6A 3KLHA 3NFAA 5FROA 3CDUA 4FZYA 1HNIB 4MFBB 1JLGA 2ZD1A 1LW0B 3T1AA 5KG6A 3O3FA 2IDOA 1N5YA 1SV5A 4KHYA 5KT3A 4U6PA 1VK0A 4E1NA 1BQNA 4NCGB 3DRRA 4KRFA 3HK2A 4WE1A 4M95A 3OYMA 1IKYA 3DLRA 3H08A 3HSTB 3O3HA 2G8HA 4LH4A 3RMBA 4NLGA 4IH7A 1RTHB 3BQ2A 4FW2A 4F4KA 2E6MA 3KLEA 1GOBA 4DEZA 4WFZA 3LP2B 2ZKUA 1W0HA 3OY9A 3V1QA 4YR0A 3V6KA 5HLFA 3DM2A 3MXJA 4R5PB 1D5AA 1RYSA 4ID5A 4Q0BB 3BQ0A 4Z4GA 1JLAA 2BANB 4JS5A 4IG3A 4HUFA 4FK4A 3SNNA 1L3TA 1HQUB 4IFYB 4IG0B 4OLAA 2F96A 3K2PA 3VQSA 2KW4A 3L8BA 2A1SA 4FJ5A 3N6NA 4LSNA 5KGWA 3MF5A 4M3UA 4RW6B 1C1BB 2YKNB 4J2AA 4ZVGA 3NF9A 4E19A 3QNOA 3TAMA 3QERA 5KFMA 3SQ2A 5KFFA 1D9FA 4KBIA 5FDLB 5KFZA 3V9XA 3CDWA 3DOLB 1R0AB 5L1JA 1Y97A 1TVRB 1NK5A 3TAMB 5KFHA 4XO0A 2D3ZA 3FFIB 1KHVA 4LQ3A 3DI6B 2YKNA 2QV6A 4TXSA 4KPYA 2WOMA 3EZ5A 4C8LA 3WNFA 5KT6A 2AGQA 3VQCA 3V4IA 4MH8A 3CO9A 5HP1A 2O4IA 2YKMA 3MTKA 4OLBA 1VSEA 1YVFA 3GILA 2XY5A 3LZIA 3AO1A 4Y3CA 3L2WA 1RTJB 3VQEA 4DG1A 1T7PA 2KFZA 3PW0A 3V6DA 2JC1A 2BANA 3Q8RB 1FK9B 1BHLA 1XHZA 4CJWA 4KREA 2IJFA 4FLTA 4URGA 2BRKA 5DQIA 4IKAA 4KV8A 1JXEA 3UIQA 4H4OB 3NH2A 4LY7A 3ZSZA 4FM1A 2Z1JA 4I9LA 3TAEA 3IS9B 4ZPCA 2DPJA 4ZVEA 4GVMA 3GIMA 3IN5A 2FBXA 4DMNA 1GOAA 3P5JA 2YKMB 3ASMA 1MU2A 5CYMA 3NBPB 4KI6A 4QWDA 3KKRA 4GC6A 4CFBA 3QO9A 3OS1A 1S1VB 1X9SA 4HUEA 1XI1A 3AVIA 3KD1E 2IM3A 5CZ1A 3SUOA 3M8PA 3CM5A 3G6VA 3HT3A 4MIBA 4NCBA 1FKOA 5E41A 5KFCA 1W9HA 3C95A 1RT2B 2YNHA 3H5UA 1T03B 4IFVB 4QPXA 3BJYA 4HVJA 5EUHA 4CGFA 3CYMA 2FJXA 3CIZA 4BDZA 1JKHB 2J6TA 4KTZA 3F73A 3VQAA 4DQIA 1SL2A 3TWHA 5J1EB 3MR3A 1SH2A 5FRMA 4N56A 4CJQA 4RNNA 4R8UA 4CCHA 4OKKA 4PWDA 2KZZA 3LAMA 3KK2B 4NLUA 3KLIA 3QNNA 5I42A 3SV4A 1JLFB 3GIJA 5HRRA 4KB7A 3OLBA 2W42A 4RW9A 4FJNA 2B6AB 1RTIB 1NNDA 5C24B 2GIQA 5EWEA 4QWEA 4IH6A 3PX0A 2ATQA 3D28A 4PWDB 4EYHB 4O3QA 5HP1B 3NMAA 2OPPA 1RBUA 1L3SA 3T5LA 4ECSA 4M3RA 2D41A 1JKHA 1FXXA 3PVXA 1Z25A 3OYHA 3TAFA 2D5RA 1WLJA 4O0JA 3CJ4A 1RTDB 4B3OB 3AVMA 3DLKA 4N47A 2WONA 1RT7B 3FRZA 1EETA 3M9MB 4M45A 1NK7A 1J9AA 2EHGA 4CF9A 3PO4A 4DSFA 2BE2A 1ZBFA 2HHTA 3CVKA 1Z26A 4K4TA 3G86A 2P5GA 4KHNA 4ED0A 4TY8A 4AHRA 3NAIA 1REVA 1HQEB 1QE1A 3G0ZA 1QS4A 2OPPB 1I39A 5HROA 4CK1A 3HVTB 4GW6A 3NGIA 3H2LA 4OKEA 1TQLA 5DGBA 2CKWA 1RTDA 4B3OA 2D3UA 4J9LA 1A5XA 4QWAA 2OPQB 3QINA 4JV0A 3ZCMA 1ZBLA 1TV6B 3OYFA 1HARA 3MXMA 4DTOA 3HHKA 2X74A 4H4OA 4RW9B 1ZETA 3RRHA 4WYLA 3DLHA 1I3AA 1C6VA 1K6YA 3RTVA 3C6UB 3I0SB 4DSIA 3E01B 5KT4A 3K5MA 1TP7A 3NF8A 4KO0B 1LW2B 4ED6A 1SKRA 1NK9A 3HL8A 4EEYA 4I2QA 3RB4A 4FK2A 1C0TB 2KZMA 1C0UB 1C1CA 4OVLA 4Y2CA 1HPZB 1S1UA 3C6TB 2V4QA 1XR6A 5DK5A 5KFNA 2XY8A 4KKOB 1TL1B 3E01A 3OYDA 4MQ3A 1HNIA 4QW8A 5KFAA 4J9OA 4PY5A 2BQUA 3TANA 1RBRA 4M41A 3LPTA 2FJVA 4RNOA 1LAVA 1ASVA 4YR2A 2HHUA 3KK3B 4AILC 2RPIA 2W8LA 2VWKA 4R8UB 4DLEA 2C28A 5J2QA 3KIOA 4ECRA 4NLDA 3MR6A 1T3NA 3HP9A 2W9CA 3RB3A 4JLHA 3UQSA 4O55A 4CF1A 4CHZA 3DRSA 1RDDA 1TK5A 1BGXT 5D3GA 1JL2A 3RRGA 4C8OA 2EX3A 1TKZA 4IDKB 1HYZA 1X9MA 2HWIA 3DOKB 1C1CB 4IH5A 5T7BA 2W7PA 4XIUA 3ZSYA 2IC3A 2IAJB 1LW2A 2RKIB 5J2NA 1C2PA 1KLNA 3KLFB 4NLQA 5K14B 2QE5A 3RBDA 4ECVA 4Z4HA 4W5QA 1IKYB 3C6TA 5F8MA 4J9RA 2ASJA 4DFKA 3SUQA 1VSKA 2FLPA 2Q3SA 3PJXA 2UVWA 3S9HA 4MFBA 1QHTA 3L2QA 2G8UA 4FZXC 1W25A 1R0AA 2JGUA 5L1LA 1NHUA 4FLVA 2I1RA 2JEGA 4CHOA 3V9SA 4F4XA 3MXIA 1U47A 1S1XA 4OJRA 4ZVFA 5KT7A 2KFNA 1JLEA 4M3YA 4M3TA 1L3UA 3M8RA 3QIPA 3EPIA 4H8KA 1CXQA 2D0BA 3AVFA 4KAZA 2G8WA 1RBTA 2HHXA 4NLVA 1IKWA 3OLAA 4B9VA 4CJFA 2WTFA 3TAQA 3OL6A 3NCIA 3QGGA 4O3OA 5L1KA 3K5NA 1QQCA 4CGGA 3VA3A 3LP0B 4Y2AA 1S0MA 5DQHA 1HMVA 5KFIA 2PYLA 5HLFB 3QGIA 1UA0A 4FVMA 1S49A 1L5UA 3QEIA 4J2DA 3PW2A 1TVRA 1S6PA 1ZYQA 3LP2A 3UR0A 3AA2A 5CZ2A 1CZBA 1LWEB 1G15A 4CJ5A 4CFAA 3LP3A 4FLUA 4FJLA 4FLYA 4GC7A 3ZT0A 1S1VA 4NZ0A 4K4VA 1TK8A 1HMVB 3PUFA 1D1UA 4KE5A 3OYCA 1BCOA 1RYRA 5KFYA 4I9QA 3H59A 3OL8A 4M3WA 1RT5B 2IM1A 5SWMA 3H5SA 2IGIA 4Q44A 4NYNA 5C24A 3PO5A 2HNDB 4DTRA 4G3IA 3EZUA 4EO6A 3RBEA 5HRSA 4LSNB 3NAHA 3HKWA 4Q8EA 3AO4A 4UQGA 3QYYA 3V6DB 4DU3A 4IG3B 4HUGA 3U3YA 2FBYA 3VQ8A 3PR5B 4FK0A 3LDSA 2YNFA 3OYAA 4E3SA 1KLMB 3H4DA 2OPRB 3NGZA 3SFGA 2DPIA 1YVUA 1RT5A 4FBTA 1VSJA 3MECA 1RTJA 1S97A 4CEQA 4O3SA 4F3TA 4PUOA 1S5JA 1RILA 5KFEA 2WRMA 1C0MA 2R7YA 3OJUA 4ELUA 4YP3A 4HHTA 1BQMB 4ID1A 2HW3A 2DFHA 4ZTJA 3IS9A 2OH2A 3RR7A 4H54A 3P83D 3MEEA 1TL3A 1HNVA 5EWFA 1BI4A 4EZ9A 4ECQA 2P5OA 2HHVA 3LP1B 1RDAA 1SKSA 1C0UA 1VSMA 1UWBA 1C1AA 1JXBA 4E7KA 4PA1A 3N6LA 3QGHA 3D45A 1TKDA 1NK4A 4ELVA 4IKFA 3DLGB 2FLLA 3WNGA 4RW7B 4KHMA 2RN2A 1FK9A 3KOAA 1S10A 4DSEA 4NLYA 3JSMB 4DWIA 2B43A 5KFSA 4Q0BA 2FBVA 3H4BA 1HQEA 4CJVA 4ZPDA 1TL3B 3HVTA 2C22A 4Q43A 3OS2A 4IBNA 4ZPBA 2XI2A 1OS5A 4B9UA 3HVAA 2JLEA 2QXFA 4OGEA 2I5JA 3TARA 1QAIA 3TVKA 4FJXA 4ZHRA 2R8HA 4J9KA 3D5MA 3VQ4A 2D7SA 1N56A 3TAPA 3KK1A 3RAQA 1LWFA 3SI6A 2FVQA 2X6SA 1RT4A 2O4GA 3ZT1A 3NGYA 2C2RA 2PYJA 4ECWA 4OPJA 3C94A 1U45A 1NOYA 3BQ1A 1WSGA 3KLVA 3QEWA 5T14A 1JLFA 1VSLA 1RAJA 4QCLA 1RT6A 4DS4A 2B5JA 1EXQA 1O1WA 4ICLB 5KFWA 2OA8A 4OPKA 1KFDA 4CEAA 2YNIB 3H5XA 4HCBA 2ALZA 2R8GA 5J2MA 3F9KA 2V4RA 3VQ7A 4M94A 1WAFA 1EX4A 3OHBA 2OPSA 5KFVA 1U48A 3AVHA 2A1RA 1CXUA 1VSDA 3AVAA 2VWJA 3UDLA 3FQLA 3NH1A 2VA2A 3BSAA 2YNHB 2E6LA 3AA5X 4LH5A 2R8JA 1S4FA 4MKAA 4TN2A 4B08A 4AHUA 4F3OA 3LZJA 4CJPA 2AQ4A 4J9NA 1WSEA 3PR4A 1T94A 2R8KA 3I8DA 3Q8SB 4B8CA 4CJSA 4TY8B 3HVRA 1FKPB 2FBTA 2WONB 3AVBA 5KI6A 1RT3A 4K4WA 5DGAA 4CEZA 4ZPAA 4J9SA 5KG5A 1FKOB 3H40A 4AH9A 1LW0A 3OJSA 1TAQA 4KO0A 2IC3B 2IM0A 5DLFA 2XWYA 3VQBA 4YR3A 4CGJA 4WZMA 3L3UA 3SV3A 3VQ5A 4CF0A 2HWHA 1TV6A 5F9LA 4RG8A 3C6UA 3I0SA 4B8AB 4DQSA 2W9CB 3KTQA 3CFPA 3P1GA 3G10A 3DRSB 4MIAA 4QW9A 2UUWA 4F50A 4IG0A 3CQ8A 1J54A 1S1XB 4RZRA 3BSOA 2WOMB 1JIHA 4IRKA 4XPCA 5DG9A 4RW8B 3ICLA 1IKVA 3KK2A 3ITHA 3KLGB 3SCXA 1RBSA 2XHBA 4KFBA 1JLCB 3H5YA 4DQQA 4KKOA 3NF7A 2FVSA 3SUPA 3OS0A 3NH0A 4ECZA 3ULDA 3S3OA 5JS1A 4MK9A 3MAQA 1S1UB 1JLQA 2ZE2A 3K57A 4NLPA 4CEOA 2GBZA 1HYSB 2FVCA 1ZBIA 4HTUA 1TKTA 3K59A 2OPSB 4Z4IA 4ZP9A 2HMIA 3KLGA 3O4QA 4W5RA 4NYZA 4KHUA 4CF8A 4OL8A 2R8IA 4FLZA 1IKWB 3SJJA 3HP6A 3K5OA 4BWMA 4N76A 1TKXA 1Q9XA 2IM2A 4TLRA 3AV9A 2IBKA 5KFRA 4ZVHA 4O3PA 4DL5A 2Y1IA 1U09A 4Y1CA 1IKVB 4HCCA 5C42B 4IR1A 5J2QB 5KG1A 2FJWA 3L3VA 4W5OA 3KHHA 3TR8A 4ECXA 4JRPA 4PQUA 2VG5A 3FSIA 1IO2A 2P51A 3Q8PB 1S1WA 4F4YA 1VRUB 1BQMA 2UVVA 4DTSA 2E4LA 4Y1DA 4ECUA 1RA6A 4FJ7A 2AWZA 1YTUA 1NJWA 4E7IA 3S3NA 1BQNB 4NCGA 2AGPA 1KCFA 1U04A 4JUZA 2GIRA 1S6QB 3IGNA 1LWCB 1TKTB 2V9WA 4N5SA 1F21A 5CY4A 2WHOA 3DI6A 1JLQB 2ZE2B 3HPHA 3IAYA 3DYAA 1RT3B 4R0EA 1BIUA 2IAJA 5J2NB 5KT2A 3V81A 4YFUA 4ZP8A 4CK2A 2E9TA 2YNFB 4FM2A 3HM9A 3SQ4A 4ED2A 4DTMA 1QSSA 2XC9A 2VA3A 1Z4UA 4O4RA 5KFXA 4DQRA 2J6SA 3H98A 4FJ8A 3V9ZA 1KFSA 2DTUA 2GC8A 3QO9B 3M9NB 3IGVA 4CHPA 3DMJA 4DSJA 3DLBA 4RUCA 3RR8A 1EP4A 1S9GA 2EC0A 1EKEA 4CGIA 3QIPB 4IDKA 3LWMA 4ZTFA 4KB1A 2F8EX 4WXWA 1RDBA 1Q9YA 5C42A 2HAIA 3MEGA 4B9LA 4Y34A 1KLMA 1BIZA 4F4ZA 2B6AA 1S1TA 3LPUA 3D0PA 2ASLA 4FJGA 2WK4A 4ICLA 2C2EA 4BE2A 4DF4A 4DTJA 2JEJA 4KHWA 4K4UA 4HYKA 2QKKA 4O44A 4ELTA 3DRPB 4EBEA 1RT4B 4K4XA 5FDLA 5KFLA 1EETB 1SUQA 4WYWA 1NOZA 3V81B 3EYZA 3K5LA 3BSNA 1YT3A 3O3GA 2BRLA 5I3UB 3V6JA 3UPFA 2QKBA 3BSCA 4FJMA 3KHLA 4O4GB 4KI4A 4KHSA 2OPRA 5L9XA 5KGXA 3V6HA 3NF6A 5KFQA 3NDKA 3VN5A 1JLGB 3AVLA 1S9GB 4O4GA 1LWEA 2JC0A 2W8KA 3NKYA 2PY5A 4FBUA 2KTQA 5I3UA 3VQPA 3PX4A 3DDKA 2VG7A 3HVWA 1N48A 1ITGA 3DRRB 3AVKA 3TABA 1GX5A 1ASWA 3NHGA 4EBCA 3AVJA 2JEFA 1UOCA 1RT1B 4I7FA 5JXSA 3ZSXA 2ILZA 3CDEA 5KFUA 3SPZA 1SH0A 3V1RA 5EDWA 1U4BA 4B9NA 4CIGA 2F8TA 4L8RB 4WXOA 4DFPA 4E89A 5L1IA 5KG0A 3KMQA 3QEVA 3DYAB 3ISND 4ED7A 1Q8IA 3NAEA 3N6MA 5HBMB 5KFTA 2C2DA 2YHBA 1T03A 1A5WA 5KFKA 1RT6B 1B9DA 1XWLA 2WB4A 1XHXA 4J2BA 1J5OA 2UVRA 4IFVA 1KRPA 1HNVB 2DY4A 1N4LA 4IOBA 2Z1GA 4BDYA 1QE1B 1LWFB 4QAGA 1RT2A 3OYNA 5F8JA 1MU2B 4F4WA 1JXLA 4G1QA 2YV0X 3PHEA 4DL6A 3A2FA 3AO2A 4CERA 2UVUA 2W9BB 1VSIA 5KFJA 3QIOA 1KTQA 2WCXA 2I5JB 2W7OA 3GYNA 3PW7A 2AU0A 2XI3A 3QLHB 2R2RA 1XR7A 4DSLA 2RKIA 1BCMA 3VQQA 3OYEA 3TQ1A 1RTIA 4WZQA 2X78A 3DLEB 2GUIA 3CFOA 4DQPA 2NUBA 1NK8A 3PX6A 3KLIB 3T5KA 5DG8A 3SQ0A 1B92A 3GV8B 3QLHA 4AHCA 4CK3A 3VQ9A 5F8LA 4K4ZA 2D0CA 4FZZA 3LANA 3OL7A 1UAXA 3SPYA 3ZSVA 4CJRA 4RW7A 3CJ2A 4CJTA 4IRCA 3ZT3A 1MMLA 2G8VA 4YQWA 4B9TA 3RB6A 1IG9A 2BE2B 3FDSA 4CJ3A 3SI8A 4BDPA 1TGOA 2W9BA 3ZT2A 3KK3A 3EY1A 3OYKA 4ZHRB 5F8HA 5HRPA 1S9EB 4RW4B 3ZSWA 1IKXA 4IQXA 4Q5VA 2X6NA 3OL9A 1S9FA 2Z1HA 1BISA 3IRXA 4CEFA 1TL1A 4NLOA 3AA3A 4C8MA 1BL3A 2XGQA 3S3MA 1GOCA 1IKXB 4O0IA 1HPZA 5KG4A 1NKBA 3AO3A 4DU1A 3NE6A 3OYIA 5CYMB 1DTQB 4RU9A 3M9OB 1JLCA 1DTTB 4DF8A 2XY6A 4EBDA 3SQ1A 3JSMA 1KVBA 1ZTWA 5J2MB 2UUTA 1T8EA 3BDPA 3OYGA 4CFDA 4I2PB 3Q8QB 4RW8A 3CJ5A 3ISNC 3NL0A 4QOZB 4CJ4A 4FW1A 3THVA 4LD0A 2VG6B 3HJFA 4I2PA 4R5PA 4MK8A 3GQCA 2YNGB 1JLAB 4J9PA 1TKXB 1I6JA 3IG1B 2HHWA 1CZ9A 5SZTA 3RAXA 2R2UA 4FLXA 1RDCA 4ED8A 3OSNA 3VQDA 3B6PA 2XY7A 1FKPA 5KG7A 1HJRA 3M8SA 3KLEB 3EPGA 4LSLA 2FVRA 4K4YA 2OZSA 4FJKA 4X2BA 2GV9A 4C8KA 4NLTA 1KSPA 3TAGA 4O44B 2IMWP 3MFHA 4OKJA 4Z4FA 4KTQA 3ITHB 5KFOA 1T05A 1LWCA 2IS3A 3IG1A 4Z0UA 1N6QA 2YNIA 4TY9A 3VQ6A 4E7HA 1SV5B 1CLQA 4FS2A 4JV1A 4QWCA 2ZD1B 1YTAA 4CESA 4NLSA 4KTWA 4EP5A 2ITGA 1QAJA 1JLBB 4BACA 2HVHA 1A5VA 2AJQA 2G8IA 4CGHA 1RCHA 1NK6A 3MFIA 4FCYA 3OYLA 4TQSA 4KHRA 4C8NA 4F2RA 2BGGA 3AVGA 3PZPA 2CJQA 1DLOB 1WSFA 3T19A 1JX4A 3L2RA 2VG7B 1JLEB 2AX1A 2HHSA 3AA4A 4W5NA 3QEXA 2ILYA 4DTUA 4IFYA 3RMDA 4URSA 1S0OA 3RMAA 2BQRA 4RNFA 5CYQB 1N6QB 3JYTA 1ZTTA 1DTQA 4J9MA 1RBVA 4DTPA 1LAWA 2HMIB 4GMJB 2E9ZA 1WN7A 2B4JA 1XC9A 1VRTA 2ETJA 1L3VA 5K14A 4WE1B 3CM6A 3GV5B 1T05B
chains in the Genus database with same CATH superfamily
1HKGA 1V4TA 5CYQA 2CJAA 5L8RC 3ZZTA 4U8VA 3A8YA 5E3AA 2EFGA 1OWXA 3ZZRA 4CLTA 3T69A 3WQUA 1RDRA 4JV5K 4HLBA 3IM8A 4UUWA 1IBCB 4C0HA 3V9WA 4DLGA 2NYHA 1EARA 5C5JA 2OMOA 3UI3A 4F8RA 2GV1A 1VRUA 3QAEA 2HSTA 4WFYA 1RHJB 4DL3A 3KJVA 1ZM9A 1C0GA 2VWBA 4FZVA 3CPWM 4ETXA 4NXNK 3N79A 3HPOA 4J5OA 3RMCA 3FQKA 1M90T 1FRIA 1SQFA 3T5JA 6AT1B 3L4IA 1RWWB 2L9DA 4CP5A 2BDPA 3I5CA 2H54B 1RTHA 2AJ0A 2O67A 4M5HA 4M63C 1NGGA 2A40A 1D8ZA 3M8QB 4WFXA 2P1JA 3MCNA 1EKRA 1FTCA 2IJNA 3DLGA 3W2WB 4O8UA 1REVB 1H7WA 2FF6A 2ZUAA 2DFFA 4RBUA 2HNYB 3L7OA 3HCXA 3ZEUB 1RT7A 1VSFA 4NLXA 4JV2A 1S6QA 1JCGA 1M5KC 3LWLA 1SVDA 2Q2RA 1CC8A 3U3GA 1HHSA 4OHYA 2YHWA 4BE0A 2MQOA 2YJEA 3KJVB 4YMEA 1VJQA 4RUAA 3A8EA 4RWXA 4CLLA 5E26A 2DK2A 5LJWA 2HOEA 1EP4B 4DXLA 4ZMMA 4E1MA 4FWKA 4OYWA 1LV5A 1M5PC 4E0DA 3TX0A 4X62K 1H2TZ 1OH5A 5E3RA 4CIEA 1NKEA 2B4PA 5A76A 3KG0A 4B3TK 2G8KA 4G1QB 3ZETB 1U8SA 3GR1A 1H2VZ 2DNNA 4IJNA 3F2KA 5F8GA 3VTHA 4P7TA 3NS7B 1RADB 5DQGA 3CJSA 3MMJA 3I5BA 1B3TA 4A8XA 2DGUA 2EG1A 2IIRA 2AP1A 1I5OB 2HVDA 3L2VA 3J81U 2ZQBA 1URRA 1RUSA 1VS3A 1SKWA 3I6PA 5HRNA 4Z4CA 1YIJS 3SYZA 4J37A 3SUNA 4EYIB 4ED3A 4QZVB 5CABA 4FM0A 1XNQJ 3G25A 4USIA 4K50A 4CM2A 1JNZB 1K1SA 4A46A 3TSUA 5DG7A 5J1EA 3CMES 1ZBSA 2CNOB 2XMWA 1UVIA 4BS2A 3QETA 1FJGK 1VJWA 2V7YA 2V2ZA 4CIFA 3MMAA 5KT5A 2RE2A 1OMSA 1N52B 3BKFA 5C25A 3PKMA 2BKPA 3OUYB 3CCZA 1TMJA 3DDNA 3PIOL 3AVCA 3BGRB 4JI8J 3OVNA 4DTNA 3W2VB 3KMSA 1D9DA 3KHGA 2BJDA 1TKZB 1LOUA 2C2NA 3CERA 1S9EA 4RW4A 1NHKL 4O3NA 1ZH5A 3U27A 4XDDA 2ASYA 2MQMA 2PZSA 1YJUA 3IRXB 4N41A 4NMLA 3BZKA 4C1NK 3BS9A 3K58A 3BGRA 4YY3F 3R6MA 2RU9A 4RNMA 3CQXA 3GLJA 4U96A 1RT1A 3CDBA 5M1OA 1P9QC 2KQ2A 2EWSA 3RZAA 4WQ5A 3MMAB 4FYDA 3C16A 4I69A 3QBXA 3THYA 4HI1A 2IOCA 4WWSA 5M1KA 2DXEA 2K8GA 3BKUA 4UOHA 1GTEA 1FKAF 4XPEA 2YJFA 1U1NA 3HYFA 4YOUA 1U1OA 1MROB 4YS2A 2F8SA 1R43A 1GLEG 4HDHA 4BR9A 3G8TA 2NZCA 5AXLA 4O3RA 1DTTA 2EK1A 2GO9A 2Q6BA 4YORA 3Q86A 4GO7X 3OTDA 4WK3A 2BQ3A 1CSJA 3MEKA 3J7AN 3L4BC 2GJ2A 2DNQA 1MA9B 3WUHA 1NJZA 1D8YA 3ZSOA 2HK2A 2OYQA 4FP9A 2UUCJ 2ZHOA 3NGDA 3GIIA 3R5CA 2XMTA 4QR0A 4KFBB 2GMHA 3PY8A 4CTAA 2BE7D 4JRQA 2JLFA 2HBJA 2W2OP 4OJHA 3ZX0A 3R8YA 5CD4H 3OHAA 5KQDA 4JBCA 4DFJA 4C8ZA 4TSXA 3O4NA 1R27B 4ECTA 3DOKA 4BRPA 3DRPA 2AJFE 2DNYA 3ZFVA 4BVPA 4NCAA 3HHLA 1UFKA 1OJ4A 3VA0A 1GXTA 3MAHA 3DM2B 1IR1A 2MGZA 2R2SA 2ZVIA 1ZAXA 5GIOA 2QM1A 1VI7A 2DXFA 2MKIA 5FROA 3VEZA 5ETMA 4OX9J 2OEMA 1VQKS 2ZJRL 4FXWA 1N5YA 1SV5A 4JI0F 1WSRA 4NCGB 1R8AA 3LO3A 4PABA 4WYBA 4M95A 2ZH1A 3IWXA 3ET6A 1IKYA 3DLRA 3D54A 2WTUA 2CPFA 3SMZA 2BJ1A 1VISA 4NLGA 5AXNA 1JMTA 2E6MA 3KLEA 1CZAN 4DEZA 1I94F 3R1HA 2EFPA 4XAKA 3V1QA 1S0VA 3G8QA 3V6KA 5HLFA 3QMQA 3NVMA 3MM7A 4KH5A 3MXJA 1Q8LA 1D5AA 3NEKA 4ID5A 2NNWA 1FHTA 1RAAB 1YKWA 1K9MO 3D2EB 3FFKB 4CD3A 1WBBA 4QYZJ 3MMCA 1GLLO 5LJ5Y 3IUCA 4OLAA 1NM2A 3A8IA 3QT8A 3VQSA 3PYEA 4LSNA 5KGWA 3MF5A 2B9EA 3SBTA 4RW6B 5E7OB 1SS6A 1T95A 3N4QA 1C1BB 1PO6A 2OAUA 3VF0B 4CO2A 2JVRA 4K2JA 1MSWD 5C2DA 3CDWA 2MKYA 5L1JA 4CBUA 1WOSA 1VQOS 3CC2S 1TVRB 1NK5A 2D3ZA 3D2WA 2X51A 4LQ3A 2YKNA 2GQQA 4KPYA 3EZ5A 4IWVA 4ZPWR 4C8LA 5HVFA 3FEYB 5KT6A 3VQCA 2X1GA 3TJ9A 4RUBA 3KHYA 5FIIA 2O4IA 4DN9A 4PKIA 1F0XA 2O8EA 1YVFA 2JJ4D 3TA0A 3OTOK 4HT5A 4BY9C 4Y3CA 1RTJB 3VQEA 2AZ3A 1Q16B 4JI3J 5C7PA 3V6DA 3Q8RB 2OD4A 2MDAA 3CCQS 4CI6A 2IJFA 3IAS9 4ZLJA 5DQIA 4H0XB 4KV8A 1JXEA 3MMVA 4X64K 3IM9A 2AEMA 2Z1JA 4YHHF 4KY3A 2DRAA 4I9LA 3MUVP 3TAEA 2OEJA 5T7LB 1NMNA 2FBXA 4DMNA 3DFEA 4DZDA 2I7PA 3ASMA 1MU2A 1NH8A 1FNOA 2EG2A 3KKRA 5DRKA 4X62F 3D2FA 4AXJA 2BKOA 2F4VF 1U2VB 3AVIA 3KD1E 2IM3A 1WOQA 4OZ5A 3M8PA 3CM5A 3K2YA 4LF4K 3MR7A 4MIBA 4RBVA 4YOYA 3R5GA 4NCBA 3JB9k 2IVFB 2X7IA 1RT2B 2YNHA 4LF6K 1IBLK 5EUHA 4CO4A 5F2RA 4L3QA 2MXYA 4UZCA 4CT8A 3CYMA 3MM8A 3CIZA 3EE9A 2LQ8A 4BDZA 5BRFA 4OZ3A 2RS8A 4AT1B 3OA9A 4WTOB 4DV2K 2YQ1A 2ZWPA 4N56A 4JN4A 4CJQA 3IR6B 2LXIA 3ISZA 2UV8A 2YX1A 1JLFB 2HGMA 1RLCL 4XH4A 3CCSN 3OLBA 1EQ0A 4YY3J 1VQ8S 1H98A 4LR8A 4PWDB 2YPZA 2P9KA 5AQWA 3NMAA 3EN9A 2R7WA 1X60A 8AT1B 1H0HB 3OR2B 4M3RA 1JKHA 3TZYA 4O0JA 2QC3A 3CJ4A 2OI2A 3AVMA 5E0OA 3FRZA 4X4VA 1EETA 3M9MB 1YXQA 2EKNA 4M7XA 1NK7A 2EHGA 4CF9A 3PO4A 2XZWA 2DR9A 1ILYA 1ZBFA 4RKUC 3MDQA 2DJWA 4K4TA 2IHR1 3G86A 4WPAA 9ATCB 2L3MA 3RW7A 1GXLA 5RUBA 3DAWA 5I9EB 1HI1A 1MW7A 4PG6A 5AR0A 4M8LA 4OKEA 1RHUB 1RTDA 4B3OA 2RD5C 1AW0A 2GJFA 3K9KA 2CQ3A 3CCVN 1ELOA 1U0HB 2H4YB 5IZHA 3MMBB 1T02A 1ZBLA 4YB6A 3TJ8A 1KAZA 4H5TA 2CG8A 3UKRB 4H4OA 4RW9B 5K9FA 2BMBA 1R6YA 2DNKA 2A3JA 2WBMA 4LR9A 1TELA 3VEVA 4K42A 4JI2J 5KT4A 3KYLA 2B9XA 3K5MA 5FLXO 4DV1F 4NA3A 4USMA 1SKRA 3HL8A 3O4WA 4I2QA 4FK2A 4WCEL 1U0SA 2KZMA 1A9NB 1C0UB 4OVLA 1HPZB 1S1UA 2V4QA 2QWRA 3BUZB 5DK5A 2XY8A 3C46A 3E01A 3IBWA 3CTRA 1ZPVA 4JKDA 1O6XA 5TKWA 2BQUA 1RBRA 3LH2S 1VFJA 2Y1LB 5GAHI 4LVNP 4ANEA 4M41A 2FJVA 3V4MA 2YPYA 1OSCA 1MROA 1GK8A 2W8LA 2DR8A 1TU0B 4DLEA 2AP6A 4K8RA 2C28A 4PKHA 5J2QA 3O9TA 2EEYA 3MPWA 2GNKA 2YKAA 4JLHA 2ACMA 1VQ8N 1KAYA 1ULRA 2JSXA 1RSCA 4DR4K 4DV5K 1RDDA 4C8OA 3RRGA 5AQVA 4B1UB 1APSA 4U67L 3M6VA 1O8BA 4FVCA 1HX1A 1HYZA 2HWIA 5BYSA 3D4JA 1C1CB 4IH5A 2DHAA 5T7BA 2VQEJ 4DV4K 2RDDA 2LP4A 3ZSYA 5KQ8A 2IAJB 2BZ2A 3KLFB 3VZHA 4OYIA 2QE5A 3EJMA 2HRTA 4Z4HA 1M1HA 3RBZA 2GGPB 2ASMA 2PMZD 4C97A 5CD4A 1EWQA 4CBWA 2GTDA 1QLNA 1YLXA 3RRKA 1YITN 1S99A 2Q3SA 2UVWA 1NDKA 3VVUA 4K0KJ 1QHTA 1W25A 1R0AA 3U1MA 2JGUA 2DVIA 5EOYA 1NHUA 1PKUA 4CDIA 5A0YA 4JAXA 1WG4A 4F4XA 1S7IA 5KT7A 2GFFA 1JLEA 3NCQA 2F9WA 4Y28C 2QLBB 5A0YB 5A8RB 4UQTA 3QIPA 1BWVA 2D3O1 3AVFA 1OH6A 2G8WA 3OLAA 3CXCR 4OI3A 3TAQA 3W9HA 3TUIC 3OL6A 5L1KA 1Q7YO 2BKNA 5IWAK 3R7SB 1UA0A 1S49A 3TP2A 2HHHK 1S76D 1V3ZA 3J7YU 3S41A 3PW2A 4A57A 1S6PA 1ZYQA 3DNCA 1WHXA 5CZ2A 4IOXA 1G15A 3H3NO 3CD6S 3BGLA 3TA1A 4FJLA 2APOA 2GHVC 3T7ZA 2QMXA 3O1LA 2XULA 4FWPA 4KE5A 1RYRA 3D66A 4M3WA 4DJBA 2IM1A 4GKKF 3VEOA 5IWAF 2HFNA 3K89A 4Q44A 5GAGI 3CJ9A 1F2GA 4K41A 2HBYB 4G3IA 1YHQS 2W6KA 1YBUA 1LQ9A 4NASA 3AO4A 1VQ7N 3QYYA 4JKEA 4DMZA 4HUGA 4RTFD 4AE5A 3K9JA 3VQ8A 3PR5B 4FK0A 2JZ5A 2E5LF 2FJDB 2UXCK 2YNFA 2UXBF 2EWHA 3H4DA 3BBBA 3MM8B 5HMZA 2HQCA 3QSYB 1EIYB 1HR0K 4YB5A 3SFGA 3R2CJ 4FBTA 1RTJA 2MKSA 1YJ7A 2O8DA 4F3TA 2CZVC 1RILA 3W8GA 1CVJA 3FGVA 4LIRA 4OYMA 1C0MA 4P72A 1QJHA 2GVZB 1BQMB 2DNMA 5CXTA 2F40A 2HW3A 4ID1A 4ZTJA 2HBRB 3IS9A 3P83D 3MEEA 1TL3A 3J8AA 2OUGA 4ECQA 1SKSA 1RAFB 2E5IA 3O5TB 1KEKA 3VERA 4OZLA 1EKSA 4PA1A 4OO1J 1M5VC 2P9CA 4ENOA 1TKDA 3T41A 2Z58B 1BLUA 3WNGA 4RW7B 1GLAG 1FEEA 2RN2A 2QLXA 2MKKA 2CQ4A 4DSEA 3QGPA 3M2RA 1S72N 3SCJE 1R7IA 3C3LA 4Q0BA 4MTPA 5BYRA 4CJVA 4ZPDA 1PIEA 2GWJA 2EFVA 1WORA 3MXHP 2XI2A 5B0BA 3OV7A 3CETA 2QXFA 4OGEA 3FZLA 1FF2A 1KC8O 3H3OB 4UZBA 4S0MA 1GQEA 4YN3B 5LL6Z 4BCAA 2LYVA 1X3MA 2D7SA 3HSGA 3OXGA 3KK1A 1DQ9A 1LWFA 3SI6A 2FVQA 2X6SA 4LFAK 4OI0A 4QS7A 1NAQA 1HI8A 4N77A 2UXDK 1V9OA 3ZT1A 1ITPA 2FC8A 2ACYA 5CQGA 5AQHA 2PYJA 2HIQA 4ECWA 1U45A 4JI6J 1NOYA 1K44A 2EVZA 3KLVA 3QEWA 1JLFA 1RAJA 2XS7A 1UPPA 2K7KA 4HH1A 4C3LA 3ZC4A 2B5JA 1EXQA 4RR5A 3RVCA 2OHDA 3TWZA 5KFWA 4OPKA 4WK1A 1KFDA 4HDGA 4LVOP 2MZSA 4U7UK 2D0OA 3DXSX 1HUXA 5J2MA 4DX5A 2YWKA 5G4DA 3VQ7A 1WAFA 1RAHB 4M5GA 1U48A 1IXKA 1UMJA 2A6AA 3OFEA 3FQLA 3NH1A 2VA2A 2YNHB 3Q22A 3FEZA 4Y0WA 3AD7C 4ZLLA 3T6JA 4AHUA 1UW9A 1FXRA 4IDHA 5IM0A 1VQPN 4CJPA 5BRHA 3C7NA 2O66A 4J9NA 1WSEA 4MLEA 4RX6A 1VLYA 1T94A 1KN6A 1XERA 2EPIA 4BGBA 1NMEB 1N5SA 1IBLF 3NMUA 2HK3A 3HVRA 3GE9A 2FBTA 2WONB 5KI6A 4OLOA 3WX8A 4QS8A 4WFNL 4CEZA 3N0VA 1MMNA 2H51B 2WFBA 3H40A 4AH9A 2VKZG 2PI5A 2R7SA 3OJSA 4H4KC 3HFKA 2BM1A 3DXKA 4KO0A 2IM0A 1NEEA 4EFAC 3OQ2A 1HKCA 2R4FA 4YR3A 4CBXA 4DCJB 3L3UA 5AJ3F 4CF0A 2YHXA 2VFTA 1TV6A 2JFKA 2VKRA 3CJQA 4USTA 2HFUA 1BUXA 3CFPA 3QT5A 4MIAA 4F50A 3CQ8A 2UUWA 3BSOA 1E6VA 2QL5B 4X4OA 5DG9A 4LFBF 1G99A 3MHYA 3KK2A 3KLGB 4KFBA 2W4DA 4ZPVR 4B1YB 4G1PA 1WKKA 3OXLA 4CRJA 1S6OA 4J7CA 4ECZA 2GW8A 1U6FA 1CQMA 1NRKA 2HF4A 1JJ2M 3IA0A 3TYTA 1JLQA 2M52A 3QSIA 4PQAA 2ZM6K 2FVCA 1ZBIA 1TKTA 3OVSA 3CJ1A 3CPEA 3DXMA 2KM8B 3T1HF 4ZP9A 2BVZA 2F4VJ 3AJ1A 4W5RA 2AZ1A 3G71N 4KHUA 3OR1B 4JHDA 4CF8A 2QA2A 2ZUGA 4BWMA 3QRQA 2F1FA 1WOOA 2OGUA 3W9IA 2IM2A 1FRMA 3M8YA 2MLZA 3J7YP 4A8MP 4Y2MA 2V68A 2C2ZB 4IZ9A 1T9VA 5J2QB 2F9JA 2D1CA 4DU7A 3CCLN 4MO4A 3FSIA 1IO2A 2PT0A 2ZBQA 2M2BA 2BE9B 1RA6A 3GZ7A 1X0FA 1B0PA 2HEKA 4E7IA 4NCGA 5IQQA 1HBUA 2FHKA 4PWWA 3KK7A 2GIRA 3G87A 4M5MA 1TKTB 1MLAA 1F21A 2E2QA 3OTBA 5CY4A 1XNRJ 2WHOA 3DI6A 1JLQB 3IAYA 4AQYK 4R0EA 2IAJA 3V81A 1YX2A 3W60A 5GMKa 2DGWA 3MWPA 3HM9A 1ZPWX 4ED2A 3EEQA 1Z4UA 5D4NA 1VBKA 4QJVA 5KFXA 5A8RA 3V9ZA 1KOOA 3NMRA 3M9NB 3IGVA 4CHPA 2FJEB 1PILA 4QIGA 1SZ2A 2ZJRQ 1UAWA 3RR8A 4FOIA 1VQMS 2EC0A 3I31A 1EKEA 4K2XA 4I6MA 4IDKA 1MN9A 1RAOA 1Q9YA 4A8OA 1ZM4A 2HAIA 1UFWA 2ADCA 3Q7BA 1KDNA 1EZZB 1S1TA 2WVDA 5DJBA 1DQAA 4PKGA 3N5BA 2FGOA 4FJGA 3PSIA 1U1RA 3QFWA 4XDCA 1Q81O 1R0BG 1FWLA 2JEJA 3G4SS 2QKKA 4EBEA 1RT4B 3FZFA 1AZSA 5FDLA 2CPZA 5KFLA 5AQFA 3K5LA 3O3GA 2BRLA 5I3UB 3G82B 2QGFB 3FCWA 2OIHA 3BSCA 3BF3A 1F9FA 4CYUB 4NZ6A 1ATSA 2OPRA 5HANA 1ROFA 5MLCV 4DV5J 1SJRA 1JLGB 3NKYA 2FY8A 2PY5A 1EQYA 3QT7A 3M30A 3P5BP 3PX4A 3VQPA 3DDKA 3WDOA 1BU6O 2P9KB 1ASWA 3NHGA 3VGSA 5LT5A 3AVJA 2JEFA 1RT1B 3ONQA 5JXSA 2ILZA 1XQSC 3CT9A 4B9NA 4P74A 4WXOA 5KG0A 3KMQA 4DQ8A 2UUBF 2U1AA 5HBMB 2C2DA 4ZCIA 5C2GA 4CD1A 1S6UA 4DHVA 4DR2K 3VV2B 1B9DA 3B4MA 2ABYA 2WB4A 1XHXA 4DCPB 2RHQB 2UXDJ 4JI3K 4EUVA 2UVRA 4FPRA 2UU9K 5LM7E 5D4OA 1FEHA 2HG4A 2Z1GA 1OSDA 2B7CB 4CJ7A 3UB5A 1QE1B 2FYXA 4BR0A 1LWFB 5B0AA 1RT2A 1JXLA 4G1QA 4DX8H 2E1RA 3D2FB 3PHEA 2P9NA 3A2FA 1CJKB 1AUDA 1GMUA 1FDDA 3PW7A 4A4JA 3AOBA 5B09A 2XI3A 1BO5O 2M8DB 2P9LB 1XR7A 4ES3A 4DSLA 2DNOA 3VQQA 3TQ1A 4WZQA 2DTJA 3DLEB 3SQGA 1WC6A 3CFOA 2NUBA 1NK8A 2V2QA 3BGUA 3PX6A 2Q36A 2P6SA 1IQZA 3GV8B 3QLHA 2DXDA 4AHCA 3IWLA 3TO8A 1EWRA 1PCAA 1R31A 4NI2A 3SPYA 4RW7A 3SAHA 2E8AA 3ZT3A 3MCPA 3SI8A 2IDLA 3FMWA 1TGOA 3KXDA 1TYQA 2EFQA 4FF4A 4A8YA 2KT5A 4UTGA 1MWYA 2E66A 2CQIA 2Z1HA 1BISA 4C8MA 3L4QA 4RU2A 4QR2A 4C2MA 4ZLNA 4OFZA 3CIMA 1QAYA 3NE6A 1RGIA 3ETOA 3M9OB 1M5OC 3BF1A 4JI7J 3SQ1A 4NI2B 2DO0A 1KVBA 2FSNA 3O9RA 5J2MB 2UUTA 4CFDA 3CJ5A 2BH1A 2ZH8A 4QOZB 2HQDA 3WXIA 4CJ4A 1B99A 3UO0A 2VQFJ 4BR2A 2BJ9A 5HAOA 3GQCA 2YNGB 2F5GA 2DNGA 4DV4J 1HHTP 3IG1B 2HHWA 5M1PA 1CZ9A 4L76A 5FPDA 1M1KO 4ZCMA 4OPHA 3R7NB 2DGSA 4OX8A 1YZ7A 3VQDA 2ZBRA 2WVEA 1FKPA 4WFBL 3HT0A 3KLEB 2LLZA 1K8KB 3O6WA 3GCWP 4X65F 2FVRA 1IG8A 1FRJA 4K4YA 2W4CA 3TTCA 2CQ2A 3EMTA 4CTAB 2RRNA 4KTQA 3ITHB 5KFOA 2KVQE 2HLTA 1LWCA 4Z0UA 3GG1A 4O5FA 1WF2A 1SV5B 1CLQA 1MG7A 4FS2A 4JV1A 4IOAQ 1A5VA 3VF4A 3VETA 2G8IA 2CDQA 2BYCA 3KUGA 1RCHA 3MFIA 4FCYA 2VFSA 1CULA 4TQSA 3J81O 1VQYA 2BGGA 3P6YC 4LFAJ 1U7LA 3TQEA 1RABB 3T19A 1WKJA 4FNIA 4X84A 2AX1A 1JLEB 4O23A 2HHSA 2A3ZA 4DTUA 5M1FA 3RMAA 2BQRA 1HW8A 4G65A 4RNFA 1VQLS 7AT1B 2UUAK 5CYQB 3UN2A 1QDUB 3JYTA 1GMWD 1YRUA 2I0XA 4EIAA 2LDYA 5JICA 1TUVA 1LAWA 3DLJA 2HMIB 3A3NB 2CPYA 5AE3A 4CO3A 5DS7A 1FT8A 1GTHA 4LSZB 1VRTA 4JI7F 1L3VA 2YQ0A 3CM6A 4GKJF 3GV5B 1H2UX 1T05B 1N36F 1B9FA 4H4MA 4CEBA 3LGNA 4DFMA 2AKWB 4JI5K 2GA7A 2PEBA 1UETA 2WB1D 4TU9A 3HXMA 2E9RX 2LU1A 2N82B 3KLFA 4MKBA 3PJ9A 4DR5J 3I0RB 1HNWJ 1J53A 5K8NA 2VOPA 3QIDA 5F3TA 1S0NA 1N36J 2U2FA 3QZ7A 4DL4A 1JLBA 5D0EA 3SSRA 3R97A 4DG1B 3SDEB 2RF2A 4I6AA 1D9AA 1LK5A 2OP5A 2X3GA 4GVBA 3AH6A 5BYQA 4PR6A 3EX7B 3V4IB 5LMNF 4J9QA 2IJRA 4B3SJ 4BC9A 3C15A 1Y7PA 4NLRA 4GVBB 4A8WA 1SH3A 2BA9A 2RF2B 4FYWB 2ZF5O 3QATA 2CXEA 2YKQA 1RWNB 4DTXA 3C2PA 3RJMB 1DHMA 2JEIA 3OYBA 1FCAA 4CNYA 1Q4RA 5E3PA 1B64A 3NG8A 4WFAQ 1PBUA 2O1PA 4N8OA 3OSPA 4LRBA 3TVZA 3PV8A 5AQQA 4B9MA 2CQ0A 2EFOA 2OMLA 3DOLA 4JI2K 3UDEA 1FW6A 2R2TA 1DY3A 4RJVA 3FBCA 1VQPS 3M2UA 2HRUA 1DEJA 1SL0A 4JI8K 3THYB 2D0PA 3QWUA 2NS1B 4DL2A 3I87A 4I67A 1V3RA 2DIUA 3F41A 3JAMY 3MEGB 4B3RF 2IRXA 3M2UB 1VLOA 2IYIA 4FJHA 3MAAB 3KNAA 4BWJA 4XTTA 1RNHA 3DWLA 3I0RA 1TL5A 5HQ8A 3DLLQ 3CCJS 5F8IA 5A8KB 5B8HA 2G2YA 3ZX2A 3ZYYX 1Q86O 5KPZA 2B8QA 3QZ8A 3THWB 4CW7B 2ZC4A 1HW9A 4MAKA 1VYAA 4KHPF 1YI2S 1ZAVA 4A2AA 1SL1A 3KD5E 4RCHA 4YNQA 3THPA 2KI2A 4B9SA 4OI6A 2AV5A 1GLBG 1D0EA 4LF7K 3EZWA 1DKGD 3EVMA 1U2CA 1BI4B 4DR1F 2XNRA 1WSHA 3UKRA 1KQGB 1K47A 4OX7A 2VU5A 2HHHF 4MYTA 5AQPA 2QA4G 1FNMA 1UA1A 5DLGA 4HKQA 1NCLA 1SKUB 1IM4A 1G2EA 1SC6A 3UDVA 2B5JB 3I82A 1BA1A 4KC5A 2G8FA 1RHKB 1GMVA 3MUTP 4ZP6A 3T3FA 3TI0A 4OYPA 2DBBA 1WD6A 3HSZA 3P31A 4ZVTB 1DFDA 3R3TA 4CGDA 2WC9A 4U7UD 1NKCA 4FOEA 4F7VA 1X0PA 3GSDA 5F8NA 2E2PA 3AAQA 4F04B 3DN9A 5C25B 2D9PA 2YWEA 1UEVA 4JYAF 2NQPA 4CEDA 3O2IA 1U49A 3M8PB 2DFEA 2RDIA 4NLWA 3AO5A 4OI4A 2DRDA 4IR9A 3VOVA 3O1BA 3JTOA 5HMWA 5B08A 5KTQA 2HHHJ 2D0AA 2YNGA 4DR6F 3GWCA 5DMRA 3MEDB 5JUMA 5BRDA 2X1FA 1WSJA 5KRTA 3MWTA 2P5VA 2IVYA 4KB0A 4KSEB 2VDIA 3DXKB 4L6V3 1K1QA 3E9LA 4WFAL 1UW4A 2Z57B 4TYBA 4YHHK 2XCPA 3DLEA 2AJ2A 2IFXA 1RBAA 1U6BA 5GIPA 4EO8A 3EGVA 4EP4A 2XO7A 4NYFA 4ID5B 4FJ9A 4CZIA 5DETA 2GQCA 3ZO7A 2AYEA 4CE9A 3MR2A 2ZEJA 3AVNA 3L0QA 2E20A 4F0HA 2MSSA 2OELA 1EO1A 4MK7A 5IM0B 4FS1A 2XTJP 1J5OB 4DV7K 4P10A 4Y0FA 3HRGA 1HYVA 2V50A 4F02A 4LFCK 1NHVA 1VMBA 1VQNN 2UU9J 1YZ6A 3BR9A 1ZM3A 2KLAA 4FJJA 1NGAA 3R6GB 4X4SA 5E3QA 3AAPA 5KFDA 3CG7A 4ZLPA 3PRVA 5A6WA 3PJWA 3TJAA 3AD8C 2VG5B 2IVMA 4CLYA 2CQPA 4K4SA 2E88A 2V5HG 4DR4J 4UOFA 5JLHA 2FLOA 3MGJA 1YVNA 3NFAA 3LGMA 4AL5A 4FZYA 2CPJA 5ETOA 1NLKL 5KG6A 4J9VA 3FZHA 3O3FA 2IBOA 2IDOA 2UUCF 3QFPA 2X1AA 4ANDA 3MPVA 4KHYA 4U6PA 4LRAA 1BQNA 2OJ3A 4CZGA 1CBKA 4ILMA 4KRFA 1SC1B 4MYUA 3R2DJ 2QYCA 3A1YG 3O3HA 4M5NA 2UUBJ 3RMBA 2UXBJ 1CEZA 3ET6B 1O13A 1RTHB 1Q7LB 4FYXB 4F4KA 2FY1A 4A8FA 3H25A 1Q95G 2L9WA 1X31C 3GOIA 1FX4A 3X3UA 2RSQA 4R5PB 4AUKA 4Q0BB 3BQ0A 2DR7A 1JLAA 2IVOA 3L7PA 1FESA 3BP8A 1GLFO 4MO5A 3SAFA 2FIUA 1LXNA 2PN6A 3SSSA 3SNNA 1L3TA 3OFGA 3VGLA 1VHIA 2F96A 1IBMJ 4C11A 3K2PA 3L8BA 3N6NA 4LT6A 2JWNA 4BHQA 3D6RA 2G1HA 2YKNB 2HS4A 2VPXB 4ZVGA 1GXUA 4DX6A 3QNOA 2Q0UA 5KFMA 1D9FA 2J76E 4CYUA 3D0GE 1X7VA 4CIOA 3V9XA 3DOLB 1R0AB 3RAMA 1BWFO 4RUHA 2O8DB 3DI6B 5IOLA 4PPZA 1AZSB 2G4BA 4YY3K 4KT0C 1KQSR 2PD1A 3MN5A 2VPYB 4MH8A 3CO9A 3VZIA 3BYRA 5IFMA 3MTKA 3K0SA 1VSEA 2G0CA 3GILA 2XY5A 5IS2A 3LZIA 4KQZA 1CJUA 1FJGF 3D1QA 3C8YA 1BHLA 1XHZA 5EHHA 4CJWA 4KREA 1SC4B 1B7FA 2FSJA 2VOOA 4FLTA 1FFWB 2BRKA 2B8PA 1W2BR 4RO0A 5JVGL 2Q79A 3O9QA 3UIQA 1VQNS 3IO1A 4IO1A 3SEOA 4XEIA 4CM0A 3I56S 3IS9B 2CZ4A 4ZPCA 3IN5A 3W63A 5KPTA 1RAEB 3DHXA 4P71A 3P5JA 2YKMB 3PNIA 3P49B 4JI4K 3NOGA 2D4WA 4CFBA 3OS1A 1SXLA 1XI1A 1WHYA 2CQGA 3CO0P 4YOWA 3SUOA 3G6VA 3HT3A 2VH7A 1FKOA 5KFCA 3A3PB 1NMDA 3G82A 4CO1A 2GMLA 3H5UA 5DDPC 4QPXA 4HVJA 4YOTA 4LF8K 2UUAJ 2BUNA 5ETTA 4JI3F 4LR7A 4WFNQ 3QB0A 3BPDA 1AB8A 2QG9B 3MM5A 2J0XA 4DQIA 4K7QA 1SL2A 3BY5A 4BRHA 5AQNA 1S12A 4CO0A 1FE0A 3MR3A 4ES2A 2GX8A 2MZTA 2AYGA 3OTOJ 5FRMA 4RNNA 2L48A 4I6MB 2KZZA 3GONA 4V19J 4LC9B 3KK2B 2NSBA 3M30B 4NLUA 4OKKA 3QNNA 5AQIA 3GIJA 4KB7A 2OTJN 1E4GT 2W42A 4RW9A 2B6AB 2QIFA 1NNDA 4DPWA 3CCSS 3KFWX 1UWAA 2FHMA 1FJ7A 2BJ7A 1YRXA 1QQOA 3T5LA 2OCEA 2D41A 2O01C 1Z25A 1WLJA 1RTDB 4B3OB 2QA4N 1HWLA 3W62A 3AGRA 2O3DA 4NL5A 4A5BA 3EZOA 3DXMB 1HWJA 4P75A 3AJDA 4H0TB 2HHTA 1Z26A 3UN5A 1P27B 4DV6J 2XLIA 4GO5X 3AB2B 3C14A 3E8OA 5JVGQ 4F3QA 1FRHA 3OTOF 2FC9A 4GW6A 1GAOA 4FF2A 1TQLA 2B9YA 1F9HA 1P1LA 2CKWA 4JV5J 2D3UA 2CPEA 1A5XA 1LNQA 2A6OA 4JKHA 4ILGB 2ZWOA 5C12A 4NO7A 2VFVA 2HSEB 1TV6B 3C6HA 1HARA 3MXMA 4DTOA 3HHKA 1E6VB 2X74A 3UKUA 4JI0K 1ZETA 3RRHA 3CGIA 2KYXA 1I3AA 3WEEA 1C6VA 2DYAA 5BPLA 1HQ2A 3KKFA 4DSIA 2HZVA 3D1OA 3DOMB 2Z2YB 3CPWR 3LDPA 1KQKA 3E01B 1YJNS 3W8PA 4C23A 2DITA 3NF8A 1TUWA 2XYPB 3W9JA 4P2SA 5GADI 3Q83A 3WHIA 4LF1A 1UVLA 4KO0B 5AQTA 2OFHX 4ZIVA 1UEUA 1NK9A 1PG5B 3RB4A 3FVYA 2NRWA 1GMWA 2JNJA 2KT2A 1C1CA 4AQYF 2CDRB 3C6TB 5KFNA 4YOXA 3D6TB 2O8FB 3OYDA 4RBTA 3B6BA 1UJ5A 1YJWN 4MQ3A 1VQ6S 4GNIA 1HBOA 1HNIA 4QW8A 5D4PA 1SQKA 2HBLA 3TANA 1VHXA 3PG9A 2CIMA 1LAVA 3M1VA 3LW5C 1TYQB 2WVCA 3U1NA 2RPIA 1IJFB 3VAKA 3TSPA 4H0YB 1RBOB 4EAHD 4A61A 4OHXA 4NLDA 3NVKA 4ZPTR 4C0OC 2A1BA 2B0GA 1BGXT 2UXBK 3I9ZA 1TKZA 3IMXA 2D1KA 2I2YA 4DV0K 1U24A 3P4UB 2NRHA 2ZWHA 4XIUA 2W7PA 3KJFB 2IC3A 3KUHA 3RBDA 4ECVA 2VHGA 3ENVA 4W5QA 4B3RJ 4J9RA 2VONA 3DDIA 2JRSA 3N4WA 5JVHQ 4PZVA 2O8CA 4CZHA 4MFBA 2W7AA 4LRFA 5L1LA 1RWVB 1U1LA 3TW0A 1Y10A 1MN7A 5CYJA 3V9SA 1GLDG 3WXLA 2VASA 3PACA 3HF5A 1Q53A 4M3YA 4GKKJ 2QWNA 4DI6A 4JI1J 4BG9A 5DM6L 3D2EA 3L9ZA 5C0YA 1KR4A 2Z56B 4B9QA 4NLVA 3Q23A 1IKWA 5KPRA 2WTFA 3BBCA 4C7QA 4JI7K 2C3UA 2D3OR 3K5NA 4O3OA 3VA3A 4FYVB 4E8UA 5DQHA 3ZEUA 1FWPA 2BJ8A 2R7VA 2QI2A 1HMVA 2O8EB 3ZETA 2PYLA 3LDOA 5HLFB 3QGIA 4FVMA 2QFIA 3W2WA 2M88A 3A4TA 3R1XA 1TVRA 1NDLA 2XHCA 4ZS6A 2BOPA 3F5TA 3W3SA 2CQCA 4OZ1A 3LP3A 2W2MP 4FLUA 4GC7A 1HWIA 3R3LA 1HMVB 4NXNF 1RKJA 1D1UA 3CUNA 1DAXA 2GVZA 1SC3B 4I9QA 2PMWA 1W97L 1UL3A 2BW7A 5AJ3J 5SWMA 4UY85 2YX4A 2PEHA 5HQLA 1OKJA 2HNDB 4DTRA 4EHUA 4EO6A 1S22A 4LSNB 3HKWA 4UQGA 3V6DB 5HVGA 3CJKB 2RB7A 4DV0F 4Z37A 2NSCA 4LBPA 3OYAA 4P2XA 3I55S 1UP1A 3B78A 3KG1A 3J7Z5 3WX4A 3NGZA 4DUZJ 2DPIA 3Q0AA 5HOOA 4DL0C 3ZTRA 3ILLA 1S97A 1QUPA 3GFYA 1FXDA 5D6GA 1R8PA 2QMUB 3GL1A 4QU7A 1XNQK 2BACA 2PAVA 4IOAL 2R7YA 3OJUA 3MM9B 1QD1A 2ZH9A 3FC9A 2OH2A 2HGLA 2XEXA 1YQHA 1IBMF 2P5OA 2XMKA 2HHVA 2VDHA 1UWBA 1J5EJ 1JXBA 3B54A 3N6LA 2HBZB 3QGHA 2RHKA 3D7EO 3SQGB 4ELVA 2MLYA 2FLLA 3KDOA 1IBLJ 4KHMA 2Z2MA 1FK9A 2F3JA 3C0BA 3JSRA 3U8XA 1S10A 2QJ3A 3FKBA 3MM7B 3JSMB 1NGHA 3BGFA 1J5EF 3FZBA 3BEXA 3H4BA 1HQEA 4ZKAA 1B4SA 4JI1K 1TL3B 2QLFB 2DGXA 1P6TA 2XHWA 3HVTA 3LM2A 1Q78A 4P73A 3OS2A 1V5VA 4IBNA 1OY8A 4ZPBA 3DU5A 5E84A 2I5JA 1KAXA 2CJYB 3JTPA 3TVKA 3I96A 4AM6A 4FJXA 1TZ0A 1KNZA 1NZ8A 4ZHRA 2R8HA 4J9KA 3JAMO 3VQ4A 3CCUS 1N56A 2RNEA 1CQNA 4USHA 3H2UB 3SBMA 4JKFA 1RT4A 2QT7A 2DEIA 1PJ6A 4X4RA 2V9KA 2KG0A 4OPJA 1KTVA 3QFHA 3BQ1A 1WSGA 3AQOA 3ATVA 2J8AA 5BR9A 5T14A 4BROA 1VSLA 1Y9OA 3A5NC 4DS4A 2CG4A 5H9FJ 3J7ZT 2HFVA 4OQJA 4PHTX 3US5A 2YNIB 1OY9A 4F0KA 3WBZA 2ALZA 4RL1A 2R8GA 4QYRA 4PG5A 1PGZA 4DR7K 2V4RA 3QDKA 1FERA 1EX4A 2OPSA 1Q86T 3AVHA 1CXUA 2VWJA 3FZMA 4GV9A 4OX6A 1H1VA 1RU2A 3BSAA 1VQ7S 1NPKA 4KH6A 2QXLA 3OW2R 5U47A 1S4FA 4MKAA 4I56A 3ENHA 1JNRB 1FFGB 3EUNA 3LZJA 4OYBA 1BA0A 3HHEA 4YB1P 3PR4A 3I8DA 3CD6N 2V4JB 5BR8K 1CLFA 3AVBA 4LF8F 2P9GA 5KG5A 1FKOB 1I1GA 1LW0A 3MOJB 2C3OA 1TAQA 2AT1B 1WTFA 4X4QA 2XWYA 2HMPA 3H90A 4IO9L 4CGJA 3EM1A 3SV3A 5LXYA 1WEXA 2HWHA 3C15B 5F9LA 2QWLA 3KTQA 2BOAA 3MMBA 3G10A 3DRSB 2GWKA 3UE2A 2FXUA 1S1XB 3UDCA 4RZRA 2WOMB 1JIHA 3KWGA 3O8MA 4XPCA 3OR1A 4RW8B 4DV6F 1U0HA 3ICLA 2GAHC 3T1HJ 2V2KA 2XWXA 3SCXA 1RBSA 1EHWA 4LFCJ 1JLCB 4X66J 3H5YA 4DQQA 3RSEB 3NF7A 3MZIA 3SSQA 4IEIA 1RLDA 1QQNA 1NDCA 4H03B 5MAOA 1OYEA 2G2ZA 1O5JA 1RFQA 3TZXA 4NPOA 1M1KT 5JS1A 1S1UB 2NYIA 4PYDA 2ZE2A 2QWMA 2GBZA 1HYSB 1VK3A 1VQ4S 4HTUA 2V8GA 1WTBA 2GS8A 1YJTA 3N5FA 3EL2A 2HMIA 2V6AA 3KLGA 2K2PA 3O4QA 4B17A 4DPOA 4LFCF 2H4WB 2R8IA 2QX0A 1RQ0A 4CNZA 3HP6A 4LF6F 3MPYA 4GVEA 3NOCA 4AF1A 4TLRA 2CGJA 1U09A 1IKVB 2A10A 4AQYJ 1T6CA 2VQEF 3NNAA 2ZHAA 2PFUA 3CCRS 3L3VA 1WSVA 4JRPA 2HPUA 2VG5A 1KC8T 3TTFA 3EGNA 1U25A 1QM9A 1CULB 3Q8PB 5GAEU 4F4YA 1VRUB 1VC0A 2E4LA 4Y1DA 2R7UA 3LPEA 4AL6A 4FJ7A 2AWZA 5BREA 4DR7J 1RP5A 1U04A 4JUZA 3AOAA 1S6QB 3IGNA 1LWCB 4N5SA 1BOTO 1HD0A 1Z1ZA 4IJAA 1W7AA 4WP9A 3LM9A 2VQEK 3HPHA 2XS5A 5B0CA 1RT3B 1RJJA 5DZ7A 3W5ZA 4YFUA 1F1BB 1K8KA 3HSCA 3SQ4A 3CF5L 3EKSA 2I38A 4UOGA 3SK3A 2J6SA 3OR2A 4YDUA 3F0NA 4DCHA 3MPUB 2GC8A 3UW1A 1ZZFA 4JI6F 1FDNA 2NUHA 1EP4A 3ETMA 4JD2B 5AFUH 4ZTFA 4KB1A 3IRWP 5T7LA 2FJBB 1RDBA 4WXWA 1YI2N 3LTOA 3MPDA 1BIZA 4F4ZA 5J1NA 1S7HA 3LPUA 3D0PA 2ASLA 3TVYA 2HIYA 2M70A 4OPAA 4BE2A 1OH7A 2VBWA 5CZVA 5LJ3Y 4DF4A 5EY4A 2ZOMA 3U9DA 2XSJB 1R89A 4K4UA 1YF5L 2MZQA 4H5VA 2LEAA 4K4XA 3WC2A 1EETB 4WYWA 1RWKB 3GFHA 1Z2LA 2K1RB 3H46O 3CD7A 2F8MA 4OYAA 1VRQC 2A0FB 4M63A 4FJMA 5ETSA 3D0IE 3R5BA 1LFPA 1N54B 3UCUP 5L9XA 5KGXA 5LMNJ 5EN1A 5KFQA 2KTQA 5K5MA 5I3UA 2DY9A 3HVWA 1N48A 4GV6A 1KONA 3FBFA 2V8HA 4UY8O 4DN0A 2VJUA 3HOSA 2QRRA 1X5SA 3LQVA 3ZSXA 1SH0A 3V1RA 3QEVA 3DYAB 4V19X 3RU0A 3FCVA 2A18A 5ETKA 3A0IX 4ED7A 5D4LA 1VQ5S 1Q8IA 3EE8A 4J9UE 1UPMB 3N6MA 4B3TJ 1A5WA 4HI2A 1J6ZA 3ZTQA 4I64A 5A8WB 3JS9A 3VEXA 1UJ6A 4J2BA 2KB2A 3VEWA 1J5OA 2F7VA 2P9NB 5C2CA 4IFVA 5CZXA 4F3MA 1AFJA 4DCOB 2WUSA 1KRPA 1VQ5N 2EBEA 2DY4A 4X66F 1U1KA 2OLWA 3VAMA 5AQGA 1GEHA 3OYNA 1MU2B 1Q81T 4F4WA 2DCUB 1W2IA 3IFEA 3J80Y 1RWMB 4CERA 3TOQA 1KTQA 4ISFA 1XJWB 5H1SV 2WSCC 2W7OA 4MKYA 2VFRA 1NGDA 2ZZMA 3R7BB 2VPWB 1HNZJ 4B02A 4FXVA 3QLHB 1ZA2B 1BCMA 4LF7F 4NLCA 2R42A 3NNCA 5L38A 4DQPA 2GUIA 3SQ0A 3F56A 2P9LA 3MN7A 5F8LA 2VYPA 5F0WA 5HMXA 4K4ZA 4DV3J 1X9JA 4IQMA 5L39A 1UAXA 1TUGB 4LF5F 4EFHA 1F60B 4CZLA 4KGXB 4K5RA 4WP8A 1BXNA 3HZGA 4BC7A 4IRCA 4B9TA 1IG9A 2BE2B 3FDSA 4CJ3A 3CCQN 3T9ZA 2MSTA 4BDPA 2W9BA 2VC1A 5D0RA 3OYKA 5F8HA 2VZ9A 3ZSWA 3DLLL 4V19S 3ILIA 2QZ8A 4E1JA 4Q5VA 1XMBA 2MKJA 4ERDA 4DV1K 4USVA 1M0SA 3HD2A 3IRXA 3CC7N 1BL3A 3S3MA 1TUYA 3AHPA 1HPZA 1NKBA 3S01A 1UTAA 2RVJA 1DTQB 2QWQA 2DD8S 2E5JA 4NB4A 1JLCA 1DTTB 4DF8A 3Q8UA 4A2BA 1ZTWA 3AXKA 1NO8A 2K06A 1T8EA 3BDPA 1NUEA 2ZBPA 4I2PB 3Q8QB 4RW8A 4JI8F 3AAWB 4H0VB 3TNVA 4RWTA 3NL0A 1VIXA 2ZH5A 3ZLJA 4DKWA 4QQBA 4LD0A 2N7YA 2DGQA 2UV8G 4F67A 3HJFA 1CG2A 1N88A 4LF9K 1WKLA 4J9PA 1Q8KA 1D09B 3NCRA 1QY7A 3NP5A 4I6YA 3BO3A 3OSNA 2AMCB 3EKUA 3NGKA 4HTIA 1Q82T 4BRKA 2GHPA 2DGOA 3OT9A 1HR0J 3EPGA 4UUXA 5LSRA 3SMPA 2OZSA 1UVMA 4FDFA 1FTRA 3D9BA 3JQKA 4UOCA 3W61A 1S3XA 2IMWP 3OBYA 3MFHA 4Z4FA 1T05A 5LMNK 1X4BA 2IVNA 4TY9A 5A2QO 2YX7A 1V5IB 4QWCA 1YTAA 4CESA 5I3QA 4NLSA 3C66A 3T1YK 4BACA 4ITSA 2HVHA 2YWFA 2DT9A 1N33J 2KRRA 5I3PA 1LEOA 4DR2F 1FRLA 4KHRA 3AVGA 1FI4A 3NWRA 3PZPA 2CJQA 4C11B 1JX4A 2E5GA 4EI2A 4W5NA 3AA4A 1S5ZA 4DR3J 4PG8A 3H1VX 3OTCA 3W66A 1N6QB 1P1TA 3G9CA 4MIWA 3VAGA 3O80A 6FDRA 1IM6A 1R3NA 1SBRA 2XQCA 3S8SA 4L75A 2ETJA 4M5JA 1OPZA 4WE1B 1HNXJ 2MPUA 2UXCF 3RBXA 4DU4A 2CPIA 2YI1A 4CJLA 2HNYA 1H73A 1S77D 3R9PA 1TFWA 1BC6A 4DHYA 2Y9HA 1IUJA 2XCAA 1FA0A 1PJ7A 4DR3F 4YB7A 4I0WA 4H4MB 4CF2A 5KFPA 2YHAA 5D78A 2FZGB 4DV0J 3PIPL 7FD1A 4FLWA 5HN0A 3J7AP 2NPIA 4X64J 1RHQB 3M8QA 2IY5B 4AHVA 4AHTA 3I8BA 4CHQA 4KGMA 1WSIA 1PYSB 3VGTA 3KLHB 2Y3YA 4RNHA 2W9AA 3CWJA 4PQUB 1RCOB 3M8ZA 2Y1JA 3Q8YA 2F4FA 3R27A 4IO8A 2NREA 4K8XA 3ALYA 4KV8B 2UU9F 4NXNJ 3FR0A 5KRSA 5FLXY 4KHPK 1J27A 2FC0A 3LP1A 4CJUA 3V1OA 1XN9A 3UVJA 5KG2A 3AQPA 5EWGA 3QJLA 4ZK7M 1ZBHA 4Q2LA 4TVAB 2HFSA 2UUBK 1VK8A 2OTLN 1T3VA 2XGPA 3SFUA 2WSFC 1QTMA 1WC3A 3W3DA 3LP0A 3MECB 2L08A 3GCXP 4DSKA 2FLNA 1TAUA 3RB0A 3HO1A 1U2RA 4R79A 1X1PA 3JYTB 3PDNA 4QS9A 1YJVA 1QSLA 4PXBA 2P9IB 5AZIA 1C4CA 3FBBA 1XNRK 2W2PP 5HVHA 2NZ4A 1KVAA 2HB5A 2FHJA 5B0EA 2ASDA 4RW6A 2RRBA 2N3LA 3T6BA 4CHYA 3CFRA 1QSYA 2OKQA 1XNRF 3WT0A 1BD6A 2FGCA 2KRBA 2QK9A 1HI0P 2JVOA 5AZJA 1JB0C 3ILJA 1K8AO 2DRBA 2CVIA 5DDRC 4LF2A 2J0SD 3FFIA 3AD9C 4TNOA 2Y0SD 1MNEA 2DNLA 1ZBUA 1YHQN 3IAM9 2OZMA 3EICA 4HH0A 4QU6A 2UUAF 3EXYA 3MEEB 4LQ9A 3D6FB 4NRTA 3LL3A 4F4AA 2K3KA 4X4PA 3TA2A 4FXDA 5ADXA 2H1YA 5DDQC 2MY7A 2ROEA 3D68A 2CJKA 1WAJA 3KWMA 4LSLB 1T9UA 4BQLA 2E1AA 2CGLA 2RQKA 2MQNA 2ZM6J 4KHQA 4OV6A 2V0NA 4B3TF 1GT8A 1RK8A 4C98A 1JJ2R 2M4MA 3J80O 3CJBA 5EU7A 4E7LA 3N28A 4Y65A 1VQLN 1GX6A 4LJMA 3MR5A 5HBMA 3W5XA 5AFUA 2HNZA 4FWMA 3V9UA 1IQTA 4P2MA 2V67A 1F3FA 3KKSA 1T11A 1NSPA 1TMMA 4X65K 4DUTA 1WDTA 3VWSA 1DGKN 2A6MA 3M32A 2RHSB 1IR0A 5J2PB 3O9SA 4F2SA 3PW4A 4LF8J 5IV4A 2JH3A 1N5VA 3KK1B 4UF4A 2UUCK 2JWLA 3ZTPA 3G6XA 1C0TA 2LECA 3KHRA 3CCLS 4NXMF 5JS2A 4JOUA 1IH7A 4DV4F 4K8ZA 5ETPA 3L2UA 1NBEB 2V94A 1HPMA 1NJXA 4PG4A 4I7FB 5GADP 5H9EK 4TQRA 2R7TA 2E5HA 3JSYA 3HKZD 4U7CA 4KAIA 1HHQA 2Q6CA 3P8BB 2BTFA 2RH3A 3LDLA 4CLSA 2AYMA 2HQGA 3UD5A 2OPQA 1OVQA 4JP8A 4E98A 4ILHA 1PAEX 1HL6A 2CNNB 4AHSA 3MEDA 1BMQB 1X4FA 3U6FA 4M3ZA 1M1GA 1H3DA 3PKYA 3ZTSA 4BRFA 3W1YC 5G0RB 1HNXK 4H5WA 1OQ3A 4BR5A 2M8HA 4M5IA 2WVBA 1Q8BA 2KDOA 4CEEA 3OFHA 2XMAA 2MHNA 4JYAJ 1S48A 3C16B 1SQGA 3G96A 1NGFA 5F0UA 2XYGB 3ZZPA 4OGCA 2HHPA 2B51A 1ASUA 2GGPA 3DLKB 5F3ZA 7FDRA 3LALA 3QEPA 5D15A 2W4PA 4URQU 1S6PB 4OX9F 1S1WB 5D3GB 1WELA 4M3XA 1N5YB 3CMQA 1KWMA 3GIKA 4Z4EA 2LQ9A 3BREA 3W2VA 3HPGA 3WEEB 3BYPA 4OHVA 2OD6A 1DLOA 2PO4A 2Z2LA 1HQUA 1OPIA 1S1TB 2VG6A 3RUBL 2VIHA 2PMHA 3D6MB 4PKDB 4QIEA 4DR1K 3VCDA 4MJKA 2RAQA 1WC0A 4MFBB 1JLGA 2ZD1A 2FTRA 3CCWA 4L74A 2VC0A 1XQIA 5KT3A 2XMMA 1CS4B 1AXQA 3H08A 2G8HA 3GYXB 4CLZA 1WOPA 2D69A 5CAAA 4OV1A 1RHMB 3I55N 1DQ8A 3BQ2A 2AF6A 4MMOA 2OANA 2Z2ZA 2V7ZA 4LF4F 1VHFA 4WFZA 3LP2B 1T9WA 2ZKUA 3ELHA 5SUHA 3BEGB 3H6EA 1NG9A 2XBPA 4YR0A 2P9PB 2XG8A 2KKZA 3S1TA 3DM2A 1T0TV 4B3MK 4N7TA 1S59A 2WZ1A 3BV8A 4Z4GA 2JDJA 2BANB 1I94K 3E3XA 3L6QA 4IG3A 3NGSA 3TZWA 2F63A 2W41A 4IYQA 3PSFA 4B1XB 3GFXA 3SCKE 3M8WA 3R8EA 1FFSB 2B7BB 4P6QA 3M1VB 4AM7A 2R7XA 4DR5K 2A1SA 4FJ5A 5AQUA 1IVZA 1N5QA 2LQBA 2MZJA 1HNZF 3ZNJ1 4IOCQ 4J2AA 1JJHA 1MMDA 4E19A 4CQ1A 2B56A 3TAMA 2O8FA 3SQ2A 5KFFA 2DGVA 4LIWA 5IC4B 4KBIA 3VF2A 2J7KA 2V8DA 3H2VE 2ZNZA 1Y97A 5KFHA 5DDOC 1Z6RA 3FFIB 2I6WA 1KHVA 3HULA 1MWQA 2QV6A 1HBNA 1FD2A 5AZJB 3AT1B 4FN5A 3QRRA 3WQTA 2CAJA 5HP1A 5BR8F 5JVHL 3HMJG 2F8HA 3AARA 2J4RA 4OLBA 1OQ6A 4D3GA 3SBGA 5AQMA 3AO1A 1P8ZA 3L2WA 2GIFA 3L95X 4PG7A 1IBKJ 1YUWA 2L41A 2VBZA 4M5KA 1YITS 2JC1A 1YTYA 3VHQA 4DOZA 1PC4A 1TR0A 4H4OB 4AYBD 4LY7A 4RWWA 4CLUA 1K0TA 3ZSZA 4FM1A 2DHSA 2VFUA 4BRLA 2DPJA 4ZVEA 3GIMA 3UNYA 2KJVA 2GVDB 5CYMA 4KI6A 4GC6A 2HURA 3LGHA 4X64F 3QO9A 2Q3PA 1Z05A 3HD1A 4HUEA 5M1NA 2ERRA 1SI9A 1YBTA 1NM1A 4HACA 1UEKA 1U02A 2C3YA 2RRAA 3PTWA 1W9HA 8ATCB 4K0KF 1DZ5A 1UKUA 3BJYA 2OTLS 3AGKA 4CZKA 4HHHA 1NDPA 4CGFA 2HLUA 4C8YA 3DGPA 1U2VA 1Y00A 1JKHB 3PEHA 2J6TA 2V8VA 3MD3A 4X66K 3F73A 3VQAA 5TKYA 3BM7A 5J1EB 5AQZA 5BJRA 1BE4A 1FXLA 4R8UA 1E4FT 4JKGA 4PWDA 3LAMA 1NWKA 1DRZA 3KLIA 5I42A 3A8JA 3SV4A 3E9OA 3K17A 3FZ2A 2ZH6A 4TU7A 2AYBA 1RTIB 2V8PA 3MM5B 5C24B 2GIQA 5EWEA 1CJTA 4IH6A 2MYFA 3PX0A 1YK9A 4O3QA 4BRDA 5HP1B 1X5PA 1LOTB 1RBUA 1Q0NA 2D74B 4ILLA 2VODA 3BZCA 1KD1O 1NSAA 4ECSA 3TAFA 1FXXA 3WXJA 2G2OA 2BEFA 1SJ3P 2D5RA 3HX9A 1MDUB 2WONA 4N47A 1RT7B 3UD3P 3R6LB 3SCIE 5LMUF 3C7NB 3AOCA 4FPAA 4KHNA 2RE1A 4ED0A 1OY6A 3HHLC 2DNZA 1PJ5A 4AHRA 3NAIA 1REVA 4NEYA 4JKBA 3S6EA 1QE1A 3G0ZA 1SCJB 4KIAA 1I39A 5HROA 3HVTB 5FJ4A 2RUGA 1BQXA 3ADAC 4PWUA 3BB5A 1NGIA 3E9PA 5DGBA 2KXNB 2RIJA 2UP1A 1CJVB 3VENA 4CI0B 3MM6B 4JV0A 2QN6B 1QQMA 3I4HX 4JB8B 2I8EA 3A13A 2P8IA 1NSQA 3U4LA 1V3SA 2J9EA 5FD1A 3BN4A 2CH6A 4EMDA 4MKVA 4ES1A 1K6YA 3EO3A 3C6UB 2VGMA 5H9FK 2PI4A 2CPXA 2CNKB 3ZXWA 1CPZA 3AXMA 4DDFA 1LW2B 4ED6A 3KVGA 3L09A 4WTYA 3HHDA 4DX7A 4Y2CA 2CVEA 1NNEA 1NH7A 2CZ9A 3I9V9 5ADZA 1U2FA 4KKOB 3MN6A 3D3CJ 2GMJA 3MCAB 2MEWA 5KFAA 4J9OA 2Q1NA 4USWA 3QNWB 5LSOA 3VAJA 1C4AA 3LPTA 4RNOA 2AJ4A 1FE4A 1Y5IB 4YR2A 2HHUA 3KK3B 4AILC 3IC1A 1FNXH 3GTYX 3HI0A 2KL8A 4J8FA 3KIOA 2KU7A 4ECRA 2V52B 3UQSA 2DR6A 1K73T 4CF1A 4CHZA 5D3GA 4WQ4C 3SQOP 4W98A 2ZGZA 4IDKB 2EK6A 1X9MA 1HNWK 1JXVA 2YQ3A 3DOKB 3U02A 3PXGa 1N8RO 4FF1A 3FGUA 5J2NA 1KLNA 1C2PA 2LA6A 2MKCA 2MKHA 4NLQA 2DB1A 4DUYK 5K14B 2CQDA 2CADA 4JI1F 1RISA 3DC2A 5F8MA 1VQ6N 2PGCA 2XMJA 2ASJA 4DFKA 4F36A 2BJEA 3CC7S 2I9SA 2FLPA 3PJXA 3S9HA 2XLJA 5MLCQ 3G2XA 2G8UA 4FZXC 3THTA 1PYTA 1VGYA 1J2VA 4KYZA 4FLVA 2KG1A 4CHOA 3W7BA 2XSFA 3MXIA 4LMZA 4B3SF 3OBIA 4ZVFA 2KFNA 3UWTA 3MOZA 3UR3C 3M8RA 1S57A 3PRDA 3EPIA 2D0BA 2ZGYA 2J5AA 3M2VA 4KAZA 4DPTA 4A8SA 2QMWA 4BR7A 4ZJOA 4B9VA 2F9TA 3HHLB 5CCLA 3NWGA 3NCIA 5HO4A 1QQCA 4CGGA 4DR2J 2DEJA 2DCLA 4Y2AA 1S0MA 3DRXA 4ZA1A 3BF4A 5KFIA 1JCEA 4OMFG 1SQEA 3W65A 3IBFB 3QAUA 3T1YF 2IPOB 1U1MA 3MCOA 3UR0A 1YIJN 4CZEA 4CFAA 5CHIA 4FLYA 1S1VA 4K4VA 2PA3A 4RLEA 4ED5A 3NS6A 5E2QA 1WACA 2YWGA 3H59A 4QPTA 3UCZP 1RT5B 3TUZC 2DGTA 3KJNB 2QA4S 2IGIA 3D6HB 5C24A 5CR4A 3FNNA 3CCVS 1O51A 2NXCA 2W24A 4C3MA 3JQMA 4JI5J 3LDSA 4E3SA 1KLMB 3CMAS 2HF3A 2DY1A