2RF2A

Hiv reverse transcriptase in complex with inhibitor 7e (nnrti)
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
557
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7
publication title Novel indole-3-sulfonamides as potent HIV non-nucleoside reverse transcriptase inhibitors (NNRTIs).
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 157
structure length 554
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2rf2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rf2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rf2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rf2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2rf2A05
2W9AA 3U3GA 4K8XA 3CM6A 3WNFA 4ELVA 2BR0A 1EETB 2P51A 3BQ2A 2FJWA 4O3PA 3OHAA 1U48A 1Q9YA 5KTQA 2ALZA 1NHUA 1RTIA 2HHUA 2YV0X 3QLHB 3QEVA 2OZSA 1FKOA 1NJYA 4YR2A 2IM0A 1RT4A 4DS4A 3MFHA 4AHTA 4TY9A 2G8HA 4DL5A 5I42A 3SI6A 3DMJA 2ILYA 1ZBUA 1EKEA 1UWBB 4IG0B 1C0UB 4DEZA 2YNIA 3K2PA 3DLEA 1TKDA 4TYAA 1TKXA 1U47A 4NLUA 4OLAA 3M9OB 4CFCA 3RRHA 4CJTA 1REVB 3PW2A 4QPXA 5DG7A 3HVRA 2R2TA 3H98A 2W7PA 1C0MA 3ZT2A 3GIKA 1KHVA 2YNGA 3ULDA 2ASDA 4WZMA 4RNMA 4OKKA 4DTOA 3KMQA 1TQLA 1TK8A 2B43A 4GC6A 1HYZA 3VQCA 2YNHB 1C0UA 3GV5B 5HRRA 3C6TA 3ZSQA 4E7IA 3T5LA 4RNHA 1EXQA 4F2RA 5HBMA 5HLFA 4CE9A 1JKHB 4Z4IA 2E9TA 1REVA 4ECXA 4AILC 3MECA 3GQCA 3MEGA 2XY6A 2G8FA 4KHMA 4EBCA 2J6UA 1N5YB 2GC8A 4CHYA 4DWIA 3I0SA 4ZPAA 2WHOA 3CQ8A 4DTXA 4WFYA 3ZCMA 1T03B 3NGZA 1FXXA 4FS2A 5C24A 4W5NA 2HWIA 3JSMA 3LWLA 3CJ0A 1JLFB 1WSJA 1NK9A 1C6VA 4ZP8A 3PY8A 4E7JA 3PUFA 4OKJA 3CVKA 2JEJA 4ED7A 1L3SA 5KFPA 1N5YA 2D41A 3QO9A 4CF8A 4DQPA 3PR4A 4OPJA 4TYBA 3PR5B 2GIRA 1SH3A 4XIUA 4OKEA 1VSEA 4CEFA 4DMNA 3KK3A 2EHGA 3N6MA 3GIIA 1T03A 4WFXA 3AO2A 1NK8A 4NCBA 5DLFA 4MIAA 3OYKA 4RW9B 2RF2B 5KFFA 5KT2A 4NLTA 3NAEA 4E1NA 2AGQA 1RT2A 2O4IA 4Z0UA 3PW0A 4Q8EA 4KHQA 2FVCA 2W42A 3MEDB 2C28A 4DTNA 3AA2A 1XHXA 2W8KA 4HCBA 1KFDA 3SYZA 5DQGA 4ECYA 2ATLA 4XPCA 3AVHA 4FBUA 5FROA 3KK2B 1NKEA 2BGGA 4RNNA 3V1RA 5CZ1A 1N48A 4I2PB 3QERA 4RW9A 4N5SA 2XGQA 1IKVB 4FLXA 3HPOA 5EWFA 4XO0A 3QNNA 4O5BA 1NK0A 1GX5A 3HP6A 3CO9A 2W8LA 3CG7A 2GUIA 4Z4EA 3RB6A 4HKQA 4MFBB 4M3YA 3DOKB 3T3FA 2B4JA 3RBEA 1L5UA 4CFAA 1A5XA 3G6YA 2Z1IA 1LW2B 2WRMA 4ED0A 3TARA 2ZD1A 2JEIA 3KK2A 4Y2AA 4CEQA 1RAJA 3PW4A 3SV3A 4ECQA 3OYHA 3T5HA 1IKVA 3AVCA 4M3UA 3T5JA 4FLZA 2UVWA 3DDKA 1S9GA 2W9BA 1N6QB 2OH2A 5DG9A 1RBUA 4JUZA 2HHXA 1FKPB 3AVLA 4KHYA 4MFBA 2VG6A 4QAGA 4NZ0A 3G86A 2Z1HA 3KMSA 5JS2A 4AHSA 4I9LA 3PX4A 4M41A 4GC7A 5HRNA 2I5JB 1JLAA 4Q8FA 4OVLA 4DU3A 2D3ZA 3AVMA 1KVCA 4CIFA 1JXBA 4URGA 4CEAA 2VWJA 3HKWA 3S9HA 1VSIA 1SL2A 3JYTB 5J2NB 1BL3A 4XPEA 3DM2B 1N6QA 4C8LA 2RN2A 5K14B 3FQLA 1RDRA 4DQSA 4I2QB 4JV1A 4E19A 2JC1A 4FM2A 2YKMB 4J2DA 2KZMA 3T19A 1VSFA 3QGIA 1UAXA 3DLKA 3NL0A 4IKAA 4NLQA 4KI4A 3KLEB 3I0RB 2R8GA 3V81A 4DTJA 3LP0A 4ECWA 2HHQA 4WFZA 2X6SA 5F8GA 2FLLA 4KTWA 4CGGA 1SH0A 2HNZA 3GIJA 4DF8A 3RBDA 4ED3A 1SH2A 1HNVB 4M3XA 3K59A 5KFNA 3KLHB 3Q8RB 3DM2A 4BWJA 1W9HA 4N76A 4AHCA 2DFHA 2R2UA 4M3ZA 1OS5A 2E9ZA 1J5OB 2C2EA 2FBXA 5KFTA 2F8SA 4CIGA 4CK2A 5FRMA 4YMEA 4KB7A 3CYMA 2WONB 2JLEA 1T3NA 1JLGB 4DSJA 3VQPA 3VQ8A 1WAJA 4RZRA 1O1WA 2ITGA 3MEEB 1LAVA 3DRRB 4IH5A 3KLGB 4KE5A 5KGWA 3DOLB 2IS3A 1IKXB 4J9MA 3OYDA 3HVAA 4Q45A 4BE1A 3UQSA 3BGRA 1ASUA 4DU4A 1K1SA 1J5OA 2Z1GA 2KZZA 4DFJA 4DL4A 4DTRA 3H40A 1JLBA 1KLMB 2WONA 3NH2A 5KG0A 4U7CA 4FM0A 3K57A 1JLGA 5HRPA 1S0OA 1HQUB 3FQKA 4NRUA 2ZQBA 4M3WA 4EYHB 4NLWA 1ITGA 4O3SA 1S9EB 2HNDB 2OPPA 3DRRA 4W5QA 3D28A 1NNDA 3VQQA 3KLGA 3RAQA 3AA5X 3DOLA 1IKXA 3NHGA 3SQ1A 2WTFA 3C95A 4GMJB 5CZ2A 3HVTA 1N56A 4B9LA 2HNYA 2PZSA 4N47A 3KKSA 5J2MA 1FK9B 3PZPA 3E51A 3IG1A 1XI1A 4ID5A 3PO4A 4KHRA 1I6JA 4DFMA 1QTMA 1LWCA 3LZIA 3GILA 1KVBA 4EZ9A 4ECRA 1S5JA 1S9EA 2AQ4A 4ECZA 4CIEA 4CJKA 2YKNA 4BDZA 4ZP7A 3C94A 2BQUA 3V6JA 5SWMA 1Q9XA 2YNFB 1JLCB 4E7KA 3L2RA 1C1CB 3IS9B 1FK9A 4ZPCA 4JV2A 3HL8A 3DYAA 4GW6A 2AX0A 1VSKA 2W7OA 3KHHA 4CEOA 1QSYA 4Z4GA 3SQ4A 3PX0A 2C2DA 4E1MA 1RDCA 2R2SA 1VRUA 3O4NA 1DLOB 3M8SA 4FJ8A 2IA6A 4FJ9A 2QV6A 1RT6B 1CZBA 1A5WA 4O44B 3H2LA 3V9XA 2YNFA 1R0AA 3RWUA 2FJXA 3VQ6A 4URQU 4ZVHA 1C1CA 4ZHRB 4R8UB 3KHRA 3LP1B 3VQBA 1X9WA 3OYFA 1TK0A 5KFHA 4J9SA 3BSOA 2QKBA 3SFGA 4FW1A 3RTVA 3OSNA 4K4TA 2B5JB 1YTUA 4RW6B 4U6PA 4J9PA 4NLXA 2HMIA 4LSNB 4QWCA 3I5CA 4B8CA 5FRNA 1MMLA 5HP1B 2G8WA 4CF1A 4O3QA 4O55A 3PV8A 1RTIB 4KHUA 3ZSOA 4B9NA 3OYGA 4R8UA 4L8RB 4KBIA 1RT4B 2XCAA 1Z25A 4J2EA 4BWMA 3KIOA 3ZSVA 3QEWA 1YT3A 4W5RA 3DLEB 3V6HA 1TKXB 3G0ZA 3KJVB 5DQHA 3L3UA 4RW6A 4FJNA 4LSNA 1S1TA 4DTUA 2VG7B 3LALA 5HP1A 4I7FA 2YHBA 5KFRA 2B6AB 4DL6A 4YR0A 2EC0A 4FJHA 1D0EA 5JUMA 3ITHB 1TKTA 1S6PB 4TN2A 2YNGB 3KLFB 4BE0A 1HARA 4MKBA 1S1UB 4KFBB 2AWZA 2W9CB 4O3OA 1BISA 4KI6A 1NK4A 3OYJA 2P5GA 3C6TB 1WSFA 4CJLA 5J2QA 3KJVA 4YFUA 1G15A 4IBNA 4H4MB 4PWDB 4LQ9A 5HBMB 5HLFB 2R8JA 4BACA 1S1WB 1JXEA 4J2AA 2VG7A 2WOMA 3MECB 3MEGB 4ECVA 3CFRA 3S3NA 2VA3A 3TAMA 2B6AA 4CGHA 2IJFA 2IMWP 3ITHA 4AHUA 1S6PA 4E7HA 1BQMA 4KO0B 3KLFA 4PA1A 4NLRA 1S1UA 3OL7A 3IRXA 4KFBA 4B9SA 2W9CA 3EZUA 1RT7B 5KT5A 1WSHA 1HQEB 3D45A 3O3FA 4DQQA 4EO6A 2EX3A 3I0SB 3AV9A 3EPGA 4K4ZA 3PW7A 4CF2A 1RDAA 4K4VA 4FCYA 3ZSXA 1T05A 4H4MA 4PWDA 1KVAA 4CFDA 3TI0A 4PY5A 3EPIA 4EZ6A 1RT5A 5C24B 1RBSA 1S1WA 4CJWA 3Q8PB 4DQIA 4FJIA 1Z26A 2BDPA 3JSMB 4DSEA 1RTHB 1MU2A 4CEDA 4IRCA 3TAGA 1YVFA 3OLAA 1RA6A 4CJRA 4M95A 5DMRA 4KO0A 4NYNA 3SQ2A 3MR3A 3QO9B 4ZTFA 1HYVA 4ZVEA 5KG2A 1RT7A 3F73A 1HQEA 2HB5A 3VQDA 1J53A 4F3TA 4CJVA 3KK3B 4RG8A 1LWEB 1S97A 2JC0A 3DRPA 4CEBA 4KHSA 2I1RA 4FXDA 3M8PA 4WYWA 4RUAA 4IFYB 3V9ZA 3OVNA 4K4XA 1S9FA 4KREA 1RTHA 2WK4A 3QGHA 4DQRA 1RCHA 1S1XB 3NCIA 1D8YA 3V4IA 1RT2B 4HHTA 3EY1A 4O4RA 2XC9A 3SV4A 3ZT1A 4O4GA 5KT4A 4N41A 2ASJA 3CFPA 4DFPA 3LAKA 1NKCA 4DL7A 2BRKA 1LWEA 2AGPA 4F4WA 1IO2A 4M3TA 1WAFA 4DLEA 2Y1IA 4IFYA 1IKYB 4YR3A 4JS4A 2ZE2B 4QWDA 3OJSA 1S1XA 1BIZA 4ZVFA 4Y1CA 3TAQA 4FVMA 2XY7A 5CYQA 3CM5A 3KLVA 3AA3A 1BI4A 3MF5A 3QGGA 4NCGB 1T94A 1S6QB 4DG1A 2D5RA 4ID1A 3BR9A 5JXSA 3RRGA 3QZ8A 3AO5A 4F4ZA 3E01A 3QETA 4KTZA 2ZD1B 3S3OA 4FYDA 2V4QA 2P1JA 3PVXA 1IKYA 3SPYA 1HRHA 3NMAA 2OPRB 4MKAA 2ZE2A 2X74A 1N4LA 3MAQA 1QSSA 1S9GB 2W9BB 3DLRA 4CFBA 3OYCA 4ECSA 1RBVA 3ZSWA 4FJXA 4NCGA 2KQ2A 1RT1A 4DTMA 1WSGA 4LY7A 1S6QA 5HROB 1S4FA 4CECA 2VG6B 5KT7A 4E3SA 4J9LA 1Y97A 3OYAA 3LZJA 1TV6A 3LWMA 5KFZA 1JLAB 3NGIA 1DTTB 1JXLA 3MXMA 1ASVA 1S48A 4ZP9A 4IR9A 3NGDA 1L3UA 4CF9A 2A1RA 1XWLA 4DTPA 2OPRA 3CDEA 5T7BA 5F8JA 3OS2A 3SQ0A 2AGOA 4IRDA 1D9FA 2VG5B 5KFLA 5KFSA 3N6LA 1X1PA 5KFQA 5HROA 2HW3A 2GIQA 3DLKB 3G6XA 2BQRA 3V6KA 3AVGA 4DL2A 5KG1A 3IGVA 1DTTA 3V81B 4FJGA 2XWYA 3LP0B 4WZQA 4O0IA 4WXOA 3CIZA 4H54A 3OLBA 2KFNA 2HNZB 1F21A 4FLTA 3LANA 3NKYA 3SFUA 3TQ1A 1LAWA 2OYQA 4QCLA 3ZT4A 2IOCA 2FVPA 3MR2A 3BSCA 2VG5A 4DFKA 4RNFA 5EDWA 1JL2A 3SUQA 2E6MA 3I8DA 5F9NA 2UVUA 1T7PA 1S0NA 2D0BA 3PX6A 4NYFA 1CXQA 1VSJA 1LW0B 1SKWA 3QEPA 4CHPA 4PUOA 1WNEA 1IH7A 1J54A 3OYMA 3HM9A 4B3OA 2O4GA 4QWEA 3VQSA 4FW2A 2G8UA 5F8LA 4DTSA 3Q8SB 2IC3B 1RTDB 1TK5A 4DL3A 3HK2A 4YP3A 4KAZA 2HHSA 1VSHA 5EU7A 1LWFB 3BQ0A 1DTQB 3BGRB 1JLQA 4QOZB 3OL9A 1S0MA 3P83D 4K4YA 3I5AA 3HP9A 1SL0A 3M9NB 3NDKA 1W0HA 1JIHA 3K5MA 3LPTA 1JLBB 3AVFA 3K58A 4LD0A 1CXUA 1LW0A 3T5KA 4EO8A 1A5VA 2XHBA 5J1EB 4QW8A 1IKWB 1QQCA 3CJ4A 5F8HA 4KB1A 2E9RX 2OPPB 4HYKA 1I3AA 1WSEA 2OPQA 3DRSB 3L2QA 4B9UA 4OL8A 4MQ3A 2IC3A 1RTDA 5DG8A 3B6PA 3RMDA 1W25A 3C6UA 2FBVA 2XY5A 1LWFA 1DTQA 4TSXA 2DPJA 3HVTB 4NRTA 2HNYB 3VQAA 4K4WA 1NKBA 4K8ZA 2FVQA 2F96A 5J2MB 3OL8A 5F9LA 3IG1B 4JRQA 4ID5B 5KFXA 1LV5A 1LWCB 4QWBA 3F9KA 5J1EA 2WB4A 5L1IA 3OS0A 2AX1A 1IKWA 4OJRA 4CHOA 5KG7A 4J9RA 3DRSA 4FBTA 4YNQA 2YKNB 4JLHA 3RMAA 4B9TA 3L2VA 2HHTA 3PJWA 1NHVA 4CJ3A 2XY8A 4RNOA 3KOAA 5F8IA 4KPYA 3MXJA 2RKIA 1QAIA 3LP2A 5KFDA 3M8QB 2R2RA 4NLPA 2C22A 3HPGA 3DYAB 2FVSA 5HRSA 5KRSA 3SUPA 4RUCA 2IJNA 1SL1A 3OJUA 2IBKA 3OYNA 2E4LA 1TVRA 4IH7A 2BANB 1VRUB 1ZBFA 2BE2B 1ZBLA 3KLIB 4K50A 5KFVA 4M3RA 4OLBA 1JLEA 1TKZA 4X2BA 4F4KA 2OPSA 1HYSB 3AVAA 3QNOA 4GVMA 4Q0BA 1TL1A 1Q8IA 1XHZA 4LSLB 4TY8B 4IR1A 4AH9A 4CJFA 4AHRA 4B9VA 1R0AB 3CJ3A 3SZ2A 2XRIA 3V1QA 1KTQA 3GIMA 3NFAA 3AO1A 4Q44A 3M8QA 4C8NA 4URSA 4TQSA 1L3VA 3CDUA 1ZETA 1SUQB 1VRTB 4N56A 4K4SA 4NLYA 2BANA 1C1AA 2DTUA 4R0EA 3RR8A 2BE2A 5L1KA 4TLRA 3KLIA 1U45A 1I39A 4PQUB 3A2FA 5KI6A 3WNHA 2VWKA 4FJLA 4F4XA 4F50A 1TAQA 2HMIB 1HYSA 5KFIA 3NF9A 3HT3A 4LSLA 3OYIA 5DK5A 4TY8A 2KTQA 1Z4UA 3P5JA 3MR5A 5L1LA 1VSLA 4M45A 4Q5VA 1C1BB 4JS5A 1ZBHA 3NBPA 1NOYA 1GOBA 1SUQA 1VRTA 2D0AA 3LP3A 1KLNA 4HUFA 3QIPB 5CYMB 4AHVA 5KT6A 3Q8QB 4RW4B 2BRLA 4CESA 3QZ7A 4PQUA 1U04A 5KFYA 5JS1A 1QHTA 3QIOA 3PHEA 1D5AA 1S1TB 1ZTTA 1SV5A 3H4DA 2C2RA 4E7LA 4O3NA 3LAMA 2IM2A 3D0PA 1HNIA 4I7FB 3HVWA 5KFKA 5F8MA 2XI3A 4DU1A 2PY5A 2ZKUA 3AVKA 3VA3A 1TKTB 4IFVA 4CJ4A 1C1BA 4J9KA 4DLGA 1RYSA 4BDPA 4ZTJA 3AO3A 3PJXA 3WNEA 1JX4A 3QIPA 4ECTA 5CYMA 1TL3A 3IN5A 5C42A 2JEFA 4RW4A 4CERA 3RR7A 2AU0A 5J2QB 3UDLA 2JGUA 1QUVA 1YTAA 2WOMB 3TAMB 3KHLA 2QKKA 4ELTA 3BREA 1SKRA 2R8IA 3M8RA 1SKSA 4J9NA 1BQMB 5KFOA 3AVJA 3IAYA 4EBEA 3IRXB 3NGYA 3ASMA 3NH1A 4FJKA 3BSNA 1BQNB 1UA1A 4MH8A 3D5MA 2Y1JA 3KTQA 2DFEA 2HHWA 2F8EX 5EUHA 1T05B 3QYYA 3LDSA 3V9SA 1BCMA 1RT5B 4DSIA 3FFIA 4WE1B 4JRPA 4CJUA 2V9WA 3HSTB 4O0JA 4H4OB 4B9MA 1QE1B 4CGJA 1MU2B 4LH5A 4CJQA 3H4BA 4RW8A 3RB4A 2XO7A 5KGXA 2V4RA 3ZSYA 4DSFA 2WCXA 1CSJA 2LSNA 3OYBA 4KKOB 2HAIA 2A1SA 1QAJA 1C2PA 4CK1A 3GV8B 1EETA 3BJYA 1S1VB 1RNHA 4ELUA 1GX6A 4FK0A 1BQNA 3BSAA 4ZP6A 4CJ5A 2J6TA 3CJ2A 2UVVA 3OY9A 4FLYA 1WSIA 3OSPA 3QLHA 2FJVA 3MFIA 3FDSA 3DRPB 4C8KA 4FK4A 3NF6A 3M8PB 4WE1A 4ZPDA 4H4OA 1QE1A 4F2SA 3AVIA 5C25B 1EP4B 3CWJA 4ZPBA 2JEGA 3AVBA 1BCOA 3V4IB 4MK7A 1UWBA 4IG0A 3VQ7A 2FLPA 4LQ3A 4CHZA 5KFUA 2XGPA 3KKRA 1KRPA 4KKOA 4O4GB 3ZSZA 1S49A 3VN5A 1S1VA 3HHKA 4FM1A 3KNAA 4OGCA 4IG3B 4W5OA 4IDKB 4Y2CA 4KRFA 2IAJB 5C5JA 3NAHA 4KHWA 4UQGA 1WNSA 2E6LA 4B08A 3V9UA 5C25A 1EP4A 3HO1A 2DY4A 2YNHA 3ZT3A 3U3YA 2IM3A 5CYQB 5DLGA 1BI4B 4HUEA 5CY4A 5KG3A 1JKHA 4DG1B 5L9XA 4NLGA 5L1JA 4IG3A 4IKFA 3L8BA 4ED1A 3E01B 4IDKA 4G1QB 4WXWA 3RMBA 2IAJA 1K6YA 4Q43A 4CJEA 5SZTA 2FBTA 2VA2A 4CJSA 2RDIA 2KW4A 3M9MB 5KFEA 4RU9A 2XCPA 3QEXA 3L3VA 1QS4A 3K5LA 4KAIA 5DQIA 5KG4A 2ATQA 3UIQA 5KFCA 1XR6A 4M42A 5FDLB 1RT1B 4R5PB 2HHVA 2G8IA 3KK1B 1C0TB 1TV6B 4NCAA 1GOCA 4F4YA 1JLFA 3ZT0A 4G1QA 3SUOA 4CK3A 2PYJA 4HTUA 3RMCA 1KFSA 4ZMMA 1NOZA 1RILA 3DLGB 3HYFA 1CLQA 4MK8A 4F3OA 2RDJA 2D3UA 3OYEA 3FRZA 2X6NA 3V1OA 4RW7B 4KB0A 4Y1DA 5F8NA 3MR6A 5FDLA 4LH4A 3AO4A 2DFFA 4R5PA 2R7YA 2R8HA 1ZTWA 4I9QA 1B9FA 3UPFA 3KK1A 1C0TA 2RF2A 1ZBIA 3BDPA 3UR0A 4CGFA 4FK2A 3NF7A 3ISNC 3MXIA 4K4UA 3SJJA 2AJQA 1NK5A 3DLGA 3MEDA 4CEZA 4EEYA 4DF4A 4FZXC 4EBDA 3SPZA 1BIUA 1RT3B 2FC0A 4RW7A 3HPHA 2ILZA 2DPIA 4NLSA 2ETJA 4CEEA 3WNGA 2GV9A 3V6DB 3SCXA 3CFOA 1VSDA 2IGIA 3EYZA 3O4QA 1WLJA 5D3GB 5E41A 3RAXA 4HUGA 4I2PA 2Q3SA 3CDWA 3SNNA 4QWAA 1RTJB 4PUOB 4H8KA 4Z4CA 3U6FA 4E0DA 3AA4A 5EWEA 3ICLA 4B3OB 4J2BA 4CJPA 3DOKA 1RBRA 3NF8A 4JV0A 3RB3A 1LW2A 4FLWA 2HVHA 1RT3A 3B6OA 4DSLA 4FS1A 3V6DA 3KD5E 5KFWA 1JLQB 4C8MA 1VK0A 4FZZA 5D3GA 4CGDA 3TAEA 1T8EA 4IRKA 1XR7A 1TAUA 3SI8A 4TXSA 4DS5A 1IG9A 1B92A 3N6NA 1KCFA 3QIDA 3QEIA 1D1UA 4J9OA 1EX4A 1RTJA 4E89A 4J9QA 4O3RA 4QW9A 4MK9A 1FKPA 4ECUA 4B8AB 4WYLA 3PO5A 3TABA 2OPQB 3VA0A 2CJQA 2I5JA 1HPZB 1JL1A 3DLBA 3C6UB 4HCCA 2BQ3A 2Z1JA 3O3HA 1NJXA 1QSLA 1RA7A 3VQEA 1ZYQA 3NAIA 4NLOA 1TGOA 3THVA 3JYTA 4KTQA 4IH6A 5J2NA 3VQ5A 4EYIB 1GOAA 5K14A 1B9DA 4ED6A 1J9AA 4I2QA 2YKMA 3TAFA 2V0NA 3TANA 3TAPA 1RDBA 5J2PB 1RYRA 4BDYA 1BGXT 1U09A 1BHLA 2FBYA 1HPZA 2NUBA 3GV7B 4G3IA 3OHBA 3KLEA 3I0RA 1UOCA 3TVKA 1WN7A 2RKIB 2G8KA 4F8RA 3H5UA 4NYZA 3LP2B 4FZYA 4Z4FA 2F8TA 3ALYA 2G8VA 1HNVA 5KFBA 2P5OA 3KLHA 1IM4A 3NH0A 1TVRB 1NK6A 2HWHA 3H5YA 1CZ9A 4ED2A 4IQXA 1JLEB 1TKZB 4NLDA 4TQRA 2OPSB 5J2PA 4KSEB 4Q0BB 1TL1B 5KT3A 4OGEA 3P1GA 5DGBA 3G10A 3GYNA 4HVJA 3MEEA 3K5NA 3FSIA 5T14A 3QINA 3H5SA 1RDDA 3H59A 5KG5A 4YQWA 1XC9A 3L2UA 3KHGA 2IM1A 1YVUA 3O3GA 3EZ5A 5KFJA 4ICLB 2HVIA 5I3UB 3QESA 4FLVA 1U49A 2R8KA 4IOBA 4ED8A 3NE6A 4NLVA 1S10A 3HXMA 3V9WA 1X9MA 3ZSRA 1KHWA 5KFMA 1KLMA 4FJJA 2OA8A 1K1QA 2YHAA 5KFGA 1HQUA 1NJZA 3HJFA 4C8OA 2HNDA 4CHQA 2ASLA 1VSMA 4FJ7A 1HJRA 3NBPB 2FVRA 4CHNA 1X9SA 4FJMA 2PYLA 4ICLA 2OZMA 5I3UA 5EWGA 3MTKA 4FJ5A 2CKWA 3H5XA 4BE2A 1SV5B 3T1AA 2D7SA 1L3TA 5KG6A 4KV8B 5KFAA 1KSPA 1HNIB 4KHNA 3CJ5A 4EP5A 1UA0A 4Y34A 4M94A 2IDOA 1HMVB 3K5OA 1D9DA 4IFVB 3DLHA 3L2WA 2UVRA 5KRTA 3H08A 3SUNA 3BQ1A 1TP7A 3OL6A 1TL3B 5C42B 1JLCA 3IS9A 3ISND 3IGNA 4ZVGA 3OS1A 3DI6B 4CGIA 3TWHA 1U4BA 4KV8A 4FLUA 3TR8A 4CCHA 4CF0A 4OPKA 3KD1E 2D0CA 3G6VA 1HMVA 3I5BA 1DLOA 1XR5A 5DGAA 3RB0A 2QK9A 1NJWA 1RT6A 2KFZA 2XI2A 2RPIA 4O44A 2UUWA 3AVNA 4Y3CA 4W5TA 4Z4HA 2UUTA 2QXFA 4EP4A 1NK7A 2GBZA 1FKOB 4ZHRA 3OYLA 4DSKA 3VQ9A 3PW5A 3FFIB 3LP1A 2FLNA 3LPUA 1ASWA 2O5DA 3DI6A 1RBTA 2X78A 4MIBA 5I42B 3S3MA 3DMJB 4RW8B 2YNIB 3VQ4A 2J6SA 2QE5A 2B5JA
chains in the Genus database with same CATH superfamily
4WKYA 3U3GA 3CM6A 4ZVPB 4IUFA 7AT1B 2P51A 2FJWA 3P3DA 5KTQA 2DHXA 4Y65A 3QEVA 2ZJQL 4NXNJ 4DR1J 4YR2A 1M5SA 4ZPWR 2O8DB 4DS4A 1J2VA 3MFHA 3KDNA 2G8HA 4DL5A 3B6BA 5I42A 2KRRA 1ZBUA 3FZHA 1UWBB 4IG0B 1C0UB 1PYOB 2YNIA 2H65B 4HH0A 5GADI 2GWKA 5CHCB 4USHA 1X3NA 4CFCA 3RRHA 4CLPA 5DG7A 3Q7BA 2V51B 3W9IA 2D0OA 1YHQN 3IR6B 1WBBA 1IR0A 4OKKA 3A8EA 4DTOA 3T9NA 3T7ZA 5DJBA 4ANEA 4GC6A 2NXCA 1H73A 2YNHB 3OTOF 1R6YA 4OFZA 1R8AA 3T5LA 3TJ9A 4A5AA 4F2RA 1ZBTA 3BEXA 2XMTA 3MWPA 3MECA 5E3RA 3GQCA 5BR8F 3GBTA 2BM0A 4K8RA 3DHWC 3EM1A 3VGSA 1NSPA 2GC8A 4CHYA 4UUXA 1TZ0A 4ZPAA 3MCOA 1YJWS 4AL6A 1FFWB 1FXXA 5C24A 3V5RA 2HWIA 3BZKA 3CJ0A 1JLFB 2DXFA 1C6VA 1HBMA 4E7JA 2H4YB 1VQ5N 1VQ5S 3O9SA 1T6DA 4ED7A 3LM2A 1L3SA 5KFPA 3P49B 1Z6RA 4DQPA 3FZLA 3M2UB 4OKEA 1H74A 3KK3A 3W2VB 3N6MA 4KHPJ 3AO2A 5GINA 1GFWB 4HEA9 3GFYA 3TWZA 2KLAA 2FHOB 5DLFA 4G9ZA 3OYKA 5LL6Z 5H1SV 2GMHA 2YX4A 3W1YC 5KT2A 3DLLL 4AQYF 3A5MC 3N0VA 1RT2A 4Z0UA 3MM8A 3TYTA 3OBWA 3E9PA 1XJWB 4HACA 1FJ7A 2C28A 5M1PA 2Y3YA 2HBJA 3E3XA 4U67Q 4L75A 2CQHA 2DVIA 5EVZA 1XMQJ 4XPCA 4AM6A 4H5NA 4HWIA 3SLCA 4LF8J 3FZKA 2P9CA 2MKIA 3IR7B 3UDVA 4AYBD 4GKJK 3QERA 3NG8A 1RK8A 4JEPA 4O5BA 3CO9A 2W8LA 1SC4B 4ZPVR 2B56A 3RB6A 4M3YA 3T3FA 4OZ1A 2AEFA 5LL6d 5A6PA 2WRMA 2YWHA 2YWWA 4C0OC 2VDIA 2AYGA 4CEQA 2YTCA 4ILGB 3MHYA 3F41A 3HHDA 1IKVA 2Q66A 4H5TA 3H0PA 3EWGA 2EFNA 2NRVA 1RWXB 4BG9A 1NRKA 2VG6A 4NZ0A 4IOXA 4AHSA 1UWAA 1HL6A 2I5JB 2MKSA 4DU3A 3N4QA 4P7TA 2EXUA 1Y3JA 1JXBA 3VMFB 2XZWA 4CEAA 1GLCG 2CJKA 4I64A 1RADB 5L9NA 3JYTB 3Q86A 3V4MA 2IVPA 4XPEA 1S57A 1MWMA 2ZJQQ 3UDEA 4DQSA 4ERDA 4JV1A 4FM2A 2JC1A 4JKDA 2BM1A 1P8GA 1JJHA 3K9KA 3SBGA 3M30B 1VBKA 1D3WA 1UAXA 3DLKA 1REGX 1C4CA 3H1QA 1X4HA 4NLQA 3O1LA 1Q82T 4ZVUB 3J81Y 2QTDA 3BGUA 3V81A 2O8CA 1IV0A 1Q5VA 4C1NK 4WFZA 4HTIA 2FLLA 1VQYA 3P38A 4FO0A 4HDHA 3GIJA 3M2VB 3AQPA 3G96A 7FDRA 3RBDA 1SH2A 1YSJA 3Q8RB 3DM2A 4BWJA 4UOGA 4N76A 2DFHA 1R8BA 4N7TA 1OS5A 2MJNA 2E9ZA 2C2EA 1S7IA 5FRMA 4YMEA 2IRYA 4KB7A 2JLEA 2F9DA 3R27A 4LF9J 2D9OA 3LDOA 4OPHA 4L6V3 4KGXB 1PKUA 1RCOB 1HNZJ 1LAVA 3KLGB 2H4WB 1GMVA 4J9MA 4Q45A 4BE1A 4LIWA 3BGRA 4DU4A 1U1NA 2EK1A 1K1SA 1J5OA 4BLGA 3I31A 4USWA 2R7WA 4ZN3A 1KLMB 1OVQA 3NH2A 4BRIA 3K57A 3NGKA 4NRUA 3KYLA 4OI0A 2ZWHA 5AXLA 2ZQBA 4EYHB 2IDEA 3DRRA 2MKHA 4W5QA 3D28A 3VQQA 2L9DA 1SJ4P 4C3KA 3GDQA 3RBZA 1UJ5A 8AT1B 5K20B 2NYIA 5ETMA 4GKKF 2B9EA 3RJMB 1CJUA 5J2MA 1F2GA 4DXLA 3PZPA 2XG8A 1XI1A 2BJDA 3PO4A 4LF1A 2CNLB 1E6VB 1LWCA 3LZIA 1YG0A 4LJMA 1N34J 5AQRA 2RH3A 4A8YA 5GAGI 3GFZA 2QL5B 2AQ4A 5HMXA 1WUAA 4YDDB 1N36F 3DLLQ 4CIEA 4CJKA 3M05A 2O3DA 3R8YA 4TLQA 1UW9A 3C94A 1IJFB 3UD4P 1JLCB 3HTVA 1JJ2M 3AOAA 2VU5A 2BE9B 5LM7E 1FK9A 4ZPCA 2AX0A 2W7OA 4Z4GA 2HBZB 1RZMA 2MHNA 1RB0A 1RDCA 5JLFA 5M1QA 2Q3PA 4NEZA 5A8WA 1NG9A 4LC9B 4CZKA 4LRBA 4FJ8A 1KQGB 2IA6A 1NGHA 3WIVA 4A8FA 1CZBA 3H2LA 2YNFA 4DR3F 1SCJB 1C1CA 5DDOC 3NCRA 4R8UB 3BGOP 3N5BA 3CQYA 3I33A 3BSOA 1RKJA 4L72B 1JQGA 2X7IA 4BR5A 4U6PA 4HLBA 1O51A 1RHKB 1VQ4S 1HR0K 4BRPA 1N5TA 2RB7A 1TR0A 5L39A 2K7KA 4DV0K 2I7PA 2XLKA 4L8RB 2P9UA 2AYBA 2XCAA 4U7UK 3C2PA 3W2WB 2UUBJ 2QA4N 1YT3A 2QA4S 2Z57B 4W5RA 3R2DJ 2KKHA 2DNRA 2XS2A 4JB8B 3FMBA 5DQHA 2W2NP 2K7JA 4PXBA 4LSNA 3CJRA 3TNVA 1S1TA 2R42A 1H0HB 4JV5J 4BR4A 4F04B 5JUMA 5GADP 2P5VA 2HFUA 3KLFB 2MZRA 2QWQA 2CGLA 4KFBB 3SXLA 3R8EA 1CJTA 2R7VA 1HIYA 2LFVA 1RWUA 4B3TJ 2ADBA 2QA4G 4GO5X 1WSFA 1KEKA 2M70A 5J2QA 4LQ9A 2P9IA 2VPXB 5J1NA 4J2AA 4DPWA 4AE5A 1WG5A 3MECB 2HGNA 4ECVA 3TAMA 3KKFA 3N4PA 2NLXA 3CJ9A 2IMWP 1YRXA 4PA1A 4KO0B 2MQLA 3NY0A 1S1UA 2RUGA 4ID8A 2WC9A 5IC4B 4DV3K 3GB0A 3EZUA 2VGMA 2FF6A 1WTBA 5GAEU 3O3FA 4DQQA 3AV9A 3EPGA 3N5FA 3QDKA 5CD4A 4H4MA 4NOHA 4EZ6A 5C24B 3CCRN 3Q8PB 5A2QU 1UCNA 2BDPA 3BP8A 1JNZB 4DR4J 1RTHB 4E98A 3AOBA 2DISA 2KI2A 1HBMB 2O67A 1R43A 1N33J 2YXLA 4WBFA 3SQ2A 4OI4A 5KPZA 1HYVA 1RT7A 3VV2B 4WQ4C 3TOQA 2QLWA 1S6UA 2HB5A 3VQDA 1U2CA 3KK3B 3PFEA 5B0FA 1LWEB 2B7BB 4KYZA 3VZHA 5EX5A 4Y2IA 3DRPA 4CEBA 4KHSA 4HHHA 4WYWA 3JAMO 4RUAA 3TA2A 3H46O 4KREA 3QBWA 1S1XB 1D8YA 3NCIA 2EG2A 3TJ8A 3QFWA 4IQMA 1RT2B 1BLUA 1A0OB 3MM8B 4GMKA 1SJ3P 1X4AA 3CJ1A 3ONQA 1XMOF 3D0GE 4YEAA 3CFPA 3D1QA 4RL1A 2NRZA 2HKEA 4F4AA 1VR6A 2D9PA 1YX2A 4DUYJ 2NXUA 2MQ8A 4F4WA 2HIQA 1IO2A 4FSVA 3MEKA 4P74A 3ETMA 1KNZA 1IKYB 3ELHA 5ETNA 3EGVA 3L4IA 4ETXA 5GMDA 3GG4A 3BGLA 4FL9A 3KLVA 3QGGA 2DRAA 2D5RA 3KJQB 4KH6A 4ANDA 4DUTA 4XK8C 3QETA 1B7FA 2HPUA 4PKIA 3OBIA 3I56S 4CD3A 2P1JA 5CZXA 4JI1K 1GLAG 2PEBA 1UEVA 2OPRB 2ZE2A 2PMHA 5E7OB 2X74A 1QSSA 4ECSA 2J8AA 1Y64A 1U2VA 4NCGA 2XS5A 3S1TA 1WSGA 3O9UA 5HROB 4KR0B 1X4GA 4CECA 2VG6B 2Z2MA 3OYAA 3LZJA 4PG7A 4JI5K 1TV6A 3NGIA 3KG1A 5HSPA 3EJMA 1LKZA 4RJVA 3MXMA 1ASVA 2BYCA 1PBAA 5EX3A 4B3RF 2A1RA 2JX2A 1T9YA 4JI7J 1HD0A 3CDEA 4WU2A 3O6QA 3VEYA 5F8JA 4M63C 2ERRA 2AGOA 4LF4K 1X8DA 4LF5J 3S7RA 4NA2A 5KFSA 1VBYA 3UO0A 5A8KB 2EEYA 2Z2YB 2AMCB 2NSCA 2ZH3A 2RQKA 3DLKB 3G6XA 2W2OP 1DTTA 3V81B 3GCXP 5MLCQ 4FJGA 2XWYA 2O8CB 2JSXA 4H54A 8ATCB 4CLYA 2GX8A 1S4EA 1WC3A 3JSRA 3RW7A 2RSQA 3DRXA 3JQJA 2J0WA 4QCLA 2GQQA 4TU8A 4F67A 2IOCA 2ZH9A 1FWPA 2X1GA 4K25A 2HAFA 4DV2J 3SUQA 4FWSA 2V2VA 4PPZA 5KPRA 3BPDA 3SBMA 5I4MA 4BRLA 4NYFA 1VSJA 1LW0B 4W4MA 4IJNA 2DHAA 1WNEA 3T1YK 1J54A 4CZGA 2UXBF 4B3OA 3RW6A 4QWEA 3VQSA 2G8UA 5F8LA 4DTSA 3Q8SB 4ANCA 1AZSA 1RTDB 3HI9A 1KOHA 2YHYA 3BO4A 1P1TA 3FVYA 3BGRB 2F3JA 1HKCA 4Q2LA 1S79A 1S0MA 2F4VF 2A5XA 4K4YA 1NEEA 3I5AA 3HP9A 5AQJA 3M9NB 1W0HA 3K5MA 3LPTA 2YPYA 4LD0A 1IWAA 2CPHA 4FWNA 4F0MA 1XC3A 4X64F 4QU6A 4DV1K 4DZDA 1QQCA 1I94K 4L74A 4KB1A 1GTEA 4HYKA 3MM9A 1AUDA 1I3AA 2G4BA 3QRRA 2IC3A 4LVNP 1W25A 4LIRA 4NI2A 2DPJA 4NRTA 1WKLA 3F56A 3AGKA 3PYGA 3HD2A 1NKBA 1Q7YT 1KAXA 2FVQA 1VMBA 4WKRA 2F96A 1CJUB 4X66F 5J2MB 2V6AA 4DPOA 4LF7F 2QO3A 1LWCB 1Z1ZA 3LDPA 1UJ4A 3ZZPA 3ATUA 1KDNA 4F3MA 2MB0B 5BR8J 3Q24A 2RS2A 1GK8A 4FVCA 2JDJA 1BDGA 3BO2A 3RMAA 2HHTA 3PJWA 1NHVA 5D77A 3T6BA 8RUCA 1EQ0A 4DR2K 3HFZB 4HVZA 2RKIA 1LXNA 2N7CA 3LP2A 3W66A 3MOJB 1HFEL 4HHUA 5KFDA 2ROEA 5GAGP 3I9ZA 2BMBA 4RWWA 5HRSA 2IJNA 1UTAA 3OYNA 3VGLA 1TVRA 2OAUA 4QJVA 2C3YA 2BE2B 1BWFO 3T1HK 4K50A 5A8WB 3MPWA 3C65A 4F4KA 4X2BA 2OPSA 1HYSB 5HVHA 1XHZA 4LSLB 3E8OA 4AHRA 5LMUF 2QWOA 4ZVRB 2HBYB 3P31A 3NFAA 4Q44A 2VH7A 2CNOB 3M8QA 3PLAA 4URSA 3UKRA 4TQSA 2CYYA 3CDUA 3RSEA 3LH2S 3FRYA 3PIOL 2ASMA 5AE1A 1R59O 2LU1A 2DTUA 2BANA 3IR5B 2OD4A 4R0EA 3RR8A 2ZM6F 3KLIA 4PQUB 4FJLA 2CJXB 3VWSA 3TPQA 3MN6A 4UY8O 4I1TA 4F50A 2UUAF 4K2XA 3NF9A 4ZN1A 4CZCA 2WSCC 4JHDA 1DJ0A 3VOVA 4F3QA 1Q7LB 4HT7A 4CO4A 4M45A 1Y3KA 4V19X 2P9UB 1ZBHA 1X5PA 2IVOA 4P7VA 1KLNA 2CDQA 4B1UB 2KT5A 3Q8QB 4RW4B 2WSFC 4PAAA 3TSPA 4M5JA 5KFYA 4XH1A 2ZEJA 2P6SA 3PHEA 1S1TB 1SV5A 4E7LA 1F2HA 1G4CA 5AQKA 4PQAA 3NS5A 1GAOA 4BC9A 3GYXB 2ZKUA 2ZWPA 2CGKA 3VA3A 3G71S 1C1BA 4CNZA 2XM3A 3J7YI 1WC5A 2VD3A 4ZTJA 1EQYA 5JLHA 1CJTB 3PJXA 2NXEA 3WNEA 1JX4A 3CCLN 4DN9A 1TL3A 1EJ7L 1NAQA 2HURA 2UP1A 4LRFA 5BYRA 4DV4F 5J2QB 2RT3A 2KXFA 1T3OA 3UDLA 1V9OA 1LFWA 2JGUA 1QUVA 4YORA 2J9DA 3TAMB 2IRUA 1YJRA 1EZZB 1N0VC 2RHQB 3MMBB 3VQTA 2GNKA 1SKSA 3EE8A 2CPJA 1Y11A 2VZ9A 1RI7A 4FJKA 3GOIA 3I82A 2NUUG 1NH7A 1ZH5A 4MH8A 2ZNZA 5CCMA 3QWPA 4X4PA 4YB5A 2KG1A 2ASPA 2V2ZA 3QYYA 4DMZA 2KH9A 1Q79A 3FFIA 4JRPA 4GY2B 4B9MA 1QE1B 1NWKA 4CJQA 4RW8A 3HJVA 5L8RC 4MO4A 4OX6A 1C2PA 5AFUA 4CK1A 1Y9OA 3UE5A 4FK0A 3ZNUA 2E5LJ 4JOUA 3M6WA 2UXDF 2QIFA 3C14B 3QLHA 3MFIA 3Q89A 3DRPB 4C8KA 3VAIA 3HKZD 1TL7A 3NF6A 4B1XB 1X0PA 3BH7B 2DR9A 5DS7A 3CWJA 4ZITA 2JVRA 4MK7A 2QFJA 2DNHA 2DO0A 3C15B 4FWQA 2FLPA 3CNQP 4DHVA 1S49A 5SUHA 3M1FA 3TZWA 1S1VA 3HHKA 2LYVA 4FM1A 3GJTB 1RBAA 3GG0A 1FJCA 3I9V9 2Z2ZA 4Y2CA 2IAJB 3OFHA 4ISFA 1Q8BA 4DPXA 4UQGA 4KHWA 4TKTA 4PYAA 2E6LA 4NA3A 2DPNA 4WFNL 1QAXA 3HLUA 5A0YA 4CWBA 3OXLA 3HO1A 2C2ZB 4QIVA 4AXIA 3ZT3A 4DX5A 1F60B 4QBUA 3SBTA 3TEHB 4HUEA 1PJ6A 4A8QA 4CBWA 5L9XA 2CH6A 4IKFA 3MWBA 4CRJA 2NZ4A 3CCUS 2VFTA 2ZDPA 2CPYA 4WXWA 3RMBA 4WPAA 1VQMN 1VQMS 3THPA 4Q43A 1ZM4A 3FNNA 5SZTA 4YB6A 3J7AN 2DITA 4OO1J 2M8DB 2XCPA 3N28A 5GADU 3K5LA 5KG4A 3UIQA 1WI6A 3Q2TC 2KU7A 2OIHA 1U2VB 2VB6A 3O8WA 4R5PB 3ZTOA 5C2FA 2VBWA 4D3GA 1TV6B 3DHXA 4F4YA 1IG8A 3NVKA 2XNRA 3SUOA 3X1LB 3L6QA 3VR1A 2PYJA 3RMCA 5LSLA 4DKWA 1RILA 1YDLA 1N36J 1K73O 5AQMA 5DM6L 5LMNF 4F3OA 2D3UA 3OYEA 2Q43A 4K2JA 3V1OA 4RW7B 4IJAA 4DR6F 2DFFA 3AD8C 3JXOA 1B70B 1S99A 1ZTWA 3THWA 2VYPA 2OLWA 2RF2A 1K0VA 2XLIA 1HI0P 1H7XA 4USUA 4CGFA 1T9UA 4K4UA 3LGHA 3QT7A 3R6GB 1WHWA 2GHWA 3VAMA 3CCQN 1U1OA 3J81U 4EEYA 2BA9A 2HQDA 1W7AA 4A8OA 4CBUA 4QR0A 3D1HA 3MPVA 4LREA 4PKHA 1XMOK 2ETJA 3UR3C 4H0PA 2IGIA 4JI3F 3QMQA 5E41A 1WLJA 3RAXA 4HUGA 4OHWA 2Q3SA 3I4HX 3FSYA 3SAHA 4PG4A 3IAM9 3M2RA 4F0KA 4B3OB 3O9QA 2D3O1 3DOKA 2J7KA 3R6LB 3O1BA 3D6TB 3MDFA 1NSKL 4FLWA 2YWFA 3D66A 3W7BA 4PG8A 5KFWA 1M90T 4NLBA 5CE3A 1XR7A 3GL1A 3BYRA 4TXSA 4DS5A 1B92A 4J91A 1X4EA 3ZX3A 3H6EA 2RU9A 2PEHA 2YCHA 4E89A 1DARA 1BUXA 4CZEA 1QUPA 1NBEB 1M5KC 4GRSA 4KQZA 2DHGA 5AT1B 3GFHA 4LUBA 2VJVA 3ZC4A 3QJLA 4NI2B 2HG4A 2Z1JA 3B8AX 1V3SA 3O3HA 3GSIA 1QSLA 4F36A 2I9SA 1RA7A 2VONA 4NLOA 3CJKA 2CH5A 3WXLA 1GOAA 4OI2A 3ENBA 5FPDA 3TUIC 2YKMA 3TAFA 3O4WA 3TANA 2E20A 3CETA 1OJ4A 3NVMA 2YHXA 2M8HA 2F7TA 5BPMA 1U09A 1OH6A 4ZCMA 1N8RT 4CLZA 2NUBA 3GV7B 3I0RA 3EN9A 3NCPA 2RKIB 4F8RA 2G8KA 2E1PA 4JK8A 3LP2B 4BRGA 2C1EB 1FE4A 4CZHA 3OTDA 2EKYA 4PKDB 1HNVA 3IC1A 1IM4A 1HNWK 1TVRB 3W9JA 5D0HA 3FLCO 3FKBA 4JK7A 4WFNQ 1RBLA 2OPSB 2L9NA 4KSEB 3TTFA 3CEDA 2P9GA 4OGEA 4JKGA 2HWTA 2FHJD 1X4DA 2I8EA 4J9UE 1FRXA 1CULA 3G10A 3GYNA 3T41A 4HVJA 3AXKA 2J7WA 3UKRB 2A41A 3FSIA 1DURA 4YQWA 3RSEB 1IBMF 3EZ5A 4OHZA 2UUCK 2BJ9A 2FZCB 4ICLB 3C6HA 3QESA 3GR1A 1IBLK 4Y2KA 1S10A 2J9DE 3ZSRA 1UZDA 3H2VE 2CGJA 3S6EA 4EFAC 1K1QA 5E3AA 2YHAA 4PWUA 3W3SA 4ZKAA 2RHSB 2RE1A 3D2WA 4DV6F 3HJFA 2QSFA 2G2OA 2HNDA 2ASLA 1FJGK 2FVRA 1G6BA 4CHNA 4KH5A 2OZMA 2C2KB 2J0XA 2XMWA 3H7HB 5DM6Q 4LF6F 5FLXY 3C19A 4UOHA 2W4DA 1SV5B 2LQ8A 1VRQC 4KV8B 4DBQA 4KHNA 2JH3A 3EE3A 2DT9A 4EP5A 1UA0A 4ZCLA 4M94A 2E2PA 3A8KA 3N4WA 1D9DA 3D1OA 3DLHA 3SCIE 3K17A 1BE4A 2A2CA 2X1FA 3SMZA 5LJVA 2KN4A 3BQ1A 1U1PA 3OL6A 1TL3B 5IT9Y 2M5YA 2XHWA 3US5A 2ZBQA 3J7YP 5AQNA 3O8MA 4ZVGA 4WCEL 1RWMB 4CCHA 4OPKA 1RWNB 4QS7A 2AD9A 1HMVA 1XR5A 2MZTA 1NJWA 4X4RA 1NMDA 3D7EO 1Y7PA 2RPIA 3QAEA 2EKNA 5MAOA 3NNCA 3WXKA 4B3RJ 2XB2D 3FFIB 2FLNA 1WF0A 2YQ0A 2OTJN 2O5DA 2OTJS 1RBTA 4B3MK 1XNQF 1Q78A 1UJ6A 3S3MA 4G6VB 4RW8B 2PO4A 3WXJA 3FBBA 3VQ4A 2J6SA 3FSXA 5GAGU 2W9AA 1K8AO 1G7CB 3WNFA 3LPYA 4LR8A 2OHDA 4CI0B 4O3PA 1U48A 3O9RA 1DFDA 3QLHB 2WSEC 1K0TA 1FKOA 1FFSB 4I6YA 1U0SA 3W60A 1M5PC 2GV1A 3C6AA 2ILYA 3K2PA 4ZIVA 1QZ6A 2DJWA 4TYAA 2J76E 4DX8H 4NLUA 4BR9A 4OLAA 3RAMA 5HMZA 1Y5IB 2QW9A 3S41A 1REVB 2M3DA 3PW2A 4W90B 3HVRA 2R2TA 1U0HA 2C3UA 3TUPA 4ZCIA 4JI4F 1SIZA 4EI2A 4V19J 2NYHA 4B02A 2YNGA 3ULDA 2ASDA 2IBOA 4CM2A 2EI5A 3AAWB 2E1AA 2KM8B 1MMNA 1TK8A 4NXMF 1EAYC 1H1VA 2CQ1A 2F4VJ 5HRRA 4B1ZA 2CJAA 5CZVA 3ZSQA 2VQEF 4E7IA 4RNHA 4H0OA 2LQ5A 1EXQA 3IBFB 5HBMA 4FPRA 1RUSA 2N3OA 3O80A 3DXMB 2AT1B 4ECXA 4ZVOB 3CT9A 4KHMA 4JKCA 5D0GA 1T9TA 1PCAA 2GELA 2J6UA 1KVKA 5TKWA 4OYWA 5FPNA 1NSAA 2LXIA 2YKPA 3DWLA 3CQ8A 4KRWA 1FDDA 4WFYA 3ZCMA 1T03B 2E2QA 4FS2A 4LF7J 4MDAA 3LWLA 3RUBL 2HRTA 4ZP8A 3VVUA 3KFWX 4OKJA 4JI6F 2RDDA 2QA1A 1N5YA 1Z2ZA 3QATA 3QO9A 1H7WA 4GVLA 1N32K 2GIRA 1IXKA 3H2UB 4CEFA 3MMAA 4DU7A 3OBYA 4IYQA 3WIUA 3EKUA 2DR5A 2RF2B 2B9YA 5KFFA 3OVBA 4NLTA 2HMPA 3NAEA 4RCHA 2AGQA 4K43A 1QQMA 1C0GA 2M52A 2O4IA 3UNYA 3ENWA 4Z94A 2RS8A 2P9PA 1YVNA 4DTNA 3AA2A 1HBOB 1XHXA 3QT6A 1BUPA 1R3NA 3VESA 1ACMB 3J7ZT 4CW7B 3AVHA 3KK2B 4QIEA 3DXKB 2BGGA 2CZVC 1N48A 1NBWA 4RW9A 4N5SA 4FLXA 3ZZUA 3HPOA 3EEQA 2ZM6J 5EWFA 5HL7L 5B0AA 3QNNA 1EKSA 3Q8VA 1NNEA 3HP6A 1WC4A 3CG7A 2UUAJ 3M2RB 5GAHU 3DGPA 2YX7A 2IYGA 4HKQA 4H0YB 4MFBB 2KVIA 3DOKB 4WCEQ 1L5UA 3QICA 3G6YA 4ED0A 4L3QA 1FRJA 2RQMA 3A8YA 2ITMA 3MN9A 1RAJA 4MYUA 3A5NC 4X4NA 3SV3A 5K9FA 3JXUA 3VGMA 2XYPB 2R9LA 1RWPB 4DPYA 3AVCA 4M3UA 3CD7A 1DQ8A 2FXUA 1N6QB 2OH2A 3LL3A 1TYQB 4JUZA 3AVLA 3BH6B 3UN2A 2POKA 3L0QA 4DZ6A 1ZA2B 3UCZP 2KVQE 4NO7A 3HOSA 4M41A 5CA5A 2I2YA 4P72A 2P9NA 1Q86T 1Q53A 1LWXA 1S6OA 2GQ2A 2M88A 1NU0A 4IFEA 2VWJA 3VGKA 3S9HA 4NXNF 4DR1F 1B64A 2BE7D 1VS3A 4X4SA 3CJKB 4ER8A 2LEAA 4AL7A 2VWBA 4C8LA 1RDRA 3EMTA 2YKMB 3T19A 1YZ6A 3QGIA 4MTPA 3FEXB 1RWVB 3NL0A 5EX0A 1T11A 3B54A 4KI4A 5IC6B 3I0RB 4B17A 4DTJA 3GG1A 2QLJB 2HHQA 4XAKA 2O8BB 3F5TA 2X6SA 5F8GA 4KTWA 2QC3A 4YDUA 3MTJA 4ED3A 1HNVB 2QXLA 4M3XA 2IJRA 2MYFA 1HHQA 2F8SA 4CIGA 4FNIA 3UI3A 4JI8K 2WONB 1KVIA 2W7AA 5D15A 3VQPA 1DKGD 3MXHP 3VQ8A 4RZRA 1IBKF 1UVJA 3R7NB 3MMCA 4EU0A 4YS2A 3LGMA 4KE5A 1IKXB 2CNNB 2M9KA 1G3OA 3EDRB 4JI1J 3CB4A 3TZXA 2C3PA 2QLFB 2B9WA 5KG0A 2F63A 1JLGA 4H4KC 5M1OA 2ZOMA 3NNHA 2KDOA 1S0OA 1BQXA 3U9ZA 3TW0A 1SJ1A 3TUJC 4NWBA 2PMWA 1VYAA 3K7RA 4E1JA 4NLWA 4O3SA 1S9EB 2HNDB 2OPPA 4JI5J 4F9OA 3RAQA 2XLJA 3DOLA 3NNAA 3NHGA 3SQ1A 2WTFA 3C95A 5CZ2A 3HVTA 2UXCF 1FESA 2PZSA 3B4MA 4I67A 3HHLA 3KKSA 4KHPF 2KRBA 3E51A 3IG1A 3HMJG 2QJ3A 4ID5A 1U1QA 4LF4J 3HSZA 3D3CJ 2A6OA 1S5JA 2GGPA 1GXTA 4I69A 2V9KA 4OIXA 5HJXA 4BRFA 3GWCA 2BQUA 4E2FB 1S72N 1S72S 4MT1A 2FQQB 2UV8A 2QA2A 2QL7B 3I4PA 3HL8A 1FO1A 3KHHA 3SDEA 3SQ4A 2C2DA 3OVAA 3DU5A 4WJBA 3M8SA 4CO2A 2QLXA 2GAGC 2YJFA 2F7VA 3UWTA 2UU9K 3IM9A 5B0BA 3PDNA 1EB0A 3V9XA 3M4XA 1WOQA 1WUUA 3HRGA 4J7CA 1W7WA 3RWUA 5AXKA 5LMNJ 2A18A 3KHRA 4BVPA 4BREA 4J9SA 1OYEA 4ISGA 1RWKB 2A0FB 1U1RA 2ZNYA 4DR6J 2YKOA 4X65K 4FW1A 1VQNN 3OSNA 3MUVP 5CXTA 3THYA 5LY3A 3LF0A 4RW6B 4YDXA 4J9PA 2NQPA 4NLXA 4DOZA 2HMIA 2Q79A 4LFCK 1YJNN 5LJ3Y 2EFOA 4B8CA 1MMLA 5HP1B 4CF1A 1KKHA 1ZZNA 3KWIA 1HNXK 2FC8A 1I94J 1U25A 4FPBA 4O8KA 1RLDA 4J2EA 3ZSVA 4NB4A 1SAZA 1AB8A 1U1LA 2DR8A 1SPBP 5E3CA 5B09A 2V8GA 4CO3A 4FJNA 2IIHA 1EWQA 2VG7B 3TJAA 4I7FA 3BF3A 2B6AB 4DL6A 2BUPA 2OSRA 1FT8A 2NS1B 1S6PB 3AA9A 2YNGB 4TN2A 1VC0A 1QVFR 1HARA 4X4TA 2MKKA 3F44A 2W9CB 4G1IA 3EICA 5C2CA 3EUNA 2DGSA 3IMXA 3HHNB 3RU0A 2P8IA 3KJVA 5HBMB 1Q95G 1H2TZ 5AQOA 1S1WB 1PIEA 4O23A 1YIJN 3CFRA 3AXMA 3Q22A 3AY9A 4ZVSB 4CGHA 3OQ2A 3ITHA 3PIPL 2NRRA 1V4TA 1SXLA 4E7HA 3WT0A 1ELOA 4NLRA 3H3NO 4OI6A 3CTRA 3OL7A 3IRXA 1EO1A 3D0IE 3BN7A 1HNZF 1WSHA 1H2VZ 4EO6A 2EX3A 1RXOB 2PA3A 1RWWB 4USMA 1RDAA 3BUZB 4FCYA 4PWDA 4F02A 1RT5A 1RBSA 2CAJA 4DQIA 2LXUA 1Z26A 4CEDA 1E6YA 2GFFA 3TAGA 3OLAA 1RA6A 3VGTA 1YXQA 3W8PA 4CJRA 2Q2RA 4OI3A 4M95A 3KK7A 3VEOA 3J7YU 1WBDA 3QO9B 4IWVA 4FNHA 3TA0A 3F73A 1HQEA 2GJFA 4CZMA 3MMAB 2QN6B 4CO0A 3FEZA 3WEEA 1YTYA 1FKAF 4FXDA 2I1RA 3W65A 2W1BA 3W61A 4IFYB 1GNKA 1S9FA 2AIRB 4FF4A 4FPIA 2ZBPA 4OV1A 3GONA 1OY6A 2DGTA 2GMLA 9RUBA 1B4SA 4O4RA 3SV4A 2R4FA 3ZZZA 2ASJA 4ILRA 4N41A 2WVFA 2E1ZA 2FZGB 1N34F 4CH7A 3EL2A 1YJ9N 3D9BA 1YJ9S 1T9XA 3KDOA 4OQJA 4FN5A 1NXIA 2E7WA 2BKPA 2VFSA 4FWMA 4MIWA 4CLKA 2AGPA 2YHWA 2CZ9A 4UTGA 4M3TA 4DLEA 1IBMJ 3L4QA 4JS4A 1T9WA 5AXMA 4OZ3A 2MEWA 5BJRA 2JLGA 4Y1CA 1Y10A 3LGNA 3MF5A 2FY1A 2EVZA 1Y0HA 1LNQA 1XNRK 2AA4A 4JI0K 3QZ8A 5KQDA 4P2XA 4FOIA 2HYIB 3MX5A 1Q8LA 4DV6J 4C9DA 2V4QA 3HZGA 5G0RB 3CJ8A 4IDHA 4Y28C 6FD1A 1AFJA 1VLOA 3SPYA 3AHPA 5A76A 1HRHA 3MAQA 2F9WA 3EE9A 4CFBA 4LF6J 2G1HA 3LO3A 3ZTQA 4BRNA 4FJXA 2OJ3A 2KQ2A 4DUZK 5B0EA 1S6QA 4ZA1A 3OVSA 5KT7A 3L7UA 4J9LA 3U1MA 5C7PA 4OMFG 1B3TA 3VF0B 5CD4H 5M1FA 2HHHJ 1MMDA 4C8ZA 2O8FA 4JI2K 4PG5A 4DTPA 1F9HA 3OS2A 3IXQA 5CABA 1WD6A 4ZIWA 1RLCL 2VG5B 2UUBF 3N6LA 1Q8KA 5KFQA 2HBRB 3WXMB 2MKYA 5DDQC 1J5EK 4OHVA 1NLKL 2EC2A 2BQRA 4JV5F 4WZQA 2JL9A 3O2IA 2FJDB 2G0CA 3VVTA 4FLTA 4Q7AA 3LANA 3D6MB 3Q7CA 4GVEA 4RO0A 4ZJLA 1KD1T 2OYQA 1IQTA 4RKUC 2UYTA 4RNFA 4K59A 4C1NI 1JL2A 5AQXA 4B3TF 4OYIA 1XNQJ 2UVUA 1CJVB 1T7PA 2KJVA 3R2CJ 2D0BA 1CC8A 4FP9A 2MLYA 4NX9A 1CXQA 1VBZA 3N9UC 3VHQA 4ED5A 4YOUA 3K0SA 1S77D 1IH7A 3CMAN 1O13A 1BD6A 1WSRA 4HT5A 4FW2A 3PEJA 1TUWA 4AFFA 1GMWA 4CM0A 2HHSA 3PIPQ 1VSHA 2XS7A 4RTFD 5EU7A 4CD1A 2KM8C 5AQYA 3A0IX 1F0XA 4GVBA 3Q23A 2CQDA 2MQPA 2BJ3A 3G4SN 3NCQA 2XMVA 3DAWA 2NNWA 4YOVA 4K0KK 1CXUA 4CH1A 3T5KA 2HQFA 4DR4F 2XHBA 1IQZA 5J1EB 2XMJA 3SJHA 2MGZA 1N33F 2E9RX 2OPPB 1WSEA 4JI4J 2AYEA 1G99A 3DRSB 4B9UA 5F0UA 2E1YA 4Y0FA 2XY5A 2FBVA 1LWFA 1DTQA 3HVTB 3DDIA 2XSJA 2M7SA 3W0LA 3HHLB 4NXMJ 1ZAVA 3EZOA 4B1VA 2EFQA 3IG1B 2WVEA 5FLXU 2VQEJ 4ID5B 2JNJA 1LV5A 2CVEA 2WB4A 1CJKB 4DR1K 3OS0A 1IKWA 2B8PA 4CHOA 1HWUA 2KKZA 2DCLA 2VKZG 4J9RA 3MUMP 2FJBB 4FBTA 4CZIA 2MZJA 4JLHA 2DEIA 3GSDA 2WB1D 3I6PA 1SC6A 1NPRA 1R8PA 1WEXA 1PO6A 4A48A 4KPYA 3MXJA 2Z0GA 1NPKA 3B78A 2DHHA 5IT9U 1YJTA 4DUYF 3TX0A 2Z4PA 3CIPA 2R2RA 2C22A 3HPGA 3DXBA 1DQ9A 3SUPA 3SDEB 2COLA 2IBKA 5AE3A 1CG2A 4IH7A 2E5IA 1JCFA 1ZPWX 1ZBFA 1ZBLA 4BRAA 2W2QP 4OLBA 4WFBQ 1JLEA 1F3VA 1RAOA 4GVMA 4Q0BA 3RG6A 5IV3A 4X62F 4FVUA 4TY8B 4IR1A 4JI6J 2RQ4A 4HTJA 2XRIA 3U1NA 1RHUB 3OFGA 2PFFB 4YHHF 3GMGA 3CJQA 1ZETA 3EVOA 1VRTB 4M5MA 4NLYA 3IRWP 2H3GX 3QBXA 2YI1A 1MWQA 3A2FA 4F4XA 2QYCA 1TAQA 2HMIB 5HK4A 3MI7X 3OYIA 5DK5A 1Z4UA 3P5JA 4DV5F 3HDSA 4DR7F 4IO8A 2KXNB 4Q5VA 4QR1A 5IM0A 3KWMA 4OX7A 1NOYA 3RRKA 1SUQA 3A13A 4WU3A 3LP3A 1NGBA 4IXCA 1DHMA 5CYMB 5KT6A 1T6CA 4X4OA 2BRLA 2ZJRL 3QZ7A 3MWTA 2CA9A 3TZYA 4LF5F 1TELA 2ZBRA 2VCPA 3MURP 2ABYA 2IM2A 1D09B 4OZ0A 1CLFA 4I7FB 2OMLA 4W98A 5KFKA 5F8MA 3MMVA 1KWMA 2PY5A 1CS4A 1DT9A 3AVKA 2Z56B 5K8PA 1A6LA 4BRMA 2IHR1 4I6AA 3IA0A 3D2FA 4BDPA 2Z8QA 4PR6A 3QIPA 3GR0A 1U24A 2JEFA 5C42A 4CERA 2AU0A 2XBPA 1VQ9N 1VQ9S 3KZBA 2ZH1A 2J0SD 1V5IB 4HI1A 2J9EA 1FDBA 4DV2F 1YTAA 5THWA 4IO1A 4CP5A 2QKKA 5H9EJ 1XMQK 3R9LA 3TQEA 3A3OB 1SKRA 4LF8K 1KQSR 4JD2A 2P9SA 3AVJA 1U26A 3IRXB 3ASMA 1E4FT 3DN9A 3P39A 1BQNB 1P1LA 1UA1A 2LLZA 3NLCA 2Y1JA 1W97L 3ENQA 2HHWA 3CDAA 5EUHA 1BCMA 1RT5B 5T7LB 4DSIA 3M8WA 4WE1B 4L76A 4A8WA 4CJUA 4U95A 2RRBA 1MN9A 1KC8O 5BXIA 1WC1A 1BXNA 2BW2A 1IBLJ 2NXJA 3GV8B 1BG3A 4ELUA 1RNHA 5K8MA 3BSAA 2J6TA 3CJ2A 2UVVA 3OY9A 3ZTPA 5A2QO 4FLYA 3FDSA 1SC3B 3WEEB 2DRBA 4LFBJ 4ZPDA 5D0EA 3KNGA 3ENOA 4H4OA 3BF1A 1EP4B 3AVBA 4WQ5A 1HBNA 3VQ7A 3ZZTA 5KFUA 3ID6A 5G4DA 4OX9J 2RQCA 4KKOA 3ZSZA 3KNAA 4OGCA 4W5OA 3OR2A 2F8HA 1RSCA 1TUVA 2ZGYA 5BPLA 1IBKJ 2DBBA 4FWLA 3D54A 5C2DA 1WNSA 4YY3K 1CC7A 5C25A 3FR0A 1Q7YO 3D67A 2DY4A 1M1KT 3NWRA 1UPMB 2IM3A 2IA0A 1FRIA 1UZHA 1YJWN 4B1WB 3CJCA 1JKHA 4U8YA 3VGVA 2K3KA 3B8HA 5AJ3F 4JKEA 3J80Y 4NLGA 4IG3A 3ZETB 4TU7A 2K1RA 3O1WA 4IDKA 2XZDB 4G1QB 2P9LB 1V5VA 1ZS6A 2D74B 5CHIA 3KG0A 3L95X 5HVFA 4BHQA 4A2AA 4NPOA 4RU9A 3QEXA 3L3VA 2CQ4A 2UXCJ 4BRHA 3R5CA 2ATQA 4UY8T 1Y5NB 5KFCA 4DV7K 4LF9K 2ZHOA 4QYRA 4M42A 3CPWR 3P5BP 2PE8A 4B3MJ 1HNZK 3KK1B 2DGOA 3OT9A 4NCAA 1GOCA 3ZT0A 3CCTA 1MW7A 1NGAA 2B4UA 3U02A 4ILJA 3PYFA 3DLGB 2R7QA 2O8FB 2EG1A 2QG9B 2DGUA 3VTIA 2FHKA 4Y6IA 2APOA 3M8YA 5F8NA 2AP1A 5FDLA 4LH4A 3AO4A 3C66A 2R8HA 4IOCQ 2DIUA 2KG0A 5AFUH 1B9FA 3UPFA 1C0TA 1FERA 2EFVA 3BDPA 2X1BA 3PFOA 3ISNC 2I0XA 1HJOA 6AT1B 2DH7A 3SJJA 3P8BB 2ZJRQ 2F1FA 1AFIA 1NK5A 4QZVB 2HEKA 2YVSA 1NCLA 3A5LC 4CLSA 3SPZA 4RBVA 2AKWB 1BIUA 1RT3B 2OEMA 3CC4N 3CC4S 3TR5A 2OSQA 3WNGA 3V6DB 3GJSB 5GIOA 2M4MA 1VJQA 2HLUA 3EYZA 3O4QA 5D3GB 1TTHB 4CBXA 1UVLA 4IEIA 3RGIA 4DR5F 2YKAA 4Z2XA 1ZAWA 3NGSA 4C11A 1NB7A 3CULA 2XYHB 2CPEA 4Q2MA 2CG4A 4QWAA 1I1GA 1MLAA 4FDFA 3FJ2A 4JYAJ 3U6FA 2C42A 3AA4A 2CPZA 2RUSA 4J2BA 1MG7A 4JV0A 2HVHA 1LW2A 4BGBA 3ZTRA 4FS1A 3EDQB 3KD5E 1X0FA 4FF3A 3QT5A 2MSSA 4B9QA 1CQMA 5AQUA 3OFFA 1FX4A 2OFGX 2W41A 1KCFA 3QEIA 1NZ8A 3PCOB 3DOMA 4J9OA 1MROB 1RTJA 1SZ2A 4J9QA 4O3RA 4B8AB 3JS6A 1F5CA 5FJ4A 2XYGB 1FA0A 5KOXA 2CJQA 4CT9A 2VQFK 2BUNA 1HPZB 2FGOA 4HCCA 2E5LF 2XSJB 3GLJA 3FZBA 2LEBA 4Y0WA 2K8GA 3NS7B 2DNKA 4PPDA 5AQIA 4DQ8A 1TGOA 3ULEA 3THVA 4FKXA 4IH6A 5J2NA 4EYIB 4DHYA 2LMIA 1B9DA 4I2QA 5F1XA 5K8NA 5H1SQ 2E1CA 1RDBA 5J2PB 2FUG9 2FY8A 2UUBK 5AZIA 4G3IA 3KLEA 1UOCA 2ZBIA 4NYZA 3I87A 3VEXA 5K8OA 3ZEUA 2F8TA 3GJQB 4LFAK 1NU4A 3PRBA 3KLHA 3A8IA 3TSQA 2FC9A 3S8SA 3H5YA 1CZ9A 2ZKTA 1JLEB 3D3BJ 4NLDA 4TQRA 3SCJE 5ADZA 1FNOA 4Q0BB 1RAGB 3PM9A 3TTDA 2HLTA 4CIOA 3NGUA 3CCVS 1QVFM 2PT0A 1P8ZA 1PSDA 1IJJA 3QINA 1RDDA 1XUPO 3KHGA 3O3GA 3UVJB 3THXA 2HVIA 5I3UB 4RLEA 3O5BA 3Q8UA 1O6XA 4ED8A 3ET6A 4NLVA 3HXMA 3V9WA 4A47A 5IS2A 1ESVA 2DNOA 1NDCA 2MY8A 4B3SF 5KFGA 4UOFA 2VICA 2ZZTA 2V8DA 4C98A 3MGJA 4A4JA 1U2FA 1VSMA 1NGJA 2HBKA 1U6BA 1E3MA 2BVZA 2ZC4A 2PGCA 1HW8A 5HANA 3CCJN 3CCJS 5EWGA 1P9YA 2CKWA 1RHJB 3SMSA 4M5IA 3MM7B 3T1AA 1L3TA 2E2OA 2KO1A 5KFAA 2IVMA 4M1KA 4BR0A 5LXRA 4B1YB 5DZ7A 4PCQA 1QVGR 1CS4B 1GH8A 2IMOA 2IDOA 4C6AA 2VPZB 1HPMA 1HLUA 2VBYA 3MUTP 3ZLJA 3D2FB 3BO3A 2UVRA 5C10A 3QRQA 4DX6A 3H08A 5C42B 3THTA 2BJ7A 3AJ1A 2Y0BB 3IS9A 3ISND 3QB0A 4MLHA 3WQPA 1QY7A 3ILJA 2OP5A 3FE1A 2BW7A 3DI6B 4FLUA 4ZOSA 3P4UB 5AQSA 2D0CA 1SQFA 3G6VA 3GIRA 2HRUA 3CJBA 1HX1A 1DLOA 2MKCA 3RB0A 4JD2B 2P9SB 1AA1B 1N5SA 2NLWA 3FC9A 2NR0A 1VQ4N 2YH0A 4JI8J 2KFZA 4O44A 1CQNA 4O0NA 1MNEA 4Y3CA 1BC6A 5EHHA 4PXDA 5HJYA 2GBZA 1XQIA 2LXFA 2HZVA 3IBCB 3W8GA 3MPYA 1OH5A 1XBWA 5M2RA 4K7QA 2X78A 5I42B 3A12A 5H9FJ 2HF3A 1Q81O 2DNQA 2YNIB 4BRQA 3WX8A 2HK2A 2MQQA 5AQPA 2B5JA 3B4DA 2AP6A 3MCPA 2BR0A 1WB9A 1X4CA 4A57A 3H20A 1UP1A 4FWKA 2W6LA 4W92B 1Q9YA 3G82A 1NGCA 2EBGA 2WW8A 3MZIA 2ALZA 1NHUA 1RTIA 2HHUA 2YV0X 2QT7A 2OZSA 3R5GA 1NJYA 3SQGA 3T6JA 1RT4A 2AJ1A 3SSQA 4AHTA 4TY9A 4FF1A 3DMJA 1HBNB 4FWOA 4KGVB 2V34A 4DEZA 3A3PB 2V7YA 1TKDA 2GW8A 1U47A 2BEFA 2J0QD 3HFKA 1X5TA 2LVWA 2QWPA 4JI7K 1WC0A 1C0FA 4QPXA 3OR2B 2W7PA 2Y0SD 1J6ZA 2VASA 2W24A 3MM5A 1OY8A 3GIKA 1KHVA 1RAEB 2O8DA 3LTOA 2RJZA 3SQOP 1S7HA 3KMQA 4KBOA 1HYZA 3JQKA 3HHLC 1DQAA 3VQCA 1C0UA 3GV5B 3W9HA 3C6TA 4CE9A 1JKHB 4KPCA 1NGIA 2E9TA 1LOUA 4AILC 1YWXA 4GKJF 2XY6A 3HOTA 2ZHAA 5T41A 2HFSA 1XEZA 2HFZA 3OA9A 1E4GT 3PJ9A 1VQPN 3EO3A 5GAHI 1VQPS 1VBXA 3OTBA 3ILLA 1HHTP 2PC6A 3PKMA 1IR1A 3I0SA 3MAAA 2OI2A 1HW9A 1X5SA 3NGZA 4AT1B 4W5NA 2CPDA 3R3LA 3JSMA 2KYXA 4X65J 1WSJA 1GLBG 4A8MP 3WQTA 1UVKA 3CVKA 4HACB 2MXYA 2D41A 4CF8A 4OPJA 4TYBA 5LT5A 2E5JA 4XIUA 1KAZA 2CQIA 3FCVA 1YI2N 1YI2S 4WFXA 3ISZA 1NK8A 2VF3A 4G1PA 2R7RA 4LT6A 2A42A 4CJ7A 1B0VA 2E7XA 3TUZC 3CJSA 4A2BA 3UE2A 2ASOA 3VF6A 5JVHL 3DFEA 3P45B 4X62J 2RHKA 1T3VA 3OTOK 2W8KA 1KFDA 3M5RA 3KWGA 1Q0NA 4ECYA 2ATLA 4FBUA 5FROA 1NKEA 3I56N 4YN3B 1PAUB 4ZK7M 4RNNA 3V1RA 4YHHJ 1HKBA 1YZ7A 5BR8K 5F0WA 2BXJA 3EVWA 2XGQA 2J5AA 1M1GA 2K06A 1IKVB 2FDNA 4JBCA 1FX2A 3J81O 4V1Ak 1UKUA 2BH1A 1NK0A 4OYZA 5U47A 2RE2A 2PSZA 4ZLJA 2V5HG 2B4JA 2QSWA 4CLFA 2Z1IA 1LW2B 5D78A 2CWKA 4DV5J 2EWSA 4DR7J 3TARA 4L73A 3AODA 2DIVA 2A40A 2CADA 4X4UA 4AXJA 4ECQA 2G9OA 3T5HA 3H3OB 4FLZA 1S9GA 3LQVA 2W9BA 2W6KA 1RBUA 2HHXA 4R79A 2OANA 2XNQA 4KHYA 3EVMA 2MQOA 3NMRA 2OUGA 4QAGA 4P10A 2Z1HA 5JS2A 5AE2A 4GC7A 5HRNA 2Q31A 4CLTA 4Q8FA 2D3ZA 1KVCA 1R7IA 1WACA 1Y5LB 2N4CA 4URGA 4EGLA 1M5HA 1NGFA 3HKWA 4AQYK 1VSIA 4EFHA 1EX8A 2GO9A 2WAQD 1SL2A 4OHYA 5J2NB 2QWLA 1VQ6N 1VQ6S 3DM2B 4CH0S 2QZ8A 3ILIA 3CGIA 2GAHC 4I2QB 3QNWB 2U1AA 1RDUA 3QWUA 1KXPA 3AD7C 4C3MA 1HUXA 3KVGA 5AZIB 1OQ3A 3KLEB 3CCSN 3CCSS 2R8GA 4ECWA 3OHRA 2ADCA 4CGGA 1OYDA 4P75A 3R1HA 2OGUA 3K59A 3KLHB 1AXQA 4AD6A 1W9HA 4AHCA 5HI7A 2NUHA 1J5OB 3JSBA 1VFJA 2LQ9A 4C3LA 3TSUA 4CK2A 3M30A 2QFIA 4CZLA 5IWAJ 1T3NA 1K47A 2ZZMA 3VCDA 4DSJA 1UL3A 3N79A 1H38A 1O1WA 3EXYA 1WG1A 5B0GA 3HHLD 4IOAL 2IVNA 3DRRB 2YKQA 5KGWA 5CCLA 4PL7A 4QPTA 2IVYA 3AB2B 3THXB 3W63A 2QM1A 3EGNA 2Z1GA 4DFJA 1ZC6A 4C23A 2L08A 1QDUB 3CCMS 4DTRA 2XMMA 4XTTA 1YRTA 3H40A 4RUBA 1JLBA 5AZJA 2AJFE 2XEXA 1KS2A 1TMMA 3FCHA 1XQSC 4IZ9A 4M8LA 5HMWA 1NDKA 2IVFB 4MKVA 5HRPA 1RGVA 3FQKA 4DUZJ 5IV4A 2C2NA 3IBWA 3IDHA 1KQSM 1ITGA 6FDRA 3M7VA 2CQ3A 2KYZA 3MPUB 2V4JA 3KLGA 3VEWA 3AA5X 4EHUA 2KHOA 3X3UA 2NRHA 2QL9B 4GMJB 1N56A 4B9LA 2HNYA 4DV0F 4N47A 4JI2J 3UFCX 1FK9B 3VF4A 2SXLA 3N01A 4RBUA 1PJ7A 2E66A 2E5LK 5JICA 1I6JA 1QTMA 1WOPA 3IAS9 1HHSA 3MMJA 4JP8A 3G2XA 5AJ3J 4EZ9A 1HWLA 2YKNA 2DEJA 2A6MA 2E5HA 2GHPA 3V6JA 5SWMA 1Q9XA 2YNFB 5JVHQ 2VOPA 4E7KA 1LEOA 3L2RA 1C1CB 3O6WA 3IS9B 3QSYB 1QJHA 1XERA 1C4AA 1VK3A 3NGRA 4JV2A 1RP5A 2DK2A 1VSKA 4CEOA 3PX0A 4E1MA 2ZITA 2PI4A 2R7UA 2R2SA 3O4NA 1DLOB 4FJ9A 2QV6A 3D6RA 1A5WA 4O44B 3QSIA 2DXDA 5IOLA 1KOOA 5KOWA 2B0GA 4URQU 3HBTA 2VPWB 2BKOA 1X9WA 3G25A 3OYFA 4JKHA 5KFHA 4DV3F 2QKBA 3SFGA 2UV8G 3RTVA 1IR2A 4K4TA 2B5JB 4LSNB 4QWCA 1OQ6A 4K0KJ 4H0TB 1Q1KA 4GKKK 4O55A 3PV8A 1RTIB 1O5JA 3ZSOA 1WKJA 3EGWB 3OYGA 4R8UA 3G71N 2LP4A 4KBIA 5E84A 1RT4B 2Q1NA 3KIOA 3QEWA 2WW4A 2XTJP 2AZ3A 2GX9A 3ZNJ1 3V6HA 3D6FB 4DR5J 3CPWM 2MKJA 1N36K 1URNA 2P9IB 3CJTA 1RFQA 2BOPA 3LALA 4DU8A 2YHBA 3AOCA 5C15A 2GVZA 4YR0A 4OYBA 3MM5B 4FJHA 3G8QA 2QTWA 4CTAA 1TKTA 3DNCA 5IT4A 5CH7B 1OKJA 4PYDA 1UAWA 2IDLA 1S1UB 1Q86O 5L38A 1DRZA 3FEYB 3SEOA 1BISA 2DHSA 3W2WA 4KI6A 4J5OA 3C6TB 2L48A 2QMWA 4DL0C 1G15A 3TZZA 3KUEA 4H4MB 4WTYA 2R8JA 5M1KA 3C16A 2DNMA 2BJEA 5ETTA 3M8ZA 2WOMA 2NZTA 3S3NA 4DR3K 3J80U 3J7Z5 2BOAA 3BV8A 4LR7A 2F40A 2IJFA 1Z2LA 1YHQS 3MR7A 4AHUA 2WVBA 3KLFA 3NRBA 3R6MA 5D8HB 2E29A 4KFBA 4B9SA 1RT7B 2CQCA 1N54B 5KT5A 2R3VA 4ZDNA 3FK4A 3D45A 3I0SB 4X84A 3PW7A 3ENHA 3MAAB 4QU7A 3ZSXA 1OMSA 1T05A 3TI0A 4CFDA 4PY5A 4IOAQ 2CWXA 4H0VB 4GV3A 3IUCA 4FJIA 5GAHP 2ROGA 3JSMB 4DSEA 5GMKa 4PXEA 4JI1F 3Q8YA 2HVZA 4WYBA 1YVFA 1VHXA 4EIAA 2HS3A 5DMRA 4KO0A 3NS6A 3ZO7A 1WHVA 4ZTFA 4BC7A 3R1LA 4ZVEA 5KG2A 1V3RA 4Z37A 4WTOB 5HN0A 4PXCA 1RU1A 1GLFO 1J53A 4JI5F 4RG8A 1S97A 5BYSA 3JS9A 3WDOA 2ATCB 4WP3A 2A10A 2CPXA 3M8PA 3RYLA 4A46A 4F26A 3V9ZA 3J7A1 1RTHA 2WK4A 4F7VA 1RCHA 1QQNA 2DTJA 4HHTA 4JKBA 1KAYA 3S01A 4O4GA 4LF4F 3CW2C 4BRKA 5KT4A 1XIQA 4FXVA 1EARA 2ZC3A 2ZH6A 4A5BA 4DFPA 4K41A 1NKCA 1GLLO 3CCUN 4QYZJ 1LWEA 2R7OA 2LDIA 4LRDA 3L7PA 1WAFA 2Y1IA 4YR3A 2NRXA 2YBVA 4PL8A 2ZE2B 1S1XA 1BIZA 4ZVFA 4FVMA 2G0IA 1SB6A 2DY9A 3AA3A 1BI4A 3CCWA 2VBZA 4NCGB 2VC0A 1T94A 4ID1A 1O0PA 3BR9A 5JXSA 4B3SJ 3PIOQ 2B4VA 1BWEA 1JB0C 3IKMA 1PJ5A 4ZVTB 4KTZA 3S3OA 5DRKA 2ZH5A 3P6YC 1RAAB 1RACB 3T1YF 1IKYA 5L46A 2V63A 1KVJA 1CVJA 1N4LA 5CYJA 3HHEA 2Q0UA 1S9GB 1UEKA 1FXRA 2W9BB 3DLRA 3OYCA 4S0MA 1RT1A 4BRCA 2CXEA 2MY7A 2H5EA 1YJVA 2Z30B 4PZVA 3JAMY 1M5OC 2DCUB 3P4IA 3UN5A 3K0JA 4KY3A 4KGZB 3CD6N 3CD6S 1DTTB 1JXLA 3MD3A 4ZP9A 4IR9A 1L3UA 4DV1F 1I94F 2OPRA 5T7BA 3SQ0A 3MX2A 3CJAA 4IRDA 1D9FA 1X60A 4MKYA 5AQVA 5HROA 2GIQA 2HBLA 2AHOB 2QMUB 2F9TA 4ZVQB 1BA1A 3AVGA 1GMWD 4OYAA 2B9XA 4DL2A 4A61A 3F2KA 4L3KA 1UEUA 1AT1B 4O0IA 4WXOA 3CIZA 5ADXH 2PFDA 2KFNA 1M0SA 1F21A 3QFHA 3NKYA 3SFUA 1VDHA 1AZSB 1UVNA 4BG8A 2XQCA 3QMLA 3ZT4A 2FVPA 3MR2A 3BSCA 4ZS6A 3BKTA 4P2MA 5EDWA 2E6MA 4WQ5C 5A8KA 4YY3J 4DR2F 5F9NA 3CXCR 4AF1A 2VHGA 2JJ4D 1GMUA 2ZH2A 1WDDA 3VEZA 1S0NA 2PN6A 3HZEA 3PX6A 1ATSA 4UF4A 1N52B 1K9MT 1SKWA 5I3QA 3A4TA 3K8VA 3M3ZA 4PUOA 1QVGM 2LEPA 2W2MP 3O08A 1T0TV 3OYMA 3GFXA 3T1HF 5HQLA 3DDNA 3MM9B 3HF5A 2IC3B 1TK5A 4YP3A 1JLQA 4QOZB 3OL9A 3P83D 2FHMA 3AARA 1JIHA 3AB4B 1JLBB 5AZJB 3K58A 2NRWA 1X3MA 1LW0A 4DV7J 3MOZA 4EO8A 1VC5A 1A5VA 3Q83A 5DZ6A 1PC5A 4B3RK 4RX6A 5F8HA 1AYEA 5IT0A 3VTHA 2V4JB 4DCJB 3CIMA 3L2QA 4MQ3A 4J37A 1RTDA 3RMDA 5DG8A 3B6PA 3H45C 5LJWA 4F0HA 4OX8A 2WUSA 3I32A 2HNYB 3P5TL 4BRDA 3VQAA 4K4WA 3CPEA 4K8ZA 3U9DA 2V67A 1Y00A 4JRQA 1Q18A 1CBKA 5KFXA 1GLEG 4FOEA 1FRHA 2KHCA 3F9KA 5I3PA 4JKFA 2GWJA 5L1IA 5GVQA 2AX1A 2VFVA 2E88A 4OJRA 2FB0A 4M5KA 4GKJJ 3UD5A 4OZ5A 2YKNB 2GVDA 2NZCA 4B9TA 1U8WA 2XY8A 4NMXA 4RNOA 2FJAB 1W26A 3FFKB 1F5AA 3LPEA 1SKUB 2FPHX 3M8QB 1RISA 3GP9A 2FVSA 3BZQA 3NWGA 4RUCA 1HWJA 1SL1A 3OJUA 1NSQA 4RWTA 2BANB 2UXBK 1FJEB 1HWKA 3KLIB 1DGKN 1TKZA 2JWNA 3AT1B 4H0XB 3TA1A 3R5AA 1Q8IA 1TL1A 3FGVA 4JHDB 4AH9A 1HWIA 4WIQA 4CJFA 1NH8A 2F4VK 2DY1A 3CJ3A 3UW1A 3V1QA 2ZJPL 4C8NA 3UCGA 1KR4A 4K4SA 5ETPA 4X64K 2MMYA 1C1AA 3R5DA 1VGYA 2BE2A 1PYSB 4K42A 3H8YA 4TLRA 2KFYA 4PABA 1U45A 5HQ8A 3WNHA 2VWKA 4FYWB 2H1YA 1HYSA 4KH0B 4DJBA 2EFPA 1RKIA 3HT3A 4LSLA 2V52B 2O01C 3MR5A 1VSLA 2RAQA 4X66K 1C1BB 1WEYA 4LF7K 3BF4A 3B82A 2HHHF 1GOBA 2VQFJ 1VIXA