3O9QA

Effector domain of ns1 from a/pr/8/34 containing a w187a mutation
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
121
structure length
121
Chain Sequence
PASRYLTDMTLEEMSRDWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEANDNTVRVSETLQRFAWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nonstructural protein 1
publication title A Transient Homotypic Interaction Model for the Influenza A Virus NS1 Protein Effector Domain.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Protein binding
total genus 34
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3o9qA00
2RHKA 4OPAA 3RVCA 3L4QA 3O9QA 3O9UA 3P39A 3OA9A 2GX9A 3D6RA 3KWIA 3EE9A 3F5TA 3O9TA 2KKZA 4OPHA 3M5RA 3O9RA 3P38A 3P31A 3KWGA 3EE8A 3O9SA
chains in the Genus database with same CATH superfamily
3HOSA 4RW6A 3U9ZA 4DUZK 5AZJA 4M3YA 1ZBUA 3DLGA 4FZXC 4U67L 1TK5A 1OKJA 2FSJA 3U9DA 1QS4A 4H03B 4Z4CA 2QXFA 4JI5K 3THWB 3VF6A 1CZAN 1GLLO 4CI6A 3CF5L 4NYNA 3D7EO 3BZKA 3U4LA 4FOEA 1I39A 2YNGA 3AV9A 3FFIA 3GL1A 3AY9A 3C6AA 3LL3A 3BDPA 4CZGA 1GLJO 2O8BB 1RBUA 2FC0A 1ASUA 2HBKA 3DAWA 3V9ZA 3D6RA 4A61A 2KHOA 4OKKA 1SAZA 3H3OB 2HMIA 3OYNA 3M8SA 2ASMA 1NGEA 4B9NA 4EZ9A 4W5NA 3VERA 1VSMA 3HPHA 4CGJA 2D0CA 4JI3K 3BY5A 4RG8A 4EHUA 3VTHA 3HI0A 3KKRA 3SAHA 4A2BA 3QERA 3AVBA 3DLRA 5AR0A 2XHBA 2VWKA 3VTIA 1HPZA 1P8ZA 2A5XA 3HSTB 1NGIA 4ID5A 3CJCA 1WSEA 2X74A 5F2RA 1HPMA 3H45C 4IZ9A 4Z4IA 4M41A 4BE1A 3OY9A 3TANA 3S9HA 2F96A 4BRCA 5J2MA 1Q18A 4YDUA 4Z0UA 3K5MA 3J8AA 1YUWA 2O8DA 1W2BM 4KHWA 1SKWA 1C0MA 3FZKA 3M8RA 1GLCG 2NRVA 2G8FA 3C94A 3NBPA 3OS1A 3J81O 4GKJK 1OVQA 5AQZA 3THVA 4K43A 1U48A 4YOXA 3SJJA 3H1VX 3QIOA 1N5YA 1FKOA 1VRTA 4WFAL 2W42A 5LMNK 4CJ5A 5C25A 2J4RA 3HRGA 4Q0BA 1NKBA 4ELTA 5J2PA 1Q82O 3VQBA 2G8UA 4WYBA 4H4OA 2FF6A 3TWHA 4I9QA 3SCXA 1TYQB 2QWQA 2YHXA 4DTPA 2D5RA 2PFUA 3RSEB 4FJ9A 1N33K 3AVGA 3NCIA 4HUGA 4B8CA 2NRZA 4JN4A 1L3VA 1CZBA 3V9XA 4WCEL 1U2VB 1K73O 1HNIA 4DU3A 1RDBA 2WBNA 3TTFA 5AQLA 4ELVA 1ZBSA 3NDKA 2CH6A 4F2RA 3TAGA 4ISGA 2NRHA 1VK0A 4AM6A 3TI0A 3CC7N 1MWMA 3A5OC 3W0LA 3M5RA 4CEEA 2HHTA 2W6KA 2VG6A 2NRRA 4IJAA 3R8EA 3MN5A 4BG8A 5BR9A 2HSTA 5AQHA 3UKUA 4LY7A 4EFHA 4TSXA 5JS1A 2FBVA 4A5BA 3MWPA 1BQNA 3EZ5A 3VN5A 3L8BA 2F4VK 4AHUA 5KRTA 2P9UA 4QOZB 3CM6A 3ZX3A 3L3VA 3AARA 3D2FB 1JKHA 4KHNA 3M3ZA 4CGDA 3SMPA 4AHVA 5CHIA 3LWMA 3NGYA 4IO8A 1U45A 4O55A 4L3QA 3I33A 4C8MA 2IVPA 4M45A 2D0BA 2F9TA 3D45A 1DGKN 3MCPA 4X62K 4RW7A 3D2EB 3ATVA 4CF0A 1D5AA 2V52B 4RW9A 3OYJA 1XMOK 3NGIA 3ZSRA 4YY3K 2IAJA 3O8MA 2VWBA 1NNEA 3V9WA 1N34K 3AO2A 3MX5A 5AQUA 5J2QA 3QESA 4K8XA 4PQUA 4KV8A 3G6EN 2GUIA 4CZEA 5FRNA 1C1CA 5JICA 5LL6Z 3ZX2A 1LOTB 3QBWA 3NHGA 3ULEA 3UB5A 2Y1IA 2BE2A 2NLXA 3NMUA 4IDKA 1K6YA 5AQSA 4BDYA 3AAQA 1WSIA 4BC4A 1RGIA 1DTTA 2Q0UA 4BRFA 4DR1K 3T7ZA 4HHTA 4FLYA 4W5RA 3ITHA 1RCHA 5HBMA 2OPRA 2OA8A 3AVCA 4O5BA 4FJIA 4B3TK 1VSJA 1EXQA 2KFNA 4CJTA 1RBVA 4WQ4A 3IAYA 2G8KA 3NFAA 1TUUA 1KXPA 4C8LA 1UA1A 4GW6A 4CBXA 1KTQA 4CEZA 2VGMA 3WQTA 1KCFA 5H1SQ 4CJQA 4C8KA 1IKVA 3LALA 3QBXA 4FWKA 4H0VB 2UYTA 4U7BA 3WXJA 3WNGA 4DQ8A 2A41A 4Y0WA 1Y64A 5GAEP 3SAFA 3EY1A 2P9PB 3SPYA 4KREA 3HOTA 4B3MK 1JLFA 3LANA 1Q8IA 4NO7A 4DSJA 4BREA 3KLHA 2P1JA 2ZGZA 4DTUA 3OYAA 4AILC 2E1YA 1RT4A 3NH2A 1QVFM 4N41A 4DR4K 1J6ZA 1S1VA 3CJ9A 1U4BA 1BWFO 3HSCA 4BRIA 4PKIA 1JLBA 4PUOA 2HF3A 3HT3A 1VSKA 2NUBA 3THXB 4CEFA 5KI6A 4PKGA 4CF1A 3AO5A 1VRUA 1KVAA 3SV3A 2P9SA 4CEBA 4AM7A 3V9UA 2VYPA 4NCGA 1BGXT 3SQ4A 2XO7A 5KGWA 5E26A 2QXLA 4H0XB 3T3FA 4CGIA 3KTQA 3AO1A 2HF4A 4E19A 1YVUA 2O8DB 1B9FA 4F3OA 2EHGA 2G8HA 4FWRA 2D1KA 3LDSA 4MDAA 4CZHA 1Q86O 4KHQA 4IOAL 4WQ4C 1YJWN 2HW3A 4B3SK 3H08A 1KAYA 3K9JA 4M7YA 3HM9A 4BDZA 2HOEA 3M6GA 4PA1A 3VQ5A 1V4SA 4DV7K 3WXMB 4ILHA 1X9SA 4BRAA 2NRTA 4OLAA 3CCJN 3G10A 4CECA 2CGLA 4M3UA 4B9QA 3HBTA 3CJ7A 4CE9A 4JLHA 3WXLA 1ASVA 5KPZA 4E7IA 3HVTA 4E7HA 2OPPA 1ATRA 1NBWA 2Q0RA 2P9IB 4IEEA 1FKPA 3TAEA 5ADXH 2YNIA 3VQAA 3VA3A 5AQGA 3QMLA 5DM6L 5AQXA 1QSSA 1IV0A 3U6FA 3ZCMA 3UE5A 2KW4A 5I42A 5HLFA 2A1SA 4H5WA 3I0RA 1RDDA 3L0QA 3SQ1A 3O9TA 1XMQK 5HRNA 5M1FA 1S1TA 1DLOA 4CFAA 3AA4A 2NNWA 1CXUA 1L5UA 1XHZA 4JS4A 4FZZA 4KBOA 5EXWA 2PZSA 1VQPN 3CFPA 3L2QA 5ADXA 1CXQA 2YCHA 3LP1A 1OH7A 1LWFA 1KD1O 2VQEK 4DTMA 4G9ZA 3UKUB 4BR5A 5KPRA 3KLFA 3N4QA 3CCQN 1TYQA 2ASOA 5TKWA 4FJHA 1C0UA 1U04A 1XHXA 1NGDA 4N5SA 3L3UA 5HRPA 1U2VA 1RDUA 4JK9A 1O1WA 3T69A 4CESA 2Z1HA 1FW6A 4E7JA 4JKAA 3KLGA 2X78A 2V51B 1T8EA 4JKGB 3QNNA 3QIPA 3R1XA 2XY5A 2A6AA 2KZMA 4FLWA 3AGKA 2G8IA 4IBNA 3ZYYX 4BRPA 3F73A 3QFUA 4XEIA 4DV0K 4X64K 1RT2A 4FK2A 3AVIA 1RT7A 2IVOA 3BZCA 3SBTA 2E4LA 5JLFA 3SUPA 1KFSA 2HHUA 4CJSA 3SV4A 1T44A 2Z1JA 1BA1A 1G99A 4BGBA 1VSDA 4FW2A 3ZETB 2BANA 2YKNA 2HHQA 1XC9A 4DR7K 1VQMN 5AQQA 1YIJN 1LAWA 4M7XA 3TR8A 4NCAA 3AVJA 4FLTA 1WAFA 3D2FA 3U3YA 1TAQA 3A5MC 4B9SA 2Q36A 3O4QA 4FJGA 3PIOL 1IKWA 2JWKA 1EP4A 2P5OA 1JXBA 2JWLA 4X65K 1Z05A 2G8WA 1SKSA 1W0HA 3ULEB 3HVRA 4BR0A 4DTXA 1YTUA 4NLCA 3D2EA 4NXNK 1IKXA 1XUPO 1Z6RA 2VGNA 1SL1A 3PX4A 3PLAA 1QE1A 3ENOA 3CETA 3GOIA 3VQ6A 4B9UA 3L4QA 2WFBA 4BVOA 4CF9A 4Z4FA 1C1AA 4B1YB 4FZYA 3E66A 2OTJN 4R5PA 1NKCA 4V19S 3QINA 4O44A 4DMNA 4EP4A 3SZ2A 2AJQA 3ULDA 3DLHA 3G0ZA 4O5FA 4GV3A 1K8KB 3HTVA 1GLBG 3EO3A 4F4KA 2BGGA 3HP9A 2Q2RA 4QS7A 3RMCA 3IMXA 3J7YP 1JCGA 4B1VA 1TKTA 3KD5E 3P39A 3QFPA 5CYMA 3KIOA 4FJ8A 1NK4A 2PY5A 4KH4A 1RFQA 2YJEA 2XY6A 2PYJA 4IG0A 4DV4K 4MO5A 4BWMA 3NH0A 2QWMA 4O8UA 1HLUA 3KWGA 4EIAA 4DFKA 4CJFA 3HZ6A 3CYMA 4FJJA 1W7AA 4KH5A 2E2PA 4OJRA 1JLGA 4W5TA 4BR9A 3FZLA 4C8OA 3JXUA 5GADP 3LDPA 3QEVA 3BUZB 1E4FT 5BREA 2HHXA 2XY8A 1ZC6A 1GLDG 2DFFA 2P9SB 2P9PA 4LD0A 1YITN 3C65A 1KFDA 1B9DA 3NF6A 2BDPA 1UAXA 4JKHA 2IIRA 3CJBA 4CJVA 4YOYA 1RTDA 1YI2N 1S72N 4EHTA 5C2DA 3CMAN 1X3MA 2Z1IA 1S5JA 1BQMA 4H4MA 4XH1A 3RR7A 3OTOK 4FWLA 5BR8K 3G4SN 3ZT0A 4QS8A 4DCHA 1VQ9N 1IKYA 3VEYA 5F1XA 3THXA 1YJ9N 3SPZA 4BRKA 4CK3A 5BN8A 4CFDA 1J53A 4B1WB 4X66K 3OYLA 2W6LA 3VQ8A 4DU1A 2XRIA 3ID8A 1J54A 4ICLA 4CHNA 5BPMA 3L2RA 4JKCA 1OH6A 2YX6A 1P90A 3ATUA 4BVPA 3ZEUA 1ZYQA 1YAGA 3C7NB 2QK9A 3F9KA 1KLMA 3I8DA 3A2FA 3KLEA 3V4IA 1TKXA 4MDBA 3VGMA 4FWNA 2I5JA 2E2OA 3V1OA 5JS2A 3SUNA 3K5NA 2IGIA 5BRHA 3OJSA 1NGAA 3OA9A 4BWJA 3ZX0A 4DQRA 2HNZA 1ZBLA 3HL8A 4E0DA 4KFBA 1N32K 1RT1A 4ZHRA 1LV5A 3KJVA 2YI1A 4NCBA 2WOMA 4FOIA 3OBWA 4KPYA 3KLIA 3RVCA 4CVNE 4GMJB 3KD1E 4FJMA 4NXMK 1HYSA 2P9IA 5E41A 2KZZA 4M3ZA 2F8TA 2WUSA 2QKKA 4DHYA 5AZIA 2D4WA 3BF3A 3O5BA 1JCEA 1HKCA 3ID6A 3NF8A 4K42A 4RTFD 4OKEA 3NH1A 3DOLA 4E7KA 3MXMA 4QS9A 2FBTA 4I7FA 2D0OA 1NJXA 5M1QA 4IO9L 4NYFA 3RMAA 1NOZA 2E88A 4KTZA 3CCSN 4FWMA 1NJZA 1WUAA 1NJYA 3R9PA 1X9WA 2IVNA 4JI2K 1J5OA 4QAGA 1JJ2M 4H5NA 4LF6K 3O08A 2F7TA 4PL7A 3MX2A 1ATNA 3LPUA 4LF7K 1BG3A 4IDHA 1HX1A 3IG1A 4A62A 1NK8A 1C1BA 1S22A 4YDUC 3TABA 1RTIA 1DKGD 2CGJA 3HYFA 5CY4A 4LF5K 3FGUA 5FPMA 4CZMA 3HPOA 3CD6N 2AP1A 3IRXA 2QKBA 2QWRA 5M1OA 4KTWA 4IEIA 3EKUA 2HBLA 4CJPA 1D4XA 3HXMA 4JRQA 4JKGA 4M3XA 4CF8A 3MXIA 1D9FA 5AQTA 5AQVA 4F2SA 3G25A 5AQMA 1VAZA 4MO4A 1NMDA 1WSFA 5BN9A 3PO4A 2QWPA 3H3NO 4DSKA 3EKSA 1SV5A 2Q1NA 1WN7A 3ZT3A 5AQWA 4MFBA 1EQYA 3MWTA 3CCLN 4B9MA 4DWIA 5JVGL 4LH4A 1S1XA 3ZETA 2PBDA 1NGCA 4CK1A 2HVIA 3CXCM 4C8NA 3LM9A 2W41A 3B8AX 1C0FA 2O8CA 5M1KA 5JLHA 4DS5A 4CHZA 3OYFA 2VG5A 3K59A 2GEMA 4A59A 4E1JA 3V81A 3FLCO 4K25A 2GBZA 3OYGA 3F9MA 1VQNN 5GAHP 4KH6A 1L3UA 3OYCA 4BR4A 5C12A 3T1YK 3DRSA 2HHWA 4CHQA 5EX5A 2Q31A 3W3DA 4OPAA 1SS6A 3MCAB 3AAPA 1TV6A 4J8FA 1NM1A 2O4GA 4BRGA 2KKZA 2FBXA 1WNSA 1HJRA 5HRRA 3O1WA 2E2NA 2ZM6K 1LCUA 2X6SA 3IDHA 4M63C 4BDPA 4H0TB 3DJCA 4E1MA 5FRMA 3VEOA 5SWMA 3CFOA 5DK5A 1K8KA 2YHWA 4HUFA 1Z25A 1RTHA 4FLUA 4H5TA 3ZT4A 4UQGA 5EVZA 2I7PA 1ILYA 3TPQA 5LJVA 3DRPA 3CJAA 3TSQA 1VHXA 3OS0A 4DV6K 3DXKA 3DLLL 4OO1J 3MN7A 4FJ5A 2FLOA 4FWSA 4BQZA 2QWOA 3TU5A 4IOXA 1BIUA 3VF4A 1QZ5A 3H6EA 2UXCK 4CEOA 4H0PA 3M8PA 1BCOA 1QQOA 5FPNA 2IC3A 1WBBA 1RT6A 4A5AA 3WNFA 4LF9K 5FROA 3UKRA 4LSNA 3ENBA 3LPTA 4I2PA 3CC2N 2UXBK 1EWRA 4CJKA 1NGBA 3WXIA 1FXXA 1NJIO 3FE1A 3VESA 4CIFA 4XH4A 2G8VA 5IWAK 1T6DA 4DV5K 5LY3A 3O6WA 1H1VA 4M42A 4FM0A 4CHPA 3I0SA 3LP2A 1JCFA 3VQ9A 4DLGA 4KKOA 3ZEUB 1NLVA 4DQQA 3DI6A 3EYZA 4HWIA 3QEWA 2GWJA 1ZBFA 3P38A 4FWPA 3KVGA 3D0PA 4FM1A 1EWQA 3T1HK 1C0GA 4AHCA 3SQ0A 2UUCK 1YXQA 1L3SA 4DKWA 3SLCA 4FPAA 2HMPA 3WXKA 4PHTX 4CJWA 1LAVA 3NGZA 4E1NA 3K2PA 4JNEA 1GOCA 3OYKA 4YNQA 2BH1A 3NE6A 1BHLA 1GOAA 1RT3A 3MEDA 4BR2A 4J2EA 2HHSA 1KSPA 3VQDA 5KPTA 4H5VA 3CM5A 2AA4A 2B5JA 3C7NA 1KVCA 3P1GA 4DQSA 3H46O 1OH8A 2ZD1A 3K9KA 3ZSZA 3E01A 5AZIB 4CGGA 3QICA 2HB5A 5ELZA 5I3UA 1ZBIA 4CJUA 4CD1A 4B3OA 5AQPA 1N36K 1UOCA 4ILJA 3S41A 3O3HA 3AVAA 5LJWA 2EX3A 4FW1A 3TAFA 1NK9A 1JLCA 2Y1JA 3KK7A 4CW7B 2NRWA 3SYZA 4B1ZA 4DFPA 2RHKA 1TAUA 4B1UB 4FM2A 2E5LK 4FVUA 2FSNA 2ZWHA 3QEXA 3CMEN 2OANA 3V1QA 4CBUA 1TKZA 3BF1A 3LWLA 4HUEA 4B9VA 1BO5O 1JXEA 3MEEA 4CJEA 1D8YA 4XIUA 3BP8A 3M8QA 4BRDA 4CIEA 1RNHA 2FBYA 1S3XA 4GVEA 3VQPA 4DTJA 1YJNN 4JI8K 3ZT2A 3THYB 4CK2A 4KTQA 2OYQA 3CERA 4IOCL 4CZJA 3DOKA 1IH7A 3VEWA 3OYHA 3OBYA 3O3FA 3JYTA 2VWJA 2YHBA 1VQKN 3CHWA 4B8AB 5BRDA 4AQYK 2WTUA 3AVMA 1YT3A 1VSIA 2GV9A 3PIPL 1LW2A 1D9DA 1BU6O 3EE8A 3PX0A 1XQSC 1E4GT 3TAMA 4ID1A 3BEXA 3HJFA 1X9JA 3O9QA 5T7BA 4HVJA 4LH5A 3I56N 1VQ4N 2HHVA 1GOBA 3G71N 3CJ1A 2E8AA 3CCVN 5AFUH 2HHHK 4YOTA 3LAKA 4CGFA 3S3NA 4FK0A 3L2UA 4B3RK 4YFUA 3JS6A 1I3AA 2E20A 4M3WA 3AVFA 1IBLK 2B4JA 3U8XA 4CJ3A 2O8CB 3NVMA 4FXDA 4DLEA 3WEEB 5C15A 2O8FA 3MXJA 1QZ6A 3LAMA 3NF9A 1HNZK 1BA0A 2X6NA 4GY2B 4JV5K 3L2WA 4DUYK 1X9MA 3ALYA 2IDOA 1NJWA 3AA5X 3AO3A 4IKFA 2XY7A 3F2KA 3MN6A 2P9LA 3OYDA 3VQQA 1SL2A 4JD2A 3Q7CA 3RRHA 4EZ6A 5EOYA 4DSLA 2E2QA 3ZSOA 5AFUA 4DTRA 3LM2A 1GLAG 5GAGP 1SL0A 2PYLA 3RRGA 3FZFA 4LC9B 4CERA 5EU7A 5HROA 4FJLA 1T3VA 5E84A 4H0YB 2OPQA 1BI4B 1UA0A 4JYAK 5SZTA 4DV1K 4LFAK 1RBSA 2A3ZA 4CHYA 5HOOA 1S6PA 2KLAA 5IT9O 4FSVA 4A57A 4DQIA 4IWVA 1NGGA 1NK7A 2D0AA 3LP3A 4BQLA 5DM7L 4WFBL 1T7PA 4JKDA 3WT0A 1N8RO 4YOVA 3SBGA 3DLBA 3PUFA 1HUXA 1HYVA 2QI2A 4OLBA 1QVGM 4KB1A 4IFYA 3DXKB 3PSIA 3SUQA 4NLBA 1QHAA 3VA0A 2P9KB 3OJUA 2F9WA 3KHYA 1EETA 4LF8K 3QLHA 1IBKK 1J9AA 1RBTA 2YHAA 1Y97A 4DQPA 5CE3A 1JLAA 3TAPA 1NG9A 5C0YA 2ITGA 4M3RA 3E1YA 1HQEA 4CCHA 2UUBK 3E9PA 3QB0A 3UKRB 1ASWA 1VQ8N 1VSEA 1BL3A 4FL9A 5FPEA 3DM2A 3M1FA 4Y1CA 1BOTO 1K8AO 1JL1A 3ASMA 2UXDK 3GBTA 1HNWK 1S9GA 5AQYA 5C10A 1M1KO 4F8RA 4IG3A 2IOCA 1KRPA 3CFRA 2GWKA 1WB9A 1DEJA 4JI6K 3VOVA 2O4IA 4HCCA 4ILGB 3MK6A 1VQON 5GIOA 3PV8A 3C95A 1R0AA 4YOUA 4C1NK 3CG7A 3VEXA 2DPNA 3E9OA 5J1EA 1QHTA 4ISEA 1DTQA 2HBMA 1BUPA 2EWSA 3A8YA 4DSFA 2DFHA 5GINA 3CQ8A 1WAJA 4GV6A 3CPEA 4OGEA 4FJNA 3MDQA 4CEQA 3N4PA 1LWEA 2VG7A 4FWOA 1HJOA 4IFVA 1GLEG 1IG9A 1RILA 4OX9K 4FO0A 4PWDA 3OVNA 3PY8A 4AHSA 2RF2A 3VETA 1HKGA 2YHYA 1BIZA 1NGHA 4DV3K 4DF4A 4CFCA 4DSIA 4KHUA 1Q9XA 3LDQA 2Q97A 5CYQA 4FJXA 5AQOA 4CZKA 1HNXK 4K0KK 3VGLA 2W40A 3DWLA 1YF5L 3V9SA 1O13A 4DFMA 4MLHA 3HM8A 4RW4A 1TKDA 1XC3A 3SAGA 5HP1A 3J7AP 4WF9L 4JKFA 4FWQA 1CZ9A 2NRXA 3OYBA 4W5OA 3CQYA 4GV9A 4BRLA 3C6TA 1FJGK 3VEVA 4CZFA 5I9EB 4DF8A 1T05A 3ZLJA 1EO1A 5CR4A 4JAXA 1WOQA 3O4NA 4YOWA 1TUYA 1TK8A 4XH5A 3FFKB 4Y1DA 1NWKA 4N47A 4CGHA 3K5OA 5F0XA 1S1WA 5AQNA 1N6QA 2A42A 3RR8A 3B6PA 4AHTA 4M3TA 3KK1A 4B08A 5KQDA 1ESVA 4NB4A 3O4WA 3IS9A 4FYDA 3KK2A 1SQKA 1QQMA 2ZE2A 1IBMK 1KQSM 1RBRA 1QQCA 2JGUA 3J7ZO 3PX6A 4QCLA 5HRSA 3RWUA 1JLQA 3HO1A 3EE9A 3VQCA 4CJ4A 3OYEA 4DR3K 1VSLA 1CLQA 4Z4HA 3C6HA 3THYA 3SI6A 1VQ6N 3IKMA 3IUCA 2DTUA 2R7YA 1Q81O 4CHOA 2VCPA 5FPDA 3MECA 4KO0A 1ITGA 4B9TA 4KB0A 3O9RA 4BACA 4JI7K 2GUPA 2QWLA 2ZF5O 2NZTA 2CGKA 4E89A 1A5XA 1ATSA 1WSHA 2YJFA 4CIGA 5CZ1A 2O8EA 2O8FB 3Q7BA 2P9NA 4KHPK 4DTSA 3I8BA 3CCEN 3ENHA 1KVBA 4C1NI 5K14A 4WFNL 3KZBA 5M1PA 2FSKA 2DFEA 3GG4A 4BR7A 1WLJA 1Z26A 2P9LB 4JD2B 4Q5VA 3P31A 4BE2A 2QW9A 3H1QA 1HKBA 1RDCA 1QQNA 3RMBA 3ZSYA 4DU4A 3MEGA 3LZIA 3LDNA 2OTLN 3MMVA 3K57A 5TKYA 1HYZA 3VGKA 5AJ3K 1HQUA 3EL2A 3A5NC 1B92A 3WEEA 4AH9A 3UIQA 3DXMA 4AHRA 4BG9A 3CIPA 2BUPA 3CCUN 4HTLA 5B8HA 4H0OA 1BCMA 4MQ3A 4JK7A 1ZXOA 4CD3A 5J2NA 1XNQK 3CQXA 4L8RB 1NGFA 4BY9C 4I6MA 3WNEA 4CEDA 3AVLA 3P5JA 3SUOA 4J2DA 4JHDA 2H3GX 4WQ5A 4OPKA 4PL8A 1K9MO 1A5VA 4F3TA 5AQIA 3JAMO 2QA4N 3AA2A 1REVA 4BRMA 4FLXA 4JI1K 4KHYA 1S1UA 3T1AA 2ASPA 5EY4A 1BDGA 4JI0K 4OPJA 3ZT1A 1TGOA 4OPHA 1BI4A 4C23A 3FR0A 2HVHA 1C0TA 4JK8A 5FDLA 1E3MA 2ETJA 3WNHA 3B6OA 3GE1A 3V1RA 5KGXA 2DY4A 4HCBA 3OS2A 1NKEA 4JS5A 5JMVA 2P5GA 4ZTFA 3C0BA 4JKBA 1WSJA 1NK6A 4F9OA 4WE1A 4CZLA 4O0JA 1U47A 3QEPA 3EN9A 1KAXA 1JLEA 1SKRA 4LFCK 3OYMA 3NF7A 2HBJA 4OKJA 2OZSA 3QNOA 4JKEA 3QO9A 4KAZA 5AQRA 2P9KA 3C6UA 3TSPA 4BROA 3S3OA 1LWCA 3VQ7A 3FZHA 5AZJB 1TL1A 3I55N 1A5WA 5HL7L 4BE0A 1HRHA 4CJLA 4DFJA 1NU0A 3SJHA 3LZJA 4BC3A 1TL3A 1TVRA 4A2AA 1U49A 1J5EK 1X1PA 4K41A 3L6QA 3ZSVA 5BRFA 1KLNA 1Q7YO 5AQKA 3SQ2A 3SNNA 1MU2A 3VF2A 1YHQN 4PKHA 4DSEA 1W9HA 1YVNA 3HPGA 1RDAA 4OGCA 2BTFA 3L4IA 1OVYA 4CFBA 2GX9A 4BC5A 4WQ5C 1EX4A 3LDOA 4DR5K 3RTVA 2KQ2A 3ZSWA 2E6LA 3THWA 4GKKK 2JLEA 4LF4K 1IO2A 3CCMN 1T03A 3R6MA 4FLZA 4B9LA 4ZTJA 3ZSXA 3AGRA 4GNIA 4J2BA 1NOYA 2Q3SA 1ZBHA 3FZMA 1HR0K 3KKSA 3LP0A 1VQ5N 2O8BA 2QEXN 1SUQA 5AQFA 3V6DA 3OYIA 4H5RA 3VQ4A 4GVMA 4BRNA 4DTNA 3MN9A 5GIPA 4IXCA 3RMDA 4ELUA 2YKMA 4JEPA 3VENA 4DR6K 2HNDA 4CF2A 4PY5A 2GTDA 3SK3A 3K5LA 1QTMA 3DMJA 3T19A 3S3MA 2ZJQL 3TTDA 1C6VA 3DRRA 1NMNA 1WBDA 4EAHD 3O3GA 3O9UA 3OW2M 4H8KA 4DB3A 3MAQA 3VQEA 2VQFK 2FF3B 2GELA 3OHRA 2OCEA 4FJKA 2YNFA 2RN2A 1QSLA 4RWTA 3ISNC 2V7YA 3VPZA 4N56A 3A0IX 4R79A 4CJ7A 4ISFA 4JI4K 3O9SA 3BGRA 3L2VA 2IS3A 1IJJA 4DS4A 4FCYA 2P51A 3EZWA 3K58A 5AQJA 2ZGYA 4KI4A 4B1XB 4W5QA 2E6MA 3ZSQA 1DT9A 3E9LA 2Z1GA 1NK0A 2ATQA 2PAVA 5KTQA 5FLXO 3TARA 2I7NA 4G1QA 1L3TA 2E1ZA 4BC2A 3QEIA 3CC4N 5C42A 2RKIA 3P4IA 1S6QA 1YTAA 2YV0X 4E3SA 3PO5A 1MDUB 4K8ZA 4KHSA 5BPLA 1NK5A 2KFZA 3NVKA 3KWIA 3WUHA 1NGJA 3F5TA 3HP6A 4I2QA 1RDWX 4RCHA 3WQUA 1S9EA 2A1RA 1XNRK 2YNHA 4AF1A 4HTUA 1R59O 3CCRN 5LMUK 2O8EB 4J2AA 3RSEA 2P9NB 3AA3A 2OZMA 4CBWA 3K0SA 1FK9A 4DG1A 4DV2K 1VQ7N 3IFRA 2ZQBA 2ZJRL 2P9UB 4O4GA 4FK4A 3AVKA 3VEZA 4MLEA 4YHHK 3DYAA 4BGAA 3TTCA 4EP5A 1X3NA 4DR2K 4FJ7A 1VSFA 4CJRA 4YORA 1U6ZA 3O1BA 4LFBK 2D0PA 1TK0A 1Q9YA 1IG8A 2LSNA 2QWNA 3J80O 1G15A 3DXMB 4FVMA 4KRFA 2ITMA 2OPSA 4DTOA 4IFEA 1W97L 3QETA 3KK3A 1JL2A 5CZ2A 5KQ8A 3AO4A 3SMSA 2F8SA 1RTJA 2V7ZA 5MLCQ 4CEAA 5JVHL 4I6MB 1BISA 3AVNA 4JHDB 3PSFA 1GLFO 4FLVA 4Z4GA 4BRHA 5BPNA 1HMVA 4RW8A 1KC8O 5A2QO 3EEQA 3P83D 1WSGA 3DLEA 2RPIA 5D3GA 4JRPA 5KRSA 2CH5A 1LW0A 3CI5A 3R3LA 4Z4EA 2UUAK 1XWLA 1MA9B 3VMFB 1KAZA 2WONA 3JSMA 3QDKA 4LSLA 4CZIA 1HNVA 3U3GA 1T6CA 3CPWM 5C24A 3TAQA 5DMRA 2HNYA 5C2FA 2UU9K 3HK2A 4Z94A 4N76A 1QSYA 3LDLA 4FPBA 2ZJPL 1UWBA 1VSHA 3GDQA 3NAEA 2WC9A 2B6AA 4O8KA 5M1NA 1M90O 1VQLN 4IJNA 4I9LA 1RT5A 1XI1A 1OH5A 2FXUA 1V4TA 2A40A 2QM1A 2QTDA 3DLKA 1SZ2A 3AVHA 1MWKA 4BRQA 1F21A 3O80A 4E7LA 1I94K 4O0IA 1EKEA 3TSUA 4KI6A 4UY8O 4OVLA 3A5LC 2KTQA 2RE2A
chains in the Genus database with same CATH topology
2QWOA 3HOSA 3TU5A 3U9ZA 1NGDA 4U7BA 4IOXA 3C6HA 3VF4A 1U2VA 5AZJA 1RDUA 1QZ5A 4JK9A 3T69A 3H6EA 1VQ6N 3IKMA 3IUCA 4U67L 4H0PA 1Q81O 1OKJA 2FSJA 2VCPA 3U9DA 4H03B 4JKAA 1QQOA 5FPNA 5FPDA 2V51B 4A5AA 4JKGB 3VF6A 1CZAN 1GLLO 3R1XA 4CI6A 3CF5L 2A6AA 3O9RA 3D7EO 3U4LA 2GUPA 4FOEA 2QWLA 3UKRA 2ZF5O 2NZTA 2CGKA 3ENBA 3AGKA 1ATSA 3GL1A 3CC2N 3AY9A 1NGBA 2YJFA 3C6AA 3LL3A 3FE1A 3WXIA 3ZYYX 4BRPA 4CZGA 1NJIO 3VESA 1GLJO 3QFUA 4XEIA 4XH4A 3Q7BA 2P9NA 1T6DA 2IVOA 3I8BA 3SBTA 3O6WA 5LY3A 3CCEN 1H1VA 3ENHA 4C1NI 5JLFA 4WFNL 2HBKA 3DAWA 3KZBA 5M1PA 2FSKA 1JCFA 1T44A 3D6RA 1BA1A 1G99A 2KHOA 4A61A 4BGBA 1SAZA 3GG4A 3ZEUB 3H3OB 4BR7A 3ZETB 1NLVA 2ASMA 1NGEA 3VERA 2P9LB 4HWIA 2GWJA 4JD2B 1VQMN 3P38A 4FWPA 5AQQA 4M7XA 3KVGA 1YIJN 4EHUA 3P31A 2QW9A 3H1QA 3VTHA 1HKBA 3HI0A 1QQNA 1C0GA 3D2FA 3SAHA 4A2BA 3LDNA 3A5MC 5AR0A 1YXQA 2Q36A 3MMVA 3SLCA 4DKWA 2OTLN 3PIOL 5TKYA 3VGKA 2JWKA 4FPAA 2HMPA 3VTIA 1P8ZA 3WXKA 4PHTX 2A5XA 1NGIA 2JWLA 3EL2A 3A5NC 3CJCA 5F2RA 1Z05A 1HPMA 3H45C 3WEEA 3DXMA 4JNEA 4BG9A 4IZ9A 3CIPA 2BUPA 3ULEB 2BH1A 4BR0A 3CCUN 4BRCA 4HTLA 5B8HA 1Q18A 4H0OA 4YDUA 4NLCA 3D2EA 4BR2A 3J8AA 1YUWA 1W2BM 4JK7A 1ZXOA 4CD3A 1XUPO 1Z6RA 2VGNA 3CQXA 5KPTA 4H5VA 1NGFA 4BY9C 4I6MA 2AA4A 3PLAA 3C7NA 3ENOA 3CETA 3GOIA 3FZKA 4JHDA 3L4QA 2H3GX 2WFBA 4WQ5A 4PL8A 4BVOA 1K9MO 3H46O 5AQIA 1GLCG 2NRVA 2QA4N 4B1YB 3K9KA 4BRMA 3E66A 5AZIB 2OTJN 3QICA 5ELZA 4CD1A 5AQPA 5AQZA 2ASPA 5EY4A 1BDGA 4K43A 4ILJA 3S41A 4OPHA 4YOXA 4C23A 3FR0A 3H1VX 4JK8A 5LJWA 4WFAL 4O5FA 3GE1A 4GV3A 3KK7A 1K8KB 2NRWA 3HTVA 1GLBG 4B1ZA 3EO3A 4QS7A 2Q2RA 2J4RA 2RHKA 4B1UB 3IMXA 4FVUA 2FSNA 1JCGA 2ZWHA 3HRGA 3CMEN 2OANA 4CBUA 4B1VA 3BF1A 5JMVA 3P39A 3C0BA 4JKBA 3QFPA 4F9OA 1Q82O 4WYBA 4CZLA 1BO5O 4KH4A 1RFQA 3EN9A 1KAXA 2YJEA 3BP8A 2FF6A 4BRDA 4MO5A 1TYQB 2QWQA 2YHXA 2HBJA 2PFUA 3RSEB 2QWMA 4O8UA 1HLUA 3KWGA 4JKEA 4EIAA 5AQRA 2P9KA 4BROA 1S3XA 2NRZA 4GVEA 4JN4A 3TSPA 1YJNN 3FZHA 3HZ6A 1U2VB 5AZJB 4WCEL 1K73O 3I55N 3CERA 5HL7L 4IOCL 4CZJA 4KH5A 3VEWA 2WBNA 3TTFA 5AQLA 3OBYA 1ZBSA 2E2PA 2CH6A 3FZLA 4BR9A 1VQKN 3CHWA 3SJHA 5BRDA 4ISGA 4BC3A 3JXUA 2NRHA 4AM6A 4A2AA 5GADP 3LDPA 1MWMA 3A5OC 3BUZB 3M5RA 3W0LA 3CC7N 1E4FT 4K41A 3L6QA 5BREA 2NRRA 4IJAA 3R8EA 1ZC6A 3MN5A 5BRFA 1GLDG 4BG8A 5BR9A 1Q7YO 3PIPL 2P9SB 2HSTA 2P9PA 5AQHA 5AQKA 3UKUA 1YITN 1BU6O 3EE8A 4EFHA 1XQSC 1E4GT 3VF2A 1YHQN 3C65A 4PKHA 3BEXA 4A5BA 1YVNA 1X9JA 3MWPA 3O9QA 3I56N 4JKHA 1VQ4N 2BTFA 3L4IA 1OVYA 3G71N 2GX9A 2IIRA 3CJBA 4BC5A 4WQ5C 4YOYA 3CJ1A 2E8AA 1YI2N 3CCVN 2P9UA 5AFUH 3ZX3A 4EHTA 1S72N 3LDOA 5C2DA 4YOTA 3CMAN 3AARA 3D2FB 1X3MA 4XH1A 3M3ZA 3JS6A 2E20A 4FWLA 3SMPA 5CHIA 3G4SN 3CCMN 4QS8A 3R6MA 4IO8A 4L3QA 3U8XA 4DCHA 3I33A 1VQ9N 5F1XA 3VEYA 1YJ9N 3AGRA 4GNIA 2IVPA 3NVMA 4BRKA 5BN8A 3WEEB 2F9TA 5C15A 4B1WB 3FZMA 1DGKN 3MCPA 1QZ6A 1VQ5N 1BA0A 4GY2B 2QEXN 3ID8A 5AQFA 5BPMA 3D2EB 4H5RA 4JKCA 4BRNA 3ATVA 2YX6A 1P90A 2V52B 3MN9A 3ATUA 4IXCA 4BVPA 3ZEUA 5GIPA 4JEPA 3VENA 1YAGA 3F2KA 3MN6A 2P9LA 3C7NB 4JD2A 3Q7CA 2GTDA 3O8MA 3SK3A 2VWBA 5EOYA 2E2QA 5AFUA 3LM2A 1GLAG 5GAGP 4MDBA 2ZJQL 3MX5A 3VGMA 3TTDA 5AQUA 4FWNA 2E2OA 3FZFA 4EAHD 4LC9B 5BRHA 3O9UA 3OW2M 3G6EN 1T3VA 5E84A 4H0YB 1NGAA 4DB3A 3OA9A 3ZX0A 4CZEA 5JICA 2FF3B 2GELA 2A3ZA 5HOOA 3OHRA 3ZX2A 1LOTB 3QBWA 2KLAA 4FSVA 3ULEA 3UB5A 4RWTA 2V7YA 2NLXA 4A57A 3VPZA 3NMUA 3A0IX 4R79A 5AQSA 4CJ7A 2YI1A 3AAQA 4ISFA 4IWVA 1RGIA 4BC4A 4FOIA 1NGGA 3O9SA 3OBWA 2Q0UA 3RVCA 4BQLA 1IJJA 4BRFA 5DM7L 3T7ZA 4WFBL 4JKDA 3EZWA 3WT0A 2P9IA 5AQJA 1N8RO 4YOVA 3SBGA 2WUSA 2ZGYA 4DHYA 4B1XB 2D4WA 3BF3A 5AZIA 1HUXA 2QI2A 3O5BA 1JCEA 1HKCA 3ID6A 1QVGM 3DXKB 4K42A 4RTFD 1DT9A 3E9LA 4NLBA 1QHAA 2P9KB 2PAVA 4QS9A 4WQ4A 2D0OA 2I7NA 5M1QA 4IO9L 2F9WA 3KHYA 2E88A 1TUUA 1KXPA 3CCSN 4FWMA 2E1ZA 4BC2A 4CBXA 3CC4N 5CE3A 1WUAA 3R9PA 3P4IA 2IVNA 2VGMA 3WQTA 1JJ2M 5C0YA 4H5NA 5H1SQ 3E1YA 1MDUB 3O08A 2F7TA 3E9PA 5BPLA 4PL7A 3QBXA 3MX2A 1ATNA 3KWIA 2UYTA 4FWKA 4H0VB 3WUHA 1NGJA 3WXJA 3NVKA 1BG3A 3F5TA 3QB0A 4DQ8A 4IDHA 2A41A 1RDWX 4RCHA 4Y0WA 1HX1A 3UKRB 1Y64A 3WQUA 5GAEP 3SAFA 1VQ8N 4A62A 2P9PB 4FL9A 5FPEA 3M1FA 1BOTO 1K8AO 3HOTA 4AF1A 1R59O 3CCRN 1S22A 4NO7A 3RSEA 2P9NB 3GBTA 4YDUC 4BREA 1DKGD 4CBWA 2CGJA 5AQYA 2ZGZA 3FGUA 5C10A 5FPMA 4CZMA 1M1KO 1VQ7N 3CD6N 2AP1A 2E1YA 3IFRA 2ZJRL 1QVFM 2P9UB 2QWRA 1J6ZA 3VEZA 3CJ9A 4MLEA 5M1OA 1BWFO 2GWKA 3HSCA 4IEIA 4BRIA 4PKIA 4BGAA 3TTCA 1DEJA 3EKUA 2HBLA 3VOVA 4ILGB 3MK6A 1VQON 5GIOA 2HF3A 1D4XA 1X3NA 4YOUA 4C1NK 3VEXA 4JKGA 2DPNA 4YORA 3E9OA 4PKGA 5AQTA 1U6ZA 3O1BA 5AQVA 4ISEA 2P9SA 4AM7A 3G25A 2D0PA 2VYPA 5AQMA 1VAZA 1IG8A 2HBMA 1BUPA 2EWSA 2QWNA 4MO4A 1NMDA 3A8YA 5BN9A 3DXMB 5GINA 2QWPA 5E26A 4GV6A 2QXLA 3CPEA 3H3NO 2ITMA 3EKSA 2Q1NA 4H0XB 4IFEA 1W97L 5AQWA 3MDQA 1EQYA 2HF4A 3MWTA 3CCLN 3N4PA 5KQ8A 5JVGL 3SMSA 2V7ZA 4FWOA 3ZETA 1HJOA 5MLCQ 5JVHL 2PBDA 1GLEG 4I6MB 4FWRA 1NGCA 2D1KA 4FO0A 4MDAA 3CXCM 4JHDB 1GLFO 3LM9A 2W41A 3B8AX 3VETA 4CZHA 1Q86O 4IOAL 1HKGA 1C0FA 4WQ4C 1YJWN 2YHYA 4BRHA 5BPNA 5M1KA 1NGHA 5JLHA 1KAYA 3K9JA 4M7YA 1KC8O 3LDQA 2HOEA 3M6GA 2GEMA 2Q97A 1V4SA 4A59A 3WXMB 4ILHA 5AQOA 4E1JA 3FLCO 4CZKA 3VGLA 2W40A 2NRTA 4BRAA 3DWLA 3CCJN 1YF5L 4K25A 2CH5A 2CGLA 3CI5A 4B9QA 1O13A 3HBTA 4MLHA 3HM8A 3CJ7A 3F9MA 1XC3A 3R3LA 3WXLA 3SAGA 5GAHP 1VQNN 4KH6A 1MA9B 3VMFB 4BR4A 5C12A 5KPZA 4WF9L 4JKFA 4FWQA 5EX5A 2NRXA 1KAZA 2Q31A 1NBWA 1ATRA 2Q0RA 3W3DA 3CQYA 2P9IB 3QDKA 1SS6A 4OPAA 4BRLA 4IEEA 4GV9A 4CZIA 5ADXH 3MCAB 3VEVA 4CZFA 3AAPA 3QMLA 5AQGA 1T6CA 4J8FA 5I9EB 5DM6L 5AQXA 3CPWM 1EO1A 5CR4A 1NM1A 3UE5A 4H5WA 4JAXA 3L0QA 4BRGA 5C2FA 1WOQA 2KKZA 3O9TA 4Z94A 5M1FA 4YOWA 3O1WA 2E2NA 3LDLA 1TUYA 4FPBA 2ZJPL 4XH5A 1LCUA 3GDQA 3FFKB 1NWKA 3IDHA 2WC9A 4M63C 5F0XA 4H0TB 5AQNA 3DJCA 2A42A 4O8KA 5M1NA 1M90O 1VQLN 2NNWA 3VEOA 4IJNA 1K8KA 2YHWA 5KQDA 1ESVA 4KBOA 5EXWA 4NB4A 2FXUA 1V4TA 3O4WA 1VQPN 4H5TA 2A40A 2QM1A 1SQKA 2QTDA 5EVZA 2I7PA 1SZ2A 1ILYA 1QQMA 1MWKA 4BRQA 5ADXA 3TPQA 3O80A 5LJVA 2YCHA 1KQSM 3CJAA 3TSQA 1KD1O 3DXKA 4G9ZA 3UKUB 4BR5A 3TSUA 5KPRA 3DLLL 4UY8O 4OO1J 3J7ZO 3MN7A 3N4QA 3CCQN 2FLOA 3A5LC 1TYQA 4FWSA 2ASOA 4BQZA 5TKWA 2RE2A 3EE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHK A;  4OPA A;  3RVC A;  3L4Q A;  3O9Q A;  3O9U A;  3P39 A;  3OA9 A;  2GX9 A;  3D6R A;  3KWI A;  3EE9 A;  3F5T A;  3O9T A;  2KKZ A;  4OPH A;  3M5R A;  3O9R A;  3P38 A;  3P31 A;  3KWG A;  3EE8 A;  3O9S A; 
#chains in the Genus database with same CATH topology
 3HOS A;  4RW6 A;  3U9Z A;  4DUZ K;  5AZJ A;  4M3Y A;  1ZBU A;  3DLG A;  4FZX C;  4U67 L;  1TK5 A;  1OKJ A;  2FSJ A;  3U9D A;  1QS4 A;  4H03 B;  4Z4C A;  2QXF A;  4JI5 K;  3THW B;  3VF6 A;  1CZA N;  1GLL O;  4CI6 A;  3CF5 L;  4NYN A;  3D7E O;  3BZK A;  3U4L A;  4FOE A;  1I39 A;  2YNG A;  3AV9 A;  3FFI A;  3GL1 A;  3AY9 A;  3C6A A;  3LL3 A;  3BDP A;  4CZG A;  1GLJ O;  2O8B B;  1RBU A;  2FC0 A;  1ASU A;  2HBK A;  3DAW A;  3V9Z A;  3D6R A;  4A61 A;  2KHO A;  4OKK A;  1SAZ A;  3H3O B;  2HMI A;  3OYN A;  3M8S A;  2ASM A;  1NGE A;  4B9N A;  4EZ9 A;  4W5N A;  3VER A;  1VSM A;  3HPH A;  4CGJ A;  2D0C A;  4JI3 K;  3BY5 A;  4RG8 A;  4EHU A;  3VTH A;  3HI0 A;  3KKR A;  3SAH A;  4A2B A;  3QER A;  3AVB A;  3DLR A;  5AR0 A;  2XHB A;  2VWK A;  3VTI A;  1HPZ A;  1P8Z A;  2A5X A;  3HST B;  1NGI A;  4ID5 A;  3CJC A;  1WSE A;  2X74 A;  5F2R A;  1HPM A;  3H45 C;  4IZ9 A;  4Z4I A;  4M41 A;  4BE1 A;  3OY9 A;  3TAN A;  3S9H A;  2F96 A;  4BRC A;  5J2M A;  1Q18 A;  4YDU A;  4Z0U A;  3K5M A;  3J8A A;  1YUW A;  2O8D A;  1W2B M;  4KHW A;  1SKW A;  1C0M A;  3FZK A;  3M8R A;  1GLC G;  2NRV A;  2G8F A;  3C94 A;  3NBP A;  3OS1 A;  3J81 O;  4GKJ K;  1OVQ A;  5AQZ A;  3THV A;  4K43 A;  1U48 A;  4YOX A;  3SJJ A;  3H1V X;  3QIO A;  1N5Y A;  1FKO A;  1VRT A;  4WFA L;  2W42 A;  5LMN K;  4CJ5 A;  5C25 A;  2J4R A;  3HRG A;  4Q0B A;  1NKB A;  4ELT A;  5J2P A;  1Q82 O;  3VQB A;  2G8U A;  4WYB A;  4H4O A;  2FF6 A;  3TWH A;  4I9Q A;  3SCX A;  1TYQ B;  2QWQ A;  2YHX A;  4DTP A;  2D5R A;  2PFU A;  3RSE B;  4FJ9 A;  1N33 K;  3AVG A;  3NCI A;  4HUG A;  4B8C A;  2NRZ A;  4JN4 A;  1L3V A;  1CZB A;  3V9X A;  4WCE L;  1U2V B;  1K73 O;  1HNI A;  4DU3 A;  1RDB A;  2WBN A;  3TTF A;  5AQL A;  4ELV A;  1ZBS A;  3NDK A;  2CH6 A;  4F2R A;  3TAG A;  4ISG A;  2NRH A;  1VK0 A;  4AM6 A;  3TI0 A;  3CC7 N;  1MWM A;  3A5O C;  3W0L A;  3M5R A;  4CEE A;  2HHT A;  2W6K A;  2VG6 A;  2NRR A;  4IJA A;  3R8E A;  3MN5 A;  4BG8 A;  5BR9 A;  2HST A;  5AQH A;  3UKU A;  4LY7 A;  4EFH A;  4TSX A;  5JS1 A;  2FBV A;  4A5B A;  3MWP A;  1BQN A;  3EZ5 A;  3VN5 A;  3L8B A;  2F4V K;  4AHU A;  5KRT A;  2P9U A;  4QOZ B;  3CM6 A;  3ZX3 A;  3L3V A;  3AAR A;  3D2F B;  1JKH A;  4KHN A;  3M3Z A;  4CGD A;  3SMP A;  4AHV A;  5CHI A;  3LWM A;  3NGY A;  4IO8 A;  1U45 A;  4O55 A;  4L3Q A;  3I33 A;  4C8M A;  2IVP A;  4M45 A;  2D0B A;  2F9T A;  3D45 A;  1DGK N;  3MCP A;  4X62 K;  4RW7 A;  3D2E B;  3ATV A;  4CF0 A;  1D5A A;  2V52 B;  4RW9 A;  3OYJ A;  1XMO K;  3NGI A;  3ZSR A;  4YY3 K;  2IAJ A;  3O8M A;  2VWB A;  1NNE A;  3V9W A;  1N34 K;  3AO2 A;  3MX5 A;  5AQU A;  5J2Q A;  3QES A;  4K8X A;  4PQU A;  4KV8 A;  3G6E N;  2GUI A;  4CZE A;  5FRN A;  1C1C A;  5JIC A;  5LL6 Z;  3ZX2 A;  1LOT B;  3QBW A;  3NHG A;  3ULE A;  3UB5 A;  2Y1I A;  2BE2 A;  2NLX A;  3NMU A;  4IDK A;  1K6Y A;  5AQS A;  4BDY A;  3AAQ A;  1WSI A;  4BC4 A;  1RGI A;  1DTT A;  2Q0U A;  4BRF A;  4DR1 K;  3T7Z A;  4HHT A;  4FLY A;  4W5R A;  3ITH A;  1RCH A;  5HBM A;  2OPR A;  2OA8 A;  3AVC A;  4O5B A;  4FJI A;  4B3T K;  1VSJ A;  1EXQ A;  2KFN A;  4CJT A;  1RBV A;  4WQ4 A;  3IAY A;  2G8K A;  3NFA A;  1TUU A;  1KXP A;  4C8L A;  1UA1 A;  4GW6 A;  4CBX A;  1KTQ A;  4CEZ A;  2VGM A;  3WQT A;  1KCF A;  5H1S Q;  4CJQ A;  4C8K A;  1IKV A;  3LAL A;  3QBX A;  4FWK A;  4H0V B;  2UYT A;  4U7B A;  3WXJ A;  3WNG A;  4DQ8 A;  2A41 A;  4Y0W A;  1Y64 A;  5GAE P;  3SAF A;  3EY1 A;  2P9P B;  3SPY A;  4KRE A;  3HOT A;  4B3M K;  1JLF A;  3LAN A;  1Q8I A;  4NO7 A;  4DSJ A;  4BRE A;  3KLH A;  2P1J A;  2ZGZ A;  4DTU A;  3OYA A;  4AIL C;  2E1Y A;  1RT4 A;  3NH2 A;  1QVF M;  4N41 A;  4DR4 K;  1J6Z A;  1S1V A;  3CJ9 A;  1U4B A;  1BWF O;  3HSC A;  4BRI A;  4PKI A;  1JLB A;  4PUO A;  2HF3 A;  3HT3 A;  1VSK A;  2NUB A;  3THX B;  4CEF A;  5KI6 A;  4PKG A;  4CF1 A;  3AO5 A;  1VRU A;  1KVA A;  3SV3 A;  2P9S A;  4CEB A;  4AM7 A;  3V9U A;  2VYP A;  4NCG A;  1BGX T;  3SQ4 A;  2XO7 A;  5KGW A;  5E26 A;  2QXL A;  4H0X B;  3T3F A;  4CGI A;  3KTQ A;  3AO1 A;  2HF4 A;  4E19 A;  1YVU A;  2O8D B;  1B9F A;  4F3O A;  2EHG A;  2G8H A;  4FWR A;  2D1K A;  3LDS A;  4MDA A;  4CZH A;  1Q86 O;  4KHQ A;  4IOA L;  4WQ4 C;  1YJW N;  2HW3 A;  4B3S K;  3H08 A;  1KAY A;  3K9J A;  4M7Y A;  3HM9 A;  4BDZ A;  2HOE A;  3M6G A;  4PA1 A;  3VQ5 A;  1V4S A;  4DV7 K;  3WXM B;  4ILH A;  1X9S A;  4BRA A;  2NRT A;  4OLA A;  3CCJ N;  3G10 A;  4CEC A;  2CGL A;  4M3U A;  4B9Q A;  3HBT A;  3CJ7 A;  4CE9 A;  4JLH A;  3WXL A;  1ASV A;  5KPZ A;  4E7I A;  3HVT A;  4E7H A;  2OPP A;  1ATR A;  1NBW A;  2Q0R A;  2P9I B;  4IEE A;  1FKP A;  3TAE A;  5ADX H;  2YNI A;  3VQA A;  3VA3 A;  5AQG A;  3QML A;  5DM6 L;  5AQX A;  1QSS A;  1IV0 A;  3U6F A;  3ZCM A;  3UE5 A;  2KW4 A;  5I42 A;  5HLF A;  2A1S A;  4H5W A;  3I0R A;  1RDD A;  3L0Q A;  3SQ1 A;  3O9T A;  1XMQ K;  5HRN A;  5M1F A;  1S1T A;  1DLO A;  4CFA A;  3AA4 A;  2NNW A;  1CXU A;  1L5U A;  1XHZ A;  4JS4 A;  4FZZ A;  4KBO A;  5EXW A;  2PZS A;  1VQP N;  3CFP A;  3L2Q A;  5ADX A;  1CXQ A;  2YCH A;  3LP1 A;  1OH7 A;  1LWF A;  1KD1 O;  2VQE K;  4DTM A;  4G9Z A;  3UKU B;  4BR5 A;  5KPR A;  3KLF A;  3N4Q A;  3CCQ N;  1TYQ A;  2ASO A;  5TKW A;  4FJH A;  1C0U A;  1U04 A;  1XHX A;  1NGD A;  4N5S A;  3L3U A;  5HRP A;  1U2V A;  1RDU A;  4JK9 A;  1O1W A;  3T69 A;  4CES A;  2Z1H A;  1FW6 A;  4E7J A;  4JKA A;  3KLG A;  2X78 A;  2V51 B;  1T8E A;  4JKG B;  3QNN A;  3QIP A;  3R1X A;  2XY5 A;  2A6A A;  2KZM A;  4FLW A;  3AGK A;  2G8I A;  4IBN A;  3ZYY X;  4BRP A;  3F73 A;  3QFU A;  4XEI A;  4DV0 K;  4X64 K;  1RT2 A;  4FK2 A;  3AVI A;  1RT7 A;  2IVO A;  3BZC A;  3SBT A;  2E4L A;  5JLF A;  3SUP A;  1KFS A;  2HHU A;  4CJS A;  3SV4 A;  1T44 A;  2Z1J A;  1BA1 A;  1G99 A;  4BGB A;  1VSD A;  4FW2 A;  3ZET B;  2BAN A;  2YKN A;  2HHQ A;  1XC9 A;  4DR7 K;  1VQM N;  5AQQ A;  1YIJ N;  1LAW A;  4M7X A;  3TR8 A;  4NCA A;  3AVJ A;  4FLT A;  1WAF A;  3D2F A;  3U3Y A;  1TAQ A;  3A5M C;  4B9S A;  2Q36 A;  3O4Q A;  4FJG A;  3PIO L;  1IKW A;  2JWK A;  1EP4 A;  2P5O A;  1JXB A;  2JWL A;  4X65 K;  1Z05 A;  2G8W A;  1SKS A;  1W0H A;  3ULE B;  3HVR A;  4BR0 A;  4DTX A;  1YTU A;  4NLC A;  3D2E A;  4NXN K;  1IKX A;  1XUP O;  1Z6R A;  2VGN A;  1SL1 A;  3PX4 A;  3PLA A;  1QE1 A;  3ENO A;  3CET A;  3GOI A;  3VQ6 A;  4B9U A;  3L4Q A;  2WFB A;  4BVO A;  4CF9 A;  4Z4F A;  1C1A A;  4B1Y B;  4FZY A;  3E66 A;  2OTJ N;  4R5P A;  1NKC A;  4V19 S;  3QIN A;  4O44 A;  4DMN A;  4EP4 A;  3SZ2 A;  2AJQ A;  3ULD A;  3DLH A;  3G0Z A;  4O5F A;  4GV3 A;  1K8K B;  3HTV A;  1GLB G;  3EO3 A;  4F4K A;  2BGG A;  3HP9 A;  2Q2R A;  4QS7 A;  3RMC A;  3IMX A;  3J7Y P;  1JCG A;  4B1V A;  1TKT A;  3KD5 E;  3P39 A;  3QFP A;  5CYM A;  3KIO A;  4FJ8 A;  1NK4 A;  2PY5 A;  4KH4 A;  1RFQ A;  2YJE A;  2XY6 A;  2PYJ A;  4IG0 A;  4DV4 K;  4MO5 A;  4BWM A;  3NH0 A;  2QWM A;  4O8U A;  1HLU A;  3KWG A;  4EIA A;  4DFK A;  4CJF A;  3HZ6 A;  3CYM A;  4FJJ A;  1W7A A;  4KH5 A;  2E2P A;  4OJR A;  1JLG A;  4W5T A;  4BR9 A;  3FZL A;  4C8O A;  3JXU A;  5GAD P;  3LDP A;  3QEV A;  3BUZ B;  1E4F T;  5BRE A;  2HHX A;  2XY8 A;  1ZC6 A;  1GLD G;  2DFF A;  2P9S B;  2P9P A;  4LD0 A;  1YIT N;  3C65 A;  1KFD A;  1B9D A;  3NF6 A;  2BDP A;  1UAX A;  4JKH A;  2IIR A;  3CJB A;  4CJV A;  4YOY A;  1RTD A;  1YI2 N;  1S72 N;  4EHT A;  5C2D A;  3CMA N;  1X3M A;  2Z1I A;  1S5J A;  1BQM A;  4H4M A;  4XH1 A;  3RR7 A;  3OTO K;  4FWL A;  5BR8 K;  3G4S N;  3ZT0 A;  4QS8 A;  4DCH A;  1VQ9 N;  1IKY A;  3VEY A;  5F1X A;  3THX A;  1YJ9 N;  3SPZ A;  4BRK A;  4CK3 A;  5BN8 A;  4CFD A;  1J53 A;  4B1W B;  4X66 K;  3OYL A;  2W6L A;  3VQ8 A;  4DU1 A;  2XRI A;  3ID8 A;  1J54 A;  4ICL A;  4CHN A;  5BPM A;  3L2R A;  4JKC A;  1OH6 A;  2YX6 A;  1P90 A;  3ATU A;  4BVP A;  3ZEU A;  1ZYQ A;  1YAG A;  3C7N B;  2QK9 A;  3F9K A;  1KLM A;  3I8D A;  3A2F A;  3KLE A;  3V4I A;  1TKX A;  4MDB A;  3VGM A;  4FWN A;  2I5J A;  2E2O A;  3V1O A;  5JS2 A;  3SUN A;  3K5N A;  2IGI A;  5BRH A;  3OJS A;  1NGA A;  3OA9 A;  4BWJ A;  3ZX0 A;  4DQR A;  2HNZ A;  1ZBL A;  3HL8 A;  4E0D A;  4KFB A;  1N32 K;  1RT1 A;  4ZHR A;  1LV5 A;  3KJV A;  2YI1 A;  4NCB A;  2WOM A;  4FOI A;  3OBW A;  4KPY A;  3KLI A;  3RVC A;  4CVN E;  4GMJ B;  3KD1 E;  4FJM A;  4NXM K;  1HYS A;  2P9I A;  5E41 A;  2KZZ A;  4M3Z A;  2F8T A;  2WUS A;  2QKK A;  4DHY A;  5AZI A;  2D4W A;  3BF3 A;  3O5B A;  1JCE A;  1HKC A;  3ID6 A;  3NF8 A;  4K42 A;  4RTF D;  4OKE A;  3NH1 A;  3DOL A;  4E7K A;  3MXM A;  4QS9 A;  2FBT A;  4I7F A;  2D0O A;  1NJX A;  5M1Q A;  4IO9 L;  4NYF A;  3RMA A;  1NOZ A;  2E88 A;  4KTZ A;  3CCS N;  4FWM A;  1NJZ A;  1WUA A;  1NJY A;  3R9P A;  1X9W A;  2IVN A;  4JI2 K;  1J5O A;  4QAG A;  1JJ2 M;  4H5N A;  4LF6 K;  3O08 A;  2F7T A;  4PL7 A;  3MX2 A;  1ATN A;  3LPU A;  4LF7 K;  1BG3 A;  4IDH A;  1HX1 A;  3IG1 A;  4A62 A;  1NK8 A;  1C1B A;  1S22 A;  4YDU C;  3TAB A;  1RTI A;  1DKG D;  2CGJ A;  3HYF A;  5CY4 A;  4LF5 K;  3FGU A;  5FPM A;  4CZM A;  3HPO A;  3CD6 N;  2AP1 A;  3IRX A;  2QKB A;  2QWR A;  5M1O A;  4KTW A;  4IEI A;  3EKU A;  2HBL A;  4CJP A;  1D4X A;  3HXM A;  4JRQ A;  4JKG A;  4M3X A;  4CF8 A;  3MXI A;  1D9F A;  5AQT A;  5AQV A;  4F2S A;  3G25 A;  5AQM A;  1VAZ A;  4MO4 A;  1NMD A;  1WSF A;  5BN9 A;  3PO4 A;  2QWP A;  3H3N O;  4DSK A;  3EKS A;  1SV5 A;  2Q1N A;  1WN7 A;  3ZT3 A;  5AQW A;  4MFB A;  1EQY A;  3MWT A;  3CCL N;  4B9M A;  4DWI A;  5JVG L;  4LH4 A;  1S1X A;  3ZET A;  2PBD A;  1NGC A;  4CK1 A;  2HVI A;  3CXC M;  4C8N A;  3LM9 A;  2W41 A;  3B8A X;  1C0F A;  2O8C A;  5M1K A;  5JLH A;  4DS5 A;  4CHZ A;  3OYF A;  2VG5 A;  3K59 A;  2GEM A;  4A59 A;  4E1J A;  3V81 A;  3FLC O;  4K25 A;  2GBZ A;  3OYG A;  3F9M A;  1VQN N;  5GAH P;  4KH6 A;  1L3U A;  3OYC A;  4BR4 A;  5C12 A;  3T1Y K;  3DRS A;  2HHW A;  4CHQ A;  5EX5 A;  2Q31 A;  3W3D A;  4OPA A;  1SS6 A;  3MCA B;  3AAP A;  1TV6 A;  4J8F A;  1NM1 A;  2O4G A;  4BRG A;  2KKZ A;  2FBX A;  1WNS A;  1HJR A;  5HRR A;  3O1W A;  2E2N A;  2ZM6 K;  1LCU A;  2X6S A;  3IDH A;  4M63 C;  4BDP A;  4H0T B;  3DJC A;  4E1M A;  5FRM A;  3VEO A;  5SWM A;  3CFO A;  5DK5 A;  1K8K A;  2YHW A;  4HUF A;  1Z25 A;  1RTH A;  4FLU A;  4H5T A;  3ZT4 A;  4UQG A;  5EVZ A;  2I7P A;  1ILY A;  3TPQ A;  5LJV A;  3DRP A;  3CJA A;  3TSQ A;  1VHX A;  3OS0 A;  4DV6 K;  3DXK A;  3DLL L;  4OO1 J;  3MN7 A;  4FJ5 A;  2FLO A;  4FWS A;  4BQZ A;  2QWO A;  3TU5 A;  4IOX A;  1BIU A;  3VF4 A;  1QZ5 A;  3H6E A;  2UXC K;  4CEO A;  4H0P A;  3M8P A;  1BCO A;  1QQO A;  5FPN A;  2IC3 A;  1WBB A;  1RT6 A;  4A5A A;  3WNF A;  4LF9 K;  5FRO A;  3UKR A;  4LSN A;  3ENB A;  3LPT A;  4I2P A;  3CC2 N;  2UXB K;  1EWR A;  4CJK A;  1NGB A;  3WXI A;  1FXX A;  1NJI O;  3FE1 A;  3VES A;  4CIF A;  4XH4 A;  2G8V A;  5IWA K;  1T6D A;  4DV5 K;  5LY3 A;  3O6W A;  1H1V A;  4M42 A;  4FM0 A;  4CHP A;  3I0S A;  3LP2 A;  1JCF A;  3VQ9 A;  4DLG A;  4KKO A;  3ZEU B;  1NLV A;  4DQQ A;  3DI6 A;  3EYZ A;  4HWI A;  3QEW A;  2GWJ A;  1ZBF A;  3P38 A;  4FWP A;  3KVG A;  3D0P A;  4FM1 A;  1EWQ A;  3T1H K;  1C0G A;  4AHC A;  3SQ0 A;  2UUC K;  1YXQ A;  1L3S A;  4DKW A;  3SLC A;  4FPA A;  2HMP A;  3WXK A;  4PHT X;  4CJW A;  1LAV A;  3NGZ A;  4E1N A;  3K2P A;  4JNE A;  1GOC A;  3OYK A;  4YNQ A;  2BH1 A;  3NE6 A;  1BHL A;  1GOA A;  1RT3 A;  3MED A;  4BR2 A;  4J2E A;  2HHS A;  1KSP A;  3VQD A;  5KPT A;  4H5V A;  3CM5 A;  2AA4 A;  2B5J A;  3C7N A;  1KVC A;  3P1G A;  4DQS A;  3H46 O;  1OH8 A;  2ZD1 A;  3K9K A;  3ZSZ A;  3E01 A;  5AZI B;  4CGG A;  3QIC A;  2HB5 A;  5ELZ A;  5I3U A;  1ZBI A;  4CJU A;  4CD1 A;  4B3O A;  5AQP A;  1N36 K;  1UOC A;  4ILJ A;  3S41 A;  3O3H A;  3AVA A;  5LJW A;  2EX3 A;  4FW1 A;  3TAF A;  1NK9 A;  1JLC A;  2Y1J A;  3KK7 A;  4CW7 B;  2NRW A;  3SYZ A;  4B1Z A;  4DFP A;  2RHK A;  1TAU A;  4B1U B;  4FM2 A;  2E5L K;  4FVU A;  2FSN A;  2ZWH A;  3QEX A;  3CME N;  2OAN A;  3V1Q A;  4CBU A;  1TKZ A;  3BF1 A;  3LWL A;  4HUE A;  4B9V A;  1BO5 O;  1JXE A;  3MEE A;  4CJE A;  1D8Y A;  4XIU A;  3BP8 A;  3M8Q A;  4BRD A;  4CIE A;  1RNH A;  2FBY A;  1S3X A;  4GVE A;  3VQP A;  4DTJ A;  1YJN N;  4JI8 K;  3ZT2 A;  3THY B;  4CK2 A;  4KTQ A;  2OYQ A;  3CER A;  4IOC L;  4CZJ A;  3DOK A;  1IH7 A;  3VEW A;  3OYH A;  3OBY A;  3O3F A;  3JYT A;  2VWJ A;  2YHB A;  1VQK N;  3CHW A;  4B8A B;  5BRD A;  4AQY K;  2WTU A;  3AVM A;  1YT3 A;  1VSI A;  2GV9 A;  3PIP L;  1LW2 A;  1D9D A;  1BU6 O;  3EE8 A;  3PX0 A;  1XQS C;  1E4G T;  3TAM A;  4ID1 A;  3BEX A;  3HJF A;  1X9J A;  3O9Q A;  5T7B A;  4HVJ A;  4LH5 A;  3I56 N;  1VQ4 N;  2HHV A;  1GOB A;  3G71 N;  3CJ1 A;  2E8A A;  3CCV N;  5AFU H;  2HHH K;  4YOT A;  3LAK A;  4CGF A;  3S3N A;  4FK0 A;  3L2U A;  4B3R K;  4YFU A;  3JS6 A;  1I3A A;  2E20 A;  4M3W A;  3AVF A;  1IBL K;  2B4J A;  3U8X A;  4CJ3 A;  2O8C B;  3NVM A;  4FXD A;  4DLE A;  3WEE B;  5C15 A;  2O8F A;  3MXJ A;  1QZ6 A;  3LAM A;  3NF9 A;  1HNZ K;  1BA0 A;  2X6N A;  4GY2 B;  4JV5 K;  3L2W A;  4DUY K;  1X9M A;  3ALY A;  2IDO A;  1NJW A;  3AA5 X;  3AO3 A;  4IKF A;  2XY7 A;  3F2K A;  3MN6 A;  2P9L A;  3OYD A;  3VQQ A;  1SL2 A;  4JD2 A;  3Q7C A;  3RRH A;  4EZ6 A;  5EOY A;  4DSL A;  2E2Q A;  3ZSO A;  5AFU A;  4DTR A;  3LM2 A;  1GLA G;  5GAG P;  1SL0 A;  2PYL A;  3RRG A;  3FZF A;  4LC9 B;  4CER A;  5EU7 A;  5HRO A;  4FJL A;  1T3V A;  5E84 A;  4H0Y B;  2OPQ A;  1BI4 B;  1UA0 A;  4JYA K;  5SZT A;  4DV1 K;  4LFA K;  1RBS A;  2A3Z A;  4CHY A;  5HOO A;  1S6P A;  2KLA A;  5IT9 O;  4FSV A;  4A57 A;  4DQI A;  4IWV A;  1NGG A;  1NK7 A;  2D0A A;  3LP3 A;  4BQL A;  5DM7 L;  4WFB L;  1T7P A;  4JKD A;  3WT0 A;  1N8R O;  4YOV A;  3SBG A;  3DLB A;  3PUF A;  1HUX A;  1HYV A;  2QI2 A;  4OLB A;  1QVG M;  4KB1 A;  4IFY A;  3DXK B;  3PSI A;  3SUQ A;  4NLB A;  1QHA A;  3VA0 A;  2P9K B;  3OJU A;  2F9W A;  3KHY A;  1EET A;  4LF8 K;  3QLH A;  1IBK K;  1J9A A;  1RBT A;  2YHA A;  1Y97 A;  4DQP A;  5CE3 A;  1JLA A;  3TAP A;  1NG9 A;  5C0Y A;  2ITG A;  4M3R A;  3E1Y A;  1HQE A;  4CCH A;  2UUB K;  3E9P A;  3QB0 A;  3UKR B;  1ASW A;  1VQ8 N;  1VSE A;  1BL3 A;  4FL9 A;  5FPE A;  3DM2 A;  3M1F A;  4Y1C A;  1BOT O;  1K8A O;  1JL1 A;  3ASM A;  2UXD K;  3GBT A;  1HNW K;  1S9G A;  5AQY A;  5C10 A;  1M1K O;  4F8R A;  4IG3 A;  2IOC A;  1KRP A;  3CFR A;  2GWK A;  1WB9 A;  1DEJ A;  4JI6 K;  3VOV A;  2O4I A;  4HCC A;  4ILG B;  3MK6 A;  1VQO N;  5GIO A;  3PV8 A;  3C95 A;  1R0A A;  4YOU A;  4C1N K;  3CG7 A;  3VEX A;  2DPN A;  3E9O A;  5J1E A;  1QHT A;  4ISE A;  1DTQ A;  2HBM A;  1BUP A;  2EWS A;  3A8Y A;  4DSF A;  2DFH A;  5GIN A;  3CQ8 A;  1WAJ A;  4GV6 A;  3CPE A;  4OGE A;  4FJN A;  3MDQ A;  4CEQ A;  3N4P A;  1LWE A;  2VG7 A;  4FWO A;  1HJO A;  4IFV A;  1GLE G;  1IG9 A;  1RIL A;  4OX9 K;  4FO0 A;  4PWD A;  3OVN A;  3PY8 A;  4AHS A;  2RF2 A;  3VET A;  1HKG A;  2YHY A;  1BIZ A;  1NGH A;  4DV3 K;  4DF4 A;  4CFC A;  4DSI A;  4KHU A;  1Q9X A;  3LDQ A;  2Q97 A;  5CYQ A;  4FJX A;  5AQO A;  4CZK A;  1HNX K;  4K0K K;  3VGL A;  2W40 A;  3DWL A;  1YF5 L;  3V9S A;  1O13 A;  4DFM A;  4MLH A;  3HM8 A;  4RW4 A;  1TKD A;  1XC3 A;  3SAG A;  5HP1 A;  3J7A P;  4WF9 L;  4JKF A;  4FWQ A;  1CZ9 A;  2NRX A;  3OYB A;  4W5O A;  3CQY A;  4GV9 A;  4BRL A;  3C6T A;  1FJG K;  3VEV A;  4CZF A;  5I9E B;  4DF8 A;  1T05 A;  3ZLJ A;  1EO1 A;  5CR4 A;  4JAX A;  1WOQ A;  3O4N A;  4YOW A;  1TUY A;  1TK8 A;  4XH5 A;  3FFK B;  4Y1D A;  1NWK A;  4N47 A;  4CGH A;  3K5O A;  5F0X A;  1S1W A;  5AQN A;  1N6Q A;  2A42 A;  3RR8 A;  3B6P A;  4AHT A;  4M3T A;  3KK1 A;  4B08 A;  5KQD A;  1ESV A;  4NB4 A;  3O4W A;  3IS9 A;  4FYD A;  3KK2 A;  1SQK A;  1QQM A;  2ZE2 A;  1IBM K;  1KQS M;  1RBR A;  1QQC A;  2JGU A;  3J7Z O;  3PX6 A;  4QCL A;  5HRS A;  3RWU A;  1JLQ A;  3HO1 A;  3EE9 A;  3VQC A;  4CJ4 A;  3OYE A;  4DR3 K;  1VSL A;  1CLQ A;  4Z4H A;  3C6H A;  3THY A;  3SI6 A;  1VQ6 N;  3IKM A;  3IUC A;  2DTU A;  2R7Y A;  1Q81 O;  4CHO A;  2VCP A;  5FPD A;  3MEC A;  4KO0 A;  1ITG A;  4B9T A;  4KB0 A;  3O9R A;  4BAC A;  4JI7 K;  2GUP A;  2QWL A;  2ZF5 O;  2NZT A;  2CGK A;  4E89 A;  1A5X A;  1ATS A;  1WSH A;  2YJF A;  4CIG A;  5CZ1 A;  2O8E A;  2O8F B;  3Q7B A;  2P9N A;  4KHP K;  4DTS A;  3I8B A;  3CCE N;  3ENH A;  1KVB A;  4C1N I;  5K14 A;  4WFN L;  3KZB A;  5M1P A;  2FSK A;  2DFE A;  3GG4 A;  4BR7 A;  1WLJ A;  1Z26 A;  2P9L B;  4JD2 B;  4Q5V A;  3P31 A;  4BE2 A;  2QW9 A;  3H1Q A;  1HKB A;  1RDC A;  1QQN A;  3RMB A;  3ZSY A;  4DU4 A;  3MEG A;  3LZI A;  3LDN A;  2OTL N;  3MMV A;  3K57 A;  5TKY A;  1HYZ A;  3VGK A;  5AJ3 K;  1HQU A;  3EL2 A;  3A5N C;  1B92 A;  3WEE A;  4AH9 A;  3UIQ A;  3DXM A;  4AHR A;  4BG9 A;  3CIP A;  2BUP A;  3CCU N;  4HTL A;  5B8H A;  4H0O A;  1BCM A;  4MQ3 A;  4JK7 A;  1ZXO A;  4CD3 A;  5J2N A;  1XNQ K;  3CQX A;  4L8R B;  1NGF A;  4BY9 C;  4I6M A;  3WNE A;  4CED A;  3AVL A;  3P5J A;  3SUO A;  4J2D A;  4JHD A;  2H3G X;  4WQ5 A;  4OPK A;  4PL8 A;  1K9M O;  1A5V A;  4F3T A;  5AQI A;  3JAM O;  2QA4 N;  3AA2 A;  1REV A;  4BRM A;  4FLX A;  4JI1 K;  4KHY A;  1S1U A;  3T1A A;  2ASP A;  5EY4 A;  1BDG A;  4JI0 K;  4OPJ A;  3ZT1 A;  1TGO A;  4OPH A;  1BI4 A;  4C23 A;  3FR0 A;  2HVH A;  1C0T A;  4JK8 A;  5FDL A;  1E3M A;  2ETJ A;  3WNH A;  3B6O A;  3GE1 A;  3V1R A;  5KGX A;  2DY4 A;  4HCB A;  3OS2 A;  1NKE A;  4JS5 A;  5JMV A;  2P5G A;  4ZTF A;  3C0B A;  4JKB A;  1WSJ A;  1NK6 A;  4F9O A;  4WE1 A;  4CZL A;  4O0J A;  1U47 A;  3QEP A;  3EN9 A;  1KAX A;  1JLE A;  1SKR A;  4LFC K;  3OYM A;  3NF7 A;  2HBJ A;  4OKJ A;  2OZS A;  3QNO A;  4JKE A;  3QO9 A;  4KAZ A;  5AQR A;  2P9K A;  3C6U A;  3TSP A;  4BRO A;  3S3O A;  1LWC A;  3VQ7 A;  3FZH A;  5AZJ B;  1TL1 A;  3I55 N;  1A5W A;  5HL7 L;  4BE0 A;  1HRH A;  4CJL A;  4DFJ A;  1NU0 A;  3SJH A;  3LZJ A;  4BC3 A;  1TL3 A;  1TVR A;  4A2A A;  1U49 A;  1J5E K;  1X1P A;  4K41 A;  3L6Q A;  3ZSV A;  5BRF A;  1KLN A;  1Q7Y O;  5AQK A;  3SQ2 A;  3SNN A;  1MU2 A;  3VF2 A;  1YHQ N;  4PKH A;  4DSE A;  1W9H A;  1YVN A;  3HPG A;  1RDA A;  4OGC A;  2BTF A;  3L4I A;  1OVY A;  4CFB A;  2GX9 A;  4BC5 A;  4WQ5 C;  1EX4 A;  3LDO A;  4DR5 K;  3RTV A;  2KQ2 A;  3ZSW A;  2E6L A;  3THW A;  4GKK K;  2JLE A;  4LF4 K;  1IO2 A;  3CCM N;  1T03 A;  3R6M A;  4FLZ A;  4B9L A;  4ZTJ A;  3ZSX A;  3AGR A;  4GNI A;  4J2B A;  1NOY A;  2Q3S A;  1ZBH A;  3FZM A;  1HR0 K;  3KKS A;  3LP0 A;  1VQ5 N;  2O8B A;  2QEX N;  1SUQ A;  5AQF A;  3V6D A;  3OYI A;  4H5R A;  3VQ4 A;  4GVM A;  4BRN A;  4DTN A;  3MN9 A;  5GIP A;  4IXC A;  3RMD A;  4ELU A;  2YKM A;  4JEP A;  3VEN A;  4DR6 K;  2HND A;  4CF2 A;  4PY5 A;  2GTD A;  3SK3 A;  3K5L A;  1QTM A;  3DMJ A;  3T19 A;  3S3M A;  2ZJQ L;  3TTD A;  1C6V A;  3DRR A;  1NMN A;  1WBD A;  4EAH D;  3O3G A;  3O9U A;  3OW2 M;  4H8K A;  4DB3 A;  3MAQ A;  3VQE A;  2VQF K;  2FF3 B;  2GEL A;  3OHR A;  2OCE A;  4FJK A;  2YNF A;  2RN2 A;  1QSL A;  4RWT A;  3ISN C;  2V7Y A;  3VPZ A;  4N56 A;  3A0I X;  4R79 A;  4CJ7 A;  4ISF A;  4JI4 K;  3O9S A;  3BGR A;  3L2V A;  2IS3 A;  1IJJ A;  4DS4 A;  4FCY A;  2P51 A;  3EZW A;  3K58 A;  5AQJ A;  2ZGY A;  4KI4 A;  4B1X B;  4W5Q A;  2E6M A;  3ZSQ A;  1DT9 A;  3E9L A;  2Z1G A;  1NK0 A;  2ATQ A;  2PAV A;  5KTQ A;  5FLX O;  3TAR A;  2I7N A;  4G1Q A;  1L3T A;  2E1Z A;  4BC2 A;  3QEI A;  3CC4 N;  5C42 A;  2RKI A;  3P4I A;  1S6Q A;  1YTA A;  2YV0 X;  4E3S A;  3PO5 A;  1MDU B;  4K8Z A;  4KHS A;  5BPL A;  1NK5 A;  2KFZ A;  3NVK A;  3KWI A;  3WUH A;  1NGJ A;  3F5T A;  3HP6 A;  4I2Q A;  1RDW X;  4RCH A;  3WQU A;  1S9E A;  2A1R A;  1XNR K;  2YNH A;  4AF1 A;  4HTU A;  1R59 O;  3CCR N;  5LMU K;  2O8E B;  4J2A A;  3RSE A;  2P9N B;  3AA3 A;  2OZM A;  4CBW A;  3K0S A;  1FK9 A;  4DG1 A;  4DV2 K;  1VQ7 N;  3IFR A;  2ZQB A;  2ZJR L;  2P9U B;  4O4G A;  4FK4 A;  3AVK A;  3VEZ A;  4MLE A;  4YHH K;  3DYA A;  4BGA A;  3TTC A;  4EP5 A;  1X3N A;  4DR2 K;  4FJ7 A;  1VSF A;  4CJR A;  4YOR A;  1U6Z A;  3O1B A;  4LFB K;  2D0P A;  1TK0 A;  1Q9Y A;  1IG8 A;  2LSN A;  2QWN A;  3J80 O;  1G15 A;  3DXM B;  4FVM A;  4KRF A;  2ITM A;  2OPS A;  4DTO A;  4IFE A;  1W97 L;  3QET A;  3KK3 A;  1JL2 A;  5CZ2 A;  5KQ8 A;  3AO4 A;  3SMS A;  2F8S A;  1RTJ A;  2V7Z A;  5MLC Q;  4CEA A;  5JVH L;  4I6M B;  1BIS A;  3AVN A;  4JHD B;  3PSF A;  1GLF O;  4FLV A;  4Z4G A;  4BRH A;  5BPN A;  1HMV A;  4RW8 A;  1KC8 O;  5A2Q O;  3EEQ A;  3P83 D;  1WSG A;  3DLE A;  2RPI A;  5D3G A;  4JRP A;  5KRS A;  2CH5 A;  1LW0 A;  3CI5 A;  3R3L A;  4Z4E A;  2UUA K;  1XWL A;  1MA9 B;  3VMF B;  1KAZ A;  2WON A;  3JSM A;  3QDK A;  4LSL A;  4CZI A;  1HNV A;  3U3G A;  1T6C A;  3CPW M;  5C24 A;  3TAQ A;  5DMR A;  2HNY A;  5C2F A;  2UU9 K;  3HK2 A;  4Z94 A;  4N76 A;  1QSY A;  3LDL A;  4FPB A;  2ZJP L;  1UWB A;  1VSH A;  3GDQ A;  3NAE A;  2WC9 A;  2B6A A;  4O8K A;  5M1N A;  1M90 O;  1VQL N;  4IJN A;  4I9L A;  1RT5 A;  1XI1 A;  1OH5 A;  2FXU A;  1V4T A;  2A40 A;  2QM1 A;  2QTD A;  3DLK A;  1SZ2 A;  3AVH A;  1MWK A;  4BRQ A;  1F21 A;  3O80 A;  4E7L A;  1I94 K;  4O0I A;  1EKE A;  3TSU A;  4KI6 A;  4UY8 O;  4OVL A;  3A5L C;  2KTQ A;  2RE2 A; 
#chains in the Genus database with same CATH homology
 2QWO A;  3HOS A;  3TU5 A;  3U9Z A;  1NGD A;  4U7B A;  4IOX A;  3C6H A;  3VF4 A;  1U2V A;  5AZJ A;  1RDU A;  1QZ5 A;  4JK9 A;  3T69 A;  3H6E A;  1VQ6 N;  3IKM A;  3IUC A;  4U67 L;  4H0P A;  1Q81 O;  1OKJ A;  2FSJ A;  2VCP A;  3U9D A;  4H03 B;  4JKA A;  1QQO A;  5FPN A;  5FPD A;  2V51 B;  4A5A A;  4JKG B;  3VF6 A;  1CZA N;  1GLL O;  3R1X A;  4CI6 A;  3CF5 L;  2A6A A;  3O9R A;  3D7E O;  3U4L A;  2GUP A;  4FOE A;  2QWL A;  3UKR A;  2ZF5 O;  2NZT A;  2CGK A;  3ENB A;  3AGK A;  1ATS A;  3GL1 A;  3CC2 N;  3AY9 A;  1NGB A;  2YJF A;  3C6A A;  3LL3 A;  3FE1 A;  3WXI A;  3ZYY X;  4BRP A;  4CZG A;  1NJI O;  3VES A;  1GLJ O;  3QFU A;  4XEI A;  4XH4 A;  3Q7B A;  2P9N A;  1T6D A;  2IVO A;  3I8B A;  3SBT A;  3O6W A;  5LY3 A;  3CCE N;  1H1V A;  3ENH A;  4C1N I;  5JLF A;  4WFN L;  2HBK A;  3DAW A;  3KZB A;  5M1P A;  2FSK A;  1JCF A;  1T44 A;  3D6R A;  1BA1 A;  1G99 A;  2KHO A;  4A61 A;  4BGB A;  1SAZ A;  3GG4 A;  3ZEU B;  3H3O B;  4BR7 A;  3ZET B;  1NLV A;  2ASM A;  1NGE A;  3VER A;  2P9L B;  4HWI A;  2GWJ A;  4JD2 B;  1VQM N;  3P38 A;  4FWP A;  5AQQ A;  4M7X A;  3KVG A;  1YIJ N;  4EHU A;  3P31 A;  2QW9 A;  3H1Q A;  3VTH A;  1HKB A;  3HI0 A;  1QQN A;  1C0G A;  3D2F A;  3SAH A;  4A2B A;  3LDN A;  3A5M C;  5AR0 A;  1YXQ A;  2Q36 A;  3MMV A;  3SLC A;  4DKW A;  2OTL N;  3PIO L;  5TKY A;  3VGK A;  2JWK A;  4FPA A;  2HMP A;  3VTI A;  1P8Z A;  3WXK A;  4PHT X;  2A5X A;  1NGI A;  2JWL A;  3EL2 A;  3A5N C;  3CJC A;  5F2R A;  1Z05 A;  1HPM A;  3H45 C;  3WEE A;  3DXM A;  4JNE A;  4BG9 A;  4IZ9 A;  3CIP A;  2BUP A;  3ULE B;  2BH1 A;  4BR0 A;  3CCU N;  4BRC A;  4HTL A;  5B8H A;  1Q18 A;  4H0O A;  4YDU A;  4NLC A;  3D2E A;  4BR2 A;  3J8A A;  1YUW A;  1W2B M;  4JK7 A;  1ZXO A;  4CD3 A;  1XUP O;  1Z6R A;  2VGN A;  3CQX A;  5KPT A;  4H5V A;  1NGF A;  4BY9 C;  4I6M A;  2AA4 A;  3PLA A;  3C7N A;  3ENO A;  3CET A;  3GOI A;  3FZK A;  4JHD A;  3L4Q A;  2H3G X;  2WFB A;  4WQ5 A;  4PL8 A;  4BVO A;  1K9M O;  3H46 O;  5AQI A;  1GLC G;  2NRV A;  2QA4 N;  4B1Y B;  3K9K A;  4BRM A;  3E66 A;  5AZI B;  2OTJ N;  3QIC A;  5ELZ A;  4CD1 A;  5AQP A;  5AQZ A;  2ASP A;  5EY4 A;  1BDG A;  4K43 A;  4ILJ A;  3S41 A;  4OPH A;  4YOX A;  4C23 A;  3FR0 A;  3H1V X;  4JK8 A;  5LJW A;  4WFA L;  4O5F A;  3GE1 A;  4GV3 A;  3KK7 A;  1K8K B;  2NRW A;  3HTV A;  1GLB G;  4B1Z A;  3EO3 A;  4QS7 A;  2Q2R A;  2J4R A;  2RHK A;  4B1U B;  3IMX A;  4FVU A;  2FSN A;  1JCG A;  2ZWH A;  3HRG A;  3CME N;  2OAN A;  4CBU A;  4B1V A;  3BF1 A;  5JMV A;  3P39 A;  3C0B A;  4JKB A;  3QFP A;  4F9O A;  1Q82 O;  4WYB A;  4CZL A;  1BO5 O;  4KH4 A;  1RFQ A;  3EN9 A;  1KAX A;  2YJE A;  3BP8 A;  2FF6 A;  4BRD A;  4MO5 A;  1TYQ B;  2QWQ A;  2YHX A;  2HBJ A;  2PFU A;  3RSE B;  2QWM A;  4O8U A;  1HLU A;  3KWG A;  4JKE A;  4EIA A;  5AQR A;  2P9K A;  4BRO A;  1S3X A;  2NRZ A;  4GVE A;  4JN4 A;  3TSP A;  1YJN N;  3FZH A;  3HZ6 A;  1U2V B;  5AZJ B;  4WCE L;  1K73 O;  3I55 N;  3CER A;  5HL7 L;  4IOC L;  4CZJ A;  4KH5 A;  3VEW A;  2WBN A;  3TTF A;  5AQL A;  3OBY A;  1ZBS A;  2E2P A;  2CH6 A;  3FZL A;  4BR9 A;  1VQK N;  3CHW A;  3SJH A;  5BRD A;  4ISG A;  4BC3 A;  3JXU A;  2NRH A;  4AM6 A;  4A2A A;  5GAD P;  3LDP A;  1MWM A;  3A5O C;  3BUZ B;  3M5R A;  3W0L A;  3CC7 N;  1E4F T;  4K41 A;  3L6Q A;  5BRE A;  2NRR A;  4IJA A;  3R8E A;  1ZC6 A;  3MN5 A;  5BRF A;  1GLD G;  4BG8 A;  5BR9 A;  1Q7Y O;  3PIP L;  2P9S B;  2HST A;  2P9P A;  5AQH A;  5AQK A;  3UKU A;  1YIT N;  1BU6 O;  3EE8 A;  4EFH A;  1XQS C;  1E4G T;  3VF2 A;  1YHQ N;  3C65 A;  4PKH A;  3BEX A;  4A5B A;  1YVN A;  1X9J A;  3MWP A;  3O9Q A;  3I56 N;  4JKH A;  1VQ4 N;  2BTF A;  3L4I A;  1OVY A;  3G71 N;  2GX9 A;  2IIR A;  3CJB A;  4BC5 A;  4WQ5 C;  4YOY A;  3CJ1 A;  2E8A A;  1YI2 N;  3CCV N;  2P9U A;  5AFU H;  3ZX3 A;  4EHT A;  1S72 N;  3LDO A;  5C2D A;  4YOT A;  3CMA N;  3AAR A;  3D2F B;  1X3M A;  4XH1 A;  3M3Z A;  3JS6 A;  2E20 A;  4FWL A;  3SMP A;  5CHI A;  3G4S N;  3CCM N;  4QS8 A;  3R6M A;  4IO8 A;  4L3Q A;  3U8X A;  4DCH A;  3I33 A;  1VQ9 N;  5F1X A;  3VEY A;  1YJ9 N;  3AGR A;  4GNI A;  2IVP A;  3NVM A;  4BRK A;  5BN8 A;  3WEE B;  2F9T A;  5C15 A;  4B1W B;  3FZM A;  1DGK N;  3MCP A;  1QZ6 A;  1VQ5 N;  1BA0 A;  4GY2 B;  2QEX N;  3ID8 A;  5AQF A;  5BPM A;  3D2E B;  4H5R A;  4JKC A;  4BRN A;  3ATV A;  2YX6 A;  1P90 A;  2V52 B;  3MN9 A;  3ATU A;  4IXC A;  4BVP A;  3ZEU A;  5GIP A;  4JEP A;  3VEN A;  1YAG A;  3F2K A;  3MN6 A;  2P9L A;  3C7N B;  4JD2 A;  3Q7C A;  2GTD A;  3O8M A;  3SK3 A;  2VWB A;  5EOY A;  2E2Q A;  5AFU A;  3LM2 A;  1GLA G;  5GAG P;  4MDB A;  2ZJQ L;  3MX5 A;  3VGM A;  3TTD A;  5AQU A;  4FWN A;  2E2O A;  3FZF A;  4EAH D;  4LC9 B;  5BRH A;  3O9U A;  3OW2 M;  3G6E N;  1T3V A;  5E84 A;  4H0Y B;  1NGA A;  4DB3 A;  3OA9 A;  3ZX0 A;  4CZE A;  5JIC A;  2FF3 B;  2GEL A;  2A3Z A;  5HOO A;  3OHR A;  3ZX2 A;  1LOT B;  3QBW A;  2KLA A;  4FSV A;  3ULE A;  3UB5 A;  4RWT A;  2V7Y A;  2NLX A;  4A57 A;  3VPZ A;  3NMU A;  3A0I X;  4R79 A;  5AQS A;  4CJ7 A;  2YI1 A;  3AAQ A;  4ISF A;  4IWV A;  1RGI A;  4BC4 A;  4FOI A;  1NGG A;  3O9S A;  3OBW A;  2Q0U A;  3RVC A;  4BQL A;  1IJJ A;  4BRF A;  5DM7 L;  3T7Z A;  4WFB L;  4JKD A;  3EZW A;  3WT0 A;  2P9I A;  5AQJ A;  1N8R O;  4YOV A;  3SBG A;  2WUS A;  2ZGY A;  4DHY A;  4B1X B;  2D4W A;  3BF3 A;  5AZI A;  1HUX A;  2QI2 A;  3O5B A;  1JCE A;  1HKC A;  3ID6 A;  1QVG M;  3DXK B;  4K42 A;  4RTF D;  1DT9 A;  3E9L A;  4NLB A;  1QHA A;  2P9K B;  2PAV A;  4QS9 A;  4WQ4 A;  2D0O A;  2I7N A;  5M1Q A;  4IO9 L;  2F9W A;  3KHY A;  2E88 A;  1TUU A;  1KXP A;  3CCS N;  4FWM A;  2E1Z A;  4BC2 A;  4CBX A;  3CC4 N;  5CE3 A;  1WUA A;  3R9P A;  3P4I A;  2IVN A;  2VGM A;  3WQT A;  1JJ2 M;  5C0Y A;  4H5N A;  5H1S Q;  3E1Y A;  1MDU B;  3O08 A;  2F7T A;  3E9P A;  5BPL A;  4PL7 A;  3QBX A;  3MX2 A;  1ATN A;  3KWI A;  2UYT A;  4FWK A;  4H0V B;  3WUH A;  1NGJ A;  3WXJ A;  3NVK A;  1BG3 A;  3F5T A;  3QB0 A;  4DQ8 A;  4IDH A;  2A41 A;  1RDW X;  4RCH A;  4Y0W A;  1HX1 A;  3UKR B;  1Y64 A;  3WQU A;  5GAE P;  3SAF A;  1VQ8 N;  4A62 A;  2P9P B;  4FL9 A;  5FPE A;  3M1F A;  1BOT O;  1K8A O;  3HOT A;  4AF1 A;  1R59 O;  3CCR N;  1S22 A;  4NO7 A;  3RSE A;  2P9N B;  3GBT A;  4YDU C;  4BRE A;  1DKG D;  4CBW A;  2CGJ A;  5AQY A;  2ZGZ A;  3FGU A;  5C10 A;  5FPM A;  4CZM A;  1M1K O;  1VQ7 N;  3CD6 N;  2AP1 A;  2E1Y A;  3IFR A;  2ZJR L;  1QVF M;  2P9U B;  2QWR A;  1J6Z A;  3VEZ A;  3CJ9 A;  4MLE A;  5M1O A;  1BWF O;  2GWK A;  3HSC A;  4IEI A;  4BRI A;  4PKI A;  4BGA A;  3TTC A;  1DEJ A;  3EKU A;  2HBL A;  3VOV A;  4ILG B;  3MK6 A;  1VQO N;  5GIO A;  2HF3 A;  1D4X A;  1X3N A;  4YOU A;  4C1N K;  3VEX A;  4JKG A;  2DPN A;  4YOR A;  3E9O A;  4PKG A;  5AQT A;  1U6Z A;  3O1B A;  5AQV A;  4ISE A;  2P9S A;  4AM7 A;  3G25 A;  2D0P A;  2VYP A;  5AQM A;  1VAZ A;  1IG8 A;  2HBM A;  1BUP A;  2EWS A;  2QWN A;  4MO4 A;  1NMD A;  3A8Y A;  5BN9 A;  3DXM B;  5GIN A;  2QWP A;  5E26 A;  4GV6 A;  2QXL A;  3CPE A;  3H3N O;  2ITM A;  3EKS A;  2Q1N A;  4H0X B;  4IFE A;  1W97 L;  5AQW A;  3MDQ A;  1EQY A;  2HF4 A;  3MWT A;  3CCL N;  3N4P A;  5KQ8 A;  5JVG L;  3SMS A;  2V7Z A;  4FWO A;  3ZET A;  1HJO A;  5MLC Q;  5JVH L;  2PBD A;  1GLE G;  4I6M B;  4FWR A;  1NGC A;  2D1K A;  4FO0 A;  4MDA A;  3CXC M;  4JHD B;  1GLF O;  3LM9 A;  2W41 A;  3B8A X;  3VET A;  4CZH A;  1Q86 O;  4IOA L;  1HKG A;  1C0F A;  4WQ4 C;  1YJW N;  2YHY A;  4BRH A;  5BPN A;  5M1K A;  1NGH A;  5JLH A;  1KAY A;  3K9J A;  4M7Y A;  1KC8 O;  3LDQ A;  2HOE A;  3M6G A;  2GEM A;  2Q97 A;  1V4S A;  4A59 A;  3WXM B;  4ILH A;  5AQO A;  4E1J A;  3FLC O;  4CZK A;  3VGL A;  2W40 A;  2NRT A;  4BRA A;  3DWL A;  3CCJ N;  1YF5 L;  4K25 A;  2CH5 A;  2CGL A;  3CI5 A;  4B9Q A;  1O13 A;  3HBT A;  4MLH A;  3HM8 A;  3CJ7 A;  3F9M A;  1XC3 A;  3R3L A;  3WXL A;  3SAG A;  5GAH P;  1VQN N;  4KH6 A;  1MA9 B;  3VMF B;  4BR4 A;  5C12 A;  5KPZ A;  4WF9 L;  4JKF A;  4FWQ A;  5EX5 A;  2NRX A;  1KAZ A;  2Q31 A;  1NBW A;  1ATR A;  2Q0R A;  3W3D A;  3CQY A;  2P9I B;  3QDK A;  1SS6 A;  4OPA A;  4BRL A;  4IEE A;  4GV9 A;  4CZI A;  5ADX H;  3MCA B;  3VEV A;  4CZF A;  3AAP A;  3QML A;  5AQG A;  1T6C A;  4J8F A;  5I9E B;  5DM6 L;  5AQX A;  3CPW M;  1EO1 A;  5CR4 A;  1NM1 A;  3UE5 A;  4H5W A;  4JAX A;  3L0Q A;  4BRG A;  5C2F A;  1WOQ A;  2KKZ A;  3O9T A;  4Z94 A;  5M1F A;  4YOW A;  3O1W A;  2E2N A;  3LDL A;  1TUY A;  4FPB A;  2ZJP L;  4XH5 A;  1LCU A;  3GDQ A;  3FFK B;  1NWK A;  3IDH A;  2WC9 A;  4M63 C;  5F0X A;  4H0T B;  5AQN A;  3DJC A;  2A42 A;  4O8K A;  5M1N A;  1M90 O;  1VQL N;  2NNW A;  3VEO A;  4IJN A;  1K8K A;  2YHW A;  5KQD A;  1ESV A;  4KBO A;  5EXW A;  4NB4 A;  2FXU A;  1V4T A;  3O4W A;  1VQP N;  4H5T A;  2A40 A;  2QM1 A;  1SQK A;  2QTD A;  5EVZ A;  2I7P A;  1SZ2 A;  1ILY A;  1QQM A;  1MWK A;  4BRQ A;  5ADX A;  3TPQ A;  3O80 A;  5LJV A;  2YCH A;  1KQS M;  3CJA A;  3TSQ A;  1KD1 O;  3DXK A;  4G9Z A;  3UKU B;  4BR5 A;  3TSU A;  5KPR A;  3DLL L;  4UY8 O;  4OO1 J;  3J7Z O;  3MN7 A;  3N4Q A;  3CCQ N;  2FLO A;  3A5L C;  1TYQ A;  4FWS A;  2ASO A;  4BQZ A;  5TKW A;  2RE2 A;  3EE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...