3O9QA

Effector domain of ns1 from a/pr/8/34 containing a w187a mutation
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
121
structure length
121
Chain Sequence
b'PASRYLTDMTLEEMSRDWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEANDNTVRVSETLQRFAWRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nonstructural protein 1
publication title A Transient Homotypic Interaction Model for the Influenza A Virus NS1 Protein Effector Domain.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Protein binding
total genus 34
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3o9qA00
3P38A 3P39A 4OPAA 3L4QA 3O9RA 3F5TA 2RHKA 3O9SA 3EE9A 3EE8A 3OA9A 3KWGA 3RVCA 3O9QA 2KKZA 3M5RA 3O9UA 3O9TA 3P31A 3D6RA 4OPHA 2GX9A 3KWIA
chains in the Genus database with same CATH superfamily
1DEJA 3THXA 1ESVA 3MMVA 4HUEA 1KAZA 1RILA 3WNGA 5J2MA 3IAYA 3G71N 3SMPA 5LY3A 4G1QA 1C1AA 1YVUA 5M1PA 3RMAA 4V19S 1JL2A 2E1ZA 3JAMO 3D2EA 4J2BA 2NRVA 3MCPA 3HP9A 5FDLA 5K14A 2ZGZA 3KKRA 3WNFA 1TV6A 5FPNA 1VAZA 3CPEA 5I3UA 5C12A 4IOCL 4JI0K 3I8BA 2VCPA 2YNIA 3CQXA 4ZHRA 5M1NA 4O0JA 3VEZA 5LMUK 3FZMA 4FZZA 4BDPA 1VRUA 2YKNA 1NM1A 3O9SA 4KHQA 1WUAA 4IFVA 3ENBA 1LWFA 5IT9O 3ZT0A 3QDKA 3ZEUB 4RWTA 1YJWN 4IOAL 1GLDG 5AZJB 2P9LA 2VG5A 3WXLA 1RBSA 1NOZA 2Q0RA 3OYIA 2BE2A 4KPYA 1UA1A 5HLFA 3O5BA 2WBNA 3H6EA 2FBYA 4OPAA 5AQHA 4PKGA 4CZMA 1HPMA 2O8DA 5EY4A 3L4IA 4FM1A 4GW6A 3WXIA 4YDUA 4WQ4C 4FJMA 4KB1A 1N8RO 4CJ3A 2HHHK 1NU0A 4DTJA 3CD6N 1YTUA 2F8SA 4EHUA 3FLCO 2QKBA 3P83D 3WT0A 1QZ5A 3T1HK 2GELA 4I2PA 3H1QA 3HPOA 4DV7K 3P39A 3QEPA 4LFCK 4DMNA 4CJUA 1YAGA 3G10A 1YVNA 1KXPA 3L3VA 1O13A 3MWPA 1TKXA 3IRXA 4H8KA 2QEXN 5HRSA 3MN6A 2FSNA 5AQRA 2D0OA 4GKKK 3M6GA 4H03B 5AQIA 4CZGA 3P4IA 5GIOA 3VF4A 4X65K 2OPSA 1NJIO 1IKVA 4WF9L 4NXMK 2QWRA 3P31A 3HXMA 3HZ6A 1MWKA 3E9OA 5KI6A 3Q7BA 3NGYA 2HNYA 2I7PA 4CHPA 4BRDA 3KLIA 4E89A 4E0DA 2YNFA 3SK3A 4B1WB 5BN8A 3UKRA 2FF6A 3F73A 2IAJA 3HSCA 3KWGA 3C0BA 2X6NA 5JLHA 5AJ3K 1T05A 1RDCA 4JI2K 3AVNA 4DFKA 3D6RA 2ITGA 4YOUA 3KK2A 4JKGB 1X9JA 2D5RA 1GLFO 1IV0A 4NYNA 1LW0A 5M1QA 3AVIA 4KKOA 3BZKA 3WEEB 3ULEB 4IOXA 3QNOA 3AV9A 4KI6A 3PUFA 2FLOA 2E6MA 1ZYQA 1J54A 4NYFA 4DTPA 4BREA 3O4QA 1HX1A 4BR2A 1KQSM 5CYQA 1WSJA 2PY5A 3DLBA 2DTUA 1HRHA 4FJJA 1S1TA 4M3ZA 3VENA 3K5LA 4H0XB 2P9UA 3JYTA 2FBTA 2QK9A 1TK0A 3O08A 2ATQA 5AQOA 5M1KA 3AVBA 5C25A 1NK4A 3PY8A 1T3VA 3HM8A 3AA3A 3TU5A 2EX3A 3V9UA 2Z1IA 3OJUA 4MO4A 5I42A 1NGHA 3QEXA 4B3OA 5AQSA 4KV8A 4JKFA 3NMUA 3M8QA 3V1RA 1VQLN 1D9FA 4XIUA 4FJ8A 1SKWA 3AGKA 3T3FA 1JLCA 3AVMA 3G25A 2HBJA 3VQPA 4ID1A 2IGIA 4B9LA 3AVJA 3AAPA 2O8FB 1XNQK 4B3MK 4ILJA 3O3FA 4OKKA 1SKRA 4CBWA 1IG9A 3GE1A 4M45A 3VQ8A 4PWDA 2Q97A 2VGMA 1VSLA 3PIPL 2O8CB 3TSPA 4DQQA 4DV5K 1LOTB 4O8KA 2VWBA 4QS7A 3NDKA 2V7ZA 1Q7YO 4EZ9A 3AA5X 3M8SA 2ASPA 4QOZB 4CEEA 4C8LA 3VTHA 1ATSA 2OPRA 3PV8A 2G8HA 5A2QO 5AQPA 4E19A 5C2DA 2E5LK 1U4BA 1QQCA 3NVKA 2A6AA 1XHXA 2CGJA 4CZFA 2A5XA 3CF5L 3ITHA 5TKYA 3E9LA 4WCEL 3K59A 4LSNA 4NCGA 4DS4A 4ISGA 1KFSA 1YHQN 3L2WA 4JRQA 1QE1A 2DFEA 1TAUA 3K58A 1QVGM 1JCEA 2VQFK 2KW4A 3QEWA 3THWB 1QVFM 2YI1A 2JWLA 1LWCA 3ZSRA 4BR0A 2PYLA 2ZD1A 2IS3A 3LDSA 3OYCA 4FJHA 3AVCA 3MX2A 5MLCQ 4F2SA 4FZXC 4J2EA 4FJGA 2BANA 3L2RA 3CCUN 3F9MA 1L3TA 4FWLA 5JMVA 1VQPN 2A42A 3DRPA 3QINA 4K42A 3N4PA 1RNHA 5FROA 3CETA 2RHKA 3R3LA 5AQGA 4AM7A 4HWIA 3L4QA 1T44A 3C95A 1HPZA 3EE9A 4W5OA 1J53A 3BP8A 1YI2N 4DSKA 3QFUA 2V52B 4HVJA 3J8AA 4JEPA 2VG7A 4WQ4A 4DF4A 3PX0A 2ZE2A 4H5TA 3OYFA 1KVAA 3DXMB 4GY2B 2QWPA 2YKMA 2Y1IA 4FJKA 1U47A 4EFHA 3ZT2A 4RTFD 4M3RA 1JLFA 3IKMA 3AO3A 4CF0A 2QWLA 3LALA 5IWAK 1Z05A 1BU6O 4WFNL 3PLAA 3SJHA 1HKCA 3S3OA 3SUNA 4DR2K 3DXKA 2ZJRL 3A2FA 4N5SA 5AQVA 5GADP 3DXMA 4DTSA 3SQ2A 1I3AA 2I7NA 1WBBA 4JYAK 3M1FA 1NJYA 1FK9A 5HRNA 2YHXA 5FPEA 4B3SK 1RDDA 1Q9YA 1KVBA 1TGOA 2KLAA 4ELVA 3VQ6A 3QNNA 2NRWA 4QAGA 3PX4A 1SL0A 4OX9K 4O5FA 4CGGA 1DGKN 2IVNA 3MN7A 3DOLA 1IBLK 3CC4N 1JLBA 1NGCA 1QHTA 3DLLL 4LH4A 3TI0A 2G8FA 3BGRA 1XHZA 3ZYYX 1IKWA 4OLAA 4LSLA 3NGIA 1HNZK 1JLAA 2RKIA 3ULDA 4CFBA 3C7NA 1R0AA 5AQNA 1S1WA 4AHRA 4JKCA 5DM6L 4ZTJA 1S72N 5AR0A 3OVNA 3VF2A 1B9DA 2D0PA 1SL1A 3E66A 4JK8A 2HMIA 4GV3A 1NGDA 1SZ2A 3ZCMA 4W5QA 3MWTA 2YNGA 4IFEA 1GLEG 4Q5VA 3CQYA 3CCEN 3O4NA 3MX5A 4CJKA 5CHIA 1C0UA 2BTFA 2H3GX 5AFUH 3PO5A 1S1XA 4FJIA 3SYZA 4FJ5A 1OH7A 5J1EA 1HYVA 3KKSA 3NHGA 3SMSA 2PFUA 1WBDA 4B3TK 1ZC6A 5KRSA 1RT4A 4J2DA 2P9KA 4IZ9A 4B8CA 4JK7A 3E1YA 3VMFB 3HPGA 1CLQA 2B5JA 4RW7A 1NG9A 3THYB 2QW9A 5F1XA 1JLEA 4KH4A 4K25A 2FBXA 3HK2A 4FVMA 1NMNA 3WXJA 5T7BA 4CJ5A 4KTQA 2E2QA 1BGXT 4GVEA 3AA4A 3H45C 3KZBA 4HUFA 1GLLO 2NRRA 2YHYA 1KVCA 4DV6K 1C1CA 1RBUA 1N6QA 1VQNN 4CFDA 5AZIB 5BRDA 4CI6A 3I0SA 2A1SA 3G0ZA 3A0IX 4CGFA 3SV4A 4E7KA 3DRSA 3HYFA 1KRPA 1NWKA 3QBXA 4JD2B 4CIEA 4WFBL 1TL3A 5BRFA 3HRGA 4FCYA 4OPHA 3MECA 4JKEA 4AM6A 1RT6A 1QS4A 3MN5A 1NBWA 3LM9A 4DV3K 4IO8A 2UXBK 2GUIA 3A5MC 2QWNA 1W9HA 1GLAG 3IFRA 2QXLA 2VG6A 2P5GA 3BDPA 3SBTA 4FO0A 1HR0K 3AA2A 1HQUA 4JD2A 4DTNA 2W6KA 4DSJA 1WAJA 1T8EA 1SQKA 3D2FB 2WONA 3CJAA 4E1NA 4DU1A 4AHCA 3V9XA 3SV3A 4DUZK 3DLRA 4BC4A 4MDBA 3ZT3A 3CMAN 3SQ0A 4KTZA 1W7AA 2D1KA 4RW9A 2NZTA 3UB5A 1EWQA 3CM5A 3JXUA 1RT2A 1BISA 4KHWA 2VQEK 2IIRA 1Z25A 1Z26A 3LWLA 4FW1A 3VQQA 4XH5A 5C42A 3RVCA 3UKUB 1QQNA 4E7LA 3TANA 2HBLA 4JKDA 4DTUA 1CXUA 4FLUA 4H5NA 1ASVA 5EU7A 3HM9A 2KQ2A 4BQZA 4O8UA 3THXB 2CH5A 4B9MA 5LL6Z 1YT3A 1S6QA 3D2EB 1VQ7N 2FF3B 3AVFA 1HYZA 4OGCA 4CD1A 4JV5K 4MLEA 2HNZA 4K41A 1RGIA 3C6TA 4BR9A 2V51B 3RTVA 4CJQA 3VESA 1XMOK 3FGUA 2YCHA 4YOWA 4KHNA 3OYAA 4BRMA 4KAZA 3LDNA 3OS0A 1S9GA 4BRQA 4B08A 3TSQA 2OPQA 1VSHA 2HOEA 4RW8A 2UXCK 4K8ZA 1TYQA 3KLFA 2P9LB 4A61A 4JS4A 3AVAA 4DTMA 4N47A 2QTDA 2OZMA 1T6DA 4BWMA 1VSMA 5FLXO 5EOYA 4HCCA 4YORA 1X1PA 3MAQA 2HHTA 2O8DB 2IDOA 3AVHA 3SJJA 3O80A 2PAVA 2G8KA 4A59A 4IEIA 3LDQA 3L2VA 3PSIA 1YITN 1DKGD 1DLOA 4FLWA 3C6HA 4DLGA 4M3YA 4M41A 3ZSWA 4A2BA 3CJCA 3HBTA 2OPPA 4BROA 5HL7L 3IMXA 3SI6A 3K57A 1YTAA 4FWMA 3HI0A 1HLUA 4CEQA 4E7IA 3LAMA 3LZIA 3HVTA 3I33A 4IWVA 3D45A 4KH5A 4I2QA 3AO1A 3HL8A 4C8NA 4LF7K 4DR3K 5I9EB 4WE1A 2AJQA 5LJWA 3OW2M 1ZBLA 2GX9A 3EZWA 4U7BA 1UWBA 1OH5A 2KZMA 2XY7A 1E4FT 2WFBA 4CEZA 2UUCK 1SV5A 5C24A 4DV1K 2KZZA 3UKRB 4UQGA 4IJAA 1JL1A 4FJLA 3LM2A 3WQTA 3KVGA 1SS6A 3AVKA 3NH1A 3J81O 4W5TA 3V9WA 3T7ZA 4JHDA 4BVPA 1BCMA 4M7XA 1L3VA 3CQ8A 4J2AA 3MCAB 1FJGK 4BY9C 2LSNA 1YJ9N 3CJ9A 3LP2A 1ZBSA 2W6LA 5BR8K 1IBMK 3CCJN 2QWMA 4IO9L 3KK7A 3NE6A 3PIOL 1OKJA 3EYZA 2EWSA 2YJFA 5AQLA 2OTLN 2HVIA 3TTCA 1NMDA 3LANA 3M8PA 5BREA 2GWJA 3ENHA 5JICA 2P9UB 3C94A 1RDWX 4CF2A 3EKSA 5C2FA 4AHTA 1W2BM 5FRMA 3NCIA 4IG0A 2OCEA 3TABA 4AHUA 5HRRA 4MO5A 4DSLA 4BR4A 1VSKA 1BHLA 5KQDA 2QXFA 4DV2K 1OH8A 2J4RA 3K2PA 4BG8A 2Q2RA 1RBRA 4KHUA 5KGWA 3NVMA 1NNEA 3QEIA 4X64K 1ASWA 4IJNA 1L5UA 5CY4A 2O8BA 5GAHP 2YNHA 2OTJN 4CE9A 1UA0A 2E2NA 2GTDA 4H0TB 4NXNK 4Y0WA 5F0XA 4DU4A 1NKCA 2E6LA 4JI6K 1NK8A 4CD3A 4JI5K 4B9QA 4K43A 3VQ9A 2UU9K 1RFQA 3QB0A 3BF1A 4XH1A 2NRZA 1NOYA 5ADXA 1TUUA 4Q0BA 2XO7A 2D4WA 4C8OA 1T03A 2W41A 1BIUA 2JLEA 4ILGB 1K8AO 4GKJK 3SQ1A 2G8UA 2IC3A 3AO4A 5EXWA 5CZ1A 4H5RA 1A5XA 4CFCA 4FK4A 3U9DA 5AQTA 1C1BA 5CZ2A 4EIAA 1JKHA 5SWMA 3CJ7A 4R5PA 2O8EA 4LF5K 3KHYA 3SAGA 1U48A 5LJVA 5AQUA 3A8YA 1HQEA 1N33K 4JI4K 4PY5A 2NRHA 1U6ZA 3P5JA 4H0PA 4MQ3A 4KB0A 1WAFA 4E1JA 3GG4A 4KI4A 2W42A 5GINA 1ATNA 3DJCA 1HNXK 4KBOA 2Q3SA 5ELZA 3J7YP 1ZBIA 2ZGYA 3H3OB 4CHQA 2WC9A 3AO2A 3O9QA 5B8HA 4IEEA 4DWIA 4OLBA 4J8FA 1NGEA 4BRIA 1NJZA 3CCLN 5BN9A 3K9KA 3ISNC 4ISEA 1XC3A 4O4GA 1VQON 2HBMA 3K9JA 4B1YB 4ICLA 3HTVA 4LF6K 5FRNA 2PBDA 3LP3A 3OS1A 4H5WA 4PKIA 1BA1A 1HJRA 2HBKA 3L8BA 4FJNA 1D4XA 3FZKA 1K8KA 1EWRA 1WOQA 4W5RA 3L0QA 1A5VA 2DPNA 5DM7L 1GLJO 2HHQA 4HTUA 3HP6A 1GLBG 4OJRA 3C6AA 2FSJA 1RTIA 1WB9A 1E4GT 2XHBA 3VTIA 3OYJA 5GAEP 1N32K 5E26A 5HRPA 3ASMA 4M3WA 1C0TA 4DQPA 4C1NI 4F4KA 4CIFA 1M90O 2OA8A 1RT1A 4BE1A 3K0SA 2DY4A 3ZETA 2DFHA 3O9UA 3GDQA 1WSEA 1R59O 3DLKA 3CFRA 4H0VB 1U45A 3CFPA 3DXKB 4H0YB 3U4LA 3HJFA 3QO9A 3CERA 5C10A 4BC3A 3AGRA 3S3MA 4FLXA 4FLYA 1M1KO 4KFBA 4FWNA 4IKFA 5GAGP 4RW6A 4WYBA 5AQQA 3MXMA 2VGNA 3OYHA 2UUAK 2HF3A 3SLCA 5HBMA 5AQWA 3JSMA 2HF4A 4E7HA 2E8AA 3RR8A 3KTQA 1VQ5N 1HNIA 1OVYA 4CERA 3I8DA 3MXIA 1JJ2M 2HW3A 3LAKA 4A5AA 4JN4A 4JI1K 3SZ2A 3MEEA 1XQSC 3ZT4A 4Z4CA 2AP1A 3C7NB 3MEDA 4C1NK 2ZJPL 5AQYA 3OHRA 3VQDA 4AHVA 4B9VA 2YHAA 3E9PA 2XRIA 4FJXA 4IFYA 3AAQA 2XY6A 5BPNA 1HUXA 3OYGA 4CK3A 4CK1A 2HHUA 1RBVA 1G15A 4BGAA 2OZSA 1HKGA 4DQRA 3SQ4A 2QWOA 3FFIA 4FK0A 1GOAA 4FJ9A 3CPWM 3N4QA 1FW6A 3L6QA 2JWKA 3NAEA 3QETA 1RDAA 2WUSA 2HNDA 1GOCA 2OYQA 2P9NA 3M5RA 3OYNA 4HCBA 4M42A 4PA1A 4FYDA 3LDOA 4FPAA 2P9KB 3NF7A 1HKBA 1Q81O 3MK6A 2BGGA 3SNNA 2P9PA 4FJ7A 3EN9A 2YJEA 4BRNA 1K6YA 3DWLA 3H08A 4BVOA 4IG3A 2F7TA 3ZSYA 4GV6A 4HHTA 3QEVA 1VRTA 4AF1A 3ZSZA 4M63C 5HP1A 2F4VK 4RCHA 3J80O 5KPTA 4B9SA 1KC8O 1BWFO 4Z94A 1BUPA 1C0MA 2IVPA 3I55N 4BC2A 4DV0K 3TAPA 1MA9B 3DI6A 3CCRN 2QWQA 3B6PA 3R6MA 2OANA 5FPMA 3ZX2A 1D9DA 4K8XA 3O1BA 4WQ5C 3OYEA 2A40A 1X3NA 3T69A 1VQ9N 3CYMA 5C0YA 4DTOA 1KD1O 4ISFA 2Q36A 1I94K 3L3UA 1RCHA 2FC0A 3TAGA 3DYAA 4M3TA 2VYPA 4OPJA 5C15A 4DFPA 4JI3K 2FXUA 4ID5A 4F3OA 1P90A 4BE0A 3R8EA 4CGDA 3ZSVA 4FOIA 3RSEA 2QKKA 3QIOA 1VK0A 1KSPA 4L3QA 2G8IA 1BQNA 4WFAL 1NK7A 2HVHA 3K5MA 3G6EN 2CH6A 3OJSA 4YY3K 1DTTA 4KTWA 4OPKA 3HVRA 4N56A 1BDGA 3CCQN 4OO1J 4RG8A 4Z4FA 4DQIA 2ZWHA 1F21A 2UXDK 1TK5A 1KAXA 4JKBA 2E1YA 4QCLA 1N34K 4X66K 4I6MA 2GEMA 3NF9A 5E84A 1XNRK 3MDQA 3VPZA 3LP0A 2Q1NA 1LCUA 2F9WA 5CR4A 3TWHA 5GIPA 4FLZA 1J5EK 4BRGA 3OYLA 3OYBA 1NLVA 3ATVA 4F2RA 3O3HA 3IS9A 2GWKA 3V1QA 4A62A 3LPUA 5KRTA 1N36K 3W0LA 1W0HA 3QLHA 2GUPA 4CZJA 3ZX0A 3P38A 3OTOK 4FL9A 2QA4N 3VOVA 3F9KA 1QQOA 3FFKB 2ETJA 3HSTB 4DS5A 5JLFA 3VEWA 2YHBA 1QHAA 3EL2A 4JKAA 2HHVA 4OVLA 1EP4A 3EE8A 4CJFA 4H5VA 3LZJA 4B9TA 3T1AA 4PHTX 3TPQA 3TAEA 4JI8K 3VERA 1YIJN 1BI4A 3DMJA 2HHSA 4Z4HA 5AQFA 2O4GA 4R79A 1QTMA 1REVA 4DB3A 1VSJA 3U8XA 1KLMA 1BIZA 4LY7A 1NGJA 4OGEA 4CF8A 1NK6A 4PUOA 1JLGA 3FZLA 4YNQA 4CEFA 4FWKA 2XY8A 4HTLA 4DSIA 3O8MA 2NUBA 1H1VA 4CZIA 4DFMA 3TARA 4DR6K 3KJVA 2IOCA 3DM2A 3U6FA 1J5OA 3OYDA 1HNVA 4KHPK 5J2NA 3VEXA 1TUYA 2PZSA 2E88A 4Y1CA 1WSIA 4G9ZA 1TYQB 4JI7K 2P9IA 3AVLA 1T6CA 2P9SA 4MDAA 4C23A 1FXXA 3CJBA 4DKWA 3QMLA 4BR7A 5TKWA 2X74A 4IDHA 4EP5A 3BY5A 3O6WA 2P1JA 2FBVA 4CF1A 2O4IA 3MXJA 3Q7CA 3L2UA 1S9EA 4DR1K 4YOXA 3SUQA 2KFZA 3ALYA 3DOKA 4BE2A 3WNEA 4F9OA 2NLXA 4DLEA 4DG1A 3AARA 1MWMA 3VN5A 3R1XA 3W3DA 4Z4GA 4CBXA 1S1UA 1C0GA 4CJVA 4YOVA 4EZ6A 1LAWA 3OYMA 4BG9A 1XC9A 4BGBA 4DTXA 1RDUA 4DCHA 2ZF5O 4JAXA 4ELUA 3CG7A 1FKPA 5AQZA 3NF8A 4B9UA 4LD0A 4RW4A 3KLHA 2KKZA 3A5LC 3OBWA 1VQMN 2XY5A 4EAHD 1NJWA 1WSHA 2DFFA 4MFBA 4X62K 4GV9A 3CXCM 4O44A 1Q82O 1I39A 4LH5A 3OY9A 3K5NA 1DT9A 1IH7A 4LF4K 3VQ7A 4YHHK 3RRGA 3S41A 1U49A 2F8TA 2ZQBA 4BRLA 3AY9A 1TK8A 4CZKA 2JGUA 2UYTA 4JKHA 4JHDB 1YXQA 2Z1HA 2EHGA 3SPYA 3CC7N 4LFBK 3RMDA 1QSSA 3BEXA 1KAYA 4CFAA 4B9NA 1EKEA 4B1ZA 1B9FA 3QFPA 4CF9A 1VSIA 1C0FA 2RPIA 1VSDA 4EP4A 1QSLA 3VQAA 4AH9A 3ZEUA 3CCVN 4PKHA 1WSFA 3CCSN 3SUOA 4C8MA 2YV0X 3EY1A 4OKEA 3ZLJA 1EO1A 5AZJA 5BPMA 1JXEA 3QICA 5BR9A 1XI1A 1JCGA 3EO3A 3WNHA 3PX6A 3VF6A 3NGZA 4FM2A 4I9LA 2HSTA 4CHYA 2BH1A 2HB5A 1VQ6N 1RT3A 1XMQK 2NRXA 1NGGA 1LW2A 1KTQA 3DLHA 4WQ5A 3GL1A 4CZLA 1LWEA 1BO5O 1CZAN 1HNWK 2RN2A 4CESA 4CHOA 1BA0A 3IUCA 3KK3A 2A3ZA 4YFUA 4B1VA 3LPTA 1NGBA 3VQBA 3BF3A 4BC5A 3WUHA 4CGIA 4DU3A 3ZSQA 1BG3A 2AA4A 1QQMA 3TR8A 4CJEA 2O8BB 4KHYA 5ADXH 3LP1A 3CHWA 4QS9A 1ZBHA 4TSXA 2E2PA 5BPLA 3CJ1A 1J6ZA 4AQYK 1NJXA 3ATUA 1NK5A 4DSFA 4FW2A 3HT3A 1NKBA 4BR5A 5JVGL 4L8RB 4DQSA 3S3NA 4NCAA 2KHOA 3C65A 3AO5A 1QZ6A 3SAHA 1SL2A 4CIGA 4E1MA 2F96A 1TKTA 3BZCA 4KO0A 3VEOA 3LDPA 4ILHA 1NGAA 1GLCG 4JKGA 3KWIA 2X78A 1KFDA 1VQ8N 4EHTA 3HO1A 1IJJA 4FLTA 3V1OA 1IG8A 4CGHA 4DQ8A 3WEEA 2E2OA 4BRAA 3ULEA 2O8EB 4BRKA 1U04A 1X9WA 2FSKA 1VQ4N 1ZBUA 4DR5K 4CEAA 4CW7B 5LMNK 4H4MA 2ZJQL 1GOBA 3CM6A 1JXBA 5HROA 5H1SQ 1P8ZA 3LL3A 3TAMA 1EX4A 3D7EO 3JS6A 4CHNA 3HOSA 3NBPA 1L3SA 3E01A 5AQJA 1NKEA 5M1OA 1S5JA 4BWJA 4GMJB 4DTRA 5BRHA 3HOTA 2ASOA 4H0OA 3KD1E 4CCHA 4JNEA 1EQYA 5F2RA 3R9PA 5AQMA 3KIOA 4FZYA 4BDYA 3QBWA 3A5OC 2A1RA 1S1VA 4CHZA 4B1UB 1RTHA 3VETA 4FLVA 1FKOA 4CJRA 1VSEA 1U2VB 2A41A 5DK5A 2KTQA 1K8KB 2O8FA 3T1YK 1WN7A 3VA3A 3THVA 1ZXOA 3H1VX 2O8CA 1LAVA 3P1GA 1IO2A 2E20A 2I5JA 2UUBK 4NO7A 4KHSA 4A5BA 1NGFA 5M1FA 3VEYA 3DRRA 4YOYA 3U3GA 1OH6A 4ELTA 1U2VA 1J9AA 3ZETB 2ITMA 5CYMA 3SUPA 3I56N 5HOOA 3KLEA 2D0BA 3ZT1A 3ZSOA 4O5BA 1Y64A 3IDHA 4BRHA 4C8KA 3FZFA 1EETA 2V7YA 2E4LA 4Z0UA 4UY8O 3I0RA 3QESA 3NH0A 4E3SA 5JVHL 5EVZA 1YUWA 4AILC 3THWA 3V4IA 2NRTA 4BQLA 1X9SA 4CJTA 3J7ZO 4GNIA 4ZTFA 1X9MA 4Y1DA 3VEVA 4A2AA 4XH4A 4CECA 2W40A 4FPBA 4W5NA 1E3MA 1VHXA 1A5WA 1X3MA 2QI2A 3NF6A 3VQEA 3O3GA 4U67L 4B3RK 1K9MO 3TTDA 2Q31A 4JS5A 4JLHA 3O9TA 4K0KK 4DR7K 4CJPA 5KGXA 1TL1A 1ZBFA 4JK9A 3V81A 4DF8A 1D5AA 5J2QA 1WSGA 1Q18A 1D8YA 3RRHA 1RTJA 4BRFA 1VSFA 2RF2A 2Z1JA 4DSEA 1K73O 4N76A 2WOMA 1Q8IA 1HJOA 3KK1A 3ZX3A 1CZBA 3VGLA 3GOIA 3VA0A 2P9NB 4H4OA 3RMBA 4BACA 4IXCA 1S22A 4FVUA 3F2KA 1RDBA 3SCXA 2P9PB 1N5YA 3CMEN 4F3TA 1RT5A 1O1WA 2IVOA 1MU2A 3UIQA 4I7FA 5E41A 3FR0A 4NB4A 3RMCA 2BDPA 3V6DA 5KPZA 4FM0A 1V4TA 4O0IA 1BL3A 3OS2A 1ASUA 4CEDA 4BRCA 1EXQA 2PYJA 4YOTA 4YDUC 4CEOA 4CZHA 5JS1A 2B4JA 4FWRA 4I9QA 4OKJA 3CC2N 3UE5A 1TKZA 1WNSA 5KPRA 2Q0UA 4PL8A 2P5OA 2CGLA 5J2PA 3CFOA 5AQXA 4M7YA 3VQ5A 4M3UA 4CJSA 3M3ZA 3S9HA 4LF9K 1RBTA 4QS8A 2R7YA 3H3NO 3ID6A 2GBZA 4A57A 2ZM6K 4PQUA 1ILYA 4O55A 4DV4K 3RSEB 1C6VA 1SUQA 3BUZB 3F5TA 3J7AP 1BQMA 1CZ9A 1SAZA 2G8WA 1CXQA 5JS2A 3ZSXA 5SZTA 1V4SA 4XEIA 3D0PA 1QSYA 4GVMA 3OYKA 1VQKN 4DUYK 3TAFA 3C6UA 4LC9B 3DLGA 3O4WA 3KLGA 4NCBA 1Y97A 4I6MB 1NGIA 3EKUA 4FWSA 2RE2A 4DR4K 4FK2A 3EEQA 4CZEA 1XUPO 4FSVA 3K5OA 3T19A 3RWUA 4E7JA 2QM1A 3GBTA 1YF5L 3VGMA 4JRPA 4IDKA 4DFJA 1MDUB 4KRFA 4LFAK 1KCFA 1S6PA 2BUPA 1YJNN 3VQCA 1ITGA 4FXDA 4F8RA 3CCMN 4BRPA 2VWJA 4CJWA 3THYA 3WXMB 3TAQA 3NFAA 2G8VA 3MN9A 5FPDA 3FZHA 4CEBA 4MLHA 1JCFA 5AFUA 3TSUA 3EZ5A 3WQUA 3CIPA 3DAWA 3SBGA 4DHYA 4KREA 1BI4B 4FOEA 3SPZA 3RR7A 1KLNA 2YHWA 1B92A 2B6AA 1RTDA 4N41A 2P51A 3O1WA 4KH6A 3DLEA 4Z4EA 5AZIA 5EX5A 1XWLA 3ID8A 1NK9A 1Q9XA 3O9RA 3VGKA 3V9SA 3VQ4A 1DTQA 4CJ4A 4FWOA 1T7PA 1TVRA 4CJLA 1UAXA 3L2QA 1BCOA 3B6OA 1NK0A 4CK2A 1BOTO 2GV9A 4CBUA 2KFNA 2ASMA 5AQKA 4FWQA 2CGKA 3LWMA 3V9ZA 4PL7A 2HHWA 2P9IB 1WLJA 5KTQA 3AVGA 2P9SB 1HMVA 1L3UA 1IBKK 2F9TA 3WXKA 3OBYA 3PSFA 1UOCA 2VWKA 3ENOA 3SAFA 2HHXA 4FWPA 4IBNA 3U9ZA 4M3XA 4NLCA 4CJ7A 4HUGA 1TAQA 1S3XA 3OA9A 3U3YA 2Y1JA 1IKYA 1TKDA 1RT7A 2WTUA 2Z1GA 1G99A 4CVNE 3CI5A 2NNWA 3MEGA 2D0AA 3D2FA 3G4SN 3KD5E 1ATRA 3M8RA 3FE1A 3TTFA 4Z4IA 4NLBA 4B1XB 3NH2A 1W97L 4BDZA 3H46O 2D0CA 3A5NC 3QIPA 2YX6A 3IG1A 3PO4A 5DMRA 2HMPA 5D3GA 1Z6RA 1LV5A 1JLQA 3QERA 4B8AB 1SKSA 1IKXA 1OVQA 3UKUA 3HPHA 4CGJA 4LF8K 2X6SA 5CE3A 1Q86O 5KQ8A 4AHSA 3B8AX 3LDLA 1HYSA
chains in the Genus database with same CATH topology
4IZ9A 1DEJA 2FSJA 3ATUA 1ESVA 3MMVA 1E4GT 4JK7A 3E1YA 3VMFB 1KAZA 3VTIA 5GAEP 5E26A 4BR5A 5JVGL 2QW9A 3G71N 3SMPA 5LY3A 5F1XA 5M1PA 2E1ZA 2KHOA 3D2EA 4KH4A 4K25A 3C65A 2NRVA 4C1NI 3MCPA 1QZ6A 1M90O 2ZGZA 3WXJA 3SAHA 5FPNA 2E2QA 4GVEA 3ZETA 1VAZA 3CPEA 3H45C 3O9UA 5C12A 3GDQA 3KZBA 1R59O 4IOCL 4H0VB 1GLLO 3I8BA 2NRRA 2YHYA 2VCPA 3VEOA 3LDPA 3CQXA 1NGAA 1GLCG 4ILHA 4JKGA 5M1NA 3KWIA 3DXKB 1VQNN 3VEZA 3FZMA 5AZIB 4CI6A 4EHTA 1IJJA 4H0YB 5BRDA 3G4SN 1VQ8N 3U4LA 3A0IX 3CERA 1NM1A 3O9SA 5C10A 1WUAA 4BC3A 1IG8A 4DQ8A 3ENBA 3AGRA 3WEEA 1NWKA 2E2OA 4BRAA 3ULEA 3QDKA 1M1KO 4BRKA 3ZEUB 3QBXA 4FWNA 4RWTA 2FSKA 4JD2B 5GAGP 1YJWN 1VQ4N 4WYBA 4WFBL 4IOAL 1GLDG 5AQQA 5AZJB 2P9LA 2ZJQL 2VGNA 3WXLA 5BRFA 2Q0RA 3HRGA 5H1SQ 1P8ZA 3LL3A 4JKEA 4OPHA 3D7EO 4AM6A 3JS6A 2HF3A 2WBNA 3H6EA 3O5BA 3SLCA 3HOSA 5AQWA 2HF4A 3MN5A 1NBWA 3LM9A 4OPAA 5AQHA 4IO8A 4PKGA 2E8AA 1HPMA 4CZMA 5EY4A 3L4IA 1VQ5N 3A5MC 2QWNA 1OVYA 5AQJA 3WXIA 1JJ2M 4YDUA 4WQ4C 1GLAG 3IFRA 2QXLA 4A5AA 4JN4A 5M1OA 1N8RO 1XQSC 5BRHA 3HOTA 3CD6N 2AP1A 2ASOA 3C7NB 4FO0A 3SBTA 4C1NK 4H0OA 4EHUA 3FLCO 4JD2A 4JNEA 1EQYA 3OHRA 5AQYA 5F2RA 3R9PA 1QZ5A 3WT0A 2ZJPL 5AQMA 3E9PA 1SQKA 3D2FB 3CJAA 3QBWA 2GELA 3A5OC 3AAQA 3H1QA 5BPNA 1HUXA 3P39A 4BGAA 1HKGA 4BC4A 1YAGA 4MDBA 3CMAN 2QWOA 4B1UB 1YVNA 1KXPA 2D1KA 2NZTA 3VETA 3UB5A 1O13A 3MWPA 3JXUA 2QEXN 3MN6A 3CPWM 1U2VB 2A41A 2D0OA 2FSNA 3L6QA 3N4QA 5AQRA 2IIRA 2JWKA 3M6GA 1K8KB 4H03B 4XH5A 3P4IA 5AQIA 3VF4A 4CZGA 3RVCA 5GIOA 2WUSA 3UKUB 1QQNA 1NJIO 2P9NA 3M5RA 4WF9L 2QWRA 3P31A 2HBLA 4JKDA 1ZXOA 3H1VX 3LDOA 3HZ6A 4H5NA 4FPAA 2P9KB 1MWKA 4BQZA 4O8UA 2E20A 3E9OA 1HKBA 3Q7BA 1Q81O 3MK6A 2CH5A 2P9PA 3EN9A 2YJEA 4BRNA 4NO7A 3DWLA 2I7PA 4A5BA 4BVOA 2F7TA 4BRDA 4GV6A 1NGFA 5M1FA 3SK3A 3D2EB 3VEYA 1VQ7N 4B1WB 5BN8A 3UKRA 4YOYA 2FF6A 2FF3B 4AF1A 1U2VA 3HSCA 3KWGA 4M63C 3C0BA 4RCHA 3ZETB 4CD1A 2ITMA 5JLHA 5KPTA 4MLEA 3I56N 4K41A 5HOOA 1KC8O 1RGIA 4BR9A 1BWFO 2V51B 1BUPA 4Z94A 2IVPA 3I55N 3D6RA 4YOUA 4BC2A 4JKGB 3VESA 3FGUA 1X9JA 2YCHA 1MA9B 1Y64A 4YOWA 1GLFO 3IDHA 2QWQA 4BRHA 3R6MA 3ZX2A 2OANA 3FZFA 5FPMA 4BRMA 3LDNA 2V7YA 3O1BA 5M1QA 4UY8O 4WQ5C 2A40A 1X3NA 3T69A 3WEEB 4BRQA 1VQ9N 3TSQA 3ULEB 5C0YA 4IOXA 5JVHL 5EVZA 1YUWA 2HOEA 1KD1O 2FLOA 4ISFA 2Q36A 1TYQA 2NRTA 2P9LB 2VYPA 4A61A 4BQLA 5C15A 4BREA 4BR2A 1HX1A 3J7ZO 1KQSM 4GNIA 2FXUA 3VENA 2QTDA 1P90A 4H0XB 1T6DA 2P9UA 3R8EA 3VEVA 4A2AA 4FOIA 5EOYA 3RSEA 4YORA 4L3QA 4XH4A 3O08A 5AQOA 2W40A 3O80A 4FPBA 4WFAL 5M1KA 1X3MA 2QI2A 3G6EN 2CH6A 1T3VA 4U67L 3HM8A 2PAVA 1K9MO 3TU5A 3TTDA 1BDGA 3CCQN 4OO1J 2Q31A 4A59A 4IEIA 3LDQA 1YITN 1DKGD 4MO4A 3C6HA 2ZWHA 3O9TA 1NGHA 1KAXA 4JKBA 2E1YA 4A2BA 3CJCA 4I6MA 3HBTA 4JK9A 5AQSA 2GEMA 5E84A 4BROA 4JKFA 5HL7L 3IMXA 3NMUA 1VQLN 1Q18A 3MDQA 3VPZA 2OTLN 4FWMA 2Q1NA 1LCUA 3AGKA 2F9WA 3HI0A 1HLUA 3G25A 4BRFA 2HBJA 5CR4A 5GIPA 1K73O 3I33A 4IWVA 4BRGA 1NLVA 3ATVA 3AAPA 1HJOA 4KH5A 3ZX3A 4ILJA 2GWKA 3GOIA 3VGLA 2P9NB 4A62A 5I9EB 4CBWA 3GE1A 5LJWA 4IXCA 3W0LA 3OW2M 2Q97A 1S22A 2VGMA 2GUPA 4CZJA 3PIPL 2GX9A 3EZWA 3TSPA 4FVUA 3ZX0A 3P38A 3F2KA 4U7BA 1LOTB 4FL9A 2VWBA 4O8KA 3VOVA 1QQOA 3FFKB 2QA4N 2P9PB 4QS7A 3CCLN 1E4FT 2V7ZA 3CMEN 5JLFA 1Q7YO 2WFBA 3VEWA 1QHAA 2IVOA 3EL2A 4JKAA 3EE8A 4H5VA 3FR0A 3UKRB 4PHTX 2ASPA 4NB4A 4IJAA 3TPQA 3LM2A 3VTHA 1ATSA 3VERA 5KPZA 1YIJN 3WQTA 3CCRN 3KVGA 5AQPA 1V4TA 1SS6A 5C2DA 5AQFA 4R79A 3NVKA 2A6AA 4DB3A 3T7ZA 3U8XA 4JHDA 4BRCA 1NGJA 4BVPA 2CGJA 4M7XA 3FZLA 4YOTA 4YDUC 4CZHA 4CZFA 2A5XA 3CF5L 3MCAB 4FWKA 4HTLA 5TKYA 3E9LA 3O8MA 1H1VA 4FWRA 4CZIA 4WCEL 4BY9C 1YJ9N 3CJ9A 1ZBSA 4ISGA 1YHQN 3CC2N 3UE5A 3VEXA 3CCJN 2QWMA 1QVGM 1JCEA 1TUYA 4IO9L 2E88A 5KPRA 3KK7A 2Q0UA 3PIOL 1OKJA 4PL8A 4G9ZA 1QVFM 2CGLA 2YI1A 1TYQB 2EWSA 2JWLA 2YJFA 5AQLA 5AQXA 4M7YA 3TTCA 1NMDA 2P9IA 1T6CA 3M3ZA 4BR0A 5BREA 2GWJA 2P9SA 4MDAA 4QS8A 4C23A 3H3NO 3ID6A 1ILYA 3ENHA 3CJBA 4A57A 2P9UB 4DKWA 5JICA 3QMLA 1RDWX 3RSEB 3EKSA 5C2FA 4BR7A 3MX2A 5TKWA 3BUZB 3F5TA 5MLCQ 4IDHA 1W2BM 1SAZA 3CCUN 3O6WA 3F9MA 3Q7CA 4MO5A 4BR4A 4FWLA 5JMVA 1VQPN 2A42A 4YOXA 1V4SA 4XEIA 4K42A 3N4PA 5KQDA 2J4RA 4F9OA 1VQKN 3CETA 4BG8A 2NLXA 3AARA 1MWMA 2Q2RA 2RHKA 3O4WA 3R3LA 4LC9B 5AQGA 3NVMA 4I6MB 3R1XA 4AM7A 1NGIA 3EKUA 4FWSA 3W3DA 4CBXA 4HWIA 2RE2A 1C0GA 3L4QA 4YOVA 1T44A 4CZEA 1XUPO 4FSVA 4IJNA 4BG9A 3EE9A 4BGBA 1RDUA 3BP8A 1YI2N 4DCHA 2QM1A 5GAHP 2ZF5O 4JAXA 3GBTA 2V52B 3QFUA 3J8AA 1YF5L 5AQZA 3VGMA 4JEPA 4WQ4A 2OTJN 2E2NA 2GTDA 2KKZA 4H0TB 3A5LC 4Y0WA 3OBWA 1VQMN 1MDUB 5F0XA 4EAHD 4H5TA 2BUPA 4CD3A 1YJNN 4GV9A 3DXMB 4B9QA 4K43A 3CCMN 3CXCM 1Q82O 4GY2B 2QWPA 4BRPA 1RFQA 3QB0A 1DT9A 3WXMB 3BF1A 3MN9A 4XH1A 3FZHA 5FPDA 2NRZA 4MLHA 4EFHA 1JCFA 5AFUA 5ADXA 4RTFD 3S41A 3TSUA 1TUUA 3WQUA 3CIPA 3DAWA 3IKMA 3SBGA 4BRLA 2D4WA 4DHYA 3AY9A 2QWLA 2W41A 4FOEA 4CZKA 2UYTA 2YHWA 4ILGB 1K8AO 1Z05A 1BU6O 4WFNL 4JKHA 3O1WA 4JHDB 3PLAA 4KH6A 3SJHA 1HKCA 1YXQA 3DXKA 3CC7N 2ZJRL 5AZIA 5EXWA 3BEXA 5EX5A 1KAYA 3ID8A 3DXMA 4H5RA 5AQVA 5GADP 4B1ZA 3O9RA 3VGKA 3QFPA 2I7NA 3M1FA 3U9DA 5AQTA 2YHXA 4EIAA 4FWOA 5FPEA 1C0FA 3CJ7A 2KLAA 1BOTO 4CBUA 3ZEUA 2ASMA 5AQKA 3CCVN 2NRWA 3KHYA 4PKHA 3SAGA 3CCSN 4FWQA 2CGKA 5LJVA 5AQUA 3A8YA 4PL7A 5AZJA 5BPMA 4O5FA 2P9IB 1EO1A 1DGKN 2IVNA 3MN7A 3QICA 2NRHA 5BR9A 1U6ZA 2P9SB 4H0PA 3CC4N 1JCGA 3EO3A 1NGCA 3DLLL 3VF6A 4E1JA 2F9TA 3WXKA 3GG4A 3OBYA 3ZYYX 3ENOA 3SAFA 2HSTA 4FWPA 3U9ZA 5GINA 2BH1A 1ATNA 3DJCA 4NLCA 4CJ7A 1VQ6N 4KBOA 2NRXA 1S3XA 1NGGA 3OA9A 5ELZA 2ZGYA 3C7NA 3H3OB 4WQ5A 3GL1A 4CZLA 2WC9A 5AQNA 1BO5O 1CZAN 3O9QA 4JKCA 5B8HA 4IEEA 1G99A 5DM6L 1S72N 3CI5A 5AR0A 1BA0A 3VF2A 2NNWA 3IUCA 4J8FA 3D2FA 2A3ZA 2D0PA 3E66A 4JK8A 4B1VA 1NGEA 4BRIA 4GV3A 1NGDA 1SZ2A 3MWTA 1NGBA 3K9KA 1ATRA 4ISEA 5BN9A 1XC3A 3FE1A 3TTFA 2HBMA 3BF3A 1VQON 4NLBA 4IFEA 4B1XB 1GLEG 4BC5A 3K9JA 3CQYA 3WUHA 1W97L 4B1YB 3H46O 3CCEN 3MX5A 3A5NC 3HTVA 1BG3A 2AA4A 2YX6A 1QQMA 5CHIA 2BTFA 2H3GX 2HMPA 2PBDA 4H5WA 4PKIA 1BA1A 5AFUH 5ADXH 2HBKA 1Z6RA 3CHWA 1D4XA 3FZKA 4QS9A 1K8KA 1WOQA 2E2PA 5BPLA 3LDLA 3UKUA 3L0QA 5DM7L 2DPNA 1GLJO 3CJ1A 1J6ZA 5CE3A 3SMSA 2PFUA 1Q86O 1GLBG 5KQ8A 3B8AX 1ZC6A 2P9KA 3C6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P38 A;  3P39 A;  4OPA A;  3L4Q A;  3O9R A;  3F5T A;  2RHK A;  3O9S A;  3EE9 A;  3EE8 A;  3OA9 A;  3KWG A;  3RVC A;  3O9Q A;  2KKZ A;  3M5R A;  3O9U A;  3O9T A;  3P31 A;  3D6R A;  4OPH A;  2GX9 A;  3KWI A; 
#chains in the Genus database with same CATH topology
 1DEJ A;  3THX A;  1ESV A;  3MMV A;  4HUE A;  1KAZ A;  1RIL A;  3WNG A;  5J2M A;  3IAY A;  3G71 N;  3SMP A;  5LY3 A;  4G1Q A;  1C1A A;  1YVU A;  5M1P A;  3RMA A;  4V19 S;  1JL2 A;  2E1Z A;  3JAM O;  3D2E A;  4J2B A;  2NRV A;  3MCP A;  3HP9 A;  5FDL A;  5K14 A;  2ZGZ A;  3KKR A;  3WNF A;  1TV6 A;  5FPN A;  1VAZ A;  3CPE A;  5I3U A;  5C12 A;  4IOC L;  4JI0 K;  3I8B A;  2VCP A;  2YNI A;  3CQX A;  4ZHR A;  5M1N A;  4O0J A;  3VEZ A;  5LMU K;  3FZM A;  4FZZ A;  4BDP A;  1VRU A;  2YKN A;  1NM1 A;  3O9S A;  4KHQ A;  1WUA A;  4IFV A;  3ENB A;  1LWF A;  5IT9 O;  3ZT0 A;  3QDK A;  3ZEU B;  4RWT A;  1YJW N;  4IOA L;  1GLD G;  5AZJ B;  2P9L A;  2VG5 A;  3WXL A;  1RBS A;  1NOZ A;  2Q0R A;  3OYI A;  2BE2 A;  4KPY A;  1UA1 A;  5HLF A;  3O5B A;  2WBN A;  3H6E A;  2FBY A;  4OPA A;  5AQH A;  4PKG A;  4CZM A;  1HPM A;  2O8D A;  5EY4 A;  3L4I A;  4FM1 A;  4GW6 A;  3WXI A;  4YDU A;  4WQ4 C;  4FJM A;  4KB1 A;  1N8R O;  4CJ3 A;  2HHH K;  1NU0 A;  4DTJ A;  3CD6 N;  1YTU A;  2F8S A;  4EHU A;  3FLC O;  2QKB A;  3P83 D;  3WT0 A;  1QZ5 A;  3T1H K;  2GEL A;  4I2P A;  3H1Q A;  3HPO A;  4DV7 K;  3P39 A;  3QEP A;  4LFC K;  4DMN A;  4CJU A;  1YAG A;  3G10 A;  1YVN A;  1KXP A;  3L3V A;  1O13 A;  3MWP A;  1TKX A;  3IRX A;  4H8K A;  2QEX N;  5HRS A;  3MN6 A;  2FSN A;  5AQR A;  2D0O A;  4GKK K;  3M6G A;  4H03 B;  5AQI A;  4CZG A;  3P4I A;  5GIO A;  3VF4 A;  4X65 K;  2OPS A;  1NJI O;  1IKV A;  4WF9 L;  4NXM K;  2QWR A;  3P31 A;  3HXM A;  3HZ6 A;  1MWK A;  3E9O A;  5KI6 A;  3Q7B A;  3NGY A;  2HNY A;  2I7P A;  4CHP A;  4BRD A;  3KLI A;  4E89 A;  4E0D A;  2YNF A;  3SK3 A;  4B1W B;  5BN8 A;  3UKR A;  2FF6 A;  3F73 A;  2IAJ A;  3HSC A;  3KWG A;  3C0B A;  2X6N A;  5JLH A;  5AJ3 K;  1T05 A;  1RDC A;  4JI2 K;  3AVN A;  4DFK A;  3D6R A;  2ITG A;  4YOU A;  3KK2 A;  4JKG B;  1X9J A;  2D5R A;  1GLF O;  1IV0 A;  4NYN A;  1LW0 A;  5M1Q A;  3AVI A;  4KKO A;  3BZK A;  3WEE B;  3ULE B;  4IOX A;  3QNO A;  3AV9 A;  4KI6 A;  3PUF A;  2FLO A;  2E6M A;  1ZYQ A;  1J54 A;  4NYF A;  4DTP A;  4BRE A;  3O4Q A;  1HX1 A;  4BR2 A;  1KQS M;  5CYQ A;  1WSJ A;  2PY5 A;  3DLB A;  2DTU A;  1HRH A;  4FJJ A;  1S1T A;  4M3Z A;  3VEN A;  3K5L A;  4H0X B;  2P9U A;  3JYT A;  2FBT A;  2QK9 A;  1TK0 A;  3O08 A;  2ATQ A;  5AQO A;  5M1K A;  3AVB A;  5C25 A;  1NK4 A;  3PY8 A;  1T3V A;  3HM8 A;  3AA3 A;  3TU5 A;  2EX3 A;  3V9U A;  2Z1I A;  3OJU A;  4MO4 A;  5I42 A;  1NGH A;  3QEX A;  4B3O A;  5AQS A;  4KV8 A;  4JKF A;  3NMU A;  3M8Q A;  3V1R A;  1VQL N;  1D9F A;  4XIU A;  4FJ8 A;  1SKW A;  3AGK A;  3T3F A;  1JLC A;  3AVM A;  3G25 A;  2HBJ A;  3VQP A;  4ID1 A;  2IGI A;  4B9L A;  3AVJ A;  3AAP A;  2O8F B;  1XNQ K;  4B3M K;  4ILJ A;  3O3F A;  4OKK A;  1SKR A;  4CBW A;  1IG9 A;  3GE1 A;  4M45 A;  3VQ8 A;  4PWD A;  2Q97 A;  2VGM A;  1VSL A;  3PIP L;  2O8C B;  3TSP A;  4DQQ A;  4DV5 K;  1LOT B;  4O8K A;  2VWB A;  4QS7 A;  3NDK A;  2V7Z A;  1Q7Y O;  4EZ9 A;  3AA5 X;  3M8S A;  2ASP A;  4QOZ B;  4CEE A;  4C8L A;  3VTH A;  1ATS A;  2OPR A;  3PV8 A;  2G8H A;  5A2Q O;  5AQP A;  4E19 A;  5C2D A;  2E5L K;  1U4B A;  1QQC A;  3NVK A;  2A6A A;  1XHX A;  2CGJ A;  4CZF A;  2A5X A;  3CF5 L;  3ITH A;  5TKY A;  3E9L A;  4WCE L;  3K59 A;  4LSN A;  4NCG A;  4DS4 A;  4ISG A;  1KFS A;  1YHQ N;  3L2W A;  4JRQ A;  1QE1 A;  2DFE A;  1TAU A;  3K58 A;  1QVG M;  1JCE A;  2VQF K;  2KW4 A;  3QEW A;  3THW B;  1QVF M;  2YI1 A;  2JWL A;  1LWC A;  3ZSR A;  4BR0 A;  2PYL A;  2ZD1 A;  2IS3 A;  3LDS A;  3OYC A;  4FJH A;  3AVC A;  3MX2 A;  5MLC Q;  4F2S A;  4FZX C;  4J2E A;  4FJG A;  2BAN A;  3L2R A;  3CCU N;  3F9M A;  1L3T A;  4FWL A;  5JMV A;  1VQP N;  2A42 A;  3DRP A;  3QIN A;  4K42 A;  3N4P A;  1RNH A;  5FRO A;  3CET A;  2RHK A;  3R3L A;  5AQG A;  4AM7 A;  4HWI A;  3L4Q A;  1T44 A;  3C95 A;  1HPZ A;  3EE9 A;  4W5O A;  1J53 A;  3BP8 A;  1YI2 N;  4DSK A;  3QFU A;  2V52 B;  4HVJ A;  3J8A A;  4JEP A;  2VG7 A;  4WQ4 A;  4DF4 A;  3PX0 A;  2ZE2 A;  4H5T A;  3OYF A;  1KVA A;  3DXM B;  4GY2 B;  2QWP A;  2YKM A;  2Y1I A;  4FJK A;  1U47 A;  4EFH A;  3ZT2 A;  4RTF D;  4M3R A;  1JLF A;  3IKM A;  3AO3 A;  4CF0 A;  2QWL A;  3LAL A;  5IWA K;  1Z05 A;  1BU6 O;  4WFN L;  3PLA A;  3SJH A;  1HKC A;  3S3O A;  3SUN A;  4DR2 K;  3DXK A;  2ZJR L;  3A2F A;  4N5S A;  5AQV A;  5GAD P;  3DXM A;  4DTS A;  3SQ2 A;  1I3A A;  2I7N A;  1WBB A;  4JYA K;  3M1F A;  1NJY A;  1FK9 A;  5HRN A;  2YHX A;  5FPE A;  4B3S K;  1RDD A;  1Q9Y A;  1KVB A;  1TGO A;  2KLA A;  4ELV A;  3VQ6 A;  3QNN A;  2NRW A;  4QAG A;  3PX4 A;  1SL0 A;  4OX9 K;  4O5F A;  4CGG A;  1DGK N;  2IVN A;  3MN7 A;  3DOL A;  1IBL K;  3CC4 N;  1JLB A;  1NGC A;  1QHT A;  3DLL L;  4LH4 A;  3TI0 A;  2G8F A;  3BGR A;  1XHZ A;  3ZYY X;  1IKW A;  4OLA A;  4LSL A;  3NGI A;  1HNZ K;  1JLA A;  2RKI A;  3ULD A;  4CFB A;  3C7N A;  1R0A A;  5AQN A;  1S1W A;  4AHR A;  4JKC A;  5DM6 L;  4ZTJ A;  1S72 N;  5AR0 A;  3OVN A;  3VF2 A;  1B9D A;  2D0P A;  1SL1 A;  3E66 A;  4JK8 A;  2HMI A;  4GV3 A;  1NGD A;  1SZ2 A;  3ZCM A;  4W5Q A;  3MWT A;  2YNG A;  4IFE A;  1GLE G;  4Q5V A;  3CQY A;  3CCE N;  3O4N A;  3MX5 A;  4CJK A;  5CHI A;  1C0U A;  2BTF A;  2H3G X;  5AFU H;  3PO5 A;  1S1X A;  4FJI A;  3SYZ A;  4FJ5 A;  1OH7 A;  5J1E A;  1HYV A;  3KKS A;  3NHG A;  3SMS A;  2PFU A;  1WBD A;  4B3T K;  1ZC6 A;  5KRS A;  1RT4 A;  4J2D A;  2P9K A;  4IZ9 A;  4B8C A;  4JK7 A;  3E1Y A;  3VMF B;  3HPG A;  1CLQ A;  2B5J A;  4RW7 A;  1NG9 A;  3THY B;  2QW9 A;  5F1X A;  1JLE A;  4KH4 A;  4K25 A;  2FBX A;  3HK2 A;  4FVM A;  1NMN A;  3WXJ A;  5T7B A;  4CJ5 A;  4KTQ A;  2E2Q A;  1BGX T;  4GVE A;  3AA4 A;  3H45 C;  3KZB A;  4HUF A;  1GLL O;  2NRR A;  2YHY A;  1KVC A;  4DV6 K;  1C1C A;  1RBU A;  1N6Q A;  1VQN N;  4CFD A;  5AZI B;  5BRD A;  4CI6 A;  3I0S A;  2A1S A;  3G0Z A;  3A0I X;  4CGF A;  3SV4 A;  4E7K A;  3DRS A;  3HYF A;  1KRP A;  1NWK A;  3QBX A;  4JD2 B;  4CIE A;  4WFB L;  1TL3 A;  5BRF A;  3HRG A;  4FCY A;  4OPH A;  3MEC A;  4JKE A;  4AM6 A;  1RT6 A;  1QS4 A;  3MN5 A;  1NBW A;  3LM9 A;  4DV3 K;  4IO8 A;  2UXB K;  2GUI A;  3A5M C;  2QWN A;  1W9H A;  1GLA G;  3IFR A;  2QXL A;  2VG6 A;  2P5G A;  3BDP A;  3SBT A;  4FO0 A;  1HR0 K;  3AA2 A;  1HQU A;  4JD2 A;  4DTN A;  2W6K A;  4DSJ A;  1WAJ A;  1T8E A;  1SQK A;  3D2F B;  2WON A;  3CJA A;  4E1N A;  4DU1 A;  4AHC A;  3V9X A;  3SV3 A;  4DUZ K;  3DLR A;  4BC4 A;  4MDB A;  3ZT3 A;  3CMA N;  3SQ0 A;  4KTZ A;  1W7A A;  2D1K A;  4RW9 A;  2NZT A;  3UB5 A;  1EWQ A;  3CM5 A;  3JXU A;  1RT2 A;  1BIS A;  4KHW A;  2VQE K;  2IIR A;  1Z25 A;  1Z26 A;  3LWL A;  4FW1 A;  3VQQ A;  4XH5 A;  5C42 A;  3RVC A;  3UKU B;  1QQN A;  4E7L A;  3TAN A;  2HBL A;  4JKD A;  4DTU A;  1CXU A;  4FLU A;  4H5N A;  1ASV A;  5EU7 A;  3HM9 A;  2KQ2 A;  4BQZ A;  4O8U A;  3THX B;  2CH5 A;  4B9M A;  5LL6 Z;  1YT3 A;  1S6Q A;  3D2E B;  1VQ7 N;  2FF3 B;  3AVF A;  1HYZ A;  4OGC A;  4CD1 A;  4JV5 K;  4MLE A;  2HNZ A;  4K41 A;  1RGI A;  3C6T A;  4BR9 A;  2V51 B;  3RTV A;  4CJQ A;  3VES A;  1XMO K;  3FGU A;  2YCH A;  4YOW A;  4KHN A;  3OYA A;  4BRM A;  4KAZ A;  3LDN A;  3OS0 A;  1S9G A;  4BRQ A;  4B08 A;  3TSQ A;  2OPQ A;  1VSH A;  2HOE A;  4RW8 A;  2UXC K;  4K8Z A;  1TYQ A;  3KLF A;  2P9L B;  4A61 A;  4JS4 A;  3AVA A;  4DTM A;  4N47 A;  2QTD A;  2OZM A;  1T6D A;  4BWM A;  1VSM A;  5FLX O;  5EOY A;  4HCC A;  4YOR A;  1X1P A;  3MAQ A;  2HHT A;  2O8D B;  2IDO A;  3AVH A;  3SJJ A;  3O80 A;  2PAV A;  2G8K A;  4A59 A;  4IEI A;  3LDQ A;  3L2V A;  3PSI A;  1YIT N;  1DKG D;  1DLO A;  4FLW A;  3C6H A;  4DLG A;  4M3Y A;  4M41 A;  3ZSW A;  4A2B A;  3CJC A;  3HBT A;  2OPP A;  4BRO A;  5HL7 L;  3IMX A;  3SI6 A;  3K57 A;  1YTA A;  4FWM A;  3HI0 A;  1HLU A;  4CEQ A;  4E7I A;  3LAM A;  3LZI A;  3HVT A;  3I33 A;  4IWV A;  3D45 A;  4KH5 A;  4I2Q A;  3AO1 A;  3HL8 A;  4C8N A;  4LF7 K;  4DR3 K;  5I9E B;  4WE1 A;  2AJQ A;  5LJW A;  3OW2 M;  1ZBL A;  2GX9 A;  3EZW A;  4U7B A;  1UWB A;  1OH5 A;  2KZM A;  2XY7 A;  1E4F T;  2WFB A;  4CEZ A;  2UUC K;  1SV5 A;  5C24 A;  4DV1 K;  2KZZ A;  3UKR B;  4UQG A;  4IJA A;  1JL1 A;  4FJL A;  3LM2 A;  3WQT A;  3KVG A;  1SS6 A;  3AVK A;  3NH1 A;  3J81 O;  4W5T A;  3V9W A;  3T7Z A;  4JHD A;  4BVP A;  1BCM A;  4M7X A;  1L3V A;  3CQ8 A;  4J2A A;  3MCA B;  1FJG K;  4BY9 C;  2LSN A;  1YJ9 N;  3CJ9 A;  3LP2 A;  1ZBS A;  2W6L A;  5BR8 K;  1IBM K;  3CCJ N;  2QWM A;  4IO9 L;  3KK7 A;  3NE6 A;  3PIO L;  1OKJ A;  3EYZ A;  2EWS A;  2YJF A;  5AQL A;  2OTL N;  2HVI A;  3TTC A;  1NMD A;  3LAN A;  3M8P A;  5BRE A;  2GWJ A;  3ENH A;  5JIC A;  2P9U B;  3C94 A;  1RDW X;  4CF2 A;  3EKS A;  5C2F A;  4AHT A;  1W2B M;  5FRM A;  3NCI A;  4IG0 A;  2OCE A;  3TAB A;  4AHU A;  5HRR A;  4MO5 A;  4DSL A;  4BR4 A;  1VSK A;  1BHL A;  5KQD A;  2QXF A;  4DV2 K;  1OH8 A;  2J4R A;  3K2P A;  4BG8 A;  2Q2R A;  1RBR A;  4KHU A;  5KGW A;  3NVM A;  1NNE A;  3QEI A;  4X64 K;  1ASW A;  4IJN A;  1L5U A;  5CY4 A;  2O8B A;  5GAH P;  2YNH A;  2OTJ N;  4CE9 A;  1UA0 A;  2E2N A;  2GTD A;  4H0T B;  4NXN K;  4Y0W A;  5F0X A;  4DU4 A;  1NKC A;  2E6L A;  4JI6 K;  1NK8 A;  4CD3 A;  4JI5 K;  4B9Q A;  4K43 A;  3VQ9 A;  2UU9 K;  1RFQ A;  3QB0 A;  3BF1 A;  4XH1 A;  2NRZ A;  1NOY A;  5ADX A;  1TUU A;  4Q0B A;  2XO7 A;  2D4W A;  4C8O A;  1T03 A;  2W41 A;  1BIU A;  2JLE A;  4ILG B;  1K8A O;  4GKJ K;  3SQ1 A;  2G8U A;  2IC3 A;  3AO4 A;  5EXW A;  5CZ1 A;  4H5R A;  1A5X A;  4CFC A;  4FK4 A;  3U9D A;  5AQT A;  1C1B A;  5CZ2 A;  4EIA A;  1JKH A;  5SWM A;  3CJ7 A;  4R5P A;  2O8E A;  4LF5 K;  3KHY A;  3SAG A;  1U48 A;  5LJV A;  5AQU A;  3A8Y A;  1HQE A;  1N33 K;  4JI4 K;  4PY5 A;  2NRH A;  1U6Z A;  3P5J A;  4H0P A;  4MQ3 A;  4KB0 A;  1WAF A;  4E1J A;  3GG4 A;  4KI4 A;  2W42 A;  5GIN A;  1ATN A;  3DJC A;  1HNX K;  4KBO A;  2Q3S A;  5ELZ A;  3J7Y P;  1ZBI A;  2ZGY A;  3H3O B;  4CHQ A;  2WC9 A;  3AO2 A;  3O9Q A;  5B8H A;  4IEE A;  4DWI A;  4OLB A;  4J8F A;  1NGE A;  4BRI A;  1NJZ A;  3CCL N;  5BN9 A;  3K9K A;  3ISN C;  4ISE A;  1XC3 A;  4O4G A;  1VQO N;  2HBM A;  3K9J A;  4B1Y B;  4ICL A;  3HTV A;  4LF6 K;  5FRN A;  2PBD A;  3LP3 A;  3OS1 A;  4H5W A;  4PKI A;  1BA1 A;  1HJR A;  2HBK A;  3L8B A;  4FJN A;  1D4X A;  3FZK A;  1K8K A;  1EWR A;  1WOQ A;  4W5R A;  3L0Q A;  1A5V A;  2DPN A;  5DM7 L;  1GLJ O;  2HHQ A;  4HTU A;  3HP6 A;  1GLB G;  4OJR A;  3C6A A;  2FSJ A;  1RTI A;  1WB9 A;  1E4G T;  2XHB A;  3VTI A;  3OYJ A;  5GAE P;  1N32 K;  5E26 A;  5HRP A;  3ASM A;  4M3W A;  1C0T A;  4DQP A;  4C1N I;  4F4K A;  4CIF A;  1M90 O;  2OA8 A;  1RT1 A;  4BE1 A;  3K0S A;  2DY4 A;  3ZET A;  2DFH A;  3O9U A;  3GDQ A;  1WSE A;  1R59 O;  3DLK A;  3CFR A;  4H0V B;  1U45 A;  3CFP A;  3DXK B;  4H0Y B;  3U4L A;  3HJF A;  3QO9 A;  3CER A;  5C10 A;  4BC3 A;  3AGR A;  3S3M A;  4FLX A;  4FLY A;  1M1K O;  4KFB A;  4FWN A;  4IKF A;  5GAG P;  4RW6 A;  4WYB A;  5AQQ A;  3MXM A;  2VGN A;  3OYH A;  2UUA K;  2HF3 A;  3SLC A;  5HBM A;  5AQW A;  3JSM A;  2HF4 A;  4E7H A;  2E8A A;  3RR8 A;  3KTQ A;  1VQ5 N;  1HNI A;  1OVY A;  4CER A;  3I8D A;  3MXI A;  1JJ2 M;  2HW3 A;  3LAK A;  4A5A A;  4JN4 A;  4JI1 K;  3SZ2 A;  3MEE A;  1XQS C;  3ZT4 A;  4Z4C A;  2AP1 A;  3C7N B;  3MED A;  4C1N K;  2ZJP L;  5AQY A;  3OHR A;  3VQD A;  4AHV A;  4B9V A;  2YHA A;  3E9P A;  2XRI A;  4FJX A;  4IFY A;  3AAQ A;  2XY6 A;  5BPN A;  1HUX A;  3OYG A;  4CK3 A;  4CK1 A;  2HHU A;  1RBV A;  1G15 A;  4BGA A;  2OZS A;  1HKG A;  4DQR A;  3SQ4 A;  2QWO A;  3FFI A;  4FK0 A;  1GOA A;  4FJ9 A;  3CPW M;  3N4Q A;  1FW6 A;  3L6Q A;  2JWK A;  3NAE A;  3QET A;  1RDA A;  2WUS A;  2HND A;  1GOC A;  2OYQ A;  2P9N A;  3M5R A;  3OYN A;  4HCB A;  4M42 A;  4PA1 A;  4FYD A;  3LDO A;  4FPA A;  2P9K B;  3NF7 A;  1HKB A;  1Q81 O;  3MK6 A;  2BGG A;  3SNN A;  2P9P A;  4FJ7 A;  3EN9 A;  2YJE A;  4BRN A;  1K6Y A;  3DWL A;  3H08 A;  4BVO A;  4IG3 A;  2F7T A;  3ZSY A;  4GV6 A;  4HHT A;  3QEV A;  1VRT A;  4AF1 A;  3ZSZ A;  4M63 C;  5HP1 A;  2F4V K;  4RCH A;  3J80 O;  5KPT A;  4B9S A;  1KC8 O;  1BWF O;  4Z94 A;  1BUP A;  1C0M A;  2IVP A;  3I55 N;  4BC2 A;  4DV0 K;  3TAP A;  1MA9 B;  3DI6 A;  3CCR N;  2QWQ A;  3B6P A;  3R6M A;  2OAN A;  5FPM A;  3ZX2 A;  1D9D A;  4K8X A;  3O1B A;  4WQ5 C;  3OYE A;  2A40 A;  1X3N A;  3T69 A;  1VQ9 N;  3CYM A;  5C0Y A;  4DTO A;  1KD1 O;  4ISF A;  2Q36 A;  1I94 K;  3L3U A;  1RCH A;  2FC0 A;  3TAG A;  3DYA A;  4M3T A;  2VYP A;  4OPJ A;  5C15 A;  4DFP A;  4JI3 K;  2FXU A;  4ID5 A;  4F3O A;  1P90 A;  4BE0 A;  3R8E A;  4CGD A;  3ZSV A;  4FOI A;  3RSE A;  2QKK A;  3QIO A;  1VK0 A;  1KSP A;  4L3Q A;  2G8I A;  1BQN A;  4WFA L;  1NK7 A;  2HVH A;  3K5M A;  3G6E N;  2CH6 A;  3OJS A;  4YY3 K;  1DTT A;  4KTW A;  4OPK A;  3HVR A;  4N56 A;  1BDG A;  3CCQ N;  4OO1 J;  4RG8 A;  4Z4F A;  4DQI A;  2ZWH A;  1F21 A;  2UXD K;  1TK5 A;  1KAX A;  4JKB A;  2E1Y A;  4QCL A;  1N34 K;  4X66 K;  4I6M A;  2GEM A;  3NF9 A;  5E84 A;  1XNR K;  3MDQ A;  3VPZ A;  3LP0 A;  2Q1N A;  1LCU A;  2F9W A;  5CR4 A;  3TWH A;  5GIP A;  4FLZ A;  1J5E K;  4BRG A;  3OYL A;  3OYB A;  1NLV A;  3ATV A;  4F2R A;  3O3H A;  3IS9 A;  2GWK A;  3V1Q A;  4A62 A;  3LPU A;  5KRT A;  1N36 K;  3W0L A;  1W0H A;  3QLH A;  2GUP A;  4CZJ A;  3ZX0 A;  3P38 A;  3OTO K;  4FL9 A;  2QA4 N;  3VOV A;  3F9K A;  1QQO A;  3FFK B;  2ETJ A;  3HST B;  4DS5 A;  5JLF A;  3VEW A;  2YHB A;  1QHA A;  3EL2 A;  4JKA A;  2HHV A;  4OVL A;  1EP4 A;  3EE8 A;  4CJF A;  4H5V A;  3LZJ A;  4B9T A;  3T1A A;  4PHT X;  3TPQ A;  3TAE A;  4JI8 K;  3VER A;  1YIJ N;  1BI4 A;  3DMJ A;  2HHS A;  4Z4H A;  5AQF A;  2O4G A;  4R79 A;  1QTM A;  1REV A;  4DB3 A;  1VSJ A;  3U8X A;  1KLM A;  1BIZ A;  4LY7 A;  1NGJ A;  4OGE A;  4CF8 A;  1NK6 A;  4PUO A;  1JLG A;  3FZL A;  4YNQ A;  4CEF A;  4FWK A;  2XY8 A;  4HTL A;  4DSI A;  3O8M A;  2NUB A;  1H1V A;  4CZI A;  4DFM A;  3TAR A;  4DR6 K;  3KJV A;  2IOC A;  3DM2 A;  3U6F A;  1J5O A;  3OYD A;  1HNV A;  4KHP K;  5J2N A;  3VEX A;  1TUY A;  2PZS A;  2E88 A;  4Y1C A;  1WSI A;  4G9Z A;  1TYQ B;  4JI7 K;  2P9I A;  3AVL A;  1T6C A;  2P9S A;  4MDA A;  4C23 A;  1FXX A;  3CJB A;  4DKW A;  3QML A;  4BR7 A;  5TKW A;  2X74 A;  4IDH A;  4EP5 A;  3BY5 A;  3O6W A;  2P1J A;  2FBV A;  4CF1 A;  2O4I A;  3MXJ A;  3Q7C A;  3L2U A;  1S9E A;  4DR1 K;  4YOX A;  3SUQ A;  2KFZ A;  3ALY A;  3DOK A;  4BE2 A;  3WNE A;  4F9O A;  2NLX A;  4DLE A;  4DG1 A;  3AAR A;  1MWM A;  3VN5 A;  3R1X A;  3W3D A;  4Z4G A;  4CBX A;  1S1U A;  1C0G A;  4CJV A;  4YOV A;  4EZ6 A;  1LAW A;  3OYM A;  4BG9 A;  1XC9 A;  4BGB A;  4DTX A;  1RDU A;  4DCH A;  2ZF5 O;  4JAX A;  4ELU A;  3CG7 A;  1FKP A;  5AQZ A;  3NF8 A;  4B9U A;  4LD0 A;  4RW4 A;  3KLH A;  2KKZ A;  3A5L C;  3OBW A;  1VQM N;  2XY5 A;  4EAH D;  1NJW A;  1WSH A;  2DFF A;  4MFB A;  4X62 K;  4GV9 A;  3CXC M;  4O44 A;  1Q82 O;  1I39 A;  4LH5 A;  3OY9 A;  3K5N A;  1DT9 A;  1IH7 A;  4LF4 K;  3VQ7 A;  4YHH K;  3RRG A;  3S41 A;  1U49 A;  2F8T A;  2ZQB A;  4BRL A;  3AY9 A;  1TK8 A;  4CZK A;  2JGU A;  2UYT A;  4JKH A;  4JHD B;  1YXQ A;  2Z1H A;  2EHG A;  3SPY A;  3CC7 N;  4LFB K;  3RMD A;  1QSS A;  3BEX A;  1KAY A;  4CFA A;  4B9N A;  1EKE A;  4B1Z A;  1B9F A;  3QFP A;  4CF9 A;  1VSI A;  1C0F A;  2RPI A;  1VSD A;  4EP4 A;  1QSL A;  3VQA A;  4AH9 A;  3ZEU A;  3CCV N;  4PKH A;  1WSF A;  3CCS N;  3SUO A;  4C8M A;  2YV0 X;  3EY1 A;  4OKE A;  3ZLJ A;  1EO1 A;  5AZJ A;  5BPM A;  1JXE A;  3QIC A;  5BR9 A;  1XI1 A;  1JCG A;  3EO3 A;  3WNH A;  3PX6 A;  3VF6 A;  3NGZ A;  4FM2 A;  4I9L A;  2HST A;  4CHY A;  2BH1 A;  2HB5 A;  1VQ6 N;  1RT3 A;  1XMQ K;  2NRX A;  1NGG A;  1LW2 A;  1KTQ A;  3DLH A;  4WQ5 A;  3GL1 A;  4CZL A;  1LWE A;  1BO5 O;  1CZA N;  1HNW K;  2RN2 A;  4CES A;  4CHO A;  1BA0 A;  3IUC A;  3KK3 A;  2A3Z A;  4YFU A;  4B1V A;  3LPT A;  1NGB A;  3VQB A;  3BF3 A;  4BC5 A;  3WUH A;  4CGI A;  4DU3 A;  3ZSQ A;  1BG3 A;  2AA4 A;  1QQM A;  3TR8 A;  4CJE A;  2O8B B;  4KHY A;  5ADX H;  3LP1 A;  3CHW A;  4QS9 A;  1ZBH A;  4TSX A;  2E2P A;  5BPL A;  3CJ1 A;  1J6Z A;  4AQY K;  1NJX A;  3ATU A;  1NK5 A;  4DSF A;  4FW2 A;  3HT3 A;  1NKB A;  4BR5 A;  5JVG L;  4L8R B;  4DQS A;  3S3N A;  4NCA A;  2KHO A;  3C65 A;  3AO5 A;  1QZ6 A;  3SAH A;  1SL2 A;  4CIG A;  4E1M A;  2F96 A;  1TKT A;  3BZC A;  4KO0 A;  3VEO A;  3LDP A;  4ILH A;  1NGA A;  1GLC G;  4JKG A;  3KWI A;  2X78 A;  1KFD A;  1VQ8 N;  4EHT A;  3HO1 A;  1IJJ A;  4FLT A;  3V1O A;  1IG8 A;  4CGH A;  4DQ8 A;  3WEE A;  2E2O A;  4BRA A;  3ULE A;  2O8E B;  4BRK A;  1U04 A;  1X9W A;  2FSK A;  1VQ4 N;  1ZBU A;  4DR5 K;  4CEA A;  4CW7 B;  5LMN K;  4H4M A;  2ZJQ L;  1GOB A;  3CM6 A;  1JXB A;  5HRO A;  5H1S Q;  1P8Z A;  3LL3 A;  3TAM A;  1EX4 A;  3D7E O;  3JS6 A;  4CHN A;  3HOS A;  3NBP A;  1L3S A;  3E01 A;  5AQJ A;  1NKE A;  5M1O A;  1S5J A;  4BWJ A;  4GMJ B;  4DTR A;  5BRH A;  3HOT A;  2ASO A;  4H0O A;  3KD1 E;  4CCH A;  4JNE A;  1EQY A;  5F2R A;  3R9P A;  5AQM A;  3KIO A;  4FZY A;  4BDY A;  3QBW A;  3A5O C;  2A1R A;  1S1V A;  4CHZ A;  4B1U B;  1RTH A;  3VET A;  4FLV A;  1FKO A;  4CJR A;  1VSE A;  1U2V B;  2A41 A;  5DK5 A;  2KTQ A;  1K8K B;  2O8F A;  3T1Y K;  1WN7 A;  3VA3 A;  3THV A;  1ZXO A;  3H1V X;  2O8C A;  1LAV A;  3P1G A;  1IO2 A;  2E20 A;  2I5J A;  2UUB K;  4NO7 A;  4KHS A;  4A5B A;  1NGF A;  5M1F A;  3VEY A;  3DRR A;  4YOY A;  3U3G A;  1OH6 A;  4ELT A;  1U2V A;  1J9A A;  3ZET B;  2ITM A;  5CYM A;  3SUP A;  3I56 N;  5HOO A;  3KLE A;  2D0B A;  3ZT1 A;  3ZSO A;  4O5B A;  1Y64 A;  3IDH A;  4BRH A;  4C8K A;  3FZF A;  1EET A;  2V7Y A;  2E4L A;  4Z0U A;  4UY8 O;  3I0R A;  3QES A;  3NH0 A;  4E3S A;  5JVH L;  5EVZ A;  1YUW A;  4AIL C;  3THW A;  3V4I A;  2NRT A;  4BQL A;  1X9S A;  4CJT A;  3J7Z O;  4GNI A;  4ZTF A;  1X9M A;  4Y1D A;  3VEV A;  4A2A A;  4XH4 A;  4CEC A;  2W40 A;  4FPB A;  4W5N A;  1E3M A;  1VHX A;  1A5W A;  1X3M A;  2QI2 A;  3NF6 A;  3VQE A;  3O3G A;  4U67 L;  4B3R K;  1K9M O;  3TTD A;  2Q31 A;  4JS5 A;  4JLH A;  3O9T A;  4K0K K;  4DR7 K;  4CJP A;  5KGX A;  1TL1 A;  1ZBF A;  4JK9 A;  3V81 A;  4DF8 A;  1D5A A;  5J2Q A;  1WSG A;  1Q18 A;  1D8Y A;  3RRH A;  1RTJ A;  4BRF A;  1VSF A;  2RF2 A;  2Z1J A;  4DSE A;  1K73 O;  4N76 A;  2WOM A;  1Q8I A;  1HJO A;  3KK1 A;  3ZX3 A;  1CZB A;  3VGL A;  3GOI A;  3VA0 A;  2P9N B;  4H4O A;  3RMB A;  4BAC A;  4IXC A;  1S22 A;  4FVU A;  3F2K A;  1RDB A;  3SCX A;  2P9P B;  1N5Y A;  3CME N;  4F3T A;  1RT5 A;  1O1W A;  2IVO A;  1MU2 A;  3UIQ A;  4I7F A;  5E41 A;  3FR0 A;  4NB4 A;  3RMC A;  2BDP A;  3V6D A;  5KPZ A;  4FM0 A;  1V4T A;  4O0I A;  1BL3 A;  3OS2 A;  1ASU A;  4CED A;  4BRC A;  1EXQ A;  2PYJ A;  4YOT A;  4YDU C;  4CEO A;  4CZH A;  5JS1 A;  2B4J A;  4FWR A;  4I9Q A;  4OKJ A;  3CC2 N;  3UE5 A;  1TKZ A;  1WNS A;  5KPR A;  2Q0U A;  4PL8 A;  2P5O A;  2CGL A;  5J2P A;  3CFO A;  5AQX A;  4M7Y A;  3VQ5 A;  4M3U A;  4CJS A;  3M3Z A;  3S9H A;  4LF9 K;  1RBT A;  4QS8 A;  2R7Y A;  3H3N O;  3ID6 A;  2GBZ A;  4A57 A;  2ZM6 K;  4PQU A;  1ILY A;  4O55 A;  4DV4 K;  3RSE B;  1C6V A;  1SUQ A;  3BUZ B;  3F5T A;  3J7A P;  1BQM A;  1CZ9 A;  1SAZ A;  2G8W A;  1CXQ A;  5JS2 A;  3ZSX A;  5SZT A;  1V4S A;  4XEI A;  3D0P A;  1QSY A;  4GVM A;  3OYK A;  1VQK N;  4DUY K;  3TAF A;  3C6U A;  4LC9 B;  3DLG A;  3O4W A;  3KLG A;  4NCB A;  1Y97 A;  4I6M B;  1NGI A;  3EKU A;  4FWS A;  2RE2 A;  4DR4 K;  4FK2 A;  3EEQ A;  4CZE A;  1XUP O;  4FSV A;  3K5O A;  3T19 A;  3RWU A;  4E7J A;  2QM1 A;  3GBT A;  1YF5 L;  3VGM A;  4JRP A;  4IDK A;  4DFJ A;  1MDU B;  4KRF A;  4LFA K;  1KCF A;  1S6P A;  2BUP A;  1YJN N;  3VQC A;  1ITG A;  4FXD A;  4F8R A;  3CCM N;  4BRP A;  2VWJ A;  4CJW A;  3THY A;  3WXM B;  3TAQ A;  3NFA A;  2G8V A;  3MN9 A;  5FPD A;  3FZH A;  4CEB A;  4MLH A;  1JCF A;  5AFU A;  3TSU A;  3EZ5 A;  3WQU A;  3CIP A;  3DAW A;  3SBG A;  4DHY A;  4KRE A;  1BI4 B;  4FOE A;  3SPZ A;  3RR7 A;  1KLN A;  2YHW A;  1B92 A;  2B6A A;  1RTD A;  4N41 A;  2P51 A;  3O1W A;  4KH6 A;  3DLE A;  4Z4E A;  5AZI A;  5EX5 A;  1XWL A;  3ID8 A;  1NK9 A;  1Q9X A;  3O9R A;  3VGK A;  3V9S A;  3VQ4 A;  1DTQ A;  4CJ4 A;  4FWO A;  1T7P A;  1TVR A;  4CJL A;  1UAX A;  3L2Q A;  1BCO A;  3B6O A;  1NK0 A;  4CK2 A;  1BOT O;  2GV9 A;  4CBU A;  2KFN A;  2ASM A;  5AQK A;  4FWQ A;  2CGK A;  3LWM A;  3V9Z A;  4PL7 A;  2HHW A;  2P9I B;  1WLJ A;  5KTQ A;  3AVG A;  2P9S B;  1HMV A;  1L3U A;  1IBK K;  2F9T A;  3WXK A;  3OBY A;  3PSF A;  1UOC A;  2VWK A;  3ENO A;  3SAF A;  2HHX A;  4FWP A;  4IBN A;  3U9Z A;  4M3X A;  4NLC A;  4CJ7 A;  4HUG A;  1TAQ A;  1S3X A;  3OA9 A;  3U3Y A;  2Y1J A;  1IKY A;  1TKD A;  1RT7 A;  2WTU A;  2Z1G A;  1G99 A;  4CVN E;  3CI5 A;  2NNW A;  3MEG A;  2D0A A;  3D2F A;  3G4S N;  3KD5 E;  1ATR A;  3M8R A;  3FE1 A;  3TTF A;  4Z4I A;  4NLB A;  4B1X B;  3NH2 A;  1W97 L;  4BDZ A;  3H46 O;  2D0C A;  3A5N C;  3QIP A;  2YX6 A;  3IG1 A;  3PO4 A;  5DMR A;  2HMP A;  5D3G A;  1Z6R A;  1LV5 A;  1JLQ A;  3QER A;  4B8A B;  1SKS A;  1IKX A;  1OVQ A;  3UKU A;  3HPH A;  4CGJ A;  4LF8 K;  2X6S A;  5CE3 A;  1Q86 O;  5KQ8 A;  4AHS A;  3B8A X;  3LDL A;  1HYS A; 
#chains in the Genus database with same CATH homology
 4IZ9 A;  1DEJ A;  2FSJ A;  3ATU A;  1ESV A;  3MMV A;  1E4G T;  4JK7 A;  3E1Y A;  3VMF B;  1KAZ A;  3VTI A;  5GAE P;  5E26 A;  4BR5 A;  5JVG L;  2QW9 A;  3G71 N;  3SMP A;  5LY3 A;  5F1X A;  5M1P A;  2E1Z A;  2KHO A;  3D2E A;  4KH4 A;  4K25 A;  3C65 A;  2NRV A;  4C1N I;  3MCP A;  1QZ6 A;  1M90 O;  2ZGZ A;  3WXJ A;  3SAH A;  5FPN A;  2E2Q A;  4GVE A;  3ZET A;  1VAZ A;  3CPE A;  3H45 C;  3O9U A;  5C12 A;  3GDQ A;  3KZB A;  1R59 O;  4IOC L;  4H0V B;  1GLL O;  3I8B A;  2NRR A;  2YHY A;  2VCP A;  3VEO A;  3LDP A;  3CQX A;  1NGA A;  1GLC G;  4ILH A;  4JKG A;  5M1N A;  3KWI A;  3DXK B;  1VQN N;  3VEZ A;  3FZM A;  5AZI B;  4CI6 A;  4EHT A;  1IJJ A;  4H0Y B;  5BRD A;  3G4S N;  1VQ8 N;  3U4L A;  3A0I X;  3CER A;  1NM1 A;  3O9S A;  5C10 A;  1WUA A;  4BC3 A;  1IG8 A;  4DQ8 A;  3ENB A;  3AGR A;  3WEE A;  1NWK A;  2E2O A;  4BRA A;  3ULE A;  3QDK A;  1M1K O;  4BRK A;  3ZEU B;  3QBX A;  4FWN A;  4RWT A;  2FSK A;  4JD2 B;  5GAG P;  1YJW N;  1VQ4 N;  4WYB A;  4WFB L;  4IOA L;  1GLD G;  5AQQ A;  5AZJ B;  2P9L A;  2ZJQ L;  2VGN A;  3WXL A;  5BRF A;  2Q0R A;  3HRG A;  5H1S Q;  1P8Z A;  3LL3 A;  4JKE A;  4OPH A;  3D7E O;  4AM6 A;  3JS6 A;  2HF3 A;  2WBN A;  3H6E A;  3O5B A;  3SLC A;  3HOS A;  5AQW A;  2HF4 A;  3MN5 A;  1NBW A;  3LM9 A;  4OPA A;  5AQH A;  4IO8 A;  4PKG A;  2E8A A;  1HPM A;  4CZM A;  5EY4 A;  3L4I A;  1VQ5 N;  3A5M C;  2QWN A;  1OVY A;  5AQJ A;  3WXI A;  1JJ2 M;  4YDU A;  4WQ4 C;  1GLA G;  3IFR A;  2QXL A;  4A5A A;  4JN4 A;  5M1O A;  1N8R O;  1XQS C;  5BRH A;  3HOT A;  3CD6 N;  2AP1 A;  2ASO A;  3C7N B;  4FO0 A;  3SBT A;  4C1N K;  4H0O A;  4EHU A;  3FLC O;  4JD2 A;  4JNE A;  1EQY A;  3OHR A;  5AQY A;  5F2R A;  3R9P A;  1QZ5 A;  3WT0 A;  2ZJP L;  5AQM A;  3E9P A;  1SQK A;  3D2F B;  3CJA A;  3QBW A;  2GEL A;  3A5O C;  3AAQ A;  3H1Q A;  5BPN A;  1HUX A;  3P39 A;  4BGA A;  1HKG A;  4BC4 A;  1YAG A;  4MDB A;  3CMA N;  2QWO A;  4B1U B;  1YVN A;  1KXP A;  2D1K A;  2NZT A;  3VET A;  3UB5 A;  1O13 A;  3MWP A;  3JXU A;  2QEX N;  3MN6 A;  3CPW M;  1U2V B;  2A41 A;  2D0O A;  2FSN A;  3L6Q A;  3N4Q A;  5AQR A;  2IIR A;  2JWK A;  3M6G A;  1K8K B;  4H03 B;  4XH5 A;  3P4I A;  5AQI A;  3VF4 A;  4CZG A;  3RVC A;  5GIO A;  2WUS A;  3UKU B;  1QQN A;  1NJI O;  2P9N A;  3M5R A;  4WF9 L;  2QWR A;  3P31 A;  2HBL A;  4JKD A;  1ZXO A;  3H1V X;  3LDO A;  3HZ6 A;  4H5N A;  4FPA A;  2P9K B;  1MWK A;  4BQZ A;  4O8U A;  2E20 A;  3E9O A;  1HKB A;  3Q7B A;  1Q81 O;  3MK6 A;  2CH5 A;  2P9P A;  3EN9 A;  2YJE A;  4BRN A;  4NO7 A;  3DWL A;  2I7P A;  4A5B A;  4BVO A;  2F7T A;  4BRD A;  4GV6 A;  1NGF A;  5M1F A;  3SK3 A;  3D2E B;  3VEY A;  1VQ7 N;  4B1W B;  5BN8 A;  3UKR A;  4YOY A;  2FF6 A;  2FF3 B;  4AF1 A;  1U2V A;  3HSC A;  3KWG A;  4M63 C;  3C0B A;  4RCH A;  3ZET B;  4CD1 A;  2ITM A;  5JLH A;  5KPT A;  4MLE A;  3I56 N;  4K41 A;  5HOO A;  1KC8 O;  1RGI A;  4BR9 A;  1BWF O;  2V51 B;  1BUP A;  4Z94 A;  2IVP A;  3I55 N;  3D6R A;  4YOU A;  4BC2 A;  4JKG B;  3VES A;  3FGU A;  1X9J A;  2YCH A;  1MA9 B;  1Y64 A;  4YOW A;  1GLF O;  3IDH A;  2QWQ A;  4BRH A;  3R6M A;  3ZX2 A;  2OAN A;  3FZF A;  5FPM A;  4BRM A;  3LDN A;  2V7Y A;  3O1B A;  5M1Q A;  4UY8 O;  4WQ5 C;  2A40 A;  1X3N A;  3T69 A;  3WEE B;  4BRQ A;  1VQ9 N;  3TSQ A;  3ULE B;  5C0Y A;  4IOX A;  5JVH L;  5EVZ A;  1YUW A;  2HOE A;  1KD1 O;  2FLO A;  4ISF A;  2Q36 A;  1TYQ A;  2NRT A;  2P9L B;  2VYP A;  4A61 A;  4BQL A;  5C15 A;  4BRE A;  4BR2 A;  1HX1 A;  3J7Z O;  1KQS M;  4GNI A;  2FXU A;  3VEN A;  2QTD A;  1P90 A;  4H0X B;  1T6D A;  2P9U A;  3R8E A;  3VEV A;  4A2A A;  4FOI A;  5EOY A;  3RSE A;  4YOR A;  4L3Q A;  4XH4 A;  3O08 A;  5AQO A;  2W40 A;  3O80 A;  4FPB A;  4WFA L;  5M1K A;  1X3M A;  2QI2 A;  3G6E N;  2CH6 A;  1T3V A;  4U67 L;  3HM8 A;  2PAV A;  1K9M O;  3TU5 A;  3TTD A;  1BDG A;  3CCQ N;  4OO1 J;  2Q31 A;  4A59 A;  4IEI A;  3LDQ A;  1YIT N;  1DKG D;  4MO4 A;  3C6H A;  2ZWH A;  3O9T A;  1NGH A;  1KAX A;  4JKB A;  2E1Y A;  4A2B A;  3CJC A;  4I6M A;  3HBT A;  4JK9 A;  5AQS A;  2GEM A;  5E84 A;  4BRO A;  4JKF A;  5HL7 L;  3IMX A;  3NMU A;  1VQL N;  1Q18 A;  3MDQ A;  3VPZ A;  2OTL N;  4FWM A;  2Q1N A;  1LCU A;  3AGK A;  2F9W A;  3HI0 A;  1HLU A;  3G25 A;  4BRF A;  2HBJ A;  5CR4 A;  5GIP A;  1K73 O;  3I33 A;  4IWV A;  4BRG A;  1NLV A;  3ATV A;  3AAP A;  1HJO A;  4KH5 A;  3ZX3 A;  4ILJ A;  2GWK A;  3GOI A;  3VGL A;  2P9N B;  4A62 A;  5I9E B;  4CBW A;  3GE1 A;  5LJW A;  4IXC A;  3W0L A;  3OW2 M;  2Q97 A;  1S22 A;  2VGM A;  2GUP A;  4CZJ A;  3PIP L;  2GX9 A;  3EZW A;  3TSP A;  4FVU A;  3ZX0 A;  3P38 A;  3F2K A;  4U7B A;  1LOT B;  4FL9 A;  2VWB A;  4O8K A;  3VOV A;  1QQO A;  3FFK B;  2QA4 N;  2P9P B;  4QS7 A;  3CCL N;  1E4F T;  2V7Z A;  3CME N;  5JLF A;  1Q7Y O;  2WFB A;  3VEW A;  1QHA A;  2IVO A;  3EL2 A;  4JKA A;  3EE8 A;  4H5V A;  3FR0 A;  3UKR B;  4PHT X;  2ASP A;  4NB4 A;  4IJA A;  3TPQ A;  3LM2 A;  3VTH A;  1ATS A;  3VER A;  5KPZ A;  1YIJ N;  3WQT A;  3CCR N;  3KVG A;  5AQP A;  1V4T A;  1SS6 A;  5C2D A;  5AQF A;  4R79 A;  3NVK A;  2A6A A;  4DB3 A;  3T7Z A;  3U8X A;  4JHD A;  4BRC A;  1NGJ A;  4BVP A;  2CGJ A;  4M7X A;  3FZL A;  4YOT A;  4YDU C;  4CZH A;  4CZF A;  2A5X A;  3CF5 L;  3MCA B;  4FWK A;  4HTL A;  5TKY A;  3E9L A;  3O8M A;  1H1V A;  4FWR A;  4CZI A;  4WCE L;  4BY9 C;  1YJ9 N;  3CJ9 A;  1ZBS A;  4ISG A;  1YHQ N;  3CC2 N;  3UE5 A;  3VEX A;  3CCJ N;  2QWM A;  1QVG M;  1JCE A;  1TUY A;  4IO9 L;  2E88 A;  5KPR A;  3KK7 A;  2Q0U A;  3PIO L;  1OKJ A;  4PL8 A;  4G9Z A;  1QVF M;  2CGL A;  2YI1 A;  1TYQ B;  2EWS A;  2JWL A;  2YJF A;  5AQL A;  5AQX A;  4M7Y A;  3TTC A;  1NMD A;  2P9I A;  1T6C A;  3M3Z A;  4BR0 A;  5BRE A;  2GWJ A;  2P9S A;  4MDA A;  4QS8 A;  4C23 A;  3H3N O;  3ID6 A;  1ILY A;  3ENH A;  3CJB A;  4A57 A;  2P9U B;  4DKW A;  5JIC A;  3QML A;  1RDW X;  3RSE B;  3EKS A;  5C2F A;  4BR7 A;  3MX2 A;  5TKW A;  3BUZ B;  3F5T A;  5MLC Q;  4IDH A;  1W2B M;  1SAZ A;  3CCU N;  3O6W A;  3F9M A;  3Q7C A;  4MO5 A;  4BR4 A;  4FWL A;  5JMV A;  1VQP N;  2A42 A;  4YOX A;  1V4S A;  4XEI A;  4K42 A;  3N4P A;  5KQD A;  2J4R A;  4F9O A;  1VQK N;  3CET A;  4BG8 A;  2NLX A;  3AAR A;  1MWM A;  2Q2R A;  2RHK A;  3O4W A;  3R3L A;  4LC9 B;  5AQG A;  3NVM A;  4I6M B;  3R1X A;  4AM7 A;  1NGI A;  3EKU A;  4FWS A;  3W3D A;  4CBX A;  4HWI A;  2RE2 A;  1C0G A;  3L4Q A;  4YOV A;  1T44 A;  4CZE A;  1XUP O;  4FSV A;  4IJN A;  4BG9 A;  3EE9 A;  4BGB A;  1RDU A;  3BP8 A;  1YI2 N;  4DCH A;  2QM1 A;  5GAH P;  2ZF5 O;  4JAX A;  3GBT A;  2V52 B;  3QFU A;  3J8A A;  1YF5 L;  5AQZ A;  3VGM A;  4JEP A;  4WQ4 A;  2OTJ N;  2E2N A;  2GTD A;  2KKZ A;  4H0T B;  3A5L C;  4Y0W A;  3OBW A;  1VQM N;  1MDU B;  5F0X A;  4EAH D;  4H5T A;  2BUP A;  4CD3 A;  1YJN N;  4GV9 A;  3DXM B;  4B9Q A;  4K43 A;  3CCM N;  3CXC M;  1Q82 O;  4GY2 B;  2QWP A;  4BRP A;  1RFQ A;  3QB0 A;  1DT9 A;  3WXM B;  3BF1 A;  3MN9 A;  4XH1 A;  3FZH A;  5FPD A;  2NRZ A;  4MLH A;  4EFH A;  1JCF A;  5AFU A;  5ADX A;  4RTF D;  3S41 A;  3TSU A;  1TUU A;  3WQU A;  3CIP A;  3DAW A;  3IKM A;  3SBG A;  4BRL A;  2D4W A;  4DHY A;  3AY9 A;  2QWL A;  2W41 A;  4FOE A;  4CZK A;  2UYT A;  2YHW A;  4ILG B;  1K8A O;  1Z05 A;  1BU6 O;  4WFN L;  4JKH A;  3O1W A;  4JHD B;  3PLA A;  4KH6 A;  3SJH A;  1HKC A;  1YXQ A;  3DXK A;  3CC7 N;  2ZJR L;  5AZI A;  5EXW A;  3BEX A;  5EX5 A;  1KAY A;  3ID8 A;  3DXM A;  4H5R A;  5AQV A;  5GAD P;  4B1Z A;  3O9R A;  3VGK A;  3QFP A;  2I7N A;  3M1F A;  3U9D A;  5AQT A;  2YHX A;  4EIA A;  4FWO A;  5FPE A;  1C0F A;  3CJ7 A;  2KLA A;  1BOT O;  4CBU A;  3ZEU A;  2ASM A;  5AQK A;  3CCV N;  2NRW A;  3KHY A;  4PKH A;  3SAG A;  3CCS N;  4FWQ A;  2CGK A;  5LJV A;  5AQU A;  3A8Y A;  4PL7 A;  5AZJ A;  5BPM A;  4O5F A;  2P9I B;  1EO1 A;  1DGK N;  2IVN A;  3MN7 A;  3QIC A;  2NRH A;  5BR9 A;  1U6Z A;  2P9S B;  4H0P A;  3CC4 N;  1JCG A;  3EO3 A;  1NGC A;  3DLL L;  3VF6 A;  4E1J A;  2F9T A;  3WXK A;  3GG4 A;  3OBY A;  3ZYY X;  3ENO A;  3SAF A;  2HST A;  4FWP A;  3U9Z A;  5GIN A;  2BH1 A;  1ATN A;  3DJC A;  4NLC A;  4CJ7 A;  1VQ6 N;  4KBO A;  2NRX A;  1S3X A;  1NGG A;  3OA9 A;  5ELZ A;  2ZGY A;  3C7N A;  3H3O B;  4WQ5 A;  3GL1 A;  4CZL A;  2WC9 A;  5AQN A;  1BO5 O;  1CZA N;  3O9Q A;  4JKC A;  5B8H A;  4IEE A;  1G99 A;  5DM6 L;  1S72 N;  3CI5 A;  5AR0 A;  1BA0 A;  3VF2 A;  2NNW A;  3IUC A;  4J8F A;  3D2F A;  2A3Z A;  2D0P A;  3E66 A;  4JK8 A;  4B1V A;  1NGE A;  4BRI A;  4GV3 A;  1NGD A;  1SZ2 A;  3MWT A;  1NGB A;  3K9K A;  1ATR A;  4ISE A;  5BN9 A;  1XC3 A;  3FE1 A;  3TTF A;  2HBM A;  3BF3 A;  1VQO N;  4NLB A;  4IFE A;  4B1X B;  1GLE G;  4BC5 A;  3K9J A;  3CQY A;  3WUH A;  1W97 L;  4B1Y B;  3H46 O;  3CCE N;  3MX5 A;  3A5N C;  3HTV A;  1BG3 A;  2AA4 A;  2YX6 A;  1QQM A;  5CHI A;  2BTF A;  2H3G X;  2HMP A;  2PBD A;  4H5W A;  4PKI A;  1BA1 A;  5AFU H;  5ADX H;  2HBK A;  1Z6R A;  3CHW A;  1D4X A;  3FZK A;  4QS9 A;  1K8K A;  1WOQ A;  2E2P A;  5BPL A;  3LDL A;  3UKU A;  3L0Q A;  5DM7 L;  2DPN A;  1GLJ O;  3CJ1 A;  1J6Z A;  5CE3 A;  3SMS A;  2PFU A;  1Q86 O;  1GLB G;  5KQ8 A;  3B8A X;  1ZC6 A;  2P9K A;  3C6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...