3CM5A

Crystal structure of cell-death related nuclease 4 (crn-4) bound with mn
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
294
structure length
294
Chain Sequence
HCPFDTLLILDFETTSDAANQDYPCEVIQFAIVAYDVPNDKIREDISFNKYVKPVLNRTLTKNCVDFTGIPQRSIDTADTFDVVYEQFQQWLITLGLEEGKFAFVCDSRQDLWRIAQYQMKLSNIQMPAFFRQYINLYKIFTNEMDRMGPKELSATTNIGKMNEYYDLPTIGRAHDAMDDCLNIATILQRMINMGAKVTVNELLTCCASWRRQPLVYNKEWRSSFMDAGKIFERVLPLVVTTIRAGDFRLEMYGVCRYCRKGMDVCGTSHQQTPHDLYKNEEDPIHFAKIAGYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, apoptosis
molecule keywords Cell death-related nuclease 4
publication title Crystal structure of CRN-4: implications for domain function in apoptotic DNA degradation
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 86
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3cm5A01
1ASWA 1KFDA 3SNNA 1Y97A 3KLIA 4QCLA 3ZT1A 3AVGA 1TVRA 5J2PA 2YV0X 3PV8A 4EZ9A 3OJSA 1XC9A 1HQEA 3LP2A 3HVTA 1U47A 1RCHA 4FJ7A 4HCBA 4CECA 1BCMA 1N6QA 1L3VA 2XY6A 4CIEA 1JXEA 1TL1A 2ZE2A 3HL8A 3HO1A 3HP9A 1DTTA 3LANA 3NF9A 5CZ2A 2VG5A 3VQQA 4ID5A 3SUQA 1A5VA 1C1CA 1YTAA 4GMJB 1XWLA 4KHUA 5KGWA 1ASUA 1WSFA 2Z1IA 3U3YA 3SQ1A 2GV9A 3SJJA 1D5AA 1WLJA 4DS5A 3PUFA 3DRPA 4CIFA 4W5QA 3CFPA 3ZT0A 1YTUA 3OYAA 1RT2A 4FM2A 4M3ZA 1L3TA 3A2FA 3ZSZA 2RKIA 2BDPA 3RR8A 3C94A 3VQBA 4DTRA 2E4LA 2IC3A 1VSDA 3DOLA 4BE2A 3U3GA 1ASVA 4M41A 3RMCA 3L3VA 1NK0A 3SQ4A 5KI6A 1NK8A 1C0TA 1BGXT 4FJGA 4CHQA 4LH4A 4KHNA 3G0ZA 3DLGA 1A5XA 2Z1JA 3KKSA 1UAXA 4CF2A 2IS3A 1SKRA 3OS2A 3OYEA 1WNSA 5SZTA 3M8RA 2FBVA 4OVLA 1NK6A 4F2SA 3BGRA 4CF8A 4BWMA 3ULDA 1L5UA 3OS1A 2HVIA 3MEDA 3DLEA 4Q5VA 1NK9A 1IKVA 4J2BA 1LWCA 4N76A 4DLEA 5FRNA 1C0MA 3K5OA 3NFAA 3LP3A 3MAQA 5J2QA 3WNGA 3SCXA 3M8SA 1TAQA 2G8WA 3V9SA 3DYAA 1ZBFA 2PYJA 4KHYA 4FLXA 3ZT4A 4RW9A 4OPKA 1BQMA 4CJUA 2XRIA 3F73A 3PX6A 1R0AA 3DLBA 4LH5A 1S6PA 3O4QA 4Q0BA 1KVAA 4KO0A 1TK5A 2YNIA 2G8HA 2G8FA 4KKOA 4OJRA 4FZXC 3V1RA 2VWJA 3DLHA 1CXQA 2D0BA 4YFUA 3KLFA 2HHWA 2OPQA 4UQGA 1RNHA 1UOCA 1T05A 1GOCA 4KTQA 4JRPA 3TWHA 3VA0A 4CE9A 1VSEA 3SPYA 3QERA 1IKWA 1RT3A 3S3NA 2Z1GA 5SWMA 4AILC 4KTWA 4HUGA 4FCYA 3KK2A 3S3MA 1RT4A 1IKYA 4B9VA 3EY1A 2HHQA 2KFZA 1IH7A 3LALA 4GVMA 4CHZA 1XHZA 2PYLA 2PZSA 2KFNA 4BDYA 1Z26A 3WNFA 3PX4A 4FJIA 3U6FA 3HYFA 1NK7A 1JLBA 4CJLA 4FLZA 5C24A 2FC0A 4CGIA 2Y1IA 1REVA 3QESA 4Z4CA 3QEPA 5HRPA 1CZBA 1J53A 2JGUA 2FBXA 3QLHA 4CHOA 3C6TA 2IGIA 4CEDA 1RBTA 1LW2A 3CYMA 3FFIA 1BQNA 4LD0A 1TKDA 2YKNA 4FLTA 1C0UA 1WAFA 4DLGA 2P5GA 3AVHA 3KLEA 1T03A 4DSFA 4M3UA 4PWDA 3TI0A 2QXFA 3AVJA 3OJUA 3L2QA 4H4OA 4RG8A 4CJQA 4KPYA 3G10A 4CGDA 1T8EA 3OYHA 4B9MA 1WAJA 4O0IA 1RDAA 4DFKA 4CHNA 4DSEA 1U4BA 4C8LA 1KLNA 2OPPA 4BDZA 3V1QA 1IO2A 4CJFA 4CJ5A 1BL3A 2QKBA 4FYDA 1EKEA 3CFRA 2OPSA 3ITHA 3PX0A 1J5OA 3M8PA 1RTIA 5HBMA 2PY5A 4AHVA 4DU3A 4FJHA 4CFCA 1RDDA 3AVFA 3O4NA 2XO7A 1RBSA 1J9AA 4E7HA 3I8DA 4W5RA 4PY5A 4AHCA 5J2NA 1JLGA 3VQ5A 2WONA 3VQCA 4I9LA 4CK3A 1W0HA 3P5JA 1QSSA 4DSLA 3NGYA 3LDSA 2HHUA 4CGHA 1RT5A 2XY8A 4PA1A 1HMVA 3SUNA 3OYJA 2BE2A 1SUQA 1EXQA 2RN2A 4W5OA 3KTQA 4W5NA 4F8RA 3SZ2A 1IG9A 4BDPA 3MXJA 4O55A 5HRRA 4CJPA 1Q9XA 4OKJA 5J2MA 3OYLA 1UA1A 4KRFA 4KHSA 2HNYA 4CERA 4DTUA 2QK9A 4MFBA 1QSYA 2EX3A 5D3GA 3EZ5A 4NYNA 4I2QA 1VSMA 5CYQA 3T3FA 3TR8A 4CF9A 1NJYA 2I5JA 1HJRA 3NF7A 3QINA 2Q3SA 3MXIA 1S5JA 1JLEA 4FM1A 4I9QA 4C8NA 3OYBA 3QIOA 4Y1CA 3TAMA 4ELVA 4B9UA 4FJJA 3RMAA 1QQCA 1RT1A 3LP0A 3NDKA 3QNNA 4C8KA 2G8IA 1JLAA 4FLVA 4RW8A 4W5TA 4DWIA 3OYMA 3TAFA 4CJWA 5J1EA 2HHVA 3IG1A 4JLHA 4XIUA 4E1MA 3SUPA 2GUIA 3NF8A 2O4IA 3IS9A 1EP4A 4IFVA 5FRMA 3SI6A 2P5OA 3VQ7A 4KHQA 4I7FA 3QIPA 1X9MA 4FJXA 5HLFA 3TARA 4E7KA 3ZT3A 3NHGA 3QEIA 3RWUA 4FJ9A 4YNQA 1TKTA 5DMRA 3OS0A 3TAPA 3B6PA 4M3WA 2X74A 3HP6A 4DSIA 3QNOA 4KB1A 1LAWA 2WOMA 3NH0A 1NJWA 1WSIA 2F8TA 4AH9A 4FZYA 3LAKA 1S6QA 3UIQA 3DMJA 4FJ5A 3RRGA 3VQAA 3AVNA 3D0PA 4R5PA 4KB0A 2YKMA 4OKKA 2IAJA 4NCBA 1A5WA 2DY4A 1CZ9A 3VQPA 1X9SA 4F3OA 4DSKA 1KRPA 2KTQA 3AO1A 4CF1A 4KFBA 1QHTA 5K14A 1LAVA 4Z4IA 4DTXA 3SQ2A 3LPUA 2R7YA 1JXBA 2OPRA 3OYNA 1LV5A 3VQ9A 2DFEA 1O1WA 3NH1A 4CJRA 3KJVA 1TKXA 4DTSA 4CJTA 4RW6A 4CEBA 1RDCA 1DLOA 3ZSXA 3DM2A 1Q9YA 5KRSA 1ZBIA 3B6OA 1HPZA 1LW0A 2KQ2A 1TV6A 1WSGA 2HNZA 4HUFA 2XY7A 2OZSA 4OLBA 2Z1HA 3MEGA 1NJZA 3AO2A 4KREA 4GW6A 2VWKA 4FW2A 4BWJA 3LPTA 4C8MA 4M3RA 3ZSYA 3QETA 4WE1A 2G8KA 4BACA 4HVJA 1RILA 5I42A 1BIZA 4CHPA 1VRUA 4CGJA 1NK4A 2RF2A 4CJEA 1TAUA 3KK3A 2YNGA 3L3UA 4Y1DA 3AVIA 4CFAA 4CGFA 4DQIA 2G8VA 3DLKA 4J2EA 4M42A 1BCOA 1EETA 4E1NA 2VG6A 3AO5A 1KVBA 3AV9A 3O3GA 3CG7A 4ICLA 3LWLA 1KVCA 3V1OA 4N56A 3K5MA 4DTJA 4J2DA 3V4IA 3AVLA 2IOCA 3ZSWA 3HM9A 4E0DA 5EU7A 4K8XA 1NKEA 4CF0A 4N41A 4DSJA 3KLHA 4E7LA 4M3XA 4DS4A 2X6NA 4DF4A 3P83D 1RT7A 4LY7A 5HRSA 4CCHA 1RTDA 2X78A 1SKWA 4DG1A 4DQSA 4CGGA 1RBUA 1S1XA 5DK5A 2F8SA 5E41A 3HPGA 1JKHA 3NAEA 1JLCA 1HNIA 1S1VA 2E6MA 3KD5E 2E6LA 3AA3A 4CEAA 4EP5A 3KLGA 1CXUA 4HTUA 4N5SA 2KZZA 4FK0A 2ETJA 3H08A 5CZ1A 1BIUA 4CK2A 3KKRA 1SL2A 1ZBHA 2HB5A 1D9FA 1HNVA 1HYVA 1B9DA 1BI4A 3ISNC 4DFPA 3SQ0A 4PUOA 4KTZA 5KGXA 3LWMA 1FK9A 4DQQA 4DU1A 1FXXA 3HPHA 3MECA 1GOAA 4DMNA 3OYDA 4JS5A 2G8UA 2ZQBA 4OPJA 4H8KA 2KW4A 1NJXA 4DQPA 1S9EA 4Z0UA 1S1WA 3PO4A 3IRXA 4IG0A 4B9TA 1K6YA 2IDOA 4E89A 2D0AA 4DF8A 3SPZA 2W42A 4ELTA 1MU2A 1WSJA 4MQ3A 3VN5A 1S1UA 1VSHA 2OA8A 5HRNA 4B9SA 3T19A 4DFMA 5HP1A 4B08A 5I3UA 4IKFA 4Z4GA 1VSJA 3V9UA 1SL1A 4F2RA 1CLQA 3K5LA 4IBNA 3S3OA 4FZZA 4CEFA 1DTQA 2YNHA 1S9GA 2BANA 5JS2A 3HSTB 4FVMA 1TL3A 4Z4HA 3JSMA 3JYTA 4JRQA 1TK8A 1N5YA 1U48A 3RR7A 1KTQA 4M3TA 4QOZB 1RT6A 4O4GA 1YT3A 3E01A 4AHTA 3NF6A 1C1AA 1SL0A 2HMIA 1WSHA 4I2PA 3ZSQA 5CY4A 3HJFA 2D0CA 2P51A 3S9HA 4B3OA 5CYMA 4RW4A 4PQUA 3ALYA 1VSLA 4LSLA 1KCFA 3C6UA 1QE1A 3K2PA 3M8QA 5C42A 3SYZA 4KAZA 2EHGA 3KIOA 3QO9A 4K8ZA 4FXDA 1JLQA 1HQUA 2DFFA 3TAQA 4G1QA 1I39A 3CM6A 4CJSA 3VQEA 1NOYA 2FBTA 1Q8IA 4O44A 3RRHA 4L8RB 1S1TA 4KHWA 4DQRA 4DTOA 3RMBA 3LP1A 1QS4A 4OGEA 2HHSA 1RBVA 4NCAA 3HPOA 1B92A 2B5JA 4CESA 3TANA 1QTMA 4Z4EA 3K5NA 2HVHA 2HNDA 2YHBA 4C8OA 3KD1E 1ZYQA 2O4GA 4EZ6A 4N47A 3OYIA 1Z25A 4OLAA 1GOBA 1LWFA 1D8YA 4O0JA 4FK4A 3NGIA 3AVKA 1EX4A 2A1RA 2HHXA 4H4MA 4ZTJA 4QAGA 1HRHA 2NUBA 3DLRA 5C25A 3L2WA 1WN7A 2ITGA 3V81A 1KSPA 4FK2A 2B6AA 3DI6A 4M3YA 2VG7A 3SV3A 4KI4A 3L2UA 3QEVA 3AA4A 3C95A 3I0RA 3V9XA 1TGOA 4FM0A 4IG3A 3AVBA 4B9LA 4Z4FA 3NCIA 1SKSA 4OKEA 3VQDA 2HHTA 2A1SA 2OZMA 4F3TA 4FLWA 1C1BA 1J54A 1I3AA 4IFYA 1HYZA 1UA0A 4RW7A 4AHRA 1C6VA 2BGGA 1T7PA 2GBZA 3O3HA 3AO3A 3CM5A 3SUOA 4CHYA 1U49A 4FJ8A 3ZT2A 3LZIA 2YHAA 1KLMA 3DOKA 3VQ4A 1VSIA 4NYFA 3VQ8A 3I0SA 1RTJA 1ZBUA 5T7BA 4DFJA 1U45A 3THVA 1QSLA 2YNFA 1BISA 4IDKA 4CFBA 3HK2A 1W9HA 4FLYA 2XY5A 4OGCA 1RDBA 1VRTA 4M45A 3T1AA 1KFSA 5FDLA 3V6DA 4FJNA 4DTPA 1YVUA 1RTHA 1NKBA 4CEEA 3D45A 2B4JA 3PY8A 4CJVA 2AJQA 4LSNA 4CJ3A 4FLUA 3WNHA 1NK5A 1B9FA 2ZD1A 4HHTA 1NKCA 1JL2A 4KV8A 3O3FA 2QKKA 1F21A 3ASMA 1HYSA 1X1PA 2OYQA 4JS4A 3AVAA 4AHSA 4FW1A 3K59A 3V9ZA 2LSNA 5KRTA 4ZTFA 1XI1A 1FKPA 3NBPA 4DTNA 1VSKA 3QEXA 3L2RA 1BI4B 5JS1A 4B8AB 4E3SA 3QEWA 4KI6A 3TAGA 2DTUA 3OYKA 3ZCMA 4CIGA 3VA3A 3MEEA 1ITGA 3DRSA 4AHUA 3NH2A 1JL1A 3K58A 2P1JA 3RTVA 4E7JA 4HCCA 4FJKA 2HW3A 4E7IA 3NE6A 4HUEA 2JLEA 3LZJA 1D9DA 3MXMA 1X9WA 4CEOA 3OYFA 3L8BA 3AA2A 3OY9A 4BE0A 5KTQA 4CJ4A 2FBYA 3AVMA 1TKZA 2XHBA 1RBRA 1L3SA 3CFOA 2RPIA 3P1GA 3SV4A 3DRRA 3OVNA 3AA5X 2Y1JA 1WSEA 3PO5A 3VQ6A 3ZSOA 4ZHRA 4DU4A 4CJKA 1L3UA 5HROA 4B9NA 1JLFA 2ATQA 4CFDA 4CEZA 4FJLA 1XHXA 4BE1A 1IKXA 3NGZA 2KZMA 3AVCA 5FROA 1UWBA 3K57A 3AO4A 4F4KA 1LWEA 2X6SA 4CEQA 3OYGA 3ZSRA 3EYZA 1G15A 2F96A 1U04A 1ZBLA 4CK1A 3HVRA 3KK1A 1SV5A 3HXMA 3CQ8A 4ID1A 2DFHA 1TK0A 1FKOA 4B8CA 4DTMA 3TAEA 3BDPA 3ZSVA 4J2AA 4FJMA 4E19A 3TABA 3V9WA 3F9KA 3HT3A 3RMDA 2D5RA 1NOZA 4O5BA 1VSFA 4NCGA 4ELUA 3IAYA 4EP4A 3LAMA 3OYCA 3WNEA 4TSXA 3L2VA 1BHLA 1VK0A
chains in the Genus database with same CATH superfamily
3SNNA 4B1XB 1QVFM 4QCLA 3ZT1A 2P9LA 1TVRA 3EE9A 3PV8A 4EZ9A 4DR6K 4FJ7A 3HVTA 1RCHA 4CECA 1N6QA 2XY6A 4CIEA 1YJ9N 1JXEA 1TL1A 3HL8A 3R1XA 3NF9A 2VG5A 4KHUA 4GMJB 1YTAA 3HM8A 4WQ4A 3SQ1A 1WLJA 4DS5A 4CIFA 4BQZA 3PSIA 3KK7A 3QFPA 4JI6K 1L3TA 4LF7K 3C94A 5AQGA 2E4LA 3QBXA 4QS7A 4RCHA 5AQHA 4M41A 1NK0A 5A2QO 1H1VA 3CMEN 1C0TA 1HKBA 4KHNA 3G0ZA 3HSCA 1A5XA 2Z1JA 1KD1O 3T7ZA 4FWOA 5SZTA 3M8RA 1VQ4N 4DV1K 4H0YB 4JI7K 1BA0A 2W6LA 3OS1A 3FZLA 3MEDA 4B1WB 4CZGA 1NLVA 4Q5VA 4B3MK 1NK9A 4YDUA 2YI1A 5J2QA 4AM7A 4GV6A 1BDGA 2E8AA 5JVHL 4OPKA 3MDQA 4BR7A 2P9UB 2E5LK 3F73A 1KVAA 4KO0A 4BRNA 4FWNA 4GKJK 1RDWX 3DLHA 2D0BA 1RNHA 1UOCA 5CR4A 1GOCA 4JRPA 4GNIA 3TWHA 4YOYA 3SPYA 2Z1GA 4KTWA 3SBTA 1RT4A 1IKYA 4PL8A 3P39A 3EY1A 5JLHA 2HHQA 3M6GA 3LALA 4FWKA 4GVMA 3WNFA 4FJIA 3HYFA 1JLBA 4CJLA 3VEXA 3VTIA 2Y1IA 1J53A 2E2QA 5KPRA 3PLAA 1LW2A 4YOXA 4L3QA 4BR5A 1BQNA 3FE1A 2YKNA 1WAFA 5AFUH 3AVHA 3BZCA 4CZEA 3H45C 4M3UA 3NMUA 4PWDA 3TI0A 3U4LA 2QXFA 3L2QA 4H4OA 4CJQA 3OA9A 3CERA 4DFKA 3FZKA 4JI5K 4H5NA 1C0FA 3WEEA 4FYDA 4A2BA 3DXKB 2OPSA 1J5OA 1RTIA 4YY3K 1RDDA 3J7YP 1RBSA 3ENOA 4W5RA 4PY5A 4AHCA 2QWPA 1JLGA 4CD1A 3VQ5A 2WONA 3AY9A 1W0HA 4A62A 1HMVA 3SUNA 2RN2A 4LF6K 5HRRA 4JKDA 5J2MA 3CPWM 3H3OB 2HNYA 3BF3A 5D3GA 5CYQA 4C1NI 1NGHA 4CZJA 3M5RA 3PIOL 2Q3SA 4FVUA 3MXIA 4FM1A 4I9QA 4C8NA 3OYBA 4ELVA 4MDBA 3QNNA 1JLAA 4RW8A 3CCRN 4DWIA 4CJWA 4JD2A 3NF8A 2NRHA 5FRMA 3SI6A 3MK6A 4KHQA 3VQ7A 1X9MA 4FJXA 1Z05A 2QW9A 3TARA 5HLFA 4OX9K 2KKZA 4MO5A 4FJ9A 1TKTA 5DMRA 3HBTA 4CZHA 2VWBA 3I8BA 5GIPA 3QNOA 3OW2M 4FZYA 3LAKA 3DMJA 4FJ5A 3R3LA 2OANA 4NCBA 4JK8A 3U8XA 4F3OA 4DSKA 1OKJA 3IMXA 4B9QA 4CF1A 2NZTA 3VTHA 4H0TB 1OH8A 3SQ2A 4EAHD 1BG3A 3VQ9A 3O08A 3NH1A 3MCAB 4CJTA 4CEBA 1RDCA 3ZSXA 4IOAL 4HUFA 2Z1HA 3MEGA 3HRGA 4V19S 2D1KA 2VWKA 4BWJA 3LPTA 4C8MA 3QETA 1YXQA 1SZ2A 4CHPA 1NK4A 4BC5A 4M63C 2YNGA 4JK9A 4CGFA 4DQIA 3DLKA 4J2EA 1S3XA 1T6DA 4E1NA 3AO5A 4ICLA 3V1OA 4DTJA 4DV7K 2IOCA 3ZSWA 1WBBA 5EU7A 4K8XA 1NKEA 4N41A 1TUUA 4LY7A 4CCHA 3UB5A 3CI5A 3DXMA 4WFAL 1ESVA 4EIAA 1S1XA 2F8SA 2F9WA 3HPGA 1JKHA 3KLGA 2OTLN 5E26A 4N5SA 2KZZA 2ETJA 5CZ1A 3MWTA 1ZBHA 3L6QA 1U2VB 1D9FA 1HNVA 4CZFA 5AQKA 3VEYA 3SQ0A 1KC8O 1K8KB 3MECA 3Q7CA 4OPJA 4H8KA 3EE8A 4IG0A 3PO4A 4B9TA 2W42A 5C0YA 1MU2A 3VN5A 1GLAG 1VSHA 2OA8A 5HRNA 3T19A 5HP1A 4IKFA 3S3OA 4GVEA 2YNHA 2BANA 3RR7A 2JWLA 3RWUA 2H3GX 2WUSA 4O4GA 3NF6A 1WSHA 4FWLA 5CY4A 4NLCA 2D0PA 2UXDK 1MA9B 3SMPA 3FFKB 4KAZA 1JLQA 3ATVA 5AQXA 2GEMA 2Q1NA 3AGRA 3RRHA 4L8RB 2FF3B 2HBKA 3RMBA 5AQFA 4NCAA 3NVKA 3FZFA 3CJBA 4BRKA 1GLDG 3KHYA 4Z4EA 4K42A 2HNDA 2YHBA 2ASPA 5JICA 3KD1E 3MMVA 3ID6A 4IZ9A 1D8YA 4FK4A 1XC3A 5AQRA 3LDLA 4ZTJA 3L2WA 3VF4A 1ZBSA 3V81A 1KSPA 4FK2A 4QS8A 3DI6A 3F2KA 4DUZK 3L2UA 5AQQA 3AA4A 3C95A 3V9XA 3AVBA 4B9LA 3LL3A 4OKEA 3CCUN 4CZMA 4FLWA 3EEQA 1J54A 2Q0RA 4IFYA 1HYZA 5M1OA 5FPNA 2GBZA 3CM5A 1U49A 3H46O 1KLMA 4QS9A 3VGKA 3VQ4A 1VSIA 3VQ8A 3CJ9A 5M1QA 4WF9L 4DFJA 2GUPA 3WT0A 2YNFA 1N36K 3HK2A 2QM1A 1W9HA 3FR0A 3TTCA 4OGCA 3T1AA 4LF9K 1ATRA 3QICA 1RTHA 1NKBA 3PY8A 4CJVA 4FLUA 2V7ZA 3O80A 2E2OA 3ATUA 3WQTA 3O3FA 2IVNA 1X1PA 3AVAA 4AHSA 4A59A 4WQ5A 1DKGD 1FKPA 5JS1A 1VSKA 1BI4B 4E3SA 3N4QA 3WUHA 4LF5K 4CIGA 2P9UA 4BRMA 4CZKA 3VA3A 3DRSA 2YJEA 2BTFA 4ILGB 1MDUB 4E7IA 3J7ZO 1YIJN 3CHWA 5KTQA 2FBYA 3P4IA 2XHBA 3CFOA 1X3NA 3P1GA 5E84A 3OVNA 4JI2K 1L3UA 2HHHK 2ATQA 4FL9A 1NNEA 4FJLA 4BE1A 3NGZA 2KZMA 1X9JA 2CH5A 1LWEA 2X6SA 4CBUA 3ZSRA 3EYZA 2F96A 1OVYA 1ZBLA 3O9SA 1SV5A 2WFBA 4IXCA 3HXMA 3CQ8A 3MX5A 1FKOA 4IO8A 4Y0WA 4B1ZA 4B8CA 3TAEA 3ZSVA 4H0PA 2E1ZA 2UUCK 5HOOA 3D7EO 1Q18A 4NCGA 2UXBK 3IAYA 3OYCA 4JS5A 3IG1A 5F0XA 1Q82O 5LMUK 1XC9A 4BVPA 1U47A 3VEZA 1BCMA 1DTTA 1XMQK 3DXKA 4DHYA 1NGCA 2Z1IA 3U3YA 2GV9A 5TKYA 3SJJA 3PUFA 1WOQA 1P8ZA 4BG8A 4CW7B 3GE1A 1N33K 3ZT0A 1YTUA 4EHTA 1QZ5A 4M3ZA 5BRFA 1KAXA 2P9NB 3O9RA 4DTRA 2IC3A 3CC4N 3SJHA 1KXPA 4BE2A 1QQMA 3U3GA 1ASVA 3SQ4A 4BROA 2UXCK 4H0VB 1BGXT 3BY5A 4NB4A 4E1JA 1YUWA 4BRHA 1WNSA 3GG4A 5KQ8A 2FBVA 4OVLA 1NK6A 4F2SA 2J4RA 4DR1K 1M1KO 3K5OA 3FGUA 2QWNA 1TAQA 2QXLA 5AZIB 2D0OA 4FLXA 3CJ7A 4CJUA 4WFNL 4R79A 3PX6A 4LH5A 1S6PA 3JAMO 1TK5A 2ZGZA 2O8CB 1YI2N 4OJRA 3H3NO 3O9QA 5EXWA 1CXQA 3V1RA 4YFUA 3KLFA 3ZETB 4KTQA 1RT3A 3S3NA 5SWMA 4AILC 3S3MA 3UKUB 4B9VA 4A57A 3THXB 4U67L 1G99A 2KFZA 1GLCG 4CHZA 2PZSA 4BDYA 3U6FA 4FLZA 2FC0A 4CGIA 1MWMA 3QESA 3QEPA 5HRPA 1CZBA 1Y64A 1KQSM 2FBXA 3QLHA 4CHOA 2IGIA 5LJWA 3CYMA 3KWGA 3FFIA 5AQYA 3EN9A 4DSFA 3WQUA 4KPYA 4CGDA 3ULEA 3OYHA 4C8LA 1KLNA 5M1PA 3T1YK 4KHPK 4CJFA 1IO2A 4CJ5A 1BL3A 2V51B 2QKBA 3SK3A 3ITHA 2PY5A 5HBMA 2YHWA 2XO7A 2O8BB 1J9AA 4E7HA 3IKMA 2NNWA 2FSKA 3CQXA 3VQCA 4I9LA 1N32K 4CK3A 3LDSA 2HHUA 4PA1A 4LF8K 1BUPA 1SUQA 4W5OA 3KTQA 4W5NA 5LMNK 4BRIA 4F8RA 3SZ2A 1IG9A 1BWFO 1NGIA 4BRFA 4CJPA 1Q9XA 4OKJA 4KRFA 1W7AA 2EX3A 5JLFA 4NYNA 4I2QA 1NBWA 1K8KA 4CF9A 1QZ6A 1HNZK 1NJYA 2I5JA 3QINA 1DT9A 4Z94A 3QIOA 3TAMA 1V4SA 3LP0A 2NRWA 1WUAA 4FLVA 4H03B 3ZEUB 3OYMA 4J8FA 4A5AA 3A5LC 5J1EA 3D2EB 2HHVA 2A6AA 4IFVA 4FOEA 2P5OA 4E7KA 4BG9A 2BH1A 4DQ8A 4BC2A 4JAXA 4DR4K 3OS0A 4B1UB 4M3WA 4X65K 2HSTA 1VQMN 4AH9A 1M90O 5FPMA 4BGAA 2ITMA 4R5PA 1IBKK 4OKKA 1A5WA 1X9SA 3OTOK 5AZJB 4B3RK 4KFBA 5C10A 1QHTA 5K14A 1LAVA 3VGLA 4DV2K 2R7YA 3OYNA 1Z6RA 4HWIA 2QWRA 1XQSC 4B9SA 3E1YA 2BUPA 1DLOA 2F7TA 1WSGA 3M3ZA 2XY7A 4OLBA 3CJ1A 3ENBA 3AO2A 4BRCA 4M3RA 3VGMA 3VEVA 4CJ7A 4BQLA 4BACA 4CGJA 1RFQA 2RF2A 4CZLA 3AVIA 3O8MA 1BCOA 1EETA 3O9TA 4F3TA 1KVBA 1KVCA 4N56A 2CGJA 1EWRA 5C12A 1KAYA 4M3XA 4DS4A 3ZYYX 5HRSA 3P31A 2QTDA 1SKWA 4DG1A 3JXUA 4LFBK 5M1NA 1VAZA 4CGGA 1TUYA 5DK5A 2O8FB 5E41A 1LOTB 2F9TA 1JLCA 3THWB 2UU9K 2E6MA 3KD5E 4CEAA 2YHXA 2KHOA 4HTUA 1BIUA 2ZGYA 4IDHA 1B9DA 1BI4A 4DMNA 3CQYA 1VQ9N 1K73O 1VQ6N 1NJXA 3LDOA 1S22A 3S41A 2IDOA 4E89A 4ELTA 2D0AA 4X66K 3CMAN 1S1UA 4JYAK 3ENHA 1SL1A 4F2RA 3K5LA 2FXUA 4IBNA 1DTQA 4FO0A 5JS2A 2ASOA 3A5NC 4FVMA 2GWJA 1GLBG 3AAQA 1YT3A 3MN9A 4GY2B 4FWRA 5H1SQ 3HJFA 2D0CA 5EOYA 4B3OA 4JHDB 3ALYA 3QMLA 3DLLL 1K8AO 3SAHA 1VSLA 4JN4A 4A2AA 5C42A 2EHGA 2DFFA 3TAQA 4G1QA 3CM6A 1NOYA 1K9MO 3HTVA 1XUPO 3BF1A 1S1TA 3MN6A 4DTOA 4OGEA 2HHSA 3HPOA 2B5JA 3CC7N 1QTMA 5AQJA 4YHHK 3K5NA 5BRHA 2HVHA 3CXCM 1ZYQA 1NU0A 4N47A 3OYIA 1JJ2M 4O0JA 1EX4A 2HBLA 2A1RA 4H4MA 2GWKA 2QWLA 4X64K 2ITGA 2B6AA 5KPTA 4FM0A 3THYB 4RWTA 3NCIA 2P9NA 3H6EA 2BGGA 1VQON 4LC9B 4B1VA 3O3HA 4FJ8A 3CCJN 3A8YA 2YJFA 2YHAA 3I0SA 1RTJA 4B3SK 4IDKA 3ID8A 3G71N 4H5TA 1VRTA 4FJNA 4DTPA 1IBMK 4H0XB 4IOCL 2B4JA 4CJ3A 1NK5A 3WXLA 4YOUA 1JL2A 1F21A 3ASMA 4FOIA 5EVZA 4FW1A 2ASMA 2LSNA 5AZIA 3NBPA 4DTNA 2FLOA 4MDAA 3L2RA 2DTUA 3TAGA 4FWQA 4AHUA 2HW3A 5BRDA 3EKSA 4HUEA 2JLEA 2O8CA 4CEOA 5HL7L 3L8BA 3AA2A 3OY9A 3AVMA 2W41A 3ZETA 1L3SA 3SV4A 2Q31A 3DJCA 3DRRA 3D2FB 3AA5X 3PO5A 3UKUA 3THXA 1QQOA 4CEZA 4JK7A 1IKXA 5FROA 3K57A 3OYGA 4CEQA 4FWMA 3QDKA 4I6MB 4JEPA 2VGNA 4JKHA 4RTFD 2DFHA 1VQLN 3QFUA 3BDPA 3TABA 1CZAN 3RMDA 4O5BA 1NOZA 1VSFA 3NVMA 3LM9A 5BR9A 4TSXA 1U48A 1ASWA 1KFDA 3KLIA 5KPZA 5J2PA 1J5EK 1HQEA 3LP2A 4K43A 3TTFA 2ZJRL 1L3VA 1HNWK 3R8EA 2P9SB 3P38A 3LANA 3SUQA 4FK0A 4AF1A 1A5VA 4DV6K 1EO1A 1XWLA 5KGWA 1ASUA 4KH4A 1D5AA 4FPAA 3DRPA 2O8BA 3ZLJA 1VQKN 3OHRA 2E2NA 1TYQB 3O1BA 2UUAK 1RT2A 3ZSZA 2RKIA 2BDPA 4LFAK 4O5FA 3DOLA 4IWVA 4A5BA 1JCEA 3DWLA 2VCPA 5JMVA 3L4QA 4LH4A 3OS2A 4XH5A 3OYEA 3AAPA 2ZJPL 4JKCA 3BGRA 4CF8A 3ULDA 1L5UA 2HVIA 3DLEA 4N76A 3ZEUA 3LP3A 3MAQA 3WNGA 3M8SA 5KQDA 3D2EA 3V9SA 3DYAA 5GINA 1ZBFA 4KHYA 2EWSA 1BQMA 4C1NK 1O13A 1R0AA 3DLBA 3O4QA 2CGKA 2G8FA 2VWJA 2OPQA 5ADXA 2NLXA 3GOIA 2HBJA 4BC4A 3VA0A 4CE9A 1OH7A 3QERA 4HUGA 4FCYA 4JKBA 5AZJA 3SLCA 1IH7A 5GAGP 2PYLA 4PHTX 2W40A 1Z26A 3TPQA 3PX4A 4OPAA 3OBWA 2KLAA 5C24A 4ISGA 1REVA 2JGUA 4F9OA 3J80O 3C6TA 3L0QA 1RBTA 4DR2K 1NWKA 3KWIA 1C0UA 4DLGA 4PKHA 1XMOK 1T03A 3WXKA 5BPLA 3AVJA 3B8AX 4RG8A 5IT9O 3G10A 3KZBA 4K41A 4B9MA 1WAJA 4GKKK 4CHNA 2OPPA 3RSEB 1GLJO 2OCEA 3HOTA 3CFRA 3VETA 4DU3A 4FJHA 5J2NA 1GLLO 3O1WA 5FPEA 2O8FA 3P5JA 1QSSA 3NGYA 2W6KA 3EZWA 1RT5A 2XY8A 3THWA 3OYJA 3G4SN 1EXQA 1VQNN 4ISEA 3MN5A 4BDPA 3MXJA 3C6HA 1UA1A 3OYLA 1VQ8N 3MN7A 4CERA 4DTUA 3I55N 1QSYA 4NLBA 3EZ5A 3C65A 5AQUA 3TR8A 1HJRA 3FZMA 2PAVA 1JLEA 4IOXA 2P9IB 1QQCA 3NDKA 4W5TA 5GAHP 3VMFB 3QB0A 4OPHA 4JLHA 3SUPA 2QWMA 2GUIA 4JI3K 2O4IA 4BREA 3M1FA 3ZT3A 3NHGA 1Q86O 3QEIA 1JCGA 3MCPA 1J6ZA 5IWAK 3TAPA 3B6PA 2X74A 1HPMA 4JHDA 4KB1A 5AQLA 1WSIA 2F8TA 4M7XA 3UIQA 3A5MC 3RRGA 3AVNA 4JI0K 2YKMA 2IAJA 4IO9L 2DY4A 1CZ9A 3VQPA 1KRPA 1BOTO 5I9EB 1IJJA 2P9KB 3G6EN 3CCQN 1VQ5N 4DTXA 4WQ4C 3LPUA 1XNRK 4H0OA 1JXBA 2OPRA 3CC2N 3V4IA 1TKXA 3CCMN 1ZBIA 3DM2A 4EHUA 3J81O 3B6OA 1HPZA 1LW0A 2KQ2A 4H5VA 1ZC6A 1NJZA 5LL6Z 4GW6A 1SS6A 1W2BM 4WE1A 2G8KA 5I42A 1BIZA 4KH6A 1VRUA 3THYA 3I33A 3KK3A 4AQYK 4BRDA 3CJCA 2VG6A 3LWLA 3O3GA 3CG7A 1S72N 1T6CA 3AGKA 3TSQA 3HM9A 1RGIA 4E0DA 1IG8A 4E7LA 4DF4A 2X6NA 4YDUC 3P83D 1R59O 1RTDA 2GTDA 2ZWHA 5AQMA 5AQWA 2V52B 1RBUA 4GV9A 1IV0A 2JWKA 3NAEA 1YHQN 3F9MA 2VQFK 2E6LA 3AA3A 5TKWA 3CCEN 4WFBL 3WXJA 1XNQK 2QWQA 2E20A 1NGDA 4CK2A 3SAFA 4KBOA 4PUOA 1HYVA 3ISNC 5AQIA 4DU1A 1FK9A 1FXXA 3HPHA 4A61A 3OYDA 4FPBA 3SAGA 4DQPA 2ZQBA 4JKGB 3SMSA 1S9EA 4Z0UA 1S1WA 1E4GT 1KAZA 1K6YA 5AQTA 1WSJA 3HOSA 5I3UA 4B08A 3A0IX 3PIPL 1VSJA 1CLQA 2HBMA 4AM6A 1HR0K 4FZZA 2I7NA 3D2FA 3RVCA 1SKRA 1U2VA 4Z4HA 3JSMA 1TL3A 4JRQA 1TK8A 2Q97A 4MO4A 3DAWA 5GADP 4AHTA 3WXIA 1C1AA 1SL0A 4I2PA 3ZSQA 3UKRB 4ILHA 3EO3A 5CYMA 4I6MA 2NRRA 3ZX2A 3K2PA 1NGGA 3SYZA 3QO9A 4FXDA 2A5XA 3G25A 3TTDA 4YOVA 2RE2A 3CF5L 3Q7BA 4KHWA 4DV3K 2YHYA 3LP1A 4CVNE 3L4IA 4CESA 3TANA 3MX2A 4IEEA 4C8OA 2P9SA 1SQKA 1GOBA 4JI1K 3O5BA 4BRGA 5AFUA 4QAGA 3O4WA 1OVQA 1HRHA 2NUBA 5C25A 1WN7A 2VG7A 4KI4A 1TGOA 1TYQA 4IG3A 4Z4FA 3VQDA 2HHTA 2P9PB 1I3AA 1UA0A 4RW7A 3U9DA 3AO3A 4XH4A 5DM7L 4NYFA 5T7BA 3T69A 3THVA 3W3DA 1BISA 3MWPA 5MLCQ 2RHKA 2XY5A 1NGFA 1RDBA 3K0SA 2A41A 2FSNA 2OTJN 3VESA 4CBWA 3N4PA 2I7PA 4CEEA 3D45A 3BZKA 2NRTA 4BR9A 2A3ZA 1VQ7N 3HI0A 3F5TA 1NKCA 4KV8A 2QKKA 1HYSA 2OYQA 4JS4A 1ILYA 2GX9A 3V9ZA 4IJAA 5KRTA 2Q36A 3CCSN 3QEXA 4ZTFA 4LF4K 4B8AB 3QEWA 4KI6A 3OYKA 3ZCMA 3MEEA 1ITGA 4X62K 3K58A 1JL1A 4DV4K 2WBNA 4E7JA 4FJKA 5AQNA 3LZJA 3MXMA 4WCEL 3OYFA 4BR4A 4DR3K 1VQPN 2PBDA 4DR7K 4BE0A 1OH6A 1TKZA 5FPDA 3VPZA 4JKFA 2A40A 3SBGA 1WSEA 4ZHRA 4CJKA 4BRAA 1YF5L 3LDNA 5HROA 3R6MA 1YJNN 1JLFA 4CFDA 4B9NA 5EX5A 5CHIA 1XHXA 5AQPA 3IDHA 3AVCA 5BR8K 4F4KA 3AO4A 1V4TA 3HVRA 2ZM6K 4ID1A 1TK0A 3O6WA 1FW6A 3HT3A 2D5RA 4ELUA 3LAMA 3L2VA 1Y97A 3AVGA 2O8EB 2YV0X 1MWKA 3OJSA 3CETA 5EY4A 1YAGA 4HCBA 4YOWA 2O8DB 3RSEA 2ZE2A 4BR2A 3HO1A 3HP9A 5CZ2A 3VQQA 4U7BA 4BY9C 4ID5A 1C1CA 5F1XA 3PSFA 4DUYK 1WSFA 3TU5A 4W5QA 3CFPA 2FF6A 4JI8K 3OYAA 4FM2A 3GL1A 2E88A 3A2FA 3RR8A 3CCLN 3VQBA 2CH6A 1BA1A 1VSDA 3RMCA 1QVGM 3L3VA 5KI6A 1NK8A 2IVPA 4FJGA 4CHQA 3DLGA 3E9LA 3KKSA 4ILJA 1UAXA 4CF2A 2IS3A 3ZX0A 1C0GA 3KVGA 4YOTA 4BWMA 1BO5O 2P9IA 3H1QA 1IKVA 4J2BA 1LWCA 4DLEA 1C0MA 3NFAA 4DB3A 2VYPA 4BGBA 3SCXA 2G8WA 2HOEA 3C7NB 4CZIA 5ELZA 2PYJA 5BPMA 3ZT4A 4RW9A 4B3TK 3W0LA 1NMDA 2XRIA 2E1YA 1NM1A 4PKGA 4Q0BA 1YVNA 2YNIA 2G8HA 2IVOA 1VHXA 4KKOA 4FZXC 4IJNA 4BRLA 2HHWA 4UQGA 1T05A 2ZJQL 3I56N 3T1HK 1VSEA 1IKWA 4MLHA 2QWOA 3KK2A 3E66A 1XHZA 2P9KA 2IIRA 3IUCA 2KFNA 3ULEB 4CD3A 1NK7A 3LDQA 3FLCO 4M7YA 4Z4CA 4MLEA 4XH1A 4CEDA 4B1YB 1HLUA 3BUZB 1HKGA 4LD0A 1TKDA 4FLTA 2P5GA 5LY3A 3KLEA 2YX6A 3EL2A 3QBWA 1E3MA 4EFHA 2P9LB 3OJUA 1T8EA 4O0IA 1RDAA 4DSEA 1U4BA 4BDZA 5C15A 1EQYA 3V1QA 4PKIA 2FSJA 1EKEA 5BREA 5M1KA 3PX0A 3M8PA 2UUBK 1WB9A 4AHVA 5BN9A 4CFCA 4ISFA 3AVFA 3O4NA 4FSVA 4WYBA 3I8DA 4WQ5C 2WC9A 3H1VX 4G9ZA 4DSLA 4OO1J 4CGHA 4NXMK 1D4XA 1RDUA 2V7YA 2BE2A 3VEWA 1Q7YO 1OH5A 3VERA 1ZXOA 4O55A 2YCHA 2PFUA 3HZ6A 4KHSA 3E9OA 2QK9A 4DV0K 4MFBA 2WTUA 3K9KA 3T3FA 1VSMA 4K0KK 3NF7A 1NGJA 1S5JA 4JKGA 1N34K 4JKEA 5AQOA 1E4FT 4Y1CA 4B9UA 4FJJA 3RMAA 1RT1A 5C2FA 4C8KA 2G8IA 5JVGL 3TAFA 5LJVA 1NJIO 4XIUA 4E1MA 1QHAA 3IS9A 1EP4A 2ZF5O 3U9ZA 4I7FA 3VF6A 3QIPA 4O8KA 4FWPA 4YNQA 3UKRA 3HP6A 4DSIA 1ATNA 1LAWA 2WOMA 3NH0A 1NJWA 3TSUA 3ZX3A 2E2PA 3GBTA 4O8UA 1S6QA 3WXMB 3VQAA 3D0PA 4KB0A 1HKCA 2QI2A 2KTQA 3AO1A 3CIPA 4Z4IA 3IFRA 1LV5A 5B8HA 2DFEA 1O1WA 4JI4K 1YJWN 1P90A 3KJVA 4CJRA 1W97L 4BVOA 4DTSA 1GLEG 4RW6A 1Q9YA 1T44A 5KRSA 1NG9A 1TV6A 2HNZA 3UE5A 2OZSA 4KREA 4FW2A 3ZSYA 4NXNK 4JKAA 4HVJA 1RILA 4DKWA 5CE3A 4CJEA 1TAUA 3LM2A 3L3UA 4Y1DA 4CFAA 1HNXK 4H5WA 3R9PA 2GELA 2G8VA 4M42A 2P9PA 5BPNA 2DPNA 3AV9A 3K5MA 3WEEB 3VF2A 4J2DA 3AVLA 4FWSA 5GAEP 1T3VA 3EKUA 3LDPA 4CF0A 4DSJA 3KLHA 1RT7A 2X78A 3CD6N 3J8AA 4PL7A 4DQSA 1NGAA 4BRPA 5AJ3K 3D6RA 1HNIA 1S1VA 4CI6A 1LCUA 4EP5A 1CXUA 4H5RA 3H08A 4BC3A 3KKRA 1SL2A 2HB5A 5FRNA 4DFPA 1HUXA 4KTZA 5KGXA 3LWMA 4DQQA 1GOAA 3CJAA 2G8UA 2KW4A 5BN8A 3IRXA 4DF8A 3SPZA 1N8RO 4KH5A 1NGBA 4MQ3A 1Q81O 2CGLA 4DFMA 4JD2B 4YORA 5AR0A 4GV3A 4Z4GA 3V9UA 5ADXH 3CCVN 2AP1A 5C2DA 4CEFA 1S9GA 3HSTB 1WBDA 3JYTA 1EWQA 3VENA 1N5YA 4HTLA 1KTQA 4M3TA 4IFEA 1RT6A 1X3MA 4QOZB 3BP8A 3E01A 2HMIA 2P51A 3S9HA 4RW4A 4PQUA 1U6ZA 4CBXA 1NGEA 4LSLA 1KCFA 3C6UA 1QE1A 3CPEA 3M8QA 3KIOA 4K8ZA 3VEOA 1HQUA 1I39A 4CJSA 3VQEA 2FBTA 1Q8IA 5GIOA 2QA4N 4O44A 4DQRA 1QS4A 2F4VK 1RBVA 4LFCK 1NMNA 1B92A 2NRZA 2O8EA 4JV5K 1HJOA 1BU6O 2O4GA 4DCHA 4EZ6A 2O8DA 1Z25A 4OLAA 1LWFA 1JCFA 2Q0UA 3NGIA 3AVKA 3OBYA 2HHXA 1SAZA 5AQSA 3DLRA 4IEIA 2NRXA 4M3YA 3SV3A 3QEVA 3I0RA 4DV5K 3O9UA 1SKSA 2A1SA 2OZMA 1I94K 1C1BA 2QEXN 3J7AP 4AHRA 1C6VA 1T7PA 5F2RA 3SUOA 3VOVA 4CHYA 3ZT2A 3LZIA 2HF4A 3DOKA 3TSPA 2VGMA 1ZBUA 1QSLA 1U45A 5AQVA 3C6AA 4CFBA 4FLYA 3DXMB 4XEIA 4M45A 1KFSA 1QQNA 3GDQA 5FDLA 3V6DA 4NO7A 1YVUA 4C23A 2HMPA 4LSNA 2AJQA 3WNHA 3C0BA 1B9FA 2ZD1A 1DEJA 4HHTA 2AA4A 3AARA 3C7NA 3K59A 1XI1A 2A42A 1DGKN 3FZHA 4UY8O 3NH2A 4HCCA 3RTVA 2P1JA 3NE6A 3A5OC 3JS6A 1D9DA 1X9WA 1HX1A 4CJ4A 2HF3A 5AQZA 1RBRA 1YITN 2RPIA 4DR5K 2Y1JA 4JNEA 3VQ6A 3ZSOA 2VQEK 4DU4A 4BR0A 4BRQA 5M1FA 1GLFO 5DM6L 3K9JA 1UWBA 2D4WA 1G15A 1U04A 5FLXO 4CK1A 3KK1A 2Q2RA 3BEXA 4K25A 4DTMA 4J2AA 4FJMA 4E19A 1ATSA 3F9KA 3V9WA 1IBLK 1FJGK 2UYTA 2NRVA 3E9PA 4EP4A 3WNEA 1BHLA 1VK0A
chains in the Genus database with same CATH topology
1ASWA 1KFDA 3SNNA 1Y97A 3KLIA 4QCLA 3ZT1A 3AVGA 1TVRA 5J2PA 2YV0X 3PV8A 4EZ9A 3OJSA 1XC9A 1HQEA 3LP2A 3HVTA 1U47A 1RCHA 4FJ7A 4HCBA 4CECA 1BCMA 1N6QA 1L3VA 2XY6A 4CIEA 1JXEA 1TL1A 2ZE2A 3HL8A 3HO1A 3HP9A 1DTTA 3LANA 3NF9A 5CZ2A 2VG5A 3VQQA 4ID5A 3SUQA 1A5VA 1C1CA 1YTAA 4GMJB 1XWLA 4KHUA 5KGWA 1ASUA 1WSFA 2Z1IA 3U3YA 3SQ1A 2GV9A 3SJJA 1D5AA 1WLJA 4DS5A 3PUFA 3DRPA 4CIFA 4W5QA 3CFPA 3ZT0A 1YTUA 3OYAA 1RT2A 4FM2A 4M3ZA 1L3TA 3A2FA 3ZSZA 2RKIA 2BDPA 3RR8A 3C94A 3VQBA 4DTRA 2E4LA 2IC3A 1VSDA 3DOLA 4BE2A 3U3GA 1ASVA 4M41A 3RMCA 3L3VA 1NK0A 3SQ4A 5KI6A 1NK8A 1C0TA 1BGXT 4FJGA 4CHQA 4LH4A 4KHNA 3G0ZA 3DLGA 1A5XA 2Z1JA 3KKSA 1UAXA 4CF2A 2IS3A 1SKRA 3OS2A 3OYEA 1WNSA 5SZTA 3M8RA 2FBVA 4OVLA 1NK6A 4F2SA 3BGRA 4CF8A 4BWMA 3ULDA 1L5UA 3OS1A 2HVIA 3MEDA 3DLEA 4Q5VA 1NK9A 1IKVA 4J2BA 1LWCA 4N76A 4DLEA 5FRNA 1C0MA 3K5OA 3NFAA 3LP3A 3MAQA 5J2QA 3WNGA 3SCXA 3M8SA 1TAQA 2G8WA 3V9SA 3DYAA 1ZBFA 2PYJA 4KHYA 4FLXA 3ZT4A 4RW9A 4OPKA 1BQMA 4CJUA 2XRIA 3F73A 3PX6A 1R0AA 3DLBA 4LH5A 1S6PA 3O4QA 4Q0BA 1KVAA 4KO0A 1TK5A 2YNIA 2G8HA 2G8FA 4KKOA 4OJRA 4FZXC 3V1RA 2VWJA 3DLHA 1CXQA 2D0BA 4YFUA 3KLFA 2HHWA 2OPQA 4UQGA 1RNHA 1UOCA 1T05A 1GOCA 4KTQA 4JRPA 3TWHA 3VA0A 4CE9A 1VSEA 3SPYA 3QERA 1IKWA 1RT3A 3S3NA 2Z1GA 5SWMA 4AILC 4KTWA 4HUGA 4FCYA 3KK2A 3S3MA 1RT4A 1IKYA 4B9VA 3EY1A 2HHQA 2KFZA 1IH7A 3LALA 4GVMA 4CHZA 1XHZA 2PYLA 2PZSA 2KFNA 4BDYA 1Z26A 3WNFA 3PX4A 4FJIA 3U6FA 3HYFA 1NK7A 1JLBA 4CJLA 4FLZA 5C24A 2FC0A 4CGIA 2Y1IA 1REVA 3QESA 4Z4CA 3QEPA 5HRPA 1CZBA 1J53A 2JGUA 2FBXA 3QLHA 4CHOA 3C6TA 2IGIA 4CEDA 1RBTA 1LW2A 3CYMA 3FFIA 1BQNA 4LD0A 1TKDA 2YKNA 4FLTA 1C0UA 1WAFA 4DLGA 2P5GA 3AVHA 3KLEA 1T03A 4DSFA 4M3UA 4PWDA 3TI0A 2QXFA 3AVJA 3OJUA 3L2QA 4H4OA 4RG8A 4CJQA 4KPYA 3G10A 4CGDA 1T8EA 3OYHA 4B9MA 1WAJA 4O0IA 1RDAA 4DFKA 4CHNA 4DSEA 1U4BA 4C8LA 1KLNA 2OPPA 4BDZA 3V1QA 1IO2A 4CJFA 4CJ5A 1BL3A 2QKBA 4FYDA 1EKEA 3CFRA 2OPSA 3ITHA 3PX0A 1J5OA 3M8PA 1RTIA 5HBMA 2PY5A 4AHVA 4DU3A 4FJHA 4CFCA 1RDDA 3AVFA 3O4NA 2XO7A 1RBSA 1J9AA 4E7HA 3I8DA 4W5RA 4PY5A 4AHCA 5J2NA 1JLGA 3VQ5A 2WONA 3VQCA 4I9LA 4CK3A 1W0HA 3P5JA 1QSSA 4DSLA 3NGYA 3LDSA 2HHUA 4CGHA 1RT5A 2XY8A 4PA1A 1HMVA 3SUNA 3OYJA 2BE2A 1SUQA 1EXQA 2RN2A 4W5OA 3KTQA 4W5NA 4F8RA 3SZ2A 1IG9A 4BDPA 3MXJA 4O55A 5HRRA 4CJPA 1Q9XA 4OKJA 5J2MA 3OYLA 1UA1A 4KRFA 4KHSA 2HNYA 4CERA 4DTUA 2QK9A 4MFBA 1QSYA 2EX3A 5D3GA 3EZ5A 4NYNA 4I2QA 1VSMA 5CYQA 3T3FA 3TR8A 4CF9A 1NJYA 2I5JA 1HJRA 3NF7A 3QINA 2Q3SA 3MXIA 1S5JA 1JLEA 4FM1A 4I9QA 4C8NA 3OYBA 3QIOA 4Y1CA 3TAMA 4ELVA 4B9UA 4FJJA 3RMAA 1QQCA 1RT1A 3LP0A 3NDKA 3QNNA 4C8KA 2G8IA 1JLAA 4FLVA 4RW8A 4W5TA 4DWIA 3OYMA 3TAFA 4CJWA 5J1EA 2HHVA 3IG1A 4JLHA 4XIUA 4E1MA 3SUPA 2GUIA 3NF8A 2O4IA 3IS9A 1EP4A 4IFVA 5FRMA 3SI6A 2P5OA 3VQ7A 4KHQA 4I7FA 3QIPA 1X9MA 4FJXA 5HLFA 3TARA 4E7KA 3ZT3A 3NHGA 3QEIA 3RWUA 4FJ9A 4YNQA 1TKTA 5DMRA 3OS0A 3TAPA 3B6PA 4M3WA 2X74A 3HP6A 4DSIA 3QNOA 4KB1A 1LAWA 2WOMA 3NH0A 1NJWA 1WSIA 2F8TA 4AH9A 4FZYA 3LAKA 1S6QA 3UIQA 3DMJA 4FJ5A 3RRGA 3VQAA 3AVNA 3D0PA 4R5PA 4KB0A 2YKMA 4OKKA 2IAJA 4NCBA 1A5WA 2DY4A 1CZ9A 3VQPA 1X9SA 4F3OA 4DSKA 1KRPA 2KTQA 3AO1A 4CF1A 4KFBA 1QHTA 5K14A 1LAVA 4Z4IA 4DTXA 3SQ2A 3LPUA 2R7YA 1JXBA 2OPRA 3OYNA 1LV5A 3VQ9A 2DFEA 1O1WA 3NH1A 4CJRA 3KJVA 1TKXA 4DTSA 4CJTA 4RW6A 4CEBA 1RDCA 1DLOA 3ZSXA 3DM2A 1Q9YA 5KRSA 1ZBIA 3B6OA 1HPZA 1LW0A 2KQ2A 1TV6A 1WSGA 2HNZA 4HUFA 2XY7A 2OZSA 4OLBA 2Z1HA 3MEGA 1NJZA 3AO2A 4KREA 4GW6A 2VWKA 4FW2A 4BWJA 3LPTA 4C8MA 4M3RA 3ZSYA 3QETA 4WE1A 2G8KA 4BACA 4HVJA 1RILA 5I42A 1BIZA 4CHPA 1VRUA 4CGJA 1NK4A 2RF2A 4CJEA 1TAUA 3KK3A 2YNGA 3L3UA 4Y1DA 3AVIA 4CFAA 4CGFA 4DQIA 2G8VA 3DLKA 4J2EA 4M42A 1BCOA 1EETA 4E1NA 2VG6A 3AO5A 1KVBA 3AV9A 3O3GA 3CG7A 4ICLA 3LWLA 1KVCA 3V1OA 4N56A 3K5MA 4DTJA 4J2DA 3V4IA 3AVLA 2IOCA 3ZSWA 3HM9A 4E0DA 5EU7A 4K8XA 1NKEA 4CF0A 4N41A 4DSJA 3KLHA 4E7LA 4M3XA 4DS4A 2X6NA 4DF4A 3P83D 1RT7A 4LY7A 5HRSA 4CCHA 1RTDA 2X78A 1SKWA 4DG1A 4DQSA 4CGGA 1RBUA 1S1XA 5DK5A 2F8SA 5E41A 3HPGA 1JKHA 3NAEA 1JLCA 1HNIA 1S1VA 2E6MA 3KD5E 2E6LA 3AA3A 4CEAA 4EP5A 3KLGA 1CXUA 4HTUA 4N5SA 2KZZA 4FK0A 2ETJA 3H08A 5CZ1A 1BIUA 4CK2A 3KKRA 1SL2A 1ZBHA 2HB5A 1D9FA 1HNVA 1HYVA 1B9DA 1BI4A 3ISNC 4DFPA 3SQ0A 4PUOA 4KTZA 5KGXA 3LWMA 1FK9A 4DQQA 4DU1A 1FXXA 3HPHA 3MECA 1GOAA 4DMNA 3OYDA 4JS5A 2G8UA 2ZQBA 4OPJA 4H8KA 2KW4A 1NJXA 4DQPA 1S9EA 4Z0UA 1S1WA 3PO4A 3IRXA 4IG0A 4B9TA 1K6YA 2IDOA 4E89A 2D0AA 4DF8A 3SPZA 2W42A 4ELTA 1MU2A 1WSJA 4MQ3A 3VN5A 1S1UA 1VSHA 2OA8A 5HRNA 4B9SA 3T19A 4DFMA 5HP1A 4B08A 5I3UA 4IKFA 4Z4GA 1VSJA 3V9UA 1SL1A 4F2RA 1CLQA 3K5LA 4IBNA 3S3OA 4FZZA 4CEFA 1DTQA 2YNHA 1S9GA 2BANA 5JS2A 3HSTB 4FVMA 1TL3A 4Z4HA 3JSMA 3JYTA 4JRQA 1TK8A 1N5YA 1U48A 3RR7A 1KTQA 4M3TA 4QOZB 1RT6A 4O4GA 1YT3A 3E01A 4AHTA 3NF6A 1C1AA 1SL0A 2HMIA 1WSHA 4I2PA 3ZSQA 5CY4A 3HJFA 2D0CA 2P51A 3S9HA 4B3OA 5CYMA 4RW4A 4PQUA 3ALYA 1VSLA 4LSLA 1KCFA 3C6UA 1QE1A 3K2PA 3M8QA 5C42A 3SYZA 4KAZA 2EHGA 3KIOA 3QO9A 4K8ZA 4FXDA 1JLQA 1HQUA 2DFFA 3TAQA 4G1QA 1I39A 3CM6A 4CJSA 3VQEA 1NOYA 2FBTA 1Q8IA 4O44A 3RRHA 4L8RB 1S1TA 4KHWA 4DQRA 4DTOA 3RMBA 3LP1A 1QS4A 4OGEA 2HHSA 1RBVA 4NCAA 3HPOA 1B92A 2B5JA 4CESA 3TANA 1QTMA 4Z4EA 3K5NA 2HVHA 2HNDA 2YHBA 4C8OA 3KD1E 1ZYQA 2O4GA 4EZ6A 4N47A 3OYIA 1Z25A 4OLAA 1GOBA 1LWFA 1D8YA 4O0JA 4FK4A 3NGIA 3AVKA 1EX4A 2A1RA 2HHXA 4H4MA 4ZTJA 4QAGA 1HRHA 2NUBA 3DLRA 5C25A 3L2WA 1WN7A 2ITGA 3V81A 1KSPA 4FK2A 2B6AA 3DI6A 4M3YA 2VG7A 3SV3A 4KI4A 3L2UA 3QEVA 3AA4A 3C95A 3I0RA 3V9XA 1TGOA 4FM0A 4IG3A 3AVBA 4B9LA 4Z4FA 3NCIA 1SKSA 4OKEA 3VQDA 2HHTA 2A1SA 2OZMA 4F3TA 4FLWA 1C1BA 1J54A 1I3AA 4IFYA 1HYZA 1UA0A 4RW7A 4AHRA 1C6VA 2BGGA 1T7PA 2GBZA 3O3HA 3AO3A 3CM5A 3SUOA 4CHYA 1U49A 4FJ8A 3ZT2A 3LZIA 2YHAA 1KLMA 3DOKA 3VQ4A 1VSIA 4NYFA 3VQ8A 3I0SA 1RTJA 1ZBUA 5T7BA 4DFJA 1U45A 3THVA 1QSLA 2YNFA 1BISA 4IDKA 4CFBA 3HK2A 1W9HA 4FLYA 2XY5A 4OGCA 1RDBA 1VRTA 4M45A 3T1AA 1KFSA 5FDLA 3V6DA 4FJNA 4DTPA 1YVUA 1RTHA 1NKBA 4CEEA 3D45A 2B4JA 3PY8A 4CJVA 2AJQA 4LSNA 4CJ3A 4FLUA 3WNHA 1NK5A 1B9FA 2ZD1A 4HHTA 1NKCA 1JL2A 4KV8A 3O3FA 2QKKA 1F21A 3ASMA 1HYSA 1X1PA 2OYQA 4JS4A 3AVAA 4AHSA 4FW1A 3K59A 3V9ZA 2LSNA 5KRTA 4ZTFA 1XI1A 1FKPA 3NBPA 4DTNA 1VSKA 3QEXA 3L2RA 1BI4B 5JS1A 4B8AB 4E3SA 3QEWA 4KI6A 3TAGA 2DTUA 3OYKA 3ZCMA 4CIGA 3VA3A 3MEEA 1ITGA 3DRSA 4AHUA 3NH2A 1JL1A 3K58A 2P1JA 3RTVA 4E7JA 4HCCA 4FJKA 2HW3A 4E7IA 3NE6A 4HUEA 2JLEA 3LZJA 1D9DA 3MXMA 1X9WA 4CEOA 3OYFA 3L8BA 3AA2A 3OY9A 4BE0A 5KTQA 4CJ4A 2FBYA 3AVMA 1TKZA 2XHBA 1RBRA 1L3SA 3CFOA 2RPIA 3P1GA 3SV4A 3DRRA 3OVNA 3AA5X 2Y1JA 1WSEA 3PO5A 3VQ6A 3ZSOA 4ZHRA 4DU4A 4CJKA 1L3UA 5HROA 4B9NA 1JLFA 2ATQA 4CFDA 4CEZA 4FJLA 1XHXA 4BE1A 1IKXA 3NGZA 2KZMA 3AVCA 5FROA 1UWBA 3K57A 3AO4A 4F4KA 1LWEA 2X6SA 4CEQA 3OYGA 3ZSRA 3EYZA 1G15A 2F96A 1U04A 1ZBLA 4CK1A 3HVRA 3KK1A 1SV5A 3HXMA 3CQ8A 4ID1A 2DFHA 1TK0A 1FKOA 4B8CA 4DTMA 3TAEA 3BDPA 3ZSVA 4J2AA 4FJMA 4E19A 3TABA 3V9WA 3F9KA 3HT3A 3RMDA 2D5RA 1NOZA 4O5BA 1VSFA 4NCGA 4ELUA 3IAYA 4EP4A 3LAMA 3OYCA 3WNEA 4TSXA 3L2VA 1BHLA 1VK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ASW A;  1KFD A;  3SNN A;  1Y97 A;  3KLI A;  4QCL A;  3ZT1 A;  3AVG A;  1TVR A;  5J2P A;  2YV0 X;  3PV8 A;  4EZ9 A;  3OJS A;  1XC9 A;  1HQE A;  3LP2 A;  3HVT A;  1U47 A;  1RCH A;  4FJ7 A;  4HCB A;  4CEC A;  1BCM A;  1N6Q A;  1L3V A;  2XY6 A;  4CIE A;  1JXE A;  1TL1 A;  2ZE2 A;  3HL8 A;  3HO1 A;  3HP9 A;  1DTT A;  3LAN A;  3NF9 A;  5CZ2 A;  2VG5 A;  3VQQ A;  4ID5 A;  3SUQ A;  1A5V A;  1C1C A;  1YTA A;  4GMJ B;  1XWL A;  4KHU A;  5KGW A;  1ASU A;  1WSF A;  2Z1I A;  3U3Y A;  3SQ1 A;  2GV9 A;  3SJJ A;  1D5A A;  1WLJ A;  4DS5 A;  3PUF A;  3DRP A;  4CIF A;  4W5Q A;  3CFP A;  3ZT0 A;  1YTU A;  3OYA A;  1RT2 A;  4FM2 A;  4M3Z A;  1L3T A;  3A2F A;  3ZSZ A;  2RKI A;  2BDP A;  3RR8 A;  3C94 A;  3VQB A;  4DTR A;  2E4L A;  2IC3 A;  1VSD A;  3DOL A;  4BE2 A;  3U3G A;  1ASV A;  4M41 A;  3RMC A;  3L3V A;  1NK0 A;  3SQ4 A;  5KI6 A;  1NK8 A;  1C0T A;  1BGX T;  4FJG A;  4CHQ A;  4LH4 A;  4KHN A;  3G0Z A;  3DLG A;  1A5X A;  2Z1J A;  3KKS A;  1UAX A;  4CF2 A;  2IS3 A;  1SKR A;  3OS2 A;  3OYE A;  1WNS A;  5SZT A;  3M8R A;  2FBV A;  4OVL A;  1NK6 A;  4F2S A;  3BGR A;  4CF8 A;  4BWM A;  3ULD A;  1L5U A;  3OS1 A;  2HVI A;  3MED A;  3DLE A;  4Q5V A;  1NK9 A;  1IKV A;  4J2B A;  1LWC A;  4N76 A;  4DLE A;  5FRN A;  1C0M A;  3K5O A;  3NFA A;  3LP3 A;  3MAQ A;  5J2Q A;  3WNG A;  3SCX A;  3M8S A;  1TAQ A;  2G8W A;  3V9S A;  3DYA A;  1ZBF A;  2PYJ A;  4KHY A;  4FLX A;  3ZT4 A;  4RW9 A;  4OPK A;  1BQM A;  4CJU A;  2XRI A;  3F73 A;  3PX6 A;  1R0A A;  3DLB A;  4LH5 A;  1S6P A;  3O4Q A;  4Q0B A;  1KVA A;  4KO0 A;  1TK5 A;  2YNI A;  2G8H A;  2G8F A;  4KKO A;  4OJR A;  4FZX C;  3V1R A;  2VWJ A;  3DLH A;  1CXQ A;  2D0B A;  4YFU A;  3KLF A;  2HHW A;  2OPQ A;  4UQG A;  1RNH A;  1UOC A;  1T05 A;  1GOC A;  4KTQ A;  4JRP A;  3TWH A;  3VA0 A;  4CE9 A;  1VSE A;  3SPY A;  3QER A;  1IKW A;  1RT3 A;  3S3N A;  2Z1G A;  5SWM A;  4AIL C;  4KTW A;  4HUG A;  4FCY A;  3KK2 A;  3S3M A;  1RT4 A;  1IKY A;  4B9V A;  3EY1 A;  2HHQ A;  2KFZ A;  1IH7 A;  3LAL A;  4GVM A;  4CHZ A;  1XHZ A;  2PYL A;  2PZS A;  2KFN A;  4BDY A;  1Z26 A;  3WNF A;  3PX4 A;  4FJI A;  3U6F A;  3HYF A;  1NK7 A;  1JLB A;  4CJL A;  4FLZ A;  5C24 A;  2FC0 A;  4CGI A;  2Y1I A;  1REV A;  3QES A;  4Z4C A;  3QEP A;  5HRP A;  1CZB A;  1J53 A;  2JGU A;  2FBX A;  3QLH A;  4CHO A;  3C6T A;  2IGI A;  4CED A;  1RBT A;  1LW2 A;  3CYM A;  3FFI A;  1BQN A;  4LD0 A;  1TKD A;  2YKN A;  4FLT A;  1C0U A;  1WAF A;  4DLG A;  2P5G A;  3AVH A;  3KLE A;  1T03 A;  4DSF A;  4M3U A;  4PWD A;  3TI0 A;  2QXF A;  3AVJ A;  3OJU A;  3L2Q A;  4H4O A;  4RG8 A;  4CJQ A;  4KPY A;  3G10 A;  4CGD A;  1T8E A;  3OYH A;  4B9M A;  1WAJ A;  4O0I A;  1RDA A;  4DFK A;  4CHN A;  4DSE A;  1U4B A;  4C8L A;  1KLN A;  2OPP A;  4BDZ A;  3V1Q A;  1IO2 A;  4CJF A;  4CJ5 A;  1BL3 A;  2QKB A;  4FYD A;  1EKE A;  3CFR A;  2OPS A;  3ITH A;  3PX0 A;  1J5O A;  3M8P A;  1RTI A;  5HBM A;  2PY5 A;  4AHV A;  4DU3 A;  4FJH A;  4CFC A;  1RDD A;  3AVF A;  3O4N A;  2XO7 A;  1RBS A;  1J9A A;  4E7H A;  3I8D A;  4W5R A;  4PY5 A;  4AHC A;  5J2N A;  1JLG A;  3VQ5 A;  2WON A;  3VQC A;  4I9L A;  4CK3 A;  1W0H A;  3P5J A;  1QSS A;  4DSL A;  3NGY A;  3LDS A;  2HHU A;  4CGH A;  1RT5 A;  2XY8 A;  4PA1 A;  1HMV A;  3SUN A;  3OYJ A;  2BE2 A;  1SUQ A;  1EXQ A;  2RN2 A;  4W5O A;  3KTQ A;  4W5N A;  4F8R A;  3SZ2 A;  1IG9 A;  4BDP A;  3MXJ A;  4O55 A;  5HRR A;  4CJP A;  1Q9X A;  4OKJ A;  5J2M A;  3OYL A;  1UA1 A;  4KRF A;  4KHS A;  2HNY A;  4CER A;  4DTU A;  2QK9 A;  4MFB A;  1QSY A;  2EX3 A;  5D3G A;  3EZ5 A;  4NYN A;  4I2Q A;  1VSM A;  5CYQ A;  3T3F A;  3TR8 A;  4CF9 A;  1NJY A;  2I5J A;  1HJR A;  3NF7 A;  3QIN A;  2Q3S A;  3MXI A;  1S5J A;  1JLE A;  4FM1 A;  4I9Q A;  4C8N A;  3OYB A;  3QIO A;  4Y1C A;  3TAM A;  4ELV A;  4B9U A;  4FJJ A;  3RMA A;  1QQC A;  1RT1 A;  3LP0 A;  3NDK A;  3QNN A;  4C8K A;  2G8I A;  1JLA A;  4FLV A;  4RW8 A;  4W5T A;  4DWI A;  3OYM A;  3TAF A;  4CJW A;  5J1E A;  2HHV A;  3IG1 A;  4JLH A;  4XIU A;  4E1M A;  3SUP A;  2GUI A;  3NF8 A;  2O4I A;  3IS9 A;  1EP4 A;  4IFV A;  5FRM A;  3SI6 A;  2P5O A;  3VQ7 A;  4KHQ A;  4I7F A;  3QIP A;  1X9M A;  4FJX A;  5HLF A;  3TAR A;  4E7K A;  3ZT3 A;  3NHG A;  3QEI A;  3RWU A;  4FJ9 A;  4YNQ A;  1TKT A;  5DMR A;  3OS0 A;  3TAP A;  3B6P A;  4M3W A;  2X74 A;  3HP6 A;  4DSI A;  3QNO A;  4KB1 A;  1LAW A;  2WOM A;  3NH0 A;  1NJW A;  1WSI A;  2F8T A;  4AH9 A;  4FZY A;  3LAK A;  1S6Q A;  3UIQ A;  3DMJ A;  4FJ5 A;  3RRG A;  3VQA A;  3AVN A;  3D0P A;  4R5P A;  4KB0 A;  2YKM A;  4OKK A;  2IAJ A;  4NCB A;  1A5W A;  2DY4 A;  1CZ9 A;  3VQP A;  1X9S A;  4F3O A;  4DSK A;  1KRP A;  2KTQ A;  3AO1 A;  4CF1 A;  4KFB A;  1QHT A;  5K14 A;  1LAV A;  4Z4I A;  4DTX A;  3SQ2 A;  3LPU A;  2R7Y A;  1JXB A;  2OPR A;  3OYN A;  1LV5 A;  3VQ9 A;  2DFE A;  1O1W A;  3NH1 A;  4CJR A;  3KJV A;  1TKX A;  4DTS A;  4CJT A;  4RW6 A;  4CEB A;  1RDC A;  1DLO A;  3ZSX A;  3DM2 A;  1Q9Y A;  5KRS A;  1ZBI A;  3B6O A;  1HPZ A;  1LW0 A;  2KQ2 A;  1TV6 A;  1WSG A;  2HNZ A;  4HUF A;  2XY7 A;  2OZS A;  4OLB A;  2Z1H A;  3MEG A;  1NJZ A;  3AO2 A;  4KRE A;  4GW6 A;  2VWK A;  4FW2 A;  4BWJ A;  3LPT A;  4C8M A;  4M3R A;  3ZSY A;  3QET A;  4WE1 A;  2G8K A;  4BAC A;  4HVJ A;  1RIL A;  5I42 A;  1BIZ A;  4CHP A;  1VRU A;  4CGJ A;  1NK4 A;  2RF2 A;  4CJE A;  1TAU A;  3KK3 A;  2YNG A;  3L3U A;  4Y1D A;  3AVI A;  4CFA A;  4CGF A;  4DQI A;  2G8V A;  3DLK A;  4J2E A;  4M42 A;  1BCO A;  1EET A;  4E1N A;  2VG6 A;  3AO5 A;  1KVB A;  3AV9 A;  3O3G A;  3CG7 A;  4ICL A;  3LWL A;  1KVC A;  3V1O A;  4N56 A;  3K5M A;  4DTJ A;  4J2D A;  3V4I A;  3AVL A;  2IOC A;  3ZSW A;  3HM9 A;  4E0D A;  5EU7 A;  4K8X A;  1NKE A;  4CF0 A;  4N41 A;  4DSJ A;  3KLH A;  4E7L A;  4M3X A;  4DS4 A;  2X6N A;  4DF4 A;  3P83 D;  1RT7 A;  4LY7 A;  5HRS A;  4CCH A;  1RTD A;  2X78 A;  1SKW A;  4DG1 A;  4DQS A;  4CGG A;  1RBU A;  1S1X A;  5DK5 A;  2F8S A;  5E41 A;  3HPG A;  1JKH A;  3NAE A;  1JLC A;  1HNI A;  1S1V A;  2E6M A;  3KD5 E;  2E6L A;  3AA3 A;  4CEA A;  4EP5 A;  3KLG A;  1CXU A;  4HTU A;  4N5S A;  2KZZ A;  4FK0 A;  2ETJ A;  3H08 A;  5CZ1 A;  1BIU A;  4CK2 A;  3KKR A;  1SL2 A;  1ZBH A;  2HB5 A;  1D9F A;  1HNV A;  1HYV A;  1B9D A;  1BI4 A;  3ISN C;  4DFP A;  3SQ0 A;  4PUO A;  4KTZ A;  5KGX A;  3LWM A;  1FK9 A;  4DQQ A;  4DU1 A;  1FXX A;  3HPH A;  3MEC A;  1GOA A;  4DMN A;  3OYD A;  4JS5 A;  2G8U A;  2ZQB A;  4OPJ A;  4H8K A;  2KW4 A;  1NJX A;  4DQP A;  1S9E A;  4Z0U A;  1S1W A;  3PO4 A;  3IRX A;  4IG0 A;  4B9T A;  1K6Y A;  2IDO A;  4E89 A;  2D0A A;  4DF8 A;  3SPZ A;  2W42 A;  4ELT A;  1MU2 A;  1WSJ A;  4MQ3 A;  3VN5 A;  1S1U A;  1VSH A;  2OA8 A;  5HRN A;  4B9S A;  3T19 A;  4DFM A;  5HP1 A;  4B08 A;  5I3U A;  4IKF A;  4Z4G A;  1VSJ A;  3V9U A;  1SL1 A;  4F2R A;  1CLQ A;  3K5L A;  4IBN A;  3S3O A;  4FZZ A;  4CEF A;  1DTQ A;  2YNH A;  1S9G A;  2BAN A;  5JS2 A;  3HST B;  4FVM A;  1TL3 A;  4Z4H A;  3JSM A;  3JYT A;  4JRQ A;  1TK8 A;  1N5Y A;  1U48 A;  3RR7 A;  1KTQ A;  4M3T A;  4QOZ B;  1RT6 A;  4O4G A;  1YT3 A;  3E01 A;  4AHT A;  3NF6 A;  1C1A A;  1SL0 A;  2HMI A;  1WSH A;  4I2P A;  3ZSQ A;  5CY4 A;  3HJF A;  2D0C A;  2P51 A;  3S9H A;  4B3O A;  5CYM A;  4RW4 A;  4PQU A;  3ALY A;  1VSL A;  4LSL A;  1KCF A;  3C6U A;  1QE1 A;  3K2P A;  3M8Q A;  5C42 A;  3SYZ A;  4KAZ A;  2EHG A;  3KIO A;  3QO9 A;  4K8Z A;  4FXD A;  1JLQ A;  1HQU A;  2DFF A;  3TAQ A;  4G1Q A;  1I39 A;  3CM6 A;  4CJS A;  3VQE A;  1NOY A;  2FBT A;  1Q8I A;  4O44 A;  3RRH A;  4L8R B;  1S1T A;  4KHW A;  4DQR A;  4DTO A;  3RMB A;  3LP1 A;  1QS4 A;  4OGE A;  2HHS A;  1RBV A;  4NCA A;  3HPO A;  1B92 A;  2B5J A;  4CES A;  3TAN A;  1QTM A;  4Z4E A;  3K5N A;  2HVH A;  2HND A;  2YHB A;  4C8O A;  3KD1 E;  1ZYQ A;  2O4G A;  4EZ6 A;  4N47 A;  3OYI A;  1Z25 A;  4OLA A;  1GOB A;  1LWF A;  1D8Y A;  4O0J A;  4FK4 A;  3NGI A;  3AVK A;  1EX4 A;  2A1R A;  2HHX A;  4H4M A;  4ZTJ A;  4QAG A;  1HRH A;  2NUB A;  3DLR A;  5C25 A;  3L2W A;  1WN7 A;  2ITG A;  3V81 A;  1KSP A;  4FK2 A;  2B6A A;  3DI6 A;  4M3Y A;  2VG7 A;  3SV3 A;  4KI4 A;  3L2U A;  3QEV A;  3AA4 A;  3C95 A;  3I0R A;  3V9X A;  1TGO A;  4FM0 A;  4IG3 A;  3AVB A;  4B9L A;  4Z4F A;  3NCI A;  1SKS A;  4OKE A;  3VQD A;  2HHT A;  2A1S A;  2OZM A;  4F3T A;  4FLW A;  1C1B A;  1J54 A;  1I3A A;  4IFY A;  1HYZ A;  1UA0 A;  4RW7 A;  4AHR A;  1C6V A;  2BGG A;  1T7P A;  2GBZ A;  3O3H A;  3AO3 A;  3CM5 A;  3SUO A;  4CHY A;  1U49 A;  4FJ8 A;  3ZT2 A;  3LZI A;  2YHA A;  1KLM A;  3DOK A;  3VQ4 A;  1VSI A;  4NYF A;  3VQ8 A;  3I0S A;  1RTJ A;  1ZBU A;  5T7B A;  4DFJ A;  1U45 A;  3THV A;  1QSL A;  2YNF A;  1BIS A;  4IDK A;  4CFB A;  3HK2 A;  1W9H A;  4FLY A;  2XY5 A;  4OGC A;  1RDB A;  1VRT A;  4M45 A;  3T1A A;  1KFS A;  5FDL A;  3V6D A;  4FJN A;  4DTP A;  1YVU A;  1RTH A;  1NKB A;  4CEE A;  3D45 A;  2B4J A;  3PY8 A;  4CJV A;  2AJQ A;  4LSN A;  4CJ3 A;  4FLU A;  3WNH A;  1NK5 A;  1B9F A;  2ZD1 A;  4HHT A;  1NKC A;  1JL2 A;  4KV8 A;  3O3F A;  2QKK A;  1F21 A;  3ASM A;  1HYS A;  1X1P A;  2OYQ A;  4JS4 A;  3AVA A;  4AHS A;  4FW1 A;  3K59 A;  3V9Z A;  2LSN A;  5KRT A;  4ZTF A;  1XI1 A;  1FKP A;  3NBP A;  4DTN A;  1VSK A;  3QEX A;  3L2R A;  1BI4 B;  5JS1 A;  4B8A B;  4E3S A;  3QEW A;  4KI6 A;  3TAG A;  2DTU A;  3OYK A;  3ZCM A;  4CIG A;  3VA3 A;  3MEE A;  1ITG A;  3DRS A;  4AHU A;  3NH2 A;  1JL1 A;  3K58 A;  2P1J A;  3RTV A;  4E7J A;  4HCC A;  4FJK A;  2HW3 A;  4E7I A;  3NE6 A;  4HUE A;  2JLE A;  3LZJ A;  1D9D A;  3MXM A;  1X9W A;  4CEO A;  3OYF A;  3L8B A;  3AA2 A;  3OY9 A;  4BE0 A;  5KTQ A;  4CJ4 A;  2FBY A;  3AVM A;  1TKZ A;  2XHB A;  1RBR A;  1L3S A;  3CFO A;  2RPI A;  3P1G A;  3SV4 A;  3DRR A;  3OVN A;  3AA5 X;  2Y1J A;  1WSE A;  3PO5 A;  3VQ6 A;  3ZSO A;  4ZHR A;  4DU4 A;  4CJK A;  1L3U A;  5HRO A;  4B9N A;  1JLF A;  2ATQ A;  4CFD A;  4CEZ A;  4FJL A;  1XHX A;  4BE1 A;  1IKX A;  3NGZ A;  2KZM A;  3AVC A;  5FRO A;  1UWB A;  3K57 A;  3AO4 A;  4F4K A;  1LWE A;  2X6S A;  4CEQ A;  3OYG A;  3ZSR A;  3EYZ A;  1G15 A;  2F96 A;  1U04 A;  1ZBL A;  4CK1 A;  3HVR A;  3KK1 A;  1SV5 A;  3HXM A;  3CQ8 A;  4ID1 A;  2DFH A;  1TK0 A;  1FKO A;  4B8C A;  4DTM A;  3TAE A;  3BDP A;  3ZSV A;  4J2A A;  4FJM A;  4E19 A;  3TAB A;  3V9W A;  3F9K A;  3HT3 A;  3RMD A;  2D5R A;  1NOZ A;  4O5B A;  1VSF A;  4NCG A;  4ELU A;  3IAY A;  4EP4 A;  3LAM A;  3OYC A;  3WNE A;  4TSX A;  3L2V A;  1BHL A;  1VK0 A; 
#chains in the Genus database with same CATH topology
 3SNN A;  4B1X B;  1QVF M;  4QCL A;  3ZT1 A;  2P9L A;  1TVR A;  3EE9 A;  3PV8 A;  4EZ9 A;  4DR6 K;  4FJ7 A;  3HVT A;  1RCH A;  4CEC A;  1N6Q A;  2XY6 A;  4CIE A;  1YJ9 N;  1JXE A;  1TL1 A;  3HL8 A;  3R1X A;  3NF9 A;  2VG5 A;  4KHU A;  4GMJ B;  1YTA A;  3HM8 A;  4WQ4 A;  3SQ1 A;  1WLJ A;  4DS5 A;  4CIF A;  4BQZ A;  3PSI A;  3KK7 A;  3QFP A;  4JI6 K;  1L3T A;  4LF7 K;  3C94 A;  5AQG A;  2E4L A;  3QBX A;  4QS7 A;  4RCH A;  5AQH A;  4M41 A;  1NK0 A;  5A2Q O;  1H1V A;  3CME N;  1C0T A;  1HKB A;  4KHN A;  3G0Z A;  3HSC A;  1A5X A;  2Z1J A;  1KD1 O;  3T7Z A;  4FWO A;  5SZT A;  3M8R A;  1VQ4 N;  4DV1 K;  4H0Y B;  4JI7 K;  1BA0 A;  2W6L A;  3OS1 A;  3FZL A;  3MED A;  4B1W B;  4CZG A;  1NLV A;  4Q5V A;  4B3M K;  1NK9 A;  4YDU A;  2YI1 A;  5J2Q A;  4AM7 A;  4GV6 A;  1BDG A;  2E8A A;  5JVH L;  4OPK A;  3MDQ A;  4BR7 A;  2P9U B;  2E5L K;  3F73 A;  1KVA A;  4KO0 A;  4BRN A;  4FWN A;  4GKJ K;  1RDW X;  3DLH A;  2D0B A;  1RNH A;  1UOC A;  5CR4 A;  1GOC A;  4JRP A;  4GNI A;  3TWH A;  4YOY A;  3SPY A;  2Z1G A;  4KTW A;  3SBT A;  1RT4 A;  1IKY A;  4PL8 A;  3P39 A;  3EY1 A;  5JLH A;  2HHQ A;  3M6G A;  3LAL A;  4FWK A;  4GVM A;  3WNF A;  4FJI A;  3HYF A;  1JLB A;  4CJL A;  3VEX A;  3VTI A;  2Y1I A;  1J53 A;  2E2Q A;  5KPR A;  3PLA A;  1LW2 A;  4YOX A;  4L3Q A;  4BR5 A;  1BQN A;  3FE1 A;  2YKN A;  1WAF A;  5AFU H;  3AVH A;  3BZC A;  4CZE A;  3H45 C;  4M3U A;  3NMU A;  4PWD A;  3TI0 A;  3U4L A;  2QXF A;  3L2Q A;  4H4O A;  4CJQ A;  3OA9 A;  3CER A;  4DFK A;  3FZK A;  4JI5 K;  4H5N A;  1C0F A;  3WEE A;  4FYD A;  4A2B A;  3DXK B;  2OPS A;  1J5O A;  1RTI A;  4YY3 K;  1RDD A;  3J7Y P;  1RBS A;  3ENO A;  4W5R A;  4PY5 A;  4AHC A;  2QWP A;  1JLG A;  4CD1 A;  3VQ5 A;  2WON A;  3AY9 A;  1W0H A;  4A62 A;  1HMV A;  3SUN A;  2RN2 A;  4LF6 K;  5HRR A;  4JKD A;  5J2M A;  3CPW M;  3H3O B;  2HNY A;  3BF3 A;  5D3G A;  5CYQ A;  4C1N I;  1NGH A;  4CZJ A;  3M5R A;  3PIO L;  2Q3S A;  4FVU A;  3MXI A;  4FM1 A;  4I9Q A;  4C8N A;  3OYB A;  4ELV A;  4MDB A;  3QNN A;  1JLA A;  4RW8 A;  3CCR N;  4DWI A;  4CJW A;  4JD2 A;  3NF8 A;  2NRH A;  5FRM A;  3SI6 A;  3MK6 A;  4KHQ A;  3VQ7 A;  1X9M A;  4FJX A;  1Z05 A;  2QW9 A;  3TAR A;  5HLF A;  4OX9 K;  2KKZ A;  4MO5 A;  4FJ9 A;  1TKT A;  5DMR A;  3HBT A;  4CZH A;  2VWB A;  3I8B A;  5GIP A;  3QNO A;  3OW2 M;  4FZY A;  3LAK A;  3DMJ A;  4FJ5 A;  3R3L A;  2OAN A;  4NCB A;  4JK8 A;  3U8X A;  4F3O A;  4DSK A;  1OKJ A;  3IMX A;  4B9Q A;  4CF1 A;  2NZT A;  3VTH A;  4H0T B;  1OH8 A;  3SQ2 A;  4EAH D;  1BG3 A;  3VQ9 A;  3O08 A;  3NH1 A;  3MCA B;  4CJT A;  4CEB A;  1RDC A;  3ZSX A;  4IOA L;  4HUF A;  2Z1H A;  3MEG A;  3HRG A;  4V19 S;  2D1K A;  2VWK A;  4BWJ A;  3LPT A;  4C8M A;  3QET A;  1YXQ A;  1SZ2 A;  4CHP A;  1NK4 A;  4BC5 A;  4M63 C;  2YNG A;  4JK9 A;  4CGF A;  4DQI A;  3DLK A;  4J2E A;  1S3X A;  1T6D A;  4E1N A;  3AO5 A;  4ICL A;  3V1O A;  4DTJ A;  4DV7 K;  2IOC A;  3ZSW A;  1WBB A;  5EU7 A;  4K8X A;  1NKE A;  4N41 A;  1TUU A;  4LY7 A;  4CCH A;  3UB5 A;  3CI5 A;  3DXM A;  4WFA L;  1ESV A;  4EIA A;  1S1X A;  2F8S A;  2F9W A;  3HPG A;  1JKH A;  3KLG A;  2OTL N;  5E26 A;  4N5S A;  2KZZ A;  2ETJ A;  5CZ1 A;  3MWT A;  1ZBH A;  3L6Q A;  1U2V B;  1D9F A;  1HNV A;  4CZF A;  5AQK A;  3VEY A;  3SQ0 A;  1KC8 O;  1K8K B;  3MEC A;  3Q7C A;  4OPJ A;  4H8K A;  3EE8 A;  4IG0 A;  3PO4 A;  4B9T A;  2W42 A;  5C0Y A;  1MU2 A;  3VN5 A;  1GLA G;  1VSH A;  2OA8 A;  5HRN A;  3T19 A;  5HP1 A;  4IKF A;  3S3O A;  4GVE A;  2YNH A;  2BAN A;  3RR7 A;  2JWL A;  3RWU A;  2H3G X;  2WUS A;  4O4G A;  3NF6 A;  1WSH A;  4FWL A;  5CY4 A;  4NLC A;  2D0P A;  2UXD K;  1MA9 B;  3SMP A;  3FFK B;  4KAZ A;  1JLQ A;  3ATV A;  5AQX A;  2GEM A;  2Q1N A;  3AGR A;  3RRH A;  4L8R B;  2FF3 B;  2HBK A;  3RMB A;  5AQF A;  4NCA A;  3NVK A;  3FZF A;  3CJB A;  4BRK A;  1GLD G;  3KHY A;  4Z4E A;  4K42 A;  2HND A;  2YHB A;  2ASP A;  5JIC A;  3KD1 E;  3MMV A;  3ID6 A;  4IZ9 A;  1D8Y A;  4FK4 A;  1XC3 A;  5AQR A;  3LDL A;  4ZTJ A;  3L2W A;  3VF4 A;  1ZBS A;  3V81 A;  1KSP A;  4FK2 A;  4QS8 A;  3DI6 A;  3F2K A;  4DUZ K;  3L2U A;  5AQQ A;  3AA4 A;  3C95 A;  3V9X A;  3AVB A;  4B9L A;  3LL3 A;  4OKE A;  3CCU N;  4CZM A;  4FLW A;  3EEQ A;  1J54 A;  2Q0R A;  4IFY A;  1HYZ A;  5M1O A;  5FPN A;  2GBZ A;  3CM5 A;  1U49 A;  3H46 O;  1KLM A;  4QS9 A;  3VGK A;  3VQ4 A;  1VSI A;  3VQ8 A;  3CJ9 A;  5M1Q A;  4WF9 L;  4DFJ A;  2GUP A;  3WT0 A;  2YNF A;  1N36 K;  3HK2 A;  2QM1 A;  1W9H A;  3FR0 A;  3TTC A;  4OGC A;  3T1A A;  4LF9 K;  1ATR A;  3QIC A;  1RTH A;  1NKB A;  3PY8 A;  4CJV A;  4FLU A;  2V7Z A;  3O80 A;  2E2O A;  3ATU A;  3WQT A;  3O3F A;  2IVN A;  1X1P A;  3AVA A;  4AHS A;  4A59 A;  4WQ5 A;  1DKG D;  1FKP A;  5JS1 A;  1VSK A;  1BI4 B;  4E3S A;  3N4Q A;  3WUH A;  4LF5 K;  4CIG A;  2P9U A;  4BRM A;  4CZK A;  3VA3 A;  3DRS A;  2YJE A;  2BTF A;  4ILG B;  1MDU B;  4E7I A;  3J7Z O;  1YIJ N;  3CHW A;  5KTQ A;  2FBY A;  3P4I A;  2XHB A;  3CFO A;  1X3N A;  3P1G A;  5E84 A;  3OVN A;  4JI2 K;  1L3U A;  2HHH K;  2ATQ A;  4FL9 A;  1NNE A;  4FJL A;  4BE1 A;  3NGZ A;  2KZM A;  1X9J A;  2CH5 A;  1LWE A;  2X6S A;  4CBU A;  3ZSR A;  3EYZ A;  2F96 A;  1OVY A;  1ZBL A;  3O9S A;  1SV5 A;  2WFB A;  4IXC A;  3HXM A;  3CQ8 A;  3MX5 A;  1FKO A;  4IO8 A;  4Y0W A;  4B1Z A;  4B8C A;  3TAE A;  3ZSV A;  4H0P A;  2E1Z A;  2UUC K;  5HOO A;  3D7E O;  1Q18 A;  4NCG A;  2UXB K;  3IAY A;  3OYC A;  4JS5 A;  3IG1 A;  5F0X A;  1Q82 O;  5LMU K;  1XC9 A;  4BVP A;  1U47 A;  3VEZ A;  1BCM A;  1DTT A;  1XMQ K;  3DXK A;  4DHY A;  1NGC A;  2Z1I A;  3U3Y A;  2GV9 A;  5TKY A;  3SJJ A;  3PUF A;  1WOQ A;  1P8Z A;  4BG8 A;  4CW7 B;  3GE1 A;  1N33 K;  3ZT0 A;  1YTU A;  4EHT A;  1QZ5 A;  4M3Z A;  5BRF A;  1KAX A;  2P9N B;  3O9R A;  4DTR A;  2IC3 A;  3CC4 N;  3SJH A;  1KXP A;  4BE2 A;  1QQM A;  3U3G A;  1ASV A;  3SQ4 A;  4BRO A;  2UXC K;  4H0V B;  1BGX T;  3BY5 A;  4NB4 A;  4E1J A;  1YUW A;  4BRH A;  1WNS A;  3GG4 A;  5KQ8 A;  2FBV A;  4OVL A;  1NK6 A;  4F2S A;  2J4R A;  4DR1 K;  1M1K O;  3K5O A;  3FGU A;  2QWN A;  1TAQ A;  2QXL A;  5AZI B;  2D0O A;  4FLX A;  3CJ7 A;  4CJU A;  4WFN L;  4R79 A;  3PX6 A;  4LH5 A;  1S6P A;  3JAM O;  1TK5 A;  2ZGZ A;  2O8C B;  1YI2 N;  4OJR A;  3H3N O;  3O9Q A;  5EXW A;  1CXQ A;  3V1R A;  4YFU A;  3KLF A;  3ZET B;  4KTQ A;  1RT3 A;  3S3N A;  5SWM A;  4AIL C;  3S3M A;  3UKU B;  4B9V A;  4A57 A;  3THX B;  4U67 L;  1G99 A;  2KFZ A;  1GLC G;  4CHZ A;  2PZS A;  4BDY A;  3U6F A;  4FLZ A;  2FC0 A;  4CGI A;  1MWM A;  3QES A;  3QEP A;  5HRP A;  1CZB A;  1Y64 A;  1KQS M;  2FBX A;  3QLH A;  4CHO A;  2IGI A;  5LJW A;  3CYM A;  3KWG A;  3FFI A;  5AQY A;  3EN9 A;  4DSF A;  3WQU A;  4KPY A;  4CGD A;  3ULE A;  3OYH A;  4C8L A;  1KLN A;  5M1P A;  3T1Y K;  4KHP K;  4CJF A;  1IO2 A;  4CJ5 A;  1BL3 A;  2V51 B;  2QKB A;  3SK3 A;  3ITH A;  2PY5 A;  5HBM A;  2YHW A;  2XO7 A;  2O8B B;  1J9A A;  4E7H A;  3IKM A;  2NNW A;  2FSK A;  3CQX A;  3VQC A;  4I9L A;  1N32 K;  4CK3 A;  3LDS A;  2HHU A;  4PA1 A;  4LF8 K;  1BUP A;  1SUQ A;  4W5O A;  3KTQ A;  4W5N A;  5LMN K;  4BRI A;  4F8R A;  3SZ2 A;  1IG9 A;  1BWF O;  1NGI A;  4BRF A;  4CJP A;  1Q9X A;  4OKJ A;  4KRF A;  1W7A A;  2EX3 A;  5JLF A;  4NYN A;  4I2Q A;  1NBW A;  1K8K A;  4CF9 A;  1QZ6 A;  1HNZ K;  1NJY A;  2I5J A;  3QIN A;  1DT9 A;  4Z94 A;  3QIO A;  3TAM A;  1V4S A;  3LP0 A;  2NRW A;  1WUA A;  4FLV A;  4H03 B;  3ZEU B;  3OYM A;  4J8F A;  4A5A A;  3A5L C;  5J1E A;  3D2E B;  2HHV A;  2A6A A;  4IFV A;  4FOE A;  2P5O A;  4E7K A;  4BG9 A;  2BH1 A;  4DQ8 A;  4BC2 A;  4JAX A;  4DR4 K;  3OS0 A;  4B1U B;  4M3W A;  4X65 K;  2HST A;  1VQM N;  4AH9 A;  1M90 O;  5FPM A;  4BGA A;  2ITM A;  4R5P A;  1IBK K;  4OKK A;  1A5W A;  1X9S A;  3OTO K;  5AZJ B;  4B3R K;  4KFB A;  5C10 A;  1QHT A;  5K14 A;  1LAV A;  3VGL A;  4DV2 K;  2R7Y A;  3OYN A;  1Z6R A;  4HWI A;  2QWR A;  1XQS C;  4B9S A;  3E1Y A;  2BUP A;  1DLO A;  2F7T A;  1WSG A;  3M3Z A;  2XY7 A;  4OLB A;  3CJ1 A;  3ENB A;  3AO2 A;  4BRC A;  4M3R A;  3VGM A;  3VEV A;  4CJ7 A;  4BQL A;  4BAC A;  4CGJ A;  1RFQ A;  2RF2 A;  4CZL A;  3AVI A;  3O8M A;  1BCO A;  1EET A;  3O9T A;  4F3T A;  1KVB A;  1KVC A;  4N56 A;  2CGJ A;  1EWR A;  5C12 A;  1KAY A;  4M3X A;  4DS4 A;  3ZYY X;  5HRS A;  3P31 A;  2QTD A;  1SKW A;  4DG1 A;  3JXU A;  4LFB K;  5M1N A;  1VAZ A;  4CGG A;  1TUY A;  5DK5 A;  2O8F B;  5E41 A;  1LOT B;  2F9T A;  1JLC A;  3THW B;  2UU9 K;  2E6M A;  3KD5 E;  4CEA A;  2YHX A;  2KHO A;  4HTU A;  1BIU A;  2ZGY A;  4IDH A;  1B9D A;  1BI4 A;  4DMN A;  3CQY A;  1VQ9 N;  1K73 O;  1VQ6 N;  1NJX A;  3LDO A;  1S22 A;  3S41 A;  2IDO A;  4E89 A;  4ELT A;  2D0A A;  4X66 K;  3CMA N;  1S1U A;  4JYA K;  3ENH A;  1SL1 A;  4F2R A;  3K5L A;  2FXU A;  4IBN A;  1DTQ A;  4FO0 A;  5JS2 A;  2ASO A;  3A5N C;  4FVM A;  2GWJ A;  1GLB G;  3AAQ A;  1YT3 A;  3MN9 A;  4GY2 B;  4FWR A;  5H1S Q;  3HJF A;  2D0C A;  5EOY A;  4B3O A;  4JHD B;  3ALY A;  3QML A;  3DLL L;  1K8A O;  3SAH A;  1VSL A;  4JN4 A;  4A2A A;  5C42 A;  2EHG A;  2DFF A;  3TAQ A;  4G1Q A;  3CM6 A;  1NOY A;  1K9M O;  3HTV A;  1XUP O;  3BF1 A;  1S1T A;  3MN6 A;  4DTO A;  4OGE A;  2HHS A;  3HPO A;  2B5J A;  3CC7 N;  1QTM A;  5AQJ A;  4YHH K;  3K5N A;  5BRH A;  2HVH A;  3CXC M;  1ZYQ A;  1NU0 A;  4N47 A;  3OYI A;  1JJ2 M;  4O0J A;  1EX4 A;  2HBL A;  2A1R A;  4H4M A;  2GWK A;  2QWL A;  4X64 K;  2ITG A;  2B6A A;  5KPT A;  4FM0 A;  3THY B;  4RWT A;  3NCI A;  2P9N A;  3H6E A;  2BGG A;  1VQO N;  4LC9 B;  4B1V A;  3O3H A;  4FJ8 A;  3CCJ N;  3A8Y A;  2YJF A;  2YHA A;  3I0S A;  1RTJ A;  4B3S K;  4IDK A;  3ID8 A;  3G71 N;  4H5T A;  1VRT A;  4FJN A;  4DTP A;  1IBM K;  4H0X B;  4IOC L;  2B4J A;  4CJ3 A;  1NK5 A;  3WXL A;  4YOU A;  1JL2 A;  1F21 A;  3ASM A;  4FOI A;  5EVZ A;  4FW1 A;  2ASM A;  2LSN A;  5AZI A;  3NBP A;  4DTN A;  2FLO A;  4MDA A;  3L2R A;  2DTU A;  3TAG A;  4FWQ A;  4AHU A;  2HW3 A;  5BRD A;  3EKS A;  4HUE A;  2JLE A;  2O8C A;  4CEO A;  5HL7 L;  3L8B A;  3AA2 A;  3OY9 A;  3AVM A;  2W41 A;  3ZET A;  1L3S A;  3SV4 A;  2Q31 A;  3DJC A;  3DRR A;  3D2F B;  3AA5 X;  3PO5 A;  3UKU A;  3THX A;  1QQO A;  4CEZ A;  4JK7 A;  1IKX A;  5FRO A;  3K57 A;  3OYG A;  4CEQ A;  4FWM A;  3QDK A;  4I6M B;  4JEP A;  2VGN A;  4JKH A;  4RTF D;  2DFH A;  1VQL N;  3QFU A;  3BDP A;  3TAB A;  1CZA N;  3RMD A;  4O5B A;  1NOZ A;  1VSF A;  3NVM A;  3LM9 A;  5BR9 A;  4TSX A;  1U48 A;  1ASW A;  1KFD A;  3KLI A;  5KPZ A;  5J2P A;  1J5E K;  1HQE A;  3LP2 A;  4K43 A;  3TTF A;  2ZJR L;  1L3V A;  1HNW K;  3R8E A;  2P9S B;  3P38 A;  3LAN A;  3SUQ A;  4FK0 A;  4AF1 A;  1A5V A;  4DV6 K;  1EO1 A;  1XWL A;  5KGW A;  1ASU A;  4KH4 A;  1D5A A;  4FPA A;  3DRP A;  2O8B A;  3ZLJ A;  1VQK N;  3OHR A;  2E2N A;  1TYQ B;  3O1B A;  2UUA K;  1RT2 A;  3ZSZ A;  2RKI A;  2BDP A;  4LFA K;  4O5F A;  3DOL A;  4IWV A;  4A5B A;  1JCE A;  3DWL A;  2VCP A;  5JMV A;  3L4Q A;  4LH4 A;  3OS2 A;  4XH5 A;  3OYE A;  3AAP A;  2ZJP L;  4JKC A;  3BGR A;  4CF8 A;  3ULD A;  1L5U A;  2HVI A;  3DLE A;  4N76 A;  3ZEU A;  3LP3 A;  3MAQ A;  3WNG A;  3M8S A;  5KQD A;  3D2E A;  3V9S A;  3DYA A;  5GIN A;  1ZBF A;  4KHY A;  2EWS A;  1BQM A;  4C1N K;  1O13 A;  1R0A A;  3DLB A;  3O4Q A;  2CGK A;  2G8F A;  2VWJ A;  2OPQ A;  5ADX A;  2NLX A;  3GOI A;  2HBJ A;  4BC4 A;  3VA0 A;  4CE9 A;  1OH7 A;  3QER A;  4HUG A;  4FCY A;  4JKB A;  5AZJ A;  3SLC A;  1IH7 A;  5GAG P;  2PYL A;  4PHT X;  2W40 A;  1Z26 A;  3TPQ A;  3PX4 A;  4OPA A;  3OBW A;  2KLA A;  5C24 A;  4ISG A;  1REV A;  2JGU A;  4F9O A;  3J80 O;  3C6T A;  3L0Q A;  1RBT A;  4DR2 K;  1NWK A;  3KWI A;  1C0U A;  4DLG A;  4PKH A;  1XMO K;  1T03 A;  3WXK A;  5BPL A;  3AVJ A;  3B8A X;  4RG8 A;  5IT9 O;  3G10 A;  3KZB A;  4K41 A;  4B9M A;  1WAJ A;  4GKK K;  4CHN A;  2OPP A;  3RSE B;  1GLJ O;  2OCE A;  3HOT A;  3CFR A;  3VET A;  4DU3 A;  4FJH A;  5J2N A;  1GLL O;  3O1W A;  5FPE A;  2O8F A;  3P5J A;  1QSS A;  3NGY A;  2W6K A;  3EZW A;  1RT5 A;  2XY8 A;  3THW A;  3OYJ A;  3G4S N;  1EXQ A;  1VQN N;  4ISE A;  3MN5 A;  4BDP A;  3MXJ A;  3C6H A;  1UA1 A;  3OYL A;  1VQ8 N;  3MN7 A;  4CER A;  4DTU A;  3I55 N;  1QSY A;  4NLB A;  3EZ5 A;  3C65 A;  5AQU A;  3TR8 A;  1HJR A;  3FZM A;  2PAV A;  1JLE A;  4IOX A;  2P9I B;  1QQC A;  3NDK A;  4W5T A;  5GAH P;  3VMF B;  3QB0 A;  4OPH A;  4JLH A;  3SUP A;  2QWM A;  2GUI A;  4JI3 K;  2O4I A;  4BRE A;  3M1F A;  3ZT3 A;  3NHG A;  1Q86 O;  3QEI A;  1JCG A;  3MCP A;  1J6Z A;  5IWA K;  3TAP A;  3B6P A;  2X74 A;  1HPM A;  4JHD A;  4KB1 A;  5AQL A;  1WSI A;  2F8T A;  4M7X A;  3UIQ A;  3A5M C;  3RRG A;  3AVN A;  4JI0 K;  2YKM A;  2IAJ A;  4IO9 L;  2DY4 A;  1CZ9 A;  3VQP A;  1KRP A;  1BOT O;  5I9E B;  1IJJ A;  2P9K B;  3G6E N;  3CCQ N;  1VQ5 N;  4DTX A;  4WQ4 C;  3LPU A;  1XNR K;  4H0O A;  1JXB A;  2OPR A;  3CC2 N;  3V4I A;  1TKX A;  3CCM N;  1ZBI A;  3DM2 A;  4EHU A;  3J81 O;  3B6O A;  1HPZ A;  1LW0 A;  2KQ2 A;  4H5V A;  1ZC6 A;  1NJZ A;  5LL6 Z;  4GW6 A;  1SS6 A;  1W2B M;  4WE1 A;  2G8K A;  5I42 A;  1BIZ A;  4KH6 A;  1VRU A;  3THY A;  3I33 A;  3KK3 A;  4AQY K;  4BRD A;  3CJC A;  2VG6 A;  3LWL A;  3O3G A;  3CG7 A;  1S72 N;  1T6C A;  3AGK A;  3TSQ A;  3HM9 A;  1RGI A;  4E0D A;  1IG8 A;  4E7L A;  4DF4 A;  2X6N A;  4YDU C;  3P83 D;  1R59 O;  1RTD A;  2GTD A;  2ZWH A;  5AQM A;  5AQW A;  2V52 B;  1RBU A;  4GV9 A;  1IV0 A;  2JWK A;  3NAE A;  1YHQ N;  3F9M A;  2VQF K;  2E6L A;  3AA3 A;  5TKW A;  3CCE N;  4WFB L;  3WXJ A;  1XNQ K;  2QWQ A;  2E20 A;  1NGD A;  4CK2 A;  3SAF A;  4KBO A;  4PUO A;  1HYV A;  3ISN C;  5AQI A;  4DU1 A;  1FK9 A;  1FXX A;  3HPH A;  4A61 A;  3OYD A;  4FPB A;  3SAG A;  4DQP A;  2ZQB A;  4JKG B;  3SMS A;  1S9E A;  4Z0U A;  1S1W A;  1E4G T;  1KAZ A;  1K6Y A;  5AQT A;  1WSJ A;  3HOS A;  5I3U A;  4B08 A;  3A0I X;  3PIP L;  1VSJ A;  1CLQ A;  2HBM A;  4AM6 A;  1HR0 K;  4FZZ A;  2I7N A;  3D2F A;  3RVC A;  1SKR A;  1U2V A;  4Z4H A;  3JSM A;  1TL3 A;  4JRQ A;  1TK8 A;  2Q97 A;  4MO4 A;  3DAW A;  5GAD P;  4AHT A;  3WXI A;  1C1A A;  1SL0 A;  4I2P A;  3ZSQ A;  3UKR B;  4ILH A;  3EO3 A;  5CYM A;  4I6M A;  2NRR A;  3ZX2 A;  3K2P A;  1NGG A;  3SYZ A;  3QO9 A;  4FXD A;  2A5X A;  3G25 A;  3TTD A;  4YOV A;  2RE2 A;  3CF5 L;  3Q7B A;  4KHW A;  4DV3 K;  2YHY A;  3LP1 A;  4CVN E;  3L4I A;  4CES A;  3TAN A;  3MX2 A;  4IEE A;  4C8O A;  2P9S A;  1SQK A;  1GOB A;  4JI1 K;  3O5B A;  4BRG A;  5AFU A;  4QAG A;  3O4W A;  1OVQ A;  1HRH A;  2NUB A;  5C25 A;  1WN7 A;  2VG7 A;  4KI4 A;  1TGO A;  1TYQ A;  4IG3 A;  4Z4F A;  3VQD A;  2HHT A;  2P9P B;  1I3A A;  1UA0 A;  4RW7 A;  3U9D A;  3AO3 A;  4XH4 A;  5DM7 L;  4NYF A;  5T7B A;  3T69 A;  3THV A;  3W3D A;  1BIS A;  3MWP A;  5MLC Q;  2RHK A;  2XY5 A;  1NGF A;  1RDB A;  3K0S A;  2A41 A;  2FSN A;  2OTJ N;  3VES A;  4CBW A;  3N4P A;  2I7P A;  4CEE A;  3D45 A;  3BZK A;  2NRT A;  4BR9 A;  2A3Z A;  1VQ7 N;  3HI0 A;  3F5T A;  1NKC A;  4KV8 A;  2QKK A;  1HYS A;  2OYQ A;  4JS4 A;  1ILY A;  2GX9 A;  3V9Z A;  4IJA A;  5KRT A;  2Q36 A;  3CCS N;  3QEX A;  4ZTF A;  4LF4 K;  4B8A B;  3QEW A;  4KI6 A;  3OYK A;  3ZCM A;  3MEE A;  1ITG A;  4X62 K;  3K58 A;  1JL1 A;  4DV4 K;  2WBN A;  4E7J A;  4FJK A;  5AQN A;  3LZJ A;  3MXM A;  4WCE L;  3OYF A;  4BR4 A;  4DR3 K;  1VQP N;  2PBD A;  4DR7 K;  4BE0 A;  1OH6 A;  1TKZ A;  5FPD A;  3VPZ A;  4JKF A;  2A40 A;  3SBG A;  1WSE A;  4ZHR A;  4CJK A;  4BRA A;  1YF5 L;  3LDN A;  5HRO A;  3R6M A;  1YJN N;  1JLF A;  4CFD A;  4B9N A;  5EX5 A;  5CHI A;  1XHX A;  5AQP A;  3IDH A;  3AVC A;  5BR8 K;  4F4K A;  3AO4 A;  1V4T A;  3HVR A;  2ZM6 K;  4ID1 A;  1TK0 A;  3O6W A;  1FW6 A;  3HT3 A;  2D5R A;  4ELU A;  3LAM A;  3L2V A;  1Y97 A;  3AVG A;  2O8E B;  2YV0 X;  1MWK A;  3OJS A;  3CET A;  5EY4 A;  1YAG A;  4HCB A;  4YOW A;  2O8D B;  3RSE A;  2ZE2 A;  4BR2 A;  3HO1 A;  3HP9 A;  5CZ2 A;  3VQQ A;  4U7B A;  4BY9 C;  4ID5 A;  1C1C A;  5F1X A;  3PSF A;  4DUY K;  1WSF A;  3TU5 A;  4W5Q A;  3CFP A;  2FF6 A;  4JI8 K;  3OYA A;  4FM2 A;  3GL1 A;  2E88 A;  3A2F A;  3RR8 A;  3CCL N;  3VQB A;  2CH6 A;  1BA1 A;  1VSD A;  3RMC A;  1QVG M;  3L3V A;  5KI6 A;  1NK8 A;  2IVP A;  4FJG A;  4CHQ A;  3DLG A;  3E9L A;  3KKS A;  4ILJ A;  1UAX A;  4CF2 A;  2IS3 A;  3ZX0 A;  1C0G A;  3KVG A;  4YOT A;  4BWM A;  1BO5 O;  2P9I A;  3H1Q A;  1IKV A;  4J2B A;  1LWC A;  4DLE A;  1C0M A;  3NFA A;  4DB3 A;  2VYP A;  4BGB A;  3SCX A;  2G8W A;  2HOE A;  3C7N B;  4CZI A;  5ELZ A;  2PYJ A;  5BPM A;  3ZT4 A;  4RW9 A;  4B3T K;  3W0L A;  1NMD A;  2XRI A;  2E1Y A;  1NM1 A;  4PKG A;  4Q0B A;  1YVN A;  2YNI A;  2G8H A;  2IVO A;  1VHX A;  4KKO A;  4FZX C;  4IJN A;  4BRL A;  2HHW A;  4UQG A;  1T05 A;  2ZJQ L;  3I56 N;  3T1H K;  1VSE A;  1IKW A;  4MLH A;  2QWO A;  3KK2 A;  3E66 A;  1XHZ A;  2P9K A;  2IIR A;  3IUC A;  2KFN A;  3ULE B;  4CD3 A;  1NK7 A;  3LDQ A;  3FLC O;  4M7Y A;  4Z4C A;  4MLE A;  4XH1 A;  4CED A;  4B1Y B;  1HLU A;  3BUZ B;  1HKG A;  4LD0 A;  1TKD A;  4FLT A;  2P5G A;  5LY3 A;  3KLE A;  2YX6 A;  3EL2 A;  3QBW A;  1E3M A;  4EFH A;  2P9L B;  3OJU A;  1T8E A;  4O0I A;  1RDA A;  4DSE A;  1U4B A;  4BDZ A;  5C15 A;  1EQY A;  3V1Q A;  4PKI A;  2FSJ A;  1EKE A;  5BRE A;  5M1K A;  3PX0 A;  3M8P A;  2UUB K;  1WB9 A;  4AHV A;  5BN9 A;  4CFC A;  4ISF A;  3AVF A;  3O4N A;  4FSV A;  4WYB A;  3I8D A;  4WQ5 C;  2WC9 A;  3H1V X;  4G9Z A;  4DSL A;  4OO1 J;  4CGH A;  4NXM K;  1D4X A;  1RDU A;  2V7Y A;  2BE2 A;  3VEW A;  1Q7Y O;  1OH5 A;  3VER A;  1ZXO A;  4O55 A;  2YCH A;  2PFU A;  3HZ6 A;  4KHS A;  3E9O A;  2QK9 A;  4DV0 K;  4MFB A;  2WTU A;  3K9K A;  3T3F A;  1VSM A;  4K0K K;  3NF7 A;  1NGJ A;  1S5J A;  4JKG A;  1N34 K;  4JKE A;  5AQO A;  1E4F T;  4Y1C A;  4B9U A;  4FJJ A;  3RMA A;  1RT1 A;  5C2F A;  4C8K A;  2G8I A;  5JVG L;  3TAF A;  5LJV A;  1NJI O;  4XIU A;  4E1M A;  1QHA A;  3IS9 A;  1EP4 A;  2ZF5 O;  3U9Z A;  4I7F A;  3VF6 A;  3QIP A;  4O8K A;  4FWP A;  4YNQ A;  3UKR A;  3HP6 A;  4DSI A;  1ATN A;  1LAW A;  2WOM A;  3NH0 A;  1NJW A;  3TSU A;  3ZX3 A;  2E2P A;  3GBT A;  4O8U A;  1S6Q A;  3WXM B;  3VQA A;  3D0P A;  4KB0 A;  1HKC A;  2QI2 A;  2KTQ A;  3AO1 A;  3CIP A;  4Z4I A;  3IFR A;  1LV5 A;  5B8H A;  2DFE A;  1O1W A;  4JI4 K;  1YJW N;  1P90 A;  3KJV A;  4CJR A;  1W97 L;  4BVO A;  4DTS A;  1GLE G;  4RW6 A;  1Q9Y A;  1T44 A;  5KRS A;  1NG9 A;  1TV6 A;  2HNZ A;  3UE5 A;  2OZS A;  4KRE A;  4FW2 A;  3ZSY A;  4NXN K;  4JKA A;  4HVJ A;  1RIL A;  4DKW A;  5CE3 A;  4CJE A;  1TAU A;  3LM2 A;  3L3U A;  4Y1D A;  4CFA A;  1HNX K;  4H5W A;  3R9P A;  2GEL A;  2G8V A;  4M42 A;  2P9P A;  5BPN A;  2DPN A;  3AV9 A;  3K5M A;  3WEE B;  3VF2 A;  4J2D A;  3AVL A;  4FWS A;  5GAE P;  1T3V A;  3EKU A;  3LDP A;  4CF0 A;  4DSJ A;  3KLH A;  1RT7 A;  2X78 A;  3CD6 N;  3J8A A;  4PL7 A;  4DQS A;  1NGA A;  4BRP A;  5AJ3 K;  3D6R A;  1HNI A;  1S1V A;  4CI6 A;  1LCU A;  4EP5 A;  1CXU A;  4H5R A;  3H08 A;  4BC3 A;  3KKR A;  1SL2 A;  2HB5 A;  5FRN A;  4DFP A;  1HUX A;  4KTZ A;  5KGX A;  3LWM A;  4DQQ A;  1GOA A;  3CJA A;  2G8U A;  2KW4 A;  5BN8 A;  3IRX A;  4DF8 A;  3SPZ A;  1N8R O;  4KH5 A;  1NGB A;  4MQ3 A;  1Q81 O;  2CGL A;  4DFM A;  4JD2 B;  4YOR A;  5AR0 A;  4GV3 A;  4Z4G A;  3V9U A;  5ADX H;  3CCV N;  2AP1 A;  5C2D A;  4CEF A;  1S9G A;  3HST B;  1WBD A;  3JYT A;  1EWQ A;  3VEN A;  1N5Y A;  4HTL A;  1KTQ A;  4M3T A;  4IFE A;  1RT6 A;  1X3M A;  4QOZ B;  3BP8 A;  3E01 A;  2HMI A;  2P51 A;  3S9H A;  4RW4 A;  4PQU A;  1U6Z A;  4CBX A;  1NGE A;  4LSL A;  1KCF A;  3C6U A;  1QE1 A;  3CPE A;  3M8Q A;  3KIO A;  4K8Z A;  3VEO A;  1HQU A;  1I39 A;  4CJS A;  3VQE A;  2FBT A;  1Q8I A;  5GIO A;  2QA4 N;  4O44 A;  4DQR A;  1QS4 A;  2F4V K;  1RBV A;  4LFC K;  1NMN A;  1B92 A;  2NRZ A;  2O8E A;  4JV5 K;  1HJO A;  1BU6 O;  2O4G A;  4DCH A;  4EZ6 A;  2O8D A;  1Z25 A;  4OLA A;  1LWF A;  1JCF A;  2Q0U A;  3NGI A;  3AVK A;  3OBY A;  2HHX A;  1SAZ A;  5AQS A;  3DLR A;  4IEI A;  2NRX A;  4M3Y A;  3SV3 A;  3QEV A;  3I0R A;  4DV5 K;  3O9U A;  1SKS A;  2A1S A;  2OZM A;  1I94 K;  1C1B A;  2QEX N;  3J7A P;  4AHR A;  1C6V A;  1T7P A;  5F2R A;  3SUO A;  3VOV A;  4CHY A;  3ZT2 A;  3LZI A;  2HF4 A;  3DOK A;  3TSP A;  2VGM A;  1ZBU A;  1QSL A;  1U45 A;  5AQV A;  3C6A A;  4CFB A;  4FLY A;  3DXM B;  4XEI A;  4M45 A;  1KFS A;  1QQN A;  3GDQ A;  5FDL A;  3V6D A;  4NO7 A;  1YVU A;  4C23 A;  2HMP A;  4LSN A;  2AJQ A;  3WNH A;  3C0B A;  1B9F A;  2ZD1 A;  1DEJ A;  4HHT A;  2AA4 A;  3AAR A;  3C7N A;  3K59 A;  1XI1 A;  2A42 A;  1DGK N;  3FZH A;  4UY8 O;  3NH2 A;  4HCC A;  3RTV A;  2P1J A;  3NE6 A;  3A5O C;  3JS6 A;  1D9D A;  1X9W A;  1HX1 A;  4CJ4 A;  2HF3 A;  5AQZ A;  1RBR A;  1YIT N;  2RPI A;  4DR5 K;  2Y1J A;  4JNE A;  3VQ6 A;  3ZSO A;  2VQE K;  4DU4 A;  4BR0 A;  4BRQ A;  5M1F A;  1GLF O;  5DM6 L;  3K9J A;  1UWB A;  2D4W A;  1G15 A;  1U04 A;  5FLX O;  4CK1 A;  3KK1 A;  2Q2R A;  3BEX A;  4K25 A;  4DTM A;  4J2A A;  4FJM A;  4E19 A;  1ATS A;  3F9K A;  3V9W A;  1IBL K;  1FJG K;  2UYT A;  2NRV A;  3E9P A;  4EP4 A;  3WNE A;  1BHL A;  1VK0 A; 
#chains in the Genus database with same CATH homology
 1ASW A;  1KFD A;  3SNN A;  1Y97 A;  3KLI A;  4QCL A;  3ZT1 A;  3AVG A;  1TVR A;  5J2P A;  2YV0 X;  3PV8 A;  4EZ9 A;  3OJS A;  1XC9 A;  1HQE A;  3LP2 A;  3HVT A;  1U47 A;  1RCH A;  4FJ7 A;  4HCB A;  4CEC A;  1BCM A;  1N6Q A;  1L3V A;  2XY6 A;  4CIE A;  1JXE A;  1TL1 A;  2ZE2 A;  3HL8 A;  3HO1 A;  3HP9 A;  1DTT A;  3LAN A;  3NF9 A;  5CZ2 A;  2VG5 A;  3VQQ A;  4ID5 A;  3SUQ A;  1A5V A;  1C1C A;  1YTA A;  4GMJ B;  1XWL A;  4KHU A;  5KGW A;  1ASU A;  1WSF A;  2Z1I A;  3U3Y A;  3SQ1 A;  2GV9 A;  3SJJ A;  1D5A A;  1WLJ A;  4DS5 A;  3PUF A;  3DRP A;  4CIF A;  4W5Q A;  3CFP A;  3ZT0 A;  1YTU A;  3OYA A;  1RT2 A;  4FM2 A;  4M3Z A;  1L3T A;  3A2F A;  3ZSZ A;  2RKI A;  2BDP A;  3RR8 A;  3C94 A;  3VQB A;  4DTR A;  2E4L A;  2IC3 A;  1VSD A;  3DOL A;  4BE2 A;  3U3G A;  1ASV A;  4M41 A;  3RMC A;  3L3V A;  1NK0 A;  3SQ4 A;  5KI6 A;  1NK8 A;  1C0T A;  1BGX T;  4FJG A;  4CHQ A;  4LH4 A;  4KHN A;  3G0Z A;  3DLG A;  1A5X A;  2Z1J A;  3KKS A;  1UAX A;  4CF2 A;  2IS3 A;  1SKR A;  3OS2 A;  3OYE A;  1WNS A;  5SZT A;  3M8R A;  2FBV A;  4OVL A;  1NK6 A;  4F2S A;  3BGR A;  4CF8 A;  4BWM A;  3ULD A;  1L5U A;  3OS1 A;  2HVI A;  3MED A;  3DLE A;  4Q5V A;  1NK9 A;  1IKV A;  4J2B A;  1LWC A;  4N76 A;  4DLE A;  5FRN A;  1C0M A;  3K5O A;  3NFA A;  3LP3 A;  3MAQ A;  5J2Q A;  3WNG A;  3SCX A;  3M8S A;  1TAQ A;  2G8W A;  3V9S A;  3DYA A;  1ZBF A;  2PYJ A;  4KHY A;  4FLX A;  3ZT4 A;  4RW9 A;  4OPK A;  1BQM A;  4CJU A;  2XRI A;  3F73 A;  3PX6 A;  1R0A A;  3DLB A;  4LH5 A;  1S6P A;  3O4Q A;  4Q0B A;  1KVA A;  4KO0 A;  1TK5 A;  2YNI A;  2G8H A;  2G8F A;  4KKO A;  4OJR A;  4FZX C;  3V1R A;  2VWJ A;  3DLH A;  1CXQ A;  2D0B A;  4YFU A;  3KLF A;  2HHW A;  2OPQ A;  4UQG A;  1RNH A;  1UOC A;  1T05 A;  1GOC A;  4KTQ A;  4JRP A;  3TWH A;  3VA0 A;  4CE9 A;  1VSE A;  3SPY A;  3QER A;  1IKW A;  1RT3 A;  3S3N A;  2Z1G A;  5SWM A;  4AIL C;  4KTW A;  4HUG A;  4FCY A;  3KK2 A;  3S3M A;  1RT4 A;  1IKY A;  4B9V A;  3EY1 A;  2HHQ A;  2KFZ A;  1IH7 A;  3LAL A;  4GVM A;  4CHZ A;  1XHZ A;  2PYL A;  2PZS A;  2KFN A;  4BDY A;  1Z26 A;  3WNF A;  3PX4 A;  4FJI A;  3U6F A;  3HYF A;  1NK7 A;  1JLB A;  4CJL A;  4FLZ A;  5C24 A;  2FC0 A;  4CGI A;  2Y1I A;  1REV A;  3QES A;  4Z4C A;  3QEP A;  5HRP A;  1CZB A;  1J53 A;  2JGU A;  2FBX A;  3QLH A;  4CHO A;  3C6T A;  2IGI A;  4CED A;  1RBT A;  1LW2 A;  3CYM A;  3FFI A;  1BQN A;  4LD0 A;  1TKD A;  2YKN A;  4FLT A;  1C0U A;  1WAF A;  4DLG A;  2P5G A;  3AVH A;  3KLE A;  1T03 A;  4DSF A;  4M3U A;  4PWD A;  3TI0 A;  2QXF A;  3AVJ A;  3OJU A;  3L2Q A;  4H4O A;  4RG8 A;  4CJQ A;  4KPY A;  3G10 A;  4CGD A;  1T8E A;  3OYH A;  4B9M A;  1WAJ A;  4O0I A;  1RDA A;  4DFK A;  4CHN A;  4DSE A;  1U4B A;  4C8L A;  1KLN A;  2OPP A;  4BDZ A;  3V1Q A;  1IO2 A;  4CJF A;  4CJ5 A;  1BL3 A;  2QKB A;  4FYD A;  1EKE A;  3CFR A;  2OPS A;  3ITH A;  3PX0 A;  1J5O A;  3M8P A;  1RTI A;  5HBM A;  2PY5 A;  4AHV A;  4DU3 A;  4FJH A;  4CFC A;  1RDD A;  3AVF A;  3O4N A;  2XO7 A;  1RBS A;  1J9A A;  4E7H A;  3I8D A;  4W5R A;  4PY5 A;  4AHC A;  5J2N A;  1JLG A;  3VQ5 A;  2WON A;  3VQC A;  4I9L A;  4CK3 A;  1W0H A;  3P5J A;  1QSS A;  4DSL A;  3NGY A;  3LDS A;  2HHU A;  4CGH A;  1RT5 A;  2XY8 A;  4PA1 A;  1HMV A;  3SUN A;  3OYJ A;  2BE2 A;  1SUQ A;  1EXQ A;  2RN2 A;  4W5O A;  3KTQ A;  4W5N A;  4F8R A;  3SZ2 A;  1IG9 A;  4BDP A;  3MXJ A;  4O55 A;  5HRR A;  4CJP A;  1Q9X A;  4OKJ A;  5J2M A;  3OYL A;  1UA1 A;  4KRF A;  4KHS A;  2HNY A;  4CER A;  4DTU A;  2QK9 A;  4MFB A;  1QSY A;  2EX3 A;  5D3G A;  3EZ5 A;  4NYN A;  4I2Q A;  1VSM A;  5CYQ A;  3T3F A;  3TR8 A;  4CF9 A;  1NJY A;  2I5J A;  1HJR A;  3NF7 A;  3QIN A;  2Q3S A;  3MXI A;  1S5J A;  1JLE A;  4FM1 A;  4I9Q A;  4C8N A;  3OYB A;  3QIO A;  4Y1C A;  3TAM A;  4ELV A;  4B9U A;  4FJJ A;  3RMA A;  1QQC A;  1RT1 A;  3LP0 A;  3NDK A;  3QNN A;  4C8K A;  2G8I A;  1JLA A;  4FLV A;  4RW8 A;  4W5T A;  4DWI A;  3OYM A;  3TAF A;  4CJW A;  5J1E A;  2HHV A;  3IG1 A;  4JLH A;  4XIU A;  4E1M A;  3SUP A;  2GUI A;  3NF8 A;  2O4I A;  3IS9 A;  1EP4 A;  4IFV A;  5FRM A;  3SI6 A;  2P5O A;  3VQ7 A;  4KHQ A;  4I7F A;  3QIP A;  1X9M A;  4FJX A;  5HLF A;  3TAR A;  4E7K A;  3ZT3 A;  3NHG A;  3QEI A;  3RWU A;  4FJ9 A;  4YNQ A;  1TKT A;  5DMR A;  3OS0 A;  3TAP A;  3B6P A;  4M3W A;  2X74 A;  3HP6 A;  4DSI A;  3QNO A;  4KB1 A;  1LAW A;  2WOM A;  3NH0 A;  1NJW A;  1WSI A;  2F8T A;  4AH9 A;  4FZY A;  3LAK A;  1S6Q A;  3UIQ A;  3DMJ A;  4FJ5 A;  3RRG A;  3VQA A;  3AVN A;  3D0P A;  4R5P A;  4KB0 A;  2YKM A;  4OKK A;  2IAJ A;  4NCB A;  1A5W A;  2DY4 A;  1CZ9 A;  3VQP A;  1X9S A;  4F3O A;  4DSK A;  1KRP A;  2KTQ A;  3AO1 A;  4CF1 A;  4KFB A;  1QHT A;  5K14 A;  1LAV A;  4Z4I A;  4DTX A;  3SQ2 A;  3LPU A;  2R7Y A;  1JXB A;  2OPR A;  3OYN A;  1LV5 A;  3VQ9 A;  2DFE A;  1O1W A;  3NH1 A;  4CJR A;  3KJV A;  1TKX A;  4DTS A;  4CJT A;  4RW6 A;  4CEB A;  1RDC A;  1DLO A;  3ZSX A;  3DM2 A;  1Q9Y A;  5KRS A;  1ZBI A;  3B6O A;  1HPZ A;  1LW0 A;  2KQ2 A;  1TV6 A;  1WSG A;  2HNZ A;  4HUF A;  2XY7 A;  2OZS A;  4OLB A;  2Z1H A;  3MEG A;  1NJZ A;  3AO2 A;  4KRE A;  4GW6 A;  2VWK A;  4FW2 A;  4BWJ A;  3LPT A;  4C8M A;  4M3R A;  3ZSY A;  3QET A;  4WE1 A;  2G8K A;  4BAC A;  4HVJ A;  1RIL A;  5I42 A;  1BIZ A;  4CHP A;  1VRU A;  4CGJ A;  1NK4 A;  2RF2 A;  4CJE A;  1TAU A;  3KK3 A;  2YNG A;  3L3U A;  4Y1D A;  3AVI A;  4CFA A;  4CGF A;  4DQI A;  2G8V A;  3DLK A;  4J2E A;  4M42 A;  1BCO A;  1EET A;  4E1N A;  2VG6 A;  3AO5 A;  1KVB A;  3AV9 A;  3O3G A;  3CG7 A;  4ICL A;  3LWL A;  1KVC A;  3V1O A;  4N56 A;  3K5M A;  4DTJ A;  4J2D A;  3V4I A;  3AVL A;  2IOC A;  3ZSW A;  3HM9 A;  4E0D A;  5EU7 A;  4K8X A;  1NKE A;  4CF0 A;  4N41 A;  4DSJ A;  3KLH A;  4E7L A;  4M3X A;  4DS4 A;  2X6N A;  4DF4 A;  3P83 D;  1RT7 A;  4LY7 A;  5HRS A;  4CCH A;  1RTD A;  2X78 A;  1SKW A;  4DG1 A;  4DQS A;  4CGG A;  1RBU A;  1S1X A;  5DK5 A;  2F8S A;  5E41 A;  3HPG A;  1JKH A;  3NAE A;  1JLC A;  1HNI A;  1S1V A;  2E6M A;  3KD5 E;  2E6L A;  3AA3 A;  4CEA A;  4EP5 A;  3KLG A;  1CXU A;  4HTU A;  4N5S A;  2KZZ A;  4FK0 A;  2ETJ A;  3H08 A;  5CZ1 A;  1BIU A;  4CK2 A;  3KKR A;  1SL2 A;  1ZBH A;  2HB5 A;  1D9F A;  1HNV A;  1HYV A;  1B9D A;  1BI4 A;  3ISN C;  4DFP A;  3SQ0 A;  4PUO A;  4KTZ A;  5KGX A;  3LWM A;  1FK9 A;  4DQQ A;  4DU1 A;  1FXX A;  3HPH A;  3MEC A;  1GOA A;  4DMN A;  3OYD A;  4JS5 A;  2G8U A;  2ZQB A;  4OPJ A;  4H8K A;  2KW4 A;  1NJX A;  4DQP A;  1S9E A;  4Z0U A;  1S1W A;  3PO4 A;  3IRX A;  4IG0 A;  4B9T A;  1K6Y A;  2IDO A;  4E89 A;  2D0A A;  4DF8 A;  3SPZ A;  2W42 A;  4ELT A;  1MU2 A;  1WSJ A;  4MQ3 A;  3VN5 A;  1S1U A;  1VSH A;  2OA8 A;  5HRN A;  4B9S A;  3T19 A;  4DFM A;  5HP1 A;  4B08 A;  5I3U A;  4IKF A;  4Z4G A;  1VSJ A;  3V9U A;  1SL1 A;  4F2R A;  1CLQ A;  3K5L A;  4IBN A;  3S3O A;  4FZZ A;  4CEF A;  1DTQ A;  2YNH A;  1S9G A;  2BAN A;  5JS2 A;  3HST B;  4FVM A;  1TL3 A;  4Z4H A;  3JSM A;  3JYT A;  4JRQ A;  1TK8 A;  1N5Y A;  1U48 A;  3RR7 A;  1KTQ A;  4M3T A;  4QOZ B;  1RT6 A;  4O4G A;  1YT3 A;  3E01 A;  4AHT A;  3NF6 A;  1C1A A;  1SL0 A;  2HMI A;  1WSH A;  4I2P A;  3ZSQ A;  5CY4 A;  3HJF A;  2D0C A;  2P51 A;  3S9H A;  4B3O A;  5CYM A;  4RW4 A;  4PQU A;  3ALY A;  1VSL A;  4LSL A;  1KCF A;  3C6U A;  1QE1 A;  3K2P A;  3M8Q A;  5C42 A;  3SYZ A;  4KAZ A;  2EHG A;  3KIO A;  3QO9 A;  4K8Z A;  4FXD A;  1JLQ A;  1HQU A;  2DFF A;  3TAQ A;  4G1Q A;  1I39 A;  3CM6 A;  4CJS A;  3VQE A;  1NOY A;  2FBT A;  1Q8I A;  4O44 A;  3RRH A;  4L8R B;  1S1T A;  4KHW A;  4DQR A;  4DTO A;  3RMB A;  3LP1 A;  1QS4 A;  4OGE A;  2HHS A;  1RBV A;  4NCA A;  3HPO A;  1B92 A;  2B5J A;  4CES A;  3TAN A;  1QTM A;  4Z4E A;  3K5N A;  2HVH A;  2HND A;  2YHB A;  4C8O A;  3KD1 E;  1ZYQ A;  2O4G A;  4EZ6 A;  4N47 A;  3OYI A;  1Z25 A;  4OLA A;  1GOB A;  1LWF A;  1D8Y A;  4O0J A;  4FK4 A;  3NGI A;  3AVK A;  1EX4 A;  2A1R A;  2HHX A;  4H4M A;  4ZTJ A;  4QAG A;  1HRH A;  2NUB A;  3DLR A;  5C25 A;  3L2W A;  1WN7 A;  2ITG A;  3V81 A;  1KSP A;  4FK2 A;  2B6A A;  3DI6 A;  4M3Y A;  2VG7 A;  3SV3 A;  4KI4 A;  3L2U A;  3QEV A;  3AA4 A;  3C95 A;  3I0R A;  3V9X A;  1TGO A;  4FM0 A;  4IG3 A;  3AVB A;  4B9L A;  4Z4F A;  3NCI A;  1SKS A;  4OKE A;  3VQD A;  2HHT A;  2A1S A;  2OZM A;  4F3T A;  4FLW A;  1C1B A;  1J54 A;  1I3A A;  4IFY A;  1HYZ A;  1UA0 A;  4RW7 A;  4AHR A;  1C6V A;  2BGG A;  1T7P A;  2GBZ A;  3O3H A;  3AO3 A;  3CM5 A;  3SUO A;  4CHY A;  1U49 A;  4FJ8 A;  3ZT2 A;  3LZI A;  2YHA A;  1KLM A;  3DOK A;  3VQ4 A;  1VSI A;  4NYF A;  3VQ8 A;  3I0S A;  1RTJ A;  1ZBU A;  5T7B A;  4DFJ A;  1U45 A;  3THV A;  1QSL A;  2YNF A;  1BIS A;  4IDK A;  4CFB A;  3HK2 A;  1W9H A;  4FLY A;  2XY5 A;  4OGC A;  1RDB A;  1VRT A;  4M45 A;  3T1A A;  1KFS A;  5FDL A;  3V6D A;  4FJN A;  4DTP A;  1YVU A;  1RTH A;  1NKB A;  4CEE A;  3D45 A;  2B4J A;  3PY8 A;  4CJV A;  2AJQ A;  4LSN A;  4CJ3 A;  4FLU A;  3WNH A;  1NK5 A;  1B9F A;  2ZD1 A;  4HHT A;  1NKC A;  1JL2 A;  4KV8 A;  3O3F A;  2QKK A;  1F21 A;  3ASM A;  1HYS A;  1X1P A;  2OYQ A;  4JS4 A;  3AVA A;  4AHS A;  4FW1 A;  3K59 A;  3V9Z A;  2LSN A;  5KRT A;  4ZTF A;  1XI1 A;  1FKP A;  3NBP A;  4DTN A;  1VSK A;  3QEX A;  3L2R A;  1BI4 B;  5JS1 A;  4B8A B;  4E3S A;  3QEW A;  4KI6 A;  3TAG A;  2DTU A;  3OYK A;  3ZCM A;  4CIG A;  3VA3 A;  3MEE A;  1ITG A;  3DRS A;  4AHU A;  3NH2 A;  1JL1 A;  3K58 A;  2P1J A;  3RTV A;  4E7J A;  4HCC A;  4FJK A;  2HW3 A;  4E7I A;  3NE6 A;  4HUE A;  2JLE A;  3LZJ A;  1D9D A;  3MXM A;  1X9W A;  4CEO A;  3OYF A;  3L8B A;  3AA2 A;  3OY9 A;  4BE0 A;  5KTQ A;  4CJ4 A;  2FBY A;  3AVM A;  1TKZ A;  2XHB A;  1RBR A;  1L3S A;  3CFO A;  2RPI A;  3P1G A;  3SV4 A;  3DRR A;  3OVN A;  3AA5 X;  2Y1J A;  1WSE A;  3PO5 A;  3VQ6 A;  3ZSO A;  4ZHR A;  4DU4 A;  4CJK A;  1L3U A;  5HRO A;  4B9N A;  1JLF A;  2ATQ A;  4CFD A;  4CEZ A;  4FJL A;  1XHX A;  4BE1 A;  1IKX A;  3NGZ A;  2KZM A;  3AVC A;  5FRO A;  1UWB A;  3K57 A;  3AO4 A;  4F4K A;  1LWE A;  2X6S A;  4CEQ A;  3OYG A;  3ZSR A;  3EYZ A;  1G15 A;  2F96 A;  1U04 A;  1ZBL A;  4CK1 A;  3HVR A;  3KK1 A;  1SV5 A;  3HXM A;  3CQ8 A;  4ID1 A;  2DFH A;  1TK0 A;  1FKO A;  4B8C A;  4DTM A;  3TAE A;  3BDP A;  3ZSV A;  4J2A A;  4FJM A;  4E19 A;  3TAB A;  3V9W A;  3F9K A;  3HT3 A;  3RMD A;  2D5R A;  1NOZ A;  4O5B A;  1VSF A;  4NCG A;  4ELU A;  3IAY A;  4EP4 A;  3LAM A;  3OYC A;  3WNE A;  4TSX A;  3L2V A;  1BHL A;  1VK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...