1S1TA

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with uc-781
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
541
structure length
533
Chain Sequence
b'SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 150
structure length 533
sequence length 541
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1tA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1tA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1tA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1tA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s1tA05
4AHRA 3VQ4A 4KAIA 5KFDA 3C6TA 4O3PA 1EETB 1WSGA 4WE1B 1ASVA 4IKFA 1LWFB 4F4WA 5F8NA 1TL3A 4TYBA 3NGYA 2UVWA 2BQRA 1SL1A 2HHXA 1UOCA 4OVLA 2C2RA 4QW9A 4MFBB 4N56A 4K4XA 1QE1A 4ECUA 5KFSA 3KD5E 2P5OA 1SKRA 2IJNA 1IKWA 4G3IA 4O4RA 4ZPCA 4DTJA 3BJYA 4DU4A 3QEXA 4KO0A 1D5AA 1JLEA 3V9SA 2Y1IA 3ZT3A 1VSIA 2B4JA 2QV6A 1RDCA 1KRPA 4PQUA 3AVAA 3ALYA 4CHZA 5HLFB 4I2PA 4IR1A 2WHOA 4G1QA 2Z1IA 5T7BA 3DRRA 2P51A 2R7YA 3ZSQA 3CJ2A 1D9FA 4EO6A 4NLTA 3DOLB 3TI0A 4Q0BB 1RDBA 5KFUA 4IFVB 3KLFB 2W9BA 4XPEA 5CZ1A 4M3WA 3CDWA 1RT5A 3KHLA 1B92A 3V6DB 2YKNB 3V1OA 2FVQA 2ILYA 4B08A 4OLAA 1JX4A 3F73A 3DI6B 3TAPA 3BGRB 1EXQA 3SUPA 1VRTB 1VRUB 1VK0A 5KFKA 3G0ZA 2RKIB 4R0EA 2HMIB 4J9NA 3LP1A 3EY1A 1JKHA 4EBDA 2LSNA 2IC3A 3OJSA 4RW8A 2A1RA 3PW0A 4ZPDA 3MAQA 5JXSA 3T3FA 1RT2B 2D0CA 1NHVA 4ZVHA 4FM1A 3MR2A 2Y1JA 2HHVA 1S9GB 3DLGB 1RT6A 3KK3B 4O4GB 2HVHA 1TKDA 1I3AA 3V9UA 1C0MA 4AHTA 1SV5A 2JEIA 4JV1A 3VQ6A 4BWMA 2XI2A 4FLWA 2WOMB 3KHHA 2AWZA 1BIZA 4O3NA 1RNHA 4YFUA 4FXDA 4H4OB 3LP2B 4F4YA 2P5GA 5L1KA 1NOZA 2VG7B 2HHSA 5C24B 4WE1A 4M94A 2VG6B 2PYJA 4O5BA 1LWFA 2XCPA 3OYKA 4CJ3A 3KMQA 1KFSA 3NAIA 4K4VA 1RT3B 3ULDA 4FK4A 4MFBA 4J9MA 5F8HA 4FS1A 2HHQA 4ZP6A 1XR5A 1VSJA 5DGBA 5DG7A 4DTPA 3SQ2A 5KGXA 1RT7B 3V81B 1U49A 4CGIA 3QLHB 3OYEA 4E1NA 1S97A 4JUZA 4YR0A 1TK5A 3IAYA 3H4BA 4FJMA 4Q5VA 4DF4A 3CO9A 3TAFA 5EDWA 3V1QA 4AHSA 3KLIB 4KPYA 1SKSA 5KG1A 3DOLA 1GOBA 4E89A 1S5JA 4IFVA 1BQMB 3KLFA 4WFXA 3L8BA 4MIAA 4GW6A 3OYNA 3PVXA 5J2MB 1GX6A 2W8LA 2J6SA 4EYHB 1XI1A 3V9WA 3KK2B 4W5NA 4K8ZA 5EWGA 3KKSA 4IQXA 3DI6A 5JUMA 1U45A 3BGRA 5KFMA 1U4BA 4Z4IA 1L3SA 4KE5A 5DG9A 1T8EA 5KFEA 1QQCA 4DL2A 1RDAA 1WSJA 3UR0A 2RKIA 2OA8A 4GVMA 4ECQA 2HMIA 3VQBA 4N76A 3BSOA 1FK9B 4PUOB 3E01B 1S49A 1S9EB 3NAEA 5T14A 4DTUA 4BE2A 4CJTA 4F2SA 2ZE2B 3KOAA 3UQSA 2JEFA 3DLGA 1KHWA 4IRDA 1K1SA 3KK3A 4XIUA 4O4GA 1TV6A 4N5SA 2FLPA 4CJLA 3AO4A 3FDSA 3OL8A 4DF8A 3IGVA 4IDKB 2WOMA 3CDEA 4LQ3A 1T94A 4NLGA 2FJXA 4AHVA 3Q8RB 3P1GA 5KT2A 2VG7A 2VA2A 3T19A 4ZTFA 2YHAA 5C24A 4Z0UA 1LW0A 3MEEA 2UVRA 1ZBLA 2R2TA 1RT3A 1ASUA 3AA2A 3F9KA 2DY4A 4B9NA 3H40A 3THVA 3OYAA 2W7OA 3VA3A 2X6SA 5JS1A 3NH0A 4RUCA 1JLGA 1VSDA 4E7IA 2BGGA 1GOAA 2X74A 2KFNA 4DSFA 4KTQA 1RT7A 2V4RA 3NDKA 1D1UA 5I3UB 1W9HA 4FJ8A 4CEOA 1WAJA 1RDDA 3M9MB 1XWLA 4J9KA 3OSNA 4CJ4A 3KLEB 4O44B 4RW7B 1S6PA 4CJ5A 5KFJA 3C95A 2YKMB 2YNFB 1KVAA 3AVGA 1S4FA 1NK0A 3BREA 2E4LA 2IM3A 3VQ8A 4ED1A 1NKCA 4K8XA 3KK2A 3HVTB 3MXIA 1C1BB 4IH5A 4F4ZA 2ASJA 4FJ9A 1RCHA 4HUGA 4KTZA 2KQ2A 3PJWA 1O1WA 4J9PA 3GYNA 1TGOA 4PWDA 2W8KA 5CZ2A 4IG0A 4Z4CA 1IKXB 3BSAA 3UPFA 3MR6A 4EZ9A 2D3ZA 4CGHA 4NRTA 3AA3A 1FK9A 4PUOA 1S1XA 4DFJA 3E01A 1S9EA 4K4YA 4CJVA 4UQGA 5KFIA 4HUEA 2E9ZA 4JS4A 4R8UB 1HNVB 2ZE2A 1JL1A 1HYVA 3ZT2A 4KHQA 1BISA 3PUFA 3LZJA 3HKWA 3HP9A 2F96A 4CE9A 4DL5A 2GC8A 4URGA 2W9AA 4ZVFA 3AVJA 3OYBA 4IDKA 3G6VA 1HYZA 4NLRA 1JXEA 4Z4GA 1NOYA 3V9XA 3M8QA 3JYTB 1QTMA 5C42B 4Y2CA 1C1AA 3S9HA 1XHZA 2G8HA 4KSEB 4FM0A 3U3YA 4ID1A 4YMEA 2DFHA 4BWJA 3Q8SB 2OYQA 1SKWA 3E51A 1VSKA 2HB5A 3T5HA 1RBUA 3ZSVA 1NJWA 4LSNA 4GC6A 1IKVA 4H54A 1HPZB 3HVRA 4LSLB 3TAMA 3KTQA 4FVMA 3K5MA 1C1CB 3RAXA 2IDOA 2C28A 3I8DA 4FLZA 3MR3A 4BACA 4W5TA 4I7FA 1UWBA 4M42A 4CIEA 4DTSA 4O0IA 2B43A 1LAVA 1JLFB 3KMSA 3T5LA 3I5AA 3CQ8A 4O44A 2PZSA 2YNGA 1EKEA 3RB3A 4YR2A 1HRHA 3TANA 2YKMA 2YNFA 1D0EA 4CJPA 1C0TB 4FJXA 2D3UA 3L3VA 3MF5A 4DEZA 2R8GA 3RB0A 3HVTA 2XI3A 4PA1A 2IMWP 4YQWA 1C1BA 2IM0A 4B9UA 2E6MA 1QSLA 3L2UA 3QO9B 3CM5A 2IBKA 4TQRA 1QAIA 1UA1A 2XRIA 2B5JB 1BHLA 5D3GB 3OHBA 1MMLA 1QHTA 3D45A 4DSJA 4CEAA 4KB0A 5KG3A 4RW9A 1A5WA 1Q9XA 3BQ1A 3SI6A 2I5JB 1HNVA 3DMJB 5KFTA 3GV7B 3BDPA 5DQIA 1TAQA 1TVRB 3RRHA 1TKTB 3ITHB 1ITGA 1JL2A 4KFBA 1U09A 3ISND 4ZPBA 4LQ9A 5KG0A 2GIRA 2WRMA 3CFRA 4Z4FA 3JYTA 5C42A 4CHOA 3KLVA 4J9LA 3O4QA 4BDPA 1CSJA 1TL1B 3QGIA 4CEZA 3AO5A 1RT1B 4YP3A 2BANB 2DPJA 1QAJA 4WYWA 5L1LA 3PW4A 4KTWA 3DDKA 1RBVA 1ASWA 1R0AB 1YVFA 3QYYA 1HPZA 2OZMA 3SUQA 1CXQA 3OS0A 3LPTA 3G86A 3SUNA 3TAQA 1UA0A 4EP5A 3QGHA 5HRPA 1N56A 3TABA 3U3GA 3OJUA 3KJVB 3NF9A 1RDRA 1HQUA 3GIKA 3CJ3A 4FLYA 4U6PA 3I0RB 3NFAA 1S1WB 4EBEA 1JLFA 3OVNA 3Q8PB 2WONB 4WZMA 2IGIA 4E7LA 2OZSA 3PV8A 2FJVA 3HL8A 2FC0A 2F8SA 2R2SA 1C0TA 2IOCA 4Y1CA 3DRPB 2R8KA 2UVVA 1SUQB 3JSMB 2R2UA 1T03B 3GIIA 4IKAA 3QO9A 4MK7A 1RTHB 3GILA 4FM2A 4NLVA 4E19A 4CF9A 2B5JA 5F9NA 2GV9A 3CJ4A 2VG5A 4KBIA 1RA6A 3VQQA 3DYAB 5HRSA 4J2DA 3CIZA 1RTIA 2G8UA 5KFCA 2I5JA 2OH2A 4E7HA 3DLBA 4KHYA 1S1TB 3O3HA 4ECWA 3EYZA 4QWBA 3DMJA 4YNQA 4QAGA 2P1JA 2JEGA 2F8EX 1TVRA 1TKTA 3ITHA 1K1QA 2E6LA 4FBTA 4DLEA 2QE5A 1VSFA 4FZXC 3KK1A 3DLEB 4IOBA 1F21A 4NCGB 4KB1A 4ED8A 1Z26A 4E3SA 2OPPB 3OHAA 4AHCA 2HVIA 1C0UA 2ATQA 4OKEA 4E7JA 4FJGA 1TL1A 3AVLA 5HROA 4F4KA 2XCAA 4FS2A 2FBXA 4BDZA 1RT1A 4R5PA 2R8JA 3AVBA 2BANA 2XGPA 2HHUA 3M9NB 3NH2A 1S1VA 5J1EB 4LY7A 4FYDA 1XHXA 4RW4B 3RAQA 2V4QA 5JS2A 5DMRA 5KG4A 3HPGA 4ECXA 4CJEA 3IRXB 4NCBA 3PW5A 2C22A 3AVCA 3KJVA 1S0OA 5KFWA 4E7KA 4ZHRB 1WSFA 1MU2B 3QEIA 3V6JA 4Q8EA 1WSEA 2XY7A 3O4NA 2G8IA 1WN7A 4DFKA 4IH6A 3T1AA 2C2DA 1S1WA 4ED2A 4FJHA 3NBPB 4GMJB 2JEJA 4KHMA 1BIUA 1ZETA 3OY9A 3VQDA 4J9RA 1EETA 4ZPAA 1N5YB 1KHVA 3DLKB 3T5JA 4CIFA 3NF6A 3LALA 2V9WA 2KZMA 2AGOA 4KI4A 4CESA 3SV3A 4XO0A 1BI4B 2QKBA 4DQPA 1SUQA 1DTTB 3JSMA 3RRGA 3OYLA 4F50A 3V4IB 1DLOB 1YVUA 3AVFA 2O4GA 1RTHA 4CJRA 3LWLA 1KSPA 3ASMA 4NYNA 4B9VA 3RB4A 3CVKA 3DYAA 2D0AA 1RAJA 1G15A 1CZ9A 5HLFA 3VQ9A 1RT4B 3QZ7A 1JLQB 2OPRB 1S1TA 4OL8A 1SH3A 3SPZA 1NK8A 4B9MA 3RMBA 3HM9A 4Q0BA 4QWEA 4CJSA 4IFYB 4WZQA 2E9TA 4CCHA 3H08A 2HWHA 2J6TA 1LW2B 3V6DA 1S0NA 4FJJA 2OPPA 3OL7A 2UVUA 2YKNA 1ZBIA 4Y1DA 3OYFA 1DTQB 3IGNA 3PX0A 1VRTA 2AGQA 1J53A 3CG7A 4DQSA 1VRUA 2E9RX 3HJFA 4CGJA 4L8RB 2HHTA 1IM4A 5CYMB 3MECB 3SZ2A 4AILC 1TAUA 4TSXA 3GIJA 1S9FA 1RT2A 1JLCB 3ZSZA 4B9TA 1IG9A 1S9GA 3BR9A 4AHUA 3IRXA 3OYIA 3N6NA 4DL4A 2AJQA 4QW8A 3IS9B 4ZHRA 1MU2A 4NLWA 1RILA 4H4OA 3LP2A 2JLEA 4FJ7A 4HUFA 3KIOA 3WNGA 4HYKA 1NK7A 2VG6A 4DQQA 5DK5A 3NKYA 1T7PA 5EWFA 3OL6A 3DLKA 2XY6A 5KFFA 1GOCA 4TLRA 1U48A 5HRRA 2I1RA 3PHEA 1NKBA 4CEEA 2YHBA 1BI4A 3AO2A 1JXBA 3QINA 4DQRA 1DTTA 3ICLA 5F9LA 4HTUA 2ALZA 3V4IA 1DLOA 4NRUA 4IG3B 3CM6A 3QEPA 3DLRA 2KFZA 3T5KA 3PJXA 3MR5A 5KG2A 2Z1GA 4O3SA 2EHGA 4W5OA 3V81A 4H8KA 3G10A 3A2FA 2GIQA 2ZD1B 3Q8QB 3QLHA 1WNSA 2XHBA 3AVNA 1JLQA 2AGPA 3QGGA 4FJIA 5C5JA 2B6AB 3KLIA 4K4SA 3SQ0A 4XPCA 5HBMB 1BQMA 3NGZA 4IFYA 3IG1B 1RTJB 1HMVB 4NYZA 1XR7A 5J2MA 3LPUA 1LW2A 3LP0B 3KD1E 4ID5B 5KI6A 1DTQA 4ZP9A 4YR3A 3MEGB 4TQSA 3KKRA 5KG6A 2V0NA 5HRNA 3KLGB 2Z1JA 4N47A 4I2QB 3TWHA 3L3UA 5CYMA 2AX0A 3MECA 4GC7A 3QETA 2BRLA 4CF2A 4DSEA 3H5UA 1JLCA 5KFRA 3HHKA 3QESA 5KT3A 2CKWA 2RN2A 3GQCA 4CJWA 3IS9A 4FJNA 4ZMMA 4K4TA 3QEVA 5I42B 4C8LA 1KFDA 1FKPB 4CFAA 4J9QA 4ELTA 3FFIB 4ZP7A 3BQ0A 3NCIA 3ZSXA 2HNDB 3QEWA 3ZSWA 2AX1A 5KRTA 3HP6A 4DTXA 3L2WA 1NK5A 3K57A 5KFBA 1KTQA 1SL2A 4F8RA 1KCFA 3CDUA 1HNIB 5HP1B 4WFZA 3OS2A 5L1JA 3DM2B 1NJZA 4IG3A 4K4ZA 4NLXA 5KFVA 4FJKA 2IM1A 3AVKA 4FK0A 2RPIA 3SPYA 2FBYA 3SJJA 1ZBHA 2FBTA 3TVKA 3CJ5A 2OPQB 3PZPA 4RUAA 4MKAA 1ZYQA 4DL3A 4URQU 1QSYA 2W9CB 1EX4A 4I9QA 4E0DA 4K4UA 3CJ0A 2ZD1A 5I3UA 2IJFA 1SL0A 4FLVA 4HKQA 2ITGA 3WNHA 4ZVEA 3KLEA 1CXUA 1NNDA 4FBUA 4RW7A 5FDLB 2ILZA 1A5XA 3OYMA 1NJXA 3G6YA 2YNHB 1HYSB 4WYLA 5KFLA 3NL0A 1HMVA 4DFPA 4WFYA 2IA6A 3D5MA 3LP0A 5E41A 1X9SA 4HVJA 4ID5A 4Q43A 4FW1A 2KTQA 2D7SA 3MEGA 4Z4HA 4ED6A 3HT3A 3KLGA 1T05B 4I2QA 3RR7A 1IKXA 3DRSB 4J9SA 2JC1A 2AU0A 4EEYA 2FBVA 2ATLA 3AA4A 4RNMA 1VSEA 4ED3A 3TR8A 4M95A 4R8UA 4M3UA 4PY5A 4DWIA 3VA0A 3AO1A 4WXOA 2RF2B 4NLUA 2O4IA 5DGAA 3NF8A 1REVB 4HCCA 4Y34A 1BGXT 1RYSA 3HPOA 5I42A 2HNZB 4C8MA 4QOZB 2BE2B 4RNOA 4G1QB 4CHQA 2GBZA 3K2PA 1I39A 1LWEB 3C94A 4O55A 4ED7A 4ECRA 3WNFA 4JS5A 2DFFA 4U7CA 3NH1A 2HNDA 4MK8A 1VSLA 3HVAA 1YT3A 4CF0A 3B6PA 3VN5A 1ZTWA 4F3TA 4KHNA 1J54A 5HP1A 4DSIA 5KG5A 3SQ4A 3DM2A 2VWKA 3VQ7A 3GIMA 3CFOA 1RTDB 4LSLA 4BE0A 1T3NA 4IH7A 1C1CA 1J9AA 2OPQA 4ECVA 2BQ3A 1JKHB 2W9CA 3V1RA 3L2VA 4NLYA 2FLNA 3H5XA 4RW8B 2FVCA 2R8IA 4KHUA 1N6QB 4F4XA 3QERA 1ZBUA 4CJFA 4DTOA 5KFYA 2G8WA 4RNNA 4NLQA 4HCBA 1RT6B 2G8VA 5FDLA 3H4DA 4OLBA 5DLFA 4I9LA 2YNHA 4M45A 1HYSA 4JRQA 4TY8B 4DU1A 1LV5A 1I6JA 2YV0X 3OYHA 3MTKA 3K59A 3OLBA 2R8HA 2BDPA 1KVBA 5KT7A 1XC9A 1XR6A 3K58A 3VQPA 3ZSOA 3I5CA 4CJUA 4OPKA 4DTRA 4FCYA 3OYCA 2XY5A 4C8KA 4DU3A 4J2AA 1NK9A 1T05A 4NLOA 1GX5A 3DRSA 4BE1A 5D3GA 3VQSA 4NLPA 1UAXA 3PY8A 2HNYB 5KT6A 4KHSA 3RMDA 3QIOA 1RBRA 2KW4A 3TARA 3VQCA 2RF2A 4DS4A 1REVA 3RR8A 4OGEA 4KI6A 2DFEA 3AVIA 1Z4UA 3H5SA 3KLHB 4LH4A 4RG8A 2HNZA 3CFPA 1HARA 2UUTA 3GV8B 1WLJA 2BE2A 2A1SA 4FW2A 5L1IA 4CFCA 1S1UB 4OGCA 3AVMA 1LWEA 3RMAA 3VQEA 2HAIA 2X6NA 1IH7A 4ZP8A 1QUVA 3KHGA 3FSIA 1TQLA 1W0HA 4K50A 1KLMB 2D41A 3RB6A 5L9XA 3TAEA 4H4MB 4B9SA 4KKOB 2HWIA 4CFDA 2F8TA 1NKEA 2FVPA 2IAJB 3QIPB 4Y2AA 1R0AA 5KT5A 4HHTA 4Q44A 1RTDA 3LANA 2XO7A 3I5BA 1YTAA 3KNAA 4CK3A 5KFZA 3CWJA 3FRZA 3ZT4A 1J5OB 5CY4A 3PW7A 3FQKA 3QZ8A 3DLHA 3I0RA 3QNOA 1N6QA 5FRMA 1IKYB 1S6QB 1FXXA 4B3OB 1RA7A 3KHRA 2WONA 5KFPA 1SH0A 4JRPA 3P83D 1TV6B 4LH5A 4TY8A 5DLGA 4M3TA 4W5QA 4ED0A 1B9DA 3DRPA 4B8CA 4OJRA 1JLAB 3BSCA 4CF1A 5F8GA 1QSSA 4FZZA 4Y3CA 1T03A 4QWAA 1NK4A 4J2EA 4QWDA 1LW0B 4FLUA 4ECZA 3MEEB 3L2RA 4DSLA 3OYDA 3OYJA 3UIQA 5SZTA 2DTUA 4CGFA 4ECSA 2HNYA 4OKKA 2OPSB 2VWJA 3PX6A 2HW3A 4FJLA 1JLBB 3NF7A 3BQ2A 3ZSYA 4KHRA 1S0MA 2Q3SA 4QWCA 1JLGB 4ECTA 1YTUA 3L2QA 3KLHA 5KGWA 1FKOB 4NLDA 3DLEA 4NCGA 1BQNB 5F8LA 3ZT1A 1L5UA 4CF8A 4IRCA 1X9MA 4KRFA 4KV8B 1S1UA 3SI8A 3O3FA 4Q45A 3MEDB 1HJRA 4CEBA 4O3RA 4TXSA 1S6PB 4DTMA 4CEQA 3AVHA 1KLMA 3EPIA 5J1EA 4QCLA 4KHWA 4H4MA 4RW4A 2JGUA 4KKOA 4DG1B 4DS5A 1OS5A 2IAJA 2KZZA 3QIPA 3ZT0A 4TN2A 3M8RA 4ICLB 4JV2A 4NYFA 4CECA 5SWMA 4PWDB 1N4LA 4IG0B 4Z4EA 2W7PA 1K6YA 5KT4A 3RWUA 4EZ6A 4O3QA 5K14B 1J5OA 1KLNA 4O3OA 4CHPA 1S1XB 2X78A 2WCXA 3HVWA 4EYIB 1IKYA 1Z25A 3C6UB 1S6QA 3K5NA 3NBPA 3M8SA 4BDYA 5J2QB 4B3OA 3HK2A 1X9WA 4CGDA 4MKBA 3P5JA 3LZIA 4C8NA 4N41A 1ZTTA 5KFXA 2ETJA 4M3ZA 3S3NA 1N5YA 3OLAA 4DMNA 1TKZB 4DLGA 3V6HA 4CFBA 3M8PB 5DQGA 1ZBFA 2JC0A 2BRKA 4CJQA 4QPXA 3EPGA 3M8QB 1JLAA 4KB7A 4CHNA 4O0JA 1N48A 2RDJA 2QXFA 3PR5B 4MQ3A 3BSNA 4WXWA 1BL3A 5EU7A 3V6KA 3NGDA 4F2RA 4CJKA 5KG7A 2FLLA 1B9FA 3NHGA 1TP7A 2OPSA 3IN5A 2BR0A 1CLQA 1JLBA 1VSHA 2YNIB 4M3RA 1RT4A 1KVCA 3LWMA 2OPRA 4LSNB 1BCOA 3OL9A 1IKVB 3LP3A 4EO8A 4KAZA 3TAMB 4LD0A 3H59A 4RNHA 2DPIA 2ZQBA 2AQ4A 3SNNA 4J2BA 1U47A 1FKOA 1WSIA 3PR4A 4FLTA 4Q8FA 4B8AB 4I7FB 1BQNA 1UWBB 3M9OB 3O3GA 3MXJA 4RZRA 4IRKA 4KV8A 1EP4B 1TK0A 4W5RA 4DSKA 1TK8A 1RYRA 3MEDA 2NUBA 4CEFA 2YNGB 3EZ5A 2UUWA 5KFQA 1WAFA 1SH2A 5FRNA 1TKXB 1LWCB 1L3UA 1HQEB 3H98A 2WTFA 4CEDA 2FVSA 2CJQA 3RBEA 5F8MA 4DG1A 3QIDA 1JIHA 3VQAA 1RBTA 3ISNC 3ZCMA 5FROA 5KFHA 4ICLA 3SFUA 3HYFA 4JLHA 3N6LA 1L3VA 2R2RA 5CYQB 3DOKB 2PYLA 5K14A 1WSHA 3OS1A 2IS3A 1CZBA 4TYAA 3RBDA 4RW9B 3VQ5A 1Q9YA 3G6XA 5J2NB 4ELVA 4NZ0A 3C6UA 4MK9A 3U6FA 5J2QA 1WNEA 4TY9A 3LAMA 3AV9A 4KFBB 1TKZA 3LDSA 4NCAA 2EC0A 3M8PA 1JXLA 3SYZA 4DFMA 5C25B 3GV5B 3H2LA 1A5VA 5EUHA 1VSMA 4URSA 5KFOA 2XC9A 3PO5A 3I0SB 2FJWA 2VA3A 4ZTJA 4M3YA 4J9OA 3TQ1A 3K5OA 4CIGA 5J2PB 3HPHA 3CYMA 3K5LA 2D5RA 3D0PA 2YNIA 2HHWA 4CGGA 3V9ZA 5F8JA 4MH8A 3PX4A 4DL6A 3PO4A 2EX3A 3RMCA 2B6AA 1D9DA 4M3XA 2G8FA 3LAKA 2QK9A 5HBMA 4CK1A 3IG1A 4RW6B 1RTJA 4MIBA 2ASLA 1HQUB 4EP4A 4FLXA 3QNNA 4E1MA 3MXMA 5KRSA 3OYGA 1EP4A 1X1PA 4X2BA 3B6OA 3SUOA 3NE6A 4FJ5A 3C6TB 3H5YA 3SV4A 5DG8A 1TKXA 1LWCA 2FVRA 2QKKA 1TL3B 5KFGA 1HQEA 1NHUA 2Z1HA 3UDLA 4CERA 4DTNA 2WK4A 4FZYA 4AH9A 4RU9A 4K4WA 4FK2A 4ZVGA 3MFIA 2O5DA 1D8YA 1QE1B 1RBSA 4JV0A 1C6VA 5CYQA 3MFHA 2PY5A 1IKWB 4ECYA 2G8KA 3DOKA 4EBCA 1L3TA 2W42A 2VG5B 3SQ1A 4KO0B 4C8OA 1BCMA 1JLEB 4DQIA 3NMAA 5KFAA 1FKPA 1RTIB 5KTQA 5J2NA 4IBNA 2J6UA 4PQUB 4KREA 4I2PB 4DL7A 1LAWA 3ZSRA 4B9LA 3FFIA 3DRRB 1QS4A 1S48A 4RNFA 4M41A 3FQLA 3AA5X 2GUIA 3S3OA 5KFNA 5F8IA 5EWEA 3EZUA 3NAHA 2W9BB 2D0BA 1W25A 3AO3A 3RTVA 3KK1B 3HO1A 1RT5B 1C2PA 2XY8A 3NGIA 5C25A 1Y97A 2BQUA 3SCXA 1C0UB 1HNIA 4OKJA 3HSTB 3I0SA 5HROB 4F3OA 5DQHA 2IM2A 2WB4A 2C2EA 3D28A 4R5PB 2RDIA 3SFGA 1NJYA 1NK6A 1S1VB 5J2PA 3LP1B 3TAGA 1S10A 2ASDA 4NLSA 3PW2A 2IC3B 2XGQA 4IR9A 4CHYA 1Q8IA 4CK2A 2ZKUA 4ELUA 3S3MA 4RW6A 3HXMA 1IO2A 4OPJA 1SV5B 3N6MA 2XWYA 3OSPA 1U04A 3WNEA
chains in the Genus database with same CATH superfamily
4JI7K 1FD2A 3AAPA 3VQ4A 2ZNYA 4B3TK 1EETB 3IAS9 5F8NA 2DNQA 3NGYA 1WC3A 1G4CA 2HHXA 1WI6A 3R27A 2ZOMA 1UOCA 3LGMA 4MFBB 4K4XA 1QE1A 1FDBA 1RWOB 2OAUA 5I3QA 1IKWA 4A5BA 3BJYA 3QEXA 4KO0A 2BABA 4FOIA 5HQ8A 4C9DA 1GTHA 4JI6F 5G4DA 2QLFB 3TTCA 4DV7F 4JI1J 1Z2LA 2AYMA 3MN9A 4FWRA 4Q0BB 1CQMA 1NMEB 3KLFB 1UKUA 5CZ1A 3MM9A 4M3WA 2SXLA 3CDWA 3KHLA 2DH7A 1B92A 4CLKA 4IXCA 3V1OA 2ILYA 3F73A 2H4YB 1N52B 2C3OA 1BUXA 1VRTB 2GMLA 4HH0A 4PWUA 2LCWA 2ZH7A 5J1PA 5KFKA 1P8GA 2EW9A 1ATRA 2FB0A 3ILOA 1RCXB 5D77A 5KOXA 3BUZB 1VQ6S 3CPWM 3LP1A 3VHQA 4QQBA 2LSNA 4J91A 3OJSA 2MKYA 4K7QA 3FGUA 1NGGA 2A1RA 4ZPDA 3MAQA 3PSFA 3T3FA 1RT2B 3MR2A 4M5JA 4DX8H 4U8YA 5LXRA 2Z57B 1RT6A 2HVHA 2R7WA 2DIVA 1W97L 2RHKA 2JEIA 3D2WA 2WOMB 2FSNA 3QT7A 1NOZA 1M1KO 2AYGA 2XCPA 5D15A 3GFHA 1IBKF 3K89A 2O8EB 3AXKA 3H42A 3SAGA 3G82B 3EM1A 3ULDA 1VQYA 4NLBA 3FJ2A 2M52A 3UKUA 1HX1A 4J9MA 2GHVC 3D54A 4FS1A 1XTZA 5GAHI 3EL2A 5DG7A 4YOXA 4MAKA 4JI6J 5KGXA 1JCEA 3QLHB 4E1NA 1TK5A 2F7TA 2XMKA 4Q5VA 3OA9A 3TAFA 1V6HA 1P6TA 3NY0A 5KG1A 3IR7B 4E89A 4IFVA 3TQEA 3L8BA 1BU6O 3OYNA 2W8LA 2J6SA 2MPUA 2V34A 4W5NA 1KAYA 3W8PA 3DI6A 5ADXH 5HQLA 1YIJS 3T1HK 2JJ4D 5KFMA 3CNQP 4YB6A 1U4BA 1RAEB 5DG9A 1T8EA 2XS5A 2HK3A 1RDAA 1WSJA 2QG9B 3NGUA 2YWWA 2RKIA 2E2OA 4GVMA 4UOFA 4ECQA 2HMIA 4N76A 9RUBA 3KUEA 3BSOA 1WG1A 1RP5A 3FBFA 4PUOB 3NAEA 1BE4A 5T14A 4BE2A 3BDEA 1T9VA 5B08A 1FJGF 1CS4B 2C2ZB 3VEWA 2JEFA 3DLGA 1X5SA 4MKVA 4XIUA 4O4GA 4CH0S 5D78A 3UD4P 2XQCA 1AXQA 1UCNA 2C2NA 4ZCKA 4OYOA 4H0OA 3ID6A 5E5NA 2W2PP 3CDEA 3R5JB 3A5LC 1YJVA 2DNKA 2VG7A 2VA2A 4KIAA 1ZZFA 3CJ7A 1IBKJ 4P74A 3CF5L 2NRWA 1VCTA 3MCOA 3A8IA 3U1NA 1RT3A 2E88A 3KKFA 5DDQC 3AA2A 4TVAB 1HKCA 2DY4A 3H40A 4DR2K 4JYAF 2W7OA 5CHIA 2WSCC 4RUCA 4LF5F 2NLXA 4E7IA 4HT5A 2R4FA 2X74A 3VF0B 2IVOA 1KQKA 1D1UA 1FX4A 3NEKA 5I3UB 4OYWA 1BDGA 1WAJA 3R2DJ 3OSNA 3KLEB 2G9OA 5IT9Y 3GIRA 1S6PA 3CCEN 5KFJA 1ZOTA 1RHKB 4AF1A 2HF3A 4RX6A 2KO1A 3UN5A 2IM3A 4JI2K 4K8XA 3HVTB 3NOGA 1C1BB 3W5YA 2E44A 3GE9A 2ASJA 4FPAA 1VQ8S 4WQ5C 3PLAA 4I4BA 4HUGA 4KTZA 1O1WA 4J9PA 3GYNA 4PWDA 5CZ2A 3UPFA 5AQKA 3I82A 4M8LA 1S9EA 4UQGA 4K4YA 3CJKB 3KZBA 2ZE2A 1XMQJ 1JL1A 4KHQA 2Y8WA 2MDAA 2FD2A 2MSSA 1MWYA 1T6CA 5JVHQ 3Q0AA 3OR1B 3VCDA 1JXEA 3UN3A 1S0VA 2RUGA 1X9JA 3QBWA 3WT0A 1RLCL 3R5GA 1QTMA 4DX7A 3H25A 2DEJA 3IMXA 3THPA 4ID1A 2ADCA 5ADXA 4DZ6A 2AA4A 2OFGX 3Q8SB 2OSRA 3MM8A 2DHAA 3CC4N 5ETRA 5IZHA 1ZA1B 3OBYA 3ZSVA 1NJWA 3VOVA 4LSNA 4JNEA 2VBYA 1V3ZA 3HVRA 4WKRA 4TU9A 5LMUK 3CCQN 2EBGA 1C1CB 2IDOA 3E8OA 2HF4A 4F67A 4PEOA 1JB0C 1LAVA 2A6MA 7FD1A 1S77D 3BH7B 1YDLA 3EICA 2YNGA 3RB3A 2K06A 4HDGA 1FDAA 2UXCK 2ACMA 3TANA 2QL7B 3AB2B 1XC3A 1KQSR 4FJXA 3C15A 5L38A 2D3UA 3QJPA 1V9OA 3AAQA 2NXUA 4A8WA 3GZ7A 3G2XA 4DEZA 2IY5B 2IMWP 4YQWA 2RIJA 4NA3A 2HZAA 1QAIA 3UI3A 1VBXA 1UA1A 1SPBP 2XSJB 3O9UA 1W2BM 4WTYA 1VAZA 4XAKA 4CVNE 4RUHA 5KG3A 1A5WA 1HKBA 1N54B 1EIYB 4LIRA 1HNVA 2J8AA 5J1NA 2F9TA 4L3KA 4BC4A 5KFTA 3IDHA 3GV7B 5DQIA 1TVRB 1ITGA 1GLJO 4KFBA 4LR7A 1B64A 3JB9k 5AJ3J 4LQ9A 4QR2A 2Z4PA 3LW5C 3DN9A 4ENOA 1ZS6A 3JYTA 1QJHA 4C4WA 4GMKA 2PA3A 3KLVA 1DFDA 2BKNA 1X0PA 5LY3A 4QIVA 3UKRB 3GFYA 5GIPA 3QJLA 3AO5A 2BANB 4GKKF 1GXTA 2YX6A 3QRRA 1LCUA 5I3PA 5L1LA 4KTWA 4FWNA 1Q78A 4L73A 2O8CA 2J9EA 2OZMA 1RFQA 3LPTA 2JZ5A 2DIUA 4QYZJ 3RSEB 3ENWA 5HRPA 1N56A 3GYGA 1LQ9A 2J0WA 2CWKA 2Q43A 4JV5F 1MWMA 4OYBA 3QDKA 2MZ1A 5A0YB 1RCOB 3VEXA 4EBEA 2UU9F 4K2XA 2FGOA 4WZMA 4Z2XA 2GCFA 4NYOA 2OZSA 5DO2A 2AD9A 4BRLA 3UVJA 2LA4A 3F0NA 2BKPA 4LFAJ 1NRKA 4LVNP 2UVVA 4JB8B 1ZM3A 2O8FB 1Z6RA 3QO9A 4MK7A 4JKFA 4OI0A 1RTHB 1SZ2A 3FEXB 3CQYA 2B5JA 5F9NA 1HR0J 1ACMB 4X62K 2VG5A 3FGVA 2DR6A 3DYAB 2CVEA 5BR8J 2W01A 4NLCA 4B1VA 3IFEA 3A12A 3POTB 2P9IA 2OD6A 4E7HA 3T7ZA 1UW4A 1S1TB 4YNQA 1RUSA 2DEIA 2P1JA 3FCVA 3ITHA 3BS9A 1VSFA 3P3DA 3KK1A 2QWNA 3K9JA 1TL5A 3DCAA 3U7JA 3DLLQ 2UUBJ 2OPPB 4JI0K 1SS6A 3VGMA 1FNOA 1WF2A 2ATQA 1TL1A 3AVLA 2HQCA 2XCAA 4BDZA 1VHFA 2R8JA 2HHUA 3AVBA 1N36K 2JL9A 5J1EB 2RU3A 3A5OC 2KH9A 1YRUA 1PAEX 3UD3P 2FC8A 1RK8A 1QVGM 4RW4B 2C3YA 4NEZA 1RHJB 4LSZB 3CMEN 3QATA 1TFWA 1B99A 4BR9A 4NCBA 3RAMA 1V3RA 2ZBIA 3AVCA 3BGLA 2YWHA 1FRHA 3W63A 1S0OA 5KFWA 4LF9J 3DXMA 3GCXP 1E6YA 3IP0A 4ZKAA 4R79A 3T1AA 4I68A 1S1WA 2ZITA 4FJHA 3ZZYA 4GMJB 1ZETA 3OY9A 3FVYA 3EDQB 4KRWA 5IT9U 5CHCB 1N0UA 1N5YB 2L9DA 2VASA 4F0MA 3T5JA 5AQHA 2RS8A 3NF6A 2CIMA 1YRXA 3MMCB 1M1KT 2ZH5A 4CESA 1HNXF 1RU2A 1KR4A 2R7VA 2QKBA 3RUBL 1SUQA 2G2OA 3TTFA 2MQOA 2BJEA 4CJRA 2J7WA 4HTLA 3ASMA 2C3UA 4NYNA 4B9VA 2F3JA 1F2GA 1YXQA 2D0AA 4CLPA 1W2IA 2YJEA 5LSLA 1RT4B 3O9RA 4OL8A 5LXYA 1NK8A 3SPZA 2LQBA 4V19X 2PFUA 4B9MA 1VOMA 2H51B 3LH2S 5RUBA 5BYSA 4BREA 3MUTP 2LEPA 4CJSA 4IFYB 3US5A 5IFMA 2LYVA 2E9TA 2HHHK 2HWHA 4FJJA 1ZBIA 3QAUA 5GADI 2CPXA 2BA9A 3T9ZA 2HZCA 4DQSA 1VRUA 3SMPA 4DPOA 2E9RX 4RUBA 3EVMA 2DGWA 1NGBA 3H2UB 3HJFA 3M1VB 1S76D 1U1RA 1VC6A 3H2VE 3C65A 2H3GX 2D69A 3VTHA 1TAUA 4P7VA 3KJNB 3I56N 1NJIO 2XMMA 3ZSZA 4DOZA 1IG9A 1S4EA 1Q1KA 1VRQC 4AHUA 1NXIA 3T1YJ 3G6ES 2AJQA 2LP4A 4CZMA 3IS9B 2P9EA 2P9LB 3C6HA 1MU2A 1YAGA 3J80Y 1F9HA 4YDUC 1VBZA 3W62A 4C6AA 4H4OA 1F5CA 4FJ7A 1PSDA 3WNGA 2MQ8A 3S8SA 4HYKA 1WC0A 2VG6A 2CNNB 3THYA 4DQQA 1T7PA 3CJ1A 2XY6A 3TA1A 4TLRA 5HRRA 3MK6A 3DC2A 5C10A 2IRUA 5F9LA 3V4IA 2HBRB 4ZN1A 3T5KA 2OTLS 3MR5A 1NBEB 1WHXA 3V81A 4ZVQB 3AJDA 3BF1A 1WNSA 1JLQA 2W2MP 3MAHA 3H6EA 3QGGA 4DV7K 3KLIA 4K4SA 3SQ0A 2DNRA 2RRNA 2DNYA 2DNNA 4GVEA 2GJFA 1HMVB 4BR5A 1XR7A 5J2MA 1FDDA 4DV0K 5D0EA 3LPUA 1ICEB 4LR8A 5H1SQ 3UCZP 1DTQA 3J7AN 4ZP9A 4YR3A 2COLA 1RWPB 4H5TA 4I2QB 1WB9A 2Q2RA 4ZVSB 5FLXY 2CWXA 1SJFA 1PILA 5CYMA 1S79A 1MLAA 3SJHA 3IM8A 3M6XA 1JLCA 5HL7L 2R3VA 3O5BA 2FF3B 1MDUB 3GQCA 1LFWA 4GVLA 4FJNA 4ZMMA 1H74A 4C8LA 4BGBA 1FKPB 2HS0A 1PGZA 2PBDA 2OKQA 4J9VA 1MROA 4IEIA 3UFCX 2JX2A 3FFIB 3CO0P 4BQLA 4ZP7A 4DUTA 3HOTA 1GMWA 1CJKB 1BMQB 1IBKK 4LF4J 1A6LA 1KTQA 2N4CA 4ZLJA 2KVQE 3SEOA 1KCFA 1HNIB 1GLAG 4USJC 1SJ4P 4FJKA 4DV2F 1UFLA 3SPYA 2FBYA 2GHWA 2FBTA 3CJ5A 1VLYA 3FZKA 2V2KA 5HN0A 1GEHA 2DD8S 2W9CB 2IIRA 1SL0A 5AQXA 3WNHA 3G87A 3RYLA 5LOQA 1NJXA 4EUVA 3D2FB 1I1GA 2OEMA 2R42A 4WFYA 5E41A 4RU2A 4ID5A 2QO3A 5D0GA 2D7SA 2YKAA 4PPDA 1RAFB 1VFJA 3AFGA 4DMZA 4DBQA 2VKZG 2XMWA 3KLGA 1IKXA 2ZJQL 3TZWA 3AA4A 1VSEA 2PAVA 1JNZB 4GO7X 2KYXA 4PPZA 3ONQA 5C12A 4PY5A 2QFIA 1FJGK 3AO1A 2RF2B 4NLUA 3GMGA 3SCLE 3NF8A 1REVB 4Y34A 1WG5A 4AT1B 1WC5A 1NBWA 5E3RA 3MPYA 1S12A 2C2MB 3B4DA 4C8MA 2Y0BB 2E20A 2BE2B 3IAM9 1S72S 3J7AP 2GBZA 4PL8A 1I39A 3C94A 1FWLA 3HHLA 3WNFA 3UO0A 2XEXA 4BRMA 4U7CA 4MJKA 2HNDA 2QFJA 2V52B 5IWAF 3VN5A 1D09B 1UETA 2Z30B 2JWKA 2B9XA 3L0QA 2YY3A 1J54A 1SQGA 3DM2A 4JYAK 1U24A 4DN9A 4QS9A 1RTDB 4LSLA 4LF5K 4BE0A 2CFXA 3ET6B 1AB8A 5LJ3Y 3VEVA 3H5XA 2BVZA 2R8IA 2CPZA 1T3VA 4NLQA 4HTIA 1RT6B 3UD5A 3P38A 5DDPC 2O66A 4JRQA 4DU1A 4YEAA 3I9ZA 2HFVA 3U27A 3K59A 3OLBA 1UEUA 2YQ3A 3GWCA 1HWJA 1XC9A 3DGPB 3VGTA 3VQPA 1GLLO 2HFUA 2X3DA 1K8AO 4CJUA 4OPKA 4NX9A 4LT6A 1T05A 1NK9A 1WWHA 5AQGA 3DRSA 1QY7A 4BE1A 5D3GA 3VQSA 1QQOA 1WOPA 3QRQA 2U2FA 2PIIA 4UUWA 3OUYA 2VDIA 3A8KA 1RBRA 2PGCA 2KW4A 1YZ7A 5IT0A 2Q0UA 3TARA 1G3OA 5DM6L 1RAGB 4DS4A 4CT9A 2Z2LA 3RR8A 2RHQB 4IFEA 2DFEA 3PEHA 2UV8A 4ZK7M 2VFVA 3MAAA 4RG8A 3C7NA 3GG0A 2HNZA 3J80U 4LF7F 1UVLA 2QA4N 3GV8B 3RBXA 4ED5A 2KJWA 2A1SA 1FW6A 5L1IA 5IQQA 5D8HB 3RMAA 1XQIA 3FEYB 4P2MA 2MLZA 3R97A 2H54B 2V6AA 2ROGA 4MLHA 4H4MB 4XEIA 3FNNA 4Y2MA 2F4VJ 4BRPA 4U67L 2F8TA 4CFDA 4LFCF 2MEWA 5KQDA 4A8KA 3CCUS 1HBMA 3QIPB 4L74A 1WORA 4K43A 3EE8A 3DJCA 4CK3A 2P8IA 3VGLA 3FRZA 3ZT4A 1UTAA 5A8KA 4B3MJ 3QZ8A 2CNLB 1NU4A 3I0RA 1Y0HA 2ZBRA 1N6QA 3PJ9A 4C7QA 4OYZA 5AQYA 3ATVA 4WKYA 1N32F 1HHTP 5LMNJ 2EXUA 3GJRB 1X4HA 3TEGA 4M5KA 3G9CA 4B8CA 4OZLA 2AEMA 4JI8F 1QSSA 4CF1A 4FZZA 1VYAA 3WZ0A 4KR0B 1T03A 4QWAA 3E9PA 4DUYF 3OYDA 3CD0A 1FWPA 1OVQA 3MR7A 4P7TA 1VQ8N 5FLXU 2HNYA 2B9EA 1ZAXA 2ADBA 3PX6A 2HW3A 1JLBB 1AT1B 3W9IA 1YITN 4DV6F 2NRZA 3D6RA 4QWCA 5E26A 3NMUA 3FR0A 1PJ6A 1YTUA 1NH7A 4KHPF 3NP5A 5KOWA 1VI7A 4NLDA 4V1Ak 3BN4A 1BQNB 3U1LA 4CF8A 1IXKA 4IRCA 4KRFA 4CYUA 3D1HA 1RAOA 2DKOB 4Y2KA 2KL8A 1S6PB 4CH1A 5H9EK 2ZJPQ 4DTMA 2E1MC 4M7XA 2DNOA 2HFZA 2ZWOA 1B7YB 1OVYA 4GKKK 1VC0A 4H0VB 3V4MA 5M1NA 3BO4A 2JGUA 1VIOA 3TVYA 3IFRA 1WSRA 4DS5A 2PMZD 2OMLA 2KZZA 3M8RA 3PRVA 3W1YC 1KQSM 4IOCL 4JV2A 3MURP 5SWMA 2V63A 4PWDB 2W7PA 4QOTA 5KT4A 4BRNA 1NJIT 4KH0B 4O3OA 4M7YA 2QLWA 1OSDA 3EX7B 2CXEA 3HVWA 4JV5K 1DURA 1Y4ZB 4CD1A 4EYIB 4AM6A 3O6QA 1IKYA 3D9BA 3NBPA 3HK2A 1R31A 2UU9K 4P2FA 4S0MA 1N32J 4LFBJ 3TSUA 3SBTA 2ETJA 1XJWB 1IBLJ 1DHMA 4CLUA 4BHQA 4DLGA 2BEFA 1CC8A 4YUDA 3E9LA 3HLUA 2ZHOA 4QPXA 3KUHA 1JLAA 4KB7A 2Z2ZA 2FHKA 2D3O1 2GVZA 2JFDA 4YB7A 3OVAA 4MQ3A 3NGDA 4CQ1A 4ZVRB 5KG7A 2NPIA 1TP7A 3GFZA 3MM8B 3IN5A 4Y6IA 1MMNA 2NXNA 2YNIB 4M63C 2OPRA 4LSNB 2DXFA 3OL9A 1NDKA 1R27B 1NH8A 2AKWB 2QI2A 1NHKL 4PG4A 5IQ6A 3HKZD 2P9KB 3SNNA 2O8BB 4I1TA 1EO1A 1TUYA 1FKOA 1RBLA 4FLTA 4B8AB 3O3GA 1WKJA 1M90O 1EP4B 1IR2A 2JDJA 1TK8A 4OI6A 3F5TA 3MEDA 2NUBA 2YNGB 3OTDA 4FWKA 2HRTA 3SCKE 4WK1A 4QU7A 2YH1A 3QMQA 1DQ8A 1M5OC 3WEEA 2Q97A 4NMXA 3HFKA 4DG1A 1R6YA 1IR1A 3VQAA 5KFHA 1FE0A 4YOWA 3LDNA 2Q6CA 4KY3A 2HBLA 3L95X 3OTOF 5K14A 1EARA 3OS1A 5A8WA 1K0TA 2IS3A 4UT4A 2FJAB 5AQMA 3B8HA 7FDRA 4ELVA 4EGLA 1BLUA 4ILJA 4C11A 4B1ZA 4TY9A 3C14A 2FIUA 4C1NI 3HHNB 1MWQA 4KFBB 1FXRA 1LXJA 2GWJA 4NCAA 3BBFA 1JXLA 1HNXK 4DL0C 3GG1A 3ILJA 2RVJA 3OW2R 2W41A 3R3LA 1GH8A 3SBMA 3CJSA 1UVKA 2YJFA 3AA8A 1NCLA 2IJRA 4A8YA 4M3YA 4A5AA 1E3MA 3HPHA 2PFDA 2Q36A 5ETTA 2UXBJ 2HHWA 1OH5A 2O8CB 2ACYA 1RGIA 2VD3A 4DL6A 2B6AA 1BHNA 2ZF5O 2W4PA 2G8FA 5HBMA 2E5LJ 1YQHA 4MIBA 4EP4A 3LDOA 3QNNA 3E1YA 2XZDB 4E1MA 3M2VA 2GJ2A 2RRBA 4LR9A 4ZJQA 4FZVA 4P71A 3OYGA 4QPTA 2KDOA 2XMTA 3BZKA 3B6OA 1ZM2A 3NE6A 1AUDA 1SJ1A 3WQTA 3C6TB 1UJ5A 5MLCV 3EZWA 3H5YA 5CYJA 5DG8A 3WQUA 3VF4A 4USVA 5C7PA 1TL3B 4CLFA 2VQEJ 2Z1HA 5GINA 4P73A 4DTNA 2WK4A 4YB1P 1D8YA 2QZ8A 3BYRA 3OTOJ 1NGEA 2CQPA 5IV3A 2Q6BA 3DOKA 1WG4A 2VG5B 1J5EF 2Q66A 2V2ZA 2FZCB 4DQIA 2HGLA 3NMAA 5KFAA 3JAMY 3KNGA 5J2NA 4IBNA 4KREA 1BA1A 4I2PB 4B9LA 1LAWA 1T44A 3DRRB 4U95A 2ZOFA 3M8ZA 3S3OA 1ZPVA 2FC9A 4QYRA 3MD3A 4I67A 2CH6A 3KK1B 1RT5B 5BPMA 2XY8A 5HATA 3NGIA 3EEQA 1WUAA 2L48A 4JP8A 2IM2A 2WB4A 3H7HB 3JSBA 2DGTA 2WVEA 1KXPA 1YHQS 4WP8A 5MAOA 3I87A 1JQGA 1UZDA 2MZSA 1Y5NB 2ROPA 4NLSA 2IC3B 1KOOA 2NQPA 2ZKUA 2A10A 3ZEUA 3UCUP 2O8DA 3OR2A 3HXMA 1IO2A 3DXMB 4DV5F 5AZJB 1E6YB 5ETPA 4OPJA 3FK4A 5CCMA 3N6MA 2XWYA 1N34J 2A1BA 3WNEA 4FF1A 2FHJA 1U2VB 4JAXA 4BQZA 5GAGU 4F4WA 2DGOA 1CG2A 4ILGB 4B9QA 3VTIA 4NB4A 3CD6S 4BY9C 4LRCA 2IVYA 5EVZA 2UVWA 2VH7A 1K8AT 2BQRA 5FD1A 5HO4A 2C2RA 1X4GA 4N56A 4PXCA 2ZDOA 3NGTA 1HBOB 1SKRA 2IJNA 1XK8A 1N33F 4IQMA 4G6VB 4HDHA 4A8XA 2GQ2A 3V9SA 2Y1IA 1TYQB 1VSIA 4EHUA 1I5OB 2IVFB 2KG0A 1KC8T 4YOVA 4G1QA 1U8SA 5T7BA 3R6LB 3L4BC 5ETVA 4ZITA 5CR4A 2R7YA 3ZSQA 4G65A 4EO6A 3DOLB 2A6AA 2QJ3A 1WF1A 3ZZRA 4XPEA 4CO1A 3ENQA 2E2PA 5SUHA 3CCMN 4OLAA 1YJRA 2NLWA 1JX4A 2YVSA 3TAPA 3BGRB 5KPTA 1EXQA 4CO0A 4L3QA 3TZYA 3JTNA 4DV2K 4G1IA 3MPUB 1VRUB 1VK0A 2QL9B 1RHUB 3G0ZA 4R0EA 2D0OA 3LGHA 5AQPA 2DK2A 3EY1A 1HNZF 1IJFB 4UF4A 3PSIA 3HULA 4RW8A 2VPXB 1S3XA 4ZCIA 2ZDPA 3QB0A 3SXLA 2O67A 2D0CA 1NHVA 1MMDA 2J5AA 2IVPA 4HT7A 1JWWA 2ASYA 3IM9A 3K2YA 3KK3B 2FPHX 1HHQA 3V9UA 4CRJA 3CCJS 5JVHL 2RRAA 2F65A 2LXUA 4PG8A 4JV1A 4BWMA 4FLWA 2VODA 4X66F 2HEKA 3KHHA 4FXDA 1PIEA 3JXUA 4H4OB 4F4YA 3PIPQ 2P5GA 2HHSA 5C24B 4M94A 3W7BA 2VG6B 1Q79A 3THYB 4ZOSA 5BXIA 1ZH5A 1RI7A 4X4TA 3NNHA 4OZ3A 2QLJB 2DXEA 3KYLA 4K4VA 4OZ1A 4MFBA 4K0KJ 1VQ7N 3MUMP 1XNQF 5F8HA 2E29A 1N33J 2PN6A 1XR5A 3P8BB 1I94F 4DTPA 3SQ2A 3V81B 3WXMB 1H6KX 1MW7A 3OYEA 4JUZA 4YR0A 2B8QA 4RBVA 4JKGB 4M5NA 3B54A 4P6QA 3H4BA 4FJMA 3V1QA 3KLIB 4KPYA 1SKSA 2ZM6J 3KLFA 3KJFB 4GW6A 3U4LA 3PVXA 3H1VX 1KAXA 5J2MB 2A2DA 1RU1A 5IWAK 4RTFD 3KK2B 4K8ZA 5AQRA 4IQXA 5GVQA 3KJQB 4X4SA 4BC7A 4JI5F 2Q0RA 5KFEA 1QQCA 4DL2A 3UR0A 3MGJA 3V2UC 3VQBA 3I31A 1Y5LB 4OZ5A 1JCFA 1VS3A 3OTCA 1FK9B 4F2SA 4DR7F 3NCPA 1KHWA 3CETA 2G0IA 5EGYA 4N5SA 2DO0A 1URRA 5ETKA 3M1FA 3QPIA 4DF8A 1EQMA 2ASOA 2D1KA 3IGVA 4IDKB 2WOMA 1MROB 4NLGA 1VHIA 2Q79A 1W7AA 1UP1A 5ELZA 4BRGA 4Z0UA 2C3PA 1KDNA 2KU7A 1FRXA 3LUYA 2UVRA 2R2TA 5A2QU 2OCEA 3V5RA 4P75A 3D7EO 5AQVA 2CDQA 4ZN3A 1RWNB 4B9NA 1RWKB 4RWXA 3CW2C 4BC3A 4JN4A 4Y2IA 1I94J 2X6SA 3VA3A 5JS1A 3S41A 3NGRA 2HFOA 4EWTA 3K0JA 2BGGA 2GTDA 1Y64A 1GOAA 3ZXWA 3SSRA 4KH4A 3NDKA 2XG8A 3JAMU 1FEEA 2PO4A 2JWLA 2RSQA 2BYCA 4LF7K 2ZVIA 5LSOA 1NB2A 2ZBQA 1RDDA 4CJ4A 1IBCB 2DNMA 2DHGA 2ZH3A 4B1UB 2F8MA 1M90T 3PM9A 5L46A 2YNFB 3AVGA 2XTJP 4BGAA 1XNRF 2E4LA 4P52A 4W92B 3MX5A 3NG8A 2YHXA 4LFCK 2PI4A 3MXIA 4FWOA 4FJ9A 2V4JB 4BC9A 3PJWA 4IG0A 1IKXB 2BJ3A 5BJRA 3MR6A 2AYBA 4CGHA 2LMIA 3AA3A 2E2NA 4PUOA 1S1XA 2ATCB 4YHHF 4CJVA 1HYVA 4DR6J 1CS4A 2D74B 5CAAA 1BOTO 3THXB 2V9KA 3LZJA 4H03B 4H0TB 3HP9A 2F96A 1UFKA 1N32K 2GC8A 4QR0A 1T11A 2W9AA 3AVJA 4NLRA 3DLLL 2D1CA 3V9XA 3M8QA 2J0QD 5C42B 4JI8K 2A18A 3HHLB 4Y2CA 1C1AA 3S9HA 1M1HA 2G8HA 1PKUA 5G0RA 4FM0A 2WW4A 4DUYK 4FWQA 2VUGA 1KNZA 4YMEA 1RWXB 2OYQA 2E66A 3E51A 5ETLA 1HPZB 2VZ9A 4DV6K 1HNWF 2BZ2A 3BY5A 4LSLB 3TAMA 1VQ4N 3KTQA 4Z94A 5A8RB 4K5SA 5D6GA 3AGKA 3TUJC 1Q4RA 4KHPK 3I8DA 4FLZA 3MR3A 4I7FA 2QM1A 4CIEA 3NRBA 1JLFB 1UZHA 3T5LA 1Y00A 3CQ8A 2PZSA 2LDIA 3P39A 4YR2A 1HRHA 4CJPA 1C0TB 1CC7A 1U6BA 3L3VA 4CBUA 2R8GA 3RB0A 3HVTA 1Q86O 3EJMA 4PA1A 1C1BA 2IM0A 3ISZA 1QSLA 5K20B 2YBVA 3MMJA 2CPDA 3ZNUA 4YOEA 1RWWB 4CM0A 2XRIA 1BHLA 4OYMA 3G4SN 4F7VA 5D3GB 1QHTA 4CEAA 4KB0A 4RW9A 2FGCA 3U8XA 3OUYB 3ELHA 3CJKA 2WUSA 5KQ8A 4GY2B 3SQGB 1YJ9S 5LL6d 3D6FB 5AZIB 2HKEA 5M1QA 1Q5YA 3FZLA 2UUAF 3FZHA 3VAJA 3RRHA 1FJEB 4OMFG 2CZ9A 3C0BA 1VQON 4HWIA 3MAAB 3ENHA 1U09A 2XS2A 4H5RA 3OR1A 5E7OB 2GIRA 2GX8A 2WRMA 1EHWA 3CCES 4NZ6A 3KUGA 3TTDA 3CT9A 4J9LA 3PFOA 4BDPA 3FBCA 1YK9A 4CEZA 1RT1B 2D0PA 1RSCA 3NCQA 2K3IA 1NUEA 5AXKA 1OIAA 3JTPA 3OXFA 4WYWA 4QR1A 3QBCA 1FDNA 2GO9A 2BACA 3DDKA 1RBVA 1HNWJ 1ASWA 3O9TA 1YVFA 3QYYA 3R5AA 4DR3F 2DGVA 2K8GA 1UA0A 3BM7A 4EP5A 2APOA 3QGHA 4OFZA 3QT6A 3TABA 4ANEA 3OJUA 1RDRA 2P9PB 3GIKA 2CQGA 3CJ3A 4U6PA 5GAHP 1D9AA 3I0RB 3LF0A 3NFAA 2MTLA 3BO3A 1OO0B 2K1RA 3VGUA 4E7LA 1O13A 4LBPA 2R2SA 3SAHA 3GG4A 5DJBA 4X4UA 2QLXA 4BVPA 2MGZA 1QTNB 2D4WA 1ITPA 4C1NK 4JI4F 3JSMB 1T03B 2VCPA 4IWVA 3CC4S 4NLVA 2XSJA 2GV9A 3OTOK 3ILLA 3CJ4A 2FJDB 1IBMJ 3WXLA 1RTIA 1M5VC 3G96A 5KFCA 3CCQS 1HL6A 2OH2A 3DLBA 5IS2A 2WSEC 5AXNA 4QAGA 2QN6B 1NPRA 1TVRA 1BG3A 1U26A 2QE5A 3CDBA 1ZPWX 2KRRA 2EFQA 4IOBA 1F21A 3TRGA 4CYUB 4X4OA 4U7UD 3OVBA 3OHAA 2HVIA 2JVRA 5AFUH 2YPZA 4EU0A 4CNYA 1SQEA 3HHDA 5HROA 4NXNJ 3CGIA 2NREA 4Z7YA 2BANA 3NH2A 1S1VA 2HQFA 3PYFA 3AD8C 3L7OA 1UJ6A 3MPDA 3IA0A 2LXFA 4DR1F 2CPEA 1ESVA 4OX6A 3D3CJ 3HPGA 5CQGA 4DPUA 2CJAA 4ECXA 4CJEA 1TR0A 3IRXB 3RSEA 1TTHB 4E7KA 5HOOA 2CGJA 3O4NA 2G8IA 1WN7A 4DFKA 1KS2A 4IH6A 5A0YA 4BCAA 2C2DA 3J7YU 4ED2A 3NBPB 4OQJA 1GMWD 3VQDA 3N5FA 2IYGA 4ILLA 3DLKB 3D66A 3MI7X 2NUHA 3LALA 3IKMA 2AGOA 4KI4A 3GONA 4DR5J 5HANA 2V8HA 4QZVB 3RRGA 2O8FA 3OYLA 1F9FA 2KHDA 1NLKL 1OWXA 3AJ2A 2O4GA 1RTHA 5HAOA 2MY7A 3LWLA 3RU0A 4FL9A 3HT0A 1J5EK 3CVKA 3DYAA 4WTOB 1G15A 4LF6F 3QFWA 3POTA 5HLFA 2DHXA 3CJ8A 2OPRB 1S1TA 1SH3A 1ELOA 2PI5A 1S7HA 1PYOB 1BD6A 1QDUB 3HM9A 4QWEA 4DR4J 2LECA 5E2QA 2NXJA 2J6TA 2RH3A 3QBXA 1S0NA 2OPPA 2UVUA 5K9FA 3ETMA 4X4QA 2VOOA 2K2PA 2AGQA 1F5BA 1U1MA 1ATSA 2K7JA 1X31C 4C2MA 4U8VA 3ATUA 2BTFA 3DXKB 1F5AA 4L8RB 1R3NA 3EGNA 1FRKA 4C8ZA 2XLJA 1IM4A 4ILRA 2FY8A 2B0GA 1S9FA 4KGKA 4B9TA 3MM6B 4A8MP 3BR9A 3KK7A 1REGX 2CUYA 2UUCF 1ZC6A 3TVZA 3J81O 2CQBA 5EX3A 3ID8A 4DV5K 2QT7A 4X65F 4NLWA 3CCZA 2E1CA 2HBZB 5K5MA 1I51B 3LP2A 3FFKB 2UXDJ 1HJOA 4ZIWA 1JNRB 3C16B 2XBPA 2GWKA 5DK5A 5LT5A 5AFUA 3K0SA 2WAQD 2W25A 5JMNA 5BREA 2F7VA 1CJUB 3CD7A 3TA0A 3M8YA 5GAGI 5AQLA 5EY4A 1ZZNA 3ICLA 4V19S 4HTUA 2MQQA 2ALZA 3K9KA 4IG3B 3TO8A 3OFHA 2KFZA 3CMES 3CC2N 1MA9B 3MTJA 1N33K 2GMHA 1XMOF 2Z1GA 3E2EA 2EHGA 4W5OA 3EE9A 4H8KA 3KHYA 3D7SB 1VQNN 2GIQA 4J5OA 5JLHA 2U1AA 2D3OR 3B4MA 1RWMB 5E3QA 4FJIA 4AE5A 1HWLA 2B6AB 4LREA 5AQTA 4MYTA 4MDBA 3UE2A 5HBMB 2ASMA 4EFHA 2EC2A 1BQMA 1CJTB 4IFYA 1Q82O 4NA2A 4ALZA 2EK6A 3BF4A 4DU7A 2NZ4A 3LP0B 1RDUA 5KI6A 3F2KA 1H0HB 5ITHA 2J9DE 2X1FA 4K59A 5HRNA 2QWPA 4RCHA 2Z1JA 3FMWA 4HHUA 3M1VA 3N4PA 3UWTA 1UEKA 4P2SA 4PXBA 1HNZK 2VQFF 3QETA 4DUZJ 1ZBTA 3GE1A 5M2PA 5K8OA 4CLZA 3HZ6A 5KT3A 1SC1B 2P9UA 2RN2A 1BWVA 4CJWA 5IM0A 1X4CA 2CNKB 1CEZA 3IS9A 3EMTA 5BYQA 4JKEA 2BBEA 3QEVA 5I42B 2W7AA 1KFDA 4IZ9A 2OD4A 4X4NA 3VF6A 3VAFA 2C42A 3VGVA 4X66K 1NSKL 3A13A 1KP6A 3H1QA 3N4QA 3MCSA 4YDXA 5GIOA 5A76A 1G6BA 3MMAB 3NCIA 3M3ZA 2DY1A 3ZSXA 2XHWA 3AODA 3DRXA 1UWAA 1HFEL 3QEWA 4B3RJ 1DGKN 2CPJA 5KRTA 2YH0A 2O01C 3L2WA 3DNCA 2DR7A 2BE7D 3CB4A 1AUSL 2IVNA 3NWGA 5L1JA 1XNQK 5HMYA 4OJGA 2RPIA 1C0FA 2BX6A 1I94K 1RDWX 3R9LA 3PZPA 4RUAA 1QSYA 4URQU 4AXJA 1ZA2B 4MO4A 3C66A 2J0XA 2YWFA 3W60A 4X64J 3LTOA 2ITGA 4ZVEA 2NZTA 1GK8A 2CRLA 2O8DB 3OR2B 3FE1A 1HMVA 3GCWP 1RGVA 2VBZA 3QT5A 2B3TB 3KG0A 1HQ2A 1PC5A 2HQDA 4KH6A 3AAWB 4FW1A 2KTQA 3THTA 1MN9A 4L76A 1YBTA 3HSGA 4OYIA 4JI5K 1R0BG 1IJJA 1Q86T 1MN7A 4DV1J 4I2QA 4J9SA 2JC1A 4EEYA 3K5PA 2RU9A 3M2UB 2EWSA 1RHMB 3B6BA 4M3UA 4DWIA 1WHVA 4JD2A 3VA0A 3EVOA 2O4IA 4DR7K 2J7UA 1CULB 2XMVA 2EG2A 2X1BA 3HPOA 2XLKA 1Y9OA 4K5RA 3RG6A 2CG4A 4A47A 3DWLA 2CQ2A 4RNOA 4G1QB 4CHQA 1FX2A 3K2PA 4I0WA 4O55A 4ANDA 4UOGA 3NS7B 4JI1F 2ZJPL 3NH1A 1T95A 4MK8A 4V19J 4CF0A 3B6PA 1B0TA 2MKJA 1DQAA 1PBUA 3SQ4A 1U0SA 2RQMA 4XK8C 2F8HA 4I64A 2AIRB 3O9SA 2PT0A 1WHYA 1T3NA 1J9AA 4ECVA 4EI2A 2W9CA 3CCLS 3HFZB 3V1RA 4FYYB 4NLYA 4PKDB 1NM2A 2FLNA 4RW8B 4KHUA 3QERA 3BO2A 1ZBUA 4CT8A 4A2BA 2P2CB 4RR5A 4JKCA 3H4DA 4OLBA 5EX0A 5DLFA 4I9LA 4BR0A 4M45A 5AQQA 3D2FA 3GL1A 4TY8B 1I6JA 3PIOQ 2KG1A 3OYHA 2Y0SD 1XNRK 3CD5A 1OPIA 2R8HA 2BDPA 2NS1B 2RAQA 2BJDA 8AT1B 4N77A 2IYIA 2R7QA 5AQUA 3I5CA 1VQKN 3GB0A 3UNYA 4NLOA 2VYPA 1UAXA 5GADP 1FNMA 5KT6A 2A6OA 1FFGB 1R59O 1VQPN 3GR1A 4YHHK 5AQFA 3DU5A 3D67A 2AP1A 4WU2A 3VQCA 1OY9A 2N3LA 3L7UA 3M6WA 3GOIA 2RF2A 1SKUB 2AJ2A 3MCAB 1REVA 2W2OP 5CABA 1Z4UA 2ZUGA 3S1TA 2K7KA 2UUTA 3PYGA 2BE2A 1QZ5A 2OFHX 4FW2A 1WKLA 2B9YA 5IV4A 4JEPA 2YKPA 3VQEA 4HI1A 2X6NA 2QWRA 5LJ5Y 4AUKA 1QUVA 3GU0A 3FSIA 1QVFR 3CC7N 1VJWA 1W0HA 1KLMB 3MN7A 3BN7A 4KKOB 2EBEA 2BXJA 1PYTA 2LU2A 3OVSA 4YOYA 1YX2A 1V5IB 1UAWA 2NXEA 5C2CA 4J37A 1R0AA 2H3EB 2QLBB 4HHTA 4WYBA 5FPDA 2G0CA 3VV2B 3N5BA 4ZS6A 3BEGB 1RTDA 3HHLC 1IM6A 1YTAA 1MG7A 4RWTA 3BB5A 2LQ5A 3ET6A 3PW7A 3TR5A 2J9DA 3FQKA 2PMHA 4LRFA 1VDHA 2L41A 4KGXB 5AXLA 4B3OB 1RA7A 2AEJA 4BRHA 1WC6A 2HAFA 2I9SA 5H9FK 3MWTA 1VJQA 1P9QC 5DLGA 3MMBA 2W4DA 1K44A 1VISA 3DRPA 2XB2D 4OJRA 3BSCA 3DGPA 3X3UA 3PRDA 4J2EA 4QWDA 4FLUA 4ECZA 3EXCX 3VVTA 3P49B 3RVCA 2W6KA 2DTUA 4ECSA 2HYIB 4UW2A 3GDQA 2OPSB 3TP2A 5BPNA 4AL7A 3SQOP 1LFPA 2LDYA 5HSPA 3BQ2A 4KHRA 2E7VA 2QX0A 2UUAK 5JJBA 3BGFA 2E1PA 1RQ0A 2NRVA 2XULA 3L2QA 4JI3J 1RBOB 4CI6A 3SK3A 3DLEA 3O8MA 4NCGA 4A8SA 3LGNA 1L5UA 1T9WA 1X9MA 3UDEA 4KV8B 3VR1A 2CJ9A 2FZGB 3D3BJ 3TA2A 2MJUA 1HLWA 4M5DB 1YWXA 5GMEA 4CI0B 3HFVA 3AOBA 3EPIA 3O08A 2Z58B 2G2YA 3MZIA 4H4MA 1FCAA 3EDRB 2HBKA 2E8AA 2QSFA 3QIPA 4BRIA 4DR3K 4CECA 1N4LA 4IG0B 3GR0A 4Z4EA 5HQMA 2H1YA 5DRKA 1S1XB 2WCXA 3TOQA 3C6UB 3K5NA 3Q83A 4BDYA 4NASA 3FMBA 4CGDA 1XMQF 3M5RA 2NYHA 4C8NA 2QA4S 1WJ9A 1R8AA 2GHPA 3ZYYX 1DQ9A 2MKHA 5THWA 3OLAA 1D3WA 4NXMJ 3V6HA 4CFBA 3O5TB 3ENOA 2JC0A 1QAYA 4CJQA 3M8QB 4USUA 1HBNA 4O0JA 4JI4K 2DNZA 3RZAA 4ZLLA 5G0RB 1N5VA 3CMAS 1DEJA 1BL3A 2AEFA 1FTCA 2FLLA 4ILMA 2IMOA 5CZXA 3L09A 2BR0A 3ZZTA 1JLBA 3G25A 3QWUA 3P31A 4FN5A 2GS8A 2YKQA 4NMLA 5F3ZA 1KVCA 3LWMA 4EO8A 4OX9J 5GAEU 4HH1A 3TAMB 4LD0A 3H59A 1FEHA 1DAXA 2DPIA 2ZQBA 1U47A 1YJ9N 4WFBQ 4NE9C 3PR4A 1FVSA 1X5PA 4Q8FA 3UE5A 4K25A 4I7FB 1BQNA 1FRJA 1JJ2M 2K3KA 1Q82T 1TK0A 4W5RA 3VMFB 4HL9A 3P4UB 3HSZA 4JI7F 3Q2SC 1RYRA 3ZX0A 4CEFA 3AGRA 2UUWA 1J27A 1XN9A 3O44A 1NDLA 3UCGA 1LWCB 1HLUA 1L3UA 2WFBA 3MM7B 1HQEB 3H98A 2CJQA 3SCIE 3D6MB 3O9QA 3RBEA 5F8MA 1M5PC 2EG1A 4N7TA 3ISNC 1RBTA 3ZCMA 4DR1K 7AT1B 3N6LA 1S5ZA 2R2RA 3S6EA 2JNJA 2PYLA 1YITS 1WSHA 1DKGD 1CZBA 3VQ5A 4RW9B 2CQIA 4AYBD 1SIWB 3N0VA 4OHXA 3DRYA 4WQ4A 4UUXA 4OX7A 1QZ6A 3LAMA 3HD2A 2F9WA 1BA0A 3ILIA 3J7YI 3OD2A 1Z2ZA 3CMQA 2EC0A 4XDCA 4PAAA 5C25B 4PABA 5AJ3F 3KG4A 3H2LA 1SC4B 4Q2LA 4YY3J 1A5VA 1VSMA 2UV8G 2DPNA 1U1PA 1UPMB 4B1YB 4E1JA 4J9OA 2DR8A 2D5RA 3C3LA 3G8SA 3W3SA 4LF6K 2YNIA 3PTWA 3OFGA 3I55S 4DV4J 4BG8A 2QTDA 3PO4A 2EX3A 1YI2N 2QYGA 2YPYA 1WSVA 5E0OA 2KHCA 1K47A 2QK9A 2P9KA 1DARA 4RW6B 1Q81O 2O8BA 1RTJA 3D0HE 4FLXA 1YGYA 3MXMA 4JI7J 2R7XA 1PBAA 1SCJB 1EP4A 1IQTA 4DCJB 4B3TJ 1X1PA 4X2BA 3RGIA 1RE1B 3PIPL 2K1RB 1R8PA 5CCLA 4FJ5A 2NRRA 4ZPVR 1FRIA 2EPIA 4ITSA 2YWKA 3UDLA 3LM2A 4CERA 2MGZB 4FZYA 4FK2A 3MFIA 2DJWA 4LFAF 2KJVA 4JV0A 3P6YC 3QFPA 1G2EA 2QGFB 4ECYA 3GLJA 2JWNA 4DJBA 4EBCA 4C8OA 2UUCK 3BGUA 3WIVA 1Q7LB 1JLEB 1HR0F 3QRPA 2DRAA 1RTIB 4X65K 5BR8F 2J6UA 4PQUB 3AJ1A 3ZSRA 4OHVA 4BC5A 1QS4A 1GLBG 1SXLA 4YDDB 4RNFA 3AA5X 3LPEA 2GUIA 3FZFA 2VL1A 2KT3A 2Z2YB 2OTJN 2W9BB 3VAIA 1W25A 3AO3A 1J2VA 2NRXA 1H2UX 3F44A 5IT9O 1Y97A 2BQUA 1UJ4A 2UUBF 3VEZA 1X60A 2YQ0A 5HROB 3W61A 3NVKA 5M1FA 2M8HA 4CIOA 1C4AA 1TL7B 2M70A 2NNWA 5T7LB 3Q7CA 1EQ0A 1NK6A 1S1VB 1XMOK 4USMA 1H73A 2QRRA 1NSQA 1K8KB 3OPKA 2ASDA 2KVIA 2A42A 4M5MA 1ZM4A 3TJAA 1Q8IA 3TSQA 3SAFA 2RDDA 1FNXH 1CVJA 1FXLA 2HBQB 3S3MA 2BV3A 2DRDA 3AA9A 2JRSA 1WI8A 5A6PA 2HLUA 1SV5B 3IUCA 4LF9F 4AHRA 2MKKA 4KAIA 3WDOA 1K0VA 5K8MA 3HRGA 1GXUA 5KFDA 3C6TA 4WE1B 1LWFB 3IRWP 2XSFA 3SCJE 1FERA 1TL3A 2NRHA 3HSCA 1NM1A 1SL1A 3P45B 5AQZA 4OVLA 3ZETB 4QW9A 2VQFK 3WUHA 4ECUA 3JSRA 3KD5E 2P5OA 3EXYA 3PEJA 3GJQB 2GX9A 4G3IA 4DTJA 3CCVN 3DXSX 3ZT3A 2B4JA 4LIWA 2QV6A 5DETA 1URNA 3ALYA 5HLFB 4I2PA 2WBRA 3D68A 3DRRA 2P51A 4JBCA 3ZZUA 1HD0A 3CJ2A 1D9FA 2QMXA 5M1KA 4KC5A 4NLTA 1NDCA 1RDBA 1Q8BA 3LO3A 1RT5A 2RQCA 1UVIA 3T1HJ 4OX8A 2XZTB 1WDDA 4C0BA 2FVQA 4PKHA 2BMBA 3HHEA 4OHYA 4DPXA 3SUPA 5IXUA 2NPFA 1U1OA 2DISA 2BW2A 4ZJOA 5HMXA 3SMSA 4PG7A 2KM8B 3JXOA 2ZC4A 4J9NA 3R1LA 1JKHA 5U47A 5JICA 2IC3A 3A4TA 3PW0A 3JS9A 2ERRA 4ZVHA 4FM1A 2HBMA 4C0HA 2HHVA 1GLEG 1WEZA 1TKDA 3EGZA 1C0MA 1MWZA 3TJ9A 3T1YF 5AZJA 1E6VA 4A61A 2XI2A 2IFXA 1MNEA 4O3NA 1W2BR 1U2VA 5AQSA 3LP2B 2X3GA 2HWTA 5L1KA 5ETOA 1OH8A 2ZZTA 2PYJA 4O5BA 1QM9A 2B8PA 5HJXA 2P9GA 4CJ3A 4UZBA 2DGSA 1KFSA 3NAIA 4U7BA 5L9NA 4DR2J 3Q8YA 3MM5B 2ZBCA 1YJ7A 2OP5A 2RQ4A 3HM8A 1K9MO 4XDDA 1HBOA 2HHQA 5AE2A 5DGBA 3PYDA 4NPOA 1RT7B 1B0VA 3A3PB 4H5WA 1QHAA 1TYQA 5DZ7A 2WB1D 2CJXB 1S97A 1D8ZA 4RBTA 1FKAF 3M6GA 4OIXA 3IAYA 4FF4A 4DF4A 5FJ4A 4EIAA 4AHSA 3DOLA 1S5JA 2CAJA 1BQMB 4WFXA 4JI1K 2Z8QA 1YG0A 1S22A 2A3JA 4F9OA 4FYXB 4EYHB 2QWMA 5EWGA 3KKSA 1YJWN 3BGRA 4UQTA 1UVJA 1VQ9S 3PRBA 1L3SA 1EAYC 1NGCA 2CVIA 2LFVA 2OA8A 3E3XA 2LKZA 2M8DB 3E01B 1S49A 1H72C 4CWBA 3A1YG 4CJTA 3KOAA 1UVMA 1FFWB 3KK3A 3IWLA 3WC0A 2P9UB 3CJ9A 5IM0B 3MX2A 2FLPA 4AD6A 3AO4A 3R6MA 3OL8A 3RBZA 4WK3A 3PKMA 1T94A 3AD7C 1NWKA 1GTEA 4AHVA 5KT2A 3T19A 4FNHA 5C24A 5LM7E 3CCMS 2KHOA 4C3KA 2YX4A 2CQ0A 3MEEA 3TPQA 3ULEB 3ZC4A 4ES1A 5F0WA 2AMCB 3A8YA 1YRTA 2MYFA 3OXLA 4LRAA 4IO9Q 4LF4F 1ASUA 3VAHA 5JMVA 3F9KA 2QC3A 3OTBA 3THVA 3L4QA 3OYAA 5LMUJ 3HI0A 3NH0A 5HVFA 4UOHA 4JHDA 3R5BA 1WOSA 4DSFA 4ES3A 4KTQA 3TNVA 4M1KA 1OYDA 1RWUA 4FJ8A 4JI6K 2XYPB 4CEOA 3ZLJA 5GMDA 4JKGA 1XWLA 2UXCJ 1QVGR 4O44B 3VZIA 2M88A 2UZAA 4CJ5A 4BRKA 3C95A 2YKMB 1P1LA 1NK0A 1S4FA 1KVAA 4H0PA 3KK2A 1AFIA 1NZAA 3I32A 3H3OB 1OYEA 2KQ2A 2XYHB 2YTCA 2W8KA 1VQ7S 4Z4CA 1TU0B 1P27B 1XBWA 4X4PA 2D3ZA 3THWA 2NSCA 4NRTA 2GMJA 2QEXS 1FK9A 2QA1A 4DFJA 2RS2A 3ZT2A 1F60B 1B3TA 4JD2B 2FLOA 3HKWA 3CCLN 4CE9A 4PHTX 2VGNA 4DL5A 2BJ8A 4URGA 4FYVB 2LU1A 4L72B 1N5QA 3MWBA 4IDKA 4Z4GA 3GSIA 3T6BA 2HZVA 2L3MA 3TZXA 1BO5O 4ANCA 1B70B 3SDEB 5B0DA 4F04B 1XHZA 5B7WA 3U3YA 2D9PA 5BPLA 4CZGA 2G1HA 4F26A 4FNIA 1VSKA 2RE2A 1RBUA 3TU5A 2VBXA 3FRYA 2GVDB 4FVMA 4H5NA 4FPBA 3K5MA 4KT0C 3RAXA 3R9PA 2B4PA 4LF2A 4BACA 1GNKA 4W5TA 1UWBA 3PXGa 4DTSA 4OHWA 4O0IA 1Q81T 3KMSA 3O4WA 2Z56B 1KAZA 4OLOA 1Y10A 4DXLA 3J80O 4NYPA 3WX4A 3BF3A 2YNFA 4OJ3A 3GBTA 2XI3A 3T69A 2FTRA 1U2RA 5CA5A 3N79A 2V4JA 3L2UA 1MWKA 3VALA 2IBKA 3CM5A 2CNOB 5E3AA 4X62J 3OFEA 2HRUA 3NXZA 2LXIA 3VAMA 4CW7B 1Q9XA 3BQ1A 3SI6A 3SSQA 2I5JB 2H65B 2RNEA 3THXA 3DMJB 2B9WA 1XMQK 1O8BA 3BDPA 1TAQA 4CZCA 1TKTB 4IOXA 3RW6A 1BWFO 4JI0J 4ZPBA 1GMUA 1Q0NA 3OFFA 1GLCG 3CFRA 4Z4FA 4H4KC 3R2CJ 5C42A 3MDQA 3OHRA 2ZJRQ 4CHOA 1S6OA 3O4QA 1N36J 1T3OA 2QXLA 2GW8A 4DCOB 3O80A 3M6VA 1QUPA 4HVZA 1P90A 2KRBA 4U7UK 4FKYA 1R8HA 4TLQA 3PW4A 1HIYA 2F4VF 2DGQA 1R0AB 3LOUA 3OQ2A 2MY8A 2QWLA 1HPZA 1RAIB 2FF6A 1CXQA 2MJNA 4WP3A 3G86A 3SUNA 2VV5A 1VQLS 2NR0A 5A8RA 2N4DA 3RRKA 4BBYA 3KJVB 3NF9A 2R7SA 1HQUA 4LUBA 4OPAA 3VGSA 3A3NB 5GAEI 1QQMA 4WFAQ 4B3MF 1JLFA 2IGIA 2A40A 5FPMA 1RKIA 3PV8A 3HL8A 1C0TA 2RJZA 2HS4A 4ISEA 3MMBB 5LMNF 4Y1CA 2OMOA 3DRPB 2R8KA 1OY6A 3AD9C 3O6WA 1FRLA 3GIIA 3LDQA 4IYQA 3C6AA 4ZDNA 4CF9A 2HFNA 2V7ZA 4KBIA 1JJHA 2YCHA 5HRSA 4J2DA 2KB2A 1VQ4S 5F0UA 3PHTA 3IBWA 1OH6A 3SQGA 4BVOA 3O3HA 4ECWA 3EYZA 4QWBA 5AZIA 3EKUA 1TELA 4WF9Q 2JEGA 2H48B 1ROFA 2HHHJ 1KC8O 1K1QA 3B8AX 2E6LA 4Y0WA 3ZZZA 1HWKA 2PEHA 2WZ1A 2FJBB 3SBGA 3DLEB 4DV0F 4NCGB 4KB1A 4ED8A 1HBUB 5BRFA 4E3SA 4RL1A 5AJ3K 4AHCA 2FXUA 4WFNQ 1GLDG 1C0UA 4OKEA 3DAWA 3P5TL 4F4KA 1NG9A 3R8YA 2FBXA 1RT1A 3VETA 3M9NB 1AZSB 1XHXA 2LEBA 1LK7A 3CMAN 3G4SS 1VMBA 2V4QA 5JS2A 2GELA 5DMRA 5C2DA 3NS5A 4FVCA 1KVKA 2RUSA 4PXDA 1IV0A 2E1ZA 3PW5A 2C22A 2F9DA 1NPKA 4PKIA 4QYZK 4ZHRB 2P9PA 5BN9A 3V6JA 4Q8EA 3G8TA 2XY7A 2CG8A 3HZGA 4FF2A 1VQOS 5EXWA 3W3DA 2JEJA 4KHMA 2RHSB 1F3FA 4XH5A 4J9RA 4ZVPB 3AY9A 4LFBF 5EOYA 3UDVA 3TJ8A 4CBXA 1KKHA 1IBLF 3GYXB 2GGPB 2KZMA 3G8QA 3AB4B 4CZKA 4XO0A 1BI4B 4DQPA 1HBNB 1DTTB 3JSMA 4LFAK 4F50A 1DLOB 1YVUA 3U9ZA 1UW9A 2BOPA 4MDAA 2F40A 3W9HA 1KSPA 4KYZA 1K9MT 1HR0K 3ZZ0A 2WVCA 2HBJA 1CZ9A 5BR8K 4DV7J 4CZFA 3CJAA 1NGJA 4XH1A 1Q7YO 2VONA 3HTVA 4DV0J 4WZQA 3TW0A 4CCHA 1LW2B 3V6DA 1VGYA 2YKNA 3BKUA 4Y1DA 3TUPA 3IGNA 2UUBK 4PL7A 3VERA 2AV5A 1KQGB 2Y3YA 1R8CA 4GKJF 1J53A 2KT2A 3O8WA 4RLEA 1FJ7A 2WVBA 4CGJA 2RILA 3ADAC 4NWBA 3MECB 2KLAA 4AILC 1VK3A 3GIJA 2AT1B 1S9GA 2PA8D 1IJEB 3IRXA 4USTA 3OYIA 3EGVA 3KWMA 5B0CA 3I55N 5IC4B 2FUG9 2R9LA 4DI6A 3R3TA 1RILA 2QWOA 4LF9K 2NSBA 3KDNA 2JLEA 2XS7A 3KIOA 3NCRA 1VQSA 3K7RA 1V5VA 1NK7A 2B56A 2FJEB 1WEYA 3NKYA 5EWFA 3OL6A 3DLKA 3L3CA 2HGNA 2J4RA 2ZGYA 3ENBA 5T41A 1U48A 2ZHBA 2I1RA 3PHEA 2HVEA 2HQ3A 2YHBA 4P2XA 3AO2A 3QINA 4LC9B 1X5OA 3QEPA 4JKHA 3DLRA 5LL6Z 5AR0A 1CJVB 3PJXA 2KT5A 4MT1A 4NI2B 2V69A 2GQCA 3HI9A 2ZD1B 3CQXA 3W65A 2BJ7A 3D6HB 2DCLA 3AVNA 1NO8A 2IA0A 2AGPA 2CADA 2UXBF 1B0PA 1BC6A 2VIHA 5M2UA 4XPCA 1JJCB 1KWMA 2ZFHA 4HTJA 2BKOA 3NGZA 4BR7A 1RTJB 3PIOL 5FPNA 2E5LF 2WBNA 3BEXA 4GKJJ 3MEGB 4TQSA 1X4FA 2F63A 2V0NA 4C23A 4N47A 1NU0A 4KPCA 3DXKA 3N28A 6FDRA 3CERA 4PYAA 4FWPA 3L3UA 1WELA 2VQEF 1FJGJ 3H5UA 3C8YA 5KFRA 3MM6A 3QESA 2XNQA 2KM8C 3T1YK 1S57A 4HHHA 4ELTA 2J76E 4FOEA 2CQHA 4CZHA 4H0YB 3C16A 5D4NA 4DTXA 1CJUA 1NK5A 3K57A 2HQGA 4KQZA 1SL2A 1T9XA 2BUNA 2KYZA 5D4OA 3J8AA 4JYAJ 3CSKA 1FVQA 5HP1B 4WFZA 3OS2A 8ATCB 4PR6A 4LF5J 4IG3A 4NLXA 5KFVA 2IM1A 3AVKA 3GJSB 3LDLA 1SIZA 3SJJA 3CIPA 2P9NB 2EKNA 2OPQB 3ZX3A 4MKAA 3D6TB 3QICA 1EX4A 1QAXA 4K4UA 1KD1O 3CJ0A 1Z1ZA 2AJ4A 4FLVA 4HKQA 3D2EA 1CXUA 1NNDA 4UTGA 4F36A 4FBUA 4RW7A 5FDLB 2ILZA 1A5XA 3OYMA 3G6YA 2YNHB 1CJTA 1HYSB 1EKRA 4WYLA 4DFPA 1AFJA 5F0XA 5BRDA 3LP0A 4Q43A 1N34F 2B4OA 2XMJA 3J7Z5 3PFEA 4OZNA 2MKIA 4Z4HA 1LOTB 4J8FA 2CJKA 2DNLA 3WHIA 4GNIA 2W6LA 1DZ5A 1ATNA 5JLFA 2Z0GA 1SBRA 1JXVA 1FJCA 2FBVA 4BRFA 3CC2S 3IR6B 5B0AA 2RB7A 2KKHA 4R8UA 2QW9A