1S1TA

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with uc-781
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
541
structure length
533
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 150
structure length 533
sequence length 541
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1tA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1tA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1tA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1tA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s1tA05
1S1WA 3C6UB 4CIFA 3LWLA 4I2PA 1LWFB 4CJTA 4KPYA 2HNYB 2W8KA 4K8ZA 3OSPA 4J2DA 1JLAB 4DL2A 5CZ2A 1SL1A 1Q9XA 1NKCA 2IGIA 4W5TA 4R5PB 2GUIA 4LSNA 3OS2A 3V9ZA 1EP4B 3RRGA 3V6HA 4NLOA 3GIMA 4J9MA 3CQ8A 3KTQA 4WFYA 1U49A 3OYCA 1NHVA 1RDAA 3FFIB 2B43A 3C6TB 4YFUA 2XCPA 3RR8A 5DLGA 1LWCA 3VQPA 3KLFB 2BANA 4QW9A 1ZBLA 4QWBA 3JYTB 1C1CB 3I5AA 3O3HA 1D8YA 4FJHA 1DTTB 5FDLA 3PX6A 4H8KA 4O3RA 3QIDA 4IG3A 2HNZB 4YMEA 2UVWA 4AHVA 1SKSA 1W0HA 1VSIA 1F21A 4MK9A 3KOAA 3AVGA 4OGEA 4QAGA 3N6MA 4F4KA 5KFNA 4AILC 3RMBA 2JGUA 4O5BA 1KFSA 3T5KA 2BQRA 2XC9A 4FXDA 3V6DB 5HP1B 2VG7A 4RNOA 3TAQA 1TK5A 5HRSA 3RB0A 1R0AB 3G10A 4PY5A 4B8AB 5L1JA 1S6PA 2FLNA 3GILA 3QEVA 4IG0A 5C24B 4NLUA 4O3SA 4BWJA 1Z4UA 5KI6A 5KG4A 4Z4IA 3QO9A 4K4ZA 1GOAA 4YNQA 3LWMA 5EUHA 1VK0A 2WCXA 4MIAA 1ZBIA 1XHZA 1IKWA 4KV8A 3OHAA 2HVHA 4E7JA 5C25B 3I0SB 3CO9A 3KK3A 2AGOA 4PQUB 3FSIA 3LP1B 3SUOA 3VQ5A 4PWDA 3T5JA 3WNHA 1Q9YA 2E6LA 1TL1B 4L8RB 1IKXA 1BQMB 3ZSYA 3PW2A 5C42B 2WTFA 2C2DA 3K59A 4DFKA 1LAVA 2VG5A 1J53A 1S1WB 4I2PB 3LZJA 1K1SA 2XWYA 1XWLA 4KKOA 2OPPA 4G1QA 2XRIA 3LAKA 4WZQA 1HMVA 2YKMA 4CJSA 3EPIA 4CEFA 3IG1A 1LAWA 4CK1A 4HYKA 4EZ9A 1NK6A 4DTSA 4TSXA 2IMWP 3KD5E 1NOYA 2QE5A 4M45A 4N5SA 3DLGA 3RWUA 3BSCA 2WHOA 3DLEA 1LWCB 2JLEA 3ITHA 4EO6A 3ZT3A 1SH0A 1D5AA 2C2EA 2FLLA 1WSJA 5KFXA 3OL8A 2RF2A 1QQCA 4RZRA 3PZPA 2BQ3A 4ECTA 2R7YA 3QEWA 2B5JA 5FDLB 1HNVB 1L3SA 5KFHA 2PY5A 1HPZB 4B08A 2FVSA 5F8JA 3JSMA 1TKTB 3AVCA 4CE9A 4FJJA 5KFJA 2Y1JA 4IFYA 3OYLA 4Y34A 3ZSRA 4Q0BA 3CJ2A 3GV7B 2PYLA 3NHGA 1BISA 3CDUA 3PV8A 1I39A 4LY7A 4RG8A 4E19A 2VG7B 2UUWA 1WAFA 4JRQA 4FLTA 1KVAA 5HBMA 1S6PB 2V4QA 1CSJA 4IG0B 2FJXA 4M3RA 3DRSA 2FBXA 3QO9B 3DMJA 4ELTA 3DOLA 1IKWB 4KV8B 3P83D 4CK3A 3IAYA 3NAEA 3QESA 4WXOA 1YTAA 2J6SA 3KK3B 4CJFA 4CGJA 1QAIA 3V6JA 3RBDA 2ITGA 3OLAA 3M8PA 1WAJA 1U4BA 3LDSA 3LP3A 4CGGA 4PWDB 2YHAA 3H5UA 5EWGA 2IC3A 3CIZA 4MK8A 3V4IA 2ILZA 3Q8SB 4NRTA 2HHWA 3H5YA 4DF8A 2VG6A 2O5DA 4DTRA 5KGWA 5JS2A 4TY8A 5HRRA 2A1SA 1WSFA 4K4YA 2VG5B 2ZQBA 3PHEA 3VQAA 4B3OA 5KFTA 1D1UA 4RNHA 4KKOB 3TAPA 4OGCA 2OPPB 3S3OA 1S48A 4G1QB 3RMCA 4Y3CA 3BSAA 1HMVB 4DU4A 1SL0A 2DPIA 2YKMB 1QAJA 3FQKA 4MKAA 3VQ9A 1IG9A 1C0UA 3IG1B 3PJXA 1C6VA 2HHSA 4EP5A 3SFUA 3BQ0A 3TQ1A 1HJRA 3OL9A 1N6QA 5F8LA 2DY4A 2F8SA 4ECQA 2V4RA 3ICLA 4TYAA 4KRFA 4FJ8A 4M3XA 3NCIA 4NCAA 3DLGB 4FW2A 2HHUA 4EYIB 1JL2A 3ZSVA 2V0NA 3PR4A 3TVKA 3T5HA 4ECUA 1TAQA 1SH2A 2EC0A 1SUQA 3ITHB 2IM0A 2ZE2A 4F8RA 5CYMA 2ETJA 2JEJA 4K4WA 4ECSA 3ZT0A 4AHCA 2RF2B 3DLBA 4ZHRA 2X6NA 3BR9A 1BGXT 3OYHA 3K58A 2B5JB 2X74A 2VA3A 3TABA 3QGIA 1RT3A 5KFOA 3IRXA 3AVMA 1SV5A 4M94A 2IS3A 3F73A 3QLHB 4O44A 4CEQA 4E7HA 3EYZA 1RBSA 4IFYB 3MTKA 3V9UA 4IBNA 3HK2A 4Q0BB 4RNNA 3AVJA 1TKDA 5L1LA 3OS1A 2YNHA 3M8QA 2HHXA 4O0JA 4KI6A 3TI0A 4FS2A 4J2AA 4CJ3A 5F9LA 2B4JA 1C1BA 1BQNA 2P5GA 2KTQA 5HBMB 1QS4A 4IKAA 1RYRA 4KHUA 3T19A 4MH8A 3M9OB 1NKBA 4ZP6A 1XR6A 3DRSB 4O3QA 5E41A 3DOLB 1S5JA 4C8LA 2G8VA 3CVKA 2R8KA 1TK0A 2OPQA 3HJFA 4TYBA 5KRTA 3L8BA 3DLKA 1XR7A 5DG8A 1GX6A 3VQBA 2IAJA 2KW4A 3M8PB 4TLRA 3NE6A 2BRLA 1XHXA 2IC3B 1T05A 1YVFA 4DQQA 3V4IB 1MU2A 4RU9A 3QEXA 3FRZA 4FBUA 1RILA 2VG6B 3DM2B 1LWFA 3IS9A 4TY8B 4CJRA 1TV6A 2HNYA 4AHRA 1X9SA 3CWJA 5F8MA 4CF0A 2BRKA 3O3FA 3MAQA 1Q8IA 1FXXA 3HVRA 3V1QA 4B3OB 3H2LA 1LWEA 4CIGA 2XY6A 1D9FA 1ASVA 3AVAA 4HCCA 3KD1E 1GOBA 1N6QB 4DF4A 1TQLA 2YKNA 3RRHA 4CERA 3DOKA 1BL3A 2OPRA 4QOZB 5KFYA 1N56A 3O3GA 1U04A 4E3SA 1HYZA 3AV9A 1JLCA 1RA6A 4CEAA 4ZP7A 4X2BA 1A5XA 1DTTA 1S4FA 5DG9A 2QXFA 1SH3A 3S3NA 4IRCA 5CYMB 4MQ3A 4FJ5A 4ZMMA 3VQQA 3L2UA 2Z1IA 3KHHA 1T3NA 4ZHRB 4F2RA 3RMAA 3Q8PB 1BHLA 4FZZA 4CGHA 3MF5A 5J1EA 1RCHA 4DG1A 1RT3B 3T5LA 3AA5X 2G8KA 3IRXB 1SV5B 2IM3A 5KG6A 4Z0UA 1TL3B 3SV4A 4O44B 3AVHA 3KLVA 1VRUA 2HHTA 2KZZA 2BGGA 3OL6A 1LW0A 5KT2A 4IH5A 2YNHB 3M8QB 2AGPA 1UA0A 5KG3A 3QNNA 3O4NA 3KK2A 4NCGB 2QKBA 1C1BB 1BQNB 3KIOA 4FK4A 5KFMA 2I5JA 5C25A 1S0NA 4M41A 4O4GA 4DL6A 3NH2A 1TVRA 1I6JA 3HVWA 4CF9A 3LP1A 4HHTA 1WLJA 1C1AA 5L9XA 4YR3A 4DSJA 3DI6A 4CJPA 4NLGA 1RT1A 5KFVA 1X9WA 4XPEA 4K8XA 3V9XA 2RN2A 3DLKB 4M3UA 2IAJB 2CJQA 2RPIA 3DDKA 4W5OA 5DLFA 3AO1A 4DTJA 1T05B 3LPUA 1MU2B 5KFEA 4NYFA 3SZ2A 4DSLA 3IS9B 2ILYA 4HUGA 1TV6B 4KTQA 5F9NA 4B9UA 4FM1A 2XY8A 1I3AA 1ZTTA 4ECZA 4DS4A 4F3OA 2R2TA 5F8IA 4NZ0A 1LWEB 3MECA 3SFGA 5KT6A 3KNAA 3SUPA 3OSNA 4HCBA 3WNFA 1TK8A 3QIOA 3P1GA 4DTNA 1KCFA 5K14B 2GBZA 3G6YA 1C0MA 5SWMA 5DQHA 2J6UA 1CXUA 2HVIA 3HVAA 3KHGA 5KFFA 5DG7A 4CHPA 4DFPA 1IKVB 3OYDA 2HMIA 2YKNB 1HYVA 4R8UA 4H54A 3UDLA 4IR9A 3DOKB 4FJ7A 4RW7B 3NF8A 4CHQA 2OPRB 4K4TA 3ULDA 1UA1A 5KFIA 1TKZA 5HRPA 4RW4B 1RDRA 3U6FA 1JLCB 4LH4A 1HNVA 3QGGA 4E1MA 4OPJA 1JLGA 3H40A 4DSFA 2J6TA 1HPZA 1TKTA 4NLPA 2DFHA 2C28A 2XY5A 5KFRA 5I3UA 2D0CA 5KRSA 3CM5A 4QWAA 2DFFA 2ATLA 3LZIA 5J1EB 5FROA 1T03A 4DG1B 4B9NA 4OL8A 3IGNA 5KFAA 5KG1A 1KVBA 1VRUB 2YNFA 1KHVA 1LW0B 2UUTA 5CZ1A 4LQ3A 3OYAA 1QE1A 2RKIA 5F8NA 4K4XA 3KMSA 4JLHA 3KJVA 3PJWA 3KK2B 3VQ7A 4DTXA 3PO5A 4J9PA 3TAGA 2D41A 1NJYA 1NJXA 2X6SA 4NLYA 2I5JB 2KQ2A 4O4GB 4KO0A 1GOCA 1TVRB 3ISNC 5KT7A 1CLQA 3A2FA 3AA3A 3ZSXA 3DI6B 1RT1B 4Z4GA 4OKEA 1JLEA 4KTWA 3ASMA 5HROB 4TY9A 5D3GA 4YP3A 2DPJA 4I2QA 2W9CA 4CF8A 3ZSZA 3ZT2A 4ECVA 4C8KA 3HP9A 1RT6A 3GIKA 4DQIA 4C8OA 4ZP9A 3H98A 4CJUA 3MECB 5KFWA 1RT4A 3DLRA 3LP2A 4KTZA 3QEIA 3GV5B 1KRPA 2W7OA 3D45A 3ZCMA 4DL5A 2D0AA 4W5QA 2JC0A 4HTUA 4K4VA 1BIUA 5KTQA 4QW8A 1S1XA 1J54A 3ZT1A 4CESA 4AH9A 3L2WA 3HSTB 4ZPBA 2RDJA 3MEDA 5J2PA 3M9NB 4YR0A 1A5WA 4GW6A 2HMIB 1U48A 3MFHA 3BREA 4R8UB 4CHYA 2UVUA 2AWZA 3SCXA 1QSSA 4N76A 3L2RA 1TKZB 5DMRA 4NLTA 4JS5A 3CJ3A 3NAHA 5EU7A 1VSDA 4LQ9A 3GYNA 3NMAA 4LD0A 1JLGB 5KG2A 4CJQA 1EKEA 1DTQA 4KAZA 3QINA 4NYZA 3QLHA 4CHZA 3PW4A 5I3UB 4URSA 3PW0A 1ZBFA 4H4OA 4J9RA 4J9LA 1FKOA 4NLXA 1T03B 2E6MA 4DSKA 4RNFA 4ZPCA 3C94A 2IJNA 2Y1IA 4JV1A 3KKRA 1RT7A 5JS1A 1JLBA 2YNFB 3D5MA 4WYWA 1IO2A 1JKHA 1QE1B 2RKIB 4KHWA 1Z26A 3L3UA 2OPSA 3KJVB 2UVVA 1RT2A 4JUZA 4CF1A 1B9DA 1RBVA 1NOZA 4KSEB 4E7KA 1JL1A 3PX0A 3NBPA 3OYIA 1ZYQA 3Q8RB 3H59A 4KO0B 1REVA 4DSIA 3SPYA 3KHLA 4KHSA 3I8DA 1HARA 4CFCA 2ASDA 3Q8QB 1S9FA 2Z1JA 3DM2A 3HKWA 1YVUA 4FBTA 1JLEB 3D28A 3V81A 3QNOA 3BDPA 1RDCA 5KFCA 2RDIA 1WNSA 3PR5B 3EPGA 5D3GB 4Q8EA 4ED2A 4I2QB 1KSPA 4Q45A 2W9CB 1WSGA 2P51A 3NFAA 4B9SA 4DU3A 2XY7A 4MIBA 4M3TA 4BACA 1RT6B 2XGPA 4O0IA 3OYEA 3HL8A 4W5RA 4DQSA 3SI8A 3CFPA 2XO7A 1KLNA 4JV0A 4IKFA 1RT4B 3NH1A 1BI4A 3LP2B 5EWFA 3SNNA 4J9SA 4Q8FA 3RTVA 4ID5A 3L3VA 4E7LA 3MR5A 4DL3A 1S1XB 3LP0A 3O4QA 2R2UA 3MEDB 5J2PB 4URGA 1K1QA 1Y97A 2AU0A 3OVNA 4ELVA 3B6PA 2ALZA 3OHBA 1HRHA 4QWEA 3TANA 5KFPA 3OYGA 1JIHA 2WB4A 4IOBA 5KFBA 4CEOA 3H5XA 3PX4A 3NAIA 4KFBB 1S6QA 3QEPA 1DTQB 1TL3A 3CYMA 4Y1CA 4H4OB 4F4WA 1FKOB 4J2EA 1WSIA 2D3ZA 3BGRB 4F4ZA 1SKWA 3NL0A 1RT7B 3OJUA 1JLBB 4NCGA 3MEGB 3QIPA 3QZ7A 1JKHB 5DK5A 4YQWA 5J2MA 3ZSWA 3HM9A 1L5UA 3V6KA 3FDSA 3HPGA 4B9VA 2OPSB 4E89A 1RT2B 5HLFA 1RAJA 4I7FA 4F3TA 1S10A 4CFDA 3NBPB 4B9MA 3F9KA 4CJ5A 1VSLA 1REVB 3C95A 4BDPA 2HHVA 2GC8A 1T8EA 2BR0A 3AO5A 1L3TA 3AVBA 1VSJA 3QGHA 1RTJA 4NLDA 3KK1A 1TP7A 3V81B 2W8LA 1T94A 3HHKA 2GV9A 1VSEA 4NLWA 2FBTA 4KHQA 3NGDA 3V1RA 2R8IA 4M3YA 4DWIA 3G6VA 4ZTJA 3KKSA 3TARA 4ELUA 5L1IA 2D3UA 1HNIA 4XIUA 2ZD1B 4OPKA 5K14A 4ECXA 2D5RA 2IJFA 3H4BA 4IH7A 1BI4B 3HPOA 1EX4A 3KLIA 1IKVA 1QSLA 3KLEA 2R8GA 3KLGA 4DTOA 4ECRA 4ID5B 4RW7A 5EWEA 2E9RX 2A1RA 3M8RA 2IM2A 2O4GA 3LP0B 1S9GA 4DFMA 4RW4A 1NK0A 4FJMA 3ISND 3H08A 3NKYA 4F4YA 4ZVHA 3OYBA 3LPTA 4Y1DA 3UR0A 4BDYA 1TGOA 1EXQA 1IKYA 4KB0A 4M3WA 3RBEA 4CHNA 3MFIA 1HQEB 5DQGA 2WONA 5CYQA 4MKBA 1VSKA 5J2QA 2Z1HA 1S6QB 3PUFA 4GC6A 4CJLA 4OLAA 5DGAA 1WN7A 2YV0X 3HP6A 4K4UA 3NF7A 5KG5A 1C0TB 2BDPA 4DEZA 4J9QA 3HVTA 1J9AA 4ZVEA 2OYQA 4DFJA 4F2SA 4ZPDA 4JRPA 2XI3A 1RYSA 4TXSA 5KT4A 4G3IA 3V1OA 4LSLA 2DFEA 1NK4A 1RNHA 3TR8A 3QIPB 4URQU 3V9SA 5KGXA 4EBEA 4BE2A 5J2MB 2UVRA 1FKPA 2R8HA 2XI2A 4N41A 3P5JA 1KHWA 2YNIA 4K50A 3AO4A 3BQ1A 3RB6A 4GVMA 1U47A 1NK8A 5HLFB 4ID1A 3SQ2A 3HO1A 3DYAA 4HKQA 4I7FB 4DMNA 1ASUA 4ZVGA 2D0BA 3THVA 4CGIA 1ZBHA 4NLVA 1NNDA 4KB7A 4TQSA 1TAUA 3CM6A 5HROA 4CJVA 1N4LA 3MEEA 1RTJB 1RTDA 5HRNA 3UPFA 3KK1B 1X1PA 3DRPA 4CEEA 2KZMA 4DLEA 1S0MA 4JV2A 3CJ0A 2HAIA 5KFKA 1EETA 1UAXA 3LANA 4ZP8A 2G8WA 4KE5A 2YHBA 3BSOA 2O4IA 1HNIB 3VQ6A 3SYZA 1QUVA 3VQCA 4BWMA 2HHQA 5JXSA 2AQ4A 2ZKUA 4BE0A 4DTPA 3K5NA 2AGQA 4IRDA 2FC0A 2C22A 3KLIB 3KLEB 3KLGB 4H4MA 3E51A 2LSNA 4FJLA 3MXJA 1S9GB 2QV6A 4MFBA 1WSEA 4DQPA 3NF6A 1BIZA 4FLWA 1N48A 3E01A 3EZ5A 1CZ9A 1RTIA 4E7IA 3AVKA 4CEBA 1U09A 4F4XA 3LAMA 3K5LA 1QSYA 3U3GA 1S9EA 1IKYB 4CJWA 2IM1A 4FLUA 3CJ4A 2WONB 5CYQB 4IFVA 2FJVA 4Q5VA 2W9AA 3VA0A 1BCMA 5J2QB 2JEIA 2F96A 4Q44A 2JC1A 3V9WA 4RW8B 5F8GA 1L3UA 3IN5A 1KTQA 1S1TA 1RDDA 1ZBUA 3HVTB 1IH7A 4DU1A 1C2PA 1X9MA 2JEGA 1GX5A 3ZSQA 3UQSA 1VSHA 1S1UB 4LSLB 4TN2A 2IDOA 4CFBA 3T3FA 4IDKB 3TAMB 3VA3A 5KFDA 4M3ZA 4QCLA 1RBTA 1FKPB 2G8UA 3FQLA 4FCYA 1XC9A 2YNIB 1BCOA 5FRMA 4XPCA 3CFOA 2IOCA 3SUQA 3DYAB 5KG7A 3PVXA 1QHTA 2VWKA 3OS0A 4NYNA 3L2QA 2XGQA 3CG7A 3CDEA 3OLBA 3OY9A 3S3MA 4MK7A 4Z4CA 3QYYA 1RDBA 3MEEB 1RTDB 5L1KA 3MXMA 3BJYA 4FK2A 4HUFA 2OA8A 3DRPB 2JEFA 1KLMA 3KMQA 2HNDA 1S97A 1EETB 5J2NA 2W9BA 2XCAA 1B92A 4W5NA 4HVJA 4ED1A 4ZPAA 2FVCA 3MXIA 2OH2A 4FLVA 4Y2CA 3ZSOA 3NF9A 4KHYA 3SPZA 1RTHA 1RBUA 2BQUA 4CCHA 2NUBA 1JXBA 4O4RA 3GIJA 2YNGA 4H4MB 4LSNB 2FBVA 2BE2A 3AA2A 1SKRA 1NKEA 3DRRA 2DTUA 3HT3A 4Q43A 4DLGA 4MFBB 4Z4EA 3BQ2A 1FK9A 1NK9A 4J9OA 3RB3A 4OKJA 3OL7A 3E01B 5JUMA 4ZTFA 1RTIB 1ZETA 1NHUA 2HB5A 3SQ4A 2X78A 4ICLA 3H5SA 4E1NA 4CGDA 4J9NA 4WE1A 1S9EB 4KFBA 5DQIA 3I5BA 2FBYA 2F8TA 2BANB 4O55A 4UQGA 3OYFA 3TAFA 4CEDA 1NJZA 4FJKA 3AVIA 4IFVB 4ED6A 1U45A 3GIIA 4PUOA 5KFGA 3BGRA 4CF2A 4J9KA 4RNMA 3PW7A 2KFZA 4NLQA 4DSEA 4O3PA 2EHGA 1S1TB 3MEGA 1RBRA 4IG3B 3PW5A 1T7PA 3RMDA 1ZTWA 4OLBA 1JX4A 2GIRA 4CGFA 3VN5A 2GIQA 4CJKA 3DLHA 5KFSA 4FM0A 4KB1A 4Z4FA 4B8CA 2WOMA 3B6OA 3QZ8A 4RUAA 1DLOA 2G8IA 1LW2A 3NGIA 4EO8A 4FJXA 2G8FA 3K5OA 4NLRA 4OKKA 1JXLA 4EP4A 1XI1A 1WNEA 3ZT4A 1J5OA 4DL4A 1K6YA 1TKXA 4ZVFA 5EDWA 3RR7A 4CK2A 3QERA 2KFNA 4KHMA 3OJSA 2FVQA 3PY8A 3VQ4A 4KBIA 4CIEA 4N56A 4FK0A 1VSMA 4BE1A 1L3VA 2PZSA 4K4SA 3M8SA 2OZSA 3VQDA 4KHNA 5I42A 1IKXB 2R2SA 1KLMB 4CECA 1JLQA 3RB4A 3H4DA 2HNDB 2ZD1A 2AX1A 2IA6A 5J2NB 2W9BB 3OYMA 4FM2A 3AA4A 1S49A 1XR5A 1N5YA 5T14A 2ASJA 1LV5A 4XO0A 3T1AA 3CDWA 1S0OA 2E9ZA 1NJWA 1RA7A 3MR3A 1UWBA 2CKWA 4FVMA 1RTHB 4C8MA 2C2RA 4AHSA 4ED8A 4CJ4A 2F8EX 4QWCA 3IGVA 2YNGB 4RW6A 2Q3SA 2BE2B 2P1JA 3KLHA 3DRRB 4FLXA 4E0DA 1O1WA 1FK9B 1HYSA 1HQEA 3I0RA 4CEZA 4EEYA 1OS5A 4AHTA 4ECWA 2ATQA 4RW9A 3U3YA 4ICLB 3DLEB 1MMLA 4WE1B 3LALA 3K5MA 4N47A 4J2BA 1VSFA 3PO4A 4KREA 4QWDA 4EZ6A 5T7BA 1C0TA 4KAIA 4FW1A 4WZMA 4WFXA 4PUOB 2FJWA 4RUCA 4EYHB 1NK5A 1D0EA 3N6NA 3SQ0A 4FLZA 3QETA 3SI6A 3GQCA 4EBCA 4DS5A 4CJEA 3NH0A 4FZXC 3JSMB 1YT3A 4O3OA 3G86A 4IR1A 1IM4A 5DGBA 4WYLA 4OVLA 2WOMB 4IH6A 4FJGA 1DLOB 5KFUA 3MR6A 1CZBA 1LW2B 4ECYA 1JLFA 3HXMA 3KHRA 2W42A 5KFZA 4GMJB 4NRUA 1S1VA 4FZYA 3AO3A 3VQ8A 2B6AA 1J5OB 1RT5A 3OYNA 4KI4A 1TKXB 4YR2A 4KHRA 4OJRA 3DMJB 5KFQA 4I9LA 2W7PA 4CHOA 2XHBA 4M42A 4HUEA 2FLPA 4U7CA 3N6LA 1HQUA 2WK4A 3UIQA 2QKKA 4EBDA 1VRTA 4JS4A 4DL7A 3CFRA 2P5OA 5FRNA 3NGYA 5I42B 4FJ9A 3C6UA 3TWHA 3SJJA 4Y2AA 1JLQB 4FLYA 4F50A 3OYJA 3I5CA 3L2VA 2WRMA 2R8JA 1JLAA 1JXEA 3OYKA 1N5YB 4IQXA 4QPXA 1CXQA 3D0PA 2FVRA 4NCBA 3GV8B 4R0EA 4R5PA 1UWBB 1EP4A 4BDZA 4M95A 3TAEA 3BSNA 3G0ZA 5CY4A 4I9QA 1B9FA 5KG0A 1D9DA 4Z4HA 1C0UB 3EZUA 4PA1A 3FFIA 2FVPA 4RW6B 4C8NA 3ALYA 5F8HA 3C6TA 3NGZA 4O3NA 3RAQA 3KLHB 3K2PA 4FJIA 1HYSB 4NLSA 4U6PA 1Z25A 3KLFA 3I0RB 2V9WA 4LH5A 2EX3A 2HWHA 1W9HA 3AVFA 3K57A 4GC7A 4RW9B 1C1CA 3JYTA 3M9MB 2G8HA 2Z1GA 1SUQB 2ZE2B 1W25A 4RW8A 4FYDA 1WSHA 3S9HA 2VA2A 5KT3A 1YTUA 3WNGA 4B9TA 2HW3A 3CJ5A 2HNZA 2I1RA 5KT5A 1ASWA 2R2RA 4TQRA 2VWJA 3MR2A 4B9LA 4IRKA 4CFAA 4DQRA 2E9TA 1S1UA 5SZTA 4ED3A 4DTMA 5C5JA 4IDKA 3V6DA 5HP1A 3TAMA 3HPHA 3SUNA 3AVNA 3AO2A 3EY1A 1NK7A 1R0AA 2QK9A 1A5VA 1ITGA 5C24A 4FS1A 4WFZA 1KVCA 3SQ1A 4DTUA 1JLFB 3VQSA 2AX0A 1S1VB 3I0SA 2HWIA 3HYFA 2B6AB 4ED7A 1SL2A 1RT5B 4PQUA 5KFLA 3SV3A 2D7SA 2ASLA 2PYJA 2IBKA 4FJNA 3AVLA 3VQEA 1QTMA 1G15A 1UOCA 1TL1A 3NDKA 3RAXA 2OPQB 1KFDA 4ED0A 1BQMA 1HQUB 4AHUA 5C42A 3G6XA 1VRTB 2OZMA 2AJQA 3WNEA 4WXWA 2E4LA
chains in the Genus database with same CATH superfamily
3LQVA 1EQYA 4OPAA 3C6UB 4CIFA 4I2PA 2XYGB 1RE1B 1LWFB 3U1MA 5BPMA 3PTWA 4CO3A 1JLAB 1SL1A 3VESA 1F9HA 2MZSA 5A8WB 2EK1A 2OUGA 4LF1A 2RS8A 2GUIA 4K59A 4CH7A 3ZETB 2HRYA 2ZNYA 1X8DA 5I3PA 4YDXA 4WFYA 3JS6A 3T7ZA 2RJZA 1SQKA 2XBPA 4QBUA 4KT0C 1ZH5A 3FZ2A 5DLGA 3RR8A 4O0NA 4C9DA 2BZ2A 3NNHA 4F9OA 1X4DA 4QW9A 1KC8O 3FUYA 4QWBA 3JYTB 3I5AA 2DXEA 4RU2A 2OKQA 2R9LA 4O3RA 1RCOB 4IG3A 2GS8A 4YMEA 2UVWA 1KD1T 1SKSA 2YHYA 3A8EA 1ZXOA 3DAWA 1F21A 4MK9A 1IJJA 4DR7F 4OGEA 1ZOTA 2BJ7A 4TU9A 2VUGA 3OFEA 4O5BA 4KGXB 3T5KA 2RQKA 3CJKB 2GGPB 3K2YA 2VG7A 1FJ7A 2IRUA 3RB0A 1N33J 3I87A 4U8YA 5FIIA 3QEVA 1CULB 2HFVA 5KG4A 4K4ZA 5EUHA 1NPRA 3QQCD 3OHAA 1RWWB 4ZPTR 2NUHA 2HVHA 5C25B 4JI4F 3KUEA 3KK3A 5DETA 3O1WA 1HBMA 4I6MB 3A12A 2WTUA 4JBCA 5IV3A 5HJYA 1Q9YA 1C0GA 5LL6Z 1TL1B 3M2RA 5CA5A 3ID6A 3M8WA 1R0BG 4DR6J 2VG5A 4NXNJ 2A40A 2YH1A 3SSQA 3IFRA 3LZJA 2GA7A 1XWLA 4FWLA 2OPPA 3D2FB 3HJVA 4IJAA 4B3MJ 3H2VE 5FD1A 3AJDA 4CJSA 5F1XA 4CWBA 3EPIA 4CEFA 3LPEA 4EZ9A 5ETNA 2AZ1A 4DTSA 1NB2A 4K0KF 1YRTA 4EHTA 5AFUA 5EX3A 1NOYA 3EEQA 3L6QA 1ZM2A 3KWIA 4N5SA 3DLGA 2QA4G 4DR1J 3DWLA 1RWPB 1S76D 3HSGA 5BN8A 4PG8A 4I6AA 1IUJA 3VGUA 1D5AA 4FSVA 4DUZF 1WSJA 4Y28C 2RF2A 1QQCA 3PZPA 2ZZMA 3ILLA 3CJRA 1FWPA 2HSTA 5AZIB 1T95A 2B5JA 2DEJA 3VQTA 2NZCA 1CC8A 4F0KA 2FVSA 4NI2A 4DV7K 1TKTB 3PYDA 3VV2B 1P8ZA 2E2QA 4LF9K 2BV3A 2RVJA 1RAAB 2Y1JA 4Y34A 5C10A 4Q0BA 6FD1A 2PYLA 3R8EA 3UE2A 2VQEK 1V5VA 1SVDA 1I39A 4LY7A 3FBFA 3CC4N 3ZZ0A 2UUWA 2W6LA 1U2FA 2DGQA 4FLTA 4U7UK 1X4CA 4LRFA 2ZOFA 4BC7A 4W92B 2FJXA 2FBXA 3KVGA 2PMZD 3DMJA 2A3ZA 2VWBA 4BC4A 3L4QA 3GJTB 4A61A 4B9QA 3OTCA 4FYWB 2O8DB 1QAIA 3V6JA 5A6WA 2KO1A 4PAAA 2ITGA 3M8PA 3LDSA 4USVA 3T6JA 5EWGA 2XLIA 5E84A 4MK8A 2ZEJA 4DUYK 3HHEA 4CZHA 1C4CA 4NRTA 4DF8A 5JS2A 1UFKA 3IR5B 4K4YA 1REGX 1U24A 2ZBPA 2OD4A 3TUJC 4EHUA 4ZITA 2F3JA 3CJCA 4L3KA 5KFTA 4RNHA 4JI0K 2N4CA 1S48A 2J7KA 1T3VA 4GNIA 4C23A 3RMCA 3ZZTA 4DDFA 3BSAA 1TR0A 2J7WA 5BPLA 2Z57B 3C15B 3IG1B 3OFFA 4B3MF 3BQ0A 1YZ6A 2CNNB 1N8RT 1N6QA 5F8LA 2DY4A 2V4RA 3QRRA 3NGSA 4FJ8A 4P74A 3EVMA 4FL9A 2B8PA 4M3XA 4CO0A 2W2QP 4FNIA 4NCAA 5DS7A 4YEAA 3ZSVA 3WBZA 5AQLA 2O8CB 3O2IA 3TVKA 1TAQA 4WYBA 4HACA 4FWSA 5LL6d 2ETJA 4JK8A 2M0GB 5JMVA 3DLBA 3CXCR 1BGXT 3F56A 4I64A 2DJWA 3OYHA 3CCRS 2VQFF 1I3OB 2X74A 3IM8A 1MLAA 4CO2A 3QPIA 4ZLNA 1SV5A 4M94A 2IS3A 3F73A 2FB0A 1ZZFA 2DY9A 4BCAA 3MWBA 4E7HA 2YBVA 3EYZA 1RBSA 3T1HK 1U26A 3MTKA 1M5PC 2X3DA 5IQQA 1TUVA 4B3SJ 2EEYA 3HHLB 3M8QA 4O0JA 1WC1A 2UUBK 4ER8A 5AQGA 1HJOA 4PG5A 4DR5K 1NGJA 2KTQA 4JI3J 4KHUA 4FDFA 4MH8A 2HBLA 4ZP6A 3FGUA 2EWSA 4BRIA 3TX8A 1T9YA 4ISEA 1OPIA 3KJQB 3MX5A 3CVKA 3QBCA 3EUNA 1BUXA 2R8KA 1XR7A 4UY8T 2BABA 3VQBA 3C14B 3J7AN 7FDRA 2ZH6A 4M5JA 1UVMA 3NE6A 2PE8A 3K17A 2W41A 1D9AA 1NM1A 1XHXA 1GLDG 3CJTA 2KH9A 1CQNA 1OIAA 4DV6J 1RILA 2VG6B 3VF2A 2BW2A 2YQ1A 4TY8B 3MMAB 2NZ4A 5BPNA 4CJRA 4CTAA 2OD6A 2HGLA 3HVRA 3V1QA 3WQUA 1FRKA 3D1OA 2XY6A 1CVJA 2HVEA 3P31A 1ASVA 5B0FA 1E4GT 4LFBF 1Z2LA 3D1QA 2QYGA 5AQHA 2DR9A 3OVAA 2DTJA 1YSJA 1BA1A 2P9GA 3O8MA 2MTLA 5CD4A 1TQLA 1ZBSA 5AJ3K 2YKNA 2LEBA 3CD0A 2CUYA 4TLQA 3DOKA 4NYPA 4DUTA 2OPRA 4OI0A 1CEZA 3AV9A 4M63A 2Y1RI 1NSQA 4X2BA 1DTTA 3M1VB 4ZVSB 2QXFA 1CLFA 4FJ5A 4QYZJ 1WC6A 4CVNE 4ZMMA 3MM6B 5LJVA 3CXCM 3RMAA 3Q8PB 4FZZA 2NXUA 5J1EA 2FSNA 2DBBA 2KRBA 1FD8A 5EN1A 3AVHA 2HHTA 3L4IA 4AYBD 4IOCQ 1AZSB 1GLCG 2X7IA 1HR0J 5H9EK 3I9ZA 3KK2A 5BRFA 3CO0P 1I51B 4NCGB 2ASYA 3HOSA 1C1BB 4LF4K 2D0OA 3O4WA 1FT8A 1VIXA 3BEGB 4A62A 2I5JA 1SIWB 4M41A 4O4GA 4K5SA 4DL6A 3NH2A 2HS3A 2YX7A 1SJQA 4CF9A 3EXYA 1NU4A 5IZHA 4JI3F 1G99A 2Y9HA 2GMJA 1KC8T 4YR3A 5A2QO 1NHKL 2O8BB 1DZ5A 4NLGA 2EKYA 2F65A 2RN2A 3DLKB 2MZRA 5HMZA 2IAJB 2PSZA 4DV2F 3TQEA 3I96A 3DDKA 1P8GA 2UUAJ 3MGJA 3AO1A 1T05B 3BS9A 2DH8A 1S6UA 4S0MA 4NXMJ 2PI4A 1GXUA 2ILYA 4HUGA 1Y4ZB 4ZPWR 4KTQA 5F9NA 2JNJA 3DFEA 1RB0A 4DV6F 3K8VA 4ZVPB 1GQEA 4HHHA 1N0UA 4KBOA 3MECA 5KT6A 3KNAA 3SUPA 3GE1A 3WNFA 4QU6A 2QYCA 1KCFA 1YJTA 3G6YA 2V50A 5DQHA 2J6UA 1CXUA 2V8HA 2CPXA 5DG7A 4CHPA 1IKVB 2VASA 2HMIA 1WJ9A 1HKCA 3UDLA 3B4MA 4IR9A 2XS5A 1PSDA 3THTA 3MM5A 1HNZF 5KFIA 3JTPA 1HWUA 4RW4B 1RDRA 4K42A 4ILHA 1YZ7A 2HHHF 3V2UC 1VQKN 4QIGA 4X66J 1K47A 2BJ3A 4LH4A 1HNVA 4OPJA 2F8HA 3CCLS 2X3GA 2J6TA 5K20B 5IQ6A 4Y00A 4NLPA 3BF1A 5KFRA 5I3UA 2D0CA 2WVDA 4DV4J 1RCXB 1Y7PA 4OL8A 5GIOA 3MM8B 5KG1A 2ERRA 3M6WA 3P4IA 4ZVRB 2QG9B 4LREA 1OY6A 1T0TV 4V1Ak 2YNFA 3H0PA 4LVNP 5CZ1A 3OYAA 2NPIA 4FZVA 4JLHA 4DV0K 4UZBA 3R8YA 3TAGA 2DR6A 1HR0F 2JFDA 4F67A 1Q18A 2BUNA 3M6UA 1KEKA 1V3SA 3OVBA 2N3OA 2ZJRQ 2WVBA 1GOCA 3ISNC 4WQ4C 5KT7A 1CLQA 3MUMP 3A2FA 4YB6A 2IRXA 3AA3A 3MURP 3DLJA 1P9YA 2XMJA 1QD1A 3LGHA 5HROB 4TY9A 2DY1A 3CCUS 5D3GA 2DNRA 2BVZA 1FRMA 2GQ2A 2UUAF 4JAXA 3FZLA 3FVYA 3NRBA 1XNRJ 2LA6A 1GMWD 2ASMA 4C8OA 4ZVOB 4CJUA 3Q2SC 3E9OA 4C1NI 3KDNA 2HBMA 2HURA 3GV5B 3NS6A 2AP6A 2OGUA 4W5QA 4HTUA 1UJ5A 4B02A 4JI2J 4PHTX 1QZ6A 1VQOS 1OSDA 4AH9A 4JB8B 1RU2A 4TVAB 2RDJA 2EBGA 4JKBA 4YR0A 1A5WA 3PRBA 4LFAJ 1ZM9A 1KAXA 5GAEU 2AWZA 3OBWA 1QSSA 4RBTA 2P9SB 2VKZG 5DMRA 4HWIA 3O1BA 2RB7A 1M90O 3CJ3A 1IVZA 3NAHA 5G0RA 2PFUA 3GYNA 3PHTA 1JLGB 2HQDA 4B3TK 5AQXA 1TFYA 4CZFA 4X66F 4BC2A 3QLHA 4L75A 4IWVA 2DRDA 1HD0A 2XNQA 1FKOA 4GKKJ 2CGKA 1T03B 4DSKA 4CDIA 3UDEA 2NSBA 5LM7E 4JV1A 2VV5A 1RT7A 4DV4F 2XM3A 2E88A 1QE1B 3J7YU 5A8RB 5FPDA 2DEIA 4CF1A 4JUZA 3GL1A 4GMKA 3L7UA 1NOZA 2G2YA 2W4DA 5CXTA 2NRRA 3NBPA 3Q8RB 1I1GA 3O44A 4KO0B 1REVA 2RAQA 4ZVQB 3SPYA 2DPNA 4KHSA 4CFCA 4AF1A 1S9FA 3IR6B 4I6YA 3WC2A 4PL7A 3LA0A 3DM2A 1YVUA 1VQ9N 3D28A 3P39A 5KFCA 4TU7A 3AGKA 5E26A 4EAHD 4WFNQ 4I2QB 3ENWA 4Q45A 3NFAA 2PA8D 4DU3A 2FXUA 3G6EN 1A7GE 4LIRA 1U1MA 2XY7A 4MIBA 3H2UB 3SI8A 1XNRF 2XO7A 4ILRA 4JKHA 1X5TA 3NH1A 5JMNA 2NXNA 4J9SA 4Q8FA 1IG8A 3HULA 1EJ7L 2IVOA 1GTEA 1TUUA 2R2UA 1HKGA 1PG5B 3QATA 4URGA 1Y97A 4BREA 4M5KA 4ELVA 2XQCA 3DU6A 1K73O 2C2ZB 4LFAF 1HRHA 4QWEA 3TANA 1X0FA 3J81O 5BYRA 3KKFA 3C2PA 4CEOA 3H5XA 1QM9A 1DTQB 1YJWS 4D3HA 4IO1A 3OUYA 4H4OB 3RRKA 4J2EA 2XSFA 4OZ5A 3BF3A 3AARA 3TNVA 4KR0B 2DKOB 2F4FA 1MN9A 3AJ2A 4GKKF 3OJUA 4F36A 1E3MA 5AE1A 1AFJA 3I32A 5F2RA 1B0PA 5DK5A 4DR4J 3FDSA 3U1NA 2GVZA 1K8KB 4NWBA 3ENVA 4JNEA 2E1MC 1SXLA 5HLFA 1RAJA 2CQBA 4PKHA 1S10A 2JVRA 2NQPA 1WG1A 1N0VC 3H7HB 2IDLA 1PO6A 2H4WB 1T8EA 5SUHA 1L3TA 1UKUA 4AQYK 3KK1A 3GTYX 3TVYA 3V81B 1AB8A 1GLJO 5HMWA 2W25A 1VSEA 3W1YC 2XB2D 3NGDA 3KWMA 2R8IA 4X4PA 1B3TA 5CH7B 1Y5NB 1NDKA 2ZD1B 1Y5IB 5K14A 1WF0A 2D5RA 2IBOA 4FVCA 4C98A 3N4PA 1BI4B 1EX4A 2W2PP 3NG8A 1S22A 4RW7A 3M8RA 3LP0B 1JQGA 3LOUA 1HLWA 2DNLA 3R3TA 3I8BA 4BQZA 1YF5L 1M5SA 5ETQA 1URNA 2G2OA 3CPEA 1R8AA 4Y1DA 4BDYA 3JS9A 2CQIA 2QA4N 1A9NB 1UFLA 3ZYYX 5CCLA 1UVJA 5CYQA 2IFXA 3VAIA 2FQQB 5LMUF 3TTCA 1S6QB 3PUFA 3CT9A 4OX7A 3M2UA 2AYBA 2MQ8A 4PZVA 4OLAA 1WN7A 4TKTA 2FGOA 4PCQA 4K4UA 3TPQA 1KBRA 1C0TB 3UD4P 2LEPA 2R7QA 3WXLA 3BN4A 3AD8C 1NAQA 3HVTA 3G87A 2DGUA 4ZVEA 2OYQA 4ZPDA 5KQ8A 4TXSA 5KT4A 1X3MA 2MQLA 4LSLA 4OI3A 1NK4A 2DFEA 4FWQA 5HQMA 3QIPB 4URQU 1WHYA 3GP9A 1SJ3P 2A42A 4ED5A 5J2MB 5HK4A 4BE2A 3RW7A 2DNGA 3P5JA 4C2MA 3ZTPA 2YNIA 4DR4F 3QJJA 3RB6A 1WDDA 2LP4A 3MDFA 3QBXA 4W90B 1ASUA 4ZKAA 1NGIA 4ZVGA 4X62K 4CGIA 1Y3JA 2Y1LB 2W6KA 2GHWA 1NNDA 4RTFD 5GINA 1RTDA 1XIQA 3HSCA 2CQDA 3R1LA 1PAEX 1X1PA 4CEEA 3HSJA 2BJ8A 3P38A 5HQLA 4JV2A 1UAXA 2CG8A 3TEGA 3LANA 2IRYA 2YKOA 4IZ9A 1EQ0A 2K1RB 1PC4A 3L7OA 3BSOA 1OSCA 1MWYA 5LSLA 1QUVA 3POTB 5E3QA 3N5FA 5DM6Q 4YOWA 5JXSA 2AQ4A 4BE0A 3K5NA 1FHTA 2CPHA 4M5NA 3WZ0A 2DO4A 3NVKA 4WQ5C 1GXTA 3KLGB 3EZOA 3G71S 4DL0C 4U96A 1KVKA 4CRJA 3EX7B 1BIZA 1UL3A 1RTIA 1G6BA 4ZLLA 4CI6A 5JICA 1YG0A 3LAMA 2IIRA 2V69A 3K7RA 1XMBA 5KQDA 2KJVA 1RBLA 4J8FA 5IT9Y 2HF4A 1RQ0A 1RWKB 4FLUA 4LBHA 3GSIA 3VA0A 2JEIA 2F96A 2JC1A 3V9WA 1L3UA 3IN5A 1KTQA 1FEHA 4EMDA 3ZXWA 4X4VA 3MWPA 1RI7A 3WXJA 2MJNA 4DU1A 3MMBB 5GAGI 1GX5A 2B7BB 1Q79A 4YY3J 1CG2A 5GVQA 3ZSQA 1XJWB 6FDRA 1FTCA 1WKKA 3BO2A 4WCEQ 2HBRB 3T3FA 3VA3A 5A2QY 2PBDA 4QCLA 1R8BA 2MKKA 1RBTA 3VCDA 2Q2RA 1FCAA 2HQIA 1XNQJ 2IOCA 5F3ZA 3DYAB 5D0HA 1M90T 3PVXA 2LEAA 3L7PA 2VWKA 3OS0A 1LK5A 2V4JB 3L2QA 1YJUA 5IWAK 3AAQA 3JSYA 5AQPA 5H9FK 3MXMA 1MWQA 1YITS 4QU7A 3PYGA 1X5PA 3DRPB 1CJUA 3W9HA 1ZBTA 1QQMA 2YI1A 3RVCA 2W9BA 2XCAA 3M8YA 1VQMS 4F02A 1RP5A 4HVJA 4ZPAA 2FVCA 3QAUA 5KPRA 4FLVA 4Y2CA 1H2TZ 2NS1B 1RISA 4M5GA 3CE8A 3GOIA 2F1FA 1RTHA 1SQFA 4O4RA 3OTOF 3GIJA 4H4MB 2CQHA 2BE2A 3ZZPA 3AA2A 1SKRA 2K3KA 5DM7Q 5E5NA 2GAHC 4ZDNA 4MFBB 3CW2C 3BM7A 3OL7A 2DNNA 5JUMA 2HIYA 4PYDA 2XMVA 3A13A 4DBQA 2HB5A 4E1NA 4CGDA 4HHUA 3MMCB 1S9EB 5DQIA 3I5BA 3ATVA 1UTAA 2MKHA 3T9ZA 2F7VA 3UFCX 2KU7A 2Q97A 4CEDA 3AVIA 3C46A 3GIIA 5KFGA 1EX8A 2G13A 2PDAA 2NRWA 2RRNA 3VWSA 3IWXA 4FF4A 3SDEB 1QLNA 1OYDA 4CGFA 3W9IA 1VHFA 2RS2A 1R3NA 5JVGL 4CJKA 4FM0A 4B8CA 1HLUA 3FE1A 4RUAA 5GIPA 3LW5C 1DLOA 3DDIA 2G8IA 3NGIA 4FJXA 4DCPB 2ZVIA 3CIMA 1XI1A 2E7VA 2A6MA 5LJ3Y 2QL7B 2ZJPQ 1K6YA 4RWXA 3R5AA 1BMQB 1FE4A 2H51B 3K5PA 2FD2A 4DPTA 5EDWA 4KHMA 1PILA 1XNQF 3BZKA 5GAGU 4N56A 3UB5A 2QM1A 1UCNA 3N9UC 3ZO7A 3M2VA 3TSQA 4AL5A 1PJ7A 2WAQD 4OJGA 4KHNA 2G4BA 3WXMB 4GVEA 5HMXA 1ZPWX 4G9ZA 3L09A 3RB4A 2DRAA 2AX1A 1AUDA 5DZ6A 1G3OA 3F0NA 2ASJA 3T1AA 2JJ4D 2C2RA 4CBWA 3CMES 3EKSA 2O8EA 1PYTA 4A4JA 2ZWPA 2Q3SA 5MLCQ 2P1JA 3DRRB 4Y65A 1HYSA 4USJC 4UUWA 2DRBA 1HQEA 3SMPA 3CCQS 1GLFO 4AHTA 4ECWA 3U3YA 3DLEB 1RLCL 4J5OA 1UPMB 3DOMB 4WE1B 4DKWA 1RGIA 3SEOA 1VSFA 2E20A 3MMJA 4CD1A 2MHEA 1I94K 4KAIA 4QR0A 4FW1A 1KKHA 4WFXA 4NOHA 3PACA 2CZ9A 1GLAG 3HX9A 1KDNA 4FLZA 2LCWA 2CPJA 4MT1A 3GQCA 3IM9A 4CJEA 1YLXA 3NH0A 1H38A 5AE3A 3VAJA 4CLSA 1YT3A 5E7OB 3G86A 1OVQA 1IXKA 4OQJA 3CCRN 4IR1A 4V19J 4WYLA 1TUWA 4UW2A 4ZVUB 3ATUA 3ADAC 2WOMB 5J1PA 3VF4A 2YKQA 4M7XA 4JI7F 3E1YA 1JLFA 2QX0A 4GMJB 1DQAA 3AO3A 5HQ8A 3KWGA 4NEZA 2COLA 3VQ8A 1U6BA 2B6AA 2C1EB 4YR2A 3QT8A 1HNXF 2QSFA 4OZ0A 3F2KA 5HL7Q 3R5JB 3NWGA 5CCMA 5K8PA 4CHOA 2XHBA 4DUYJ 2FLPA 3MHYA 3FLCO 1U8WA 2WK4A 1N52B 2P9UA 2W2MP 1VRTA 2V52B 4DL7A 1FJGF 2P9EA 2P5OA 3NGYA 1YX2A 5I42B 3AQOA 2DO0A 5AR0A 5HAOA 2AJ1A 1RWUA 1JLQB 4JI0J 3D2EA 4OV1A 1GXLA 5TKYA 3M6XA 2R8JA 3OYKA 3GCXP 2EFVA 1N5YB 3CI5A 2FVRA 3MZIA 2UXCK 1UWBB 1S59A 4BRKA 4ZCLA 4X4OA 3VEVA 3TAEA 2EW9A 2CQGA 2APOA 3OTBA 4Z4HA 3GJSB 3EZUA 4PKGA 1U2VB 4PA1A 2P9NA 2FVPA 2MGZA 1HBNA 3NGZA 1YRUA 3KLHB 1CJVB 1V3ZA 3AJ1A 3A1YG 4KHPF 1ZAVA 3HFZB 5AQNA 2IA0A 2HZAA 4NLSA 1Z25A 3KLFA 2LQ5A 2EX3A 1NO8A 1C1CA 5TKWA 2YX1A 1SUQB 2ZE2B 1FWKA 4YOEA 3UVJA 2E5GA 4FYDA 2OELA 3E3XA 2VA2A 4JI1J 2D1KA 3BV8A 2PFFB 3LDPA 2O8FA 3TOQA 4DQRA 2E9TA 2CYYA 5SZTA 2UUBJ 4ED3A 5C5JA 1N88A 5HP1A 3TAMA 3SUNA 5A8KB 4OZ3A 1X9JA 3MM9A 2GWKA 3UR3C 3W5YA 1ITGA 1VYAA 4I0WA 2J9EA 3SQ1A 4DTUA 1S1VB 3E66A 2D9OA 4BHQA 3VOVA 1SL2A 4HT5A 2CRLA 5KFLA 2K8GA 2ASLA 2V9KA 2QEXN 1QTMA 3VQEA 1UOCA 3A5MC 3NDKA 1KFDA 4DZDA 5C42A 4OFZA 2CZVC 1RKIA 5IM0A 4R0JA 3Q7BA 3M4XA 4KGKA 4A59A 1R8HA 2OZMA 4DUYF 3WNEA 1C0FA 2E4LA 3U7JA 3Q83A 3EGNA 1BLUA 1IQZA 3GJQB 3MCOA 1X60A 2B9WA 2H3EB 4CJTA 1FRJA 3CC7N 1VQ8S 2HNYB 3MN7A 2W8KA 4K8ZA 1LKZA 3FZFA 2E1ZA 2HAFA 1YI2S 5AQZA 3H3NO 3GFHA 4LSNA 3OS2A 3V9ZA 1EP4B 3SMZA 2KT5A 2JLGA 4XH1A 3ILIA 3V6HA 1SKUB 3ZFVA 4J9MA 5M1NA 4QJVA 3KTQA 3OYCA 1NHVA 1RDAA 3SLCA 3FFIB 3C6TB 3DU5A 2XCPA 1YXQA 1WC4A 3J8AA 2FY1A 2XYPB 2BANA 4BGAA 2KXFA 3A4TA 2MMYA 1MROB 1D8YA 3QSIA 4JI8J 4FJHA 2YPZA 2BEFA 4JKGB 3PX6A 2GHPA 2E5JA 2DNPA 3CIPA 1RAIB 4UTGA 2Z58B 4H8KA 3QNWB 4A57A 4DCHA 1V3RA 5C7PA 1W0HA 4NZ6A 3IXQA 1J5EF 3AVGA 9ATCB 4QAGA 2RIJA 3N6MA 4JI1F 3RMBA 4YN3B 2P9PA 4M63C 3CCLN 2BQRA 1OVYA 5H9EJ 2XC9A 4FXDA 4RNOA 1U1KA 2QLXA 3G10A 1SJ1A 3QRPA 4PY5A 3HI9A 5L1JA 3DXBA 2HSEB 4D3GA 2JH3A 5C24B 4BWJA 4IEEA 4Z4IA 3LWMA 1CJTB 4MIAA 4P2FA 1XHZA 1IKWA 4KV8A 3T1YJ 5D78A 3I0SB 2Y3YA 4PQUB 2GX8A 3LP1B 4Y2MA 3SUOA 2EK6A 4WP3A 4PWDA 4DR3J 4IOCL 4FPRA 3ZSYA 2CG4A 2B9EA 4F3QA 2WTFA 3OV7A 3U9DA 4DFKA 2M8DB 3N5BA 2LFVA 3M5RA 4LSZB 3CCES 3VGVA 4I2PB 3MUTP 2XWYA 4ZN3A 2LECA 4KKOA 4DI6A 4G1QA 3LAKA 1GAOA 1HMVA 3Q8UA 1H6KX 2YKMA 2KJWA 4J37A 1QVGR 4KIAA 3MAAA 3HT0A 3MPVA 5KOXA 3CCUN 4K41A 4CK1A 1Z2ZA 2CPIA 5FPMA 3RYLA 4JKEA 3PEJA 2P9IA 1T9WA 5AXMA 3FCHA 4JYAK 4CLTA 2HRUA 2WHOA 2E5LK 1RZMA 3ITHA 3HHLD 4FKYA 4F26A 1X7VA 2C2EA 2FLLA 3MCPA 5KFXA 1GLBG 2POKA 1EHWA 1AYEA 3L9ZA 1VQON 3KK7A 5LSOA 4ECTA 2UUCK 3QEWA 3L95X 4BRHA 2PY5A 1HPZB 4JI8F 3EVWA 5F8JA 4B1WB 3W5ZA 1F2HA 3AVCA 4B1ZA 4FJJA 4IFYA 4P7VA 2IPOB 5D4LA 1N5SA 2C2OB 3ZSRA 4OJ1A 3CJ2A 5CHIA 4ZIVA 1VOMA 3NHGA 1VISA 2VZ9A 1BISA 4OIXA 5GAEP 3L4BC 1P27B 4DV0J 2VG7B 4I6WA 3IRWP 4JRQA 3FFKB 1KVAA 3D66A 5HBMA 3ZTSA 4OHVA 3BZCA 3W0LA 4FXVA 3NMUA 1Q5VA 4ELTA 3DOLA 5IS2A 3J80Y 4WXOA 3UD3P 3KK3B 3T1YF 1HBMB 4G1PA 3BGLA 5M2UA 4NA1A 3I56S 3BBBA 2YHAA 1AUSL 2IC3A 3M2RB 1ATNA 4KYZA 3N4QA 1NGEA 2HHWA 3SCIE 2O5DA 4DR3F 1LFPA 5HRRA 2A1SA 1WSFA 2VG5B 2HFNA 2GEMA 1U1LA 2WVCA 4CYUA 1D1UA 3UN3A 5EX5A 3TAPA 2AEJA 4OGCA 1Q53A 2OPPB 3S3OA 3VF0B 2ZJRL 3IAM9 4NO7A 1FVQA 2HBKA 3FQKA 4MKAA 1FNXH 1IG9A 4ED4A 1QVGM 1NJIO 2CAJA 3M30A 3V4MA 1FRIA 2LQ9A 2N4DA 1UEVA 2AMCB 5ETVA 1N36K 3ONQA 4KRFA 1H7WA 2CIMA 2Z56B 3NCIA 3TX0A 3DLGB 3P6YC 3UKUB 2Q6CA 2B9XA 2V0NA 3T5HA 3OPKA 4ECUA 5IT0A 3D0GE 3BKFA 3CSKA 1F3VA 5CYMA 4B3TJ 4AHCA 4K4WA 4ECSA 3ZT0A 2RF2B 2FF3B 1FRXA 1YJ9S 2HFSA 4ZHRA 1O8BA 4V19X 3BR9A 2F9WA 4RX6A 4CH1A 3K58A 2B5JB 3A3PB 3TABA 1YVNA 4WWSA 4NI2B 1RT3A 3IRXA 1NXIA 3L3CA 1W2BR 3H3OB 4CW7B 3FZBA 4O44A 4YORA 4CEQA 2AIRB 1I5OB 5M1KA 3P5TL 4M5HA 4Q0BB 5FJ4A 3KG1A 5L1LA 4GV3A 4KI6A 3TI0A 4FS2A 1YJWN 4NEYA 5F9LA 3ZZOA 2IHR1 4CH0S 2P5GA 5ADZA 1QS4A 4IKAA 2NREA 3HHDA 3NCRA 1XR6A 1YGYA 1WHWA 3GR0A 5E41A 3TZYA 4C8YA 3QBWA 3MN9A 5C2DA 2OPQA 4ZCIA 4TYBA 3HJFA 3CF5Q 3L8BA 1OMSA 5DG8A 3AODA 4ANEA 2FPHX 2LYVA 4HEA9 2KW4A 1NSPA 3M8PB 4X64K 1AW0A 3W8GA 5IT9U 1YVFA 2CNLB 3WEEB 4A8OA 4P75A 4FBUA 4ALZA 3FK4A 1LWFA 4RKUC 4A5AA 2V51B 3FR0A 1U6ZA 5M1FA 4P2SA 1X9SA 5F8MA 2BRKA 3O3FA 1CC7A 3CHWA 3W62A 1Q8IA 3G82A 2WC9A 2ZDOA 1T02A 2LU2A 4W98A 3MEKA 4F3MA 3GE9A 1FDNA 1X4EA 3HRGA 4PXDA 3BBCA 1UJ4A 3P96A 2ZKTA 1N6QB 1VQNS 4CNZA 4CERA 1E6YA 1BL3A 1X3NA 3AGRA 4O8UA 2PAVA 4QOZB 2CQ0A 4WP8A 3UNGC 3GB0A 4E3SA 1RA6A 4HACB 1HNWK 1T6DA 1DFDA 1ZZNA 2JZ5A 3S3NA 1SH3A 4ZCMA 2EC2A 1IR2A 3FNNA 2Z1IA 4AM6A 3QAEA 1BHLA 5D8HB 3MF5A 4DG1A 3T5LA 1SV5B 3TSUA 4ZCKA 3CJKA 4I4BA 1TL3B 4Z0UA 3BYPA 1VRUA 4BRNA 2BGGA 4BRFA 1Q82O 3M8QB 5CYJA 2AGPA 3SCLE 3O4NA 2F9DA 2QKBA 2DGTA 4HH1A 2AT1B 3KIOA 3ZTRA 5C25A 4USMA 1TVRA 4ILGB 1I6JA 2F8MA 3CB4A 1WLJA 4JN4A 4YOUA 4IO9Q 5KFVA 4XPEA 4AQYJ 1R59O 1OWXA 3V9XA 1RWMB 2KM8B 3PG9A 3IFEA 3LH2S 4BGBA 3MUVP 1YRXA 1Y00A 1FA0A 2V7ZA 4MO5A 1HBUA 3O8WA 2AJ4A 3D6TB 1XC3A 4B9UA 5AQMA 1XQIA 4CTAB 1VQYA 1K0TA 4H5TA 3VF6A 3QWPA 2KKHA 4CI0B 4USUA 5F8IA 4QIEA 2O66A 3OSNA 4HCBA 1BD6A 2HVZA 1TK8A 1RBAA 1UEKA 2L9NA 1EWRA 2KKZA 3EXCX 3IP0A 2UXBJ 3GYGA 2GBZA 3MCAB 2M8HA 2E2PA 2HVIA 3KHGA 3FRYA 3OYDA 2YKNB 4R8UA 4H54A 7AT1B 3DOKB 1IJEB 2OPRB 2FZKB 3ULDA 2ZM6F 1TKZA 3BYRA 5HRPA 1T9VA 5HO4A 1S72N 3FCVA 4X4NA 1ATSA 2KI2A 3K89A 4DX7A 3AA9A 3VEZA 3RBXA 3SQGA 2H1YA 3DXKA 2M9KA 1LXNA 1TKTA 2D4WA 1KVIA 5KRSA 4QR1A 2M3DA 4QWAA 3ZX0A 3LZIA 3MPDA 5J1EB 5FROA 2FC8A 4OO1J 2W4CA 1V4SA 3SSRA 3FEXB 5LJWA 1NSAA 3CCJN 1KHVA 3AAWB 1G2EA 4PXCA 5F8NA 4K4XA 3KJVA 3PJWA 3KK2B 1B70B 2FHKA 1N54B 2RQMA 4C3LA 3CCVN 2HG4A 4DU8A 5KPTA 1JJ4A 4NLYA 2I5JB 4X62J 2KQ2A 2V34A 2ZWOA 4O4GB 1T44A 4YHHJ 1Q7LB 4WTOB 3HZEA 4LF5K 4ILJA 1HHQA 2NSCA 1ELOA 1ZC6A 4AQYF 4NB4A 2CNKB 2PMHA 2CQ1A 3E9LA 2W9CA 3H25A 1EB0A 2ZH5A 1U7LA 5AQWA 2GVDA 3ZSZA 4ECVA 4QIVA 4DCJB 3OA9A 4DQIA 1RT6A 3HP9A 3NGUA 1ESVA 3H98A 2OO4A 3O9QA 3MECB 1T3OA 5KFWA 1BY9A 2CJXB 3QEIA 1RUSA 3OBIA 1WBDA 3C16B 1JK9B 5D4OA 1UAWA 2D0AA 2JC0A 4K4VA 2NRXA 4QW8A 1S1XA 3ZZYA 1J54A 1VLOA 2UXBF 4MLHA 4ZPBA 3MEDA 5J2PA 4GW6A 2HMIB 4IFEA 3NCPA 5HJXA 2AEFA 2LQ8A 4DXLA 3MM5B 1A0OB 3CEDA 4RWTA 1F9EB 3VZIA 1FO1A 4YDUC 3AY0A 5G4DA 3TUZC 5HI7A 3WQTA 1VSDA 2CJ9A 4FWNA 1APSA 2I9SA 2C2KB 4EWTA 4CJQA 5DM6L 4NYZA 1FNOA 4CHZA 2GUPA 4LFCJ 5I3UB 4URSA 3PW0A 2M4MA 1YUWA 1ZBFA 2XG8A 4J9LA 2VYPA 4HR2A 3H45C 4RNFA 3AT1B 2IJNA 4CZIA 3C65A 5JS1A 2YNFB 2MY7A 4DV1F 1JKHA 2WVFA 2F4VK 2P2CB 2MJUA 1Z26A 3OTEA 1RAFB 2YWKA 4OPHA 2PO4A 3R9LA 2OPSA 2UVVA 1K9MT 1RT2A 2MQOA 3VEWA 2HBQB 4KSEB 4CZCA 4WF9Q 1JL1A 2PT0A 3VALA 3OYIA 1WEXA 1DURA 2DHHA 3H59A 3SMSA 3VMFB 3KHYA 4DSIA 2V7YA 1Y5LB 4M5LA 1HARA 2ASDA 3D0HE 5H9FJ 3C8YA 4YHHF 4L72B 4H5VA 2UXDF 2AYEA 2J7UA 1H1VA 1SQGA 1TL4A 3AFGA 1WI8A 3BDPA 5E0OA 2GX9A 3QNOA 4EFAC 3D7EO 1WC5A 4FO0A 4AE5A 3EPGA 5D3GB 2KN4A 3OR1B 3HF5A 4K5RA 4GRSA 4GO7X 4BACA 2ZJQQ 4U67Q 4P10A 3PM9A 4EUVA 4JV0A 4IKFA 3DLLQ 1KNZA 5EWFA 1KTVA 4LRDA 1WOSA 4CLFA 2ZHBA 3RTVA 3CJ9A 2D9PA 5GAGP 5LXYA 3MR5A 3VTHA 5K8MA 4X65J 3MD3A 2RD5C 1E6VB 4C97A 1RWOB 3PKYA 3R9PA 1VQLN 2Z30B 2DITA 3JSRA 1F5AA 1ROFA 3OHBA 1BXNA 3CMEN 3OT9A 5KFPA 5G0RB 2QI2A 3MM7A 4CD3A 1JIHA 2WB4A 5KFBA 1R8CA 1KXPA 3NAIA 4MKVA 2H48B 2KYXA 2HEKA 1HQ2A 1Y11A 3CYMA 2V8DA 3NGKA 3PSIA 4F4WA 1FKOB 1BOTO 3THYA 1WSIA 4LFCF 5U47A 3BGRB 1TMMA 1MMDA 4F4ZA 3HD2A 1RT7B 3I33A 2E1AA 4NCGA 1WI6A 6AT1B 2R7VA 3QZ7A 5I9EB 3VEYA 3D3CJ 2CH5A 2J9CA 3HPGA 4B9VA 1BWFO 4RLEA 4YOVA 4KGVB 4DPUA 2UV8G 1SIZA 4FWKA 8RUCA 4JI4K 2XZWA 3TJ9A 3EICA 4OMFG 4F3TA 4B9MA 3NBPB 1RXOB 3UE5A 4NZ7A 1VSLA 1N8RO 3CJ8A 1REVB 2HF3A 2CQPA 1M1KT 3C95A 2YKAA 4A46A 3AVBA 1ZA2B 4DHVA 1RTJA 3C19A 1U25A 2J0XA 1TZ0A 1Q7YT 3LDOA 2W8LA 1T94A 3HHKA 2LDYA 4NLWA 3DJCA 4PG4A 1NPKA 1R0CB 2R4FA 1XMOF 3RZAA 3ID8A 3ETOA 3C66A 4M3YA 4C6AA 1QAXA 3R2DJ 3GFXA 1KOOA 4ELUA 2V8PA 2QWRA 2D3UA 5I4MA 3QRQA 1IBKK 4XIUA 3GCWP 4K0KK 2IJFA 4JI6J 4GV6A 3KLIA 1IKVA 2R8GA 4DTOA 5EWEA 4F0MA 4EU0A 2G9OA 1S9GA 4RW4A 3SAGA 4FJMA 3ISND 4LVOP 2Q36A 4DUZK 4X65F 4KGZB 3RG6A 1NNEA 1HIYA 1TGOA 3S41A 1IKYA 1HKAA 3RBEA 5DQGA 2WONA 3NCQA 2E1RA 4X4UA 1VSKA 2Z1HA 3M6VA 4UY8O 3EDRB 4GC6A 4CJLA 2VD3A 5DGAA 2V67A 1LK7A 2IYIA 5KG5A 4BRQA 4L3NA 2BDPA 1S79A 5T7LA 4J9QA 4NLCA 4DMZA 2RQCA 1RYSA 4G3IA 3ENAA 3V1OA 1M1HA 1RNHA 3CD7A 3V9SA 1NH8A 3UDCA 3BO4A 3MK6A 3BGOP 5JLFA 2GVZB 2R8HA 2RRAA 2GW8A 4K50A 3BQ1A 3CMAS 5HLFB 3HO1A 4DMNA 2UU9J 1SJFA 2ZWHA 3LGMA 2I7PA 5IC4B 1RWXB 4P71A 5HROA 1N4LA 1HPMA 7FD1A 3PEHA 1AROP 2RDDA 3KK1B 2NXJA 1R7IA 4U95A 1VQPN 2P9LA 5KFKA 1EETA 3QFUA 2B8QA 3J7Z5 2XMUA 4ANDA 2G8WA 1U02A 4QR2A 1XUPO 3SYZA 1KN6A 3VQ6A 2CDQA 4BWMA 2HHQA 1VCTA 2UXCJ 3MPUB 4UOGA 4WIIA 3CCMS 1VQ7S 4DTPA 3TO8A 4L73A 5HL7L 2C22A 1VQ5S 3UCGA 2PD1A 3ILOA 2WSEC 4PG7A 4FJLA 4JI6F 2VICA 3MXJA 1VQ8N 5E3PA 1CPZA 3NF6A 2MDAA 2GCFA 4E7IA 3J80U 1WKJA 4B1XB 1U09A 4DR2K 2GQCA 3LF0A 4F4XA 4TNOA 2EBEA 2VQFK 3HTVA 3UDVA 1YK9A 1PYOB 5EXWA 2PI5A 3CJ4A 5CYQB 4IFVA 1BCMA 2HBYB 1IBMK 2OTLN 3M2UB 3U1LA 2JRSA 1VK3A 2U1AA 3GDQA 4JOUA 3J81j 1S1TA 2VCPA 3HSZA 3FZHA 4QOTA 1YJNN 3TUPA 4MDAA 3HVTB 2M2BA 1B0TA 1S57A 1OQ6A 1U2CA 3UQSA 4LSLB 3MPYA 2LMIA 1SI9A 5KFDA 4NA2A 3EO3A 2G8UA 3FQLA 1WOQA 1HI0P 2YNIB 4UT4A 3D0IE 5D0EA 2DCLA 3CCSS 2OEMA 3OXFA 4NYNA 4FPAA 3EVOA 2ZH8A 3CDEA 2EFPA 2QTWA 2Z8QA 1TL7A 4MK7A 3AY9A 4Z4CA 2UU9F 2EFQA 1RDBA 1LFWA 1VI7A 2C2NA 4XH5A 1RTDB 2LU1A 3BJYA 2I6WA 3ENBA 2E7XA 2WBMA 2OA8A 5EOYA 4OI6A 2QWOA 3LDQA 4PABA 1KLMA 1BUPA 4DJBA 2HNDA 1S97A 3TEHB 5J2NA 4ZPVR 4LFBK 4JV5K 4HHJA 1WC3A 5LMNK 4A8KA 2DD8S 3ZSOA 2VDIA 3THXB 5HSPA 1XMQJ 3HSDA 2R7RA 2V8GA 1OH6A 1JXBA 4ZN1A 2RHKA 4KH5A 1NWKA 2NLWA 1NGCA 3UKRA 2YNGA 4K2JA 3CGIA 2FBVA 1DRZA 3X1LB 1NKEA 5EX0A 4FYXB 4Q43A 2VC1A 1JCEA 4J9OA 2FJBB 1VAZA 2HHPA 1RTIB 4WFBQ 1SC6A 4Q7AA 4ICLA 3H90A 4J9NA 4QS7A 2FBYA 2F8TA 3Q86A 3US5A 3TAFA 4ED6A 1U45A 1N34J 4JKAA 1G1XA 4NX9A 5AZJA 3QB0A 1WUUA 4PUOA 5BXIA 4XTTA 5I3QA 1NMDA 3PW7A 5M2PA 3AA8A 5GADI 3VERA 4H0PA 1YWXA 1Z6RA 1T7PA 3PW5A 1ZTWA 2GIRA 4H0VB 1U1NA 2GIQA 2C42A 3T9NA 4FF2A 1T11A 5DDQC 4KH6A 2JFKA 1O0PA 2G0JA 1Q95G 4J91A 3QZ8A 2YJEA 4JI3K 1LW2A 2ZC4A 3AXMA 4OKKA 2FJAB 2MKSA 1MWZA 4DV2K 2FTRA 1N33F 1HW8A 4P6QA 2KFNA 1LOUA 3QERA 5D4PA 2G1HA 2D74B 4A2BA 1YJVA 1R6YA 3BH7B 2J76E 4BE1A 3DCAA 3KXDA 1IV0A 2FYXA 4G65A 4BRGA 2OZSA 1M5OC 2G0IA 3CETA 2K06A 1VHXA 1IKXB 5ADXH 5B0GA 1WELA 4FPBA 2ZGZA 2ZD1A 4JHDA 1X4AA 4CZMA 2W9BB 3OYMA 1PAUB 1RGVA 1X4HA 3I56N 4DR6F 4NXNF 2W2NP 3VAMA 1UVNA 1RTHB 4C8MA 3VGSA 2QL9B 1XMQF 2DXDA 4ETZA 1HNZK 4G1IA 4QWCA 4JYAJ 2HHHK 1SB6A 2BE2B 1N5VA 2E5LJ 2VL1A 4FLXA 4E0DA 4ATNA 1O1WA 2ZOMA 4LF8J 3I0RA 1MWMA 4EEYA 4FVUA 4BR7A 4RW9A 4XEIA 1EIYB 4HTJA 2WW8A 1MMLA 3LALA 4DR1F 4QYZK 1JMTA 4J2BA 4P73A 2VGMA 2DVIA 3PO4A 4KREA 1Q8KA 3WQPA 4EZ6A 1C0TA 2B7CB 3EWGA 5BRHA 2R7OA 4ISFA 4GKJK 2FJWA 4RUCA 1NK5A 4USKA 2L41A 1R27B 3SQ0A 1N34F 2CPEA 3QETA 5F3TA 2IDEA 2W2OP 4FZXC 3JSMB 3W61A 3H1VX 1H74A 5E3RA 4P9SA 2ALYB 1D09B 1YDLA 2B4VA 4PXEA 1YHQS 1UVKA 1DLOB 5KFUA 4DQ8A 4ECYA 3KNGA 3KHRA 2ZUGA 5C2GA 4FZYA 3DNCA 4C48A 1RWVB 1BG3A 4UOFA 1RT5A 2WB1D 4KHRA 4WKYA 4OHYA 1ZAXA 4A8SA 4ILMA 3PXGa 2QGFB 3FSYA 3IO1A 2QKKA 2QFIA 3WHIA 1OYEA 2EXUA 5FRNA 2FY8A 2CPYA 4USHA 2CNOB 2AP1A 4FJ9A 4HDHA 2K1RA 1TL5A 3I4PA 3C7NA 1WSVA 3GG4A 4F50A 1EQMA 3JTOA 2GAGC 4C0BA 2MZ1A 3HBTA 4NCBA 3ZNJ1 2F7TA 2ZF5O 4R5PA 4HL9A 2J4RA 1N36J 4BDZA 4M95A 1S12A 2QLFB 1P1TA 4CLUA 3UI3A 3G0ZA 4I9QA 3GU0A 2O8EB 4KRWA 1C0UB 3ZX3A 4RCHA 4C8NA 4O3NA 3RAQA 5AT1B 4N8OA 4X84A 3B8AX 1HYSB 4IUFA 4JYAF 1NDPA 2NNWA 5B0BA 2E5LF 2HWHA 4M5DA 2LKZA 4X66K 2OEJA 5A0YA 4LF8F 2YY3A 1VQNN 1S5ZA 2ZUAA 2Z1GA 1W25A 1YTUA 3WNGA 1VJWA 3J7ZT 2HNZA 4DV4K 3T69A 2W7AA 2VWJA 1Q1KA 1U0HA 1YBUA 1AXQA 3PIOL 5IT9O 2HYIB 4DTMA 3V6DA 2L48A 5D6GA 3AVNA 5D77A 2GQQA 1VC6A 3ZC4A 3EY1A 1NK7A 1R0AA 4JD2A 2HFUA 4WKRA 2QK9A 2HKEA 3HHNB 4M1KA 1LCUA 4B3SF 3C3LA 2ZGYA 1JLFB 1LEOA 3MCMA 3R3LA 2HWIA 5BR9A 2B6AB 1DJ0A 1HW9A 4A47A 3SV3A 4X64J 2ROGA 3AVLA 4OYPA 3RAXA 2ACMA 1BQMA 2P9UB 1VRTB 4AL7A 2XLJA 2WVEA 2CFXA 4HLBA 3U8XA 1S1WA 3LWLA 3ISZA 3VAHA 1XNRK 3BGUA 4OYMA 1T9TA 3D2EB 1QQNA 2SXLA 3TJAA 1H2VZ 3OSPA 4DL2A 1Q9XA 1BWVA 3TA0A 1NKCA 1Q16B 3P3DA 3TA1A 2IGIA 5D15A 3GIMA 2XSJA 3CCZA 1SJ4P 1FJCA 4OHWA 1RAOA 4C11A 1U49A 4LFAK 2MGZB 2VJVA 1HBNB 4YFUA 4JKDA 2QT7A 1LWCA 2I2YA 1HNWJ 4GVBA 4B3RJ 3R7SB 3VQPA 3KLFB 1ZBLA 1FTRA 1C1CB 2MSSA 2CXEA 1OKJA 4P2MA 2LXFA 5FDLA 3UVJB 3NP5A 2XYHB 3QIDA 4GKKK 3KOAA 2O8FB 4U8VA 2A0FB 4AILC 2BJDA 3G4SS 2JGUA 5HP1B 3D6FB 3G96A 1TK5A 3TAQA 1JWWA 3E2EA 5HRSA 5LOQA 4KC5A 3MM9B 1NGFA 1S6PA 3GILA 4IG0A 4O3SA 2ZZTA 2IIHA 3MAHA 3QO9A 4YNQA 2C3MA 3IC1A 1VK0A 2WCXA 4Z2XA 1SC4B 1ZBIA 2J9DA 2AKWB 3CO9A 4CLKA 2ZBIA 1GH8A 5D0GA 4CP5A 3WNHA 4A8WA 4DV5K 3BKUA 1DARA 2HFOA 4X64F 5C42B 4ES2A 5IM0B 2C2DA 3BUZB 1HX1A 3K59A 3ET6A 2IVPA 4M5MA 1J53A 1VQ6S 3CUNA 4C8ZA 1P9QC 2XRIA 4FP9A 4HI1A 2OFGX 4OV6A 1A6LA 4NXMF 1U8SA 3BP8A 2E5HA 3R5GA 4BVOA 3FBCA 1NMNA 4Q2LA 4ES3A 4CO1A 1LAWA 4IO9L 3G2XA 1NK6A 3P4UB 3W63A 1NCLA 4R79A 5F0UA 4M45A 3W2WA 3F5TA 3BSCA 2FLOA 2Y0SD 4KGMA 3DLEA 3NY0A 5ADXA 2HS4A 2JLEA 1SH0A 5LSRA 5LMUK 3OL8A 1DKGD 2A6OA 2VFVA 1HNWF 4B3RF 1CS4A 3OXGA 2AA4A 3N01A 4RBUA 3CD5A 3Q22A 5FPNA 4N8NA 4IEIA 5KFHA 4B08A 4OLPA 5A76A 4CE9A 1NLVA 5KFJA 2CPZA 3QJLA 4NMXA 1LXJA 2QWQA 4FXWA 2YPYA 1NDCA 2P9PB 3TTDA 3CDUA 2AJ0A 4RG8A 4E19A 4PG6A 4IJNA 3M1FA 1WWHA 5EY4A 4PEOA 4FWMA 2V4QA 2DH7A 3J81U 1W2IA 1CSJA 3P49B 4M3RA 3DRSA 2HK3A 4CZJA 5BYSA 2ASPA 1IKWB 4KV8B 1S0VA 4BQLA 4CK3A 4LF5J 3NAEA 3QESA 4L76A 1YTAA 1Q78A 4CJFA 4CGJA 1W26A 3OLAA 1WAJA 4CGGA 4PWDB 3H5UA 3CIZA 2E1CA 3V4IA 4IQMA 4IOAL 3LM9A 3Q8SB 3H5YA 4GY2B 5KGWA 1V5IB 3JQJA 4P2XA 3PHEA 4B3OA 3MPWA 2QL5B 4ES1A 4KKOB 4G1QB 1HMVB 1KAYA 4DU4A 1YJRA 2DPIA 2YKMB 5HMYA 1QAJA 4EFHA 3VQ9A 4ZLPA 3MAAB 5MLCV 1C6VA 3SFUA 3TQ1A 1HJRA 2N7YA 2P9KA 2ROPA 2P9IB 3K8WA 4FW2A 4MO4A 3PFEA 4JI2F 3S7RA 3PR4A 1SH2A 2BACA 1SUQA 3ITHB 4DOZA 2BH1A 2ZE2A 2CJAA 4OJ3A 3R5DA 3KG4A 1S77D 2X6NA 4WU3A 5DZ7A 3QGIA 2QWPA 5AXNA 1VHIA 1BU6O 2XNRA 2N3LA 5KFOA 2DHAA 2F40A 2BOAA 4QS9A 3ZEUA 4IFYB 3V9UA 2F4VJ 4OLOA 2VONA 2R7SA 3WX4A 1BQXA 3OS1A 2YNHA 2GWJA 1MDUB 3LTOA 3ILJA 4J2AA 4YS2A 1GLEG 2B4JA 5HOOA 1BQNA 5HBMB 3UWTA 3M9OB 1NKBA 4O3QA 3DOLB 4L74A 3QMQA 3HHLC 2G8VA 2LXUA 2P6TA 5KRTA 1GX6A 4LF5F 3RW6A 4TLRA 2BRLA 2IC3B 4N7TA 5ETMA 4DQQA 2C3UA 1MU2A 2NLXA 1F6TA 1WBBA 3QEXA 3IS9A 2XULA 1TV6A 2HNYA 4AHRA 3K9JA 5B8HA 4CYUB 3MAQA 3KUGA 4IO8A 5HANA 1FXXA 4WF9L 2IVFB 1LWEA 1HD1A 5ETSA 2KVQE 3OTOK 1D9FA 3PLAA 4HCCA 1GOBA 2KYZA 3A8YA 2QTDA 3M30B 1N5TA 1UPPA 2EFNA 2XTJP 4CZGA 3R7BB 3RRHA 5B0CA 3GFYA 1WD6A 4DZ6A 1U04A 1HYZA 1JLCA 1OPZA 2FZGB 3NS5A 4K43A 4ZP7A 5LJ5Y 1WKLA 1SPBP 5CYMB 4MQ3A 4C3KA 4W4MA 1T3NA 4ZHRB 2MZQA 3H20A 4CGHA 3ULEA 2MZJA 3W2VA 1RCHA 2VJUA 3O9SA 1RT3B 3AA5X 2G8KA 3IRXB 2IM3A 5KG6A 3SV4A 4O44B 3VGTA 2Z2YB 1XTZA 3IBCB 3OL6A 1LW0A 2E2OA 5KT2A 4IH5A 1G4CA 1BWEA 5KG3A 1YBTA 1HKBA 3CC2S 3QNNA 4JKCA 2F4VF 5HVHA 1ZPVA 4FK4A 3G8QA 3QJPA 2BM1A 2V68A 5L39A 3LP1A 4HHTA 5L9XA 2NRHA 1CBKA 2XS2A 3DI6A 1RT1A 4M3UA 2CJQA 4Y0FA 2RPIA 2DR7A 5DLFA 3UW1A 4DTJA 3D4JA 3CMAN 5KFEA 3SZ2A 4DSLA 4ANCA 3FZKA 1IBKJ 1I3AA 1ZTTA 4ECZA 4DS4A 1EKSA 4F3OA 2R2TA 2VH7A 4K0KJ 3G82B 1F5BA 3SFGA 2B56A 2KRRA 3M3ZA 3PYFA 4A8XA 2F63A 4OJHA 4RUBA 3BN7A 3P1GA 4DTNA 4YDUA 3ULHA 3I4HX 1IJFB 2MKIA 1C0MA 5SWMA 3GFZA 3ZX2A 4DFPA 4DUZJ 3SCKE 5GMDA 1F9FA 1LOTB 1E6YB 4FJ7A 3TU5A 5JVGQ 3R6MA 1FRHA 3U6FA 3CCMN 1VQ7N 1VQ5N 3TA2A 2VFUA 4Z94A 4E1MA 4IOXA 4DSFA 1HPZA 3QT7A 1N32J 3H8YA 2O1PA 1DHMA 2KT2A 3TZZA 2DFHA 2C28A 2DIVA 3O9TA 3KDOA 2PIIA 1MA9B 3VGLA 4DG1B 4B9NA 2CJKA 2KHDA 3TWZA 1VRUB 4LBPA 1RAEB 3Q0AA 2XO6A 2D69A 4LQ3A 4OHZA 2RKIA 4JI7K 3KMSA 2QMUB 3VQ7A 2H4YB 1NGBA 4J9PA 3VAKA 2Z0GA 1NJYA 1VJQA 1AA1B 1JCFA 1HNXK 3UNYA 4DV3J 1TVRB 2RUGA 2QJ3A 2ZFHA 2BKNA 2BJ1A 1FJGK 4PWUA 2VFSA 4ID8A 4Z4GA 2M70A 4F7VA 5M1QA 3K9KA 2QMXA 4OKEA 1JLEA 2R42A 3CCSN 3W5XA 3J80O 4YP3A 1Q0NA 2DPJA 1HBUB 3VEXA 3GG0A 3KFWX 3BPSP 4YOYA 4CF8A 3TVZA 3ZT2A 4C8KA 4I67A 4NA3A 1D3WA 4ZP9A 4KH1B 2CADA 3DHWC 4I68A 1GNKA 1RT4A 1LWXA 3SQOP 1TUYA 3DLRA 1IBKF 2RUSA 2E1YA 3EZWA 3LP2A 1KRPA 3D45A 3UCUP 3UN5A 1JB0C 1BIUA 5H1SV 5IT4A 4KHPK 4CLPA 3ZT1A 1R43A 4ZVTB 4B1YB 4PKDB 2QLBB 3UKUA 3HSTB 3M9NB 3MFHA 4R8UB 1VGYA 2FF6A 4CHYA 5FLXU 3WXIA 3SCXA 4ETXA 1GMWA 5K9FA 4DR2J 2ZH3A 1TKZB 2VQFJ 3QT6A 4NLTA 2HOEA 1NBEB 2VBYA 1TFWA 3GWCA 1KAZA 3SQGB 3NMAA 4LD0A 3DXKB 3PNIA 2A10A 1OH8A 1IBMJ 1S99A 3OVSA 3LL3A 4OI1A 3PW4A 1HBOA 1N32F 1M0SA 4NLXA 3MN6A 1F3FA 2HBZB 4ZPCA 4A8YA 3C94A 2Y1IA 3KKRA 2C3PA 3NOCA 1JLBA 3D5MA 3O08A 1FXRA 4ZJOA 2PC6A 5F0WA 3KJVB 3M05A 3JAMU 4FNHA 4UOHA 3D67A 3PX0A 5B0DA 4YY3F 1ZYQA 3C0BA 3IWLA 5AXKA 3I8DA 2VOOA 3RJMB 2GNKA 4DV3F 1K44A 3H42A 3WEEA 5EVZA 3WUHA 2RDIA 1WNSA 2YWFA 1KSPA 2DK2A 4LFBJ 2W9CB 2P51A 4JV5J 2GVDB 5LMNJ 4M3TA 4J90A 1Q86T 1RT6B 2XGPA 2C3YA 2YX6A 3OYEA 4W5RA 4DQSA 2VBWA 3CFPA 2EPIA 3E9PA 1HI1A 3D6HB 2JVOA 2MYFA 3FKBA 1Y3KA 1NM2A 4ID5A 4DHYA 2HGMA 1S1XB 1RDUA 3EKUA 5BN9A 3BKTA 1D8ZA 3SBTA 3MEDB 5J2PB 1K1QA 1FKAF 3FMWA 2WBRA 4QPTA 2MKCA 1B7FA 3BZQA 2ZOGA 2V6AA 3KJFB 3IUCA 4DR2F 1J2VA 5CZXA 2HLTA 4LBIA 3OR2A 3OYGA 3A8KA 1FVSA 3CJ1A 2VIHA 3PX4A 4KFBB 1NGDA 1J5EK 1U2RA 3QEPA 2V2ZA 4JI1K 2L08A 3QSYB 1TL3A 1MG7A 4DV7J 4Y1CA 3KYLA 1IBMF 2OAUA 4LF9J 3VHQA 3LDLA 2D3ZA 3DXMA 1EZZB 5K8OA 1SKWA 3NL0A 1UZDA 3PJ9A 4HI2A 2VQEJ 1V4TA 3MEGB 4MJKA 1JKHB 3J7A1 4YQWA 1RWNB 1L5UA 3ZSWA 4WFBL 3V6KA 3OFHA 2OPSB 1RT2B 3JQKA 2CQ3A 2XHCA 4DV2J 4I7FA 1X4FA 2CJBA 3ENQA 3F9KA 2FGCA 1U1RA 2HHVA 2O01C 2GC8A 2BR0A 1NG9A 2X1BA 2E1PA 1UZHA 3QGHA 3JXOA 1RFQA 1YHQN 2BJEA 3AHPA 5E2QA 1LNQA 4NLDA 2QFJA 2JSXA 2DT9A 3RAMA 1PYSB 1TELA 2FBTA 2CGLA 3V1RA 5J1NA 2HQ3A 4ZTJA 3TARA 4NE9C 4ENOA 5L1IA 2ZH9A 1YIJS 1HNIA 4OPKA 2DHXA 5E33A 1HWKA 4JV5F 3S1TA 3GZ7A 5LMNF 5GADP 4IH7A 3CCWA 3I9V9 3HPOA 2DR8A 1HNZJ 3O6QA 3KLEA 3MWTA 4ECRA 2AEMA 3R27A 2E9RX 4I1TA 2HHHJ 2MZTA 2IM2A 2O4GA 3HZ6A 3FEZA 1NK0A 4DFMA 3MR7A 4ERDA 3VPZA 3H08A 2K2PA 1W7AA 3GYXB 4ZVHA