1S1TA

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with uc-781
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
541
structure length
533
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 150
structure length 533
sequence length 541
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1tA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1tA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1tA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1tA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s1tA05
5F9LA 1SH3A 3DMJA 4CCHA 4KSEB 4O0JA 3MF5A 3AO1A 3H08A 3C95A 2P51A 2G8UA 3DLKA 2YNIB 3T1AA 4EO8A 2RPIA 1MMLA 3UR0A 3AVGA 3CG7A 1SL0A 5KFMA 3HPHA 1SH2A 4O3PA 3VQPA 3AA2A 3CM6A 1FKPA 3QIPB 3QIOA 1NJXA 4FS1A 3KOAA 5C5JA 1HNIB 4CJWA 1RT6B 4C8LA 3S9HA 4CGDA 4ELUA 1GOCA 1EKEA 3QEWA 2YV0X 2GUIA 1RT7A 3KK2A 3T5LA 5C42B 3KIOA 1TK0A 1C1BB 3V81B 2P5GA 1CSJA 4I2PB 1NK4A 4J9SA 4CEFA 3GIKA 2F8EX 4M94A 1JIHA 4GVMA 1T7PA 3SI8A 4Y1CA 3C6TA 4AHTA 4MFBB 3V6DA 4RW4A 4CF2A 2E9RX 3QEVA 4ELTA 2VA3A 2CJQA 2R8HA 1LW2A 4CF1A 4PQUB 2Q3SA 4CEAA 3L2VA 3FQKA 3SFUA 4KAZA 4FZZA 3PJWA 3D28A 2FVSA 5J2PB 5SZTA 2WHOA 4KV8A 1GX5A 3QEIA 4FK4A 4ZPAA 1JLBB 1D5AA 3WNFA 2YKMA 4ED2A 2YNFB 5JS2A 4W5QA 5KFTA 1JLQA 3LWMA 1Q9YA 5EDWA 5HRSA 4LSLA 3H98A 1ZBFA 3H2LA 4FJ8A 3QIDA 3PW0A 3RB6A 4TY8B 3P1GA 2HNZB 4HTUA 1A5VA 4WFXA 4F4YA 4Q43A 4FW1A 1S6PA 4YFUA 3ZSRA 5C24A 3HP6A 3MEGB 5KT7A 3M8RA 3CJ4A 4DLEA 1JXEA 4FJXA 3CM5A 2RN2A 1QUVA 1L3SA 3CFRA 1X9MA 4Z4IA 3OLBA 4RW7B 1QSLA 4EYIB 2OZSA 1NK8A 2XWYA 3S3NA 1D9DA 3NKYA 3UQSA 4DU1A 1TKXA 4K8ZA 2OPPA 1VSEA 3OVNA 4AHRA 4CHYA 2GC8A 2C22A 4CGGA 2BRLA 4NLQA 4FLZA 4RW9A 4KI6A 2XGPA 3T3FA 2XI2A 3TAPA 5KFJA 1KHWA 3OL6A 5KFUA 2WONA 3Q8PB 3G6XA 4NLXA 4MK8A 4NCAA 1FKPB 1C1CA 1S9GB 3V9UA 2XI3A 3ITHB 3MECA 1EX4A 2ETJA 4IRKA 2X6NA 1J5OB 5HRPA 1VSIA 3ZSOA 3GYNA 1SKRA 5KFFA 5F8GA 2HNYA 3OSNA 5KRSA 3U6FA 4NCGA 3VQSA 1VSLA 1S4FA 3SNNA 1RT3A 3NF8A 4JS5A 2E4LA 1W9HA 4E0DA 3GILA 4HCBA 4CIGA 3C6TB 4Y2CA 1N56A 3V6DB 2F8SA 4NCBA 1CZBA 4DEZA 4CGFA 4B8AB 3LP1B 1QHTA 3M9OB 1JLAA 4UQGA 2R8JA 2A1RA 2G8HA 1KCFA 2FLPA 3HT3A 4DU4A 1D8YA 4OKKA 1KVBA 4CHOA 5FDLB 3IAYA 1Z25A 1RT4A 1WSGA 3PO5A 4Z0UA 4OL8A 3KD5E 5HRRA 4MKAA 4FW2A 4K4ZA 4NLYA 4K4UA 4QWCA 4J9NA 4O3RA 3GV7B 3EZ5A 4PUOA 3KLFB 3RMBA 3OYIA 2RDJA 3ZT1A 5DGBA 1KLMB 1IKXA 5KFXA 3AO2A 1IG9A 2VG7B 1S6PB 1C0UA 5C24B 4E7LA 2OPQB 2IM2A 4IQXA 2JEGA 3HO1A 1RBRA 3TAQA 1U49A 3CJ0A 3NH1A 3L2QA 3V1OA 4OLBA 1JL1A 4O44A 4QWDA 1QE1B 4FJ5A 3BJYA 3RB4A 2OPPB 5HLFB 3CVKA 4LQ3A 3PX4A 1WSEA 3ZSVA 1S5JA 4ECQA 4FS2A 4CGHA 4RW9B 4NLGA 2AU0A 1TVRB 3DLGB 4DU3A 2AX0A 1C6VA 3GQCA 5DG7A 2R8IA 2FVPA 4Q0BA 4DF4A 4Z4GA 1SV5A 3M8PA 4ED0A 4RUCA 2WOMB 3MECB 2XO7A 1B92A 3PW7A 2FJWA 4OKEA 1C0MA 4RNFA 5F8MA 3DM2A 2HNYB 1HYVA 1KFSA 5I42A 1S48A 4KHSA 4ID5A 1RA6A 1WSJA 4OGCA 4O0IA 4WE1A 3K58A 2KTQA 4F2RA 1ZBLA 1S6QA 2HNDB 4KB7A 1VSMA 4FJKA 3QGIA 1IKVA 4FJ7A 2JEIA 4HHTA 4XPEA 1F21A 1JLAB 3ZT4A 1TL3B 2FVRA 1RT2B 2I5JA 4URQU 4ECWA 3M8QB 4CJVA 5HBMA 3TI0A 3SJJA 1ZTTA 3AVIA 4ECSA 3I5AA 2XCPA 3NAEA 1RILA 4ZVEA 1I6JA 4J9QA 1RT4B 3O4NA 4OKJA 1NHUA 1WSFA 4DQSA 2IOCA 4RW6A 4E7HA 4IKAA 5D3GA 1BGXT 4CHNA 1R0AA 1ZBIA 3LPUA 3KLIB 4Y34A 1DTQA 4IRDA 1S1XB 2KZMA 3EPGA 5CZ2A 3ZT2A 3SYZA 3ZSQA 4YQWA 4HUEA 2IS3A 4DL6A 2GIQA 2BQRA 1RDBA 3QNOA 5CY4A 1SH0A 1TQLA 4NLDA 4IG0A 4O44B 4FLTA 3OYJA 1LW0B 4CK2A 3PO4A 4I2QB 3VQDA 3KMQA 1VRUA 4Y2AA 4NLRA 1NJWA 4KTZA 3WNEA 4KHUA 4ED6A 3VQ5A 2X74A 4DS5A 4FK0A 5KG0A 2HHQA 4ZP8A 3BSCA 2AGQA 3L2WA 3NHGA 5KRTA 3SPYA 4IKFA 1JLCB 1REVB 3BQ1A 3GIMA 3M8PB 3FFIB 3O3GA 2B5JA 4F3TA 1Q9XA 4XIUA 4ELVA 4M3YA 3ZCMA 3OL8A 2V0NA 4LD0A 3SUNA 5HROB 4W5TA 1IKWB 3NMAA 4ID5B 3VQCA 3KK1B 1RT5B 1EP4A 4IG3B 2B43A 4WE1B 5I3UB 3K59A 2D0BA 3NAIA 3MXMA 1MU2B 3QZ8A 3NAHA 3KHHA 1NKEA 3BQ0A 3H4DA 2ZKUA 1IKVB 1CLQA 1HMVB 3VN5A 4O3NA 4QPXA 4F8RA 2YHAA 4CIEA 1HJRA 4ED8A 3OYHA 3CDWA 4OJRA 3I8DA 4CJKA 3O4QA 4E1MA 4B9SA 3D0PA 1FKOB 4LQ9A 3M8SA 1CXQA 3OL7A 4Y3CA 4KHRA 4FYDA 1HNIA 4KI4A 2R2UA 1RT6A 3TQ1A 5KGWA 1LV5A 3I0RA 4EEYA 1Y97A 1C1BA 3V81A 3HVRA 4RW6B 4LSNB 5D3GB 1HNVA 1SUQB 4I2PA 4JV2A 1R0AB 4EBEA 4E89A 3FQLA 3PR4A 2FBTA 3SZ2A 4N56A 1TKZA 5KFSA 1WNEA 4WXWA 1NK7A 4MFBA 3PX0A 4K50A 3T19A 1T05B 5KT3A 4H4MB 5DQGA 4DL2A 4PQUA 4CEEA 2OPSA 1N6QA 1YT3A 4CF8A 3NDKA 4NLTA 4ZPCA 2ATLA 4RNMA 5J2PA 2V9WA 4FLWA 2NUBA 3KK3A 1DLOA 3HPGA 2YNFA 4IR9A 4TQSA 4YNQA 3PZPA 3OYCA 1T8EA 4RNNA 2HW3A 4DL7A 4G3IA 3BGRB 1EETB 1OS5A 4TY8A 4CK1A 2HNZA 5CYMB 3NBPB 3OLAA 3AVCA 4ID1A 3RWUA 2HHWA 1KTQA 4K8XA 3DRSB 5KFNA 1BQNB 4R8UA 4WFYA 3BSNA 3HPOA 3SUQA 2KFNA 3K5LA 4FJNA 2VG5B 3LWLA 1CZ9A 2WTFA 2W9CB 3KTQA 2AQ4A 1RT1B 4YMEA 4Q8EA 2IMWP 3MFIA 3DLHA 3CYMA 4AHUA 4KHYA 4OVLA 3RAQA 4M45A 4ZVHA 4ED7A 3RBEA 4ZVFA 2FBXA 2XCAA 4OLAA 5KFOA 1L3UA 2GV9A 5KFVA 3VQ6A 4JRPA 4O4GA 3HP9A 5L1KA 4CFCA 3NFAA 4DTUA 3NE6A 4DSIA 1BCMA 3QZ7A 3ZT0A 4FJMA 4KHWA 1S9GA 3ITHA 2HHTA 3QYYA 1KLNA 1VSDA 2FVCA 1J5OA 3MEEB 3H5YA 3I0RB 1RDRA 4BACA 5KFAA 3DYAB 2OA8A 4EO6A 4QW9A 1HNVB 2F96A 3K5MA 4B9NA 4K4YA 4CJLA 5KFZA 1TKZB 5KFEA 3OYGA 3H40A 4CJ5A 4DQIA 4M95A 4DS4A 4CESA 3KHGA 3LP1A 3P5JA 2ILYA 1VSHA 2AJQA 4MIAA 3S3MA 3OYEA 5F8JA 1A5XA 1D9FA 5C25B 2BE2A 2OPSB 1N6QB 2ITGA 2PYJA 3TR8A 3G86A 4HKQA 2RF2A 1NKBA 3RMAA 4KHQA 3JSMA 4DTXA 5FDLA 3KK3B 1DLOB 4J2EA 4QW8A 1K1SA 1W0HA 4R5PA 3LP3A 3KLHA 3I5CA 3GV5B 2B4JA 2IM3A 1RNHA 1TKTB 4TYAA 3KLFA 3IS9B 1IKYB 4Z4FA 3P83D 4ZP7A 1KLMA 4BDPA 4FCYA 1XR7A 4DSKA 4J9PA 5DGAA 2VG7A 4R8UB 2OPQA 3RRGA 4CFAA 1TAQA 3TAGA 3OYBA 4FJHA 1FK9B 1RTIA 3VQ4A 2HMIB 4F4ZA 2E9TA 3ISND 3TAMA 3SUOA 3IGNA 1S0MA 4Z4CA 1HQEB 2VWKA 1RCHA 1QE1A 3KKRA 4E7IA 4URGA 3AA4A 5KFIA 5HLFA 2DTUA 4EZ6A 3KLEA 2J6SA 3AVHA 3NL0A 4O4GB 2ZE2B 4FBTA 4M3WA 1TVRA 3VA3A 4IFYB 4O4RA 3DLGA 3OSPA 1WAFA 3CJ5A 3PJXA 3AVLA 4EZ9A 2W7PA 4QWEA 2WOMA 4IOBA 1VK0A 1S1UB 4RZRA 1XR6A 2R8KA 2HWIA 3TAFA 1IH7A 2HHXA 2D3ZA 4HVJA 1XI1A 1GX6A 1HRHA 3U3YA 1NJZA 4E7JA 4F50A 1U09A 4NYFA 2HNDA 5KFCA 3LANA 5F8NA 5KG3A 2YKNB 3F9KA 4RNOA 1S9EB 3QESA 4MQ3A 5F8IA 4GC7A 4E7KA 1TL3A 4N5SA 4KTQA 1RT2A 4B08A 3M8QA 3AVJA 4B9UA 2BE2B 1BCOA 2RF2B 3UIQA 1S0NA 5J2MB 1TKDA 4CE9A 3JSMB 5KFRA 4K4SA 3V9WA 2IM0A 1TAUA 3MR6A 1BIUA 2O5DA 4TQRA 2XGQA 4R5PB 4FJIA 4BWJA 5KFBA 4FLUA 3KLHB 3KNAA 1U48A 1S0OA 3PV8A 1RDAA 4Q44A 2KFZA 4QWAA 2YNHA 2HWHA 4E1NA 5KT2A 1TK8A 4C8KA 2VG6B 1U4BA 4RU9A 2G8IA 3KLIA 2D7SA 1XHXA 2W9BB 1RYRA 4I7FA 1S1XA 3Q8QB 3F73A 4HUGA 3DLBA 4BDYA 4LY7A 3KKSA 1NNDA 3N6NA 2PYLA 1RTIB 3SQ4A 2FVQA 1UOCA 3A2FA 3TAMB 1O1WA 3UDLA 3N6LA 5KG2A 1LW0A 3QLHB 3TVKA 4QCLA 4I2QA 2DFHA 4ECTA 4PA1A 3AVMA 2ASDA 1BQMB 1JXBA 3KLEB 1QTMA 3VQBA 1S97A 3SV4A 2P5OA 2XY8A 1B9DA 4E3SA 4M3UA 2KZZA 3L3VA 3OL9A 3OYFA 5EWEA 3AO4A 1IM4A 1JLCA 1REVA 4DFPA 4ZPBA 4G1QA 3FFIA 3ZSWA 3SFGA 5FRMA 1TP7A 4TXSA 2D0CA 4J2DA 1SKSA 3IG1A 2OPRA 3RTVA 1LWFA 4CJPA 2PZSA 3ASMA 5CYQA 3RBDA 1ASWA 4DTSA 2IC3A 5HROA 1IKWA 3KK1A 1RT5A 4IG3A 5I3UA 5DLFA 1KSPA 2FJXA 1N4LA 3NCIA 3WNHA 4F3OA 4LH5A 1MU2A 3KLGA 2UVWA 4KAIA 1HMVA 1VSKA 4ZTFA 2A1SA 2FLLA 3H5SA 4JV1A 4HYKA 1HPZB 1LAWA 4BE2A 3SI6A 5KFKA 4O3SA 3PR5B 3EY1A 5DK5A 2D5RA 3V6HA 1DTTB 1QSSA 1FKOA 3K57A 3AO5A 3O3FA 4ZP9A 4CHQA 3G6YA 1TK5A 1RYSA 3D45A 3KHRA 3SCXA 4H54A 3MR2A 4K4TA 2FJVA 3H5XA 1XWLA 3OYNA 4JS4A 4AILC 3OJUA 3MAQA 3QERA 5EUHA 2YNHB 4LSNA 1YTAA 3HKWA 3VA0A 1SUQA 2GIRA 2DFFA 3CFPA 3RB3A 1SL2A 4ECUA 2B6AB 4ED1A 4KREA 4I7FB 3PX6A 1T05A 3VQ9A 1UWBB 4B9TA 4H4MA 4CFBA 3ISNC 3M9NB 3TAEA 1X1PA 1WSHA 3LP2B 3T5HA 3NGZA 4W5OA 4J2BA 5KFDA 2FLNA 3B6OA 2PY5A 5HP1B 2Y1IA 1YVUA 3I0SB 3SQ2A 4WFZA 3WNGA 5T14A 2C28A 4X2BA 4QOZB 3QNNA 3FRZA 1W25A 3BGRA 1EETA 3NF6A 5CYMA 3NBPA 4ECXA 3OYLA 3NF7A 4G1QB 3HHKA 1VRTA 4IH5A 3DRSA 1RDCA 1BQNA 2IM1A 4CIFA 3IG1B 4CGIA 2OPRB 3LPTA 2VG5A 1LWFB 1GOBA 2W9CA 5CYQB 1RT1A 4YP3A 2W8LA 2IC3B 2BGGA 3OY9A 2IBKA 3BSAA 1JLEB 3ZSXA 3SPZA 4OPJA 1S9FA 1RTDB 2D0AA 3KLGB 1TV6B 4CECA 4CJTA 3L3UA 4KB0A 1T94A 4FJJA 3LDSA 5J2NB 3BREA 4FLVA 4IH6A 4MK7A 3LZIA 2EHGA 1LWCB 1KRPA 3GIJA 1LWEB 4NLVA 3KHLA 5EWGA 5EWFA 2DPJA 3GV8B 4O3OA 2YNGA 2BQ3A 4KB1A 2W42A 3HVAA 5DG8A 4ZVGA 2X78A 4CK3A 2ZD1B 2JC1A 1WLJA 3G10A 3KLVA 1C0TB 3MEDB 3BDPA 1JKHA 2AGPA 3MEEA 2BRKA 4DTPA 3CDEA 3DOKB 3DYAA 4WZMA 1X9WA 4F4XA 3PY8A 4Z4EA 5J1EA 2J6UA 5T7BA 2BDPA 5K14A 3ZT3A 1RBTA 4DQPA 2HHSA 3PHEA 4QWBA 2JEJA 5KT6A 2BANA 3DRPA 2G8VA 4EP5A 2C2RA 4I9LA 1QAJA 2WK4A 4CJEA 5C25A 1NJYA 1ITGA 3CWJA 3VQQA 3HK2A 3V1RA 4OPKA 2D3UA 4MIBA 3EPIA 3S3OA 3VQAA 5F8HA 4B3OA 2DPIA 3IRXB 4CEBA 3NGDA 4FBUA 3ZSYA 5KT5A 1TKTA 3G6VA 3EZUA 2X6SA 4FM2A 3IS9A 4FM0A 1IKYA 1N5YA 2R2SA 2EX3A 4YR3A 3C6UA 4EBDA 2R8GA 1VRTB 2AGOA 1C1AA 4TLRA 2D41A 4AHSA 4FJLA 3K2PA 3ULDA 1BIZA 4I9QA 1VSJA 1EXQA 4KTWA 4DFKA 2F8TA 1RTJA 1FK9A 4KO0B 5KFYA 2HMIA 3CO9A 1S1VB 2FBYA 3NH0A 3HVWA 3VQ8A 1HQEA 2IGIA 3HM9A 2HAIA 1U47A 3K5OA 3V6KA 4EYHB 4DG1B 3CIZA 3ICLA 1N48A 4DTNA 3V1QA 2IAJB 3AVKA 2HB5A 3GIIA 2ZE2A 4CJRA 5KFWA 2ALZA 1NK0A 3JYTA 4IFYA 4B8CA 3RAXA 5KFLA 2YNGB 4URSA 5DMRA 2OYQA 4ZMMA 2BQUA 4ECVA 3V9SA 4KKOB 1QQCA 3EYZA 5EU7A 4CJFA 4MH8A 1KVCA 1S1UA 3DDKA 4CJUA 5J2QB 1JKHB 2C2DA 3QINA 4KFBB 4CJSA 4B9VA 2O4IA 3SV3A 4RW8A 1XR5A 2QKKA 1NHVA 4W5NA 3QETA 3TANA 5KTQA 3DLEA 4NLWA 1KHVA 5J1EB 1S49A 5K14B 5JS1A 4DL4A 4N76A 1LAVA 4W5RA 1I39A 1UA1A 4TYBA 2UVRA 2YKNA 4NYZA 5KG6A 3CJ3A 1S9EA 4MK9A 4Q8FA 3PVXA 3DI6B 3RB0A 2BANB 3DRPB 4J9LA 1BL3A 1WSIA 3OYDA 3KJVB 3T5KA 2E9ZA 4K4VA 2HVHA 5JXSA 1K1QA 1RBVA 3KMSA 2VA2A 2HHUA 4FK2A 5DLGA 4DTRA 1RDDA 4CJ4A 2ATQA 5J2MA 2EC0A 3M9MB 1WN7A 4BDZA 3OYAA 4C8MA 4HCCA 4EP4A 3Q8RB 1WAJA 4PY5A 1BI4B 4B3OB 4TSXA 4GW6A 4F4KA 4NYNA 2QV6A 4K4XA 1JL2A 3G0ZA 1SL1A 4JUZA 2VG6A 3DRRB 5FROA 4J2AA 4CEDA 1N5YB 4NRTA 3C6UB 1L3VA 1JX4A 4NZ0A 4FXDA 1ZTWA 4ZP6A 5L1LA 2XY6A 2W9BA 3NH2A 3OHAA 3B6PA 1YTUA 5FRNA 1HARA 3HSTB 5DQIA 3HL8A 2J6TA 1GOAA 4H4OA 3HXMA 4F2SA 1RTJB 3LALA 1BHLA 3HYFA 3I5BA 2UUTA 3QO9A 4AHCA 4CF0A 4DQQA 5KI6A 3QLHA 4O5BA 4Q5VA 4PWDB 1ZETA 3MFHA 3AVBA 4NLSA 4IR1A 1BQMA 3PW5A 1RTHB 5KG7A 4ICLA 3NGYA 2P1JA 4BE1A 3JYTB 4ZHRB 4EBCA 3Q8SB 1ASVA 4XO0A 1FXXA 3DMJB 4DFMA 5CZ1A 4FJGA 5JUMA 4CJQA 5F9NA 4M3ZA 4RUAA 3DLKB 4RNHA 4WYLA 4RW8B 1T03A 3DLEB 4WXOA 4CEQA 3H4BA 4QAGA 2UVVA 3BQ2A 3DOLA 1XHZA 1QSYA 4KHNA 1KVAA 1RT7B 3KK2B 2IJNA 4DL3A 4ECRA 1HPZA 3QEPA 2WRMA 2XC9A 1S1WA 3VQEA 1TL1A 3C94A 2R2RA 4J9MA 1DTTA 2C2EA 1QAIA 1TGOA 1VSFA 4RW4B 4KHMA 1J53A 4J9RA 1LW2B 3CDUA 3ALYA 4WZQA 1A5WA 3PUFA 4C8OA 3OJSA 4M3RA 2VWJA 3QGGA 2V4QA 1K6YA 4KV8B 2B6AA 2YKMB 4DSFA 3AVNA 1JLQB 4IFVA 3L8BA 4IDKA 1UWBA 4LSLB 3OS1A 4H4OB 4NRUA 4AH9A 5HRNA 3BSOA 4JV0A 3QO9B 1NOZA 4C8NA 3LP2A 4KPYA 4TN2A 5HP1A 4NLOA 3I0SA 2JGUA 4ZPDA 1Z26A 1UA0A 4HUFA 4ICLB 3THVA 2ILZA 4BWMA 1D1UA 4Z4HA 4N47A 1C2PA 2XY5A 4FM1A 1TKXB 3T5JA 3CQ8A 4WYWA 5L1JA 4FZXC 2QE5A 1U04A 3OYMA 1XC9A 3FDSA 4L8RB 2O4GA 3OHBA 1YVFA 4Q45A 1J54A 2IDOA 1NK5A 2CKWA 2WONB 1T03B 1Q8IA 1JLEA 1UAXA 4CERA 4DQRA 1S1TA 1KFDA 1C1CB 1B9FA 3DOLB 1RTDA 3RMDA 4DLGA 2QK9A 4CHZA 1WNSA 1TV6A 3LAKA 1JLGA 1ZBHA 4B9LA 5J2NA 1G15A 4NCGB 5KFQA 3ZSZA 3IGVA 4CEOA 1LWCA 3LP0A 1S1WB 1LWEA 1RT3B 4DTMA 1TL1B 1HQUA 4DSLA 2R2TA 4FLXA 1JLFA 2UVUA 2ZD1A 4DTJA 1C0TA 3SUPA 3MEDA 4XPCA 1SKWA 1HYSA 3CJ2A 3DOKA 4RG8A 3O3HA 2WB4A 2HHVA 4DF8A 2RDIA 2YHBA 3BR9A 1ZYQA 2Y1JA 4JRQA 3TABA 4M3TA 3PW2A 1RBUA 4BE0A 5KG4A 4E19A 2I1RA 5F8LA 4IFVB 3AA3A 3N6MA 4IDKB 4CF9A 3FSIA 3D5MA 3AV9A 1IO2A 3VQ7A 4IRCA 1ZBUA 1D0EA 2KQ2A 4FVMA 4PUOB 3UPFA 4AHVA 4DSJA 1IKXB 2QXFA 5L9XA 3RR8A 3V6JA 2XHBA 3V9ZA 2AWZA 3AO3A 1C0UB 5KG1A 3RR7A 2Z1IA 3NGIA 2UUWA 2FC0A 1NK9A 1T3NA 5KGXA 3SQ1A 2W7OA 3IRXA 2XRIA 3TWHA 1L3TA 4M3XA 1L5UA 5L1IA 2WCXA 4K4WA 2RKIA 1JXLA 1S10A 1HYZA 2HVIA 4TY9A 2KW4A 1RAJA 3V4IA 1X9SA 3HVTA 1QS4A 4DFJA 4KO0A 3V9XA 4J9OA 2JC0A 3RRHA 4F4WA 5SWMA 4B9MA 1S1VA 3AVFA 4Q0BB 1S1TB 1SV5B 3CFOA 2LSNA 2GBZA 2OH2A 4KRFA 4ZTJA 2FBVA 1JLGB 4DG1A 3MXIA 4DTOA 2IAJA 3DM2B 4DSEA 4DWIA 5I42B 4O55A 1RBSA 2ZQBA 3E01A 3LP0B 2ASLA 4CHPA 1NKCA 2JEFA 2G8FA 1S6QB 1HQUB 3RMCA 2IJFA 1JLFB 4N41A 5KG5A 2Z1HA 4KKOA 3L2RA 2DFEA 4CJ3A 2I5JB 5J2QA 4MKBA 5HBMB 1HYSB 2Z1GA 2YNIA 3H5UA 2ASJA 4JLHA 4KFBA 4KBIA 3MR5A 3H59A 1J9AA 3LAMA 2JLEA 3QIPA 3NF9A 2G8KA 4GC6A 3SQ0A 3K5NA 4IBNA 4DL5A 4CEZA 4CGJA 1U45A 5DG9A 3DI6A 5C42A 3U3GA 3KJVA 4KE5A 4U6PA 1NOYA 5KFPA 3PW4A 2E6MA 3MR3A 2V4RA 4ECYA 1DTQB 2DY4A 3AA5X 4Y1DA 1ASUA 4FLYA 4NLPA 4O3QA 2OZMA 1BI4A 4FJ9A 3OS0A 4LH4A 2W9AA 4M42A 2Z1JA 2BR0A 5DQHA 4IG0B 5KFGA 3QGHA 4H8KA 3OYKA 3AVAA 3DRRA 3HJFA 1JLBA 1VRUB 5KFHA 4FZYA 2RKIB 4M41A 4U7CA 2G8WA 2R7YA 3V4IB 2W8KA 3E51A 3IN5A 3MXJA 3HVTB 4DMNA 2E6LA 4ED3A 3L2UA 5E41A 1NK6A 1RA7A 2XY7A 4YR2A 2AX1A 4IH7A 3KD1E 1I3AA 3OS2A 2B5JB 3LZJA 4PWDA 3MEGA 1BISA 2QKBA 3TARA 4OGEA 4CFDA 4R0EA 1RTHA 3MTKA 4ECZA 4RW7A 1EP4B 3E01B 1CXUA 4ZHRA 1Z4UA 4YR0A 5KT4A 4NLUA 4J9KA 4GMJB 3DLRA 2IA6A 3QEXA
chains in the Genus database with same CATH superfamily
3BBBA 4DR3K 1FNXH 3CERA 3DMJA 1WKKA 4DX8H 4O8KA 2XNRA 4BGBA 4O0JA 2CPFA 3TEHB 3AO1A 1DQAA 4RX6A 5DM7Q 3D68A 1CLFA 1WC5A 3IWNC 3DLKA 3MN9A 2RPIA 2L9NA 3HPHA 3DN9A 4JN4A 2DNGA 4P75A 5K20B 1NJXA 3NG8A 1RT6B 5TKWA 2ZBIA 2GS8A 3SIPB 1T9YA 5C42B 3C6HA 2QMWA 3HTVA 2OJ3A 4CEFA 1P90A 4H5TA 4LUBA 3GP9A 2WSEC 1JIHA 1T7PA 1VQNN 5E3AA 3MN7A 4RW4A 1WSRA 4UZBA 2IBOA 3QEVA 5AZJA 3RVCA 2CJQA 1YJ9N 3ETMA 4CF1A 1SBRA 2Q3SA 2RRNA 1N88A 1UP1A 4FZZA 2BJ8A 1A0OB 1T0TV 2FVSA 2PFUA 2WHOA 3QEIA 4ZPAA 1JLBB 3GJQB 3EDQB 2M2BA 2OEJA 3WNFA 2YKMA 4W5QA 3W9HA 1Q86O 3G87A 3ZX2A 2ZHOA 4LMZA 1RHKB 1X4GA 1RKIA 3P1GA 4HTUA 2D0PA 3ADAC 4Q43A 4FW1A 5ETSA 4KBOA 3WIUA 4CDIA 2DNMA 1S6PA 4ERDA 2O8CA 1VQNS 2AMCB 3HP6A 3AJDA 1QUVA 4NPOA 3ZTOA 2PFFB 4UQTA 1YJ9S 1W7WA 4RW7B 3VAGA 1S59A 2ERRA 3KXDA 3VAFA 2E1RA 3W66A 3KJNB 4BRGA 1U1OA 3NKYA 2DCUB 1TKXA 4CLPA 2AZ1A 3W61A 1VSEA 4KPCA 2JH3A 3TOQA 1FNOA 3D6FB 2XGPA 2KG0A 5KFUA 3W8GA 1FRIA 1JCEA 4C2MA 1IBKK 4NLXA 4NCAA 2XEXA 1S9GB 3V9UA 3MOZA 1SKRA 5F8GA 4B3MK 4USVA 2PN6A 1RAAB 3OSNA 3IR6B 2KU7A 1SZ2A 4LFBK 4FYXB 4BRQA 2KKHA 3POTA 2PO4A 3T1YK 3BPSP 1YJRA 4HCBA 4CIGA 2P9NA 4PG6A 4DEZA 2FSJA 4DR4K 3LP1B 1QHTA 1VMBA 2RHSB 3KNGA 4UQGA 1LOTB 4CBUA 2DY9A 1KCFA 2FLPA 3FNNA 3HT3A 3D1HA 2G9OA 4DU4A 2V4JA 2KLAA 2W2NP 4B3SJ 1VBZA 4Y0FA 3TZWA 2J8AA 5FDLB 4I6MA 5T7LA 3PO5A 1B7YB 1VQSA 1ATSA 2K06A 1XMQK 4JKDA 3MM7B 3UNYA 3EZ5A 4PUOA 1A7GE 3EDRB 1N52B 1H73A 2W2PP 3HCXA 1IG9A 1J5EF 4E7LA 3NGUA 1BY9A 4DN0A 4IQXA 1RTZA 2IYGA 2HHHF 2IDLA 5A2QU 2PIIA 3TO8A 3THYA 1XQSC 1O8BA 3NH1A 3V1OA 4MLEA 3ZEUA 1ITPA 4OLBA 4Z7CA 1U6ZA 4YDDB 2XZDB 4QWDA 1IBLK 1RGIA 3BY5A 3EX7B 2CH6A 3A13A 3G82B 1HNWJ 1GLBG 2EFGA 4ECQA 4CGHA 4DV4F 4RW9B 3PFEA 1TVRB 4TNOA 1IBCB 3OR2A 4FOIA 3C6AA 5BN9A 4BR7A 1VAZA 4ED0A 4DU7A 3MECB 3TWZA 2IVYA 2XO7A 1N8RT 3DRYA 4OKEA 3EGWB 5F8MA 1Y9OA 3DM2A 1KFSA 3CXCM 1WSJA 4CLFA 4U7UK 4X4RA 2BJEA 2DR7A 3HHEA 3CCSN 1V3ZA 4FWOA 1HD0A 2P9SB 2EI5A 2D3OR 4CM0A 4FJ7A 1AZSB 2JEIA 2LP4A 1F21A 2YWWA 5IT9U 4CJVA 4U67Q 5CAAA 2WBMA 2CNKB 3AVIA 4FF4A 2HKEA 3NAEA 2OMOA 4CLKA 1EIYB 2J8SA 4J9QA 1R27B 3CCVN 3KHYA 1KAXA 2F7TA 4W4MA 2YCHA 4A5BA 1XMOK 2HRUA 3K8WA 3MX5A 4RW6A 4IKAA 1N32F 4PCQA 1TUWA 3MI7X 5MLCQ 3LPUA 4CZJA 2GMJA 2CWKA 3SCIE 1QAXA 2ZC4A 2KZMA 3CCSS 3KWGA 1HFEL 2R7VA 2HF4A 3SYZA 4KQZA 3KUEA 4YQWA 3TYTA 5DM7L 2QLBB 1Q4RA 4O44B 4LFAK 3OYJA 3Q8YA 4JD2A 2HFNA 4I2QB 2BOAA 3VQDA 4Y2AA 4KTZA 1F3FA 4KHUA 3CCVS 5JICA 3VQ5A 4DR1F 2HHQA 4ZP8A 5CD4H 4V19S 3R3TA 4DR3F 5K9FA 2AGQA 4RWXA 1K73T 5IV3A 3MAAA 3SPYA 1S76D 2NRTA 1PJ5A 3CUNA 2Q97A 3L7OA 3GIMA 3M8PB 3FFIB 4JYAJ 4IEIA 4F3TA 1NEEA 1Q8BA 4DL0C 3KG4A 4XIUA 4M3YA 3OL8A 4LD0A 5HROB 1RLCL 1T9XA 1EX8A 4ID5B 3KK1B 4Y0WA 2B43A 1P8GA 3KJFB 3K59A 3DRXA 2D0BA 2R4FA 3NAIA 4FWKA 5IV4A 2C2OB 2HBYB 3KHHA 1NKEA 1Q81O 1HMVB 1SB6A 2NRVA 2V6AA 3UD4P 1RBLA 4JI2K 2BV3A 1BE4A 4OFZA 1SJQA 2YHWA 2Q2RA 2VFRA 3DKDA 3OYHA 2IVFB 4OJRA 3D0PA 3M8SA 4OJHA 4KGZB 3OL7A 4FYDA 4KI4A 3H20A 1P9QC 4H0VB 5DJBA 5KGWA 1C1BA 3HVRA 2ZM6K 4PG8A 4I2PA 1R0AB 4EBEA 5F0WA 3FQLA 3HMJG 1B0TA 3PR4A 2FBTA 4N56A 2XMWA 2KXFA 3T19A 3CETA 4H4MB 5DQGA 3EXCX 4C3KA 1DEJA 4NA1A 4CF8A 3NDKA 2ATLA 2V9WA 3R27A 2IRXA 3TSQA 4H5VA 2JNJA 4BRCA 3PZPA 2NZCA 3OYCA 4PABA 3SXLA 3OVSA 3GR0A 1YJUA 4CK1A 1WC4A 2XS7A 3P6YC 2APOA 1AYEA 3OLAA 4A8FA 4ID1A 5LJVA 2YI1A 5D4PA 4K8XA 5LMUK 5KFNA 3HPOA 1BUPA 5BYQA 4LC9B 1ZS6A 3ETOA 3CJQA 1RT1B 4YMEA 1IBKF 4WFAQ 4XTTA 3VPZA 2JSXA 4AM7A 3WC0A 2UXBK 3GSIA 3ILJA 3EXYA 2JLFA 4EUVA 2AYGA 2KRRA 4ED7A 2D4WA 2CH5A 2CPZA 2DNNA 2DR5A 3DFEA 3D3CJ 4O4GA 4LFBF 3T1YF 2E5LK 5L1KA 1NB7A 3EVWA 4CYUB 3CCUN 2ZGYA 4FJMA 3AB4B 1Q5YA 3QYYA 3A5OC 4LVNP 2HBQB 3J80O 4CO1A 4PXCA 1RDRA 5KFAA 2BUNA 3VEWA 2K3IA 4M5KA 4HDGA 1GMUA 3H40A 1M5KC 4CJ5A 2GMHA 3O6WA 1XMQF 2ILYA 2AJQA 2M9KA 3S3MA 5HSPA 1D9FA 4OYOA 3NOGA 2QWNA 4OZJA 2I2YA 2PYJA 3TR8A 3G86A 4HKQA 5AT1B 3HZ6A 4KHQA 2W4DA 3BZKA 1V3RA 3CCUS 2A6OA 4DMZA 3M6XA 1NDPA 3I5CA 3QWPA 2B4JA 4HTIA 1TKTB 1IBLF 3P83D 1KLMA 4BDPA 2WUSA 2VG7A 2IVOA 3AD7C 4R8UB 2FJEB 1FCAA 3TAGA 1R8HA 4UUXA 2GVZA 4FJHA 3VV2B 2EG2A 2HMIB 4BRKA 1JJCB 1S0MA 4U67L 2QW9A 2VWKA 1RCHA 1QE1A 2I9SA 3AA4A 3RYLA 5HLFA 4M5LA 3VEVA 4X4TA 2QSFA 4M3WA 4O4RA 2BTFA 4OZ1A 2V8HA 1WAFA 3GIRA 2MZ1A 1EARA 4C97A 2WOMA 4IOBA 3B8AX 4NEZA 2LFVA 4RZRA 1XR6A 2HWIA 5GIPA 3TAFA 4N8NA 1O0PA 1SJRA 4BRIA 4U7UD 2F63A 3PXGa 1VBKA 4DHVA 3U3YA 3W8PA 2A2DA 4E7JA 5D77A 1U09A 5KFCA 4UOCA 2HFZA 4H4KA 1XMOF 3M6GA 1H2TZ 5DETA 4B3TK 2LEPA 1IQZA 4N5SA 4B08A 4B9UA 4FPBA 2OO4A 1PAUB 3P31A 3A3PB 1KKHA 1BCOA 4OO1J 1J5EJ 3OHRA 2Q66A 2N4CA 3C15B 4CE9A 3JSMB 4H0OA 3V9WA 2HHHJ 3B78A 3P45B 3AHPA 4ZVOB 4BWJA 2FD2A 1EJ7L 4ITSA 1U48A 3KNAA 1LFWA 3E9PA 1OH6A 2PE8A 4BHQA 2HBJA 2RQKA 4E1NA 5KT2A 4LFAF 3MM5A 3MD1A 4LIRA 2FYXA 3LGHA 2W9BB 4DV4J 2DGSA 1S1XA 4CIOA 4HUGA 3DLBA 4ILRA 1F3VA 3CJKB 2GJIA 2V69A 5CA5A 2UP1A 4N8OA 2PYLA 4P10A 3OVBA 1HBUB 1VQ8N 5M2UA 2QTWA 1BO5O 4MDAA 1O5JA 1VQPN 4FNHA 3TVKA 3R8EA 1ZAXA 2RHKA 4JK8A 3ATVA 3R1HA 1JXBA 1T11A 1UL3A 2ZC3A 1QTMA 3AJ2A 2EWSA 1S97A 3SV4A 3RBXA 5DDPC 1B9DA 2XY8A 3J80Y 2WSCC 2PA3A 3FMBA 4B02A 2AYMA 2CQ4A 3I8BA 2OFGX 4G1QA 2P9PB 3ZSWA 3A8JA 3HULA 3MDFA 4BRNA 2W41A 5FIIA 2D0CA 5M1FA 4AXJA 4J2DA 1SKSA 3IG1A 3RTVA 4CTAB 1IJJA 4DDFA 3RBDA 1WC0A 5B08A 3PYFA 4P6QA 2XBPA 4A8XA 1CC7A 3M30A 4A46A 1DQ8A 5I3UA 3CW2C 3WNHA 2OD4A 2HBRB 1VQ8S 4CI6A 4HI2A 4NZ7A 1UVMA 2V2KA 4KAIA 1VQPS 4OLPA 4ZTFA 1N32J 2DO0A 4BS2A 2ZM6F 1LAWA 2F4VK 3SI6A 4Y2MA 2VGNA 3DOMA 4CLSA 3PR5B 2BZ2A 3O9UA 2HBLA 4OX9K 2MSSA 1DTTB 4P2FA 4IJNA 5E3PA 1ULRA 5A8KB 3AO5A 1T3VA 2OEMA 3BO2A 1KVIA 1RYSA 4C1NI 3RW6A 2FJVA 1TL7B 3OYNA 2AJ2A 4F0MA 3D2EB 2F40A 4A62A 5LMNK 2Y1LB 2YNHB 1YTAA 1NGEA 4FPAA 1A6LA 4ZVRB 3MMAA 3NMUA 5BPLA 4WFAL 2ASPA 2IVPA 1KNZA 3Q0AA 3P38A 2BA9A 4ED1A 4KREA 2QT7A 3CPWR 4DR1J 1I94K 3ULHA 1T05A 2CRLA 1FJEB 4DR3J 4C23A 3IA0A 4PXBA 5K8OA 4CFBA 1YRTA 3UKUB 3TAEA 1HBNB 5IM0B 5AFUH 3T5HA 2F8HA 4ENOA 4J2BA 5LMUF 2PY5A 1AFJA 2Y1IA 1FEHA 3SQ2A 4LBPA 1WEXA 3UD5A 2DR8A 1D09B 3Q8VA 4LRDA 1ZAWA 1EETA 2UXBF 2MEWA 5H9EK 1K0VA 3O1LA 2QLJB 4ECXA 3OYLA 3NF7A 3OBWA 4XEIA 2YQ0A 1OPIA 1RDCA 4UT4A 1FJCA 4CGIA 3KYLA 2VONA 2W9CA 1GOBA 2E5LF 4Q7AA 4FPIA 2IC3B 3MUVP 3NGKA 3OR1B 2IBKA 1OVQA 3ZSXA 3SPZA 4TVAB 4K25A 5E7OB 2AIRB 3OFGA 2LQJA 4QIFA 4OJ1A 5J2NB 1F9EB 4P2XA 3TUIC 2EHGA 1KRPA 3A8EA 3MURP 3T9ZA 1BC6A 2MPUA 2DPJA 3GV8B 4O3OA 1H3DA 2YNGA 4G65A 4KB1A 1OJ4A 5DG8A 1NWKA 5AZIB 4ZVGA 2AJ4A 4M63A 4MDBA 4RKUC 4CO2A 1JKHA 4DV2K 2YPZA 4DTPA 4USHA 3DOKB 3P5BP 1F9HA 3UVJB 2YH0A 1X9WA 5AXMA 1FDDA 3CDBA 1WUAA 2ABYA 3NNHA 2NPFA 2GHWA 1B70B 3RU0A 2E5HA 2HHSA 2NYHA 3PHEA 4RPFA 2EK6A 5EY4A 2CQ1A 2JEJA 5KT6A 5D4OA 4I9LA 2BKNA 5E26A 1W2BM 4CJEA 1NJYA 3IP0A 3C14B 4MYTA 3MCMA 1IR1A 4DX5A 3CWJA 3R6GB 2DT9A 3HK2A 4CLLA 4FWSA 3R5GA 2EVZA 1HD1A 2D0OA 3EPIA 1IBKJ 3OVAA 3FZMA 3VQAA 2DPIA 1E6YB 4CEBA 3NGDA 2YHXA 2ZH4A 3VGUA 2ADCA 4FM0A 1WB9A 3ZTPA 1IKYA 1BA1A 2R7SA 2EX3A 5DDOC 4A8OA 3WX8A 1H72C 2R8GA 2ZBCA 4LFBJ 4FJLA 1TUYA 3T1YJ 1KQFB 3ULDA 1BIZA 3T6BA 4I9QA 3OA9A 4A8MP 2ZZMA 1ESVA 4KTWA 5A8WA 1RTJA 3MAHA 3M6WA 1QZ5A 2ZH9A 2V2VA 3QGPA 4WP8A 1HQEA 1V5VA 3HM9A 2VOPA 1U47A 3V6KA 4EYHB 2E1ZA 5KPRA 2HFSA 2XZWA 4DTNA 3GIIA 1BHNA 3R2CJ 4IFYA 2XMVA 1XNQK 1CJTA 2JX2A 1Q18A 4BR4A 2QI2A 5DMRA 1UJ5A 1XMQJ 4B3TF 4ZMMA 4ECVA 3TP2A 2XYPB 2R3VA 2RU9A 4ZIWA 2PC6A 2GVDA 1ZZFA 5KTQA 2WC9A 3DLEA 2MHNA 5JS1A 5K14B 3I56N 3H3NO 5ETPA 3I9ZA 1I39A 1UA1A 2UVRA 1HW9A 5KG6A 1S9EA 4Q8FA 5AQMA 3PVXA 3DRPB 4J9LA 1IBLJ 2AEJA 2RS2A 2XMJA 2V7ZA 1NM2A 1HHSA 1K1QA 1VHIA 5A2QO 2HHUA 4KRWA 4YS2A 4CJ4A 2ATQA 2QM1A 3IR5B 4LR9A 3VAIA 3VVTA 3W64A 4S0MA 4C8MA 1SVDA 3Q8RB 4FWMA 4DCJB 1RZMA 4B3OB 2GAGC 4LF8K 1WHWA 4JV5K 4K4XA 5CXTA 1SL1A 3WT0A 4JUZA 2YX7A 3OPKA 3FSYA 2YJEA 1MSWD 5K8NA 3M2VB 3D54A 5FROA 4J2AA 4CEDA 1N5YB 4NZ0A 4FXDA 3O9QA 2DBBA 4B1ZA 3I56S 3NH2A 2WB1D 2CNNB 2XS5A 1GOAA 1RHUB 1F5AA 4H4OA 3HXMA 4F2SA 3KZBA 2Z2MA 3LALA 3IMQJ 3I5BA 4DQQA 4WQ4C 1R3NA 1TMJA 3UNGC 2CADA 4Q5VA 3VTIA 1PC5A 3WXJA 3AVBA 1LK7A 4NLSA 1BQMA 4X4PA 5AQLA 2Q31A 3Q7BA 1VJQA 5IT9O 4LR8A 3JYTB 1GXUA 1XMOJ 4EBCA 5AJ3K 2G2OA 1G3OA 3DMJB 3LDLA 2HBMA 1BWFO 4X4VA 4L72B 5M1PA 2F4VF 2NXUA 4M3ZA 3DLKB 1Q8LA 4PKDB 3TSPA 1D8ZA 1CJVA 5EGYA 4RNHA 4CZMA 2ZEJA 3SSSA 1FFWB 1WHVA 1S6OA 3JS6A 4BR0A 4WXOA 4CEQA 3CIPA 2RMLA 3FGVA 1XHZA 3JXOA 1I51B 4LFAJ 5LMNF 1VCTA 4DL3A 2GELA 3P4IA 3HI0A 3RGIA 1R43A 1KDNA 2F9TA 3VQEA 1TL1A 3W65A 2WFBA 4OIXA 2C2EA 2VDIA 3M2UB 1I94F 2OI2A 4RW4B 1VSFA 2NXEA 4RO0A 1CZAN 5AZJB 3R9PA 4BRHA 4NYOA 4A59A 3L0QA 1A5WA 1Q7YT 3PUFA 3OJSA 4IO9Q 4BBYA 2GEMA 2CA9A 1K6YA 3ZYYX 1P1LA 1FFSB 4HHHA 2C3UA 2YKMB 3AVNA 3ENOA 2LQ9A 3QRRA 4FF1A 3UCGA 1X5OA 5B09A 3OS1A 4HT7A 3AGRA 3RUBL 1FXDA 1PYOB 2NREA 4J90A 4J5OA 4KPYA 2QL5B 5E3CA 4X66K 2O8CB 2AD9A 3KWIA 2I7NA 3M8ZA 3RBZA 2WVCA 1GLFO 2OTJN 5LJ5Y 1KQKA 3THVA 2VOOA 2V52B 3K9KA 2B9YA 2M8HA 2NUUG 3T5JA 1TKXB 2ZM6J 2V2QA 4WYWA 6FDRA 5L1JA 5J1PA 2QE5A 4IDHA 1R59O 3OYMA 3FUYA 3MDQA 1R8BA 5MLCV 2W1BA 5AQTA 4IO8A 3W3SA 3CE8A 1FVQA 4IOXA 2ZGZA 5I4MA 3EO3A 4CERA 3MMBA 1KFDA 2DNHA 1VQ9N 4O5FA 2JHEA 3O08A 3AXKA 4CHZA 1WNSA 4DV2F 1YTYA 5GMEA 1ZBHA 1M1KT 4PPDA 1EWQA 1G15A 1Q82T 2ZUGA 1NMNA 4PHTX 3RG6A 4FL9A 1LWEA 3TR5A 2OTJS 3POTB 3L3CA 2P9NB 3HSGA 1HWLA 4DTJA 1G2EA 1C0TA 3QJJA 1QAYA 1SKWA 4C11A 2NPIA 3MCNA 3ZZPA 5LMUJ 2V4JB 3LF0A 5AQWA 5FLXY 2CQHA 3HHDA 4DF8A 2RDIA 4I6MB 5T7LB 2Y1JA 4JKFA 4DB3A 1MROA 5KG4A 2DXDA 4X4NA 1VQ9S 4A5AA 4IFVB 2Q1NA 4G1PA 5CHCB 4BCAA 2UXBJ 4IRCA 1N34K 2DNLA 4X4OA 4PUOB 3J7YU 4BR9A 3CD7A 4CNZA 5IT9Y 4CLZA 3RR8A 2CXEA 3V9ZA 5KG1A 2E5LJ 1RB0A 2Z1IA 3J7ZT 1KOHA 1WI6A 3J7AP 5CZXA 3ILOA 4CO3A 4DBQA 2HQCA 1L3TA 1H1VA 1PKUA 1L5UA 1YJNN 4MMOA 1RWXB 2O3DA 3NOCA 2IVMA 1H0HB 2M70A 3O9RA 1S10A 2HVIA 3V4IA 2VICA 1OO0B 1HBOA 3F5TA 1VBXA 1XNQF 2HEKA 3V9XA 4J9OA 2VIHA 2OANA 4CZEA 4F4WA 3CCJN 3IC1A 3HLUA 1S1VA 1S1TB 5AQRA 1TL5A 2CPXA 2P8IA 4YHHF 2FBVA 4DG1A 4DTOA 4BC4A 3DM2B 3TA1A 1IM6A 1Y3JA 2KDOA 1RBSA 1YI2N 3E01A 4XH5A 2HVZA 1NKCA 1B64A 2G8FA 2G4BA 3W9IA 4KGMA 2KM8B 1JLFB 3VF4A 4N41A 4TU8A 1YJNS 1RDUA 5KG5A 3RAMA 1NGBA 2Z1GA 5GAGP 4HVZA 1Q53A 1CQMA 3SBGA 3K0JA 5A8RA 3ZTSA 2IRYA 1J9AA 2CPIA 3EKSA 3WEEA 2K3KA 3CCJS 5AQOA 4NLCA 1TELA 3NF9A 4GC6A 2PD1A 4QYRA 2NRRA 4LF8F 4JV5F 2QWQA 2D1KA 4HR2A 3DI6A 5IFMA 5C42A 4KE5A 2G1HA 3EE8A 5KFPA 2E6MA 1YI2S 1KD1O 1Y5NB 1PILA 3B54A 2V4RA 4QU6A 3ZC4A 3CJ7A 3HD1A 4Q2MA 1NNEA 4FLYA 2OSQA 1EAYC 1BI4A 4LH4A 2BR0A 1C0FA 1KC8O 3OFFA 4BC7A 2FZGB 3OYKA 3AVAA 3C7NA 3L9ZA 2NSCA 3DRRA 3IAM9 3HJFA 1TFWA 4JD2B 1JLBA 4DZDA 1YK9A 1X0PA 2P9IA 5FPEA 2RKIB 3E9OA 1SS6A 2G8WA 2AZ3A 3QB0A 2HSTA 3MXJA 3PM9A 2GJFA 3SAHA 2F3JA 5I9EB 4FWQA 5AJ3F 4B3TJ 4DV7K 4AFFA 1RA7A 3M4XA 4NOHA 2ZKTA 2WZ1A 4YR2A 3NVKA 4AQYK 3PJ9A 1GTEA 4PWDA 1BISA 3TARA 1MWQA 3FZFA 2X3DA 3QAUA 3MTKA 1VC6A 1YVNA 2CGJA 4ECZA 2OP5A 4RW7A 2NQPA 2XO6A 4USJC 4EI2A 4JI5K 4B1WB 2GO8A 4IO9L 4KSEB 2WVFA 2QWRA 2MKCA 3TRGA 5AQSA 2G8UA 1VQON 4MIWA 2YNIB 3M3ZA 1MMLA 3GSDA 4LBIA 3CG7A 1QLNA 1GFWB 1U2RA 1NRKA 1OYEA 2W6LA 3KOAA 5C5JA 4YB7A 7FD1A 4AT1B 1EKEA 3T5LA 3HX9A 3KIOA 1C1BB 1AA1B 5EX3A 4I2PB 3WQPA 1NK4A 2LXIA 2F8EX 3L7UA 4QBUA 4GVMA 3K8VA 2VD3A 4Y1CA 4AHTA 2R7OA 2MZJA 4ELTA 4BC2A 1LW2A 2VPXB 3L2VA 1GMWA 1PYTA 1VQOS 4QR2A 3QMQA 5SZTA 4X66F 4FK4A 1KXPA 5KFTA 2W6KA 1Q9YA 4PYDA 5HL7Q 2NRHA 4PQAA 2KYXA 3A3NB 4LSLA 5HRSA 1HKCA 2CZ9A 1ZBFA 3H2LA 3MPUB 2FHJA 4FJ8A 3RB6A 2FHOB 3PFOA 1A5VA 2F4VJ 2E7VA 4FWLA 4YFUA 2RE2A 3ZSRA 1JWWA 2NS1B 3M8RA 3EGVA 4NX9A 3QPIA 5AXNA 3CFRA 4BY9C 3AJ1A 4Z4IA 1W2IA 3LGNA 3OLBA 1S77D 4C7QA 4CO5A 2OZSA 4L75A 3QFUA 5LMNJ 3UQSA 1WJ9A 2CZVC 4AHRA 1EB0A 2LLZA 3ZZYA 2BRLA 3OTBA 4RW9A 3SEOA 1DY3A 4HH0A 2A1BA 3T3FA 2XI2A 1I94J 1KHWA 3G6XA 3CF5L 5J1NA 3AD8C 3G9CA 3MECA 2ETJA 1MMDA 2KH9A 4J9UE 3AQPA 1VSIA 3ZSOA 3GYNA 5KFFA 1X4EA 1QDUB 3CCMN 4B1UB 3OTOK 3I82A 4NCGA 4I68A 3VQSA 3K9JA 2DGQA 1VSLA 1VRQC 1S4FA 4UF4A 4ETZA 4DR6K 4JS5A 2E4LA 3UFCX 3C6TB 3V6DB 5B0AA 4CQ1A 4B8AB 5H9EJ 1N34F 4CP5A 2A1RA 4L3KA 2QX0A 2PMHA 4OKKA 4DCPB 4CHOA 5E5NA 4YOYA 1QVGM 4JI1K 2CQ3A 4H0PA 1MDUB 2QWPA 1Z25A 2DNOA 1ZZNA 1S79A 5HRRA 4K4ZA 4NLYA 4QWCA 4J9NA 3GV7B 1U1MA 3QWUA 4CNYA 3CCMS 1YGYA 2RDJA 3ZT1A 2QLWA 1KLMB 1IKXA 2K2PA 3R7NB 3GJSB 5KFXA 3J81U 5HJYA 2LKZA 2VG7B 1UEVA 5GAHP 5C24B 1NPRA 2Z0GA 4EHUA 4GVBA 3HO1A 1RBRA 2R7QA 3Q2SC 2HK3A 2ASOA 2GVZB 2JRSA 3CJ0A 3N0VA 3ZO7A 1X9JA 3FBFA 4DV2J 4O44A 2X1GA 4BRMA 1JK9B 4Z94A 1QE1B 1BWVA 2OPPB 5HLFB 1S5JA 4FS2A 5D0GA 5D78A 1YJ7A 2AU0A 3D9BA 2DNKA 4ZIVA 1RP5A 1D3WA 3GQCA 4AUKA 1LEOA 2GV1A 3TSUA 3GR1A 3GL1A 3M8PA 2WOMB 4ES3A 2BKOA 1B92A 3PW7A 1C0MA 4RNFA 5SUHA 2HNYB 1HYVA 4LSZB 2E2NA 4KHSA 4ISEA 4ID5A 1RA6A 4O0IA 1M90T 3K58A 3DDIA 8RUCA 2KRBA 3O1BA 4FJKA 5L46A 5D6GA 4P74A 3BGFA 4JI3K 4XPEA 1JLAB 5BRHA 4M5MA 4ECWA 2KXHA 4URQU 4QYZJ 1Q78A 3TI0A 4ECSA 3I5AA 1Y5LB 4XH4A 1RILA 4ZVEA 3MR7A 2NCKL 4ED4A 1RWOB 1RT4B 4FF3A 4CZIA 3V4MA 2ACMA 2VJVA 4CLYA 2CPEA 2UUBK 1R0AA 3MM5B 3HRGA 3GG4A 1IWGA 2Z58B 2E44A 2RAQA 1VHFA 2QMUB 1S1XB 2HHPA 1JNRB 2WAQD 4CLTA 1N8RO 1XNQJ 1W26A 3CCLN 3IMXA 2FF3B 4DV7F 1Y5IB 4DL6A 2BQRA 3N4QA 3QNOA 5CY4A 1SH0A 1TQLA 4TKTA 4AQYF 4X65K 3CHWA 4NLRA 5CE3A 2RNEA 1NJWA 2KVQE 3R5DA 4CT9A 3PSIA 4ED6A 1X4FA 1OSDA 2PT0A 2M0GB 3VEZA 3PKYA 1JJHA 2ZVIA 3BSCA 2Y8WA 5AE1A 3K89A 3LPEA 3VF2A 5DDQC 2MQLA 3TA2A 2M4MA 4I6WA 1HLWA 4R79A 4AXIA 4ELVA 4ZOSA 3CCLS 3ZCMA 2V0NA 3NMAA 3M30B 5I3UB 4LF8J 5LY3A 4J91A 5DZ6A 4JV5J 4LF9K 1LOUA 3OTEA 3NAHA 3U9ZA 3BQ0A 1ROFA 3AY9A 1NGDA 3CMEN 2D9PA 2MZTA 4D3GA 7FDRA 1FEEA 4QPXA 4F8RA 3DOMB 3O8MA 2CWXA 1UZHA 5HL7L 2DISA 3O8WA 2CGKA 3CDWA 5BJRA 1JB0C 4WYBA 4CJKA 4B9SA 4CYUA 3GFHA 4NASA 4USMA 2L08A 4Y3CA 2KFYA 4KHRA 4OPHA 1WEZA 2GWJA 2XTJP 1LV5A 1UFKA 4EEYA 4PWWA 3W63A 5D3GB 5T41A 1YITN 3MMAB 4IOCQ 2FZKB 2AJ0A 1GMWD 1PGZA 4MFBA 1T05B 5AJ3J 4WIIA 4DN9A 2KB2A 3CMES 1FI4A 4DL2A 4EU0A 1Z05A 4PQUA 2VB6A 2G0JA 5IC6B 2VBWA 3DLLQ 4CEEA 2DR9A 5J2PA 5HMXA 2FHJD 2CQBA 2ZF5O 5B0DA 4YNQA 5AQGA 3DXSX 2NXJA 1T8EA 3NS5A 4XAKA 3C2PA 1F2HA 4J37A 5AR0A 1SXLA 5H9FK 2IPOB 3MUMP 1AFIA 1EETB 1OS5A 2EFOA 4ZITA 4TY8A 2HNZA 3TTFA 2YX4A 1YITS 3BBCA 3BBFA 4X4UA 4R8UA 3BSNA 4WFYA 1Y3KA 2KFNA 4FJNA 3D0IE 2W9CB 3ZZZA 2AQ4A 1VK8A 2IMWP 4MO5A 3DLHA 4O0NA 4KH1B 2IY5B 1CEZA 2MB0B 2W4PA 2J0WA 3QT6A 2BYCA 2XCAA 3OTOF 4DR6F 2RILA 4GNIA 4WQ4A 3HP9A 2GNKA 4DUYK 4USTA 1OQ3A 1WHYA 3HF5A 4FP9A 4UZCA 3QZ7A 5DO2A 1WC3A 4R0JA 1FWKA 1XJWB 3QJLA 2JWKA 3UI3A 4ZVUB 2EKNA 4IXCA 2RUGA 1J5OA 2GWKA 2POKA 3E8OA 4I0WA 3H5YA 3I9V9 3I0RB 2V50A 4X66J 2GCFA 1OY8A 3LH2S 2H48B 4QW9A 1HNVB 1DHMA 2F96A 4JP8A 4JI1F 3PSFA 1XMBA 4H0TB 1HNZK 2Q6CA 4K4YA 5KFEA 2EWHA 3NNCA 3BPDA 1NZAA 4DS4A 2IVNA 3P5JA 2L3MA 1VSHA 3NCRA 1GAOA 2X3GA 1R8CA 3GPAA 2CJ9A 5F8JA 4NA3A 1ATNA 3D0HE 1N6QB 3AB2B 4ZVPB 2OCEA 1R6VA 2ZH5A 3JSMA 4EHTA 1FRXA 3KK3B 3L7PA 4J2EA 2XSJA 1W0HA 1NBWA 2DB1A 4YOUA 1Q0NA 5IT4A 5FPNA 1ILYA 1H74A 2BEFA 5LL6Z 2HAFA 2IM3A 1U0HA 1RNHA 3C3LA 2DH9A 1R8AA 2BACA 2NRZA 5L8RC 3KLFA 1IKYB 4Z4FA 4ZP7A 2X1BA 1HHTP 3H46O 2VBXA 4FCYA 1QJHA 4J9PA 2DHGA 2C2MB 3NVMA 2OEKA 4NMLA 5FPMA 1PCAA 3PYEA 2OPQA 5AQJA 3CJKA 1TUUA 1TAQA 4MKYA 5GADP 4F4ZA 2OSRA 1HBUA 3C16B 3OTDA 3SUOA 3IGNA 2R7WA 3R3LA 3ULEA 1HQEB 5G4DA 4LRAA 5KFIA 5GAGU 4EZ6A 2IMOA 2J6SA 1WF0A 3NCQA 2JLGA 1VC0A 3I55N 5DM6Q 1QVFR 4IFYB 3DLGA 3OSPA 2N3OA 1N34J 2QL7B 3TX0A 4JI3F 2OAUA 2W7PA 5JMVA 2HGNA 3SAFA 2R8KA 4EIAA 2E29A 4F50A 5TKYA 2BJ3A 2HNDA 3PHTA 4WF9Q 3CT9A 2XULA 1FF2A 3FKBA 3F9KA 1S9EB 3KK7A 3QESA 4MQ3A 3FCHA 1UVLA 4FO0A 1TL3A 4E7KA 4EWTA 4KTQA 1RT2A 1VHXA 4DV3K 3M8QA 2UUBF 1ZM2A 2FDNA 5D0EA 4OV1A 2BE2B 2FJDB 3JTPA 2RF2B 4M5GA 2CG4A 2P6TA 3I55S 5E84A 1KAYA 3FCVA 5KFRA 5A8KA 3CXCR 4JHDA 1TAUA 2O5DA 2XGQA 2CDRB 4ZLJA 1B0PA 3EKUA 2CJYB 1CPZA 1S0OA 2KFZA 4PL8A 4X65F 2YNHA 2HWHA 1TK8A 1NGJA 4WTOB 1VR6A 3ZETA 3KLIA 2D7SA 1RYRA 2QO3A 4P2SA 3FEYB 4IO1A 4HWIA 4OHXA 4Q2LA 3KKSA 1X31C 1NNDA 3N6NA 3TU5A 3W2VA 3U7JA 2FVQA 3UKUA 1UOCA 4JEPA 5IM0A 3UDLA 4FDFA 4JKCA 3N6LA 3ENBA 4LVOP 1LW0A 1OH8A 4LF7K 1BQMB 3KLEB 1X8DA 1JJ4A 4UTGA 2KZZA 3AAPA 4M3UA 3OL9A 2Y9HA 2Q0UA 3O2IA 4LF9F 3MWBA 1R8PA 1J27A 1JLCA 1REVA 3NY0A 4BR5A 4IOCL 2MGZB 1RWVB 4TXSA 5K8MA 4QQBA 3EGZA 4WU2A 4OLOA 3ASMA 2PZSA 4DTSA 2IC3A 2ZH1A 1IKWA 5K8PA 2MDAA 4OYMA 3IR7B 1UJ4A 2FJXA 4PG7A 2Y3YA 4OZ3A 1RKJA 4P52A 1VSKA 3H2VE 2YKOA 2A1SA 4A48A 2YWFA 1G6BA 2J7UA 4JV1A 3VGMA 2Q6BA 1L3KA 3NS6A 3EY1A 5DK5A 3J7A1 3V6HA 3T9NA 1FKOA 3K57A 4M8LA 1FE0A 4ZP9A 1FVSA 4DV7J 4NXMK 3SCXA 4AQYJ 2JDJA 3H5XA 5L9NA 4H0XB 3FBBA 3OJUA 3MAQA 3GONA 2UYTA 3MM6A 1KWMA 4ILJA 2UV8A 4JKBA 1SL2A 1U8WA 2QLXA 1Z2ZA 1RE1B 3UCUP 1X5SA 1F2GA 3PX6A 3G8QA 5EHHA 3VESA 1N54B 4A8QA 4DR7K 3DXKA 3L6QA 2JFKA 2VFSA 1LFPA 4PEOA 3ISNC 1CS4A 1P27B 1WSHA 5KOXA 4K7QA 2KO1A 3NGZA 3BUZB 2Z2ZA 4IUFA 2C3MA 2RS8A 5GAGI 4F67A 3SCJE 2C28A 4QOZB 3QNNA 2QN6B 3BGRA 1HKGA 4Y2KA 2EBGA 2LA6A 3MN5A 3HHKA 3QNWB 5BREA 3FLCO 1BQNA 5JJBA 2OPRB 5BPMA 3LPTA 1LWFB 4ZCLA 5CYQB 4DUYF 3WXMB 4RUHA 3MMBB 5A0YA 2YQ3A 2D0AA 3HHNB 1WKLA 3KLGB 4ZN1A 3S1TA 3EVOA 3VGTA 4IZ9A 3L3UA 2DRAA 4C8YA 1QQOA 1F6TA 1HNZF 3CPWM 1LWEB 3R5AA 5EWGA 9RUBA 2BQ3A 3HVAA 2HQIA 2XYGB 2A41A 2JC1A 3KLVA 1HLUA 1C0TB 4LRBA 1FXLA 2AGPA 4C11B 2RQ4A 4DPWA 5JLHA 1HX1A 1UTAA 2K1RB 5T7BA 5K14A 2PGCA 1MROB 3ZT3A 4ZJQA 2P6SA 4KH6A 1DAXA 4DQPA 4QWBA 1WC1A 3DRPA 2XHWA 1UEUA 3DXMA 5C25A 3IAS9 2P5VA 2CNLB 2CGLA 3HJVA 1U02A 5DM6L 2E1MC 2B4UA 4FOEA 2DIUA 2MZRA 4MIBA 2VBYA 2LECA 1G1XA 2M52A 1MWZA 5F8HA 4B3OA 5BR9A 3IWLA 1S5ZA 5BXIA 4FBUA 2QTDA 5M1KA 3GFYA 5KT5A 3G6VA 2X6SA 2G2ZA 2QG9B 3IS9A 1ZPVA 1N5YA 2R2SA 1FD8A 2ZOFA 4YR3A 3OTOJ 1NMEB 3SJHA 3IBFB 1JJ2M 3CJCA 5C2FA 1VRTB 2DKOB 1C1AA 4TLRA 2DY1A 4AHSA 4DR6J 4WF9L 2YKQA 2IA0A 1HBOB 3NS7B 1EXQA 3FEXB 2VASA 1FK9A 2VYPA 3MMCA 3VF0B 3N5BA 3THXB 4ZS6A 1S1VB 2M88A 3UD3P 3NH0A 3VQ8A 3TW0A 1U2CA 3I31A 2MHEA 2LXUA 4KGKA 2B0GA 2FHMA 1VIXA 4DG1B 2ZOMA 3V1QA 2AP6A 4YB5A 2HB5A 3EL2A 4JI1J 4WKYA 2ZE2A 1NK0A 2ALZA 3JYTA 4OZ5A 4B8CA 3L4IA 2Q79A 5KFLA 2MQPA 3GG0A 4WK1A 2OYQA 2BQUA 1I5OB 3CJTA 3MXHP 3H6EA 1IR0A 5EU7A 4CJFA 1URRA 4MH8A 4OHVA 4DV3F 3DHWC 4CJUA 2QYCA 2V67A 1RDWX 1YJWN 4YUDA 2C2DA 3GTYX 4AE5A 3TNVA 4B9VA 4CJSA 1SC3B 2H5JB 5HK4A 2O4IA 1XR5A 3E3XA 2W01A 5A8RB 3TANA 1Y0HA 2QYGA 1NU4A 4NLWA 1KHVA 3WEEB 1H7XA 4DL4A 4I1TA 5F41A 4TYBA 4NYZA 2Y0BB 4MK9A 3DI6B 3RB0A 3C46A 3T5KA 2E9ZA 1Z6RA 4K4VA 2CQ2A 2HVHA 5JXSA 3KMSA 1M1HA 2QWOA 3TJ9A 4DTRA 5J2MA 2CZ4A 2WVBA 4ES1A 3NRBA 4LREA 3M2UA 1TYQA 1HI1A 4HCCA 4EP4A 1BI4B 4WU3A 1UMJA 1YJWS 4NYNA 4DUZK 2X51A 4OJ3A 1KONA 3C7NB 2WTUA 3DRRB 4GKKK 2JL9A 4JKEA 3C6UB 4F9OA 2P9IB 4LF7F 4ZP6A 3TVYA 3CJ8A 1NPKA 3CQXA 2NNWA 3OHAA 4CH1A 5DQIA 2J6TA 1KVJA 2HQFA 2DIVA 2FHKA 3HFVA 2B4PA 2RSQA 5M2PA 4JI3J 4HACA 4CF0A 4EFAC 2RUSA 3N4PA 1U1QA 3JSYA 5KI6A 2CDQA 3GYXB 4PWDB 1NZ8A 4U8YA 1ZETA 3VAMA 1GLLO 2E7XA 2E20A 4KYZA 2O8DB 2RRAA 3NGYA 4BE1A 1ASVA 4C3MA 4XO0A 2W2MP 2J0QD 1FXXA 4FJGA 4FXWA 3N5FA 5CZ1A 2UUBJ 2VQFK 2J7WA 1NB2A 3I33A 2HQ3A 2J9EA 1K8KA 2RE1A 5H1SQ 4RW8B 5ADZA 3ZX3A 5GAHI 2V68A 1WDTA 1FHTA 3H4BA 5CQGA 2UVVA 4NXMF 3BQ2A 3MM9B 3T7ZA 3HKZD 4X65J 4HL9A 4UY8O 1HW8A 3H7HB 4ECRA 1E6VB 2Y8YA 4FKYA 1Q1KA 1VBYA 3AQOA 1N0VC 1Y7PA 1D9AA 2PAVA 3MCPA 1RXOB 3OBYA 1YBUA 1TGOA 4K2XA 4K59A 1ZH5A 4KHMA 3ONQA 8AT1B 4DR7F 1LW2B 4E2FB 3CDUA 4CZGA 4NLBA 5D0RA 3WUHA 1M5VC 2VWJA 3QGGA 2V4QA 3VEYA 1P6TA 5E0OA 4OZ0A 4QR0A 2B6AA 1VI7A 2VQEF 1TUGB 5U47A 4IFVA 4OYXA 4LSLB 3H1VX 4LF9J 1CJKB 4PWUA 5KPZA 2O67A 4AH9A 3AODA 1JCFA 4WP9A 1NOZA 2VGMA 3LP2A 2YX1A 4NMXA 3AGKA 5HP1A 3VAKA 1Z26A 1RAOA 1X4BA 4J8FA 4ICLB 4WIQA 3OXFA 3O44A 5M1NA 3T1HK 2R7UA 4Z4HA 1B7FA 2WVDA 1C2PA 3TVZA 1Q7LB 3M05A 1XC9A 3FDSA 2DGVA 1BDGA 2O4GA 1CBKA 3OHBA 3LDPA 2IDOA 3UDEA 4EMDA 2CKWA 1NLVA 3MOJB 3BF3A 1JLEA 1S1TA 1B9FA 3DOLB 4DLGA 3SDEA 1TV6A 3QATA 2V9KA 3LAKA 3FZKA 4FWRA 2ALYB 4NCGB 3PRBA 2B4OA 1KOOA 3ZSZA 3G25A 2CJAA 2UUCK 4DTMA 4ANEA 4DSLA 4OI2A 1JLFA 1YSJA 5H9FJ 2P9EA 3PDNA 4GV6A 3EN9A 1Y11A 2QLFB 3FMWA 2KT3A 1N5QA 3Q86A 3CJ2A 3MUTP 3HSDA 3O3HA 4RJVA 2WB4A 2FSNA 2UXDK 2HHVA 2F1FA 4OZNA 1SJ4P 3O9SA 3RZAA 3TABA 3R6MA 3Q22A 1RBUA 1WI8A 5GADU 3AA3A 3N6MA 4IDKB 3FSIA 3D5MA 4W90B 3FGUA 3IBCB 4FVMA 2Q0RA 1SJFA 1ZM3A 1IKXB 1GLAG 4XK8C 4OJGA 3VHQA 2XHBA 1LNQA 1MNEA 2AWZA 1GLEG 5HO4A 3N4WA 3ZTQA 4DUYJ 4CO0A 4P73A 4GVBB 1M1KO 1NK9A 1SKUB 1Q82O 1U2VA 4M3XA 1T44A 2DEIA 2DD8S 2WSFC 2GTDA 4K4WA 1W2BR 5LOQA 2RKIA 1AB8A 2J9DE 1HYZA 4QPTA 4KH4A 5DRKA 1HNZJ 4TY9A 1ZOTA 1FNMA 3TZXA 4QOTA 1X9SA 2HBKA 1K9MO 2KJWA 4EGLA 4B9MA 2VCPA 2BJDA 2LSNA 3SCKE 3M7VA 2GBZA 4X4SA 2EW9A 2Y0SD 2OLWA 1JLGB 2IAJA 4DSEA 4OYBA 2HVEA 3LP0B 2A2CA 1HQUB 1CVJA 2G2YA 4LIWA 2D9OA 2Z1HA 3J7ZO 3R5JB 1EKRA 4OX6A 2DGUA 3F44A 4YOWA 1X5TA 4MKBA 2JVRA 2F7VA 2YNIA 3H5UA 2ASJA 1VQ6N 4I6AA 3H59A 3CPEA 3ENWA 2Z30B 1GLCG 2I0XA 2RB7A 4WJBA 2AKWB 3K5NA 4IBNA 4DL5A 4CEZA 4C8ZA 4HDHA 1CJUA 4R25A 3WX4A 4DUZF 4ZN3A 3CTRA 4A2BA 4U6PA 1NOYA 4GKKF 2V34A 3PW4A 2HMPA 5KQDA 3MR3A 5G0RA 2YH1A 2DY4A 3NGRA 3CNQP 5BR8K 1S57A 2OZMA 2DTJA 4FJ9A 2W9AA 1UKUA 1J2VA 4M42A 2W7AA 3EE3A 3QGHA 3CJSA 4H8KA 2G0IA 1VQ6S 1E3MA 1H6KX 3BO3A 1XBWA 2P9LA 4M41A 4H5RA 4CZHA 1VQYA 4U7CA 4USUA 2W8KA 3E51A 2FQQB 5THWA 3IN5A 3HHLB 3SBTA 4DMNA 4OZLA 4ER8A 1V6HA 3DAWA 3WXLA 3MGJA 3L2UA 4C0HA 2XY7A 3D2FA 3HT0A 3GMGA 4DV3J 4WQ5A 2VQFF 3OS2A 3D67A 3BEXA 3LZJA 1RHJB 2N4DA 3F56A 1CXUA 2MY8A 2HWTA 4ZHRA 1Z4UA 2A0FB 4NLUA 4GMJB 4PG4A 3QEXA 5F9LA 4DXLA 2EKYA 2L9DA 3ENAA 2KYZA 3I87A 4B3MF 3MF5A 3H08A 1FT8A 4D3HA 4AYBD 1SL0A 2DPNA 1SH2A 3JQKA 1DKGD 3AA2A 4QJVA 3CM6A 4DR4F 3QIOA 1FRLA 2C3PA 3DNCA 2ROPA 4FS1A 4CZKA 4CJWA 3S9HA 1FDNA 2O66A 3OXLA 5GADI 4ELUA 3QEWA 2CPJA 4C3LA 2YV0X 2GUIA 1RT7A 1RU2A 5B7WA 5A6PA 1BOTO 2MLXA 1CSJA 1EO1A 4LJMA 4LF7J 2MKHA 4C0BA 4LFCK 3GIKA 3LM2A 4FXVA 3C6TA 2QC3A 4MFBB 3V6DA 4CF2A 4DV6K 2I6WA 2AYBA 1OSCA 2VA3A 3A5LC 2FC9A 2R8HA 2XLIA 4PQUB 4H5NA 8ATCB 3QAEA 3FQKA 1Q8KA 3SFUA 2D1CA 4KAZA 4I67A 3PJWA 1SC4B 3D28A 2ZJPQ 5J2PB 1FJGK 4DOZA 1GX5A 3UKRA 5C15A 1D5AA 2OKQA 3HFZB 4ED2A 5IQQA 2DCLA 5HQLA 1JLQA 3LWMA 5EDWA 1U6FA 3P49B 1LQ9A 3H98A 2CQDA 2E1PA 2MLZA 2RT3A 3T1HF 3UE5A 4TY8B 2HNZB 5I3QA 4WFXA 2L9WA 4OQJA 1S22A 2YHYA 5C24A 3CJ4A 4FJXA 1OH7A 2RN2A 2UXCK 2FGOA 3CGIA 3B8HA 1X9MA 4AL7A 2FY1A 1QSLA 4NXMJ 2W40A 4EYIB 3GJRB 4LF5K 1FDBA 4HEA9 3S3NA 2UUAK 1TU0B 4CO4A 1RAIB 4KC5A 4ZLLA 2OPPA 3OVNA 1FD2A 1F5CA 4CHYA 2O8BA 2C22A 1IJEB 2UUCF 3IO1A 5LXRA 3OL6A 2H3GX 4DR7J 4MK8A 2Q43A 3AOBA 4P7VA 2YKAA 1FKPB 4PG5A 1C1CA 5LL6d 2YX6A 5EOYA 3R7BB 3DWLA 3A8IA 3P5TL 4IRKA 2X6NA 1J5OB 5HRPA 2HNYA 4YB1P 3GU0A 1OPZA 3U6FA 4HHUA 1MW7A 2UXDF 2NSBA 3QBCA 2HRYA 2VQEJ 3SNNA 1RT3A 3NF8A 2ZWOA 4YEAA 1W9HA 4E0DA 3GILA 4X64K 4YOTA 4DV0K 1R89A 1CZBA 1NH8A 2V51B 2C2KB 3MPWA 3JQJA 2LYVA 4W92B 1JLAA 3C0BA 2G8HA 4OYIA 4M1KA 3U02A 1YZ7A 5IC4B 3ZZUA 1D8YA 2GJ2A 2KT5A 1LXJA 2BKPA 2XSJB 2XMMA 5BRFA 1RT4A 2XM3A 1WSGA 2F9WA 2RHQB 2GQ2A 3B82A 1ZA1B 1U0HB 4WFBQ 2PMWA 3KLFB 3RMBA 3OYIA 5DGBA 4DCHA 4DU8A 2R7TA 3AO2A 1C0UA 1R31A 5F3ZA 2OPQB 5HVGA 3C19A 3E9LA 1U49A 2LQBA 1GLDG 3KWMA 5C7PA 4PKGA 1JL1A 2OFHX 3ULEB 3S8SA 3BJYA 1M0SA 3RB4A 3EVMA 4LQ3A 3PX4A 1WSEA 3ZSVA 4H4KC 3C8YA 2JFDA 3DLGB 5LJ3Y 3ISZA 4DU3A 2JWLA 4RBTA 3OUYA 5DG7A 2FVPA 4DF4A 1F60B 4Z4GA 1SV5A 3VGLA 1NGHA 3VAJA 1JXVA 2ASMA 4JI2F 2HS4A 2J7KA 1IBMK 2E2QA 4PXEA 2ZWHA 4RBVA 4U96A 3RJMB 5HN0A 2KTQA 3A5MC 1S6QA 2HNDB 4KB7A 1VSMA 4FVCA 4QU7A 3QGIA 5FJ4A 5LT5A 5BYSA 3ZNUA 3ZT4A 1TL3B 2XWXA 1RT2B 4FYYB 3CQYA 3M8QB 1VC5A 3R1XA 5IXUA 1X60A 3FVYA 2XCPA 2MQMA 3ET6A 1XC3A 2V8DA 3ENQA 5F3TA 1FTCA 4DX7A 4JHDB 5BR8F 4CVNE 5LSOA 2QWLA 3OW2R 4CRJA 1NHUA 2IOCA 4E7HA 1MN9A 5D3GA 4B3RK 2DO4A 1BGXT 4Z7YA 3ZETB 1ZBIA 3Q23A 2QMXA 1WEYA 3KLIB 2I8EA 4Y34A 2MSTA 1YRXA 2OTLN 2U1AA 1DURA 2QFIA 2ZNZA 2H3EB 4HUEA 2IS3A 3W2VB 2H4YB 1RDBA 4NLDA 4IG0A 2HLUA 1RBAA 2KJVA 2DXEA 1LW0B 4CK2A 4RL1A 4PKIA 1WWHA 1VRUA 3Q89A 1WOPA 3H25A 1J5EK 2X74A 5KG0A 4FF2A 3GOIA 3L2WA 5KRTA 4IKFA 1JLCB 1REVB 2B8QA 2CFXA 2B5JA 4QIEA 2OTLS 3GLJA 2XQCA 1V4SA 1KTVA 5ETKA 2Y1RI 2E5IA 3W5YA 1BA0A 1IKWB 4W5TA 3VQCA 3Q7CA 1EP4A 3UO0A 1KC8T 4WE1B 4CW7B 1V3SA 4C0OC 2AV5A 2ZZTA 4KH0B 3MXMA 2IDEA 4DUZJ 3H4DA 2ZKUA 1IKVB 1CLQA 3GYGA 2B9EA 4O3NA 3AA8A 4GKKJ 4BRAA 2ZH6A 4LFCF 2YHAA 3VETA 3UDVA 3W2WA 3I8DA 3O4QA 4E1MA 1FKOB 4LQ9A 4DV6F 3HOTA 3B4MA 1N5TA 1HNIA 4DPYA 3MX2A 4GKJK 2R2UA 3TQ1A 3W5ZA 3DCAA 1R0BG 3I0RA 2HIYA 3D0GE 1Y97A 3V81A 1FJGF 3MM6B 1HNVA 4XDCA 4HT5A 4E89A 4MT1A 3ZTRA 3ENHA 3FZHA 2E2PA 3NNAA 1S12A 2ROGA 2LMIA 1QY7A 3UE2A 5KFSA 4P2MA 1NK7A 3VWSA 3JTOA 1UVJA 3QFWA 5KT3A 3DXKB 3JAMU 4IFEA 5CABA 2VQFJ 1CS4B 4LF6K 1N6QA 3MMJA 4DJBA 3HHLC 4ZPCA 3WC2A 3KG1A 2ZWPA 4FLWA 4LT6A 1HI0P 3KK3A 2UXCF 1KS2A 3D6HB 3HPGA 2YNFA 1NM1A 3BGOP 2DYAA 4RR5A 2HW3A 1RHRB 2H51B 4LF5F 3C65A 3G2XA 4DL7A 5LJWA 3BGRB 2UUAF 2VKRA 4BRLA 4B3MJ 1OVYA 2QFJA 2V2ZA 2HHWA 3RWUA 1VYAA 1AW0A 1BQNB 1K47A 4LF4K 3K5LA 1U1LA 3LWLA 5ETLA 2WTFA 3KTQA 3H1QA 4DR4J 3PTWA 2VC0A 2OGUA 5GIOA 2FZCB 3C16A 1KP6A 3MFIA 4KHYA 5A0YB 4OVLA 4K43A 5AE2A 2ASYA 2FBXA 1DARA 2BABA 3VGVA 3A5NC 5KFOA 2E1CA 3JQMA 3VQ6A 4JRPA 3QMLA 4DPTA 1SIZA 3PNIA 1NG9A 1VLYA 1DGKN 1ZM4A 3NFAA 1SCJB 4DTUA 4X64F 3NE6A 4DV0F 3ZT0A 2GA7A 4WFBL 3KDNA 4P71A 3M1VA 3ITHA 2HHTA 3R97A 5D4LA 3FZLA 1KLNA 2HFVA 1LXNA 2HFOA 5B0BA 1HPMA 3CJBA 4CD3A 1LCUA 2JZ5A 2OA8A 2HGMA 4K5SA 4EO6A 5HMWA 1OKJA 4K41A 1YRUA 2LCWA 4CJLA 1KQSM 1TKZB 3OYGA 2BVZA 3T1HJ 4CESA 3KHGA 2MMYA 2VZ9A 3CCQN 1ZBTA 3DXMB 5C25B 2BE2A 2OPSB 3TUZC 1ZAVA 2RF2A 1NKBA 4K8RA 4CWBA 1BWEA 4DTXA 1SQKA 1DLOB 4QW8A 1K1SA 5H1SV 2AJ1A 3LP3A 2ACYA 1SPBP 4JI0K 4F04B 4A8YA 1RWPB 2YXLA 3BV8A 3W7BA 2AHOB 3MM8A 2HLTA 3IS9B 4QIVA 3CJRA 3AXMA 2OELA 4NEYA 1XR7A 3SQGA 5DGAA 2UUCJ 4TLQA 3O1WA 4CFAA 1QVGR 1FK9B 3CCQS 3MMCB 5LM7E 2DRDA 4RU2A 2E9TA 3MWPA 3ISND 3A0IX 3U8XA 4O8UA 1IBMF 3M32A 2M3DA 1IUJA 5D0HA 2UXDJ 4NL5A 4V19J 1VQKN 2DTUA 3KLEA 3AVHA 1N5SA 2F65A 4ZKAA 2ZE2B 4FBTA 2QRRA 5D8HB 2V7YA 2QA2A 4OMFG 5HJXA 5ETNA 1IG8A 3CJ5A 1KEKA 4EZ9A 2SXLA 3AVLA 4QWEA 2MGZA 4BC3A 2E7WA 2HZCA 1VK0A 4ZPTR 4FN5A 4JKGB 3RSEA 3MPYA 4OX9F 2D3ZA 3VENA 4HVJA 3LOUA 1NJZA 1XI1A 3M2RB 4JK7A 3PIOQ 4CZCA 4CLWA 2XMAA 5KG3A 5F8NA 4A61A 1FJ7A 2GGPA 5F8IA 3O6QA 2RJZA 2H4WB 3M6VA 4B3RF 1VQKS 3AVJA 1FA0A 3HD2A 3TZZA 3UIQA 5J2MB 1TKDA 4K4SA 2IM0A 1NSPA 1TYQB 2NXNA 1BIUA 2X1AA 4R5PB 5KFBA 3O5TB 4FYVB 3KLHB 3HSCA 3J7AN 5M1QA 3VVUA 3PV8A 1RDAA 4Q44A 1IWAA 1DZ5A 2A10A 4C8KA 2BW7A 2G8IA 1M5OC 4F0HA 1XHXA 4BLGA 3F73A 5FPDA 1QVFM 1NHKL 4BDYA 4LY7A 3THWA 2XMUA 2K7KA 1RTIB 3SQ4A 2GO9A 4HACB 3A2FA 3TAMB 4JI2J 1O1WA 1VLOA 2KT2A 6FD1A 3AOCA 5KG2A 4DV1K 4QCLA 2DFHA 4ECTA 3SMPA 3AVMA 3LDQA 3UB5A 1WG4A 5HMYA 2P5OA 3FBEA 2I38A 3L3VA 3OYFA 4MAKA 3PKMA 1IM4A 4K2JA 3KUHA 3BZCA 3F41A 5CYJA 2Q3PA 2IJRA 1TP7A 5EX5A 2OPRA 1LWFA 5FLXU 1K8KB 4CJPA 5CYQA 1TFYA 5BR8J 2ZZNA 1RT5A 4IG3A 2L48A 2J4RA 2A42A 2E2OA 5A2QY 3DU5A 1KSPA 3NCIA 1N4LA 4GKJF 4LH5A 1MU2A 3KLGA 2QA1A 1YJTA 5GMKa 1KBRA 2E5GA 1XTZA 2W24A 2DITA 4XDDA 3N9UC 3VMFB 2QL9B 3H5SA 4BE2A 2LVWA 4O3SA 1EKSA 2D5RA 2HFUA 2A5XA 3DJCA 1QSSA 3O3FA 4CHQA 4BC5A 3G6YA 1TK5A 4ZJOA 3KHRA 4K4TA 4Y6IA 4LF6F 1U24A 3Q24A 3D7SB 4LSNA 3DGPB 3HKWA 2BM0A 3VA0A 1SUQA 2ZNYA 2GIRA 2DFFA 1HNXK 3RB3A 2K1RA 3D7EO 1NSKL 2B6AB 2BX6A 4I7FB 3ZNJ1 3U1NA 3VQ9A 2PI5A 4ILMA 1K8AT 1ZPWX 3M9NB 3FR0A 4IEEA 3LP2B 1NGAA 2GIFA 7AT1B 3L4BC 3NWGA 2IHR1 1C0GA 2KHDA 1RAGB 4LF4F 1U7LA 5HP1B 3R5CA 1YAGA 3EICA 3QFPA 4DR5K 3THTA 4WFZA 1REGX 5T14A 2MKIA 4X2BA 1MMNA 2ZDOA 1HI8A 3CC4N 3NF6A 5CYMA 3NBPA 4RTFD 4L3NA 3G6EN 2R42A 2PMZD 1VRTA 3QFHA 4LFCJ 3DRSA 4CIFA 3JSBA 2VG5A 3L95X 4DV6J 2W8LA 2BGGA 4JI6K 3OY9A 3THXA 2X7IA 1Z1ZA 4JKAA 3BSAA 1JLEB 4OPJA 1NO8A 1S9FA 4J9VA 3SDEB 1TV6B 4OYAA 4CECA 1FJG