1S1TA

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with uc-781
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
541
structure length
533
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase
total genus 150
structure length 533
sequence length 541
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1tA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1tA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1tA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1tA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s1tA05
4XIUA 2GV9A 3OL8A 4KB7A 2D3ZA 2IOCA 4KHRA 2HHSA 4E19A 1REVB 3OYFA 3S9HA 4B9VA 2KZMA 2XY8A 2VG6B 4M3RA 4CFDA 4Z4IA 4TY8B 1N6QB 3M8QA 4KHNA 1S1VA 4IG3A 1Q8IA 1TK5A 5F8GA 2O4IA 3I5CA 1JKHB 3GIMA 4LQ3A 4OL8A 3TAEA 4ECSA 3ZT0A 3O3FA 4CHOA 1TKXA 5KRTA 3NDKA 3PO4A 1GX6A 1QAJA 4QW9A 1HYSB 1LAVA 2KW4A 4CGDA 4X2BA 1W9HA 5C25A 3HVRA 2D0CA 4ECRA 4DF8A 3LP2B 4IG0A 4R8UA 1RT3A 1TKTB 1K1QA 3OYBA 4J2DA 2OA8A 2V4QA 5KT6A 2WOMB 1DLOA 1HQUB 5EWEA 1WSEA 2JC0A 3H5YA 4YR3A 4FBTA 3OYGA 1J5OB 1VRTA 3CQ8A 1QAIA 5HLFA 3RAQA 4CHQA 3HO1A 4C8LA 3CVKA 3G6VA 4NLVA 3GILA 2VG7A 4DU1A 1TL3B 4CFCA 3L2QA 2GIRA 1XC9A 1N5YA 4CEFA 4NCBA 3NBPB 5FRNA 4RNNA 3KLHA 2YNIA 3MAQA 4KTWA 4I7FB 4FBUA 5KG7A 3SZ2A 1RTJB 4ZPCA 1SL0A 5C25B 3ZSYA 4E7IA 3V9WA 3I0RB 3UR0A 2FC0A 3ZT3A 4CIGA 3NFAA 1CZ9A 5KFWA 3LAKA 1UAXA 1RT1A 2WB4A 2V4RA 4FJIA 1TKZB 1S9GB 4CF9A 3BJYA 1HNIB 4U7CA 2HAIA 2R2SA 1VSHA 5DG9A 3MR3A 2F8TA 4CGJA 1S1VB 4J2BA 5C24A 2HWIA 4CJTA 4MH8A 3BDPA 4MIBA 2VG5A 1TGOA 1VSFA 2YNFB 4E1MA 1R0AA 2BE2B 4DFKA 3D0PA 4WE1A 2BR0A 4EZ6A 2A1RA 3V9XA 5L1KA 5F8LA 3Q8PB 4OPJA 5L1IA 5CYMB 3AO4A 3NCIA 4DQSA 4ECQA 5KFKA 1DTQA 4M41A 5JXSA 3TAGA 2XCAA 5E41A 3LP0A 4GC7A 4TY9A 3V81B 2VG5B 3AVGA 1KVBA 3KK3A 3QIPA 3QERA 1CXUA 3N6LA 3H59A 2UUWA 1X9WA 3KK2A 3N6MA 2HVIA 3KK1B 3M8RA 2C2EA 4CJWA 4O3NA 4CF2A 3CFRA 3ZT4A 1VSDA 2D3UA 2GIQA 2F8EX 2JEJA 3SQ0A 4FLXA 1LW0A 1VSEA 3C6TA 3MEGB 4QCLA 5KFAA 4AHCA 1S6QA 4CF0A 4WFYA 4CE9A 5KFLA 1JXLA 1W0HA 1BQNB 1RTDA 1FXXA 1KLMA 2ILYA 2XHBA 4F4ZA 1WLJA 2RDJA 1SV5B 1EP4B 3V4IB 5DQGA 1RTDB 3U3YA 3TVKA 2ZKUA 4DTJA 1S49A 3DLEB 4FVMA 4DSFA 1HNVB 5J1EB 5CZ1A 4IFYB 1RTIB 1FKOA 4B3OA 5EWGA 1S0OA 4KAIA 1UA0A 2W9CB 2IDOA 4RW4A 4TQSA 4AHRA 4KV8B 1IM4A 2WONB 1RT5B 1B9DA 3AO2A 1S5JA 3KIOA 1JKHA 1KFSA 4ED8A 3T5LA 4O3OA 2IGIA 2R8IA 4HTUA 3OVNA 2OPPA 4J9OA 5SWMA 4K4YA 2ATQA 4BE2A 4LSLA 1C0UB 4J9KA 3NL0A 4FJLA 3IG1A 2X6NA 3PW2A 2XRIA 3NHGA 3RBDA 3KD1E 2D5RA 3KHLA 3OYMA 1S6PB 2JGUA 3AVMA 4JLHA 2BQUA 2Z1HA 4RG8A 2BE2A 3V1RA 5KT2A 2KFNA 4Y3CA 3PW7A 2XY5A 4N76A 2BQRA 4F3TA 4F3OA 3AVKA 4KREA 1HNIA 4KPYA 2W9BA 4FLZA 1CZBA 4CGFA 2ATLA 5HRNA 3VQPA 3IS9A 4EEYA 1XR6A 2J6SA 4DTOA 4KKOA 3O3HA 1HQEB 3PJWA 5KFEA 4AH9A 4NLTA 4ZP6A 3KLHB 4W5OA 1JLCB 1IKWA 2V9WA 1RDCA 3PR5B 2HNDA 1S1XA 1EX4A 4M3WA 4Y2CA 1VSMA 2ITGA 3QO9A 3ISNC 2JLEA 3OL7A 1I6JA 5DQIA 4AHUA 3DM2B 4Z0UA 2HHUA 4F4WA 3M8PB 1RAJA 1NJXA 1TL3A 3SQ1A 4DTPA 4URQU 4KI6A 4ZMMA 3KLVA 1WAJA 1Z26A 1O1WA 2B5JB 1LW2B 3NF7A 2RKIA 3NKYA 4IR9A 3DYAA 2ILZA 1ZBFA 4YP3A 3CDUA 1X9SA 4ZPBA 1HNVA 1NNDA 4Y1CA 3RB4A 5I42A 4TSXA 2XC9A 1HQUA 1QSSA 3BSCA 4Z4FA 5HRSA 4O4RA 4H4OB 3PO5A 1TKTA 2DFHA 1VRUB 1BI4A 1HYZA 3DI6A 2E9ZA 1KHWA 4RNHA 4E7KA 4F4KA 4M3XA 4G1QA 4BDPA 3GIKA 1XR5A 4J2AA 3MECB 4KI4A 1RBSA 2Z1GA 3QZ7A 5FDLA 2AX1A 4CEEA 1U09A 5JS1A 2R8HA 3VQ7A 2D0AA 4Q8EA 4HYKA 3IGVA 3RRHA 3NAIA 4IG3B 5KFQA 3G10A 1T7PA 4ZPAA 1WNEA 3VN5A 3RMBA 3L2UA 4Q43A 2UUTA 1C1BB 4EO6A 2PYLA 2O4GA 4FJGA 4PQUA 1S0NA 4B9UA 1U48A 4EP5A 1JLAB 4WZQA 4BDYA 2ETJA 4MQ3A 3I8DA 2ZE2A 3D28A 1JLAA 4WYLA 3HHKA 3HP9A 3KD5E 4HHTA 2XI3A 3AVJA 4OKEA 4J9NA 3LWLA 3JSMA 1KCFA 5KFJA 4K4XA 2HHTA 3L3VA 3KLGA 1J53A 3GIJA 3CM5A 2XCPA 2Y1IA 3EPIA 4MFBA 5KFHA 1KFDA 1T03B 2Z1JA 4CEOA 5CYQA 2D0BA 3PZPA 2UVWA 1T05A 3KHRA 4K8ZA 5J2MB 3QLHB 1KHVA 3KLFA 4FLYA 3CDEA 4IQXA 2E4LA 4DMNA 1T05B 2D41A 3OL9A 4NLWA 2HW3A 4PA1A 4ED7A 3TAFA 2QXFA 2P5OA 3QGHA 2XO7A 4FJ8A 3HK2A 4AILC 4RW9A 4ZVFA 2F8SA 1L3UA 5JUMA 4KRFA 3MR6A 4DTXA 4CGIA 2C28A 4YFUA 5C42B 3DRSA 1LW2A 1ASUA 3RTVA 1U47A 4CESA 2YNGB 5F8NA 1C1CA 2WTFA 3PW4A 5T7BA 1JX4A 2FVSA 3JSMB 5D3GA 1DTQB 1HARA 2X78A 2I1RA 2R7YA 2IC3B 4KFBB 1L3VA 3TAPA 4KSEB 1D5AA 2J6UA 3HPGA 3I0SA 1Y97A 2IS3A 1S9GA 3SQ4A 4NLPA 1N4LA 3VQ8A 4ECWA 5KFCA 5L9XA 3SFUA 2FBVA 5C24B 4CGGA 3LP2A 1NK9A 3WNFA 3VA3A 1D1UA 4Z4HA 3K58A 4B9TA 3TAMA 4H4MB 3V6DB 1SH0A 3KLEB 3SV4A 2V0NA 4DG1B 4MKAA 4EBCA 2ASJA 3PX6A 1JLQA 3C94A 3WNEA 4DSJA 4KHSA 4OPKA 2GUIA 2UVVA 3D5MA 1WN7A 4DU4A 3LWMA 3P83D 4WFZA 2OZSA 2HNYB 4DLEA 1T03A 4DU3A 5KGXA 5KFRA 4JS4A 1HRHA 4N56A 4BE1A 4BWMA 2BANA 3QEIA 1RTJA 2ZE2B 2YHBA 1S1TB 2FVRA 3KLGB 3U3GA 2PYJA 5KT5A 1WSGA 3BGRB 3C95A 2WONA 3AO5A 4WZMA 3ZSWA 3DOKB 1J5OA 1REVA 4EO8A 4E0DA 4FXDA 3DRRB 4OGCA 3EPGA 3T1AA 3FQLA 2IM3A 4FW1A 3BSOA 4CCHA 1KSPA 3PY8A 3LAMA 4IFYA 3DLHA 5J2QA 2I5JA 4DFJA 1RA7A 4NYZA 3CJ0A 2Q3SA 2ASDA 3T19A 4CJRA 3AV9A 4DQRA 4ID1A 3BQ0A 4JV1A 1QE1A 4DL6A 4GW6A 2XI2A 4B3OB 2RF2B 3OYLA 3QESA 4RW9B 1LW0B 1RDAA 1XR7A 2W7PA 1VSLA 5KG2A 1LWCB 4K4WA 1VK0A 3QETA 4LQ9A 5F8IA 4J9SA 4FCYA 5KFVA 1YTUA 3V81A 1GOCA 3HPOA 3SJJA 3NGDA 1TK8A 4LSNB 3ITHA 5KFNA 2QKKA 3OYAA 4MFBB 4R5PB 4TY8A 5CYMA 2BGGA 3OYDA 4KB0A 3DYAB 5KFYA 3KK2B 1JL2A 1S1WB 4Q5VA 4CERA 4IH5A 1F21A 3QO9B 2PY5A 4QWAA 1ZBIA 4RW6B 4BDZA 2XGPA 2RN2A 4M3TA 1B9FA 3UQSA 3V9ZA 3O4NA 4E1NA 3E51A 1LWEB 4F4XA 4DFMA 1D0EA 4IH6A 4CF1A 3MXIA 1XWLA 4DL2A 3OYNA 4K8XA 1C2PA 3NGIA 4XO0A 2B4JA 3Q8RB 2ALZA 4NLUA 3ITHB 4CHZA 4J9QA 3RR8A 3WNHA 1S9EA 2W9AA 4I2PA 1TKZA 3KKSA 1IO2A 1D8YA 1QSYA 1TVRA 5FRMA 2IAJA 3SPZA 4O3RA 4QWBA 4K4SA 2WRMA 3L2VA 2OZMA 4ECZA 3HM9A 3SYZA 1T8EA 4TQRA 4NRUA 3IGNA 1YVFA 4ED1A 5EU7A 5HP1A 4CJ4A 3QNNA 1Q9XA 5F8MA 1B92A 4J9RA 3QZ8A 3LP1B 5DQHA 3HSTB 4HKQA 1S9FA 3DDKA 2OH2A 3LZIA 2Z1IA 1EETB 2R2UA 2IM2A 4O0IA 1UOCA 1WSJA 3M9NB 1C0TB 4ELVA 1I3AA 2FVCA 3CFOA 2UVUA 5HRPA 4F2SA 2G8WA 4KHQA 3MFIA 3CIZA 1SKRA 1OS5A 1TKDA 3VQCA 4DQPA 4W5NA 4W5RA 2W42A 1X9MA 4OLAA 5KG1A 3IRXA 1U45A 4KV8A 3TI0A 4TXSA 1KTQA 3PJXA 3LDSA 2FJWA 2R8GA 1TKXB 5J1EA 2WCXA 4TLRA 4CEDA 2ZD1B 4NCGA 3G6YA 3LP1A 4J9LA 4N47A 4E3SA 3IS9B 4YMEA 1TP7A 2WK4A 4F4YA 3KKRA 2W9BB 3OYIA 4ID5B 4IFVB 2AJQA 4FJNA 3T5JA 3OSNA 3V6KA 3LP3A 1S97A 3FSIA 4DFPA 1HYVA 3K5LA 2VG6A 4R0EA 1NOYA 4C8OA 2P1JA 3KOAA 1C1AA 2DFFA 4CF8A 3KJVB 4DQQA 1D9DA 5EUHA 4ED2A 5KG4A 4KHYA 2BQ3A 3L3UA 2FLPA 3H4DA 3AVAA 2RPIA 2EC0A 1U04A 4B9LA 1RT6A 4CK1A 5KFFA 1BCMA 1I39A 4YR2A 1C6VA 3RB6A 3QIDA 2OPSA 4LH4A 4ZHRA 4RUAA 3AA3A 4ED3A 4CJ5A 4R5PA 1Z4UA 1A5XA 4RW6A 3MEEB 1RT6B 4L8RB 3E01A 3L2WA 4HVJA 4CEBA 1SUQB 2QK9A 2WOMA 2NUBA 5DLFA 3VQ6A 3QEWA 3OYKA 4FM0A 4DTMA 4KHUA 4KAZA 3OS1A 1TK0A 3I0RA 1SV5A 2EHGA 2B6AB 1BQMB 5KT7A 1JLGA 2YNHB 2VA2A 4LH5A 4RNMA 5F9LA 1UWBB 3C6TB 5EWFA 3HKWA 2OPQA 4DSIA 4DWIA 4NRTA 3BQ2A 2HHWA 2VG7B 4ELUA 1ZTWA 4DSKA 1DTTB 4GMJB 3IRXB 3NF9A 3JYTA 4NLQA 3RMDA 2ZQBA 4OKJA 5L1LA 3OYJA 4XPEA 1LWFB 2G8UA 4K4TA 3F73A 4O3PA 4NLOA 1DLOB 5J2NA 3BGRA 4E89A 1VSIA 2XY7A 4QWEA 1W25A 3BSNA 4CJEA 2YHAA 3HVAA 1L3TA 2HHQA 2VA3A 1KLNA 4K4UA 4RUCA 4U6PA 3DRRA 4PY5A 4FS1A 3QIOA 1JLFA 5HP1B 1KVCA 4G1QB 4IDKB 1VSKA 1HMVA 3FFIB 3UIQA 2IM1A 4H54A 2HNZA 4K4VA 3H98A 3GQCA 3G86A 2D7SA 1NKCA 4JV2A 2C2RA 1HPZB 5F9NA 1RT1B 3KLEA 3CDWA 2R8KA 3TAQA 1NJWA 3QEPA 4ECYA 1RT7A 3RMAA 1RT2B 1JLQB 3GYNA 2IJFA 3DOLB 3TARA 3SQ2A 5DMRA 2HMIB 4MIAA 3SV3A 4DTUA 4J2EA 2OPPB 4Q45A 2BDPA 4RW7A 2IC3A 3OYCA 3VQAA 1XI1A 3M8PA 3V1OA 3ULDA 1JL1A 4CJQA 4PWDA 4O44A 1A5WA 1IKXA 1GOBA 3UPFA 2VWJA 3KMQA 4ZP7A 4DL4A 4EYIB 4CK3A 3KTQA 4NLDA 3C6UA 3GV8B 2VWKA 1DTTA 5KGWA 4F50A 1S1UB 1BISA 3RAXA 1SH2A 2C22A 1N48A 4PUOA 4AHSA 4RZRA 4CEZA 3AA4A 2W8LA 1RT2A 1JLCA 3U6FA 4NLXA 4ECUA 3ALYA 2W8KA 4FS2A 3T3FA 1EXQA 4FJ9A 4BACA 1VSJA 4CEAA 3TWHA 3SI8A 4FLUA 4DF4A 5KRSA 1IKYB 4DTSA 2HMIA 3MEDB 3PW0A 2CJQA 3S3NA 4OVLA 3HVTB 3AO3A 4I2PB 3DRPA 4M3ZA 5J2PA 2FLLA 3VA0A 3OYEA 4RW8A 3HYFA 5CYQB 4TN2A 1SUQA 5SZTA 5HBMA 4FJKA 3KNAA 3OSPA 4O44B 2GBZA 4CHPA 3BREA 2R8JA 2EX3A 3MR5A 2QE5A 4ICLB 1BCOA 4LSLB 4YNQA 4CHYA 4RW7B 5HROB 4O3SA 4FJ7A 3PVXA 2OPRA 4M45A 4FYDA 1HMVB 3FFIA 2ASLA 1S1XB 3DOLA 3VQDA 3KJVA 3EZUA 3CO9A 2F96A 4CECA 1NJYA 3QEVA 2IJNA 4PQUB 3THVA 4FK0A 2RDIA 5FDLB 1ASWA 3CM6A 3KMSA 2IA6A 3MXJA 2OPQB 2IM0A 1KLMB 5C5JA 1LWFA 4IBNA 4MK8A 3CFPA 4UQGA 1QHTA 5KFMA 4EBEA 1NHUA 2PZSA 1JLGB 1IKYA 4HUGA 3V4IA 4I2QB 5KI6A 4YR0A 4K4ZA 2ZD1A 2X74A 4URGA 4Y1DA 4IDKA 5HRRA 3SPYA 4NCGB 4NZ0A 2FBTA 2XWYA 2RKIB 4GC6A 1BHLA 2FBXA 1ZBUA 3S3OA 4B08A 1FKPA 3ASMA 1MU2A 3AVNA 3V9UA 1RDDA 1BGXT 1RT4A 4Y2AA 1TAUA 2YKNB 2FVPA 1S1UA 4NLRA 5KFOA 3OLBA 4K50A 4DTRA 3V9SA 3SUOA 3ZSQA 3NE6A 4IRCA 3K5NA 1VRTB 2W9CA 1JLEA 2E9TA 1RYRA 1GOAA 3O3GA 3K59A 3AA2A 1UA1A 1JLEB 4HUFA 4JRQA 4CJSA 4IG0B 4R8UB 3JYTB 3NF8A 2HNDB 4DLGA 4NYFA 1LV5A 1WNSA 3NGZA 1NOZA 1IKXB 3RB0A 3VQ4A 1WAFA 4DSLA 4E7JA 1R0AB 3LPTA 4EZ9A 3KHHA 3NF6A 1TAQA 3QLHA 2P51A 2B6AA 4DG1A 1S4FA 4QWCA 3PW5A 2DPJA 3A2FA 2DFEA 4HCBA 1XHZA 5CZ2A 4M3UA 1NKBA 2KFZA 4M42A 4I2QA 1K6YA 1S6PA 3B6PA 4AHVA 1CSJA 4KO0B 3MR2A 3EYZA 1LWEA 1QUVA 1NK7A 4F2RA 3ISND 3I0SB 4OJRA 4J9MA 3DLBA 5DGAA 2G8FA 3K2PA 4WYWA 1T94A 1BIZA 3NGYA 4O4GB 3EZ5A 1WSFA 1FK9A 3ZSXA 1YVUA 3GV7B 2AGOA 4IR1A 5KG3A 5L1JA 3HT3A 5DG7A 3IAYA 1RTHB 1TV6A 2BRKA 4CJLA 1FKPB 4G3IA 2DPIA 4Q8FA 1NJZA 4ZVEA 3KHGA 1NKEA 4E7LA 4TYAA 2YKNA 4CJPA 4KB1A 5EDWA 3QNOA 5J2NB 5HROA 4ZTJA 3DLKB 4URSA 2X6SA 4IH7A 2O5DA 2AGQA 2HWHA 1HYSA 4LSNA 1QTMA 3VQEA 4AHTA 3AO1A 4ID5A 4IFVA 5K14B 3M9OB 3IN5A 3RRGA 1WSHA 4CK2A 4KBIA 4JUZA 4B8CA 5KG5A 4FLVA 2GC8A 4IRKA 4FZXC 2RF2A 4XPCA 2C2DA 1CXQA 3HP6A 1S6QB 2IAJB 3I5AA 5KFDA 3NBPA 4ZVHA 3DI6B 5KFBA 1JXBA 3QIPB 1QS4A 1D9FA 2DTUA 1RNHA 5K14A 4EP4A 1C0TA 3HPHA 2B5JA 3SFGA 1RTHA 1TV6B 1RBVA 4CJFA 4FJHA 4M3YA 3G6XA 2XGQA 1J9AA 4F8RA 5KFXA 2OYQA 3SUQA 3K5OA 2IBKA 3HXMA 3DOKA 4CIEA 4FK4A 3DLKA 3CWJA 3NAHA 1JLBB 3DLGB 1TVRB 5J2QB 3HJFA 4QW8A 2FJXA 2E6LA 1RBRA 4RU9A 4CFAA 1SKWA 2HNYA 4RNOA 1KRPA 3RMCA 2AX0A 4B9MA 3BQ1A 4I9LA 4O0JA 4KHMA 2OPRB 4KO0A 1HQEA 3CJ4A 4ZP9A 4FJMA 4O4GA 4QWDA 3CJ2A 3UDLA 2BRLA 4H4MA 4Q44A 3WNGA 4C8MA 4CJVA 1NK5A 3RR7A 1VRUA 1BI4B 4ECVA 3TANA 1SH3A 3Q8QB 3H40A 5KFZA 2WHOA 3MEDA 3ZSRA 4CJUA 4DEZA 3SUNA 2AGPA 2E6MA 4HCCA 4B8AB 3H2LA 2KQ2A 4ED0A 3AVHA 1LWCA 3PHEA 3H5SA 4E7HA 3D45A 3DLRA 4EBDA 1ZTTA 3RWUA 3ZSZA 5FROA 1J54A 1QQCA 2W7OA 3ICLA 1S10A 2YNIB 4ZPDA 1JLBA 2I5JB 3DLGA 5KG0A 2G8HA 4IRDA 1ASVA 3KLIB 5T14A 1HJRA 3LPUA 1A5VA 4HUEA 2YNGA 3ZT2A 3OS0A 4Q0BB 3K57A 1QSLA 1N5YB 4FZYA 4Z4GA 4DL5A 5CY4A 1NK0A 3AA5X 1RT4B 1RTIA 4OLBA 1HPZA 4B9SA 3OL6A 3OJSA 3SUPA 4DSEA 3H5UA 3K5MA 2R2RA 4CGHA 3PX0A 4BWJA 2BANB 4IOBA 3P1GA 2B43A 1ZYQA 4OKKA 1GX5A 3LZJA 4KHWA 1ZBHA 3LALA 1BQNA 5DG8A 4FZZA 2HVHA 1RBUA 1EETA 4ZP8A 4ELTA 4B9NA 3GV5B 1BIUA 3QINA 3QGGA 5KFGA 3B6OA 3LANA 5KT3A 1QE1B 1BQMA 3S3MA 3PV8A 4WFXA 2IMWP 3SNNA 3Q8SB 4RNFA 1RBTA 1SKSA 3AVCA 3QGIA 3CYMA 4Z4EA 1N6QA 4ED6A 2G8IA 4KTZA 4FLTA 4ZTFA 1ZETA 5DGBA 1C0UA 1NK8A 3OHBA 2JC1A 4JRPA 3TAMB 1MMLA 4JV0A 3V6JA 4LD0A 3MTKA 4W5TA 1RT5A 2XY6A 2FVQA 4RW4B 4NCAA 1BL3A 4FK2A 5KFPA 1RYSA 4LY7A 2YNFA 4W5QA 3EY1A 4I9QA 1S1WA 3QEXA 4M94A 4GVMA 3DLEA 5HBMB 4FM2A 1YTAA 4NLGA 2YNHA 4MKBA 5KT4A 1TL1B 1G15A 4RW8B 1L5UA 1RA6A 2JEIA 3OY9A 3FRZA 3PR4A 4CHNA 5F8HA 3I5BA 1IKVA 4J9PA 4ICLA 4WE1B 1U4BA 1NK6A 2AQ4A 4MK9A 2A1SA 2KTQA 3SI6A 3N6NA 5I42B 4CIFA 4O5BA 4QOZB 1JXEA 3DRPB 1CLQA 4H4OA 5KTQA 1IG9A 5KFIA 4KTQA 2FBYA 3OS2A 1NHVA 2JEGA 4DTNA 4WXWA 1JIHA 2AWZA 2QV6A 3C6UB 3TQ1A 3F9KA 4CJKA 4FJ5A 2YV0X 4Q0BA 4EYHB 3NMAA 2YKMA 3VQQA 3LP0B 4DS4A 1RCHA 1IKWB 4IKFA 2QKBA 3AVLA 3BR9A 1YT3A 4H8KA 4CJ3A 3NAEA 4OGEA 2R2TA 1C1CB 3RB3A 4ECTA 1SL2A 4O55A 5C42A 3ZSOA 3DMJB 4DL7A 3QYYA 2UVRA 2CKWA 3VQ5A 1RT3B 4FJJA 3VQSA 1FK9B 3CJ5A 4O3QA 4DL3A 1S1TA 4KKOB 5HLFB 2FLNA 1MU2B 3RBEA 4NLSA 2HB5A 1RT7B 2KZZA 3V6HA 3PUFA 3L8BA 3KLFB 1NK4A 4DS5A 2AU0A 3MECA 3AVFA 4IKAA 5KFSA 4MK7A 1KVAA 3P5JA 3ZSVA 3M8SA 3HL8A 5I3UB 4QAGA 3AVBA 4N41A 3V6DA 1IKVB 1JLFB 4NLYA 1TQLA 3VQ9A 1EKEA 1TL1A 4KE5A 2JEFA 2DY4A 5DLGA 4I7FA 2HNZB 4FJXA 1ITGA 3CJ3A 5I3UA 1S48A 1T3NA 1Q9YA 3MXMA 4Z4CA 1RILA 5F8JA 1K1SA 3AVIA 4CFBA 1WSIA 1S0MA 1RDBA 3KLIA 3M8QB 4QPXA 4FLWA 2LSNA 1ZBLA 3HVWA 3MF5A 1C1BA 5D3GB 3DM2A 3M9MB 3OJUA 4DQIA 1FKOB 1EP4A 3DRSB 4NYNA 1LAWA 3ZCMA 3MFHA 3T5KA 3DMJA 1SL1A 4KFBA 1U49A 5KG6A 1X1PA 3VQBA 1UWBA 3BSAA 4PWDB 4C8NA 4C8KA 4YQWA 3OHAA 3PX4A 3H4BA 2YKMB 2HHVA 3SCXA 1Z25A 4N5SA 3NH2A 3OYHA 1N56A 2J6TA 3MEGA 5J2PB 1XHXA 3ZT1A 1S9EB 3HVTA 4M95A 2P5GA 4PUOB 5J2MA 4ECXA 5DK5A 2HHXA 3NH0A 3G0ZA 4Y34A 1C0MA 2E9RX 4JS5A 3NH1A 4FW2A 3FQKA 4BE0A 3E01B 3FDSA 3OLAA 4ZHRB 1L3SA 3KK1A 3O4QA 5JS2A 3T5HA 3TABA 4CEQA 5KFUA 2G8VA 3L2RA 3KK3B 2G8KA 3GIIA 3CG7A 5KFTA 3H08A 2FJVA 3V1QA 4FM1A 3IG1B 3H5XA 2Y1JA 3TR8A 4ZVGA 4WXOA 3MEEA 2OPSB 1RDRA 4TYBA 1IH7A
chains in the Genus database with same CATH superfamily
2QO3A 3OL8A 1HR0F 2AEMA 5TKYA 2HHSA 1HR0K 3HMJG 4AQYJ 4CZCA 2BM1A 1REVB 3OYFA 1ZM4A 4B9VA 1ZM3A 2BYCA 5THWA 4Z4IA 2MY7A 2W25A 4DZDA 4TY8B 2AW0A 3EVWA 4IG3A 3UVJA 1TK5A 2Y9HA 4KH1B 1N32F 4ECSA 3K0JA 3ZT0A 3O3FA 1M5SA 4MDAA 4DQ8A 3BGLA 4O8KA 2AKWB 2CJYB 3NDKA 3PO4A 3EGVA 2WZ1A 2H48B 1WC4A 1X7VA 1YRUA 1FXDA 3HVRA 3ULEB 5MLCQ 2D0CA 4ECRA 3OYBA 2F7TA 2V4QA 2VFSA 5KT6A 5AE1A 3T7ZA 1DLOA 4WWSA 2JC0A 3OYGA 4FBTA 1J5OB 2KLAA 3JSBA 3RAQA 2Z0GA 5GAHI 2HHHJ 3JXUA 1HBMA 1PKUA 4CO3A 2JWKA 1IBLK 2VG7A 2V5HG 1TU0B 4CFCA 3L2QA 2JVRA 3CD5A 3W63A 2GIRA 1VQ9N 4ALZA 5FRNA 5EVZA 3HDSA 3R9LA 4KTWA 4OQJA 1E4GT 4FBUA 2LYVA 5E7OB 1X4GA 2DVIA 2GGPA 5C25B 1UWAA 2PEBA 3VGUA 3R9PA 2MHNA 3DOMA 3MI7X 4A47A 5C2GA 4DV2F 1CZ9A 4FWRA 4NMLA 1K44A 4A2BA 3ADAC 1LKZA 4CF9A 4HLBA 2HQFA 5AZJA 3V2UC 3MR3A 1S1VB 4J2BA 5HN0A 3E9OA 3CMAS 1HWJA 3FEXB 2UXCK 2VG5A 3CE8A 1VSFA 4ZVOB 3CCMS 2NS1B 4DZ6A 3I56S 2W2QP 5A8KB 1OQ3A 5L1KA 2DR7A 2HMPA 3Q8PB 4OPJA 3I4PA 2NXJA 3AO4A 3NCIA 2ZJPL 4DQSA 3QAUA 4ECQA 2DO0A 3AOBA 2XCAA 1OPZA 3THWA 3MURP 4JBCA 3NOCA 1SAZA 3N6LA 3KK2A 1NGDA 4C3MA 3KK1B 3BPDA 3M8RA 2C2EA 3OR1A 2HHPA 1Y11A 3OW2R 1BWFO 1VSDA 2VU5A 2ITMA 3I4HX 3SQ0A 1LW0A 3C6TA 3MEGB 3QPIA 3QBXA 4QCLA 1V3SA 3OW2M 1R8CA 5LMUF 4CF0A 4RKUC 1RAIB 4CE9A 4L3KA 2HIYA 1JXLA 4ES2A 2M9KA 1WORA 1WLJA 3NMRA 2CPXA 2O1PA 1SV5B 2BJ9A 3U3YA 3TVKA 1BWVA 4C98A 4ZITA 5LSOA 4KH4A 3CPEA 1U2RA 2QSWA 2ADBA 1B70B 2B8QA 5J1EB 4FN5A 4QQBA 5EWGA 1LCUA 4KAIA 4RW4A 2MYFA 4HACB 2WONB 3M7VA 3HI0A 3FMWA 1B9DA 2VUGA 1RWKB 3KIOA 5HO4A 4A8MP 1XUPO 5KAKA 4ED8A 4HTUA 1NLKL 2R7SA 4DV4K 3QAEA 3E1YA 4K4YA 2E44A 5LMUJ 3O9QA 3THWB 1GMUA 1VISA 3IG1A 1O5JA 2F3JA 5HVGA 3SXLA 1FCAA 3A4TA 3KHLA 4WFNQ 3PKYA 2QEXN 3ZZZA 1BU6O 1S6PB 2BJ8A 2ZUAA 4JLHA 4RG8A 3DXBA 3V1RA 5K8PA 4FYVB 4N76A 4F3TA 5G0RA 5GAHU 1XMOK 1HNIA 1T9TA 2FJEB 2P9SA 8AT1B 1S6OA 1OH7A 3ZZPA 1BWEA 4C4WA 2FYXA 2CQGA 4DTOA 3BZQA 3J7AP 3ID8A 4F3MA 3PJWA 2KO1A 3P4UB 1IKWA 4LF8F 1RDCA 1Z6RA 3BO3A 4M3WA 2UXBF 2MQQA 2FLOA 3DOMB 2IPOB 3PM9A 3FZFA 2B4VA 1I6JA 4DJBA 5DQIA 3DM2B 2PMWA 4L76A 4OZJA 2HHUA 5BYQA 1NJXA 2QWLA 1T9XA 4QYRA 3D3CJ 1U1OA 2IFXA 1U8SA 2VJVA 2UU9F 3B54A 1O1WA 3GG4A 1FXLA 2RKIA 4FKXA 2ILZA 1A7GE 2ACYA 4ZPBA 4PZVA 5I42A 2KJVA 2HZCA 4WU3A 5EN1A 1QSSA 4Z4FA 5HRSA 3UKUB 4O4RA 1F5AA 4Z2XA 2WW4A 1BI4A 2YXLA 1MWZA 4F4KA 1NGFA 2HS3A 4KY3A 4MAKA 4KRWA 3F2KA 4KI4A 3NLCA 1RBSA 5GAEP 6AT1B 3QZ7A 2AX1A 3A8IA 1YK9A 1IR2A 2D0AA 1GK8A 4HYKA 3IGVA 5ETQA 3HHDA 2VQFF 3G10A 1T7PA 3A8KA 3VN5A 1DBDA 2XSFA 5E5NA 3L2UA 3ZFVA 4YB1P 1CPZA 2UUTA 2PYLA 2GV1A 4B9UA 1U48A 2A2CA 3D28A 4OHYA 1JLAA 1SQGA 4MJKA 2RE2A 2V69A 2ASMA 3KD5E 4U8VA 4OKEA 1EAYC 3NGUA 4IOAQ 2YH1A 1IBMF 3LWLA 3JSMA 1RAGB 2H65B 4IEIA 3CJ9A 4LFAF 4OV1A 1J53A 4CZLA 4DV2K 3GIJA 2R7UA 5AT1B 3WXKA 3EE3A 3CM5A 3W1YC 5IT9Y 4LF4F 1JMTA 4MFBA 4HEA9 1KFDA 1T03B 5ADZA 1DRZA 4CEOA 4ILMA 4RJVA 2ZM6K 1G3OA 4HTIA 1L3KA 5AQYA 3QB0A 4YHHK 1KHVA 4FNIA 2E4LA 2WC9A 2X1FA 1T05B 3MUTP 4DMNA 2DH7A 3VAFA 2HW3A 2F4VF 4W92B 4Y2IA 4PA1A 3TAFA 4GRSA 1S76D 5AQFA 2P5OA 3T1HF 4IO9L 4M7XA 3HK2A 3EXCX 4KRFA 2RS2A 5A0YB 4CGIA 4YFUA 1LW2A 1ASUA 3OBYA 3P49B 5F8NA 2BM0A 1K8AT 1JX4A 2V7YA 1GMWD 2ZWOA 2A18A 5HMXA 4DV5F 1YBTA 2I1RA 2IC3B 3FSXA 5A2QY 5AQHA 3UNYA 3HPGA 1FRKA 9RUBA 5A0YA 3D6RA 2YWHA 2IS3A 1S9GA 3OTCA 1WHXA 2F1FA 3O9RA 2XS7A 4N8OA 4CGGA 1ATNA 1VQSA 2FC8A 3GCXP 3EN9A 3KG0A 5FLXY 1WHWA 4JP8A 4Z4HA 2M8HA 3KLEB 1Y3KA 4MKAA 1JLQA 1YJ7A 1X4FA 3AXMA 4DSJA 1RCOB 4DBQA 3WNEA 4KHSA 1H0HB 4OPKA 2BA9A 3H3NO 4WFZA 4DLEA 1T03A 5A6PA 4JS4A 3M2UA 3QEIA 2EFQA 4BRCA 3CHWA 2ZE2B 1BLUA 2CJAA 4OZ1A 1J27A 3C95A 5A8WA 4WZMA 3UKRA 2V8VA 5RUBA 3MPDA 1REVA 3JTOA 4MO5A 4EO8A 4E0DA 4KC5A 1N8RO 1AZSB 4FW1A 2KT3A 1CJKB 4IFYA 3DLHA 2I5JA 3ONQA 2X7IA 1RA7A 3OXLA 4CJRA 4YY3F 2CQ1A 4ID1A 4PCQA 2MQ8A 3DHXA 1CQMA 2MGZA 4GW6A 4DR1K 4EI2A 2J7WA 3OYLA 2J76E 5AQSA 1RDAA 2W7PA 1VSLA 2XQCA 1WUUA 1LWCB 4JEPA 3VVUA 3QETA 4LQ9A 2BJDA 2JLFA 3HX9A 5F8IA 3CDBA 3CCRS 4FCYA 2LP4A 5KFVA 1YTUA 2J9CA 3J7ZO 1RWXB 5C0YA 1GOCA 3HPOA 4DR3J 3ITHA 5KFNA 2JHEA 3OYAA 4MFBB 3OPKA 1TL7B 2D9OA 5KOWA 4I6AA 4CERA 4IH5A 3QO9B 4BDZA 2RN2A 1NGHA 1B9FA 2WAQD 3I31A 2QG9B 3V9ZA 4JI1K 3O4NA 5F0UA 2KL8A 3RZAA 4EIAA 2MB0B 4F4XA 3VESA 1RWWB 3L09A 3M32A 3OYNA 3UE2A 2UXCJ 1RUSA 3O5TB 1LWXA 3LO3A 1S77D 3JB9k 1P9QC 1F60B 4UY8O 3WNHA 1S9EA 2W9AA 1TKZA 1T02A 3KKSA 1VQ6N 1TVRA 3I9V9 3AGKA 2W6KA 5FRMA 4U9RA 4LF6K 2O8DA 4O3RA 1NXIA 2NNWA 4K4SA 2WRMA 3VF2A 3SYZA 1T9YA 1T8EA 4TQRA 3ISZA 5IV4A 1YVFA 5EU7A 4CJ4A 4G6VB 3QNNA 1Q8BA 1B92A 4RLEA 2MQMA 2EVZA 3LP1B 4GKJK 3WQUA 2XMJA 3Q8VA 4H5WA 2B51A 2IM2A 4O0IA 3FCWA 1NCLA 3UCUP 3L7UA 1X4CA 1GTEA 2FVCA 2X51A 2D3O1 3VVTA 5HMYA 2UVUA 1FRIA 2D3OR 2O8CB 2A0FB 4DQPA 4ZJQA 5CH7B 1C4AA 4ZK7M 3N5BA 3BBCA 4CZHA 2BJ7A 2NZTA 1SQFA 4CBXA 3GCWP 1KTQA 1J5EJ 1TKXB 5J1EA 4WQ5A 1Q5VA 2DY9A 3VGMA 4DR7J 3LP1A 4J9LA 5A6WA 2DRAA 4RBVA 1R31A 2F9TA 1EQ0A 3I33A 1TP7A 1ZPWX 3D2EA 1ZAWA 2M70A 4IFVB 2Z2ZA 4FJNA 3J7AN 5G0RB 2P1JA 4ZCMA 1VQLN 5CCMA 5D4PA 2L48A 2HBRB 5D6GA 1HNZF 2ZUGA 3RJMB 1X60A 4OHXA 3WHIA 1XMOF 1UPMB 4ED2A 2KG1A 5L9NA 4P2SA 3D66A 2BQ3A 2CQDA 3L3UA 2YWGA 4RL1A 2EC0A 1J2VA 4CK1A 2A3ZA 1BCMA 4LF8J 5HJXA 5D4NA 2YBVA 3QIDA 3E3XA 4LH4A 4ZHRA 4RUAA 2QLWA 1YJ9N 2XMVA 4ED3A 2CDQA 4R5PA 4L74A 2KFYA 3MEEB 4H0PA 1RT6B 4L8RB 3L2WA 1UMJA 2HGMA 1B99A 4B1YB 3WQTA 3M8ZA 5GAGI 2VPWB 5K8OA 1J6ZA 2UUCK 3SAGA 3QEWA 4DTMA 1XMQK 3OS1A 1RP5A 3ZZUA 3CCJS 4JI5J 3I0RA 1SV5A 5ETKA 1KQSM 3D4JA 1NGEA 4ZVQB 3R1HA 3IBCB 5GADI 1M5PC 4YB6A 4RNMA 4B3RF 3VAGA 1FJ7A 4JKHA 3C6TB 5EWFA 2CQPA 5JVGQ 2VGMA 5ETNA 2OPQA 2HYIB 4DSIA 2BOAA 2OAUA 2HHWA 1MROB 1ZTWA 1RWNB 2AV5A 4DSKA 4OYOA 1VQ6S 3NF9A 4IOCL 3RMDA 4B3SJ 3PIOL 3N4PA 2CPFA 5L1LA 1B4SA 3C6AA 3C7NB 1PJ7A 4NLOA 2C3YA 2H3GX 2EK1A 4JI3K 3MMCA 3ZTOA 2XY7A 4QWEA 1EWRA 4CJEA 2DHGA 2XMKA 4AL7A 2HHQA 2EFOA 2L9DA 1YRTA 1KLNA 4OZ2A 1YHQN 3BEXA 3THXA 4X65K 1CVJA 4FS1A 2PMHA 3QIOA 1JLFA 2EK6A 4G1QB 4NI2B 1HMVA 3FFIB 2IM1A 1FX4A 2KJWA 2KHCA 1IBMK 3H98A 5D4LA 2VKRA 3GQCA 3N4WA 1BDGA 2BEFA 5GVQA 1IJJA 1WB9A 4LF4K 4M5DA 3KLEA 2R8KA 4UUXA 1Q78A 1G2EA 1JLQB 3GYNA 4F9OA 2Q1LA 5DMRA 3SV3A 2DR6A 1KKHA 3OT9A 4J2EA 3BH7B 3Q0AA 3MCSA 4RW7A 3HD1A 2MKKA 3OYCA 3F56A 3VQAA 3ULDA 1JL1A 4BY9C 1FRXA 1U25A 4OYXA 1TR0A 1FEEA 5M1NA 3GSDA 4Y0WA 2NSBA 2AYGA 3DAWA 4EYIB 3TEHB 1SIWB 4NLDA 2Y8YA 2VWKA 1T9UA 3R6MA 1BISA 3RAXA 2P9IB 1D4XA 1N48A 3OFHA 5DM7Q 2ZNZA 4AHSA 4OJHA 3AA4A 3A8EA 3AA9A 1NEEA 1JLCA 3ALYA 5DETA 3NCRA 2W8KA 1B7FA 2PSZA 4FJ9A 3L4IA 1LK5A 5KRSA 3MM6B 3HVTB 3JS6A 4QS8A 3VA0A 3HFZB 4BRNA 3CCMN 2N82B 3MM5A 5HBMA 4FJKA 3OSPA 4OYBA 2OTLS 4CHPA 1KOHA 1GLCG 4M5NA 2QE5A 1BCOA 1H2VZ 3A8JA 4CHYA 3S6EA 3W66A 5C7PA 1HMVB 3FFIA 2F9JA 4IUFA 4DV3J 3DOLA 3VQDA 2UV8A 1PGZA 3EZUA 2F96A 1NJYA 1OH5A 2OTLN 4BHQA 3QEVA 3MCMA 5A2QO 3MM8A 3VEOA 2V8GA 5U47A 4FK0A 1WACA 4CO0A 1F2HA 1GLBG 1KC8O 3KMSA 4DL0C 1VMBA 1VQ8S 3QWUA 1VQPN 5AQGA 1NSKL 3CFPA 1ZM9A 3CJRA 1PBUA 1QHTA 3UR3C 1NHUA 2Q2RA 1JLGB 1R8BA 4HUGA 4PKGA 3V4IA 4YR0A 4WFBQ 4A8KA 4K4ZA 2ZD1A 3FUYA 5CR4A 4URGA 3LTOA 2P9PB 3D0IE 1WKKA 1BHLA 2FBXA 5EOYA 2QXLA 3Q83A 3MPWA 3WEEA 3ASMA 1CJUB 2DISA 3FNNA 4Q2LA 3WX4A 2DGVA 3LDLA 5KFOA 4B3TF 4K50A 1N33J 4IJNA 1YJNN 1YRXA 3ZSQA 3NE6A 2J0XA 3DLLL 2MKSA 1VRTB 4LF5K 5HVFA 2GX8A 3U1NA 5C12A 4JRQA 2J5AA 1SJ1A 3CCTA 1LV5A 4NYFA 4OV6A 3NGZA 4JKEA 2CQ0A 1WEZA 3QRRA 3VQ4A 1WAFA 4H4KA 3CNQP 1R0AB 4BC5A 3LPTA 3NF6A 2XULA 2M4MA 2LXFA 4ER8A 2Y8WA 1AROP 4B1ZA 3P4IA 1B0VA 1KS2A 2KFZA 1AFIA 4PKDB 4LR7A 4I2QA 4AHVA 3TSQA 1SKUB 1YHQS 4ZA1A 4P2FA 4DX6A 3MR2A 3EYZA 2MLXA 4RCHA 1VYAA 2N3LA 1QUVA 2MJUA 4F2RA 3ISND 4BR4A 2DGUA 4J9MA 1DZ5A 3THXB 5IT4A 4DR4J 3VZIA 2X1AA 4BR2A 2HFVA 3THTA 1WSFA 5JVHL 2GQ2A 3GV7B 3VEWA 5L1JA 3HT3A 5DG7A 1XK8A 2DNLA 1A0OB 3R5GA 4E8UA 4CJLA 2DNOA 5ETOA 4G3IA 4Q8FA 4ZVEA 1ESVA 2W2PP 3VENA 4OX9K 4E7LA 4LFBJ 4L72B 3D7EO 4KB1A 3VQTA 1MWQA 5J2NB 5HROA 3MEKA 2O5DA 3RUBL 2JLGA 1XTZA 2KM8C 1HYSA 4DR5K 4P72A 4NEZA 4HACA 3AJ2A 3KDOA 3VQEA 4AHTA 4IFVA 5K14B 2E5GA 4DUYJ 3RRGA 4WF9Q 2L9NA 4CK2A 3P5TL 2A5XA 3UKUA 5KG5A 1YJNS 3WBZA 1HHSA 4FZXC 3M2RB 2EPIA 2CQHA 3R97A 3I5AA 3C14B 5KFDA 3NBPA 2CPZA 3H25A 1CS4A 3R2DJ 3CCLN 1D9FA 5K14A 3HPHA 3SFGA 1RTHA 3ENHA 3Q2TC 2XGQA 1J9AA 2MXYA 3SUQA 2JFKA 1KVIA 3FC9A 4CIEA 3E9LA 4JKGA 2HQDA 2DIUA 1TVRB 1WWHA 5J2QB 4HL9A 3FE1A 4RUBA 3GB0A 4I68A 1YWXA 3JSRA 1QVGR 4DU7A 2ZDPA 4PAAA 2ZWHA 5DDPC 3DLLQ 3O9TA 2HNYA 3HSZA 5E3PA 1KRPA 3QSIA 3MHYA 3BQ1A 4KHMA 2OPRB 4KO0A 1WEXA 4AL6A 3HSCA 3HSJA 4QWDA 4OJ1A 3UDLA 1U1LA 1ZA1B 4LRFA 2N4DA 2AIRB 3WNGA 4C8MA 4CO2A 4CJVA 4EFHA 4U8YA 3SSRA 1Q86T 1VRUA 3SIPB 3FBBA 4CYUA 1KVKA 3VCDA 3TANA 4ANDA 3IDHA 2AJ0A 2FUG9 2KB2A 4TU7A 1XMOJ 3CC4S 3ZSRA 3CCUN 2AGPA 4LF9F 4OPHA 4HCCA 2KQ2A 4LF7J 2CPDA 2HGLA 2DNGA 2O8BA 2ERRA 2JL9A 5IWAJ 3D45A 1FJGF 3TA0A 3I32A 2A10A 3ZSZA 1XNQF 3HHLD 5FROA 1J54A 4K43A 2XYHB 3ET6A 2RD5C 2E1ZA 2FHJA 2VB6A 3GYXB 4IRDA 1ASVA 3KLIB 3POTB 3TU5A 3B4MA 2OANA 4J37A 1A5VA 2YNGA 1J5EF 1QSLA 3BN7A 4NX9A 4DL5A 1GLEG 4ZCIA 2PDAA 5CE3A 3AA5X 2W2NP 4DV6J 5AE2A 2DGWA 4K0KJ 3OL6A 4DSEA 3UD4P 3KXDA 3M2RA 2DO4A 4JKCA 4IOBA 2G1DA 2FC9A 4NYOA 4OKKA 4KHWA 4K42A 4B9NA 1SIZA 3QGGA 4L3NA 3AQPA 3LANA 2W40A 1QE1B 4AXJA 1BQMA 2AMCB 3S3MA 1QDUB 1RE1B 1RBTA 1UPPA 4DDFA 3QGIA 2V68A 2QGFB 2ZH8A 2DT9A 4WP3A 4FLTA 1AYEA 3N28A 2R3VA 1ZETA 3OHBA 3MM8B 4JRPA 2MQOA 5FPDA 2NRZA 1HBUA 3CCUS 2IYGA 2E20A 3H90A 3T69A 3FBEA 4QU7A 4LD0A 1JCGA 5A76A 1F0XA 2X1BA 1BL3A 4FK2A 1ELOA 1TFYA 5KFPA 4LY7A 3W5XA 4M94A 4KGVB 1KXPA 2KM8B 1YTAA 3QT6A 1TL1B 1M90T 4RW8B 4NMXA 5E84A 1L5UA 4JK9A 2QA2A 2DRDA 2QTDA 4KT0C 3ZTRA 2KTQA 4DOZA 2D0OA 1VQNS 3LGHA 2VBXA 5CHCB 1JXEA 1G1XA 1CLQA 1IG9A 2G13A 3L4BC 1FESA 3OS2A 2PC6A 1Y0HA 3UDEA 1NHVA 5K5MA 3VAMA 4OYMA 3BY5A 3VGVA 1TUGB 4C11A 2MGZB 3UN2A 3O5BA 4Q0BA 2OMOA 4NYPA 4RWXA 3VQQA 4MYUA 1Q86O 3F9MA 4LMZA 4CM0A 4H0OA 1U1PA 2DXEA 4MKVA 3NAEA 2OHDA 2DNQA 1N32J 4A2AA 4O55A 2XNRA 5B0CA 2HHHK 4YDUA 4DL7A 3A5MC 3BF1A 4DR1F 4V19X 1VHIA 4FJJA 1FK9B 4DL3A 1NBEB 1HWKA 3J7ZT 2PGCA 3G82A 3F44A 5FLXO 3K8VA 3US5A 3LL3A 4R79A 3L8BA 2V8HA 4TKTA 1NK4A 4A62A 4NLBA 2C3MA 3OVSA 5KFSA 4ZLPA 1MLAA 1IBMJ 4A5AA 3HL8A 4YORA 3G96A 2ADCA 4PG4A 4DUTA 2CXEA 3B4DA 3MN6A 1M1HA 3T1YJ 3VQ9A 1EKEA 1TL1A 1H1VA 2PA3A 4KE5A 3ILOA 4QU6A 5AQOA 4FJXA 1FHTA 2VF3A 1Q9YA 3GSIA 1HNWJ 1K1SA 1HKCA 2DH9A 4LRDA 4A8QA 5B09A 3KYLA 5BN9A 2KI2A 4DV3K 2YX4A 1SJQA 1OPIA 1H7WA 4KQZA 1GXTA 2IVPA 4ED4A 3OJUA 3M9MB 3L3CA 2B7CB 3ZXWA 2IRUA 1KQGB 4CVNE 2GQQA 2J9DE 3PX4A 3H4BA 4NE9C 1Q82O 1Z25A 3NH2A 4ZVUB 1VQPS 2Q6CA 3OYHA 1N56A 1HWIA 1S5ZA 2UUBF 4K25A 3ZT1A 4H5RA 2HBYB 4B3MF 2P5GA 1NRKA 5B0FA 5DK5A 2HHXA 1RAHB 2XLKA 4Y34A 2E9RX 3E01B 3FDSA 3D3BJ 5JS2A 1XJWB 1SCJB 2VOOA 1GQEA 3KK3B 3VERA 2G8KA 1Y9OA 3GIIA 3H5XA 5I3QA 3MCPA 1WC3A 3MEEA 2G2ZA 2MY8A 1Y5NB 1IH7A 1X5OA 2D3ZA 2NYHA 3PFEA 4NXNK 3BKFA 1IG8A 4E19A 5JMVA 1H6KX 4NXNF 3HT0A 1Y3JA 1VQMN 2VG6B 3H3OB 2LVWA 4J90A 2VODA 2JVOA 4CZIA 4TU9A 3M8QA 4KHNA 1EARA 3QBWA 3I5CA 3UWTA 1M5VC 1WOSA 4OL8A 2NPFA 3M6GA 5KRTA 1V5VA 2VQFJ 2ZH2A 2MMYA 4F3QA 2VCPA 4F36A 1XQSC 4WTYA 2XWXA 3BR8A 5ELZA 4X2BA 4B02A 4YB5A 4DV1K 4DF8A 3LP2B 1YUWA 2KXFA 2K8GA 3W9JA 4M7YA 1TKTB 2K3KA 4X65F 2I2YA 4LRBA 2HBKA 4DR2J 2V2QA 3VF4A 1UP1A 5EWEA 4A46A 3MXHP 4YR3A 1K8KA 4WFAL 2KDOA 5A8RA 2ZITA 4R0JA 3VGKA 1QAIA 3CQ8A 3BF4A 4CHQA 4ISFA 3J80Y 4C8LA 3BDEA 2V51B 4BRQA 4WFAQ 1VBZA 1KAXA 3DU5A 1XC9A 3ENBA 3PIPL 1R43A 1FRMA 4GKJJ 4NCBA 5IQ6A 4BCAA 2IVNA 4ISEA 3NBPB 1IBKF 1EO1A 2FB0A 2FY8A 4RNNA 1LEOA 2MLZA 3UN3A 3MAQA 4JI8K 2O8BB 3WZ0A 4I7FB 4P9SA 5BYSA 3SZ2A 1RTJB 2VFTA 3ZSYA 1R8PA 2KH9A 2FTRA 3HHLA 3I0RB 2FC0A 1YBUA 1NJIT 3AARA 3ZT3A 5AQWA 5KFWA 2EWSA 2RE1A 2Z2YB 1UAXA 2HZAA 3JQJA 2V4RA 1ZM2A 1HNIB 1PC5A 4BGBA 1NGAA 4U7CA 2ZKTA 4GVLA 3OR1B 1VSHA 2O8DB 2F8TA 3HHLB 2X1GA 4MH8A 2CG4A 4P10A 1CQNA 4MIBA 1YX2A 5FJ4A 1JK9B 2YNFB 2YPZA 2ZH7A 3PEHA 1R0AA 4L6V3 3ZLJA 4IO8A 3D0PA 4WE1A 3PRBA 4EZ6A 4F7VA 2A1RA 1YJWN 2VQEF 5L1IA 5CYMB 4X4TA 4DUZJ 5JXSA 2K7JA 2ZH5A 1HBNB 3LP0A 2Q36A 4OYAA 3MX5A 3V81B 2VG5B 1K8KB 2XMUA 1K73T 5CCLA 3KK3A 3QERA 4Y6IA 3H59A 1VQ5N 4H0XB 5AR0A 4CH1A 1KONA 4DR4F 2WSCC 4CJWA 4J9VA 3Q7CA 4CF2A 3ZT4A 2WVFA 2WVDA 2JEJA 4A48A 1NDKA 4FLXA 1VSEA 1EJ7L 3CEDA 3BGFA 4DR2F 1W0HA 1BQNB 1RTDA 4OLPA 4X4QA 4DR7K 5E26A 4QYZJ 4A59A 1IM6A 1EP4B 3BS9A 3V4IB 4EHUA 2ZZNA 2E7WA 4V19J 1HNVB 4PKHA 2CJBA 1RTIB 1GLFO 4WU2A 3WXIA 1S0OA 4TQSA 3FCVA 1M5HA 1IM4A 4YOTA 1RT5B 2U1AA 3CT9A 1S5JA 2MQPA 2DH8A 3T5LA 1S6UA 4O3OA 4DX8H 1AZSA 4Y2KA 4BE2A 3OFGA 2G9OA 1VC0A 1VLOA 1KQFB 4J9KA 3OXFA 3UW1A 4FJLA 5E3AA 3PW2A 4F0MA 4FWLA 2FQQB 2D5RA 2R7VA 3OYMA 2XZWA 1N36F 1Q4RA 5HATA 1NH8A 2BQUA 1EWQA 5CXTA 2BE2A 1G4CA 5KT2A 5KQ8A 2HBLA 3BO4A 2XY5A 2UYTA 2QLBB 1V3ZA 1AUSL 2PN6A 3M1VA 3UDVA 3R5CA 4KREA 2W9BA 4X65J 2V8PA 4CGFA 1IQTA 4HDGA 2ATLA 1UJ6A 2ZFHA 3VQPA 3IS9A 2L3MA 5E0OA 4GKKJ 2ZWPA 3O3HA 5A2QU 3R6LB 4NLTA 1F5CA 1JLCB 3ZX0A 3C65A 3E2EA 4WP8A 3CMAN 2GEMA 1VSMA 2ZVIA 2ITGA 4HHHA 3ATVA 3QO9A 3ISNC 2GHVC 3SLCA 3OL7A 2W7AA 3P6YC 3UFCX 2M2BA 3M8PB 1RAJA 3BZKA 1P90A 2AZ1A 3SQ1A 2DGTA 2EXUA 4L73A 3VTIA 2BJ1A 3FFKB 3MM5B 4URQU 5LMNJ 2HFSA 4WCEL 1Z26A 1LW2B 5CD4H 1ZBFA 5CABA 2P8IA 5A8WB 3CDUA 1U2CA 2AZ3A 5DRKA 3NNCA 2EBGA 2W01A 2MJNA 2ZEJA 2FZGB 1VQ8N 4BRIA 2RU9A 5IV3A 3DI6A 4OZ5A 1KHWA 4E7KA 3W3SA 3LGNA 4H5TA 1LQ9A 2DK2A 3KDNA 5B7WA 4IJAA 4KHPF 1MMNA 4CEEA 2DITA 5JS1A 2R8HA 2DNRA 2XO6A 4X4RA 2O8FA 1JCFA 3VTHA 2N7YA 3OTOK 2AJ1A 1NZAA 4IG3B 3UVJB 3RW6A 1NNEA 5AQPA 4DI6A 3GG0A 2UP1A 3A5NC 2B3TB 1C1BB 2O3DA 2GHWA 3G2XA 4PQUA 1V5IB 1JLAB 4BDYA 2RHQB 4MQ3A 4OJGA 2ZE2A 1WI8A 4WYLA 3TTFA 2CPJA 3W2VA 2ZJQQ 2HK3A 4PL8A 2JRSA 3P39A 4K4XA 3L3VA 3KLGA 3E8OA 3R5DA 8RUCA 1MMDA 3GFYA 3I55S 3A1YG 2CH6A 5BN8A 2XCPA 5M1KA 3EPIA 3M8YA 2J0WA 3IR7B 4M5HA 2Z1JA 4JI8J 2BJEA 3DRYA 5CYQA 1RB0A 3PZPA 4PL7A 2UVWA 1T05A 4K59A 2QLJB 1HWLA 3HZGA 4BR7A 1U24A 1YSJA 2LEAA 2XMTA 4JKFA 1LK7A 3MM7B 2GVZA 5HQLA 3KUHA 4XH5A 2XO7A 1ZXOA 4AILC 1RWMB 4JN4A 2F8SA 5JUMA 4FPBA 3MR6A 3TW0A 4IQMA 5CQGA 1UJ4A 2C28A 5C42B 3DRSA 4CESA 2YNGB 1FJGJ 3JSMB 5D3GA 3A13A 2VYPA 1DAXA 3KFWX 4QIEA 2NRVA 4DV7J 4GNIA 1VR6A 2E88A 3BB5A 4ZN3A 3T6JA 1L3VA 4DV6K 4NXMJ 3CJKB 2V50A 2W4CA 3MWBA 5HL7Q 5F0XA 2J6UA 4QIFA 4YEAA 3I0SA 1Y97A 1VOMA 4H03B 3ETOA 1GH8A 1RDWX 2DNNA 3A3PB 2E8AA 2QRRA 2XMAA 2FBVA 2V2ZA 3CGIA 4ERDA 2QZ8A 2H5EA 3VA3A 1D1UA 4BRGA 3TAMA 5T41A 2VV5A 4O5FA 1P1LA 1SH0A 3V5RA 2ASOA 2EC2A 2XSJA 2ASJA 3PX6A 2C3UA 4IO1A 2KG0A 3FK4A 2NXEA 3QFUA 2UVVA 2VQEJ 1WN7A 2OZSA 1X0PA 4DU3A 5KFRA 1GLAG 3ZO7A 3EE8A 4X4VA 4BE1A 1Q79A 3NOGA 1RTJA 2FIUA 3U3GA 4DV7K 2PYJA 5KT5A 3PACA 3JAMY 2HG4A 3AO5A 3CJBA 3DOKB 4ID8A 3WT0A 1T3OA 1EIYB 4CZEA 2RS8A 3FBCA 3CB4A 1DARA 4OGCA 3FQLA 3H2VE 2IM3A 5ADXA 5J2QA 2B0GA 2IVFB 1C4CA 3UO0A 3O1WA 3QJLA 2QSFA 4NYZA 2FD2A 2ASDA 3JAMO 3T19A 3AV9A 4DQRA 1N36K 2I6WA 4JV1A 1QE1A 4OYWA 3H2UB 2VKZG 4WF9L 4AFFA 3CDAA 4W98A 2XI2A 4DR6J 3QESA 2ZH9A 3ZETB 4K4WA 2G1HA 1PJ5A 4PR6A 3TO8A 4GVEA 4CW7B 4HT7A 1Z2LA 4MIWA 2QL5B 2JSXA 3V81A 2DR5A 2W6LA 3KHYA 3SJJA 1DFDA 2UU9J 2OSQA 4R5PB 3VWSA 5B0EA 5HI7A 4LF9J 2GJ2A 5CYMA 3OYDA 5CYJA 1H73A 1SQEA 1UEVA 3KK2B 1JL2A 4X64K 1F21A 4DUZF 5D78A 1U1MA 3GJSB 3K7RA 1LFPA 4E1NA 1LWEB 1D0EA 4IH6A 2OCEA 1S4EA 4CH7A 3MXIA 2CRLA 4OX9J 1C2PA 4BRMA 2Z58B 2ALZA 5F2RA 1MW7A 3OR2B 5B0BA 5D0EA 1YQHA 1QSYA 4I67A 3SPZA 4P52A 4ECZA 4U7BA 3HM9A 4C9DA 2VQEK 4NRUA 3K5PA 3AHPA 3MCOA 2APOA 1WBBA 2W24A 1F3FA 4ED1A 1YJ9S 5AZIB 3PYFA 1Q9XA 3R8YA 1E3MA 4FYWB 4USWA 5IT9U 5DQHA 2OH2A 3LM9A 1C0FA 3U4LA 3GTYX 1CC7A 5GAEI 3W5YA 2B8PA 3M9NB 2JJ4D 1RLDA 1I3AA 4JB8B 3GYGA 7FD1A 4KHQA 3MFIA 3P5BP 1TKDA 2HFUA 5KG1A 1HBMB 4DPYA 2R4FA 3EKUA 1HNWK 3D68A 4CBUA 4KV8A 3D6TB 1VC6A 3PJXA 3MZIA 1FFWB 2R8GA 4DPTA 2OSRA 1ZS6A 2WCXA 4TLRA 4CEDA 2ZD1B 4CIOA 4ILRA 1N33K 3NRBA 3G6YA 1W26A 5CAAA 3WXLA 1PILA 3B78A 4PPDA 1DQAA 1SC1B 1BUPA 5AJ3K 3L0QA 3KKRA 2QWNA 1UKUA 3UI3A 3T5JA 4W90B 5B0GA 3V6KA 4DFPA 5F0WA 1HYVA 2VG6A 4R0EA 1NOYA 2LEBA 4C8OA 4JI3F 5IC6B 4CF8A 1C1AA 2DFFA 2E2NA 4YOXA 1X5PA 1HHTP 3DDNA 1WBDA 3QRQA 5BR8F 3RU0A 4J5OA 2HLTA 2DGXA 3AB4B 4YN3B 3NGSA 3VGTA 3W9HA 3AVAA 1NMNA 4YR2A 1C6VA 1FJCA 3RB6A 2HVZA 2Q0RA 2OPSA 3C0BA 3T6BA 1N88A 3CCJN 4CLLA 2W2OP 5E2QA 1A5XA 3E01A 3UN5A 4HVJA 4UQTA 3R3LA 2QN6B 2KXNB 1B0PA 4CLTA 4FM0A 1NGBA 4KHUA 4KAZA 2KHOA 4AYBD 1RBOB 2E2PA 4UW2A 3O6QA 1JLGA 4BBYA 2QX0A 4LH5A 1FDNA 4IOXA 3PYGA 3TUIC 1RK8A 1U0HB 1FFSB 2VWBA 3HKWA 2VDHA 5K20B 1FI4A 3GE9A 2VG7B 4ELUA 4DR1J 4OYPA 4BR9A 3JYTA 1N36J 5C2FA 3CCSN 4FXVA 2CGKA 2Q97A 3CULA 1EZZB 4K4TA 4O3PA 1DLOB 3L6QA 1CJTA 3AQOA 4X62K 4E89A 1UFKA 2AJFE 1RHRB 1JNRB 2IY5B 1AB8A 5GIOA 4IZ9A 4JKBA 1VBKA 1VQ5S 1UZHA 1KVCA 2AHOB 1VSKA 3UIQA 4HT5A 3W8GA 2JH3A 2B4OA 4K4VA 2J9EA 3G86A 2C2RA 1HPZB 3CDWA 1RT7A 1ZPVA 2IJFA 3DOLB 4JI6J 1HLWA 3AJ1A 2MTLA 5LXRA 4LFAJ 4K8RA 5AQXA 3HCXA 3QNWB 1GEHA 2D0PA 2IC3A 3MD1A 3O1LA 1XI1A 3M8PA 3V1OA 2ZDOA 1IKXA 1GOBA 2I8EA 3UPFA 2YI1A 3DNCA 3UD5A 3KMQA 4X4OA 2J8SA 4DL4A 5ADXH 1IQZA 2MQNA 4CK3A 3KTQA 2XS5A 3U27A 3BGOP 3PNIA 1KOOA 5KGWA 4F50A 1S1UB 4ZS6A 3QFHA 1M5KC 2C22A 5I3PA 4ZOSA 4LC9B 3M5RA 1VQMS 4CEZA 3U6FA 4NLXA 5B8HA 3EGWB 4LBHA 2E5JA 2VIHA 1EXQA 3EE9A 1NSQA 3I82A 2P9IA 5M2UA 3MD3A 3TA1A 4DTSA 2HMIA 1MG7A 2CJQA 3TYTA 1FNXH 4M5JA 3AO3A 1WSVA 2CYYA 5J2PA 3PLAA 3OYEA 4RW8A 1QVFM 1PYTA 1QLNA 3VF0B 2G4BA 3VALA 3I56N 3QMQA 3KNAA 1Q7YO 1KR4A 3BREA 2R8JA 2EX3A 3AD9C 3AJDA 3MR5A 3PIOQ 2P9CA 4JYAF 2GW8A 4YNQA 1QD1A 4RW7B 1Q7LB 2UUBK 4FJ7A 2EI5A 2BKPA 2OPRA 4CLZA 4OX6A 3SBMA 3SSSA 2ZBQA 4M45A 1HNZJ 2ASLA 2V6AA 3GMGA 3TPQA 4PYDA 2O66A 4JAXA 3AD8C 1U1QA 1GAOA 1PBAA 2BBEA 3W5ZA 3CO9A 2CPEA 3VEYA 3CF5L 4QR1A 2RDIA 3MWTA 3EJMA 4YOWA 4CD3A 4J7CA 2F4VK 1NMEB 2IA6A 5H1SQ 2OPQB 2IM0A 1LWFA 2CQCA 2Q66A 1WJ9A 2DIVA 2R7XA 1QZ6A 3SDEB 1M90O 2XLIA 2QWOA 4C8ZA 2OMLA 5BPMA 2GUPA 4BRFA 2ZJRL 2LA4A 5KI6A 4IOAL 3Q23A 2CWXA 1CULB 2HIQA 4Y1DA 4IDKA 3TJ9A 5HRRA 2WFBA 2RKIB 2E1AA 3NWRA 2V67A 4B08A 2ATCB 3U1LA 2LU2A 2LQ8A 3KVGA 1IBLJ 1FKPA 2A42A 2HKEA 1FRLA 3AVNA 3DKDA 3L7PA 4N8NA 4LJMA 2C2MB 3U9DA 2FF3B 3DWLA 2BH1A 3SUOA 4X62F 4GKJF 3K5NA 3THYA 3MTJA 2WBNA 1KP6A 1IWGA 1JLEB 4DR4K 3K0SA 3IWXA 4ANCA 4DLGA 4WK3A 5DDOC 4DV5K 2OIHA 3RB0A 2NXUA 1FDAA 4E7JA 4ZLLA 1RAFB 4PG5A 3QLHA 1D3WA 3IKMA 4CNYA 4QWCA 2DPJA 3FEYB 3A2FA 2CAJA 1KBRA 2GZOA 1BA1A 4M3UA 4NPOA 1NKBA 1GFWB 1H2TZ 3NXZA 4YDDB 4A8OA 2PI5A 1S6PA 1CSJA 1Y00A 5EY4A 3KG1A 4KO0B 5F3ZA 1LWEA 1HA1A 3HHLC 3I0SB 1LXNA 3DLBA 2LLZA 2YH0A 3I87A 3ULHA 2JDJA 3C15A 3EUNA 3JS9A 4V1Ak 2O8EA 3ZSXA 3ATUA 3NGKA 3HJVA 1YJUA 5KG3A 4LR8A 3IAYA 1RTHB 2BRKA 3IA0A 1FKPB 2LQJA 5HANA 2WW8A 5CZVA 2VPYB 3KHGA 3WC2A 1NKEA 4X4SA 4URSA 4JV5F 2HWHA 1D8ZA 3UB5A 4ID5A 1ROFA 3M9OB 2GWJA 2YX1A 2H1YA 2NZCA 4YY3J 2M5YA 4B8CA 3J8AA 3T1YF 2AJ4A 1ATSA 1CXQA 3CCRN 2PIIA 4B3TJ 2ZBIA 1YKWA 5KFBA 3SCIE 3IBWA 3A5LC 1R8AA 1RBVA 4FWOA 4F8RA 3GPAA 3K5OA 3HXMA 3DOKA 4FK4A 4CJ7A 4JHDA 3DLKA 2MSSA 2P9GA 3DLGB 5L39A 1ZZNA 1R0BG 1FVQA 3HJFA 1GXUA 4QW8A 4RO0A 1WOPA 1VLYA 4WP9A 3MPVA 1VQ7N 3O1BA 1WC1A 2CQIA 2RU3A 3CF5Q 3RMCA 4P2XA 4KBOA 4B9MA 3OUYB 4I9LA 5GADU 4IEEA 3N79A 3UNGC 2BZ2A 4LFCF 1HQEA 3PHTA 3VEZA 4FJMA 2UV8G 2BRLA 3P31A 3CJTA 2HSEB 4CT9A 1VHFA 4DV0F 4MT1A 4Q44A 3IUCA 1NK5A 4Q7AA 3RR7A 4BR0A 3M6VA 2F4FA 2HBQB 3H40A 1EB0A 2WHOA 2P9KB 1UFLA 1S7HA 4CJUA 2P9LB 3SUNA 1QQMA 2E6MA 4B8AB 3CMEN 1FRJA 3H2LA 1UZDA 3CCZA 3M32B 5GMKa 1LWCA 2WUSA 2RB7A 1S79A 3MOZA 4JI7J 5FPNA 2GGPB 2CNOB 2DD8S 1GMWA 4EBDA 1ZA2B 1QQCA 1VQNN 1LOUA 3WIVA 2QLFB 3QATA 2HFZA 2YNIB 4N77A 4ZPDA 2WVBA 1JLBA 2I5JB 2JNJA 2Q79A 4K7QA 1CJKA 3LDQA 1BOTO 1NU4A 3PIPQ 3D7SB 4HUEA 3ZT2A 3OS0A 4Q0BB 1N5YB 4DB3A 4FZYA 4QPTA 2VZ9A 3UKRB 4OLBA 2J9DA 1HPZA 2KKZA 3ULEA 3OJSA 3SUPA 4M5MA 4C0HA 2R2RA 3OTEA 1HNXJ 5K9FA 4LF4J 2B43A 1ZYQA 3UE5A 3HOTA 4E2FB 2QWPA 2MQLA 1ZBHA 2B9EA 5DG8A 3S1TA 2BE9B 1RBUA 1EETA 3LDNA 3GV5B 2CGLA 1BIUA 5KFGA 5F41A 3B6OA 3O44A 3KG4A 5KT3A 4FPIA 4WFXA 1VDHA 1T6CA 2IMWP 4JI4J 3SBTA 2QC3A 3TJAA 1HI0P 4HDHA 3AVCA 3CPWR 3CYMA 3TA2A 4ED6A 4KTZA 4Y65A 3MWPA 4WIIA 4XH1A 1OY6A 5IC4B 2JC1A 4WFNL 5G4DA 1KQSR 4JI3J 4WKRA 1MMLA 1SJFA 2HBZB 4JV0A 3ZYYX 3SEOA 1HBUB 2Z2MA 1RT5A 2FVQA 4NCAA 1VI7A 2NRHA 1RYSA 2B9YA 4W5QA 3EY1A 4I9QA 1S1WA 1YITN 4GVMA 4FF1A 5HBMB 4C11B 4MKBA 1G15A 5AFUH 4U7UD 3OY9A 5F8HA 4RTFD 1CJVB 4ICLA 3QT5A 1NK6A 2CVIA 2OEJA 4MK9A 3A8YA 5IOLA 5K8NA 1T9VA 3VAJA 3BBBA 1FFGB 3FJ2A 4GO7X 1QVFR 4QOZB 5E3RA 3NCPA 3DRPB 4CLKA 3MK6A 1GNKA 1WTBA 2QFJA 3M30A 3FVYA 5KFIA 1RWVB 3SCJE 2K1RA 1RJJA 2WBRA 4C6AA 1N8RT 1YIJN 4DTNA 4WXWA 1W2BM 4CTAB 1JIHA 4ZVTB 4R25A 3F9KA 4LIRA 1OMSA 2VFRA 2E2QA 2GHPA 2YV0X 5D4OA 4EYHB 3NMAA 4A8YA 3CERA 3LP0B 4ILLA 4JV5J 2ZGZA 4DV6F 4IKFA 1YIJS 3BR9A 1YT3A 3CCQS 4OGEA 3G71S 1C1CB 3DJCA 5BRFA 5L46A 3ZSOA 5DDRC 2HOEA 1ZBSA 3VQ5A 1G99A 3AAWB 2E1YA 4IOCQ 2WBMA 3BO2A 1GXLA 4X66F 2AF6A 5HLFB 1MU2B 4NLSA 1H2UX 4XK8C 2KZZA 2C2ZB 3V6HA 1VQ4S 3PUFA 2VONA 2AU0A 4ZPWR 4IKAA 4CYUB 1KVAA 3B8AX 1RU2A 3LPEA 4JI4K 2YPYA 4NB4A 4QAGA 2BTFA 1IKVB 1JLFB 1HFEL 3RAMA 5GADP 1TQLA 2KT5A 1GLJO 3GFHA 3GR1A 2DY4A 5DLGA 4I7FA 2HNZB 1I1GA 2PD1A 3CJ3A 5I3UA 1S48A 1T3NA 3MXMA 1T3VA 2CIMA 5F8JA 3M8WA 3M2VA 3TQEA 4B17A 4DN9A 3AVIA 2QMWA 3KLIA 3POTA 3C7NA 2ZOMA 2EFPA 4FLWA 4CI6A 3D6FB 4GV3A 2IRXA 1JJ4A 2CPIA 3DM2A 4DQIA 1EP4A 3X1LB 5DM6L 1VHXA 4C2MA 3H1QA 3ZCMA 1MN9A 3MFHA 2A41A 3DMJA 2DKOB 1SL1A 4KFBA 1IWAA 3BSAA 3SMSA 2DHXA 4C8NA 3RSEA 3N0VA 4PYAA 4PRFA 3OHAA 2W4PA 2YKMB 4CD1A 5BR8K 5AQNA 3SCXA 4N5SA 4KHPK 3CI5A 4EFAC 3UD3P 2FGCA 3B6BA 2CZ4A 2C3PA 3T9NA 3MEGA 1NH7A 2M3DA 3OTOF 4ETXA 1RBAA 4M95A 1UVIA 3DU6A 3PCOB 3MUVP 3BBFA 3G0ZA 4JS5A 1PAUB 3FQKA 4FW2A 1M1KT 1RKJA 3OLAA 4ZHRB 1L3SA 3KK1A 2BKOA 2RDDA 3JAMU 1ZAVA 5KFUA 2HF3A 3TTCA 2G8VA 3D2FA 3THPA 3PKMA 1IXKA 2FHKA 2V2KA 5KFTA 3V1QA 2GMLA 3IG1B 4ITSA 3OTOJ 1S3XA 3FGUA 4HVZA 4TYBA 5LT5A 4TVAB 1TMJA 4P71A 4XIUA 3IM9A 4ANEA 2GV9A 4KB7A 4LVNP 5GIPA 2IOCA 4KHRA 2HVEA 3CQXA 3D6MB 5KQDA 2KZMA 4RBUA 3QT8A 4M3RA 1VK8A 3M6XA 5AZJB 2ASPA 4FF4A 1S1VA 2YWWA 2O4IA 1JKHB 3GIMA 4LQ3A 4DMZA 3BM7A 4YDUC 2E5LF 4CHOA 1PSDA 1TKXA 2W1BA 3AGRA 5C15A 1BHNA 3NNAA 1RBLA 1FNOA 1VQKS 3Q24A 4QW9A 1NLVA 4C23A 1H74A 1HYSB 4QJVA 1LAVA 5DZ6A 1IBCB 4CGDA 1W9HA 5C25A 1OH6A 1HW8A 3C16B 4DCPB 2G0JA 1RT3A 1K1QA 2UXCF 4NLCA 2O8CA 4JKDA 2ZHBA 1HQUB 3O08A 2RUSA 3VEVA 1WSEA 3H5YA 1FA0A 1VRTA 1VK3A 5HLFA 4CLFA 2CA9A 2WSFC 4NLVA 3GILA 4DU1A 1TL3B 2EFNA 3G25A 3GJQB 4I1TA 2ZVSA 3DN9A 1YXQA 4FWQA 3A12A 4I69A 1IUJA 1RAOA 1TTHB 5KG7A 2MKCA 5JLFA 4ZPCA 1UTAA 4E7IA 2EW9A 4KPCA 3IAM9 2NZ4A 4CIGA 3NFAA 3LAKA 4LFCK 1RT1A 3ILLA 4FJIA 2ZH6A 3O9SA 1TKZB 3BJYA 1BE4A 1ZBTA 4GVBB 2M52A 2OGUA 4FSVA 2R2SA 2IDEA 4CGJA 1XMBA 2HWIA 3PEJA 2XM3A 2H4YB 4E1MA 3ZEUA 2CNKB 4LT6A 1O51A 3GBTA 2BR0A 3V9XA 1DGKN 4M41A 1IBLF 2CDRB 1WD6A 5E41A 3IR6B 1SC6A 1RLCL 3EGNA 4GC7A 4LIWA 1FD2A 3QIPA 4FKYA 3SAFA 2UUWA 1X9WA 3O8WA 3CCWA 4FO0A 2D3UA 2GIQA 3NY0A 2F8EX 3MN7A 2Y1RI 2I7NA 4ILGB 1QTNB 2ZM6J 4BRKA 3BEGB 4IO9Q 5KFAA 4AHCA 1S6QA 4WFYA 3QMLA 5KFLA 3WX8A 3W9IA 2ILYA 2XHBA 4F4ZA 2RDJA 3K2YA 5DQGA 5M2PA 2E7VA 2C3OA 3ZTSA 5IQQA 2ZKUA 5AE3A 4DTJA 5C2CA 4Y28C 1R7IA 1S49A 1VC5A 4IFYB 3HLUA 4P73A 2VFVA 4PG7A 1U6ZA 1UA0A 4LVOP 2QMXA 5B08A 2HQ3A 1VJWA 2IDOA 2QW9A 2DHHA 2HK2A 4KHPJ 1KFSA 2CPHA 3AY9A 4BG9A 2OLWA 3OVNA 5DM6Q 4K2JA 2CFXA 3HOSA 2ATQA 3EDQB 4WPAA 4C3KA 1HNZK 3NL0A 2ZM6F 1OVQA 3VEXA 2LMIA 3NHGA 3RBDA 3SSQA 4OYIA 4ZVPB 4CT8A 3CIPA 2JGUA 2LCWA 1O6XA 3CMQA 2BV3A 1GLLO 2V7ZA 1OQ6A 2HFNA 1Z2ZA 2KFNA 4Y3CA 3CD6N 3R8EA 2GJIA 4F3OA 1N5TA 3AVKA 2VBZA 1I94F 4FLZA 1CZBA 3O3LA 4OZLA 5HRNA 2M8DB 4EEYA 3EWGA 4B9QA 1K9MT 5J1PA 5KFEA 3SQGA 3SK3A 3KLHB 2V9WA 3PR5B 2HNDA 4DV5J 2NRTA 2JLEA 3MDFA 4AHUA 4F4WA 3SMPA 2E7XA 3PRDA 2RILA 1U2VB 3Q86A 3CJ8A 3CCVS 3R2CJ 1WAJA 4UY8T 2B5JB 3NF7A 4IR9A 4B3SF 3DYAA 3C66A 5D0HA 1X9SA 2UXDJ 2F8HA 4TSXA 4V19S 4WYBA 5IZHA 1HQUA 3BSCA 3EVOA 3PXGa 4H4OB 2HSTA 4X66K 1HUXA 1VRUB 2GJFA 1HYZA 3FEZA 2E9ZA 4RNHA 3MN5A 3C16A 1WC5A 4XDDA 4M3XA 4G1QA 4F26A 1VQLS 4J2AA 3MECB 4P74A 2Z30B 2UXBJ 2J8AA 1U09A 3HD2A 4Q8EA 5B0DA 2EG2A 2ZOFA 2XYGB 1KN6A 2E66A 3RRHA 1O8BA 3OVAA 3G8SA 4X84A 1X4HA 2BACA 3NAIA 5CA5A 1P27B 2M0GB 2A40A 4BROA 3WXMB 3MMCB 4I4BA 4ZPAA 1QM9A 4HHUA 2K06A 1OSCA 5DM7L 3WC0A 4EO6A 4CZGA 2O4GA 4FPAA 4BVOA 1F2GA 3MDQA 1S0NA 4EP5A 2GWKA 4JKGB 3H8YA 2Z2LA 3I8DA 3MMVA 1E6VB 2GVDA 1JJ2R 3HHKA 4KR0B 3HP9A 4H5VA 3QT7A 4HHTA 2XI3A 4J9NA 2NRWA 4LFCJ 3TWZA 1VIXA 1FE0A 4L75A 2HHTA 3ZX2A 3BKUA 2U2FA 3H42A 5JICA 3GU0A 2Y1IA 1QVGM 4AUKA 4BLGA 2AYMA 3MOJB 2HEKA 3NCQA 3C19A 2D0BA 3JSYA 2AJ2A 1FD8A 5J2MB 3KLFA 1QUPA 4IQXA 4NO7A 1RXOB 2D41A 3OL9A 4MLEA 2FPHX 2MKJA 4ED7A 2JOQA 4CO5A 3QGHA 3CQYA 3HBTA 4FJ8A 4RW9A 1L3UA 3O9UA 4FVUA 4DTXA 3NG8A 1T6DA 3O80A 4QOTA 4GO5X 4WQ4A 1URRA 1NSAA 5ETRA 4CO4A 3PW4A 1H72C 1H3DA 2BOPA 2XHCA 2GFFA 3EXYA 2VICA 4NXMF 4F02A 2R7YA 4KFBB 1XN9A 2A2DA 2MZJA 3TAPA 5LXYA 1CZAN 2J0SD 3D1QA 5AQVA 2P9SB 4WK1A 2Y1LB 3SQ4A 2ZBPA 2DXDA 4MMOA 5K8MA 5LJVA 2YKAA 1NK9A 3DGVA 3WNFA 3CPWM 3A5OC 3HSDA 2E29A 1YF5L 3R27A 3W61A 2BKNA 3TOQA 3V6DB 3GJRB 3SV4A 4HH0A 2V9KA 2XMWA 1K8AO 2HQGA 3C94A 2QTWA 2MKHA 2UUAK 3D5MA 4NEYA 4FF3A 4DU4A 3LWMA 3P83D 2HNYB 3HHEA 4ILHA 5KGXA 1N32K 2Z4PA 3ZZOA 2V2VA 4N56A 4QZVB 4BWMA 2HQIA 2YHBA 2EFVA 2BXJA 1S1TB 3GDQA 2KXHA 1HD0A 3AFGA 1NDCA 4DPUA 1WSGA 1R6YA 2MKIA 2XS2A 3BP8A 2WONA 4BVPA 3LDOA 4FXDA 1Y5LB 3DRRB 1DQ8A 3EPGA 1XERA 3A3NB 2RQCA 3I6PA 3PY8A 4E1JA 1JXVA 2B56A 3C14A 3BZCA 1YBAA 2ZH4A 1G7CB 2Q3SA 3CJ0A 3D2WA 4EAHD 4OHVA 3BQ0A 4FWNA 3VZHA 4NZ6A 2CGJA 4B3OB 2RF2B 2DGQA 2C42A 1XNQK 4RW9B 1LW0B 3MMJA 1WF2A 3LA0A 4H0YB 4EGLA 1VK0A 2NREA 1NPKA 3PSFA 1JJ2M 4DV2J 4JI5K 2FSJA 2HVDA 1Y4ZB 1OH8A 3NGDA 3MMBB 4LSNB 4H0TB 3JTPA 3W60A 4TY8A 2BGGA 3MGJA 1UVJA 4KB0A 2HRUA 3DYAB 3EEQA 3HF5A 5KFYA 4Q5VA 1F9HA 5A8KA 2DHAA 2PY5A 4QWAA 4RW6B 2VOPA 1UEUA 4M3TA 3FKBA 3E51A 4DFMA 2HURA 2YY3A 3LH2S 1XWLA 4DL2A 3SCKE 3NGIA 2B4JA 2L08A 2C1EB 3Q8RB 4BQZA 4NLUA 3ITHB 4LFBF 4CHZA 4J9QA 4OI1A 1W97L 1X4DA 4OI3A 4H5NA 5LL6Z 3MM6A 1IO2A 2LDIA 4XH4A 2R9LA 4QWBA 1WG4A 2CQ3A 3L2VA 2OZMA 2XZTB 2UUAJ 4XAKA 5HVHA 3IGNA 3LUYA 5HP1A 2PFDA 2IRYA 4AM6A 4MTPA 5AQKA 5F8MA 2OELA 1HWUA 1R0CB 4LREA 2QI2A 4CBWA 1S9FA 4CLUA 1XEZA 3H6EA 3J7Z5 1QHAA 1WHVA 1EETB 3G4SS 1IVZA 1RHUB 4C0BA 1UOCA 4LUBA 4DHYA 4ELVA 3CC2S 1K0VA 4USMA 4JI4F 1N5SA 1OS5A 4UT4A 3VQCA 3BF3A 4JD2A 3N5FA 2HWTA 2W42A 1X9MA 2DR8A 2P9PA 3IRXA 2P9NB 4JD2B 1U45A 4P6QA 3QDKA 4DXLA 2BABA 4TXSA 2Z57B 3MPYA 4OI0A 2FJWA 3KUGA 4M5DB 4DV4F 3H46O 3T1HJ 2QYGA 4N47A 1KAYA 4CTAA 4O23A 4E3SA 3IP0A 3L9ZA 1MN7A 1QJHA 2OO4A 1VQ9S 3O8MA 3MN9A 2UUAF 2V8DA 2WK4A 4F4YA 2OTJS 5KOXA 3OYIA 2AJQA 2OD4A 2YHXA 4C7QA 5DS7A 1S97A 3K5LA 4S0MA 2UUCJ 1F9FA 1Q81O 2QFIA 1D9DA 2Z8QA 3OVBA 4UF4A 3MX2A 2OFHX 2YX6A 3EKSA 4OX8A 1M5OC 4NXMK 3H4DA 2RPIA 2AEJA 3S8SA 3NVKA 5KFFA 1U26A 1I39A 4DCJB 4JV5K 1FJGK 2D1CA 3AA3A 1D09B 2HRTA 4QS9A 4CJ5A 3TRGA 2VPXB 1Z4UA 1K73O 4RW6A 4CLSA 4D3HA 1X9JA 2FJBB 4IDHA 3NP5A 2QT7A 3OFFA 3TSPA 2HBJA 3Q2SC 3TZYA 1SUQB 3G4SN 3HHNB 2WOMA 5DLFA 1UVNA 2GNKA 1XMQF 4BRDA 4JI8F 4ES1A 3OYKA 4MYTA 6FDRA 1WF1A 2P6TA 4JI2J 3GL1A 2B6AB 5BJRA 3MMBA 4LFBK 2VA2A 2XNQA 3IWNC 5F9LA 1HX1A 3HFVA 3D9BA 1UWBB 2CJ9A 5IS2A 5ETVA 2PE8A 3ZC4A 4J9UE 1J5EK 3IRXB 1YGYA 4NLQA 2C2OB 2B9XA 5HSPA 3OYJA 2VD3A 2CNLB 3F73A 2OTJN 4K2XA 5LSRA 3BGRA 1W25A 2YHAA 3HVAA 4TNOA 2VA3A 2QYCA 5D0GA 3EL2A 4WTOB 1AW0A 3VV2B 1YJTA 3DRRA 3E66A 1JNZB 5HP1B 3T1YK 1RAAB 1M1KO 2ROPA 1HHQA 4K5SA 3F41A 4KJIA 4JI6K 2D7SA 1NKCA 1KAZA 4JV2A 3CCES 1JWWA 2ZBCA 1RT1B 1T44A 3QEPA 4FZVA 4WJBA 3RMAA 1N5VA 1HBOB 1RT2B 2GQCA 3D1OA 1X4EA 3TARA 3PRVA 2P6SA 4B3RJ 4MIAA 4DTUA 3FMBA 3W3DA 4HH1A 3K89A 4ISGA