1S1TA

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with uc-781
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
541
structure length
533
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase
total genus 150
structure length 533
sequence length 541
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1tA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1tA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1tA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1tA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s1tA05
2RKIB 2FBVA 1EX4A 1IO2A 3JYTB 3PV8A 1KRPA 4YFUA 1F21A 3KHGA 2BRKA 2GBZA 4CK1A 1KVBA 3I5AA 1JLAB 4PA1A 5C24B 5KT5A 5DQGA 2FVPA 2W9BA 4W5QA 4HKQA 4QW8A 4EZ6A 4EBDA 4J2BA 4FK2A 2I5JA 4K50A 1L3UA 3SI8A 2IOCA 3DDKA 2FBYA 1C0UA 3GV8B 1D8YA 3RMAA 1MU2A 3MECA 4JLHA 4CHYA 4Y3CA 3NAEA 1TL1B 3T5JA 1EXQA 5L1JA 4K4YA 4AHVA 2UVRA 3CWJA 3S3OA 5KT7A 3TAMB 3MR5A 3NE6A 2XRIA 1D5AA 4TY8B 3KLHB 4KAZA 3PW5A 4IG0B 4XIUA 2YHAA 3ITHB 3NMAA 4M94A 1TGOA 1T05A 1XHXA 4H54A 2HHTA 2P5OA 2IM1A 3QLHA 1B9FA 4JUZA 3HM9A 1C0TB 4DTRA 3M8RA 4CHOA 2BE2A 3U3YA 2R7YA 3PZPA 2OPQA 4PWDB 4UQGA 3SZ2A 1KLNA 4F2SA 1T8EA 3SJJA 4LH4A 3N6MA 4N47A 1ITGA 5CYMB 4M42A 3H4BA 2BQ3A 1IKWA 1A5XA 3QESA 1EETB 1NJYA 4W5NA 2O4IA 1NK0A 4DG1A 1ZYQA 2R2SA 3AVJA 5KFZA 3V4IA 3KNAA 1KTQA 4OJRA 1ASUA 5KFIA 4W5OA 1VSDA 1S9FA 5C42B 5DGAA 4IR9A 3K5MA 3DRSA 2ZKUA 1RT3B 3SUOA 2Z1HA 4FM2A 1RDBA 1TKTA 3SFGA 1I3AA 5F8JA 1S1WA 4B3OA 5KG3A 4Q44A 3AVNA 1CLQA 4FJMA 3KOAA 1RT6B 5J2MB 2BQUA 2AQ4A 5F9LA 4DTPA 5EWFA 2OPSA 4EBEA 5KFRA 4KREA 5KFVA 4IDKA 2IMWP 5I3UB 4M3RA 2C28A 4DL4A 4LY7A 3KLVA 4DTNA 2HNZA 4PY5A 2KTQA 1K1SA 5KFUA 3CDWA 2B6AB 5KFSA 1RDAA 4E7HA 1HPZA 2C2RA 1S48A 2V9WA 4O3QA 1TVRB 1FKOB 1RTIA 3HXMA 2G8VA 4CCHA 1T94A 1RT1B 4IH5A 4BDZA 1T03A 2ILZA 4MIAA 1HRHA 1WSEA 4CIGA 1JKHB 1S97A 3VQDA 3HVTA 3UR0A 4DL5A 1FXXA 4FJ9A 1VRTB 4WYWA 1QAJA 4O0IA 2HNDA 2D0AA 1BQNB 4LQ3A 1WSJA 3IS9B 3G6VA 5KFBA 3QGGA 4FZZA 3VA3A 5DG9A 3DYAB 4FJKA 1Q8IA 4EO6A 3KK2B 2OPPA 4ZVFA 3AVCA 1SUQB 3DRRA 1QS4A 5DQIA 3PW0A 1FKPB 4Q5VA 2IM3A 3NF9A 4C8KA 1LV5A 2ZD1A 1HQUB 3DOKB 4M3TA 3AVBA 2FBTA 3D28A 3TABA 3U6FA 1C6VA 1IKYA 2ZE2A 3G6XA 2D3ZA 3VA0A 4DSFA 2FLNA 3SUNA 2LSNA 1GOCA 2XGPA 4HCCA 2IAJA 4QWEA 4F3OA 4NCGB 2FJXA 4Q0BB 3DI6A 1JLEA 1S10A 3O3GA 3PR5B 5KG5A 2VG5A 5HBMA 4DQQA 2Z1IA 5HP1B 4XO0A 3BGRA 3KK1B 4PUOB 3ASMA 2AX0A 5HLFB 1HNIA 4FK4A 4NLSA 1HYSA 3K5NA 2GC8A 4E7LA 3DMJB 1TL3B 2HB5A 3ZT4A 3SUPA 4I2QA 2KZZA 5FDLB 2J6TA 3NH2A 2GV9A 1L3SA 1LWCA 1YVFA 3S3MA 3HP9A 3L2WA 4HUFA 2B43A 4IKAA 1S5JA 4PQUB 4I2PA 4B8CA 2HWIA 3T5KA 2BDPA 4KO0B 4MFBB 3KJVB 4IQXA 1GOBA 3OYAA 3CJ5A 4ZPCA 3G0ZA 3OYIA 2E6MA 4J2EA 3EZUA 1S1TB 1JLCA 4LSNA 3PJXA 1ZBHA 2OPRA 2B5JA 3AVFA 2UVVA 3DYAA 3NAIA 4KE5A 4EYIB 5DG7A 1QE1B 2HHSA 3PHEA 1W9HA 1BQMB 5KT3A 1C1CA 1TK5A 1S1XB 4LSLA 3D45A 1QSSA 1RBRA 3QEVA 1RBSA 2HHXA 4TY9A 1IG9A 1KFSA 1S9GA 4CEZA 3IGNA 4DS4A 2YNFB 3OYBA 2D0CA 3OYKA 2IM2A 3CVKA 3L3UA 3OL8A 4B9UA 2W8LA 4Z4GA 3HJFA 4FJ7A 4CEOA 4RW7B 3SPYA 3K57A 4O5BA 3AVGA 3HO1A 4DQPA 2XHBA 4I7FA 2GUIA 3DLEA 5JXSA 3HPGA 2IGIA 2JEFA 3PO4A 1CXUA 3JSMA 4FYDA 1S1VA 3VQBA 4E3SA 2XWYA 2W7OA 3CFOA 5F8MA 3RWUA 4E7IA 2FLLA 3NGIA 4CJ3A 2XC9A 4URSA 1RTJA 1JIHA 3DM2A 1OS5A 1LWEB 2RF2B 3O4QA 4FJIA 4FVMA 2O5DA 4C8NA 2EX3A 2A1SA 2XCPA 4JRQA 3MEEB 1J53A 3BSCA 4DF8A 4QAGA 4IKFA 4FZYA 3OL7A 1QHTA 4AH9A 4CJ4A 3KD1E 3IN5A 1RTDA 3LZJA 3SQ2A 1XR5A 4RW6A 2FLPA 1R0AB 4CJQA 3V6HA 4CGJA 3CG7A 3DOLB 3V81B 4JV2A 4FJ8A 1LWEA 3AA3A 1U04A 2JEGA 2XI3A 4AHSA 2W8KA 1HYSB 4CJRA 1JLQA 1A5WA 4CEQA 1KVAA 4CJKA 4OVLA 2WHOA 2AWZA 2HNYB 3BGRB 5HP1A 5HBMB 3GILA 2WRMA 3QNNA 4DWIA 3TAQA 4G1QA 4EYHB 3TQ1A 4FJGA 5KRSA 1JLEB 4Q0BA 3KLIA 1N4LA 3MXMA 1SL2A 3LP1B 1C1BA 4Z4HA 4GMJB 4CEDA 1NHVA 4BE1A 3TAFA 1LW2A 4NLPA 3NHGA 4FLVA 4ICLA 4KTQA 4NLGA 3ZSYA 1D1UA 4Y34A 3OVNA 4J9NA 2HMIB 1S6PB 4KB1A 3V6DB 4F4YA 2C2EA 3RB3A 5J2PB 3B6OA 3OYLA 5CY4A 3BDPA 3UPFA 1QE1A 1T05B 4RNFA 2E6LA 4BACA 4ZVEA 4Y1CA 1NK9A 1LAWA 5CYQB 4NLUA 4FW2A 3H5SA 5DLGA 4ED3A 4MK7A 4QWCA 4H8KA 4EBCA 1S1UA 2EC0A 3DLKB 5J2NB 4ECSA 4KHRA 2WTFA 1RBVA 3DLBA 3RBEA 4KHMA 1RT7B 5DMRA 3IG1B 4ID1A 1SKRA 5J2QA 1S1UB 1U09A 1W25A 4DTUA 1BHLA 3ZT1A 4ECTA 2YKMB 4KTWA 3C6TB 3G6YA 3OJSA 4KO0A 2XCAA 2YNGA 2RDIA 3T19A 5C25A 3TVKA 1C0UB 4KTZA 5F9NA 4QCLA 1S6PA 1ASVA 1QQCA 4J9KA 3KMQA 5CZ2A 4ECXA 3UQSA 2WCXA 3OYDA 1XI1A 1REVA 1KHVA 5F8IA 1NJXA 4H4OA 4FS1A 1XR7A 3RR8A 4M95A 5C25B 3CDUA 2YNGB 4F4KA 5K14B 4O4GB 4MH8A 4DTSA 3GV5B 4CJWA 4TSXA 3EZ5A 2FJWA 3RR7A 2E9ZA 5KG6A 4ED0A 2HNZB 1JLCB 4AHRA 3C6TA 3L3VA 3F73A 3QIDA 3OS2A 4QWBA 5JS1A 1HMVA 1RT4B 5J2QB 4OGCA 2CJQA 4C8MA 1RT7A 3WNEA 4G3IA 3PX6A 3OHAA 2OYQA 1IKVA 1N5YA 3PX4A 4OL8A 4DLEA 4FLTA 2HWHA 3QEXA 4KV8A 1LWCB 1IKYB 1BISA 4WFXA 3ZT3A 3I0SA 3UDLA 1BIUA 4E7JA 4CFDA 3VQAA 4ZVHA 4KI6A 3OYGA 3M8QA 2W9CB 5DK5A 4FCYA 2P1JA 2HHVA 4RUAA 4F3TA 4FBUA 3DLRA 3AVMA 4M3UA 4EP4A 1DTQA 2IC3B 4OPKA 2VWJA 3HL8A 4M3WA 5K14A 1EETA 3AO1A 4ZTFA 4NLOA 2RDJA 3P5JA 3IS9A 2HNYA 3DI6B 1XR6A 4QWDA 2FVSA 4IRKA 4RW7A 2KQ2A 4H4OB 4LH5A 4ZPAA 3RMCA 5KTQA 5KGWA 4Q8EA 4B08A 2IAJB 1QUVA 2O4GA 4CHZA 1WSFA 2WONA 2RPIA 4YR0A 1RT2B 3QIOA 3HVWA 5KFCA 2VG7B 3U3GA 5EWGA 4DL6A 1S0MA 5L9XA 1XHZA 2PYJA 1C0MA 4RW6B 4CGIA 1X9MA 1B9DA 3NH1A 1HPZB 3QEIA 3KKSA 3M9MB 3GQCA 1BI4B 3RMDA 1S0OA 2QE5A 3CJ0A 3Q8PB 1YT3A 3DLKA 3NKYA 1Q9YA 4ELVA 2RF2A 1HARA 4ECUA 3HPOA 4IRCA 4E89A 1HQEB 1JLGB 4YNQA 4DF4A 2PZSA 4CK3A 4ECVA 2B4JA 1RT6A 1RTHA 4GVMA 1SH3A 4CEFA 2VG7A 1NK7A 2WONB 4J2DA 2HHUA 4CESA 3HPHA 1S6QB 2F8SA 1FK9B 4H4MB 1WAJA 2OH2A 4F8RA 1S1XA 1RT2A 4LSLB 3OHBA 3DMJA 1L3TA 1HNVB 4CJEA 3KHHA 4FLWA 3OY9A 4CJLA 3JYTA 4E1NA 4KHSA 4I9LA 3KD5E 3EPGA 4BDYA 5F8NA 4C8LA 4KHUA 1HYZA 1JLGA 1Y97A 4OKJA 2OZMA 2D41A 3CQ8A 4IDKB 4ECQA 2FBXA 1DLOA 1ZTTA 3QNOA 1UA0A 4KV8B 3H98A 4DTXA 1RAJA 4EEYA 1RTDB 4MK9A 3O3HA 3QYYA 2VA2A 4MFBA 4URGA 4KBIA 1U48A 1C2PA 1YTUA 4NRUA 3AVIA 3M9NB 4RNMA 1TKDA 4ZPBA 1RT4A 4IG0A 5F8GA 4CIFA 5C42A 4JV0A 3IRXB 3C95A 3H59A 3SV3A 1RTJB 5FDLA 4CEEA 3MAQA 3DRRB 1C1BB 3V4IB 4J9LA 3LP1A 4DSLA 3H40A 3M8SA 4NLDA 3JSMB 2CKWA 3KTQA 4KPYA 4CFBA 2R2UA 1IKWB 3DLEB 3MR3A 3CYMA 1U45A 3MXIA 5HRNA 4QWAA 3L2VA 1TP7A 4J9OA 2V4RA 2QV6A 4O3RA 5DLFA 3LPUA 2FJVA 1CZBA 4F4XA 3IRXA 3BR9A 2ALZA 4Z4IA 3I0RB 1JXEA 3ISND 3DLGA 3I8DA 4ZP9A 3GIIA 4H4MA 1GX5A 2FVCA 2AX1A 3VQPA 4B9SA 1G15A 2ATQA 3TAPA 1TVRA 2FVRA 4DU1A 2GIRA 4OKKA 4M3ZA 3RB4A 1B92A 2ILYA 4IFVA 3VQ5A 3MEGA 4CE9A 2G8HA 2ZQBA 4LSNB 3BQ2A 3KLGB 2E9RX 5I3UA 2AJQA 5CYQA 2IS3A 4CFAA 1RNHA 1JXBA 3AVKA 2W9AA 3CFRA 3MECB 1SH0A 1BCOA 1BI4A 4M45A 5J2PA 3HT3A 4ZMMA 1NK6A 4CFCA 2QK9A 2I5JB 4I9QA 1KVCA 4O4GA 4ED6A 3RBDA 5KFLA 4B3OB 4W5RA 3A2FA 1KLMA 3FFIA 1JL1A 1HNVA 2G8FA 3CIZA 3GIKA 3V9WA 4CHNA 3HVRA 3LAKA 2F96A 1S6QA 3L2QA 3I0RA 3NCIA 3KHLA 2HW3A 2YNFA 1XWLA 1VSFA 3LALA 1Z26A 1NNDA 4N56A 3OJUA 3GV7B 2XY6A 1BQMA 3SFUA 2ETJA 2P5GA 3L8BA 2VG5B 4FM0A 2IA6A 1VSIA 3HYFA 1DTQB 2IC3A 3E51A 4KB0A 3TAGA 1S4FA 2EHGA 3DOLA 3N6NA 3NGYA 3VQ8A 3OYJA 2VG6B 5J2NA 4CK2A 3ZSZA 1XC9A 1EKEA 2BR0A 3V1QA 4BE2A 1ZETA 1CSJA 4F4ZA 4AHUA 3QZ8A 4YP3A 4DFKA 2YNHA 3V81A 2ASDA 3KJVA 2YHBA 1QSLA 2KFNA 2JEIA 5E41A 4URQU 3WNHA 1BL3A 5KG0A 3MEEA 4CJPA 4JS4A 4DSEA 3M9OB 4ED1A 3PUFA 2HAIA 2HMIA 4XPEA 1JL2A 3DM2B 1S1WB 3CM5A 1IKVB 3HK2A 1TKTB 4YR2A 1QTMA 1FKPA 3V9ZA 1RDCA 1HMVB 3CFPA 2D7SA 1TL3A 2R8JA 1NK5A 3V1OA 2NUBA 2R8IA 4K4UA 3CJ3A 4LQ9A 3TI0A 4DFPA 2X78A 4I7FB 4HHTA 1SH2A 4MKBA 4J9RA 3KK1A 4PUOA 4WFZA 2YKNB 3H4DA 4F2RA 4FZXC 5T14A 4RG8A 2QXFA 2W9BB 3RTVA 3SI6A 4FK0A 4Y2AA 5KFWA 1S9GB 1VSLA 1C0TA 3PVXA 1X9SA 1JLAA 4F50A 2X6NA 1FKOA 3AVLA 1YVUA 4BE0A 5KFDA 5D3GA 4NYZA 3ITHA 1C1CB 1SV5B 4CJ5A 1T7PA 1EP4B 3HVAA 3OSPA 2X74A 1Z4UA 1JLFA 3TAMA 3AA5X 3LP3A 2FC0A 1RCHA 4ED8A 3AA2A 2E4LA 5HROA 2P51A 4FW1A 1RT5A 3K5OA 3RRGA 3ICLA 4CGHA 4CF2A 3MEDB 1WNEA 5HRSA 2OPPB 4HCBA 4IH7A 4DU4A 5KFJA 4OGEA 4I2PB 2F8TA 4Q45A 3GIMA 4ECYA 4DTJA 3DLGB 5FRMA 1RA6A 4IH6A 2J6SA 1LW2B 3CO9A 3SQ4A 3QZ7A 1VRUA 3HVTB 3NFAA 4CIEA 2HHWA 2DY4A 1IM4A 3KHRA 4KRFA 3AO4A 4GC7A 3ULDA 5SZTA 4NLYA 4RUCA 3I5CA 1LAVA 4ELUA 2YKMA 3V1RA 4KSEB 1NHUA 4GC6A 2XGQA 3K2PA 3C6UB 4Z0UA 3GYNA 3ZT2A 3MF5A 3VQCA 3NGDA 3TANA 4GW6A 4FLZA 3V9SA 2IDOA 2ATLA 4NLXA 4WZMA 3GIJA 4IR1A 1SKSA 3QIPA 1LW0B 3OYEA 2JEJA 5KFEA 3V6DA 2AGQA 3T5HA 5T7BA 4FXDA 4ICLB 2AU0A 4LD0A 1NKBA 3NL0A 3H08A 1S0NA 3MFIA 2YNIA 1Z25A 3VQ9A 4QPXA 1GX6A 4TLRA 3KLIB 5KFPA 3T1AA 1TL1A 1DTTB 4Z4FA 3D0PA 4K4XA 3AVAA 5KT2A 3PX0A 5EUHA 4JRPA 4CGDA 1HNIB 5HLFA 5KFGA 1O1WA 1SUQA 1S1VB 4N76A 1BQNA 3IAYA 3RAXA 1KSPA 1TQLA 2JC0A 1VRTA 4IG3B 5CYMA 4FJXA 4K4SA 2PYLA 3KLEB 3PY8A 1GOAA 1RT1A 5KG4A 3IGVA 1REVB 1K6YA 3RB6A 1SL0A 4J9QA 1TKZA 4KI4A 5DQHA 3F9KA 2G8IA 2OPQB 4R0EA 3OYHA 3S9HA 5KFQA 4WYLA 2DPIA 1L3VA 1RTHB 3ZSXA 1U47A 4O44B 3AVHA 3OLBA 3LP0A 3EY1A 2ZE2B 4DQRA 1TKXA 3DOKA 2B6AA 5HRRA 3TAEA 2ZD1B 1ASWA 2B5JB 1IKXA 3LP0B 2OPRB 4K4WA 4DU3A 2WB4A 4K8XA 1RILA 4DQIA 1NOYA 3EYZA 3CM6A 4O3NA 3FQKA 4K4TA 3VQSA 3RRHA 4ZPDA 4CECA 3PO5A 3LZIA 4NYNA 4WXWA 3VQ7A 3CJ2A 3V9UA 4FJJA 3Q8QB 4F4WA 5J1EA 2R2TA 3LPTA 1MMLA 1WN7A 4IOBA 4FM1A 4BDPA 2GIQA 1RT3A 2J6UA 1JKHA 4EO8A 4QOZB 4DL7A 4DFJA 2G8UA 4X2BA 4KAIA 2OA8A 1LWFA 4Q43A 4NLWA 4J2AA 1VSJA 2VWKA 1DTTA 3G86A 1VSKA 4U6PA 5KG7A 3PW2A 3SNNA 3OYCA 5KFTA 4WFYA 3HHKA 4AHCA 3MTKA 3K59A 4O0JA 3ZSWA 4KHQA 2G8KA 3NAHA 3M8QB 3P1GA 4OLBA 1ZBUA 1ZTWA 3LANA 2BE2B 2FVQA 4R5PB 2G8WA 4CJSA 2OPSB 1LW0A 4ID5A 4TYBA 2JGUA 2IJNA 1R0AA 1VSEA 4PQUA 4TYAA 2X6SA 4TQSA 4FLUA 3O3FA 1TV6B 3PW7A 3L2RA 3KLHA 4TN2A 3AO3A 4L8RB 3BSNA 2C2DA 4DS5A 4TQRA 3DRSB 4O3PA 4I2QB 1HQUA 3V6JA 2WOMA 4Y2CA 4KHYA 3M8PA 2UVWA 1VSHA 4FLYA 4C8OA 3LWLA 4CJUA 1QSYA 4RW9A 5KFMA 5EDWA 4Q8FA 3TWHA 4R8UA 5L1KA 4ECRA 4Z4CA 2ASLA 5KFYA 5C24A 1NKCA 2KFZA 2HNDB 4DTOA 4NCGA 4NYFA 3MXJA 3H5XA 4R8UB 2HVIA 4CJVA 1KFDA 2IM0A 4J9PA 2DFFA 4DSIA 3VN5A 3QLHB 1C1AA 4CF1A 1RTIB 1K1QA 3OLAA 1UOCA 1N6QB 5I42B 3Q8RB 4QW9A 3KK3B 4OLAA 5C5JA 2HHQA 1JXLA 4DLGA 3BSAA 2IBKA 4ED7A 3IG1A 1EP4A 1SV5A 4YQWA 4EP5A 1S1TA 4MIBA 4RNHA 1TAUA 4W5TA 4KFBB 3TR8A 4RZRA 4CGGA 4CEBA 5F8HA 4ED2A 5KT4A 2D5RA 4J9SA 1BCMA 4WZQA 3NF6A 4IG3A 3NF8A 4ZTJA 3VQ4A 4RNNA 3SQ0A 5FRNA 3K58A 4K8ZA 4B9TA 4ECWA 3FSIA 2YKNA 2DFHA 2UUWA 2KW4A 1WSGA 3DLHA 4CF8A 4ELTA 1WSIA 4EZ9A 3OYMA 3KLFB 4ZVGA 1D9FA 4DL2A 1HJRA 1LWFB 1RBTA 4G1QB 4B9VA 2WOMB 5KG2A 2A1RA 2RKIA 1WSHA 1D0EA 2OZSA 4DG1B 1BGXT 1JLQB 5JUMA 1QAIA 2HVHA 1UWBB 1W0HA 1TK0A 3SPZA 4ZHRB 4NLQA 4CF0A 4B8AB 2XY7A 4DSKA 3H5YA 2UVUA 3T3FA 3WNGA 4HTUA 3ISNC 4HYKA 3OYFA 4FLXA 4AILC 4M41A 4B9NA 4RU9A 4KB7A 1UWBA 3KK3A 4ZP6A 4RW4B 4E1MA 3NF7A 4NZ0A 4TY8A 1JX4A 4M3YA 4IRDA 2UUTA 3KLFA 2Z1GA 2DTUA 2F8EX 3SYZA 4E0DA 3KK2A 1TKZB 1J5OB 2DFEA 1NJWA 5L1IA 5HRPA 3G10A 1RDRA 1KLMB 3FFIB 4MKAA 3QO9A 2AGOA 4CERA 3BREA 5KGXA 3QGHA 1J9AA 3C94A 1X9WA 3MR2A 4MQ3A 4IFYB 4NCAA 4DQSA 5KFXA 4RW9B 3HSTB 2AGPA 3MEDA 3ZT0A 1U49A 1T03B 3K5LA 4JV1A 1TAQA 3EPIA 3V9XA 4HUGA 3DRPA 3QEWA 3OS0A 3N6LA 2XY5A 5HROB 1NJZA 3OL9A 1CXQA 2WK4A 2R2RA 1RDDA 4HVJA 2Y1JA 3WNFA 3FDSA 3MR6A 1I39A 4CGFA 4K4ZA 4NLTA 5EWEA 4IFVB 1N6QA 3QERA 2QKBA 3NBPB 4RW8A 1RBUA 3HP6A 3ALYA 4CJFA 4R5PA 2R8HA 1MU2B 4FJ5A 2DPJA 1UAXA 3S3NA 4IFYA 2YV0X 5KFAA 3QO9B 3LDSA 2RN2A 4WE1A 3O4NA 5JS2A 4O55A 3E01A 4NRTA 4Y1DA 3M8PB 2XY8A 2ASJA 3LP2A 3RAQA 4K4VA 4FJNA 2JC1A 4WE1B 2W7PA 1VRUB 5KFOA 4CEAA 1TK8A 5F8LA 1UA1A 4ECZA 3ZSVA 1ZBLA 3UIQA 3ZSRA 1A5VA 4ZP7A 4JS5A 3D5MA 3NH0A 1TV6A 4NLVA 3P83D 3L2UA 3THVA 2BGGA 1KCFA 3NGZA 3LWMA 3Q8SB 1D9DA 2BQRA 4ID5B 2XI2A 3ZCMA 3VQ6A 4FJLA 3NBPA 4RW8B 1NK8A 4FJHA 2JLEA 3PR4A 1DLOB 1T3NA 1SKWA 1J54A 5KFHA 3T5LA 1NOZA 3QINA 1JLFB 1S49A 2E9TA 3OYNA 4FBTA 1HYVA 4O44A 4BWMA 3SQ1A 3HKWA 1RYRA 4NCBA 2D0BA 1IH7A 3OS1A 2R8KA 5FROA 3AO2A 5KFKA 3KMSA 3RMBA 3DRPB 2W42A 4M3XA 2BANA 2BRLA 4DTMA 2XO7A 1YTAA 5EU7A 4RNOA 3KLEA 1FK9A 3VQEA 4NLRA 4OKEA 4B9MA 2C22A 4FS2A 1ZBFA 5J1EB 2IJFA 3AA4A 4IBNA 4KKOA 1S9EA 4AHTA 4DSJA 2KZMA 3BSOA 1I6JA 5DG8A 5L1LA 3PJWA 1N56A 3PW4A 1NKEA 1X1PA 1CZ9A 1HQEA 5KI6A 1NK4A 4KHWA 3KIOA 3VQQA 5KFNA 4CJTA 4DMNA 1JLBB 1TKXB 3KLGA 3ZSQA 4WXOA 4U7CA 3I5BA 3QGIA 3AO5A 4BWJA 4DL3A 2V4QA 4Z4EA 3MEGB 3OL6A 1JLBA 3KKRA 5D3GB 5I42A 3OSNA 5KRTA 4B9LA 2QKKA 2Q3SA 3FQLA 4DFMA 2PY5A 3H2LA 1ZBIA 5J2MA 3CDEA 3V6KA 4ZP8A 1S9EB 4KKOB 2VG6A 4KHNA 1WLJA 3C6UA 5DGBA 1WAFA 4XPCA 2VA3A 4CHPA 4J9MA 3ZSOA 4YMEA 4O3SA 5CZ1A 1J5OA 2BANB 1RYSA 1SL1A 2V0NA 3SCXA 3RB0A 1BIZA 2D3UA 3CJ4A 3BQ0A 1VK0A 1WNSA 3LP2B 3NDKA 2Z1JA 2W9CA 4HUEA 5KG1A 4MK8A 5KT6A 1KHWA 4CF9A 5SWMA 3E01B 4RW4A 3SUQA 3I0SB 4CHQA 3LAMA 2ITGA 2YNIB 4E19A 3AV9A 2Y1IA 4O3OA 4E7KA 3MFHA 1N48A 2YNHB 2I1RA 4N5SA 4YR3A 4PWDA 3BJYA 2R8GA 1N5YB 3FRZA 1Q9XA 3TARA 3B6PA 1RA7A 3QIPB 1RT5B 3SV4A 1U4BA 5KFFA 1IKXB 3H5UA 4KFBA 4TXSA 4ZHRA 4O4RA 4DEZA 1VSMA 4N41A 3QETA 4OPJA 3QEPA 1L5UA 3BQ1A
chains in the Genus database with same CATH superfamily
4OYBA 2FBVA 3ZTPA 2Z58B 2AP1A 4CK1A 3I5AA 1JLAB 1QAYA 2E88A 2DHGA 5KT5A 4CJ7A 2ZH1A 2W41A 1FX4A 2W9BA 1YJWN 2L3MA 2XNQA 1MROA 3O44A 4J2BA 4KIAA 1L3UA 4K50A 3DDKA 2P9LA 5MLCQ 3GV8B 1D8YA 5A6WA 3EICA 3RMAA 3GCXP 2F9TA 2ASPA 3WZ0A 4CHYA 3NAEA 3T5JA 3BF4A 1HW9A 5M1NA 5KT7A 3NE6A 5CYJA 1FI4A 4XIUA 4FYYB 2HVZA 2HHPA 1XHXA 2JX2A 4H54A 3LDNA 2IM1A 4PKHA 1PJ7A 2VFUA 4CHOA 3U3YA 3PZPA 2MTLA 4YOTA 2RJZA 1NH7A 2OEMA 3ZZRA 5I9EB 4LH4A 1G99A 4YHHK 1ITGA 3MPWA 4ZK7M 4M42A 4WK1A 4OYIA 1IKWA 1WEXA 1EETB 1NJYA 4W5NA 4LBHA 2O4IA 1S4EA 3KWMA 2GHPA 3DXMA 1HR0F 1KTQA 1F6TA 5BRHA 2KT5A 1WC1A 1VSDA 3B82A 1S9FA 2ZJQL 4CH1A 2Q1NA 3ZZPA 2E1ZA 3CETA 2Z1HA 2CPZA 2RD5C 2C2MB 3U02A 3RW6A 1S1WA 3HI0A 2P9NB 3D6RA 1CLQA 4ED4A 2ZZTA 3KOAA 5J2MB 2AQ4A 4YY3K 4DUZF 5ETPA 5LMUJ 2IMWP 1HBNB 5I3UB 3CSKA 4UOFA 1JB0C 3CDAA 4DI6A 4LY7A 4DTNA 3D1QA 2NRXA 5H1SV 2KTQA 3VGLA 4C3LA 4PEOA 2F4VF 2PA3A 4E7HA 2DR6A 4MDBA 3MPUB 1S48A 4GKKF 2QC3A 1KQSM 2G8VA 1R59O 3P45B 1HRHA 4CZFA 1JKHB 2V8HA 5BR8J 3W65A 4OJ1A 1VRTB 2KM8C 4UW2A 3P6YC 3E66A 4NMLA 4R79A 4WYWA 5J1PA 1YGYA 2X51A 4BVOA 1U1KA 3IS9B 5KFBA 3CCWA 3QGGA 3LQVA 4BG9A 5DG9A 4FJKA 1ZM2A 3B4DA 1SUQB 1I1GA 1M5PC 3DRRA 1MSWD 3C0BA 2CWKA 3TPQA 1OJ4A 5AE1A 1LV5A 4OYAA 4KQZA 4DCPB 2GJ2A 1HNZJ 3JTOA 3U6FA 1RU2A 3ID8A 2D3ZA 2AHOB 4Y65A 2Z4PA 4MLEA 3LOUA 4XTTA 3Q23A 4HCCA 4MYTA 1S7HA 2GGPA 1KKHA 4F3OA 4QWEA 4MMOA 5L39A 3R6LB 4CLTA 1UJ4A 3UKRA 4K42A 3DI6A 1NH8A 6AT1B 3O3GA 1DQAA 4K0KK 4QU6A 5KG5A 2EPIA 4B17A 2DRDA 2GV1A 1HL6A 1MN7A 4XO0A 3BGRA 3ASMA 3IWLA 5HLFB 4NLSA 4DV5F 5LMNJ 1VK3A 5A0YA 3MWTA 3DMJB 2HB5A 3ZT4A 1F9FA 5DDQC 2RH3A 2KH9A 1NM1A 3WX4A 2HFSA 2DR8A 3NH2A 1L3SA 1LWCA 1FERA 2PMWA 5L8RC 2NQPA 5M2UA 2KXHA 2GMJA 4IKAA 5BPLA 5H9FJ 1IWGA 3IRWP 1VR6A 2XHWA 3EZUA 2EFVA 3WC2A 4HLBA 3PJXA 2AD9A 2XWXA 2B5JA 3AVFA 3A8EA 4JI1J 4LMZA 3M3ZA 2GFFA 4KE5A 4EYIB 1VQ7N 3KJFB 1W9HA 1Q86T 1TK5A 3C14B 1S1XB 5T7LA 1WSVA 1QSSA 3QEVA 2G2YA 1GEHA 1FXLA 2V51B 4DHVA 3WXLA 3OFEA 3AOAA 1RE1B 2W8LA 4B9UA 3ZTOA 4FF3A 3E9PA 3US5A 2GUIA 4XK8C 3DLEA 5JXSA 2H3EB 2QL7B 3JAMY 1YRXA 4RLEA 2DVIA 1CXUA 3R2CJ 1S1VA 3VQBA 4E3SA 3UWTA 2W7OA 1YVNA 3RWUA 2FLLA 4JV5F 2GQQA 2RVJA 2YX4A 4URSA 2ZWHA 3JTNA 2UU9J 3O4QA 1N33F 2O5DA 4CD3A 2A1BA 4C8NA 4LFBK 1X4EA 4XEIA 1HWUA 2A1SA 2ZH9A 1RAGB 1B0TA 4IKFA 4AH9A 3KD1E 4CJQA 3V6HA 1M5OC 4BR4A 4CGJA 3CG7A 4RL1A 2W1BA 1HKCA 3DRYA 4M5JA 1YK9A 4Q2MA 1LWEA 1U04A 3W2VA 3E2EA 1HYSB 4FZVA 3G6EN 4CJRA 2YX7A 2HPUA 4B3MJ 1JLQA 1X3MA 1V3ZA 5AXNA 2WHOA 1XQIA 2DXFA 3LA0A 1Y64A 5HBMB 3GILA 3TAQA 4EYHB 5K8MA 5KRSA 3BM7A 4Q0BA 2YTCA 3FCWA 3BH7B 2NSCA 4P2FA 2J8SA 3DAWA 3ZZ0A 1NHVA 4JOUA 5AZIB 1LW2A 3U9ZA 1D1UA 1OQ6A 3GZ7A 5B0BA 4Y0FA 3PRBA 4F4YA 3B6OA 5J2PB 3BDPA 4JI6K 1QE1A 5BRFA 3HSZA 2E6LA 1VQ9N 3CPWM 4FPIA 4NLUA 2FZGB 3DXKA 1HNXF 3E8OA 4MK7A 1WC4A 4UF4A 4BCAA 1X5OA 2EFOA 3DLKB 4ECSA 4NB4A 3H3OB 5CH7B 3RBEA 4BGAA 5J2QA 3A5LC 1YZ6A 1REGX 4MTPA 3IXQA 2YKMB 4KTWA 4U7UK 3J7YP 2G2ZA 4WBFA 3T19A 5IT9Y 1NGCA 1GK8A 3IAM9 4UQTA 4DUZK 4KTZA 2P9LB 4CLZA 1VI7A 3BYRA 3KMQA 2HS4A 2AYEA 2ZC3A 2V6AA 2HQFA 1VIXA 1VQ6N 2YNGB 4LBIA 3K17A 3GV5B 1QZ6A 4TSXA 1H73A 3LH2S 5GMDA 4BHQA 2FTRA 3L3VA 1RWOB 3F73A 5GINA 2IYGA 2WVFA 3QIDA 3EDQB 5D0EA 1HMVA 5J2QB 2LA6A 2CJQA 4C8MA 2ZJPQ 4G3IA 3PX6A 1CJVB 2AA4A 3O1BA 1NZAA 3CJRA 5HN0A 1MMDA 5E3PA 3RBXA 3UDCA 4RO0A 3PCOB 3UDLA 2YH1A 2VF3A 4E7JA 3TSUA 4RUAA 1XNQK 2B8QA 3AVMA 3ENWA 3NVKA 4YHHF 3EGNA 1VQLN 3CCZA 5K14A 4UUXA 3DNCA 1NPPA 3P5JA 5AQKA 1XC3A 2HG4A 4QWDA 1SC1B 4ZPAA 4LH5A 2H65B 4HI1A 2UXDJ 5KGWA 2RUGA 2OELA 2V8DA 4BC5A 4A8MP 4CHZA 2J0QD 1WSFA 4X4RA 1FWLA 5KFCA 3CC4N 2BM0A 5L9XA 2LP4A 3DHXA 1CBKA 3H6EA 1H2TZ 2PFFB 1X9MA 2B9XA 1KC8O 1HPZB 4BC2A 3GR0A 3QFWA 2WZ1A 4X66J 3MI7X 2FGOA 3GQCA 5CXTA 4PL7A 2MXYA 3CCUS 2P9IB 3BS9A 3CJ0A 3OTDA 5A8RA 2OFHX 3Q8PB 2PEHA 1YT3A 3IMQJ 3NWGA 2V68A 4G65A 1CQNA 4Y2IA 2IRUA 3F2KA 1SIZA 1U1OA 3I9V9 3IC1A 1JLGB 1PIEA 2LECA 4ILHA 4DF4A 3UW1A 2N4DA 2MKKA 1RT6A 2YHXA 1CJKA 3I56N 2HEKA 3MMCB 2IBOA 2VG7A 1O51A 2XMKA 2DHSA 2HHUA 1XMQJ 3HPHA 1FK9B 4FNIA 1KAXA 2GVDB 1L3TA 3DMJA 5CHIA 4ANEA 5DJBA 1FRIA 3QDKA 4FN5A 2VOPA 3BKTA 2O8BA 5HJXA 1MWYA 1QVGM 3D0IE 4BDYA 5F8NA 2Q1LA 4C8LA 5GADP 3O9TA 3CB4A 4IEEA 2RE2A 3MM7B 2ZDOA 2OZMA 2D41A 2Q0RA 4IDKB 3G82B 3N4WA 4LF6F 2FBXA 2HBKA 3MX5A 1DLOA 3D3BJ 4IO9L 3H98A 3CCJS 4EEYA 3VALA 4X64J 5B0DA 4MK9A 3O3HA 2VA2A 4URGA 3HHNB 4YB1P 4KBIA 4PWUA 2FHMA 1ZM9A 2QFJA 3J7A1 2XMVA 4JI3F 2ZDPA 1TKDA 1RT4A 2ATCB 4IG0A 1NCLA 1HIYA 1EHWA 5GAHU 3C95A 2N3LA 3H59A 1VHXA 1RTJB 1XMQK 4NE9C 1X31C 4QBUA 3DRRB 1C1BB 1Q7LB 2N3OA 4K2XA 1F5AA 1P9YA 2G0CA 5BRDA 3U27A 1XK8A 3H40A 4NLDA 2CKWA 1NGJA 4KPYA 2R2UA 3QQCD 3WIVA 2XYPB 3MXIA 1Q82O 4U8VA 3FRYA 4QWAA 3SBMA 4OPHA 5DLFA 1S6OA 5HK4A 1CZBA 2OKQA 2ALZA 4DUYF 3DLGA 4ZP9A 2W4CA 1D9AA 2H48B 3A1YG 1A0OB 4ZVUB 2KKZA 1AT1B 2ADBA 4M3ZA 1VQ5N 1B92A 1LQ9A 2ROGA 3VQ5A 5JVGL 4B3MK 4A47A 5D0GA 3HMJG 4OI4A 3KLGB 2KG1A 2EK1A 5I3UA 2AJQA 5CYQA 4MO4A 3DU5A 3AVKA 2ZKTA 3SIPB 3WC0A 1SH0A 3GG0A 3KUGA 3FMWA 4A5BA 3HT3A 4ZMMA 4CFCA 2P9UB 2V4JB 4I9QA 1KVCA 2ZWOA 1KDNA 4ED6A 1KLMA 1R8CA 1VHFA 1HNVA 2IDEA 2CQ1A 4NXNK 3R5JB 4HT7A 3GIKA 2BXJA 1YJNS 3V9WA 1N8RO 3LAKA 2QM1A 2F96A 1S6QA 1NDPA 3I0RA 1X9JA 3NCIA 2DXEA 3D9BA 1Y0HA 2ETJA 3IKMA 3A5NC 2VG5B 4C1NK 4HHJA 2HBJA 3ETMA 5LT5A 1SS6A 2RU9A 4LF8F 5C15A 3DOLA 3NGYA 2DR7A 4JHDA 4BRMA 4I68A 4BE2A 1U1PA 4F4ZA 4N8OA 4WCEL 4USKA 3QJJA 2W6KA 3JS6A 3QT8A 4DSEA 3CCES 4YY3F 3CUNA 3DM2B 1S1WB 3HK2A 2HF4A 4YR2A 1QTMA 4H0XB 1D4XA 1HMVB 4PKDB 2E2NA 1TL3A 1IR2A 4AF1A 3TI0A 2RIJA 4CT8A 4JKFA 4A4JA 5K9FA 4MKBA 4J9RA 4PUOA 2BBEA 4WFZA 3MPDA 4BC3A 3H4DA 4FZXC 3VEYA 2C42A 4RG8A 1VLYA 2W9BB 3SI6A 2MQPA 2B3TB 2EFQA 1VSLA 2Z0GA 4EUVA 2CPYA 3PVXA 1RISA 1JLAA 4F50A 3HHEA 4G1IA 2X6NA 1FRHA 2DEJA 1XIQA 2RQ4A 3AVLA 4LIRA 2J7KA 5KFDA 2IIRA 3T1YK 4AE5A 3FZ2A 2VCPA 1EP4B 4O0NA 2X74A 1M1KO 1Z4UA 1JLFA 1WKKA 5IT9U 2VDHA 1X4CA 1ZA1B 2ZGYA 1ZBTA 3AGRA 1VQON 5DM6L 4N77A 3AGKA 1WOPA 3K5OA 3RRGA 1FRMA 4CF2A 1CC8A 1RSCA 1AUDA 3SXLA 1NPKA 4C98A 2XS2A 1FF2A 4BRLA 4HCBA 4K7QA 4U67L 4DU4A 4B3RJ 3MTJA 3DJCA 1EKRA 4FP9A 2F8TA 2HVDA 5IQ6A 1RTZA 4QZVB 1E4FT 3SEOA 5K8PA 3QSYB 1H0HB 1LW2B 3CO9A 3NCRA 1VRUA 3KHRA 2MKCA 4WTYA 4F02A 3W2WB 4RUCA 1CPZA 4LVOP 2XSFA 1FX2A 2CYYA 4KSEB 1Y4ZB 2QYCA 3TUJC 2C2ZB 2XGQA 3K2PA 4Z0UA 1VQSA 3ZT2A 3VQCA 4DV4J 3SJHA 4GNIA 1K44A 4WZMA 4JI4K 1SKSA 2JEJA 2CWXA 2YPYA 3GR1A 3PIPQ 2M4MA 1TL5A 5KFEA 4CQ1A 4CYUB 4ALZA 2Q6BA 3T5HA 2GJFA 5T7BA 3MD3A 1O5JA 4OZ5A 1UJ6A 3MFIA 2YNIA 2CJXB 1Z25A 5CQGA 4A2AA 1T44A 1N5QA 3GJRB 3VQ9A 4TLRA 1VC6A 1UVIA 3AVAA 2PSZA 1RAEB 1HNIB 5M1FA 1S1VB 3FUYA 5CD4A 2XYGB 3M2RA 1X4FA 4JN4A 1KSPA 4W98A 3M8WA 3VAMA 2XS5A 1X8DA 2NUUG 1YDLA 5M1QA 5CYMA 4FJXA 2VQFJ 4GKKK 3PY8A 4RWXA 1RT1A 5KG4A 3IGVA 1REVB 4U7UD 4YN3B 2BX6A 4DCJB 3F9KA 2OPQB 5KFQA 5T7LB 4M8LA 5BREA 1WOQA 3EY1A 2ZHOA 1AUSL 2ZE2B 5HMXA 4DQRA 2G4BA 4JAXA 2B6AA 2QSWA 4JD2B 3O9UA 2ZD1B 4KHPF 2B5JB 3J7ZO 3JTPA 3CMAS 1OY9A 1RILA 1NOYA 3EYZA 2UUAJ 3CM6A 2HFVA 1B0VA 5EOYA 1ZM3A 3QRQA 3DRXA 3SQGB 3RRHA 1ZS6A 1RKIA 3ENBA 3TTFA 4LF5J 2QO3A 2YPZA 1U6ZA 2HQIA 4WXWA 5BPMA 1M5KC 1U1NA 3OTOJ 4NXMJ 3UN2A 3GIRA 2V69A 3Q8QB 3C7NA 2MJNA 1WN7A 3FLCO 2GIQA 5GAEI 2FY8A 2GNKA 2J6UA 4EO8A 4DFJA 2G8UA 2MEWA 1IR1A 1LWFA 4Q43A 4NLWA 4C2MA 4ZPWR 3NGSA 1VSKA 1U2VB 3SNNA 1SJQA 1KVJA 4MLHA 4PKGA 3MUVP 3UDVA 3MTKA 1R43A 2YX1A 5AJ3K 2QTWA 2PN6A 4DV5J 2H51B 4YORA 4JI7F 4CVNE 3ZX0A 3MUMP 3HI9A 2F5GA 4ID5A 2HFUA 4LF4K 1IN0A 4F0KA 4PQUA 3VAKA 3OHRA 1MWMA 4JK7A 5ADXA 3L2RA 3KLHA 1SKUB 1FDAA 1X3NA 4TQRA 1GMWD 3DLLL 1GXLA 4ZN3A 2WOMA 5IC4B 2EG2A 3D2FB 2AEMA 5H1SQ 1VSHA 3BF1A 2CQ3A 3LWLA 3NNHA 1QSYA 2PEBA 4RW9A 4QR0A 5D4NA 1X4HA 4ECRA 4Z4CA 3IUCA 4NCGA 4CP5A 1S7IA 3PLAA 3PG9A 2UXDK 2OTJN 3CC2S 4BRQA 3P39A 1UJ5A 3CW2C 2B9WA 2GQCA 2SXLA 3M6XA 1K1QA 1H1VA 1M90T 1R31A 4BQZA 1GLAG 1RWXB 1VCTA 4ED7A 3CCSN 2NRHA 3ZX2A 4EP5A 3I4HX 4B1ZA 1S1TA 5DETA 4DB3A 4RNHA 1TAUA 4OI2A 3VENA 1XMOF 4CGGA 3ELHA 5F8HA 1BCMA 3SQOP 4WZQA 4JP8A 2XQCA 4KR0B 4IG3A 3SQ0A 1QD1A 2IY5B 3ISZA 3HSJA 1K73T 1FJCA 2UUWA 2VJVA 3D7SB 1WSGA 4H0YB 3P8BB 3VGMA 4FKYA 4EZ9A 4I64A 1AW0A 2E5IA 1DQ8A 3MMJA 3Q89A 1LWFB 2K2PA 2DY1A 1IJFB 1BWVA 1SPBP 3KJNB 1QQMA 1GT8A 3IM8A 1QAIA 3J7Z5 1NB2A 2CJAA 4WFNL 3SPZA 4ZHRB 2CG4A 2Q97A 1Z1ZA 1Q7YT 1WDTA 2Z2ZA 4DV6F 2ZH2A 2UVUA 2DHHA 3WNGA 5BN9A 4HTUA 2MPUA 1Q81O 3NXZA 1OYDA 4M41A 2KKHA 2W2QP 5H9EK 1DJ0A 4PG7A 4CZMA 1VK8A 1OH7A 3ZLJA 2O8EA 4MYUA 3KK3A 3L95X 1R89A 1HNWK 2OFGX 3SYZA 3R6MA 2MGZA 2NLWA 3I4PA 1YJWS 3KK2A 4NWBA 4RBVA 4F0HA 5L1IA 4FOEA 4YOWA 1GAOA 2E29A 2W2MP 4JI8J 1HI8A 1RDRA 1RFQA 1BA0A 4C11B 1S77D 3FFIB 1AROP 3QO9A 2L9DA 2ZJRQ 3BREA 3QGHA 3NOGA 2UUCJ 3JAMU 1NGGA 1U49A 2V2KA 1T03B 2CH6A 5AE2A 1TAQA 1I94F 4CI0B 4FL9A 2V52B 1SQFA 1XEZA 3QEWA 3ILOA 5HROB 3SSQA 4LF4F 2MYFA 4KGVB 1YUWA 2KHDA 2R2RA 3W8PA 2YWKA 5FIIA 4JI7K 3FDSA 4CGFA 2CPJA 4IFVB 5LMNK 2IVNA 2I7NA 4LR8A 5DS7A 1RHUB 2QKBA 1LXJA 1HBOB 4C6AA 4RX6A 3S01A 5A2QY 4U95A 2ZWPA 5KFAA 4NPOA 2NR0A 2NRRA 4O55A 4NRTA 1FHTA 2LXFA 4FXVA 5DRKA 2ASJA 5ETMA 4K4VA 5EX3A 1S79A 4P73A 1VRUB 1UA1A 2J9DA 1R6VA 2QZ8A 5F0UA 2ZM6F 3K9JA 4FWSA 1VQ4S 3G87A 4V19J 4NLVA 3P83D 2BGGA 3ENAA 1L3KA 2EWHA 2VL1A 2UUAF 4FWLA 2BQRA 4ID5B 4M5IA 4LF7F 3EZOA 4DR4K 3NBPA 4RW8B 1NK8A 2OD4A 3MDQA 5MAOA 1DT9A 1VQPS 2BJ1A 4FJHA 2QWRA 2WVCA 3IFRA 2ZH4A 3ILIA 2QWOA 4X62F 3T5LA 2NNWA 2DT9A 2RE1A 4CRJA 3K9KA 3QINA 1JLFB 2OP5A 3B78A 1S49A 4CBUA 4FBTA 1NSPA 4I0WA 3SQ1A 1G4CA 2V2ZA 4NCBA 3D2WA 2VQFF 2HZAA 2R8KA 2E7XA 5FROA 2UUAK 2Q66A 3UB5A 3LL3A 3RMBA 2CNLB 2VFSA 2BANA 3C16A 4DTMA 2V8PA 4B9QA 4H4KA 4BBYA 2DGWA 3AA4A 3GJSB 5DM7Q 4ANDA 1P27B 2HBMA 2FDNA 3BSOA 5B0EA 2ZNYA 4NX9A 5AJ3F 5B0FA 1GFWB 1EAYC 5B0AA 3A4TA 4CJTA 1OMSA 3ZSQA 4U7CA 3CJ8A 4Z4EA 2DNZA 3SSRA 1UEUA 1H2VZ 3OSNA 2QKKA 2Q3SA 3OR1A 3A8YA 2U1AA 1GTHA 1H2UX 2C2OB 1UKUA 1HI0P 1HNZF 1ZBIA 3CDEA 2J9EA 3IBWA 2N82B 3E9OA 3IM9A 3OFHA 3FBFA 3PYDA 5D15A 3C6UA 2DKOB 2AYMA 2LU1A 2DNKA 1VFJA 4J9MA 3BO3A 3ZSOA 4YMEA 4O3SA 2UUCF 3ZZYA 1WKLA 5D0HA 2ZC4A 2BANB 4JI4J 3SCXA 3EO3A 2D3UA 2B4OA 4BC9A 3MN9A 4J90A 4HUEA 3M1FA 2QT7A 2D9OA 4CF9A 2HZVA 3EKSA 3E01B 2EK6A 3SUQA 4U67Q 2ZVIA 4X4NA 4E19A 3AV9A 3OW2M 4MAKA 2YWWA 1N48A 4N7TA 1QQNA 2DBBA 2P9UA 4PWDA 2R8GA 2IFXA 1YHQN 1Q9XA 4ZPTR 1GLLO 3K8WA 1CG2A 3PFOA 4TXSA 4DU7A 3JS9A 3UFCX 1SQGA 3VESA 3JQKA 1EQ0A 3FGUA 5JMNA 3G8TA 3FZLA 4N41A 5IWAF 3QETA 4WF9L 3QEPA 4FYXB 1IQTA 2GVZB 2HIYA 2RKIB 1EX4A 3TNVA 4HVZA 3PV8A 1KRPA 3TA0A 4BY9C 1KVBA 5E5NA 4PA1A 3EKUA 5FLXO 5C24B 5B0GA 4OI0A 4ZVSB 5IM0A 3L4QA 3CJKB 5DDPC 4W5QA 1V5VA 1JCGA 3C19A 1T3VA 4EBDA 4X66K 1TFYA 2I5JA 4LF9K 2FBYA 1AZSB 3AJDA 5AQWA 3F9MA 4DV7F 4K4YA 4M5LA 4AHVA 3CWJA 3FCVA 4GVLA 1D5AA 2QWLA 4IG0B 2YHAA 2DY9A 2NPFA 4HTLA 1TTHB 3NMAA 2CNKB 2A2DA 2W24A 3DXBA 4LF8J 3HM9A 3HZEA 3M8RA 2R7YA 2F63A 1YI2S 3MZIA 4YY3J 2A10A 1B99A 1KLNA 2F4VK 2RUSA 1T8EA 1BY9A 1BUXA 4A8FA 1SQEA 3N6MA 2LQ5A 3G82A 2ZH6A 1VQ6S 4N47A 3H4BA 3RG6A 2BQ3A 4WKRA 3PYEA 3AVJA 1P1LA 1BA1A 2OUGA 3QAEA 3O8WA 4Q2LA 4OJRA 1ASUA 1A9NB 1HNWJ 3AD9C 4M5GA 4ZLPA 4W5OA 1CVJA 5C42B 5DGAA 3C15A 3I9ZA 4IR9A 3GBTA 3UE5A 3SUOA 1QQOA 1P90A 3RUBL 4AXJA 3HX9A 5HANA 1K9MO 3DLLQ 1S6UA 1HD1A 4LIWA 1RT6B 2P9SB 1AB8A 3PYFA 5AZJA 2Z2MA 2VPYB 4DR5K 5EWFA 4H4KC 1Z05A 1IBKK 3R5BA 1KXPA 3KLVA 4DV0J 1HD0A 3PKMA 1HWKA 5KFUA 2B6AB 2CQIA 3CD7A 1RDAA 1HPZA 2C2RA 3TYTA 2M88A 2XG8A 3OTOF 1TVRB 1K0VA 3UNGC 4CCHA 1T94A 4IH5A 4AT1B 5EX0A 1WSEA 2X7IA 5A8WA 5K8OA 5B09A 4FJ9A 2C3YA 4LR9A 4G1PA 1PC4A 5BR9A 1U0HA 1HKAA 4PABA 4O0IA 1BQNB 4LQ3A 3MM5A 3TQEA 2RHKA 1WOOA 3ZTRA 4DUYJ 5AQUA 1VQMN 1TZ0A 4RBTA 1FE4A 4KHPJ 1WTBA 2OPPA 3AVCA 4DX5A 5DQIA 1FKPB 5BN8A 2W25A 1UVLA 4FWKA 3DOKB 2PI5A 3AVBA 4DR2F 1S57A 2M7SA 1XNRF 1C6VA 2R7OA 1VQYA 4W4MA 5AQHA 2FLNA 2KYZA 3RRKA 4S0MA 4CO4A 3F41A 2F9WA 2HOEA 4CYUA 3HFKA 2F7TA 3BH6B 3LGMA 4R25A 2P8IA 2IAJA 3F44A 4M63C 3A13A 4NCGB 4XDDA 5E3CA 2CPFA 5FLXY 4H5WA 4C3MA 1JXVA 2OTLS 3H20A 4HTIA 1T9YA 1ULRA 5HP1B 1XQSC 4FDFA 4CM2A 3KK1B 2AX0A 1IVZA 5LSLA 2ZNZA 1G2EA 3CJCA 4E7LA 2MY8A 1WEYA 4DL0C 3CEDA 3R3LA 5FDLB 2J6TA 2JVRA 5AQFA 2DH9A 3TVYA 2MQMA 1W2BM 4RJVA 4LFCK 4JI2F 4PQUB 4OI6A 5I4MA 3L6QA 2BDPA 3KJVB 2I9SA 3CJ5A 3VMFB 3G0ZA 2GJIA 2RS8A 3TZYA 1JLCA 4LSNA 1Y5LB 2JFKA 1FRJA 4KH1B 1I94K 2CQPA 4L73A 2ACMA 4CZHA 4DV4F 3CI5A 1QE1B 3EMTA 3FEXB 1BQMB 3A5MC 1P8ZA 3GG1A 4CEZA 3T1HJ 3IGNA 4DS4A 3T1HK 1NGIA 1B0PA 3I33A 2IM2A 4IO9Q 3OL8A 4Z4GA 4FJ7A 3T1YJ 1G3OA 3HO1A 3AVGA 4O5BA 4DQPA 2HRYA 2EI5A 2DGQA 4BR7A 3BBCA 1SCJB 3JSMA 2D1KA 4PPDA 4FYDA 1FJGJ 4ZA1A 5F8MA 3NGIA 2XC9A 4ATNA 3H46O 4OX8A 1LWEB 3OVSA 1RJJA 3OBWA 4FVMA 4FOIA 3MEEB 5AQYA 2KRRA 1VISA 4CJ4A 3IN5A 1RTDA 2GO8A 2H1YA 1X5PA 4RW6A 3ZZZA 1CLFA 2FLPA 1R0AB 1VQPN 2HKEA 2Y8WA 2CG8A 1LNQA 1LCUA 3G8SA 1O13A 4FJ8A 2AEFA 3AA3A 2UP1A 4NA2A 3GJQB 2JEGA 1VQKS 2V9KA 1H7XA 4UOGA 1A5WA 4OVLA 3Q7CA 3N5FA 3FBCA 3MOJB 3PTWA 3CE8A 3CHWA 1F3VA 4B3SF 4DWIA 3QNNA 1JLEB 2Z56B 4C8ZA 1EZZB 5E3RA 4OHVA 1IBCB 4FLVA 4NLGA 3OVNA 4J9NA 3H1VX 5JVGQ 2HMIB 4DR1F 3KDNA 3NNAA 4XH1A 3RB3A 3OYLA 3UPFA 4V19X 1WC3A 3OTOK 4FW2A 3FGVA 3CD6S 4H8KA 3VEXA 2XLKA 1NU4A 2HS0A 5J2NB 4DV4K 4KHRA 1ROFA 2QJ3A 2WTFA 1RT7B 4AQYF 2AV5A 1S1UB 1U09A 5G4DA 3J7YI 3WIUA 1VC5A 1EKSA 4ECTA 1DGKN 3G6YA 3EE3A 2YNGA 2RDIA 1C0UB 1FCAA 1C0FA 4A2BA 1WUAA 4ZIWA 4P9SA 4KH5A 1S6PA 1QQCA 4J9KA 4CLKA 3OYDA 3MAAB 1UEKA 5F8IA 5C7PA 4H4OA 3L0QA 1NBWA 4E2FB 1S3XA 3NGRA 1C0GA 4BRNA 3CDUA 3R3TA 2A6MA 2Z30B 4O4GB 4MH8A 2VOOA 5HOOA 1UL3A 1YF5L 4CJWA 1Y3JA 3EZ5A 3RR7A 4LF9J 2HNZB 1JLCB 1IBKJ 4QWBA 3VR1A 2AF6A 2LA4A 2E5LJ 5JS1A 2PDAA 2XTJP 4OGCA 2KM8B 1IR0A 4DX7A 2GGPB 1BHNA 3W8GA 2JVOA 2OTJS 1OVYA 2B56A 4OL8A 5AXKA 1NDCA 5A2QO 4FLTA 1N33J 3GLJA 2B0GA 3P96A 3ZETA 2XNRA 3J80Y 3N28A 3QJPA 2JNJA 2YQ1A 1Z6RA 3VQAA 4ZVHA 2KO1A 4KI6A 4LR7A 5HJYA 2GTDA 2W9CB 1QVGR 5DK5A 2HHVA 2P1JA 2YBVA 3DLRA 2V8GA 3HSDA 4EP4A 1DTQA 4M5NA 4M3WA 4OYOA 2UXCK 1LFWA 3PRVA 2VU5A 2PBDA 1FRLA 4NLOA 1M0SA 2RDJA 3E1YA 3IS9A 2HNYA 4EFHA 2HQGA 2B9YA 3PKYA 4NXMK 2PAVA 1QY7A 5KTQA 3HOTA 3MMAB 3AA8A 2IAJB 1YXQA 5LJWA 1U1RA 2WONA 3QIOA 4ZLJA 3HVWA 2QWPA 2BW2A 5EWGA 4B1VA 4LUBA 4DL6A 4M1KA 2FF6A 3VAIA 2PYJA 2HS3A 3BPDA 4CGIA 1UEVA 2BJ7A 4EFAC 1B9DA 3L7OA 3DOMA 4BRFA 2HBYB 3QEIA 5C2CA 3KKSA 1YJVA 5F0XA 1S0OA 3O9QA 1OVQA 1JNZB 5M2RA 2MQ8A 5L38A 1N5VA 2YI1A 4ELVA 2RF2A 2AJ2A 3SDEB 2BJ9A 3RZAA 3EL2A 4IRCA 1WC5A 3LTOA 2F40A 5A8RB 1WD6A 1RTHA 4GVMA 1XMQF 2O8CA 1SH3A 4CEFA 3UR3C 2M70A 2WFBA 2WONB 1Q7YO 1YI2N 1S6QB 2C3MA 4H4MB 3LDQA 3LO3A 2OH2A 1S1XA 3OHBA 1HNVB 3KHHA 2VJUA 1ZAVA 4DOZA 3JYTA 3QPIA 4A5AA 4YB6A 2QLXA 4PG8A 3C66A 1KOOA 1DFDA 2OMLA 2VDIA 4DUYK 2HVEA 1HYZA 1TU0B 1T11A 5H9FK 5CD4H 1EWRA 3CQ8A 1F60B 1OH8A 3ZETB 1YBAA 1RAJA 3W1YC 3D66A 2VASA 2HBZB 2RHQB 2G0JA 3QYYA 2R7TA 3THXB 3M9NB 1BU6O 4ZPBA 2J0WA 2ADCA 3AOCA 2PC6A 5C42A 3J81U 4JV0A 3VEVA 2G9OA 3L9ZA 5F1XA 2IYIA 2W40A 2UU9K 4CEEA 1M1HA 1KONA 4RUHA 3LP1A 3VGTA 4UY8T 3M8SA 4CZCA 2KVIA 4AM6A 4BG8A 5M1KA 2V4RA 1M5VC 4HEA9 2A41A 3LPUA 2FJVA 4F4XA 6FD1A 5E33A 3BR9A 1K0TA 1DZ5A 3R5AA 2NLXA 3I8DA 1YZ7A 3GIIA 1CC7A 2BOAA 5KOWA 4BRKA 2AX1A 3VQPA 4B9SA 4EMDA 5B08A 1FFWB 2GIRA 4Z2XA 4OKKA 2LXIA 2LCWA 4FPRA 5DDOC 2G8HA 2CZ9A 3WXMB 4P75A 2XSJA 1Q5YA 2YCHA 3EGZA 4C7QA 3AB2B 1QVFM 2MKYA 1YJ7A 1WELA 1JXBA 2W9AA 4HTJA 1RU1A 2ZEJA 3UKUA 4EHTA 4DV2F 2I5JB 1RWUA 3FVYA 4O4GA 5KFLA 4B3OB 4USJC 2IVPA 4W5RA 2XZTB 4ZIVA 2FIUA 4OX9F 3KWIA 2RNEA 1OPZA 3D7EO 2IRYA 5IWAJ 1LK7A 1QTNB 2FY1A 2YNFA 3S1TA 4DX8H 2XLIA 1WUUA 1Z26A 1NNDA 1RHJB 1UVKA 3GV7B 1KTVA 2A3ZA 2HHHK 3MCSA 5JJBA 2E1RA 3L8BA 1FVSA 4FM0A 2AJ4A 2VPXB 2PFDA 5HSPA 1X0FA 1RGIA 4H0VB 2BM1A 5IS2A 4ZVTB 4QIVA 4FF2A 4DZDA 5J2NA 2R42A 1XC9A 1EQMA 5DZ6A 1CSJA 3ZX3A 4YP3A 1Q79A 4LRCA 4WKYA 1QSLA 2YHBA 3MMVA 2FSJA 5ETRA 5LSRA 1ZH5A 5E41A 4URQU 4TVAB 2AYBA 3MEEA 2CQCA 1UVNA 1O6XA 4CJPA 3LDLA 4WFAQ 4JI4F 4U96A 2HMIA 1RDWX 2VFRA 3ADAC 1VDHA 3OUYB 2I8EA 4OJGA 1HR0K 2F1FA 1B3TA 3CFPA 4AM7A 2D7SA 4ES1A 3CIMA 2NUBA 3CJ3A 4CBWA 2QLBB 3HSGA 1W7AA 4LQ9A 4LFCJ 3SAHA 5IC6B 2X78A 2BMBA 1B7FA 2YKNB 4IO8A 3VWSA 3OQ2A 1F2GA 5T14A 3G9CA 2MKJA 4RCHA 4DR5F 1SI9A 4FK0A 3VZIA 4PYDA 1V3SA 1FKOA 2XYHB 1J6ZA 4L3KA 2MQNA 4X4TA 3CJSA 4CJ5A 1Q78A 1DEJA 1D3WA 4CO5A 3OSPA 1PBAA 1J5EJ 3AA5X 2B8PA 4CZLA 4ED8A 3AA2A 5KAKA 2E4LA 5AQTA 1TFWA 2P51A 5JVHQ 3TTCA 4CLLA 2L08A 1RT5A 4BS2A 3T6JA 4X65F 4CGHA 3MEDB 3G8QA 3RGIA 4CLYA 2CGJA 5AQVA 1WOSA 3SMZA 2NXUA 4IH7A 5KFJA 3FSYA 3UCGA 1S5ZA 1UP1A 4Q45A 2AKWB 2IHR1 4HDHA 4FWMA 1GLBG 2ZH5A 1MNEA 5ITHA 5FRMA 4LVNP 3BBBA 4JKGA 4XH5A 1KOHA 1WORA 2Y3YA 4IOCQ 2EEYA 4PRFA 4CIEA 3HVTB 1UCNA 4P6QA 1EX8A 1ZA2B 1VMBA 3I8BA 4KRFA 5D4PA 1CJUA 2B4VA 1BXNA 4NLYA 1IBLJ 1H6KX 4GV3A 3FJ2A 3OTBA 2QTDA 4ED5A 4WP8A 4ELUA 2YKMA 1JWWA 3U9DA 3EUNA 5GADI 3GYGA 5AXMA 3TEGA 4JI2J 1GLEG 1ZBSA 3NGKA 3TANA 4GW6A 3OBIA 3V9SA 4B3SJ 1NM2A 2IDOA 4JKEA 2ATLA 2YKQA 3CJAA 2W2NP 3GIJA 3GMGA 1DARA 3QIPA 4PXBA 3CCEN 1K8AT 2AGQA 1H38A 4HDGA 1OSCA 3WQPA 4FXDA 2RRNA 4LD0A 3VEOA 3NL0A 3H08A 4KC5A 3IR7B 1UW9A 2FPHX 2X1GA 3IR5B 5KFPA 1OH6A 1TL1A 5BYSA 5LJ3Y 1DTTB 2B9EA 3MPVA 4Z4FA 4K4XA 5KT2A 3PX0A 5EUHA 2V67A 1SUQA 3NNCA 5GAGP 1CQMA 2J5AA 3VHQA 3W9JA 4AQYK 1BQNA 3IAYA 1TQLA 4UY8O 3ZYYX 2ZZMA 2QEXN 3ZZOA 5AJ3J 1ZXOA 2XULA 1GOAA 3U1LA 3GONA 1TKZA 1NSQA 3CXCR 1XTZA 3HBTA 4EAHD 5DQHA 3W5ZA 2BH1A 2HHHF 4OV6A 5C0YA 2BKPA 3ULHA 2V7ZA 4WYLA 3LM2A 2JWNA 1RTHB 4O44B 3AVHA 4V19S 2HFNA 3LP0A 5AQXA 5BPNA 2ROEA 2EFGA 3DOKA 2FJBB 4KJIA 1Q18A 1YIJN 1LOUA 2X3GA 1GH8A 5THWA 4CZKA 3A5OC 4O3NA 4QYRA 2XMAA 1IJJA 2E8AA 4ZPDA 4FWRA 4LF6J 3PO5A 3LZIA 3ENOA 4NYNA 1X4DA 1VQ5S 3CJ2A 3V9UA 4J91A 2CPDA 2M8DB 5J1EA 2UYTA 3VGSA 3HZ6A 1K8KA 2O8FB 2DCUB 3NP5A 4KAIA 1PYOB 3T41A 1VSJA 1FJ7A 4DR7F 2LU2A 5KG7A 3PW2A 2LLZA 4BRPA 3C2PA 3D1HA 3S41A 2NSBA 3HHKA 2RMLA 1T3OA 4NO7A 4KHQA 1Y10A 3P1GA 3PYGA 3IR6B 5CE3A 4JI3K 3PEHA 3CCVN 4OYWA 2G8WA 4R5PB 3EE8A 1LW0A 3M8ZA 4DR1K 1VSEA 3NWRA 4TYAA 2X6SA 7AT1B 4TQSA 2CJKA 1TV6B 2KT3A 5CHCB 4TN2A 3AO3A 4L8RB 5SUHA 1RDUA 1N34F 4NEYA 1OY6A 1ZZNA 3V6JA 3C3LA 2CGKA 2VBYA 2NPIA 2BJDA 3WX8A 1VGYA 2UVWA 3R7NB 3LW5C 2CADA 1SJFA 4CJUA 5J1NA 1U24A 4J7CA 1S72N 4DUTA 4WIIA 5EDWA 1NGHA 1P8GA 2YJFA 4R8UA 1H7WA 3FBBA 5L1KA 4OI3A 2ASLA 4BC7A 1KR4A 5IM0B 2DIUA 5C24A 2HNDB 2BUPA 4C48A 5I3QA 5DM6Q 2HVIA 3PM9A 1E4GT 2IM0A 4CWBA 4F25A 4Y6IA 3VEZA 2GVZA 1C1AA 4ZCMA 3A3PB 5FPNA 1UOCA 1DRZA 5I42B 5C5JA 2KJWA 3KYLA 4QIFA 2IBKA 1T02A 2COLA 3CCTA 1T9WA 3GJTB 1IM6A 1SV5A 4YQWA 1LOTB 4MIBA 2VODA 2QA4S 4W5TA 1P1TA 3OXGA 4J9VA 1ATRA 3WQUA 3PIOQ 1ZPWX 2DB1A 2IPOB 3NF8A 4DPUA 4JI1K 3K58A 3FSIA 3ZFVA 2KW4A 3BGUA 4OHXA 3HF5A 4WQ4C 1HNXK 1WF1A 4ELTA 3AQPA 2CQ2A 3ID6A 3WXKA 2P9KB 1E6YA 4ZVGA 4DJBA 4DL2A 3D2FA 1I51B 1RBTA 2WOMB 1QLNA 1R7IA 4NA3A 2AIRB 4DZ6A 5KG2A 1T9UA 2A1RA 2RKIA 4TU9A 4KGXB 4DG1B 2V94A 3H7HB 4RWTA 4YOYA 2RRBA 5JUMA 2HVHA 3DGPA 2PA8D 5GVQA 3DDIA 3FC9A 3TRGA 2XY7A 4OX9K 3H5YA 2G1HA 1YSJA 1NDLA 1M5HA 1KAZA 3ISNC 4HYKA 1Q16B 4LFBJ 3OYFA 4FLXA 2DGTA 4GY2B 1IBLK 4A8OA 2MZQA 4KB7A 1UWBA 2NRVA 1RCOB 4ZP6A 4E1MA 3NF7A 5KPZA 3FK4A 1RAIB 4JI5K 2DGOA 1GXUA 2VGMA 3KLFA 2J7UA 2PFUA 2DTUA 1VAZA 1MA9B 4YDUA 3U7JA 2DFEA 1NJWA 3M05A 3DFEA 3F5TA 3OFFA 3GU0A 4TU7A 2XM3A 3G10A 2HLTA 1J5EK 3O80A 4CERA 4DV7J 4B3TK 5C10A 4MQ3A 3QGPA 4DQSA 4PAAA 5KFXA 2OLWA 2WW4A 4LRAA 4X84A 3HSTB 2J76E 3MEDA 4ZPVR 2AT1B 2P2CB 4JV1A 3EPIA 3FZKA 3FEZA 3AFGA 3KHYA 3I82A 4H5TA 2Q3PA 2WK4A 1RDDA 3EVMA 4MIWA 3MR6A 1I39A 1S99A 5AR0A 1N6QA 3NBPB 4RW8A 3HP6A 1VQNN 4NL5A 3QJLA 3AXMA 3BGOP 1VQ9S 4QPTA 1KQKA 2GWKA 2KU7A 4NA1A 3DGPB 2AP6A 3UVJB 3QT7A 2YV0X 1MN9A 1HWIA 2J9DE 4F3QA 3M6VA 3I31A 1VJQA 1TELA 4DN0A 5CZVA 3UCUP 3M8PB 4O8KA 3LP2A 1YKWA 4WFNQ 5GAGI 2W7PA 4K0KF 5KFOA 5F2RA 4CEAA 3R27A 1M1GA 3ZSVA 3ZSRA 4ZP7A 4JS5A 1X5TA 4L3NA 3Q8SB 3A8IA 5E2QA 4OZ3A 3OR2A 2XI2A 3ZCMA 2GZOA 3VQ6A 4FJLA 2BOPA 1NB7A 3H2VE 4X66F 1UW4A 2H9ZA 1HFEL 2JLEA 3PR4A 4OZNA 2EXUA 4AXIA 1T3NA 1R0BG 2QA2A 2QN6B 4F7VA 3ILLA 1Q82T 1FTRA 4JK9A 4BR5A 5FPEA 5ADZA 1V4TA 3OD2A 1RYRA 1IH7A 3UDEA 2FHOB 1T6CA 5KFKA 3D1OA 4M3XA 2KDOA 2BRLA 2XO7A 4AYBD 3MURP 3I96A 4K0KJ 4RNOA 3KLEA 1DQ9A 2Y8YA 3VQEA 1NRKA 2BZ2A 4B9MA 2HQ3A 1ZBFA 1U0HB 1JJ2R 1WHWA 4KKOA 3GSIA 4BRIA 4P10A 3PJWA 3GDQA 1N56A 3MXHP 1CZ9A 3W7BA 2DR9A 4M5DA 1HQEA 5KI6A 1NK4A 4KHWA 2XB2D 5F3ZA 3CT9A 3AODA 1Q8BA 1RWPB 4WXOA 2J9CA 3CJTA 3EVWA 3I5BA 4L76A 3AO5A 1XJWB 1N32K 4IJAA 2HRTA 2ACYA 4DV7K 2X3DA 2H3GX 2WVEA 3CPWR 2AJ1A 4L74A 5I42A 5KRTA 3IMXA 4OX6A 2VBZA 3FQLA 4CNYA 4Q7AA 4C0BA 3H2LA 1KQGB 4PKIA 2RQMA 4ZP8A 2DISA 4RR5A 4W90B 2DCLA 5DGBA 1WAFA 1YJ9N 4QR2A 1HJOA 3UD4P 2W2PP 1VBXA 5CZ1A 5FJ4A 2RQCA 4KGMA 1YX2A 4B3TF 3RB0A 4A61A 2QWMA 1BIZA 1T9XA 4CLPA 3NDKA 1WNSA 2CAJA 2Z1JA 4KBOA 5JLFA 1KHWA 3K2YA 3I0SB 2ITGA 2AZ3A 3LF0A 3DC2A 3K5PA 4OV1A 2Y1IA 5IV4A 2DJWA 5ETTA 4E7KA 1NXIA 2I1RA 4N5SA 1ZPVA 5JVHL 2D69A 3C6AA 1N5YB 4LSZB 3UO0A 3GSDA 3B6PA 2VICA 1R3NA 5HQMA 3H5UA 4OIXA 3RJMB 4ZHRA 5C2DA 1SJ3P 2QA4N 2HFZA 2QXLA 3RVCA 4OPJA 4I1TA 2CGLA 3CQYA 1TUWA 4CM0A 3BQ1A 5D4OA 2POKA 2DGSA 3JYTB 3OBYA 4YFUA 4DR5J 2BRKA 2GBZA 4XH4A 1IV0A 1CZAN 3THWB 2B7CB 1Q5VA 5DQGA 1K8KB 2FVPA 3GWCA 2O8FA 4HKQA 4QW8A 3TX0A 3CCMS 1NGDA 1HBUA 4FK2A 3HCXA 2DNGA 3SI8A 1RP5A 2IOCA 2JDJA 5LSOA 3D6HB 1A7GE 1MU2A 3C46A 2CH5A 2RB7A 4JLHA 1VIOA 5E26A 4Y3CA 1RHKB 1TL1B 1QDUB 2UVRA 4Y00A 2D0OA 2Y0SD 2ZJQQ 3A3NB 3BV8A 1ITPA 1HKGA 3ZZUA 3G96A 4TY8B 2K8GA 3KLHB 3PW5A 3QT6A 3SAFA 2E1YA 1TGOA 1T05A 3A3OB 2HHTA 2P5OA 5HATA 3J80O 2DYAA 1WF0A 4JUZA 1C0TB 4DTRA 5KPTA 2OIHA 3J8AA 2WAQD 1WHYA 4PWDB 4UQGA 4F2SA 4PXCA 3SJJA 3CERA 2DTJA 2Z57B 2DNQA 3CQXA 1A6LA 1Y9OA 4F9OA 4FYVB 2N7CA 2O8DA 2XEXA 3QESA 3CD0A 3TJAA 2YWGA 2R2SA 4BR2A 3KNAA 5HO4A 3O6WA 5KFIA 1VQOS 4NI2A 1DURA 2CJBA 1FNOA 2DXDA 2KHCA 2ZKUA 2A3JA 4YB5A 4FM2A 1N0VC 3I55N 1TKTA 3SFGA 1I3AA 5KG3A 3FBEA 1KS2A 4KH4A 2GX9A 3AVNA 2EKYA 2VHGA 4DTPA 2Q6CA 4EBEA 5KFRA 2EG1A 5AQSA 4IDKA 3IO1A 2C28A 4KGZB 2OO4A 3GG4A 2PMZD 1NLKL 2HNZA 2P9CA 4PY5A 2R7VA 2EFNA 3M5RA 1K1SA 4I6WA 3L4IA 2AJ0A 2QL5B 4JI7J 5HI7A 2JL9A 9RUBA 1NMDA 3CXCM 1S76D 3ZZTA 2V9WA 1U2VA 2ZOGA 4O3QA 4BREA 2KFYA 1FKOB 1RTIA 2PMHA 3HXMA 2OSQA 1RT1B 2JLFA 2ROPA 2LQJA 1WEZA 1CJUB 2ILZA 4CIGA 1S97A 3HVTA 3UR0A 2P9GA 5IT0A 4A8QA 1TUVA 1EO1A 4JKGB 1GLFO 2MSTA 4KRWA 1W2IA 4W92B 1FJEB 1HHQA 4FZZA 3VA3A 3DYAB 4ZCIA 1Q8IA 1RQ0A 2H4YB 4CI6A 2CPXA 3TA1A 5AQPA 4Q5VA 2IM3A 3NF9A 4C8KA 4WQ5A 3RBZA 3A8KA 2ZD1A 1I3OB 2RSQA 4ZS6A 1XNQF 1HQUB 4M3TA 2FBTA 1NGFA 3MCMA 3D28A 3TABA 1IKYA 2ZE2A 5HQLA 4ISGA 1U2RA 3VA0A 1QJHA 4IOAL 2FHJD 2LSNA 4B02A 3H45C 3A0IX 3QICA 2K7KA 1GOCA 1S0VA 5LOQA 3J81O 2R3VA 4MKVA 3P5TL 3K7RA 4OZ2A 1Q53A 3BYPA 1YG0A 1FXRA 4DBQA 2FJXA 1F1BB 1JLEA 3HHLD 1YRTA 4A46A 4WJBA 1PBUA 3DCAA 2MSSA 4XDCA 2Z1IA 2E44A 1NLVA 5HMWA 2C2KB 1TMMA 4ZJQA 1HNIA 4FK4A 1YJTA 2ZH7A 2CDQA 1E6YB 4K5SA 3OPKA 1FDDA 3SUPA 3R7SB 1C4AA 2EWSA 3AHPA 1X4AA 3S3MA 1Y3KA 5KQDA 4HUFA 2LVWA 2B43A 4DV6K 4DHYA 1KN6A 2LQBA 4B8CA 3T5KA 4KO0B 4MFBB 2YQ0A 4IQXA 1GOBA 4ITSA 5G0RA 3THYB 5DO2A 3I55S 4HH0A 3J7YU 3NCQA 2XSJB 1O8BA 3CJ9A 1ZBHA 2OPRA 3BEXA 2PE8A 4IO1A 1CULB 1VYAA 2UVVA 2DNOA 1QZ5A 2YHYA 1ZAWA 3DYAA 3NAIA 1GQEA 4LF7J 2HHSA 4DCOB 4FWPA 3NGUA 3L09A 1C1CA 4CLFA 4LSLA 1BMQB 1N36J 1RBRA 2HHXA 4TY9A 1X0PA 1KFSA 4WQ5C 3DLJA 2YNFB 4QS9A 4AL5A 1RGVA 1WF2A 3CVKA 3L3UA 3V5RA 3HJFA 2QA1A 4RW7B 1NO8A 4OZ0A 2QWQA 2OTLN 4YDDB 4AQYJ 1X7VA 4UTGA 3HPGA 2JEFA 3QT5A 4JKHA 3Q8UA 4JB8B 4MT1A 2XWYA 4E7IA 4CJ3A 4OZJA 5FPMA 3QBXA 2MB0B 2ZOMA 3DM2A 4LRBA 3QATA 4DMZA 2F9JA 3AH6A 4QOTA 3MM9B 2EX3A 2XCPA 2DRBA 2GAHC 2QMWA 1N0UA 1RAHB 1J53A 5JICA 1PILA 4DF8A 4QAGA 4NMXA 1HHTP 3OL7A 4LJMA 4FVUA 1OO0B 4LF8K 1T9TA 2WBMA 3NG8A 2GMHA 3DOLB 3V81B 4JV2A 4LF4J 3H8YA 2AMCB 1WG5A 3EJMA 2UXCF 2XI3A 4BVPA 4FKXA 3I56S 1KVAA 1APSA 3Q2SC 2RRAA 4CTAB 2Z2LA 2AWZA 2BVZA 5HP1A 2BJ8A 1WKJA 2WRMA 1URRA 3CCQS 3KUHA 3G71N 3SMSA 3VF6A 4FJGA 4QQBA 1N4LA 1SL2A 3LP1B 4Z4HA 3WBZA 4P74A 4GMJB 4BE1A 3TAFA 1RWWB 3UE2A 2EVZA 1SC3B 4KTQA 4Y34A 2CJ9A 4ILMA 5AQGA 1TMJA 3L4BC 3THXA 4OX7A 4N8NA 1MDUB 1T05B 4RNFA 4BACA 2YWEA 4QIWD 3EGVA 4Y1CA 4X4PA 2L9WA 1X4GA 5CYQB 3TTDA 4DR6K 3LGHA 4QWCA 4A8SA 2EC0A 4UZBA 1RBVA 2UXBF 5A2QU 5DMRA 3NRBA 1BHLA 3ZT1A 5ADXH 3AB4B 3C6TB 1NGBA 4J37A 2XCAA 5C25A 1NDKA 4JI0J 4LF6K 2ZZNA 4DR4F 1FW6A 1HI1A 3MN7A 2O66A 1JCEA 1GMWA 3KVGA 2LKZA 1XI1A 3H3NO 1KHVA 3U1NA 1NJXA 1WJ9A 3BBFA 2XBPA 1ATNA 4X4SA 4FS1A 3RR8A 1HKBA 4M95A 1OH5A 4QIGA 4F4KA 4DTSA 2FJWA 4NLCA 4ED0A 3M4XA 3C6TA 1R8HA 1RWMB 3VGVA 3OS2A 3T7ZA 1PCAA 1RT4B 2E5HA 1RUSA 1B70B 1IKVA 3MEKA 2QWNA 1N5YA 3ETOA 5H9EJ 3OXLA 2HWHA 5CCMA 1LWCB 4QYZJ 3PXGa 4X4UA 1BISA 1VRQC 4WFXA 3ZT3A 3I0SA 1BIUA 4CO3A 4CFDA 1OKJA 3ZO7A 3B8HA 5A0YB 3OYGA 4F3TA 3SBGA 4WFBL 2IC3B 2DH7A 2ZBQA 1KD1T 2VWJA 3HL8A 2M2BA 2RILA 1UPMB 2JRSA 4CZJA 3T1HF 3DI6B 1XR6A 4OFZA 2FVSA 4IRKA 4RW7A 4H4OB 5LY3A 4B08A 1QUVA 1PJ6A 2RPIA 2VG7B 3MMCA 3D6FB 4KPCA 5HL7Q 1C0MA 2H5JB 3TSPA 3P4IA 2F7VA 3NH1A 1KQSR 3M9MB 3HHLB 1BI4B 4JI3J 4F26A 5M2PA 2QE5A 3O1WA 1PC5A 1RZMA 2I0XA 3KUEA 3NKYA 2NXJA 3P5BP 2P9IA 1SB6A 3VGUA 4ECUA 3HPOA 2ZM6J 1HQEB 1AZSA 2NCKL 5BR8F 2ZBPA 2DNRA 4CK3A 3BY5A 3A12A 2NZTA 4ECVA 1F2HA 2B4JA 3SMPA 1N8RT 2HGLA 4G6VB 3ZTQA 1FD2A 4YDUC 4DV1F 5LMNF 4J2DA 4CESA 2WSFC 1MWQA 3IWXA 3G6ES 4DR3K 2NUHA 2F8SA 1JMTA 3MAAA 1RT2A 4EGLA 3AA9A 4CJEA 4FLWA 3OY9A 3EE9A 4E1NA 4KHSA 1CJKB 2QMXA 2P5VA 1JLGA 1Y97A 2DH8A 3D6TB 2HURA 3R5DA 1S72S 1CULA 1EQYA 3PNIA 2MQQA 3H90A 3CCJN 1NAQA 3HULA 4DR2J 1RTDB 4MFBA 2GHWA 3N4PA 1U48A 1C2PA 1YTUA 3NGTA 4U8YA 3AVIA 4BLGA 2IVOA 2DNLA 3KXDA 3VF4A 4JEPA 5A6PA 5CABA 1U26A 3SV3A 4DR3J 3NLCA 2Z2YB 3MAQA 3QRRA 4B3RK 4DSLA 3CO0P 5HMZA 2YX6A 3BZQA 2HF3A 3AD8C 3JSMB 3ATUA 4HL9A 3KTQA 1YITS 4CFBA 1IKWB 1VQMS 1S22A 3CYMA 3MWBA 5E84A 1TP7A 4E98A 3AY9A 3SK3A 5BYRA 1RHRB 3UVJA 4O3RA 3CJQA 4KH6A 4GKKJ 3IRXA 2OEKA 3JSBA 1JXEA 8RUCA 1U2CA 2MZJA 2VIHA 1ICEB 1GX5A 3ATVA 3G71S 1G15A 2NYHA 2ATQA 3TAPA 2FVRA 4H5NA 4DU1A 3RB4A 5LXYA 4DV0F 4WYBA 1QHAA 3R9PA 1IBKF 2HAFA 4X4VA 3LDPA 2ZQBA 3PSFA 4QS8A 1T0TV 4LSNB 2ASYA 1F3FA 4OYZA 5A76A 4P2XA 2IS3A 4CFAA 4K59A 1RNHA 1NPRA 3CFRA 1VQ4N 1HPMA 1BCOA 1BI4A 5J2PA 3TZXA 3HHLA 3QMQA 1NK6A 1MROB 3CD6N 3EM1A 4PCQA 2FZKB 1HWJA 2OJ3A 1M5SA 1JL1A 1KVIA 2G2OA 1ACMB 4WQ4A 3L2QA 1TUGB 1VQLS 3KG1A 2HW3A 3TWZA 4LT6A 1XWLA 1DY3A 4DX6A 5D77A 1GLDG 4PYAA 2YKOA 1W26A 1VSFA 4OJ3A 2QEXS 5DM7L 2G13A 4EU0A 3LALA 2ZUAA 3TUZC 1BQMA 2DGXA 1TR0A 2P5GA 1Q4RA 2M3DA 3EWGA 2IA6A 2O3DA 3HYFA 3JQJA 4F3MA 2QLWA 2IC3A 3E51A 1FO1A 4DR4J 4KB0A 2V2QA 1S4FA 2VBWA 3N6NA 4A59A 2VV5A 2VG6B 4CK2A 2B51A 4KYZA 2MLYA 5HVFA 3VVTA 5DDRC 2NRWA 5AQIA 4DFKA 2XMJA 3NS6A 4ISEA 2ASDA 3KJVA 2JEIA 3Q83A 3O1LA 1BL3A 1H74A 4JS4A 1E6VA 3PUFA 2HAIA 3H1QA 1VQ8N 2F3JA 2QSFA 2YJEA 2P9EA 1Y00A 1JL2A 4XPEA 1IKVB 1TKTB 1NG9A 2KB2A 4JHDB 1URNA 1FKPA 3S6EA 1RDCA 3B4MA 1RLDA 3OVAA 3V1OA 2R8IA 2P9KA 4AL6A 1K47A 3J7AN 2HIQA 4HHTA 3SLCA 3KK1A 2VZ9A 4ILJA 1KQFB 4IOAQ 3SCJE 3I32A 2O8DB 4B3SK 1HX1A 4LF9F 3HZGA 5KFWA 2WSEC 5A8WB 3NMUA 2CPIA 1FKAF 1X9SA 4B3MF 2J7WA 5D3GA 2V4JA 2CDRB 4CZEA 2NREA 3ITHA 1SV5B 4ZITA 5LM7E 3AJ2A 4QJVA 3JB9k 3MD1A 4L75A 2YXLA 2GA7A 3TAMA 3JXOA 2FC0A 2BJEA 1RCHA 3HHDA 3FZBA 4DV1K 5HROA 1U1QA 2DPNA 2HBQB 2IRXA 3MCAB 4I6MB 3IWNC 2FB0A 2QGFB 3MDFA 2EC2A 1V3RA 3ICLA 3TU5A 5HQ8A 2OPPB 3R8YA 4TKTA 5FLXU 1SIWB 1HNZK 4I2PB 2IVMA 2RHSB 1TL7A 4YDXA 1ZM4A 1N54B 1WI8A 1NEEA 4U9RA 3CF5L 4ECYA 4DTJA 3DLGB 3AT1B 3CGIA 1RA6A 4IH6A 2M9KA 2IIHA 5BJRA 3SQ4A 3K0SA 3QZ7A 4IOXA 2WVBA 3NFAA 2HHWA 2DY4A 3AO4A 4Y2MA 3C14A 3O08A 3O2IA 2B7BB 3I5CA 1RXOB 4F04B 2XMMA 3Q8VA 2MLXA 1N36F 4GC6A 1WWHA 2H54B 1NJIO 3OVBA 3MF5A 4FLZA 4QS7A 3FFKB 4AD6A 4DQ8A 4C1NI 3L7UA