1S1TA

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with uc-781
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
541
structure length
533
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 150
structure length 533
sequence length 541
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1tA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1tA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1tA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1tA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s1tA05
1Z26A 4TSXA 4O44B 4IQXA 2IM2A 3NH0A 4J9PA 2XGQA 3QIOA 1JLAB 1ASWA 1RDAA 2HHXA 3G6YA 5DQIA 3I5BA 1IKXA 2HVIA 3DOKA 1HMVA 4ZP6A 1SV5A 5C42B 3KJVA 3BREA 4ED7A 1SKSA 4DSLA 1RTHA 3H08A 4O3QA 4ZTFA 3OL7A 2YNGB 1L3UA 5J2NA 2KFNA 1XR6A 3RWUA 1YVFA 1KLMA 3M8SA 4RW7B 4O4RA 4F2SA 1RT7A 2ZE2A 1TV6A 4QWCA 1J53A 3AO3A 1S9GB 1HQUB 3V1RA 1Q9XA 2WONA 3NGZA 2ZD1B 3OHBA 3VQEA 4BACA 3RBDA 4PQUB 3LAMA 4DL2A 4FLVA 1JLEB 2AX0A 4CJQA 2FLPA 3MFIA 3NAEA 4TY9A 3KHLA 4DTOA 3MR5A 5C5JA 1WSJA 3LWMA 5KG7A 5KT7A 1CZBA 1ITGA 3LALA 4CERA 2EX3A 3OLAA 2IC3B 2XY7A 3G0ZA 3SJJA 1D9FA 5HRRA 1LAWA 4F4KA 3SI8A 4KFBA 3AVJA 4O5BA 4CF8A 4Q0BA 3VQ6A 2QK9A 4O4GA 4NLXA 1FKPB 2O4GA 2R8HA 1QS4A 1XC9A 5KT6A 3OS0A 2QE5A 4CFBA 2KZZA 5F8MA 3QEWA 4HCCA 1EKEA 3C6TA 2HMIA 4CEEA 1J5OB 4YMEA 1C6VA 4FM1A 3IAYA 2ZKUA 5KFVA 4ED0A 3JSMA 1S1WB 5F8JA 3IRXA 2FVCA 4DTSA 4MIBA 3KKSA 1BIZA 4W5TA 4N76A 4FJ9A 4JV0A 4JUZA 1L5UA 3T5LA 4M3XA 5L9XA 4IH7A 1NK5A 2UVRA 1NJZA 3BGRB 2ASLA 2R8GA 3OYAA 1IM4A 3DRRB 3CDEA 4WYWA 4NYZA 3ZSZA 5DG7A 4DL7A 3C94A 4IBNA 2C2DA 2RF2B 5HLFA 1DTQB 1S1UA 5F8LA 1N6QA 3VQPA 2UVVA 1MU2A 4E7KA 1W9HA 2FVRA 1JLBB 3ISND 2I5JA 3SQ0A 2G8VA 3UPFA 3QETA 2IJFA 5JUMA 1JLCB 2HNDA 2BE2B 3UR0A 4ED2A 4PA1A 5HRNA 4ZVGA 2PY5A 3I0RA 1HJRA 4IKFA 2XRIA 4KV8B 2BANA 2B6AB 1NKEA 3KLEB 1RDBA 4J9KA 3OYLA 4HKQA 1S48A 3CM5A 1KHWA 3HVAA 3MEGB 3HPOA 1LW2B 3ALYA 4ZHRB 4M3UA 1DLOB 2D5RA 2KQ2A 3CVKA 2R7YA 3ITHB 4IH5A 1VRUA 4AHTA 2BDPA 4EP5A 4B8CA 1VSFA 5DG8A 1D1UA 4FW2A 4CJEA 4TYBA 3QERA 2FLLA 2XHBA 3PW7A 4N47A 1KHVA 2AX1A 4WXWA 4J9SA 5EU7A 4M95A 3M8QA 3LP2A 4NYNA 1BI4B 2IAJA 3CWJA 4JRPA 2GC8A 3TWHA 1VSJA 3OL8A 1C0TA 4ZPCA 1WSHA 1K6YA 1QE1B 5HP1A 2BRLA 3RB4A 4ZPDA 4CHQA 5L1KA 4FK2A 3ZSYA 4KHMA 4NLGA 4AHCA 4ED8A 5F8NA 1JLGA 3WNEA 4L8RB 4NLDA 4DF4A 2A1RA 1CXQA 4R5PB 4HUGA 2YNHA 4CEOA 2IBKA 1BQNA 3ZT0A 3G6VA 1RNHA 3ZT2A 2WK4A 3BQ0A 3NH2A 4BDPA 3EPGA 4NLYA 2JGUA 1NK7A 1YT3A 2Z1JA 2FC0A 3V4IA 2JC1A 4B9LA 1JIHA 1KVAA 4CIFA 3ZT4A 3LAKA 2R2RA 3DLGA 4FLUA 4M3YA 4Q8EA 1N5YA 4CFAA 3KK2A 3NL0A 2CKWA 5KFSA 4QWDA 2W7PA 2YKNB 3DLEB 1EP4B 1HNVA 4CF0A 4FBUA 3MECB 1HQEB 2FBYA 2GUIA 1T3NA 5SWMA 3C6UB 4ZVFA 4F4XA 4NLOA 2Q3SA 3KLIB 1RT2A 1NJXA 3KHGA 4Y3CA 2C22A 4Q8FA 1FK9B 5KFGA 3PR5B 4O55A 5EDWA 1RYSA 4FCYA 5DLFA 2V9WA 4IKAA 3CQ8A 1TKZA 4QW9A 4KI6A 1ZTTA 2HNZA 4YR0A 4K4WA 1HPZA 5CYMB 3QESA 2IA6A 2E4LA 4ZVHA 4I7FA 4IFVB 5KFPA 4CCHA 4NLPA 5KG1A 1VK0A 5HROA 3VQDA 2OPRA 1TQLA 5J2QA 1BCOA 3QINA 3M9MB 4IG3A 4OGCA 4FJLA 4LQ3A 2DTUA 4LSLB 3K5NA 1VSHA 3PO4A 3EYZA 5KFRA 5E41A 1T03A 1RTDB 4CHPA 2FVSA 3M8PA 1JLFB 4KKOB 3KHRA 4KSEB 1IKYB 3RB3A 1GX5A 3S3MA 5DQHA 1UWBB 2IM0A 4RNHA 4W5OA 2ASJA 4M42A 4DTPA 4C8OA 4YQWA 1G15A 4MIAA 3OYFA 4IFYB 4CJTA 3F73A 4QWBA 1HYVA 4YR2A 1FKOB 3CJ2A 2XY8A 3D28A 2HHWA 3H59A 3CG7A 3IS9B 1FXXA 2FJXA 2ATLA 2HVHA 4H8KA 3HL8A 2QKKA 3QIDA 3LDSA 1ZBIA 4DTUA 3TQ1A 3V1QA 1DTTA 3DRPA 3HM9A 3RTVA 3I0SA 1SKRA 4MK8A 3AVCA 5HRSA 1RCHA 3HP6A 2B5JA 1RT6A 1IH7A 4CIEA 1SKWA 5CZ2A 4DQRA 1U47A 3HPHA 2P51A 1TL1A 5CYQB 2IM3A 1S1TA 4FJ7A 4AHRA 3KTQA 4ZPAA 4KB1A 1RT5B 2ALZA 2ETJA 1BQMB 4FJJA 4C8KA 4W5QA 2V4RA 3PR4A 3TAQA 1X9WA 3ISNC 3SNNA 1K1QA 3QLHB 3DYAA 2JEGA 3H2LA 3H5UA 1CXUA 3KLFA 2D41A 4WE1B 3DLBA 5KG5A 2OPPB 1S0OA 3K2PA 1KLNA 3KMSA 4FJXA 1KCFA 4FYDA 1HARA 3IG1B 1NJWA 2UVUA 4RW9B 4CEFA 3T5HA 2ASDA 3QEVA 3LWLA 3KD1E 4C8MA 1ZBFA 3NF8A 1RA7A 4FZYA 2PZSA 3GIMA 2OZSA 2LSNA 4ECWA 1R0AB 4R8UA 3V6KA 1EX4A 3OYDA 4Y1DA 2ILZA 3OL9A 1C1CB 4TY8A 4CGFA 1S6QA 3HVTA 3FFIA 2ATQA 1ZYQA 4U6PA 4LY7A 1UOCA 3T5KA 1C0UA 1JKHA 3K5MA 4LD0A 3TVKA 2AGPA 1S6PB 1QAJA 1RILA 3HT3A 3OYGA 4DS4A 2BQUA 1VSLA 2YNIB 3ASMA 4PWDA 1NNDA 5KFUA 3RAXA 3MR3A 1LWEA 5I42B 1TK8A 1BGXT 4G3IA 3KLHB 4F4WA 4NLTA 3PJXA 4EZ6A 4HCBA 4PUOB 2VG7A 4TYAA 3AVNA 4M41A 3HXMA 2HHQA 2XCAA 4ECVA 1U04A 4RU9A 2UVWA 3AA4A 4ECRA 3VA3A 1Z4UA 3K57A 4E7LA 1RT1A 1WSGA 2B4JA 3EPIA 1LW0A 3RRGA 5FDLA 3KLGB 4ELTA 4BE1A 4GC7A 1WLJA 3NH1A 1SV5B 4TQRA 4IG0B 2XWYA 4FLWA 1TKXB 4JV1A 2YKMA 3MEDB 4ICLA 2PYJA 4GVMA 2W9CB 1GOCA 3AV9A 4KHSA 1EXQA 1XHXA 2FJWA 4BWJA 5FRMA 1S9EA 1QHTA 4FJNA 1REVB 1SH2A 4OPJA 2ZE2B 3OS1A 3IN5A 2RKIB 2IS3A 3V6HA 4CFCA 4WFXA 4B3OA 3EZ5A 5J2PA 5J2MB 4OLAA 3QEXA 2VG5B 1S1XA 3NF9A 1X9SA 1ZETA 3E01A 3IGNA 5JXSA 4UQGA 4O44A 4NLQA 2JEFA 2D0CA 1RT4B 5KFOA 5I3UA 3PUFA 2I1RA 1JLAA 2GV9A 4QW8A 2F8EX 4IRCA 3TABA 3NMAA 5D3GB 1QSSA 4E7IA 2W42A 2V0NA 3S3OA 1S0NA 3EY1A 4PY5A 4E3SA 3V81B 1LV5A 1I39A 2YNGA 2D0BA 4LH5A 3THVA 3NGDA 2PYLA 4Z4CA 4KFBB 4DSKA 3P5JA 4OKJA 3OVNA 1JXEA 3HYFA 4Q0BB 4OL8A 1A5VA 3QNOA 4URGA 4K4VA 3G6XA 1LWCB 4RW7A 3AVGA 5JS2A 2RPIA 4B9VA 3T5JA 1QSYA 3DI6B 1S9GA 2BR0A 1HQUA 4CHYA 3JSMB 4I9LA 1NK4A 3TAMB 4J9NA 4DFMA 4E89A 3IRXB 4G1QB 3ULDA 4H4OB 4AH9A 1TKTB 3DLHA 3MXIA 3P1GA 1LWFA 1U45A 3Q8RB 1JLEA 3VQBA 4I2QB 2R8KA 3V6DB 2E9TA 2R2UA 1RTIB 3VN5A 3KK1B 2J6SA 3SUQA 1W25A 2V4QA 2CJQA 4NRTA 4NCGB 5KFLA 3DOLB 4Z4EA 4CGDA 1LAVA 4CJRA 4M3TA 4DL3A 4DFKA 1SL2A 4B9NA 1VRTB 3SQ2A 3NDKA 3QYYA 1FKPA 3OL6A 1XI1A 4OLBA 3HJFA 4O3RA 3GIJA 1T05B 3I0RB 3GV7B 1OS5A 1J5OA 3SQ1A 5C25B 1T94A 4QPXA 4M3ZA 3O4NA 4KHQA 4FJKA 1S1WA 5KG3A 4DEZA 4B08A 4K4ZA 1XWLA 3MF5A 2Y1IA 1TGOA 3WNHA 5KFZA 4EYHB 3BGRA 3NE6A 3Q8QB 1KFSA 4IH6A 4AHSA 3CJ5A 1XR5A 4CJ3A 3UIQA 1IG9A 1NK8A 4K4SA 4GMJB 3KOAA 4RUAA 5L1JA 1RTJB 3OYMA 3WNGA 2WB4A 3LPTA 3ZCMA 4KBIA 1KVCA 3M8QB 1HNIB 4ZP9A 2IAJB 3CIZA 2G8UA 2FVQA 4RNMA 4CGIA 2YHBA 2IDOA 1JLCA 1C0TB 4O0JA 2BE2A 2HAIA 4WXOA 2VA3A 5HP1B 3L3UA 3BQ1A 1U49A 2BRKA 2D3UA 3OYCA 4OKEA 2B6AA 2F8TA 4MFBB 3KLEA 2AGQA 4HHTA 4YNQA 4IRKA 1RT3B 4Z4HA 3MEGA 4WYLA 4KB0A 1EETB 1LW2A 3MXJA 4ZHRA 1DLOA 2RDIA 1J9AA 1N56A 4NLWA 4FBTA 1WSIA 3HO1A 4DU1A 3K58A 3ITHA 2W9BB 5C24B 1RBVA 4YFUA 4BDYA 3BSCA 2R8JA 3M9NB 4CJUA 3KD5E 3LP1B 3TAFA 1N5YB 4ID5B 4DQPA 4LSNB 1BI4A 2R2TA 1XR7A 3L2VA 3PJWA 1IKWB 2G8KA 1HNVB 1TKDA 3VQQA 4W5NA 1S49A 1RT2B 3RRHA 4IDKB 5KTQA 1QE1A 4DL4A 5KG6A 3HPGA 4RW4B 5HRPA 4EO8A 4CE9A 2WRMA 3U3YA 2DFHA 3TAEA 2C2RA 4RW6B 5KG2A 4K8ZA 2QV6A 2J6TA 3NKYA 1WSEA 4J2EA 4ZP8A 4CGGA 4M94A 1HPZB 2OPSB 4J2DA 4KO0B 4IRDA 4I2PB 3TAPA 4CHNA 2AU0A 1QAIA 3PW5A 3QO9B 1BIUA 1L3TA 3RMBA 3KK3B 4FJ5A 1WN7A 2AQ4A 3VA0A 2BQRA 4KTQA 1C1BB 2B43A 2HNYB 4CIGA 3WNFA 4FJ8A 4NCBA 4FM2A 3GYNA 3H5YA 4DL5A 3PVXA 4K4UA 2KZMA 1QTMA 2YKNA 3DLEA 1EP4A 3AVIA 1BCMA 3GV5B 1HQEA 2C28A 3C6UA 3FQKA 3KLIA 1WNSA 2RN2A 2IM1A 3E51A 4ZMMA 4KHRA 1CZ9A 2AGOA 3V9WA 1Z25A 4H4MB 3JYTB 3DRSA 3I5CA 5KI6A 4EYIB 1IKVB 3O3GA 1HYSB 4Z4IA 5K14A 1L3VA 1SUQB 3CJ4A 3PW2A 4O3NA 4KRFA 5CYMA 4DSJA 3AO5A 3EZUA 3DMJB 1A5XA 3DDKA 1NOYA 2DPJA 3T1AA 4RW8A 5KFAA 4AILC 3RB0A 3F9KA 1DTTB 1TVRB 3I0SB 2P1JA 4DSEA 3QIPB 4N56A 1TAUA 3MR2A 3LPUA 4LSLA 4GW6A 4Z0UA 3NF6A 2JC0A 5KFHA 2IGIA 4GC6A 1RTDA 1TL1B 3NBPB 1YTUA 1JLFA 4KKOA 3Q8PB 1IKYA 1S5JA 2DFEA 3SYZA 4FM0A 1S10A 2G8FA 3DM2B 1UWBA 1TL3B 3BSAA 3GV8B 2FBVA 4E1MA 5KFFA 2FBXA 1QSLA 3CDUA 4Y1CA 3P83D 3U6FA 4IFYA 2YNFA 3KLFB 4N5SA 1FKOA 1C1AA 3LP0B 3S3NA 4E7HA 4DFPA 3AA2A 4CEZA 5T14A 4ECUA 4QOZB 3O4QA 1B9DA 3DLKB 4F2RA 4IOBA 2G8IA 2WOMB 3KMQA 1U4BA 1KVBA 4E19A 2ZQBA 5KFJA 4DTXA 5CYQA 2Z1HA 5F8IA 5KFBA 1RBSA 3H98A 3V9UA 3CO9A 3AO1A 3PW4A 3AA3A 1BQMA 3QGIA 5KT3A 3L8BA 3G10A 1F21A 1JLQA 3LANA 4CJLA 5HBMA 4CJKA 4IR9A 4ECXA 4CF9A 4DG1B 2YHAA 5KRSA 4WE1A 4N41A 4DU3A 1S1VB 3PV8A 4CF2A 2OPPA 3NAHA 1BHLA 4CJFA 3ZSQA 3Q8SB 5DQGA 3IG1A 1O1WA 3T19A 3V6JA 3SUPA 4RW9A 4CK1A 2F8SA 2BQ3A 4FXDA 2D3ZA 2C2EA 3AA5X 3VQCA 2JLEA 5FRNA 1RT1B 3SQ4A 3V9ZA 2OPQB 1HYZA 3SPYA 5J1EB 3VQ5A 4CJ4A 3NGIA 1R0AA 5FDLB 4KB7A 4MK9A 4E7JA 5KFEA 5KFCA 1QQCA 2DPIA 3MEEB 4HUFA 1C1CA 1NKCA 4CECA 3PW0A 3SCXA 3N6LA 1J54A 3SV3A 1X9MA 4F3TA 4ZTJA 4WZMA 2A1SA 1S9FA 3HSTB 3I8DA 2YKMB 3L2WA 4KTZA 1C0MA 3ZSOA 4CGHA 1S97A 1GOBA 2X74A 1S6PA 4F4ZA 1TK0A 2ILYA 1RDRA 1IKXB 2VG6A 3AVHA 3DOKB 1HMVB 4NRUA 3KJVB 2YNIA 3QGHA 1RTHB 4EO6A 3B6OA 3ZSVA 4MQ3A 3TAGA 5I42A 5J2NB 3SPZA 4KPYA 1NOZA 3KLHA 4DLGA 5J2PB 4PUOA 1KLMB 3GIKA 2E6LA 4Y2CA 4RG8A 1RT7B 4FLZA 2F96A 2IOCA 1W0HA 1TV6B 3SUOA 1A5WA 3PX4A 5I3UB 4H54A 2VWJA 4OVLA 4Z4FA 3QEPA 3KLGA 4B8AB 3FRZA 5F8HA 4MH8A 2WONB 3PHEA 3OJSA 3DLRA 3OYIA 5KT4A 4IG0A 3QGGA 3H5XA 1TKXA 3HVWA 4CGJA 3MEDA 4MK7A 2VA2A 4NLRA 2W9CA 4R0EA 3H4BA 1SH3A 1VSKA 4E0DA 2R8IA 5C42A 2P5OA 1REVA 4MKAA 2GIQA 2O5DA 5EUHA 3K59A 2GBZA 2RKIA 4QWAA 4DU4A 5T7BA 4JS5A 3ZSXA 1IO2A 5J2MA 4O4GB 2VG5A 4DSIA 4C8NA 1T7PA 3C6TB 2HMIB 1JL2A 1LWFB 4KTWA 5KG0A 1RT4A 3BSOA 3NHGA 4J9OA 4QWEA 3OYEA 3VQ4A 1SL0A 1C2PA 4EP4A 4KE5A 1B92A 2ZD1A 1D9DA 5D3GA 4PQUA 3QZ7A 4M45A 4AHVA 4CESA 3V81A 1TAQA 4JV2A 4OPKA 4W5RA 3ICLA 4FLYA 3FDSA 1RBTA 2DY4A 1KSPA 1LWCA 5HLFB 2QKBA 4HUEA 3L2UA 3GILA 4NZ0A 1S1UB 2IC3A 5KFTA 4Z4GA 2O4IA 1N6QB 4Y2AA 4J2AA 4DSFA 3UDLA 1S0MA 3PX6A 4U7CA 3VQ9A 1MU2B 3DI6A 2HHVA 3S9HA 3TR8A 4M3RA 2P5GA 3D0PA 2Z1GA 2EC0A 3ZT3A 4OGEA 2I5JB 1UAXA 3TAMA 4G1QA 4H4OA 4AHUA 1TKTA 2HNDB 3BSNA 4B9TA 4DFJA 2HWIA 4HTUA 3BDPA 4I9QA 2BANB 1N48A 1S4FA 4I2QA 3V6DA 4O3SA 1CSJA 3M9OB 2E9RX 4CHZA 4DTNA 3L3VA 3KNAA 1RTIA 3RR8A 3KK1A 1N4LA 3GIIA 2X6SA 1Q8IA 3SV4A 5KFDA 2KFZA 4NCGA 3DOLA 4ED1A 4CJ5A 5SZTA 4X2BA 4DQQA 2XGPA 3VQAA 2FBTA 3PY8A 2XC9A 4K4TA 4RNNA 1VRTA 1VRUB 3DRRA 4M3WA 1JX4A 3HHKA 4KAIA 1JXLA 2RF2A 1DTQA 3VQSA 3AVKA 1NK6A 2DFFA 2XY5A 1T05A 3V9XA 2Z1IA 4B9SA 1NK0A 1YVUA 3AO4A 5C25A 3CM6A 3LP2B 1RBRA 4FJMA 1RBUA 1Q9YA 3SFUA 1JLBA 4J9LA 4FZZA 1WAJA 5KT2A 3NAIA 4ID1A 4TN2A 2X78A 3H5SA 4FJGA 3SFGA 1ZBLA 4KV8A 4RUCA 5KFNA 2OH2A 3OHAA 3C95A 4CF1A 3O3FA 2W7OA 2IMWP 3ZSRA 4ECTA 3ZSWA 3NCIA 1QUVA 5JS1A 4QAGA 4IR1A 3UQSA 1L3SA 1JLGB 4BE2A 2YNHB 1BQNB 3SUNA 4NLVA 4J2BA 1RTJA 3CFRA 2J6UA 1UA1A 4DQIA 4WFZA 2WHOA 1WNEA 3H4DA 2EHGA 3AVBA 1HNIA 3OYNA 3GQCA 3V4IB 3TARA 5F8GA 4Q44A 3OY9A 2XO7A 3DLGB 4YR3A 1ZBUA 3OLBA 4EEYA 3RMDA 4J9MA 3KK2B 4KI4A 4KHYA 3K5OA 2HWHA 3CFPA 4MFBA 4Q5VA 1RDDA 1D5AA 1RT3A 3HVRA 2E6MA 1I3AA 3BJYA 4CHOA 3RMAA 4ECQA 1EETA 4DS5A 4CJVA 1VSMA 2HHSA 3MR6A 3CYMA 4KHNA 2R2SA 3CJ3A 3NGYA 5DGBA 4JLHA 4ZPBA 3N6MA 1I6JA 5EWEA 5KFQA 3OYHA 2W9BA 5C24A 2XI2A 3N6NA 4FZXC 1TKZB 4R5PA 3L2QA 4O0IA 1RDCA 2HNZB 4Q43A 4CJSA 3MAQA 2YV0X 3OSPA 3OYBA 3LP1A 5F9LA 2KW4A 3H40A 4K4XA 2KTQA 4O3OA 5EWGA 4ID5A 4ED6A 1CLQA 4I7FB 4LSNA 4CEBA 1UA0A 1IKWA 5HROB 3I5AA 4DMNA 4ECYA 2OPRB 1TK5A 4MKBA 5J2QB 3AVFA 5KFWA 4EBEA 4IG3B 3PZPA 3D45A 2D7SA 4IDKA 2OA8A 4RW4A 4DWIA 5CZ1A 2XCPA 1GX6A 2D0AA 1VSEA 4OKKA 2HW3A 3DRSB 2Y1JA 3LZIA 4RW6A 2XI3A 1RA6A 1T03B 2W8LA 4K8XA 4BE0A 3M8PB 2NUBA 3MECA 2XY6A 5K14B 3KHHA 3QZ8A 4CJWA 2OPSA 4Y34A 1FK9A 3RMCA 3LP3A 4TXSA 4KO0A 3K5LA 1XHZA 2JEJA 4URQU 4RW8B 3QNNA 4I2PA 4DF8A 1B9FA 3QO9A 4CK3A 3AVLA 4DLEA 2AWZA 2FVPA 3KK3A 3SZ2A 2IJNA 4BWMA 2FJVA 3HKWA 1C1BA 2OZMA 4FK4A 2HNYA 3AVAA 4EBCA 5DG9A 4IFVA 4B9MA 4LH4A 3VQ8A 4FS2A 2VWKA 5KGWA 4XPEA 4ZVEA 4WZQA 4FLXA 1U09A 4FJHA 4F3OA 5DLGA 1NHVA 4F8RA 3DRPB 2E9ZA 5KFXA 4TQSA 4K50A 1D0EA 4NLUA 4CK2A 4BDZA 1VSIA 2QXFA 3BQ2A 4NCAA 2B5JB 1RT6B 1ZTWA 5DGAA 4E1NA 1SL1A 1JXBA 4H4MA 3JYTA 2G8WA 1IKVA 4NLSA 1HYSA 3A2FA 2YNFB 1S1TB 3G86A 1ASVA 3V9SA 1SUQA 4J9RA 4CEDA 2G8HA 4QCLA 1WAFA 1KFDA 4KREA 3DMJA 4JRQA 4DTRA 2UUWA 3NFAA 3TI0A 4EBDA 3DYAB 2W8KA 3TANA 2WTFA 4HYKA 1TVRA 1Y97A 4K4YA 4YP3A 3KIOA 4FLTA 3M8RA 4FK0A 3QIPA 2FLNA 4Q45A 1X1PA 3O3HA 3IS9A 3QEIA 1ASUA 4ELUA 3KLVA 4RNOA 3NBPA 4ECZA 2ITGA 1VSDA 4CJPA 4DTJA 2HHUA 1SH0A 3BR9A 5KFKA 3DM2A 1RAJA 3RR7A 2WCXA 1TL3A 3MTKA 3B6PA 4R8UB 4CEAA 3L2RA 4F50A 4FVMA 4RZRA 3MFHA 3D5MA 5KRTA 1JLQB 3OSNA 4F4YA 4TY8B 3VQ7A 1S6QB 3HVTB 5HBMB 4ED3A 4CEQA 1K1SA 5EWFA 3FFIB 3FSIA 5KGXA 2HB5A 3KKRA 4EZ9A 2JEIA 5DMRA 4ZP7A 3RBEA 1C0UB 1JKHB 1MMLA 3CDWA 4HVJA 4ELVA 1RT5A 3IGVA 3RAQA 3LP0A 4WFYA 1BL3A 5KFMA 4NYFA 3U3GA 5L1LA 1GOAA 4XPCA 3T3FA 3QLHA 4PWDB 3DLKA 1LWEB 1KRPA 3HK2A 4DTMA 1D8YA 4OJRA 3OJUA 1NK9A 3LZJA 2WOMA 2HHTA 4J9QA 4XO0A 2AJQA 2VG7B 3CJ0A 1TP7A 4DQSA 2X6NA 3OYKA 3RB6A 2UUTA 3AVMA 4FS1A 3AO2A 3FQLA 1LW0B 3NF7A 4FW1A 3ZT1A 4XIUA 4LQ9A 1YTAA 5KFIA 3SI6A 3PO5A 5KT5A 2VG6B 1RYRA 2RDJA 3V1OA 1NHUA 1HRHA 4DL6A 5KFYA 4O3PA 3OS2A 4C8LA 4FJIA 1NKBA 4DG1A 5FROA 1NJYA 4KAZA 4ICLB 5L1IA 1S1VA 3OYJA 4CFDA 2GIRA 5F9NA 1WSFA 2BGGA 4KHUA 5CY4A 5KG4A 4B9UA 1U48A 1S9EB 1JL1A 3PX0A 4TLRA 1T8EA 2OPQA 3CFOA 5J1EA 5DK5A 1ZBHA 4B3OB 4RNFA 1KTQA 3HP9A 1BISA 3MXMA 4JS4A 1S1XB 3MEEA 4KHWA 2OYQA 3E01B 4URSA 2W9AA 4ECSA
chains in the Genus database with same CATH superfamily
1HR0J 1X4BA 2D1CA 4IQXA 1C0GA 2VCPA 2MLYA 4FPBA 3QIOA 1RDAA 4Y28C 3G6YA 4QR2A 5DQIA 3I5BA 1IKXA 2CJYB 1NLKL 3DOKA 2HBQB 5C42B 3KJVA 1SKSA 4DSLA 4QIFA 2D9PA 1PO6A 3H08A 4O3QA 1L3UA 5J2NA 2PMHA 3M8YA 4A48A 4A2AA 4BVPA 2CWKA 3VAIA 4F2SA 3O5TB 2HAFA 1CJTA 1J53A 3AO3A 1ZM2A 3IWNC 1HQUB 2FSNA 2BW2A 3OTOK 2WONA 3I32A 4OJHA 5A6WA 3NAEA 3KHLA 3W62A 1N8RT 2AEFA 3A8YA 3LWMA 1W2IA 4YB7A 2W4CA 2MKHA 1FNOA 4USKA 2XLIA 1ITGA 4CERA 2DR8A 4M5KA 3LF0A 1RWOB 4PKGA 2IC3B 2XY7A 1DQ8A 2CQ3A 5FPEA 4BRMA 1M90T 5HRRA 3SI8A 1P6TA 3AVJA 2Z4PA 3VQ6A 4PXEA 1VC6A 3ZXWA 1XC9A 4FKXA 3GDQA 5KT6A 5CZXA 4CFBA 1Q5VA 3CJ7A 3WHIA 3R8YA 2VJUA 1QQOA 2OGUA 3C6TA 1EKEA 3A8KA 4CEEA 3THTA 3M2VA 4NWBA 2DB1A 3BGFA 2HVDA 4ED0A 3NOCA 3D54A 4NMXA 4JI2J 3MM7A 3IRXA 5K20B 1H0HB 2RJZA 1N36J 1BIZA 4W5TA 4FJ9A 3OVBA 4ILLA 2R7TA 2LDIA 4JUZA 3PXGa 4JI0J 4BR4A 2V52B 4PXBA 2UVRA 5ETQA 2XB2D 1YJNS 2GTDA 1VHIA 1IM4A 1D3WA 1SC4B 5C2DA 3SBGA 4IBNA 3IR5B 3T9NA 3CC4S 2AKWB 3VQPA 4DV7F 3ISND 4WCEQ 2G8VA 3SQ0A 1ZM9A 3UPFA 3H6EA 1Y0HA 4ZVGA 3THYA 3I0RA 4ZITA 4JKEA 2XRIA 1U6ZA 5BR8K 1WF1A 2B6AB 2KG0A 4EFAC 1RDBA 4JKDA 5AE3A 2FIUA 1FRKA 1HNZJ 3OTBA 2FHJD 3HM8A 2EFQA 4USIA 5AQLA 4X64K 2C3YA 2J0XA 5GADP 2D5RA 1GTEA 1U6BA 3OUYB 3UD3P 1N33J 4JKFA 5L38A 1NGCA 2BACA 2CG8A 2KHCA 4IH5A 5EY4A 1Y5IB 4BGBA 3MURP 1T02A 4EP5A 1VSFA 3I82A 4TYBA 2XHBA 1JMTA 4OYBA 3HI0A 4JYAJ 1Y00A 3CJ1A 3ENWA 3M8QA 2R9LA 5EOYA 4YB6A 2IAJA 3HD1A 4CQ1A 4CTAA 1VSJA 2B56A 2FZKB 3OL8A 1PCAA 1HNWK 5HP1A 4ZPDA 4DPOA 4CHQA 5L1KA 4U67Q 1KDNA 4KHMA 3RBZA 2MQPA 4ED8A 3S8SA 2YNHA 4CEOA 3OW2R 1T3VA 2GMHA 3ZT0A 1VJWA 2FF3B 3G6VA 2WK4A 4LF4K 3DGVA 4NLYA 2JGUA 1NK7A 1YT3A 5ETPA 3V4IA 2FC0A 3DLLQ 1JIHA 2N7CA 5BRHA 3Q22A 4M3YA 2UUBJ 2DGUA 4Q8EA 1N5YA 4PR6A 2OSRA 1JXVA 3OFFA 4QWDA 2W7PA 1RHUB 1EP4B 1HNVA 1HQEB 4OZLA 1GMWD 3E9LA 5LXYA 1NJXA 5KFGA 3VALA 4NI2A 4DUYF 2VFUA 3B4MA 1RYSA 4H5VA 4QW9A 3VAMA 4KI6A 4HLBA 5ETLA 2EC2A 3M1VA 2L08A 2Q1LA 1WUAA 2P9SA 1HPZA 5CYMB 1NRKA 3LA0A 4OPAA 4ZDNA 2ZVSA 5KFPA 3R27A 1M1KO 5HROA 3B6BA 3VQDA 2OPRA 1PGZA 4AXJA 5J2QA 3PACA 2NREA 4OGCA 2NUUG 3R97A 1EQYA 5KOWA 4FYYB 2VQFJ 4LQ3A 3CNQP 3BH7B 2CVEA 1Y3JA 3AD8C 1T03A 3DCAA 4LREA 1D9AA 4JK8A 2FVSA 3M8PA 2NPFA 1S76D 3DAWA 4KH1B 1K8AT 3O8MA 1HPMA 1T9XA 1GXTA 3MWBA 4OYIA 1E4GT 4LF7J 2X3DA 1G15A 1CULA 3OYFA 4IFYB 1S12A 1WB9A 2ZOFA 2HZAA 2XBPA 1FKOB 1Y5LB 3CJRA 3AY0A 2HHWA 1GLLO 6AT1B 3EGWB 3MK6A 2HVHA 2CZ9A 2MGZA 1YLXA 4A5BA 2CH5A 3DJCA 3RTVA 3I0SA 3QMLA 1TZ0A 3AVCA 3CHWA 1CQNA 4X4PA 1SKWA 5GAGI 2D3OR 2DCLA 3ZETB 4DQRA 5BR8F 2P51A 2FHMA 5DETA 2OEKA 4FJ7A 4AHRA 4ZPAA 2D74B 1IR2A 3GB0A 2ALZA 2ETJA 1BQMB 4IO9L 4ISGA 8AT1B 4C8KA 1R6YA 4W5QA 4X64F 3BEGB 1X5SA 1K1QA 1X5PA 4ED4A 4FWLA 3QT6A 3QLHB 2JEGA 3H2LA 3TA2A 4DL0C 3MCSA 4PL7A 1FWKA 3A5MC 1S0OA 2NXNA 3MPUB 3IG1B 2OFGX 1VQ4S 4YDUC 3UNYA 4CLYA 1URRA 1CLFA 3CCQN 4GO5X 3HFKA 4OV1A 3NS7B 1U1KA 2Z56B 1T3OA 2F9DA 4FWQA 3GIMA 1NXIA 1Q18A 2H4WB 4R8UA 3JQJA 3IUCA 3OYDA 2XS5A 1HNWF 1C1CB 5B0FA 3HVTA 1UVJA 3SK3A 1ZYQA 4U6PA 1NBWA 5AQSA 4LD0A 3ZFVA 1QAJA 1XNRF 2LXUA 2MHEA 2HFNA 4DS4A 2BQUA 3SCIE 4LF4F 9RUBA 2YNIB 3O1LA 4PWDA 2P9NA 1H74A 5D0RA 4G3IA 3KLHB 3CULA 3D68A 4EZ6A 2F5GA 3MMVA 5DDPC 4PUOB 3GG4A 1HR0K 4ECVA 1S59A 2CZ4A 2UVWA 3AA4A 1NSAA 3VA3A 1Z4UA 3TA0A 1NNEA 3BF3A 3R3TA 3KKFA 1WSGA 2HIYA 3RRGA 3GSIA 3BZQA 1KOOA 2Z57B 2XNQA 1X3MA 3J80U 4KQZA 4GC7A 2PBDA 1WLJA 1MROB 5AFUA 3NH1A 4NA1A 5KPRA 3RW7A 1FJEB 4DR2J 4FLWA 3AGRA 3Q24A 4EGLA 2W9CB 1GOCA 4BRFA 3NEKA 4USTA 1EXQA 2PAVA 1XHXA 2FJWA 2X1FA 3C14A 3D7EO 1QHTA 2NYIA 4FJNA 4OPJA 2CQPA 4OQJA 1FKAF 4BQLA 3FC9A 2IY5B 2IS3A 4TU8A 5H1SQ 4U7UK 1FTCA 4HTJA 2RS2A 1WD6A 3QEXA 3HOSA 1RWMB 2QWLA 4OI4A 1X9SA 2H54B 1S7HA 3CD0A 4O44A 1TL7B 2EG1A 2XO6A 2JEFA 2BXJA 3EXYA 3AHPA 2D0CA 5I3UA 2I1RA 2JSXA 1B0PA 2VB6A 4QW8A 2DH9A 2F8EX 2QW9A 3TABA 2MY7A 3NMAA 3O08A 3UDEA 4E7IA 4B1YB 3S3OA 2Y9HA 4OZ5A 1LV5A 1EKRA 3NGDA 1UVMA 5D0HA 3P5JA 3OXFA 3OVNA 4HR2A 1LFPA 1U1QA 3G6XA 5DZ7A 5JS2A 1DRZA 2E5IA 5JLHA 4JI2K 2IDLA 3O2IA 2BTFA 4CHYA 1N36K 4I9LA 1Y4ZB 3TAMB 4JI0K 4OZJA 3IRXB 4G1QB 4DX8H 3PEHA 4H4OB 1TKTB 1WDDA 3P1GA 4JI8J 4USMA 2ZH2A 2AJ2A 5AQNA 4I6MB 5B0AA 1LWFA 2YTCA 4BS2A 3VQBA 1WEYA 4ILHA 4I2QB 2CGLA 2W40A 2HRTA 1RHKB 2E1YA 2RE1A 3GTYX 4WFAL 5GADI 3PYGA 3W63A 2A1BA 4NCGB 4CGDA 1G6BA 3VVUA 3VAGA 4MKVA 4NLCA 1S99A 4B9NA 4H0TB 3SQ2A 3OL6A 2RUGA 2Y0SD 5JLFA 2HLUA 1XI1A 4OLBA 3MCOA 4O3RA 1GEHA 2QEXN 3I0RB 3RZAA 3L7PA 1HNZK 2GO8A 1J5OA 3EUNA 3FVYA 3GYXB 5C25B 1T94A 4QPXA 4FN5A 3O4NA 4KHQA 1S1WA 1TUVA 4PKHA 2P9KA 3J7YU 1FD8A 3K9KA 4FDFA 3HDSA 1N33K 2HQ3A 4C98A 1NWKA 3LL3A 3C15B 3Q8QB 1XMOJ 4CZIA 4V19S 4IH6A 2RAQA 5T7LB 4JYAK 2DISA 4CJ3A 1D4XA 1PSDA 3L0QA 3KOAA 4ZVTB 1BA0A 3M8QB 5D77A 1HNIB 2IAJB 2YPYA 3CIZA 4CTAB 2I7PA 4LVNP 1JLCA 1HR0F 2HBJA 5HP1B 4DI6A 2PSZA 4F3MA 2D3UA 3OYCA 2F8TA 2DGSA 2IDEA 3UB5A 1K9MT 3G8SA 2K3KA 1WI8A 3CERA 3OFHA 5DZ6A 1DLOA 3P5TL 4FF2A 5GIOA 4FBTA 3HO1A 5C0YA 3K58A 4F0KA 3THXA 2W9BB 2M52A 5C24B 2Q1NA 2G4BA 3LM2A 1RBVA 3A8IA 3W2VB 1S22A 2E88A 5ADXH 4C7QA 1N5YB 4ID5B 1FVSA 1HBMA 1BI4A 1IKWB 4A8QA 1HNVB 5LM7E 5LSRA 3FKBA 3VQQA 1H3DA 3CJBA 4UUWA 4IDKB 1QE1A 4I68A 4TLQA 4RW4B 4EO8A 4CE9A 5EXWA 4LF6F 2C2RA 1NB7A 3ZZZA 1JJCB 2LVWA 4OI3A 4CGGA 2AEMA 1HPZB 4J2DA 4KO0B 4HHUA 1U1NA 3O1BA 3DU6A 2QWMA 4I2PB 3TAPA 2AU0A 3BF1A 4PYAA 3VETA 5ETKA 1PJ7A 3RMBA 2XSJA 4X4RA 3KK3B 1S6OA 2VQFK 3VA0A 3R6LB 2BQRA 1WEZA 2B43A 4CIGA 3WNFA 2DR7A 4O8KA 3PVXA 1IBLJ 1QTMA 1RP5A 3W7BA 3DLEA 1XERA 4PKDB 4HDGA 5M1NA 1UJ5A 1N36F 4LIWA 4BC4A 3KLIA 5E3CA 4OYAA 2P2CB 4JI0F 4WQ4A 4NZ6A 2XSFA 2ZF5O 2XULA 4I4BA 5EGYA 1Z25A 2CJXB 3BBFA 2DGOA 3JYTB 3CCEN 4EYIB 5GAEU 1IKVB 1CULB 3O3GA 1H7WA 5K14A 4USUA 1RHQB 3M8ZA 4I67A 4O3NA 2HHHF 5A0YB 2CNOB 4DSJA 2AF6A 3EZUA 3JTOA 1I94J 5AXNA 4XH4A 3DMJB 2IRXA 5FPMA 1NOYA 3GG1A 4RW8A 2XNRA 3CW2C 2PO4A 3IMXA 4V19X 1PJ6A 5CZVA 3I0SB 4DSEA 2P1JA 2HVEA 3EGVA 4N56A 3TZXA 3MR2A 2A40A 4GW6A 4Z0UA 3NF6A 4GC6A 3BKUA 5HQMA 1YTUA 4DR1J 3Q8PB 3VENA 1IKYA 1U0HB 3J7ZO 3EKUA 3DM2B 1TL3B 1NH7A 1H6KX 3FZFA 3G4SS 2BMBA 3GV8B 1VQOS 2FBVA 1N33F 2OAUA 3CD7A 5LOQA 2YHXA 3CI5A 1U2VB 2W2MP 3VAFA 3QBXA 3MM9B 1C1AA 2GAHC 2WBNA 2RH3A 2MQQA 2N3OA 3NGUA 3QT7A 4QOZB 1B9DA 4Z37A 1NGDA 4ZCKA 3DLKB 2PC6A 2DH7A 1GT8A 1W7WA 2MPUA 2HBRB 4WFAQ 4HTLA 3FMWA 4KYZA 1Q86O 4H4KC 2WOMB 2AV5A 4U9RA 5JICA 4DV5J 2WVEA 1EZZB 2Q36A 4ZVUB 3HHLA 2AP1A 4KBOA 4DTXA 5CYQA 2Z1HA 3KVGA 1RBSA 3BGUA 3V9UA 1FT8A 3PW4A 2J4RA 5KT3A 1RLCL 4DV0J 3G10A 2VPXB 1RUSA 3P3DA 4IR9A 4ILMA 3AXMA 1EWQA 5KRSA 3JS6A 4FWPA 4DU3A 5M1KA 3PV8A 2OPPA 3NAHA 3T6BA 2UUBF 4B02A 3ZSQA 3H20A 2GWJA 4RW9A 1VQ5S 5G0RA 3AA5X 4P2SA 2JLEA 4RJVA 3SQ4A 4ZN1A 5LMNJ 5J1EB 3VQ5A 4CJ4A 2L3MA 1R0AA 4MK9A 4DR2K 2ZVIA 1QQCA 1X5TA 3J7Z5 4CECA 3AA9A 2MZJA 3D2FB 4ZTJA 2GVDB 3Q83A 4FWOA 4DV1J 4FL9A 4GVLA 3P39A 3VPZA 3WEEB 1TK0A 2PE8A 3LO3A 1HKAA 2DNQA 2V9KA 3U02A 4AT1B 5DM6Q 4HI1A 3QGHA 1H98A 1RTHB 1DHMA 1NGEA 5FPDA 2VHGA 4M5JA 4WU2A 4MQ3A 3NNAA 3NCPA 3EN9A 4DLGA 2VQFF 1KLMB 3LQVA 2HBMA 3MN5A 4JKBA 2E6LA 2Q0RA 2AYBA 2KXFA 2V7ZA 3CCMN 1REGX 2IOCA 3LPYA 4DCHA 1W0HA 1TV6B 3K8WA 3GR0A 4WQ4C 3PX4A 1YF5L 5LL6Z 5I3UB 3DXKB 2VWJA 2SXLA 4OVLA 2RHSB 1H2TZ 2QLWA 3JB9k 2QA4S 4P52A 1WUUA 4MH8A 4OJ3A 4LMZA 3OJSA 4LF7F 3DLRA 3OYIA 5IT0A 4JHDB 3MEDA 2WZ1A 2VA2A 4NLRA 3FE1A 4R0EA 4CLKA 1UWAA 2DGVA 3EICA 2R8IA 1X4CA 3W9IA 3POTB 3IRWP 1VI7A 2ZFHA 3L4IA 2RS8A 4WK1A 3UKRA 3S01A 4PXDA 4DU8A 2UXDF 4JS5A 1NCLA 3SMZA 3ZSXA 1IO2A 4YOUA 1NPPA 1NGAA 4JI8K 1M5OC 4YOYA 4DB3A 5IM0B 1NGJA 2XMJA 2HS4A 1LWFB 1SC1B 3N79A 4KTWA 1IBKJ 1NAQA 1RT4A 3I56S 3O44A 3OYEA 3HLUA 3VQ4A 1V4TA 3QWPA 3P5BP 1D9DA 3SLCA 3OV7A 4PQUA 2NRHA 2QA4G 2RB7A 1YJ7A 5JVGL 4QOTA 4B1UB 3F56A 4HEA9 1BUPA 4LF1A 3JAMU 2QGFB 4DR7J 4AL6A 5IC6B 1LWCA 4HL9A 4A8XA 5HLFB 3C19A 2JX2A 2DVIA 1N6QB 1HWIA 4Y2AA 4U7CA 1MU2B 3DI6A 1HI8A 2HHVA 1CBKA 3TR8A 1IJJA 2P5GA 3D0PA 2QSWA 3M6GA 4F02A 3VF4A 5D0EA 1H7XA 3I4HX 1YITN 1RDWX 2QLFB 4K8RA 1XMOK 1A0OB 3M9OB 4DTNA 1XN9A 2J5AA 4P9SA 2RU3A 3KK1A 2NSCA 4AQYJ 2YJEA 4MT1A 3CCLS 3DOLA 1LQ9A 4UZBA 2BX6A 5AQYA 2XGPA 4JOUA 4EFHA 2KM8C 1MWMA 2XHWA 4K4TA 2ZEJA 4AL7A 2DHSA 4UW2A 2LQBA 3H90A 1S72N 1VRTA 3DRRA 4BC3A 1O5JA 2EBGA 3CC7N 2ACMA 2RF2A 1VBYA 5MAOA 2QWQA 1DTQA 3AVKA 4YHHJ 3T1HJ 3V9XA 1E6YB 3AO4A 2RHQB 4BHQA 3LP2B 3WX8A 2ZH9A 1QHAA 1U26A 3NAIA 4ERDA 4LFCJ 4DR2F 2VJVA 2FPHX 1Z2ZA 4NLBA 3OHAA 3ZZ0A 4YY3J 2IMWP 4X65J 1F0XA 1HLUA 2BVZA 4ECTA 3ZSWA 3NCIA 3THXB 3PSFA 4QAGA 3F0NA 2PI4A 3QJPA 3SCJE 3P96A 3W2WA 4NLVA 4F0HA 3O9RA 1RTJA 5CD4H 4KGVB 2J6UA 2ZJRL 4FPRA 2CAJA 3DRXA 4AL5A 4Q44A 4A2BA 1ZBUA 4EEYA 2HWTA 3ILLA 5ETTA 2H3GX 1SIZA 3IAS9 5LJ3Y 3HVRA 3SAGA 5GMDA 1I1GA 2WC9A 3HT0A 3CJ3A 3MMCA 1VAZA 1LOUA 4OYZA 3LGHA 2V2ZA 2DHGA 2VYPA 2AA4A 5BYRA 3KDOA 3OYHA 3FGVA 2QYGA 2XZWA 3FZKA 3VR1A 3AGKA 2HQFA 2HNZB 4Q43A 4CJSA 3FBEA 3OYBA 2O8FB 1IBLK 3TU5A 2XZTB 5EWGA 5AT1B 1OVYA 4LSNA 4CEBA 3AA8A 3MDFA 1TK5A 2KVIA 4DMNA 4BR0A 2IRUA 3AVFA 2ASPA 4IG3B 2AYEA 2V8DA 4CBWA 3PZPA 2D7SA 4JI8F 4ZVSB 1FD2A 2VH7A 4DPUA 5CZ1A 2D0AA 5E26A 1VQ7S 3KUEA 4RW6A 4C0BA 5EX0A 2QT7A 5K14B 3GMGA 3UN5A 1I94K 2NS1B 5AQMA 4TXSA 5HJYA 2MSSA 4RW8B 3QNNA 2EFPA 3QSIA 2AWZA 2UV8G 1F9EB 3PIPL 4CLLA 1AFJA 3EXCX 2FJVA 3HKWA 1TYQB 1RISA 4FK4A 2HNYA 2E1AA 4B3MJ 3W66A 3VAJA 4F0MA 4DR1K 3ZC4A 1S79A 5DG9A 4IFVA 2ZZMA 3M30A 3VQ8A 1C4AA 5CHCB 4UF4A 5ETOA 4XPEA 1U09A 4K50A 3R5JB 3CO0P 5TKYA 1X4GA 4N8NA 1RT6B 5AQQA 4DU7A 4E1NA 1XMOF 2MZTA 3H2UB 3O6QA 4DHYA 2UZAA 4K2XA 5IV3A 4NLSA 1NMEB 4PL8A 4XEIA 1HYSA 2CG4A 1S1TB 3V9SA 4J9RA 4OZNA 3RW6A 1WAFA 1U8WA 3MCNA 3IA0A 3FFKB 4KREA 4CI0B 2UXBJ 4JRQA 1X8DA 4H5RA 3DYAB 2AJ0A 1HBOA 4F67A 1TVRA 1P9QC 3BYRA 4DV5K 1EARA 3HZEA 4LBHA 2ZBQA 5KOXA 2MKSA 3B54A 1TR0A 4Q45A 3OXGA 3O8WA 2GGPB 2X1AA 2BJ1A 3P6YC 3FGUA 3SSSA 4YORA 4RNOA 3NBPA 2QIFA 4ECZA 4DV0K 3O4WA 3DRYA 2HHUA 5KFKA 4C11A 2WCXA 5DJBA 4F50A 3MFHA 5IQQA 4FWKA 4W4MA 3QSYB 4WQ5C 3VQ7A 4EZ9A 5DMRA 3RBEA 3RSEB 2KM8B 1FDDA 1HX1A 1MMNA 3VF0B 1RWKB 1WKJA 5KFMA 2E1MC 5LMNK 1GOAA 4XPCA 4XH5A 4FVCA 2QFIA 3UNGC 3PRVA 4GVBA 1D8YA 2Z2LA 4CNYA 4XK8C 3OJUA 1FRJA 4J9QA 2AJQA 2GJIA 2VG7B 3CJ0A 2OUGA 4DQSA 3UVJA 3CC2N 1FJ7A 2GEMA 2PFUA 1I5OB 2UUTA 3ZTRA 4CZMA 1UFKA 4FW1A 2G13A 3A12A 2M2BA 1YTAA 4CLTA 4QIWD 4X4QA 2YQ0A 5KT5A 3FZBA 3HRGA 2VV5A 2RDJA 4A4JA 3V1OA 5IQ6A 1HRHA 4O3PA 4FJIA 2O8CA 2IVPA 4DG1A 3W0LA 3CPWM 3TPQA 5FROA 3ZTPA 1MN9A 2VPYB 1FFWB 2GIRA 3QBWA 5F9NA 1OWXA 1JJ2M 1FDAA 4OZ0A 4DX6A 3GP9A 4ZJOA 2B4PA 4KY3A 3IXQA 2OMOA 4RWTA 1JL1A 3RU0A 3RVCA 3PX0A 2XYPB 2OPQA 5A8RB 3CFOA 4M7YA 2ZNZA 1X4EA 5DK5A 1ZBHA 1KTQA 3SBMA 4JS4A 2XMUA 1S1XB 2DXEA 3F41A 3MEEA 3OA9A 1S77D 2ZJRQ 3AB4B 2OYQA 3E01B 1RWWB 4LF2A 4URSA 2W9AA 1HIYA 1UTAA 4NL5A 1Z26A 3W1YC 2YHWA 3SXLA 2EK1A 3CCTA 2AZ1A 4DV4F 3PKYA 1OH6A 4RWWA 2CQCA 2HHXA 1E3MA 2RHKA 2MJUA 1SV5A 2F1FA 3TWZA 3MMJA 2KFNA 2H1YA 3UKUB 3NNHA 1V6HA 1IXKA 3RWUA 4B17A 1IBKK 5AJ3J 2W25A 4DR1F 4KH6A 3C65A 1VBKA 3MMBA 3D9BA 1NMNA 1PJ5A 1IWGA 3V1RA 2VQEJ 2Z2MA 4B9QA 3NGZA 1FFGB 4BACA 4PQUB 3LAMA 4MDBA 3RRKA 3SSRA 4DL2A 1JLEB 2V4JA 5EX3A 4CJQA 4DR7K 3A13A 2VBWA 1QM9A 2AZ3A 5KT7A 1F3VA 2EX3A 2PFFB 1YJUA 1D9FA 3FZMA 3R3LA 4RX6A 2C2ZB 3C16B 4CF8A 1OY8A 4DV5F 3EE8A 5M1PA 4NLXA 1YHQN 2R8HA 1PG5B 4BRNA 4HCCA 3S7RA 1QVFM 2HMIA 3WQTA 4R79A 1H2VZ 4D3GA 4YMEA 3IAYA 3R5CA 2ZKUA 5KFVA 3PIPQ 3ZLJA 2MSTA 3JSMA 4HT7A 2OIHA 3A5NC 4WKRA 2FXUA 4DTSA 1ATNA 1IBCB 4MIBA 3KKSA 4XTTA 4L75A 4ATNA 3GYGA 1FJGJ 2EBEA 2CPXA 2IVMA 2BKNA 2ZDPA 3TEHB 3G96A 2R8GA 4B3RJ 3VCDA 3DRRB 4JI6J 3CDEA 4WYWA 3VWSA 4YHHK 5DG7A 2C2DA 1LK7A 4NMLA 2RF2B 1DTQB 3CETA 2HGNA 3QGPA 1EIYB 3MMAA 2K1RA 3AJDA 1FXRA 1MW7A 3GLJA 1W9HA 4YEAA 4LFCK 3ETOA 2HBZB 4JI4J 4OLOA 2V94A 2IJFA 1JNRB 3SQGA 3UR0A 4YY3K 4X65K 2ZGZA 3TSPA 5HRNA 1HJRA 2XWXA 4DV1F 2BANA 4CBUA 3H1VX 1CJVB 5E3QA 2N3LA 4HKQA 4JI3J 1NM1A 3I55S 2YI1A 3CM5A 1KHWA 4OX6A 3HVAA 3HPOA 4JAXA 1LW2B 1U1PA 4LF8J 3ALYA 1QDUB 1V4SA 2E5LJ 4M3UA 2Q2RA 1X60A 2DEJA 2YJFA 2J7KA 4ANCA 5D0GA 5A76A 2KQ2A 2KO1A 2M88A 5CCLA 1BQXA 2EG2A 4JV5J 4JKCA 2MQMA 1YVNA 3PRDA 4H5WA 2ZWHA 3GE9A 4CJEA 4L3KA 1XQSC 2EKNA 4E98A 3O6WA 2ZBIA 2QLJB 4WXWA 3CCVS 3O3LA 2O67A 1Y7PA 1EX8A 2FHJA 6FDRA 2IMOA 4P10A 2JLGA 3I87A 1IBMF 1HW8A 4QS9A 1K6YA 2BRLA 1OO0B 4FK2A 1KAZA 5HJXA 2GS8A 5LMUJ 1JLGA 5F2RA 1YIJN 1SJQA 4NLDA 4HUGA 1BQNA 3M6XA 1Q8LA 4OJ1A 1RNHA 3ZT2A 1P1LA 2Z1JA 2ZJQL 3IWXA 2PA3A 4B9LA 4CIFA 4C97A 2RIJA 4CYUB 3EJMA 3ZT4A 4A8KA 2JZ5A 3KK2A 3NL0A 4NASA 2WB1D 1R8PA 2ZNYA 1KP6A 1YSJA 4FBUA 2YX6A 3G6EN 2FBYA 3TSUA 1T3NA 3C6UB 4ZVFA 1ZZNA 2Q3SA 1KVJA 3CMEN 4Y3CA 2ZDOA 4G65A 3FK4A 5I9EB 1PAUB 1OJ4A 4FCYA 4GMKA 1M1HA 5DM7L 4IFEA 2Z2YB 4DR7F 1TKZA 1ZTTA 4WIIA 3PLAA 4B1VA 1JB0C 4K4WA 5A8KB 2ATCB 1LEOA 2IA6A 2LXFA 4ZVHA 2R42A 3THWB 4IFVB 5AXKA 4NLPA 1VK0A 2NXCA 2UU9J 1TQLA 4OYXA 5LXRA 5BRDA 4CIOA 8ATCB 3QINA 3M2UA 3W5YA 5E0OA 4FJLA 3PG9A 3VHQA 4LSLB 5BJRA 2WTUA 3K5NA 1M5HA 4AQYF 1RTDB 1P8GA 2CXEA 2O8EA 3MWTA 1WELA 3KHRA 1AZSB 4KSEB 5HO4A 5ADXA 3SEOA 2IM0A 1T6DA 3FLCO 5ITHA 2VF3A 2RQKA 4M42A 1EB0A 2HG4A 4DTPA 1MWKA 2ZHBA 1VQ6N 4C8OA 4CJTA 3MM6A 1GH8A 3F73A 4IQMA 1ZXOA 6FD1A 5B7WA 4YHHF 2XMKA 3T1HF 4O8UA 1Y9OA 2Z0GA 2HGLA 3H59A 4UOHA 4E2FB 2ATLA 2CPHA 2QKKA 3QIDA 3V1QA 1X31C 3HM9A 1YRXA 3BB5A 3T1YF 4LRDA 4YOXA 2CIMA 4MK8A 3J81j 1C4CA 3OR1A 5HRSA 1IH7A 3FNNA 3ILIA 5JJBA 5CZ2A 2P9IA 3CUNA 3MX5A 1OSDA 1U47A 4MMOA 3CB4A 1R3NA 2OD4A 1TL1A 1VC5A 1HBUA 2I2YA 2UV8A 4KB1A 4H0YB 4P7VA 1RQ0A 3S41A 2V4RA 3PR4A 3TAQA 5B08A 4LF9F 3ISNC 5AFUH 3ZZRA 2A18A 3SNNA 1I51B 5E3AA 4WE1B 5KG5A 1KLNA 3KMSA 1KCFA 3MD3A 1HARA 3L09A 3N5BA 2YWEA 3QEVA 1ZBFA 2NZTA 5F3ZA 1U2CA 3Q86A 3HD2A 2N4DA 1MA9B 2FC9A 2LSNA 1DGKN 4PWWA 3ZEUA 4L73A 1XNQF 3LH2S 4TY8A 1S6QA 4LIRA 5AQHA 4CD1A 3FFIA 1TMJA 3UFCX 4LY7A 4M5LA 2FJAB 2RNEA 1JKHA 5HATA 1UW4A 3K5MA 1S6PB 3GCXP 1RILA 2G0CA 3HT3A 2M5YA 2CQIA 4NX9A 4EHTA 2NRRA 1NBEB 3ASMA 1LWEA 4Y2IA 4DX7A 1RBAA 1TK8A 2YX1A 3BM7A 2WSEC 3D2WA 1X4HA 4NLTA 3PJXA 5D4OA 4HHHA 3AVNA 2HHQA 3F5TA 3X1LB 1U04A 3I8BA 1F1BB 1YK9A 2D4WA 4M5NA 3MOJB 3TRGA 1RT1A 1DURA 4C1NI 5AR0A 1CJUB 2GCFA 3KLGB 1BUXA 3AOBA 3AY9A 1SV5B 4C8YA 5HVGA 2A42A 1U24A 3J80O 1TKXB 2DRDA 4JV1A 1MLAA 2PYJA 1K0TA 2E7VA 2NRXA 1PC5A 4B3MF 3L6QA 3NOGA 3L95X 5AJ3K 3TP2A 4FNHA 3JXOA 3E3XA 4OYWA 3HJVA 4BWJA 5H1SV 2PIIA 1S9EA 2W2PP 4OYOA 5ETMA 1OQ6A 3IN5A 3MMBB 2RKIB 4YOTA 4Y00A 2HRYA 3R7NB 3F9MA 4BRQA 4F9OA 4B3OA 3EZ5A 1JCGA 2V2KA 1KQFB 4I56A 5CA5A 2W2OP 2LU2A 2VG5B 3IGNA 5JXSA 1RAIB 2KXNB 4IJAA 2F9JA 3T69A 2FSKA 2ZJQQ 2VODA 4NLQA 1TFWA 5AZJB 1HNXJ 4YOWA 4JBCA 5KFOA 2HFSA 2RE2A 2XMMA 3J7AN 4ZPVR 1Q8KA 1WC5A 4IEEA 1M1KT 1HW9A 2UXBF 1KVKA 2W42A 3CF5L 1DY3A 1S0NA 2QC3A 1DBDA 3EY1A 4E3SA 2V2VA 3MUMP 2H5JB 5CABA 4LH5A 3THVA 2PYLA 4IYQA 1A9NB 4Z4CA 4DSKA 4DKWA 4OL8A 4Y0WA 3AVGA 4MO4A 2RPIA 3FUYA 2KT5A 3MI7X 1PBUA 2P8IA 5DM7Q 3BDEA 5IXUA 4KGZB 1HQUA 1Y10A 2CADA 3JSMB 1XMQF 1FJGK 4DFMA 3OPKA 3LDLA 2G1DA 4B3RK 2OTJN 3SAHA 1U45A 4JI6K 2MQOA 4DUYJ 2J0WA 2R8KA 3V6DB 2ZWPA 4AD6A 2E9TA 2QN6B 1LFWA 2QLBB 3VN5A 4NYOA 2CUYA 4NRTA 5TKWA 4M3TA 4I6WA 1IR0A 4JI4K 1V5VA 1WOSA 2K1RB 4QQBA 3FR0A 2OANA 4AM7A 3U1LA 4A8MP 3GIJA 5E33A 3VTIA 1T05B 3H3OB 4JI3K 5KAKA 4CZEA 2GQQA 4LF8K 4AYBD 2E5LK 4DEZA 1YZ7A 3MF5A 1PYSB 2L9WA 3WNHA 4JV5K 3MX2A 1JK9B 2HF4A 4EYHB 3M05A 3MD1A 2YWKA 2QJ3A 1TUYA 4AHSA 3ZX2A 4QS8A 3PDNA 3ZZUA 2LEAA 2M9KA 3CDAA 2DR6A 4RUAA 5L1JA 2BM1A 4ALZA 4YDDB 2DNZA 4RO0A 2WB4A 5J1PA 2XTJP 3UE2A 2F63A 4BG8A 1L3KA 3AAWB 4CLSA 1F60B 5D8HB 1B70B 1GLFO 3SCLE 2X51A 5ETRA 4O5FA 2IDOA 3ISZA 2AIRB 4BC9A 3TTDA 1B7YB 1NO8A 2HVZA 4EI2A 4BR7A 3KYLA 2BRKA 3U7JA 5LMUK 4OKEA 2B6AA 4MFBB 2AGQA 4YNQA 2BABA 1RT3B 3UN2A 4Z4HA 1OY6A 4WYLA 1R8AA 4LR9A 3MXJA 4WFNL 4ZVRB 3G9CA 2DPNA 2KRBA 1RHJB 2RDIA 1J9AA 1KAYA 5LJ5Y 3OUYA 4HACB 2NXEA 1O51A 1AROP 3KZBA 1AUSL 4YFUA 4BDYA 3UDVA 3Q8UA 3BSCA 1RAHB 4CJUA 1SJ3P 3T7ZA 4ITSA 3TAFA 1WG4A 2HBLA 1A6LA 4DQPA 3SMSA 2COLA 2VFSA 2YWGA 1QVGR 3WC2A 1UPMB 1VDHA 4P74A 3B78A 2VQEF 2CJBA 1TKDA 3BF4A 2OCEA 4W5NA 5KTQA 5HANA 4ANEA 2KFYA 3DU5A 2V69A 2XHCA 4FSVA 2J9EA 3R9PA 1CS4B 3NCQA 3D6MB 4K8ZA 4DPXA 2MLXA 1WSEA 3UE5A 3OR2B 3CXCM 4ZP8A 1TFYA 4GV3A 1KBRA 1XNRJ 1VCTA 2R3VA 4X4UA 1QAIA 1FXLA 3QO9B 1L3TA 2V8GA 2Q6CA 1N5QA 1QAXA 3R5DA 4Z7YA 2AQ4A 4KTQA 4CZGA 4DR5K 4FJ8A 3GJRB 4NCBA 1T11A 3EM1A 4DL5A 2YQ3A 2QWNA 1EP4A 4H0VB 1MNEA 3GV5B 5A2QU 1HQEA 1Z05A 4CLZA 3D6RA 5AQVA 4ZJLA 1WNSA 5B0CA 1F6TA 4KHRA 1CZ9A 4B3RF 3C46A 2MKYA 3DRSA 5KI6A 1FDNA 3R1HA 2HURA 2XYGB 5HMXA 1L3VA 1SUQB 3CJ4A 3PW2A 4F4AA 2E7WA 3HI9A 3CCUN 3IM8A 3NS6A 4KRFA 5IFMA 3HSZA 5CYMA 3AO5A 1TTHB 3WX4A 1A5XA 3N01A 3BN4A 2DPJA 1NG9A 3ZX0A 2C3OA 1PC4A 3CCJN 3M6VA 2QWOA 1F5AA 3F9KA 4KT0C 3NNCA 2PDAA 3IFRA 1VQ8S 1GXUA 4JI5J 5D4NA 2XEXA 3ENOA 3CF5Q 4BRPA 4XAKA 2OFHX 1GLJO 4NYPA 2JC0A 4JI3F 2LCWA 2G2OA 1FE0A 1HFEL 1TL1B 4OHXA 5DRKA 4LF8F 3SYZA 2DFEA 2LA4A 1O6XA 2E5LF 2V51B 1Y11A 3WT0A 4FM0A 2G8FA 4ZLNA 3NMUA 1VS3A 2IVFB 4I69A 4GNIA 3BSAA 3B8AX 2KU7A 2BUNA 2VIHA 5KPTA 4JV5F 5KFFA 2FBXA 5F0XA 2R7SA 3IKMA 3P83D 3U6FA 3IFEA 1BWVA 4IFYA 3T6JA 2YNFA 4N5SA 4JNEA 4ANDA 2Q0UA 2PFDA 1FKOA 2CQ2A 3FZHA 3U1MA 3LP0B 1ULRA 1QQNA 4FWSA 3TTCA 2B4VA 3AA2A 4JKGB 2W4PA 2JFKA 1G4CA 1NZAA 2Y8YA 4F2RA 4J8FA 2FC8A 2V5HG 4IOBA 2G8IA 3SCKE 4M5MA 1ELOA 3KMQA 3HSGA 3ZETA 2K3IA 4WTOB 3GSDA 2QL5B 1JWWA 1HHSA 3DHXA 2BOPA 1UCNA 2YWHA 5F8IA 1FWPA 5CE3A 4CH7A 5GAGU 1BQMA 4CJ7A 4ES3A 1HHTP 1Q0NA 1JLQA 3GE1A 5LJWA 4BC2A 5HBMA 4ZVQB 2YHAA 4Y6IA 4N41A 3WIUA 3HTVA 1RTZA 1SS6A 4CF2A 1B4SA 2XZDB 1BHLA 1JCFA 4KC5A 3IG1A 1O1WA 3T19A 3V6JA 2F8SA 2KH9A 5FRNA 1RT1B 3FCHA 1HYZA 4OI2A 3KG4A 3R5GA 4E7JA 3DHWC 2B9WA 5H9EJ 5KFEA 1UKUA 1C1CA 4IOCQ 2VWBA 4UUXA 1NKCA 2J0SD 3PW0A 2P6SA 3SCXA 1X4DA 1BE4A 3LGNA 2IPOB 2A1SA 2QX0A 3I8DA 5EX5A 4CGHA 2BE7D 2MZSA 3ZSOA 1S97A 2KKHA 2BBEA 4F4ZA 2ILYA 2VL1A 1LCUA 2ZC3A 3AVHA 1HMVB 4NRUA 2YNIA 3P4IA 4BR2A 2UU9F 4KR0B 4EO6A 3TAGA 4KPYA 1NOZA 1QY7A 3KLHA 4X4TA 3K8VA 4R0JA 4WFNQ 4PUOA 3QPIA 4TNOA 4DPYA 2MKCA 4W92B 3AJ2A 1HNXK 1RT7B 4FLZA 4AXIA 3JQKA 4ED5A 1G3OA 2QSFA 1KS2A 3UWTA 1A5WA 1RBLA 4H54A 1XEZA 2PD1A 5B0DA 1XMBA 1MROA 1PILA 1QAYA 1SJ1A 1U25A 3QGGA 5ELZA 5LY3A 2LDYA 3IDHA 4K5RA 1X9JA 1VQMN 4MK7A 3JTNA 3J81U 2W9CA 1Z1ZA 1URNA 4B3SF 1O8BA 1RJJA 2XS2A 4A46A 5EUHA 3K59A 1WHVA 1IN0A 1M0SA 4IO1A 4QWAA 4DU4A 4RBUA 5T7BA 3QFWA 1RACB 4O4GB 2MKJA 2ZJPL 4DUYK 2CPEA 5AZIB 2HS0A 2Q43A 4ER8A 1TL7A 2MLZA 2JWLA 1U1LA 4RKUC 2A5XA 4RPFA 3BSOA 4LF6J 4J9OA 1NU0A 4DZDA 3K5PA 3TO8A 1OPZA 5J1NA 4KE5A 2N4CA 1B92A 1QQMA 2VZ9A 2F7VA 2HIQA 1MSWD 3QZ7A 1GQEA 2NR0A 1WEXA 3OTDA 2YKOA 3ICLA 4FLYA 4X4NA 2DY4A 2ASYA 1N5SA 1IV0A 4TU9A 1R43A 4P72A 3W8GA 4CLPA 4OLPA 3ATVA 1UZHA 3J7ZT 3GILA 1S1UB 4J2AA 4DSFA 1S0MA 3JAMO 4HI2A 3JSYA 3S9HA 3D6HB 4H5TA 2DNPA 3ZT3A 4OGEA 2I5JB 1WG1A 3TAMA 2ZH3A 4M1KA 4G1QA 2H9ZA 3O9QA 4H4OA 4AHUA 1TKTA 2HNDB 1U02A 1AT1B 3A8EA 4B9TA 4DFJA 2HWIA 4I6MA 4PG6A 1S4FA 4I2QA 4B1WB 4O3SA 2CJAA 5FPNA 1RADB 1E4FT 1N4LA 3GIIA 2X6SA 2E2PA 2KFZA 2QEXS 4QU7A 1CQMA 4NCGA 1UZDA 2J9DE 4ED1A 2HHHJ 1Q86T 1YZ6A 3PY8A 3W3DA 1RGIA 2NCKL 5C10A 5GADU 3NY0A 1VRUB 4M3WA 5KQDA 4M8LA 1JX4A 2PMWA 4FPIA 3C6AA 2ROEA 1JXLA 2R7WA 1NK6A 2DFFA 4JD2A 5HMZA 5C25A 3VGLA 2KYXA 4RCHA 2QI2A 1RBUA 1Q9YA 5K8NA 1JLBA 4WKYA 4FZZA 1WAJA 1U1RA 5IOLA 2GHPA 1SC6A 1DARA 2M8HA 4KV8A 1X4AA 2W7OA 3C15A 3ZSRA 2HFVA 3L7UA 1Q5YA 3PHTA 1KD1O 3N4WA 5T7LA 4CM2A 4YS2A 4MLEA 4PRFA 1RFQA 3WDOA 2Y0BB 1RGVA 5FD1A 4DDFA 1UA1A 3GL1A 2R4FA 2GQ2A 5IT9U 3GZ7A 2EHGA 3MM8A 3TX8A 3AVBA 1HNIA 3OYNA 2VOPA 4YDUA 3O9SA 3B8HA 1RSCA 3MOZA 3N9UC 5F8GA 2D1KA 3BKFA 2XO7A 4M63C 4MDAA 3DLGB 4XDCA 4ISEA 4WIQA 1QZ6A 3MPDA 4J9MA 1HNXF 1B7FA 1HBNA 3CFPA 3ENVA 3K2YA 1D5AA 1RDDA 3ULEB 2DGXA 1I3AA 3BJYA 4OO1J 2KYZA 4ECQA 2HHSA 1XNRK 4CZKA 5GVQA 3MR6A 3CYMA 5AE2A 5DGBA 2ALYB 4JLHA 2IA0A 3N6MA 1IVZA 3WIVA 2VDIA 2W9BA 5C24A 3FRYA 3N6NA 4FZXC 3L2QA 2XS7A 3CIPA 2WW8A 3W2VA 2YV0X 3ET6B 3NG8A 3OSPA 2QL9B 5HK4A 5F9LA 2KW4A 2KTQA 3QJJA 3L4BC 4O3OA 4ID5A 2WVFA 4CZHA 4I7FB 3G82B 1UA0A 3AAPA 1B64A 1IKWA 4MKBA 4BRHA 3TNVA 5KFWA 3BY5A 1CVJA 4IDKA 2HSTA 2KG1A 4RW4A 4DWIA 1W2BM 2XCPA 4KIAA 1U2RA 1VSEA 2HW3A 3DRSB 2Y1JA 1RA6A 4K8XA 2HZCA 3DXBA 2NUBA 3MECA 2XY6A 3D2EA 3KHHA 2KI2A 2CRLA 5GMEA 1JNZB 4U95A 3RMCA 3LP3A 4M5DB 4KO0A 1WC0A 2JEJA 4URQU 4FOEA 4I2PA 3C7NB 1R6VA 2VBXA 5AQKA 3AVLA 4DLEA 4CK3A 4JI5K 2GAGC 3A3PB 1WC6A 3KK3A 1FRMA 2IJNA 2PA8D 2OZMA 2JVOA 4MAKA 2HQIA 3O80A 3AVAA 3CCES 2G0JA 1J5EJ 1XC3A 1BWEA 4B9MA 2Z58B 2AT1B 4LH4A 5GAHP 4FS2A 5CYJA 4FLXA 4WZQA 1KN6A 4FJHA 3Q8VA 4F3OA 4F8RA 3DRPB 1IUJA 2E9ZA 5KFXA 4BVOA 1D0EA 4NLUA 4CK2A 4BDZA 2P9LB 4OZ1A 4NCAA 2B5JB 1VQ8N 1ZTWA 4M5IA 5DGAA 1SL1A 4IDHA 1UVLA 3JYTA 1B0VA 2YKPA 4U8YA 1IKVA 2YNFB 3R2DJ 4QCLA 3HCXA 5A0YA 2ZJPQ 5AQZA 5IWAF 1KFDA 2ZOGA 3CMAN 3DMJA 3NFAA 2W01A 3H8YA 4FLTA 3M8RA 2UXDJ 4QYRA 1AB8A 2ROGA 2RD5C 3VGKA 3CPWR 2ZWOA 1JJ2R 2GUPA 1LNQA 2CPDA 2CA9A 2BH1A 4CJPA 1U0HA 4IWVA 3BR9A 7AT1B 3DM2A 1RAJA 2J9CA 4JI7J 1TL3A 3MTKA 4CEAA 4ES1A 1N0VC 1HD1A 3CGIA 3VGMA 4F7VA 1VOMA 2YY3A 4OI1A 2BKOA 1JLQB 1SKUB 5HBMB 1U2VA 5HN0A 3AARA 1K1SA 2LU1A 3FSIA 4ES2A 4C3KA 3KKRA 1V5IB 2JEIA 1C0UB 3CDWA 4ELVA 3MM9A 2VICA 3BEXA 1YJ9N 3IGVA 3P4UB 2ZKTA 2DEIA 5EHHA 1O0PA 3TSQA 4LRFA 5AQFA 1BL3A 3N0VA 3V4MA 3U3GA 5L1LA 2ITMA 3KWMA 4ZA1A 3DLKA 3HK2A 4DTMA 4W90B 4EMDA 5H9EK 4OHVA 1K0VA 4MKYA 4OJRA 2WOMA 4DV6F 2DT9A 3W5ZA 2B7BB 4XO0A 1YBAA 4K2JA 1TP7A 4CZCA 2H65B 1NDCA 1SJ4P 3OYKA 1KWMA 3AVMA 4CW7B 2FGCA 3FQLA 4CD3A 1LW0B 3NF7A 4XIUA 3ZT1A 1Q81O 3UD4P 4LQ9A 5KFIA 3EDQB 4JB8B 5B09A 4PG8A 1DZ5A 1R31A 5KFYA 2DNLA 2ZH6A 5C12A 1DQAA 1P8ZA 4ZCMA 2HFUA 4ICLB 2Q79A 3CJ9A 1J2VA 3OYJA 2VBYA 5E5NA 1WSFA 1OYDA 4WP8A 3MAAB 2IYIA 4QR0A 1S5ZA 3CD6N 2VD3A 4DCPB 2JLFA 2O8BB 5J1EA 2IYGA 4RNFA 2MKIA 3ENBA 3MXMA 2JWKA 5M1OA 4KHWA 1UL3A 3HZGA 3H45C 3D2FA 1VQNN 2DY1A 4TSXA 5MLCQ 2C1EB 2GVDA 3NH0A 3WEEA 3IWLA 1JLAB 1ASWA 3BS9A 2V50A 1BWFO 1KEKA 1QVFR 2E8AA 3CCMS 4ZP6A 4ED7A 3QWUA 3J80Y 4P2XA 1RTHA 3KJNB 1YI2N 3OL7A 1FJCA 3FJ2A 2YNGB 1XR6A 4JI5F 1VYAA 2GMLA 2V8PA 3FZLA 1KLMA 2N7YA 4RW7B 3DXSX 2I0XA 4LF6K 1Q53A 1H72C 1TV6A 2CQ1A 4ZS6A 1S9GB 4L74A 3DXKA 3NLCA 3CCSN 1U7LA 3X3UA 3VQEA 1HD0A 4WFBL 2LLZA 4A62A 4JHDA 3F44A 4J9UE 2MJNA 2FLPA 4FWNA 3MFIA 3QQCD 1APSA 3P38A 1DJ0A 1UEVA 4TY9A 4DTOA 2ZHOA 5C5JA 2VDHA 2OKQA 3POTA 1CZBA 3LALA 3H1QA 2AYMA 1GMUA 3IO1A 1BOTO 3G0ZA 3U8XA 3F2KA 4MO5A 4F4KA 3SAFA 4ENOA 4KFBA 4DR3F 4BROA 4O5BA 1BDGA 1PKUA 3MM5B 3NVKA 2QK9A 1FKPB 2CPFA 3DN9A 3FCWA 4UOFA 5IM0A 2KZZA 1PYTA 5RUBA 4K7QA 2KLAA 3QEWA 4NXMF 2ZGYA 2VC1A 3SIPB 2EFNA 2OTLN 1EAYC 3FEYB 1YJRA 2HHHK 2MHNA 4RTFD 2FVCA 4ID8A 3UCUP 2QMWA 3AT1B 5GMKa 4DZ6A 3T5LA 4GKJF 5L9XA 4M3XA 1NK5A 3BGRB 1NM2A 2YH1A 4NXNF 3ZSZA 4FO0A 1YITS 1BHNA 5HLFA 2IRYA 4JD2B 1PIEA 5F8LA 4XDDA 1N6QA 3CJKB 2O8DB 2OO4A 1DAXA 1Q8BA 2UVVA 1ZBTA 1MU2A 5A8WB 4E7KA 2FVRA 2HOEA 1JLBB 5L39A 2GFFA 2OD6A 3QETA 2BE2B 4ED2A 3MAHA 1KC8T 2PY5A 1GLDG 4IKFA 1S72S 4KV8B 4X4SA 1N5TA 3CT9A 1SQEA 1NKEA 5A6PA 3KLEB 2P9PB 5L8RC 1M5VC 3CC7S 3S6EA 3SBTA 1KONA 3MEGB 1FX4A 5AQIA 2ZZTA 1FE4A 3A3NB 4ZHRB 2DY9A 1SZ2A 4Q2LA 1SB6A 4C3MA 3MDQA 3CVKA 3R5BA 3MM8B 1UP1A 4WU3A 2ZBCA 2R7YA 4WJBA 3ITHB 2CQHA 3DNCA 4AHTA 1RI7A 3I4PA 1YRTA 4U7BA 1V3SA 3LDQA 4B8CA 2DHHA 2B8PA 4IO9Q 4FW2A 1VQLN 2NZCA 2FB0A 4WBFA 3G87A 3JSBA 2DR5A 3QERA 2FLLA 3EEQA 3PW7A 1KHVA 1E6YA 2DXDA 4FYXB 4FVUA 4H4KA 4J9SA 2DNRA 1HJOA 1HBNB 4N77A 1VQKN 4BC7A 3LP2A 4NYNA 2GC8A 2FF6A 1KQSM 2CZVC 1C0TA 4ZPCA 2QTDA 4BR9A 3RB4A 3FEXB 5L9NA 3N4QA 3ZSYA 4AHCA 3VGUA 1U6FA 5LL6d 4A59A 3WNEA 4DF4A 4IJNA 2UUBK 3QAUA 2B7CB 2IBKA 2CJKA 4X4OA 5AXMA 3MPWA 1PAEX 3NH2A 3VVTA 3EPGA 3P8BB 2W2NP 3M5RA 4UTGA 3BKTA 3TR5A 1FW6A 1ATRA 2JC1A 4NB4A 4JKAA 3L3CA 1V3RA 1T9YA 5GAHI 1WC3A 3VAHA 2CKWA 5AQOA 5KFSA 2YKNB 1LWXA 4USVA 4CO1A 2KJVA 4I6YA 1WDTA 4IO8A 2CGKA 3MECB 3D2EB 2GUIA 2V68A 4B3TJ 3TEGA 3PR5B 4O55A 4RBTA 2V9WA 1MMDA 3CQ8A 4P6QA 1EQ0A 1WF0A 5IZHA 2HNZA 2DH8A 1N34J 2RRNA 4YR0A 2O8FA 1ZM3A 1LKZA 3K89A 5D15A 1N32J 3QESA 1XTZA 4UOCA 4F36A 3M2RB 3ZZTA 3BYPA 1BCOA 1M5SA 1RB0A 4IG3A 2CPJA 4USWA 4LF7K 3BGLA 3EMTA 2DTUA 5K8PA 3JTPA 2BZ2A 1VSHA 3PO4A 1JLFB 2LQ8A 4KKOB 3ULHA 1RHRB 1QVGM 1GX5A 4FF1A 1NGIA 3S3MA 1UWBB 4DV4J 4W5OA 1R27B 4C9DA 1NGFA 3A4TA 1GMVA 4DV2J 5SUHA 4BREA 2A2DA 4H0XB 7FD1A 4YQWA 4MIAA 3LDPA 1YBTA 4ZLJA 4MTPA 2UXDK 1FWLA 4YR2A 3R9LA 1TYQA 1NB2A 4OI0A 1P90A 3CJ2A 2XY8A 4WFBQ 3D28A 4LUBA 1WJ9A 2DYAA 3UCZP 2XQCA 2F4FA 1FXXA 2H48B 5BPNA 3KJQB 1P1TA 3HL8A 2RT3A 1ZBIA 4DTUA 2ASMA 4F26A 4JI7K 3TQ1A 1DTTA 3QFPA 1SKRA 2B4UA 1UJ4A 1XK8A 3EZWA 1RT6A 4CIEA 4F04B 5DO2A 3RG6A 3E66A 1S57A 2XG8A 3NGKA 5HQ8A 3HSJA 2IM3A 2EW9A 1S1TA 4HVZA 1YJWN 3KTQA 3CJSA 1CJKB 3WXIA 4FJJA 2HRUA 4IXCA 1U2FA 4ZJQA 2DNYA 1JJ4A 4RWXA 3DYAA 2RSQA 3W8PA 1CXUA 3QMQA 3DLBA 5B0EA 2X1GA 4FJXA 3UO0A 1K8KB 2GGPA 1UVIA 2FZGB 3T5HA 2ASDA 3MN6A 4LBIA 3LWLA 4C8MA 3NF8A 4U67L 4ILRA 2HBYB 4ECWA 1U1OA 1Y3KA 3R6MA 5FLXU 1F5BA 1EX4A 1KOHA 2ILZA 3OL9A 1YQHA 1UOCA 3RSEA 3DLLL 3W61A 2J0QD 3TVKA 2DGWA 2AGPA 2JVRA 3CC2S 4AFFA 4CLFA 4L6V3 1RCOB 3A0IX 3LPEA 1BC6A 1VSLA 4RL1A 3R8EA 1NNDA 5I42B 3BGOP 3PFOA 4BRKA 3MXHP 3SSQA 1LXJA 3QFUA 4HCBA 2EXUA 2XMWA 2VG7A 4TYAA 4K59A 1J27A 4RU9A 4ECRA 1I3OB 2GX9A 4UZCA 2ZH8A 2B4JA 4CLWA 1FNMA 3EPIA 5FDLA 4ELTA 4BE1A 2YKQA 2GIFA 3RYLA 1A7GE 4TQRA 4IG0B 2XWYA 2E5HA 3LDNA 4QR1A 4GVMA 2P6TA 4OX8A 1J5EF 3AD9C 4KHSA 1X4FA 4C6AA 2LP4A 1WHYA 2G2ZA 3D3CJ 3QNWB 1REVB 1SH2A 4GKKJ 3HSCA 2YWFA 5AQUA 5I4MA 5A8RA 3PYFA 3W5XA 3VEVA 2LQ9A 1T9WA 5J2MB 5E3RA 1S1XA 1IBMJ 1MDUB 3E01A 2IBOA 4OYMA 3MR7A 5BYQA 4JK7A 2QRRA 4AE5A 3ZNUA 2GV9A 4P7TA 1SQGA 4IRCA 1Y5NB 2B4OA 5D3GB 3Q89A 1QSSA 2EVZA 4PY5A 3U4LA 3V81B 1SJRA 1RU1A 4KFBB 3UKUA 1A5VA 4X66J 3QNOA 3ZX3A 3HHDA 3PFEA 2VUGA 3HHEA 3CCWA 5CAAA 4B9VA 4YDXA 4OZ2A 3T5JA 1KXPA 1WC4A 5HL7L 3K0SA 3EL2A 3JQMA 1Z2LA 3R7SB 4JI7F 3N4PA 2RQ4A 1NK4A 4J9NA 3OQ2A 1U0SA 3MXIA 5KQ8A 3Q8RB 3DFEA 1JLEA 3D0IE 2DNGA 3GWCA 1FA0A 3NP5A 2R2UA 1VQ9N 1RTIB 1YHQS 2QA2A 2ZM6J 2VC0A 3SUQA 1W25A 2QMUB 4RUHA 3NS5A 4NEZA 4Z4EA 3M32B 4CJRA 4H5NA 4FF4A 4EUVA 2F8MA 1SL2A 3C16A 1X5OA 4OHYA 1TUGB 3NDKA 2DTJA 1QZ5A 3CCRN 3PYEA 3JAMY 2W6LA 2RUSA 3AAQA 3CPEA 1OS5A 2NRVA 2LA6A 4ZIWA 4M3ZA 2GV1A 4B08A 1XWLA 2LEBA 2NSBA 2Y1IA 2Q6BA 5M2PA 1TGOA 1YRUA 1EO1A 1F3FA 1NZ8A 5KFZA 2OELA 4C0OC 3K17A 2HMPA 3PTWA 3NE6A 2KXHA 1KFSA 4OHWA 1V9OA 5LT5A 1XR5A 2RRAA 3UIQA 3WXMB 4K4SA 2GQCA 3WNGA 1K44A 3TZYA 3LPTA 3ZCMA 3CXCR 4KBIA 1KVCA 3FBFA 1VHXA 4F3QA 4ZP9A 2G8UA 5HI7A 2A0FB 2D9OA 4I1TA 2YHBA 2LKZA 1U1MA 1C0TB 2AD9A 3WC0A 4P73A 3ID8A 3T1YJ 4WXOA 2ZBPA 3QRQA 3L3UA 2B3TB 3BQ1A 1U49A 3A3OB 3MCPA 3KHYA 5AQRA 2C2KB 4ZN3A 4HHTA 1CJVA 4IRKA 1KAXA 4WQ5A 2DXFA 4KB0A 1EETB 1T44A 4DX5A 2QL7B 1LW2A 3KK7A 4OMFG 1Q82O 4K43A 4NLWA 2VOOA 1WSIA 4LF9J 4DU1A 5K8OA 2R8JA 3M9NB 3QJLA 1Z6RA 3LP1B 3G25A 2LEPA 1R0CB 2KJWA 2CNLB 1YIJS 1XBWA 1XR7A 1XJWB 2GHVC 4B3TK 3AH6A 5CR4A 1VFJA 2DK2A 2G8KA 1AXQA 3DOMB 1DEJA 3RRHA 3E9OA 4J5OA 2QXLA 3HPGA 5HRPA 2WVCA 1XNQJ 4FOIA 3W65A 3U3YA 2DFHA 3TAEA 2P9UB 1GXLA 2QV6A 2J6TA 1N34K 4USJC 3NKYA 4J2EA 2QTWA 2L9DA 1N32K 3OTOF 3G71N 4M94A 4NA2A 3MEKA 2OPSB 4FPAA 2LXIA 3W3SA 4M5HA 2MQLA 4DUTA 3G6ES 3AOCA 4Y2KA 3PW5A 1BIUA 3D3BJ 3HFVA 1Q4RA 1RWUA 1PBAA 2GA7A 3CMES 4CYUA 4FJ5A 5AQPA 4DXLA 1WN7A 4ZKAA 1C1BB 1G2EA 1YX2A 4FM2A 1OPIA 3GYNA 3H5YA 4QU6A 2PGCA 4KGKA 3N28A 4Y0FA 2K2PA 4AM6A 4DV4K 2DNKA 3EE9A 1T0TV 2AYGA 4DV2K 1T9TA 2PT0A 2C28A 3C6UA 1SPBP 2RN2A 2IM1A 2UYTA 3E51A 4ZMMA 2AGOA 5A2QO 1C0FA 3L4QA 1BLUA 2KRRA 4H4MB 1YTYA 4IEIA 5C2GA 2Z30B 1F9HA 4GVEA 2OJ3A 2RRBA 2EFGA 5A8KA 1SQFA 4A8WA 4L76A 4KRWA 3THWA 3T1AA 1EQMA 3GFHA 4B1XB 2YWWA 3RB0A 4YB5A 1VQPN 2CNKB 1DTTB 1FHTA 3ZYYX 3QIPB 2VKZG