3AA2A

A52i e. coli rnase hi
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
153
structure length
153
Chain Sequence
KQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAIIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease HI
publication title Protein core adaptability: crystal structures of the cavity-filling variants of Escherichia coli RNase HI
pubmed doi rcsb
source organism Escherichia coli
total genus 48
structure length 153
sequence length 153
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3aa2A00
3NDKA 1GOAA 3K5LA 4PWDA 5T7BA 3OYLA 1J9AA 3L2RA 4BE2A 2F8SA 2I5JA 3HL8A 3OYAA 2BE2A 2BGGA 4CK2A 3K58A 3O3GA 4FJNA 1XC9A 1ZBHA 1ITGA 1T7PA 4I7FA 4K8XA 4KB1A 5I42A 4M3TA 1WSJA 1NKBA 3LAKA 4CJ5A 3RMCA 1N5YA 1D8YA 4DTOA 2E6LA 4IBNA 5HRPA 3L8BA 4Z0UA 4HTUA 4EZ6A 1BISA 2DY4A 3LPTA 3ZT2A 3M8RA 4KI4A 4CGHA 5HP1A 3OJSA 2A1RA 1KLNA 1JLCA 1TKDA 1Q9YA 3S3OA 3U3YA 1QSSA 4N47A 1R0AA 3BDPA 1F21A 1X9SA 4B08A 4CJVA 3AVCA 5EU7A 3PO4A 2FC0A 3D45A 4I9LA 1ZBLA 3LALA 1HJRA 5FROA 3KTQA 4CF8A 4CJEA 4FJHA 1FKPA 2D5RA 1D9FA 5JS1A 1RT2A 1ASWA 5CZ1A 3QEIA 4DU3A 3DRPA 4DTXA 3DOLA 4FLYA 4DQRA 1DTQA 3BGRA 1YTAA 3NGYA 4ELTA 4CEAA 3OS0A 3OYMA 3F73A 4FJKA 4ELUA 4HHTA 1W0HA 2OPSA 4DSKA 2WONA 2YHBA 3C95A 3IRXA 3DLBA 5SZTA 4RW8A 3C6TA 3M8QA 1RBTA 4AHTA 3CFOA 1KTQA 4W5OA 3P5JA 4E7KA 4LY7A 2XY8A 4BDPA 4EZ9A 1WSFA 3NF7A 1YTUA 4FJJA 1VSEA 3MEGA 3KD1E 5HROA 4AHVA 3MXMA 3THVA 4ID5A 1BCMA 1IKWA 2OA8A 4DFKA 4FZXC 2FBTA 3QESA 2HB5A 2Z1JA 3AVFA 3F9KA 4JS4A 1NJZA 4Z4FA 4Z4HA 3EYZA 1YVUA 3NE6A 4MQ3A 3OYFA 1RBUA 3RR8A 2HHUA 1IKYA 1W9HA 1RNHA 1RDAA 2YNGA 4IFVA 2AJQA 3DMJA 4KHSA 3LZJA 1RTIA 1VSHA 3U3GA 2HVHA 4MFBA 4CEZA 1G15A 2LSNA 3V1QA 4FK2A 4M3XA 1JL2A 1REVA 1BQMA 1EXQA 1QHTA 2IOCA 2ATQA 5J1EA 4RW9A 1J5OA 3VQ9A 3VQ8A 3HYFA 4H4OA 4J2EA 1Q8IA 3AO1A 5KI6A 1EKEA 3VA0A 4C8LA 2XY6A 5SWMA 1T03A 2F8TA 1TKXA 4CGIA 3SUQA 3KK3A 3LPUA 4FJ9A 3LP3A 4DLGA 4Z4EA 3PO5A 4FJMA 3LDSA 4HUEA 2HHXA 1WAFA 4DQPA 2KFNA 4EP5A 1KVBA 1Z26A 3VA3A 4FJIA 3PX6A 1S5JA 1S6PA 1JKHA 1L3TA 2KFZA 4KO0A 4CJ3A 3QIPA 1UAXA 4Z4IA 2BANA 3CYMA 4E89A 1XI1A 3TR8A 3HPOA 3IG1A 1CLQA 1EX4A 3V4IA 3WNFA 4CHZA 4E7LA 4QAGA 4OJRA 1XHZA 4B8CA 3SUPA 4KRFA 3E01A 4E1NA 4DTRA 4TSXA 2KZMA 4LH4A 5CY4A 2XHBA 1D5AA 1ZBFA 1FKOA 1JL1A 2HHTA 4NCGA 2XY7A 3G10A 3KLIA 1C1CA 4CHQA 3RRHA 1QTMA 1UA1A 3AA5X 5KRSA 4IG3A 3HVTA 3S3MA 4FJ7A 4BDZA 1KRPA 3CM6A 2P5OA 1T05A 4FK4A 5J2QA 4CE9A 3T3FA 1NJWA 2Z1HA 3RMDA 1SL2A 4DFPA 1RILA 3PY8A 1K6YA 3HT3A 5J2PA 4B3OA 2RN2A 4CJUA 1TK0A 4FZZA 3K5OA 1J53A 5C25A 3EZ5A 3SPZA 1L3SA 4DWIA 4O5BA 2QKKA 3OYBA 2OPRA 2QKBA 4DFMA 2VG7A 3DLGA 2W42A 3SQ2A 4QOZB 1SKWA 4C8OA 3KLFA 4DS4A 1NK6A 4AHUA 4CF0A 4DSFA 3V9SA 3QERA 1Z25A 3V81A 4Q0BA 1TK5A 4DLEA 3QEVA 4AH9A 3WNEA 1EP4A 2X74A 1JLQA 1JLEA 1BHLA 1VSDA 4JRPA 1KVAA 3B6OA 1RDBA 4KHYA 4FXDA 2G8VA 4EP4A 3KK1A 3ZT0A 1VSIA 4IFYA 4WE1A 4OKEA 1QS4A 4OGCA 3EY1A 1RDCA 3DRRA 1KFSA 4N56A 3OYNA 2IS3A 3O4NA 4RW6A 3OYGA 2VWJA 2VG5A 1LW2A 1Q9XA 2FBYA 1SKRA 4OLBA 5KTQA 2Q3SA 2YKMA 1RCHA 3KLHA 4B9SA 3I0RA 4RW7A 3T19A 4FLWA 4FLXA 4DSEA 3RMBA 3LWMA 3AO2A 1RTDA 3KK2A 1U48A 1S1VA 3MXIA 1U4BA 4IKFA 4KHWA 2IC3A 1HYSA 1C1BA 3MAQA 2YNHA 4KTZA 3OS2A 2D0CA 2YKNA 1TGOA 3NH0A 1HNVA 4CEQA 4W5QA 3AO4A 3PX0A 2JLEA 3B6PA 4AILC 1KSPA 1TAUA 1HPZA 4FLUA 4DU1A 3VQCA 3QETA 3QO9A 4M3UA 4BWMA 1WAJA 1LW0A 1BCOA 4N41A 3QINA 1C6VA 3CM5A 1TL1A 4FW1A 4O44A 4RG8A 4E7HA 3VQDA 3MEEA 5HLFA 4K8ZA 3VQ7A 4RW4A 1B9DA 3NH1A 1VSKA 1TL3A 3D0PA 5C24A 2HNYA 3TAPA 3KD5E 4PUOA 4ID1A 3OYKA 3DRSA 2BDPA 4CF2A 4ELVA 4KFBA 3ZT1A 2QK9A 4DF8A 4CGFA 3AVJA 1WSEA 2GV9A 1ASVA 2GUIA 4CF1A 2E4LA 1NOZA 3TANA 2D0AA 1L3VA 1HQUA 2YV0X 4PA1A 4Y1CA 4JLHA 4J2DA 5J2NA 4OLAA 1CXUA 3VQQA 3HP6A 3ZSZA 4KTQA 1HMVA 3ISNC 3TAFA 1UWBA 2XO7A 1IKXA 4CJ4A 5JS2A 4CJTA 4CHNA 4DU4A 2WOMA 1CXQA 1C1AA 3JSMA 4FJLA 3ZSOA 1YT3A 4NYFA 3VQ5A 4W5RA 1T8EA 1GOCA 3DLKA 1I39A 2F96A 4CJKA 3SQ0A 1NK9A 3AVMA 1RBRA 3AVIA 3C94A 3HSTB 4FZYA 3P1GA 1UOCA 1S6QA 3HXMA 3MXJA 4GMJB 4BACA 3TARA 2P5GA 4M3ZA 2D0BA 2G8IA 4JRQA 4CK1A 4DG1A 4Z4CA 4B9UA 1I3AA 1RT6A 4HCBA 1U47A 3P83D 4L8RB 3I0SA 1JXBA 1X1PA 2KTQA 4FM1A 2XY5A 1JXEA 2ZQBA 3AV9A 2DTUA 3SI6A 3HK2A 1BI4A 2KZZA 3FFIA 3HM9A 4DTMA 2Y1IA 4LSNA 4O4GA 4DSIA 4FJ8A 1S1UA 1RTHA 1J54A 4CECA 3LAMA 3NH2A 4DTUA 1KCFA 3VQBA 3TAQA 1U45A 3ZSWA 5DK5A 1NK5A 3DI6A 3H08A 1VSJA 3IAYA 3HO1A 1QQCA 1DLOA 4F8RA 4Q5VA 3NHGA 5K14A 5FRNA 1A5XA 3NGZA 3I8DA 4DS5A 1SKSA 3HJFA 3O3HA 1JLBA 3V9WA 4FJ5A 1KVCA 3K59A 2FBVA 3V1OA 3OJUA 3LANA 3QNOA 4F2SA 4FJXA 1LAWA 3VN5A 3G0ZA 5KGXA 4DF4A 4CEDA 3DLRA 4FYDA 4NYNA 3DM2A 3ZT3A 4PY5A 3AVNA 1LWFA 2RF2A 3SV3A 4M45A 4CJFA 1LAVA 4LD0A 1LV5A 1B92A 3KJVA 2E6MA 1U49A 2PZSA 3SQ1A 3A2FA 5KRTA 3V6DA 4B9LA 4OKJA 4LH5A 3SV4A 2FBXA 2QXFA 4I2QA 4AHCA 1RDDA 3TAGA 4CEEA 5I3UA 4LSLA 5CZ2A 3NF8A 3VQEA 1BI4B 3SZ2A 1ZBUA 2P51A 4UQGA 3OVNA 3AVHA 1JLAA 3ULDA 2Y1JA 3U6FA 4OPJA 4M41A 2ZD1A 1TK8A 1RT7A 4DFJA 3OYEA 4J2AA 4CJRA 4B9MA 3AA3A 1Y97A 2NUBA 4H4MA 1TAQA 3K2PA 4IG0A 1RTJA 3ZSRA 2OZSA 1TVRA 3ITHA 1BIZA 3OYHA 4F3TA 1HYVA 2RPIA 5HRNA 2EX3A 3LP0A 3S9HA 2ETJA 2VG6A 4FVMA 5CYQA 4B8AB 4N5SA 4F3OA 4CJPA 1CZ9A 2HNZA 1IH7A 3RTVA 4CCHA 3V9XA 4KKOA 2YNIA 2EHGA 1RT5A 3HPGA 4BE0A 3RRGA 4CJWA 4HUFA 3S3NA 4CIGA 1HYZA 4HUGA 4FW2A 3CFRA 4FM2A 3C6UA 4CJLA 4KTWA 4B9NA 4ZHRA 1NK4A 1NK0A 3LP1A 3T1AA 3V1RA 4E1MA 1N6QA 1RT4A 3CG7A 2G8KA 4DQIA 3TI0A 4E0DA 3QLHA 3SCXA 1VSFA 1ZBIA 4CHPA 4OGEA 3LZIA 3RMAA 2HNDA 1S1WA 3WNGA 1SV5A 4CERA 2G8FA 4DTNA 3LWLA 1HQEA 1BL3A 4YNQA 1C0UA 5FDLA 4CJSA 4OVLA 4QCLA 3DLEA 4CFDA 2XRIA 5DMRA 2Z1GA 3O3FA 4DTSA 3AA2A 1VK0A 3SYZA 2DFEA 3QNNA 3AVLA 3V9ZA 5KGWA 4AHRA 1S1XA 4KAZA 3NGIA 4CHYA 2HVIA 4DQSA 3V9UA 1IG9A 4BWJA 2DFFA 3DOKA 2B5JA 2O4GA 3NBPA 3SQ4A 4M42A 3PV8A 4CF9A 1FXXA 2B4JA 3MECA 1SUQA 3L3UA 1QSYA 3UIQA 3IS9A 5FRMA 3OYIA 1NJXA 1JLFA 3OYDA 2OYQA 1BIUA 3KKRA 4F2RA 3MEDA 4FCYA 3AVGA 2HW3A 3DYAA 4CFCA 1NKCA 2HHWA 3NCIA 1U04A 2A1SA 4ICLA 4FLVA 1KFDA 3OYJA 4M3WA 2X6NA 3ZSQA 3AVAA 4E7IA 3RWUA 1RBSA 3ZSYA 3TAMA 1MU2A 3KKSA 3WNHA 1ZYQA 3L2UA 4J2BA 4E3SA 4CEFA 3VQ4A 3SNNA 4ZTFA 4FLZA 3L2VA 3ZCMA 2OPQA 4O0IA 3OS1A 4KV8A 1VSLA 1O1WA 3K57A 1L5UA 4KB0A 4O0JA 2X78A 5D3GA 1X9WA 2Z1IA 3RR7A 4FJGA 2HHSA 3AVKA 5HRRA 3ZT4A 4CEOA 1A5WA 1XWLA 2PY5A 4R5PA 1GOBA 4BE1A 1WSHA 2P1JA 3AO3A 1A5VA 3HPHA 1QSLA 4W5NA 1NJYA 4Z4GA 4YFUA 1WSGA 1S9GA 3TABA 1RBVA 3LP2A 4Y1DA 3L3VA 3ZSXA 4E19A 2IAJA 2OPPA 2KW4A 2IGIA 4DSJA 4F4KA 4CGDA 2ZE2A 1FK9A 1NOYA 2JGUA 5C42A 3SPYA 3HVRA 4O55A 1IKVA 4AHSA 4JS5A 4N76A 4M3YA 3ASMA 3JYTA 4DQQA 3KIOA 4DTPA 3CFPA 4KHUA 4KPYA 2O4IA 4CGGA 3QEWA 1WSIA 2YHAA 3L2WA 1B9FA 2YNFA 2R7YA 1X9MA 2PYJA 3NF9A 2HHVA 4I2PA 4CJQA 4NCBA 4KI6A 1IO2A 1HNIA 4CK3A 2IDOA 4DSLA 3CQ8A 4FK0A 1WN7A 3KLGA 1ASUA 4CEBA 5J2MA 1D9DA 1NK7A 4B9VA 4HCCA 3K5MA 4W5TA 3L2QA 1QE1A 1SL0A 1XHXA 2GBZA 3VQAA 4CIEA 5E41A 3NF6A 3ALYA 3AA4A 4CFAA 3TAEA 3SUOA 3SJJA 1VRUA 1WLJA 3VQPA 2RKIA 1JLGA 2G8WA 4B9TA 3VQ6A 4H8KA 4DTJA 4CIFA 4C8MA 4ZTJA 4KREA 1KLMA 4I9QA 4GW6A 1NKEA 4CHOA 2ITGA 1S1TA 3PX4A 3QEPA 1SL1A 4KHNA 4GVMA 2HMIA 4BDYA 4KHQA 4OKKA 2VWKA 3NAEA 2OZMA 3TWHA 5HBMA 1VSMA 3SUNA 4CGJA 3HP9A 1TV6A 4IDKA 4FLTA 2G8HA 1S9EA 1DTTA 3DLHA 4PQUA 1HRHA 1C0TA 3M8PA 2X6SA 3QIOA 2B6AA 4OPKA 1BQNA 4CESA 3KLEA 4XIUA 3PUFA 4E7JA 4M3RA 4G1QA 1CZBA 1EETA 4HVJA 3K5NA 1RT1A 4C8NA 3AO5A 4CFBA 2KQ2A 1NK8A 2HHQA 4C8KA 1LWEA 4DMNA 1RT3A 1VRTA 4FM0A 3OY9A 3QEXA 2PYLA 1LWCA 4NCAA 1TKTA 1BGXT 2DFHA 3NFAA 1WNSA 3O4QA 3ZSVA 5HRSA 3OYCA 3M8SA 1L3UA 3AVBA 2G8UA 1UA0A 1C0MA 1TKZA 5CYMA
chains in the Genus database with same CATH superfamily
4V19S 2GX9A 1SQKA 4RCHA 1T7PA 4KB1A 5I42A 4M3TA 1NKBA 3LAKA 3RMCA 4A2BA 4BVOA 2FF6A 2E6LA 5HRPA 1ESVA 3IDHA 1VQ8N 4EZ6A 1BISA 1W7AA 3LPTA 4KI4A 3CCLN 1JLCA 1TKDA 1QSSA 3S3OA 4MO5A 2HBKA 3VEYA 1NGAA 3D45A 1HJRA 3KTQA 4CJEA 2FSNA 1D9FA 1OH6A 4DQ8A 5CZ1A 3DOLA 4CZIA 3CMAN 3OYMA 5BPNA 3TSUA 2OPSA 3VPZA 4DSKA 4JI0K 2YHBA 2O8EA 4WYBA 1V4TA 5SZTA 3DXMA 3P5JA 4E7KA 3BEXA 4FJJA 4JN4A 3KD1E 4I6MB 2E5LK 3FZHA 4ID5A 5GIOA 5H1SQ 3AVFA 2O8FB 1SS6A 2HHUA 1IKYA 1W9HA 1XNQK 2AJQA 5I9EB 3N4PA 1GLBG 3EO3A 4CEZA 2GTDA 1VQ6N 1BA1A 2YJEA 4M3XA 3VMFB 1WUAA 3ENBA 5J1EA 3LM9A 4IEEA 4BC3A 1T03A 3O80A 4CGIA 4Z4EA 3LPUA 3LP3A 4JKAA 1T44A 2VQFK 3I33A 3FLCO 4QS8A 3D2FA 3D7EO 3LDOA 4JI4K 4MO4A 3U4LA 4YORA 3C6HA 4QS9A 1R59O 1VQON 4JK8A 1S6PA 1L3TA 4FOEA 5JVHL 3O1BA 5M1FA 1XI1A 4BRHA 5AQFA 3SAHA 4CBWA 4FWSA 4OJRA 3E01A 4E1NA 4WCEL 2V7ZA 4FVUA 4TSXA 2YHXA 2HHTA 4NCGA 4ILGB 4O8UA 3CHWA 4FWQA 5KRSA 1EWRA 5KQ8A 3CETA 4NLCA 2ASPA 1C0GA 4FJ7A 3WXMB 4H5WA 3CM6A 2P5OA 3T3FA 1SL2A 1RILA 3PY8A 4BC4A 5J2PA 4K42A 3K5OA 3WXKA 5FPMA 2ZJQL 1L3SA 3MWPA 3OBWA 3ULEB 2A41A 4DFMA 4OPAA 5GINA 2VQEK 4C8OA 4DS4A 3PSFA 3QEVA 4AH9A 1EP4A 5DM7L 2X74A 4JRPA 1VSDA 1KVAA 1LCUA 2E8AA 2G8VA 4EP4A 3ZT0A 4IFYA 5HL7L 2QEXN 4BR2A 1JCFA 4N56A 2IS3A 4UY8O 1Q9XA 1Q7YO 4OLBA 3H45C 2Q3SA 3KLHA 2UU9K 2HBJA 4FLXA 4DSEA 2IC3A 3UKUA 3MAQA 2YKNA 4CEQA 4W5QA 1O13A 4JKEA 3AY9A 1VQ5N 1T6CA 4FOIA 4O44A 3NH1A 1B9DA 1XQSC 5BPMA 2Q1NA 3H1VX 3U9DA 3D0PA 4PUOA 1S72N 1H1VA 3L4IA 3WT0A 4A2AA 2ITMA 4DF8A 1ASVA 2GV9A 2V52B 1VQNN 1YVNA 2D0AA 1NGIA 1RDWX 1NGJA 4YOXA 4FWKA 2UYTA 1E4GT 4J2DA 5J2NA 2I7PA 3ZSZA 1HMVA 4B3MK 2YX6A 1IKXA 3BF3A 1S22A 3KVGA 1XMQK 4DU4A 3SLCA 2WOMA 2O8DB 2NLXA 5FPEA 1KAYA 1YIJN 4CJKA 1NK9A 3D2EA 4CZHA 1S6QA 3MXJA 4EAHD 3VEVA 4B9UA 1I3AA 1RT6A 1U47A 2P9SB 3AV9A 1WOQA 3HK2A 1BI4A 3HM9A 4LSNA 4FJ8A 1S1UA 3THXB 1WBBA 2V51B 3LAMA 3Q7BA 1U45A 4DV3K 3DI6A 3H08A 1VSJA 4ISFA 1VQLN 1QQCA 3H1QA 3NHGA 1SZ2A 4CZEA 1A5XA 3I8DA 1SKSA 4GVEA 3O3HA 3MN9A 3V9WA 3LANA 3ZX2A 2IVOA 1NM1A 4DF4A 3DLRA 3I55N 3Q7CA 4JKBA 4NYNA 4PY5A 3SV3A 4M45A 4LD0A 3KJVA 1U49A 5M1NA 3VGLA 4B9LA 4OKJA 4LH5A 1HR0K 4I2QA 3TAGA 5LMNK 3FE1A 4BRMA 5CZ2A 3D6RA 3VQEA 1ZBUA 2P51A 4UQGA 3AVHA 4MLHA 2Y1JA 2QWOA 4BR4A 3U6FA 2NRTA 4OPJA 2ASMA 4JKHA 4U67L 1TK8A 4DFJA 3OW2M 1OKJA 3AA3A 3ZSRA 5GIPA 2HHSA 2E2PA 3K2PA 2QWNA 4PKGA 3R9PA 3U9ZA 4CZGA 3EE9A 3LP0A 3MMVA 2ETJA 4B8AB 2QXLA 4CJPA 2QWLA 2QWRA 1VAZA 4CJWA 1N8RO 2NRXA 1XMOK 1HYZA 4FM2A 1P90A 4BQLA 4ZHRA 5GAGP 1NK4A 1NK0A 5AQMA 4E1MA 3V1RA 1N6QA 1RT4A 3A5LC 3CMEN 1S1WA 3WNGA 1SV5A 4JNEA 1HQEA 1C0UA 1NGEA 4DTSA 5ELZA 4JI2K 2DFEA 3E9PA 4AM7A 5KGWA 3NGIA 3FZLA 4CHYA 5BR8K 3DOKA 1BO5O 3NBPA 4M7YA 4R79A 3E1YA 1K8KB 3MECA 1QQNA 1OH7A 3IS9A 4NO7A 3OYIA 1NJXA 1JLFA 3THYB 4F2RA 3MEDA 5LJWA 4JKFA 1NKCA 2FXUA 1VQ7N 4IDHA 3NCIA 1K73O 1U04A 2A1SA 3O9RA 1ZYQA 3WNHA 3W0LA 3L2UA 1ATRA 3SNNA 3K57A 3T1YK 4KV8A 1O1WA 3ZEUB 4BRDA 4YY3K 5D3GA 4CD1A 1BA0A 4GV9A 2PY5A 4R5PA 1GOBA 4BE1A 2D0OA 1WSHA 3AO3A 1A5VA 2E20A 2P9LB 2UUCK 3L3VA 3ZSXA 4E19A 2OPPA 4F4KA 3BY5A 4O55A 3SBTA 4AHSA 4JS5A 4M3YA 3ASMA 4DQQA 4DTPA 3G6EN 4O5FA 3QEWA 1WSIA 3TPQA 3L2WA 3E9OA 1N34K 1X9MA 3TTFA 2HHVA 1IO2A 1HNIA 2IDOA 4FK0A 1ASUA 4CEBA 5J2MA 2E1YA 1ATSA 4CIEA 3ULEA 3AA4A 5AFUA 3VQPA 1NGCA 3C7NB 4H8KA 4CIFA 3UE5A 4ZTJA 4GW6A 4CHOA 1EWQA 5AQRA 3QEPA 1SL1A 2P9UA 4O8KA 2OANA 4BDYA 3AAQA 4GKJK 3SUNA 4CGJA 3HP9A 4FLTA 5BN8A 4BC5A 4CESA 3KLEA 5AQWA 3PUFA 1U6ZA 4E7JA 3S41A 1NK8A 3K5NA 2GUPA 3WQUA 4JK9A 1RT3A 1VRTA 5M1QA 4FM0A 2HBLA 2YI1A 3QEXA 2PYLA 5CE3A 4EFHA 1SAZA 1WNSA 5MLCQ 3OYCA 2G8UA 1U2VB 5KPTA 3O9UA 1TKZA 5T7BA 1J9AA 4BE2A 2I5JA 3DXKB 1ZBHA 1XC9A 1ITGA 4WFBL 4YHHK 4CJ5A 3VF4A 4IBNA 4Z0UA 3W3DA 2IIRA 1HKCA 4CGHA 3OJSA 3CC4N 2NRRA 4JI5K 1R0AA 4JKGB 1F21A 2CGLA 4B08A 3PLAA 1S3XA 4DV5K 4X65K 4PL8A 4I9LA 3LALA 4BRQA 4FJHA 1FKPA 3KWGA 1ASWA 1GLEG 5E84A 3J7AP 1DTQA 2UXBK 4CZJA 1DT9A 4FJKA 4HHTA 3RSEB 4YDUA 2WONA 3C95A 3NVMA 1MWKA 4RW8A 4NLBA 3THXA 4W5OA 4BDPA 5BR9A 4IO8A 3K9KA 2RHKA 1VSEA 3HZ6A 1N36K 4CZFA 4DV7K 1IG8A 2GELA 2YJFA 2VWBA 2Z1JA 4JS4A 3F9KA 3O5BA 1NJZA 3O08A 3TU5A 3EYZA 4MQ3A 3OYFA 3R8EA 5F2RA 3VEZA 5JICA 3O9TA 4IFVA 3DMJA 3U3GA 2ZJPL 4B1UB 5AJ3K 3LDNA 1HNZK 2LSNA 4FK2A 4LFBK 1JL2A 5M1KA 2QA4N 1Y64A 1BQMA 4RW9A 3VQ9A 4H4OA 5AQKA 3CI5A 1ATNA 2F7TA 1TUUA 3VA0A 2XY6A 2F8TA 4FJ9A 3SUQA 5AZIA 4FJMA 2NRHA 4HUEA 2HHXA 1WAFA 1BWFO 4EP5A 1KVBA 4OO1J 3EL2A 4KO0A 4IEIA 4CJ3A 2BANA 1GLCG 2BH1A 1CLQA 1EX4A 3V4IA 4CHZA 4E7LA 4QAGA 3A5NC 4IJNA 2KZMA 4DR6K 3B8AX 5CY4A 4K41A 2XHBA 1FKOA 3VOVA 3RRHA 4BR7A 5B8HA 1UA1A 3AA5X 4IG3A 3T69A 1KXPA 5AQLA 3BUZB 5AQYA 4CE9A 1NJWA 3J7ZO 3RMDA 2A3ZA 4DFPA 4DKWA 3HT3A 4CJUA 1TK0A 4FZZA 4BR0A 5C25A 5AQVA 3O8MA 3L0QA 2ASOA 1NGFA 2QKBA 1M90O 3SQ2A 1YAGA 3DLGA 1IBMK 3C65A 4GV3A 1SKWA 2VGMA 2P9KB 3V9SA 1Z25A 4DLEA 1K8KA 3J81O 1BHLA 4LFAK 4BR5A 1RDBA 3THYA 4KHYA 4BG8A 1KAXA 3KK1A 4WE1A 4OKEA 4OGCA 1K9MO 1KFSA 3O4NA 1NMNA 1RCHA 3CJ7A 3I0RA 3T19A 1RFQA 3M3ZA 2D0PA 3AO2A 4IKFA 3O9QA 1S1VA 3CJ9A 3ZX3A 4KH4A 1HNVA 2JLEA 3N4QA 3B6PA 1TAUA 2IVPA 4BG9A 3QETA 1NWKA 1LW0A 4N41A 3CM5A 4BVPA 4RG8A 3VQDA 3MEEA 4FWOA 1TL3A 3FR0A 5C24A 3KD5E 4H0TB 3OYKA 1M1KO 3GDQA 5AQXA 3ZT1A 2A42A 1WSEA 4CF1A 3THWB 1L3VA 2FSKA 1HQUA 2YV0X 1WBDA 1KAZA 3AAPA 1CXUA 4A59A 3HP6A 4KTQA 1Q81O 4DUYK 4F9OA 4CJ4A 4YOYA 3G4SN 1CXQA 4NYFA 1YJWN 2GWJA 3C94A 3HSTB 2HSTA 4BACA 3C7NA 4CJ7A 4Z4CA 4HCBA 3BP8A 5EY4A 4L8RB 3I0SA 5GADP 4FM1A 3MWTA 5C10A 1JXEA 1KQSM 2KZZA 2ZGZA 3P38A 2Y1IA 4DSIA 1RTHA 1V4SA 1J54A 3TAQA 4JHDB 2QM1A 4QS7A 2YHWA 1T3VA 3A5OC 2NRVA 3HO1A 1BOTO 3HRGA 4JI3K 4B3SK 5K14A 5FRNA 4OPHA 3K59A 1U2VA 3IUCA 3QBXA 1HX1A 1LAWA 3VN5A 3EKSA 4A57A 5KGXA 4CEDA 4FYDA 3QBWA 3AVNA 4LF9K 2P9IB 2E6MA 1YHQN 3BF1A 3A2FA 2F9WA 3CCSN 3V6DA 1WB9A 4IJAA 3CF5L 2CGJA 4BRPA 2FBXA 3SV4A 1FW6A 5I3UA 4LSLA 3C0BA 3M5RA 4BRGA 3CCEN 2Q31A 4JKGA 3PSIA 3ENOA 3OVNA 4BGBA 3UB5A 1GLFO 4J2AA 2P9NB 3VF2A 1NBWA 1TVRA 1BIZA 3ITHA 4WFAL 2RPIA 4CZKA 4YOWA 1FJGK 2A6AA 1HPMA 4K25A 4H0XB 1IH7A 3RTVA 4CCHA 3V9XA 4LC9B 3HPGA 4BE0A 2IVNA 4YDUC 4HUFA 4CIGA 4GY2B 3CFRA 4CJLA 2W40A 3T1AA 3CG7A 4DQIA 3TI0A 3QLHA 3SCXA 4CHPA 1DGKN 4OGEA 3VGKA 5EOYA 3RMAA 2HNDA 4CERA 2GWKA 3LWLA 1BL3A 4YNQA 4OVLA 4QCLA 1E3MA 4MDAA 2Z1GA 3TTDA 3AA2A 3MN6A 4BRKA 3QNNA 3V9ZA 4AHRA 4KAZA 4JI1K 3TTCA 4DQSA 3V9UA 4HTLA 2DFFA 2B5JA 4KBOA 3PV8A 4CF9A 2B4JA 3SMSA 3UIQA 2OYQA 3DYAA 3QMLA 5BRHA 2HHWA 4WF9L 4FLVA 1GLDG 2VYPA 3ENHA 1Z05A 2UUBK 3AVAA 3TAMA 1MU2A 3KKSA 4J2BA 4NXNK 4DR1K 4E3SA 3VQ4A 4ZTFA 3DLBA 3L2VA 3ZCMA 1HKGA 5E26A 4KB0A 2X78A 5A2QO 3VEWA 3RR7A 4YOVA 3AVKA 5HRRA 4CEOA 4FWNA 1Q82O 4Z4GA 4YFUA 1WSGA 3LDQA 1S9GA 4Y1DA 2IAJA 2IGIA 2ZE2A 1FK9A 2W6LA 3SPYA 1NGBA 1IKVA 5AQSA 2O8CB 3CJ1A 2BTFA 4H03B 2YNFA 4IZ9A 4CJQA 1HNXK 4NCBA 3CQ8A 4NXMK 1NK7A 1P8ZA 2ZGYA 3H46O 3K5MA 4W5TA 3L2QA 1XHXA 4DR4K 1TUYA 3NF6A 4PL7A 1WLJA 2QTDA 2P9KA 2G8WA 3VQ6A 3MN5A 4C8MA 4I9QA 2ITGA 1S1TA 3VGMA 3PX4A 4GVMA 4LF6K 1OVYA 3TWHA 4EHUA 1I94K 4PQUA 1S9EA 1DTTA 2YCHA 5EXWA 3WXIA 3DLHA 3QIOA 3NVKA 2B6AA 2UUAK 4M3RA 1N33K 1CZBA 4HVJA 2HHQA 3HBTA 4CFBA 3JS6A 2Q97A 4C1NI 2QI2A 4DMNA 3G71N 1IV0A 4NCAA 2DFHA 3ZSVA 3R3LA 3M8SA 4KHPK 5F0XA 2W41A 1C0MA 5CYMA 5JLHA 3J7YP 1GOAA 2HBMA 2HOEA 3OYLA 3L2RA 2HHHK 3K58A 1VQMN 3AGRA 4IFEA 3ZYYX 2Q2RA 1WSJA 4I6MA 3CXCM 1D8YA 4DTOA 4DUZK 4H0PA 4HTUA 3THWA 2O8FA 4A5AA 5HP1A 1YUWA 1Q9YA 3U3YA 5LL6Z 3FZFA 3KWIA 3SAGA 5IWAK 3AVCA 4JAXA 2OTJN 4LFCK 5EU7A 1HJOA 2FC0A 5FPDA 2YHYA 1X3MA 1VQ9N 5AQUA 5ADXH 1DEJA 3DRPA 4FLYA 3VTIA 3BGRA 1YTAA 3LM2A 3NGYA 3F73A 4JK7A 3H6EA 5M1PA 4X64K 3M8QA 2HF4A 3CFOA 1OVQA 4LY7A 5BREA 2W6KA 3MEGA 3LDPA 5HROA 3MXMA 3THVA 3HI0A 3VETA 1IKWA 4DFKA 1IBKK 3QESA 5GAHP 4Z4FA 3A0IX 1YITN 1KD1O 1RBUA 3CC2N 3CCRN 1RDAA 4KHSA 3LZJA 1RTIA 1VSHA 4GNIA 4M63C 2HVHA 1G15A 3TSQA 1QVFM 3V1QA 1REVA 2P9IA 4B1VA 1YF5L 1EXQA 2IOCA 2ATQA 2CH6A 1J5OA 3GE1A 4XH1A 3VQ8A 1DKGD 3HYFA 4B1WB 3DWLA 2WTUA 3AO1A 5KI6A 5AQPA 5SWMA 3KK3A 4BROA 4DV1K 5KPRA 2KFNA 4YOUA 4B9QA 2CH5A 1Z26A 4FJIA 3PX6A 2KFZA 3QIPA 3IMXA 4FPAA 3HPOA 3WNFA 1XHZA 4B8CA 4KRFA 4DTRA 4RWTA 4IOCL 5AQOA 4DV6K 1ZBFA 3H3OB 2XY7A 3G10A 3KLIA 4CBUA 3EKUA 3HVTA 4AQYK 3S3MA 1NG9A 5C12A 1KRPA 4BY9C 4NB4A 3O4WA 1T05A 4FK4A 5J2QA 2Z1HA 2GEMA 1K6YA 4B3OA 2RN2A 2ZJRL 4CD3A 3ATVA 4GKKK 4WQ5A 4O5BA 3OYBA 4QOZB 2W42A 4AHUA 1JCEA 3PIPL 4Q0BA 3V81A 1TK5A 4U7BA 3OTOK 1JLQA 4FXDA 4H5TA 1EQYA 1VSIA 2O8DA 4ILJA 1GLAG 3CCQN 4DR3K 4RW6A 2FBYA 5KTQA 2YKMA 2I7NA 2A40A 4Y0WA 4FLWA 5TKWA 1Q86O 3CQYA 3KK2A 1U48A 1HYSA 1C1BA 4CVNE 4KTZA 2D0CA 4JD2B 1TGOA 2P9SA 3R6MA 3PX0A 3AO4A 4EIAA 1HUXA 4AILC 2NRZA 3VQCA 1JJ2M 3HOSA 1WAJA 1BCOA 1NGGA 1TL1A 2AP1A 4K8ZA 3VQ7A 4RW4A 4DR5K 1VSKA 4BR9A 2O8CA 5DM6L 3CCUN 4CF2A 4ELVA 3K9JA 4KFBA 2QK9A 4CGFA 2GUIA 1NOZA 4JLHA 1G99A 4OLAA 3OHRA 3TAFA 2XO7A 1J6ZA 5JS2A 4CJTA 1C1AA 4FJLA 3ZSOA 2D1KA 3VQ5A 1T8EA 1GOCA 3DLKA 2F96A 3HOTA 1NNEA 4XH4A 4FZYA 3HM8A 3P1GA 3VF6A 3HXMA 3TARA 4M3ZA 2D0BA 4JRQA 4DG1A 4H0VB 3UKUB 1ZBSA 2ZQBA 5JMVA 4LF8K 3FFIA 4DTMA 1HNWK 4O4GA 1BUPA 5EX5A 4DTUA 3VQBA 1DLOA 4F8RA 4DV2K 1D4XA 1ZXOA 3I8BA 1QQMA 2WFBA 3NGZA 4DS5A 4FJ5A 1KVCA 3QNOA 3OJUA 1K8AO 3A5MC 3WQTA 3DM2A 3FFKB 4K43A 4CJFA 1X9JA 2HF3A 2PZSA 3LL3A 5KRTA 1QVGM 5C2DA 2QXFA 1RDDA 1BI4B 5BN9A 3ZETB 5HOOA 1JLAA 4H5NA 3ULDA 2OCEA 4DV4K 4KH6A 2FF3B 3OYEA 5JVGL 1Y97A 4H4MA 1TAQA 2OZSA 1RTJA 3OYHA 5HRNA 4J8FA 2EX3A 1NJIO 4B3RK 2VG6A 4FVMA 4N5SA 3T1HK 4F3OA 1CZ9A 2HNZA 2QW9A 4LF4K 2YNIA 2EHGA 4IOAL 1RT5A 3CQXA 4H5VA 4IOXA 3S3NA 3BZKA 3C6UA 4B9NA 4KTWA 3ZEUA 2ZM6K 3LP1A 5AZJB 1ZC6A 3LZIA 5AQTA 2NNWA 5CR4A 1MWMA 1VHXA 4JV5K 2P9LA 4H0OA 1E4FT 5FDLA 3DLEA 2XRIA 4WFNL 2E2QA 1VK0A 3SYZA 3AVLA 3O1WA 3CC7N 5C0YA 4BWJA 2QWMA 5AQGA 2NRWA 3K0SA 5EVZA 3R1XA 1QSYA 1X3NA 3OYDA 4BGAA 4FPBA 4FCYA 3AVGA 2DPNA 4CZLA 4FWMA 4RTFD 3LDLA 3ZSQA 3ZSYA 4BRNA 3FZMA 4O0IA 3OS1A 4DR2K 1VSLA 1L5UA 4O0JA 4FSVA 3J80O 2Z1IA 3SK3A 3JAMO 1XWLA 3MK6A 4BREA 2P1JA 2OTLN 2PFUA 3HPHA 1NJYA 3MX2A 3VTHA 3TABA 1RBVA 3AARA 3EN9A 3GOIA 1NOYA 2JGUA 5FLXO 5C42A 3HVRA 1XNRK 2UXDK 5AQQA 3JYTA 3KIOA 4KHUA 4KPYA 2O4IA 4CGGA 2YHAA 2NZTA 4M7XA 4CI6A 2PYJA 3NF9A 4I2PA 2Q0RA 5LMUK 4CK3A 1C0FA 1D9DA 4B9VA 4HCCA 3DXKA 1QE1A 5BRFA 1SL0A 5AQZA 2GBZA 3O6WA 2FSJA 3SJJA 3AGKA 1VRUA 2RKIA 1JLGA 4WQ5C 3VENA 5LJVA 1NKEA 5CHIA 2D4WA 2HMIA 3QFPA 4DCHA 3BZCA 4KHQA 1N32K 1TYQB 1VSMA 1TV6A 4MLEA 2G8HA 1HRHA 4OPKA 1BQNA 4XIUA 4G1QA 4C8NA 2VCPA 2O8BB 4C8KA 1LWEA 3DAWA 3OY9A 1LWCA 4JD2A 1BGXT 3CCJN 5TKYA 5HRSA 3VESA 1UA0A 3RSEA 3NDKA 3K5LA 4PWDA 2F8SA 3HL8A 3OYAA 2BGGA 2BE2A 4CK2A 3O3GA 3WUHA 4FJNA 4K8XA 4I7FA 5GAEP 4X66K 3VEXA 5ADXA 1N5YA 3KHYA 3L8BA 1VQKN 1JCGA 3ZT2A 3M8RA 2P9UB 2A1RA 1KLNA 1Z6RA 4X62K 4N47A 3EE8A 4B3TK 3BDPA 4A62A 1X9SA 4DR7K 4CJVA 3PO4A 1ZBLA 5FROA 4CF8A 4DHYA 2D5RA 5JS1A 1RT2A 3NMUA 5C15A 2F9TA 3QEIA 5AR0A 4JYAK 4DU3A 4DTXA 4DQRA 5JLFA 2WBNA 4A61A 4ELTA 4CEAA 3OS0A 4B1ZA 4ELUA 1W0HA 3IRXA 4ISGA 4K0KK 2CGKA 4AHTA 3C6TA 1RBTA 4YOTA 1KTQA 2XY8A 4EZ9A 1YTUA 1WSFA 3NF7A 5AQHA 1YJ9N 5FPNA 4AHVA 2OA8A 1BCMA 4FZXC 2FBTA 4XH5A 2HB5A 3SBGA 3QFUA 4B1YB 4Z4HA 1YVUA 3NE6A 4ILHA 3SAFA 1EO1A 3RR8A 1RNHA 2YNGA 3F5TA 1W97L 4MFBA 4MDBA 4CZMA 1LOTB 3F9MA 1MDUB 3CCMN 1QHTA 4BRLA 3ID6A 4FL9A 4IXCA 4J2EA 1Q8IA 4H0YB 2PBDA 1EKEA 4C8LA 3ZETA 1J5EK 1TKXA 3MCAB 4DLGA 3PO5A 3LDSA 4BRCA 4DQPA 3SMPA 4BC2A 4CW7B 1IBLK 3VA3A 4JKDA 3WEEB 1OH8A 1S5JA 1JKHA 3IFRA 1UAXA 4Z4IA 3CYMA 4AM6A 1NMDA 4E89A 3TR8A 3IG1A 3SUPA 4LH4A 1D5AA 1NU0A 1RDUA 4FO0A 1JL1A 4JI8K 1C1CA 4CHQA 1QTMA 2E2NA 4H5RA 4BDZA 2UXCK 5AZJA 3QICA 1J53A 3EZ5A 3SPZA 5AZIB 4DWIA 3P39A 2QKKA 2OPRA 3VERA 2VG7A 3CIPA 3M6GA 3WXLA 5BRDA 3KLFA 1NK6A 4CF0A 4DSFA 3QERA 5IT9O 1ILYA 3WNEA 4CBXA 1JLEA 3B6OA 2J4RA 1MA9B 3H3NO 1YI2N 3QDKA 4WQ4A 2H3GX 1CZAN 4C1NK 5AQJA 3CJCA 3CD6N 3F2KA 1QS4A 3EY1A 1RDCA 3DRRA 3OYNA 3OYGA 2VWJA 2VG5A 1LW2A 1SKRA 3UKRB 4B9SA 4RW7A 3RMBA 3LWMA 1RTDA 3MXIA 2HMPA 1U4BA 4KHWA 2P9PB 2YNHA 3OS2A 1RGIA 3NH0A 1KSPA 2EWSA 1HPZA 4FLUA 4DU1A 3CPWM 4DV0K 1QHAA 3QO9A 1Q18A 4BWMA 4M3UA 1QZ6A 3QINA 1C6VA 4FW1A 5HLFA 4E7HA 5BPLA 3MCPA 3TAPA 2E1ZA 2HNYA 4JHDA 4ID1A 5KPZA 1XUPO 4IO9L 3DRSA 2BDPA 3ZX0A 3AVJA 2E4LA 3HSCA 3TANA 4PA1A 4Y1CA 1GLJO 2RE2A 2WUSA 2AA4A 2V7YA 3VQQA 5AQNA 1IJJA 3ISNC 1UWBA 2VGNA 4CHNA 3CJAA 4AF1A 3JSMA 1YT3A 4W5RA 3IKMA 1I39A 3SQ0A 2KHOA 3AVMA 1RBRA 2BUPA 2E88A 3AVIA 4FWPA 1UOCA 4GMJB 2P5GA 4BRIA 1NGDA 2G8IA 1NLVA 3WXJA 3P31A 4CK1A 3ZLJA 4FWLA 3P83D 1JXBA 1X1PA 2KTQA 3ATUA 2XY5A 2DTUA 3DJCA 3SI6A 1BDGA 1TYQA 2O8EB 4GV6A 3DXMB 1BG3A 5AQIA 4CECA 3NH2A 1KCFA 3PIOL 3ZSWA 5DK5A 1NK5A 4JEPA 3IAYA 3ID8A 2P9NA 2O8BA 4Q5VA 3EEQA 2JWKA 3HJFA 1VQ4N 1JLBA 3L6QA 3GG4A 4A5BA 2JWLA 3MDQA 2FBVA 3V1OA 1YJNN 4F2SA 4FJXA 1ZBIA 3OA9A 4B1XB 3G0ZA 3KZBA 3ZT3A 1LWFA 2RF2A 3OBYA 1LAVA 4JKCA 4KH5A 1B92A 4BRAA 3SQ1A 3CPEA 3CCVN 2FLOA 3KK7A 4AHCA 4BQZA 4CEEA 3NF8A 3SZ2A 1OH5A 1KC8O 3MX5A 1QZ5A 3JXUA 4M41A 2ZD1A 3D2FB 1RT7A 4CJRA 2WC9A 4B9MA 4IG0A 2QWQA 2NUBA 2DY4A 4F3TA 3GBTA 1HYVA 4BRFA 3S9HA 3CJBA 5CYQA 2A5XA 2KKZA 4IWVA 2Q36A 4KKOA 3M1FA 3RVCA 3RRGA 1GLLO 5M1OA 3C6AA 4FW2A 4HUGA 5F1XA 4E0DA 1XC3A 2G8KA 4PKHA 4PKIA 4XEIA 1VSFA 3L4QA 4DB3A 1NGHA 3HTVA 4DTNA 2G8FA 4CJSA 3O9SA 4CFDA 5DMRA 3O3FA 3GL1A 4ISEA 1S1XA 4OX9K 2HVIA 3G25A 1IG9A 3SQ4A 4M42A 2O4GA 1HKBA 3J8AA 1FXXA 1SUQA 1QQOA 3L3UA 5FRMA 2HW3A 1BIUA 3E9LA 3KKRA 3SJHA 3MN7A 4CFCA 4ICLA 3FZKA 2KLAA 1KFDA 3OYJA 4M3WA 3VEOA 2X6NA 3RWUA 4E7IA 1RBSA 1HLUA 3DLLL 4CEFA 4FLZA 2OPQA 2QWPA 3CERA 3WEEA 1X9WA 4FJGA 1VQPN 3ZT4A 1A5WA 2PAVA 3TSPA 3P4IA 1QSLA 4W5NA 2Q0UA 3LP2A 4DSJA 4L3QA 1T6DA 2KW4A 4CGDA 4HWIA 4N76A 5KQDA 4C23A 3CFPA 3T7ZA 4E1JA 1B9FA 4FWRA 2R7YA 4KI6A 2ZF5O 4DSLA 1WN7A 4Z94A 3KLGA 4JI6K 4G9ZA 3VQAA 5E41A 3D2EB 3ALYA 4LF7K 4CFAA 3TAEA 3SUOA 3U8XA 4B9TA 4DTJA 4KREA 1KLMA 4KHNA 3QB0A 4JI7K 2ZWHA 4OKKA 2VWKA 5C2FA 3NAEA 2OZMA 4LF5K 5HBMA 3I56N 3A8YA 4IDKA 4EHTA 5LY3A 2F4VK 1C0TA 2E2OA 3M8PA 2X6SA 4WQ4C 3UKRA 1EETA 5AFUH 1LV5A 1RT1A 3AO5A 2KQ2A 3E66A 4PHTX 2P9PA 1TKTA 3FGUA 3NFAA 1BU6O 3O4QA 1L3UA 1YXQA 1W2BM 3AVBA 3EZWA
chains in the Genus database with same CATH topology
3NDKA 1GOAA 3K5LA 4PWDA 5T7BA 3OYLA 1J9AA 3L2RA 4BE2A 2F8SA 2I5JA 3HL8A 3OYAA 2BE2A 2BGGA 4CK2A 3K58A 3O3GA 4FJNA 1XC9A 1ZBHA 1ITGA 1T7PA 4I7FA 4K8XA 4KB1A 5I42A 4M3TA 1WSJA 1NKBA 3LAKA 4CJ5A 3RMCA 1N5YA 1D8YA 4DTOA 2E6LA 4IBNA 5HRPA 3L8BA 4Z0UA 4HTUA 4EZ6A 1BISA 2DY4A 3LPTA 3ZT2A 3M8RA 4KI4A 4CGHA 5HP1A 3OJSA 2A1RA 1KLNA 1JLCA 1TKDA 1Q9YA 3S3OA 3U3YA 1QSSA 4N47A 1R0AA 3BDPA 1F21A 1X9SA 4B08A 4CJVA 3AVCA 5EU7A 3PO4A 2FC0A 3D45A 4I9LA 1ZBLA 3LALA 1HJRA 5FROA 3KTQA 4CF8A 4CJEA 4FJHA 1FKPA 2D5RA 1D9FA 5JS1A 1RT2A 1ASWA 5CZ1A 3QEIA 4DU3A 3DRPA 4DTXA 3DOLA 4FLYA 4DQRA 1DTQA 3BGRA 1YTAA 3NGYA 4ELTA 4CEAA 3OS0A 3OYMA 3F73A 4FJKA 4ELUA 4HHTA 1W0HA 2OPSA 4DSKA 2WONA 2YHBA 3C95A 3IRXA 3DLBA 5SZTA 4RW8A 3C6TA 3M8QA 1RBTA 4AHTA 3CFOA 1KTQA 4W5OA 3P5JA 4E7KA 4LY7A 2XY8A 4BDPA 4EZ9A 1WSFA 3NF7A 1YTUA 4FJJA 1VSEA 3MEGA 3KD1E 5HROA 4AHVA 3MXMA 3THVA 4ID5A 1BCMA 1IKWA 2OA8A 4DFKA 4FZXC 2FBTA 3QESA 2HB5A 2Z1JA 3AVFA 3F9KA 4JS4A 1NJZA 4Z4FA 4Z4HA 3EYZA 1YVUA 3NE6A 4MQ3A 3OYFA 1RBUA 3RR8A 2HHUA 1IKYA 1W9HA 1RNHA 1RDAA 2YNGA 4IFVA 2AJQA 3DMJA 4KHSA 3LZJA 1RTIA 1VSHA 3U3GA 2HVHA 4MFBA 4CEZA 1G15A 2LSNA 3V1QA 4FK2A 4M3XA 1JL2A 1REVA 1BQMA 1EXQA 1QHTA 2IOCA 2ATQA 5J1EA 4RW9A 1J5OA 3VQ9A 3VQ8A 3HYFA 4H4OA 4J2EA 1Q8IA 3AO1A 5KI6A 1EKEA 3VA0A 4C8LA 2XY6A 5SWMA 1T03A 2F8TA 1TKXA 4CGIA 3SUQA 3KK3A 3LPUA 4FJ9A 3LP3A 4DLGA 4Z4EA 3PO5A 4FJMA 3LDSA 4HUEA 2HHXA 1WAFA 4DQPA 2KFNA 4EP5A 1KVBA 1Z26A 3VA3A 4FJIA 3PX6A 1S5JA 1S6PA 1JKHA 1L3TA 2KFZA 4KO0A 4CJ3A 3QIPA 1UAXA 4Z4IA 2BANA 3CYMA 4E89A 1XI1A 3TR8A 3HPOA 3IG1A 1CLQA 1EX4A 3V4IA 3WNFA 4CHZA 4E7LA 4QAGA 4OJRA 1XHZA 4B8CA 3SUPA 4KRFA 3E01A 4E1NA 4DTRA 4TSXA 2KZMA 4LH4A 5CY4A 2XHBA 1D5AA 1ZBFA 1FKOA 1JL1A 2HHTA 4NCGA 2XY7A 3G10A 3KLIA 1C1CA 4CHQA 3RRHA 1QTMA 1UA1A 3AA5X 5KRSA 4IG3A 3HVTA 3S3MA 4FJ7A 4BDZA 1KRPA 3CM6A 2P5OA 1T05A 4FK4A 5J2QA 4CE9A 3T3FA 1NJWA 2Z1HA 3RMDA 1SL2A 4DFPA 1RILA 3PY8A 1K6YA 3HT3A 5J2PA 4B3OA 2RN2A 4CJUA 1TK0A 4FZZA 3K5OA 1J53A 5C25A 3EZ5A 3SPZA 1L3SA 4DWIA 4O5BA 2QKKA 3OYBA 2OPRA 2QKBA 4DFMA 2VG7A 3DLGA 2W42A 3SQ2A 4QOZB 1SKWA 4C8OA 3KLFA 4DS4A 1NK6A 4AHUA 4CF0A 4DSFA 3V9SA 3QERA 1Z25A 3V81A 4Q0BA 1TK5A 4DLEA 3QEVA 4AH9A 3WNEA 1EP4A 2X74A 1JLQA 1JLEA 1BHLA 1VSDA 4JRPA 1KVAA 3B6OA 1RDBA 4KHYA 4FXDA 2G8VA 4EP4A 3KK1A 3ZT0A 1VSIA 4IFYA 4WE1A 4OKEA 1QS4A 4OGCA 3EY1A 1RDCA 3DRRA 1KFSA 4N56A 3OYNA 2IS3A 3O4NA 4RW6A 3OYGA 2VWJA 2VG5A 1LW2A 1Q9XA 2FBYA 1SKRA 4OLBA 5KTQA 2Q3SA 2YKMA 1RCHA 3KLHA 4B9SA 3I0RA 4RW7A 3T19A 4FLWA 4FLXA 4DSEA 3RMBA 3LWMA 3AO2A 1RTDA 3KK2A 1U48A 1S1VA 3MXIA 1U4BA 4IKFA 4KHWA 2IC3A 1HYSA 1C1BA 3MAQA 2YNHA 4KTZA 3OS2A 2D0CA 2YKNA 1TGOA 3NH0A 1HNVA 4CEQA 4W5QA 3AO4A 3PX0A 2JLEA 3B6PA 4AILC 1KSPA 1TAUA 1HPZA 4FLUA 4DU1A 3VQCA 3QETA 3QO9A 4M3UA 4BWMA 1WAJA 1LW0A 1BCOA 4N41A 3QINA 1C6VA 3CM5A 1TL1A 4FW1A 4O44A 4RG8A 4E7HA 3VQDA 3MEEA 5HLFA 4K8ZA 3VQ7A 4RW4A 1B9DA 3NH1A 1VSKA 1TL3A 3D0PA 5C24A 2HNYA 3TAPA 3KD5E 4PUOA 4ID1A 3OYKA 3DRSA 2BDPA 4CF2A 4ELVA 4KFBA 3ZT1A 2QK9A 4DF8A 4CGFA 3AVJA 1WSEA 2GV9A 1ASVA 2GUIA 4CF1A 2E4LA 1NOZA 3TANA 2D0AA 1L3VA 1HQUA 2YV0X 4PA1A 4Y1CA 4JLHA 4J2DA 5J2NA 4OLAA 1CXUA 3VQQA 3HP6A 3ZSZA 4KTQA 1HMVA 3ISNC 3TAFA 1UWBA 2XO7A 1IKXA 4CJ4A 5JS2A 4CJTA 4CHNA 4DU4A 2WOMA 1CXQA 1C1AA 3JSMA 4FJLA 3ZSOA 1YT3A 4NYFA 3VQ5A 4W5RA 1T8EA 1GOCA 3DLKA 1I39A 2F96A 4CJKA 3SQ0A 1NK9A 3AVMA 1RBRA 3AVIA 3C94A 3HSTB 4FZYA 3P1GA 1UOCA 1S6QA 3HXMA 3MXJA 4GMJB 4BACA 3TARA 2P5GA 4M3ZA 2D0BA 2G8IA 4JRQA 4CK1A 4DG1A 4Z4CA 4B9UA 1I3AA 1RT6A 4HCBA 1U47A 3P83D 4L8RB 3I0SA 1JXBA 1X1PA 2KTQA 4FM1A 2XY5A 1JXEA 2ZQBA 3AV9A 2DTUA 3SI6A 3HK2A 1BI4A 2KZZA 3FFIA 3HM9A 4DTMA 2Y1IA 4LSNA 4O4GA 4DSIA 4FJ8A 1S1UA 1RTHA 1J54A 4CECA 3LAMA 3NH2A 4DTUA 1KCFA 3VQBA 3TAQA 1U45A 3ZSWA 5DK5A 1NK5A 3DI6A 3H08A 1VSJA 3IAYA 3HO1A 1QQCA 1DLOA 4F8RA 4Q5VA 3NHGA 5K14A 5FRNA 1A5XA 3NGZA 3I8DA 4DS5A 1SKSA 3HJFA 3O3HA 1JLBA 3V9WA 4FJ5A 1KVCA 3K59A 2FBVA 3V1OA 3OJUA 3LANA 3QNOA 4F2SA 4FJXA 1LAWA 3VN5A 3G0ZA 5KGXA 4DF4A 4CEDA 3DLRA 4FYDA 4NYNA 3DM2A 3ZT3A 4PY5A 3AVNA 1LWFA 2RF2A 3SV3A 4M45A 4CJFA 1LAVA 4LD0A 1LV5A 1B92A 3KJVA 2E6MA 1U49A 2PZSA 3SQ1A 3A2FA 5KRTA 3V6DA 4B9LA 4OKJA 4LH5A 3SV4A 2FBXA 2QXFA 4I2QA 4AHCA 1RDDA 3TAGA 4CEEA 5I3UA 4LSLA 5CZ2A 3NF8A 3VQEA 1BI4B 3SZ2A 1ZBUA 2P51A 4UQGA 3OVNA 3AVHA 1JLAA 3ULDA 2Y1JA 3U6FA 4OPJA 4M41A 2ZD1A 1TK8A 1RT7A 4DFJA 3OYEA 4J2AA 4CJRA 4B9MA 3AA3A 1Y97A 2NUBA 4H4MA 1TAQA 3K2PA 4IG0A 1RTJA 3ZSRA 2OZSA 1TVRA 3ITHA 1BIZA 3OYHA 4F3TA 1HYVA 2RPIA 5HRNA 2EX3A 3LP0A 3S9HA 2ETJA 2VG6A 4FVMA 5CYQA 4B8AB 4N5SA 4F3OA 4CJPA 1CZ9A 2HNZA 1IH7A 3RTVA 4CCHA 3V9XA 4KKOA 2YNIA 2EHGA 1RT5A 3HPGA 4BE0A 3RRGA 4CJWA 4HUFA 3S3NA 4CIGA 1HYZA 4HUGA 4FW2A 3CFRA 4FM2A 3C6UA 4CJLA 4KTWA 4B9NA 4ZHRA 1NK4A 1NK0A 3LP1A 3T1AA 3V1RA 4E1MA 1N6QA 1RT4A 3CG7A 2G8KA 4DQIA 3TI0A 4E0DA 3QLHA 3SCXA 1VSFA 1ZBIA 4CHPA 4OGEA 3LZIA 3RMAA 2HNDA 1S1WA 3WNGA 1SV5A 4CERA 2G8FA 4DTNA 3LWLA 1HQEA 1BL3A 4YNQA 1C0UA 5FDLA 4CJSA 4OVLA 4QCLA 3DLEA 4CFDA 2XRIA 5DMRA 2Z1GA 3O3FA 4DTSA 3AA2A 1VK0A 3SYZA 2DFEA 3QNNA 3AVLA 3V9ZA 5KGWA 4AHRA 1S1XA 4KAZA 3NGIA 4CHYA 2HVIA 4DQSA 3V9UA 1IG9A 4BWJA 2DFFA 3DOKA 2B5JA 2O4GA 3NBPA 3SQ4A 4M42A 3PV8A 4CF9A 1FXXA 2B4JA 3MECA 1SUQA 3L3UA 1QSYA 3UIQA 3IS9A 5FRMA 3OYIA 1NJXA 1JLFA 3OYDA 2OYQA 1BIUA 3KKRA 4F2RA 3MEDA 4FCYA 3AVGA 2HW3A 3DYAA 4CFCA 1NKCA 2HHWA 3NCIA 1U04A 2A1SA 4ICLA 4FLVA 1KFDA 3OYJA 4M3WA 2X6NA 3ZSQA 3AVAA 4E7IA 3RWUA 1RBSA 3ZSYA 3TAMA 1MU2A 3KKSA 3WNHA 1ZYQA 3L2UA 4J2BA 4E3SA 4CEFA 3VQ4A 3SNNA 4ZTFA 4FLZA 3L2VA 3ZCMA 2OPQA 4O0IA 3OS1A 4KV8A 1VSLA 1O1WA 3K57A 1L5UA 4KB0A 4O0JA 2X78A 5D3GA 1X9WA 2Z1IA 3RR7A 4FJGA 2HHSA 3AVKA 5HRRA 3ZT4A 4CEOA 1A5WA 1XWLA 2PY5A 4R5PA 1GOBA 4BE1A 1WSHA 2P1JA 3AO3A 1A5VA 3HPHA 1QSLA 4W5NA 1NJYA 4Z4GA 4YFUA 1WSGA 1S9GA 3TABA 1RBVA 3LP2A 4Y1DA 3L3VA 3ZSXA 4E19A 2IAJA 2OPPA 2KW4A 2IGIA 4DSJA 4F4KA 4CGDA 2ZE2A 1FK9A 1NOYA 2JGUA 5C42A 3SPYA 3HVRA 4O55A 1IKVA 4AHSA 4JS5A 4N76A 4M3YA 3ASMA 3JYTA 4DQQA 3KIOA 4DTPA 3CFPA 4KHUA 4KPYA 2O4IA 4CGGA 3QEWA 1WSIA 2YHAA 3L2WA 1B9FA 2YNFA 2R7YA 1X9MA 2PYJA 3NF9A 2HHVA 4I2PA 4CJQA 4NCBA 4KI6A 1IO2A 1HNIA 4CK3A 2IDOA 4DSLA 3CQ8A 4FK0A 1WN7A 3KLGA 1ASUA 4CEBA 5J2MA 1D9DA 1NK7A 4B9VA 4HCCA 3K5MA 4W5TA 3L2QA 1QE1A 1SL0A 1XHXA 2GBZA 3VQAA 4CIEA 5E41A 3NF6A 3ALYA 3AA4A 4CFAA 3TAEA 3SUOA 3SJJA 1VRUA 1WLJA 3VQPA 2RKIA 1JLGA 2G8WA 4B9TA 3VQ6A 4H8KA 4DTJA 4CIFA 4C8MA 4ZTJA 4KREA 1KLMA 4I9QA 4GW6A 1NKEA 4CHOA 2ITGA 1S1TA 3PX4A 3QEPA 1SL1A 4KHNA 4GVMA 2HMIA 4BDYA 4KHQA 4OKKA 2VWKA 3NAEA 2OZMA 3TWHA 5HBMA 1VSMA 3SUNA 4CGJA 3HP9A 1TV6A 4IDKA 4FLTA 2G8HA 1S9EA 1DTTA 3DLHA 4PQUA 1HRHA 1C0TA 3M8PA 2X6SA 3QIOA 2B6AA 4OPKA 1BQNA 4CESA 3KLEA 4XIUA 3PUFA 4E7JA 4M3RA 4G1QA 1CZBA 1EETA 4HVJA 3K5NA 1RT1A 4C8NA 3AO5A 4CFBA 2KQ2A 1NK8A 2HHQA 4C8KA 1LWEA 4DMNA 1RT3A 1VRTA 4FM0A 3OY9A 3QEXA 2PYLA 1LWCA 4NCAA 1TKTA 1BGXT 2DFHA 3NFAA 1WNSA 3O4QA 3ZSVA 5HRSA 3OYCA 3M8SA 1L3UA 3AVBA 2G8UA 1UA0A 1C0MA 1TKZA 5CYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NDK A;  1GOA A;  3K5L A;  4PWD A;  5T7B A;  3OYL A;  1J9A A;  3L2R A;  4BE2 A;  2F8S A;  2I5J A;  3HL8 A;  3OYA A;  2BE2 A;  2BGG A;  4CK2 A;  3K58 A;  3O3G A;  4FJN A;  1XC9 A;  1ZBH A;  1ITG A;  1T7P A;  4I7F A;  4K8X A;  4KB1 A;  5I42 A;  4M3T A;  1WSJ A;  1NKB A;  3LAK A;  4CJ5 A;  3RMC A;  1N5Y A;  1D8Y A;  4DTO A;  2E6L A;  4IBN A;  5HRP A;  3L8B A;  4Z0U A;  4HTU A;  4EZ6 A;  1BIS A;  2DY4 A;  3LPT A;  3ZT2 A;  3M8R A;  4KI4 A;  4CGH A;  5HP1 A;  3OJS A;  2A1R A;  1KLN A;  1JLC A;  1TKD A;  1Q9Y A;  3S3O A;  3U3Y A;  1QSS A;  4N47 A;  1R0A A;  3BDP A;  1F21 A;  1X9S A;  4B08 A;  4CJV A;  3AVC A;  5EU7 A;  3PO4 A;  2FC0 A;  3D45 A;  4I9L A;  1ZBL A;  3LAL A;  1HJR A;  5FRO A;  3KTQ A;  4CF8 A;  4CJE A;  4FJH A;  1FKP A;  2D5R A;  1D9F A;  5JS1 A;  1RT2 A;  1ASW A;  5CZ1 A;  3QEI A;  4DU3 A;  3DRP A;  4DTX A;  3DOL A;  4FLY A;  4DQR A;  1DTQ A;  3BGR A;  1YTA A;  3NGY A;  4ELT A;  4CEA A;  3OS0 A;  3OYM A;  3F73 A;  4FJK A;  4ELU A;  4HHT A;  1W0H A;  2OPS A;  4DSK A;  2WON A;  2YHB A;  3C95 A;  3IRX A;  3DLB A;  5SZT A;  4RW8 A;  3C6T A;  3M8Q A;  1RBT A;  4AHT A;  3CFO A;  1KTQ A;  4W5O A;  3P5J A;  4E7K A;  4LY7 A;  2XY8 A;  4BDP A;  4EZ9 A;  1WSF A;  3NF7 A;  1YTU A;  4FJJ A;  1VSE A;  3MEG A;  3KD1 E;  5HRO A;  4AHV A;  3MXM A;  3THV A;  4ID5 A;  1BCM A;  1IKW A;  2OA8 A;  4DFK A;  4FZX C;  2FBT A;  3QES A;  2HB5 A;  2Z1J A;  3AVF A;  3F9K A;  4JS4 A;  1NJZ A;  4Z4F A;  4Z4H A;  3EYZ A;  1YVU A;  3NE6 A;  4MQ3 A;  3OYF A;  1RBU A;  3RR8 A;  2HHU A;  1IKY A;  1W9H A;  1RNH A;  1RDA A;  2YNG A;  4IFV A;  2AJQ A;  3DMJ A;  4KHS A;  3LZJ A;  1RTI A;  1VSH A;  3U3G A;  2HVH A;  4MFB A;  4CEZ A;  1G15 A;  2LSN A;  3V1Q A;  4FK2 A;  4M3X A;  1JL2 A;  1REV A;  1BQM A;  1EXQ A;  1QHT A;  2IOC A;  2ATQ A;  5J1E A;  4RW9 A;  1J5O A;  3VQ9 A;  3VQ8 A;  3HYF A;  4H4O A;  4J2E A;  1Q8I A;  3AO1 A;  5KI6 A;  1EKE A;  3VA0 A;  4C8L A;  2XY6 A;  5SWM A;  1T03 A;  2F8T A;  1TKX A;  4CGI A;  3SUQ A;  3KK3 A;  3LPU A;  4FJ9 A;  3LP3 A;  4DLG A;  4Z4E A;  3PO5 A;  4FJM A;  3LDS A;  4HUE A;  2HHX A;  1WAF A;  4DQP A;  2KFN A;  4EP5 A;  1KVB A;  1Z26 A;  3VA3 A;  4FJI A;  3PX6 A;  1S5J A;  1S6P A;  1JKH A;  1L3T A;  2KFZ A;  4KO0 A;  4CJ3 A;  3QIP A;  1UAX A;  4Z4I A;  2BAN A;  3CYM A;  4E89 A;  1XI1 A;  3TR8 A;  3HPO A;  3IG1 A;  1CLQ A;  1EX4 A;  3V4I A;  3WNF A;  4CHZ A;  4E7L A;  4QAG A;  4OJR A;  1XHZ A;  4B8C A;  3SUP A;  4KRF A;  3E01 A;  4E1N A;  4DTR A;  4TSX A;  2KZM A;  4LH4 A;  5CY4 A;  2XHB A;  1D5A A;  1ZBF A;  1FKO A;  1JL1 A;  2HHT A;  4NCG A;  2XY7 A;  3G10 A;  3KLI A;  1C1C A;  4CHQ A;  3RRH A;  1QTM A;  1UA1 A;  3AA5 X;  5KRS A;  4IG3 A;  3HVT A;  3S3M A;  4FJ7 A;  4BDZ A;  1KRP A;  3CM6 A;  2P5O A;  1T05 A;  4FK4 A;  5J2Q A;  4CE9 A;  3T3F A;  1NJW A;  2Z1H A;  3RMD A;  1SL2 A;  4DFP A;  1RIL A;  3PY8 A;  1K6Y A;  3HT3 A;  5J2P A;  4B3O A;  2RN2 A;  4CJU A;  1TK0 A;  4FZZ A;  3K5O A;  1J53 A;  5C25 A;  3EZ5 A;  3SPZ A;  1L3S A;  4DWI A;  4O5B A;  2QKK A;  3OYB A;  2OPR A;  2QKB A;  4DFM A;  2VG7 A;  3DLG A;  2W42 A;  3SQ2 A;  4QOZ B;  1SKW A;  4C8O A;  3KLF A;  4DS4 A;  1NK6 A;  4AHU A;  4CF0 A;  4DSF A;  3V9S A;  3QER A;  1Z25 A;  3V81 A;  4Q0B A;  1TK5 A;  4DLE A;  3QEV A;  4AH9 A;  3WNE A;  1EP4 A;  2X74 A;  1JLQ A;  1JLE A;  1BHL A;  1VSD A;  4JRP A;  1KVA A;  3B6O A;  1RDB A;  4KHY A;  4FXD A;  2G8V A;  4EP4 A;  3KK1 A;  3ZT0 A;  1VSI A;  4IFY A;  4WE1 A;  4OKE A;  1QS4 A;  4OGC A;  3EY1 A;  1RDC A;  3DRR A;  1KFS A;  4N56 A;  3OYN A;  2IS3 A;  3O4N A;  4RW6 A;  3OYG A;  2VWJ A;  2VG5 A;  1LW2 A;  1Q9X A;  2FBY A;  1SKR A;  4OLB A;  5KTQ A;  2Q3S A;  2YKM A;  1RCH A;  3KLH A;  4B9S A;  3I0R A;  4RW7 A;  3T19 A;  4FLW A;  4FLX A;  4DSE A;  3RMB A;  3LWM A;  3AO2 A;  1RTD A;  3KK2 A;  1U48 A;  1S1V A;  3MXI A;  1U4B A;  4IKF A;  4KHW A;  2IC3 A;  1HYS A;  1C1B A;  3MAQ A;  2YNH A;  4KTZ A;  3OS2 A;  2D0C A;  2YKN A;  1TGO A;  3NH0 A;  1HNV A;  4CEQ A;  4W5Q A;  3AO4 A;  3PX0 A;  2JLE A;  3B6P A;  4AIL C;  1KSP A;  1TAU A;  1HPZ A;  4FLU A;  4DU1 A;  3VQC A;  3QET A;  3QO9 A;  4M3U A;  4BWM A;  1WAJ A;  1LW0 A;  1BCO A;  4N41 A;  3QIN A;  1C6V A;  3CM5 A;  1TL1 A;  4FW1 A;  4O44 A;  4RG8 A;  4E7H A;  3VQD A;  3MEE A;  5HLF A;  4K8Z A;  3VQ7 A;  4RW4 A;  1B9D A;  3NH1 A;  1VSK A;  1TL3 A;  3D0P A;  5C24 A;  2HNY A;  3TAP A;  3KD5 E;  4PUO A;  4ID1 A;  3OYK A;  3DRS A;  2BDP A;  4CF2 A;  4ELV A;  4KFB A;  3ZT1 A;  2QK9 A;  4DF8 A;  4CGF A;  3AVJ A;  1WSE A;  2GV9 A;  1ASV A;  2GUI A;  4CF1 A;  2E4L A;  1NOZ A;  3TAN A;  2D0A A;  1L3V A;  1HQU A;  2YV0 X;  4PA1 A;  4Y1C A;  4JLH A;  4J2D A;  5J2N A;  4OLA A;  1CXU A;  3VQQ A;  3HP6 A;  3ZSZ A;  4KTQ A;  1HMV A;  3ISN C;  3TAF A;  1UWB A;  2XO7 A;  1IKX A;  4CJ4 A;  5JS2 A;  4CJT A;  4CHN A;  4DU4 A;  2WOM A;  1CXQ A;  1C1A A;  3JSM A;  4FJL A;  3ZSO A;  1YT3 A;  4NYF A;  3VQ5 A;  4W5R A;  1T8E A;  1GOC A;  3DLK A;  1I39 A;  2F96 A;  4CJK A;  3SQ0 A;  1NK9 A;  3AVM A;  1RBR A;  3AVI A;  3C94 A;  3HST B;  4FZY A;  3P1G A;  1UOC A;  1S6Q A;  3HXM A;  3MXJ A;  4GMJ B;  4BAC A;  3TAR A;  2P5G A;  4M3Z A;  2D0B A;  2G8I A;  4JRQ A;  4CK1 A;  4DG1 A;  4Z4C A;  4B9U A;  1I3A A;  1RT6 A;  4HCB A;  1U47 A;  3P83 D;  4L8R B;  3I0S A;  1JXB A;  1X1P A;  2KTQ A;  4FM1 A;  2XY5 A;  1JXE A;  2ZQB A;  3AV9 A;  2DTU A;  3SI6 A;  3HK2 A;  1BI4 A;  2KZZ A;  3FFI A;  3HM9 A;  4DTM A;  2Y1I A;  4LSN A;  4O4G A;  4DSI A;  4FJ8 A;  1S1U A;  1RTH A;  1J54 A;  4CEC A;  3LAM A;  3NH2 A;  4DTU A;  1KCF A;  3VQB A;  3TAQ A;  1U45 A;  3ZSW A;  5DK5 A;  1NK5 A;  3DI6 A;  3H08 A;  1VSJ A;  3IAY A;  3HO1 A;  1QQC A;  1DLO A;  4F8R A;  4Q5V A;  3NHG A;  5K14 A;  5FRN A;  1A5X A;  3NGZ A;  3I8D A;  4DS5 A;  1SKS A;  3HJF A;  3O3H A;  1JLB A;  3V9W A;  4FJ5 A;  1KVC A;  3K59 A;  2FBV A;  3V1O A;  3OJU A;  3LAN A;  3QNO A;  4F2S A;  4FJX A;  1LAW A;  3VN5 A;  3G0Z A;  5KGX A;  4DF4 A;  4CED A;  3DLR A;  4FYD A;  4NYN A;  3DM2 A;  3ZT3 A;  4PY5 A;  3AVN A;  1LWF A;  2RF2 A;  3SV3 A;  4M45 A;  4CJF A;  1LAV A;  4LD0 A;  1LV5 A;  1B92 A;  3KJV A;  2E6M A;  1U49 A;  2PZS A;  3SQ1 A;  3A2F A;  5KRT A;  3V6D A;  4B9L A;  4OKJ A;  4LH5 A;  3SV4 A;  2FBX A;  2QXF A;  4I2Q A;  4AHC A;  1RDD A;  3TAG A;  4CEE A;  5I3U A;  4LSL A;  5CZ2 A;  3NF8 A;  3VQE A;  1BI4 B;  3SZ2 A;  1ZBU A;  2P51 A;  4UQG A;  3OVN A;  3AVH A;  1JLA A;  3ULD A;  2Y1J A;  3U6F A;  4OPJ A;  4M41 A;  2ZD1 A;  1TK8 A;  1RT7 A;  4DFJ A;  3OYE A;  4J2A A;  4CJR A;  4B9M A;  3AA3 A;  1Y97 A;  2NUB A;  4H4M A;  1TAQ A;  3K2P A;  4IG0 A;  1RTJ A;  3ZSR A;  2OZS A;  1TVR A;  3ITH A;  1BIZ A;  3OYH A;  4F3T A;  1HYV A;  2RPI A;  5HRN A;  2EX3 A;  3LP0 A;  3S9H A;  2ETJ A;  2VG6 A;  4FVM A;  5CYQ A;  4B8A B;  4N5S A;  4F3O A;  4CJP A;  1CZ9 A;  2HNZ A;  1IH7 A;  3RTV A;  4CCH A;  3V9X A;  4KKO A;  2YNI A;  2EHG A;  1RT5 A;  3HPG A;  4BE0 A;  3RRG A;  4CJW A;  4HUF A;  3S3N A;  4CIG A;  1HYZ A;  4HUG A;  4FW2 A;  3CFR A;  4FM2 A;  3C6U A;  4CJL A;  4KTW A;  4B9N A;  4ZHR A;  1NK4 A;  1NK0 A;  3LP1 A;  3T1A A;  3V1R A;  4E1M A;  1N6Q A;  1RT4 A;  3CG7 A;  2G8K A;  4DQI A;  3TI0 A;  4E0D A;  3QLH A;  3SCX A;  1VSF A;  1ZBI A;  4CHP A;  4OGE A;  3LZI A;  3RMA A;  2HND A;  1S1W A;  3WNG A;  1SV5 A;  4CER A;  2G8F A;  4DTN A;  3LWL A;  1HQE A;  1BL3 A;  4YNQ A;  1C0U A;  5FDL A;  4CJS A;  4OVL A;  4QCL A;  3DLE A;  4CFD A;  2XRI A;  5DMR A;  2Z1G A;  3O3F A;  4DTS A;  3AA2 A;  1VK0 A;  3SYZ A;  2DFE A;  3QNN A;  3AVL A;  3V9Z A;  5KGW A;  4AHR A;  1S1X A;  4KAZ A;  3NGI A;  4CHY A;  2HVI A;  4DQS A;  3V9U A;  1IG9 A;  4BWJ A;  2DFF A;  3DOK A;  2B5J A;  2O4G A;  3NBP A;  3SQ4 A;  4M42 A;  3PV8 A;  4CF9 A;  1FXX A;  2B4J A;  3MEC A;  1SUQ A;  3L3U A;  1QSY A;  3UIQ A;  3IS9 A;  5FRM A;  3OYI A;  1NJX A;  1JLF A;  3OYD A;  2OYQ A;  1BIU A;  3KKR A;  4F2R A;  3MED A;  4FCY A;  3AVG A;  2HW3 A;  3DYA A;  4CFC A;  1NKC A;  2HHW A;  3NCI A;  1U04 A;  2A1S A;  4ICL A;  4FLV A;  1KFD A;  3OYJ A;  4M3W A;  2X6N A;  3ZSQ A;  3AVA A;  4E7I A;  3RWU A;  1RBS A;  3ZSY A;  3TAM A;  1MU2 A;  3KKS A;  3WNH A;  1ZYQ A;  3L2U A;  4J2B A;  4E3S A;  4CEF A;  3VQ4 A;  3SNN A;  4ZTF A;  4FLZ A;  3L2V A;  3ZCM A;  2OPQ A;  4O0I A;  3OS1 A;  4KV8 A;  1VSL A;  1O1W A;  3K57 A;  1L5U A;  4KB0 A;  4O0J A;  2X78 A;  5D3G A;  1X9W A;  2Z1I A;  3RR7 A;  4FJG A;  2HHS A;  3AVK A;  5HRR A;  3ZT4 A;  4CEO A;  1A5W A;  1XWL A;  2PY5 A;  4R5P A;  1GOB A;  4BE1 A;  1WSH A;  2P1J A;  3AO3 A;  1A5V A;  3HPH A;  1QSL A;  4W5N A;  1NJY A;  4Z4G A;  4YFU A;  1WSG A;  1S9G A;  3TAB A;  1RBV A;  3LP2 A;  4Y1D A;  3L3V A;  3ZSX A;  4E19 A;  2IAJ A;  2OPP A;  2KW4 A;  2IGI A;  4DSJ A;  4F4K A;  4CGD A;  2ZE2 A;  1FK9 A;  1NOY A;  2JGU A;  5C42 A;  3SPY A;  3HVR A;  4O55 A;  1IKV A;  4AHS A;  4JS5 A;  4N76 A;  4M3Y A;  3ASM A;  3JYT A;  4DQQ A;  3KIO A;  4DTP A;  3CFP A;  4KHU A;  4KPY A;  2O4I A;  4CGG A;  3QEW A;  1WSI A;  2YHA A;  3L2W A;  1B9F A;  2YNF A;  2R7Y A;  1X9M A;  2PYJ A;  3NF9 A;  2HHV A;  4I2P A;  4CJQ A;  4NCB A;  4KI6 A;  1IO2 A;  1HNI A;  4CK3 A;  2IDO A;  4DSL A;  3CQ8 A;  4FK0 A;  1WN7 A;  3KLG A;  1ASU A;  4CEB A;  5J2M A;  1D9D A;  1NK7 A;  4B9V A;  4HCC A;  3K5M A;  4W5T A;  3L2Q A;  1QE1 A;  1SL0 A;  1XHX A;  2GBZ A;  3VQA A;  4CIE A;  5E41 A;  3NF6 A;  3ALY A;  3AA4 A;  4CFA A;  3TAE A;  3SUO A;  3SJJ A;  1VRU A;  1WLJ A;  3VQP A;  2RKI A;  1JLG A;  2G8W A;  4B9T A;  3VQ6 A;  4H8K A;  4DTJ A;  4CIF A;  4C8M A;  4ZTJ A;  4KRE A;  1KLM A;  4I9Q A;  4GW6 A;  1NKE A;  4CHO A;  2ITG A;  1S1T A;  3PX4 A;  3QEP A;  1SL1 A;  4KHN A;  4GVM A;  2HMI A;  4BDY A;  4KHQ A;  4OKK A;  2VWK A;  3NAE A;  2OZM A;  3TWH A;  5HBM A;  1VSM A;  3SUN A;  4CGJ A;  3HP9 A;  1TV6 A;  4IDK A;  4FLT A;  2G8H A;  1S9E A;  1DTT A;  3DLH A;  4PQU A;  1HRH A;  1C0T A;  3M8P A;  2X6S A;  3QIO A;  2B6A A;  4OPK A;  1BQN A;  4CES A;  3KLE A;  4XIU A;  3PUF A;  4E7J A;  4M3R A;  4G1Q A;  1CZB A;  1EET A;  4HVJ A;  3K5N A;  1RT1 A;  4C8N A;  3AO5 A;  4CFB A;  2KQ2 A;  1NK8 A;  2HHQ A;  4C8K A;  1LWE A;  4DMN A;  1RT3 A;  1VRT A;  4FM0 A;  3OY9 A;  3QEX A;  2PYL A;  1LWC A;  4NCA A;  1TKT A;  1BGX T;  2DFH A;  3NFA A;  1WNS A;  3O4Q A;  3ZSV A;  5HRS A;  3OYC A;  3M8S A;  1L3U A;  3AVB A;  2G8U A;  1UA0 A;  1C0M A;  1TKZ A;  5CYM A; 
#chains in the Genus database with same CATH topology
 4V19 S;  2GX9 A;  1SQK A;  4RCH A;  1T7P A;  4KB1 A;  5I42 A;  4M3T A;  1NKB A;  3LAK A;  3RMC A;  4A2B A;  4BVO A;  2FF6 A;  2E6L A;  5HRP A;  1ESV A;  3IDH A;  1VQ8 N;  4EZ6 A;  1BIS A;  1W7A A;  3LPT A;  4KI4 A;  3CCL N;  1JLC A;  1TKD A;  1QSS A;  3S3O A;  4MO5 A;  2HBK A;  3VEY A;  1NGA A;  3D45 A;  1HJR A;  3KTQ A;  4CJE A;  2FSN A;  1D9F A;  1OH6 A;  4DQ8 A;  5CZ1 A;  3DOL A;  4CZI A;  3CMA N;  3OYM A;  5BPN A;  3TSU A;  2OPS A;  3VPZ A;  4DSK A;  4JI0 K;  2YHB A;  2O8E A;  4WYB A;  1V4T A;  5SZT A;  3DXM A;  3P5J A;  4E7K A;  3BEX A;  4FJJ A;  4JN4 A;  3KD1 E;  4I6M B;  2E5L K;  3FZH A;  4ID5 A;  5GIO A;  5H1S Q;  3AVF A;  2O8F B;  1SS6 A;  2HHU A;  1IKY A;  1W9H A;  1XNQ K;  2AJQ A;  5I9E B;  3N4P A;  1GLB G;  3EO3 A;  4CEZ A;  2GTD A;  1VQ6 N;  1BA1 A;  2YJE A;  4M3X A;  3VMF B;  1WUA A;  3ENB A;  5J1E A;  3LM9 A;  4IEE A;  4BC3 A;  1T03 A;  3O80 A;  4CGI A;  4Z4E A;  3LPU A;  3LP3 A;  4JKA A;  1T44 A;  2VQF K;  3I33 A;  3FLC O;  4QS8 A;  3D2F A;  3D7E O;  3LDO A;  4JI4 K;  4MO4 A;  3U4L A;  4YOR A;  3C6H A;  4QS9 A;  1R59 O;  1VQO N;  4JK8 A;  1S6P A;  1L3T A;  4FOE A;  5JVH L;  3O1B A;  5M1F A;  1XI1 A;  4BRH A;  5AQF A;  3SAH A;  4CBW A;  4FWS A;  4OJR A;  3E01 A;  4E1N A;  4WCE L;  2V7Z A;  4FVU A;  4TSX A;  2YHX A;  2HHT A;  4NCG A;  4ILG B;  4O8U A;  3CHW A;  4FWQ A;  5KRS A;  1EWR A;  5KQ8 A;  3CET A;  4NLC A;  2ASP A;  1C0G A;  4FJ7 A;  3WXM B;  4H5W A;  3CM6 A;  2P5O A;  3T3F A;  1SL2 A;  1RIL A;  3PY8 A;  4BC4 A;  5J2P A;  4K42 A;  3K5O A;  3WXK A;  5FPM A;  2ZJQ L;  1L3S A;  3MWP A;  3OBW A;  3ULE B;  2A41 A;  4DFM A;  4OPA A;  5GIN A;  2VQE K;  4C8O A;  4DS4 A;  3PSF A;  3QEV A;  4AH9 A;  1EP4 A;  5DM7 L;  2X74 A;  4JRP A;  1VSD A;  1KVA A;  1LCU A;  2E8A A;  2G8V A;  4EP4 A;  3ZT0 A;  4IFY A;  5HL7 L;  2QEX N;  4BR2 A;  1JCF A;  4N56 A;  2IS3 A;  4UY8 O;  1Q9X A;  1Q7Y O;  4OLB A;  3H45 C;  2Q3S A;  3KLH A;  2UU9 K;  2HBJ A;  4FLX A;  4DSE A;  2IC3 A;  3UKU A;  3MAQ A;  2YKN A;  4CEQ A;  4W5Q A;  1O13 A;  4JKE A;  3AY9 A;  1VQ5 N;  1T6C A;  4FOI A;  4O44 A;  3NH1 A;  1B9D A;  1XQS C;  5BPM A;  2Q1N A;  3H1V X;  3U9D A;  3D0P A;  4PUO A;  1S72 N;  1H1V A;  3L4I A;  3WT0 A;  4A2A A;  2ITM A;  4DF8 A;  1ASV A;  2GV9 A;  2V52 B;  1VQN N;  1YVN A;  2D0A A;  1NGI A;  1RDW X;  1NGJ A;  4YOX A;  4FWK A;  2UYT A;  1E4G T;  4J2D A;  5J2N A;  2I7P A;  3ZSZ A;  1HMV A;  4B3M K;  2YX6 A;  1IKX A;  3BF3 A;  1S22 A;  3KVG A;  1XMQ K;  4DU4 A;  3SLC A;  2WOM A;  2O8D B;  2NLX A;  5FPE A;  1KAY A;  1YIJ N;  4CJK A;  1NK9 A;  3D2E A;  4CZH A;  1S6Q A;  3MXJ A;  4EAH D;  3VEV A;  4B9U A;  1I3A A;  1RT6 A;  1U47 A;  2P9S B;  3AV9 A;  1WOQ A;  3HK2 A;  1BI4 A;  3HM9 A;  4LSN A;  4FJ8 A;  1S1U A;  3THX B;  1WBB A;  2V51 B;  3LAM A;  3Q7B A;  1U45 A;  4DV3 K;  3DI6 A;  3H08 A;  1VSJ A;  4ISF A;  1VQL N;  1QQC A;  3H1Q A;  3NHG A;  1SZ2 A;  4CZE A;  1A5X A;  3I8D A;  1SKS A;  4GVE A;  3O3H A;  3MN9 A;  3V9W A;  3LAN A;  3ZX2 A;  2IVO A;  1NM1 A;  4DF4 A;  3DLR A;  3I55 N;  3Q7C A;  4JKB A;  4NYN A;  4PY5 A;  3SV3 A;  4M45 A;  4LD0 A;  3KJV A;  1U49 A;  5M1N A;  3VGL A;  4B9L A;  4OKJ A;  4LH5 A;  1HR0 K;  4I2Q A;  3TAG A;  5LMN K;  3FE1 A;  4BRM A;  5CZ2 A;  3D6R A;  3VQE A;  1ZBU A;  2P51 A;  4UQG A;  3AVH A;  4MLH A;  2Y1J A;  2QWO A;  4BR4 A;  3U6F A;  2NRT A;  4OPJ A;  2ASM A;  4JKH A;  4U67 L;  1TK8 A;  4DFJ A;  3OW2 M;  1OKJ A;  3AA3 A;  3ZSR A;  5GIP A;  2HHS A;  2E2P A;  3K2P A;  2QWN A;  4PKG A;  3R9P A;  3U9Z A;  4CZG A;  3EE9 A;  3LP0 A;  3MMV A;  2ETJ A;  4B8A B;  2QXL A;  4CJP A;  2QWL A;  2QWR A;  1VAZ A;  4CJW A;  1N8R O;  2NRX A;  1XMO K;  1HYZ A;  4FM2 A;  1P90 A;  4BQL A;  4ZHR A;  5GAG P;  1NK4 A;  1NK0 A;  5AQM A;  4E1M A;  3V1R A;  1N6Q A;  1RT4 A;  3A5L C;  3CME N;  1S1W A;  3WNG A;  1SV5 A;  4JNE A;  1HQE A;  1C0U A;  1NGE A;  4DTS A;  5ELZ A;  4JI2 K;  2DFE A;  3E9P A;  4AM7 A;  5KGW A;  3NGI A;  3FZL A;  4CHY A;  5BR8 K;  3DOK A;  1BO5 O;  3NBP A;  4M7Y A;  4R79 A;  3E1Y A;  1K8K B;  3MEC A;  1QQN A;  1OH7 A;  3IS9 A;  4NO7 A;  3OYI A;  1NJX A;  1JLF A;  3THY B;  4F2R A;  3MED A;  5LJW A;  4JKF A;  1NKC A;  2FXU A;  1VQ7 N;  4IDH A;  3NCI A;  1K73 O;  1U04 A;  2A1S A;  3O9R A;  1ZYQ A;  3WNH A;  3W0L A;  3L2U A;  1ATR A;  3SNN A;  3K57 A;  3T1Y K;  4KV8 A;  1O1W A;  3ZEU B;  4BRD A;  4YY3 K;  5D3G A;  4CD1 A;  1BA0 A;  4GV9 A;  2PY5 A;  4R5P A;  1GOB A;  4BE1 A;  2D0O A;  1WSH A;  3AO3 A;  1A5V A;  2E20 A;  2P9L B;  2UUC K;  3L3V A;  3ZSX A;  4E19 A;  2OPP A;  4F4K A;  3BY5 A;  4O55 A;  3SBT A;  4AHS A;  4JS5 A;  4M3Y A;  3ASM A;  4DQQ A;  4DTP A;  3G6E N;  4O5F A;  3QEW A;  1WSI A;  3TPQ A;  3L2W A;  3E9O A;  1N34 K;  1X9M A;  3TTF A;  2HHV A;  1IO2 A;  1HNI A;  2IDO A;  4FK0 A;  1ASU A;  4CEB A;  5J2M A;  2E1Y A;  1ATS A;  4CIE A;  3ULE A;  3AA4 A;  5AFU A;  3VQP A;  1NGC A;  3C7N B;  4H8K A;  4CIF A;  3UE5 A;  4ZTJ A;  4GW6 A;  4CHO A;  1EWQ A;  5AQR A;  3QEP A;  1SL1 A;  2P9U A;  4O8K A;  2OAN A;  4BDY A;  3AAQ A;  4GKJ K;  3SUN A;  4CGJ A;  3HP9 A;  4FLT A;  5BN8 A;  4BC5 A;  4CES A;  3KLE A;  5AQW A;  3PUF A;  1U6Z A;  4E7J A;  3S41 A;  1NK8 A;  3K5N A;  2GUP A;  3WQU A;  4JK9 A;  1RT3 A;  1VRT A;  5M1Q A;  4FM0 A;  2HBL A;  2YI1 A;  3QEX A;  2PYL A;  5CE3 A;  4EFH A;  1SAZ A;  1WNS A;  5MLC Q;  3OYC A;  2G8U A;  1U2V B;  5KPT A;  3O9U A;  1TKZ A;  5T7B A;  1J9A A;  4BE2 A;  2I5J A;  3DXK B;  1ZBH A;  1XC9 A;  1ITG A;  4WFB L;  4YHH K;  4CJ5 A;  3VF4 A;  4IBN A;  4Z0U A;  3W3D A;  2IIR A;  1HKC A;  4CGH A;  3OJS A;  3CC4 N;  2NRR A;  4JI5 K;  1R0A A;  4JKG B;  1F21 A;  2CGL A;  4B08 A;  3PLA A;  1S3X A;  4DV5 K;  4X65 K;  4PL8 A;  4I9L A;  3LAL A;  4BRQ A;  4FJH A;  1FKP A;  3KWG A;  1ASW A;  1GLE G;  5E84 A;  3J7A P;  1DTQ A;  2UXB K;  4CZJ A;  1DT9 A;  4FJK A;  4HHT A;  3RSE B;  4YDU A;  2WON A;  3C95 A;  3NVM A;  1MWK A;  4RW8 A;  4NLB A;  3THX A;  4W5O A;  4BDP A;  5BR9 A;  4IO8 A;  3K9K A;  2RHK A;  1VSE A;  3HZ6 A;  1N36 K;  4CZF A;  4DV7 K;  1IG8 A;  2GEL A;  2YJF A;  2VWB A;  2Z1J A;  4JS4 A;  3F9K A;  3O5B A;  1NJZ A;  3O08 A;  3TU5 A;  3EYZ A;  4MQ3 A;  3OYF A;  3R8E A;  5F2R A;  3VEZ A;  5JIC A;  3O9T A;  4IFV A;  3DMJ A;  3U3G A;  2ZJP L;  4B1U B;  5AJ3 K;  3LDN A;  1HNZ K;  2LSN A;  4FK2 A;  4LFB K;  1JL2 A;  5M1K A;  2QA4 N;  1Y64 A;  1BQM A;  4RW9 A;  3VQ9 A;  4H4O A;  5AQK A;  3CI5 A;  1ATN A;  2F7T A;  1TUU A;  3VA0 A;  2XY6 A;  2F8T A;  4FJ9 A;  3SUQ A;  5AZI A;  4FJM A;  2NRH A;  4HUE A;  2HHX A;  1WAF A;  1BWF O;  4EP5 A;  1KVB A;  4OO1 J;  3EL2 A;  4KO0 A;  4IEI A;  4CJ3 A;  2BAN A;  1GLC G;  2BH1 A;  1CLQ A;  1EX4 A;  3V4I A;  4CHZ A;  4E7L A;  4QAG A;  3A5N C;  4IJN A;  2KZM A;  4DR6 K;  3B8A X;  5CY4 A;  4K41 A;  2XHB A;  1FKO A;  3VOV A;  3RRH A;  4BR7 A;  5B8H A;  1UA1 A;  3AA5 X;  4IG3 A;  3T69 A;  1KXP A;  5AQL A;  3BUZ B;  5AQY A;  4CE9 A;  1NJW A;  3J7Z O;  3RMD A;  2A3Z A;  4DFP A;  4DKW A;  3HT3 A;  4CJU A;  1TK0 A;  4FZZ A;  4BR0 A;  5C25 A;  5AQV A;  3O8M A;  3L0Q A;  2ASO A;  1NGF A;  2QKB A;  1M90 O;  3SQ2 A;  1YAG A;  3DLG A;  1IBM K;  3C65 A;  4GV3 A;  1SKW A;  2VGM A;  2P9K B;  3V9S A;  1Z25 A;  4DLE A;  1K8K A;  3J81 O;  1BHL A;  4LFA K;  4BR5 A;  1RDB A;  3THY A;  4KHY A;  4BG8 A;  1KAX A;  3KK1 A;  4WE1 A;  4OKE A;  4OGC A;  1K9M O;  1KFS A;  3O4N A;  1NMN A;  1RCH A;  3CJ7 A;  3I0R A;  3T19 A;  1RFQ A;  3M3Z A;  2D0P A;  3AO2 A;  4IKF A;  3O9Q A;  1S1V A;  3CJ9 A;  3ZX3 A;  4KH4 A;  1HNV A;  2JLE A;  3N4Q A;  3B6P A;  1TAU A;  2IVP A;  4BG9 A;  3QET A;  1NWK A;  1LW0 A;  4N41 A;  3CM5 A;  4BVP A;  4RG8 A;  3VQD A;  3MEE A;  4FWO A;  1TL3 A;  3FR0 A;  5C24 A;  3KD5 E;  4H0T B;  3OYK A;  1M1K O;  3GDQ A;  5AQX A;  3ZT1 A;  2A42 A;  1WSE A;  4CF1 A;  3THW B;  1L3V A;  2FSK A;  1HQU A;  2YV0 X;  1WBD A;  1KAZ A;  3AAP A;  1CXU A;  4A59 A;  3HP6 A;  4KTQ A;  1Q81 O;  4DUY K;  4F9O A;  4CJ4 A;  4YOY A;  3G4S N;  1CXQ A;  4NYF A;  1YJW N;  2GWJ A;  3C94 A;  3HST B;  2HST A;  4BAC A;  3C7N A;  4CJ7 A;  4Z4C A;  4HCB A;  3BP8 A;  5EY4 A;  4L8R B;  3I0S A;  5GAD P;  4FM1 A;  3MWT A;  5C10 A;  1JXE A;  1KQS M;  2KZZ A;  2ZGZ A;  3P38 A;  2Y1I A;  4DSI A;  1RTH A;  1V4S A;  1J54 A;  3TAQ A;  4JHD B;  2QM1 A;  4QS7 A;  2YHW A;  1T3V A;  3A5O C;  2NRV A;  3HO1 A;  1BOT O;  3HRG A;  4JI3 K;  4B3S K;  5K14 A;  5FRN A;  4OPH A;  3K59 A;  1U2V A;  3IUC A;  3QBX A;  1HX1 A;  1LAW A;  3VN5 A;  3EKS A;  4A57 A;  5KGX A;  4CED A;  4FYD A;  3QBW A;  3AVN A;  4LF9 K;  2P9I B;  2E6M A;  1YHQ N;  3BF1 A;  3A2F A;  2F9W A;  3CCS N;  3V6D A;  1WB9 A;  4IJA A;  3CF5 L;  2CGJ A;  4BRP A;  2FBX A;  3SV4 A;  1FW6 A;  5I3U A;  4LSL A;  3C0B A;  3M5R A;  4BRG A;  3CCE N;  2Q31 A;  4JKG A;  3PSI A;  3ENO A;  3OVN A;  4BGB A;  3UB5 A;  1GLF O;  4J2A A;  2P9N B;  3VF2 A;  1NBW A;  1TVR A;  1BIZ A;  3ITH A;  4WFA L;  2RPI A;  4CZK A;  4YOW A;  1FJG K;  2A6A A;  1HPM A;  4K25 A;  4H0X B;  1IH7 A;  3RTV A;  4CCH A;  3V9X A;  4LC9 B;  3HPG A;  4BE0 A;  2IVN A;  4YDU C;  4HUF A;  4CIG A;  4GY2 B;  3CFR A;  4CJL A;  2W40 A;  3T1A A;  3CG7 A;  4DQI A;  3TI0 A;  3QLH A;  3SCX A;  4CHP A;  1DGK N;  4OGE A;  3VGK A;  5EOY A;  3RMA A;  2HND A;  4CER A;  2GWK A;  3LWL A;  1BL3 A;  4YNQ A;  4OVL A;  4QCL A;  1E3M A;  4MDA A;  2Z1G A;  3TTD A;  3AA2 A;  3MN6 A;  4BRK A;  3QNN A;  3V9Z A;  4AHR A;  4KAZ A;  4JI1 K;  3TTC A;  4DQS A;  3V9U A;  4HTL A;  2DFF A;  2B5J A;  4KBO A;  3PV8 A;  4CF9 A;  2B4J A;  3SMS A;  3UIQ A;  2OYQ A;  3DYA A;  3QML A;  5BRH A;  2HHW A;  4WF9 L;  4FLV A;  1GLD G;  2VYP A;  3ENH A;  1Z05 A;  2UUB K;  3AVA A;  3TAM A;  1MU2 A;  3KKS A;  4J2B A;  4NXN K;  4DR1 K;  4E3S A;  3VQ4 A;  4ZTF A;  3DLB A;  3L2V A;  3ZCM A;  1HKG A;  5E26 A;  4KB0 A;  2X78 A;  5A2Q O;  3VEW A;  3RR7 A;  4YOV A;  3AVK A;  5HRR A;  4CEO A;  4FWN A;  1Q82 O;  4Z4G A;  4YFU A;  1WSG A;  3LDQ A;  1S9G A;  4Y1D A;  2IAJ A;  2IGI A;  2ZE2 A;  1FK9 A;  2W6L A;  3SPY A;  1NGB A;  1IKV A;  5AQS A;  2O8C B;  3CJ1 A;  2BTF A;  4H03 B;  2YNF A;  4IZ9 A;  4CJQ A;  1HNX K;  4NCB A;  3CQ8 A;  4NXM K;  1NK7 A;  1P8Z A;  2ZGY A;  3H46 O;  3K5M A;  4W5T A;  3L2Q A;  1XHX A;  4DR4 K;  1TUY A;  3NF6 A;  4PL7 A;  1WLJ A;  2QTD A;  2P9K A;  2G8W A;  3VQ6 A;  3MN5 A;  4C8M A;  4I9Q A;  2ITG A;  1S1T A;  3VGM A;  3PX4 A;  4GVM A;  4LF6 K;  1OVY A;  3TWH A;  4EHU A;  1I94 K;  4PQU A;  1S9E A;  1DTT A;  2YCH A;  5EXW A;  3WXI A;  3DLH A;  3QIO A;  3NVK A;  2B6A A;  2UUA K;  4M3R A;  1N33 K;  1CZB A;  4HVJ A;  2HHQ A;  3HBT A;  4CFB A;  3JS6 A;  2Q97 A;  4C1N I;  2QI2 A;  4DMN A;  3G71 N;  1IV0 A;  4NCA A;  2DFH A;  3ZSV A;  3R3L A;  3M8S A;  4KHP K;  5F0X A;  2W41 A;  1C0M A;  5CYM A;  5JLH A;  3J7Y P;  1GOA A;  2HBM A;  2HOE A;  3OYL A;  3L2R A;  2HHH K;  3K58 A;  1VQM N;  3AGR A;  4IFE A;  3ZYY X;  2Q2R A;  1WSJ A;  4I6M A;  3CXC M;  1D8Y A;  4DTO A;  4DUZ K;  4H0P A;  4HTU A;  3THW A;  2O8F A;  4A5A A;  5HP1 A;  1YUW A;  1Q9Y A;  3U3Y A;  5LL6 Z;  3FZF A;  3KWI A;  3SAG A;  5IWA K;  3AVC A;  4JAX A;  2OTJ N;  4LFC K;  5EU7 A;  1HJO A;  2FC0 A;  5FPD A;  2YHY A;  1X3M A;  1VQ9 N;  5AQU A;  5ADX H;  1DEJ A;  3DRP A;  4FLY A;  3VTI A;  3BGR A;  1YTA A;  3LM2 A;  3NGY A;  3F73 A;  4JK7 A;  3H6E A;  5M1P A;  4X64 K;  3M8Q A;  2HF4 A;  3CFO A;  1OVQ A;  4LY7 A;  5BRE A;  2W6K A;  3MEG A;  3LDP A;  5HRO A;  3MXM A;  3THV A;  3HI0 A;  3VET A;  1IKW A;  4DFK A;  1IBK K;  3QES A;  5GAH P;  4Z4F A;  3A0I X;  1YIT N;  1KD1 O;  1RBU A;  3CC2 N;  3CCR N;  1RDA A;  4KHS A;  3LZJ A;  1RTI A;  1VSH A;  4GNI A;  4M63 C;  2HVH A;  1G15 A;  3TSQ A;  1QVF M;  3V1Q A;  1REV A;  2P9I A;  4B1V A;  1YF5 L;  1EXQ A;  2IOC A;  2ATQ A;  2CH6 A;  1J5O A;  3GE1 A;  4XH1 A;  3VQ8 A;  1DKG D;  3HYF A;  4B1W B;  3DWL A;  2WTU A;  3AO1 A;  5KI6 A;  5AQP A;  5SWM A;  3KK3 A;  4BRO A;  4DV1 K;  5KPR A;  2KFN A;  4YOU A;  4B9Q A;  2CH5 A;  1Z26 A;  4FJI A;  3PX6 A;  2KFZ A;  3QIP A;  3IMX A;  4FPA A;  3HPO A;  3WNF A;  1XHZ A;  4B8C A;  4KRF A;  4DTR A;  4RWT A;  4IOC L;  5AQO A;  4DV6 K;  1ZBF A;  3H3O B;  2XY7 A;  3G10 A;  3KLI A;  4CBU A;  3EKU A;  3HVT A;  4AQY K;  3S3M A;  1NG9 A;  5C12 A;  1KRP A;  4BY9 C;  4NB4 A;  3O4W A;  1T05 A;  4FK4 A;  5J2Q A;  2Z1H A;  2GEM A;  1K6Y A;  4B3O A;  2RN2 A;  2ZJR L;  4CD3 A;  3ATV A;  4GKK K;  4WQ5 A;  4O5B A;  3OYB A;  4QOZ B;  2W42 A;  4AHU A;  1JCE A;  3PIP L;  4Q0B A;  3V81 A;  1TK5 A;  4U7B A;  3OTO K;  1JLQ A;  4FXD A;  4H5T A;  1EQY A;  1VSI A;  2O8D A;  4ILJ A;  1GLA G;  3CCQ N;  4DR3 K;  4RW6 A;  2FBY A;  5KTQ A;  2YKM A;  2I7N A;  2A40 A;  4Y0W A;  4FLW A;  5TKW A;  1Q86 O;  3CQY A;  3KK2 A;  1U48 A;  1HYS A;  1C1B A;  4CVN E;  4KTZ A;  2D0C A;  4JD2 B;  1TGO A;  2P9S A;  3R6M A;  3PX0 A;  3AO4 A;  4EIA A;  1HUX A;  4AIL C;  2NRZ A;  3VQC A;  1JJ2 M;  3HOS A;  1WAJ A;  1BCO A;  1NGG A;  1TL1 A;  2AP1 A;  4K8Z A;  3VQ7 A;  4RW4 A;  4DR5 K;  1VSK A;  4BR9 A;  2O8C A;  5DM6 L;  3CCU N;  4CF2 A;  4ELV A;  3K9J A;  4KFB A;  2QK9 A;  4CGF A;  2GUI A;  1NOZ A;  4JLH A;  1G99 A;  4OLA A;  3OHR A;  3TAF A;  2XO7 A;  1J6Z A;  5JS2 A;  4CJT A;  1C1A A;  4FJL A;  3ZSO A;  2D1K A;  3VQ5 A;  1T8E A;  1GOC A;  3DLK A;  2F96 A;  3HOT A;  1NNE A;  4XH4 A;  4FZY A;  3HM8 A;  3P1G A;  3VF6 A;  3HXM A;  3TAR A;  4M3Z A;  2D0B A;  4JRQ A;  4DG1 A;  4H0V B;  3UKU B;  1ZBS A;  2ZQB A;  5JMV A;  4LF8 K;  3FFI A;  4DTM A;  1HNW K;  4O4G A;  1BUP A;  5EX5 A;  4DTU A;  3VQB A;  1DLO A;  4F8R A;  4DV2 K;  1D4X A;  1ZXO A;  3I8B A;  1QQM A;  2WFB A;  3NGZ A;  4DS5 A;  4FJ5 A;  1KVC A;  3QNO A;  3OJU A;  1K8A O;  3A5M C;  3WQT A;  3DM2 A;  3FFK B;  4K43 A;  4CJF A;  1X9J A;  2HF3 A;  2PZS A;  3LL3 A;  5KRT A;  1QVG M;  5C2D A;  2QXF A;  1RDD A;  1BI4 B;  5BN9 A;  3ZET B;  5HOO A;  1JLA A;  4H5N A;  3ULD A;  2OCE A;  4DV4 K;  4KH6 A;  2FF3 B;  3OYE A;  5JVG L;  1Y97 A;  4H4M A;  1TAQ A;  2OZS A;  1RTJ A;  3OYH A;  5HRN A;  4J8F A;  2EX3 A;  1NJI O;  4B3R K;  2VG6 A;  4FVM A;  4N5S A;  3T1H K;  4F3O A;  1CZ9 A;  2HNZ A;  2QW9 A;  4LF4 K;  2YNI A;  2EHG A;  4IOA L;  1RT5 A;  3CQX A;  4H5V A;  4IOX A;  3S3N A;  3BZK A;  3C6U A;  4B9N A;  4KTW A;  3ZEU A;  2ZM6 K;  3LP1 A;  5AZJ B;  1ZC6 A;  3LZI A;  5AQT A;  2NNW A;  5CR4 A;  1MWM A;  1VHX A;  4JV5 K;  2P9L A;  4H0O A;  1E4F T;  5FDL A;  3DLE A;  2XRI A;  4WFN L;  2E2Q A;  1VK0 A;  3SYZ A;  3AVL A;  3O1W A;  3CC7 N;  5C0Y A;  4BWJ A;  2QWM A;  5AQG A;  2NRW A;  3K0S A;  5EVZ A;  3R1X A;  1QSY A;  1X3N A;  3OYD A;  4BGA A;  4FPB A;  4FCY A;  3AVG A;  2DPN A;  4CZL A;  4FWM A;  4RTF D;  3LDL A;  3ZSQ A;  3ZSY A;  4BRN A;  3FZM A;  4O0I A;  3OS1 A;  4DR2 K;  1VSL A;  1L5U A;  4O0J A;  4FSV A;  3J80 O;  2Z1I A;  3SK3 A;  3JAM O;  1XWL A;  3MK6 A;  4BRE A;  2P1J A;  2OTL N;  2PFU A;  3HPH A;  1NJY A;  3MX2 A;  3VTH A;  3TAB A;  1RBV A;  3AAR A;  3EN9 A;  3GOI A;  1NOY A;  2JGU A;  5FLX O;  5C42 A;  3HVR A;  1XNR K;  2UXD K;  5AQQ A;  3JYT A;  3KIO A;  4KHU A;  4KPY A;  2O4I A;  4CGG A;  2YHA A;  2NZT A;  4M7X A;  4CI6 A;  2PYJ A;  3NF9 A;  4I2P A;  2Q0R A;  5LMU K;  4CK3 A;  1C0F A;  1D9D A;  4B9V A;  4HCC A;  3DXK A;  1QE1 A;  5BRF A;  1SL0 A;  5AQZ A;  2GBZ A;  3O6W A;  2FSJ A;  3SJJ A;  3AGK A;  1VRU A;  2RKI A;  1JLG A;  4WQ5 C;  3VEN A;  5LJV A;  1NKE A;  5CHI A;  2D4W A;  2HMI A;  3QFP A;  4DCH A;  3BZC A;  4KHQ A;  1N32 K;  1TYQ B;  1VSM A;  1TV6 A;  4MLE A;  2G8H A;  1HRH A;  4OPK A;  1BQN A;  4XIU A;  4G1Q A;  4C8N A;  2VCP A;  2O8B B;  4C8K A;  1LWE A;  3DAW A;  3OY9 A;  1LWC A;  4JD2 A;  1BGX T;  3CCJ N;  5TKY A;  5HRS A;  3VES A;  1UA0 A;  3RSE A;  3NDK A;  3K5L A;  4PWD A;  2F8S A;  3HL8 A;  3OYA A;  2BGG A;  2BE2 A;  4CK2 A;  3O3G A;  3WUH A;  4FJN A;  4K8X A;  4I7F A;  5GAE P;  4X66 K;  3VEX A;  5ADX A;  1N5Y A;  3KHY A;  3L8B A;  1VQK N;  1JCG A;  3ZT2 A;  3M8R A;  2P9U B;  2A1R A;  1KLN A;  1Z6R A;  4X62 K;  4N47 A;  3EE8 A;  4B3T K;  3BDP A;  4A62 A;  1X9S A;  4DR7 K;  4CJV A;  3PO4 A;  1ZBL A;  5FRO A;  4CF8 A;  4DHY A;  2D5R A;  5JS1 A;  1RT2 A;  3NMU A;  5C15 A;  2F9T A;  3QEI A;  5AR0 A;  4JYA K;  4DU3 A;  4DTX A;  4DQR A;  5JLF A;  2WBN A;  4A61 A;  4ELT A;  4CEA A;  3OS0 A;  4B1Z A;  4ELU A;  1W0H A;  3IRX A;  4ISG A;  4K0K K;  2CGK A;  4AHT A;  3C6T A;  1RBT A;  4YOT A;  1KTQ A;  2XY8 A;  4EZ9 A;  1YTU A;  1WSF A;  3NF7 A;  5AQH A;  1YJ9 N;  5FPN A;  4AHV A;  2OA8 A;  1BCM A;  4FZX C;  2FBT A;  4XH5 A;  2HB5 A;  3SBG A;  3QFU A;  4B1Y B;  4Z4H A;  1YVU A;  3NE6 A;  4ILH A;  3SAF A;  1EO1 A;  3RR8 A;  1RNH A;  2YNG A;  3F5T A;  1W97 L;  4MFB A;  4MDB A;  4CZM A;  1LOT B;  3F9M A;  1MDU B;  3CCM N;  1QHT A;  4BRL A;  3ID6 A;  4FL9 A;  4IXC A;  4J2E A;  1Q8I A;  4H0Y B;  2PBD A;  1EKE A;  4C8L A;  3ZET A;  1J5E K;  1TKX A;  3MCA B;  4DLG A;  3PO5 A;  3LDS A;  4BRC A;  4DQP A;  3SMP A;  4BC2 A;  4CW7 B;  1IBL K;  3VA3 A;  4JKD A;  3WEE B;  1OH8 A;  1S5J A;  1JKH A;  3IFR A;  1UAX A;  4Z4I A;  3CYM A;  4AM6 A;  1NMD A;  4E89 A;  3TR8 A;  3IG1 A;  3SUP A;  4LH4 A;  1D5A A;  1NU0 A;  1RDU A;  4FO0 A;  1JL1 A;  4JI8 K;  1C1C A;  4CHQ A;  1QTM A;  2E2N A;  4H5R A;  4BDZ A;  2UXC K;  5AZJ A;  3QIC A;  1J53 A;  3EZ5 A;  3SPZ A;  5AZI B;  4DWI A;  3P39 A;  2QKK A;  2OPR A;  3VER A;  2VG7 A;  3CIP A;  3M6G A;  3WXL A;  5BRD A;  3KLF A;  1NK6 A;  4CF0 A;  4DSF A;  3QER A;  5IT9 O;  1ILY A;  3WNE A;  4CBX A;  1JLE A;  3B6O A;  2J4R A;  1MA9 B;  3H3N O;  1YI2 N;  3QDK A;  4WQ4 A;  2H3G X;  1CZA N;  4C1N K;  5AQJ A;  3CJC A;  3CD6 N;  3F2K A;  1QS4 A;  3EY1 A;  1RDC A;  3DRR A;  3OYN A;  3OYG A;  2VWJ A;  2VG5 A;  1LW2 A;  1SKR A;  3UKR B;  4B9S A;  4RW7 A;  3RMB A;  3LWM A;  1RTD A;  3MXI A;  2HMP A;  1U4B A;  4KHW A;  2P9P B;  2YNH A;  3OS2 A;  1RGI A;  3NH0 A;  1KSP A;  2EWS A;  1HPZ A;  4FLU A;  4DU1 A;  3CPW M;  4DV0 K;  1QHA A;  3QO9 A;  1Q18 A;  4BWM A;  4M3U A;  1QZ6 A;  3QIN A;  1C6V A;  4FW1 A;  5HLF A;  4E7H A;  5BPL A;  3MCP A;  3TAP A;  2E1Z A;  2HNY A;  4JHD A;  4ID1 A;  5KPZ A;  1XUP O;  4IO9 L;  3DRS A;  2BDP A;  3ZX0 A;  3AVJ A;  2E4L A;  3HSC A;  3TAN A;  4PA1 A;  4Y1C A;  1GLJ O;  2RE2 A;  2WUS A;  2AA4 A;  2V7Y A;  3VQQ A;  5AQN A;  1IJJ A;  3ISN C;  1UWB A;  2VGN A;  4CHN A;  3CJA A;  4AF1 A;  3JSM A;  1YT3 A;  4W5R A;  3IKM A;  1I39 A;  3SQ0 A;  2KHO A;  3AVM A;  1RBR A;  2BUP A;  2E88 A;  3AVI A;  4FWP A;  1UOC A;  4GMJ B;  2P5G A;  4BRI A;  1NGD A;  2G8I A;  1NLV A;  3WXJ A;  3P31 A;  4CK1 A;  3ZLJ A;  4FWL A;  3P83 D;  1JXB A;  1X1P A;  2KTQ A;  3ATU A;  2XY5 A;  2DTU A;  3DJC A;  3SI6 A;  1BDG A;  1TYQ A;  2O8E B;  4GV6 A;  3DXM B;  1BG3 A;  5AQI A;  4CEC A;  3NH2 A;  1KCF A;  3PIO L;  3ZSW A;  5DK5 A;  1NK5 A;  4JEP A;  3IAY A;  3ID8 A;  2P9N A;  2O8B A;  4Q5V A;  3EEQ A;  2JWK A;  3HJF A;  1VQ4 N;  1JLB A;  3L6Q A;  3GG4 A;  4A5B A;  2JWL A;  3MDQ A;  2FBV A;  3V1O A;  1YJN N;  4F2S A;  4FJX A;  1ZBI A;  3OA9 A;  4B1X B;  3G0Z A;  3KZB A;  3ZT3 A;  1LWF A;  2RF2 A;  3OBY A;  1LAV A;  4JKC A;  4KH5 A;  1B92 A;  4BRA A;  3SQ1 A;  3CPE A;  3CCV N;  2FLO A;  3KK7 A;  4AHC A;  4BQZ A;  4CEE A;  3NF8 A;  3SZ2 A;  1OH5 A;  1KC8 O;  3MX5 A;  1QZ5 A;  3JXU A;  4M41 A;  2ZD1 A;  3D2F B;  1RT7 A;  4CJR A;  2WC9 A;  4B9M A;  4IG0 A;  2QWQ A;  2NUB A;  2DY4 A;  4F3T A;  3GBT A;  1HYV A;  4BRF A;  3S9H A;  3CJB A;  5CYQ A;  2A5X A;  2KKZ A;  4IWV A;  2Q36 A;  4KKO A;  3M1F A;  3RVC A;  3RRG A;  1GLL O;  5M1O A;  3C6A A;  4FW2 A;  4HUG A;  5F1X A;  4E0D A;  1XC3 A;  2G8K A;  4PKH A;  4PKI A;  4XEI A;  1VSF A;  3L4Q A;  4DB3 A;  1NGH A;  3HTV A;  4DTN A;  2G8F A;  4CJS A;  3O9S A;  4CFD A;  5DMR A;  3O3F A;  3GL1 A;  4ISE A;  1S1X A;  4OX9 K;  2HVI A;  3G25 A;  1IG9 A;  3SQ4 A;  4M42 A;  2O4G A;  1HKB A;  3J8A A;  1FXX A;  1SUQ A;  1QQO A;  3L3U A;  5FRM A;  2HW3 A;  1BIU A;  3E9L A;  3KKR A;  3SJH A;  3MN7 A;  4CFC A;  4ICL A;  3FZK A;  2KLA A;  1KFD A;  3OYJ A;  4M3W A;  3VEO A;  2X6N A;  3RWU A;  4E7I A;  1RBS A;  1HLU A;  3DLL L;  4CEF A;  4FLZ A;  2OPQ A;  2QWP A;  3CER A;  3WEE A;  1X9W A;  4FJG A;  1VQP N;  3ZT4 A;  1A5W A;  2PAV A;  3TSP A;  3P4I A;  1QSL A;  4W5N A;  2Q0U A;  3LP2 A;  4DSJ A;  4L3Q A;  1T6D A;  2KW4 A;  4CGD A;  4HWI A;  4N76 A;  5KQD A;  4C23 A;  3CFP A;  3T7Z A;  4E1J A;  1B9F A;  4FWR A;  2R7Y A;  4KI6 A;  2ZF5 O;  4DSL A;  1WN7 A;  4Z94 A;  3KLG A;  4JI6 K;  4G9Z A;  3VQA A;  5E41 A;  3D2E B;  3ALY A;  4LF7 K;  4CFA A;  3TAE A;  3SUO A;  3U8X A;  4B9T A;  4DTJ A;  4KRE A;  1KLM A;  4KHN A;  3QB0 A;  4JI7 K;  2ZWH A;  4OKK A;  2VWK A;  5C2F A;  3NAE A;  2OZM A;  4LF5 K;  5HBM A;  3I56 N;  3A8Y A;  4IDK A;  4EHT A;  5LY3 A;  2F4V K;  1C0T A;  2E2O A;  3M8P A;  2X6S A;  4WQ4 C;  3UKR A;  1EET A;  5AFU H;  1LV5 A;  1RT1 A;  3AO5 A;  2KQ2 A;  3E66 A;  4PHT X;  2P9P A;  1TKT A;  3FGU A;  3NFA A;  1BU6 O;  3O4Q A;  1L3U A;  1YXQ A;  1W2B M;  3AVB A;  3EZW A; 
#chains in the Genus database with same CATH homology
 3NDK A;  1GOA A;  3K5L A;  4PWD A;  5T7B A;  3OYL A;  1J9A A;  3L2R A;  4BE2 A;  2F8S A;  2I5J A;  3HL8 A;  3OYA A;  2BE2 A;  2BGG A;  4CK2 A;  3K58 A;  3O3G A;  4FJN A;  1XC9 A;  1ZBH A;  1ITG A;  1T7P A;  4I7F A;  4K8X A;  4KB1 A;  5I42 A;  4M3T A;  1WSJ A;  1NKB A;  3LAK A;  4CJ5 A;  3RMC A;  1N5Y A;  1D8Y A;  4DTO A;  2E6L A;  4IBN A;  5HRP A;  3L8B A;  4Z0U A;  4HTU A;  4EZ6 A;  1BIS A;  2DY4 A;  3LPT A;  3ZT2 A;  3M8R A;  4KI4 A;  4CGH A;  5HP1 A;  3OJS A;  2A1R A;  1KLN A;  1JLC A;  1TKD A;  1Q9Y A;  3S3O A;  3U3Y A;  1QSS A;  4N47 A;  1R0A A;  3BDP A;  1F21 A;  1X9S A;  4B08 A;  4CJV A;  3AVC A;  5EU7 A;  3PO4 A;  2FC0 A;  3D45 A;  4I9L A;  1ZBL A;  3LAL A;  1HJR A;  5FRO A;  3KTQ A;  4CF8 A;  4CJE A;  4FJH A;  1FKP A;  2D5R A;  1D9F A;  5JS1 A;  1RT2 A;  1ASW A;  5CZ1 A;  3QEI A;  4DU3 A;  3DRP A;  4DTX A;  3DOL A;  4FLY A;  4DQR A;  1DTQ A;  3BGR A;  1YTA A;  3NGY A;  4ELT A;  4CEA A;  3OS0 A;  3OYM A;  3F73 A;  4FJK A;  4ELU A;  4HHT A;  1W0H A;  2OPS A;  4DSK A;  2WON A;  2YHB A;  3C95 A;  3IRX A;  3DLB A;  5SZT A;  4RW8 A;  3C6T A;  3M8Q A;  1RBT A;  4AHT A;  3CFO A;  1KTQ A;  4W5O A;  3P5J A;  4E7K A;  4LY7 A;  2XY8 A;  4BDP A;  4EZ9 A;  1WSF A;  3NF7 A;  1YTU A;  4FJJ A;  1VSE A;  3MEG A;  3KD1 E;  5HRO A;  4AHV A;  3MXM A;  3THV A;  4ID5 A;  1BCM A;  1IKW A;  2OA8 A;  4DFK A;  4FZX C;  2FBT A;  3QES A;  2HB5 A;  2Z1J A;  3AVF A;  3F9K A;  4JS4 A;  1NJZ A;  4Z4F A;  4Z4H A;  3EYZ A;  1YVU A;  3NE6 A;  4MQ3 A;  3OYF A;  1RBU A;  3RR8 A;  2HHU A;  1IKY A;  1W9H A;  1RNH A;  1RDA A;  2YNG A;  4IFV A;  2AJQ A;  3DMJ A;  4KHS A;  3LZJ A;  1RTI A;  1VSH A;  3U3G A;  2HVH A;  4MFB A;  4CEZ A;  1G15 A;  2LSN A;  3V1Q A;  4FK2 A;  4M3X A;  1JL2 A;  1REV A;  1BQM A;  1EXQ A;  1QHT A;  2IOC A;  2ATQ A;  5J1E A;  4RW9 A;  1J5O A;  3VQ9 A;  3VQ8 A;  3HYF A;  4H4O A;  4J2E A;  1Q8I A;  3AO1 A;  5KI6 A;  1EKE A;  3VA0 A;  4C8L A;  2XY6 A;  5SWM A;  1T03 A;  2F8T A;  1TKX A;  4CGI A;  3SUQ A;  3KK3 A;  3LPU A;  4FJ9 A;  3LP3 A;  4DLG A;  4Z4E A;  3PO5 A;  4FJM A;  3LDS A;  4HUE A;  2HHX A;  1WAF A;  4DQP A;  2KFN A;  4EP5 A;  1KVB A;  1Z26 A;  3VA3 A;  4FJI A;  3PX6 A;  1S5J A;  1S6P A;  1JKH A;  1L3T A;  2KFZ A;  4KO0 A;  4CJ3 A;  3QIP A;  1UAX A;  4Z4I A;  2BAN A;  3CYM A;  4E89 A;  1XI1 A;  3TR8 A;  3HPO A;  3IG1 A;  1CLQ A;  1EX4 A;  3V4I A;  3WNF A;  4CHZ A;  4E7L A;  4QAG A;  4OJR A;  1XHZ A;  4B8C A;  3SUP A;  4KRF A;  3E01 A;  4E1N A;  4DTR A;  4TSX A;  2KZM A;  4LH4 A;  5CY4 A;  2XHB A;  1D5A A;  1ZBF A;  1FKO A;  1JL1 A;  2HHT A;  4NCG A;  2XY7 A;  3G10 A;  3KLI A;  1C1C A;  4CHQ A;  3RRH A;  1QTM A;  1UA1 A;  3AA5 X;  5KRS A;  4IG3 A;  3HVT A;  3S3M A;  4FJ7 A;  4BDZ A;  1KRP A;  3CM6 A;  2P5O A;  1T05 A;  4FK4 A;  5J2Q A;  4CE9 A;  3T3F A;  1NJW A;  2Z1H A;  3RMD A;  1SL2 A;  4DFP A;  1RIL A;  3PY8 A;  1K6Y A;  3HT3 A;  5J2P A;  4B3O A;  2RN2 A;  4CJU A;  1TK0 A;  4FZZ A;  3K5O A;  1J53 A;  5C25 A;  3EZ5 A;  3SPZ A;  1L3S A;  4DWI A;  4O5B A;  2QKK A;  3OYB A;  2OPR A;  2QKB A;  4DFM A;  2VG7 A;  3DLG A;  2W42 A;  3SQ2 A;  4QOZ B;  1SKW A;  4C8O A;  3KLF A;  4DS4 A;  1NK6 A;  4AHU A;  4CF0 A;  4DSF A;  3V9S A;  3QER A;  1Z25 A;  3V81 A;  4Q0B A;  1TK5 A;  4DLE A;  3QEV A;  4AH9 A;  3WNE A;  1EP4 A;  2X74 A;  1JLQ A;  1JLE A;  1BHL A;  1VSD A;  4JRP A;  1KVA A;  3B6O A;  1RDB A;  4KHY A;  4FXD A;  2G8V A;  4EP4 A;  3KK1 A;  3ZT0 A;  1VSI A;  4IFY A;  4WE1 A;  4OKE A;  1QS4 A;  4OGC A;  3EY1 A;  1RDC A;  3DRR A;  1KFS A;  4N56 A;  3OYN A;  2IS3 A;  3O4N A;  4RW6 A;  3OYG A;  2VWJ A;  2VG5 A;  1LW2 A;  1Q9X A;  2FBY A;  1SKR A;  4OLB A;  5KTQ A;  2Q3S A;  2YKM A;  1RCH A;  3KLH A;  4B9S A;  3I0R A;  4RW7 A;  3T19 A;  4FLW A;  4FLX A;  4DSE A;  3RMB A;  3LWM A;  3AO2 A;  1RTD A;  3KK2 A;  1U48 A;  1S1V A;  3MXI A;  1U4B A;  4IKF A;  4KHW A;  2IC3 A;  1HYS A;  1C1B A;  3MAQ A;  2YNH A;  4KTZ A;  3OS2 A;  2D0C A;  2YKN A;  1TGO A;  3NH0 A;  1HNV A;  4CEQ A;  4W5Q A;  3AO4 A;  3PX0 A;  2JLE A;  3B6P A;  4AIL C;  1KSP A;  1TAU A;  1HPZ A;  4FLU A;  4DU1 A;  3VQC A;  3QET A;  3QO9 A;  4M3U A;  4BWM A;  1WAJ A;  1LW0 A;  1BCO A;  4N41 A;  3QIN A;  1C6V A;  3CM5 A;  1TL1 A;  4FW1 A;  4O44 A;  4RG8 A;  4E7H A;  3VQD A;  3MEE A;  5HLF A;  4K8Z A;  3VQ7 A;  4RW4 A;  1B9D A;  3NH1 A;  1VSK A;  1TL3 A;  3D0P A;  5C24 A;  2HNY A;  3TAP A;  3KD5 E;  4PUO A;  4ID1 A;  3OYK A;  3DRS A;  2BDP A;  4CF2 A;  4ELV A;  4KFB A;  3ZT1 A;  2QK9 A;  4DF8 A;  4CGF A;  3AVJ A;  1WSE A;  2GV9 A;  1ASV A;  2GUI A;  4CF1 A;  2E4L A;  1NOZ A;  3TAN A;  2D0A A;  1L3V A;  1HQU A;  2YV0 X;  4PA1 A;  4Y1C A;  4JLH A;  4J2D A;  5J2N A;  4OLA A;  1CXU A;  3VQQ A;  3HP6 A;  3ZSZ A;  4KTQ A;  1HMV A;  3ISN C;  3TAF A;  1UWB A;  2XO7 A;  1IKX A;  4CJ4 A;  5JS2 A;  4CJT A;  4CHN A;  4DU4 A;  2WOM A;  1CXQ A;  1C1A A;  3JSM A;  4FJL A;  3ZSO A;  1YT3 A;  4NYF A;  3VQ5 A;  4W5R A;  1T8E A;  1GOC A;  3DLK A;  1I39 A;  2F96 A;  4CJK A;  3SQ0 A;  1NK9 A;  3AVM A;  1RBR A;  3AVI A;  3C94 A;  3HST B;  4FZY A;  3P1G A;  1UOC A;  1S6Q A;  3HXM A;  3MXJ A;  4GMJ B;  4BAC A;  3TAR A;  2P5G A;  4M3Z A;  2D0B A;  2G8I A;  4JRQ A;  4CK1 A;  4DG1 A;  4Z4C A;  4B9U A;  1I3A A;  1RT6 A;  4HCB A;  1U47 A;  3P83 D;  4L8R B;  3I0S A;  1JXB A;  1X1P A;  2KTQ A;  4FM1 A;  2XY5 A;  1JXE A;  2ZQB A;  3AV9 A;  2DTU A;  3SI6 A;  3HK2 A;  1BI4 A;  2KZZ A;  3FFI A;  3HM9 A;  4DTM A;  2Y1I A;  4LSN A;  4O4G A;  4DSI A;  4FJ8 A;  1S1U A;  1RTH A;  1J54 A;  4CEC A;  3LAM A;  3NH2 A;  4DTU A;  1KCF A;  3VQB A;  3TAQ A;  1U45 A;  3ZSW A;  5DK5 A;  1NK5 A;  3DI6 A;  3H08 A;  1VSJ A;  3IAY A;  3HO1 A;  1QQC A;  1DLO A;  4F8R A;  4Q5V A;  3NHG A;  5K14 A;  5FRN A;  1A5X A;  3NGZ A;  3I8D A;  4DS5 A;  1SKS A;  3HJF A;  3O3H A;  1JLB A;  3V9W A;  4FJ5 A;  1KVC A;  3K59 A;  2FBV A;  3V1O A;  3OJU A;  3LAN A;  3QNO A;  4F2S A;  4FJX A;  1LAW A;  3VN5 A;  3G0Z A;  5KGX A;  4DF4 A;  4CED A;  3DLR A;  4FYD A;  4NYN A;  3DM2 A;  3ZT3 A;  4PY5 A;  3AVN A;  1LWF A;  2RF2 A;  3SV3 A;  4M45 A;  4CJF A;  1LAV A;  4LD0 A;  1LV5 A;  1B92 A;  3KJV A;  2E6M A;  1U49 A;  2PZS A;  3SQ1 A;  3A2F A;  5KRT A;  3V6D A;  4B9L A;  4OKJ A;  4LH5 A;  3SV4 A;  2FBX A;  2QXF A;  4I2Q A;  4AHC A;  1RDD A;  3TAG A;  4CEE A;  5I3U A;  4LSL A;  5CZ2 A;  3NF8 A;  3VQE A;  1BI4 B;  3SZ2 A;  1ZBU A;  2P51 A;  4UQG A;  3OVN A;  3AVH A;  1JLA A;  3ULD A;  2Y1J A;  3U6F A;  4OPJ A;  4M41 A;  2ZD1 A;  1TK8 A;  1RT7 A;  4DFJ A;  3OYE A;  4J2A A;  4CJR A;  4B9M A;  3AA3 A;  1Y97 A;  2NUB A;  4H4M A;  1TAQ A;  3K2P A;  4IG0 A;  1RTJ A;  3ZSR A;  2OZS A;  1TVR A;  3ITH A;  1BIZ A;  3OYH A;  4F3T A;  1HYV A;  2RPI A;  5HRN A;  2EX3 A;  3LP0 A;  3S9H A;  2ETJ A;  2VG6 A;  4FVM A;  5CYQ A;  4B8A B;  4N5S A;  4F3O A;  4CJP A;  1CZ9 A;  2HNZ A;  1IH7 A;  3RTV A;  4CCH A;  3V9X A;  4KKO A;  2YNI A;  2EHG A;  1RT5 A;  3HPG A;  4BE0 A;  3RRG A;  4CJW A;  4HUF A;  3S3N A;  4CIG A;  1HYZ A;  4HUG A;  4FW2 A;  3CFR A;  4FM2 A;  3C6U A;  4CJL A;  4KTW A;  4B9N A;  4ZHR A;  1NK4 A;  1NK0 A;  3LP1 A;  3T1A A;  3V1R A;  4E1M A;  1N6Q A;  1RT4 A;  3CG7 A;  2G8K A;  4DQI A;  3TI0 A;  4E0D A;  3QLH A;  3SCX A;  1VSF A;  1ZBI A;  4CHP A;  4OGE A;  3LZI A;  3RMA A;  2HND A;  1S1W A;  3WNG A;  1SV5 A;  4CER A;  2G8F A;  4DTN A;  3LWL A;  1HQE A;  1BL3 A;  4YNQ A;  1C0U A;  5FDL A;  4CJS A;  4OVL A;  4QCL A;  3DLE A;  4CFD A;  2XRI A;  5DMR A;  2Z1G A;  3O3F A;  4DTS A;  3AA2 A;  1VK0 A;  3SYZ A;  2DFE A;  3QNN A;  3AVL A;  3V9Z A;  5KGW A;  4AHR A;  1S1X A;  4KAZ A;  3NGI A;  4CHY A;  2HVI A;  4DQS A;  3V9U A;  1IG9 A;  4BWJ A;  2DFF A;  3DOK A;  2B5J A;  2O4G A;  3NBP A;  3SQ4 A;  4M42 A;  3PV8 A;  4CF9 A;  1FXX A;  2B4J A;  3MEC A;  1SUQ A;  3L3U A;  1QSY A;  3UIQ A;  3IS9 A;  5FRM A;  3OYI A;  1NJX A;  1JLF A;  3OYD A;  2OYQ A;  1BIU A;  3KKR A;  4F2R A;  3MED A;  4FCY A;  3AVG A;  2HW3 A;  3DYA A;  4CFC A;  1NKC A;  2HHW A;  3NCI A;  1U04 A;  2A1S A;  4ICL A;  4FLV A;  1KFD A;  3OYJ A;  4M3W A;  2X6N A;  3ZSQ A;  3AVA A;  4E7I A;  3RWU A;  1RBS A;  3ZSY A;  3TAM A;  1MU2 A;  3KKS A;  3WNH A;  1ZYQ A;  3L2U A;  4J2B A;  4E3S A;  4CEF A;  3VQ4 A;  3SNN A;  4ZTF A;  4FLZ A;  3L2V A;  3ZCM A;  2OPQ A;  4O0I A;  3OS1 A;  4KV8 A;  1VSL A;  1O1W A;  3K57 A;  1L5U A;  4KB0 A;  4O0J A;  2X78 A;  5D3G A;  1X9W A;  2Z1I A;  3RR7 A;  4FJG A;  2HHS A;  3AVK A;  5HRR A;  3ZT4 A;  4CEO A;  1A5W A;  1XWL A;  2PY5 A;  4R5P A;  1GOB A;  4BE1 A;  1WSH A;  2P1J A;  3AO3 A;  1A5V A;  3HPH A;  1QSL A;  4W5N A;  1NJY A;  4Z4G A;  4YFU A;  1WSG A;  1S9G A;  3TAB A;  1RBV A;  3LP2 A;  4Y1D A;  3L3V A;  3ZSX A;  4E19 A;  2IAJ A;  2OPP A;  2KW4 A;  2IGI A;  4DSJ A;  4F4K A;  4CGD A;  2ZE2 A;  1FK9 A;  1NOY A;  2JGU A;  5C42 A;  3SPY A;  3HVR A;  4O55 A;  1IKV A;  4AHS A;  4JS5 A;  4N76 A;  4M3Y A;  3ASM A;  3JYT A;  4DQQ A;  3KIO A;  4DTP A;  3CFP A;  4KHU A;  4KPY A;  2O4I A;  4CGG A;  3QEW A;  1WSI A;  2YHA A;  3L2W A;  1B9F A;  2YNF A;  2R7Y A;  1X9M A;  2PYJ A;  3NF9 A;  2HHV A;  4I2P A;  4CJQ A;  4NCB A;  4KI6 A;  1IO2 A;  1HNI A;  4CK3 A;  2IDO A;  4DSL A;  3CQ8 A;  4FK0 A;  1WN7 A;  3KLG A;  1ASU A;  4CEB A;  5J2M A;  1D9D A;  1NK7 A;  4B9V A;  4HCC A;  3K5M A;  4W5T A;  3L2Q A;  1QE1 A;  1SL0 A;  1XHX A;  2GBZ A;  3VQA A;  4CIE A;  5E41 A;  3NF6 A;  3ALY A;  3AA4 A;  4CFA A;  3TAE A;  3SUO A;  3SJJ A;  1VRU A;  1WLJ A;  3VQP A;  2RKI A;  1JLG A;  2G8W A;  4B9T A;  3VQ6 A;  4H8K A;  4DTJ A;  4CIF A;  4C8M A;  4ZTJ A;  4KRE A;  1KLM A;  4I9Q A;  4GW6 A;  1NKE A;  4CHO A;  2ITG A;  1S1T A;  3PX4 A;  3QEP A;  1SL1 A;  4KHN A;  4GVM A;  2HMI A;  4BDY A;  4KHQ A;  4OKK A;  2VWK A;  3NAE A;  2OZM A;  3TWH A;  5HBM A;  1VSM A;  3SUN A;  4CGJ A;  3HP9 A;  1TV6 A;  4IDK A;  4FLT A;  2G8H A;  1S9E A;  1DTT A;  3DLH A;  4PQU A;  1HRH A;  1C0T A;  3M8P A;  2X6S A;  3QIO A;  2B6A A;  4OPK A;  1BQN A;  4CES A;  3KLE A;  4XIU A;  3PUF A;  4E7J A;  4M3R A;  4G1Q A;  1CZB A;  1EET A;  4HVJ A;  3K5N A;  1RT1 A;  4C8N A;  3AO5 A;  4CFB A;  2KQ2 A;  1NK8 A;  2HHQ A;  4C8K A;  1LWE A;  4DMN A;  1RT3 A;  1VRT A;  4FM0 A;  3OY9 A;  3QEX A;  2PYL A;  1LWC A;  4NCA A;  1TKT A;  1BGX T;  2DFH A;  3NFA A;  1WNS A;  3O4Q A;  3ZSV A;  5HRS A;  3OYC A;  3M8S A;  1L3U A;  3AVB A;  2G8U A;  1UA0 A;  1C0M A;  1TKZ A;  5CYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...