3AA2A

A52i e. coli rnase hi
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
153
structure length
153
Chain Sequence
KQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAIIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Protein core adaptability: crystal structures of the cavity-filling variants of Escherichia coli RNase HI
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 48
structure length 153
sequence length 153
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3aa2A00
1S5JA 1TKZA 3LAMA 2P5OA 1C1AA 3CYMA 4DQSA 4DQRA 1JL1A 2A1RA 3DRRA 2G8VA 4N76A 2KTQA 3TAPA 1ZBIA 1S1WA 4QCLA 3DOKA 5J2NA 1WSGA 5DK5A 3OS1A 2BE2A 3L3VA 4CEAA 3O4QA 3D45A 1JLGA 2P1JA 1S9EA 1ZBHA 3QERA 2RPIA 1REVA 4HUEA 3E01A 4NYNA 3QEIA 4K8XA 2VG6A 1CLQA 3DM2A 1RT7A 3EYZA 2D5RA 3G10A 3VQAA 2YNFA 2F8TA 4FZYA 1RT3A 3QEVA 2LSNA 1HJRA 4W5QA 1NK8A 1C0TA 3OS0A 4JRPA 1B92A 2HHTA 1SL2A 2NUBA 3NBPA 4EZ9A 1TL1A 4C8NA 3SQ2A 3DMJA 4CJ3A 3KLEA 2BDPA 4FJ5A 4FYDA 1VSLA 3SUQA 4FJIA 4IFYA 4DTOA 1IKYA 1ITGA 2G8IA 1KLMA 4KAZA 3QESA 2KZMA 3KD1E 2OPSA 1YTUA 1TVRA 1VSHA 3AA3A 4BDZA 1J5OA 2PY5A 2VWJA 1BQNA 1SV5A 3RR8A 1XC9A 1Z25A 1I39A 4FZZA 1KVBA 3V81A 1WAJA 1WSEA 3DI6A 3H08A 2GUIA 2KW4A 3V9XA 4DS4A 3L3UA 4LSLA 2YV0X 5HRPA 2XY8A 3RMAA 3WNEA 4QOZB 4CFDA 1I3AA 2XRIA 4RW8A 2X74A 3VA3A 1WSJA 1J53A 4H8KA 3T3FA 3S9HA 1SL1A 3NDKA 3V1RA 2IOCA 3SPYA 2QKKA 4BACA 4CJQA 1LAWA 3MECA 3L2RA 1D5AA 4CF2A 1SKWA 4DTSA 4CEFA 3S3OA 4OKJA 4YFUA 3NHGA 4FW2A 4M41A 4DU1A 2JLEA 4CHOA 4OPKA 4JS5A 4KB0A 4KHWA 1JLQA 3EZ5A 4Z4IA 3HO1A 1U47A 3I8DA 4AILC 3BDPA 3IG1A 4F2SA 2EHGA 3VQ6A 4H4OA 1ZBUA 3AVFA 3OYJA 4OJRA 3ZSOA 4JS4A 4FCYA 3LPUA 2HHXA 2IDOA 3HPGA 1S1VA 3RRGA 4CGFA 3UIQA 4EZ6A 4W5RA 4N47A 5KRSA 3JSMA 3F73A 2Y1JA 3AV9A 4DG1A 1VSFA 3LANA 2W42A 4KHYA 1C1BA 3VQDA 1S9GA 1HQUA 1Q8IA 3AVNA 3P5JA 3M8SA 5HRRA 1Y97A 3K5LA 3L2QA 2G8HA 4O5BA 1KCFA 3AVLA 3LP3A 4IG3A 4CEZA 4F3OA 3SV4A 5FDLA 4DSEA 4CHPA 3NGIA 1F21A 1KFSA 4CJRA 1HQEA 4HHTA 3OYHA 5HRSA 1UAXA 3SNNA 3VQPA 3ZSWA 4EP5A 4PWDA 1CXUA 4B08A 4NCBA 3SUOA 4CCHA 4E1MA 5T7BA 3SV3A 3AO4A 3SZ2A 2X6SA 1N5YA 3SCXA 3K5NA 2PZSA 1RBUA 2HHSA 4ZTFA 5C25A 2FBTA 2XY5A 2XY6A 1ZBLA 4OLAA 1LW0A 4B9SA 1RT5A 1TK8A 3PX0A 3AVAA 5SZTA 4KO0A 4ID5A 4CJPA 4YNQA 5D3GA 3B6OA 4M3UA 4CJKA 2Z1IA 2KFZA 3OYCA 2DFEA 3BGRA 4C8LA 2F8SA 4RG8A 3TABA 1GOCA 2G8FA 2QKBA 3DYAA 3CFRA 3VQEA 3LWMA 4CEDA 3NAEA 3TAMA 2PYLA 1EETA 4Y1CA 3KK3A 3HT3A 4PQUA 1DTQA 1S6PA 4LSNA 1U4BA 1JXBA 1U04A 1GOAA 3AO3A 2Y1IA 5KRTA 1U45A 1C0UA 3S3MA 2OZSA 4DLGA 4CF8A 4CGGA 5HRNA 3LWLA 4BDPA 4ID1A 4DSLA 3QINA 1WSHA 4FJMA 3NGYA 4TSXA 4CHQA 3LAKA 4O0JA 1XHZA 4CIGA 3V1QA 4KTZA 1VSJA 2IAJA 3NF8A 3VQ7A 3QNOA 1S1UA 2E6LA 3SPZA 3TR8A 3FFIA 2VWKA 4FXDA 3OYKA 2HHWA 2DTUA 1RDCA 2QXFA 3LPTA 4Q5VA 4E7JA 1QHTA 1RT2A 3OYMA 2XY7A 5HLFA 1L3SA 3OS2A 4FK0A 1JL2A 1XI1A 4JLHA 3RR7A 4ELTA 5HROA 2P5GA 3I0RA 1HYZA 3QIOA 4J2EA 1X1PA 1RTJA 4UQGA 1D9DA 3ZT0A 1R0AA 2OA8A 4RW6A 3AA5X 3PO4A 3KK1A 1A5WA 4CJSA 4CHYA 2HVIA 3K59A 1KVAA 2HHVA 5C42A 3QNNA 1UWBA 3CQ8A 3RMDA 4BWMA 3HVRA 4L8RB 4CHZA 3LZJA 4DTNA 4C8KA 3HSTB 4F2RA 4DMNA 4B9MA 2B5JA 5CZ1A 3OYLA 3OJSA 3SQ0A 4FK2A 1YTAA 2X6NA 4M3WA 1HNIA 1RTHA 3CFOA 2ETJA 4MQ3A 4DTJA 1UA0A 1WN7A 2KZZA 3TARA 4HCCA 3AO5A 3NGZA 3KIOA 4E7HA 3V9WA 1RDBA 4AHCA 2D0CA 3DLHA 4FLWA 4CJTA 1S1XA 1NK0A 1JLFA 3B6PA 4FJXA 1VRUA 3T19A 3O3FA 3OYBA 4KRFA 3VQ5A 1NOYA 3VN5A 3AA2A 4R5PA 1HMVA 4CECA 1FKPA 4JRQA 1NK5A 1DLOA 3AA4A 3G0ZA 3DLGA 1WNSA 3U3YA 3TAFA 2O4GA 4FLVA 3SUPA 4B9NA 2OPRA 4I2PA 4DTXA 3HL8A 4J2BA 2HNZA 1RDDA 1HYVA 4Z4HA 2FC0A 2AJQA 3IAYA 2B6AA 3KLFA 4CERA 2XO7A 3KTQA 3KJVA 3K2PA 3T1AA 1LAVA 1VK0A 1BQMA 4MFBA 3AVKA 4FM0A 3P83D 4AHTA 3DLEA 2OPPA 3HVTA 4CFAA 3RMBA 3PY8A 5JS2A 3VQBA 1BIUA 4DWIA 1Z26A 4Z0UA 1NOZA 4CEQA 3PX4A 1LWCA 4FZXC 1O1WA 3SQ1A 1BIZA 4CK1A 4C8OA 4FJLA 1UA1A 1RBSA 3L2VA 4CEBA 4KFBA 4GMJB 3C6TA 3ZSZA 1BISA 3QIPA 1TAUA 2KQ2A 2YHBA 3KD5E 1WAFA 4Q0BA 2YNHA 4N5SA 3KK2A 2HHQA 5EU7A 3MAQA 3NFAA 4BE0A 2RN2A 2B4JA 3HP6A 3O4NA 3EY1A 1QSSA 4NCAA 3HK2A 2WONA 3D0PA 3AVBA 1BI4A 4IDKA 4CEOA 1WLJA 3HM9A 1RILA 5J1EA 4AHUA 3RWUA 5JS1A 1QE1A 5CYQA 2ZE2A 3AO1A 5J2QA 4DTMA 1LWEA 1EXQA 1U49A 4KV8A 2F96A 3QEXA 1TK5A 1YVUA 3ZSVA 3DRSA 1RT4A 1D8YA 1IKXA 1RCHA 5HBMA 2QK9A 1HPZA 4PA1A 1QQCA 4IBNA 3KLIA 4LD0A 2OPQA 4FM1A 1W0HA 3NF9A 4CJ4A 1UOCA 2ATQA 1QS4A 3OJUA 3ISNC 3HPHA 3OVNA 1EKEA 2IS3A 4M45A 3K58A 4HVJA 2D0AA 2YNIA 1T8EA 4Z4GA 1A5VA 3LP2A 3QEWA 4M3RA 4DQPA 4KI6A 1U48A 4FJ7A 2Z1HA 4M3ZA 1QSLA 4BWJA 4CFCA 2HB5A 3C95A 3I0SA 4LH4A 4FLTA 2IGIA 4CJFA 3V4IA 2IC3A 1BCOA 1RT6A 3ZSRA 3K57A 3PUFA 3V6DA 4KHSA 3M8RA 1IKVA 2ZQBA 3V9SA 1IG9A 3OYNA 1VSIA 2EX3A 3JYTA 4CJVA 3ZCMA 3V9ZA 1ZBFA 3M8QA 4WE1A 4FJGA 4DTUA 1KTQA 4NYFA 3F9KA 4BE1A 3KKRA 3OYFA 4CFBA 5KGWA 4RW7A 3KLGA 3SJJA 1BI4B 3MXMA 3KKSA 2BGGA 4OPJA 1Q9YA 1NK4A 1SKRA 1TKTA 3ULDA 4DQQA 4AHRA 4W5TA 4CJUA 3OYEA 2I5JA 4DF4A 4FJ9A 1HRHA 2GV9A 4ICLA 4FVMA 1KVCA 4CHNA 4DFPA 1XWLA 3L2WA 5C24A 4DSIA 3VQ4A 1DTTA 1RBTA 3U3GA 4CGDA 3LZIA 3ZT1A 2G8KA 2Q3SA 4M42A 3WNFA 4PY5A 4CK3A 3QETA 2FBVA 4HTUA 3TWHA 4K8ZA 1LW2A 1TAQA 4E3SA 5J2PA 4M3XA 3L8BA 1T05A 2D0BA 3CG7A 4KTQA 4B8CA 3KLHA 4FLZA 2HHUA 1KFDA 4E7LA 1NK7A 5CZ2A 1ASUA 1FXXA 2A1SA 1NJXA 4FJKA 4ELUA 2R7YA 1B9DA 4KI4A 1JKHA 3IS9A 4OKKA 4KB1A 5J2MA 5FRNA 3HJFA 3AVGA 3LDSA 1N6QA 4DSJA 1S6QA 1JLAA 4N41A 4B8AB 3MXJA 5FROA 3AVHA 3LALA 1JLCA 4CJLA 2XHBA 1RTIA 4FLUA 4C8MA 2GBZA 4E1NA 2DFFA 3VQ8A 4O0IA 2RKIA 3HPOA 1MU2A 4E19A 3TAEA 1C6VA 1QSYA 3OYGA 3AVMA 1NKEA 1SUQA 1XHXA 3THVA 1NKCA 3OYIA 5I42A 4W5OA 3VA0A 3C6UA 4GVMA 4RW9A 4CF0A 3NE6A 4KHQA 1WSFA 3ZT2A 1CZBA 1LWFA 5HP1A 3PO5A 1NJYA 3DOLA 1ASWA 2FBYA 1NK9A 3QLHA 1J54A 5KGXA 1L3UA 3WNHA 1ASVA 3O3GA 3P1GA 1WSIA 2BANA 1CZ9A 1C1CA 4KKOA 4BE2A 4O44A 3NF6A 4QAGA 3O3HA 3V9UA 2HW3A 2WOMA 4M3YA 4Z4FA 1G15A 3AVCA 3NH0A 2G8WA 4FJNA 3DRPA 2VG5A 3ASMA 1NJZA 4FK4A 4DQIA 2KFNA 3NF7A 3CFPA 3VQQA 1RTDA 1X9SA 4H4MA 1SL0A 4IFVA 1GOBA 4FJ8A 4I2QA 1TK0A 1K6YA 3NCIA 3S3NA 1RDAA 3CM5A 4OGCA 5SWMA 3IRXA 4LY7A 5E41A 4DLEA 1TL3A 2HNDA 2G8UA 4OGEA 3WNGA 4DFMA 3SI6A 3RTVA 2YKMA 4CE9A 4CK2A 4CF9A 4B9LA 4O4GA 1X9WA 3MEGA 3OYDA 3NH1A 2YHAA 4BDYA 4KREA 4CIFA 1JLEA 2ITGA 4DF8A 4F8RA 4Y1DA 1RT1A 1T7PA 4W5NA 4RW4A 3QO9A 2OYQA 4J2DA 1W9HA 2YKNA 4FW1A 4KTWA 4Z4CA 3K5MA 1JXEA 3HYFA 2HVHA 2Z1JA 1QTMA 1VSMA 2VG7A 5K14A 4HUFA 4FM2A 1NJWA 3A2FA 4CIEA 4E0DA 3K5OA 3AVIA 4DU4A 2RF2A 4IKFA 1S1TA 2X78A 4DTRA 5DMRA 1NK6A 1LV5A 5KTQA 1HNVA 1HYSA 1Q9XA 3TAQA 3SQ4A 3AO2A 4CGHA 1IH7A 4N56A 1L5UA 3NH2A 4PUOA 4LH5A 2O4IA 1C0MA 4CJWA 2HNYA 1VSKA 4E89A 1VSDA 4CJEA 4AHSA 5CYMA 4IG0A 3TANA 4CEEA 1BGXT 1BL3A 4DSFA 4DFJA 3HP9A 2YNGA 4B9VA 5I3UA 1B9FA 2OZMA 4CESA 3PV8A 4CJ5A 3ZSYA 3L2UA 1IO2A 3AVJA 3RMCA 3SUNA 4F4KA 4FLXA 1KLNA 1FKOA 3ZSXA 4AHVA 4ZHRA 4O55A 3MEDA 3OY9A 4E7KA 3CM6A 3VQCA 4FLYA 3HXMA 1RBVA 3TAGA 1YT3A 4XIUA 1KSPA 3ZT3A 2P51A 1CXQA 5FRMA 3MXIA 4E7IA 3DLBA 3TI0A 4NCGA 3MEEA 4DTPA 3DLKA 1D9FA 4B9UA 2FBXA 4FJJA 4KHNA 4DSKA 1EP4A 1BHLA 4DS5A 4B9TA 3VQ9A 1SKSA 4B3OA 5KI6A 4I9QA 3LP1A 3V1OA 4I7FA 2JGUA 3DLRA 2E6MA 3M8PA 4FJHA 1TKXA 4CF1A 1X9MA 4OVLA 4GW6A 1JLBA 4Z4EA 3PX6A 4DU3A 5CY4A 4OLBA 3SYZA 3ZT4A 3LP0A 2DY4A 1VSEA 4KPYA 4HUGA 3ALYA 4CGJA 4G1QA 1T03A 2Z1GA 1EX4A 1FK9A 4EP4A 4M3TA 4F3TA 4HCBA 1TV6A 1A5XA 1TKDA 3RRHA 1BCMA 1KRPA 2PYJA 3C94A 2HMIA 1NKBA 4DFKA 1ZYQA 3ZSQA 1J9AA 4OKEA 1IKWA 1RBRA 1RNHA 2E4LA 4CGIA 3U6FA 1L3TA 4KHUA 4I9LA 2ZD1A 3QEPA 4ZTJA 4ELVA 2DFHA 3ITHA 4AH9A 3OYAA 1L3VA 4J2AA 1VRTA 1TGOA
chains in the Genus database with same CATH superfamily
4DQRA 3DRRA 2VGNA 4N76A 2KTQA 4MDAA 3CPWM 1S1WA 4I6MB 5EY4A 3I56N 5DK5A 1ATSA 3OS1A 2YI1A 3L3VA 3O4QA 3VEVA 4CEAA 1JLGA 2YHXA 2P1JA 3O9QA 1S9EA 3Q7BA 3QEIA 4K8XA 1YXQA 1YITN 3DM2A 1RT7A 3VEOA 2YHWA 5JLFA 1QQNA 5KPTA 3GL1A 3KZBA 3THXA 1NWKA 1B92A 4C8NA 2BDPA 3ULEA 3KLEA 4FYDA 1DEJA 1GLFO 2YJFA 4FWRA 4IFYA 1KLMA 4KAZA 4IO8A 2Q0UA 4BQZA 2OPSA 3A0IX 1TVRA 1VSHA 3AA3A 4BDZA 1TYQB 3RR8A 1I39A 1WAJA 3VTHA 3O9UA 3V9XA 4FWQA 1NMNA 3WQUA 4JV5K 3VGLA 1WSJA 4H8KA 4KH6A 1NBWA 4MLHA 2QKKA 3V1RA 4WQ4C 2FSJA 4CF2A 3NHGA 2JLEA 3HO1A 3SAFA 2E1ZA 1U47A 4AILC 4DV3K 4GKJK 2GUPA 3OYJA 4JS4A 3LPUA 2HHXA 2IDOA 3HPGA 1S1VA 2WBNA 4CGFA 3RRGA 4EZ6A 3MK6A 4N47A 5KRSA 3JSMA 2Y1JA 3HI0A 3ENHA 3LANA 4KHYA 3G6EN 3CJ1A 2PBDA 1S9GA 1Q8IA 3WEEA 5HRRA 4BROA 4O5BA 1KCFA 2WUSA 2V7ZA 4DSEA 3NGIA 1F21A 2UUBK 4HHTA 5KPZA 2O8FB 3O4WA 4B08A 4NCBA 1NM1A 3SV3A 5AQRA 1N5YA 3K5NA 2PZSA 4H0TB 4YY3K 1ZBLA 1LW0A 1R59O 1RT5A 3AVAA 4FOIA 5SZTA 4ID5A 4DQ8A 3BGRA 2F8SA 2ASMA 4RG8A 3D2FB 1BOTO 3MMVA 3NAEA 3TSPA 2PYLA 1EETA 4Y1CA 1DTQA 1TUUA 1JXBA 5BN8A 1TUYA 4H0YB 3AO3A 1HUXA 4CF8A 4CGGA 4BDPA 4DSLA 4FJMA 4TSXA 4ILHA 3LAKA 2HF4A 4CIGA 3NF8A 1NJIO 3VQ7A 3QNOA 1BU6O 2QWMA 2VWKA 4H0OA 1YI2N 4FXDA 3HSCA 2HHWA 2QXFA 4KHPK 4Q5VA 1RT2A 3OYMA 3P31A 5C2DA 1L3SA 1XI1A 1YF5L 2UUCK 3TU5A 1VQON 1RTJA 5H1SQ 4RW6A 3U9ZA 1A5WA 2HVIA 1NNEA 4GV9A 4DKWA 2HHVA 1UWBA 3RMDA 3A5OC 4L8RB 3LZJA 4H5TA 3ZEUB 2BTFA 3OYLA 1HNIA 2ETJA 1JCFA 2WFBA 3H45C 2KZZA 3AO5A 3NGZA 3SBTA 5AJ3K 5JVHL 4E7HA 3M3ZA 1S1XA 3CF5L 2W6KA 3J80O 3QBXA 3O3FA 3LDOA 1NOYA 1HNWK 1NGFA 4R5PA 1NK5A 4NXMK 3HOSA 3HOTA 1DLOA 3U3YA 3SUPA 4FWLA 2D4WA 1MDUB 2VCPA 2HNZA 4BRQA 2AJQA 2FC0A 4A57A 1LCUA 1VQ7N 3K2PA 4FM0A 3LDLA 4DR5K 4AHTA 5KQ8A 2Q2RA 3RMBA 5JS2A 3FZMA 4Z0UA 2HHHK 3SQ1A 4FJLA 4GMJB 3CCSN 1HNXK 1TAUA 1S72N 4FVUA 5M1NA 2YNHA 4N5SA 3KK2A 2HHQA 3WXLA 3HP6A 4KH5A 1SS6A 5BPNA 4K43A 3D0PA 3AVBA 1BI4A 3HM9A 3RWUA 1ESVA 3AO1A 3FZFA 4LFCK 1EXQA 3QEXA 1YVUA 3ZSVA 4RTFD 1RT4A 2NRZA 4PA1A 4LD0A 2OPQA 4IFEA 1W0HA 4A2BA 1UOCA 2ATQA 4CZKA 3MN6A 5AQLA 3ISNC 3HPHA 3OVNA 2A3ZA 4HVJA 3GG4A 2D0AA 4MDBA 4KI6A 1U48A 4WQ5A 4IO9L 4PKHA 3V4IA 2IC3A 3ZSRA 3V6DA 3PUFA 3LDNA 4BR5A 2ZQBA 3V9SA 5AQMA 1S3XA 3V9ZA 2O8CA 1VQLN 3JS6A 4CFBA 4YHHK 5KGWA 4EAHD 4CZHA 5KQDA 1QVFM 1SKRA 1CZAN 1TKTA 4DQQA 4AHRA 4ICLA 1XWLA 4X66K 3ZX2A 4CGDA 1BA1A 3F5TA 5TKYA 5AQPA 3WNFA 4PY5A 3LDQA 2F9TA 2FBVA 4HTUA 1NGCA 3ZETB 3L8BA 4KTQA 3FZKA 1KFDA 4IJNA 1NK7A 5CZ2A 4CZJA 1FXXA 2A1SA 2QXLA 4DCHA 4ELUA 2R7YA 1JKHA 3CC4N 4KB1A 3HJFA 4DSJA 1N6QA 1S6QA 3MN9A 5CE3A 2O8DB 3LALA 1GLEG 1JJ2M 2XHBA 2QW9A 4FLUA 4C8MA 4E1NA 2DFFA 3VQ8A 5MLCQ 3HPOA 5EOYA 4CZEA 3AVMA 3THVA 1NKCA 4NLCA 3VA0A 3R1XA 4GVMA 3UKUA 1WSFA 1LWFA 5AQNA 1NU0A 1S22A 2FBYA 5KGXA 1L3UA 1ASVA 3O3GA 4LF6K 1CZ9A 1C1CA 4KKOA 4O44A 4JD2A 3O3HA 2WOMA 4M3YA 3AVCA 3DRPA 2KFZA 4DQIA 4H4MA 1YHQN 1SL0A 4IFVA 1K6YA 3S3NA 3CM5A 3AAQA 3CCUN 1TL3A 2YKMA 4CK2A 1T6DA 4GV6A 1OH6A 3U9DA 4WFNL 3QBWA 1G99A 3VGKA 1RT1A 2OYQA 4KTWA 1ZC6A 1VSMA 4FM2A 4BR4A 3R6MA 5DM7L 1HYSA 3ULEB 5IT9O 3AO2A 5AQWA 1IH7A 1L5UA 3NH2A 4PUOA 1GLJO 4GNIA 4E1JA 5CYMA 1HKGA 3I55N 1I94K 1VQ9N 5I3UA 2HBMA 1B9FA 2OZMA 4CJ5A 3L2UA 2Q0RA 3SUNA 3TTFA 4ZHRA 1C0FA 3CM6A 1HLUA 3VQCA 3TAGA 1XNRK 3MEEA 4DTPA 3O9RA 2FBXA 3J7ZO 1BHLA 4JK8A 1HKBA 5AQSA 1SKSA 4B3OA 3K0SA 3V1OA 2JGUA 3DLRA 4PL7A 3J81O 1X9MA 4OVLA 3VETA 3VEYA 3PX6A 5CY4A 3SYZA 3LP0A 3UB5A 5JMVA 1VSEA 3ALYA 4CGJA 1K8KA 4FWPA 1T03A 4O8UA 4OO1J 4BQLA 3H3NO 4WQ4A 2HMIA 3SMSA 5FPEA 4EHTA 3WEEB 1J9AA 1IKWA 2E4LA 1L3TA 1EQYA 2PFUA 4ELVA 2DFHA 2O8EA 4AH9A 2P9KA 5FPDA 4PKIA 3DXKA 4J2AA 1TGOA 4A5BA 4DQSA 4JKHA 1JL1A 5AQVA 4GV3A 1ZBIA 4JAXA 3DOKA 5GIOA 2OTJN 3H6EA 5J2NA 1WSGA 3KWIA 3O08A 4X65K 4DR4K 2RPIA 1REVA 3E1YA 4FPBA 2VG6A 1NLVA 1X9JA 3EO3A 1CLQA 2D5RA 3G10A 1DT9A 4K25A 3WXJA 2YNFA 2F8TA 1RT3A 2LSNA 1HJRA 4W5QA 4JRPA 2QM1A 3O1BA 4CJ3A 5M1PA 3SAHA 3G71N 3SUQA 4FJIA 2KZMA 2UXDK 4JKEA 1YTUA 1J5OA 2VWJA 1SV5A 1XC9A 4C23A 4FZZA 1KVBA 1WSEA 3DI6A 3H08A 2GUIA 3CI5A 4X64K 4DS4A 2HBLA 5AQFA 2XY8A 4QOZB 3WNEA 3BEXA 4WFBL 4CBUA 4RW8A 3VA3A 4BRCA 1J53A 1SL1A 3T3FA 3SPYA 1NGBA 4BACA 4LF9K 3L2RA 3CJ9A 1D5AA 1HX1A 1SKWA 2E8AA 2ZWHA 3BF3A 4OKJA 4CBWA 4BR7A 4CHOA 4OPKA 2OANA 4Z4IA 4BG8A 5EXWA 5JICA 1ZBUA 2VYPA 3ZSOA 3UIQA 4W5RA 4U7BA 1VQ8N 1U2VA 1C1BA 3EZWA 4GY2B 2G8HA 2ZGYA 2P9NA 4PKGA 3CC2N 3C6HA 4YOXA 4CHPA 3ID8A 3WXMB 5F1XA 1MWKA 1M1KO 3SNNA 1O13A 3VQPA 4DHYA 3SUOA 4UY8O 4WCEL 4E1MA 4CCHA 3TSQA 3SZ2A 2X6SA 3SCXA 1RBUA 2BUPA 2FBTA 2XY6A 4B9SA 3KWGA 4FWSA 4CBXA 3BZCA 1TK8A 4KO0A 4DV0K 1QZ6A 4DV2K 4JI2K 1XC3A 3O9TA 1GOCA 2P9LA 3VENA 4A2AA 4PQUA 2UUAK 3L4IA 4LSNA 3GDQA 1GOAA 2Y1IA 3BF1A 4B3MK 4QS9A 1YAGA 4DLGA 1NGAA 2QTDA 2P9PA 4O0JA 3V1QA 4KTZA 4DUYK 1ZXOA 1SZ2A 4ISFA 3OYKA 2GWJA 5HLFA 5AZIA 1KAXA 1JL2A 4JLHA 3QIOA 4JEPA 4AM7A 1M90O 1X1PA 4UQGA 2OA8A 3ZT0A 3OBWA 3CMEN 4CJSA 3K59A 3QNNA 3CQ8A 3NMUA 3HVRA 4CHZA 1P8ZA 4BRNA 4JK7A 3OJSA 4FK2A 4M3WA 1EO1A 4MQ3A 1WBDA 3TARA 4HCCA 5AQQA 4CZIA 3V9WA 1NMDA 3THWA 2D0CA 3EKUA 3DLLL 3AAPA 4H03B 2NZTA 2RE2A 3I8BA 3VN5A 1HMVA 4O8KA 3G0ZA 3TAFA 3DLGA 2O4GA 4FLVA 1ILYA 2FXUA 4DTXA 2HSTA 3HL8A 1RDDA 4BR9A 2B6AA 3KTQA 2ZJQL 3T1AA 1LAVA 3DLEA 4JHDA 3DXMB 5BRFA 3PY8A 4A61A 1Z26A 3PX4A 4CEQA 1LWCA 4CD1A 1O1WA 2WC9A 1BIZA 4C8OA 5M1FA 1UA1A 3CXCM 3GBTA 4A5AA 3CCVN 1IBKK 4CZFA 4BC4A 1U6ZA 3HK2A 1EWQA 2RN2A 2B4JA 4NCAA 2WONA 4B1VA 4LF8K 4QS7A 3CERA 5AQUA 4RWTA 2E2QA 2GX9A 3DWLA 3VMFB 5CYQA 3NVMA 1U49A 4KV8A 1DGKN 4IBNA 3KLIA 4IEIA 3CJCA 3NF9A 2BH1A 3RVCA 3OJUA 1EKEA 2IS3A 3VF6A 3K58A 2W41A 1SAZA 2Z1HA 4B1YB 1HKCA 5ADXA 4LH4A 4FLTA 2E2PA 4WFAL 4KHSA 2AA4A 4DR6K 3M8RA 1C0GA 1IG9A 2EX3A 3E9OA 4BRLA 3M8QA 2ZJRL 4BR2A 3KKSA 1NGEA 4OPJA 1YUWA 1NK4A 3ULDA 2ZF5O 3CCJN 4CHNA 4FVMA 2P9IA 4BVOA 3MCAB 5C24A 3VQ4A 1FJGK 1GLDG 3CCLN 2G8KA 4M42A 4K8ZA 1LW2A 4ISEA 5J2PA 2D0BA 4B8CA 3KLHA 3PSFA 1ASUA 5IWAK 1NJXA 3J8AA 5C12A 4XH4A 4OKKA 4MLEA 3LDSA 4B8AB 3AVHA 3PLAA 1WOQA 4IWVA 1JLCA 4CJLA 4B1UB 4WF9L 2GBZA 2A40A 2RKIA 1MU2A 1C6VA 1QSYA 3FZLA 2W40A 4W5OA 2NRHA 3LL3A 4RW9A 5HP1A 3PO5A 4R79A 1ASWA 1NK9A 1J54A 4B1ZA 1IV0A 3HM8A 3D2EA 1XMQK 3S41A 4FWNA 2IIRA 1G15A 2O8EB 4FJNA 3J7YP 3NF7A 3DXKB 2I7PA 4FJ8A 4I2QA 4JI0K 4DV4K 5SWMA 4NLBA 1FW6A 3TPQA 4C1NI 3OTOK 3WNGA 4DFMA 2KHOA 1VAZA 2IVOA 4DR1K 2FSNA 3CJAA 3FLCO 4CF9A 4CVNE 4B9LA 1X9WA 3MEGA 4KREA 3NH1A 1QQOA 4CZGA 2A42A 3C7NA 4F8RA 5LL6Z 4Y1DA 2HVHA 4FW1A 1E4GT 1ZBSA 2Z1JA 5K14A 3P39A 4QS8A 1NJWA 4IKFA 3CIPA 4DTRA 1NK6A 4JI3K 5KTQA 1MWMA 3FZHA 3TAQA 3O5BA 4CGHA 3CETA 3SK3A 4N56A 4EHUA 5TKWA 1C0MA 4CJWA 3H46O 4JI8K 4LF5K 3BP8A 2HNYA 2YX6A 3QB0A 4AHSA 3IFRA 3TANA 1XMOK 4OPHA 1IBLK 5AQJA 2YNGA 3RSEA 3Q7CA 4OPAA 1VQPN 3AVJA 4FLXA 5AQHA 1KLNA 4E7KA 4HCBA 4FLYA 3HXMA 1RBVA 3ZT3A 2P51A 1CXQA 4E7IA 3DLBA 4NCGA 3BUZB 3P4IA 3R8EA 4B9TA 3LP1A 3LM9A 1TKXA 4Z4EA 3THYB 3IUCA 2IVPA 4OLBA 4NO7A 5HL7L 3OHRA 4HUGA 4YOTA 4G1QA 2Z1GA 1EX4A 1FK9A 4GVEA 3WT0A 3QFPA 1A5XA 1U2VB 4C1NK 2KKZA 1BCMA 1KRPA 4LFAK 3C94A 4DFKA 3ZSQA 3WXKA 3U6FA 3QDKA 4KHUA 3MN5A 4JKGA 3LDPA 2ZD1A 4I9LA 4K0KK 1TYQA 2P9NB 3OYAA 1S5JA 1TKZA 2A1RA 2G8VA 3TAPA 4QCLA 2Q97A 5AFUA 1HPMA 4JKCA 4YOYA 2NNWA 3A5NC 1ZBHA 3QERA 2UXBK 4HUEA 3E01A 3TSUA 3VQAA 4FZYA 3QFUA 3OS0A 2HHTA 3CMAN 4FWMA 3L6QA 3NBPA 4IOXA 1TL1A 3SQ2A 3R3LA 1VSLA 1BUPA 4WYBA 1IKYA 1BA0A 3KK7A 2QWPA 3QESA 3CD6N 2PY5A 1BQNA 3EE8A 4JI5K 5HOOA 2VGMA 2ASOA 3T7ZA 2F4VK 2KW4A 3L3UA 4LSLA 5LY3A 1XUPO 1I3AA 5JVGL 4DV1K 1Q81O 2XRIA 3T1HK 2JWKA 4EZ9A 3S9HA 3NDKA 2IOCA 3EE9A 3MECA 3CQYA 5AZIB 3J7AP 2O8FA 4DTSA 4CEFA 3S3OA 3C0BA 4DU1A 4M41A 4JS5A 3THXB 1YJ9N 4KHWA 1JLQA 4F2SA 3I8DA 4BC5A 2EHGA 4H4OA 1HR0K 1NGJA 3AVFA 4B3RK 4OJRA 4FCYA 3B8AX 2P9UA 4DV5K 2Q1NA 3F73A 5FLXO 3AV9A 3LM2A 4DG1A 4X62K 1VQ4N 3H3OB 3VQDA 3MDQA 3THWB 1HQUA 3AVNA 3M8SA 3K5LA 1Y97A 5BPLA 1GLCG 3L2QA 3LP3A 3D6RA 4IG3A 1OKJA 3JAMO 4F3OA 5BR8K 1KFSA 5HRSA 1N32K 4JI6K 4EP5A 4PWDA 1CXUA 5T7BA 3P38A 1WB9A 2HHSA 4CZLA 5C25A 4OLAA 4JHDB 1YJWN 2GEMA 5D3GA 4M3UA 3EL2A 4CJKA 2Q31A 2Z1IA 3ATVA 4L3QA 2D0OA 2DFEA 4LF7K 3C65A 1BO5O 4C8LA 3TABA 2G8FA 2QKBA 1K73O 4K42A 3DYAA 3CFRA 3VQEA 4ILGB 1OH5A 4AF1A 3AARA 3QICA 5KRTA 3S3MA 2OZSA 5JLHA 2OTLN 5HRNA 3LWLA 5GAGP 1QVGM 1BG3A 3AGRA 4B3SK 1VSJA 3F9MA 3O80A 4BG9A 5AQIA 1S1UA 4H0PA 2E6LA 3SPZA 1YVNA 5M1OA 1RDCA 3LPTA 2XY7A 3GE1A 3RR7A 4ELTA 2P5GA 1R0AA 4Z94A 4H5RA 4CHYA 4BY9C 4BWMA 3ID6A 3D7EO 5GINA 4PHTX 3HSTB 1VQNN 3SQ0A 1YTAA 1UA0A 2D0PA 1JCGA 3KVGA 4HTLA 1N33K 4JN4A 1RDBA 4AHCA 3DLHA 4CJTA 4CD3A 3DJCA 1NK0A 3W3DA 2P9IB 4FJXA 4FWOA 3T19A 4H5WA 3VTIA 3HTVA 3O6WA 1OVQA 4IXCA 4CECA 4JRQA 4B9NA 2OPRA 4B1XB 1J5EK 4K41A 4Z4HA 3IAYA 3VF2A 1Q18A 4CERA 2YHYA 1KC8O 2P9SA 3E9LA 3KJVA 1VK0A 1BQMA 2HBKA 4B3TK 2OPPA 3HVTA 4JI7K 3VQBA 2E20A 5GADP 5E26A 1NOZA 4LC9B 2CGKA 1K8AO 1RBSA 2E2OA 4CEBA 3L2VA 3W0LA 3QIPA 2KQ2A 2YHBA 3CCEN 4Q0BA 3MWTA 3MAQA 3NFAA 4BE0A 3EY1A 1QSSA 1P90A 3MCPA 3PSIA 2A6AA 3FGUA 4IDKA 1WLJA 5J1EA 3D2EB 5EVZA 5LJWA 4H5NA 2V52B 4BGBA 4DTMA 1LWEA 2E2NA 3R9PA 1IKXA 4FOEA 2QK9A 4NB4A 1HPZA 1X3NA 4DR3K 4FM1A 1QS4A 3UKRA 4CJ7A 4M45A 1A5VA 4M3RA 5BRDA 4EFHA 1QSLA 4IJAA 4BWJA 4CFCA 3C95A 4LFBK 3I33A 3C7NB 4BRMA 1BCOA 1BDGA 1RT6A 5BPMA 2O8DA 3OYNA 1VSIA 4AM6A 3H1QA 4CJVA 1ZBFA 4FJGA 4A62A 4DTUA 1KTQA 4BRAA 3HBTA 3M6GA 4IZ9A 5M1QA 3OYFA 1OH7A 3EN9A 4RW7A 3T1YK 3SJJA 1BI4B 3MXMA 4DR7K 4HWIA 1Q9YA 3AY9A 4W5TA 3OYEA 2I5JA 1Z05A 3FFKB 2FLOA 3U8XA 3L2WA 3M5RA 1DTTA 4CW7B 2E1YA 3U3GA 3LZIA 4YDUA 4FL9A 3ZT1A 3RSEB 3TWHA 4M3XA 1TAQA 4E3SA 4KBOA 5GIPA 2WTUA 1T05A 3OBYA 4FLZA 4E7LA 3ATUA 4FJKA 1XNQK 4KI4A 1WBBA 3IS9A 4MO5A 5FRNA 3AVGA 4ILJA 4N41A 1JLAA 4DV7K 3MXJA 4DV6K 2QI2A 4IDHA 1RTIA 3OW2M 4OX9K 2O8CB 4E19A 3TAEA 5BREA 3JXUA 3OYGA 2OCEA 1SUQA 3OYIA 5I42A 3C6UA 4CF0A 3NE6A 2RHKA 3ZT2A 1GLBG 2CH5A 5GAEP 1NJYA 3DOLA 1Q7YO 1SQKA 3CHWA 3QLHA 3WNHA 5FPMA 3P1GA 1WSIA 2BANA 5AQGA 3SAGA 4J8FA 4JI4K 4BE2A 4QAGA 1LOTB 4Z4FA 4JKGB 2G8WA 4FK4A 3CFPA 1RTDA 4FSVA 1TK0A 3NCIA 1RFQA 1RDAA 1IJJA 3IRXA 4LY7A 5E41A 2G8UA 1IBMK 4BVPA 2VQFK 3SI6A 3L4QA 5C0YA 4CE9A 3OYDA 4BDYA 4CIFA 5B8HA 1T7PA 3QMLA 4W5NA 3L0QA 4RW4A 1W9HA 2YKNA 3UKUB 1YJNN 1JXEA 1QTMA 3A8YA 3A2FA 4CIEA 3F2KA 3K5OA 5LMNK 2RF2A 2X78A 1LV5A 4JKDA 3CCQN 4U67L 3FE1A 4M7XA 4JD2B 3UE5A 3MX5A 2NRVA 4LH5A 5ADXH 4YOWA 4CJEA 4IG0A 4CEEA 1NGGA 1BGXT 2CGLA 3O1WA 4DSFA 4DFJA 3HP9A 4B9VA 3ZSYA 4O5FA 3RMCA 1FKOA 3ZSXA 2I7NA 4AHVA 3GOIA 4O55A 3MEDA 3OY9A 2NRRA 1KSPA 1YT3A 1NG9A 5FRMA 3EEQA 4GKKK 3MXIA 2QWLA 3DLKA 1D9FA 5AQOA 4B9UA 4KHNA 4DS5A 3VQ9A 2HOEA 4I9QA 2E6MA 4FJHA 4CF1A 1GLLO 4GW6A 3VEXA 2YJEA 4DU3A 2E5LK 2DY4A 2P9UB 3TTCA 4CZMA 4EP4A 4M3TA 1VQ5N 1TV6A 2ZGZA 2UXCK 4OKEA 1RNHA 4CGIA 2EWSA 4PL8A 3QEPA 3ITHA 3ZYYX 4BGAA 1VRTA 2FF3B 3LAMA 2P5OA 4IEEA 1C1AA 3CYMA 2F7TA 3ENOA 5C10A 1KAYA 5I9EB 2BE2A 5AR0A 4BR0A 2ITMA 1EWRA 3D45A 1VQKN 5C15A 5AZJA 4NYNA 3WXIA 3EYZA 4M63C 4A59A 3QEVA 1NK8A 1K8KB 1C0TA 2GTDA 3SJHA 1SL2A 2NUBA 3DMJA 4FJ5A 3VOVA 4BRGA 2ZJPL 3EKSA 4DTOA 1ITGA 2G8IA 4FO0A 2ASPA 2F9WA 3KD1E 2VWBA 2P9KB 1Z25A 3V81A 2UU9K 4BRFA 1DKGD 4IOCL 1QQMA 2YV0X 5HRPA 3RMAA 1D4XA 4CFDA 4FWKA 5F2RA 2X74A 5LJVA 4B1WB 4EIAA 1Z6RA 4CJQA 4BRKA 4YDUC 1LAWA 2HF3A 4JKAA 3BY5A 4YFUA 1KD1O 4FW2A 3A5LC 1NGHA 2HBJA 4KB0A 3EZ5A 3CCRN 2FF6A 2AP1A 4XH5A 3BDPA 3IG1A 3VQ6A 4H5VA 1VQMN 1QHAA 1VSFA 2W42A 1ATNA 4H0VB 3P5JA 3HRGA 3O9SA 2O8BA 1E4FT 3AVLA 4CEZA 3SV4A 2Q36A 3O8MA 5FDLA 4CJRA 1HQEA 3OYHA 2E88A 1QZ5A 1UAXA 3ZSWA 4I6MA 3OA9A 3E66A 2P9SB 3AO4A 4ZTFA 2XY5A 1N34K 1RDWX 1VHXA 3PX0A 4BREA 4CJPA 4YNQA 3FR0A 3B6OA 3G25A 4CI6A 3K9JA 3OYCA 4FPAA 2QA4N 1OH8A 3LWMA 4CEDA 3TAMA 5AFUH 3KK3A 4Y0WA 3HT3A 3E9PA 1S6PA 5M1KA 2QEXN 1U4BA 1U04A 3IMXA 3VERA 1U45A 1C0UA 4ID1A 3QINA 1WSHA 3NGYA 4CHQA 5CR4A 3K9KA 1XHZA 5ELZA 1BWFO 2IAJA 5BR9A 3H1VX 2V51B 3TR8A 3FFIA 3CJ7A 2DTUA 1Q82O 4E7JA 1QHTA 2GELA 1VQ6N 3OS2A 4FK0A 3UKRB 5HROA 3I0RA 1HYZA 4J2EA 3MX2A 1D9DA 4NXNK 3TTDA 3AA5X 3PO4A 3KK1A 1KVAA 3DXMA 5C42A 2P9LB 4YOVA 4DTNA 4C8KA 4F2RA 2KLAA 4DMNA 4B9MA 2B5JA 5CZ1A 2J4RA 5AQZA 5LMUK 2X6NA 1RTHA 3CFOA 4DTJA 1Q86O 1RDUA 1WN7A 3KIOA 4JYAK 1MA9B 5EX5A 1RGIA 2P9PB 1JCEA 4FLWA 1JLFA 3B6PA 1VRUA 1T6CA 3OYBA 4KRFA 3VQ5A 4XH1A 3AA2A 1FKPA 3AA4A 1WNSA 4JNEA 4I2PA 1HNZK 3N4PA 4J2BA 5CHIA 1HYVA 3PIPL 3KLFA 2XO7A 1W97L 4MFBA 3AVKA 3WQTA 3P83D 5F0XA 4CFAA 1BIUA 4DWIA 1W7AA 1OVYA 3ZLJA 4FZXC 3MWPA 4CK1A 2YCHA 4KFBA 3C6TA 3ZSZA 1BISA 3AGKA 3D2FA 3KD5E 1WAFA 5EU7A 4F9OA 4BRHA 1V4SA 3O4NA 4AQYK 3U4LA 4CEOA 5JS1A 1RILA 3IDHA 4AHUA 1QE1A 2ZE2A 3HZ6A 5J2QA 4JI1K 2F96A 1TK5A 3DRSA 3WUHA 2QWNA 1D8YA 1RCHA 5HBMA 4MO4A 4BRIA 1QQCA 4YORA 4CJ4A 2NLXA 2YNIA 3C6AA 1T8EA 3QEWA 3LP2A 4Z4GA 4DQPA 1YIJN 1N8RO 4FJ7A 4RCHA 4M3ZA 1K9MO 4BRPA 2HB5A 3I0SA 2DPNA 2IGIA 4CJFA 3K57A 1IKVA 3MN7A 3JYTA 3ZX3A 3ZEUA 2D1KA 3ZCMA 5FPNA 4WE1A 4NYFA 2NRXA 3F9KA 4BE1A 1NGDA 3KKRA 3VEWA 3KLGA 5AQYA 3CPEA 4M7YA 1ATRA 2BGGA 5DM6L 4FJ9A 4CJUA 4DF4A 1HRHA 2GV9A 1KVCA 5BRHA 2VQEK 4DFPA 1V4TA 4DSIA 4JKBA 1RBTA 2Q3SA 4CK3A 3QETA 3KHYA 3CG7A 3G4SN 2QWRA 1GLAG 2HHUA 3SBGA 1B9DA 4IOAL 5J2MA 5FROA 4JKFA 4BC2A 4O0IA 4KH4A 4DUZK 3SMPA 1NKEA 1XHXA 4BRDA 4XEIA 1T3VA 3SLCA 5E84A 4KHQA 1CZBA 1XQSC 3M1FA 2NRTA 3ENBA 1KQSM 3N4QA 4WQ5C 4B9QA 1KXPA 3DAWA 1T44A 3NF6A 3V9UA 5BN9A 2QWOA 2HW3A 5AQTA 2QWQA 2JWLA 3NH0A 2VG5A 3ASMA 1NJZA 2KFNA 3VQQA 1X9SA 4G9ZA 2FSKA 1N36K 1GOBA 4V19S 3A5MC 3IKMA 4OGCA 4DLEA 1X3MA 2HNDA 4OGEA 3VPZA 3RTVA 4O4GA 2NRWA 2YHAA 3CQXA 1JLEA 2CH6A 5AZJB 3VEZA 2ITGA 4DF8A 2V7YA 3QO9A 1NGIA 5A2QO 4J2DA 3K5MA 4Z4CA 3HYFA 2VG7A 2H3GX 4HUFA 4E0DA 5GAHP 3AVIA 4YOUA 4DU4A 1S1TA 5DMRA 1IG8A 1HNVA 2CGJA 1Q9XA 3THYA 3SQ4A 1WUAA 1KAZA 2O4IA 3CCMN 2UYTA 4ISGA 1VSKA 4DB3A 1VSDA 2GWKA 4E89A 4LF4K 3NVKA 4JK9A 3VESA 1BL3A 5C2FA 2A5XA 4CESA 3PV8A 3ZETA 1IO2A 4F4KA 4DR2K 4BC3A 2ZM6K 4XIUA 1Y64A 3CJBA 3TI0A 2PAVA 2A41A 3T69A 4FJJA 4DSKA 1EP4A 5AQKA 5KI6A 4I7FA 3M8PA 3ZX0A 2IVNA 1HJOA 1JLBA 5AQXA 3VGMA 3ZT4A 3PIOL 4KPYA 1H1VA 4F3TA 5KPRA 4H0XB 1J6ZA 1TKDA 2HMPA 3RRHA 2PYJA 1NKBA 3CC7N 1ZYQA 1W2BM 1RBRA 3BZKA 2O8BB 4ZTJA 2W6LA 1L3VA 3VF4A 1E3MA
chains in the Genus database with same CATH topology
1S5JA 1TKZA 3LAMA 2P5OA 1C1AA 3CYMA 4DQSA 4DQRA 1JL1A 2A1RA 3DRRA 2G8VA 4N76A 2KTQA 3TAPA 1ZBIA 1S1WA 4QCLA 3DOKA 5J2NA 1WSGA 5DK5A 3OS1A 2BE2A 3L3VA 4CEAA 3O4QA 3D45A 1JLGA 2P1JA 1S9EA 1ZBHA 3QERA 2RPIA 1REVA 4HUEA 3E01A 4NYNA 3QEIA 4K8XA 2VG6A 1CLQA 3DM2A 1RT7A 3EYZA 2D5RA 3G10A 3VQAA 2YNFA 2F8TA 4FZYA 1RT3A 3QEVA 2LSNA 1HJRA 4W5QA 1NK8A 1C0TA 3OS0A 4JRPA 1B92A 2HHTA 1SL2A 2NUBA 3NBPA 4EZ9A 1TL1A 4C8NA 3SQ2A 3DMJA 4CJ3A 3KLEA 2BDPA 4FJ5A 4FYDA 1VSLA 3SUQA 4FJIA 4IFYA 4DTOA 1IKYA 1ITGA 2G8IA 1KLMA 4KAZA 3QESA 2KZMA 3KD1E 2OPSA 1YTUA 1TVRA 1VSHA 3AA3A 4BDZA 1J5OA 2PY5A 2VWJA 1BQNA 1SV5A 3RR8A 1XC9A 1Z25A 1I39A 4FZZA 1KVBA 3V81A 1WAJA 1WSEA 3DI6A 3H08A 2GUIA 2KW4A 3V9XA 4DS4A 3L3UA 4LSLA 2YV0X 5HRPA 2XY8A 3RMAA 3WNEA 4QOZB 4CFDA 1I3AA 2XRIA 4RW8A 2X74A 3VA3A 1WSJA 1J53A 4H8KA 3T3FA 3S9HA 1SL1A 3NDKA 3V1RA 2IOCA 3SPYA 2QKKA 4BACA 4CJQA 1LAWA 3MECA 3L2RA 1D5AA 4CF2A 1SKWA 4DTSA 4CEFA 3S3OA 4OKJA 4YFUA 3NHGA 4FW2A 4M41A 4DU1A 2JLEA 4CHOA 4OPKA 4JS5A 4KB0A 4KHWA 1JLQA 3EZ5A 4Z4IA 3HO1A 1U47A 3I8DA 4AILC 3BDPA 3IG1A 4F2SA 2EHGA 3VQ6A 4H4OA 1ZBUA 3AVFA 3OYJA 4OJRA 3ZSOA 4JS4A 4FCYA 3LPUA 2HHXA 2IDOA 3HPGA 1S1VA 3RRGA 4CGFA 3UIQA 4EZ6A 4W5RA 4N47A 5KRSA 3JSMA 3F73A 2Y1JA 3AV9A 4DG1A 1VSFA 3LANA 2W42A 4KHYA 1C1BA 3VQDA 1S9GA 1HQUA 1Q8IA 3AVNA 3P5JA 3M8SA 5HRRA 1Y97A 3K5LA 3L2QA 2G8HA 4O5BA 1KCFA 3AVLA 3LP3A 4IG3A 4CEZA 4F3OA 3SV4A 5FDLA 4DSEA 4CHPA 3NGIA 1F21A 1KFSA 4CJRA 1HQEA 4HHTA 3OYHA 5HRSA 1UAXA 3SNNA 3VQPA 3ZSWA 4EP5A 4PWDA 1CXUA 4B08A 4NCBA 3SUOA 4CCHA 4E1MA 5T7BA 3SV3A 3AO4A 3SZ2A 2X6SA 1N5YA 3SCXA 3K5NA 2PZSA 1RBUA 2HHSA 4ZTFA 5C25A 2FBTA 2XY5A 2XY6A 1ZBLA 4OLAA 1LW0A 4B9SA 1RT5A 1TK8A 3PX0A 3AVAA 5SZTA 4KO0A 4ID5A 4CJPA 4YNQA 5D3GA 3B6OA 4M3UA 4CJKA 2Z1IA 2KFZA 3OYCA 2DFEA 3BGRA 4C8LA 2F8SA 4RG8A 3TABA 1GOCA 2G8FA 2QKBA 3DYAA 3CFRA 3VQEA 3LWMA 4CEDA 3NAEA 3TAMA 2PYLA 1EETA 4Y1CA 3KK3A 3HT3A 4PQUA 1DTQA 1S6PA 4LSNA 1U4BA 1JXBA 1U04A 1GOAA 3AO3A 2Y1IA 5KRTA 1U45A 1C0UA 3S3MA 2OZSA 4DLGA 4CF8A 4CGGA 5HRNA 3LWLA 4BDPA 4ID1A 4DSLA 3QINA 1WSHA 4FJMA 3NGYA 4TSXA 4CHQA 3LAKA 4O0JA 1XHZA 4CIGA 3V1QA 4KTZA 1VSJA 2IAJA 3NF8A 3VQ7A 3QNOA 1S1UA 2E6LA 3SPZA 3TR8A 3FFIA 2VWKA 4FXDA 3OYKA 2HHWA 2DTUA 1RDCA 2QXFA 3LPTA 4Q5VA 4E7JA 1QHTA 1RT2A 3OYMA 2XY7A 5HLFA 1L3SA 3OS2A 4FK0A 1JL2A 1XI1A 4JLHA 3RR7A 4ELTA 5HROA 2P5GA 3I0RA 1HYZA 3QIOA 4J2EA 1X1PA 1RTJA 4UQGA 1D9DA 3ZT0A 1R0AA 2OA8A 4RW6A 3AA5X 3PO4A 3KK1A 1A5WA 4CJSA 4CHYA 2HVIA 3K59A 1KVAA 2HHVA 5C42A 3QNNA 1UWBA 3CQ8A 3RMDA 4BWMA 3HVRA 4L8RB 4CHZA 3LZJA 4DTNA 4C8KA 3HSTB 4F2RA 4DMNA 4B9MA 2B5JA 5CZ1A 3OYLA 3OJSA 3SQ0A 4FK2A 1YTAA 2X6NA 4M3WA 1HNIA 1RTHA 3CFOA 2ETJA 4MQ3A 4DTJA 1UA0A 1WN7A 2KZZA 3TARA 4HCCA 3AO5A 3NGZA 3KIOA 4E7HA 3V9WA 1RDBA 4AHCA 2D0CA 3DLHA 4FLWA 4CJTA 1S1XA 1NK0A 1JLFA 3B6PA 4FJXA 1VRUA 3T19A 3O3FA 3OYBA 4KRFA 3VQ5A 1NOYA 3VN5A 3AA2A 4R5PA 1HMVA 4CECA 1FKPA 4JRQA 1NK5A 1DLOA 3AA4A 3G0ZA 3DLGA 1WNSA 3U3YA 3TAFA 2O4GA 4FLVA 3SUPA 4B9NA 2OPRA 4I2PA 4DTXA 3HL8A 4J2BA 2HNZA 1RDDA 1HYVA 4Z4HA 2FC0A 2AJQA 3IAYA 2B6AA 3KLFA 4CERA 2XO7A 3KTQA 3KJVA 3K2PA 3T1AA 1LAVA 1VK0A 1BQMA 4MFBA 3AVKA 4FM0A 3P83D 4AHTA 3DLEA 2OPPA 3HVTA 4CFAA 3RMBA 3PY8A 5JS2A 3VQBA 1BIUA 4DWIA 1Z26A 4Z0UA 1NOZA 4CEQA 3PX4A 1LWCA 4FZXC 1O1WA 3SQ1A 1BIZA 4CK1A 4C8OA 4FJLA 1UA1A 1RBSA 3L2VA 4CEBA 4KFBA 4GMJB 3C6TA 3ZSZA 1BISA 3QIPA 1TAUA 2KQ2A 2YHBA 3KD5E 1WAFA 4Q0BA 2YNHA 4N5SA 3KK2A 2HHQA 5EU7A 3MAQA 3NFAA 4BE0A 2RN2A 2B4JA 3HP6A 3O4NA 3EY1A 1QSSA 4NCAA 3HK2A 2WONA 3D0PA 3AVBA 1BI4A 4IDKA 4CEOA 1WLJA 3HM9A 1RILA 5J1EA 4AHUA 3RWUA 5JS1A 1QE1A 5CYQA 2ZE2A 3AO1A 5J2QA 4DTMA 1LWEA 1EXQA 1U49A 4KV8A 2F96A 3QEXA 1TK5A 1YVUA 3ZSVA 3DRSA 1RT4A 1D8YA 1IKXA 1RCHA 5HBMA 2QK9A 1HPZA 4PA1A 1QQCA 4IBNA 3KLIA 4LD0A 2OPQA 4FM1A 1W0HA 3NF9A 4CJ4A 1UOCA 2ATQA 1QS4A 3OJUA 3ISNC 3HPHA 3OVNA 1EKEA 2IS3A 4M45A 3K58A 4HVJA 2D0AA 2YNIA 1T8EA 4Z4GA 1A5VA 3LP2A 3QEWA 4M3RA 4DQPA 4KI6A 1U48A 4FJ7A 2Z1HA 4M3ZA 1QSLA 4BWJA 4CFCA 2HB5A 3C95A 3I0SA 4LH4A 4FLTA 2IGIA 4CJFA 3V4IA 2IC3A 1BCOA 1RT6A 3ZSRA 3K57A 3PUFA 3V6DA 4KHSA 3M8RA 1IKVA 2ZQBA 3V9SA 1IG9A 3OYNA 1VSIA 2EX3A 3JYTA 4CJVA 3ZCMA 3V9ZA 1ZBFA 3M8QA 4WE1A 4FJGA 4DTUA 1KTQA 4NYFA 3F9KA 4BE1A 3KKRA 3OYFA 4CFBA 5KGWA 4RW7A 3KLGA 3SJJA 1BI4B 3MXMA 3KKSA 2BGGA 4OPJA 1Q9YA 1NK4A 1SKRA 1TKTA 3ULDA 4DQQA 4AHRA 4W5TA 4CJUA 3OYEA 2I5JA 4DF4A 4FJ9A 1HRHA 2GV9A 4ICLA 4FVMA 1KVCA 4CHNA 4DFPA 1XWLA 3L2WA 5C24A 4DSIA 3VQ4A 1DTTA 1RBTA 3U3GA 4CGDA 3LZIA 3ZT1A 2G8KA 2Q3SA 4M42A 3WNFA 4PY5A 4CK3A 3QETA 2FBVA 4HTUA 3TWHA 4K8ZA 1LW2A 1TAQA 4E3SA 5J2PA 4M3XA 3L8BA 1T05A 2D0BA 3CG7A 4KTQA 4B8CA 3KLHA 4FLZA 2HHUA 1KFDA 4E7LA 1NK7A 5CZ2A 1ASUA 1FXXA 2A1SA 1NJXA 4FJKA 4ELUA 2R7YA 1B9DA 4KI4A 1JKHA 3IS9A 4OKKA 4KB1A 5J2MA 5FRNA 3HJFA 3AVGA 3LDSA 1N6QA 4DSJA 1S6QA 1JLAA 4N41A 4B8AB 3MXJA 5FROA 3AVHA 3LALA 1JLCA 4CJLA 2XHBA 1RTIA 4FLUA 4C8MA 2GBZA 4E1NA 2DFFA 3VQ8A 4O0IA 2RKIA 3HPOA 1MU2A 4E19A 3TAEA 1C6VA 1QSYA 3OYGA 3AVMA 1NKEA 1SUQA 1XHXA 3THVA 1NKCA 3OYIA 5I42A 4W5OA 3VA0A 3C6UA 4GVMA 4RW9A 4CF0A 3NE6A 4KHQA 1WSFA 3ZT2A 1CZBA 1LWFA 5HP1A 3PO5A 1NJYA 3DOLA 1ASWA 2FBYA 1NK9A 3QLHA 1J54A 5KGXA 1L3UA 3WNHA 1ASVA 3O3GA 3P1GA 1WSIA 2BANA 1CZ9A 1C1CA 4KKOA 4BE2A 4O44A 3NF6A 4QAGA 3O3HA 3V9UA 2HW3A 2WOMA 4M3YA 4Z4FA 1G15A 3AVCA 3NH0A 2G8WA 4FJNA 3DRPA 2VG5A 3ASMA 1NJZA 4FK4A 4DQIA 2KFNA 3NF7A 3CFPA 3VQQA 1RTDA 1X9SA 4H4MA 1SL0A 4IFVA 1GOBA 4FJ8A 4I2QA 1TK0A 1K6YA 3NCIA 3S3NA 1RDAA 3CM5A 4OGCA 5SWMA 3IRXA 4LY7A 5E41A 4DLEA 1TL3A 2HNDA 2G8UA 4OGEA 3WNGA 4DFMA 3SI6A 3RTVA 2YKMA 4CE9A 4CK2A 4CF9A 4B9LA 4O4GA 1X9WA 3MEGA 3OYDA 3NH1A 2YHAA 4BDYA 4KREA 4CIFA 1JLEA 2ITGA 4DF8A 4F8RA 4Y1DA 1RT1A 1T7PA 4W5NA 4RW4A 3QO9A 2OYQA 4J2DA 1W9HA 2YKNA 4FW1A 4KTWA 4Z4CA 3K5MA 1JXEA 3HYFA 2HVHA 2Z1JA 1QTMA 1VSMA 2VG7A 5K14A 4HUFA 4FM2A 1NJWA 3A2FA 4CIEA 4E0DA 3K5OA 3AVIA 4DU4A 2RF2A 4IKFA 1S1TA 2X78A 4DTRA 5DMRA 1NK6A 1LV5A 5KTQA 1HNVA 1HYSA 1Q9XA 3TAQA 3SQ4A 3AO2A 4CGHA 1IH7A 4N56A 1L5UA 3NH2A 4PUOA 4LH5A 2O4IA 1C0MA 4CJWA 2HNYA 1VSKA 4E89A 1VSDA 4CJEA 4AHSA 5CYMA 4IG0A 3TANA 4CEEA 1BGXT 1BL3A 4DSFA 4DFJA 3HP9A 2YNGA 4B9VA 5I3UA 1B9FA 2OZMA 4CESA 3PV8A 4CJ5A 3ZSYA 3L2UA 1IO2A 3AVJA 3RMCA 3SUNA 4F4KA 4FLXA 1KLNA 1FKOA 3ZSXA 4AHVA 4ZHRA 4O55A 3MEDA 3OY9A 4E7KA 3CM6A 3VQCA 4FLYA 3HXMA 1RBVA 3TAGA 1YT3A 4XIUA 1KSPA 3ZT3A 2P51A 1CXQA 5FRMA 3MXIA 4E7IA 3DLBA 3TI0A 4NCGA 3MEEA 4DTPA 3DLKA 1D9FA 4B9UA 2FBXA 4FJJA 4KHNA 4DSKA 1EP4A 1BHLA 4DS5A 4B9TA 3VQ9A 1SKSA 4B3OA 5KI6A 4I9QA 3LP1A 3V1OA 4I7FA 2JGUA 3DLRA 2E6MA 3M8PA 4FJHA 1TKXA 4CF1A 1X9MA 4OVLA 4GW6A 1JLBA 4Z4EA 3PX6A 4DU3A 5CY4A 4OLBA 3SYZA 3ZT4A 3LP0A 2DY4A 1VSEA 4KPYA 4HUGA 3ALYA 4CGJA 4G1QA 1T03A 2Z1GA 1EX4A 1FK9A 4EP4A 4M3TA 4F3TA 4HCBA 1TV6A 1A5XA 1TKDA 3RRHA 1BCMA 1KRPA 2PYJA 3C94A 2HMIA 1NKBA 4DFKA 1ZYQA 3ZSQA 1J9AA 4OKEA 1IKWA 1RBRA 1RNHA 2E4LA 4CGIA 3U6FA 1L3TA 4KHUA 4I9LA 2ZD1A 3QEPA 4ZTJA 4ELVA 2DFHA 3ITHA 4AH9A 3OYAA 1L3VA 4J2AA 1VRTA 1TGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5J A;  1TKZ A;  3LAM A;  2P5O A;  1C1A A;  3CYM A;  4DQS A;  4DQR A;  1JL1 A;  2A1R A;  3DRR A;  2G8V A;  4N76 A;  2KTQ A;  3TAP A;  1ZBI A;  1S1W A;  4QCL A;  3DOK A;  5J2N A;  1WSG A;  5DK5 A;  3OS1 A;  2BE2 A;  3L3V A;  4CEA A;  3O4Q A;  3D45 A;  1JLG A;  2P1J A;  1S9E A;  1ZBH A;  3QER A;  2RPI A;  1REV A;  4HUE A;  3E01 A;  4NYN A;  3QEI A;  4K8X A;  2VG6 A;  1CLQ A;  3DM2 A;  1RT7 A;  3EYZ A;  2D5R A;  3G10 A;  3VQA A;  2YNF A;  2F8T A;  4FZY A;  1RT3 A;  3QEV A;  2LSN A;  1HJR A;  4W5Q A;  1NK8 A;  1C0T A;  3OS0 A;  4JRP A;  1B92 A;  2HHT A;  1SL2 A;  2NUB A;  3NBP A;  4EZ9 A;  1TL1 A;  4C8N A;  3SQ2 A;  3DMJ A;  4CJ3 A;  3KLE A;  2BDP A;  4FJ5 A;  4FYD A;  1VSL A;  3SUQ A;  4FJI A;  4IFY A;  4DTO A;  1IKY A;  1ITG A;  2G8I A;  1KLM A;  4KAZ A;  3QES A;  2KZM A;  3KD1 E;  2OPS A;  1YTU A;  1TVR A;  1VSH A;  3AA3 A;  4BDZ A;  1J5O A;  2PY5 A;  2VWJ A;  1BQN A;  1SV5 A;  3RR8 A;  1XC9 A;  1Z25 A;  1I39 A;  4FZZ A;  1KVB A;  3V81 A;  1WAJ A;  1WSE A;  3DI6 A;  3H08 A;  2GUI A;  2KW4 A;  3V9X A;  4DS4 A;  3L3U A;  4LSL A;  2YV0 X;  5HRP A;  2XY8 A;  3RMA A;  3WNE A;  4QOZ B;  4CFD A;  1I3A A;  2XRI A;  4RW8 A;  2X74 A;  3VA3 A;  1WSJ A;  1J53 A;  4H8K A;  3T3F A;  3S9H A;  1SL1 A;  3NDK A;  3V1R A;  2IOC A;  3SPY A;  2QKK A;  4BAC A;  4CJQ A;  1LAW A;  3MEC A;  3L2R A;  1D5A A;  4CF2 A;  1SKW A;  4DTS A;  4CEF A;  3S3O A;  4OKJ A;  4YFU A;  3NHG A;  4FW2 A;  4M41 A;  4DU1 A;  2JLE A;  4CHO A;  4OPK A;  4JS5 A;  4KB0 A;  4KHW A;  1JLQ A;  3EZ5 A;  4Z4I A;  3HO1 A;  1U47 A;  3I8D A;  4AIL C;  3BDP A;  3IG1 A;  4F2S A;  2EHG A;  3VQ6 A;  4H4O A;  1ZBU A;  3AVF A;  3OYJ A;  4OJR A;  3ZSO A;  4JS4 A;  4FCY A;  3LPU A;  2HHX A;  2IDO A;  3HPG A;  1S1V A;  3RRG A;  4CGF A;  3UIQ A;  4EZ6 A;  4W5R A;  4N47 A;  5KRS A;  3JSM A;  3F73 A;  2Y1J A;  3AV9 A;  4DG1 A;  1VSF A;  3LAN A;  2W42 A;  4KHY A;  1C1B A;  3VQD A;  1S9G A;  1HQU A;  1Q8I A;  3AVN A;  3P5J A;  3M8S A;  5HRR A;  1Y97 A;  3K5L A;  3L2Q A;  2G8H A;  4O5B A;  1KCF A;  3AVL A;  3LP3 A;  4IG3 A;  4CEZ A;  4F3O A;  3SV4 A;  5FDL A;  4DSE A;  4CHP A;  3NGI A;  1F21 A;  1KFS A;  4CJR A;  1HQE A;  4HHT A;  3OYH A;  5HRS A;  1UAX A;  3SNN A;  3VQP A;  3ZSW A;  4EP5 A;  4PWD A;  1CXU A;  4B08 A;  4NCB A;  3SUO A;  4CCH A;  4E1M A;  5T7B A;  3SV3 A;  3AO4 A;  3SZ2 A;  2X6S A;  1N5Y A;  3SCX A;  3K5N A;  2PZS A;  1RBU A;  2HHS A;  4ZTF A;  5C25 A;  2FBT A;  2XY5 A;  2XY6 A;  1ZBL A;  4OLA A;  1LW0 A;  4B9S A;  1RT5 A;  1TK8 A;  3PX0 A;  3AVA A;  5SZT A;  4KO0 A;  4ID5 A;  4CJP A;  4YNQ A;  5D3G A;  3B6O A;  4M3U A;  4CJK A;  2Z1I A;  2KFZ A;  3OYC A;  2DFE A;  3BGR A;  4C8L A;  2F8S A;  4RG8 A;  3TAB A;  1GOC A;  2G8F A;  2QKB A;  3DYA A;  3CFR A;  3VQE A;  3LWM A;  4CED A;  3NAE A;  3TAM A;  2PYL A;  1EET A;  4Y1C A;  3KK3 A;  3HT3 A;  4PQU A;  1DTQ A;  1S6P A;  4LSN A;  1U4B A;  1JXB A;  1U04 A;  1GOA A;  3AO3 A;  2Y1I A;  5KRT A;  1U45 A;  1C0U A;  3S3M A;  2OZS A;  4DLG A;  4CF8 A;  4CGG A;  5HRN A;  3LWL A;  4BDP A;  4ID1 A;  4DSL A;  3QIN A;  1WSH A;  4FJM A;  3NGY A;  4TSX A;  4CHQ A;  3LAK A;  4O0J A;  1XHZ A;  4CIG A;  3V1Q A;  4KTZ A;  1VSJ A;  2IAJ A;  3NF8 A;  3VQ7 A;  3QNO A;  1S1U A;  2E6L A;  3SPZ A;  3TR8 A;  3FFI A;  2VWK A;  4FXD A;  3OYK A;  2HHW A;  2DTU A;  1RDC A;  2QXF A;  3LPT A;  4Q5V A;  4E7J A;  1QHT A;  1RT2 A;  3OYM A;  2XY7 A;  5HLF A;  1L3S A;  3OS2 A;  4FK0 A;  1JL2 A;  1XI1 A;  4JLH A;  3RR7 A;  4ELT A;  5HRO A;  2P5G A;  3I0R A;  1HYZ A;  3QIO A;  4J2E A;  1X1P A;  1RTJ A;  4UQG A;  1D9D A;  3ZT0 A;  1R0A A;  2OA8 A;  4RW6 A;  3AA5 X;  3PO4 A;  3KK1 A;  1A5W A;  4CJS A;  4CHY A;  2HVI A;  3K59 A;  1KVA A;  2HHV A;  5C42 A;  3QNN A;  1UWB A;  3CQ8 A;  3RMD A;  4BWM A;  3HVR A;  4L8R B;  4CHZ A;  3LZJ A;  4DTN A;  4C8K A;  3HST B;  4F2R A;  4DMN A;  4B9M A;  2B5J A;  5CZ1 A;  3OYL A;  3OJS A;  3SQ0 A;  4FK2 A;  1YTA A;  2X6N A;  4M3W A;  1HNI A;  1RTH A;  3CFO A;  2ETJ A;  4MQ3 A;  4DTJ A;  1UA0 A;  1WN7 A;  2KZZ A;  3TAR A;  4HCC A;  3AO5 A;  3NGZ A;  3KIO A;  4E7H A;  3V9W A;  1RDB A;  4AHC A;  2D0C A;  3DLH A;  4FLW A;  4CJT A;  1S1X A;  1NK0 A;  1JLF A;  3B6P A;  4FJX A;  1VRU A;  3T19 A;  3O3F A;  3OYB A;  4KRF A;  3VQ5 A;  1NOY A;  3VN5 A;  3AA2 A;  4R5P A;  1HMV A;  4CEC A;  1FKP A;  4JRQ A;  1NK5 A;  1DLO A;  3AA4 A;  3G0Z A;  3DLG A;  1WNS A;  3U3Y A;  3TAF A;  2O4G A;  4FLV A;  3SUP A;  4B9N A;  2OPR A;  4I2P A;  4DTX A;  3HL8 A;  4J2B A;  2HNZ A;  1RDD A;  1HYV A;  4Z4H A;  2FC0 A;  2AJQ A;  3IAY A;  2B6A A;  3KLF A;  4CER A;  2XO7 A;  3KTQ A;  3KJV A;  3K2P A;  3T1A A;  1LAV A;  1VK0 A;  1BQM A;  4MFB A;  3AVK A;  4FM0 A;  3P83 D;  4AHT A;  3DLE A;  2OPP A;  3HVT A;  4CFA A;  3RMB A;  3PY8 A;  5JS2 A;  3VQB A;  1BIU A;  4DWI A;  1Z26 A;  4Z0U A;  1NOZ A;  4CEQ A;  3PX4 A;  1LWC A;  4FZX C;  1O1W A;  3SQ1 A;  1BIZ A;  4CK1 A;  4C8O A;  4FJL A;  1UA1 A;  1RBS A;  3L2V A;  4CEB A;  4KFB A;  4GMJ B;  3C6T A;  3ZSZ A;  1BIS A;  3QIP A;  1TAU A;  2KQ2 A;  2YHB A;  3KD5 E;  1WAF A;  4Q0B A;  2YNH A;  4N5S A;  3KK2 A;  2HHQ A;  5EU7 A;  3MAQ A;  3NFA A;  4BE0 A;  2RN2 A;  2B4J A;  3HP6 A;  3O4N A;  3EY1 A;  1QSS A;  4NCA A;  3HK2 A;  2WON A;  3D0P A;  3AVB A;  1BI4 A;  4IDK A;  4CEO A;  1WLJ A;  3HM9 A;  1RIL A;  5J1E A;  4AHU A;  3RWU A;  5JS1 A;  1QE1 A;  5CYQ A;  2ZE2 A;  3AO1 A;  5J2Q A;  4DTM A;  1LWE A;  1EXQ A;  1U49 A;  4KV8 A;  2F96 A;  3QEX A;  1TK5 A;  1YVU A;  3ZSV A;  3DRS A;  1RT4 A;  1D8Y A;  1IKX A;  1RCH A;  5HBM A;  2QK9 A;  1HPZ A;  4PA1 A;  1QQC A;  4IBN A;  3KLI A;  4LD0 A;  2OPQ A;  4FM1 A;  1W0H A;  3NF9 A;  4CJ4 A;  1UOC A;  2ATQ A;  1QS4 A;  3OJU A;  3ISN C;  3HPH A;  3OVN A;  1EKE A;  2IS3 A;  4M45 A;  3K58 A;  4HVJ A;  2D0A A;  2YNI A;  1T8E A;  4Z4G A;  1A5V A;  3LP2 A;  3QEW A;  4M3R A;  4DQP A;  4KI6 A;  1U48 A;  4FJ7 A;  2Z1H A;  4M3Z A;  1QSL A;  4BWJ A;  4CFC A;  2HB5 A;  3C95 A;  3I0S A;  4LH4 A;  4FLT A;  2IGI A;  4CJF A;  3V4I A;  2IC3 A;  1BCO A;  1RT6 A;  3ZSR A;  3K57 A;  3PUF A;  3V6D A;  4KHS A;  3M8R A;  1IKV A;  2ZQB A;  3V9S A;  1IG9 A;  3OYN A;  1VSI A;  2EX3 A;  3JYT A;  4CJV A;  3ZCM A;  3V9Z A;  1ZBF A;  3M8Q A;  4WE1 A;  4FJG A;  4DTU A;  1KTQ A;  4NYF A;  3F9K A;  4BE1 A;  3KKR A;  3OYF A;  4CFB A;  5KGW A;  4RW7 A;  3KLG A;  3SJJ A;  1BI4 B;  3MXM A;  3KKS A;  2BGG A;  4OPJ A;  1Q9Y A;  1NK4 A;  1SKR A;  1TKT A;  3ULD A;  4DQQ A;  4AHR A;  4W5T A;  4CJU A;  3OYE A;  2I5J A;  4DF4 A;  4FJ9 A;  1HRH A;  2GV9 A;  4ICL A;  4FVM A;  1KVC A;  4CHN A;  4DFP A;  1XWL A;  3L2W A;  5C24 A;  4DSI A;  3VQ4 A;  1DTT A;  1RBT A;  3U3G A;  4CGD A;  3LZI A;  3ZT1 A;  2G8K A;  2Q3S A;  4M42 A;  3WNF A;  4PY5 A;  4CK3 A;  3QET A;  2FBV A;  4HTU A;  3TWH A;  4K8Z A;  1LW2 A;  1TAQ A;  4E3S A;  5J2P A;  4M3X A;  3L8B A;  1T05 A;  2D0B A;  3CG7 A;  4KTQ A;  4B8C A;  3KLH A;  4FLZ A;  2HHU A;  1KFD A;  4E7L A;  1NK7 A;  5CZ2 A;  1ASU A;  1FXX A;  2A1S A;  1NJX A;  4FJK A;  4ELU A;  2R7Y A;  1B9D A;  4KI4 A;  1JKH A;  3IS9 A;  4OKK A;  4KB1 A;  5J2M A;  5FRN A;  3HJF A;  3AVG A;  3LDS A;  1N6Q A;  4DSJ A;  1S6Q A;  1JLA A;  4N41 A;  4B8A B;  3MXJ A;  5FRO A;  3AVH A;  3LAL A;  1JLC A;  4CJL A;  2XHB A;  1RTI A;  4FLU A;  4C8M A;  2GBZ A;  4E1N A;  2DFF A;  3VQ8 A;  4O0I A;  2RKI A;  3HPO A;  1MU2 A;  4E19 A;  3TAE A;  1C6V A;  1QSY A;  3OYG A;  3AVM A;  1NKE A;  1SUQ A;  1XHX A;  3THV A;  1NKC A;  3OYI A;  5I42 A;  4W5O A;  3VA0 A;  3C6U A;  4GVM A;  4RW9 A;  4CF0 A;  3NE6 A;  4KHQ A;  1WSF A;  3ZT2 A;  1CZB A;  1LWF A;  5HP1 A;  3PO5 A;  1NJY A;  3DOL A;  1ASW A;  2FBY A;  1NK9 A;  3QLH A;  1J54 A;  5KGX A;  1L3U A;  3WNH A;  1ASV A;  3O3G A;  3P1G A;  1WSI A;  2BAN A;  1CZ9 A;  1C1C A;  4KKO A;  4BE2 A;  4O44 A;  3NF6 A;  4QAG A;  3O3H A;  3V9U A;  2HW3 A;  2WOM A;  4M3Y A;  4Z4F A;  1G15 A;  3AVC A;  3NH0 A;  2G8W A;  4FJN A;  3DRP A;  2VG5 A;  3ASM A;  1NJZ A;  4FK4 A;  4DQI A;  2KFN A;  3NF7 A;  3CFP A;  3VQQ A;  1RTD A;  1X9S A;  4H4M A;  1SL0 A;  4IFV A;  1GOB A;  4FJ8 A;  4I2Q A;  1TK0 A;  1K6Y A;  3NCI A;  3S3N A;  1RDA A;  3CM5 A;  4OGC A;  5SWM A;  3IRX A;  4LY7 A;  5E41 A;  4DLE A;  1TL3 A;  2HND A;  2G8U A;  4OGE A;  3WNG A;  4DFM A;  3SI6 A;  3RTV A;  2YKM A;  4CE9 A;  4CK2 A;  4CF9 A;  4B9L A;  4O4G A;  1X9W A;  3MEG A;  3OYD A;  3NH1 A;  2YHA A;  4BDY A;  4KRE A;  4CIF A;  1JLE A;  2ITG A;  4DF8 A;  4F8R A;  4Y1D A;  1RT1 A;  1T7P A;  4W5N A;  4RW4 A;  3QO9 A;  2OYQ A;  4J2D A;  1W9H A;  2YKN A;  4FW1 A;  4KTW A;  4Z4C A;  3K5M A;  1JXE A;  3HYF A;  2HVH A;  2Z1J A;  1QTM A;  1VSM A;  2VG7 A;  5K14 A;  4HUF A;  4FM2 A;  1NJW A;  3A2F A;  4CIE A;  4E0D A;  3K5O A;  3AVI A;  4DU4 A;  2RF2 A;  4IKF A;  1S1T A;  2X78 A;  4DTR A;  5DMR A;  1NK6 A;  1LV5 A;  5KTQ A;  1HNV A;  1HYS A;  1Q9X A;  3TAQ A;  3SQ4 A;  3AO2 A;  4CGH A;  1IH7 A;  4N56 A;  1L5U A;  3NH2 A;  4PUO A;  4LH5 A;  2O4I A;  1C0M A;  4CJW A;  2HNY A;  1VSK A;  4E89 A;  1VSD A;  4CJE A;  4AHS A;  5CYM A;  4IG0 A;  3TAN A;  4CEE A;  1BGX T;  1BL3 A;  4DSF A;  4DFJ A;  3HP9 A;  2YNG A;  4B9V A;  5I3U A;  1B9F A;  2OZM A;  4CES A;  3PV8 A;  4CJ5 A;  3ZSY A;  3L2U A;  1IO2 A;  3AVJ A;  3RMC A;  3SUN A;  4F4K A;  4FLX A;  1KLN A;  1FKO A;  3ZSX A;  4AHV A;  4ZHR A;  4O55 A;  3MED A;  3OY9 A;  4E7K A;  3CM6 A;  3VQC A;  4FLY A;  3HXM A;  1RBV A;  3TAG A;  1YT3 A;  4XIU A;  1KSP A;  3ZT3 A;  2P51 A;  1CXQ A;  5FRM A;  3MXI A;  4E7I A;  3DLB A;  3TI0 A;  4NCG A;  3MEE A;  4DTP A;  3DLK A;  1D9F A;  4B9U A;  2FBX A;  4FJJ A;  4KHN A;  4DSK A;  1EP4 A;  1BHL A;  4DS5 A;  4B9T A;  3VQ9 A;  1SKS A;  4B3O A;  5KI6 A;  4I9Q A;  3LP1 A;  3V1O A;  4I7F A;  2JGU A;  3DLR A;  2E6M A;  3M8P A;  4FJH A;  1TKX A;  4CF1 A;  1X9M A;  4OVL A;  4GW6 A;  1JLB A;  4Z4E A;  3PX6 A;  4DU3 A;  5CY4 A;  4OLB A;  3SYZ A;  3ZT4 A;  3LP0 A;  2DY4 A;  1VSE A;  4KPY A;  4HUG A;  3ALY A;  4CGJ A;  4G1Q A;  1T03 A;  2Z1G A;  1EX4 A;  1FK9 A;  4EP4 A;  4M3T A;  4F3T A;  4HCB A;  1TV6 A;  1A5X A;  1TKD A;  3RRH A;  1BCM A;  1KRP A;  2PYJ A;  3C94 A;  2HMI A;  1NKB A;  4DFK A;  1ZYQ A;  3ZSQ A;  1J9A A;  4OKE A;  1IKW A;  1RBR A;  1RNH A;  2E4L A;  4CGI A;  3U6F A;  1L3T A;  4KHU A;  4I9L A;  2ZD1 A;  3QEP A;  4ZTJ A;  4ELV A;  2DFH A;  3ITH A;  4AH9 A;  3OYA A;  1L3V A;  4J2A A;  1VRT A;  1TGO A; 
#chains in the Genus database with same CATH topology
 4DQR A;  3DRR A;  2VGN A;  4N76 A;  2KTQ A;  4MDA A;  3CPW M;  1S1W A;  4I6M B;  5EY4 A;  3I56 N;  5DK5 A;  1ATS A;  3OS1 A;  2YI1 A;  3L3V A;  3O4Q A;  3VEV A;  4CEA A;  1JLG A;  2YHX A;  2P1J A;  3O9Q A;  1S9E A;  3Q7B A;  3QEI A;  4K8X A;  1YXQ A;  1YIT N;  3DM2 A;  1RT7 A;  3VEO A;  2YHW A;  5JLF A;  1QQN A;  5KPT A;  3GL1 A;  3KZB A;  3THX A;  1NWK A;  1B92 A;  4C8N A;  2BDP A;  3ULE A;  3KLE A;  4FYD A;  1DEJ A;  1GLF O;  2YJF A;  4FWR A;  4IFY A;  1KLM A;  4KAZ A;  4IO8 A;  2Q0U A;  4BQZ A;  2OPS A;  3A0I X;  1TVR A;  1VSH A;  3AA3 A;  4BDZ A;  1TYQ B;  3RR8 A;  1I39 A;  1WAJ A;  3VTH A;  3O9U A;  3V9X A;  4FWQ A;  1NMN A;  3WQU A;  4JV5 K;  3VGL A;  1WSJ A;  4H8K A;  4KH6 A;  1NBW A;  4MLH A;  2QKK A;  3V1R A;  4WQ4 C;  2FSJ A;  4CF2 A;  3NHG A;  2JLE A;  3HO1 A;  3SAF A;  2E1Z A;  1U47 A;  4AIL C;  4DV3 K;  4GKJ K;  2GUP A;  3OYJ A;  4JS4 A;  3LPU A;  2HHX A;  2IDO A;  3HPG A;  1S1V A;  2WBN A;  4CGF A;  3RRG A;  4EZ6 A;  3MK6 A;  4N47 A;  5KRS A;  3JSM A;  2Y1J A;  3HI0 A;  3ENH A;  3LAN A;  4KHY A;  3G6E N;  3CJ1 A;  2PBD A;  1S9G A;  1Q8I A;  3WEE A;  5HRR A;  4BRO A;  4O5B A;  1KCF A;  2WUS A;  2V7Z A;  4DSE A;  3NGI A;  1F21 A;  2UUB K;  4HHT A;  5KPZ A;  2O8F B;  3O4W A;  4B08 A;  4NCB A;  1NM1 A;  3SV3 A;  5AQR A;  1N5Y A;  3K5N A;  2PZS A;  4H0T B;  4YY3 K;  1ZBL A;  1LW0 A;  1R59 O;  1RT5 A;  3AVA A;  4FOI A;  5SZT A;  4ID5 A;  4DQ8 A;  3BGR A;  2F8S A;  2ASM A;  4RG8 A;  3D2F B;  1BOT O;  3MMV A;  3NAE A;  3TSP A;  2PYL A;  1EET A;  4Y1C A;  1DTQ A;  1TUU A;  1JXB A;  5BN8 A;  1TUY A;  4H0Y B;  3AO3 A;  1HUX A;  4CF8 A;  4CGG A;  4BDP A;  4DSL A;  4FJM A;  4TSX A;  4ILH A;  3LAK A;  2HF4 A;  4CIG A;  3NF8 A;  1NJI O;  3VQ7 A;  3QNO A;  1BU6 O;  2QWM A;  2VWK A;  4H0O A;  1YI2 N;  4FXD A;  3HSC A;  2HHW A;  2QXF A;  4KHP K;  4Q5V A;  1RT2 A;  3OYM A;  3P31 A;  5C2D A;  1L3S A;  1XI1 A;  1YF5 L;  2UUC K;  3TU5 A;  1VQO N;  1RTJ A;  5H1S Q;  4RW6 A;  3U9Z A;  1A5W A;  2HVI A;  1NNE A;  4GV9 A;  4DKW A;  2HHV A;  1UWB A;  3RMD A;  3A5O C;  4L8R B;  3LZJ A;  4H5T A;  3ZEU B;  2BTF A;  3OYL A;  1HNI A;  2ETJ A;  1JCF A;  2WFB A;  3H45 C;  2KZZ A;  3AO5 A;  3NGZ A;  3SBT A;  5AJ3 K;  5JVH L;  4E7H A;  3M3Z A;  1S1X A;  3CF5 L;  2W6K A;  3J80 O;  3QBX A;  3O3F A;  3LDO A;  1NOY A;  1HNW K;  1NGF A;  4R5P A;  1NK5 A;  4NXM K;  3HOS A;  3HOT A;  1DLO A;  3U3Y A;  3SUP A;  4FWL A;  2D4W A;  1MDU B;  2VCP A;  2HNZ A;  4BRQ A;  2AJQ A;  2FC0 A;  4A57 A;  1LCU A;  1VQ7 N;  3K2P A;  4FM0 A;  3LDL A;  4DR5 K;  4AHT A;  5KQ8 A;  2Q2R A;  3RMB A;  5JS2 A;  3FZM A;  4Z0U A;  2HHH K;  3SQ1 A;  4FJL A;  4GMJ B;  3CCS N;  1HNX K;  1TAU A;  1S72 N;  4FVU A;  5M1N A;  2YNH A;  4N5S A;  3KK2 A;  2HHQ A;  3WXL A;  3HP6 A;  4KH5 A;  1SS6 A;  5BPN A;  4K43 A;  3D0P A;  3AVB A;  1BI4 A;  3HM9 A;  3RWU A;  1ESV A;  3AO1 A;  3FZF A;  4LFC K;  1EXQ A;  3QEX A;  1YVU A;  3ZSV A;  4RTF D;  1RT4 A;  2NRZ A;  4PA1 A;  4LD0 A;  2OPQ A;  4IFE A;  1W0H A;  4A2B A;  1UOC A;  2ATQ A;  4CZK A;  3MN6 A;  5AQL A;  3ISN C;  3HPH A;  3OVN A;  2A3Z A;  4HVJ A;  3GG4 A;  2D0A A;  4MDB A;  4KI6 A;  1U48 A;  4WQ5 A;  4IO9 L;  4PKH A;  3V4I A;  2IC3 A;  3ZSR A;  3V6D A;  3PUF A;  3LDN A;  4BR5 A;  2ZQB A;  3V9S A;  5AQM A;  1S3X A;  3V9Z A;  2O8C A;  1VQL N;  3JS6 A;  4CFB A;  4YHH K;  5KGW A;  4EAH D;  4CZH A;  5KQD A;  1QVF M;  1SKR A;  1CZA N;  1TKT A;  4DQQ A;  4AHR A;  4ICL A;  1XWL A;  4X66 K;  3ZX2 A;  4CGD A;  1BA1 A;  3F5T A;  5TKY A;  5AQP A;  3WNF A;  4PY5 A;  3LDQ A;  2F9T A;  2FBV A;  4HTU A;  1NGC A;  3ZET B;  3L8B A;  4KTQ A;  3FZK A;  1KFD A;  4IJN A;  1NK7 A;  5CZ2 A;  4CZJ A;  1FXX A;  2A1S A;  2QXL A;  4DCH A;  4ELU A;  2R7Y A;  1JKH A;  3CC4 N;  4KB1 A;  3HJF A;  4DSJ A;  1N6Q A;  1S6Q A;  3MN9 A;  5CE3 A;  2O8D B;  3LAL A;  1GLE G;  1JJ2 M;  2XHB A;  2QW9 A;  4FLU A;  4C8M A;  4E1N A;  2DFF A;  3VQ8 A;  5MLC Q;  3HPO A;  5EOY A;  4CZE A;  3AVM A;  3THV A;  1NKC A;  4NLC A;  3VA0 A;  3R1X A;  4GVM A;  3UKU A;  1WSF A;  1LWF A;  5AQN A;  1NU0 A;  1S22 A;  2FBY A;  5KGX A;  1L3U A;  1ASV A;  3O3G A;  4LF6 K;  1CZ9 A;  1C1C A;  4KKO A;  4O44 A;  4JD2 A;  3O3H A;  2WOM A;  4M3Y A;  3AVC A;  3DRP A;  2KFZ A;  4DQI A;  4H4M A;  1YHQ N;  1SL0 A;  4IFV A;  1K6Y A;  3S3N A;  3CM5 A;  3AAQ A;  3CCU N;  1TL3 A;  2YKM A;  4CK2 A;  1T6D A;  4GV6 A;  1OH6 A;  3U9D A;  4WFN L;  3QBW A;  1G99 A;  3VGK A;  1RT1 A;  2OYQ A;  4KTW A;  1ZC6 A;  1VSM A;  4FM2 A;  4BR4 A;  3R6M A;  5DM7 L;  1HYS A;  3ULE B;  5IT9 O;  3AO2 A;  5AQW A;  1IH7 A;  1L5U A;  3NH2 A;  4PUO A;  1GLJ O;  4GNI A;  4E1J A;  5CYM A;  1HKG A;  3I55 N;  1I94 K;  1VQ9 N;  5I3U A;  2HBM A;  1B9F A;  2OZM A;  4CJ5 A;  3L2U A;  2Q0R A;  3SUN A;  3TTF A;  4ZHR A;  1C0F A;  3CM6 A;  1HLU A;  3VQC A;  3TAG A;  1XNR K;  3MEE A;  4DTP A;  3O9R A;  2FBX A;  3J7Z O;  1BHL A;  4JK8 A;  1HKB A;  5AQS A;  1SKS A;  4B3O A;  3K0S A;  3V1O A;  2JGU A;  3DLR A;  4PL7 A;  3J81 O;  1X9M A;  4OVL A;  3VET A;  3VEY A;  3PX6 A;  5CY4 A;  3SYZ A;  3LP0 A;  3UB5 A;  5JMV A;  1VSE A;  3ALY A;  4CGJ A;  1K8K A;  4FWP A;  1T03 A;  4O8U A;  4OO1 J;  4BQL A;  3H3N O;  4WQ4 A;  2HMI A;  3SMS A;  5FPE A;  4EHT A;  3WEE B;  1J9A A;  1IKW A;  2E4L A;  1L3T A;  1EQY A;  2PFU A;  4ELV A;  2DFH A;  2O8E A;  4AH9 A;  2P9K A;  5FPD A;  4PKI A;  3DXK A;  4J2A A;  1TGO A;  4A5B A;  4DQS A;  4JKH A;  1JL1 A;  5AQV A;  4GV3 A;  1ZBI A;  4JAX A;  3DOK A;  5GIO A;  2OTJ N;  3H6E A;  5J2N A;  1WSG A;  3KWI A;  3O08 A;  4X65 K;  4DR4 K;  2RPI A;  1REV A;  3E1Y A;  4FPB A;  2VG6 A;  1NLV A;  1X9J A;  3EO3 A;  1CLQ A;  2D5R A;  3G10 A;  1DT9 A;  4K25 A;  3WXJ A;  2YNF A;  2F8T A;  1RT3 A;  2LSN A;  1HJR A;  4W5Q A;  4JRP A;  2QM1 A;  3O1B A;  4CJ3 A;  5M1P A;  3SAH A;  3G71 N;  3SUQ A;  4FJI A;  2KZM A;  2UXD K;  4JKE A;  1YTU A;  1J5O A;  2VWJ A;  1SV5 A;  1XC9 A;  4C23 A;  4FZZ A;  1KVB A;  1WSE A;  3DI6 A;  3H08 A;  2GUI A;  3CI5 A;  4X64 K;  4DS4 A;  2HBL A;  5AQF A;  2XY8 A;  4QOZ B;  3WNE A;  3BEX A;  4WFB L;  4CBU A;  4RW8 A;  3VA3 A;  4BRC A;  1J53 A;  1SL1 A;  3T3F A;  3SPY A;  1NGB A;  4BAC A;  4LF9 K;  3L2R A;  3CJ9 A;  1D5A A;  1HX1 A;  1SKW A;  2E8A A;  2ZWH A;  3BF3 A;  4OKJ A;  4CBW A;  4BR7 A;  4CHO A;  4OPK A;  2OAN A;  4Z4I A;  4BG8 A;  5EXW A;  5JIC A;  1ZBU A;  2VYP A;  3ZSO A;  3UIQ A;  4W5R A;  4U7B A;  1VQ8 N;  1U2V A;  1C1B A;  3EZW A;  4GY2 B;  2G8H A;  2ZGY A;  2P9N A;  4PKG A;  3CC2 N;  3C6H A;  4YOX A;  4CHP A;  3ID8 A;  3WXM B;  5F1X A;  1MWK A;  1M1K O;  3SNN A;  1O13 A;  3VQP A;  4DHY A;  3SUO A;  4UY8 O;  4WCE L;  4E1M A;  4CCH A;  3TSQ A;  3SZ2 A;  2X6S A;  3SCX A;  1RBU A;  2BUP A;  2FBT A;  2XY6 A;  4B9S A;  3KWG A;  4FWS A;  4CBX A;  3BZC A;  1TK8 A;  4KO0 A;  4DV0 K;  1QZ6 A;  4DV2 K;  4JI2 K;  1XC3 A;  3O9T A;  1GOC A;  2P9L A;  3VEN A;  4A2A A;  4PQU A;  2UUA K;  3L4I A;  4LSN A;  3GDQ A;  1GOA A;  2Y1I A;  3BF1 A;  4B3M K;  4QS9 A;  1YAG A;  4DLG A;  1NGA A;  2QTD A;  2P9P A;  4O0J A;  3V1Q A;  4KTZ A;  4DUY K;  1ZXO A;  1SZ2 A;  4ISF A;  3OYK A;  2GWJ A;  5HLF A;  5AZI A;  1KAX A;  1JL2 A;  4JLH A;  3QIO A;  4JEP A;  4AM7 A;  1M90 O;  1X1P A;  4UQG A;  2OA8 A;  3ZT0 A;  3OBW A;  3CME N;  4CJS A;  3K59 A;  3QNN A;  3CQ8 A;  3NMU A;  3HVR A;  4CHZ A;  1P8Z A;  4BRN A;  4JK7 A;  3OJS A;  4FK2 A;  4M3W A;  1EO1 A;  4MQ3 A;  1WBD A;  3TAR A;  4HCC A;  5AQQ A;  4CZI A;  3V9W A;  1NMD A;  3THW A;  2D0C A;  3EKU A;  3DLL L;  3AAP A;  4H03 B;  2NZT A;  2RE2 A;  3I8B A;  3VN5 A;  1HMV A;  4O8K A;  3G0Z A;  3TAF A;  3DLG A;  2O4G A;  4FLV A;  1ILY A;  2FXU A;  4DTX A;  2HST A;  3HL8 A;  1RDD A;  4BR9 A;  2B6A A;  3KTQ A;  2ZJQ L;  3T1A A;  1LAV A;  3DLE A;  4JHD A;  3DXM B;  5BRF A;  3PY8 A;  4A61 A;  1Z26 A;  3PX4 A;  4CEQ A;  1LWC A;  4CD1 A;  1O1W A;  2WC9 A;  1BIZ A;  4C8O A;  5M1F A;  1UA1 A;  3CXC M;  3GBT A;  4A5A A;  3CCV N;  1IBK K;  4CZF A;  4BC4 A;  1U6Z A;  3HK2 A;  1EWQ A;  2RN2 A;  2B4J A;  4NCA A;  2WON A;  4B1V A;  4LF8 K;  4QS7 A;  3CER A;  5AQU A;  4RWT A;  2E2Q A;  2GX9 A;  3DWL A;  3VMF B;  5CYQ A;  3NVM A;  1U49 A;  4KV8 A;  1DGK N;  4IBN A;  3KLI A;  4IEI A;  3CJC A;  3NF9 A;  2BH1 A;  3RVC A;  3OJU A;  1EKE A;  2IS3 A;  3VF6 A;  3K58 A;  2W41 A;  1SAZ A;  2Z1H A;  4B1Y B;  1HKC A;  5ADX A;  4LH4 A;  4FLT A;  2E2P A;  4WFA L;  4KHS A;  2AA4 A;  4DR6 K;  3M8R A;  1C0G A;  1IG9 A;  2EX3 A;  3E9O A;  4BRL A;  3M8Q A;  2ZJR L;  4BR2 A;  3KKS A;  1NGE A;  4OPJ A;  1YUW A;  1NK4 A;  3ULD A;  2ZF5 O;  3CCJ N;  4CHN A;  4FVM A;  2P9I A;  4BVO A;  3MCA B;  5C24 A;  3VQ4 A;  1FJG K;  1GLD G;  3CCL N;  2G8K A;  4M42 A;  4K8Z A;  1LW2 A;  4ISE A;  5J2P A;  2D0B A;  4B8C A;  3KLH A;  3PSF A;  1ASU A;  5IWA K;  1NJX A;  3J8A A;  5C12 A;  4XH4 A;  4OKK A;  4MLE A;  3LDS A;  4B8A B;  3AVH A;  3PLA A;  1WOQ A;  4IWV A;  1JLC A;  4CJL A;  4B1U B;  4WF9 L;  2GBZ A;  2A40 A;  2RKI A;  1MU2 A;  1C6V A;  1QSY A;  3FZL A;  2W40 A;  4W5O A;  2NRH A;  3LL3 A;  4RW9 A;  5HP1 A;  3PO5 A;  4R79 A;  1ASW A;  1NK9 A;  1J54 A;  4B1Z A;  1IV0 A;  3HM8 A;  3D2E A;  1XMQ K;  3S41 A;  4FWN A;  2IIR A;  1G15 A;  2O8E B;  4FJN A;  3J7Y P;  3NF7 A;  3DXK B;  2I7P A;  4FJ8 A;  4I2Q A;  4JI0 K;  4DV4 K;  5SWM A;  4NLB A;  1FW6 A;  3TPQ A;  4C1N I;  3OTO K;  3WNG A;  4DFM A;  2KHO A;  1VAZ A;  2IVO A;  4DR1 K;  2FSN A;  3CJA A;  3FLC O;  4CF9 A;  4CVN E;  4B9L A;  1X9W A;  3MEG A;  4KRE A;  3NH1 A;  1QQO A;  4CZG A;  2A42 A;  3C7N A;  4F8R A;  5LL6 Z;  4Y1D A;  2HVH A;  4FW1 A;  1E4G T;  1ZBS A;  2Z1J A;  5K14 A;  3P39 A;  4QS8 A;  1NJW A;  4IKF A;  3CIP A;  4DTR A;  1NK6 A;  4JI3 K;  5KTQ A;  1MWM A;  3FZH A;  3TAQ A;  3O5B A;  4CGH A;  3CET A;  3SK3 A;  4N56 A;  4EHU A;  5TKW A;  1C0M A;  4CJW A;  3H46 O;  4JI8 K;  4LF5 K;  3BP8 A;  2HNY A;  2YX6 A;  3QB0 A;  4AHS A;  3IFR A;  3TAN A;  1XMO K;  4OPH A;  1IBL K;  5AQJ A;  2YNG A;  3RSE A;  3Q7C A;  4OPA A;  1VQP N;  3AVJ A;  4FLX A;  5AQH A;  1KLN A;  4E7K A;  4HCB A;  4FLY A;  3HXM A;  1RBV A;  3ZT3 A;  2P51 A;  1CXQ A;  4E7I A;  3DLB A;  4NCG A;  3BUZ B;  3P4I A;  3R8E A;  4B9T A;  3LP1 A;  3LM9 A;  1TKX A;  4Z4E A;  3THY B;  3IUC A;  2IVP A;  4OLB A;  4NO7 A;  5HL7 L;  3OHR A;  4HUG A;  4YOT A;  4G1Q A;  2Z1G A;  1EX4 A;  1FK9 A;  4GVE A;  3WT0 A;  3QFP A;  1A5X A;  1U2V B;  4C1N K;  2KKZ A;  1BCM A;  1KRP A;  4LFA K;  3C94 A;  4DFK A;  3ZSQ A;  3WXK A;  3U6F A;  3QDK A;  4KHU A;  3MN5 A;  4JKG A;  3LDP A;  2ZD1 A;  4I9L A;  4K0K K;  1TYQ A;  2P9N B;  3OYA A;  1S5J A;  1TKZ A;  2A1R A;  2G8V A;  3TAP A;  4QCL A;  2Q97 A;  5AFU A;  1HPM A;  4JKC A;  4YOY A;  2NNW A;  3A5N C;  1ZBH A;  3QER A;  2UXB K;  4HUE A;  3E01 A;  3TSU A;  3VQA A;  4FZY A;  3QFU A;  3OS0 A;  2HHT A;  3CMA N;  4FWM A;  3L6Q A;  3NBP A;  4IOX A;  1TL1 A;  3SQ2 A;  3R3L A;  1VSL A;  1BUP A;  4WYB A;  1IKY A;  1BA0 A;  3KK7 A;  2QWP A;  3QES A;  3CD6 N;  2PY5 A;  1BQN A;  3EE8 A;  4JI5 K;  5HOO A;  2VGM A;  2ASO A;  3T7Z A;  2F4V K;  2KW4 A;  3L3U A;  4LSL A;  5LY3 A;  1XUP O;  1I3A A;  5JVG L;  4DV1 K;  1Q81 O;  2XRI A;  3T1H K;  2JWK A;  4EZ9 A;  3S9H A;  3NDK A;  2IOC A;  3EE9 A;  3MEC A;  3CQY A;  5AZI B;  3J7A P;  2O8F A;  4DTS A;  4CEF A;  3S3O A;  3C0B A;  4DU1 A;  4M41 A;  4JS5 A;  3THX B;  1YJ9 N;  4KHW A;  1JLQ A;  4F2S A;  3I8D A;  4BC5 A;  2EHG A;  4H4O A;  1HR0 K;  1NGJ A;  3AVF A;  4B3R K;  4OJR A;  4FCY A;  3B8A X;  2P9U A;  4DV5 K;  2Q1N A;  3F73 A;  5FLX O;  3AV9 A;  3LM2 A;  4DG1 A;  4X62 K;  1VQ4 N;  3H3O B;  3VQD A;  3MDQ A;  3THW B;  1HQU A;  3AVN A;  3M8S A;  3K5L A;  1Y97 A;  5BPL A;  1GLC G;  3L2Q A;  3LP3 A;  3D6R A;  4IG3 A;  1OKJ A;  3JAM O;  4F3O A;  5BR8 K;  1KFS A;  5HRS A;  1N32 K;  4JI6 K;  4EP5 A;  4PWD A;  1CXU A;  5T7B A;  3P38 A;  1WB9 A;  2HHS A;  4CZL A;  5C25 A;  4OLA A;  4JHD B;  1YJW N;  2GEM A;  5D3G A;  4M3U A;  3EL2 A;  4CJK A;  2Q31 A;  2Z1I A;  3ATV A;  4L3Q A;  2D0O A;  2DFE A;  4LF7 K;  3C65 A;  1BO5 O;  4C8L A;  3TAB A;  2G8F A;  2QKB A;  1K73 O;  4K42 A;  3DYA A;  3CFR A;  3VQE A;  4ILG B;  1OH5 A;  4AF1 A;  3AAR A;  3QIC A;  5KRT A;  3S3M A;  2OZS A;  5JLH A;  2OTL N;  5HRN A;  3LWL A;  5GAG P;  1QVG M;  1BG3 A;  3AGR A;  4B3S K;  1VSJ A;  3F9M A;  3O80 A;  4BG9 A;  5AQI A;  1S1U A;  4H0P A;  2E6L A;  3SPZ A;  1YVN A;  5M1O A;  1RDC A;  3LPT A;  2XY7 A;  3GE1 A;  3RR7 A;  4ELT A;  2P5G A;  1R0A A;  4Z94 A;  4H5R A;  4CHY A;  4BY9 C;  4BWM A;  3ID6 A;  3D7E O;  5GIN A;  4PHT X;  3HST B;  1VQN N;  3SQ0 A;  1YTA A;  1UA0 A;  2D0P A;  1JCG A;  3KVG A;  4HTL A;  1N33 K;  4JN4 A;  1RDB A;  4AHC A;  3DLH A;  4CJT A;  4CD3 A;  3DJC A;  1NK0 A;  3W3D A;  2P9I B;  4FJX A;  4FWO A;  3T19 A;  4H5W A;  3VTI A;  3HTV A;  3O6W A;  1OVQ A;  4IXC A;  4CEC A;  4JRQ A;  4B9N A;  2OPR A;  4B1X B;  1J5E K;  4K41 A;  4Z4H A;  3IAY A;  3VF2 A;  1Q18 A;  4CER A;  2YHY A;  1KC8 O;  2P9S A;  3E9L A;  3KJV A;  1VK0 A;  1BQM A;  2HBK A;  4B3T K;  2OPP A;  3HVT A;  4JI7 K;  3VQB A;  2E20 A;  5GAD P;  5E26 A;  1NOZ A;  4LC9 B;  2CGK A;  1K8A O;  1RBS A;  2E2O A;  4CEB A;  3L2V A;  3W0L A;  3QIP A;  2KQ2 A;  2YHB A;  3CCE N;  4Q0B A;  3MWT A;  3MAQ A;  3NFA A;  4BE0 A;  3EY1 A;  1QSS A;  1P90 A;  3MCP A;  3PSI A;  2A6A A;  3FGU A;  4IDK A;  1WLJ A;  5J1E A;  3D2E B;  5EVZ A;  5LJW A;  4H5N A;  2V52 B;  4BGB A;  4DTM A;  1LWE A;  2E2N A;  3R9P A;  1IKX A;  4FOE A;  2QK9 A;  4NB4 A;  1HPZ A;  1X3N A;  4DR3 K;  4FM1 A;  1QS4 A;  3UKR A;  4CJ7 A;  4M45 A;  1A5V A;  4M3R A;  5BRD A;  4EFH A;  1QSL A;  4IJA A;  4BWJ A;  4CFC A;  3C95 A;  4LFB K;  3I33 A;  3C7N B;  4BRM A;  1BCO A;  1BDG A;  1RT6 A;  5BPM A;  2O8D A;  3OYN A;  1VSI A;  4AM6 A;  3H1Q A;  4CJV A;  1ZBF A;  4FJG A;  4A62 A;  4DTU A;  1KTQ A;  4BRA A;  3HBT A;  3M6G A;  4IZ9 A;  5M1Q A;  3OYF A;  1OH7 A;  3EN9 A;  4RW7 A;  3T1Y K;  3SJJ A;  1BI4 B;  3MXM A;  4DR7 K;  4HWI A;  1Q9Y A;  3AY9 A;  4W5T A;  3OYE A;  2I5J A;  1Z05 A;  3FFK B;  2FLO A;  3U8X A;  3L2W A;  3M5R A;  1DTT A;  4CW7 B;  2E1Y A;  3U3G A;  3LZI A;  4YDU A;  4FL9 A;  3ZT1 A;  3RSE B;  3TWH A;  4M3X A;  1TAQ A;  4E3S A;  4KBO A;  5GIP A;  2WTU A;  1T05 A;  3OBY A;  4FLZ A;  4E7L A;  3ATU A;  4FJK A;  1XNQ K;  4KI4 A;  1WBB A;  3IS9 A;  4MO5 A;  5FRN A;  3AVG A;  4ILJ A;  4N41 A;  1JLA A;  4DV7 K;  3MXJ A;  4DV6 K;  2QI2 A;  4IDH A;  1RTI A;  3OW2 M;  4OX9 K;  2O8C B;  4E19 A;  3TAE A;  5BRE A;  3JXU A;  3OYG A;  2OCE A;  1SUQ A;  3OYI A;  5I42 A;  3C6U A;  4CF0 A;  3NE6 A;  2RHK A;  3ZT2 A;  1GLB G;  2CH5 A;  5GAE P;  1NJY A;  3DOL A;  1Q7Y O;  1SQK A;  3CHW A;  3QLH A;  3WNH A;  5FPM A;  3P1G A;  1WSI A;  2BAN A;  5AQG A;  3SAG A;  4J8F A;  4JI4 K;  4BE2 A;  4QAG A;  1LOT B;  4Z4F A;  4JKG B;  2G8W A;  4FK4 A;  3CFP A;  1RTD A;  4FSV A;  1TK0 A;  3NCI A;  1RFQ A;  1RDA A;  1IJJ A;  3IRX A;  4LY7 A;  5E41 A;  2G8U A;  1IBM K;  4BVP A;  2VQF K;  3SI6 A;  3L4Q A;  5C0Y A;  4CE9 A;  3OYD A;  4BDY A;  4CIF A;  5B8H A;  1T7P A;  3QML A;  4W5N A;  3L0Q A;  4RW4 A;  1W9H A;  2YKN A;  3UKU B;  1YJN N;  1JXE A;  1QTM A;  3A8Y A;  3A2F A;  4CIE A;  3F2K A;  3K5O A;  5LMN K;  2RF2 A;  2X78 A;  1LV5 A;  4JKD A;  3CCQ N;  4U67 L;  3FE1 A;  4M7X A;  4JD2 B;  3UE5 A;  3MX5 A;  2NRV A;  4LH5 A;  5ADX H;  4YOW A;  4CJE A;  4IG0 A;  4CEE A;  1NGG A;  1BGX T;  2CGL A;  3O1W A;  4DSF A;  4DFJ A;  3HP9 A;  4B9V A;  3ZSY A;  4O5F A;  3RMC A;  1FKO A;  3ZSX A;  2I7N A;  4AHV A;  3GOI A;  4O55 A;  3MED A;  3OY9 A;  2NRR A;  1KSP A;  1YT3 A;  1NG9 A;  5FRM A;  3EEQ A;  4GKK K;  3MXI A;  2QWL A;  3DLK A;  1D9F A;  5AQO A;  4B9U A;  4KHN A;  4DS5 A;  3VQ9 A;  2HOE A;  4I9Q A;  2E6M A;  4FJH A;  4CF1 A;  1GLL O;  4GW6 A;  3VEX A;  2YJE A;  4DU3 A;  2E5L K;  2DY4 A;  2P9U B;  3TTC A;  4CZM A;  4EP4 A;  4M3T A;  1VQ5 N;  1TV6 A;  2ZGZ A;  2UXC K;  4OKE A;  1RNH A;  4CGI A;  2EWS A;  4PL8 A;  3QEP A;  3ITH A;  3ZYY X;  4BGA A;  1VRT A;  2FF3 B;  3LAM A;  2P5O A;  4IEE A;  1C1A A;  3CYM A;  2F7T A;  3ENO A;  5C10 A;  1KAY A;  5I9E B;  2BE2 A;  5AR0 A;  4BR0 A;  2ITM A;  1EWR A;  3D45 A;  1VQK N;  5C15 A;  5AZJ A;  4NYN A;  3WXI A;  3EYZ A;  4M63 C;  4A59 A;  3QEV A;  1NK8 A;  1K8K B;  1C0T A;  2GTD A;  3SJH A;  1SL2 A;  2NUB A;  3DMJ A;  4FJ5 A;  3VOV A;  4BRG A;  2ZJP L;  3EKS A;  4DTO A;  1ITG A;  2G8I A;  4FO0 A;  2ASP A;  2F9W A;  3KD1 E;  2VWB A;  2P9K B;  1Z25 A;  3V81 A;  2UU9 K;  4BRF A;  1DKG D;  4IOC L;  1QQM A;  2YV0 X;  5HRP A;  3RMA A;  1D4X A;  4CFD A;  4FWK A;  5F2R A;  2X74 A;  5LJV A;  4B1W B;  4EIA A;  1Z6R A;  4CJQ A;  4BRK A;  4YDU C;  1LAW A;  2HF3 A;  4JKA A;  3BY5 A;  4YFU A;  1KD1 O;  4FW2 A;  3A5L C;  1NGH A;  2HBJ A;  4KB0 A;  3EZ5 A;  3CCR N;  2FF6 A;  2AP1 A;  4XH5 A;  3BDP A;  3IG1 A;  3VQ6 A;  4H5V A;  1VQM N;  1QHA A;  1VSF A;  2W42 A;  1ATN A;  4H0V B;  3P5J A;  3HRG A;  3O9S A;  2O8B A;  1E4F T;  3AVL A;  4CEZ A;  3SV4 A;  2Q36 A;  3O8M A;  5FDL A;  4CJR A;  1HQE A;  3OYH A;  2E88 A;  1QZ5 A;  1UAX A;  3ZSW A;  4I6M A;  3OA9 A;  3E66 A;  2P9S B;  3AO4 A;  4ZTF A;  2XY5 A;  1N34 K;  1RDW X;  1VHX A;  3PX0 A;  4BRE A;  4CJP A;  4YNQ A;  3FR0 A;  3B6O A;  3G25 A;  4CI6 A;  3K9J A;  3OYC A;  4FPA A;  2QA4 N;  1OH8 A;  3LWM A;  4CED A;  3TAM A;  5AFU H;  3KK3 A;  4Y0W A;  3HT3 A;  3E9P A;  1S6P A;  5M1K A;  2QEX N;  1U4B A;  1U04 A;  3IMX A;  3VER A;  1U45 A;  1C0U A;  4ID1 A;  3QIN A;  1WSH A;  3NGY A;  4CHQ A;  5CR4 A;  3K9K A;  1XHZ A;  5ELZ A;  1BWF O;  2IAJ A;  5BR9 A;  3H1V X;  2V51 B;  3TR8 A;  3FFI A;  3CJ7 A;  2DTU A;  1Q82 O;  4E7J A;  1QHT A;  2GEL A;  1VQ6 N;  3OS2 A;  4FK0 A;  3UKR B;  5HRO A;  3I0R A;  1HYZ A;  4J2E A;  3MX2 A;  1D9D A;  4NXN K;  3TTD A;  3AA5 X;  3PO4 A;  3KK1 A;  1KVA A;  3DXM A;  5C42 A;  2P9L B;  4YOV A;  4DTN A;  4C8K A;  4F2R A;  2KLA A;  4DMN A;  4B9M A;  2B5J A;  5CZ1 A;  2J4R A;  5AQZ A;  5LMU K;  2X6N A;  1RTH A;  3CFO A;  4DTJ A;  1Q86 O;  1RDU A;  1WN7 A;  3KIO A;  4JYA K;  1MA9 B;  5EX5 A;  1RGI A;  2P9P B;  1JCE A;  4FLW A;  1JLF A;  3B6P A;  1VRU A;  1T6C A;  3OYB A;  4KRF A;  3VQ5 A;  4XH1 A;  3AA2 A;  1FKP A;  3AA4 A;  1WNS A;  4JNE A;  4I2P A;  1HNZ K;  3N4P A;  4J2B A;  5CHI A;  1HYV A;  3PIP L;  3KLF A;  2XO7 A;  1W97 L;  4MFB A;  3AVK A;  3WQT A;  3P83 D;  5F0X A;  4CFA A;  1BIU A;  4DWI A;  1W7A A;  1OVY A;  3ZLJ A;  4FZX C;  3MWP A;  4CK1 A;  2YCH A;  4KFB A;  3C6T A;  3ZSZ A;  1BIS A;  3AGK A;  3D2F A;  3KD5 E;  1WAF A;  5EU7 A;  4F9O A;  4BRH A;  1V4S A;  3O4N A;  4AQY K;  3U4L A;  4CEO A;  5JS1 A;  1RIL A;  3IDH A;  4AHU A;  1QE1 A;  2ZE2 A;  3HZ6 A;  5J2Q A;  4JI1 K;  2F96 A;  1TK5 A;  3DRS A;  3WUH A;  2QWN A;  1D8Y A;  1RCH A;  5HBM A;  4MO4 A;  4BRI A;  1QQC A;  4YOR A;  4CJ4 A;  2NLX A;  2YNI A;  3C6A A;  1T8E A;  3QEW A;  3LP2 A;  4Z4G A;  4DQP A;  1YIJ N;  1N8R O;  4FJ7 A;  4RCH A;  4M3Z A;  1K9M O;  4BRP A;  2HB5 A;  3I0S A;  2DPN A;  2IGI A;  4CJF A;  3K57 A;  1IKV A;  3MN7 A;  3JYT A;  3ZX3 A;  3ZEU A;  2D1K A;  3ZCM A;  5FPN A;  4WE1 A;  4NYF A;  2NRX A;  3F9K A;  4BE1 A;  1NGD A;  3KKR A;  3VEW A;  3KLG A;  5AQY A;  3CPE A;  4M7Y A;  1ATR A;  2BGG A;  5DM6 L;  4FJ9 A;  4CJU A;  4DF4 A;  1HRH A;  2GV9 A;  1KVC A;  5BRH A;  2VQE K;  4DFP A;  1V4T A;  4DSI A;  4JKB A;  1RBT A;  2Q3S A;  4CK3 A;  3QET A;  3KHY A;  3CG7 A;  3G4S N;  2QWR A;  1GLA G;  2HHU A;  3SBG A;  1B9D A;  4IOA L;  5J2M A;  5FRO A;  4JKF A;  4BC2 A;  4O0I A;  4KH4 A;  4DUZ K;  3SMP A;  1NKE A;  1XHX A;  4BRD A;  4XEI A;  1T3V A;  3SLC A;  5E84 A;  4KHQ A;  1CZB A;  1XQS C;  3M1F A;  2NRT A;  3ENB A;  1KQS M;  3N4Q A;  4WQ5 C;  4B9Q A;  1KXP A;  3DAW A;  1T44 A;  3NF6 A;  3V9U A;  5BN9 A;  2QWO A;  2HW3 A;  5AQT A;  2QWQ A;  2JWL A;  3NH0 A;  2VG5 A;  3ASM A;  1NJZ A;  2KFN A;  3VQQ A;  1X9S A;  4G9Z A;  2FSK A;  1N36 K;  1GOB A;  4V19 S;  3A5M C;  3IKM A;  4OGC A;  4DLE A;  1X3M A;  2HND A;  4OGE A;  3VPZ A;  3RTV A;  4O4G A;  2NRW A;  2YHA A;  3CQX A;  1JLE A;  2CH6 A;  5AZJ B;  3VEZ A;  2ITG A;  4DF8 A;  2V7Y A;  3QO9 A;  1NGI A;  5A2Q O;  4J2D A;  3K5M A;  4Z4C A;  3HYF A;  2VG7 A;  2H3G X;  4HUF A;  4E0D A;  5GAH P;  3AVI A;  4YOU A;  4DU4 A;  1S1T A;  5DMR A;  1IG8 A;  1HNV A;  2CGJ A;  1Q9X A;  3THY A;  3SQ4 A;  1WUA A;  1KAZ A;  2O4I A;  3CCM N;  2UYT A;  4ISG A;  1VSK A;  4DB3 A;  1VSD A;  2GWK A;  4E89 A;  4LF4 K;  3NVK A;  4JK9 A;  3VES A;  1BL3 A;  5C2F A;  2A5X A;  4CES A;  3PV8 A;  3ZET A;  1IO2 A;  4F4K A;  4DR2 K;  4BC3 A;  2ZM6 K;  4XIU A;  1Y64 A;  3CJB A;  3TI0 A;  2PAV A;  2A41 A;  3T69 A;  4FJJ A;  4DSK A;  1EP4 A;  5AQK A;  5KI6 A;  4I7F A;  3M8P A;  3ZX0 A;  2IVN A;  1HJO A;  1JLB A;  5AQX A;  3VGM A;  3ZT4 A;  3PIO L;  4KPY A;  1H1V A;  4F3T A;  5KPR A;  4H0X B;  1J6Z A;  1TKD A;  2HMP A;  3RRH A;  2PYJ A;  1NKB A;  3CC7 N;  1ZYQ A;  1W2B M;  1RBR A;  3BZK A;  2O8B B;  4ZTJ A;  2W6L A;  1L3V A;  3VF4 A;  1E3M A; 
#chains in the Genus database with same CATH homology
 1S5J A;  1TKZ A;  3LAM A;  2P5O A;  1C1A A;  3CYM A;  4DQS A;  4DQR A;  1JL1 A;  2A1R A;  3DRR A;  2G8V A;  4N76 A;  2KTQ A;  3TAP A;  1ZBI A;  1S1W A;  4QCL A;  3DOK A;  5J2N A;  1WSG A;  5DK5 A;  3OS1 A;  2BE2 A;  3L3V A;  4CEA A;  3O4Q A;  3D45 A;  1JLG A;  2P1J A;  1S9E A;  1ZBH A;  3QER A;  2RPI A;  1REV A;  4HUE A;  3E01 A;  4NYN A;  3QEI A;  4K8X A;  2VG6 A;  1CLQ A;  3DM2 A;  1RT7 A;  3EYZ A;  2D5R A;  3G10 A;  3VQA A;  2YNF A;  2F8T A;  4FZY A;  1RT3 A;  3QEV A;  2LSN A;  1HJR A;  4W5Q A;  1NK8 A;  1C0T A;  3OS0 A;  4JRP A;  1B92 A;  2HHT A;  1SL2 A;  2NUB A;  3NBP A;  4EZ9 A;  1TL1 A;  4C8N A;  3SQ2 A;  3DMJ A;  4CJ3 A;  3KLE A;  2BDP A;  4FJ5 A;  4FYD A;  1VSL A;  3SUQ A;  4FJI A;  4IFY A;  4DTO A;  1IKY A;  1ITG A;  2G8I A;  1KLM A;  4KAZ A;  3QES A;  2KZM A;  3KD1 E;  2OPS A;  1YTU A;  1TVR A;  1VSH A;  3AA3 A;  4BDZ A;  1J5O A;  2PY5 A;  2VWJ A;  1BQN A;  1SV5 A;  3RR8 A;  1XC9 A;  1Z25 A;  1I39 A;  4FZZ A;  1KVB A;  3V81 A;  1WAJ A;  1WSE A;  3DI6 A;  3H08 A;  2GUI A;  2KW4 A;  3V9X A;  4DS4 A;  3L3U A;  4LSL A;  2YV0 X;  5HRP A;  2XY8 A;  3RMA A;  3WNE A;  4QOZ B;  4CFD A;  1I3A A;  2XRI A;  4RW8 A;  2X74 A;  3VA3 A;  1WSJ A;  1J53 A;  4H8K A;  3T3F A;  3S9H A;  1SL1 A;  3NDK A;  3V1R A;  2IOC A;  3SPY A;  2QKK A;  4BAC A;  4CJQ A;  1LAW A;  3MEC A;  3L2R A;  1D5A A;  4CF2 A;  1SKW A;  4DTS A;  4CEF A;  3S3O A;  4OKJ A;  4YFU A;  3NHG A;  4FW2 A;  4M41 A;  4DU1 A;  2JLE A;  4CHO A;  4OPK A;  4JS5 A;  4KB0 A;  4KHW A;  1JLQ A;  3EZ5 A;  4Z4I A;  3HO1 A;  1U47 A;  3I8D A;  4AIL C;  3BDP A;  3IG1 A;  4F2S A;  2EHG A;  3VQ6 A;  4H4O A;  1ZBU A;  3AVF A;  3OYJ A;  4OJR A;  3ZSO A;  4JS4 A;  4FCY A;  3LPU A;  2HHX A;  2IDO A;  3HPG A;  1S1V A;  3RRG A;  4CGF A;  3UIQ A;  4EZ6 A;  4W5R A;  4N47 A;  5KRS A;  3JSM A;  3F73 A;  2Y1J A;  3AV9 A;  4DG1 A;  1VSF A;  3LAN A;  2W42 A;  4KHY A;  1C1B A;  3VQD A;  1S9G A;  1HQU A;  1Q8I A;  3AVN A;  3P5J A;  3M8S A;  5HRR A;  1Y97 A;  3K5L A;  3L2Q A;  2G8H A;  4O5B A;  1KCF A;  3AVL A;  3LP3 A;  4IG3 A;  4CEZ A;  4F3O A;  3SV4 A;  5FDL A;  4DSE A;  4CHP A;  3NGI A;  1F21 A;  1KFS A;  4CJR A;  1HQE A;  4HHT A;  3OYH A;  5HRS A;  1UAX A;  3SNN A;  3VQP A;  3ZSW A;  4EP5 A;  4PWD A;  1CXU A;  4B08 A;  4NCB A;  3SUO A;  4CCH A;  4E1M A;  5T7B A;  3SV3 A;  3AO4 A;  3SZ2 A;  2X6S A;  1N5Y A;  3SCX A;  3K5N A;  2PZS A;  1RBU A;  2HHS A;  4ZTF A;  5C25 A;  2FBT A;  2XY5 A;  2XY6 A;  1ZBL A;  4OLA A;  1LW0 A;  4B9S A;  1RT5 A;  1TK8 A;  3PX0 A;  3AVA A;  5SZT A;  4KO0 A;  4ID5 A;  4CJP A;  4YNQ A;  5D3G A;  3B6O A;  4M3U A;  4CJK A;  2Z1I A;  2KFZ A;  3OYC A;  2DFE A;  3BGR A;  4C8L A;  2F8S A;  4RG8 A;  3TAB A;  1GOC A;  2G8F A;  2QKB A;  3DYA A;  3CFR A;  3VQE A;  3LWM A;  4CED A;  3NAE A;  3TAM A;  2PYL A;  1EET A;  4Y1C A;  3KK3 A;  3HT3 A;  4PQU A;  1DTQ A;  1S6P A;  4LSN A;  1U4B A;  1JXB A;  1U04 A;  1GOA A;  3AO3 A;  2Y1I A;  5KRT A;  1U45 A;  1C0U A;  3S3M A;  2OZS A;  4DLG A;  4CF8 A;  4CGG A;  5HRN A;  3LWL A;  4BDP A;  4ID1 A;  4DSL A;  3QIN A;  1WSH A;  4FJM A;  3NGY A;  4TSX A;  4CHQ A;  3LAK A;  4O0J A;  1XHZ A;  4CIG A;  3V1Q A;  4KTZ A;  1VSJ A;  2IAJ A;  3NF8 A;  3VQ7 A;  3QNO A;  1S1U A;  2E6L A;  3SPZ A;  3TR8 A;  3FFI A;  2VWK A;  4FXD A;  3OYK A;  2HHW A;  2DTU A;  1RDC A;  2QXF A;  3LPT A;  4Q5V A;  4E7J A;  1QHT A;  1RT2 A;  3OYM A;  2XY7 A;  5HLF A;  1L3S A;  3OS2 A;  4FK0 A;  1JL2 A;  1XI1 A;  4JLH A;  3RR7 A;  4ELT A;  5HRO A;  2P5G A;  3I0R A;  1HYZ A;  3QIO A;  4J2E A;  1X1P A;  1RTJ A;  4UQG A;  1D9D A;  3ZT0 A;  1R0A A;  2OA8 A;  4RW6 A;  3AA5 X;  3PO4 A;  3KK1 A;  1A5W A;  4CJS A;  4CHY A;  2HVI A;  3K59 A;  1KVA A;  2HHV A;  5C42 A;  3QNN A;  1UWB A;  3CQ8 A;  3RMD A;  4BWM A;  3HVR A;  4L8R B;  4CHZ A;  3LZJ A;  4DTN A;  4C8K A;  3HST B;  4F2R A;  4DMN A;  4B9M A;  2B5J A;  5CZ1 A;  3OYL A;  3OJS A;  3SQ0 A;  4FK2 A;  1YTA A;  2X6N A;  4M3W A;  1HNI A;  1RTH A;  3CFO A;  2ETJ A;  4MQ3 A;  4DTJ A;  1UA0 A;  1WN7 A;  2KZZ A;  3TAR A;  4HCC A;  3AO5 A;  3NGZ A;  3KIO A;  4E7H A;  3V9W A;  1RDB A;  4AHC A;  2D0C A;  3DLH A;  4FLW A;  4CJT A;  1S1X A;  1NK0 A;  1JLF A;  3B6P A;  4FJX A;  1VRU A;  3T19 A;  3O3F A;  3OYB A;  4KRF A;  3VQ5 A;  1NOY A;  3VN5 A;  3AA2 A;  4R5P A;  1HMV A;  4CEC A;  1FKP A;  4JRQ A;  1NK5 A;  1DLO A;  3AA4 A;  3G0Z A;  3DLG A;  1WNS A;  3U3Y A;  3TAF A;  2O4G A;  4FLV A;  3SUP A;  4B9N A;  2OPR A;  4I2P A;  4DTX A;  3HL8 A;  4J2B A;  2HNZ A;  1RDD A;  1HYV A;  4Z4H A;  2FC0 A;  2AJQ A;  3IAY A;  2B6A A;  3KLF A;  4CER A;  2XO7 A;  3KTQ A;  3KJV A;  3K2P A;  3T1A A;  1LAV A;  1VK0 A;  1BQM A;  4MFB A;  3AVK A;  4FM0 A;  3P83 D;  4AHT A;  3DLE A;  2OPP A;  3HVT A;  4CFA A;  3RMB A;  3PY8 A;  5JS2 A;  3VQB A;  1BIU A;  4DWI A;  1Z26 A;  4Z0U A;  1NOZ A;  4CEQ A;  3PX4 A;  1LWC A;  4FZX C;  1O1W A;  3SQ1 A;  1BIZ A;  4CK1 A;  4C8O A;  4FJL A;  1UA1 A;  1RBS A;  3L2V A;  4CEB A;  4KFB A;  4GMJ B;  3C6T A;  3ZSZ A;  1BIS A;  3QIP A;  1TAU A;  2KQ2 A;  2YHB A;  3KD5 E;  1WAF A;  4Q0B A;  2YNH A;  4N5S A;  3KK2 A;  2HHQ A;  5EU7 A;  3MAQ A;  3NFA A;  4BE0 A;  2RN2 A;  2B4J A;  3HP6 A;  3O4N A;  3EY1 A;  1QSS A;  4NCA A;  3HK2 A;  2WON A;  3D0P A;  3AVB A;  1BI4 A;  4IDK A;  4CEO A;  1WLJ A;  3HM9 A;  1RIL A;  5J1E A;  4AHU A;  3RWU A;  5JS1 A;  1QE1 A;  5CYQ A;  2ZE2 A;  3AO1 A;  5J2Q A;  4DTM A;  1LWE A;  1EXQ A;  1U49 A;  4KV8 A;  2F96 A;  3QEX A;  1TK5 A;  1YVU A;  3ZSV A;  3DRS A;  1RT4 A;  1D8Y A;  1IKX A;  1RCH A;  5HBM A;  2QK9 A;  1HPZ A;  4PA1 A;  1QQC A;  4IBN A;  3KLI A;  4LD0 A;  2OPQ A;  4FM1 A;  1W0H A;  3NF9 A;  4CJ4 A;  1UOC A;  2ATQ A;  1QS4 A;  3OJU A;  3ISN C;  3HPH A;  3OVN A;  1EKE A;  2IS3 A;  4M45 A;  3K58 A;  4HVJ A;  2D0A A;  2YNI A;  1T8E A;  4Z4G A;  1A5V A;  3LP2 A;  3QEW A;  4M3R A;  4DQP A;  4KI6 A;  1U48 A;  4FJ7 A;  2Z1H A;  4M3Z A;  1QSL A;  4BWJ A;  4CFC A;  2HB5 A;  3C95 A;  3I0S A;  4LH4 A;  4FLT A;  2IGI A;  4CJF A;  3V4I A;  2IC3 A;  1BCO A;  1RT6 A;  3ZSR A;  3K57 A;  3PUF A;  3V6D A;  4KHS A;  3M8R A;  1IKV A;  2ZQB A;  3V9S A;  1IG9 A;  3OYN A;  1VSI A;  2EX3 A;  3JYT A;  4CJV A;  3ZCM A;  3V9Z A;  1ZBF A;  3M8Q A;  4WE1 A;  4FJG A;  4DTU A;  1KTQ A;  4NYF A;  3F9K A;  4BE1 A;  3KKR A;  3OYF A;  4CFB A;  5KGW A;  4RW7 A;  3KLG A;  3SJJ A;  1BI4 B;  3MXM A;  3KKS A;  2BGG A;  4OPJ A;  1Q9Y A;  1NK4 A;  1SKR A;  1TKT A;  3ULD A;  4DQQ A;  4AHR A;  4W5T A;  4CJU A;  3OYE A;  2I5J A;  4DF4 A;  4FJ9 A;  1HRH A;  2GV9 A;  4ICL A;  4FVM A;  1KVC A;  4CHN A;  4DFP A;  1XWL A;  3L2W A;  5C24 A;  4DSI A;  3VQ4 A;  1DTT A;  1RBT A;  3U3G A;  4CGD A;  3LZI A;  3ZT1 A;  2G8K A;  2Q3S A;  4M42 A;  3WNF A;  4PY5 A;  4CK3 A;  3QET A;  2FBV A;  4HTU A;  3TWH A;  4K8Z A;  1LW2 A;  1TAQ A;  4E3S A;  5J2P A;  4M3X A;  3L8B A;  1T05 A;  2D0B A;  3CG7 A;  4KTQ A;  4B8C A;  3KLH A;  4FLZ A;  2HHU A;  1KFD A;  4E7L A;  1NK7 A;  5CZ2 A;  1ASU A;  1FXX A;  2A1S A;  1NJX A;  4FJK A;  4ELU A;  2R7Y A;  1B9D A;  4KI4 A;  1JKH A;  3IS9 A;  4OKK A;  4KB1 A;  5J2M A;  5FRN A;  3HJF A;  3AVG A;  3LDS A;  1N6Q A;  4DSJ A;  1S6Q A;  1JLA A;  4N41 A;  4B8A B;  3MXJ A;  5FRO A;  3AVH A;  3LAL A;  1JLC A;  4CJL A;  2XHB A;  1RTI A;  4FLU A;  4C8M A;  2GBZ A;  4E1N A;  2DFF A;  3VQ8 A;  4O0I A;  2RKI A;  3HPO A;  1MU2 A;  4E19 A;  3TAE A;  1C6V A;  1QSY A;  3OYG A;  3AVM A;  1NKE A;  1SUQ A;  1XHX A;  3THV A;  1NKC A;  3OYI A;  5I42 A;  4W5O A;  3VA0 A;  3C6U A;  4GVM A;  4RW9 A;  4CF0 A;  3NE6 A;  4KHQ A;  1WSF A;  3ZT2 A;  1CZB A;  1LWF A;  5HP1 A;  3PO5 A;  1NJY A;  3DOL A;  1ASW A;  2FBY A;  1NK9 A;  3QLH A;  1J54 A;  5KGX A;  1L3U A;  3WNH A;  1ASV A;  3O3G A;  3P1G A;  1WSI A;  2BAN A;  1CZ9 A;  1C1C A;  4KKO A;  4BE2 A;  4O44 A;  3NF6 A;  4QAG A;  3O3H A;  3V9U A;  2HW3 A;  2WOM A;  4M3Y A;  4Z4F A;  1G15 A;  3AVC A;  3NH0 A;  2G8W A;  4FJN A;  3DRP A;  2VG5 A;  3ASM A;  1NJZ A;  4FK4 A;  4DQI A;  2KFN A;  3NF7 A;  3CFP A;  3VQQ A;  1RTD A;  1X9S A;  4H4M A;  1SL0 A;  4IFV A;  1GOB A;  4FJ8 A;  4I2Q A;  1TK0 A;  1K6Y A;  3NCI A;  3S3N A;  1RDA A;  3CM5 A;  4OGC A;  5SWM A;  3IRX A;  4LY7 A;  5E41 A;  4DLE A;  1TL3 A;  2HND A;  2G8U A;  4OGE A;  3WNG A;  4DFM A;  3SI6 A;  3RTV A;  2YKM A;  4CE9 A;  4CK2 A;  4CF9 A;  4B9L A;  4O4G A;  1X9W A;  3MEG A;  3OYD A;  3NH1 A;  2YHA A;  4BDY A;  4KRE A;  4CIF A;  1JLE A;  2ITG A;  4DF8 A;  4F8R A;  4Y1D A;  1RT1 A;  1T7P A;  4W5N A;  4RW4 A;  3QO9 A;  2OYQ A;  4J2D A;  1W9H A;  2YKN A;  4FW1 A;  4KTW A;  4Z4C A;  3K5M A;  1JXE A;  3HYF A;  2HVH A;  2Z1J A;  1QTM A;  1VSM A;  2VG7 A;  5K14 A;  4HUF A;  4FM2 A;  1NJW A;  3A2F A;  4CIE A;  4E0D A;  3K5O A;  3AVI A;  4DU4 A;  2RF2 A;  4IKF A;  1S1T A;  2X78 A;  4DTR A;  5DMR A;  1NK6 A;  1LV5 A;  5KTQ A;  1HNV A;  1HYS A;  1Q9X A;  3TAQ A;  3SQ4 A;  3AO2 A;  4CGH A;  1IH7 A;  4N56 A;  1L5U A;  3NH2 A;  4PUO A;  4LH5 A;  2O4I A;  1C0M A;  4CJW A;  2HNY A;  1VSK A;  4E89 A;  1VSD A;  4CJE A;  4AHS A;  5CYM A;  4IG0 A;  3TAN A;  4CEE A;  1BGX T;  1BL3 A;  4DSF A;  4DFJ A;  3HP9 A;  2YNG A;  4B9V A;  5I3U A;  1B9F A;  2OZM A;  4CES A;  3PV8 A;  4CJ5 A;  3ZSY A;  3L2U A;  1IO2 A;  3AVJ A;  3RMC A;  3SUN A;  4F4K A;  4FLX A;  1KLN A;  1FKO A;  3ZSX A;  4AHV A;  4ZHR A;  4O55 A;  3MED A;  3OY9 A;  4E7K A;  3CM6 A;  3VQC A;  4FLY A;  3HXM A;  1RBV A;  3TAG A;  1YT3 A;  4XIU A;  1KSP A;  3ZT3 A;  2P51 A;  1CXQ A;  5FRM A;  3MXI A;  4E7I A;  3DLB A;  3TI0 A;  4NCG A;  3MEE A;  4DTP A;  3DLK A;  1D9F A;  4B9U A;  2FBX A;  4FJJ A;  4KHN A;  4DSK A;  1EP4 A;  1BHL A;  4DS5 A;  4B9T A;  3VQ9 A;  1SKS A;  4B3O A;  5KI6 A;  4I9Q A;  3LP1 A;  3V1O A;  4I7F A;  2JGU A;  3DLR A;  2E6M A;  3M8P A;  4FJH A;  1TKX A;  4CF1 A;  1X9M A;  4OVL A;  4GW6 A;  1JLB A;  4Z4E A;  3PX6 A;  4DU3 A;  5CY4 A;  4OLB A;  3SYZ A;  3ZT4 A;  3LP0 A;  2DY4 A;  1VSE A;  4KPY A;  4HUG A;  3ALY A;  4CGJ A;  4G1Q A;  1T03 A;  2Z1G A;  1EX4 A;  1FK9 A;  4EP4 A;  4M3T A;  4F3T A;  4HCB A;  1TV6 A;  1A5X A;  1TKD A;  3RRH A;  1BCM A;  1KRP A;  2PYJ A;  3C94 A;  2HMI A;  1NKB A;  4DFK A;  1ZYQ A;  3ZSQ A;  1J9A A;  4OKE A;  1IKW A;  1RBR A;  1RNH A;  2E4L A;  4CGI A;  3U6F A;  1L3T A;  4KHU A;  4I9L A;  2ZD1 A;  3QEP A;  4ZTJ A;  4ELV A;  2DFH A;  3ITH A;  4AH9 A;  3OYA A;  1L3V A;  4J2A A;  1VRT A;  1TGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...