3AA2A

A52i e. coli rnase hi
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
153
structure length
153
Chain Sequence
KQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAIIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein core adaptability: crystal structures of the cavity-filling variants of Escherichia coli RNase HI
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Ribonuclease HI
total genus 48
structure length 153
sequence length 153
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3aa2A00
3NDKA 4KKOA 2HHTA 1S1WA 3QEXA 2YKNA 1I3AA 2E6LA 3C6TA 3DI6A 3V9WA 1UA0A 1SKSA 2KTQA 3LP3A 3RR7A 4QCLA 3TR8A 3PV8A 4R5PA 2YHBA 3ZT1A 4DU3A 3DRRA 4W5TA 3LPUA 1RDCA 4QAGA 3ZSXA 1HJRA 1RTIA 3SQ0A 1J5OA 3HL8A 2BANA 2B4JA 2EHGA 3CYMA 3DOKA 3JYTA 2YNIA 4KHQA 4ELUA 3SJJA 4H4OA 3QETA 3ALYA 1JLQA 3OYJA 1NK4A 1WSHA 3L3UA 3DMJA 5HRRA 3NGYA 4CEOA 4DTOA 1JLFA 1VSDA 2GBZA 4E7IA 3KJVA 1B92A 4DTMA 2B5JA 3D45A 3LAMA 4O4GA 4CF1A 1LAVA 3QIOA 4IFYA 5JS1A 3HT3A 1WNSA 4I2PA 4ZTFA 5KI6A 3HPGA 1N6QA 4N47A 2XY6A 1KVBA 4ID1A 1IKYA 1VSFA 1I39A 4LSLA 4GW6A 3LP0A 3ZSZA 4KTWA 3JSMA 4B9MA 1JL2A 4I9LA 5C25A 3K5NA 4CFCA 1TKXA 3OYDA 3MXMA 1X9SA 4CEDA 2HMIA 1ZBFA 3B6PA 4CJTA 2FBYA 1TK0A 1EX4A 2VG7A 1TKTA 1WSEA 3HPHA 3IAYA 5FRNA 3DLBA 2HHWA 4CEFA 3VQDA 4CEZA 4E89A 1QSSA 3AVBA 4B9LA 4LY7A 2ZE2A 4M41A 1FXXA 3EYZA 4I2QA 1CZ9A 2G8FA 4WE1A 3HXMA 3KK3A 4CEBA 5HRPA 1NJXA 3VA3A 4B9VA 3OVNA 1R0AA 1A5XA 1S5JA 4C8NA 4DF8A 4CIFA 4CJRA 3KKSA 5T7BA 4DLEA 1REVA 5J2PA 3C6UA 3V9UA 3THVA 1G15A 4CJ5A 3PY8A 3DRPA 1EXQA 2G8KA 3QNNA 3ZSYA 4OKKA 1UA1A 4J2DA 4BE0A 1U04A 3I8DA 4FM1A 1F21A 3OS0A 1SKRA 3NF9A 3LDSA 4OPKA 3HP9A 1GOCA 3TWHA 1S9GA 2R7YA 4CEEA 3A2FA 4NCAA 1RT1A 4CFDA 3L2RA 2VWJA 3CFOA 4CJVA 1QQCA 4CJPA 3VQ4A 1QSYA 1ASWA 4YNQA 2HB5A 4J2AA 4FJJA 3S3MA 4FJKA 5CZ2A 3L2WA 2WONA 3P5JA 3OYCA 4RW6A 1YT3A 4CJQA 4HVJA 5J2QA 3RRGA 3HVTA 3NFAA 3OYMA 1WSFA 3E01A 4JS4A 3SQ4A 4CJEA 4AH9A 3O3GA 1RT5A 1KSPA 2IOCA 4FXDA 3OYEA 2P1JA 3T1AA 3VQ5A 4B9SA 3RMDA 5FDLA 4M3YA 2RF2A 1T03A 1VSJA 4B08A 1Q9YA 4NCBA 1WAJA 1JXEA 3DLGA 4KV8A 4JRQA 1BCOA 3VQBA 3UIQA 1S1VA 4CF8A 3AA4A 5KGXA 2YKMA 4KHWA 1BI4B 1BI4A 1EKEA 4OVLA 3K59A 1ZBHA 1CXQA 1LWFA 4IFVA 5DK5A 5KRSA 1FKPA 3OS1A 3T3FA 1KFSA 1C1AA 1S1TA 2XRIA 3QNOA 3HVRA 3PO5A 1VSMA 4DSIA 1JLGA 4DFMA 3U3GA 1U45A 3NGIA 2KFZA 4DSFA 3NCIA 4FJXA 4FCYA 2OPRA 3HYFA 2JLEA 4B9TA 1X1PA 1XHXA 3NH0A 2PZSA 4DQIA 3AVCA 1O1WA 3IS9A 1WLJA 4DLGA 1VSHA 2XHBA 1NOZA 3P83D 4BDYA 1DLOA 4LD0A 4E1MA 2VWKA 3LP1A 1S9EA 4Y1CA 4FJMA 4KRFA 5CYMA 1Y97A 3G10A 1HNVA 4N56A 3SCXA 3WNGA 1ASUA 4C8KA 4HCCA 3QEVA 1ZYQA 2O4GA 2PYJA 1GOBA 4CE9A 4CHQA 3HPOA 1BQMA 4F2RA 3VQCA 4FW1A 2QKBA 3DOLA 3SPZA 2F8SA 3DRSA 3WNEA 4XIUA 5K14A 2PYLA 4UQGA 4KHUA 5KGWA 3FFIA 4Z4CA 4RW7A 4FJIA 1IKVA 1HNIA 1LAWA 4B3OA 4PWDA 2KW4A 5JS2A 3M8SA 1MU2A 4CIEA 1K6YA 3RRHA 3PX0A 2P5GA 4FJ7A 4FYDA 3DLRA 1RNHA 3MECA 4C8OA 3V4IA 4CJFA 5C24A 3OYGA 1JLAA 2O4IA 1CXUA 1RTJA 4CGIA 4PA1A 4BACA 5KTQA 4CERA 3OYLA 3SV3A 4C8LA 1VSLA 1U47A 2PY5A 2P51A 4HHTA 1U4BA 4OJRA 1TKDA 2P5OA 4Z4IA 4NCGA 1N5YA 4Z0UA 1VK0A 2BE2A 4CK1A 1NOYA 4ELTA 4F8RA 5HLFA 1D9FA 5HBMA 4KB0A 3V1QA 3LZJA 4FLVA 1NKEA 1KCFA 4KO0A 4M3ZA 3HP6A 2YNFA 4BE2A 2XY7A 1QHTA 3KLIA 3KLFA 2E4LA 4DTSA 3HJFA 3QO9A 2RN2A 4NYFA 1J9AA 3SQ1A 3G0ZA 2I5JA 4CJLA 3KIOA 3S9HA 2YV0X 4FM2A 1XI1A 3KTQA 1IKWA 1YVUA 2VG6A 3LALA 1VRTA 3AO4A 3AO2A 3MXJA 4EP4A 2NUBA 4W5RA 3OS2A 4FLYA 2HNYA 1W0HA 1KVAA 3AO3A 5CYQA 3ZCMA 4E7KA 3V6DA 5KRTA 3QEWA 4E3SA 1WSIA 4KHYA 1SL0A 1LW2A 4LH4A 4Q5VA 3NAEA 4B8AB 4EZ6A 2OYQA 4FJ8A 4M3UA 3TARA 2FBXA 1L3SA 4ELVA 2HW3A 1RBUA 4KREA 2ITGA 4CJ3A 4BE1A 1NK6A 4G1QA 4FLZA 1L5UA 4DU4A 3CQ8A 1KRPA 4FK0A 3AVHA 4DG1A 2XY5A 3SZ2A 3SUOA 3VQ8A 3K57A 4Y1DA 2FC0A 4DTNA 1SL2A 4K8XA 4Z4FA 3KLHA 3S3NA 2IC3A 1L3VA 5DMRA 2ETJA 4FJNA 3VN5A 4DWIA 4ZHRA 4FK2A 4E1NA 3K5LA 1RBRA 3NH2A 4L8RB 3AVFA 3O3HA 1BL3A 1BQNA 4O0IA 3SUPA 3V1OA 4FJ5A 3EZ5A 2Z1HA 3L2UA 1L3UA 3RTVA 3QERA 3SPYA 4OGCA 1C1CA 1ZBUA 1KFDA 3LAKA 3WNHA 2HVIA 3K58A 1IKXA 3KLGA 2XO7A 2DFEA 4GMJB 1RDDA 3AA5X 4FW2A 4CGFA 4KAZA 1L3TA 3AVJA 2OZMA 4PQUA 1C0MA 4B8CA 1T7PA 1TK8A 3H08A 3RMBA 3AVGA 1BCMA 4BWJA 3C95A 4Z4GA 2HNDA 3VQ9A 3WNFA 4AHVA 5HROA 3TAFA 1HYVA 4ICLA 1SUQA 3KK1A 1NKCA 3AVMA 1QTMA 4CEAA 4J2BA 2HHQA 3B6OA 2GV9A 1KLNA 1LW0A 2VG5A 3CM6A 3LWLA 3VQAA 1TGOA 2YNHA 3ZT3A 5CY4A 3KK2A 4HUGA 3LZIA 3NE6A 2DTUA 1VSIA 3KKRA 3ZT4A 3OYNA 1QSLA 2HHUA 4FZZA 3TABA 4AHRA 3PUFA 1RTDA 4C8MA 4FJ9A 1NK5A 3VQPA 2X78A 1XWLA 4CJKA 1BIZA 1HPZA 3CM5A 2B6AA 2ZD1A 4J2EA 1QS4A 4MQ3A 4AHSA 3V81A 4I9QA 4N5SA 2HHVA 2BDPA 3V1RA 3K2PA 1D9DA 1BIUA 1NJWA 4JS5A 1W9HA 3VQEA 4H4MA 3EY1A 2Y1IA 3I0RA 2F8TA 3TAMA 1TV6A 4F2SA 3P1GA 1KLMA 1BHLA 4ID5A 4M3RA 1D8YA 1ZBIA 4CGGA 3L3VA 3AVAA 2ZQBA 3NF7A 4AHTA 3NHGA 4OPJA 1T05A 1S1XA 4O0JA 3MXIA 1ZBLA 4N41A 1JLEA 4FLXA 3BGRA 1NJZA 2D0BA 3O4NA 4MFBA 4CJWA 4Z4HA 3M8RA 3F73A 2OPQA 4F4KA 4E7LA 1XHZA 2IS3A 2YHAA 2HNZA 1RCHA 2IGIA 3CG7A 3TAEA 3TANA 1FK9A 4E7HA 1U49A 4CEQA 3C94A 3ZT0A 1TL3A 4E0DA 3VQ7A 4FLWA 3OJUA 4KHNA 4JLHA 1C0TA 1EETA 1KTQA 3SYZA 2XY8A 1RT3A 4HCBA 4DU1A 2OA8A 2ATQA 4ZTJA 2JGUA 3OYAA 2G8UA 1UOCA 4GVMA 3OYIA 3LPTA 4CF0A 3DLEA 2X6SA 1IH7A 4RW4A 4DTJA 2G8WA 4DF4A 5FROA 4CJUA 4FLUA 1VSEA 4DTUA 1BGXT 1U48A 3BDPA 3KD1E 3SI6A 1Q8IA 1RTHA 2FBTA 3MEEA 1WSJA 2OPSA 2A1RA 3HO1A 4OKEA 4KI6A 2RKIA 2X74A 2Z1GA 3DYAA 1A5VA 1S6PA 4IKFA 4K8ZA 3ZSQA 4CIGA 3QESA 2G8HA 3L8BA 4FLTA 4AHCA 2HVHA 4CJ4A 2WOMA 1TKZA 4O5BA 3RMAA 3O3FA 3ZSOA 4DQQA 3ITHA 4OKJA 4F3OA 3VQ6A 1Z26A 5D3GA 1J53A 1YTAA 3NF6A 1DTTA 5J2NA 4QOZB 3AVKA 3SQ2A 3NGZA 1T8EA 4NYNA 1NKBA 3QEPA 3DLKA 3OYKA 3M8PA 4DFKA 3HK2A 3NBPA 1Z25A 3MEDA 1WAFA 1RILA 4CFBA 3L2QA 1LWEA 3TI0A 1LV5A 4N76A 1HMVA 4CK3A 3M8QA 4OLAA 2G8IA 4AILC 4FZXC 4FJHA 4KB1A 4TSXA 3ULDA 3PX4A 4CFAA 4DFPA 3AO5A 2Z1IA 5FRMA 4O55A 4DFJA 1NJYA 2YNGA 5I3UA 4EZ9A 1B9DA 4HTUA 4BDZA 3U6FA 1A5WA 1XC9A 2QKKA 4EP5A 2RPIA 4LH5A 1HQEA 4CF2A 1SL1A 4CCHA 3IRXA 1TAQA 2IDOA 4DSEA 3NH1A 4CJSA 4CGJA 4DTXA 1J54A 1HQUA 1SV5A 2Z1JA 3LWMA 1SKWA 1VSKA 1EP4A 3OJSA 4DS4A 2OZSA 2KZMA 1X9MA 4FM0A 2DFHA 4CK2A 4CHPA 4CF9A 2AJQA 4KTZA 4CHZA 1RT7A 2BGGA 1RDBA 4CGDA 1X9WA 3QIPA 1WN7A 1IG9A 1TL1A 3ISNC 3CFPA 3PX6A 2G8VA 2D0CA 4B9NA 3QEIA 2KZZA 2QXFA 3RMCA 1VRUA 1BISA 3AVIA 2KQ2A 5HRNA 3AV9A 1RBVA 4E7JA 5I42A 4Z4EA 1RT2A 2D0AA 3F9KA 3HSTB 4HUEA 2EX3A 1HYZA 3S3OA 4KI4A 4M3WA 3HM9A 3KLEA 4AHUA 1NK0A 3RR8A 3K5MA 3ZT2A 1KVCA 4KFBA 1C1BA 5CZ1A 1TVRA 5EU7A 3PO4A 5SWMA 2QK9A 3V9ZA 3KD5E 4RG8A 4CECA 1JXBA 4OGEA 1JLBA 4IBNA 4BWMA 5C42A 1ITGA 4W5QA 4O44A 3ZSVA 5HRSA 3D0PA 1RBSA 4DS5A 4IG3A 3L2VA 3MEGA 1NK9A 1Q9XA 3OYFA 2OPPA 1WSGA 2Q3SA 1TAUA 4CGHA 4OLBA 5SZTA 3O4QA 4KHSA 4I7FA 4FZYA 2IAJA 5J2MA 1GOAA 1NK7A 3VQQA 4JRPA 4CESA 3DLHA 3AA3A 2FBVA 3SV4A 3I0SA 5J1EA 4DSJA 3TAQA 4H8KA 3CFRA 1JL1A 4BDPA 4LSNA 3NF8A 3VA0A 3AA2A 4RW8A 4CHNA 4DQSA 4FJGA 1QE1A 1RT6A 3IG1A 3QLHA 1IO2A 3K5OA 2KFNA 3AVLA 3SNNA 2DY4A 1JLCA 2DFFA 1RDAA 2LSNA 2X6NA 3RWUA 2D5RA 1TK5A 2E6MA 4M3TA 4Q0BA 1RT4A 2HHSA 4KPYA 4HUFA 3SUQA 2W42A 4DQPA 1C0UA 3ASMA 4FK4A 1ASVA 1HRHA 4DTPA 3TAPA 4F3TA 4M42A 2HHXA 1CLQA 5HP1A 4FJLA 4FVMA 3AVNA 3T19A 4E19A 4YFUA 4M45A 4W5OA 3OYBA 3QINA 3V9XA 4PUOA 3OY9A 1LWCA 1CZBA 3AO1A 3MAQA 4RW9A 3LANA 2GUIA 3DM2A 4IG0A 1NK8A 4B9UA 4DSKA 4W5NA 1RBTA 4CHOA 3OYHA 1B9FA 3SUNA 1UAXA 1UWBA 3ZSWA 1YTUA 2F96A 4CHYA 4KTQA 4DTRA 3ZSRA 3LP2A 4IDKA 1JKHA 4DMNA 5E41A 1FKOA 4DSLA 1D5AA 4DQRA 3V9SA 1S6QA 2Y1JA 1HYSA 3U3YA 3TAGA 2A1SA 1C6VA 1DTQA 4M3XA 4PY5A 1S1UA
chains in the Genus database with same CATH superfamily
5AQMA 4N41A 3C6TA 2KTQA 3DXMA 3LP3A 4QCLA 2YHBA 4DU3A 3THYA 4W5TA 3DJCA 4KBOA 3HL8A 2B4JA 3DOKA 4ELUA 2RHKA 2UYTA 3ALYA 3OYJA 1Q81O 3NGYA 4DTMA 4A62A 2PFUA 4O4GA 2QEXN 4LFCK 5JS1A 4X66K 1WNSA 2O8CB 2OTJN 3I8BA 1YAGA 1I39A 2NRTA 5AQZA 4B9MA 4DQ8A 5ELZA 4IEEA 1JL2A 3MXMA 4CFCA 4CD1A 4CBUA 4A2BA 3B6PA 1NGJA 2VG7A 1WSEA 3DLBA 4H0XB 4CD3A 3VQDA 4CEZA 1NU0A 4DV1K 5M1FA 3NVMA 1HR0K 1N33K 4E1JA 4I2QA 4WE1A 3KK7A 1NJXA 5HRPA 1YHQN 4B9VA 3OVNA 1Q82O 4C8NA 4DF8A 3HBTA 5T7BA 3ENBA 1ZC6A 2KLAA 4OKKA 2E1ZA 3O9QA 4H0PA 4J2DA 4FWPA 1F21A 1SKRA 1GOCA 1S9GA 2R7YA 4CEEA 4BROA 4NCAA 3SLCA 3L2RA 1QQCA 3QBWA 5GIPA 1QSYA 1GLLO 3D6RA 4YNQA 4YDUC 2A42A 4IDHA 4FJJA 4FJKA 3L2WA 2NZTA 1EWRA 2ITMA 4CJQA 4HVJA 4DUZK 4IJAA 1WSFA 3IFRA 1WOQA 2IOCA 4FXDA 2HBMA 3VESA 3ZLJA 2P1JA 3T1AA 3WXIA 5FDLA 3ZX0A 1HNXK 4GKJK 1Q9YA 1VQPN 4KV8A 3CCSN 3DXKB 3FGUA 4LFAK 1ZBHA 4KHWA 4OPAA 1BI4A 3D7EO 1LWFA 3OS1A 2JWKA 3HVRA 3U3GA 4JK8A 1XHXA 1O1WA 4NXNK 3IS9A 2VGNA 4JHDB 2HBLA 1W97L 4B1YB 1YVNA 3K9KA 4LD0A 3LP1A 3WXMB 1GLEG 4CZMA 4FJMA 4JKHA 5AQJA 1Y97A 3G10A 3QEVA 4CZGA 4FW1A 3B8AX 3JXUA 4BQLA 3SPZA 5GINA 4XIUA 1EQYA 4UQGA 1T6DA 5KGWA 2FXUA 4LF7K 3ID8A 4Z4CA 1HNIA 4PWDA 3T7ZA 5JS2A 3RRHA 4XH1A 3T69A 4MO4A 4WQ4C 4Z94A 5I9EB 3PLAA 5C24A 1JLAA 4H5VA 1NGAA 4BACA 4CERA 4LFBK 2PY5A 2P51A 4IJNA 1U4BA 4Z4IA 1N5YA 4Z0UA 2BE2A 1XUPO 4F8RA 4BR0A 4DB3A 4KB0A 4FLVA 4PHTX 1DT9A 4JKGB 5M1PA 3FZKA 1ZBSA 4Y0WA 1VQNN 4DTSA 3HJFA 2RN2A 3G0ZA 4CJLA 3KIOA 3S9HA 4FM2A 5F2RA 3LALA 1YXQA 4B3RK 1W0HA 1KVAA 2NLXA 3VEOA 3NAEA 1XNRK 1J6ZA 2OYQA 1NGFA 1L3SA 2HW3A 4JI3K 2E20A 2ITGA 4CJ3A 4YHHK 2VYPA 1BA1A 4PL7A 1L5UA 4FK0A 1BOTO 1KRPA 1VQ9N 2YCHA 3SUOA 4DTNA 5CR4A 3QFPA 4K8XA 3Q7BA 3CCUN 2ETJA 2WC9A 3FLCO 4FK2A 1XMOK 4C1NI 4L8RB 3AVFA 4O0IA 1L3UA 4X65K 5FPNA 4O5FA 4CGFA 4K42A 2D0OA 5B8HA 2OZMA 1C0MA 3RMBA 4WFAL 3WNFA 5HROA 4AHVA 2QW9A 1SUQA 4NB4A 1LW0A 3VOVA 4I6MB 3LZIA 3T1HK 2QWLA 1O13A 3ZT4A 2HHUA 4FZZA 3ZX2A 1XWLA 4CJKA 5BREA 1BIZA 2B6AA 2O8EA 3FZMA 4J2EA 4I9QA 4O8KA 1BIUA 4H4MA 3EY1A 1TV6A 1W7AA 3P1GA 1BHLA 5AQGA 3AAQA 4LC9B 4CGGA 2ZQBA 3NF7A 3NHGA 3GBTA 2ZWHA 2F7TA 3UE5A 2QWOA 3CJCA 1NJZA 3F73A 3L6QA 4F4KA 1XHZA 4A5AA 3O5BA 2YHAA 5AQKA 2I7NA 3ZEUA 3TAEA 1FK9A 3FZHA 5JMVA 3O9RA 3TSPA 3VQ7A 4KHNA 3OJUA 4JLHA 3SYZA 5A2QO 2G8UA 4ZTJA 3OYAA 3CI5A 3HSCA 2CGKA 1IH7A 4DF4A 5EOYA 2HF3A 3CCRN 3KD1E 3MEEA 1YJWN 2P9NB 3DXMB 3ZSQA 1VQ5N 4FL9A 4B3SK 2HVHA 4JEPA 4CJ4A 3JAMO 3RMAA 4CW7B 3VQ6A 5D3GA 3NF6A 1DTTA 3NGZA 4NYNA 1NKBA 5FPDA 1U2VB 1VHXA 2P9IA 3MWTA 4DFKA 3VF2A 1RILA 1NMNA 4FWRA 3CPWM 4KB1A 4TSXA 3ULDA 3E9LA 5FRMA 4BC5A 2YNGA 1GLAG 4HTUA 4BDZA 3U6FA 2QKKA 1X9JA 5C15A 3NH1A 4K0KK 2Z1JA 2OZSA 3E9PA 1VSKA 1EP4A 2EWSA 2KZMA 3ZEUB 4FM0A 4BRNA 4FWSA 4MLEA 3TU5A 2PAVA 2QM1A 2D0CA 4JN4A 2GWJA 1NBWA 1RT2A 3S3OA 2EX3A 3W3DA 2O8BB 3MMVA 4AHUA 3RR8A 5BN8A 3K5MA 4ILJA 3ZT2A 5BRDA 3QICA 5EU7A 4PKGA 2P9UA 4IBNA 4BWMA 1ITGA 3D0PA 3CC4N 1ATNA 1RBSA 5AQXA 3BP8A 1ILYA 1DKGD 3U9ZA 3OYFA 4OLBA 1KXPA 4BC4A 5BRHA 4I7FA 1GOAA 4JRPA 4BRAA 3SV4A 3I0SA 5J1EA 5ADXH 5BR9A 3CFRA 4QS7A 1NJIO 1ATRA 4LSNA 3NF8A 3SMPA 3VA0A 4FJGA 3EN9A 1QE1A 3THXA 2VQEK 5M1QA 3K5OA 2KFNA 3CJ1A 3AVLA 2UU9K 3KWIA 2DFFA 2LSNA 3RWUA 4GV6A 4JI6K 2E6MA 4Q0BA 1KQSM 4DQPA 1Z05A 3TAPA 1CLQA 3BZKA 4M42A 5JVHL 4RCHA 5HP1A 3GDQA 4JI7K 3ULEA 3QINA 1GLJO 2NRZA 3QDKA 3OY9A 1LWCA 4RW9A 2GUIA 4OX9K 1HKBA 1KC8O 4W5NA 1RBTA 1N32K 1UAXA 1UWBA 2CH5A 4CHYA 5E41A 2E1YA 1FKOA 4DSLA 4DQRA 2Y1JA 3U3YA 2UXDK 4B1UB 2FF6A 4FJXA 2O8BA 4DV5K 2A5XA 3E9OA 4DKWA 5C2DA 2NRRA 3RR7A 3TR8A 2NRWA 1BO5O 3DRRA 3LPUA 1RDCA 1RTIA 4ISFA 2EHGA 3CYMA 4DCHA 3SJJA 2GWKA 1JLQA 1JLFA 1B92A 3AARA 4JI8K 3SAFA 2QWRA 3QIOA 5JLFA 4XEIA 1NGGA 3H1QA 5KI6A 3HPGA 4N47A 4ID1A 3VERA 3LP0A 3RVCA 3OYDA 1QQNA 2QWMA 2HMIA 1C0FA 4JD2A 3VEZA 1TK0A 1K8AO 3IAYA 3H3OB 4CEFA 4BR7A 5TKWA 2ZE2A 3S41A 1CZ9A 4JI1K 3WXKA 5BN9A 3KK3A 4JKGA 4IFEA 1R0AA 1BA0A 2JWLA 4DSKA 3O8MA 4CJRA 3PY8A 4DLEA 3WQTA 3CQXA 5KQDA 3BY5A 3QNNA 3WXJA 5F1XA 1IG8A 4BE0A 1U04A 4BRMA 4BREA 3VGMA 3G6EN 4B1WB 2V7ZA 4CFDA 2VWJA 3CFOA 4BGBA 1ASWA 3RSEB 2HB5A 4FPBA 1VQKN 4H5WA 2WONA 3P5JA 1OH5A 5GAHP 3NFAA 4XH5A 4CVNE 4CJEA 1RT5A 1Y64A 3OYEA 1ESVA 3VQ5A 4DR6K 2GEMA 4H5NA 2RF2A 4M3YA 4B08A 4NCBA 3O80A 1WAJA 2UXBK 2YJEA 1HLUA 3K59A 1EKEA 1CXQA 5KRSA 1VQLN 2ZGYA 3T3FA 1C1AA 1S1TA 1SQKA 5AQOA 4DSIA 2VWBA 1JLGA 5AQUA 3NGIA 2Q36A 3HYFA 1HUXA 3LDOA 2IVNA 4B9TA 1X1PA 3EKSA 3WUHA 3NH0A 4DQIA 3AVCA 2HOEA 1NOZA 3F2KA 3MWPA 4BC2A 1VQON 2E2PA 3CCQN 1DLOA 4JKDA 2VWKA 1YI2N 4HWIA 4KRFA 4IOAL 5FRNA 1HNVA 4HCCA 4JKFA 2O4GA 2PYJA 4CHQA 1JCEA 3IMXA 1I94K 2ZJQL 4IOCL 2QKBA 3DOLA 2F8SA 1JCFA 3WNEA 3AGRA 3CCVN 3UKRB 2V7YA 5F0XA 3FFIA 3WT0A 4H0TB 5CE3A 1M1KO 4A2AA 3BZCA 3L4QA 4BRHA 3HOSA 1MU2A 1K6YA 1RNHA 4C8OA 3VGLA 2I7PA 4BG8A 3OYGA 4O8UA 4YOVA 1CXUA 2Q1NA 2KFZA 4PA1A 5KTQA 1U47A 5EY4A 4HHTA 4FWOA 4OJRA 4CBWA 1TKDA 2P5OA 4CK1A 1NOYA 1HJOA 1K8KB 3BF1A 5LY3A 3D2EA 5HBMA 3LZJA 4M3ZA 2AP1A 2E4LA 5AQQA 3SQ1A 4NYFA 3TPQA 1J9AA 5AQFA 4B9QA 1XI1A 1YVUA 3MXJA 4EP4A 4W5RA 2NUBA 4FLYA 2HNYA 2Q0RA 3AO3A 4E7KA 4BVPA 2O8CA 3VEWA 4KHYA 1SL0A 4LH4A 4H0OA 4FJ8A 3VPZA 3TARA 2YJFA 3WEEA 1NK6A 4LF5K 4DU4A 4DG1A 2XY5A 4DV2K 1KAXA 3K57A 2W41A 1SL2A 1DEJA 4Z4FA 3MCAB 3VN5A 4DWIA 2BH1A 3K5LA 5E26A 3SUPA 4FJ5A 1U2VA 5AFUH 3L2UA 5AQVA 1C1CA 2ASPA 3WNHA 2HVIA 1IKXA 5AQTA 4LF9K 4KAZA 1L3TA 3H08A 4BGAA 1C0GA 4BWJA 3C95A 4Z4GA 5TKYA 2HNDA 3VQ9A 4YOWA 3F5TA 4FWKA 4GV3A 4BRIA 1MWMA 3LL3A 4X64K 2GV9A 1KLNA 3LWLA 1TGOA 2YNHA 3ZYYX 5CY4A 2FLOA 4ILHA 3KK2A 3P4IA 3NE6A 3KKRA 4R79A 5KPZA 1OH8A 4FJ9A 1NK5A 4WQ5A 5AQIA 4AM7A 4AHSA 2BDPA 3V1RA 1NJWA 2NRVA 2Y1IA 4F2SA 3WEEB 1ZBIA 3CCMN 4BVOA 3AVAA 4AHTA 5AQNA 4OPJA 1T05A 3LDLA 1S1XA 4O0JA 1JLEA 2D0BA 4CJWA 4NXMK 3M8RA 1T44A 4E7HA 5KPRA 1EO1A 3C94A 2VQFK 3O1WA 4FLWA 1BWFO 1EETA 3ENOA 2XY8A 5AQRA 4BRKA 2GTDA 3SBGA 2OA8A 1UOCA 3OYIA 3LPTA 4CF0A 3DLEA 5FROA 3CETA 3BDPA 1VSEA 2P9SB 1Q8IA 3PIPL 3CD6N 1WSJA 1GLCG 4KI6A 2X74A 1Q18A 1A5VA 1S6PA 4IKFA 3PIOL 1YIJN 2WOMA 4O5BA 4DQQA 1FW6A 3MX2A 4F3OA 3AVKA 2Q2RA 4DR4K 3KWGA 3EKUA 3J7ZO 3HK2A 3NBPA 2E88A 3MEDA 4CFBA 1LWEA 4OLAA 1LV5A 4CK3A 3J7AP 3F9MA 1WB9A 5IWAK 3AO5A 4JNEA 2HBJA 2Z1IA 4GY2B 1NJYA 1JJ2M 1B9DA 1P90A 1HQEA 1NM1A 4CCHA 3IRXA 4NO7A 3VGKA 4BRFA 1VQ4N 1J54A 1HQUA 3LWMA 2A3ZA 2WUSA 5AFUA 4KTZA 4CHZA 2BGGA 5C10A 1RDBA 4CGDA 1X9WA 3EL2A 1TL1A 4KH5A 2KZZA 2F4VK 3QEIA 3RMCA 1VRUA 4BR9A 5HRNA 4E7JA 3FE1A 4BG9A 2BTFA 4Z4EA 2D0AA 1HYZA 3D2FB 1KVCA 5CZ1A 3NMUA 1TVRA 4V19S 4K41A 4GKKK 1XNQK 1XMQK 3KD5E 1X3NA 4RG8A 5JVGL 2AA4A 3A5OC 4O44A 5HRSA 4H0VB 4CZIA 3L2VA 4WFNL 4L3QA 4MO5A 2OPPA 2Q3SA 3KZBA 3OBYA 5SZTA 4DV3K 4KHSA 4FZYA 2IAJA 2GUPA 4BRPA 3TAQA 4H8KA 3H1VX 4BDPA 2QTDA 5AZIA 2VCPA 1N34K 1VAZA 5ADXA 1QZ5A 2W40A 1IO2A 2D4WA 4J8FA 3A0IX 4X62K 4B3MK 3SNNA 2DY4A 1JLCA 2X6NA 1RDAA 1RT4A 2HHSA 4HUFA 2FF3B 1WUAA 1C0UA 4B3TK 2A41A 3CJ7A 3DWLA 4BC3A 4W5OA 3V9XA 1XC3A 3O4WA 3VF4A 4H5RA 1TUYA 3DM2A 4JHDA 4B9UA 5AQPA 4JK7A 3OYHA 1B9FA 1YTUA 2F96A 4DTRA 4DR3K 3T1YK 3V9SA 2IIRA 2A1SA 4M3XA 2HHTA 1S1WA 3QEXA 1I3AA 1SKSA 3V9WA 1NLVA 3PV8A 4BRQA 2W6LA 3JS6A 2PBDA 2E8AA 1J5OA 2Q97A 2BANA 3O9TA 3JYTA 1K9MO 1WSHA 4EHTA 3DMJA 2CGLA 3QBXA 4CEOA 2GBZA 3KJVA 2B5JA 1QVGM 3LAMA 2UUCK 3E1YA 3E66A 5FPMA 4I2PA 5AZJA 4ZTFA 3CC2N 1N6QA 4JI2K 5AQSA 2XY6A 1KVBA 1IKYA 1VSFA 2YX6A 4LSLA 4GW6A 4KTWA 3JSMA 2P9NA 3U4LA 4I9LA 1X9SA 1TKXA 2P9KA 4IZ9A 3FFKB 3MN5A 4CJTA 1EX4A 1TKTA 3HPHA 1NGHA 4E89A 1QSSA 3AVBA 5AQWA 3TSQA 4B1ZA 5C12A 4B9LA 4FVUA 4MLHA 4LY7A 3R1XA 4PKIA 3HXMA 1VQMN 1S5JA 4CIFA 3MXIA 1XQSC 4YORA 3THVA 3C6UA 1G15A 1TYQA 4CJ5A 3DRPA 3LM2A 1EXQA 4C23A 2G8KA 3DLLL 4CI6A 4B1VA 4DV6K 3I8DA 3OS0A 3NF9A 3LDSA 4OPKA 3TTCA 3TWHA 4K25A 3R3LA 2Q31A 3G4SN 1RT1A 1E3MA 4CJVA 5AZJB 4CJPA 2W6KA 3K9JA 3O08A 3S3MA 3OYCA 3UKUB 1YT3A 1YITN 3ZETB 1BG3A 3RRGA 3HVTA 4JS4A 1X3MA 1N8RO 3RMDA 1T03A 1JXEA 1Z6RA 3P39A 1FJGK 3UIQA 1S1VA 3AA4A 1SAZA 3SMSA 5KGXA 2E2QA 4IFVA 5DK5A 3ID6A 3QNOA 4M63C 2ZGZA 1VSMA 4DR5K 4DFMA 1U45A 3NCIA 3CMEN 3N4PA 2OPRA 3BEXA 3CMAN 3G25A 4DLGA 1VSHA 2XHBA 4JKAA 4YOUA 5LL6Z 3A5LC 3P83D 3EE9A 4E1MA 3A8YA 1S9EA 4Y1CA 3CCLN 3CXCM 1N36K 4C8KA 4N56A 3SCXA 1ASUA 3I33A 1ZYQA 4CE9A 3HPOA 1BQMA 3VQCA 4EHUA 4AF1A 4BR5A 2O8EB 4KHUA 3O1BA 3LDNA 5AZIB 4RW7A 1LAWA 3HTVA 4DR2K 2UUBK 2GX9A 3PX0A 4FYDA 2P5GA 4LF4K 3DLRA 3MECA 2ASMA 2IVOA 3MK6A 2FSKA 1RTJA 4BRLA 2P9PA 4CZJA 3OYLA 4JK9A 1VSLA 4GV9A 4NCGA 4DR1K 3SAGA 1D9FA 4FOEA 3V1QA 1HX1A 4GNIA 3HP6A 2YNFA 3IKMA 3KLIA 4WF9L 3HI0A 3KLFA 1ATSA 2I5JA 2YV0X 3TTDA 3KTQA 1IKWA 2VG6A 4WYBA 3AO4A 3AO2A 2OTLN 3OS2A 5CYQA 3UB5A 3V6DA 5KRTA 2WBNA 3QEWA 3CJAA 2F9WA 2ZJPL 1JCGA 4EZ6A 1HNWK 1RBUA 3CJBA 5BPNA 4BE1A 4G1QA 5JLHA 2QWPA 3BUZB 4JYAK 3VQ8A 3KLHA 5DMRA 4ZHRA 4E1NA 3O3HA 1BQNA 3IDHA 3EZ5A 2Z1HA 1CZAN 3QERA 5EX5A 3SBTA 1KFDA 3LAKA 5DM6L 3KLGA 2XO7A 5AR0A 4DV7K 3AA5X 3AAPA 5EXWA 4B8CA 1YJNN 1ZXOA 3DXKA 2WFBA 3AVGA 4HTLA 1NGBA 2O8DB 1HYVA 4ICLA 3KK1A 3THWB 1NKCA 4RWTA 1QTMA 4CEAA 4J2BA 2HHQA 3P38A 1T3VA 3B6OA 1M90O 3D2FA 3CM6A 3ZT3A 4A59A 4HUGA 4I6MA 2RE2A 3THXB 3AGKA 3UKUA 2DTUA 1S3XA 3MN9A 3OYNA 3IUCA 1QSLA 4F9OA 3CC7N 3QFUA 3TABA 1RTDA 4C8MA 1HPZA 2ZD1A 5HOOA 2P9UB 2FSJA 4FO0A 1J5EK 3VTIA 4DV4K 1IBKK 4ILGB 3K2PA 1D9DA 4AQYK 3I55N 3HZ6A 2F8TA 5BRFA 1KAZA 1KLMA 4ID5A 3J80O 4M3RA 2HF4A 1OVQA 4A57A 3PSFA 4H0YB 3EEQA 3L3VA 1VQ7N 4ISEA 4LF8K 1QQOA 1KAYA 3BGRA 4Z4HA 2OPQA 4E7LA 3CG7A 2HNZA 2IGIA 5AQLA 4YOTA 4JI4K 3TANA 3O9SA 3ZT0A 4E0DA 1RT3A 1E4FT 1NNEA 4HCBA 4DU1A 3MCPA 2X6SA 4RW4A 4DTJA 3MDQA 4DTUA 1BGXT 4BRDA 1RTHA 3HO1A 3H46O 4CIGA 3QESA 2G8HA 4OPHA 4FLTA 1P8ZA 5GAEP 1TKZA 3L4IA 5BPMA 1Z26A 1J53A 1YTAA 5J2NA 4BR4A 2QWQA 3DLKA 3OYKA 3M8PA 3HOTA 2P9LB 3I56N 1YUWA 3M1FA 1Z25A 5GAGP 4F3TA 4N76A 3TI0A 2OCEA 4DUYK 3C0BA 4AILC 4FJHA 1DGKN 2QI2A 4DFPA 3TSUA 4JKBA 4O55A 4DFJA 5MLCQ 5I3UA 4EZ9A 1RDUA 3HM8A 4JD2B 1XC9A 4EP5A 2E2NA 1IBLK 4LH5A 4CBXA 4CF2A 1QHAA 4A5BA 3MX5A 4CJSA 1SV5A 3OA9A 4DS4A 4CK2A 4CHPA 4CF9A 1RT7A 5LJVA 1WN7A 2E2OA 1IG9A 4FPAA 3CFPA 3PX6A 2G8VA 5JICA 2O8FA 2QXFA 3EO3A 3AVIA 2KQ2A 2DPNA 2V52B 5I42A 1MWKA 5GADP 4HUEA 4KI4A 4M3WA 3KLEA 3FR0A 4A61A 4IO9L 5E84A 1NK0A 3PO4A 5SWMA 3CHWA 3V9ZA 4W5QA 4DS5A 2A6AA 1Q9XA 1WSGA 2D0PA 4CGHA 1TAUA 1GLFO 5FPEA 1U6ZA 3U9DA 1OH7A 2UXCK 3AA3A 2FBVA 3AA2A 4RW8A 5C0YA 3L0QA 4M7YA 4BR2A 3HRGA 3VETA 3WQUA 3VEVA 1YJ9N 1VQ6N 3THWA 1TYQB 4KPYA 1QZ6A 3H3NO 3SUQA 3ASMA 3MN7A 1ASVA 4FK4A 2HHXA 2HSTA 4FJLA 4FVMA 3AVNA 3T19A 4M45A 3OYBA 4PUOA 3R9PA 1CZBA 3DAWA 3MAQA 4IG0A 4CHOA 3SUNA 3H45C 1W2BM 3ZSWA 4CZHA 4EFHA 1V4SA 4IDKA 2O8FB 1JKHA 4K43A 4DMNA 1D5AA 1Q7YO 1C6VA 4PY5A 1S1UA 3NDKA 4KKOA 2YHYA 1GLBG 2YKNA 1D4XA 2E6LA 3VENA 3DI6A 5HL7L 1UA0A 1VQ8N 2IVPA 5C2FA 3D2EB 1E4GT 4FOIA 4R5PA 3ZT1A 5KPTA 4WQ4A 4QAGA 3ZSXA 1HJRA 3SQ0A 4GVEA 2YNIA 2D1KA 4KHQA 4H4OA 3QETA 1NK4A 3VEYA 3L3UA 5HRRA 4DTOA 1VSDA 3R8EA 4E7IA 3D45A 1Q86O 4CF1A 1LAVA 4IFYA 1HKGA 1MDUB 3HT3A 4JI0K 2HHHK 1RFQA 1S22A 2ZF5O 3CCEN 4MDAA 3ZSZA 5C25A 3K5NA 3DLHA 4CEDA 1ZBFA 2FBYA 1NGEA 1H1VA 3LDQA 2HHWA 3QB0A 1SS6A 4KHPK 5CHIA 4M41A 1FXXA 3EYZA 3VTHA 3A5NC 2G8FA 4CEBA 4BY9C 1SZ2A 3VA3A 1A5XA 4PQUA 3KKSA 4OO1J 1REVA 5J2PA 3V9UA 4CZKA 3EZWA 3ZSYA 5KQ8A 1UA1A 3GE1A 4YY3K 4FM1A 4YDUA 3HP9A 2YHWA 3A2FA 2A40A 3MN6A 1NGDA 3VQ4A 3P31A 4JI5K 4NLCA 4J2AA 5CZ2A 1G99A 4RW6A 3CJ9A 5J2QA 3OYMA 3E01A 3SQ4A 4AH9A 3O3GA 1KSPA 1BU6O 4B9SA 3ULEB 1VSJA 3SK3A 4YOYA 2ZM6K 3DLGA 4JRQA 1K73O 5BPLA 1BCOA 3VQBA 4CF8A 2YKMA 1BI4B 4OVLA 5M1OA 4IO8A 2O4IA 1FKPA 3CF5L 1KFSA 2XRIA 3PO5A 4DSFA 4FCYA 4U67L 2JLEA 2PZSA 2KKZA 3BF3A 1IJJA 1WLJA 5AQHA 3R6MA 4BDYA 2HMPA 4YOXA 5CYMA 3KVGA 3OW2M 1HKCA 1OVYA 2Q0UA 4H5TA 3WNGA 3A5MC 4XH4A 1GOBA 4F2RA 4MDBA 4DR7K 3CQYA 3DRSA 5K14A 2PYLA 1OKJA 1LOTB 4FJIA 1IKVA 1IBMK 4B3OA 2KW4A 3M8SA 2HBKA 4CIEA 4FJ7A 1OH6A 3V4IA 4CJFA 2V51B 2QWNA 3QMLA 4CGIA 3UKRA 3SV3A 3EE8A 4C8LA 1VK0A 3VMFB 4ELTA 4CZLA 5HLFA 1T6CA 3VF6A 1NKEA 1KCFA 4KO0A 2J4RA 4IWVA 4BE2A 2XY7A 1QHTA 3QO9A 4DV0K 1IV0A 3K0SA 3CCJN 2ZJRL 1VRTA 4FWNA 4M7XA 1V4TA 3ZCMA 2E5LK 3C6AA 4E3SA 3M5RA 1WSIA 5AJ3K 1LW2A 4Q5VA 4B8AB 4QS9A 4M3UA 2FBXA 4ELVA 2P9SA 4KREA 1GLDG 3J81O 4FLZA 3CQ8A 4CZFA 3AVHA 4QS8A 5LMNK 3OHRA 3SZ2A 4Y1DA 2FC0A 4FWLA 3S3NA 2IC3A 3PSIA 1L3VA 4FJNA 4G9ZA 1NWKA 4KH6A 2YHXA 2KHOA 3CPEA 1RBRA 4IOXA 3NH2A 1BL3A 5EVZA 2VGMA 3V1OA 5AQYA 3RTVA 2OANA 3SPYA 4OGCA 1ZBUA 3K58A 3GG4A 3RSEA 2DFEA 4GMJB 1RDDA 4FW2A 4B1XB 3AVJA 1TK8A 4FWMA 3O9UA 1BCMA 2ASOA 3ATUA 3U8XA 4IXCA 4H03B 3TAFA 3VEXA 1R59O 3AVMA 4CJ7A 2NRXA 4ISGA 2VG5A 1BUPA 2F9TA 3VQAA 1EWQA 5LJWA 1VSIA 5M1KA 4AHRA 3PUFA 1LCUA 3VQPA 2X78A 3CM5A 3KHYA 1QS4A 3ATVA 4MQ3A 3V81A 2HHVA 4N5SA 3Q7CA 3SJHA 4NLBA 4JS5A 1W9HA 3VQEA 3I0RA 4KH4A 3TAMA 4PKHA 1D8YA 1WBDA 2O8DA 2FSNA 4JKEA 1ZBLA 4FLXA 3FZLA 3O4NA 4MFBA 4RTFD 2IS3A 1RCHA 4BRGA 3O6WA 1U49A 4CEQA 1S72N 2BUPA 1TL3A 2P9IB 1MA9B 1C0TA 1KTQA 4JKCA 1NGIA 3C7NA 3TTFA 2ATQA 3CERA 2JGUA 5GIOA 4GVMA 1T7PA 2G8WA 2GELA 4CJUA 4FLUA 1U48A 1RGIA 2QXLA 1K8KA 3SI6A 2FBTA 4U7BA 2OPSA 2A1RA 1BDGA 3GOIA 3ENHA 4OKEA 2RKIA 3ZX3A 5DM7L 2Z1GA 3DYAA 4K8ZA 3L8BA 4AHCA 1WBBA 3O3FA 3ZSOA 3ITHA 4BRCA 4OKJA 5FLXO 4QOZB 3SQ2A 1T8EA 3QEPA 3FZFA 4WCEL 2QA4N 1WAFA 1NG9A 2P9KB 5LMUK 1HMVA 3J7YP 3M8QA 2G8IA 4FZXC 3H6EA 3PX4A 1HPMA 2CGJA 4CFAA 4EAHD 2WTUA 3M6GA 4FWQA 4C1NK 1A5WA 2RPIA 4BQZA 1SL1A 3M3ZA 3THYB 1TAQA 4JAXA 2IDOA 4DSEA 4CGJA 4DTXA 1SKWA 5H1SQ 3LM9A 3OJSA 2H3GX 2P9PB 1X9MA 2DFHA 3OTOK 2AJQA 2P9LA 1TUUA 3QIPA 2NRHA 3ISNC 4B9NA 3WXLA 4WQ5C 1BISA 3C7NB 3AV9A 1RBVA 4IEIA 3HSTB 3F9KA 1QVFM 3HM9A 4UY8O 3CIPA 4KFBA 1C1BA 2QK9A 4PL8A 3G71N 4CECA 1JXBA 4OGEA 1JLBA 1QQMA 5C42A 3LDPA 3ZSVA 4IG3A 3MEGA 4AM6A 3W0LA 4DHYA 1NK9A 3AY9A 3J8AA 2NNWA 3O4QA 3NVKA 5J2MA 1NK7A 3VQQA 4CESA 4DSJA 2YI1A 5M1NA 1JL1A 4DQSA 4CHNA 3C6HA 1HNZK 1RT6A 4JV5K 3IG1A 3QLHA 4EIAA 1NMDA 4FSVA 4M3TA 2D5RA 1TK5A 2W42A 3C65A 4DTPA 1HRHA 4WFBL 3SAHA 1NGCA 4E19A 4YFUA 4CZEA 3AO1A 1RDWX 3LANA 1KD1O 3OBWA 1NK8A 3GL1A 5IT9O 1YF5L 3N4QA 3ZETA 2CH6A 4KTQA 3ZSRA 3LP2A 5BR8K 1S6QA 1HYSA 4LF6K 3TAGA 2UUAK 1DTQA 3L2QA
chains in the Genus database with same CATH topology
3NDKA 4KKOA 2HHTA 1S1WA 3QEXA 2YKNA 1I3AA 2E6LA 3C6TA 3DI6A 3V9WA 1UA0A 1SKSA 2KTQA 3LP3A 3RR7A 4QCLA 3TR8A 3PV8A 4R5PA 2YHBA 3ZT1A 4DU3A 3DRRA 4W5TA 3LPUA 1RDCA 4QAGA 3ZSXA 1HJRA 1RTIA 3SQ0A 1J5OA 3HL8A 2BANA 2B4JA 2EHGA 3CYMA 3DOKA 3JYTA 2YNIA 4KHQA 4ELUA 3SJJA 4H4OA 3QETA 3ALYA 1JLQA 3OYJA 1NK4A 1WSHA 3L3UA 3DMJA 5HRRA 3NGYA 4CEOA 4DTOA 1JLFA 1VSDA 2GBZA 4E7IA 3KJVA 1B92A 4DTMA 2B5JA 3D45A 3LAMA 4O4GA 4CF1A 1LAVA 3QIOA 4IFYA 5JS1A 3HT3A 1WNSA 4I2PA 4ZTFA 5KI6A 3HPGA 1N6QA 4N47A 2XY6A 1KVBA 4ID1A 1IKYA 1VSFA 1I39A 4LSLA 4GW6A 3LP0A 3ZSZA 4KTWA 3JSMA 4B9MA 1JL2A 4I9LA 5C25A 3K5NA 4CFCA 1TKXA 3OYDA 3MXMA 1X9SA 4CEDA 2HMIA 1ZBFA 3B6PA 4CJTA 2FBYA 1TK0A 1EX4A 2VG7A 1TKTA 1WSEA 3HPHA 3IAYA 5FRNA 3DLBA 2HHWA 4CEFA 3VQDA 4CEZA 4E89A 1QSSA 3AVBA 4B9LA 4LY7A 2ZE2A 4M41A 1FXXA 3EYZA 4I2QA 1CZ9A 2G8FA 4WE1A 3HXMA 3KK3A 4CEBA 5HRPA 1NJXA 3VA3A 4B9VA 3OVNA 1R0AA 1A5XA 1S5JA 4C8NA 4DF8A 4CIFA 4CJRA 3KKSA 5T7BA 4DLEA 1REVA 5J2PA 3C6UA 3V9UA 3THVA 1G15A 4CJ5A 3PY8A 3DRPA 1EXQA 2G8KA 3QNNA 3ZSYA 4OKKA 1UA1A 4J2DA 4BE0A 1U04A 3I8DA 4FM1A 1F21A 3OS0A 1SKRA 3NF9A 3LDSA 4OPKA 3HP9A 1GOCA 3TWHA 1S9GA 2R7YA 4CEEA 3A2FA 4NCAA 1RT1A 4CFDA 3L2RA 2VWJA 3CFOA 4CJVA 1QQCA 4CJPA 3VQ4A 1QSYA 1ASWA 4YNQA 2HB5A 4J2AA 4FJJA 3S3MA 4FJKA 5CZ2A 3L2WA 2WONA 3P5JA 3OYCA 4RW6A 1YT3A 4CJQA 4HVJA 5J2QA 3RRGA 3HVTA 3NFAA 3OYMA 1WSFA 3E01A 4JS4A 3SQ4A 4CJEA 4AH9A 3O3GA 1RT5A 1KSPA 2IOCA 4FXDA 3OYEA 2P1JA 3T1AA 3VQ5A 4B9SA 3RMDA 5FDLA 4M3YA 2RF2A 1T03A 1VSJA 4B08A 1Q9YA 4NCBA 1WAJA 1JXEA 3DLGA 4KV8A 4JRQA 1BCOA 3VQBA 3UIQA 1S1VA 4CF8A 3AA4A 5KGXA 2YKMA 4KHWA 1BI4B 1BI4A 1EKEA 4OVLA 3K59A 1ZBHA 1CXQA 1LWFA 4IFVA 5DK5A 5KRSA 1FKPA 3OS1A 3T3FA 1KFSA 1C1AA 1S1TA 2XRIA 3QNOA 3HVRA 3PO5A 1VSMA 4DSIA 1JLGA 4DFMA 3U3GA 1U45A 3NGIA 2KFZA 4DSFA 3NCIA 4FJXA 4FCYA 2OPRA 3HYFA 2JLEA 4B9TA 1X1PA 1XHXA 3NH0A 2PZSA 4DQIA 3AVCA 1O1WA 3IS9A 1WLJA 4DLGA 1VSHA 2XHBA 1NOZA 3P83D 4BDYA 1DLOA 4LD0A 4E1MA 2VWKA 3LP1A 1S9EA 4Y1CA 4FJMA 4KRFA 5CYMA 1Y97A 3G10A 1HNVA 4N56A 3SCXA 3WNGA 1ASUA 4C8KA 4HCCA 3QEVA 1ZYQA 2O4GA 2PYJA 1GOBA 4CE9A 4CHQA 3HPOA 1BQMA 4F2RA 3VQCA 4FW1A 2QKBA 3DOLA 3SPZA 2F8SA 3DRSA 3WNEA 4XIUA 5K14A 2PYLA 4UQGA 4KHUA 5KGWA 3FFIA 4Z4CA 4RW7A 4FJIA 1IKVA 1HNIA 1LAWA 4B3OA 4PWDA 2KW4A 5JS2A 3M8SA 1MU2A 4CIEA 1K6YA 3RRHA 3PX0A 2P5GA 4FJ7A 4FYDA 3DLRA 1RNHA 3MECA 4C8OA 3V4IA 4CJFA 5C24A 3OYGA 1JLAA 2O4IA 1CXUA 1RTJA 4CGIA 4PA1A 4BACA 5KTQA 4CERA 3OYLA 3SV3A 4C8LA 1VSLA 1U47A 2PY5A 2P51A 4HHTA 1U4BA 4OJRA 1TKDA 2P5OA 4Z4IA 4NCGA 1N5YA 4Z0UA 1VK0A 2BE2A 4CK1A 1NOYA 4ELTA 4F8RA 5HLFA 1D9FA 5HBMA 4KB0A 3V1QA 3LZJA 4FLVA 1NKEA 1KCFA 4KO0A 4M3ZA 3HP6A 2YNFA 4BE2A 2XY7A 1QHTA 3KLIA 3KLFA 2E4LA 4DTSA 3HJFA 3QO9A 2RN2A 4NYFA 1J9AA 3SQ1A 3G0ZA 2I5JA 4CJLA 3KIOA 3S9HA 2YV0X 4FM2A 1XI1A 3KTQA 1IKWA 1YVUA 2VG6A 3LALA 1VRTA 3AO4A 3AO2A 3MXJA 4EP4A 2NUBA 4W5RA 3OS2A 4FLYA 2HNYA 1W0HA 1KVAA 3AO3A 5CYQA 3ZCMA 4E7KA 3V6DA 5KRTA 3QEWA 4E3SA 1WSIA 4KHYA 1SL0A 1LW2A 4LH4A 4Q5VA 3NAEA 4B8AB 4EZ6A 2OYQA 4FJ8A 4M3UA 3TARA 2FBXA 1L3SA 4ELVA 2HW3A 1RBUA 4KREA 2ITGA 4CJ3A 4BE1A 1NK6A 4G1QA 4FLZA 1L5UA 4DU4A 3CQ8A 1KRPA 4FK0A 3AVHA 4DG1A 2XY5A 3SZ2A 3SUOA 3VQ8A 3K57A 4Y1DA 2FC0A 4DTNA 1SL2A 4K8XA 4Z4FA 3KLHA 3S3NA 2IC3A 1L3VA 5DMRA 2ETJA 4FJNA 3VN5A 4DWIA 4ZHRA 4FK2A 4E1NA 3K5LA 1RBRA 3NH2A 4L8RB 3AVFA 3O3HA 1BL3A 1BQNA 4O0IA 3SUPA 3V1OA 4FJ5A 3EZ5A 2Z1HA 3L2UA 1L3UA 3RTVA 3QERA 3SPYA 4OGCA 1C1CA 1ZBUA 1KFDA 3LAKA 3WNHA 2HVIA 3K58A 1IKXA 3KLGA 2XO7A 2DFEA 4GMJB 1RDDA 3AA5X 4FW2A 4CGFA 4KAZA 1L3TA 3AVJA 2OZMA 4PQUA 1C0MA 4B8CA 1T7PA 1TK8A 3H08A 3RMBA 3AVGA 1BCMA 4BWJA 3C95A 4Z4GA 2HNDA 3VQ9A 3WNFA 4AHVA 5HROA 3TAFA 1HYVA 4ICLA 1SUQA 3KK1A 1NKCA 3AVMA 1QTMA 4CEAA 4J2BA 2HHQA 3B6OA 2GV9A 1KLNA 1LW0A 2VG5A 3CM6A 3LWLA 3VQAA 1TGOA 2YNHA 3ZT3A 5CY4A 3KK2A 4HUGA 3LZIA 3NE6A 2DTUA 1VSIA 3KKRA 3ZT4A 3OYNA 1QSLA 2HHUA 4FZZA 3TABA 4AHRA 3PUFA 1RTDA 4C8MA 4FJ9A 1NK5A 3VQPA 2X78A 1XWLA 4CJKA 1BIZA 1HPZA 3CM5A 2B6AA 2ZD1A 4J2EA 1QS4A 4MQ3A 4AHSA 3V81A 4I9QA 4N5SA 2HHVA 2BDPA 3V1RA 3K2PA 1D9DA 1BIUA 1NJWA 4JS5A 1W9HA 3VQEA 4H4MA 3EY1A 2Y1IA 3I0RA 2F8TA 3TAMA 1TV6A 4F2SA 3P1GA 1KLMA 1BHLA 4ID5A 4M3RA 1D8YA 1ZBIA 4CGGA 3L3VA 3AVAA 2ZQBA 3NF7A 4AHTA 3NHGA 4OPJA 1T05A 1S1XA 4O0JA 3MXIA 1ZBLA 4N41A 1JLEA 4FLXA 3BGRA 1NJZA 2D0BA 3O4NA 4MFBA 4CJWA 4Z4HA 3M8RA 3F73A 2OPQA 4F4KA 4E7LA 1XHZA 2IS3A 2YHAA 2HNZA 1RCHA 2IGIA 3CG7A 3TAEA 3TANA 1FK9A 4E7HA 1U49A 4CEQA 3C94A 3ZT0A 1TL3A 4E0DA 3VQ7A 4FLWA 3OJUA 4KHNA 4JLHA 1C0TA 1EETA 1KTQA 3SYZA 2XY8A 1RT3A 4HCBA 4DU1A 2OA8A 2ATQA 4ZTJA 2JGUA 3OYAA 2G8UA 1UOCA 4GVMA 3OYIA 3LPTA 4CF0A 3DLEA 2X6SA 1IH7A 4RW4A 4DTJA 2G8WA 4DF4A 5FROA 4CJUA 4FLUA 1VSEA 4DTUA 1BGXT 1U48A 3BDPA 3KD1E 3SI6A 1Q8IA 1RTHA 2FBTA 3MEEA 1WSJA 2OPSA 2A1RA 3HO1A 4OKEA 4KI6A 2RKIA 2X74A 2Z1GA 3DYAA 1A5VA 1S6PA 4IKFA 4K8ZA 3ZSQA 4CIGA 3QESA 2G8HA 3L8BA 4FLTA 4AHCA 2HVHA 4CJ4A 2WOMA 1TKZA 4O5BA 3RMAA 3O3FA 3ZSOA 4DQQA 3ITHA 4OKJA 4F3OA 3VQ6A 1Z26A 5D3GA 1J53A 1YTAA 3NF6A 1DTTA 5J2NA 4QOZB 3AVKA 3SQ2A 3NGZA 1T8EA 4NYNA 1NKBA 3QEPA 3DLKA 3OYKA 3M8PA 4DFKA 3HK2A 3NBPA 1Z25A 3MEDA 1WAFA 1RILA 4CFBA 3L2QA 1LWEA 3TI0A 1LV5A 4N76A 1HMVA 4CK3A 3M8QA 4OLAA 2G8IA 4AILC 4FZXC 4FJHA 4KB1A 4TSXA 3ULDA 3PX4A 4CFAA 4DFPA 3AO5A 2Z1IA 5FRMA 4O55A 4DFJA 1NJYA 2YNGA 5I3UA 4EZ9A 1B9DA 4HTUA 4BDZA 3U6FA 1A5WA 1XC9A 2QKKA 4EP5A 2RPIA 4LH5A 1HQEA 4CF2A 1SL1A 4CCHA 3IRXA 1TAQA 2IDOA 4DSEA 3NH1A 4CJSA 4CGJA 4DTXA 1J54A 1HQUA 1SV5A 2Z1JA 3LWMA 1SKWA 1VSKA 1EP4A 3OJSA 4DS4A 2OZSA 2KZMA 1X9MA 4FM0A 2DFHA 4CK2A 4CHPA 4CF9A 2AJQA 4KTZA 4CHZA 1RT7A 2BGGA 1RDBA 4CGDA 1X9WA 3QIPA 1WN7A 1IG9A 1TL1A 3ISNC 3CFPA 3PX6A 2G8VA 2D0CA 4B9NA 3QEIA 2KZZA 2QXFA 3RMCA 1VRUA 1BISA 3AVIA 2KQ2A 5HRNA 3AV9A 1RBVA 4E7JA 5I42A 4Z4EA 1RT2A 2D0AA 3F9KA 3HSTB 4HUEA 2EX3A 1HYZA 3S3OA 4KI4A 4M3WA 3HM9A 3KLEA 4AHUA 1NK0A 3RR8A 3K5MA 3ZT2A 1KVCA 4KFBA 1C1BA 5CZ1A 1TVRA 5EU7A 3PO4A 5SWMA 2QK9A 3V9ZA 3KD5E 4RG8A 4CECA 1JXBA 4OGEA 1JLBA 4IBNA 4BWMA 5C42A 1ITGA 4W5QA 4O44A 3ZSVA 5HRSA 3D0PA 1RBSA 4DS5A 4IG3A 3L2VA 3MEGA 1NK9A 1Q9XA 3OYFA 2OPPA 1WSGA 2Q3SA 1TAUA 4CGHA 4OLBA 5SZTA 3O4QA 4KHSA 4I7FA 4FZYA 2IAJA 5J2MA 1GOAA 1NK7A 3VQQA 4JRPA 4CESA 3DLHA 3AA3A 2FBVA 3SV4A 3I0SA 5J1EA 4DSJA 3TAQA 4H8KA 3CFRA 1JL1A 4BDPA 4LSNA 3NF8A 3VA0A 3AA2A 4RW8A 4CHNA 4DQSA 4FJGA 1QE1A 1RT6A 3IG1A 3QLHA 1IO2A 3K5OA 2KFNA 3AVLA 3SNNA 2DY4A 1JLCA 2DFFA 1RDAA 2LSNA 2X6NA 3RWUA 2D5RA 1TK5A 2E6MA 4M3TA 4Q0BA 1RT4A 2HHSA 4KPYA 4HUFA 3SUQA 2W42A 4DQPA 1C0UA 3ASMA 4FK4A 1ASVA 1HRHA 4DTPA 3TAPA 4F3TA 4M42A 2HHXA 1CLQA 5HP1A 4FJLA 4FVMA 3AVNA 3T19A 4E19A 4YFUA 4M45A 4W5OA 3OYBA 3QINA 3V9XA 4PUOA 3OY9A 1LWCA 1CZBA 3AO1A 3MAQA 4RW9A 3LANA 2GUIA 3DM2A 4IG0A 1NK8A 4B9UA 4DSKA 4W5NA 1RBTA 4CHOA 3OYHA 1B9FA 3SUNA 1UAXA 1UWBA 3ZSWA 1YTUA 2F96A 4CHYA 4KTQA 4DTRA 3ZSRA 3LP2A 4IDKA 1JKHA 4DMNA 5E41A 1FKOA 4DSLA 1D5AA 4DQRA 3V9SA 1S6QA 2Y1JA 1HYSA 3U3YA 3TAGA 2A1SA 1C6VA 1DTQA 4M3XA 4PY5A 1S1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NDK A;  4KKO A;  2HHT A;  1S1W A;  3QEX A;  2YKN A;  1I3A A;  2E6L A;  3C6T A;  3DI6 A;  3V9W A;  1UA0 A;  1SKS A;  2KTQ A;  3LP3 A;  3RR7 A;  4QCL A;  3TR8 A;  3PV8 A;  4R5P A;  2YHB A;  3ZT1 A;  4DU3 A;  3DRR A;  4W5T A;  3LPU A;  1RDC A;  4QAG A;  3ZSX A;  1HJR A;  1RTI A;  3SQ0 A;  1J5O A;  3HL8 A;  2BAN A;  2B4J A;  2EHG A;  3CYM A;  3DOK A;  3JYT A;  2YNI A;  4KHQ A;  4ELU A;  3SJJ A;  4H4O A;  3QET A;  3ALY A;  1JLQ A;  3OYJ A;  1NK4 A;  1WSH A;  3L3U A;  3DMJ A;  5HRR A;  3NGY A;  4CEO A;  4DTO A;  1JLF A;  1VSD A;  2GBZ A;  4E7I A;  3KJV A;  1B92 A;  4DTM A;  2B5J A;  3D45 A;  3LAM A;  4O4G A;  4CF1 A;  1LAV A;  3QIO A;  4IFY A;  5JS1 A;  3HT3 A;  1WNS A;  4I2P A;  4ZTF A;  5KI6 A;  3HPG A;  1N6Q A;  4N47 A;  2XY6 A;  1KVB A;  4ID1 A;  1IKY A;  1VSF A;  1I39 A;  4LSL A;  4GW6 A;  3LP0 A;  3ZSZ A;  4KTW A;  3JSM A;  4B9M A;  1JL2 A;  4I9L A;  5C25 A;  3K5N A;  4CFC A;  1TKX A;  3OYD A;  3MXM A;  1X9S A;  4CED A;  2HMI A;  1ZBF A;  3B6P A;  4CJT A;  2FBY A;  1TK0 A;  1EX4 A;  2VG7 A;  1TKT A;  1WSE A;  3HPH A;  3IAY A;  5FRN A;  3DLB A;  2HHW A;  4CEF A;  3VQD A;  4CEZ A;  4E89 A;  1QSS A;  3AVB A;  4B9L A;  4LY7 A;  2ZE2 A;  4M41 A;  1FXX A;  3EYZ A;  4I2Q A;  1CZ9 A;  2G8F A;  4WE1 A;  3HXM A;  3KK3 A;  4CEB A;  5HRP A;  1NJX A;  3VA3 A;  4B9V A;  3OVN A;  1R0A A;  1A5X A;  1S5J A;  4C8N A;  4DF8 A;  4CIF A;  4CJR A;  3KKS A;  5T7B A;  4DLE A;  1REV A;  5J2P A;  3C6U A;  3V9U A;  3THV A;  1G15 A;  4CJ5 A;  3PY8 A;  3DRP A;  1EXQ A;  2G8K A;  3QNN A;  3ZSY A;  4OKK A;  1UA1 A;  4J2D A;  4BE0 A;  1U04 A;  3I8D A;  4FM1 A;  1F21 A;  3OS0 A;  1SKR A;  3NF9 A;  3LDS A;  4OPK A;  3HP9 A;  1GOC A;  3TWH A;  1S9G A;  2R7Y A;  4CEE A;  3A2F A;  4NCA A;  1RT1 A;  4CFD A;  3L2R A;  2VWJ A;  3CFO A;  4CJV A;  1QQC A;  4CJP A;  3VQ4 A;  1QSY A;  1ASW A;  4YNQ A;  2HB5 A;  4J2A A;  4FJJ A;  3S3M A;  4FJK A;  5CZ2 A;  3L2W A;  2WON A;  3P5J A;  3OYC A;  4RW6 A;  1YT3 A;  4CJQ A;  4HVJ A;  5J2Q A;  3RRG A;  3HVT A;  3NFA A;  3OYM A;  1WSF A;  3E01 A;  4JS4 A;  3SQ4 A;  4CJE A;  4AH9 A;  3O3G A;  1RT5 A;  1KSP A;  2IOC A;  4FXD A;  3OYE A;  2P1J A;  3T1A A;  3VQ5 A;  4B9S A;  3RMD A;  5FDL A;  4M3Y A;  2RF2 A;  1T03 A;  1VSJ A;  4B08 A;  1Q9Y A;  4NCB A;  1WAJ A;  1JXE A;  3DLG A;  4KV8 A;  4JRQ A;  1BCO A;  3VQB A;  3UIQ A;  1S1V A;  4CF8 A;  3AA4 A;  5KGX A;  2YKM A;  4KHW A;  1BI4 B;  1BI4 A;  1EKE A;  4OVL A;  3K59 A;  1ZBH A;  1CXQ A;  1LWF A;  4IFV A;  5DK5 A;  5KRS A;  1FKP A;  3OS1 A;  3T3F A;  1KFS A;  1C1A A;  1S1T A;  2XRI A;  3QNO A;  3HVR A;  3PO5 A;  1VSM A;  4DSI A;  1JLG A;  4DFM A;  3U3G A;  1U45 A;  3NGI A;  2KFZ A;  4DSF A;  3NCI A;  4FJX A;  4FCY A;  2OPR A;  3HYF A;  2JLE A;  4B9T A;  1X1P A;  1XHX A;  3NH0 A;  2PZS A;  4DQI A;  3AVC A;  1O1W A;  3IS9 A;  1WLJ A;  4DLG A;  1VSH A;  2XHB A;  1NOZ A;  3P83 D;  4BDY A;  1DLO A;  4LD0 A;  4E1M A;  2VWK A;  3LP1 A;  1S9E A;  4Y1C A;  4FJM A;  4KRF A;  5CYM A;  1Y97 A;  3G10 A;  1HNV A;  4N56 A;  3SCX A;  3WNG A;  1ASU A;  4C8K A;  4HCC A;  3QEV A;  1ZYQ A;  2O4G A;  2PYJ A;  1GOB A;  4CE9 A;  4CHQ A;  3HPO A;  1BQM A;  4F2R A;  3VQC A;  4FW1 A;  2QKB A;  3DOL A;  3SPZ A;  2F8S A;  3DRS A;  3WNE A;  4XIU A;  5K14 A;  2PYL A;  4UQG A;  4KHU A;  5KGW A;  3FFI A;  4Z4C A;  4RW7 A;  4FJI A;  1IKV A;  1HNI A;  1LAW A;  4B3O A;  4PWD A;  2KW4 A;  5JS2 A;  3M8S A;  1MU2 A;  4CIE A;  1K6Y A;  3RRH A;  3PX0 A;  2P5G A;  4FJ7 A;  4FYD A;  3DLR A;  1RNH A;  3MEC A;  4C8O A;  3V4I A;  4CJF A;  5C24 A;  3OYG A;  1JLA A;  2O4I A;  1CXU A;  1RTJ A;  4CGI A;  4PA1 A;  4BAC A;  5KTQ A;  4CER A;  3OYL A;  3SV3 A;  4C8L A;  1VSL A;  1U47 A;  2PY5 A;  2P51 A;  4HHT A;  1U4B A;  4OJR A;  1TKD A;  2P5O A;  4Z4I A;  4NCG A;  1N5Y A;  4Z0U A;  1VK0 A;  2BE2 A;  4CK1 A;  1NOY A;  4ELT A;  4F8R A;  5HLF A;  1D9F A;  5HBM A;  4KB0 A;  3V1Q A;  3LZJ A;  4FLV A;  1NKE A;  1KCF A;  4KO0 A;  4M3Z A;  3HP6 A;  2YNF A;  4BE2 A;  2XY7 A;  1QHT A;  3KLI A;  3KLF A;  2E4L A;  4DTS A;  3HJF A;  3QO9 A;  2RN2 A;  4NYF A;  1J9A A;  3SQ1 A;  3G0Z A;  2I5J A;  4CJL A;  3KIO A;  3S9H A;  2YV0 X;  4FM2 A;  1XI1 A;  3KTQ A;  1IKW A;  1YVU A;  2VG6 A;  3LAL A;  1VRT A;  3AO4 A;  3AO2 A;  3MXJ A;  4EP4 A;  2NUB A;  4W5R A;  3OS2 A;  4FLY A;  2HNY A;  1W0H A;  1KVA A;  3AO3 A;  5CYQ A;  3ZCM A;  4E7K A;  3V6D A;  5KRT A;  3QEW A;  4E3S A;  1WSI A;  4KHY A;  1SL0 A;  1LW2 A;  4LH4 A;  4Q5V A;  3NAE A;  4B8A B;  4EZ6 A;  2OYQ A;  4FJ8 A;  4M3U A;  3TAR A;  2FBX A;  1L3S A;  4ELV A;  2HW3 A;  1RBU A;  4KRE A;  2ITG A;  4CJ3 A;  4BE1 A;  1NK6 A;  4G1Q A;  4FLZ A;  1L5U A;  4DU4 A;  3CQ8 A;  1KRP A;  4FK0 A;  3AVH A;  4DG1 A;  2XY5 A;  3SZ2 A;  3SUO A;  3VQ8 A;  3K57 A;  4Y1D A;  2FC0 A;  4DTN A;  1SL2 A;  4K8X A;  4Z4F A;  3KLH A;  3S3N A;  2IC3 A;  1L3V A;  5DMR A;  2ETJ A;  4FJN A;  3VN5 A;  4DWI A;  4ZHR A;  4FK2 A;  4E1N A;  3K5L A;  1RBR A;  3NH2 A;  4L8R B;  3AVF A;  3O3H A;  1BL3 A;  1BQN A;  4O0I A;  3SUP A;  3V1O A;  4FJ5 A;  3EZ5 A;  2Z1H A;  3L2U A;  1L3U A;  3RTV A;  3QER A;  3SPY A;  4OGC A;  1C1C A;  1ZBU A;  1KFD A;  3LAK A;  3WNH A;  2HVI A;  3K58 A;  1IKX A;  3KLG A;  2XO7 A;  2DFE A;  4GMJ B;  1RDD A;  3AA5 X;  4FW2 A;  4CGF A;  4KAZ A;  1L3T A;  3AVJ A;  2OZM A;  4PQU A;  1C0M A;  4B8C A;  1T7P A;  1TK8 A;  3H08 A;  3RMB A;  3AVG A;  1BCM A;  4BWJ A;  3C95 A;  4Z4G A;  2HND A;  3VQ9 A;  3WNF A;  4AHV A;  5HRO A;  3TAF A;  1HYV A;  4ICL A;  1SUQ A;  3KK1 A;  1NKC A;  3AVM A;  1QTM A;  4CEA A;  4J2B A;  2HHQ A;  3B6O A;  2GV9 A;  1KLN A;  1LW0 A;  2VG5 A;  3CM6 A;  3LWL A;  3VQA A;  1TGO A;  2YNH A;  3ZT3 A;  5CY4 A;  3KK2 A;  4HUG A;  3LZI A;  3NE6 A;  2DTU A;  1VSI A;  3KKR A;  3ZT4 A;  3OYN A;  1QSL A;  2HHU A;  4FZZ A;  3TAB A;  4AHR A;  3PUF A;  1RTD A;  4C8M A;  4FJ9 A;  1NK5 A;  3VQP A;  2X78 A;  1XWL A;  4CJK A;  1BIZ A;  1HPZ A;  3CM5 A;  2B6A A;  2ZD1 A;  4J2E A;  1QS4 A;  4MQ3 A;  4AHS A;  3V81 A;  4I9Q A;  4N5S A;  2HHV A;  2BDP A;  3V1R A;  3K2P A;  1D9D A;  1BIU A;  1NJW A;  4JS5 A;  1W9H A;  3VQE A;  4H4M A;  3EY1 A;  2Y1I A;  3I0R A;  2F8T A;  3TAM A;  1TV6 A;  4F2S A;  3P1G A;  1KLM A;  1BHL A;  4ID5 A;  4M3R A;  1D8Y A;  1ZBI A;  4CGG A;  3L3V A;  3AVA A;  2ZQB A;  3NF7 A;  4AHT A;  3NHG A;  4OPJ A;  1T05 A;  1S1X A;  4O0J A;  3MXI A;  1ZBL A;  4N41 A;  1JLE A;  4FLX A;  3BGR A;  1NJZ A;  2D0B A;  3O4N A;  4MFB A;  4CJW A;  4Z4H A;  3M8R A;  3F73 A;  2OPQ A;  4F4K A;  4E7L A;  1XHZ A;  2IS3 A;  2YHA A;  2HNZ A;  1RCH A;  2IGI A;  3CG7 A;  3TAE A;  3TAN A;  1FK9 A;  4E7H A;  1U49 A;  4CEQ A;  3C94 A;  3ZT0 A;  1TL3 A;  4E0D A;  3VQ7 A;  4FLW A;  3OJU A;  4KHN A;  4JLH A;  1C0T A;  1EET A;  1KTQ A;  3SYZ A;  2XY8 A;  1RT3 A;  4HCB A;  4DU1 A;  2OA8 A;  2ATQ A;  4ZTJ A;  2JGU A;  3OYA A;  2G8U A;  1UOC A;  4GVM A;  3OYI A;  3LPT A;  4CF0 A;  3DLE A;  2X6S A;  1IH7 A;  4RW4 A;  4DTJ A;  2G8W A;  4DF4 A;  5FRO A;  4CJU A;  4FLU A;  1VSE A;  4DTU A;  1BGX T;  1U48 A;  3BDP A;  3KD1 E;  3SI6 A;  1Q8I A;  1RTH A;  2FBT A;  3MEE A;  1WSJ A;  2OPS A;  2A1R A;  3HO1 A;  4OKE A;  4KI6 A;  2RKI A;  2X74 A;  2Z1G A;  3DYA A;  1A5V A;  1S6P A;  4IKF A;  4K8Z A;  3ZSQ A;  4CIG A;  3QES A;  2G8H A;  3L8B A;  4FLT A;  4AHC A;  2HVH A;  4CJ4 A;  2WOM A;  1TKZ A;  4O5B A;  3RMA A;  3O3F A;  3ZSO A;  4DQQ A;  3ITH A;  4OKJ A;  4F3O A;  3VQ6 A;  1Z26 A;  5D3G A;  1J53 A;  1YTA A;  3NF6 A;  1DTT A;  5J2N A;  4QOZ B;  3AVK A;  3SQ2 A;  3NGZ A;  1T8E A;  4NYN A;  1NKB A;  3QEP A;  3DLK A;  3OYK A;  3M8P A;  4DFK A;  3HK2 A;  3NBP A;  1Z25 A;  3MED A;  1WAF A;  1RIL A;  4CFB A;  3L2Q A;  1LWE A;  3TI0 A;  1LV5 A;  4N76 A;  1HMV A;  4CK3 A;  3M8Q A;  4OLA A;  2G8I A;  4AIL C;  4FZX C;  4FJH A;  4KB1 A;  4TSX A;  3ULD A;  3PX4 A;  4CFA A;  4DFP A;  3AO5 A;  2Z1I A;  5FRM A;  4O55 A;  4DFJ A;  1NJY A;  2YNG A;  5I3U A;  4EZ9 A;  1B9D A;  4HTU A;  4BDZ A;  3U6F A;  1A5W A;  1XC9 A;  2QKK A;  4EP5 A;  2RPI A;  4LH5 A;  1HQE A;  4CF2 A;  1SL1 A;  4CCH A;  3IRX A;  1TAQ A;  2IDO A;  4DSE A;  3NH1 A;  4CJS A;  4CGJ A;  4DTX A;  1J54 A;  1HQU A;  1SV5 A;  2Z1J A;  3LWM A;  1SKW A;  1VSK A;  1EP4 A;  3OJS A;  4DS4 A;  2OZS A;  2KZM A;  1X9M A;  4FM0 A;  2DFH A;  4CK2 A;  4CHP A;  4CF9 A;  2AJQ A;  4KTZ A;  4CHZ A;  1RT7 A;  2BGG A;  1RDB A;  4CGD A;  1X9W A;  3QIP A;  1WN7 A;  1IG9 A;  1TL1 A;  3ISN C;  3CFP A;  3PX6 A;  2G8V A;  2D0C A;  4B9N A;  3QEI A;  2KZZ A;  2QXF A;  3RMC A;  1VRU A;  1BIS A;  3AVI A;  2KQ2 A;  5HRN A;  3AV9 A;  1RBV A;  4E7J A;  5I42 A;  4Z4E A;  1RT2 A;  2D0A A;  3F9K A;  3HST B;  4HUE A;  2EX3 A;  1HYZ A;  3S3O A;  4KI4 A;  4M3W A;  3HM9 A;  3KLE A;  4AHU A;  1NK0 A;  3RR8 A;  3K5M A;  3ZT2 A;  1KVC A;  4KFB A;  1C1B A;  5CZ1 A;  1TVR A;  5EU7 A;  3PO4 A;  5SWM A;  2QK9 A;  3V9Z A;  3KD5 E;  4RG8 A;  4CEC A;  1JXB A;  4OGE A;  1JLB A;  4IBN A;  4BWM A;  5C42 A;  1ITG A;  4W5Q A;  4O44 A;  3ZSV A;  5HRS A;  3D0P A;  1RBS A;  4DS5 A;  4IG3 A;  3L2V A;  3MEG A;  1NK9 A;  1Q9X A;  3OYF A;  2OPP A;  1WSG A;  2Q3S A;  1TAU A;  4CGH A;  4OLB A;  5SZT A;  3O4Q A;  4KHS A;  4I7F A;  4FZY A;  2IAJ A;  5J2M A;  1GOA A;  1NK7 A;  3VQQ A;  4JRP A;  4CES A;  3DLH A;  3AA3 A;  2FBV A;  3SV4 A;  3I0S A;  5J1E A;  4DSJ A;  3TAQ A;  4H8K A;  3CFR A;  1JL1 A;  4BDP A;  4LSN A;  3NF8 A;  3VA0 A;  3AA2 A;  4RW8 A;  4CHN A;  4DQS A;  4FJG A;  1QE1 A;  1RT6 A;  3IG1 A;  3QLH A;  1IO2 A;  3K5O A;  2KFN A;  3AVL A;  3SNN A;  2DY4 A;  1JLC A;  2DFF A;  1RDA A;  2LSN A;  2X6N A;  3RWU A;  2D5R A;  1TK5 A;  2E6M A;  4M3T A;  4Q0B A;  1RT4 A;  2HHS A;  4KPY A;  4HUF A;  3SUQ A;  2W42 A;  4DQP A;  1C0U A;  3ASM A;  4FK4 A;  1ASV A;  1HRH A;  4DTP A;  3TAP A;  4F3T A;  4M42 A;  2HHX A;  1CLQ A;  5HP1 A;  4FJL A;  4FVM A;  3AVN A;  3T19 A;  4E19 A;  4YFU A;  4M45 A;  4W5O A;  3OYB A;  3QIN A;  3V9X A;  4PUO A;  3OY9 A;  1LWC A;  1CZB A;  3AO1 A;  3MAQ A;  4RW9 A;  3LAN A;  2GUI A;  3DM2 A;  4IG0 A;  1NK8 A;  4B9U A;  4DSK A;  4W5N A;  1RBT A;  4CHO A;  3OYH A;  1B9F A;  3SUN A;  1UAX A;  1UWB A;  3ZSW A;  1YTU A;  2F96 A;  4CHY A;  4KTQ A;  4DTR A;  3ZSR A;  3LP2 A;  4IDK A;  1JKH A;  4DMN A;  5E41 A;  1FKO A;  4DSL A;  1D5A A;  4DQR A;  3V9S A;  1S6Q A;  2Y1J A;  1HYS A;  3U3Y A;  3TAG A;  2A1S A;  1C6V A;  1DTQ A;  4M3X A;  4PY5 A;  1S1U A; 
#chains in the Genus database with same CATH topology
 5AQM A;  4N41 A;  3C6T A;  2KTQ A;  3DXM A;  3LP3 A;  4QCL A;  2YHB A;  4DU3 A;  3THY A;  4W5T A;  3DJC A;  4KBO A;  3HL8 A;  2B4J A;  3DOK A;  4ELU A;  2RHK A;  2UYT A;  3ALY A;  3OYJ A;  1Q81 O;  3NGY A;  4DTM A;  4A62 A;  2PFU A;  4O4G A;  2QEX N;  4LFC K;  5JS1 A;  4X66 K;  1WNS A;  2O8C B;  2OTJ N;  3I8B A;  1YAG A;  1I39 A;  2NRT A;  5AQZ A;  4B9M A;  4DQ8 A;  5ELZ A;  4IEE A;  1JL2 A;  3MXM A;  4CFC A;  4CD1 A;  4CBU A;  4A2B A;  3B6P A;  1NGJ A;  2VG7 A;  1WSE A;  3DLB A;  4H0X B;  4CD3 A;  3VQD A;  4CEZ A;  1NU0 A;  4DV1 K;  5M1F A;  3NVM A;  1HR0 K;  1N33 K;  4E1J A;  4I2Q A;  4WE1 A;  3KK7 A;  1NJX A;  5HRP A;  1YHQ N;  4B9V A;  3OVN A;  1Q82 O;  4C8N A;  4DF8 A;  3HBT A;  5T7B A;  3ENB A;  1ZC6 A;  2KLA A;  4OKK A;  2E1Z A;  3O9Q A;  4H0P A;  4J2D A;  4FWP A;  1F21 A;  1SKR A;  1GOC A;  1S9G A;  2R7Y A;  4CEE A;  4BRO A;  4NCA A;  3SLC A;  3L2R A;  1QQC A;  3QBW A;  5GIP A;  1QSY A;  1GLL O;  3D6R A;  4YNQ A;  4YDU C;  2A42 A;  4IDH A;  4FJJ A;  4FJK A;  3L2W A;  2NZT A;  1EWR A;  2ITM A;  4CJQ A;  4HVJ A;  4DUZ K;  4IJA A;  1WSF A;  3IFR A;  1WOQ A;  2IOC A;  4FXD A;  2HBM A;  3VES A;  3ZLJ A;  2P1J A;  3T1A A;  3WXI A;  5FDL A;  3ZX0 A;  1HNX K;  4GKJ K;  1Q9Y A;  1VQP N;  4KV8 A;  3CCS N;  3DXK B;  3FGU A;  4LFA K;  1ZBH A;  4KHW A;  4OPA A;  1BI4 A;  3D7E O;  1LWF A;  3OS1 A;  2JWK A;  3HVR A;  3U3G A;  4JK8 A;  1XHX A;  1O1W A;  4NXN K;  3IS9 A;  2VGN A;  4JHD B;  2HBL A;  1W97 L;  4B1Y B;  1YVN A;  3K9K A;  4LD0 A;  3LP1 A;  3WXM B;  1GLE G;  4CZM A;  4FJM A;  4JKH A;  5AQJ A;  1Y97 A;  3G10 A;  3QEV A;  4CZG A;  4FW1 A;  3B8A X;  3JXU A;  4BQL A;  3SPZ A;  5GIN A;  4XIU A;  1EQY A;  4UQG A;  1T6D A;  5KGW A;  2FXU A;  4LF7 K;  3ID8 A;  4Z4C A;  1HNI A;  4PWD A;  3T7Z A;  5JS2 A;  3RRH A;  4XH1 A;  3T69 A;  4MO4 A;  4WQ4 C;  4Z94 A;  5I9E B;  3PLA A;  5C24 A;  1JLA A;  4H5V A;  1NGA A;  4BAC A;  4CER A;  4LFB K;  2PY5 A;  2P51 A;  4IJN A;  1U4B A;  4Z4I A;  1N5Y A;  4Z0U A;  2BE2 A;  1XUP O;  4F8R A;  4BR0 A;  4DB3 A;  4KB0 A;  4FLV A;  4PHT X;  1DT9 A;  4JKG B;  5M1P A;  3FZK A;  1ZBS A;  4Y0W A;  1VQN N;  4DTS A;  3HJF A;  2RN2 A;  3G0Z A;  4CJL A;  3KIO A;  3S9H A;  4FM2 A;  5F2R A;  3LAL A;  1YXQ A;  4B3R K;  1W0H A;  1KVA A;  2NLX A;  3VEO A;  3NAE A;  1XNR K;  1J6Z A;  2OYQ A;  1NGF A;  1L3S A;  2HW3 A;  4JI3 K;  2E20 A;  2ITG A;  4CJ3 A;  4YHH K;  2VYP A;  1BA1 A;  4PL7 A;  1L5U A;  4FK0 A;  1BOT O;  1KRP A;  1VQ9 N;  2YCH A;  3SUO A;  4DTN A;  5CR4 A;  3QFP A;  4K8X A;  3Q7B A;  3CCU N;  2ETJ A;  2WC9 A;  3FLC O;  4FK2 A;  1XMO K;  4C1N I;  4L8R B;  3AVF A;  4O0I A;  1L3U A;  4X65 K;  5FPN A;  4O5F A;  4CGF A;  4K42 A;  2D0O A;  5B8H A;  2OZM A;  1C0M A;  3RMB A;  4WFA L;  3WNF A;  5HRO A;  4AHV A;  2QW9 A;  1SUQ A;  4NB4 A;  1LW0 A;  3VOV A;  4I6M B;  3LZI A;  3T1H K;  2QWL A;  1O13 A;  3ZT4 A;  2HHU A;  4FZZ A;  3ZX2 A;  1XWL A;  4CJK A;  5BRE A;  1BIZ A;  2B6A A;  2O8E A;  3FZM A;  4J2E A;  4I9Q A;  4O8K A;  1BIU A;  4H4M A;  3EY1 A;  1TV6 A;  1W7A A;  3P1G A;  1BHL A;  5AQG A;  3AAQ A;  4LC9 B;  4CGG A;  2ZQB A;  3NF7 A;  3NHG A;  3GBT A;  2ZWH A;  2F7T A;  3UE5 A;  2QWO A;  3CJC A;  1NJZ A;  3F73 A;  3L6Q A;  4F4K A;  1XHZ A;  4A5A A;  3O5B A;  2YHA A;  5AQK A;  2I7N A;  3ZEU A;  3TAE A;  1FK9 A;  3FZH A;  5JMV A;  3O9R A;  3TSP A;  3VQ7 A;  4KHN A;  3OJU A;  4JLH A;  3SYZ A;  5A2Q O;  2G8U A;  4ZTJ A;  3OYA A;  3CI5 A;  3HSC A;  2CGK A;  1IH7 A;  4DF4 A;  5EOY A;  2HF3 A;  3CCR N;  3KD1 E;  3MEE A;  1YJW N;  2P9N B;  3DXM B;  3ZSQ A;  1VQ5 N;  4FL9 A;  4B3S K;  2HVH A;  4JEP A;  4CJ4 A;  3JAM O;  3RMA A;  4CW7 B;  3VQ6 A;  5D3G A;  3NF6 A;  1DTT A;  3NGZ A;  4NYN A;  1NKB A;  5FPD A;  1U2V B;  1VHX A;  2P9I A;  3MWT A;  4DFK A;  3VF2 A;  1RIL A;  1NMN A;  4FWR A;  3CPW M;  4KB1 A;  4TSX A;  3ULD A;  3E9L A;  5FRM A;  4BC5 A;  2YNG A;  1GLA G;  4HTU A;  4BDZ A;  3U6F A;  2QKK A;  1X9J A;  5C15 A;  3NH1 A;  4K0K K;  2Z1J A;  2OZS A;  3E9P A;  1VSK A;  1EP4 A;  2EWS A;  2KZM A;  3ZEU B;  4FM0 A;  4BRN A;  4FWS A;  4MLE A;  3TU5 A;  2PAV A;  2QM1 A;  2D0C A;  4JN4 A;  2GWJ A;  1NBW A;  1RT2 A;  3S3O A;  2EX3 A;  3W3D A;  2O8B B;  3MMV A;  4AHU A;  3RR8 A;  5BN8 A;  3K5M A;  4ILJ A;  3ZT2 A;  5BRD A;  3QIC A;  5EU7 A;  4PKG A;  2P9U A;  4IBN A;  4BWM A;  1ITG A;  3D0P A;  3CC4 N;  1ATN A;  1RBS A;  5AQX A;  3BP8 A;  1ILY A;  1DKG D;  3U9Z A;  3OYF A;  4OLB A;  1KXP A;  4BC4 A;  5BRH A;  4I7F A;  1GOA A;  4JRP A;  4BRA A;  3SV4 A;  3I0S A;  5J1E A;  5ADX H;  5BR9 A;  3CFR A;  4QS7 A;  1NJI O;  1ATR A;  4LSN A;  3NF8 A;  3SMP A;  3VA0 A;  4FJG A;  3EN9 A;  1QE1 A;  3THX A;  2VQE K;  5M1Q A;  3K5O A;  2KFN A;  3CJ1 A;  3AVL A;  2UU9 K;  3KWI A;  2DFF A;  2LSN A;  3RWU A;  4GV6 A;  4JI6 K;  2E6M A;  4Q0B A;  1KQS M;  4DQP A;  1Z05 A;  3TAP A;  1CLQ A;  3BZK A;  4M42 A;  5JVH L;  4RCH A;  5HP1 A;  3GDQ A;  4JI7 K;  3ULE A;  3QIN A;  1GLJ O;  2NRZ A;  3QDK A;  3OY9 A;  1LWC A;  4RW9 A;  2GUI A;  4OX9 K;  1HKB A;  1KC8 O;  4W5N A;  1RBT A;  1N32 K;  1UAX A;  1UWB A;  2CH5 A;  4CHY A;  5E41 A;  2E1Y A;  1FKO A;  4DSL A;  4DQR A;  2Y1J A;  3U3Y A;  2UXD K;  4B1U B;  2FF6 A;  4FJX A;  2O8B A;  4DV5 K;  2A5X A;  3E9O A;  4DKW A;  5C2D A;  2NRR A;  3RR7 A;  3TR8 A;  2NRW A;  1BO5 O;  3DRR A;  3LPU A;  1RDC A;  1RTI A;  4ISF A;  2EHG A;  3CYM A;  4DCH A;  3SJJ A;  2GWK A;  1JLQ A;  1JLF A;  1B92 A;  3AAR A;  4JI8 K;  3SAF A;  2QWR A;  3QIO A;  5JLF A;  4XEI A;  1NGG A;  3H1Q A;  5KI6 A;  3HPG A;  4N47 A;  4ID1 A;  3VER A;  3LP0 A;  3RVC A;  3OYD A;  1QQN A;  2QWM A;  2HMI A;  1C0F A;  4JD2 A;  3VEZ A;  1TK0 A;  1K8A O;  3IAY A;  3H3O B;  4CEF A;  4BR7 A;  5TKW A;  2ZE2 A;  3S41 A;  1CZ9 A;  4JI1 K;  3WXK A;  5BN9 A;  3KK3 A;  4JKG A;  4IFE A;  1R0A A;  1BA0 A;  2JWL A;  4DSK A;  3O8M A;  4CJR A;  3PY8 A;  4DLE A;  3WQT A;  3CQX A;  5KQD A;  3BY5 A;  3QNN A;  3WXJ A;  5F1X A;  1IG8 A;  4BE0 A;  1U04 A;  4BRM A;  4BRE A;  3VGM A;  3G6E N;  4B1W B;  2V7Z A;  4CFD A;  2VWJ A;  3CFO A;  4BGB A;  1ASW A;  3RSE B;  2HB5 A;  4FPB A;  1VQK N;  4H5W A;  2WON A;  3P5J A;  1OH5 A;  5GAH P;  3NFA A;  4XH5 A;  4CVN E;  4CJE A;  1RT5 A;  1Y64 A;  3OYE A;  1ESV A;  3VQ5 A;  4DR6 K;  2GEM A;  4H5N A;  2RF2 A;  4M3Y A;  4B08 A;  4NCB A;  3O80 A;  1WAJ A;  2UXB K;  2YJE A;  1HLU A;  3K59 A;  1EKE A;  1CXQ A;  5KRS A;  1VQL N;  2ZGY A;  3T3F A;  1C1A A;  1S1T A;  1SQK A;  5AQO A;  4DSI A;  2VWB A;  1JLG A;  5AQU A;  3NGI A;  2Q36 A;  3HYF A;  1HUX A;  3LDO A;  2IVN A;  4B9T A;  1X1P A;  3EKS A;  3WUH A;  3NH0 A;  4DQI A;  3AVC A;  2HOE A;  1NOZ A;  3F2K A;  3MWP A;  4BC2 A;  1VQO N;  2E2P A;  3CCQ N;  1DLO A;  4JKD A;  2VWK A;  1YI2 N;  4HWI A;  4KRF A;  4IOA L;  5FRN A;  1HNV A;  4HCC A;  4JKF A;  2O4G A;  2PYJ A;  4CHQ A;  1JCE A;  3IMX A;  1I94 K;  2ZJQ L;  4IOC L;  2QKB A;  3DOL A;  2F8S A;  1JCF A;  3WNE A;  3AGR A;  3CCV N;  3UKR B;  2V7Y A;  5F0X A;  3FFI A;  3WT0 A;  4H0T B;  5CE3 A;  1M1K O;  4A2A A;  3BZC A;  3L4Q A;  4BRH A;  3HOS A;  1MU2 A;  1K6Y A;  1RNH A;  4C8O A;  3VGL A;  2I7P A;  4BG8 A;  3OYG A;  4O8U A;  4YOV A;  1CXU A;  2Q1N A;  2KFZ A;  4PA1 A;  5KTQ A;  1U47 A;  5EY4 A;  4HHT A;  4FWO A;  4OJR A;  4CBW A;  1TKD A;  2P5O A;  4CK1 A;  1NOY A;  1HJO A;  1K8K B;  3BF1 A;  5LY3 A;  3D2E A;  5HBM A;  3LZJ A;  4M3Z A;  2AP1 A;  2E4L A;  5AQQ A;  3SQ1 A;  4NYF A;  3TPQ A;  1J9A A;  5AQF A;  4B9Q A;  1XI1 A;  1YVU A;  3MXJ A;  4EP4 A;  4W5R A;  2NUB A;  4FLY A;  2HNY A;  2Q0R A;  3AO3 A;  4E7K A;  4BVP A;  2O8C A;  3VEW A;  4KHY A;  1SL0 A;  4LH4 A;  4H0O A;  4FJ8 A;  3VPZ A;  3TAR A;  2YJF A;  3WEE A;  1NK6 A;  4LF5 K;  4DU4 A;  4DG1 A;  2XY5 A;  4DV2 K;  1KAX A;  3K57 A;  2W41 A;  1SL2 A;  1DEJ A;  4Z4F A;  3MCA B;  3VN5 A;  4DWI A;  2BH1 A;  3K5L A;  5E26 A;  3SUP A;  4FJ5 A;  1U2V A;  5AFU H;  3L2U A;  5AQV A;  1C1C A;  2ASP A;  3WNH A;  2HVI A;  1IKX A;  5AQT A;  4LF9 K;  4KAZ A;  1L3T A;  3H08 A;  4BGA A;  1C0G A;  4BWJ A;  3C95 A;  4Z4G A;  5TKY A;  2HND A;  3VQ9 A;  4YOW A;  3F5T A;  4FWK A;  4GV3 A;  4BRI A;  1MWM A;  3LL3 A;  4X64 K;  2GV9 A;  1KLN A;  3LWL A;  1TGO A;  2YNH A;  3ZYY X;  5CY4 A;  2FLO A;  4ILH A;  3KK2 A;  3P4I A;  3NE6 A;  3KKR A;  4R79 A;  5KPZ A;  1OH8 A;  4FJ9 A;  1NK5 A;  4WQ5 A;  5AQI A;  4AM7 A;  4AHS A;  2BDP A;  3V1R A;  1NJW A;  2NRV A;  2Y1I A;  4F2S A;  3WEE B;  1ZBI A;  3CCM N;  4BVO A;  3AVA A;  4AHT A;  5AQN A;  4OPJ A;  1T05 A;  3LDL A;  1S1X A;  4O0J A;  1JLE A;  2D0B A;  4CJW A;  4NXM K;  3M8R A;  1T44 A;  4E7H A;  5KPR A;  1EO1 A;  3C94 A;  2VQF K;  3O1W A;  4FLW A;  1BWF O;  1EET A;  3ENO A;  2XY8 A;  5AQR A;  4BRK A;  2GTD A;  3SBG A;  2OA8 A;  1UOC A;  3OYI A;  3LPT A;  4CF0 A;  3DLE A;  5FRO A;  3CET A;  3BDP A;  1VSE A;  2P9S B;  1Q8I A;  3PIP L;  3CD6 N;  1WSJ A;  1GLC G;  4KI6 A;  2X74 A;  1Q18 A;  1A5V A;  1S6P A;  4IKF A;  3PIO L;  1YIJ N;  2WOM A;  4O5B A;  4DQQ A;  1FW6 A;  3MX2 A;  4F3O A;  3AVK A;  2Q2R A;  4DR4 K;  3KWG A;  3EKU A;  3J7Z O;  3HK2 A;  3NBP A;  2E88 A;  3MED A;  4CFB A;  1LWE A;  4OLA A;  1LV5 A;  4CK3 A;  3J7A P;  3F9M A;  1WB9 A;  5IWA K;  3AO5 A;  4JNE A;  2HBJ A;  2Z1I A;  4GY2 B;  1NJY A;  1JJ2 M;  1B9D A;  1P90 A;  1HQE A;  1NM1 A;  4CCH A;  3IRX A;  4NO7 A;  3VGK A;  4BRF A;  1VQ4 N;  1J54 A;  1HQU A;  3LWM A;  2A3Z A;  2WUS A;  5AFU A;  4KTZ A;  4CHZ A;  2BGG A;  5C10 A;  1RDB A;  4CGD A;  1X9W A;  3EL2 A;  1TL1 A;  4KH5 A;  2KZZ A;  2F4V K;  3QEI A;  3RMC A;  1VRU A;  4BR9 A;  5HRN A;  4E7J A;  3FE1 A;  4BG9 A;  2BTF A;  4Z4E A;  2D0A A;  1HYZ A;  3D2F B;  1KVC A;  5CZ1 A;  3NMU A;  1TVR A;  4V19 S;  4K41 A;  4GKK K;  1XNQ K;  1XMQ K;  3KD5 E;  1X3N A;  4RG8 A;  5JVG L;  2AA4 A;  3A5O C;  4O44 A;  5HRS A;  4H0V B;  4CZI A;  3L2V A;  4WFN L;  4L3Q A;  4MO5 A;  2OPP A;  2Q3S A;  3KZB A;  3OBY A;  5SZT A;  4DV3 K;  4KHS A;  4FZY A;  2IAJ A;  2GUP A;  4BRP A;  3TAQ A;  4H8K A;  3H1V X;  4BDP A;  2QTD A;  5AZI A;  2VCP A;  1N34 K;  1VAZ A;  5ADX A;  1QZ5 A;  2W40 A;  1IO2 A;  2D4W A;  4J8F A;  3A0I X;  4X62 K;  4B3M K;  3SNN A;  2DY4 A;  1JLC A;  2X6N A;  1RDA A;  1RT4 A;  2HHS A;  4HUF A;  2FF3 B;  1WUA A;  1C0U A;  4B3T K;  2A41 A;  3CJ7 A;  3DWL A;  4BC3 A;  4W5O A;  3V9X A;  1XC3 A;  3O4W A;  3VF4 A;  4H5R A;  1TUY A;  3DM2 A;  4JHD A;  4B9U A;  5AQP A;  4JK7 A;  3OYH A;  1B9F A;  1YTU A;  2F96 A;  4DTR A;  4DR3 K;  3T1Y K;  3V9S A;  2IIR A;  2A1S A;  4M3X A;  2HHT A;  1S1W A;  3QEX A;  1I3A A;  1SKS A;  3V9W A;  1NLV A;  3PV8 A;  4BRQ A;  2W6L A;  3JS6 A;  2PBD A;  2E8A A;  1J5O A;  2Q97 A;  2BAN A;  3O9T A;  3JYT A;  1K9M O;  1WSH A;  4EHT A;  3DMJ A;  2CGL A;  3QBX A;  4CEO A;  2GBZ A;  3KJV A;  2B5J A;  1QVG M;  3LAM A;  2UUC K;  3E1Y A;  3E66 A;  5FPM A;  4I2P A;  5AZJ A;  4ZTF A;  3CC2 N;  1N6Q A;  4JI2 K;  5AQS A;  2XY6 A;  1KVB A;  1IKY A;  1VSF A;  2YX6 A;  4LSL A;  4GW6 A;  4KTW A;  3JSM A;  2P9N A;  3U4L A;  4I9L A;  1X9S A;  1TKX A;  2P9K A;  4IZ9 A;  3FFK B;  3MN5 A;  4CJT A;  1EX4 A;  1TKT A;  3HPH A;  1NGH A;  4E89 A;  1QSS A;  3AVB A;  5AQW A;  3TSQ A;  4B1Z A;  5C12 A;  4B9L A;  4FVU A;  4MLH A;  4LY7 A;  3R1X A;  4PKI A;  3HXM A;  1VQM N;  1S5J A;  4CIF A;  3MXI A;  1XQS C;  4YOR A;  3THV A;  3C6U A;  1G15 A;  1TYQ A;  4CJ5 A;  3DRP A;  3LM2 A;  1EXQ A;  4C23 A;  2G8K A;  3DLL L;  4CI6 A;  4B1V A;  4DV6 K;  3I8D A;  3OS0 A;  3NF9 A;  3LDS A;  4OPK A;  3TTC A;  3TWH A;  4K25 A;  3R3L A;  2Q31 A;  3G4S N;  1RT1 A;  1E3M A;  4CJV A;  5AZJ B;  4CJP A;  2W6K A;  3K9J A;  3O08 A;  3S3M A;  3OYC A;  3UKU B;  1YT3 A;  1YIT N;  3ZET B;  1BG3 A;  3RRG A;  3HVT A;  4JS4 A;  1X3M A;  1N8R O;  3RMD A;  1T03 A;  1JXE A;  1Z6R A;  3P39 A;  1FJG K;  3UIQ A;  1S1V A;  3AA4 A;  1SAZ A;  3SMS A;  5KGX A;  2E2Q A;  4IFV A;  5DK5 A;  3ID6 A;  3QNO A;  4M63 C;  2ZGZ A;  1VSM A;  4DR5 K;  4DFM A;  1U45 A;  3NCI A;  3CME N;  3N4P A;  2OPR A;  3BEX A;  3CMA N;  3G25 A;  4DLG A;  1VSH A;  2XHB A;  4JKA A;  4YOU A;  5LL6 Z;  3A5L C;  3P83 D;  3EE9 A;  4E1M A;  3A8Y A;  1S9E A;  4Y1C A;  3CCL N;  3CXC M;  1N36 K;  4C8K A;  4N56 A;  3SCX A;  1ASU A;  3I33 A;  1ZYQ A;  4CE9 A;  3HPO A;  1BQM A;  3VQC A;  4EHU A;  4AF1 A;  4BR5 A;  2O8E B;  4KHU A;  3O1B A;  3LDN A;  5AZI B;  4RW7 A;  1LAW A;  3HTV A;  4DR2 K;  2UUB K;  2GX9 A;  3PX0 A;  4FYD A;  2P5G A;  4LF4 K;  3DLR A;  3MEC A;  2ASM A;  2IVO A;  3MK6 A;  2FSK A;  1RTJ A;  4BRL A;  2P9P A;  4CZJ A;  3OYL A;  4JK9 A;  1VSL A;  4GV9 A;  4NCG A;  4DR1 K;  3SAG A;  1D9F A;  4FOE A;  3V1Q A;  1HX1 A;  4GNI A;  3HP6 A;  2YNF A;  3IKM A;  3KLI A;  4WF9 L;  3HI0 A;  3KLF A;  1ATS A;  2I5J A;  2YV0 X;  3TTD A;  3KTQ A;  1IKW A;  2VG6 A;  4WYB A;  3AO4 A;  3AO2 A;  2OTL N;  3OS2 A;  5CYQ A;  3UB5 A;  3V6D A;  5KRT A;  2WBN A;  3QEW A;  3CJA A;  2F9W A;  2ZJP L;  1JCG A;  4EZ6 A;  1HNW K;  1RBU A;  3CJB A;  5BPN A;  4BE1 A;  4G1Q A;  5JLH A;  2QWP A;  3BUZ B;  4JYA K;  3VQ8 A;  3KLH A;  5DMR A;  4ZHR A;  4E1N A;  3O3H A;  1BQN A;  3IDH A;  3EZ5 A;  2Z1H A;  1CZA N;  3QER A;  5EX5 A;  3SBT A;  1KFD A;  3LAK A;  5DM6 L;  3KLG A;  2XO7 A;  5AR0 A;  4DV7 K;  3AA5 X;  3AAP A;  5EXW A;  4B8C A;  1YJN N;  1ZXO A;  3DXK A;  2WFB A;  3AVG A;  4HTL A;  1NGB A;  2O8D B;  1HYV A;  4ICL A;  3KK1 A;  3THW B;  1NKC A;  4RWT A;  1QTM A;  4CEA A;  4J2B A;  2HHQ A;  3P38 A;  1T3V A;  3B6O A;  1M90 O;  3D2F A;  3CM6 A;  3ZT3 A;  4A59 A;  4HUG A;  4I6M A;  2RE2 A;  3THX B;  3AGK A;  3UKU A;  2DTU A;  1S3X A;  3MN9 A;  3OYN A;  3IUC A;  1QSL A;  4F9O A;  3CC7 N;  3QFU A;  3TAB A;  1RTD A;  4C8M A;  1HPZ A;  2ZD1 A;  5HOO A;  2P9U B;  2FSJ A;  4FO0 A;  1J5E K;  3VTI A;  4DV4 K;  1IBK K;  4ILG B;  3K2P A;  1D9D A;  4AQY K;  3I55 N;  3HZ6 A;  2F8T A;  5BRF A;  1KAZ A;  1KLM A;  4ID5 A;  3J80 O;  4M3R A;  2HF4 A;  1OVQ A;  4A57 A;  3PSF A;  4H0Y B;  3EEQ A;  3L3V A;  1VQ7 N;  4ISE A;  4LF8 K;  1QQO A;  1KAY A;  3BGR A;  4Z4H A;  2OPQ A;  4E7L A;  3CG7 A;  2HNZ A;  2IGI A;  5AQL A;  4YOT A;  4JI4 K;  3TAN A;  3O9S A;  3ZT0 A;  4E0D A;  1RT3 A;  1E4F T;  1NNE A;  4HCB A;  4DU1 A;  3MCP A;  2X6S A;  4RW4 A;  4DTJ A;  3MDQ A;  4DTU A;  1BGX T;  4BRD A;  1RTH A;  3HO1 A;  3H46 O;  4CIG A;  3QES A;  2G8H A;  4OPH A;  4FLT A;  1P8Z A;  5GAE P;  1TKZ A;  3L4I A;  5BPM A;  1Z26 A;  1J53 A;  1YTA A;  5J2N A;  4BR4 A;  2QWQ A;  3DLK A;  3OYK A;  3M8P A;  3HOT A;  2P9L B;  3I56 N;  1YUW A;  3M1F A;  1Z25 A;  5GAG P;  4F3T A;  4N76 A;  3TI0 A;  2OCE A;  4DUY K;  3C0B A;  4AIL C;  4FJH A;  1DGK N;  2QI2 A;  4DFP A;  3TSU A;  4JKB A;  4O55 A;  4DFJ A;  5MLC Q;  5I3U A;  4EZ9 A;  1RDU A;  3HM8 A;  4JD2 B;  1XC9 A;  4EP5 A;  2E2N A;  1IBL K;  4LH5 A;  4CBX A;  4CF2 A;  1QHA A;  4A5B A;  3MX5 A;  4CJS A;  1SV5 A;  3OA9 A;  4DS4 A;  4CK2 A;  4CHP A;  4CF9 A;  1RT7 A;  5LJV A;  1WN7 A;  2E2O A;  1IG9 A;  4FPA A;  3CFP A;  3PX6 A;  2G8V A;  5JIC A;  2O8F A;  2QXF A;  3EO3 A;  3AVI A;  2KQ2 A;  2DPN A;  2V52 B;  5I42 A;  1MWK A;  5GAD P;  4HUE A;  4KI4 A;  4M3W A;  3KLE A;  3FR0 A;  4A61 A;  4IO9 L;  5E84 A;  1NK0 A;  3PO4 A;  5SWM A;  3CHW A;  3V9Z A;  4W5Q A;  4DS5 A;  2A6A A;  1Q9X A;  1WSG A;  2D0P A;  4CGH A;  1TAU A;  1GLF O;  5FPE A;  1U6Z A;  3U9D A;  1OH7 A;  2UXC K;  3AA3 A;  2FBV A;  3AA2 A;  4RW8 A;  5C0Y A;  3L0Q A;  4M7Y A;  4BR2 A;  3HRG A;  3VET A;  3WQU A;  3VEV A;  1YJ9 N;  1VQ6 N;  3THW A;  1TYQ B;  4KPY A;  1QZ6 A;  3H3N O;  3SUQ A;  3ASM A;  3MN7 A;  1ASV A;  4FK4 A;  2HHX A;  2HST A;  4FJL A;  4FVM A;  3AVN A;  3T19 A;  4M45 A;  3OYB A;  4PUO A;  3R9P A;  1CZB A;  3DAW A;  3MAQ A;  4IG0 A;  4CHO A;  3SUN A;  3H45 C;  1W2B M;  3ZSW A;  4CZH A;  4EFH A;  1V4S A;  4IDK A;  2O8F B;  1JKH A;  4K43 A;  4DMN A;  1D5A A;  1Q7Y O;  1C6V A;  4PY5 A;  1S1U A;  3NDK A;  4KKO A;  2YHY A;  1GLB G;  2YKN A;  1D4X A;  2E6L A;  3VEN A;  3DI6 A;  5HL7 L;  1UA0 A;  1VQ8 N;  2IVP A;  5C2F A;  3D2E B;  1E4G T;  4FOI A;  4R5P A;  3ZT1 A;  5KPT A;  4WQ4 A;  4QAG A;  3ZSX A;  1HJR A;  3SQ0 A;  4GVE A;  2YNI A;  2D1K A;  4KHQ A;  4H4O A;  3QET A;  1NK4 A;  3VEY A;  3L3U A;  5HRR A;  4DTO A;  1VSD A;  3R8E A;  4E7I A;  3D45 A;  1Q86 O;  4CF1 A;  1LAV A;  4IFY A;  1HKG A;  1MDU B;  3HT3 A;  4JI0 K;  2HHH K;  1RFQ A;  1S22 A;  2ZF5 O;  3CCE N;  4MDA A;  3ZSZ A;  5C25 A;  3K5N A;  3DLH A;  4CED A;  1ZBF A;  2FBY A;  1NGE A;  1H1V A;  3LDQ A;  2HHW A;  3QB0 A;  1SS6 A;  4KHP K;  5CHI A;  4M41 A;  1FXX A;  3EYZ A;  3VTH A;  3A5N C;  2G8F A;  4CEB A;  4BY9 C;  1SZ2 A;  3VA3 A;  1A5X A;  4PQU A;  3KKS A;  4OO1 J;  1REV A;  5J2P A;  3V9U A;  4CZK A;  3EZW A;  3ZSY A;  5KQ8 A;  1UA1 A;  3GE1 A;  4YY3 K;  4FM1 A;  4YDU A;  3HP9 A;  2YHW A;  3A2F A;  2A40 A;  3MN6 A;  1NGD A;  3VQ4 A;  3P31 A;  4JI5 K;  4NLC A;  4J2A A;  5CZ2 A;  1G99 A;  4RW6 A;  3CJ9 A;  5J2Q A;  3OYM A;  3E01 A;  3SQ4 A;  4AH9 A;  3O3G A;  1KSP A;  1BU6 O;  4B9S A;  3ULE B;  1VSJ A;  3SK3 A;  4YOY A;  2ZM6 K;  3DLG A;  4JRQ A;  1K73 O;  5BPL A;  1BCO A;  3VQB A;  4CF8 A;  2YKM A;  1BI4 B;  4OVL A;  5M1O A;  4IO8 A;  2O4I A;  1FKP A;  3CF5 L;  1KFS A;  2XRI A;  3PO5 A;  4DSF A;  4FCY A;  4U67 L;  2JLE A;  2PZS A;  2KKZ A;  3BF3 A;  1IJJ A;  1WLJ A;  5AQH A;  3R6M A;  4BDY A;  2HMP A;  4YOX A;  5CYM A;  3KVG A;  3OW2 M;  1HKC A;  1OVY A;  2Q0U A;  4H5T A;  3WNG A;  3A5M C;  4XH4 A;  1GOB A;  4F2R A;  4MDB A;  4DR7 K;  3CQY A;  3DRS A;  5K14 A;  2PYL A;  1OKJ A;  1LOT B;  4FJI A;  1IKV A;  1IBM K;  4B3O A;  2KW4 A;  3M8S A;  2HBK A;  4CIE A;  4FJ7 A;  1OH6 A;  3V4I A;  4CJF A;  2V51 B;  2QWN A;  3QML A;  4CGI A;  3UKR A;  3SV3 A;  3EE8 A;  4C8L A;  1VK0 A;  3VMF B;  4ELT A;  4CZL A;  5HLF A;  1T6C A;  3VF6 A;  1NKE A;  1KCF A;  4KO0 A;  2J4R A;  4IWV A;  4BE2 A;  2XY7 A;  1QHT A;  3QO9 A;  4DV0 K;  1IV0 A;  3K0S A;  3CCJ N;  2ZJR L;  1VRT A;  4FWN A;  4M7X A;  1V4T A;  3ZCM A;  2E5L K;  3C6A A;  4E3S A;  3M5R A;  1WSI A;  5AJ3 K;  1LW2 A;  4Q5V A;  4B8A B;  4QS9 A;  4M3U A;  2FBX A;  4ELV A;  2P9S A;  4KRE A;  1GLD G;  3J81 O;  4FLZ A;  3CQ8 A;  4CZF A;  3AVH A;  4QS8 A;  5LMN K;  3OHR A;  3SZ2 A;  4Y1D A;  2FC0 A;  4FWL A;  3S3N A;  2IC3 A;  3PSI A;  1L3V A;  4FJN A;  4G9Z A;  1NWK A;  4KH6 A;  2YHX A;  2KHO A;  3CPE A;  1RBR A;  4IOX A;  3NH2 A;  1BL3 A;  5EVZ A;  2VGM A;  3V1O A;  5AQY A;  3RTV A;  2OAN A;  3SPY A;  4OGC A;  1ZBU A;  3K58 A;  3GG4 A;  3RSE A;  2DFE A;  4GMJ B;  1RDD A;  4FW2 A;  4B1X B;  3AVJ A;  1TK8 A;  4FWM A;  3O9U A;  1BCM A;  2ASO A;  3ATU A;  3U8X A;  4IXC A;  4H03 B;  3TAF A;  3VEX A;  1R59 O;  3AVM A;  4CJ7 A;  2NRX A;  4ISG A;  2VG5 A;  1BUP A;  2F9T A;  3VQA A;  1EWQ A;  5LJW A;  1VSI A;  5M1K A;  4AHR A;  3PUF A;  1LCU A;  3VQP A;  2X78 A;  3CM5 A;  3KHY A;  1QS4 A;  3ATV A;  4MQ3 A;  3V81 A;  2HHV A;  4N5S A;  3Q7C A;  3SJH A;  4NLB A;  4JS5 A;  1W9H A;  3VQE A;  3I0R A;  4KH4 A;  3TAM A;  4PKH A;  1D8Y A;  1WBD A;  2O8D A;  2FSN A;  4JKE A;  1ZBL A;  4FLX A;  3FZL A;  3O4N A;  4MFB A;  4RTF D;  2IS3 A;  1RCH A;  4BRG A;  3O6W A;  1U49 A;  4CEQ A;  1S72 N;  2BUP A;  1TL3 A;  2P9I B;  1MA9 B;  1C0T A;  1KTQ A;  4JKC A;  1NGI A;  3C7N A;  3TTF A;  2ATQ A;  3CER A;  2JGU A;  5GIO A;  4GVM A;  1T7P A;  2G8W A;  2GEL A;  4CJU A;  4FLU A;  1U48 A;  1RGI A;  2QXL A;  1K8K A;  3SI6 A;  2FBT A;  4U7B A;  2OPS A;  2A1R A;  1BDG A;  3GOI A;  3ENH A;  4OKE A;  2RKI A;  3ZX3 A;  5DM7 L;  2Z1G A;  3DYA A;  4K8Z A;  3L8B A;  4AHC A;  1WBB A;  3O3F A;  3ZSO A;  3ITH A;  4BRC A;  4OKJ A;  5FLX O;  4QOZ B;  3SQ2 A;  1T8E A;  3QEP A;  3FZF A;  4WCE L;  2QA4 N;  1WAF A;  1NG9 A;  2P9K B;  5LMU K;  1HMV A;  3J7Y P;  3M8Q A;  2G8I A;  4FZX C;  3H6E A;  3PX4 A;  1HPM A;  2CGJ A;  4CFA A;  4EAH D;  2WTU A;  3M6G A;  4FWQ A;  4C1N K;  1A5W A;  2RPI A;  4BQZ A;  1SL1 A;  3M3Z A;  3THY B;  1TAQ A;  4JAX A;  2IDO A;  4DSE A;  4CGJ A;  4DTX A;  1SKW A;  5H1S Q;  3LM9 A;  3OJS A;  2H3G X;  2P9P B;  1X9M A;  2DFH A;  3OTO K;  2AJQ A;  2P9L A;  1TUU A;  3QIP A;  2NRH A;  3ISN C;  4B9N A;  3WXL A;  4WQ5 C;  1BIS A;  3C7N B;  3AV9 A;  1RBV A;  4IEI A;  3HST B;  3F9K A;  1QVF M;  3HM9 A;  4UY8 O;  3CIP A;  4KFB A;  1C1B A;  2QK9 A;  4PL8 A;  3G71 N;  4CEC A;  1JXB A;  4OGE A;  1JLB A;  1QQM A;  5C42 A;  3LDP A;  3ZSV A;  4IG3 A;  3MEG A;  4AM6 A;  3W0L A;  4DHY A;  1NK9 A;  3AY9 A;  3J8A A;  2NNW A;  3O4Q A;  3NVK A;  5J2M A;  1NK7 A;  3VQQ A;  4CES A;  4DSJ A;  2YI1 A;  5M1N A;  1JL1 A;  4DQS A;  4CHN A;  3C6H A;  1HNZ K;  1RT6 A;  4JV5 K;  3IG1 A;  3QLH A;  4EIA A;  1NMD A;  4FSV A;  4M3T A;  2D5R A;  1TK5 A;  2W42 A;  3C65 A;  4DTP A;  1HRH A;  4WFB L;  3SAH A;  1NGC A;  4E19 A;  4YFU A;  4CZE A;  3AO1 A;  1RDW X;  3LAN A;  1KD1 O;  3OBW A;  1NK8 A;  3GL1 A;  5IT9 O;  1YF5 L;  3N4Q A;  3ZET A;  2CH6 A;  4KTQ A;  3ZSR A;  3LP2 A;  5BR8 K;  1S6Q A;  1HYS A;  4LF6 K;  3TAG A;  2UUA K;  1DTQ A;  3L2Q A; 
#chains in the Genus database with same CATH homology
 3NDK A;  4KKO A;  2HHT A;  1S1W A;  3QEX A;  2YKN A;  1I3A A;  2E6L A;  3C6T A;  3DI6 A;  3V9W A;  1UA0 A;  1SKS A;  2KTQ A;  3LP3 A;  3RR7 A;  4QCL A;  3TR8 A;  3PV8 A;  4R5P A;  2YHB A;  3ZT1 A;  4DU3 A;  3DRR A;  4W5T A;  3LPU A;  1RDC A;  4QAG A;  3ZSX A;  1HJR A;  1RTI A;  3SQ0 A;  1J5O A;  3HL8 A;  2BAN A;  2B4J A;  2EHG A;  3CYM A;  3DOK A;  3JYT A;  2YNI A;  4KHQ A;  4ELU A;  3SJJ A;  4H4O A;  3QET A;  3ALY A;  1JLQ A;  3OYJ A;  1NK4 A;  1WSH A;  3L3U A;  3DMJ A;  5HRR A;  3NGY A;  4CEO A;  4DTO A;  1JLF A;  1VSD A;  2GBZ A;  4E7I A;  3KJV A;  1B92 A;  4DTM A;  2B5J A;  3D45 A;  3LAM A;  4O4G A;  4CF1 A;  1LAV A;  3QIO A;  4IFY A;  5JS1 A;  3HT3 A;  1WNS A;  4I2P A;  4ZTF A;  5KI6 A;  3HPG A;  1N6Q A;  4N47 A;  2XY6 A;  1KVB A;  4ID1 A;  1IKY A;  1VSF A;  1I39 A;  4LSL A;  4GW6 A;  3LP0 A;  3ZSZ A;  4KTW A;  3JSM A;  4B9M A;  1JL2 A;  4I9L A;  5C25 A;  3K5N A;  4CFC A;  1TKX A;  3OYD A;  3MXM A;  1X9S A;  4CED A;  2HMI A;  1ZBF A;  3B6P A;  4CJT A;  2FBY A;  1TK0 A;  1EX4 A;  2VG7 A;  1TKT A;  1WSE A;  3HPH A;  3IAY A;  5FRN A;  3DLB A;  2HHW A;  4CEF A;  3VQD A;  4CEZ A;  4E89 A;  1QSS A;  3AVB A;  4B9L A;  4LY7 A;  2ZE2 A;  4M41 A;  1FXX A;  3EYZ A;  4I2Q A;  1CZ9 A;  2G8F A;  4WE1 A;  3HXM A;  3KK3 A;  4CEB A;  5HRP A;  1NJX A;  3VA3 A;  4B9V A;  3OVN A;  1R0A A;  1A5X A;  1S5J A;  4C8N A;  4DF8 A;  4CIF A;  4CJR A;  3KKS A;  5T7B A;  4DLE A;  1REV A;  5J2P A;  3C6U A;  3V9U A;  3THV A;  1G15 A;  4CJ5 A;  3PY8 A;  3DRP A;  1EXQ A;  2G8K A;  3QNN A;  3ZSY A;  4OKK A;  1UA1 A;  4J2D A;  4BE0 A;  1U04 A;  3I8D A;  4FM1 A;  1F21 A;  3OS0 A;  1SKR A;  3NF9 A;  3LDS A;  4OPK A;  3HP9 A;  1GOC A;  3TWH A;  1S9G A;  2R7Y A;  4CEE A;  3A2F A;  4NCA A;  1RT1 A;  4CFD A;  3L2R A;  2VWJ A;  3CFO A;  4CJV A;  1QQC A;  4CJP A;  3VQ4 A;  1QSY A;  1ASW A;  4YNQ A;  2HB5 A;  4J2A A;  4FJJ A;  3S3M A;  4FJK A;  5CZ2 A;  3L2W A;  2WON A;  3P5J A;  3OYC A;  4RW6 A;  1YT3 A;  4CJQ A;  4HVJ A;  5J2Q A;  3RRG A;  3HVT A;  3NFA A;  3OYM A;  1WSF A;  3E01 A;  4JS4 A;  3SQ4 A;  4CJE A;  4AH9 A;  3O3G A;  1RT5 A;  1KSP A;  2IOC A;  4FXD A;  3OYE A;  2P1J A;  3T1A A;  3VQ5 A;  4B9S A;  3RMD A;  5FDL A;  4M3Y A;  2RF2 A;  1T03 A;  1VSJ A;  4B08 A;  1Q9Y A;  4NCB A;  1WAJ A;  1JXE A;  3DLG A;  4KV8 A;  4JRQ A;  1BCO A;  3VQB A;  3UIQ A;  1S1V A;  4CF8 A;  3AA4 A;  5KGX A;  2YKM A;  4KHW A;  1BI4 B;  1BI4 A;  1EKE A;  4OVL A;  3K59 A;  1ZBH A;  1CXQ A;  1LWF A;  4IFV A;  5DK5 A;  5KRS A;  1FKP A;  3OS1 A;  3T3F A;  1KFS A;  1C1A A;  1S1T A;  2XRI A;  3QNO A;  3HVR A;  3PO5 A;  1VSM A;  4DSI A;  1JLG A;  4DFM A;  3U3G A;  1U45 A;  3NGI A;  2KFZ A;  4DSF A;  3NCI A;  4FJX A;  4FCY A;  2OPR A;  3HYF A;  2JLE A;  4B9T A;  1X1P A;  1XHX A;  3NH0 A;  2PZS A;  4DQI A;  3AVC A;  1O1W A;  3IS9 A;  1WLJ A;  4DLG A;  1VSH A;  2XHB A;  1NOZ A;  3P83 D;  4BDY A;  1DLO A;  4LD0 A;  4E1M A;  2VWK A;  3LP1 A;  1S9E A;  4Y1C A;  4FJM A;  4KRF A;  5CYM A;  1Y97 A;  3G10 A;  1HNV A;  4N56 A;  3SCX A;  3WNG A;  1ASU A;  4C8K A;  4HCC A;  3QEV A;  1ZYQ A;  2O4G A;  2PYJ A;  1GOB A;  4CE9 A;  4CHQ A;  3HPO A;  1BQM A;  4F2R A;  3VQC A;  4FW1 A;  2QKB A;  3DOL A;  3SPZ A;  2F8S A;  3DRS A;  3WNE A;  4XIU A;  5K14 A;  2PYL A;  4UQG A;  4KHU A;  5KGW A;  3FFI A;  4Z4C A;  4RW7 A;  4FJI A;  1IKV A;  1HNI A;  1LAW A;  4B3O A;  4PWD A;  2KW4 A;  5JS2 A;  3M8S A;  1MU2 A;  4CIE A;  1K6Y A;  3RRH A;  3PX0 A;  2P5G A;  4FJ7 A;  4FYD A;  3DLR A;  1RNH A;  3MEC A;  4C8O A;  3V4I A;  4CJF A;  5C24 A;  3OYG A;  1JLA A;  2O4I A;  1CXU A;  1RTJ A;  4CGI A;  4PA1 A;  4BAC A;  5KTQ A;  4CER A;  3OYL A;  3SV3 A;  4C8L A;  1VSL A;  1U47 A;  2PY5 A;  2P51 A;  4HHT A;  1U4B A;  4OJR A;  1TKD A;  2P5O A;  4Z4I A;  4NCG A;  1N5Y A;  4Z0U A;  1VK0 A;  2BE2 A;  4CK1 A;  1NOY A;  4ELT A;  4F8R A;  5HLF A;  1D9F A;  5HBM A;  4KB0 A;  3V1Q A;  3LZJ A;  4FLV A;  1NKE A;  1KCF A;  4KO0 A;  4M3Z A;  3HP6 A;  2YNF A;  4BE2 A;  2XY7 A;  1QHT A;  3KLI A;  3KLF A;  2E4L A;  4DTS A;  3HJF A;  3QO9 A;  2RN2 A;  4NYF A;  1J9A A;  3SQ1 A;  3G0Z A;  2I5J A;  4CJL A;  3KIO A;  3S9H A;  2YV0 X;  4FM2 A;  1XI1 A;  3KTQ A;  1IKW A;  1YVU A;  2VG6 A;  3LAL A;  1VRT A;  3AO4 A;  3AO2 A;  3MXJ A;  4EP4 A;  2NUB A;  4W5R A;  3OS2 A;  4FLY A;  2HNY A;  1W0H A;  1KVA A;  3AO3 A;  5CYQ A;  3ZCM A;  4E7K A;  3V6D A;  5KRT A;  3QEW A;  4E3S A;  1WSI A;  4KHY A;  1SL0 A;  1LW2 A;  4LH4 A;  4Q5V A;  3NAE A;  4B8A B;  4EZ6 A;  2OYQ A;  4FJ8 A;  4M3U A;  3TAR A;  2FBX A;  1L3S A;  4ELV A;  2HW3 A;  1RBU A;  4KRE A;  2ITG A;  4CJ3 A;  4BE1 A;  1NK6 A;  4G1Q A;  4FLZ A;  1L5U A;  4DU4 A;  3CQ8 A;  1KRP A;  4FK0 A;  3AVH A;  4DG1 A;  2XY5 A;  3SZ2 A;  3SUO A;  3VQ8 A;  3K57 A;  4Y1D A;  2FC0 A;  4DTN A;  1SL2 A;  4K8X A;  4Z4F A;  3KLH A;  3S3N A;  2IC3 A;  1L3V A;  5DMR A;  2ETJ A;  4FJN A;  3VN5 A;  4DWI A;  4ZHR A;  4FK2 A;  4E1N A;  3K5L A;  1RBR A;  3NH2 A;  4L8R B;  3AVF A;  3O3H A;  1BL3 A;  1BQN A;  4O0I A;  3SUP A;  3V1O A;  4FJ5 A;  3EZ5 A;  2Z1H A;  3L2U A;  1L3U A;  3RTV A;  3QER A;  3SPY A;  4OGC A;  1C1C A;  1ZBU A;  1KFD A;  3LAK A;  3WNH A;  2HVI A;  3K58 A;  1IKX A;  3KLG A;  2XO7 A;  2DFE A;  4GMJ B;  1RDD A;  3AA5 X;  4FW2 A;  4CGF A;  4KAZ A;  1L3T A;  3AVJ A;  2OZM A;  4PQU A;  1C0M A;  4B8C A;  1T7P A;  1TK8 A;  3H08 A;  3RMB A;  3AVG A;  1BCM A;  4BWJ A;  3C95 A;  4Z4G A;  2HND A;  3VQ9 A;  3WNF A;  4AHV A;  5HRO A;  3TAF A;  1HYV A;  4ICL A;  1SUQ A;  3KK1 A;  1NKC A;  3AVM A;  1QTM A;  4CEA A;  4J2B A;  2HHQ A;  3B6O A;  2GV9 A;  1KLN A;  1LW0 A;  2VG5 A;  3CM6 A;  3LWL A;  3VQA A;  1TGO A;  2YNH A;  3ZT3 A;  5CY4 A;  3KK2 A;  4HUG A;  3LZI A;  3NE6 A;  2DTU A;  1VSI A;  3KKR A;  3ZT4 A;  3OYN A;  1QSL A;  2HHU A;  4FZZ A;  3TAB A;  4AHR A;  3PUF A;  1RTD A;  4C8M A;  4FJ9 A;  1NK5 A;  3VQP A;  2X78 A;  1XWL A;  4CJK A;  1BIZ A;  1HPZ A;  3CM5 A;  2B6A A;  2ZD1 A;  4J2E A;  1QS4 A;  4MQ3 A;  4AHS A;  3V81 A;  4I9Q A;  4N5S A;  2HHV A;  2BDP A;  3V1R A;  3K2P A;  1D9D A;  1BIU A;  1NJW A;  4JS5 A;  1W9H A;  3VQE A;  4H4M A;  3EY1 A;  2Y1I A;  3I0R A;  2F8T A;  3TAM A;  1TV6 A;  4F2S A;  3P1G A;  1KLM A;  1BHL A;  4ID5 A;  4M3R A;  1D8Y A;  1ZBI A;  4CGG A;  3L3V A;  3AVA A;  2ZQB A;  3NF7 A;  4AHT A;  3NHG A;  4OPJ A;  1T05 A;  1S1X A;  4O0J A;  3MXI A;  1ZBL A;  4N41 A;  1JLE A;  4FLX A;  3BGR A;  1NJZ A;  2D0B A;  3O4N A;  4MFB A;  4CJW A;  4Z4H A;  3M8R A;  3F73 A;  2OPQ A;  4F4K A;  4E7L A;  1XHZ A;  2IS3 A;  2YHA A;  2HNZ A;  1RCH A;  2IGI A;  3CG7 A;  3TAE A;  3TAN A;  1FK9 A;  4E7H A;  1U49 A;  4CEQ A;  3C94 A;  3ZT0 A;  1TL3 A;  4E0D A;  3VQ7 A;  4FLW A;  3OJU A;  4KHN A;  4JLH A;  1C0T A;  1EET A;  1KTQ A;  3SYZ A;  2XY8 A;  1RT3 A;  4HCB A;  4DU1 A;  2OA8 A;  2ATQ A;  4ZTJ A;  2JGU A;  3OYA A;  2G8U A;  1UOC A;  4GVM A;  3OYI A;  3LPT A;  4CF0 A;  3DLE A;  2X6S A;  1IH7 A;  4RW4 A;  4DTJ A;  2G8W A;  4DF4 A;  5FRO A;  4CJU A;  4FLU A;  1VSE A;  4DTU A;  1BGX T;  1U48 A;  3BDP A;  3KD1 E;  3SI6 A;  1Q8I A;  1RTH A;  2FBT A;  3MEE A;  1WSJ A;  2OPS A;  2A1R A;  3HO1 A;  4OKE A;  4KI6 A;  2RKI A;  2X74 A;  2Z1G A;  3DYA A;  1A5V A;  1S6P A;  4IKF A;  4K8Z A;  3ZSQ A;  4CIG A;  3QES A;  2G8H A;  3L8B A;  4FLT A;  4AHC A;  2HVH A;  4CJ4 A;  2WOM A;  1TKZ A;  4O5B A;  3RMA A;  3O3F A;  3ZSO A;  4DQQ A;  3ITH A;  4OKJ A;  4F3O A;  3VQ6 A;  1Z26 A;  5D3G A;  1J53 A;  1YTA A;  3NF6 A;  1DTT A;  5J2N A;  4QOZ B;  3AVK A;  3SQ2 A;  3NGZ A;  1T8E A;  4NYN A;  1NKB A;  3QEP A;  3DLK A;  3OYK A;  3M8P A;  4DFK A;  3HK2 A;  3NBP A;  1Z25 A;  3MED A;  1WAF A;  1RIL A;  4CFB A;  3L2Q A;  1LWE A;  3TI0 A;  1LV5 A;  4N76 A;  1HMV A;  4CK3 A;  3M8Q A;  4OLA A;  2G8I A;  4AIL C;  4FZX C;  4FJH A;  4KB1 A;  4TSX A;  3ULD A;  3PX4 A;  4CFA A;  4DFP A;  3AO5 A;  2Z1I A;  5FRM A;  4O55 A;  4DFJ A;  1NJY A;  2YNG A;  5I3U A;  4EZ9 A;  1B9D A;  4HTU A;  4BDZ A;  3U6F A;  1A5W A;  1XC9 A;  2QKK A;  4EP5 A;  2RPI A;  4LH5 A;  1HQE A;  4CF2 A;  1SL1 A;  4CCH A;  3IRX A;  1TAQ A;  2IDO A;  4DSE A;  3NH1 A;  4CJS A;  4CGJ A;  4DTX A;  1J54 A;  1HQU A;  1SV5 A;  2Z1J A;  3LWM A;  1SKW A;  1VSK A;  1EP4 A;  3OJS A;  4DS4 A;  2OZS A;  2KZM A;  1X9M A;  4FM0 A;  2DFH A;  4CK2 A;  4CHP A;  4CF9 A;  2AJQ A;  4KTZ A;  4CHZ A;  1RT7 A;  2BGG A;  1RDB A;  4CGD A;  1X9W A;  3QIP A;  1WN7 A;  1IG9 A;  1TL1 A;  3ISN C;  3CFP A;  3PX6 A;  2G8V A;  2D0C A;  4B9N A;  3QEI A;  2KZZ A;  2QXF A;  3RMC A;  1VRU A;  1BIS A;  3AVI A;  2KQ2 A;  5HRN A;  3AV9 A;  1RBV A;  4E7J A;  5I42 A;  4Z4E A;  1RT2 A;  2D0A A;  3F9K A;  3HST B;  4HUE A;  2EX3 A;  1HYZ A;  3S3O A;  4KI4 A;  4M3W A;  3HM9 A;  3KLE A;  4AHU A;  1NK0 A;  3RR8 A;  3K5M A;  3ZT2 A;  1KVC A;  4KFB A;  1C1B A;  5CZ1 A;  1TVR A;  5EU7 A;  3PO4 A;  5SWM A;  2QK9 A;  3V9Z A;  3KD5 E;  4RG8 A;  4CEC A;  1JXB A;  4OGE A;  1JLB A;  4IBN A;  4BWM A;  5C42 A;  1ITG A;  4W5Q A;  4O44 A;  3ZSV A;  5HRS A;  3D0P A;  1RBS A;  4DS5 A;  4IG3 A;  3L2V A;  3MEG A;  1NK9 A;  1Q9X A;  3OYF A;  2OPP A;  1WSG A;  2Q3S A;  1TAU A;  4CGH A;  4OLB A;  5SZT A;  3O4Q A;  4KHS A;  4I7F A;  4FZY A;  2IAJ A;  5J2M A;  1GOA A;  1NK7 A;  3VQQ A;  4JRP A;  4CES A;  3DLH A;  3AA3 A;  2FBV A;  3SV4 A;  3I0S A;  5J1E A;  4DSJ A;  3TAQ A;  4H8K A;  3CFR A;  1JL1 A;  4BDP A;  4LSN A;  3NF8 A;  3VA0 A;  3AA2 A;  4RW8 A;  4CHN A;  4DQS A;  4FJG A;  1QE1 A;  1RT6 A;  3IG1 A;  3QLH A;  1IO2 A;  3K5O A;  2KFN A;  3AVL A;  3SNN A;  2DY4 A;  1JLC A;  2DFF A;  1RDA A;  2LSN A;  2X6N A;  3RWU A;  2D5R A;  1TK5 A;  2E6M A;  4M3T A;  4Q0B A;  1RT4 A;  2HHS A;  4KPY A;  4HUF A;  3SUQ A;  2W42 A;  4DQP A;  1C0U A;  3ASM A;  4FK4 A;  1ASV A;  1HRH A;  4DTP A;  3TAP A;  4F3T A;  4M42 A;  2HHX A;  1CLQ A;  5HP1 A;  4FJL A;  4FVM A;  3AVN A;  3T19 A;  4E19 A;  4YFU A;  4M45 A;  4W5O A;  3OYB A;  3QIN A;  3V9X A;  4PUO A;  3OY9 A;  1LWC A;  1CZB A;  3AO1 A;  3MAQ A;  4RW9 A;  3LAN A;  2GUI A;  3DM2 A;  4IG0 A;  1NK8 A;  4B9U A;  4DSK A;  4W5N A;  1RBT A;  4CHO A;  3OYH A;  1B9F A;  3SUN A;  1UAX A;  1UWB A;  3ZSW A;  1YTU A;  2F96 A;  4CHY A;  4KTQ A;  4DTR A;  3ZSR A;  3LP2 A;  4IDK A;  1JKH A;  4DMN A;  5E41 A;  1FKO A;  4DSL A;  1D5A A;  4DQR A;  3V9S A;  1S6Q A;  2Y1J A;  1HYS A;  3U3Y A;  3TAG A;  2A1S A;  1C6V A;  1DTQ A;  4M3X A;  4PY5 A;  1S1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...