3AA2A

A52i e. coli rnase hi
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
153
structure length
153
Chain Sequence
b'KQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAIIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Protein core adaptability: crystal structures of the cavity-filling variants of Escherichia coli RNase HI
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 48
structure length 153
sequence length 153
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3aa2A00
3OY9A 1RDBA 2HHTA 3HYFA 1L3SA 4E0DA 3ISNC 1T03A 1JXBA 4OGCA 3PX4A 4CE9A 2DFEA 4CJTA 1KCFA 2HVIA 4IFYA 4FJHA 3OYCA 3U6FA 4DU1A 4J2EA 1RT6A 4FM1A 3VQEA 4FK4A 4FLXA 4LD0A 1VSJA 2HW3A 1B92A 3AVMA 2Y1IA 4CJFA 5KGWA 3MXMA 4KI6A 1YTUA 1CXUA 4DSEA 4ELTA 4YNQA 3C6TA 4E7IA 1RT7A 4DSLA 1JL2A 4I2QA 4DQRA 3HVTA 1ASWA 1EP4A 5K14A 3CM6A 4BDYA 3DLKA 1QSSA 2G8IA 1WSFA 3OYFA 4OVLA 2DY4A 4C8LA 3OYKA 3SI6A 2Z1HA 3DLGA 2YKNA 2BANA 1B9DA 2EHGA 2O4GA 4NCGA 3L2UA 3HJFA 1IKXA 4M3RA 2RPIA 4RW6A 2HNYA 1T8EA 1GOBA 1JLAA 3AO5A 1VSHA 3AVHA 1WSJA 2EX3A 1BIUA 3DYAA 3ZSRA 4EP4A 4F3TA 1CXQA 1JLBA 3AA3A 4LSNA 5SZTA 5J2MA 2HB5A 4JS4A 4CFBA 4FLWA 3K58A 1JLFA 1S6QA 4LY7A 1NK6A 3NGZA 4FLUA 1JLQA 3CFOA 1BISA 4E3SA 2A1RA 2KZZA 3HVRA 1IKVA 3HO1A 1HJRA 4CGJA 3HT3A 3ZSYA 2B5JA 1JXEA 2YNGA 2VWKA 4FM0A 1FK9A 1IH7A 2YHBA 2YNIA 4CF2A 4JRPA 4FJ7A 1CZ9A 4RW4A 3ZSOA 1RBUA 4CJPA 3MXIA 1S6PA 3SQ4A 1GOCA 2YKMA 1I39A 4OPJA 3DOKA 3OYNA 3L2WA 3OYHA 1FKPA 2IC3A 4Z4HA 1EKEA 1BQMA 1S1XA 1S1TA 3D0PA 3I0RA 2OA8A 4FJ9A 3KTQA 4RG8A 3LAKA 3VA0A 4ZHRA 1KVAA 3ZT4A 1HPZA 5C42A 4M42A 4F4KA 3O3GA 4C8KA 3NFAA 3AVBA 3CM5A 4KB0A 1N5YA 1K6YA 4CFAA 1RT5A 4AHRA 1RT1A 3L2QA 3LP1A 3T1AA 3SJJA 1IG9A 3VA3A 2RKIA 2DTUA 4M3ZA 4BWJA 1JLGA 4CIEA 3QESA 1RDDA 3VQDA 3RMCA 1W0HA 3HP9A 2D0CA 3HPGA 1VSIA 1RBSA 3AVFA 4DFJA 5KRTA 4IG0A 3I0SA 4DG1A 5HP1A 4PY5A 1SKSA 2A1SA 2Q3SA 4N47A 3RRHA 3KK1A 2G8KA 4CJSA 1ZBFA 2LSNA 2ZE2A 3LP2A 4CEOA 2G8WA 2HHWA 1TK5A 3MEDA 4B9SA 3NF6A 4DU4A 3NH2A 3PO5A 3OYDA 4CHZA 1RBRA 4FW2A 4DQQA 2ETJA 3DRSA 4C8OA 3SQ2A 4E7KA 1J53A 1EX4A 2WONA 4DTXA 4Z4FA 4DF8A 4H8KA 1I3AA 3IS9A 3AVNA 3A2FA 3TWHA 3PV8A 3WNHA 4E7HA 4CHQA 1LAWA 3PX6A 1J5OA 4DSJA 5FRNA 3IG1A 4Z4EA 3QNNA 3AO3A 3H08A 1CLQA 3AVCA 3DLRA 3DRPA 4IKFA 3V9ZA 4ID5A 4CGHA 3SYZA 1C0TA 2QKBA 4G1QA 2OZSA 3L2VA 5KGXA 4OKJA 1BL3A 4J2DA 4OJRA 3NCIA 5HLFA 3AVKA 3M8SA 1VRUA 3SV3A 1HNIA 1FXXA 5CYQA 3TARA 4AHVA 4QCLA 4W5RA 2G8UA 1REVA 3V6DA 1TV6A 1A5WA 4B08A 2Z1GA 3HP6A 3O3FA 4AILC 4KFBA 1RT2A 1UA1A 3HL8A 1TAUA 1SUQA 2IAJA 2FBYA 2ITGA 4IDKA 3SQ1A 1QE1A 3AVIA 1KVCA 3DM2A 4CEDA 4KO0A 3RMDA 1F21A 1VSFA 3MEGA 1IKWA 4CK3A 1VSLA 3PX0A 4FJLA 2X6SA 3OS1A 4PQUA 3VQ6A 2WOMA 4KHYA 4JS5A 1RTIA 4FLTA 4FYDA 3L8BA 3K5NA 3LZIA 2G8VA 4B9LA 2P51A 1RTHA 4FCYA 3LWLA 4M3WA 3VQ8A 4HUGA 4DQIA 4HHTA 4FJJA 4ELVA 4OLAA 3DOLA 4CJ5A 3NDKA 4NCAA 3V9WA 3OYGA 4KTWA 3QETA 3THVA 3VQBA 4B9NA 4CF0A 4TSXA 2HHQA 3L2RA 2FC0A 4Y1CA 4O55A 3RMBA 1NK0A 3B6PA 1DTQA 3QINA 3LDSA 4FJ8A 4IBNA 3SPYA 1YTAA 3K5MA 4CCHA 3UIQA 1G15A 2XY7A 4H4OA 4O0IA 4F2RA 1S1VA 1NK8A 2FBVA 3OYIA 1L3VA 1VSMA 3WNGA 1WSGA 3L3UA 3G10A 3ZSQA 4CHPA 1U4BA 1FKOA 1TGOA 2B4JA 5J1EA 3LPTA 5HBMA 5SWMA 5T7BA 3KK2A 4FLVA 4N76A 4RW9A 1VK0A 4F8RA 3VQ9A 3QIOA 3NHGA 4HUEA 3TAQA 1TK8A 5HRNA 5HROA 1C1CA 1RNHA 4CK1A 4CFDA 1KVBA 4CJEA 3OYAA 3RR8A 1J54A 5J2PA 3AV9A 2YV0X 3QO9A 4CESA 1NOYA 1SKRA 3HPOA 2OYQA 4Z4IA 3K5LA 1TK0A 3NF7A 4KREA 3U3GA 1C1AA 3VQ4A 2X78A 4B8CA 4CIGA 3CFPA 4CJWA 4LSLA 4CJRA 1X1PA 2KFZA 3AVAA 1RDCA 1BI4B 1LAVA 1RCHA 4Y1DA 5KI6A 3I8DA 3NE6A 1EETA 2PYJA 1WLJA 3AO2A 4WE1A 3M8RA 2X6NA 1UA0A 2G8FA 4I7FA 1RTDA 3ASMA 3QEIA 3EZ5A 1JL1A 4FVMA 4OLBA 4KTQA 1NOZA 2HNDA 3NF9A 3DI6A 3NGIA 4M3XA 2F96A 3P5JA 2VG6A 4RW7A 1ZBLA 3OYMA 4DWIA 1A5VA 3DLBA 2YNHA 4M41A 3KJVA 3TABA 4DQPA 3S3OA 3MAQA 1ASUA 3IAYA 4M3TA 4CJVA 2QKKA 2O4IA 2FBTA 4Q5VA 2KFNA 1U48A 2GV9A 4B8AB 1JKHA 3JSMA 4FJKA 4HCCA 4KHWA 1HYZA 2YNFA 2W42A 3V9XA 3VN5A 3TANA 1BI4A 3LP0A 4IG3A 4N5SA 1A5XA 4DLGA 4KHSA 1HMVA 3ZSVA 1TL3A 4CJ3A 4EZ6A 3PUFA 4E1NA 4GW6A 4FLYA 3SCXA 2OPQA 4DSFA 2IDOA 3C95A 3TI0A 4DSIA 4FJIA 1NK5A 2F8TA 2OPSA 3L3VA 3C6UA 2XHBA 1BCMA 3KIOA 3NH0A 4DLEA 1SL1A 1KFSA 4F2SA 4PUOA 3QIPA 4B9VA 1VSDA 3QEXA 2HHXA 1NK4A 4BWMA 4FW1A 4FZXC 3SNNA 4I9QA 3AO1A 1TVRA 3BGRA 1S1WA 3HM9A 4FJGA 4GMJB 1WAJA 3VQ5A 1JLEA 4W5TA 1T05A 2GUIA 1XHXA 1VRTA 4OKEA 3RWUA 3DLHA 3LZJA 1QSLA 4LH4A 4KHUA 1TKZA 1BGXT 4QAGA 1YT3A 4NYFA 2G8HA 4AHTA 4B9UA 4GVMA 4DFKA 4EP5A 4KAZA 1Z25A 4EZ9A 3QERA 1RT4A 4JLHA 5EU7A 4F3OA 4PWDA 3MECA 3P83D 4E7JA 3KD1E 2RF2A 4KRFA 3KLIA 2FBXA 1QSYA 3V1QA 3E01A 2HNZA 4Z0UA 3ALYA 3MEEA 3ITHA 4NCBA 3TAGA 5D3GA 2Z1IA 4CGFA 1UAXA 1S5JA 2D0BA 3JYTA 4H4MA 3QNOA 5HRSA 1S9GA 4E1MA 1LV5A 1O1WA 1L3TA 1Y97A 4MQ3A 2XO7A 4J2AA 3QEWA 2KQ2A 1U04A 2IS3A 3S3MA 2BDPA 4B9MA 3VQQA 4AHUA 4E7LA 1L3UA 5J2NA 1XHZA 1WNSA 1QS4A 3LANA 5CYMA 4E89A 1HYVA 3NF8A 4PA1A 4FM2A 4BDPA 4YFUA 4W5OA 4M45A 4CFCA 2KW4A 3ZCMA 3F73A 3QEPA 5I3UA 2JLEA 1J9AA 3O3HA 1ZYQA 4O5BA 3SV4A 3VQCA 1QHTA 1SL0A 1XWLA 4OKKA 3KLHA 3V81A 4AHSA 4CECA 4DSKA 4C8NA 2BGGA 3VQ7A 3HSTB 3TR8A 4AHCA 3K59A 3HK2A 4DTNA 2HHVA 4KTZA 2P5OA 2VG7A 3M8QA 2E6MA 4NYNA 4DMNA 4FJMA 1HNVA 1BQNA 1KFDA 3ZT1A 4J2BA 4CGGA 1SKWA 2PYLA 2HHSA 1X9WA 4CJKA 1T7PA 4KB1A 4QOZB 1KLNA 1ZBIA 4FJNA 4ZTJA 2E4LA 3ZSWA 2ZD1A 4CEQA 4CGDA 3SUQA 4E19A 1C1BA 2X74A 1KTQA 2B6AA 3KLFA 3NAEA 4AH9A 1NJYA 3LALA 2QXFA 3RR7A 1UOCA 3KLEA 1NK9A 2F8SA 5HRPA 4DTJA 4ZTFA 1Z26A 3K2PA 3OJSA 3AA2A 4CHNA 5KTQA 3CFRA 2R7YA 4FXDA 1VSEA 3P1GA 2NUBA 1RBVA 3AA4A 5J2QA 1NK7A 4N56A 4CEFA 3NH1A 1NJWA 2HVHA 4Z4GA 5FDLA 1Q9YA 5JS1A 3AO4A 4BE1A 3SUPA 4CIFA 4DS5A 4DTPA 2XY6A 3BDPA 3TAPA 4ELUA 4CJ4A 2VG5A 1D5AA 4HVJA 3DLEA 1QQCA 4JRQA 3AA5X 3VQAA 1XC9A 1DTTA 3WNFA 4I9LA 1NKCA 4FK2A 3RTVA 1HYSA 3OVNA 3QLHA 1VSKA 3OS0A 4KI4A 3CG7A 4FK0A 4KKOA 1LWCA 1C0UA 3OYJA 4CHOA 5E41A 3SUOA 1EXQA 3C94A 3LP3A 1RT3A 2ZQBA 3TAEA 5C25A 1WSIA 1WSHA 1TAQA 4K8ZA 1U49A 3OYEA 2BE2A 1KRPA 4DS4A 1X9SA 2D5RA 4CF1A 2OPPA 4OPKA 1LW0A 4HTUA 1RTJA 3ULDA 2OZMA 2AJQA 4M3YA 1UWBA 4FJXA 4I2PA 4CJLA 3VQPA 4DTSA 5FRMA 4BDZA 4Q0BA 5FROA 1Q8IA 2QK9A 3EYZA 1NJXA 5KRSA 1RBTA 1S1UA 1LWFA 2ATQA 1B9FA 4CK2A 1MU2A 3KKSA 1DLOA 1RILA 5CY4A 4XIUA 4HCBA 4N41A 5I42A 3SQ0A 2E6LA 3K57A 1U45A 3PO4A 3CYMA 4CHYA 4CJUA 4CEZA 1BIZA 3V9SA 1NKBA 2DFFA 1LWEA 3B6OA 1R0AA 3DMJA 1HRHA 1KLMA 3WNEA 5CZ1A 3U3YA 3SPZA 2HHUA 1TKDA 3PY8A 3FFIA 4BE0A 5CZ2A 3T3FA 4KPYA 3KLGA 1LW2A 3QEVA 3V4IA 3RRGA 3AVGA 4L8RB 2GBZA 3ZSXA 4K8XA 4DTOA 4FJ5A 4CF8A 2XY8A 4O0JA 2RN2A 4DTUA 2PZSA 4DQSA 1NJZA 3V1RA 3AVJA 1ZBHA 1SV5A 3KK3A 4W5NA 3IRXA 3HPHA 1D9FA 4LH5A 3M8PA 1SL2A 1U47A 1S9EA 5HRRA 3ZSZA 4CEEA 3O4NA 3ZT0A 3KD5E 3O4QA 1X9MA 1BHLA 4O4GA 3OJUA 3EY1A 5DMRA 1TKXA 4DTRA 2I5JA 4CJQA 3LAMA 4R5PA 3S9HA 4CERA 2HMIA 3HXMA 4KV8A 4OGEA 4CEAA 2XY5A 2P5GA 2KTQA 2DFHA 5JS2A 3LPUA 4DTMA 1C0MA 1YVUA 4ID1A 3TAFA 2P1JA 3CQ8A 3SZ2A 4HUFA 1RDAA 4O44A 3NGYA 4DFMA 1HQEA 4CF9A 1KSPA 1N6QA 1W9HA 4UQGA 1WN7A 5DK5A 3ZT2A 2VWJA 1ITGA 4MFBA 3LWMA 1XI1A 3OYLA 2Y1JA 3OS2A 4KHNA 3KKRA 1TL1A 2IGIA 4FZZA 1BCOA 1CZBA 4DFPA 1ZBUA 1D9DA 3MXJA 3AVLA 1HQUA 3RMAA 1L5UA 4CGIA 4FLZA 1NKEA 1GOAA 4C8MA 1ASVA 3NBPA 1IKYA 3V1OA 3K5OA 4Z4CA 2OPRA 4DU3A 3SUNA 3S3NA 4ICLA 5C24A 2D0AA 1WSEA 1QTMA 4B3OA 3F9KA 4IFVA 4BE2A 4W5QA 4B9TA 2KZMA 4RW8A 1D8YA 1WAFA 4DF4A 4KHQA 2IOCA 3DRRA 1Q9XA 2Z1JA 4FZYA 3OYBA 1JLCA 2XRIA 1C6VA 3G0ZA 1TKTA 3TAMA 3V9UA 2PY5A 3ZT3A 2YHAA 3D45A 4BACA 3T19A 4CEBA 2JGUA 1IO2A 4M3UA
chains in the Genus database with same CATH superfamily
2HHTA 4E0DA 3ISNC 4IFYA 3DJCA 1D4XA 4FJHA 3U6FA 2JWKA 4J2EA 3W3DA 2QXLA 4FM1A 2BH1A 4FLXA 3SBTA 3PIPL 5MLCQ 3G6EN 4JD2B 3OW2M 2Y1IA 4B1ZA 3MXMA 1YTUA 1CXUA 1YF5L 4YNQA 3K9KA 1EP4A 1ASWA 2G8IA 3DLKA 3VERA 1WSFA 4OVLA 3SI6A 3HJFA 4NCGA 2P9PA 2RPIA 4RW6A 4M3RA 3VGKA 3AO5A 1BIUA 3ZSRA 1JLBA 4LSNA 4JS4A 4CFBA 2NRRA 1R59O 1S6QA 2AA4A 3CMEN 1NK6A 4NXNK 1ESVA 5BREA 3HT3A 3ZSYA 4JAXA 2YNIA 1TUUA 3MXIA 4RW4A 3U9ZA 1ATSA 3ZSOA 2O8DB 3VGLA 3SQ4A 2O8BB 4OPJA 1KXPA 3OYNA 3ENBA 3OYHA 4Z4HA 2OA8A 1VQ6N 3I0RA 3UE5A 3KTQA 4DV4K 4H0TB 3NVMA 4PKGA 4C8KA 3CJ1A 4KB0A 3CQXA 4CFAA 1RT5A 2P9IB 4AHRA 1IG9A 3T1AA 2PBDA 2DTUA 4IXCA 4M3ZA 1JLGA 2NNWA 3CJBA 3RMCA 3AARA 1W0HA 3HPGA 4OPAA 2O8DA 2V51B 2G8KA 5KPZA 2G8WA 2HHWA 1TK5A 3MEDA 3NF6A 3NH2A 4JI6K 3FGUA 4DQQA 2ETJA 3DRSA 4E7KA 2WONA 2P9IA 4O8KA 4H8KA 1I3AA 3D2EA 3IS9A 4R79A 2ZGZA 3A2FA 4JI0K 2V7YA 3PV8A 4Y0WA 3WNHA 4E7HA 1MDUB 4KH6A 4A5BA 1C0FA 3EEQA 5AQMA 1EO1A 3H08A 1VAZA 5TKWA 4YORA 3O9RA 1C0TA 4G1QA 2OZSA 5KGXA 4A2BA 4OPHA 1KC8O 3ENHA 3AGRA 1VRUA 3P38A 1X3NA 1REVA 5KQDA 2Z1GA 4KFBA 3SMSA 4ILHA 3AVIA 1TYQA 4O5FA 1F21A 1VSFA 1IKWA 3PLAA 4PQUA 4KHYA 4JS5A 3L8BA 3LZIA 4HUGA 2D0PA 4HHTA 4B3RK 4GKJK 1EWRA 3NDKA 3L4QA 3OYGA 4WQ5A 4A2AA 4KTWA 3WXMB 3QETA 3CIPA 3VQBA 2HHQA 1NK0A 3B6PA 4X66K 3HOTA 3LDSA 4FJ8A 2OCEA 3K5MA 1G15A 4X65K 4O0IA 2FBVA 1BWFO 1L3VA 4JKAA 5JVGL 4CHPA 3VF4A 1U4BA 1FKOA 5T7BA 5J1EA 5SWMA 3H3NO 2YCHA 3R6MA 4RW9A 4F8RA 5JLHA 3R9PA 3CHWA 3NHGA 4HUEA 1TK8A 1HNZK 4LC9B 1RNHA 3E1YA 3U8XA 1Q81O 3VEXA 1KVBA 3RR8A 3EN9A 2YV0X 3QO9A 4CESA 1NOYA 4Z4IA 3SAHA 1TK0A 4KREA 3TTCA 1C1AA 4WFNL 2X78A 3VGMA 4CJWA 4LSLA 5M1QA 5LL6Z 1RDCA 1BI4B 1RCHA 1EETA 1WLJA 2G8FA 2X6NA 5JVHL 2CGLA 3QEIA 1JL1A 4FWNA 4GY2B 3GOIA 1NOZA 3NF9A 1QVGM 2F96A 1ZBLA 2VG6A 3OYMA 3DLBA 4DQPA 1VQ4N 4X64K 4EAHD 4CZFA 3GBTA 2QKKA 2KFNA 2FBTA 4B8AB 3JSMA 3CC4N 1HYZA 3THYA 4DUYK 1N33K 1BI4A 3LP0A 1A5XA 1TL3A 3PUFA 4FLYA 3UB5A 3H45C 3SCXA 4DSFA 2HHHK 3RSEA 1NGFA 1BCMA 1SL1A 1MA9B 3KK7A 3CCMN 4PUOA 3QEXA 3DXMB 4JKCA 1NK4A 2H3GX 4DR6K 3BGRA 3VQ5A 4W5TA 1VRTA 3RWUA 5AQXA 4YDUC 3HM8A 4DR4K 1QSLA 4LH4A 3TTFA 2UYTA 2J4RA 1S3XA 4NYFA 4NO7A 5C12A 4B9UA 4GVMA 4LFBK 4EP5A 4F3OA 3MECA 3D6RA 3P83D 2YHYA 2RF2A 3KLIA 1GLJO 1QSYA 2RE2A 3BP8A 3E01A 4XH1A 3ALYA 3MEEA 3J7ZO 3ITHA 3O4WA 4BR4A 5D3GA 1UAXA 2D0BA 5HRSA 1LV5A 1L3TA 1Y97A 4J2AA 1VQPN 4DKWA 3QEWA 2IS3A 3MWTA 1NWKA 2HBMA 3VQQA 5ADXA 1NNEA 4E7LA 4BRFA 1IBLK 5CYMA 2ASPA 4FM2A 4BDPA 1YUWA 3WEEB 3MK6A 5BPLA 4CFCA 3ZCMA 2FLOA 1J9AA 4O5BA 4BRMA 2ZJRL 3VQCA 1SL0A 1XWLA 1XC3A 2BGGA 3HK2A 3K59A 4KTZA 5A2QO 4NYNA 3NMUA 1KFDA 5F0XA 3R1XA 2HHSA 2PYLA 3VF2A 1T7PA 1S22A 2HF4A 1ZBIA 4FJNA 4JKHA 3ZSWA 1Z6RA 3ID6A 4E19A 4JN4A 1T3VA 1BO5O 3KLFA 4AH9A 1UOCA 1NK9A 4CVNE 2F8SA 1WUAA 1YXQA 4FXDA 3AA2A 5KTQA 3CFRA 3P1GA 1IO2A 4LF7K 5AZJB 3E9LA 2W6LA 4WQ4C 1NK7A 3ZEUA 4NLBA 3AO4A 4DB3A 5GAGP 1D5AA 4BREA 4HVJA 3WXIA 4BRAA 4CZKA 3CF5L 4JRQA 3AA5X 3VQAA 1DTTA 4I9LA 4FK2A 4BR0A 3OVNA 1VSKA 3J8AA 4B1UB 1DT9A 4FOEA 3SUOA 3C94A 3SJHA 2ZQBA 3QDKA 5C25A 1KD1O 1WSHA 1VQLN 4K8ZA 4YHHK 1KRPA 5AZJA 4WFBL 4M7YA 2NRHA 4HTUA 2OPPA 3GL1A 1JJ2M 3O1BA 3VQPA 2IVOA 1GLFO 1Q8IA 3TTDA 3SBGA 4DV1K 4CK2A 4XIUA 1NBWA 2E6LA 2ITMA 4CBXA 3V9SA 1RFQA 2QM1A 3B6OA 3WNEA 3U3YA 4B1XB 1RDUA 3O80A 3FFIA 4KPYA 3QMLA 3QEVA 4K8XA 4BR5A 4FJ5A 5AFUA 4JI1K 4DTUA 2A40A 1NJZA 3QBXA 4DUZK 3AVJA 4W5NA 5LMUK 4AQYK 5GIPA 4NB4A 3KD5E 3OJUA 2IIRA 4CJQA 3LAMA 4U7BA 4DR2K 3HXMA 4KV8A 4OGEA 4CEAA 2DFHA 5JS2A 5CE3A 3TAFA 1OVYA 4O44A 3FZLA 2V52B 3NGYA 1J5EK 4CD1A 4UQGA 1WN7A 2VWJA 1ITGA 3ZX2A 1XI1A 3OS2A 4KHNA 1NLVA 4A59A 2NZTA 1HQUA 3LDPA 3NBPA 4FZYA 1IJJA 5C24A 3C6HA 4B9TA 2KZMA 4M7XA 2O8CB 3WXKA 1D8YA 2E2QA 4KHQA 2IOCA 3DRRA 1K8AO 3VF6A 3L0QA 3G0ZA 1TKTA 3T1HK 1WBDA 2UXBK 3ZX0A 4CEBA 3ZT4A 2CGKA 4BR2A 4BRDA 4CJTA 4DU1A 3FZMA 3JXUA 3VQEA 4FK4A 4JYAK 2IVPA 1HLUA 1B92A 3VTHA 4DV3K 3HZ6A 5KGWA 4CJFA 3VEVA 1RT7A 1JL2A 3G4SN 1QSSA 2QWRA 3IUCA 2YX6A 4C8LA 3OYKA 2OTJN 3DLGA 2YKNA 2BANA 3A5LC 2HNYA 1GOBA 1FW6A 5SZTA 2HMPA 3ZX3A 2HB5A 4FLWA 1JLFA 4K25A 4QS7A 4LY7A 3NGZA 4FLUA 1JLQA 5BRDA 3CFOA 3FZKA 2VQEK 2YI1A 1HJRA 1NGAA 3GE1A 1HKCA 2VWKA 4IOAL 3EKSA 4JKGA 4JRPA 1RBUA 2YKMA 3L2WA 1FKPA 4KH4A 4MO4A 3C7NA 4RG8A 1KVAA 1HPZA 3TSPA 5C42A 2F7TA 1KAZA 4FWRA 5FPEA 3AVBA 3L2QA 3LP1A 1Q82O 2RKIA 4AM7A 4BWJA 2W41A 5F1XA 4GKKK 3HP9A 3O6WA 2D0CA 1RBSA 3E66A 4PY5A 4FSVA 1SKSA 2A1SA 2Q3SA 4N47A 1OH6A 2NRWA 5C10A 3KK1A 3VEWA 2LSNA 2Q1NA 4BRCA 3PO5A 3VMFB 1RBRA 2E20A 1ATRA 1SAZA 4C8OA 3SQ2A 1J53A 4FWPA 3B8AX 3DLLL 4JKFA 4Z4FA 4DF8A 1GLAG 2UXCK 3TWHA 1WB9A 1J5OA 2P9KB 3IG1A 3EO3A 5FRNA 3QNNA 3AO3A 4EIAA 1CLQA 4CGHA 2UXDK 3L2VA 3ZETA 4OKJA 1BL3A 3MN6A 4CZEA 5HLFA 1XNQK 1HNIA 4QCLA 4AHVA 2ZWHA 4QS8A 1T44A 4AILC 3AGKA 3LDQA 4L3QA 4BRHA 3N4PA 2IAJA 2FBYA 2I7NA 3RMDA 2P9KA 4CK3A 1VSLA 4FJLA 3VQ6A 3MDQA 3KHYA 2G8VA 4B9LA 2P51A 1RTHA 5GADP 1T6CA 4M3WA 2Q0UA 4OLAA 2P9PB 1HKBA 1WBBA 4B9NA 4CF0A 4BRKA 2FC0A 1DTQA 4CD3A 4IBNA 1YTAA 5AQIA 4CCHA 3BF1A 2XY7A 1Q7YO 3L6QA 4B3SK 3H3OB 1WSGA 3E9PA 1TGOA 3LPTA 4B1VA 1VK0A 1NU0A 2HBLA 1N8RO 3VQ9A 5IT9O 3CMAN 3TAQA 5HRNA 1C1CA 1VQ8N 1V4TA 1IBKK 2D0OA 3CC7N 3KWIA 3OYAA 3VENA 1J54A 4PHTX 1C0GA 3AV9A 3HPOA 3K5LA 1VQ9N 3NF7A 2GELA 4CIGA 4B8CA 2NRZA 2KFZA 3AVAA 1LAVA 2PYJA 3I8DA 4Y1DA 5BR9A 4WE1A 3K9JA 1UA0A 3EZ5A 4FVMA 4KTQA 2QTDA 4X62K 1QQMA 3DI6A 4G9ZA 3SMPA 4RW7A 4DWIA 1FJGK 1JCFA 1VQKN 3A5OC 3ATUA 4M41A 3KJVA 4I6MA 1YAGA 4XH5A 4KHWA 3EZWA 1HR0K 4HCCA 3D2EB 2W42A 3I56N 3UKUA 2DPNA 2ZM6K 4DLGA 4KHSA 1RGIA 4IO8A 3VPZA 4CJ3A 4IO9L 4GW6A 3CCUN 4BG8A 4H0XB 2OPQA 3LL3A 3G71N 3TI0A 4IWVA 1N34K 2ASOA 2BUPA 3WUHA 2WFBA 2XHBA 2QWMA 4H5NA 3KIOA 5KQ8A 5LJVA 4B9VA 2VGNA 1VSDA 4IEEA 2HHXA 3CCEN 3AO1A 3HM9A 1S1WA 4GMJB 4YOXA 1JLEA 1T05A 4B9QA 4H0OA 3DLHA 4YOUA 4CI6A 1WOQA 1TYQB 4GV9A 4WYBA 5H1SQ 4QAGA 1YT3A 3T7ZA 4C1NI 1BOTO 4LF4K 3A5MC 4JKEA 4DFKA 1Z25A 3FFKB 1Q18A 5BRFA 5AJ3K 1GLDG 4KH5A 2HBJA 3V1QA 2FF6A 4H4MA 3ENOA 4LF8K 4E1MA 2YHXA 3TPQA 2BDPA 4BRPA 5J2NA 3O9TA 3LANA 1QS4A 4PA1A 4YFUA 4M45A 2KW4A 3F73A 5ELZA 3LDLA 2JLEA 3O3HA 3O8MA 1ZYQA 3BY5A 1GLEG 5KPTA 4FPAA 4BR7A 4DR7K 4OKKA 4IDHA 4DSKA 4JI5K 4DR3K 3A8YA 3VQ7A 3M8QA 2E6MA 4K41A 2UUAK 4FJMA 1HNVA 1VQNN 4YDUA 4J2BA 3PSFA 2E4LA 2ZD1A 4IOCL 4H0VB 2HOEA 2X74A 1KTQA 2B6AA 3NAEA 4JI8K 2QXFA 3RR7A 1YITN 4ISFA 5HRPA 5AR0A 4DTJA 4ZTFA 4EFHA 4DV0K 3THYB 2NUBA 3R3LA 5AQPA 2OANA 5FDLA 4BE1A 3SUPA 3BDPA 2FSKA 1OH7A 4CJ4A 2VG5A 3AAQA 3RSEB 3Q7CA 4CJ7A 5AQTA 1NKCA 4LFAK 2UUBK 4FK0A 3ULEB 4CHOA 5E41A 1M90O 3LP3A 3TAEA 3VEOA 5I9EB 1WSIA 1TAQA 3OYEA 3MN5A 2D5RA 3CCJN 1N32K 2AJQA 4M3YA 3CC2N 3KVGA 4BG9A 4DTSA 3E9OA 1NJXA 5KRSA 3CD6N 1NGEA 1S1UA 2ATQA 1B9FA 4HCBA 3KKSA 1RILA 4N41A 3TU5A 4CEZA 1NKBA 3ULEA 4B3TK 1HRHA 3PY8A 3AVGA 2F9TA 2ZF5O 1EWQA 4DQSA 3BZKA 3KK3A 4LH5A 3M8PA 3H46O 1U47A 5HRRA 5HOOA 4YOTA 1BHLA 4O4GA 1K8KB 5JMVA 5BR8K 3EY1A 5DMRA 2I5JA 4R5PA 2BTFA 2P9UB 4HUFA 1JCEA 4CF9A 4CZJA 4JHDB 1VQMN 4MFBA 1VHXA 3KKRA 5AQFA 4DFPA 3C0BA 3MWPA 1IG8A 3MXJA 3CQYA 1EQYA 1L5UA 3RMAA 5F2RA 4FLZA 4DHYA 1GOAA 4C8MA 1ASVA 1K8KA 3V1OA 3K5OA 3SUNA 4B3OA 3F9KA 4IFVA 2A42A 5AQJA 4JI7K 2P9UA 2XRIA 2E5LK 3ZT3A 3D45A 3G25A 4BACA 2JGUA 4JHDA 5AQRA 4M3UA 3ZEUB 3HYFA 4UY8O 2OTLN 1T6DA 1T03A 4OGCA 4CE9A 2HVIA 1KCFA 3OYCA 2PAVA 5M1KA 1VSJA 2YJFA 3UKRB 4KI6A 4CBUA 4DSEA 3CCSN 3C6TA 3WQUA 5C2FA 4I2QA 4DQRA 3VEZA 5K14A 3CM6A 4BDYA 4JI4K 3THWB 2DY4A 2Z1HA 2EHGA 3L2UA 1IKXA 3AVHA 2EX3A 5AQGA 2F9WA 1P90A 3K58A 4K42A 1QVFM 4ILGB 2QWPA 4E3SA 1BISA 3UKRA 3HVRA 4IFEA 1IKVA 5LJWA 4CGJA 2B5JA 1IH7A 2YHBA 4FJ7A 1CZ9A 3THWA 1S6PA 4LF9K 1I39A 3DOKA 4U67L 3T1YK 1EKEA 1BQMA 4LF5K 3D0PA 1NGHA 2FSJA 1QZ5A 3LAKA 3VA0A 4ZHRA 4M42A 3P31A 3HOSA 3NFAA 1W2BM 1N5YA 1K6YA 4BROA 3VA3A 4IJAA 4CIEA 3AVFA 5AQSA 4DFJA 4IG0A 3I0SA 4DG1A 3D2FA 3RRHA 3TSUA 4B3MK 4CJSA 1ZBFA 4K43A 1LOTB 2GX9A 4DU4A 3CXCM 3LM9A 3OYDA 4CHZA 4H0PA 4FW2A 4EHUA 4DTXA 3MN7A 4QS9A 3AVNA 3IFRA 4CHQA 1LAWA 3M6GA 4YOWA 5CR4A 5BN8A 4DSJA 2QEXN 4DCHA 3DRPA 2Q31A 3H1VX 3NCIA 2A6AA 3AVKA 2P9NA 3M8SA 5CYQA 3TARA 5AQZA 4W5RA 2G8UA 3RVCA 3V6DA 1TV6A 1A5WA 1U2VB 4B08A 5AQLA 1UA1A 1RT2A 1XUPO 3HL8A 3PSIA 1TAUA 1SUQA 2NRXA 2ITGA 2Q97A 1QE1A 4CEDA 2KKZA 3PX0A 1BA1A 4FYDA 4H5WA 1OVQA 1IBMK 3HTVA 4ELVA 3DOLA 4CJ5A 5ADXH 4NCAA 3V9WA 3SLCA 2YJEA 2PFUA 1U2VA 2WUSA 4Y1CA 3THXA 4O55A 2VCPA 3QINA 4DV5K 3SPYA 2NRVA 3UIQA 4H4OA 3OYIA 1BA0A 2UU9K 1VSMA 3WNGA 3L3UA 4BVPA 4BRNA 4JKGB 2B4JA 3KK2A 5HBMA 4FLVA 4GV3A 4ISGA 5E26A 3JAMO 3I8BA 3D7EO 5HROA 3C6AA 3C7NB 4CFDA 2QA4N 4CJEA 3OBWA 4H5TA 1NJIO 1GLLO 1SKRA 3CI5A 2GUPA 1LCUA 3U4LA 1NGIA 3BF3A 3QICA 3ASMA 3ATVA 4OLBA 5AQWA 3NGIA 4M3XA 3I55N 1A5VA 3TABA 3S3OA 2NLXA 1IV0A 3CJ7A 3L4IA 4M3TA 1ASUA 1JCGA 4CJVA 4WFAL 1U48A 2GV9A 3J81O 3V9XA 3VN5A 4IG3A 3OTOK 3N4QA 3CJ9A 4E1NA 1XMOK 2WTUA 1NK5A 1VQ5N 2F8TA 2OPSA 2QWQA 3ZETB 1J6ZA 3ZLJA 4ISEA 3NH0A 1KFSA 1TUYA 5CHIA 3QIPA 4BWMA 4FZXC 2P9LA 1DKGD 1TVRA 4FJGA 1WAJA 1NMNA 4LF6K 1XHXA 3MX2A 3CETA 2QI2A 3LZJA 1MWMA 4KHUA 1TKZA 5DM6L 1HUXA 1QZ6A 4JLHA 4PWDA 5EU7A 3LM2A 5AFUH 4E7JA 4KRFA 2ZGYA 4O8UA 4Z0UA 4JNEA 3KWGA 4NCBA 4CGFA 1S5JA 1S9GA 1O1WA 5AQUA 1HKGA 4MQ3A 2XO7A 4YOVA 1ZC6A 4B9MA 5KPRA 1L3UA 1YVNA 1XHZA 1WNSA 4E89A 3NF8A 4XH4A 4W5OA 1DEJA 3QEPA 5I3UA 4OO1J 2EWSA 3QFUA 3SV4A 4V19S 1QHTA 4RWTA 3V81A 4AHSA 4CECA 4J8FA 3HSTB 2HHVA 2VG7A 4NLCA 1BUPA 4DMNA 1BQNA 4CGGA 5HL7L 1KAYA 1X9WA 3WQTA 4KB1A 4QOZB 1KLNA 3EL2A 3DXKA 3SUQA 1C1BA 2D4WA 4I6MB 2HSTA 4FWKA 4OX9K 2FSNA 5JICA 2F4VK 3MX5A 3VTIA 2R7YA 2NRTA 3UKUB 5J2QA 4CEFA 2HVHA 4Z4GA 1Q9YA 3SAFA 4DTPA 2XY6A 4BRGA 3DLEA 1QQCA 3CCLN 4LFCK 4FOIA 1XC9A 1ILYA 4JV5K 3CCRN 5EOYA 3QLHA 3ZYYX 3OS0A 4JD2A 1LWCA 1C0UA 3OYJA 3QBWA 3SAGA 2HBKA 3PIOL 1U49A 2BE2A 4GVEA 2D1KA 4OPKA 1LW0A 1RTJA 1BG3A 3F2KA 3K0SA 4I2PA 1K73O 4CJLA 4BC5A 4A57A 5FROA 2QK9A 1RBTA 5CY4A 4BRIA 3SQ0A 1XQSC 3NVKA 4E1JA 1QQNA 1E4GT 3CYMA 4CZHA 4CJUA 3DMJA 1KLMA 4FO0A 1YHQN 1X3MA 4F9OA 1ATNA 5M1NA 4JEPA 4BE0A 5CZ2A 3T3FA 2O8BA 3V4IA 3RRGA 4BQLA 4L8RB 1BDGA 2GBZA 4DTOA 1K9MO 2RN2A 3C65A 2PZSA 3V1RA 4A62A 1SV5A 1ZBHA 3I33A 3HPHA 1D9FA 1E3MA 2JWLA 1ZXOA 3O4NA 5EVZA 3ZT0A 5GAEP 1X9MA 1E4FT 1DGKN 4HWIA 3S9HA 4JK9A 2HMIA 3KZBA 1NMDA 3LPUA 1O13A 4ID1A 2P1JA 5FPNA 3SZ2A 4BRQA 4CBWA 1W9HA 5DK5A 3OYLA 2Y1JA 1TL1A 2IGIA 4WCEL 1IKYA 2OPRA 4AF1A 1WSEA 4GV6A 4W5QA 4BVOA 1WAFA 2FF3B 4DF4A 5LY3A 1Q9XA 2Z1JA 3OYBA 4PL7A 2PY5A 5FLXO 3OY9A 1RDBA 1L3SA 1JXBA 3M5RA 3U9DA 3PX4A 2DFEA 4JI3K 3CJCA 4H5RA 5AQVA 1RT6A 4LD0A 2Q0RA 2HW3A 3AVMA 2A41A 3M1FA 4ELTA 1SS6A 4E7IA 4DSLA 3HVTA 4MDBA 2E1YA 2KLAA 3OYFA 1XNRK 1B9DA 2O4GA 1N36K 1T8EA 3AAPA 1I94K 1JLAA 4BGAA 1VSHA 1QHAA 1WSJA 3DYAA 1VQON 4FL9A 4EP4A 4F3TA 1CXQA 3AA3A 5J2MA 1HX1A 3R8EA 4HTLA 4BY9C 2A1RA 2KZZA 5EY4A 3HO1A 1JXEA 3HRGA 2YNGA 3O9UA 4FM0A 1FK9A 4CF2A 1YJWN 4CJPA 1GOCA 1Q86O 1H1VA 2IC3A 2GWJA 1S1XA 1S1TA 4FJ9A 4K0KK 3OBYA 4DV2K 4IZ9A 4F4KA 3O3GA 2IVNA 3CM5A 1RT1A 3SJJA 4MLHA 3QESA 4YY3K 4GNIA 1KQSM 1RDDA 3VQDA 2W40A 1VSIA 2UUCK 1CZAN 5AQOA 2CH5A 5KRTA 5HP1A 2E1ZA 1YJ9N 5BPMA 3O1WA 2ZE2A 3LP2A 4CEOA 4WQ4A 4WQ5C 4B9SA 4MO5A 3J7AP 1S72N 2ASMA 1YIJN 1W97L 4WF9L 3GG4A 1EX4A 5TKYA 1NGJA 2Q2RA 4IEIA 1P8ZA 1NGGA 3PX6A 5E84A 3EKUA 4Z4EA 3AVCA 3DLRA 4CW7B 5BN9A 3V9ZA 4IKFA 3WXJA 4ID5A 2QKBA 3SYZA 4J2DA 3P4IA 4OJRA 3T69A 4FVUA 3SV3A 1FXXA 3DXMA 3WT0A 5EX5A 5GINA 4PKHA 3HP6A 4PKIA 3O3FA 3HI0A 4IDKA 2E8AA 3SQ1A 1KVCA 2YHWA 3DM2A 4ILJA 2VYPA 4KO0A 1VQ7N 3MEGA 2VGMA 2X6SA 3OS1A 2WOMA 4JK8A 2O8EB 1RTIA 4FLTA 3K5NA 3VOVA 4FCYA 3IMXA 3LWLA 2W6KA 3VQ8A 4DQIA 2V7ZA 4FJJA 2Q36A 4FWOA 3SK3A 2VQFK 5AZIB 3BEXA 3DAWA 4JI2K 3THVA 4TSXA 5DM7L 3L2RA 4DQ8A 3RMBA 2CGJA 3O5BA 5EXWA 4BC2A 4CZIA 3MMVA 1S1VA 1NK8A 4F2RA 3Q7BA 3G10A 3ZSQA 2O8EA 3VESA 4JKDA 2VWBA 4N76A 4BC4A 3QIOA 3WEEA 3AY9A 5AZIA 4A5AA 4CK1A 4XEIA 3BZCA 2E88A 3FE1A 4H5VA 5J2PA 3MCAB 4H03B 2OYQA 3U3GA 3VQ4A 3CFPA 4YOYA 5FPDA 4CJRA 1X1PA 3NE6A 2FXUA 5KI6A 3AO2A 3M8RA 5LMNK 1NG9A 5AQNA 4I7FA 1RTDA 4FWQA 1NGDA 3D2FB 2QW9A 3HSCA 3M3ZA 2HNDA 4FWMA 4BRLA 3P5JA 3A0IX 5M1PA 1HPMA 2I7PA 2YNHA 3OA9A 3MAQA 3IAYA 3EE9A 2O4IA 4IJNA 4Q5VA 1JKHA 4FJKA 2YNFA 3A5NC 4A61A 3TANA 1MWKA 4N5SA 3QB0A 3O08A 1HMVA 3ZSVA 4EZ6A 2IDOA 3C95A 3VETA 4DSIA 4FJIA 3P39A 3LDOA 1X9JA 3L3VA 3C6UA 3QFPA 3GDQA 5C0YA 4DLEA 4F2SA 1SQKA 2P9NB 2GTDA 4FWLA 4PL8A 3S41A 4FW1A 1OH8A 3SNNA 4I9QA 5AQQA 1NGBA 3CJAA 4KBOA 3OHRA 2GUIA 3CPEA 4JK7A 3O9SA 4OKEA 1RDWX 1BGXT 1XMQK 2G8HA 4AHTA 2CH6A 4KAZA 4H0YB 4EZ9A 4NXMK 3QERA 1RT4A 2E2NA 3KD1E 2FBXA 1BU6O 4FWSA 2HNZA 3TAGA 2HF3A 2Z1IA 2KHOA 3JYTA 3THXB 3QNOA 3DWLA 1GLBG 2GWKA 2KQ2A 1U04A 1G99A 1QQOA 3MN9A 3S3MA 4IOXA 5M1OA 4AHUA 3CCVN 3JS6A 1HYVA 4BGBA 3TSQA 2ZJPL 3FLCO 4B1WB 3KLHA 3IKMA 2E2OA 1Y64A 4C8NA 4B1YB 3TR8A 4AHCA 3HBTA 4DTNA 2P5OA 3WXLA 1GLCG 2WC9A 3FZHA 3ZT1A 4CZLA 1SKWA 3IDHA 1W7AA 4CJKA 5GIOA 3J80O 4ZTJA 3BUZB 4CEQA 4CGDA 4DR5K 3CCQN 4BC3A 3W0LA 5AQYA 1NJYA 4CZMA 3LALA 2O8CA 4MDAA 3KLEA 2GEMA 1SZ2A 4BR9A 1Z26A 3K2PA 3OJSA 3ID8A 4CHNA 2A5XA 2WBNA 1VSEA 1RBVA 3AA4A 4N56A 3NH1A 1NJWA 3LDNA 5IWAK 5JS1A 4CIFA 4DS5A 3TAPA 4ELUA 3CERA 3WNFA 2RHKA 4DV6K 4DR1K 3RTVA 2AP1A 1HYSA 4KI4A 4Z94A 3CG7A 4KKOA 2O8FB 1EXQA 3MCPA 2P9LB 1RT3A 1KAXA 4DS4A 1X9SA 4CF1A 2OZMA 3ULDA 2E2PA 1UWBA 3J7YP 3EE8A 4FJXA 5FRMA 4BDZA 1HNWK 4Q0BA 4C23A 3EYZA 1LWFA 3FZFA 1MU2A 1Z05A 1DLOA 2QWOA 3H1QA 5I42A 1OKJA 1OH5A 1NGCA 3K57A 1U45A 3PO4A 4CHYA 3VEYA 1BIZA 2O8FA 2DFFA 1LWEA 1R0AA 1YJNN 2P9SB 4M63C 3SPZA 5CZ1A 2HHUA 1TKDA 1HNXK 3O9QA 4C1NK 3KLGA 1LW2A 1YI2N 3ZSXA 5JLFA 4CF8A 2XY8A 4O0JA 5BPNA 4BQZA 4FPBA 3IRXA 4KHPK 1SL2A 1S9EA 3ZSZA 4CEEA 3O4QA 5AQHA 3H6EA 5FPMA 1TKXA 4DTRA 5GAHP 4RCHA 4CERA 4DV7K 2P9SA 4AM6A 5C15A 2XY5A 2P5GA 2KTQA 2QWNA 4DTMA 1C0MA 1HJOA 1YVUA 3CQ8A 4CZGA 1U6ZA 4EHTA 1RDAA 5BRHA 4DFMA 1HQEA 1KSPA 1N6QA 5AQKA 3ZT2A 5B8HA 3LWMA 3F9MA 2ZJQL 3CPWM 4JKBA 4FZZA 1BCOA 1CZBA 1D9DA 1ZBUA 3DXKB 3AVLA 4CGIA 1NKEA 1V4SA 4Z4CA 1M1KO 4DU3A 3S3NA 4ICLA 5C2DA 2D0AA 3F5TA 1ZBSA 1QTMA 4BE2A 2A3ZA 4RW8A 4MLEA 4RTFD 1JLCA 2QWLA 3V9UA 3TAMA 5M1FA 2YHAA 1NM1A 3T19A 1C6VA 3FR0A
chains in the Genus database with same CATH topology
3OY9A 1RDBA 2HHTA 3HYFA 1L3SA 4E0DA 3ISNC 1T03A 1JXBA 4OGCA 3PX4A 4CE9A 2DFEA 4CJTA 1KCFA 2HVIA 4IFYA 4FJHA 3OYCA 3U6FA 4DU1A 4J2EA 1RT6A 4FM1A 3VQEA 4FK4A 4FLXA 4LD0A 1VSJA 2HW3A 1B92A 3AVMA 2Y1IA 4CJFA 5KGWA 3MXMA 4KI6A 1YTUA 1CXUA 4DSEA 4ELTA 4YNQA 3C6TA 4E7IA 1RT7A 4DSLA 1JL2A 4I2QA 4DQRA 3HVTA 1ASWA 1EP4A 5K14A 3CM6A 4BDYA 3DLKA 1QSSA 2G8IA 1WSFA 3OYFA 4OVLA 2DY4A 4C8LA 3OYKA 3SI6A 2Z1HA 3DLGA 2YKNA 2BANA 1B9DA 2EHGA 2O4GA 4NCGA 3L2UA 3HJFA 1IKXA 4M3RA 2RPIA 4RW6A 2HNYA 1T8EA 1GOBA 1JLAA 3AO5A 1VSHA 3AVHA 1WSJA 2EX3A 1BIUA 3DYAA 3ZSRA 4EP4A 4F3TA 1CXQA 1JLBA 3AA3A 4LSNA 5SZTA 5J2MA 2HB5A 4JS4A 4CFBA 4FLWA 3K58A 1JLFA 1S6QA 4LY7A 1NK6A 3NGZA 4FLUA 1JLQA 3CFOA 1BISA 4E3SA 2A1RA 2KZZA 3HVRA 1IKVA 3HO1A 1HJRA 4CGJA 3HT3A 3ZSYA 2B5JA 1JXEA 2YNGA 2VWKA 4FM0A 1FK9A 1IH7A 2YHBA 2YNIA 4CF2A 4JRPA 4FJ7A 1CZ9A 4RW4A 3ZSOA 1RBUA 4CJPA 3MXIA 1S6PA 3SQ4A 1GOCA 2YKMA 1I39A 4OPJA 3DOKA 3OYNA 3L2WA 3OYHA 1FKPA 2IC3A 4Z4HA 1EKEA 1BQMA 1S1XA 1S1TA 3D0PA 3I0RA 2OA8A 4FJ9A 3KTQA 4RG8A 3LAKA 3VA0A 4ZHRA 1KVAA 3ZT4A 1HPZA 5C42A 4M42A 4F4KA 3O3GA 4C8KA 3NFAA 3AVBA 3CM5A 4KB0A 1N5YA 1K6YA 4CFAA 1RT5A 4AHRA 1RT1A 3L2QA 3LP1A 3T1AA 3SJJA 1IG9A 3VA3A 2RKIA 2DTUA 4M3ZA 4BWJA 1JLGA 4CIEA 3QESA 1RDDA 3VQDA 3RMCA 1W0HA 3HP9A 2D0CA 3HPGA 1VSIA 1RBSA 3AVFA 4DFJA 5KRTA 4IG0A 3I0SA 4DG1A 5HP1A 4PY5A 1SKSA 2A1SA 2Q3SA 4N47A 3RRHA 3KK1A 2G8KA 4CJSA 1ZBFA 2LSNA 2ZE2A 3LP2A 4CEOA 2G8WA 2HHWA 1TK5A 3MEDA 4B9SA 3NF6A 4DU4A 3NH2A 3PO5A 3OYDA 4CHZA 1RBRA 4FW2A 4DQQA 2ETJA 3DRSA 4C8OA 3SQ2A 4E7KA 1J53A 1EX4A 2WONA 4DTXA 4Z4FA 4DF8A 4H8KA 1I3AA 3IS9A 3AVNA 3A2FA 3TWHA 3PV8A 3WNHA 4E7HA 4CHQA 1LAWA 3PX6A 1J5OA 4DSJA 5FRNA 3IG1A 4Z4EA 3QNNA 3AO3A 3H08A 1CLQA 3AVCA 3DLRA 3DRPA 4IKFA 3V9ZA 4ID5A 4CGHA 3SYZA 1C0TA 2QKBA 4G1QA 2OZSA 3L2VA 5KGXA 4OKJA 1BL3A 4J2DA 4OJRA 3NCIA 5HLFA 3AVKA 3M8SA 1VRUA 3SV3A 1HNIA 1FXXA 5CYQA 3TARA 4AHVA 4QCLA 4W5RA 2G8UA 1REVA 3V6DA 1TV6A 1A5WA 4B08A 2Z1GA 3HP6A 3O3FA 4AILC 4KFBA 1RT2A 1UA1A 3HL8A 1TAUA 1SUQA 2IAJA 2FBYA 2ITGA 4IDKA 3SQ1A 1QE1A 3AVIA 1KVCA 3DM2A 4CEDA 4KO0A 3RMDA 1F21A 1VSFA 3MEGA 1IKWA 4CK3A 1VSLA 3PX0A 4FJLA 2X6SA 3OS1A 4PQUA 3VQ6A 2WOMA 4KHYA 4JS5A 1RTIA 4FLTA 4FYDA 3L8BA 3K5NA 3LZIA 2G8VA 4B9LA 2P51A 1RTHA 4FCYA 3LWLA 4M3WA 3VQ8A 4HUGA 4DQIA 4HHTA 4FJJA 4ELVA 4OLAA 3DOLA 4CJ5A 3NDKA 4NCAA 3V9WA 3OYGA 4KTWA 3QETA 3THVA 3VQBA 4B9NA 4CF0A 4TSXA 2HHQA 3L2RA 2FC0A 4Y1CA 4O55A 3RMBA 1NK0A 3B6PA 1DTQA 3QINA 3LDSA 4FJ8A 4IBNA 3SPYA 1YTAA 3K5MA 4CCHA 3UIQA 1G15A 2XY7A 4H4OA 4O0IA 4F2RA 1S1VA 1NK8A 2FBVA 3OYIA 1L3VA 1VSMA 3WNGA 1WSGA 3L3UA 3G10A 3ZSQA 4CHPA 1U4BA 1FKOA 1TGOA 2B4JA 5J1EA 3LPTA 5HBMA 5SWMA 5T7BA 3KK2A 4FLVA 4N76A 4RW9A 1VK0A 4F8RA 3VQ9A 3QIOA 3NHGA 4HUEA 3TAQA 1TK8A 5HRNA 5HROA 1C1CA 1RNHA 4CK1A 4CFDA 1KVBA 4CJEA 3OYAA 3RR8A 1J54A 5J2PA 3AV9A 2YV0X 3QO9A 4CESA 1NOYA 1SKRA 3HPOA 2OYQA 4Z4IA 3K5LA 1TK0A 3NF7A 4KREA 3U3GA 1C1AA 3VQ4A 2X78A 4B8CA 4CIGA 3CFPA 4CJWA 4LSLA 4CJRA 1X1PA 2KFZA 3AVAA 1RDCA 1BI4B 1LAVA 1RCHA 4Y1DA 5KI6A 3I8DA 3NE6A 1EETA 2PYJA 1WLJA 3AO2A 4WE1A 3M8RA 2X6NA 1UA0A 2G8FA 4I7FA 1RTDA 3ASMA 3QEIA 3EZ5A 1JL1A 4FVMA 4OLBA 4KTQA 1NOZA 2HNDA 3NF9A 3DI6A 3NGIA 4M3XA 2F96A 3P5JA 2VG6A 4RW7A 1ZBLA 3OYMA 4DWIA 1A5VA 3DLBA 2YNHA 4M41A 3KJVA 3TABA 4DQPA 3S3OA 3MAQA 1ASUA 3IAYA 4M3TA 4CJVA 2QKKA 2O4IA 2FBTA 4Q5VA 2KFNA 1U48A 2GV9A 4B8AB 1JKHA 3JSMA 4FJKA 4HCCA 4KHWA 1HYZA 2YNFA 2W42A 3V9XA 3VN5A 3TANA 1BI4A 3LP0A 4IG3A 4N5SA 1A5XA 4DLGA 4KHSA 1HMVA 3ZSVA 1TL3A 4CJ3A 4EZ6A 3PUFA 4E1NA 4GW6A 4FLYA 3SCXA 2OPQA 4DSFA 2IDOA 3C95A 3TI0A 4DSIA 4FJIA 1NK5A 2F8TA 2OPSA 3L3VA 3C6UA 2XHBA 1BCMA 3KIOA 3NH0A 4DLEA 1SL1A 1KFSA 4F2SA 4PUOA 3QIPA 4B9VA 1VSDA 3QEXA 2HHXA 1NK4A 4BWMA 4FW1A 4FZXC 3SNNA 4I9QA 3AO1A 1TVRA 3BGRA 1S1WA 3HM9A 4FJGA 4GMJB 1WAJA 3VQ5A 1JLEA 4W5TA 1T05A 2GUIA 1XHXA 1VRTA 4OKEA 3RWUA 3DLHA 3LZJA 1QSLA 4LH4A 4KHUA 1TKZA 1BGXT 4QAGA 1YT3A 4NYFA 2G8HA 4AHTA 4B9UA 4GVMA 4DFKA 4EP5A 4KAZA 1Z25A 4EZ9A 3QERA 1RT4A 4JLHA 5EU7A 4F3OA 4PWDA 3MECA 3P83D 4E7JA 3KD1E 2RF2A 4KRFA 3KLIA 2FBXA 1QSYA 3V1QA 3E01A 2HNZA 4Z0UA 3ALYA 3MEEA 3ITHA 4NCBA 3TAGA 5D3GA 2Z1IA 4CGFA 1UAXA 1S5JA 2D0BA 3JYTA 4H4MA 3QNOA 5HRSA 1S9GA 4E1MA 1LV5A 1O1WA 1L3TA 1Y97A 4MQ3A 2XO7A 4J2AA 3QEWA 2KQ2A 1U04A 2IS3A 3S3MA 2BDPA 4B9MA 3VQQA 4AHUA 4E7LA 1L3UA 5J2NA 1XHZA 1WNSA 1QS4A 3LANA 5CYMA 4E89A 1HYVA 3NF8A 4PA1A 4FM2A 4BDPA 4YFUA 4W5OA 4M45A 4CFCA 2KW4A 3ZCMA 3F73A 3QEPA 5I3UA 2JLEA 1J9AA 3O3HA 1ZYQA 4O5BA 3SV4A 3VQCA 1QHTA 1SL0A 1XWLA 4OKKA 3KLHA 3V81A 4AHSA 4CECA 4DSKA 4C8NA 2BGGA 3VQ7A 3HSTB 3TR8A 4AHCA 3K59A 3HK2A 4DTNA 2HHVA 4KTZA 2P5OA 2VG7A 3M8QA 2E6MA 4NYNA 4DMNA 4FJMA 1HNVA 1BQNA 1KFDA 3ZT1A 4J2BA 4CGGA 1SKWA 2PYLA 2HHSA 1X9WA 4CJKA 1T7PA 4KB1A 4QOZB 1KLNA 1ZBIA 4FJNA 4ZTJA 2E4LA 3ZSWA 2ZD1A 4CEQA 4CGDA 3SUQA 4E19A 1C1BA 2X74A 1KTQA 2B6AA 3KLFA 3NAEA 4AH9A 1NJYA 3LALA 2QXFA 3RR7A 1UOCA 3KLEA 1NK9A 2F8SA 5HRPA 4DTJA 4ZTFA 1Z26A 3K2PA 3OJSA 3AA2A 4CHNA 5KTQA 3CFRA 2R7YA 4FXDA 1VSEA 3P1GA 2NUBA 1RBVA 3AA4A 5J2QA 1NK7A 4N56A 4CEFA 3NH1A 1NJWA 2HVHA 4Z4GA 5FDLA 1Q9YA 5JS1A 3AO4A 4BE1A 3SUPA 4CIFA 4DS5A 4DTPA 2XY6A 3BDPA 3TAPA 4ELUA 4CJ4A 2VG5A 1D5AA 4HVJA 3DLEA 1QQCA 4JRQA 3AA5X 3VQAA 1XC9A 1DTTA 3WNFA 4I9LA 1NKCA 4FK2A 3RTVA 1HYSA 3OVNA 3QLHA 1VSKA 3OS0A 4KI4A 3CG7A 4FK0A 4KKOA 1LWCA 1C0UA 3OYJA 4CHOA 5E41A 3SUOA 1EXQA 3C94A 3LP3A 1RT3A 2ZQBA 3TAEA 5C25A 1WSIA 1WSHA 1TAQA 4K8ZA 1U49A 3OYEA 2BE2A 1KRPA 4DS4A 1X9SA 2D5RA 4CF1A 2OPPA 4OPKA 1LW0A 4HTUA 1RTJA 3ULDA 2OZMA 2AJQA 4M3YA 1UWBA 4FJXA 4I2PA 4CJLA 3VQPA 4DTSA 5FRMA 4BDZA 4Q0BA 5FROA 1Q8IA 2QK9A 3EYZA 1NJXA 5KRSA 1RBTA 1S1UA 1LWFA 2ATQA 1B9FA 4CK2A 1MU2A 3KKSA 1DLOA 1RILA 5CY4A 4XIUA 4HCBA 4N41A 5I42A 3SQ0A 2E6LA 3K57A 1U45A 3PO4A 3CYMA 4CHYA 4CJUA 4CEZA 1BIZA 3V9SA 1NKBA 2DFFA 1LWEA 3B6OA 1R0AA 3DMJA 1HRHA 1KLMA 3WNEA 5CZ1A 3U3YA 3SPZA 2HHUA 1TKDA 3PY8A 3FFIA 4BE0A 5CZ2A 3T3FA 4KPYA 3KLGA 1LW2A 3QEVA 3V4IA 3RRGA 3AVGA 4L8RB 2GBZA 3ZSXA 4K8XA 4DTOA 4FJ5A 4CF8A 2XY8A 4O0JA 2RN2A 4DTUA 2PZSA 4DQSA 1NJZA 3V1RA 3AVJA 1ZBHA 1SV5A 3KK3A 4W5NA 3IRXA 3HPHA 1D9FA 4LH5A 3M8PA 1SL2A 1U47A 1S9EA 5HRRA 3ZSZA 4CEEA 3O4NA 3ZT0A 3KD5E 3O4QA 1X9MA 1BHLA 4O4GA 3OJUA 3EY1A 5DMRA 1TKXA 4DTRA 2I5JA 4CJQA 3LAMA 4R5PA 3S9HA 4CERA 2HMIA 3HXMA 4KV8A 4OGEA 4CEAA 2XY5A 2P5GA 2KTQA 2DFHA 5JS2A 3LPUA 4DTMA 1C0MA 1YVUA 4ID1A 3TAFA 2P1JA 3CQ8A 3SZ2A 4HUFA 1RDAA 4O44A 3NGYA 4DFMA 1HQEA 4CF9A 1KSPA 1N6QA 1W9HA 4UQGA 1WN7A 5DK5A 3ZT2A 2VWJA 1ITGA 4MFBA 3LWMA 1XI1A 3OYLA 2Y1JA 3OS2A 4KHNA 3KKRA 1TL1A 2IGIA 4FZZA 1BCOA 1CZBA 4DFPA 1ZBUA 1D9DA 3MXJA 3AVLA 1HQUA 3RMAA 1L5UA 4CGIA 4FLZA 1NKEA 1GOAA 4C8MA 1ASVA 3NBPA 1IKYA 3V1OA 3K5OA 4Z4CA 2OPRA 4DU3A 3SUNA 3S3NA 4ICLA 5C24A 2D0AA 1WSEA 1QTMA 4B3OA 3F9KA 4IFVA 4BE2A 4W5QA 4B9TA 2KZMA 4RW8A 1D8YA 1WAFA 4DF4A 4KHQA 2IOCA 3DRRA 1Q9XA 2Z1JA 4FZYA 3OYBA 1JLCA 2XRIA 1C6VA 3G0ZA 1TKTA 3TAMA 3V9UA 2PY5A 3ZT3A 2YHAA 3D45A 4BACA 3T19A 4CEBA 2JGUA 1IO2A 4M3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OY9 A;  1RDB A;  2HHT A;  3HYF A;  1L3S A;  4E0D A;  3ISN C;  1T03 A;  1JXB A;  4OGC A;  3PX4 A;  4CE9 A;  2DFE A;  4CJT A;  1KCF A;  2HVI A;  4IFY A;  4FJH A;  3OYC A;  3U6F A;  4DU1 A;  4J2E A;  1RT6 A;  4FM1 A;  3VQE A;  4FK4 A;  4FLX A;  4LD0 A;  1VSJ A;  2HW3 A;  1B92 A;  3AVM A;  2Y1I A;  4CJF A;  5KGW A;  3MXM A;  4KI6 A;  1YTU A;  1CXU A;  4DSE A;  4ELT A;  4YNQ A;  3C6T A;  4E7I A;  1RT7 A;  4DSL A;  1JL2 A;  4I2Q A;  4DQR A;  3HVT A;  1ASW A;  1EP4 A;  5K14 A;  3CM6 A;  4BDY A;  3DLK A;  1QSS A;  2G8I A;  1WSF A;  3OYF A;  4OVL A;  2DY4 A;  4C8L A;  3OYK A;  3SI6 A;  2Z1H A;  3DLG A;  2YKN A;  2BAN A;  1B9D A;  2EHG A;  2O4G A;  4NCG A;  3L2U A;  3HJF A;  1IKX A;  4M3R A;  2RPI A;  4RW6 A;  2HNY A;  1T8E A;  1GOB A;  1JLA A;  3AO5 A;  1VSH A;  3AVH A;  1WSJ A;  2EX3 A;  1BIU A;  3DYA A;  3ZSR A;  4EP4 A;  4F3T A;  1CXQ A;  1JLB A;  3AA3 A;  4LSN A;  5SZT A;  5J2M A;  2HB5 A;  4JS4 A;  4CFB A;  4FLW A;  3K58 A;  1JLF A;  1S6Q A;  4LY7 A;  1NK6 A;  3NGZ A;  4FLU A;  1JLQ A;  3CFO A;  1BIS A;  4E3S A;  2A1R A;  2KZZ A;  3HVR A;  1IKV A;  3HO1 A;  1HJR A;  4CGJ A;  3HT3 A;  3ZSY A;  2B5J A;  1JXE A;  2YNG A;  2VWK A;  4FM0 A;  1FK9 A;  1IH7 A;  2YHB A;  2YNI A;  4CF2 A;  4JRP A;  4FJ7 A;  1CZ9 A;  4RW4 A;  3ZSO A;  1RBU A;  4CJP A;  3MXI A;  1S6P A;  3SQ4 A;  1GOC A;  2YKM A;  1I39 A;  4OPJ A;  3DOK A;  3OYN A;  3L2W A;  3OYH A;  1FKP A;  2IC3 A;  4Z4H A;  1EKE A;  1BQM A;  1S1X A;  1S1T A;  3D0P A;  3I0R A;  2OA8 A;  4FJ9 A;  3KTQ A;  4RG8 A;  3LAK A;  3VA0 A;  4ZHR A;  1KVA A;  3ZT4 A;  1HPZ A;  5C42 A;  4M42 A;  4F4K A;  3O3G A;  4C8K A;  3NFA A;  3AVB A;  3CM5 A;  4KB0 A;  1N5Y A;  1K6Y A;  4CFA A;  1RT5 A;  4AHR A;  1RT1 A;  3L2Q A;  3LP1 A;  3T1A A;  3SJJ A;  1IG9 A;  3VA3 A;  2RKI A;  2DTU A;  4M3Z A;  4BWJ A;  1JLG A;  4CIE A;  3QES A;  1RDD A;  3VQD A;  3RMC A;  1W0H A;  3HP9 A;  2D0C A;  3HPG A;  1VSI A;  1RBS A;  3AVF A;  4DFJ A;  5KRT A;  4IG0 A;  3I0S A;  4DG1 A;  5HP1 A;  4PY5 A;  1SKS A;  2A1S A;  2Q3S A;  4N47 A;  3RRH A;  3KK1 A;  2G8K A;  4CJS A;  1ZBF A;  2LSN A;  2ZE2 A;  3LP2 A;  4CEO A;  2G8W A;  2HHW A;  1TK5 A;  3MED A;  4B9S A;  3NF6 A;  4DU4 A;  3NH2 A;  3PO5 A;  3OYD A;  4CHZ A;  1RBR A;  4FW2 A;  4DQQ A;  2ETJ A;  3DRS A;  4C8O A;  3SQ2 A;  4E7K A;  1J53 A;  1EX4 A;  2WON A;  4DTX A;  4Z4F A;  4DF8 A;  4H8K A;  1I3A A;  3IS9 A;  3AVN A;  3A2F A;  3TWH A;  3PV8 A;  3WNH A;  4E7H A;  4CHQ A;  1LAW A;  3PX6 A;  1J5O A;  4DSJ A;  5FRN A;  3IG1 A;  4Z4E A;  3QNN A;  3AO3 A;  3H08 A;  1CLQ A;  3AVC A;  3DLR A;  3DRP A;  4IKF A;  3V9Z A;  4ID5 A;  4CGH A;  3SYZ A;  1C0T A;  2QKB A;  4G1Q A;  2OZS A;  3L2V A;  5KGX A;  4OKJ A;  1BL3 A;  4J2D A;  4OJR A;  3NCI A;  5HLF A;  3AVK A;  3M8S A;  1VRU A;  3SV3 A;  1HNI A;  1FXX A;  5CYQ A;  3TAR A;  4AHV A;  4QCL A;  4W5R A;  2G8U A;  1REV A;  3V6D A;  1TV6 A;  1A5W A;  4B08 A;  2Z1G A;  3HP6 A;  3O3F A;  4AIL C;  4KFB A;  1RT2 A;  1UA1 A;  3HL8 A;  1TAU A;  1SUQ A;  2IAJ A;  2FBY A;  2ITG A;  4IDK A;  3SQ1 A;  1QE1 A;  3AVI A;  1KVC A;  3DM2 A;  4CED A;  4KO0 A;  3RMD A;  1F21 A;  1VSF A;  3MEG A;  1IKW A;  4CK3 A;  1VSL A;  3PX0 A;  4FJL A;  2X6S A;  3OS1 A;  4PQU A;  3VQ6 A;  2WOM A;  4KHY A;  4JS5 A;  1RTI A;  4FLT A;  4FYD A;  3L8B A;  3K5N A;  3LZI A;  2G8V A;  4B9L A;  2P51 A;  1RTH A;  4FCY A;  3LWL A;  4M3W A;  3VQ8 A;  4HUG A;  4DQI A;  4HHT A;  4FJJ A;  4ELV A;  4OLA A;  3DOL A;  4CJ5 A;  3NDK A;  4NCA A;  3V9W A;  3OYG A;  4KTW A;  3QET A;  3THV A;  3VQB A;  4B9N A;  4CF0 A;  4TSX A;  2HHQ A;  3L2R A;  2FC0 A;  4Y1C A;  4O55 A;  3RMB A;  1NK0 A;  3B6P A;  1DTQ A;  3QIN A;  3LDS A;  4FJ8 A;  4IBN A;  3SPY A;  1YTA A;  3K5M A;  4CCH A;  3UIQ A;  1G15 A;  2XY7 A;  4H4O A;  4O0I A;  4F2R A;  1S1V A;  1NK8 A;  2FBV A;  3OYI A;  1L3V A;  1VSM A;  3WNG A;  1WSG A;  3L3U A;  3G10 A;  3ZSQ A;  4CHP A;  1U4B A;  1FKO A;  1TGO A;  2B4J A;  5J1E A;  3LPT A;  5HBM A;  5SWM A;  5T7B A;  3KK2 A;  4FLV A;  4N76 A;  4RW9 A;  1VK0 A;  4F8R A;  3VQ9 A;  3QIO A;  3NHG A;  4HUE A;  3TAQ A;  1TK8 A;  5HRN A;  5HRO A;  1C1C A;  1RNH A;  4CK1 A;  4CFD A;  1KVB A;  4CJE A;  3OYA A;  3RR8 A;  1J54 A;  5J2P A;  3AV9 A;  2YV0 X;  3QO9 A;  4CES A;  1NOY A;  1SKR A;  3HPO A;  2OYQ A;  4Z4I A;  3K5L A;  1TK0 A;  3NF7 A;  4KRE A;  3U3G A;  1C1A A;  3VQ4 A;  2X78 A;  4B8C A;  4CIG A;  3CFP A;  4CJW A;  4LSL A;  4CJR A;  1X1P A;  2KFZ A;  3AVA A;  1RDC A;  1BI4 B;  1LAV A;  1RCH A;  4Y1D A;  5KI6 A;  3I8D A;  3NE6 A;  1EET A;  2PYJ A;  1WLJ A;  3AO2 A;  4WE1 A;  3M8R A;  2X6N A;  1UA0 A;  2G8F A;  4I7F A;  1RTD A;  3ASM A;  3QEI A;  3EZ5 A;  1JL1 A;  4FVM A;  4OLB A;  4KTQ A;  1NOZ A;  2HND A;  3NF9 A;  3DI6 A;  3NGI A;  4M3X A;  2F96 A;  3P5J A;  2VG6 A;  4RW7 A;  1ZBL A;  3OYM A;  4DWI A;  1A5V A;  3DLB A;  2YNH A;  4M41 A;  3KJV A;  3TAB A;  4DQP A;  3S3O A;  3MAQ A;  1ASU A;  3IAY A;  4M3T A;  4CJV A;  2QKK A;  2O4I A;  2FBT A;  4Q5V A;  2KFN A;  1U48 A;  2GV9 A;  4B8A B;  1JKH A;  3JSM A;  4FJK A;  4HCC A;  4KHW A;  1HYZ A;  2YNF A;  2W42 A;  3V9X A;  3VN5 A;  3TAN A;  1BI4 A;  3LP0 A;  4IG3 A;  4N5S A;  1A5X A;  4DLG A;  4KHS A;  1HMV A;  3ZSV A;  1TL3 A;  4CJ3 A;  4EZ6 A;  3PUF A;  4E1N A;  4GW6 A;  4FLY A;  3SCX A;  2OPQ A;  4DSF A;  2IDO A;  3C95 A;  3TI0 A;  4DSI A;  4FJI A;  1NK5 A;  2F8T A;  2OPS A;  3L3V A;  3C6U A;  2XHB A;  1BCM A;  3KIO A;  3NH0 A;  4DLE A;  1SL1 A;  1KFS A;  4F2S A;  4PUO A;  3QIP A;  4B9V A;  1VSD A;  3QEX A;  2HHX A;  1NK4 A;  4BWM A;  4FW1 A;  4FZX C;  3SNN A;  4I9Q A;  3AO1 A;  1TVR A;  3BGR A;  1S1W A;  3HM9 A;  4FJG A;  4GMJ B;  1WAJ A;  3VQ5 A;  1JLE A;  4W5T A;  1T05 A;  2GUI A;  1XHX A;  1VRT A;  4OKE A;  3RWU A;  3DLH A;  3LZJ A;  1QSL A;  4LH4 A;  4KHU A;  1TKZ A;  1BGX T;  4QAG A;  1YT3 A;  4NYF A;  2G8H A;  4AHT A;  4B9U A;  4GVM A;  4DFK A;  4EP5 A;  4KAZ A;  1Z25 A;  4EZ9 A;  3QER A;  1RT4 A;  4JLH A;  5EU7 A;  4F3O A;  4PWD A;  3MEC A;  3P83 D;  4E7J A;  3KD1 E;  2RF2 A;  4KRF A;  3KLI A;  2FBX A;  1QSY A;  3V1Q A;  3E01 A;  2HNZ A;  4Z0U A;  3ALY A;  3MEE A;  3ITH A;  4NCB A;  3TAG A;  5D3G A;  2Z1I A;  4CGF A;  1UAX A;  1S5J A;  2D0B A;  3JYT A;  4H4M A;  3QNO A;  5HRS A;  1S9G A;  4E1M A;  1LV5 A;  1O1W A;  1L3T A;  1Y97 A;  4MQ3 A;  2XO7 A;  4J2A A;  3QEW A;  2KQ2 A;  1U04 A;  2IS3 A;  3S3M A;  2BDP A;  4B9M A;  3VQQ A;  4AHU A;  4E7L A;  1L3U A;  5J2N A;  1XHZ A;  1WNS A;  1QS4 A;  3LAN A;  5CYM A;  4E89 A;  1HYV A;  3NF8 A;  4PA1 A;  4FM2 A;  4BDP A;  4YFU A;  4W5O A;  4M45 A;  4CFC A;  2KW4 A;  3ZCM A;  3F73 A;  3QEP A;  5I3U A;  2JLE A;  1J9A A;  3O3H A;  1ZYQ A;  4O5B A;  3SV4 A;  3VQC A;  1QHT A;  1SL0 A;  1XWL A;  4OKK A;  3KLH A;  3V81 A;  4AHS A;  4CEC A;  4DSK A;  4C8N A;  2BGG A;  3VQ7 A;  3HST B;  3TR8 A;  4AHC A;  3K59 A;  3HK2 A;  4DTN A;  2HHV A;  4KTZ A;  2P5O A;  2VG7 A;  3M8Q A;  2E6M A;  4NYN A;  4DMN A;  4FJM A;  1HNV A;  1BQN A;  1KFD A;  3ZT1 A;  4J2B A;  4CGG A;  1SKW A;  2PYL A;  2HHS A;  1X9W A;  4CJK A;  1T7P A;  4KB1 A;  4QOZ B;  1KLN A;  1ZBI A;  4FJN A;  4ZTJ A;  2E4L A;  3ZSW A;  2ZD1 A;  4CEQ A;  4CGD A;  3SUQ A;  4E19 A;  1C1B A;  2X74 A;  1KTQ A;  2B6A A;  3KLF A;  3NAE A;  4AH9 A;  1NJY A;  3LAL A;  2QXF A;  3RR7 A;  1UOC A;  3KLE A;  1NK9 A;  2F8S A;  5HRP A;  4DTJ A;  4ZTF A;  1Z26 A;  3K2P A;  3OJS A;  3AA2 A;  4CHN A;  5KTQ A;  3CFR A;  2R7Y A;  4FXD A;  1VSE A;  3P1G A;  2NUB A;  1RBV A;  3AA4 A;  5J2Q A;  1NK7 A;  4N56 A;  4CEF A;  3NH1 A;  1NJW A;  2HVH A;  4Z4G A;  5FDL A;  1Q9Y A;  5JS1 A;  3AO4 A;  4BE1 A;  3SUP A;  4CIF A;  4DS5 A;  4DTP A;  2XY6 A;  3BDP A;  3TAP A;  4ELU A;  4CJ4 A;  2VG5 A;  1D5A A;  4HVJ A;  3DLE A;  1QQC A;  4JRQ A;  3AA5 X;  3VQA A;  1XC9 A;  1DTT A;  3WNF A;  4I9L A;  1NKC A;  4FK2 A;  3RTV A;  1HYS A;  3OVN A;  3QLH A;  1VSK A;  3OS0 A;  4KI4 A;  3CG7 A;  4FK0 A;  4KKO A;  1LWC A;  1C0U A;  3OYJ A;  4CHO A;  5E41 A;  3SUO A;  1EXQ A;  3C94 A;  3LP3 A;  1RT3 A;  2ZQB A;  3TAE A;  5C25 A;  1WSI A;  1WSH A;  1TAQ A;  4K8Z A;  1U49 A;  3OYE A;  2BE2 A;  1KRP A;  4DS4 A;  1X9S A;  2D5R A;  4CF1 A;  2OPP A;  4OPK A;  1LW0 A;  4HTU A;  1RTJ A;  3ULD A;  2OZM A;  2AJQ A;  4M3Y A;  1UWB A;  4FJX A;  4I2P A;  4CJL A;  3VQP A;  4DTS A;  5FRM A;  4BDZ A;  4Q0B A;  5FRO A;  1Q8I A;  2QK9 A;  3EYZ A;  1NJX A;  5KRS A;  1RBT A;  1S1U A;  1LWF A;  2ATQ A;  1B9F A;  4CK2 A;  1MU2 A;  3KKS A;  1DLO A;  1RIL A;  5CY4 A;  4XIU A;  4HCB A;  4N41 A;  5I42 A;  3SQ0 A;  2E6L A;  3K57 A;  1U45 A;  3PO4 A;  3CYM A;  4CHY A;  4CJU A;  4CEZ A;  1BIZ A;  3V9S A;  1NKB A;  2DFF A;  1LWE A;  3B6O A;  1R0A A;  3DMJ A;  1HRH A;  1KLM A;  3WNE A;  5CZ1 A;  3U3Y A;  3SPZ A;  2HHU A;  1TKD A;  3PY8 A;  3FFI A;  4BE0 A;  5CZ2 A;  3T3F A;  4KPY A;  3KLG A;  1LW2 A;  3QEV A;  3V4I A;  3RRG A;  3AVG A;  4L8R B;  2GBZ A;  3ZSX A;  4K8X A;  4DTO A;  4FJ5 A;  4CF8 A;  2XY8 A;  4O0J A;  2RN2 A;  4DTU A;  2PZS A;  4DQS A;  1NJZ A;  3V1R A;  3AVJ A;  1ZBH A;  1SV5 A;  3KK3 A;  4W5N A;  3IRX A;  3HPH A;  1D9F A;  4LH5 A;  3M8P A;  1SL2 A;  1U47 A;  1S9E A;  5HRR A;  3ZSZ A;  4CEE A;  3O4N A;  3ZT0 A;  3KD5 E;  3O4Q A;  1X9M A;  1BHL A;  4O4G A;  3OJU A;  3EY1 A;  5DMR A;  1TKX A;  4DTR A;  2I5J A;  4CJQ A;  3LAM A;  4R5P A;  3S9H A;  4CER A;  2HMI A;  3HXM A;  4KV8 A;  4OGE A;  4CEA A;  2XY5 A;  2P5G A;  2KTQ A;  2DFH A;  5JS2 A;  3LPU A;  4DTM A;  1C0M A;  1YVU A;  4ID1 A;  3TAF A;  2P1J A;  3CQ8 A;  3SZ2 A;  4HUF A;  1RDA A;  4O44 A;  3NGY A;  4DFM A;  1HQE A;  4CF9 A;  1KSP A;  1N6Q A;  1W9H A;  4UQG A;  1WN7 A;  5DK5 A;  3ZT2 A;  2VWJ A;  1ITG A;  4MFB A;  3LWM A;  1XI1 A;  3OYL A;  2Y1J A;  3OS2 A;  4KHN A;  3KKR A;  1TL1 A;  2IGI A;  4FZZ A;  1BCO A;  1CZB A;  4DFP A;  1ZBU A;  1D9D A;  3MXJ A;  3AVL A;  1HQU A;  3RMA A;  1L5U A;  4CGI A;  4FLZ A;  1NKE A;  1GOA A;  4C8M A;  1ASV A;  3NBP A;  1IKY A;  3V1O A;  3K5O A;  4Z4C A;  2OPR A;  4DU3 A;  3SUN A;  3S3N A;  4ICL A;  5C24 A;  2D0A A;  1WSE A;  1QTM A;  4B3O A;  3F9K A;  4IFV A;  4BE2 A;  4W5Q A;  4B9T A;  2KZM A;  4RW8 A;  1D8Y A;  1WAF A;  4DF4 A;  4KHQ A;  2IOC A;  3DRR A;  1Q9X A;  2Z1J A;  4FZY A;  3OYB A;  1JLC A;  2XRI A;  1C6V A;  3G0Z A;  1TKT A;  3TAM A;  3V9U A;  2PY5 A;  3ZT3 A;  2YHA A;  3D45 A;  4BAC A;  3T19 A;  4CEB A;  2JGU A;  1IO2 A;  4M3U A; 
#chains in the Genus database with same CATH topology
 2HHT A;  4E0D A;  3ISN C;  4IFY A;  3DJC A;  1D4X A;  4FJH A;  3U6F A;  2JWK A;  4J2E A;  3W3D A;  2QXL A;  4FM1 A;  2BH1 A;  4FLX A;  3SBT A;  3PIP L;  5MLC Q;  3G6E N;  4JD2 B;  3OW2 M;  2Y1I A;  4B1Z A;  3MXM A;  1YTU A;  1CXU A;  1YF5 L;  4YNQ A;  3K9K A;  1EP4 A;  1ASW A;  2G8I A;  3DLK A;  3VER A;  1WSF A;  4OVL A;  3SI6 A;  3HJF A;  4NCG A;  2P9P A;  2RPI A;  4RW6 A;  4M3R A;  3VGK A;  3AO5 A;  1BIU A;  3ZSR A;  1JLB A;  4LSN A;  4JS4 A;  4CFB A;  2NRR A;  1R59 O;  1S6Q A;  2AA4 A;  3CME N;  1NK6 A;  4NXN K;  1ESV A;  5BRE A;  3HT3 A;  3ZSY A;  4JAX A;  2YNI A;  1TUU A;  3MXI A;  4RW4 A;  3U9Z A;  1ATS A;  3ZSO A;  2O8D B;  3VGL A;  3SQ4 A;  2O8B B;  4OPJ A;  1KXP A;  3OYN A;  3ENB A;  3OYH A;  4Z4H A;  2OA8 A;  1VQ6 N;  3I0R A;  3UE5 A;  3KTQ A;  4DV4 K;  4H0T B;  3NVM A;  4PKG A;  4C8K A;  3CJ1 A;  4KB0 A;  3CQX A;  4CFA A;  1RT5 A;  2P9I B;  4AHR A;  1IG9 A;  3T1A A;  2PBD A;  2DTU A;  4IXC A;  4M3Z A;  1JLG A;  2NNW A;  3CJB A;  3RMC A;  3AAR A;  1W0H A;  3HPG A;  4OPA A;  2O8D A;  2V51 B;  2G8K A;  5KPZ A;  2G8W A;  2HHW A;  1TK5 A;  3MED A;  3NF6 A;  3NH2 A;  4JI6 K;  3FGU A;  4DQQ A;  2ETJ A;  3DRS A;  4E7K A;  2WON A;  2P9I A;  4O8K A;  4H8K A;  1I3A A;  3D2E A;  3IS9 A;  4R79 A;  2ZGZ A;  3A2F A;  4JI0 K;  2V7Y A;  3PV8 A;  4Y0W A;  3WNH A;  4E7H A;  1MDU B;  4KH6 A;  4A5B A;  1C0F A;  3EEQ A;  5AQM A;  1EO1 A;  3H08 A;  1VAZ A;  5TKW A;  4YOR A;  3O9R A;  1C0T A;  4G1Q A;  2OZS A;  5KGX A;  4A2B A;  4OPH A;  1KC8 O;  3ENH A;  3AGR A;  1VRU A;  3P38 A;  1X3N A;  1REV A;  5KQD A;  2Z1G A;  4KFB A;  3SMS A;  4ILH A;  3AVI A;  1TYQ A;  4O5F A;  1F21 A;  1VSF A;  1IKW A;  3PLA A;  4PQU A;  4KHY A;  4JS5 A;  3L8B A;  3LZI A;  4HUG A;  2D0P A;  4HHT A;  4B3R K;  4GKJ K;  1EWR A;  3NDK A;  3L4Q A;  3OYG A;  4WQ5 A;  4A2A A;  4KTW A;  3WXM B;  3QET A;  3CIP A;  3VQB A;  2HHQ A;  1NK0 A;  3B6P A;  4X66 K;  3HOT A;  3LDS A;  4FJ8 A;  2OCE A;  3K5M A;  1G15 A;  4X65 K;  4O0I A;  2FBV A;  1BWF O;  1L3V A;  4JKA A;  5JVG L;  4CHP A;  3VF4 A;  1U4B A;  1FKO A;  5T7B A;  5J1E A;  5SWM A;  3H3N O;  2YCH A;  3R6M A;  4RW9 A;  4F8R A;  5JLH A;  3R9P A;  3CHW A;  3NHG A;  4HUE A;  1TK8 A;  1HNZ K;  4LC9 B;  1RNH A;  3E1Y A;  3U8X A;  1Q81 O;  3VEX A;  1KVB A;  3RR8 A;  3EN9 A;  2YV0 X;  3QO9 A;  4CES A;  1NOY A;  4Z4I A;  3SAH A;  1TK0 A;  4KRE A;  3TTC A;  1C1A A;  4WFN L;  2X78 A;  3VGM A;  4CJW A;  4LSL A;  5M1Q A;  5LL6 Z;  1RDC A;  1BI4 B;  1RCH A;  1EET A;  1WLJ A;  2G8F A;  2X6N A;  5JVH L;  2CGL A;  3QEI A;  1JL1 A;  4FWN A;  4GY2 B;  3GOI A;  1NOZ A;  3NF9 A;  1QVG M;  2F96 A;  1ZBL A;  2VG6 A;  3OYM A;  3DLB A;  4DQP A;  1VQ4 N;  4X64 K;  4EAH D;  4CZF A;  3GBT A;  2QKK A;  2KFN A;  2FBT A;  4B8A B;  3JSM A;  3CC4 N;  1HYZ A;  3THY A;  4DUY K;  1N33 K;  1BI4 A;  3LP0 A;  1A5X A;  1TL3 A;  3PUF A;  4FLY A;  3UB5 A;  3H45 C;  3SCX A;  4DSF A;  2HHH K;  3RSE A;  1NGF A;  1BCM A;  1SL1 A;  1MA9 B;  3KK7 A;  3CCM N;  4PUO A;  3QEX A;  3DXM B;  4JKC A;  1NK4 A;  2H3G X;  4DR6 K;  3BGR A;  3VQ5 A;  4W5T A;  1VRT A;  3RWU A;  5AQX A;  4YDU C;  3HM8 A;  4DR4 K;  1QSL A;  4LH4 A;  3TTF A;  2UYT A;  2J4R A;  1S3X A;  4NYF A;  4NO7 A;  5C12 A;  4B9U A;  4GVM A;  4LFB K;  4EP5 A;  4F3O A;  3MEC A;  3D6R A;  3P83 D;  2YHY A;  2RF2 A;  3KLI A;  1GLJ O;  1QSY A;  2RE2 A;  3BP8 A;  3E01 A;  4XH1 A;  3ALY A;  3MEE A;  3J7Z O;  3ITH A;  3O4W A;  4BR4 A;  5D3G A;  1UAX A;  2D0B A;  5HRS A;  1LV5 A;  1L3T A;  1Y97 A;  4J2A A;  1VQP N;  4DKW A;  3QEW A;  2IS3 A;  3MWT A;  1NWK A;  2HBM A;  3VQQ A;  5ADX A;  1NNE A;  4E7L A;  4BRF A;  1IBL K;  5CYM A;  2ASP A;  4FM2 A;  4BDP A;  1YUW A;  3WEE B;  3MK6 A;  5BPL A;  4CFC A;  3ZCM A;  2FLO A;  1J9A A;  4O5B A;  4BRM A;  2ZJR L;  3VQC A;  1SL0 A;  1XWL A;  1XC3 A;  2BGG A;  3HK2 A;  3K59 A;  4KTZ A;  5A2Q O;  4NYN A;  3NMU A;  1KFD A;  5F0X A;  3R1X A;  2HHS A;  2PYL A;  3VF2 A;  1T7P A;  1S22 A;  2HF4 A;  1ZBI A;  4FJN A;  4JKH A;  3ZSW A;  1Z6R A;  3ID6 A;  4E19 A;  4JN4 A;  1T3V A;  1BO5 O;  3KLF A;  4AH9 A;  1UOC A;  1NK9 A;  4CVN E;  2F8S A;  1WUA A;  1YXQ A;  4FXD A;  3AA2 A;  5KTQ A;  3CFR A;  3P1G A;  1IO2 A;  4LF7 K;  5AZJ B;  3E9L A;  2W6L A;  4WQ4 C;  1NK7 A;  3ZEU A;  4NLB A;  3AO4 A;  4DB3 A;  5GAG P;  1D5A A;  4BRE A;  4HVJ A;  3WXI A;  4BRA A;  4CZK A;  3CF5 L;  4JRQ A;  3AA5 X;  3VQA A;  1DTT A;  4I9L A;  4FK2 A;  4BR0 A;  3OVN A;  1VSK A;  3J8A A;  4B1U B;  1DT9 A;  4FOE A;  3SUO A;  3C94 A;  3SJH A;  2ZQB A;  3QDK A;  5C25 A;  1KD1 O;  1WSH A;  1VQL N;  4K8Z A;  4YHH K;  1KRP A;  5AZJ A;  4WFB L;  4M7Y A;  2NRH A;  4HTU A;  2OPP A;  3GL1 A;  1JJ2 M;  3O1B A;  3VQP A;  2IVO A;  1GLF O;  1Q8I A;  3TTD A;  3SBG A;  4DV1 K;  4CK2 A;  4XIU A;  1NBW A;  2E6L A;  2ITM A;  4CBX A;  3V9S A;  1RFQ A;  2QM1 A;  3B6O A;  3WNE A;  3U3Y A;  4B1X B;  1RDU A;  3O80 A;  3FFI A;  4KPY A;  3QML A;  3QEV A;  4K8X A;  4BR5 A;  4FJ5 A;  5AFU A;  4JI1 K;  4DTU A;  2A40 A;  1NJZ A;  3QBX A;  4DUZ K;  3AVJ A;  4W5N A;  5LMU K;  4AQY K;  5GIP A;  4NB4 A;  3KD5 E;  3OJU A;  2IIR A;  4CJQ A;  3LAM A;  4U7B A;  4DR2 K;  3HXM A;  4KV8 A;  4OGE A;  4CEA A;  2DFH A;  5JS2 A;  5CE3 A;  3TAF A;  1OVY A;  4O44 A;  3FZL A;  2V52 B;  3NGY A;  1J5E K;  4CD1 A;  4UQG A;  1WN7 A;  2VWJ A;  1ITG A;  3ZX2 A;  1XI1 A;  3OS2 A;  4KHN A;  1NLV A;  4A59 A;  2NZT A;  1HQU A;  3LDP A;  3NBP A;  4FZY A;  1IJJ A;  5C24 A;  3C6H A;  4B9T A;  2KZM A;  4M7X A;  2O8C B;  3WXK A;  1D8Y A;  2E2Q A;  4KHQ A;  2IOC A;  3DRR A;  1K8A O;  3VF6 A;  3L0Q A;  3G0Z A;  1TKT A;  3T1H K;  1WBD A;  2UXB K;  3ZX0 A;  4CEB A;  3ZT4 A;  2CGK A;  4BR2 A;  4BRD A;  4CJT A;  4DU1 A;  3FZM A;  3JXU A;  3VQE A;  4FK4 A;  4JYA K;  2IVP A;  1HLU A;  1B92 A;  3VTH A;  4DV3 K;  3HZ6 A;  5KGW A;  4CJF A;  3VEV A;  1RT7 A;  1JL2 A;  3G4S N;  1QSS A;  2QWR A;  3IUC A;  2YX6 A;  4C8L A;  3OYK A;  2OTJ N;  3DLG A;  2YKN A;  2BAN A;  3A5L C;  2HNY A;  1GOB A;  1FW6 A;  5SZT A;  2HMP A;  3ZX3 A;  2HB5 A;  4FLW A;  1JLF A;  4K25 A;  4QS7 A;  4LY7 A;  3NGZ A;  4FLU A;  1JLQ A;  5BRD A;  3CFO A;  3FZK A;  2VQE K;  2YI1 A;  1HJR A;  1NGA A;  3GE1 A;  1HKC A;  2VWK A;  4IOA L;  3EKS A;  4JKG A;  4JRP A;  1RBU A;  2YKM A;  3L2W A;  1FKP A;  4KH4 A;  4MO4 A;  3C7N A;  4RG8 A;  1KVA A;  1HPZ A;  3TSP A;  5C42 A;  2F7T A;  1KAZ A;  4FWR A;  5FPE A;  3AVB A;  3L2Q A;  3LP1 A;  1Q82 O;  2RKI A;  4AM7 A;  4BWJ A;  2W41 A;  5F1X A;  4GKK K;  3HP9 A;  3O6W A;  2D0C A;  1RBS A;  3E66 A;  4PY5 A;  4FSV A;  1SKS A;  2A1S A;  2Q3S A;  4N47 A;  1OH6 A;  2NRW A;  5C10 A;  3KK1 A;  3VEW A;  2LSN A;  2Q1N A;  4BRC A;  3PO5 A;  3VMF B;  1RBR A;  2E20 A;  1ATR A;  1SAZ A;  4C8O A;  3SQ2 A;  1J53 A;  4FWP A;  3B8A X;  3DLL L;  4JKF A;  4Z4F A;  4DF8 A;  1GLA G;  2UXC K;  3TWH A;  1WB9 A;  1J5O A;  2P9K B;  3IG1 A;  3EO3 A;  5FRN A;  3QNN A;  3AO3 A;  4EIA A;  1CLQ A;  4CGH A;  2UXD K;  3L2V A;  3ZET A;  4OKJ A;  1BL3 A;  3MN6 A;  4CZE A;  5HLF A;  1XNQ K;  1HNI A;  4QCL A;  4AHV A;  2ZWH A;  4QS8 A;  1T44 A;  4AIL C;  3AGK A;  3LDQ A;  4L3Q A;  4BRH A;  3N4P A;  2IAJ A;  2FBY A;  2I7N A;  3RMD A;  2P9K A;  4CK3 A;  1VSL A;  4FJL A;  3VQ6 A;  3MDQ A;  3KHY A;  2G8V A;  4B9L A;  2P51 A;  1RTH A;  5GAD P;  1T6C A;  4M3W A;  2Q0U A;  4OLA A;  2P9P B;  1HKB A;  1WBB A;  4B9N A;  4CF0 A;  4BRK A;  2FC0 A;  1DTQ A;  4CD3 A;  4IBN A;  1YTA A;  5AQI A;  4CCH A;  3BF1 A;  2XY7 A;  1Q7Y O;  3L6Q A;  4B3S K;  3H3O B;  1WSG A;  3E9P A;  1TGO A;  3LPT A;  4B1V A;  1VK0 A;  1NU0 A;  2HBL A;  1N8R O;  3VQ9 A;  5IT9 O;  3CMA N;  3TAQ A;  5HRN A;  1C1C A;  1VQ8 N;  1V4T A;  1IBK K;  2D0O A;  3CC7 N;  3KWI A;  3OYA A;  3VEN A;  1J54 A;  4PHT X;  1C0G A;  3AV9 A;  3HPO A;  3K5L A;  1VQ9 N;  3NF7 A;  2GEL A;  4CIG A;  4B8C A;  2NRZ A;  2KFZ A;  3AVA A;  1LAV A;  2PYJ A;  3I8D A;  4Y1D A;  5BR9 A;  4WE1 A;  3K9J A;  1UA0 A;  3EZ5 A;  4FVM A;  4KTQ A;  2QTD A;  4X62 K;  1QQM A;  3DI6 A;  4G9Z A;  3SMP A;  4RW7 A;  4DWI A;  1FJG K;  1JCF A;  1VQK N;  3A5O C;  3ATU A;  4M41 A;  3KJV A;  4I6M A;  1YAG A;  4XH5 A;  4KHW A;  3EZW A;  1HR0 K;  4HCC A;  3D2E B;  2W42 A;  3I56 N;  3UKU A;  2DPN A;  2ZM6 K;  4DLG A;  4KHS A;  1RGI A;  4IO8 A;  3VPZ A;  4CJ3 A;  4IO9 L;  4GW6 A;  3CCU N;  4BG8 A;  4H0X B;  2OPQ A;  3LL3 A;  3G71 N;  3TI0 A;  4IWV A;  1N34 K;  2ASO A;  2BUP A;  3WUH A;  2WFB A;  2XHB A;  2QWM A;  4H5N A;  3KIO A;  5KQ8 A;  5LJV A;  4B9V A;  2VGN A;  1VSD A;  4IEE A;  2HHX A;  3CCE N;  3AO1 A;  3HM9 A;  1S1W A;  4GMJ B;  4YOX A;  1JLE A;  1T05 A;  4B9Q A;  4H0O A;  3DLH A;  4YOU A;  4CI6 A;  1WOQ A;  1TYQ B;  4GV9 A;  4WYB A;  5H1S Q;  4QAG A;  1YT3 A;  3T7Z A;  4C1N I;  1BOT O;  4LF4 K;  3A5M C;  4JKE A;  4DFK A;  1Z25 A;  3FFK B;  1Q18 A;  5BRF A;  5AJ3 K;  1GLD G;  4KH5 A;  2HBJ A;  3V1Q A;  2FF6 A;  4H4M A;  3ENO A;  4LF8 K;  4E1M A;  2YHX A;  3TPQ A;  2BDP A;  4BRP A;  5J2N A;  3O9T A;  3LAN A;  1QS4 A;  4PA1 A;  4YFU A;  4M45 A;  2KW4 A;  3F73 A;  5ELZ A;  3LDL A;  2JLE A;  3O3H A;  3O8M A;  1ZYQ A;  3BY5 A;  1GLE G;  5KPT A;  4FPA A;  4BR7 A;  4DR7 K;  4OKK A;  4IDH A;  4DSK A;  4JI5 K;  4DR3 K;  3A8Y A;  3VQ7 A;  3M8Q A;  2E6M A;  4K41 A;  2UUA K;  4FJM A;  1HNV A;  1VQN N;  4YDU A;  4J2B A;  3PSF A;  2E4L A;  2ZD1 A;  4IOC L;  4H0V B;  2HOE A;  2X74 A;  1KTQ A;  2B6A A;  3NAE A;  4JI8 K;  2QXF A;  3RR7 A;  1YIT N;  4ISF A;  5HRP A;  5AR0 A;  4DTJ A;  4ZTF A;  4EFH A;  4DV0 K;  3THY B;  2NUB A;  3R3L A;  5AQP A;  2OAN A;  5FDL A;  4BE1 A;  3SUP A;  3BDP A;  2FSK A;  1OH7 A;  4CJ4 A;  2VG5 A;  3AAQ A;  3RSE B;  3Q7C A;  4CJ7 A;  5AQT A;  1NKC A;  4LFA K;  2UUB K;  4FK0 A;  3ULE B;  4CHO A;  5E41 A;  1M90 O;  3LP3 A;  3TAE A;  3VEO A;  5I9E B;  1WSI A;  1TAQ A;  3OYE A;  3MN5 A;  2D5R A;  3CCJ N;  1N32 K;  2AJQ A;  4M3Y A;  3CC2 N;  3KVG A;  4BG9 A;  4DTS A;  3E9O A;  1NJX A;  5KRS A;  3CD6 N;  1NGE A;  1S1U A;  2ATQ A;  1B9F A;  4HCB A;  3KKS A;  1RIL A;  4N41 A;  3TU5 A;  4CEZ A;  1NKB A;  3ULE A;  4B3T K;  1HRH A;  3PY8 A;  3AVG A;  2F9T A;  2ZF5 O;  1EWQ A;  4DQS A;  3BZK A;  3KK3 A;  4LH5 A;  3M8P A;  3H46 O;  1U47 A;  5HRR A;  5HOO A;  4YOT A;  1BHL A;  4O4G A;  1K8K B;  5JMV A;  5BR8 K;  3EY1 A;  5DMR A;  2I5J A;  4R5P A;  2BTF A;  2P9U B;  4HUF A;  1JCE A;  4CF9 A;  4CZJ A;  4JHD B;  1VQM N;  4MFB A;  1VHX A;  3KKR A;  5AQF A;  4DFP A;  3C0B A;  3MWP A;  1IG8 A;  3MXJ A;  3CQY A;  1EQY A;  1L5U A;  3RMA A;  5F2R A;  4FLZ A;  4DHY A;  1GOA A;  4C8M A;  1ASV A;  1K8K A;  3V1O A;  3K5O A;  3SUN A;  4B3O A;  3F9K A;  4IFV A;  2A42 A;  5AQJ A;  4JI7 K;  2P9U A;  2XRI A;  2E5L K;  3ZT3 A;  3D45 A;  3G25 A;  4BAC A;  2JGU A;  4JHD A;  5AQR A;  4M3U A;  3ZEU B;  3HYF A;  4UY8 O;  2OTL N;  1T6D A;  1T03 A;  4OGC A;  4CE9 A;  2HVI A;  1KCF A;  3OYC A;  2PAV A;  5M1K A;  1VSJ A;  2YJF A;  3UKR B;  4KI6 A;  4CBU A;  4DSE A;  3CCS N;  3C6T A;  3WQU A;  5C2F A;  4I2Q A;  4DQR A;  3VEZ A;  5K14 A;  3CM6 A;  4BDY A;  4JI4 K;  3THW B;  2DY4 A;  2Z1H A;  2EHG A;  3L2U A;  1IKX A;  3AVH A;  2EX3 A;  5AQG A;  2F9W A;  1P90 A;  3K58 A;  4K42 A;  1QVF M;  4ILG B;  2QWP A;  4E3S A;  1BIS A;  3UKR A;  3HVR A;  4IFE A;  1IKV A;  5LJW A;  4CGJ A;  2B5J A;  1IH7 A;  2YHB A;  4FJ7 A;  1CZ9 A;  3THW A;  1S6P A;  4LF9 K;  1I39 A;  3DOK A;  4U67 L;  3T1Y K;  1EKE A;  1BQM A;  4LF5 K;  3D0P A;  1NGH A;  2FSJ A;  1QZ5 A;  3LAK A;  3VA0 A;  4ZHR A;  4M42 A;  3P31 A;  3HOS A;  3NFA A;  1W2B M;  1N5Y A;  1K6Y A;  4BRO A;  3VA3 A;  4IJA A;  4CIE A;  3AVF A;  5AQS A;  4DFJ A;  4IG0 A;  3I0S A;  4DG1 A;  3D2F A;  3RRH A;  3TSU A;  4B3M K;  4CJS A;  1ZBF A;  4K43 A;  1LOT B;  2GX9 A;  4DU4 A;  3CXC M;  3LM9 A;  3OYD A;  4CHZ A;  4H0P A;  4FW2 A;  4EHU A;  4DTX A;  3MN7 A;  4QS9 A;  3AVN A;  3IFR A;  4CHQ A;  1LAW A;  3M6G A;  4YOW A;  5CR4 A;  5BN8 A;  4DSJ A;  2QEX N;  4DCH A;  3DRP A;  2Q31 A;  3H1V X;  3NCI A;  2A6A A;  3AVK A;  2P9N A;  3M8S A;  5CYQ A;  3TAR A;  5AQZ A;  4W5R A;  2G8U A;  3RVC A;  3V6D A;  1TV6 A;  1A5W A;  1U2V B;  4B08 A;  5AQL A;  1UA1 A;  1RT2 A;  1XUP O;  3HL8 A;  3PSI A;  1TAU A;  1SUQ A;  2NRX A;  2ITG A;  2Q97 A;  1QE1 A;  4CED A;  2KKZ A;  3PX0 A;  1BA1 A;  4FYD A;  4H5W A;  1OVQ A;  1IBM K;  3HTV A;  4ELV A;  3DOL A;  4CJ5 A;  5ADX H;  4NCA A;  3V9W A;  3SLC A;  2YJE A;  2PFU A;  1U2V A;  2WUS A;  4Y1C A;  3THX A;  4O55 A;  2VCP A;  3QIN A;  4DV5 K;  3SPY A;  2NRV A;  3UIQ A;  4H4O A;  3OYI A;  1BA0 A;  2UU9 K;  1VSM A;  3WNG A;  3L3U A;  4BVP A;  4BRN A;  4JKG B;  2B4J A;  3KK2 A;  5HBM A;  4FLV A;  4GV3 A;  4ISG A;  5E26 A;  3JAM O;  3I8B A;  3D7E O;  5HRO A;  3C6A A;  3C7N B;  4CFD A;  2QA4 N;  4CJE A;  3OBW A;  4H5T A;  1NJI O;  1GLL O;  1SKR A;  3CI5 A;  2GUP A;  1LCU A;  3U4L A;  1NGI A;  3BF3 A;  3QIC A;  3ASM A;  3ATV A;  4OLB A;  5AQW A;  3NGI A;  4M3X A;  3I55 N;  1A5V A;  3TAB A;  3S3O A;  2NLX A;  1IV0 A;  3CJ7 A;  3L4I A;  4M3T A;  1ASU A;  1JCG A;  4CJV A;  4WFA L;  1U48 A;  2GV9 A;  3J81 O;  3V9X A;  3VN5 A;  4IG3 A;  3OTO K;  3N4Q A;  3CJ9 A;  4E1N A;  1XMO K;  2WTU A;  1NK5 A;  1VQ5 N;  2F8T A;  2OPS A;  2QWQ A;  3ZET B;  1J6Z A;  3ZLJ A;  4ISE A;  3NH0 A;  1KFS A;  1TUY A;  5CHI A;  3QIP A;  4BWM A;  4FZX C;  2P9L A;  1DKG D;  1TVR A;  4FJG A;  1WAJ A;  1NMN A;  4LF6 K;  1XHX A;  3MX2 A;  3CET A;  2QI2 A;  3LZJ A;  1MWM A;  4KHU A;  1TKZ A;  5DM6 L;  1HUX A;  1QZ6 A;  4JLH A;  4PWD A;  5EU7 A;  3LM2 A;  5AFU H;  4E7J A;  4KRF A;  2ZGY A;  4O8U A;  4Z0U A;  4JNE A;  3KWG A;  4NCB A;  4CGF A;  1S5J A;  1S9G A;  1O1W A;  5AQU A;  1HKG A;  4MQ3 A;  2XO7 A;  4YOV A;  1ZC6 A;  4B9M A;  5KPR A;  1L3U A;  1YVN A;  1XHZ A;  1WNS A;  4E89 A;  3NF8 A;  4XH4 A;  4W5O A;  1DEJ A;  3QEP A;  5I3U A;  4OO1 J;  2EWS A;  3QFU A;  3SV4 A;  4V19 S;  1QHT A;  4RWT A;  3V81 A;  4AHS A;  4CEC A;  4J8F A;  3HST B;  2HHV A;  2VG7 A;  4NLC A;  1BUP A;  4DMN A;  1BQN A;  4CGG A;  5HL7 L;  1KAY A;  1X9W A;  3WQT A;  4KB1 A;  4QOZ B;  1KLN A;  3EL2 A;  3DXK A;  3SUQ A;  1C1B A;  2D4W A;  4I6M B;  2HST A;  4FWK A;  4OX9 K;  2FSN A;  5JIC A;  2F4V K;  3MX5 A;  3VTI A;  2R7Y A;  2NRT A;  3UKU B;  5J2Q A;  4CEF A;  2HVH A;  4Z4G A;  1Q9Y A;  3SAF A;  4DTP A;  2XY6 A;  4BRG A;  3DLE A;  1QQC A;  3CCL N;  4LFC K;  4FOI A;  1XC9 A;  1ILY A;  4JV5 K;  3CCR N;  5EOY A;  3QLH A;  3ZYY X;  3OS0 A;  4JD2 A;  1LWC A;  1C0U A;  3OYJ A;  3QBW A;  3SAG A;  2HBK A;  3PIO L;  1U49 A;  2BE2 A;  4GVE A;  2D1K A;  4OPK A;  1LW0 A;  1RTJ A;  1BG3 A;  3F2K A;  3K0S A;  4I2P A;  1K73 O;  4CJL A;  4BC5 A;  4A57 A;  5FRO A;  2QK9 A;  1RBT A;  5CY4 A;  4BRI A;  3SQ0 A;  1XQS C;  3NVK A;  4E1J A;  1QQN A;  1E4G T;  3CYM A;  4CZH A;  4CJU A;  3DMJ A;  1KLM A;  4FO0 A;  1YHQ N;  1X3M A;  4F9O A;  1ATN A;  5M1N A;  4JEP A;  4BE0 A;  5CZ2 A;  3T3F A;  2O8B A;  3V4I A;  3RRG A;  4BQL A;  4L8R B;  1BDG A;  2GBZ A;  4DTO A;  1K9M O;  2RN2 A;  3C65 A;  2PZS A;  3V1R A;  4A62 A;  1SV5 A;  1ZBH A;  3I33 A;  3HPH A;  1D9F A;  1E3M A;  2JWL A;  1ZXO A;  3O4N A;  5EVZ A;  3ZT0 A;  5GAE P;  1X9M A;  1E4F T;  1DGK N;  4HWI A;  3S9H A;  4JK9 A;  2HMI A;  3KZB A;  1NMD A;  3LPU A;  1O13 A;  4ID1 A;  2P1J A;  5FPN A;  3SZ2 A;  4BRQ A;  4CBW A;  1W9H A;  5DK5 A;  3OYL A;  2Y1J A;  1TL1 A;  2IGI A;  4WCE L;  1IKY A;  2OPR A;  4AF1 A;  1WSE A;  4GV6 A;  4W5Q A;  4BVO A;  1WAF A;  2FF3 B;  4DF4 A;  5LY3 A;  1Q9X A;  2Z1J A;  3OYB A;  4PL7 A;  2PY5 A;  5FLX O;  3OY9 A;  1RDB A;  1L3S A;  1JXB A;  3M5R A;  3U9D A;  3PX4 A;  2DFE A;  4JI3 K;  3CJC A;  4H5R A;  5AQV A;  1RT6 A;  4LD0 A;  2Q0R A;  2HW3 A;  3AVM A;  2A41 A;  3M1F A;  4ELT A;  1SS6 A;  4E7I A;  4DSL A;  3HVT A;  4MDB A;  2E1Y A;  2KLA A;  3OYF A;  1XNR K;  1B9D A;  2O4G A;  1N36 K;  1T8E A;  3AAP A;  1I94 K;  1JLA A;  4BGA A;  1VSH A;  1QHA A;  1WSJ A;  3DYA A;  1VQO N;  4FL9 A;  4EP4 A;  4F3T A;  1CXQ A;  3AA3 A;  5J2M A;  1HX1 A;  3R8E A;  4HTL A;  4BY9 C;  2A1R A;  2KZZ A;  5EY4 A;  3HO1 A;  1JXE A;  3HRG A;  2YNG A;  3O9U A;  4FM0 A;  1FK9 A;  4CF2 A;  1YJW N;  4CJP A;  1GOC A;  1Q86 O;  1H1V A;  2IC3 A;  2GWJ A;  1S1X A;  1S1T A;  4FJ9 A;  4K0K K;  3OBY A;  4DV2 K;  4IZ9 A;  4F4K A;  3O3G A;  2IVN A;  3CM5 A;  1RT1 A;  3SJJ A;  4MLH A;  3QES A;  4YY3 K;  4GNI A;  1KQS M;  1RDD A;  3VQD A;  2W40 A;  1VSI A;  2UUC K;  1CZA N;  5AQO A;  2CH5 A;  5KRT A;  5HP1 A;  2E1Z A;  1YJ9 N;  5BPM A;  3O1W A;  2ZE2 A;  3LP2 A;  4CEO A;  4WQ4 A;  4WQ5 C;  4B9S A;  4MO5 A;  3J7A P;  1S72 N;  2ASM A;  1YIJ N;  1W97 L;  4WF9 L;  3GG4 A;  1EX4 A;  5TKY A;  1NGJ A;  2Q2R A;  4IEI A;  1P8Z A;  1NGG A;  3PX6 A;  5E84 A;  3EKU A;  4Z4E A;  3AVC A;  3DLR A;  4CW7 B;  5BN9 A;  3V9Z A;  4IKF A;  3WXJ A;  4ID5 A;  2QKB A;  3SYZ A;  4J2D A;  3P4I A;  4OJR A;  3T69 A;  4FVU A;  3SV3 A;  1FXX A;  3DXM A;  3WT0 A;  5EX5 A;  5GIN A;  4PKH A;  3HP6 A;  4PKI A;  3O3F A;  3HI0 A;  4IDK A;  2E8A A;  3SQ1 A;  1KVC A;  2YHW A;  3DM2 A;  4ILJ A;  2VYP A;  4KO0 A;  1VQ7 N;  3MEG A;  2VGM A;  2X6S A;  3OS1 A;  2WOM A;  4JK8 A;  2O8E B;  1RTI A;  4FLT A;  3K5N A;  3VOV A;  4FCY A;  3IMX A;  3LWL A;  2W6K A;  3VQ8 A;  4DQI A;  2V7Z A;  4FJJ A;  2Q36 A;  4FWO A;  3SK3 A;  2VQF K;  5AZI B;  3BEX A;  3DAW A;  4JI2 K;  3THV A;  4TSX A;  5DM7 L;  3L2R A;  4DQ8 A;  3RMB A;  2CGJ A;  3O5B A;  5EXW A;  4BC2 A;  4CZI A;  3MMV A;  1S1V A;  1NK8 A;  4F2R A;  3Q7B A;  3G10 A;  3ZSQ A;  2O8E A;  3VES A;  4JKD A;  2VWB A;  4N76 A;  4BC4 A;  3QIO A;  3WEE A;  3AY9 A;  5AZI A;  4A5A A;  4CK1 A;  4XEI A;  3BZC A;  2E88 A;  3FE1 A;  4H5V A;  5J2P A;  3MCA B;  4H03 B;  2OYQ A;  3U3G A;  3VQ4 A;  3CFP A;  4YOY A;  5FPD A;  4CJR A;  1X1P A;  3NE6 A;  2FXU A;  5KI6 A;  3AO2 A;  3M8R A;  5LMN K;  1NG9 A;  5AQN A;  4I7F A;  1RTD A;  4FWQ A;  1NGD A;  3D2F B;  2QW9 A;  3HSC A;  3M3Z A;  2HND A;  4FWM A;  4BRL A;  3P5J A;  3A0I X;  5M1P A;  1HPM A;  2I7P A;  2YNH A;  3OA9 A;  3MAQ A;  3IAY A;  3EE9 A;  2O4I A;  4IJN A;  4Q5V A;  1JKH A;  4FJK A;  2YNF A;  3A5N C;  4A61 A;  3TAN A;  1MWK A;  4N5S A;  3QB0 A;  3O08 A;  1HMV A;  3ZSV A;  4EZ6 A;  2IDO A;  3C95 A;  3VET A;  4DSI A;  4FJI A;  3P39 A;  3LDO A;  1X9J A;  3L3V A;  3C6U A;  3QFP A;  3GDQ A;  5C0Y A;  4DLE A;  4F2S A;  1SQK A;  2P9N B;  2GTD A;  4FWL A;  4PL8 A;  3S41 A;  4FW1 A;  1OH8 A;  3SNN A;  4I9Q A;  5AQQ A;  1NGB A;  3CJA A;  4KBO A;  3OHR A;  2GUI A;  3CPE A;  4JK7 A;  3O9S A;  4OKE A;  1RDW X;  1BGX T;  1XMQ K;  2G8H A;  4AHT A;  2CH6 A;  4KAZ A;  4H0Y B;  4EZ9 A;  4NXM K;  3QER A;  1RT4 A;  2E2N A;  3KD1 E;  2FBX A;  1BU6 O;  4FWS A;  2HNZ A;  3TAG A;  2HF3 A;  2Z1I A;  2KHO A;  3JYT A;  3THX B;  3QNO A;  3DWL A;  1GLB G;  2GWK A;  2KQ2 A;  1U04 A;  1G99 A;  1QQO A;  3MN9 A;  3S3M A;  4IOX A;  5M1O A;  4AHU A;  3CCV N;  3JS6 A;  1HYV A;  4BGB A;  3TSQ A;  2ZJP L;  3FLC O;  4B1W B;  3KLH A;  3IKM A;  2E2O A;  1Y64 A;  4C8N A;  4B1Y B;  3TR8 A;  4AHC A;  3HBT A;  4DTN A;  2P5O A;  3WXL A;  1GLC G;  2WC9 A;  3FZH A;  3ZT1 A;  4CZL A;  1SKW A;  3IDH A;  1W7A A;  4CJK A;  5GIO A;  3J80 O;  4ZTJ A;  3BUZ B;  4CEQ A;  4CGD A;  4DR5 K;  3CCQ N;  4BC3 A;  3W0L A;  5AQY A;  1NJY A;  4CZM A;  3LAL A;  2O8C A;  4MDA A;  3KLE A;  2GEM A;  1SZ2 A;  4BR9 A;  1Z26 A;  3K2P A;  3OJS A;  3ID8 A;  4CHN A;  2A5X A;  2WBN A;  1VSE A;  1RBV A;  3AA4 A;  4N56 A;  3NH1 A;  1NJW A;  3LDN A;  5IWA K;  5JS1 A;  4CIF A;  4DS5 A;  3TAP A;  4ELU A;  3CER A;  3WNF A;  2RHK A;  4DV6 K;  4DR1 K;  3RTV A;  2AP1 A;  1HYS A;  4KI4 A;  4Z94 A;  3CG7 A;  4KKO A;  2O8F B;  1EXQ A;  3MCP A;  2P9L B;  1RT3 A;  1KAX A;  4DS4 A;  1X9S A;  4CF1 A;  2OZM A;  3ULD A;  2E2P A;  1UWB A;  3J7Y P;  3EE8 A;  4FJX A;  5FRM A;  4BDZ A;  1HNW K;  4Q0B A;  4C23 A;  3EYZ A;  1LWF A;  3FZF A;  1MU2 A;  1Z05 A;  1DLO A;  2QWO A;  3H1Q A;  5I42 A;  1OKJ A;  1OH5 A;  1NGC A;  3K57 A;  1U45 A;  3PO4 A;  4CHY A;  3VEY A;  1BIZ A;  2O8F A;  2DFF A;  1LWE A;  1R0A A;  1YJN N;  2P9S B;  4M63 C;  3SPZ A;  5CZ1 A;  2HHU A;  1TKD A;  1HNX K;  3O9Q A;  4C1N K;  3KLG A;  1LW2 A;  1YI2 N;  3ZSX A;  5JLF A;  4CF8 A;  2XY8 A;  4O0J A;  5BPN A;  4BQZ A;  4FPB A;  3IRX A;  4KHP K;  1SL2 A;  1S9E A;  3ZSZ A;  4CEE A;  3O4Q A;  5AQH A;  3H6E A;  5FPM A;  1TKX A;  4DTR A;  5GAH P;  4RCH A;  4CER A;  4DV7 K;  2P9S A;  4AM6 A;  5C15 A;  2XY5 A;  2P5G A;  2KTQ A;  2QWN A;  4DTM A;  1C0M A;  1HJO A;  1YVU A;  3CQ8 A;  4CZG A;  1U6Z A;  4EHT A;  1RDA A;  5BRH A;  4DFM A;  1HQE A;  1KSP A;  1N6Q A;  5AQK A;  3ZT2 A;  5B8H A;  3LWM A;  3F9M A;  2ZJQ L;  3CPW M;  4JKB A;  4FZZ A;  1BCO A;  1CZB A;  1D9D A;  1ZBU A;  3DXK B;  3AVL A;  4CGI A;  1NKE A;  1V4S A;  4Z4C A;  1M1K O;  4DU3 A;  3S3N A;  4ICL A;  5C2D A;  2D0A A;  3F5T A;  1ZBS A;  1QTM A;  4BE2 A;  2A3Z A;  4RW8 A;  4MLE A;  4RTF D;  1JLC A;  2QWL A;  3V9U A;  3TAM A;  5M1F A;  2YHA A;  1NM1 A;  3T19 A;  1C6V A;  3FR0 A; 
#chains in the Genus database with same CATH homology
 3OY9 A;  1RDB A;  2HHT A;  3HYF A;  1L3S A;  4E0D A;  3ISN C;  1T03 A;  1JXB A;  4OGC A;  3PX4 A;  4CE9 A;  2DFE A;  4CJT A;  1KCF A;  2HVI A;  4IFY A;  4FJH A;  3OYC A;  3U6F A;  4DU1 A;  4J2E A;  1RT6 A;  4FM1 A;  3VQE A;  4FK4 A;  4FLX A;  4LD0 A;  1VSJ A;  2HW3 A;  1B92 A;  3AVM A;  2Y1I A;  4CJF A;  5KGW A;  3MXM A;  4KI6 A;  1YTU A;  1CXU A;  4DSE A;  4ELT A;  4YNQ A;  3C6T A;  4E7I A;  1RT7 A;  4DSL A;  1JL2 A;  4I2Q A;  4DQR A;  3HVT A;  1ASW A;  1EP4 A;  5K14 A;  3CM6 A;  4BDY A;  3DLK A;  1QSS A;  2G8I A;  1WSF A;  3OYF A;  4OVL A;  2DY4 A;  4C8L A;  3OYK A;  3SI6 A;  2Z1H A;  3DLG A;  2YKN A;  2BAN A;  1B9D A;  2EHG A;  2O4G A;  4NCG A;  3L2U A;  3HJF A;  1IKX A;  4M3R A;  2RPI A;  4RW6 A;  2HNY A;  1T8E A;  1GOB A;  1JLA A;  3AO5 A;  1VSH A;  3AVH A;  1WSJ A;  2EX3 A;  1BIU A;  3DYA A;  3ZSR A;  4EP4 A;  4F3T A;  1CXQ A;  1JLB A;  3AA3 A;  4LSN A;  5SZT A;  5J2M A;  2HB5 A;  4JS4 A;  4CFB A;  4FLW A;  3K58 A;  1JLF A;  1S6Q A;  4LY7 A;  1NK6 A;  3NGZ A;  4FLU A;  1JLQ A;  3CFO A;  1BIS A;  4E3S A;  2A1R A;  2KZZ A;  3HVR A;  1IKV A;  3HO1 A;  1HJR A;  4CGJ A;  3HT3 A;  3ZSY A;  2B5J A;  1JXE A;  2YNG A;  2VWK A;  4FM0 A;  1FK9 A;  1IH7 A;  2YHB A;  2YNI A;  4CF2 A;  4JRP A;  4FJ7 A;  1CZ9 A;  4RW4 A;  3ZSO A;  1RBU A;  4CJP A;  3MXI A;  1S6P A;  3SQ4 A;  1GOC A;  2YKM A;  1I39 A;  4OPJ A;  3DOK A;  3OYN A;  3L2W A;  3OYH A;  1FKP A;  2IC3 A;  4Z4H A;  1EKE A;  1BQM A;  1S1X A;  1S1T A;  3D0P A;  3I0R A;  2OA8 A;  4FJ9 A;  3KTQ A;  4RG8 A;  3LAK A;  3VA0 A;  4ZHR A;  1KVA A;  3ZT4 A;  1HPZ A;  5C42 A;  4M42 A;  4F4K A;  3O3G A;  4C8K A;  3NFA A;  3AVB A;  3CM5 A;  4KB0 A;  1N5Y A;  1K6Y A;  4CFA A;  1RT5 A;  4AHR A;  1RT1 A;  3L2Q A;  3LP1 A;  3T1A A;  3SJJ A;  1IG9 A;  3VA3 A;  2RKI A;  2DTU A;  4M3Z A;  4BWJ A;  1JLG A;  4CIE A;  3QES A;  1RDD A;  3VQD A;  3RMC A;  1W0H A;  3HP9 A;  2D0C A;  3HPG A;  1VSI A;  1RBS A;  3AVF A;  4DFJ A;  5KRT A;  4IG0 A;  3I0S A;  4DG1 A;  5HP1 A;  4PY5 A;  1SKS A;  2A1S A;  2Q3S A;  4N47 A;  3RRH A;  3KK1 A;  2G8K A;  4CJS A;  1ZBF A;  2LSN A;  2ZE2 A;  3LP2 A;  4CEO A;  2G8W A;  2HHW A;  1TK5 A;  3MED A;  4B9S A;  3NF6 A;  4DU4 A;  3NH2 A;  3PO5 A;  3OYD A;  4CHZ A;  1RBR A;  4FW2 A;  4DQQ A;  2ETJ A;  3DRS A;  4C8O A;  3SQ2 A;  4E7K A;  1J53 A;  1EX4 A;  2WON A;  4DTX A;  4Z4F A;  4DF8 A;  4H8K A;  1I3A A;  3IS9 A;  3AVN A;  3A2F A;  3TWH A;  3PV8 A;  3WNH A;  4E7H A;  4CHQ A;  1LAW A;  3PX6 A;  1J5O A;  4DSJ A;  5FRN A;  3IG1 A;  4Z4E A;  3QNN A;  3AO3 A;  3H08 A;  1CLQ A;  3AVC A;  3DLR A;  3DRP A;  4IKF A;  3V9Z A;  4ID5 A;  4CGH A;  3SYZ A;  1C0T A;  2QKB A;  4G1Q A;  2OZS A;  3L2V A;  5KGX A;  4OKJ A;  1BL3 A;  4J2D A;  4OJR A;  3NCI A;  5HLF A;  3AVK A;  3M8S A;  1VRU A;  3SV3 A;  1HNI A;  1FXX A;  5CYQ A;  3TAR A;  4AHV A;  4QCL A;  4W5R A;  2G8U A;  1REV A;  3V6D A;  1TV6 A;  1A5W A;  4B08 A;  2Z1G A;  3HP6 A;  3O3F A;  4AIL C;  4KFB A;  1RT2 A;  1UA1 A;  3HL8 A;  1TAU A;  1SUQ A;  2IAJ A;  2FBY A;  2ITG A;  4IDK A;  3SQ1 A;  1QE1 A;  3AVI A;  1KVC A;  3DM2 A;  4CED A;  4KO0 A;  3RMD A;  1F21 A;  1VSF A;  3MEG A;  1IKW A;  4CK3 A;  1VSL A;  3PX0 A;  4FJL A;  2X6S A;  3OS1 A;  4PQU A;  3VQ6 A;  2WOM A;  4KHY A;  4JS5 A;  1RTI A;  4FLT A;  4FYD A;  3L8B A;  3K5N A;  3LZI A;  2G8V A;  4B9L A;  2P51 A;  1RTH A;  4FCY A;  3LWL A;  4M3W A;  3VQ8 A;  4HUG A;  4DQI A;  4HHT A;  4FJJ A;  4ELV A;  4OLA A;  3DOL A;  4CJ5 A;  3NDK A;  4NCA A;  3V9W A;  3OYG A;  4KTW A;  3QET A;  3THV A;  3VQB A;  4B9N A;  4CF0 A;  4TSX A;  2HHQ A;  3L2R A;  2FC0 A;  4Y1C A;  4O55 A;  3RMB A;  1NK0 A;  3B6P A;  1DTQ A;  3QIN A;  3LDS A;  4FJ8 A;  4IBN A;  3SPY A;  1YTA A;  3K5M A;  4CCH A;  3UIQ A;  1G15 A;  2XY7 A;  4H4O A;  4O0I A;  4F2R A;  1S1V A;  1NK8 A;  2FBV A;  3OYI A;  1L3V A;  1VSM A;  3WNG A;  1WSG A;  3L3U A;  3G10 A;  3ZSQ A;  4CHP A;  1U4B A;  1FKO A;  1TGO A;  2B4J A;  5J1E A;  3LPT A;  5HBM A;  5SWM A;  5T7B A;  3KK2 A;  4FLV A;  4N76 A;  4RW9 A;  1VK0 A;  4F8R A;  3VQ9 A;  3QIO A;  3NHG A;  4HUE A;  3TAQ A;  1TK8 A;  5HRN A;  5HRO A;  1C1C A;  1RNH A;  4CK1 A;  4CFD A;  1KVB A;  4CJE A;  3OYA A;  3RR8 A;  1J54 A;  5J2P A;  3AV9 A;  2YV0 X;  3QO9 A;  4CES A;  1NOY A;  1SKR A;  3HPO A;  2OYQ A;  4Z4I A;  3K5L A;  1TK0 A;  3NF7 A;  4KRE A;  3U3G A;  1C1A A;  3VQ4 A;  2X78 A;  4B8C A;  4CIG A;  3CFP A;  4CJW A;  4LSL A;  4CJR A;  1X1P A;  2KFZ A;  3AVA A;  1RDC A;  1BI4 B;  1LAV A;  1RCH A;  4Y1D A;  5KI6 A;  3I8D A;  3NE6 A;  1EET A;  2PYJ A;  1WLJ A;  3AO2 A;  4WE1 A;  3M8R A;  2X6N A;  1UA0 A;  2G8F A;  4I7F A;  1RTD A;  3ASM A;  3QEI A;  3EZ5 A;  1JL1 A;  4FVM A;  4OLB A;  4KTQ A;  1NOZ A;  2HND A;  3NF9 A;  3DI6 A;  3NGI A;  4M3X A;  2F96 A;  3P5J A;  2VG6 A;  4RW7 A;  1ZBL A;  3OYM A;  4DWI A;  1A5V A;  3DLB A;  2YNH A;  4M41 A;  3KJV A;  3TAB A;  4DQP A;  3S3O A;  3MAQ A;  1ASU A;  3IAY A;  4M3T A;  4CJV A;  2QKK A;  2O4I A;  2FBT A;  4Q5V A;  2KFN A;  1U48 A;  2GV9 A;  4B8A B;  1JKH A;  3JSM A;  4FJK A;  4HCC A;  4KHW A;  1HYZ A;  2YNF A;  2W42 A;  3V9X A;  3VN5 A;  3TAN A;  1BI4 A;  3LP0 A;  4IG3 A;  4N5S A;  1A5X A;  4DLG A;  4KHS A;  1HMV A;  3ZSV A;  1TL3 A;  4CJ3 A;  4EZ6 A;  3PUF A;  4E1N A;  4GW6 A;  4FLY A;  3SCX A;  2OPQ A;  4DSF A;  2IDO A;  3C95 A;  3TI0 A;  4DSI A;  4FJI A;  1NK5 A;  2F8T A;  2OPS A;  3L3V A;  3C6U A;  2XHB A;  1BCM A;  3KIO A;  3NH0 A;  4DLE A;  1SL1 A;  1KFS A;  4F2S A;  4PUO A;  3QIP A;  4B9V A;  1VSD A;  3QEX A;  2HHX A;  1NK4 A;  4BWM A;  4FW1 A;  4FZX C;  3SNN A;  4I9Q A;  3AO1 A;  1TVR A;  3BGR A;  1S1W A;  3HM9 A;  4FJG A;  4GMJ B;  1WAJ A;  3VQ5 A;  1JLE A;  4W5T A;  1T05 A;  2GUI A;  1XHX A;  1VRT A;  4OKE A;  3RWU A;  3DLH A;  3LZJ A;  1QSL A;  4LH4 A;  4KHU A;  1TKZ A;  1BGX T;  4QAG A;  1YT3 A;  4NYF A;  2G8H A;  4AHT A;  4B9U A;  4GVM A;  4DFK A;  4EP5 A;  4KAZ A;  1Z25 A;  4EZ9 A;  3QER A;  1RT4 A;  4JLH A;  5EU7 A;  4F3O A;  4PWD A;  3MEC A;  3P83 D;  4E7J A;  3KD1 E;  2RF2 A;  4KRF A;  3KLI A;  2FBX A;  1QSY A;  3V1Q A;  3E01 A;  2HNZ A;  4Z0U A;  3ALY A;  3MEE A;  3ITH A;  4NCB A;  3TAG A;  5D3G A;  2Z1I A;  4CGF A;  1UAX A;  1S5J A;  2D0B A;  3JYT A;  4H4M A;  3QNO A;  5HRS A;  1S9G A;  4E1M A;  1LV5 A;  1O1W A;  1L3T A;  1Y97 A;  4MQ3 A;  2XO7 A;  4J2A A;  3QEW A;  2KQ2 A;  1U04 A;  2IS3 A;  3S3M A;  2BDP A;  4B9M A;  3VQQ A;  4AHU A;  4E7L A;  1L3U A;  5J2N A;  1XHZ A;  1WNS A;  1QS4 A;  3LAN A;  5CYM A;  4E89 A;  1HYV A;  3NF8 A;  4PA1 A;  4FM2 A;  4BDP A;  4YFU A;  4W5O A;  4M45 A;  4CFC A;  2KW4 A;  3ZCM A;  3F73 A;  3QEP A;  5I3U A;  2JLE A;  1J9A A;  3O3H A;  1ZYQ A;  4O5B A;  3SV4 A;  3VQC A;  1QHT A;  1SL0 A;  1XWL A;  4OKK A;  3KLH A;  3V81 A;  4AHS A;  4CEC A;  4DSK A;  4C8N A;  2BGG A;  3VQ7 A;  3HST B;  3TR8 A;  4AHC A;  3K59 A;  3HK2 A;  4DTN A;  2HHV A;  4KTZ A;  2P5O A;  2VG7 A;  3M8Q A;  2E6M A;  4NYN A;  4DMN A;  4FJM A;  1HNV A;  1BQN A;  1KFD A;  3ZT1 A;  4J2B A;  4CGG A;  1SKW A;  2PYL A;  2HHS A;  1X9W A;  4CJK A;  1T7P A;  4KB1 A;  4QOZ B;  1KLN A;  1ZBI A;  4FJN A;  4ZTJ A;  2E4L A;  3ZSW A;  2ZD1 A;  4CEQ A;  4CGD A;  3SUQ A;  4E19 A;  1C1B A;  2X74 A;  1KTQ A;  2B6A A;  3KLF A;  3NAE A;  4AH9 A;  1NJY A;  3LAL A;  2QXF A;  3RR7 A;  1UOC A;  3KLE A;  1NK9 A;  2F8S A;  5HRP A;  4DTJ A;  4ZTF A;  1Z26 A;  3K2P A;  3OJS A;  3AA2 A;  4CHN A;  5KTQ A;  3CFR A;  2R7Y A;  4FXD A;  1VSE A;  3P1G A;  2NUB A;  1RBV A;  3AA4 A;  5J2Q A;  1NK7 A;  4N56 A;  4CEF A;  3NH1 A;  1NJW A;  2HVH A;  4Z4G A;  5FDL A;  1Q9Y A;  5JS1 A;  3AO4 A;  4BE1 A;  3SUP A;  4CIF A;  4DS5 A;  4DTP A;  2XY6 A;  3BDP A;  3TAP A;  4ELU A;  4CJ4 A;  2VG5 A;  1D5A A;  4HVJ A;  3DLE A;  1QQC A;  4JRQ A;  3AA5 X;  3VQA A;  1XC9 A;  1DTT A;  3WNF A;  4I9L A;  1NKC A;  4FK2 A;  3RTV A;  1HYS A;  3OVN A;  3QLH A;  1VSK A;  3OS0 A;  4KI4 A;  3CG7 A;  4FK0 A;  4KKO A;  1LWC A;  1C0U A;  3OYJ A;  4CHO A;  5E41 A;  3SUO A;  1EXQ A;  3C94 A;  3LP3 A;  1RT3 A;  2ZQB A;  3TAE A;  5C25 A;  1WSI A;  1WSH A;  1TAQ A;  4K8Z A;  1U49 A;  3OYE A;  2BE2 A;  1KRP A;  4DS4 A;  1X9S A;  2D5R A;  4CF1 A;  2OPP A;  4OPK A;  1LW0 A;  4HTU A;  1RTJ A;  3ULD A;  2OZM A;  2AJQ A;  4M3Y A;  1UWB A;  4FJX A;  4I2P A;  4CJL A;  3VQP A;  4DTS A;  5FRM A;  4BDZ A;  4Q0B A;  5FRO A;  1Q8I A;  2QK9 A;  3EYZ A;  1NJX A;  5KRS A;  1RBT A;  1S1U A;  1LWF A;  2ATQ A;  1B9F A;  4CK2 A;  1MU2 A;  3KKS A;  1DLO A;  1RIL A;  5CY4 A;  4XIU A;  4HCB A;  4N41 A;  5I42 A;  3SQ0 A;  2E6L A;  3K57 A;  1U45 A;  3PO4 A;  3CYM A;  4CHY A;  4CJU A;  4CEZ A;  1BIZ A;  3V9S A;  1NKB A;  2DFF A;  1LWE A;  3B6O A;  1R0A A;  3DMJ A;  1HRH A;  1KLM A;  3WNE A;  5CZ1 A;  3U3Y A;  3SPZ A;  2HHU A;  1TKD A;  3PY8 A;  3FFI A;  4BE0 A;  5CZ2 A;  3T3F A;  4KPY A;  3KLG A;  1LW2 A;  3QEV A;  3V4I A;  3RRG A;  3AVG A;  4L8R B;  2GBZ A;  3ZSX A;  4K8X A;  4DTO A;  4FJ5 A;  4CF8 A;  2XY8 A;  4O0J A;  2RN2 A;  4DTU A;  2PZS A;  4DQS A;  1NJZ A;  3V1R A;  3AVJ A;  1ZBH A;  1SV5 A;  3KK3 A;  4W5N A;  3IRX A;  3HPH A;  1D9F A;  4LH5 A;  3M8P A;  1SL2 A;  1U47 A;  1S9E A;  5HRR A;  3ZSZ A;  4CEE A;  3O4N A;  3ZT0 A;  3KD5 E;  3O4Q A;  1X9M A;  1BHL A;  4O4G A;  3OJU A;  3EY1 A;  5DMR A;  1TKX A;  4DTR A;  2I5J A;  4CJQ A;  3LAM A;  4R5P A;  3S9H A;  4CER A;  2HMI A;  3HXM A;  4KV8 A;  4OGE A;  4CEA A;  2XY5 A;  2P5G A;  2KTQ A;  2DFH A;  5JS2 A;  3LPU A;  4DTM A;  1C0M A;  1YVU A;  4ID1 A;  3TAF A;  2P1J A;  3CQ8 A;  3SZ2 A;  4HUF A;  1RDA A;  4O44 A;  3NGY A;  4DFM A;  1HQE A;  4CF9 A;  1KSP A;  1N6Q A;  1W9H A;  4UQG A;  1WN7 A;  5DK5 A;  3ZT2 A;  2VWJ A;  1ITG A;  4MFB A;  3LWM A;  1XI1 A;  3OYL A;  2Y1J A;  3OS2 A;  4KHN A;  3KKR A;  1TL1 A;  2IGI A;  4FZZ A;  1BCO A;  1CZB A;  4DFP A;  1ZBU A;  1D9D A;  3MXJ A;  3AVL A;  1HQU A;  3RMA A;  1L5U A;  4CGI A;  4FLZ A;  1NKE A;  1GOA A;  4C8M A;  1ASV A;  3NBP A;  1IKY A;  3V1O A;  3K5O A;  4Z4C A;  2OPR A;  4DU3 A;  3SUN A;  3S3N A;  4ICL A;  5C24 A;  2D0A A;  1WSE A;  1QTM A;  4B3O A;  3F9K A;  4IFV A;  4BE2 A;  4W5Q A;  4B9T A;  2KZM A;  4RW8 A;  1D8Y A;  1WAF A;  4DF4 A;  4KHQ A;  2IOC A;  3DRR A;  1Q9X A;  2Z1J A;  4FZY A;  3OYB A;  1JLC A;  2XRI A;  1C6V A;  3G0Z A;  1TKT A;  3TAM A;  3V9U A;  2PY5 A;  3ZT3 A;  2YHA A;  3D45 A;  4BAC A;  3T19 A;  4CEB A;  2JGU A;  1IO2 A;  4M3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...