3AA2A

A52i e. coli rnase hi
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
153
structure length
153
Chain Sequence
b'KQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAIIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Protein core adaptability: crystal structures of the cavity-filling variants of Escherichia coli RNase HI
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 48
structure length 153
sequence length 153
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3aa2A00
1RT5A 3VA0A 1VRUA 4JRQA 1VSLA 3M8QA 4CK3A 4DTJA 1ASVA 3KLFA 1Y97A 1QSSA 3DMJA 4CIEA 3L3UA 5HROA 2PZSA 3IS9A 4CF2A 2G8IA 4RG8A 3CG7A 1NK9A 3TAMA 1WSIA 5FROA 5DK5A 4FJXA 3AVKA 4DF4A 4CJSA 2P1JA 4CJ5A 1HQEA 3SV3A 2YNFA 1TKZA 3OVNA 3KKSA 1R0AA 4DU4A 1ZBHA 3C95A 2OZMA 4BACA 3AO5A 1LWEA 1HJRA 3LZIA 5CZ1A 2JGUA 3F9KA 3VQDA 1NOZA 5CZ2A 4KI4A 1IH7A 3LANA 4DSIA 2B6AA 3NF6A 4DS4A 1NK4A 1UA1A 1KLMA 2RF2A 1I39A 1BL3A 4RW9A 2I5JA 3NHGA 4K8XA 2P5OA 2YNHA 3ITHA 1U4BA 1N6QA 3OYCA 4F8RA 1WSJA 3AVCA 2HMIA 3THVA 4CEFA 4CFCA 1TV6A 3CFRA 4CGIA 4I9LA 1NJYA 5HRSA 3SZ2A 3QEXA 4KI6A 1ASUA 1UA0A 4CEQA 3DLBA 5HRNA 1QE1A 4IG3A 5KTQA 1RBVA 2BE2A 4O0IA 4CK1A 4J2EA 4GW6A 1B9FA 5C24A 3QNNA 1JLGA 3I0RA 2YNIA 5J2MA 4M42A 2Y1JA 3LWLA 3ZCMA 4KTWA 3LPTA 3V9UA 3K5LA 4DTXA 1IKWA 2YKMA 3TAFA 4FVMA 1WSFA 1WNSA 3OS1A 4K8ZA 1JKHA 3BGRA 5HBMA 4CIFA 4DSJA 4B8AB 1CXUA 4J2AA 1T7PA 3OJUA 4N76A 4Q5VA 3OS0A 3RWUA 3ZT4A 4M3UA 2F8TA 3CYMA 1FKOA 3EY1A 3NCIA 4DFPA 1SL2A 4FJ9A 1ASWA 4IBNA 3KK1A 4LSNA 4W5QA 1KFDA 3ZSWA 2OZSA 3TWHA 4CEBA 2XY7A 4DSFA 2JLEA 4BDPA 4EP5A 4CJRA 1C0UA 1HYZA 4G1QA 3OYIA 3S3NA 4OVLA 3HM9A 4KFBA 3ZT3A 3KLGA 1NK5A 3QEPA 3AVAA 4AHCA 1TKTA 4OKKA 5HRRA 3U3YA 1X9WA 3VQ4A 3DLHA 3QETA 1WSGA 2G8KA 4ELTA 3NDKA 1FK9A 3SV4A 4B9UA 3VQ5A 1IO2A 4DQSA 4B9SA 1BIUA 4GMJB 3SQ2A 4KTZA 1JL1A 4B3OA 3KK3A 1YVUA 4FLVA 2OPSA 2DY4A 3PY8A 3ZT0A 1RDBA 3QEWA 4Z4EA 2XY8A 3AA3A 4DTNA 3ZSYA 1C6VA 3QIPA 4OKJA 1W9HA 4PUOA 1RNHA 1J54A 4DFKA 4DSLA 1TAUA 4E7LA 3A2FA 3DRPA 4XIUA 4IFVA 3C6TA 1RDCA 5EU7A 1LAVA 1KCFA 4CF1A 4CJEA 1RBSA 4CE9A 1EXQA 2VG5A 1HRHA 4DTSA 5JS1A 2FBTA 3D0PA 3HPOA 4CGFA 1D8YA 2EX3A 2KQ2A 4I9QA 4F3OA 4DQQA 1QHTA 3RRHA 4AILC 4LH4A 4B9NA 4DQIA 4CFDA 3TAQA 4OLBA 4QCLA 4NCAA 4CHOA 3PX4A 1W0HA 2HVHA 4CHPA 2HHWA 3F73A 3LAKA 4O55A 5J2NA 4FZXC 1CXQA 1VK0A 3IRXA 1X9SA 1S9EA 3TR8A 1KVAA 3AO3A 4C8MA 2YHBA 3CFPA 3MAQA 3ASMA 3RMBA 2KFNA 2O4IA 1NJZA 1ITGA 4CJUA 1NKBA 1BIZA 2QXFA 2RN2A 2ZQBA 3V1QA 2DFEA 1IKYA 3MEEA 4I2PA 4CESA 4FLWA 3LPUA 4W5RA 4HUFA 3TANA 4CJWA 1C1BA 4DQRA 1JL2A 3E01A 4KKOA 3HXMA 3ZT1A 4CF8A 3K59A 4DFMA 1JLQA 5CY4A 3B6PA 3NH1A 1NOYA 1RTDA 3AO1A 1S1XA 4CJ3A 3OYHA 2Y1IA 2KZMA 4FM1A 1RT1A 1BI4B 5D3GA 4KHNA 4FZZA 1VSFA 1JLAA 4AHUA 3U3GA 4DTRA 2OPPA 2IOCA 1CZBA 2QKKA 4B9TA 2X74A 2Z1GA 4Y1DA 4M3WA 3L2VA 1EP4A 1VSMA 3M8PA 3NF9A 3KJVA 3AVIA 3HSTB 2G8WA 3K2PA 3VQ8A 1QSYA 4F3TA 5DMRA 4H4MA 4FZYA 1SL1A 4CGJA 1LWFA 4AH9A 3DLGA 4OPJA 3OY9A 1U48A 2D0AA 4DLEA 4Z4IA 2X78A 4Z4CA 3QIOA 1Q8IA 3VQ6A 1RCHA 1T05A 4CHQA 1TL3A 2YHAA 3P5JA 4E7JA 1LW2A 1REVA 3DI6A 3KLHA 3LZJA 3M8RA 4UQGA 3NF7A 2ZD1A 3PX6A 2Z1JA 3MEGA 2YNGA 3ZSZA 1O1WA 1EETA 4ICLA 4BWJA 3T1AA 3B6OA 3WNFA 3OYNA 4LD0A 4FJGA 3VA3A 4AHRA 4E7KA 3QNOA 3OYLA 2PYJA 4KB0A 4DWIA 1U45A 1L3UA 3NBPA 3PO5A 2Z1HA 3AVJA 3K5NA 3SQ0A 3HVRA 3OYEA 2O4GA 3CM5A 2IGIA 4CHNA 3HT3A 5I42A 3QERA 4I2QA 1HYSA 1BQMA 4RW7A 1TKDA 1RBTA 2R7YA 3KLIA 4Y1CA 4M3YA 4NYFA 2NUBA 4JS5A 4LSLA 1VSJA 2QK9A 1BHLA 4IFYA 1X9MA 3FFIA 3QEVA 2X6SA 3AA4A 4KREA 1RDAA 1DLOA 2RKIA 3JSMA 5KRSA 4TSXA 4F2SA 1L3SA 2FC0A 3AO2A 1WSHA 4N41A 3LP0A 2XRIA 2YKNA 1L5UA 3H08A 4O5BA 3T19A 2RPIA 1BGXT 5KI6A 1CLQA 3O4QA 1RTIA 3SQ4A 4OJRA 3VQCA 4JS4A 1TK5A 4CGGA 2KFZA 4HCBA 1T8EA 1JLBA 4FJ7A 3K58A 4FJHA 3AA5X 2GBZA 4ZHRA 3RTVA 4B9LA 1L3TA 3V1OA 5T7BA 3LDSA 3OYBA 3HL8A 3KD5E 3AO4A 3DOLA 3HVTA 3AVBA 4CEZA 1QTMA 3MXJA 3MXIA 2P51A 4CJLA 5KRTA 4JLHA 2F96A 1RTJA 1VSEA 2IC3A 3S3OA 1CZ9A 5J2QA 4PQUA 1C1AA 3VN5A 4FJJA 1TKXA 4JRPA 1T03A 5FRMA 4M3RA 3TAEA 2E6LA 1XHXA 1XI1A 2OPRA 4CERA 4B08A 4NYNA 4OGCA 3O3FA 1LV5A 4B9MA 4FK2A 2HVIA 2EHGA 3OYJA 3AVGA 4W5OA 1C1CA 3P1GA 4CJQA 3AA2A 4L8RB 1N5YA 4CJVA 4CHYA 3O4NA 4PA1A 2G8FA 1YTAA 5FRNA 4CJFA 3OS2A 4FYDA 4HVJA 3K57A 2VWKA 2FBXA 3S3MA 1Q9YA 4CF0A 1NK7A 1RBRA 4KB1A 1HQUA 3ZSXA 2KW4A 4CK2A 3SUQA 2OYQA 1GOBA 2WONA 3SNNA 3L2UA 1WSEA 1JXEA 4CFBA 1F21A 4BDYA 3MEDA 4FW1A 1ZBUA 4NCGA 4YNQA 4N5SA 3K5MA 3QEIA 3SUNA 4IG0A 3G10A 1EKEA 3OJSA 2XY5A 4B9VA 3AV9A 3ZSQA 3K5OA 2GV9A 2DFHA 4ID1A 4LH5A 2VWJA 2GUIA 3SJJA 5K14A 4CEAA 4CJKA 3OYMA 4R5PA 3D45A 4C8LA 4J2DA 4KHUA 5SZTA 4H4OA 4ID5A 3SI6A 1VSDA 3QO9A 2F8SA 1BQNA 5KGWA 4E7HA 2OPQA 1WAJA 4N56A 2BGGA 4J2BA 4FJ8A 4FJIA 3HPGA 4RW8A 1YTUA 2HNDA 1S9GA 3ZSRA 1I3AA 1VSIA 3DOKA 1HNVA 1TL1A 3PX0A 1C0TA 1A5VA 1A5WA 3RMAA 4C8KA 4DU1A 3RR8A 4ELUA 2D0BA 4DS5A 1SUQA 3DYAA 4IKFA 4CIGA 1D9DA 2BDPA 4FLZA 4DSEA 3T3FA 3AVMA 1UWBA 4Z4FA 1S1TA 1KVCA 1UAXA 4CEEA 4DQPA 4FJKA 4FLYA 3AVNA 4W5TA 3NH0A 1C0MA 4AHTA 5HLFA 2D0CA 3VQ9A 2IAJA 4CFAA 5SWMA 1KFSA 1ZBIA 3RRGA 4FJ5A 4IDKA 1S1WA 3DLKA 4CJ4A 4PWDA 2HHXA 3VQAA 4H8KA 1FKPA 1JLFA 4E0DA 1GOAA 1K6YA 4KO0A 3VQBA 4YFUA 1SKSA 5CYQA 3LP1A 3VQQA 3QINA 4PY5A 4CGHA 1JLEA 3MXMA 5HRPA 1ZBFA 3PV8A 1B92A 2HB5A 1XHZA 2HW3A 1BI4A 3SQ1A 3V9XA 4ZTFA 1DTQA 3V9SA 1D5AA 3ZT2A 1TAQA 3QESA 4AHVA 4DLGA 3L2WA 2HHSA 2B4JA 4O0JA 3G0ZA 2HHVA 1YT3A 1QSLA 3OYDA 4BE0A 4FJLA 3WNEA 3NAEA 2XO7A 4AHSA 3DRSA 4O44A 1WN7A 1LWCA 4RW6A 4DMNA 3KIOA 1Z25A 3SPZA 4FLUA 2OA8A 1IG9A 3PUFA 3HP9A 1RT3A 3EYZA 3NGIA 4EZ9A 2HNYA 2G8UA 1NJWA 4FK0A 3VQEA 1RILA 2B5JA 3QLHA 4CECA 1Z26A 4BWMA 4DTOA 2HHQA 3SCXA 1KLNA 3IAYA 3DRRA 3ISNC 3AVLA 3HPHA 2VG6A 4E7IA 2G8VA 4E3SA 1HPZA 1ZYQA 2KZZA 3TABA 4EP4A 3I8DA 4CJTA 1HMVA 2P5GA 4WE1A 2A1SA 4FJMA 4W5NA 3EZ5A 3V9WA 3TAPA 2HHUA 2DFFA 3V6DA 1KRPA 2ETJA 4FLTA 3KTQA 3PO4A 5E41A 3C94A 1MU2A 1LAWA 1WAFA 1KSPA 2HHTA 1RTHA 3MECA 3KD1E 3O3GA 5HP1A 1IKXA 4E19A 4CHZA 4ZTJA 3NE6A 3HO1A 4LY7A 4C8OA 3SYZA 2LSNA 3L3VA 3ULDA 4DTMA 2XY6A 4KAZA 3NF8A 3LP3A 4MFBA 1LW0A 1RT7A 3VQPA 1S6QA 3DLEA 3NFAA 3KLEA 4HTUA 2KTQA 4Z0UA 1FXXA 1KVBA 2QKBA 1S5JA 1U04A 4O4GA 1DTTA 3O3HA 1VSKA 3RMDA 1NJXA 1UOCA 4M3ZA 4QOZB 3V1RA 3OYGA 3I0SA 2D5RA 3ALYA 1NK0A 2AJQA 3CFOA 1TK0A 4BDZA 4EZ6A 4M41A 3CM6A 3L8BA 3WNGA 4FM2A 4QAGA 3V4IA 1XC9A 4M3TA 2Z1IA 3HJFA 2IS3A 4E1NA 4Q0BA 3SUOA 4B8CA 3TI0A 4DTPA 4F2RA 4KHWA 4OPKA 5I3UA 3M8SA 4HCCA 1RT6A 3NGZA 1EX4A 2G8HA 4HUGA 1QQCA 3VQ7A 2X6NA 2FBVA 2A1RA 3RR7A 2DTUA 3BDPA 4KHQA 5J1EA 3L2RA 4KHSA 2E4LA 3L2QA 3CQ8A 5C42A 4KPYA 4M3XA 4KHYA 4GVMA 1BCOA 1IKVA 1SL0A 2Q3SA 2ATQA 1RT2A 4I7FA 4FW2A 1S6PA 4DF8A 3U6FA 1VRTA 3P83D 1NKEA 3KKRA 3LWMA 1S1VA 2XHBA 1QS4A 5KGXA 1KTQA 4KRFA 1TVRA 1B9DA 1HYVA 4M45A 1NKCA 1S1UA 1X1PA 3DM2A 4E89A 4DTUA 2HNZA 4CEDA 2W42A 4HHTA 4DG1A 3NH2A 3C6UA 3LP2A 4Z4GA 4CEOA 1ZBLA 2FBYA 3KK2A 4CJPA 1Q9XA 4C8NA 1NK8A 4F4KA 1J53A 1SV5A 3AVHA 3IG1A 3ZSOA 3HK2A 4FXDA 1BCMA 3S9HA 3LAMA 1L3VA 4N47A 2WOMA 4HUEA 3AVFA 3HYFA 1VSHA 2ZE2A 3JYTA 2VG7A 4MQ3A 4DSKA 1RBUA 3OYKA 4KV8A 3V81A 1NK6A 4CF9A 4FM0A 4CGDA 2IDOA 3RMCA 1RT4A 3SPYA 1D9FA 4FJNA 1SKWA 3OYAA 4E1MA 4FLXA 2E6MA 3DLRA 3ZSVA 4OGEA 1GOCA 1HNIA 1WLJA 3WNHA 2PY5A 5CYMA 4Z4HA 1J5OA 4KTQA 1JXBA 1A5XA 5JS2A 5J2PA 1BISA 5FDLA 1U47A 1G15A 1JLCA 3V9ZA 4DU3A 1RDDA 4RW4A 3TAGA 3TARA 2BANA 4FK4A 2YV0X 3SUPA 4ELVA 1XWLA 1SKRA 4DFJA 3OYFA 4NCBA 3UIQA 4CCHA 4FCYA 4OKEA 5C25A 1J9AA 3LALA 1TGOA 3HP6A 4BE2A 3NGYA 4BE1A 1TK8A 2PYLA 4OLAA 1U49A 2ITGA
chains in the Genus database with same CATH superfamily
1RT5A 3TPQA 1VSLA 3A5LC 1ASVA 5AQFA 3R8EA 4DF4A 2A40A 3SV3A 1BG3A 2YNFA 3KKSA 5AFUA 3E9PA 3C95A 1NGJA 1ZC6A 3CETA 3MN6A 5CZ1A 3F9KA 5BRHA 3RSEB 1NOZA 5CZ2A 1IH7A 3LANA 3WEEB 1I39A 2YNHA 2I7PA 3ITHA 1N6QA 5AQPA 2HMIA 3THVA 1ZBSA 2E2OA 1KAYA 5HRSA 4KI6A 4GY2B 1QE1A 3R1XA 4QS9A 4CK1A 3QNNA 3MMVA 1IBMK 1ZXOA 3LWLA 4KTWA 3N4QA 3V9UA 3GDQA 4BRAA 3TAFA 2HBJA 1JKHA 4XH1A 4J2AA 3OJUA 4F9OA 4CZGA 4Q5VA 3RWUA 3CYMA 4BRNA 1SL2A 3KK1A 5AQXA 2XY7A 3ZEUB 4FWKA 4G1QA 1HYZA 3OYIA 4M63C 4KFBA 3KLGA 3HM9A 2G8KA 4ELTA 2ASMA 5FPMA 4CZHA 1M90O 4B9UA 4B9SA 4FWSA 2UXDK 4B3OA 4KTZA 1JL1A 2YCHA 3KK3A 1YVUA 3QEWA 2QWMA 3PLAA 1C6VA 2IVOA 4PUOA 4MLEA 1J54A 4DFKA 4E7LA 3TU5A 4IFVA 2NRRA 5EU7A 1RDCA 1VQ9N 3A5MC 2PFUA 4ISGA 5LJVA 1EXQA 1MWMA 4FWNA 4GKJK 2EX3A 2HBMA 3E66A 2HHVA 4AILC 5H1SQ 4CFDA 3TAQA 2HVHA 5AZJB 4CHOA 1W0HA 3PX4A 4CHPA 4O55A 3AGRA 4A59A 3KWGA 1ATRA 1BIZA 4LF6K 3MEEA 5CE3A 4DQRA 3HXMA 3LDNA 2V7YA 4CF8A 3M1FA 4MLHA 3FZKA 4OPHA 2Y1IA 3H3OB 1WUAA 4FZZA 4AHUA 4DTRA 4NXNK 2Z1GA 3DAWA 2W41A 4M3WA 3KK7A 3O9QA 3ZX2A 3KJVA 3AVIA 2G8WA 1SL1A 2Q36A 2E1YA 1V4TA 3KHYA 2D0AA 1VHXA 4FWRA 3VQ6A 3MCPA 4A57A 1VQPN 3ENHA 2YHAA 3VOVA 3CC4N 4UQGA 3LDQA 1WB9A 3MEGA 1O1WA 1HNZK 2QI2A 4BR5A 3VA3A 3OYLA 4JKGB 3O9RA 2PYJA 1OVQA 3K5NA 3SQ0A 2P9IB 3CM5A 4AM7A 4IEIA 2HF3A 3NVMA 4NLBA 3VERA 2R7YA 4FL9A 3KLIA 4EHUA 2NUBA 1Y64A 1ILYA 1BHLA 3RSEA 1XUPO 2D0OA 4Y0WA 3WEEA 2YHXA 3I56N 1X3NA 4FVUA 3AO2A 4I6MB 2XRIA 1T44A 5BRDA 4O5BA 3T19A 3E1YA 3QDKA 1C0GA 2E5LK 2UU9K 2KFZA 4HCBA 4IO8A 1T6DA 4FJHA 3AA5X 4ZHRA 5AQTA 3AVBA 4CEZA 5KRTA 1T3VA 2FSNA 2IC3A 5J2QA 3FGUA 4FJJA 3GG4A 1TKXA 5C2FA 4M3RA 2RE2A 3FE1A 3OYJA 3AVGA 3UKRA 4L8RB 3O4NA 2G8FA 4A5BA 4CJFA 3OS2A 4HVJA 3S3MA 2VWKA 2QWLA 3FLCO 3QBWA 4JKFA 3TTCA 4CK2A 1LCUA 4BRQA 4DV7K 1Q86O 3JAMO 2YHWA 1WBDA 1XMOK 3QEIA 4FWMA 2XY5A 2QW9A 4ID1A 2DFHA 2VWJA 3SJJA 4CEAA 4CJKA 4KHPK 2WC9A 1BA1A 4GNIA 3VETA 1WAJA 1TL1A 1C0TA 1A5WA 4DU1A 5AZJA 2D0BA 4X65K 4BR4A 3EZWA 2BDPA 4FLZA 4DV2K 1K8KB 1UAXA 5HLFA 4HWIA 3VQ9A 4CFAA 5SWMA 4B1ZA 4FJ5A 1E4GT 4CJ4A 5AQQA 2O8CA 4L3QA 1GOAA 3VQBA 5DM7L 5CYQA 3VQQA 3MXMA 3MN5A 1HPMA 3SQ1A 5BPLA 5AQRA 4ZTFA 1DTQA 3V9SA 4BR0A 4DKWA 4AHVA 4DLGA 4O0JA 3CF5L 2BH1A 1YT3A 1YHQN 3OA9A 5KPRA 4MDAA 1WN7A 3MDQA 4DMNA 1BA0A 3BY5A 1RT3A 4H0OA 4A5AA 5C12A 3ATVA 3OTOK 2B5JA 2HHQA 4DTOA 4BWMA 4CZFA 3SCXA 3J81O 3ISNC 3JS6A 2VG6A 3TABA 2O8FB 4EP4A 4CJTA 5AQOA 1YXQA 5AQUA 3EZ5A 3TAPA 2HHUA 1KRPA 3R6MA 4FLTA 4BGBA 5E41A 4JKGA 1LAWA 3B8AX 2HHTA 3MN9A 2F9WA 3O3GA 2P9IA 4JI1K 3WQTA 3NE6A 4LY7A 1V4SA 2GX9A 3D6RA 3L3VA 5BN9A 4X64K 2XY6A 4KAZA 2QWNA 4MFBA 2OCEA 2W6KA 2A6AA 3C7NA 1KVBA 2CH5A 4YOXA 5EY4A 5BR8K 2AA4A 4H0TB 5E26A 3KZBA 2H3GX 3CQXA 1XC9A 4M3TA 3HJFA 2IS3A 4BC3A 4B3TK 3J7ZO 4G9ZA 4Q0BA 4B8CA 1RT6A 4WQ4A 2NRWA 1QQCA 2X6NA 3LDPA 1RGIA 1S72N 3CI5A 3SBTA 1DEJA 4M3XA 2KHOA 2P9SB 3TSQA 1YI2N 1RT2A 4DF8A 3KKRA 2XHBA 4KRFA 1KTQA 1B9DA 1NGGA 1S1UA 1X1PA 4E89A 4DG1A 3C6UA 3LP2A 1HJOA 2FBYA 4C8NA 4F4KA 3AVHA 3ZSOA 3HK2A 5AQWA 1L3VA 4N47A 2UUAK 4HUEA 4DSKA 3V81A 3MX5A 4FM0A 4IJNA 1D9FA 1RT4A 5C2DA 2E6MA 3DLRA 3T1HK 1YUWA 4XH4A 3ZSVA 4OGEA 5TKYA 1JXBA 3T7ZA 1A5XA 1BISA 1YIJN 5GAGP 1U47A 2HMPA 3V9ZA 3SAHA 3MK6A 4JK8A 3TARA 5AQIA 4FK4A 3SUPA 5KPZA 1XC3A 3PSFA 5BPNA 4BRGA 2NRTA 4CCHA 4OKEA 4JHDA 1TK8A 2ITGA 3I8BA 1RDUA 3HTVA 4CIEA 4EFHA 3IS9A 3CG7A 3TAMA 3CCLN 1WSIA 5FROA 5DK5A 4JKDA 3AVKA 3C6AA 4A2AA 5BRFA 3OVNA 1MWKA 4YDUC 3O9UA 4BACA 3VQDA 2ASOA 2B6AA 1NLVA 4B9QA 1NK4A 2UUBK 1KLMA 4RW9A 1QZ6A 2I5JA 3NHGA 1WBBA 2P5OA 4LF5K 4F8RA 3AVCA 2EWSA 5JLFA 4CEFA 4CGIA 4YORA 3CCEN 2GELA 3BZKA 4IWVA 1ASUA 4B3MK 1NGEA 5KTQA 1RBVA 1D4XA 5CHIA 3HM8A 1JLGA 3IKMA 4M42A 4A2BA 3I55N 3LPTA 3OS1A 1WNSA 3BGRA 4B8AB 3CCRN 1T7PA 1Q81O 4N76A 5ELZA 4WFNL 3ZT4A 4M3UA 1E4FT 1FKOA 3EE9A 5KQDA 2P9LB 1KFDA 3ZSWA 2OZSA 1NGHA 3KVGA 4EP5A 4B3SK 1FW6A 3S3NA 4OVLA 3THYB 4OKKA 4PKHA 5HRRA 5GIPA 3NDKA 1FK9A 5C0YA 3VQ5A 4JN4A 5AQSA 3WXKA 4GMJB 4O8UA 3SQ2A 3L0QA 4FLVA 3OBYA 4AF1A 4JI3K 3PY8A 4Z4EA 3KWIA 3VTHA 4FOIA 3AA3A 1NNEA 4CZKA 2HBKA 1X3MA 4LF7K 1VQKN 3C6TA 4DUYK 1LAVA 4CE9A 1NU0A 1HRHA 4DTSA 5JS1A 2CGLA 2KQ2A 4IOXA 4B9NA 1QHTA 4LH4A 4OLBA 2HHWA 2KKZA 3IRXA 1X9SA 3AO3A 3ULEB 3MAQA 3RMBA 2O4IA 4CJUA 4QS7A 4DV6K 1YJ9N 3NVKA 1IKYA 3LPUA 1C1BA 3O8MA 4KKOA 3CJ9A 4JI0K 5FPEA 3K59A 5CY4A 3WXLA 4UY8O 3AO1A 1S1XA 5JVHL 1RT1A 5M1FA 3U3GA 2IOCA 1CZBA 2QKKA 4B9TA 4Y1DA 3CQYA 4WQ5A 1VSMA 3VEXA 1VQMN 1DKGD 5AQYA 1U2VA 1IV0A 3HOTA 4JD2A 1LWFA 3G4SN 4BRIA 4JI7K 1W7AA 4DHYA 2KLAA 2NRXA 2X78A 4Z4CA 3O9TA 3QIOA 1Q8IA 3CCVN 2IVNA 4BVPA 3CHWA 1T05A 3P5JA 3DI6A 2ZD1A 2Z1JA 5AZIB 2YNGA 4EAHD 3T1AA 1N8RO 3UKUA 4LD0A 3NBPA 2Z1HA 3AVJA 3HVRA 2O4GA 2IGIA 4JKCA 4IFEA 1HYSA 3H3NO 4I2QA 4RW7A 2QWPA 4Y1CA 4ISEA 4DV5K 4IFYA 3FFIA 2OTLN 3AA4A 1DLOA 3VGKA 1KD1O 4NB4A 1L3SA 4CBWA 3LP0A 1L5UA 3H08A 5KI6A 4JK9A 1CLQA 1BGXT 3RVCA 3HRGA 1RTIA 1GLDG 3VQCA 2P9NB 4JS4A 1TK5A 4CGGA 2Q97A 3BZCA 4FWQA 2VQFK 1BOTO 3RTVA 3HZ6A 3U9ZA 1H1VA 4Z94A 3HL8A 3HVTA 3T1YK 3C65A 1QTMA 3MXJA 3MXIA 3IDHA 4JLHA 2JWLA 1VSEA 1CZ9A 4DR2K 2P9LA 1T03A 3GL1A 2E6LA 1XHXA 3L4IA 4CERA 4NYNA 3O08A 4OGCA 3TTDA 4FK2A 2HVIA 4W5OA 1TYQA 2FXUA 2YI1A 2GWKA 4CJQA 3THYA 1N5YA 4CHYA 2P9UB 3HBTA 1S22A 5FRNA 4A62A 1W97L 2Q1NA 4FYDA 4O5FA 4CF0A 1NK7A 5B8HA 3ATUA 1RBRA 3BP8A 2V7ZA 2KW4A 3SNNA 1X9JA 2OANA 3L2UA 4CFBA 1F21A 1VQNN 4PKIA 5IWAK 2HSTA 4E1JA 3OJSA 3ZSQA 2J4RA 3K5OA 2GV9A 4FJ8A 4BGAA 5K14A 3VEOA 4PKGA 3P31A 1VQ7N 4JI4K 5M1QA 2F8SA 2FF6A 1BQNA 3CJAA 1VQ5N 1VSIA 4C8KA 3PX0A 3NMUA 3RR8A 4ELUA 1HUXA 4CIGA 5BN8A 1D9DA 2WBNA 2D1KA 3T3FA 4Z4FA 1S1TA 3E9OA 4DQPA 3NH0A 4W5TA 4AHTA 4BROA 1GLEG 3DXMA 1O13A 1ZBIA 4IDKA 1S1WA 4RCHA 3THXA 3DLKA 4PWDA 4H8KA 4E0DA 4KO0A 1SKSA 3LP1A 3CIPA 4PY5A 1JLEA 1ZBFA 2HB5A 2UXBK 1D5AA 5GINA 3QMLA 1YVNA 5M1OA 4FJLA 4IXCA 5CR4A 1KQSM 3NAEA 1Q82O 1G99A 4RW6A 3S41A 2VYPA 4FLUA 3R3LA 1IG9A 3HP9A 3NGIA 3EYZA 4EZ9A 2HNYA 3CPWM 3VQEA 4CECA 5A2QO 1KLNA 3IAYA 3DWLA 4JNEA 1ZYQA 3CCUN 3I8DA 1ATSA 4WE1A 4BREA 5AZIA 4ILHA 1KSPA 1NBWA 2E88A 1QVGM 1IKXA 4E19A 4B3RK 3O80A 4C8OA 3SYZA 2LSNA 3NF8A 3LP3A 1LW0A 1RT7A 2QM1A 1S6QA 3DLEA 4Z0UA 2QKBA 1S5JA 4O4GA 4KH4A 1DTTA 3O3HA 1VSKA 4BRLA 4DCHA 1NJXA 4QOZB 1NK0A 2AJQA 3CFOA 4BDZA 4EZ6A 4QAGA 2Z1IA 2P9KB 3EEQA 3F5TA 3M5RA 3ZEUA 4OPKA 2E2NA 5EX5A 4HUGA 2FBVA 2ZJPL 3W3DA 3CQ8A 1OH6A 3O1BA 5M1NA 5AFUH 3VF2A 1IKVA 4I7FA 4CZJA 1VRTA 3P83D 1NKEA 1YITN 1S1VA 1QS4A 5KGXA 4BY9C 1TVRA 5FRMA 2W42A 4HHTA 2HBLA 5GAHP 1NMNA 1VQ8N 3IG1A 3VGMA 2QXLA 4CZIA 3LAMA 3LM2A 2WOMA 5HL7L 2ZE2A 5AQNA 3JYTA 4MO5A 4KV8A 1EWRA 1NK6A 4CZMA 4CGDA 3SPYA 4BG8A 3WNHA 1WLJA 1HNIA 4PL8A 4CZEA 4KTQA 5CYMA 3T69A 4CW7B 1MA9B 4OO1J 5JS2A 5ADXH 1G15A 4H5TA 5MLCQ 3WXIA 1XWLA 1YJWN 3WXJA 1YAGA 3UIQA 2YHYA 3DXKB 3D2FB 1J9AA 3LALA 5C25A 3HP6A 1NGDA 2JWKA 4HTLA 4BRKA 4CK3A 3AY9A 1N32K 3KLFA 1Y97A 1QSSA 3DMJA 5HROA 2PZSA 4LFBK 2O8DB 1Q7YO 2E2PA 5AQLA 4CF2A 4RG8A 1NK9A 4B1XB 4CJ5A 1HQEA 3G25A 1W2BM 2DPNA 3H45C 4DU4A 1ZBHA 2OZMA 3AO5A 3ENOA 4JK7A 1LWEA 1HJRA 3LZIA 4KI4A 3WXMB 1K8AO 4DS4A 2RF2A 1BL3A 1WSJA 1QQNA 3L4QA 3U9DA 4C23A 4CFCA 3CFRA 4GVEA 3QEXA 1GLAG 3DLBA 5HRNA 5FLXO 4O0IA 1M1KO 2BE2A 4IZ9A 3VEYA 1B9FA 3CPEA 5C24A 1K73O 3MCAB 2Y1JA 4B1WB 3K5LA 4DTXA 4IOAL 4FPBA 1IKWA 3QFPA 1HNWK 3CMAN 3H46O 1JCFA 4DV1K 3OS0A 2F8TA 5FPNA 3EY1A 3NCIA 4FJ9A 1ASWA 1VAZA 4LSNA 4W5QA 3FR0A 4CEBA 3LL3A 3ZT3A 1SKWA 1X9WA 3AVAA 4I6MA 1TKTA 4AHCA 1WSGA 5JVGL 3SV4A 4JKHA 1Z6RA 4DQSA 2NLXA 1BIUA 4BC2A 2DY4A 2OPSA 3GE1A 1ESVA 5FPDA 3EKSA 3ZSYA 2ITMA 3O4WA 4YHHK 1W9HA 1RNHA 4B1YB 2HHHK 5AQJA 3U8XA 3A2FA 1U6ZA 3K0SA 4XIUA 1HKGA 2WUSA 4JAXA 4X66K 4CF1A 4CJEA 1RBSA 4K42A 2W40A 1YF5L 2VG5A 4DV0K 4RTFD 3D0PA 1D8YA 3ENBA 4I9QA 4DQQA 3RRHA 4DQIA 4NCAA 3LAKA 1CXQA 3THWB 1S9EA 4AM6A 3TR8A 1KVAA 1JJ2M 3CXCM 4C8MA 2PBDA 3LDOA 2E1ZA 3CFPA 3SAFA 3BF3A 1J5EK 1ITGA 2P9PB 3V1QA 4W5RA 4CJWA 1JL2A 3AAQA 4H0PA 4DFMA 2VGMA 1NOYA 1RTDA 4CJ3A 2KZMA 4FM1A 2NRZA 5D3GA 4KH5A 4KHNA 1JLAA 2OPPA 2X74A 4C1NI 4H5VA 3HI0A 1EP4A 4ISFA 3NF9A 1K8KA 3K2PA 3VQ8A 1SQKA 5DMRA 4H4MA 3K9JA 5M1PA 2UYTA 4AH9A 4IOCL 1KXPA 4FWPA 4OPJA 4B1VA 1U48A 4MDBA 2VQEK 1HNXK 4H03B 1RCHA 1EO1A 1TL3A 4E7JA 1LW2A 1QQMA 4K25A 3DXKA 4WYBA 4DR3K 1IJJA 4BG9A 3PX6A 1RFQA 4ICLA 4BWJA 4FJGA 3B6OA 4KB0A 4DWIA 3PO5A 1KAXA 5KQ8A 3AGKA 3HT3A 5I42A 1NGBA 3P4IA 3QERA 5AQMA 5AR0A 1TKDA 2ZM6K 4DQ8A 4M3YA 4H0XB 1VSJA 2AP1A 2X6SA 1RDAA 3WT0A 5C10A 4JI5K 2RKIA 3VEVA 5F0XA 4K0KK 4A61A 2FC0A 3MWTA 1HR0K 4DUZK 2O8FA 4N41A 2YKNA 2RPIA 4WFBL 1R59O 4BRHA 4U67L 3QBXA 3CCQN 1T8EA 2A5XA 2GBZA 4B9LA 1L3TA 4OLAA 3BEXA 3LDSA 3AO4A 3DOLA 3EE8A 3CMEN 2O8EB 2P51A 4CJLA 2F96A 1RTJA 4H5WA 4PQUA 2E20A 4WQ4C 4U7BA 3CCMN 3ID8A 3TAEA 3ID6A 1XI1A 3O3FA 3QB0A 4DR6K 4B9MA 1C1CA 4CD3A 1QZ5A 4CJVA 4RWTA 4PA1A 4IO9L 4BR2A 1EQYA 2FBXA 2NRVA 1OH8A 3LM9A 1HQUA 1NGCA 3ZSXA 3SUQA 2OYQA 4BQLA 1GOBA 2WONA 2P9SA 4X62K 1BUPA 3GBTA 1OH7A 1NGAA 1JXEA 4IDHA 3MEDA 1ZBUA 4NCGA 4YNQA 4N5SA 3SUNA 4IG0A 1EKEA 1GLCG 4B1UB 2GUIA 4KHUA 2HOEA 4J2DA 4R5PA 3D45A 5SZTA 3CCJN 3QO9A 2V51B 1IBLK 2FSKA 4WFAL 5KGWA 4E7HA 3ZLJA 4N56A 2BGGA 4J2BA 3A5OC 4RW8A 1YTUA 4CZLA 3CJ7A 3ZSRA 1K9MO 1I3AA 2WFBA 3DOKA 3W0LA 3CJCA 4DS5A 1SUQA 3DYAA 2QWRA 3CC7N 1GLLO 4DSEA 1NGFA 3AVMA 2BTFA 1KVCA 3AVNA 4PHTX 3L6QA 5GADP 1Z05A 2P9PA 2FLOA 2IAJA 4CBUA 4FPAA 4YOVA 4NLCA 3VQAA 4YFUA 1K6YA 4H5NA 3Q7CA 3QINA 4R79A 2A41A 4LFAK 5HRPA 3M6GA 3PV8A 1B92A 1XHZA 2HW3A 1HLUA 1TAQA 2HHSA 2B4JA 3G0ZA 1QSLA 3WNEA 2XO7A 4AHSA 3H6EA 3PIOL 4O44A 3TSUA 1LWCA 4GV6A 1HX1A 2OA8A 4WF9L 2NNWA 3SBGA 1HKCA 1NJWA 4FK0A 2Q0UA 2GEMA 5AQGA 1RILA 3QLHA 3SAGA 1Z26A 1NJIO 3C0BA 3HPHA 3F2KA 3DJCA 1HPZA 4GV3A 2KZZA 4LF9K 1HMVA 2P5GA 3M3ZA 4CD1A 4JV5K 4W5NA 2DFFA 3V6DA 2ETJA 5AJ3K 3C94A 1WAFA 4DR5K 3MECA 3G6EN 1XQSC 1VQ6N 4ZTJA 3O5BA 3ULDA 4DTMA 3SK3A 4EIAA 3VQPA 2Q0RA 3KLEA 3Q7BA 1FXXA 3RMDA 1UOCA 3V1RA 3I0SA 4LFCK 2D5RA 4FOEA 3ALYA 5ADXA 3CCSN 1SAZA 4YOUA 1S3XA 4M41A 2PAVA 3CM6A 4XEIA 3WNGA 4BRCA 2UUCK 4E1NA 3UKRB 3VEZA 3SUOA 3TI0A 4DTPA 4KHWA 5I3UA 3NGZA 2G8HA 3A8YA 2A1RA 3MX2A 2IIRA 2DTUA 4M7YA 3BDPA 3L2RA 2E4LA 4K43A 4KHYA 4BVOA 4GVMA 1BCOA 1VQLN 4FW2A 1S6PA 3U6FA 1NM1A 4GV9A 3UE5A 2O8EA 1HYVA 1QHAA 4M45A 3DM2A 4CEDA 4OX9K 3NH2A 4CEOA 4YOWA 1ZBLA 4CJPA 1NK8A 3A0IX 3C6HA 1J53A 1SV5A 3ZYYX 4CBXA 1VSHA 2VG7A 5E84A 5LY3A 3MN7A 3OYKA 1GLJO 5EXWA 3OYAA 4FLXA 3FZLA 5AQKA 2PY5A 4Z4HA 4DR1K 5J2PA 3ULEA 5FDLA 1JLCA 1CZAN 1RDDA 1BO5O 3TAGA 2O8CB 5JICA 2VGNA 3HSCA 3I33A 4ELVA 3FZFA 3OYFA 1DT9A 3MWPA 3VMFB 1TUYA 1TGOA 2A3ZA 4WQ5C 4BE2A 3NGYA 4BE1A 2PYLA 1XMQK 4KBOA 3VA0A 1VRUA 4JRQA 4BR9A 3M8QA 2Q31A 4DTJA 5F2RA 3L3UA 2QEXN 1QVFM 2G8IA 3TSPA 2O8BB 4FJXA 4CJSA 2P1JA 4C1NK 2V52B 2CGJA 1TKZA 1R0AA 1MDUB 5TKWA 3PSIA 2JGUA 4V19S 1SZ2A 4DSIA 3NF6A 4BRDA 2ZWHA 1LOTB 1UA1A 4K8XA 1U4BA 3OYCA 2D0PA 1TV6A 1NWKA 1NJYA 4I9LA 3EN9A 3SZ2A 1UA0A 1N33K 3N4PA 4CEQA 3ZETB 4IG3A 4J2EA 5GIOA 4GW6A 5J2MA 3I0RA 2YNIA 3VTIA 3C7NB 3ZCMA 1BU6O 3P38A 1C0FA 5HOOA 4YOTA 2YKMA 4FVMA 1WSFA 4K8ZA 5HBMA 4CIFA 4DSJA 1CXUA 2QWQA 4DFPA 4IBNA 1J6ZA 3TWHA 4BDPA 4DSFA 2JLEA 4BC5A 4CJRA 1C0UA 3TTFA 1N34K 1EWQA 4ILGB 2F9TA 1NK5A 3QEPA 3U3YA 3DLHA 3VQ4A 2VCPA 3QETA 1IO2A 3D2EB 4IJAA 2P9NA 3SMSA 4CI6A 3BF1A 4JI2K 4O8KA 3EKUA 3ZT0A 1RDBA 3PIPL 2XY8A 4FO0A 4DTNA 4OKJA 3QIPA 3D7EO 4DSLA 1TAUA 5C15A 3DRPA 4H0YB 3H1QA 4MO4A 4WCEL 1N36K 1KCFA 2A42A 2F7TA 3WQUA 2FBTA 3HPOA 3LDLA 4CGFA 2P9UA 4F3OA 4QCLA 4CVNE 3CC2N 3F73A 5J2NA 4FZXC 1VK0A 2W6LA 2YHBA 3ASMA 3P39A 2KFNA 3O9SA 1NJZA 1NKBA 2RN2A 2QXFA 2ZQBA 3H1VX 2DFEA 4CESA 4I2PA 5GAEP 4FLWA 4HUFA 3TANA 4DR4K 3E01A 3ZT1A 1JLQA 4JHDB 1T6CA 3B6PA 3NH1A 3OYHA 3E9LA 1HKBA 1BI4B 4XH5A 1VSFA 2Q2RA 3L2VA 1NMDA 1BWFO 4JYAK 2YX6A 4QS8A 3M8PA 3FZMA 3EO3A 3HSTB 4F3TA 1QSYA 4FZYA 5JMVA 4CGJA 3DLGA 2FSJA 5LMNK 5EVZA 3OY9A 1VQON 4DLEA 4Z4IA 2QTDA 2IVPA 5LMUK 2GWJA 3SMPA 3VF6A 4CHQA 4YDUA 1REVA 3LZJA 3KLHA 3BUZB 3M8RA 3NF7A 4BR7A 3OYNA 3ZSZA 1EETA 5AQZA 3WNFA 2NRHA 4AHRA 4E7KA 3QNOA 4BRMA 3A5NC 1U45A 1L3UA 3OYEA 5LJWA 4CHNA 2O8BA 1BQMA 1RBTA 3FFKB 3J80O 3GOIA 4NYFA 3HOSA 4JS5A 4LSLA 2QK9A 3FZHA 1X9MA 3QEVA 3F9MA 4JEPA 4KREA 1IBKK 3JSMA 5KRSA 4TSXA 4F2SA 1WSHA 4FWLA 4LF8K 2OTJN 3O4QA 4JKAA 3ZETA 4OJRA 1JCGA 3SQ4A 1JLBA 4FJ7A 3K58A 2GUPA 5F1XA 1NGIA 3V1OA 5T7BA 3DLLL 4DB3A 3OYBA 3KD5E 4ILJA 5KPTA 5BPMA 2CH6A 2ZJRL 3S3OA 3QFUA 1C1AA 3VN5A 3U4LA 4JRPA 1YJNN 2D4WA 3WUHA 2OPRA 1LV5A 4B08A 2P9KA 4H5RA 2EHGA 3P1GA 3AA2A 1YTAA 3D2EA 5EOYA 3K57A 3ZX0A 1Q9YA 5BR9A 2BUPA 4KB1A 2ZF5O 3SLCA 1WSEA 3G71N 4BDYA 4FW1A 3K5MA 3OHRA 3J8AA 3G10A 4B9VA 3AV9A 4IEEA 4K41A 4LH5A 4YOYA 4C8LA 3OYMA 3CERA 4H4OA 4LF4K 4ID5A 3SI6A 1VSDA 3R9PA 3UB5A 4CJ7A 2OPQA 4BQZA 1GLFO 2I7NA 4FJIA 3HPGA 1S9GA 2HNDA 4DR7K 4JKEA 3QICA 1HNVA 1A5VA 4DV4K 3RMAA 3IFRA 3AAPA 4IKFA 1FJGK 1UWBA 4FJKA 4CEEA 1P90A 1U2VB 4FLYA 1TUUA 1C0MA 4JD2B 2QWOA 2D0CA 3VENA 1KFSA 4NO7A 3RRGA 1I94K 2ASPA 2HHXA 2CGKA 3J7YP 1FKPA 1JLFA 2ZGYA 4BRFA 4YY3K 4OPAA 4CGHA 1IG8A 4J8FA 3D2FA 3UKUB 1BI4A 3V9XA 1P8ZA 3OW2M 3ZT2A 3QESA 3L2WA 3OYDA 4BE0A 2O8DA 3DRSA 3KIOA 1Z25A 3SPZA 2E2QA 4FSVA 3PUFA 4DV3K 2G8UA 1JCEA 3CJ1A 3DRRA 5AQVA 3AVLA 3K9KA 4E7IA 1ATNA 4GKKK 2G8VA 4BC4A 4E3SA 5I9EB 2A1SA 5JLHA 1NG9A 4FJMA 1BDGA 4BRPA 3V9WA 3PO4A 3KTQA 3OBWA 1MU2A 1OVYA 4JKBA 1RTHA 3ZX3A 1KAZA 3VF4A 5HP1A 3KD1E 1SS6A 4CHZA 1XNRK 3HO1A 2VWBA 5DM6L 3NFAA 4HTUA 2KTQA 5LL6Z 1E3MA 1U04A 4M3ZA 3JXUA 2YJEA 2ZGZA 3OYGA 3VGLA 1TK0A 4FM2A 3L8BA 4FWOA 3V4IA 4AQYK 3IMXA 2RHKA 2UXCK 3O6WA 1TYQB 1VQ4N 4F2RA 2E8AA 3M8SA 4HCCA 5AQHA 1EX4A 2WTUA 4JI6K 3VQ7A 3RR7A 2YJFA 3IUCA 4KHQA 3VEWA 5J1EA 4KHSA 5BREA 3L2QA 4KPYA 5C42A 1GLBG 3EL2A 3VESA 2ZJQL 2NZTA 2Q3SA 1RDWX 2ATQA 1SL0A 1DGKN 4M7XA 3LWMA 4JI8K 4NXMK 4PL7A 5IT9O 1NKCA 4DTUA 2HNZA 3O1WA 3CD6N 1QQOA 4Z4GA 3KK2A 1Q9XA 3SJHA 4FXDA 2GTDA 1BCMA 4LC9B 3S9HA 3AVFA 3HYFA 2QA4N 4MQ3A 3J7AP 1RBUA 4CF9A 2IDOA 3RMCA 4FJNA 1XNQK 4E1MA 3CJBA 4EHTA 1GOCA 3THWA 1J5OA 3DXMB 3VPZA 5M1KA 4KH6A 1WOQA 3THXB 1OH5A 1KC8O 4H0VB 2F4VK 4DU3A 4RW4A 2BANA 2YV0X 1SKRA 4DFJA 2FF3B 3AARA 4NCBA 4FCYA 2HF4A 1OKJA 1Q18A 1U49A
chains in the Genus database with same CATH topology
1RT5A 3VA0A 1VRUA 4JRQA 1VSLA 3M8QA 4CK3A 4DTJA 1ASVA 3KLFA 1Y97A 1QSSA 3DMJA 4CIEA 3L3UA 5HROA 2PZSA 3IS9A 4CF2A 2G8IA 4RG8A 3CG7A 1NK9A 3TAMA 1WSIA 5FROA 5DK5A 4FJXA 3AVKA 4DF4A 4CJSA 2P1JA 4CJ5A 1HQEA 3SV3A 2YNFA 1TKZA 3OVNA 3KKSA 1R0AA 4DU4A 1ZBHA 3C95A 2OZMA 4BACA 3AO5A 1LWEA 1HJRA 3LZIA 5CZ1A 2JGUA 3F9KA 3VQDA 1NOZA 5CZ2A 4KI4A 1IH7A 3LANA 4DSIA 2B6AA 3NF6A 4DS4A 1NK4A 1UA1A 1KLMA 2RF2A 1I39A 1BL3A 4RW9A 2I5JA 3NHGA 4K8XA 2P5OA 2YNHA 3ITHA 1U4BA 1N6QA 3OYCA 4F8RA 1WSJA 3AVCA 2HMIA 3THVA 4CEFA 4CFCA 1TV6A 3CFRA 4CGIA 4I9LA 1NJYA 5HRSA 3SZ2A 3QEXA 4KI6A 1ASUA 1UA0A 4CEQA 3DLBA 5HRNA 1QE1A 4IG3A 5KTQA 1RBVA 2BE2A 4O0IA 4CK1A 4J2EA 4GW6A 1B9FA 5C24A 3QNNA 1JLGA 3I0RA 2YNIA 5J2MA 4M42A 2Y1JA 3LWLA 3ZCMA 4KTWA 3LPTA 3V9UA 3K5LA 4DTXA 1IKWA 2YKMA 3TAFA 4FVMA 1WSFA 1WNSA 3OS1A 4K8ZA 1JKHA 3BGRA 5HBMA 4CIFA 4DSJA 4B8AB 1CXUA 4J2AA 1T7PA 3OJUA 4N76A 4Q5VA 3OS0A 3RWUA 3ZT4A 4M3UA 2F8TA 3CYMA 1FKOA 3EY1A 3NCIA 4DFPA 1SL2A 4FJ9A 1ASWA 4IBNA 3KK1A 4LSNA 4W5QA 1KFDA 3ZSWA 2OZSA 3TWHA 4CEBA 2XY7A 4DSFA 2JLEA 4BDPA 4EP5A 4CJRA 1C0UA 1HYZA 4G1QA 3OYIA 3S3NA 4OVLA 3HM9A 4KFBA 3ZT3A 3KLGA 1NK5A 3QEPA 3AVAA 4AHCA 1TKTA 4OKKA 5HRRA 3U3YA 1X9WA 3VQ4A 3DLHA 3QETA 1WSGA 2G8KA 4ELTA 3NDKA 1FK9A 3SV4A 4B9UA 3VQ5A 1IO2A 4DQSA 4B9SA 1BIUA 4GMJB 3SQ2A 4KTZA 1JL1A 4B3OA 3KK3A 1YVUA 4FLVA 2OPSA 2DY4A 3PY8A 3ZT0A 1RDBA 3QEWA 4Z4EA 2XY8A 3AA3A 4DTNA 3ZSYA 1C6VA 3QIPA 4OKJA 1W9HA 4PUOA 1RNHA 1J54A 4DFKA 4DSLA 1TAUA 4E7LA 3A2FA 3DRPA 4XIUA 4IFVA 3C6TA 1RDCA 5EU7A 1LAVA 1KCFA 4CF1A 4CJEA 1RBSA 4CE9A 1EXQA 2VG5A 1HRHA 4DTSA 5JS1A 2FBTA 3D0PA 3HPOA 4CGFA 1D8YA 2EX3A 2KQ2A 4I9QA 4F3OA 4DQQA 1QHTA 3RRHA 4AILC 4LH4A 4B9NA 4DQIA 4CFDA 3TAQA 4OLBA 4QCLA 4NCAA 4CHOA 3PX4A 1W0HA 2HVHA 4CHPA 2HHWA 3F73A 3LAKA 4O55A 5J2NA 4FZXC 1CXQA 1VK0A 3IRXA 1X9SA 1S9EA 3TR8A 1KVAA 3AO3A 4C8MA 2YHBA 3CFPA 3MAQA 3ASMA 3RMBA 2KFNA 2O4IA 1NJZA 1ITGA 4CJUA 1NKBA 1BIZA 2QXFA 2RN2A 2ZQBA 3V1QA 2DFEA 1IKYA 3MEEA 4I2PA 4CESA 4FLWA 3LPUA 4W5RA 4HUFA 3TANA 4CJWA 1C1BA 4DQRA 1JL2A 3E01A 4KKOA 3HXMA 3ZT1A 4CF8A 3K59A 4DFMA 1JLQA 5CY4A 3B6PA 3NH1A 1NOYA 1RTDA 3AO1A 1S1XA 4CJ3A 3OYHA 2Y1IA 2KZMA 4FM1A 1RT1A 1BI4B 5D3GA 4KHNA 4FZZA 1VSFA 1JLAA 4AHUA 3U3GA 4DTRA 2OPPA 2IOCA 1CZBA 2QKKA 4B9TA 2X74A 2Z1GA 4Y1DA 4M3WA 3L2VA 1EP4A 1VSMA 3M8PA 3NF9A 3KJVA 3AVIA 3HSTB 2G8WA 3K2PA 3VQ8A 1QSYA 4F3TA 5DMRA 4H4MA 4FZYA 1SL1A 4CGJA 1LWFA 4AH9A 3DLGA 4OPJA 3OY9A 1U48A 2D0AA 4DLEA 4Z4IA 2X78A 4Z4CA 3QIOA 1Q8IA 3VQ6A 1RCHA 1T05A 4CHQA 1TL3A 2YHAA 3P5JA 4E7JA 1LW2A 1REVA 3DI6A 3KLHA 3LZJA 3M8RA 4UQGA 3NF7A 2ZD1A 3PX6A 2Z1JA 3MEGA 2YNGA 3ZSZA 1O1WA 1EETA 4ICLA 4BWJA 3T1AA 3B6OA 3WNFA 3OYNA 4LD0A 4FJGA 3VA3A 4AHRA 4E7KA 3QNOA 3OYLA 2PYJA 4KB0A 4DWIA 1U45A 1L3UA 3NBPA 3PO5A 2Z1HA 3AVJA 3K5NA 3SQ0A 3HVRA 3OYEA 2O4GA 3CM5A 2IGIA 4CHNA 3HT3A 5I42A 3QERA 4I2QA 1HYSA 1BQMA 4RW7A 1TKDA 1RBTA 2R7YA 3KLIA 4Y1CA 4M3YA 4NYFA 2NUBA 4JS5A 4LSLA 1VSJA 2QK9A 1BHLA 4IFYA 1X9MA 3FFIA 3QEVA 2X6SA 3AA4A 4KREA 1RDAA 1DLOA 2RKIA 3JSMA 5KRSA 4TSXA 4F2SA 1L3SA 2FC0A 3AO2A 1WSHA 4N41A 3LP0A 2XRIA 2YKNA 1L5UA 3H08A 4O5BA 3T19A 2RPIA 1BGXT 5KI6A 1CLQA 3O4QA 1RTIA 3SQ4A 4OJRA 3VQCA 4JS4A 1TK5A 4CGGA 2KFZA 4HCBA 1T8EA 1JLBA 4FJ7A 3K58A 4FJHA 3AA5X 2GBZA 4ZHRA 3RTVA 4B9LA 1L3TA 3V1OA 5T7BA 3LDSA 3OYBA 3HL8A 3KD5E 3AO4A 3DOLA 3HVTA 3AVBA 4CEZA 1QTMA 3MXJA 3MXIA 2P51A 4CJLA 5KRTA 4JLHA 2F96A 1RTJA 1VSEA 2IC3A 3S3OA 1CZ9A 5J2QA 4PQUA 1C1AA 3VN5A 4FJJA 1TKXA 4JRPA 1T03A 5FRMA 4M3RA 3TAEA 2E6LA 1XHXA 1XI1A 2OPRA 4CERA 4B08A 4NYNA 4OGCA 3O3FA 1LV5A 4B9MA 4FK2A 2HVIA 2EHGA 3OYJA 3AVGA 4W5OA 1C1CA 3P1GA 4CJQA 3AA2A 4L8RB 1N5YA 4CJVA 4CHYA 3O4NA 4PA1A 2G8FA 1YTAA 5FRNA 4CJFA 3OS2A 4FYDA 4HVJA 3K57A 2VWKA 2FBXA 3S3MA 1Q9YA 4CF0A 1NK7A 1RBRA 4KB1A 1HQUA 3ZSXA 2KW4A 4CK2A 3SUQA 2OYQA 1GOBA 2WONA 3SNNA 3L2UA 1WSEA 1JXEA 4CFBA 1F21A 4BDYA 3MEDA 4FW1A 1ZBUA 4NCGA 4YNQA 4N5SA 3K5MA 3QEIA 3SUNA 4IG0A 3G10A 1EKEA 3OJSA 2XY5A 4B9VA 3AV9A 3ZSQA 3K5OA 2GV9A 2DFHA 4ID1A 4LH5A 2VWJA 2GUIA 3SJJA 5K14A 4CEAA 4CJKA 3OYMA 4R5PA 3D45A 4C8LA 4J2DA 4KHUA 5SZTA 4H4OA 4ID5A 3SI6A 1VSDA 3QO9A 2F8SA 1BQNA 5KGWA 4E7HA 2OPQA 1WAJA 4N56A 2BGGA 4J2BA 4FJ8A 4FJIA 3HPGA 4RW8A 1YTUA 2HNDA 1S9GA 3ZSRA 1I3AA 1VSIA 3DOKA 1HNVA 1TL1A 3PX0A 1C0TA 1A5VA 1A5WA 3RMAA 4C8KA 4DU1A 3RR8A 4ELUA 2D0BA 4DS5A 1SUQA 3DYAA 4IKFA 4CIGA 1D9DA 2BDPA 4FLZA 4DSEA 3T3FA 3AVMA 1UWBA 4Z4FA 1S1TA 1KVCA 1UAXA 4CEEA 4DQPA 4FJKA 4FLYA 3AVNA 4W5TA 3NH0A 1C0MA 4AHTA 5HLFA 2D0CA 3VQ9A 2IAJA 4CFAA 5SWMA 1KFSA 1ZBIA 3RRGA 4FJ5A 4IDKA 1S1WA 3DLKA 4CJ4A 4PWDA 2HHXA 3VQAA 4H8KA 1FKPA 1JLFA 4E0DA 1GOAA 1K6YA 4KO0A 3VQBA 4YFUA 1SKSA 5CYQA 3LP1A 3VQQA 3QINA 4PY5A 4CGHA 1JLEA 3MXMA 5HRPA 1ZBFA 3PV8A 1B92A 2HB5A 1XHZA 2HW3A 1BI4A 3SQ1A 3V9XA 4ZTFA 1DTQA 3V9SA 1D5AA 3ZT2A 1TAQA 3QESA 4AHVA 4DLGA 3L2WA 2HHSA 2B4JA 4O0JA 3G0ZA 2HHVA 1YT3A 1QSLA 3OYDA 4BE0A 4FJLA 3WNEA 3NAEA 2XO7A 4AHSA 3DRSA 4O44A 1WN7A 1LWCA 4RW6A 4DMNA 3KIOA 1Z25A 3SPZA 4FLUA 2OA8A 1IG9A 3PUFA 3HP9A 1RT3A 3EYZA 3NGIA 4EZ9A 2HNYA 2G8UA 1NJWA 4FK0A 3VQEA 1RILA 2B5JA 3QLHA 4CECA 1Z26A 4BWMA 4DTOA 2HHQA 3SCXA 1KLNA 3IAYA 3DRRA 3ISNC 3AVLA 3HPHA 2VG6A 4E7IA 2G8VA 4E3SA 1HPZA 1ZYQA 2KZZA 3TABA 4EP4A 3I8DA 4CJTA 1HMVA 2P5GA 4WE1A 2A1SA 4FJMA 4W5NA 3EZ5A 3V9WA 3TAPA 2HHUA 2DFFA 3V6DA 1KRPA 2ETJA 4FLTA 3KTQA 3PO4A 5E41A 3C94A 1MU2A 1LAWA 1WAFA 1KSPA 2HHTA 1RTHA 3MECA 3KD1E 3O3GA 5HP1A 1IKXA 4E19A 4CHZA 4ZTJA 3NE6A 3HO1A 4LY7A 4C8OA 3SYZA 2LSNA 3L3VA 3ULDA 4DTMA 2XY6A 4KAZA 3NF8A 3LP3A 4MFBA 1LW0A 1RT7A 3VQPA 1S6QA 3DLEA 3NFAA 3KLEA 4HTUA 2KTQA 4Z0UA 1FXXA 1KVBA 2QKBA 1S5JA 1U04A 4O4GA 1DTTA 3O3HA 1VSKA 3RMDA 1NJXA 1UOCA 4M3ZA 4QOZB 3V1RA 3OYGA 3I0SA 2D5RA 3ALYA 1NK0A 2AJQA 3CFOA 1TK0A 4BDZA 4EZ6A 4M41A 3CM6A 3L8BA 3WNGA 4FM2A 4QAGA 3V4IA 1XC9A 4M3TA 2Z1IA 3HJFA 2IS3A 4E1NA 4Q0BA 3SUOA 4B8CA 3TI0A 4DTPA 4F2RA 4KHWA 4OPKA 5I3UA 3M8SA 4HCCA 1RT6A 3NGZA 1EX4A 2G8HA 4HUGA 1QQCA 3VQ7A 2X6NA 2FBVA 2A1RA 3RR7A 2DTUA 3BDPA 4KHQA 5J1EA 3L2RA 4KHSA 2E4LA 3L2QA 3CQ8A 5C42A 4KPYA 4M3XA 4KHYA 4GVMA 1BCOA 1IKVA 1SL0A 2Q3SA 2ATQA 1RT2A 4I7FA 4FW2A 1S6PA 4DF8A 3U6FA 1VRTA 3P83D 1NKEA 3KKRA 3LWMA 1S1VA 2XHBA 1QS4A 5KGXA 1KTQA 4KRFA 1TVRA 1B9DA 1HYVA 4M45A 1NKCA 1S1UA 1X1PA 3DM2A 4E89A 4DTUA 2HNZA 4CEDA 2W42A 4HHTA 4DG1A 3NH2A 3C6UA 3LP2A 4Z4GA 4CEOA 1ZBLA 2FBYA 3KK2A 4CJPA 1Q9XA 4C8NA 1NK8A 4F4KA 1J53A 1SV5A 3AVHA 3IG1A 3ZSOA 3HK2A 4FXDA 1BCMA 3S9HA 3LAMA 1L3VA 4N47A 2WOMA 4HUEA 3AVFA 3HYFA 1VSHA 2ZE2A 3JYTA 2VG7A 4MQ3A 4DSKA 1RBUA 3OYKA 4KV8A 3V81A 1NK6A 4CF9A 4FM0A 4CGDA 2IDOA 3RMCA 1RT4A 3SPYA 1D9FA 4FJNA 1SKWA 3OYAA 4E1MA 4FLXA 2E6MA 3DLRA 3ZSVA 4OGEA 1GOCA 1HNIA 1WLJA 3WNHA 2PY5A 5CYMA 4Z4HA 1J5OA 4KTQA 1JXBA 1A5XA 5JS2A 5J2PA 1BISA 5FDLA 1U47A 1G15A 1JLCA 3V9ZA 4DU3A 1RDDA 4RW4A 3TAGA 3TARA 2BANA 4FK4A 2YV0X 3SUPA 4ELVA 1XWLA 1SKRA 4DFJA 3OYFA 4NCBA 3UIQA 4CCHA 4FCYA 4OKEA 5C25A 1J9AA 3LALA 1TGOA 3HP6A 4BE2A 3NGYA 4BE1A 1TK8A 2PYLA 4OLAA 1U49A 2ITGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RT5 A;  3VA0 A;  1VRU A;  4JRQ A;  1VSL A;  3M8Q A;  4CK3 A;  4DTJ A;  1ASV A;  3KLF A;  1Y97 A;  1QSS A;  3DMJ A;  4CIE A;  3L3U A;  5HRO A;  2PZS A;  3IS9 A;  4CF2 A;  2G8I A;  4RG8 A;  3CG7 A;  1NK9 A;  3TAM A;  1WSI A;  5FRO A;  5DK5 A;  4FJX A;  3AVK A;  4DF4 A;  4CJS A;  2P1J A;  4CJ5 A;  1HQE A;  3SV3 A;  2YNF A;  1TKZ A;  3OVN A;  3KKS A;  1R0A A;  4DU4 A;  1ZBH A;  3C95 A;  2OZM A;  4BAC A;  3AO5 A;  1LWE A;  1HJR A;  3LZI A;  5CZ1 A;  2JGU A;  3F9K A;  3VQD A;  1NOZ A;  5CZ2 A;  4KI4 A;  1IH7 A;  3LAN A;  4DSI A;  2B6A A;  3NF6 A;  4DS4 A;  1NK4 A;  1UA1 A;  1KLM A;  2RF2 A;  1I39 A;  1BL3 A;  4RW9 A;  2I5J A;  3NHG A;  4K8X A;  2P5O A;  2YNH A;  3ITH A;  1U4B A;  1N6Q A;  3OYC A;  4F8R A;  1WSJ A;  3AVC A;  2HMI A;  3THV A;  4CEF A;  4CFC A;  1TV6 A;  3CFR A;  4CGI A;  4I9L A;  1NJY A;  5HRS A;  3SZ2 A;  3QEX A;  4KI6 A;  1ASU A;  1UA0 A;  4CEQ A;  3DLB A;  5HRN A;  1QE1 A;  4IG3 A;  5KTQ A;  1RBV A;  2BE2 A;  4O0I A;  4CK1 A;  4J2E A;  4GW6 A;  1B9F A;  5C24 A;  3QNN A;  1JLG A;  3I0R A;  2YNI A;  5J2M A;  4M42 A;  2Y1J A;  3LWL A;  3ZCM A;  4KTW A;  3LPT A;  3V9U A;  3K5L A;  4DTX A;  1IKW A;  2YKM A;  3TAF A;  4FVM A;  1WSF A;  1WNS A;  3OS1 A;  4K8Z A;  1JKH A;  3BGR A;  5HBM A;  4CIF A;  4DSJ A;  4B8A B;  1CXU A;  4J2A A;  1T7P A;  3OJU A;  4N76 A;  4Q5V A;  3OS0 A;  3RWU A;  3ZT4 A;  4M3U A;  2F8T A;  3CYM A;  1FKO A;  3EY1 A;  3NCI A;  4DFP A;  1SL2 A;  4FJ9 A;  1ASW A;  4IBN A;  3KK1 A;  4LSN A;  4W5Q A;  1KFD A;  3ZSW A;  2OZS A;  3TWH A;  4CEB A;  2XY7 A;  4DSF A;  2JLE A;  4BDP A;  4EP5 A;  4CJR A;  1C0U A;  1HYZ A;  4G1Q A;  3OYI A;  3S3N A;  4OVL A;  3HM9 A;  4KFB A;  3ZT3 A;  3KLG A;  1NK5 A;  3QEP A;  3AVA A;  4AHC A;  1TKT A;  4OKK A;  5HRR A;  3U3Y A;  1X9W A;  3VQ4 A;  3DLH A;  3QET A;  1WSG A;  2G8K A;  4ELT A;  3NDK A;  1FK9 A;  3SV4 A;  4B9U A;  3VQ5 A;  1IO2 A;  4DQS A;  4B9S A;  1BIU A;  4GMJ B;  3SQ2 A;  4KTZ A;  1JL1 A;  4B3O A;  3KK3 A;  1YVU A;  4FLV A;  2OPS A;  2DY4 A;  3PY8 A;  3ZT0 A;  1RDB A;  3QEW A;  4Z4E A;  2XY8 A;  3AA3 A;  4DTN A;  3ZSY A;  1C6V A;  3QIP A;  4OKJ A;  1W9H A;  4PUO A;  1RNH A;  1J54 A;  4DFK A;  4DSL A;  1TAU A;  4E7L A;  3A2F A;  3DRP A;  4XIU A;  4IFV A;  3C6T A;  1RDC A;  5EU7 A;  1LAV A;  1KCF A;  4CF1 A;  4CJE A;  1RBS A;  4CE9 A;  1EXQ A;  2VG5 A;  1HRH A;  4DTS A;  5JS1 A;  2FBT A;  3D0P A;  3HPO A;  4CGF A;  1D8Y A;  2EX3 A;  2KQ2 A;  4I9Q A;  4F3O A;  4DQQ A;  1QHT A;  3RRH A;  4AIL C;  4LH4 A;  4B9N A;  4DQI A;  4CFD A;  3TAQ A;  4OLB A;  4QCL A;  4NCA A;  4CHO A;  3PX4 A;  1W0H A;  2HVH A;  4CHP A;  2HHW A;  3F73 A;  3LAK A;  4O55 A;  5J2N A;  4FZX C;  1CXQ A;  1VK0 A;  3IRX A;  1X9S A;  1S9E A;  3TR8 A;  1KVA A;  3AO3 A;  4C8M A;  2YHB A;  3CFP A;  3MAQ A;  3ASM A;  3RMB A;  2KFN A;  2O4I A;  1NJZ A;  1ITG A;  4CJU A;  1NKB A;  1BIZ A;  2QXF A;  2RN2 A;  2ZQB A;  3V1Q A;  2DFE A;  1IKY A;  3MEE A;  4I2P A;  4CES A;  4FLW A;  3LPU A;  4W5R A;  4HUF A;  3TAN A;  4CJW A;  1C1B A;  4DQR A;  1JL2 A;  3E01 A;  4KKO A;  3HXM A;  3ZT1 A;  4CF8 A;  3K59 A;  4DFM A;  1JLQ A;  5CY4 A;  3B6P A;  3NH1 A;  1NOY A;  1RTD A;  3AO1 A;  1S1X A;  4CJ3 A;  3OYH A;  2Y1I A;  2KZM A;  4FM1 A;  1RT1 A;  1BI4 B;  5D3G A;  4KHN A;  4FZZ A;  1VSF A;  1JLA A;  4AHU A;  3U3G A;  4DTR A;  2OPP A;  2IOC A;  1CZB A;  2QKK A;  4B9T A;  2X74 A;  2Z1G A;  4Y1D A;  4M3W A;  3L2V A;  1EP4 A;  1VSM A;  3M8P A;  3NF9 A;  3KJV A;  3AVI A;  3HST B;  2G8W A;  3K2P A;  3VQ8 A;  1QSY A;  4F3T A;  5DMR A;  4H4M A;  4FZY A;  1SL1 A;  4CGJ A;  1LWF A;  4AH9 A;  3DLG A;  4OPJ A;  3OY9 A;  1U48 A;  2D0A A;  4DLE A;  4Z4I A;  2X78 A;  4Z4C A;  3QIO A;  1Q8I A;  3VQ6 A;  1RCH A;  1T05 A;  4CHQ A;  1TL3 A;  2YHA A;  3P5J A;  4E7J A;  1LW2 A;  1REV A;  3DI6 A;  3KLH A;  3LZJ A;  3M8R A;  4UQG A;  3NF7 A;  2ZD1 A;  3PX6 A;  2Z1J A;  3MEG A;  2YNG A;  3ZSZ A;  1O1W A;  1EET A;  4ICL A;  4BWJ A;  3T1A A;  3B6O A;  3WNF A;  3OYN A;  4LD0 A;  4FJG A;  3VA3 A;  4AHR A;  4E7K A;  3QNO A;  3OYL A;  2PYJ A;  4KB0 A;  4DWI A;  1U45 A;  1L3U A;  3NBP A;  3PO5 A;  2Z1H A;  3AVJ A;  3K5N A;  3SQ0 A;  3HVR A;  3OYE A;  2O4G A;  3CM5 A;  2IGI A;  4CHN A;  3HT3 A;  5I42 A;  3QER A;  4I2Q A;  1HYS A;  1BQM A;  4RW7 A;  1TKD A;  1RBT A;  2R7Y A;  3KLI A;  4Y1C A;  4M3Y A;  4NYF A;  2NUB A;  4JS5 A;  4LSL A;  1VSJ A;  2QK9 A;  1BHL A;  4IFY A;  1X9M A;  3FFI A;  3QEV A;  2X6S A;  3AA4 A;  4KRE A;  1RDA A;  1DLO A;  2RKI A;  3JSM A;  5KRS A;  4TSX A;  4F2S A;  1L3S A;  2FC0 A;  3AO2 A;  1WSH A;  4N41 A;  3LP0 A;  2XRI A;  2YKN A;  1L5U A;  3H08 A;  4O5B A;  3T19 A;  2RPI A;  1BGX T;  5KI6 A;  1CLQ A;  3O4Q A;  1RTI A;  3SQ4 A;  4OJR A;  3VQC A;  4JS4 A;  1TK5 A;  4CGG A;  2KFZ A;  4HCB A;  1T8E A;  1JLB A;  4FJ7 A;  3K58 A;  4FJH A;  3AA5 X;  2GBZ A;  4ZHR A;  3RTV A;  4B9L A;  1L3T A;  3V1O A;  5T7B A;  3LDS A;  3OYB A;  3HL8 A;  3KD5 E;  3AO4 A;  3DOL A;  3HVT A;  3AVB A;  4CEZ A;  1QTM A;  3MXJ A;  3MXI A;  2P51 A;  4CJL A;  5KRT A;  4JLH A;  2F96 A;  1RTJ A;  1VSE A;  2IC3 A;  3S3O A;  1CZ9 A;  5J2Q A;  4PQU A;  1C1A A;  3VN5 A;  4FJJ A;  1TKX A;  4JRP A;  1T03 A;  5FRM A;  4M3R A;  3TAE A;  2E6L A;  1XHX A;  1XI1 A;  2OPR A;  4CER A;  4B08 A;  4NYN A;  4OGC A;  3O3F A;  1LV5 A;  4B9M A;  4FK2 A;  2HVI A;  2EHG A;  3OYJ A;  3AVG A;  4W5O A;  1C1C A;  3P1G A;  4CJQ A;  3AA2 A;  4L8R B;  1N5Y A;  4CJV A;  4CHY A;  3O4N A;  4PA1 A;  2G8F A;  1YTA A;  5FRN A;  4CJF A;  3OS2 A;  4FYD A;  4HVJ A;  3K57 A;  2VWK A;  2FBX A;  3S3M A;  1Q9Y A;  4CF0 A;  1NK7 A;  1RBR A;  4KB1 A;  1HQU A;  3ZSX A;  2KW4 A;  4CK2 A;  3SUQ A;  2OYQ A;  1GOB A;  2WON A;  3SNN A;  3L2U A;  1WSE A;  1JXE A;  4CFB A;  1F21 A;  4BDY A;  3MED A;  4FW1 A;  1ZBU A;  4NCG A;  4YNQ A;  4N5S A;  3K5M A;  3QEI A;  3SUN A;  4IG0 A;  3G10 A;  1EKE A;  3OJS A;  2XY5 A;  4B9V A;  3AV9 A;  3ZSQ A;  3K5O A;  2GV9 A;  2DFH A;  4ID1 A;  4LH5 A;  2VWJ A;  2GUI A;  3SJJ A;  5K14 A;  4CEA A;  4CJK A;  3OYM A;  4R5P A;  3D45 A;  4C8L A;  4J2D A;  4KHU A;  5SZT A;  4H4O A;  4ID5 A;  3SI6 A;  1VSD A;  3QO9 A;  2F8S A;  1BQN A;  5KGW A;  4E7H A;  2OPQ A;  1WAJ A;  4N56 A;  2BGG A;  4J2B A;  4FJ8 A;  4FJI A;  3HPG A;  4RW8 A;  1YTU A;  2HND A;  1S9G A;  3ZSR A;  1I3A A;  1VSI A;  3DOK A;  1HNV A;  1TL1 A;  3PX0 A;  1C0T A;  1A5V A;  1A5W A;  3RMA A;  4C8K A;  4DU1 A;  3RR8 A;  4ELU A;  2D0B A;  4DS5 A;  1SUQ A;  3DYA A;  4IKF A;  4CIG A;  1D9D A;  2BDP A;  4FLZ A;  4DSE A;  3T3F A;  3AVM A;  1UWB A;  4Z4F A;  1S1T A;  1KVC A;  1UAX A;  4CEE A;  4DQP A;  4FJK A;  4FLY A;  3AVN A;  4W5T A;  3NH0 A;  1C0M A;  4AHT A;  5HLF A;  2D0C A;  3VQ9 A;  2IAJ A;  4CFA A;  5SWM A;  1KFS A;  1ZBI A;  3RRG A;  4FJ5 A;  4IDK A;  1S1W A;  3DLK A;  4CJ4 A;  4PWD A;  2HHX A;  3VQA A;  4H8K A;  1FKP A;  1JLF A;  4E0D A;  1GOA A;  1K6Y A;  4KO0 A;  3VQB A;  4YFU A;  1SKS A;  5CYQ A;  3LP1 A;  3VQQ A;  3QIN A;  4PY5 A;  4CGH A;  1JLE A;  3MXM A;  5HRP A;  1ZBF A;  3PV8 A;  1B92 A;  2HB5 A;  1XHZ A;  2HW3 A;  1BI4 A;  3SQ1 A;  3V9X A;  4ZTF A;  1DTQ A;  3V9S A;  1D5A A;  3ZT2 A;  1TAQ A;  3QES A;  4AHV A;  4DLG A;  3L2W A;  2HHS A;  2B4J A;  4O0J A;  3G0Z A;  2HHV A;  1YT3 A;  1QSL A;  3OYD A;  4BE0 A;  4FJL A;  3WNE A;  3NAE A;  2XO7 A;  4AHS A;  3DRS A;  4O44 A;  1WN7 A;  1LWC A;  4RW6 A;  4DMN A;  3KIO A;  1Z25 A;  3SPZ A;  4FLU A;  2OA8 A;  1IG9 A;  3PUF A;  3HP9 A;  1RT3 A;  3EYZ A;  3NGI A;  4EZ9 A;  2HNY A;  2G8U A;  1NJW A;  4FK0 A;  3VQE A;  1RIL A;  2B5J A;  3QLH A;  4CEC A;  1Z26 A;  4BWM A;  4DTO A;  2HHQ A;  3SCX A;  1KLN A;  3IAY A;  3DRR A;  3ISN C;  3AVL A;  3HPH A;  2VG6 A;  4E7I A;  2G8V A;  4E3S A;  1HPZ A;  1ZYQ A;  2KZZ A;  3TAB A;  4EP4 A;  3I8D A;  4CJT A;  1HMV A;  2P5G A;  4WE1 A;  2A1S A;  4FJM A;  4W5N A;  3EZ5 A;  3V9W A;  3TAP A;  2HHU A;  2DFF A;  3V6D A;  1KRP A;  2ETJ A;  4FLT A;  3KTQ A;  3PO4 A;  5E41 A;  3C94 A;  1MU2 A;  1LAW A;  1WAF A;  1KSP A;  2HHT A;  1RTH A;  3MEC A;  3KD1 E;  3O3G A;  5HP1 A;  1IKX A;  4E19 A;  4CHZ A;  4ZTJ A;  3NE6 A;  3HO1 A;  4LY7 A;  4C8O A;  3SYZ A;  2LSN A;  3L3V A;  3ULD A;  4DTM A;  2XY6 A;  4KAZ A;  3NF8 A;  3LP3 A;  4MFB A;  1LW0 A;  1RT7 A;  3VQP A;  1S6Q A;  3DLE A;  3NFA A;  3KLE A;  4HTU A;  2KTQ A;  4Z0U A;  1FXX A;  1KVB A;  2QKB A;  1S5J A;  1U04 A;  4O4G A;  1DTT A;  3O3H A;  1VSK A;  3RMD A;  1NJX A;  1UOC A;  4M3Z A;  4QOZ B;  3V1R A;  3OYG A;  3I0S A;  2D5R A;  3ALY A;  1NK0 A;  2AJQ A;  3CFO A;  1TK0 A;  4BDZ A;  4EZ6 A;  4M41 A;  3CM6 A;  3L8B A;  3WNG A;  4FM2 A;  4QAG A;  3V4I A;  1XC9 A;  4M3T A;  2Z1I A;  3HJF A;  2IS3 A;  4E1N A;  4Q0B A;  3SUO A;  4B8C A;  3TI0 A;  4DTP A;  4F2R A;  4KHW A;  4OPK A;  5I3U A;  3M8S A;  4HCC A;  1RT6 A;  3NGZ A;  1EX4 A;  2G8H A;  4HUG A;  1QQC A;  3VQ7 A;  2X6N A;  2FBV A;  2A1R A;  3RR7 A;  2DTU A;  3BDP A;  4KHQ A;  5J1E A;  3L2R A;  4KHS A;  2E4L A;  3L2Q A;  3CQ8 A;  5C42 A;  4KPY A;  4M3X A;  4KHY A;  4GVM A;  1BCO A;  1IKV A;  1SL0 A;  2Q3S A;  2ATQ A;  1RT2 A;  4I7F A;  4FW2 A;  1S6P A;  4DF8 A;  3U6F A;  1VRT A;  3P83 D;  1NKE A;  3KKR A;  3LWM A;  1S1V A;  2XHB A;  1QS4 A;  5KGX A;  1KTQ A;  4KRF A;  1TVR A;  1B9D A;  1HYV A;  4M45 A;  1NKC A;  1S1U A;  1X1P A;  3DM2 A;  4E89 A;  4DTU A;  2HNZ A;  4CED A;  2W42 A;  4HHT A;  4DG1 A;  3NH2 A;  3C6U A;  3LP2 A;  4Z4G A;  4CEO A;  1ZBL A;  2FBY A;  3KK2 A;  4CJP A;  1Q9X A;  4C8N A;  1NK8 A;  4F4K A;  1J53 A;  1SV5 A;  3AVH A;  3IG1 A;  3ZSO A;  3HK2 A;  4FXD A;  1BCM A;  3S9H A;  3LAM A;  1L3V A;  4N47 A;  2WOM A;  4HUE A;  3AVF A;  3HYF A;  1VSH A;  2ZE2 A;  3JYT A;  2VG7 A;  4MQ3 A;  4DSK A;  1RBU A;  3OYK A;  4KV8 A;  3V81 A;  1NK6 A;  4CF9 A;  4FM0 A;  4CGD A;  2IDO A;  3RMC A;  1RT4 A;  3SPY A;  1D9F A;  4FJN A;  1SKW A;  3OYA A;  4E1M A;  4FLX A;  2E6M A;  3DLR A;  3ZSV A;  4OGE A;  1GOC A;  1HNI A;  1WLJ A;  3WNH A;  2PY5 A;  5CYM A;  4Z4H A;  1J5O A;  4KTQ A;  1JXB A;  1A5X A;  5JS2 A;  5J2P A;  1BIS A;  5FDL A;  1U47 A;  1G15 A;  1JLC A;  3V9Z A;  4DU3 A;  1RDD A;  4RW4 A;  3TAG A;  3TAR A;  2BAN A;  4FK4 A;  2YV0 X;  3SUP A;  4ELV A;  1XWL A;  1SKR A;  4DFJ A;  3OYF A;  4NCB A;  3UIQ A;  4CCH A;  4FCY A;  4OKE A;  5C25 A;  1J9A A;  3LAL A;  1TGO A;  3HP6 A;  4BE2 A;  3NGY A;  4BE1 A;  1TK8 A;  2PYL A;  4OLA A;  1U49 A;  2ITG A; 
#chains in the Genus database with same CATH topology
 1RT5 A;  3TPQ A;  1VSL A;  3A5L C;  1ASV A;  5AQF A;  3R8E A;  4DF4 A;  2A40 A;  3SV3 A;  1BG3 A;  2YNF A;  3KKS A;  5AFU A;  3E9P A;  3C95 A;  1NGJ A;  1ZC6 A;  3CET A;  3MN6 A;  5CZ1 A;  3F9K A;  5BRH A;  3RSE B;  1NOZ A;  5CZ2 A;  1IH7 A;  3LAN A;  3WEE B;  1I39 A;  2YNH A;  2I7P A;  3ITH A;  1N6Q A;  5AQP A;  2HMI A;  3THV A;  1ZBS A;  2E2O A;  1KAY A;  5HRS A;  4KI6 A;  4GY2 B;  1QE1 A;  3R1X A;  4QS9 A;  4CK1 A;  3QNN A;  3MMV A;  1IBM K;  1ZXO A;  3LWL A;  4KTW A;  3N4Q A;  3V9U A;  3GDQ A;  4BRA A;  3TAF A;  2HBJ A;  1JKH A;  4XH1 A;  4J2A A;  3OJU A;  4F9O A;  4CZG A;  4Q5V A;  3RWU A;  3CYM A;  4BRN A;  1SL2 A;  3KK1 A;  5AQX A;  2XY7 A;  3ZEU B;  4FWK A;  4G1Q A;  1HYZ A;  3OYI A;  4M63 C;  4KFB A;  3KLG A;  3HM9 A;  2G8K A;  4ELT A;  2ASM A;  5FPM A;  4CZH A;  1M90 O;  4B9U A;  4B9S A;  4FWS A;  2UXD K;  4B3O A;  4KTZ A;  1JL1 A;  2YCH A;  3KK3 A;  1YVU A;  3QEW A;  2QWM A;  3PLA A;  1C6V A;  2IVO A;  4PUO A;  4MLE A;  1J54 A;  4DFK A;  4E7L A;  3TU5 A;  4IFV A;  2NRR A;  5EU7 A;  1RDC A;  1VQ9 N;  3A5M C;  2PFU A;  4ISG A;  5LJV A;  1EXQ A;  1MWM A;  4FWN A;  4GKJ K;  2EX3 A;  2HBM A;  3E66 A;  2HHV A;  4AIL C;  5H1S Q;  4CFD A;  3TAQ A;  2HVH A;  5AZJ B;  4CHO A;  1W0H A;  3PX4 A;  4CHP A;  4O55 A;  3AGR A;  4A59 A;  3KWG A;  1ATR A;  1BIZ A;  4LF6 K;  3MEE A;  5CE3 A;  4DQR A;  3HXM A;  3LDN A;  2V7Y A;  4CF8 A;  3M1F A;  4MLH A;  3FZK A;  4OPH A;  2Y1I A;  3H3O B;  1WUA A;  4FZZ A;  4AHU A;  4DTR A;  4NXN K;  2Z1G A;  3DAW A;  2W41 A;  4M3W A;  3KK7 A;  3O9Q A;  3ZX2 A;  3KJV A;  3AVI A;  2G8W A;  1SL1 A;  2Q36 A;  2E1Y A;  1V4T A;  3KHY A;  2D0A A;  1VHX A;  4FWR A;  3VQ6 A;  3MCP A;  4A57 A;  1VQP N;  3ENH A;  2YHA A;  3VOV A;  3CC4 N;  4UQG A;  3LDQ A;  1WB9 A;  3MEG A;  1O1W A;  1HNZ K;  2QI2 A;  4BR5 A;  3VA3 A;  3OYL A;  4JKG B;  3O9R A;  2PYJ A;  1OVQ A;  3K5N A;  3SQ0 A;  2P9I B;  3CM5 A;  4AM7 A;  4IEI A;  2HF3 A;  3NVM A;  4NLB A;  3VER A;  2R7Y A;  4FL9 A;  3KLI A;  4EHU A;  2NUB A;  1Y64 A;  1ILY A;  1BHL A;  3RSE A;  1XUP O;  2D0O A;  4Y0W A;  3WEE A;  2YHX A;  3I56 N;  1X3N A;  4FVU A;  3AO2 A;  4I6M B;  2XRI A;  1T44 A;  5BRD A;  4O5B A;  3T19 A;  3E1Y A;  3QDK A;  1C0G A;  2E5L K;  2UU9 K;  2KFZ A;  4HCB A;  4IO8 A;  1T6D A;  4FJH A;  3AA5 X;  4ZHR A;  5AQT A;  3AVB A;  4CEZ A;  5KRT A;  1T3V A;  2FSN A;  2IC3 A;  5J2Q A;  3FGU A;  4FJJ A;  3GG4 A;  1TKX A;  5C2F A;  4M3R A;  2RE2 A;  3FE1 A;  3OYJ A;  3AVG A;  3UKR A;  4L8R B;  3O4N A;  2G8F A;  4A5B A;  4CJF A;  3OS2 A;  4HVJ A;  3S3M A;  2VWK A;  2QWL A;  3FLC O;  3QBW A;  4JKF A;  3TTC A;  4CK2 A;  1LCU A;  4BRQ A;  4DV7 K;  1Q86 O;  3JAM O;  2YHW A;  1WBD A;  1XMO K;  3QEI A;  4FWM A;  2XY5 A;  2QW9 A;  4ID1 A;  2DFH A;  2VWJ A;  3SJJ A;  4CEA A;  4CJK A;  4KHP K;  2WC9 A;  1BA1 A;  4GNI A;  3VET A;  1WAJ A;  1TL1 A;  1C0T A;  1A5W A;  4DU1 A;  5AZJ A;  2D0B A;  4X65 K;  4BR4 A;  3EZW A;  2BDP A;  4FLZ A;  4DV2 K;  1K8K B;  1UAX A;  5HLF A;  4HWI A;  3VQ9 A;  4CFA A;  5SWM A;  4B1Z A;  4FJ5 A;  1E4G T;  4CJ4 A;  5AQQ A;  2O8C A;  4L3Q A;  1GOA A;  3VQB A;  5DM7 L;  5CYQ A;  3VQQ A;  3MXM A;  3MN5 A;  1HPM A;  3SQ1 A;  5BPL A;  5AQR A;  4ZTF A;  1DTQ A;  3V9S A;  4BR0 A;  4DKW A;  4AHV A;  4DLG A;  4O0J A;  3CF5 L;  2BH1 A;  1YT3 A;  1YHQ N;  3OA9 A;  5KPR A;  4MDA A;  1WN7 A;  3MDQ A;  4DMN A;  1BA0 A;  3BY5 A;  1RT3 A;  4H0O A;  4A5A A;  5C12 A;  3ATV A;  3OTO K;  2B5J A;  2HHQ A;  4DTO A;  4BWM A;  4CZF A;  3SCX A;  3J81 O;  3ISN C;  3JS6 A;  2VG6 A;  3TAB A;  2O8F B;  4EP4 A;  4CJT A;  5AQO A;  1YXQ A;  5AQU A;  3EZ5 A;  3TAP A;  2HHU A;  1KRP A;  3R6M A;  4FLT A;  4BGB A;  5E41 A;  4JKG A;  1LAW A;  3B8A X;  2HHT A;  3MN9 A;  2F9W A;  3O3G A;  2P9I A;  4JI1 K;  3WQT A;  3NE6 A;  4LY7 A;  1V4S A;  2GX9 A;  3D6R A;  3L3V A;  5BN9 A;  4X64 K;  2XY6 A;  4KAZ A;  2QWN A;  4MFB A;  2OCE A;  2W6K A;  2A6A A;  3C7N A;  1KVB A;  2CH5 A;  4YOX A;  5EY4 A;  5BR8 K;  2AA4 A;  4H0T B;  5E26 A;  3KZB A;  2H3G X;  3CQX A;  1XC9 A;  4M3T A;  3HJF A;  2IS3 A;  4BC3 A;  4B3T K;  3J7Z O;  4G9Z A;  4Q0B A;  4B8C A;  1RT6 A;  4WQ4 A;  2NRW A;  1QQC A;  2X6N A;  3LDP A;  1RGI A;  1S72 N;  3CI5 A;  3SBT A;  1DEJ A;  4M3X A;  2KHO A;  2P9S B;  3TSQ A;  1YI2 N;  1RT2 A;  4DF8 A;  3KKR A;  2XHB A;  4KRF A;  1KTQ A;  1B9D A;  1NGG A;  1S1U A;  1X1P A;  4E89 A;  4DG1 A;  3C6U A;  3LP2 A;  1HJO A;  2FBY A;  4C8N A;  4F4K A;  3AVH A;  3ZSO A;  3HK2 A;  5AQW A;  1L3V A;  4N47 A;  2UUA K;  4HUE A;  4DSK A;  3V81 A;  3MX5 A;  4FM0 A;  4IJN A;  1D9F A;  1RT4 A;  5C2D A;  2E6M A;  3DLR A;  3T1H K;  1YUW A;  4XH4 A;  3ZSV A;  4OGE A;  5TKY A;  1JXB A;  3T7Z A;  1A5X A;  1BIS A;  1YIJ N;  5GAG P;  1U47 A;  2HMP A;  3V9Z A;  3SAH A;  3MK6 A;  4JK8 A;  3TAR A;  5AQI A;  4FK4 A;  3SUP A;  5KPZ A;  1XC3 A;  3PSF A;  5BPN A;  4BRG A;  2NRT A;  4CCH A;  4OKE A;  4JHD A;  1TK8 A;  2ITG A;  3I8B A;  1RDU A;  3HTV A;  4CIE A;  4EFH A;  3IS9 A;  3CG7 A;  3TAM A;  3CCL N;  1WSI A;  5FRO A;  5DK5 A;  4JKD A;  3AVK A;  3C6A A;  4A2A A;  5BRF A;  3OVN A;  1MWK A;  4YDU C;  3O9U A;  4BAC A;  3VQD A;  2ASO A;  2B6A A;  1NLV A;  4B9Q A;  1NK4 A;  2UUB K;  1KLM A;  4RW9 A;  1QZ6 A;  2I5J A;  3NHG A;  1WBB A;  2P5O A;  4LF5 K;  4F8R A;  3AVC A;  2EWS A;  5JLF A;  4CEF A;  4CGI A;  4YOR A;  3CCE N;  2GEL A;  3BZK A;  4IWV A;  1ASU A;  4B3M K;  1NGE A;  5KTQ A;  1RBV A;  1D4X A;  5CHI A;  3HM8 A;  1JLG A;  3IKM A;  4M42 A;  4A2B A;  3I55 N;  3LPT A;  3OS1 A;  1WNS A;  3BGR A;  4B8A B;  3CCR N;  1T7P A;  1Q81 O;  4N76 A;  5ELZ A;  4WFN L;  3ZT4 A;  4M3U A;  1E4F T;  1FKO A;  3EE9 A;  5KQD A;  2P9L B;  1KFD A;  3ZSW A;  2OZS A;  1NGH A;  3KVG A;  4EP5 A;  4B3S K;  1FW6 A;  3S3N A;  4OVL A;  3THY B;  4OKK A;  4PKH A;  5HRR A;  5GIP A;  3NDK A;  1FK9 A;  5C0Y A;  3VQ5 A;  4JN4 A;  5AQS A;  3WXK A;  4GMJ B;  4O8U A;  3SQ2 A;  3L0Q A;  4FLV A;  3OBY A;  4AF1 A;  4JI3 K;  3PY8 A;  4Z4E A;  3KWI A;  3VTH A;  4FOI A;  3AA3 A;  1NNE A;  4CZK A;  2HBK A;  1X3M A;  4LF7 K;  1VQK N;  3C6T A;  4DUY K;  1LAV A;  4CE9 A;  1NU0 A;  1HRH A;  4DTS A;  5JS1 A;  2CGL A;  2KQ2 A;  4IOX A;  4B9N A;  1QHT A;  4LH4 A;  4OLB A;  2HHW A;  2KKZ A;  3IRX A;  1X9S A;  3AO3 A;  3ULE B;  3MAQ A;  3RMB A;  2O4I A;  4CJU A;  4QS7 A;  4DV6 K;  1YJ9 N;  3NVK A;  1IKY A;  3LPU A;  1C1B A;  3O8M A;  4KKO A;  3CJ9 A;  4JI0 K;  5FPE A;  3K59 A;  5CY4 A;  3WXL A;  4UY8 O;  3AO1 A;  1S1X A;  5JVH L;  1RT1 A;  5M1F A;  3U3G A;  2IOC A;  1CZB A;  2QKK A;  4B9T A;  4Y1D A;  3CQY A;  4WQ5 A;  1VSM A;  3VEX A;  1VQM N;  1DKG D;  5AQY A;  1U2V A;  1IV0 A;  3HOT A;  4JD2 A;  1LWF A;  3G4S N;  4BRI A;  4JI7 K;  1W7A A;  4DHY A;  2KLA A;  2NRX A;  2X78 A;  4Z4C A;  3O9T A;  3QIO A;  1Q8I A;  3CCV N;  2IVN A;  4BVP A;  3CHW A;  1T05 A;  3P5J A;  3DI6 A;  2ZD1 A;  2Z1J A;  5AZI B;  2YNG A;  4EAH D;  3T1A A;  1N8R O;  3UKU A;  4LD0 A;  3NBP A;  2Z1H A;  3AVJ A;  3HVR A;  2O4G A;  2IGI A;  4JKC A;  4IFE A;  1HYS A;  3H3N O;  4I2Q A;  4RW7 A;  2QWP A;  4Y1C A;  4ISE A;  4DV5 K;  4IFY A;  3FFI A;  2OTL N;  3AA4 A;  1DLO A;  3VGK A;  1KD1 O;  4NB4 A;  1L3S A;  4CBW A;  3LP0 A;  1L5U A;  3H08 A;  5KI6 A;  4JK9 A;  1CLQ A;  1BGX T;  3RVC A;  3HRG A;  1RTI A;  1GLD G;  3VQC A;  2P9N B;  4JS4 A;  1TK5 A;  4CGG A;  2Q97 A;  3BZC A;  4FWQ A;  2VQF K;  1BOT O;  3RTV A;  3HZ6 A;  3U9Z A;  1H1V A;  4Z94 A;  3HL8 A;  3HVT A;  3T1Y K;  3C65 A;  1QTM A;  3MXJ A;  3MXI A;  3IDH A;  4JLH A;  2JWL A;  1VSE A;  1CZ9 A;  4DR2 K;  2P9L A;  1T03 A;  3GL1 A;  2E6L A;  1XHX A;  3L4I A;  4CER A;  4NYN A;  3O08 A;  4OGC A;  3TTD A;  4FK2 A;  2HVI A;  4W5O A;  1TYQ A;  2FXU A;  2YI1 A;  2GWK A;  4CJQ A;  3THY A;  1N5Y A;  4CHY A;  2P9U B;  3HBT A;  1S22 A;  5FRN A;  4A62 A;  1W97 L;  2Q1N A;  4FYD A;  4O5F A;  4CF0 A;  1NK7 A;  5B8H A;  3ATU A;  1RBR A;  3BP8 A;  2V7Z A;  2KW4 A;  3SNN A;  1X9J A;  2OAN A;  3L2U A;  4CFB A;  1F21 A;  1VQN N;  4PKI A;  5IWA K;  2HST A;  4E1J A;  3OJS A;  3ZSQ A;  2J4R A;  3K5O A;  2GV9 A;  4FJ8 A;  4BGA A;  5K14 A;  3VEO A;  4PKG A;  3P31 A;  1VQ7 N;  4JI4 K;  5M1Q A;  2F8S A;  2FF6 A;  1BQN A;  3CJA A;  1VQ5 N;  1VSI A;  4C8K A;  3PX0 A;  3NMU A;  3RR8 A;  4ELU A;  1HUX A;  4CIG A;  5BN8 A;  1D9D A;  2WBN A;  2D1K A;  3T3F A;  4Z4F A;  1S1T A;  3E9O A;  4DQP A;  3NH0 A;  4W5T A;  4AHT A;  4BRO A;  1GLE G;  3DXM A;  1O13 A;  1ZBI A;  4IDK A;  1S1W A;  4RCH A;  3THX A;  3DLK A;  4PWD A;  4H8K A;  4E0D A;  4KO0 A;  1SKS A;  3LP1 A;  3CIP A;  4PY5 A;  1JLE A;  1ZBF A;  2HB5 A;  2UXB K;  1D5A A;  5GIN A;  3QML A;  1YVN A;  5M1O A;  4FJL A;  4IXC A;  5CR4 A;  1KQS M;  3NAE A;  1Q82 O;  1G99 A;  4RW6 A;  3S41 A;  2VYP A;  4FLU A;  3R3L A;  1IG9 A;  3HP9 A;  3NGI A;  3EYZ A;  4EZ9 A;  2HNY A;  3CPW M;  3VQE A;  4CEC A;  5A2Q O;  1KLN A;  3IAY A;  3DWL A;  4JNE A;  1ZYQ A;  3CCU N;  3I8D A;  1ATS A;  4WE1 A;  4BRE A;  5AZI A;  4ILH A;  1KSP A;  1NBW A;  2E88 A;  1QVG M;  1IKX A;  4E19 A;  4B3R K;  3O80 A;  4C8O A;  3SYZ A;  2LSN A;  3NF8 A;  3LP3 A;  1LW0 A;  1RT7 A;  2QM1 A;  1S6Q A;  3DLE A;  4Z0U A;  2QKB A;  1S5J A;  4O4G A;  4KH4 A;  1DTT A;  3O3H A;  1VSK A;  4BRL A;  4DCH A;  1NJX A;  4QOZ B;  1NK0 A;  2AJQ A;  3CFO A;  4BDZ A;  4EZ6 A;  4QAG A;  2Z1I A;  2P9K B;  3EEQ A;  3F5T A;  3M5R A;  3ZEU A;  4OPK A;  2E2N A;  5EX5 A;  4HUG A;  2FBV A;  2ZJP L;  3W3D A;  3CQ8 A;  1OH6 A;  3O1B A;  5M1N A;  5AFU H;  3VF2 A;  1IKV A;  4I7F A;  4CZJ A;  1VRT A;  3P83 D;  1NKE A;  1YIT N;  1S1V A;  1QS4 A;  5KGX A;  4BY9 C;  1TVR A;  5FRM A;  2W42 A;  4HHT A;  2HBL A;  5GAH P;  1NMN A;  1VQ8 N;  3IG1 A;  3VGM A;  2QXL A;  4CZI A;  3LAM A;  3LM2 A;  2WOM A;  5HL7 L;  2ZE2 A;  5AQN A;  3JYT A;  4MO5 A;  4KV8 A;  1EWR A;  1NK6 A;  4CZM A;  4CGD A;  3SPY A;  4BG8 A;  3WNH A;  1WLJ A;  1HNI A;  4PL8 A;  4CZE A;  4KTQ A;  5CYM A;  3T69 A;  4CW7 B;  1MA9 B;  4OO1 J;  5JS2 A;  5ADX H;  1G15 A;  4H5T A;  5MLC Q;  3WXI A;  1XWL A;  1YJW N;  3WXJ A;  1YAG A;  3UIQ A;  2YHY A;  3DXK B;  3D2F B;  1J9A A;  3LAL A;  5C25 A;  3HP6 A;  1NGD A;  2JWK A;  4HTL A;  4BRK A;  4CK3 A;  3AY9 A;  1N32 K;  3KLF A;  1Y97 A;  1QSS A;  3DMJ A;  5HRO A;  2PZS A;  4LFB K;  2O8D B;  1Q7Y O;  2E2P A;  5AQL A;  4CF2 A;  4RG8 A;  1NK9 A;  4B1X B;  4CJ5 A;  1HQE A;  3G25 A;  1W2B M;  2DPN A;  3H45 C;  4DU4 A;  1ZBH A;  2OZM A;  3AO5 A;  3ENO A;  4JK7 A;  1LWE A;  1HJR A;  3LZI A;  4KI4 A;  3WXM B;  1K8A O;  4DS4 A;  2RF2 A;  1BL3 A;  1WSJ A;  1QQN A;  3L4Q A;  3U9D A;  4C23 A;  4CFC A;  3CFR A;  4GVE A;  3QEX A;  1GLA G;  3DLB A;  5HRN A;  5FLX O;  4O0I A;  1M1K O;  2BE2 A;  4IZ9 A;  3VEY A;  1B9F A;  3CPE A;  5C24 A;  1K73 O;  3MCA B;  2Y1J A;  4B1W B;  3K5L A;  4DTX A;  4IOA L;  4FPB A;  1IKW A;  3QFP A;  1HNW K;  3CMA N;  3H46 O;  1JCF A;  4DV1 K;  3OS0 A;  2F8T A;  5FPN A;  3EY1 A;  3NCI A;  4FJ9 A;  1ASW A;  1VAZ A;  4LSN A;  4W5Q A;  3FR0 A;  4CEB A;  3LL3 A;  3ZT3 A;  1SKW A;  1X9W A;  3AVA A;  4I6M A;  1TKT A;  4AHC A;  1WSG A;  5JVG L;  3SV4 A;  4JKH A;  1Z6R A;  4DQS A;  2NLX A;  1BIU A;  4BC2 A;  2DY4 A;  2OPS A;  3GE1 A;  1ESV A;  5FPD A;  3EKS A;  3ZSY A;  2ITM A;  3O4W A;  4YHH K;  1W9H A;  1RNH A;  4B1Y B;  2HHH K;  5AQJ A;  3U8X A;  3A2F A;  1U6Z A;  3K0S A;  4XIU A;  1HKG A;  2WUS A;  4JAX A;  4X66 K;  4CF1 A;  4CJE A;  1RBS A;  4K42 A;  2W40 A;  1YF5 L;  2VG5 A;  4DV0 K;  4RTF D;  3D0P A;  1D8Y A;  3ENB A;  4I9Q A;  4DQQ A;  3RRH A;  4DQI A;  4NCA A;  3LAK A;  1CXQ A;  3THW B;  1S9E A;  4AM6 A;  3TR8 A;  1KVA A;  1JJ2 M;  3CXC M;  4C8M A;  2PBD A;  3LDO A;  2E1Z A;  3CFP A;  3SAF A;  3BF3 A;  1J5E K;  1ITG A;  2P9P B;  3V1Q A;  4W5R A;  4CJW A;  1JL2 A;  3AAQ A;  4H0P A;  4DFM A;  2VGM A;  1NOY A;  1RTD A;  4CJ3 A;  2KZM A;  4FM1 A;  2NRZ A;  5D3G A;  4KH5 A;  4KHN A;  1JLA A;  2OPP A;  2X74 A;  4C1N I;  4H5V A;  3HI0 A;  1EP4 A;  4ISF A;  3NF9 A;  1K8K A;  3K2P A;  3VQ8 A;  1SQK A;  5DMR A;  4H4M A;  3K9J A;  5M1P A;  2UYT A;  4AH9 A;  4IOC L;  1KXP A;  4FWP A;  4OPJ A;  4B1V A;  1U48 A;  4MDB A;  2VQE K;  1HNX K;  4H03 B;  1RCH A;  1EO1 A;  1TL3 A;  4E7J A;  1LW2 A;  1QQM A;  4K25 A;  3DXK A;  4WYB A;  4DR3 K;  1IJJ A;  4BG9 A;  3PX6 A;  1RFQ A;  4ICL A;  4BWJ A;  4FJG A;  3B6O A;  4KB0 A;  4DWI A;  3PO5 A;  1KAX A;  5KQ8 A;  3AGK A;  3HT3 A;  5I42 A;  1NGB A;  3P4I A;  3QER A;  5AQM A;  5AR0 A;  1TKD A;  2ZM6 K;  4DQ8 A;  4M3Y A;  4H0X B;  1VSJ A;  2AP1 A;  2X6S A;  1RDA A;  3WT0 A;  5C10 A;  4JI5 K;  2RKI A;  3VEV A;  5F0X A;  4K0K K;  4A61 A;  2FC0 A;  3MWT A;  1HR0 K;  4DUZ K;  2O8F A;  4N41 A;  2YKN A;  2RPI A;  4WFB L;  1R59 O;  4BRH A;  4U67 L;  3QBX A;  3CCQ N;  1T8E A;  2A5X A;  2GBZ A;  4B9L A;  1L3T A;  4OLA A;  3BEX A;  3LDS A;  3AO4 A;  3DOL A;  3EE8 A;  3CME N;  2O8E B;  2P51 A;  4CJL A;  2F96 A;  1RTJ A;  4H5W A;  4PQU A;  2E20 A;  4WQ4 C;  4U7B A;  3CCM N;  3ID8 A;  3TAE A;  3ID6 A;  1XI1 A;  3O3F A;  3QB0 A;  4DR6 K;  4B9M A;  1C1C A;  4CD3 A;  1QZ5 A;  4CJV A;  4RWT A;  4PA1 A;  4IO9 L;  4BR2 A;  1EQY A;  2FBX A;  2NRV A;  1OH8 A;  3LM9 A;  1HQU A;  1NGC A;  3ZSX A;  3SUQ A;  2OYQ A;  4BQL A;  1GOB A;  2WON A;  2P9S A;  4X62 K;  1BUP A;  3GBT A;  1OH7 A;  1NGA A;  1JXE A;  4IDH A;  3MED A;  1ZBU A;  4NCG A;  4YNQ A;  4N5S A;  3SUN A;  4IG0 A;  1EKE A;  1GLC G;  4B1U B;  2GUI A;  4KHU A;  2HOE A;  4J2D A;  4R5P A;  3D45 A;  5SZT A;  3CCJ N;  3QO9 A;  2V51 B;  1IBL K;  2FSK A;  4WFA L;  5KGW A;  4E7H A;  3ZLJ A;  4N56 A;  2BGG A;  4J2B A;  3A5O C;  4RW8 A;  1YTU A;  4CZL A;  3CJ7 A;  3ZSR A;  1K9M O;  1I3A A;  2WFB A;  3DOK A;  3W0L A;  3CJC A;  4DS5 A;  1SUQ A;  3DYA A;  2QWR A;  3CC7 N;  1GLL O;  4DSE A;  1NGF A;  3AVM A;  2BTF A;  1KVC A;  3AVN A;  4PHT X;  3L6Q A;  5GAD P;  1Z05 A;  2P9P A;  2FLO A;  2IAJ A;  4CBU A;  4FPA A;  4YOV A;  4NLC A;  3VQA A;  4YFU A;  1K6Y A;  4H5N A;  3Q7C A;  3QIN A;  4R79 A;  2A41 A;  4LFA K;  5HRP A;  3M6G A;  3PV8 A;  1B92 A;  1XHZ A;  2HW3 A;  1HLU A;  1TAQ A;  2HHS A;  2B4J A;  3G0Z A;  1QSL A;  3WNE A;  2XO7 A;  4AHS A;  3H6E A;  3PIO L;  4O44 A;  3TSU A;  1LWC A;  4GV6 A;  1HX1 A;  2OA8 A;  4WF9 L;  2NNW A;  3SBG A;  1HKC A;  1NJW A;  4FK0 A;  2Q0U A;  2GEM A;  5AQG A;  1RIL A;  3QLH A;  3SAG A;  1Z26 A;  1NJI O;  3C0B A;  3HPH A;  3F2K A;  3DJC A;  1HPZ A;  4GV3 A;  2KZZ A;  4LF9 K;  1HMV A;  2P5G A;  3M3Z A;  4CD1 A;  4JV5 K;  4W5N A;  2DFF A;  3V6D A;  2ETJ A;  5AJ3 K;  3C94 A;  1WAF A;  4DR5 K;  3MEC A;  3G6E N;  1XQS C;  1VQ6 N;  4ZTJ A;  3O5B A;  3ULD A;  4DTM A;  3SK3 A;  4EIA A;  3VQP A;  2Q0R A;  3KLE A;  3Q7B A;  1FXX A;  3RMD A;  1UOC A;  3V1R A;  3I0S A;  4LFC K;  2D5R A;  4FOE A;  3ALY A;  5ADX A;  3CCS N;  1SAZ A;  4YOU A;  1S3X A;  4M41 A;  2PAV A;  3CM6 A;  4XEI A;  3WNG A;  4BRC A;  2UUC K;  4E1N A;  3UKR B;  3VEZ A;  3SUO A;  3TI0 A;  4DTP A;  4KHW A;  5I3U A;  3NGZ A;  2G8H A;  3A8Y A;  2A1R A;  3MX2 A;  2IIR A;  2DTU A;  4M7Y A;  3BDP A;  3L2R A;  2E4L A;  4K43 A;  4KHY A;  4BVO A;  4GVM A;  1BCO A;  1VQL N;  4FW2 A;  1S6P A;  3U6F A;  1NM1 A;  4GV9 A;  3UE5 A;  2O8E A;  1HYV A;  1QHA A;  4M45 A;  3DM2 A;  4CED A;  4OX9 K;  3NH2 A;  4CEO A;  4YOW A;  1ZBL A;  4CJP A;  1NK8 A;  3A0I X;  3C6H A;  1J53 A;  1SV5 A;  3ZYY X;  4CBX A;  1VSH A;  2VG7 A;  5E84 A;  5LY3 A;  3MN7 A;  3OYK A;  1GLJ O;  5EXW A;  3OYA A;  4FLX A;  3FZL A;  5AQK A;  2PY5 A;  4Z4H A;  4DR1 K;  5J2P A;  3ULE A;  5FDL A;  1JLC A;  1CZA N;  1RDD A;  1BO5 O;  3TAG A;  2O8C B;  5JIC A;  2VGN A;  3HSC A;  3I33 A;  4ELV A;  3FZF A;  3OYF A;  1DT9 A;  3MWP A;  3VMF B;  1TUY A;  1TGO A;  2A3Z A;  4WQ5 C;  4BE2 A;  3NGY A;  4BE1 A;  2PYL A;  1XMQ K;  4KBO A;  3VA0 A;  1VRU A;  4JRQ A;  4BR9 A;  3M8Q A;  2Q31 A;  4DTJ A;  5F2R A;  3L3U A;  2QEX N;  1QVF M;  2G8I A;  3TSP A;  2O8B B;  4FJX A;  4CJS A;  2P1J A;  4C1N K;  2V52 B;  2CGJ A;  1TKZ A;  1R0A A;  1MDU B;  5TKW A;  3PSI A;  2JGU A;  4V19 S;  1SZ2 A;  4DSI A;  3NF6 A;  4BRD A;  2ZWH A;  1LOT B;  1UA1 A;  4K8X A;  1U4B A;  3OYC A;  2D0P A;  1TV6 A;  1NWK A;  1NJY A;  4I9L A;  3EN9 A;  3SZ2 A;  1UA0 A;  1N33 K;  3N4P A;  4CEQ A;  3ZET B;  4IG3 A;  4J2E A;  5GIO A;  4GW6 A;  5J2M A;  3I0R A;  2YNI A;  3VTI A;  3C7N B;  3ZCM A;  1BU6 O;  3P38 A;  1C0F A;  5HOO A;  4YOT A;  2YKM A;  4FVM A;  1WSF A;  4K8Z A;  5HBM A;  4CIF A;  4DSJ A;  1CXU A;  2QWQ A;  4DFP A;  4IBN A;  1J6Z A;  3TWH A;  4BDP A;  4DSF A;  2JLE A;  4BC5 A;  4CJR A;  1C0U A;  3TTF A;  1N34 K;  1EWQ A;  4ILG B;  2F9T A;  1NK5 A;  3QEP A;  3U3Y A;  3DLH A;  3VQ4 A;  2VCP A;  3QET A;  1IO2 A;  3D2E B;  4IJA A;  2P9N A;  3SMS A;  4CI6 A;  3BF1 A;  4JI2 K;  4O8K A;  3EKU A;  3ZT0 A;  1RDB A;  3PIP L;  2XY8 A;  4FO0 A;  4DTN A;  4OKJ A;  3QIP A;  3D7E O;  4DSL A;  1TAU A;  5C15 A;  3DRP A;  4H0Y B;  3H1Q A;  4MO4 A;  4WCE L;  1N36 K;  1KCF A;  2A42 A;  2F7T A;  3WQU A;  2FBT A;  3HPO A;  3LDL A;  4CGF A;  2P9U A;  4F3O A;  4QCL A;  4CVN E;  3CC2 N;  3F73 A;  5J2N A;  4FZX C;  1VK0 A;  2W6L A;  2YHB A;  3ASM A;  3P39 A;  2KFN A;  3O9S A;  1NJZ A;  1NKB A;  2RN2 A;  2QXF A;  2ZQB A;  3H1V X;  2DFE A;  4CES A;  4I2P A;  5GAE P;  4FLW A;  4HUF A;  3TAN A;  4DR4 K;  3E01 A;  3ZT1 A;  1JLQ A;  4JHD B;  1T6C A;  3B6P A;  3NH1 A;  3OYH A;  3E9L A;  1HKB A;  1BI4 B;  4XH5 A;  1VSF A;  2Q2R A;  3L2V A;  1NMD A;  1BWF O;  4JYA K;  2YX6 A;  4QS8 A;  3M8P A;  3FZM A;  3EO3 A;  3HST B;  4F3T A;  1QSY A;  4FZY A;  5JMV A;  4CGJ A;  3DLG A;  2FSJ A;  5LMN K;  5EVZ A;  3OY9 A;  1VQO N;  4DLE A;  4Z4I A;  2QTD A;  2IVP A;  5LMU K;  2GWJ A;  3SMP A;  3VF6 A;  4CHQ A;  4YDU A;  1REV A;  3LZJ A;  3KLH A;  3BUZ B;  3M8R A;  3NF7 A;  4BR7 A;  3OYN A;  3ZSZ A;  1EET A;  5AQZ A;  3WNF A;  2NRH A;  4AHR A;  4E7K A;  3QNO A;  4BRM A;  3A5N C;  1U45 A;  1L3U A;  3OYE A;  5LJW A;  4CHN A;  2O8B A;  1BQM A;  1RBT A;  3FFK B;  3J80 O;  3GOI A;  4NYF A;  3HOS A;  4JS5 A;  4LSL A;  2QK9 A;  3FZH A;  1X9M A;  3QEV A;  3F9M A;  4JEP A;  4KRE A;  1IBK K;  3JSM A;  5KRS A;  4TSX A;  4F2S A;  1WSH A;  4FWL A;  4LF8 K;  2OTJ N;  3O4Q A;  4JKA A;  3ZET A;  4OJR A;  1JCG A;  3SQ4 A;  1JLB A;  4FJ7 A;  3K58 A;  2GUP A;  5F1X A;  1NGI A;  3V1O A;  5T7B A;  3DLL L;  4DB3 A;  3OYB A;  3KD5 E;  4ILJ A;  5KPT A;  5BPM A;  2CH6 A;  2ZJR L;  3S3O A;  3QFU A;  1C1A A;  3VN5 A;  3U4L A;  4JRP A;  1YJN N;  2D4W A;  3WUH A;  2OPR A;  1LV5 A;  4B08 A;  2P9K A;  4H5R A;  2EHG A;  3P1G A;  3AA2 A;  1YTA A;  3D2E A;  5EOY A;  3K57 A;  3ZX0 A;  1Q9Y A;  5BR9 A;  2BUP A;  4KB1 A;  2ZF5 O;  3SLC A;  1WSE A;  3G71 N;  4BDY A;  4FW1 A;  3K5M A;  3OHR A;  3J8A A;  3G10 A;  4B9V A;  3AV9 A;  4IEE A;  4K41 A;  4LH5 A;  4YOY A;  4C8L A;  3OYM A;  3CER A;  4H4O A;  4LF4 K;  4ID5 A;  3SI6 A;  1VSD A;  3R9P A;  3UB5 A;  4CJ7 A;  2OPQ A;  4BQZ A;  1GLF O;  2I7N A;  4FJI A;  3HPG A;  1S9G A;  2HND A;  4DR7 K;  4JKE A;  3QIC A;  1HNV A;  1A5V A;  4DV4 K;  3RMA A;  3IFR A;  3AAP A;  4IKF A;  1FJG K;  1UWB A;  4FJK A;  4CEE A;  1P90 A;  1U2V B;  4FLY A;  1TUU A;  1C0M A;  4JD2 B;  2QWO A;  2D0C A;  3VEN A;  1KFS A;  4NO7 A;  3RRG A;  1I94 K;  2ASP A;  2HHX A;  2CGK A;  3J7Y P;  1FKP A;  1JLF A;  2ZGY A;  4BRF A;  4YY3 K;  4OPA A;  4CGH A;  1IG8 A;  4J8F A;  3D2F A;  3UKU B;  1BI4 A;  3V9X A;  1P8Z A;  3OW2 M;  3ZT2 A;  3QES A;  3L2W A;  3OYD A;  4BE0 A;  2O8D A;  3DRS A;  3KIO A;  1Z25 A;  3SPZ A;  2E2Q A;  4FSV A;  3PUF A;  4DV3 K;  2G8U A;  1JCE A;  3CJ1 A;  3DRR A;  5AQV A;  3AVL A;  3K9K A;  4E7I A;  1ATN A;  4GKK K;  2G8V A;  4BC4 A;  4E3S A;  5I9E B;  2A1S A;  5JLH A;  1NG9 A;  4FJM A;  1BDG A;  4BRP A;  3V9W A;  3PO4 A;  3KTQ A;  3OBW A;  1MU2 A;  1OVY A;  4JKB A;  1RTH A;  3ZX3 A;  1KAZ A;  3VF4 A;  5HP1 A;  3KD1 E;  1SS6 A;  4CHZ A;  1XNR K;  3HO1 A;  2VWB A;  5DM6 L;  3NFA A;  4HTU A;  2KTQ A;  5LL6 Z;  1E3M A;  1U04 A;  4M3Z A;  3JXU A;  2YJE A;  2ZGZ A;  3OYG A;  3VGL A;  1TK0 A;  4FM2 A;  3L8B A;  4FWO A;  3V4I A;  4AQY K;  3IMX A;  2RHK A;  2UXC K;  3O6W A;  1TYQ B;  1VQ4 N;  4F2R A;  2E8A A;  3M8S A;  4HCC A;  5AQH A;  1EX4 A;  2WTU A;  4JI6 K;  3VQ7 A;  3RR7 A;  2YJF A;  3IUC A;  4KHQ A;  3VEW A;  5J1E A;  4KHS A;  5BRE A;  3L2Q A;  4KPY A;  5C42 A;  1GLB G;  3EL2 A;  3VES A;  2ZJQ L;  2NZT A;  2Q3S A;  1RDW X;  2ATQ A;  1SL0 A;  1DGK N;  4M7X A;  3LWM A;  4JI8 K;  4NXM K;  4PL7 A;  5IT9 O;  1NKC A;  4DTU A;  2HNZ A;  3O1W A;  3CD6 N;  1QQO A;  4Z4G A;  3KK2 A;  1Q9X A;  3SJH A;  4FXD A;  2GTD A;  1BCM A;  4LC9 B;  3S9H A;  3AVF A;  3HYF A;  2QA4 N;  4MQ3 A;  3J7A P;  1RBU A;  4CF9 A;  2IDO A;  3RMC A;  4FJN A;  1XNQ K;  4E1M A;  3CJB A;  4EHT A;  1GOC A;  3THW A;  1J5O A;  3DXM B;  3VPZ A;  5M1K A;  4KH6 A;  1WOQ A;  3THX B;  1OH5 A;  1KC8 O;  4H0V B;  2F4V K;  4DU3 A;  4RW4 A;  2BAN A;  2YV0 X;  1SKR A;  4DFJ A;  2FF3 B;  3AAR A;  4NCB A;  4FCY A;  2HF4 A;  1OKJ A;  1Q18 A;  1U49 A; 
#chains in the Genus database with same CATH homology
 1RT5 A;  3VA0 A;  1VRU A;  4JRQ A;  1VSL A;  3M8Q A;  4CK3 A;  4DTJ A;  1ASV A;  3KLF A;  1Y97 A;  1QSS A;  3DMJ A;  4CIE A;  3L3U A;  5HRO A;  2PZS A;  3IS9 A;  4CF2 A;  2G8I A;  4RG8 A;  3CG7 A;  1NK9 A;  3TAM A;  1WSI A;  5FRO A;  5DK5 A;  4FJX A;  3AVK A;  4DF4 A;  4CJS A;  2P1J A;  4CJ5 A;  1HQE A;  3SV3 A;  2YNF A;  1TKZ A;  3OVN A;  3KKS A;  1R0A A;  4DU4 A;  1ZBH A;  3C95 A;  2OZM A;  4BAC A;  3AO5 A;  1LWE A;  1HJR A;  3LZI A;  5CZ1 A;  2JGU A;  3F9K A;  3VQD A;  1NOZ A;  5CZ2 A;  4KI4 A;  1IH7 A;  3LAN A;  4DSI A;  2B6A A;  3NF6 A;  4DS4 A;  1NK4 A;  1UA1 A;  1KLM A;  2RF2 A;  1I39 A;  1BL3 A;  4RW9 A;  2I5J A;  3NHG A;  4K8X A;  2P5O A;  2YNH A;  3ITH A;  1U4B A;  1N6Q A;  3OYC A;  4F8R A;  1WSJ A;  3AVC A;  2HMI A;  3THV A;  4CEF A;  4CFC A;  1TV6 A;  3CFR A;  4CGI A;  4I9L A;  1NJY A;  5HRS A;  3SZ2 A;  3QEX A;  4KI6 A;  1ASU A;  1UA0 A;  4CEQ A;  3DLB A;  5HRN A;  1QE1 A;  4IG3 A;  5KTQ A;  1RBV A;  2BE2 A;  4O0I A;  4CK1 A;  4J2E A;  4GW6 A;  1B9F A;  5C24 A;  3QNN A;  1JLG A;  3I0R A;  2YNI A;  5J2M A;  4M42 A;  2Y1J A;  3LWL A;  3ZCM A;  4KTW A;  3LPT A;  3V9U A;  3K5L A;  4DTX A;  1IKW A;  2YKM A;  3TAF A;  4FVM A;  1WSF A;  1WNS A;  3OS1 A;  4K8Z A;  1JKH A;  3BGR A;  5HBM A;  4CIF A;  4DSJ A;  4B8A B;  1CXU A;  4J2A A;  1T7P A;  3OJU A;  4N76 A;  4Q5V A;  3OS0 A;  3RWU A;  3ZT4 A;  4M3U A;  2F8T A;  3CYM A;  1FKO A;  3EY1 A;  3NCI A;  4DFP A;  1SL2 A;  4FJ9 A;  1ASW A;  4IBN A;  3KK1 A;  4LSN A;  4W5Q A;  1KFD A;  3ZSW A;  2OZS A;  3TWH A;  4CEB A;  2XY7 A;  4DSF A;  2JLE A;  4BDP A;  4EP5 A;  4CJR A;  1C0U A;  1HYZ A;  4G1Q A;  3OYI A;  3S3N A;  4OVL A;  3HM9 A;  4KFB A;  3ZT3 A;  3KLG A;  1NK5 A;  3QEP A;  3AVA A;  4AHC A;  1TKT A;  4OKK A;  5HRR A;  3U3Y A;  1X9W A;  3VQ4 A;  3DLH A;  3QET A;  1WSG A;  2G8K A;  4ELT A;  3NDK A;  1FK9 A;  3SV4 A;  4B9U A;  3VQ5 A;  1IO2 A;  4DQS A;  4B9S A;  1BIU A;  4GMJ B;  3SQ2 A;  4KTZ A;  1JL1 A;  4B3O A;  3KK3 A;  1YVU A;  4FLV A;  2OPS A;  2DY4 A;  3PY8 A;  3ZT0 A;  1RDB A;  3QEW A;  4Z4E A;  2XY8 A;  3AA3 A;  4DTN A;  3ZSY A;  1C6V A;  3QIP A;  4OKJ A;  1W9H A;  4PUO A;  1RNH A;  1J54 A;  4DFK A;  4DSL A;  1TAU A;  4E7L A;  3A2F A;  3DRP A;  4XIU A;  4IFV A;  3C6T A;  1RDC A;  5EU7 A;  1LAV A;  1KCF A;  4CF1 A;  4CJE A;  1RBS A;  4CE9 A;  1EXQ A;  2VG5 A;  1HRH A;  4DTS A;  5JS1 A;  2FBT A;  3D0P A;  3HPO A;  4CGF A;  1D8Y A;  2EX3 A;  2KQ2 A;  4I9Q A;  4F3O A;  4DQQ A;  1QHT A;  3RRH A;  4AIL C;  4LH4 A;  4B9N A;  4DQI A;  4CFD A;  3TAQ A;  4OLB A;  4QCL A;  4NCA A;  4CHO A;  3PX4 A;  1W0H A;  2HVH A;  4CHP A;  2HHW A;  3F73 A;  3LAK A;  4O55 A;  5J2N A;  4FZX C;  1CXQ A;  1VK0 A;  3IRX A;  1X9S A;  1S9E A;  3TR8 A;  1KVA A;  3AO3 A;  4C8M A;  2YHB A;  3CFP A;  3MAQ A;  3ASM A;  3RMB A;  2KFN A;  2O4I A;  1NJZ A;  1ITG A;  4CJU A;  1NKB A;  1BIZ A;  2QXF A;  2RN2 A;  2ZQB A;  3V1Q A;  2DFE A;  1IKY A;  3MEE A;  4I2P A;  4CES A;  4FLW A;  3LPU A;  4W5R A;  4HUF A;  3TAN A;  4CJW A;  1C1B A;  4DQR A;  1JL2 A;  3E01 A;  4KKO A;  3HXM A;  3ZT1 A;  4CF8 A;  3K59 A;  4DFM A;  1JLQ A;  5CY4 A;  3B6P A;  3NH1 A;  1NOY A;  1RTD A;  3AO1 A;  1S1X A;  4CJ3 A;  3OYH A;  2Y1I A;  2KZM A;  4FM1 A;  1RT1 A;  1BI4 B;  5D3G A;  4KHN A;  4FZZ A;  1VSF A;  1JLA A;  4AHU A;  3U3G A;  4DTR A;  2OPP A;  2IOC A;  1CZB A;  2QKK A;  4B9T A;  2X74 A;  2Z1G A;  4Y1D A;  4M3W A;  3L2V A;  1EP4 A;  1VSM A;  3M8P A;  3NF9 A;  3KJV A;  3AVI A;  3HST B;  2G8W A;  3K2P A;  3VQ8 A;  1QSY A;  4F3T A;  5DMR A;  4H4M A;  4FZY A;  1SL1 A;  4CGJ A;  1LWF A;  4AH9 A;  3DLG A;  4OPJ A;  3OY9 A;  1U48 A;  2D0A A;  4DLE A;  4Z4I A;  2X78 A;  4Z4C A;  3QIO A;  1Q8I A;  3VQ6 A;  1RCH A;  1T05 A;  4CHQ A;  1TL3 A;  2YHA A;  3P5J A;  4E7J A;  1LW2 A;  1REV A;  3DI6 A;  3KLH A;  3LZJ A;  3M8R A;  4UQG A;  3NF7 A;  2ZD1 A;  3PX6 A;  2Z1J A;  3MEG A;  2YNG A;  3ZSZ A;  1O1W A;  1EET A;  4ICL A;  4BWJ A;  3T1A A;  3B6O A;  3WNF A;  3OYN A;  4LD0 A;  4FJG A;  3VA3 A;  4AHR A;  4E7K A;  3QNO A;  3OYL A;  2PYJ A;  4KB0 A;  4DWI A;  1U45 A;  1L3U A;  3NBP A;  3PO5 A;  2Z1H A;  3AVJ A;  3K5N A;  3SQ0 A;  3HVR A;  3OYE A;  2O4G A;  3CM5 A;  2IGI A;  4CHN A;  3HT3 A;  5I42 A;  3QER A;  4I2Q A;  1HYS A;  1BQM A;  4RW7 A;  1TKD A;  1RBT A;  2R7Y A;  3KLI A;  4Y1C A;  4M3Y A;  4NYF A;  2NUB A;  4JS5 A;  4LSL A;  1VSJ A;  2QK9 A;  1BHL A;  4IFY A;  1X9M A;  3FFI A;  3QEV A;  2X6S A;  3AA4 A;  4KRE A;  1RDA A;  1DLO A;  2RKI A;  3JSM A;  5KRS A;  4TSX A;  4F2S A;  1L3S A;  2FC0 A;  3AO2 A;  1WSH A;  4N41 A;  3LP0 A;  2XRI A;  2YKN A;  1L5U A;  3H08 A;  4O5B A;  3T19 A;  2RPI A;  1BGX T;  5KI6 A;  1CLQ A;  3O4Q A;  1RTI A;  3SQ4 A;  4OJR A;  3VQC A;  4JS4 A;  1TK5 A;  4CGG A;  2KFZ A;  4HCB A;  1T8E A;  1JLB A;  4FJ7 A;  3K58 A;  4FJH A;  3AA5 X;  2GBZ A;  4ZHR A;  3RTV A;  4B9L A;  1L3T A;  3V1O A;  5T7B A;  3LDS A;  3OYB A;  3HL8 A;  3KD5 E;  3AO4 A;  3DOL A;  3HVT A;  3AVB A;  4CEZ A;  1QTM A;  3MXJ A;  3MXI A;  2P51 A;  4CJL A;  5KRT A;  4JLH A;  2F96 A;  1RTJ A;  1VSE A;  2IC3 A;  3S3O A;  1CZ9 A;  5J2Q A;  4PQU A;  1C1A A;  3VN5 A;  4FJJ A;  1TKX A;  4JRP A;  1T03 A;  5FRM A;  4M3R A;  3TAE A;  2E6L A;  1XHX A;  1XI1 A;  2OPR A;  4CER A;  4B08 A;  4NYN A;  4OGC A;  3O3F A;  1LV5 A;  4B9M A;  4FK2 A;  2HVI A;  2EHG A;  3OYJ A;  3AVG A;  4W5O A;  1C1C A;  3P1G A;  4CJQ A;  3AA2 A;  4L8R B;  1N5Y A;  4CJV A;  4CHY A;  3O4N A;  4PA1 A;  2G8F A;  1YTA A;  5FRN A;  4CJF A;  3OS2 A;  4FYD A;  4HVJ A;  3K57 A;  2VWK A;  2FBX A;  3S3M A;  1Q9Y A;  4CF0 A;  1NK7 A;  1RBR A;  4KB1 A;  1HQU A;  3ZSX A;  2KW4 A;  4CK2 A;  3SUQ A;  2OYQ A;  1GOB A;  2WON A;  3SNN A;  3L2U A;  1WSE A;  1JXE A;  4CFB A;  1F21 A;  4BDY A;  3MED A;  4FW1 A;  1ZBU A;  4NCG A;  4YNQ A;  4N5S A;  3K5M A;  3QEI A;  3SUN A;  4IG0 A;  3G10 A;  1EKE A;  3OJS A;  2XY5 A;  4B9V A;  3AV9 A;  3ZSQ A;  3K5O A;  2GV9 A;  2DFH A;  4ID1 A;  4LH5 A;  2VWJ A;  2GUI A;  3SJJ A;  5K14 A;  4CEA A;  4CJK A;  3OYM A;  4R5P A;  3D45 A;  4C8L A;  4J2D A;  4KHU A;  5SZT A;  4H4O A;  4ID5 A;  3SI6 A;  1VSD A;  3QO9 A;  2F8S A;  1BQN A;  5KGW A;  4E7H A;  2OPQ A;  1WAJ A;  4N56 A;  2BGG A;  4J2B A;  4FJ8 A;  4FJI A;  3HPG A;  4RW8 A;  1YTU A;  2HND A;  1S9G A;  3ZSR A;  1I3A A;  1VSI A;  3DOK A;  1HNV A;  1TL1 A;  3PX0 A;  1C0T A;  1A5V A;  1A5W A;  3RMA A;  4C8K A;  4DU1 A;  3RR8 A;  4ELU A;  2D0B A;  4DS5 A;  1SUQ A;  3DYA A;  4IKF A;  4CIG A;  1D9D A;  2BDP A;  4FLZ A;  4DSE A;  3T3F A;  3AVM A;  1UWB A;  4Z4F A;  1S1T A;  1KVC A;  1UAX A;  4CEE A;  4DQP A;  4FJK A;  4FLY A;  3AVN A;  4W5T A;  3NH0 A;  1C0M A;  4AHT A;  5HLF A;  2D0C A;  3VQ9 A;  2IAJ A;  4CFA A;  5SWM A;  1KFS A;  1ZBI A;  3RRG A;  4FJ5 A;  4IDK A;  1S1W A;  3DLK A;  4CJ4 A;  4PWD A;  2HHX A;  3VQA A;  4H8K A;  1FKP A;  1JLF A;  4E0D A;  1GOA A;  1K6Y A;  4KO0 A;  3VQB A;  4YFU A;  1SKS A;  5CYQ A;  3LP1 A;  3VQQ A;  3QIN A;  4PY5 A;  4CGH A;  1JLE A;  3MXM A;  5HRP A;  1ZBF A;  3PV8 A;  1B92 A;  2HB5 A;  1XHZ A;  2HW3 A;  1BI4 A;  3SQ1 A;  3V9X A;  4ZTF A;  1DTQ A;  3V9S A;  1D5A A;  3ZT2 A;  1TAQ A;  3QES A;  4AHV A;  4DLG A;  3L2W A;  2HHS A;  2B4J A;  4O0J A;  3G0Z A;  2HHV A;  1YT3 A;  1QSL A;  3OYD A;  4BE0 A;  4FJL A;  3WNE A;  3NAE A;  2XO7 A;  4AHS A;  3DRS A;  4O44 A;  1WN7 A;  1LWC A;  4RW6 A;  4DMN A;  3KIO A;  1Z25 A;  3SPZ A;  4FLU A;  2OA8 A;  1IG9 A;  3PUF A;  3HP9 A;  1RT3 A;  3EYZ A;  3NGI A;  4EZ9 A;  2HNY A;  2G8U A;  1NJW A;  4FK0 A;  3VQE A;  1RIL A;  2B5J A;  3QLH A;  4CEC A;  1Z26 A;  4BWM A;  4DTO A;  2HHQ A;  3SCX A;  1KLN A;  3IAY A;  3DRR A;  3ISN C;  3AVL A;  3HPH A;  2VG6 A;  4E7I A;  2G8V A;  4E3S A;  1HPZ A;  1ZYQ A;  2KZZ A;  3TAB A;  4EP4 A;  3I8D A;  4CJT A;  1HMV A;  2P5G A;  4WE1 A;  2A1S A;  4FJM A;  4W5N A;  3EZ5 A;  3V9W A;  3TAP A;  2HHU A;  2DFF A;  3V6D A;  1KRP A;  2ETJ A;  4FLT A;  3KTQ A;  3PO4 A;  5E41 A;  3C94 A;  1MU2 A;  1LAW A;  1WAF A;  1KSP A;  2HHT A;  1RTH A;  3MEC A;  3KD1 E;  3O3G A;  5HP1 A;  1IKX A;  4E19 A;  4CHZ A;  4ZTJ A;  3NE6 A;  3HO1 A;  4LY7 A;  4C8O A;  3SYZ A;  2LSN A;  3L3V A;  3ULD A;  4DTM A;  2XY6 A;  4KAZ A;  3NF8 A;  3LP3 A;  4MFB A;  1LW0 A;  1RT7 A;  3VQP A;  1S6Q A;  3DLE A;  3NFA A;  3KLE A;  4HTU A;  2KTQ A;  4Z0U A;  1FXX A;  1KVB A;  2QKB A;  1S5J A;  1U04 A;  4O4G A;  1DTT A;  3O3H A;  1VSK A;  3RMD A;  1NJX A;  1UOC A;  4M3Z A;  4QOZ B;  3V1R A;  3OYG A;  3I0S A;  2D5R A;  3ALY A;  1NK0 A;  2AJQ A;  3CFO A;  1TK0 A;  4BDZ A;  4EZ6 A;  4M41 A;  3CM6 A;  3L8B A;  3WNG A;  4FM2 A;  4QAG A;  3V4I A;  1XC9 A;  4M3T A;  2Z1I A;  3HJF A;  2IS3 A;  4E1N A;  4Q0B A;  3SUO A;  4B8C A;  3TI0 A;  4DTP A;  4F2R A;  4KHW A;  4OPK A;  5I3U A;  3M8S A;  4HCC A;  1RT6 A;  3NGZ A;  1EX4 A;  2G8H A;  4HUG A;  1QQC A;  3VQ7 A;  2X6N A;  2FBV A;  2A1R A;  3RR7 A;  2DTU A;  3BDP A;  4KHQ A;  5J1E A;  3L2R A;  4KHS A;  2E4L A;  3L2Q A;  3CQ8 A;  5C42 A;  4KPY A;  4M3X A;  4KHY A;  4GVM A;  1BCO A;  1IKV A;  1SL0 A;  2Q3S A;  2ATQ A;  1RT2 A;  4I7F A;  4FW2 A;  1S6P A;  4DF8 A;  3U6F A;  1VRT A;  3P83 D;  1NKE A;  3KKR A;  3LWM A;  1S1V A;  2XHB A;  1QS4 A;  5KGX A;  1KTQ A;  4KRF A;  1TVR A;  1B9D A;  1HYV A;  4M45 A;  1NKC A;  1S1U A;  1X1P A;  3DM2 A;  4E89 A;  4DTU A;  2HNZ A;  4CED A;  2W42 A;  4HHT A;  4DG1 A;  3NH2 A;  3C6U A;  3LP2 A;  4Z4G A;  4CEO A;  1ZBL A;  2FBY A;  3KK2 A;  4CJP A;  1Q9X A;  4C8N A;  1NK8 A;  4F4K A;  1J53 A;  1SV5 A;  3AVH A;  3IG1 A;  3ZSO A;  3HK2 A;  4FXD A;  1BCM A;  3S9H A;  3LAM A;  1L3V A;  4N47 A;  2WOM A;  4HUE A;  3AVF A;  3HYF A;  1VSH A;  2ZE2 A;  3JYT A;  2VG7 A;  4MQ3 A;  4DSK A;  1RBU A;  3OYK A;  4KV8 A;  3V81 A;  1NK6 A;  4CF9 A;  4FM0 A;  4CGD A;  2IDO A;  3RMC A;  1RT4 A;  3SPY A;  1D9F A;  4FJN A;  1SKW A;  3OYA A;  4E1M A;  4FLX A;  2E6M A;  3DLR A;  3ZSV A;  4OGE A;  1GOC A;  1HNI A;  1WLJ A;  3WNH A;  2PY5 A;  5CYM A;  4Z4H A;  1J5O A;  4KTQ A;  1JXB A;  1A5X A;  5JS2 A;  5J2P A;  1BIS A;  5FDL A;  1U47 A;  1G15 A;  1JLC A;  3V9Z A;  4DU3 A;  1RDD A;  4RW4 A;  3TAG A;  3TAR A;  2BAN A;  4FK4 A;  2YV0 X;  3SUP A;  4ELV A;  1XWL A;  1SKR A;  4DFJ A;  3OYF A;  4NCB A;  3UIQ A;  4CCH A;  4FCY A;  4OKE A;  5C25 A;  1J9A A;  3LAL A;  1TGO A;  3HP6 A;  4BE2 A;  3NGY A;  4BE1 A;  1TK8 A;  2PYL A;  4OLA A;  1U49 A;  2ITG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...