4CHYA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 54
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4chyA00
1N6QA 3ISNC 5KRSA 2AJQA 3QETA 4N76A 3K5OA 1Z25A 3JYTA 3SCXA 1ITGA 3OVNA 1S6QA 4GMJB 1HNIA 3QIOA 3M8RA 1IKWA 3V4IA 3JSMA 4BDYA 1ASWA 4HVJA 1SUQA 2YNFA 1QSSA 3TAPA 1S1TA 1ZBIA 4EZ6A 3NCIA 4GW6A 2QXFA 3OJUA 4Z4GA 1L3SA 4KHQA 2P5GA 4B9MA 2GV9A 4BDZA 1S1VA 3C95A 3QEIA 4FLYA 4CEBA 2E4LA 4HUGA 4FLWA 3MXJA 3ZT2A 3ZT3A 4CJPA 3SZ2A 3PX4A 3SQ2A 4KRFA 1XHXA 4Z4HA 4AHVA 4CEOA 4QCLA 5CYQA 3FFIA 4LY7A 1Q9XA 1KVCA 3D0PA 1A5WA 1T03A 5C42A 1X9WA 1RBRA 4CEDA 2HVIA 3OYNA 4KB1A 2FBYA 3M8SA 3LWMA 3RMDA 1NKEA 1RTIA 3IAYA 4BWJA 1GOAA 2PY5A 3T3FA 1NK9A 1W9HA 3OYKA 3RTVA 1RBUA 1UWBA 4DFPA 3L8BA 3ZT1A 3NH0A 4CECA 4ICLA 4O0IA 3L2WA 2QK9A 3KD5E 4FJIA 3AVIA 2BGGA 4IBNA 4OPJA 4O5BA 1KVAA 3VQ9A 3HPGA 3ZSRA 1SKWA 3OY9A 4RW4A 4DQIA 2KZZA 5J1EA 3AVNA 4PY5A 3NH2A 2KFNA 5JS2A 3HK2A 1C1AA 2KTQA 4KKOA 4OPKA 1JLEA 5HRNA 1IKYA 3E01A 2YKMA 1NK5A 4M3TA 1HPZA 1VRUA 2GUIA 4CJ5A 1BL3A 4Q5VA 3NF7A 3OJSA 3AO3A 3T1AA 4E7JA 3O3GA 3TARA 1YTAA 3AO1A 3LP1A 3OYLA 3PX6A 5FROA 3KLHA 3AVLA 4N5SA 4KB0A 1HYZA 3DM2A 1D9DA 4AHSA 4B9NA 1VSLA 2X78A 4I2QA 3L2QA 1LWFA 4CJFA 4CJRA 5J2QA 3TABA 1HNVA 2HMIA 2FC0A 1YVUA 3TAMA 3DRSA 4KI4A 3TR8A 5C25A 4FJ7A 1BI4A 2VG6A 3LAMA 2NUBA 5SWMA 4KV8A 1WSEA 4E3SA 3VQPA 3B6PA 3CG7A 3RR7A 4HUEA 4DTXA 3KIOA 3CQ8A 1QHTA 4KAZA 1B9FA 4E7IA 1T05A 1VSJA 1BCMA 1TL1A 1HRHA 3OYIA 3QNOA 4I9QA 4FLZA 4EP5A 3SV3A 3AVMA 5DK5A 1I3AA 1QE1A 1B9DA 5EU7A 3VQAA 3KK2A 1RT1A 3IG1A 5CYMA 4BE2A 4KHUA 4B9SA 3PV8A 3SUOA 4FJJA 1LV5A 2IOCA 1NJWA 4CEQA 4DLGA 2X6SA 1VK0A 4FLVA 1U45A 3HPHA 4YFUA 4DSIA 2Z1JA 3ZSVA 1S1UA 3KJVA 4NCAA 1IH7A 3AVBA 4FLXA 1BGXT 4OVLA 3VN5A 4CGJA 4W5RA 1X9MA 2RPIA 2P51A 4I9LA 3OYGA 4FJGA 3B6OA 2O4IA 3ZSZA 4IG3A 1Y97A 3OS0A 1RT7A 3RMCA 4FJNA 1HYVA 1JLCA 4LSNA 3UIQA 1HQUA 4DS5A 1KLNA 4W5NA 1ZYQA 3KLIA 4OGCA 4E7KA 4B9TA 4CJEA 4DTUA 1VSEA 1TKDA 1RTHA 4CFAA 3ZT0A 4OLAA 1N5YA 3QIPA 3ZT4A 4FW2A 4JS4A 1NK6A 1UAXA 1HJRA 3KK3A 1BHLA 1KFSA 4Z4IA 3LZIA 3AO4A 2W42A 4FZYA 4R5PA 3OYHA 3DLEA 4AILC 4FJ8A 2IGIA 5FRMA 1DTTA 1TAUA 2WOMA 3LP0A 4CJTA 5HLFA 5JS1A 1BQMA 1WNSA 2VWKA 2ZD1A 1WLJA 3LALA 4DTRA 1C1BA 4CHQA 1A5XA 5KGWA 2G8VA 4ELVA 4CE9A 1VSHA 4J2AA 2HNYA 2RF2A 1JLFA 4Z4EA 3VQCA 3VQQA 1RILA 4Z4CA 2HVHA 3CM6A 4RW6A 4FJ5A 4JLHA 3EYZA 5E41A 2B4JA 4M3UA 3SUQA 4B3OA 1KSPA 5CY4A 3CFOA 3NAEA 2A1RA 5J2MA 4FW1A 3KD1E 4I7FA 2D5RA 3G0ZA 4KO0A 1S5JA 3DLBA 4OKKA 4CJWA 4CJLA 4CGGA 3V6DA 4CHZA 3AA2A 4CJVA 3SNNA 1RNHA 3DLRA 3QNNA 1JXEA 4CFDA 2O4GA 3RRHA 3VQ4A 2X6NA 3DLHA 4FJMA 2OPPA 4Q0BA 2DFFA 1EX4A 3DLKA 2VWJA 2D0CA 4DTJA 4DU3A 4KFBA 4YNQA 1X1PA 1U48A 3SQ0A 1UOCA 2ZE2A 1WN7A 1K6YA 3LAKA 1FK9A 4CF8A 1A5VA 1SV5A 3IS9A 3OYAA 4PQUA 1HYSA 4F2SA 2OPSA 4KHNA 4DTOA 1RT5A 3T19A 4O4GA 5K14A 3LDSA 3OYCA 2OZSA 2DFEA 1LWCA 1VSIA 3AO5A 2G8UA 5FDLA 4FZXC 1C6VA 5I42A 1J53A 4DSLA 1CLQA 3RMBA 1BIUA 4DTPA 2G8IA 3KKSA 2WONA 4F3OA 4B8CA 3DOLA 5CZ1A 3QEXA 1RTJA 1JLAA 2OYQA 4KPYA 2HHWA 4C8OA 1RTDA 3TAQA 1EETA 1HMVA 3NGZA 3VQ7A 2QKKA 4HHTA 4DTSA 3P5JA 3V1QA 2RKIA 3K5MA 5CZ2A 3ULDA 1GOCA 1JL1A 3SPYA 3NBPA 1FKPA 2VG5A 3NF8A 4CJUA 1WAJA 3QLHA 1LW0A 4NYFA 4QAGA 4CF9A 3WNEA 1J9AA 4FM1A 3NGIA 4B9UA 1TKXA 3SJJA 4O0JA 4DQQA 3DRPA 2VG7A 4E1MA 4B08A 4NCBA 4NYNA 1RBSA 3KLFA 1C0UA 2HW3A 3BDPA 1TK8A 4C8LA 4CHPA 3RMAA 3KTQA 3LZJA 3HO1A 4F3TA 1RBVA 2YKNA 4OJRA 3MECA 4C8KA 3LPUA 3SQ1A 2Y1IA 4M3RA 3V9ZA 1CXQA 1ASUA 2G8WA 1NK0A 4CEEA 3AVGA 3LP2A 3HVTA 3NFAA 1L3TA 3ZSXA 3AVKA 2IDOA 4N47A 3VA3A 1ZBLA 3CM5A 1TAQA 4KTZA 3AA4A 3HP6A 2HB5A 1NK7A 3PY8A 1WSGA 4E19A 2E6MA 3K57A 3KKRA 4RG8A 3PX0A 2ATQA 3AO2A 4H4OA 2RN2A 3V1RA 1D8YA 4DSJA 1MU2A 1S6PA 3EY1A 4ID5A 5D3GA 3M8PA 5J2PA 1KLMA 4ELUA 4H4MA 4CJKA 2FBTA 3HP9A 2A1SA 4H8KA 3NHGA 4DF4A 4FM0A 1S9GA 1QS4A 3QO9A 4DFJA 1C0MA 4AH9A 3AVJA 2Z1IA 5J2NA 2IAJA 4M45A 4CK2A 4KHWA 2HNDA 1RCHA 2OZMA 2KW4A 3V9WA 3OYEA 1TGOA 4IFYA 1BQNA 1NKBA 4O55A 4K8XA 1UA1A 2OA8A 4CESA 3QINA 4OKJA 4CGFA 4DWIA 1S1WA 4OLBA 4OKEA 4M3XA 3U6FA 4C8NA 2HHXA 3V81A 1RDCA 3BGRA 4CGIA 3WNHA 1NKCA 2PYJA 2G8KA 4W5QA 3OYDA 2P5OA 1LWEA 1CZBA 4GVMA 3LP3A 2YHBA 4CFBA 4CEAA 1KVBA 3I0RA 4M42A 1UA0A 4F8RA 2YV0X 4CHNA 1Q8IA 2EX3A 2R7YA 1JLQA 1LAVA 2P1JA 4JS5A 1RT6A 3ASMA 1RT4A 4CK3A 4FM2A 1XHZA 1U49A 1BI4B 1TKZA 2DFHA 5DMRA 4BE1A 3TAEA 4KTQA 3AVHA 3L2UA 1KTQA 1Q9YA 4FJXA 3EZ5A 3QEPA 2BDPA 2QKBA 4N41A 1U47A 1BCOA 3TAFA 4DG1A 4CHYA 2KQ2A 5HRSA 4CCHA 2IC3A 2HHQA 3QERA 2OPRA 3LWLA 4KHSA 4FXDA 4O44A 4J2DA 4ZTFA 1FXXA 1IKVA 3MEDA 3OYBA 1TK5A 2G8FA 1KCFA 1ZBHA 1IO2A 3WNGA 3HVRA 1T8EA 3DOKA 4CFCA 1WSFA 4DMNA 1SKSA 4N56A 4M3YA 5KI6A 3DYAA 4BDPA 4AHTA 1REVA 3HSTB 4K8ZA 3ZSYA 3HT3A 5HP1A 1SKRA 4HCBA 3AVFA 1NOYA 3U3YA 4HTUA 1TL3A 4DTNA 3QEWA 3SUNA 4E0DA 4C8MA 3OYMA 3I8DA 1BISA 4DTMA 4JRQA 2X74A 5I3UA 2ETJA 5HRRA 3VQEA 1WSIA 4AHUA 4AHRA 3WNFA 4DLEA 1XC9A 2PZSA 3F9KA 4OGEA 2JGUA 1YTUA 4LH5A 1GOBA 2LSNA 3NH1A 3L2VA 4CGHA 4EP4A 3OYFA 4HUFA 4DFMA 4F4KA 1LAWA 4RW7A 2OPQA 1EP4A 3HL8A 1W0HA 2XRIA 4ELTA 3MEGA 1J54A 1FKOA 1RDDA 3K2PA 3C6UA 1HQEA 1L5UA 4FVMA 3S3OA 1KFDA 1VRTA 2YNGA 3CFPA 1O1WA 4B9VA 1JKHA 4ID1A 1LW2A 1QSYA 4B9LA 2EHGA 2HHUA 5KRTA 3PO5A 4KI6A 3K58A 4Y1CA 5HROA 4DQRA 3KLEA 3KK1A 2B6AA 2I5JA 4CF0A 3MXMA 5T7BA 2XY6A 2F8TA 4CJ3A 3S3MA 1NJZA 2HHVA 2DY4A 1RDAA 1S1XA 1RDBA 4DSKA 1B92A 3HXMA 3VQ5A 4XIUA 3V9XA 2XY8A 2D0AA 1ASVA 1JLBA 4LSLA 4M41A 4IKFA 1EKEA 1T7PA 2XO7A 1WSHA 4DSEA 1XI1A 4FK4A 4CF2A 2F8SA 3V9SA 3DMJA 3HPOA 1VSDA 2YNIA 3C6TA 4CGDA 4J2EA 5HRPA 2IS3A 1R0AA 4DFKA 1QSLA 1SL0A 4BWMA 4CEFA 3O4QA 1RT2A 1U04A 4FJKA 4FJ9A 3SI6A 3S3NA 1ZBFA 1F21A 3PUFA 4KHYA 4Z0UA 4FK0A 3VA0A 3RR8A 4LD0A 1NJXA 3U3GA 4CJSA 2D0BA 3NGYA 3LANA 4IG0A 4ZHRA 3O4NA 1D9FA 2XY5A 4E1NA 4DQSA 3OS2A 1J5OA 3ZSQA 3A2FA 4E7LA 2YNHA 3OS1A 5HBMA 4W5OA 1L3VA 2G8HA 4M3WA 2BANA 3AVCA 4NCGA 4DF8A 2Y1JA 3MXIA 3H08A 2FBVA 3V1OA 4TSXA 5SZTA 4IDKA 3ITHA 1NJYA 1G15A 3VQBA 4FYDA 3TANA 3SPZA 1JLGA 2GBZA 3NE6A 4ZTJA 3L3VA 3NF6A 2HHTA 3AV9A 2FBXA 3C94A 3ZSOA 2HNZA 3DLGA 4L8RB 4Z4FA 1RT3A 3I0SA 3MAQA 3L2RA 4DQPA 4DU4A 3NF9A 2B5JA 3AA5X 4AHCA 4FLUA 2KFZA 3L3UA 1JXBA 5KGXA 3IRXA 3VQ8A 4G1QA 1BIZA 3K59A 4CK1A 4FLTA 3LPTA 3ZCMA 2XY7A 1I39A 4I2PA 1EXQA 1CZ9A 2PYLA 1YT3A 4BACA 4FK2A 3F73A 1IKXA 3HM9A 4J2BA 4RW8A 1ZBUA 1NK4A 1QTMA 1IG9A 3SYZA 2Z1HA 3SUPA 4M3ZA 3DI6A 1NK8A 1RBTA 2F96A 3TWHA 3TAGA 4KREA 1L3UA 4JRPA 4PUOA 4FCYA 4CHOA 4DS4A 3RRGA 3KLGA 1CXUA 3HYFA 2YHAA 1KRPA 4MQ3A 4B8AB 4Y1DA 3O3FA 4BE0A 2HHSA 4PWDA 4EZ9A 4CIGA 2XHBA 3P1GA 4IFVA 5C24A 3O3HA 4F2RA 3V9UA 3M8QA 2KZMA 4UQGA 4E7HA 3HJFA 2Z1GA 4KTWA 4FZZA 1VSFA 3P83D 4CJ4A 4CEZA 1X9SA 1TK0A 1VSKA 1XWLA 4DSFA 1SL1A 4HCCA 3ALYA 4CERA 4QOZB 2JLEA 4LH4A 2BE2A 1SL2A 2DTUA 3VQ6A 1VSMA 4MFBA 2ZQBA 1TKTA 4WE1A 4PA1A 3SV4A 1WAFA 3DRRA 1JL2A 5KTQA 1DTQA 4E89A 1Z26A 3VQDA 3K5NA 3TI0A 3THVA 4DU1A 4CJQA 3CYMA 3QESA 1U4BA 3NDKA 1C0TA 3QEVA 3MEEA 1S9EA 4W5TA 3AVAA 2ITGA 1D5AA 1DLOA 2E6LA 4CF1A 4CIFA 4FJHA 3AA3A 5FRNA 3G10A 4RW9A 3SQ4A 3RWUA 1WSJA 1QQCA 3CFRA 1TV6A 4CIEA 1TVRA 3D45A 3K5LA 3S9HA 3PO4A 4FJLA 3OYJA 3ZSWA 1NOZA 1C1CA 2Q3SA
chains in the Genus database with same CATH superfamily
1N6QA 4RWTA 1XC3A 2OTJN 4GMJB 1HNIA 3QIOA 1SUQA 2YNFA 1QSSA 4Z4GA 2O8BA 2P5GA 4BDZA 3HBTA 3QEIA 4CEBA 4HUGA 1FJGK 2NLXA 4CJPA 4LF9K 3C0BA 4KRFA 2ZJPL 4IJAA 4LY7A 1VAZA 1V4TA 1A5WA 1HJOA 1RBRA 4KB1A 2FBYA 3M8SA 3LWMA 1RTIA 4BWJA 3T3FA 4OO1J 3A5MC 4BY9C 2UXCK 3L8BA 2QK9A 5AQVA 3KD5E 4FJIA 5AZIB 1YJNN 4OPJA 4GNIA 1MWKA 2OTLN 3FLCO 4A61A 2KFNA 3HK2A 1C1AA 1VHXA 5HRNA 1W2BM 4M3TA 3FZKA 1YIJN 3T1HK 3OJSA 3AO3A 5FPMA 3KLHA 3D2FB 2JWKA 5AQNA 2GWKA 4CJ7A 3TABA 3CPEA 2HMIA 1YVUA 3O1WA 2YCHA 3P38A 3DRSA 4KI4A 3TR8A 5C25A 3O9RA 2VG6A 3LAMA 2NUBA 5SWMA 4KV8A 4B1YB 4C1NI 3KIOA 1B9FA 5EXWA 3QB0A 2YJFA 5EU7A 3ZX3A 1BO5O 2IOCA 1VK0A 3HPHA 5JMVA 3ZSVA 4IJNA 3ATUA 1S1UA 4NCAA 3MN7A 4FLXA 3ULEB 4W5RA 3VN5A 3MX2A 4CGJA 2RPIA 2IVPA 4JKGB 2O4IA 3SMPA 3N4PA 4CZEA 1HYVA 5A2QO 3THYB 4WQ5C 4W5NA 1D4XA 4M7XA 4OLAA 1N5YA 3DXMB 3ZT4A 1YHQN 1UAXA 4WQ4A 1BHLA 1T6DA 5AQFA 3TSUA 5C2DA 3KK3A 1KFSA 3LZIA 3O08A 3DLEA 1KC8O 5FRMA 1TAUA 3LP0A 3DAWA 2G8VA 4ELVA 4CE9A 1VSHA 5E84A 3VQCA 4RW6A 4JLHA 3EYZA 2B4JA 1T44A 1K8AO 5CY4A 3PSFA 3KD1E 1TUYA 3A5LC 4I7FA 2D5RA 4KO0A 4CBXA 4CGGA 4CHZA 3QFPA 4JKFA 2A40A 4EFHA 2O4GA 4ILHA 3VQ4A 2X6NA 3H3NO 4H0YB 3DLLL 4LFBK 5C0YA 4Q0BA 1IBLK 1EX4A 5AQWA 5BRDA 4YNQA 2VQEK 1U48A 3LAKA 3HOTA 3SBTA 4BROA 2P9IA 3AY9A 3THXB 1VSIA 4DR3K 2VYPA 1C6VA 1J53A 1BA1A 1SZ2A 2WONA 5IWAK 4F3OA 3QEXA 1JLAA 4H03B 4C8OA 1RTDA 4LF4K 3UKRA 2D0PA 3V1QA 1YAGA 1GLEG 2UUAK 1HKBA 3QFUA 3I56N 1GOCA 3SPYA 3NF8A 4CJUA 2A5XA 4NYFA 5AQTA 2NRHA 4QAGA 4LC9B 4B9UA 3S41A 2I7PA 3DRPA 4E1MA 4NCBA 4C8KA 1CXQA 4CVNE 4CEEA 4CZFA 5LY3A 1VQ6N 1VQKN 3SJHA 3AVKA 3SAGA 3BZKA 4BC2A 3HP6A 2YHXA 3AA4A 5KPTA 2HB5A 3PY8A 3K57A 4RG8A 3PX0A 3AO2A 2RHKA 2WTUA 1HR0K 3M8PA 4H4MA 2FBTA 4IEIA 4BR5A 3NHGA 4DF4A 3VF6A 4FM0A 4WYBA 3AVJA 5J2NA 2IAJA 4M45A 1RCHA 4FWSA 4GV3A 2Q97A 3OYEA 2HF3A 1NKBA 4O55A 3R6MA 3QINA 4OKJA 2EWSA 3TTFA 2D1KA 1MA9B 4CZIA 3BGRA 1NKCA 2O8DB 1KXPA 1LWEA 2YHBA 4JYAK 4M42A 1KVBA 3I0RA 4CHNA 5FPDA 2EX3A 3GOIA 4JI6K 1JLQA 3CCSN 1JJ2M 4CK3A 4A2AA 5BRFA 3TAEA 3GE1A 1NGJA 2QKBA 5HRSA 2FSKA 3QERA 3C7NA 4FXDA 4O44A 1FXXA 5BN9A 5I9EB 2V52B 3U9DA 3WNGA 3OA9A 4R79A 4WFBL 4BRQA 2E2QA 4DMNA 1REVA 4DTNA 4DV3K 4KHPK 1BISA 5H1SQ 5HRRA 4AHUA 1WSIA 2ZGZA 2HHXA 5JVGL 3F9KA 2JGUA 1YTUA 4MDAA 3NH1A 2LSNA 1NGEA 3LDOA 4BRGA 3GBTA 1FKOA 2A6AA 1RDDA 2QWLA 4FPBA 5CE3A 3ID8A 1KFDA 1VRTA 3CFPA 4AF1A 5JLHA 5GAHP 3OHRA 4F9OA 3H46O 3TU5A 3KLEA 5T7BA 2XY6A 1K8KB 2W40A 2E88A 1RDAA 3VMFB 3VQ5A 1HNZK 2XY8A 2YHYA 3E1YA 3VPZA 4LSLA 2E5LK 4MLEA 4YHHK 4DV6K 3LM2A 4U67L 1WSHA 2KHOA 1XI1A 4FK4A 4IO8A 2F8SA 1VSDA 1QQNA 4CGDA 5HRPA 1NG9A 5MLCQ 3O4QA 1SS6A 3PLAA 4FSVA 1S3XA 1ATNA 3U3GA 3LANA 1D9FA 4E1NA 3D7EO 3OS2A 4E7LA 2YNHA 4CZMA 4M3WA 4IZ9A 3AVCA 4NCGA 4DV5K 4DV1K 3WEEA 3H08A 4C23A 4TSXA 5SZTA 4B3SK 1XUPO 3ITHA 2WFBA 3TANA 3FGUA 3NF6A 2HHTA 3EL2A 2FBXA 4L8RB 1WOQA 4DU4A 4H0OA 1VQ9N 4FLUA 2YX6A 3IRXA 3K59A 4CK1A 3CJCA 4FLTA 2GUPA 3LPTA 4DUYK 2PYLA 1YT3A 4FK2A 2GELA 3CJ9A 1X3MA 1N32K 1IG9A 3SYZA 1NK8A 4K41A 4KREA 3TAGA 4PUOA 4PL7A 4JKAA 3RRGA 1CXUA 5LMUK 2YHAA 4Y0WA 1KRPA 1BUPA 4BR2A 1ZBSA 5AQHA 5AFUH 2HHSA 4KH4A 3WXLA 1RFQA 4BC5A 2XHBA 5C24A 4B1ZA 3M8QA 3G25A 4UQGA 5GIPA 4E7HA 2Z1GA 4KTWA 5ADXH 1KAZA 3SAFA 3FR0A 5AQOA 2ZM6K 3E9PA 4CERA 4ISEA 1ATRA 3VQ6A 4CZGA 1TKTA 2VGNA 4WE1A 3SV4A 1WAFA 1OKJA 3R1XA 3JAMO 1DTQA 3THWA 3VQDA 1OVQA 3TI0A 2KKZA 3CYMA 5AQYA 1C0TA 4W5TA 1N33K 5M1NA 3CCRN 1D5AA 2E6LA 2D4WA 4ILJA 4BRMA 3RWUA 4JK8A 1TVRA 3D45A 3S9HA 4OX9K 1NOZA 1NGCA 4KH6A 2HF4A 3ISNC 3QETA 2E2PA 3K5OA 3JYTA 3V4IA 5C10A 4HVJA 2ITMA 4B3RK 1VQ5N 2Q31A 1H1VA 4GW6A 4YDUC 4KHQA 2GV9A 3P39A 4GV6A 4G9ZA 3C95A 3SLCA 4JNEA 4FWOA 1HNWK 4QS9A 3PX4A 3SQ2A 3BEXA 2NRVA 1XHXA 4CEOA 5CYQA 3FFIA 1Q9XA 4H5WA 1T03A 4CEDA 1TYQB 1UWBA 4BRHA 3A8YA 4CECA 3DJCA 4O0IA 2GEMA 1LCUA 3EKSA 4PHTX 1KVAA 4JI4K 4H0PA 3A5NC 3AVNA 2CGKA 3O9QA 2VCPA 4JN4A 4YOWA 4OPKA 1IKYA 1NGHA 2IVOA 1N8RO 1VRUA 4Q5VA 3NF7A 4E7JA 1LOTB 3O3GA 1QVFM 1Z6RA 2P9LB 3VETA 4N5SA 1MWMA 3ENHA 1ZXOA 4B9NA 1VSLA 2X78A 4IOCL 4JKCA 3L6QA 2FC0A 3ZLJA 3TAMA 4DB3A 4DR7K 2QEXN 2P9KA 3DWLA 1VQNN 5KQ8A 1BI4A 3IUCA 4CZJA 3VQPA 1QHTA 4JKEA 4KAZA 1KD1O 1GLJO 1HRHA 4IDHA 3MWTA 3SV3A 3AVMA 4BE2A 3QMLA 3VQAA 5CYMA 4B9SA 1LV5A 4DLGA 5C2FA 4YFUA 4DSIA 4DCHA 5F1XA 5FPEA 3C65A 1HPMA 3KJVA 3PIPL 3B6OA 5AQKA 4IG3A 3EE8A 1RT7A 5FLXO 3RMCA 4LF8K 4AQYK 1JLCA 4DR2K 4LSNA 1ZYQA 4B9TA 3KVGA 4CJEA 1TKDA 3ZT0A 4FW2A 3AO4A 2W42A 3OYHA 4JD2B 2IGIA 4B1VA 1BQMA 4LFAK 2VWBA 1C1BA 3O6WA 4JI7K 1A5XA 1JLFA 3VQQA 1RILA 3FZFA 3CM6A 1N36K 1U2VB 4FJ5A 1MDUB 1QZ6A 5C15A 3SUQA 4B3OA 5BN8A 5J2MA 3O9TA 3G0ZA 4CBUA 5B8HA 3V6DA 1WBDA 3CJAA 3FZMA 1FW6A 3DLHA 4E1JA 2D0CA 4DU3A 4B3MK 3CC7N 4I6MA 1K6YA 4BREA 3F9MA 1A5VA 4B9QA 1HYSA 2OPSA 3MWPA 4DTOA 1NMDA 1RT5A 5HOOA 5K14A 3LDSA 5KPRA 3T1YK 2G8UA 4FZXC 4DSLA 1CLQA 2G8IA 5F2RA 3KKSA 3UKUA 2OYQA 4KPYA 4JHDA 4KBOA 5M1OA 3C6HA 1HMVA 3D2FA 4A5BA 3NGZA 3VQ7A 2QKKA 4JAXA 4HHTA 2ZJRL 4DTSA 5AQQA 1S22A 3K5MA 1JL1A 3CC4N 3QLHA 4RCHA 3JXUA 4DR4K 3NGIA 3SJJA 4O0JA 3CCQN 4XH5A 4DUZK 2O8CA 1C0UA 5E26A 3A0IX 1KQSM 4C8LA 3RMAA 3HO1A 1XQSC 3MECA 3SQ1A 1BG3A 5EY4A 3V9ZA 3O9SA 3AVGA 3AGRA 2V51B 1L3TA 3VA3A 4N47A 1JCEA 3CM5A 1NK7A 2E6MA 2HHWA 3KKRA 3MCPA 3V1RA 4H4OA 3SAHA 1D8YA 3ZEUB 1MU2A 1KLMA 4CJKA 2A1SA 4BRDA 4JKGA 4CK2A 4BGAA 3PIOL 1OH8A 1BQNA 3GG4A 3VTHA 3DXKB 4K8XA 4CGFA 3AAPA 2NRZA 4OLBA 3U6FA 3V81A 1RDCA 4IOXA 2AP1A 3F2KA 4QS8A 3ENOA 2CH6A 1GLLO 4CEAA 1YJ9N 2W6KA 1UA0A 2YV0X 1Q8IA 1C0GA 2NZTA 1J5EK 1LAVA 3ASMA 4FM2A 3EN9A 4KTQA 4BE1A 2DFHA 5DMRA 1YJWN 1IBMK 4LFCK 3BP8A 4BR7A 1WUAA 1Q9YA 4N41A 1BCOA 4CCHA 2IC3A 4ISFA 3H3OB 4KHSA 3WXKA 2HBMA 3MX5A 4ZTFA 1TK5A 2G8FA 4O8UA 2P9PB 3TSQA 3HVRA 3CF5L 3VGMA 3DOKA 1WSFA 3OBYA 3HSTB 3CCVN 4DV0K 3HT3A 1SKRA 1NOYA 4E0DA 3U3YA 3SUNA 4FWLA 4C8MA 3HOSA 2X74A 4O8KA 2ETJA 2PZSA 1XC9A 4OGEA 4CI6A 4LH5A 1GOBA 4CGHA 2W41A 4EP4A 5BR8K 4DFMA 4L3QA 3G4SN 2OPQA 2XRIA 1J54A 2I7NA 4DR6K 3K2PA 3NVMA 3C6UA 1HQEA 3VF2A 3S3OA 4BRKA 5AFUA 1E4FT 4ID1A 1QSYA 4B9LA 2EHGA 5KRTA 3PO5A 4KI6A 3E9OA 5AQGA 5AQPA 5ADXA 4DQRA 3WQTA 4CJ3A 3QDKA 2YI1A 1S1XA 3VEZA 4DSKA 4XIUA 3ZETA 4BVPA 1JLBA 3EZWA 4M41A 3WQUA 4A62A 4X65K 4X64K 2FF6A 3VESA 3HPOA 2P9NB 1QSLA 1SL0A 5LJWA 1JCGA 2WC9A 3SI6A 2A3ZA 2E2NA 3VA0A 1Y64A 2O8FB 1NJXA 2D0BA 3HM8A 1J6ZA 4DQSA 5BPNA 5BREA 3ZSQA 3A2FA 1J5OA 2P9UB 5HBMA 1NM1A 4W5OA 3I33A 2G8HA 2Y1JA 1HLUA 3MXIA 4YDUA 1QQOA 1G15A 4FWMA 3UKRB 3SPZA 1JLGA 2GBZA 3NE6A 4NLBA 3AV9A 4Z4FA 3DLGA 1RT3A 3I0SA 1BWFO 4DQPA 4H0TB 3CPWM 1JXBA 5KGXA 4JI3K 3HZ6A 4BRAA 2FSJA 4NO7A 1IJJA 3SUPA 4LF5K 3TWHA 1NGDA 5LL6Z 4JRPA 4FCYA 4CHOA 4DS4A 1NGAA 2QA4N 1XNRK 1SAZA 4B8AB 4Y1DA 3O3FA 4BE0A 3HSCA 4PWDA 2UU9K 3UB5A 3CCLN 3O3HA 3V9UA 5JICA 5EOYA 4XH4A 4FZZA 3MDQA 3CXCM 1X9SA 1SL1A 1HUXA 3CMEN 1SL2A 1WB9A 2KLAA 4E89A 4H0XB 4BQLA 1NU0A 3QESA 3NDKA 1U4BA 4QS7A 3MEEA 1TUUA 3AVAA 4JI0K 4CF1A 4FJHA 3AA3A 5IT9O 4RW9A 3SQ4A 4U7BA 2IIRA 4DR5K 1TV6A 4CIEA 2F4VK 3ZSWA 3P83D 2XY5A 1C1CA 2Q3SA 1K8KA 3TPQA 2F7TA 4N76A 1Z25A 3SCXA 1P90A 5BRHA 2DPNA 3M8RA 4BDYA 1T3VA 3TAPA 1WBBA 3NCIA 3ENBA 3OJUA 1L3SA 4B9MA 3T69A 3O1BA 2OCEA 3O8MA 3SK3A 4FLYA 1K73O 4FLWA 3MXJA 2GTDA 3SZ2A 5M1PA 4Z4HA 4AHVA 3FZHA 2YHWA 3D0PA 3T7ZA 5C42A 1X9WA 1NKEA 1GOAA 2PY5A 1NK9A 4FWNA 1W9HA 1JCFA 3OYKA 4YOUA 3FZLA 2AA4A 5KPZA 2E1ZA 4DFPA 4PL8A 3LDQA 4ICLA 3L2WA 3U8XA 2BGGA 2UXDK 5TKWA 4X62K 3BY5A 4RW4A 4DQ8A 4DQIA 2KZZA 5J1EA 4PY5A 2KTQA 3J8AA 3E01A 2YKMA 3CCJN 1HPZA 2GUIA 1BL3A 3T1AA 3TARA 3AO1A 3OYLA 5DM6L 3VEWA 1HYZA 2NRTA 1D9DA 4AHSA 5FPNA 4I2QA 3L2QA 1RGIA 3CHWA 4EHUA 4CJRA 5J2QA 4CW7B 3EEQA 3AGKA 1HNVA 3H45C 1R59O 4OPHA 4JI8K 4MLHA 4DR1K 2CGJA 3B6PA 3CG7A 5TKYA 4JI1K 4DTXA 4EIAA 3CQ8A 1OH5A 2Q0UA 4IFEA 1T05A 1M1KO 3MMVA 1BCMA 3OYIA 1GLCG 1C0FA 4EP5A 5DK5A 3L4IA 3TSPA 1RT1A 4KHUA 2RE2A 3PV8A 3SUOA 4CEQA 5AQRA 4FLVA 1U45A 3WEEB 3RVCA 3O80A 3AAQA 3AVBA 4OVLA 4YOTA 1X9MA 3BUZB 4BRNA 3J7AP 2O8EA 3Q7CA 3ZSZA 1N34K 3OS0A 1VQ7N 2F9TA 3UIQA 4BVOA 1KLNA 3KLIA 4OGCA 4BGBA 4E7KA 3CC2N 3CERA 4DTUA 1VSEA 4CFAA 4JS4A 2OANA 4HWIA 4JI2K 2HBJA 4CD1A 3LDNA 4YOXA 2QWOA 3LDLA 3D6RA 4CJTA 5HLFA 3LM9A 1WNSA 3LALA 2ZD1A 1WLJA 4DTRA 3CMAN 2QW9A 4CHQA 4X66K 2HNYA 2RF2A 4Z4EA 2ASOA 4Z4CA 2A42A 5E41A 5LJVA 5BPMA 4BRCA 3CFOA 5AR0A 3IMXA 4OKKA 3O9UA 4CJWA 4V19S 1I94K 3K9KA 3VGKA 3AA2A 1RNHA 4FVUA 3MN5A 3P4IA 4CFDA 2DFFA 4DTJA 2YJEA 1X1PA 2QWNA 2ZE2A 1WN7A 2E8AA 3ZX2A 1FK9A 4CF8A 1SV5A 3IS9A 3OYAA 4PQUA 4KHNA 3O5BA 4O4GA 1VQ8N 4C1NK 4GKJK 3KHYA 5I42A 3RMBA 1BIUA 4DTPA 4CBWA 5CZ1A 3MCAB 1NJIO 1OH7A 3TTDA 2Q1NA 1EETA 2FXUA 3P5JA 1EO1A 1VQLN 3ULDA 2VG5A 3CJ1A 1J9AA 4FM1A 4K43A 1TKXA 4IOAL 4DQQA 4AM6A 1YXQA 4KH5A 3KLFA 3B8AX 3BDPA 3KTQA 3LZJA 3M5RA 1RBVA 2V7ZA 3LPUA 2Y1IA 3RSEB 4M3RA 4IWVA 1CZAN 3HVTA 3BZCA 1Q81O 3ZSXA 2IDOA 1ZBLA 1WSGA 4BC3A 2P9SB 4E19A 2NRRA 2ATQA 3UE5A 4DV4K 4DSJA 2HSTA 4ID5A 1YF5L 2ZJQL 5J2PA 4EAHD 4ELUA 1T6CA 1BA0A 3HP9A 4H8KA 2QTDA 3QO9A 1QVGM 1C0MA 1GLAG 4KHWA 2HNDA 2OZMA 2KW4A 3V9WA 5AZJA 4IFYA 5EVZA 5GADP 1UA1A 5GAGP 4DWIA 5BR9A 4A5AA 4M3XA 4C8NA 4CGIA 3WNHA 2PYJA 4CD3A 4W5QA 1KAYA 3OYDA 2P5OA 1CZBA 1VQPN 4GVMA 3VGLA 2HBLA 4ISGA 4JD2A 5AJ3K 2P9KB 4A2BA 2R7YA 1RT6A 1E4GT 4FO0A 2QI2A 1BI4B 1KTQA 4FJXA 2BDPA 3TAFA 4DG1A 4CHYA 2KQ2A 2HHQA 1YVNA 4J2DA 1IKVA 1KCFA 3SMSA 3H1VX 4CFCA 3D2EB 1V4SA 1E3MA 1SKSA 4N56A 3DYAA 1VQ4N 4HCBA 3AVFA 4HTUA 3OYMA 3I8DA 4DTMA 4JRQA 1NGGA 5I3UA 3VQEA 3ATVA 1ATSA 1ZC6A 1XMOK 3OYFA 4HUFA 4F4KA 1LAWA 4FWRA 3HL8A 1W0HA 4FL9A 3H1QA 4IXCA 1L5UA 1M90O 5M1QA 1IG8A 1BOTO 5AZIA 2YNGA 1O1WA 1LW2A 2HHUA 4JKDA 5JVHL 2E20A 2B6AA 2I5JA 3MXMA 3C6AA 2F8TA 1XNQK 2HHVA 3HXMA 3V9XA 2D0AA 4XH1A 4IKFA 1EKEA 3A5OC 2XO7A 4DSEA 2O8BB 1X9JA 1HKGA 4CF2A 3WT0A 3DMJA 3V9SA 2F9WA 2YNIA 2IS3A 4BWMA 4CEFA 3ZEUA 1RT2A 4I6MB 4FJKA 5HL7L 1ZBFA 4H5RA 1F21A 5JLFA 4Z0UA 4FK0A 3I55N 4LD0A 4CJSA 4ZHRA 4IG0A 3E66A 3O4NA 5CR4A 2FF3B 3OS1A 1L3VA 1Q82O 3UKUB 4A59A 3DXKA 1YI2N 2FBVA 3V1OA 4JHDB 1NJYA 3R8EA 2BUPA 3ULEA 4FYDA 3VQBA 3EE9A 2GWJA 3VEYA 3C94A 3ZSOA 4MO4A 3MAQA 2B5JA 3L3UA 4FWQA 3THYA 1NLVA 3Q7BA 4B1WB 1CZ9A 2O8CB 2QXLA 4BACA 3DXMA 3VEVA 1G99A 4LF6K 3DI6A 2F96A 4H5NA 3CCUN 3L0QA 1QQMA 3HYFA 2P9PA 2ASMA 2Q36A 2BH1A 4EZ9A 2Q0RA 4CIGA 4F2RA 3P1GA 2KZMA 1YITN 4K42A 2GX9A 3HJFA 4BR9A 4CJ4A 4CEZA 4HCCA 3GDQA 4DSFA 2JLEA 4LH4A 1QHAA 1VSMA 5M1FA 2VGMA 3QICA 2ZQBA 3VENA 3DRRA 1JL2A 2UYTA 5KTQA 3TTCA 3O4WA 3K5NA 1Z26A 4CZLA 2HOEA 3QEVA 1S9EA 3CJ7A 1DLOA 4CIFA 5FRNA 4NLCA 1QQCA 1NBWA 4CZHA 3K5LA 3THXA 4FJLA 4M7YA 3H6EA 5KRSA 2AJQA 4XEIA 3ZX0A 1ITGA 3OVNA 1S6QA 3KK7A 1IKWA 3JSMA 1ASWA 1S1TA 1ZBIA 4EZ6A 2QXFA 2UUCK 2QM1A 2W6LA 1S1VA 2P9NA 4BR0A 2E4LA 1NMNA 3ZT2A 3ZT3A 3WXJA 4JK9A 5AQSA 4QCLA 3IKMA 3G71N 1KVCA 3BF1A 4DV2K 2HVIA 3OYNA 3F5TA 3VOVA 2UXBK 3RMDA 2O8FA 1NGFA 3VEOA 3IAYA 3J80O 2QWMA 3CIPA 4EHTA 4NXNK 3RTVA 4BG8A 1RBUA 2ASPA 2P9UA 1W97L 3ZT1A 5AQXA 4J8FA 3NH0A 5KQDA 3AVIA 4IBNA 4O5BA 3VQ9A 4FOEA 1EWRA 3HPGA 3ZSRA 1SKWA 2E2OA 3OY9A 2P9IB 3KZBA 3NH2A 5JS2A 4BRLA 4KKOA 1JLEA 3SBGA 3CCEN 2WBNA 1NK5A 4CJ5A 1YTAA 3LP1A 3ZETB 4YY3K 3PX6A 5FROA 4DKWA 3AVLA 4KB0A 3CJBA 3DM2A 2O8DA 5LMNK 1LWFA 4CJFA 4WFNL 1Z05A 3AARA 3CQXA 1Q18A 3JS6A 3IFRA 2PFUA 3OW2M 4A57A 4FJ7A 2NRWA 2H3GX 2ZWHA 3VEXA 1WSEA 3K9JA 4E3SA 3RR7A 4HUEA 3KWIA 3J81O 2NRXA 1HKCA 2NNWA 4E7IA 1VSJA 1TL1A 3QNOA 4I9QA 1GLDG 4FLZA 1I3AA 1QE1A 1B9DA 3KK2A 2E1YA 3IG1A 4FJJA 2ZGYA 1NJWA 2X6SA 2PAVA 3U4LA 2Z1JA 1IH7A 1BGXT 1EQYA 2P51A 3LL3A 4I9LA 3OYGA 4FJGA 1Y97A 4FJNA 3QBWA 1NGIA 1HQUA 3CETA 1ILYA 4DS5A 4ILGB 4JV5K 2JWLA 1RTHA 3QIPA 1NK6A 1HJRA 4YORA 4K25A 4Z4IA 4JEPA 3GL1A 1OVYA 4FZYA 4R5PA 4AILC 4BRFA 4FJ8A 1DTTA 2WOMA 4UY8O 5JS1A 4DHYA 2VWKA 3M1FA 5KGWA 2J4RA 1X3NA 4J2AA 2FLOA 2HVHA 3J7YP 4DV7K 1BU6O 4M3UA 3BF3A 3C7NB 4IO9L 2PBDA 1KSPA 3NAEA 2A1RA 4FW1A 3FFKB 1S5JA 3VTIA 1DT9A 3DLBA 4CJLA 4CJVA 3U9ZA 3SNNA 3DLRA 3QNNA 1DEJA 1JXEA 3RRHA 5M1KA 4FJMA 2OPPA 3N4QA 3DLKA 2VWJA 5EX5A 4KFBA 1BDGA 3CQYA 4H0VB 1UOCA 3SQ0A 4PKIA 1GLFO 1QZ5A 4NXMK 5AQLA 4F2SA 4BRIA 3T19A 2OZSA 3OYCA 2D0OA 2DFEA 1LWCA 3AO5A 3W0LA 5FDLA 4JKBA 4B1UB 5GAEP 3WUHA 3EO3A 4M63C 3KWGA 4B8CA 1ESVA 3DOLA 1RTJA 5GIOA 1GLBG 1OH6A 3TAQA 1IV0A 3MN6A 2RKIA 1S72N 5CZ2A 3WXIA 1RDWX 3NBPA 1FKPA 1WAJA 4CF9A 1LW0A 3MN9A 5BPLA 3WNEA 4YOVA 3NVKA 2WUSA 4PKGA 2VG7A 1HNXK 4B08A 4NYNA 4LF7K 1RBSA 2HW3A 1TK8A 4CHPA 4F3TA 2YKNA 4OJRA 2FSNA 1DGKN 1ASUA 3VF4A 1NK0A 4WQ4C 2G8WA 3LP2A 4BC4A 3NFAA 2Q2RA 3HI0A 1TAQA 4KTZA 4Z94A 4WF9L 2RN2A 3ID6A 1S6PA 4WCEL 4NB4A 3EY1A 5D3GA 4WFAL 4GKKK 1S9GA 1QS4A 4DFJA 4AH9A 2Z1IA 1W7AA 1TGOA 2OA8A 4CESA 2V7YA 1S1WA 4BG9A 4OKEA 4FWPA 3PSIA 4GV9A 5C12A 2G8KA 1KAXA 3LP3A 1NWKA 3VERA 4CFBA 2BTFA 4F8RA 2P1JA 4JS5A 3E9LA 1Q7YO 1RT4A 4BR4A 1XHZA 4RTFD 1U49A 1TKZA 2CH5A 2A41A 4IEEA 3AVHA 3L2UA 1XMQK 1O13A 3EZ5A 3L4QA 3QEPA 1U47A 2OPRA 3LWLA 4GY2B 1NNEA 3MEDA 3OYBA 3K0SA 4MO5A 1ZBHA 1IO2A 1T8EA 3R3LA 1U6ZA 4M3YA 5KI6A 4BDPA 4AHTA 4K8ZA 3ZSYA 5HP1A 2CGLA 1TL3A 3QEWA 2QWPA 3G6EN 4PKHA 2O8EB 4DLEA 4AHRA 3WNFA 3L2VA 2HHHK 5AQMA 5CHIA 1TYQA 3THWB 4RW7A 1Q86O 3R9PA 1EP4A 4CZKA 4FPAA 3MEGA 3J7ZO 4ELTA 1HX1A 4FVMA 3HTVA 3OBWA 4B9VA 1JKHA 4H5TA 3K58A 1YUWA 4Y1CA 3OTOK 5HROA 4JKHA 3KK1A 4CF0A 3S3MA 1NJZA 4JI5K 2DY4A 4B3TK 1RDBA 1B92A 3QBXA 2P9LA 1ASVA 3CI5A 5ELZA 4WQ5A 2VQFK 1T7PA 3RSEA 5AQJA 3C6TA 4J2EA 4B1XB 1R0AA 3W3DA 4DFKA 2P9SA 1U04A 4FJ9A 3S3NA 3PUFA 2IVNA 4KHYA 5AQIA 5F0XA 3RR8A 3LDPA 3NGYA 2HBKA 2QWQA 2BANA 4DF8A 3MK6A 4IDKA 1DKGD 2QWRA 4ZTJA 1NGBA 3L3VA 1EWQA 4AM7A 3ZYYX 2HNZA 5AQZA 3L2RA 5GINA 3NF9A 3AA5X 2KFZA 4AHCA 3CCMN 2ZF5O 4GVEA 1RDUA 4BQZA 3VQ8A 4G1QA 1BIZA 5AQUA 4FOIA 4H5VA 4MDBA 3ZCMA 2XY7A 1I39A 1EXQA 4O5FA 3F73A 1IKXA 3HM9A 4J2BA 4RW8A 1ZBUA 1NK4A 1QTMA 4M3ZA 2Z1HA 1RBTA 4OPAA 1L3UA 4K0KK 3KLGA 4FWKA 1VQON 4MQ3A 4BRPA 3D2EA 3WXMB 3HRGA 4IFVA 1U2VA 3EKUA 3P31A 3M3ZA 1VSFA 2HMPA 1TK0A 3CD6N 1VSKA 1XWLA 3ALYA 4QOZB 2BE2A 4JK7A 2DTUA 3I8BA 5DM7L 1SQKA 4MFBA 5AZJB 4PA1A 4YOYA 2UUBK 3IDHA 3THVA 4DU1A 3NMUA 4CJQA 1IBKK 1K9MO 1P8ZA 3M6GA 2ITGA 1VQMN 3G10A 4HTLA 1WSJA 3CFRA 3FE1A 3PO4A 3OYJA 4I2PA
chains in the Genus database with same CATH topology
1N6QA 3ISNC 5KRSA 2AJQA 3QETA 4N76A 3K5OA 1Z25A 3JYTA 3SCXA 1ITGA 3OVNA 1S6QA 4GMJB 1HNIA 3QIOA 3M8RA 1IKWA 3V4IA 3JSMA 4BDYA 1ASWA 4HVJA 1SUQA 2YNFA 1QSSA 3TAPA 1S1TA 1ZBIA 4EZ6A 3NCIA 4GW6A 2QXFA 3OJUA 4Z4GA 1L3SA 4KHQA 2P5GA 4B9MA 2GV9A 4BDZA 1S1VA 3C95A 3QEIA 4FLYA 4CEBA 2E4LA 4HUGA 4FLWA 3MXJA 3ZT2A 3ZT3A 4CJPA 3SZ2A 3PX4A 3SQ2A 4KRFA 1XHXA 4Z4HA 4AHVA 4CEOA 4QCLA 5CYQA 3FFIA 4LY7A 1Q9XA 1KVCA 3D0PA 1A5WA 1T03A 5C42A 1X9WA 1RBRA 4CEDA 2HVIA 3OYNA 4KB1A 2FBYA 3M8SA 3LWMA 3RMDA 1NKEA 1RTIA 3IAYA 4BWJA 1GOAA 2PY5A 3T3FA 1NK9A 1W9HA 3OYKA 3RTVA 1RBUA 1UWBA 4DFPA 3L8BA 3ZT1A 3NH0A 4CECA 4ICLA 4O0IA 3L2WA 2QK9A 3KD5E 4FJIA 3AVIA 2BGGA 4IBNA 4OPJA 4O5BA 1KVAA 3VQ9A 3HPGA 3ZSRA 1SKWA 3OY9A 4RW4A 4DQIA 2KZZA 5J1EA 3AVNA 4PY5A 3NH2A 2KFNA 5JS2A 3HK2A 1C1AA 2KTQA 4KKOA 4OPKA 1JLEA 5HRNA 1IKYA 3E01A 2YKMA 1NK5A 4M3TA 1HPZA 1VRUA 2GUIA 4CJ5A 1BL3A 4Q5VA 3NF7A 3OJSA 3AO3A 3T1AA 4E7JA 3O3GA 3TARA 1YTAA 3AO1A 3LP1A 3OYLA 3PX6A 5FROA 3KLHA 3AVLA 4N5SA 4KB0A 1HYZA 3DM2A 1D9DA 4AHSA 4B9NA 1VSLA 2X78A 4I2QA 3L2QA 1LWFA 4CJFA 4CJRA 5J2QA 3TABA 1HNVA 2HMIA 2FC0A 1YVUA 3TAMA 3DRSA 4KI4A 3TR8A 5C25A 4FJ7A 1BI4A 2VG6A 3LAMA 2NUBA 5SWMA 4KV8A 1WSEA 4E3SA 3VQPA 3B6PA 3CG7A 3RR7A 4HUEA 4DTXA 3KIOA 3CQ8A 1QHTA 4KAZA 1B9FA 4E7IA 1T05A 1VSJA 1BCMA 1TL1A 1HRHA 3OYIA 3QNOA 4I9QA 4FLZA 4EP5A 3SV3A 3AVMA 5DK5A 1I3AA 1QE1A 1B9DA 5EU7A 3VQAA 3KK2A 1RT1A 3IG1A 5CYMA 4BE2A 4KHUA 4B9SA 3PV8A 3SUOA 4FJJA 1LV5A 2IOCA 1NJWA 4CEQA 4DLGA 2X6SA 1VK0A 4FLVA 1U45A 3HPHA 4YFUA 4DSIA 2Z1JA 3ZSVA 1S1UA 3KJVA 4NCAA 1IH7A 3AVBA 4FLXA 1BGXT 4OVLA 3VN5A 4CGJA 4W5RA 1X9MA 2RPIA 2P51A 4I9LA 3OYGA 4FJGA 3B6OA 2O4IA 3ZSZA 4IG3A 1Y97A 3OS0A 1RT7A 3RMCA 4FJNA 1HYVA 1JLCA 4LSNA 3UIQA 1HQUA 4DS5A 1KLNA 4W5NA 1ZYQA 3KLIA 4OGCA 4E7KA 4B9TA 4CJEA 4DTUA 1VSEA 1TKDA 1RTHA 4CFAA 3ZT0A 4OLAA 1N5YA 3QIPA 3ZT4A 4FW2A 4JS4A 1NK6A 1UAXA 1HJRA 3KK3A 1BHLA 1KFSA 4Z4IA 3LZIA 3AO4A 2W42A 4FZYA 4R5PA 3OYHA 3DLEA 4AILC 4FJ8A 2IGIA 5FRMA 1DTTA 1TAUA 2WOMA 3LP0A 4CJTA 5HLFA 5JS1A 1BQMA 1WNSA 2VWKA 2ZD1A 1WLJA 3LALA 4DTRA 1C1BA 4CHQA 1A5XA 5KGWA 2G8VA 4ELVA 4CE9A 1VSHA 4J2AA 2HNYA 2RF2A 1JLFA 4Z4EA 3VQCA 3VQQA 1RILA 4Z4CA 2HVHA 3CM6A 4RW6A 4FJ5A 4JLHA 3EYZA 5E41A 2B4JA 4M3UA 3SUQA 4B3OA 1KSPA 5CY4A 3CFOA 3NAEA 2A1RA 5J2MA 4FW1A 3KD1E 4I7FA 2D5RA 3G0ZA 4KO0A 1S5JA 3DLBA 4OKKA 4CJWA 4CJLA 4CGGA 3V6DA 4CHZA 3AA2A 4CJVA 3SNNA 1RNHA 3DLRA 3QNNA 1JXEA 4CFDA 2O4GA 3RRHA 3VQ4A 2X6NA 3DLHA 4FJMA 2OPPA 4Q0BA 2DFFA 1EX4A 3DLKA 2VWJA 2D0CA 4DTJA 4DU3A 4KFBA 4YNQA 1X1PA 1U48A 3SQ0A 1UOCA 2ZE2A 1WN7A 1K6YA 3LAKA 1FK9A 4CF8A 1A5VA 1SV5A 3IS9A 3OYAA 4PQUA 1HYSA 4F2SA 2OPSA 4KHNA 4DTOA 1RT5A 3T19A 4O4GA 5K14A 3LDSA 3OYCA 2OZSA 2DFEA 1LWCA 1VSIA 3AO5A 2G8UA 5FDLA 4FZXC 1C6VA 5I42A 1J53A 4DSLA 1CLQA 3RMBA 1BIUA 4DTPA 2G8IA 3KKSA 2WONA 4F3OA 4B8CA 3DOLA 5CZ1A 3QEXA 1RTJA 1JLAA 2OYQA 4KPYA 2HHWA 4C8OA 1RTDA 3TAQA 1EETA 1HMVA 3NGZA 3VQ7A 2QKKA 4HHTA 4DTSA 3P5JA 3V1QA 2RKIA 3K5MA 5CZ2A 3ULDA 1GOCA 1JL1A 3SPYA 3NBPA 1FKPA 2VG5A 3NF8A 4CJUA 1WAJA 3QLHA 1LW0A 4NYFA 4QAGA 4CF9A 3WNEA 1J9AA 4FM1A 3NGIA 4B9UA 1TKXA 3SJJA 4O0JA 4DQQA 3DRPA 2VG7A 4E1MA 4B08A 4NCBA 4NYNA 1RBSA 3KLFA 1C0UA 2HW3A 3BDPA 1TK8A 4C8LA 4CHPA 3RMAA 3KTQA 3LZJA 3HO1A 4F3TA 1RBVA 2YKNA 4OJRA 3MECA 4C8KA 3LPUA 3SQ1A 2Y1IA 4M3RA 3V9ZA 1CXQA 1ASUA 2G8WA 1NK0A 4CEEA 3AVGA 3LP2A 3HVTA 3NFAA 1L3TA 3ZSXA 3AVKA 2IDOA 4N47A 3VA3A 1ZBLA 3CM5A 1TAQA 4KTZA 3AA4A 3HP6A 2HB5A 1NK7A 3PY8A 1WSGA 4E19A 2E6MA 3K57A 3KKRA 4RG8A 3PX0A 2ATQA 3AO2A 4H4OA 2RN2A 3V1RA 1D8YA 4DSJA 1MU2A 1S6PA 3EY1A 4ID5A 5D3GA 3M8PA 5J2PA 1KLMA 4ELUA 4H4MA 4CJKA 2FBTA 3HP9A 2A1SA 4H8KA 3NHGA 4DF4A 4FM0A 1S9GA 1QS4A 3QO9A 4DFJA 1C0MA 4AH9A 3AVJA 2Z1IA 5J2NA 2IAJA 4M45A 4CK2A 4KHWA 2HNDA 1RCHA 2OZMA 2KW4A 3V9WA 3OYEA 1TGOA 4IFYA 1BQNA 1NKBA 4O55A 4K8XA 1UA1A 2OA8A 4CESA 3QINA 4OKJA 4CGFA 4DWIA 1S1WA 4OLBA 4OKEA 4M3XA 3U6FA 4C8NA 2HHXA 3V81A 1RDCA 3BGRA 4CGIA 3WNHA 1NKCA 2PYJA 2G8KA 4W5QA 3OYDA 2P5OA 1LWEA 1CZBA 4GVMA 3LP3A 2YHBA 4CFBA 4CEAA 1KVBA 3I0RA 4M42A 1UA0A 4F8RA 2YV0X 4CHNA 1Q8IA 2EX3A 2R7YA 1JLQA 1LAVA 2P1JA 4JS5A 1RT6A 3ASMA 1RT4A 4CK3A 4FM2A 1XHZA 1U49A 1BI4B 1TKZA 2DFHA 5DMRA 4BE1A 3TAEA 4KTQA 3AVHA 3L2UA 1KTQA 1Q9YA 4FJXA 3EZ5A 3QEPA 2BDPA 2QKBA 4N41A 1U47A 1BCOA 3TAFA 4DG1A 4CHYA 2KQ2A 5HRSA 4CCHA 2IC3A 2HHQA 3QERA 2OPRA 3LWLA 4KHSA 4FXDA 4O44A 4J2DA 4ZTFA 1FXXA 1IKVA 3MEDA 3OYBA 1TK5A 2G8FA 1KCFA 1ZBHA 1IO2A 3WNGA 3HVRA 1T8EA 3DOKA 4CFCA 1WSFA 4DMNA 1SKSA 4N56A 4M3YA 5KI6A 3DYAA 4BDPA 4AHTA 1REVA 3HSTB 4K8ZA 3ZSYA 3HT3A 5HP1A 1SKRA 4HCBA 3AVFA 1NOYA 3U3YA 4HTUA 1TL3A 4DTNA 3QEWA 3SUNA 4E0DA 4C8MA 3OYMA 3I8DA 1BISA 4DTMA 4JRQA 2X74A 5I3UA 2ETJA 5HRRA 3VQEA 1WSIA 4AHUA 4AHRA 3WNFA 4DLEA 1XC9A 2PZSA 3F9KA 4OGEA 2JGUA 1YTUA 4LH5A 1GOBA 2LSNA 3NH1A 3L2VA 4CGHA 4EP4A 3OYFA 4HUFA 4DFMA 4F4KA 1LAWA 4RW7A 2OPQA 1EP4A 3HL8A 1W0HA 2XRIA 4ELTA 3MEGA 1J54A 1FKOA 1RDDA 3K2PA 3C6UA 1HQEA 1L5UA 4FVMA 3S3OA 1KFDA 1VRTA 2YNGA 3CFPA 1O1WA 4B9VA 1JKHA 4ID1A 1LW2A 1QSYA 4B9LA 2EHGA 2HHUA 5KRTA 3PO5A 4KI6A 3K58A 4Y1CA 5HROA 4DQRA 3KLEA 3KK1A 2B6AA 2I5JA 4CF0A 3MXMA 5T7BA 2XY6A 2F8TA 4CJ3A 3S3MA 1NJZA 2HHVA 2DY4A 1RDAA 1S1XA 1RDBA 4DSKA 1B92A 3HXMA 3VQ5A 4XIUA 3V9XA 2XY8A 2D0AA 1ASVA 1JLBA 4LSLA 4M41A 4IKFA 1EKEA 1T7PA 2XO7A 1WSHA 4DSEA 1XI1A 4FK4A 4CF2A 2F8SA 3V9SA 3DMJA 3HPOA 1VSDA 2YNIA 3C6TA 4CGDA 4J2EA 5HRPA 2IS3A 1R0AA 4DFKA 1QSLA 1SL0A 4BWMA 4CEFA 3O4QA 1RT2A 1U04A 4FJKA 4FJ9A 3SI6A 3S3NA 1ZBFA 1F21A 3PUFA 4KHYA 4Z0UA 4FK0A 3VA0A 3RR8A 4LD0A 1NJXA 3U3GA 4CJSA 2D0BA 3NGYA 3LANA 4IG0A 4ZHRA 3O4NA 1D9FA 2XY5A 4E1NA 4DQSA 3OS2A 1J5OA 3ZSQA 3A2FA 4E7LA 2YNHA 3OS1A 5HBMA 4W5OA 1L3VA 2G8HA 4M3WA 2BANA 3AVCA 4NCGA 4DF8A 2Y1JA 3MXIA 3H08A 2FBVA 3V1OA 4TSXA 5SZTA 4IDKA 3ITHA 1NJYA 1G15A 3VQBA 4FYDA 3TANA 3SPZA 1JLGA 2GBZA 3NE6A 4ZTJA 3L3VA 3NF6A 2HHTA 3AV9A 2FBXA 3C94A 3ZSOA 2HNZA 3DLGA 4L8RB 4Z4FA 1RT3A 3I0SA 3MAQA 3L2RA 4DQPA 4DU4A 3NF9A 2B5JA 3AA5X 4AHCA 4FLUA 2KFZA 3L3UA 1JXBA 5KGXA 3IRXA 3VQ8A 4G1QA 1BIZA 3K59A 4CK1A 4FLTA 3LPTA 3ZCMA 2XY7A 1I39A 4I2PA 1EXQA 1CZ9A 2PYLA 1YT3A 4BACA 4FK2A 3F73A 1IKXA 3HM9A 4J2BA 4RW8A 1ZBUA 1NK4A 1QTMA 1IG9A 3SYZA 2Z1HA 3SUPA 4M3ZA 3DI6A 1NK8A 1RBTA 2F96A 3TWHA 3TAGA 4KREA 1L3UA 4JRPA 4PUOA 4FCYA 4CHOA 4DS4A 3RRGA 3KLGA 1CXUA 3HYFA 2YHAA 1KRPA 4MQ3A 4B8AB 4Y1DA 3O3FA 4BE0A 2HHSA 4PWDA 4EZ9A 4CIGA 2XHBA 3P1GA 4IFVA 5C24A 3O3HA 4F2RA 3V9UA 3M8QA 2KZMA 4UQGA 4E7HA 3HJFA 2Z1GA 4KTWA 4FZZA 1VSFA 3P83D 4CJ4A 4CEZA 1X9SA 1TK0A 1VSKA 1XWLA 4DSFA 1SL1A 4HCCA 3ALYA 4CERA 4QOZB 2JLEA 4LH4A 2BE2A 1SL2A 2DTUA 3VQ6A 1VSMA 4MFBA 2ZQBA 1TKTA 4WE1A 4PA1A 3SV4A 1WAFA 3DRRA 1JL2A 5KTQA 1DTQA 4E89A 1Z26A 3VQDA 3K5NA 3TI0A 3THVA 4DU1A 4CJQA 3CYMA 3QESA 1U4BA 3NDKA 1C0TA 3QEVA 3MEEA 1S9EA 4W5TA 3AVAA 2ITGA 1D5AA 1DLOA 2E6LA 4CF1A 4CIFA 4FJHA 3AA3A 5FRNA 3G10A 4RW9A 3SQ4A 3RWUA 1WSJA 1QQCA 3CFRA 1TV6A 4CIEA 1TVRA 3D45A 3K5LA 3S9HA 3PO4A 4FJLA 3OYJA 3ZSWA 1NOZA 1C1CA 2Q3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N6Q A;  3ISN C;  5KRS A;  2AJQ A;  3QET A;  4N76 A;  3K5O A;  1Z25 A;  3JYT A;  3SCX A;  1ITG A;  3OVN A;  1S6Q A;  4GMJ B;  1HNI A;  3QIO A;  3M8R A;  1IKW A;  3V4I A;  3JSM A;  4BDY A;  1ASW A;  4HVJ A;  1SUQ A;  2YNF A;  1QSS A;  3TAP A;  1S1T A;  1ZBI A;  4EZ6 A;  3NCI A;  4GW6 A;  2QXF A;  3OJU A;  4Z4G A;  1L3S A;  4KHQ A;  2P5G A;  4B9M A;  2GV9 A;  4BDZ A;  1S1V A;  3C95 A;  3QEI A;  4FLY A;  4CEB A;  2E4L A;  4HUG A;  4FLW A;  3MXJ A;  3ZT2 A;  3ZT3 A;  4CJP A;  3SZ2 A;  3PX4 A;  3SQ2 A;  4KRF A;  1XHX A;  4Z4H A;  4AHV A;  4CEO A;  4QCL A;  5CYQ A;  3FFI A;  4LY7 A;  1Q9X A;  1KVC A;  3D0P A;  1A5W A;  1T03 A;  5C42 A;  1X9W A;  1RBR A;  4CED A;  2HVI A;  3OYN A;  4KB1 A;  2FBY A;  3M8S A;  3LWM A;  3RMD A;  1NKE A;  1RTI A;  3IAY A;  4BWJ A;  1GOA A;  2PY5 A;  3T3F A;  1NK9 A;  1W9H A;  3OYK A;  3RTV A;  1RBU A;  1UWB A;  4DFP A;  3L8B A;  3ZT1 A;  3NH0 A;  4CEC A;  4ICL A;  4O0I A;  3L2W A;  2QK9 A;  3KD5 E;  4FJI A;  3AVI A;  2BGG A;  4IBN A;  4OPJ A;  4O5B A;  1KVA A;  3VQ9 A;  3HPG A;  3ZSR A;  1SKW A;  3OY9 A;  4RW4 A;  4DQI A;  2KZZ A;  5J1E A;  3AVN A;  4PY5 A;  3NH2 A;  2KFN A;  5JS2 A;  3HK2 A;  1C1A A;  2KTQ A;  4KKO A;  4OPK A;  1JLE A;  5HRN A;  1IKY A;  3E01 A;  2YKM A;  1NK5 A;  4M3T A;  1HPZ A;  1VRU A;  2GUI A;  4CJ5 A;  1BL3 A;  4Q5V A;  3NF7 A;  3OJS A;  3AO3 A;  3T1A A;  4E7J A;  3O3G A;  3TAR A;  1YTA A;  3AO1 A;  3LP1 A;  3OYL A;  3PX6 A;  5FRO A;  3KLH A;  3AVL A;  4N5S A;  4KB0 A;  1HYZ A;  3DM2 A;  1D9D A;  4AHS A;  4B9N A;  1VSL A;  2X78 A;  4I2Q A;  3L2Q A;  1LWF A;  4CJF A;  4CJR A;  5J2Q A;  3TAB A;  1HNV A;  2HMI A;  2FC0 A;  1YVU A;  3TAM A;  3DRS A;  4KI4 A;  3TR8 A;  5C25 A;  4FJ7 A;  1BI4 A;  2VG6 A;  3LAM A;  2NUB A;  5SWM A;  4KV8 A;  1WSE A;  4E3S A;  3VQP A;  3B6P A;  3CG7 A;  3RR7 A;  4HUE A;  4DTX A;  3KIO A;  3CQ8 A;  1QHT A;  4KAZ A;  1B9F A;  4E7I A;  1T05 A;  1VSJ A;  1BCM A;  1TL1 A;  1HRH A;  3OYI A;  3QNO A;  4I9Q A;  4FLZ A;  4EP5 A;  3SV3 A;  3AVM A;  5DK5 A;  1I3A A;  1QE1 A;  1B9D A;  5EU7 A;  3VQA A;  3KK2 A;  1RT1 A;  3IG1 A;  5CYM A;  4BE2 A;  4KHU A;  4B9S A;  3PV8 A;  3SUO A;  4FJJ A;  1LV5 A;  2IOC A;  1NJW A;  4CEQ A;  4DLG A;  2X6S A;  1VK0 A;  4FLV A;  1U45 A;  3HPH A;  4YFU A;  4DSI A;  2Z1J A;  3ZSV A;  1S1U A;  3KJV A;  4NCA A;  1IH7 A;  3AVB A;  4FLX A;  1BGX T;  4OVL A;  3VN5 A;  4CGJ A;  4W5R A;  1X9M A;  2RPI A;  2P51 A;  4I9L A;  3OYG A;  4FJG A;  3B6O A;  2O4I A;  3ZSZ A;  4IG3 A;  1Y97 A;  3OS0 A;  1RT7 A;  3RMC A;  4FJN A;  1HYV A;  1JLC A;  4LSN A;  3UIQ A;  1HQU A;  4DS5 A;  1KLN A;  4W5N A;  1ZYQ A;  3KLI A;  4OGC A;  4E7K A;  4B9T A;  4CJE A;  4DTU A;  1VSE A;  1TKD A;  1RTH A;  4CFA A;  3ZT0 A;  4OLA A;  1N5Y A;  3QIP A;  3ZT4 A;  4FW2 A;  4JS4 A;  1NK6 A;  1UAX A;  1HJR A;  3KK3 A;  1BHL A;  1KFS A;  4Z4I A;  3LZI A;  3AO4 A;  2W42 A;  4FZY A;  4R5P A;  3OYH A;  3DLE A;  4AIL C;  4FJ8 A;  2IGI A;  5FRM A;  1DTT A;  1TAU A;  2WOM A;  3LP0 A;  4CJT A;  5HLF A;  5JS1 A;  1BQM A;  1WNS A;  2VWK A;  2ZD1 A;  1WLJ A;  3LAL A;  4DTR A;  1C1B A;  4CHQ A;  1A5X A;  5KGW A;  2G8V A;  4ELV A;  4CE9 A;  1VSH A;  4J2A A;  2HNY A;  2RF2 A;  1JLF A;  4Z4E A;  3VQC A;  3VQQ A;  1RIL A;  4Z4C A;  2HVH A;  3CM6 A;  4RW6 A;  4FJ5 A;  4JLH A;  3EYZ A;  5E41 A;  2B4J A;  4M3U A;  3SUQ A;  4B3O A;  1KSP A;  5CY4 A;  3CFO A;  3NAE A;  2A1R A;  5J2M A;  4FW1 A;  3KD1 E;  4I7F A;  2D5R A;  3G0Z A;  4KO0 A;  1S5J A;  3DLB A;  4OKK A;  4CJW A;  4CJL A;  4CGG A;  3V6D A;  4CHZ A;  3AA2 A;  4CJV A;  3SNN A;  1RNH A;  3DLR A;  3QNN A;  1JXE A;  4CFD A;  2O4G A;  3RRH A;  3VQ4 A;  2X6N A;  3DLH A;  4FJM A;  2OPP A;  4Q0B A;  2DFF A;  1EX4 A;  3DLK A;  2VWJ A;  2D0C A;  4DTJ A;  4DU3 A;  4KFB A;  4YNQ A;  1X1P A;  1U48 A;  3SQ0 A;  1UOC A;  2ZE2 A;  1WN7 A;  1K6Y A;  3LAK A;  1FK9 A;  4CF8 A;  1A5V A;  1SV5 A;  3IS9 A;  3OYA A;  4PQU A;  1HYS A;  4F2S A;  2OPS A;  4KHN A;  4DTO A;  1RT5 A;  3T19 A;  4O4G A;  5K14 A;  3LDS A;  3OYC A;  2OZS A;  2DFE A;  1LWC A;  1VSI A;  3AO5 A;  2G8U A;  5FDL A;  4FZX C;  1C6V A;  5I42 A;  1J53 A;  4DSL A;  1CLQ A;  3RMB A;  1BIU A;  4DTP A;  2G8I A;  3KKS A;  2WON A;  4F3O A;  4B8C A;  3DOL A;  5CZ1 A;  3QEX A;  1RTJ A;  1JLA A;  2OYQ A;  4KPY A;  2HHW A;  4C8O A;  1RTD A;  3TAQ A;  1EET A;  1HMV A;  3NGZ A;  3VQ7 A;  2QKK A;  4HHT A;  4DTS A;  3P5J A;  3V1Q A;  2RKI A;  3K5M A;  5CZ2 A;  3ULD A;  1GOC A;  1JL1 A;  3SPY A;  3NBP A;  1FKP A;  2VG5 A;  3NF8 A;  4CJU A;  1WAJ A;  3QLH A;  1LW0 A;  4NYF A;  4QAG A;  4CF9 A;  3WNE A;  1J9A A;  4FM1 A;  3NGI A;  4B9U A;  1TKX A;  3SJJ A;  4O0J A;  4DQQ A;  3DRP A;  2VG7 A;  4E1M A;  4B08 A;  4NCB A;  4NYN A;  1RBS A;  3KLF A;  1C0U A;  2HW3 A;  3BDP A;  1TK8 A;  4C8L A;  4CHP A;  3RMA A;  3KTQ A;  3LZJ A;  3HO1 A;  4F3T A;  1RBV A;  2YKN A;  4OJR A;  3MEC A;  4C8K A;  3LPU A;  3SQ1 A;  2Y1I A;  4M3R A;  3V9Z A;  1CXQ A;  1ASU A;  2G8W A;  1NK0 A;  4CEE A;  3AVG A;  3LP2 A;  3HVT A;  3NFA A;  1L3T A;  3ZSX A;  3AVK A;  2IDO A;  4N47 A;  3VA3 A;  1ZBL A;  3CM5 A;  1TAQ A;  4KTZ A;  3AA4 A;  3HP6 A;  2HB5 A;  1NK7 A;  3PY8 A;  1WSG A;  4E19 A;  2E6M A;  3K57 A;  3KKR A;  4RG8 A;  3PX0 A;  2ATQ A;  3AO2 A;  4H4O A;  2RN2 A;  3V1R A;  1D8Y A;  4DSJ A;  1MU2 A;  1S6P A;  3EY1 A;  4ID5 A;  5D3G A;  3M8P A;  5J2P A;  1KLM A;  4ELU A;  4H4M A;  4CJK A;  2FBT A;  3HP9 A;  2A1S A;  4H8K A;  3NHG A;  4DF4 A;  4FM0 A;  1S9G A;  1QS4 A;  3QO9 A;  4DFJ A;  1C0M A;  4AH9 A;  3AVJ A;  2Z1I A;  5J2N A;  2IAJ A;  4M45 A;  4CK2 A;  4KHW A;  2HND A;  1RCH A;  2OZM A;  2KW4 A;  3V9W A;  3OYE A;  1TGO A;  4IFY A;  1BQN A;  1NKB A;  4O55 A;  4K8X A;  1UA1 A;  2OA8 A;  4CES A;  3QIN A;  4OKJ A;  4CGF A;  4DWI A;  1S1W A;  4OLB A;  4OKE A;  4M3X A;  3U6F A;  4C8N A;  2HHX A;  3V81 A;  1RDC A;  3BGR A;  4CGI A;  3WNH A;  1NKC A;  2PYJ A;  2G8K A;  4W5Q A;  3OYD A;  2P5O A;  1LWE A;  1CZB A;  4GVM A;  3LP3 A;  2YHB A;  4CFB A;  4CEA A;  1KVB A;  3I0R A;  4M42 A;  1UA0 A;  4F8R A;  2YV0 X;  4CHN A;  1Q8I A;  2EX3 A;  2R7Y A;  1JLQ A;  1LAV A;  2P1J A;  4JS5 A;  1RT6 A;  3ASM A;  1RT4 A;  4CK3 A;  4FM2 A;  1XHZ A;  1U49 A;  1BI4 B;  1TKZ A;  2DFH A;  5DMR A;  4BE1 A;  3TAE A;  4KTQ A;  3AVH A;  3L2U A;  1KTQ A;  1Q9Y A;  4FJX A;  3EZ5 A;  3QEP A;  2BDP A;  2QKB A;  4N41 A;  1U47 A;  1BCO A;  3TAF A;  4DG1 A;  4CHY A;  2KQ2 A;  5HRS A;  4CCH A;  2IC3 A;  2HHQ A;  3QER A;  2OPR A;  3LWL A;  4KHS A;  4FXD A;  4O44 A;  4J2D A;  4ZTF A;  1FXX A;  1IKV A;  3MED A;  3OYB A;  1TK5 A;  2G8F A;  1KCF A;  1ZBH A;  1IO2 A;  3WNG A;  3HVR A;  1T8E A;  3DOK A;  4CFC A;  1WSF A;  4DMN A;  1SKS A;  4N56 A;  4M3Y A;  5KI6 A;  3DYA A;  4BDP A;  4AHT A;  1REV A;  3HST B;  4K8Z A;  3ZSY A;  3HT3 A;  5HP1 A;  1SKR A;  4HCB A;  3AVF A;  1NOY A;  3U3Y A;  4HTU A;  1TL3 A;  4DTN A;  3QEW A;  3SUN A;  4E0D A;  4C8M A;  3OYM A;  3I8D A;  1BIS A;  4DTM A;  4JRQ A;  2X74 A;  5I3U A;  2ETJ A;  5HRR A;  3VQE A;  1WSI A;  4AHU A;  4AHR A;  3WNF A;  4DLE A;  1XC9 A;  2PZS A;  3F9K A;  4OGE A;  2JGU A;  1YTU A;  4LH5 A;  1GOB A;  2LSN A;  3NH1 A;  3L2V A;  4CGH A;  4EP4 A;  3OYF A;  4HUF A;  4DFM A;  4F4K A;  1LAW A;  4RW7 A;  2OPQ A;  1EP4 A;  3HL8 A;  1W0H A;  2XRI A;  4ELT A;  3MEG A;  1J54 A;  1FKO A;  1RDD A;  3K2P A;  3C6U A;  1HQE A;  1L5U A;  4FVM A;  3S3O A;  1KFD A;  1VRT A;  2YNG A;  3CFP A;  1O1W A;  4B9V A;  1JKH A;  4ID1 A;  1LW2 A;  1QSY A;  4B9L A;  2EHG A;  2HHU A;  5KRT A;  3PO5 A;  4KI6 A;  3K58 A;  4Y1C A;  5HRO A;  4DQR A;  3KLE A;  3KK1 A;  2B6A A;  2I5J A;  4CF0 A;  3MXM A;  5T7B A;  2XY6 A;  2F8T A;  4CJ3 A;  3S3M A;  1NJZ A;  2HHV A;  2DY4 A;  1RDA A;  1S1X A;  1RDB A;  4DSK A;  1B92 A;  3HXM A;  3VQ5 A;  4XIU A;  3V9X A;  2XY8 A;  2D0A A;  1ASV A;  1JLB A;  4LSL A;  4M41 A;  4IKF A;  1EKE A;  1T7P A;  2XO7 A;  1WSH A;  4DSE A;  1XI1 A;  4FK4 A;  4CF2 A;  2F8S A;  3V9S A;  3DMJ A;  3HPO A;  1VSD A;  2YNI A;  3C6T A;  4CGD A;  4J2E A;  5HRP A;  2IS3 A;  1R0A A;  4DFK A;  1QSL A;  1SL0 A;  4BWM A;  4CEF A;  3O4Q A;  1RT2 A;  1U04 A;  4FJK A;  4FJ9 A;  3SI6 A;  3S3N A;  1ZBF A;  1F21 A;  3PUF A;  4KHY A;  4Z0U A;  4FK0 A;  3VA0 A;  3RR8 A;  4LD0 A;  1NJX A;  3U3G A;  4CJS A;  2D0B A;  3NGY A;  3LAN A;  4IG0 A;  4ZHR A;  3O4N A;  1D9F A;  2XY5 A;  4E1N A;  4DQS A;  3OS2 A;  1J5O A;  3ZSQ A;  3A2F A;  4E7L A;  2YNH A;  3OS1 A;  5HBM A;  4W5O A;  1L3V A;  2G8H A;  4M3W A;  2BAN A;  3AVC A;  4NCG A;  4DF8 A;  2Y1J A;  3MXI A;  3H08 A;  2FBV A;  3V1O A;  4TSX A;  5SZT A;  4IDK A;  3ITH A;  1NJY A;  1G15 A;  3VQB A;  4FYD A;  3TAN A;  3SPZ A;  1JLG A;  2GBZ A;  3NE6 A;  4ZTJ A;  3L3V A;  3NF6 A;  2HHT A;  3AV9 A;  2FBX A;  3C94 A;  3ZSO A;  2HNZ A;  3DLG A;  4L8R B;  4Z4F A;  1RT3 A;  3I0S A;  3MAQ A;  3L2R A;  4DQP A;  4DU4 A;  3NF9 A;  2B5J A;  3AA5 X;  4AHC A;  4FLU A;  2KFZ A;  3L3U A;  1JXB A;  5KGX A;  3IRX A;  3VQ8 A;  4G1Q A;  1BIZ A;  3K59 A;  4CK1 A;  4FLT A;  3LPT A;  3ZCM A;  2XY7 A;  1I39 A;  4I2P A;  1EXQ A;  1CZ9 A;  2PYL A;  1YT3 A;  4BAC A;  4FK2 A;  3F73 A;  1IKX A;  3HM9 A;  4J2B A;  4RW8 A;  1ZBU A;  1NK4 A;  1QTM A;  1IG9 A;  3SYZ A;  2Z1H A;  3SUP A;  4M3Z A;  3DI6 A;  1NK8 A;  1RBT A;  2F96 A;  3TWH A;  3TAG A;  4KRE A;  1L3U A;  4JRP A;  4PUO A;  4FCY A;  4CHO A;  4DS4 A;  3RRG A;  3KLG A;  1CXU A;  3HYF A;  2YHA A;  1KRP A;  4MQ3 A;  4B8A B;  4Y1D A;  3O3F A;  4BE0 A;  2HHS A;  4PWD A;  4EZ9 A;  4CIG A;  2XHB A;  3P1G A;  4IFV A;  5C24 A;  3O3H A;  4F2R A;  3V9U A;  3M8Q A;  2KZM A;  4UQG A;  4E7H A;  3HJF A;  2Z1G A;  4KTW A;  4FZZ A;  1VSF A;  3P83 D;  4CJ4 A;  4CEZ A;  1X9S A;  1TK0 A;  1VSK A;  1XWL A;  4DSF A;  1SL1 A;  4HCC A;  3ALY A;  4CER A;  4QOZ B;  2JLE A;  4LH4 A;  2BE2 A;  1SL2 A;  2DTU A;  3VQ6 A;  1VSM A;  4MFB A;  2ZQB A;  1TKT A;  4WE1 A;  4PA1 A;  3SV4 A;  1WAF A;  3DRR A;  1JL2 A;  5KTQ A;  1DTQ A;  4E89 A;  1Z26 A;  3VQD A;  3K5N A;  3TI0 A;  3THV A;  4DU1 A;  4CJQ A;  3CYM A;  3QES A;  1U4B A;  3NDK A;  1C0T A;  3QEV A;  3MEE A;  1S9E A;  4W5T A;  3AVA A;  2ITG A;  1D5A A;  1DLO A;  2E6L A;  4CF1 A;  4CIF A;  4FJH A;  3AA3 A;  5FRN A;  3G10 A;  4RW9 A;  3SQ4 A;  3RWU A;  1WSJ A;  1QQC A;  3CFR A;  1TV6 A;  4CIE A;  1TVR A;  3D45 A;  3K5L A;  3S9H A;  3PO4 A;  4FJL A;  3OYJ A;  3ZSW A;  1NOZ A;  1C1C A;  2Q3S A; 
#chains in the Genus database with same CATH topology
 1N6Q A;  4RWT A;  1XC3 A;  2OTJ N;  4GMJ B;  1HNI A;  3QIO A;  1SUQ A;  2YNF A;  1QSS A;  4Z4G A;  2O8B A;  2P5G A;  4BDZ A;  3HBT A;  3QEI A;  4CEB A;  4HUG A;  1FJG K;  2NLX A;  4CJP A;  4LF9 K;  3C0B A;  4KRF A;  2ZJP L;  4IJA A;  4LY7 A;  1VAZ A;  1V4T A;  1A5W A;  1HJO A;  1RBR A;  4KB1 A;  2FBY A;  3M8S A;  3LWM A;  1RTI A;  4BWJ A;  3T3F A;  4OO1 J;  3A5M C;  4BY9 C;  2UXC K;  3L8B A;  2QK9 A;  5AQV A;  3KD5 E;  4FJI A;  5AZI B;  1YJN N;  4OPJ A;  4GNI A;  1MWK A;  2OTL N;  3FLC O;  4A61 A;  2KFN A;  3HK2 A;  1C1A A;  1VHX A;  5HRN A;  1W2B M;  4M3T A;  3FZK A;  1YIJ N;  3T1H K;  3OJS A;  3AO3 A;  5FPM A;  3KLH A;  3D2F B;  2JWK A;  5AQN A;  2GWK A;  4CJ7 A;  3TAB A;  3CPE A;  2HMI A;  1YVU A;  3O1W A;  2YCH A;  3P38 A;  3DRS A;  4KI4 A;  3TR8 A;  5C25 A;  3O9R A;  2VG6 A;  3LAM A;  2NUB A;  5SWM A;  4KV8 A;  4B1Y B;  4C1N I;  3KIO A;  1B9F A;  5EXW A;  3QB0 A;  2YJF A;  5EU7 A;  3ZX3 A;  1BO5 O;  2IOC A;  1VK0 A;  3HPH A;  5JMV A;  3ZSV A;  4IJN A;  3ATU A;  1S1U A;  4NCA A;  3MN7 A;  4FLX A;  3ULE B;  4W5R A;  3VN5 A;  3MX2 A;  4CGJ A;  2RPI A;  2IVP A;  4JKG B;  2O4I A;  3SMP A;  3N4P A;  4CZE A;  1HYV A;  5A2Q O;  3THY B;  4WQ5 C;  4W5N A;  1D4X A;  4M7X A;  4OLA A;  1N5Y A;  3DXM B;  3ZT4 A;  1YHQ N;  1UAX A;  4WQ4 A;  1BHL A;  1T6D A;  5AQF A;  3TSU A;  5C2D A;  3KK3 A;  1KFS A;  3LZI A;  3O08 A;  3DLE A;  1KC8 O;  5FRM A;  1TAU A;  3LP0 A;  3DAW A;  2G8V A;  4ELV A;  4CE9 A;  1VSH A;  5E84 A;  3VQC A;  4RW6 A;  4JLH A;  3EYZ A;  2B4J A;  1T44 A;  1K8A O;  5CY4 A;  3PSF A;  3KD1 E;  1TUY A;  3A5L C;  4I7F A;  2D5R A;  4KO0 A;  4CBX A;  4CGG A;  4CHZ A;  3QFP A;  4JKF A;  2A40 A;  4EFH A;  2O4G A;  4ILH A;  3VQ4 A;  2X6N A;  3H3N O;  4H0Y B;  3DLL L;  4LFB K;  5C0Y A;  4Q0B A;  1IBL K;  1EX4 A;  5AQW A;  5BRD A;  4YNQ A;  2VQE K;  1U48 A;  3LAK A;  3HOT A;  3SBT A;  4BRO A;  2P9I A;  3AY9 A;  3THX B;  1VSI A;  4DR3 K;  2VYP A;  1C6V A;  1J53 A;  1BA1 A;  1SZ2 A;  2WON A;  5IWA K;  4F3O A;  3QEX A;  1JLA A;  4H03 B;  4C8O A;  1RTD A;  4LF4 K;  3UKR A;  2D0P A;  3V1Q A;  1YAG A;  1GLE G;  2UUA K;  1HKB A;  3QFU A;  3I56 N;  1GOC A;  3SPY A;  3NF8 A;  4CJU A;  2A5X A;  4NYF A;  5AQT A;  2NRH A;  4QAG A;  4LC9 B;  4B9U A;  3S41 A;  2I7P A;  3DRP A;  4E1M A;  4NCB A;  4C8K A;  1CXQ A;  4CVN E;  4CEE A;  4CZF A;  5LY3 A;  1VQ6 N;  1VQK N;  3SJH A;  3AVK A;  3SAG A;  3BZK A;  4BC2 A;  3HP6 A;  2YHX A;  3AA4 A;  5KPT A;  2HB5 A;  3PY8 A;  3K57 A;  4RG8 A;  3PX0 A;  3AO2 A;  2RHK A;  2WTU A;  1HR0 K;  3M8P A;  4H4M A;  2FBT A;  4IEI A;  4BR5 A;  3NHG A;  4DF4 A;  3VF6 A;  4FM0 A;  4WYB A;  3AVJ A;  5J2N A;  2IAJ A;  4M45 A;  1RCH A;  4FWS A;  4GV3 A;  2Q97 A;  3OYE A;  2HF3 A;  1NKB A;  4O55 A;  3R6M A;  3QIN A;  4OKJ A;  2EWS A;  3TTF A;  2D1K A;  1MA9 B;  4CZI A;  3BGR A;  1NKC A;  2O8D B;  1KXP A;  1LWE A;  2YHB A;  4JYA K;  4M42 A;  1KVB A;  3I0R A;  4CHN A;  5FPD A;  2EX3 A;  3GOI A;  4JI6 K;  1JLQ A;  3CCS N;  1JJ2 M;  4CK3 A;  4A2A A;  5BRF A;  3TAE A;  3GE1 A;  1NGJ A;  2QKB A;  5HRS A;  2FSK A;  3QER A;  3C7N A;  4FXD A;  4O44 A;  1FXX A;  5BN9 A;  5I9E B;  2V52 B;  3U9D A;  3WNG A;  3OA9 A;  4R79 A;  4WFB L;  4BRQ A;  2E2Q A;  4DMN A;  1REV A;  4DTN A;  4DV3 K;  4KHP K;  1BIS A;  5H1S Q;  5HRR A;  4AHU A;  1WSI A;  2ZGZ A;  2HHX A;  5JVG L;  3F9K A;  2JGU A;  1YTU A;  4MDA A;  3NH1 A;  2LSN A;  1NGE A;  3LDO A;  4BRG A;  3GBT A;  1FKO A;  2A6A A;  1RDD A;  2QWL A;  4FPB A;  5CE3 A;  3ID8 A;  1KFD A;  1VRT A;  3CFP A;  4AF1 A;  5JLH A;  5GAH P;  3OHR A;  4F9O A;  3H46 O;  3TU5 A;  3KLE A;  5T7B A;  2XY6 A;  1K8K B;  2W40 A;  2E88 A;  1RDA A;  3VMF B;  3VQ5 A;  1HNZ K;  2XY8 A;  2YHY A;  3E1Y A;  3VPZ A;  4LSL A;  2E5L K;  4MLE A;  4YHH K;  4DV6 K;  3LM2 A;  4U67 L;  1WSH A;  2KHO A;  1XI1 A;  4FK4 A;  4IO8 A;  2F8S A;  1VSD A;  1QQN A;  4CGD A;  5HRP A;  1NG9 A;  5MLC Q;  3O4Q A;  1SS6 A;  3PLA A;  4FSV A;  1S3X A;  1ATN A;  3U3G A;  3LAN A;  1D9F A;  4E1N A;  3D7E O;  3OS2 A;  4E7L A;  2YNH A;  4CZM A;  4M3W A;  4IZ9 A;  3AVC A;  4NCG A;  4DV5 K;  4DV1 K;  3WEE A;  3H08 A;  4C23 A;  4TSX A;  5SZT A;  4B3S K;  1XUP O;  3ITH A;  2WFB A;  3TAN A;  3FGU A;  3NF6 A;  2HHT A;  3EL2 A;  2FBX A;  4L8R B;  1WOQ A;  4DU4 A;  4H0O A;  1VQ9 N;  4FLU A;  2YX6 A;  3IRX A;  3K59 A;  4CK1 A;  3CJC A;  4FLT A;  2GUP A;  3LPT A;  4DUY K;  2PYL A;  1YT3 A;  4FK2 A;  2GEL A;  3CJ9 A;  1X3M A;  1N32 K;  1IG9 A;  3SYZ A;  1NK8 A;  4K41 A;  4KRE A;  3TAG A;  4PUO A;  4PL7 A;  4JKA A;  3RRG A;  1CXU A;  5LMU K;  2YHA A;  4Y0W A;  1KRP A;  1BUP A;  4BR2 A;  1ZBS A;  5AQH A;  5AFU H;  2HHS A;  4KH4 A;  3WXL A;  1RFQ A;  4BC5 A;  2XHB A;  5C24 A;  4B1Z A;  3M8Q A;  3G25 A;  4UQG A;  5GIP A;  4E7H A;  2Z1G A;  4KTW A;  5ADX H;  1KAZ A;  3SAF A;  3FR0 A;  5AQO A;  2ZM6 K;  3E9P A;  4CER A;  4ISE A;  1ATR A;  3VQ6 A;  4CZG A;  1TKT A;  2VGN A;  4WE1 A;  3SV4 A;  1WAF A;  1OKJ A;  3R1X A;  3JAM O;  1DTQ A;  3THW A;  3VQD A;  1OVQ A;  3TI0 A;  2KKZ A;  3CYM A;  5AQY A;  1C0T A;  4W5T A;  1N33 K;  5M1N A;  3CCR N;  1D5A A;  2E6L A;  2D4W A;  4ILJ A;  4BRM A;  3RWU A;  4JK8 A;  1TVR A;  3D45 A;  3S9H A;  4OX9 K;  1NOZ A;  1NGC A;  4KH6 A;  2HF4 A;  3ISN C;  3QET A;  2E2P A;  3K5O A;  3JYT A;  3V4I A;  5C10 A;  4HVJ A;  2ITM A;  4B3R K;  1VQ5 N;  2Q31 A;  1H1V A;  4GW6 A;  4YDU C;  4KHQ A;  2GV9 A;  3P39 A;  4GV6 A;  4G9Z A;  3C95 A;  3SLC A;  4JNE A;  4FWO A;  1HNW K;  4QS9 A;  3PX4 A;  3SQ2 A;  3BEX A;  2NRV A;  1XHX A;  4CEO A;  5CYQ A;  3FFI A;  1Q9X A;  4H5W A;  1T03 A;  4CED A;  1TYQ B;  1UWB A;  4BRH A;  3A8Y A;  4CEC A;  3DJC A;  4O0I A;  2GEM A;  1LCU A;  3EKS A;  4PHT X;  1KVA A;  4JI4 K;  4H0P A;  3A5N C;  3AVN A;  2CGK A;  3O9Q A;  2VCP A;  4JN4 A;  4YOW A;  4OPK A;  1IKY A;  1NGH A;  2IVO A;  1N8R O;  1VRU A;  4Q5V A;  3NF7 A;  4E7J A;  1LOT B;  3O3G A;  1QVF M;  1Z6R A;  2P9L B;  3VET A;  4N5S A;  1MWM A;  3ENH A;  1ZXO A;  4B9N A;  1VSL A;  2X78 A;  4IOC L;  4JKC A;  3L6Q A;  2FC0 A;  3ZLJ A;  3TAM A;  4DB3 A;  4DR7 K;  2QEX N;  2P9K A;  3DWL A;  1VQN N;  5KQ8 A;  1BI4 A;  3IUC A;  4CZJ A;  3VQP A;  1QHT A;  4JKE A;  4KAZ A;  1KD1 O;  1GLJ O;  1HRH A;  4IDH A;  3MWT A;  3SV3 A;  3AVM A;  4BE2 A;  3QML A;  3VQA A;  5CYM A;  4B9S A;  1LV5 A;  4DLG A;  5C2F A;  4YFU A;  4DSI A;  4DCH A;  5F1X A;  5FPE A;  3C65 A;  1HPM A;  3KJV A;  3PIP L;  3B6O A;  5AQK A;  4IG3 A;  3EE8 A;  1RT7 A;  5FLX O;  3RMC A;  4LF8 K;  4AQY K;  1JLC A;  4DR2 K;  4LSN A;  1ZYQ A;  4B9T A;  3KVG A;  4CJE A;  1TKD A;  3ZT0 A;  4FW2 A;  3AO4 A;  2W42 A;  3OYH A;  4JD2 B;  2IGI A;  4B1V A;  1BQM A;  4LFA K;  2VWB A;  1C1B A;  3O6W A;  4JI7 K;  1A5X A;  1JLF A;  3VQQ A;  1RIL A;  3FZF A;  3CM6 A;  1N36 K;  1U2V B;  4FJ5 A;  1MDU B;  1QZ6 A;  5C15 A;  3SUQ A;  4B3O A;  5BN8 A;  5J2M A;  3O9T A;  3G0Z A;  4CBU A;  5B8H A;  3V6D A;  1WBD A;  3CJA A;  3FZM A;  1FW6 A;  3DLH A;  4E1J A;  2D0C A;  4DU3 A;  4B3M K;  3CC7 N;  4I6M A;  1K6Y A;  4BRE A;  3F9M A;  1A5V A;  4B9Q A;  1HYS A;  2OPS A;  3MWP A;  4DTO A;  1NMD A;  1RT5 A;  5HOO A;  5K14 A;  3LDS A;  5KPR A;  3T1Y K;  2G8U A;  4FZX C;  4DSL A;  1CLQ A;  2G8I A;  5F2R A;  3KKS A;  3UKU A;  2OYQ A;  4KPY A;  4JHD A;  4KBO A;  5M1O A;  3C6H A;  1HMV A;  3D2F A;  4A5B A;  3NGZ A;  3VQ7 A;  2QKK A;  4JAX A;  4HHT A;  2ZJR L;  4DTS A;  5AQQ A;  1S22 A;  3K5M A;  1JL1 A;  3CC4 N;  3QLH A;  4RCH A;  3JXU A;  4DR4 K;  3NGI A;  3SJJ A;  4O0J A;  3CCQ N;  4XH5 A;  4DUZ K;  2O8C A;  1C0U A;  5E26 A;  3A0I X;  1KQS M;  4C8L A;  3RMA A;  3HO1 A;  1XQS C;  3MEC A;  3SQ1 A;  1BG3 A;  5EY4 A;  3V9Z A;  3O9S A;  3AVG A;  3AGR A;  2V51 B;  1L3T A;  3VA3 A;  4N47 A;  1JCE A;  3CM5 A;  1NK7 A;  2E6M A;  2HHW A;  3KKR A;  3MCP A;  3V1R A;  4H4O A;  3SAH A;  1D8Y A;  3ZEU B;  1MU2 A;  1KLM A;  4CJK A;  2A1S A;  4BRD A;  4JKG A;  4CK2 A;  4BGA A;  3PIO L;  1OH8 A;  1BQN A;  3GG4 A;  3VTH A;  3DXK B;  4K8X A;  4CGF A;  3AAP A;  2NRZ A;  4OLB A;  3U6F A;  3V81 A;  1RDC A;  4IOX A;  2AP1 A;  3F2K A;  4QS8 A;  3ENO A;  2CH6 A;  1GLL O;  4CEA A;  1YJ9 N;  2W6K A;  1UA0 A;  2YV0 X;  1Q8I A;  1C0G A;  2NZT A;  1J5E K;  1LAV A;  3ASM A;  4FM2 A;  3EN9 A;  4KTQ A;  4BE1 A;  2DFH A;  5DMR A;  1YJW N;  1IBM K;  4LFC K;  3BP8 A;  4BR7 A;  1WUA A;  1Q9Y A;  4N41 A;  1BCO A;  4CCH A;  2IC3 A;  4ISF A;  3H3O B;  4KHS A;  3WXK A;  2HBM A;  3MX5 A;  4ZTF A;  1TK5 A;  2G8F A;  4O8U A;  2P9P B;  3TSQ A;  3HVR A;  3CF5 L;  3VGM A;  3DOK A;  1WSF A;  3OBY A;  3HST B;  3CCV N;  4DV0 K;  3HT3 A;  1SKR A;  1NOY A;  4E0D A;  3U3Y A;  3SUN A;  4FWL A;  4C8M A;  3HOS A;  2X74 A;  4O8K A;  2ETJ A;  2PZS A;  1XC9 A;  4OGE A;  4CI6 A;  4LH5 A;  1GOB A;  4CGH A;  2W41 A;  4EP4 A;  5BR8 K;  4DFM A;  4L3Q A;  3G4S N;  2OPQ A;  2XRI A;  1J54 A;  2I7N A;  4DR6 K;  3K2P A;  3NVM A;  3C6U A;  1HQE A;  3VF2 A;  3S3O A;  4BRK A;  5AFU A;  1E4F T;  4ID1 A;  1QSY A;  4B9L A;  2EHG A;  5KRT A;  3PO5 A;  4KI6 A;  3E9O A;  5AQG A;  5AQP A;  5ADX A;  4DQR A;  3WQT A;  4CJ3 A;  3QDK A;  2YI1 A;  1S1X A;  3VEZ A;  4DSK A;  4XIU A;  3ZET A;  4BVP A;  1JLB A;  3EZW A;  4M41 A;  3WQU A;  4A62 A;  4X65 K;  4X64 K;  2FF6 A;  3VES A;  3HPO A;  2P9N B;  1QSL A;  1SL0 A;  5LJW A;  1JCG A;  2WC9 A;  3SI6 A;  2A3Z A;  2E2N A;  3VA0 A;  1Y64 A;  2O8F B;  1NJX A;  2D0B A;  3HM8 A;  1J6Z A;  4DQS A;  5BPN A;  5BRE A;  3ZSQ A;  3A2F A;  1J5O A;  2P9U B;  5HBM A;  1NM1 A;  4W5O A;  3I33 A;  2G8H A;  2Y1J A;  1HLU A;  3MXI A;  4YDU A;  1QQO A;  1G15 A;  4FWM A;  3UKR B;  3SPZ A;  1JLG A;  2GBZ A;  3NE6 A;  4NLB A;  3AV9 A;  4Z4F A;  3DLG A;  1RT3 A;  3I0S A;  1BWF O;  4DQP A;  4H0T B;  3CPW M;  1JXB A;  5KGX A;  4JI3 K;  3HZ6 A;  4BRA A;  2FSJ A;  4NO7 A;  1IJJ A;  3SUP A;  4LF5 K;  3TWH A;  1NGD A;  5LL6 Z;  4JRP A;  4FCY A;  4CHO A;  4DS4 A;  1NGA A;  2QA4 N;  1XNR K;  1SAZ A;  4B8A B;  4Y1D A;  3O3F A;  4BE0 A;  3HSC A;  4PWD A;  2UU9 K;  3UB5 A;  3CCL N;  3O3H A;  3V9U A;  5JIC A;  5EOY A;  4XH4 A;  4FZZ A;  3MDQ A;  3CXC M;  1X9S A;  1SL1 A;  1HUX A;  3CME N;  1SL2 A;  1WB9 A;  2KLA A;  4E89 A;  4H0X B;  4BQL A;  1NU0 A;  3QES A;  3NDK A;  1U4B A;  4QS7 A;  3MEE A;  1TUU A;  3AVA A;  4JI0 K;  4CF1 A;  4FJH A;  3AA3 A;  5IT9 O;  4RW9 A;  3SQ4 A;  4U7B A;  2IIR A;  4DR5 K;  1TV6 A;  4CIE A;  2F4V K;  3ZSW A;  3P83 D;  2XY5 A;  1C1C A;  2Q3S A;  1K8K A;  3TPQ A;  2F7T A;  4N76 A;  1Z25 A;  3SCX A;  1P90 A;  5BRH A;  2DPN A;  3M8R A;  4BDY A;  1T3V A;  3TAP A;  1WBB A;  3NCI A;  3ENB A;  3OJU A;  1L3S A;  4B9M A;  3T69 A;  3O1B A;  2OCE A;  3O8M A;  3SK3 A;  4FLY A;  1K73 O;  4FLW A;  3MXJ A;  2GTD A;  3SZ2 A;  5M1P A;  4Z4H A;  4AHV A;  3FZH A;  2YHW A;  3D0P A;  3T7Z A;  5C42 A;  1X9W A;  1NKE A;  1GOA A;  2PY5 A;  1NK9 A;  4FWN A;  1W9H A;  1JCF A;  3OYK A;  4YOU A;  3FZL A;  2AA4 A;  5KPZ A;  2E1Z A;  4DFP A;  4PL8 A;  3LDQ A;  4ICL A;  3L2W A;  3U8X A;  2BGG A;  2UXD K;  5TKW A;  4X62 K;  3BY5 A;  4RW4 A;  4DQ8 A;  4DQI A;  2KZZ A;  5J1E A;  4PY5 A;  2KTQ A;  3J8A A;  3E01 A;  2YKM A;  3CCJ N;  1HPZ A;  2GUI A;  1BL3 A;  3T1A A;  3TAR A;  3AO1 A;  3OYL A;  5DM6 L;  3VEW A;  1HYZ A;  2NRT A;  1D9D A;  4AHS A;  5FPN A;  4I2Q A;  3L2Q A;  1RGI A;  3CHW A;  4EHU A;  4CJR A;  5J2Q A;  4CW7 B;  3EEQ A;  3AGK A;  1HNV A;  3H45 C;  1R59 O;  4OPH A;  4JI8 K;  4MLH A;  4DR1 K;  2CGJ A;  3B6P A;  3CG7 A;  5TKY A;  4JI1 K;  4DTX A;  4EIA A;  3CQ8 A;  1OH5 A;  2Q0U A;  4IFE A;  1T05 A;  1M1K O;  3MMV A;  1BCM A;  3OYI A;  1GLC G;  1C0F A;  4EP5 A;  5DK5 A;  3L4I A;  3TSP A;  1RT1 A;  4KHU A;  2RE2 A;  3PV8 A;  3SUO A;  4CEQ A;  5AQR A;  4FLV A;  1U45 A;  3WEE B;  3RVC A;  3O80 A;  3AAQ A;  3AVB A;  4OVL A;  4YOT A;  1X9M A;  3BUZ B;  4BRN A;  3J7A P;  2O8E A;  3Q7C A;  3ZSZ A;  1N34 K;  3OS0 A;  1VQ7 N;  2F9T A;  3UIQ A;  4BVO A;  1KLN A;  3KLI A;  4OGC A;  4BGB A;  4E7K A;  3CC2 N;  3CER A;  4DTU A;  1VSE A;  4CFA A;  4JS4 A;  2OAN A;  4HWI A;  4JI2 K;  2HBJ A;  4CD1 A;  3LDN A;  4YOX A;  2QWO A;  3LDL A;  3D6R A;  4CJT A;  5HLF A;  3LM9 A;  1WNS A;  3LAL A;  2ZD1 A;  1WLJ A;  4DTR A;  3CMA N;  2QW9 A;  4CHQ A;  4X66 K;  2HNY A;  2RF2 A;  4Z4E A;  2ASO A;  4Z4C A;  2A42 A;  5E41 A;  5LJV A;  5BPM A;  4BRC A;  3CFO A;  5AR0 A;  3IMX A;  4OKK A;  3O9U A;  4CJW A;  4V19 S;  1I94 K;  3K9K A;  3VGK A;  3AA2 A;  1RNH A;  4FVU A;  3MN5 A;  3P4I A;  4CFD A;  2DFF A;  4DTJ A;  2YJE A;  1X1P A;  2QWN A;  2ZE2 A;  1WN7 A;  2E8A A;  3ZX2 A;  1FK9 A;  4CF8 A;  1SV5 A;  3IS9 A;  3OYA A;  4PQU A;  4KHN A;  3O5B A;  4O4G A;  1VQ8 N;  4C1N K;  4GKJ K;  3KHY A;  5I42 A;  3RMB A;  1BIU A;  4DTP A;  4CBW A;  5CZ1 A;  3MCA B;  1NJI O;  1OH7 A;  3TTD A;  2Q1N A;  1EET A;  2FXU A;  3P5J A;  1EO1 A;  1VQL N;  3ULD A;  2VG5 A;  3CJ1 A;  1J9A A;  4FM1 A;  4K43 A;  1TKX A;  4IOA L;  4DQQ A;  4AM6 A;  1YXQ A;  4KH5 A;  3KLF A;  3B8A X;  3BDP A;  3KTQ A;  3LZJ A;  3M5R A;  1RBV A;  2V7Z A;  3LPU A;  2Y1I A;  3RSE B;  4M3R A;  4IWV A;  1CZA N;  3HVT A;  3BZC A;  1Q81 O;  3ZSX A;  2IDO A;  1ZBL A;  1WSG A;  4BC3 A;  2P9S B;  4E19 A;  2NRR A;  2ATQ A;  3UE5 A;  4DV4 K;  4DSJ A;  2HST A;  4ID5 A;  1YF5 L;  2ZJQ L;  5J2P A;  4EAH D;  4ELU A;  1T6C A;  1BA0 A;  3HP9 A;  4H8K A;  2QTD A;  3QO9 A;  1QVG M;  1C0M A;  1GLA G;  4KHW A;  2HND A;  2OZM A;  2KW4 A;  3V9W A;  5AZJ A;  4IFY A;  5EVZ A;  5GAD P;  1UA1 A;  5GAG P;  4DWI A;  5BR9 A;  4A5A A;  4M3X A;  4C8N A;  4CGI A;  3WNH A;  2PYJ A;  4CD3 A;  4W5Q A;  1KAY A;  3OYD A;  2P5O A;  1CZB A;  1VQP N;  4GVM A;  3VGL A;  2HBL A;  4ISG A;  4JD2 A;  5AJ3 K;  2P9K B;  4A2B A;  2R7Y A;  1RT6 A;  1E4G T;  4FO0 A;  2QI2 A;  1BI4 B;  1KTQ A;  4FJX A;  2BDP A;  3TAF A;  4DG1 A;  4CHY A;  2KQ2 A;  2HHQ A;  1YVN A;  4J2D A;  1IKV A;  1KCF A;  3SMS A;  3H1V X;  4CFC A;  3D2E B;  1V4S A;  1E3M A;  1SKS A;  4N56 A;  3DYA A;  1VQ4 N;  4HCB A;  3AVF A;  4HTU A;  3OYM A;  3I8D A;  4DTM A;  4JRQ A;  1NGG A;  5I3U A;  3VQE A;  3ATV A;  1ATS A;  1ZC6 A;  1XMO K;  3OYF A;  4HUF A;  4F4K A;  1LAW A;  4FWR A;  3HL8 A;  1W0H A;  4FL9 A;  3H1Q A;  4IXC A;  1L5U A;  1M90 O;  5M1Q A;  1IG8 A;  1BOT O;  5AZI A;  2YNG A;  1O1W A;  1LW2 A;  2HHU A;  4JKD A;  5JVH L;  2E20 A;  2B6A A;  2I5J A;  3MXM A;  3C6A A;  2F8T A;  1XNQ K;  2HHV A;  3HXM A;  3V9X A;  2D0A A;  4XH1 A;  4IKF A;  1EKE A;  3A5O C;  2XO7 A;  4DSE A;  2O8B B;  1X9J A;  1HKG A;  4CF2 A;  3WT0 A;  3DMJ A;  3V9S A;  2F9W A;  2YNI A;  2IS3 A;  4BWM A;  4CEF A;  3ZEU A;  1RT2 A;  4I6M B;  4FJK A;  5HL7 L;  1ZBF A;  4H5R A;  1F21 A;  5JLF A;  4Z0U A;  4FK0 A;  3I55 N;  4LD0 A;  4CJS A;  4ZHR A;  4IG0 A;  3E66 A;  3O4N A;  5CR4 A;  2FF3 B;  3OS1 A;  1L3V A;  1Q82 O;  3UKU B;  4A59 A;  3DXK A;  1YI2 N;  2FBV A;  3V1O A;  4JHD B;  1NJY A;  3R8E A;  2BUP A;  3ULE A;  4FYD A;  3VQB A;  3EE9 A;  2GWJ A;  3VEY A;  3C94 A;  3ZSO A;  4MO4 A;  3MAQ A;  2B5J A;  3L3U A;  4FWQ A;  3THY A;  1NLV A;  3Q7B A;  4B1W B;  1CZ9 A;  2O8C B;  2QXL A;  4BAC A;  3DXM A;  3VEV A;  1G99 A;  4LF6 K;  3DI6 A;  2F96 A;  4H5N A;  3CCU N;  3L0Q A;  1QQM A;  3HYF A;  2P9P A;  2ASM A;  2Q36 A;  2BH1 A;  4EZ9 A;  2Q0R A;  4CIG A;  4F2R A;  3P1G A;  2KZM A;  1YIT N;  4K42 A;  2GX9 A;  3HJF A;  4BR9 A;  4CJ4 A;  4CEZ A;  4HCC A;  3GDQ A;  4DSF A;  2JLE A;  4LH4 A;  1QHA A;  1VSM A;  5M1F A;  2VGM A;  3QIC A;  2ZQB A;  3VEN A;  3DRR A;  1JL2 A;  2UYT A;  5KTQ A;  3TTC A;  3O4W A;  3K5N A;  1Z26 A;  4CZL A;  2HOE A;  3QEV A;  1S9E A;  3CJ7 A;  1DLO A;  4CIF A;  5FRN A;  4NLC A;  1QQC A;  1NBW A;  4CZH A;  3K5L A;  3THX A;  4FJL A;  4M7Y A;  3H6E A;  5KRS A;  2AJQ A;  4XEI A;  3ZX0 A;  1ITG A;  3OVN A;  1S6Q A;  3KK7 A;  1IKW A;  3JSM A;  1ASW A;  1S1T A;  1ZBI A;  4EZ6 A;  2QXF A;  2UUC K;  2QM1 A;  2W6L A;  1S1V A;  2P9N A;  4BR0 A;  2E4L A;  1NMN A;  3ZT2 A;  3ZT3 A;  3WXJ A;  4JK9 A;  5AQS A;  4QCL A;  3IKM A;  3G71 N;  1KVC A;  3BF1 A;  4DV2 K;  2HVI A;  3OYN A;  3F5T A;  3VOV A;  2UXB K;  3RMD A;  2O8F A;  1NGF A;  3VEO A;  3IAY A;  3J80 O;  2QWM A;  3CIP A;  4EHT A;  4NXN K;  3RTV A;  4BG8 A;  1RBU A;  2ASP A;  2P9U A;  1W97 L;  3ZT1 A;  5AQX A;  4J8F A;  3NH0 A;  5KQD A;  3AVI A;  4IBN A;  4O5B A;  3VQ9 A;  4FOE A;  1EWR A;  3HPG A;  3ZSR A;  1SKW A;  2E2O A;  3OY9 A;  2P9I B;  3KZB A;  3NH2 A;  5JS2 A;  4BRL A;  4KKO A;  1JLE A;  3SBG A;  3CCE N;  2WBN A;  1NK5 A;  4CJ5 A;  1YTA A;  3LP1 A;  3ZET B;  4YY3 K;  3PX6 A;  5FRO A;  4DKW A;  3AVL A;  4KB0 A;  3CJB A;  3DM2 A;  2O8D A;  5LMN K;  1LWF A;  4CJF A;  4WFN L;  1Z05 A;  3AAR A;  3CQX A;  1Q18 A;  3JS6 A;  3IFR A;  2PFU A;  3OW2 M;  4A57 A;  4FJ7 A;  2NRW A;  2H3G X;  2ZWH A;  3VEX A;  1WSE A;  3K9J A;  4E3S A;  3RR7 A;  4HUE A;  3KWI A;  3J81 O;  2NRX A;  1HKC A;  2NNW A;  4E7I A;  1VSJ A;  1TL1 A;  3QNO A;  4I9Q A;  1GLD G;  4FLZ A;  1I3A A;  1QE1 A;  1B9D A;  3KK2 A;  2E1Y A;  3IG1 A;  4FJJ A;  2ZGY A;  1NJW A;  2X6S A;  2PAV A;  3U4L A;  2Z1J A;  1IH7 A;  1BGX T;  1EQY A;  2P51 A;  3LL3 A;  4I9L A;  3OYG A;  4FJG A;  1Y97 A;  4FJN A;  3QBW A;  1NGI A;  1HQU A;  3CET A;  1ILY A;  4DS5 A;  4ILG B;  4JV5 K;  2JWL A;  1RTH A;  3QIP A;  1NK6 A;  1HJR A;  4YOR A;  4K25 A;  4Z4I A;  4JEP A;  3GL1 A;  1OVY A;  4FZY A;  4R5P A;  4AIL C;  4BRF A;  4FJ8 A;  1DTT A;  2WOM A;  4UY8 O;  5JS1 A;  4DHY A;  2VWK A;  3M1F A;  5KGW A;  2J4R A;  1X3N A;  4J2A A;  2FLO A;  2HVH A;  3J7Y P;  4DV7 K;  1BU6 O;  4M3U A;  3BF3 A;  3C7N B;  4IO9 L;  2PBD A;  1KSP A;  3NAE A;  2A1R A;  4FW1 A;  3FFK B;  1S5J A;  3VTI A;  1DT9 A;  3DLB A;  4CJL A;  4CJV A;  3U9Z A;  3SNN A;  3DLR A;  3QNN A;  1DEJ A;  1JXE A;  3RRH A;  5M1K A;  4FJM A;  2OPP A;  3N4Q A;  3DLK A;  2VWJ A;  5EX5 A;  4KFB A;  1BDG A;  3CQY A;  4H0V B;  1UOC A;  3SQ0 A;  4PKI A;  1GLF O;  1QZ5 A;  4NXM K;  5AQL A;  4F2S A;  4BRI A;  3T19 A;  2OZS A;  3OYC A;  2D0O A;  2DFE A;  1LWC A;  3AO5 A;  3W0L A;  5FDL A;  4JKB A;  4B1U B;  5GAE P;  3WUH A;  3EO3 A;  4M63 C;  3KWG A;  4B8C A;  1ESV A;  3DOL A;  1RTJ A;  5GIO A;  1GLB G;  1OH6 A;  3TAQ A;  1IV0 A;  3MN6 A;  2RKI A;  1S72 N;  5CZ2 A;  3WXI A;  1RDW X;  3NBP A;  1FKP A;  1WAJ A;  4CF9 A;  1LW0 A;  3MN9 A;  5BPL A;  3WNE A;  4YOV A;  3NVK A;  2WUS A;  4PKG A;  2VG7 A;  1HNX K;  4B08 A;  4NYN A;  4LF7 K;  1RBS A;  2HW3 A;  1TK8 A;  4CHP A;  4F3T A;  2YKN A;  4OJR A;  2FSN A;  1DGK N;  1ASU A;  3VF4 A;  1NK0 A;  4WQ4 C;  2G8W A;  3LP2 A;  4BC4 A;  3NFA A;  2Q2R A;  3HI0 A;  1TAQ A;  4KTZ A;  4Z94 A;  4WF9 L;  2RN2 A;  3ID6 A;  1S6P A;  4WCE L;  4NB4 A;  3EY1 A;  5D3G A;  4WFA L;  4GKK K;  1S9G A;  1QS4 A;  4DFJ A;  4AH9 A;  2Z1I A;  1W7A A;  1TGO A;  2OA8 A;  4CES A;  2V7Y A;  1S1W A;  4BG9 A;  4OKE A;  4FWP A;  3PSI A;  4GV9 A;  5C12 A;  2G8K A;  1KAX A;  3LP3 A;  1NWK A;  3VER A;  4CFB A;  2BTF A;  4F8R A;  2P1J A;  4JS5 A;  3E9L A;  1Q7Y O;  1RT4 A;  4BR4 A;  1XHZ A;  4RTF D;  1U49 A;  1TKZ A;  2CH5 A;  2A41 A;  4IEE A;  3AVH A;  3L2U A;  1XMQ K;  1O13 A;  3EZ5 A;  3L4Q A;  3QEP A;  1U47 A;  2OPR A;  3LWL A;  4GY2 B;  1NNE A;  3MED A;  3OYB A;  3K0S A;  4MO5 A;  1ZBH A;  1IO2 A;  1T8E A;  3R3L A;  1U6Z A;  4M3Y A;  5KI6 A;  4BDP A;  4AHT A;  4K8Z A;  3ZSY A;  5HP1 A;  2CGL A;  1TL3 A;  3QEW A;  2QWP A;  3G6E N;  4PKH A;  2O8E B;  4DLE A;  4AHR A;  3WNF A;  3L2V A;  2HHH K;  5AQM A;  5CHI A;  1TYQ A;  3THW B;  4RW7 A;  1Q86 O;  3R9P A;  1EP4 A;  4CZK A;  4FPA A;  3MEG A;  3J7Z O;  4ELT A;  1HX1 A;  4FVM A;  3HTV A;  3OBW A;  4B9V A;  1JKH A;  4H5T A;  3K58 A;  1YUW A;  4Y1C A;  3OTO K;  5HRO A;  4JKH A;  3KK1 A;  4CF0 A;  3S3M A;  1NJZ A;  4JI5 K;  2DY4 A;  4B3T K;  1RDB A;  1B92 A;  3QBX A;  2P9L A;  1ASV A;  3CI5 A;  5ELZ A;  4WQ5 A;  2VQF K;  1T7P A;  3RSE A;  5AQJ A;  3C6T A;  4J2E A;  4B1X B;  1R0A A;  3W3D A;  4DFK A;  2P9S A;  1U04 A;  4FJ9 A;  3S3N A;  3PUF A;  2IVN A;  4KHY A;  5AQI A;  5F0X A;  3RR8 A;  3LDP A;  3NGY A;  2HBK A;  2QWQ A;  2BAN A;  4DF8 A;  3MK6 A;  4IDK A;  1DKG D;  2QWR A;  4ZTJ A;  1NGB A;  3L3V A;  1EWQ A;  4AM7 A;  3ZYY X;  2HNZ A;  5AQZ A;  3L2R A;  5GIN A;  3NF9 A;  3AA5 X;  2KFZ A;  4AHC A;  3CCM N;  2ZF5 O;  4GVE A;  1RDU A;  4BQZ A;  3VQ8 A;  4G1Q A;  1BIZ A;  5AQU A;  4FOI A;  4H5V A;  4MDB A;  3ZCM A;  2XY7 A;  1I39 A;  1EXQ A;  4O5F A;  3F73 A;  1IKX A;  3HM9 A;  4J2B A;  4RW8 A;  1ZBU A;  1NK4 A;  1QTM A;  4M3Z A;  2Z1H A;  1RBT A;  4OPA A;  1L3U A;  4K0K K;  3KLG A;  4FWK A;  1VQO N;  4MQ3 A;  4BRP A;  3D2E A;  3WXM B;  3HRG A;  4IFV A;  1U2V A;  3EKU A;  3P31 A;  3M3Z A;  1VSF A;  2HMP A;  1TK0 A;  3CD6 N;  1VSK A;  1XWL A;  3ALY A;  4QOZ B;  2BE2 A;  4JK7 A;  2DTU A;  3I8B A;  5DM7 L;  1SQK A;  4MFB A;  5AZJ B;  4PA1 A;  4YOY A;  2UUB K;  3IDH A;  3THV A;  4DU1 A;  3NMU A;  4CJQ A;  1IBK K;  1K9M O;  1P8Z A;  3M6G A;  2ITG A;  1VQM N;  3G10 A;  4HTL A;  1WSJ A;  3CFR A;  3FE1 A;  3PO4 A;  3OYJ A;  4I2P A; 
#chains in the Genus database with same CATH homology
 1N6Q A;  3ISN C;  5KRS A;  2AJQ A;  3QET A;  4N76 A;  3K5O A;  1Z25 A;  3JYT A;  3SCX A;  1ITG A;  3OVN A;  1S6Q A;  4GMJ B;  1HNI A;  3QIO A;  3M8R A;  1IKW A;  3V4I A;  3JSM A;  4BDY A;  1ASW A;  4HVJ A;  1SUQ A;  2YNF A;  1QSS A;  3TAP A;  1S1T A;  1ZBI A;  4EZ6 A;  3NCI A;  4GW6 A;  2QXF A;  3OJU A;  4Z4G A;  1L3S A;  4KHQ A;  2P5G A;  4B9M A;  2GV9 A;  4BDZ A;  1S1V A;  3C95 A;  3QEI A;  4FLY A;  4CEB A;  2E4L A;  4HUG A;  4FLW A;  3MXJ A;  3ZT2 A;  3ZT3 A;  4CJP A;  3SZ2 A;  3PX4 A;  3SQ2 A;  4KRF A;  1XHX A;  4Z4H A;  4AHV A;  4CEO A;  4QCL A;  5CYQ A;  3FFI A;  4LY7 A;  1Q9X A;  1KVC A;  3D0P A;  1A5W A;  1T03 A;  5C42 A;  1X9W A;  1RBR A;  4CED A;  2HVI A;  3OYN A;  4KB1 A;  2FBY A;  3M8S A;  3LWM A;  3RMD A;  1NKE A;  1RTI A;  3IAY A;  4BWJ A;  1GOA A;  2PY5 A;  3T3F A;  1NK9 A;  1W9H A;  3OYK A;  3RTV A;  1RBU A;  1UWB A;  4DFP A;  3L8B A;  3ZT1 A;  3NH0 A;  4CEC A;  4ICL A;  4O0I A;  3L2W A;  2QK9 A;  3KD5 E;  4FJI A;  3AVI A;  2BGG A;  4IBN A;  4OPJ A;  4O5B A;  1KVA A;  3VQ9 A;  3HPG A;  3ZSR A;  1SKW A;  3OY9 A;  4RW4 A;  4DQI A;  2KZZ A;  5J1E A;  3AVN A;  4PY5 A;  3NH2 A;  2KFN A;  5JS2 A;  3HK2 A;  1C1A A;  2KTQ A;  4KKO A;  4OPK A;  1JLE A;  5HRN A;  1IKY A;  3E01 A;  2YKM A;  1NK5 A;  4M3T A;  1HPZ A;  1VRU A;  2GUI A;  4CJ5 A;  1BL3 A;  4Q5V A;  3NF7 A;  3OJS A;  3AO3 A;  3T1A A;  4E7J A;  3O3G A;  3TAR A;  1YTA A;  3AO1 A;  3LP1 A;  3OYL A;  3PX6 A;  5FRO A;  3KLH A;  3AVL A;  4N5S A;  4KB0 A;  1HYZ A;  3DM2 A;  1D9D A;  4AHS A;  4B9N A;  1VSL A;  2X78 A;  4I2Q A;  3L2Q A;  1LWF A;  4CJF A;  4CJR A;  5J2Q A;  3TAB A;  1HNV A;  2HMI A;  2FC0 A;  1YVU A;  3TAM A;  3DRS A;  4KI4 A;  3TR8 A;  5C25 A;  4FJ7 A;  1BI4 A;  2VG6 A;  3LAM A;  2NUB A;  5SWM A;  4KV8 A;  1WSE A;  4E3S A;  3VQP A;  3B6P A;  3CG7 A;  3RR7 A;  4HUE A;  4DTX A;  3KIO A;  3CQ8 A;  1QHT A;  4KAZ A;  1B9F A;  4E7I A;  1T05 A;  1VSJ A;  1BCM A;  1TL1 A;  1HRH A;  3OYI A;  3QNO A;  4I9Q A;  4FLZ A;  4EP5 A;  3SV3 A;  3AVM A;  5DK5 A;  1I3A A;  1QE1 A;  1B9D A;  5EU7 A;  3VQA A;  3KK2 A;  1RT1 A;  3IG1 A;  5CYM A;  4BE2 A;  4KHU A;  4B9S A;  3PV8 A;  3SUO A;  4FJJ A;  1LV5 A;  2IOC A;  1NJW A;  4CEQ A;  4DLG A;  2X6S A;  1VK0 A;  4FLV A;  1U45 A;  3HPH A;  4YFU A;  4DSI A;  2Z1J A;  3ZSV A;  1S1U A;  3KJV A;  4NCA A;  1IH7 A;  3AVB A;  4FLX A;  1BGX T;  4OVL A;  3VN5 A;  4CGJ A;  4W5R A;  1X9M A;  2RPI A;  2P51 A;  4I9L A;  3OYG A;  4FJG A;  3B6O A;  2O4I A;  3ZSZ A;  4IG3 A;  1Y97 A;  3OS0 A;  1RT7 A;  3RMC A;  4FJN A;  1HYV A;  1JLC A;  4LSN A;  3UIQ A;  1HQU A;  4DS5 A;  1KLN A;  4W5N A;  1ZYQ A;  3KLI A;  4OGC A;  4E7K A;  4B9T A;  4CJE A;  4DTU A;  1VSE A;  1TKD A;  1RTH A;  4CFA A;  3ZT0 A;  4OLA A;  1N5Y A;  3QIP A;  3ZT4 A;  4FW2 A;  4JS4 A;  1NK6 A;  1UAX A;  1HJR A;  3KK3 A;  1BHL A;  1KFS A;  4Z4I A;  3LZI A;  3AO4 A;  2W42 A;  4FZY A;  4R5P A;  3OYH A;  3DLE A;  4AIL C;  4FJ8 A;  2IGI A;  5FRM A;  1DTT A;  1TAU A;  2WOM A;  3LP0 A;  4CJT A;  5HLF A;  5JS1 A;  1BQM A;  1WNS A;  2VWK A;  2ZD1 A;  1WLJ A;  3LAL A;  4DTR A;  1C1B A;  4CHQ A;  1A5X A;  5KGW A;  2G8V A;  4ELV A;  4CE9 A;  1VSH A;  4J2A A;  2HNY A;  2RF2 A;  1JLF A;  4Z4E A;  3VQC A;  3VQQ A;  1RIL A;  4Z4C A;  2HVH A;  3CM6 A;  4RW6 A;  4FJ5 A;  4JLH A;  3EYZ A;  5E41 A;  2B4J A;  4M3U A;  3SUQ A;  4B3O A;  1KSP A;  5CY4 A;  3CFO A;  3NAE A;  2A1R A;  5J2M A;  4FW1 A;  3KD1 E;  4I7F A;  2D5R A;  3G0Z A;  4KO0 A;  1S5J A;  3DLB A;  4OKK A;  4CJW A;  4CJL A;  4CGG A;  3V6D A;  4CHZ A;  3AA2 A;  4CJV A;  3SNN A;  1RNH A;  3DLR A;  3QNN A;  1JXE A;  4CFD A;  2O4G A;  3RRH A;  3VQ4 A;  2X6N A;  3DLH A;  4FJM A;  2OPP A;  4Q0B A;  2DFF A;  1EX4 A;  3DLK A;  2VWJ A;  2D0C A;  4DTJ A;  4DU3 A;  4KFB A;  4YNQ A;  1X1P A;  1U48 A;  3SQ0 A;  1UOC A;  2ZE2 A;  1WN7 A;  1K6Y A;  3LAK A;  1FK9 A;  4CF8 A;  1A5V A;  1SV5 A;  3IS9 A;  3OYA A;  4PQU A;  1HYS A;  4F2S A;  2OPS A;  4KHN A;  4DTO A;  1RT5 A;  3T19 A;  4O4G A;  5K14 A;  3LDS A;  3OYC A;  2OZS A;  2DFE A;  1LWC A;  1VSI A;  3AO5 A;  2G8U A;  5FDL A;  4FZX C;  1C6V A;  5I42 A;  1J53 A;  4DSL A;  1CLQ A;  3RMB A;  1BIU A;  4DTP A;  2G8I A;  3KKS A;  2WON A;  4F3O A;  4B8C A;  3DOL A;  5CZ1 A;  3QEX A;  1RTJ A;  1JLA A;  2OYQ A;  4KPY A;  2HHW A;  4C8O A;  1RTD A;  3TAQ A;  1EET A;  1HMV A;  3NGZ A;  3VQ7 A;  2QKK A;  4HHT A;  4DTS A;  3P5J A;  3V1Q A;  2RKI A;  3K5M A;  5CZ2 A;  3ULD A;  1GOC A;  1JL1 A;  3SPY A;  3NBP A;  1FKP A;  2VG5 A;  3NF8 A;  4CJU A;  1WAJ A;  3QLH A;  1LW0 A;  4NYF A;  4QAG A;  4CF9 A;  3WNE A;  1J9A A;  4FM1 A;  3NGI A;  4B9U A;  1TKX A;  3SJJ A;  4O0J A;  4DQQ A;  3DRP A;  2VG7 A;  4E1M A;  4B08 A;  4NCB A;  4NYN A;  1RBS A;  3KLF A;  1C0U A;  2HW3 A;  3BDP A;  1TK8 A;  4C8L A;  4CHP A;  3RMA A;  3KTQ A;  3LZJ A;  3HO1 A;  4F3T A;  1RBV A;  2YKN A;  4OJR A;  3MEC A;  4C8K A;  3LPU A;  3SQ1 A;  2Y1I A;  4M3R A;  3V9Z A;  1CXQ A;  1ASU A;  2G8W A;  1NK0 A;  4CEE A;  3AVG A;  3LP2 A;  3HVT A;  3NFA A;  1L3T A;  3ZSX A;  3AVK A;  2IDO A;  4N47 A;  3VA3 A;  1ZBL A;  3CM5 A;  1TAQ A;  4KTZ A;  3AA4 A;  3HP6 A;  2HB5 A;  1NK7 A;  3PY8 A;  1WSG A;  4E19 A;  2E6M A;  3K57 A;  3KKR A;  4RG8 A;  3PX0 A;  2ATQ A;  3AO2 A;  4H4O A;  2RN2 A;  3V1R A;  1D8Y A;  4DSJ A;  1MU2 A;  1S6P A;  3EY1 A;  4ID5 A;  5D3G A;  3M8P A;  5J2P A;  1KLM A;  4ELU A;  4H4M A;  4CJK A;  2FBT A;  3HP9 A;  2A1S A;  4H8K A;  3NHG A;  4DF4 A;  4FM0 A;  1S9G A;  1QS4 A;  3QO9 A;  4DFJ A;  1C0M A;  4AH9 A;  3AVJ A;  2Z1I A;  5J2N A;  2IAJ A;  4M45 A;  4CK2 A;  4KHW A;  2HND A;  1RCH A;  2OZM A;  2KW4 A;  3V9W A;  3OYE A;  1TGO A;  4IFY A;  1BQN A;  1NKB A;  4O55 A;  4K8X A;  1UA1 A;  2OA8 A;  4CES A;  3QIN A;  4OKJ A;  4CGF A;  4DWI A;  1S1W A;  4OLB A;  4OKE A;  4M3X A;  3U6F A;  4C8N A;  2HHX A;  3V81 A;  1RDC A;  3BGR A;  4CGI A;  3WNH A;  1NKC A;  2PYJ A;  2G8K A;  4W5Q A;  3OYD A;  2P5O A;  1LWE A;  1CZB A;  4GVM A;  3LP3 A;  2YHB A;  4CFB A;  4CEA A;  1KVB A;  3I0R A;  4M42 A;  1UA0 A;  4F8R A;  2YV0 X;  4CHN A;  1Q8I A;  2EX3 A;  2R7Y A;  1JLQ A;  1LAV A;  2P1J A;  4JS5 A;  1RT6 A;  3ASM A;  1RT4 A;  4CK3 A;  4FM2 A;  1XHZ A;  1U49 A;  1BI4 B;  1TKZ A;  2DFH A;  5DMR A;  4BE1 A;  3TAE A;  4KTQ A;  3AVH A;  3L2U A;  1KTQ A;  1Q9Y A;  4FJX A;  3EZ5 A;  3QEP A;  2BDP A;  2QKB A;  4N41 A;  1U47 A;  1BCO A;  3TAF A;  4DG1 A;  4CHY A;  2KQ2 A;  5HRS A;  4CCH A;  2IC3 A;  2HHQ A;  3QER A;  2OPR A;  3LWL A;  4KHS A;  4FXD A;  4O44 A;  4J2D A;  4ZTF A;  1FXX A;  1IKV A;  3MED A;  3OYB A;  1TK5 A;  2G8F A;  1KCF A;  1ZBH A;  1IO2 A;  3WNG A;  3HVR A;  1T8E A;  3DOK A;  4CFC A;  1WSF A;  4DMN A;  1SKS A;  4N56 A;  4M3Y A;  5KI6 A;  3DYA A;  4BDP A;  4AHT A;  1REV A;  3HST B;  4K8Z A;  3ZSY A;  3HT3 A;  5HP1 A;  1SKR A;  4HCB A;  3AVF A;  1NOY A;  3U3Y A;  4HTU A;  1TL3 A;  4DTN A;  3QEW A;  3SUN A;  4E0D A;  4C8M A;  3OYM A;  3I8D A;  1BIS A;  4DTM A;  4JRQ A;  2X74 A;  5I3U A;  2ETJ A;  5HRR A;  3VQE A;  1WSI A;  4AHU A;  4AHR A;  3WNF A;  4DLE A;  1XC9 A;  2PZS A;  3F9K A;  4OGE A;  2JGU A;  1YTU A;  4LH5 A;  1GOB A;  2LSN A;  3NH1 A;  3L2V A;  4CGH A;  4EP4 A;  3OYF A;  4HUF A;  4DFM A;  4F4K A;  1LAW A;  4RW7 A;  2OPQ A;  1EP4 A;  3HL8 A;  1W0H A;  2XRI A;  4ELT A;  3MEG A;  1J54 A;  1FKO A;  1RDD A;  3K2P A;  3C6U A;  1HQE A;  1L5U A;  4FVM A;  3S3O A;  1KFD A;  1VRT A;  2YNG A;  3CFP A;  1O1W A;  4B9V A;  1JKH A;  4ID1 A;  1LW2 A;  1QSY A;  4B9L A;  2EHG A;  2HHU A;  5KRT A;  3PO5 A;  4KI6 A;  3K58 A;  4Y1C A;  5HRO A;  4DQR A;  3KLE A;  3KK1 A;  2B6A A;  2I5J A;  4CF0 A;  3MXM A;  5T7B A;  2XY6 A;  2F8T A;  4CJ3 A;  3S3M A;  1NJZ A;  2HHV A;  2DY4 A;  1RDA A;  1S1X A;  1RDB A;  4DSK A;  1B92 A;  3HXM A;  3VQ5 A;  4XIU A;  3V9X A;  2XY8 A;  2D0A A;  1ASV A;  1JLB A;  4LSL A;  4M41 A;  4IKF A;  1EKE A;  1T7P A;  2XO7 A;  1WSH A;  4DSE A;  1XI1 A;  4FK4 A;  4CF2 A;  2F8S A;  3V9S A;  3DMJ A;  3HPO A;  1VSD A;  2YNI A;  3C6T A;  4CGD A;  4J2E A;  5HRP A;  2IS3 A;  1R0A A;  4DFK A;  1QSL A;  1SL0 A;  4BWM A;  4CEF A;  3O4Q A;  1RT2 A;  1U04 A;  4FJK A;  4FJ9 A;  3SI6 A;  3S3N A;  1ZBF A;  1F21 A;  3PUF A;  4KHY A;  4Z0U A;  4FK0 A;  3VA0 A;  3RR8 A;  4LD0 A;  1NJX A;  3U3G A;  4CJS A;  2D0B A;  3NGY A;  3LAN A;  4IG0 A;  4ZHR A;  3O4N A;  1D9F A;  2XY5 A;  4E1N A;  4DQS A;  3OS2 A;  1J5O A;  3ZSQ A;  3A2F A;  4E7L A;  2YNH A;  3OS1 A;  5HBM A;  4W5O A;  1L3V A;  2G8H A;  4M3W A;  2BAN A;  3AVC A;  4NCG A;  4DF8 A;  2Y1J A;  3MXI A;  3H08 A;  2FBV A;  3V1O A;  4TSX A;  5SZT A;  4IDK A;  3ITH A;  1NJY A;  1G15 A;  3VQB A;  4FYD A;  3TAN A;  3SPZ A;  1JLG A;  2GBZ A;  3NE6 A;  4ZTJ A;  3L3V A;  3NF6 A;  2HHT A;  3AV9 A;  2FBX A;  3C94 A;  3ZSO A;  2HNZ A;  3DLG A;  4L8R B;  4Z4F A;  1RT3 A;  3I0S A;  3MAQ A;  3L2R A;  4DQP A;  4DU4 A;  3NF9 A;  2B5J A;  3AA5 X;  4AHC A;  4FLU A;  2KFZ A;  3L3U A;  1JXB A;  5KGX A;  3IRX A;  3VQ8 A;  4G1Q A;  1BIZ A;  3K59 A;  4CK1 A;  4FLT A;  3LPT A;  3ZCM A;  2XY7 A;  1I39 A;  4I2P A;  1EXQ A;  1CZ9 A;  2PYL A;  1YT3 A;  4BAC A;  4FK2 A;  3F73 A;  1IKX A;  3HM9 A;  4J2B A;  4RW8 A;  1ZBU A;  1NK4 A;  1QTM A;  1IG9 A;  3SYZ A;  2Z1H A;  3SUP A;  4M3Z A;  3DI6 A;  1NK8 A;  1RBT A;  2F96 A;  3TWH A;  3TAG A;  4KRE A;  1L3U A;  4JRP A;  4PUO A;  4FCY A;  4CHO A;  4DS4 A;  3RRG A;  3KLG A;  1CXU A;  3HYF A;  2YHA A;  1KRP A;  4MQ3 A;  4B8A B;  4Y1D A;  3O3F A;  4BE0 A;  2HHS A;  4PWD A;  4EZ9 A;  4CIG A;  2XHB A;  3P1G A;  4IFV A;  5C24 A;  3O3H A;  4F2R A;  3V9U A;  3M8Q A;  2KZM A;  4UQG A;  4E7H A;  3HJF A;  2Z1G A;  4KTW A;  4FZZ A;  1VSF A;  3P83 D;  4CJ4 A;  4CEZ A;  1X9S A;  1TK0 A;  1VSK A;  1XWL A;  4DSF A;  1SL1 A;  4HCC A;  3ALY A;  4CER A;  4QOZ B;  2JLE A;  4LH4 A;  2BE2 A;  1SL2 A;  2DTU A;  3VQ6 A;  1VSM A;  4MFB A;  2ZQB A;  1TKT A;  4WE1 A;  4PA1 A;  3SV4 A;  1WAF A;  3DRR A;  1JL2 A;  5KTQ A;  1DTQ A;  4E89 A;  1Z26 A;  3VQD A;  3K5N A;  3TI0 A;  3THV A;  4DU1 A;  4CJQ A;  3CYM A;  3QES A;  1U4B A;  3NDK A;  1C0T A;  3QEV A;  3MEE A;  1S9E A;  4W5T A;  3AVA A;  2ITG A;  1D5A A;  1DLO A;  2E6L A;  4CF1 A;  4CIF A;  4FJH A;  3AA3 A;  5FRN A;  3G10 A;  4RW9 A;  3SQ4 A;  3RWU A;  1WSJ A;  1QQC A;  3CFR A;  1TV6 A;  4CIE A;  1TVR A;  3D45 A;  3K5L A;  3S9H A;  3PO4 A;  4FJL A;  3OYJ A;  3ZSW A;  1NOZ A;  1C1C A;  2Q3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...