4CHYA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4chyA00
4F2RA 4CK3A 2YNHA 1WSGA 3K59A 3L2QA 3V81A 3QEPA 3PUFA 3V4IA 4EZ9A 4F3TA 1U45A 3HL8A 1DLOA 1RT6A 3CYMA 1VSJA 3SYZA 2KTQA 5DMRA 5J2QA 3K58A 4W5OA 1Q9XA 2FC0A 5HLFA 1XI1A 3HO1A 1T8EA 4GMJB 1NK0A 5KRSA 1U04A 1CXUA 1U4BA 3O3GA 1JXEA 3V9SA 2DFEA 3QESA 4KPYA 4KV8A 1EETA 5HRNA 3SUOA 3G10A 4CJTA 3KD5E 4DSKA 5HRPA 4DF8A 4DFPA 4EP4A 4RG8A 4RW6A 4FLWA 3U3YA 2D0BA 1XC9A 3PV8A 4DQIA 5JS1A 1XHXA 3DLBA 4E0DA 3QO9A 1JLGA 1RBUA 3ULDA 4FK0A 1RNHA 1C1AA 4I2QA 3VQPA 4CF8A 3O3FA 4FM1A 4DSFA 4E7JA 3SQ2A 3MXMA 1WSIA 1QE1A 4B08A 4YNQA 4DFMA 4DWIA 4DS4A 4FJIA 4AH9A 2VG5A 2WONA 2PYJA 3NH0A 3T1AA 1UOCA 2Z1IA 4DG1A 3OYJA 1L3UA 3LPUA 3RR7A 4KHNA 3QINA 1TK0A 4Z4IA 4EP5A 5FDLA 3DLHA 3P5JA 4LY7A 2OPQA 4C8NA 4CGJA 4I7FA 4NCGA 3RR8A 4C8KA 1RT2A 2KFZA 2B4JA 3DLRA 3OYHA 4E7HA 3SUPA 4CJPA 4DTMA 1NOZA 3AO1A 3MECA 2VG6A 3AV9A 4KTZA 3NGZA 2JGUA 4DFJA 4CHPA 4C8OA 2G8WA 1VSDA 1QSSA 1KVCA 2HNYA 2XRIA 3LALA 1I3AA 4LH5A 4CK1A 3KK3A 3HXMA 4CHOA 1Z25A 4M3YA 3SPZA 2YKNA 5KGXA 1FXXA 1WSEA 2RN2A 2NUBA 3L3VA 3ZSYA 4CIGA 4B8CA 3AA4A 1LWFA 5JS2A 4RW9A 2F8SA 2HHXA 4KHUA 4FM2A 1JLAA 1BQNA 2OYQA 1JLFA 4H4OA 4OPJA 4DSIA 2YNIA 3IG1A 3EZ5A 3I8DA 1RDDA 3LWMA 3KIOA 2X6SA 3ZSXA 3TR8A 2A1RA 3SUQA 5HRRA 3ZSWA 4KREA 4CJQA 4DMNA 4FLZA 3BGRA 3CG7A 3OS0A 1NK6A 3HT3A 4NCAA 1HRHA 4KHYA 4AHCA 3M8PA 3NFAA 3K5OA 3HP6A 1U49A 3HK2A 3T19A 3AVAA 3T3FA 4OKKA 4CF2A 4JS5A 4FJGA 4FJNA 3AVHA 4ID5A 1JKHA 2WOMA 3ZT4A 4CFDA 5C25A 4J2EA 1GOBA 4FJHA 3L2RA 4DS5A 1RT4A 1SKSA 4YFUA 4IKFA 4Z4GA 3HP9A 4CF1A 3OJUA 1JLQA 3C6UA 3VQ7A 4N5SA 3O4NA 3RTVA 1RBVA 4FLTA 4E89A 3DLGA 2B6AA 1NK7A 1W9HA 2KFNA 3L8BA 1TKZA 3KLGA 4KO0A 1S6QA 2KZZA 1DTTA 4O44A 5K14A 2VWJA 4M41A 5C24A 3ZT0A 4I2PA 3NE6A 5KRTA 3TAFA 4AHVA 3K57A 4DQRA 1TKDA 3LP1A 1NJZA 2ZE2A 4E7LA 3OY9A 1KSPA 4M3UA 3AVJA 4HCBA 5FRNA 3DI6A 4CJKA 5SZTA 5HP1A 4OKJA 5FROA 1VSEA 4AHUA 1L3TA 4O0IA 3OYCA 4BE1A 4RW8A 1W0HA 3VA3A 4OJRA 2P51A 4CESA 3VQ5A 3RMDA 3MXJA 1WNSA 4CJEA 1RT3A 3QIOA 3SV3A 4OLBA 4CERA 4M42A 2YNGA 3ISNC 1S6PA 4W5QA 3NBPA 3OYDA 4HUEA 3OS1A 4XIUA 3OYBA 2IDOA 1BIUA 1KFDA 1RBSA 1C1CA 1HYSA 2RPIA 4Z0UA 4CEOA 3AVMA 1N5YA 1GOCA 3AVKA 1FKPA 3MEGA 1REVA 2VWKA 4CJUA 1L3SA 1HYVA 3ZCMA 3OJSA 1LW2A 2ATQA 1QHTA 4CEBA 4DQSA 3ZT3A 5J2NA 3QEWA 1SL0A 2DTUA 1DTQA 2E6LA 4IBNA 1CZ9A 1TKTA 1WAFA 2YHAA 1YTUA 2F8TA 3THVA 4CJVA 4EZ6A 1ZBHA 1HYZA 1RDCA 3B6PA 2XY5A 4K8ZA 4AHSA 3VQDA 3DLKA 2QKKA 4RW4A 3WNHA 1A5WA 4DSEA 1C0UA 3DLEA 4FJMA 2IAJA 3H08A 4HUGA 3P83D 5HBMA 3NF7A 1VRUA 1RDBA 2Q3SA 4IFVA 1UAXA 2D0AA 3LWLA 4FJKA 4M3TA 2HW3A 1IO2A 4CJ5A 3QEXA 2DY4A 2ZD1A 4E19A 4CHNA 4C8LA 3S3MA 5KTQA 2P5OA 3SQ4A 2IS3A 4GVMA 4BWJA 4CJFA 4CF9A 3PX0A 3MAQA 1HPZA 1XWLA 3OYMA 3P1GA 5KI6A 3V6DA 1O1WA 3CFOA 4RW7A 1ZBLA 2G8UA 3VQ8A 3KKSA 1NK4A 4FXDA 4KHWA 3LANA 5CYQA 4OVLA 3CFPA 3TARA 4LD0A 3RRHA 3C94A 2XO7A 4O5BA 4CGDA 4DLGA 4HTUA 2HVHA 2DFHA 3AO4A 3G0ZA 4JLHA 4B9SA 3ZSOA 4BE2A 3VQBA 4ICLA 4FJXA 4DLEA 2FBTA 2YNFA 3TAQA 5CZ1A 4Z4FA 4CJWA 4FJ5A 2QK9A 1NK9A 3I0SA 2P1JA 2P5GA 4FJLA 1X1PA 1VSLA 2BANA 1T03A 3IAYA 2KZMA 1LWEA 1B9DA 2Y1JA 1VSIA 3KJVA 1IG9A 2HHVA 3ALYA 1S5JA 4CFCA 2XY7A 1YTAA 1BGXT 4CHYA 1WSFA 3HPOA 4CJ3A 1VSHA 3AVIA 3SUNA 1BI4A 2YKMA 3PO4A 3F9KA 4IG3A 2YV0X 1BQMA 4O4GA 4TSXA 2F96A 3LZIA 3QERA 1CXQA 2Z1HA 2BE2A 3VN5A 4DFKA 1KRPA 1RILA 2E6MA 2B5JA 4E1NA 4QCLA 3OYIA 1HNVA 3DOLA 4E7KA 3TABA 4QOZB 1S1TA 1JLBA 4DTJA 1KVAA 3SQ0A 4CE9A 4CEDA 3KLHA 3S3NA 4JRPA 3HM9A 3KKRA 2W42A 3DRPA 2O4GA 4AHRA 1X9MA 3AVCA 3NDKA 1FK9A 3CQ8A 2OPRA 4E1MA 3KLEA 4LH4A 4Z4CA 5I3UA 3DRSA 1ASWA 1R0AA 4M3RA 2KW4A 2QKBA 4FM0A 3M8RA 2PYLA 3TAGA 2OPPA 4J2BA 1TV6A 3AO5A 4CJSA 1JLEA 3A2FA 4ELTA 2HHSA 5J1EA 3OYKA 3V9ZA 2IC3A 3B6OA 3AA3A 1G15A 1EXQA 5DK5A 3PO5A 4Q0BA 3ZSQA 5HRSA 3EY1A 1IH7A 4DU4A 1T05A 3D45A 1NKEA 4OLAA 4H4MA 1D5AA 1NOYA 2FBYA 3TI0A 1BHLA 1JL2A 4CIEA 3RMCA 3SCXA 3V9UA 4KI6A 1VSMA 2O4IA 3L2UA 1WSHA 4Z4HA 4W5RA 3NAEA 3QEIA 3OYNA 2G8HA 3K5LA 4LSLA 4OGEA 2PZSA 1QQCA 4B9LA 4H8KA 4CJRA 3LAKA 1S1WA 1TK8A 2G8KA 4ZTFA 1BI4B 4KKOA 3C95A 3LDSA 2X74A 4N76A 3HSTB 2XHBA 5CY4A 1TL3A 4CHQA 3ZSRA 3HVTA 3NF9A 3VQ6A 3O3HA 1Q9YA 1TAQA 1C1BA 1RTDA 4CFBA 1D9FA 4L8RB 2G8FA 5T7BA 4KTQA 1ASUA 4FW2A 4FCYA 3PX4A 1NJXA 1CLQA 2OPSA 1YVUA 4FZZA 1Z26A 3KD1E 1IKWA 3M8SA 2HHWA 4IDKA 1LV5A 1KLNA 3V1RA 3L3UA 3NH2A 3DRRA 1S9GA 1RBTA 3IRXA 1NKCA 4JRQA 4G1QA 1QTMA 2KQ2A 4ID1A 4J2AA 1SV5A 3L2VA 1B92A 3SI6A 4DSJA 1QSLA 4FLXA 3QLHA 4CFAA 1LWCA 3LP2A 4I9QA 4M3WA 3OS2A 2ETJA 4NYNA 1NJYA 1C0MA 1HMVA 3ITHA 5C42A 4ELVA 4UQGA 3LP0A 3IS9A 4HVJA 1J5OA 3NF8A 3LPTA 4FW1A 1RTJA 4CJ4A 4CJLA 3QETA 3SJJA 1C0TA 3FFIA 5SWMA 3U3GA 4DTXA 4J2DA 4PWDA 2HHUA 2HHQA 3OYEA 1ZBIA 1KLMA 4KHQA 3DM2A 1SL2A 4Z4EA 1SL1A 3MEDA 1VSFA 3KK1A 4DTUA 2LSNA 3OYAA 4CGIA 1SKWA 4CEZA 4BDPA 3QEVA 1VRTA 1TK5A 4N41A 3JYTA 3RMAA 4HUFA 2OZSA 1EX4A 3OYFA 4FK4A 3V9XA 3E01A 4DTRA 1RT5A 3NCIA 4R5PA 2QXFA 1RBRA 4DQQA 4MQ3A 1EKEA 2HB5A 1C6VA 1S1UA 3DMJA 3TAEA 4N47A 1KCFA 1UA1A 1U47A 5EU7A 1QS4A 3SZ2A 4FYDA 2Z1JA 4ELUA 4LSNA 3VQ4A 3ZSVA 2XY8A 4CEFA 4AILC 1XHZA 1QSYA 1FKOA 4KTWA 4CGHA 4W5TA 4OPKA 2HHTA 3AVNA 1BIZA 3S3OA 4FJ9A 3DYAA 4FZXC 1J53A 4PQUA 2IOCA 1RTHA 4M3XA 2FBXA 2X78A 3SV4A 3EYZA 3SQ1A 1A5VA 3OVNA 4DTOA 4B8AB 1TL1A 4B9MA 4FZYA 1JL1A 1J54A 3O4QA 4CGGA 1HQUA 1F21A 4O0JA 2Y1IA 1WLJA 3AA2A 4DTNA 4FJ7A 1EP4A 4OGCA 2X6NA 4F2SA 1K6YA 1RCHA 2ZQBA 4BE0A 3AO2A 4DF4A 4E7IA 4M45A 3AVFA 4CECA 4BWMA 2GBZA 1N6QA 3RRGA 3PY8A 1NJWA 3ZT2A 4BACA 1WSJA 3HPGA 1ZYQA 5D3GA 2G8IA 2RKIA 5CZ2A 1KFSA 4NCBA 3AO3A 3D0PA 2EX3A 1UWBA 3OYGA 3NGYA 2D5RA 5J2MA 3WNGA 3KLIA 4CEAA 4OKEA 4C8MA 4CK2A 5E41A 3KLFA 2EHGA 4QAGA 1L5UA 4F8RA 4KB1A 4KRFA 4NYFA 2DFFA 3CM6A 1S1VA 4Y1DA 1S1XA 5KGWA 3NHGA 3V1QA 1BL3A 4F4KA 3UIQA 3ZT1A 4N56A 3U6FA 1LW0A 4O55A 1NKBA 1HNIA 3SPYA 2BDPA 1TGOA 1BCOA 3TAPA 3VQ9A 1ZBFA 4HCCA 3HPHA 4GW6A 4CEQA 4CIFA 4B9TA 1NK5A 3VQQA 3L2WA 1ASVA 3KTQA 1J9AA 1JXBA 4KB0A 5CYMA 2BGGA 1D9DA 1WN7A 2HNZA 3K5NA 1RTIA 2ITGA 3RMBA 4CCHA 3RWUA 4KAZA 3AVGA 2R7YA 4AHTA 5J2PA 4DSLA 3TANA 4CF0A 1KTQA 2E4LA 4CEEA 3JSMA 4DQPA 4IFYA 4CHZA 3NGIA 1LAWA 4PUOA 4I9LA 3VA0A 1D8YA 1IKXA 2I5JA 1VSKA 1LAVA 3NF6A 3K5MA 1U48A 1BISA 4DU1A 1CZBA 1JLCA 1GOAA 1HQEA 4B9VA 1I39A 5FRMA 1BCMA 4Q5VA 4DTPA 3V9WA 1UA0A 3F73A 3BDPA 4B9NA 1WAJA 2AJQA 1MU2A 2OA8A 2Z1GA 4HHTA 4ZTJA 2HMIA 2HVIA 2A1SA 4KFBA 1TAUA 1A5XA 3HYFA 3LP3A 4K8XA 4E3SA 1L3VA 4W5NA 3ZSZA 1RDAA 3TAMA 3HVRA 3M8QA 2YHBA 3I0RA 4KI4A 1IKYA 1TKXA 2D0CA 4IG0A 4Y1CA 1HJRA 4B9UA 3LAMA 2RF2A 3AA5X 1Y97A 4FJJA 3QNNA 2OZMA 4WE1A 3WNFA 3CM5A 4BDYA 4MFBA 3NH1A 4FVMA 3SNNA 4B3OA 1KVBA 3PX6A 1T7PA 5I42A 4FLVA 3V1OA 3KK2A 1SKRA 1ITGA 1IKVA 4FJ8A 4F3OA 4JS4A 1B9FA 3MXIA 4CGFA 3OYLA 3VQEA 1YT3A 4PY5A 1Q8IA 1VK0A 4PA1A 1NK8A 3CFRA 2GV9A 3VQAA 4FLUA 1X9WA 4FK2A 2HNDA 2JLEA 3LZJA 4FLYA 1SUQA 4M3ZA 1RT1A 2XY6A 3DOKA 2G8VA 3AVBA 2PY5A 1X9SA 2FBVA 1RT7A 3K2PA 3VQCA 3MEEA 3TWHA 1TVRA 3AVLA 1ZBUA 4DU3A 2IGIA 4ZHRA 2VG7A 3QIPA 2GUIA 4BDZA 3QNOA 5HROA 3HJFA 3C6TA 4DTSA 1S9EA 3ASMA 4KHSA 3WNEA 3S9HA
chains in the Genus database with same CATH superfamily
4FOIA 2D1KA 1WSGA 3L2QA 3QEPA 4F3TA 3CPEA 1U45A 3I33A 3MCAB 3H1VX 4K42A 2FC0A 3HO1A 1T8EA 1U04A 1U4BA 3O3GA 1D4XA 3CC4N 4KPYA 3G10A 3KD5E 4DF8A 4RW6A 4FLWA 2D0BA 1XC9A 4H5NA 1XHXA 4E0DA 1JLGA 1GLFO 2P9UA 4U67L 1YI2N 1KAZA 5DM7L 3O3FA 3P4IA 4AH9A 2VG5A 3J80O 3NH0A 3T1AA 3ZLJA 3OYJA 1MA9B 3QINA 5FDLA 3P5JA 4LY7A 3RR8A 3FZLA 4C8NA 4I7FA 2KFZA 2B4JA 1NLVA 3DLRA 4CJPA 4KTZA 1Z6RA 4CHPA 3UKUA 5EXWA 3HXMA 1I3AA 3LDLA 1WSEA 2NUBA 4JKFA 3CPWM 3EL2A 4PKIA 4KHUA 1JLAA 4DSIA 3CJ7A 1RDDA 4IFEA 4BROA 1VQNN 1RDUA 1NGJA 5HRRA 4R79A 4JI8K 3ZSWA 3CD6N 4KREA 4DUYK 4L3QA 3BGRA 4NCAA 4CI6A 3HP6A 1VQON 2ZGZA 3ENBA 3F2KA 3T19A 1MWKA 4OKKA 4JS5A 2GWKA 5ELZA 1RT4A 1SKSA 4YFUA 4DV2K 3VQ7A 4G9ZA 4JEPA 4YOYA 1RBVA 5AR0A 3BZCA 1NU0A 3L8BA 3LM9A 1YJWN 1DTTA 5TKYA 2P9PA 3DWLA 1G99A 4JI6K 3J81O 3ZT0A 3TAFA 1TKDA 4YOVA 1O13A 4GV9A 4C23A 4O8UA 1NJZA 3BF3A 4M3UA 3AVJA 4K43A 1W2BM 2E2QA 4GNIA 4AHUA 2D4WA 4H0PA 1EWRA 3VA3A 3PSFA 3VQ5A 4CJEA 1RT3A 4CERA 4M42A 2YNGA 1S6PA 5GAGP 4RWTA 2DPNA 1ESVA 1RBSA 1C1CA 1HJOA 4CEOA 1T3VA 3MEGA 3CCQN 3TTDA 3A8YA 4DR3K 3ZCMA 3ZT3A 1SL0A 4MLEA 3L0QA 1DTQA 1WUAA 2E6LA 4IBNA 2YHAA 3FFKB 4EZ6A 3B6PA 2XY5A 3VQDA 2QKKA 3ID8A 3OA9A 3H08A 1NGIA 5HBMA 1VRUA 4M3TA 1UAXA 1XC3A 3LWLA 3THYB 4CJ5A 3QEXA 2FF3B 4E19A 4CHNA 4BVOA 3S3MA 2NRZA 5KTQA 3S9HA 2IS3A 4H5RA 2HBKA 4GVMA 1YJ9N 1XWLA 4X62K 1ZBLA 3Q7CA 3CFOA 4IJAA 3UB5A 1NK4A 3VESA 4KHWA 1JCFA 5CYQA 3O9RA 4OVLA 5IWAK 4FWQA 3PSIA 4DR6K 5FLXO 4DLGA 3SJHA 1HX1A 2HVHA 5AQFA 2NLXA 3J8AA 4JLHA 4B9SA 3ZSOA 2O8CB 4ICLA 4FJXA 2YNFA 3TAQA 2O8EB 4WCEL 4FJ5A 3BY5A 2P1JA 3U9ZA 2HHVA 3R3LA 4CJ3A 3SUNA 1BI4A 3H3OB 1BQMA 3O9TA 5AQRA 2F96A 5ADXH 5C10A 1RILA 1TUUA 4E1NA 1IBKK 1HNVA 4E7KA 3TABA 4QOZB 4JKCA 5KPZA 4CD1A 3EN9A 3S3NA 2P9UB 4JKEA 1N8RO 5C2DA 3CQ8A 3KWGA 1NBWA 1R0AA 1ATSA 3VEVA 3G25A 4QS8A 3M8RA 4DR4K 5J1EA 3OYKA 2FF6A 3B6OA 3CCEN 3WUHA 1IH7A 4DU4A 1T05A 3D45A 3WXKA 4BRGA 2NNWA 4YOXA 3V9UA 2O4IA 3NAEA 1T6CA 3QEIA 3K5LA 4LSLA 4B1UB 4JD2B 4HWIA 1TK8A 2G8KA 5CY4A 4CHQA 1Q9YA 4LF5K 1TAQA 3EEQA 1D9FA 3QMLA 3VEZA 4FCYA 1NJXA 1CLQA 1HNWK 1LCUA 2OPSA 1YVUA 5AQPA 3KD1E 3M8SA 3IUCA 4B3SK 2QWPA 2QWRA 2O8DB 3L3UA 1S9GA 1RBTA 3OBWA 4XH1A 4ID1A 2ASOA 3TSUA 3OS2A 1C0MA 3ITHA 3VENA 3S41A 3Q7BA 4CJ4A 3VF4A 4CJLA 4DTXA 5SWMA 4BRLA 4J2DA 2HHUA 2YHWA 3AAQA 4LF4K 3MEDA 4CGIA 2Q0RA 2P9PB 4N41A 1VRTA 3MN5A 1TK5A 3JYTA 2NRTA 1QQNA 4FK4A 3V9XA 5FPMA 2QXFA 3FR0A 4DQQA 1EKEA 3TAEA 1KQSM 5HL7L 4IO8A 2D0PA 4CEFA 4AILC 2IVNA 1XHZA 4W5TA 3A5NC 2CGJA 3ATUA 1BIZA 2P9LB 4FZXC 1J53A 4B8AB 4BRIA 3O4QA 1HQUA 1F21A 4FJ7A 1Q18A 2ZQBA 4BRAA 4BE0A 4JKBA 3CCJN 1OVYA 3C0BA 4MO4A 3DJCA 2YX6A 1FW6A 3AO3A 5GADP 2EX3A 3OYGA 4NLBA 1HKGA 3NGYA 2D5RA 4CEAA 2ZGYA 4C8MA 2WUSA 3MWPA 2EHGA 4NYFA 4YOTA 4X66K 1TUYA 1YVNA 1BL3A 3V1QA 4FWSA 3ZT1A 3UIQA 1LW0A 1NKBA 3HPHA 4GW6A 5KPRA 4B9TA 2F9WA 1S3XA 3KTQA 2OANA 1NMDA 3K5NA 4JHDA 4FPBA 3RMBA 2F4VK 3AVGA 4AHTA 4DSLA 1KTQA 1LOTB 4CEEA 4IFYA 1NJIO 1D8YA 2QTDA 1LAVA 1BISA 1JLCA 1HQEA 2BUPA 1BU6O 3BDPA 4DHYA 1MU2A 3U9DA 4AQYK 2HVIA 2A1SA 4KFBA 1MWMA 4W5NA 1BO5O 4ILHA 1OH5A 2YHBA 3HM8A 1NGHA 3I0RA 1QVFM 5DM6L 3LAMA 2NRXA 3QNNA 2OZMA 3U8XA 3CM5A 2P9KA 4MFBA 3SNNA 1FJGK 5I42A 3V1OA 3KK2A 1IKVA 4DQ8A 3D2EB 4DV5K 4PA1A 2J4RA 3CFRA 4FK2A 2HOEA 2JLEA 1C0GA 3DOKA 3CCVN 2G8VA 4OO1J 3AVBA 1IJJA 3J7AP 4Y0WA 2FBVA 3MEEA 1ZBUA 4ZHRA 1NM1A 5HROA 2GUIA 3QNOA 2NRVA 4DR5K 4BRFA 2VYPA 4KH6A 3V81A 3PUFA 1RT6A 3SYZA 3CI5A 5J2QA 4NXNK 4W5OA 1Q9XA 1XI1A 1NK0A 5EX5A 1OKJA 3V9SA 2DFEA 3BZKA 4LFAK 1NG9A 4CJTA 4DSKA 5AFUA 4DFPA 4RG8A 4MDBA 3PV8A 5JS1A 3DLBA 3QO9A 4BQLA 1RBUA 3MN9A 2QW9A 1ATRA 4CF8A 4DSFA 4M63C 4RCHA 4BRCA 4DFMA 4WQ4A 4FJIA 1WOQA 3L4QA 5C2FA 2GEMA 1UOCA 3TSQA 3VPZA 2OPQA 4NCGA 1RT2A 3HBTA 3NGZA 2VG6A 3VERA 4C8OA 3O08A 3N4PA 1VSDA 1QSSA 4JKDA 1KVCA 4BGBA 3KK3A 3LALA 4LH5A 4M3YA 3E9OA 2AP1A 1GLAG 4B8CA 5JS2A 1HNXK 1QZ6A 1JLFA 3C6AA 3G4SN 3FZKA 3EZ5A 1S72N 3KIOA 3TR8A 2Q2RA 4JI2K 3CG7A 1VQMN 3ZX0A 1DKGD 1X3MA 3NFAA 4FWOA 4FJNA 4ID5A 1JKHA 5JVGL 5C25A 1GOBA 4FJHA 1U6ZA 1XNRK 4FWNA 1XMOK 3C6UA 2UXBK 3RTVA 5AQHA 1NK7A 2KFNA 3C7NB 1JCEA 3D2FB 3I8BA 4M41A 4I2PA 3NE6A 3QBWA 5BR9A 2ZE2A 4FWKA 4BR5A 5AQUA 1KSPA 2QXLA 4CJKA 3D6RA 2ZJPL 1VSEA 3PIPL 3OYCA 5H1SQ 1W0HA 4OJRA 4MLHA 4CBXA 1WNSA 5C0YA 5AQIA 1BA1A 3OS1A 3L6QA 5AQZA 1KFDA 1HYSA 3P31A 1HR0K 2RPIA 4Z0UA 5BPLA 3A5LC 2ZJQL 3CIPA 1OH6A 2WC9A 1HYVA 4BRKA 3OJSA 1LW2A 1QHTA 3KHYA 4PL8A 3I55N 1CZ9A 5EOYA 1WAFA 3A0IX 3VTHA 1YTUA 2F8TA 3THVA 2V52B 3WNHA 1A5WA 3UE5A 4FJMA 5LMNK 1RDBA 2HW3A 3LM2A 2I7NA 2DY4A 2KKZA 1DEJA 5JLFA 4C8LA 4A57A 1YXQA 2P9KB 1HUXA 5AFUH 4BWJA 3PX0A 3OYMA 3ENHA 5KI6A 1O1WA 4BG8A 3VQ8A 3KKSA 2CGLA 3HRGA 3TARA 2UUAK 1XMQK 3SAGA 4XH5A 3G0ZA 3VQBA 3CCSN 2P9IA 4DLEA 3R1XA 4CJWA 4IOXA 1X1PA 1VSLA 2BANA 2KZMA 3CJ1A 1LWEA 2Y1JA 3KJVA 2XY7A 1YTAA 4JD2A 5ADXA 1WSFA 3HPOA 2YKMA 3PO4A 1Y64A 2YV0X 3QERA 2Z1HA 2BE2A 2E2PA 3RSEA 2E6MA 4GKJK 4KH4A 4B9QA 1HNZK 1Q82O 3LDQA 3P39A 1KVAA 1QVGM 2O8DA 3MK6A 1X9MA 1NGAA 1N33K 2OCEA 2OPRA 3KLEA 5I3UA 2VWBA 2E1ZA 4LH4A 4Z4CA 5JICA 3TSPA 4M3RA 2GTDA 3VTIA 4DKWA 5E84A 3TAGA 1T44A 1TV6A 4DV4K 4J2BA 3AO5A 4A62A 1JLEA 3E1YA 3TTFA 3SMSA 2F7TA 4OLAA 4H4MA 3TI0A 1JL2A 3SCXA 3SLCA 3L2UA 1WSHA 3JS6A 3ATVA 4DV7K 4BR7A 2PZSA 3LAKA 1YAGA 1IV0A 3H6EA 4WQ4C 1RDWX 3JAMO 3TTCA 4BREA 3HVTA 3VQ6A 4B1YB 4H5WA 1C1BA 1RTDA 5T7BA 3H1QA 1ASUA 2Q36A 3OTOK 4KTQA 4FW2A 2P9LA 3SBTA 2YHXA 1LV5A 3E9PA 2JWLA 1NGBA 1J6ZA 3NH2A 2P9NA 3CERA 3DRRA 2A6AA 1NKCA 3IRXA 5GAHP 4JRQA 4G1QA 4J2AA 1SV5A 3L4IA 4I9QA 2E5LK 2NRRA 5TKWA 4WF9L 4HVJA 4FW1A 5MLCQ 3QETA 3FFIA 1ZBIA 5E26A 1KLMA 3DM2A 1NNEA 5C15A 3MN6A 1SKWA 3VMFB 4BR9A 3QEVA 1XQSC 4WFNL 2FSKA 2OZSA 4BC2A 3T69A 2GX9A 3ZYYX 5KPTA 1RT5A 3NCIA 3PLAA 4PHTX 1S1UA 4N47A 1UA1A 1QS4A 4JK8A 2Z1JA 2XY8A 3MWTA 3CETA 4KTWA 1SAZA 2HHTA 3AVNA 4H0OA 4FJ9A 3DYAA 4PQUA 5CE3A 2FBXA 3SV4A 1BDGA 4UY8O 4DTOA 1TL1A 4CGGA 2Y1IA 1WLJA 4KH5A 4F2SA 1K6YA 4DF4A 4M45A 4CECA 3U4LA 4YHHK 1NJWA 3R8EA 1K8AO 2G8IA 4NCBA 1WBDA 1UWBA 4A61A 3ZX2A 5J2MA 5KQDA 4O8KA 3EKUA 1L5UA 3GG4A 2DFFA 1E4FT 3CM6A 1S1VA 3FGUA 4Y1DA 3NHGA 5KGWA 4QS7A 3M3ZA 3P38A 2HBMA 5JVHL 3D2EA 1HNIA 2OTLN 1BA0A 4XH4A 4CEQA 4CIFA 3L2WA 3FLCO 2VQFK 2W40A 1D9DA 1WN7A 1RTIA 3MX5A 2HSTA 1YIJN 4CCHA 4KAZA 4CF0A 2P9IB 1GLEG 4YOUA 5GAEP 3JSMA 1N34K 1VSKA 2IVOA 3BEXA 1CZBA 4B9VA 1I39A 4I6MB 2Q0UA 4JK7A 5AQGA 5FPDA 1HKCA 2OA8A 4H0XB 4HHTA 4E1JA 3OHRA 3WEEB 3HYFA 4E3SA 3VEOA 1L3VA 1OH8A 1RDAA 3RSEB 3G71N 1SQKA 3M8QA 4YORA 4DR1K 1IKYA 1JCGA 2RF2A 3AA5X 1Y97A 4JNEA 4FJJA 4BR4A 3WNFA 4DCHA 4H5TA 4FWLA 3HOTA 3FE1A 3OYLA 3VQEA 1YT3A 4PY5A 1Q8IA 1VK0A 4JKHA 2GV9A 4FLUA 1V4TA 3ZETA 4CZIA 1RT1A 3MDQA 2XY6A 4JI5K 1RT7A 1TVRA 4ISGA 4EHUA 5LJVA 2GUPA 2UXCK 2VG7A 4BDZA 3HJFA 4DV1K 1S9EA 5E41A 4CK3A 2YNHA 3K59A 5AQYA 1VQ7N 4LF9K 3V4IA 4JI4K 4BQZA 4WFAL 1DLOA 1VSJA 2KTQA 1Q7YO 1J5EK 4FVUA 1T6DA 1JXEA 4A5AA 2EWSA 4FWMA 3QESA 2O8BB 4KV8A 1EETA 5HRNA 1NGDA 3SMPA 4EP4A 3U3YA 2ZJRL 3QBXA 3C6HA 5B8HA 4FK0A 1RNHA 1C1AA 2P9NB 1YITN 1WSIA 1QE1A 2IIRA 4DG1A 3RR7A 4KHNA 3LPUA 1TK0A 4EP5A 1M90O 4C8KA 3O80A 4B1ZA 5LL6Z 4E7HA 3SUPA 4IOAL 4DTMA 1NOZA 3MECA 3T1YK 2JGUA 1JJ2M 3C7NA 3D2FA 2PFUA 2HNYA 2XRIA 4PKHA 4CHOA 3SPZA 2YKNA 5KGXA 1FXXA 3O8MA 3L3VA 1VQ5N 3AA4A 4RW9A 4FM2A 2W6LA 2OYQA 4H4OA 2A5XA 1NWKA 4OPJA 3LWMA 3GOIA 2UYTA 2X6SA 3ZSXA 2A1RA 4JN4A 5AQKA 3VF2A 2O8FA 3SUQA 2CH5A 2WFBA 3EE9A 5LY3A 4DMNA 1NK6A 4WQ5A 3BUZB 2QA4N 3GDQA 1HRHA 3D7EO 3K5OA 2YJFA 1VQKN 3HK2A 3M5RA 5AZIA 4CBUA 3AVAA 4CF2A 3AVHA 2WOMA 4J2EA 3E66A 3CJCA 4DS5A 2PBDA 1WBBA 3H45C 4N5SA 3O4NA 2GELA 1KAYA 4BRDA 5F0XA 4FLTA 4E89A 1MDUB 3WXLA 4KBOA 1TKZA 3KLGA 4O44A 5K14A 1E3MA 2H3GX 3ULEA 3THXB 5M1QA 4DQRA 3C65A 2QI2A 3AGKA 4V19S 3VOVA 3O6WA 4DV3K 2GWJA 5HP1A 4OKJA 1L3TA 2V51B 4O0IA 2QWQA 2W41A 4EHTA 3FZFA 1KD1O 3RMDA 3MXJA 1P90A 3T7ZA 3SV3A 3ISNC 1NGGA 3R9PA 4BC3A 3AAPA 3NBPA 3O4WA 3OYDA 4HUEA 4JYAK 4XIUA 3VETA 3OYBA 3LDOA 2IDOA 1BIUA 3EZWA 3JXUA 1X9JA 3AVMA 1GOCA 3AVKA 1FKPA 1BWFO 3O1WA 4IOCL 1L3SA 4GY2B 2ZF5O 3EKSA 5J2NA 2ATQA 2P9SA 2NZTA 3LL3A 4CEBA 2DTUA 5AQNA 4DV0K 3T1HK 1TKTA 4ISEA 4BG9A 4H0VB 1ZBHA 4WFBL 4K8ZA 4AHSA 4AM7A 3DLKA 1C0UA 3NF7A 2Q3SA 4IFVA 4FJKA 5KQ8A 1IO2A 4BVPA 3SQ4A 4CZJA 4CJFA 2ASMA 4CF9A 3V6DA 3P1GA 4RW7A 2G8UA 4A59A 1ILYA 3SAFA 1GLDG 1HLUA 3LANA 3CFPA 4IXCA 4LD0A 3ZETB 3RRHA 3CMEN 3C94A 2XO7A 4O5BA 5GINA 2VQEK 2FLOA 1Z05A 3I0SA 1GLBG 2P5GA 4FJLA 1T03A 1B9DA 2JWKA 1VSIA 1IG9A 4CFCA 3HTVA 3WXMB 5M1KA 4Z94A 2IVPA 3VEWA 3VN5A 3K9JA 3GE1A 4CVNE 3A5OC 1YJNN 3N4QA 4CBWA 3KLHA 4JRPA 1KXPA 2W42A 4AHRA 3AVCA 3DXKA 3NDKA 1KC8O 3O9QA 2NRWA 3BP8A 1ASWA 4DUZK 2KW4A 2QKBA 4FM0A 1BUPA 2PYLA 3H46O 2OPPA 2HHHK 4ELTA 3ZEUA 3K0SA 3MMVA 1EXQA 3ZSQA 5HRSA 3EY1A 1R59O 3SBGA 1NKEA 4K0KK 4MO5A 4B3MK 3FZHA 2FBYA 3CXCM 3RMCA 1VSMA 4Z4HA 2G8HA 4OGEA 4H8KA 2V7YA 1S1WA 1E4GT 4ZTFA 2QWOA 3LDSA 4N76A 3HSTB 3UKRA 1HPMA 2KLAA 3ZSRA 4YDUA 3NF9A 2FXUA 4CFBA 1IBLK 2O8FB 2G8FA 2HBLA 1XNQK 3PX4A 2VCPA 1TYQA 3CC7N 1IKWA 5AQOA 5AZIB 2BH1A 4IDKA 2RHKA 1KLNA 3O5BA 3V1RA 4JKGB 1OVQA 1BG3A 4CZEA 1QTMA 2KQ2A 3L2VA 3SI6A 4FLXA 1XUPO 2ETJA 4ELVA 4KHPK 1HMVA 5C42A 3LP0A 3E9LA 3IS9A 1RTJA 3SJJA 2HHQA 4PWDA 4Z4EA 1SL2A 4H5VA 3KK1A 3R6MA 4WQ5C 3OYAA 2HF4A 4BDPA 5AZJA 3ULEB 3RMAA 1EX4A 3OYFA 3QFPA 3E01A 1VQPN 1RBRA 4MQ3A 5F1XA 3AGRA 3SZ2A 4FYDA 4ELUA 4LSNA 3KK7A 3ZSVA 5EVZA 1QQMA 5CHIA 3S3OA 2IOCA 4CZLA 3H3NO 2X78A 5BPMA 4JV5K 1CZAN 3QDKA 4M7XA 4IEIA 5AQXA 5M1NA 4YOWA 1EP4A 2UUBK 4OGCA 4BGAA 3AO2A 4I6MA 2Q1NA 3AVFA 2P9SB 2GBZA 4H03B 3G6EN 3PY8A 3ZT2A 3HPGA 1RFQA 1ZYQA 5D3GA 4J8FA 3WEEA 5CZ2A 5EY4A 3KWIA 1EQYA 1KFSA 4K41A 3D0PA 3LDNA 3CQXA 2OTJN 3WNGA 5AQVA 1U2VA 3KLFA 4NB4A 4CK2A 4KRFA 4F8RA 4QAGA 4KB1A 2HF3A 5F2RA 4FOEA 2UXDK 2Q31A 4N56A 3W3DA 3U6FA 1Q86O 4DB3A 2BDPA 1TGOA 2PAVA 1BCOA 3VQ9A 4HCCA 4FPAA 1QZ5A 1J9AA 1JXBA 5AQQA 3PIOL 4KB0A 2BGGA 3QB0A 2HNZA 3RWUA 2ITGA 5J2PA 2R7YA 3TANA 3OBYA 4DQPA 2E20A 4CHZA 2I5JA 4A5BA 3NF6A 3K5MA 4DU1A 4BRPA 3I56N 5FRMA 4DTPA 3F73A 3HOSA 1WAJA 4BRNA 1OH7A 4BRQA 1TAUA 1A5XA 3THWA 3ZSZA 2A41A 3HVRA 2O8BA 4GVEA 1ZC6A 2D0CA 5BRFA 4Y1CA 1HJRA 1QHAA 4WE1A 4FVMA 3PX6A 3DXKB 2WBNA 4FLVA 1SKRA 3W0LA 1W97L 4JS4A 4CGFA 1M1KO 1NK8A 2VGNA 3VQAA 1X9WA 1SS6A 1YHQN 3RVCA 3ZEUB 4FLYA 2E2NA 1SUQA 4A2AA 2PY5A 4CD3A 3VQCA 3K2PA 4BRMA 3TWHA 1VQ8N 3AVLA 4DU3A 3CMAN 3QIPA 3C6TA 3WNEA 4F2RA 2E88A 3WQUA 4EZ9A 4RTFD 3HL8A 1K8KA 3CYMA 3J7YP 5DMRA 5M1PA 3K58A 3UKRB 5HLFA 2QWMA 3O1BA 3DXMA 4GMJB 5KRSA 1CXUA 3SUOA 1SZ2A 1BOTO 5HRPA 4NXMK 4DQIA 1TYQB 2CGKA 1DT9A 5FPEA 3ULDA 1DGKN 4I2QA 4FM1A 3VQPA 3SQ2A 3MXMA 3TPQA 4E7JA 4B08A 4YNQA 4DWIA 4DS4A 2A42A 2WONA 2PYJA 4GV3A 2Z1IA 1L3UA 4Z4IA 4DV6K 5BREA 3DLHA 4CGJA 3ZX3A 5BRHA 5CR4A 3OYHA 4YDUC 3AO1A 4DFJA 3AV9A 3CJBA 1C0FA 2G8WA 4AM6A 4CK1A 5AZJB 1Z25A 3THXA 4LF6K 2RN2A 3M6GA 4PKGA 3ZSYA 4CIGA 3MCPA 3CQYA 1LWFA 2F8SA 2HHXA 4B3TK 1VAZA 1BQNA 4FL9A 4FWRA 2YNIA 3IG1A 3I8DA 4CZMA 2YCHA 4C1NI 4EFHA 2A40A 4JI1K 5AQWA 4CJQA 4FLZA 3OS0A 3HT3A 4KHYA 4AHCA 3M8PA 1U49A 3T3FA 4JI7K 4FJGA 4CZHA 3ZT4A 4CFDA 3L2RA 5AQJA 1P8ZA 4CJ7A 2RE2A 4IKFA 4U7BA 1GLJO 3HP9A 4CF1A 3OJUA 1JLQA 5AQMA 4Z4GA 1IBMK 3DLGA 2B6AA 3UKUB 1W9HA 4KO0A 1S6QA 2AA4A 2VWJA 2KZZA 3VGMA 5C24A 1U2VB 5KRTA 4AHVA 3K57A 4QS9A 4FO0A 3LP1A 4E7LA 3OY9A 5FPNA 4HCBA 5FRNA 3DI6A 5SZTA 5I9EB 4M7YA 5FROA 1RGIA 5AQTA 1WB9A 4BE1A 4RW8A 4EIAA 2P51A 4CESA 1N36K 4H0YB 2UUCK 4BC4A 3QIOA 4OLBA 2QEXN 4W5QA 3K9KA 4JAXA 2YJEA 3VGKA 1VQ9N 2F9TA 1N5YA 5BR8K 1REVA 2VWKA 2E1YA 1X3NA 4CJUA 1VQLN 2ITMA 4DQSA 3QEWA 2KHOA 1S22A 4CJVA 3THWB 1HYZA 1RDCA 4AF1A 4RW4A 4DSEA 2IAJA 4HUGA 3OW2M 5IT9O 4DR2K 3P83D 3WQTA 2D0AA 4LC9B 2ZD1A 4WYBA 2P5OA 2A3ZA 3KVGA 1HPZA 3MAQA 2Q97A 4B1VA 5GIPA 4FXDA 3DAWA 3GBTA 1ZXOA 4CGDA 4HTUA 2NRHA 2DFHA 3AO4A 5LJWA 5C12A 2YI1A 1V4SA 4BE2A 3IMXA 2FBTA 4Z4FA 5CZ1A 2QK9A 1VHXA 1NK9A 3IAYA 3VGLA 3F5TA 4JI3K 3ALYA 1S5JA 3CC2N 1BGXT 4CHYA 1K8KB 5HOOA 2V7ZA 1VSHA 4IEEA 3AVIA 3VF6A 4CZFA 3F9KA 4IG3A 3QFUA 5BN8A 3DXMB 4O4GA 4TSXA 4ILGB 5BN9A 5A2QO 3LZIA 1CXQA 4DFKA 1KRPA 1YUWA 2B5JA 3SAHA 3O9UA 4QCLA 3OYIA 3DOLA 4CZKA 5LMUK 1S1TA 1JLBA 4DTJA 4A2BA 3SQ0A 4CE9A 4CEDA 5AJ3K 3HM9A 3KKRA 3DRPA 4F9OA 2O4GA 4JKGA 1FK9A 4E1MA 1GLCG 3DRSA 2VGMA 2ZM6K 4B3RK 4O5FA 3CF5L 4CJSA 3QICA 3A2FA 4ILJA 4LF7K 3NMUA 2HHSA 3V9ZA 2IC3A 2YHYA 1G15A 3AA3A 1NMNA 5DK5A 3PO5A 4Q0BA 3AARA 1D5AA 1NOYA 5BRDA 1BHLA 4CIEA 5JLHA 4KI6A 4W5RA 3OYNA 3MN7A 1QQCA 4B9LA 4CJRA 1ATNA 2I7PA 4B1XB 3VEYA 1BI4B 4KKOA 3C95A 2HBJA 2X74A 1K9MO 2XHBA 1TL3A 3O3HA 4L8RB 4LFCK 4CW7B 5BPNA 2BTFA 3SK3A 4FZZA 1Z26A 1VQ6N 2HHWA 4OPHA 1NGFA 5JMVA 3MX2A 4JI0K 3HZ6A 2ZWHA 3CCRN 4GKKK 4IWVA 3VEXA 1NGEA 3WT0A 1B92A 4BRHA 4DSJA 1QSLA 4M3WA 3QLHA 4CFAA 1LWCA 3LP2A 3B8AX 4NYNA 1NJYA 4UQGA 1J5OA 3NF8A 3EO3A 3LPTA 4IO9L 1C0TA 3U3GA 1VQ4N 3OYEA 4KHQA 4CZGA 1SL1A 3TU5A 1VSFA 4JKAA 5M1FA 2LSNA 4H0TB 3DLLL 4DTUA 4CEZA 2QWLA 3HSCA 4IDHA 4HUFA 4OPAA 4FWPA 4DTRA 3J7ZO 4R5PA 3BF1A 2HB5A 1C6VA 3DMJA 2CH6A 3IFRA 1N32K 1KCFA 1ZBSA 1U47A 5EU7A 2E2OA 3ID6A 3VQ4A 3NVMA 1QSYA 3LDPA 4X65K 1FKOA 4CGHA 3HI0A 4OPKA 4X64K 3WXJA 4NO7A 3CCLN 3CJAA 1RTHA 4M3XA 3EYZA 3SQ1A 1A5VA 3OVNA 4C1NK 4B9MA 4FZYA 4BC5A 1JL1A 1J54A 4IJNA 3CJ9A 4O0JA 3AA2A 4DTNA 1QQOA 2X6NA 1RCHA 2W6KA 4E7IA 4BWMA 1N6QA 2ASPA 3RRGA 4BACA 1WSJA 3WXIA 3AY9A 2RKIA 2E8AA 1K73O 4IZ9A 4MDAA 3KLIA 4K25A 4OKEA 3ENOA 4HTLA 4XEIA 1S1XA 4B1WB 3IDHA 4F4KA 4DR7K 4O55A 3SPYA 1KAXA 5AQSA 4LF8K 4BR2A 3TAPA 1ZBFA 4EAHD 2FSNA 2QWNA 1NK5A 1Q81O 3VQQA 4GV6A 1ASVA 4BR0A 3O9SA 5CYMA 4PL7A 3EE8A 4ISFA 3NVKA 2UU9K 3F9MA 4YY3K 2E4LA 4PUOA 2HMPA 1LAWA 4I9LA 3VA0A 1IKXA 1U48A 1GOAA 1I94K 2WTUA 1BCMA 4Q5VA 3V9WA 1UA0A 4FSVA 4B9NA 2AJQA 4OX9K 1IG8A 2Z1GA 4ZTJA 2HMIA 1HKBA 1GLLO 3CHWA 3LP3A 4K8XA 3FZMA 3TAMA 3IKMA 4BY9C 4KI4A 1W7AA 1TKXA 4IG0A 4B9UA 1YF5L 3THYA 4BDYA 3NH1A 4B3OA 1KVBA 1T7PA 5GIOA 3M1FA 1ITGA 3CCMN 4FJ8A 4F3OA 1B9FA 1EO1A 3MXIA 3A5MC 1H1VA 3GL1A 2FSJA 1EWQA 2HNDA 4NLCA 5AQLA 3LZJA 4LFBK 4JHDB 4M3ZA 5M1OA 2QM1A 3KZBA 1X9SA 2O8CA 3CCUN 1NGCA 2O8EA 2IGIA 4DTSA 4KHSA 3DLEA 3ASMA 2D0OA 3NGIA 4JK9A
chains in the Genus database with same CATH topology
4F2RA 4CK3A 2YNHA 1WSGA 3K59A 3L2QA 3V81A 3QEPA 3PUFA 3V4IA 4EZ9A 4F3TA 1U45A 3HL8A 1DLOA 1RT6A 3CYMA 1VSJA 3SYZA 2KTQA 5DMRA 5J2QA 3K58A 4W5OA 1Q9XA 2FC0A 5HLFA 1XI1A 3HO1A 1T8EA 4GMJB 1NK0A 5KRSA 1U04A 1CXUA 1U4BA 3O3GA 1JXEA 3V9SA 2DFEA 3QESA 4KPYA 4KV8A 1EETA 5HRNA 3SUOA 3G10A 4CJTA 3KD5E 4DSKA 5HRPA 4DF8A 4DFPA 4EP4A 4RG8A 4RW6A 4FLWA 3U3YA 2D0BA 1XC9A 3PV8A 4DQIA 5JS1A 1XHXA 3DLBA 4E0DA 3QO9A 1JLGA 1RBUA 3ULDA 4FK0A 1RNHA 1C1AA 4I2QA 3VQPA 4CF8A 3O3FA 4FM1A 4DSFA 4E7JA 3SQ2A 3MXMA 1WSIA 1QE1A 4B08A 4YNQA 4DFMA 4DWIA 4DS4A 4FJIA 4AH9A 2VG5A 2WONA 2PYJA 3NH0A 3T1AA 1UOCA 2Z1IA 4DG1A 3OYJA 1L3UA 3LPUA 3RR7A 4KHNA 3QINA 1TK0A 4Z4IA 4EP5A 5FDLA 3DLHA 3P5JA 4LY7A 2OPQA 4C8NA 4CGJA 4I7FA 4NCGA 3RR8A 4C8KA 1RT2A 2KFZA 2B4JA 3DLRA 3OYHA 4E7HA 3SUPA 4CJPA 4DTMA 1NOZA 3AO1A 3MECA 2VG6A 3AV9A 4KTZA 3NGZA 2JGUA 4DFJA 4CHPA 4C8OA 2G8WA 1VSDA 1QSSA 1KVCA 2HNYA 2XRIA 3LALA 1I3AA 4LH5A 4CK1A 3KK3A 3HXMA 4CHOA 1Z25A 4M3YA 3SPZA 2YKNA 5KGXA 1FXXA 1WSEA 2RN2A 2NUBA 3L3VA 3ZSYA 4CIGA 4B8CA 3AA4A 1LWFA 5JS2A 4RW9A 2F8SA 2HHXA 4KHUA 4FM2A 1JLAA 1BQNA 2OYQA 1JLFA 4H4OA 4OPJA 4DSIA 2YNIA 3IG1A 3EZ5A 3I8DA 1RDDA 3LWMA 3KIOA 2X6SA 3ZSXA 3TR8A 2A1RA 3SUQA 5HRRA 3ZSWA 4KREA 4CJQA 4DMNA 4FLZA 3BGRA 3CG7A 3OS0A 1NK6A 3HT3A 4NCAA 1HRHA 4KHYA 4AHCA 3M8PA 3NFAA 3K5OA 3HP6A 1U49A 3HK2A 3T19A 3AVAA 3T3FA 4OKKA 4CF2A 4JS5A 4FJGA 4FJNA 3AVHA 4ID5A 1JKHA 2WOMA 3ZT4A 4CFDA 5C25A 4J2EA 1GOBA 4FJHA 3L2RA 4DS5A 1RT4A 1SKSA 4YFUA 4IKFA 4Z4GA 3HP9A 4CF1A 3OJUA 1JLQA 3C6UA 3VQ7A 4N5SA 3O4NA 3RTVA 1RBVA 4FLTA 4E89A 3DLGA 2B6AA 1NK7A 1W9HA 2KFNA 3L8BA 1TKZA 3KLGA 4KO0A 1S6QA 2KZZA 1DTTA 4O44A 5K14A 2VWJA 4M41A 5C24A 3ZT0A 4I2PA 3NE6A 5KRTA 3TAFA 4AHVA 3K57A 4DQRA 1TKDA 3LP1A 1NJZA 2ZE2A 4E7LA 3OY9A 1KSPA 4M3UA 3AVJA 4HCBA 5FRNA 3DI6A 4CJKA 5SZTA 5HP1A 4OKJA 5FROA 1VSEA 4AHUA 1L3TA 4O0IA 3OYCA 4BE1A 4RW8A 1W0HA 3VA3A 4OJRA 2P51A 4CESA 3VQ5A 3RMDA 3MXJA 1WNSA 4CJEA 1RT3A 3QIOA 3SV3A 4OLBA 4CERA 4M42A 2YNGA 3ISNC 1S6PA 4W5QA 3NBPA 3OYDA 4HUEA 3OS1A 4XIUA 3OYBA 2IDOA 1BIUA 1KFDA 1RBSA 1C1CA 1HYSA 2RPIA 4Z0UA 4CEOA 3AVMA 1N5YA 1GOCA 3AVKA 1FKPA 3MEGA 1REVA 2VWKA 4CJUA 1L3SA 1HYVA 3ZCMA 3OJSA 1LW2A 2ATQA 1QHTA 4CEBA 4DQSA 3ZT3A 5J2NA 3QEWA 1SL0A 2DTUA 1DTQA 2E6LA 4IBNA 1CZ9A 1TKTA 1WAFA 2YHAA 1YTUA 2F8TA 3THVA 4CJVA 4EZ6A 1ZBHA 1HYZA 1RDCA 3B6PA 2XY5A 4K8ZA 4AHSA 3VQDA 3DLKA 2QKKA 4RW4A 3WNHA 1A5WA 4DSEA 1C0UA 3DLEA 4FJMA 2IAJA 3H08A 4HUGA 3P83D 5HBMA 3NF7A 1VRUA 1RDBA 2Q3SA 4IFVA 1UAXA 2D0AA 3LWLA 4FJKA 4M3TA 2HW3A 1IO2A 4CJ5A 3QEXA 2DY4A 2ZD1A 4E19A 4CHNA 4C8LA 3S3MA 5KTQA 2P5OA 3SQ4A 2IS3A 4GVMA 4BWJA 4CJFA 4CF9A 3PX0A 3MAQA 1HPZA 1XWLA 3OYMA 3P1GA 5KI6A 3V6DA 1O1WA 3CFOA 4RW7A 1ZBLA 2G8UA 3VQ8A 3KKSA 1NK4A 4FXDA 4KHWA 3LANA 5CYQA 4OVLA 3CFPA 3TARA 4LD0A 3RRHA 3C94A 2XO7A 4O5BA 4CGDA 4DLGA 4HTUA 2HVHA 2DFHA 3AO4A 3G0ZA 4JLHA 4B9SA 3ZSOA 4BE2A 3VQBA 4ICLA 4FJXA 4DLEA 2FBTA 2YNFA 3TAQA 5CZ1A 4Z4FA 4CJWA 4FJ5A 2QK9A 1NK9A 3I0SA 2P1JA 2P5GA 4FJLA 1X1PA 1VSLA 2BANA 1T03A 3IAYA 2KZMA 1LWEA 1B9DA 2Y1JA 1VSIA 3KJVA 1IG9A 2HHVA 3ALYA 1S5JA 4CFCA 2XY7A 1YTAA 1BGXT 4CHYA 1WSFA 3HPOA 4CJ3A 1VSHA 3AVIA 3SUNA 1BI4A 2YKMA 3PO4A 3F9KA 4IG3A 2YV0X 1BQMA 4O4GA 4TSXA 2F96A 3LZIA 3QERA 1CXQA 2Z1HA 2BE2A 3VN5A 4DFKA 1KRPA 1RILA 2E6MA 2B5JA 4E1NA 4QCLA 3OYIA 1HNVA 3DOLA 4E7KA 3TABA 4QOZB 1S1TA 1JLBA 4DTJA 1KVAA 3SQ0A 4CE9A 4CEDA 3KLHA 3S3NA 4JRPA 3HM9A 3KKRA 2W42A 3DRPA 2O4GA 4AHRA 1X9MA 3AVCA 3NDKA 1FK9A 3CQ8A 2OPRA 4E1MA 3KLEA 4LH4A 4Z4CA 5I3UA 3DRSA 1ASWA 1R0AA 4M3RA 2KW4A 2QKBA 4FM0A 3M8RA 2PYLA 3TAGA 2OPPA 4J2BA 1TV6A 3AO5A 4CJSA 1JLEA 3A2FA 4ELTA 2HHSA 5J1EA 3OYKA 3V9ZA 2IC3A 3B6OA 3AA3A 1G15A 1EXQA 5DK5A 3PO5A 4Q0BA 3ZSQA 5HRSA 3EY1A 1IH7A 4DU4A 1T05A 3D45A 1NKEA 4OLAA 4H4MA 1D5AA 1NOYA 2FBYA 3TI0A 1BHLA 1JL2A 4CIEA 3RMCA 3SCXA 3V9UA 4KI6A 1VSMA 2O4IA 3L2UA 1WSHA 4Z4HA 4W5RA 3NAEA 3QEIA 3OYNA 2G8HA 3K5LA 4LSLA 4OGEA 2PZSA 1QQCA 4B9LA 4H8KA 4CJRA 3LAKA 1S1WA 1TK8A 2G8KA 4ZTFA 1BI4B 4KKOA 3C95A 3LDSA 2X74A 4N76A 3HSTB 2XHBA 5CY4A 1TL3A 4CHQA 3ZSRA 3HVTA 3NF9A 3VQ6A 3O3HA 1Q9YA 1TAQA 1C1BA 1RTDA 4CFBA 1D9FA 4L8RB 2G8FA 5T7BA 4KTQA 1ASUA 4FW2A 4FCYA 3PX4A 1NJXA 1CLQA 2OPSA 1YVUA 4FZZA 1Z26A 3KD1E 1IKWA 3M8SA 2HHWA 4IDKA 1LV5A 1KLNA 3V1RA 3L3UA 3NH2A 3DRRA 1S9GA 1RBTA 3IRXA 1NKCA 4JRQA 4G1QA 1QTMA 2KQ2A 4ID1A 4J2AA 1SV5A 3L2VA 1B92A 3SI6A 4DSJA 1QSLA 4FLXA 3QLHA 4CFAA 1LWCA 3LP2A 4I9QA 4M3WA 3OS2A 2ETJA 4NYNA 1NJYA 1C0MA 1HMVA 3ITHA 5C42A 4ELVA 4UQGA 3LP0A 3IS9A 4HVJA 1J5OA 3NF8A 3LPTA 4FW1A 1RTJA 4CJ4A 4CJLA 3QETA 3SJJA 1C0TA 3FFIA 5SWMA 3U3GA 4DTXA 4J2DA 4PWDA 2HHUA 2HHQA 3OYEA 1ZBIA 1KLMA 4KHQA 3DM2A 1SL2A 4Z4EA 1SL1A 3MEDA 1VSFA 3KK1A 4DTUA 2LSNA 3OYAA 4CGIA 1SKWA 4CEZA 4BDPA 3QEVA 1VRTA 1TK5A 4N41A 3JYTA 3RMAA 4HUFA 2OZSA 1EX4A 3OYFA 4FK4A 3V9XA 3E01A 4DTRA 1RT5A 3NCIA 4R5PA 2QXFA 1RBRA 4DQQA 4MQ3A 1EKEA 2HB5A 1C6VA 1S1UA 3DMJA 3TAEA 4N47A 1KCFA 1UA1A 1U47A 5EU7A 1QS4A 3SZ2A 4FYDA 2Z1JA 4ELUA 4LSNA 3VQ4A 3ZSVA 2XY8A 4CEFA 4AILC 1XHZA 1QSYA 1FKOA 4KTWA 4CGHA 4W5TA 4OPKA 2HHTA 3AVNA 1BIZA 3S3OA 4FJ9A 3DYAA 4FZXC 1J53A 4PQUA 2IOCA 1RTHA 4M3XA 2FBXA 2X78A 3SV4A 3EYZA 3SQ1A 1A5VA 3OVNA 4DTOA 4B8AB 1TL1A 4B9MA 4FZYA 1JL1A 1J54A 3O4QA 4CGGA 1HQUA 1F21A 4O0JA 2Y1IA 1WLJA 3AA2A 4DTNA 4FJ7A 1EP4A 4OGCA 2X6NA 4F2SA 1K6YA 1RCHA 2ZQBA 4BE0A 3AO2A 4DF4A 4E7IA 4M45A 3AVFA 4CECA 4BWMA 2GBZA 1N6QA 3RRGA 3PY8A 1NJWA 3ZT2A 4BACA 1WSJA 3HPGA 1ZYQA 5D3GA 2G8IA 2RKIA 5CZ2A 1KFSA 4NCBA 3AO3A 3D0PA 2EX3A 1UWBA 3OYGA 3NGYA 2D5RA 5J2MA 3WNGA 3KLIA 4CEAA 4OKEA 4C8MA 4CK2A 5E41A 3KLFA 2EHGA 4QAGA 1L5UA 4F8RA 4KB1A 4KRFA 4NYFA 2DFFA 3CM6A 1S1VA 4Y1DA 1S1XA 5KGWA 3NHGA 3V1QA 1BL3A 4F4KA 3UIQA 3ZT1A 4N56A 3U6FA 1LW0A 4O55A 1NKBA 1HNIA 3SPYA 2BDPA 1TGOA 1BCOA 3TAPA 3VQ9A 1ZBFA 4HCCA 3HPHA 4GW6A 4CEQA 4CIFA 4B9TA 1NK5A 3VQQA 3L2WA 1ASVA 3KTQA 1J9AA 1JXBA 4KB0A 5CYMA 2BGGA 1D9DA 1WN7A 2HNZA 3K5NA 1RTIA 2ITGA 3RMBA 4CCHA 3RWUA 4KAZA 3AVGA 2R7YA 4AHTA 5J2PA 4DSLA 3TANA 4CF0A 1KTQA 2E4LA 4CEEA 3JSMA 4DQPA 4IFYA 4CHZA 3NGIA 1LAWA 4PUOA 4I9LA 3VA0A 1D8YA 1IKXA 2I5JA 1VSKA 1LAVA 3NF6A 3K5MA 1U48A 1BISA 4DU1A 1CZBA 1JLCA 1GOAA 1HQEA 4B9VA 1I39A 5FRMA 1BCMA 4Q5VA 4DTPA 3V9WA 1UA0A 3F73A 3BDPA 4B9NA 1WAJA 2AJQA 1MU2A 2OA8A 2Z1GA 4HHTA 4ZTJA 2HMIA 2HVIA 2A1SA 4KFBA 1TAUA 1A5XA 3HYFA 3LP3A 4K8XA 4E3SA 1L3VA 4W5NA 3ZSZA 1RDAA 3TAMA 3HVRA 3M8QA 2YHBA 3I0RA 4KI4A 1IKYA 1TKXA 2D0CA 4IG0A 4Y1CA 1HJRA 4B9UA 3LAMA 2RF2A 3AA5X 1Y97A 4FJJA 3QNNA 2OZMA 4WE1A 3WNFA 3CM5A 4BDYA 4MFBA 3NH1A 4FVMA 3SNNA 4B3OA 1KVBA 3PX6A 1T7PA 5I42A 4FLVA 3V1OA 3KK2A 1SKRA 1ITGA 1IKVA 4FJ8A 4F3OA 4JS4A 1B9FA 3MXIA 4CGFA 3OYLA 3VQEA 1YT3A 4PY5A 1Q8IA 1VK0A 4PA1A 1NK8A 3CFRA 2GV9A 3VQAA 4FLUA 1X9WA 4FK2A 2HNDA 2JLEA 3LZJA 4FLYA 1SUQA 4M3ZA 1RT1A 2XY6A 3DOKA 2G8VA 3AVBA 2PY5A 1X9SA 2FBVA 1RT7A 3K2PA 3VQCA 3MEEA 3TWHA 1TVRA 3AVLA 1ZBUA 4DU3A 2IGIA 4ZHRA 2VG7A 3QIPA 2GUIA 4BDZA 3QNOA 5HROA 3HJFA 3C6TA 4DTSA 1S9EA 3ASMA 4KHSA 3WNEA 3S9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F2R A;  4CK3 A;  2YNH A;  1WSG A;  3K59 A;  3L2Q A;  3V81 A;  3QEP A;  3PUF A;  3V4I A;  4EZ9 A;  4F3T A;  1U45 A;  3HL8 A;  1DLO A;  1RT6 A;  3CYM A;  1VSJ A;  3SYZ A;  2KTQ A;  5DMR A;  5J2Q A;  3K58 A;  4W5O A;  1Q9X A;  2FC0 A;  5HLF A;  1XI1 A;  3HO1 A;  1T8E A;  4GMJ B;  1NK0 A;  5KRS A;  1U04 A;  1CXU A;  1U4B A;  3O3G A;  1JXE A;  3V9S A;  2DFE A;  3QES A;  4KPY A;  4KV8 A;  1EET A;  5HRN A;  3SUO A;  3G10 A;  4CJT A;  3KD5 E;  4DSK A;  5HRP A;  4DF8 A;  4DFP A;  4EP4 A;  4RG8 A;  4RW6 A;  4FLW A;  3U3Y A;  2D0B A;  1XC9 A;  3PV8 A;  4DQI A;  5JS1 A;  1XHX A;  3DLB A;  4E0D A;  3QO9 A;  1JLG A;  1RBU A;  3ULD A;  4FK0 A;  1RNH A;  1C1A A;  4I2Q A;  3VQP A;  4CF8 A;  3O3F A;  4FM1 A;  4DSF A;  4E7J A;  3SQ2 A;  3MXM A;  1WSI A;  1QE1 A;  4B08 A;  4YNQ A;  4DFM A;  4DWI A;  4DS4 A;  4FJI A;  4AH9 A;  2VG5 A;  2WON A;  2PYJ A;  3NH0 A;  3T1A A;  1UOC A;  2Z1I A;  4DG1 A;  3OYJ A;  1L3U A;  3LPU A;  3RR7 A;  4KHN A;  3QIN A;  1TK0 A;  4Z4I A;  4EP5 A;  5FDL A;  3DLH A;  3P5J A;  4LY7 A;  2OPQ A;  4C8N A;  4CGJ A;  4I7F A;  4NCG A;  3RR8 A;  4C8K A;  1RT2 A;  2KFZ A;  2B4J A;  3DLR A;  3OYH A;  4E7H A;  3SUP A;  4CJP A;  4DTM A;  1NOZ A;  3AO1 A;  3MEC A;  2VG6 A;  3AV9 A;  4KTZ A;  3NGZ A;  2JGU A;  4DFJ A;  4CHP A;  4C8O A;  2G8W A;  1VSD A;  1QSS A;  1KVC A;  2HNY A;  2XRI A;  3LAL A;  1I3A A;  4LH5 A;  4CK1 A;  3KK3 A;  3HXM A;  4CHO A;  1Z25 A;  4M3Y A;  3SPZ A;  2YKN A;  5KGX A;  1FXX A;  1WSE A;  2RN2 A;  2NUB A;  3L3V A;  3ZSY A;  4CIG A;  4B8C A;  3AA4 A;  1LWF A;  5JS2 A;  4RW9 A;  2F8S A;  2HHX A;  4KHU A;  4FM2 A;  1JLA A;  1BQN A;  2OYQ A;  1JLF A;  4H4O A;  4OPJ A;  4DSI A;  2YNI A;  3IG1 A;  3EZ5 A;  3I8D A;  1RDD A;  3LWM A;  3KIO A;  2X6S A;  3ZSX A;  3TR8 A;  2A1R A;  3SUQ A;  5HRR A;  3ZSW A;  4KRE A;  4CJQ A;  4DMN A;  4FLZ A;  3BGR A;  3CG7 A;  3OS0 A;  1NK6 A;  3HT3 A;  4NCA A;  1HRH A;  4KHY A;  4AHC A;  3M8P A;  3NFA A;  3K5O A;  3HP6 A;  1U49 A;  3HK2 A;  3T19 A;  3AVA A;  3T3F A;  4OKK A;  4CF2 A;  4JS5 A;  4FJG A;  4FJN A;  3AVH A;  4ID5 A;  1JKH A;  2WOM A;  3ZT4 A;  4CFD A;  5C25 A;  4J2E A;  1GOB A;  4FJH A;  3L2R A;  4DS5 A;  1RT4 A;  1SKS A;  4YFU A;  4IKF A;  4Z4G A;  3HP9 A;  4CF1 A;  3OJU A;  1JLQ A;  3C6U A;  3VQ7 A;  4N5S A;  3O4N A;  3RTV A;  1RBV A;  4FLT A;  4E89 A;  3DLG A;  2B6A A;  1NK7 A;  1W9H A;  2KFN A;  3L8B A;  1TKZ A;  3KLG A;  4KO0 A;  1S6Q A;  2KZZ A;  1DTT A;  4O44 A;  5K14 A;  2VWJ A;  4M41 A;  5C24 A;  3ZT0 A;  4I2P A;  3NE6 A;  5KRT A;  3TAF A;  4AHV A;  3K57 A;  4DQR A;  1TKD A;  3LP1 A;  1NJZ A;  2ZE2 A;  4E7L A;  3OY9 A;  1KSP A;  4M3U A;  3AVJ A;  4HCB A;  5FRN A;  3DI6 A;  4CJK A;  5SZT A;  5HP1 A;  4OKJ A;  5FRO A;  1VSE A;  4AHU A;  1L3T A;  4O0I A;  3OYC A;  4BE1 A;  4RW8 A;  1W0H A;  3VA3 A;  4OJR A;  2P51 A;  4CES A;  3VQ5 A;  3RMD A;  3MXJ A;  1WNS A;  4CJE A;  1RT3 A;  3QIO A;  3SV3 A;  4OLB A;  4CER A;  4M42 A;  2YNG A;  3ISN C;  1S6P A;  4W5Q A;  3NBP A;  3OYD A;  4HUE A;  3OS1 A;  4XIU A;  3OYB A;  2IDO A;  1BIU A;  1KFD A;  1RBS A;  1C1C A;  1HYS A;  2RPI A;  4Z0U A;  4CEO A;  3AVM A;  1N5Y A;  1GOC A;  3AVK A;  1FKP A;  3MEG A;  1REV A;  2VWK A;  4CJU A;  1L3S A;  1HYV A;  3ZCM A;  3OJS A;  1LW2 A;  2ATQ A;  1QHT A;  4CEB A;  4DQS A;  3ZT3 A;  5J2N A;  3QEW A;  1SL0 A;  2DTU A;  1DTQ A;  2E6L A;  4IBN A;  1CZ9 A;  1TKT A;  1WAF A;  2YHA A;  1YTU A;  2F8T A;  3THV A;  4CJV A;  4EZ6 A;  1ZBH A;  1HYZ A;  1RDC A;  3B6P A;  2XY5 A;  4K8Z A;  4AHS A;  3VQD A;  3DLK A;  2QKK A;  4RW4 A;  3WNH A;  1A5W A;  4DSE A;  1C0U A;  3DLE A;  4FJM A;  2IAJ A;  3H08 A;  4HUG A;  3P83 D;  5HBM A;  3NF7 A;  1VRU A;  1RDB A;  2Q3S A;  4IFV A;  1UAX A;  2D0A A;  3LWL A;  4FJK A;  4M3T A;  2HW3 A;  1IO2 A;  4CJ5 A;  3QEX A;  2DY4 A;  2ZD1 A;  4E19 A;  4CHN A;  4C8L A;  3S3M A;  5KTQ A;  2P5O A;  3SQ4 A;  2IS3 A;  4GVM A;  4BWJ A;  4CJF A;  4CF9 A;  3PX0 A;  3MAQ A;  1HPZ A;  1XWL A;  3OYM A;  3P1G A;  5KI6 A;  3V6D A;  1O1W A;  3CFO A;  4RW7 A;  1ZBL A;  2G8U A;  3VQ8 A;  3KKS A;  1NK4 A;  4FXD A;  4KHW A;  3LAN A;  5CYQ A;  4OVL A;  3CFP A;  3TAR A;  4LD0 A;  3RRH A;  3C94 A;  2XO7 A;  4O5B A;  4CGD A;  4DLG A;  4HTU A;  2HVH A;  2DFH A;  3AO4 A;  3G0Z A;  4JLH A;  4B9S A;  3ZSO A;  4BE2 A;  3VQB A;  4ICL A;  4FJX A;  4DLE A;  2FBT A;  2YNF A;  3TAQ A;  5CZ1 A;  4Z4F A;  4CJW A;  4FJ5 A;  2QK9 A;  1NK9 A;  3I0S A;  2P1J A;  2P5G A;  4FJL A;  1X1P A;  1VSL A;  2BAN A;  1T03 A;  3IAY A;  2KZM A;  1LWE A;  1B9D A;  2Y1J A;  1VSI A;  3KJV A;  1IG9 A;  2HHV A;  3ALY A;  1S5J A;  4CFC A;  2XY7 A;  1YTA A;  1BGX T;  4CHY A;  1WSF A;  3HPO A;  4CJ3 A;  1VSH A;  3AVI A;  3SUN A;  1BI4 A;  2YKM A;  3PO4 A;  3F9K A;  4IG3 A;  2YV0 X;  1BQM A;  4O4G A;  4TSX A;  2F96 A;  3LZI A;  3QER A;  1CXQ A;  2Z1H A;  2BE2 A;  3VN5 A;  4DFK A;  1KRP A;  1RIL A;  2E6M A;  2B5J A;  4E1N A;  4QCL A;  3OYI A;  1HNV A;  3DOL A;  4E7K A;  3TAB A;  4QOZ B;  1S1T A;  1JLB A;  4DTJ A;  1KVA A;  3SQ0 A;  4CE9 A;  4CED A;  3KLH A;  3S3N A;  4JRP A;  3HM9 A;  3KKR A;  2W42 A;  3DRP A;  2O4G A;  4AHR A;  1X9M A;  3AVC A;  3NDK A;  1FK9 A;  3CQ8 A;  2OPR A;  4E1M A;  3KLE A;  4LH4 A;  4Z4C A;  5I3U A;  3DRS A;  1ASW A;  1R0A A;  4M3R A;  2KW4 A;  2QKB A;  4FM0 A;  3M8R A;  2PYL A;  3TAG A;  2OPP A;  4J2B A;  1TV6 A;  3AO5 A;  4CJS A;  1JLE A;  3A2F A;  4ELT A;  2HHS A;  5J1E A;  3OYK A;  3V9Z A;  2IC3 A;  3B6O A;  3AA3 A;  1G15 A;  1EXQ A;  5DK5 A;  3PO5 A;  4Q0B A;  3ZSQ A;  5HRS A;  3EY1 A;  1IH7 A;  4DU4 A;  1T05 A;  3D45 A;  1NKE A;  4OLA A;  4H4M A;  1D5A A;  1NOY A;  2FBY A;  3TI0 A;  1BHL A;  1JL2 A;  4CIE A;  3RMC A;  3SCX A;  3V9U A;  4KI6 A;  1VSM A;  2O4I A;  3L2U A;  1WSH A;  4Z4H A;  4W5R A;  3NAE A;  3QEI A;  3OYN A;  2G8H A;  3K5L A;  4LSL A;  4OGE A;  2PZS A;  1QQC A;  4B9L A;  4H8K A;  4CJR A;  3LAK A;  1S1W A;  1TK8 A;  2G8K A;  4ZTF A;  1BI4 B;  4KKO A;  3C95 A;  3LDS A;  2X74 A;  4N76 A;  3HST B;  2XHB A;  5CY4 A;  1TL3 A;  4CHQ A;  3ZSR A;  3HVT A;  3NF9 A;  3VQ6 A;  3O3H A;  1Q9Y A;  1TAQ A;  1C1B A;  1RTD A;  4CFB A;  1D9F A;  4L8R B;  2G8F A;  5T7B A;  4KTQ A;  1ASU A;  4FW2 A;  4FCY A;  3PX4 A;  1NJX A;  1CLQ A;  2OPS A;  1YVU A;  4FZZ A;  1Z26 A;  3KD1 E;  1IKW A;  3M8S A;  2HHW A;  4IDK A;  1LV5 A;  1KLN A;  3V1R A;  3L3U A;  3NH2 A;  3DRR A;  1S9G A;  1RBT A;  3IRX A;  1NKC A;  4JRQ A;  4G1Q A;  1QTM A;  2KQ2 A;  4ID1 A;  4J2A A;  1SV5 A;  3L2V A;  1B92 A;  3SI6 A;  4DSJ A;  1QSL A;  4FLX A;  3QLH A;  4CFA A;  1LWC A;  3LP2 A;  4I9Q A;  4M3W A;  3OS2 A;  2ETJ A;  4NYN A;  1NJY A;  1C0M A;  1HMV A;  3ITH A;  5C42 A;  4ELV A;  4UQG A;  3LP0 A;  3IS9 A;  4HVJ A;  1J5O A;  3NF8 A;  3LPT A;  4FW1 A;  1RTJ A;  4CJ4 A;  4CJL A;  3QET A;  3SJJ A;  1C0T A;  3FFI A;  5SWM A;  3U3G A;  4DTX A;  4J2D A;  4PWD A;  2HHU A;  2HHQ A;  3OYE A;  1ZBI A;  1KLM A;  4KHQ A;  3DM2 A;  1SL2 A;  4Z4E A;  1SL1 A;  3MED A;  1VSF A;  3KK1 A;  4DTU A;  2LSN A;  3OYA A;  4CGI A;  1SKW A;  4CEZ A;  4BDP A;  3QEV A;  1VRT A;  1TK5 A;  4N41 A;  3JYT A;  3RMA A;  4HUF A;  2OZS A;  1EX4 A;  3OYF A;  4FK4 A;  3V9X A;  3E01 A;  4DTR A;  1RT5 A;  3NCI A;  4R5P A;  2QXF A;  1RBR A;  4DQQ A;  4MQ3 A;  1EKE A;  2HB5 A;  1C6V A;  1S1U A;  3DMJ A;  3TAE A;  4N47 A;  1KCF A;  1UA1 A;  1U47 A;  5EU7 A;  1QS4 A;  3SZ2 A;  4FYD A;  2Z1J A;  4ELU A;  4LSN A;  3VQ4 A;  3ZSV A;  2XY8 A;  4CEF A;  4AIL C;  1XHZ A;  1QSY A;  1FKO A;  4KTW A;  4CGH A;  4W5T A;  4OPK A;  2HHT A;  3AVN A;  1BIZ A;  3S3O A;  4FJ9 A;  3DYA A;  4FZX C;  1J53 A;  4PQU A;  2IOC A;  1RTH A;  4M3X A;  2FBX A;  2X78 A;  3SV4 A;  3EYZ A;  3SQ1 A;  1A5V A;  3OVN A;  4DTO A;  4B8A B;  1TL1 A;  4B9M A;  4FZY A;  1JL1 A;  1J54 A;  3O4Q A;  4CGG A;  1HQU A;  1F21 A;  4O0J A;  2Y1I A;  1WLJ A;  3AA2 A;  4DTN A;  4FJ7 A;  1EP4 A;  4OGC A;  2X6N A;  4F2S A;  1K6Y A;  1RCH A;  2ZQB A;  4BE0 A;  3AO2 A;  4DF4 A;  4E7I A;  4M45 A;  3AVF A;  4CEC A;  4BWM A;  2GBZ A;  1N6Q A;  3RRG A;  3PY8 A;  1NJW A;  3ZT2 A;  4BAC A;  1WSJ A;  3HPG A;  1ZYQ A;  5D3G A;  2G8I A;  2RKI A;  5CZ2 A;  1KFS A;  4NCB A;  3AO3 A;  3D0P A;  2EX3 A;  1UWB A;  3OYG A;  3NGY A;  2D5R A;  5J2M A;  3WNG A;  3KLI A;  4CEA A;  4OKE A;  4C8M A;  4CK2 A;  5E41 A;  3KLF A;  2EHG A;  4QAG A;  1L5U A;  4F8R A;  4KB1 A;  4KRF A;  4NYF A;  2DFF A;  3CM6 A;  1S1V A;  4Y1D A;  1S1X A;  5KGW A;  3NHG A;  3V1Q A;  1BL3 A;  4F4K A;  3UIQ A;  3ZT1 A;  4N56 A;  3U6F A;  1LW0 A;  4O55 A;  1NKB A;  1HNI A;  3SPY A;  2BDP A;  1TGO A;  1BCO A;  3TAP A;  3VQ9 A;  1ZBF A;  4HCC A;  3HPH A;  4GW6 A;  4CEQ A;  4CIF A;  4B9T A;  1NK5 A;  3VQQ A;  3L2W A;  1ASV A;  3KTQ A;  1J9A A;  1JXB A;  4KB0 A;  5CYM A;  2BGG A;  1D9D A;  1WN7 A;  2HNZ A;  3K5N A;  1RTI A;  2ITG A;  3RMB A;  4CCH A;  3RWU A;  4KAZ A;  3AVG A;  2R7Y A;  4AHT A;  5J2P A;  4DSL A;  3TAN A;  4CF0 A;  1KTQ A;  2E4L A;  4CEE A;  3JSM A;  4DQP A;  4IFY A;  4CHZ A;  3NGI A;  1LAW A;  4PUO A;  4I9L A;  3VA0 A;  1D8Y A;  1IKX A;  2I5J A;  1VSK A;  1LAV A;  3NF6 A;  3K5M A;  1U48 A;  1BIS A;  4DU1 A;  1CZB A;  1JLC A;  1GOA A;  1HQE A;  4B9V A;  1I39 A;  5FRM A;  1BCM A;  4Q5V A;  4DTP A;  3V9W A;  1UA0 A;  3F73 A;  3BDP A;  4B9N A;  1WAJ A;  2AJQ A;  1MU2 A;  2OA8 A;  2Z1G A;  4HHT A;  4ZTJ A;  2HMI A;  2HVI A;  2A1S A;  4KFB A;  1TAU A;  1A5X A;  3HYF A;  3LP3 A;  4K8X A;  4E3S A;  1L3V A;  4W5N A;  3ZSZ A;  1RDA A;  3TAM A;  3HVR A;  3M8Q A;  2YHB A;  3I0R A;  4KI4 A;  1IKY A;  1TKX A;  2D0C A;  4IG0 A;  4Y1C A;  1HJR A;  4B9U A;  3LAM A;  2RF2 A;  3AA5 X;  1Y97 A;  4FJJ A;  3QNN A;  2OZM A;  4WE1 A;  3WNF A;  3CM5 A;  4BDY A;  4MFB A;  3NH1 A;  4FVM A;  3SNN A;  4B3O A;  1KVB A;  3PX6 A;  1T7P A;  5I42 A;  4FLV A;  3V1O A;  3KK2 A;  1SKR A;  1ITG A;  1IKV A;  4FJ8 A;  4F3O A;  4JS4 A;  1B9F A;  3MXI A;  4CGF A;  3OYL A;  3VQE A;  1YT3 A;  4PY5 A;  1Q8I A;  1VK0 A;  4PA1 A;  1NK8 A;  3CFR A;  2GV9 A;  3VQA A;  4FLU A;  1X9W A;  4FK2 A;  2HND A;  2JLE A;  3LZJ A;  4FLY A;  1SUQ A;  4M3Z A;  1RT1 A;  2XY6 A;  3DOK A;  2G8V A;  3AVB A;  2PY5 A;  1X9S A;  2FBV A;  1RT7 A;  3K2P A;  3VQC A;  3MEE A;  3TWH A;  1TVR A;  3AVL A;  1ZBU A;  4DU3 A;  2IGI A;  4ZHR A;  2VG7 A;  3QIP A;  2GUI A;  4BDZ A;  3QNO A;  5HRO A;  3HJF A;  3C6T A;  4DTS A;  1S9E A;  3ASM A;  4KHS A;  3WNE A;  3S9H A; 
#chains in the Genus database with same CATH topology
 4FOI A;  2D1K A;  1WSG A;  3L2Q A;  3QEP A;  4F3T A;  3CPE A;  1U45 A;  3I33 A;  3MCA B;  3H1V X;  4K42 A;  2FC0 A;  3HO1 A;  1T8E A;  1U04 A;  1U4B A;  3O3G A;  1D4X A;  3CC4 N;  4KPY A;  3G10 A;  3KD5 E;  4DF8 A;  4RW6 A;  4FLW A;  2D0B A;  1XC9 A;  4H5N A;  1XHX A;  4E0D A;  1JLG A;  1GLF O;  2P9U A;  4U67 L;  1YI2 N;  1KAZ A;  5DM7 L;  3O3F A;  3P4I A;  4AH9 A;  2VG5 A;  3J80 O;  3NH0 A;  3T1A A;  3ZLJ A;  3OYJ A;  1MA9 B;  3QIN A;  5FDL A;  3P5J A;  4LY7 A;  3RR8 A;  3FZL A;  4C8N A;  4I7F A;  2KFZ A;  2B4J A;  1NLV A;  3DLR A;  4CJP A;  4KTZ A;  1Z6R A;  4CHP A;  3UKU A;  5EXW A;  3HXM A;  1I3A A;  3LDL A;  1WSE A;  2NUB A;  4JKF A;  3CPW M;  3EL2 A;  4PKI A;  4KHU A;  1JLA A;  4DSI A;  3CJ7 A;  1RDD A;  4IFE A;  4BRO A;  1VQN N;  1RDU A;  1NGJ A;  5HRR A;  4R79 A;  4JI8 K;  3ZSW A;  3CD6 N;  4KRE A;  4DUY K;  4L3Q A;  3BGR A;  4NCA A;  4CI6 A;  3HP6 A;  1VQO N;  2ZGZ A;  3ENB A;  3F2K A;  3T19 A;  1MWK A;  4OKK A;  4JS5 A;  2GWK A;  5ELZ A;  1RT4 A;  1SKS A;  4YFU A;  4DV2 K;  3VQ7 A;  4G9Z A;  4JEP A;  4YOY A;  1RBV A;  5AR0 A;  3BZC A;  1NU0 A;  3L8B A;  3LM9 A;  1YJW N;  1DTT A;  5TKY A;  2P9P A;  3DWL A;  1G99 A;  4JI6 K;  3J81 O;  3ZT0 A;  3TAF A;  1TKD A;  4YOV A;  1O13 A;  4GV9 A;  4C23 A;  4O8U A;  1NJZ A;  3BF3 A;  4M3U A;  3AVJ A;  4K43 A;  1W2B M;  2E2Q A;  4GNI A;  4AHU A;  2D4W A;  4H0P A;  1EWR A;  3VA3 A;  3PSF A;  3VQ5 A;  4CJE A;  1RT3 A;  4CER A;  4M42 A;  2YNG A;  1S6P A;  5GAG P;  4RWT A;  2DPN A;  1ESV A;  1RBS A;  1C1C A;  1HJO A;  4CEO A;  1T3V A;  3MEG A;  3CCQ N;  3TTD A;  3A8Y A;  4DR3 K;  3ZCM A;  3ZT3 A;  1SL0 A;  4MLE A;  3L0Q A;  1DTQ A;  1WUA A;  2E6L A;  4IBN A;  2YHA A;  3FFK B;  4EZ6 A;  3B6P A;  2XY5 A;  3VQD A;  2QKK A;  3ID8 A;  3OA9 A;  3H08 A;  1NGI A;  5HBM A;  1VRU A;  4M3T A;  1UAX A;  1XC3 A;  3LWL A;  3THY B;  4CJ5 A;  3QEX A;  2FF3 B;  4E19 A;  4CHN A;  4BVO A;  3S3M A;  2NRZ A;  5KTQ A;  3S9H A;  2IS3 A;  4H5R A;  2HBK A;  4GVM A;  1YJ9 N;  1XWL A;  4X62 K;  1ZBL A;  3Q7C A;  3CFO A;  4IJA A;  3UB5 A;  1NK4 A;  3VES A;  4KHW A;  1JCF A;  5CYQ A;  3O9R A;  4OVL A;  5IWA K;  4FWQ A;  3PSI A;  4DR6 K;  5FLX O;  4DLG A;  3SJH A;  1HX1 A;  2HVH A;  5AQF A;  2NLX A;  3J8A A;  4JLH A;  4B9S A;  3ZSO A;  2O8C B;  4ICL A;  4FJX A;  2YNF A;  3TAQ A;  2O8E B;  4WCE L;  4FJ5 A;  3BY5 A;  2P1J A;  3U9Z A;  2HHV A;  3R3L A;  4CJ3 A;  3SUN A;  1BI4 A;  3H3O B;  1BQM A;  3O9T A;  5AQR A;  2F96 A;  5ADX H;  5C10 A;  1RIL A;  1TUU A;  4E1N A;  1IBK K;  1HNV A;  4E7K A;  3TAB A;  4QOZ B;  4JKC A;  5KPZ A;  4CD1 A;  3EN9 A;  3S3N A;  2P9U B;  4JKE A;  1N8R O;  5C2D A;  3CQ8 A;  3KWG A;  1NBW A;  1R0A A;  1ATS A;  3VEV A;  3G25 A;  4QS8 A;  3M8R A;  4DR4 K;  5J1E A;  3OYK A;  2FF6 A;  3B6O A;  3CCE N;  3WUH A;  1IH7 A;  4DU4 A;  1T05 A;  3D45 A;  3WXK A;  4BRG A;  2NNW A;  4YOX A;  3V9U A;  2O4I A;  3NAE A;  1T6C A;  3QEI A;  3K5L A;  4LSL A;  4B1U B;  4JD2 B;  4HWI A;  1TK8 A;  2G8K A;  5CY4 A;  4CHQ A;  1Q9Y A;  4LF5 K;  1TAQ A;  3EEQ A;  1D9F A;  3QML A;  3VEZ A;  4FCY A;  1NJX A;  1CLQ A;  1HNW K;  1LCU A;  2OPS A;  1YVU A;  5AQP A;  3KD1 E;  3M8S A;  3IUC A;  4B3S K;  2QWP A;  2QWR A;  2O8D B;  3L3U A;  1S9G A;  1RBT A;  3OBW A;  4XH1 A;  4ID1 A;  2ASO A;  3TSU A;  3OS2 A;  1C0M A;  3ITH A;  3VEN A;  3S41 A;  3Q7B A;  4CJ4 A;  3VF4 A;  4CJL A;  4DTX A;  5SWM A;  4BRL A;  4J2D A;  2HHU A;  2YHW A;  3AAQ A;  4LF4 K;  3MED A;  4CGI A;  2Q0R A;  2P9P B;  4N41 A;  1VRT A;  3MN5 A;  1TK5 A;  3JYT A;  2NRT A;  1QQN A;  4FK4 A;  3V9X A;  5FPM A;  2QXF A;  3FR0 A;  4DQQ A;  1EKE A;  3TAE A;  1KQS M;  5HL7 L;  4IO8 A;  2D0P A;  4CEF A;  4AIL C;  2IVN A;  1XHZ A;  4W5T A;  3A5N C;  2CGJ A;  3ATU A;  1BIZ A;  2P9L B;  4FZX C;  1J53 A;  4B8A B;  4BRI A;  3O4Q A;  1HQU A;  1F21 A;  4FJ7 A;  1Q18 A;  2ZQB A;  4BRA A;  4BE0 A;  4JKB A;  3CCJ N;  1OVY A;  3C0B A;  4MO4 A;  3DJC A;  2YX6 A;  1FW6 A;  3AO3 A;  5GAD P;  2EX3 A;  3OYG A;  4NLB A;  1HKG A;  3NGY A;  2D5R A;  4CEA A;  2ZGY A;  4C8M A;  2WUS A;  3MWP A;  2EHG A;  4NYF A;  4YOT A;  4X66 K;  1TUY A;  1YVN A;  1BL3 A;  3V1Q A;  4FWS A;  3ZT1 A;  3UIQ A;  1LW0 A;  1NKB A;  3HPH A;  4GW6 A;  5KPR A;  4B9T A;  2F9W A;  1S3X A;  3KTQ A;  2OAN A;  1NMD A;  3K5N A;  4JHD A;  4FPB A;  3RMB A;  2F4V K;  3AVG A;  4AHT A;  4DSL A;  1KTQ A;  1LOT B;  4CEE A;  4IFY A;  1NJI O;  1D8Y A;  2QTD A;  1LAV A;  1BIS A;  1JLC A;  1HQE A;  2BUP A;  1BU6 O;  3BDP A;  4DHY A;  1MU2 A;  3U9D A;  4AQY K;  2HVI A;  2A1S A;  4KFB A;  1MWM A;  4W5N A;  1BO5 O;  4ILH A;  1OH5 A;  2YHB A;  3HM8 A;  1NGH A;  3I0R A;  1QVF M;  5DM6 L;  3LAM A;  2NRX A;  3QNN A;  2OZM A;  3U8X A;  3CM5 A;  2P9K A;  4MFB A;  3SNN A;  1FJG K;  5I42 A;  3V1O A;  3KK2 A;  1IKV A;  4DQ8 A;  3D2E B;  4DV5 K;  4PA1 A;  2J4R A;  3CFR A;  4FK2 A;  2HOE A;  2JLE A;  1C0G A;  3DOK A;  3CCV N;  2G8V A;  4OO1 J;  3AVB A;  1IJJ A;  3J7A P;  4Y0W A;  2FBV A;  3MEE A;  1ZBU A;  4ZHR A;  1NM1 A;  5HRO A;  2GUI A;  3QNO A;  2NRV A;  4DR5 K;  4BRF A;  2VYP A;  4KH6 A;  3V81 A;  3PUF A;  1RT6 A;  3SYZ A;  3CI5 A;  5J2Q A;  4NXN K;  4W5O A;  1Q9X A;  1XI1 A;  1NK0 A;  5EX5 A;  1OKJ A;  3V9S A;  2DFE A;  3BZK A;  4LFA K;  1NG9 A;  4CJT A;  4DSK A;  5AFU A;  4DFP A;  4RG8 A;  4MDB A;  3PV8 A;  5JS1 A;  3DLB A;  3QO9 A;  4BQL A;  1RBU A;  3MN9 A;  2QW9 A;  1ATR A;  4CF8 A;  4DSF A;  4M63 C;  4RCH A;  4BRC A;  4DFM A;  4WQ4 A;  4FJI A;  1WOQ A;  3L4Q A;  5C2F A;  2GEM A;  1UOC A;  3TSQ A;  3VPZ A;  2OPQ A;  4NCG A;  1RT2 A;  3HBT A;  3NGZ A;  2VG6 A;  3VER A;  4C8O A;  3O08 A;  3N4P A;  1VSD A;  1QSS A;  4JKD A;  1KVC A;  4BGB A;  3KK3 A;  3LAL A;  4LH5 A;  4M3Y A;  3E9O A;  2AP1 A;  1GLA G;  4B8C A;  5JS2 A;  1HNX K;  1QZ6 A;  1JLF A;  3C6A A;  3G4S N;  3FZK A;  3EZ5 A;  1S72 N;  3KIO A;  3TR8 A;  2Q2R A;  4JI2 K;  3CG7 A;  1VQM N;  3ZX0 A;  1DKG D;  1X3M A;  3NFA A;  4FWO A;  4FJN A;  4ID5 A;  1JKH A;  5JVG L;  5C25 A;  1GOB A;  4FJH A;  1U6Z A;  1XNR K;  4FWN A;  1XMO K;  3C6U A;  2UXB K;  3RTV A;  5AQH A;  1NK7 A;  2KFN A;  3C7N B;  1JCE A;  3D2F B;  3I8B A;  4M41 A;  4I2P A;  3NE6 A;  3QBW A;  5BR9 A;  2ZE2 A;  4FWK A;  4BR5 A;  5AQU A;  1KSP A;  2QXL A;  4CJK A;  3D6R A;  2ZJP L;  1VSE A;  3PIP L;  3OYC A;  5H1S Q;  1W0H A;  4OJR A;  4MLH A;  4CBX A;  1WNS A;  5C0Y A;  5AQI A;  1BA1 A;  3OS1 A;  3L6Q A;  5AQZ A;  1KFD A;  1HYS A;  3P31 A;  1HR0 K;  2RPI A;  4Z0U A;  5BPL A;  3A5L C;  2ZJQ L;  3CIP A;  1OH6 A;  2WC9 A;  1HYV A;  4BRK A;  3OJS A;  1LW2 A;  1QHT A;  3KHY A;  4PL8 A;  3I55 N;  1CZ9 A;  5EOY A;  1WAF A;  3A0I X;  3VTH A;  1YTU A;  2F8T A;  3THV A;  2V52 B;  3WNH A;  1A5W A;  3UE5 A;  4FJM A;  5LMN K;  1RDB A;  2HW3 A;  3LM2 A;  2I7N A;  2DY4 A;  2KKZ A;  1DEJ A;  5JLF A;  4C8L A;  4A57 A;  1YXQ A;  2P9K B;  1HUX A;  5AFU H;  4BWJ A;  3PX0 A;  3OYM A;  3ENH A;  5KI6 A;  1O1W A;  4BG8 A;  3VQ8 A;  3KKS A;  2CGL A;  3HRG A;  3TAR A;  2UUA K;  1XMQ K;  3SAG A;  4XH5 A;  3G0Z A;  3VQB A;  3CCS N;  2P9I A;  4DLE A;  3R1X A;  4CJW A;  4IOX A;  1X1P A;  1VSL A;  2BAN A;  2KZM A;  3CJ1 A;  1LWE A;  2Y1J A;  3KJV A;  2XY7 A;  1YTA A;  4JD2 A;  5ADX A;  1WSF A;  3HPO A;  2YKM A;  3PO4 A;  1Y64 A;  2YV0 X;  3QER A;  2Z1H A;  2BE2 A;  2E2P A;  3RSE A;  2E6M A;  4GKJ K;  4KH4 A;  4B9Q A;  1HNZ K;  1Q82 O;  3LDQ A;  3P39 A;  1KVA A;  1QVG M;  2O8D A;  3MK6 A;  1X9M A;  1NGA A;  1N33 K;  2OCE A;  2OPR A;  3KLE A;  5I3U A;  2VWB A;  2E1Z A;  4LH4 A;  4Z4C A;  5JIC A;  3TSP A;  4M3R A;  2GTD A;  3VTI A;  4DKW A;  5E84 A;  3TAG A;  1T44 A;  1TV6 A;  4DV4 K;  4J2B A;  3AO5 A;  4A62 A;  1JLE A;  3E1Y A;  3TTF A;  3SMS A;  2F7T A;  4OLA A;  4H4M A;  3TI0 A;  1JL2 A;  3SCX A;  3SLC A;  3L2U A;  1WSH A;  3JS6 A;  3ATV A;  4DV7 K;  4BR7 A;  2PZS A;  3LAK A;  1YAG A;  1IV0 A;  3H6E A;  4WQ4 C;  1RDW X;  3JAM O;  3TTC A;  4BRE A;  3HVT A;  3VQ6 A;  4B1Y B;  4H5W A;  1C1B A;  1RTD A;  5T7B A;  3H1Q A;  1ASU A;  2Q36 A;  3OTO K;  4KTQ A;  4FW2 A;  2P9L A;  3SBT A;  2YHX A;  1LV5 A;  3E9P A;  2JWL A;  1NGB A;  1J6Z A;  3NH2 A;  2P9N A;  3CER A;  3DRR A;  2A6A A;  1NKC A;  3IRX A;  5GAH P;  4JRQ A;  4G1Q A;  4J2A A;  1SV5 A;  3L4I A;  4I9Q A;  2E5L K;  2NRR A;  5TKW A;  4WF9 L;  4HVJ A;  4FW1 A;  5MLC Q;  3QET A;  3FFI A;  1ZBI A;  5E26 A;  1KLM A;  3DM2 A;  1NNE A;  5C15 A;  3MN6 A;  1SKW A;  3VMF B;  4BR9 A;  3QEV A;  1XQS C;  4WFN L;  2FSK A;  2OZS A;  4BC2 A;  3T69 A;  2GX9 A;  3ZYY X;  5KPT A;  1RT5 A;  3NCI A;  3PLA A;  4PHT X;  1S1U A;  4N47 A;  1UA1 A;  1QS4 A;  4JK8 A;  2Z1J A;  2XY8 A;  3MWT A;  3CET A;  4KTW A;  1SAZ A;  2HHT A;  3AVN A;  4H0O A;  4FJ9 A;  3DYA A;  4PQU A;  5CE3 A;  2FBX A;  3SV4 A;  1BDG A;  4UY8 O;  4DTO A;  1TL1 A;  4CGG A;  2Y1I A;  1WLJ A;  4KH5 A;  4F2S A;  1K6Y A;  4DF4 A;  4M45 A;  4CEC A;  3U4L A;  4YHH K;  1NJW A;  3R8E A;  1K8A O;  2G8I A;  4NCB A;  1WBD A;  1UWB A;  4A61 A;  3ZX2 A;  5J2M A;  5KQD A;  4O8K A;  3EKU A;  1L5U A;  3GG4 A;  2DFF A;  1E4F T;  3CM6 A;  1S1V A;  3FGU A;  4Y1D A;  3NHG A;  5KGW A;  4QS7 A;  3M3Z A;  3P38 A;  2HBM A;  5JVH L;  3D2E A;  1HNI A;  2OTL N;  1BA0 A;  4XH4 A;  4CEQ A;  4CIF A;  3L2W A;  3FLC O;  2VQF K;  2W40 A;  1D9D A;  1WN7 A;  1RTI A;  3MX5 A;  2HST A;  1YIJ N;  4CCH A;  4KAZ A;  4CF0 A;  2P9I B;  1GLE G;  4YOU A;  5GAE P;  3JSM A;  1N34 K;  1VSK A;  2IVO A;  3BEX A;  1CZB A;  4B9V A;  1I39 A;  4I6M B;  2Q0U A;  4JK7 A;  5AQG A;  5FPD A;  1HKC A;  2OA8 A;  4H0X B;  4HHT A;  4E1J A;  3OHR A;  3WEE B;  3HYF A;  4E3S A;  3VEO A;  1L3V A;  1OH8 A;  1RDA A;  3RSE B;  3G71 N;  1SQK A;  3M8Q A;  4YOR A;  4DR1 K;  1IKY A;  1JCG A;  2RF2 A;  3AA5 X;  1Y97 A;  4JNE A;  4FJJ A;  4BR4 A;  3WNF A;  4DCH A;  4H5T A;  4FWL A;  3HOT A;  3FE1 A;  3OYL A;  3VQE A;  1YT3 A;  4PY5 A;  1Q8I A;  1VK0 A;  4JKH A;  2GV9 A;  4FLU A;  1V4T A;  3ZET A;  4CZI A;  1RT1 A;  3MDQ A;  2XY6 A;  4JI5 K;  1RT7 A;  1TVR A;  4ISG A;  4EHU A;  5LJV A;  2GUP A;  2UXC K;  2VG7 A;  4BDZ A;  3HJF A;  4DV1 K;  1S9E A;  5E41 A;  4CK3 A;  2YNH A;  3K59 A;  5AQY A;  1VQ7 N;  4LF9 K;  3V4I A;  4JI4 K;  4BQZ A;  4WFA L;  1DLO A;  1VSJ A;  2KTQ A;  1Q7Y O;  1J5E K;  4FVU A;  1T6D A;  1JXE A;  4A5A A;  2EWS A;  4FWM A;  3QES A;  2O8B B;  4KV8 A;  1EET A;  5HRN A;  1NGD A;  3SMP A;  4EP4 A;  3U3Y A;  2ZJR L;  3QBX A;  3C6H A;  5B8H A;  4FK0 A;  1RNH A;  1C1A A;  2P9N B;  1YIT N;  1WSI A;  1QE1 A;  2IIR A;  4DG1 A;  3RR7 A;  4KHN A;  3LPU A;  1TK0 A;  4EP5 A;  1M90 O;  4C8K A;  3O80 A;  4B1Z A;  5LL6 Z;  4E7H A;  3SUP A;  4IOA L;  4DTM A;  1NOZ A;  3MEC A;  3T1Y K;  2JGU A;  1JJ2 M;  3C7N A;  3D2F A;  2PFU A;  2HNY A;  2XRI A;  4PKH A;  4CHO A;  3SPZ A;  2YKN A;  5KGX A;  1FXX A;  3O8M A;  3L3V A;  1VQ5 N;  3AA4 A;  4RW9 A;  4FM2 A;  2W6L A;  2OYQ A;  4H4O A;  2A5X A;  1NWK A;  4OPJ A;  3LWM A;  3GOI A;  2UYT A;  2X6S A;  3ZSX A;  2A1R A;  4JN4 A;  5AQK A;  3VF2 A;  2O8F A;  3SUQ A;  2CH5 A;  2WFB A;  3EE9 A;  5LY3 A;  4DMN A;  1NK6 A;  4WQ5 A;  3BUZ B;  2QA4 N;  3GDQ A;  1HRH A;  3D7E O;  3K5O A;  2YJF A;  1VQK N;  3HK2 A;  3M5R A;  5AZI A;  4CBU A;  3AVA A;  4CF2 A;  3AVH A;  2WOM A;  4J2E A;  3E66 A;  3CJC A;  4DS5 A;  2PBD A;  1WBB A;  3H45 C;  4N5S A;  3O4N A;  2GEL A;  1KAY A;  4BRD A;  5F0X A;  4FLT A;  4E89 A;  1MDU B;  3WXL A;  4KBO A;  1TKZ A;  3KLG A;  4O44 A;  5K14 A;  1E3M A;  2H3G X;  3ULE A;  3THX B;  5M1Q A;  4DQR A;  3C65 A;  2QI2 A;  3AGK A;  4V19 S;  3VOV A;  3O6W A;  4DV3 K;  2GWJ A;  5HP1 A;  4OKJ A;  1L3T A;  2V51 B;  4O0I A;  2QWQ A;  2W41 A;  4EHT A;  3FZF A;  1KD1 O;  3RMD A;  3MXJ A;  1P90 A;  3T7Z A;  3SV3 A;  3ISN C;  1NGG A;  3R9P A;  4BC3 A;  3AAP A;  3NBP A;  3O4W A;  3OYD A;  4HUE A;  4JYA K;  4XIU A;  3VET A;  3OYB A;  3LDO A;  2IDO A;  1BIU A;  3EZW A;  3JXU A;  1X9J A;  3AVM A;  1GOC A;  3AVK A;  1FKP A;  1BWF O;  3O1W A;  4IOC L;  1L3S A;  4GY2 B;  2ZF5 O;  3EKS A;  5J2N A;  2ATQ A;  2P9S A;  2NZT A;  3LL3 A;  4CEB A;  2DTU A;  5AQN A;  4DV0 K;  3T1H K;  1TKT A;  4ISE A;  4BG9 A;  4H0V B;  1ZBH A;  4WFB L;  4K8Z A;  4AHS A;  4AM7 A;  3DLK A;  1C0U A;  3NF7 A;  2Q3S A;  4IFV A;  4FJK A;  5KQ8 A;  1IO2 A;  4BVP A;  3SQ4 A;  4CZJ A;  4CJF A;  2ASM A;  4CF9 A;  3V6D A;  3P1G A;  4RW7 A;  2G8U A;  4A59 A;  1ILY A;  3SAF A;  1GLD G;  1HLU A;  3LAN A;  3CFP A;  4IXC A;  4LD0 A;  3ZET B;  3RRH A;  3CME N;  3C94 A;  2XO7 A;  4O5B A;  5GIN A;  2VQE K;  2FLO A;  1Z05 A;  3I0S A;  1GLB G;  2P5G A;  4FJL A;  1T03 A;  1B9D A;  2JWK A;  1VSI A;  1IG9 A;  4CFC A;  3HTV A;  3WXM B;  5M1K A;  4Z94 A;  2IVP A;  3VEW A;  3VN5 A;  3K9J A;  3GE1 A;  4CVN E;  3A5O C;  1YJN N;  3N4Q A;  4CBW A;  3KLH A;  4JRP A;  1KXP A;  2W42 A;  4AHR A;  3AVC A;  3DXK A;  3NDK A;  1KC8 O;  3O9Q A;  2NRW A;  3BP8 A;  1ASW A;  4DUZ K;  2KW4 A;  2QKB A;  4FM0 A;  1BUP A;  2PYL A;  3H46 O;  2OPP A;  2HHH K;  4ELT A;  3ZEU A;  3K0S A;  3MMV A;  1EXQ A;  3ZSQ A;  5HRS A;  3EY1 A;  1R59 O;  3SBG A;  1NKE A;  4K0K K;  4MO5 A;  4B3M K;  3FZH A;  2FBY A;  3CXC M;  3RMC A;  1VSM A;  4Z4H A;  2G8H A;  4OGE A;  4H8K A;  2V7Y A;  1S1W A;  1E4G T;  4ZTF A;  2QWO A;  3LDS A;  4N76 A;  3HST B;  3UKR A;  1HPM A;  2KLA A;  3ZSR A;  4YDU A;  3NF9 A;  2FXU A;  4CFB A;  1IBL K;  2O8F B;  2G8F A;  2HBL A;  1XNQ K;  3PX4 A;  2VCP A;  1TYQ A;  3CC7 N;  1IKW A;  5AQO A;  5AZI B;  2BH1 A;  4IDK A;  2RHK A;  1KLN A;  3O5B A;  3V1R A;  4JKG B;  1OVQ A;  1BG3 A;  4CZE A;  1QTM A;  2KQ2 A;  3L2V A;  3SI6 A;  4FLX A;  1XUP O;  2ETJ A;  4ELV A;  4KHP K;  1HMV A;  5C42 A;  3LP0 A;  3E9L A;  3IS9 A;  1RTJ A;  3SJJ A;  2HHQ A;  4PWD A;  4Z4E A;  1SL2 A;  4H5V A;  3KK1 A;  3R6M A;  4WQ5 C;  3OYA A;  2HF4 A;  4BDP A;  5AZJ A;  3ULE B;  3RMA A;  1EX4 A;  3OYF A;  3QFP A;  3E01 A;  1VQP N;  1RBR A;  4MQ3 A;  5F1X A;  3AGR A;  3SZ2 A;  4FYD A;  4ELU A;  4LSN A;  3KK7 A;  3ZSV A;  5EVZ A;  1QQM A;  5CHI A;  3S3O A;  2IOC A;  4CZL A;  3H3N O;  2X78 A;  5BPM A;  4JV5 K;  1CZA N;  3QDK A;  4M7X A;  4IEI A;  5AQX A;  5M1N A;  4YOW A;  1EP4 A;  2UUB K;  4OGC A;  4BGA A;  3AO2 A;  4I6M A;  2Q1N A;  3AVF A;  2P9S B;  2GBZ A;  4H03 B;  3G6E N;  3PY8 A;  3ZT2 A;  3HPG A;  1RFQ A;  1ZYQ A;  5D3G A;  4J8F A;  3WEE A;  5CZ2 A;  5EY4 A;  3KWI A;  1EQY A;  1KFS A;  4K41 A;  3D0P A;  3LDN A;  3CQX A;  2OTJ N;  3WNG A;  5AQV A;  1U2V A;  3KLF A;  4NB4 A;  4CK2 A;  4KRF A;  4F8R A;  4QAG A;  4KB1 A;  2HF3 A;  5F2R A;  4FOE A;  2UXD K;  2Q31 A;  4N56 A;  3W3D A;  3U6F A;  1Q86 O;  4DB3 A;  2BDP A;  1TGO A;  2PAV A;  1BCO A;  3VQ9 A;  4HCC A;  4FPA A;  1QZ5 A;  1J9A A;  1JXB A;  5AQQ A;  3PIO L;  4KB0 A;  2BGG A;  3QB0 A;  2HNZ A;  3RWU A;  2ITG A;  5J2P A;  2R7Y A;  3TAN A;  3OBY A;  4DQP A;  2E20 A;  4CHZ A;  2I5J A;  4A5B A;  3NF6 A;  3K5M A;  4DU1 A;  4BRP A;  3I56 N;  5FRM A;  4DTP A;  3F73 A;  3HOS A;  1WAJ A;  4BRN A;  1OH7 A;  4BRQ A;  1TAU A;  1A5X A;  3THW A;  3ZSZ A;  2A41 A;  3HVR A;  2O8B A;  4GVE A;  1ZC6 A;  2D0C A;  5BRF A;  4Y1C A;  1HJR A;  1QHA A;  4WE1 A;  4FVM A;  3PX6 A;  3DXK B;  2WBN A;  4FLV A;  1SKR A;  3W0L A;  1W97 L;  4JS4 A;  4CGF A;  1M1K O;  1NK8 A;  2VGN A;  3VQA A;  1X9W A;  1SS6 A;  1YHQ N;  3RVC A;  3ZEU B;  4FLY A;  2E2N A;  1SUQ A;  4A2A A;  2PY5 A;  4CD3 A;  3VQC A;  3K2P A;  4BRM A;  3TWH A;  1VQ8 N;  3AVL A;  4DU3 A;  3CMA N;  3QIP A;  3C6T A;  3WNE A;  4F2R A;  2E88 A;  3WQU A;  4EZ9 A;  4RTF D;  3HL8 A;  1K8K A;  3CYM A;  3J7Y P;  5DMR A;  5M1P A;  3K58 A;  3UKR B;  5HLF A;  2QWM A;  3O1B A;  3DXM A;  4GMJ B;  5KRS A;  1CXU A;  3SUO A;  1SZ2 A;  1BOT O;  5HRP A;  4NXM K;  4DQI A;  1TYQ B;  2CGK A;  1DT9 A;  5FPE A;  3ULD A;  1DGK N;  4I2Q A;  4FM1 A;  3VQP A;  3SQ2 A;  3MXM A;  3TPQ A;  4E7J A;  4B08 A;  4YNQ A;  4DWI A;  4DS4 A;  2A42 A;  2WON A;  2PYJ A;  4GV3 A;  2Z1I A;  1L3U A;  4Z4I A;  4DV6 K;  5BRE A;  3DLH A;  4CGJ A;  3ZX3 A;  5BRH A;  5CR4 A;  3OYH A;  4YDU C;  3AO1 A;  4DFJ A;  3AV9 A;  3CJB A;  1C0F A;  2G8W A;  4AM6 A;  4CK1 A;  5AZJ B;  1Z25 A;  3THX A;  4LF6 K;  2RN2 A;  3M6G A;  4PKG A;  3ZSY A;  4CIG A;  3MCP A;  3CQY A;  1LWF A;  2F8S A;  2HHX A;  4B3T K;  1VAZ A;  1BQN A;  4FL9 A;  4FWR A;  2YNI A;  3IG1 A;  3I8D A;  4CZM A;  2YCH A;  4C1N I;  4EFH A;  2A40 A;  4JI1 K;  5AQW A;  4CJQ A;  4FLZ A;  3OS0 A;  3HT3 A;  4KHY A;  4AHC A;  3M8P A;  1U49 A;  3T3F A;  4JI7 K;  4FJG A;  4CZH A;  3ZT4 A;  4CFD A;  3L2R A;  5AQJ A;  1P8Z A;  4CJ7 A;  2RE2 A;  4IKF A;  4U7B A;  1GLJ O;  3HP9 A;  4CF1 A;  3OJU A;  1JLQ A;  5AQM A;  4Z4G A;  1IBM K;  3DLG A;  2B6A A;  3UKU B;  1W9H A;  4KO0 A;  1S6Q A;  2AA4 A;  2VWJ A;  2KZZ A;  3VGM A;  5C24 A;  1U2V B;  5KRT A;  4AHV A;  3K57 A;  4QS9 A;  4FO0 A;  3LP1 A;  4E7L A;  3OY9 A;  5FPN A;  4HCB A;  5FRN A;  3DI6 A;  5SZT A;  5I9E B;  4M7Y A;  5FRO A;  1RGI A;  5AQT A;  1WB9 A;  4BE1 A;  4RW8 A;  4EIA A;  2P51 A;  4CES A;  1N36 K;  4H0Y B;  2UUC K;  4BC4 A;  3QIO A;  4OLB A;  2QEX N;  4W5Q A;  3K9K A;  4JAX A;  2YJE A;  3VGK A;  1VQ9 N;  2F9T A;  1N5Y A;  5BR8 K;  1REV A;  2VWK A;  2E1Y A;  1X3N A;  4CJU A;  1VQL N;  2ITM A;  4DQS A;  3QEW A;  2KHO A;  1S22 A;  4CJV A;  3THW B;  1HYZ A;  1RDC A;  4AF1 A;  4RW4 A;  4DSE A;  2IAJ A;  4HUG A;  3OW2 M;  5IT9 O;  4DR2 K;  3P83 D;  3WQT A;  2D0A A;  4LC9 B;  2ZD1 A;  4WYB A;  2P5O A;  2A3Z A;  3KVG A;  1HPZ A;  3MAQ A;  2Q97 A;  4B1V A;  5GIP A;  4FXD A;  3DAW A;  3GBT A;  1ZXO A;  4CGD A;  4HTU A;  2NRH A;  2DFH A;  3AO4 A;  5LJW A;  5C12 A;  2YI1 A;  1V4S A;  4BE2 A;  3IMX A;  2FBT A;  4Z4F A;  5CZ1 A;  2QK9 A;  1VHX A;  1NK9 A;  3IAY A;  3VGL A;  3F5T A;  4JI3 K;  3ALY A;  1S5J A;  3CC2 N;  1BGX T;  4CHY A;  1K8K B;  5HOO A;  2V7Z A;  1VSH A;  4IEE A;  3AVI A;  3VF6 A;  4CZF A;  3F9K A;  4IG3 A;  3QFU A;  5BN8 A;  3DXM B;  4O4G A;  4TSX A;  4ILG B;  5BN9 A;  5A2Q O;  3LZI A;  1CXQ A;  4DFK A;  1KRP A;  1YUW A;  2B5J A;  3SAH A;  3O9U A;  4QCL A;  3OYI A;  3DOL A;  4CZK A;  5LMU K;  1S1T A;  1JLB A;  4DTJ A;  4A2B A;  3SQ0 A;  4CE9 A;  4CED A;  5AJ3 K;  3HM9 A;  3KKR A;  3DRP A;  4F9O A;  2O4G A;  4JKG A;  1FK9 A;  4E1M A;  1GLC G;  3DRS A;  2VGM A;  2ZM6 K;  4B3R K;  4O5F A;  3CF5 L;  4CJS A;  3QIC A;  3A2F A;  4ILJ A;  4LF7 K;  3NMU A;  2HHS A;  3V9Z A;  2IC3 A;  2YHY A;  1G15 A;  3AA3 A;  1NMN A;  5DK5 A;  3PO5 A;  4Q0B A;  3AAR A;  1D5A A;  1NOY A;  5BRD A;  1BHL A;  4CIE A;  5JLH A;  4KI6 A;  4W5R A;  3OYN A;  3MN7 A;  1QQC A;  4B9L A;  4CJR A;  1ATN A;  2I7P A;  4B1X B;  3VEY A;  1BI4 B;  4KKO A;  3C95 A;  2HBJ A;  2X74 A;  1K9M O;  2XHB A;  1TL3 A;  3O3H A;  4L8R B;  4LFC K;  4CW7 B;  5BPN A;  2BTF A;  3SK3 A;  4FZZ A;  1Z26 A;  1VQ6 N;  2HHW A;  4OPH A;  1NGF A;  5JMV A;  3MX2 A;  4JI0 K;  3HZ6 A;  2ZWH A;  3CCR N;  4GKK K;  4IWV A;  3VEX A;  1NGE A;  3WT0 A;  1B92 A;  4BRH A;  4DSJ A;  1QSL A;  4M3W A;  3QLH A;  4CFA A;  1LWC A;  3LP2 A;  3B8A X;  4NYN A;  1NJY A;  4UQG A;  1J5O A;  3NF8 A;  3EO3 A;  3LPT A;  4IO9 L;  1C0T A;  3U3G A;  1VQ4 N;  3OYE A;  4KHQ A;  4CZG A;  1SL1 A;  3TU5 A;  1VSF A;  4JKA A;  5M1F A;  2LSN A;  4H0T B;  3DLL L;  4DTU A;  4CEZ A;  2QWL A;  3HSC A;  4IDH A;  4HUF A;  4OPA A;  4FWP A;  4DTR A;  3J7Z O;  4R5P A;  3BF1 A;  2HB5 A;  1C6V A;  3DMJ A;  2CH6 A;  3IFR A;  1N32 K;  1KCF A;  1ZBS A;  1U47 A;  5EU7 A;  2E2O A;  3ID6 A;  3VQ4 A;  3NVM A;  1QSY A;  3LDP A;  4X65 K;  1FKO A;  4CGH A;  3HI0 A;  4OPK A;  4X64 K;  3WXJ A;  4NO7 A;  3CCL N;  3CJA A;  1RTH A;  4M3X A;  3EYZ A;  3SQ1 A;  1A5V A;  3OVN A;  4C1N K;  4B9M A;  4FZY A;  4BC5 A;  1JL1 A;  1J54 A;  4IJN A;  3CJ9 A;  4O0J A;  3AA2 A;  4DTN A;  1QQO A;  2X6N A;  1RCH A;  2W6K A;  4E7I A;  4BWM A;  1N6Q A;  2ASP A;  3RRG A;  4BAC A;  1WSJ A;  3WXI A;  3AY9 A;  2RKI A;  2E8A A;  1K73 O;  4IZ9 A;  4MDA A;  3KLI A;  4K25 A;  4OKE A;  3ENO A;  4HTL A;  4XEI A;  1S1X A;  4B1W B;  3IDH A;  4F4K A;  4DR7 K;  4O55 A;  3SPY A;  1KAX A;  5AQS A;  4LF8 K;  4BR2 A;  3TAP A;  1ZBF A;  4EAH D;  2FSN A;  2QWN A;  1NK5 A;  1Q81 O;  3VQQ A;  4GV6 A;  1ASV A;  4BR0 A;  3O9S A;  5CYM A;  4PL7 A;  3EE8 A;  4ISF A;  3NVK A;  2UU9 K;  3F9M A;  4YY3 K;  2E4L A;  4PUO A;  2HMP A;  1LAW A;  4I9L A;  3VA0 A;  1IKX A;  1U48 A;  1GOA A;  1I94 K;  2WTU A;  1BCM A;  4Q5V A;  3V9W A;  1UA0 A;  4FSV A;  4B9N A;  2AJQ A;  4OX9 K;  1IG8 A;  2Z1G A;  4ZTJ A;  2HMI A;  1HKB A;  1GLL O;  3CHW A;  3LP3 A;  4K8X A;  3FZM A;  3TAM A;  3IKM A;  4BY9 C;  4KI4 A;  1W7A A;  1TKX A;  4IG0 A;  4B9U A;  1YF5 L;  3THY A;  4BDY A;  3NH1 A;  4B3O A;  1KVB A;  1T7P A;  5GIO A;  3M1F A;  1ITG A;  3CCM N;  4FJ8 A;  4F3O A;  1B9F A;  1EO1 A;  3MXI A;  3A5M C;  1H1V A;  3GL1 A;  2FSJ A;  1EWQ A;  2HND A;  4NLC A;  5AQL A;  3LZJ A;  4LFB K;  4JHD B;  4M3Z A;  5M1O A;  2QM1 A;  3KZB A;  1X9S A;  2O8C A;  3CCU N;  1NGC A;  2O8E A;  2IGI A;  4DTS A;  4KHS A;  3DLE A;  3ASM A;  2D0O A;  3NGI A;  4JK9 A; 
#chains in the Genus database with same CATH homology
 4F2R A;  4CK3 A;  2YNH A;  1WSG A;  3K59 A;  3L2Q A;  3V81 A;  3QEP A;  3PUF A;  3V4I A;  4EZ9 A;  4F3T A;  1U45 A;  3HL8 A;  1DLO A;  1RT6 A;  3CYM A;  1VSJ A;  3SYZ A;  2KTQ A;  5DMR A;  5J2Q A;  3K58 A;  4W5O A;  1Q9X A;  2FC0 A;  5HLF A;  1XI1 A;  3HO1 A;  1T8E A;  4GMJ B;  1NK0 A;  5KRS A;  1U04 A;  1CXU A;  1U4B A;  3O3G A;  1JXE A;  3V9S A;  2DFE A;  3QES A;  4KPY A;  4KV8 A;  1EET A;  5HRN A;  3SUO A;  3G10 A;  4CJT A;  3KD5 E;  4DSK A;  5HRP A;  4DF8 A;  4DFP A;  4EP4 A;  4RG8 A;  4RW6 A;  4FLW A;  3U3Y A;  2D0B A;  1XC9 A;  3PV8 A;  4DQI A;  5JS1 A;  1XHX A;  3DLB A;  4E0D A;  3QO9 A;  1JLG A;  1RBU A;  3ULD A;  4FK0 A;  1RNH A;  1C1A A;  4I2Q A;  3VQP A;  4CF8 A;  3O3F A;  4FM1 A;  4DSF A;  4E7J A;  3SQ2 A;  3MXM A;  1WSI A;  1QE1 A;  4B08 A;  4YNQ A;  4DFM A;  4DWI A;  4DS4 A;  4FJI A;  4AH9 A;  2VG5 A;  2WON A;  2PYJ A;  3NH0 A;  3T1A A;  1UOC A;  2Z1I A;  4DG1 A;  3OYJ A;  1L3U A;  3LPU A;  3RR7 A;  4KHN A;  3QIN A;  1TK0 A;  4Z4I A;  4EP5 A;  5FDL A;  3DLH A;  3P5J A;  4LY7 A;  2OPQ A;  4C8N A;  4CGJ A;  4I7F A;  4NCG A;  3RR8 A;  4C8K A;  1RT2 A;  2KFZ A;  2B4J A;  3DLR A;  3OYH A;  4E7H A;  3SUP A;  4CJP A;  4DTM A;  1NOZ A;  3AO1 A;  3MEC A;  2VG6 A;  3AV9 A;  4KTZ A;  3NGZ A;  2JGU A;  4DFJ A;  4CHP A;  4C8O A;  2G8W A;  1VSD A;  1QSS A;  1KVC A;  2HNY A;  2XRI A;  3LAL A;  1I3A A;  4LH5 A;  4CK1 A;  3KK3 A;  3HXM A;  4CHO A;  1Z25 A;  4M3Y A;  3SPZ A;  2YKN A;  5KGX A;  1FXX A;  1WSE A;  2RN2 A;  2NUB A;  3L3V A;  3ZSY A;  4CIG A;  4B8C A;  3AA4 A;  1LWF A;  5JS2 A;  4RW9 A;  2F8S A;  2HHX A;  4KHU A;  4FM2 A;  1JLA A;  1BQN A;  2OYQ A;  1JLF A;  4H4O A;  4OPJ A;  4DSI A;  2YNI A;  3IG1 A;  3EZ5 A;  3I8D A;  1RDD A;  3LWM A;  3KIO A;  2X6S A;  3ZSX A;  3TR8 A;  2A1R A;  3SUQ A;  5HRR A;  3ZSW A;  4KRE A;  4CJQ A;  4DMN A;  4FLZ A;  3BGR A;  3CG7 A;  3OS0 A;  1NK6 A;  3HT3 A;  4NCA A;  1HRH A;  4KHY A;  4AHC A;  3M8P A;  3NFA A;  3K5O A;  3HP6 A;  1U49 A;  3HK2 A;  3T19 A;  3AVA A;  3T3F A;  4OKK A;  4CF2 A;  4JS5 A;  4FJG A;  4FJN A;  3AVH A;  4ID5 A;  1JKH A;  2WOM A;  3ZT4 A;  4CFD A;  5C25 A;  4J2E A;  1GOB A;  4FJH A;  3L2R A;  4DS5 A;  1RT4 A;  1SKS A;  4YFU A;  4IKF A;  4Z4G A;  3HP9 A;  4CF1 A;  3OJU A;  1JLQ A;  3C6U A;  3VQ7 A;  4N5S A;  3O4N A;  3RTV A;  1RBV A;  4FLT A;  4E89 A;  3DLG A;  2B6A A;  1NK7 A;  1W9H A;  2KFN A;  3L8B A;  1TKZ A;  3KLG A;  4KO0 A;  1S6Q A;  2KZZ A;  1DTT A;  4O44 A;  5K14 A;  2VWJ A;  4M41 A;  5C24 A;  3ZT0 A;  4I2P A;  3NE6 A;  5KRT A;  3TAF A;  4AHV A;  3K57 A;  4DQR A;  1TKD A;  3LP1 A;  1NJZ A;  2ZE2 A;  4E7L A;  3OY9 A;  1KSP A;  4M3U A;  3AVJ A;  4HCB A;  5FRN A;  3DI6 A;  4CJK A;  5SZT A;  5HP1 A;  4OKJ A;  5FRO A;  1VSE A;  4AHU A;  1L3T A;  4O0I A;  3OYC A;  4BE1 A;  4RW8 A;  1W0H A;  3VA3 A;  4OJR A;  2P51 A;  4CES A;  3VQ5 A;  3RMD A;  3MXJ A;  1WNS A;  4CJE A;  1RT3 A;  3QIO A;  3SV3 A;  4OLB A;  4CER A;  4M42 A;  2YNG A;  3ISN C;  1S6P A;  4W5Q A;  3NBP A;  3OYD A;  4HUE A;  3OS1 A;  4XIU A;  3OYB A;  2IDO A;  1BIU A;  1KFD A;  1RBS A;  1C1C A;  1HYS A;  2RPI A;  4Z0U A;  4CEO A;  3AVM A;  1N5Y A;  1GOC A;  3AVK A;  1FKP A;  3MEG A;  1REV A;  2VWK A;  4CJU A;  1L3S A;  1HYV A;  3ZCM A;  3OJS A;  1LW2 A;  2ATQ A;  1QHT A;  4CEB A;  4DQS A;  3ZT3 A;  5J2N A;  3QEW A;  1SL0 A;  2DTU A;  1DTQ A;  2E6L A;  4IBN A;  1CZ9 A;  1TKT A;  1WAF A;  2YHA A;  1YTU A;  2F8T A;  3THV A;  4CJV A;  4EZ6 A;  1ZBH A;  1HYZ A;  1RDC A;  3B6P A;  2XY5 A;  4K8Z A;  4AHS A;  3VQD A;  3DLK A;  2QKK A;  4RW4 A;  3WNH A;  1A5W A;  4DSE A;  1C0U A;  3DLE A;  4FJM A;  2IAJ A;  3H08 A;  4HUG A;  3P83 D;  5HBM A;  3NF7 A;  1VRU A;  1RDB A;  2Q3S A;  4IFV A;  1UAX A;  2D0A A;  3LWL A;  4FJK A;  4M3T A;  2HW3 A;  1IO2 A;  4CJ5 A;  3QEX A;  2DY4 A;  2ZD1 A;  4E19 A;  4CHN A;  4C8L A;  3S3M A;  5KTQ A;  2P5O A;  3SQ4 A;  2IS3 A;  4GVM A;  4BWJ A;  4CJF A;  4CF9 A;  3PX0 A;  3MAQ A;  1HPZ A;  1XWL A;  3OYM A;  3P1G A;  5KI6 A;  3V6D A;  1O1W A;  3CFO A;  4RW7 A;  1ZBL A;  2G8U A;  3VQ8 A;  3KKS A;  1NK4 A;  4FXD A;  4KHW A;  3LAN A;  5CYQ A;  4OVL A;  3CFP A;  3TAR A;  4LD0 A;  3RRH A;  3C94 A;  2XO7 A;  4O5B A;  4CGD A;  4DLG A;  4HTU A;  2HVH A;  2DFH A;  3AO4 A;  3G0Z A;  4JLH A;  4B9S A;  3ZSO A;  4BE2 A;  3VQB A;  4ICL A;  4FJX A;  4DLE A;  2FBT A;  2YNF A;  3TAQ A;  5CZ1 A;  4Z4F A;  4CJW A;  4FJ5 A;  2QK9 A;  1NK9 A;  3I0S A;  2P1J A;  2P5G A;  4FJL A;  1X1P A;  1VSL A;  2BAN A;  1T03 A;  3IAY A;  2KZM A;  1LWE A;  1B9D A;  2Y1J A;  1VSI A;  3KJV A;  1IG9 A;  2HHV A;  3ALY A;  1S5J A;  4CFC A;  2XY7 A;  1YTA A;  1BGX T;  4CHY A;  1WSF A;  3HPO A;  4CJ3 A;  1VSH A;  3AVI A;  3SUN A;  1BI4 A;  2YKM A;  3PO4 A;  3F9K A;  4IG3 A;  2YV0 X;  1BQM A;  4O4G A;  4TSX A;  2F96 A;  3LZI A;  3QER A;  1CXQ A;  2Z1H A;  2BE2 A;  3VN5 A;  4DFK A;  1KRP A;  1RIL A;  2E6M A;  2B5J A;  4E1N A;  4QCL A;  3OYI A;  1HNV A;  3DOL A;  4E7K A;  3TAB A;  4QOZ B;  1S1T A;  1JLB A;  4DTJ A;  1KVA A;  3SQ0 A;  4CE9 A;  4CED A;  3KLH A;  3S3N A;  4JRP A;  3HM9 A;  3KKR A;  2W42 A;  3DRP A;  2O4G A;  4AHR A;  1X9M A;  3AVC A;  3NDK A;  1FK9 A;  3CQ8 A;  2OPR A;  4E1M A;  3KLE A;  4LH4 A;  4Z4C A;  5I3U A;  3DRS A;  1ASW A;  1R0A A;  4M3R A;  2KW4 A;  2QKB A;  4FM0 A;  3M8R A;  2PYL A;  3TAG A;  2OPP A;  4J2B A;  1TV6 A;  3AO5 A;  4CJS A;  1JLE A;  3A2F A;  4ELT A;  2HHS A;  5J1E A;  3OYK A;  3V9Z A;  2IC3 A;  3B6O A;  3AA3 A;  1G15 A;  1EXQ A;  5DK5 A;  3PO5 A;  4Q0B A;  3ZSQ A;  5HRS A;  3EY1 A;  1IH7 A;  4DU4 A;  1T05 A;  3D45 A;  1NKE A;  4OLA A;  4H4M A;  1D5A A;  1NOY A;  2FBY A;  3TI0 A;  1BHL A;  1JL2 A;  4CIE A;  3RMC A;  3SCX A;  3V9U A;  4KI6 A;  1VSM A;  2O4I A;  3L2U A;  1WSH A;  4Z4H A;  4W5R A;  3NAE A;  3QEI A;  3OYN A;  2G8H A;  3K5L A;  4LSL A;  4OGE A;  2PZS A;  1QQC A;  4B9L A;  4H8K A;  4CJR A;  3LAK A;  1S1W A;  1TK8 A;  2G8K A;  4ZTF A;  1BI4 B;  4KKO A;  3C95 A;  3LDS A;  2X74 A;  4N76 A;  3HST B;  2XHB A;  5CY4 A;  1TL3 A;  4CHQ A;  3ZSR A;  3HVT A;  3NF9 A;  3VQ6 A;  3O3H A;  1Q9Y A;  1TAQ A;  1C1B A;  1RTD A;  4CFB A;  1D9F A;  4L8R B;  2G8F A;  5T7B A;  4KTQ A;  1ASU A;  4FW2 A;  4FCY A;  3PX4 A;  1NJX A;  1CLQ A;  2OPS A;  1YVU A;  4FZZ A;  1Z26 A;  3KD1 E;  1IKW A;  3M8S A;  2HHW A;  4IDK A;  1LV5 A;  1KLN A;  3V1R A;  3L3U A;  3NH2 A;  3DRR A;  1S9G A;  1RBT A;  3IRX A;  1NKC A;  4JRQ A;  4G1Q A;  1QTM A;  2KQ2 A;  4ID1 A;  4J2A A;  1SV5 A;  3L2V A;  1B92 A;  3SI6 A;  4DSJ A;  1QSL A;  4FLX A;  3QLH A;  4CFA A;  1LWC A;  3LP2 A;  4I9Q A;  4M3W A;  3OS2 A;  2ETJ A;  4NYN A;  1NJY A;  1C0M A;  1HMV A;  3ITH A;  5C42 A;  4ELV A;  4UQG A;  3LP0 A;  3IS9 A;  4HVJ A;  1J5O A;  3NF8 A;  3LPT A;  4FW1 A;  1RTJ A;  4CJ4 A;  4CJL A;  3QET A;  3SJJ A;  1C0T A;  3FFI A;  5SWM A;  3U3G A;  4DTX A;  4J2D A;  4PWD A;  2HHU A;  2HHQ A;  3OYE A;  1ZBI A;  1KLM A;  4KHQ A;  3DM2 A;  1SL2 A;  4Z4E A;  1SL1 A;  3MED A;  1VSF A;  3KK1 A;  4DTU A;  2LSN A;  3OYA A;  4CGI A;  1SKW A;  4CEZ A;  4BDP A;  3QEV A;  1VRT A;  1TK5 A;  4N41 A;  3JYT A;  3RMA A;  4HUF A;  2OZS A;  1EX4 A;  3OYF A;  4FK4 A;  3V9X A;  3E01 A;  4DTR A;  1RT5 A;  3NCI A;  4R5P A;  2QXF A;  1RBR A;  4DQQ A;  4MQ3 A;  1EKE A;  2HB5 A;  1C6V A;  1S1U A;  3DMJ A;  3TAE A;  4N47 A;  1KCF A;  1UA1 A;  1U47 A;  5EU7 A;  1QS4 A;  3SZ2 A;  4FYD A;  2Z1J A;  4ELU A;  4LSN A;  3VQ4 A;  3ZSV A;  2XY8 A;  4CEF A;  4AIL C;  1XHZ A;  1QSY A;  1FKO A;  4KTW A;  4CGH A;  4W5T A;  4OPK A;  2HHT A;  3AVN A;  1BIZ A;  3S3O A;  4FJ9 A;  3DYA A;  4FZX C;  1J53 A;  4PQU A;  2IOC A;  1RTH A;  4M3X A;  2FBX A;  2X78 A;  3SV4 A;  3EYZ A;  3SQ1 A;  1A5V A;  3OVN A;  4DTO A;  4B8A B;  1TL1 A;  4B9M A;  4FZY A;  1JL1 A;  1J54 A;  3O4Q A;  4CGG A;  1HQU A;  1F21 A;  4O0J A;  2Y1I A;  1WLJ A;  3AA2 A;  4DTN A;  4FJ7 A;  1EP4 A;  4OGC A;  2X6N A;  4F2S A;  1K6Y A;  1RCH A;  2ZQB A;  4BE0 A;  3AO2 A;  4DF4 A;  4E7I A;  4M45 A;  3AVF A;  4CEC A;  4BWM A;  2GBZ A;  1N6Q A;  3RRG A;  3PY8 A;  1NJW A;  3ZT2 A;  4BAC A;  1WSJ A;  3HPG A;  1ZYQ A;  5D3G A;  2G8I A;  2RKI A;  5CZ2 A;  1KFS A;  4NCB A;  3AO3 A;  3D0P A;  2EX3 A;  1UWB A;  3OYG A;  3NGY A;  2D5R A;  5J2M A;  3WNG A;  3KLI A;  4CEA A;  4OKE A;  4C8M A;  4CK2 A;  5E41 A;  3KLF A;  2EHG A;  4QAG A;  1L5U A;  4F8R A;  4KB1 A;  4KRF A;  4NYF A;  2DFF A;  3CM6 A;  1S1V A;  4Y1D A;  1S1X A;  5KGW A;  3NHG A;  3V1Q A;  1BL3 A;  4F4K A;  3UIQ A;  3ZT1 A;  4N56 A;  3U6F A;  1LW0 A;  4O55 A;  1NKB A;  1HNI A;  3SPY A;  2BDP A;  1TGO A;  1BCO A;  3TAP A;  3VQ9 A;  1ZBF A;  4HCC A;  3HPH A;  4GW6 A;  4CEQ A;  4CIF A;  4B9T A;  1NK5 A;  3VQQ A;  3L2W A;  1ASV A;  3KTQ A;  1J9A A;  1JXB A;  4KB0 A;  5CYM A;  2BGG A;  1D9D A;  1WN7 A;  2HNZ A;  3K5N A;  1RTI A;  2ITG A;  3RMB A;  4CCH A;  3RWU A;  4KAZ A;  3AVG A;  2R7Y A;  4AHT A;  5J2P A;  4DSL A;  3TAN A;  4CF0 A;  1KTQ A;  2E4L A;  4CEE A;  3JSM A;  4DQP A;  4IFY A;  4CHZ A;  3NGI A;  1LAW A;  4PUO A;  4I9L A;  3VA0 A;  1D8Y A;  1IKX A;  2I5J A;  1VSK A;  1LAV A;  3NF6 A;  3K5M A;  1U48 A;  1BIS A;  4DU1 A;  1CZB A;  1JLC A;  1GOA A;  1HQE A;  4B9V A;  1I39 A;  5FRM A;  1BCM A;  4Q5V A;  4DTP A;  3V9W A;  1UA0 A;  3F73 A;  3BDP A;  4B9N A;  1WAJ A;  2AJQ A;  1MU2 A;  2OA8 A;  2Z1G A;  4HHT A;  4ZTJ A;  2HMI A;  2HVI A;  2A1S A;  4KFB A;  1TAU A;  1A5X A;  3HYF A;  3LP3 A;  4K8X A;  4E3S A;  1L3V A;  4W5N A;  3ZSZ A;  1RDA A;  3TAM A;  3HVR A;  3M8Q A;  2YHB A;  3I0R A;  4KI4 A;  1IKY A;  1TKX A;  2D0C A;  4IG0 A;  4Y1C A;  1HJR A;  4B9U A;  3LAM A;  2RF2 A;  3AA5 X;  1Y97 A;  4FJJ A;  3QNN A;  2OZM A;  4WE1 A;  3WNF A;  3CM5 A;  4BDY A;  4MFB A;  3NH1 A;  4FVM A;  3SNN A;  4B3O A;  1KVB A;  3PX6 A;  1T7P A;  5I42 A;  4FLV A;  3V1O A;  3KK2 A;  1SKR A;  1ITG A;  1IKV A;  4FJ8 A;  4F3O A;  4JS4 A;  1B9F A;  3MXI A;  4CGF A;  3OYL A;  3VQE A;  1YT3 A;  4PY5 A;  1Q8I A;  1VK0 A;  4PA1 A;  1NK8 A;  3CFR A;  2GV9 A;  3VQA A;  4FLU A;  1X9W A;  4FK2 A;  2HND A;  2JLE A;  3LZJ A;  4FLY A;  1SUQ A;  4M3Z A;  1RT1 A;  2XY6 A;  3DOK A;  2G8V A;  3AVB A;  2PY5 A;  1X9S A;  2FBV A;  1RT7 A;  3K2P A;  3VQC A;  3MEE A;  3TWH A;  1TVR A;  3AVL A;  1ZBU A;  4DU3 A;  2IGI A;  4ZHR A;  2VG7 A;  3QIP A;  2GUI A;  4BDZ A;  3QNO A;  5HRO A;  3HJF A;  3C6T A;  4DTS A;  1S9E A;  3ASM A;  4KHS A;  3WNE A;  3S9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...