4CHYA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 54
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4chyA00
2XRIA 4YNQA 1SUQA 2W42A 2ETJA 4O0IA 1RTHA 2HNZA 3OS0A 1MU2A 4CJSA 3WNGA 4CGIA 5KGXA 4B9VA 3V81A 3I0SA 1HJRA 2XO7A 1I3AA 5C42A 1Y97A 1NJZA 2KZMA 4OGCA 4F3TA 4HUEA 3QEWA 3LDSA 4OLAA 5KGWA 4KB0A 3O3HA 4FLTA 1FXXA 4FJIA 1NK7A 4DSFA 4KHSA 1NJXA 1C0MA 4CE9A 1HYVA 5J2QA 2YNHA 4FJXA 1U04A 1JLGA 3QEXA 4DQSA 3OYMA 2Z1GA 4N56A 4J2BA 5CYMA 4DTXA 2QK9A 1K6YA 3DLKA 1RDCA 3ASMA 1ZBFA 1U48A 4FJHA 1KFSA 4CGHA 1U47A 4FXDA 3RRGA 3OJSA 1KVBA 3AVMA 1BCMA 4M3YA 2IS3A 4PY5A 3WNEA 1T8EA 4DFPA 4L8RB 3C95A 4ID5A 2QKBA 3D45A 4I9QA 4PWDA 2P5GA 4FW1A 3V9XA 4ELTA 3LPTA 2B5JA 5J1EA 1RBVA 4CEQA 4B9LA 4TSXA 3OJUA 1Q8IA 4R5PA 1RDAA 1B92A 1UOCA 1UWBA 2FC0A 5EU7A 4CJKA 1S1XA 2HHWA 4DQRA 3V1RA 3HO1A 4CK2A 3K57A 3AVJA 4KHNA 3DI6A 4GW6A 5FROA 3VQQA 1KVCA 1I39A 3CM6A 4FVMA 4XIUA 3TAGA 1SL0A 3QIOA 4AHUA 5SZTA 3OS2A 4DF8A 3EY1A 5FRMA 2ITGA 3NH0A 1BHLA 2VG6A 3ZCMA 1Q9YA 3VQAA 4KTZA 3AVGA 5C24A 3QNOA 1REVA 3CFOA 3L3UA 4E7IA 1A5XA 1BQNA 1LWEA 1EX4A 2F96A 3IG1A 4O5BA 1TV6A 3OYAA 3SQ1A 3V9SA 3FFIA 4N5SA 1TK8A 3PO5A 4EZ6A 4PQUA 1TAUA 1VRUA 4BDPA 3AA2A 3PX6A 3BDPA 3NF9A 3SI6A 2FBXA 1NOZA 2YKMA 4Z4HA 1KTQA 4FM0A 4DTJA 2IOCA 4H4OA 5CZ2A 4C8NA 2GUIA 4Q0BA 1QQCA 3ISNC 4EZ9A 2ZD1A 4FZZA 2B6AA 3VQPA 5KRTA 4FLVA 3NAEA 2Z1IA 5J2PA 1NK8A 4FLXA 4CFCA 1QSSA 3KKSA 4Y1CA 3T19A 3NDKA 1NK4A 3L2RA 4KHWA 2DFEA 3HSTB 1B9FA 4IFYA 3K59A 5J2MA 4B9SA 1S6QA 1RBSA 2QXFA 3LAKA 2HW3A 1O1WA 1BL3A 1S6PA 1UAXA 4HHTA 1HPZA 3EZ5A 2HB5A 4W5NA 1U49A 4ICLA 3QERA 4DU1A 2XY6A 1S1WA 4DFMA 4DTSA 1ZBUA 1JLCA 2A1RA 1JLEA 1RTIA 4AHRA 4JS4A 1NK5A 4CCHA 4FLWA 4FJNA 1SKWA 5I3UA 3ZSOA 3DYAA 1VSEA 4EP4A 1GOCA 1IKYA 1UA0A 2BANA 2G8FA 5JS1A 2B4JA 4CEZA 2DTUA 3HP6A 4Z4GA 4RW9A 4CK3A 5C25A 4HCBA 1XC9A 1C0UA 4HCCA 2FBVA 4BACA 3HPOA 2O4IA 1IKXA 5HRSA 3F73A 4AHVA 1JLBA 4IBNA 4CJ5A 3TAPA 1D8YA 4F2SA 3QEIA 4FLYA 4CK1A 1NKEA 4CECA 4KO0A 4B3OA 3DOKA 1JKHA 3OYIA 3VQCA 2F8SA 4CJPA 1HRHA 1S9GA 1YTAA 1TL1A 1ITGA 2KFZA 3C6UA 1L3UA 1J9AA 1WAFA 5KTQA 5D3GA 3QNNA 4B9TA 2HHQA 3DRPA 1VSKA 1JL2A 2ATQA 3DLBA 4FJ7A 4J2DA 1ASWA 2DFFA 2X6SA 2AJQA 1BI4B 4OLBA 3HL8A 3SYZA 3AVFA 4DSJA 2VG5A 4DF4A 4KTQA 5T7BA 4J2AA 2E6MA 3TAEA 5HLFA 4MFBA 3VQ8A 4CEEA 3T3FA 2KFNA 2JGUA 1W9HA 1HNVA 3NH1A 3A2FA 4ZTJA 4KB1A 4OKKA 3UIQA 2D0AA 3ZSVA 3NF6A 4M3RA 3TABA 1RT3A 1CZBA 3VQ5A 3JYTA 3KLHA 2HNYA 1RTJA 1XWLA 4CHYA 4AHCA 4CJUA 3K58A 3DRRA 4QCLA 4DLEA 2HHTA 4Q5VA 4CFDA 3ZSQA 3VA3A 4PA1A 4M45A 3NGZA 3V9UA 1RTDA 4BE2A 4W5QA 4O44A 1C6VA 4C8LA 4ZHRA 4DTMA 1BI4A 3AVAA 2Y1JA 1T7PA 4Z4CA 3ZT3A 4FJ8A 4IG0A 1GOBA 4K8ZA 2D0CA 3OYNA 3PX0A 4M3XA 1S1UA 4E1NA 4CHOA 1RBTA 2G8WA 3KK2A 1TK5A 1S1TA 1WNSA 2OA8A 5CY4A 4CGGA 3K5LA 3DLGA 3LP1A 1VRTA 3AVCA 4CHZA 4CGFA 4HVJA 3OS1A 3SJJA 1FKPA 1S1VA 1S9EA 4KHQA 1CXQA 3NF8A 2BE2A 3P83D 3NHGA 1NJWA 4RW7A 1VSLA 1YTUA 2YNFA 3NF7A 4WE1A 1RT6A 3AO1A 4LD0A 1X9MA 4DSKA 2HMIA 2VG7A 1YVUA 3TAQA 4B08A 2KQ2A 3CYMA 4CJ3A 3SPZA 1SKSA 3CG7A 1RT1A 2OZMA 3V9WA 4DQQA 3NGYA 5KRSA 2P51A 1ZBIA 1NJYA 3WNFA 3M8PA 3TAMA 3CQ8A 2G8IA 2DFHA 1HNIA 2GBZA 3VQBA 3K5OA 3O4QA 1NKCA 2XY8A 1SV5A 5HROA 1XI1A 1RILA 4FYDA 3SQ2A 3HVTA 1QS4A 3AVIA 2RF2A 2Z1JA 4CERA 3K5MA 1WN7A 3PV8A 2IDOA 4DMNA 4FJLA 4CGJA 1WLJA 4CIGA 1EP4A 4F8RA 4OKEA 1Q9XA 4I7FA 3MAQA 1TAQA 3HPHA 2G8VA 2VWJA 4FLUA 1LV5A 1BIUA 3KK3A 3S9HA 1VSFA 1WSFA 1WSGA 4E7KA 2HVIA 4Y1DA 4CF9A 3SZ2A 2O4GA 3L2VA 3VA0A 2Q3SA 3LAMA 1CLQA 1NK6A 3THVA 1LAWA 4CJEA 4W5TA 3NGIA 4JRPA 1J53A 2P1JA 1KFDA 3AO5A 5HBMA 4B9NA 3AO2A 4LSNA 3LANA 3L3VA 3V1QA 4BWMA 3V6DA 4M3UA 1A5VA 4QAGA 1ZBLA 4IKFA 4M3WA 3SQ0A 3KD1E 4HUGA 1RDBA 3LALA 1C1CA 3S3OA 3ITHA 1JXBA 1HMVA 4OKJA 1NOYA 4J2EA 1TGOA 2PYJA 4FZXC 1HQUA 2YKNA 1WSJA 2RKIA 2X78A 4BE0A 3QINA 1L3TA 2KTQA 1FKOA 4KTWA 4I9LA 3LWMA 4FLZA 4GMJB 2IAJA 2ZQBA 1UA1A 4N47A 4KPYA 3NH2A 3DM2A 1N6QA 3RMCA 1GOAA 4E19A 2LSNA 4GVMA 2FBTA 3KD5E 2PYLA 2WONA 4B8CA 4M42A 1RBRA 3K2PA 1RT7A 4NCBA 1FK9A 3ZT0A 3LZIA 3SCXA 4RW8A 4AH9A 3KTQA 3U3YA 2YV0X 2HHVA 2I5JA 3QETA 1YT3A 4M3ZA 1DLOA 3TR8A 3HVRA 3PUFA 4CEFA 3TWHA 4DTOA 3CFPA 4FK2A 1ZBHA 4CGDA 4CF2A 2GV9A 3KK1A 3L2UA 3RRHA 1L3VA 1D9DA 4H4MA 4W5RA 4FJMA 1HYSA 3NCIA 3S3NA 2IC3A 4E7LA 3AVKA 3DOLA 1VSIA 4CEOA 4JLHA 3KKRA 4CJLA 3HXMA 4BE1A 3V4IA 4FJKA 4CJTA 3OVNA 3KLGA 3MXJA 2HHSA 4FK0A 4KV8A 4IG3A 4DSIA 3D0PA 3RMDA 3L2WA 4O55A 1T03A 2YNGA 1IO2A 3RMAA 4CHPA 3NBPA 1R0AA 3AVBA 3ZSRA 4FK4A 1RBUA 3AVHA 3SV3A 1LW0A 2IGIA 3MEDA 2X74A 5SWMA 3VQEA 3O4NA 2A1SA 4CJWA 3M8RA 3JSMA 4FM2A 3VQ7A 4NCAA 3G10A 3B6PA 3C6TA 4FJJA 4DU4A 3K5NA 1RT5A 1NK0A 3HPGA 3OYLA 4OPKA 1TK0A 1T05A 1J5OA 3NFAA 4KREA 1KLNA 3SQ4A 4G1QA 3DLEA 3M8SA 5HRRA 4CF1A 4DSLA 4IFVA 4UQGA 3MXIA 4E1MA 4HTUA 4E0DA 4O4GA 3TAFA 4DLGA 1D5AA 1SL2A 3EYZA 1IKWA 3PY8A 2G8HA 1B9DA 4DQIA 3OYFA 4KHUA 3OYDA 4AHSA 1DTQA 5JS2A 2F8TA 3QIPA 4JRQA 4BDZA 4E7JA 2P5OA 1KLMA 2XY7A 4N76A 2KW4A 2HHUA 3HM9A 3HYFA 4DSEA 3HP9A 3QEVA 1BCOA 4CJFA 3L2QA 1QSYA 2BDPA 3HT3A 4ZTFA 4DQPA 3G0ZA 3TARA 3RR7A 1SKRA 4FJ5A 1BQMA 3HJFA 4CF0A 5J2NA 3B6OA 2OYQA 2KZZA 3LP0A 3SUOA 3S3MA 1KSPA 4CJQA 3LWLA 1X9SA 4ID1A 3ZT2A 3AA3A 1L5UA 1WAJA 3AO4A 3VN5A 4CFAA 1S5JA 3ZSXA 2RPIA 2VWKA 1N5YA 5HP1A 4I2PA 3AA5X 4YFUA 3KIOA 3SUQA 3SUNA 3O3FA 2E6LA 3ULDA 4M3TA 5E41A 3DRSA 1XHZA 3OYJA 2G8KA 3MXMA 1RNHA 4I2QA 1VSHA 4CJ4A 3DLRA 5HRNA 3QESA 4DWIA 1EETA 3IAYA 4CFBA 1J54A 4CIFA 1QHTA 1LW2A 4KRFA 3I8DA 2D5RA 1QSLA 4FW2A 4CIEA 5CYQA 3LP3A 4KI6A 5KI6A 1ZYQA 1LWCA 4BWJA 4B9MA 4DFKA 3WNHA 1ASUA 1VK0A 4LH5A 3M8QA 4EP5A 2YHAA 3VQ6A 2XHBA 3TI0A 1NKBA 1DTTA 1BGXT 1TVRA 2G8UA 1VSJA 3ZT4A 3OYKA 1Z26A 4E3SA 3PO4A 2Y1IA 4B9UA 3SPYA 4CEBA 1U4BA 4RW6A 2DY4A 1SL1A 3AVNA 3ZSYA 1A5WA 4C8KA 3KLIA 1LWFA 3IS9A 4KAZA 1KVAA 1VSMA 3U6FA 3V9ZA 1L3SA 3OYGA 3OYHA 1W0HA 2R7YA 1F21A 1G15A 2OPPA 4ELUA 4KI4A 1JXEA 1WSEA 4DS4A 3OYCA 4ELVA 4FJ9A 4KKOA 2BGGA 1LAVA 4DTNA 1BISA 1JLAA 2WOMA 1RT4A 4CJVA 3PX4A 4FM1A 2HVHA 1WSIA 2EX3A 4B8AB 3QO9A 4CJRA 4CEDA 4DFJA 3SNNA 1TKDA 3OYBA 4O0JA 3VQDA 4DU3A 2OZSA 1KCFA 4DS5A 4DTPA 3I0RA 1NK9A 3L8BA 4CHNA 1RCHA 4AHTA 1U45A 3U3GA 1TKXA 3ZSWA 3KLEA 1RT2A 4BDYA 3P5JA 3F9KA 2XY5A 1TL3A 3QLHA 3DMJA 4C8OA 3LPUA 4MQ3A 3MEEA 1HYZA 3H08A 5FRNA 4OGEA 3CM5A 4DTRA 3LP2A 1C1BA 4OPJA 5CZ1A 5DK5A 3RR8A 3CFRA 4Z0UA 1D9FA 3V1OA 5DMRA 1KRPA 1IH7A 4DG1A 3BGRA 2RN2A 1QTMA 3ALYA 1TKZA 3RTVA 1QE1A 3ZSZA 4M41A 3AA4A 3MEGA 2QKKA 1JL1A 4C8MA 4OVLA 2EHGA 3LZJA 3P1GA 4RG8A 3SV4A 3NE6A 4LSLA 2D0BA 4QOZB 4PUOA 2PY5A 3KLFA 4F2RA 2HHXA 5I42A 2ZE2A 2OPRA 4CESA 1ASVA 1C0TA 3TANA 4LH4A 4AILC 1IG9A 3HK2A 3OYEA 1EKEA 4LY7A 5K14A 4E7HA 2PZSA 2E4LA 4F3OA 4KHYA 4CHQA 4FZYA 1JLQA 1VSDA 4H8KA 4N41A 4DTUA 3E01A 4KFBA 4NYNA 4Z4EA 2JLEA 2X6NA 1X1PA 1X9WA 4FJGA 3AO3A 1CXUA 5FDLA 3T1AA 3VQ9A 2OPSA 4JS5A 1IKVA 3IRXA 2NUBA 4CEAA 1WSHA 3C94A 4NCGA 2YHBA 4IDKA 4OJRA 3OY9A 2HNDA 4E89A 5HRPA 1JLFA 1EXQA 3DLHA 4Z4IA 3MECA 4W5OA 3RMBA 1TKTA 1BIZA 4NYFA 2FBYA 1RDDA 4HUFA 3VQ4A 3SUPA 1Z25A 3QEPA 3O3GA 2Z1HA 4Z4FA 4K8XA 1C1AA 2OPQA 3RWUA 3KJVA 4F4KA 1HQEA 4FCYA 1XHXA 2YNIA 3AVLA 1CZ9A 4RW4A 4CF8A 3AV9A 3ZT1A
chains in the Genus database with same CATH superfamily
1C0GA 2XRIA 4JAXA 4O0IA 3G71N 4A2AA 4BRKA 4C1NK 3I0SA 4FOEA 3OBWA 1Y97A 1NJZA 5LMNK 2OTJN 3L6QA 2KZMA 4F3TA 4BC3A 5KGWA 4FLTA 1FXXA 4FJIA 4KHSA 4GV6A 4KHPK 1C0MA 2ZM6K 4YOWA 1ESVA 1U04A 1JLGA 3QEXA 3AGKA 4CBUA 3UKUB 5C12A 4N56A 4BC4A 3DLKA 2E5LK 1HX1A 5IT9O 1RDCA 3ASMA 1U48A 1U47A 3RRGA 3AVMA 4PY5A 1D4XA 3WXMB 4FW1A 3V9XA 1NGEA 5GAGP 1Q8IA 1RDAA 5EU7A 1S1XA 4IOCL 3B8AX 3V1RA 3HO1A 2NRZA 4BVOA 3DI6A 5FROA 3VQQA 3QIOA 4DF8A 3OS2A 3H46O 3NH0A 5AQPA 4BRGA 2ITMA 1Q9YA 3VPZA 5C24A 3FGUA 1NGJA 3L3UA 4E7IA 3VGKA 4BRMA 1LWEA 3IG1A 3KWIA 3V9SA 1ZXOA 4LFBK 3BY5A 4JD2A 4BDPA 2FBXA 2YKMA 3MN7A 4FM0A 3BP8A 4ISGA 4CZJA 3I55N 3H3OB 3FZFA 3R1XA 4EZ9A 4A5AA 5KRTA 5J2PA 1YXQA 3NAEA 1NK8A 3VMFB 3KKSA 4Y1CA 4DV3K 4IFYA 1E4GT 4FWLA 2QXFA 2O8EB 1NBWA 4W5NA 2HB5A 3ZX0A 2NRWA 2A41A 1JLCA 1BA1A 1RTIA 3TSUA 5AQSA 1WUAA 1FJGK 1VSEA 1QZ6A 2BANA 3ULEA 2DTUA 3KVGA 3HP6A 4IJAA 4CK3A 4HCBA 4HCCA 5JICA 2O4IA 4F2SA 4B1VA 3VF2A 4FLYA 4KO0A 1JKHA 3OYIA 3VQCA 5AQMA 1HRHA 1YTAA 2HBMA 1WBDA 1WAFA 2HHQA 4PKGA 2ATQA 3VEWA 2AJQA 3CIPA 3AVFA 5T7BA 1FW6A 3F9MA 3TAEA 4IOAL 4CEEA 4YOYA 4KB1A 3BUZB 4OKKA 2D0AA 3TABA 4JKEA 2P9UB 4JNEA 3KWGA 3JYTA 2HNYA 4M63C 3IKMA 4CHYA 4AHCA 4CJUA 3H45C 3P39A 3SBTA 4M45A 4BE2A 2HBKA 4DQ8A 4W5QA 3O9TA 1C6VA 1GLLO 3AVAA 5EX5A 1T7PA 2PAVA 3ZT3A 4FJ8A 2QWPA 3SBGA 1S1UA 4JI8K 5AQGA 4E1NA 4B3SK 1TK5A 3O6WA 3OS1A 4HVJA 4CGFA 1NK6A 4KHQA 2BE2A 1Q7YO 3SJHA 3NF7A 1NJIO 3VGMA 1W97L 4WFAL 1YUWA 3TAQA 4B08A 4BRLA 1RT1A 4JK9A 3NGYA 5KRSA 1NJYA 3WNFA 3M8PA 2HF3A 3K5OA 1SZ2A 1QS4A 3K5MA 4BR9A 3PV8A 2IDOA 4RTFD 2H3GX 3LDQA 4CIGA 4OO1J 4OKEA 3K9JA 5AQTA 1TAQA 3MCAB 3F2KA 3G6EN 4CZGA 3J8AA 3S9HA 3SZ2A 4GY2B 3FZMA 5AZIA 3VA0A 1LAWA 4IEEA 1KFDA 3AO5A 2QA4N 4LSNA 3LANA 2ZWHA 5DM7L 4BWMA 4QAGA 4HUGA 1RDBA 4B9QA 1C1CA 3CJBA 4OKJA 4FZXC 2RKIA 1L3TA 3QINA 3J7YP 2D1KA 4BRPA 4LF4K 4GVMA 2VWBA 3KD5E 1BG3A 2WONA 5JMVA 4NCBA 1FK9A 3ZT0A 1NG9A 3MN9A 4RW8A 3C7NA 2IVNA 1YT3A 3CJ1A 4M3ZA 3QDKA 3TR8A 4LF8K 3CFPA 1D9DA 4B3MK 2GV9A 5KPZA 4H4MA 3S3NA 3QB0A 5BRFA 1XC3A 4H0PA 2QW9A 1YHQN 3CCRN 4DSIA 1HKCA 5BPLA 4O55A 3RMAA 3H3NO 3WEEA 2IGIA 5SWMA 3O4NA 2A1SA 3M5RA 5AQVA 3M8RA 3VQ7A 1WBBA 4BG9A 4FPAA 1GLAG 1RT5A 3HPGA 4OPKA 4MO5A 3KHYA 2E20A 3SK3A 3S41A 3M8SA 4X62K 4CF1A 1OH7A 4IFVA 4UQGA 4GV9A 4E1MA 4O4GA 1XMQK 1YJNN 3SAGA 1SL2A 2GELA 3EYZA 4IDHA 4AHSA 4BR2A 4JRQA 1KLMA 3A0IX 2KW4A 4FWQA 3QEVA 3ID6A 3HT3A 4ZTFA 4FJ5A 2O8DA 2OYQA 3LP0A 4BY9C 1VQ9N 1L5UA 4CFAA 2RPIA 2UXCK 3SUQA 1VQKN 2GX9A 5AQZA 3OYJA 4I2QA 5HRNA 3DLRA 1QHTA 4JI5K 3AY9A 5BRHA 2VQEK 4KI6A 5KI6A 1EWRA 1ZYQA 4B9MA 3JAMO 1N33K 3THXA 1KXPA 1Z26A 4E3SA 2VCPA 1SL1A 1OH5A 3KLIA 3IS9A 5CHIA 4KH5A 1VSMA 4BC2A 3V9ZA 4BGBA 1L3SA 1GLBG 4JI6K 3VOVA 3OYGA 2R7YA 1F21A 2OPPA 2HSTA 4KKOA 3TSPA 4DTNA 1BISA 1JLAA 3TPQA 1WSIA 1TKDA 2QWRA 3QO9A 1X9JA 2D0PA 3CMAN 3OYBA 4Y0WA 3I0RA 3M3ZA 1IBKK 3KLEA 1RT2A 3P5JA 5BREA 2XY5A 3QLHA 4MQ3A 3MEEA 4H03B 4JKHA 3LP2A 4OPJA 2O8FA 1D9FA 4Z0UA 5AZJB 2RN2A 1TYQB 4C8MA 4OVLA 2EHGA 4GKJK 4LSLA 2D0BA 2P9KB 4F2RA 4NLBA 4JI4K 2YI1A 2ZE2A 3H6EA 4CJ7A 4CESA 3UKUA 4LH4A 3OYEA 3IDHA 3NVMA 4LY7A 1U2VA 2PZSA 1S72N 4FZYA 1VSDA 3P31A 3CI5A 4M7YA 2X6NA 1X1PA 3O5BA 4X64K 4JS5A 3PLAA 2NUBA 3CJ7A 4CEAA 3WXLA 3C94A 3DLHA 1EXQA 3MECA 1TKTA 1Q86O 1X3NA 4NYFA 4HUFA 4DR1K 2NRRA 3J80O 3QEPA 2RE2A 1HQEA 4FCYA 3AVLA 4A61A 1V4SA 2W42A 2CH6A 3VF4A 2KLAA 3A5NC 3WNGA 3ENBA 4B9VA 2XO7A 4DR7K 4O8KA 3LM9A 4JI3K 4KB0A 1NK7A 4DSFA 4CE9A 5J2QA 1DKGD 1E4FT 2QK9A 3OYMA 4J2BA 4DTXA 3J81O 4AM6A 1HNXK 1ZBFA 1KFSA 4FXDA 4JHDB 1KVBA 4A2BA 3J7ZO 4M3YA 2IS3A 4FWRA 4O5FA 3WNEA 1T8EA 4ID5A 4FVUA 2P5GA 4ELTA 3FZLA 2B5JA 5M1PA 4ILGB 4DV0K 4CEQA 1UOCA 5C15A 3FZKA 4A59A 4DR6K 2VQFK 3TAGA 2EWSA 4AHUA 5SZTA 4CZFA 1BHLA 3VQAA 1P8ZA 3U8XA 1REVA 1KQSM 1YVNA 3E9LA 1BQNA 1R0AA 4BRHA 1TV6A 4FWMA 3OYAA 1TAUA 1VRUA 3T1YK 4KH6A 3PX6A 3NF9A 1NOZA 3CCMN 2CH5A 1I94K 2V7ZA 4H4OA 2GUIA 5AQOA 4FZZA 4H5RA 4FLVA 2Z1IA 3L0QA 4FLXA 4CFCA 3T19A 2OTLN 3GBTA 3K59A 3LAKA 1UAXA 3VEXA 4HHTA 3VEZA 3EZ5A 3CPEA 1U49A 1Z05A 3GL1A 4DFMA 4DTSA 5LJWA 4JS4A 4CCHA 3PIOL 5I3UA 3ZSOA 4DR5K 3W3DA 1GOCA 2ZF5O 2B4JA 4Z4GA 5M1FA 5C25A 3CC4N 1C0UA 2FBVA 4CZIA 1D8YA 4AHVA 4CJ5A 2ZJPL 3TAPA 3QEIA 1NKEA 1J5EK 4CW7B 5FLXO 4U7BA 4WQ5A 3VEVA 1VQ4N 1J9AA 2HMPA 4LC9B 4B9TA 3QFUA 3DLBA 4FJ7A 1RDWX 4J2DA 4GNIA 4OLBA 4LF5K 4DF4A 4KTQA 2WFBA 1NM1A 2E6MA 3OHRA 4MFBA 2JGUA 2GTDA 3K0SA 5M1KA 3UIQA 4H0YB 5BN9A 1CZBA 4RCHA 3MK6A 3VQ5A 2ASOA 4Q5VA 4CFDA 3VA3A 3PSFA 4KBOA 1M1KO 4DV6K 3THWB 3ZYYX 4ZHRA 3THWA 2UUBK 1BI4A 2P9LB 4Z4CA 3O9UA 1GOBA 4M3XA 3OYNA 3J7AP 4CHOA 2QM1A 1RBTA 2G8WA 3O4WA 1S1TA 1WNSA 5TKYA 3TTCA 3LP1A 4CHZA 3AVCA 1S1VA 3NF8A 3O9SA 1NGBA 3HM8A 2YNFA 3IFRA 4DV5K 1RT6A 3AO1A 1X9MA 4DSKA 1YVUA 1SKSA 4AQYK 2W6LA 1H1VA 2OZMA 4WQ4A 4L3QA 4DQQA 3TAMA 5AQQA 1BO5O 4XH1A 5BRDA 1T3VA 4QS7A 2XY8A 2I7NA 1Q82O 2OCEA 1Q81O 3RSEA 1EP4A 3DJCA 1Q9XA 4I7FA 3MAQA 5BN8A 3HPHA 2VWJA 4FLUA 1BIUA 1VSFA 1VAZA 2O4GA 4GV3A 3L2VA 4WQ4C 3THVA 4W5TA 2P1JA 5HBMA 4JK8A 5DM6L 3AO2A 3L3VA 3V1QA 3V6DA 4M3UA 4JKDA 4AM7A 1EO1A 3DXMB 3LALA 3THYA 1JXBA 5CE3A 2X78A 3ATUA 2J4RA 4EIAA 1XUPO 2P9KA 4GMJB 1UA1A 4FWPA 4N47A 4EFHA 4KPYA 3DM2A 3EO3A 3CJCA 4E19A 2LSNA 2PYLA 4B8CA 4M42A 1RBRA 3K2PA 4YORA 3LZIA 3KTQA 3U3YA 2DPNA 2YV0X 2HHVA 5GIPA 4MO4A 3HVRA 3TWHA 3DLLL 3L2UA 4W5RA 3NCIA 5BPNA 2IC3A 2GWKA 3AVKA 1VSIA 4CJLA 4CJTA 4B1UB 2HHSA 3MXJA 4FK0A 5B8HA 4IG3A 4R79A 3U4LA 1U6ZA 3NBPA 4BC5A 3VESA 3ZSRA 4FK4A 3AVHA 2ZJRL 1QZ5A 2Q97A 3VQEA 4FM2A 3MN5A 3JXUA 3MDQA 4CZLA 4DU4A 4DR4K 3OYLA 1KLNA 4G1QA 4QS8A 3VEYA 5HRRA 1MDUB 3RSEB 3C0BA 4DLGA 1D5AA 5GAHP 1B9DA 4DQIA 1NU0A 5JS2A 1KAZA 2P5OA 4ISEA 2XY7A 3HM9A 2ZGZA 1QHAA 2UU9K 3HP9A 3C7NB 1QSYA 3QBXA 4MDBA 3L2QA 4DQPA 1XNQK 4LFAK 1BQMA 3HJFA 4NLCA 1KSPA 1YF5L 2VGMA 3C6AA 3ZT2A 3EKSA 4PL8A 4XEIA 3HSCA 2NRVA 1Z6RA 2VWKA 1N5YA 5HP1A 4I2PA 4B3RK 3ULDA 5E41A 3DRSA 3MXMA 1RNHA 3O1BA 4DWIA 4FJHA 1EETA 1J54A 4LFCK 5AQFA 2D5RA 4FW2A 4CIEA 4CBWA 2YHWA 4BWJA 5ADXH 3VETA 4EP5A 2YHAA 3QICA 3CPWM 2Q0RA 1TVRA 4MLHA 3UE5A 3OYKA 3SPYA 4RW6A 2DY4A 1NGDA 3AVNA 1LWFA 1LCUA 3H1VX 4ELUA 4ELVA 4FJ9A 1LAVA 2WOMA 3PX4A 4FM1A 2EX3A 4CJRA 3THYB 3TSQA 2FSKA 4RWTA 4CD3A 3P38A 4O0JA 5AQXA 1KCFA 3MWPA 1U45A 3U3GA 2YHYA 3F9KA 3DMJA 3CC7N 1EWQA 4DHYA 3OA9A 4OPAA 3D2EB 4OGEA 2FXUA 4JI2K 1IH7A 4BROA 4H0XB 3RTVA 4FWSA 3AA4A 3MEGA 2D0OA 3W0LA 1JL1A 5AQKA 4RG8A 3SV4A 3A5LC 4PUOA 3NMUA 2HHXA 1NWKA 2OPRA 1ASVA 3TANA 4CZKA 3HOSA 2AA4A 3FFKB 4NO7A 3T7ZA 4F3OA 2E4LA 4H8KA 1VQMN 1RFQA 1OKJA 4NYNA 4GVEA 4XH4A 2UXDK 2JLEA 3A5MC 3AO3A 3EZWA 5AFUA 3C6HA 2HF4A 3CERA 1IKVA 3IRXA 3FZHA 2IVOA 4IDKA 5F1XA 1GLFO 1JLFA 4BRCA 4Z4IA 3I33A 4W5OA 3RMBA 1BIZA 2ASPA 4BR7A 3F5TA 3LDNA 1Z25A 2A40A 4DR2K 1W7AA 4JEPA 3SMPA 3KJVA 4F4KA 1E3MA 2YNIA 2UUAK 3G25A 5C10A 1SUQA 4JKBA 2ETJA 1RTHA 2HNZA 4BR0A 2E1ZA 4CJSA 4BRIA 3V81A 1HJRA 5C42A 2A3ZA 3TTDA 4HUEA 1BOTO 3O3HA 2P9UA 1NJXA 2YNHA 3ULEB 4JI0K 3ZLJA 4IO8A 5CYMA 1K6YA 1TUUA 3MWTA 1YJ9N 4CGHA 3CQYA 3AARA 2WC9A 1BCMA 3SAFA 4IFEA 2F4VK 4DFPA 4EHTA 4PWDA 3D45A 1P90A 3LPTA 3U9ZA 5J1EA 1RBVA 4FO0A 1NGCA 5LMUK 2UXBK 4B9LA 4TSXA 1EQYA 1U4BA 4R5PA 1B92A 1UWBA 2FC0A 3R3LA 4CJKA 2HHWA 4CK2A 4CI6A 4KHNA 4GW6A 1N36K 2P9IA 3CM6A 4FVMA 5AFUH 3EY1A 2VG6A 3ZCMA 3QNOA 3DAWA 3AVGA 4KTZA 4E1JA 5I9EB 1O13A 2FSJA 3CFOA 4B1ZA 1NOYA 5F0XA 3TI0A 1TK8A 5AQYA 3PO5A 4PQUA 5EY4A 3BDPA 5AR0A 1KTQA 4DTJA 2P9SA 1T44A 1DT9A 5CZ2A 4C8NA 1YI2N 2CGJA 1SS6A 1OVQA 2B6AA 3VQPA 1QSSA 3NDKA 1NK4A 4YDUC 3L2RA 4A57A 3HSTB 1K73O 1O1WA 1BL3A 3LL3A 3THXB 5BPMA 3CD6N 3WUHA 3QERA 4JD2B 2O8CA 2A1RA 1NK5A 1JLEA 2CGKA 2NLXA 3MX2A 4EP4A 5JS1A 4CZMA 2ZJQL 1GLEG 1QQNA 4RW9A 4B1WB 4BACA 1IKXA 5HRSA 5LJVA 2F9TA 4NXMK 5FPDA 5M1NA 4B3OA 1VQ6N 2FF3B 2QWQA 2W41A 4NXNK 2KFZA 3C6UA 4JYAK 1RGIA 5KTQA 1VQ8N 1BU6O 3DRPA 1VSKA 1JL2A 3IMXA 2DFFA 1ATSA 4DKWA 3HL8A 4DSJA 2VG5A 3CF5L 4FL9A 5HLFA 3VQ8A 3ZEUA 3CCVN 2KFNA 1W9HA 1HNVA 3A2FA 4ZTJA 4WFNL 3E66A 5M1QA 3NF6A 4JKGB 4FWNA 4YOVA 4JKGA 4K43A 5EXWA 3KLHA 3CMEN 1XWLA 3ZSQA 4PA1A 1V4TA 3V9UA 2A5XA 4IO9L 2Y1JA 2V51B 3CC2N 3PX0A 2KHOA 2O8EA 4CD1A 3KK2A 1OH6A 3EE8A 2OA8A 5CY4A 4DB3A 3SJJA 3DLGA 3IUCA 5IWAK 1K9MO 1S9EA 4K0KK 1CZAN 4RW7A 1VSLA 5C2FA 1OVYA 3CCSN 2HMIA 2VG7A 2KQ2A 3CYMA 4CJ3A 3CG7A 1TUYA 3D7EO 3V9WA 2HBLA 4K41A 1ZBIA 2P51A 3BZCA 5FPNA 3CQ8A 4K42A 5ADXA 3VQBA 3A8YA 3O4QA 1N34K 1SV5A 5ELZA 2Z1JA 3WXKA 5F2RA 3TU5A 2GWJA 3ID8A 2BH1A 1J6ZA 4F8RA 1HNZK 4DR3K 4X65K 1NMNA 1WSGA 1WSFA 4PKIA 2HVIA 4CF9A 3O8MA 2Q3SA 3LAMA 4Z94A 4CJEA 5JVGL 3NGIA 2NRTA 5JLHA 4LF9K 3Q7CA 4WFBL 4M3WA 1ZBLA 5AJ3K 4IKFA 3SQ0A 3KD1E 2HBJA 3VERA 3AAPA 4G9ZA 4JV5K 4J2EA 1TGOA 2PYJA 2QWLA 2KTQA 2W6KA 4IWVA 1FKOA 4I9LA 3LWMA 4BVPA 4FLZA 3NH2A 1Q18A 1N6QA 3RMCA 5LY3A 3EN9A 2BUPA 1KC8O 3SCXA 4AH9A 1QVFM 4DTOA 1ZBHA 4CEFA 4CGDA 3KK1A 3RRHA 4FJMA 1HYSA 2YJEA 1N32K 4E7LA 4FJKA 4JLHA 3V4IA 3K9KA 3KLGA 3EEQA 4QS9A 3BF1A 4H5NA 3D0PA 3RMDA 3GE1A 1XQSC 3LDLA 4CHPA 3AVBA 4BREA 1W2BM 3MEDA 4YOUA 2X74A 1NGHA 1GLJO 3CCLN 3CCUN 2YJFA 4NCAA 3C6TA 3K5NA 5GAEP 5KQ8A 1VQON 3SQ4A 2JWKA 4CBXA 3MXIA 3T69A 5KPRA 4H5VA 3TAFA 1U2VB 1G99A 4PKHA 2ASMA 1VQLN 3PY8A 5LL6Z 4JKFA 3OYFA 3OYDA 2Q36A 3QIPA 4IJNA 4BRAA 4F9OA 3HYFA 3DWLA 2P9NB 4CJFA 3R8EA 1SKRA 5AQWA 4CF0A 3S3MA 2GUPA 4CJQA 2V7YA 1NGFA 3AA3A 2W40A 2OANA 1WAJA 3AO4A 3VN5A 1S5JA 4YFUA 4M3TA 2E6LA 1XHZA 2QWMA 3QESA 4CJ4A 3QMLA 3RVCA 4CFBA 4CIFA 5HOOA 3I56N 4KRFA 1BUPA 3I8DA 1BWFO 1QQMA 1QSLA 5CYQA 3LP3A 1LWCA 4DUZK 3WNHA 4LH5A 4BR5A 1BGXT 4OX9K 3CXCM 2Y1IA 4CEBA 5BR9A 2P9IB 4GKKK 3WXJA 3GDQA 3ZSYA 1A5WA 1YAGA 4C8KA 4KAZA 4YOTA 1KVAA 4JK7A 3G4SN 3ZEUB 1WB9A 3OYHA 1G15A 2BGGA 1WSEA 2KKZA 2HVHA 4B8AB 4DFJA 4CEDA 2QXLA 3T1HK 1HPMA 4DU3A 3OTOK 1ATRA 3ZX2A 4DS5A 1NK9A 3L8BA 2E2NA 1LOTB 4DV7K 1TKXA 4BDYA 3MN6A 4C8OA 1IJJA 5BR8K 1HNWK 3OBYA 1VQPN 1HYZA 5KQDA 5CR4A 5FRNA 1C1BA 3RR8A 5CZ1A 5DK5A 3CFRA 3V1OA 4DUYK 5DMRA 4WQ5C 3ZETA 4DV4K 3ZSZA 3L4QA 2QKKA 2O8CB 4QOZB 4JI1K 2PY5A 5I42A 5GINA 3SLCA 3CJ9A 1C0TA 3C65A 4AILC 1EKEA 2IVPA 4JN4A 3Q7BA 4E7HA 1JLQA 4N41A 4H0TB 4DTUA 3E01A 4KFBA 5FDLA 2OPSA 1BDGA 1WSHA 4OJRA 1K8KA 3QBWA 5HRPA 3M6GA 4V19S 2FBYA 1RDDA 3R9PA 1Y64A 3O3GA 2Z1HA 4Z4FA 3RWUA 4BQZA 3ZT1A 3AV9A 4JHDA 3LDPA 4YNQA 4A5BA 4J8FA 1IV0A 3MMVA 3OS0A 1MU2A 4CGIA 1WOQA 5KGXA 1I3AA 5AQJA 1VQ7N 4OPHA 4OGCA 1SAZA 3QEWA 3EKUA 3LDSA 4OLAA 3FLCO 1HYVA 1KD1O 1M90O 3H1QA 4FJXA 2HOEA 3CETA 3VTIA 1K8AO 4DQSA 2HHTA 2Z1GA 4YDUA 3I8BA 4H5TA 4BRNA 3P4IA 4U67L 3OJSA 1NGGA 3E9OA 2PFUA 4L8RB 4KH4A 3C95A 2QKBA 4I9QA 5AQRA 1IG8A 3OJUA 3QETA 1X9WA 3O1WA 4DQRA 5AQLA 2NNWA 3K57A 2P9SB 3AVJA 3CCJN 1KVCA 1I39A 4XIUA 4DV2K 1SL0A 5FRMA 1YITN 2ITGA 3U9DA 4WCEL 1A5XA 3SQ1A 4PL7A 1EX4A 2F96A 4O5BA 4EZ6A 3FFIA 4HWIA 4N5SA 1ATNA 3AA2A 2Q0UA 3SI6A 2RHKA 4Z4HA 1K8KB 2E2PA 4IEIA 2IOCA 2E1YA 4B3TK 3GOIA 4HTLA 1ILYA 4Q0BA 4MDAA 5AZIB 1QQCA 3ISNC 2ZD1A 2UYTA 4ILHA 4KHWA 1NGIA 2DFEA 2ZGYA 1B9FA 4B9SA 5J2MA 1S6QA 1RBSA 1N8RO 2HW3A 1S6PA 2O8BA 4A62A 1HPZA 4ICLA 2QI2A 2XY6A 4DU1A 1S1WA 1ZBUA 2A42A 2E8AA 4AHRA 1IBMK 4FLWA 2FF6A 4FJNA 1SKWA 1UA0A 3DYAA 2G8FA 3LM2A 1IKYA 3CHWA 4FWOA 4LF6K 4CEZA 5EOYA 1XC9A 3D2FB 3HPOA 3F73A 1JLBA 4IBNA 4BRDA 4FPBA 4CK1A 5AZJA 4CECA 2JWLA 3DOKA 5KPTA 3VGLA 2F8SA 5E26A 4CJPA 4IZ9A 1S9GA 1ZC6A 5AQHA 1TL1A 1ITGA 1JCEA 3ATVA 1HUXA 1L3UA 3DXKB 4CZEA 5D3GA 3QNNA 4YY3K 1ASWA 2X6SA 1HKGA 1BI4B 2P9LA 4BRFA 4H0OA 5JLFA 3SYZA 1BA0A 4J2AA 1S3XA 3O9RA 3T3FA 3OW2M 3NH1A 3L4IA 2E2OA 3ZSVA 4M3RA 3BZKA 1RT3A 5TKWA 1NLVA 5C2DA 1RTJA 3K58A 3DRRA 4QCLA 2E2QA 4DLEA 3VEOA 1NMDA 2QWNA 5M1OA 3NGZA 1RTDA 4O44A 4C8LA 4X66K 4DTMA 2WUSA 4IG0A 4K8ZA 2D0CA 4JKAA 1VQNN 5H1SQ 4BRQA 3N4PA 4FSVA 5AQIA 4CGGA 3K5LA 2I7PA 1VRTA 4B1YB 3QFPA 1FKPA 3PSIA 1CXQA 3NHGA 1NJWA 3P83D 1YTUA 5HL7L 2Q2RA 4H0VB 4WE1A 4WF9L 1JJ2M 4LD0A 3NVKA 2QTDA 3AAQA 4YHHK 4DV1K 2VGNA 3SPZA 3SAHA 3JS6A 2G8IA 2DFHA 3SMSA 3A5OC 1HNIA 2GBZA 1NKCA 2FSNA 5HROA 4FYDA 1XI1A 1RILA 4ILJA 3BF3A 3HVTA 3SQ2A 3AVIA 2RF2A 3ZETB 4CERA 2YHXA 1WN7A 3VTHA 4DMNA 4FJLA 4CGJA 1WLJA 2Q31A 3KZBA 5C0YA 1RDUA 2BTFA 2G8VA 1LV5A 3KK3A 3WEEB 4E7KA 4Y1DA 4NB4A 1CLQA 2QEXN 4JRPA 1J53A 1YJWN 4B9NA 1A5VA 3LDOA 3S3OA 3ITHA 1HMVA 2CGLA 3DXMA 1HQUA 2YKNA 1WSJA 1ZBSA 4BE0A 1TYQA 5AQNA 1MWMA 4KTWA 2IAJA 2ZQBA 2VYPA 1GOAA 2NZTA 2FBTA 4K25A 2O8FB 1RT7A 2NRXA 3WQUA 1HR0K 2I5JA 2P9NA 2WTUA 4BGAA 4CZHA 1DLOA 3O80A 4FK2A 3PUFA 2IIRA 2Q1NA 4CF2A 1L3VA 4MLEA 4DCHA 3DOLA 3HXMA 4CEOA 4BE1A 3KKRA 5FPMA 2NRHA 3OVNA 1R59O 4KV8A 1T6DA 3EL2A 3L2WA 1IBLK 1T03A 2YNGA 1IO2A 4B1XB 3CCQN 1RBUA 3SV3A 1LW0A 4FOIA 4CJWA 4YOXA 3JSMA 3UKRA 4IOXA 3G10A 3B6PA 3CCEN 4FJJA 3TTFA 1GLDG 4UY8O 1NK0A 3GG4A 1TK0A 3EE9A 5JVHL 2F7TA 1T05A 1J5OA 2YX6A 3NFAA 4KREA 3WXIA 2O8DB 3DLEA 4DSLA 4PHTX 4HTUA 4E0DA 3HI0A 2QWOA 3DXKA 3ENOA 1IKWA 1QQOA 2G8HA 3VENA 4KHUA 1T6CA 3ZX3A 1DTQA 3HZ6A 2F8TA 2HHUA 4BDZA 4E7JA 4N76A 1SQKA 4DSEA 1BCOA 2BDPA 3G0ZA 3TARA 3RR7A 4I6MA 5J2NA 4CVNE 3B6OA 2KZZA 1DEJA 2PBDA 3SUOA 3VF6A 4XH5A 3LWLA 1X9SA 4ID1A 1S22A 5GIOA 4EAHD 4EHUA 3ZSXA 3D2FA 3AA5X 3KIOA 3SUNA 3O3FA 1DGKN 4H5WA 4C23A 2G8KA 2F9WA 2GEMA 1VSHA 3D6RA 3IAYA 1LW2A 1KAXA 2P9PA 4LF7K 2E88A 5MLCQ 2P9PB 1MA9B 3UB5A 4DFKA 1ASUA 3E1YA 1VK0A 3M8QA 2XHBA 3VQ6A 4BQLA 1NKBA 2O8BB 1DTTA 2G8UA 1VSJA 3ZT4A 1XMOK 3PO4A 3HBTA 5EVZA 3CQXA 4B9UA 1NGAA 5AQUA 1YIJN 3O08A 4BG8A 3U6FA 3PIPL 5GADP 1HLUA 1VQ5N 1W0HA 4KI4A 4Z4EA 1JXEA 4DS4A 3OYCA 4AF1A 1RT4A 4CJVA 3SNNA 3WT0A 1JCGA 1C0FA 4FWKA 3VQDA 1GLCG 5FPEA 2OZSA 1KAYA 4DTPA 4CHNA 1RCHA 4AHTA 3ZSWA 1HJOA 2YCHA 3HRGA 1TL3A 3LPUA 2AP1A 3MX5A 3H08A 3N4QA 3CM5A 4IXCA 4DTRA 1KRPA 4DG1A 3BGRA 3HOTA 1QTMA 3ALYA 4WYBA 5E84A 1TKZA 4I6MB 2UUCK 1QE1A 3UKRB 3AGRA 4M41A 3LZJA 3P1GA 3WQTA 3NE6A 3CJAA 3KLFA 1MWKA 3MCPA 1NNEA 2A6AA 4C1NI 4M7XA 1IG9A 3ENHA 2HHHK 3HK2A 1VHXA 3R6MA 5K14A 4KHYA 3FR0A 4CHQA 2V52B 3O9QA 1HKBA 5A2QO 3D2EA 2WBNA 1XNRK 3HTVA 3M1FA 4FJGA 3BEXA 3T1AA 1CXUA 3VQ9A 1JCFA 4ISFA 1X3MA 2FLOA 4NCGA 2YHBA 3OY9A 3KK7A 1QVGM 2HNDA 4E89A 4JKCA 4O8UA 1OH8A 3VQ4A 3SUPA 2D4WA 4K8XA 1C1AA 2OPQA 1XHXA 1CZ9A 3FE1A 4RW4A 4CF8A 4JI7K 4BR4A 3E9PA
chains in the Genus database with same CATH topology
2XRIA 4YNQA 1SUQA 2W42A 2ETJA 4O0IA 1RTHA 2HNZA 3OS0A 1MU2A 4CJSA 3WNGA 4CGIA 5KGXA 4B9VA 3V81A 3I0SA 1HJRA 2XO7A 1I3AA 5C42A 1Y97A 1NJZA 2KZMA 4OGCA 4F3TA 4HUEA 3QEWA 3LDSA 4OLAA 5KGWA 4KB0A 3O3HA 4FLTA 1FXXA 4FJIA 1NK7A 4DSFA 4KHSA 1NJXA 1C0MA 4CE9A 1HYVA 5J2QA 2YNHA 4FJXA 1U04A 1JLGA 3QEXA 4DQSA 3OYMA 2Z1GA 4N56A 4J2BA 5CYMA 4DTXA 2QK9A 1K6YA 3DLKA 1RDCA 3ASMA 1ZBFA 1U48A 4FJHA 1KFSA 4CGHA 1U47A 4FXDA 3RRGA 3OJSA 1KVBA 3AVMA 1BCMA 4M3YA 2IS3A 4PY5A 3WNEA 1T8EA 4DFPA 4L8RB 3C95A 4ID5A 2QKBA 3D45A 4I9QA 4PWDA 2P5GA 4FW1A 3V9XA 4ELTA 3LPTA 2B5JA 5J1EA 1RBVA 4CEQA 4B9LA 4TSXA 3OJUA 1Q8IA 4R5PA 1RDAA 1B92A 1UOCA 1UWBA 2FC0A 5EU7A 4CJKA 1S1XA 2HHWA 4DQRA 3V1RA 3HO1A 4CK2A 3K57A 3AVJA 4KHNA 3DI6A 4GW6A 5FROA 3VQQA 1KVCA 1I39A 3CM6A 4FVMA 4XIUA 3TAGA 1SL0A 3QIOA 4AHUA 5SZTA 3OS2A 4DF8A 3EY1A 5FRMA 2ITGA 3NH0A 1BHLA 2VG6A 3ZCMA 1Q9YA 3VQAA 4KTZA 3AVGA 5C24A 3QNOA 1REVA 3CFOA 3L3UA 4E7IA 1A5XA 1BQNA 1LWEA 1EX4A 2F96A 3IG1A 4O5BA 1TV6A 3OYAA 3SQ1A 3V9SA 3FFIA 4N5SA 1TK8A 3PO5A 4EZ6A 4PQUA 1TAUA 1VRUA 4BDPA 3AA2A 3PX6A 3BDPA 3NF9A 3SI6A 2FBXA 1NOZA 2YKMA 4Z4HA 1KTQA 4FM0A 4DTJA 2IOCA 4H4OA 5CZ2A 4C8NA 2GUIA 4Q0BA 1QQCA 3ISNC 4EZ9A 2ZD1A 4FZZA 2B6AA 3VQPA 5KRTA 4FLVA 3NAEA 2Z1IA 5J2PA 1NK8A 4FLXA 4CFCA 1QSSA 3KKSA 4Y1CA 3T19A 3NDKA 1NK4A 3L2RA 4KHWA 2DFEA 3HSTB 1B9FA 4IFYA 3K59A 5J2MA 4B9SA 1S6QA 1RBSA 2QXFA 3LAKA 2HW3A 1O1WA 1BL3A 1S6PA 1UAXA 4HHTA 1HPZA 3EZ5A 2HB5A 4W5NA 1U49A 4ICLA 3QERA 4DU1A 2XY6A 1S1WA 4DFMA 4DTSA 1ZBUA 1JLCA 2A1RA 1JLEA 1RTIA 4AHRA 4JS4A 1NK5A 4CCHA 4FLWA 4FJNA 1SKWA 5I3UA 3ZSOA 3DYAA 1VSEA 4EP4A 1GOCA 1IKYA 1UA0A 2BANA 2G8FA 5JS1A 2B4JA 4CEZA 2DTUA 3HP6A 4Z4GA 4RW9A 4CK3A 5C25A 4HCBA 1XC9A 1C0UA 4HCCA 2FBVA 4BACA 3HPOA 2O4IA 1IKXA 5HRSA 3F73A 4AHVA 1JLBA 4IBNA 4CJ5A 3TAPA 1D8YA 4F2SA 3QEIA 4FLYA 4CK1A 1NKEA 4CECA 4KO0A 4B3OA 3DOKA 1JKHA 3OYIA 3VQCA 2F8SA 4CJPA 1HRHA 1S9GA 1YTAA 1TL1A 1ITGA 2KFZA 3C6UA 1L3UA 1J9AA 1WAFA 5KTQA 5D3GA 3QNNA 4B9TA 2HHQA 3DRPA 1VSKA 1JL2A 2ATQA 3DLBA 4FJ7A 4J2DA 1ASWA 2DFFA 2X6SA 2AJQA 1BI4B 4OLBA 3HL8A 3SYZA 3AVFA 4DSJA 2VG5A 4DF4A 4KTQA 5T7BA 4J2AA 2E6MA 3TAEA 5HLFA 4MFBA 3VQ8A 4CEEA 3T3FA 2KFNA 2JGUA 1W9HA 1HNVA 3NH1A 3A2FA 4ZTJA 4KB1A 4OKKA 3UIQA 2D0AA 3ZSVA 3NF6A 4M3RA 3TABA 1RT3A 1CZBA 3VQ5A 3JYTA 3KLHA 2HNYA 1RTJA 1XWLA 4CHYA 4AHCA 4CJUA 3K58A 3DRRA 4QCLA 4DLEA 2HHTA 4Q5VA 4CFDA 3ZSQA 3VA3A 4PA1A 4M45A 3NGZA 3V9UA 1RTDA 4BE2A 4W5QA 4O44A 1C6VA 4C8LA 4ZHRA 4DTMA 1BI4A 3AVAA 2Y1JA 1T7PA 4Z4CA 3ZT3A 4FJ8A 4IG0A 1GOBA 4K8ZA 2D0CA 3OYNA 3PX0A 4M3XA 1S1UA 4E1NA 4CHOA 1RBTA 2G8WA 3KK2A 1TK5A 1S1TA 1WNSA 2OA8A 5CY4A 4CGGA 3K5LA 3DLGA 3LP1A 1VRTA 3AVCA 4CHZA 4CGFA 4HVJA 3OS1A 3SJJA 1FKPA 1S1VA 1S9EA 4KHQA 1CXQA 3NF8A 2BE2A 3P83D 3NHGA 1NJWA 4RW7A 1VSLA 1YTUA 2YNFA 3NF7A 4WE1A 1RT6A 3AO1A 4LD0A 1X9MA 4DSKA 2HMIA 2VG7A 1YVUA 3TAQA 4B08A 2KQ2A 3CYMA 4CJ3A 3SPZA 1SKSA 3CG7A 1RT1A 2OZMA 3V9WA 4DQQA 3NGYA 5KRSA 2P51A 1ZBIA 1NJYA 3WNFA 3M8PA 3TAMA 3CQ8A 2G8IA 2DFHA 1HNIA 2GBZA 3VQBA 3K5OA 3O4QA 1NKCA 2XY8A 1SV5A 5HROA 1XI1A 1RILA 4FYDA 3SQ2A 3HVTA 1QS4A 3AVIA 2RF2A 2Z1JA 4CERA 3K5MA 1WN7A 3PV8A 2IDOA 4DMNA 4FJLA 4CGJA 1WLJA 4CIGA 1EP4A 4F8RA 4OKEA 1Q9XA 4I7FA 3MAQA 1TAQA 3HPHA 2G8VA 2VWJA 4FLUA 1LV5A 1BIUA 3KK3A 3S9HA 1VSFA 1WSFA 1WSGA 4E7KA 2HVIA 4Y1DA 4CF9A 3SZ2A 2O4GA 3L2VA 3VA0A 2Q3SA 3LAMA 1CLQA 1NK6A 3THVA 1LAWA 4CJEA 4W5TA 3NGIA 4JRPA 1J53A 2P1JA 1KFDA 3AO5A 5HBMA 4B9NA 3AO2A 4LSNA 3LANA 3L3VA 3V1QA 4BWMA 3V6DA 4M3UA 1A5VA 4QAGA 1ZBLA 4IKFA 4M3WA 3SQ0A 3KD1E 4HUGA 1RDBA 3LALA 1C1CA 3S3OA 3ITHA 1JXBA 1HMVA 4OKJA 1NOYA 4J2EA 1TGOA 2PYJA 4FZXC 1HQUA 2YKNA 1WSJA 2RKIA 2X78A 4BE0A 3QINA 1L3TA 2KTQA 1FKOA 4KTWA 4I9LA 3LWMA 4FLZA 4GMJB 2IAJA 2ZQBA 1UA1A 4N47A 4KPYA 3NH2A 3DM2A 1N6QA 3RMCA 1GOAA 4E19A 2LSNA 4GVMA 2FBTA 3KD5E 2PYLA 2WONA 4B8CA 4M42A 1RBRA 3K2PA 1RT7A 4NCBA 1FK9A 3ZT0A 3LZIA 3SCXA 4RW8A 4AH9A 3KTQA 3U3YA 2YV0X 2HHVA 2I5JA 3QETA 1YT3A 4M3ZA 1DLOA 3TR8A 3HVRA 3PUFA 4CEFA 3TWHA 4DTOA 3CFPA 4FK2A 1ZBHA 4CGDA 4CF2A 2GV9A 3KK1A 3L2UA 3RRHA 1L3VA 1D9DA 4H4MA 4W5RA 4FJMA 1HYSA 3NCIA 3S3NA 2IC3A 4E7LA 3AVKA 3DOLA 1VSIA 4CEOA 4JLHA 3KKRA 4CJLA 3HXMA 4BE1A 3V4IA 4FJKA 4CJTA 3OVNA 3KLGA 3MXJA 2HHSA 4FK0A 4KV8A 4IG3A 4DSIA 3D0PA 3RMDA 3L2WA 4O55A 1T03A 2YNGA 1IO2A 3RMAA 4CHPA 3NBPA 1R0AA 3AVBA 3ZSRA 4FK4A 1RBUA 3AVHA 3SV3A 1LW0A 2IGIA 3MEDA 2X74A 5SWMA 3VQEA 3O4NA 2A1SA 4CJWA 3M8RA 3JSMA 4FM2A 3VQ7A 4NCAA 3G10A 3B6PA 3C6TA 4FJJA 4DU4A 3K5NA 1RT5A 1NK0A 3HPGA 3OYLA 4OPKA 1TK0A 1T05A 1J5OA 3NFAA 4KREA 1KLNA 3SQ4A 4G1QA 3DLEA 3M8SA 5HRRA 4CF1A 4DSLA 4IFVA 4UQGA 3MXIA 4E1MA 4HTUA 4E0DA 4O4GA 3TAFA 4DLGA 1D5AA 1SL2A 3EYZA 1IKWA 3PY8A 2G8HA 1B9DA 4DQIA 3OYFA 4KHUA 3OYDA 4AHSA 1DTQA 5JS2A 2F8TA 3QIPA 4JRQA 4BDZA 4E7JA 2P5OA 1KLMA 2XY7A 4N76A 2KW4A 2HHUA 3HM9A 3HYFA 4DSEA 3HP9A 3QEVA 1BCOA 4CJFA 3L2QA 1QSYA 2BDPA 3HT3A 4ZTFA 4DQPA 3G0ZA 3TARA 3RR7A 1SKRA 4FJ5A 1BQMA 3HJFA 4CF0A 5J2NA 3B6OA 2OYQA 2KZZA 3LP0A 3SUOA 3S3MA 1KSPA 4CJQA 3LWLA 1X9SA 4ID1A 3ZT2A 3AA3A 1L5UA 1WAJA 3AO4A 3VN5A 4CFAA 1S5JA 3ZSXA 2RPIA 2VWKA 1N5YA 5HP1A 4I2PA 3AA5X 4YFUA 3KIOA 3SUQA 3SUNA 3O3FA 2E6LA 3ULDA 4M3TA 5E41A 3DRSA 1XHZA 3OYJA 2G8KA 3MXMA 1RNHA 4I2QA 1VSHA 4CJ4A 3DLRA 5HRNA 3QESA 4DWIA 1EETA 3IAYA 4CFBA 1J54A 4CIFA 1QHTA 1LW2A 4KRFA 3I8DA 2D5RA 1QSLA 4FW2A 4CIEA 5CYQA 3LP3A 4KI6A 5KI6A 1ZYQA 1LWCA 4BWJA 4B9MA 4DFKA 3WNHA 1ASUA 1VK0A 4LH5A 3M8QA 4EP5A 2YHAA 3VQ6A 2XHBA 3TI0A 1NKBA 1DTTA 1BGXT 1TVRA 2G8UA 1VSJA 3ZT4A 3OYKA 1Z26A 4E3SA 3PO4A 2Y1IA 4B9UA 3SPYA 4CEBA 1U4BA 4RW6A 2DY4A 1SL1A 3AVNA 3ZSYA 1A5WA 4C8KA 3KLIA 1LWFA 3IS9A 4KAZA 1KVAA 1VSMA 3U6FA 3V9ZA 1L3SA 3OYGA 3OYHA 1W0HA 2R7YA 1F21A 1G15A 2OPPA 4ELUA 4KI4A 1JXEA 1WSEA 4DS4A 3OYCA 4ELVA 4FJ9A 4KKOA 2BGGA 1LAVA 4DTNA 1BISA 1JLAA 2WOMA 1RT4A 4CJVA 3PX4A 4FM1A 2HVHA 1WSIA 2EX3A 4B8AB 3QO9A 4CJRA 4CEDA 4DFJA 3SNNA 1TKDA 3OYBA 4O0JA 3VQDA 4DU3A 2OZSA 1KCFA 4DS5A 4DTPA 3I0RA 1NK9A 3L8BA 4CHNA 1RCHA 4AHTA 1U45A 3U3GA 1TKXA 3ZSWA 3KLEA 1RT2A 4BDYA 3P5JA 3F9KA 2XY5A 1TL3A 3QLHA 3DMJA 4C8OA 3LPUA 4MQ3A 3MEEA 1HYZA 3H08A 5FRNA 4OGEA 3CM5A 4DTRA 3LP2A 1C1BA 4OPJA 5CZ1A 5DK5A 3RR8A 3CFRA 4Z0UA 1D9FA 3V1OA 5DMRA 1KRPA 1IH7A 4DG1A 3BGRA 2RN2A 1QTMA 3ALYA 1TKZA 3RTVA 1QE1A 3ZSZA 4M41A 3AA4A 3MEGA 2QKKA 1JL1A 4C8MA 4OVLA 2EHGA 3LZJA 3P1GA 4RG8A 3SV4A 3NE6A 4LSLA 2D0BA 4QOZB 4PUOA 2PY5A 3KLFA 4F2RA 2HHXA 5I42A 2ZE2A 2OPRA 4CESA 1ASVA 1C0TA 3TANA 4LH4A 4AILC 1IG9A 3HK2A 3OYEA 1EKEA 4LY7A 5K14A 4E7HA 2PZSA 2E4LA 4F3OA 4KHYA 4CHQA 4FZYA 1JLQA 1VSDA 4H8KA 4N41A 4DTUA 3E01A 4KFBA 4NYNA 4Z4EA 2JLEA 2X6NA 1X1PA 1X9WA 4FJGA 3AO3A 1CXUA 5FDLA 3T1AA 3VQ9A 2OPSA 4JS5A 1IKVA 3IRXA 2NUBA 4CEAA 1WSHA 3C94A 4NCGA 2YHBA 4IDKA 4OJRA 3OY9A 2HNDA 4E89A 5HRPA 1JLFA 1EXQA 3DLHA 4Z4IA 3MECA 4W5OA 3RMBA 1TKTA 1BIZA 4NYFA 2FBYA 1RDDA 4HUFA 3VQ4A 3SUPA 1Z25A 3QEPA 3O3GA 2Z1HA 4Z4FA 4K8XA 1C1AA 2OPQA 3RWUA 3KJVA 4F4KA 1HQEA 4FCYA 1XHXA 2YNIA 3AVLA 1CZ9A 4RW4A 4CF8A 3AV9A 3ZT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XRI A;  4YNQ A;  1SUQ A;  2W42 A;  2ETJ A;  4O0I A;  1RTH A;  2HNZ A;  3OS0 A;  1MU2 A;  4CJS A;  3WNG A;  4CGI A;  5KGX A;  4B9V A;  3V81 A;  3I0S A;  1HJR A;  2XO7 A;  1I3A A;  5C42 A;  1Y97 A;  1NJZ A;  2KZM A;  4OGC A;  4F3T A;  4HUE A;  3QEW A;  3LDS A;  4OLA A;  5KGW A;  4KB0 A;  3O3H A;  4FLT A;  1FXX A;  4FJI A;  1NK7 A;  4DSF A;  4KHS A;  1NJX A;  1C0M A;  4CE9 A;  1HYV A;  5J2Q A;  2YNH A;  4FJX A;  1U04 A;  1JLG A;  3QEX A;  4DQS A;  3OYM A;  2Z1G A;  4N56 A;  4J2B A;  5CYM A;  4DTX A;  2QK9 A;  1K6Y A;  3DLK A;  1RDC A;  3ASM A;  1ZBF A;  1U48 A;  4FJH A;  1KFS A;  4CGH A;  1U47 A;  4FXD A;  3RRG A;  3OJS A;  1KVB A;  3AVM A;  1BCM A;  4M3Y A;  2IS3 A;  4PY5 A;  3WNE A;  1T8E A;  4DFP A;  4L8R B;  3C95 A;  4ID5 A;  2QKB A;  3D45 A;  4I9Q A;  4PWD A;  2P5G A;  4FW1 A;  3V9X A;  4ELT A;  3LPT A;  2B5J A;  5J1E A;  1RBV A;  4CEQ A;  4B9L A;  4TSX A;  3OJU A;  1Q8I A;  4R5P A;  1RDA A;  1B92 A;  1UOC A;  1UWB A;  2FC0 A;  5EU7 A;  4CJK A;  1S1X A;  2HHW A;  4DQR A;  3V1R A;  3HO1 A;  4CK2 A;  3K57 A;  3AVJ A;  4KHN A;  3DI6 A;  4GW6 A;  5FRO A;  3VQQ A;  1KVC A;  1I39 A;  3CM6 A;  4FVM A;  4XIU A;  3TAG A;  1SL0 A;  3QIO A;  4AHU A;  5SZT A;  3OS2 A;  4DF8 A;  3EY1 A;  5FRM A;  2ITG A;  3NH0 A;  1BHL A;  2VG6 A;  3ZCM A;  1Q9Y A;  3VQA A;  4KTZ A;  3AVG A;  5C24 A;  3QNO A;  1REV A;  3CFO A;  3L3U A;  4E7I A;  1A5X A;  1BQN A;  1LWE A;  1EX4 A;  2F96 A;  3IG1 A;  4O5B A;  1TV6 A;  3OYA A;  3SQ1 A;  3V9S A;  3FFI A;  4N5S A;  1TK8 A;  3PO5 A;  4EZ6 A;  4PQU A;  1TAU A;  1VRU A;  4BDP A;  3AA2 A;  3PX6 A;  3BDP A;  3NF9 A;  3SI6 A;  2FBX A;  1NOZ A;  2YKM A;  4Z4H A;  1KTQ A;  4FM0 A;  4DTJ A;  2IOC A;  4H4O A;  5CZ2 A;  4C8N A;  2GUI A;  4Q0B A;  1QQC A;  3ISN C;  4EZ9 A;  2ZD1 A;  4FZZ A;  2B6A A;  3VQP A;  5KRT A;  4FLV A;  3NAE A;  2Z1I A;  5J2P A;  1NK8 A;  4FLX A;  4CFC A;  1QSS A;  3KKS A;  4Y1C A;  3T19 A;  3NDK A;  1NK4 A;  3L2R A;  4KHW A;  2DFE A;  3HST B;  1B9F A;  4IFY A;  3K59 A;  5J2M A;  4B9S A;  1S6Q A;  1RBS A;  2QXF A;  3LAK A;  2HW3 A;  1O1W A;  1BL3 A;  1S6P A;  1UAX A;  4HHT A;  1HPZ A;  3EZ5 A;  2HB5 A;  4W5N A;  1U49 A;  4ICL A;  3QER A;  4DU1 A;  2XY6 A;  1S1W A;  4DFM A;  4DTS A;  1ZBU A;  1JLC A;  2A1R A;  1JLE A;  1RTI A;  4AHR A;  4JS4 A;  1NK5 A;  4CCH A;  4FLW A;  4FJN A;  1SKW A;  5I3U A;  3ZSO A;  3DYA A;  1VSE A;  4EP4 A;  1GOC A;  1IKY A;  1UA0 A;  2BAN A;  2G8F A;  5JS1 A;  2B4J A;  4CEZ A;  2DTU A;  3HP6 A;  4Z4G A;  4RW9 A;  4CK3 A;  5C25 A;  4HCB A;  1XC9 A;  1C0U A;  4HCC A;  2FBV A;  4BAC A;  3HPO A;  2O4I A;  1IKX A;  5HRS A;  3F73 A;  4AHV A;  1JLB A;  4IBN A;  4CJ5 A;  3TAP A;  1D8Y A;  4F2S A;  3QEI A;  4FLY A;  4CK1 A;  1NKE A;  4CEC A;  4KO0 A;  4B3O A;  3DOK A;  1JKH A;  3OYI A;  3VQC A;  2F8S A;  4CJP A;  1HRH A;  1S9G A;  1YTA A;  1TL1 A;  1ITG A;  2KFZ A;  3C6U A;  1L3U A;  1J9A A;  1WAF A;  5KTQ A;  5D3G A;  3QNN A;  4B9T A;  2HHQ A;  3DRP A;  1VSK A;  1JL2 A;  2ATQ A;  3DLB A;  4FJ7 A;  4J2D A;  1ASW A;  2DFF A;  2X6S A;  2AJQ A;  1BI4 B;  4OLB A;  3HL8 A;  3SYZ A;  3AVF A;  4DSJ A;  2VG5 A;  4DF4 A;  4KTQ A;  5T7B A;  4J2A A;  2E6M A;  3TAE A;  5HLF A;  4MFB A;  3VQ8 A;  4CEE A;  3T3F A;  2KFN A;  2JGU A;  1W9H A;  1HNV A;  3NH1 A;  3A2F A;  4ZTJ A;  4KB1 A;  4OKK A;  3UIQ A;  2D0A A;  3ZSV A;  3NF6 A;  4M3R A;  3TAB A;  1RT3 A;  1CZB A;  3VQ5 A;  3JYT A;  3KLH A;  2HNY A;  1RTJ A;  1XWL A;  4CHY A;  4AHC A;  4CJU A;  3K58 A;  3DRR A;  4QCL A;  4DLE A;  2HHT A;  4Q5V A;  4CFD A;  3ZSQ A;  3VA3 A;  4PA1 A;  4M45 A;  3NGZ A;  3V9U A;  1RTD A;  4BE2 A;  4W5Q A;  4O44 A;  1C6V A;  4C8L A;  4ZHR A;  4DTM A;  1BI4 A;  3AVA A;  2Y1J A;  1T7P A;  4Z4C A;  3ZT3 A;  4FJ8 A;  4IG0 A;  1GOB A;  4K8Z A;  2D0C A;  3OYN A;  3PX0 A;  4M3X A;  1S1U A;  4E1N A;  4CHO A;  1RBT A;  2G8W A;  3KK2 A;  1TK5 A;  1S1T A;  1WNS A;  2OA8 A;  5CY4 A;  4CGG A;  3K5L A;  3DLG A;  3LP1 A;  1VRT A;  3AVC A;  4CHZ A;  4CGF A;  4HVJ A;  3OS1 A;  3SJJ A;  1FKP A;  1S1V A;  1S9E A;  4KHQ A;  1CXQ A;  3NF8 A;  2BE2 A;  3P83 D;  3NHG A;  1NJW A;  4RW7 A;  1VSL A;  1YTU A;  2YNF A;  3NF7 A;  4WE1 A;  1RT6 A;  3AO1 A;  4LD0 A;  1X9M A;  4DSK A;  2HMI A;  2VG7 A;  1YVU A;  3TAQ A;  4B08 A;  2KQ2 A;  3CYM A;  4CJ3 A;  3SPZ A;  1SKS A;  3CG7 A;  1RT1 A;  2OZM A;  3V9W A;  4DQQ A;  3NGY A;  5KRS A;  2P51 A;  1ZBI A;  1NJY A;  3WNF A;  3M8P A;  3TAM A;  3CQ8 A;  2G8I A;  2DFH A;  1HNI A;  2GBZ A;  3VQB A;  3K5O A;  3O4Q A;  1NKC A;  2XY8 A;  1SV5 A;  5HRO A;  1XI1 A;  1RIL A;  4FYD A;  3SQ2 A;  3HVT A;  1QS4 A;  3AVI A;  2RF2 A;  2Z1J A;  4CER A;  3K5M A;  1WN7 A;  3PV8 A;  2IDO A;  4DMN A;  4FJL A;  4CGJ A;  1WLJ A;  4CIG A;  1EP4 A;  4F8R A;  4OKE A;  1Q9X A;  4I7F A;  3MAQ A;  1TAQ A;  3HPH A;  2G8V A;  2VWJ A;  4FLU A;  1LV5 A;  1BIU A;  3KK3 A;  3S9H A;  1VSF A;  1WSF A;  1WSG A;  4E7K A;  2HVI A;  4Y1D A;  4CF9 A;  3SZ2 A;  2O4G A;  3L2V A;  3VA0 A;  2Q3S A;  3LAM A;  1CLQ A;  1NK6 A;  3THV A;  1LAW A;  4CJE A;  4W5T A;  3NGI A;  4JRP A;  1J53 A;  2P1J A;  1KFD A;  3AO5 A;  5HBM A;  4B9N A;  3AO2 A;  4LSN A;  3LAN A;  3L3V A;  3V1Q A;  4BWM A;  3V6D A;  4M3U A;  1A5V A;  4QAG A;  1ZBL A;  4IKF A;  4M3W A;  3SQ0 A;  3KD1 E;  4HUG A;  1RDB A;  3LAL A;  1C1C A;  3S3O A;  3ITH A;  1JXB A;  1HMV A;  4OKJ A;  1NOY A;  4J2E A;  1TGO A;  2PYJ A;  4FZX C;  1HQU A;  2YKN A;  1WSJ A;  2RKI A;  2X78 A;  4BE0 A;  3QIN A;  1L3T A;  2KTQ A;  1FKO A;  4KTW A;  4I9L A;  3LWM A;  4FLZ A;  4GMJ B;  2IAJ A;  2ZQB A;  1UA1 A;  4N47 A;  4KPY A;  3NH2 A;  3DM2 A;  1N6Q A;  3RMC A;  1GOA A;  4E19 A;  2LSN A;  4GVM A;  2FBT A;  3KD5 E;  2PYL A;  2WON A;  4B8C A;  4M42 A;  1RBR A;  3K2P A;  1RT7 A;  4NCB A;  1FK9 A;  3ZT0 A;  3LZI A;  3SCX A;  4RW8 A;  4AH9 A;  3KTQ A;  3U3Y A;  2YV0 X;  2HHV A;  2I5J A;  3QET A;  1YT3 A;  4M3Z A;  1DLO A;  3TR8 A;  3HVR A;  3PUF A;  4CEF A;  3TWH A;  4DTO A;  3CFP A;  4FK2 A;  1ZBH A;  4CGD A;  4CF2 A;  2GV9 A;  3KK1 A;  3L2U A;  3RRH A;  1L3V A;  1D9D A;  4H4M A;  4W5R A;  4FJM A;  1HYS A;  3NCI A;  3S3N A;  2IC3 A;  4E7L A;  3AVK A;  3DOL A;  1VSI A;  4CEO A;  4JLH A;  3KKR A;  4CJL A;  3HXM A;  4BE1 A;  3V4I A;  4FJK A;  4CJT A;  3OVN A;  3KLG A;  3MXJ A;  2HHS A;  4FK0 A;  4KV8 A;  4IG3 A;  4DSI A;  3D0P A;  3RMD A;  3L2W A;  4O55 A;  1T03 A;  2YNG A;  1IO2 A;  3RMA A;  4CHP A;  3NBP A;  1R0A A;  3AVB A;  3ZSR A;  4FK4 A;  1RBU A;  3AVH A;  3SV3 A;  1LW0 A;  2IGI A;  3MED A;  2X74 A;  5SWM A;  3VQE A;  3O4N A;  2A1S A;  4CJW A;  3M8R A;  3JSM A;  4FM2 A;  3VQ7 A;  4NCA A;  3G10 A;  3B6P A;  3C6T A;  4FJJ A;  4DU4 A;  3K5N A;  1RT5 A;  1NK0 A;  3HPG A;  3OYL A;  4OPK A;  1TK0 A;  1T05 A;  1J5O A;  3NFA A;  4KRE A;  1KLN A;  3SQ4 A;  4G1Q A;  3DLE A;  3M8S A;  5HRR A;  4CF1 A;  4DSL A;  4IFV A;  4UQG A;  3MXI A;  4E1M A;  4HTU A;  4E0D A;  4O4G A;  3TAF A;  4DLG A;  1D5A A;  1SL2 A;  3EYZ A;  1IKW A;  3PY8 A;  2G8H A;  1B9D A;  4DQI A;  3OYF A;  4KHU A;  3OYD A;  4AHS A;  1DTQ A;  5JS2 A;  2F8T A;  3QIP A;  4JRQ A;  4BDZ A;  4E7J A;  2P5O A;  1KLM A;  2XY7 A;  4N76 A;  2KW4 A;  2HHU A;  3HM9 A;  3HYF A;  4DSE A;  3HP9 A;  3QEV A;  1BCO A;  4CJF A;  3L2Q A;  1QSY A;  2BDP A;  3HT3 A;  4ZTF A;  4DQP A;  3G0Z A;  3TAR A;  3RR7 A;  1SKR A;  4FJ5 A;  1BQM A;  3HJF A;  4CF0 A;  5J2N A;  3B6O A;  2OYQ A;  2KZZ A;  3LP0 A;  3SUO A;  3S3M A;  1KSP A;  4CJQ A;  3LWL A;  1X9S A;  4ID1 A;  3ZT2 A;  3AA3 A;  1L5U A;  1WAJ A;  3AO4 A;  3VN5 A;  4CFA A;  1S5J A;  3ZSX A;  2RPI A;  2VWK A;  1N5Y A;  5HP1 A;  4I2P A;  3AA5 X;  4YFU A;  3KIO A;  3SUQ A;  3SUN A;  3O3F A;  2E6L A;  3ULD A;  4M3T A;  5E41 A;  3DRS A;  1XHZ A;  3OYJ A;  2G8K A;  3MXM A;  1RNH A;  4I2Q A;  1VSH A;  4CJ4 A;  3DLR A;  5HRN A;  3QES A;  4DWI A;  1EET A;  3IAY A;  4CFB A;  1J54 A;  4CIF A;  1QHT A;  1LW2 A;  4KRF A;  3I8D A;  2D5R A;  1QSL A;  4FW2 A;  4CIE A;  5CYQ A;  3LP3 A;  4KI6 A;  5KI6 A;  1ZYQ A;  1LWC A;  4BWJ A;  4B9M A;  4DFK A;  3WNH A;  1ASU A;  1VK0 A;  4LH5 A;  3M8Q A;  4EP5 A;  2YHA A;  3VQ6 A;  2XHB A;  3TI0 A;  1NKB A;  1DTT A;  1BGX T;  1TVR A;  2G8U A;  1VSJ A;  3ZT4 A;  3OYK A;  1Z26 A;  4E3S A;  3PO4 A;  2Y1I A;  4B9U A;  3SPY A;  4CEB A;  1U4B A;  4RW6 A;  2DY4 A;  1SL1 A;  3AVN A;  3ZSY A;  1A5W A;  4C8K A;  3KLI A;  1LWF A;  3IS9 A;  4KAZ A;  1KVA A;  1VSM A;  3U6F A;  3V9Z A;  1L3S A;  3OYG A;  3OYH A;  1W0H A;  2R7Y A;  1F21 A;  1G15 A;  2OPP A;  4ELU A;  4KI4 A;  1JXE A;  1WSE A;  4DS4 A;  3OYC A;  4ELV A;  4FJ9 A;  4KKO A;  2BGG A;  1LAV A;  4DTN A;  1BIS A;  1JLA A;  2WOM A;  1RT4 A;  4CJV A;  3PX4 A;  4FM1 A;  2HVH A;  1WSI A;  2EX3 A;  4B8A B;  3QO9 A;  4CJR A;  4CED A;  4DFJ A;  3SNN A;  1TKD A;  3OYB A;  4O0J A;  3VQD A;  4DU3 A;  2OZS A;  1KCF A;  4DS5 A;  4DTP A;  3I0R A;  1NK9 A;  3L8B A;  4CHN A;  1RCH A;  4AHT A;  1U45 A;  3U3G A;  1TKX A;  3ZSW A;  3KLE A;  1RT2 A;  4BDY A;  3P5J A;  3F9K A;  2XY5 A;  1TL3 A;  3QLH A;  3DMJ A;  4C8O A;  3LPU A;  4MQ3 A;  3MEE A;  1HYZ A;  3H08 A;  5FRN A;  4OGE A;  3CM5 A;  4DTR A;  3LP2 A;  1C1B A;  4OPJ A;  5CZ1 A;  5DK5 A;  3RR8 A;  3CFR A;  4Z0U A;  1D9F A;  3V1O A;  5DMR A;  1KRP A;  1IH7 A;  4DG1 A;  3BGR A;  2RN2 A;  1QTM A;  3ALY A;  1TKZ A;  3RTV A;  1QE1 A;  3ZSZ A;  4M41 A;  3AA4 A;  3MEG A;  2QKK A;  1JL1 A;  4C8M A;  4OVL A;  2EHG A;  3LZJ A;  3P1G A;  4RG8 A;  3SV4 A;  3NE6 A;  4LSL A;  2D0B A;  4QOZ B;  4PUO A;  2PY5 A;  3KLF A;  4F2R A;  2HHX A;  5I42 A;  2ZE2 A;  2OPR A;  4CES A;  1ASV A;  1C0T A;  3TAN A;  4LH4 A;  4AIL C;  1IG9 A;  3HK2 A;  3OYE A;  1EKE A;  4LY7 A;  5K14 A;  4E7H A;  2PZS A;  2E4L A;  4F3O A;  4KHY A;  4CHQ A;  4FZY A;  1JLQ A;  1VSD A;  4H8K A;  4N41 A;  4DTU A;  3E01 A;  4KFB A;  4NYN A;  4Z4E A;  2JLE A;  2X6N A;  1X1P A;  1X9W A;  4FJG A;  3AO3 A;  1CXU A;  5FDL A;  3T1A A;  3VQ9 A;  2OPS A;  4JS5 A;  1IKV A;  3IRX A;  2NUB A;  4CEA A;  1WSH A;  3C94 A;  4NCG A;  2YHB A;  4IDK A;  4OJR A;  3OY9 A;  2HND A;  4E89 A;  5HRP A;  1JLF A;  1EXQ A;  3DLH A;  4Z4I A;  3MEC A;  4W5O A;  3RMB A;  1TKT A;  1BIZ A;  4NYF A;  2FBY A;  1RDD A;  4HUF A;  3VQ4 A;  3SUP A;  1Z25 A;  3QEP A;  3O3G A;  2Z1H A;  4Z4F A;  4K8X A;  1C1A A;  2OPQ A;  3RWU A;  3KJV A;  4F4K A;  1HQE A;  4FCY A;  1XHX A;  2YNI A;  3AVL A;  1CZ9 A;  4RW4 A;  4CF8 A;  3AV9 A;  3ZT1 A; 
#chains in the Genus database with same CATH topology
 1C0G A;  2XRI A;  4JAX A;  4O0I A;  3G71 N;  4A2A A;  4BRK A;  4C1N K;  3I0S A;  4FOE A;  3OBW A;  1Y97 A;  1NJZ A;  5LMN K;  2OTJ N;  3L6Q A;  2KZM A;  4F3T A;  4BC3 A;  5KGW A;  4FLT A;  1FXX A;  4FJI A;  4KHS A;  4GV6 A;  4KHP K;  1C0M A;  2ZM6 K;  4YOW A;  1ESV A;  1U04 A;  1JLG A;  3QEX A;  3AGK A;  4CBU A;  3UKU B;  5C12 A;  4N56 A;  4BC4 A;  3DLK A;  2E5L K;  1HX1 A;  5IT9 O;  1RDC A;  3ASM A;  1U48 A;  1U47 A;  3RRG A;  3AVM A;  4PY5 A;  1D4X A;  3WXM B;  4FW1 A;  3V9X A;  1NGE A;  5GAG P;  1Q8I A;  1RDA A;  5EU7 A;  1S1X A;  4IOC L;  3B8A X;  3V1R A;  3HO1 A;  2NRZ A;  4BVO A;  3DI6 A;  5FRO A;  3VQQ A;  3QIO A;  4DF8 A;  3OS2 A;  3H46 O;  3NH0 A;  5AQP A;  4BRG A;  2ITM A;  1Q9Y A;  3VPZ A;  5C24 A;  3FGU A;  1NGJ A;  3L3U A;  4E7I A;  3VGK A;  4BRM A;  1LWE A;  3IG1 A;  3KWI A;  3V9S A;  1ZXO A;  4LFB K;  3BY5 A;  4JD2 A;  4BDP A;  2FBX A;  2YKM A;  3MN7 A;  4FM0 A;  3BP8 A;  4ISG A;  4CZJ A;  3I55 N;  3H3O B;  3FZF A;  3R1X A;  4EZ9 A;  4A5A A;  5KRT A;  5J2P A;  1YXQ A;  3NAE A;  1NK8 A;  3VMF B;  3KKS A;  4Y1C A;  4DV3 K;  4IFY A;  1E4G T;  4FWL A;  2QXF A;  2O8E B;  1NBW A;  4W5N A;  2HB5 A;  3ZX0 A;  2NRW A;  2A41 A;  1JLC A;  1BA1 A;  1RTI A;  3TSU A;  5AQS A;  1WUA A;  1FJG K;  1VSE A;  1QZ6 A;  2BAN A;  3ULE A;  2DTU A;  3KVG A;  3HP6 A;  4IJA A;  4CK3 A;  4HCB A;  4HCC A;  5JIC A;  2O4I A;  4F2S A;  4B1V A;  3VF2 A;  4FLY A;  4KO0 A;  1JKH A;  3OYI A;  3VQC A;  5AQM A;  1HRH A;  1YTA A;  2HBM A;  1WBD A;  1WAF A;  2HHQ A;  4PKG A;  2ATQ A;  3VEW A;  2AJQ A;  3CIP A;  3AVF A;  5T7B A;  1FW6 A;  3F9M A;  3TAE A;  4IOA L;  4CEE A;  4YOY A;  4KB1 A;  3BUZ B;  4OKK A;  2D0A A;  3TAB A;  4JKE A;  2P9U B;  4JNE A;  3KWG A;  3JYT A;  2HNY A;  4M63 C;  3IKM A;  4CHY A;  4AHC A;  4CJU A;  3H45 C;  3P39 A;  3SBT A;  4M45 A;  4BE2 A;  2HBK A;  4DQ8 A;  4W5Q A;  3O9T A;  1C6V A;  1GLL O;  3AVA A;  5EX5 A;  1T7P A;  2PAV A;  3ZT3 A;  4FJ8 A;  2QWP A;  3SBG A;  1S1U A;  4JI8 K;  5AQG A;  4E1N A;  4B3S K;  1TK5 A;  3O6W A;  3OS1 A;  4HVJ A;  4CGF A;  1NK6 A;  4KHQ A;  2BE2 A;  1Q7Y O;  3SJH A;  3NF7 A;  1NJI O;  3VGM A;  1W97 L;  4WFA L;  1YUW A;  3TAQ A;  4B08 A;  4BRL A;  1RT1 A;  4JK9 A;  3NGY A;  5KRS A;  1NJY A;  3WNF A;  3M8P A;  2HF3 A;  3K5O A;  1SZ2 A;  1QS4 A;  3K5M A;  4BR9 A;  3PV8 A;  2IDO A;  4RTF D;  2H3G X;  3LDQ A;  4CIG A;  4OO1 J;  4OKE A;  3K9J A;  5AQT A;  1TAQ A;  3MCA B;  3F2K A;  3G6E N;  4CZG A;  3J8A A;  3S9H A;  3SZ2 A;  4GY2 B;  3FZM A;  5AZI A;  3VA0 A;  1LAW A;  4IEE A;  1KFD A;  3AO5 A;  2QA4 N;  4LSN A;  3LAN A;  2ZWH A;  5DM7 L;  4BWM A;  4QAG A;  4HUG A;  1RDB A;  4B9Q A;  1C1C A;  3CJB A;  4OKJ A;  4FZX C;  2RKI A;  1L3T A;  3QIN A;  3J7Y P;  2D1K A;  4BRP A;  4LF4 K;  4GVM A;  2VWB A;  3KD5 E;  1BG3 A;  2WON A;  5JMV A;  4NCB A;  1FK9 A;  3ZT0 A;  1NG9 A;  3MN9 A;  4RW8 A;  3C7N A;  2IVN A;  1YT3 A;  3CJ1 A;  4M3Z A;  3QDK A;  3TR8 A;  4LF8 K;  3CFP A;  1D9D A;  4B3M K;  2GV9 A;  5KPZ A;  4H4M A;  3S3N A;  3QB0 A;  5BRF A;  1XC3 A;  4H0P A;  2QW9 A;  1YHQ N;  3CCR N;  4DSI A;  1HKC A;  5BPL A;  4O55 A;  3RMA A;  3H3N O;  3WEE A;  2IGI A;  5SWM A;  3O4N A;  2A1S A;  3M5R A;  5AQV A;  3M8R A;  3VQ7 A;  1WBB A;  4BG9 A;  4FPA A;  1GLA G;  1RT5 A;  3HPG A;  4OPK A;  4MO5 A;  3KHY A;  2E20 A;  3SK3 A;  3S41 A;  3M8S A;  4X62 K;  4CF1 A;  1OH7 A;  4IFV A;  4UQG A;  4GV9 A;  4E1M A;  4O4G A;  1XMQ K;  1YJN N;  3SAG A;  1SL2 A;  2GEL A;  3EYZ A;  4IDH A;  4AHS A;  4BR2 A;  4JRQ A;  1KLM A;  3A0I X;  2KW4 A;  4FWQ A;  3QEV A;  3ID6 A;  3HT3 A;  4ZTF A;  4FJ5 A;  2O8D A;  2OYQ A;  3LP0 A;  4BY9 C;  1VQ9 N;  1L5U A;  4CFA A;  2RPI A;  2UXC K;  3SUQ A;  1VQK N;  2GX9 A;  5AQZ A;  3OYJ A;  4I2Q A;  5HRN A;  3DLR A;  1QHT A;  4JI5 K;  3AY9 A;  5BRH A;  2VQE K;  4KI6 A;  5KI6 A;  1EWR A;  1ZYQ A;  4B9M A;  3JAM O;  1N33 K;  3THX A;  1KXP A;  1Z26 A;  4E3S A;  2VCP A;  1SL1 A;  1OH5 A;  3KLI A;  3IS9 A;  5CHI A;  4KH5 A;  1VSM A;  4BC2 A;  3V9Z A;  4BGB A;  1L3S A;  1GLB G;  4JI6 K;  3VOV A;  3OYG A;  2R7Y A;  1F21 A;  2OPP A;  2HST A;  4KKO A;  3TSP A;  4DTN A;  1BIS A;  1JLA A;  3TPQ A;  1WSI A;  1TKD A;  2QWR A;  3QO9 A;  1X9J A;  2D0P A;  3CMA N;  3OYB A;  4Y0W A;  3I0R A;  3M3Z A;  1IBK K;  3KLE A;  1RT2 A;  3P5J A;  5BRE A;  2XY5 A;  3QLH A;  4MQ3 A;  3MEE A;  4H03 B;  4JKH A;  3LP2 A;  4OPJ A;  2O8F A;  1D9F A;  4Z0U A;  5AZJ B;  2RN2 A;  1TYQ B;  4C8M A;  4OVL A;  2EHG A;  4GKJ K;  4LSL A;  2D0B A;  2P9K B;  4F2R A;  4NLB A;  4JI4 K;  2YI1 A;  2ZE2 A;  3H6E A;  4CJ7 A;  4CES A;  3UKU A;  4LH4 A;  3OYE A;  3IDH A;  3NVM A;  4LY7 A;  1U2V A;  2PZS A;  1S72 N;  4FZY A;  1VSD A;  3P31 A;  3CI5 A;  4M7Y A;  2X6N A;  1X1P A;  3O5B A;  4X64 K;  4JS5 A;  3PLA A;  2NUB A;  3CJ7 A;  4CEA A;  3WXL A;  3C94 A;  3DLH A;  1EXQ A;  3MEC A;  1TKT A;  1Q86 O;  1X3N A;  4NYF A;  4HUF A;  4DR1 K;  2NRR A;  3J80 O;  3QEP A;  2RE2 A;  1HQE A;  4FCY A;  3AVL A;  4A61 A;  1V4S A;  2W42 A;  2CH6 A;  3VF4 A;  2KLA A;  3A5N C;  3WNG A;  3ENB A;  4B9V A;  2XO7 A;  4DR7 K;  4O8K A;  3LM9 A;  4JI3 K;  4KB0 A;  1NK7 A;  4DSF A;  4CE9 A;  5J2Q A;  1DKG D;  1E4F T;  2QK9 A;  3OYM A;  4J2B A;  4DTX A;  3J81 O;  4AM6 A;  1HNX K;  1ZBF A;  1KFS A;  4FXD A;  4JHD B;  1KVB A;  4A2B A;  3J7Z O;  4M3Y A;  2IS3 A;  4FWR A;  4O5F A;  3WNE A;  1T8E A;  4ID5 A;  4FVU A;  2P5G A;  4ELT A;  3FZL A;  2B5J A;  5M1P A;  4ILG B;  4DV0 K;  4CEQ A;  1UOC A;  5C15 A;  3FZK A;  4A59 A;  4DR6 K;  2VQF K;  3TAG A;  2EWS A;  4AHU A;  5SZT A;  4CZF A;  1BHL A;  3VQA A;  1P8Z A;  3U8X A;  1REV A;  1KQS M;  1YVN A;  3E9L A;  1BQN A;  1R0A A;  4BRH A;  1TV6 A;  4FWM A;  3OYA A;  1TAU A;  1VRU A;  3T1Y K;  4KH6 A;  3PX6 A;  3NF9 A;  1NOZ A;  3CCM N;  2CH5 A;  1I94 K;  2V7Z A;  4H4O A;  2GUI A;  5AQO A;  4FZZ A;  4H5R A;  4FLV A;  2Z1I A;  3L0Q A;  4FLX A;  4CFC A;  3T19 A;  2OTL N;  3GBT A;  3K59 A;  3LAK A;  1UAX A;  3VEX A;  4HHT A;  3VEZ A;  3EZ5 A;  3CPE A;  1U49 A;  1Z05 A;  3GL1 A;  4DFM A;  4DTS A;  5LJW A;  4JS4 A;  4CCH A;  3PIO L;  5I3U A;  3ZSO A;  4DR5 K;  3W3D A;  1GOC A;  2ZF5 O;  2B4J A;  4Z4G A;  5M1F A;  5C25 A;  3CC4 N;  1C0U A;  2FBV A;  4CZI A;  1D8Y A;  4AHV A;  4CJ5 A;  2ZJP L;  3TAP A;  3QEI A;  1NKE A;  1J5E K;  4CW7 B;  5FLX O;  4U7B A;  4WQ5 A;  3VEV A;  1VQ4 N;  1J9A A;  2HMP A;  4LC9 B;  4B9T A;  3QFU A;  3DLB A;  4FJ7 A;  1RDW X;  4J2D A;  4GNI A;  4OLB A;  4LF5 K;  4DF4 A;  4KTQ A;  2WFB A;  1NM1 A;  2E6M A;  3OHR A;  4MFB A;  2JGU A;  2GTD A;  3K0S A;  5M1K A;  3UIQ A;  4H0Y B;  5BN9 A;  1CZB A;  4RCH A;  3MK6 A;  3VQ5 A;  2ASO A;  4Q5V A;  4CFD A;  3VA3 A;  3PSF A;  4KBO A;  1M1K O;  4DV6 K;  3THW B;  3ZYY X;  4ZHR A;  3THW A;  2UUB K;  1BI4 A;  2P9L B;  4Z4C A;  3O9U A;  1GOB A;  4M3X A;  3OYN A;  3J7A P;  4CHO A;  2QM1 A;  1RBT A;  2G8W A;  3O4W A;  1S1T A;  1WNS A;  5TKY A;  3TTC A;  3LP1 A;  4CHZ A;  3AVC A;  1S1V A;  3NF8 A;  3O9S A;  1NGB A;  3HM8 A;  2YNF A;  3IFR A;  4DV5 K;  1RT6 A;  3AO1 A;  1X9M A;  4DSK A;  1YVU A;  1SKS A;  4AQY K;  2W6L A;  1H1V A;  2OZM A;  4WQ4 A;  4L3Q A;  4DQQ A;  3TAM A;  5AQQ A;  1BO5 O;  4XH1 A;  5BRD A;  1T3V A;  4QS7 A;  2XY8 A;  2I7N A;  1Q82 O;  2OCE A;  1Q81 O;  3RSE A;  1EP4 A;  3DJC A;  1Q9X A;  4I7F A;  3MAQ A;  5BN8 A;  3HPH A;  2VWJ A;  4FLU A;  1BIU A;  1VSF A;  1VAZ A;  2O4G A;  4GV3 A;  3L2V A;  4WQ4 C;  3THV A;  4W5T A;  2P1J A;  5HBM A;  4JK8 A;  5DM6 L;  3AO2 A;  3L3V A;  3V1Q A;  3V6D A;  4M3U A;  4JKD A;  4AM7 A;  1EO1 A;  3DXM B;  3LAL A;  3THY A;  1JXB A;  5CE3 A;  2X78 A;  3ATU A;  2J4R A;  4EIA A;  1XUP O;  2P9K A;  4GMJ B;  1UA1 A;  4FWP A;  4N47 A;  4EFH A;  4KPY A;  3DM2 A;  3EO3 A;  3CJC A;  4E19 A;  2LSN A;  2PYL A;  4B8C A;  4M42 A;  1RBR A;  3K2P A;  4YOR A;  3LZI A;  3KTQ A;  3U3Y A;  2DPN A;  2YV0 X;  2HHV A;  5GIP A;  4MO4 A;  3HVR A;  3TWH A;  3DLL L;  3L2U A;  4W5R A;  3NCI A;  5BPN A;  2IC3 A;  2GWK A;  3AVK A;  1VSI A;  4CJL A;  4CJT A;  4B1U B;  2HHS A;  3MXJ A;  4FK0 A;  5B8H A;  4IG3 A;  4R79 A;  3U4L A;  1U6Z A;  3NBP A;  4BC5 A;  3VES A;  3ZSR A;  4FK4 A;  3AVH A;  2ZJR L;  1QZ5 A;  2Q97 A;  3VQE A;  4FM2 A;  3MN5 A;  3JXU A;  3MDQ A;  4CZL A;  4DU4 A;  4DR4 K;  3OYL A;  1KLN A;  4G1Q A;  4QS8 A;  3VEY A;  5HRR A;  1MDU B;  3RSE B;  3C0B A;  4DLG A;  1D5A A;  5GAH P;  1B9D A;  4DQI A;  1NU0 A;  5JS2 A;  1KAZ A;  2P5O A;  4ISE A;  2XY7 A;  3HM9 A;  2ZGZ A;  1QHA A;  2UU9 K;  3HP9 A;  3C7N B;  1QSY A;  3QBX A;  4MDB A;  3L2Q A;  4DQP A;  1XNQ K;  4LFA K;  1BQM A;  3HJF A;  4NLC A;  1KSP A;  1YF5 L;  2VGM A;  3C6A A;  3ZT2 A;  3EKS A;  4PL8 A;  4XEI A;  3HSC A;  2NRV A;  1Z6R A;  2VWK A;  1N5Y A;  5HP1 A;  4I2P A;  4B3R K;  3ULD A;  5E41 A;  3DRS A;  3MXM A;  1RNH A;  3O1B A;  4DWI A;  4FJH A;  1EET A;  1J54 A;  4LFC K;  5AQF A;  2D5R A;  4FW2 A;  4CIE A;  4CBW A;  2YHW A;  4BWJ A;  5ADX H;  3VET A;  4EP5 A;  2YHA A;  3QIC A;  3CPW M;  2Q0R A;  1TVR A;  4MLH A;  3UE5 A;  3OYK A;  3SPY A;  4RW6 A;  2DY4 A;  1NGD A;  3AVN A;  1LWF A;  1LCU A;  3H1V X;  4ELU A;  4ELV A;  4FJ9 A;  1LAV A;  2WOM A;  3PX4 A;  4FM1 A;  2EX3 A;  4CJR A;  3THY B;  3TSQ A;  2FSK A;  4RWT A;  4CD3 A;  3P38 A;  4O0J A;  5AQX A;  1KCF A;  3MWP A;  1U45 A;  3U3G A;  2YHY A;  3F9K A;  3DMJ A;  3CC7 N;  1EWQ A;  4DHY A;  3OA9 A;  4OPA A;  3D2E B;  4OGE A;  2FXU A;  4JI2 K;  1IH7 A;  4BRO A;  4H0X B;  3RTV A;  4FWS A;  3AA4 A;  3MEG A;  2D0O A;  3W0L A;  1JL1 A;  5AQK A;  4RG8 A;  3SV4 A;  3A5L C;  4PUO A;  3NMU A;  2HHX A;  1NWK A;  2OPR A;  1ASV A;  3TAN A;  4CZK A;  3HOS A;  2AA4 A;  3FFK B;  4NO7 A;  3T7Z A;  4F3O A;  2E4L A;  4H8K A;  1VQM N;  1RFQ A;  1OKJ A;  4NYN A;  4GVE A;  4XH4 A;  2UXD K;  2JLE A;  3A5M C;  3AO3 A;  3EZW A;  5AFU A;  3C6H A;  2HF4 A;  3CER A;  1IKV A;  3IRX A;  3FZH A;  2IVO A;  4IDK A;  5F1X A;  1GLF O;  1JLF A;  4BRC A;  4Z4I A;  3I33 A;  4W5O A;  3RMB A;  1BIZ A;  2ASP A;  4BR7 A;  3F5T A;  3LDN A;  1Z25 A;  2A40 A;  4DR2 K;  1W7A A;  4JEP A;  3SMP A;  3KJV A;  4F4K A;  1E3M A;  2YNI A;  2UUA K;  3G25 A;  5C10 A;  1SUQ A;  4JKB A;  2ETJ A;  1RTH A;  2HNZ A;  4BR0 A;  2E1Z A;  4CJS A;  4BRI A;  3V81 A;  1HJR A;  5C42 A;  2A3Z A;  3TTD A;  4HUE A;  1BOT O;  3O3H A;  2P9U A;  1NJX A;  2YNH A;  3ULE B;  4JI0 K;  3ZLJ A;  4IO8 A;  5CYM A;  1K6Y A;  1TUU A;  3MWT A;  1YJ9 N;  4CGH A;  3CQY A;  3AAR A;  2WC9 A;  1BCM A;  3SAF A;  4IFE A;  2F4V K;  4DFP A;  4EHT A;  4PWD A;  3D45 A;  1P90 A;  3LPT A;  3U9Z A;  5J1E A;  1RBV A;  4FO0 A;  1NGC A;  5LMU K;  2UXB K;  4B9L A;  4TSX A;  1EQY A;  1U4B A;  4R5P A;  1B92 A;  1UWB A;  2FC0 A;  3R3L A;  4CJK A;  2HHW A;  4CK2 A;  4CI6 A;  4KHN A;  4GW6 A;  1N36 K;  2P9I A;  3CM6 A;  4FVM A;  5AFU H;  3EY1 A;  2VG6 A;  3ZCM A;  3QNO A;  3DAW A;  3AVG A;  4KTZ A;  4E1J A;  5I9E B;  1O13 A;  2FSJ A;  3CFO A;  4B1Z A;  1NOY A;  5F0X A;  3TI0 A;  1TK8 A;  5AQY A;  3PO5 A;  4PQU A;  5EY4 A;  3BDP A;  5AR0 A;  1KTQ A;  4DTJ A;  2P9S A;  1T44 A;  1DT9 A;  5CZ2 A;  4C8N A;  1YI2 N;  2CGJ A;  1SS6 A;  1OVQ A;  2B6A A;  3VQP A;  1QSS A;  3NDK A;  1NK4 A;  4YDU C;  3L2R A;  4A57 A;  3HST B;  1K73 O;  1O1W A;  1BL3 A;  3LL3 A;  3THX B;  5BPM A;  3CD6 N;  3WUH A;  3QER A;  4JD2 B;  2O8C A;  2A1R A;  1NK5 A;  1JLE A;  2CGK A;  2NLX A;  3MX2 A;  4EP4 A;  5JS1 A;  4CZM A;  2ZJQ L;  1GLE G;  1QQN A;  4RW9 A;  4B1W B;  4BAC A;  1IKX A;  5HRS A;  5LJV A;  2F9T A;  4NXM K;  5FPD A;  5M1N A;  4B3O A;  1VQ6 N;  2FF3 B;  2QWQ A;  2W41 A;  4NXN K;  2KFZ A;  3C6U A;  4JYA K;  1RGI A;  5KTQ A;  1VQ8 N;  1BU6 O;  3DRP A;  1VSK A;  1JL2 A;  3IMX A;  2DFF A;  1ATS A;  4DKW A;  3HL8 A;  4DSJ A;  2VG5 A;  3CF5 L;  4FL9 A;  5HLF A;  3VQ8 A;  3ZEU A;  3CCV N;  2KFN A;  1W9H A;  1HNV A;  3A2F A;  4ZTJ A;  4WFN L;  3E66 A;  5M1Q A;  3NF6 A;  4JKG B;  4FWN A;  4YOV A;  4JKG A;  4K43 A;  5EXW A;  3KLH A;  3CME N;  1XWL A;  3ZSQ A;  4PA1 A;  1V4T A;  3V9U A;  2A5X A;  4IO9 L;  2Y1J A;  2V51 B;  3CC2 N;  3PX0 A;  2KHO A;  2O8E A;  4CD1 A;  3KK2 A;  1OH6 A;  3EE8 A;  2OA8 A;  5CY4 A;  4DB3 A;  3SJJ A;  3DLG A;  3IUC A;  5IWA K;  1K9M O;  1S9E A;  4K0K K;  1CZA N;  4RW7 A;  1VSL A;  5C2F A;  1OVY A;  3CCS N;  2HMI A;  2VG7 A;  2KQ2 A;  3CYM A;  4CJ3 A;  3CG7 A;  1TUY A;  3D7E O;  3V9W A;  2HBL A;  4K41 A;  1ZBI A;  2P51 A;  3BZC A;  5FPN A;  3CQ8 A;  4K42 A;  5ADX A;  3VQB A;  3A8Y A;  3O4Q A;  1N34 K;  1SV5 A;  5ELZ A;  2Z1J A;  3WXK A;  5F2R A;  3TU5 A;  2GWJ A;  3ID8 A;  2BH1 A;  1J6Z A;  4F8R A;  1HNZ K;  4DR3 K;  4X65 K;  1NMN A;  1WSG A;  1WSF A;  4PKI A;  2HVI A;  4CF9 A;  3O8M A;  2Q3S A;  3LAM A;  4Z94 A;  4CJE A;  5JVG L;  3NGI A;  2NRT A;  5JLH A;  4LF9 K;  3Q7C A;  4WFB L;  4M3W A;  1ZBL A;  5AJ3 K;  4IKF A;  3SQ0 A;  3KD1 E;  2HBJ A;  3VER A;  3AAP A;  4G9Z A;  4JV5 K;  4J2E A;  1TGO A;  2PYJ A;  2QWL A;  2KTQ A;  2W6K A;  4IWV A;  1FKO A;  4I9L A;  3LWM A;  4BVP A;  4FLZ A;  3NH2 A;  1Q18 A;  1N6Q A;  3RMC A;  5LY3 A;  3EN9 A;  2BUP A;  1KC8 O;  3SCX A;  4AH9 A;  1QVF M;  4DTO A;  1ZBH A;  4CEF A;  4CGD A;  3KK1 A;  3RRH A;  4FJM A;  1HYS A;  2YJE A;  1N32 K;  4E7L A;  4FJK A;  4JLH A;  3V4I A;  3K9K A;  3KLG A;  3EEQ A;  4QS9 A;  3BF1 A;  4H5N A;  3D0P A;  3RMD A;  3GE1 A;  1XQS C;  3LDL A;  4CHP A;  3AVB A;  4BRE A;  1W2B M;  3MED A;  4YOU A;  2X74 A;  1NGH A;  1GLJ O;  3CCL N;  3CCU N;  2YJF A;  4NCA A;  3C6T A;  3K5N A;  5GAE P;  5KQ8 A;  1VQO N;  3SQ4 A;  2JWK A;  4CBX A;  3MXI A;  3T69 A;  5KPR A;  4H5V A;  3TAF A;  1U2V B;  1G99 A;  4PKH A;  2ASM A;  1VQL N;  3PY8 A;  5LL6 Z;  4JKF A;  3OYF A;  3OYD A;  2Q36 A;  3QIP A;  4IJN A;  4BRA A;  4F9O A;  3HYF A;  3DWL A;  2P9N B;  4CJF A;  3R8E A;  1SKR A;  5AQW A;  4CF0 A;  3S3M A;  2GUP A;  4CJQ A;  2V7Y A;  1NGF A;  3AA3 A;  2W40 A;  2OAN A;  1WAJ A;  3AO4 A;  3VN5 A;  1S5J A;  4YFU A;  4M3T A;  2E6L A;  1XHZ A;  2QWM A;  3QES A;  4CJ4 A;  3QML A;  3RVC A;  4CFB A;  4CIF A;  5HOO A;  3I56 N;  4KRF A;  1BUP A;  3I8D A;  1BWF O;  1QQM A;  1QSL A;  5CYQ A;  3LP3 A;  1LWC A;  4DUZ K;  3WNH A;  4LH5 A;  4BR5 A;  1BGX T;  4OX9 K;  3CXC M;  2Y1I A;  4CEB A;  5BR9 A;  2P9I B;  4GKK K;  3WXJ A;  3GDQ A;  3ZSY A;  1A5W A;  1YAG A;  4C8K A;  4KAZ A;  4YOT A;  1KVA A;  4JK7 A;  3G4S N;  3ZEU B;  1WB9 A;  3OYH A;  1G15 A;  2BGG A;  1WSE A;  2KKZ A;  2HVH A;  4B8A B;  4DFJ A;  4CED A;  2QXL A;  3T1H K;  1HPM A;  4DU3 A;  3OTO K;  1ATR A;  3ZX2 A;  4DS5 A;  1NK9 A;  3L8B A;  2E2N A;  1LOT B;  4DV7 K;  1TKX A;  4BDY A;  3MN6 A;  4C8O A;  1IJJ A;  5BR8 K;  1HNW K;  3OBY A;  1VQP N;  1HYZ A;  5KQD A;  5CR4 A;  5FRN A;  1C1B A;  3RR8 A;  5CZ1 A;  5DK5 A;  3CFR A;  3V1O A;  4DUY K;  5DMR A;  4WQ5 C;  3ZET A;  4DV4 K;  3ZSZ A;  3L4Q A;  2QKK A;  2O8C B;  4QOZ B;  4JI1 K;  2PY5 A;  5I42 A;  5GIN A;  3SLC A;  3CJ9 A;  1C0T A;  3C65 A;  4AIL C;  1EKE A;  2IVP A;  4JN4 A;  3Q7B A;  4E7H A;  1JLQ A;  4N41 A;  4H0T B;  4DTU A;  3E01 A;  4KFB A;  5FDL A;  2OPS A;  1BDG A;  1WSH A;  4OJR A;  1K8K A;  3QBW A;  5HRP A;  3M6G A;  4V19 S;  2FBY A;  1RDD A;  3R9P A;  1Y64 A;  3O3G A;  2Z1H A;  4Z4F A;  3RWU A;  4BQZ A;  3ZT1 A;  3AV9 A;  4JHD A;  3LDP A;  4YNQ A;  4A5B A;  4J8F A;  1IV0 A;  3MMV A;  3OS0 A;  1MU2 A;  4CGI A;  1WOQ A;  5KGX A;  1I3A A;  5AQJ A;  1VQ7 N;  4OPH A;  4OGC A;  1SAZ A;  3QEW A;  3EKU A;  3LDS A;  4OLA A;  3FLC O;  1HYV A;  1KD1 O;  1M90 O;  3H1Q A;  4FJX A;  2HOE A;  3CET A;  3VTI A;  1K8A O;  4DQS A;  2HHT A;  2Z1G A;  4YDU A;  3I8B A;  4H5T A;  4BRN A;  3P4I A;  4U67 L;  3OJS A;  1NGG A;  3E9O A;  2PFU A;  4L8R B;  4KH4 A;  3C95 A;  2QKB A;  4I9Q A;  5AQR A;  1IG8 A;  3OJU A;  3QET A;  1X9W A;  3O1W A;  4DQR A;  5AQL A;  2NNW A;  3K57 A;  2P9S B;  3AVJ A;  3CCJ N;  1KVC A;  1I39 A;  4XIU A;  4DV2 K;  1SL0 A;  5FRM A;  1YIT N;  2ITG A;  3U9D A;  4WCE L;  1A5X A;  3SQ1 A;  4PL7 A;  1EX4 A;  2F96 A;  4O5B A;  4EZ6 A;  3FFI A;  4HWI A;  4N5S A;  1ATN A;  3AA2 A;  2Q0U A;  3SI6 A;  2RHK A;  4Z4H A;  1K8K B;  2E2P A;  4IEI A;  2IOC A;  2E1Y A;  4B3T K;  3GOI A;  4HTL A;  1ILY A;  4Q0B A;  4MDA A;  5AZI B;  1QQC A;  3ISN C;  2ZD1 A;  2UYT A;  4ILH A;  4KHW A;  1NGI A;  2DFE A;  2ZGY A;  1B9F A;  4B9S A;  5J2M A;  1S6Q A;  1RBS A;  1N8R O;  2HW3 A;  1S6P A;  2O8B A;  4A62 A;  1HPZ A;  4ICL A;  2QI2 A;  2XY6 A;  4DU1 A;  1S1W A;  1ZBU A;  2A42 A;  2E8A A;  4AHR A;  1IBM K;  4FLW A;  2FF6 A;  4FJN A;  1SKW A;  1UA0 A;  3DYA A;  2G8F A;  3LM2 A;  1IKY A;  3CHW A;  4FWO A;  4LF6 K;  4CEZ A;  5EOY A;  1XC9 A;  3D2F B;  3HPO A;  3F73 A;  1JLB A;  4IBN A;  4BRD A;  4FPB A;  4CK1 A;  5AZJ A;  4CEC A;  2JWL A;  3DOK A;  5KPT A;  3VGL A;  2F8S A;  5E26 A;  4CJP A;  4IZ9 A;  1S9G A;  1ZC6 A;  5AQH A;  1TL1 A;  1ITG A;  1JCE A;  3ATV A;  1HUX A;  1L3U A;  3DXK B;  4CZE A;  5D3G A;  3QNN A;  4YY3 K;  1ASW A;  2X6S A;  1HKG A;  1BI4 B;  2P9L A;  4BRF A;  4H0O A;  5JLF A;  3SYZ A;  1BA0 A;  4J2A A;  1S3X A;  3O9R A;  3T3F A;  3OW2 M;  3NH1 A;  3L4I A;  2E2O A;  3ZSV A;  4M3R A;  3BZK A;  1RT3 A;  5TKW A;  1NLV A;  5C2D A;  1RTJ A;  3K58 A;  3DRR A;  4QCL A;  2E2Q A;  4DLE A;  3VEO A;  1NMD A;  2QWN A;  5M1O A;  3NGZ A;  1RTD A;  4O44 A;  4C8L A;  4X66 K;  4DTM A;  2WUS A;  4IG0 A;  4K8Z A;  2D0C A;  4JKA A;  1VQN N;  5H1S Q;  4BRQ A;  3N4P A;  4FSV A;  5AQI A;  4CGG A;  3K5L A;  2I7P A;  1VRT A;  4B1Y B;  3QFP A;  1FKP A;  3PSI A;  1CXQ A;  3NHG A;  1NJW A;  3P83 D;  1YTU A;  5HL7 L;  2Q2R A;  4H0V B;  4WE1 A;  4WF9 L;  1JJ2 M;  4LD0 A;  3NVK A;  2QTD A;  3AAQ A;  4YHH K;  4DV1 K;  2VGN A;  3SPZ A;  3SAH A;  3JS6 A;  2G8I A;  2DFH A;  3SMS A;  3A5O C;  1HNI A;  2GBZ A;  1NKC A;  2FSN A;  5HRO A;  4FYD A;  1XI1 A;  1RIL A;  4ILJ A;  3BF3 A;  3HVT A;  3SQ2 A;  3AVI A;  2RF2 A;  3ZET B;  4CER A;  2YHX A;  1WN7 A;  3VTH A;  4DMN A;  4FJL A;  4CGJ A;  1WLJ A;  2Q31 A;  3KZB A;  5C0Y A;  1RDU A;  2BTF A;  2G8V A;  1LV5 A;  3KK3 A;  3WEE B;  4E7K A;  4Y1D A;  4NB4 A;  1CLQ A;  2QEX N;  4JRP A;  1J53 A;  1YJW N;  4B9N A;  1A5V A;  3LDO A;  3S3O A;  3ITH A;  1HMV A;  2CGL A;  3DXM A;  1HQU A;  2YKN A;  1WSJ A;  1ZBS A;  4BE0 A;  1TYQ A;  5AQN A;  1MWM A;  4KTW A;  2IAJ A;  2ZQB A;  2VYP A;  1GOA A;  2NZT A;  2FBT A;  4K25 A;  2O8F B;  1RT7 A;  2NRX A;  3WQU A;  1HR0 K;  2I5J A;  2P9N A;  2WTU A;  4BGA A;  4CZH A;  1DLO A;  3O80 A;  4FK2 A;  3PUF A;  2IIR A;  2Q1N A;  4CF2 A;  1L3V A;  4MLE A;  4DCH A;  3DOL A;  3HXM A;  4CEO A;  4BE1 A;  3KKR A;  5FPM A;  2NRH A;  3OVN A;  1R59 O;  4KV8 A;  1T6D A;  3EL2 A;  3L2W A;  1IBL K;  1T03 A;  2YNG A;  1IO2 A;  4B1X B;  3CCQ N;  1RBU A;  3SV3 A;  1LW0 A;  4FOI A;  4CJW A;  4YOX A;  3JSM A;  3UKR A;  4IOX A;  3G10 A;  3B6P A;  3CCE N;  4FJJ A;  3TTF A;  1GLD G;  4UY8 O;  1NK0 A;  3GG4 A;  1TK0 A;  3EE9 A;  5JVH L;  2F7T A;  1T05 A;  1J5O A;  2YX6 A;  3NFA A;  4KRE A;  3WXI A;  2O8D B;  3DLE A;  4DSL A;  4PHT X;  4HTU A;  4E0D A;  3HI0 A;  2QWO A;  3DXK A;  3ENO A;  1IKW A;  1QQO A;  2G8H A;  3VEN A;  4KHU A;  1T6C A;  3ZX3 A;  1DTQ A;  3HZ6 A;  2F8T A;  2HHU A;  4BDZ A;  4E7J A;  4N76 A;  1SQK A;  4DSE A;  1BCO A;  2BDP A;  3G0Z A;  3TAR A;  3RR7 A;  4I6M A;  5J2N A;  4CVN E;  3B6O A;  2KZZ A;  1DEJ A;  2PBD A;  3SUO A;  3VF6 A;  4XH5 A;  3LWL A;  1X9S A;  4ID1 A;  1S22 A;  5GIO A;  4EAH D;  4EHU A;  3ZSX A;  3D2F A;  3AA5 X;  3KIO A;  3SUN A;  3O3F A;  1DGK N;  4H5W A;  4C23 A;  2G8K A;  2F9W A;  2GEM A;  1VSH A;  3D6R A;  3IAY A;  1LW2 A;  1KAX A;  2P9P A;  4LF7 K;  2E88 A;  5MLC Q;  2P9P B;  1MA9 B;  3UB5 A;  4DFK A;  1ASU A;  3E1Y A;  1VK0 A;  3M8Q A;  2XHB A;  3VQ6 A;  4BQL A;  1NKB A;  2O8B B;  1DTT A;  2G8U A;  1VSJ A;  3ZT4 A;  1XMO K;  3PO4 A;  3HBT A;  5EVZ A;  3CQX A;  4B9U A;  1NGA A;  5AQU A;  1YIJ N;  3O08 A;  4BG8 A;  3U6F A;  3PIP L;  5GAD P;  1HLU A;  1VQ5 N;  1W0H A;  4KI4 A;  4Z4E A;  1JXE A;  4DS4 A;  3OYC A;  4AF1 A;  1RT4 A;  4CJV A;  3SNN A;  3WT0 A;  1JCG A;  1C0F A;  4FWK A;  3VQD A;  1GLC G;  5FPE A;  2OZS A;  1KAY A;  4DTP A;  4CHN A;  1RCH A;  4AHT A;  3ZSW A;  1HJO A;  2YCH A;  3HRG A;  1TL3 A;  3LPU A;  2AP1 A;  3MX5 A;  3H08 A;  3N4Q A;  3CM5 A;  4IXC A;  4DTR A;  1KRP A;  4DG1 A;  3BGR A;  3HOT A;  1QTM A;  3ALY A;  4WYB A;  5E84 A;  1TKZ A;  4I6M B;  2UUC K;  1QE1 A;  3UKR B;  3AGR A;  4M41 A;  3LZJ A;  3P1G A;  3WQT A;  3NE6 A;  3CJA A;  3KLF A;  1MWK A;  3MCP A;  1NNE A;  2A6A A;  4C1N I;  4M7X A;  1IG9 A;  3ENH A;  2HHH K;  3HK2 A;  1VHX A;  3R6M A;  5K14 A;  4KHY A;  3FR0 A;  4CHQ A;  2V52 B;  3O9Q A;  1HKB A;  5A2Q O;  3D2E A;  2WBN A;  1XNR K;  3HTV A;  3M1F A;  4FJG A;  3BEX A;  3T1A A;  1CXU A;  3VQ9 A;  1JCF A;  4ISF A;  1X3M A;  2FLO A;  4NCG A;  2YHB A;  3OY9 A;  3KK7 A;  1QVG M;  2HND A;  4E89 A;  4JKC A;  4O8U A;  1OH8 A;  3VQ4 A;  3SUP A;  2D4W A;  4K8X A;  1C1A A;  2OPQ A;  1XHX A;  1CZ9 A;  3FE1 A;  4RW4 A;  4CF8 A;  4JI7 K;  4BR4 A;  3E9P A; 
#chains in the Genus database with same CATH homology
 2XRI A;  4YNQ A;  1SUQ A;  2W42 A;  2ETJ A;  4O0I A;  1RTH A;  2HNZ A;  3OS0 A;  1MU2 A;  4CJS A;  3WNG A;  4CGI A;  5KGX A;  4B9V A;  3V81 A;  3I0S A;  1HJR A;  2XO7 A;  1I3A A;  5C42 A;  1Y97 A;  1NJZ A;  2KZM A;  4OGC A;  4F3T A;  4HUE A;  3QEW A;  3LDS A;  4OLA A;  5KGW A;  4KB0 A;  3O3H A;  4FLT A;  1FXX A;  4FJI A;  1NK7 A;  4DSF A;  4KHS A;  1NJX A;  1C0M A;  4CE9 A;  1HYV A;  5J2Q A;  2YNH A;  4FJX A;  1U04 A;  1JLG A;  3QEX A;  4DQS A;  3OYM A;  2Z1G A;  4N56 A;  4J2B A;  5CYM A;  4DTX A;  2QK9 A;  1K6Y A;  3DLK A;  1RDC A;  3ASM A;  1ZBF A;  1U48 A;  4FJH A;  1KFS A;  4CGH A;  1U47 A;  4FXD A;  3RRG A;  3OJS A;  1KVB A;  3AVM A;  1BCM A;  4M3Y A;  2IS3 A;  4PY5 A;  3WNE A;  1T8E A;  4DFP A;  4L8R B;  3C95 A;  4ID5 A;  2QKB A;  3D45 A;  4I9Q A;  4PWD A;  2P5G A;  4FW1 A;  3V9X A;  4ELT A;  3LPT A;  2B5J A;  5J1E A;  1RBV A;  4CEQ A;  4B9L A;  4TSX A;  3OJU A;  1Q8I A;  4R5P A;  1RDA A;  1B92 A;  1UOC A;  1UWB A;  2FC0 A;  5EU7 A;  4CJK A;  1S1X A;  2HHW A;  4DQR A;  3V1R A;  3HO1 A;  4CK2 A;  3K57 A;  3AVJ A;  4KHN A;  3DI6 A;  4GW6 A;  5FRO A;  3VQQ A;  1KVC A;  1I39 A;  3CM6 A;  4FVM A;  4XIU A;  3TAG A;  1SL0 A;  3QIO A;  4AHU A;  5SZT A;  3OS2 A;  4DF8 A;  3EY1 A;  5FRM A;  2ITG A;  3NH0 A;  1BHL A;  2VG6 A;  3ZCM A;  1Q9Y A;  3VQA A;  4KTZ A;  3AVG A;  5C24 A;  3QNO A;  1REV A;  3CFO A;  3L3U A;  4E7I A;  1A5X A;  1BQN A;  1LWE A;  1EX4 A;  2F96 A;  3IG1 A;  4O5B A;  1TV6 A;  3OYA A;  3SQ1 A;  3V9S A;  3FFI A;  4N5S A;  1TK8 A;  3PO5 A;  4EZ6 A;  4PQU A;  1TAU A;  1VRU A;  4BDP A;  3AA2 A;  3PX6 A;  3BDP A;  3NF9 A;  3SI6 A;  2FBX A;  1NOZ A;  2YKM A;  4Z4H A;  1KTQ A;  4FM0 A;  4DTJ A;  2IOC A;  4H4O A;  5CZ2 A;  4C8N A;  2GUI A;  4Q0B A;  1QQC A;  3ISN C;  4EZ9 A;  2ZD1 A;  4FZZ A;  2B6A A;  3VQP A;  5KRT A;  4FLV A;  3NAE A;  2Z1I A;  5J2P A;  1NK8 A;  4FLX A;  4CFC A;  1QSS A;  3KKS A;  4Y1C A;  3T19 A;  3NDK A;  1NK4 A;  3L2R A;  4KHW A;  2DFE A;  3HST B;  1B9F A;  4IFY A;  3K59 A;  5J2M A;  4B9S A;  1S6Q A;  1RBS A;  2QXF A;  3LAK A;  2HW3 A;  1O1W A;  1BL3 A;  1S6P A;  1UAX A;  4HHT A;  1HPZ A;  3EZ5 A;  2HB5 A;  4W5N A;  1U49 A;  4ICL A;  3QER A;  4DU1 A;  2XY6 A;  1S1W A;  4DFM A;  4DTS A;  1ZBU A;  1JLC A;  2A1R A;  1JLE A;  1RTI A;  4AHR A;  4JS4 A;  1NK5 A;  4CCH A;  4FLW A;  4FJN A;  1SKW A;  5I3U A;  3ZSO A;  3DYA A;  1VSE A;  4EP4 A;  1GOC A;  1IKY A;  1UA0 A;  2BAN A;  2G8F A;  5JS1 A;  2B4J A;  4CEZ A;  2DTU A;  3HP6 A;  4Z4G A;  4RW9 A;  4CK3 A;  5C25 A;  4HCB A;  1XC9 A;  1C0U A;  4HCC A;  2FBV A;  4BAC A;  3HPO A;  2O4I A;  1IKX A;  5HRS A;  3F73 A;  4AHV A;  1JLB A;  4IBN A;  4CJ5 A;  3TAP A;  1D8Y A;  4F2S A;  3QEI A;  4FLY A;  4CK1 A;  1NKE A;  4CEC A;  4KO0 A;  4B3O A;  3DOK A;  1JKH A;  3OYI A;  3VQC A;  2F8S A;  4CJP A;  1HRH A;  1S9G A;  1YTA A;  1TL1 A;  1ITG A;  2KFZ A;  3C6U A;  1L3U A;  1J9A A;  1WAF A;  5KTQ A;  5D3G A;  3QNN A;  4B9T A;  2HHQ A;  3DRP A;  1VSK A;  1JL2 A;  2ATQ A;  3DLB A;  4FJ7 A;  4J2D A;  1ASW A;  2DFF A;  2X6S A;  2AJQ A;  1BI4 B;  4OLB A;  3HL8 A;  3SYZ A;  3AVF A;  4DSJ A;  2VG5 A;  4DF4 A;  4KTQ A;  5T7B A;  4J2A A;  2E6M A;  3TAE A;  5HLF A;  4MFB A;  3VQ8 A;  4CEE A;  3T3F A;  2KFN A;  2JGU A;  1W9H A;  1HNV A;  3NH1 A;  3A2F A;  4ZTJ A;  4KB1 A;  4OKK A;  3UIQ A;  2D0A A;  3ZSV A;  3NF6 A;  4M3R A;  3TAB A;  1RT3 A;  1CZB A;  3VQ5 A;  3JYT A;  3KLH A;  2HNY A;  1RTJ A;  1XWL A;  4CHY A;  4AHC A;  4CJU A;  3K58 A;  3DRR A;  4QCL A;  4DLE A;  2HHT A;  4Q5V A;  4CFD A;  3ZSQ A;  3VA3 A;  4PA1 A;  4M45 A;  3NGZ A;  3V9U A;  1RTD A;  4BE2 A;  4W5Q A;  4O44 A;  1C6V A;  4C8L A;  4ZHR A;  4DTM A;  1BI4 A;  3AVA A;  2Y1J A;  1T7P A;  4Z4C A;  3ZT3 A;  4FJ8 A;  4IG0 A;  1GOB A;  4K8Z A;  2D0C A;  3OYN A;  3PX0 A;  4M3X A;  1S1U A;  4E1N A;  4CHO A;  1RBT A;  2G8W A;  3KK2 A;  1TK5 A;  1S1T A;  1WNS A;  2OA8 A;  5CY4 A;  4CGG A;  3K5L A;  3DLG A;  3LP1 A;  1VRT A;  3AVC A;  4CHZ A;  4CGF A;  4HVJ A;  3OS1 A;  3SJJ A;  1FKP A;  1S1V A;  1S9E A;  4KHQ A;  1CXQ A;  3NF8 A;  2BE2 A;  3P83 D;  3NHG A;  1NJW A;  4RW7 A;  1VSL A;  1YTU A;  2YNF A;  3NF7 A;  4WE1 A;  1RT6 A;  3AO1 A;  4LD0 A;  1X9M A;  4DSK A;  2HMI A;  2VG7 A;  1YVU A;  3TAQ A;  4B08 A;  2KQ2 A;  3CYM A;  4CJ3 A;  3SPZ A;  1SKS A;  3CG7 A;  1RT1 A;  2OZM A;  3V9W A;  4DQQ A;  3NGY A;  5KRS A;  2P51 A;  1ZBI A;  1NJY A;  3WNF A;  3M8P A;  3TAM A;  3CQ8 A;  2G8I A;  2DFH A;  1HNI A;  2GBZ A;  3VQB A;  3K5O A;  3O4Q A;  1NKC A;  2XY8 A;  1SV5 A;  5HRO A;  1XI1 A;  1RIL A;  4FYD A;  3SQ2 A;  3HVT A;  1QS4 A;  3AVI A;  2RF2 A;  2Z1J A;  4CER A;  3K5M A;  1WN7 A;  3PV8 A;  2IDO A;  4DMN A;  4FJL A;  4CGJ A;  1WLJ A;  4CIG A;  1EP4 A;  4F8R A;  4OKE A;  1Q9X A;  4I7F A;  3MAQ A;  1TAQ A;  3HPH A;  2G8V A;  2VWJ A;  4FLU A;  1LV5 A;  1BIU A;  3KK3 A;  3S9H A;  1VSF A;  1WSF A;  1WSG A;  4E7K A;  2HVI A;  4Y1D A;  4CF9 A;  3SZ2 A;  2O4G A;  3L2V A;  3VA0 A;  2Q3S A;  3LAM A;  1CLQ A;  1NK6 A;  3THV A;  1LAW A;  4CJE A;  4W5T A;  3NGI A;  4JRP A;  1J53 A;  2P1J A;  1KFD A;  3AO5 A;  5HBM A;  4B9N A;  3AO2 A;  4LSN A;  3LAN A;  3L3V A;  3V1Q A;  4BWM A;  3V6D A;  4M3U A;  1A5V A;  4QAG A;  1ZBL A;  4IKF A;  4M3W A;  3SQ0 A;  3KD1 E;  4HUG A;  1RDB A;  3LAL A;  1C1C A;  3S3O A;  3ITH A;  1JXB A;  1HMV A;  4OKJ A;  1NOY A;  4J2E A;  1TGO A;  2PYJ A;  4FZX C;  1HQU A;  2YKN A;  1WSJ A;  2RKI A;  2X78 A;  4BE0 A;  3QIN A;  1L3T A;  2KTQ A;  1FKO A;  4KTW A;  4I9L A;  3LWM A;  4FLZ A;  4GMJ B;  2IAJ A;  2ZQB A;  1UA1 A;  4N47 A;  4KPY A;  3NH2 A;  3DM2 A;  1N6Q A;  3RMC A;  1GOA A;  4E19 A;  2LSN A;  4GVM A;  2FBT A;  3KD5 E;  2PYL A;  2WON A;  4B8C A;  4M42 A;  1RBR A;  3K2P A;  1RT7 A;  4NCB A;  1FK9 A;  3ZT0 A;  3LZI A;  3SCX A;  4RW8 A;  4AH9 A;  3KTQ A;  3U3Y A;  2YV0 X;  2HHV A;  2I5J A;  3QET A;  1YT3 A;  4M3Z A;  1DLO A;  3TR8 A;  3HVR A;  3PUF A;  4CEF A;  3TWH A;  4DTO A;  3CFP A;  4FK2 A;  1ZBH A;  4CGD A;  4CF2 A;  2GV9 A;  3KK1 A;  3L2U A;  3RRH A;  1L3V A;  1D9D A;  4H4M A;  4W5R A;  4FJM A;  1HYS A;  3NCI A;  3S3N A;  2IC3 A;  4E7L A;  3AVK A;  3DOL A;  1VSI A;  4CEO A;  4JLH A;  3KKR A;  4CJL A;  3HXM A;  4BE1 A;  3V4I A;  4FJK A;  4CJT A;  3OVN A;  3KLG A;  3MXJ A;  2HHS A;  4FK0 A;  4KV8 A;  4IG3 A;  4DSI A;  3D0P A;  3RMD A;  3L2W A;  4O55 A;  1T03 A;  2YNG A;  1IO2 A;  3RMA A;  4CHP A;  3NBP A;  1R0A A;  3AVB A;  3ZSR A;  4FK4 A;  1RBU A;  3AVH A;  3SV3 A;  1LW0 A;  2IGI A;  3MED A;  2X74 A;  5SWM A;  3VQE A;  3O4N A;  2A1S A;  4CJW A;  3M8R A;  3JSM A;  4FM2 A;  3VQ7 A;  4NCA A;  3G10 A;  3B6P A;  3C6T A;  4FJJ A;  4DU4 A;  3K5N A;  1RT5 A;  1NK0 A;  3HPG A;  3OYL A;  4OPK A;  1TK0 A;  1T05 A;  1J5O A;  3NFA A;  4KRE A;  1KLN A;  3SQ4 A;  4G1Q A;  3DLE A;  3M8S A;  5HRR A;  4CF1 A;  4DSL A;  4IFV A;  4UQG A;  3MXI A;  4E1M A;  4HTU A;  4E0D A;  4O4G A;  3TAF A;  4DLG A;  1D5A A;  1SL2 A;  3EYZ A;  1IKW A;  3PY8 A;  2G8H A;  1B9D A;  4DQI A;  3OYF A;  4KHU A;  3OYD A;  4AHS A;  1DTQ A;  5JS2 A;  2F8T A;  3QIP A;  4JRQ A;  4BDZ A;  4E7J A;  2P5O A;  1KLM A;  2XY7 A;  4N76 A;  2KW4 A;  2HHU A;  3HM9 A;  3HYF A;  4DSE A;  3HP9 A;  3QEV A;  1BCO A;  4CJF A;  3L2Q A;  1QSY A;  2BDP A;  3HT3 A;  4ZTF A;  4DQP A;  3G0Z A;  3TAR A;  3RR7 A;  1SKR A;  4FJ5 A;  1BQM A;  3HJF A;  4CF0 A;  5J2N A;  3B6O A;  2OYQ A;  2KZZ A;  3LP0 A;  3SUO A;  3S3M A;  1KSP A;  4CJQ A;  3LWL A;  1X9S A;  4ID1 A;  3ZT2 A;  3AA3 A;  1L5U A;  1WAJ A;  3AO4 A;  3VN5 A;  4CFA A;  1S5J A;  3ZSX A;  2RPI A;  2VWK A;  1N5Y A;  5HP1 A;  4I2P A;  3AA5 X;  4YFU A;  3KIO A;  3SUQ A;  3SUN A;  3O3F A;  2E6L A;  3ULD A;  4M3T A;  5E41 A;  3DRS A;  1XHZ A;  3OYJ A;  2G8K A;  3MXM A;  1RNH A;  4I2Q A;  1VSH A;  4CJ4 A;  3DLR A;  5HRN A;  3QES A;  4DWI A;  1EET A;  3IAY A;  4CFB A;  1J54 A;  4CIF A;  1QHT A;  1LW2 A;  4KRF A;  3I8D A;  2D5R A;  1QSL A;  4FW2 A;  4CIE A;  5CYQ A;  3LP3 A;  4KI6 A;  5KI6 A;  1ZYQ A;  1LWC A;  4BWJ A;  4B9M A;  4DFK A;  3WNH A;  1ASU A;  1VK0 A;  4LH5 A;  3M8Q A;  4EP5 A;  2YHA A;  3VQ6 A;  2XHB A;  3TI0 A;  1NKB A;  1DTT A;  1BGX T;  1TVR A;  2G8U A;  1VSJ A;  3ZT4 A;  3OYK A;  1Z26 A;  4E3S A;  3PO4 A;  2Y1I A;  4B9U A;  3SPY A;  4CEB A;  1U4B A;  4RW6 A;  2DY4 A;  1SL1 A;  3AVN A;  3ZSY A;  1A5W A;  4C8K A;  3KLI A;  1LWF A;  3IS9 A;  4KAZ A;  1KVA A;  1VSM A;  3U6F A;  3V9Z A;  1L3S A;  3OYG A;  3OYH A;  1W0H A;  2R7Y A;  1F21 A;  1G15 A;  2OPP A;  4ELU A;  4KI4 A;  1JXE A;  1WSE A;  4DS4 A;  3OYC A;  4ELV A;  4FJ9 A;  4KKO A;  2BGG A;  1LAV A;  4DTN A;  1BIS A;  1JLA A;  2WOM A;  1RT4 A;  4CJV A;  3PX4 A;  4FM1 A;  2HVH A;  1WSI A;  2EX3 A;  4B8A B;  3QO9 A;  4CJR A;  4CED A;  4DFJ A;  3SNN A;  1TKD A;  3OYB A;  4O0J A;  3VQD A;  4DU3 A;  2OZS A;  1KCF A;  4DS5 A;  4DTP A;  3I0R A;  1NK9 A;  3L8B A;  4CHN A;  1RCH A;  4AHT A;  1U45 A;  3U3G A;  1TKX A;  3ZSW A;  3KLE A;  1RT2 A;  4BDY A;  3P5J A;  3F9K A;  2XY5 A;  1TL3 A;  3QLH A;  3DMJ A;  4C8O A;  3LPU A;  4MQ3 A;  3MEE A;  1HYZ A;  3H08 A;  5FRN A;  4OGE A;  3CM5 A;  4DTR A;  3LP2 A;  1C1B A;  4OPJ A;  5CZ1 A;  5DK5 A;  3RR8 A;  3CFR A;  4Z0U A;  1D9F A;  3V1O A;  5DMR A;  1KRP A;  1IH7 A;  4DG1 A;  3BGR A;  2RN2 A;  1QTM A;  3ALY A;  1TKZ A;  3RTV A;  1QE1 A;  3ZSZ A;  4M41 A;  3AA4 A;  3MEG A;  2QKK A;  1JL1 A;  4C8M A;  4OVL A;  2EHG A;  3LZJ A;  3P1G A;  4RG8 A;  3SV4 A;  3NE6 A;  4LSL A;  2D0B A;  4QOZ B;  4PUO A;  2PY5 A;  3KLF A;  4F2R A;  2HHX A;  5I42 A;  2ZE2 A;  2OPR A;  4CES A;  1ASV A;  1C0T A;  3TAN A;  4LH4 A;  4AIL C;  1IG9 A;  3HK2 A;  3OYE A;  1EKE A;  4LY7 A;  5K14 A;  4E7H A;  2PZS A;  2E4L A;  4F3O A;  4KHY A;  4CHQ A;  4FZY A;  1JLQ A;  1VSD A;  4H8K A;  4N41 A;  4DTU A;  3E01 A;  4KFB A;  4NYN A;  4Z4E A;  2JLE A;  2X6N A;  1X1P A;  1X9W A;  4FJG A;  3AO3 A;  1CXU A;  5FDL A;  3T1A A;  3VQ9 A;  2OPS A;  4JS5 A;  1IKV A;  3IRX A;  2NUB A;  4CEA A;  1WSH A;  3C94 A;  4NCG A;  2YHB A;  4IDK A;  4OJR A;  3OY9 A;  2HND A;  4E89 A;  5HRP A;  1JLF A;  1EXQ A;  3DLH A;  4Z4I A;  3MEC A;  4W5O A;  3RMB A;  1TKT A;  1BIZ A;  4NYF A;  2FBY A;  1RDD A;  4HUF A;  3VQ4 A;  3SUP A;  1Z25 A;  3QEP A;  3O3G A;  2Z1H A;  4Z4F A;  4K8X A;  1C1A A;  2OPQ A;  3RWU A;  3KJV A;  4F4K A;  1HQE A;  4FCY A;  1XHX A;  2YNI A;  3AVL A;  1CZ9 A;  4RW4 A;  4CF8 A;  3AV9 A;  3ZT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...