3AA4A

A52v e.coli rnase hi
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
152
structure length
152
Chain Sequence
LKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAVIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein core adaptability: crystal structures of the cavity-filling variants of Escherichia coli RNase HI
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Ribonuclease HI
total genus 51
structure length 152
sequence length 152
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3aa4A00
3ASMA 1HMVA 1TVRA 3KLHA 3OYKA 3TAGA 3HYFA 3THVA 2G8IA 5CZ2A 1RBSA 1QSYA 4CJVA 4KHSA 3D0PA 1L3UA 2RN2A 3S3OA 2B5JA 3DI6A 1LAWA 3DRRA 1W9HA 3M8PA 5KTQA 3TAQA 1SKRA 1VRTA 1A5VA 3AVFA 3PO5A 1WSFA 1WSHA 4KHNA 1RDCA 2YKMA 3ALYA 3OYMA 5FRNA 4LD0A 3SPZA 4CEDA 3RRGA 1IG9A 4FJIA 4Z4EA 3AVHA 1JLBA 3AA5X 4CJLA 3U6FA 1BCMA 4F3OA 1U47A 4ID5A 1IO2A 3AA4A 4OKKA 1D9FA 3A2FA 3DLBA 4EP5A 4MQ3A 4DU4A 4CEBA 3V9UA 1RILA 1GOBA 3AO1A 1NKBA 1RT4A 3KTQA 3LPUA 4DLEA 3NF6A 4FW2A 2YNHA 4IDKA 4CIFA 1KFDA 1XC9A 2KFZA 4HUEA 3TI0A 4DQRA 3C6UA 4HCCA 1SKWA 2BDPA 3CFRA 3SUQA 5HP1A 2G8HA 3L3VA 3B6PA 4I9QA 4Q0BA 1RNHA 4YNQA 3L2WA 5C25A 1HRHA 1RCHA 3U3GA 4DF8A 4QAGA 4JS4A 1SL1A 1RT1A 4B9LA 4DSFA 5HLFA 1UAXA 4CJQA 3AO3A 1SUQA 3VQ4A 4FZZA 3KLGA 1T03A 3PUFA 3SV3A 1RDBA 3OS1A 3V9XA 3AA2A 2P5GA 2HHTA 1FXXA 3O3HA 4HCBA 3S9HA 1TK8A 1RDDA 1T7PA 4C8KA 1LAVA 3CQ8A 3K2PA 3V4IA 4NCAA 4CJTA 1B9FA 4Z4GA 3TAEA 3SCXA 2ATQA 3OYDA 4OPKA 4YFUA 2IOCA 1RT2A 4DTRA 2G8UA 3O4NA 2PYLA 4DQPA 1J53A 1F21A 2A1RA 4KTZA 5K14A 2G8KA 4FZXC 1YTAA 4H4OA 3AV9A 3HSTB 2JGUA 1S1TA 1VSDA 3RMCA 1FKOA 4BDPA 5FRMA 3VQEA 2F8TA 4E7KA 2E4LA 1N5YA 4AHTA 2PY5A 1Z26A 1A5XA 4O44A 3OYHA 4FLTA 4IFVA 4CJEA 1NK7A 1ASWA 3DOLA 4CJFA 3HP6A 1BISA 1ZYQA 1B9DA 3PV8A 3KIOA 2FBVA 1CXQA 1FK9A 1NJXA 1VSIA 4CK3A 3QEVA 4AHRA 3TARA 4J2BA 3CFOA 1LW2A 4CFAA 3I8DA 1C1BA 3I0SA 3LANA 1KFSA 4IBNA 2BANA 1HYVA 3P1GA 4N56A 3DRPA 3V81A 3DMJA 3M8RA 3QEXA 3EY1A 3VQ9A 3ZT4A 4E7LA 3DLHA 4KHQA 1KCFA 1U49A 2P5OA 1MU2A 1RTDA 3MXMA 1RBRA 2JLEA 4KV8A 3VQDA 4C8NA 4UQGA 3KD1E 4KHWA 3DRSA 4KPYA 4IG0A 4CIGA 4DTPA 3DLGA 1BQNA 2OPSA 2ETJA 4CHQA 4ZHRA 1SL2A 4FJ5A 3KLEA 4B9UA 3VN5A 1TL1A 2OA8A 2D0CA 4M41A 1U48A 4OKJA 1G15A 1T05A 3HT3A 3LDSA 1LWEA 1KVCA 2WONA 4CJ4A 4ZTFA 2OZSA 4B9TA 3CM5A 3DM2A 4FLVA 3C94A 4DTNA 1W0HA 5I3UA 4OVLA 3L2QA 1HNVA 4CF2A 3KJVA 2PYJA 3RR8A 3ZSYA 3O3GA 4CK1A 3KK3A 4DFMA 4QCLA 2YNIA 4K8XA 4K8ZA 4C8LA 3NE6A 1ASVA 1TK0A 2D0BA 2KZMA 2F96A 3RRHA 1JLEA 2BE2A 1LWFA 4FLWA 4HVJA 1EXQA 4BWMA 1RTJA 2ZQBA 2Z1JA 4W5QA 3OJSA 1S9EA 4EZ9A 1J54A 2OPQA 4CJ5A 2HVHA 3B6OA 1BCOA 3OYEA 3OVNA 1J9AA 3KKRA 3WNHA 4B9MA 3NFAA 4DSKA 3SUPA 1RTHA 1GOAA 2IGIA 3DLEA 1NKEA 1NOYA 4Z4IA 3T19A 5KRSA 2ITGA 3HPOA 4CHPA 4FLXA 4Y1DA 4M3TA 1BI4A 4GW6A 1NK9A 1CXUA 1RT7A 1YTUA 2O4GA 4DSJA 1LV5A 3AVKA 2FBTA 4FW1A 4OGEA 3ZT2A 1BI4B 4G1QA 3ZSOA 4FJKA 1TL3A 1S9GA 1XI1A 1NKCA 2VG5A 5J1EA 1TAUA 5I42A 4FVMA 1VSJA 4LY7A 3DLKA 3E01A 4M45A 3V1RA 3ZT1A 4KO0A 3L8BA 1KLNA 4FK0A 2QKBA 1JLGA 4CFDA 5EU7A 2FBXA 4W5RA 2YHBA 3ISNC 5HRRA 5HRSA 1NK8A 4FJHA 3HPGA 1D9DA 4AHUA 5J2PA 1ZBHA 2Y1IA 1BIUA 4OGCA 3K57A 4E89A 2W42A 4KRFA 4KB1A 3RTVA 4BE1A 4JRQA 4M3YA 2FC0A 4ELVA 5FROA 4BE2A 1UWBA 4LSLA 4F8RA 3PX4A 3V1OA 3K5OA 3QO9A 4N5SA 4AILC 4PY5A 4DMNA 1R0AA 3PO4A 2OPPA 3SUOA 1RTIA 2IDOA 3NGIA 2XRIA 1U4BA 2G8VA 4CGIA 4FJ9A 4XIUA 1L3TA 4IKFA 4FJMA 3IRXA 3WNFA 3LP0A 2D5RA 1S1XA 3ZSVA 3EZ5A 4FJJA 2E6LA 3BDPA 3AVGA 4FJXA 4B8CA 1YVUA 2X78A 4FJGA 4QOZB 1KVAA 3V9ZA 1NJWA 1C1AA 3IS9A 3ITHA 4E1NA 4Z4HA 2IAJA 3NDKA 3SQ0A 3UIQA 4OPJA 1JLQA 3TWHA 2HHXA 4B3OA 3KLIA 4H8KA 1NK4A 2QK9A 1YT3A 3ZT3A 5E41A 4B9SA 4CHNA 4PQUA 1BIZA 5DMRA 3QETA 1C6VA 4CK2A 1BL3A 1REVA 3VQ5A 3ZSQA 4CIEA 1QSLA 2QXFA 3K5NA 3DOKA 4E19A 4E7JA 4FXDA 5SZTA 1N6QA 3OYBA 3KK2A 3SPYA 4CJUA 1WSJA 3AVNA 4CJWA 1RT6A 4KI6A 2HVIA 5HRPA 2AJQA 3DYAA 1QE1A 1UOCA 3V9SA 3LP1A 3ZSRA 2D0AA 4DSIA 4J2DA 3MEDA 3IG1A 5FDLA 3T1AA 1WN7A 5HRNA 4BDYA 1TV6A 1DLOA 4DU1A 4DTJA 4FLZA 3RMAA 3MEEA 3P5JA 1I3AA 3HPHA 4OLAA 2VWJA 1X9SA 2VG6A 4M3RA 1X9MA 3HJFA 4CJ3A 1Q9YA 3HM9A 4DF4A 1IKWA 1SKSA 2G8FA 1VSLA 2DFHA 4CHOA 3VA0A 1TKDA 4Q5VA 1RBVA 1SV5A 4M3UA 3IAYA 2KQ2A 4KB0A 2R7YA 4DFPA 4DTXA 4CF8A 1D5AA 4BE0A 1QSSA 5JS1A 2RF2A 4NYFA 3VA3A 5HBMA 4L8RB 1NJYA 4MFBA 3MAQA 4NCBA 4BWJA 3ZSXA 2X6NA 1JLFA 3OYCA 3K59A 1SL0A 3LWMA 3BGRA 1ASUA 4CEOA 3LP2A 4FM0A 1JKHA 2IS3A 1VSFA 5KGXA 3SNNA 2X6SA 1S1UA 1IKXA 3AVJA 2PZSA 5KRTA 3QINA 1L3VA 3D45A 2HNZA 4FK4A 4JLHA 3VQCA 3TANA 2P1JA 4DTMA 1VSEA 4O0IA 4DG1A 4CJSA 3QEPA 3MXIA 3QEIA 3NGZA 2ZE2A 4HUGA 4CE9A 3PX6A 1DTTA 4FM2A 3AA3A 1NK6A 3OYFA 1QHTA 2RPIA 4O4GA 1BGXT 4KFBA 1X1PA 5KI6A 4FK2A 5CY4A 2YKNA 3K58A 3SJJA 3OYIA 1KLMA 3SI6A 4LH5A 1RDAA 1LWCA 4KREA 4DLGA 1NK0A 3K5MA 1JL2A 3ZSWA 4CEEA 4CCHA 1WSEA 1I39A 4ID1A 4AHCA 4Z0UA 1Q9XA 3HP9A 2XHBA 3HL8A 4OKEA 3KK1A 2XY8A 2OZMA 1S6PA 1ZBIA 1TKZA 3WNGA 4LH4A 3OYAA 2Z1HA 1CZ9A 3JYTA 1L5UA 4RW4A 5CYMA 1VSMA 4KKOA 3ZCMA 3L2RA 4B9NA 4F2RA 2DTUA 1Q8IA 4KHYA 3HXMA 3CYMA 4DSEA 3O4QA 3OYGA 3RMBA 4W5TA 4CJRA 1XWLA 3JSMA 3OS0A 3TAPA 3ZSZA 3M8SA 4FJ7A 4F3TA 2HW3A 1VRUA 2A1SA 4Z4FA 1HQEA 1QQCA 3NGYA 1ZBLA 4RW7A 4OLBA 1WLJA 4FJ8A 5JS2A 4TSXA 5CYQA 3SYZA 4PWDA 3AVLA 1S6QA 3QIPA 4NCGA 3VQPA 1ITGA 3C6TA 4KI4A 2DFEA 3CFPA 3SQ1A 3TAMA 1RT5A 2F8SA 4DTOA 2YNFA 3AO2A 4PA1A 5C42A 2XY5A 4N76A 1BQMA 2XY6A 3AVMA 1RBTA 2EX3A 3F9KA 3KKSA 3MXJA 4RW6A 3OYNA 5J2NA 1D8YA 1NK5A 1UA0A 3L2VA 4GVMA 3V1QA 4E1MA 1Y97A 5D3GA 3LZIA 4KAZA 1VSKA 1KVBA 1TKXA 4BACA 2KFNA 1HYZA 1LW0A 4NYNA 4HHTA 3LWLA 4ELUA 1JXEA 1HYSA 4I9LA 4IG3A 4O0JA 1QTMA 2GBZA 3OYJA 1BHLA 1TAQA 4CGHA 3C95A 3MECA 1C0MA 3RMDA 3K5LA 3TAFA 4I2PA 1XHZA 3DLRA 4HTUA 1NJZA 3O3FA 3KD5E 4Y1CA 2B6AA 4EZ6A 3HVRA 3NF7A 5KGWA 4FZYA 1S1WA 3SQ4A 3PX0A 1EP4A 1UA1A 4I2QA 1VK0A 2DFFA 1JLCA 3VQAA 2YHAA 3CG7A 4O55A 4EP4A 4Z4CA 1TGOA 2X74A 2BGGA 2E6MA 2HHVA 3L2UA 2I5JA 4DQQA 3FFIA 3RWUA 2IC3A 4R5PA 1EETA 3QNOA 3S3NA 1WAJA 4CFCA 4CHZA 3NHGA 5SWMA 4PUOA 4FYDA 3VQQA 1FKPA 3LAKA 4CGGA 4WE1A 4FLUA 1S5JA 1KSPA 2LSNA 4J2AA 1Z25A 1HJRA 1C0TA 1RBUA 2GV9A 4CFBA 1X9WA 2G8WA 3NF9A 3F73A 1RT3A 4DSLA 1VSHA 1EKEA 1B92A 5DK5A 3VQ8A 2GUIA 4CJPA 3AVCA 3WNEA 4CGFA 4RW9A 5CZ1A 2XO7A 4O5BA 2B4JA 1O1WA 2YNGA 4B08A 2Y1JA 2EHGA 4DFKA 3LAMA 3QIOA 4FJLA 4DU3A 3ZT0A 3NH1A 3AO4A 1CZBA 2KTQA 2HHSA 1QS4A 3OJUA 4B8AB 5J2QA 1IH7A 2HB5A 1A5WA 4CESA 4CGDA 4BDZA 4FCYA 1EX4A 3MEGA 3ULDA 2ZD1A 3SUNA 4DQIA 3OY9A 4H4MA 3SV4A 4IFYA 1JXBA 4CGJA 4N41A 1NOZA 3NAEA 4M3XA 4ICLA 4M42A 2XY7A 3AVBA 2NUBA 1KRPA 3QNNA 3P83D 1DTQA 1HNIA 1C1CA 1JL1A 4ZTJA 3CM6A 1ZBFA 2QKKA 4M3WA 5HROA 4HUFA 1XHXA 3RR7A 4C8MA 4F4KA 4DS4A 4W5NA 4CEFA 2RKIA 2DY4A 4GMJB 3OS2A 3QERA 2P51A 4KHUA 4C8OA 4N47A 4AHVA 4E3SA 3PY8A 1WSGA 4KTWA 3S3MA 3QESA 4CJKA 4JRPA 3KLFA 2OPRA 3QEWA 1GOCA 4I7FA 1HQUA 3M8QA 3QLHA 3VQ6A 4CEAA 4OJRA 4CEZA 3T3FA 4E7HA 1IKVA 3SQ2A 4RW8A 2KZZA 1U45A 2O4IA 4DFJA 1CLQA 4DTUA 4CF9A 3NF8A 3U3YA 3V9WA 3NCIA 3V6DA 3SZ2A 4F2SA 4FJNA 3G10A 1T8EA 4E7IA 3VQ7A 4W5OA 3LP3A 4KTQA 4DWIA 3HVTA 1TK5A 1IKYA 4CF1A 4M3ZA 1HPZA 3NH2A 3LPTA 2HHWA 3AVAA 4CF0A 4CHYA 2Z1IA 2KW4A 2HMIA 4E0DA 2Q3SA 3HO1A 1WNSA 1ZBUA 4DS5A 4DTSA 3EYZA 2HNDA 3G0ZA 5T7BA 4B9VA 1WAFA 1K6YA 2HNYA 3HK2A 3LALA 4AH9A 2YV0X 1WSIA 1C0UA 1J5OA 4AHSA 3NBPA 4CERA 2WOMA 3NH0A 2Z1GA 2OYQA 1KTQA 4FLYA 5J2MA 3AVIA 1U04A 4LSNA 4RG8A 3TR8A 3VQBA 4DQSA 4J2EA 2HHUA 2VG7A 3LZJA 2HHQA 4ELTA 1L3SA 1JLAA 4CECA 1S1VA 4FM1A 2FBYA 4CEQA 3TABA 3I0RA 5C24A 3AO5A 3L3UA 3OYLA 4JS5A 3H08A 2VWKA 1TKTA
chains in the Genus database with same CATH superfamily
3ASMA 4WFAL 3EKUA 3CCEN 4ILJA 2G8IA 5CZ2A 1QSYA 3HM8A 3D0PA 5AZJB 1L3UA 4ISGA 4JD2B 3S3OA 1SKRA 5M1NA 2ZGZA 4IEIA 1WSFA 3OW2M 2O8CB 1EQYA 5F0XA 3RRGA 1IG9A 4Z4EA 4H0TB 4F3OA 1U47A 3ZX2A 2FXUA 1IO2A 1D9FA 5DM7L 3DLBA 4CEBA 3CJBA 1Z6RA 5CR4A 1RILA 1GOBA 3UB5A 1NKBA 3CPEA 4X62K 3KTQA 3LPUA 4IDKA 1KFDA 2QWMA 4BC3A 2P9IB 4HUEA 1XC9A 2Q1NA 1DT9A 2O8BA 2O8EA 3L3VA 3OBWA 4I9QA 4M63C 4WYBA 3U3GA 1T6CA 1SL1A 1VQ7N 1E3MA 5HLFA 3AO3A 4FZZA 4FWRA 3SV3A 1RDBA 3V9XA 1OH5A 1TK8A 1RDDA 1YF5L 5E26A 1T7PA 1LAVA 4C8KA 3CQ8A 4Z4GA 4IDHA 4CZGA 4PWDA 2PYLA 4YFUA 2Q0UA 5KQDA 4DTRA 2O8DB 2ZWHA 4KTZA 2G8KA 3AV9A 3HSTB 1S1TA 1QZ6A 5FRMA 3ZX3A 2E4LA 3DXMB 3O9QA 3ZETB 3A5LC 4O44A 3OYHA 1NG9A 1IV0A 1ASWA 4BG9A 2D0PA 1FW6A 1KFSA 2OANA 4IBNA 3V81A 3DMJA 3EY1A 3ZT4A 1U49A 2HBMA 1MU2A 4KH5A 1RTDA 3PLAA 3KK7A 5A2QO 3DLGA 4JN4A 3VN5A 1TL1A 2OA8A 2D0CA 2P9NA 4JHDB 4M41A 4LF9K 5H1SQ 3WXKA 1G15A 3VENA 3CM5A 4FLVA 1HNVA 4CF2A 3D2EB 5LJVA 3RR8A 4QCLA 5C10A 4BRKA 3NE6A 1TK0A 2D0BA 2KZMA 1Y64A 1T3VA 4FLWA 2ZQBA 2Z1JA 1NGFA 2O8FA 5M1PA 2HVHA 1BCOA 1Q81O 3D2FB 4YDUC 3L0QA 1JJ2M 4DSKA 1NKEA 1GOAA 2IGIA 1NOYA 4CHPA 4GW6A 2P9PA 3DJCA 3AVKA 5E84A 1BI4B 3C7NB 1TL3A 1E4GT 4FVMA 3V1RA 3U4LA 4FK0A 1EWRA 2QWLA 3HPGA 4AHUA 5J2PA 4LF4K 4E89A 1NGIA 4KB1A 4M3YA 3CC7N 4BE2A 2QWQA 3PX4A 4AILC 2OPPA 4GKKK 2IDOA 1U4BA 5F2RA 2XRIA 4A57A 4FJ9A 4IKFA 2D5RA 3GL1A 3BDPA 1KXPA 2X78A 4QOZB 1KVAA 3V9ZA 4E1NA 5F1XA 1HUXA 3R8EA 4NO7A 3HTVA 3TWHA 2HHXA 1VQKN 4B3OA 2QK9A 1YT3A 3ZT3A 1BIZA 5AQLA 1LOTB 5M1FA 3K5NA 4IOXA 3EZWA 4CJUA 1WSJA 3W3DA 3T7ZA 4CJWA 1RT6A 4YOXA 2HVIA 5GAHP 3QB0A 3LP1A 2D0AA 1Q18A 5FDLA 3RMAA 3MEEA 1I3AA 3HPHA 3TTFA 2VCPA 3I56N 2NRHA 3H3NO 1KC8O 3JAMO 2DFHA 1SV5A 4DTXA 4CF8A 4BE0A 4I6MB 2D4WA 5HBMA 3WEEB 1N34K 4XH1A 4NCBA 4DV0K 1MWMA 1SZ2A 1NLVA 2YJFA 3OYCA 1HPMA 3QDKA 4E1JA 1XMQK 5M1QA 2IS3A 1VSFA 5KGXA 4B3TK 3SNNA 4LF8K 3AVJA 1L3VA 3D45A 2FSKA 3GG4A 3TANA 5HOOA 1OVQA 4DG1A 5GIPA 2ZE2A 2O8DA 3B8AX 4FM2A 3E9PA 1NK6A 1XNQK 1QHTA 4O4GA 4KFBA 5KI6A 4ILGB 3SJJA 1EWQA 4LH5A 4DV1K 3VGLA 4CEEA 4CCHA 1NBWA 1Q9XA 3HL8A 3OYAA 1CZ9A 1K9MO 1TYQB 4BRCA 4RW4A 3L2RA 4A59A 1KAXA 2DTUA 1Q8IA 1Z05A 4W5TA 4CJRA 2QXLA 4F3TA 3ATUA 1QQCA 3NGYA 3E9LA 4TSXA 3QIPA 1NGHA 3TAMA 5AQXA 1RT5A 3F2KA 2F8SA 4DTOA 2XY5A 2GTDA 1BQMA 4CBUA 2XY6A 1D8YA 3SK3A 3K9JA 5MLCQ 4CI6A 4EAHD 4BACA 1TKXA 3EE8A 3CCJN 2KFNA 1HYZA 3LWLA 4CZEA 3O5BA 4O0JA 3J7AP 2GBZA 3C95A 1C0MA 3RMDA 3K5LA 1NJZA 4HTUA 4FWPA 3HVRA 1JCGA 4FZYA 1S1WA 3BF1A 4K0KK 4I2QA 1VK0A 3HZ6A 4Z4CA 3NVKA 2X74A 5JLHA 3QNOA 4CFCA 5BR8K 5SWMA 3VQQA 1FKPA 3LAKA 5AQZA 3CCVN 1KSPA 1GLJO 1RBUA 4DR6K 1N8RO 3F73A 3VOVA 4JKAA 3HSCA 1X3NA 1EKEA 2I7NA 3HBTA 2UXDK 5DK5A 3VQ8A 5KPTA 2GUIA 5BPMA 3WNEA 4CGFA 3CCMN 3GBTA 4B08A 3D2FA 2Y1JA 4Y0WA 3AARA 3VTHA 3LAMA 4DFKA 4DU3A 3ZT0A 3AO4A 1CZBA 2KTQA 2HHSA 5FPMA 4CGDA 4FCYA 1EX4A 4CJ7A 2GUPA 3SUNA 1VQPN 3OY9A 2NZTA 3SV4A 2NNWA 1JXBA 3O08A 4NB4A 3SJHA 3PSIA 3QNNA 1HNIA 1C1CA 2ZJRL 1ZC6A 2PAVA 4DS4A 4CEFA 2RKIA 4GMJB 2NLXA 4KHUA 4C8OA 4E3SA 1GLAG 3PY8A 3L4QA 3QESA 4CJKA 2V7YA 4BRNA 3O4WA 2VYPA 1VAZA 4DFJA 3O8MA 4CF9A 3VGMA 3U3YA 3SZ2A 4DUZK 3VESA 3VQ7A 3LP3A 1S72N 4KTQA 1WBDA 1K8KB 3FZFA 3SMPA 1IKYA 4M3ZA 3CIPA 1HJOA 2A40A 2J4RA 4JKCA 4CHYA 2Z1IA 2HMIA 4E0DA 2Q3SA 1ZBUA 3EYZA 4G9ZA 3G0ZA 4B9VA 1NGJA 1WAFA 4BRLA 3HK2A 4MO5A 2YV0X 4JKBA 4DV7K 2IIRA 1C0UA 4AM6A 1QZ5A 4K42A 2Z1GA 5J2MA 3D2EA 4YY3K 2VG7A 1JLAA 2YCHA 4H0VB 4PHTX 4CEQA 3OYLA 3RSEA 2W6LA 3ATVA 1QQNA 5AZJA 1W97L 2E88A 3HYFA 4JKGB 4O8UA 1LAWA 5IT9O 5JVHL 5KTQA 3CCRN 3TPQA 4B3SK 4KHNA 1WSHA 4JI6K 2YKMA 4DV5K 4H03B 3VEYA 3ALYA 5FRNA 4FJIA 1Q82O 1JLBA 4CJLA 3SBTA 3A2FA 3FZKA 3PSFA 4DU4A 3AO1A 1RT4A 3QFPA 4GV6A 3TTCA 2YNHA 4MDAA 3CERA 3BF3A 4HCCA 4A5AA 3D7EO 4Z94A 3SAHA 1VQ4N 5KPZA 5GADP 1NJIO 1ESVA 2BDPA 3CFRA 3SUQA 5HP1A 2G8HA 4BRHA 3VF2A 4A61A 1RCHA 1LCUA 4QAGA 4JS4A 4H5RA 4B9LA 1O13A 4WCEL 2QTDA 1SUQA 3VQ4A 3KLGA 1T03A 3AA2A 2P5GA 4HCBA 4L3QA 1ATRA 3K2PA 3LL3A 4NCAA 1B9FA 3EKSA 3TAEA 4FJKA 2WTUA 2IOCA 1RT2A 1J53A 1F21A 2FF3B 3A5NC 5AQQA 2F8TA 4JI3K 1Z26A 4FWQA 4CJEA 1NK7A 2NRTA 4QS7A 3P31A 1ATNA 1CXQA 1VSIA 4CK3A 3I8DA 3KVGA 3P1GA 5LMNK 3M8RA 1NGAA 3VQ9A 3DLHA 1GLBG 4KV8A 4UQGA 3KD1E 3DRSA 4KPYA 3BZKA 4IG0A 4CIGA 5KQ8A 1BQNA 1JCEA 5GIOA 4FJ5A 3KLEA 4H0PA 1VQ5N 2UU9K 2A5XA 4X66K 4A5BA 4OO1J 5GAEP 1T05A 1LWEA 1R59O 2WONA 2A41A 2QWOA 4CZHA 1VQNN 4OVLA 1V4TA 3VMFB 5FLXO 1KAYA 2KHOA 2YNIA 4BRIA 4K8ZA 5BRHA 3U9ZA 5AQJA 2WC9A 2F96A 1JLEA 4BRPA 4HVJA 4DR1K 3OJSA 4EZ9A 2OPQA 4CJ5A 5AZIA 3O9SA 1TYQA 4Z4IA 3HPOA 4JK8A 4H5WA 4M3TA 4PL7A 1CXUA 1VQLN 1NMDA 4H5NA 4OGEA 2E2PA 5J1EA 1TAUA 5I42A 4HWIA 4LY7A 3DLKA 3ZT1A 2AA4A 3E01A 1KLNA 4K43A 3C0BA 2BTFA 3JS6A 2FBXA 2YHBA 1ZBHA 4OGCA 2W42A 2RHKA 1D4XA 2W40A 1UWBA 4JI0K 3V1OA 3QO9A 4DMNA 1R0AA 5AQSA 2G8VA 4CGIA 4XIUA 5C15A 3EZ5A 3MMVA 1VQON 4FJXA 1YVUA 4C1NI 4FJGA 5TKYA 1M1KO 3A8YA 3ITHA 4NLBA 4Z4HA 4CD1A 3NDKA 4B9QA 3SQ0A 3ENOA 1JLQA 2HSTA 1NNEA 3AGKA 4H8KA 4CHNA 4WQ5C 4PQUA 1X3MA 5DMRA 1C6VA 4CK2A 1BL3A 1REVA 3VQ5A 1QSLA 1XMOK 2V51B 3CHWA 2QXFA 4B3MK 3T1YK 3L6QA 1N6QA 3OYBA 3KK2A 4PL8A 3E66A 3AY9A 4FWSA 3DYAA 1UOCA 3V9SA 4DSIA 3MEDA 4BDYA 5AQHA 1DLOA 2OTJN 4FLZA 3P5JA 4DCHA 3ULEA 3HJFA 3SLCA 1Q9YA 4DV4K 4DF4A 3CJAA 1VSLA 4Q5VA 2R7YA 2RF2A 3VA3A 3MAQA 3ZSXA 3TSQA 1JLFA 1OKJA 3LP2A 4FM0A 1VQ9N 3EO3A 3O1BA 2HBKA 4IEEA 4YDUA 3G25A 2Q97A 1S1UA 1P90A 3G6EN 2A6AA 2NRXA 2PZSA 1HLUA 5KRTA 2FSNA 4UY8O 3WUHA 3WQTA 4CVNE 4O0IA 3QEPA 3MXIA 1MWKA 3NGZA 3EEQA 4HUGA 4OPAA 2D0OA 1IBMK 3AA3A 1TUYA 2YKNA 5BR9A 1WBBA 3DAWA 1KLMA 4KREA 4DLGA 1HKCA 3IFRA 1WSEA 3VF6A 4ID1A 1BUPA 4CZIA 1BO5O 4ISFA 2W6KA 2OZMA 3BEXA 1L5UA 2VGMA 3K9KA 3J7YP 5CYMA 4B9NA 4GNIA 4F2RA 3MN7A 3HXMA 4FJ7A 4JK9A 4JYAK 3ZSZA 1Q86O 3OTOK 2A1SA 1HQEA 4FJ8A 5JS2A 5JLFA 3AVLA 5AQMA 3C6TA 3OBYA 4DR7K 1BDGA 2WUSA 4JI7K 2YNFA 3AO2A 3GOIA 4PA1A 5C42A 3A0IX 2YHYA 3G71N 3AVMA 3AGRA 4BQLA 1NK5A 1UA0A 3L2VA 3V1QA 4E1MA 3LDPA 5ADXH 3LZIA 3LDLA 1VQ6N 4ELUA 1LW0A 4IG3A 1NU0A 4YOYA 3MECA 2ZM6K 1H1VA 3TAFA 4C1NK 4I2PA 3KD5E 3O80A 2B6AA 5KGWA 2E1ZA 1EP4A 2DFFA 4EP4A 3R9PA 2BGGA 4PKGA 2I5JA 4O8KA 4NLCA 1M90O 3RWUA 4R5PA 1KAZA 1EETA 3WT0A 1WAJA 4PUOA 1Z25A 4CFBA 1X9WA 2G8WA 3NF9A 4DSLA 5BPNA 4NXMK 3TU5A 4BRQA 4CJPA 3MN9A 1YIJN 3P39A 4O5BA 2B4JA 2YNGA 5JVGL 4H5TA 5AJ3K 3HOSA 3NH1A 4DR5K 3H6EA 3D6RA 1QS4A 4BGAA 5FPEA 5J2QA 1IH7A 2P9UA 3HRGA 4IFYA 1T6DA 3NAEA 3THXB 1JCFA 4BRMA 2XY7A 2NUBA 3CQYA 1DTQA 1JL1A 3CM6A 4KBOA 1QQMA 1EO1A 5C12A 1ZBSA 5IWAK 4JI5K 2O8BB 3QERA 2P51A 4JV5K 4IFEA 4AHVA 1WUAA 3S3MA 4JRPA 3KLFA 3I33A 1GOCA 2P9NB 3THWA 3M8QA 4QS9A 4CEZA 4OJRA 1SS6A 1IKVA 3SQ2A 4RW8A 1NM1A 2O4IA 2HBLA 5AQUA 4M7YA 3BZCA 3HVTA 5AQOA 3BP8A 4X65K 4CF1A 4DHYA 3OA9A 5CHIA 2QEXN 3LPTA 1VQMN 2HHWA 3A5OC 3AVAA 3Q7CA 1QVFM 4MLEA 3LALA 4AH9A 5I9EB 1WSIA 3MDQA 1W2BM 3NBPA 4CERA 1MA9B 4FYDA 4FLYA 4DQSA 1U04A 5AFUH 2YHXA 2HHUA 2HHQA 3GE1A 4H0YB 1IBLK 4DKWA 1RFQA 1L3SA 4CECA 2FBYA 4JKEA 3TABA 3I0RA 5C24A 4DWIA 1TKTA 3KLHA 2HF3A 5LMUK 3TAGA 3THVA 4FOIA 4CJVA 4KHSA 1YHQN 2F9WA 2RN2A 2B5JA 1MDUB 4DUYK 1W9HA 3M8PA 2ASOA 3CC2N 3DLLL 2O8EB 4DV2K 3SAFA 4RWTA 3AVFA 1QVGM 3OYMA 4LD0A 3SPZA 4CEDA 3ULEB 4JKFA 3AVHA 3R1XA 3U6FA 3S41A 1IJJA 1BCMA 2A3ZA 4ID5A 3AA4A 3SMSA 4EP5A 4MQ3A 4CZMA 3V9UA 4FW2A 4BY9C 1NGCA 2KFZA 4DQRA 4LF6K 1NGDA 4XH4A 3CMEN 2NRZA 1RNHA 4YNQA 3L2WA 5C25A 1HRHA 3CF5L 4DF8A 1BOTO 4CBXA 4DSFA 1UAXA 4CJQA 2F7TA 3PUFA 2HHTA 3O3HA 5AQPA 3S9HA 1G99A 3N4QA 3V4IA 3SCXA 3ZYYX 4OPKA 4DQPA 3WXJA 5K14A 4FZXC 4H4OA 4HTLA 2JGUA 1VSDA 1FKOA 1N5YA 2PY5A 4AHTA 4FLTA 5BN8A 4MO4A 1YXQA 3DOLA 3HP6A 1BISA 3PV8A 4A2AA 3KIOA 2FBVA 1FK9A 3L4IA 3ZLJA 1YITN 3QEVA 3TARA 4J2BA 1C1BA 3LDQA 3LANA 4DR3K 1HYVA 4N56A 2CGKA 4E7LA 2CH6A 4JAXA 2P5OA 2CH5A 3O6WA 3MXMA 1RBRA 2JLEA 1HX1A 4KHWA 3KWIA 1QHAA 4DTPA 4DR4K 4CHQA 3DXMA 4CW7B 4K25A 4OX9K 2P9LB 3J81O 1U48A 4OKJA 3CI5A 3HT3A 1KVCA 4H0OA 4ZTFA 1XQSC 2OZSA 3A5MC 4B9TA 3DM2A 1RDWX 4DTNA 1W0HA 5I3UA 3L2QA 3J7ZO 3KJVA 4F9OA 2PYJA 3VEOA 4DQ8A 3ZSYA 3O3GA 4CK1A 3KK3A 4DFMA 4K8XA 1K8AO 1ASVA 3PIPL 2VQFK 3P38A 2P9UB 2ZGYA 3RRHA 1LWFA 3CETA 1RTJA 5B8HA 4W5QA 3AAPA 1J54A 2AP1A 3ZEUA 3OVNA 3UKRB 2GELA 3KKRA 3WNHA 4B9MA 3SUPA 1RTHA 2V52B 5KRSA 2ITGA 2FF6A 3OHRA 1BI4A 1RT7A 1YTUA 2O4GA 1VHXA 3WXMB 4B3RK 4FW1A 5EY4A 3ZSOA 2ITMA 3TTDA 1XI1A 2VG5A 1S22A 2E1YA 4KO0A 3L8BA 1JLGA 5EU7A 3CCQN 1YAGA 1WOQA 4W5RA 1NK8A 1FJGK 2KZZA 2YI1A 2Y1IA 1BIUA 5AQTA 2IVPA 3K57A 3FZLA 4RTFD 3R3LA 4BE1A 2UXBK 4JRQA 4M7XA 4ELVA 5JMVA 5FROA 2P9IA 2QW9A 3QFUA 5AQNA 4LF5K 4N5SA 3PO4A 3NGIA 1HR0K 1OH8A 1L3TA 3TSPA 4FJMA 3IRXA 3LP0A 2GX9A 3DXKA 4B8CA 5EOYA 1V4SA 4YOWA 3IS9A 3UIQA 3M6GA 4YOVA 5DM6L 1CZAN 1NK4A 5E41A 4B9SA 4DV6K 3NVMA 4CIEA 5AQVA 4E7JA 3F9MA 4E19A 4FXDA 1U2VA 4BR4A 4BC2A 1S3XA 3AVNA 3EL2A 4KI6A 3ENHA 2IVNA 5AFUA 2ASMA 3MX2A 1QE1A 3F5TA 3H1VX 4B1ZA 3T1AA 1WN7A 5HRNA 1TV6A 2PBDA 4OLAA 1XC3A 3LM2A 1X9SA 4M3RA 1X9MA 3FZHA 4IOCL 1IKWA 1SKSA 4CHOA 1TKDA 1GLCG 4M3UA 4JEPA 4DFPA 3C6HA 3J80O 2BH1A 4BWJA 3T69A 1NGEA 3K59A 5LL6Z 1SL0A 3BGRA 4B1UB 3ENBA 2HHHK 1JKHA 2HF4A 4IXCA 2GWJA 2IVOA 1NMNA 2X6SA 4BR9A 4JHDA 3QINA 2HNZA 3VERA 4FK4A 4JLHA 2O8FB 3LDNA 2NRWA 4B1VA 4CJSA 3QEIA 4CZLA 4U7BA 4CE9A 1DTTA 3DWLA 3UE5A 4FK2A 1X1PA 3KHYA 3K58A 1U2VB 1LWCA 1NK0A 3K5MA 1HNXK 2V7ZA 1I39A 2WFBA 4Z0UA 3HP9A 2I7PA 1YVNA 4WQ4C 1ZBIA 1TKZA 3WNGA 2KLAA 4LH4A 2Z1HA 4FPBA 3UKUB 4LFAK 4CD3A 1VSMA 4KKOA 4AM7A 2VGNA 1C0FA 3CYMA 3M5RA 3OYGA 3RMBA 1XWLA 5BRFA 3OS0A 3TAPA 5BN9A 2HW3A 3CCLN 1VRUA 1GLDG 1ZBLA 4RW7A 4OLBA 2OTLN 5CYQA 3SYZA 1S6QA 1DKGD 3VQPA 4KI4A 2DFEA 3CFPA 3SQ1A 4N76A 4KHPK 3MK6A 2D1KA 2EX3A 5J2NA 3MXJA 1NGBA 4GVMA 5D3GA 1DGKN 3ZX0A 1VSKA 1KVBA 3CJCA 3FFKB 4NYNA 4MLHA 3RVCA 4I9LA 1QTMA 3VGKA 1BHLA 4CGHA 1XHZA 3DLRA 3FGUA 3O3FA 4Y1CA 4IWVA 3NF7A 3PX0A 3SQ4A 1Q7YO 2Q36A 1UA1A 1JLCA 3VQAA 3CG7A 5M1OA 2HHVA 1OVYA 2QWNA 2F9TA 3FFIA 4C23A 5M1KA 2FLOA 3NHGA 3IMXA 4CGGA 1S5JA 4J2AA 1C0TA 2GV9A 4GY2B 1XNRK 4BQZA 1B92A 4RW9A 5CZ1A 2XO7A 4LF7K 1YJWN 1O1WA 2A42A 2EHGA 1RDUA 2KKZA 3OJUA 2CGLA 5GAGP 4BGBA 2HB5A 1A5WA 1HKGA 4CESA 2UUAK 4IZ9A 3MEGA 2ZD1A 4BRFA 4CGJA 5C0YA 1NOZA 2E2OA 4M3XA 5AQGA 5FPNA 3C65A 3AVBA 3P83D 2JWKA 4ZTJA 2UUCK 2QKKA 4M3WA 3IKMA 3JXUA 4HUFA 1OH7A 3RR7A 4F4KA 2DY4A 3OS2A 4N47A 1WSGA 4KTWA 4BR7A 4BC5A 1BG3A 4CBWA 3QEWA 3MCAB 4I7FA 1HQUA 3QLHA 4DTUA 3THYB 1K8KA 4LC9B 4FJNA 3G10A 4E7IA 5AR0A 3VTIA 4YHHK 4W5OA 5JICA 3WXLA 1TK5A 4BR2A 3NH2A 4CF0A 3E9OA 4X64K 3MN6A 4JKGA 3ZEUB 1J5EK 2BUPA 3H46O 4AHSA 4EHUA 3J8AA 2ZJPL 1RGIA 2WOMA 3NH0A 2OYQA 4IJAA 3FE1A 4EHTA 4ELTA 2YHWA 5LY3A 3WQUA 2O8CA 1VQ8N 1YI2N 1S1VA 3AO5A 3L3UA 4DR2K 3E1YA 2VWKA 3IUCA 1HMVA 1TVRA 3OYKA 1RBSA 4AQYK 3DI6A 3DRRA 3TAQA 4BRGA 1VRTA 1A5VA 3GDQA 4JD2A 3PO5A 2ZJQL 1RDCA 3AA5X 3SAGA 4OKKA 1BA1A 4PKHA 3VEZA 1IBKK 4DLEA 3NF6A 4CIFA 4B1YB 3TI0A 3C6UA 1SKWA 2E5LK 4BG8A 3B6PA 3O9TA 3VPZA 4Q0BA 5ADXA 1RT1A 3VEWA 4NXNK 3OS1A 1FXXA 5C2FA 3UKRA 3VEVA 4CJTA 2G8UA 2ATQA 3OYDA 4KB0A 1GLLO 3M3ZA 3O4NA 2A1RA 1YTAA 1BA0A 3RMCA 4BDPA 3VQEA 1YJNN 4E7KA 2Q31A 3H45C 1A5XA 4FWOA 4IFVA 4FSVA 4CJFA 1ZYQA 1B9DA 2QI2A 1NJXA 1W7AA 4AHRA 3CFOA 1LW2A 4IO8A 4CFAA 3I0SA 3N4PA 3O9RA 2BANA 3I8BA 3DRPA 4A62A 3QEXA 4KHQA 3NMUA 1KCFA 4YORA 3HOTA 3VQDA 4C8NA 1J6ZA 3VF4A 4K41A 2OPSA 2ETJA 4ZHRA 1SL2A 4B9UA 5AQRA 1N32K 1WB9A 3LDSA 4GKJK 4CJ4A 1HNZK 5C2DA 3MWPA 3CXCM 3K0SA 3C94A 3SBGA 3C6AA 4J8FA 4FWLA 3CC4N 3C7NA 4C8LA 4DB3A 4JKDA 3LDOA 3CQXA 1IG8A 2BE2A 1EXQA 4BWMA 1S9EA 2P9LA 4CZFA 2YJEA 3B6OA 1YUWA 3KWGA 1TUUA 3OYEA 3PIOL 1J9AA 3MWTA 3NFAA 4GV3A 3DLEA 4H5VA 3T19A 4FLXA 4Y1DA 3LM9A 1NK9A 4JI4K 1ILYA 4DSJA 1DEJA 2HMPA 3O9UA 2UYTA 2FBTA 1LV5A 3ZT2A 4G1QA 4BVPA 1S9GA 4FWMA 1NKCA 1VSJA 4M45A 2QKBA 5ELZA 4CFDA 4FJHA 3ISNC 5HRRA 5HRSA 1D9DA 2QWRA 2CGJA 3ID6A 4KRFA 3RTVA 2P9SA 3HI0A 4YOUA 2P9KB 2FC0A 4LSLA 4F8RA 3K5OA 4PY5A 3SUOA 1RTIA 1HKBA 4WFNL 3CCUN 3WNFA 1QQOA 1S1XA 3ZSVA 4FJJA 4FVUA 1SQKA 2E6LA 3AVGA 5FPDA 1NJWA 1C1AA 2IAJA 4OPJA 4FWKA 4H0XB 3KLIA 4BRAA 3QETA 4O5FA 3ZSQA 3ID8A 3DOKA 3FR0A 5BPLA 3H3OB 5SZTA 3SPYA 3BY5A 3DXKB 2DPNA 2AJQA 5HRPA 4BRDA 5EVZA 2HBJA 4A2BA 3H1QA 4JI8K 3ZSRA 1NWKA 4WQ4A 4J2DA 3CJ1A 3IG1A 3QICA 4DU1A 4DTJA 2E2QA 2VWJA 2VG6A 4CJ3A 3HM9A 4BREA 2G8FA 3VA0A 1RBVA 3IAYA 2KQ2A 5EX5A 4EIAA 4JI2K 5CE3A 1D5AA 4KH6A 1QSSA 4V19S 5JS1A 4NYFA 4DV3K 4L8RB 1NJYA 4MFBA 5LJWA 3O1WA 1HNWK 2X6NA 3QBWA 1BWFO 3LWMA 1ASUA 4CEOA 4JI1K 1KD1O 2ASPA 1IKXA 3QBXA 4CZKA 3EE9A 3VQCA 3FLCO 2P1JA 4DTMA 1VSEA 1BU6O 2W41A 3PX6A 3I55N 3MN5A 4AF1A 3OYFA 4WFBL 2RPIA 4CZJA 1BGXT 2UUBK 4GV9A 3IDHA 1K73O 5CY4A 4BC4A 4B1XB 3P4IA 3QMLA 3OYIA 3SI6A 3Q7BA 1ATSA 1RDAA 1JL2A 3ZSWA 1OH6A 3R6MA 4FPAA 4AHCA 1GLFO 5AZIB 2XHBA 4OKEA 3KK1A 2XY8A 1S6PA 4JK7A 2QA4N 1E4FT 3JYTA 2NRRA 1SAZA 2QWPA 5TKWA 3ZCMA 1T44A 3BUZB 1GLEG 1P8ZA 2GWKA 1N36K 4KHYA 4DSEA 3O4QA 4B1WB 4LFCK 4FO0A 3JSMA 2PFUA 3M8SA 4BR0A 4Z4FA 1WLJA 2WBNA 4IO9L 4WQ5A 4R79A 4NCGA 1ITGA 4WF9L 5KPRA 3THWB 4FWNA 3M1FA 3U9DA 3UKUA 3THYA 3OYNA 1RBTA 3F9KA 4RW6A 3KKSA 1Y97A 4KAZA 3CCSN 1XUPO 4HHTA 1JXEA 1HYSA 3U8XA 3OYJA 1TAQA 3CJ7A 5EXWA 3KZBA 4EZ6A 4BROA 3VETA 5GINA 2FSJA 2YHAA 4O55A 2E2NA 1TGOA 2E6MA 3MCPA 3L2UA 4DQQA 2OCEA 4RCHA 1U6ZA 2IC3A 1N33K 2E8AA 3S3NA 4CHZA 4WE1A 4FLUA 2LSNA 1HJRA 3CJ9A 3THXA 1RT3A 1VSHA 4YOTA 5AQIA 3AVCA 4IJNA 3G4SN 2P9KA 4LFBK 3EN9A 2P9PB 4JKHA 4ILHA 3QIOA 4FJLA 4MDBA 2JWLA 2HOEA 4B8AB 3WXIA 4BDZA 3CD6N 3ULDA 4PKIA 4DQIA 4H4MA 4N41A 5AQKA 3VEXA 2F4VK 2EWSA 3CPWM 5AQYA 4ICLA 4M42A 4QS8A 1X9JA 3TSUA 1KRPA 2UXCK 3WEEA 5BREA 4FL9A 1ZBFA 2GEMA 4ISEA 5HROA 2VQEK 1XHXA 4U67L 4C8MA 1YJ9N 4W5NA 2P9SB 3CMAN 2ZF5O 1C0GA 2NRVA 2OPRA 4CEAA 3VQ6A 2QM1A 1NGGA 5AQFA 5HL7L 3T3FA 4E7HA 2RE2A 1U45A 4OPHA 1CLQA 4EFHA 3NF8A 3V9WA 3NCIA 3V6DA 4F2SA 2H3GX 3AAQA 2E20A 1T8EA 4JNEA 4BR5A 4KH4A 1KQSM 1HPZA 5AQWA 3RSEB 2Q2RA 2KW4A 2VWBA 1ZXOA 3HO1A 4BVOA 1WNSA 4DS5A 4DTSA 4IOAL 2HNDA 5T7BA 1K6YA 2HNYA 4XEIA 3MX5A 4I6MA 5BRDA 1J5OA 1KTQA 2Q0RA 3TR8A 3AVIA 4LSNA 4RG8A 3VQBA 4J2EA 1I94K 3LZJA 3W0LA 3T1HK 3FZMA 4FM1A 4GVEA 3ZETA 4FOEA 2YX6A 4JS5A 3H08A 4XH5A
chains in the Genus database with same CATH topology
3ASMA 1HMVA 1TVRA 3KLHA 3OYKA 3TAGA 3HYFA 3THVA 2G8IA 5CZ2A 1RBSA 1QSYA 4CJVA 4KHSA 3D0PA 1L3UA 2RN2A 3S3OA 2B5JA 3DI6A 1LAWA 3DRRA 1W9HA 3M8PA 5KTQA 3TAQA 1SKRA 1VRTA 1A5VA 3AVFA 3PO5A 1WSFA 1WSHA 4KHNA 1RDCA 2YKMA 3ALYA 3OYMA 5FRNA 4LD0A 3SPZA 4CEDA 3RRGA 1IG9A 4FJIA 4Z4EA 3AVHA 1JLBA 3AA5X 4CJLA 3U6FA 1BCMA 4F3OA 1U47A 4ID5A 1IO2A 3AA4A 4OKKA 1D9FA 3A2FA 3DLBA 4EP5A 4MQ3A 4DU4A 4CEBA 3V9UA 1RILA 1GOBA 3AO1A 1NKBA 1RT4A 3KTQA 3LPUA 4DLEA 3NF6A 4FW2A 2YNHA 4IDKA 4CIFA 1KFDA 1XC9A 2KFZA 4HUEA 3TI0A 4DQRA 3C6UA 4HCCA 1SKWA 2BDPA 3CFRA 3SUQA 5HP1A 2G8HA 3L3VA 3B6PA 4I9QA 4Q0BA 1RNHA 4YNQA 3L2WA 5C25A 1HRHA 1RCHA 3U3GA 4DF8A 4QAGA 4JS4A 1SL1A 1RT1A 4B9LA 4DSFA 5HLFA 1UAXA 4CJQA 3AO3A 1SUQA 3VQ4A 4FZZA 3KLGA 1T03A 3PUFA 3SV3A 1RDBA 3OS1A 3V9XA 3AA2A 2P5GA 2HHTA 1FXXA 3O3HA 4HCBA 3S9HA 1TK8A 1RDDA 1T7PA 4C8KA 1LAVA 3CQ8A 3K2PA 3V4IA 4NCAA 4CJTA 1B9FA 4Z4GA 3TAEA 3SCXA 2ATQA 3OYDA 4OPKA 4YFUA 2IOCA 1RT2A 4DTRA 2G8UA 3O4NA 2PYLA 4DQPA 1J53A 1F21A 2A1RA 4KTZA 5K14A 2G8KA 4FZXC 1YTAA 4H4OA 3AV9A 3HSTB 2JGUA 1S1TA 1VSDA 3RMCA 1FKOA 4BDPA 5FRMA 3VQEA 2F8TA 4E7KA 2E4LA 1N5YA 4AHTA 2PY5A 1Z26A 1A5XA 4O44A 3OYHA 4FLTA 4IFVA 4CJEA 1NK7A 1ASWA 3DOLA 4CJFA 3HP6A 1BISA 1ZYQA 1B9DA 3PV8A 3KIOA 2FBVA 1CXQA 1FK9A 1NJXA 1VSIA 4CK3A 3QEVA 4AHRA 3TARA 4J2BA 3CFOA 1LW2A 4CFAA 3I8DA 1C1BA 3I0SA 3LANA 1KFSA 4IBNA 2BANA 1HYVA 3P1GA 4N56A 3DRPA 3V81A 3DMJA 3M8RA 3QEXA 3EY1A 3VQ9A 3ZT4A 4E7LA 3DLHA 4KHQA 1KCFA 1U49A 2P5OA 1MU2A 1RTDA 3MXMA 1RBRA 2JLEA 4KV8A 3VQDA 4C8NA 4UQGA 3KD1E 4KHWA 3DRSA 4KPYA 4IG0A 4CIGA 4DTPA 3DLGA 1BQNA 2OPSA 2ETJA 4CHQA 4ZHRA 1SL2A 4FJ5A 3KLEA 4B9UA 3VN5A 1TL1A 2OA8A 2D0CA 4M41A 1U48A 4OKJA 1G15A 1T05A 3HT3A 3LDSA 1LWEA 1KVCA 2WONA 4CJ4A 4ZTFA 2OZSA 4B9TA 3CM5A 3DM2A 4FLVA 3C94A 4DTNA 1W0HA 5I3UA 4OVLA 3L2QA 1HNVA 4CF2A 3KJVA 2PYJA 3RR8A 3ZSYA 3O3GA 4CK1A 3KK3A 4DFMA 4QCLA 2YNIA 4K8XA 4K8ZA 4C8LA 3NE6A 1ASVA 1TK0A 2D0BA 2KZMA 2F96A 3RRHA 1JLEA 2BE2A 1LWFA 4FLWA 4HVJA 1EXQA 4BWMA 1RTJA 2ZQBA 2Z1JA 4W5QA 3OJSA 1S9EA 4EZ9A 1J54A 2OPQA 4CJ5A 2HVHA 3B6OA 1BCOA 3OYEA 3OVNA 1J9AA 3KKRA 3WNHA 4B9MA 3NFAA 4DSKA 3SUPA 1RTHA 1GOAA 2IGIA 3DLEA 1NKEA 1NOYA 4Z4IA 3T19A 5KRSA 2ITGA 3HPOA 4CHPA 4FLXA 4Y1DA 4M3TA 1BI4A 4GW6A 1NK9A 1CXUA 1RT7A 1YTUA 2O4GA 4DSJA 1LV5A 3AVKA 2FBTA 4FW1A 4OGEA 3ZT2A 1BI4B 4G1QA 3ZSOA 4FJKA 1TL3A 1S9GA 1XI1A 1NKCA 2VG5A 5J1EA 1TAUA 5I42A 4FVMA 1VSJA 4LY7A 3DLKA 3E01A 4M45A 3V1RA 3ZT1A 4KO0A 3L8BA 1KLNA 4FK0A 2QKBA 1JLGA 4CFDA 5EU7A 2FBXA 4W5RA 2YHBA 3ISNC 5HRRA 5HRSA 1NK8A 4FJHA 3HPGA 1D9DA 4AHUA 5J2PA 1ZBHA 2Y1IA 1BIUA 4OGCA 3K57A 4E89A 2W42A 4KRFA 4KB1A 3RTVA 4BE1A 4JRQA 4M3YA 2FC0A 4ELVA 5FROA 4BE2A 1UWBA 4LSLA 4F8RA 3PX4A 3V1OA 3K5OA 3QO9A 4N5SA 4AILC 4PY5A 4DMNA 1R0AA 3PO4A 2OPPA 3SUOA 1RTIA 2IDOA 3NGIA 2XRIA 1U4BA 2G8VA 4CGIA 4FJ9A 4XIUA 1L3TA 4IKFA 4FJMA 3IRXA 3WNFA 3LP0A 2D5RA 1S1XA 3ZSVA 3EZ5A 4FJJA 2E6LA 3BDPA 3AVGA 4FJXA 4B8CA 1YVUA 2X78A 4FJGA 4QOZB 1KVAA 3V9ZA 1NJWA 1C1AA 3IS9A 3ITHA 4E1NA 4Z4HA 2IAJA 3NDKA 3SQ0A 3UIQA 4OPJA 1JLQA 3TWHA 2HHXA 4B3OA 3KLIA 4H8KA 1NK4A 2QK9A 1YT3A 3ZT3A 5E41A 4B9SA 4CHNA 4PQUA 1BIZA 5DMRA 3QETA 1C6VA 4CK2A 1BL3A 1REVA 3VQ5A 3ZSQA 4CIEA 1QSLA 2QXFA 3K5NA 3DOKA 4E19A 4E7JA 4FXDA 5SZTA 1N6QA 3OYBA 3KK2A 3SPYA 4CJUA 1WSJA 3AVNA 4CJWA 1RT6A 4KI6A 2HVIA 5HRPA 2AJQA 3DYAA 1QE1A 1UOCA 3V9SA 3LP1A 3ZSRA 2D0AA 4DSIA 4J2DA 3MEDA 3IG1A 5FDLA 3T1AA 1WN7A 5HRNA 4BDYA 1TV6A 1DLOA 4DU1A 4DTJA 4FLZA 3RMAA 3MEEA 3P5JA 1I3AA 3HPHA 4OLAA 2VWJA 1X9SA 2VG6A 4M3RA 1X9MA 3HJFA 4CJ3A 1Q9YA 3HM9A 4DF4A 1IKWA 1SKSA 2G8FA 1VSLA 2DFHA 4CHOA 3VA0A 1TKDA 4Q5VA 1RBVA 1SV5A 4M3UA 3IAYA 2KQ2A 4KB0A 2R7YA 4DFPA 4DTXA 4CF8A 1D5AA 4BE0A 1QSSA 5JS1A 2RF2A 4NYFA 3VA3A 5HBMA 4L8RB 1NJYA 4MFBA 3MAQA 4NCBA 4BWJA 3ZSXA 2X6NA 1JLFA 3OYCA 3K59A 1SL0A 3LWMA 3BGRA 1ASUA 4CEOA 3LP2A 4FM0A 1JKHA 2IS3A 1VSFA 5KGXA 3SNNA 2X6SA 1S1UA 1IKXA 3AVJA 2PZSA 5KRTA 3QINA 1L3VA 3D45A 2HNZA 4FK4A 4JLHA 3VQCA 3TANA 2P1JA 4DTMA 1VSEA 4O0IA 4DG1A 4CJSA 3QEPA 3MXIA 3QEIA 3NGZA 2ZE2A 4HUGA 4CE9A 3PX6A 1DTTA 4FM2A 3AA3A 1NK6A 3OYFA 1QHTA 2RPIA 4O4GA 1BGXT 4KFBA 1X1PA 5KI6A 4FK2A 5CY4A 2YKNA 3K58A 3SJJA 3OYIA 1KLMA 3SI6A 4LH5A 1RDAA 1LWCA 4KREA 4DLGA 1NK0A 3K5MA 1JL2A 3ZSWA 4CEEA 4CCHA 1WSEA 1I39A 4ID1A 4AHCA 4Z0UA 1Q9XA 3HP9A 2XHBA 3HL8A 4OKEA 3KK1A 2XY8A 2OZMA 1S6PA 1ZBIA 1TKZA 3WNGA 4LH4A 3OYAA 2Z1HA 1CZ9A 3JYTA 1L5UA 4RW4A 5CYMA 1VSMA 4KKOA 3ZCMA 3L2RA 4B9NA 4F2RA 2DTUA 1Q8IA 4KHYA 3HXMA 3CYMA 4DSEA 3O4QA 3OYGA 3RMBA 4W5TA 4CJRA 1XWLA 3JSMA 3OS0A 3TAPA 3ZSZA 3M8SA 4FJ7A 4F3TA 2HW3A 1VRUA 2A1SA 4Z4FA 1HQEA 1QQCA 3NGYA 1ZBLA 4RW7A 4OLBA 1WLJA 4FJ8A 5JS2A 4TSXA 5CYQA 3SYZA 4PWDA 3AVLA 1S6QA 3QIPA 4NCGA 3VQPA 1ITGA 3C6TA 4KI4A 2DFEA 3CFPA 3SQ1A 3TAMA 1RT5A 2F8SA 4DTOA 2YNFA 3AO2A 4PA1A 5C42A 2XY5A 4N76A 1BQMA 2XY6A 3AVMA 1RBTA 2EX3A 3F9KA 3KKSA 3MXJA 4RW6A 3OYNA 5J2NA 1D8YA 1NK5A 1UA0A 3L2VA 4GVMA 3V1QA 4E1MA 1Y97A 5D3GA 3LZIA 4KAZA 1VSKA 1KVBA 1TKXA 4BACA 2KFNA 1HYZA 1LW0A 4NYNA 4HHTA 3LWLA 4ELUA 1JXEA 1HYSA 4I9LA 4IG3A 4O0JA 1QTMA 2GBZA 3OYJA 1BHLA 1TAQA 4CGHA 3C95A 3MECA 1C0MA 3RMDA 3K5LA 3TAFA 4I2PA 1XHZA 3DLRA 4HTUA 1NJZA 3O3FA 3KD5E 4Y1CA 2B6AA 4EZ6A 3HVRA 3NF7A 5KGWA 4FZYA 1S1WA 3SQ4A 3PX0A 1EP4A 1UA1A 4I2QA 1VK0A 2DFFA 1JLCA 3VQAA 2YHAA 3CG7A 4O55A 4EP4A 4Z4CA 1TGOA 2X74A 2BGGA 2E6MA 2HHVA 3L2UA 2I5JA 4DQQA 3FFIA 3RWUA 2IC3A 4R5PA 1EETA 3QNOA 3S3NA 1WAJA 4CFCA 4CHZA 3NHGA 5SWMA 4PUOA 4FYDA 3VQQA 1FKPA 3LAKA 4CGGA 4WE1A 4FLUA 1S5JA 1KSPA 2LSNA 4J2AA 1Z25A 1HJRA 1C0TA 1RBUA 2GV9A 4CFBA 1X9WA 2G8WA 3NF9A 3F73A 1RT3A 4DSLA 1VSHA 1EKEA 1B92A 5DK5A 3VQ8A 2GUIA 4CJPA 3AVCA 3WNEA 4CGFA 4RW9A 5CZ1A 2XO7A 4O5BA 2B4JA 1O1WA 2YNGA 4B08A 2Y1JA 2EHGA 4DFKA 3LAMA 3QIOA 4FJLA 4DU3A 3ZT0A 3NH1A 3AO4A 1CZBA 2KTQA 2HHSA 1QS4A 3OJUA 4B8AB 5J2QA 1IH7A 2HB5A 1A5WA 4CESA 4CGDA 4BDZA 4FCYA 1EX4A 3MEGA 3ULDA 2ZD1A 3SUNA 4DQIA 3OY9A 4H4MA 3SV4A 4IFYA 1JXBA 4CGJA 4N41A 1NOZA 3NAEA 4M3XA 4ICLA 4M42A 2XY7A 3AVBA 2NUBA 1KRPA 3QNNA 3P83D 1DTQA 1HNIA 1C1CA 1JL1A 4ZTJA 3CM6A 1ZBFA 2QKKA 4M3WA 5HROA 4HUFA 1XHXA 3RR7A 4C8MA 4F4KA 4DS4A 4W5NA 4CEFA 2RKIA 2DY4A 4GMJB 3OS2A 3QERA 2P51A 4KHUA 4C8OA 4N47A 4AHVA 4E3SA 3PY8A 1WSGA 4KTWA 3S3MA 3QESA 4CJKA 4JRPA 3KLFA 2OPRA 3QEWA 1GOCA 4I7FA 1HQUA 3M8QA 3QLHA 3VQ6A 4CEAA 4OJRA 4CEZA 3T3FA 4E7HA 1IKVA 3SQ2A 4RW8A 2KZZA 1U45A 2O4IA 4DFJA 1CLQA 4DTUA 4CF9A 3NF8A 3U3YA 3V9WA 3NCIA 3V6DA 3SZ2A 4F2SA 4FJNA 3G10A 1T8EA 4E7IA 3VQ7A 4W5OA 3LP3A 4KTQA 4DWIA 3HVTA 1TK5A 1IKYA 4CF1A 4M3ZA 1HPZA 3NH2A 3LPTA 2HHWA 3AVAA 4CF0A 4CHYA 2Z1IA 2KW4A 2HMIA 4E0DA 2Q3SA 3HO1A 1WNSA 1ZBUA 4DS5A 4DTSA 3EYZA 2HNDA 3G0ZA 5T7BA 4B9VA 1WAFA 1K6YA 2HNYA 3HK2A 3LALA 4AH9A 2YV0X 1WSIA 1C0UA 1J5OA 4AHSA 3NBPA 4CERA 2WOMA 3NH0A 2Z1GA 2OYQA 1KTQA 4FLYA 5J2MA 3AVIA 1U04A 4LSNA 4RG8A 3TR8A 3VQBA 4DQSA 4J2EA 2HHUA 2VG7A 3LZJA 2HHQA 4ELTA 1L3SA 1JLAA 4CECA 1S1VA 4FM1A 2FBYA 4CEQA 3TABA 3I0RA 5C24A 3AO5A 3L3UA 3OYLA 4JS5A 3H08A 2VWKA 1TKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASM A;  1HMV A;  1TVR A;  3KLH A;  3OYK A;  3TAG A;  3HYF A;  3THV A;  2G8I A;  5CZ2 A;  1RBS A;  1QSY A;  4CJV A;  4KHS A;  3D0P A;  1L3U A;  2RN2 A;  3S3O A;  2B5J A;  3DI6 A;  1LAW A;  3DRR A;  1W9H A;  3M8P A;  5KTQ A;  3TAQ A;  1SKR A;  1VRT A;  1A5V A;  3AVF A;  3PO5 A;  1WSF A;  1WSH A;  4KHN A;  1RDC A;  2YKM A;  3ALY A;  3OYM A;  5FRN A;  4LD0 A;  3SPZ A;  4CED A;  3RRG A;  1IG9 A;  4FJI A;  4Z4E A;  3AVH A;  1JLB A;  3AA5 X;  4CJL A;  3U6F A;  1BCM A;  4F3O A;  1U47 A;  4ID5 A;  1IO2 A;  3AA4 A;  4OKK A;  1D9F A;  3A2F A;  3DLB A;  4EP5 A;  4MQ3 A;  4DU4 A;  4CEB A;  3V9U A;  1RIL A;  1GOB A;  3AO1 A;  1NKB A;  1RT4 A;  3KTQ A;  3LPU A;  4DLE A;  3NF6 A;  4FW2 A;  2YNH A;  4IDK A;  4CIF A;  1KFD A;  1XC9 A;  2KFZ A;  4HUE A;  3TI0 A;  4DQR A;  3C6U A;  4HCC A;  1SKW A;  2BDP A;  3CFR A;  3SUQ A;  5HP1 A;  2G8H A;  3L3V A;  3B6P A;  4I9Q A;  4Q0B A;  1RNH A;  4YNQ A;  3L2W A;  5C25 A;  1HRH A;  1RCH A;  3U3G A;  4DF8 A;  4QAG A;  4JS4 A;  1SL1 A;  1RT1 A;  4B9L A;  4DSF A;  5HLF A;  1UAX A;  4CJQ A;  3AO3 A;  1SUQ A;  3VQ4 A;  4FZZ A;  3KLG A;  1T03 A;  3PUF A;  3SV3 A;  1RDB A;  3OS1 A;  3V9X A;  3AA2 A;  2P5G A;  2HHT A;  1FXX A;  3O3H A;  4HCB A;  3S9H A;  1TK8 A;  1RDD A;  1T7P A;  4C8K A;  1LAV A;  3CQ8 A;  3K2P A;  3V4I A;  4NCA A;  4CJT A;  1B9F A;  4Z4G A;  3TAE A;  3SCX A;  2ATQ A;  3OYD A;  4OPK A;  4YFU A;  2IOC A;  1RT2 A;  4DTR A;  2G8U A;  3O4N A;  2PYL A;  4DQP A;  1J53 A;  1F21 A;  2A1R A;  4KTZ A;  5K14 A;  2G8K A;  4FZX C;  1YTA A;  4H4O A;  3AV9 A;  3HST B;  2JGU A;  1S1T A;  1VSD A;  3RMC A;  1FKO A;  4BDP A;  5FRM A;  3VQE A;  2F8T A;  4E7K A;  2E4L A;  1N5Y A;  4AHT A;  2PY5 A;  1Z26 A;  1A5X A;  4O44 A;  3OYH A;  4FLT A;  4IFV A;  4CJE A;  1NK7 A;  1ASW A;  3DOL A;  4CJF A;  3HP6 A;  1BIS A;  1ZYQ A;  1B9D A;  3PV8 A;  3KIO A;  2FBV A;  1CXQ A;  1FK9 A;  1NJX A;  1VSI A;  4CK3 A;  3QEV A;  4AHR A;  3TAR A;  4J2B A;  3CFO A;  1LW2 A;  4CFA A;  3I8D A;  1C1B A;  3I0S A;  3LAN A;  1KFS A;  4IBN A;  2BAN A;  1HYV A;  3P1G A;  4N56 A;  3DRP A;  3V81 A;  3DMJ A;  3M8R A;  3QEX A;  3EY1 A;  3VQ9 A;  3ZT4 A;  4E7L A;  3DLH A;  4KHQ A;  1KCF A;  1U49 A;  2P5O A;  1MU2 A;  1RTD A;  3MXM A;  1RBR A;  2JLE A;  4KV8 A;  3VQD A;  4C8N A;  4UQG A;  3KD1 E;  4KHW A;  3DRS A;  4KPY A;  4IG0 A;  4CIG A;  4DTP A;  3DLG A;  1BQN A;  2OPS A;  2ETJ A;  4CHQ A;  4ZHR A;  1SL2 A;  4FJ5 A;  3KLE A;  4B9U A;  3VN5 A;  1TL1 A;  2OA8 A;  2D0C A;  4M41 A;  1U48 A;  4OKJ A;  1G15 A;  1T05 A;  3HT3 A;  3LDS A;  1LWE A;  1KVC A;  2WON A;  4CJ4 A;  4ZTF A;  2OZS A;  4B9T A;  3CM5 A;  3DM2 A;  4FLV A;  3C94 A;  4DTN A;  1W0H A;  5I3U A;  4OVL A;  3L2Q A;  1HNV A;  4CF2 A;  3KJV A;  2PYJ A;  3RR8 A;  3ZSY A;  3O3G A;  4CK1 A;  3KK3 A;  4DFM A;  4QCL A;  2YNI A;  4K8X A;  4K8Z A;  4C8L A;  3NE6 A;  1ASV A;  1TK0 A;  2D0B A;  2KZM A;  2F96 A;  3RRH A;  1JLE A;  2BE2 A;  1LWF A;  4FLW A;  4HVJ A;  1EXQ A;  4BWM A;  1RTJ A;  2ZQB A;  2Z1J A;  4W5Q A;  3OJS A;  1S9E A;  4EZ9 A;  1J54 A;  2OPQ A;  4CJ5 A;  2HVH A;  3B6O A;  1BCO A;  3OYE A;  3OVN A;  1J9A A;  3KKR A;  3WNH A;  4B9M A;  3NFA A;  4DSK A;  3SUP A;  1RTH A;  1GOA A;  2IGI A;  3DLE A;  1NKE A;  1NOY A;  4Z4I A;  3T19 A;  5KRS A;  2ITG A;  3HPO A;  4CHP A;  4FLX A;  4Y1D A;  4M3T A;  1BI4 A;  4GW6 A;  1NK9 A;  1CXU A;  1RT7 A;  1YTU A;  2O4G A;  4DSJ A;  1LV5 A;  3AVK A;  2FBT A;  4FW1 A;  4OGE A;  3ZT2 A;  1BI4 B;  4G1Q A;  3ZSO A;  4FJK A;  1TL3 A;  1S9G A;  1XI1 A;  1NKC A;  2VG5 A;  5J1E A;  1TAU A;  5I42 A;  4FVM A;  1VSJ A;  4LY7 A;  3DLK A;  3E01 A;  4M45 A;  3V1R A;  3ZT1 A;  4KO0 A;  3L8B A;  1KLN A;  4FK0 A;  2QKB A;  1JLG A;  4CFD A;  5EU7 A;  2FBX A;  4W5R A;  2YHB A;  3ISN C;  5HRR A;  5HRS A;  1NK8 A;  4FJH A;  3HPG A;  1D9D A;  4AHU A;  5J2P A;  1ZBH A;  2Y1I A;  1BIU A;  4OGC A;  3K57 A;  4E89 A;  2W42 A;  4KRF A;  4KB1 A;  3RTV A;  4BE1 A;  4JRQ A;  4M3Y A;  2FC0 A;  4ELV A;  5FRO A;  4BE2 A;  1UWB A;  4LSL A;  4F8R A;  3PX4 A;  3V1O A;  3K5O A;  3QO9 A;  4N5S A;  4AIL C;  4PY5 A;  4DMN A;  1R0A A;  3PO4 A;  2OPP A;  3SUO A;  1RTI A;  2IDO A;  3NGI A;  2XRI A;  1U4B A;  2G8V A;  4CGI A;  4FJ9 A;  4XIU A;  1L3T A;  4IKF A;  4FJM A;  3IRX A;  3WNF A;  3LP0 A;  2D5R A;  1S1X A;  3ZSV A;  3EZ5 A;  4FJJ A;  2E6L A;  3BDP A;  3AVG A;  4FJX A;  4B8C A;  1YVU A;  2X78 A;  4FJG A;  4QOZ B;  1KVA A;  3V9Z A;  1NJW A;  1C1A A;  3IS9 A;  3ITH A;  4E1N A;  4Z4H A;  2IAJ A;  3NDK A;  3SQ0 A;  3UIQ A;  4OPJ A;  1JLQ A;  3TWH A;  2HHX A;  4B3O A;  3KLI A;  4H8K A;  1NK4 A;  2QK9 A;  1YT3 A;  3ZT3 A;  5E41 A;  4B9S A;  4CHN A;  4PQU A;  1BIZ A;  5DMR A;  3QET A;  1C6V A;  4CK2 A;  1BL3 A;  1REV A;  3VQ5 A;  3ZSQ A;  4CIE A;  1QSL A;  2QXF A;  3K5N A;  3DOK A;  4E19 A;  4E7J A;  4FXD A;  5SZT A;  1N6Q A;  3OYB A;  3KK2 A;  3SPY A;  4CJU A;  1WSJ A;  3AVN A;  4CJW A;  1RT6 A;  4KI6 A;  2HVI A;  5HRP A;  2AJQ A;  3DYA A;  1QE1 A;  1UOC A;  3V9S A;  3LP1 A;  3ZSR A;  2D0A A;  4DSI A;  4J2D A;  3MED A;  3IG1 A;  5FDL A;  3T1A A;  1WN7 A;  5HRN A;  4BDY A;  1TV6 A;  1DLO A;  4DU1 A;  4DTJ A;  4FLZ A;  3RMA A;  3MEE A;  3P5J A;  1I3A A;  3HPH A;  4OLA A;  2VWJ A;  1X9S A;  2VG6 A;  4M3R A;  1X9M A;  3HJF A;  4CJ3 A;  1Q9Y A;  3HM9 A;  4DF4 A;  1IKW A;  1SKS A;  2G8F A;  1VSL A;  2DFH A;  4CHO A;  3VA0 A;  1TKD A;  4Q5V A;  1RBV A;  1SV5 A;  4M3U A;  3IAY A;  2KQ2 A;  4KB0 A;  2R7Y A;  4DFP A;  4DTX A;  4CF8 A;  1D5A A;  4BE0 A;  1QSS A;  5JS1 A;  2RF2 A;  4NYF A;  3VA3 A;  5HBM A;  4L8R B;  1NJY A;  4MFB A;  3MAQ A;  4NCB A;  4BWJ A;  3ZSX A;  2X6N A;  1JLF A;  3OYC A;  3K59 A;  1SL0 A;  3LWM A;  3BGR A;  1ASU A;  4CEO A;  3LP2 A;  4FM0 A;  1JKH A;  2IS3 A;  1VSF A;  5KGX A;  3SNN A;  2X6S A;  1S1U A;  1IKX A;  3AVJ A;  2PZS A;  5KRT A;  3QIN A;  1L3V A;  3D45 A;  2HNZ A;  4FK4 A;  4JLH A;  3VQC A;  3TAN A;  2P1J A;  4DTM A;  1VSE A;  4O0I A;  4DG1 A;  4CJS A;  3QEP A;  3MXI A;  3QEI A;  3NGZ A;  2ZE2 A;  4HUG A;  4CE9 A;  3PX6 A;  1DTT A;  4FM2 A;  3AA3 A;  1NK6 A;  3OYF A;  1QHT A;  2RPI A;  4O4G A;  1BGX T;  4KFB A;  1X1P A;  5KI6 A;  4FK2 A;  5CY4 A;  2YKN A;  3K58 A;  3SJJ A;  3OYI A;  1KLM A;  3SI6 A;  4LH5 A;  1RDA A;  1LWC A;  4KRE A;  4DLG A;  1NK0 A;  3K5M A;  1JL2 A;  3ZSW A;  4CEE A;  4CCH A;  1WSE A;  1I39 A;  4ID1 A;  4AHC A;  4Z0U A;  1Q9X A;  3HP9 A;  2XHB A;  3HL8 A;  4OKE A;  3KK1 A;  2XY8 A;  2OZM A;  1S6P A;  1ZBI A;  1TKZ A;  3WNG A;  4LH4 A;  3OYA A;  2Z1H A;  1CZ9 A;  3JYT A;  1L5U A;  4RW4 A;  5CYM A;  1VSM A;  4KKO A;  3ZCM A;  3L2R A;  4B9N A;  4F2R A;  2DTU A;  1Q8I A;  4KHY A;  3HXM A;  3CYM A;  4DSE A;  3O4Q A;  3OYG A;  3RMB A;  4W5T A;  4CJR A;  1XWL A;  3JSM A;  3OS0 A;  3TAP A;  3ZSZ A;  3M8S A;  4FJ7 A;  4F3T A;  2HW3 A;  1VRU A;  2A1S A;  4Z4F A;  1HQE A;  1QQC A;  3NGY A;  1ZBL A;  4RW7 A;  4OLB A;  1WLJ A;  4FJ8 A;  5JS2 A;  4TSX A;  5CYQ A;  3SYZ A;  4PWD A;  3AVL A;  1S6Q A;  3QIP A;  4NCG A;  3VQP A;  1ITG A;  3C6T A;  4KI4 A;  2DFE A;  3CFP A;  3SQ1 A;  3TAM A;  1RT5 A;  2F8S A;  4DTO A;  2YNF A;  3AO2 A;  4PA1 A;  5C42 A;  2XY5 A;  4N76 A;  1BQM A;  2XY6 A;  3AVM A;  1RBT A;  2EX3 A;  3F9K A;  3KKS A;  3MXJ A;  4RW6 A;  3OYN A;  5J2N A;  1D8Y A;  1NK5 A;  1UA0 A;  3L2V A;  4GVM A;  3V1Q A;  4E1M A;  1Y97 A;  5D3G A;  3LZI A;  4KAZ A;  1VSK A;  1KVB A;  1TKX A;  4BAC A;  2KFN A;  1HYZ A;  1LW0 A;  4NYN A;  4HHT A;  3LWL A;  4ELU A;  1JXE A;  1HYS A;  4I9L A;  4IG3 A;  4O0J A;  1QTM A;  2GBZ A;  3OYJ A;  1BHL A;  1TAQ A;  4CGH A;  3C95 A;  3MEC A;  1C0M A;  3RMD A;  3K5L A;  3TAF A;  4I2P A;  1XHZ A;  3DLR A;  4HTU A;  1NJZ A;  3O3F A;  3KD5 E;  4Y1C A;  2B6A A;  4EZ6 A;  3HVR A;  3NF7 A;  5KGW A;  4FZY A;  1S1W A;  3SQ4 A;  3PX0 A;  1EP4 A;  1UA1 A;  4I2Q A;  1VK0 A;  2DFF A;  1JLC A;  3VQA A;  2YHA A;  3CG7 A;  4O55 A;  4EP4 A;  4Z4C A;  1TGO A;  2X74 A;  2BGG A;  2E6M A;  2HHV A;  3L2U A;  2I5J A;  4DQQ A;  3FFI A;  3RWU A;  2IC3 A;  4R5P A;  1EET A;  3QNO A;  3S3N A;  1WAJ A;  4CFC A;  4CHZ A;  3NHG A;  5SWM A;  4PUO A;  4FYD A;  3VQQ A;  1FKP A;  3LAK A;  4CGG A;  4WE1 A;  4FLU A;  1S5J A;  1KSP A;  2LSN A;  4J2A A;  1Z25 A;  1HJR A;  1C0T A;  1RBU A;  2GV9 A;  4CFB A;  1X9W A;  2G8W A;  3NF9 A;  3F73 A;  1RT3 A;  4DSL A;  1VSH A;  1EKE A;  1B92 A;  5DK5 A;  3VQ8 A;  2GUI A;  4CJP A;  3AVC A;  3WNE A;  4CGF A;  4RW9 A;  5CZ1 A;  2XO7 A;  4O5B A;  2B4J A;  1O1W A;  2YNG A;  4B08 A;  2Y1J A;  2EHG A;  4DFK A;  3LAM A;  3QIO A;  4FJL A;  4DU3 A;  3ZT0 A;  3NH1 A;  3AO4 A;  1CZB A;  2KTQ A;  2HHS A;  1QS4 A;  3OJU A;  4B8A B;  5J2Q A;  1IH7 A;  2HB5 A;  1A5W A;  4CES A;  4CGD A;  4BDZ A;  4FCY A;  1EX4 A;  3MEG A;  3ULD A;  2ZD1 A;  3SUN A;  4DQI A;  3OY9 A;  4H4M A;  3SV4 A;  4IFY A;  1JXB A;  4CGJ A;  4N41 A;  1NOZ A;  3NAE A;  4M3X A;  4ICL A;  4M42 A;  2XY7 A;  3AVB A;  2NUB A;  1KRP A;  3QNN A;  3P83 D;  1DTQ A;  1HNI A;  1C1C A;  1JL1 A;  4ZTJ A;  3CM6 A;  1ZBF A;  2QKK A;  4M3W A;  5HRO A;  4HUF A;  1XHX A;  3RR7 A;  4C8M A;  4F4K A;  4DS4 A;  4W5N A;  4CEF A;  2RKI A;  2DY4 A;  4GMJ B;  3OS2 A;  3QER A;  2P51 A;  4KHU A;  4C8O A;  4N47 A;  4AHV A;  4E3S A;  3PY8 A;  1WSG A;  4KTW A;  3S3M A;  3QES A;  4CJK A;  4JRP A;  3KLF A;  2OPR A;  3QEW A;  1GOC A;  4I7F A;  1HQU A;  3M8Q A;  3QLH A;  3VQ6 A;  4CEA A;  4OJR A;  4CEZ A;  3T3F A;  4E7H A;  1IKV A;  3SQ2 A;  4RW8 A;  2KZZ A;  1U45 A;  2O4I A;  4DFJ A;  1CLQ A;  4DTU A;  4CF9 A;  3NF8 A;  3U3Y A;  3V9W A;  3NCI A;  3V6D A;  3SZ2 A;  4F2S A;  4FJN A;  3G10 A;  1T8E A;  4E7I A;  3VQ7 A;  4W5O A;  3LP3 A;  4KTQ A;  4DWI A;  3HVT A;  1TK5 A;  1IKY A;  4CF1 A;  4M3Z A;  1HPZ A;  3NH2 A;  3LPT A;  2HHW A;  3AVA A;  4CF0 A;  4CHY A;  2Z1I A;  2KW4 A;  2HMI A;  4E0D A;  2Q3S A;  3HO1 A;  1WNS A;  1ZBU A;  4DS5 A;  4DTS A;  3EYZ A;  2HND A;  3G0Z A;  5T7B A;  4B9V A;  1WAF A;  1K6Y A;  2HNY A;  3HK2 A;  3LAL A;  4AH9 A;  2YV0 X;  1WSI A;  1C0U A;  1J5O A;  4AHS A;  3NBP A;  4CER A;  2WOM A;  3NH0 A;  2Z1G A;  2OYQ A;  1KTQ A;  4FLY A;  5J2M A;  3AVI A;  1U04 A;  4LSN A;  4RG8 A;  3TR8 A;  3VQB A;  4DQS A;  4J2E A;  2HHU A;  2VG7 A;  3LZJ A;  2HHQ A;  4ELT A;  1L3S A;  1JLA A;  4CEC A;  1S1V A;  4FM1 A;  2FBY A;  4CEQ A;  3TAB A;  3I0R A;  5C24 A;  3AO5 A;  3L3U A;  3OYL A;  4JS5 A;  3H08 A;  2VWK A;  1TKT A; 
#chains in the Genus database with same CATH topology
 3ASM A;  4WFA L;  3EKU A;  3CCE N;  4ILJ A;  2G8I A;  5CZ2 A;  1QSY A;  3HM8 A;  3D0P A;  5AZJ B;  1L3U A;  4ISG A;  4JD2 B;  3S3O A;  1SKR A;  5M1N A;  2ZGZ A;  4IEI A;  1WSF A;  3OW2 M;  2O8C B;  1EQY A;  5F0X A;  3RRG A;  1IG9 A;  4Z4E A;  4H0T B;  4F3O A;  1U47 A;  3ZX2 A;  2FXU A;  1IO2 A;  1D9F A;  5DM7 L;  3DLB A;  4CEB A;  3CJB A;  1Z6R A;  5CR4 A;  1RIL A;  1GOB A;  3UB5 A;  1NKB A;  3CPE A;  4X62 K;  3KTQ A;  3LPU A;  4IDK A;  1KFD A;  2QWM A;  4BC3 A;  2P9I B;  4HUE A;  1XC9 A;  2Q1N A;  1DT9 A;  2O8B A;  2O8E A;  3L3V A;  3OBW A;  4I9Q A;  4M63 C;  4WYB A;  3U3G A;  1T6C A;  1SL1 A;  1VQ7 N;  1E3M A;  5HLF A;  3AO3 A;  4FZZ A;  4FWR A;  3SV3 A;  1RDB A;  3V9X A;  1OH5 A;  1TK8 A;  1RDD A;  1YF5 L;  5E26 A;  1T7P A;  1LAV A;  4C8K A;  3CQ8 A;  4Z4G A;  4IDH A;  4CZG A;  4PWD A;  2PYL A;  4YFU A;  2Q0U A;  5KQD A;  4DTR A;  2O8D B;  2ZWH A;  4KTZ A;  2G8K A;  3AV9 A;  3HST B;  1S1T A;  1QZ6 A;  5FRM A;  3ZX3 A;  2E4L A;  3DXM B;  3O9Q A;  3ZET B;  3A5L C;  4O44 A;  3OYH A;  1NG9 A;  1IV0 A;  1ASW A;  4BG9 A;  2D0P A;  1FW6 A;  1KFS A;  2OAN A;  4IBN A;  3V81 A;  3DMJ A;  3EY1 A;  3ZT4 A;  1U49 A;  2HBM A;  1MU2 A;  4KH5 A;  1RTD A;  3PLA A;  3KK7 A;  5A2Q O;  3DLG A;  4JN4 A;  3VN5 A;  1TL1 A;  2OA8 A;  2D0C A;  2P9N A;  4JHD B;  4M41 A;  4LF9 K;  5H1S Q;  3WXK A;  1G15 A;  3VEN A;  3CM5 A;  4FLV A;  1HNV A;  4CF2 A;  3D2E B;  5LJV A;  3RR8 A;  4QCL A;  5C10 A;  4BRK A;  3NE6 A;  1TK0 A;  2D0B A;  2KZM A;  1Y64 A;  1T3V A;  4FLW A;  2ZQB A;  2Z1J A;  1NGF A;  2O8F A;  5M1P A;  2HVH A;  1BCO A;  1Q81 O;  3D2F B;  4YDU C;  3L0Q A;  1JJ2 M;  4DSK A;  1NKE A;  1GOA A;  2IGI A;  1NOY A;  4CHP A;  4GW6 A;  2P9P A;  3DJC A;  3AVK A;  5E84 A;  1BI4 B;  3C7N B;  1TL3 A;  1E4G T;  4FVM A;  3V1R A;  3U4L A;  4FK0 A;  1EWR A;  2QWL A;  3HPG A;  4AHU A;  5J2P A;  4LF4 K;  4E89 A;  1NGI A;  4KB1 A;  4M3Y A;  3CC7 N;  4BE2 A;  2QWQ A;  3PX4 A;  4AIL C;  2OPP A;  4GKK K;  2IDO A;  1U4B A;  5F2R A;  2XRI A;  4A57 A;  4FJ9 A;  4IKF A;  2D5R A;  3GL1 A;  3BDP A;  1KXP A;  2X78 A;  4QOZ B;  1KVA A;  3V9Z A;  4E1N A;  5F1X A;  1HUX A;  3R8E A;  4NO7 A;  3HTV A;  3TWH A;  2HHX A;  1VQK N;  4B3O A;  2QK9 A;  1YT3 A;  3ZT3 A;  1BIZ A;  5AQL A;  1LOT B;  5M1F A;  3K5N A;  4IOX A;  3EZW A;  4CJU A;  1WSJ A;  3W3D A;  3T7Z A;  4CJW A;  1RT6 A;  4YOX A;  2HVI A;  5GAH P;  3QB0 A;  3LP1 A;  2D0A A;  1Q18 A;  5FDL A;  3RMA A;  3MEE A;  1I3A A;  3HPH A;  3TTF A;  2VCP A;  3I56 N;  2NRH A;  3H3N O;  1KC8 O;  3JAM O;  2DFH A;  1SV5 A;  4DTX A;  4CF8 A;  4BE0 A;  4I6M B;  2D4W A;  5HBM A;  3WEE B;  1N34 K;  4XH1 A;  4NCB A;  4DV0 K;  1MWM A;  1SZ2 A;  1NLV A;  2YJF A;  3OYC A;  1HPM A;  3QDK A;  4E1J A;  1XMQ K;  5M1Q A;  2IS3 A;  1VSF A;  5KGX A;  4B3T K;  3SNN A;  4LF8 K;  3AVJ A;  1L3V A;  3D45 A;  2FSK A;  3GG4 A;  3TAN A;  5HOO A;  1OVQ A;  4DG1 A;  5GIP A;  2ZE2 A;  2O8D A;  3B8A X;  4FM2 A;  3E9P A;  1NK6 A;  1XNQ K;  1QHT A;  4O4G A;  4KFB A;  5KI6 A;  4ILG B;  3SJJ A;  1EWQ A;  4LH5 A;  4DV1 K;  3VGL A;  4CEE A;  4CCH A;  1NBW A;  1Q9X A;  3HL8 A;  3OYA A;  1CZ9 A;  1K9M O;  1TYQ B;  4BRC A;  4RW4 A;  3L2R A;  4A59 A;  1KAX A;  2DTU A;  1Q8I A;  1Z05 A;  4W5T A;  4CJR A;  2QXL A;  4F3T A;  3ATU A;  1QQC A;  3NGY A;  3E9L A;  4TSX A;  3QIP A;  1NGH A;  3TAM A;  5AQX A;  1RT5 A;  3F2K A;  2F8S A;  4DTO A;  2XY5 A;  2GTD A;  1BQM A;  4CBU A;  2XY6 A;  1D8Y A;  3SK3 A;  3K9J A;  5MLC Q;  4CI6 A;  4EAH D;  4BAC A;  1TKX A;  3EE8 A;  3CCJ N;  2KFN A;  1HYZ A;  3LWL A;  4CZE A;  3O5B A;  4O0J A;  3J7A P;  2GBZ A;  3C95 A;  1C0M A;  3RMD A;  3K5L A;  1NJZ A;  4HTU A;  4FWP A;  3HVR A;  1JCG A;  4FZY A;  1S1W A;  3BF1 A;  4K0K K;  4I2Q A;  1VK0 A;  3HZ6 A;  4Z4C A;  3NVK A;  2X74 A;  5JLH A;  3QNO A;  4CFC A;  5BR8 K;  5SWM A;  3VQQ A;  1FKP A;  3LAK A;  5AQZ A;  3CCV N;  1KSP A;  1GLJ O;  1RBU A;  4DR6 K;  1N8R O;  3F73 A;  3VOV A;  4JKA A;  3HSC A;  1X3N A;  1EKE A;  2I7N A;  3HBT A;  2UXD K;  5DK5 A;  3VQ8 A;  5KPT A;  2GUI A;  5BPM A;  3WNE A;  4CGF A;  3CCM N;  3GBT A;  4B08 A;  3D2F A;  2Y1J A;  4Y0W A;  3AAR A;  3VTH A;  3LAM A;  4DFK A;  4DU3 A;  3ZT0 A;  3AO4 A;  1CZB A;  2KTQ A;  2HHS A;  5FPM A;  4CGD A;  4FCY A;  1EX4 A;  4CJ7 A;  2GUP A;  3SUN A;  1VQP N;  3OY9 A;  2NZT A;  3SV4 A;  2NNW A;  1JXB A;  3O08 A;  4NB4 A;  3SJH A;  3PSI A;  3QNN A;  1HNI A;  1C1C A;  2ZJR L;  1ZC6 A;  2PAV A;  4DS4 A;  4CEF A;  2RKI A;  4GMJ B;  2NLX A;  4KHU A;  4C8O A;  4E3S A;  1GLA G;  3PY8 A;  3L4Q A;  3QES A;  4CJK A;  2V7Y A;  4BRN A;  3O4W A;  2VYP A;  1VAZ A;  4DFJ A;  3O8M A;  4CF9 A;  3VGM A;  3U3Y A;  3SZ2 A;  4DUZ K;  3VES A;  3VQ7 A;  3LP3 A;  1S72 N;  4KTQ A;  1WBD A;  1K8K B;  3FZF A;  3SMP A;  1IKY A;  4M3Z A;  3CIP A;  1HJO A;  2A40 A;  2J4R A;  4JKC A;  4CHY A;  2Z1I A;  2HMI A;  4E0D A;  2Q3S A;  1ZBU A;  3EYZ A;  4G9Z A;  3G0Z A;  4B9V A;  1NGJ A;  1WAF A;  4BRL A;  3HK2 A;  4MO5 A;  2YV0 X;  4JKB A;  4DV7 K;  2IIR A;  1C0U A;  4AM6 A;  1QZ5 A;  4K42 A;  2Z1G A;  5J2M A;  3D2E A;  4YY3 K;  2VG7 A;  1JLA A;  2YCH A;  4H0V B;  4PHT X;  4CEQ A;  3OYL A;  3RSE A;  2W6L A;  3ATV A;  1QQN A;  5AZJ A;  1W97 L;  2E88 A;  3HYF A;  4JKG B;  4O8U A;  1LAW A;  5IT9 O;  5JVH L;  5KTQ A;  3CCR N;  3TPQ A;  4B3S K;  4KHN A;  1WSH A;  4JI6 K;  2YKM A;  4DV5 K;  4H03 B;  3VEY A;  3ALY A;  5FRN A;  4FJI A;  1Q82 O;  1JLB A;  4CJL A;  3SBT A;  3A2F A;  3FZK A;  3PSF A;  4DU4 A;  3AO1 A;  1RT4 A;  3QFP A;  4GV6 A;  3TTC A;  2YNH A;  4MDA A;  3CER A;  3BF3 A;  4HCC A;  4A5A A;  3D7E O;  4Z94 A;  3SAH A;  1VQ4 N;  5KPZ A;  5GAD P;  1NJI O;  1ESV A;  2BDP A;  3CFR A;  3SUQ A;  5HP1 A;  2G8H A;  4BRH A;  3VF2 A;  4A61 A;  1RCH A;  1LCU A;  4QAG A;  4JS4 A;  4H5R A;  4B9L A;  1O13 A;  4WCE L;  2QTD A;  1SUQ A;  3VQ4 A;  3KLG A;  1T03 A;  3AA2 A;  2P5G A;  4HCB A;  4L3Q A;  1ATR A;  3K2P A;  3LL3 A;  4NCA A;  1B9F A;  3EKS A;  3TAE A;  4FJK A;  2WTU A;  2IOC A;  1RT2 A;  1J53 A;  1F21 A;  2FF3 B;  3A5N C;  5AQQ A;  2F8T A;  4JI3 K;  1Z26 A;  4FWQ A;  4CJE A;  1NK7 A;  2NRT A;  4QS7 A;  3P31 A;  1ATN A;  1CXQ A;  1VSI A;  4CK3 A;  3I8D A;  3KVG A;  3P1G A;  5LMN K;  3M8R A;  1NGA A;  3VQ9 A;  3DLH A;  1GLB G;  4KV8 A;  4UQG A;  3KD1 E;  3DRS A;  4KPY A;  3BZK A;  4IG0 A;  4CIG A;  5KQ8 A;  1BQN A;  1JCE A;  5GIO A;  4FJ5 A;  3KLE A;  4H0P A;  1VQ5 N;  2UU9 K;  2A5X A;  4X66 K;  4A5B A;  4OO1 J;  5GAE P;  1T05 A;  1LWE A;  1R59 O;  2WON A;  2A41 A;  2QWO A;  4CZH A;  1VQN N;  4OVL A;  1V4T A;  3VMF B;  5FLX O;  1KAY A;  2KHO A;  2YNI A;  4BRI A;  4K8Z A;  5BRH A;  3U9Z A;  5AQJ A;  2WC9 A;  2F96 A;  1JLE A;  4BRP A;  4HVJ A;  4DR1 K;  3OJS A;  4EZ9 A;  2OPQ A;  4CJ5 A;  5AZI A;  3O9S A;  1TYQ A;  4Z4I A;  3HPO A;  4JK8 A;  4H5W A;  4M3T A;  4PL7 A;  1CXU A;  1VQL N;  1NMD A;  4H5N A;  4OGE A;  2E2P A;  5J1E A;  1TAU A;  5I42 A;  4HWI A;  4LY7 A;  3DLK A;  3ZT1 A;  2AA4 A;  3E01 A;  1KLN A;  4K43 A;  3C0B A;  2BTF A;  3JS6 A;  2FBX A;  2YHB A;  1ZBH A;  4OGC A;  2W42 A;  2RHK A;  1D4X A;  2W40 A;  1UWB A;  4JI0 K;  3V1O A;  3QO9 A;  4DMN A;  1R0A A;  5AQS A;  2G8V A;  4CGI A;  4XIU A;  5C15 A;  3EZ5 A;  3MMV A;  1VQO N;  4FJX A;  1YVU A;  4C1N I;  4FJG A;  5TKY A;  1M1K O;  3A8Y A;  3ITH A;  4NLB A;  4Z4H A;  4CD1 A;  3NDK A;  4B9Q A;  3SQ0 A;  3ENO A;  1JLQ A;  2HST A;  1NNE A;  3AGK A;  4H8K A;  4CHN A;  4WQ5 C;  4PQU A;  1X3M A;  5DMR A;  1C6V A;  4CK2 A;  1BL3 A;  1REV A;  3VQ5 A;  1QSL A;  1XMO K;  2V51 B;  3CHW A;  2QXF A;  4B3M K;  3T1Y K;  3L6Q A;  1N6Q A;  3OYB A;  3KK2 A;  4PL8 A;  3E66 A;  3AY9 A;  4FWS A;  3DYA A;  1UOC A;  3V9S A;  4DSI A;  3MED A;  4BDY A;  5AQH A;  1DLO A;  2OTJ N;  4FLZ A;  3P5J A;  4DCH A;  3ULE A;  3HJF A;  3SLC A;  1Q9Y A;  4DV4 K;  4DF4 A;  3CJA A;  1VSL A;  4Q5V A;  2R7Y A;  2RF2 A;  3VA3 A;  3MAQ A;  3ZSX A;  3TSQ A;  1JLF A;  1OKJ A;  3LP2 A;  4FM0 A;  1VQ9 N;  3EO3 A;  3O1B A;  2HBK A;  4IEE A;  4YDU A;  3G25 A;  2Q97 A;  1S1U A;  1P90 A;  3G6E N;  2A6A A;  2NRX A;  2PZS A;  1HLU A;  5KRT A;  2FSN A;  4UY8 O;  3WUH A;  3WQT A;  4CVN E;  4O0I A;  3QEP A;  3MXI A;  1MWK A;  3NGZ A;  3EEQ A;  4HUG A;  4OPA A;  2D0O A;  1IBM K;  3AA3 A;  1TUY A;  2YKN A;  5BR9 A;  1WBB A;  3DAW A;  1KLM A;  4KRE A;  4DLG A;  1HKC A;  3IFR A;  1WSE A;  3VF6 A;  4ID1 A;  1BUP A;  4CZI A;  1BO5 O;  4ISF A;  2W6K A;  2OZM A;  3BEX A;  1L5U A;  2VGM A;  3K9K A;  3J7Y P;  5CYM A;  4B9N A;  4GNI A;  4F2R A;  3MN7 A;  3HXM A;  4FJ7 A;  4JK9 A;  4JYA K;  3ZSZ A;  1Q86 O;  3OTO K;  2A1S A;  1HQE A;  4FJ8 A;  5JS2 A;  5JLF A;  3AVL A;  5AQM A;  3C6T A;  3OBY A;  4DR7 K;  1BDG A;  2WUS A;  4JI7 K;  2YNF A;  3AO2 A;  3GOI A;  4PA1 A;  5C42 A;  3A0I X;  2YHY A;  3G71 N;  3AVM A;  3AGR A;  4BQL A;  1NK5 A;  1UA0 A;  3L2V A;  3V1Q A;  4E1M A;  3LDP A;  5ADX H;  3LZI A;  3LDL A;  1VQ6 N;  4ELU A;  1LW0 A;  4IG3 A;  1NU0 A;  4YOY A;  3MEC A;  2ZM6 K;  1H1V A;  3TAF A;  4C1N K;  4I2P A;  3KD5 E;  3O80 A;  2B6A A;  5KGW A;  2E1Z A;  1EP4 A;  2DFF A;  4EP4 A;  3R9P A;  2BGG A;  4PKG A;  2I5J A;  4O8K A;  4NLC A;  1M90 O;  3RWU A;  4R5P A;  1KAZ A;  1EET A;  3WT0 A;  1WAJ A;  4PUO A;  1Z25 A;  4CFB A;  1X9W A;  2G8W A;  3NF9 A;  4DSL A;  5BPN A;  4NXM K;  3TU5 A;  4BRQ A;  4CJP A;  3MN9 A;  1YIJ N;  3P39 A;  4O5B A;  2B4J A;  2YNG A;  5JVG L;  4H5T A;  5AJ3 K;  3HOS A;  3NH1 A;  4DR5 K;  3H6E A;  3D6R A;  1QS4 A;  4BGA A;  5FPE A;  5J2Q A;  1IH7 A;  2P9U A;  3HRG A;  4IFY A;  1T6D A;  3NAE A;  3THX B;  1JCF A;  4BRM A;  2XY7 A;  2NUB A;  3CQY A;  1DTQ A;  1JL1 A;  3CM6 A;  4KBO A;  1QQM A;  1EO1 A;  5C12 A;  1ZBS A;  5IWA K;  4JI5 K;  2O8B B;  3QER A;  2P51 A;  4JV5 K;  4IFE A;  4AHV A;  1WUA A;  3S3M A;  4JRP A;  3KLF A;  3I33 A;  1GOC A;  2P9N B;  3THW A;  3M8Q A;  4QS9 A;  4CEZ A;  4OJR A;  1SS6 A;  1IKV A;  3SQ2 A;  4RW8 A;  1NM1 A;  2O4I A;  2HBL A;  5AQU A;  4M7Y A;  3BZC A;  3HVT A;  5AQO A;  3BP8 A;  4X65 K;  4CF1 A;  4DHY A;  3OA9 A;  5CHI A;  2QEX N;  3LPT A;  1VQM N;  2HHW A;  3A5O C;  3AVA A;  3Q7C A;  1QVF M;  4MLE A;  3LAL A;  4AH9 A;  5I9E B;  1WSI A;  3MDQ A;  1W2B M;  3NBP A;  4CER A;  1MA9 B;  4FYD A;  4FLY A;  4DQS A;  1U04 A;  5AFU H;  2YHX A;  2HHU A;  2HHQ A;  3GE1 A;  4H0Y B;  1IBL K;  4DKW A;  1RFQ A;  1L3S A;  4CEC A;  2FBY A;  4JKE A;  3TAB A;  3I0R A;  5C24 A;  4DWI A;  1TKT A;  3KLH A;  2HF3 A;  5LMU K;  3TAG A;  3THV A;  4FOI A;  4CJV A;  4KHS A;  1YHQ N;  2F9W A;  2RN2 A;  2B5J A;  1MDU B;  4DUY K;  1W9H A;  3M8P A;  2ASO A;  3CC2 N;  3DLL L;  2O8E B;  4DV2 K;  3SAF A;  4RWT A;  3AVF A;  1QVG M;  3OYM A;  4LD0 A;  3SPZ A;  4CED A;  3ULE B;  4JKF A;  3AVH A;  3R1X A;  3U6F A;  3S41 A;  1IJJ A;  1BCM A;  2A3Z A;  4ID5 A;  3AA4 A;  3SMS A;  4EP5 A;  4MQ3 A;  4CZM A;  3V9U A;  4FW2 A;  4BY9 C;  1NGC A;  2KFZ A;  4DQR A;  4LF6 K;  1NGD A;  4XH4 A;  3CME N;  2NRZ A;  1RNH A;  4YNQ A;  3L2W A;  5C25 A;  1HRH A;  3CF5 L;  4DF8 A;  1BOT O;  4CBX A;  4DSF A;  1UAX A;  4CJQ A;  2F7T A;  3PUF A;  2HHT A;  3O3H A;  5AQP A;  3S9H A;  1G99 A;  3N4Q A;  3V4I A;  3SCX A;  3ZYY X;  4OPK A;  4DQP A;  3WXJ A;  5K14 A;  4FZX C;  4H4O A;  4HTL A;  2JGU A;  1VSD A;  1FKO A;  1N5Y A;  2PY5 A;  4AHT A;  4FLT A;  5BN8 A;  4MO4 A;  1YXQ A;  3DOL A;  3HP6 A;  1BIS A;  3PV8 A;  4A2A A;  3KIO A;  2FBV A;  1FK9 A;  3L4I A;  3ZLJ A;  1YIT N;  3QEV A;  3TAR A;  4J2B A;  1C1B A;  3LDQ A;  3LAN A;  4DR3 K;  1HYV A;  4N56 A;  2CGK A;  4E7L A;  2CH6 A;  4JAX A;  2P5O A;  2CH5 A;  3O6W A;  3MXM A;  1RBR A;  2JLE A;  1HX1 A;  4KHW A;  3KWI A;  1QHA A;  4DTP A;  4DR4 K;  4CHQ A;  3DXM A;  4CW7 B;  4K25 A;  4OX9 K;  2P9L B;  3J81 O;  1U48 A;  4OKJ A;  3CI5 A;  3HT3 A;  1KVC A;  4H0O A;  4ZTF A;  1XQS C;  2OZS A;  3A5M C;  4B9T A;  3DM2 A;  1RDW X;  4DTN A;  1W0H A;  5I3U A;  3L2Q A;  3J7Z O;  3KJV A;  4F9O A;  2PYJ A;  3VEO A;  4DQ8 A;  3ZSY A;  3O3G A;  4CK1 A;  3KK3 A;  4DFM A;  4K8X A;  1K8A O;  1ASV A;  3PIP L;  2VQF K;  3P38 A;  2P9U B;  2ZGY A;  3RRH A;  1LWF A;  3CET A;  1RTJ A;  5B8H A;  4W5Q A;  3AAP A;  1J54 A;  2AP1 A;  3ZEU A;  3OVN A;  3UKR B;  2GEL A;  3KKR A;  3WNH A;  4B9M A;  3SUP A;  1RTH A;  2V52 B;  5KRS A;  2ITG A;  2FF6 A;  3OHR A;  1BI4 A;  1RT7 A;  1YTU A;  2O4G A;  1VHX A;  3WXM B;  4B3R K;  4FW1 A;  5EY4 A;  3ZSO A;  2ITM A;  3TTD A;  1XI1 A;  2VG5 A;  1S22 A;  2E1Y A;  4KO0 A;  3L8B A;  1JLG A;  5EU7 A;  3CCQ N;  1YAG A;  1WOQ A;  4W5R A;  1NK8 A;  1FJG K;  2KZZ A;  2YI1 A;  2Y1I A;  1BIU A;  5AQT A;  2IVP A;  3K57 A;  3FZL A;  4RTF D;  3R3L A;  4BE1 A;  2UXB K;  4JRQ A;  4M7X A;  4ELV A;  5JMV A;  5FRO A;  2P9I A;  2QW9 A;  3QFU A;  5AQN A;  4LF5 K;  4N5S A;  3PO4 A;  3NGI A;  1HR0 K;  1OH8 A;  1L3T A;  3TSP A;  4FJM A;  3IRX A;  3LP0 A;  2GX9 A;  3DXK A;  4B8C A;  5EOY A;  1V4S A;  4YOW A;  3IS9 A;  3UIQ A;  3M6G A;  4YOV A;  5DM6 L;  1CZA N;  1NK4 A;  5E41 A;  4B9S A;  4DV6 K;  3NVM A;  4CIE A;  5AQV A;  4E7J A;  3F9M A;  4E19 A;  4FXD A;  1U2V A;  4BR4 A;  4BC2 A;  1S3X A;  3AVN A;  3EL2 A;  4KI6 A;  3ENH A;  2IVN A;  5AFU A;  2ASM A;  3MX2 A;  1QE1 A;  3F5T A;  3H1V X;  4B1Z A;  3T1A A;  1WN7 A;  5HRN A;  1TV6 A;  2PBD A;  4OLA A;  1XC3 A;  3LM2 A;  1X9S A;  4M3R A;  1X9M A;  3FZH A;  4IOC L;  1IKW A;  1SKS A;  4CHO A;  1TKD A;  1GLC G;  4M3U A;  4JEP A;  4DFP A;  3C6H A;  3J80 O;  2BH1 A;  4BWJ A;  3T69 A;  1NGE A;  3K59 A;  5LL6 Z;  1SL0 A;  3BGR A;  4B1U B;  3ENB A;  2HHH K;  1JKH A;  2HF4 A;  4IXC A;  2GWJ A;  2IVO A;  1NMN A;  2X6S A;  4BR9 A;  4JHD A;  3QIN A;  2HNZ A;  3VER A;  4FK4 A;  4JLH A;  2O8F B;  3LDN A;  2NRW A;  4B1V A;  4CJS A;  3QEI A;  4CZL A;  4U7B A;  4CE9 A;  1DTT A;  3DWL A;  3UE5 A;  4FK2 A;  1X1P A;  3KHY A;  3K58 A;  1U2V B;  1LWC A;  1NK0 A;  3K5M A;  1HNX K;  2V7Z A;  1I39 A;  2WFB A;  4Z0U A;  3HP9 A;  2I7P A;  1YVN A;  4WQ4 C;  1ZBI A;  1TKZ A;  3WNG A;  2KLA A;  4LH4 A;  2Z1H A;  4FPB A;  3UKU B;  4LFA K;  4CD3 A;  1VSM A;  4KKO A;  4AM7 A;  2VGN A;  1C0F A;  3CYM A;  3M5R A;  3OYG A;  3RMB A;  1XWL A;  5BRF A;  3OS0 A;  3TAP A;  5BN9 A;  2HW3 A;  3CCL N;  1VRU A;  1GLD G;  1ZBL A;  4RW7 A;  4OLB A;  2OTL N;  5CYQ A;  3SYZ A;  1S6Q A;  1DKG D;  3VQP A;  4KI4 A;  2DFE A;  3CFP A;  3SQ1 A;  4N76 A;  4KHP K;  3MK6 A;  2D1K A;  2EX3 A;  5J2N A;  3MXJ A;  1NGB A;  4GVM A;  5D3G A;  1DGK N;  3ZX0 A;  1VSK A;  1KVB A;  3CJC A;  3FFK B;  4NYN A;  4MLH A;  3RVC A;  4I9L A;  1QTM A;  3VGK A;  1BHL A;  4CGH A;  1XHZ A;  3DLR A;  3FGU A;  3O3F A;  4Y1C A;  4IWV A;  3NF7 A;  3PX0 A;  3SQ4 A;  1Q7Y O;  2Q36 A;  1UA1 A;  1JLC A;  3VQA A;  3CG7 A;  5M1O A;  2HHV A;  1OVY A;  2QWN A;  2F9T A;  3FFI A;  4C23 A;  5M1K A;  2FLO A;  3NHG A;  3IMX A;  4CGG A;  1S5J A;  4J2A A;  1C0T A;  2GV9 A;  4GY2 B;  1XNR K;  4BQZ A;  1B92 A;  4RW9 A;  5CZ1 A;  2XO7 A;  4LF7 K;  1YJW N;  1O1W A;  2A42 A;  2EHG A;  1RDU A;  2KKZ A;  3OJU A;  2CGL A;  5GAG P;  4BGB A;  2HB5 A;  1A5W A;  1HKG A;  4CES A;  2UUA K;  4IZ9 A;  3MEG A;  2ZD1 A;  4BRF A;  4CGJ A;  5C0Y A;  1NOZ A;  2E2O A;  4M3X A;  5AQG A;  5FPN A;  3C65 A;  3AVB A;  3P83 D;  2JWK A;  4ZTJ A;  2UUC K;  2QKK A;  4M3W A;  3IKM A;  3JXU A;  4HUF A;  1OH7 A;  3RR7 A;  4F4K A;  2DY4 A;  3OS2 A;  4N47 A;  1WSG A;  4KTW A;  4BR7 A;  4BC5 A;  1BG3 A;  4CBW A;  3QEW A;  3MCA B;  4I7F A;  1HQU A;  3QLH A;  4DTU A;  3THY B;  1K8K A;  4LC9 B;  4FJN A;  3G10 A;  4E7I A;  5AR0 A;  3VTI A;  4YHH K;  4W5O A;  5JIC A;  3WXL A;  1TK5 A;  4BR2 A;  3NH2 A;  4CF0 A;  3E9O A;  4X64 K;  3MN6 A;  4JKG A;  3ZEU B;  1J5E K;  2BUP A;  3H46 O;  4AHS A;  4EHU A;  3J8A A;  2ZJP L;  1RGI A;  2WOM A;  3NH0 A;  2OYQ A;  4IJA A;  3FE1 A;  4EHT A;  4ELT A;  2YHW A;  5LY3 A;  3WQU A;  2O8C A;  1VQ8 N;  1YI2 N;  1S1V A;  3AO5 A;  3L3U A;  4DR2 K;  3E1Y A;  2VWK A;  3IUC A;  1HMV A;  1TVR A;  3OYK A;  1RBS A;  4AQY K;  3DI6 A;  3DRR A;  3TAQ A;  4BRG A;  1VRT A;  1A5V A;  3GDQ A;  4JD2 A;  3PO5 A;  2ZJQ L;  1RDC A;  3AA5 X;  3SAG A;  4OKK A;  1BA1 A;  4PKH A;  3VEZ A;  1IBK K;  4DLE A;  3NF6 A;  4CIF A;  4B1Y B;  3TI0 A;  3C6U A;  1SKW A;  2E5L K;  4BG8 A;  3B6P A;  3O9T A;  3VPZ A;  4Q0B A;  5ADX A;  1RT1 A;  3VEW A;  4NXN K;  3OS1 A;  1FXX A;  5C2F A;  3UKR A;  3VEV A;  4CJT A;  2G8U A;  2ATQ A;  3OYD A;  4KB0 A;  1GLL O;  3M3Z A;  3O4N A;  2A1R A;  1YTA A;  1BA0 A;  3RMC A;  4BDP A;  3VQE A;  1YJN N;  4E7K A;  2Q31 A;  3H45 C;  1A5X A;  4FWO A;  4IFV A;  4FSV A;  4CJF A;  1ZYQ A;  1B9D A;  2QI2 A;  1NJX A;  1W7A A;  4AHR A;  3CFO A;  1LW2 A;  4IO8 A;  4CFA A;  3I0S A;  3N4P A;  3O9R A;  2BAN A;  3I8B A;  3DRP A;  4A62 A;  3QEX A;  4KHQ A;  3NMU A;  1KCF A;  4YOR A;  3HOT A;  3VQD A;  4C8N A;  1J6Z A;  3VF4 A;  4K41 A;  2OPS A;  2ETJ A;  4ZHR A;  1SL2 A;  4B9U A;  5AQR A;  1N32 K;  1WB9 A;  3LDS A;  4GKJ K;  4CJ4 A;  1HNZ K;  5C2D A;  3MWP A;  3CXC M;  3K0S A;  3C94 A;  3SBG A;  3C6A A;  4J8F A;  4FWL A;  3CC4 N;  3C7N A;  4C8L A;  4DB3 A;  4JKD A;  3LDO A;  3CQX A;  1IG8 A;  2BE2 A;  1EXQ A;  4BWM A;  1S9E A;  2P9L A;  4CZF A;  2YJE A;  3B6O A;  1YUW A;  3KWG A;  1TUU A;  3OYE A;  3PIO L;  1J9A A;  3MWT A;  3NFA A;  4GV3 A;  3DLE A;  4H5V A;  3T19 A;  4FLX A;  4Y1D A;  3LM9 A;  1NK9 A;  4JI4 K;  1ILY A;  4DSJ A;  1DEJ A;  2HMP A;  3O9U A;  2UYT A;  2FBT A;  1LV5 A;  3ZT2 A;  4G1Q A;  4BVP A;  1S9G A;  4FWM A;  1NKC A;  1VSJ A;  4M45 A;  2QKB A;  5ELZ A;  4CFD A;  4FJH A;  3ISN C;  5HRR A;  5HRS A;  1D9D A;  2QWR A;  2CGJ A;  3ID6 A;  4KRF A;  3RTV A;  2P9S A;  3HI0 A;  4YOU A;  2P9K B;  2FC0 A;  4LSL A;  4F8R A;  3K5O A;  4PY5 A;  3SUO A;  1RTI A;  1HKB A;  4WFN L;  3CCU N;  3WNF A;  1QQO A;  1S1X A;  3ZSV A;  4FJJ A;  4FVU A;  1SQK A;  2E6L A;  3AVG A;  5FPD A;  1NJW A;  1C1A A;  2IAJ A;  4OPJ A;  4FWK A;  4H0X B;  3KLI A;  4BRA A;  3QET A;  4O5F A;  3ZSQ A;  3ID8 A;  3DOK A;  3FR0 A;  5BPL A;  3H3O B;  5SZT A;  3SPY A;  3BY5 A;  3DXK B;  2DPN A;  2AJQ A;  5HRP A;  4BRD A;  5EVZ A;  2HBJ A;  4A2B A;  3H1Q A;  4JI8 K;  3ZSR A;  1NWK A;  4WQ4 A;  4J2D A;  3CJ1 A;  3IG1 A;  3QIC A;  4DU1 A;  4DTJ A;  2E2Q A;  2VWJ A;  2VG6 A;  4CJ3 A;  3HM9 A;  4BRE A;  2G8F A;  3VA0 A;  1RBV A;  3IAY A;  2KQ2 A;  5EX5 A;  4EIA A;  4JI2 K;  5CE3 A;  1D5A A;  4KH6 A;  1QSS A;  4V19 S;  5JS1 A;  4NYF A;  4DV3 K;  4L8R B;  1NJY A;  4MFB A;  5LJW A;  3O1W A;  1HNW K;  2X6N A;  3QBW A;  1BWF O;  3LWM A;  1ASU A;  4CEO A;  4JI1 K;  1KD1 O;  2ASP A;  1IKX A;  3QBX A;  4CZK A;  3EE9 A;  3VQC A;  3FLC O;  2P1J A;  4DTM A;  1VSE A;  1BU6 O;  2W41 A;  3PX6 A;  3I55 N;  3MN5 A;  4AF1 A;  3OYF A;  4WFB L;  2RPI A;  4CZJ A;  1BGX T;  2UUB K;  4GV9 A;  3IDH A;  1K73 O;  5CY4 A;  4BC4 A;  4B1X B;  3P4I A;  3QML A;  3OYI A;  3SI6 A;  3Q7B A;  1ATS A;  1RDA A;  1JL2 A;  3ZSW A;  1OH6 A;  3R6M A;  4FPA A;  4AHC A;  1GLF O;  5AZI B;  2XHB A;  4OKE A;  3KK1 A;  2XY8 A;  1S6P A;  4JK7 A;  2QA4 N;  1E4F T;  3JYT A;  2NRR A;  1SAZ A;  2QWP A;  5TKW A;  3ZCM A;  1T44 A;  3BUZ B;  1GLE G;  1P8Z A;  2GWK A;  1N36 K;  4KHY A;  4DSE A;  3O4Q A;  4B1W B;  4LFC K;  4FO0 A;  3JSM A;  2PFU A;  3M8S A;  4BR0 A;  4Z4F A;  1WLJ A;  2WBN A;  4IO9 L;  4WQ5 A;  4R79 A;  4NCG A;  1ITG A;  4WF9 L;  5KPR A;  3THW B;  4FWN A;  3M1F A;  3U9D A;  3UKU A;  3THY A;  3OYN A;  1RBT A;  3F9K A;  4RW6 A;  3KKS A;  1Y97 A;  4KAZ A;  3CCS N;  1XUP O;  4HHT A;  1JXE A;  1HYS A;  3U8X A;  3OYJ A;  1TAQ A;  3CJ7 A;  5EXW A;  3KZB A;  4EZ6 A;  4BRO A;  3VET A;  5GIN A;  2FSJ A;  2YHA A;  4O55 A;  2E2N A;  1TGO A;  2E6M A;  3MCP A;  3L2U A;  4DQQ A;  2OCE A;  4RCH A;  1U6Z A;  2IC3 A;  1N33 K;  2E8A A;  3S3N A;  4CHZ A;  4WE1 A;  4FLU A;  2LSN A;  1HJR A;  3CJ9 A;  3THX A;  1RT3 A;  1VSH A;  4YOT A;  5AQI A;  3AVC A;  4IJN A;  3G4S N;  2P9K A;  4LFB K;  3EN9 A;  2P9P B;  4JKH A;  4ILH A;  3QIO A;  4FJL A;  4MDB A;  2JWL A;  2HOE A;  4B8A B;  3WXI A;  4BDZ A;  3CD6 N;  3ULD A;  4PKI A;  4DQI A;  4H4M A;  4N41 A;  5AQK A;  3VEX A;  2F4V K;  2EWS A;  3CPW M;  5AQY A;  4ICL A;  4M42 A;  4QS8 A;  1X9J A;  3TSU A;  1KRP A;  2UXC K;  3WEE A;  5BRE A;  4FL9 A;  1ZBF A;  2GEM A;  4ISE A;  5HRO A;  2VQE K;  1XHX A;  4U67 L;  4C8M A;  1YJ9 N;  4W5N A;  2P9S B;  3CMA N;  2ZF5 O;  1C0G A;  2NRV A;  2OPR A;  4CEA A;  3VQ6 A;  2QM1 A;  1NGG A;  5AQF A;  5HL7 L;  3T3F A;  4E7H A;  2RE2 A;  1U45 A;  4OPH A;  1CLQ A;  4EFH A;  3NF8 A;  3V9W A;  3NCI A;  3V6D A;  4F2S A;  2H3G X;  3AAQ A;  2E20 A;  1T8E A;  4JNE A;  4BR5 A;  4KH4 A;  1KQS M;  1HPZ A;  5AQW A;  3RSE B;  2Q2R A;  2KW4 A;  2VWB A;  1ZXO A;  3HO1 A;  4BVO A;  1WNS A;  4DS5 A;  4DTS A;  4IOA L;  2HND A;  5T7B A;  1K6Y A;  2HNY A;  4XEI A;  3MX5 A;  4I6M A;  5BRD A;  1J5O A;  1KTQ A;  2Q0R A;  3TR8 A;  3AVI A;  4LSN A;  4RG8 A;  3VQB A;  4J2E A;  1I94 K;  3LZJ A;  3W0L A;  3T1H K;  3FZM A;  4FM1 A;  4GVE A;  3ZET A;  4FOE A;  2YX6 A;  4JS5 A;  3H08 A;  4XH5 A; 
#chains in the Genus database with same CATH homology
 3ASM A;  1HMV A;  1TVR A;  3KLH A;  3OYK A;  3TAG A;  3HYF A;  3THV A;  2G8I A;  5CZ2 A;  1RBS A;  1QSY A;  4CJV A;  4KHS A;  3D0P A;  1L3U A;  2RN2 A;  3S3O A;  2B5J A;  3DI6 A;  1LAW A;  3DRR A;  1W9H A;  3M8P A;  5KTQ A;  3TAQ A;  1SKR A;  1VRT A;  1A5V A;  3AVF A;  3PO5 A;  1WSF A;  1WSH A;  4KHN A;  1RDC A;  2YKM A;  3ALY A;  3OYM A;  5FRN A;  4LD0 A;  3SPZ A;  4CED A;  3RRG A;  1IG9 A;  4FJI A;  4Z4E A;  3AVH A;  1JLB A;  3AA5 X;  4CJL A;  3U6F A;  1BCM A;  4F3O A;  1U47 A;  4ID5 A;  1IO2 A;  3AA4 A;  4OKK A;  1D9F A;  3A2F A;  3DLB A;  4EP5 A;  4MQ3 A;  4DU4 A;  4CEB A;  3V9U A;  1RIL A;  1GOB A;  3AO1 A;  1NKB A;  1RT4 A;  3KTQ A;  3LPU A;  4DLE A;  3NF6 A;  4FW2 A;  2YNH A;  4IDK A;  4CIF A;  1KFD A;  1XC9 A;  2KFZ A;  4HUE A;  3TI0 A;  4DQR A;  3C6U A;  4HCC A;  1SKW A;  2BDP A;  3CFR A;  3SUQ A;  5HP1 A;  2G8H A;  3L3V A;  3B6P A;  4I9Q A;  4Q0B A;  1RNH A;  4YNQ A;  3L2W A;  5C25 A;  1HRH A;  1RCH A;  3U3G A;  4DF8 A;  4QAG A;  4JS4 A;  1SL1 A;  1RT1 A;  4B9L A;  4DSF A;  5HLF A;  1UAX A;  4CJQ A;  3AO3 A;  1SUQ A;  3VQ4 A;  4FZZ A;  3KLG A;  1T03 A;  3PUF A;  3SV3 A;  1RDB A;  3OS1 A;  3V9X A;  3AA2 A;  2P5G A;  2HHT A;  1FXX A;  3O3H A;  4HCB A;  3S9H A;  1TK8 A;  1RDD A;  1T7P A;  4C8K A;  1LAV A;  3CQ8 A;  3K2P A;  3V4I A;  4NCA A;  4CJT A;  1B9F A;  4Z4G A;  3TAE A;  3SCX A;  2ATQ A;  3OYD A;  4OPK A;  4YFU A;  2IOC A;  1RT2 A;  4DTR A;  2G8U A;  3O4N A;  2PYL A;  4DQP A;  1J53 A;  1F21 A;  2A1R A;  4KTZ A;  5K14 A;  2G8K A;  4FZX C;  1YTA A;  4H4O A;  3AV9 A;  3HST B;  2JGU A;  1S1T A;  1VSD A;  3RMC A;  1FKO A;  4BDP A;  5FRM A;  3VQE A;  2F8T A;  4E7K A;  2E4L A;  1N5Y A;  4AHT A;  2PY5 A;  1Z26 A;  1A5X A;  4O44 A;  3OYH A;  4FLT A;  4IFV A;  4CJE A;  1NK7 A;  1ASW A;  3DOL A;  4CJF A;  3HP6 A;  1BIS A;  1ZYQ A;  1B9D A;  3PV8 A;  3KIO A;  2FBV A;  1CXQ A;  1FK9 A;  1NJX A;  1VSI A;  4CK3 A;  3QEV A;  4AHR A;  3TAR A;  4J2B A;  3CFO A;  1LW2 A;  4CFA A;  3I8D A;  1C1B A;  3I0S A;  3LAN A;  1KFS A;  4IBN A;  2BAN A;  1HYV A;  3P1G A;  4N56 A;  3DRP A;  3V81 A;  3DMJ A;  3M8R A;  3QEX A;  3EY1 A;  3VQ9 A;  3ZT4 A;  4E7L A;  3DLH A;  4KHQ A;  1KCF A;  1U49 A;  2P5O A;  1MU2 A;  1RTD A;  3MXM A;  1RBR A;  2JLE A;  4KV8 A;  3VQD A;  4C8N A;  4UQG A;  3KD1 E;  4KHW A;  3DRS A;  4KPY A;  4IG0 A;  4CIG A;  4DTP A;  3DLG A;  1BQN A;  2OPS A;  2ETJ A;  4CHQ A;  4ZHR A;  1SL2 A;  4FJ5 A;  3KLE A;  4B9U A;  3VN5 A;  1TL1 A;  2OA8 A;  2D0C A;  4M41 A;  1U48 A;  4OKJ A;  1G15 A;  1T05 A;  3HT3 A;  3LDS A;  1LWE A;  1KVC A;  2WON A;  4CJ4 A;  4ZTF A;  2OZS A;  4B9T A;  3CM5 A;  3DM2 A;  4FLV A;  3C94 A;  4DTN A;  1W0H A;  5I3U A;  4OVL A;  3L2Q A;  1HNV A;  4CF2 A;  3KJV A;  2PYJ A;  3RR8 A;  3ZSY A;  3O3G A;  4CK1 A;  3KK3 A;  4DFM A;  4QCL A;  2YNI A;  4K8X A;  4K8Z A;  4C8L A;  3NE6 A;  1ASV A;  1TK0 A;  2D0B A;  2KZM A;  2F96 A;  3RRH A;  1JLE A;  2BE2 A;  1LWF A;  4FLW A;  4HVJ A;  1EXQ A;  4BWM A;  1RTJ A;  2ZQB A;  2Z1J A;  4W5Q A;  3OJS A;  1S9E A;  4EZ9 A;  1J54 A;  2OPQ A;  4CJ5 A;  2HVH A;  3B6O A;  1BCO A;  3OYE A;  3OVN A;  1J9A A;  3KKR A;  3WNH A;  4B9M A;  3NFA A;  4DSK A;  3SUP A;  1RTH A;  1GOA A;  2IGI A;  3DLE A;  1NKE A;  1NOY A;  4Z4I A;  3T19 A;  5KRS A;  2ITG A;  3HPO A;  4CHP A;  4FLX A;  4Y1D A;  4M3T A;  1BI4 A;  4GW6 A;  1NK9 A;  1CXU A;  1RT7 A;  1YTU A;  2O4G A;  4DSJ A;  1LV5 A;  3AVK A;  2FBT A;  4FW1 A;  4OGE A;  3ZT2 A;  1BI4 B;  4G1Q A;  3ZSO A;  4FJK A;  1TL3 A;  1S9G A;  1XI1 A;  1NKC A;  2VG5 A;  5J1E A;  1TAU A;  5I42 A;  4FVM A;  1VSJ A;  4LY7 A;  3DLK A;  3E01 A;  4M45 A;  3V1R A;  3ZT1 A;  4KO0 A;  3L8B A;  1KLN A;  4FK0 A;  2QKB A;  1JLG A;  4CFD A;  5EU7 A;  2FBX A;  4W5R A;  2YHB A;  3ISN C;  5HRR A;  5HRS A;  1NK8 A;  4FJH A;  3HPG A;  1D9D A;  4AHU A;  5J2P A;  1ZBH A;  2Y1I A;  1BIU A;  4OGC A;  3K57 A;  4E89 A;  2W42 A;  4KRF A;  4KB1 A;  3RTV A;  4BE1 A;  4JRQ A;  4M3Y A;  2FC0 A;  4ELV A;  5FRO A;  4BE2 A;  1UWB A;  4LSL A;  4F8R A;  3PX4 A;  3V1O A;  3K5O A;  3QO9 A;  4N5S A;  4AIL C;  4PY5 A;  4DMN A;  1R0A A;  3PO4 A;  2OPP A;  3SUO A;  1RTI A;  2IDO A;  3NGI A;  2XRI A;  1U4B A;  2G8V A;  4CGI A;  4FJ9 A;  4XIU A;  1L3T A;  4IKF A;  4FJM A;  3IRX A;  3WNF A;  3LP0 A;  2D5R A;  1S1X A;  3ZSV A;  3EZ5 A;  4FJJ A;  2E6L A;  3BDP A;  3AVG A;  4FJX A;  4B8C A;  1YVU A;  2X78 A;  4FJG A;  4QOZ B;  1KVA A;  3V9Z A;  1NJW A;  1C1A A;  3IS9 A;  3ITH A;  4E1N A;  4Z4H A;  2IAJ A;  3NDK A;  3SQ0 A;  3UIQ A;  4OPJ A;  1JLQ A;  3TWH A;  2HHX A;  4B3O A;  3KLI A;  4H8K A;  1NK4 A;  2QK9 A;  1YT3 A;  3ZT3 A;  5E41 A;  4B9S A;  4CHN A;  4PQU A;  1BIZ A;  5DMR A;  3QET A;  1C6V A;  4CK2 A;  1BL3 A;  1REV A;  3VQ5 A;  3ZSQ A;  4CIE A;  1QSL A;  2QXF A;  3K5N A;  3DOK A;  4E19 A;  4E7J A;  4FXD A;  5SZT A;  1N6Q A;  3OYB A;  3KK2 A;  3SPY A;  4CJU A;  1WSJ A;  3AVN A;  4CJW A;  1RT6 A;  4KI6 A;  2HVI A;  5HRP A;  2AJQ A;  3DYA A;  1QE1 A;  1UOC A;  3V9S A;  3LP1 A;  3ZSR A;  2D0A A;  4DSI A;  4J2D A;  3MED A;  3IG1 A;  5FDL A;  3T1A A;  1WN7 A;  5HRN A;  4BDY A;  1TV6 A;  1DLO A;  4DU1 A;  4DTJ A;  4FLZ A;  3RMA A;  3MEE A;  3P5J A;  1I3A A;  3HPH A;  4OLA A;  2VWJ A;  1X9S A;  2VG6 A;  4M3R A;  1X9M A;  3HJF A;  4CJ3 A;  1Q9Y A;  3HM9 A;  4DF4 A;  1IKW A;  1SKS A;  2G8F A;  1VSL A;  2DFH A;  4CHO A;  3VA0 A;  1TKD A;  4Q5V A;  1RBV A;  1SV5 A;  4M3U A;  3IAY A;  2KQ2 A;  4KB0 A;  2R7Y A;  4DFP A;  4DTX A;  4CF8 A;  1D5A A;  4BE0 A;  1QSS A;  5JS1 A;  2RF2 A;  4NYF A;  3VA3 A;  5HBM A;  4L8R B;  1NJY A;  4MFB A;  3MAQ A;  4NCB A;  4BWJ A;  3ZSX A;  2X6N A;  1JLF A;  3OYC A;  3K59 A;  1SL0 A;  3LWM A;  3BGR A;  1ASU A;  4CEO A;  3LP2 A;  4FM0 A;  1JKH A;  2IS3 A;  1VSF A;  5KGX A;  3SNN A;  2X6S A;  1S1U A;  1IKX A;  3AVJ A;  2PZS A;  5KRT A;  3QIN A;  1L3V A;  3D45 A;  2HNZ A;  4FK4 A;  4JLH A;  3VQC A;  3TAN A;  2P1J A;  4DTM A;  1VSE A;  4O0I A;  4DG1 A;  4CJS A;  3QEP A;  3MXI A;  3QEI A;  3NGZ A;  2ZE2 A;  4HUG A;  4CE9 A;  3PX6 A;  1DTT A;  4FM2 A;  3AA3 A;  1NK6 A;  3OYF A;  1QHT A;  2RPI A;  4O4G A;  1BGX T;  4KFB A;  1X1P A;  5KI6 A;  4FK2 A;  5CY4 A;  2YKN A;  3K58 A;  3SJJ A;  3OYI A;  1KLM A;  3SI6 A;  4LH5 A;  1RDA A;  1LWC A;  4KRE A;  4DLG A;  1NK0 A;  3K5M A;  1JL2 A;  3ZSW A;  4CEE A;  4CCH A;  1WSE A;  1I39 A;  4ID1 A;  4AHC A;  4Z0U A;  1Q9X A;  3HP9 A;  2XHB A;  3HL8 A;  4OKE A;  3KK1 A;  2XY8 A;  2OZM A;  1S6P A;  1ZBI A;  1TKZ A;  3WNG A;  4LH4 A;  3OYA A;  2Z1H A;  1CZ9 A;  3JYT A;  1L5U A;  4RW4 A;  5CYM A;  1VSM A;  4KKO A;  3ZCM A;  3L2R A;  4B9N A;  4F2R A;  2DTU A;  1Q8I A;  4KHY A;  3HXM A;  3CYM A;  4DSE A;  3O4Q A;  3OYG A;  3RMB A;  4W5T A;  4CJR A;  1XWL A;  3JSM A;  3OS0 A;  3TAP A;  3ZSZ A;  3M8S A;  4FJ7 A;  4F3T A;  2HW3 A;  1VRU A;  2A1S A;  4Z4F A;  1HQE A;  1QQC A;  3NGY A;  1ZBL A;  4RW7 A;  4OLB A;  1WLJ A;  4FJ8 A;  5JS2 A;  4TSX A;  5CYQ A;  3SYZ A;  4PWD A;  3AVL A;  1S6Q A;  3QIP A;  4NCG A;  3VQP A;  1ITG A;  3C6T A;  4KI4 A;  2DFE A;  3CFP A;  3SQ1 A;  3TAM A;  1RT5 A;  2F8S A;  4DTO A;  2YNF A;  3AO2 A;  4PA1 A;  5C42 A;  2XY5 A;  4N76 A;  1BQM A;  2XY6 A;  3AVM A;  1RBT A;  2EX3 A;  3F9K A;  3KKS A;  3MXJ A;  4RW6 A;  3OYN A;  5J2N A;  1D8Y A;  1NK5 A;  1UA0 A;  3L2V A;  4GVM A;  3V1Q A;  4E1M A;  1Y97 A;  5D3G A;  3LZI A;  4KAZ A;  1VSK A;  1KVB A;  1TKX A;  4BAC A;  2KFN A;  1HYZ A;  1LW0 A;  4NYN A;  4HHT A;  3LWL A;  4ELU A;  1JXE A;  1HYS A;  4I9L A;  4IG3 A;  4O0J A;  1QTM A;  2GBZ A;  3OYJ A;  1BHL A;  1TAQ A;  4CGH A;  3C95 A;  3MEC A;  1C0M A;  3RMD A;  3K5L A;  3TAF A;  4I2P A;  1XHZ A;  3DLR A;  4HTU A;  1NJZ A;  3O3F A;  3KD5 E;  4Y1C A;  2B6A A;  4EZ6 A;  3HVR A;  3NF7 A;  5KGW A;  4FZY A;  1S1W A;  3SQ4 A;  3PX0 A;  1EP4 A;  1UA1 A;  4I2Q A;  1VK0 A;  2DFF A;  1JLC A;  3VQA A;  2YHA A;  3CG7 A;  4O55 A;  4EP4 A;  4Z4C A;  1TGO A;  2X74 A;  2BGG A;  2E6M A;  2HHV A;  3L2U A;  2I5J A;  4DQQ A;  3FFI A;  3RWU A;  2IC3 A;  4R5P A;  1EET A;  3QNO A;  3S3N A;  1WAJ A;  4CFC A;  4CHZ A;  3NHG A;  5SWM A;  4PUO A;  4FYD A;  3VQQ A;  1FKP A;  3LAK A;  4CGG A;  4WE1 A;  4FLU A;  1S5J A;  1KSP A;  2LSN A;  4J2A A;  1Z25 A;  1HJR A;  1C0T A;  1RBU A;  2GV9 A;  4CFB A;  1X9W A;  2G8W A;  3NF9 A;  3F73 A;  1RT3 A;  4DSL A;  1VSH A;  1EKE A;  1B92 A;  5DK5 A;  3VQ8 A;  2GUI A;  4CJP A;  3AVC A;  3WNE A;  4CGF A;  4RW9 A;  5CZ1 A;  2XO7 A;  4O5B A;  2B4J A;  1O1W A;  2YNG A;  4B08 A;  2Y1J A;  2EHG A;  4DFK A;  3LAM A;  3QIO A;  4FJL A;  4DU3 A;  3ZT0 A;  3NH1 A;  3AO4 A;  1CZB A;  2KTQ A;  2HHS A;  1QS4 A;  3OJU A;  4B8A B;  5J2Q A;  1IH7 A;  2HB5 A;  1A5W A;  4CES A;  4CGD A;  4BDZ A;  4FCY A;  1EX4 A;  3MEG A;  3ULD A;  2ZD1 A;  3SUN A;  4DQI A;  3OY9 A;  4H4M A;  3SV4 A;  4IFY A;  1JXB A;  4CGJ A;  4N41 A;  1NOZ A;  3NAE A;  4M3X A;  4ICL A;  4M42 A;  2XY7 A;  3AVB A;  2NUB A;  1KRP A;  3QNN A;  3P83 D;  1DTQ A;  1HNI A;  1C1C A;  1JL1 A;  4ZTJ A;  3CM6 A;  1ZBF A;  2QKK A;  4M3W A;  5HRO A;  4HUF A;  1XHX A;  3RR7 A;  4C8M A;  4F4K A;  4DS4 A;  4W5N A;  4CEF A;  2RKI A;  2DY4 A;  4GMJ B;  3OS2 A;  3QER A;  2P51 A;  4KHU A;  4C8O A;  4N47 A;  4AHV A;  4E3S A;  3PY8 A;  1WSG A;  4KTW A;  3S3M A;  3QES A;  4CJK A;  4JRP A;  3KLF A;  2OPR A;  3QEW A;  1GOC A;  4I7F A;  1HQU A;  3M8Q A;  3QLH A;  3VQ6 A;  4CEA A;  4OJR A;  4CEZ A;  3T3F A;  4E7H A;  1IKV A;  3SQ2 A;  4RW8 A;  2KZZ A;  1U45 A;  2O4I A;  4DFJ A;  1CLQ A;  4DTU A;  4CF9 A;  3NF8 A;  3U3Y A;  3V9W A;  3NCI A;  3V6D A;  3SZ2 A;  4F2S A;  4FJN A;  3G10 A;  1T8E A;  4E7I A;  3VQ7 A;  4W5O A;  3LP3 A;  4KTQ A;  4DWI A;  3HVT A;  1TK5 A;  1IKY A;  4CF1 A;  4M3Z A;  1HPZ A;  3NH2 A;  3LPT A;  2HHW A;  3AVA A;  4CF0 A;  4CHY A;  2Z1I A;  2KW4 A;  2HMI A;  4E0D A;  2Q3S A;  3HO1 A;  1WNS A;  1ZBU A;  4DS5 A;  4DTS A;  3EYZ A;  2HND A;  3G0Z A;  5T7B A;  4B9V A;  1WAF A;  1K6Y A;  2HNY A;  3HK2 A;  3LAL A;  4AH9 A;  2YV0 X;  1WSI A;  1C0U A;  1J5O A;  4AHS A;  3NBP A;  4CER A;  2WOM A;  3NH0 A;  2Z1G A;  2OYQ A;  1KTQ A;  4FLY A;  5J2M A;  3AVI A;  1U04 A;  4LSN A;  4RG8 A;  3TR8 A;  3VQB A;  4DQS A;  4J2E A;  2HHU A;  2VG7 A;  3LZJ A;  2HHQ A;  4ELT A;  1L3S A;  1JLA A;  4CEC A;  1S1V A;  4FM1 A;  2FBY A;  4CEQ A;  3TAB A;  3I0R A;  5C24 A;  3AO5 A;  3L3U A;  3OYL A;  4JS5 A;  3H08 A;  2VWK A;  1TKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...