3AA4A

A52v e.coli rnase hi
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
152
structure length
152
Chain Sequence
LKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAVIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease HI
publication title Protein core adaptability: crystal structures of the cavity-filling variants of Escherichia coli RNase HI
pubmed doi rcsb
source organism Escherichia coli
total genus 51
structure length 152
sequence length 152
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3aa4A00
3SQ2A 2OPSA 4M3UA 4I9LA 3DLHA 1CLQA 1HYZA 2IAJA 4MFBA 4KTQA 3WNHA 4AHVA 2JGUA 2LSNA 3AA3A 3ULDA 4NCAA 5JS2A 1NK6A 1BCOA 4NYNA 3QIOA 2A1SA 5HRPA 3LALA 3O3HA 3LWLA 5HROA 3SPZA 3S3MA 1KRPA 4B9VA 3ZSYA 3K57A 3ZSWA 4OKKA 1BL3A 3MXJA 4O5BA 4CJTA 1RTJA 3RR7A 4B3OA 3V9ZA 4QOZB 4O0IA 3P5JA 2G8FA 3V9UA 4CHOA 1S6PA 4BWMA 3PX6A 1IKWA 2P5OA 1HQUA 3RRGA 5DK5A 1WAFA 4DSIA 1VSJA 3L3UA 3S3NA 3O4QA 2WONA 4O4GA 1ASVA 1S1UA 1VSKA 5J1EA 1JKHA 3DRRA 3M8SA 3OYLA 4IG3A 3U3YA 1ZBFA 4OLAA 4I7FA 1WAJA 4KAZA 3NH2A 1WSGA 2KFZA 4OKEA 4DTNA 2I5JA 1UA1A 4Q0BA 2DFHA 2ZQBA 2A1RA 4KV8A 3DOKA 1NOYA 1UAXA 2JLEA 1A5XA 1RTIA 4TSXA 4E19A 4DTOA 1T7PA 3V9WA 3IS9A 4XIUA 1QE1A 2OPPA 3DLGA 3OJSA 1NK7A 3AVIA 1YTAA 4NYFA 1SV5A 3VQBA 2G8KA 1TAUA 1LAWA 3RR8A 4BE2A 3D0PA 1QHTA 4LSNA 1RBRA 4RW7A 3QEPA 3LANA 2B5JA 1JXEA 1NK8A 2FBVA 4H4MA 1EXQA 1S1XA 1EP4A 3DYAA 3QIPA 4CJKA 1GOCA 3RMCA 3AO2A 3UIQA 4Z4FA 3CM6A 3OYMA 3M8PA 3LP0A 4G1QA 1Y97A 4CECA 1ITGA 4FJ5A 5KTQA 3K58A 1IKVA 4RG8A 4F3OA 3NF8A 3ASMA 2OYQA 1TKDA 1K6YA 1L3VA 4IFVA 1REVA 2DFFA 3L2QA 4FLWA 2ETJA 2YNGA 5E41A 4GVMA 4M3ZA 1LWCA 5SWMA 2X78A 4JRPA 1YTUA 1J54A 3T3FA 4PQUA 4FZXC 3OYDA 1HYVA 4BDZA 2XY5A 3K2PA 3QEIA 1NJZA 4FXDA 5I3UA 1KVAA 4BE0A 2VWKA 4DTMA 1Q9XA 3AVBA 4DSKA 4F2RA 5HRNA 3HP6A 4DQIA 4QAGA 1F21A 3KK1A 4FJJA 2HW3A 3CFRA 2QKKA 3I0SA 1XI1A 3HP9A 4DFPA 2FBXA 2YHBA 1BIZA 4CHYA 4FM1A 3AVHA 2XY8A 2IS3A 3L2WA 4HTUA 1U48A 2G8IA 4KHQA 3AO4A 4DTXA 4FK0A 3V4IA 5HLFA 3I8DA 4N5SA 4HVJA 2P51A 3F73A 2VWJA 3PX0A 4EZ9A 4FJ8A 1RCHA 1XC9A 5CY4A 1IO2A 2G8WA 4CEZA 3U3GA 3DLEA 1T03A 1TKXA 2FC0A 4Z4CA 1B92A 4CF2A 4FJLA 2EX3A 1C6VA 2YNIA 3E01A 3S9HA 4IKFA 4AHUA 4OLBA 1C0TA 1U49A 1CXUA 4KHUA 3DM2A 2XHBA 3DLKA 4BWJA 1RNHA 3TARA 3K5LA 4AHTA 4J2AA 2E6LA 2YV0X 2E4LA 2HNYA 1NK0A 3OYNA 1KVCA 4DS5A 2QKBA 4ELUA 3SUQA 1L5UA 2F8TA 4CGDA 2Z1IA 3L2RA 1IKXA 1KTQA 1S1TA 3B6PA 1C1BA 3V9SA 2NUBA 3NE6A 2DTUA 1D9DA 2KTQA 1SUQA 3LPTA 1WSFA 4W5TA 3AO3A 3KLHA 2O4IA 2XRIA 4FLYA 5J2QA 3OYEA 2HHUA 4OGCA 3SV4A 1SL1A 3WNFA 2HVHA 4YNQA 3AA4A 1RT2A 1RT7A 5CYMA 4BDYA 4EP5A 4RW9A 4DQRA 4KHSA 1LWEA 3IG1A 1JLQA 3VQAA 1RT1A 4FYDA 3NH1A 4LY7A 1TKTA 3DLRA 3KLIA 2PY5A 4EZ6A 4B8AB 4IFYA 1KSPA 4KHYA 4H8KA 1BI4A 4Q5VA 3AO5A 1HYSA 1TAQA 1RT6A 4CJ3A 4CHPA 2HMIA 4FJMA 4KRFA 3P83D 1GOBA 1YVUA 4CJSA 1S5JA 1C0UA 4DTJA 4FLVA 4IG0A 3O3GA 2HB5A 4CFAA 4DMNA 4C8KA 3KKRA 3AA2A 4CERA 4FJ9A 2F8SA 5KGXA 2QK9A 3VQ9A 1BIUA 2HHSA 4ICLA 4PA1A 4RW8A 1R0AA 2B4JA 3VN5A 1U04A 3ZSXA 4DTSA 3SQ1A 2OPQA 1S1VA 4M3RA 2HHVA 4UQGA 3AO1A 4DFKA 4CHNA 4O55A 5EU7A 2Z1JA 4QCLA 4CEBA 2G8VA 2GV9A 5DMRA 4HUGA 4JS5A 4KPYA 4Z4GA 4DLEA 1BGXT 3HPGA 4I9QA 3K5OA 3VQ7A 4CGFA 4B08A 4FK4A 4CEEA 4JS4A 1WNSA 3CFPA 1N5YA 2HHTA 4O44A 1VSHA 4R5PA 3FFIA 3SI6A 3DRSA 1J53A 4DQSA 1JLEA 4W5QA 1UA0A 3I0RA 4ELTA 4E1MA 3D45A 1FXXA 2PZSA 4B9NA 3AV9A 3QINA 3OYKA 3C95A 4N41A 2HHQA 2KW4A 1B9FA 3HK2A 5K14A 3OYJA 2DY4A 2W42A 1ZBLA 1B9DA 3SV3A 5C25A 1JLBA 4BDPA 3KD5E 4L8RB 2EHGA 3HVTA 4LSLA 5KRTA 3OYHA 1NJXA 3T1AA 3QO9A 3KJVA 3NF9A 1BCMA 3CG7A 2PYJA 3QEVA 4KI4A 4C8NA 4B9LA 4DFJA 1RT5A 4IBNA 4LD0A 4DFMA 4FZZA 2OPRA 4E7HA 3ZT3A 3CYMA 3RMBA 4F8RA 3MEDA 3HL8A 3TI0A 4NCGA 3EY1A 3HM9A 1VSMA 2E6MA 4CGHA 3KLEA 5FRMA 4E89A 2OZSA 4DF8A 1XWLA 2GBZA 2HNDA 4FLZA 2Y1IA 4DG1A 1WSIA 3M8RA 2HNZA 4CEFA 4DQQA 3MXIA 2OA8A 3LP2A 4CK1A 5SZTA 3QESA 2YNFA 3L2VA 3PV8A 4FCYA 2IC3A 3ZSZA 3BGRA 1LW0A 1MU2A 1BQMA 3C94A 4FW2A 2Z1HA 3S3OA 4HHTA 4DLGA 4B8CA 3KLFA 2BGGA 4NCBA 3WNEA 3AVCA 4CJEA 1RT3A 3HXMA 4OVLA 3QEXA 4M45A 1EX4A 1NK4A 5HBMA 4CJRA 4N76A 3TAGA 3AVGA 1TK0A 3SPYA 4KI6A 1LW2A 5FDLA 3NF6A 2RKIA 1KFDA 1O1WA 4CF0A 2P1JA 3KD1E 1VSLA 1QS4A 3DRPA 1JLFA 1QTMA 1TL1A 4C8MA 4DU1A 1X9SA 4CJFA 4CIGA 1W0HA 4OPJA 1RDBA 1TVRA 2FBYA 4K8XA 1BI4B 1IG9A 1TK8A 3PY8A 1ZYQA 1QSSA 1A5VA 1NKEA 1LWFA 1WN7A 2D0BA 3O3FA 2G8HA 4I2QA 4KB0A 4FLXA 3QERA 3AVLA 2R7YA 3G0ZA 3SUOA 4CJ5A 4KREA 4Z4HA 4KHWA 4CF8A 3OY9A 1I3AA 1X1PA 2WOMA 5CYQA 1HNVA 4KTZA 4Y1DA 3SNNA 3VQ8A 2VG7A 2YKMA 3NBPA 3A2FA 4CGIA 4CJQA 4OKJA 1JL1A 1ASUA 2XY7A 1ZBUA 1HQEA 1JXBA 1S9EA 4CHZA 1VSIA 2HHXA 3WNGA 4FJHA 4Z4EA 3KTQA 4ZTFA 3V9XA 5I42A 3VQ5A 3VQ6A 4CJ4A 4YFUA 1T8EA 1D8YA 3ZT1A 3SZ2A 4E7KA 2B6AA 3OYIA 3LZJA 3K59A 3HPOA 5D3GA 3LPUA 4FJXA 4CFCA 1Q9YA 4E7JA 1HRHA 4FVMA 2RN2A 3IRXA 4DF4A 3PO5A 4K8ZA 3VQDA 4M42A 4Z0UA 4F3TA 3KIOA 2ZE2A 4BACA 1QSLA 3VQQA 1CZ9A 4DU4A 1LAVA 5FROA 5C24A 2X6SA 1L3TA 3OYAA 3F9KA 1VSDA 3RWUA 3QNNA 4CFBA 4E7IA 4KHNA 4M41A 4AHSA 3V1QA 4CGGA 3NDKA 1SL0A 4DSLA 4E0DA 4F2SA 3LDSA 3LAKA 1JLCA 3QLHA 1L3SA 3RRHA 3RMDA 4J2BA 3HJFA 3DOLA 4KO0A 4AILC 1J5OA 5KRSA 1BQNA 1JL2A 3ITHA 3O4NA 1VSEA 3HT3A 1FK9A 2IGIA 2Q3SA 3RTVA 4E7LA 1HPZA 3H08A 4Y1CA 4CGJA 3TABA 3SCXA 3MEGA 4CESA 1XHZA 1KLNA 2X6NA 1TL3A 2X74A 1UOCA 1TKZA 3LZIA 1XHXA 4O0JA 5HRRA 3OYBA 3QEWA 4I2PA 1ZBIA 3AVMA 2Z1GA 3C6UA 3U6FA 1KLMA 4HUEA 2HHWA 2QXFA 3P1GA 4DWIA 3DI6A 4KFBA 3ZSQA 4M3TA 4DSEA 2D5RA 3HO1A 4CJWA 3MECA 4Z4IA 1CZBA 1RBTA 3L8BA 3CQ8A 1TV6A 3KK2A 1QSYA 3TAMA 4DQPA 3M8QA 3MEEA 1WSEA 4CJPA 3NGZA 3HVRA 3K5MA 2BANA 5JS1A 3PO4A 3SUPA 3PUFA 2KZZA 5J2PA 4FJIA 3OS0A 4J2DA 4CHQA 1RBVA 3ZT2A 2D0CA 3NGYA 3B6OA 4KB1A 1UWBA 1WSHA 3V1RA 4F4KA 4FLTA 4W5NA 1RDAA 4N47A 1KCFA 3V81A 3MXMA 1ZBHA 2AJQA 4DSFA 2ATQA 4CF1A 1KVBA 4JRQA 4B9TA 3HPHA 4CFDA 3TWHA 2IDOA 4FJNA 2FBTA 3NAEA 1NKCA 4CF9A 4CE9A 1S9GA 1VSFA 3TAQA 2KFNA 3IAYA 1SKWA 3L3VA 3ZSVA 4CIFA 4DU3A 3OVNA 5CZ2A 4CEDA 1EKEA 3AVAA 1VK0A 1SL2A 3TANA 3OYGA 2KQ2A 4DSJA 1TGOA 4PWDA 1RDDA 4ELVA 3VA0A 2RF2A 1RDCA 3SQ0A 3SYZA 3ZT0A 1L3UA 1J9AA 3ZSRA 4E3SA 4M3YA 2O4GA 4ID1A 3SUNA 1SKRA 3CM5A 1X9WA 2RPIA 3DMJA 4CK3A 4FZYA 3L2UA 3PX4A 3LWMA 1Q8IA 4BE1A 1JLGA 4FM0A 1D9FA 4CEQA 1NK9A 1FKOA 1KFSA 3AVKA 1EETA 4MQ3A 4GMJB 4DTPA 1NOZA 1T05A 4C8OA 1C1CA 1QQCA 4AH9A 1NJYA 1LV5A 5T7BA 4KTWA 5KI6A 5C42A 3ZSOA 1IKYA 1DTQA 1HNIA 3RMAA 4CK2A 4B9SA 3TAFA 4WE1A 4AHRA 2YKNA 3HYFA 2G8UA 3KKSA 3KLGA 4HCCA 3HSTB 2DFEA 3VQEA 3LAMA 4CEOA 3TAPA 3JSMA 4CJUA 3G10A 1HJRA 5HRSA 4ZHRA 2HVIA 3NGIA 1GOAA 3NCIA 4DTRA 1Z26A 1U4BA 2F96A 4LH5A 3ZT4A 1X9MA 3VQ4A 4CEAA 3AVJA 1DTTA 1C1AA 1RBSA 1S6QA 1S1WA 4IDKA 4KKOA 4OGEA 4N56A 4E1NA 3NHGA 1BISA 1VRUA 4CIEA 2BDPA 4LH4A 4H4OA 3VQCA 3AVNA 1NK5A 3NF7A 4AHCA 1NKBA 3V1OA 1RILA 4OJRA 1N6QA 4FW1A 3TAEA 1WSJA 1SKSA 4B9UA 1I39A 3JYTA 3K5NA 3KK3A 1U47A 3THVA 3LP3A 2OZMA 3CFOA 4RW4A 2YHAA 3V6DA 1C0MA 2BE2A 3ALYA 3OS1A 3OYCA 2YNHA 5KGWA 3NH0A 3OYFA 4ID5A 2D0AA 4FJGA 5HP1A 3SJJA 2ZD1A 3OJUA 3LP1A 3EYZA 1HMVA 3BDPA 1U45A 1RTDA 2XO7A 4FJ7A 2XY6A 2VG5A 3T19A 3MAQA 4J2EA 3EZ5A 1ASWA 1CXQA 5J2NA 4PY5A 1A5WA 3AA5X 1RT4A 1YT3A 4CJLA 4FK2A 2Y1JA 1Z25A 1TK5A 4HCBA 3OS2A 1DLOA 2ITGA 4OPKA 4CCHA 4FM2A 4DS4A 1D5AA 4JLHA 1BHLA 1RTHA 1JLAA 4C8LA 3QNOA 3VA3A 2P5GA 4M3XA 1IH7A 4W5RA 3SQ4A 3ZCMA 5FRNA 5J2MA 3NFAA 2PYLA 3C6TA 2GUIA 1WLJA 4FJKA 3TR8A 1FKPA 4B9MA 1G15A 2IOCA 1VRTA 3AVFA 4DTUA 4ZTJA 4M3WA 3ISNC 4EP4A 2KZMA 4HUFA 4GW6A 1NJWA 3VQPA 4W5OA 5CZ1A 4PUOA 3QETA 1W9HA 3DLBA 4CJVA 4FLUA 1RBUA 4RW6A 2VG6A
chains in the Genus database with same CATH superfamily
3CD6N 4JI2K 1T3VA 2P9UB 4DV3K 3SJHA 2NRVA 2A6AA 3QIOA 5HRPA 3LALA 3NVKA 3SPZA 1N34K 4OKKA 3MXJA 4O5BA 4CJTA 1RTJA 2A41A 3WXIA 2G8FA 4YOYA 4CHOA 1S6PA 2UUCK 3PX6A 2CH5A 4JK7A 3A5MC 5DK5A 3L3UA 3G25A 4U67L 1ASVA 4RWTA 3M8SA 3OYLA 4C23A 3NH2A 3AARA 1K73O 3CCMN 1UAXA 3VTHA 3E9OA 5BPLA 4JI0K 5AQLA 1NGFA 2EWSA 3DLGA 3OJSA 3VEVA 1SV5A 1LAWA 1U2VB 3RR8A 3QEPA 4LSNA 1NK8A 3SBTA 1HNZK 3DYAA 1R59O 2CGKA 1GOCA 3UIQA 1Y64A 4Y0WA 3LP0A 4G9ZA 3K58A 4DUYK 4RG8A 3TSPA 4F3OA 1BU6O 2DFFA 3BY5A 5AQMA 2X78A 1J54A 4FZXC 2JWKA 3THWB 2JWLA 2XY5A 4BG9A 2Q0UA 1NJZA 5AZJA 4DTMA 4DSKA 3KK7A 2E2OA 3KK1A 1F21A 3FZHA 4FJJA 2QKKA 3I0SA 3HP9A 1NMDA 4DFPA 3IUCA 2YHBA 4JEPA 4CHYA 4FM1A 3SAFA 2QA4N 4KHQA 4FK0A 3V4IA 3I8DA 4N5SA 4H0XB 5A2QO 2VWJA 3HRGA 1HPMA 3VEXA 1GLLO 5EY4A 1RCHA 4FWRA 4E1JA 3U3GA 1T03A 2FC0A 4H03B 4H5WA 4Z4CA 1B92A 2EX3A 2YNIA 3MN6A 1YJNN 1C0TA 1CXUA 4BWJA 1RNHA 4AHTA 4H0OA 3OYNA 4IEEA 4A2BA 2F8TA 2Z1IA 2ZWHA 1KTQA 3MK6A 4B1VA 3ENBA 4BGAA 4BQZA 2NUBA 3NE6A 1D9DA 4DV2K 2WUSA 3LPTA 3OA9A 2P9SB 4YOVA 1S3XA 3I55N 3WNFA 4YNQA 3AA4A 3SAHA 4IWVA 1OH5A 4B1ZA 1LWEA 1Q82O 3NH1A 4LY7A 3U8XA 3DLRA 1NGAA 3HOSA 1BA1A 1TAQA 4KRFA 4CJ3A 3MWPA 1GOBA 4CJSA 1S5JA 5BPNA 1C0UA 4DTJA 5FPMA 1KXPA 3O3GA 3KKRA 3AA2A 3EKSA 2QK9A 5AQUA 2HHSA 5AZIB 5BPMA 4LFAK 1NGBA 4ICLA 3T1HK 1QQNA 3SLCA 4ILHA 4M3RA 2HHVA 3AO1A 1RFQA 4BR4A 4LF9K 4O55A 4QCLA 4CEBA 5GAEP 2G8VA 4BVPA 4EAHD 4Z4GA 3K5OA 3VQ7A 4B08A 5IT9O 2HF4A 2P9LA 3EEQA 4XEIA 3SI6A 3DRSA 1J53A 4DQSA 4GV6A 3IDHA 1FXXA 5GIOA 4N41A 2KW4A 2W42A 5BR8K 1ZBLA 3N4QA 3UE5A 4BDPA 2EHGA 5KRTA 1WB9A 5M1QA 2PYJA 2OTJN 4DFJA 1N32K 3ZT3A 1IV0A 1JCGA 4NCGA 1MA9B 4A57A 1BO5O 4B1YB 4E89A 4HTLA 1WUAA 3M8RA 3P39A 1NMNA 3O80A 4HHTA 4JKAA 2UXDK 2E2NA 4CJEA 4JAXA 1EX4A 5HBMA 1YITN 4DR6K 3TAGA 3SPYA 3ID8A 4JKHA 1O1WA 1XMQK 2E2QA 2D0OA 3VGKA 4IO8A 1TVRA 1BI4B 4FWSA 1QZ6A 3CJCA 3O3FA 3QERA 1ZC6A 4CZKA 3J80O 2R7YA 3SUOA 3TU5A 4KHWA 3CIPA 2WOMA 3SNNA 1VQ4N 3H46O 2A5XA 3VQ8A 2VG7A 2YKMA 2W40A 3R6MA 2J4RA 4WF9L 1U2VA 2QI2A 2NRHA 1JL1A 4CHZA 3EE8A 2A40A 4IOXA 3EL2A 2H3GX 1T8EA 3A8YA 3ZT1A 3SZ2A 2RE2A 3LZJA 3HPOA 5D3GA 1SS6A 4FVMA 2O8EB 4M42A 3P31A 2ZE2A 4ILGB 5FROA 3CPEA 3C0BA 2VGMA 3RWUA 3V1QA 1E4GT 4DSLA 3NDKA 1L3SA 3QLHA 3RMDA 4J2BA 4AILC 4BRIA 3M1FA 2YJEA 1VSEA 5M1FA 3J7ZO 2IGIA 4E7LA 1HPZA 3TABA 3VEOA 4DHYA 3U9ZA 3SMPA 1XHZA 4I2PA 3CCRN 5C15A 2FF6A 2Z1GA 2NRZA 3C6UA 1KLMA 3GDQA 2QXFA 5FPDA 4DWIA 3ZSQA 3MECA 3A0IX 3QB0A 3LDOA 3TAMA 4IZ9A 3MEEA 3W0LA 5JS1A 4FJIA 4H5NA 4J2DA 1RBVA 1ZXOA 2P9SA 3V1RA 1WSHA 5AQNA 5C2DA 3HI0A 1RDAA 4N47A 1KCFA 4B9QA 3V81A 3FFKB 5F2RA 4B3SK 3BUZB 3TWHA 4FJNA 3NAEA 1VSFA 1SKWA 3L3VA 5CZ2A 3AVAA 3AAPA 3OYGA 2KQ2A 1TGOA 4OO1J 2NLXA 4ELVA 3VA0A 4PKGA 3SQ0A 5BREA 3CC4N 4FOEA 3ZSRA 5JMVA 4E3SA 2O4GA 4ID1A 1X3NA 5AZIA 1JCFA 1I94K 2RPIA 1H1VA 3L2UA 1P90A 1Q8IA 4EHTA 1JLGA 2IVOA 4BE1A 1KFSA 1NOZA 2V52B 2GELA 2P5OA 3G71N 1DTQA 3VGMA 4B9SA 4WE1A 4BRKA 2FSNA 1QQOA 4BRLA 2ASMA 3KKSA 3A5NC 2ZM6K 3TAPA 4A59A 3NCIA 4CVNE 3VQ4A 5BRDA 4OGEA 2FSJA 1OVYA 3O6WA 3QBWA 4CIEA 2BDPA 4DCHA 4H4OA 2NRTA 3AVNA 3NF7A 4DR4K 4IO9L 3J7AP 1N6QA 4FW1A 5AQRA 4JNEA 3O9RA 4B9UA 4CZFA 3LP3A 2OZMA 1OKJA 4YDUC 3V6DA 1DEJA 2YJFA 5FLXO 3OYCA 2ZF5O 4IJAA 3ID6A 3AY9A 2D0AA 5HP1A 3LP1A 3VGLA 1HMVA 1GLBG 2HVIA 3L6QA 3EZ5A 1CXQA 4HCBA 3J8AA 2F9TA 2ITGA 3QICA 1GLEG 4OPKA 1U6ZA 4FM2A 1WBBA 4CCHA 4YORA 4DS4A 1RTHA 1JLAA 5H1SQ 3QNOA 2ZJPL 4JI7K 2QWOA 3OHRA 1VRTA 4JN4A 2V7ZA 3VQPA 4W5OA 5CZ1A 5F0XA 3DLBA 4CJVA 4FLUA 2HBKA 1IBLK 4LF8K 2IVPA 5HOOA 4MFBA 4A61A 3WNHA 4AHVA 1GLAG 1BCOA 3O08A 3T69A 4BRGA 2A1SA 1YHQN 3O3HA 3S3MA 3C7NB 3K57A 3UB5A 1BL3A 1IG8A 4B3OA 3RR7A 3ZX3A 3P5JA 3D2EA 4BWMA 3O1BA 1HQUA 2QWRA 3RRGA 1WAFA 1VQ6N 1XNQK 2AP1A 1JCEA 4BR2A 1VSKA 1XC3A 1X9JA 1JKHA 3DRRA 4IG3A 1ZBFA 3ZYYX 4OLAA 3EKUA 4I7FA 2PBDA 4H0TB 4OKEA 4DTNA 5JVGL 2A1RA 4KV8A 2OCEA 2JLEA 4E19A 4TSXA 2GWJA 4I6MA 4XIUA 2HMPA 5CE3A 5TKWA 1NK7A 3VQBA 2G8KA 2O8EA 2GTDA 1QHTA 1JXEA 3SBGA 3QBXA 2FBVA 4LF6K 4H4MA 1EXQA 3AO2A 3CM6A 3O9SA 4FJ5A 1Y97A 3NMUA 1TUYA 1TKDA 1K6YA 3GOIA 3O8MA 3T1YK 1NGDA 1REVA 1NM1A 3DXKB 2CGLA 5E41A 4LFBK 5LL6Z 2KKZA 5SWMA 3VMFB 4JRPA 1QHAA 3OYDA 1HYVA 3K2PA 2A42A 1NGIA 3K9JA 4XH5A 1YAGA 1GLJO 4DQIA 2HW3A 3U4LA 4DV6K 1OH8A 4BR9A 2G8IA 1U48A 4HTUA 4X65K 3AO4A 3EO3A 2Q36A 4EZ9A 4B1XB 3F73A 3E1YA 1KAZA 1JJ2M 2E88A 5CY4A 4BVOA 1BOTO 3DLEA 4KH5A 4EIAA 4CF2A 3E01A 3CCLN 4IKFA 4AHUA 4OLBA 1W2BM 1Q81O 1V4TA 3TARA 3K5LA 4KH4A 2YV0X 2E4LA 4DS5A 3SUQA 3JS6A 2YCHA 3L2RA 4OPAA 5B8HA 1VQLN 5EX5A 4JI5K 2E20A 2KTQA 2O4IA 4FLYA 4OGCA 2ITMA 1K8KB 4X64K 5CYMA 4BDYA 3MCPA 4M7XA 4DQRA 2HBJA 2WTUA 1RT1A 2PY5A 4B8AB 4CBXA 1KSPA 4KHYA 4H8KA 3BF1A 4Q5VA 2HMIA 4YDUA 1YVUA 3CCQN 2YHWA 4DMNA 5FPEA 2F8SA 4CERA 4FJ9A 3VTIA 4EFHA 2Q2RA 2B4JA 4C1NI 4XH1A 5E84A 4B3MK 4X66K 1NWKA 1U04A 3ZSXA 2OPQA 3IMXA 4UQGA 3WEEB 2Z1JA 4H0PA 4HUGA 5TKYA 4KPYA 4DLEA 1XUPO 3HPGA 4MO4A 4I9QA 2NRXA 2E5LK 4FK4A 1QZ5A 3JAMO 1N5YA 4PHTX 3E9LA 3FFIA 5ADXH 3CQYA 1Z6RA 4J8FA 3O4WA 3OYKA 3HK2A 3SV3A 5E26A 4L8RB 3T1AA 4LC9B 1BCMA 3IKMA 4C8NA 1QVFM 3MCAB 5M1KA 3CYMA 3CJBA 3HL8A 3ENHA 1VSMA 3KLEA 3W3DA 5FRMA 5AQPA 1G99A 2FF3B 4L3QA 2Y1IA 3FE1A 4CEFA 3LP2A 5AQQA 3PV8A 4PL7A 2IC3A 3ZSZA 1MU2A 3CXCM 1IBMK 3QDKA 4NCBA 1VQMN 3HXMA 1RT3A 2VQFK 4CJRA 2PFUA 4N76A 3GE1A 3AVGA 1TK0A 4KI6A 5FDLA 1KFDA 2RKIA 4LF4K 3T7ZA 4CW7B 1QTMA 1TL1A 2Q97A 1RDBA 3H6EA 4K8XA 5GAGP 1ZYQA 1QSSA 1A5VA 1KQSM 1NKEA 1WN7A 4KB0A 2QTDA 3LDPA 5C12A 1MWMA 5DM7L 3G0ZA 1NGJA 4CJ5A 4Z4HA 3CCUN 5AFUA 1X1PA 2W6LA 5AQFA 3NBPA 4K41A 2O8CB 4CGIA 4CJQA 4WQ5C 1IJJA 1VSIA 3WNGA 4FPBA 3V9XA 1DKGD 3LDLA 3VQ6A 3VOVA 4E7KA 3F2KA 5MLCQ 5AQZA 3DXKA 3VF2A 4E7JA 5BRFA 3CJ9A 4Z0UA 3KIOA 5GINA 3VQQA 1LAVA 1DGKN 1L3TA 4CZLA 3OYAA 1VSDA 3QNNA 4F9OA 4KHNA 4AHSA 1SL0A 4BRDA 4GKJK 3LDSA 3ZEUB 3RRHA 2UXBK 1KD1O 4OPHA 3CPWM 1OH6A 4JI3K 1T44A 3O4NA 3HT3A 1FK9A 3RTVA 4Y1CA 5M1OA 1OVQA 4A5AA 1KLNA 2X6NA 1TL3A 2X74A 3LZIA 1HLUA 1XHXA 3AGKA 3OYBA 3AVMA 4YOUA 3EN9A 3U6FA 3P1GA 3MWTA 2D5RA 3HO1A 5KQ8A 4DR3K 1NJIO 2NZTA 1TV6A 1QSYA 4DQPA 4JV5K 2Q31A 2BANA 3H1QA 3PUFA 4CHQA 4KB1A 3B6OA 1D4XA 1UWBA 1Z05A 5LJWA 4FLTA 3MXMA 4DSFA 4B9TA 4FWPA 3FZFA 3EE9A 2IDOA 2FBTA 4JD2B 3VF4A 4CE9A 3CI5A 3ZSVA 4DU3A 3OVNA 4CEDA 1SL2A 3Q7BA 1VK0A 4JKGB 2UXCK 1HR0K 4DSJA 3L4QA 2P9UA 5AQXA 4AM7A 2RF2A 4O5FA 3I8BA 3ZT0A 4M3YA 1J9AA 3KHYA 4K0KK 3U9DA 3SUNA 3PX4A 4FM0A 1HJOA 3ZX0A 1NK9A 1D9FA 3MX5A 3MX2A 5I9EB 1C0FA 4JKFA 4C8OA 4CJ7A 5KI6A 4JK8A 3ZSOA 1IKYA 1YVNA 4CK2A 4AHRA 2YKNA 2G8UA 3KLGA 1VHXA 2HHHK 3VQEA 3LAMA 3JSMA 3G10A 1HJRA 2WC9A 3VERA 4K42A 1GOAA 1Z26A 2F96A 4LH5A 1DTTA 4N56A 3NHGA 4YOXA 5M1NA 1BISA 1VRUA 1FW6A 1XNRK 3BEXA 1NK5A 3DXMB 1NKBA 5LJVA 5KPRA 5KQDA 3TAEA 1J5EK 3K5NA 3THVA 5C0YA 2UYTA 1T6CA 2QWLA 3CJAA 3G4SN 1C0MA 2IVNA 3ALYA 5KPZA 5KGWA 5EXWA 4ID5A 5M1PA 2ASPA 5F1XA 2QWPA 1ASWA 1HKCA 4DKWA 1KC8O 3THWA 4H0YB 4R79A 4JLHA 1BHLA 3M5RA 4JI6K 4C8LA 1GLFO 3PLAA 1IH7A 4W5RA 5FRNA 1GLCG 1YUWA 3MDQA 3ZCMA 2PYLA 3C6TA 2GUIA 3UKRB 4O8UA 3HSCA 4WQ5A 4ZTJA 1BWFO 3AVFA 4EP4A 4HUFA 1NJWA 3QETA 3ZLJA 1K9MO 3SQ2A 2OPSA 2KLAA 1RGIA 4M3UA 1CLQA 1HYZA 2IAJA 4KTQA 3AA3A 5JS2A 1NK6A 5HROA 3LWLA 4ISFA 1KRPA 2QEXN 3ZSYA 3ZSWA 4QOZB 2F7TA 5JLHA 3HOTA 1VQ7N 3O9UA 4BRHA 4FWNA 2OANA 1VQ9N 3KVGA 3MN7A 2O8CA 4DSIA 1NGEA 1Q18A 1VSJA 3QEXA 1S22A 1OH7A 5BR9A 1WAJA 4BY9C 4KHPK 1WSGA 4Q0BA 1P8ZA 3DOKA 3L4IA 1A5XA 3V9WA 1BA0A 3IS9A 1QE1A 2OPPA 2HF3A 1YTAA 4NYFA 3D2FB 3D0PA 3D6RA 4RW7A 1RBRA 1S1XA 1EP4A 4CJKA 3RMCA 1KAXA 3OYMA 3M8PA 1N33K 3NF8A 1X3MA 3ASMA 2OYQA 3LM2A 3CCJN 2YNGA 4BRFA 4M3ZA 3L0QA 3P38A 4H5TA 4BDZA 3QEIA 1HKBA 4FVUA 4GY2B 4FXDA 4BG8A 4BE0A 2VWKA 3AVBA 1RDWX 3H3OB 3R3LA 1XI1A 2IS3A 2XY8A 3AVHA 1NG9A 3G6EN 3PX0A 3THYB 4MLEA 5AQTA 2G8WA 2VCPA 4BGBA 2GX9A 1U49A 3DLKA 4MLHA 4JI4K 5AQHA 4GV9A 3CMAN 4J2AA 5BN8A 2P9PB 3CHWA 1KVCA 4ELUA 1L5UA 2E2PA 1Q86O 5BRHA 3RSEB 1IKXA 1C1BA 1HNXK 4JKEA 4JKGA 1WSFA 4W5TA 3AO3A 3E9PA 3KLHA 4B3RK 2XRIA 3CC7N 4IEIA 3OYEA 2HHUA 4FO0A 3SV4A 1SL1A 1YIJN 4EP5A 2BUPA 4KHSA 1JLQA 3VQAA 1E3MA 4FYDA 1YF5L 3PSIA 5AQWA 3BZKA 1BI4A 3AO5A 3BF3A 3JXUA 4IG0A 5AQOA 1HKGA 4NB4A 3CERA 3I33A 2CH6A 2F9WA 3KWGA 4PA1A 4RW8A 2UUAK 5GIPA 4DTSA 4KBOA 2E1YA 4CHNA 3ATVA 5EU7A 2GV9A 5DMRA 4JS5A 3OBYA 4CGFA 2NRRA 1GLDG 4MO5A 4CEEA 4JS4A 1VSHA 4R5PA 4PKHA 1JLEA 2I7NA 4W5QA 4E1MA 3C95A 4NXMK 3ULEB 1B9FA 5K14A 4JKBA 4WQ4C 1B9DA 3KD5E 1JLBA 4CZGA 3OYHA 3TTFA 1NJXA 3QO9A 3KJVA 2YHXA 3CG7A 2D4WA 3J81O 4CD3A 1RT5A 4IBNA 4LD0A 4BC5A 3RMBA 4FL9A 3MEDA 4F8RA 3EY1A 5AJ3K 2E6MA 4CGHA 1HX1A 1N36K 1XWLA 2HNDA 3UKRA 3B8AX 4LF5K 1WSIA 2HNZA 4CK1A 5SZTA 2YNFA 3L2VA 3TSQA 3S3OA 2Z1HA 3D7EO 3KLFA 3THXB 1NBWA 2BGGA 1NLVA 3AVCA 1NK4A 3A5LC 1LW2A 3NF6A 3KD1E 1VSLA 3DRPA 4M7YA 3Q7CA 3K0SA 4C8MA 3VPZA 4DU1A 1WOQA 4AM6A 4CIGA 1W0HA 4OPJA 5AQSA 1ILYA 4JI8K 3CJ1A 1IG9A 1TK8A 5GADP 2G8HA 1FJGK 4I2QA 4FLXA 3QFPA 2O8DB 3H3NO 4DR1K 2AA4A 4CF8A 1I3AA 1LOTB 4DV0K 4KTZA 1CZAN 4NXNK 1MWKA 4Y1DA 2YHYA 4FWQA 4CD1A 1QVGM 2PAVA 2P9KB 3D2FA 4OKJA 1ZBUA 2P9LB 1ATSA 1S9EA 2HHXA 3M6GA 3WQTA 4GNIA 3VQ5A 3F5TA 4CJ4A 4A62A 1Q7YO 3FLCO 2B6AA 3K59A 2YX6A 4FJXA 4CFCA 2RN2A 3IRXA 4DF4A 3PO5A 4K8ZA 1K8AO 2VYPA 1QSLA 1CZ9A 4DU4A 2X6SA 4YY3K 1E4FT 4E7IA 3LM9A 3VEZA 2QM1A 4U7BA 4F2SA 3LAKA 1JLCA 2VQEK 1VQNN 3HJFA 3DOLA 3CMEN 1N8RO 5KRSA 1BQNA 3ITHA 3TTCA 4JK9A 3TTDA 4DUZK 2ZGZA 4WCEL 3CCEN 3SCXA 3MEGA 5IWAK 4QS9A 1UOCA 1ZBIA 3PIPL 3QEWA 3OW2M 2NRWA 2HHWA 4CBUA 4FWMA 4GVEA 3DI6A 4M3TA 4YOTA 4DSEA 2P9PA 4Z4IA 1CZBA 3CQ8A 3KK2A 1O13A 4CJPA 1WSEA 3NGZA 3HVRA 3RSEA 5LMUK 2KHOA 4BRPA 2QWNA 5JVHL 2F4VK 4IJNA 2GWKA 3SUPA 4CZEA 1VQON 4W5NA 4YOWA 1ZBHA 2AJQA 2ATQA 4AF1A 1KVBA 4JRQA 3LDQA 4DR5K 3WT0A 1NKCA 4CF9A 4LFCK 2KFNA 3CCVN 3IAYA 4CIFA 4Z94A 2D1KA 3TANA 4PWDA 4WQ4A 1RDCA 1L3UA 3C7NA 2O8BB 4H0VB 1SKRA 4CK3A 4OX9K 3LWMA 2RHKA 3P4IA 3AVKA 1EETA 4DTPA 1C1CA 1LV5A 1NJYA 2D0PA 4BRQA 4KTWA 1HNIA 4BR7A 3TAFA 3HYFA 3C6HA 2DFEA 3AGRA 5HRSA 4ZHRA 3S41A 1U4BA 3NGIA 4CEAA 3ULEA 1RBSA 1S6QA 4IDKA 4E1NA 3MMVA 1DT9A 3VQCA 4PKIA 4AHCA 3V1OA 2Q1NA 4OJRA 5JLFA 3FR0A 5C2FA 3UKUB 1I39A 3KK3A 1J6ZA 4RW4A 2YHAA 4EHUA 3VENA 4PL8A 4CI6A 1NNEA 3SJJA 3OJUA 2YI1A 4BROA 2XO7A 1QQMA 3MAQA 4J2EA 4DR2K 3DWLA 2V51B 1A5WA 3AA5X 1RT4A 4CJLA 2Y1JA 1Z25A 4DV4K 1TK5A 3OS2A 1VQ8N 3THXA 2UU9K 4BRMA 2W6KA 3VA3A 5J2MA 3NFAA 1WLJA 5AQIA 4B9MA 1G15A 2KZMA 1VQPN 1RDUA 4GW6A 5AQJA 4KH6A 1W9HA 4PY5A 1NGHA 1RBUA 5JICA 3N4PA 4I9LA 3DLHA 2WBNA 2JGUA 4NO7A 2LSNA 3ULDA 4NCAA 2O8DA 4NYNA 4BC2A 3BP8A 4FWKA 4B9VA 3VETA 1EWRA 3FGUA 5AQVA 3V9ZA 4O0IA 4JKDA 3MN5A 3V9UA 2E1ZA 1IKWA 5EVZA 2P9IB 5DM6L 3S3NA 3SAGA 3SMSA 3O4QA 2WONA 4O4GA 1S1UA 2P9KA 5J1EA 3AAQA 4BC4A 4C1NK 3U3YA 4KAZA 2I5JA 1UA1A 2DFHA 2ZQBA 3H45C 1NOYA 1K8KA 5CR4A 1RTIA 4DTOA 1BG3A 5HL7L 1T7PA 4O8KA 1VQ5N 4FSVA 3AVIA 1TAUA 2HOEA 4WFNL 4BE2A 3LANA 2B5JA 4X62K 4GV3A 3QIPA 3THYA 4Z4FA 4CZJA 2ASOA 4BRAA 4G1QA 4CECA 1ITGA 5KTQA 2HBLA 1IKVA 2QWQA 1L3VA 4IFVA 3L2QA 3GG4A 4FLWA 2QXLA 2ETJA 4GVMA 4B1UB 1LWCA 3WQUA 4DQ8A 1YTUA 3T3FA 4PQUA 3WEEA 4A5BA 4BC3A 5I3UA 1KVAA 4A2AA 1BUPA 1Q9XA 4F2RA 3CC2N 5HRNA 3HP6A 4QAGA 3R1XA 3CFRA 2I7PA 2FBXA 1BIZA 3L2WA 1W7AA 4DTXA 2FXUA 5HLFA 3CJ7A 2P51A 4HVJA 4FJ8A 5AQYA 1XC9A 3FZMA 1IO2A 4CEZA 1TKXA 4CBWA 1TYQB 4FJLA 1C6VA 3S9HA 4KHUA 3DM2A 2XHBA 1XQSC 3BZCA 2E6LA 3NVMA 2HNYA 1NK0A 2HSTA 3HBTA 2QKBA 4IOAL 3D2EB 4CGDA 1S1TA 3B6PA 2BTFA 4IOCL 3V9SA 2O8FB 2DTUA 2HBMA 1SUQA 5J2QA 2HVHA 1SZ2A 3ZETB 1IBKK 1RT2A 1RT7A 1V4SA 4RW9A 3IG1A 4I6MB 2O8BA 5AFUH 2V7YA 1TKTA 3KLIA 4EZ6A 2Q0RA 4IFYA 3CF5L 1HUXA 1HYSA 3K9KA 1RT6A 4CHPA 4FJMA 3P83D 4BRNA 4FLVA 4GKKK 2FLOA 4HWIA 2HB5A 1KAYA 4CFAA 4C8KA 5KGXA 3VQ9A 1BIUA 1R0AA 1YJWN 3VN5A 3SQ1A 4IDHA 1S1VA 4JHDB 4DFKA 1C0GA 4M63C 3O9QA 4NLBA 1BGXT 4FPAA 4WFAL 1WNSA 5EOYA 3CFPA 3O9TA 4O44A 3ATUA 2HHTA 3UKUA 1UA0A 4ELTA 3I0RA 3D45A 3LL3A 2PZSA 4B9NA 3AV9A 3QINA 2HHQA 3OYJA 2DY4A 4JI1K 5C25A 2GEMA 3HVTA 4LSLA 1EWQA 1ESVA 3NF9A 3QEVA 4KI4A 2P9NB 4B9LA 4DFMA 1T6DA 4FZZA 2OPRA 4E7HA 3J7YP 3HM9A 3TI0A 4BRCA 3WXKA 4AQYK 2OZSA 4DF8A 1SQKA 2GBZA 3ZEUA 4FLZA 4DG1A 3RVCA 3MXIA 4NLCA 3QFUA 4DQQA 2OA8A 3QESA 2KFZA 2E8AA 4FCYA 3BGRA 1LW0A 3C94A 1BQMA 3A5OC 4FW2A 1SAZA 3LDNA 4DLGA 4XH4A 4B8CA 3WNEA 4OVLA 2CGJA 4M45A 2NNWA 4FOIA 4CZHA 3I56N 4CF0A 2P1JA 1M1KO 1QS4A 4QS8A 1JLFA 5BN9A 1X9SA 5KPTA 2DPNA 4CJFA 3OBWA 5AQKA 2FBYA 1TUUA 2VGNA 2UUBK 3PY8A 2P9IA 3VF6A 1LWFA 2D0BA 3AVLA 3M3ZA 3PIOL 3WXLA 4RCHA 4KREA 4FWOA 3OY9A 1VQKN 3FZKA 5CYQA 1HNVA 1MDUB 3CCSN 3VEWA 2WFBA 4JKCA 4UY8O 4BQLA 4JD2A 3A2FA 1XMOK 1ASUA 2XY7A 1HQEA 1JXBA 3WXJA 4FJHA 4Z4EA 3KTQA 1BDGA 4ZTFA 5I42A 4YFUA 3H1VX 4H5RA 1D8YA 3OYIA 2ZJRL 1WBDA 3LPUA 1Q9YA 4LF7K 1HRHA 2A3ZA 3SK3A 3VQDA 4F3TA 4BACA 2IIRA 5C24A 4H5VA 3VESA 4BR0A 3F9KA 4ISEA 5ADXA 4CFBA 4V19S 5ELZA 2QWMA 4M41A 3VEYA 4CGGA 4E0DA 3OTOK 3DLLL 4JYAK 3PSFA 4KO0A 1J5OA 1JL2A 3C6AA 3ZX2A 3CQXA 3GL1A 2Q3SA 4MDBA 3H08A 3TSUA 1NU0A 4CGJA 2QW9A 1M90O 4CESA 5AZJB 3HM8A 1TKZA 3GBTA 2W41A 5HRRA 3DXMA 4O0JA 1TYQA 3DAWA 5LMNK 4HUEA 4IXCA 3WUHA 4KFBA 4CJWA 3CETA 1RBTA 3L8BA 3M8QA 2OTLN 3K5MA 3TPQA 4ISGA 2O8FA 3PO4A 4DR7K 2KZZA 5J2PA 3OS0A 3ZT2A 2D0CA 3NGYA 4F4KA 1NGCA 4CZIA 3WXMB 3ZETA 5GAHP 3R8EA 2BH1A 5AR0A 4CF1A 1NGGA 1EO1A 1EQYA 3HPHA 4CFDA 5LY3A 3TAQA 1S9GA 5FPNA 1ZBSA 1EKEA 3FZLA 1YJ9N 1RDDA 4YHHK 4DV7K 3KZBA 4IFEA 4K43A 2FSKA 5C10A 3SYZA 4WYBA 4BREA 2ZJQL 2ZGYA 4WFBL 3CM5A 1X9WA 3ENOA 3DMJA 4FZYA 4CEQA 1FKOA 5AQGA 1VAZA 4JHDA 4B1WB 4MQ3A 1W97L 4GMJB 4DB3A 1T05A 4BR5A 1ATNA 5CHIA 1QQCA 4AH9A 3HZ6A 5T7BA 3DJCA 5C42A 3RMAA 1LCUA 4HCCA 1S72N 1YXQA 3HSTB 3E66A 4CEOA 4CJUA 4K25A 3KWIA 3QMLA 4DTRA 3ZT4A 1X9MA 3AVJA 4KKOA 1C1AA 1S1WA 3MN9A 1HNWK 4ILJA 3EZWA 1ATRA 4MDAA 4LH4A 2P9NA 3O5BA 4CZMA 1RILA 1WSJA 1SKSA 3JYTA 1U47A 3CFOA 3R9PA 2BE2A 4RTFD 3OS1A 2GUPA 2YNHA 3IFRA 3NH0A 3OYFA 4DV5K 4DV1K 4FJGA 2ZD1A 3EYZA 3BDPA 1YI2N 4FJ7A 1U45A 1RTDA 2XY6A 2VG5A 3T19A 5J2NA 4QS7A 4FK2A 1YT3A 2VWBA 3F9MA 1DLOA 3HTVA 1D5AA 4B3TK 3C65A 3O1WA 2P5GA 4M3XA 3SQ4A 4FJKA 3TR8A 1FKPA 4M3WA 2IOCA 4DTUA 3ISNC 4FWLA 4PUOA 4RW6A 2VG6A
chains in the Genus database with same CATH topology
3SQ2A 2OPSA 4M3UA 4I9LA 3DLHA 1CLQA 1HYZA 2IAJA 4MFBA 4KTQA 3WNHA 4AHVA 2JGUA 2LSNA 3AA3A 3ULDA 4NCAA 5JS2A 1NK6A 1BCOA 4NYNA 3QIOA 2A1SA 5HRPA 3LALA 3O3HA 3LWLA 5HROA 3SPZA 3S3MA 1KRPA 4B9VA 3ZSYA 3K57A 3ZSWA 4OKKA 1BL3A 3MXJA 4O5BA 4CJTA 1RTJA 3RR7A 4B3OA 3V9ZA 4QOZB 4O0IA 3P5JA 2G8FA 3V9UA 4CHOA 1S6PA 4BWMA 3PX6A 1IKWA 2P5OA 1HQUA 3RRGA 5DK5A 1WAFA 4DSIA 1VSJA 3L3UA 3S3NA 3O4QA 2WONA 4O4GA 1ASVA 1S1UA 1VSKA 5J1EA 1JKHA 3DRRA 3M8SA 3OYLA 4IG3A 3U3YA 1ZBFA 4OLAA 4I7FA 1WAJA 4KAZA 3NH2A 1WSGA 2KFZA 4OKEA 4DTNA 2I5JA 1UA1A 4Q0BA 2DFHA 2ZQBA 2A1RA 4KV8A 3DOKA 1NOYA 1UAXA 2JLEA 1A5XA 1RTIA 4TSXA 4E19A 4DTOA 1T7PA 3V9WA 3IS9A 4XIUA 1QE1A 2OPPA 3DLGA 3OJSA 1NK7A 3AVIA 1YTAA 4NYFA 1SV5A 3VQBA 2G8KA 1TAUA 1LAWA 3RR8A 4BE2A 3D0PA 1QHTA 4LSNA 1RBRA 4RW7A 3QEPA 3LANA 2B5JA 1JXEA 1NK8A 2FBVA 4H4MA 1EXQA 1S1XA 1EP4A 3DYAA 3QIPA 4CJKA 1GOCA 3RMCA 3AO2A 3UIQA 4Z4FA 3CM6A 3OYMA 3M8PA 3LP0A 4G1QA 1Y97A 4CECA 1ITGA 4FJ5A 5KTQA 3K58A 1IKVA 4RG8A 4F3OA 3NF8A 3ASMA 2OYQA 1TKDA 1K6YA 1L3VA 4IFVA 1REVA 2DFFA 3L2QA 4FLWA 2ETJA 2YNGA 5E41A 4GVMA 4M3ZA 1LWCA 5SWMA 2X78A 4JRPA 1YTUA 1J54A 3T3FA 4PQUA 4FZXC 3OYDA 1HYVA 4BDZA 2XY5A 3K2PA 3QEIA 1NJZA 4FXDA 5I3UA 1KVAA 4BE0A 2VWKA 4DTMA 1Q9XA 3AVBA 4DSKA 4F2RA 5HRNA 3HP6A 4DQIA 4QAGA 1F21A 3KK1A 4FJJA 2HW3A 3CFRA 2QKKA 3I0SA 1XI1A 3HP9A 4DFPA 2FBXA 2YHBA 1BIZA 4CHYA 4FM1A 3AVHA 2XY8A 2IS3A 3L2WA 4HTUA 1U48A 2G8IA 4KHQA 3AO4A 4DTXA 4FK0A 3V4IA 5HLFA 3I8DA 4N5SA 4HVJA 2P51A 3F73A 2VWJA 3PX0A 4EZ9A 4FJ8A 1RCHA 1XC9A 5CY4A 1IO2A 2G8WA 4CEZA 3U3GA 3DLEA 1T03A 1TKXA 2FC0A 4Z4CA 1B92A 4CF2A 4FJLA 2EX3A 1C6VA 2YNIA 3E01A 3S9HA 4IKFA 4AHUA 4OLBA 1C0TA 1U49A 1CXUA 4KHUA 3DM2A 2XHBA 3DLKA 4BWJA 1RNHA 3TARA 3K5LA 4AHTA 4J2AA 2E6LA 2YV0X 2E4LA 2HNYA 1NK0A 3OYNA 1KVCA 4DS5A 2QKBA 4ELUA 3SUQA 1L5UA 2F8TA 4CGDA 2Z1IA 3L2RA 1IKXA 1KTQA 1S1TA 3B6PA 1C1BA 3V9SA 2NUBA 3NE6A 2DTUA 1D9DA 2KTQA 1SUQA 3LPTA 1WSFA 4W5TA 3AO3A 3KLHA 2O4IA 2XRIA 4FLYA 5J2QA 3OYEA 2HHUA 4OGCA 3SV4A 1SL1A 3WNFA 2HVHA 4YNQA 3AA4A 1RT2A 1RT7A 5CYMA 4BDYA 4EP5A 4RW9A 4DQRA 4KHSA 1LWEA 3IG1A 1JLQA 3VQAA 1RT1A 4FYDA 3NH1A 4LY7A 1TKTA 3DLRA 3KLIA 2PY5A 4EZ6A 4B8AB 4IFYA 1KSPA 4KHYA 4H8KA 1BI4A 4Q5VA 3AO5A 1HYSA 1TAQA 1RT6A 4CJ3A 4CHPA 2HMIA 4FJMA 4KRFA 3P83D 1GOBA 1YVUA 4CJSA 1S5JA 1C0UA 4DTJA 4FLVA 4IG0A 3O3GA 2HB5A 4CFAA 4DMNA 4C8KA 3KKRA 3AA2A 4CERA 4FJ9A 2F8SA 5KGXA 2QK9A 3VQ9A 1BIUA 2HHSA 4ICLA 4PA1A 4RW8A 1R0AA 2B4JA 3VN5A 1U04A 3ZSXA 4DTSA 3SQ1A 2OPQA 1S1VA 4M3RA 2HHVA 4UQGA 3AO1A 4DFKA 4CHNA 4O55A 5EU7A 2Z1JA 4QCLA 4CEBA 2G8VA 2GV9A 5DMRA 4HUGA 4JS5A 4KPYA 4Z4GA 4DLEA 1BGXT 3HPGA 4I9QA 3K5OA 3VQ7A 4CGFA 4B08A 4FK4A 4CEEA 4JS4A 1WNSA 3CFPA 1N5YA 2HHTA 4O44A 1VSHA 4R5PA 3FFIA 3SI6A 3DRSA 1J53A 4DQSA 1JLEA 4W5QA 1UA0A 3I0RA 4ELTA 4E1MA 3D45A 1FXXA 2PZSA 4B9NA 3AV9A 3QINA 3OYKA 3C95A 4N41A 2HHQA 2KW4A 1B9FA 3HK2A 5K14A 3OYJA 2DY4A 2W42A 1ZBLA 1B9DA 3SV3A 5C25A 1JLBA 4BDPA 3KD5E 4L8RB 2EHGA 3HVTA 4LSLA 5KRTA 3OYHA 1NJXA 3T1AA 3QO9A 3KJVA 3NF9A 1BCMA 3CG7A 2PYJA 3QEVA 4KI4A 4C8NA 4B9LA 4DFJA 1RT5A 4IBNA 4LD0A 4DFMA 4FZZA 2OPRA 4E7HA 3ZT3A 3CYMA 3RMBA 4F8RA 3MEDA 3HL8A 3TI0A 4NCGA 3EY1A 3HM9A 1VSMA 2E6MA 4CGHA 3KLEA 5FRMA 4E89A 2OZSA 4DF8A 1XWLA 2GBZA 2HNDA 4FLZA 2Y1IA 4DG1A 1WSIA 3M8RA 2HNZA 4CEFA 4DQQA 3MXIA 2OA8A 3LP2A 4CK1A 5SZTA 3QESA 2YNFA 3L2VA 3PV8A 4FCYA 2IC3A 3ZSZA 3BGRA 1LW0A 1MU2A 1BQMA 3C94A 4FW2A 2Z1HA 3S3OA 4HHTA 4DLGA 4B8CA 3KLFA 2BGGA 4NCBA 3WNEA 3AVCA 4CJEA 1RT3A 3HXMA 4OVLA 3QEXA 4M45A 1EX4A 1NK4A 5HBMA 4CJRA 4N76A 3TAGA 3AVGA 1TK0A 3SPYA 4KI6A 1LW2A 5FDLA 3NF6A 2RKIA 1KFDA 1O1WA 4CF0A 2P1JA 3KD1E 1VSLA 1QS4A 3DRPA 1JLFA 1QTMA 1TL1A 4C8MA 4DU1A 1X9SA 4CJFA 4CIGA 1W0HA 4OPJA 1RDBA 1TVRA 2FBYA 4K8XA 1BI4B 1IG9A 1TK8A 3PY8A 1ZYQA 1QSSA 1A5VA 1NKEA 1LWFA 1WN7A 2D0BA 3O3FA 2G8HA 4I2QA 4KB0A 4FLXA 3QERA 3AVLA 2R7YA 3G0ZA 3SUOA 4CJ5A 4KREA 4Z4HA 4KHWA 4CF8A 3OY9A 1I3AA 1X1PA 2WOMA 5CYQA 1HNVA 4KTZA 4Y1DA 3SNNA 3VQ8A 2VG7A 2YKMA 3NBPA 3A2FA 4CGIA 4CJQA 4OKJA 1JL1A 1ASUA 2XY7A 1ZBUA 1HQEA 1JXBA 1S9EA 4CHZA 1VSIA 2HHXA 3WNGA 4FJHA 4Z4EA 3KTQA 4ZTFA 3V9XA 5I42A 3VQ5A 3VQ6A 4CJ4A 4YFUA 1T8EA 1D8YA 3ZT1A 3SZ2A 4E7KA 2B6AA 3OYIA 3LZJA 3K59A 3HPOA 5D3GA 3LPUA 4FJXA 4CFCA 1Q9YA 4E7JA 1HRHA 4FVMA 2RN2A 3IRXA 4DF4A 3PO5A 4K8ZA 3VQDA 4M42A 4Z0UA 4F3TA 3KIOA 2ZE2A 4BACA 1QSLA 3VQQA 1CZ9A 4DU4A 1LAVA 5FROA 5C24A 2X6SA 1L3TA 3OYAA 3F9KA 1VSDA 3RWUA 3QNNA 4CFBA 4E7IA 4KHNA 4M41A 4AHSA 3V1QA 4CGGA 3NDKA 1SL0A 4DSLA 4E0DA 4F2SA 3LDSA 3LAKA 1JLCA 3QLHA 1L3SA 3RRHA 3RMDA 4J2BA 3HJFA 3DOLA 4KO0A 4AILC 1J5OA 5KRSA 1BQNA 1JL2A 3ITHA 3O4NA 1VSEA 3HT3A 1FK9A 2IGIA 2Q3SA 3RTVA 4E7LA 1HPZA 3H08A 4Y1CA 4CGJA 3TABA 3SCXA 3MEGA 4CESA 1XHZA 1KLNA 2X6NA 1TL3A 2X74A 1UOCA 1TKZA 3LZIA 1XHXA 4O0JA 5HRRA 3OYBA 3QEWA 4I2PA 1ZBIA 3AVMA 2Z1GA 3C6UA 3U6FA 1KLMA 4HUEA 2HHWA 2QXFA 3P1GA 4DWIA 3DI6A 4KFBA 3ZSQA 4M3TA 4DSEA 2D5RA 3HO1A 4CJWA 3MECA 4Z4IA 1CZBA 1RBTA 3L8BA 3CQ8A 1TV6A 3KK2A 1QSYA 3TAMA 4DQPA 3M8QA 3MEEA 1WSEA 4CJPA 3NGZA 3HVRA 3K5MA 2BANA 5JS1A 3PO4A 3SUPA 3PUFA 2KZZA 5J2PA 4FJIA 3OS0A 4J2DA 4CHQA 1RBVA 3ZT2A 2D0CA 3NGYA 3B6OA 4KB1A 1UWBA 1WSHA 3V1RA 4F4KA 4FLTA 4W5NA 1RDAA 4N47A 1KCFA 3V81A 3MXMA 1ZBHA 2AJQA 4DSFA 2ATQA 4CF1A 1KVBA 4JRQA 4B9TA 3HPHA 4CFDA 3TWHA 2IDOA 4FJNA 2FBTA 3NAEA 1NKCA 4CF9A 4CE9A 1S9GA 1VSFA 3TAQA 2KFNA 3IAYA 1SKWA 3L3VA 3ZSVA 4CIFA 4DU3A 3OVNA 5CZ2A 4CEDA 1EKEA 3AVAA 1VK0A 1SL2A 3TANA 3OYGA 2KQ2A 4DSJA 1TGOA 4PWDA 1RDDA 4ELVA 3VA0A 2RF2A 1RDCA 3SQ0A 3SYZA 3ZT0A 1L3UA 1J9AA 3ZSRA 4E3SA 4M3YA 2O4GA 4ID1A 3SUNA 1SKRA 3CM5A 1X9WA 2RPIA 3DMJA 4CK3A 4FZYA 3L2UA 3PX4A 3LWMA 1Q8IA 4BE1A 1JLGA 4FM0A 1D9FA 4CEQA 1NK9A 1FKOA 1KFSA 3AVKA 1EETA 4MQ3A 4GMJB 4DTPA 1NOZA 1T05A 4C8OA 1C1CA 1QQCA 4AH9A 1NJYA 1LV5A 5T7BA 4KTWA 5KI6A 5C42A 3ZSOA 1IKYA 1DTQA 1HNIA 3RMAA 4CK2A 4B9SA 3TAFA 4WE1A 4AHRA 2YKNA 3HYFA 2G8UA 3KKSA 3KLGA 4HCCA 3HSTB 2DFEA 3VQEA 3LAMA 4CEOA 3TAPA 3JSMA 4CJUA 3G10A 1HJRA 5HRSA 4ZHRA 2HVIA 3NGIA 1GOAA 3NCIA 4DTRA 1Z26A 1U4BA 2F96A 4LH5A 3ZT4A 1X9MA 3VQ4A 4CEAA 3AVJA 1DTTA 1C1AA 1RBSA 1S6QA 1S1WA 4IDKA 4KKOA 4OGEA 4N56A 4E1NA 3NHGA 1BISA 1VRUA 4CIEA 2BDPA 4LH4A 4H4OA 3VQCA 3AVNA 1NK5A 3NF7A 4AHCA 1NKBA 3V1OA 1RILA 4OJRA 1N6QA 4FW1A 3TAEA 1WSJA 1SKSA 4B9UA 1I39A 3JYTA 3K5NA 3KK3A 1U47A 3THVA 3LP3A 2OZMA 3CFOA 4RW4A 2YHAA 3V6DA 1C0MA 2BE2A 3ALYA 3OS1A 3OYCA 2YNHA 5KGWA 3NH0A 3OYFA 4ID5A 2D0AA 4FJGA 5HP1A 3SJJA 2ZD1A 3OJUA 3LP1A 3EYZA 1HMVA 3BDPA 1U45A 1RTDA 2XO7A 4FJ7A 2XY6A 2VG5A 3T19A 3MAQA 4J2EA 3EZ5A 1ASWA 1CXQA 5J2NA 4PY5A 1A5WA 3AA5X 1RT4A 1YT3A 4CJLA 4FK2A 2Y1JA 1Z25A 1TK5A 4HCBA 3OS2A 1DLOA 2ITGA 4OPKA 4CCHA 4FM2A 4DS4A 1D5AA 4JLHA 1BHLA 1RTHA 1JLAA 4C8LA 3QNOA 3VA3A 2P5GA 4M3XA 1IH7A 4W5RA 3SQ4A 3ZCMA 5FRNA 5J2MA 3NFAA 2PYLA 3C6TA 2GUIA 1WLJA 4FJKA 3TR8A 1FKPA 4B9MA 1G15A 2IOCA 1VRTA 3AVFA 4DTUA 4ZTJA 4M3WA 3ISNC 4EP4A 2KZMA 4HUFA 4GW6A 1NJWA 3VQPA 4W5OA 5CZ1A 4PUOA 3QETA 1W9HA 3DLBA 4CJVA 4FLUA 1RBUA 4RW6A 2VG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SQ2 A;  2OPS A;  4M3U A;  4I9L A;  3DLH A;  1CLQ A;  1HYZ A;  2IAJ A;  4MFB A;  4KTQ A;  3WNH A;  4AHV A;  2JGU A;  2LSN A;  3AA3 A;  3ULD A;  4NCA A;  5JS2 A;  1NK6 A;  1BCO A;  4NYN A;  3QIO A;  2A1S A;  5HRP A;  3LAL A;  3O3H A;  3LWL A;  5HRO A;  3SPZ A;  3S3M A;  1KRP A;  4B9V A;  3ZSY A;  3K57 A;  3ZSW A;  4OKK A;  1BL3 A;  3MXJ A;  4O5B A;  4CJT A;  1RTJ A;  3RR7 A;  4B3O A;  3V9Z A;  4QOZ B;  4O0I A;  3P5J A;  2G8F A;  3V9U A;  4CHO A;  1S6P A;  4BWM A;  3PX6 A;  1IKW A;  2P5O A;  1HQU A;  3RRG A;  5DK5 A;  1WAF A;  4DSI A;  1VSJ A;  3L3U A;  3S3N A;  3O4Q A;  2WON A;  4O4G A;  1ASV A;  1S1U A;  1VSK A;  5J1E A;  1JKH A;  3DRR A;  3M8S A;  3OYL A;  4IG3 A;  3U3Y A;  1ZBF A;  4OLA A;  4I7F A;  1WAJ A;  4KAZ A;  3NH2 A;  1WSG A;  2KFZ A;  4OKE A;  4DTN A;  2I5J A;  1UA1 A;  4Q0B A;  2DFH A;  2ZQB A;  2A1R A;  4KV8 A;  3DOK A;  1NOY A;  1UAX A;  2JLE A;  1A5X A;  1RTI A;  4TSX A;  4E19 A;  4DTO A;  1T7P A;  3V9W A;  3IS9 A;  4XIU A;  1QE1 A;  2OPP A;  3DLG A;  3OJS A;  1NK7 A;  3AVI A;  1YTA A;  4NYF A;  1SV5 A;  3VQB A;  2G8K A;  1TAU A;  1LAW A;  3RR8 A;  4BE2 A;  3D0P A;  1QHT A;  4LSN A;  1RBR A;  4RW7 A;  3QEP A;  3LAN A;  2B5J A;  1JXE A;  1NK8 A;  2FBV A;  4H4M A;  1EXQ A;  1S1X A;  1EP4 A;  3DYA A;  3QIP A;  4CJK A;  1GOC A;  3RMC A;  3AO2 A;  3UIQ A;  4Z4F A;  3CM6 A;  3OYM A;  3M8P A;  3LP0 A;  4G1Q A;  1Y97 A;  4CEC A;  1ITG A;  4FJ5 A;  5KTQ A;  3K58 A;  1IKV A;  4RG8 A;  4F3O A;  3NF8 A;  3ASM A;  2OYQ A;  1TKD A;  1K6Y A;  1L3V A;  4IFV A;  1REV A;  2DFF A;  3L2Q A;  4FLW A;  2ETJ A;  2YNG A;  5E41 A;  4GVM A;  4M3Z A;  1LWC A;  5SWM A;  2X78 A;  4JRP A;  1YTU A;  1J54 A;  3T3F A;  4PQU A;  4FZX C;  3OYD A;  1HYV A;  4BDZ A;  2XY5 A;  3K2P A;  3QEI A;  1NJZ A;  4FXD A;  5I3U A;  1KVA A;  4BE0 A;  2VWK A;  4DTM A;  1Q9X A;  3AVB A;  4DSK A;  4F2R A;  5HRN A;  3HP6 A;  4DQI A;  4QAG A;  1F21 A;  3KK1 A;  4FJJ A;  2HW3 A;  3CFR A;  2QKK A;  3I0S A;  1XI1 A;  3HP9 A;  4DFP A;  2FBX A;  2YHB A;  1BIZ A;  4CHY A;  4FM1 A;  3AVH A;  2XY8 A;  2IS3 A;  3L2W A;  4HTU A;  1U48 A;  2G8I A;  4KHQ A;  3AO4 A;  4DTX A;  4FK0 A;  3V4I A;  5HLF A;  3I8D A;  4N5S A;  4HVJ A;  2P51 A;  3F73 A;  2VWJ A;  3PX0 A;  4EZ9 A;  4FJ8 A;  1RCH A;  1XC9 A;  5CY4 A;  1IO2 A;  2G8W A;  4CEZ A;  3U3G A;  3DLE A;  1T03 A;  1TKX A;  2FC0 A;  4Z4C A;  1B92 A;  4CF2 A;  4FJL A;  2EX3 A;  1C6V A;  2YNI A;  3E01 A;  3S9H A;  4IKF A;  4AHU A;  4OLB A;  1C0T A;  1U49 A;  1CXU A;  4KHU A;  3DM2 A;  2XHB A;  3DLK A;  4BWJ A;  1RNH A;  3TAR A;  3K5L A;  4AHT A;  4J2A A;  2E6L A;  2YV0 X;  2E4L A;  2HNY A;  1NK0 A;  3OYN A;  1KVC A;  4DS5 A;  2QKB A;  4ELU A;  3SUQ A;  1L5U A;  2F8T A;  4CGD A;  2Z1I A;  3L2R A;  1IKX A;  1KTQ A;  1S1T A;  3B6P A;  1C1B A;  3V9S A;  2NUB A;  3NE6 A;  2DTU A;  1D9D A;  2KTQ A;  1SUQ A;  3LPT A;  1WSF A;  4W5T A;  3AO3 A;  3KLH A;  2O4I A;  2XRI A;  4FLY A;  5J2Q A;  3OYE A;  2HHU A;  4OGC A;  3SV4 A;  1SL1 A;  3WNF A;  2HVH A;  4YNQ A;  3AA4 A;  1RT2 A;  1RT7 A;  5CYM A;  4BDY A;  4EP5 A;  4RW9 A;  4DQR A;  4KHS A;  1LWE A;  3IG1 A;  1JLQ A;  3VQA A;  1RT1 A;  4FYD A;  3NH1 A;  4LY7 A;  1TKT A;  3DLR A;  3KLI A;  2PY5 A;  4EZ6 A;  4B8A B;  4IFY A;  1KSP A;  4KHY A;  4H8K A;  1BI4 A;  4Q5V A;  3AO5 A;  1HYS A;  1TAQ A;  1RT6 A;  4CJ3 A;  4CHP A;  2HMI A;  4FJM A;  4KRF A;  3P83 D;  1GOB A;  1YVU A;  4CJS A;  1S5J A;  1C0U A;  4DTJ A;  4FLV A;  4IG0 A;  3O3G A;  2HB5 A;  4CFA A;  4DMN A;  4C8K A;  3KKR A;  3AA2 A;  4CER A;  4FJ9 A;  2F8S A;  5KGX A;  2QK9 A;  3VQ9 A;  1BIU A;  2HHS A;  4ICL A;  4PA1 A;  4RW8 A;  1R0A A;  2B4J A;  3VN5 A;  1U04 A;  3ZSX A;  4DTS A;  3SQ1 A;  2OPQ A;  1S1V A;  4M3R A;  2HHV A;  4UQG A;  3AO1 A;  4DFK A;  4CHN A;  4O55 A;  5EU7 A;  2Z1J A;  4QCL A;  4CEB A;  2G8V A;  2GV9 A;  5DMR A;  4HUG A;  4JS5 A;  4KPY A;  4Z4G A;  4DLE A;  1BGX T;  3HPG A;  4I9Q A;  3K5O A;  3VQ7 A;  4CGF A;  4B08 A;  4FK4 A;  4CEE A;  4JS4 A;  1WNS A;  3CFP A;  1N5Y A;  2HHT A;  4O44 A;  1VSH A;  4R5P A;  3FFI A;  3SI6 A;  3DRS A;  1J53 A;  4DQS A;  1JLE A;  4W5Q A;  1UA0 A;  3I0R A;  4ELT A;  4E1M A;  3D45 A;  1FXX A;  2PZS A;  4B9N A;  3AV9 A;  3QIN A;  3OYK A;  3C95 A;  4N41 A;  2HHQ A;  2KW4 A;  1B9F A;  3HK2 A;  5K14 A;  3OYJ A;  2DY4 A;  2W42 A;  1ZBL A;  1B9D A;  3SV3 A;  5C25 A;  1JLB A;  4BDP A;  3KD5 E;  4L8R B;  2EHG A;  3HVT A;  4LSL A;  5KRT A;  3OYH A;  1NJX A;  3T1A A;  3QO9 A;  3KJV A;  3NF9 A;  1BCM A;  3CG7 A;  2PYJ A;  3QEV A;  4KI4 A;  4C8N A;  4B9L A;  4DFJ A;  1RT5 A;  4IBN A;  4LD0 A;  4DFM A;  4FZZ A;  2OPR A;  4E7H A;  3ZT3 A;  3CYM A;  3RMB A;  4F8R A;  3MED A;  3HL8 A;  3TI0 A;  4NCG A;  3EY1 A;  3HM9 A;  1VSM A;  2E6M A;  4CGH A;  3KLE A;  5FRM A;  4E89 A;  2OZS A;  4DF8 A;  1XWL A;  2GBZ A;  2HND A;  4FLZ A;  2Y1I A;  4DG1 A;  1WSI A;  3M8R A;  2HNZ A;  4CEF A;  4DQQ A;  3MXI A;  2OA8 A;  3LP2 A;  4CK1 A;  5SZT A;  3QES A;  2YNF A;  3L2V A;  3PV8 A;  4FCY A;  2IC3 A;  3ZSZ A;  3BGR A;  1LW0 A;  1MU2 A;  1BQM A;  3C94 A;  4FW2 A;  2Z1H A;  3S3O A;  4HHT A;  4DLG A;  4B8C A;  3KLF A;  2BGG A;  4NCB A;  3WNE A;  3AVC A;  4CJE A;  1RT3 A;  3HXM A;  4OVL A;  3QEX A;  4M45 A;  1EX4 A;  1NK4 A;  5HBM A;  4CJR A;  4N76 A;  3TAG A;  3AVG A;  1TK0 A;  3SPY A;  4KI6 A;  1LW2 A;  5FDL A;  3NF6 A;  2RKI A;  1KFD A;  1O1W A;  4CF0 A;  2P1J A;  3KD1 E;  1VSL A;  1QS4 A;  3DRP A;  1JLF A;  1QTM A;  1TL1 A;  4C8M A;  4DU1 A;  1X9S A;  4CJF A;  4CIG A;  1W0H A;  4OPJ A;  1RDB A;  1TVR A;  2FBY A;  4K8X A;  1BI4 B;  1IG9 A;  1TK8 A;  3PY8 A;  1ZYQ A;  1QSS A;  1A5V A;  1NKE A;  1LWF A;  1WN7 A;  2D0B A;  3O3F A;  2G8H A;  4I2Q A;  4KB0 A;  4FLX A;  3QER A;  3AVL A;  2R7Y A;  3G0Z A;  3SUO A;  4CJ5 A;  4KRE A;  4Z4H A;  4KHW A;  4CF8 A;  3OY9 A;  1I3A A;  1X1P A;  2WOM A;  5CYQ A;  1HNV A;  4KTZ A;  4Y1D A;  3SNN A;  3VQ8 A;  2VG7 A;  2YKM A;  3NBP A;  3A2F A;  4CGI A;  4CJQ A;  4OKJ A;  1JL1 A;  1ASU A;  2XY7 A;  1ZBU A;  1HQE A;  1JXB A;  1S9E A;  4CHZ A;  1VSI A;  2HHX A;  3WNG A;  4FJH A;  4Z4E A;  3KTQ A;  4ZTF A;  3V9X A;  5I42 A;  3VQ5 A;  3VQ6 A;  4CJ4 A;  4YFU A;  1T8E A;  1D8Y A;  3ZT1 A;  3SZ2 A;  4E7K A;  2B6A A;  3OYI A;  3LZJ A;  3K59 A;  3HPO A;  5D3G A;  3LPU A;  4FJX A;  4CFC A;  1Q9Y A;  4E7J A;  1HRH A;  4FVM A;  2RN2 A;  3IRX A;  4DF4 A;  3PO5 A;  4K8Z A;  3VQD A;  4M42 A;  4Z0U A;  4F3T A;  3KIO A;  2ZE2 A;  4BAC A;  1QSL A;  3VQQ A;  1CZ9 A;  4DU4 A;  1LAV A;  5FRO A;  5C24 A;  2X6S A;  1L3T A;  3OYA A;  3F9K A;  1VSD A;  3RWU A;  3QNN A;  4CFB A;  4E7I A;  4KHN A;  4M41 A;  4AHS A;  3V1Q A;  4CGG A;  3NDK A;  1SL0 A;  4DSL A;  4E0D A;  4F2S A;  3LDS A;  3LAK A;  1JLC A;  3QLH A;  1L3S A;  3RRH A;  3RMD A;  4J2B A;  3HJF A;  3DOL A;  4KO0 A;  4AIL C;  1J5O A;  5KRS A;  1BQN A;  1JL2 A;  3ITH A;  3O4N A;  1VSE A;  3HT3 A;  1FK9 A;  2IGI A;  2Q3S A;  3RTV A;  4E7L A;  1HPZ A;  3H08 A;  4Y1C A;  4CGJ A;  3TAB A;  3SCX A;  3MEG A;  4CES A;  1XHZ A;  1KLN A;  2X6N A;  1TL3 A;  2X74 A;  1UOC A;  1TKZ A;  3LZI A;  1XHX A;  4O0J A;  5HRR A;  3OYB A;  3QEW A;  4I2P A;  1ZBI A;  3AVM A;  2Z1G A;  3C6U A;  3U6F A;  1KLM A;  4HUE A;  2HHW A;  2QXF A;  3P1G A;  4DWI A;  3DI6 A;  4KFB A;  3ZSQ A;  4M3T A;  4DSE A;  2D5R A;  3HO1 A;  4CJW A;  3MEC A;  4Z4I A;  1CZB A;  1RBT A;  3L8B A;  3CQ8 A;  1TV6 A;  3KK2 A;  1QSY A;  3TAM A;  4DQP A;  3M8Q A;  3MEE A;  1WSE A;  4CJP A;  3NGZ A;  3HVR A;  3K5M A;  2BAN A;  5JS1 A;  3PO4 A;  3SUP A;  3PUF A;  2KZZ A;  5J2P A;  4FJI A;  3OS0 A;  4J2D A;  4CHQ A;  1RBV A;  3ZT2 A;  2D0C A;  3NGY A;  3B6O A;  4KB1 A;  1UWB A;  1WSH A;  3V1R A;  4F4K A;  4FLT A;  4W5N A;  1RDA A;  4N47 A;  1KCF A;  3V81 A;  3MXM A;  1ZBH A;  2AJQ A;  4DSF A;  2ATQ A;  4CF1 A;  1KVB A;  4JRQ A;  4B9T A;  3HPH A;  4CFD A;  3TWH A;  2IDO A;  4FJN A;  2FBT A;  3NAE A;  1NKC A;  4CF9 A;  4CE9 A;  1S9G A;  1VSF A;  3TAQ A;  2KFN A;  3IAY A;  1SKW A;  3L3V A;  3ZSV A;  4CIF A;  4DU3 A;  3OVN A;  5CZ2 A;  4CED A;  1EKE A;  3AVA A;  1VK0 A;  1SL2 A;  3TAN A;  3OYG A;  2KQ2 A;  4DSJ A;  1TGO A;  4PWD A;  1RDD A;  4ELV A;  3VA0 A;  2RF2 A;  1RDC A;  3SQ0 A;  3SYZ A;  3ZT0 A;  1L3U A;  1J9A A;  3ZSR A;  4E3S A;  4M3Y A;  2O4G A;  4ID1 A;  3SUN A;  1SKR A;  3CM5 A;  1X9W A;  2RPI A;  3DMJ A;  4CK3 A;  4FZY A;  3L2U A;  3PX4 A;  3LWM A;  1Q8I A;  4BE1 A;  1JLG A;  4FM0 A;  1D9F A;  4CEQ A;  1NK9 A;  1FKO A;  1KFS A;  3AVK A;  1EET A;  4MQ3 A;  4GMJ B;  4DTP A;  1NOZ A;  1T05 A;  4C8O A;  1C1C A;  1QQC A;  4AH9 A;  1NJY A;  1LV5 A;  5T7B A;  4KTW A;  5KI6 A;  5C42 A;  3ZSO A;  1IKY A;  1DTQ A;  1HNI A;  3RMA A;  4CK2 A;  4B9S A;  3TAF A;  4WE1 A;  4AHR A;  2YKN A;  3HYF A;  2G8U A;  3KKS A;  3KLG A;  4HCC A;  3HST B;  2DFE A;  3VQE A;  3LAM A;  4CEO A;  3TAP A;  3JSM A;  4CJU A;  3G10 A;  1HJR A;  5HRS A;  4ZHR A;  2HVI A;  3NGI A;  1GOA A;  3NCI A;  4DTR A;  1Z26 A;  1U4B A;  2F96 A;  4LH5 A;  3ZT4 A;  1X9M A;  3VQ4 A;  4CEA A;  3AVJ A;  1DTT A;  1C1A A;  1RBS A;  1S6Q A;  1S1W A;  4IDK A;  4KKO A;  4OGE A;  4N56 A;  4E1N A;  3NHG A;  1BIS A;  1VRU A;  4CIE A;  2BDP A;  4LH4 A;  4H4O A;  3VQC A;  3AVN A;  1NK5 A;  3NF7 A;  4AHC A;  1NKB A;  3V1O A;  1RIL A;  4OJR A;  1N6Q A;  4FW1 A;  3TAE A;  1WSJ A;  1SKS A;  4B9U A;  1I39 A;  3JYT A;  3K5N A;  3KK3 A;  1U47 A;  3THV A;  3LP3 A;  2OZM A;  3CFO A;  4RW4 A;  2YHA A;  3V6D A;  1C0M A;  2BE2 A;  3ALY A;  3OS1 A;  3OYC A;  2YNH A;  5KGW A;  3NH0 A;  3OYF A;  4ID5 A;  2D0A A;  4FJG A;  5HP1 A;  3SJJ A;  2ZD1 A;  3OJU A;  3LP1 A;  3EYZ A;  1HMV A;  3BDP A;  1U45 A;  1RTD A;  2XO7 A;  4FJ7 A;  2XY6 A;  2VG5 A;  3T19 A;  3MAQ A;  4J2E A;  3EZ5 A;  1ASW A;  1CXQ A;  5J2N A;  4PY5 A;  1A5W A;  3AA5 X;  1RT4 A;  1YT3 A;  4CJL A;  4FK2 A;  2Y1J A;  1Z25 A;  1TK5 A;  4HCB A;  3OS2 A;  1DLO A;  2ITG A;  4OPK A;  4CCH A;  4FM2 A;  4DS4 A;  1D5A A;  4JLH A;  1BHL A;  1RTH A;  1JLA A;  4C8L A;  3QNO A;  3VA3 A;  2P5G A;  4M3X A;  1IH7 A;  4W5R A;  3SQ4 A;  3ZCM A;  5FRN A;  5J2M A;  3NFA A;  2PYL A;  3C6T A;  2GUI A;  1WLJ A;  4FJK A;  3TR8 A;  1FKP A;  4B9M A;  1G15 A;  2IOC A;  1VRT A;  3AVF A;  4DTU A;  4ZTJ A;  4M3W A;  3ISN C;  4EP4 A;  2KZM A;  4HUF A;  4GW6 A;  1NJW A;  3VQP A;  4W5O A;  5CZ1 A;  4PUO A;  3QET A;  1W9H A;  3DLB A;  4CJV A;  4FLU A;  1RBU A;  4RW6 A;  2VG6 A; 
#chains in the Genus database with same CATH topology
 3CD6 N;  4JI2 K;  1T3V A;  2P9U B;  4DV3 K;  3SJH A;  2NRV A;  2A6A A;  3QIO A;  5HRP A;  3LAL A;  3NVK A;  3SPZ A;  1N34 K;  4OKK A;  3MXJ A;  4O5B A;  4CJT A;  1RTJ A;  2A41 A;  3WXI A;  2G8F A;  4YOY A;  4CHO A;  1S6P A;  2UUC K;  3PX6 A;  2CH5 A;  4JK7 A;  3A5M C;  5DK5 A;  3L3U A;  3G25 A;  4U67 L;  1ASV A;  4RWT A;  3M8S A;  3OYL A;  4C23 A;  3NH2 A;  3AAR A;  1K73 O;  3CCM N;  1UAX A;  3VTH A;  3E9O A;  5BPL A;  4JI0 K;  5AQL A;  1NGF A;  2EWS A;  3DLG A;  3OJS A;  3VEV A;  1SV5 A;  1LAW A;  1U2V B;  3RR8 A;  3QEP A;  4LSN A;  1NK8 A;  3SBT A;  1HNZ K;  3DYA A;  1R59 O;  2CGK A;  1GOC A;  3UIQ A;  1Y64 A;  4Y0W A;  3LP0 A;  4G9Z A;  3K58 A;  4DUY K;  4RG8 A;  3TSP A;  4F3O A;  1BU6 O;  2DFF A;  3BY5 A;  5AQM A;  2X78 A;  1J54 A;  4FZX C;  2JWK A;  3THW B;  2JWL A;  2XY5 A;  4BG9 A;  2Q0U A;  1NJZ A;  5AZJ A;  4DTM A;  4DSK A;  3KK7 A;  2E2O A;  3KK1 A;  1F21 A;  3FZH A;  4FJJ A;  2QKK A;  3I0S A;  3HP9 A;  1NMD A;  4DFP A;  3IUC A;  2YHB A;  4JEP A;  4CHY A;  4FM1 A;  3SAF A;  2QA4 N;  4KHQ A;  4FK0 A;  3V4I A;  3I8D A;  4N5S A;  4H0X B;  5A2Q O;  2VWJ A;  3HRG A;  1HPM A;  3VEX A;  1GLL O;  5EY4 A;  1RCH A;  4FWR A;  4E1J A;  3U3G A;  1T03 A;  2FC0 A;  4H03 B;  4H5W A;  4Z4C A;  1B92 A;  2EX3 A;  2YNI A;  3MN6 A;  1YJN N;  1C0T A;  1CXU A;  4BWJ A;  1RNH A;  4AHT A;  4H0O A;  3OYN A;  4IEE A;  4A2B A;  2F8T A;  2Z1I A;  2ZWH A;  1KTQ A;  3MK6 A;  4B1V A;  3ENB A;  4BGA A;  4BQZ A;  2NUB A;  3NE6 A;  1D9D A;  4DV2 K;  2WUS A;  3LPT A;  3OA9 A;  2P9S B;  4YOV A;  1S3X A;  3I55 N;  3WNF A;  4YNQ A;  3AA4 A;  3SAH A;  4IWV A;  1OH5 A;  4B1Z A;  1LWE A;  1Q82 O;  3NH1 A;  4LY7 A;  3U8X A;  3DLR A;  1NGA A;  3HOS A;  1BA1 A;  1TAQ A;  4KRF A;  4CJ3 A;  3MWP A;  1GOB A;  4CJS A;  1S5J A;  5BPN A;  1C0U A;  4DTJ A;  5FPM A;  1KXP A;  3O3G A;  3KKR A;  3AA2 A;  3EKS A;  2QK9 A;  5AQU A;  2HHS A;  5AZI B;  5BPM A;  4LFA K;  1NGB A;  4ICL A;  3T1H K;  1QQN A;  3SLC A;  4ILH A;  4M3R A;  2HHV A;  3AO1 A;  1RFQ A;  4BR4 A;  4LF9 K;  4O55 A;  4QCL A;  4CEB A;  5GAE P;  2G8V A;  4BVP A;  4EAH D;  4Z4G A;  3K5O A;  3VQ7 A;  4B08 A;  5IT9 O;  2HF4 A;  2P9L A;  3EEQ A;  4XEI A;  3SI6 A;  3DRS A;  1J53 A;  4DQS A;  4GV6 A;  3IDH A;  1FXX A;  5GIO A;  4N41 A;  2KW4 A;  2W42 A;  5BR8 K;  1ZBL A;  3N4Q A;  3UE5 A;  4BDP A;  2EHG A;  5KRT A;  1WB9 A;  5M1Q A;  2PYJ A;  2OTJ N;  4DFJ A;  1N32 K;  3ZT3 A;  1IV0 A;  1JCG A;  4NCG A;  1MA9 B;  4A57 A;  1BO5 O;  4B1Y B;  4E89 A;  4HTL A;  1WUA A;  3M8R A;  3P39 A;  1NMN A;  3O80 A;  4HHT A;  4JKA A;  2UXD K;  2E2N A;  4CJE A;  4JAX A;  1EX4 A;  5HBM A;  1YIT N;  4DR6 K;  3TAG A;  3SPY A;  3ID8 A;  4JKH A;  1O1W A;  1XMQ K;  2E2Q A;  2D0O A;  3VGK A;  4IO8 A;  1TVR A;  1BI4 B;  4FWS A;  1QZ6 A;  3CJC A;  3O3F A;  3QER A;  1ZC6 A;  4CZK A;  3J80 O;  2R7Y A;  3SUO A;  3TU5 A;  4KHW A;  3CIP A;  2WOM A;  3SNN A;  1VQ4 N;  3H46 O;  2A5X A;  3VQ8 A;  2VG7 A;  2YKM A;  2W40 A;  3R6M A;  2J4R A;  4WF9 L;  1U2V A;  2QI2 A;  2NRH A;  1JL1 A;  4CHZ A;  3EE8 A;  2A40 A;  4IOX A;  3EL2 A;  2H3G X;  1T8E A;  3A8Y A;  3ZT1 A;  3SZ2 A;  2RE2 A;  3LZJ A;  3HPO A;  5D3G A;  1SS6 A;  4FVM A;  2O8E B;  4M42 A;  3P31 A;  2ZE2 A;  4ILG B;  5FRO A;  3CPE A;  3C0B A;  2VGM A;  3RWU A;  3V1Q A;  1E4G T;  4DSL A;  3NDK A;  1L3S A;  3QLH A;  3RMD A;  4J2B A;  4AIL C;  4BRI A;  3M1F A;  2YJE A;  1VSE A;  5M1F A;  3J7Z O;  2IGI A;  4E7L A;  1HPZ A;  3TAB A;  3VEO A;  4DHY A;  3U9Z A;  3SMP A;  1XHZ A;  4I2P A;  3CCR N;  5C15 A;  2FF6 A;  2Z1G A;  2NRZ A;  3C6U A;  1KLM A;  3GDQ A;  2QXF A;  5FPD A;  4DWI A;  3ZSQ A;  3MEC A;  3A0I X;  3QB0 A;  3LDO A;  3TAM A;  4IZ9 A;  3MEE A;  3W0L A;  5JS1 A;  4FJI A;  4H5N A;  4J2D A;  1RBV A;  1ZXO A;  2P9S A;  3V1R A;  1WSH A;  5AQN A;  5C2D A;  3HI0 A;  1RDA A;  4N47 A;  1KCF A;  4B9Q A;  3V81 A;  3FFK B;  5F2R A;  4B3S K;  3BUZ B;  3TWH A;  4FJN A;  3NAE A;  1VSF A;  1SKW A;  3L3V A;  5CZ2 A;  3AVA A;  3AAP A;  3OYG A;  2KQ2 A;  1TGO A;  4OO1 J;  2NLX A;  4ELV A;  3VA0 A;  4PKG A;  3SQ0 A;  5BRE A;  3CC4 N;  4FOE A;  3ZSR A;  5JMV A;  4E3S A;  2O4G A;  4ID1 A;  1X3N A;  5AZI A;  1JCF A;  1I94 K;  2RPI A;  1H1V A;  3L2U A;  1P90 A;  1Q8I A;  4EHT A;  1JLG A;  2IVO A;  4BE1 A;  1KFS A;  1NOZ A;  2V52 B;  2GEL A;  2P5O A;  3G71 N;  1DTQ A;  3VGM A;  4B9S A;  4WE1 A;  4BRK A;  2FSN A;  1QQO A;  4BRL A;  2ASM A;  3KKS A;  3A5N C;  2ZM6 K;  3TAP A;  4A59 A;  3NCI A;  4CVN E;  3VQ4 A;  5BRD A;  4OGE A;  2FSJ A;  1OVY A;  3O6W A;  3QBW A;  4CIE A;  2BDP A;  4DCH A;  4H4O A;  2NRT A;  3AVN A;  3NF7 A;  4DR4 K;  4IO9 L;  3J7A P;  1N6Q A;  4FW1 A;  5AQR A;  4JNE A;  3O9R A;  4B9U A;  4CZF A;  3LP3 A;  2OZM A;  1OKJ A;  4YDU C;  3V6D A;  1DEJ A;  2YJF A;  5FLX O;  3OYC A;  2ZF5 O;  4IJA A;  3ID6 A;  3AY9 A;  2D0A A;  5HP1 A;  3LP1 A;  3VGL A;  1HMV A;  1GLB G;  2HVI A;  3L6Q A;  3EZ5 A;  1CXQ A;  4HCB A;  3J8A A;  2F9T A;  2ITG A;  3QIC A;  1GLE G;  4OPK A;  1U6Z A;  4FM2 A;  1WBB A;  4CCH A;  4YOR A;  4DS4 A;  1RTH A;  1JLA A;  5H1S Q;  3QNO A;  2ZJP L;  4JI7 K;  2QWO A;  3OHR A;  1VRT A;  4JN4 A;  2V7Z A;  3VQP A;  4W5O A;  5CZ1 A;  5F0X A;  3DLB A;  4CJV A;  4FLU A;  2HBK A;  1IBL K;  4LF8 K;  2IVP A;  5HOO A;  4MFB A;  4A61 A;  3WNH A;  4AHV A;  1GLA G;  1BCO A;  3O08 A;  3T69 A;  4BRG A;  2A1S A;  1YHQ N;  3O3H A;  3S3M A;  3C7N B;  3K57 A;  3UB5 A;  1BL3 A;  1IG8 A;  4B3O A;  3RR7 A;  3ZX3 A;  3P5J A;  3D2E A;  4BWM A;  3O1B A;  1HQU A;  2QWR A;  3RRG A;  1WAF A;  1VQ6 N;  1XNQ K;  2AP1 A;  1JCE A;  4BR2 A;  1VSK A;  1XC3 A;  1X9J A;  1JKH A;  3DRR A;  4IG3 A;  1ZBF A;  3ZYY X;  4OLA A;  3EKU A;  4I7F A;  2PBD A;  4H0T B;  4OKE A;  4DTN A;  5JVG L;  2A1R A;  4KV8 A;  2OCE A;  2JLE A;  4E19 A;  4TSX A;  2GWJ A;  4I6M A;  4XIU A;  2HMP A;  5CE3 A;  5TKW A;  1NK7 A;  3VQB A;  2G8K A;  2O8E A;  2GTD A;  1QHT A;  1JXE A;  3SBG A;  3QBX A;  2FBV A;  4LF6 K;  4H4M A;  1EXQ A;  3AO2 A;  3CM6 A;  3O9S A;  4FJ5 A;  1Y97 A;  3NMU A;  1TUY A;  1TKD A;  1K6Y A;  3GOI A;  3O8M A;  3T1Y K;  1NGD A;  1REV A;  1NM1 A;  3DXK B;  2CGL A;  5E41 A;  4LFB K;  5LL6 Z;  2KKZ A;  5SWM A;  3VMF B;  4JRP A;  1QHA A;  3OYD A;  1HYV A;  3K2P A;  2A42 A;  1NGI A;  3K9J A;  4XH5 A;  1YAG A;  1GLJ O;  4DQI A;  2HW3 A;  3U4L A;  4DV6 K;  1OH8 A;  4BR9 A;  2G8I A;  1U48 A;  4HTU A;  4X65 K;  3AO4 A;  3EO3 A;  2Q36 A;  4EZ9 A;  4B1X B;  3F73 A;  3E1Y A;  1KAZ A;  1JJ2 M;  2E88 A;  5CY4 A;  4BVO A;  1BOT O;  3DLE A;  4KH5 A;  4EIA A;  4CF2 A;  3E01 A;  3CCL N;  4IKF A;  4AHU A;  4OLB A;  1W2B M;  1Q81 O;  1V4T A;  3TAR A;  3K5L A;  4KH4 A;  2YV0 X;  2E4L A;  4DS5 A;  3SUQ A;  3JS6 A;  2YCH A;  3L2R A;  4OPA A;  5B8H A;  1VQL N;  5EX5 A;  4JI5 K;  2E20 A;  2KTQ A;  2O4I A;  4FLY A;  4OGC A;  2ITM A;  1K8K B;  4X64 K;  5CYM A;  4BDY A;  3MCP A;  4M7X A;  4DQR A;  2HBJ A;  2WTU A;  1RT1 A;  2PY5 A;  4B8A B;  4CBX A;  1KSP A;  4KHY A;  4H8K A;  3BF1 A;  4Q5V A;  2HMI A;  4YDU A;  1YVU A;  3CCQ N;  2YHW A;  4DMN A;  5FPE A;  2F8S A;  4CER A;  4FJ9 A;  3VTI A;  4EFH A;  2Q2R A;  2B4J A;  4C1N I;  4XH1 A;  5E84 A;  4B3M K;  4X66 K;  1NWK A;  1U04 A;  3ZSX A;  2OPQ A;  3IMX A;  4UQG A;  3WEE B;  2Z1J A;  4H0P A;  4HUG A;  5TKY A;  4KPY A;  4DLE A;  1XUP O;  3HPG A;  4MO4 A;  4I9Q A;  2NRX A;  2E5L K;  4FK4 A;  1QZ5 A;  3JAM O;  1N5Y A;  4PHT X;  3E9L A;  3FFI A;  5ADX H;  3CQY A;  1Z6R A;  4J8F A;  3O4W A;  3OYK A;  3HK2 A;  3SV3 A;  5E26 A;  4L8R B;  3T1A A;  4LC9 B;  1BCM A;  3IKM A;  4C8N A;  1QVF M;  3MCA B;  5M1K A;  3CYM A;  3CJB A;  3HL8 A;  3ENH A;  1VSM A;  3KLE A;  3W3D A;  5FRM A;  5AQP A;  1G99 A;  2FF3 B;  4L3Q A;  2Y1I A;  3FE1 A;  4CEF A;  3LP2 A;  5AQQ A;  3PV8 A;  4PL7 A;  2IC3 A;  3ZSZ A;  1MU2 A;  3CXC M;  1IBM K;  3QDK A;  4NCB A;  1VQM N;  3HXM A;  1RT3 A;  2VQF K;  4CJR A;  2PFU A;  4N76 A;  3GE1 A;  3AVG A;  1TK0 A;  4KI6 A;  5FDL A;  1KFD A;  2RKI A;  4LF4 K;  3T7Z A;  4CW7 B;  1QTM A;  1TL1 A;  2Q97 A;  1RDB A;  3H6E A;  4K8X A;  5GAG P;  1ZYQ A;  1QSS A;  1A5V A;  1KQS M;  1NKE A;  1WN7 A;  4KB0 A;  2QTD A;  3LDP A;  5C12 A;  1MWM A;  5DM7 L;  3G0Z A;  1NGJ A;  4CJ5 A;  4Z4H A;  3CCU N;  5AFU A;  1X1P A;  2W6L A;  5AQF A;  3NBP A;  4K41 A;  2O8C B;  4CGI A;  4CJQ A;  4WQ5 C;  1IJJ A;  1VSI A;  3WNG A;  4FPB A;  3V9X A;  1DKG D;  3LDL A;  3VQ6 A;  3VOV A;  4E7K A;  3F2K A;  5MLC Q;  5AQZ A;  3DXK A;  3VF2 A;  4E7J A;  5BRF A;  3CJ9 A;  4Z0U A;  3KIO A;  5GIN A;  3VQQ A;  1LAV A;  1DGK N;  1L3T A;  4CZL A;  3OYA A;  1VSD A;  3QNN A;  4F9O A;  4KHN A;  4AHS A;  1SL0 A;  4BRD A;  4GKJ K;  3LDS A;  3ZEU B;  3RRH A;  2UXB K;  1KD1 O;  4OPH A;  3CPW M;  1OH6 A;  4JI3 K;  1T44 A;  3O4N A;  3HT3 A;  1FK9 A;  3RTV A;  4Y1C A;  5M1O A;  1OVQ A;  4A5A A;  1KLN A;  2X6N A;  1TL3 A;  2X74 A;  3LZI A;  1HLU A;  1XHX A;  3AGK A;  3OYB A;  3AVM A;  4YOU A;  3EN9 A;  3U6F A;  3P1G A;  3MWT A;  2D5R A;  3HO1 A;  5KQ8 A;  4DR3 K;  1NJI O;  2NZT A;  1TV6 A;  1QSY A;  4DQP A;  4JV5 K;  2Q31 A;  2BAN A;  3H1Q A;  3PUF A;  4CHQ A;  4KB1 A;  3B6O A;  1D4X A;  1UWB A;  1Z05 A;  5LJW A;  4FLT A;  3MXM A;  4DSF A;  4B9T A;  4FWP A;  3FZF A;  3EE9 A;  2IDO A;  2FBT A;  4JD2 B;  3VF4 A;  4CE9 A;  3CI5 A;  3ZSV A;  4DU3 A;  3OVN A;  4CED A;  1SL2 A;  3Q7B A;  1VK0 A;  4JKG B;  2UXC K;  1HR0 K;  4DSJ A;  3L4Q A;  2P9U A;  5AQX A;  4AM7 A;  2RF2 A;  4O5F A;  3I8B A;  3ZT0 A;  4M3Y A;  1J9A A;  3KHY A;  4K0K K;  3U9D A;  3SUN A;  3PX4 A;  4FM0 A;  1HJO A;  3ZX0 A;  1NK9 A;  1D9F A;  3MX5 A;  3MX2 A;  5I9E B;  1C0F A;  4JKF A;  4C8O A;  4CJ7 A;  5KI6 A;  4JK8 A;  3ZSO A;  1IKY A;  1YVN A;  4CK2 A;  4AHR A;  2YKN A;  2G8U A;  3KLG A;  1VHX A;  2HHH K;  3VQE A;  3LAM A;  3JSM A;  3G10 A;  1HJR A;  2WC9 A;  3VER A;  4K42 A;  1GOA A;  1Z26 A;  2F96 A;  4LH5 A;  1DTT A;  4N56 A;  3NHG A;  4YOX A;  5M1N A;  1BIS A;  1VRU A;  1FW6 A;  1XNR K;  3BEX A;  1NK5 A;  3DXM B;  1NKB A;  5LJV A;  5KPR A;  5KQD A;  3TAE A;  1J5E K;  3K5N A;  3THV A;  5C0Y A;  2UYT A;  1T6C A;  2QWL A;  3CJA A;  3G4S N;  1C0M A;  2IVN A;  3ALY A;  5KPZ A;  5KGW A;  5EXW A;  4ID5 A;  5M1P A;  2ASP A;  5F1X A;  2QWP A;  1ASW A;  1HKC A;  4DKW A;  1KC8 O;  3THW A;  4H0Y B;  4R79 A;  4JLH A;  1BHL A;  3M5R A;  4JI6 K;  4C8L A;  1GLF O;  3PLA A;  1IH7 A;  4W5R A;  5FRN A;  1GLC G;  1YUW A;  3MDQ A;  3ZCM A;  2PYL A;  3C6T A;  2GUI A;  3UKR B;  4O8U A;  3HSC A;  4WQ5 A;  4ZTJ A;  1BWF O;  3AVF A;  4EP4 A;  4HUF A;  1NJW A;  3QET A;  3ZLJ A;  1K9M O;  3SQ2 A;  2OPS A;  2KLA A;  1RGI A;  4M3U A;  1CLQ A;  1HYZ A;  2IAJ A;  4KTQ A;  3AA3 A;  5JS2 A;  1NK6 A;  5HRO A;  3LWL A;  4ISF A;  1KRP A;  2QEX N;  3ZSY A;  3ZSW A;  4QOZ B;  2F7T A;  5JLH A;  3HOT A;  1VQ7 N;  3O9U A;  4BRH A;  4FWN A;  2OAN A;  1VQ9 N;  3KVG A;  3MN7 A;  2O8C A;  4DSI A;  1NGE A;  1Q18 A;  1VSJ A;  3QEX A;  1S22 A;  1OH7 A;  5BR9 A;  1WAJ A;  4BY9 C;  4KHP K;  1WSG A;  4Q0B A;  1P8Z A;  3DOK A;  3L4I A;  1A5X A;  3V9W A;  1BA0 A;  3IS9 A;  1QE1 A;  2OPP A;  2HF3 A;  1YTA A;  4NYF A;  3D2F B;  3D0P A;  3D6R A;  4RW7 A;  1RBR A;  1S1X A;  1EP4 A;  4CJK A;  3RMC A;  1KAX A;  3OYM A;  3M8P A;  1N33 K;  3NF8 A;  1X3M A;  3ASM A;  2OYQ A;  3LM2 A;  3CCJ N;  2YNG A;  4BRF A;  4M3Z A;  3L0Q A;  3P38 A;  4H5T A;  4BDZ A;  3QEI A;  1HKB A;  4FVU A;  4GY2 B;  4FXD A;  4BG8 A;  4BE0 A;  2VWK A;  3AVB A;  1RDW X;  3H3O B;  3R3L A;  1XI1 A;  2IS3 A;  2XY8 A;  3AVH A;  1NG9 A;  3G6E N;  3PX0 A;  3THY B;  4MLE A;  5AQT A;  2G8W A;  2VCP A;  4BGB A;  2GX9 A;  1U49 A;  3DLK A;  4MLH A;  4JI4 K;  5AQH A;  4GV9 A;  3CMA N;  4J2A A;  5BN8 A;  2P9P B;  3CHW A;  1KVC A;  4ELU A;  1L5U A;  2E2P A;  1Q86 O;  5BRH A;  3RSE B;  1IKX A;  1C1B A;  1HNX K;  4JKE A;  4JKG A;  1WSF A;  4W5T A;  3AO3 A;  3E9P A;  3KLH A;  4B3R K;  2XRI A;  3CC7 N;  4IEI A;  3OYE A;  2HHU A;  4FO0 A;  3SV4 A;  1SL1 A;  1YIJ N;  4EP5 A;  2BUP A;  4KHS A;  1JLQ A;  3VQA A;  1E3M A;  4FYD A;  1YF5 L;  3PSI A;  5AQW A;  3BZK A;  1BI4 A;  3AO5 A;  3BF3 A;  3JXU A;  4IG0 A;  5AQO A;  1HKG A;  4NB4 A;  3CER A;  3I33 A;  2CH6 A;  2F9W A;  3KWG A;  4PA1 A;  4RW8 A;  2UUA K;  5GIP A;  4DTS A;  4KBO A;  2E1Y A;  4CHN A;  3ATV A;  5EU7 A;  2GV9 A;  5DMR A;  4JS5 A;  3OBY A;  4CGF A;  2NRR A;  1GLD G;  4MO5 A;  4CEE A;  4JS4 A;  1VSH A;  4R5P A;  4PKH A;  1JLE A;  2I7N A;  4W5Q A;  4E1M A;  3C95 A;  4NXM K;  3ULE B;  1B9F A;  5K14 A;  4JKB A;  4WQ4 C;  1B9D A;  3KD5 E;  1JLB A;  4CZG A;  3OYH A;  3TTF A;  1NJX A;  3QO9 A;  3KJV A;  2YHX A;  3CG7 A;  2D4W A;  3J81 O;  4CD3 A;  1RT5 A;  4IBN A;  4LD0 A;  4BC5 A;  3RMB A;  4FL9 A;  3MED A;  4F8R A;  3EY1 A;  5AJ3 K;  2E6M A;  4CGH A;  1HX1 A;  1N36 K;  1XWL A;  2HND A;  3UKR A;  3B8A X;  4LF5 K;  1WSI A;  2HNZ A;  4CK1 A;  5SZT A;  2YNF A;  3L2V A;  3TSQ A;  3S3O A;  2Z1H A;  3D7E O;  3KLF A;  3THX B;  1NBW A;  2BGG A;  1NLV A;  3AVC A;  1NK4 A;  3A5L C;  1LW2 A;  3NF6 A;  3KD1 E;  1VSL A;  3DRP A;  4M7Y A;  3Q7C A;  3K0S A;  4C8M A;  3VPZ A;  4DU1 A;  1WOQ A;  4AM6 A;  4CIG A;  1W0H A;  4OPJ A;  5AQS A;  1ILY A;  4JI8 K;  3CJ1 A;  1IG9 A;  1TK8 A;  5GAD P;  2G8H A;  1FJG K;  4I2Q A;  4FLX A;  3QFP A;  2O8D B;  3H3N O;  4DR1 K;  2AA4 A;  4CF8 A;  1I3A A;  1LOT B;  4DV0 K;  4KTZ A;  1CZA N;  4NXN K;  1MWK A;  4Y1D A;  2YHY A;  4FWQ A;  4CD1 A;  1QVG M;  2PAV A;  2P9K B;  3D2F A;  4OKJ A;  1ZBU A;  2P9L B;  1ATS A;  1S9E A;  2HHX A;  3M6G A;  3WQT A;  4GNI A;  3VQ5 A;  3F5T A;  4CJ4 A;  4A62 A;  1Q7Y O;  3FLC O;  2B6A A;  3K59 A;  2YX6 A;  4FJX A;  4CFC A;  2RN2 A;  3IRX A;  4DF4 A;  3PO5 A;  4K8Z A;  1K8A O;  2VYP A;  1QSL A;  1CZ9 A;  4DU4 A;  2X6S A;  4YY3 K;  1E4F T;  4E7I A;  3LM9 A;  3VEZ A;  2QM1 A;  4U7B A;  4F2S A;  3LAK A;  1JLC A;  2VQE K;  1VQN N;  3HJF A;  3DOL A;  3CME N;  1N8R O;  5KRS A;  1BQN A;  3ITH A;  3TTC A;  4JK9 A;  3TTD A;  4DUZ K;  2ZGZ A;  4WCE L;  3CCE N;  3SCX A;  3MEG A;  5IWA K;  4QS9 A;  1UOC A;  1ZBI A;  3PIP L;  3QEW A;  3OW2 M;  2NRW A;  2HHW A;  4CBU A;  4FWM A;  4GVE A;  3DI6 A;  4M3T A;  4YOT A;  4DSE A;  2P9P A;  4Z4I A;  1CZB A;  3CQ8 A;  3KK2 A;  1O13 A;  4CJP A;  1WSE A;  3NGZ A;  3HVR A;  3RSE A;  5LMU K;  2KHO A;  4BRP A;  2QWN A;  5JVH L;  2F4V K;  4IJN A;  2GWK A;  3SUP A;  4CZE A;  1VQO N;  4W5N A;  4YOW A;  1ZBH A;  2AJQ A;  2ATQ A;  4AF1 A;  1KVB A;  4JRQ A;  3LDQ A;  4DR5 K;  3WT0 A;  1NKC A;  4CF9 A;  4LFC K;  2KFN A;  3CCV N;  3IAY A;  4CIF A;  4Z94 A;  2D1K A;  3TAN A;  4PWD A;  4WQ4 A;  1RDC A;  1L3U A;  3C7N A;  2O8B B;  4H0V B;  1SKR A;  4CK3 A;  4OX9 K;  3LWM A;  2RHK A;  3P4I A;  3AVK A;  1EET A;  4DTP A;  1C1C A;  1LV5 A;  1NJY A;  2D0P A;  4BRQ A;  4KTW A;  1HNI A;  4BR7 A;  3TAF A;  3HYF A;  3C6H A;  2DFE A;  3AGR A;  5HRS A;  4ZHR A;  3S41 A;  1U4B A;  3NGI A;  4CEA A;  3ULE A;  1RBS A;  1S6Q A;  4IDK A;  4E1N A;  3MMV A;  1DT9 A;  3VQC A;  4PKI A;  4AHC A;  3V1O A;  2Q1N A;  4OJR A;  5JLF A;  3FR0 A;  5C2F A;  3UKU B;  1I39 A;  3KK3 A;  1J6Z A;  4RW4 A;  2YHA A;  4EHU A;  3VEN A;  4PL8 A;  4CI6 A;  1NNE A;  3SJJ A;  3OJU A;  2YI1 A;  4BRO A;  2XO7 A;  1QQM A;  3MAQ A;  4J2E A;  4DR2 K;  3DWL A;  2V51 B;  1A5W A;  3AA5 X;  1RT4 A;  4CJL A;  2Y1J A;  1Z25 A;  4DV4 K;  1TK5 A;  3OS2 A;  1VQ8 N;  3THX A;  2UU9 K;  4BRM A;  2W6K A;  3VA3 A;  5J2M A;  3NFA A;  1WLJ A;  5AQI A;  4B9M A;  1G15 A;  2KZM A;  1VQP N;  1RDU A;  4GW6 A;  5AQJ A;  4KH6 A;  1W9H A;  4PY5 A;  1NGH A;  1RBU A;  5JIC A;  3N4P A;  4I9L A;  3DLH A;  2WBN A;  2JGU A;  4NO7 A;  2LSN A;  3ULD A;  4NCA A;  2O8D A;  4NYN A;  4BC2 A;  3BP8 A;  4FWK A;  4B9V A;  3VET A;  1EWR A;  3FGU A;  5AQV A;  3V9Z A;  4O0I A;  4JKD A;  3MN5 A;  3V9U A;  2E1Z A;  1IKW A;  5EVZ A;  2P9I B;  5DM6 L;  3S3N A;  3SAG A;  3SMS A;  3O4Q A;  2WON A;  4O4G A;  1S1U A;  2P9K A;  5J1E A;  3AAQ A;  4BC4 A;  4C1N K;  3U3Y A;  4KAZ A;  2I5J A;  1UA1 A;  2DFH A;  2ZQB A;  3H45 C;  1NOY A;  1K8K A;  5CR4 A;  1RTI A;  4DTO A;  1BG3 A;  5HL7 L;  1T7P A;  4O8K A;  1VQ5 N;  4FSV A;  3AVI A;  1TAU A;  2HOE A;  4WFN L;  4BE2 A;  3LAN A;  2B5J A;  4X62 K;  4GV3 A;  3QIP A;  3THY A;  4Z4F A;  4CZJ A;  2ASO A;  4BRA A;  4G1Q A;  4CEC A;  1ITG A;  5KTQ A;  2HBL A;  1IKV A;  2QWQ A;  1L3V A;  4IFV A;  3L2Q A;  3GG4 A;  4FLW A;  2QXL A;  2ETJ A;  4GVM A;  4B1U B;  1LWC A;  3WQU A;  4DQ8 A;  1YTU A;  3T3F A;  4PQU A;  3WEE A;  4A5B A;  4BC3 A;  5I3U A;  1KVA A;  4A2A A;  1BUP A;  1Q9X A;  4F2R A;  3CC2 N;  5HRN A;  3HP6 A;  4QAG A;  3R1X A;  3CFR A;  2I7P A;  2FBX A;  1BIZ A;  3L2W A;  1W7A A;  4DTX A;  2FXU A;  5HLF A;  3CJ7 A;  2P51 A;  4HVJ A;  4FJ8 A;  5AQY A;  1XC9 A;  3FZM A;  1IO2 A;  4CEZ A;  1TKX A;  4CBW A;  1TYQ B;  4FJL A;  1C6V A;  3S9H A;  4KHU A;  3DM2 A;  2XHB A;  1XQS C;  3BZC A;  2E6L A;  3NVM A;  2HNY A;  1NK0 A;  2HST A;  3HBT A;  2QKB A;  4IOA L;  3D2E B;  4CGD A;  1S1T A;  3B6P A;  2BTF A;  4IOC L;  3V9S A;  2O8F B;  2DTU A;  2HBM A;  1SUQ A;  5J2Q A;  2HVH A;  1SZ2 A;  3ZET B;  1IBK K;  1RT2 A;  1RT7 A;  1V4S A;  4RW9 A;  3IG1 A;  4I6M B;  2O8B A;  5AFU H;  2V7Y A;  1TKT A;  3KLI A;  4EZ6 A;  2Q0R A;  4IFY A;  3CF5 L;  1HUX A;  1HYS A;  3K9K A;  1RT6 A;  4CHP A;  4FJM A;  3P83 D;  4BRN A;  4FLV A;  4GKK K;  2FLO A;  4HWI A;  2HB5 A;  1KAY A;  4CFA A;  4C8K A;  5KGX A;  3VQ9 A;  1BIU A;  1R0A A;  1YJW N;  3VN5 A;  3SQ1 A;  4IDH A;  1S1V A;  4JHD B;  4DFK A;  1C0G A;  4M63 C;  3O9Q A;  4NLB A;  1BGX T;  4FPA A;  4WFA L;  1WNS A;  5EOY A;  3CFP A;  3O9T A;  4O44 A;  3ATU A;  2HHT A;  3UKU A;  1UA0 A;  4ELT A;  3I0R A;  3D45 A;  3LL3 A;  2PZS A;  4B9N A;  3AV9 A;  3QIN A;  2HHQ A;  3OYJ A;  2DY4 A;  4JI1 K;  5C25 A;  2GEM A;  3HVT A;  4LSL A;  1EWQ A;  1ESV A;  3NF9 A;  3QEV A;  4KI4 A;  2P9N B;  4B9L A;  4DFM A;  1T6D A;  4FZZ A;  2OPR A;  4E7H A;  3J7Y P;  3HM9 A;  3TI0 A;  4BRC A;  3WXK A;  4AQY K;  2OZS A;  4DF8 A;  1SQK A;  2GBZ A;  3ZEU A;  4FLZ A;  4DG1 A;  3RVC A;  3MXI A;  4NLC A;  3QFU A;  4DQQ A;  2OA8 A;  3QES A;  2KFZ A;  2E8A A;  4FCY A;  3BGR A;  1LW0 A;  3C94 A;  1BQM A;  3A5O C;  4FW2 A;  1SAZ A;  3LDN A;  4DLG A;  4XH4 A;  4B8C A;  3WNE A;  4OVL A;  2CGJ A;  4M45 A;  2NNW A;  4FOI A;  4CZH A;  3I56 N;  4CF0 A;  2P1J A;  1M1K O;  1QS4 A;  4QS8 A;  1JLF A;  5BN9 A;  1X9S A;  5KPT A;  2DPN A;  4CJF A;  3OBW A;  5AQK A;  2FBY A;  1TUU A;  2VGN A;  2UUB K;  3PY8 A;  2P9I A;  3VF6 A;  1LWF A;  2D0B A;  3AVL A;  3M3Z A;  3PIO L;  3WXL A;  4RCH A;  4KRE A;  4FWO A;  3OY9 A;  1VQK N;  3FZK A;  5CYQ A;  1HNV A;  1MDU B;  3CCS N;  3VEW A;  2WFB A;  4JKC A;  4UY8 O;  4BQL A;  4JD2 A;  3A2F A;  1XMO K;  1ASU A;  2XY7 A;  1HQE A;  1JXB A;  3WXJ A;  4FJH A;  4Z4E A;  3KTQ A;  1BDG A;  4ZTF A;  5I42 A;  4YFU A;  3H1V X;  4H5R A;  1D8Y A;  3OYI A;  2ZJR L;  1WBD A;  3LPU A;  1Q9Y A;  4LF7 K;  1HRH A;  2A3Z A;  3SK3 A;  3VQD A;  4F3T A;  4BAC A;  2IIR A;  5C24 A;  4H5V A;  3VES A;  4BR0 A;  3F9K A;  4ISE A;  5ADX A;  4CFB A;  4V19 S;  5ELZ A;  2QWM A;  4M41 A;  3VEY A;  4CGG A;  4E0D A;  3OTO K;  3DLL L;  4JYA K;  3PSF A;  4KO0 A;  1J5O A;  1JL2 A;  3C6A A;  3ZX2 A;  3CQX A;  3GL1 A;  2Q3S A;  4MDB A;  3H08 A;  3TSU A;  1NU0 A;  4CGJ A;  2QW9 A;  1M90 O;  4CES A;  5AZJ B;  3HM8 A;  1TKZ A;  3GBT A;  2W41 A;  5HRR A;  3DXM A;  4O0J A;  1TYQ A;  3DAW A;  5LMN K;  4HUE A;  4IXC A;  3WUH A;  4KFB A;  4CJW A;  3CET A;  1RBT A;  3L8B A;  3M8Q A;  2OTL N;  3K5M A;  3TPQ A;  4ISG A;  2O8F A;  3PO4 A;  4DR7 K;  2KZZ A;  5J2P A;  3OS0 A;  3ZT2 A;  2D0C A;  3NGY A;  4F4K A;  1NGC A;  4CZI A;  3WXM B;  3ZET A;  5GAH P;  3R8E A;  2BH1 A;  5AR0 A;  4CF1 A;  1NGG A;  1EO1 A;  1EQY A;  3HPH A;  4CFD A;  5LY3 A;  3TAQ A;  1S9G A;  5FPN A;  1ZBS A;  1EKE A;  3FZL A;  1YJ9 N;  1RDD A;  4YHH K;  4DV7 K;  3KZB A;  4IFE A;  4K43 A;  2FSK A;  5C10 A;  3SYZ A;  4WYB A;  4BRE A;  2ZJQ L;  2ZGY A;  4WFB L;  3CM5 A;  1X9W A;  3ENO A;  3DMJ A;  4FZY A;  4CEQ A;  1FKO A;  5AQG A;  1VAZ A;  4JHD A;  4B1W B;  4MQ3 A;  1W97 L;  4GMJ B;  4DB3 A;  1T05 A;  4BR5 A;  1ATN A;  5CHI A;  1QQC A;  4AH9 A;  3HZ6 A;  5T7B A;  3DJC A;  5C42 A;  3RMA A;  1LCU A;  4HCC A;  1S72 N;  1YXQ A;  3HST B;  3E66 A;  4CEO A;  4CJU A;  4K25 A;  3KWI A;  3QML A;  4DTR A;  3ZT4 A;  1X9M A;  3AVJ A;  4KKO A;  1C1A A;  1S1W A;  3MN9 A;  1HNW K;  4ILJ A;  3EZW A;  1ATR A;  4MDA A;  4LH4 A;  2P9N A;  3O5B A;  4CZM A;  1RIL A;  1WSJ A;  1SKS A;  3JYT A;  1U47 A;  3CFO A;  3R9P A;  2BE2 A;  4RTF D;  3OS1 A;  2GUP A;  2YNH A;  3IFR A;  3NH0 A;  3OYF A;  4DV5 K;  4DV1 K;  4FJG A;  2ZD1 A;  3EYZ A;  3BDP A;  1YI2 N;  4FJ7 A;  1U45 A;  1RTD A;  2XY6 A;  2VG5 A;  3T19 A;  5J2N A;  4QS7 A;  4FK2 A;  1YT3 A;  2VWB A;  3F9M A;  1DLO A;  3HTV A;  1D5A A;  4B3T K;  3C65 A;  3O1W A;  2P5G A;  4M3X A;  3SQ4 A;  4FJK A;  3TR8 A;  1FKP A;  4M3W A;  2IOC A;  4DTU A;  3ISN C;  4FWL A;  4PUO A;  4RW6 A;  2VG6 A; 
#chains in the Genus database with same CATH homology
 3SQ2 A;  2OPS A;  4M3U A;  4I9L A;  3DLH A;  1CLQ A;  1HYZ A;  2IAJ A;  4MFB A;  4KTQ A;  3WNH A;  4AHV A;  2JGU A;  2LSN A;  3AA3 A;  3ULD A;  4NCA A;  5JS2 A;  1NK6 A;  1BCO A;  4NYN A;  3QIO A;  2A1S A;  5HRP A;  3LAL A;  3O3H A;  3LWL A;  5HRO A;  3SPZ A;  3S3M A;  1KRP A;  4B9V A;  3ZSY A;  3K57 A;  3ZSW A;  4OKK A;  1BL3 A;  3MXJ A;  4O5B A;  4CJT A;  1RTJ A;  3RR7 A;  4B3O A;  3V9Z A;  4QOZ B;  4O0I A;  3P5J A;  2G8F A;  3V9U A;  4CHO A;  1S6P A;  4BWM A;  3PX6 A;  1IKW A;  2P5O A;  1HQU A;  3RRG A;  5DK5 A;  1WAF A;  4DSI A;  1VSJ A;  3L3U A;  3S3N A;  3O4Q A;  2WON A;  4O4G A;  1ASV A;  1S1U A;  1VSK A;  5J1E A;  1JKH A;  3DRR A;  3M8S A;  3OYL A;  4IG3 A;  3U3Y A;  1ZBF A;  4OLA A;  4I7F A;  1WAJ A;  4KAZ A;  3NH2 A;  1WSG A;  2KFZ A;  4OKE A;  4DTN A;  2I5J A;  1UA1 A;  4Q0B A;  2DFH A;  2ZQB A;  2A1R A;  4KV8 A;  3DOK A;  1NOY A;  1UAX A;  2JLE A;  1A5X A;  1RTI A;  4TSX A;  4E19 A;  4DTO A;  1T7P A;  3V9W A;  3IS9 A;  4XIU A;  1QE1 A;  2OPP A;  3DLG A;  3OJS A;  1NK7 A;  3AVI A;  1YTA A;  4NYF A;  1SV5 A;  3VQB A;  2G8K A;  1TAU A;  1LAW A;  3RR8 A;  4BE2 A;  3D0P A;  1QHT A;  4LSN A;  1RBR A;  4RW7 A;  3QEP A;  3LAN A;  2B5J A;  1JXE A;  1NK8 A;  2FBV A;  4H4M A;  1EXQ A;  1S1X A;  1EP4 A;  3DYA A;  3QIP A;  4CJK A;  1GOC A;  3RMC A;  3AO2 A;  3UIQ A;  4Z4F A;  3CM6 A;  3OYM A;  3M8P A;  3LP0 A;  4G1Q A;  1Y97 A;  4CEC A;  1ITG A;  4FJ5 A;  5KTQ A;  3K58 A;  1IKV A;  4RG8 A;  4F3O A;  3NF8 A;  3ASM A;  2OYQ A;  1TKD A;  1K6Y A;  1L3V A;  4IFV A;  1REV A;  2DFF A;  3L2Q A;  4FLW A;  2ETJ A;  2YNG A;  5E41 A;  4GVM A;  4M3Z A;  1LWC A;  5SWM A;  2X78 A;  4JRP A;  1YTU A;  1J54 A;  3T3F A;  4PQU A;  4FZX C;  3OYD A;  1HYV A;  4BDZ A;  2XY5 A;  3K2P A;  3QEI A;  1NJZ A;  4FXD A;  5I3U A;  1KVA A;  4BE0 A;  2VWK A;  4DTM A;  1Q9X A;  3AVB A;  4DSK A;  4F2R A;  5HRN A;  3HP6 A;  4DQI A;  4QAG A;  1F21 A;  3KK1 A;  4FJJ A;  2HW3 A;  3CFR A;  2QKK A;  3I0S A;  1XI1 A;  3HP9 A;  4DFP A;  2FBX A;  2YHB A;  1BIZ A;  4CHY A;  4FM1 A;  3AVH A;  2XY8 A;  2IS3 A;  3L2W A;  4HTU A;  1U48 A;  2G8I A;  4KHQ A;  3AO4 A;  4DTX A;  4FK0 A;  3V4I A;  5HLF A;  3I8D A;  4N5S A;  4HVJ A;  2P51 A;  3F73 A;  2VWJ A;  3PX0 A;  4EZ9 A;  4FJ8 A;  1RCH A;  1XC9 A;  5CY4 A;  1IO2 A;  2G8W A;  4CEZ A;  3U3G A;  3DLE A;  1T03 A;  1TKX A;  2FC0 A;  4Z4C A;  1B92 A;  4CF2 A;  4FJL A;  2EX3 A;  1C6V A;  2YNI A;  3E01 A;  3S9H A;  4IKF A;  4AHU A;  4OLB A;  1C0T A;  1U49 A;  1CXU A;  4KHU A;  3DM2 A;  2XHB A;  3DLK A;  4BWJ A;  1RNH A;  3TAR A;  3K5L A;  4AHT A;  4J2A A;  2E6L A;  2YV0 X;  2E4L A;  2HNY A;  1NK0 A;  3OYN A;  1KVC A;  4DS5 A;  2QKB A;  4ELU A;  3SUQ A;  1L5U A;  2F8T A;  4CGD A;  2Z1I A;  3L2R A;  1IKX A;  1KTQ A;  1S1T A;  3B6P A;  1C1B A;  3V9S A;  2NUB A;  3NE6 A;  2DTU A;  1D9D A;  2KTQ A;  1SUQ A;  3LPT A;  1WSF A;  4W5T A;  3AO3 A;  3KLH A;  2O4I A;  2XRI A;  4FLY A;  5J2Q A;  3OYE A;  2HHU A;  4OGC A;  3SV4 A;  1SL1 A;  3WNF A;  2HVH A;  4YNQ A;  3AA4 A;  1RT2 A;  1RT7 A;  5CYM A;  4BDY A;  4EP5 A;  4RW9 A;  4DQR A;  4KHS A;  1LWE A;  3IG1 A;  1JLQ A;  3VQA A;  1RT1 A;  4FYD A;  3NH1 A;  4LY7 A;  1TKT A;  3DLR A;  3KLI A;  2PY5 A;  4EZ6 A;  4B8A B;  4IFY A;  1KSP A;  4KHY A;  4H8K A;  1BI4 A;  4Q5V A;  3AO5 A;  1HYS A;  1TAQ A;  1RT6 A;  4CJ3 A;  4CHP A;  2HMI A;  4FJM A;  4KRF A;  3P83 D;  1GOB A;  1YVU A;  4CJS A;  1S5J A;  1C0U A;  4DTJ A;  4FLV A;  4IG0 A;  3O3G A;  2HB5 A;  4CFA A;  4DMN A;  4C8K A;  3KKR A;  3AA2 A;  4CER A;  4FJ9 A;  2F8S A;  5KGX A;  2QK9 A;  3VQ9 A;  1BIU A;  2HHS A;  4ICL A;  4PA1 A;  4RW8 A;  1R0A A;  2B4J A;  3VN5 A;  1U04 A;  3ZSX A;  4DTS A;  3SQ1 A;  2OPQ A;  1S1V A;  4M3R A;  2HHV A;  4UQG A;  3AO1 A;  4DFK A;  4CHN A;  4O55 A;  5EU7 A;  2Z1J A;  4QCL A;  4CEB A;  2G8V A;  2GV9 A;  5DMR A;  4HUG A;  4JS5 A;  4KPY A;  4Z4G A;  4DLE A;  1BGX T;  3HPG A;  4I9Q A;  3K5O A;  3VQ7 A;  4CGF A;  4B08 A;  4FK4 A;  4CEE A;  4JS4 A;  1WNS A;  3CFP A;  1N5Y A;  2HHT A;  4O44 A;  1VSH A;  4R5P A;  3FFI A;  3SI6 A;  3DRS A;  1J53 A;  4DQS A;  1JLE A;  4W5Q A;  1UA0 A;  3I0R A;  4ELT A;  4E1M A;  3D45 A;  1FXX A;  2PZS A;  4B9N A;  3AV9 A;  3QIN A;  3OYK A;  3C95 A;  4N41 A;  2HHQ A;  2KW4 A;  1B9F A;  3HK2 A;  5K14 A;  3OYJ A;  2DY4 A;  2W42 A;  1ZBL A;  1B9D A;  3SV3 A;  5C25 A;  1JLB A;  4BDP A;  3KD5 E;  4L8R B;  2EHG A;  3HVT A;  4LSL A;  5KRT A;  3OYH A;  1NJX A;  3T1A A;  3QO9 A;  3KJV A;  3NF9 A;  1BCM A;  3CG7 A;  2PYJ A;  3QEV A;  4KI4 A;  4C8N A;  4B9L A;  4DFJ A;  1RT5 A;  4IBN A;  4LD0 A;  4DFM A;  4FZZ A;  2OPR A;  4E7H A;  3ZT3 A;  3CYM A;  3RMB A;  4F8R A;  3MED A;  3HL8 A;  3TI0 A;  4NCG A;  3EY1 A;  3HM9 A;  1VSM A;  2E6M A;  4CGH A;  3KLE A;  5FRM A;  4E89 A;  2OZS A;  4DF8 A;  1XWL A;  2GBZ A;  2HND A;  4FLZ A;  2Y1I A;  4DG1 A;  1WSI A;  3M8R A;  2HNZ A;  4CEF A;  4DQQ A;  3MXI A;  2OA8 A;  3LP2 A;  4CK1 A;  5SZT A;  3QES A;  2YNF A;  3L2V A;  3PV8 A;  4FCY A;  2IC3 A;  3ZSZ A;  3BGR A;  1LW0 A;  1MU2 A;  1BQM A;  3C94 A;  4FW2 A;  2Z1H A;  3S3O A;  4HHT A;  4DLG A;  4B8C A;  3KLF A;  2BGG A;  4NCB A;  3WNE A;  3AVC A;  4CJE A;  1RT3 A;  3HXM A;  4OVL A;  3QEX A;  4M45 A;  1EX4 A;  1NK4 A;  5HBM A;  4CJR A;  4N76 A;  3TAG A;  3AVG A;  1TK0 A;  3SPY A;  4KI6 A;  1LW2 A;  5FDL A;  3NF6 A;  2RKI A;  1KFD A;  1O1W A;  4CF0 A;  2P1J A;  3KD1 E;  1VSL A;  1QS4 A;  3DRP A;  1JLF A;  1QTM A;  1TL1 A;  4C8M A;  4DU1 A;  1X9S A;  4CJF A;  4CIG A;  1W0H A;  4OPJ A;  1RDB A;  1TVR A;  2FBY A;  4K8X A;  1BI4 B;  1IG9 A;  1TK8 A;  3PY8 A;  1ZYQ A;  1QSS A;  1A5V A;  1NKE A;  1LWF A;  1WN7 A;  2D0B A;  3O3F A;  2G8H A;  4I2Q A;  4KB0 A;  4FLX A;  3QER A;  3AVL A;  2R7Y A;  3G0Z A;  3SUO A;  4CJ5 A;  4KRE A;  4Z4H A;  4KHW A;  4CF8 A;  3OY9 A;  1I3A A;  1X1P A;  2WOM A;  5CYQ A;  1HNV A;  4KTZ A;  4Y1D A;  3SNN A;  3VQ8 A;  2VG7 A;  2YKM A;  3NBP A;  3A2F A;  4CGI A;  4CJQ A;  4OKJ A;  1JL1 A;  1ASU A;  2XY7 A;  1ZBU A;  1HQE A;  1JXB A;  1S9E A;  4CHZ A;  1VSI A;  2HHX A;  3WNG A;  4FJH A;  4Z4E A;  3KTQ A;  4ZTF A;  3V9X A;  5I42 A;  3VQ5 A;  3VQ6 A;  4CJ4 A;  4YFU A;  1T8E A;  1D8Y A;  3ZT1 A;  3SZ2 A;  4E7K A;  2B6A A;  3OYI A;  3LZJ A;  3K59 A;  3HPO A;  5D3G A;  3LPU A;  4FJX A;  4CFC A;  1Q9Y A;  4E7J A;  1HRH A;  4FVM A;  2RN2 A;  3IRX A;  4DF4 A;  3PO5 A;  4K8Z A;  3VQD A;  4M42 A;  4Z0U A;  4F3T A;  3KIO A;  2ZE2 A;  4BAC A;  1QSL A;  3VQQ A;  1CZ9 A;  4DU4 A;  1LAV A;  5FRO A;  5C24 A;  2X6S A;  1L3T A;  3OYA A;  3F9K A;  1VSD A;  3RWU A;  3QNN A;  4CFB A;  4E7I A;  4KHN A;  4M41 A;  4AHS A;  3V1Q A;  4CGG A;  3NDK A;  1SL0 A;  4DSL A;  4E0D A;  4F2S A;  3LDS A;  3LAK A;  1JLC A;  3QLH A;  1L3S A;  3RRH A;  3RMD A;  4J2B A;  3HJF A;  3DOL A;  4KO0 A;  4AIL C;  1J5O A;  5KRS A;  1BQN A;  1JL2 A;  3ITH A;  3O4N A;  1VSE A;  3HT3 A;  1FK9 A;  2IGI A;  2Q3S A;  3RTV A;  4E7L A;  1HPZ A;  3H08 A;  4Y1C A;  4CGJ A;  3TAB A;  3SCX A;  3MEG A;  4CES A;  1XHZ A;  1KLN A;  2X6N A;  1TL3 A;  2X74 A;  1UOC A;  1TKZ A;  3LZI A;  1XHX A;  4O0J A;  5HRR A;  3OYB A;  3QEW A;  4I2P A;  1ZBI A;  3AVM A;  2Z1G A;  3C6U A;  3U6F A;  1KLM A;  4HUE A;  2HHW A;  2QXF A;  3P1G A;  4DWI A;  3DI6 A;  4KFB A;  3ZSQ A;  4M3T A;  4DSE A;  2D5R A;  3HO1 A;  4CJW A;  3MEC A;  4Z4I A;  1CZB A;  1RBT A;  3L8B A;  3CQ8 A;  1TV6 A;  3KK2 A;  1QSY A;  3TAM A;  4DQP A;  3M8Q A;  3MEE A;  1WSE A;  4CJP A;  3NGZ A;  3HVR A;  3K5M A;  2BAN A;  5JS1 A;  3PO4 A;  3SUP A;  3PUF A;  2KZZ A;  5J2P A;  4FJI A;  3OS0 A;  4J2D A;  4CHQ A;  1RBV A;  3ZT2 A;  2D0C A;  3NGY A;  3B6O A;  4KB1 A;  1UWB A;  1WSH A;  3V1R A;  4F4K A;  4FLT A;  4W5N A;  1RDA A;  4N47 A;  1KCF A;  3V81 A;  3MXM A;  1ZBH A;  2AJQ A;  4DSF A;  2ATQ A;  4CF1 A;  1KVB A;  4JRQ A;  4B9T A;  3HPH A;  4CFD A;  3TWH A;  2IDO A;  4FJN A;  2FBT A;  3NAE A;  1NKC A;  4CF9 A;  4CE9 A;  1S9G A;  1VSF A;  3TAQ A;  2KFN A;  3IAY A;  1SKW A;  3L3V A;  3ZSV A;  4CIF A;  4DU3 A;  3OVN A;  5CZ2 A;  4CED A;  1EKE A;  3AVA A;  1VK0 A;  1SL2 A;  3TAN A;  3OYG A;  2KQ2 A;  4DSJ A;  1TGO A;  4PWD A;  1RDD A;  4ELV A;  3VA0 A;  2RF2 A;  1RDC A;  3SQ0 A;  3SYZ A;  3ZT0 A;  1L3U A;  1J9A A;  3ZSR A;  4E3S A;  4M3Y A;  2O4G A;  4ID1 A;  3SUN A;  1SKR A;  3CM5 A;  1X9W A;  2RPI A;  3DMJ A;  4CK3 A;  4FZY A;  3L2U A;  3PX4 A;  3LWM A;  1Q8I A;  4BE1 A;  1JLG A;  4FM0 A;  1D9F A;  4CEQ A;  1NK9 A;  1FKO A;  1KFS A;  3AVK A;  1EET A;  4MQ3 A;  4GMJ B;  4DTP A;  1NOZ A;  1T05 A;  4C8O A;  1C1C A;  1QQC A;  4AH9 A;  1NJY A;  1LV5 A;  5T7B A;  4KTW A;  5KI6 A;  5C42 A;  3ZSO A;  1IKY A;  1DTQ A;  1HNI A;  3RMA A;  4CK2 A;  4B9S A;  3TAF A;  4WE1 A;  4AHR A;  2YKN A;  3HYF A;  2G8U A;  3KKS A;  3KLG A;  4HCC A;  3HST B;  2DFE A;  3VQE A;  3LAM A;  4CEO A;  3TAP A;  3JSM A;  4CJU A;  3G10 A;  1HJR A;  5HRS A;  4ZHR A;  2HVI A;  3NGI A;  1GOA A;  3NCI A;  4DTR A;  1Z26 A;  1U4B A;  2F96 A;  4LH5 A;  3ZT4 A;  1X9M A;  3VQ4 A;  4CEA A;  3AVJ A;  1DTT A;  1C1A A;  1RBS A;  1S6Q A;  1S1W A;  4IDK A;  4KKO A;  4OGE A;  4N56 A;  4E1N A;  3NHG A;  1BIS A;  1VRU A;  4CIE A;  2BDP A;  4LH4 A;  4H4O A;  3VQC A;  3AVN A;  1NK5 A;  3NF7 A;  4AHC A;  1NKB A;  3V1O A;  1RIL A;  4OJR A;  1N6Q A;  4FW1 A;  3TAE A;  1WSJ A;  1SKS A;  4B9U A;  1I39 A;  3JYT A;  3K5N A;  3KK3 A;  1U47 A;  3THV A;  3LP3 A;  2OZM A;  3CFO A;  4RW4 A;  2YHA A;  3V6D A;  1C0M A;  2BE2 A;  3ALY A;  3OS1 A;  3OYC A;  2YNH A;  5KGW A;  3NH0 A;  3OYF A;  4ID5 A;  2D0A A;  4FJG A;  5HP1 A;  3SJJ A;  2ZD1 A;  3OJU A;  3LP1 A;  3EYZ A;  1HMV A;  3BDP A;  1U45 A;  1RTD A;  2XO7 A;  4FJ7 A;  2XY6 A;  2VG5 A;  3T19 A;  3MAQ A;  4J2E A;  3EZ5 A;  1ASW A;  1CXQ A;  5J2N A;  4PY5 A;  1A5W A;  3AA5 X;  1RT4 A;  1YT3 A;  4CJL A;  4FK2 A;  2Y1J A;  1Z25 A;  1TK5 A;  4HCB A;  3OS2 A;  1DLO A;  2ITG A;  4OPK A;  4CCH A;  4FM2 A;  4DS4 A;  1D5A A;  4JLH A;  1BHL A;  1RTH A;  1JLA A;  4C8L A;  3QNO A;  3VA3 A;  2P5G A;  4M3X A;  1IH7 A;  4W5R A;  3SQ4 A;  3ZCM A;  5FRN A;  5J2M A;  3NFA A;  2PYL A;  3C6T A;  2GUI A;  1WLJ A;  4FJK A;  3TR8 A;  1FKP A;  4B9M A;  1G15 A;  2IOC A;  1VRT A;  3AVF A;  4DTU A;  4ZTJ A;  4M3W A;  3ISN C;  4EP4 A;  2KZM A;  4HUF A;  4GW6 A;  1NJW A;  3VQP A;  4W5O A;  5CZ1 A;  4PUO A;  3QET A;  1W9H A;  3DLB A;  4CJV A;  4FLU A;  1RBU A;  4RW6 A;  2VG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...