3AA4A

A52v e.coli rnase hi
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
152
structure length
152
Chain Sequence
LKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAVIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Protein core adaptability: crystal structures of the cavity-filling variants of Escherichia coli RNase HI
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 51
structure length 152
sequence length 152
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3aa4A00
3L2VA 1NKCA 4JS5A 1ZBLA 2KFZA 4M3UA 4OPJA 2XY5A 2HNDA 4W5RA 2G8UA 4KHWA 3SUNA 2ITGA 1Q9YA 4CJSA 1UWBA 4CCHA 3V6DA 3QETA 2WONA 3TAFA 4AHVA 2IDOA 4BE1A 4QAGA 1NK0A 5FRNA 4M3TA 1DLOA 1HYVA 4BACA 4DTMA 2HHWA 1QQCA 4CEFA 5D3GA 4KFBA 3K57A 4DTUA 3V1RA 4N41A 3NH0A 1FK9A 3WNHA 1RT5A 3SQ4A 4XIUA 4E7LA 1A5XA 3IRXA 3VQCA 2HVIA 1BI4A 3BGRA 3V1QA 1U47A 4C8NA 1RCHA 3NF6A 4M41A 4M45A 3DLEA 5KRSA 4IFYA 5KGXA 3NH2A 3RR7A 1CLQA 4OGEA 1RNHA 2D0AA 1WNSA 3MXIA 4IG3A 1L3VA 2G8FA 3SYZA 4K8XA 1LW0A 3ISNC 2F8SA 2QXFA 5J2MA 1WSJA 3ULDA 2DFHA 5FRMA 2XY8A 2PYJA 4CEDA 3LZIA 3NFAA 4W5NA 1KLNA 3KLIA 4CEEA 2G8HA 1KLMA 3O3HA 1VSHA 4NYFA 2DFEA 3PX0A 1U49A 3H08A 3MEEA 4B9UA 1RTDA 2O4IA 1F21A 4GMJB 4EP5A 1O1WA 3QEVA 1I3AA 1G15A 5J2PA 3NE6A 3AVNA 3AVJA 2HNZA 3HL8A 3THVA 3DI6A 1RDAA 2O4GA 5KI6A 4CEBA 4CJLA 4Y1CA 1KTQA 3S3MA 1MU2A 4HUFA 2OZMA 4FJHA 1C0UA 1IKWA 3ZCMA 3JSMA 4FYDA 4DFKA 3L3VA 1HMVA 4RW4A 3HT3A 3LWLA 3V81A 4CK1A 3ZSXA 2DTUA 3QESA 3V1OA 1WSEA 2FC0A 4CK2A 4QOZB 4PWDA 2YNFA 4B8CA 1RT1A 3OYNA 4ZTJA 2ZE2A 2RKIA 1IH7A 2BE2A 3MEGA 4CJPA 4CGDA 4CF1A 3O4QA 4HUEA 1RTHA 1YT3A 4KB0A 3ZSYA 2D5RA 2GBZA 1RTIA 2Z1IA 4FW2A 1VSFA 4WE1A 2X78A 3A2FA 3DLRA 2IAJA 2YKMA 1UOCA 3V9WA 1QSSA 3RWUA 4DTXA 3M8PA 1Q8IA 3DLBA 1LAVA 4DTNA 1U4BA 1YTUA 3M8SA 3KD5E 1ASUA 5J1EA 3CM6A 4N5SA 1N6QA 3KK3A 4FCYA 3DM2A 3SUQA 2B4JA 1XHXA 3NF8A 4OLAA 1W9HA 4BE0A 4DQQA 3UIQA 3LP0A 4DLGA 1RBVA 4CF0A 4W5TA 3OJSA 1B9FA 5T7BA 4E7HA 1C6VA 3ZSZA 4CF8A 5E41A 4GW6A 4J2DA 2VG6A 2E6LA 5C24A 2P1JA 4JS4A 3HJFA 4O0JA 4CEAA 1CXQA 3F9KA 3EYZA 1T03A 1NK9A 1X1PA 1VSMA 2ZD1A 3VA3A 3TWHA 1KVCA 4RW8A 1WSGA 1J5OA 4OKEA 4HTUA 2KFNA 2OYQA 3TAQA 3T19A 1BI4B 4DSJA 2PY5A 4OVLA 3QEXA 4FJ5A 1ITGA 3ZT2A 4PY5A 3PY8A 4CHYA 2HW3A 3SNNA 2HHVA 3LP1A 3ZT0A 4IBNA 3OYBA 1HJRA 1HQUA 4ICLA 3HVRA 1T7PA 1FKPA 3K5MA 1SKRA 4F8RA 3HYFA 3TAPA 2FBVA 4YFUA 3LWMA 4FVMA 2YNGA 4DF8A 3LDSA 4HVJA 4DQPA 3OY9A 4O55A 2HNYA 3WNFA 5EU7A 3T1AA 4LSLA 4LSNA 3OJUA 1JLGA 3DLGA 3K59A 1QHTA 1W0HA 3LZJA 4L8RB 3WNGA 1XWLA 2G8IA 2F8TA 2HHQA 5CZ2A 2YKNA 1CXUA 2IC3A 3AVKA 2Y1JA 4KHQA 3JYTA 3QEPA 3VQEA 4CIEA 4Y1DA 2R7YA 1B9DA 3AVFA 3KK2A 1WLJA 4CECA 3DLHA 2HB5A 1KVAA 1RT4A 3IG1A 1WSFA 3IS9A 3OYEA 3V9UA 1SL1A 1JKHA 1L3SA 1VSEA 3VN5A 3C94A 3AVAA 4RW6A 1Q9XA 3QIPA 1IKVA 1HNIA 4TSXA 4BWMA 4KB1A 4OKJA 3QLHA 3VQ5A 1QTMA 2X6NA 4CIGA 4FW1A 5CYMA 4CESA 1YVUA 1RDBA 3OYJA 1SV5A 2OPRA 1ASWA 4AILC 3M8QA 3OS1A 3K5NA 4DTPA 3OYDA 3DLKA 1ZBFA 3LAMA 4MFBA 3HP6A 3MAQA 3TI0A 1C0TA 1C1BA 4E1NA 1TK8A 3NAEA 3PO4A 1NK4A 3KIOA 4CE9A 5J2NA 1WAJA 1J9AA 4BWJA 4CJFA 4J2EA 4IG0A 2KW4A 1BCMA 3MXJA 4CJUA 3AVHA 4KHSA 2KQ2A 3D45A 5SZTA 2XHBA 2EX3A 4EZ9A 1EX4A 1A5VA 2ZQBA 3DRPA 2LSNA 2DFFA 2XY6A 3ALYA 2ETJA 1NKBA 3S3OA 4CF9A 3QEIA 4DS4A 2P5OA 4M3XA 5C25A 1L5UA 4KKOA 4B9MA 1Y97A 3AVGA 3EY1A 3PX4A 4IKFA 4FJ8A 2RPIA 1U45A 3OYAA 4CJWA 2P51A 4CIFA 4DSIA 1BIZA 1BQNA 3NHGA 1NJZA 4FJJA 4FJXA 1CZBA 4FLXA 3AVLA 3KLGA 3TANA 4ZTFA 1S1VA 1QSYA 5J2QA 1J53A 4N47A 4BDZA 3AV9A 3DOLA 4KTQA 4DMNA 3KLFA 2YNHA 3VA0A 3AA2A 1NKEA 3NGZA 2GUIA 4CEZA 1N5YA 4C8KA 1FXXA 4DQSA 1JLBA 1IKYA 1DTTA 3SQ0A 3SUPA 3TABA 5JS1A 3OS2A 4E7JA 2HHUA 4KTWA 2W42A 1SUQA 3U6FA 3QNOA 1TKDA 3EZ5A 5HP1A 4EZ6A 2BANA 3VQ8A 1KRPA 1FKOA 1TL3A 2EHGA 3NBPA 2NUBA 3RMDA 4B9VA 1YTAA 1JLAA 4LH4A 4CJ4A 5FDLA 3NF7A 4IFVA 1D9FA 3O3GA 3KLHA 4KTZA 2KZMA 4FM0A 1TKXA 1S6QA 3PUFA 1KSPA 4FJ9A 5HRRA 4B9LA 4ELTA 5KRTA 2BDPA 4M3WA 1JL2A 1BGXT 3ZT3A 4KV8A 5K14A 4LH5A 3S3NA 3RRGA 2D0CA 4B9TA 3FFIA 2Z1GA 4G1QA 3CFRA 3L2QA 3MEDA 1EKEA 3DRRA 2RF2A 3PX6A 3RMAA 2JGUA 4CJ5A 5KGWA 4ID5A 3TAEA 3L2RA 1S9EA 2B6AA 3G10A 2JLEA 1VSJA 2I5JA 4Q5VA 3AVCA 1WSIA 4GVMA 3CFPA 3SUOA 1NJXA 3SCXA 1GOAA 1RT7A 3ZSOA 3D0PA 3T3FA 4F2SA 3TAGA 3LP3A 3RMBA 4C8LA 3HO1A 3V9ZA 1RDCA 3LP2A 5CZ1A 3AO4A 3AVBA 4JLHA 4CFAA 3U3GA 3SI6A 4CJTA 4HHTA 4FJGA 4Z4HA 4E89A 1L3UA 3BDPA 1TK5A 4FJIA 4K8ZA 4DU4A 1BQMA 4B3OA 4Z4CA 1NOZA 3AA5X 3DMJA 4LY7A 1K6YA 3TR8A 1C1CA 3DRSA 4I9QA 3MECA 1SKWA 3CM5A 3SV4A 1UA1A 2VG7A 3AO2A 4FM2A 1NJWA 3V9XA 1R0AA 1X9WA 2G8WA 4N56A 4PA1A 1U48A 4FLTA 4ELUA 3DOKA 3DYAA 3LAKA 1RILA 1RT6A 1XI1A 4JRQA 2OA8A 4CJQA 3QINA 5CYQA 4M42A 1XC9A 4Q0BA 2G8VA 4DTRA 5JS2A 3K5LA 3B6OA 3L8BA 3AA3A 2X74A 4HUGA 1WAFA 2OZSA 1REVA 4DFPA 1ASVA 4OGCA 4CFDA 4OJRA 4FK2A 2YHBA 1VSIA 1Z26A 3VQBA 4J2AA 3KLEA 3NCIA 3NGIA 4CHOA 1RTJA 1BL3A 3OYMA 1KFSA 1SKSA 1LAWA 5I3UA 1CZ9A 3P5JA 4KI4A 3AO5A 3VQ7A 4FXDA 2FBTA 2RN2A 3SV3A 3ZT4A 3O3FA 4FLWA 2KZZA 2XRIA 4CGIA 3PO5A 4CHQA 3OYCA 3RRHA 1TGOA 4O44A 1TKTA 3C95A 1NK8A 3I8DA 1VSLA 4RW7A 3IAYA 3OYGA 3K5OA 1NJYA 2X6SA 5HLFA 4I2PA 3HP9A 1S1TA 3L3UA 4LD0A 3VQQA 4CK3A 4DU3A 3B6PA 1RBTA 1LWFA 1BCOA 3ZSRA 2IGIA 4CFCA 4FLZA 1S5JA 4E3SA 4KHUA 4B9SA 3OYIA 3HPGA 4BE2A 4W5QA 1UA0A 1ZYQA 4B9NA 4CGJA 4CGFA 4F3OA 4KI6A 1RBRA 4N76A 2FBXA 1VSKA 1NK7A 2PYLA 4FJMA 4OLBA 4I2QA 4CFBA 2E4LA 4DQIA 4Z4IA 4CJRA 1S1UA 4I7FA 4FZYA 4C8MA 3OYKA 2PZSA 3S9HA 4PUOA 2HHXA 3QIOA 2DY4A 4CGHA 3OS0A 1HRHA 1JL1A 3CQ8A 1HYZA 2D0BA 4DSKA 1EETA 2HVHA 4HCBA 1JXBA 1JLQA 4H4OA 4E19A 4KRFA 3K58A 1XHZA 3QO9A 1ZBUA 3AA4A 1C1AA 1Z25A 4AHCA 4CEQA 4FLUA 2VG5A 4M3RA 3AO3A 4CF2A 1A5WA 4FK0A 4O5BA 1GOBA 2OPQA 4B08A 1TV6A 3HVTA 4RW9A 2A1RA 4DWIA 4KREA 4FLYA 1NK5A 4AHUA 3NH1A 3HK2A 2XO7A 4E0DA 1S9GA 2KTQA 3SJJA 4FZXC 2VWJA 5HRNA 4W5OA 3HSTB 1EP4A 4KHYA 3HM9A 2QKBA 3OYFA 4CHPA 1JXEA 1S1XA 2OPPA 3LPUA 3KJVA 4FLVA 4ELVA 4M3YA 1ZBHA 3SQ2A 1TAUA 1TAQA 4KO0A 1X9SA 3KKRA 4DG1A 3AO1A 1L3TA 4Z4EA 4PQUA 4E7IA 4AHTA 1JLFA 3RR8A 4FM1A 3K2PA 4H4MA 2QK9A 3NDKA 4ID1A 4DFMA 3QNNA 1IO2A 1I39A 3SPZA 4DSEA 4DTSA 3P83D 1UAXA 4FJ7A 3OVNA 1B92A 1WN7A 5DK5A 3LPTA 3ZSVA 5CY4A 1EXQA 1KCFA 3VQ9A 3WNEA 4R5PA 2Y1IA 4DQRA 2OPSA 3VQDA 1TK0A 2P5GA 4KHNA 3VQAA 5HRPA 1TVRA 3E01A 3LANA 3VQ6A 1KFDA 2B5JA 4NYNA 1T05A 4CHNA 1LW2A 4I9LA 4CJEA 4DFJA 1ZBIA 1RDDA 1QS4A 3U3YA 3CYMA 4H8KA 3VQ4A 4MQ3A 4FJNA 2Z1HA 3KK1A 4DSFA 3NGYA 1DTQA 4JRPA 4HCCA 3ASMA 3TAMA 3OYLA 1SL2A 2XY7A 5FROA 1VRTA 3P1GA 4E7KA 5I42A 1QE1A 4F2RA 2AJQA 1NK6A 2F96A 4EP4A 4DTOA 1NOYA 4Z4FA 4O0IA 3C6TA 2HHSA 2ATQA 4BDPA 3HPHA 1IG9A 4DS5A 1RT3A 3QERA 5KTQA 1T8EA 3I0SA 4DSLA 4FK4A 1BHLA 2E6MA 1VSDA 1RT2A 3CFOA 3NF9A 2HMIA 1TKZA 4J2BA 4FJKA 3KD1E 3HPOA 1RBSA 5HRSA 2HHTA 4BDYA 3ZSQA 3KTQA 1LWCA 1D5AA 5SWMA 4DU1A 1IKXA 4ZHRA 5C42A 4O4GA 2YHAA 4CEOA 4Z4GA 3LALA 2YNIA 4UQGA 3V9SA 1TL1A 1HQEA 3AVMA 3L2UA 2WOMA 1QSLA 3HXMA 5HROA 4AH9A 3ZT1A 4F4KA 3SPYA 3QEWA 3G0ZA 1JLEA 3ITHA 3L2WA 3CG7A 3V4IA 4KAZA 4CJVA 1RBUA 1VRUA 5DMRA 1C0MA 3SQ1A 1X9MA 2QKKA 1GOCA 4B8AB 3M8RA 4OPKA 3O4NA 4KPYA 4E1MA 1U04A 3VQPA 4NCBA 4FJLA 1D9DA 4DTJA 2G8KA 3RMCA 1S1WA 4CERA 3TARA 4CJ3A 4DF4A 4F3TA 1HNVA 2FBYA 2BGGA 1VK0A 3AVIA 3KKSA 4NCGA 1HPZA 1LWEA 1JLCA 2IS3A 1S6PA 3F73A 4AHSA 3I0RA 4CGGA 4C8OA 4CJKA 2VWKA 4Z0UA 3RTVA 1HYSA 4YNQA 4CHZA 3ZSWA 3PV8A 1BIUA 1J54A 4IDKA 1WSHA 1LV5A 4FZZA 3C6UA 1D8YA 5HBMA 2Z1JA 1KVBA 3MXMA 2IOCA 2Q3SA 3OYHA 2YV0X 2A1SA 4OKKA 4NCAA 3SZ2A 4DLEA 2GV9A 1SL0A 4M3ZA 4AHRA 4RG8A 4QCLA 1BISA
chains in the Genus database with same CATH superfamily
2NRHA 5AQPA 5C0YA 4JS5A 3QDKA 4BGBA 4M3UA 5GIOA 4W5RA 1WOQA 1HNZK 3V6DA 2WONA 2I7PA 5BRFA 4BE1A 5FRNA 1HYVA 4LF6K 3SBGA 3ID6A 4DTMA 4CEFA 3SLCA 4DTUA 4KH5A 3V1RA 4XH4A 3JAMO 4ILGB 2HVIA 1BI4A 4NXMK 4M41A 4M45A 1CLQA 5KGXA 3JS6A 3FZMA 1WNSA 4IG3A 3SYZA 1LW0A 5J2MA 1WSJA 2XY8A 1K9MO 3DXKB 3GBTA 2DFEA 1U49A 3MEEA 4BRNA 4Z94A 1RTDA 4DQ8A 4B3TK 1O1WA 1I3AA 1G15A 3AVNA 2QXLA 1YAGA 3O9UA 4WCEL 4DR6K 3DI6A 3LL3A 2O4GA 1KTQA 1MU2A 3ZCMA 1NGDA 3TSPA 1HMVA 3HT3A 1JCEA 4BRCA 5B8HA 3A0IX 1WSEA 2FC0A 3MCAB 3OYNA 5AQGA 3TTDA 1IH7A 3MEGA 4CJPA 4CGDA 3O4QA 3TSQA 3ZSYA 2GBZA 2Z1IA 3WUHA 2CGLA 1VSFA 4WE1A 3DLRA 2IAJA 3RWUA 4DTXA 1Q8IA 2OANA 4BG8A 4K41A 1N6QA 4DQQA 3UKRB 4DLGA 3OJSA 3EE9A 2IVPA 1V4SA 2VG6A 4YDUA 4JI3K 5AQIA 3A5NC 2HF4A 4JS4A 3F9KA 2V7ZA 1BWFO 1X1PA 2ZD1A 4RW8A 1J5OA 4OKEA 2OYQA 1IV0A 3TAQA 4DR2K 2QM1A 3QEXA 3LM9A 3HRGA 4PY5A 4B3MK 4CHYA 3OYBA 4DV3K 4F8RA 3K5MA 1BDGA 1GLCG 4DF8A 1OVYA 1QZ5A 4BVOA 1XC3A 2P9PA 4BRKA 5EU7A 4FZZA 3K59A 3MK6A 2G8IA 2HHQA 3WNGA 2YKNA 2O8BA 2E2PA 4CIEA 4Y1DA 3KK2A 4DHYA 1KVAA 2BH1A 4CI6A 1WSFA 3EO3A 3C94A 4JHDB 4YOVA 3QIPA 1IKVA 4KB1A 4BC4A 4CESA 1YJ9N 3CCVN 4EFHA 4AILC 3OS1A 3CC4N 3OYDA 3TI0A 3HP6A 4MFBA 3WQUA 3VGKA 4O8KA 3DAWA 1TK8A 3KIOA 1WAJA 3WXIA 3CHWA 4KHSA 4U7BA 2XHBA 4EZ9A 4DV6K 4K42A 2XY6A 1MDUB 3ALYA 2ETJA 4G9ZA 2P5OA 3K9KA 3HZ6A 4U67L 1OH7A 1SQKA 3IUCA 2P9SA 2YI1A 3OYAA 4CJWA 3OHRA 3W0LA 2HSTA 1CZBA 3AVLA 1S1VA 1QSYA 4KTQA 4YOUA 1NNEA 3AA2A 1NMNA 1T44A 1RFQA 4CEZA 5JVHL 1N5YA 3NVKA 3TABA 3T7ZA 2QTDA 1HJOA 1SUQA 4PKIA 4BR5A 2FSJA 4ILJA 3GL1A 1YTAA 4WQ4C 4RTFD 1D9FA 3O3GA 2KZMA 1E4FT 1G99A 3PIPL 1S6QA 1R59O 4DUYK 4FJ9A 3MCPA 4ELTA 2BDPA 2BUPA 4BRMA 2Q97A 4H5TA 4QS9A 3DRRA 2RF2A 3AGRA 4ID5A 3CPWM 3G10A 2D4WA 2I5JA 4JKEA 3H3OB 2QWRA 3HBTA 3CI5A 2HBLA 1GOAA 3D0PA 5KQ8A 3TAGA 4JKGA 3C6HA 5EX5A 3LP2A 4JI5K 4CJTA 4HHTA 4Z4HA 5LL6Z 1BQMA 1MA9B 1C0GA 3E9PA 3PIOL 1K6YA 1V4TA 4JD2B 4B3RK 4B1YB 2QA4N 4FLTA 1VQMN 4YDUC 5EVZA 3LAKA 3DYAA 3FLCO 2FF3B 2OA8A 4CJQA 5CYQA 1OKJA 5JLFA 2JWKA 3AA3A 4C1NI 4CZGA 1WAFA 4FK2A 1HKBA 4DFPA 4OGCA 4OJRA 3VF4A 1VSIA 3VQBA 3KLEA 3NGIA 1BL3A 3J81O 3P5JA 4KI4A 3AO5A 3SV3A 4CGIA 1ILYA 3L0QA 3PO5A 3SAGA 2HBMA 5GADP 3I8DA 3OYGA 2EWSA 2OCEA 3VQQA 3HP9A 3L3UA 4LD0A 4DU3A 3ZSRA 4ISFA 4FLZA 4BR2A 4E3SA 5JVGL 1QZ6A 3HPGA 2FXUA 5GAGP 4FOIA 4F3OA 4OPAA 4IEIA 5C2FA 1Y64A 3CJ1A 3O1WA 2ZJPL 2PAVA 2IVNA 4IJNA 4CJRA 1NM1A 4FL9A 2PZSA 3S9HA 2HHXA 3WEEB 5AFUA 4BG9A 3OS0A 5M1KA 1HYZA 4DSKA 1EETA 3F2KA 5AQRA 4EAHD 1JXBA 1XNRK 4AHCA 4CEQA 2DPNA 2VG5A 3P31A 4FWMA 1IJJA 1GOBA 3D6RA 5AQLA 1M90O 4DWIA 4KREA 4JI4K 4FLYA 5E84A 4W5OA 1K8KB 1EP4A 3M3ZA 3OYFA 2W6LA 1JXEA 1S1XA 2OPPA 2WC9A 4GVEA 4ELVA 3SQ2A 1X9SA 4KO0A 4DG1A 1L3TA 1JCFA 4E7IA 3R3LA 3NDKA 2IIRA 3QNNA 1I39A 3SPZA 4DSEA 1UAXA 1NGIA 3LDLA 1XMQK 4A2AA 3LPTA 1KCFA 3WNEA 2Y1IA 4BRQA 4E1JA 3CC2N 3VQ6A 4NYNA 1LW2A 4I9LA 4A57A 4DFJA 5MLCQ 3CXCM 4JYAK 3U3YA 3VQ4A 4MQ3A 4DSFA 4J8FA 3TAMA 4JKDA 5IWAK 2XY7A 1VRTA 2OTJN 3OA9A 3VEVA 2YHYA 5CR4A 2CGJA 5JICA 4DS5A 1NGJA 1RT3A 4CD1A 5BPNA 1BA1A 3MN5A 1X9JA 2E6MA 3MDQA 5C10A 4FJKA 2NRVA 4BDYA 2NRZA 1LWCA 2Q0UA 3FZKA 4DV4K 4DU1A 3WXMB 5C42A 4O4GA 5BR9A 3V9SA 1TL1A 3AVMA 3L2UA 3HXMA 4GV3A 2AP1A 3ZT1A 3CCEN 3QEWA 4DKWA 2HBKA 3ITHA 3CCJN 2F9WA 4KAZA 4CJVA 4RCHA 1VRUA 1BOTO 5DMRA 3VQPA 3THYB 3RMCA 1S1WA 4CERA 3TARA 4DF4A 3I55N 2FBYA 2UYTA 3K9JA 2UUCK 4CZKA 3O80A 4BRPA 3RTVA 4YNQA 1BIUA 1GLEG 3C6UA 1QVGM 2Z1JA 4OKKA 3SZ2A 4DLEA 1BISA 1U2VB 2YHWA 5F2RA 4OPJA 2G8UA 2KKZA 3QFPA 1UWBA 5LMUK 1MWMA 3QETA 3TAFA 4AQYK 1QQCA 5D3GA 4KFBA 1FK9A 1RT5A 3R1XA 3O9SA 2NNWA 3V1QA 3P38A 1YITN 4K8XA 1L3VA 3ISNC 1OH8A 2DFHA 2OTLN 4CEDA 3LZIA 3LDPA 5HL7L 3O3HA 2H3GX 3H08A 3CJAA 5J2PA 4LF5K 3AVJA 4FVUA 2HNZA 4BC2A 3THVA 1RDAA 5KI6A 4CJLA 1ATNA 4Y1CA 4BRFA 3S3MA 1OH5A 3H46O 3JSMA 2ZJRL 4FYDA 3LWLA 1QHAA 3VGMA 3GDQA 4CK2A 4QOZB 2NRXA 2Q0RA 2YNFA 3EL2A 1VQNN 2CGKA 2V7YA 4HUEA 1Z6RA 1RTIA 2YKMA 1I94K 2O8DA 1LAVA 5AZIB 3M8SA 3KD5E 1ASUA 4BRDA 4N5SA 3L4QA 4O5FA 3SUQA 2B4JA 3ZETA 3WEEA 3VEZA 1W9HA 3LP0A 4W5TA 4BROA 1QQMA 4E7HA 3ZSZA 5E41A 4J2DA 4BQZA 2E6LA 2FLOA 4Y0WA 4O0JA 4CEAA 3EYZA 5AQJA 2HMPA 1KVCA 4FWKA 1RDWX 3LM2A 5FPNA 1KC8O 3T19A 3Q7BA 4GNIA 2PY5A 4OVLA 1ITGA 2QWNA 3C7NA 3JXUA 2HHVA 2ZF5O 3ZT0A 4IBNA 4FSVA 4X66K 1HQUA 1T7PA 3SAHA 1FKPA 2D0OA 1SKRA 4FVMA 4DQPA 4HVJA 3BF3A 3OY9A 3CJ7A 4O55A 3WNFA 1NGAA 1TAUA 1JLGA 3ZLJA 1QHTA 5BN9A 5CZ2A 1CXUA 4KHQA 3AVKA 1P90A 3JYTA 3VQEA 3AVFA 4NO7A 3DLHA 3HM8A 1RT4A 3OYEA 3IS9A 1SL1A 1JKHA 1YJNN 4LFAK 1Q9XA 4TSXA 1ATRA 1HNIA 4BWMA 3QLHA 3TPQA 2X6NA 4FW1A 2QWMA 5CYMA 2VWBA 2OPRA 1ASWA 5AZJB 2O8FA 3LAMA 1ZBFA 3MAQA 1C0TA 1C1BA 4IXCA 3ATUA 3PO4A 3R8EA 4CE9A 1FW6A 1J9AA 4J2EA 4CJFA 4FWRA 4IG0A 1JCGA 3U4LA 3R9PA 5BPLA 3IFRA 4JI0K 3D45A 2ZQBA 3DRPA 3J8AA 5M1OA 1NKBA 3W3DA 4H0OA 3H6EA 4KKOA 1L5UA 5ADXH 3EY1A 4IKFA 1U45A 3RSEA 3AARA 2W40A 4PL8A 1KAXA 4WQ4A 1NJZA 4LF9K 3KLGA 4ZTFA 1J53A 4BDZA 3THYA 3AV9A 2YJEA 3SMSA 3KK7A 4K0KK 4DMNA 3KLFA 2YNHA 3VA0A 3BZCA 3IKMA 4C8KA 1FXXA 1JLBA 1IKYA 3SQ0A 4E7JA 2HHUA 3ULEB 2W42A 4DV2K 2V52B 2QW9A 3PSFA 2BANA 5HP1A 1TYQB 3NBPA 2NUBA 4XH5A 4B9VA 1JLAA 2HBJA 1VQ5N 3NF7A 4IFVA 4WQ5C 5HRRA 5KRTA 3T1YK 4KV8A 3S3NA 4LH5A 1U2VA 4CZEA 4K43A 3FFIA 2E8AA 3CFRA 5AQQA 2KLAA 4X62K 4B1XB 1S9EA 1VSJA 2HHHK 3SUOA 4RWTA 3SCXA 3M6GA 3ZSOA 5GIPA 3V9ZA 4OO1J 3D2EB 3AO4A 4JLHA 3SI6A 3VMFB 1TK5A 2NRTA 2O8EA 3AA5X 4FOEA 4LY7A 3TR8A 3DRSA 1SKWA 3SV4A 3AO2A 3V9XA 1R0AA 2UU9K 4PA1A 5CHIA 4KBOA 4BQLA 4JRQA 1XC9A 4Q0BA 4QS7A 4HUGA 3T69A 4CFDA 1KAYA 1Z26A 4A61A 4A2BA 3VEYA 4EHTA 3OYMA 2QWLA 1KFSA 3HSCA 1GLDG 4BC5A 4NLBA 3AAQA 2FBTA 3RVCA 3UKUB 1U6ZA 4YY3K 2PBDA 3EKSA 4CHQA 3OYCA 1TUYA 1SAZA 3FFKB 2I7NA 1VSLA 4RW7A 3IAYA 2X6SA 3NMUA 4AM6A 1RBTA 2VGMA 2IGIA 1S5JA 4B9SA 3OYIA 5HOOA 1IBLK 4W5QA 1ZYQA 4CGJA 4I6MA 4N76A 2FBXA 1VSKA 2PYLA 1NGEA 4I2QA 2E4LA 3WXKA 4CJ7A 3OYKA 4CGHA 1NGBA 2ZM6K 3CQ8A 2HVHA 1IBKK 4HCBA 1ZBUA 1S72N 1C1AA 3U9DA 3AO3A 4CF2A 1A5WA 4AF1A 1NG9A 1NK5A 3NH1A 2UUBK 3I33A 2XO7A 2P9KA 1S9GA 4BRHA 4WF9L 5HRNA 3HSTB 2QKBA 3U9ZA 1ZBHA 1WBDA 2ASMA 3KKRA 5AQXA 3FR0A 5DM7L 4GV9A 4AHTA 3RR8A 3O9TA 3LDQA 4JK9A 1IO2A 2A42A 4DTSA 3P83D 1NGFA 4FWSA 2ZGYA 1YIJN 1WN7A 1TK0A 3VESA 4R5PA 4JKBA 3VQDA 4KHNA 3VQAA 1EO1A 1QS4A 3CYMA 3CJBA 3QBXA 4DR4K 2Z1HA 3NGYA 1DTQA 5F0XA 4JRPA 1W2BM 2FSNA 3GE1A 4OX9K 3P1GA 5AZJA 1XUPO 1W7AA 4F2RA 1NK6A 1NOYA 1GLFO 3CIPA 3C6TA 4BDPA 3HPHA 3MWTA 4DV1K 1T8EA 3H45C 1BHLA 1RT2A 3NF9A 2NLXA 2HMIA 1QQNA 1K8AO 2HHTA 4C1NK 1HLUA 3KTQA 5SWMA 1IKXA 2YHAA 3CQXA 4UQGA 1MWKA 1QSLA 5M1QA 3BF1A 5HROA 1EWQA 3DXKA 4M7XA 4F4KA 3SPYA 1BA0A 1JLEA 3L2WA 2E5LK 2ZGZA 1RBUA 3SQ1A 3MN6A 4B8AB 3KHYA 4OPKA 4KPYA 4E1MA 2FSKA 1HNVA 3SJHA 1VK0A 1NJIO 2O8CB 5AQFA 1JLCA 2JWLA 3ULEA 1EWRA 3QBWA 2VWKA 1TYQA 4Z0UA 4CZJA 3FZHA 4CHZA 3ZSWA 3PV8A 1J54A 1LV5A 3HOSA 1D4XA 4NCAA 2YV0X 4BR4A 4RG8A 2E20A 3L2VA 5C12A 1ZBLA 4FWQA 5GINA 4GY2B 5E26A 4KHWA 3MX2A 3NVMA 5EXWA 4CJSA 4CCHA 3UKRA 4AHVA 4GKKK 4QAGA 5AQVA 4M3TA 1DLOA 1BU6O 4A62A 4JKCA 3D2EA 3K57A 4H0XB 1VQKN 4N41A 4NB4A 3NH0A 4XIUA 2E2QA 3VQCA 1HNWK 5KRSA 3NH2A 1YVNA 4OGEA 2D0AA 2F8SA 2QXFA 5FRMA 2PYJA 2NRWA 3NFAA 1KLNA 3KLIA 4YORA 4CEEA 1HKCA 1KLMA 2G8HA 3PX0A 1VSHA 4NYFA 4B9UA 2E1YA 4EP5A 3QEVA 3NE6A 2RHKA 3ZX3A 1Q18A 2Q31A 4HWIA 3HL8A 4HUFA 2OZMA 4JKAA 4FJHA 1C0UA 3FZFA 4A5AA 1NGGA 3I8BA 4RW4A 4JHDA 4IDHA 3V81A 1VQPN 2HF3A 3VEWA 2GTDA 3O9QA 3QESA 4BR9A 4PWDA 5TKYA 4B8CA 1RT1A 3SAFA 2RKIA 2BE2A 4FPAA 4CF1A 2D5RA 4FW2A 3A2FA 1UOCA 3V9WA 1QSSA 1NU0A 4JI8K 3DLBA 3J7ZO 1YTUA 5KQDA 2D0PA 1LCUA 5AQTA 5J1EA 3THXB 3KK3A 4FCYA 3DM2A 5GAEP 1XHXA 5AQSA 3NF8A 4OLAA 1O13A 4BE0A 3UIQA 3VERA 4CF0A 4PL7A 4GW6A 2CH5A 2GELA 3BP8A 1CXQA 4H5VA 3O6WA 3VTIA 1YI2N 3TWHA 4JNEA 3CMEN 4H0TB 1WSGA 1N32K 3F9MA 1BI4B 1WBBA 4JI7K 2ZWHA 4CBWA 3SNNA 3VF6A 3HVRA 4CD3A 2UUAK 3HYFA 4BVPA 3QB0A 1YHQN 2YNGA 3LDSA 4LFBK 1SS6A 4AM7A 3T1AA 4LSLA 4LSNA 3OJUA 2F8TA 1W0HA 2UXDK 3MMVA 4LF8K 2R7YA 5AQZA 4IOCL 1B9DA 2YHXA 1WLJA 4CECA 1ZXOA 1L3SA 5EOYA 2W41A 5M1PA 4RW6A 3VETA 3DXMB 1QTMA 1Q81O 1YVUA 3OYJA 1HR0K 1SV5A 4BREA 3M8QA 4DTPA 4DV7K 5TKWA 3NAEA 4BWJA 1N8RO 3VPZA 2A3ZA 2KW4A 3MXJA 4CJUA 2AA4A 4IWVA 2KQ2A 2ASPA 4BRLA 5SZTA 2EX3A 4MDBA 1EX4A 4FWOA 1A5VA 1YJWN 4JD2A 4CW7B 3QEIA 4M3XA 2VYPA 4B9MA 3AVGA 1NBWA 3PX4A 4FJ8A 2RPIA 5KPTA 3KZBA 1QVFM 5LJVA 4K25A 2ASOA 1BIZA 1BQNA 3CCMN 3N4QA 4FJXA 4WQ5A 3EKUA 4BR0A 3TANA 1VQ7N 4N47A 3DOLA 1KAZA 1NKEA 2GUIA 4DQSA 2O8CA 1DTTA 3SUPA 4HTLA 3VTHA 5JS1A 3BUZB 3OS2A 4WFAL 3CCRN 4L3QA 4B1VA 2EHGA 4CZIA 1JJ2M 3RMDA 4PKGA 4CJ4A 1NMDA 3KLHA 5JMVA 1NWKA 5I9EB 5H1SQ 2O8BB 1KSPA 5AQMA 3C0BA 3OTOK 4M7YA 4B9LA 1Q82O 4M3WA 1BGXT 3ZT3A 3A5MC 4C23A 2D0CA 4B9TA 4CZFA 1KQSM 2Z1GA 4G1QA 1J6ZA 4WFNL 3RMAA 4CJ5A 5KGWA 1M1KO 3TAEA 4CVNE 2B6AA 3DLLL 4GVMA 1WSIA 3CFPA 4DV5K 3OBWA 3RMBA 3HO1A 2YX6A 4IOAL 3F5TA 5EY4A 4JI1K 3U3GA 4E89A 5AFUH 4K8ZA 4CBXA 4B3OA 3PLAA 3AY9A 4QS8A 3G71N 3G4SN 3DMJA 4I9QA 1K8KA 4CBUA 3CM5A 1UA1A 3MX5A 2VG7A 4FM2A 5LMNK 1X9WA 2G8WA 3R6MA 4N56A 1W97L 4BY9C 4ELUA 1XI1A 1RILA 4M42A 3QINA 4DTRA 3K5LA 5FPMA 3L8BA 1REVA 1Q86O 2NRRA 3NCIA 3CPEA 3UB5A 2A6AA 1CZ9A 3H3NO 3VQ7A 4FXDA 4IOXA 3ZT4A 4FLWA 2KZZA 2QI2A 5GAHP 4DR3K 4LF7K 3A5LC 3BZKA 1TKTA 3C95A 4O44A 4IZ9A 2RE2A 3VOVA 4I2PA 1S1TA 4CK3A 1HNXK 3CD6N 3B6PA 1BCOA 4CFCA 2A40A 1N33K 3SK3A 4B9NA 4DB3A 4KI6A 1RBRA 2CH6A 4OLBA 4FJMA 3THXA 4I7FA 2F4VK 4XEIA 3CJCA 4KHPK 1JL1A 4JV5K 4JKFA 1JLQA 4H4OA 2QWOA 4JKGB 3AA4A 1Z25A 4JKHA 2OPQA 4B08A 1TV6A 4RW9A 5AQWA 2A1RA 3GOIA 4AHUA 1H1VA 4E0DA 1S3XA 4FWLA 4EIAA 3SJJA 4FZXC 1N36K 4KHYA 3HM9A 3AAPA 1Q7YO 4CHPA 3LPUA 4H5RA 3P39A 4Z4EA 4YHHK 4B9QA 3L6QA 4ID1A 4DFMA 2V51B 4CZMA 4FJ7A 3ZSVA 3VQ9A 2O4IA 2P5GA 2OPSA 4PHTX 5HRPA 3CF5L 3LANA 2B5JA 3CCSN 3HTVA 4CJEA 4BGAA 3H1VX 4YOTA 4DUZK 4FJNA 3DXMA 3PSIA 3CJ9A 4MDAA 4UY8O 4YOWA 3E9LA 1SL2A 4E7KA 1QE1A 4DTOA 4EP4A 4Z4FA 1DEJA 2QEXN 4O0IA 1XMOK 2HHSA 3M1FA 1IG9A 1DT9A 3QERA 5KTQA 2P9LB 3I0SA 2HOEA 4DSLA 2UXCK 1VQ6N 3O08A 1VQON 1TKZA 3KD1E 1RBSA 3J7YP 3ZSQA 1WB9A 3LALA 2YNIA 5KPZA 1HQEA 3O8MA 5FPDA 3CMAN 3G6EN 1LOTB 4DV0K 4AH9A 4YOXA 3CG7A 4IO8A 3V4IA 4LC9B 2GX9A 4BR7A 1C0MA 4X65K 2QKKA 3M8RA 3THWB 3L4IA 1CZAN 3O4NA 4NCBA 1BG3A 4F3TA 4CJ3A 2BGGA 3AVIA 1HUXA 3M5RA 4NCGA 1ESVA 1NLVA 1LWEA 3F73A 4CGGA 3VGLA 4C8OA 5AQUA 3EZWA 3WXLA 4R79A 1XQSC 1HYSA 1WSHA 3WXJA 5HBMA 3MXMA 2IOCA 3ZEUB 2Q3SA 3OYHA 2A1SA 4M3ZA 1SL0A 4AHRA 2ZJQL 4H0YB 3AGKA 5AZIA 4V19S 4GV6A 4O8UA 2KFZA 2A5XA 3E66A 2XY5A 2HNDA 4DR1K 5C2DA 3SUNA 2ITGA 1Q9YA 2IDOA 3J80O 3A5OC 1NK0A 4B1WB 4BACA 2HHWA 3I56N 2E2OA 3IMXA 3C6AA 3WNHA 4ISGA 4E7LA 3SQ4A 1A5XA 3ENHA 3IRXA 4IJAA 2FF6A 3BGRA 3D2FB 1U47A 4C8NA 1RCHA 2E88A 3NF6A 3DLEA 3RR7A 4IFYA 1RNHA 4H0PA 3MXIA 4JI2K 2G8FA 3ATVA 3ULDA 1OH6A 1TUUA 4W5NA 5AQOA 4A5BA 2E1ZA 3S41A 5F1XA 5BRDA 2P9IB 1F21A 4GMJB 2F7TA 4KH4A 3C65A 3P4IA 5FPEA 4B1UB 4CEBA 4WFBL 3O5BA 3FZLA 4ISEA 1IKWA 1BUPA 3HI0A 4DFKA 3L3VA 1RDUA 4CK1A 3TTFA 3CCLN 3ZSXA 2DTUA 3V1OA 4MLEA 3B8AX 4ZTJA 2ZE2A 5AQNA 1RTHA 1YT3A 4OPHA 4KB0A 2KHOA 1C0FA 4FJ5A 2X78A 4JN4A 4JI6K 4KH6A 3D7EO 3SBTA 3M8PA 4DTNA 1U4BA 3FE1A 2YCHA 1P8ZA 3CM6A 2GWKA 4XH1A 2PFUA 1RBVA 1S22A 1B9FA 1HKGA 5T7BA 1C6VA 4CF8A 5C24A 2P1JA 3HJFA 3CERA 2VCPA 1T03A 1NK9A 1VSMA 3VA3A 4GKJK 1YUWA 4HTUA 2KFNA 5BR8K 4DSJA 1YF5L 3ZT2A 3PY8A 1K73O 1DGKN 2HW3A 3LP1A 5AR0A 3G25A 1HJRA 4ICLA 5IT9O 3TAPA 2FBVA 4YFUA 3LWMA 5AJ3K 3ZX2A 3BY5A 1J5EK 4PKHA 2HNYA 3LZJA 3DLGA 4L8RB 1XWLA 2IC3A 2Y1JA 5CE3A 3QEPA 2P9NB 3KVGA 2HB5A 5C15A 3V9UA 3IG1A 3VEXA 3J7AP 1VSEA 3VN5A 4IFEA 3HOTA 3AVAA 3VQ5A 4OKJA 2WTUA 1ZBSA 4CIGA 1ZC6A 1RDBA 4LF4K 1T6CA 3K5NA 3DLKA 2GUPA 4H03B 2UXBK 3KWGA 2IVOA 2P9LA 3O4WA 1NK4A 4IEEA 2QWQA 3TU5A 1T6DA 5J2NA 4NXNK 2O8DB 4X64K 1BCMA 1N34K 3AVHA 3H1QA 2LSNA 3ZETB 2DFFA 4CZLA 1BO5O 4EHUA 3S3OA 4CF9A 2ITMA 4DS4A 2A41A 5C25A 5LJWA 1SZ2A 1Y97A 4MO5A 3TSUA 2P51A 3MN7A 4CIFA 4DSIA 4WYBA 3NHGA 3CCQN 4FJJA 1WUAA 3THWA 3TTCA 4FLXA 3KWIA 5J2QA 3ENBA 3C7NB 3NGZA 3SMPA 2F9TA 2WUSA 3DWLA 1X3MA 3UKUA 4KTWA 3WQTA 1HX1A 3U6FA 3QNOA 1TKDA 3EZ5A 4EZ6A 3VQ8A 1KRPA 1FKOA 1TL3A 2WBNA 3CCUN 2P9UB 4LH4A 5FDLA 4KTZA 1VQLN 4FM0A 1TKXA 3E1YA 3ZEUA 1NGHA 3PUFA 2BTFA 5DM6L 1JL2A 4DCHA 3QICA 5K14A 4JK7A 3RRGA 1OVQA 3L2QA 1HPMA 1EKEA 1GLLO 3MEDA 4FPBA 3PX6A 2JGUA 1VQ4N 4IO9L 3L2RA 5ELZA 2JLEA 4Q5VA 3AVCA 2VQFK 1NJXA 3OW2M 1RT7A 4DR7K 3T3FA 4F2SA 2O8FB 3LP3A 4C8LA 1RDCA 5CZ1A 2Q36A 1XNQK 3AVBA 4JK8A 3EN9A 4CFAA 4FJGA 1L3UA 3BDPA 4FJIA 1Z05A 3IDHA 4DU4A 5ADXA 4A59A 4YOYA 1GLAG 4BC3A 3VENA 4Z4CA 1NOZA 3D2FA 4JEPA 1C1CA 3MECA 4FWNA 2D1KA 1NJWA 4H5NA 4M63C 2Q1NA 1GLBG 1U48A 1VAZA 3DOKA 1RT6A 2J4RA 5AQKA 3GG4A 5M1NA 5JS2A 2G8VA 3RSEB 2P9IA 3ZX0A 3B6OA 3ENOA 2OZSA 2X74A 3WT0A 4MLHA 1ASVA 1T3VA 3U8XA 2YHBA 3DJCA 4J2AA 1GLJO 5FLXO 3QFUA 4CHOA 1RTJA 1SKSA 1LAWA 5I3UA 3N4PA 4ILHA 3CETA 1IBMK 1E4GT 2RN2A 5AQYA 3O3FA 2XRIA 4FWPA 3RRHA 1TGOA 3LDNA 1NK8A 3K5OA 1NJYA 5HLFA 1FJGK 1ATSA 5BRHA 1LWFA 3T1HK 4KHUA 4BE2A 1UA0A 5BREA 4CGFA 1VQ8N 1VHXA 1NK7A 2WFBA 4CFBA 4DQIA 4Z4IA 1S1UA 4FZYA 4C8MA 2DY4A 4PUOA 3QIOA 1HRHA 2D0BA 5BPMA 5JLHA 1VQ9N 4E19A 4KRFA 3K58A 1XHZA 3QO9A 3EE8A 4FLUA 4FO0A 4M3RA 4B3SK 4DR5K 4FK0A 4O5BA 5M1FA 3HVTA 2VQEK 3HK2A 4NLCA 2O8EB 2NZTA 2KTQA 2VWJA 2GEMA 3KJVA 4M3YA 4BRAA 4FLVA 1TAQA 3AO1A 4PQUA 1JLFA 3FGUA 4MO4A 4FM1A 3K2PA 4H4MA 2QK9A 4LFCK 2P9PB 5LY3A 3OVNA 1B92A 3CC7N 3BEXA 5DK5A 3EEQA 1NKCA 5CY4A 1EXQA 4J2BA 4DQRA 2GWJA 1TVRA 4CZHA 3E01A 2P9NA 2QWPA 3MWPA 3QMLA 1KFDA 1T05A 3VEOA 4CHNA 3Q7CA 1E3MA 1RGIA 1KD1O 1ZBIA 1RDDA 4H8KA 3ZYYX 3KK1A 3CQYA 2W6KA 4HCCA 3ASMA 3OYLA 5FROA 5I42A 3VF2A 2AJQA 1IG8A 3O9RA 2F96A 3LDOA 5A2QO 2ATQA 2E2NA 2VGNA 4FK4A 3K0SA 1VSDA 4I6MB 3CFOA 3E9OA 3HPOA 5HRSA 1QQOA 1D5AA 4BRGA 4ZHRA 4CEOA 4Z4GA 2Q2RA 2WOMA 3A8YA 4F9OA 5AQHA 2P9SB 3G0ZA 4H5WA 1DKGD 4BRIA 1X9MA 3ID8A 1GOCA 1KXPA 1U04A 2P9KB 4FJLA 1D9DA 4DTJA 1NGCA 2G8KA 3KKSA 1HPZA 1EQYA 2IS3A 1S6PA 4AHSA 3I0RA 4JAXA 3MN9A 4H0VB 4CJKA 4B1ZA 1YXQA 1X3NA 2P9UA 4IDKA 5BN8A 1D8YA 3UE5A 1KVBA 3O1BA 3OBYA 5KPRA 4QCLA 2GV9A 4E1NA 2YJFA
chains in the Genus database with same CATH topology
3L2VA 1NKCA 4JS5A 1ZBLA 2KFZA 4M3UA 4OPJA 2XY5A 2HNDA 4W5RA 2G8UA 4KHWA 3SUNA 2ITGA 1Q9YA 4CJSA 1UWBA 4CCHA 3V6DA 3QETA 2WONA 3TAFA 4AHVA 2IDOA 4BE1A 4QAGA 1NK0A 5FRNA 4M3TA 1DLOA 1HYVA 4BACA 4DTMA 2HHWA 1QQCA 4CEFA 5D3GA 4KFBA 3K57A 4DTUA 3V1RA 4N41A 3NH0A 1FK9A 3WNHA 1RT5A 3SQ4A 4XIUA 4E7LA 1A5XA 3IRXA 3VQCA 2HVIA 1BI4A 3BGRA 3V1QA 1U47A 4C8NA 1RCHA 3NF6A 4M41A 4M45A 3DLEA 5KRSA 4IFYA 5KGXA 3NH2A 3RR7A 1CLQA 4OGEA 1RNHA 2D0AA 1WNSA 3MXIA 4IG3A 1L3VA 2G8FA 3SYZA 4K8XA 1LW0A 3ISNC 2F8SA 2QXFA 5J2MA 1WSJA 3ULDA 2DFHA 5FRMA 2XY8A 2PYJA 4CEDA 3LZIA 3NFAA 4W5NA 1KLNA 3KLIA 4CEEA 2G8HA 1KLMA 3O3HA 1VSHA 4NYFA 2DFEA 3PX0A 1U49A 3H08A 3MEEA 4B9UA 1RTDA 2O4IA 1F21A 4GMJB 4EP5A 1O1WA 3QEVA 1I3AA 1G15A 5J2PA 3NE6A 3AVNA 3AVJA 2HNZA 3HL8A 3THVA 3DI6A 1RDAA 2O4GA 5KI6A 4CEBA 4CJLA 4Y1CA 1KTQA 3S3MA 1MU2A 4HUFA 2OZMA 4FJHA 1C0UA 1IKWA 3ZCMA 3JSMA 4FYDA 4DFKA 3L3VA 1HMVA 4RW4A 3HT3A 3LWLA 3V81A 4CK1A 3ZSXA 2DTUA 3QESA 3V1OA 1WSEA 2FC0A 4CK2A 4QOZB 4PWDA 2YNFA 4B8CA 1RT1A 3OYNA 4ZTJA 2ZE2A 2RKIA 1IH7A 2BE2A 3MEGA 4CJPA 4CGDA 4CF1A 3O4QA 4HUEA 1RTHA 1YT3A 4KB0A 3ZSYA 2D5RA 2GBZA 1RTIA 2Z1IA 4FW2A 1VSFA 4WE1A 2X78A 3A2FA 3DLRA 2IAJA 2YKMA 1UOCA 3V9WA 1QSSA 3RWUA 4DTXA 3M8PA 1Q8IA 3DLBA 1LAVA 4DTNA 1U4BA 1YTUA 3M8SA 3KD5E 1ASUA 5J1EA 3CM6A 4N5SA 1N6QA 3KK3A 4FCYA 3DM2A 3SUQA 2B4JA 1XHXA 3NF8A 4OLAA 1W9HA 4BE0A 4DQQA 3UIQA 3LP0A 4DLGA 1RBVA 4CF0A 4W5TA 3OJSA 1B9FA 5T7BA 4E7HA 1C6VA 3ZSZA 4CF8A 5E41A 4GW6A 4J2DA 2VG6A 2E6LA 5C24A 2P1JA 4JS4A 3HJFA 4O0JA 4CEAA 1CXQA 3F9KA 3EYZA 1T03A 1NK9A 1X1PA 1VSMA 2ZD1A 3VA3A 3TWHA 1KVCA 4RW8A 1WSGA 1J5OA 4OKEA 4HTUA 2KFNA 2OYQA 3TAQA 3T19A 1BI4B 4DSJA 2PY5A 4OVLA 3QEXA 4FJ5A 1ITGA 3ZT2A 4PY5A 3PY8A 4CHYA 2HW3A 3SNNA 2HHVA 3LP1A 3ZT0A 4IBNA 3OYBA 1HJRA 1HQUA 4ICLA 3HVRA 1T7PA 1FKPA 3K5MA 1SKRA 4F8RA 3HYFA 3TAPA 2FBVA 4YFUA 3LWMA 4FVMA 2YNGA 4DF8A 3LDSA 4HVJA 4DQPA 3OY9A 4O55A 2HNYA 3WNFA 5EU7A 3T1AA 4LSLA 4LSNA 3OJUA 1JLGA 3DLGA 3K59A 1QHTA 1W0HA 3LZJA 4L8RB 3WNGA 1XWLA 2G8IA 2F8TA 2HHQA 5CZ2A 2YKNA 1CXUA 2IC3A 3AVKA 2Y1JA 4KHQA 3JYTA 3QEPA 3VQEA 4CIEA 4Y1DA 2R7YA 1B9DA 3AVFA 3KK2A 1WLJA 4CECA 3DLHA 2HB5A 1KVAA 1RT4A 3IG1A 1WSFA 3IS9A 3OYEA 3V9UA 1SL1A 1JKHA 1L3SA 1VSEA 3VN5A 3C94A 3AVAA 4RW6A 1Q9XA 3QIPA 1IKVA 1HNIA 4TSXA 4BWMA 4KB1A 4OKJA 3QLHA 3VQ5A 1QTMA 2X6NA 4CIGA 4FW1A 5CYMA 4CESA 1YVUA 1RDBA 3OYJA 1SV5A 2OPRA 1ASWA 4AILC 3M8QA 3OS1A 3K5NA 4DTPA 3OYDA 3DLKA 1ZBFA 3LAMA 4MFBA 3HP6A 3MAQA 3TI0A 1C0TA 1C1BA 4E1NA 1TK8A 3NAEA 3PO4A 1NK4A 3KIOA 4CE9A 5J2NA 1WAJA 1J9AA 4BWJA 4CJFA 4J2EA 4IG0A 2KW4A 1BCMA 3MXJA 4CJUA 3AVHA 4KHSA 2KQ2A 3D45A 5SZTA 2XHBA 2EX3A 4EZ9A 1EX4A 1A5VA 2ZQBA 3DRPA 2LSNA 2DFFA 2XY6A 3ALYA 2ETJA 1NKBA 3S3OA 4CF9A 3QEIA 4DS4A 2P5OA 4M3XA 5C25A 1L5UA 4KKOA 4B9MA 1Y97A 3AVGA 3EY1A 3PX4A 4IKFA 4FJ8A 2RPIA 1U45A 3OYAA 4CJWA 2P51A 4CIFA 4DSIA 1BIZA 1BQNA 3NHGA 1NJZA 4FJJA 4FJXA 1CZBA 4FLXA 3AVLA 3KLGA 3TANA 4ZTFA 1S1VA 1QSYA 5J2QA 1J53A 4N47A 4BDZA 3AV9A 3DOLA 4KTQA 4DMNA 3KLFA 2YNHA 3VA0A 3AA2A 1NKEA 3NGZA 2GUIA 4CEZA 1N5YA 4C8KA 1FXXA 4DQSA 1JLBA 1IKYA 1DTTA 3SQ0A 3SUPA 3TABA 5JS1A 3OS2A 4E7JA 2HHUA 4KTWA 2W42A 1SUQA 3U6FA 3QNOA 1TKDA 3EZ5A 5HP1A 4EZ6A 2BANA 3VQ8A 1KRPA 1FKOA 1TL3A 2EHGA 3NBPA 2NUBA 3RMDA 4B9VA 1YTAA 1JLAA 4LH4A 4CJ4A 5FDLA 3NF7A 4IFVA 1D9FA 3O3GA 3KLHA 4KTZA 2KZMA 4FM0A 1TKXA 1S6QA 3PUFA 1KSPA 4FJ9A 5HRRA 4B9LA 4ELTA 5KRTA 2BDPA 4M3WA 1JL2A 1BGXT 3ZT3A 4KV8A 5K14A 4LH5A 3S3NA 3RRGA 2D0CA 4B9TA 3FFIA 2Z1GA 4G1QA 3CFRA 3L2QA 3MEDA 1EKEA 3DRRA 2RF2A 3PX6A 3RMAA 2JGUA 4CJ5A 5KGWA 4ID5A 3TAEA 3L2RA 1S9EA 2B6AA 3G10A 2JLEA 1VSJA 2I5JA 4Q5VA 3AVCA 1WSIA 4GVMA 3CFPA 3SUOA 1NJXA 3SCXA 1GOAA 1RT7A 3ZSOA 3D0PA 3T3FA 4F2SA 3TAGA 3LP3A 3RMBA 4C8LA 3HO1A 3V9ZA 1RDCA 3LP2A 5CZ1A 3AO4A 3AVBA 4JLHA 4CFAA 3U3GA 3SI6A 4CJTA 4HHTA 4FJGA 4Z4HA 4E89A 1L3UA 3BDPA 1TK5A 4FJIA 4K8ZA 4DU4A 1BQMA 4B3OA 4Z4CA 1NOZA 3AA5X 3DMJA 4LY7A 1K6YA 3TR8A 1C1CA 3DRSA 4I9QA 3MECA 1SKWA 3CM5A 3SV4A 1UA1A 2VG7A 3AO2A 4FM2A 1NJWA 3V9XA 1R0AA 1X9WA 2G8WA 4N56A 4PA1A 1U48A 4FLTA 4ELUA 3DOKA 3DYAA 3LAKA 1RILA 1RT6A 1XI1A 4JRQA 2OA8A 4CJQA 3QINA 5CYQA 4M42A 1XC9A 4Q0BA 2G8VA 4DTRA 5JS2A 3K5LA 3B6OA 3L8BA 3AA3A 2X74A 4HUGA 1WAFA 2OZSA 1REVA 4DFPA 1ASVA 4OGCA 4CFDA 4OJRA 4FK2A 2YHBA 1VSIA 1Z26A 3VQBA 4J2AA 3KLEA 3NCIA 3NGIA 4CHOA 1RTJA 1BL3A 3OYMA 1KFSA 1SKSA 1LAWA 5I3UA 1CZ9A 3P5JA 4KI4A 3AO5A 3VQ7A 4FXDA 2FBTA 2RN2A 3SV3A 3ZT4A 3O3FA 4FLWA 2KZZA 2XRIA 4CGIA 3PO5A 4CHQA 3OYCA 3RRHA 1TGOA 4O44A 1TKTA 3C95A 1NK8A 3I8DA 1VSLA 4RW7A 3IAYA 3OYGA 3K5OA 1NJYA 2X6SA 5HLFA 4I2PA 3HP9A 1S1TA 3L3UA 4LD0A 3VQQA 4CK3A 4DU3A 3B6PA 1RBTA 1LWFA 1BCOA 3ZSRA 2IGIA 4CFCA 4FLZA 1S5JA 4E3SA 4KHUA 4B9SA 3OYIA 3HPGA 4BE2A 4W5QA 1UA0A 1ZYQA 4B9NA 4CGJA 4CGFA 4F3OA 4KI6A 1RBRA 4N76A 2FBXA 1VSKA 1NK7A 2PYLA 4FJMA 4OLBA 4I2QA 4CFBA 2E4LA 4DQIA 4Z4IA 4CJRA 1S1UA 4I7FA 4FZYA 4C8MA 3OYKA 2PZSA 3S9HA 4PUOA 2HHXA 3QIOA 2DY4A 4CGHA 3OS0A 1HRHA 1JL1A 3CQ8A 1HYZA 2D0BA 4DSKA 1EETA 2HVHA 4HCBA 1JXBA 1JLQA 4H4OA 4E19A 4KRFA 3K58A 1XHZA 3QO9A 1ZBUA 3AA4A 1C1AA 1Z25A 4AHCA 4CEQA 4FLUA 2VG5A 4M3RA 3AO3A 4CF2A 1A5WA 4FK0A 4O5BA 1GOBA 2OPQA 4B08A 1TV6A 3HVTA 4RW9A 2A1RA 4DWIA 4KREA 4FLYA 1NK5A 4AHUA 3NH1A 3HK2A 2XO7A 4E0DA 1S9GA 2KTQA 3SJJA 4FZXC 2VWJA 5HRNA 4W5OA 3HSTB 1EP4A 4KHYA 3HM9A 2QKBA 3OYFA 4CHPA 1JXEA 1S1XA 2OPPA 3LPUA 3KJVA 4FLVA 4ELVA 4M3YA 1ZBHA 3SQ2A 1TAUA 1TAQA 4KO0A 1X9SA 3KKRA 4DG1A 3AO1A 1L3TA 4Z4EA 4PQUA 4E7IA 4AHTA 1JLFA 3RR8A 4FM1A 3K2PA 4H4MA 2QK9A 3NDKA 4ID1A 4DFMA 3QNNA 1IO2A 1I39A 3SPZA 4DSEA 4DTSA 3P83D 1UAXA 4FJ7A 3OVNA 1B92A 1WN7A 5DK5A 3LPTA 3ZSVA 5CY4A 1EXQA 1KCFA 3VQ9A 3WNEA 4R5PA 2Y1IA 4DQRA 2OPSA 3VQDA 1TK0A 2P5GA 4KHNA 3VQAA 5HRPA 1TVRA 3E01A 3LANA 3VQ6A 1KFDA 2B5JA 4NYNA 1T05A 4CHNA 1LW2A 4I9LA 4CJEA 4DFJA 1ZBIA 1RDDA 1QS4A 3U3YA 3CYMA 4H8KA 3VQ4A 4MQ3A 4FJNA 2Z1HA 3KK1A 4DSFA 3NGYA 1DTQA 4JRPA 4HCCA 3ASMA 3TAMA 3OYLA 1SL2A 2XY7A 5FROA 1VRTA 3P1GA 4E7KA 5I42A 1QE1A 4F2RA 2AJQA 1NK6A 2F96A 4EP4A 4DTOA 1NOYA 4Z4FA 4O0IA 3C6TA 2HHSA 2ATQA 4BDPA 3HPHA 1IG9A 4DS5A 1RT3A 3QERA 5KTQA 1T8EA 3I0SA 4DSLA 4FK4A 1BHLA 2E6MA 1VSDA 1RT2A 3CFOA 3NF9A 2HMIA 1TKZA 4J2BA 4FJKA 3KD1E 3HPOA 1RBSA 5HRSA 2HHTA 4BDYA 3ZSQA 3KTQA 1LWCA 1D5AA 5SWMA 4DU1A 1IKXA 4ZHRA 5C42A 4O4GA 2YHAA 4CEOA 4Z4GA 3LALA 2YNIA 4UQGA 3V9SA 1TL1A 1HQEA 3AVMA 3L2UA 2WOMA 1QSLA 3HXMA 5HROA 4AH9A 3ZT1A 4F4KA 3SPYA 3QEWA 3G0ZA 1JLEA 3ITHA 3L2WA 3CG7A 3V4IA 4KAZA 4CJVA 1RBUA 1VRUA 5DMRA 1C0MA 3SQ1A 1X9MA 2QKKA 1GOCA 4B8AB 3M8RA 4OPKA 3O4NA 4KPYA 4E1MA 1U04A 3VQPA 4NCBA 4FJLA 1D9DA 4DTJA 2G8KA 3RMCA 1S1WA 4CERA 3TARA 4CJ3A 4DF4A 4F3TA 1HNVA 2FBYA 2BGGA 1VK0A 3AVIA 3KKSA 4NCGA 1HPZA 1LWEA 1JLCA 2IS3A 1S6PA 3F73A 4AHSA 3I0RA 4CGGA 4C8OA 4CJKA 2VWKA 4Z0UA 3RTVA 1HYSA 4YNQA 4CHZA 3ZSWA 3PV8A 1BIUA 1J54A 4IDKA 1WSHA 1LV5A 4FZZA 3C6UA 1D8YA 5HBMA 2Z1JA 1KVBA 3MXMA 2IOCA 2Q3SA 3OYHA 2YV0X 2A1SA 4OKKA 4NCAA 3SZ2A 4DLEA 2GV9A 1SL0A 4M3ZA 4AHRA 4RG8A 4QCLA 1BISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L2V A;  1NKC A;  4JS5 A;  1ZBL A;  2KFZ A;  4M3U A;  4OPJ A;  2XY5 A;  2HND A;  4W5R A;  2G8U A;  4KHW A;  3SUN A;  2ITG A;  1Q9Y A;  4CJS A;  1UWB A;  4CCH A;  3V6D A;  3QET A;  2WON A;  3TAF A;  4AHV A;  2IDO A;  4BE1 A;  4QAG A;  1NK0 A;  5FRN A;  4M3T A;  1DLO A;  1HYV A;  4BAC A;  4DTM A;  2HHW A;  1QQC A;  4CEF A;  5D3G A;  4KFB A;  3K57 A;  4DTU A;  3V1R A;  4N41 A;  3NH0 A;  1FK9 A;  3WNH A;  1RT5 A;  3SQ4 A;  4XIU A;  4E7L A;  1A5X A;  3IRX A;  3VQC A;  2HVI A;  1BI4 A;  3BGR A;  3V1Q A;  1U47 A;  4C8N A;  1RCH A;  3NF6 A;  4M41 A;  4M45 A;  3DLE A;  5KRS A;  4IFY A;  5KGX A;  3NH2 A;  3RR7 A;  1CLQ A;  4OGE A;  1RNH A;  2D0A A;  1WNS A;  3MXI A;  4IG3 A;  1L3V A;  2G8F A;  3SYZ A;  4K8X A;  1LW0 A;  3ISN C;  2F8S A;  2QXF A;  5J2M A;  1WSJ A;  3ULD A;  2DFH A;  5FRM A;  2XY8 A;  2PYJ A;  4CED A;  3LZI A;  3NFA A;  4W5N A;  1KLN A;  3KLI A;  4CEE A;  2G8H A;  1KLM A;  3O3H A;  1VSH A;  4NYF A;  2DFE A;  3PX0 A;  1U49 A;  3H08 A;  3MEE A;  4B9U A;  1RTD A;  2O4I A;  1F21 A;  4GMJ B;  4EP5 A;  1O1W A;  3QEV A;  1I3A A;  1G15 A;  5J2P A;  3NE6 A;  3AVN A;  3AVJ A;  2HNZ A;  3HL8 A;  3THV A;  3DI6 A;  1RDA A;  2O4G A;  5KI6 A;  4CEB A;  4CJL A;  4Y1C A;  1KTQ A;  3S3M A;  1MU2 A;  4HUF A;  2OZM A;  4FJH A;  1C0U A;  1IKW A;  3ZCM A;  3JSM A;  4FYD A;  4DFK A;  3L3V A;  1HMV A;  4RW4 A;  3HT3 A;  3LWL A;  3V81 A;  4CK1 A;  3ZSX A;  2DTU A;  3QES A;  3V1O A;  1WSE A;  2FC0 A;  4CK2 A;  4QOZ B;  4PWD A;  2YNF A;  4B8C A;  1RT1 A;  3OYN A;  4ZTJ A;  2ZE2 A;  2RKI A;  1IH7 A;  2BE2 A;  3MEG A;  4CJP A;  4CGD A;  4CF1 A;  3O4Q A;  4HUE A;  1RTH A;  1YT3 A;  4KB0 A;  3ZSY A;  2D5R A;  2GBZ A;  1RTI A;  2Z1I A;  4FW2 A;  1VSF A;  4WE1 A;  2X78 A;  3A2F A;  3DLR A;  2IAJ A;  2YKM A;  1UOC A;  3V9W A;  1QSS A;  3RWU A;  4DTX A;  3M8P A;  1Q8I A;  3DLB A;  1LAV A;  4DTN A;  1U4B A;  1YTU A;  3M8S A;  3KD5 E;  1ASU A;  5J1E A;  3CM6 A;  4N5S A;  1N6Q A;  3KK3 A;  4FCY A;  3DM2 A;  3SUQ A;  2B4J A;  1XHX A;  3NF8 A;  4OLA A;  1W9H A;  4BE0 A;  4DQQ A;  3UIQ A;  3LP0 A;  4DLG A;  1RBV A;  4CF0 A;  4W5T A;  3OJS A;  1B9F A;  5T7B A;  4E7H A;  1C6V A;  3ZSZ A;  4CF8 A;  5E41 A;  4GW6 A;  4J2D A;  2VG6 A;  2E6L A;  5C24 A;  2P1J A;  4JS4 A;  3HJF A;  4O0J A;  4CEA A;  1CXQ A;  3F9K A;  3EYZ A;  1T03 A;  1NK9 A;  1X1P A;  1VSM A;  2ZD1 A;  3VA3 A;  3TWH A;  1KVC A;  4RW8 A;  1WSG A;  1J5O A;  4OKE A;  4HTU A;  2KFN A;  2OYQ A;  3TAQ A;  3T19 A;  1BI4 B;  4DSJ A;  2PY5 A;  4OVL A;  3QEX A;  4FJ5 A;  1ITG A;  3ZT2 A;  4PY5 A;  3PY8 A;  4CHY A;  2HW3 A;  3SNN A;  2HHV A;  3LP1 A;  3ZT0 A;  4IBN A;  3OYB A;  1HJR A;  1HQU A;  4ICL A;  3HVR A;  1T7P A;  1FKP A;  3K5M A;  1SKR A;  4F8R A;  3HYF A;  3TAP A;  2FBV A;  4YFU A;  3LWM A;  4FVM A;  2YNG A;  4DF8 A;  3LDS A;  4HVJ A;  4DQP A;  3OY9 A;  4O55 A;  2HNY A;  3WNF A;  5EU7 A;  3T1A A;  4LSL A;  4LSN A;  3OJU A;  1JLG A;  3DLG A;  3K59 A;  1QHT A;  1W0H A;  3LZJ A;  4L8R B;  3WNG A;  1XWL A;  2G8I A;  2F8T A;  2HHQ A;  5CZ2 A;  2YKN A;  1CXU A;  2IC3 A;  3AVK A;  2Y1J A;  4KHQ A;  3JYT A;  3QEP A;  3VQE A;  4CIE A;  4Y1D A;  2R7Y A;  1B9D A;  3AVF A;  3KK2 A;  1WLJ A;  4CEC A;  3DLH A;  2HB5 A;  1KVA A;  1RT4 A;  3IG1 A;  1WSF A;  3IS9 A;  3OYE A;  3V9U A;  1SL1 A;  1JKH A;  1L3S A;  1VSE A;  3VN5 A;  3C94 A;  3AVA A;  4RW6 A;  1Q9X A;  3QIP A;  1IKV A;  1HNI A;  4TSX A;  4BWM A;  4KB1 A;  4OKJ A;  3QLH A;  3VQ5 A;  1QTM A;  2X6N A;  4CIG A;  4FW1 A;  5CYM A;  4CES A;  1YVU A;  1RDB A;  3OYJ A;  1SV5 A;  2OPR A;  1ASW A;  4AIL C;  3M8Q A;  3OS1 A;  3K5N A;  4DTP A;  3OYD A;  3DLK A;  1ZBF A;  3LAM A;  4MFB A;  3HP6 A;  3MAQ A;  3TI0 A;  1C0T A;  1C1B A;  4E1N A;  1TK8 A;  3NAE A;  3PO4 A;  1NK4 A;  3KIO A;  4CE9 A;  5J2N A;  1WAJ A;  1J9A A;  4BWJ A;  4CJF A;  4J2E A;  4IG0 A;  2KW4 A;  1BCM A;  3MXJ A;  4CJU A;  3AVH A;  4KHS A;  2KQ2 A;  3D45 A;  5SZT A;  2XHB A;  2EX3 A;  4EZ9 A;  1EX4 A;  1A5V A;  2ZQB A;  3DRP A;  2LSN A;  2DFF A;  2XY6 A;  3ALY A;  2ETJ A;  1NKB A;  3S3O A;  4CF9 A;  3QEI A;  4DS4 A;  2P5O A;  4M3X A;  5C25 A;  1L5U A;  4KKO A;  4B9M A;  1Y97 A;  3AVG A;  3EY1 A;  3PX4 A;  4IKF A;  4FJ8 A;  2RPI A;  1U45 A;  3OYA A;  4CJW A;  2P51 A;  4CIF A;  4DSI A;  1BIZ A;  1BQN A;  3NHG A;  1NJZ A;  4FJJ A;  4FJX A;  1CZB A;  4FLX A;  3AVL A;  3KLG A;  3TAN A;  4ZTF A;  1S1V A;  1QSY A;  5J2Q A;  1J53 A;  4N47 A;  4BDZ A;  3AV9 A;  3DOL A;  4KTQ A;  4DMN A;  3KLF A;  2YNH A;  3VA0 A;  3AA2 A;  1NKE A;  3NGZ A;  2GUI A;  4CEZ A;  1N5Y A;  4C8K A;  1FXX A;  4DQS A;  1JLB A;  1IKY A;  1DTT A;  3SQ0 A;  3SUP A;  3TAB A;  5JS1 A;  3OS2 A;  4E7J A;  2HHU A;  4KTW A;  2W42 A;  1SUQ A;  3U6F A;  3QNO A;  1TKD A;  3EZ5 A;  5HP1 A;  4EZ6 A;  2BAN A;  3VQ8 A;  1KRP A;  1FKO A;  1TL3 A;  2EHG A;  3NBP A;  2NUB A;  3RMD A;  4B9V A;  1YTA A;  1JLA A;  4LH4 A;  4CJ4 A;  5FDL A;  3NF7 A;  4IFV A;  1D9F A;  3O3G A;  3KLH A;  4KTZ A;  2KZM A;  4FM0 A;  1TKX A;  1S6Q A;  3PUF A;  1KSP A;  4FJ9 A;  5HRR A;  4B9L A;  4ELT A;  5KRT A;  2BDP A;  4M3W A;  1JL2 A;  1BGX T;  3ZT3 A;  4KV8 A;  5K14 A;  4LH5 A;  3S3N A;  3RRG A;  2D0C A;  4B9T A;  3FFI A;  2Z1G A;  4G1Q A;  3CFR A;  3L2Q A;  3MED A;  1EKE A;  3DRR A;  2RF2 A;  3PX6 A;  3RMA A;  2JGU A;  4CJ5 A;  5KGW A;  4ID5 A;  3TAE A;  3L2R A;  1S9E A;  2B6A A;  3G10 A;  2JLE A;  1VSJ A;  2I5J A;  4Q5V A;  3AVC A;  1WSI A;  4GVM A;  3CFP A;  3SUO A;  1NJX A;  3SCX A;  1GOA A;  1RT7 A;  3ZSO A;  3D0P A;  3T3F A;  4F2S A;  3TAG A;  3LP3 A;  3RMB A;  4C8L A;  3HO1 A;  3V9Z A;  1RDC A;  3LP2 A;  5CZ1 A;  3AO4 A;  3AVB A;  4JLH A;  4CFA A;  3U3G A;  3SI6 A;  4CJT A;  4HHT A;  4FJG A;  4Z4H A;  4E89 A;  1L3U A;  3BDP A;  1TK5 A;  4FJI A;  4K8Z A;  4DU4 A;  1BQM A;  4B3O A;  4Z4C A;  1NOZ A;  3AA5 X;  3DMJ A;  4LY7 A;  1K6Y A;  3TR8 A;  1C1C A;  3DRS A;  4I9Q A;  3MEC A;  1SKW A;  3CM5 A;  3SV4 A;  1UA1 A;  2VG7 A;  3AO2 A;  4FM2 A;  1NJW A;  3V9X A;  1R0A A;  1X9W A;  2G8W A;  4N56 A;  4PA1 A;  1U48 A;  4FLT A;  4ELU A;  3DOK A;  3DYA A;  3LAK A;  1RIL A;  1RT6 A;  1XI1 A;  4JRQ A;  2OA8 A;  4CJQ A;  3QIN A;  5CYQ A;  4M42 A;  1XC9 A;  4Q0B A;  2G8V A;  4DTR A;  5JS2 A;  3K5L A;  3B6O A;  3L8B A;  3AA3 A;  2X74 A;  4HUG A;  1WAF A;  2OZS A;  1REV A;  4DFP A;  1ASV A;  4OGC A;  4CFD A;  4OJR A;  4FK2 A;  2YHB A;  1VSI A;  1Z26 A;  3VQB A;  4J2A A;  3KLE A;  3NCI A;  3NGI A;  4CHO A;  1RTJ A;  1BL3 A;  3OYM A;  1KFS A;  1SKS A;  1LAW A;  5I3U A;  1CZ9 A;  3P5J A;  4KI4 A;  3AO5 A;  3VQ7 A;  4FXD A;  2FBT A;  2RN2 A;  3SV3 A;  3ZT4 A;  3O3F A;  4FLW A;  2KZZ A;  2XRI A;  4CGI A;  3PO5 A;  4CHQ A;  3OYC A;  3RRH A;  1TGO A;  4O44 A;  1TKT A;  3C95 A;  1NK8 A;  3I8D A;  1VSL A;  4RW7 A;  3IAY A;  3OYG A;  3K5O A;  1NJY A;  2X6S A;  5HLF A;  4I2P A;  3HP9 A;  1S1T A;  3L3U A;  4LD0 A;  3VQQ A;  4CK3 A;  4DU3 A;  3B6P A;  1RBT A;  1LWF A;  1BCO A;  3ZSR A;  2IGI A;  4CFC A;  4FLZ A;  1S5J A;  4E3S A;  4KHU A;  4B9S A;  3OYI A;  3HPG A;  4BE2 A;  4W5Q A;  1UA0 A;  1ZYQ A;  4B9N A;  4CGJ A;  4CGF A;  4F3O A;  4KI6 A;  1RBR A;  4N76 A;  2FBX A;  1VSK A;  1NK7 A;  2PYL A;  4FJM A;  4OLB A;  4I2Q A;  4CFB A;  2E4L A;  4DQI A;  4Z4I A;  4CJR A;  1S1U A;  4I7F A;  4FZY A;  4C8M A;  3OYK A;  2PZS A;  3S9H A;  4PUO A;  2HHX A;  3QIO A;  2DY4 A;  4CGH A;  3OS0 A;  1HRH A;  1JL1 A;  3CQ8 A;  1HYZ A;  2D0B A;  4DSK A;  1EET A;  2HVH A;  4HCB A;  1JXB A;  1JLQ A;  4H4O A;  4E19 A;  4KRF A;  3K58 A;  1XHZ A;  3QO9 A;  1ZBU A;  3AA4 A;  1C1A A;  1Z25 A;  4AHC A;  4CEQ A;  4FLU A;  2VG5 A;  4M3R A;  3AO3 A;  4CF2 A;  1A5W A;  4FK0 A;  4O5B A;  1GOB A;  2OPQ A;  4B08 A;  1TV6 A;  3HVT A;  4RW9 A;  2A1R A;  4DWI A;  4KRE A;  4FLY A;  1NK5 A;  4AHU A;  3NH1 A;  3HK2 A;  2XO7 A;  4E0D A;  1S9G A;  2KTQ A;  3SJJ A;  4FZX C;  2VWJ A;  5HRN A;  4W5O A;  3HST B;  1EP4 A;  4KHY A;  3HM9 A;  2QKB A;  3OYF A;  4CHP A;  1JXE A;  1S1X A;  2OPP A;  3LPU A;  3KJV A;  4FLV A;  4ELV A;  4M3Y A;  1ZBH A;  3SQ2 A;  1TAU A;  1TAQ A;  4KO0 A;  1X9S A;  3KKR A;  4DG1 A;  3AO1 A;  1L3T A;  4Z4E A;  4PQU A;  4E7I A;  4AHT A;  1JLF A;  3RR8 A;  4FM1 A;  3K2P A;  4H4M A;  2QK9 A;  3NDK A;  4ID1 A;  4DFM A;  3QNN A;  1IO2 A;  1I39 A;  3SPZ A;  4DSE A;  4DTS A;  3P83 D;  1UAX A;  4FJ7 A;  3OVN A;  1B92 A;  1WN7 A;  5DK5 A;  3LPT A;  3ZSV A;  5CY4 A;  1EXQ A;  1KCF A;  3VQ9 A;  3WNE A;  4R5P A;  2Y1I A;  4DQR A;  2OPS A;  3VQD A;  1TK0 A;  2P5G A;  4KHN A;  3VQA A;  5HRP A;  1TVR A;  3E01 A;  3LAN A;  3VQ6 A;  1KFD A;  2B5J A;  4NYN A;  1T05 A;  4CHN A;  1LW2 A;  4I9L A;  4CJE A;  4DFJ A;  1ZBI A;  1RDD A;  1QS4 A;  3U3Y A;  3CYM A;  4H8K A;  3VQ4 A;  4MQ3 A;  4FJN A;  2Z1H A;  3KK1 A;  4DSF A;  3NGY A;  1DTQ A;  4JRP A;  4HCC A;  3ASM A;  3TAM A;  3OYL A;  1SL2 A;  2XY7 A;  5FRO A;  1VRT A;  3P1G A;  4E7K A;  5I42 A;  1QE1 A;  4F2R A;  2AJQ A;  1NK6 A;  2F96 A;  4EP4 A;  4DTO A;  1NOY A;  4Z4F A;  4O0I A;  3C6T A;  2HHS A;  2ATQ A;  4BDP A;  3HPH A;  1IG9 A;  4DS5 A;  1RT3 A;  3QER A;  5KTQ A;  1T8E A;  3I0S A;  4DSL A;  4FK4 A;  1BHL A;  2E6M A;  1VSD A;  1RT2 A;  3CFO A;  3NF9 A;  2HMI A;  1TKZ A;  4J2B A;  4FJK A;  3KD1 E;  3HPO A;  1RBS A;  5HRS A;  2HHT A;  4BDY A;  3ZSQ A;  3KTQ A;  1LWC A;  1D5A A;  5SWM A;  4DU1 A;  1IKX A;  4ZHR A;  5C42 A;  4O4G A;  2YHA A;  4CEO A;  4Z4G A;  3LAL A;  2YNI A;  4UQG A;  3V9S A;  1TL1 A;  1HQE A;  3AVM A;  3L2U A;  2WOM A;  1QSL A;  3HXM A;  5HRO A;  4AH9 A;  3ZT1 A;  4F4K A;  3SPY A;  3QEW A;  3G0Z A;  1JLE A;  3ITH A;  3L2W A;  3CG7 A;  3V4I A;  4KAZ A;  4CJV A;  1RBU A;  1VRU A;  5DMR A;  1C0M A;  3SQ1 A;  1X9M A;  2QKK A;  1GOC A;  4B8A B;  3M8R A;  4OPK A;  3O4N A;  4KPY A;  4E1M A;  1U04 A;  3VQP A;  4NCB A;  4FJL A;  1D9D A;  4DTJ A;  2G8K A;  3RMC A;  1S1W A;  4CER A;  3TAR A;  4CJ3 A;  4DF4 A;  4F3T A;  1HNV A;  2FBY A;  2BGG A;  1VK0 A;  3AVI A;  3KKS A;  4NCG A;  1HPZ A;  1LWE A;  1JLC A;  2IS3 A;  1S6P A;  3F73 A;  4AHS A;  3I0R A;  4CGG A;  4C8O A;  4CJK A;  2VWK A;  4Z0U A;  3RTV A;  1HYS A;  4YNQ A;  4CHZ A;  3ZSW A;  3PV8 A;  1BIU A;  1J54 A;  4IDK A;  1WSH A;  1LV5 A;  4FZZ A;  3C6U A;  1D8Y A;  5HBM A;  2Z1J A;  1KVB A;  3MXM A;  2IOC A;  2Q3S A;  3OYH A;  2YV0 X;  2A1S A;  4OKK A;  4NCA A;  3SZ2 A;  4DLE A;  2GV9 A;  1SL0 A;  4M3Z A;  4AHR A;  4RG8 A;  4QCL A;  1BIS A; 
#chains in the Genus database with same CATH topology
 2NRH A;  5AQP A;  5C0Y A;  4JS5 A;  3QDK A;  4BGB A;  4M3U A;  5GIO A;  4W5R A;  1WOQ A;  1HNZ K;  3V6D A;  2WON A;  2I7P A;  5BRF A;  4BE1 A;  5FRN A;  1HYV A;  4LF6 K;  3SBG A;  3ID6 A;  4DTM A;  4CEF A;  3SLC A;  4DTU A;  4KH5 A;  3V1R A;  4XH4 A;  3JAM O;  4ILG B;  2HVI A;  1BI4 A;  4NXM K;  4M41 A;  4M45 A;  1CLQ A;  5KGX A;  3JS6 A;  3FZM A;  1WNS A;  4IG3 A;  3SYZ A;  1LW0 A;  5J2M A;  1WSJ A;  2XY8 A;  1K9M O;  3DXK B;  3GBT A;  2DFE A;  1U49 A;  3MEE A;  4BRN A;  4Z94 A;  1RTD A;  4DQ8 A;  4B3T K;  1O1W A;  1I3A A;  1G15 A;  3AVN A;  2QXL A;  1YAG A;  3O9U A;  4WCE L;  4DR6 K;  3DI6 A;  3LL3 A;  2O4G A;  1KTQ A;  1MU2 A;  3ZCM A;  1NGD A;  3TSP A;  1HMV A;  3HT3 A;  1JCE A;  4BRC A;  5B8H A;  3A0I X;  1WSE A;  2FC0 A;  3MCA B;  3OYN A;  5AQG A;  3TTD A;  1IH7 A;  3MEG A;  4CJP A;  4CGD A;  3O4Q A;  3TSQ A;  3ZSY A;  2GBZ A;  2Z1I A;  3WUH A;  2CGL A;  1VSF A;  4WE1 A;  3DLR A;  2IAJ A;  3RWU A;  4DTX A;  1Q8I A;  2OAN A;  4BG8 A;  4K41 A;  1N6Q A;  4DQQ A;  3UKR B;  4DLG A;  3OJS A;  3EE9 A;  2IVP A;  1V4S A;  2VG6 A;  4YDU A;  4JI3 K;  5AQI A;  3A5N C;  2HF4 A;  4JS4 A;  3F9K A;  2V7Z A;  1BWF O;  1X1P A;  2ZD1 A;  4RW8 A;  1J5O A;  4OKE A;  2OYQ A;  1IV0 A;  3TAQ A;  4DR2 K;  2QM1 A;  3QEX A;  3LM9 A;  3HRG A;  4PY5 A;  4B3M K;  4CHY A;  3OYB A;  4DV3 K;  4F8R A;  3K5M A;  1BDG A;  1GLC G;  4DF8 A;  1OVY A;  1QZ5 A;  4BVO A;  1XC3 A;  2P9P A;  4BRK A;  5EU7 A;  4FZZ A;  3K59 A;  3MK6 A;  2G8I A;  2HHQ A;  3WNG A;  2YKN A;  2O8B A;  2E2P A;  4CIE A;  4Y1D A;  3KK2 A;  4DHY A;  1KVA A;  2BH1 A;  4CI6 A;  1WSF A;  3EO3 A;  3C94 A;  4JHD B;  4YOV A;  3QIP A;  1IKV A;  4KB1 A;  4BC4 A;  4CES A;  1YJ9 N;  3CCV N;  4EFH A;  4AIL C;  3OS1 A;  3CC4 N;  3OYD A;  3TI0 A;  3HP6 A;  4MFB A;  3WQU A;  3VGK A;  4O8K A;  3DAW A;  1TK8 A;  3KIO A;  1WAJ A;  3WXI A;  3CHW A;  4KHS A;  4U7B A;  2XHB A;  4EZ9 A;  4DV6 K;  4K42 A;  2XY6 A;  1MDU B;  3ALY A;  2ETJ A;  4G9Z A;  2P5O A;  3K9K A;  3HZ6 A;  4U67 L;  1OH7 A;  1SQK A;  3IUC A;  2P9S A;  2YI1 A;  3OYA A;  4CJW A;  3OHR A;  3W0L A;  2HST A;  1CZB A;  3AVL A;  1S1V A;  1QSY A;  4KTQ A;  4YOU A;  1NNE A;  3AA2 A;  1NMN A;  1T44 A;  1RFQ A;  4CEZ A;  5JVH L;  1N5Y A;  3NVK A;  3TAB A;  3T7Z A;  2QTD A;  1HJO A;  1SUQ A;  4PKI A;  4BR5 A;  2FSJ A;  4ILJ A;  3GL1 A;  1YTA A;  4WQ4 C;  4RTF D;  1D9F A;  3O3G A;  2KZM A;  1E4F T;  1G99 A;  3PIP L;  1S6Q A;  1R59 O;  4DUY K;  4FJ9 A;  3MCP A;  4ELT A;  2BDP A;  2BUP A;  4BRM A;  2Q97 A;  4H5T A;  4QS9 A;  3DRR A;  2RF2 A;  3AGR A;  4ID5 A;  3CPW M;  3G10 A;  2D4W A;  2I5J A;  4JKE A;  3H3O B;  2QWR A;  3HBT A;  3CI5 A;  2HBL A;  1GOA A;  3D0P A;  5KQ8 A;  3TAG A;  4JKG A;  3C6H A;  5EX5 A;  3LP2 A;  4JI5 K;  4CJT A;  4HHT A;  4Z4H A;  5LL6 Z;  1BQM A;  1MA9 B;  1C0G A;  3E9P A;  3PIO L;  1K6Y A;  1V4T A;  4JD2 B;  4B3R K;  4B1Y B;  2QA4 N;  4FLT A;  1VQM N;  4YDU C;  5EVZ A;  3LAK A;  3DYA A;  3FLC O;  2FF3 B;  2OA8 A;  4CJQ A;  5CYQ A;  1OKJ A;  5JLF A;  2JWK A;  3AA3 A;  4C1N I;  4CZG A;  1WAF A;  4FK2 A;  1HKB A;  4DFP A;  4OGC A;  4OJR A;  3VF4 A;  1VSI A;  3VQB A;  3KLE A;  3NGI A;  1BL3 A;  3J81 O;  3P5J A;  4KI4 A;  3AO5 A;  3SV3 A;  4CGI A;  1ILY A;  3L0Q A;  3PO5 A;  3SAG A;  2HBM A;  5GAD P;  3I8D A;  3OYG A;  2EWS A;  2OCE A;  3VQQ A;  3HP9 A;  3L3U A;  4LD0 A;  4DU3 A;  3ZSR A;  4ISF A;  4FLZ A;  4BR2 A;  4E3S A;  5JVG L;  1QZ6 A;  3HPG A;  2FXU A;  5GAG P;  4FOI A;  4F3O A;  4OPA A;  4IEI A;  5C2F A;  1Y64 A;  3CJ1 A;  3O1W A;  2ZJP L;  2PAV A;  2IVN A;  4IJN A;  4CJR A;  1NM1 A;  4FL9 A;  2PZS A;  3S9H A;  2HHX A;  3WEE B;  5AFU A;  4BG9 A;  3OS0 A;  5M1K A;  1HYZ A;  4DSK A;  1EET A;  3F2K A;  5AQR A;  4EAH D;  1JXB A;  1XNR K;  4AHC A;  4CEQ A;  2DPN A;  2VG5 A;  3P31 A;  4FWM A;  1IJJ A;  1GOB A;  3D6R A;  5AQL A;  1M90 O;  4DWI A;  4KRE A;  4JI4 K;  4FLY A;  5E84 A;  4W5O A;  1K8K B;  1EP4 A;  3M3Z A;  3OYF A;  2W6L A;  1JXE A;  1S1X A;  2OPP A;  2WC9 A;  4GVE A;  4ELV A;  3SQ2 A;  1X9S A;  4KO0 A;  4DG1 A;  1L3T A;  1JCF A;  4E7I A;  3R3L A;  3NDK A;  2IIR A;  3QNN A;  1I39 A;  3SPZ A;  4DSE A;  1UAX A;  1NGI A;  3LDL A;  1XMQ K;  4A2A A;  3LPT A;  1KCF A;  3WNE A;  2Y1I A;  4BRQ A;  4E1J A;  3CC2 N;  3VQ6 A;  4NYN A;  1LW2 A;  4I9L A;  4A57 A;  4DFJ A;  5MLC Q;  3CXC M;  4JYA K;  3U3Y A;  3VQ4 A;  4MQ3 A;  4DSF A;  4J8F A;  3TAM A;  4JKD A;  5IWA K;  2XY7 A;  1VRT A;  2OTJ N;  3OA9 A;  3VEV A;  2YHY A;  5CR4 A;  2CGJ A;  5JIC A;  4DS5 A;  1NGJ A;  1RT3 A;  4CD1 A;  5BPN A;  1BA1 A;  3MN5 A;  1X9J A;  2E6M A;  3MDQ A;  5C10 A;  4FJK A;  2NRV A;  4BDY A;  2NRZ A;  1LWC A;  2Q0U A;  3FZK A;  4DV4 K;  4DU1 A;  3WXM B;  5C42 A;  4O4G A;  5BR9 A;  3V9S A;  1TL1 A;  3AVM A;  3L2U A;  3HXM A;  4GV3 A;  2AP1 A;  3ZT1 A;  3CCE N;  3QEW A;  4DKW A;  2HBK A;  3ITH A;  3CCJ N;  2F9W A;  4KAZ A;  4CJV A;  4RCH A;  1VRU A;  1BOT O;  5DMR A;  3VQP A;  3THY B;  3RMC A;  1S1W A;  4CER A;  3TAR A;  4DF4 A;  3I55 N;  2FBY A;  2UYT A;  3K9J A;  2UUC K;  4CZK A;  3O80 A;  4BRP A;  3RTV A;  4YNQ A;  1BIU A;  1GLE G;  3C6U A;  1QVG M;  2Z1J A;  4OKK A;  3SZ2 A;  4DLE A;  1BIS A;  1U2V B;  2YHW A;  5F2R A;  4OPJ A;  2G8U A;  2KKZ A;  3QFP A;  1UWB A;  5LMU K;  1MWM A;  3QET A;  3TAF A;  4AQY K;  1QQC A;  5D3G A;  4KFB A;  1FK9 A;  1RT5 A;  3R1X A;  3O9S A;  2NNW A;  3V1Q A;  3P38 A;  1YIT N;  4K8X A;  1L3V A;  3ISN C;  1OH8 A;  2DFH A;  2OTL N;  4CED A;  3LZI A;  3LDP A;  5HL7 L;  3O3H A;  2H3G X;  3H08 A;  3CJA A;  5J2P A;  4LF5 K;  3AVJ A;  4FVU A;  2HNZ A;  4BC2 A;  3THV A;  1RDA A;  5KI6 A;  4CJL A;  1ATN A;  4Y1C A;  4BRF A;  3S3M A;  1OH5 A;  3H46 O;  3JSM A;  2ZJR L;  4FYD A;  3LWL A;  1QHA A;  3VGM A;  3GDQ A;  4CK2 A;  4QOZ B;  2NRX A;  2Q0R A;  2YNF A;  3EL2 A;  1VQN N;  2CGK A;  2V7Y A;  4HUE A;  1Z6R A;  1RTI A;  2YKM A;  1I94 K;  2O8D A;  1LAV A;  5AZI B;  3M8S A;  3KD5 E;  1ASU A;  4BRD A;  4N5S A;  3L4Q A;  4O5F A;  3SUQ A;  2B4J A;  3ZET A;  3WEE A;  3VEZ A;  1W9H A;  3LP0 A;  4W5T A;  4BRO A;  1QQM A;  4E7H A;  3ZSZ A;  5E41 A;  4J2D A;  4BQZ A;  2E6L A;  2FLO A;  4Y0W A;  4O0J A;  4CEA A;  3EYZ A;  5AQJ A;  2HMP A;  1KVC A;  4FWK A;  1RDW X;  3LM2 A;  5FPN A;  1KC8 O;  3T19 A;  3Q7B A;  4GNI A;  2PY5 A;  4OVL A;  1ITG A;  2QWN A;  3C7N A;  3JXU A;  2HHV A;  2ZF5 O;  3ZT0 A;  4IBN A;  4FSV A;  4X66 K;  1HQU A;  1T7P A;  3SAH A;  1FKP A;  2D0O A;  1SKR A;  4FVM A;  4DQP A;  4HVJ A;  3BF3 A;  3OY9 A;  3CJ7 A;  4O55 A;  3WNF A;  1NGA A;  1TAU A;  1JLG A;  3ZLJ A;  1QHT A;  5BN9 A;  5CZ2 A;  1CXU A;  4KHQ A;  3AVK A;  1P90 A;  3JYT A;  3VQE A;  3AVF A;  4NO7 A;  3DLH A;  3HM8 A;  1RT4 A;  3OYE A;  3IS9 A;  1SL1 A;  1JKH A;  1YJN N;  4LFA K;  1Q9X A;  4TSX A;  1ATR A;  1HNI A;  4BWM A;  3QLH A;  3TPQ A;  2X6N A;  4FW1 A;  2QWM A;  5CYM A;  2VWB A;  2OPR A;  1ASW A;  5AZJ B;  2O8F A;  3LAM A;  1ZBF A;  3MAQ A;  1C0T A;  1C1B A;  4IXC A;  3ATU A;  3PO4 A;  3R8E A;  4CE9 A;  1FW6 A;  1J9A A;  4J2E A;  4CJF A;  4FWR A;  4IG0 A;  1JCG A;  3U4L A;  3R9P A;  5BPL A;  3IFR A;  4JI0 K;  3D45 A;  2ZQB A;  3DRP A;  3J8A A;  5M1O A;  1NKB A;  3W3D A;  4H0O A;  3H6E A;  4KKO A;  1L5U A;  5ADX H;  3EY1 A;  4IKF A;  1U45 A;  3RSE A;  3AAR A;  2W40 A;  4PL8 A;  1KAX A;  4WQ4 A;  1NJZ A;  4LF9 K;  3KLG A;  4ZTF A;  1J53 A;  4BDZ A;  3THY A;  3AV9 A;  2YJE A;  3SMS A;  3KK7 A;  4K0K K;  4DMN A;  3KLF A;  2YNH A;  3VA0 A;  3BZC A;  3IKM A;  4C8K A;  1FXX A;  1JLB A;  1IKY A;  3SQ0 A;  4E7J A;  2HHU A;  3ULE B;  2W42 A;  4DV2 K;  2V52 B;  2QW9 A;  3PSF A;  2BAN A;  5HP1 A;  1TYQ B;  3NBP A;  2NUB A;  4XH5 A;  4B9V A;  1JLA A;  2HBJ A;  1VQ5 N;  3NF7 A;  4IFV A;  4WQ5 C;  5HRR A;  5KRT A;  3T1Y K;  4KV8 A;  3S3N A;  4LH5 A;  1U2V A;  4CZE A;  4K43 A;  3FFI A;  2E8A A;  3CFR A;  5AQQ A;  2KLA A;  4X62 K;  4B1X B;  1S9E A;  1VSJ A;  2HHH K;  3SUO A;  4RWT A;  3SCX A;  3M6G A;  3ZSO A;  5GIP A;  3V9Z A;  4OO1 J;  3D2E B;  3AO4 A;  4JLH A;  3SI6 A;  3VMF B;  1TK5 A;  2NRT A;  2O8E A;  3AA5 X;  4FOE A;  4LY7 A;  3TR8 A;  3DRS A;  1SKW A;  3SV4 A;  3AO2 A;  3V9X A;  1R0A A;  2UU9 K;  4PA1 A;  5CHI A;  4KBO A;  4BQL A;  4JRQ A;  1XC9 A;  4Q0B A;  4QS7 A;  4HUG A;  3T69 A;  4CFD A;  1KAY A;  1Z26 A;  4A61 A;  4A2B A;  3VEY A;  4EHT A;  3OYM A;  2QWL A;  1KFS A;  3HSC A;  1GLD G;  4BC5 A;  4NLB A;  3AAQ A;  2FBT A;  3RVC A;  3UKU B;  1U6Z A;  4YY3 K;  2PBD A;  3EKS A;  4CHQ A;  3OYC A;  1TUY A;  1SAZ A;  3FFK B;  2I7N A;  1VSL A;  4RW7 A;  3IAY A;  2X6S A;  3NMU A;  4AM6 A;  1RBT A;  2VGM A;  2IGI A;  1S5J A;  4B9S A;  3OYI A;  5HOO A;  1IBL K;  4W5Q A;  1ZYQ A;  4CGJ A;  4I6M A;  4N76 A;  2FBX A;  1VSK A;  2PYL A;  1NGE A;  4I2Q A;  2E4L A;  3WXK A;  4CJ7 A;  3OYK A;  4CGH A;  1NGB A;  2ZM6 K;  3CQ8 A;  2HVH A;  1IBK K;  4HCB A;  1ZBU A;  1S72 N;  1C1A A;  3U9D A;  3AO3 A;  4CF2 A;  1A5W A;  4AF1 A;  1NG9 A;  1NK5 A;  3NH1 A;  2UUB K;  3I33 A;  2XO7 A;  2P9K A;  1S9G A;  4BRH A;  4WF9 L;  5HRN A;  3HST B;  2QKB A;  3U9Z A;  1ZBH A;  1WBD A;  2ASM A;  3KKR A;  5AQX A;  3FR0 A;  5DM7 L;  4GV9 A;  4AHT A;  3RR8 A;  3O9T A;  3LDQ A;  4JK9 A;  1IO2 A;  2A42 A;  4DTS A;  3P83 D;  1NGF A;  4FWS A;  2ZGY A;  1YIJ N;  1WN7 A;  1TK0 A;  3VES A;  4R5P A;  4JKB A;  3VQD A;  4KHN A;  3VQA A;  1EO1 A;  1QS4 A;  3CYM A;  3CJB A;  3QBX A;  4DR4 K;  2Z1H A;  3NGY A;  1DTQ A;  5F0X A;  4JRP A;  1W2B M;  2FSN A;  3GE1 A;  4OX9 K;  3P1G A;  5AZJ A;  1XUP O;  1W7A A;  4F2R A;  1NK6 A;  1NOY A;  1GLF O;  3CIP A;  3C6T A;  4BDP A;  3HPH A;  3MWT A;  4DV1 K;  1T8E A;  3H45 C;  1BHL A;  1RT2 A;  3NF9 A;  2NLX A;  2HMI A;  1QQN A;  1K8A O;  2HHT A;  4C1N K;  1HLU A;  3KTQ A;  5SWM A;  1IKX A;  2YHA A;  3CQX A;  4UQG A;  1MWK A;  1QSL A;  5M1Q A;  3BF1 A;  5HRO A;  1EWQ A;  3DXK A;  4M7X A;  4F4K A;  3SPY A;  1BA0 A;  1JLE A;  3L2W A;  2E5L K;  2ZGZ A;  1RBU A;  3SQ1 A;  3MN6 A;  4B8A B;  3KHY A;  4OPK A;  4KPY A;  4E1M A;  2FSK A;  1HNV A;  3SJH A;  1VK0 A;  1NJI O;  2O8C B;  5AQF A;  1JLC A;  2JWL A;  3ULE A;  1EWR A;  3QBW A;  2VWK A;  1TYQ A;  4Z0U A;  4CZJ A;  3FZH A;  4CHZ A;  3ZSW A;  3PV8 A;  1J54 A;  1LV5 A;  3HOS A;  1D4X A;  4NCA A;  2YV0 X;  4BR4 A;  4RG8 A;  2E20 A;  3L2V A;  5C12 A;  1ZBL A;  4FWQ A;  5GIN A;  4GY2 B;  5E26 A;  4KHW A;  3MX2 A;  3NVM A;  5EXW A;  4CJS A;  4CCH A;  3UKR A;  4AHV A;  4GKK K;  4QAG A;  5AQV A;  4M3T A;  1DLO A;  1BU6 O;  4A62 A;  4JKC A;  3D2E A;  3K57 A;  4H0X B;  1VQK N;  4N41 A;  4NB4 A;  3NH0 A;  4XIU A;  2E2Q A;  3VQC A;  1HNW K;  5KRS A;  3NH2 A;  1YVN A;  4OGE A;  2D0A A;  2F8S A;  2QXF A;  5FRM A;  2PYJ A;  2NRW A;  3NFA A;  1KLN A;  3KLI A;  4YOR A;  4CEE A;  1HKC A;  1KLM A;  2G8H A;  3PX0 A;  1VSH A;  4NYF A;  4B9U A;  2E1Y A;  4EP5 A;  3QEV A;  3NE6 A;  2RHK A;  3ZX3 A;  1Q18 A;  2Q31 A;  4HWI A;  3HL8 A;  4HUF A;  2OZM A;  4JKA A;  4FJH A;  1C0U A;  3FZF A;  4A5A A;  1NGG A;  3I8B A;  4RW4 A;  4JHD A;  4IDH A;  3V81 A;  1VQP N;  2HF3 A;  3VEW A;  2GTD A;  3O9Q A;  3QES A;  4BR9 A;  4PWD A;  5TKY A;  4B8C A;  1RT1 A;  3SAF A;  2RKI A;  2BE2 A;  4FPA A;  4CF1 A;  2D5R A;  4FW2 A;  3A2F A;  1UOC A;  3V9W A;  1QSS A;  1NU0 A;  4JI8 K;  3DLB A;  3J7Z O;  1YTU A;  5KQD A;  2D0P A;  1LCU A;  5AQT A;  5J1E A;  3THX B;  3KK3 A;  4FCY A;  3DM2 A;  5GAE P;  1XHX A;  5AQS A;  3NF8 A;  4OLA A;  1O13 A;  4BE0 A;  3UIQ A;  3VER A;  4CF0 A;  4PL7 A;  4GW6 A;  2CH5 A;  2GEL A;  3BP8 A;  1CXQ A;  4H5V A;  3O6W A;  3VTI A;  1YI2 N;  3TWH A;  4JNE A;  3CME N;  4H0T B;  1WSG A;  1N32 K;  3F9M A;  1BI4 B;  1WBB A;  4JI7 K;  2ZWH A;  4CBW A;  3SNN A;  3VF6 A;  3HVR A;  4CD3 A;  2UUA K;  3HYF A;  4BVP A;  3QB0 A;  1YHQ N;  2YNG A;  3LDS A;  4LFB K;  1SS6 A;  4AM7 A;  3T1A A;  4LSL A;  4LSN A;  3OJU A;  2F8T A;  1W0H A;  2UXD K;  3MMV A;  4LF8 K;  2R7Y A;  5AQZ A;  4IOC L;  1B9D A;  2YHX A;  1WLJ A;  4CEC A;  1ZXO A;  1L3S A;  5EOY A;  2W41 A;  5M1P A;  4RW6 A;  3VET A;  3DXM B;  1QTM A;  1Q81 O;  1YVU A;  3OYJ A;  1HR0 K;  1SV5 A;  4BRE A;  3M8Q A;  4DTP A;  4DV7 K;  5TKW A;  3NAE A;  4BWJ A;  1N8R O;  3VPZ A;  2A3Z A;  2KW4 A;  3MXJ A;  4CJU A;  2AA4 A;  4IWV A;  2KQ2 A;  2ASP A;  4BRL A;  5SZT A;  2EX3 A;  4MDB A;  1EX4 A;  4FWO A;  1A5V A;  1YJW N;  4JD2 A;  4CW7 B;  3QEI A;  4M3X A;  2VYP A;  4B9M A;  3AVG A;  1NBW A;  3PX4 A;  4FJ8 A;  2RPI A;  5KPT A;  3KZB A;  1QVF M;  5LJV A;  4K25 A;  2ASO A;  1BIZ A;  1BQN A;  3CCM N;  3N4Q A;  4FJX A;  4WQ5 A;  3EKU A;  4BR0 A;  3TAN A;  1VQ7 N;  4N47 A;  3DOL A;  1KAZ A;  1NKE A;  2GUI A;  4DQS A;  2O8C A;  1DTT A;  3SUP A;  4HTL A;  3VTH A;  5JS1 A;  3BUZ B;  3OS2 A;  4WFA L;  3CCR N;  4L3Q A;  4B1V A;  2EHG A;  4CZI A;  1JJ2 M;  3RMD A;  4PKG A;  4CJ4 A;  1NMD A;  3KLH A;  5JMV A;  1NWK A;  5I9E B;  5H1S Q;  2O8B B;  1KSP A;  5AQM A;  3C0B A;  3OTO K;  4M7Y A;  4B9L A;  1Q82 O;  4M3W A;  1BGX T;  3ZT3 A;  3A5M C;  4C23 A;  2D0C A;  4B9T A;  4CZF A;  1KQS M;  2Z1G A;  4G1Q A;  1J6Z A;  4WFN L;  3RMA A;  4CJ5 A;  5KGW A;  1M1K O;  3TAE A;  4CVN E;  2B6A A;  3DLL L;  4GVM A;  1WSI A;  3CFP A;  4DV5 K;  3OBW A;  3RMB A;  3HO1 A;  2YX6 A;  4IOA L;  3F5T A;  5EY4 A;  4JI1 K;  3U3G A;  4E89 A;  5AFU H;  4K8Z A;  4CBX A;  4B3O A;  3PLA A;  3AY9 A;  4QS8 A;  3G71 N;  3G4S N;  3DMJ A;  4I9Q A;  1K8K A;  4CBU A;  3CM5 A;  1UA1 A;  3MX5 A;  2VG7 A;  4FM2 A;  5LMN K;  1X9W A;  2G8W A;  3R6M A;  4N56 A;  1W97 L;  4BY9 C;  4ELU A;  1XI1 A;  1RIL A;  4M42 A;  3QIN A;  4DTR A;  3K5L A;  5FPM A;  3L8B A;  1REV A;  1Q86 O;  2NRR A;  3NCI A;  3CPE A;  3UB5 A;  2A6A A;  1CZ9 A;  3H3N O;  3VQ7 A;  4FXD A;  4IOX A;  3ZT4 A;  4FLW A;  2KZZ A;  2QI2 A;  5GAH P;  4DR3 K;  4LF7 K;  3A5L C;  3BZK A;  1TKT A;  3C95 A;  4O44 A;  4IZ9 A;  2RE2 A;  3VOV A;  4I2P A;  1S1T A;  4CK3 A;  1HNX K;  3CD6 N;  3B6P A;  1BCO A;  4CFC A;  2A40 A;  1N33 K;  3SK3 A;  4B9N A;  4DB3 A;  4KI6 A;  1RBR A;  2CH6 A;  4OLB A;  4FJM A;  3THX A;  4I7F A;  2F4V K;  4XEI A;  3CJC A;  4KHP K;  1JL1 A;  4JV5 K;  4JKF A;  1JLQ A;  4H4O A;  2QWO A;  4JKG B;  3AA4 A;  1Z25 A;  4JKH A;  2OPQ A;  4B08 A;  1TV6 A;  4RW9 A;  5AQW A;  2A1R A;  3GOI A;  4AHU A;  1H1V A;  4E0D A;  1S3X A;  4FWL A;  4EIA A;  3SJJ A;  4FZX C;  1N36 K;  4KHY A;  3HM9 A;  3AAP A;  1Q7Y O;  4CHP A;  3LPU A;  4H5R A;  3P39 A;  4Z4E A;  4YHH K;  4B9Q A;  3L6Q A;  4ID1 A;  4DFM A;  2V51 B;  4CZM A;  4FJ7 A;  3ZSV A;  3VQ9 A;  2O4I A;  2P5G A;  2OPS A;  4PHT X;  5HRP A;  3CF5 L;  3LAN A;  2B5J A;  3CCS N;  3HTV A;  4CJE A;  4BGA A;  3H1V X;  4YOT A;  4DUZ K;  4FJN A;  3DXM A;  3PSI A;  3CJ9 A;  4MDA A;  4UY8 O;  4YOW A;  3E9L A;  1SL2 A;  4E7K A;  1QE1 A;  4DTO A;  4EP4 A;  4Z4F A;  1DEJ A;  2QEX N;  4O0I A;  1XMO K;  2HHS A;  3M1F A;  1IG9 A;  1DT9 A;  3QER A;  5KTQ A;  2P9L B;  3I0S A;  2HOE A;  4DSL A;  2UXC K;  1VQ6 N;  3O08 A;  1VQO N;  1TKZ A;  3KD1 E;  1RBS A;  3J7Y P;  3ZSQ A;  1WB9 A;  3LAL A;  2YNI A;  5KPZ A;  1HQE A;  3O8M A;  5FPD A;  3CMA N;  3G6E N;  1LOT B;  4DV0 K;  4AH9 A;  4YOX A;  3CG7 A;  4IO8 A;  3V4I A;  4LC9 B;  2GX9 A;  4BR7 A;  1C0M A;  4X65 K;  2QKK A;  3M8R A;  3THW B;  3L4I A;  1CZA N;  3O4N A;  4NCB A;  1BG3 A;  4F3T A;  4CJ3 A;  2BGG A;  3AVI A;  1HUX A;  3M5R A;  4NCG A;  1ESV A;  1NLV A;  1LWE A;  3F73 A;  4CGG A;  3VGL A;  4C8O A;  5AQU A;  3EZW A;  3WXL A;  4R79 A;  1XQS C;  1HYS A;  1WSH A;  3WXJ A;  5HBM A;  3MXM A;  2IOC A;  3ZEU B;  2Q3S A;  3OYH A;  2A1S A;  4M3Z A;  1SL0 A;  4AHR A;  2ZJQ L;  4H0Y B;  3AGK A;  5AZI A;  4V19 S;  4GV6 A;  4O8U A;  2KFZ A;  2A5X A;  3E66 A;  2XY5 A;  2HND A;  4DR1 K;  5C2D A;  3SUN A;  2ITG A;  1Q9Y A;  2IDO A;  3J80 O;  3A5O C;  1NK0 A;  4B1W B;  4BAC A;  2HHW A;  3I56 N;  2E2O A;  3IMX A;  3C6A A;  3WNH A;  4ISG A;  4E7L A;  3SQ4 A;  1A5X A;  3ENH A;  3IRX A;  4IJA A;  2FF6 A;  3BGR A;  3D2F B;  1U47 A;  4C8N A;  1RCH A;  2E88 A;  3NF6 A;  3DLE A;  3RR7 A;  4IFY A;  1RNH A;  4H0P A;  3MXI A;  4JI2 K;  2G8F A;  3ATV A;  3ULD A;  1OH6 A;  1TUU A;  4W5N A;  5AQO A;  4A5B A;  2E1Z A;  3S41 A;  5F1X A;  5BRD A;  2P9I B;  1F21 A;  4GMJ B;  2F7T A;  4KH4 A;  3C65 A;  3P4I A;  5FPE A;  4B1U B;  4CEB A;  4WFB L;  3O5B A;  3FZL A;  4ISE A;  1IKW A;  1BUP A;  3HI0 A;  4DFK A;  3L3V A;  1RDU A;  4CK1 A;  3TTF A;  3CCL N;  3ZSX A;  2DTU A;  3V1O A;  4MLE A;  3B8A X;  4ZTJ A;  2ZE2 A;  5AQN A;  1RTH A;  1YT3 A;  4OPH A;  4KB0 A;  2KHO A;  1C0F A;  4FJ5 A;  2X78 A;  4JN4 A;  4JI6 K;  4KH6 A;  3D7E O;  3SBT A;  3M8P A;  4DTN A;  1U4B A;  3FE1 A;  2YCH A;  1P8Z A;  3CM6 A;  2GWK A;  4XH1 A;  2PFU A;  1RBV A;  1S22 A;  1B9F A;  1HKG A;  5T7B A;  1C6V A;  4CF8 A;  5C24 A;  2P1J A;  3HJF A;  3CER A;  2VCP A;  1T03 A;  1NK9 A;  1VSM A;  3VA3 A;  4GKJ K;  1YUW A;  4HTU A;  2KFN A;  5BR8 K;  4DSJ A;  1YF5 L;  3ZT2 A;  3PY8 A;  1K73 O;  1DGK N;  2HW3 A;  3LP1 A;  5AR0 A;  3G25 A;  1HJR A;  4ICL A;  5IT9 O;  3TAP A;  2FBV A;  4YFU A;  3LWM A;  5AJ3 K;  3ZX2 A;  3BY5 A;  1J5E K;  4PKH A;  2HNY A;  3LZJ A;  3DLG A;  4L8R B;  1XWL A;  2IC3 A;  2Y1J A;  5CE3 A;  3QEP A;  2P9N B;  3KVG A;  2HB5 A;  5C15 A;  3V9U A;  3IG1 A;  3VEX A;  3J7A P;  1VSE A;  3VN5 A;  4IFE A;  3HOT A;  3AVA A;  3VQ5 A;  4OKJ A;  2WTU A;  1ZBS A;  4CIG A;  1ZC6 A;  1RDB A;  4LF4 K;  1T6C A;  3K5N A;  3DLK A;  2GUP A;  4H03 B;  2UXB K;  3KWG A;  2IVO A;  2P9L A;  3O4W A;  1NK4 A;  4IEE A;  2QWQ A;  3TU5 A;  1T6D A;  5J2N A;  4NXN K;  2O8D B;  4X64 K;  1BCM A;  1N34 K;  3AVH A;  3H1Q A;  2LSN A;  3ZET B;  2DFF A;  4CZL A;  1BO5 O;  4EHU A;  3S3O A;  4CF9 A;  2ITM A;  4DS4 A;  2A41 A;  5C25 A;  5LJW A;  1SZ2 A;  1Y97 A;  4MO5 A;  3TSU A;  2P51 A;  3MN7 A;  4CIF A;  4DSI A;  4WYB A;  3NHG A;  3CCQ N;  4FJJ A;  1WUA A;  3THW A;  3TTC A;  4FLX A;  3KWI A;  5J2Q A;  3ENB A;  3C7N B;  3NGZ A;  3SMP A;  2F9T A;  2WUS A;  3DWL A;  1X3M A;  3UKU A;  4KTW A;  3WQT A;  1HX1 A;  3U6F A;  3QNO A;  1TKD A;  3EZ5 A;  4EZ6 A;  3VQ8 A;  1KRP A;  1FKO A;  1TL3 A;  2WBN A;  3CCU N;  2P9U B;  4LH4 A;  5FDL A;  4KTZ A;  1VQL N;  4FM0 A;  1TKX A;  3E1Y A;  3ZEU A;  1NGH A;  3PUF A;  2BTF A;  5DM6 L;  1JL2 A;  4DCH A;  3QIC A;  5K14 A;  4JK7 A;  3RRG A;  1OVQ A;  3L2Q A;  1HPM A;  1EKE A;  1GLL O;  3MED A;  4FPB A;  3PX6 A;  2JGU A;  1VQ4 N;  4IO9 L;  3L2R A;  5ELZ A;  2JLE A;  4Q5V A;  3AVC A;  2VQF K;  1NJX A;  3OW2 M;  1RT7 A;  4DR7 K;  3T3F A;  4F2S A;  2O8F B;  3LP3 A;  4C8L A;  1RDC A;  5CZ1 A;  2Q36 A;  1XNQ K;  3AVB A;  4JK8 A;  3EN9 A;  4CFA A;  4FJG A;  1L3U A;  3BDP A;  4FJI A;  1Z05 A;  3IDH A;  4DU4 A;  5ADX A;  4A59 A;  4YOY A;  1GLA G;  4BC3 A;  3VEN A;  4Z4C A;  1NOZ A;  3D2F A;  4JEP A;  1C1C A;  3MEC A;  4FWN A;  2D1K A;  1NJW A;  4H5N A;  4M63 C;  2Q1N A;  1GLB G;  1U48 A;  1VAZ A;  3DOK A;  1RT6 A;  2J4R A;  5AQK A;  3GG4 A;  5M1N A;  5JS2 A;  2G8V A;  3RSE B;  2P9I A;  3ZX0 A;  3B6O A;  3ENO A;  2OZS A;  2X74 A;  3WT0 A;  4MLH A;  1ASV A;  1T3V A;  3U8X A;  2YHB A;  3DJC A;  4J2A A;  1GLJ O;  5FLX O;  3QFU A;  4CHO A;  1RTJ A;  1SKS A;  1LAW A;  5I3U A;  3N4P A;  4ILH A;  3CET A;  1IBM K;  1E4G T;  2RN2 A;  5AQY A;  3O3F A;  2XRI A;  4FWP A;  3RRH A;  1TGO A;  3LDN A;  1NK8 A;  3K5O A;  1NJY A;  5HLF A;  1FJG K;  1ATS A;  5BRH A;  1LWF A;  3T1H K;  4KHU A;  4BE2 A;  1UA0 A;  5BRE A;  4CGF A;  1VQ8 N;  1VHX A;  1NK7 A;  2WFB A;  4CFB A;  4DQI A;  4Z4I A;  1S1U A;  4FZY A;  4C8M A;  2DY4 A;  4PUO A;  3QIO A;  1HRH A;  2D0B A;  5BPM A;  5JLH A;  1VQ9 N;  4E19 A;  4KRF A;  3K58 A;  1XHZ A;  3QO9 A;  3EE8 A;  4FLU A;  4FO0 A;  4M3R A;  4B3S K;  4DR5 K;  4FK0 A;  4O5B A;  5M1F A;  3HVT A;  2VQE K;  3HK2 A;  4NLC A;  2O8E B;  2NZT A;  2KTQ A;  2VWJ A;  2GEM A;  3KJV A;  4M3Y A;  4BRA A;  4FLV A;  1TAQ A;  3AO1 A;  4PQU A;  1JLF A;  3FGU A;  4MO4 A;  4FM1 A;  3K2P A;  4H4M A;  2QK9 A;  4LFC K;  2P9P B;  5LY3 A;  3OVN A;  1B92 A;  3CC7 N;  3BEX A;  5DK5 A;  3EEQ A;  1NKC A;  5CY4 A;  1EXQ A;  4J2B A;  4DQR A;  2GWJ A;  1TVR A;  4CZH A;  3E01 A;  2P9N A;  2QWP A;  3MWP A;  3QML A;  1KFD A;  1T05 A;  3VEO A;  4CHN A;  3Q7C A;  1E3M A;  1RGI A;  1KD1 O;  1ZBI A;  1RDD A;  4H8K A;  3ZYY X;  3KK1 A;  3CQY A;  2W6K A;  4HCC A;  3ASM A;  3OYL A;  5FRO A;  5I42 A;  3VF2 A;  2AJQ A;  1IG8 A;  3O9R A;  2F96 A;  3LDO A;  5A2Q O;  2ATQ A;  2E2N A;  2VGN A;  4FK4 A;  3K0S A;  1VSD A;  4I6M B;  3CFO A;  3E9O A;  3HPO A;  5HRS A;  1QQO A;  1D5A A;  4BRG A;  4ZHR A;  4CEO A;  4Z4G A;  2Q2R A;  2WOM A;  3A8Y A;  4F9O A;  5AQH A;  2P9S B;  3G0Z A;  4H5W A;  1DKG D;  4BRI A;  1X9M A;  3ID8 A;  1GOC A;  1KXP A;  1U04 A;  2P9K B;  4FJL A;  1D9D A;  4DTJ A;  1NGC A;  2G8K A;  3KKS A;  1HPZ A;  1EQY A;  2IS3 A;  1S6P A;  4AHS A;  3I0R A;  4JAX A;  3MN9 A;  4H0V B;  4CJK A;  4B1Z A;  1YXQ A;  1X3N A;  2P9U A;  4IDK A;  5BN8 A;  1D8Y A;  3UE5 A;  1KVB A;  3O1B A;  3OBY A;  5KPR A;  4QCL A;  2GV9 A;  4E1N A;  2YJF A; 
#chains in the Genus database with same CATH homology
 3L2V A;  1NKC A;  4JS5 A;  1ZBL A;  2KFZ A;  4M3U A;  4OPJ A;  2XY5 A;  2HND A;  4W5R A;  2G8U A;  4KHW A;  3SUN A;  2ITG A;  1Q9Y A;  4CJS A;  1UWB A;  4CCH A;  3V6D A;  3QET A;  2WON A;  3TAF A;  4AHV A;  2IDO A;  4BE1 A;  4QAG A;  1NK0 A;  5FRN A;  4M3T A;  1DLO A;  1HYV A;  4BAC A;  4DTM A;  2HHW A;  1QQC A;  4CEF A;  5D3G A;  4KFB A;  3K57 A;  4DTU A;  3V1R A;  4N41 A;  3NH0 A;  1FK9 A;  3WNH A;  1RT5 A;  3SQ4 A;  4XIU A;  4E7L A;  1A5X A;  3IRX A;  3VQC A;  2HVI A;  1BI4 A;  3BGR A;  3V1Q A;  1U47 A;  4C8N A;  1RCH A;  3NF6 A;  4M41 A;  4M45 A;  3DLE A;  5KRS A;  4IFY A;  5KGX A;  3NH2 A;  3RR7 A;  1CLQ A;  4OGE A;  1RNH A;  2D0A A;  1WNS A;  3MXI A;  4IG3 A;  1L3V A;  2G8F A;  3SYZ A;  4K8X A;  1LW0 A;  3ISN C;  2F8S A;  2QXF A;  5J2M A;  1WSJ A;  3ULD A;  2DFH A;  5FRM A;  2XY8 A;  2PYJ A;  4CED A;  3LZI A;  3NFA A;  4W5N A;  1KLN A;  3KLI A;  4CEE A;  2G8H A;  1KLM A;  3O3H A;  1VSH A;  4NYF A;  2DFE A;  3PX0 A;  1U49 A;  3H08 A;  3MEE A;  4B9U A;  1RTD A;  2O4I A;  1F21 A;  4GMJ B;  4EP5 A;  1O1W A;  3QEV A;  1I3A A;  1G15 A;  5J2P A;  3NE6 A;  3AVN A;  3AVJ A;  2HNZ A;  3HL8 A;  3THV A;  3DI6 A;  1RDA A;  2O4G A;  5KI6 A;  4CEB A;  4CJL A;  4Y1C A;  1KTQ A;  3S3M A;  1MU2 A;  4HUF A;  2OZM A;  4FJH A;  1C0U A;  1IKW A;  3ZCM A;  3JSM A;  4FYD A;  4DFK A;  3L3V A;  1HMV A;  4RW4 A;  3HT3 A;  3LWL A;  3V81 A;  4CK1 A;  3ZSX A;  2DTU A;  3QES A;  3V1O A;  1WSE A;  2FC0 A;  4CK2 A;  4QOZ B;  4PWD A;  2YNF A;  4B8C A;  1RT1 A;  3OYN A;  4ZTJ A;  2ZE2 A;  2RKI A;  1IH7 A;  2BE2 A;  3MEG A;  4CJP A;  4CGD A;  4CF1 A;  3O4Q A;  4HUE A;  1RTH A;  1YT3 A;  4KB0 A;  3ZSY A;  2D5R A;  2GBZ A;  1RTI A;  2Z1I A;  4FW2 A;  1VSF A;  4WE1 A;  2X78 A;  3A2F A;  3DLR A;  2IAJ A;  2YKM A;  1UOC A;  3V9W A;  1QSS A;  3RWU A;  4DTX A;  3M8P A;  1Q8I A;  3DLB A;  1LAV A;  4DTN A;  1U4B A;  1YTU A;  3M8S A;  3KD5 E;  1ASU A;  5J1E A;  3CM6 A;  4N5S A;  1N6Q A;  3KK3 A;  4FCY A;  3DM2 A;  3SUQ A;  2B4J A;  1XHX A;  3NF8 A;  4OLA A;  1W9H A;  4BE0 A;  4DQQ A;  3UIQ A;  3LP0 A;  4DLG A;  1RBV A;  4CF0 A;  4W5T A;  3OJS A;  1B9F A;  5T7B A;  4E7H A;  1C6V A;  3ZSZ A;  4CF8 A;  5E41 A;  4GW6 A;  4J2D A;  2VG6 A;  2E6L A;  5C24 A;  2P1J A;  4JS4 A;  3HJF A;  4O0J A;  4CEA A;  1CXQ A;  3F9K A;  3EYZ A;  1T03 A;  1NK9 A;  1X1P A;  1VSM A;  2ZD1 A;  3VA3 A;  3TWH A;  1KVC A;  4RW8 A;  1WSG A;  1J5O A;  4OKE A;  4HTU A;  2KFN A;  2OYQ A;  3TAQ A;  3T19 A;  1BI4 B;  4DSJ A;  2PY5 A;  4OVL A;  3QEX A;  4FJ5 A;  1ITG A;  3ZT2 A;  4PY5 A;  3PY8 A;  4CHY A;  2HW3 A;  3SNN A;  2HHV A;  3LP1 A;  3ZT0 A;  4IBN A;  3OYB A;  1HJR A;  1HQU A;  4ICL A;  3HVR A;  1T7P A;  1FKP A;  3K5M A;  1SKR A;  4F8R A;  3HYF A;  3TAP A;  2FBV A;  4YFU A;  3LWM A;  4FVM A;  2YNG A;  4DF8 A;  3LDS A;  4HVJ A;  4DQP A;  3OY9 A;  4O55 A;  2HNY A;  3WNF A;  5EU7 A;  3T1A A;  4LSL A;  4LSN A;  3OJU A;  1JLG A;  3DLG A;  3K59 A;  1QHT A;  1W0H A;  3LZJ A;  4L8R B;  3WNG A;  1XWL A;  2G8I A;  2F8T A;  2HHQ A;  5CZ2 A;  2YKN A;  1CXU A;  2IC3 A;  3AVK A;  2Y1J A;  4KHQ A;  3JYT A;  3QEP A;  3VQE A;  4CIE A;  4Y1D A;  2R7Y A;  1B9D A;  3AVF A;  3KK2 A;  1WLJ A;  4CEC A;  3DLH A;  2HB5 A;  1KVA A;  1RT4 A;  3IG1 A;  1WSF A;  3IS9 A;  3OYE A;  3V9U A;  1SL1 A;  1JKH A;  1L3S A;  1VSE A;  3VN5 A;  3C94 A;  3AVA A;  4RW6 A;  1Q9X A;  3QIP A;  1IKV A;  1HNI A;  4TSX A;  4BWM A;  4KB1 A;  4OKJ A;  3QLH A;  3VQ5 A;  1QTM A;  2X6N A;  4CIG A;  4FW1 A;  5CYM A;  4CES A;  1YVU A;  1RDB A;  3OYJ A;  1SV5 A;  2OPR A;  1ASW A;  4AIL C;  3M8Q A;  3OS1 A;  3K5N A;  4DTP A;  3OYD A;  3DLK A;  1ZBF A;  3LAM A;  4MFB A;  3HP6 A;  3MAQ A;  3TI0 A;  1C0T A;  1C1B A;  4E1N A;  1TK8 A;  3NAE A;  3PO4 A;  1NK4 A;  3KIO A;  4CE9 A;  5J2N A;  1WAJ A;  1J9A A;  4BWJ A;  4CJF A;  4J2E A;  4IG0 A;  2KW4 A;  1BCM A;  3MXJ A;  4CJU A;  3AVH A;  4KHS A;  2KQ2 A;  3D45 A;  5SZT A;  2XHB A;  2EX3 A;  4EZ9 A;  1EX4 A;  1A5V A;  2ZQB A;  3DRP A;  2LSN A;  2DFF A;  2XY6 A;  3ALY A;  2ETJ A;  1NKB A;  3S3O A;  4CF9 A;  3QEI A;  4DS4 A;  2P5O A;  4M3X A;  5C25 A;  1L5U A;  4KKO A;  4B9M A;  1Y97 A;  3AVG A;  3EY1 A;  3PX4 A;  4IKF A;  4FJ8 A;  2RPI A;  1U45 A;  3OYA A;  4CJW A;  2P51 A;  4CIF A;  4DSI A;  1BIZ A;  1BQN A;  3NHG A;  1NJZ A;  4FJJ A;  4FJX A;  1CZB A;  4FLX A;  3AVL A;  3KLG A;  3TAN A;  4ZTF A;  1S1V A;  1QSY A;  5J2Q A;  1J53 A;  4N47 A;  4BDZ A;  3AV9 A;  3DOL A;  4KTQ A;  4DMN A;  3KLF A;  2YNH A;  3VA0 A;  3AA2 A;  1NKE A;  3NGZ A;  2GUI A;  4CEZ A;  1N5Y A;  4C8K A;  1FXX A;  4DQS A;  1JLB A;  1IKY A;  1DTT A;  3SQ0 A;  3SUP A;  3TAB A;  5JS1 A;  3OS2 A;  4E7J A;  2HHU A;  4KTW A;  2W42 A;  1SUQ A;  3U6F A;  3QNO A;  1TKD A;  3EZ5 A;  5HP1 A;  4EZ6 A;  2BAN A;  3VQ8 A;  1KRP A;  1FKO A;  1TL3 A;  2EHG A;  3NBP A;  2NUB A;  3RMD A;  4B9V A;  1YTA A;  1JLA A;  4LH4 A;  4CJ4 A;  5FDL A;  3NF7 A;  4IFV A;  1D9F A;  3O3G A;  3KLH A;  4KTZ A;  2KZM A;  4FM0 A;  1TKX A;  1S6Q A;  3PUF A;  1KSP A;  4FJ9 A;  5HRR A;  4B9L A;  4ELT A;  5KRT A;  2BDP A;  4M3W A;  1JL2 A;  1BGX T;  3ZT3 A;  4KV8 A;  5K14 A;  4LH5 A;  3S3N A;  3RRG A;  2D0C A;  4B9T A;  3FFI A;  2Z1G A;  4G1Q A;  3CFR A;  3L2Q A;  3MED A;  1EKE A;  3DRR A;  2RF2 A;  3PX6 A;  3RMA A;  2JGU A;  4CJ5 A;  5KGW A;  4ID5 A;  3TAE A;  3L2R A;  1S9E A;  2B6A A;  3G10 A;  2JLE A;  1VSJ A;  2I5J A;  4Q5V A;  3AVC A;  1WSI A;  4GVM A;  3CFP A;  3SUO A;  1NJX A;  3SCX A;  1GOA A;  1RT7 A;  3ZSO A;  3D0P A;  3T3F A;  4F2S A;  3TAG A;  3LP3 A;  3RMB A;  4C8L A;  3HO1 A;  3V9Z A;  1RDC A;  3LP2 A;  5CZ1 A;  3AO4 A;  3AVB A;  4JLH A;  4CFA A;  3U3G A;  3SI6 A;  4CJT A;  4HHT A;  4FJG A;  4Z4H A;  4E89 A;  1L3U A;  3BDP A;  1TK5 A;  4FJI A;  4K8Z A;  4DU4 A;  1BQM A;  4B3O A;  4Z4C A;  1NOZ A;  3AA5 X;  3DMJ A;  4LY7 A;  1K6Y A;  3TR8 A;  1C1C A;  3DRS A;  4I9Q A;  3MEC A;  1SKW A;  3CM5 A;  3SV4 A;  1UA1 A;  2VG7 A;  3AO2 A;  4FM2 A;  1NJW A;  3V9X A;  1R0A A;  1X9W A;  2G8W A;  4N56 A;  4PA1 A;  1U48 A;  4FLT A;  4ELU A;  3DOK A;  3DYA A;  3LAK A;  1RIL A;  1RT6 A;  1XI1 A;  4JRQ A;  2OA8 A;  4CJQ A;  3QIN A;  5CYQ A;  4M42 A;  1XC9 A;  4Q0B A;  2G8V A;  4DTR A;  5JS2 A;  3K5L A;  3B6O A;  3L8B A;  3AA3 A;  2X74 A;  4HUG A;  1WAF A;  2OZS A;  1REV A;  4DFP A;  1ASV A;  4OGC A;  4CFD A;  4OJR A;  4FK2 A;  2YHB A;  1VSI A;  1Z26 A;  3VQB A;  4J2A A;  3KLE A;  3NCI A;  3NGI A;  4CHO A;  1RTJ A;  1BL3 A;  3OYM A;  1KFS A;  1SKS A;  1LAW A;  5I3U A;  1CZ9 A;  3P5J A;  4KI4 A;  3AO5 A;  3VQ7 A;  4FXD A;  2FBT A;  2RN2 A;  3SV3 A;  3ZT4 A;  3O3F A;  4FLW A;  2KZZ A;  2XRI A;  4CGI A;  3PO5 A;  4CHQ A;  3OYC A;  3RRH A;  1TGO A;  4O44 A;  1TKT A;  3C95 A;  1NK8 A;  3I8D A;  1VSL A;  4RW7 A;  3IAY A;  3OYG A;  3K5O A;  1NJY A;  2X6S A;  5HLF A;  4I2P A;  3HP9 A;  1S1T A;  3L3U A;  4LD0 A;  3VQQ A;  4CK3 A;  4DU3 A;  3B6P A;  1RBT A;  1LWF A;  1BCO A;  3ZSR A;  2IGI A;  4CFC A;  4FLZ A;  1S5J A;  4E3S A;  4KHU A;  4B9S A;  3OYI A;  3HPG A;  4BE2 A;  4W5Q A;  1UA0 A;  1ZYQ A;  4B9N A;  4CGJ A;  4CGF A;  4F3O A;  4KI6 A;  1RBR A;  4N76 A;  2FBX A;  1VSK A;  1NK7 A;  2PYL A;  4FJM A;  4OLB A;  4I2Q A;  4CFB A;  2E4L A;  4DQI A;  4Z4I A;  4CJR A;  1S1U A;  4I7F A;  4FZY A;  4C8M A;  3OYK A;  2PZS A;  3S9H A;  4PUO A;  2HHX A;  3QIO A;  2DY4 A;  4CGH A;  3OS0 A;  1HRH A;  1JL1 A;  3CQ8 A;  1HYZ A;  2D0B A;  4DSK A;  1EET A;  2HVH A;  4HCB A;  1JXB A;  1JLQ A;  4H4O A;  4E19 A;  4KRF A;  3K58 A;  1XHZ A;  3QO9 A;  1ZBU A;  3AA4 A;  1C1A A;  1Z25 A;  4AHC A;  4CEQ A;  4FLU A;  2VG5 A;  4M3R A;  3AO3 A;  4CF2 A;  1A5W A;  4FK0 A;  4O5B A;  1GOB A;  2OPQ A;  4B08 A;  1TV6 A;  3HVT A;  4RW9 A;  2A1R A;  4DWI A;  4KRE A;  4FLY A;  1NK5 A;  4AHU A;  3NH1 A;  3HK2 A;  2XO7 A;  4E0D A;  1S9G A;  2KTQ A;  3SJJ A;  4FZX C;  2VWJ A;  5HRN A;  4W5O A;  3HST B;  1EP4 A;  4KHY A;  3HM9 A;  2QKB A;  3OYF A;  4CHP A;  1JXE A;  1S1X A;  2OPP A;  3LPU A;  3KJV A;  4FLV A;  4ELV A;  4M3Y A;  1ZBH A;  3SQ2 A;  1TAU A;  1TAQ A;  4KO0 A;  1X9S A;  3KKR A;  4DG1 A;  3AO1 A;  1L3T A;  4Z4E A;  4PQU A;  4E7I A;  4AHT A;  1JLF A;  3RR8 A;  4FM1 A;  3K2P A;  4H4M A;  2QK9 A;  3NDK A;  4ID1 A;  4DFM A;  3QNN A;  1IO2 A;  1I39 A;  3SPZ A;  4DSE A;  4DTS A;  3P83 D;  1UAX A;  4FJ7 A;  3OVN A;  1B92 A;  1WN7 A;  5DK5 A;  3LPT A;  3ZSV A;  5CY4 A;  1EXQ A;  1KCF A;  3VQ9 A;  3WNE A;  4R5P A;  2Y1I A;  4DQR A;  2OPS A;  3VQD A;  1TK0 A;  2P5G A;  4KHN A;  3VQA A;  5HRP A;  1TVR A;  3E01 A;  3LAN A;  3VQ6 A;  1KFD A;  2B5J A;  4NYN A;  1T05 A;  4CHN A;  1LW2 A;  4I9L A;  4CJE A;  4DFJ A;  1ZBI A;  1RDD A;  1QS4 A;  3U3Y A;  3CYM A;  4H8K A;  3VQ4 A;  4MQ3 A;  4FJN A;  2Z1H A;  3KK1 A;  4DSF A;  3NGY A;  1DTQ A;  4JRP A;  4HCC A;  3ASM A;  3TAM A;  3OYL A;  1SL2 A;  2XY7 A;  5FRO A;  1VRT A;  3P1G A;  4E7K A;  5I42 A;  1QE1 A;  4F2R A;  2AJQ A;  1NK6 A;  2F96 A;  4EP4 A;  4DTO A;  1NOY A;  4Z4F A;  4O0I A;  3C6T A;  2HHS A;  2ATQ A;  4BDP A;  3HPH A;  1IG9 A;  4DS5 A;  1RT3 A;  3QER A;  5KTQ A;  1T8E A;  3I0S A;  4DSL A;  4FK4 A;  1BHL A;  2E6M A;  1VSD A;  1RT2 A;  3CFO A;  3NF9 A;  2HMI A;  1TKZ A;  4J2B A;  4FJK A;  3KD1 E;  3HPO A;  1RBS A;  5HRS A;  2HHT A;  4BDY A;  3ZSQ A;  3KTQ A;  1LWC A;  1D5A A;  5SWM A;  4DU1 A;  1IKX A;  4ZHR A;  5C42 A;  4O4G A;  2YHA A;  4CEO A;  4Z4G A;  3LAL A;  2YNI A;  4UQG A;  3V9S A;  1TL1 A;  1HQE A;  3AVM A;  3L2U A;  2WOM A;  1QSL A;  3HXM A;  5HRO A;  4AH9 A;  3ZT1 A;  4F4K A;  3SPY A;  3QEW A;  3G0Z A;  1JLE A;  3ITH A;  3L2W A;  3CG7 A;  3V4I A;  4KAZ A;  4CJV A;  1RBU A;  1VRU A;  5DMR A;  1C0M A;  3SQ1 A;  1X9M A;  2QKK A;  1GOC A;  4B8A B;  3M8R A;  4OPK A;  3O4N A;  4KPY A;  4E1M A;  1U04 A;  3VQP A;  4NCB A;  4FJL A;  1D9D A;  4DTJ A;  2G8K A;  3RMC A;  1S1W A;  4CER A;  3TAR A;  4CJ3 A;  4DF4 A;  4F3T A;  1HNV A;  2FBY A;  2BGG A;  1VK0 A;  3AVI A;  3KKS A;  4NCG A;  1HPZ A;  1LWE A;  1JLC A;  2IS3 A;  1S6P A;  3F73 A;  4AHS A;  3I0R A;  4CGG A;  4C8O A;  4CJK A;  2VWK A;  4Z0U A;  3RTV A;  1HYS A;  4YNQ A;  4CHZ A;  3ZSW A;  3PV8 A;  1BIU A;  1J54 A;  4IDK A;  1WSH A;  1LV5 A;  4FZZ A;  3C6U A;  1D8Y A;  5HBM A;  2Z1J A;  1KVB A;  3MXM A;  2IOC A;  2Q3S A;  3OYH A;  2YV0 X;  2A1S A;  4OKK A;  4NCA A;  3SZ2 A;  4DLE A;  2GV9 A;  1SL0 A;  4M3Z A;  4AHR A;  4RG8 A;  4QCL A;  1BIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...