3AA4A

A52v e.coli rnase hi
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
152
structure length
152
Chain Sequence
LKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAVIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Protein core adaptability: crystal structures of the cavity-filling variants of Escherichia coli RNase HI
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 51
structure length 152
sequence length 152
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3aa4A00
4O44A 3U6FA 2BANA 4FM0A 4RW7A 2LSNA 1XC9A 1NK5A 1BL3A 1F21A 2XY8A 1JLFA 4HCBA 4KHYA 4NYNA 3L3UA 1NK4A 1DTQA 1GOBA 3S9HA 4EZ9A 3DM2A 2QKBA 1TK0A 4NCGA 3KLFA 1NKBA 4CF8A 4DS5A 4DTXA 3LALA 1WSIA 1XWLA 4CEFA 4BACA 2PY5A 1FKOA 1LAWA 1I3AA 3CFOA 1TAQA 3QETA 4ZHRA 3OS0A 3I8DA 4CJEA 3SQ0A 1A5WA 5DMRA 2OZMA 4F2RA 2WONA 2E4LA 4DTNA 3VQ7A 5CZ1A 4E7LA 1KFSA 4DSIA 1CZ9A 4CJQA 2HB5A 2JGUA 3AVMA 5HRSA 4CK3A 2PYLA 1R0AA 4FXDA 1SKWA 5SWMA 4OVLA 4CERA 1C1BA 1HQUA 4H4OA 4M45A 4GW6A 1WSFA 3QINA 1RILA 1TKZA 3WNHA 1IH7A 4CHOA 3QERA 2Y1IA 3T1AA 4BE0A 4FW2A 3MXJA 3LPTA 2KTQA 1RTJA 3CM5A 1IKYA 3SPYA 1X9WA 3PX4A 1JL2A 1IKWA 2IS3A 4TSXA 1BIZA 3L2UA 4ELTA 4CCHA 4AHTA 4DSEA 3KJVA 3ISNC 3SUNA 4CJKA 4B9NA 2OPRA 1IG9A 1X9SA 2KFZA 1VRTA 2IOCA 4Y1CA 4B8AB 4DQRA 1KVBA 1SL0A 3NF8A 1K6YA 2G8WA 3QEPA 2ZD1A 1UAXA 2PZSA 4AH9A 4RW8A 2IGIA 3AA3A 2XY7A 1T03A 4BWJA 2EHGA 3AVNA 1U45A 3OYFA 4C8LA 4JS4A 1ZBLA 1GOCA 4JS5A 4FJJA 4KB1A 3DLKA 3KLEA 4CJ4A 1RT3A 1X1PA 3L2WA 2OA8A 2BE2A 2DY4A 3PY8A 4N5SA 1Q9XA 5T7BA 1BQNA 1DLOA 2YNIA 2PYJA 3SV3A 2G8KA 4CJLA 1HRHA 4CFAA 1WN7A 4CFDA 1YT3A 5J2QA 1VSHA 5CYMA 1VRUA 4CHYA 4DF4A 4KI4A 4MQ3A 4I7FA 2HHVA 1DTTA 1VSEA 1CZBA 1HYVA 1RBRA 3DLRA 4CHPA 3QESA 4PA1A 2VWJA 4CHZA 2OYQA 4E7IA 3ITHA 2D0BA 4GMJB 1NOYA 4FZYA 3DI6A 3O4QA 3V1QA 3LWMA 1RBUA 3NAEA 1FXXA 2I5JA 2XO7A 3LAMA 1TL3A 4Q5VA 4KO0A 3D0PA 4O55A 4YFUA 1CXUA 4RG8A 1TV6A 3SUPA 3CFPA 3O3FA 1WSEA 4DTPA 4FJLA 1IO2A 2IAJA 3LP3A 4DMNA 1EETA 3DRSA 3KKSA 4R5PA 3NH0A 4KB0A 2HW3A 3KD5E 1O1WA 4OKKA 4FVMA 4LSLA 1KVCA 2VWKA 3SNNA 4DTUA 1ZYQA 1S1XA 2X78A 4F3TA 4NCBA 1D8YA 3L2QA 4AHRA 3AO1A 1W0HA 3DLGA 5C24A 4AILC 3ALYA 4FJ9A 4J2BA 1ZBUA 1WAJA 1N5YA 1NJZA 4IG0A 3RMBA 4CEOA 3NGZA 3LP1A 5C25A 3JSMA 3WNGA 3S3NA 1Q8IA 5KGXA 1J9AA 5HP1A 2HNYA 2P5GA 1T8EA 4DTMA 1RTHA 4LSNA 4Z4HA 4UQGA 2XY5A 4Z4FA 2HHTA 4KREA 3HJFA 5KRTA 1EX4A 1WLJA 5K14A 3VQQA 3PO4A 3G10A 3HT3A 3OYDA 3ZCMA 4B9LA 4Z4CA 3OYBA 1JLGA 3LPUA 4DSFA 4CGJA 5HLFA 4CEBA 4M41A 1C6VA 4KTQA 3OYLA 3EYZA 4CGDA 4DQIA 3VQPA 2HVHA 1VSIA 3K5OA 4J2AA 1NK7A 4IBNA 3OJSA 4DQQA 1LW0A 2ZQBA 4HUFA 3SQ1A 4J2DA 3AVIA 4KV8A 1TGOA 3K2PA 2D0AA 5C42A 3KD1E 2RKIA 3RR8A 1HPZA 3SCXA 2E6LA 1C0UA 1HQEA 3SUQA 1BCMA 4RW6A 4FK4A 3HP9A 1W9HA 2KQ2A 1BISA 2YNGA 4BWMA 4O4GA 3ZT3A 1NOZA 3QLHA 4NYFA 4LY7A 1B9DA 2RN2A 3I0RA 4M3RA 1SL2A 5KTQA 2YHAA 3AVBA 1TKXA 3OYEA 1FKPA 4G1QA 1RCHA 1NKCA 4E7HA 3T19A 5CZ2A 3OYIA 3ULDA 4B08A 4E89A 3QNOA 2OPPA 4FZZA 4E3SA 2ITGA 3MXIA 3HVTA 3AO3A 1RDBA 1WSGA 4FJNA 4CECA 4ZTFA 1N6QA 3EZ5A 3KK1A 3RMCA 5D3GA 3B6OA 3NGIA 1TKTA 4KHQA 4B9MA 5J2NA 1U04A 3P83D 3QEVA 1GOAA 1A5XA 4CF2A 1BHLA 1L3TA 4DU1A 3HPOA 1HJRA 3HXMA 1RBTA 2Z1IA 4O0IA 3VQ4A 4DLGA 4W5TA 3CYMA 3NF6A 1LV5A 1JXEA 1SL1A 4HHTA 1EP4A 1RTDA 4M3TA 3P1GA 4N56A 3T3FA 4B9VA 4FW1A 5E41A 3OYGA 1RT2A 3ZSOA 4B9UA 2W42A 3CQ8A 4WE1A 3IS9A 1RBVA 3QEWA 3RMDA 4B9SA 4DWIA 5J1EA 4L8RB 4N41A 4M3XA 4OLAA 1HYSA 5KI6A 4Y1DA 5FRNA 3SJJA 3FFIA 3QIOA 2OPSA 1EXQA 4FJIA 2G8IA 1RT1A 1ITGA 3NE6A 3SYZA 3QEIA 2HVIA 4M3WA 3K59A 3VQBA 4CEZA 1KLNA 3KK3A 4RW4A 3DRPA 1ASUA 3NF7A 3HVRA 3V9XA 1BGXT 3KLGA 4ICLA 1ZBFA 3AO2A 4DU3A 1NJYA 3IAYA 1QTMA 3L2RA 1UWBA 2XRIA 4IFVA 1QQCA 4KHNA 3LZIA 4JLHA 3VA0A 4OJRA 4OGEA 3NBPA 4M3UA 1VSLA 5JS1A 4JRQA 1NJWA 2P51A 5KRSA 4M3ZA 1JL1A 4ZTJA 1NJXA 1KVAA 1LWEA 1U47A 1S1VA 4FLZA 3SQ4A 4I9QA 1KTQA 3ASMA 2P1JA 3TAGA 3DOKA 1BIUA 1U4BA 1RBSA 4KHSA 1TK8A 2P5OA 4HVJA 4CEDA 4LH5A 3NDKA 3AV9A 1REVA 4PQUA 2DFHA 4DQPA 3AVKA 3AO4A 1G15A 4CJRA 1C1CA 2AJQA 5KGWA 4PUOA 4DU4A 4OPJA 2O4GA 3OYHA 4O0JA 4CF9A 3AVAA 5CY4A 3M8RA 2FBVA 4PWDA 1S5JA 1C0MA 4AHUA 4W5RA 4DF8A 3QNNA 5HROA 1TKDA 3F73A 4HUGA 3IRXA 1LWCA 4CJUA 3ZT2A 3LAKA 3HPGA 3VQEA 4CIEA 2E6MA 3K57A 2RPIA 3TWHA 4NCAA 4OLBA 4B3OA 1RT4A 4QCLA 3SQ2A 3VN5A 4EP5A 3KKRA 2YNFA 2HMIA 3TARA 1TVRA 3L3VA 4AHCA 3SPZA 1T05A 2RF2A 4DTOA 3ZSQA 2G8FA 1RT7A 2YKNA 1D5AA 1QE1A 4FM1A 3RRGA 3AVCA 4KTWA 3V1OA 2G8VA 2Q3SA 4DLEA 4CGIA 4K8XA 1A5VA 4F4KA 1TL1A 2Z1JA 3DLEA 1XI1A 2DFEA 3S3OA 1QHTA 4CJTA 4CESA 1RTIA 4MFBA 2BGGA 4OKJA 3VA3A 1LAVA 3TI0A 1NK9A 3PX6A 4RW9A 1J54A 1J5OA 1KSPA 4CEAA 4OPKA 4K8ZA 1VSMA 3KLHA 2D5RA 3RWUA 4KAZA 2HHUA 1HYZA 3NFAA 1HNVA 4CFBA 3DOLA 4DG1A 3ZSWA 4DFMA 3MAQA 4FK0A 3KIOA 2EX3A 5SZTA 3LZJA 3SI6A 4CK2A 2HHQA 1LWFA 4KFBA 1VSKA 5HRPA 1KRPA 1RT6A 3K5NA 1SKRA 1B9FA 1QSSA 3HP6A 2HHSA 1JKHA 3NHGA 4E7JA 3V6DA 1JXBA 3DLBA 4BDPA 1JLEA 3LP2A 1Z25A 3OYAA 4FLXA 4W5NA 5DK5A 4KKOA 4IFYA 4BE2A 2O4IA 3CFRA 3PX0A 5I3UA 1NK6A 3MEGA 3DYAA 3OJUA 2Y1JA 4DSLA 3A2FA 3AA5X 3TAFA 3AO5A 3D45A 4DTSA 2QKKA 3QIPA 2HNZA 3NGYA 4I9LA 4I2PA 2XY6A 1YVUA 1EKEA 3MEDA 5EU7A 4LD0A 3TAMA 4FJ7A 1D9FA 4FCYA 2FC0A 3NCIA 3LANA 1BQMA 3VQ8A 1CLQA 1TAUA 4CIGA 2VG6A 1VSJA 5HRRA 3TR8A 4DFKA 1Y97A 3BDPA 3PV8A 3V1RA 4QOZB 4OGCA 3OS1A 1JLAA 4Z4EA 3DLHA 3VQ6A 2FBXA 3AVFA 5HRNA 3VQ5A 4KHWA 3ZT4A 3LDSA 1C1AA 4CJ5A 4CJVA 3SZ2A 2QXFA 3S3MA 3NH2A 2YKMA 4IG3A 3MXMA 4EZ6A 2VG5A 3NH1A 3OVNA 3AVHA 3ZT1A 4DTJA 3TAQA 1SKSA 3OYMA 2HNDA 3KLIA 1L3VA 4FJ8A 3ZSVA 1IKVA 3AVJA 3V9ZA 4N76A 1RNHA 5I42A 4J2EA 2GUIA 3TAEA 3C6UA 4IDKA 4CHQA 2KFNA 2YHBA 1WSHA 1NK0A 5CYQA 4E7KA 4CF0A 4FJKA 4KRFA 4CIFA 2HHWA 4CJFA 1S1WA 2KZZA 1RDAA 4CHNA 1B92A 4PY5A 2A1RA 1XHZA 4C8NA 1HNIA 3P5JA 4Z4GA 1VK0A 4ID1A 4CF1A 4C8MA 4GVMA 4FJ5A 3DMJA 4FLUA 3I0SA 1NK8A 4F3OA 3ZSYA 1UOCA 2IC3A 4M42A 2WOMA 4I2QA 3HM9A 3ZSRA 4DFJA 3CM6A 4KI6A 4KHUA 4FJHA 4CJWA 1RDDA 4FYDA 3ZSZA 2ETJA 3AA2A 2R7YA 2A1SA 3DRRA 1L3UA 4B8CA 4B9TA 4DQSA 1WSJA 3HL8A 1C0TA 4AHVA 4ELVA 4H4MA 3C94A 3RMAA 4N47A 1KFDA 3PUFA 2F96A 1U48A 2NUBA 1QS4A 3AVGA 1WNSA 1TK5A 4DTRA 1YTAA 3OS2A 4BE1A 1NKEA 4W5OA 4CE9A 4FJMA 3V4IA 1XHXA 2DFFA 2X6NA 3AVLA 4DFPA 3OYJA 3TANA 3VQDA 2B5JA 3OY9A 3OYNA 3THVA 2VG7A 4KTZA 3JYTA 1BI4B 1X9MA 3PO5A 2IDOA 4CGGA 3ZSXA 4F2SA 4Z4IA 1ZBIA 3QO9A 4ID5A 2Z1HA 4FJGA 1RDCA 3HYFA 4QAGA 2FBTA 5J2MA 1L5UA 4C8OA 3SUOA 4HCCA 3M8SA 2G8HA 1UA1A 1U49A 2Z1GA 3LWLA 5FROA 3K5LA 4OKEA 3K5MA 4BDZA 4ELUA 3VQAA 4Q0BA 3TAPA 1JLCA 4BDYA 2XHBA 3L2VA 3LP0A 2GBZA 4CGHA 3K58A 1FK9A 3C6TA 3U3GA 4F8RA 3SV4A 3EY1A 2QK9A 4LH4A 4M3YA 3KK2A 2KZMA 1S6PA 4DS4A 3U3YA 3RTVA 2BDPA 1VSFA 2G8UA 2YV0X 1KCFA 3KTQA 2X6SA 2ATQA 4FK2A 1LW2A 4CJPA 4C8KA 2OPQA 4JRPA 3O3HA 3E01A 1Z26A 3ZT0A 2YNHA 1BI4A 4FLYA 3HK2A 1IKXA 2F8TA 3H08A 3O4NA 4W5QA 3HO1A 1BCOA 3V9WA 4YNQA 4CJ3A 2B4JA 4XIUA 1ASVA 2GV9A 3RR7A 2HHXA 1S9GA 4O5BA 3HSTB 1UA0A 2ZE2A 1Q9YA 3MEEA 1MU2A 3M8QA 5HBMA 1RT5A 4E0DA 1VSDA 1JLQA 4HUEA 1QSYA 3WNEA 1D9DA 3TABA 4DSJA 3AA4A 3V9UA 2F8SA 3OYCA 1I39A 4FZXC 3VQCA 1WAFA 1ASWA 4HTUA 2B6AA 3WNFA 4KPYA 4DSKA 4EP4A 4CK1A 4FM2A 1QSLA 1T7PA 2FBYA 4CEEA 3C95A 1KLMA 3UIQA 1ZBHA 3L8BA 2D0CA 4Z0UA 2JLEA 4IKFA 1CXQA 3RRHA 1HMVA 5FDLA 4CEQA 3VQ9A 4CFCA 4AHSA 3QEXA 1S1UA 2DTUA 3G0ZA 3HPHA 3V81A 3O3GA 4FJXA 3V9SA 4E1NA 3M8PA 3NF9A 4CJSA 1S1TA 4E1MA 3MECA 2OZSA 1J53A 3BGRA 3B6PA 4CGFA 1S9EA 5JS2A 5J2PA 3OYKA 4FLVA 1SV5A 4FLTA 2KW4A 3F9KA 1SUQA 4H8KA 4E19A 1JLBA 3CG7A 3IG1A 1L3SA 1S6QA 5FRMA 2X74A 1YTUA 4FLWA
chains in the Genus database with same CATH superfamily
4O44A 4B1ZA 1K8KB 5BN8A 4HCBA 4JKDA 3SAHA 1NK4A 2P9LA 2Q31A 4EIAA 1H1VA 3KLFA 3BUZB 3KHYA 4DTXA 1XWLA 4CEFA 3QETA 3C6HA 3OS0A 3SQ0A 2BUPA 2OZMA 4DR5K 2PAVA 3VQ7A 4H0YB 3WEEB 2OTJN 3LDPA 5HRSA 4LF8K 1K8AO 3M1FA 1SKWA 5SWMA 1C1BA 4H4OA 4B1YB 3QINA 1RILA 1TKZA 2E2NA 1IH7A 4CHOA 3QERA 2Y1IA 3SPYA 1DKGD 1BIZA 4JI8K 4DR6K 2QWPA 4DSEA 1Q82O 1NNEA 4H0XB 4E1JA 4H5WA 4X62K 2IVOA 4I6MA 3QEPA 2PFUA 1N34K 2HBJA 4BR7A 4BWJA 4GV3A 1WOQA 2VQEK 4C8LA 4DR4K 4JS5A 3THYA 4BR4A 3L2WA 1RT3A 1X1PA 2BE2A 2YNIA 3O4WA 1HRHA 4WF9L 1VRUA 5AQUA 3P39A 4CHYA 4DF4A 4MQ3A 4MDAA 1DTTA 1CZBA 1HYVA 4CHPA 4AM7A 2OYQA 2WFBA 3BP8A 1NOYA 3DI6A 3PLAA 3K0SA 1RBUA 2XO7A 3HZ6A 3H45C 1TL3A 3HTVA 3D0PA 1DEJA 3CFPA 4FJLA 3QDKA 4KB0A 4GV6A 1XNQK 3DRSA 3ZEUB 2VWKA 2X78A 4QS9A 3VGKA 1KXPA 3L2QA 3RSEB 3U9DA 4AHRA 3ALYA 4BROA 1LCUA 2YHYA 4CEOA 3NGZA 4CVNE 1W97L 3S3NA 3OBWA 4DTMA 4YDUA 4AM6A 4UQGA 2A6AA 3VEVA 3HJFA 1NGGA 3VQQA 3G10A 4GV9A 4Z4CA 3THXA 1TYQB 3LPUA 1IV0A 5HLFA 4M41A 1C6VA 2KHOA 2CGLA 3EYZA 4DQIA 2NNWA 4J2AA 3K5OA 2NRWA 4IBNA 3OJSA 3OBYA 1TGOA 3SBGA 4LF9K 4CZGA 1ILYA 3U4LA 3D7EO 1G99A 1Q18A 3G6EN 2V7ZA 2KQ2A 1BISA 1NOZA 3QLHA 3J7AP 1VHXA 1TKXA 1FKPA 1RCHA 1NGFA 4DCHA 4B3MK 4E3SA 3MK6A 1RDBA 1WSGA 4FJNA 4ZTFA 3MCAB 5AZIB 2E20A 3RMCA 1U04A 3H1VX 3BF3A 1BHLA 1RBTA 5BPNA 4DLGA 2A40A 3NF6A 4IFEA 4WFBL 4E0DA 4DSIA 3ZSOA 4WE1A 4BC3A 1GLJO 1RBVA 4DWIA 4L8RB 2O8EB 2UUBK 3BF1A 1NM1A 3TSUA 3K59A 2Q1NA 3DRPA 3V9XA 5E26A 1NJYA 3KLGA 5BR8K 1ZBFA 1ATNA 3L2RA 4IFVA 3LZIA 1YHQN 3UKRA 4CZJA 4BRKA 4H5VA 2KKZA 1OH8A 4M3UA 1VSLA 5JS1A 2P51A 5KRSA 4M3ZA 2GWKA 4ZTJA 1U47A 5EY4A 3D2EA 5M1KA 3TAGA 1I94K 1RBSA 3ENBA 4A61A 1TK8A 2P5OA 3D2FA 4KHSA 3QICA 3AV9A 3CCQN 3AVKA 3SK3A 1C1CA 1U2VB 2P9NB 3A5OC 3FZKA 4O8UA 3O9QA 3LL3A 4QS7A 5M1PA 3M8RA 3FE1A 5AQFA 4W5RA 4HTLA 4DF8A 4CW7B 1TKDA 1VQ4N 4CJUA 3ZT2A 4B1WB 3VQEA 4NCAA 2RPIA 3O6WA 3SQ2A 4FPAA 5BPLA 4EP5A 3L3VA 3CPWM 5A2QO 1D5AA 2G8VA 4DLEA 4F4KA 1NGJA 3DLEA 5AQWA 5AR0A 1XI1A 2IVPA 4OX9K 4WFNL 3W0LA 4BR2A 1RTIA 3A5LC 3P38A 3U9ZA 1LAVA 2HSTA 2YX6A 1XC3A 2E1ZA 1BU6O 2HHUA 1HYZA 3NFAA 3CPEA 3DOLA 1EWQA 5SZTA 4CK2A 2P9KB 1LWFA 1TUYA 3K5NA 4BRFA 2HHSA 1JXBA 2CGKA 4GNIA 2F4VK 3LP2A 4H0VB 4B1XB 1N33K 5DK5A 4IFYA 4M7XA 3TU5A 4C1NK 1HJOA 4DSLA 3CIPA 3A2FA 3AA5X 1VQON 4B3RK 1E4GT 3D45A 4DTSA 2HNZA 4JD2A 1D9FA 2FC0A 3VQ8A 4DUYK 1CLQA 4CIGA 4A2BA 4DFKA 1Y97A 5JLFA 4FO0A 3PV8A 2FLOA 1T6DA 2FBXA 1BA0A 1NG9A 3VQ5A 5AZJA 3ZT4A 4K43A 3PIOL 3SZ2A 4DV3K 2YKMA 3MXMA 5AQJA 2NLXA 3L4QA 4I6MB 3BEXA 1RNHA 4BVPA 5B8HA 1SS6A 1NK0A 1GLLO 4CIFA 5C2FA 2KZZA 3B8AX 4BRNA 4CHNA 3THYB 4PY5A 2A1RA 1XHZA 4YOWA 4C8NA 4JV5K 1VK0A 4ID1A 2WUSA 3CJBA 4CF1A 4CI6A 2YCHA 4GVMA 1KAZA 2E2QA 3R6MA 4FLUA 1N32K 1IBMK 1GLEG 4I2QA 1XMOK 3ZSRA 1Q7YO 1MDUB 4JI3K 4FYDA 2DPNA 4Y0WA 3THWA 3AA2A 5GAHP 2R7YA 3EKUA 2W6LA 2O8CA 2HBKA 4ELVA 1YAGA 4DHYA 4LF6K 1SZ2A 1U48A 1QS4A 4DTRA 3VEZA 1NKEA 3FZMA 4WQ4A 3UKUA 5BRHA 4EFHA 1X3NA 4OPAA 3OY9A 3C65A 3PO5A 2VG7A 4KTZA 3JYTA 4Z4IA 3FZHA 4IJAA 4C8OA 3SUOA 2VYPA 2G8HA 3CC2N 4ELUA 2QWLA 3VQAA 4BDYA 3WXMB 3LP0A 3K58A 3C6TA 3GDQA 1ZXOA 2W41A 3T69A 3THXB 5AQMA 3RTVA 3ID6A 4FK2A 1J5EK 4C8KA 4JRPA 3O3HA 3E01A 3ZT0A 3AGKA 4FLYA 2F8TA 3H08A 2E1YA 4YNQA 4XIUA 5EXWA 1E3MA 2HHXA 1O13A 3MEEA 1IBLK 2Q0RA 4GKJK 4HUEA 3EN9A 4JK7A 4R79A 2GELA 2A3ZA 4LF4K 1I39A 4KPYA 3CCRN 4CK1A 1KLMA 1ZBHA 3CMAN 4DB3A 3L8BA 2JLEA 4IKFA 3RRHA 3VQ9A 4B3SK 4E1MA 2OZSA 3FZLA 3BGRA 3B6PA 1S9EA 2QW9A 5CR4A 1SUQA 2ITMA 4MLEA 2X74A 1RDWX 4FLWA 3U6FA 1T6CA 2BANA 3CXCM 2NRTA 1F21A 1ZBSA 3DM2A 4NCGA 1NKBA 3LALA 1FKOA 3CFOA 1I3AA 1ESVA 3I8DA 1A5WA 3SJHA 4DV1K 4DTNA 2HBLA 3DXKA 4JI6K 3VGMA 2HB5A 2JGUA 3AVMA 5BN9A 4CK3A 2PYLA 1R0AA 3F2KA 4BRGA 4OVLA 4A57A 3NVKA 4GW6A 1WSFA 3WNHA 2UXCK 3JXUA 4FW2A 1HX1A 2KTQA 2J4RA 3I8BA 1JL2A 2O8FB 2IS3A 4ELTA 1QQNA 5GINA 3CERA 3ISNC 3SUNA 3H1QA 3D2EB 3TTFA 2F7TA 4CJKA 4B9NA 2KFZA 1CZAN 4B8AB 3D2FB 4DQRA 1SL0A 3ID8A 2G8WA 4BR0A 2ZD1A 5JVHL 3WT0A 2IGIA 3AA3A 1E4FT 1OH5A 1ZBLA 4DKWA 3CJ9A 1NMNA 3H3NO 4CFAA 1WN7A 1VSHA 5CYMA 3O9SA 4KBOA 5FPEA 4GMJB 1SQKA 3LWMA 3V1QA 3H3OB 3NAEA 2I5JA 1V4SA 3MCPA 3LAMA 4JYAK 4LC9B 3C0BA 4KO0A 4O55A 5JLHA 1CXUA 1TV6A 3O3FA 1WSEA 1IO2A 1VQNN 4DMNA 4R5PA 3T1HK 4BVOA 3SNNA 1KVCA 4AQYK 4DTUA 1S1XA 5GIPA 3CCUN 3WUHA 4J2BA 1ZBUA 1WAJA 3RMBA 1JCEA 3JSMA 3GL1A 2P5GA 1BUPA 1RTHA 4Z4HA 4Z4FA 4KREA 5K14A 4BRHA 3PO4A 4DR7K 2P9UA 4DSFA 1V4TA 2UU9K 4FWQA 1BOTO 4DV4K 3J81O 4FWLA 4JD2B 5KQDA 2ZQBA 4J2DA 3AVIA 4KV8A 4H5TA 4H5NA 5C2DA 5C42A 4K42A 2RKIA 3CJCA 2E6LA 1HQEA 4RW6A 4BC5A 3H46O 1KAYA 5AZJB 4CZMA 4BWMA 3ZT3A 4LY7A 2RN2A 1ATRA 5KTQA 1YJNN 4YY3K 4G1QA 1DT9A 1EQYA 5EOYA 3ULDA 4E89A 3OW2M 3WXJA 3MXIA 3ENOA 3CF5L 3R8EA 5FLXO 1N6QA 3EZ5A 5D3GA 3VEWA 3NGIA 1TKTA 3P83D 2GX9A 3L4IA 4A5BA 4CF2A 3E1YA 4YDUC 3L6QA 5DM6L 2VGMA 5GIOA 3CYMA 1LV5A 1SL1A 3THWB 3KWIA 4XH1A 2QM1A 1HUXA 3CCSN 2O8CB 3OYGA 4F3TA 2W42A 3CQ8A 1OVQA 3IS9A 4PHTX 1HYSA 3VF2A 4CBXA 4N41A 4M3XA 1FJGK 3SJJA 3QIOA 4FJIA 4BGBA 4X65K 3VTIA 4IEIA 4M3WA 4J8FA 4CEZA 1NGDA 4DU3A 3AO2A 3IAYA 1QTMA 4FWNA 4KHNA 4JLHA 3VA0A 4BRPA 1NJWA 2HHHK 1JL1A 1NJXA 1KVAA 1LWEA 2Q36A 4B1VA 4I9QA 3ASMA 1QVGM 4WCEL 5FPDA 4CEDA 3CJ7A 4PQUA 4FOEA 1G15A 2AJQA 2AA4A 2NRRA 2ASOA 4OPJA 3OYHA 1XNRK 4LFAK 2CH6A 5MLCQ 2AP1A 1W2BM 4PWDA 1C0MA 3QNNA 4Z94A 5HROA 3TTCA 4FOIA 3F73A 3CQYA 3IRXA 3HPGA 4CIEA 3TWHA 2E6MA 4OLBA 2E8AA 3VN5A 3GE1A 1TVRA 4AHCA 1QVFM 4DTOA 1RT7A 2YKNA 1QE1A 2VWBA 4FM1A 3MX2A 2Q97A 3C6AA 5M1QA 2Q3SA 1GLBG 1TL1A 2DFEA 2FXUA 3A8YA 3CI5A 4CESA 2YHWA 2BGGA 3VESA 1NK9A 3PX6A 4RW9A 1J5OA 4CEAA 4KAZA 4B9QA 4YOUA 4C1NI 3MAQA 3DLLL 2EX3A 4PKGA 3LZJA 4KFBA 1VSKA 1NU0A 3HP6A 3V6DA 4G9ZA 1JLEA 4W5NA 2O4IA 4DR3K 1VQPN 3O9UA 4U7BA 1LOTB 4OO1J 1NMDA 3QIPA 4I9LA 4CZFA 3O1WA 1YVUA 1EKEA 3MEDA 5EU7A 4FJ7A 1DGKN 3EEQA 2VG6A 3HSCA 5IWAK 1VQLN 3V1RA 4OGCA 2I7NA 3OS1A 1JLAA 4Z4EA 3LM9A 3VQ6A 3CCMN 3LDSA 1C1AA 4ISEA 4CJVA 2QXFA 4IWVA 3S3MA 3NH2A 5ADXH 3AAPA 2CH5A 3TAQA 4L3QA 3OYMA 5ADXA 3MDQA 3ZSVA 1IKVA 3AVJA 5I42A 4J2EA 2GUIA 3C6UA 3MN9A 3AARA 4FJKA 3CD6N 2HHWA 4CJFA 1S1WA 4BRLA 4Z4GA 2NRVA 4IZ9A 4F3OA 3QFUA 1UOCA 3FZFA 2WOMA 3HM9A 4KI6A 4KHUA 4FJHA 3C7NA 4CD1A 2QWMA 1YF5L 3ZSZA 4BRQA 4B8CA 4B9TA 4DQSA 2HF4A 2ZJPL 4H4MA 2QEXN 1IG8A 4XH5A 3PUFA 3AVGA 1WNSA 4KHPK 4W5OA 1VQ9N 4FJMA 3V4IA 3LDQA 4XEIA 4CZEA 3HRGA 4IEEA 3OYJA 4DFPA 3HI0A 3OYNA 1MWKA 1NGBA 4F2SA 3UE5A 3ZSXA 1ZBIA 4ID5A 2Z1HA 1OH7A 1RDCA 2QXLA 4HCCA 3M8SA 1UA1A 1U49A 3K5LA 4BDZA 3TAPA 1JLCA 4CD3A 4NLCA 3L2VA 2GBZA 4F8RA 4U67L 4LH4A 2KZMA 3CQXA 4DS4A 3ATVA 3VEXA 1EWRA 2PBDA 1Z26A 1BI4A 1IKXA 3HO1A 1BCOA 3LDLA 3VF6A 4ILGB 4BRIA 1S9GA 3HSTB 2ZE2A 3M8QA 5LJVA 1VSDA 1JCFA 4X64K 1JLQA 1MWMA 1QSYA 1D9DA 3TABA 5KPZA 3V9UA 2F8SA 3Q7CA 3DWLA 4WQ4C 1T7PA 4FM2A 4NXNK 4IDHA 3CHWA 3C95A 2P9LB 3VOVA 1CXQA 2QA4N 4CEQA 5BPMA 3QEXA 2DTUA 3V81A 3O3GA 4FJXA 3V9SA 4C23A 3MECA 4CGFA 3KWGA 4IOAL 4E19A 4JNEA 1JLBA 1YTUA 4Y1DA 1S6QA 4FWPA 4RW7A 1NK5A 3MWTA 5AQNA 1BL3A 1JLFA 3L3UA 3N4PA 1DTQA 1GOBA 3S9HA 4EZ9A 1HKGA 2QKBA 5AQTA 3U8XA 3G25A 4CF8A 4DS5A 1WSIA 2PY5A 1TAQA 1JCGA 1OKJA 3MN6A 5E84A 4CJEA 4ZHRA 5DMRA 3ZX0A 1HNZK 5CZ1A 4E7LA 1KFSA 4CJQA 1WBBA 1P8ZA 5BRDA 4RWTA 4M45A 2V7YA 3O08A 4KH5A 3T1AA 3GOIA 3LPTA 1IKYA 1X9WA 1IKWA 3L2UA 4JKHA 3P4IA 2OPRA 1IG9A 4HWIA 2D1KA 1WB9A 1U6ZA 1VRTA 2JWKA 4Y1CA 1K6YA 1WUAA 4KH4A 4PL7A 2PZSA 4BRMA 2EHGA 3IKMA 3OYFA 1U45A 4FJJA 4KB1A 3PY8A 2E88A 4BGAA 1Q9XA 1BQNA 1DLOA 3VETA 2G8KA 5J2QA 1YT3A 4MO5A 1RGIA 4KH6A 3DLRA 1RBRA 1VAZA 3A5MC 4PA1A 4CHZA 4YOYA 4IO9L 3ITHA 4K41A 4FZYA 1RDUA 2HMPA 1YJ9N 1HNXK 3CCJN 3SMSA 4Q5VA 3T1YK 2GUPA 4RG8A 3I33A 4DTPA 3MX5A 3LP3A 1EETA 3NH0A 2IIRA 4PKIA 3KD5E 1O1WA 3LM2A 4FVMA 4LSLA 3HOSA 1VQ6N 1ZYQA 4NCBA 4JKBA 3ZX3A 1S3XA 5KPTA 3PSFA 2P9IA 3AO1A 1W0HA 5C24A 4DQ8A 3IDHA 1N5YA 4IG0A 3LP1A 4IO8A 3WNGA 1Q8IA 5KGXA 1J9AA 5HP1A 2HNYA 1T3VA 4JI4K 1T8EA 5ELZA 1WBDA 2NZTA 3ULEA 1S22A 5KRTA 3HT3A 3OYDA 3OYBA 4YOXA 1BG3A 4KTQA 3EE9A 3N4QA 3E9LA 4FL9A 5AQOA 3LDOA 1NK7A 4DQQA 1LW0A 4HUFA 2YJEA 3K2PA 3RR8A 2UXDK 3SCXA 4FWMA 3O8MA 3SUQA 1BCMA 1IJJA 1W9HA 2E2PA 4O4GA 4NYFA 5FPMA 3R9PA 1B9DA 4FPBA 2YHAA 1Q86O 2O8BA 1NKCA 1HNWK 4DV5K 3QNOA 4FZZA 2OPPA 3HVTA 3AO3A 3VEYA 5C0YA 2A41A 1GLCG 4B9MA 5J2NA 1C0FA 1L3TA 1HJRA 2FSJA 3HXMA 4BR5A 4FSVA 4W5TA 3C7NB 1YXQA 3UKRB 5LMNK 1EP4A 1RTDA 4M3TA 4LF5K 4N56A 4B9VA 4FW1A 4B9UA 3ZLJA 5JMVA 4B9SA 2HF3A 3TSQA 4OLAA 1QHAA 5KI6A 5FRNA 1HKCA 3FFIA 2OPSA 5AZIA 1RT1A 3WQTA 3NMUA 3SYZA 5GADP 2HVIA 3S41A 4EHTA 2YI1A 4CBUA 1KLNA 1QZ5A 3E66A 1ASUA 3T7ZA 3NF7A 2GWJA 1BGXT 4ICLA 2E2OA 1GLDG 2XRIA 3F5TA 1D4XA 3CC7N 2JWLA 1YJWN 4JRQA 3WXIA 2GEMA 5FPNA 2A42A 3DOKA 1BIUA 2O8EA 4HVJA 4LH5A 4DQPA 5F1XA 4BG9A 5KGWA 4PUOA 3WXKA 4DU4A 1GLFO 2WC9A 3ZETA 1NLVA 3PSIA 1J6ZA 3MN7A 4O0JA 4CF9A 3AVAA 3FLCO 5CY4A 1S5JA 4JKEA 1LWCA 2ASMA 1VQ7N 4B3OA 2ZJQL 1RT4A 3KKRA 3CJ1A 4JK8A 4BC4A 2HMIA 3TARA 2RF2A 3ZSQA 3RRGA 5JVGL 3AVCA 4KTWA 3V1OA 5AJ3K 1KD1O 3BZCA 1A5VA 2Z1JA 2P9NA 4NLBA 3G4SN 4CJTA 3OA9A 3EL2A 4OKJA 3TI0A 4YOVA 1J54A 1KSPA 4OPKA 3RWUA 1HNVA 4K25A 1W7AA 3ZSWA 2HHQA 3KIOA 4LF7K 1KRPA 1SKRA 1QSSA 1B9FA 5AQVA 1JKHA 3NHGA 4E7JA 3DLBA 4BDPA 3MWPA 2ASPA 4FLXA 2CGJA 4BE2A 4UY8O 3MEGA 4WYBA 3OJUA 1ZC6A 2FF6A 1Z6RA 2QKKA 2VQFK 4DR2K 4LD0A 2QI2A 3I56N 1Q81O 1BQMA 1XMQK 1TAUA 4GKKK 3VEOA 5HRRA 4PKHA 1K9MO 3BDPA 3F9MA 4QOZB 2P9KA 1BDGA 3AVFA 4H0TB 2YJFA 5HRNA 2UUAK 4BY9C 2IVNA 4CJ5A 2QWQA 4IG3A 4EZ6A 4FWKA 3NH1A 5H1SQ 3OVNA 3AVHA 3ZT1A 3AY9A 1SKSA 2HNDA 3QB0A 4FJ8A 1R59O 3BZKA 5F2RA 4OPHA 3V9ZA 3QBXA 5LJWA 3TAEA 3WQUA 3Q7BA 4IDKA 2KFNA 1WSHA 5CYQA 4E7KA 4CF0A 3UKUB 1VQMN 5JICA 1HNIA 3P5JA 4FJ5A 3DAWA 3ZSYA 3VTHA 3DJCA 4DFJA 3CM6A 5DM7L 2YHXA 4YHHK 2GTDA 1VQ5N 2ETJA 2OANA 2A1SA 3DRRA 1WSJA 3HL8A 4BREA 2QWNA 3LDNA 2ZM6K 1HKBA 2F96A 2OCEA 2NUBA 5AQZA 3OHRA 1TK5A 3OS2A 4CE9A 1XHXA 2DFFA 3AVLA 1BO5O 3E9OA 4BQLA 4CZLA 5AQXA 1X9MA 4JI2K 2P9IB 3W3DA 1ATSA 3QO9A 4JKGA 3HYFA 5TKYA 1L5UA 2FBTA 1N36K 4JI0K 2D0PA 1NWKA 3LWLA 5FROA 3HM8A 4Q0BA 2BTFA 3ULEB 4NXMK 3O9RA 4CGHA 1FK9A 3SV4A 3KK2A 1S6PA 1YVNA 3U3YA 3O9TA 1VSFA 3CC4N 1KCFA 3KTQA 2X6SA 2OPQA 4RTFD 3J80O 2NRZA 2Q0UA 2YNHA 4LFCK 3HK2A 3O4NA 3QFPA 3V9WA 4CJ3A 2B4JA 1ASVA 3SBTA 4H5RA 3RR7A 5C12A 3KK7A 1Q9YA 5HBMA 1T44A 1NGAA 5TKWA 4DSJA 3G71N 4FWRA 5LMUK 4X66K 4FWOA 4WFAL 1WAFA 1ASWA 4HTUA 2B6AA 3WNFA 4DSKA 4EP4A 3OTOK 1QSLA 2FBYA 2O8BB 1BWFO 2V51B 3CCLN 4Z0UA 1JJ2M 1HMVA 5FDLA 5KQ8A 1S1UA 3HPHA 3H6EA 5AQKA 3VGLA 4EAHD 3NF9A 4RCHA 4CJSA 1S1TA 1J53A 3DXKB 2V52B 3M6GA 5JS2A 4DUZK 5AQGA 4FLTA 3I55N 2KW4A 3IG1A 5C10A 4IXCA 3PIPL 4FM0A 2LSNA 5AQYA 1XC9A 4O8KA 2XY8A 4KHYA 4CZKA 4NYNA 3VENA 1TK0A 4JN4A 1QQOA 2W6KA 4BACA 1LAWA 1EO1A 4JI7K 2NRHA 1KAXA 4A2AA 1XQSC 5BR9A 4F2RA 2WONA 4BG8A 2E4LA 3ENHA 1CZ9A 3DXMA 3R1XA 3CJAA 3O1BA 3TTDA 4FXDA 4CERA 1HQUA 3K9JA 1M90O 4BE0A 3MXJA 1RTJA 3CM5A 3PX4A 4F9OA 3O5BA 4TSXA 4PL8A 4CZIA 4CCHA 4AHTA 5AFUH 4JHDA 1X9JA 3KJVA 3TPQA 1X9SA 5AFUA 2IOCA 3CCEN 4B3TK 1KVBA 3NF8A 1UAXA 2ZGZA 3O80A 4RW8A 4AH9A 2XY7A 1T03A 1K73O 3AVNA 4CZHA 3ZETB 4JS4A 1QQMA 1GOCA 3SAFA 3DLKA 3KLEA 4CJ4A 5HOOA 5AQRA 2OA8A 2DY4A 4MDBA 4N5SA 5T7BA 2PYJA 3SV3A 4EHUA 1P90A 4CJLA 4CFDA 4KI4A 3D6RA 1N8RO 1XUPO 4I7FA 2HHVA 1VSEA 2O8FA 3QESA 2VWJA 2UYTA 4JAXA 4E7IA 2D0BA 3O4QA 2ZF5O 5AQHA 3KVGA 1FXXA 2FSNA 1NJIO 2P9SA 4V19S 5M1OA 3MMVA 4AF1A 4YFUA 3SUPA 3VMFB 5KPRA 5GAGP 2IAJA 2HW3A 3GG4A 3KKSA 2P9UB 4OKKA 2P9PA 1D8YA 3VF4A 4M63C 4M7YA 3IUCA 3DLGA 4AILC 4FJ9A 1NGEA 1NJZA 4XH4A 5C25A 4O5FA 5M1NA 4LSNA 2XY5A 2HHTA 1EX4A 1WLJA 3ZCMA 4B9LA 1M1KO 5BRFA 4DV7K 1JLGA 4CGJA 3E9PA 1NBWA 4CEBA 4WQ5C 4BC2A 5CHIA 3OYLA 2O8DA 4CGDA 2VCPA 3VQPA 2HVHA 1VSIA 3JS6A 3HBTA 3SQ1A 2ZWHA 2D0AA 3KD1E 1HPZA 1C0UA 5I9EB 3AAQA 4FK4A 3HP9A 2YNGA 1YI2N 2W40A 5EX5A 3I0RA 4M3RA 1SL2A 3AVBA 3OYEA 1KC8O 2E5LK 4E7HA 3T19A 5CZ2A 2A5XA 3OYIA 4B08A 3VPZA 3J7YP 2ITGA 3EE8A 4CECA 4B1UB 3KK1A 3B6OA 4KHQA 2HOEA 3QEVA 4BQZA 1GOAA 1A5XA 3QBWA 4DU1A 3HPOA 4JEPA 2Z1IA 4O0IA 4LFBK 3VQ4A 3EO3A 1JXEA 4IOXA 1OH6A 4HHTA 1K8KA 4H0PA 3FGUA 3P1GA 3T3FA 3EZWA 5E41A 1RT2A 3QEWA 2Q2RA 3RMDA 5J1EA 3L0QA 3AGRA 1EXQA 2G8IA 1ITGA 3NE6A 3QEIA 1IBKK 1YIJN 3VQBA 3KK3A 3M5RA 3WEEA 4RW4A 4IJNA 3HVRA 3IFRA 1UWBA 4JKGB 1QQCA 4MO4A 4OJRA 4WQ5A 4OGEA 4H0OA 3NBPA 4IOCL 1S1VA 1SAZA 4FLZA 3SQ4A 1KTQA 1Z05A 4JK9A 2P1JA 1HPMA 2WTUA 5HL7L 1U4BA 3NDKA 1REVA 2DFHA 3AO4A 3SAGA 4CJRA 3M3ZA 4MLHA 2O4GA 2RHKA 3VERA 3SMPA 4GVEA 2FBVA 4AHUA 2FSKA 4HUGA 3LAKA 1OVYA 3FFKB 5C15A 3K57A 1NGHA 4QCLA 4A59A 3EKSA 2YNFA 4NO7A 3NVMA 2G8FA 3SPZA 1T05A 1VQ8N 4K8XA 4CGIA 1YITN 3JAMO 1Y64A 1QHTA 3S3OA 4MFBA 3ZEUA 2ZJRL 2F9TA 3VA3A 5F0XA 4ILJA 4BR9A 1QZ6A 3ZYYX 3RSEA 4H03B 5EVZA 4K8ZA 1VSMA 3KLHA 2D5RA 3TSPA 5IT9O 4CFBA 4DG1A 4JI1K 4DFMA 4FK0A 3SI6A 2D4WA 2FF3B 5HRPA 3HOTA 5GAEP 1RT6A 2KLAA 3FR0A 1Z25A 3OYAA 4BRAA 4KKOA 3CFRA 3PX0A 5I3UA 1NK6A 3K9KA 3DYAA 4DV0K 2Y1JA 1TYQA 3TAFA 3AO5A 1BA1A 3NGYA 2XY6A 4I2PA 3DXMB 3TAMA 4DV2K 4FCYA 3A5NC 4ISFA 3NCIA 3LANA 1VSJA 3TR8A 2RE2A 2EWSA 4A5AA 3DLHA 2I7PA 5AQQA 4ILHA 2WBNA 4FWSA 4KHWA 4JHDB 2VG5A 4DTJA 5LL6Z 1MA9B 3KLIA 1L3VA 1RFQA 2VGNA 1KQSM 1HR0K 4N76A 2OTLN 4QS8A 4CHQA 1GLAG 1YUWA 2YHBA 4KRFA 1RDAA 4NB4A 1B92A 3RVCA 4C8MA 3DMJA 3GBTA 3I0SA 3IMXA 1NK8A 3CMEN 2IC3A 4M42A 4A62A 4BRCA 4CJWA 1RDDA 5AQIA 2ZGYA 1HLUA 1L3UA 3P31A 3BY5A 1C0TA 4JKCA 4AHVA 3WXLA 3C94A 3RMAA 4N47A 1KFDA 2P9SB 3CCVN 1YTAA 4BE1A 3SLCA 2X6NA 5AQLA 1S72N 3ATUA 1TUUA 3TANA 3VQDA 2B5JA 2P9PB 3THVA 1BI4B 2QWOA 2IDOA 4JKFA 4CGGA 5BREA 3UB5A 3J7ZO 5LY3A 4FJGA 4QAGA 5J2MA 1VQKN 2QWRA 3A0IX 2QTDA 3R3LA 2Z1GA 4CJ7A 3K5MA 4OKEA 2UUCK 2XHBA 3ZX2A 3U3GA 3EY1A 2QK9A 4M3YA 2F9WA 4ISGA 1FW6A 2BDPA 2G8UA 2YV0X 2ATQA 2H3GX 1LW2A 4CJPA 5AQPA 1U2VA 4JKAA 2O8DB 5AQSA 4W5QA 2UXBK 3CETA 4CBWA 2GV9A 2BH1A 4O5BA 1UA0A 3J8AA 1MU2A 1RT5A 2HBMA 3WNEA 4BRDA 1X3MA 3AA4A 3OYCA 4FZXC 1NGCA 3VQCA 4DV6K 5M1FA 3MN5A 3UIQA 4CEEA 4DR1K 2D0CA 3KZBA 2D0OA 4FVUA 4CFCA 4YORA 4AHSA 3G0ZA 1C0GA 4JI5K 4E1NA 3M8PA 4K0KK 4GY2B 2NRXA 5J2PA 4YOTA 1NGIA 3OYKA 4FLVA 1SV5A 4H8KA 3F9KA 5CE3A 3QMLA 5FRMA 3CG7A 1L3SA
chains in the Genus database with same CATH topology
4O44A 3U6FA 2BANA 4FM0A 4RW7A 2LSNA 1XC9A 1NK5A 1BL3A 1F21A 2XY8A 1JLFA 4HCBA 4KHYA 4NYNA 3L3UA 1NK4A 1DTQA 1GOBA 3S9HA 4EZ9A 3DM2A 2QKBA 1TK0A 4NCGA 3KLFA 1NKBA 4CF8A 4DS5A 4DTXA 3LALA 1WSIA 1XWLA 4CEFA 4BACA 2PY5A 1FKOA 1LAWA 1I3AA 3CFOA 1TAQA 3QETA 4ZHRA 3OS0A 3I8DA 4CJEA 3SQ0A 1A5WA 5DMRA 2OZMA 4F2RA 2WONA 2E4LA 4DTNA 3VQ7A 5CZ1A 4E7LA 1KFSA 4DSIA 1CZ9A 4CJQA 2HB5A 2JGUA 3AVMA 5HRSA 4CK3A 2PYLA 1R0AA 4FXDA 1SKWA 5SWMA 4OVLA 4CERA 1C1BA 1HQUA 4H4OA 4M45A 4GW6A 1WSFA 3QINA 1RILA 1TKZA 3WNHA 1IH7A 4CHOA 3QERA 2Y1IA 3T1AA 4BE0A 4FW2A 3MXJA 3LPTA 2KTQA 1RTJA 3CM5A 1IKYA 3SPYA 1X9WA 3PX4A 1JL2A 1IKWA 2IS3A 4TSXA 1BIZA 3L2UA 4ELTA 4CCHA 4AHTA 4DSEA 3KJVA 3ISNC 3SUNA 4CJKA 4B9NA 2OPRA 1IG9A 1X9SA 2KFZA 1VRTA 2IOCA 4Y1CA 4B8AB 4DQRA 1KVBA 1SL0A 3NF8A 1K6YA 2G8WA 3QEPA 2ZD1A 1UAXA 2PZSA 4AH9A 4RW8A 2IGIA 3AA3A 2XY7A 1T03A 4BWJA 2EHGA 3AVNA 1U45A 3OYFA 4C8LA 4JS4A 1ZBLA 1GOCA 4JS5A 4FJJA 4KB1A 3DLKA 3KLEA 4CJ4A 1RT3A 1X1PA 3L2WA 2OA8A 2BE2A 2DY4A 3PY8A 4N5SA 1Q9XA 5T7BA 1BQNA 1DLOA 2YNIA 2PYJA 3SV3A 2G8KA 4CJLA 1HRHA 4CFAA 1WN7A 4CFDA 1YT3A 5J2QA 1VSHA 5CYMA 1VRUA 4CHYA 4DF4A 4KI4A 4MQ3A 4I7FA 2HHVA 1DTTA 1VSEA 1CZBA 1HYVA 1RBRA 3DLRA 4CHPA 3QESA 4PA1A 2VWJA 4CHZA 2OYQA 4E7IA 3ITHA 2D0BA 4GMJB 1NOYA 4FZYA 3DI6A 3O4QA 3V1QA 3LWMA 1RBUA 3NAEA 1FXXA 2I5JA 2XO7A 3LAMA 1TL3A 4Q5VA 4KO0A 3D0PA 4O55A 4YFUA 1CXUA 4RG8A 1TV6A 3SUPA 3CFPA 3O3FA 1WSEA 4DTPA 4FJLA 1IO2A 2IAJA 3LP3A 4DMNA 1EETA 3DRSA 3KKSA 4R5PA 3NH0A 4KB0A 2HW3A 3KD5E 1O1WA 4OKKA 4FVMA 4LSLA 1KVCA 2VWKA 3SNNA 4DTUA 1ZYQA 1S1XA 2X78A 4F3TA 4NCBA 1D8YA 3L2QA 4AHRA 3AO1A 1W0HA 3DLGA 5C24A 4AILC 3ALYA 4FJ9A 4J2BA 1ZBUA 1WAJA 1N5YA 1NJZA 4IG0A 3RMBA 4CEOA 3NGZA 3LP1A 5C25A 3JSMA 3WNGA 3S3NA 1Q8IA 5KGXA 1J9AA 5HP1A 2HNYA 2P5GA 1T8EA 4DTMA 1RTHA 4LSNA 4Z4HA 4UQGA 2XY5A 4Z4FA 2HHTA 4KREA 3HJFA 5KRTA 1EX4A 1WLJA 5K14A 3VQQA 3PO4A 3G10A 3HT3A 3OYDA 3ZCMA 4B9LA 4Z4CA 3OYBA 1JLGA 3LPUA 4DSFA 4CGJA 5HLFA 4CEBA 4M41A 1C6VA 4KTQA 3OYLA 3EYZA 4CGDA 4DQIA 3VQPA 2HVHA 1VSIA 3K5OA 4J2AA 1NK7A 4IBNA 3OJSA 4DQQA 1LW0A 2ZQBA 4HUFA 3SQ1A 4J2DA 3AVIA 4KV8A 1TGOA 3K2PA 2D0AA 5C42A 3KD1E 2RKIA 3RR8A 1HPZA 3SCXA 2E6LA 1C0UA 1HQEA 3SUQA 1BCMA 4RW6A 4FK4A 3HP9A 1W9HA 2KQ2A 1BISA 2YNGA 4BWMA 4O4GA 3ZT3A 1NOZA 3QLHA 4NYFA 4LY7A 1B9DA 2RN2A 3I0RA 4M3RA 1SL2A 5KTQA 2YHAA 3AVBA 1TKXA 3OYEA 1FKPA 4G1QA 1RCHA 1NKCA 4E7HA 3T19A 5CZ2A 3OYIA 3ULDA 4B08A 4E89A 3QNOA 2OPPA 4FZZA 4E3SA 2ITGA 3MXIA 3HVTA 3AO3A 1RDBA 1WSGA 4FJNA 4CECA 4ZTFA 1N6QA 3EZ5A 3KK1A 3RMCA 5D3GA 3B6OA 3NGIA 1TKTA 4KHQA 4B9MA 5J2NA 1U04A 3P83D 3QEVA 1GOAA 1A5XA 4CF2A 1BHLA 1L3TA 4DU1A 3HPOA 1HJRA 3HXMA 1RBTA 2Z1IA 4O0IA 3VQ4A 4DLGA 4W5TA 3CYMA 3NF6A 1LV5A 1JXEA 1SL1A 4HHTA 1EP4A 1RTDA 4M3TA 3P1GA 4N56A 3T3FA 4B9VA 4FW1A 5E41A 3OYGA 1RT2A 3ZSOA 4B9UA 2W42A 3CQ8A 4WE1A 3IS9A 1RBVA 3QEWA 3RMDA 4B9SA 4DWIA 5J1EA 4L8RB 4N41A 4M3XA 4OLAA 1HYSA 5KI6A 4Y1DA 5FRNA 3SJJA 3FFIA 3QIOA 2OPSA 1EXQA 4FJIA 2G8IA 1RT1A 1ITGA 3NE6A 3SYZA 3QEIA 2HVIA 4M3WA 3K59A 3VQBA 4CEZA 1KLNA 3KK3A 4RW4A 3DRPA 1ASUA 3NF7A 3HVRA 3V9XA 1BGXT 3KLGA 4ICLA 1ZBFA 3AO2A 4DU3A 1NJYA 3IAYA 1QTMA 3L2RA 1UWBA 2XRIA 4IFVA 1QQCA 4KHNA 3LZIA 4JLHA 3VA0A 4OJRA 4OGEA 3NBPA 4M3UA 1VSLA 5JS1A 4JRQA 1NJWA 2P51A 5KRSA 4M3ZA 1JL1A 4ZTJA 1NJXA 1KVAA 1LWEA 1U47A 1S1VA 4FLZA 3SQ4A 4I9QA 1KTQA 3ASMA 2P1JA 3TAGA 3DOKA 1BIUA 1U4BA 1RBSA 4KHSA 1TK8A 2P5OA 4HVJA 4CEDA 4LH5A 3NDKA 3AV9A 1REVA 4PQUA 2DFHA 4DQPA 3AVKA 3AO4A 1G15A 4CJRA 1C1CA 2AJQA 5KGWA 4PUOA 4DU4A 4OPJA 2O4GA 3OYHA 4O0JA 4CF9A 3AVAA 5CY4A 3M8RA 2FBVA 4PWDA 1S5JA 1C0MA 4AHUA 4W5RA 4DF8A 3QNNA 5HROA 1TKDA 3F73A 4HUGA 3IRXA 1LWCA 4CJUA 3ZT2A 3LAKA 3HPGA 3VQEA 4CIEA 2E6MA 3K57A 2RPIA 3TWHA 4NCAA 4OLBA 4B3OA 1RT4A 4QCLA 3SQ2A 3VN5A 4EP5A 3KKRA 2YNFA 2HMIA 3TARA 1TVRA 3L3VA 4AHCA 3SPZA 1T05A 2RF2A 4DTOA 3ZSQA 2G8FA 1RT7A 2YKNA 1D5AA 1QE1A 4FM1A 3RRGA 3AVCA 4KTWA 3V1OA 2G8VA 2Q3SA 4DLEA 4CGIA 4K8XA 1A5VA 4F4KA 1TL1A 2Z1JA 3DLEA 1XI1A 2DFEA 3S3OA 1QHTA 4CJTA 4CESA 1RTIA 4MFBA 2BGGA 4OKJA 3VA3A 1LAVA 3TI0A 1NK9A 3PX6A 4RW9A 1J54A 1J5OA 1KSPA 4CEAA 4OPKA 4K8ZA 1VSMA 3KLHA 2D5RA 3RWUA 4KAZA 2HHUA 1HYZA 3NFAA 1HNVA 4CFBA 3DOLA 4DG1A 3ZSWA 4DFMA 3MAQA 4FK0A 3KIOA 2EX3A 5SZTA 3LZJA 3SI6A 4CK2A 2HHQA 1LWFA 4KFBA 1VSKA 5HRPA 1KRPA 1RT6A 3K5NA 1SKRA 1B9FA 1QSSA 3HP6A 2HHSA 1JKHA 3NHGA 4E7JA 3V6DA 1JXBA 3DLBA 4BDPA 1JLEA 3LP2A 1Z25A 3OYAA 4FLXA 4W5NA 5DK5A 4KKOA 4IFYA 4BE2A 2O4IA 3CFRA 3PX0A 5I3UA 1NK6A 3MEGA 3DYAA 3OJUA 2Y1JA 4DSLA 3A2FA 3AA5X 3TAFA 3AO5A 3D45A 4DTSA 2QKKA 3QIPA 2HNZA 3NGYA 4I9LA 4I2PA 2XY6A 1YVUA 1EKEA 3MEDA 5EU7A 4LD0A 3TAMA 4FJ7A 1D9FA 4FCYA 2FC0A 3NCIA 3LANA 1BQMA 3VQ8A 1CLQA 1TAUA 4CIGA 2VG6A 1VSJA 5HRRA 3TR8A 4DFKA 1Y97A 3BDPA 3PV8A 3V1RA 4QOZB 4OGCA 3OS1A 1JLAA 4Z4EA 3DLHA 3VQ6A 2FBXA 3AVFA 5HRNA 3VQ5A 4KHWA 3ZT4A 3LDSA 1C1AA 4CJ5A 4CJVA 3SZ2A 2QXFA 3S3MA 3NH2A 2YKMA 4IG3A 3MXMA 4EZ6A 2VG5A 3NH1A 3OVNA 3AVHA 3ZT1A 4DTJA 3TAQA 1SKSA 3OYMA 2HNDA 3KLIA 1L3VA 4FJ8A 3ZSVA 1IKVA 3AVJA 3V9ZA 4N76A 1RNHA 5I42A 4J2EA 2GUIA 3TAEA 3C6UA 4IDKA 4CHQA 2KFNA 2YHBA 1WSHA 1NK0A 5CYQA 4E7KA 4CF0A 4FJKA 4KRFA 4CIFA 2HHWA 4CJFA 1S1WA 2KZZA 1RDAA 4CHNA 1B92A 4PY5A 2A1RA 1XHZA 4C8NA 1HNIA 3P5JA 4Z4GA 1VK0A 4ID1A 4CF1A 4C8MA 4GVMA 4FJ5A 3DMJA 4FLUA 3I0SA 1NK8A 4F3OA 3ZSYA 1UOCA 2IC3A 4M42A 2WOMA 4I2QA 3HM9A 3ZSRA 4DFJA 3CM6A 4KI6A 4KHUA 4FJHA 4CJWA 1RDDA 4FYDA 3ZSZA 2ETJA 3AA2A 2R7YA 2A1SA 3DRRA 1L3UA 4B8CA 4B9TA 4DQSA 1WSJA 3HL8A 1C0TA 4AHVA 4ELVA 4H4MA 3C94A 3RMAA 4N47A 1KFDA 3PUFA 2F96A 1U48A 2NUBA 1QS4A 3AVGA 1WNSA 1TK5A 4DTRA 1YTAA 3OS2A 4BE1A 1NKEA 4W5OA 4CE9A 4FJMA 3V4IA 1XHXA 2DFFA 2X6NA 3AVLA 4DFPA 3OYJA 3TANA 3VQDA 2B5JA 3OY9A 3OYNA 3THVA 2VG7A 4KTZA 3JYTA 1BI4B 1X9MA 3PO5A 2IDOA 4CGGA 3ZSXA 4F2SA 4Z4IA 1ZBIA 3QO9A 4ID5A 2Z1HA 4FJGA 1RDCA 3HYFA 4QAGA 2FBTA 5J2MA 1L5UA 4C8OA 3SUOA 4HCCA 3M8SA 2G8HA 1UA1A 1U49A 2Z1GA 3LWLA 5FROA 3K5LA 4OKEA 3K5MA 4BDZA 4ELUA 3VQAA 4Q0BA 3TAPA 1JLCA 4BDYA 2XHBA 3L2VA 3LP0A 2GBZA 4CGHA 3K58A 1FK9A 3C6TA 3U3GA 4F8RA 3SV4A 3EY1A 2QK9A 4LH4A 4M3YA 3KK2A 2KZMA 1S6PA 4DS4A 3U3YA 3RTVA 2BDPA 1VSFA 2G8UA 2YV0X 1KCFA 3KTQA 2X6SA 2ATQA 4FK2A 1LW2A 4CJPA 4C8KA 2OPQA 4JRPA 3O3HA 3E01A 1Z26A 3ZT0A 2YNHA 1BI4A 4FLYA 3HK2A 1IKXA 2F8TA 3H08A 3O4NA 4W5QA 3HO1A 1BCOA 3V9WA 4YNQA 4CJ3A 2B4JA 4XIUA 1ASVA 2GV9A 3RR7A 2HHXA 1S9GA 4O5BA 3HSTB 1UA0A 2ZE2A 1Q9YA 3MEEA 1MU2A 3M8QA 5HBMA 1RT5A 4E0DA 1VSDA 1JLQA 4HUEA 1QSYA 3WNEA 1D9DA 3TABA 4DSJA 3AA4A 3V9UA 2F8SA 3OYCA 1I39A 4FZXC 3VQCA 1WAFA 1ASWA 4HTUA 2B6AA 3WNFA 4KPYA 4DSKA 4EP4A 4CK1A 4FM2A 1QSLA 1T7PA 2FBYA 4CEEA 3C95A 1KLMA 3UIQA 1ZBHA 3L8BA 2D0CA 4Z0UA 2JLEA 4IKFA 1CXQA 3RRHA 1HMVA 5FDLA 4CEQA 3VQ9A 4CFCA 4AHSA 3QEXA 1S1UA 2DTUA 3G0ZA 3HPHA 3V81A 3O3GA 4FJXA 3V9SA 4E1NA 3M8PA 3NF9A 4CJSA 1S1TA 4E1MA 3MECA 2OZSA 1J53A 3BGRA 3B6PA 4CGFA 1S9EA 5JS2A 5J2PA 3OYKA 4FLVA 1SV5A 4FLTA 2KW4A 3F9KA 1SUQA 4H8KA 4E19A 1JLBA 3CG7A 3IG1A 1L3SA 1S6QA 5FRMA 2X74A 1YTUA 4FLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O44 A;  3U6F A;  2BAN A;  4FM0 A;  4RW7 A;  2LSN A;  1XC9 A;  1NK5 A;  1BL3 A;  1F21 A;  2XY8 A;  1JLF A;  4HCB A;  4KHY A;  4NYN A;  3L3U A;  1NK4 A;  1DTQ A;  1GOB A;  3S9H A;  4EZ9 A;  3DM2 A;  2QKB A;  1TK0 A;  4NCG A;  3KLF A;  1NKB A;  4CF8 A;  4DS5 A;  4DTX A;  3LAL A;  1WSI A;  1XWL A;  4CEF A;  4BAC A;  2PY5 A;  1FKO A;  1LAW A;  1I3A A;  3CFO A;  1TAQ A;  3QET A;  4ZHR A;  3OS0 A;  3I8D A;  4CJE A;  3SQ0 A;  1A5W A;  5DMR A;  2OZM A;  4F2R A;  2WON A;  2E4L A;  4DTN A;  3VQ7 A;  5CZ1 A;  4E7L A;  1KFS A;  4DSI A;  1CZ9 A;  4CJQ A;  2HB5 A;  2JGU A;  3AVM A;  5HRS A;  4CK3 A;  2PYL A;  1R0A A;  4FXD A;  1SKW A;  5SWM A;  4OVL A;  4CER A;  1C1B A;  1HQU A;  4H4O A;  4M45 A;  4GW6 A;  1WSF A;  3QIN A;  1RIL A;  1TKZ A;  3WNH A;  1IH7 A;  4CHO A;  3QER A;  2Y1I A;  3T1A A;  4BE0 A;  4FW2 A;  3MXJ A;  3LPT A;  2KTQ A;  1RTJ A;  3CM5 A;  1IKY A;  3SPY A;  1X9W A;  3PX4 A;  1JL2 A;  1IKW A;  2IS3 A;  4TSX A;  1BIZ A;  3L2U A;  4ELT A;  4CCH A;  4AHT A;  4DSE A;  3KJV A;  3ISN C;  3SUN A;  4CJK A;  4B9N A;  2OPR A;  1IG9 A;  1X9S A;  2KFZ A;  1VRT A;  2IOC A;  4Y1C A;  4B8A B;  4DQR A;  1KVB A;  1SL0 A;  3NF8 A;  1K6Y A;  2G8W A;  3QEP A;  2ZD1 A;  1UAX A;  2PZS A;  4AH9 A;  4RW8 A;  2IGI A;  3AA3 A;  2XY7 A;  1T03 A;  4BWJ A;  2EHG A;  3AVN A;  1U45 A;  3OYF A;  4C8L A;  4JS4 A;  1ZBL A;  1GOC A;  4JS5 A;  4FJJ A;  4KB1 A;  3DLK A;  3KLE A;  4CJ4 A;  1RT3 A;  1X1P A;  3L2W A;  2OA8 A;  2BE2 A;  2DY4 A;  3PY8 A;  4N5S A;  1Q9X A;  5T7B A;  1BQN A;  1DLO A;  2YNI A;  2PYJ A;  3SV3 A;  2G8K A;  4CJL A;  1HRH A;  4CFA A;  1WN7 A;  4CFD A;  1YT3 A;  5J2Q A;  1VSH A;  5CYM A;  1VRU A;  4CHY A;  4DF4 A;  4KI4 A;  4MQ3 A;  4I7F A;  2HHV A;  1DTT A;  1VSE A;  1CZB A;  1HYV A;  1RBR A;  3DLR A;  4CHP A;  3QES A;  4PA1 A;  2VWJ A;  4CHZ A;  2OYQ A;  4E7I A;  3ITH A;  2D0B A;  4GMJ B;  1NOY A;  4FZY A;  3DI6 A;  3O4Q A;  3V1Q A;  3LWM A;  1RBU A;  3NAE A;  1FXX A;  2I5J A;  2XO7 A;  3LAM A;  1TL3 A;  4Q5V A;  4KO0 A;  3D0P A;  4O55 A;  4YFU A;  1CXU A;  4RG8 A;  1TV6 A;  3SUP A;  3CFP A;  3O3F A;  1WSE A;  4DTP A;  4FJL A;  1IO2 A;  2IAJ A;  3LP3 A;  4DMN A;  1EET A;  3DRS A;  3KKS A;  4R5P A;  3NH0 A;  4KB0 A;  2HW3 A;  3KD5 E;  1O1W A;  4OKK A;  4FVM A;  4LSL A;  1KVC A;  2VWK A;  3SNN A;  4DTU A;  1ZYQ A;  1S1X A;  2X78 A;  4F3T A;  4NCB A;  1D8Y A;  3L2Q A;  4AHR A;  3AO1 A;  1W0H A;  3DLG A;  5C24 A;  4AIL C;  3ALY A;  4FJ9 A;  4J2B A;  1ZBU A;  1WAJ A;  1N5Y A;  1NJZ A;  4IG0 A;  3RMB A;  4CEO A;  3NGZ A;  3LP1 A;  5C25 A;  3JSM A;  3WNG A;  3S3N A;  1Q8I A;  5KGX A;  1J9A A;  5HP1 A;  2HNY A;  2P5G A;  1T8E A;  4DTM A;  1RTH A;  4LSN A;  4Z4H A;  4UQG A;  2XY5 A;  4Z4F A;  2HHT A;  4KRE A;  3HJF A;  5KRT A;  1EX4 A;  1WLJ A;  5K14 A;  3VQQ A;  3PO4 A;  3G10 A;  3HT3 A;  3OYD A;  3ZCM A;  4B9L A;  4Z4C A;  3OYB A;  1JLG A;  3LPU A;  4DSF A;  4CGJ A;  5HLF A;  4CEB A;  4M41 A;  1C6V A;  4KTQ A;  3OYL A;  3EYZ A;  4CGD A;  4DQI A;  3VQP A;  2HVH A;  1VSI A;  3K5O A;  4J2A A;  1NK7 A;  4IBN A;  3OJS A;  4DQQ A;  1LW0 A;  2ZQB A;  4HUF A;  3SQ1 A;  4J2D A;  3AVI A;  4KV8 A;  1TGO A;  3K2P A;  2D0A A;  5C42 A;  3KD1 E;  2RKI A;  3RR8 A;  1HPZ A;  3SCX A;  2E6L A;  1C0U A;  1HQE A;  3SUQ A;  1BCM A;  4RW6 A;  4FK4 A;  3HP9 A;  1W9H A;  2KQ2 A;  1BIS A;  2YNG A;  4BWM A;  4O4G A;  3ZT3 A;  1NOZ A;  3QLH A;  4NYF A;  4LY7 A;  1B9D A;  2RN2 A;  3I0R A;  4M3R A;  1SL2 A;  5KTQ A;  2YHA A;  3AVB A;  1TKX A;  3OYE A;  1FKP A;  4G1Q A;  1RCH A;  1NKC A;  4E7H A;  3T19 A;  5CZ2 A;  3OYI A;  3ULD A;  4B08 A;  4E89 A;  3QNO A;  2OPP A;  4FZZ A;  4E3S A;  2ITG A;  3MXI A;  3HVT A;  3AO3 A;  1RDB A;  1WSG A;  4FJN A;  4CEC A;  4ZTF A;  1N6Q A;  3EZ5 A;  3KK1 A;  3RMC A;  5D3G A;  3B6O A;  3NGI A;  1TKT A;  4KHQ A;  4B9M A;  5J2N A;  1U04 A;  3P83 D;  3QEV A;  1GOA A;  1A5X A;  4CF2 A;  1BHL A;  1L3T A;  4DU1 A;  3HPO A;  1HJR A;  3HXM A;  1RBT A;  2Z1I A;  4O0I A;  3VQ4 A;  4DLG A;  4W5T A;  3CYM A;  3NF6 A;  1LV5 A;  1JXE A;  1SL1 A;  4HHT A;  1EP4 A;  1RTD A;  4M3T A;  3P1G A;  4N56 A;  3T3F A;  4B9V A;  4FW1 A;  5E41 A;  3OYG A;  1RT2 A;  3ZSO A;  4B9U A;  2W42 A;  3CQ8 A;  4WE1 A;  3IS9 A;  1RBV A;  3QEW A;  3RMD A;  4B9S A;  4DWI A;  5J1E A;  4L8R B;  4N41 A;  4M3X A;  4OLA A;  1HYS A;  5KI6 A;  4Y1D A;  5FRN A;  3SJJ A;  3FFI A;  3QIO A;  2OPS A;  1EXQ A;  4FJI A;  2G8I A;  1RT1 A;  1ITG A;  3NE6 A;  3SYZ A;  3QEI A;  2HVI A;  4M3W A;  3K59 A;  3VQB A;  4CEZ A;  1KLN A;  3KK3 A;  4RW4 A;  3DRP A;  1ASU A;  3NF7 A;  3HVR A;  3V9X A;  1BGX T;  3KLG A;  4ICL A;  1ZBF A;  3AO2 A;  4DU3 A;  1NJY A;  3IAY A;  1QTM A;  3L2R A;  1UWB A;  2XRI A;  4IFV A;  1QQC A;  4KHN A;  3LZI A;  4JLH A;  3VA0 A;  4OJR A;  4OGE A;  3NBP A;  4M3U A;  1VSL A;  5JS1 A;  4JRQ A;  1NJW A;  2P51 A;  5KRS A;  4M3Z A;  1JL1 A;  4ZTJ A;  1NJX A;  1KVA A;  1LWE A;  1U47 A;  1S1V A;  4FLZ A;  3SQ4 A;  4I9Q A;  1KTQ A;  3ASM A;  2P1J A;  3TAG A;  3DOK A;  1BIU A;  1U4B A;  1RBS A;  4KHS A;  1TK8 A;  2P5O A;  4HVJ A;  4CED A;  4LH5 A;  3NDK A;  3AV9 A;  1REV A;  4PQU A;  2DFH A;  4DQP A;  3AVK A;  3AO4 A;  1G15 A;  4CJR A;  1C1C A;  2AJQ A;  5KGW A;  4PUO A;  4DU4 A;  4OPJ A;  2O4G A;  3OYH A;  4O0J A;  4CF9 A;  3AVA A;  5CY4 A;  3M8R A;  2FBV A;  4PWD A;  1S5J A;  1C0M A;  4AHU A;  4W5R A;  4DF8 A;  3QNN A;  5HRO A;  1TKD A;  3F73 A;  4HUG A;  3IRX A;  1LWC A;  4CJU A;  3ZT2 A;  3LAK A;  3HPG A;  3VQE A;  4CIE A;  2E6M A;  3K57 A;  2RPI A;  3TWH A;  4NCA A;  4OLB A;  4B3O A;  1RT4 A;  4QCL A;  3SQ2 A;  3VN5 A;  4EP5 A;  3KKR A;  2YNF A;  2HMI A;  3TAR A;  1TVR A;  3L3V A;  4AHC A;  3SPZ A;  1T05 A;  2RF2 A;  4DTO A;  3ZSQ A;  2G8F A;  1RT7 A;  2YKN A;  1D5A A;  1QE1 A;  4FM1 A;  3RRG A;  3AVC A;  4KTW A;  3V1O A;  2G8V A;  2Q3S A;  4DLE A;  4CGI A;  4K8X A;  1A5V A;  4F4K A;  1TL1 A;  2Z1J A;  3DLE A;  1XI1 A;  2DFE A;  3S3O A;  1QHT A;  4CJT A;  4CES A;  1RTI A;  4MFB A;  2BGG A;  4OKJ A;  3VA3 A;  1LAV A;  3TI0 A;  1NK9 A;  3PX6 A;  4RW9 A;  1J54 A;  1J5O A;  1KSP A;  4CEA A;  4OPK A;  4K8Z A;  1VSM A;  3KLH A;  2D5R A;  3RWU A;  4KAZ A;  2HHU A;  1HYZ A;  3NFA A;  1HNV A;  4CFB A;  3DOL A;  4DG1 A;  3ZSW A;  4DFM A;  3MAQ A;  4FK0 A;  3KIO A;  2EX3 A;  5SZT A;  3LZJ A;  3SI6 A;  4CK2 A;  2HHQ A;  1LWF A;  4KFB A;  1VSK A;  5HRP A;  1KRP A;  1RT6 A;  3K5N A;  1SKR A;  1B9F A;  1QSS A;  3HP6 A;  2HHS A;  1JKH A;  3NHG A;  4E7J A;  3V6D A;  1JXB A;  3DLB A;  4BDP A;  1JLE A;  3LP2 A;  1Z25 A;  3OYA A;  4FLX A;  4W5N A;  5DK5 A;  4KKO A;  4IFY A;  4BE2 A;  2O4I A;  3CFR A;  3PX0 A;  5I3U A;  1NK6 A;  3MEG A;  3DYA A;  3OJU A;  2Y1J A;  4DSL A;  3A2F A;  3AA5 X;  3TAF A;  3AO5 A;  3D45 A;  4DTS A;  2QKK A;  3QIP A;  2HNZ A;  3NGY A;  4I9L A;  4I2P A;  2XY6 A;  1YVU A;  1EKE A;  3MED A;  5EU7 A;  4LD0 A;  3TAM A;  4FJ7 A;  1D9F A;  4FCY A;  2FC0 A;  3NCI A;  3LAN A;  1BQM A;  3VQ8 A;  1CLQ A;  1TAU A;  4CIG A;  2VG6 A;  1VSJ A;  5HRR A;  3TR8 A;  4DFK A;  1Y97 A;  3BDP A;  3PV8 A;  3V1R A;  4QOZ B;  4OGC A;  3OS1 A;  1JLA A;  4Z4E A;  3DLH A;  3VQ6 A;  2FBX A;  3AVF A;  5HRN A;  3VQ5 A;  4KHW A;  3ZT4 A;  3LDS A;  1C1A A;  4CJ5 A;  4CJV A;  3SZ2 A;  2QXF A;  3S3M A;  3NH2 A;  2YKM A;  4IG3 A;  3MXM A;  4EZ6 A;  2VG5 A;  3NH1 A;  3OVN A;  3AVH A;  3ZT1 A;  4DTJ A;  3TAQ A;  1SKS A;  3OYM A;  2HND A;  3KLI A;  1L3V A;  4FJ8 A;  3ZSV A;  1IKV A;  3AVJ A;  3V9Z A;  4N76 A;  1RNH A;  5I42 A;  4J2E A;  2GUI A;  3TAE A;  3C6U A;  4IDK A;  4CHQ A;  2KFN A;  2YHB A;  1WSH A;  1NK0 A;  5CYQ A;  4E7K A;  4CF0 A;  4FJK A;  4KRF A;  4CIF A;  2HHW A;  4CJF A;  1S1W A;  2KZZ A;  1RDA A;  4CHN A;  1B92 A;  4PY5 A;  2A1R A;  1XHZ A;  4C8N A;  1HNI A;  3P5J A;  4Z4G A;  1VK0 A;  4ID1 A;  4CF1 A;  4C8M A;  4GVM A;  4FJ5 A;  3DMJ A;  4FLU A;  3I0S A;  1NK8 A;  4F3O A;  3ZSY A;  1UOC A;  2IC3 A;  4M42 A;  2WOM A;  4I2Q A;  3HM9 A;  3ZSR A;  4DFJ A;  3CM6 A;  4KI6 A;  4KHU A;  4FJH A;  4CJW A;  1RDD A;  4FYD A;  3ZSZ A;  2ETJ A;  3AA2 A;  2R7Y A;  2A1S A;  3DRR A;  1L3U A;  4B8C A;  4B9T A;  4DQS A;  1WSJ A;  3HL8 A;  1C0T A;  4AHV A;  4ELV A;  4H4M A;  3C94 A;  3RMA A;  4N47 A;  1KFD A;  3PUF A;  2F96 A;  1U48 A;  2NUB A;  1QS4 A;  3AVG A;  1WNS A;  1TK5 A;  4DTR A;  1YTA A;  3OS2 A;  4BE1 A;  1NKE A;  4W5O A;  4CE9 A;  4FJM A;  3V4I A;  1XHX A;  2DFF A;  2X6N A;  3AVL A;  4DFP A;  3OYJ A;  3TAN A;  3VQD A;  2B5J A;  3OY9 A;  3OYN A;  3THV A;  2VG7 A;  4KTZ A;  3JYT A;  1BI4 B;  1X9M A;  3PO5 A;  2IDO A;  4CGG A;  3ZSX A;  4F2S A;  4Z4I A;  1ZBI A;  3QO9 A;  4ID5 A;  2Z1H A;  4FJG A;  1RDC A;  3HYF A;  4QAG A;  2FBT A;  5J2M A;  1L5U A;  4C8O A;  3SUO A;  4HCC A;  3M8S A;  2G8H A;  1UA1 A;  1U49 A;  2Z1G A;  3LWL A;  5FRO A;  3K5L A;  4OKE A;  3K5M A;  4BDZ A;  4ELU A;  3VQA A;  4Q0B A;  3TAP A;  1JLC A;  4BDY A;  2XHB A;  3L2V A;  3LP0 A;  2GBZ A;  4CGH A;  3K58 A;  1FK9 A;  3C6T A;  3U3G A;  4F8R A;  3SV4 A;  3EY1 A;  2QK9 A;  4LH4 A;  4M3Y A;  3KK2 A;  2KZM A;  1S6P A;  4DS4 A;  3U3Y A;  3RTV A;  2BDP A;  1VSF A;  2G8U A;  2YV0 X;  1KCF A;  3KTQ A;  2X6S A;  2ATQ A;  4FK2 A;  1LW2 A;  4CJP A;  4C8K A;  2OPQ A;  4JRP A;  3O3H A;  3E01 A;  1Z26 A;  3ZT0 A;  2YNH A;  1BI4 A;  4FLY A;  3HK2 A;  1IKX A;  2F8T A;  3H08 A;  3O4N A;  4W5Q A;  3HO1 A;  1BCO A;  3V9W A;  4YNQ A;  4CJ3 A;  2B4J A;  4XIU A;  1ASV A;  2GV9 A;  3RR7 A;  2HHX A;  1S9G A;  4O5B A;  3HST B;  1UA0 A;  2ZE2 A;  1Q9Y A;  3MEE A;  1MU2 A;  3M8Q A;  5HBM A;  1RT5 A;  4E0D A;  1VSD A;  1JLQ A;  4HUE A;  1QSY A;  3WNE A;  1D9D A;  3TAB A;  4DSJ A;  3AA4 A;  3V9U A;  2F8S A;  3OYC A;  1I39 A;  4FZX C;  3VQC A;  1WAF A;  1ASW A;  4HTU A;  2B6A A;  3WNF A;  4KPY A;  4DSK A;  4EP4 A;  4CK1 A;  4FM2 A;  1QSL A;  1T7P A;  2FBY A;  4CEE A;  3C95 A;  1KLM A;  3UIQ A;  1ZBH A;  3L8B A;  2D0C A;  4Z0U A;  2JLE A;  4IKF A;  1CXQ A;  3RRH A;  1HMV A;  5FDL A;  4CEQ A;  3VQ9 A;  4CFC A;  4AHS A;  3QEX A;  1S1U A;  2DTU A;  3G0Z A;  3HPH A;  3V81 A;  3O3G A;  4FJX A;  3V9S A;  4E1N A;  3M8P A;  3NF9 A;  4CJS A;  1S1T A;  4E1M A;  3MEC A;  2OZS A;  1J53 A;  3BGR A;  3B6P A;  4CGF A;  1S9E A;  5JS2 A;  5J2P A;  3OYK A;  4FLV A;  1SV5 A;  4FLT A;  2KW4 A;  3F9K A;  1SUQ A;  4H8K A;  4E19 A;  1JLB A;  3CG7 A;  3IG1 A;  1L3S A;  1S6Q A;  5FRM A;  2X74 A;  1YTU A;  4FLW A; 
#chains in the Genus database with same CATH topology
 4O44 A;  4B1Z A;  1K8K B;  5BN8 A;  4HCB A;  4JKD A;  3SAH A;  1NK4 A;  2P9L A;  2Q31 A;  4EIA A;  1H1V A;  3KLF A;  3BUZ B;  3KHY A;  4DTX A;  1XWL A;  4CEF A;  3QET A;  3C6H A;  3OS0 A;  3SQ0 A;  2BUP A;  2OZM A;  4DR5 K;  2PAV A;  3VQ7 A;  4H0Y B;  3WEE B;  2OTJ N;  3LDP A;  5HRS A;  4LF8 K;  1K8A O;  3M1F A;  1SKW A;  5SWM A;  1C1B A;  4H4O A;  4B1Y B;  3QIN A;  1RIL A;  1TKZ A;  2E2N A;  1IH7 A;  4CHO A;  3QER A;  2Y1I A;  3SPY A;  1DKG D;  1BIZ A;  4JI8 K;  4DR6 K;  2QWP A;  4DSE A;  1Q82 O;  1NNE A;  4H0X B;  4E1J A;  4H5W A;  4X62 K;  2IVO A;  4I6M A;  3QEP A;  2PFU A;  1N34 K;  2HBJ A;  4BR7 A;  4BWJ A;  4GV3 A;  1WOQ A;  2VQE K;  4C8L A;  4DR4 K;  4JS5 A;  3THY A;  4BR4 A;  3L2W A;  1RT3 A;  1X1P A;  2BE2 A;  2YNI A;  3O4W A;  1HRH A;  4WF9 L;  1VRU A;  5AQU A;  3P39 A;  4CHY A;  4DF4 A;  4MQ3 A;  4MDA A;  1DTT A;  1CZB A;  1HYV A;  4CHP A;  4AM7 A;  2OYQ A;  2WFB A;  3BP8 A;  1NOY A;  3DI6 A;  3PLA A;  3K0S A;  1RBU A;  2XO7 A;  3HZ6 A;  3H45 C;  1TL3 A;  3HTV A;  3D0P A;  1DEJ A;  3CFP A;  4FJL A;  3QDK A;  4KB0 A;  4GV6 A;  1XNQ K;  3DRS A;  3ZEU B;  2VWK A;  2X78 A;  4QS9 A;  3VGK A;  1KXP A;  3L2Q A;  3RSE B;  3U9D A;  4AHR A;  3ALY A;  4BRO A;  1LCU A;  2YHY A;  4CEO A;  3NGZ A;  4CVN E;  1W97 L;  3S3N A;  3OBW A;  4DTM A;  4YDU A;  4AM6 A;  4UQG A;  2A6A A;  3VEV A;  3HJF A;  1NGG A;  3VQQ A;  3G10 A;  4GV9 A;  4Z4C A;  3THX A;  1TYQ B;  3LPU A;  1IV0 A;  5HLF A;  4M41 A;  1C6V A;  2KHO A;  2CGL A;  3EYZ A;  4DQI A;  2NNW A;  4J2A A;  3K5O A;  2NRW A;  4IBN A;  3OJS A;  3OBY A;  1TGO A;  3SBG A;  4LF9 K;  4CZG A;  1ILY A;  3U4L A;  3D7E O;  1G99 A;  1Q18 A;  3G6E N;  2V7Z A;  2KQ2 A;  1BIS A;  1NOZ A;  3QLH A;  3J7A P;  1VHX A;  1TKX A;  1FKP A;  1RCH A;  1NGF A;  4DCH A;  4B3M K;  4E3S A;  3MK6 A;  1RDB A;  1WSG A;  4FJN A;  4ZTF A;  3MCA B;  5AZI B;  2E20 A;  3RMC A;  1U04 A;  3H1V X;  3BF3 A;  1BHL A;  1RBT A;  5BPN A;  4DLG A;  2A40 A;  3NF6 A;  4IFE A;  4WFB L;  4E0D A;  4DSI A;  3ZSO A;  4WE1 A;  4BC3 A;  1GLJ O;  1RBV A;  4DWI A;  4L8R B;  2O8E B;  2UUB K;  3BF1 A;  1NM1 A;  3TSU A;  3K59 A;  2Q1N A;  3DRP A;  3V9X A;  5E26 A;  1NJY A;  3KLG A;  5BR8 K;  1ZBF A;  1ATN A;  3L2R A;  4IFV A;  3LZI A;  1YHQ N;  3UKR A;  4CZJ A;  4BRK A;  4H5V A;  2KKZ A;  1OH8 A;  4M3U A;  1VSL A;  5JS1 A;  2P51 A;  5KRS A;  4M3Z A;  2GWK A;  4ZTJ A;  1U47 A;  5EY4 A;  3D2E A;  5M1K A;  3TAG A;  1I94 K;  1RBS A;  3ENB A;  4A61 A;  1TK8 A;  2P5O A;  3D2F A;  4KHS A;  3QIC A;  3AV9 A;  3CCQ N;  3AVK A;  3SK3 A;  1C1C A;  1U2V B;  2P9N B;  3A5O C;  3FZK A;  4O8U A;  3O9Q A;  3LL3 A;  4QS7 A;  5M1P A;  3M8R A;  3FE1 A;  5AQF A;  4W5R A;  4HTL A;  4DF8 A;  4CW7 B;  1TKD A;  1VQ4 N;  4CJU A;  3ZT2 A;  4B1W B;  3VQE A;  4NCA A;  2RPI A;  3O6W A;  3SQ2 A;  4FPA A;  5BPL A;  4EP5 A;  3L3V A;  3CPW M;  5A2Q O;  1D5A A;  2G8V A;  4DLE A;  4F4K A;  1NGJ A;  3DLE A;  5AQW A;  5AR0 A;  1XI1 A;  2IVP A;  4OX9 K;  4WFN L;  3W0L A;  4BR2 A;  1RTI A;  3A5L C;  3P38 A;  3U9Z A;  1LAV A;  2HST A;  2YX6 A;  1XC3 A;  2E1Z A;  1BU6 O;  2HHU A;  1HYZ A;  3NFA A;  3CPE A;  3DOL A;  1EWQ A;  5SZT A;  4CK2 A;  2P9K B;  1LWF A;  1TUY A;  3K5N A;  4BRF A;  2HHS A;  1JXB A;  2CGK A;  4GNI A;  2F4V K;  3LP2 A;  4H0V B;  4B1X B;  1N33 K;  5DK5 A;  4IFY A;  4M7X A;  3TU5 A;  4C1N K;  1HJO A;  4DSL A;  3CIP A;  3A2F A;  3AA5 X;  1VQO N;  4B3R K;  1E4G T;  3D45 A;  4DTS A;  2HNZ A;  4JD2 A;  1D9F A;  2FC0 A;  3VQ8 A;  4DUY K;  1CLQ A;  4CIG A;  4A2B A;  4DFK A;  1Y97 A;  5JLF A;  4FO0 A;  3PV8 A;  2FLO A;  1T6D A;  2FBX A;  1BA0 A;  1NG9 A;  3VQ5 A;  5AZJ A;  3ZT4 A;  4K43 A;  3PIO L;  3SZ2 A;  4DV3 K;  2YKM A;  3MXM A;  5AQJ A;  2NLX A;  3L4Q A;  4I6M B;  3BEX A;  1RNH A;  4BVP A;  5B8H A;  1SS6 A;  1NK0 A;  1GLL O;  4CIF A;  5C2F A;  2KZZ A;  3B8A X;  4BRN A;  4CHN A;  3THY B;  4PY5 A;  2A1R A;  1XHZ A;  4YOW A;  4C8N A;  4JV5 K;  1VK0 A;  4ID1 A;  2WUS A;  3CJB A;  4CF1 A;  4CI6 A;  2YCH A;  4GVM A;  1KAZ A;  2E2Q A;  3R6M A;  4FLU A;  1N32 K;  1IBM K;  1GLE G;  4I2Q A;  1XMO K;  3ZSR A;  1Q7Y O;  1MDU B;  4JI3 K;  4FYD A;  2DPN A;  4Y0W A;  3THW A;  3AA2 A;  5GAH P;  2R7Y A;  3EKU A;  2W6L A;  2O8C A;  2HBK A;  4ELV A;  1YAG A;  4DHY A;  4LF6 K;  1SZ2 A;  1U48 A;  1QS4 A;  4DTR A;  3VEZ A;  1NKE A;  3FZM A;  4WQ4 A;  3UKU A;  5BRH A;  4EFH A;  1X3N A;  4OPA A;  3OY9 A;  3C65 A;  3PO5 A;  2VG7 A;  4KTZ A;  3JYT A;  4Z4I A;  3FZH A;  4IJA A;  4C8O A;  3SUO A;  2VYP A;  2G8H A;  3CC2 N;  4ELU A;  2QWL A;  3VQA A;  4BDY A;  3WXM B;  3LP0 A;  3K58 A;  3C6T A;  3GDQ A;  1ZXO A;  2W41 A;  3T69 A;  3THX B;  5AQM A;  3RTV A;  3ID6 A;  4FK2 A;  1J5E K;  4C8K A;  4JRP A;  3O3H A;  3E01 A;  3ZT0 A;  3AGK A;  4FLY A;  2F8T A;  3H08 A;  2E1Y A;  4YNQ A;  4XIU A;  5EXW A;  1E3M A;  2HHX A;  1O13 A;  3MEE A;  1IBL K;  2Q0R A;  4GKJ K;  4HUE A;  3EN9 A;  4JK7 A;  4R79 A;  2GEL A;  2A3Z A;  4LF4 K;  1I39 A;  4KPY A;  3CCR N;  4CK1 A;  1KLM A;  1ZBH A;  3CMA N;  4DB3 A;  3L8B A;  2JLE A;  4IKF A;  3RRH A;  3VQ9 A;  4B3S K;  4E1M A;  2OZS A;  3FZL A;  3BGR A;  3B6P A;  1S9E A;  2QW9 A;  5CR4 A;  1SUQ A;  2ITM A;  4MLE A;  2X74 A;  1RDW X;  4FLW A;  3U6F A;  1T6C A;  2BAN A;  3CXC M;  2NRT A;  1F21 A;  1ZBS A;  3DM2 A;  4NCG A;  1NKB A;  3LAL A;  1FKO A;  3CFO A;  1I3A A;  1ESV A;  3I8D A;  1A5W A;  3SJH A;  4DV1 K;  4DTN A;  2HBL A;  3DXK A;  4JI6 K;  3VGM A;  2HB5 A;  2JGU A;  3AVM A;  5BN9 A;  4CK3 A;  2PYL A;  1R0A A;  3F2K A;  4BRG A;  4OVL A;  4A57 A;  3NVK A;  4GW6 A;  1WSF A;  3WNH A;  2UXC K;  3JXU A;  4FW2 A;  1HX1 A;  2KTQ A;  2J4R A;  3I8B A;  1JL2 A;  2O8F B;  2IS3 A;  4ELT A;  1QQN A;  5GIN A;  3CER A;  3ISN C;  3SUN A;  3H1Q A;  3D2E B;  3TTF A;  2F7T A;  4CJK A;  4B9N A;  2KFZ A;  1CZA N;  4B8A B;  3D2F B;  4DQR A;  1SL0 A;  3ID8 A;  2G8W A;  4BR0 A;  2ZD1 A;  5JVH L;  3WT0 A;  2IGI A;  3AA3 A;  1E4F T;  1OH5 A;  1ZBL A;  4DKW A;  3CJ9 A;  1NMN A;  3H3N O;  4CFA A;  1WN7 A;  1VSH A;  5CYM A;  3O9S A;  4KBO A;  5FPE A;  4GMJ B;  1SQK A;  3LWM A;  3V1Q A;  3H3O B;  3NAE A;  2I5J A;  1V4S A;  3MCP A;  3LAM A;  4JYA K;  4LC9 B;  3C0B A;  4KO0 A;  4O55 A;  5JLH A;  1CXU A;  1TV6 A;  3O3F A;  1WSE A;  1IO2 A;  1VQN N;  4DMN A;  4R5P A;  3T1H K;  4BVO A;  3SNN A;  1KVC A;  4AQY K;  4DTU A;  1S1X A;  5GIP A;  3CCU N;  3WUH A;  4J2B A;  1ZBU A;  1WAJ A;  3RMB A;  1JCE A;  3JSM A;  3GL1 A;  2P5G A;  1BUP A;  1RTH A;  4Z4H A;  4Z4F A;  4KRE A;  5K14 A;  4BRH A;  3PO4 A;  4DR7 K;  2P9U A;  4DSF A;  1V4T A;  2UU9 K;  4FWQ A;  1BOT O;  4DV4 K;  3J81 O;  4FWL A;  4JD2 B;  5KQD A;  2ZQB A;  4J2D A;  3AVI A;  4KV8 A;  4H5T A;  4H5N A;  5C2D A;  5C42 A;  4K42 A;  2RKI A;  3CJC A;  2E6L A;  1HQE A;  4RW6 A;  4BC5 A;  3H46 O;  1KAY A;  5AZJ B;  4CZM A;  4BWM A;  3ZT3 A;  4LY7 A;  2RN2 A;  1ATR A;  5KTQ A;  1YJN N;  4YY3 K;  4G1Q A;  1DT9 A;  1EQY A;  5EOY A;  3ULD A;  4E89 A;  3OW2 M;  3WXJ A;  3MXI A;  3ENO A;  3CF5 L;  3R8E A;  5FLX O;  1N6Q A;  3EZ5 A;  5D3G A;  3VEW A;  3NGI A;  1TKT A;  3P83 D;  2GX9 A;  3L4I A;  4A5B A;  4CF2 A;  3E1Y A;  4YDU C;  3L6Q A;  5DM6 L;  2VGM A;  5GIO A;  3CYM A;  1LV5 A;  1SL1 A;  3THW B;  3KWI A;  4XH1 A;  2QM1 A;  1HUX A;  3CCS N;  2O8C B;  3OYG A;  4F3T A;  2W42 A;  3CQ8 A;  1OVQ A;  3IS9 A;  4PHT X;  1HYS A;  3VF2 A;  4CBX A;  4N41 A;  4M3X A;  1FJG K;  3SJJ A;  3QIO A;  4FJI A;  4BGB A;  4X65 K;  3VTI A;  4IEI A;  4M3W A;  4J8F A;  4CEZ A;  1NGD A;  4DU3 A;  3AO2 A;  3IAY A;  1QTM A;  4FWN A;  4KHN A;  4JLH A;  3VA0 A;  4BRP A;  1NJW A;  2HHH K;  1JL1 A;  1NJX A;  1KVA A;  1LWE A;  2Q36 A;  4B1V A;  4I9Q A;  3ASM A;  1QVG M;  4WCE L;  5FPD A;  4CED A;  3CJ7 A;  4PQU A;  4FOE A;  1G15 A;  2AJQ A;  2AA4 A;  2NRR A;  2ASO A;  4OPJ A;  3OYH A;  1XNR K;  4LFA K;  2CH6 A;  5MLC Q;  2AP1 A;  1W2B M;  4PWD A;  1C0M A;  3QNN A;  4Z94 A;  5HRO A;  3TTC A;  4FOI A;  3F73 A;  3CQY A;  3IRX A;  3HPG A;  4CIE A;  3TWH A;  2E6M A;  4OLB A;  2E8A A;  3VN5 A;  3GE1 A;  1TVR A;  4AHC A;  1QVF M;  4DTO A;  1RT7 A;  2YKN A;  1QE1 A;  2VWB A;  4FM1 A;  3MX2 A;  2Q97 A;  3C6A A;  5M1Q A;  2Q3S A;  1GLB G;  1TL1 A;  2DFE A;  2FXU A;  3A8Y A;  3CI5 A;  4CES A;  2YHW A;  2BGG A;  3VES A;  1NK9 A;  3PX6 A;  4RW9 A;  1J5O A;  4CEA A;  4KAZ A;  4B9Q A;  4YOU A;  4C1N I;  3MAQ A;  3DLL L;  2EX3 A;  4PKG A;  3LZJ A;  4KFB A;  1VSK A;  1NU0 A;  3HP6 A;  3V6D A;  4G9Z A;  1JLE A;  4W5N A;  2O4I A;  4DR3 K;  1VQP N;  3O9U A;  4U7B A;  1LOT B;  4OO1 J;  1NMD A;  3QIP A;  4I9L A;  4CZF A;  3O1W A;  1YVU A;  1EKE A;  3MED A;  5EU7 A;  4FJ7 A;  1DGK N;  3EEQ A;  2VG6 A;  3HSC A;  5IWA K;  1VQL N;  3V1R A;  4OGC A;  2I7N A;  3OS1 A;  1JLA A;  4Z4E A;  3LM9 A;  3VQ6 A;  3CCM N;  3LDS A;  1C1A A;  4ISE A;  4CJV A;  2QXF A;  4IWV A;  3S3M A;  3NH2 A;  5ADX H;  3AAP A;  2CH5 A;  3TAQ A;  4L3Q A;  3OYM A;  5ADX A;  3MDQ A;  3ZSV A;  1IKV A;  3AVJ A;  5I42 A;  4J2E A;  2GUI A;  3C6U A;  3MN9 A;  3AAR A;  4FJK A;  3CD6 N;  2HHW A;  4CJF A;  1S1W A;  4BRL A;  4Z4G A;  2NRV A;  4IZ9 A;  4F3O A;  3QFU A;  1UOC A;  3FZF A;  2WOM A;  3HM9 A;  4KI6 A;  4KHU A;  4FJH A;  3C7N A;  4CD1 A;  2QWM A;  1YF5 L;  3ZSZ A;  4BRQ A;  4B8C A;  4B9T A;  4DQS A;  2HF4 A;  2ZJP L;  4H4M A;  2QEX N;  1IG8 A;  4XH5 A;  3PUF A;  3AVG A;  1WNS A;  4KHP K;  4W5O A;  1VQ9 N;  4FJM A;  3V4I A;  3LDQ A;  4XEI A;  4CZE A;  3HRG A;  4IEE A;  3OYJ A;  4DFP A;  3HI0 A;  3OYN A;  1MWK A;  1NGB A;  4F2S A;  3UE5 A;  3ZSX A;  1ZBI A;  4ID5 A;  2Z1H A;  1OH7 A;  1RDC A;  2QXL A;  4HCC A;  3M8S A;  1UA1 A;  1U49 A;  3K5L A;  4BDZ A;  3TAP A;  1JLC A;  4CD3 A;  4NLC A;  3L2V A;  2GBZ A;  4F8R A;  4U67 L;  4LH4 A;  2KZM A;  3CQX A;  4DS4 A;  3ATV A;  3VEX A;  1EWR A;  2PBD A;  1Z26 A;  1BI4 A;  1IKX A;  3HO1 A;  1BCO A;  3LDL A;  3VF6 A;  4ILG B;  4BRI A;  1S9G A;  3HST B;  2ZE2 A;  3M8Q A;  5LJV A;  1VSD A;  1JCF A;  4X64 K;  1JLQ A;  1MWM A;  1QSY A;  1D9D A;  3TAB A;  5KPZ A;  3V9U A;  2F8S A;  3Q7C A;  3DWL A;  4WQ4 C;  1T7P A;  4FM2 A;  4NXN K;  4IDH A;  3CHW A;  3C95 A;  2P9L B;  3VOV A;  1CXQ A;  2QA4 N;  4CEQ A;  5BPM A;  3QEX A;  2DTU A;  3V81 A;  3O3G A;  4FJX A;  3V9S A;  4C23 A;  3MEC A;  4CGF A;  3KWG A;  4IOA L;  4E19 A;  4JNE A;  1JLB A;  1YTU A;  4Y1D A;  1S6Q A;  4FWP A;  4RW7 A;  1NK5 A;  3MWT A;  5AQN A;  1BL3 A;  1JLF A;  3L3U A;  3N4P A;  1DTQ A;  1GOB A;  3S9H A;  4EZ9 A;  1HKG A;  2QKB A;  5AQT A;  3U8X A;  3G25 A;  4CF8 A;  4DS5 A;  1WSI A;  2PY5 A;  1TAQ A;  1JCG A;  1OKJ A;  3MN6 A;  5E84 A;  4CJE A;  4ZHR A;  5DMR A;  3ZX0 A;  1HNZ K;  5CZ1 A;  4E7L A;  1KFS A;  4CJQ A;  1WBB A;  1P8Z A;  5BRD A;  4RWT A;  4M45 A;  2V7Y A;  3O08 A;  4KH5 A;  3T1A A;  3GOI A;  3LPT A;  1IKY A;  1X9W A;  1IKW A;  3L2U A;  4JKH A;  3P4I A;  2OPR A;  1IG9 A;  4HWI A;  2D1K A;  1WB9 A;  1U6Z A;  1VRT A;  2JWK A;  4Y1C A;  1K6Y A;  1WUA A;  4KH4 A;  4PL7 A;  2PZS A;  4BRM A;  2EHG A;  3IKM A;  3OYF A;  1U45 A;  4FJJ A;  4KB1 A;  3PY8 A;  2E88 A;  4BGA A;  1Q9X A;  1BQN A;  1DLO A;  3VET A;  2G8K A;  5J2Q A;  1YT3 A;  4MO5 A;  1RGI A;  4KH6 A;  3DLR A;  1RBR A;  1VAZ A;  3A5M C;  4PA1 A;  4CHZ A;  4YOY A;  4IO9 L;  3ITH A;  4K41 A;  4FZY A;  1RDU A;  2HMP A;  1YJ9 N;  1HNX K;  3CCJ N;  3SMS A;  4Q5V A;  3T1Y K;  2GUP A;  4RG8 A;  3I33 A;  4DTP A;  3MX5 A;  3LP3 A;  1EET A;  3NH0 A;  2IIR A;  4PKI A;  3KD5 E;  1O1W A;  3LM2 A;  4FVM A;  4LSL A;  3HOS A;  1VQ6 N;  1ZYQ A;  4NCB A;  4JKB A;  3ZX3 A;  1S3X A;  5KPT A;  3PSF A;  2P9I A;  3AO1 A;  1W0H A;  5C24 A;  4DQ8 A;  3IDH A;  1N5Y A;  4IG0 A;  3LP1 A;  4IO8 A;  3WNG A;  1Q8I A;  5KGX A;  1J9A A;  5HP1 A;  2HNY A;  1T3V A;  4JI4 K;  1T8E A;  5ELZ A;  1WBD A;  2NZT A;  3ULE A;  1S22 A;  5KRT A;  3HT3 A;  3OYD A;  3OYB A;  4YOX A;  1BG3 A;  4KTQ A;  3EE9 A;  3N4Q A;  3E9L A;  4FL9 A;  5AQO A;  3LDO A;  1NK7 A;  4DQQ A;  1LW0 A;  4HUF A;  2YJE A;  3K2P A;  3RR8 A;  2UXD K;  3SCX A;  4FWM A;  3O8M A;  3SUQ A;  1BCM A;  1IJJ A;  1W9H A;  2E2P A;  4O4G A;  4NYF A;  5FPM A;  3R9P A;  1B9D A;  4FPB A;  2YHA A;  1Q86 O;  2O8B A;  1NKC A;  1HNW K;  4DV5 K;  3QNO A;  4FZZ A;  2OPP A;  3HVT A;  3AO3 A;  3VEY A;  5C0Y A;  2A41 A;  1GLC G;  4B9M A;  5J2N A;  1C0F A;  1L3T A;  1HJR A;  2FSJ A;  3HXM A;  4BR5 A;  4FSV A;  4W5T A;  3C7N B;  1YXQ A;  3UKR B;  5LMN K;  1EP4 A;  1RTD A;  4M3T A;  4LF5 K;  4N56 A;  4B9V A;  4FW1 A;  4B9U A;  3ZLJ A;  5JMV A;  4B9S A;  2HF3 A;  3TSQ A;  4OLA A;  1QHA A;  5KI6 A;  5FRN A;  1HKC A;  3FFI A;  2OPS A;  5AZI A;  1RT1 A;  3WQT A;  3NMU A;  3SYZ A;  5GAD P;  2HVI A;  3S41 A;  4EHT A;  2YI1 A;  4CBU A;  1KLN A;  1QZ5 A;  3E66 A;  1ASU A;  3T7Z A;  3NF7 A;  2GWJ A;  1BGX T;  4ICL A;  2E2O A;  1GLD G;  2XRI A;  3F5T A;  1D4X A;  3CC7 N;  2JWL A;  1YJW N;  4JRQ A;  3WXI A;  2GEM A;  5FPN A;  2A42 A;  3DOK A;  1BIU A;  2O8E A;  4HVJ A;  4LH5 A;  4DQP A;  5F1X A;  4BG9 A;  5KGW A;  4PUO A;  3WXK A;  4DU4 A;  1GLF O;  2WC9 A;  3ZET A;  1NLV A;  3PSI A;  1J6Z A;  3MN7 A;  4O0J A;  4CF9 A;  3AVA A;  3FLC O;  5CY4 A;  1S5J A;  4JKE A;  1LWC A;  2ASM A;  1VQ7 N;  4B3O A;  2ZJQ L;  1RT4 A;  3KKR A;  3CJ1 A;  4JK8 A;  4BC4 A;  2HMI A;  3TAR A;  2RF2 A;  3ZSQ A;  3RRG A;  5JVG L;  3AVC A;  4KTW A;  3V1O A;  5AJ3 K;  1KD1 O;  3BZC A;  1A5V A;  2Z1J A;  2P9N A;  4NLB A;  3G4S N;  4CJT A;  3OA9 A;  3EL2 A;  4OKJ A;  3TI0 A;  4YOV A;  1J54 A;  1KSP A;  4OPK A;  3RWU A;  1HNV A;  4K25 A;  1W7A A;  3ZSW A;  2HHQ A;  3KIO A;  4LF7 K;  1KRP A;  1SKR A;  1QSS A;  1B9F A;  5AQV A;  1JKH A;  3NHG A;  4E7J A;  3DLB A;  4BDP A;  3MWP A;  2ASP A;  4FLX A;  2CGJ A;  4BE2 A;  4UY8 O;  3MEG A;  4WYB A;  3OJU A;  1ZC6 A;  2FF6 A;  1Z6R A;  2QKK A;  2VQF K;  4DR2 K;  4LD0 A;  2QI2 A;  3I56 N;  1Q81 O;  1BQM A;  1XMQ K;  1TAU A;  4GKK K;  3VEO A;  5HRR A;  4PKH A;  1K9M O;  3BDP A;  3F9M A;  4QOZ B;  2P9K A;  1BDG A;  3AVF A;  4H0T B;  2YJF A;  5HRN A;  2UUA K;  4BY9 C;  2IVN A;  4CJ5 A;  2QWQ A;  4IG3 A;  4EZ6 A;  4FWK A;  3NH1 A;  5H1S Q;  3OVN A;  3AVH A;  3ZT1 A;  3AY9 A;  1SKS A;  2HND A;  3QB0 A;  4FJ8 A;  1R59 O;  3BZK A;  5F2R A;  4OPH A;  3V9Z A;  3QBX A;  5LJW A;  3TAE A;  3WQU A;  3Q7B A;  4IDK A;  2KFN A;  1WSH A;  5CYQ A;  4E7K A;  4CF0 A;  3UKU B;  1VQM N;  5JIC A;  1HNI A;  3P5J A;  4FJ5 A;  3DAW A;  3ZSY A;  3VTH A;  3DJC A;  4DFJ A;  3CM6 A;  5DM7 L;  2YHX A;  4YHH K;  2GTD A;  1VQ5 N;  2ETJ A;  2OAN A;  2A1S A;  3DRR A;  1WSJ A;  3HL8 A;  4BRE A;  2QWN A;  3LDN A;  2ZM6 K;  1HKB A;  2F96 A;  2OCE A;  2NUB A;  5AQZ A;  3OHR A;  1TK5 A;  3OS2 A;  4CE9 A;  1XHX A;  2DFF A;  3AVL A;  1BO5 O;  3E9O A;  4BQL A;  4CZL A;  5AQX A;  1X9M A;  4JI2 K;  2P9I B;  3W3D A;  1ATS A;  3QO9 A;  4JKG A;  3HYF A;  5TKY A;  1L5U A;  2FBT A;  1N36 K;  4JI0 K;  2D0P A;  1NWK A;  3LWL A;  5FRO A;  3HM8 A;  4Q0B A;  2BTF A;  3ULE B;  4NXM K;  3O9R A;  4CGH A;  1FK9 A;  3SV4 A;  3KK2 A;  1S6P A;  1YVN A;  3U3Y A;  3O9T A;  1VSF A;  3CC4 N;  1KCF A;  3KTQ A;  2X6S A;  2OPQ A;  4RTF D;  3J80 O;  2NRZ A;  2Q0U A;  2YNH A;  4LFC K;  3HK2 A;  3O4N A;  3QFP A;  3V9W A;  4CJ3 A;  2B4J A;  1ASV A;  3SBT A;  4H5R A;  3RR7 A;  5C12 A;  3KK7 A;  1Q9Y A;  5HBM A;  1T44 A;  1NGA A;  5TKW A;  4DSJ A;  3G71 N;  4FWR A;  5LMU K;  4X66 K;  4FWO A;  4WFA L;  1WAF A;  1ASW A;  4HTU A;  2B6A A;  3WNF A;  4DSK A;  4EP4 A;  3OTO K;  1QSL A;  2FBY A;  2O8B B;  1BWF O;  2V51 B;  3CCL N;  4Z0U A;  1JJ2 M;  1HMV A;  5FDL A;  5KQ8 A;  1S1U A;  3HPH A;  3H6E A;  5AQK A;  3VGL A;  4EAH D;  3NF9 A;  4RCH A;  4CJS A;  1S1T A;  1J53 A;  3DXK B;  2V52 B;  3M6G A;  5JS2 A;  4DUZ K;  5AQG A;  4FLT A;  3I55 N;  2KW4 A;  3IG1 A;  5C10 A;  4IXC A;  3PIP L;  4FM0 A;  2LSN A;  5AQY A;  1XC9 A;  4O8K A;  2XY8 A;  4KHY A;  4CZK A;  4NYN A;  3VEN A;  1TK0 A;  4JN4 A;  1QQO A;  2W6K A;  4BAC A;  1LAW A;  1EO1 A;  4JI7 K;  2NRH A;  1KAX A;  4A2A A;  1XQS C;  5BR9 A;  4F2R A;  2WON A;  4BG8 A;  2E4L A;  3ENH A;  1CZ9 A;  3DXM A;  3R1X A;  3CJA A;  3O1B A;  3TTD A;  4FXD A;  4CER A;  1HQU A;  3K9J A;  1M90 O;  4BE0 A;  3MXJ A;  1RTJ A;  3CM5 A;  3PX4 A;  4F9O A;  3O5B A;  4TSX A;  4PL8 A;  4CZI A;  4CCH A;  4AHT A;  5AFU H;  4JHD A;  1X9J A;  3KJV A;  3TPQ A;  1X9S A;  5AFU A;  2IOC A;  3CCE N;  4B3T K;  1KVB A;  3NF8 A;  1UAX A;  2ZGZ A;  3O80 A;  4RW8 A;  4AH9 A;  2XY7 A;  1T03 A;  1K73 O;  3AVN A;  4CZH A;  3ZET B;  4JS4 A;  1QQM A;  1GOC A;  3SAF A;  3DLK A;  3KLE A;  4CJ4 A;  5HOO A;  5AQR A;  2OA8 A;  2DY4 A;  4MDB A;  4N5S A;  5T7B A;  2PYJ A;  3SV3 A;  4EHU A;  1P90 A;  4CJL A;  4CFD A;  4KI4 A;  3D6R A;  1N8R O;  1XUP O;  4I7F A;  2HHV A;  1VSE A;  2O8F A;  3QES A;  2VWJ A;  2UYT A;  4JAX A;  4E7I A;  2D0B A;  3O4Q A;  2ZF5 O;  5AQH A;  3KVG A;  1FXX A;  2FSN A;  1NJI O;  2P9S A;  4V19 S;  5M1O A;  3MMV A;  4AF1 A;  4YFU A;  3SUP A;  3VMF B;  5KPR A;  5GAG P;  2IAJ A;  2HW3 A;  3GG4 A;  3KKS A;  2P9U B;  4OKK A;  2P9P A;  1D8Y A;  3VF4 A;  4M63 C;  4M7Y A;  3IUC A;  3DLG A;  4AIL C;  4FJ9 A;  1NGE A;  1NJZ A;  4XH4 A;  5C25 A;  4O5F A;  5M1N A;  4LSN A;  2XY5 A;  2HHT A;  1EX4 A;  1WLJ A;  3ZCM A;  4B9L A;  1M1K O;  5BRF A;  4DV7 K;  1JLG A;  4CGJ A;  3E9P A;  1NBW A;  4CEB A;  4WQ5 C;  4BC2 A;  5CHI A;  3OYL A;  2O8D A;  4CGD A;  2VCP A;  3VQP A;  2HVH A;  1VSI A;  3JS6 A;  3HBT A;  3SQ1 A;  2ZWH A;  2D0A A;  3KD1 E;  1HPZ A;  1C0U A;  5I9E B;  3AAQ A;  4FK4 A;  3HP9 A;  2YNG A;  1YI2 N;  2W40 A;  5EX5 A;  3I0R A;  4M3R A;  1SL2 A;  3AVB A;  3OYE A;  1KC8 O;  2E5L K;  4E7H A;  3T19 A;  5CZ2 A;  2A5X A;  3OYI A;  4B08 A;  3VPZ A;  3J7Y P;  2ITG A;  3EE8 A;  4CEC A;  4B1U B;  3KK1 A;  3B6O A;  4KHQ A;  2HOE A;  3QEV A;  4BQZ A;  1GOA A;  1A5X A;  3QBW A;  4DU1 A;  3HPO A;  4JEP A;  2Z1I A;  4O0I A;  4LFB K;  3VQ4 A;  3EO3 A;  1JXE A;  4IOX A;  1OH6 A;  4HHT A;  1K8K A;  4H0P A;  3FGU A;  3P1G A;  3T3F A;  3EZW A;  5E41 A;  1RT2 A;  3QEW A;  2Q2R A;  3RMD A;  5J1E A;  3L0Q A;  3AGR A;  1EXQ A;  2G8I A;  1ITG A;  3NE6 A;  3QEI A;  1IBK K;  1YIJ N;  3VQB A;  3KK3 A;  3M5R A;  3WEE A;  4RW4 A;  4IJN A;  3HVR A;  3IFR A;  1UWB A;  4JKG B;  1QQC A;  4MO4 A;  4OJR A;  4WQ5 A;  4OGE A;  4H0O A;  3NBP A;  4IOC L;  1S1V A;  1SAZ A;  4FLZ A;  3SQ4 A;  1KTQ A;  1Z05 A;  4JK9 A;  2P1J A;  1HPM A;  2WTU A;  5HL7 L;  1U4B A;  3NDK A;  1REV A;  2DFH A;  3AO4 A;  3SAG A;  4CJR A;  3M3Z A;  4MLH A;  2O4G A;  2RHK A;  3VER A;  3SMP A;  4GVE A;  2FBV A;  4AHU A;  2FSK A;  4HUG A;  3LAK A;  1OVY A;  3FFK B;  5C15 A;  3K57 A;  1NGH A;  4QCL A;  4A59 A;  3EKS A;  2YNF A;  4NO7 A;  3NVM A;  2G8F A;  3SPZ A;  1T05 A;  1VQ8 N;  4K8X A;  4CGI A;  1YIT N;  3JAM O;  1Y64 A;  1QHT A;  3S3O A;  4MFB A;  3ZEU A;  2ZJR L;  2F9T A;  3VA3 A;  5F0X A;  4ILJ A;  4BR9 A;  1QZ6 A;  3ZYY X;  3RSE A;  4H03 B;  5EVZ A;  4K8Z A;  1VSM A;  3KLH A;  2D5R A;  3TSP A;  5IT9 O;  4CFB A;  4DG1 A;  4JI1 K;  4DFM A;  4FK0 A;  3SI6 A;  2D4W A;  2FF3 B;  5HRP A;  3HOT A;  5GAE P;  1RT6 A;  2KLA A;  3FR0 A;  1Z25 A;  3OYA A;  4BRA A;  4KKO A;  3CFR A;  3PX0 A;  5I3U A;  1NK6 A;  3K9K A;  3DYA A;  4DV0 K;  2Y1J A;  1TYQ A;  3TAF A;  3AO5 A;  1BA1 A;  3NGY A;  2XY6 A;  4I2P A;  3DXM B;  3TAM A;  4DV2 K;  4FCY A;  3A5N C;  4ISF A;  3NCI A;  3LAN A;  1VSJ A;  3TR8 A;  2RE2 A;  2EWS A;  4A5A A;  3DLH A;  2I7P A;  5AQQ A;  4ILH A;  2WBN A;  4FWS A;  4KHW A;  4JHD B;  2VG5 A;  4DTJ A;  5LL6 Z;  1MA9 B;  3KLI A;  1L3V A;  1RFQ A;  2VGN A;  1KQS M;  1HR0 K;  4N76 A;  2OTL N;  4QS8 A;  4CHQ A;  1GLA G;  1YUW A;  2YHB A;  4KRF A;  1RDA A;  4NB4 A;  1B92 A;  3RVC A;  4C8M A;  3DMJ A;  3GBT A;  3I0S A;  3IMX A;  1NK8 A;  3CME N;  2IC3 A;  4M42 A;  4A62 A;  4BRC A;  4CJW A;  1RDD A;  5AQI A;  2ZGY A;  1HLU A;  1L3U A;  3P31 A;  3BY5 A;  1C0T A;  4JKC A;  4AHV A;  3WXL A;  3C94 A;  3RMA A;  4N47 A;  1KFD A;  2P9S B;  3CCV N;  1YTA A;  4BE1 A;  3SLC A;  2X6N A;  5AQL A;  1S72 N;  3ATU A;  1TUU A;  3TAN A;  3VQD A;  2B5J A;  2P9P B;  3THV A;  1BI4 B;  2QWO A;  2IDO A;  4JKF A;  4CGG A;  5BRE A;  3UB5 A;  3J7Z O;  5LY3 A;  4FJG A;  4QAG A;  5J2M A;  1VQK N;  2QWR A;  3A0I X;  2QTD A;  3R3L A;  2Z1G A;  4CJ7 A;  3K5M A;  4OKE A;  2UUC K;  2XHB A;  3ZX2 A;  3U3G A;  3EY1 A;  2QK9 A;  4M3Y A;  2F9W A;  4ISG A;  1FW6 A;  2BDP A;  2G8U A;  2YV0 X;  2ATQ A;  2H3G X;  1LW2 A;  4CJP A;  5AQP A;  1U2V A;  4JKA A;  2O8D B;  5AQS A;  4W5Q A;  2UXB K;  3CET A;  4CBW A;  2GV9 A;  2BH1 A;  4O5B A;  1UA0 A;  3J8A A;  1MU2 A;  1RT5 A;  2HBM A;  3WNE A;  4BRD A;  1X3M A;  3AA4 A;  3OYC A;  4FZX C;  1NGC A;  3VQC A;  4DV6 K;  5M1F A;  3MN5 A;  3UIQ A;  4CEE A;  4DR1 K;  2D0C A;  3KZB A;  2D0O A;  4FVU A;  4CFC A;  4YOR A;  4AHS A;  3G0Z A;  1C0G A;  4JI5 K;  4E1N A;  3M8P A;  4K0K K;  4GY2 B;  2NRX A;  5J2P A;  4YOT A;  1NGI A;  3OYK A;  4FLV A;  1SV5 A;  4H8K A;  3F9K A;  5CE3 A;  3QML A;  5FRM A;  3CG7 A;  1L3S A; 
#chains in the Genus database with same CATH homology
 4O44 A;  3U6F A;  2BAN A;  4FM0 A;  4RW7 A;  2LSN A;  1XC9 A;  1NK5 A;  1BL3 A;  1F21 A;  2XY8 A;  1JLF A;  4HCB A;  4KHY A;  4NYN A;  3L3U A;  1NK4 A;  1DTQ A;  1GOB A;  3S9H A;  4EZ9 A;  3DM2 A;  2QKB A;  1TK0 A;  4NCG A;  3KLF A;  1NKB A;  4CF8 A;  4DS5 A;  4DTX A;  3LAL A;  1WSI A;  1XWL A;  4CEF A;  4BAC A;  2PY5 A;  1FKO A;  1LAW A;  1I3A A;  3CFO A;  1TAQ A;  3QET A;  4ZHR A;  3OS0 A;  3I8D A;  4CJE A;  3SQ0 A;  1A5W A;  5DMR A;  2OZM A;  4F2R A;  2WON A;  2E4L A;  4DTN A;  3VQ7 A;  5CZ1 A;  4E7L A;  1KFS A;  4DSI A;  1CZ9 A;  4CJQ A;  2HB5 A;  2JGU A;  3AVM A;  5HRS A;  4CK3 A;  2PYL A;  1R0A A;  4FXD A;  1SKW A;  5SWM A;  4OVL A;  4CER A;  1C1B A;  1HQU A;  4H4O A;  4M45 A;  4GW6 A;  1WSF A;  3QIN A;  1RIL A;  1TKZ A;  3WNH A;  1IH7 A;  4CHO A;  3QER A;  2Y1I A;  3T1A A;  4BE0 A;  4FW2 A;  3MXJ A;  3LPT A;  2KTQ A;  1RTJ A;  3CM5 A;  1IKY A;  3SPY A;  1X9W A;  3PX4 A;  1JL2 A;  1IKW A;  2IS3 A;  4TSX A;  1BIZ A;  3L2U A;  4ELT A;  4CCH A;  4AHT A;  4DSE A;  3KJV A;  3ISN C;  3SUN A;  4CJK A;  4B9N A;  2OPR A;  1IG9 A;  1X9S A;  2KFZ A;  1VRT A;  2IOC A;  4Y1C A;  4B8A B;  4DQR A;  1KVB A;  1SL0 A;  3NF8 A;  1K6Y A;  2G8W A;  3QEP A;  2ZD1 A;  1UAX A;  2PZS A;  4AH9 A;  4RW8 A;  2IGI A;  3AA3 A;  2XY7 A;  1T03 A;  4BWJ A;  2EHG A;  3AVN A;  1U45 A;  3OYF A;  4C8L A;  4JS4 A;  1ZBL A;  1GOC A;  4JS5 A;  4FJJ A;  4KB1 A;  3DLK A;  3KLE A;  4CJ4 A;  1RT3 A;  1X1P A;  3L2W A;  2OA8 A;  2BE2 A;  2DY4 A;  3PY8 A;  4N5S A;  1Q9X A;  5T7B A;  1BQN A;  1DLO A;  2YNI A;  2PYJ A;  3SV3 A;  2G8K A;  4CJL A;  1HRH A;  4CFA A;  1WN7 A;  4CFD A;  1YT3 A;  5J2Q A;  1VSH A;  5CYM A;  1VRU A;  4CHY A;  4DF4 A;  4KI4 A;  4MQ3 A;  4I7F A;  2HHV A;  1DTT A;  1VSE A;  1CZB A;  1HYV A;  1RBR A;  3DLR A;  4CHP A;  3QES A;  4PA1 A;  2VWJ A;  4CHZ A;  2OYQ A;  4E7I A;  3ITH A;  2D0B A;  4GMJ B;  1NOY A;  4FZY A;  3DI6 A;  3O4Q A;  3V1Q A;  3LWM A;  1RBU A;  3NAE A;  1FXX A;  2I5J A;  2XO7 A;  3LAM A;  1TL3 A;  4Q5V A;  4KO0 A;  3D0P A;  4O55 A;  4YFU A;  1CXU A;  4RG8 A;  1TV6 A;  3SUP A;  3CFP A;  3O3F A;  1WSE A;  4DTP A;  4FJL A;  1IO2 A;  2IAJ A;  3LP3 A;  4DMN A;  1EET A;  3DRS A;  3KKS A;  4R5P A;  3NH0 A;  4KB0 A;  2HW3 A;  3KD5 E;  1O1W A;  4OKK A;  4FVM A;  4LSL A;  1KVC A;  2VWK A;  3SNN A;  4DTU A;  1ZYQ A;  1S1X A;  2X78 A;  4F3T A;  4NCB A;  1D8Y A;  3L2Q A;  4AHR A;  3AO1 A;  1W0H A;  3DLG A;  5C24 A;  4AIL C;  3ALY A;  4FJ9 A;  4J2B A;  1ZBU A;  1WAJ A;  1N5Y A;  1NJZ A;  4IG0 A;  3RMB A;  4CEO A;  3NGZ A;  3LP1 A;  5C25 A;  3JSM A;  3WNG A;  3S3N A;  1Q8I A;  5KGX A;  1J9A A;  5HP1 A;  2HNY A;  2P5G A;  1T8E A;  4DTM A;  1RTH A;  4LSN A;  4Z4H A;  4UQG A;  2XY5 A;  4Z4F A;  2HHT A;  4KRE A;  3HJF A;  5KRT A;  1EX4 A;  1WLJ A;  5K14 A;  3VQQ A;  3PO4 A;  3G10 A;  3HT3 A;  3OYD A;  3ZCM A;  4B9L A;  4Z4C A;  3OYB A;  1JLG A;  3LPU A;  4DSF A;  4CGJ A;  5HLF A;  4CEB A;  4M41 A;  1C6V A;  4KTQ A;  3OYL A;  3EYZ A;  4CGD A;  4DQI A;  3VQP A;  2HVH A;  1VSI A;  3K5O A;  4J2A A;  1NK7 A;  4IBN A;  3OJS A;  4DQQ A;  1LW0 A;  2ZQB A;  4HUF A;  3SQ1 A;  4J2D A;  3AVI A;  4KV8 A;  1TGO A;  3K2P A;  2D0A A;  5C42 A;  3KD1 E;  2RKI A;  3RR8 A;  1HPZ A;  3SCX A;  2E6L A;  1C0U A;  1HQE A;  3SUQ A;  1BCM A;  4RW6 A;  4FK4 A;  3HP9 A;  1W9H A;  2KQ2 A;  1BIS A;  2YNG A;  4BWM A;  4O4G A;  3ZT3 A;  1NOZ A;  3QLH A;  4NYF A;  4LY7 A;  1B9D A;  2RN2 A;  3I0R A;  4M3R A;  1SL2 A;  5KTQ A;  2YHA A;  3AVB A;  1TKX A;  3OYE A;  1FKP A;  4G1Q A;  1RCH A;  1NKC A;  4E7H A;  3T19 A;  5CZ2 A;  3OYI A;  3ULD A;  4B08 A;  4E89 A;  3QNO A;  2OPP A;  4FZZ A;  4E3S A;  2ITG A;  3MXI A;  3HVT A;  3AO3 A;  1RDB A;  1WSG A;  4FJN A;  4CEC A;  4ZTF A;  1N6Q A;  3EZ5 A;  3KK1 A;  3RMC A;  5D3G A;  3B6O A;  3NGI A;  1TKT A;  4KHQ A;  4B9M A;  5J2N A;  1U04 A;  3P83 D;  3QEV A;  1GOA A;  1A5X A;  4CF2 A;  1BHL A;  1L3T A;  4DU1 A;  3HPO A;  1HJR A;  3HXM A;  1RBT A;  2Z1I A;  4O0I A;  3VQ4 A;  4DLG A;  4W5T A;  3CYM A;  3NF6 A;  1LV5 A;  1JXE A;  1SL1 A;  4HHT A;  1EP4 A;  1RTD A;  4M3T A;  3P1G A;  4N56 A;  3T3F A;  4B9V A;  4FW1 A;  5E41 A;  3OYG A;  1RT2 A;  3ZSO A;  4B9U A;  2W42 A;  3CQ8 A;  4WE1 A;  3IS9 A;  1RBV A;  3QEW A;  3RMD A;  4B9S A;  4DWI A;  5J1E A;  4L8R B;  4N41 A;  4M3X A;  4OLA A;  1HYS A;  5KI6 A;  4Y1D A;  5FRN A;  3SJJ A;  3FFI A;  3QIO A;  2OPS A;  1EXQ A;  4FJI A;  2G8I A;  1RT1 A;  1ITG A;  3NE6 A;  3SYZ A;  3QEI A;  2HVI A;  4M3W A;  3K59 A;  3VQB A;  4CEZ A;  1KLN A;  3KK3 A;  4RW4 A;  3DRP A;  1ASU A;  3NF7 A;  3HVR A;  3V9X A;  1BGX T;  3KLG A;  4ICL A;  1ZBF A;  3AO2 A;  4DU3 A;  1NJY A;  3IAY A;  1QTM A;  3L2R A;  1UWB A;  2XRI A;  4IFV A;  1QQC A;  4KHN A;  3LZI A;  4JLH A;  3VA0 A;  4OJR A;  4OGE A;  3NBP A;  4M3U A;  1VSL A;  5JS1 A;  4JRQ A;  1NJW A;  2P51 A;  5KRS A;  4M3Z A;  1JL1 A;  4ZTJ A;  1NJX A;  1KVA A;  1LWE A;  1U47 A;  1S1V A;  4FLZ A;  3SQ4 A;  4I9Q A;  1KTQ A;  3ASM A;  2P1J A;  3TAG A;  3DOK A;  1BIU A;  1U4B A;  1RBS A;  4KHS A;  1TK8 A;  2P5O A;  4HVJ A;  4CED A;  4LH5 A;  3NDK A;  3AV9 A;  1REV A;  4PQU A;  2DFH A;  4DQP A;  3AVK A;  3AO4 A;  1G15 A;  4CJR A;  1C1C A;  2AJQ A;  5KGW A;  4PUO A;  4DU4 A;  4OPJ A;  2O4G A;  3OYH A;  4O0J A;  4CF9 A;  3AVA A;  5CY4 A;  3M8R A;  2FBV A;  4PWD A;  1S5J A;  1C0M A;  4AHU A;  4W5R A;  4DF8 A;  3QNN A;  5HRO A;  1TKD A;  3F73 A;  4HUG A;  3IRX A;  1LWC A;  4CJU A;  3ZT2 A;  3LAK A;  3HPG A;  3VQE A;  4CIE A;  2E6M A;  3K57 A;  2RPI A;  3TWH A;  4NCA A;  4OLB A;  4B3O A;  1RT4 A;  4QCL A;  3SQ2 A;  3VN5 A;  4EP5 A;  3KKR A;  2YNF A;  2HMI A;  3TAR A;  1TVR A;  3L3V A;  4AHC A;  3SPZ A;  1T05 A;  2RF2 A;  4DTO A;  3ZSQ A;  2G8F A;  1RT7 A;  2YKN A;  1D5A A;  1QE1 A;  4FM1 A;  3RRG A;  3AVC A;  4KTW A;  3V1O A;  2G8V A;  2Q3S A;  4DLE A;  4CGI A;  4K8X A;  1A5V A;  4F4K A;  1TL1 A;  2Z1J A;  3DLE A;  1XI1 A;  2DFE A;  3S3O A;  1QHT A;  4CJT A;  4CES A;  1RTI A;  4MFB A;  2BGG A;  4OKJ A;  3VA3 A;  1LAV A;  3TI0 A;  1NK9 A;  3PX6 A;  4RW9 A;  1J54 A;  1J5O A;  1KSP A;  4CEA A;  4OPK A;  4K8Z A;  1VSM A;  3KLH A;  2D5R A;  3RWU A;  4KAZ A;  2HHU A;  1HYZ A;  3NFA A;  1HNV A;  4CFB A;  3DOL A;  4DG1 A;  3ZSW A;  4DFM A;  3MAQ A;  4FK0 A;  3KIO A;  2EX3 A;  5SZT A;  3LZJ A;  3SI6 A;  4CK2 A;  2HHQ A;  1LWF A;  4KFB A;  1VSK A;  5HRP A;  1KRP A;  1RT6 A;  3K5N A;  1SKR A;  1B9F A;  1QSS A;  3HP6 A;  2HHS A;  1JKH A;  3NHG A;  4E7J A;  3V6D A;  1JXB A;  3DLB A;  4BDP A;  1JLE A;  3LP2 A;  1Z25 A;  3OYA A;  4FLX A;  4W5N A;  5DK5 A;  4KKO A;  4IFY A;  4BE2 A;  2O4I A;  3CFR A;  3PX0 A;  5I3U A;  1NK6 A;  3MEG A;  3DYA A;  3OJU A;  2Y1J A;  4DSL A;  3A2F A;  3AA5 X;  3TAF A;  3AO5 A;  3D45 A;  4DTS A;  2QKK A;  3QIP A;  2HNZ A;  3NGY A;  4I9L A;  4I2P A;  2XY6 A;  1YVU A;  1EKE A;  3MED A;  5EU7 A;  4LD0 A;  3TAM A;  4FJ7 A;  1D9F A;  4FCY A;  2FC0 A;  3NCI A;  3LAN A;  1BQM A;  3VQ8 A;  1CLQ A;  1TAU A;  4CIG A;  2VG6 A;  1VSJ A;  5HRR A;  3TR8 A;  4DFK A;  1Y97 A;  3BDP A;  3PV8 A;  3V1R A;  4QOZ B;  4OGC A;  3OS1 A;  1JLA A;  4Z4E A;  3DLH A;  3VQ6 A;  2FBX A;  3AVF A;  5HRN A;  3VQ5 A;  4KHW A;  3ZT4 A;  3LDS A;  1C1A A;  4CJ5 A;  4CJV A;  3SZ2 A;  2QXF A;  3S3M A;  3NH2 A;  2YKM A;  4IG3 A;  3MXM A;  4EZ6 A;  2VG5 A;  3NH1 A;  3OVN A;  3AVH A;  3ZT1 A;  4DTJ A;  3TAQ A;  1SKS A;  3OYM A;  2HND A;  3KLI A;  1L3V A;  4FJ8 A;  3ZSV A;  1IKV A;  3AVJ A;  3V9Z A;  4N76 A;  1RNH A;  5I42 A;  4J2E A;  2GUI A;  3TAE A;  3C6U A;  4IDK A;  4CHQ A;  2KFN A;  2YHB A;  1WSH A;  1NK0 A;  5CYQ A;  4E7K A;  4CF0 A;  4FJK A;  4KRF A;  4CIF A;  2HHW A;  4CJF A;  1S1W A;  2KZZ A;  1RDA A;  4CHN A;  1B92 A;  4PY5 A;  2A1R A;  1XHZ A;  4C8N A;  1HNI A;  3P5J A;  4Z4G A;  1VK0 A;  4ID1 A;  4CF1 A;  4C8M A;  4GVM A;  4FJ5 A;  3DMJ A;  4FLU A;  3I0S A;  1NK8 A;  4F3O A;  3ZSY A;  1UOC A;  2IC3 A;  4M42 A;  2WOM A;  4I2Q A;  3HM9 A;  3ZSR A;  4DFJ A;  3CM6 A;  4KI6 A;  4KHU A;  4FJH A;  4CJW A;  1RDD A;  4FYD A;  3ZSZ A;  2ETJ A;  3AA2 A;  2R7Y A;  2A1S A;  3DRR A;  1L3U A;  4B8C A;  4B9T A;  4DQS A;  1WSJ A;  3HL8 A;  1C0T A;  4AHV A;  4ELV A;  4H4M A;  3C94 A;  3RMA A;  4N47 A;  1KFD A;  3PUF A;  2F96 A;  1U48 A;  2NUB A;  1QS4 A;  3AVG A;  1WNS A;  1TK5 A;  4DTR A;  1YTA A;  3OS2 A;  4BE1 A;  1NKE A;  4W5O A;  4CE9 A;  4FJM A;  3V4I A;  1XHX A;  2DFF A;  2X6N A;  3AVL A;  4DFP A;  3OYJ A;  3TAN A;  3VQD A;  2B5J A;  3OY9 A;  3OYN A;  3THV A;  2VG7 A;  4KTZ A;  3JYT A;  1BI4 B;  1X9M A;  3PO5 A;  2IDO A;  4CGG A;  3ZSX A;  4F2S A;  4Z4I A;  1ZBI A;  3QO9 A;  4ID5 A;  2Z1H A;  4FJG A;  1RDC A;  3HYF A;  4QAG A;  2FBT A;  5J2M A;  1L5U A;  4C8O A;  3SUO A;  4HCC A;  3M8S A;  2G8H A;  1UA1 A;  1U49 A;  2Z1G A;  3LWL A;  5FRO A;  3K5L A;  4OKE A;  3K5M A;  4BDZ A;  4ELU A;  3VQA A;  4Q0B A;  3TAP A;  1JLC A;  4BDY A;  2XHB A;  3L2V A;  3LP0 A;  2GBZ A;  4CGH A;  3K58 A;  1FK9 A;  3C6T A;  3U3G A;  4F8R A;  3SV4 A;  3EY1 A;  2QK9 A;  4LH4 A;  4M3Y A;  3KK2 A;  2KZM A;  1S6P A;  4DS4 A;  3U3Y A;  3RTV A;  2BDP A;  1VSF A;  2G8U A;  2YV0 X;  1KCF A;  3KTQ A;  2X6S A;  2ATQ A;  4FK2 A;  1LW2 A;  4CJP A;  4C8K A;  2OPQ A;  4JRP A;  3O3H A;  3E01 A;  1Z26 A;  3ZT0 A;  2YNH A;  1BI4 A;  4FLY A;  3HK2 A;  1IKX A;  2F8T A;  3H08 A;  3O4N A;  4W5Q A;  3HO1 A;  1BCO A;  3V9W A;  4YNQ A;  4CJ3 A;  2B4J A;  4XIU A;  1ASV A;  2GV9 A;  3RR7 A;  2HHX A;  1S9G A;  4O5B A;  3HST B;  1UA0 A;  2ZE2 A;  1Q9Y A;  3MEE A;  1MU2 A;  3M8Q A;  5HBM A;  1RT5 A;  4E0D A;  1VSD A;  1JLQ A;  4HUE A;  1QSY A;  3WNE A;  1D9D A;  3TAB A;  4DSJ A;  3AA4 A;  3V9U A;  2F8S A;  3OYC A;  1I39 A;  4FZX C;  3VQC A;  1WAF A;  1ASW A;  4HTU A;  2B6A A;  3WNF A;  4KPY A;  4DSK A;  4EP4 A;  4CK1 A;  4FM2 A;  1QSL A;  1T7P A;  2FBY A;  4CEE A;  3C95 A;  1KLM A;  3UIQ A;  1ZBH A;  3L8B A;  2D0C A;  4Z0U A;  2JLE A;  4IKF A;  1CXQ A;  3RRH A;  1HMV A;  5FDL A;  4CEQ A;  3VQ9 A;  4CFC A;  4AHS A;  3QEX A;  1S1U A;  2DTU A;  3G0Z A;  3HPH A;  3V81 A;  3O3G A;  4FJX A;  3V9S A;  4E1N A;  3M8P A;  3NF9 A;  4CJS A;  1S1T A;  4E1M A;  3MEC A;  2OZS A;  1J53 A;  3BGR A;  3B6P A;  4CGF A;  1S9E A;  5JS2 A;  5J2P A;  3OYK A;  4FLV A;  1SV5 A;  4FLT A;  2KW4 A;  3F9K A;  1SUQ A;  4H8K A;  4E19 A;  1JLB A;  3CG7 A;  3IG1 A;  1L3S A;  1S6Q A;  5FRM A;  2X74 A;  1YTU A;  4FLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...