3AA4A

A52v e.coli rnase hi
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
152
structure length
152
Chain Sequence
b'LKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAVIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Protein core adaptability: crystal structures of the cavity-filling variants of Escherichia coli RNase HI
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 51
structure length 152
sequence length 152
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3aa4A00
1JLQA 1WN7A 3K2PA 3L2RA 4F8RA 3CFRA 3OYIA 3RMDA 3CG7A 1EX4A 4EP5A 1NK4A 4CEZA 1RT4A 2NUBA 1IKWA 4CF1A 3SQ0A 4KPYA 3V1RA 3VQBA 1L3SA 3H08A 2JGUA 3ZSQA 2G8VA 4FM2A 3AO3A 3HPGA 4I9QA 4FYDA 4DTJA 2E6LA 4XIUA 4OLBA 3OS1A 4DU1A 3I8DA 3PO5A 3HP6A 1A5WA 4KTQA 4H4MA 4M3UA 3KLIA 3NF7A 3SNNA 3VQQA 3D0PA 1KTQA 3L3UA 2XY5A 1XI1A 4FJ5A 4M3TA 4M42A 4CJWA 1RT1A 4B9NA 2X6NA 1BCOA 3AVIA 4Y1CA 4GVMA 4CIFA 4DSIA 2QK9A 3TAGA 2OPQA 3LAMA 3T1AA 4B9LA 4IG0A 2DFEA 4CFBA 3HPHA 3V9XA 1QSLA 1X9SA 4MQ3A 3DLKA 3BGRA 4ELUA 2OPSA 1TK5A 4RW6A 1SL1A 1TV6A 1D9DA 3AVNA 1U49A 4L8RB 1U48A 2VWJA 3M8RA 3NGZA 3SPYA 1X9MA 4DWIA 1WLJA 3KIOA 2XY7A 4FLXA 4CEFA 2ITGA 3HPOA 4DSEA 1S1XA 4IBNA 4JRPA 1ZYQA 4M3WA 5C25A 3QIPA 1HNVA 1JL1A 4YNQA 1TL1A 3NHGA 4Z4CA 2O4GA 3DLBA 4CE9A 4PY5A 3T19A 1S6QA 3E01A 4CK1A 3S3NA 1RT3A 3L3VA 3VQEA 4F3TA 1C1CA 3DLEA 3LZJA 4EZ6A 4OKKA 4LH4A 1WAFA 3QINA 5CZ2A 4R5PA 2ZD1A 4CJSA 2XO7A 1VSKA 4C8LA 2E6MA 4KB0A 4DLGA 2O4IA 1ZBLA 3V9SA 4E7HA 2HNYA 2HNZA 3DRRA 4OGCA 2F96A 3DLHA 3K57A 3MEGA 2PYJA 3PY8A 3AVLA 1UA0A 1HQUA 3AVHA 3I0SA 4M3ZA 4E7KA 1NOYA 1Y97A 2FBTA 2YKMA 2YKNA 3NAEA 5J1EA 3U3YA 1SL2A 3K58A 1FK9A 1VSDA 2P51A 4FM1A 3SUPA 1LWEA 4O4GA 4OPKA 1CXQA 3ZSVA 1BI4B 4W5RA 4FCYA 3B6OA 1DTQA 2XHBA 3TAPA 3VA3A 3LWLA 4DSKA 4KHWA 2BDPA 2DTUA 4C8KA 3AA5X 2QKBA 3LZIA 4N5SA 4FZZA 4FLVA 1RILA 4CFAA 1YTAA 2DFHA 3ZT3A 3SI6A 1XHXA 4IDKA 3SV3A 4CEOA 4K8ZA 3AO2A 3CQ8A 4M3YA 3KLEA 1BL3A 4J2EA 1NJYA 4HTUA 4O44A 2QKKA 3NE6A 3QEVA 3IAYA 1RCHA 4OGEA 1BQNA 3U6FA 4DFKA 1HYSA 4IFVA 4C8MA 3OYDA 3KLFA 3JYTA 3CM6A 3SQ2A 2YNGA 4DTPA 3KK1A 2HHWA 5DMRA 2DY4A 4CF9A 4E1MA 3L2VA 3HJFA 4EZ9A 4IKFA 3DYAA 1LAVA 5KGXA 3VQ5A 2D0CA 4DFMA 4Z0UA 1EP4A 3HYFA 3OYMA 4KO0A 3KLHA 1B92A 4B8AB 4BDYA 4OJRA 2OZSA 3PV8A 1IO2A 1VSIA 3QEXA 4NCGA 4CHPA 4FVMA 1ITGA 2YHAA 3ZSRA 1VSMA 3SQ4A 1L3UA 1RDCA 1T05A 4DTNA 3TAEA 3ASMA 4KI4A 2VG6A 4JLHA 4HUGA 1QHTA 1CZBA 2Q3SA 2FC0A 1B9DA 2GBZA 3DRSA 4CECA 5HRPA 3JSMA 2E4LA 4B9UA 3OJSA 2HW3A 4RG8A 4ID5A 3ZT1A 4FJHA 3F73A 3M8QA 5J2MA 3RRGA 3KLGA 4KHNA 3TAFA 4KHSA 1VSHA 3OVNA 4CJ4A 3AVMA 1XWLA 2BANA 1CZ9A 3LALA 3MECA 4DQRA 2WONA 3V1OA 4H8KA 2YHBA 4FK0A 3ZSZA 2DFFA 1IKYA 1Q9XA 4E1NA 1HPZA 3RR8A 1SUQA 3QNOA 4AHUA 4ELTA 1IKXA 3OS2A 4B9TA 3F9KA 2A1SA 1LW0A 2YNIA 4Z4HA 1TKTA 3O3GA 4JRQA 4AHCA 2HVIA 1WSGA 1T03A 4LSLA 4DQPA 4DTMA 2EX3A 2LSNA 1RTJA 2D0BA 4CK3A 1CLQA 4DTRA 4BDPA 3VQPA 4FLZA 1JXBA 2D0AA 3TI0A 1XC9A 2G8KA 4O0JA 3LWMA 2IAJA 4Y1DA 1NK8A 2QXFA 4I7FA 4C8OA 3L8BA 4O5BA 3IS9A 4FJGA 1HNIA 3SV4A 3NH1A 3TWHA 1U04A 4OKEA 4CJLA 3AVCA 4KV8A 1RTHA 1NJWA 1NK9A 1ZBFA 4F2SA 5JS2A 4AHSA 3LP2A 4H4OA 3K5LA 3NDKA 4CCHA 4NYFA 3K5MA 4E7LA 4FK2A 3G10A 4BDZA 3KTQA 3UIQA 4KI6A 4DS5A 3KKSA 5SWMA 4CJEA 1Q9YA 1L5UA 1L3TA 3M8SA 3SPZA 3TAQA 4ELVA 2RKIA 4I2QA 1RT7A 1QE1A 1G15A 5J2QA 1N6QA 2YNHA 1EKEA 3DOKA 4AHRA 4BE0A 4DS4A 3ISNC 1UAXA 3WNFA 4CFDA 3OYNA 2IC3A 2YNFA 2OZMA 3DLRA 4B3OA 1TGOA 4PQUA 1C1AA 2PY5A 4M3XA 4KHYA 3DMJA 3MXIA 3O4QA 1KSPA 1VSFA 3V4IA 3VQCA 3HK2A 3NBPA 2BGGA 2ATQA 1RDDA 1UOCA 1X1PA 3IRXA 2RPIA 1KVBA 1BCMA 1RBSA 4ID1A 3K5OA 2OYQA 4NYNA 3BDPA 3HM9A 3QEPA 2HHQA 2KW4A 3G0ZA 3NF9A 3IG1A 2ZE2A 2GV9A 4OKJA 5HRSA 4O55A 3OYKA 4KAZA 4HVJA 3SUNA 1XHZA 1NK5A 1LAWA 1ASWA 4CGJA 5HBMA 4I9LA 1NOZA 1EXQA 3V1QA 3RMCA 1WSEA 3MXJA 3TAMA 3T3FA 4DTUA 3S3OA 3KD1E 1BGXT 1EETA 4CJRA 5E41A 3OJUA 1WSHA 3MXMA 3O3HA 3K59A 5HLFA 1GOCA 3LP3A 4N56A 1QTMA 1RDAA 4K8XA 5C24A 3SQ1A 4ZTJA 4KTWA 5FDLA 2FBVA 1RT2A 2XY6A 2HHSA 4DMNA 1RNHA 1S5JA 4KFBA 4KB1A 4N41A 1SV5A 3PX0A 4RW9A 2B5JA 1VK0A 3RMAA 4E3SA 1BIUA 4W5TA 1GOAA 4B08A 3TABA 4Z4FA 1LWFA 3AA4A 3QO9A 4CEQA 1D9FA 4C8NA 5J2PA 5T7BA 4FLWA 1KCFA 4FJJA 4J2BA 1UWBA 1KLNA 4Q5VA 3OS0A 2PYLA 2PZSA 4NCAA 1C0TA 3QEWA 4HUEA 1HYZA 3AO5A 3I0RA 3KK3A 3RWUA 2JLEA 3WNHA 3OYFA 3ULDA 1S1VA 2RN2A 5KGWA 3EYZA 4CESA 3AVAA 3OYEA 1VRTA 3C6UA 3SUQA 4DF4A 1IKVA 2AJQA 3D45A 4DFJA 1J9AA 1NKCA 4GW6A 3P5JA 3CFPA 4LY7A 4PWDA 5HRRA 5I42A 2ETJA 4CGHA 4FLTA 1IG9A 3WNEA 4HHTA 1CXUA 1GOBA 1RBRA 4RW8A 4DTSA 1TKDA 4CJUA 4EP4A 4J2AA 4CF8A 3SYZA 2P5GA 4AHVA 4NCBA 3AA2A 4E89A 4DLEA 3CM5A 4DFPA 4B8CA 4ZTFA 2HHVA 3QEIA 3MEEA 1WSJA 3AO1A 5SZTA 2IS3A 3ALYA 2IDOA 2Z1JA 3OYGA 3SCXA 1SKWA 3OYJA 4M41A 2KFZA 5HROA 4CHYA 1DLOA 4FW1A 4LD0A 3NCIA 3TR8A 2KFNA 3VN5A 2FBYA 5KTQA 4FJLA 4CHZA 3DM2A 1WAJA 1KFSA 1KRPA 3RMBA 5JS1A 3L2UA 4UQGA 1J5OA 1JLBA 2B6AA 4BE1A 3AVKA 1UA1A 2KZZA 4CK2A 3P1GA 3DRPA 4IG3A 3QNNA 4M45A 4QOZB 4CERA 1VSLA 3VQ4A 1RTIA 1HMVA 3M8PA 2W42A 5DK5A 2OA8A 3KD5E 1YT3A 4W5QA 4KREA 1WNSA 3VQDA 3PO4A 4F4KA 4CJQA 2HHTA 3C6TA 3TANA 3HP9A 1U4BA 1ASVA 1VSEA 1NKBA 4RW4A 1ASUA 4CGDA 1WSIA 4M3RA 4B9SA 4CF0A 1S1TA 4I2PA 3PX6A 4E19A 1TK8A 1LW2A 1TVRA 2XRIA 3LP1A 2G8WA 2G8UA 4QCLA 4FJ9A 3HXMA 4G1QA 3ZT0A 1QSYA 4O0IA 3L2WA 3QLHA 3QERA 4N76A 4Z4IA 2IOCA 5CYMA 3MAQA 2OPRA 3KKRA 3MEDA 1J53A 4FLYA 3SUOA 3OYBA 1L3VA 2YV0X 2D5RA 1NJXA 1KFDA 4Q0BA 3RRHA 2HNDA 2VG5A 3ZSXA 4CHOA 1S9EA 3L2QA 1BQMA 4KHQA 4CEBA 1NK6A 1Q8IA 1Z26A 4CJTA 1T7PA 1NJZA 4DTXA 4YFUA 2X6SA 1S6PA 4FM0A 5D3GA 2Z1IA 3LP0A 1N5YA 1F21A 5J2NA 3NGYA 4CIGA 4DSFA 1JLAA 2OPPA 3HVTA 4CFCA 3OYLA 1TL3A 1RBUA 3DLGA 4CEAA 4CF2A 1KVAA 3O3FA 3KJVA 2FBXA 4CJFA 3EZ5A 3O4NA 4F2RA 3VQ6A 3NF6A 1HJRA 1S1WA 3OYHA 4Z4GA 1ZBIA 4MFBA 3VQ7A 1RBTA 3ZSOA 5HRNA 3QESA 1DTTA 1YTUA 1R0AA 1C6VA 3NF8A 3NGIA 3V9UA 4PUOA 4IFYA 3HVRA 1SKRA 4DQSA 1O1WA 4TSXA 2VG7A 3ZCMA 4DG1A 1IH7A 1TAQA 3QETA 1JLFA 4B9VA 3P83D 1KLMA 4JS4A 1ZBUA 3VA0A 1NKEA 3A2FA 1S9GA 4FZXC 1TAUA 3DOLA 4CJ5A 1NK0A 2P1JA 4WE1A 4CEDA 2HHUA 5FRNA 4CHNA 4BACA 2EHGA 1HQEA 3CFOA 3VQAA 1QS4A 3LDSA 4E7JA 1T8EA 1TKZA 4CGIA 4DTOA 3OYAA 3NFAA 3CYMA 3ZT4A 3OY9A 2X78A 4CIEA 5FRMA 3AVJA 1RT6A 5KRSA 1BISA 4B9MA 4N47A 1B9FA 4DQQA 1JXEA 4ICLA 4KKOA 3RR7A 4OVLA 4CGGA 1RT5A 4Z4EA 1JLGA 1VRUA 4AH9A 3VQ9A 3PX4A 4CJKA 4BWJA 1TK0A 2KZMA 4AHTA 2X74A 3C95A 1WSFA 4CGFA 4F3OA 4FJXA 4QAGA 4DSJA 1RTDA 3LPTA 1HYVA 3LANA 5CZ1A 4CJ3A 4FW2A 3THVA 1W9HA 3U3GA 2B4JA 3DI6A 1JL2A 4JS5A 4FJKA 2F8TA 1C1BA 4KTZA 4RW7A 3EY1A 4FJIA 4FJMA 1C0MA 3NH0A 2KQ2A 1A5XA 2P5OA 2Y1IA 5CY4A 1NK7A 3AV9A 3S9HA 1VSJA 1W0HA 4KRFA 4FLUA 1I3AA 3SZ2A 2F8SA 2G8FA 4FJ7A 4CJVA 4FXDA 4DQIA 3ZT2A 3NH2A 2ZQBA 1HRHA 4ZHRA 4E7IA 3ITHA 4HCBA 4J2DA 4FJNA 2G8IA 1ZBHA 1JKHA 5K14A 1BHLA 2IGIA 4CEEA 5FROA 2R7YA 3HT3A 3LPUA 3V9ZA 2BE2A 1JLEA 1LWCA 1QSSA 5C42A 3OYCA 1SKSA 1QQCA 1RBVA 1REVA 2HMIA 4W5OA 1FKOA 4DU3A 4LSNA 3AVBA 4DF8A 1Z25A 3ZSWA 4HCCA 3TARA 4FK4A 4OLAA 3V9WA 1U47A 5CYQA 3LAKA 1LV5A 4KHUA 3AO4A 1J54A 3KK2A 4E0DA 5KI6A 1D8YA 1RDBA 2Z1HA 3K5NA 5KRTA 3V6DA 1I39A 2RF2A 2HVHA 2HHXA 4DSLA 1K6YA 2I5JA 4BWMA 4GMJB 1BI4A 4OPJA 4AILC 3VQ8A 4BE2A 3RTVA 2XY8A 3V81A 5HP1A 3HSTB 5I3UA 2HB5A 1MU2A 3S3MA 4PA1A 1D5AA 1JLCA 1U45A 1SL0A 2KTQA 4W5NA 1KVCA 2A1RA 1X9WA 2G8HA 3C94A 3QIOA 3HO1A 3HL8A 3AA3A 2Z1GA 1TKXA 3AVFA 1C0UA 4CJPA 2GUIA 1FXXA 3SJJA 2VWKA 1YVUA 1BIZA 3PUFA 3B6PA 1S1UA 3AVGA 4CHQA 4FJ8A 5EU7A 3ZSYA 3WNGA 4DU4A 4HUFA 1A5VA 4LH5A 2Y1JA 4FZYA 1FKPA 2WOMA 3FFIA
chains in the Genus database with same CATH superfamily
1JLQA 3K2PA 4F8RA 3RSEA 5AQTA 1Z6RA 4DV7K 1Q81O 4EP5A 3J8AA 4MDAA 2NUBA 1I94K 3SQ0A 1L3SA 4CZKA 2OTJN 2G8VA 4O5FA 4FYDA 3ZEUA 4JKFA 3HP6A 1A5WA 1QZ6A 1J5EK 3FZHA 4XH1A 4NLCA 3VQQA 1KTQA 4M3TA 2X6NA 2H3GX 3AVIA 4GVMA 3TAGA 2OPQA 4BRPA 4CFBA 4H5RA 4BRFA 2P9PB 3DXKB 1SS6A 3UE5A 1TK5A 1HLUA 4FVUA 1D9DA 4I6MB 4YOTA 3U8XA 1U48A 1NGJA 2VWJA 3SPYA 3FR0A 4FOEA 1TL1A 4Z4CA 3DLBA 4CE9A 3ID6A 1RT3A 3VF6A 1NGIA 3VQEA 4R5PA 3QINA 1N32K 2VGNA 1VSKA 4C8LA 3I8BA 3VEYA 4GV9A 3ID8A 4E7HA 4DR2K 3K57A 4FSVA 2PYJA 3T1HK 5AQPA 3AVHA 2FBTA 2YKNA 1SL2A 3U3YA 1QVGM 1ATNA 1FK9A 4CW7B 1LWEA 4O4GA 3F9MA 1CXQA 1E3MA 4W5RA 5M1FA 2XHBA 3LWLA 3TTFA 4C8KA 4YDUC 3TSPA 4N5SA 4FZZA 4FLVA 4CFAA 1SAZA 5ADXH 3MCPA 4HTUA 3CJCA 3QEVA 3IAYA 4C8MA 4DR5K 2YNGA 4DTPA 3RVCA 3E9OA 4E1MA 3CCEN 2NRTA 5JLHA 2WBNA 3HYFA 1B92A 4B8AB 4BGAA 4DB3A 3PV8A 4NCGA 2YHAA 5AQLA 1CZAN 2FC0A 4A57A 2YJEA 2E4LA 3THWB 4JKDA 4RG8A 3F73A 3RRGA 1WBDA 3T69A 4KHNA 4DR7K 4FO0A 3IDHA 3C0BA 1KQSM 3LALA 1IG8A 3MECA 2WONA 2NRZA 4JKCA 4H8KA 2VWBA 3ZSZA 4CD1A 1Q9XA 1BA1A 1SUQA 4LF8K 1NU0A 4ISEA 4B9TA 2O8CA 2A1SA 4AQYK 3O3GA 2HVIA 1HKCA 1BO5O 4LSLA 5KQ8A 4DTMA 1DEJA 2V52B 1YXQA 1X3NA 2D0BA 4X62K 5LMNK 4BDPA 1C0GA 4FLZA 1CLQA 1JXBA 2D0AA 3TI0A 4CZGA 1HKGA 4FWSA 1W97L 1GLBG 2IAJA 4Y1DA 1IV0A 2QXFA 5B8HA 4C8OA 4FJGA 3IS9A 5BRFA 3Q7CA 1SQKA 2P9NB 1YF5L 1NK9A 1ZBFA 4F9OA 5GAGP 1HPMA 3H3NO 3QDKA 3DXMB 5SWMA 4CJEA 2HSTA 3SPZA 3CJ9A 4BRHA 2RKIA 1RT7A 4U67L 5J2QA 1EKEA 4BE0A 1UAXA 3WNFA 4A62A 1HKBA 2QWQA 4CZLA 2PY5A 2NRHA 4M3XA 4KHYA 1VHXA 2P9SB 4WQ4C 2Q0UA 5KPRA 3VQCA 2NRVA 1ILYA 1RFQA 2A6AA 3WXIA 2ATQA 1RDDA 1RBSA 4AM7A 4NYNA 4MLEA 3BDPA 5AQRA 3HM9A 3A5MC 3IG1A 2WTUA 4KAZA 1GLEG 3EN9A 1XHZA 2UUAK 3V1QA 1EXQA 3J80O 3MXJA 3T3FA 4KPYA 1EETA 1WSHA 5MLCQ 3O3HA 4N56A 2OANA 3R9PA 4JV5K 4ZTJA 2FBVA 3CPEA 4DMNA 1S5JA 4A2AA 1SV5A 3PX0A 4RW9A 2B5JA 3RMAA 4E3SA 4W5TA 4QS7A 2FSJA 4HTLA 4Z4FA 1R59O 2BTFA 4C8NA 3WXJA 5T7BA 4FJJA 4J2BA 1UWBA 4H5VA 3OS0A 2NRWA 3QEWA 3RWUA 3ULDA 1DT9A 3WNHA 4GNIA 5KGWA 3AVAA 3SUQA 1VRTA 3C6UA 1H1VA 1P90A 3D45A 1NKCA 4GW6A 3P5JA 4NXMK 3VEOA 3CC7N 2ETJA 2VGMA 4CGHA 4CZHA 4HHTA 1RBRA 3K0SA 4CJUA 4ISFA 3AA2A 3E9PA 4ZTFA 1WSJA 3OYGA 2D4WA 4BG9A 4DR3K 4M41A 1DLOA 2KFNA 4K41A 3RMBA 4AF1A 4UQGA 1J5OA 2A40A 1JLBA 4JK7A 1UA1A 3FGUA 4JD2B 4IG3A 3DRPA 3QNNA 4M45A 1VSLA 3VGMA 1YT3A 4KREA 4CJQA 3C6TA 1NKBA 2F9TA 1NBWA 4I2PA 2XRIA 4O0IA 3L2WA 3QERA 5CYMA 3MAQA 2OPRA 4MLHA 1FW6A 2F9WA 4FLYA 3SUOA 1L3VA 3C7NB 4Q0BA 2HNDA 3O9TA 3C6HA 3O4WA 4V19S 1NGBA 5AQMA 4B3TK 3KVGA 2CH6A 1S6PA 2HBJA 4H0PA 2QWRA 3ZYYX 3LP0A 1N5YA 4O8UA 3D7EO 4DSFA 1JLAA 2OPPA 2YHXA 1WOQA 3VEWA 4K42A 4CF2A 3O3FA 4YY3K 3KJVA 3JS6A 3KWIA 3FZMA 4Z4GA 3ZSOA 1C6VA 1BA0A 3NF8A 4LC9B 3V9UA 3HVRA 1SKRA 1O1WA 5E84A 3TU5A 3QFUA 1JLFA 3P83D 4JS4A 4FZXC 3W3DA 3PIOL 4WE1A 4CEDA 2EHGA 1HQEA 4E7JA 1T8EA 5GAEP 4CGIA 4DTOA 2O8FA 4GV6A 4BRAA 2V51B 4CIEA 3BF3A 1EWQA 4B9MA 4N47A 2E8AA 3ZETB 3QBWA 5F0XA 4ICLA 3RR7A 4Z4EA 1VRUA 4AH9A 2YHYA 4FWOA 3SK3A 1WSFA 4JI1K 4DSJA 1HYVA 5CZ1A 3HOTA 1JJ2M 3OBWA 4FW2A 3U3GA 2B4JA 3DI6A 3TPQA 2F8TA 3EY1A 4WFAL 2Y1IA 1NK7A 3FLCO 4IEEA 3S9HA 1VSJA 2QWMA 4DQIA 2GWJA 3NH2A 1HR0K 4FJNA 4ZHRA 4E7IA 3ITHA 4NO7A 3MN7A 4J2DA 3C6AA 1ZBHA 2IGIA 5FROA 2R7YA 3PIPL 1XMOK 3V9ZA 2NNWA 5C42A 3CCVN 1FKOA 3AVBA 3SJHA 1Z25A 4HCCA 3VF4A 2IVNA 3EE8A 2W6KA 2P9UB 1U47A 3KK2A 1EQYA 5KI6A 1D8YA 2Z1HA 5KRTA 4WYBA 4BR2A 4CBXA 2W40A 4AILC 4YOXA 3VQ8A 2O8EB 1S22A 4CBWA 3HSTB 1MU2A 1SL0A 4W5NA 1D5AA 4K43A 4IDHA 3B8AX 1KVCA 2A1RA 3FE1A 5AZIA 2FSNA 5AFUH 3CF5L 2Z1GA 3ZX0A 1C0UA 2WUSA 2VWKA 3TTCA 1BIZA 4FJ8A 3B6PA 3AVGA 5EU7A 4BG8A 5AQIA 4DU4A 4HUFA 4LH5A 2Q97A 1V4TA 1FKPA 3WXKA 4EHUA 1YHQN 3FFIA 1NMDA 1E4GT 3VESA 1RT4A 4CF1A 3H08A 4I9QA 4IXCA 5HL7L 4DU1A 3SLCA 3PO5A 4M3UA 4EFHA 5BPLA 3U9ZA 4BC2A 3CHWA 2XY5A 2AP1A 1BCOA 4CIFA 3E1YA 1VQ6N 4EIAA 3LAMA 1NGFA 3WXMB 4B9LA 4O8KA 3MN9A 1LOTB 2DFEA 3NMUA 3HPHA 3TSQA 2BUPA 4ELUA 1Y64A 3CC2N 3AVNA 3I33A 1U49A 4L3QA 3THXA 3NGZA 4H5WA 3EEQA 1WLJA 3KIOA 4FLXA 4CEFA 3HPOA 5GADP 1S1XA 2UU9K 5F2RA 1JL1A 5LJVA 2O4GA 3T19A 3E01A 4CK1A 3S3NA 3EE9A 1ATSA 4H0VB 1HNWK 4F3TA 1WAFA 2HBKA 4ILGB 5KPTA 2O4IA 3HM8A 4DLGA 3V9SA 1BG3A 5C12A 3L0QA 2GTDA 2HNYA 2HNZA 3HTVA 2A5XA 4E7KA 4FWQA 4IWVA 4DQ8A 2YKMA 3NAEA 5J1EA 5C2FA 4PL7A 2P51A 5AZJA 3SAHA 1BI4B 4DSKA 3VA3A 4EAHD 2BDPA 2DTUA 1BUPA 3AA5X 2QKBA 1XNRK 5EOYA 2ZWHA 4NLBA 1RGIA 3SI6A 2CGJA 2HBLA 4KH5A 3CQ8A 3DAWA 4LF7K 1BL3A 4M3YA 1JCGA 4DV2K 2QKKA 5LY3A 4OGEA 3U6FA 4DFKA 1WBBA 3KLFA 3CM6A 3KK1A 2DY4A 4PKHA 4IOXA 1Q82O 3IUCA 4CF9A 2O8DB 4IKFA 2NLXA 5KGXA 3VQ5A 4DFMA 2UUBK 4KO0A 3KLHA 5TKWA 1IO2A 5LJWA 3P39A 2RHKA 1RDCA 2RE2A 5EX5A 1T05A 2ASOA 4DTNA 3TAEA 3ASMA 4JLHA 4HUGA 2Q3SA 4J8FA 4BQLA 5HRPA 3CCJN 4B9UA 1VQ8N 3CCMN 2HW3A 3KLGA 1QHAA 3OVNA 1TYQA 1XWLA 1CZ9A 4DQRA 4FK0A 2YHBA 3RR8A 1HPZA 1N34K 4AHUA 4ELTA 1KAZA 3F9KA 1LW0A 1TKTA 2QW9A 5M1OA 1QQMA 4FWKA 3BP8A 2LSNA 4CK3A 3VQPA 4JI5K 1NK8A 4I7FA 4JHDB 4O5BA 3SV4A 5JICA 4BR5A 3NH1A 5AQHA 4KH4A 4RTFD 2QM1A 3AVCA 4F2SA 4FK2A 4XH5A 3K5LA 1WB9A 3K5MA 4E7LA 4B1WB 3G10A 4BROA 1YAGA 3UIQA 4BREA 4KI6A 4DS5A 4IOCL 4ELVA 4I2QA 5LL6Z 5LMUK 4DV6K 2GELA 5BPNA 1N6QA 2V7ZA 5H1SQ 3O1WA 3TABA 4LF9K 1ZBIA 1RDWX 2YNFA 1GLCG 3DLRA 5AQNA 1C1AA 3O6WA 4FWLA 2YX6A 4JKGA 2BGGA 4GKJK 3IRXA 2RPIA 3UB5A 1BCMA 2QA4N 3K5OA 2OYQA 1XUPO 3G0ZA 3H6EA 3OYKA 1S3XA 1NOZA 1XC3A 3RMCA 4Y0WA 4JKHA 1Q18A 3R6MA 4DTUA 3KD1E 4YOYA 5HLFA 1NWKA 3K59A 3G4SN 5TKYA 3H1QA 5DM6L 4KTWA 1RT2A 5C0YA 3J7YP 1RNHA 1Z05A 4BRLA 3L4QA 3E66A 4N41A 4FWNA 3CETA 5KQDA 2E88A 1VK0A 2J4RA 4G9ZA 1BIUA 1VAZA 1HUXA 4B08A 1D9FA 5BRHA 5KPZA 2Q31A 5AQXA 4HUEA 1HYZA 3KK3A 2JLEA 1YITN 4CESA 3N4PA 2VQFK 4IZ9A 1IKVA 3OW2M 4DFJA 1U2VA 4BR9A 1YVNA 5DM7L 1WUAA 3CFPA 4LY7A 3CXCM 5I42A 3O9QA 2UXDK 5IT9O 3SYZA 2P5GA 4NCBA 4E89A 4GY2B 1O13A 2F7TA 3CM5A 3GG4A 4B8CA 2HHVA 4QS8A 5EY4A 2IS3A 2P9KA 2Z1JA 3GOIA 1SKWA 4BC3A 5FPEA 5HROA 4CHYA 4LD0A 4FPAA 2FBYA 4FJLA 3DM2A 2JWLA 4JI3K 3D2EB 1N36K 2B6AA 4BE1A 2ZJQL 2KZZA 2OCEA 1S72N 2E2PA 4B1ZA 1VQLN 2ZF5O 3M8PA 3KD5E 3O1BA 4W5QA 1VQKN 3ATUA 3PO4A 4F4KA 3D2FA 3QMLA 3TANA 3HP9A 3GBTA 2GWKA 4M3RA 4CF0A 4E19A 1TVRA 3LP1A 4QCLA 3WQUA 3HXMA 3ZT0A 2CGKA 4PL8A 4Z4IA 4RWTA 3MEDA 4AM6A 5JLFA 3OYBA 1K73O 2D5RA 2IVPA 5BN8A 3RRHA 2VG5A 3ZSXA 3WT0A 4KHQA 4CEBA 2UYTA 1NGAA 1Q8IA 1NJZA 4YFUA 4IOAL 2Z1IA 3VEVA 3NGYA 4C23A 4BVPA 4ISGA 3FZLA 3DLGA 4CEAA 1LCUA 3A5NC 3MMVA 4CJFA 3O4NA 3EZ5A 3NF6A 1HJRA 3OYHA 2O8BB 4MFBA 1RBTA 3QESA 5HRNA 1YTUA 4PUOA 2D0OA 3CJBA 3HBTA 3IFRA 4IFYA 3ULEB 5JVHL 4DQSA 4TSXA 3ZCMA 4NB4A 1IH7A 3QETA 1YI2N 3VEZA 1NKEA 1S9GA 2V7YA 1TAUA 4BR4A 4CHNA 4BACA 3DLLL 5AQJA 3CMAN 1TKZA 3CYMA 3OY9A 2X78A 3EO3A 5FRMA 3AVJA 1ZXOA 4DQQA 5AJ3K 4OVLA 4CGGA 2E2NA 3VQ9A 4BWJA 1TK0A 2KZMA 4BRMA 4CGFA 2P9PA 1RTDA 3DXKA 3LPTA 3JAMO 4EHTA 1RDUA 4I6MA 1XQSC 4JS5A 1C1BA 4RW7A 4FJIA 4LF4K 4FLUA 1I3AA 2F8SA 1BU6O 4JKBA 2HMPA 4HCBA 2P9LB 1JKHA 1BHLA 1JCEA 3SBTA 3HT3A 4OX9K 4JNEA 1LWCA 4ILJA 3F5TA 2GEMA 1RBVA 3OTOK 2UXBK 2HMIA 4E1JA 4LSNA 2F4VK 4KHPK 3ZSWA 3TARA 3V9WA 5CYQA 3LAKA 1LV5A 3GE1A 4DCHA 3R1XA 5C2DA 3K5NA 1I39A 2HVHA 3N4QA 3IMXA 1SZ2A 2E2QA 4WFBL 1HX1A 1K6YA 4BWMA 2PFUA 4IJAA 4BE2A 5IWAK 5I3UA 1U45A 3S3MA 4PA1A 4YORA 3CCQN 1VQON 3THYB 3HO1A 3I55N 3AVFA 5GINA 3BF1A 1S1UA 3ZSYA 4XH4A 3FZFA 1DKGD 3UKRB 2Y1JA 1WN7A 3L2RA 5AQOA 2VQEK 3CFRA 3OYIA 3RMDA 1EX4A 1NK4A 1IKWA 4M63C 2JGUA 2ZM6K 2ITMA 3AO3A 3HPGA 2E6LA 3M3ZA 4XIUA 3H45C 4A5AA 3I8DA 4KTQA 3NF7A 3G25A 3SNNA 3ENHA 5BR9A 1YJWN 3L3UA 4FJ5A 3LL3A 4CJWA 4LF6K 4Y1CA 4DSIA 2QK9A 1C0FA 2HOEA 3V9XA 1QSLA 4K25A 3U4LA 4CBUA 5BREA 3BGRA 3VGLA 2OPSA 5A2QO 4RW6A 1SL1A 1TV6A 4QS9A 2WC9A 3DJCA 3Q7BA 4L8RB 3CJ1A 3QB0A 4DWIA 2XY7A 2NZTA 4YNQA 3NHGA 3CD6N 4FOIA 4PY5A 3LM2A 4LFBK 1S6QA 3D6RA 2E1YA 3L6QA 4YOVA 2JWKA 3DLEA 3LZJA 4EZ6A 5CZ2A 2P9NA 2ZD1A 4CJSA 2E6MA 1ZBLA 1GLJO 3BUZB 3DLHA 4OGCA 4CZEA 3PY8A 1UA0A 3DXMA 3I0SA 2OTLN 1NOYA 1Y97A 4JI2K 4FM1A 4OPKA 2P9IB 3ZSVA 3CQYA 4FCYA 4CZIA 3TAPA 4KHWA 3UKUB 1MA9B 4B1VA 3LZIA 2P9SA 3G6EN 1RILA 1YTAA 2DFHA 3SAFA 3SBGA 3S41A 4H0XB 4K8ZA 3BZCA 4B3RK 3KLEA 4J2EA 5F1XA 1QVFM 3AARA 1RCHA 5FPNA 1HYSA 4IFVA 1OH6A 3JYTA 1MWKA 2HHWA 5DMRA 3RSEB 3L2VA 3HJFA 3DYAA 2YI1A 4JI7K 1EP4A 4WQ5A 4BDYA 2OZSA 3QEXA 1VSIA 3SQ4A 1NJIO 4FVMA 3ZEUB 1VSMA 3TTDA 4KI4A 1CZBA 4CECA 1B9DA 2GBZA 3JSMA 3OJSA 4HWIA 3ZT1A 2ASPA 1TUYA 3TAFA 4KHSA 4CJ4A 4X64K 3GDQA 2BANA 5AQGA 3V1OA 1IKYA 4E1NA 1IBMK 3LM9A 3OS2A 1OH8A 3MN6A 2YNIA 4JRQA 3MN5A 1T03A 2EX3A 4B1XB 3MK6A 1IJJA 1XC9A 5BN9A 2G8KA 3LWMA 1HNIA 4BGBA 1NGEA 1HNZK 1NLVA 3TWHA 4OKEA 4C1NI 4KV8A 1RTHA 1YJNN 1NJWA 4AHSA 3NDKA 1DGKN 3OA9A 4CCHA 4BDZA 4JYAK 3KKSA 1L5UA 1L3TA 1HNXK 1QE1A 1G15A 3ISNC 4CFDA 3OYNA 2OZMA 2IC3A 4MO4A 4B3OA 4BRCA 1GLAG 4LFCK 2QWPA 3DMJA 3MXIA 1KSPA 1VSFA 4JI8K 5E26A 1UOCA 1K8AO 3O80A 4ID1A 3QBXA 4A59A 3NF9A 4RCHA 4PKIA 2GV9A 3U9DA 4CZMA 3CCSN 4NXNK 3SUNA 3TSUA 1NK5A 3CCUN 1ASWA 3KZBA 4BR7A 3S3OA 2Q36A 1BGXT 3HI0A 5E41A 3MXMA 3OJUA 1YIJN 4M7XA 5ELZA 3LP3A 4K8XA 1QTMA 2BH1A 5C24A 3SQ1A 2FF6A 5FDLA 3C7NA 1NGGA 2HHSA 5BRDA 2QWOA 4KFBA 1OH7A 1OH5A 3FZKA 3KHYA 1GOAA 3AAPA 3EZWA 4JEPA 5J2PA 3VMFB 1KCFA 1KLNA 2PYLA 2PZSA 4BY9C 2O8CB 4CI6A 3OHRA 4DF4A 4H03B 3WEEA 3WUHA 1ZC6A 5AQFA 4FLTA 1P8ZA 1CXUA 1GOBA 4RW8A 1TKDA 3ZLJA 4J2AA 4EP4A 4WFNL 4AHVA 4DLEA 4IFEA 4JN4A 3MCAB 4DFPA 3QEIA 3AO1A 4H0YB 5SZTA 2I7NA 3ALYA 3H46O 2PAVA 2YHWA 3OYJA 3A0IX 4X65K 1T6CA 3NCIA 4JKAA 3TR8A 3VN5A 3ZETA 1Q7YO 1WAJA 3M5RA 3L2UA 1GLFO 4JK9A 4CK2A 3CI5A 2W42A 5DK5A 1K9MO 2OA8A 4DV1K 4C1NK 3CERA 3VQDA 3O9SA 2CH5A 2HHTA 4H0OA 1U4BA 1ASVA 1VSEA 4RW4A 1ASUA 4CGDA 2QWNA 1WSIA 1MDUB 3FFKB 1TUUA 4B9SA 1FJGK 3PX6A 1V4SA 2NRXA 2G8UA 2G8WA 5EXWA 4G1QA 3H3OB 3BEXA 3KKRA 4ILHA 1J53A 3VEXA 3VPZA 3A5LC 4FL9A 2IIRA 1NJXA 4OPHA 3VTHA 3L2QA 1EWRA 3PSIA 1NGDA 3CQXA 1YJ9N 1NK6A 4FWPA 2P9UA 1Z26A 1T7PA 4DTXA 2X6SA 3VENA 4X66K 3CCRN 5D3GA 1ZBSA 1F21A 5J2NA 3C65A 2PBDA 2QWLA 3HVTA 3OYLA 4OPAA 2O8EA 1RBUA 2QTDA 2FBXA 4F2RA 4BC4A 1KC8O 3NGIA 4WF9L 4DV5K 3I56N 2VG7A 3PSFA 4B3MK 4DG1A 1TAQA 4B9VA 2ZJRL 1KLMA 1ZBUA 3A2FA 1BOTO 3DOLA 1NK0A 2P1JA 2HHUA 5FRNA 1W2BM 3OYAA 3NFAA 3ZT4A 3M6GA 3BY5A 2FXUA 4OO1J 5KRSA 4DV4K 1BISA 4YHHK 1B9FA 5ADXA 3NVMA 3G71N 3T7ZA 4BVOA 4AHTA 2X74A 3C95A 4FJXA 4A5BA 4B3SK 3LANA 4MDBA 4CJ3A 3THVA 2HBMA 4KTZA 2CGLA 4FJMA 1C0MA 2KQ2A 1A5XA 1YUWA 3EKSA 3OBYA 4KRFA 4CJVA 1NGHA 4FXDA 2ZQBA 1HRHA 1E4FT 4PHTX 3LPUA 2BE2A 1JLEA 1QSSA 1SKSA 1QQCA 4W5OA 4DF8A 4CZJA 3ZX3A 1X9JA 3A8YA 1OKJA 1RDBA 3T1YK 3V6DA 2RF2A 4WQ5C 2HHXA 4DSLA 2I5JA 4GMJB 1BI4A 4OPJA 2QI2A 3RTVA 3V81A 5HP1A 1KXPA 4FJ7A 1K8KA 2HB5A 1JLCA 3AAQA 2KTQA 1GLLO 1U6ZA 2G8HA 1X9WA 1TKXA 2GUIA 4CHQA 3WNGA 4DUYK 1A5VA 2Q0RA 2WOMA 4FPBA 3CG7A 4CEZA 2O8DA 3CC4N 4DUZK 5AQKA 3V1RA 3VQBA 3ZSQA 4FM2A 2O8FB 1NNEA 4DTJA 4OLBA 3OS1A 5C15A 4H4MA 3KLIA 2A3ZA 3LDNA 1NGCA 2ZJPL 3D0PA 5CHIA 1XI1A 2A41A 3VERA 4M42A 1JCFA 2VCPA 1RT1A 4B9NA 3T1AA 2D0PA 4IG0A 2QEXN 5CE3A 5M1NA 3J7AP 1X9SA 4MQ3A 4BRQA 4BRIA 3DLKA 5AQYA 4WCEL 2KLAA 2UXCK 5GIOA 1KAXA 3M8RA 1X9MA 1BWFO 4JI6K 2ITGA 2HF4A 4DSEA 1QQNA 4IBNA 4JRPA 1ZYQA 4M3WA 1G99A 3QIPA 1HNVA 5C25A 5AQQA 1T44A 1OVYA 4DR1K 1EO1A 4JHDA 3L3VA 3EL2A 1C1CA 1NMNA 4LH4A 4OKKA 4A61A 2NRRA 2XO7A 4IO8A 4KB0A 3K9KA 3NVKA 1M1KO 3DRRA 2F96A 3MEGA 3AVLA 3MX5A 1HQUA 4M3ZA 3K58A 5GAHP 1OVQA 1VSDA 3SUPA 4DHYA 3B6OA 1DTQA 4UY8O 3LDOA 5AR0A 4B1YB 5AZIB 3M1FA 3ZT3A 1XHXA 4IDKA 3SV3A 4CEOA 3AO2A 4PKGA 3ENBA 1NJYA 4O44A 3LDPA 4BRKA 3NE6A 5HOOA 3MWPA 4GVEA 1BQNA 4R79A 3J81O 3OYDA 3VGKA 3SQ2A 2E2OA 2ASMA 4EZ9A 1LAVA 4FWMA 2D0CA 4Z0UA 3OYMA 5BPMA 4OJRA 3CCLN 4DV3K 4CHPA 1ITGA 4BC5A 3ZSRA 1L3UA 1N8RO 4YOWA 2VG6A 1QHTA 3DRSA 5AQWA 4ID5A 4FJHA 3M8QA 5J2MA 1VSHA 2FF3B 3AVMA 3SAGA 1IBKK 2AA4A 2DFFA 3O9UA 3HRGA 1N33K 3LDQA 3QNOA 4KH6A 1IKXA 4Z4HA 3THXB 4BRNA 4AHCA 1WSGA 3GL1A 4DR4K 4DQPA 1BDGA 4K0KK 3O8MA 1RTJA 4DTRA 3R3LA 4O0JA 1NG9A 3L8BA 5FLXO 1KD1O 3JXUA 3BZKA 1U04A 5JVGL 1XNQK 4KBOA 2ZGZA 4CJLA 2Q2RA 3THWA 5JS2A 4H5TA 3LP2A 3O9RA 4H4OA 4JI4K 4NYFA 5I9EB 3L4IA 3KTQA 3CIPA 1Q9YA 3M8SA 3TAQA 2GUPA 4XEIA 3D2EA 3MWTA 3KK7A 2YNHA 3DOKA 3CJAA 5AZJB 3O5BA 3VTIA 4AHRA 4DS4A 1TGOA 4PQUA 1QZ5A 4LF5K 4BR0A 3VOVA 3O4QA 4M7YA 3HK2A 3V4IA 3NBPA 2QXLA 1X1PA 3A5OC 1KVBA 4FWRA 2UUCK 3QEPA 2HHQA 2KW4A 4BRDA 4IO9L 2ZE2A 4H5NA 4OKJA 1VQNN 3VETA 4O55A 5HRSA 4HVJA 5JMVA 4MO5A 1LAWA 4CGJA 5HBMA 4I9LA 3WEEB 1WSEA 3KWGA 3TAMA 4B9QA 4CJRA 5C10A 1GOCA 5EVZA 1RDAA 1NM1A 3E9LA 5M1KA 4YOUA 2XY6A 5GIPA 3MDQA 4KB1A 4YDUA 4U7BA 4LFAK 5AQVA 1LWFA 3AA4A 3QO9A 4CEQA 1VQ7N 2HHHK 1TYQB 4JKEA 2YCHA 3WXLA 2KKZA 4FLWA 5AQUA 4Q5VA 4NCAA 1D4XA 1C0TA 2YJFA 3AO5A 3I0RA 1M90O 2E1ZA 3OYFA 4JI0K 1S1VA 2RN2A 3EYZA 3OYEA 2O8BA 2AJQA 1J9AA 2W41A 1ESVA 4PWDA 5HRRA 3ULEA 4A2BA 1IG9A 3WNEA 4DTSA 4CF8A 2E20A 3QFPA 5BR8K 1ATRA 3LDLA 3MEEA 1VQ9N 2IDOA 1HJOA 5M1QA 3SCXA 1X3MA 2KFZA 3ZX2A 3MX2A 3SMPA 4FW1A 5KTQA 5AFUA 4CHZA 1KFSA 3DWLA 1KRPA 5JS1A 3EKUA 3AVKA 4IEIA 1GLDG 3P1GA 1W7AA 4QOZB 4CERA 3SMSA 1RTIA 3VQ4A 3J7ZO 1HMVA 1T6DA 4JK8A 4JKGB 1WNSA 1T3VA 5FPMA 2GX9A 4CJ7A 5AQSA 1S1TA 3ATVA 4BQZA 1TK8A 1LW2A 4FJ9A 2P9LA 1QSYA 4N76A 3QLHA 2IOCA 2YV0X 4CVNE 3IKMA 1KFDA 2HF3A 1KAYA 3P38A 4CHOA 4JAXA 1S9EA 1BQMA 4CJTA 4JD2A 4WQ4A 1IBLK 3R8EA 2KHOA 4FM0A 4DR6K 4CIGA 3K9JA 4CFCA 3P31A 1Q86O 1TL3A 3PLAA 2W6LA 1KVAA 4GV3A 3VQ6A 3QICA 4B1UB 3THYA 1S1WA 1VQMN 1J6ZA 3VQ7A 1DTTA 1R0AA 1U2VB 4DV0K 3AY9A 3HSCA 3UKRA 2FSKA 3VA0A 3HZ6A 3CPWM 3W0LA 4CJ5A 3CFOA 3LDSA 3VQAA 1QS4A 2WFBA 2DPNA 2P9KB 1VQ4N 1RT6A 3CMEN 2A42A 3F2KA 1MWMA 1JXEA 2FLOA 4KKOA 2ZGYA 1RT5A 2I7PA 1JLGA 3PX4A 4CJKA 5CR4A 4F3OA 1VQ5N 4QAGA 1XMQK 3D2FB 1W9HA 2EWSA 1JL2A 4FJKA 3HOSA 1K8KB 2D1KA 3P4IA 3NH0A 3H1VX 2P5OA 5CY4A 3VF2A 3AV9A 4H0TB 1W0HA 3SZ2A 2G8FA 2VYPA 3ZT2A 2G8IA 3CJ7A 5K14A 4CEEA 4GKKK 4CD3A 3OYCA 5M1PA 4CZFA 1REVA 2IVOA 4DU3A 3ENOA 1QQOA 4FK4A 3AGRA 4OLAA 2E5LK 1VQPN 4KHUA 3AO4A 1J54A 5FPDA 2Q1NA 4Z94A 4E0DA 4IJNA 3O08A 2P9IA 2XY8A 5AQZA 3UKUA 3WQTA 3C94A 3QIOA 3HL8A 3AA3A 4CJPA 1FXXA 3SJJA 1YVUA 3PUFA 4BRGA 4FZYA 3AGKA 4DKWA
chains in the Genus database with same CATH topology
1JLQA 1WN7A 3K2PA 3L2RA 4F8RA 3CFRA 3OYIA 3RMDA 3CG7A 1EX4A 4EP5A 1NK4A 4CEZA 1RT4A 2NUBA 1IKWA 4CF1A 3SQ0A 4KPYA 3V1RA 3VQBA 1L3SA 3H08A 2JGUA 3ZSQA 2G8VA 4FM2A 3AO3A 3HPGA 4I9QA 4FYDA 4DTJA 2E6LA 4XIUA 4OLBA 3OS1A 4DU1A 3I8DA 3PO5A 3HP6A 1A5WA 4KTQA 4H4MA 4M3UA 3KLIA 3NF7A 3SNNA 3VQQA 3D0PA 1KTQA 3L3UA 2XY5A 1XI1A 4FJ5A 4M3TA 4M42A 4CJWA 1RT1A 4B9NA 2X6NA 1BCOA 3AVIA 4Y1CA 4GVMA 4CIFA 4DSIA 2QK9A 3TAGA 2OPQA 3LAMA 3T1AA 4B9LA 4IG0A 2DFEA 4CFBA 3HPHA 3V9XA 1QSLA 1X9SA 4MQ3A 3DLKA 3BGRA 4ELUA 2OPSA 1TK5A 4RW6A 1SL1A 1TV6A 1D9DA 3AVNA 1U49A 4L8RB 1U48A 2VWJA 3M8RA 3NGZA 3SPYA 1X9MA 4DWIA 1WLJA 3KIOA 2XY7A 4FLXA 4CEFA 2ITGA 3HPOA 4DSEA 1S1XA 4IBNA 4JRPA 1ZYQA 4M3WA 5C25A 3QIPA 1HNVA 1JL1A 4YNQA 1TL1A 3NHGA 4Z4CA 2O4GA 3DLBA 4CE9A 4PY5A 3T19A 1S6QA 3E01A 4CK1A 3S3NA 1RT3A 3L3VA 3VQEA 4F3TA 1C1CA 3DLEA 3LZJA 4EZ6A 4OKKA 4LH4A 1WAFA 3QINA 5CZ2A 4R5PA 2ZD1A 4CJSA 2XO7A 1VSKA 4C8LA 2E6MA 4KB0A 4DLGA 2O4IA 1ZBLA 3V9SA 4E7HA 2HNYA 2HNZA 3DRRA 4OGCA 2F96A 3DLHA 3K57A 3MEGA 2PYJA 3PY8A 3AVLA 1UA0A 1HQUA 3AVHA 3I0SA 4M3ZA 4E7KA 1NOYA 1Y97A 2FBTA 2YKMA 2YKNA 3NAEA 5J1EA 3U3YA 1SL2A 3K58A 1FK9A 1VSDA 2P51A 4FM1A 3SUPA 1LWEA 4O4GA 4OPKA 1CXQA 3ZSVA 1BI4B 4W5RA 4FCYA 3B6OA 1DTQA 2XHBA 3TAPA 3VA3A 3LWLA 4DSKA 4KHWA 2BDPA 2DTUA 4C8KA 3AA5X 2QKBA 3LZIA 4N5SA 4FZZA 4FLVA 1RILA 4CFAA 1YTAA 2DFHA 3ZT3A 3SI6A 1XHXA 4IDKA 3SV3A 4CEOA 4K8ZA 3AO2A 3CQ8A 4M3YA 3KLEA 1BL3A 4J2EA 1NJYA 4HTUA 4O44A 2QKKA 3NE6A 3QEVA 3IAYA 1RCHA 4OGEA 1BQNA 3U6FA 4DFKA 1HYSA 4IFVA 4C8MA 3OYDA 3KLFA 3JYTA 3CM6A 3SQ2A 2YNGA 4DTPA 3KK1A 2HHWA 5DMRA 2DY4A 4CF9A 4E1MA 3L2VA 3HJFA 4EZ9A 4IKFA 3DYAA 1LAVA 5KGXA 3VQ5A 2D0CA 4DFMA 4Z0UA 1EP4A 3HYFA 3OYMA 4KO0A 3KLHA 1B92A 4B8AB 4BDYA 4OJRA 2OZSA 3PV8A 1IO2A 1VSIA 3QEXA 4NCGA 4CHPA 4FVMA 1ITGA 2YHAA 3ZSRA 1VSMA 3SQ4A 1L3UA 1RDCA 1T05A 4DTNA 3TAEA 3ASMA 4KI4A 2VG6A 4JLHA 4HUGA 1QHTA 1CZBA 2Q3SA 2FC0A 1B9DA 2GBZA 3DRSA 4CECA 5HRPA 3JSMA 2E4LA 4B9UA 3OJSA 2HW3A 4RG8A 4ID5A 3ZT1A 4FJHA 3F73A 3M8QA 5J2MA 3RRGA 3KLGA 4KHNA 3TAFA 4KHSA 1VSHA 3OVNA 4CJ4A 3AVMA 1XWLA 2BANA 1CZ9A 3LALA 3MECA 4DQRA 2WONA 3V1OA 4H8KA 2YHBA 4FK0A 3ZSZA 2DFFA 1IKYA 1Q9XA 4E1NA 1HPZA 3RR8A 1SUQA 3QNOA 4AHUA 4ELTA 1IKXA 3OS2A 4B9TA 3F9KA 2A1SA 1LW0A 2YNIA 4Z4HA 1TKTA 3O3GA 4JRQA 4AHCA 2HVIA 1WSGA 1T03A 4LSLA 4DQPA 4DTMA 2EX3A 2LSNA 1RTJA 2D0BA 4CK3A 1CLQA 4DTRA 4BDPA 3VQPA 4FLZA 1JXBA 2D0AA 3TI0A 1XC9A 2G8KA 4O0JA 3LWMA 2IAJA 4Y1DA 1NK8A 2QXFA 4I7FA 4C8OA 3L8BA 4O5BA 3IS9A 4FJGA 1HNIA 3SV4A 3NH1A 3TWHA 1U04A 4OKEA 4CJLA 3AVCA 4KV8A 1RTHA 1NJWA 1NK9A 1ZBFA 4F2SA 5JS2A 4AHSA 3LP2A 4H4OA 3K5LA 3NDKA 4CCHA 4NYFA 3K5MA 4E7LA 4FK2A 3G10A 4BDZA 3KTQA 3UIQA 4KI6A 4DS5A 3KKSA 5SWMA 4CJEA 1Q9YA 1L5UA 1L3TA 3M8SA 3SPZA 3TAQA 4ELVA 2RKIA 4I2QA 1RT7A 1QE1A 1G15A 5J2QA 1N6QA 2YNHA 1EKEA 3DOKA 4AHRA 4BE0A 4DS4A 3ISNC 1UAXA 3WNFA 4CFDA 3OYNA 2IC3A 2YNFA 2OZMA 3DLRA 4B3OA 1TGOA 4PQUA 1C1AA 2PY5A 4M3XA 4KHYA 3DMJA 3MXIA 3O4QA 1KSPA 1VSFA 3V4IA 3VQCA 3HK2A 3NBPA 2BGGA 2ATQA 1RDDA 1UOCA 1X1PA 3IRXA 2RPIA 1KVBA 1BCMA 1RBSA 4ID1A 3K5OA 2OYQA 4NYNA 3BDPA 3HM9A 3QEPA 2HHQA 2KW4A 3G0ZA 3NF9A 3IG1A 2ZE2A 2GV9A 4OKJA 5HRSA 4O55A 3OYKA 4KAZA 4HVJA 3SUNA 1XHZA 1NK5A 1LAWA 1ASWA 4CGJA 5HBMA 4I9LA 1NOZA 1EXQA 3V1QA 3RMCA 1WSEA 3MXJA 3TAMA 3T3FA 4DTUA 3S3OA 3KD1E 1BGXT 1EETA 4CJRA 5E41A 3OJUA 1WSHA 3MXMA 3O3HA 3K59A 5HLFA 1GOCA 3LP3A 4N56A 1QTMA 1RDAA 4K8XA 5C24A 3SQ1A 4ZTJA 4KTWA 5FDLA 2FBVA 1RT2A 2XY6A 2HHSA 4DMNA 1RNHA 1S5JA 4KFBA 4KB1A 4N41A 1SV5A 3PX0A 4RW9A 2B5JA 1VK0A 3RMAA 4E3SA 1BIUA 4W5TA 1GOAA 4B08A 3TABA 4Z4FA 1LWFA 3AA4A 3QO9A 4CEQA 1D9FA 4C8NA 5J2PA 5T7BA 4FLWA 1KCFA 4FJJA 4J2BA 1UWBA 1KLNA 4Q5VA 3OS0A 2PYLA 2PZSA 4NCAA 1C0TA 3QEWA 4HUEA 1HYZA 3AO5A 3I0RA 3KK3A 3RWUA 2JLEA 3WNHA 3OYFA 3ULDA 1S1VA 2RN2A 5KGWA 3EYZA 4CESA 3AVAA 3OYEA 1VRTA 3C6UA 3SUQA 4DF4A 1IKVA 2AJQA 3D45A 4DFJA 1J9AA 1NKCA 4GW6A 3P5JA 3CFPA 4LY7A 4PWDA 5HRRA 5I42A 2ETJA 4CGHA 4FLTA 1IG9A 3WNEA 4HHTA 1CXUA 1GOBA 1RBRA 4RW8A 4DTSA 1TKDA 4CJUA 4EP4A 4J2AA 4CF8A 3SYZA 2P5GA 4AHVA 4NCBA 3AA2A 4E89A 4DLEA 3CM5A 4DFPA 4B8CA 4ZTFA 2HHVA 3QEIA 3MEEA 1WSJA 3AO1A 5SZTA 2IS3A 3ALYA 2IDOA 2Z1JA 3OYGA 3SCXA 1SKWA 3OYJA 4M41A 2KFZA 5HROA 4CHYA 1DLOA 4FW1A 4LD0A 3NCIA 3TR8A 2KFNA 3VN5A 2FBYA 5KTQA 4FJLA 4CHZA 3DM2A 1WAJA 1KFSA 1KRPA 3RMBA 5JS1A 3L2UA 4UQGA 1J5OA 1JLBA 2B6AA 4BE1A 3AVKA 1UA1A 2KZZA 4CK2A 3P1GA 3DRPA 4IG3A 3QNNA 4M45A 4QOZB 4CERA 1VSLA 3VQ4A 1RTIA 1HMVA 3M8PA 2W42A 5DK5A 2OA8A 3KD5E 1YT3A 4W5QA 4KREA 1WNSA 3VQDA 3PO4A 4F4KA 4CJQA 2HHTA 3C6TA 3TANA 3HP9A 1U4BA 1ASVA 1VSEA 1NKBA 4RW4A 1ASUA 4CGDA 1WSIA 4M3RA 4B9SA 4CF0A 1S1TA 4I2PA 3PX6A 4E19A 1TK8A 1LW2A 1TVRA 2XRIA 3LP1A 2G8WA 2G8UA 4QCLA 4FJ9A 3HXMA 4G1QA 3ZT0A 1QSYA 4O0IA 3L2WA 3QLHA 3QERA 4N76A 4Z4IA 2IOCA 5CYMA 3MAQA 2OPRA 3KKRA 3MEDA 1J53A 4FLYA 3SUOA 3OYBA 1L3VA 2YV0X 2D5RA 1NJXA 1KFDA 4Q0BA 3RRHA 2HNDA 2VG5A 3ZSXA 4CHOA 1S9EA 3L2QA 1BQMA 4KHQA 4CEBA 1NK6A 1Q8IA 1Z26A 4CJTA 1T7PA 1NJZA 4DTXA 4YFUA 2X6SA 1S6PA 4FM0A 5D3GA 2Z1IA 3LP0A 1N5YA 1F21A 5J2NA 3NGYA 4CIGA 4DSFA 1JLAA 2OPPA 3HVTA 4CFCA 3OYLA 1TL3A 1RBUA 3DLGA 4CEAA 4CF2A 1KVAA 3O3FA 3KJVA 2FBXA 4CJFA 3EZ5A 3O4NA 4F2RA 3VQ6A 3NF6A 1HJRA 1S1WA 3OYHA 4Z4GA 1ZBIA 4MFBA 3VQ7A 1RBTA 3ZSOA 5HRNA 3QESA 1DTTA 1YTUA 1R0AA 1C6VA 3NF8A 3NGIA 3V9UA 4PUOA 4IFYA 3HVRA 1SKRA 4DQSA 1O1WA 4TSXA 2VG7A 3ZCMA 4DG1A 1IH7A 1TAQA 3QETA 1JLFA 4B9VA 3P83D 1KLMA 4JS4A 1ZBUA 3VA0A 1NKEA 3A2FA 1S9GA 4FZXC 1TAUA 3DOLA 4CJ5A 1NK0A 2P1JA 4WE1A 4CEDA 2HHUA 5FRNA 4CHNA 4BACA 2EHGA 1HQEA 3CFOA 3VQAA 1QS4A 3LDSA 4E7JA 1T8EA 1TKZA 4CGIA 4DTOA 3OYAA 3NFAA 3CYMA 3ZT4A 3OY9A 2X78A 4CIEA 5FRMA 3AVJA 1RT6A 5KRSA 1BISA 4B9MA 4N47A 1B9FA 4DQQA 1JXEA 4ICLA 4KKOA 3RR7A 4OVLA 4CGGA 1RT5A 4Z4EA 1JLGA 1VRUA 4AH9A 3VQ9A 3PX4A 4CJKA 4BWJA 1TK0A 2KZMA 4AHTA 2X74A 3C95A 1WSFA 4CGFA 4F3OA 4FJXA 4QAGA 4DSJA 1RTDA 3LPTA 1HYVA 3LANA 5CZ1A 4CJ3A 4FW2A 3THVA 1W9HA 3U3GA 2B4JA 3DI6A 1JL2A 4JS5A 4FJKA 2F8TA 1C1BA 4KTZA 4RW7A 3EY1A 4FJIA 4FJMA 1C0MA 3NH0A 2KQ2A 1A5XA 2P5OA 2Y1IA 5CY4A 1NK7A 3AV9A 3S9HA 1VSJA 1W0HA 4KRFA 4FLUA 1I3AA 3SZ2A 2F8SA 2G8FA 4FJ7A 4CJVA 4FXDA 4DQIA 3ZT2A 3NH2A 2ZQBA 1HRHA 4ZHRA 4E7IA 3ITHA 4HCBA 4J2DA 4FJNA 2G8IA 1ZBHA 1JKHA 5K14A 1BHLA 2IGIA 4CEEA 5FROA 2R7YA 3HT3A 3LPUA 3V9ZA 2BE2A 1JLEA 1LWCA 1QSSA 5C42A 3OYCA 1SKSA 1QQCA 1RBVA 1REVA 2HMIA 4W5OA 1FKOA 4DU3A 4LSNA 3AVBA 4DF8A 1Z25A 3ZSWA 4HCCA 3TARA 4FK4A 4OLAA 3V9WA 1U47A 5CYQA 3LAKA 1LV5A 4KHUA 3AO4A 1J54A 3KK2A 4E0DA 5KI6A 1D8YA 1RDBA 2Z1HA 3K5NA 5KRTA 3V6DA 1I39A 2RF2A 2HVHA 2HHXA 4DSLA 1K6YA 2I5JA 4BWMA 4GMJB 1BI4A 4OPJA 4AILC 3VQ8A 4BE2A 3RTVA 2XY8A 3V81A 5HP1A 3HSTB 5I3UA 2HB5A 1MU2A 3S3MA 4PA1A 1D5AA 1JLCA 1U45A 1SL0A 2KTQA 4W5NA 1KVCA 2A1RA 1X9WA 2G8HA 3C94A 3QIOA 3HO1A 3HL8A 3AA3A 2Z1GA 1TKXA 3AVFA 1C0UA 4CJPA 2GUIA 1FXXA 3SJJA 2VWKA 1YVUA 1BIZA 3PUFA 3B6PA 1S1UA 3AVGA 4CHQA 4FJ8A 5EU7A 3ZSYA 3WNGA 4DU4A 4HUFA 1A5VA 4LH5A 2Y1JA 4FZYA 1FKPA 2WOMA 3FFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JLQ A;  1WN7 A;  3K2P A;  3L2R A;  4F8R A;  3CFR A;  3OYI A;  3RMD A;  3CG7 A;  1EX4 A;  4EP5 A;  1NK4 A;  4CEZ A;  1RT4 A;  2NUB A;  1IKW A;  4CF1 A;  3SQ0 A;  4KPY A;  3V1R A;  3VQB A;  1L3S A;  3H08 A;  2JGU A;  3ZSQ A;  2G8V A;  4FM2 A;  3AO3 A;  3HPG A;  4I9Q A;  4FYD A;  4DTJ A;  2E6L A;  4XIU A;  4OLB A;  3OS1 A;  4DU1 A;  3I8D A;  3PO5 A;  3HP6 A;  1A5W A;  4KTQ A;  4H4M A;  4M3U A;  3KLI A;  3NF7 A;  3SNN A;  3VQQ A;  3D0P A;  1KTQ A;  3L3U A;  2XY5 A;  1XI1 A;  4FJ5 A;  4M3T A;  4M42 A;  4CJW A;  1RT1 A;  4B9N A;  2X6N A;  1BCO A;  3AVI A;  4Y1C A;  4GVM A;  4CIF A;  4DSI A;  2QK9 A;  3TAG A;  2OPQ A;  3LAM A;  3T1A A;  4B9L A;  4IG0 A;  2DFE A;  4CFB A;  3HPH A;  3V9X A;  1QSL A;  1X9S A;  4MQ3 A;  3DLK A;  3BGR A;  4ELU A;  2OPS A;  1TK5 A;  4RW6 A;  1SL1 A;  1TV6 A;  1D9D A;  3AVN A;  1U49 A;  4L8R B;  1U48 A;  2VWJ A;  3M8R A;  3NGZ A;  3SPY A;  1X9M A;  4DWI A;  1WLJ A;  3KIO A;  2XY7 A;  4FLX A;  4CEF A;  2ITG A;  3HPO A;  4DSE A;  1S1X A;  4IBN A;  4JRP A;  1ZYQ A;  4M3W A;  5C25 A;  3QIP A;  1HNV A;  1JL1 A;  4YNQ A;  1TL1 A;  3NHG A;  4Z4C A;  2O4G A;  3DLB A;  4CE9 A;  4PY5 A;  3T19 A;  1S6Q A;  3E01 A;  4CK1 A;  3S3N A;  1RT3 A;  3L3V A;  3VQE A;  4F3T A;  1C1C A;  3DLE A;  3LZJ A;  4EZ6 A;  4OKK A;  4LH4 A;  1WAF A;  3QIN A;  5CZ2 A;  4R5P A;  2ZD1 A;  4CJS A;  2XO7 A;  1VSK A;  4C8L A;  2E6M A;  4KB0 A;  4DLG A;  2O4I A;  1ZBL A;  3V9S A;  4E7H A;  2HNY A;  2HNZ A;  3DRR A;  4OGC A;  2F96 A;  3DLH A;  3K57 A;  3MEG A;  2PYJ A;  3PY8 A;  3AVL A;  1UA0 A;  1HQU A;  3AVH A;  3I0S A;  4M3Z A;  4E7K A;  1NOY A;  1Y97 A;  2FBT A;  2YKM A;  2YKN A;  3NAE A;  5J1E A;  3U3Y A;  1SL2 A;  3K58 A;  1FK9 A;  1VSD A;  2P51 A;  4FM1 A;  3SUP A;  1LWE A;  4O4G A;  4OPK A;  1CXQ A;  3ZSV A;  1BI4 B;  4W5R A;  4FCY A;  3B6O A;  1DTQ A;  2XHB A;  3TAP A;  3VA3 A;  3LWL A;  4DSK A;  4KHW A;  2BDP A;  2DTU A;  4C8K A;  3AA5 X;  2QKB A;  3LZI A;  4N5S A;  4FZZ A;  4FLV A;  1RIL A;  4CFA A;  1YTA A;  2DFH A;  3ZT3 A;  3SI6 A;  1XHX A;  4IDK A;  3SV3 A;  4CEO A;  4K8Z A;  3AO2 A;  3CQ8 A;  4M3Y A;  3KLE A;  1BL3 A;  4J2E A;  1NJY A;  4HTU A;  4O44 A;  2QKK A;  3NE6 A;  3QEV A;  3IAY A;  1RCH A;  4OGE A;  1BQN A;  3U6F A;  4DFK A;  1HYS A;  4IFV A;  4C8M A;  3OYD A;  3KLF A;  3JYT A;  3CM6 A;  3SQ2 A;  2YNG A;  4DTP A;  3KK1 A;  2HHW A;  5DMR A;  2DY4 A;  4CF9 A;  4E1M A;  3L2V A;  3HJF A;  4EZ9 A;  4IKF A;  3DYA A;  1LAV A;  5KGX A;  3VQ5 A;  2D0C A;  4DFM A;  4Z0U A;  1EP4 A;  3HYF A;  3OYM A;  4KO0 A;  3KLH A;  1B92 A;  4B8A B;  4BDY A;  4OJR A;  2OZS A;  3PV8 A;  1IO2 A;  1VSI A;  3QEX A;  4NCG A;  4CHP A;  4FVM A;  1ITG A;  2YHA A;  3ZSR A;  1VSM A;  3SQ4 A;  1L3U A;  1RDC A;  1T05 A;  4DTN A;  3TAE A;  3ASM A;  4KI4 A;  2VG6 A;  4JLH A;  4HUG A;  1QHT A;  1CZB A;  2Q3S A;  2FC0 A;  1B9D A;  2GBZ A;  3DRS A;  4CEC A;  5HRP A;  3JSM A;  2E4L A;  4B9U A;  3OJS A;  2HW3 A;  4RG8 A;  4ID5 A;  3ZT1 A;  4FJH A;  3F73 A;  3M8Q A;  5J2M A;  3RRG A;  3KLG A;  4KHN A;  3TAF A;  4KHS A;  1VSH A;  3OVN A;  4CJ4 A;  3AVM A;  1XWL A;  2BAN A;  1CZ9 A;  3LAL A;  3MEC A;  4DQR A;  2WON A;  3V1O A;  4H8K A;  2YHB A;  4FK0 A;  3ZSZ A;  2DFF A;  1IKY A;  1Q9X A;  4E1N A;  1HPZ A;  3RR8 A;  1SUQ A;  3QNO A;  4AHU A;  4ELT A;  1IKX A;  3OS2 A;  4B9T A;  3F9K A;  2A1S A;  1LW0 A;  2YNI A;  4Z4H A;  1TKT A;  3O3G A;  4JRQ A;  4AHC A;  2HVI A;  1WSG A;  1T03 A;  4LSL A;  4DQP A;  4DTM A;  2EX3 A;  2LSN A;  1RTJ A;  2D0B A;  4CK3 A;  1CLQ A;  4DTR A;  4BDP A;  3VQP A;  4FLZ A;  1JXB A;  2D0A A;  3TI0 A;  1XC9 A;  2G8K A;  4O0J A;  3LWM A;  2IAJ A;  4Y1D A;  1NK8 A;  2QXF A;  4I7F A;  4C8O A;  3L8B A;  4O5B A;  3IS9 A;  4FJG A;  1HNI A;  3SV4 A;  3NH1 A;  3TWH A;  1U04 A;  4OKE A;  4CJL A;  3AVC A;  4KV8 A;  1RTH A;  1NJW A;  1NK9 A;  1ZBF A;  4F2S A;  5JS2 A;  4AHS A;  3LP2 A;  4H4O A;  3K5L A;  3NDK A;  4CCH A;  4NYF A;  3K5M A;  4E7L A;  4FK2 A;  3G10 A;  4BDZ A;  3KTQ A;  3UIQ A;  4KI6 A;  4DS5 A;  3KKS A;  5SWM A;  4CJE A;  1Q9Y A;  1L5U A;  1L3T A;  3M8S A;  3SPZ A;  3TAQ A;  4ELV A;  2RKI A;  4I2Q A;  1RT7 A;  1QE1 A;  1G15 A;  5J2Q A;  1N6Q A;  2YNH A;  1EKE A;  3DOK A;  4AHR A;  4BE0 A;  4DS4 A;  3ISN C;  1UAX A;  3WNF A;  4CFD A;  3OYN A;  2IC3 A;  2YNF A;  2OZM A;  3DLR A;  4B3O A;  1TGO A;  4PQU A;  1C1A A;  2PY5 A;  4M3X A;  4KHY A;  3DMJ A;  3MXI A;  3O4Q A;  1KSP A;  1VSF A;  3V4I A;  3VQC A;  3HK2 A;  3NBP A;  2BGG A;  2ATQ A;  1RDD A;  1UOC A;  1X1P A;  3IRX A;  2RPI A;  1KVB A;  1BCM A;  1RBS A;  4ID1 A;  3K5O A;  2OYQ A;  4NYN A;  3BDP A;  3HM9 A;  3QEP A;  2HHQ A;  2KW4 A;  3G0Z A;  3NF9 A;  3IG1 A;  2ZE2 A;  2GV9 A;  4OKJ A;  5HRS A;  4O55 A;  3OYK A;  4KAZ A;  4HVJ A;  3SUN A;  1XHZ A;  1NK5 A;  1LAW A;  1ASW A;  4CGJ A;  5HBM A;  4I9L A;  1NOZ A;  1EXQ A;  3V1Q A;  3RMC A;  1WSE A;  3MXJ A;  3TAM A;  3T3F A;  4DTU A;  3S3O A;  3KD1 E;  1BGX T;  1EET A;  4CJR A;  5E41 A;  3OJU A;  1WSH A;  3MXM A;  3O3H A;  3K59 A;  5HLF A;  1GOC A;  3LP3 A;  4N56 A;  1QTM A;  1RDA A;  4K8X A;  5C24 A;  3SQ1 A;  4ZTJ A;  4KTW A;  5FDL A;  2FBV A;  1RT2 A;  2XY6 A;  2HHS A;  4DMN A;  1RNH A;  1S5J A;  4KFB A;  4KB1 A;  4N41 A;  1SV5 A;  3PX0 A;  4RW9 A;  2B5J A;  1VK0 A;  3RMA A;  4E3S A;  1BIU A;  4W5T A;  1GOA A;  4B08 A;  3TAB A;  4Z4F A;  1LWF A;  3AA4 A;  3QO9 A;  4CEQ A;  1D9F A;  4C8N A;  5J2P A;  5T7B A;  4FLW A;  1KCF A;  4FJJ A;  4J2B A;  1UWB A;  1KLN A;  4Q5V A;  3OS0 A;  2PYL A;  2PZS A;  4NCA A;  1C0T A;  3QEW A;  4HUE A;  1HYZ A;  3AO5 A;  3I0R A;  3KK3 A;  3RWU A;  2JLE A;  3WNH A;  3OYF A;  3ULD A;  1S1V A;  2RN2 A;  5KGW A;  3EYZ A;  4CES A;  3AVA A;  3OYE A;  1VRT A;  3C6U A;  3SUQ A;  4DF4 A;  1IKV A;  2AJQ A;  3D45 A;  4DFJ A;  1J9A A;  1NKC A;  4GW6 A;  3P5J A;  3CFP A;  4LY7 A;  4PWD A;  5HRR A;  5I42 A;  2ETJ A;  4CGH A;  4FLT A;  1IG9 A;  3WNE A;  4HHT A;  1CXU A;  1GOB A;  1RBR A;  4RW8 A;  4DTS A;  1TKD A;  4CJU A;  4EP4 A;  4J2A A;  4CF8 A;  3SYZ A;  2P5G A;  4AHV A;  4NCB A;  3AA2 A;  4E89 A;  4DLE A;  3CM5 A;  4DFP A;  4B8C A;  4ZTF A;  2HHV A;  3QEI A;  3MEE A;  1WSJ A;  3AO1 A;  5SZT A;  2IS3 A;  3ALY A;  2IDO A;  2Z1J A;  3OYG A;  3SCX A;  1SKW A;  3OYJ A;  4M41 A;  2KFZ A;  5HRO A;  4CHY A;  1DLO A;  4FW1 A;  4LD0 A;  3NCI A;  3TR8 A;  2KFN A;  3VN5 A;  2FBY A;  5KTQ A;  4FJL A;  4CHZ A;  3DM2 A;  1WAJ A;  1KFS A;  1KRP A;  3RMB A;  5JS1 A;  3L2U A;  4UQG A;  1J5O A;  1JLB A;  2B6A A;  4BE1 A;  3AVK A;  1UA1 A;  2KZZ A;  4CK2 A;  3P1G A;  3DRP A;  4IG3 A;  3QNN A;  4M45 A;  4QOZ B;  4CER A;  1VSL A;  3VQ4 A;  1RTI A;  1HMV A;  3M8P A;  2W42 A;  5DK5 A;  2OA8 A;  3KD5 E;  1YT3 A;  4W5Q A;  4KRE A;  1WNS A;  3VQD A;  3PO4 A;  4F4K A;  4CJQ A;  2HHT A;  3C6T A;  3TAN A;  3HP9 A;  1U4B A;  1ASV A;  1VSE A;  1NKB A;  4RW4 A;  1ASU A;  4CGD A;  1WSI A;  4M3R A;  4B9S A;  4CF0 A;  1S1T A;  4I2P A;  3PX6 A;  4E19 A;  1TK8 A;  1LW2 A;  1TVR A;  2XRI A;  3LP1 A;  2G8W A;  2G8U A;  4QCL A;  4FJ9 A;  3HXM A;  4G1Q A;  3ZT0 A;  1QSY A;  4O0I A;  3L2W A;  3QLH A;  3QER A;  4N76 A;  4Z4I A;  2IOC A;  5CYM A;  3MAQ A;  2OPR A;  3KKR A;  3MED A;  1J53 A;  4FLY A;  3SUO A;  3OYB A;  1L3V A;  2YV0 X;  2D5R A;  1NJX A;  1KFD A;  4Q0B A;  3RRH A;  2HND A;  2VG5 A;  3ZSX A;  4CHO A;  1S9E A;  3L2Q A;  1BQM A;  4KHQ A;  4CEB A;  1NK6 A;  1Q8I A;  1Z26 A;  4CJT A;  1T7P A;  1NJZ A;  4DTX A;  4YFU A;  2X6S A;  1S6P A;  4FM0 A;  5D3G A;  2Z1I A;  3LP0 A;  1N5Y A;  1F21 A;  5J2N A;  3NGY A;  4CIG A;  4DSF A;  1JLA A;  2OPP A;  3HVT A;  4CFC A;  3OYL A;  1TL3 A;  1RBU A;  3DLG A;  4CEA A;  4CF2 A;  1KVA A;  3O3F A;  3KJV A;  2FBX A;  4CJF A;  3EZ5 A;  3O4N A;  4F2R A;  3VQ6 A;  3NF6 A;  1HJR A;  1S1W A;  3OYH A;  4Z4G A;  1ZBI A;  4MFB A;  3VQ7 A;  1RBT A;  3ZSO A;  5HRN A;  3QES A;  1DTT A;  1YTU A;  1R0A A;  1C6V A;  3NF8 A;  3NGI A;  3V9U A;  4PUO A;  4IFY A;  3HVR A;  1SKR A;  4DQS A;  1O1W A;  4TSX A;  2VG7 A;  3ZCM A;  4DG1 A;  1IH7 A;  1TAQ A;  3QET A;  1JLF A;  4B9V A;  3P83 D;  1KLM A;  4JS4 A;  1ZBU A;  3VA0 A;  1NKE A;  3A2F A;  1S9G A;  4FZX C;  1TAU A;  3DOL A;  4CJ5 A;  1NK0 A;  2P1J A;  4WE1 A;  4CED A;  2HHU A;  5FRN A;  4CHN A;  4BAC A;  2EHG A;  1HQE A;  3CFO A;  3VQA A;  1QS4 A;  3LDS A;  4E7J A;  1T8E A;  1TKZ A;  4CGI A;  4DTO A;  3OYA A;  3NFA A;  3CYM A;  3ZT4 A;  3OY9 A;  2X78 A;  4CIE A;  5FRM A;  3AVJ A;  1RT6 A;  5KRS A;  1BIS A;  4B9M A;  4N47 A;  1B9F A;  4DQQ A;  1JXE A;  4ICL A;  4KKO A;  3RR7 A;  4OVL A;  4CGG A;  1RT5 A;  4Z4E A;  1JLG A;  1VRU A;  4AH9 A;  3VQ9 A;  3PX4 A;  4CJK A;  4BWJ A;  1TK0 A;  2KZM A;  4AHT A;  2X74 A;  3C95 A;  1WSF A;  4CGF A;  4F3O A;  4FJX A;  4QAG A;  4DSJ A;  1RTD A;  3LPT A;  1HYV A;  3LAN A;  5CZ1 A;  4CJ3 A;  4FW2 A;  3THV A;  1W9H A;  3U3G A;  2B4J A;  3DI6 A;  1JL2 A;  4JS5 A;  4FJK A;  2F8T A;  1C1B A;  4KTZ A;  4RW7 A;  3EY1 A;  4FJI A;  4FJM A;  1C0M A;  3NH0 A;  2KQ2 A;  1A5X A;  2P5O A;  2Y1I A;  5CY4 A;  1NK7 A;  3AV9 A;  3S9H A;  1VSJ A;  1W0H A;  4KRF A;  4FLU A;  1I3A A;  3SZ2 A;  2F8S A;  2G8F A;  4FJ7 A;  4CJV A;  4FXD A;  4DQI A;  3ZT2 A;  3NH2 A;  2ZQB A;  1HRH A;  4ZHR A;  4E7I A;  3ITH A;  4HCB A;  4J2D A;  4FJN A;  2G8I A;  1ZBH A;  1JKH A;  5K14 A;  1BHL A;  2IGI A;  4CEE A;  5FRO A;  2R7Y A;  3HT3 A;  3LPU A;  3V9Z A;  2BE2 A;  1JLE A;  1LWC A;  1QSS A;  5C42 A;  3OYC A;  1SKS A;  1QQC A;  1RBV A;  1REV A;  2HMI A;  4W5O A;  1FKO A;  4DU3 A;  4LSN A;  3AVB A;  4DF8 A;  1Z25 A;  3ZSW A;  4HCC A;  3TAR A;  4FK4 A;  4OLA A;  3V9W A;  1U47 A;  5CYQ A;  3LAK A;  1LV5 A;  4KHU A;  3AO4 A;  1J54 A;  3KK2 A;  4E0D A;  5KI6 A;  1D8Y A;  1RDB A;  2Z1H A;  3K5N A;  5KRT A;  3V6D A;  1I39 A;  2RF2 A;  2HVH A;  2HHX A;  4DSL A;  1K6Y A;  2I5J A;  4BWM A;  4GMJ B;  1BI4 A;  4OPJ A;  4AIL C;  3VQ8 A;  4BE2 A;  3RTV A;  2XY8 A;  3V81 A;  5HP1 A;  3HST B;  5I3U A;  2HB5 A;  1MU2 A;  3S3M A;  4PA1 A;  1D5A A;  1JLC A;  1U45 A;  1SL0 A;  2KTQ A;  4W5N A;  1KVC A;  2A1R A;  1X9W A;  2G8H A;  3C94 A;  3QIO A;  3HO1 A;  3HL8 A;  3AA3 A;  2Z1G A;  1TKX A;  3AVF A;  1C0U A;  4CJP A;  2GUI A;  1FXX A;  3SJJ A;  2VWK A;  1YVU A;  1BIZ A;  3PUF A;  3B6P A;  1S1U A;  3AVG A;  4CHQ A;  4FJ8 A;  5EU7 A;  3ZSY A;  3WNG A;  4DU4 A;  4HUF A;  1A5V A;  4LH5 A;  2Y1J A;  4FZY A;  1FKP A;  2WOM A;  3FFI A; 
#chains in the Genus database with same CATH topology
 1JLQ A;  3K2P A;  4F8R A;  3RSE A;  5AQT A;  1Z6R A;  4DV7 K;  1Q81 O;  4EP5 A;  3J8A A;  4MDA A;  2NUB A;  1I94 K;  3SQ0 A;  1L3S A;  4CZK A;  2OTJ N;  2G8V A;  4O5F A;  4FYD A;  3ZEU A;  4JKF A;  3HP6 A;  1A5W A;  1QZ6 A;  1J5E K;  3FZH A;  4XH1 A;  4NLC A;  3VQQ A;  1KTQ A;  4M3T A;  2X6N A;  2H3G X;  3AVI A;  4GVM A;  3TAG A;  2OPQ A;  4BRP A;  4CFB A;  4H5R A;  4BRF A;  2P9P B;  3DXK B;  1SS6 A;  3UE5 A;  1TK5 A;  1HLU A;  4FVU A;  1D9D A;  4I6M B;  4YOT A;  3U8X A;  1U48 A;  1NGJ A;  2VWJ A;  3SPY A;  3FR0 A;  4FOE A;  1TL1 A;  4Z4C A;  3DLB A;  4CE9 A;  3ID6 A;  1RT3 A;  3VF6 A;  1NGI A;  3VQE A;  4R5P A;  3QIN A;  1N32 K;  2VGN A;  1VSK A;  4C8L A;  3I8B A;  3VEY A;  4GV9 A;  3ID8 A;  4E7H A;  4DR2 K;  3K57 A;  4FSV A;  2PYJ A;  3T1H K;  5AQP A;  3AVH A;  2FBT A;  2YKN A;  1SL2 A;  3U3Y A;  1QVG M;  1ATN A;  1FK9 A;  4CW7 B;  1LWE A;  4O4G A;  3F9M A;  1CXQ A;  1E3M A;  4W5R A;  5M1F A;  2XHB A;  3LWL A;  3TTF A;  4C8K A;  4YDU C;  3TSP A;  4N5S A;  4FZZ A;  4FLV A;  4CFA A;  1SAZ A;  5ADX H;  3MCP A;  4HTU A;  3CJC A;  3QEV A;  3IAY A;  4C8M A;  4DR5 K;  2YNG A;  4DTP A;  3RVC A;  3E9O A;  4E1M A;  3CCE N;  2NRT A;  5JLH A;  2WBN A;  3HYF A;  1B92 A;  4B8A B;  4BGA A;  4DB3 A;  3PV8 A;  4NCG A;  2YHA A;  5AQL A;  1CZA N;  2FC0 A;  4A57 A;  2YJE A;  2E4L A;  3THW B;  4JKD A;  4RG8 A;  3F73 A;  3RRG A;  1WBD A;  3T69 A;  4KHN A;  4DR7 K;  4FO0 A;  3IDH A;  3C0B A;  1KQS M;  3LAL A;  1IG8 A;  3MEC A;  2WON A;  2NRZ A;  4JKC A;  4H8K A;  2VWB A;  3ZSZ A;  4CD1 A;  1Q9X A;  1BA1 A;  1SUQ A;  4LF8 K;  1NU0 A;  4ISE A;  4B9T A;  2O8C A;  2A1S A;  4AQY K;  3O3G A;  2HVI A;  1HKC A;  1BO5 O;  4LSL A;  5KQ8 A;  4DTM A;  1DEJ A;  2V52 B;  1YXQ A;  1X3N A;  2D0B A;  4X62 K;  5LMN K;  4BDP A;  1C0G A;  4FLZ A;  1CLQ A;  1JXB A;  2D0A A;  3TI0 A;  4CZG A;  1HKG A;  4FWS A;  1W97 L;  1GLB G;  2IAJ A;  4Y1D A;  1IV0 A;  2QXF A;  5B8H A;  4C8O A;  4FJG A;  3IS9 A;  5BRF A;  3Q7C A;  1SQK A;  2P9N B;  1YF5 L;  1NK9 A;  1ZBF A;  4F9O A;  5GAG P;  1HPM A;  3H3N O;  3QDK A;  3DXM B;  5SWM A;  4CJE A;  2HST A;  3SPZ A;  3CJ9 A;  4BRH A;  2RKI A;  1RT7 A;  4U67 L;  5J2Q A;  1EKE A;  4BE0 A;  1UAX A;  3WNF A;  4A62 A;  1HKB A;  2QWQ A;  4CZL A;  2PY5 A;  2NRH A;  4M3X A;  4KHY A;  1VHX A;  2P9S B;  4WQ4 C;  2Q0U A;  5KPR A;  3VQC A;  2NRV A;  1ILY A;  1RFQ A;  2A6A A;  3WXI A;  2ATQ A;  1RDD A;  1RBS A;  4AM7 A;  4NYN A;  4MLE A;  3BDP A;  5AQR A;  3HM9 A;  3A5M C;  3IG1 A;  2WTU A;  4KAZ A;  1GLE G;  3EN9 A;  1XHZ A;  2UUA K;  3V1Q A;  1EXQ A;  3J80 O;  3MXJ A;  3T3F A;  4KPY A;  1EET A;  1WSH A;  5MLC Q;  3O3H A;  4N56 A;  2OAN A;  3R9P A;  4JV5 K;  4ZTJ A;  2FBV A;  3CPE A;  4DMN A;  1S5J A;  4A2A A;  1SV5 A;  3PX0 A;  4RW9 A;  2B5J A;  3RMA A;  4E3S A;  4W5T A;  4QS7 A;  2FSJ A;  4HTL A;  4Z4F A;  1R59 O;  2BTF A;  4C8N A;  3WXJ A;  5T7B A;  4FJJ A;  4J2B A;  1UWB A;  4H5V A;  3OS0 A;  2NRW A;  3QEW A;  3RWU A;  3ULD A;  1DT9 A;  3WNH A;  4GNI A;  5KGW A;  3AVA A;  3SUQ A;  1VRT A;  3C6U A;  1H1V A;  1P90 A;  3D45 A;  1NKC A;  4GW6 A;  3P5J A;  4NXM K;  3VEO A;  3CC7 N;  2ETJ A;  2VGM A;  4CGH A;  4CZH A;  4HHT A;  1RBR A;  3K0S A;  4CJU A;  4ISF A;  3AA2 A;  3E9P A;  4ZTF A;  1WSJ A;  3OYG A;  2D4W A;  4BG9 A;  4DR3 K;  4M41 A;  1DLO A;  2KFN A;  4K41 A;  3RMB A;  4AF1 A;  4UQG A;  1J5O A;  2A40 A;  1JLB A;  4JK7 A;  1UA1 A;  3FGU A;  4JD2 B;  4IG3 A;  3DRP A;  3QNN A;  4M45 A;  1VSL A;  3VGM A;  1YT3 A;  4KRE A;  4CJQ A;  3C6T A;  1NKB A;  2F9T A;  1NBW A;  4I2P A;  2XRI A;  4O0I A;  3L2W A;  3QER A;  5CYM A;  3MAQ A;  2OPR A;  4MLH A;  1FW6 A;  2F9W A;  4FLY A;  3SUO A;  1L3V A;  3C7N B;  4Q0B A;  2HND A;  3O9T A;  3C6H A;  3O4W A;  4V19 S;  1NGB A;  5AQM A;  4B3T K;  3KVG A;  2CH6 A;  1S6P A;  2HBJ A;  4H0P A;  2QWR A;  3ZYY X;  3LP0 A;  1N5Y A;  4O8U A;  3D7E O;  4DSF A;  1JLA A;  2OPP A;  2YHX A;  1WOQ A;  3VEW A;  4K42 A;  4CF2 A;  3O3F A;  4YY3 K;  3KJV A;  3JS6 A;  3KWI A;  3FZM A;  4Z4G A;  3ZSO A;  1C6V A;  1BA0 A;  3NF8 A;  4LC9 B;  3V9U A;  3HVR A;  1SKR A;  1O1W A;  5E84 A;  3TU5 A;  3QFU A;  1JLF A;  3P83 D;  4JS4 A;  4FZX C;  3W3D A;  3PIO L;  4WE1 A;  4CED A;  2EHG A;  1HQE A;  4E7J A;  1T8E A;  5GAE P;  4CGI A;  4DTO A;  2O8F A;  4GV6 A;  4BRA A;  2V51 B;  4CIE A;  3BF3 A;  1EWQ A;  4B9M A;  4N47 A;  2E8A A;  3ZET B;  3QBW A;  5F0X A;  4ICL A;  3RR7 A;  4Z4E A;  1VRU A;  4AH9 A;  2YHY A;  4FWO A;  3SK3 A;  1WSF A;  4JI1 K;  4DSJ A;  1HYV A;  5CZ1 A;  3HOT A;  1JJ2 M;  3OBW A;  4FW2 A;  3U3G A;  2B4J A;  3DI6 A;  3TPQ A;  2F8T A;  3EY1 A;  4WFA L;  2Y1I A;  1NK7 A;  3FLC O;  4IEE A;  3S9H A;  1VSJ A;  2QWM A;  4DQI A;  2GWJ A;  3NH2 A;  1HR0 K;  4FJN A;  4ZHR A;  4E7I A;  3ITH A;  4NO7 A;  3MN7 A;  4J2D A;  3C6A A;  1ZBH A;  2IGI A;  5FRO A;  2R7Y A;  3PIP L;  1XMO K;  3V9Z A;  2NNW A;  5C42 A;  3CCV N;  1FKO A;  3AVB A;  3SJH A;  1Z25 A;  4HCC A;  3VF4 A;  2IVN A;  3EE8 A;  2W6K A;  2P9U B;  1U47 A;  3KK2 A;  1EQY A;  5KI6 A;  1D8Y A;  2Z1H A;  5KRT A;  4WYB A;  4BR2 A;  4CBX A;  2W40 A;  4AIL C;  4YOX A;  3VQ8 A;  2O8E B;  1S22 A;  4CBW A;  3HST B;  1MU2 A;  1SL0 A;  4W5N A;  1D5A A;  4K43 A;  4IDH A;  3B8A X;  1KVC A;  2A1R A;  3FE1 A;  5AZI A;  2FSN A;  5AFU H;  3CF5 L;  2Z1G A;  3ZX0 A;  1C0U A;  2WUS A;  2VWK A;  3TTC A;  1BIZ A;  4FJ8 A;  3B6P A;  3AVG A;  5EU7 A;  4BG8 A;  5AQI A;  4DU4 A;  4HUF A;  4LH5 A;  2Q97 A;  1V4T A;  1FKP A;  3WXK A;  4EHU A;  1YHQ N;  3FFI A;  1NMD A;  1E4G T;  3VES A;  1RT4 A;  4CF1 A;  3H08 A;  4I9Q A;  4IXC A;  5HL7 L;  4DU1 A;  3SLC A;  3PO5 A;  4M3U A;  4EFH A;  5BPL A;  3U9Z A;  4BC2 A;  3CHW A;  2XY5 A;  2AP1 A;  1BCO A;  4CIF A;  3E1Y A;  1VQ6 N;  4EIA A;  3LAM A;  1NGF A;  3WXM B;  4B9L A;  4O8K A;  3MN9 A;  1LOT B;  2DFE A;  3NMU A;  3HPH A;  3TSQ A;  2BUP A;  4ELU A;  1Y64 A;  3CC2 N;  3AVN A;  3I33 A;  1U49 A;  4L3Q A;  3THX A;  3NGZ A;  4H5W A;  3EEQ A;  1WLJ A;  3KIO A;  4FLX A;  4CEF A;  3HPO A;  5GAD P;  1S1X A;  2UU9 K;  5F2R A;  1JL1 A;  5LJV A;  2O4G A;  3T19 A;  3E01 A;  4CK1 A;  3S3N A;  3EE9 A;  1ATS A;  4H0V B;  1HNW K;  4F3T A;  1WAF A;  2HBK A;  4ILG B;  5KPT A;  2O4I A;  3HM8 A;  4DLG A;  3V9S A;  1BG3 A;  5C12 A;  3L0Q A;  2GTD A;  2HNY A;  2HNZ A;  3HTV A;  2A5X A;  4E7K A;  4FWQ A;  4IWV A;  4DQ8 A;  2YKM A;  3NAE A;  5J1E A;  5C2F A;  4PL7 A;  2P51 A;  5AZJ A;  3SAH A;  1BI4 B;  4DSK A;  3VA3 A;  4EAH D;  2BDP A;  2DTU A;  1BUP A;  3AA5 X;  2QKB A;  1XNR K;  5EOY A;  2ZWH A;  4NLB A;  1RGI A;  3SI6 A;  2CGJ A;  2HBL A;  4KH5 A;  3CQ8 A;  3DAW A;  4LF7 K;  1BL3 A;  4M3Y A;  1JCG A;  4DV2 K;  2QKK A;  5LY3 A;  4OGE A;  3U6F A;  4DFK A;  1WBB A;  3KLF A;  3CM6 A;  3KK1 A;  2DY4 A;  4PKH A;  4IOX A;  1Q82 O;  3IUC A;  4CF9 A;  2O8D B;  4IKF A;  2NLX A;  5KGX A;  3VQ5 A;  4DFM A;  2UUB K;  4KO0 A;  3KLH A;  5TKW A;  1IO2 A;  5LJW A;  3P39 A;  2RHK A;  1RDC A;  2RE2 A;  5EX5 A;  1T05 A;  2ASO A;  4DTN A;  3TAE A;  3ASM A;  4JLH A;  4HUG A;  2Q3S A;  4J8F A;  4BQL A;  5HRP A;  3CCJ N;  4B9U A;  1VQ8 N;  3CCM N;  2HW3 A;  3KLG A;  1QHA A;  3OVN A;  1TYQ A;  1XWL A;  1CZ9 A;  4DQR A;  4FK0 A;  2YHB A;  3RR8 A;  1HPZ A;  1N34 K;  4AHU A;  4ELT A;  1KAZ A;  3F9K A;  1LW0 A;  1TKT A;  2QW9 A;  5M1O A;  1QQM A;  4FWK A;  3BP8 A;  2LSN A;  4CK3 A;  3VQP A;  4JI5 K;  1NK8 A;  4I7F A;  4JHD B;  4O5B A;  3SV4 A;  5JIC A;  4BR5 A;  3NH1 A;  5AQH A;  4KH4 A;  4RTF D;  2QM1 A;  3AVC A;  4F2S A;  4FK2 A;  4XH5 A;  3K5L A;  1WB9 A;  3K5M A;  4E7L A;  4B1W B;  3G10 A;  4BRO A;  1YAG A;  3UIQ A;  4BRE A;  4KI6 A;  4DS5 A;  4IOC L;  4ELV A;  4I2Q A;  5LL6 Z;  5LMU K;  4DV6 K;  2GEL A;  5BPN A;  1N6Q A;  2V7Z A;  5H1S Q;  3O1W A;  3TAB A;  4LF9 K;  1ZBI A;  1RDW X;  2YNF A;  1GLC G;  3DLR A;  5AQN A;  1C1A A;  3O6W A;  4FWL A;  2YX6 A;  4JKG A;  2BGG A;  4GKJ K;  3IRX A;  2RPI A;  3UB5 A;  1BCM A;  2QA4 N;  3K5O A;  2OYQ A;  1XUP O;  3G0Z A;  3H6E A;  3OYK A;  1S3X A;  1NOZ A;  1XC3 A;  3RMC A;  4Y0W A;  4JKH A;  1Q18 A;  3R6M A;  4DTU A;  3KD1 E;  4YOY A;  5HLF A;  1NWK A;  3K59 A;  3G4S N;  5TKY A;  3H1Q A;  5DM6 L;  4KTW A;  1RT2 A;  5C0Y A;  3J7Y P;  1RNH A;  1Z05 A;  4BRL A;  3L4Q A;  3E66 A;  4N41 A;  4FWN A;  3CET A;  5KQD A;  2E88 A;  1VK0 A;  2J4R A;  4G9Z A;  1BIU A;  1VAZ A;  1HUX A;  4B08 A;  1D9F A;  5BRH A;  5KPZ A;  2Q31 A;  5AQX A;  4HUE A;  1HYZ A;  3KK3 A;  2JLE A;  1YIT N;  4CES A;  3N4P A;  2VQF K;  4IZ9 A;  1IKV A;  3OW2 M;  4DFJ A;  1U2V A;  4BR9 A;  1YVN A;  5DM7 L;  1WUA A;  3CFP A;  4LY7 A;  3CXC M;  5I42 A;  3O9Q A;  2UXD K;  5IT9 O;  3SYZ A;  2P5G A;  4NCB A;  4E89 A;  4GY2 B;  1O13 A;  2F7T A;  3CM5 A;  3GG4 A;  4B8C A;  2HHV A;  4QS8 A;  5EY4 A;  2IS3 A;  2P9K A;  2Z1J A;  3GOI A;  1SKW A;  4BC3 A;  5FPE A;  5HRO A;  4CHY A;  4LD0 A;  4FPA A;  2FBY A;  4FJL A;  3DM2 A;  2JWL A;  4JI3 K;  3D2E B;  1N36 K;  2B6A A;  4BE1 A;  2ZJQ L;  2KZZ A;  2OCE A;  1S72 N;  2E2P A;  4B1Z A;  1VQL N;  2ZF5 O;  3M8P A;  3KD5 E;  3O1B A;  4W5Q A;  1VQK N;  3ATU A;  3PO4 A;  4F4K A;  3D2F A;  3QML A;  3TAN A;  3HP9 A;  3GBT A;  2GWK A;  4M3R A;  4CF0 A;  4E19 A;  1TVR A;  3LP1 A;  4QCL A;  3WQU A;  3HXM A;  3ZT0 A;  2CGK A;  4PL8 A;  4Z4I A;  4RWT A;  3MED A;  4AM6 A;  5JLF A;  3OYB A;  1K73 O;  2D5R A;  2IVP A;  5BN8 A;  3RRH A;  2VG5 A;  3ZSX A;  3WT0 A;  4KHQ A;  4CEB A;  2UYT A;  1NGA A;  1Q8I A;  1NJZ A;  4YFU A;  4IOA L;  2Z1I A;  3VEV A;  3NGY A;  4C23 A;  4BVP A;  4ISG A;  3FZL A;  3DLG A;  4CEA A;  1LCU A;  3A5N C;  3MMV A;  4CJF A;  3O4N A;  3EZ5 A;  3NF6 A;  1HJR A;  3OYH A;  2O8B B;  4MFB A;  1RBT A;  3QES A;  5HRN A;  1YTU A;  4PUO A;  2D0O A;  3CJB A;  3HBT A;  3IFR A;  4IFY A;  3ULE B;  5JVH L;  4DQS A;  4TSX A;  3ZCM A;  4NB4 A;  1IH7 A;  3QET A;  1YI2 N;  3VEZ A;  1NKE A;  1S9G A;  2V7Y A;  1TAU A;  4BR4 A;  4CHN A;  4BAC A;  3DLL L;  5AQJ A;  3CMA N;  1TKZ A;  3CYM A;  3OY9 A;  2X78 A;  3EO3 A;  5FRM A;  3AVJ A;  1ZXO A;  4DQQ A;  5AJ3 K;  4OVL A;  4CGG A;  2E2N A;  3VQ9 A;  4BWJ A;  1TK0 A;  2KZM A;  4BRM A;  4CGF A;  2P9P A;  1RTD A;  3DXK A;  3LPT A;  3JAM O;  4EHT A;  1RDU A;  4I6M A;  1XQS C;  4JS5 A;  1C1B A;  4RW7 A;  4FJI A;  4LF4 K;  4FLU A;  1I3A A;  2F8S A;  1BU6 O;  4JKB A;  2HMP A;  4HCB A;  2P9L B;  1JKH A;  1BHL A;  1JCE A;  3SBT A;  3HT3 A;  4OX9 K;  4JNE A;  1LWC A;  4ILJ A;  3F5T A;  2GEM A;  1RBV A;  3OTO K;  2UXB K;  2HMI A;  4E1J A;  4LSN A;  2F4V K;  4KHP K;  3ZSW A;  3TAR A;  3V9W A;  5CYQ A;  3LAK A;  1LV5 A;  3GE1 A;  4DCH A;  3R1X A;  5C2D A;  3K5N A;  1I39 A;  2HVH A;  3N4Q A;  3IMX A;  1SZ2 A;  2E2Q A;  4WFB L;  1HX1 A;  1K6Y A;  4BWM A;  2PFU A;  4IJA A;  4BE2 A;  5IWA K;  5I3U A;  1U45 A;  3S3M A;  4PA1 A;  4YOR A;  3CCQ N;  1VQO N;  3THY B;  3HO1 A;  3I55 N;  3AVF A;  5GIN A;  3BF1 A;  1S1U A;  3ZSY A;  4XH4 A;  3FZF A;  1DKG D;  3UKR B;  2Y1J A;  1WN7 A;  3L2R A;  5AQO A;  2VQE K;  3CFR A;  3OYI A;  3RMD A;  1EX4 A;  1NK4 A;  1IKW A;  4M63 C;  2JGU A;  2ZM6 K;  2ITM A;  3AO3 A;  3HPG A;  2E6L A;  3M3Z A;  4XIU A;  3H45 C;  4A5A A;  3I8D A;  4KTQ A;  3NF7 A;  3G25 A;  3SNN A;  3ENH A;  5BR9 A;  1YJW N;  3L3U A;  4FJ5 A;  3LL3 A;  4CJW A;  4LF6 K;  4Y1C A;  4DSI A;  2QK9 A;  1C0F A;  2HOE A;  3V9X A;  1QSL A;  4K25 A;  3U4L A;  4CBU A;  5BRE A;  3BGR A;  3VGL A;  2OPS A;  5A2Q O;  4RW6 A;  1SL1 A;  1TV6 A;  4QS9 A;  2WC9 A;  3DJC A;  3Q7B A;  4L8R B;  3CJ1 A;  3QB0 A;  4DWI A;  2XY7 A;  2NZT A;  4YNQ A;  3NHG A;  3CD6 N;  4FOI A;  4PY5 A;  3LM2 A;  4LFB K;  1S6Q A;  3D6R A;  2E1Y A;  3L6Q A;  4YOV A;  2JWK A;  3DLE A;  3LZJ A;  4EZ6 A;  5CZ2 A;  2P9N A;  2ZD1 A;  4CJS A;  2E6M A;  1ZBL A;  1GLJ O;  3BUZ B;  3DLH A;  4OGC A;  4CZE A;  3PY8 A;  1UA0 A;  3DXM A;  3I0S A;  2OTL N;  1NOY A;  1Y97 A;  4JI2 K;  4FM1 A;  4OPK A;  2P9I B;  3ZSV A;  3CQY A;  4FCY A;  4CZI A;  3TAP A;  4KHW A;  3UKU B;  1MA9 B;  4B1V A;  3LZI A;  2P9S A;  3G6E N;  1RIL A;  1YTA A;  2DFH A;  3SAF A;  3SBG A;  3S41 A;  4H0X B;  4K8Z A;  3BZC A;  4B3R K;  3KLE A;  4J2E A;  5F1X A;  1QVF M;  3AAR A;  1RCH A;  5FPN A;  1HYS A;  4IFV A;  1OH6 A;  3JYT A;  1MWK A;  2HHW A;  5DMR A;  3RSE B;  3L2V A;  3HJF A;  3DYA A;  2YI1 A;  4JI7 K;  1EP4 A;  4WQ5 A;  4BDY A;  2OZS A;  3QEX A;  1VSI A;  3SQ4 A;  1NJI O;  4FVM A;  3ZEU B;  1VSM A;  3TTD A;  4KI4 A;  1CZB A;  4CEC A;  1B9D A;  2GBZ A;  3JSM A;  3OJS A;  4HWI A;  3ZT1 A;  2ASP A;  1TUY A;  3TAF A;  4KHS A;  4CJ4 A;  4X64 K;  3GDQ A;  2BAN A;  5AQG A;  3V1O A;  1IKY A;  4E1N A;  1IBM K;  3LM9 A;  3OS2 A;  1OH8 A;  3MN6 A;  2YNI A;  4JRQ A;  3MN5 A;  1T03 A;  2EX3 A;  4B1X B;  3MK6 A;  1IJJ A;  1XC9 A;  5BN9 A;  2G8K A;  3LWM A;  1HNI A;  4BGB A;  1NGE A;  1HNZ K;  1NLV A;  3TWH A;  4OKE A;  4C1N I;  4KV8 A;  1RTH A;  1YJN N;  1NJW A;  4AHS A;  3NDK A;  1DGK N;  3OA9 A;  4CCH A;  4BDZ A;  4JYA K;  3KKS A;  1L5U A;  1L3T A;  1HNX K;  1QE1 A;  1G15 A;  3ISN C;  4CFD A;  3OYN A;  2OZM A;  2IC3 A;  4MO4 A;  4B3O A;  4BRC A;  1GLA G;  4LFC K;  2QWP A;  3DMJ A;  3MXI A;  1KSP A;  1VSF A;  4JI8 K;  5E26 A;  1UOC A;  1K8A O;  3O80 A;  4ID1 A;  3QBX A;  4A59 A;  3NF9 A;  4RCH A;  4PKI A;  2GV9 A;  3U9D A;  4CZM A;  3CCS N;  4NXN K;  3SUN A;  3TSU A;  1NK5 A;  3CCU N;  1ASW A;  3KZB A;  4BR7 A;  3S3O A;  2Q36 A;  1BGX T;  3HI0 A;  5E41 A;  3MXM A;  3OJU A;  1YIJ N;  4M7X A;  5ELZ A;  3LP3 A;  4K8X A;  1QTM A;  2BH1 A;  5C24 A;  3SQ1 A;  2FF6 A;  5FDL A;  3C7N A;  1NGG A;  2HHS A;  5BRD A;  2QWO A;  4KFB A;  1OH7 A;  1OH5 A;  3FZK A;  3KHY A;  1GOA A;  3AAP A;  3EZW A;  4JEP A;  5J2P A;  3VMF B;  1KCF A;  1KLN A;  2PYL A;  2PZS A;  4BY9 C;  2O8C B;  4CI6 A;  3OHR A;  4DF4 A;  4H03 B;  3WEE A;  3WUH A;  1ZC6 A;  5AQF A;  4FLT A;  1P8Z A;  1CXU A;  1GOB A;  4RW8 A;  1TKD A;  3ZLJ A;  4J2A A;  4EP4 A;  4WFN L;  4AHV A;  4DLE A;  4IFE A;  4JN4 A;  3MCA B;  4DFP A;  3QEI A;  3AO1 A;  4H0Y B;  5SZT A;  2I7N A;  3ALY A;  3H46 O;  2PAV A;  2YHW A;  3OYJ A;  3A0I X;  4X65 K;  1T6C A;  3NCI A;  4JKA A;  3TR8 A;  3VN5 A;  3ZET A;  1Q7Y O;  1WAJ A;  3M5R A;  3L2U A;  1GLF O;  4JK9 A;  4CK2 A;  3CI5 A;  2W42 A;  5DK5 A;  1K9M O;  2OA8 A;  4DV1 K;  4C1N K;  3CER A;  3VQD A;  3O9S A;  2CH5 A;  2HHT A;  4H0O A;  1U4B A;  1ASV A;  1VSE A;  4RW4 A;  1ASU A;  4CGD A;  2QWN A;  1WSI A;  1MDU B;  3FFK B;  1TUU A;  4B9S A;  1FJG K;  3PX6 A;  1V4S A;  2NRX A;  2G8U A;  2G8W A;  5EXW A;  4G1Q A;  3H3O B;  3BEX A;  3KKR A;  4ILH A;  1J53 A;  3VEX A;  3VPZ A;  3A5L C;  4FL9 A;  2IIR A;  1NJX A;  4OPH A;  3VTH A;  3L2Q A;  1EWR A;  3PSI A;  1NGD A;  3CQX A;  1YJ9 N;  1NK6 A;  4FWP A;  2P9U A;  1Z26 A;  1T7P A;  4DTX A;  2X6S A;  3VEN A;  4X66 K;  3CCR N;  5D3G A;  1ZBS A;  1F21 A;  5J2N A;  3C65 A;  2PBD A;  2QWL A;  3HVT A;  3OYL A;  4OPA A;  2O8E A;  1RBU A;  2QTD A;  2FBX A;  4F2R A;  4BC4 A;  1KC8 O;  3NGI A;  4WF9 L;  4DV5 K;  3I56 N;  2VG7 A;  3PSF A;  4B3M K;  4DG1 A;  1TAQ A;  4B9V A;  2ZJR L;  1KLM A;  1ZBU A;  3A2F A;  1BOT O;  3DOL A;  1NK0 A;  2P1J A;  2HHU A;  5FRN A;  1W2B M;  3OYA A;  3NFA A;  3ZT4 A;  3M6G A;  3BY5 A;  2FXU A;  4OO1 J;  5KRS A;  4DV4 K;  1BIS A;  4YHH K;  1B9F A;  5ADX A;  3NVM A;  3G71 N;  3T7Z A;  4BVO A;  4AHT A;  2X74 A;  3C95 A;  4FJX A;  4A5B A;  4B3S K;  3LAN A;  4MDB A;  4CJ3 A;  3THV A;  2HBM A;  4KTZ A;  2CGL A;  4FJM A;  1C0M A;  2KQ2 A;  1A5X A;  1YUW A;  3EKS A;  3OBY A;  4KRF A;  4CJV A;  1NGH A;  4FXD A;  2ZQB A;  1HRH A;  1E4F T;  4PHT X;  3LPU A;  2BE2 A;  1JLE A;  1QSS A;  1SKS A;  1QQC A;  4W5O A;  4DF8 A;  4CZJ A;  3ZX3 A;  1X9J A;  3A8Y A;  1OKJ A;  1RDB A;  3T1Y K;  3V6D A;  2RF2 A;  4WQ5 C;  2HHX A;  4DSL A;  2I5J A;  4GMJ B;  1BI4 A;  4OPJ A;  2QI2 A;  3RTV A;  3V81 A;  5HP1 A;  1KXP A;  4FJ7 A;  1K8K A;  2HB5 A;  1JLC A;  3AAQ A;  2KTQ A;  1GLL O;  1U6Z A;  2G8H A;  1X9W A;  1TKX A;  2GUI A;  4CHQ A;  3WNG A;  4DUY K;  1A5V A;  2Q0R A;  2WOM A;  4FPB A;  3CG7 A;  4CEZ A;  2O8D A;  3CC4 N;  4DUZ K;  5AQK A;  3V1R A;  3VQB A;  3ZSQ A;  4FM2 A;  2O8F B;  1NNE A;  4DTJ A;  4OLB A;  3OS1 A;  5C15 A;  4H4M A;  3KLI A;  2A3Z A;  3LDN A;  1NGC A;  2ZJP L;  3D0P A;  5CHI A;  1XI1 A;  2A41 A;  3VER A;  4M42 A;  1JCF A;  2VCP A;  1RT1 A;  4B9N A;  3T1A A;  2D0P A;  4IG0 A;  2QEX N;  5CE3 A;  5M1N A;  3J7A P;  1X9S A;  4MQ3 A;  4BRQ A;  4BRI A;  3DLK A;  5AQY A;  4WCE L;  2KLA A;  2UXC K;  5GIO A;  1KAX A;  3M8R A;  1X9M A;  1BWF O;  4JI6 K;  2ITG A;  2HF4 A;  4DSE A;  1QQN A;  4IBN A;  4JRP A;  1ZYQ A;  4M3W A;  1G99 A;  3QIP A;  1HNV A;  5C25 A;  5AQQ A;  1T44 A;  1OVY A;  4DR1 K;  1EO1 A;  4JHD A;  3L3V A;  3EL2 A;  1C1C A;  1NMN A;  4LH4 A;  4OKK A;  4A61 A;  2NRR A;  2XO7 A;  4IO8 A;  4KB0 A;  3K9K A;  3NVK A;  1M1K O;  3DRR A;  2F96 A;  3MEG A;  3AVL A;  3MX5 A;  1HQU A;  4M3Z A;  3K58 A;  5GAH P;  1OVQ A;  1VSD A;  3SUP A;  4DHY A;  3B6O A;  1DTQ A;  4UY8 O;  3LDO A;  5AR0 A;  4B1Y B;  5AZI B;  3M1F A;  3ZT3 A;  1XHX A;  4IDK A;  3SV3 A;  4CEO A;  3AO2 A;  4PKG A;  3ENB A;  1NJY A;  4O44 A;  3LDP A;  4BRK A;  3NE6 A;  5HOO A;  3MWP A;  4GVE A;  1BQN A;  4R79 A;  3J81 O;  3OYD A;  3VGK A;  3SQ2 A;  2E2O A;  2ASM A;  4EZ9 A;  1LAV A;  4FWM A;  2D0C A;  4Z0U A;  3OYM A;  5BPM A;  4OJR A;  3CCL N;  4DV3 K;  4CHP A;  1ITG A;  4BC5 A;  3ZSR A;  1L3U A;  1N8R O;  4YOW A;  2VG6 A;  1QHT A;  3DRS A;  5AQW A;  4ID5 A;  4FJH A;  3M8Q A;  5J2M A;  1VSH A;  2FF3 B;  3AVM A;  3SAG A;  1IBK K;  2AA4 A;  2DFF A;  3O9U A;  3HRG A;  1N33 K;  3LDQ A;  3QNO A;  4KH6 A;  1IKX A;  4Z4H A;  3THX B;  4BRN A;  4AHC A;  1WSG A;  3GL1 A;  4DR4 K;  4DQP A;  1BDG A;  4K0K K;  3O8M A;  1RTJ A;  4DTR A;  3R3L A;  4O0J A;  1NG9 A;  3L8B A;  5FLX O;  1KD1 O;  3JXU A;  3BZK A;  1U04 A;  5JVG L;  1XNQ K;  4KBO A;  2ZGZ A;  4CJL A;  2Q2R A;  3THW A;  5JS2 A;  4H5T A;  3LP2 A;  3O9R A;  4H4O A;  4JI4 K;  4NYF A;  5I9E B;  3L4I A;  3KTQ A;  3CIP A;  1Q9Y A;  3M8S A;  3TAQ A;  2GUP A;  4XEI A;  3D2E A;  3MWT A;  3KK7 A;  2YNH A;  3DOK A;  3CJA A;  5AZJ B;  3O5B A;  3VTI A;  4AHR A;  4DS4 A;  1TGO A;  4PQU A;  1QZ5 A;  4LF5 K;  4BR0 A;  3VOV A;  3O4Q A;  4M7Y A;  3HK2 A;  3V4I A;  3NBP A;  2QXL A;  1X1P A;  3A5O C;  1KVB A;  4FWR A;  2UUC K;  3QEP A;  2HHQ A;  2KW4 A;  4BRD A;  4IO9 L;  2ZE2 A;  4H5N A;  4OKJ A;  1VQN N;  3VET A;  4O55 A;  5HRS A;  4HVJ A;  5JMV A;  4MO5 A;  1LAW A;  4CGJ A;  5HBM A;  4I9L A;  3WEE B;  1WSE A;  3KWG A;  3TAM A;  4B9Q A;  4CJR A;  5C10 A;  1GOC A;  5EVZ A;  1RDA A;  1NM1 A;  3E9L A;  5M1K A;  4YOU A;  2XY6 A;  5GIP A;  3MDQ A;  4KB1 A;  4YDU A;  4U7B A;  4LFA K;  5AQV A;  1LWF A;  3AA4 A;  3QO9 A;  4CEQ A;  1VQ7 N;  2HHH K;  1TYQ B;  4JKE A;  2YCH A;  3WXL A;  2KKZ A;  4FLW A;  5AQU A;  4Q5V A;  4NCA A;  1D4X A;  1C0T A;  2YJF A;  3AO5 A;  3I0R A;  1M90 O;  2E1Z A;  3OYF A;  4JI0 K;  1S1V A;  2RN2 A;  3EYZ A;  3OYE A;  2O8B A;  2AJQ A;  1J9A A;  2W41 A;  1ESV A;  4PWD A;  5HRR A;  3ULE A;  4A2B A;  1IG9 A;  3WNE A;  4DTS A;  4CF8 A;  2E20 A;  3QFP A;  5BR8 K;  1ATR A;  3LDL A;  3MEE A;  1VQ9 N;  2IDO A;  1HJO A;  5M1Q A;  3SCX A;  1X3M A;  2KFZ A;  3ZX2 A;  3MX2 A;  3SMP A;  4FW1 A;  5KTQ A;  5AFU A;  4CHZ A;  1KFS A;  3DWL A;  1KRP A;  5JS1 A;  3EKU A;  3AVK A;  4IEI A;  1GLD G;  3P1G A;  1W7A A;  4QOZ B;  4CER A;  3SMS A;  1RTI A;  3VQ4 A;  3J7Z O;  1HMV A;  1T6D A;  4JK8 A;  4JKG B;  1WNS A;  1T3V A;  5FPM A;  2GX9 A;  4CJ7 A;  5AQS A;  1S1T A;  3ATV A;  4BQZ A;  1TK8 A;  1LW2 A;  4FJ9 A;  2P9L A;  1QSY A;  4N76 A;  3QLH A;  2IOC A;  2YV0 X;  4CVN E;  3IKM A;  1KFD A;  2HF3 A;  1KAY A;  3P38 A;  4CHO A;  4JAX A;  1S9E A;  1BQM A;  4CJT A;  4JD2 A;  4WQ4 A;  1IBL K;  3R8E A;  2KHO A;  4FM0 A;  4DR6 K;  4CIG A;  3K9J A;  4CFC A;  3P31 A;  1Q86 O;  1TL3 A;  3PLA A;  2W6L A;  1KVA A;  4GV3 A;  3VQ6 A;  3QIC A;  4B1U B;  3THY A;  1S1W A;  1VQM N;  1J6Z A;  3VQ7 A;  1DTT A;  1R0A A;  1U2V B;  4DV0 K;  3AY9 A;  3HSC A;  3UKR A;  2FSK A;  3VA0 A;  3HZ6 A;  3CPW M;  3W0L A;  4CJ5 A;  3CFO A;  3LDS A;  3VQA A;  1QS4 A;  2WFB A;  2DPN A;  2P9K B;  1VQ4 N;  1RT6 A;  3CME N;  2A42 A;  3F2K A;  1MWM A;  1JXE A;  2FLO A;  4KKO A;  2ZGY A;  1RT5 A;  2I7P A;  1JLG A;  3PX4 A;  4CJK A;  5CR4 A;  4F3O A;  1VQ5 N;  4QAG A;  1XMQ K;  3D2F B;  1W9H A;  2EWS A;  1JL2 A;  4FJK A;  3HOS A;  1K8K B;  2D1K A;  3P4I A;  3NH0 A;  3H1V X;  2P5O A;  5CY4 A;  3VF2 A;  3AV9 A;  4H0T B;  1W0H A;  3SZ2 A;  2G8F A;  2VYP A;  3ZT2 A;  2G8I A;  3CJ7 A;  5K14 A;  4CEE A;  4GKK K;  4CD3 A;  3OYC A;  5M1P A;  4CZF A;  1REV A;  2IVO A;  4DU3 A;  3ENO A;  1QQO A;  4FK4 A;  3AGR A;  4OLA A;  2E5L K;  1VQP N;  4KHU A;  3AO4 A;  1J54 A;  5FPD A;  2Q1N A;  4Z94 A;  4E0D A;  4IJN A;  3O08 A;  2P9I A;  2XY8 A;  5AQZ A;  3UKU A;  3WQT A;  3C94 A;  3QIO A;  3HL8 A;  3AA3 A;  4CJP A;  1FXX A;  3SJJ A;  1YVU A;  3PUF A;  4BRG A;  4FZY A;  3AGK A;  4DKW A; 
#chains in the Genus database with same CATH homology
 1JLQ A;  1WN7 A;  3K2P A;  3L2R A;  4F8R A;  3CFR A;  3OYI A;  3RMD A;  3CG7 A;  1EX4 A;  4EP5 A;  1NK4 A;  4CEZ A;  1RT4 A;  2NUB A;  1IKW A;  4CF1 A;  3SQ0 A;  4KPY A;  3V1R A;  3VQB A;  1L3S A;  3H08 A;  2JGU A;  3ZSQ A;  2G8V A;  4FM2 A;  3AO3 A;  3HPG A;  4I9Q A;  4FYD A;  4DTJ A;  2E6L A;  4XIU A;  4OLB A;  3OS1 A;  4DU1 A;  3I8D A;  3PO5 A;  3HP6 A;  1A5W A;  4KTQ A;  4H4M A;  4M3U A;  3KLI A;  3NF7 A;  3SNN A;  3VQQ A;  3D0P A;  1KTQ A;  3L3U A;  2XY5 A;  1XI1 A;  4FJ5 A;  4M3T A;  4M42 A;  4CJW A;  1RT1 A;  4B9N A;  2X6N A;  1BCO A;  3AVI A;  4Y1C A;  4GVM A;  4CIF A;  4DSI A;  2QK9 A;  3TAG A;  2OPQ A;  3LAM A;  3T1A A;  4B9L A;  4IG0 A;  2DFE A;  4CFB A;  3HPH A;  3V9X A;  1QSL A;  1X9S A;  4MQ3 A;  3DLK A;  3BGR A;  4ELU A;  2OPS A;  1TK5 A;  4RW6 A;  1SL1 A;  1TV6 A;  1D9D A;  3AVN A;  1U49 A;  4L8R B;  1U48 A;  2VWJ A;  3M8R A;  3NGZ A;  3SPY A;  1X9M A;  4DWI A;  1WLJ A;  3KIO A;  2XY7 A;  4FLX A;  4CEF A;  2ITG A;  3HPO A;  4DSE A;  1S1X A;  4IBN A;  4JRP A;  1ZYQ A;  4M3W A;  5C25 A;  3QIP A;  1HNV A;  1JL1 A;  4YNQ A;  1TL1 A;  3NHG A;  4Z4C A;  2O4G A;  3DLB A;  4CE9 A;  4PY5 A;  3T19 A;  1S6Q A;  3E01 A;  4CK1 A;  3S3N A;  1RT3 A;  3L3V A;  3VQE A;  4F3T A;  1C1C A;  3DLE A;  3LZJ A;  4EZ6 A;  4OKK A;  4LH4 A;  1WAF A;  3QIN A;  5CZ2 A;  4R5P A;  2ZD1 A;  4CJS A;  2XO7 A;  1VSK A;  4C8L A;  2E6M A;  4KB0 A;  4DLG A;  2O4I A;  1ZBL A;  3V9S A;  4E7H A;  2HNY A;  2HNZ A;  3DRR A;  4OGC A;  2F96 A;  3DLH A;  3K57 A;  3MEG A;  2PYJ A;  3PY8 A;  3AVL A;  1UA0 A;  1HQU A;  3AVH A;  3I0S A;  4M3Z A;  4E7K A;  1NOY A;  1Y97 A;  2FBT A;  2YKM A;  2YKN A;  3NAE A;  5J1E A;  3U3Y A;  1SL2 A;  3K58 A;  1FK9 A;  1VSD A;  2P51 A;  4FM1 A;  3SUP A;  1LWE A;  4O4G A;  4OPK A;  1CXQ A;  3ZSV A;  1BI4 B;  4W5R A;  4FCY A;  3B6O A;  1DTQ A;  2XHB A;  3TAP A;  3VA3 A;  3LWL A;  4DSK A;  4KHW A;  2BDP A;  2DTU A;  4C8K A;  3AA5 X;  2QKB A;  3LZI A;  4N5S A;  4FZZ A;  4FLV A;  1RIL A;  4CFA A;  1YTA A;  2DFH A;  3ZT3 A;  3SI6 A;  1XHX A;  4IDK A;  3SV3 A;  4CEO A;  4K8Z A;  3AO2 A;  3CQ8 A;  4M3Y A;  3KLE A;  1BL3 A;  4J2E A;  1NJY A;  4HTU A;  4O44 A;  2QKK A;  3NE6 A;  3QEV A;  3IAY A;  1RCH A;  4OGE A;  1BQN A;  3U6F A;  4DFK A;  1HYS A;  4IFV A;  4C8M A;  3OYD A;  3KLF A;  3JYT A;  3CM6 A;  3SQ2 A;  2YNG A;  4DTP A;  3KK1 A;  2HHW A;  5DMR A;  2DY4 A;  4CF9 A;  4E1M A;  3L2V A;  3HJF A;  4EZ9 A;  4IKF A;  3DYA A;  1LAV A;  5KGX A;  3VQ5 A;  2D0C A;  4DFM A;  4Z0U A;  1EP4 A;  3HYF A;  3OYM A;  4KO0 A;  3KLH A;  1B92 A;  4B8A B;  4BDY A;  4OJR A;  2OZS A;  3PV8 A;  1IO2 A;  1VSI A;  3QEX A;  4NCG A;  4CHP A;  4FVM A;  1ITG A;  2YHA A;  3ZSR A;  1VSM A;  3SQ4 A;  1L3U A;  1RDC A;  1T05 A;  4DTN A;  3TAE A;  3ASM A;  4KI4 A;  2VG6 A;  4JLH A;  4HUG A;  1QHT A;  1CZB A;  2Q3S A;  2FC0 A;  1B9D A;  2GBZ A;  3DRS A;  4CEC A;  5HRP A;  3JSM A;  2E4L A;  4B9U A;  3OJS A;  2HW3 A;  4RG8 A;  4ID5 A;  3ZT1 A;  4FJH A;  3F73 A;  3M8Q A;  5J2M A;  3RRG A;  3KLG A;  4KHN A;  3TAF A;  4KHS A;  1VSH A;  3OVN A;  4CJ4 A;  3AVM A;  1XWL A;  2BAN A;  1CZ9 A;  3LAL A;  3MEC A;  4DQR A;  2WON A;  3V1O A;  4H8K A;  2YHB A;  4FK0 A;  3ZSZ A;  2DFF A;  1IKY A;  1Q9X A;  4E1N A;  1HPZ A;  3RR8 A;  1SUQ A;  3QNO A;  4AHU A;  4ELT A;  1IKX A;  3OS2 A;  4B9T A;  3F9K A;  2A1S A;  1LW0 A;  2YNI A;  4Z4H A;  1TKT A;  3O3G A;  4JRQ A;  4AHC A;  2HVI A;  1WSG A;  1T03 A;  4LSL A;  4DQP A;  4DTM A;  2EX3 A;  2LSN A;  1RTJ A;  2D0B A;  4CK3 A;  1CLQ A;  4DTR A;  4BDP A;  3VQP A;  4FLZ A;  1JXB A;  2D0A A;  3TI0 A;  1XC9 A;  2G8K A;  4O0J A;  3LWM A;  2IAJ A;  4Y1D A;  1NK8 A;  2QXF A;  4I7F A;  4C8O A;  3L8B A;  4O5B A;  3IS9 A;  4FJG A;  1HNI A;  3SV4 A;  3NH1 A;  3TWH A;  1U04 A;  4OKE A;  4CJL A;  3AVC A;  4KV8 A;  1RTH A;  1NJW A;  1NK9 A;  1ZBF A;  4F2S A;  5JS2 A;  4AHS A;  3LP2 A;  4H4O A;  3K5L A;  3NDK A;  4CCH A;  4NYF A;  3K5M A;  4E7L A;  4FK2 A;  3G10 A;  4BDZ A;  3KTQ A;  3UIQ A;  4KI6 A;  4DS5 A;  3KKS A;  5SWM A;  4CJE A;  1Q9Y A;  1L5U A;  1L3T A;  3M8S A;  3SPZ A;  3TAQ A;  4ELV A;  2RKI A;  4I2Q A;  1RT7 A;  1QE1 A;  1G15 A;  5J2Q A;  1N6Q A;  2YNH A;  1EKE A;  3DOK A;  4AHR A;  4BE0 A;  4DS4 A;  3ISN C;  1UAX A;  3WNF A;  4CFD A;  3OYN A;  2IC3 A;  2YNF A;  2OZM A;  3DLR A;  4B3O A;  1TGO A;  4PQU A;  1C1A A;  2PY5 A;  4M3X A;  4KHY A;  3DMJ A;  3MXI A;  3O4Q A;  1KSP A;  1VSF A;  3V4I A;  3VQC A;  3HK2 A;  3NBP A;  2BGG A;  2ATQ A;  1RDD A;  1UOC A;  1X1P A;  3IRX A;  2RPI A;  1KVB A;  1BCM A;  1RBS A;  4ID1 A;  3K5O A;  2OYQ A;  4NYN A;  3BDP A;  3HM9 A;  3QEP A;  2HHQ A;  2KW4 A;  3G0Z A;  3NF9 A;  3IG1 A;  2ZE2 A;  2GV9 A;  4OKJ A;  5HRS A;  4O55 A;  3OYK A;  4KAZ A;  4HVJ A;  3SUN A;  1XHZ A;  1NK5 A;  1LAW A;  1ASW A;  4CGJ A;  5HBM A;  4I9L A;  1NOZ A;  1EXQ A;  3V1Q A;  3RMC A;  1WSE A;  3MXJ A;  3TAM A;  3T3F A;  4DTU A;  3S3O A;  3KD1 E;  1BGX T;  1EET A;  4CJR A;  5E41 A;  3OJU A;  1WSH A;  3MXM A;  3O3H A;  3K59 A;  5HLF A;  1GOC A;  3LP3 A;  4N56 A;  1QTM A;  1RDA A;  4K8X A;  5C24 A;  3SQ1 A;  4ZTJ A;  4KTW A;  5FDL A;  2FBV A;  1RT2 A;  2XY6 A;  2HHS A;  4DMN A;  1RNH A;  1S5J A;  4KFB A;  4KB1 A;  4N41 A;  1SV5 A;  3PX0 A;  4RW9 A;  2B5J A;  1VK0 A;  3RMA A;  4E3S A;  1BIU A;  4W5T A;  1GOA A;  4B08 A;  3TAB A;  4Z4F A;  1LWF A;  3AA4 A;  3QO9 A;  4CEQ A;  1D9F A;  4C8N A;  5J2P A;  5T7B A;  4FLW A;  1KCF A;  4FJJ A;  4J2B A;  1UWB A;  1KLN A;  4Q5V A;  3OS0 A;  2PYL A;  2PZS A;  4NCA A;  1C0T A;  3QEW A;  4HUE A;  1HYZ A;  3AO5 A;  3I0R A;  3KK3 A;  3RWU A;  2JLE A;  3WNH A;  3OYF A;  3ULD A;  1S1V A;  2RN2 A;  5KGW A;  3EYZ A;  4CES A;  3AVA A;  3OYE A;  1VRT A;  3C6U A;  3SUQ A;  4DF4 A;  1IKV A;  2AJQ A;  3D45 A;  4DFJ A;  1J9A A;  1NKC A;  4GW6 A;  3P5J A;  3CFP A;  4LY7 A;  4PWD A;  5HRR A;  5I42 A;  2ETJ A;  4CGH A;  4FLT A;  1IG9 A;  3WNE A;  4HHT A;  1CXU A;  1GOB A;  1RBR A;  4RW8 A;  4DTS A;  1TKD A;  4CJU A;  4EP4 A;  4J2A A;  4CF8 A;  3SYZ A;  2P5G A;  4AHV A;  4NCB A;  3AA2 A;  4E89 A;  4DLE A;  3CM5 A;  4DFP A;  4B8C A;  4ZTF A;  2HHV A;  3QEI A;  3MEE A;  1WSJ A;  3AO1 A;  5SZT A;  2IS3 A;  3ALY A;  2IDO A;  2Z1J A;  3OYG A;  3SCX A;  1SKW A;  3OYJ A;  4M41 A;  2KFZ A;  5HRO A;  4CHY A;  1DLO A;  4FW1 A;  4LD0 A;  3NCI A;  3TR8 A;  2KFN A;  3VN5 A;  2FBY A;  5KTQ A;  4FJL A;  4CHZ A;  3DM2 A;  1WAJ A;  1KFS A;  1KRP A;  3RMB A;  5JS1 A;  3L2U A;  4UQG A;  1J5O A;  1JLB A;  2B6A A;  4BE1 A;  3AVK A;  1UA1 A;  2KZZ A;  4CK2 A;  3P1G A;  3DRP A;  4IG3 A;  3QNN A;  4M45 A;  4QOZ B;  4CER A;  1VSL A;  3VQ4 A;  1RTI A;  1HMV A;  3M8P A;  2W42 A;  5DK5 A;  2OA8 A;  3KD5 E;  1YT3 A;  4W5Q A;  4KRE A;  1WNS A;  3VQD A;  3PO4 A;  4F4K A;  4CJQ A;  2HHT A;  3C6T A;  3TAN A;  3HP9 A;  1U4B A;  1ASV A;  1VSE A;  1NKB A;  4RW4 A;  1ASU A;  4CGD A;  1WSI A;  4M3R A;  4B9S A;  4CF0 A;  1S1T A;  4I2P A;  3PX6 A;  4E19 A;  1TK8 A;  1LW2 A;  1TVR A;  2XRI A;  3LP1 A;  2G8W A;  2G8U A;  4QCL A;  4FJ9 A;  3HXM A;  4G1Q A;  3ZT0 A;  1QSY A;  4O0I A;  3L2W A;  3QLH A;  3QER A;  4N76 A;  4Z4I A;  2IOC A;  5CYM A;  3MAQ A;  2OPR A;  3KKR A;  3MED A;  1J53 A;  4FLY A;  3SUO A;  3OYB A;  1L3V A;  2YV0 X;  2D5R A;  1NJX A;  1KFD A;  4Q0B A;  3RRH A;  2HND A;  2VG5 A;  3ZSX A;  4CHO A;  1S9E A;  3L2Q A;  1BQM A;  4KHQ A;  4CEB A;  1NK6 A;  1Q8I A;  1Z26 A;  4CJT A;  1T7P A;  1NJZ A;  4DTX A;  4YFU A;  2X6S A;  1S6P A;  4FM0 A;  5D3G A;  2Z1I A;  3LP0 A;  1N5Y A;  1F21 A;  5J2N A;  3NGY A;  4CIG A;  4DSF A;  1JLA A;  2OPP A;  3HVT A;  4CFC A;  3OYL A;  1TL3 A;  1RBU A;  3DLG A;  4CEA A;  4CF2 A;  1KVA A;  3O3F A;  3KJV A;  2FBX A;  4CJF A;  3EZ5 A;  3O4N A;  4F2R A;  3VQ6 A;  3NF6 A;  1HJR A;  1S1W A;  3OYH A;  4Z4G A;  1ZBI A;  4MFB A;  3VQ7 A;  1RBT A;  3ZSO A;  5HRN A;  3QES A;  1DTT A;  1YTU A;  1R0A A;  1C6V A;  3NF8 A;  3NGI A;  3V9U A;  4PUO A;  4IFY A;  3HVR A;  1SKR A;  4DQS A;  1O1W A;  4TSX A;  2VG7 A;  3ZCM A;  4DG1 A;  1IH7 A;  1TAQ A;  3QET A;  1JLF A;  4B9V A;  3P83 D;  1KLM A;  4JS4 A;  1ZBU A;  3VA0 A;  1NKE A;  3A2F A;  1S9G A;  4FZX C;  1TAU A;  3DOL A;  4CJ5 A;  1NK0 A;  2P1J A;  4WE1 A;  4CED A;  2HHU A;  5FRN A;  4CHN A;  4BAC A;  2EHG A;  1HQE A;  3CFO A;  3VQA A;  1QS4 A;  3LDS A;  4E7J A;  1T8E A;  1TKZ A;  4CGI A;  4DTO A;  3OYA A;  3NFA A;  3CYM A;  3ZT4 A;  3OY9 A;  2X78 A;  4CIE A;  5FRM A;  3AVJ A;  1RT6 A;  5KRS A;  1BIS A;  4B9M A;  4N47 A;  1B9F A;  4DQQ A;  1JXE A;  4ICL A;  4KKO A;  3RR7 A;  4OVL A;  4CGG A;  1RT5 A;  4Z4E A;  1JLG A;  1VRU A;  4AH9 A;  3VQ9 A;  3PX4 A;  4CJK A;  4BWJ A;  1TK0 A;  2KZM A;  4AHT A;  2X74 A;  3C95 A;  1WSF A;  4CGF A;  4F3O A;  4FJX A;  4QAG A;  4DSJ A;  1RTD A;  3LPT A;  1HYV A;  3LAN A;  5CZ1 A;  4CJ3 A;  4FW2 A;  3THV A;  1W9H A;  3U3G A;  2B4J A;  3DI6 A;  1JL2 A;  4JS5 A;  4FJK A;  2F8T A;  1C1B A;  4KTZ A;  4RW7 A;  3EY1 A;  4FJI A;  4FJM A;  1C0M A;  3NH0 A;  2KQ2 A;  1A5X A;  2P5O A;  2Y1I A;  5CY4 A;  1NK7 A;  3AV9 A;  3S9H A;  1VSJ A;  1W0H A;  4KRF A;  4FLU A;  1I3A A;  3SZ2 A;  2F8S A;  2G8F A;  4FJ7 A;  4CJV A;  4FXD A;  4DQI A;  3ZT2 A;  3NH2 A;  2ZQB A;  1HRH A;  4ZHR A;  4E7I A;  3ITH A;  4HCB A;  4J2D A;  4FJN A;  2G8I A;  1ZBH A;  1JKH A;  5K14 A;  1BHL A;  2IGI A;  4CEE A;  5FRO A;  2R7Y A;  3HT3 A;  3LPU A;  3V9Z A;  2BE2 A;  1JLE A;  1LWC A;  1QSS A;  5C42 A;  3OYC A;  1SKS A;  1QQC A;  1RBV A;  1REV A;  2HMI A;  4W5O A;  1FKO A;  4DU3 A;  4LSN A;  3AVB A;  4DF8 A;  1Z25 A;  3ZSW A;  4HCC A;  3TAR A;  4FK4 A;  4OLA A;  3V9W A;  1U47 A;  5CYQ A;  3LAK A;  1LV5 A;  4KHU A;  3AO4 A;  1J54 A;  3KK2 A;  4E0D A;  5KI6 A;  1D8Y A;  1RDB A;  2Z1H A;  3K5N A;  5KRT A;  3V6D A;  1I39 A;  2RF2 A;  2HVH A;  2HHX A;  4DSL A;  1K6Y A;  2I5J A;  4BWM A;  4GMJ B;  1BI4 A;  4OPJ A;  4AIL C;  3VQ8 A;  4BE2 A;  3RTV A;  2XY8 A;  3V81 A;  5HP1 A;  3HST B;  5I3U A;  2HB5 A;  1MU2 A;  3S3M A;  4PA1 A;  1D5A A;  1JLC A;  1U45 A;  1SL0 A;  2KTQ A;  4W5N A;  1KVC A;  2A1R A;  1X9W A;  2G8H A;  3C94 A;  3QIO A;  3HO1 A;  3HL8 A;  3AA3 A;  2Z1G A;  1TKX A;  3AVF A;  1C0U A;  4CJP A;  2GUI A;  1FXX A;  3SJJ A;  2VWK A;  1YVU A;  1BIZ A;  3PUF A;  3B6P A;  1S1U A;  3AVG A;  4CHQ A;  4FJ8 A;  5EU7 A;  3ZSY A;  3WNG A;  4DU4 A;  4HUF A;  1A5V A;  4LH5 A;  2Y1J A;  4FZY A;  1FKP A;  2WOM A;  3FFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...