3R1XA

Crystal structure of 2-oxo-3-deoxygalactonate kinase from klebsiella pneumoniae
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
295
structure length
295
Chain Sequence
SNAMTARYIAIDWGSTNLRAWLYQGEECLESRQSEAGVTRLNGRSPAAVLAEITQHWRDGATPVVMAGMVGSNVGWKIAPYLPLPAAFSDIGQQLTAVGDNIWIIPGLCVSRDDNHNVMRGEETQLLGARALAPSSVYVMPGTHCKWVLADRRQIHDFRTVLTGELHHLLLQLSLVGAGLPPQETSAAAFAAGLQRGINNPAVLPQLFEVRASHVLGALPREQVSEFLSGLLIGAEVATLSDTFAGQQAISLVAGSSLTSRYQQAFAAIGREVSAVAGDTAFQTGIRSIAYAVAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of 2-oxo-3-deoxygalactonate kinase from Klebsiella pneumoniae.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Transferase
molecule keywords 2-oxo-3-deoxygalactonate kinase
total genus 93
structure length 295
sequence length 295
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.58: 2-dehydro-3-deoxygalactonokinase.
pdb deposition date 2011-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05035 DGOK 2-keto-3-deoxy-galactonokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.300 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3r1xA01
3.30.420.310 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3r1xA02
3T69A 3R1XA
chains in the Genus database with same CATH superfamily
2W41A 3MXIA 3VETA 4OVLA 3CETA 3S41A 3MXJA 4CIFA 4CGGA 1RDUA 3O9TA 2HHHK 3U4LA 4K8XA 1O1WA 3MN7A 2OZMA 2HNYA 4FJKA 1TUUA 2QM1A 3NE6A 3ZSQA 2O4IA 4FJ8A 3TAQA 1D9FA 2E2QA 4FOIA 4CHOA 3NH2A 1BISA 4XEIA 4NCAA 3TI0A 1HPMA 2E20A 3OYMA 2ZJQL 1GLDG 2O8CA 4CJLA 4G1QA 2QWQA 4JKHA 2J4RA 3QIPA 2X74A 4FWLA 3K9JA 4O5FA 4QAGA 1HKBA 1REVA 2WONA 1JLQA 4PKIA 4FWNA 3L2RA 2GTDA 4KFBA 4CIGA 1XHXA 4O0JA 3U9DA 3ATVA 4CJ4A 2QWRA 4CZMA 5AZJA 3OYNA 4ELTA 1ILYA 3CJCA 3BF1A 2NLXA 4DF8A 4CJQA 3P5JA 3SQ1A 3HM8A 3OBWA 1EX4A 3ENOA 1TL3A 4CHPA 4C1NK 1T7PA 3CPEA 4KAZA 3AGRA 3B6PA 2KHOA 3CPWM 2BE2A 4NO7A 3K59A 2OPRA 1RFQA 4K25A 2OCEA 3THXB 4CF9A 4FWPA 4CK3A 4RW7A 1B9FA 3ID8A 4DQSA 3I56N 1GLAG 4CZIA 4DG1A 4H5WA 1U2VA 2Z1GA 5C2DA 4FOEA 1VQ9N 3L2WA 4DSIA 4IJNA 2PZSA 2Q36A 4B9TA 1L5UA 4F4KA 2OTLN 5FDLA 1CZ9A 5GAEP 3BZKA 3BUZB 1VSIA 2JWLA 1HNZK 2ITGA 3R6MA 1I3AA 3HTVA 1JL1A 3O1WA 3K58A 2IS3A 3LP3A 4CZFA 3RVCA 5BREA 4O4GA 3NF9A 3AARA 2UUBK 5KRTA 4DLGA 2A42A 4J2EA 3KWIA 4RCHA 5KGWA 4DU3A 4YNQA 3SV4A 1NJXA 3KLFA 3QEWA 5FROA 3SUNA 2QTDA 3KZBA 3QDKA 2VWJA 4ILHA 4B3MK 4IXCA 4ISFA 1D9DA 4CFCA 4U67L 1JXEA 1NJZA 3VQ9A 1RTDA 4OKKA 4HTLA 2HBMA 2PYLA 4H5TA 5KI6A 1TAUA 2RF2A 4Z4GA 1JJ2M 4LFBK 2ITMA 4N5SA 1L3VA 4CZJA 4B9VA 2O8EB 2F9WA 4FJMA 5AQIA 5DM6L 4CJUA 3VA0A 2E8AA 1GOBA 1YAGA 2IGIA 2GELA 3VEVA 2KLAA 2E2PA 1U2VB 3O3GA 4FJHA 3ZETB 3TWHA 1T6DA 4FZZA 3ZCMA 1JLCA 3VTIA 1UWBA 4EP4A 4CI6A 5HBMA 3JSMA 5BRHA 1U45A 4BACA 4Z94A 3R1XA 1NK8A 4M3YA 4NLBA 2HNDA 1T44A 1FJGK 3L3UA 2O8FB 3CC7N 2P9KB 4PKHA 3IS9A 1NU0A 2UUAK 3KWGA 4NYNA 1RBVA 1VQON 5CR4A 1L3UA 4PWDA 1G15A 1WSEA 1L3TA 2X78A 3WEEB 2OPSA 2HMPA 4CF8A 2ASOA 5CYQA 3HXMA 1HYZA 1SS6A 2QWOA 1HRHA 4AQYK 3VQ5A 3C0BA 4HUFA 4E7HA 2CGJA 3MCAB 4WF9L 3QINA 4DS4A 1TL1A 5K14A 3VGKA 3CC2N 1Z26A 1A5XA 1S1UA 3JS6A 4B9NA 3V9WA 1HX1A 1M1KO 4CEAA 4KBOA 5F1XA 5JVHL 1IKWA 3IDHA 1X9WA 1W97L 2ZM6K 5MLCQ 2ZF5O 2A3ZA 4EHUA 2OPQA 2X6NA 2PBDA 4RWTA 5C42A 4CBXA 1T3VA 3VENA 4EZ6A 4CK2A 2E5LK 2X6SA 3ZT4A 4CJFA 4LF6K 1OKJA 1X3MA 3ULEA 3O80A 1LV5A 4H0TB 1EETA 4CJPA 1N6QA 3B8AX 4B1XB 3CCLN 3EE9A 3BDPA 3ZSOA 1OVYA 4ISEA 3J7AP 1WNSA 2NRVA 4X66K 1Q86O 4JI8K 3IG1A 3K0SA 1SKSA 2O8BB 3D2EA 3WEEA 5CHIA 3L4QA 3T3FA 4XH1A 3HPGA 2QXFA 3KKSA 1N5YA 4WYBA 1NGDA 4NLCA 3PIOL 5J2MA 2P9KA 4BRFA 2WTUA 4B3OA 1ZBIA 4FLUA 1BQMA 1QQCA 4E19A 3OYDA 3HI0A 4FLYA 3RSEB 4FO0A 4B9LA 3A5MC 3U8XA 3C65A 3MWTA 1MA9B 1W0HA 5I42A 1UOCA 2W42A 1K9MO 5AQRA 3OYKA 4CESA 4IDHA 1Q18A 3DXMA 4FLWA 3SMSA 3A8YA 4Z4EA 4DFJA 3KK3A 5EVZA 3JXUA 4AHTA 3VGMA 4DTSA 4H5NA 1XMQK 1HQEA 1ATNA 1X1PA 3EZ5A 3LAKA 5D3GA 3MDQA 1CLQA 4CF0A 3CJ9A 1VQ4N 4DV5K 4OX9K 3HM9A 4KTQA 3CG7A 4JNEA 4EP5A 4IO9L 1KSPA 5KPTA 2YHXA 4BGAA 3OYIA 3QNNA 3RRGA 4DSLA 4JV5K 3EN9A 3VEZA 2QWPA 1QSSA 3CIPA 1YT3A 1BI4B 4M3WA 4B9QA 1BCMA 3CD6N 3CM6A 5GIPA 4CFDA 3D0PA 3RRHA 1M90O 4CHYA 2XHBA 4LH5A 3IUCA 5FRMA 1J53A 1BCOA 3QLHA 3U3GA 3LALA 4FLXA 4JI5K 3K2PA 5BPLA 5BPMA 2ZD1A 3C7NA 4JLHA 3AVJA 1HJRA 1S1XA 4JI4K 3QO9A 3VMFB 4A2AA 4CK1A 3OJUA 4DTJA 4XH4A 2E1YA 1E4GT 3M8QA 4FJGA 1F21A 2V7ZA 3GG4A 3HPHA 4DTRA 4FWKA 4JD2A 5FPMA 1N34K 3PO4A 2O4GA 3M5RA 3C95A 2XRIA 4GV9A 1V4TA 4Z4HA 4DV2K 2I7NA 2AA4A 4WQ4C 2ZE2A 4KHSA 5SZTA 1NK7A 1MDUB 5M1KA 2YNIA 2XY6A 1NLVA 1DTQA 1KCFA 2IAJA 3VF2A 1JXBA 3H3NO 4JKDA 4H4OA 2P51A 1NK4A 3HZ6A 1YJNN 1RT7A 2Q3SA 5E84A 2EHGA 3LZIA 4E1MA 1KTQA 4FLZA 3JYTA 1ZBSA 4DV7K 5AQXA 4YORA 1ATRA 3CCSN 4F3OA 3TAEA 2IVPA 1Y97A 3ZSYA 1BG3A 2VCPA 4B9UA 4HHTA 2P1JA 3THVA 2HMIA 1RT5A 5GAHP 4BVPA 1VSFA 3MK6A 3I8BA 3QEIA 2ZGZA 4BR4A 4BR9A 3GBTA 1CZBA 3EEQA 5AQPA 3AVMA 3MCPA 3SUQA 2GX9A 3DRSA 5KPZA 2IC3A 3NDKA 3ENHA 3OYJA 5KTQA 3CC4N 3UKUB 1R59O 3WXLA 5GINA 2GEMA 4DWIA 4QS7A 3P1GA 5FLXO 3SUOA 5J2QA 5BRFA 5DM7L 4IEIA 4E7KA 1RDDA 4CJSA 3OYCA 4ZTJA 2FBTA 4RW4A 2OTJN 2P9LA 3M8PA 3DWLA 2G8KA 1ZYQA 2Q97A 4OKJA 4BRAA 4OPJA 1IBLK 3GOIA 4DTUA 5KQ8A 3ZX0A 3S3MA 5I9EB 3A5LC 2E6LA 1X3NA 4HWIA 4OGEA 3VQQA 4IOXA 4LF8K 4CEFA 1Z6RA 4KRFA 4GVEA 3ZX2A 1HMVA 4I7FA 4M7YA 3NHGA 5DK5A 2FF6A 3WXJA 2O8BA 3DI6A 1WAJA 4JN4A 4MLHA 4N56A 3EY1A 2PY5A 3H46O 3QIOA 3J7ZO 1S5JA 4JI6K 3DLEA 4FJ5A 4FLVA 4NXMK 5B8HA 1ZBHA 3FLCO 2XY5A 3KLHA 2V51B 4GMJB 2O8DB 3DXKB 4C8LA 4HUGA 4WQ4A 2VG6A 3L3VA 4O55A 3LWLA 4LH4A 1YTUA 1A5WA 3AO3A 3AVKA 5J2NA 3O9UA 4B1YB 3O6WA 5HL7L 4A59A 3TAMA 5KGXA 3M1FA 3VA3A 4GVMA 3DM2A 1N8RO 5LJVA 2IVNA 4FJNA 4GKJK 4CGFA 3I8DA 2VGMA 4RW6A 4FZYA 1BA1A 4BRKA 3H1QA 3HYFA 4DR2K 2Z1HA 3PSFA 1J54A 3RWUA 4BWMA 5AQQA 5GADP 4CD3A 2YNHA 4Z0UA 1TUYA 5HRRA 4KH5A 5JLFA 3ZSWA 4IJAA 4Y0WA 3B6OA 3HBTA 3L2VA 3ZEUA 3TR8A 1GLFO 5CYMA 3UE5A 4GV6A 3O5BA 1JLGA 1W2BM 1IV0A 4C8KA 4BRHA 2ZJRL 1T03A 3CCMN 4KH6A 1JCGA 1BGXT 1ZC6A 3A5OC 2VWKA 4CF1A 2W40A 2F96A 3I0SA 4KB1A 3BP8A 4IZ9A 3LDSA 3RMDA 2FSNA 4CZEA 1VSMA 3MXMA 2ZJPL 5TKWA 3L2UA 1C0FA 1NMDA 1TKZA 3L4IA 3PX4A 1S1VA 4ISGA 1W9HA 4FWOA 3F5TA 4WQ5C 3G10A 5EU7A 3RMCA 4LFCK 3A5NC 3SNNA 1UAXA 3CQ8A 3WXMB 4A5BA 4JD2B 5HLFA 2OANA 3VOVA 4BGBA 1SL0A 3RMBA 1ITGA 1NGBA 1VSDA 3HK2A 5C0YA 2HNZA 4F2SA 4I2PA 4KHYA 3P39A 1ATSA 1VQ6N 2YV0X 1TGOA 2UXDK 4DR3K 3UIQA 4FWRA 3ZEUB 1GLCG 3AO5A 4DQIA 1IKVA 4ID5A 4WE1A 5E26A 4DQPA 5HRSA 3EL2A 4I2QA 1SUQA 3VESA 3TSUA 4FJ7A 5KQDA 2HBLA 4CIEA 4IOAL 3WXIA 1U4BA 1XNQK 3AAQA 4L3QA 4FM0A 4B9SA 3O3HA 1NK9A 4B1WB 1IBKK 4MDBA 3TTCA 3ALYA 4A61A 4CEEA 1QS4A 1J6ZA 2GWKA 3E9OA 3KLIA 2V52B 2QKBA 4DTXA 3VQCA 2HF4A 3E9LA 1IH7A 1A5VA 3MMVA 1JL2A 5BR8K 2JWKA 4CE9A 3CQYA 3UB5A 3AV9A 1O13A 1TKXA 4HUEA 3DRPA 4FM2A 4YOTA 1QZ5A 3HP6A 4CEBA 3T1HK 3OS1A 1ASVA 2NNWA 2E6MA 2IIRA 1JCEA 3CXCM 3PV8A 1CXUA 2E2OA 2QWMA 2WBNA 4R5PA 4MDAA 3SAGA 3C6TA 4K8ZA 2D0OA 3DLLL 4M3RA 2FXUA 3KTQA 1C1AA 3F9KA 1N32K 4E1NA 2EX3A 1S6PA 3DAWA 3TTDA 3LP2A 4KTZA 4BROA 3ULDA 4FCYA 1QQNA 3OS0A 3SBTA 5AZJB 2NRZA 3HP9A 4CGHA 2HHSA 3AVHA 1HYVA 2O8EA 1VRTA 3FZLA 4HVJA 1NK0A 1N36K 4CZLA 2AJQA 5AQJA 3FFKB 1U6ZA 3CCVN 3OY9A 3KJVA 3O3FA 3HSTB 1VSHA 3WNGA 4B9MA 1XHZA 2D5RA 4DLEA 1BA0A 3CM5A 4O44A 5AFUH 4ZTFA 2UYTA 2RE2A 2UUCK 4IO8A 1HYSA 4H4MA 3H1VX 4GV3A 4CJ3A 1TK5A 1NWKA 5JMVA 2HHXA 1BIZA 3K5OA 1WSJA 1S6QA 3ENBA 3LZJA 2QXLA 2CH5A 1VQNN 4PL8A 4IKFA 1KD1O 3QERA 2B4JA 1VSJA 2OZSA 3HOTA 1RT2A 3SAFA 4DQQA 3KD5E 5AQYA 5EY4A 1QQOA 2VG5A 5F2RA 4JKCA 5FRNA 3EKUA 3O8MA 3HSCA 3C7NB 4AM6A 3OW2M 1NGFA 3ZX3A 3DOLA 4BC4A 1C0TA 4DV0K 2DTUA 1BL3A 4JK9A 3E01A 3VQ6A 3EYZA 3LM9A 3IAYA 1QQMA 4BG9A 1SAZA 2F7TA 1JLBA 3R3LA 3T1AA 4Z4FA 1SKRA 3DOKA 4J2BA 4KHPK 4IG3A 1TYQA 2D4WA 1HNXK 5AFUA 1DLOA 2YHYA 3S3NA 4JI3K 4V19S 4E3SA 2A40A 4KHWA 1C1CA 1OVQA 1L3SA 4NCGA 3S3OA 2NRXA 3ZT3A 4B3RK 5C10A 1P90A 1EO1A 3OYFA 1HKGA 3CCQN 3J81O 1WB9A 4H0XB 3SPYA 3K5LA 4CGJA 3ITHA 1GOCA 4YDUC 1QTMA 3DLBA 1KLNA 3H3OB 5M1PA 1YXQA 2A1SA 1NGGA 3HVTA 3NF6A 4RW8A 1WAFA 3DLKA 5LY3A 3RMAA 1VSLA 3WQTA 3RTVA 4B3TK 3W0LA 4YOXA 1OH7A 2F9TA 1NKBA 4N76A 3BGRA 4H0VB 3DLRA 4IFYA 3WNEA 4WCEL 5C15A 2PYJA 1IKXA 5M1QA 2Y1IA 4CCHA 3OYHA 4F9OA 3TABA 2ZWHA 4N41A 4FK0A 2HB5A 4FJIA 4DR6K 5AQLA 2OPPA 1IKYA 2VGNA 3IMXA 2IOCA 3NMUA 4QS9A 1BQNA 4F2RA 4I6MA 4DQ8A 1UA1A 4BRQA 4C1NI 4J2DA 4E7JA 4BR0A 3NH0A 3MX5A 4DFPA 1YIJN 4KI6A 3OVNA 1DT9A 2KFNA 3T19A 3QBWA 5H1SQ 5AQWA 4JKGA 1HNIA 2HHUA 1NBWA 2RPIA 3P4IA 4KTWA 3WT0A 4CECA 4B8CA 4DSFA 1BDGA 4IEEA 3VQEA 4DSKA 1BOTO 4CGDA 1WLJA 2NRRA 4DV3K 4FJXA 1MWKA 3IFRA 5HRNA 1TK8A 4F3TA 3V9XA 1ZBFA 3BZCA 3CJBA 5JS2A 2A41A 1LWFA 2FBXA 2V7YA 1EKEA 1LAWA 3UKRA 3WNHA 5AQOA 2G8UA 5AZIA 5BN8A 1NGAA 2QEXN 1D5AA 3SK3A 5JVGL 1HUXA 1E3MA 5LL6Z 1ESVA 3AVNA 5HRPA 2DFHA 4DV1K 5LJWA 3NGIA 2P5OA 2HSTA 5J1EA 2XO7A 4K41A 3SMPA 5FPEA 4CERA 4CZHA 1WSHA 4M3ZA 3V9ZA 2RN2A 3GDQA 5AQZA 4PL7A 4LFAK 2F8SA 3OS2A 1NGCA 4DR5K 3ZLJA 3PIPL 1NGIA 3MECA 2YHBA 4MQ3A 3AAPA 5E41A 4YOVA 4O8UA 5JLHA 1KQSM 3MAQA 4AM7A 3ATUA 2KTQA 3N4PA 3A0IX 4CF2A 4CEQA 3VEYA 4JKAA 3F2KA 2F4VK 1S3XA 5HP1A 4U7BA 5T7BA 5AQMA 2DFEA 3E9PA 2WFBA 3UKRB 3ZETA 3AVLA 3NH1A 1KRPA 2HHTA 4EZ9A 4FK2A 2VQEK 2YJEA 1WUAA 4OJRA 2AP1A 4UQGA 4OPKA 2YKNA 3V1QA 3QETA 3SCXA 4GKKK 4M63C 4Z4CA 4CHZA 4Z4IA 2P9PA 3V6DA 2QKKA 1WSFA 1XC9A 2EWSA 4CJ5A 3LAMA 4BY9C 3LDLA 4E1JA 3LDPA 2I7PA 2UXCK 2I5JA 3VERA 4Y1CA 3L6QA 4DV6K 4ZHRA 3ZT2A 3BY5A 2VYPA 4H8KA 2BH1A 1Q9XA 1HNVA 1HPZA 2G8HA 1J9AA 3AA4A 3VTHA 3VQDA 1QHTA 1VSKA 1FW6A 4KO0A 1KAXA 3LANA 1X9SA 2E88A 1S1WA 3PSIA 3HVRA 4WFBL 3NAEA 4CFBA 4ID1A 5JICA 2ASPA 4RW9A 5AQSA 4Y1DA 3OYGA 5AJ3K 1EWQA 1K73O 2BTFA 2E4LA 4PKGA 3QNOA 3M6GA 4MFBA 2Z1IA 2G8VA 4FJJA 2YX6A 1BU6O 4ELUA 1RT3A 5AQKA 4W5QA 2CGKA 1NNEA 1TYQB 1SQKA 4KI4A 3M8RA 2FSJA 4C8OA 1U04A 3LP0A 4IFEA 4BDPA 2P9PB 1C0UA 1S9EA 2D0BA 1GOAA 1RT1A 3O1BA 4NXNK 1WSIA 2OYQA 2YJFA 5M1NA 1UA0A 1YJ9N 3CFRA 4DU1A 1RILA 1S1TA 3T1YK 2HBKA 1Q9YA 4ICLA 1TKDA 3WQUA 4PUOA 4CJ7A 3EKSA 1XC3A 3ZSZA 1VQMN 2FBVA 3BF3A 3GL1A 1XNRK 1JKHA 2A1RA 4M3TA 2O8CB 1Y64A 4BQLA 3H08A 5FPNA 4KHNA 3THYA 5CY4A 3CQXA 4DR7K 4BE2A 3HOSA 4GY2B 4YY3K 1XQSC 2GUIA 2O8DA 4KB0A 4FJLA 4DSEA 4PA1A 4DB3A 3KLGA 1RTHA 4KV8A 2DFFA 3L0QA 3U9ZA 4OKEA 4DTOA 1KVCA 4BC3A 4H0YB 3CYMA 2ATQA 4DMNA 2GV9A 1Z05A 2Q31A 4M42A 3CMAN 4CEZA 2CGLA 4ILGB 1YUWA 2BUPA 4FPBA 4WFAL 5C24A 2NRWA 3VF6A 3PX0A 4JKGB 4MO5A 3CFPA 1KAYA 2HOEA 3SBGA 5HOOA 5FPDA 4IDKA 4JRQA 1I39A 3LDOA 1S9GA 4BE0A 1C0MA 1YF5L 3LL3A 3ZSVA 3SPZA 1K8KA 3VQPA 1C6VA 4YOWA 3T69A 1BI4A 1GLLO 2O8FA 4GW6A 3R9PA 1S22A 1C1BA 4H0OA 3HL8A 1C0GA 3O9SA 4JK8A 4BDZA 3SQ2A 1HLUA 4BR7A 3THWB 3TARA 1NGJA 1J5OA 4JI2K 1S72N 3VGLA 1MWMA 4BVOA 3HRGA 2XY8A 4FLTA 3PY8A 2Y1JA 4KH4A 4CJEA 3T7ZA 1G99A 2ASMA 2Q1NA 3AGKA 2BDPA 3AVCA 1D8YA 2RKIA 4M7XA 2WC9A 4BRNA 2YNFA 1X9JA 4BG8A 3H45C 1RBUA 4LF4K 2IVOA 3FZKA 3D2FB 4FW2A 4CJVA 2KQ2A 3LPTA 4R79A 1VQKN 4BRLA 3NFAA 4C23A 4FK4A 3TPQA 4CFAA 4BRCA 2P9IB 4CJKA 5CE3A 3AY9A 1DKGD 4DFKA 4JHDB 1IJJA 4OPAA 3J8AA 3VQ7A 4A5AA 4KHUA 3AO2A 4M3UA 2B6AA 3LPUA 4OPHA 1XWLA 3KVGA 3AVAA 3TSQA 2HW3A 3SQ4A 4BC2A 4CHQA 1DEJA 1DGKN 4JKFA 4CEDA 3Q7CA 4LF7K 4XH5A 1P8ZA 4DTMA 3JAMO 3CCRN 3SV3A 4E89A 1R0AA 1H1VA 4M45A 1RDBA 4HCBA 2HVIA 3D6RA 4NYFA 5AQVA 2QI2A 3E66A 5AQHA 3QEXA 3MN9A 1KFSA 2BGGA 3CMEN 4H03B 1RTIA 3K57A 3AVFA 1HNWK 2LSNA 3G6EN 3W3DA 4DSJA 2G8IA 2YKMA 1SZ2A 3QMLA 4DF4A 3KD1E 4FVUA 2ZQBA 3V9UA 5AQFA 1LAVA 3CJAA 4W5TA 4IBNA 3CI5A 4BRIA 3J7YP 1VQ8N 1B92A 3TAFA 1W7AA 3OYBA 2KZZA 1K8AO 3MWPA 2P9SA 5AQNA 4AHUA 2PFUA 5LMUK 3CCUN 3LM2A 5CZ1A 1EQYA 1NGHA 3DXKA 1YITN 3FE1A 1J5EK 3KLEA 4JK7A 4JKEA 1E4FT 2VQFK 3P31A 3OTOK 4F8RA 3ZSXA 2P9UB 3KHYA 2D0AA 4I6MB 3DMJA 1VQ7N 2Q2RA 4DR1K 2G8WA 3MEEA 4KREA 2WOMA 3ASMA 2P9LB 4K0KK 4ILJA 3SZ2A 1Q82O 1TK0A 4M41A 4AH9A 1RGIA 4LSLA 2ZGYA 3TANA 3GE1A 1Z25A 3O4WA 1B9DA 5SWMA 4CZGA 1X9MA 1XI1A 1HKCA 1N33K 4BDYA 1IBMK 4JS4A 4FWQA 3C6HA 3FGUA 1DTTA 4HCCA 3ZT1A 1NGEA 3V81A 2FSKA 3V1RA 1KXPA 4MLEA 4CBUA 3IRXA 1OH5A 2KZMA 2GBZA 1I94K 4LF5K 4FL9A 4E7LA 4YOYA 1SV5A 4IOCL 4X62K 3VPZA 3TAPA 3NVKA 3I0RA 3V4IA 4EIAA 3KK1A 3BEXA 4B08A 3QFPA 2BANA 2D0PA 1NKCA 3L2QA 2QWNA 1IG9A 3VN5A 1NKEA 1QSYA 2CH6A 4RTFD 3MEDA 3VEWA 4J2AA 4DCHA 4DQRA 1K6YA 3D7EO 4ELVA 4Q0BA 2A6AA 1YI2N 4FSVA 5IT9O 3O4QA 3SLCA 4AHRA 2NUBA 5C25A 3OA9A 4Q5VA 3PO5A 2JLEA 1TV6A 3QEVA 4QS8A 1Q8IA 4EAHD 1GLBG 3R8EA 5IWAK 1NJYA 1VK0A 3CFOA 3DJCA 4AF1A 3NVMA 1YJWN 4O8KA 3M8SA 3KK7A 4BRPA 4H5VA 2NRTA 5BRDA 3N4QA 1YHQN 3MN6A 4DR4K 3ZSRA 5ELZA 2PAVA 3CF5L 2P5GA 1V4SA 3AVBA 1RNHA 5ADXH 1ASWA 4DU4A 2YHAA 1NMNA 4CJTA 2FF3B 2RHKA 4H5RA 4KPYA 2W6KA 2NRHA 3V1OA 1WN7A 3C6AA 3M3ZA 4HTUA 1LWEA 3Q7BA 2H3GX 3ID6A 3U3YA 4I9LA 1TVRA 1ASUA 1RCHA 4OLAA 4YOUA 4BRMA 4BRDA 1K8KB 4OLBA 3VF4A 1SKWA 1JLEA 1RDAA 4GNIA 1BO5O 1NM1A 2UU9K 1NOYA 4NCBA 3THWA 1YVNA 3RSEA 4DKWA 5J2PA 4LC9B 2VWBA 3TU5A 4FPAA 5LMNK 3D45A 1NJIO 4AHCA 3O9QA 3DLHA 3FZMA 1JLAA 4BC5A 4K43A 5AQGA 3SUPA 1Q81O 3C94A 3AVGA 3EE8A 3OHRA 3F9MA 4FVMA 3UKUA 1KVAA 1RT6A 3VEOA 4G9ZA 4B1ZA 3AVIA 4DTPA 5EXWA 2KFZA 4FJ9A 2XY7A 1VQLN 4M3XA 1EWRA 2D0CA 3E1YA 3KKRA 4OGCA 2P9IA 3KIOA 1ZXOA 3OYLA 2P9NB 1XMOK 3DRRA 3AA2A 3LP1A 3SAHA 4QCLA 1CXQA 4LD0A 3OYEA 3QBXA 3PX6A 1T8EA 1U48A 3CJ1A 1NG9A 1QVFM 4E0DA 1KFDA 4JI0K 4A57A 4B1UB 1FK9A 2DPNA 2R7YA 3K5NA 4IWVA 4EFHA 4CW7B 1IG8A 5KPRA 4UY8O 5HROA 4YDUA 4B1VA 3OYAA 2KKZA 3FR0A 3QICA 1VHXA 4E7IA 3O9RA 5CZ2A 5AZIB 5BPNA 2YCHA 1BIUA 4TSXA 4YHHK 3A2FA 4BRGA 3NBPA 2HHWA 1CZAN 3WNFA 3HT3A 4B3SK 1FKOA 1U49A 3V9SA 1ZBLA 2YHWA 4CZKA 4YFUA 3C6UA 1JCFA 5TKYA 5KRSA 3G71N 5BR9A 3TTFA 1OH8A 1RT4A 4FWSA 1D4XA 2P9SB 4DUZK 3I33A 3QFUA 1VSEA 3QESA 4CEOA 4B8AB 1LCUA 3EO3A 5AR0A 3U6FA 2W6LA 1NK6A 2ETJA 2QWLA 5I3UA 1VRUA 4JI7K 2E2NA 1BUPA 4A2BA 5C12A 4JEPA 2P9UA 4AHSA 4AHVA 1GLEG 1HJOA 4DV4K 4FYDA 3OJSA 3LWMA 4O5BA 2KW4A 3MX2A 1FXXA 3ULEB 3CHWA 4DFMA 2YI1A 3J80O 4X65K 4L8RB 3CERA 3SJJA 4BR5A 4QOZB 2HHVA 3ISNC 2F8TA 2FC0A 3FZFA 3AA5X 1GLJO 4CD1A 3HPOA 1LOTB 4DHYA 5GAGP 1RBRA 4FM1A 5A2QO 2G8FA 2IDOA 2Q0RA 3D2EB 4AILC 4FWMA 3NF7A 2B5JA 3SI6A 1TKTA 1KVBA 4I9QA 1U47A 4C8MA 4IFVA 4OO1J 1NK5A 1KAZA 4JKBA 1HR0K 3CJ7A 3HJFA 3CCJN 3K9KA 1JLFA 5EOYA 5GIOA 4J8FA 1FKPA 3O4NA 4JYAK 3HO1A 5C2FA 1BHLA 2UXBK 4CJRA 2WUSA 4W5RA 1WBDA 3QB0A 3LDNA 1XUPO 3DXMB 1RDCA 1OH6A 1LW0A 3TSPA 1ZBUA 1LW2A 3D2FA 1YVUA 5AQTA 4O0IA 4W5OA 5M1FA 1QHAA 2Z1JA 1RBTA 4DTNA 2FLOA 3OBYA 3PUFA 4JHDA 3K5MA 4KHQA 1QZ6A 3KK2A 3WXKA 4N47A 2NZTA 1RBSA 4IG0A 3O08A 4RG8A 2HHQA 3ZT0A 4DUYK 1KLMA 4LF9K 1VAZA 5DMRA 2DY4A 4CJWA 4LSNA 4X64K 3G4SN 1HQUA 2OA8A 3MEGA 1BWFO 5F0XA 2QK9A 4CHNA 3P83D 4JAXA 2HBJA 2QW9A 4PHTX 3VQ8A 4BQZA 4W5NA 2HF3A 3NGYA 1IO2A 3DLGA 4JS5A 4A62A 3PLAA 1WOQA 3L8BA 1QVGM 2GUPA 4CBWA 4FZXC 4BWJA 4H0PA 3VEXA 1MU2A 3MN5A 2E1ZA 3SQ0A 3VQAA 1WBBA 3P38A 4PQUA 4KKOA 3EZWA 2FBYA 3NF8A 4BE1A 1YTAA 1QSLA 3RR8A 1NJWA 3G0ZA 4CVNE 3SJHA 5AQUA 1Q7YO 1SL2A 5EX5A 2D1KA 1T05A 3AO1A 3QEPA 3NCIA 4MO4A 3NGZA 4JRPA 1EP4A 2Q0UA 3THYB 4EHTA 3SYZA 1EXQA 3TAGA 3LDQA 2JGUA 3I55N 3S9HA 1TAQA 4FW1A 3DYAA 4XIUA 3F73A 1WSGA 1RDWX 3FFIA 4LY7A 2QA4N 4CGIA 4BR2A 4NB4A 5M1OA 4WQ5A 4WFNL 1VQPN 3AA3A 4K42A 1SL1A 2A5XA 4BREA 3FZHA 1T6CA 3VQBA 3ZYYX 2HVHA 2GWJA 2YNGA 4JI1K 2P9NA 3H6EA 5ADXA 2VG7A 1QE1A 3RR7A 1VQ5N 3CCEN 1KC8O 3WUHA 5JS1A 3G25A 4PY5A 4FXDA 5BN9A 1RTJA 4C8NA 1LWCA 1NOZA 3VQ4A 3IKMA 3AO4A 3THXA 4DS5A
chains in the Genus database with same CATH topology
2W41A 4BR4A 4BRQA 4BR9A 3O4WA 3VETA 3GBTA 4C1NI 4BR0A 4CZGA 5AQPA 1HKCA 3CETA 3S41A 3MCPA 2GX9A 3MX5A 4FWQA 3C6HA 3FGUA 1YIJN 1DT9A 1RDUA 5KPZA 3O9TA 1NGEA 3U4LA 3MN7A 2FSKA 1TUUA 3ENHA 1KXPA 3QBWA 2QM1A 3UKUB 1R59O 5AQWA 5H1SQ 3CC4N 4JKGA 4MLEA 4CBUA 3WXLA 1NBWA 3P4IA 5GINA 2GEMA 3WT0A 4QS7A 2E2QA 4FOIA 1BDGA 4IEEA 4FL9A 4XEIA 5BRFA 5DM7L 1BOTO 4YOYA 4IEIA 2NRRA 1HPMA 2E20A 1MWKA 4IOCL 2ZJQL 3VPZA 1GLDG 3NVKA 4JKHA 2QWQA 2OTJN 2P9LA 4EIAA 3IFRA 3DWLA 3BEXA 2J4RA 3QFPA 3CJBA 2D0PA 2QWNA 4FWLA 3K9JA 4O5FA 2A41A 2Q97A 1HKBA 2V7YA 4BRAA 3UKRA 2CH6A 3GOIA 4PKIA 4RTFD 4FWNA 5AQOA 3VEWA 5AZIA 5BN8A 1NGAA 2GTDA 2QEXN 5KQ8A 3SK3A 4DCHA 5JVGL 3ZX0A 1HUXA 3U9DA 3ATVA 1ESVA 2QWRA 4CZMA 5AZJA 5I9EB 3A5LC 1ILYA 3CJCA 1X3NA 4HWIA 3BF1A 3D7EO 2NLXA 2A6AA 1YI2N 5LJWA 3HM8A 4FSVA 3OBWA 4IOXA 3SLCA 4C1NK 3ENOA 2HSTA 3OA9A 1Z6RA 3CPEA 3AGRA 4GVEA 4K41A 3SMPA 2KHOA 3CPWM 5FPEA 3ZX2A 4QS8A 4NO7A 4CZHA 4EAHD 1GLBG 1RFQA 4M7YA 4K25A 3R8EA 4FWPA 3GDQA 5AQZA 4PL7A 3DJCA 4AF1A 3ID8A 2FF6A 3NVMA 4O8KA 3WXJA 1YJWN 3I56N 1GLAG 4JN4A 4MLHA 3KK7A 4BRPA 4CZIA 4H5VA 4H5WA 1NGCA 2NRTA 1U2VA 3H46O 5BRDA 3N4QA 3J7ZO 5C2DA 4FOEA 1VQ9N 1YHQN 3MN6A 5ELZA 2PAVA 5B8HA 3CF5L 3FLCO 1V4SA 4IJNA 3PIPL 1NGIA 2V51B 5ADXH 2Q36A 2OTLN 3AAPA 5GAEP 4YOVA 4O8UA 2FF3B 2RHKA 5JLHA 1KQSM 3BUZB 4AM7A 3ATUA 3DXKB 2JWLA 4H5RA 2NRHA 3N4PA 4WQ4A 3A0IX 3C6AA 3R6MA 3M3ZA 3VEYA 4JKAA 3HTVA 3F2KA 1S3XA 3O1WA 3Q7BA 2H3GX 4CZFA 3ID6A 4U7BA 3RVCA 5BREA 5AQMA 3O9UA 4YOUA 4BRMA 4BRDA 1K8KB 3AARA 2A42A 3O6WA 4B1YB 3E9PA 5HL7L 2WFBA 3KWIA 3UKRB 4RCHA 3VF4A 3ZETA 4A59A 3M1FA 4GNIA 1BO5O 2QTDA 3KZBA 3QDKA 1N8RO 1NM1A 2YJEA 4ILHA 2IVNA 5LJVA 1WUAA 4IXCA 2AP1A 1YVNA 4ISFA 3RSEA 4DKWA 2VGMA 4LC9B 4U67L 4M63C 1BA1A 2VWBA 3TU5A 4BRKA 4FPAA 3H1QA 2P9PA 4HTLA 1NJIO 2EWSA 3O9QA 3FZMA 2HBMA 4H5TA 5AQQA 5GADP 4CD3A 4BC5A 1JJ2M 2ITMA 4K43A 1TUYA 5AQGA 4BY9C 4KH5A 3LDLA 1Q81O 5JLFA 4CZJA 4E1JA 2F9WA 3LDPA 3EE8A 2I7PA 3OHRA 3F9MA 3UKUA 3VEOA 4IJAA 4Y0WA 5AQIA 3HBTA 4B1ZA 5DM6L 3ZEUA 4G9ZA 3VERA 2E8AA 1YAGA 1GLFO 5EXWA 2GELA 3L6QA 3VEVA 2KLAA 2E2PA 3UE5A 1U2VB 1VQLN 4GV6A 3O5BA 1W2BM 3E1YA 3ZETB 2VYPA 2BH1A 1T6DA 4BRHA 2ZJRL 2P9IA 3VTIA 1ZXOA 3VTHA 2P9NB 4CI6A 3CCMN 4KH6A 1KAXA 3SAHA 5BRHA 1JCGA 4Z94A 2E88A 3R1XA 3QBXA 1ZC6A 3A5OC 4NLBA 4WFBL 1T44A 5JICA 2P9KB 2W40A 4PKHA 3CC7N 2ASPA 3CJ1A 3KWGA 5AQSA 3BP8A 4IZ9A 1QVFM 2FSNA 1VQON 1K73O 2BTFA 4PKGA 5CR4A 4A57A 3M6GA 4B1UB 4CZEA 2DPNA 4IWVA 2YX6A 4EFHA 1BU6O 2ZJPL 1IG8A 5KPRA 4UY8O 5TKWA 3WEEB 5AQKA 1C0FA 2CGKA 2HMPA 1NMDA 2ASOA 3L4IA 1SS6A 1TYQB 2QWOA 4ISGA 4FWOA 4WQ5C 3C0BA 3F5TA 4YDUA 1SQKA 2KKZA 3FR0A 4B1VA 3QICA 2CGJA 2FSJA 3MCAB 3A5NC 3O9RA 5AZIB 5BPNA 4WF9L 3CC2N 3VGKA 2YCHA 4IFEA 2P9PB 4BRGA 3WXMB 1CZAN 4A5BA 4JD2B 3JS6A 2OANA 3VOVA 4BGBA 1HX1A 1M1KO 1NGBA 5C0YA 3O1BA 4KBOA 5F1XA 5JVHL 2YJFA 5M1NA 2YHWA 3IDHA 3P39A 1ATSA 1VQ6N 1YJ9N 1W97L 4CZKA 1JCFA 4FWRA 5TKYA 3ZEUB 5MLCQ 1GLCG 3G71N 5BR9A 2ZF5O 2A3ZA 3TTFA 5E26A 3EL2A 4EHUA 3VESA 4FWSA 3TSUA 5KQDA 1D4XA 2P9SB 2PBDA 2HBKA 2HBLA 3I33A 4IOAL 4RWTA 3QFUA 3WXIA 4CBXA 1T3VA 3WQUA 3AAQA 4L3QA 3VENA 4CJ7A 3EKSA 1XC3A 1VQMN 3BF3A 3GL1A 1LCUA 1OKJA 3EO3A 5AR0A 1X3MA 3ULEA 4B1WB 1Y64A 3O80A 4MDBA 4BQLA 5FPNA 3TTCA 2QWLA 4A61A 4H0TB 3CQXA 2E2NA 1BUPA 4A2BA 3HOSA 4GY2B 1J6ZA 5C12A 4JEPA 2P9UA 2GWKA 1XQSC 3E9OA 3B8AX 2V52B 4B1XB 1GLEG 3CCLN 3EE9A 1HJOA 2HF4A 3E9LA 1OVYA 3MMVA 4ISEA 4DB3A 3MX2A 3ULEB 2JWKA 3CHWA 2NRVA 2YI1A 3CQYA 3UB5A 1Q86O 3L0QA 1O13A 3D2EA 3WEEA 5CHIA 3CERA 3L4QA 3U9ZA 4XH1A 4BR5A 4BC3A 4YOTA 4H0YB 1QZ5A 3FZFA 1GLJO 4CD1A 1LOTB 1NGDA 1Z05A 2NNWA 4NLCA 2IIRA 2Q31A 1JCEA 4WYBA 4DHYA 3PIOL 3CXCM 2E2OA 5GAGP 3CMAN 2QWMA 2P9KA 2WBNA 4MDAA 4BRFA 2CGLA 4ILGB 3SAGA 2Q0RA 1YUWA 2BUPA 4FPBA 4WFAL 3D2EB 2D0OA 3DLLL 3HI0A 2NRWA 4FWMA 3VF6A 2FXUA 3RSEB 4FO0A 3A5MC 3U8XA 3C65A 3MWTA 3DAWA 3TTDA 4JKGB 4MO5A 1MA9B 4BROA 1KAYA 2HOEA 4OO1J 1KAZA 4JKBA 3SBGA 1K9MO 3CJ7A 5AQRA 5HOOA 5FPDA 3CCJN 1QQNA 3LDOA 3SBTA 3K9KA 5AZJB 5EOYA 5GIOA 1YF5L 3LL3A 4J8FA 2NRZA 4IDHA 1Q18A 1K8KA 3DXMA 3SMSA 3FZLA 3A8YA 4CZLA 5C2FA 5AQJA 4YOWA 3FFKB 1U6ZA 3T69A 3CCVN 2WUSA 1GLLO 5EVZA 3JXUA 3R9PA 1S22A 4H0OA 3VGMA 1C0GA 3QB0A 3LDNA 3O9SA 4JK8A 4H5NA 1HLUA 4BR7A 1BA0A 1NGJA 1ATNA 1XUPO 3DXMB 1S72N 5AFUH 3VGLA 1MWMA 4BVOA 2UYTA 2RE2A 3HRGA 3TSPA 3MDQA 4IO8A 4KH4A 3D2FA 3CJ9A 3H1VX 3T7ZA 4GV3A 1VQ4N 1G99A 1NWKA 2ASMA 2Q1NA 3AGKA 5JMVA 5AQTA 4JNEA 4M7XA 2WC9A 4BRNA 5M1FA 4IO9L 1X9JA 4BG8A 3ENBA 1QHAA 2QXLA 2CH5A 1VQNN 3H45C 4PL8A 5KPTA 2FLOA 3OBYA 2YHXA 4JHDA 4BGAA 1KD1O 2IVOA 3FZKA 3D2FB 1QZ6A 4R79A 1VQKN 3HOTA 3EN9A 3VEZA 2QWPA 3WXKA 3CIPA 4BRLA 2NZTA 3SAFA 4C23A 3O08A 5AQYA 5EY4A 1QQOA 3TPQA 4B9QA 5F2RA 4JKCA 4BRCA 2P9IB 1VAZA 3EKUA 5CE3A 3AY9A 1DKGD 4JHDB 3O8MA 1IJJA 3HSCA 3C7NB 4OPAA 4AM6A 3G4SN 3J8AA 4A5AA 3OW2M 3CD6N 5GIPA 1NGFA 1BWFO 5F0XA 1M90O 3ZX3A 4BC4A 4OPHA 3IUCA 3KVGA 4JAXA 2HBJA 2QW9A 3TSQA 4PHTX 4BQZA 4BC2A 4JK9A 1DEJA 1DGKN 3LM9A 4JKFA 2HF3A 1QQMA 3Q7CA 4BG9A 5BPMA 4XH5A 5BPLA 1P8ZA 1SAZA 3C7NA 2F7TA 4A62A 3PLAA 3CCRN 1WOQA 1QVGM 1H1VA 3R3LA 3D6RA 2GUPA 4CBWA 4H0PA 2QI2A 5AQVA 3MN5A 3VEXA 2E1ZA 3VMFB 3E66A 4A2AA 1TYQA 2D4WA 5AQHA 3MN9A 3P38A 4XH4A 3EZWA 2E1YA 1E4GT 5AFUA 3CMEN 4H03B 2V7ZA 2YHYA 3GG4A 3SJHA 5AQUA 1Q7YO 5EX5A 2A40A 4FWKA 4JD2A 2D1KA 5FPMA 3G6EN 3W3DA 3QMLA 1SZ2A 4MO4A 4FVUA 2NRXA 3M5RA 5AQFA 4GV9A 5C10A 1P90A 1V4TA 2Q0UA 3CJAA 3CI5A 4EHTA 4BRIA 1EO1A 3LDQA 1HKGA 3I55N 3CCQN 2I7NA 2AA4A 4WQ4C 1VQ8N 1MDUB 4H0XB 5M1KA 1RDWX 2QA4N 1NLVA 4BR2A 4NB4A 1K8AO 3MWPA 2P9SA 5AQNA 5M1OA 4WQ5A 2PFUA 4YDUC 4WFNL 3CCUN 1VQPN 3VF2A 3LM2A 4K42A 3H3NO 4JKDA 2A5XA 4BREA 3H3OB 1EQYA 3FZHA 1NGHA 1T6CA 5M1PA 3DXKA 1YITN 3ZYYX 1YXQA 3FE1A 3HZ6A 1YJNN 1NGGA 4JK7A 4JKEA 1E4FT 2GWJA 5LY3A 5E84A 1ZBSA 3P31A 2P9NA 3WQTA 5AQXA 3H6EA 5ADXA 3W0LA 4YOXA 2F9TA 4YORA 1ATRA 2P9UB 3CCSN 4H0VB 3KHYA 1VQ5N 3CCEN 1KC8O 4WCEL 4I6MB 5C15A 3WUHA 2IVPA 5M1QA 1VQ7N 1BG3A 4F9OA 2Q2RA 3G25A 2VCPA 2ZWHA 5BN9A 2P9LB 4ILJA 1Q82O 5AQLA 5GAHP 3IKMA 4BVPA 1RGIA 2VGNA 3IMXA 3NMUA 2ZGYA 3MK6A 4QS9A 3I8BA 4I6MA 2ZGZA 4DQ8A 3GE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T69 A;  3R1X A; 
#chains in the Genus database with same CATH topology
 2W41 A;  3MXI A;  3VET A;  4OVL A;  3CET A;  3S41 A;  3MXJ A;  4CIF A;  4CGG A;  1RDU A;  3O9T A;  2HHH K;  3U4L A;  4K8X A;  1O1W A;  3MN7 A;  2OZM A;  2HNY A;  4FJK A;  1TUU A;  2QM1 A;  3NE6 A;  3ZSQ A;  2O4I A;  4FJ8 A;  3TAQ A;  1D9F A;  2E2Q A;  4FOI A;  4CHO A;  3NH2 A;  1BIS A;  4XEI A;  4NCA A;  3TI0 A;  1HPM A;  2E20 A;  3OYM A;  2ZJQ L;  1GLD G;  2O8C A;  4CJL A;  4G1Q A;  2QWQ A;  4JKH A;  2J4R A;  3QIP A;  2X74 A;  4FWL A;  3K9J A;  4O5F A;  4QAG A;  1HKB A;  1REV A;  2WON A;  1JLQ A;  4PKI A;  4FWN A;  3L2R A;  2GTD A;  4KFB A;  4CIG A;  1XHX A;  4O0J A;  3U9D A;  3ATV A;  4CJ4 A;  2QWR A;  4CZM A;  5AZJ A;  3OYN A;  4ELT A;  1ILY A;  3CJC A;  3BF1 A;  2NLX A;  4DF8 A;  4CJQ A;  3P5J A;  3SQ1 A;  3HM8 A;  3OBW A;  1EX4 A;  3ENO A;  1TL3 A;  4CHP A;  4C1N K;  1T7P A;  3CPE A;  4KAZ A;  3AGR A;  3B6P A;  2KHO A;  3CPW M;  2BE2 A;  4NO7 A;  3K59 A;  2OPR A;  1RFQ A;  4K25 A;  2OCE A;  3THX B;  4CF9 A;  4FWP A;  4CK3 A;  4RW7 A;  1B9F A;  3ID8 A;  4DQS A;  3I56 N;  1GLA G;  4CZI A;  4DG1 A;  4H5W A;  1U2V A;  2Z1G A;  5C2D A;  4FOE A;  1VQ9 N;  3L2W A;  4DSI A;  4IJN A;  2PZS A;  2Q36 A;  4B9T A;  1L5U A;  4F4K A;  2OTL N;  5FDL A;  1CZ9 A;  5GAE P;  3BZK A;  3BUZ B;  1VSI A;  2JWL A;  1HNZ K;  2ITG A;  3R6M A;  1I3A A;  3HTV A;  1JL1 A;  3O1W A;  3K58 A;  2IS3 A;  3LP3 A;  4CZF A;  3RVC A;  5BRE A;  4O4G A;  3NF9 A;  3AAR A;  2UUB K;  5KRT A;  4DLG A;  2A42 A;  4J2E A;  3KWI A;  4RCH A;  5KGW A;  4DU3 A;  4YNQ A;  3SV4 A;  1NJX A;  3KLF A;  3QEW A;  5FRO A;  3SUN A;  2QTD A;  3KZB A;  3QDK A;  2VWJ A;  4ILH A;  4B3M K;  4IXC A;  4ISF A;  1D9D A;  4CFC A;  4U67 L;  1JXE A;  1NJZ A;  3VQ9 A;  1RTD A;  4OKK A;  4HTL A;  2HBM A;  2PYL A;  4H5T A;  5KI6 A;  1TAU A;  2RF2 A;  4Z4G A;  1JJ2 M;  4LFB K;  2ITM A;  4N5S A;  1L3V A;  4CZJ A;  4B9V A;  2O8E B;  2F9W A;  4FJM A;  5AQI A;  5DM6 L;  4CJU A;  3VA0 A;  2E8A A;  1GOB A;  1YAG A;  2IGI A;  2GEL A;  3VEV A;  2KLA A;  2E2P A;  1U2V B;  3O3G A;  4FJH A;  3ZET B;  3TWH A;  1T6D A;  4FZZ A;  3ZCM A;  1JLC A;  3VTI A;  1UWB A;  4EP4 A;  4CI6 A;  5HBM A;  3JSM A;  5BRH A;  1U45 A;  4BAC A;  4Z94 A;  3R1X A;  1NK8 A;  4M3Y A;  4NLB A;  2HND A;  1T44 A;  1FJG K;  3L3U A;  2O8F B;  3CC7 N;  2P9K B;  4PKH A;  3IS9 A;  1NU0 A;  2UUA K;  3KWG A;  4NYN A;  1RBV A;  1VQO N;  5CR4 A;  1L3U A;  4PWD A;  1G15 A;  1WSE A;  1L3T A;  2X78 A;  3WEE B;  2OPS A;  2HMP A;  4CF8 A;  2ASO A;  5CYQ A;  3HXM A;  1HYZ A;  1SS6 A;  2QWO A;  1HRH A;  4AQY K;  3VQ5 A;  3C0B A;  4HUF A;  4E7H A;  2CGJ A;  3MCA B;  4WF9 L;  3QIN A;  4DS4 A;  1TL1 A;  5K14 A;  3VGK A;  3CC2 N;  1Z26 A;  1A5X A;  1S1U A;  3JS6 A;  4B9N A;  3V9W A;  1HX1 A;  1M1K O;  4CEA A;  4KBO A;  5F1X A;  5JVH L;  1IKW A;  3IDH A;  1X9W A;  1W97 L;  2ZM6 K;  5MLC Q;  2ZF5 O;  2A3Z A;  4EHU A;  2OPQ A;  2X6N A;  2PBD A;  4RWT A;  5C42 A;  4CBX A;  1T3V A;  3VEN A;  4EZ6 A;  4CK2 A;  2E5L K;  2X6S A;  3ZT4 A;  4CJF A;  4LF6 K;  1OKJ A;  1X3M A;  3ULE A;  3O80 A;  1LV5 A;  4H0T B;  1EET A;  4CJP A;  1N6Q A;  3B8A X;  4B1X B;  3CCL N;  3EE9 A;  3BDP A;  3ZSO A;  1OVY A;  4ISE A;  3J7A P;  1WNS A;  2NRV A;  4X66 K;  1Q86 O;  4JI8 K;  3IG1 A;  3K0S A;  1SKS A;  2O8B B;  3D2E A;  3WEE A;  5CHI A;  3L4Q A;  3T3F A;  4XH1 A;  3HPG A;  2QXF A;  3KKS A;  1N5Y A;  4WYB A;  1NGD A;  4NLC A;  3PIO L;  5J2M A;  2P9K A;  4BRF A;  2WTU A;  4B3O A;  1ZBI A;  4FLU A;  1BQM A;  1QQC A;  4E19 A;  3OYD A;  3HI0 A;  4FLY A;  3RSE B;  4FO0 A;  4B9L A;  3A5M C;  3U8X A;  3C65 A;  3MWT A;  1MA9 B;  1W0H A;  5I42 A;  1UOC A;  2W42 A;  1K9M O;  5AQR A;  3OYK A;  4CES A;  4IDH A;  1Q18 A;  3DXM A;  4FLW A;  3SMS A;  3A8Y A;  4Z4E A;  4DFJ A;  3KK3 A;  5EVZ A;  3JXU A;  4AHT A;  3VGM A;  4DTS A;  4H5N A;  1XMQ K;  1HQE A;  1ATN A;  1X1P A;  3EZ5 A;  3LAK A;  5D3G A;  3MDQ A;  1CLQ A;  4CF0 A;  3CJ9 A;  1VQ4 N;  4DV5 K;  4OX9 K;  3HM9 A;  4KTQ A;  3CG7 A;  4JNE A;  4EP5 A;  4IO9 L;  1KSP A;  5KPT A;  2YHX A;  4BGA A;  3OYI A;  3QNN A;  3RRG A;  4DSL A;  4JV5 K;  3EN9 A;  3VEZ A;  2QWP A;  1QSS A;  3CIP A;  1YT3 A;  1BI4 B;  4M3W A;  4B9Q A;  1BCM A;  3CD6 N;  3CM6 A;  5GIP A;  4CFD A;  3D0P A;  3RRH A;  1M90 O;  4CHY A;  2XHB A;  4LH5 A;  3IUC A;  5FRM A;  1J53 A;  1BCO A;  3QLH A;  3U3G A;  3LAL A;  4FLX A;  4JI5 K;  3K2P A;  5BPL A;  5BPM A;  2ZD1 A;  3C7N A;  4JLH A;  3AVJ A;  1HJR A;  1S1X A;  4JI4 K;  3QO9 A;  3VMF B;  4A2A A;  4CK1 A;  3OJU A;  4DTJ A;  4XH4 A;  2E1Y A;  1E4G T;  3M8Q A;  4FJG A;  1F21 A;  2V7Z A;  3GG4 A;  3HPH A;  4DTR A;  4FWK A;  4JD2 A;  5FPM A;  1N34 K;  3PO4 A;  2O4G A;  3M5R A;  3C95 A;  2XRI A;  4GV9 A;  1V4T A;  4Z4H A;  4DV2 K;  2I7N A;  2AA4 A;  4WQ4 C;  2ZE2 A;  4KHS A;  5SZT A;  1NK7 A;  1MDU B;  5M1K A;  2YNI A;  2XY6 A;  1NLV A;  1DTQ A;  1KCF A;  2IAJ A;  3VF2 A;  1JXB A;  3H3N O;  4JKD A;  4H4O A;  2P51 A;  1NK4 A;  3HZ6 A;  1YJN N;  1RT7 A;  2Q3S A;  5E84 A;  2EHG A;  3LZI A;  4E1M A;  1KTQ A;  4FLZ A;  3JYT A;  1ZBS A;  4DV7 K;  5AQX A;  4YOR A;  1ATR A;  3CCS N;  4F3O A;  3TAE A;  2IVP A;  1Y97 A;  3ZSY A;  1BG3 A;  2VCP A;  4B9U A;  4HHT A;  2P1J A;  3THV A;  2HMI A;  1RT5 A;  5GAH P;  4BVP A;  1VSF A;  3MK6 A;  3I8B A;  3QEI A;  2ZGZ A;  4BR4 A;  4BR9 A;  3GBT A;  1CZB A;  3EEQ A;  5AQP A;  3AVM A;  3MCP A;  3SUQ A;  2GX9 A;  3DRS A;  5KPZ A;  2IC3 A;  3NDK A;  3ENH A;  3OYJ A;  5KTQ A;  3CC4 N;  3UKU B;  1R59 O;  3WXL A;  5GIN A;  2GEM A;  4DWI A;  4QS7 A;  3P1G A;  5FLX O;  3SUO A;  5J2Q A;  5BRF A;  5DM7 L;  4IEI A;  4E7K A;  1RDD A;  4CJS A;  3OYC A;  4ZTJ A;  2FBT A;  4RW4 A;  2OTJ N;  2P9L A;  3M8P A;  3DWL A;  2G8K A;  1ZYQ A;  2Q97 A;  4OKJ A;  4BRA A;  4OPJ A;  1IBL K;  3GOI A;  4DTU A;  5KQ8 A;  3ZX0 A;  3S3M A;  5I9E B;  3A5L C;  2E6L A;  1X3N A;  4HWI A;  4OGE A;  3VQQ A;  4IOX A;  4LF8 K;  4CEF A;  1Z6R A;  4KRF A;  4GVE A;  3ZX2 A;  1HMV A;  4I7F A;  4M7Y A;  3NHG A;  5DK5 A;  2FF6 A;  3WXJ A;  2O8B A;  3DI6 A;  1WAJ A;  4JN4 A;  4MLH A;  4N56 A;  3EY1 A;  2PY5 A;  3H46 O;  3QIO A;  3J7Z O;  1S5J A;  4JI6 K;  3DLE A;  4FJ5 A;  4FLV A;  4NXM K;  5B8H A;  1ZBH A;  3FLC O;  2XY5 A;  3KLH A;  2V51 B;  4GMJ B;  2O8D B;  3DXK B;  4C8L A;  4HUG A;  4WQ4 A;  2VG6 A;  3L3V A;  4O55 A;  3LWL A;  4LH4 A;  1YTU A;  1A5W A;  3AO3 A;  3AVK A;  5J2N A;  3O9U A;  4B1Y B;  3O6W A;  5HL7 L;  4A59 A;  3TAM A;  5KGX A;  3M1F A;  3VA3 A;  4GVM A;  3DM2 A;  1N8R O;  5LJV A;  2IVN A;  4FJN A;  4GKJ K;  4CGF A;  3I8D A;  2VGM A;  4RW6 A;  4FZY A;  1BA1 A;  4BRK A;  3H1Q A;  3HYF A;  4DR2 K;  2Z1H A;  3PSF A;  1J54 A;  3RWU A;  4BWM A;  5AQQ A;  5GAD P;  4CD3 A;  2YNH A;  4Z0U A;  1TUY A;  5HRR A;  4KH5 A;  5JLF A;  3ZSW A;  4IJA A;  4Y0W A;  3B6O A;  3HBT A;  3L2V A;  3ZEU A;  3TR8 A;  1GLF O;  5CYM A;  3UE5 A;  4GV6 A;  3O5B A;  1JLG A;  1W2B M;  1IV0 A;  4C8K A;  4BRH A;  2ZJR L;  1T03 A;  3CCM N;  4KH6 A;  1JCG A;  1BGX T;  1ZC6 A;  3A5O C;  2VWK A;  4CF1 A;  2W40 A;  2F96 A;  3I0S A;  4KB1 A;  3BP8 A;  4IZ9 A;  3LDS A;  3RMD A;  2FSN A;  4CZE A;  1VSM A;  3MXM A;  2ZJP L;  5TKW A;  3L2U A;  1C0F A;  1NMD A;  1TKZ A;  3L4I A;  3PX4 A;  1S1V A;  4ISG A;  1W9H A;  4FWO A;  3F5T A;  4WQ5 C;  3G10 A;  5EU7 A;  3RMC A;  4LFC K;  3A5N C;  3SNN A;  1UAX A;  3CQ8 A;  3WXM B;  4A5B A;  4JD2 B;  5HLF A;  2OAN A;  3VOV A;  4BGB A;  1SL0 A;  3RMB A;  1ITG A;  1NGB A;  1VSD A;  3HK2 A;  5C0Y A;  2HNZ A;  4F2S A;  4I2P A;  4KHY A;  3P39 A;  1ATS A;  1VQ6 N;  2YV0 X;  1TGO A;  2UXD K;  4DR3 K;  3UIQ A;  4FWR A;  3ZEU B;  1GLC G;  3AO5 A;  4DQI A;  1IKV A;  4ID5 A;  4WE1 A;  5E26 A;  4DQP A;  5HRS A;  3EL2 A;  4I2Q A;  1SUQ A;  3VES A;  3TSU A;  4FJ7 A;  5KQD A;  2HBL A;  4CIE A;  4IOA L;  3WXI A;  1U4B A;  1XNQ K;  3AAQ A;  4L3Q A;  4FM0 A;  4B9S A;  3O3H A;  1NK9 A;  4B1W B;  1IBK K;  4MDB A;  3TTC A;  3ALY A;  4A61 A;  4CEE A;  1QS4 A;  1J6Z A;  2GWK A;  3E9O A;  3KLI A;  2V52 B;  2QKB A;  4DTX A;  3VQC A;  2HF4 A;  3E9L A;  1IH7 A;  1A5V A;  3MMV A;  1JL2 A;  5BR8 K;  2JWK A;  4CE9 A;  3CQY A;  3UB5 A;  3AV9 A;  1O13 A;  1TKX A;  4HUE A;  3DRP A;  4FM2 A;  4YOT A;  1QZ5 A;  3HP6 A;  4CEB A;  3T1H K;  3OS1 A;  1ASV A;  2NNW A;  2E6M A;  2IIR A;  1JCE A;  3CXC M;  3PV8 A;  1CXU A;  2E2O A;  2QWM A;  2WBN A;  4R5P A;  4MDA A;  3SAG A;  3C6T A;  4K8Z A;  2D0O A;  3DLL L;  4M3R A;  2FXU A;  3KTQ A;  1C1A A;  3F9K A;  1N32 K;  4E1N A;  2EX3 A;  1S6P A;  3DAW A;  3TTD A;  3LP2 A;  4KTZ A;  4BRO A;  3ULD A;  4FCY A;  1QQN A;  3OS0 A;  3SBT A;  5AZJ B;  2NRZ A;  3HP9 A;  4CGH A;  2HHS A;  3AVH A;  1HYV A;  2O8E A;  1VRT A;  3FZL A;  4HVJ A;  1NK0 A;  1N36 K;  4CZL A;  2AJQ A;  5AQJ A;  3FFK B;  1U6Z A;  3CCV N;  3OY9 A;  3KJV A;  3O3F A;  3HST B;  1VSH A;  3WNG A;  4B9M A;  1XHZ A;  2D5R A;  4DLE A;  1BA0 A;  3CM5 A;  4O44 A;  5AFU H;  4ZTF A;  2UYT A;  2RE2 A;  2UUC K;  4IO8 A;  1HYS A;  4H4M A;  3H1V X;  4GV3 A;  4CJ3 A;  1TK5 A;  1NWK A;  5JMV A;  2HHX A;  1BIZ A;  3K5O A;  1WSJ A;  1S6Q A;  3ENB A;  3LZJ A;  2QXL A;  2CH5 A;  1VQN N;  4PL8 A;  4IKF A;  1KD1 O;  3QER A;  2B4J A;  1VSJ A;  2OZS A;  3HOT A;  1RT2 A;  3SAF A;  4DQQ A;  3KD5 E;  5AQY A;  5EY4 A;  1QQO A;  2VG5 A;  5F2R A;  4JKC A;  5FRN A;  3EKU A;  3O8M A;  3HSC A;  3C7N B;  4AM6 A;  3OW2 M;  1NGF A;  3ZX3 A;  3DOL A;  4BC4 A;  1C0T A;  4DV0 K;  2DTU A;  1BL3 A;  4JK9 A;  3E01 A;  3VQ6 A;  3EYZ A;  3LM9 A;  3IAY A;  1QQM A;  4BG9 A;  1SAZ A;  2F7T A;  1JLB A;  3R3L A;  3T1A A;  4Z4F A;  1SKR A;  3DOK A;  4J2B A;  4KHP K;  4IG3 A;  1TYQ A;  2D4W A;  1HNX K;  5AFU A;  1DLO A;  2YHY A;  3S3N A;  4JI3 K;  4V19 S;  4E3S A;  2A40 A;  4KHW A;  1C1C A;  1OVQ A;  1L3S A;  4NCG A;  3S3O A;  2NRX A;  3ZT3 A;  4B3R K;  5C10 A;  1P90 A;  1EO1 A;  3OYF A;  1HKG A;  3CCQ N;  3J81 O;  1WB9 A;  4H0X B;  3SPY A;  3K5L A;  4CGJ A;  3ITH A;  1GOC A;  4YDU C;  1QTM A;  3DLB A;  1KLN A;  3H3O B;  5M1P A;  1YXQ A;  2A1S A;  1NGG A;  3HVT A;  3NF6 A;  4RW8 A;  1WAF A;  3DLK A;  5LY3 A;  3RMA A;  1VSL A;  3WQT A;  3RTV A;  4B3T K;  3W0L A;  4YOX A;  1OH7 A;  2F9T A;  1NKB A;  4N76 A;  3BGR A;  4H0V B;  3DLR A;  4IFY A;  3WNE A;  4WCE L;  5C15 A;  2PYJ A;  1IKX A;  5M1Q A;  2Y1I A;  4CCH A;  3OYH A;  4F9O A;  3TAB A;  2ZWH A;  4N41 A;  4FK0 A;  2HB5 A;  4FJI A;  4DR6 K;  5AQL A;  2OPP A;  1IKY A;  2VGN A;  3IMX A;  2IOC A;  3NMU A;  4QS9 A;  1BQN A;  4F2R A;  4I6M A;  4DQ8 A;  1UA1 A;  4BRQ A;  4C1N I;  4J2D A;  4E7J A;  4BR0 A;  3NH0 A;  3MX5 A;  4DFP A;  1YIJ N;  4KI6 A;  3OVN A;  1DT9 A;  2KFN A;  3T19 A;  3QBW A;  5H1S Q;  5AQW A;  4JKG A;  1HNI A;  2HHU A;  1NBW A;  2RPI A;  3P4I A;  4KTW A;  3WT0 A;  4CEC A;  4B8C A;  4DSF A;  1BDG A;  4IEE A;  3VQE A;  4DSK A;  1BOT O;  4CGD A;  1WLJ A;  2NRR A;  4DV3 K;  4FJX A;  1MWK A;  3IFR A;  5HRN A;  1TK8 A;  4F3T A;  3V9X A;  1ZBF A;  3BZC A;  3CJB A;  5JS2 A;  2A41 A;  1LWF A;  2FBX A;  2V7Y A;  1EKE A;  1LAW A;  3UKR A;  3WNH A;  5AQO A;  2G8U A;  5AZI A;  5BN8 A;  1NGA A;  2QEX N;  1D5A A;  3SK3 A;  5JVG L;  1HUX A;  1E3M A;  5LL6 Z;  1ESV A;  3AVN A;  5HRP A;  2DFH A;  4DV1 K;  5LJW A;  3NGI A;  2P5O A;  2HST A;  5J1E A;  2XO7 A;  4K41 A;  3SMP A;  5FPE A;  4CER A;  4CZH A;  1WSH A;  4M3Z A;  3V9Z A;  2RN2 A;  3GDQ A;  5AQZ A;  4PL7 A;  4LFA K;  2F8S A;  3OS2 A;  1NGC A;  4DR5 K;  3ZLJ A;  3PIP L;  1NGI A;  3MEC A;  2YHB A;  4MQ3 A;  3AAP A;  5E41 A;  4YOV A;  4O8U A;  5JLH A;  1KQS M;  3MAQ A;  4AM7 A;  3ATU A;  2KTQ A;  3N4P A;  3A0I X;  4CF2 A;  4CEQ A;  3VEY A;  4JKA A;  3F2K A;  2F4V K;  1S3X A;  5HP1 A;  4U7B A;  5T7B A;  5AQM A;  2DFE A;  3E9P A;  2WFB A;  3UKR B;  3ZET A;  3AVL A;  3NH1 A;  1KRP A;  2HHT A;  4EZ9 A;  4FK2 A;  2VQE K;  2YJE A;  1WUA A;  4OJR A;  2AP1 A;  4UQG A;  4OPK A;  2YKN A;  3V1Q A;  3QET A;  3SCX A;  4GKK K;  4M63 C;  4Z4C A;  4CHZ A;  4Z4I A;  2P9P A;  3V6D A;  2QKK A;  1WSF A;  1XC9 A;  2EWS A;  4CJ5 A;  3LAM A;  4BY9 C;  3LDL A;  4E1J A;  3LDP A;  2I7P A;  2UXC K;  2I5J A;  3VER A;  4Y1C A;  3L6Q A;  4DV6 K;  4ZHR A;  3ZT2 A;  3BY5 A;  2VYP A;  4H8K A;  2BH1 A;  1Q9X A;  1HNV A;  1HPZ A;  2G8H A;  1J9A A;  3AA4 A;  3VTH A;  3VQD A;  1QHT A;  1VSK A;  1FW6 A;  4KO0 A;  1KAX A;  3LAN A;  1X9S A;  2E88 A;  1S1W A;  3PSI A;  3HVR A;  4WFB L;  3NAE A;  4CFB A;  4ID1 A;  5JIC A;  2ASP A;  4RW9 A;  5AQS A;  4Y1D A;  3OYG A;  5AJ3 K;  1EWQ A;  1K73 O;  2BTF A;  2E4L A;  4PKG A;  3QNO A;  3M6G A;  4MFB A;  2Z1I A;  2G8V A;  4FJJ A;  2YX6 A;  1BU6 O;  4ELU A;  1RT3 A;  5AQK A;  4W5Q A;  2CGK A;  1NNE A;  1TYQ B;  1SQK A;  4KI4 A;  3M8R A;  2FSJ A;  4C8O A;  1U04 A;  3LP0 A;  4IFE A;  4BDP A;  2P9P B;  1C0U A;  1S9E A;  2D0B A;  1GOA A;  1RT1 A;  3O1B A;  4NXN K;  1WSI A;  2OYQ A;  2YJF A;  5M1N A;  1UA0 A;  1YJ9 N;  3CFR A;  4DU1 A;  1RIL A;  1S1T A;  3T1Y K;  2HBK A;  1Q9Y A;  4ICL A;  1TKD A;  3WQU A;  4PUO A;  4CJ7 A;  3EKS A;  1XC3 A;  3ZSZ A;  1VQM N;  2FBV A;  3BF3 A;  3GL1 A;  1XNR K;  1JKH A;  2A1R A;  4M3T A;  2O8C B;  1Y64 A;  4BQL A;  3H08 A;  5FPN A;  4KHN A;  3THY A;  5CY4 A;  3CQX A;  4DR7 K;  4BE2 A;  3HOS A;  4GY2 B;  4YY3 K;  1XQS C;  2GUI A;  2O8D A;  4KB0 A;  4FJL A;  4DSE A;  4PA1 A;  4DB3 A;  3KLG A;  1RTH A;  4KV8 A;  2DFF A;  3L0Q A;  3U9Z A;  4OKE A;  4DTO A;  1KVC A;  4BC3 A;  4H0Y B;  3CYM A;  2ATQ A;  4DMN A;  2GV9 A;  1Z05 A;  2Q31 A;  4M42 A;  3CMA N;  4CEZ A;  2CGL A;  4ILG B;  1YUW A;  2BUP A;  4FPB A;  4WFA L;  5C24 A;  2NRW A;  3VF6 A;  3PX0 A;  4JKG B;  4MO5 A;  3CFP A;  1KAY A;  2HOE A;  3SBG A;  5HOO A;  5FPD A;  4IDK A;  4JRQ A;  1I39 A;  3LDO A;  1S9G A;  4BE0 A;  1C0M A;  1YF5 L;  3LL3 A;  3ZSV A;  3SPZ A;  1K8K A;  3VQP A;  1C6V A;  4YOW A;  3T69 A;  1BI4 A;  1GLL O;  2O8F A;  4GW6 A;  3R9P A;  1S22 A;  1C1B A;  4H0O A;  3HL8 A;  1C0G A;  3O9S A;  4JK8 A;  4BDZ A;  3SQ2 A;  1HLU A;  4BR7 A;  3THW B;  3TAR A;  1NGJ A;  1J5O A;  4JI2 K;  1S72 N;  3VGL A;  1MWM A;  4BVO A;  3HRG A;  2XY8 A;  4FLT A;  3PY8 A;  2Y1J A;  4KH4 A;  4CJE A;  3T7Z A;  1G99 A;  2ASM A;  2Q1N A;  3AGK A;  2BDP A;  3AVC A;  1D8Y A;  2RKI A;  4M7X A;  2WC9 A;  4BRN A;  2YNF A;  1X9J A;  4BG8 A;  3H45 C;  1RBU A;  4LF4 K;  2IVO A;  3FZK A;  3D2F B;  4FW2 A;  4CJV A;  2KQ2 A;  3LPT A;  4R79 A;  1VQK N;  4BRL A;  3NFA A;  4C23 A;  4FK4 A;  3TPQ A;  4CFA A;  4BRC A;  2P9I B;  4CJK A;  5CE3 A;  3AY9 A;  1DKG D;  4DFK A;  4JHD B;  1IJJ A;  4OPA A;  3J8A A;  3VQ7 A;  4A5A A;  4KHU A;  3AO2 A;  4M3U A;  2B6A A;  3LPU A;  4OPH A;  1XWL A;  3KVG A;  3AVA A;  3TSQ A;  2HW3 A;  3SQ4 A;  4BC2 A;  4CHQ A;  1DEJ A;  1DGK N;  4JKF A;  4CED A;  3Q7C A;  4LF7 K;  4XH5 A;  1P8Z A;  4DTM A;  3JAM O;  3CCR N;  3SV3 A;  4E89 A;  1R0A A;  1H1V A;  4M45 A;  1RDB A;  4HCB A;  2HVI A;  3D6R A;  4NYF A;  5AQV A;  2QI2 A;  3E66 A;  5AQH A;  3QEX A;  3MN9 A;  1KFS A;  2BGG A;  3CME N;  4H03 B;  1RTI A;  3K57 A;  3AVF A;  1HNW K;  2LSN A;  3G6E N;  3W3D A;  4DSJ A;  2G8I A;  2YKM A;  1SZ2 A;  3QML A;  4DF4 A;  3KD1 E;  4FVU A;  2ZQB A;  3V9U A;  5AQF A;  1LAV A;  3CJA A;  4W5T A;  4IBN A;  3CI5 A;  4BRI A;  3J7Y P;  1VQ8 N;  1B92 A;  3TAF A;  1W7A A;  3OYB A;  2KZZ A;  1K8A O;  3MWP A;  2P9S A;  5AQN A;  4AHU A;  2PFU A;  5LMU K;  3CCU N;  3LM2 A;  5CZ1 A;  1EQY A;  1NGH A;  3DXK A;  1YIT N;  3FE1 A;  1J5E K;  3KLE A;  4JK7 A;  4JKE A;  1E4F T;  2VQF K;  3P31 A;  3OTO K;  4F8R A;  3ZSX A;  2P9U B;  3KHY A;  2D0A A;  4I6M B;  3DMJ A;  1VQ7 N;  2Q2R A;  4DR1 K;  2G8W A;  3MEE A;  4KRE A;  2WOM A;  3ASM A;  2P9L B;  4K0K K;  4ILJ A;  3SZ2 A;  1Q82 O;  1TK0 A;  4M41 A;  4AH9 A;  1RGI A;  4LSL A;  2ZGY A;  3TAN A;  3GE1 A;  1Z25 A;  3O4W A;  1B9D A;  5SWM A;  4CZG A;  1X9M A;  1XI1 A;  1HKC A;  1N33 K;  4BDY A;  1IBM K;  4JS4 A;  4FWQ A;  3C6H A;  3FGU A;  1DTT A;  4HCC A;  3ZT1 A;  1NGE A;  3V81 A;  2FSK A;  3V1R A;  1KXP A;  4MLE A;  4CBU A;  3IRX A;  1OH5 A;  2KZM A;  2GBZ A;  1I94 K;  4LF5 K;  4FL9 A;  4E7L A;  4YOY A;  1SV5 A;  4IOC L;  4X62 K;  3VPZ A;  3TAP A;  3NVK A;  3I0R A;  3V4I A;  4EIA A;  3KK1 A;  3BEX A;  4B08 A;  3QFP A;  2BAN A;  2D0P A;  1NKC A;  3L2Q A;  2QWN A;  1IG9 A;  3VN5 A;  1NKE A;  1QSY A;  2CH6 A;  4RTF D;  3MED A;  3VEW A;  4J2A A;  4DCH A;  4DQR A;  1K6Y A;  3D7E O;  4ELV A;  4Q0B A;  2A6A A;  1YI2 N;  4FSV A;  5IT9 O;  3O4Q A;  3SLC A;  4AHR A;  2NUB A;  5C25 A;  3OA9 A;  4Q5V A;  3PO5 A;  2JLE A;  1TV6 A;  3QEV A;  4QS8 A;  1Q8I A;  4EAH D;  1GLB G;  3R8E A;  5IWA K;  1NJY A;  1VK0 A;  3CFO A;  3DJC A;  4AF1 A;  3NVM A;  1YJW N;  4O8K A;  3M8S A;  3KK7 A;  4BRP A;  4H5V A;  2NRT A;  5BRD A;  3N4Q A;  1YHQ N;  3MN6 A;  4DR4 K;  3ZSR A;  5ELZ A;  2PAV A;  3CF5 L;  2P5G A;  1V4S A;  3AVB A;  1RNH A;  5ADX H;  1ASW A;  4DU4 A;  2YHA A;  1NMN A;  4CJT A;  2FF3 B;  2RHK A;  4H5R A;  4KPY A;  2W6K A;  2NRH A;  3V1O A;  1WN7 A;  3C6A A;  3M3Z A;  4HTU A;  1LWE A;  3Q7B A;  2H3G X;  3ID6 A;  3U3Y A;  4I9L A;  1TVR A;  1ASU A;  1RCH A;  4OLA A;  4YOU A;  4BRM A;  4BRD A;  1K8K B;  4OLB A;  3VF4 A;  1SKW A;  1JLE A;  1RDA A;  4GNI A;  1BO5 O;  1NM1 A;  2UU9 K;  1NOY A;  4NCB A;  3THW A;  1YVN A;  3RSE A;  4DKW A;  5J2P A;  4LC9 B;  2VWB A;  3TU5 A;  4FPA A;  5LMN K;  3D45 A;  1NJI O;  4AHC A;  3O9Q A;  3DLH A;  3FZM A;  1JLA A;  4BC5 A;  4K43 A;  5AQG A;  3SUP A;  1Q81 O;  3C94 A;  3AVG A;  3EE8 A;  3OHR A;  3F9M A;  4FVM A;  3UKU A;  1KVA A;  1RT6 A;  3VEO A;  4G9Z A;  4B1Z A;  3AVI A;  4DTP A;  5EXW A;  2KFZ A;  4FJ9 A;  2XY7 A;  1VQL N;  4M3X A;  1EWR A;  2D0C A;  3E1Y A;  3KKR A;  4OGC A;  2P9I A;  3KIO A;  1ZXO A;  3OYL A;  2P9N B;  1XMO K;  3DRR A;  3AA2 A;  3LP1 A;  3SAH A;  4QCL A;  1CXQ A;  4LD0 A;  3OYE A;  3QBX A;  3PX6 A;  1T8E A;  1U48 A;  3CJ1 A;  1NG9 A;  1QVF M;  4E0D A;  1KFD A;  4JI0 K;  4A57 A;  4B1U B;  1FK9 A;  2DPN A;  2R7Y A;  3K5N A;  4IWV A;  4EFH A;  4CW7 B;  1IG8 A;  5KPR A;  4UY8 O;  5HRO A;  4YDU A;  4B1V A;  3OYA A;  2KKZ A;  3FR0 A;  3QIC A;  1VHX A;  4E7I A;  3O9R A;  5CZ2 A;  5AZI B;  5BPN A;  2YCH A;  1BIU A;  4TSX A;  4YHH K;  3A2F A;  4BRG A;  3NBP A;  2HHW A;  1CZA N;  3WNF A;  3HT3 A;  4B3S K;  1FKO A;  1U49 A;  3V9S A;  1ZBL A;  2YHW A;  4CZK A;  4YFU A;  3C6U A;  1JCF A;  5TKY A;  5KRS A;  3G71 N;  5BR9 A;  3TTF A;  1OH8 A;  1RT4 A;  4FWS A;  1D4X A;  2P9S B;  4DUZ K;  3I33 A;  3QFU A;  1VSE A;  3QES A;  4CEO A;  4B8A B;  1LCU A;  3EO3 A;  5AR0 A;  3U6F A;  2W6L A;  1NK6 A;  2ETJ A;  2QWL A;  5I3U A;  1VRU A;  4JI7 K;  2E2N A;  1BUP A;  4A2B A;  5C12 A;  4JEP A;  2P9U A;  4AHS A;  4AHV A;  1GLE G;  1HJO A;  4DV4 K;  4FYD A;  3OJS A;  3LWM A;  4O5B A;  2KW4 A;  3MX2 A;  1FXX A;  3ULE B;  3CHW A;  4DFM A;  2YI1 A;  3J80 O;  4X65 K;  4L8R B;  3CER A;  3SJJ A;  4BR5 A;  4QOZ B;  2HHV A;  3ISN C;  2F8T A;  2FC0 A;  3FZF A;  3AA5 X;  1GLJ O;  4CD1 A;  3HPO A;  1LOT B;  4DHY A;  5GAG P;  1RBR A;  4FM1 A;  5A2Q O;  2G8F A;  2IDO A;  2Q0R A;  3D2E B;  4AIL C;  4FWM A;  3NF7 A;  2B5J A;  3SI6 A;  1TKT A;  1KVB A;  4I9Q A;  1U47 A;  4C8M A;  4IFV A;  4OO1 J;  1NK5 A;  1KAZ A;  4JKB A;  1HR0 K;  3CJ7 A;  3HJF A;  3CCJ N;  3K9K A;  1JLF A;  5EOY A;  5GIO A;  4J8F A;  1FKP A;  3O4N A;  4JYA K;  3HO1 A;  5C2F A;  1BHL A;  2UXB K;  4CJR A;  2WUS A;  4W5R A;  1WBD A;  3QB0 A;  3LDN A;  1XUP O;  3DXM B;  1RDC A;  1OH6 A;  1LW0 A;  3TSP A;  1ZBU A;  1LW2 A;  3D2F A;  1YVU A;  5AQT A;  4O0I A;  4W5O A;  5M1F A;  1QHA A;  2Z1J A;  1RBT A;  4DTN A;  2FLO A;  3OBY A;  3PUF A;  4JHD A;  3K5M A;  4KHQ A;  1QZ6 A;  3KK2 A;  3WXK A;  4N47 A;  2NZT A;  1RBS A;  4IG0 A;  3O08 A;  4RG8 A;  2HHQ A;  3ZT0 A;  4DUY K;  1KLM A;  4LF9 K;  1VAZ A;  5DMR A;  2DY4 A;  4CJW A;  4LSN A;  4X64 K;  3G4S N;  1HQU A;  2OA8 A;  3MEG A;  1BWF O;  5F0X A;  2QK9 A;  4CHN A;  3P83 D;  4JAX A;  2HBJ A;  2QW9 A;  4PHT X;  3VQ8 A;  4BQZ A;  4W5N A;  2HF3 A;  3NGY A;  1IO2 A;  3DLG A;  4JS5 A;  4A62 A;  3PLA A;  1WOQ A;  3L8B A;  1QVG M;  2GUP A;  4CBW A;  4FZX C;  4BWJ A;  4H0P A;  3VEX A;  1MU2 A;  3MN5 A;  2E1Z A;  3SQ0 A;  3VQA A;  1WBB A;  3P38 A;  4PQU A;  4KKO A;  3EZW A;  2FBY A;  3NF8 A;  4BE1 A;  1YTA A;  1QSL A;  3RR8 A;  1NJW A;  3G0Z A;  4CVN E;  3SJH A;  5AQU A;  1Q7Y O;  1SL2 A;  5EX5 A;  2D1K A;  1T05 A;  3AO1 A;  3QEP A;  3NCI A;  4MO4 A;  3NGZ A;  4JRP A;  1EP4 A;  2Q0U A;  3THY B;  4EHT A;  3SYZ A;  1EXQ A;  3TAG A;  3LDQ A;  2JGU A;  3I55 N;  3S9H A;  1TAQ A;  4FW1 A;  3DYA A;  4XIU A;  3F73 A;  1WSG A;  1RDW X;  3FFI A;  4LY7 A;  2QA4 N;  4CGI A;  4BR2 A;  4NB4 A;  5M1O A;  4WQ5 A;  4WFN L;  1VQP N;  3AA3 A;  4K42 A;  1SL1 A;  2A5X A;  4BRE A;  3FZH A;  1T6C A;  3VQB A;  3ZYY X;  2HVH A;  2GWJ A;  2YNG A;  4JI1 K;  2P9N A;  3H6E A;  5ADX A;  2VG7 A;  1QE1 A;  3RR7 A;  1VQ5 N;  3CCE N;  1KC8 O;  3WUH A;  5JS1 A;  3G25 A;  4PY5 A;  4FXD A;  5BN9 A;  1RTJ A;  4C8N A;  1LWC A;  1NOZ A;  3VQ4 A;  3IKM A;  3AO4 A;  3THX A;  4DS5 A; 
#chains in the Genus database with same CATH homology
 2W41 A;  4BR4 A;  4BRQ A;  4BR9 A;  3O4W A;  3VET A;  3GBT A;  4C1N I;  4BR0 A;  4CZG A;  5AQP A;  1HKC A;  3CET A;  3S41 A;  3MCP A;  2GX9 A;  3MX5 A;  4FWQ A;  3C6H A;  3FGU A;  1YIJ N;  1DT9 A;  1RDU A;  5KPZ A;  3O9T A;  1NGE A;  3U4L A;  3MN7 A;  2FSK A;  1TUU A;  3ENH A;  1KXP A;  3QBW A;  2QM1 A;  3UKU B;  1R59 O;  5AQW A;  5H1S Q;  3CC4 N;  4JKG A;  4MLE A;  4CBU A;  3WXL A;  1NBW A;  3P4I A;  5GIN A;  2GEM A;  3WT0 A;  4QS7 A;  2E2Q A;  4FOI A;  1BDG A;  4IEE A;  4FL9 A;  4XEI A;  5BRF A;  5DM7 L;  1BOT O;  4YOY A;  4IEI A;  2NRR A;  1HPM A;  2E20 A;  1MWK A;  4IOC L;  2ZJQ L;  3VPZ A;  1GLD G;  3NVK A;  4JKH A;  2QWQ A;  2OTJ N;  2P9L A;  4EIA A;  3IFR A;  3DWL A;  3BEX A;  2J4R A;  3QFP A;  3CJB A;  2D0P A;  2QWN A;  4FWL A;  3K9J A;  4O5F A;  2A41 A;  2Q97 A;  1HKB A;  2V7Y A;  4BRA A;  3UKR A;  2CH6 A;  3GOI A;  4PKI A;  4RTF D;  4FWN A;  5AQO A;  3VEW A;  5AZI A;  5BN8 A;  1NGA A;  2GTD A;  2QEX N;  5KQ8 A;  3SK3 A;  4DCH A;  5JVG L;  3ZX0 A;  1HUX A;  3U9D A;  3ATV A;  1ESV A;  2QWR A;  4CZM A;  5AZJ A;  5I9E B;  3A5L C;  1ILY A;  3CJC A;  1X3N A;  4HWI A;  3BF1 A;  3D7E O;  2NLX A;  2A6A A;  1YI2 N;  5LJW A;  3HM8 A;  4FSV A;  3OBW A;  4IOX A;  3SLC A;  4C1N K;  3ENO A;  2HST A;  3OA9 A;  1Z6R A;  3CPE A;  3AGR A;  4GVE A;  4K41 A;  3SMP A;  2KHO A;  3CPW M;  5FPE A;  3ZX2 A;  4QS8 A;  4NO7 A;  4CZH A;  4EAH D;  1GLB G;  1RFQ A;  4M7Y A;  4K25 A;  3R8E A;  4FWP A;  3GDQ A;  5AQZ A;  4PL7 A;  3DJC A;  4AF1 A;  3ID8 A;  2FF6 A;  3NVM A;  4O8K A;  3WXJ A;  1YJW N;  3I56 N;  1GLA G;  4JN4 A;  4MLH A;  3KK7 A;  4BRP A;  4CZI A;  4H5V A;  4H5W A;  1NGC A;  2NRT A;  1U2V A;  3H46 O;  5BRD A;  3N4Q A;  3J7Z O;  5C2D A;  4FOE A;  1VQ9 N;  1YHQ N;  3MN6 A;  5ELZ A;  2PAV A;  5B8H A;  3CF5 L;  3FLC O;  1V4S A;  4IJN A;  3PIP L;  1NGI A;  2V51 B;  5ADX H;  2Q36 A;  2OTL N;  3AAP A;  5GAE P;  4YOV A;  4O8U A;  2FF3 B;  2RHK A;  5JLH A;  1KQS M;  3BUZ B;  4AM7 A;  3ATU A;  3DXK B;  2JWL A;  4H5R A;  2NRH A;  3N4P A;  4WQ4 A;  3A0I X;  3C6A A;  3R6M A;  3M3Z A;  3VEY A;  4JKA A;  3HTV A;  3F2K A;  1S3X A;  3O1W A;  3Q7B A;  2H3G X;  4CZF A;  3ID6 A;  4U7B A;  3RVC A;  5BRE A;  5AQM A;  3O9U A;  4YOU A;  4BRM A;  4BRD A;  1K8K B;  3AAR A;  2A42 A;  3O6W A;  4B1Y B;  3E9P A;  5HL7 L;  2WFB A;  3KWI A;  3UKR B;  4RCH A;  3VF4 A;  3ZET A;  4A59 A;  3M1F A;  4GNI A;  1BO5 O;  2QTD A;  3KZB A;  3QDK A;  1N8R O;  1NM1 A;  2YJE A;  4ILH A;  2IVN A;  5LJV A;  1WUA A;  4IXC A;  2AP1 A;  1YVN A;  4ISF A;  3RSE A;  4DKW A;  2VGM A;  4LC9 B;  4U67 L;  4M63 C;  1BA1 A;  2VWB A;  3TU5 A;  4BRK A;  4FPA A;  3H1Q A;  2P9P A;  4HTL A;  1NJI O;  2EWS A;  3O9Q A;  3FZM A;  2HBM A;  4H5T A;  5AQQ A;  5GAD P;  4CD3 A;  4BC5 A;  1JJ2 M;  2ITM A;  4K43 A;  1TUY A;  5AQG A;  4BY9 C;  4KH5 A;  3LDL A;  1Q81 O;  5JLF A;  4CZJ A;  4E1J A;  2F9W A;  3LDP A;  3EE8 A;  2I7P A;  3OHR A;  3F9M A;  3UKU A;  3VEO A;  4IJA A;  4Y0W A;  5AQI A;  3HBT A;  4B1Z A;  5DM6 L;  3ZEU A;  4G9Z A;  3VER A;  2E8A A;  1YAG A;  1GLF O;  5EXW A;  2GEL A;  3L6Q A;  3VEV A;  2KLA A;  2E2P A;  3UE5 A;  1U2V B;  1VQL N;  4GV6 A;  3O5B A;  1W2B M;  3E1Y A;  3ZET B;  2VYP A;  2BH1 A;  1T6D A;  4BRH A;  2ZJR L;  2P9I A;  3VTI A;  1ZXO A;  3VTH A;  2P9N B;  4CI6 A;  3CCM N;  4KH6 A;  1KAX A;  3SAH A;  5BRH A;  1JCG A;  4Z94 A;  2E88 A;  3R1X A;  3QBX A;  1ZC6 A;  3A5O C;  4NLB A;  4WFB L;  1T44 A;  5JIC A;  2P9K B;  2W40 A;  4PKH A;  3CC7 N;  2ASP A;  3CJ1 A;  3KWG A;  5AQS A;  3BP8 A;  4IZ9 A;  1QVF M;  2FSN A;  1VQO N;  1K73 O;  2BTF A;  4PKG A;  5CR4 A;  4A57 A;  3M6G A;  4B1U B;  4CZE A;  2DPN A;  4IWV A;  2YX6 A;  4EFH A;  1BU6 O;  2ZJP L;  1IG8 A;  5KPR A;  4UY8 O;  5TKW A;  3WEE B;  5AQK A;  1C0F A;  2CGK A;  2HMP A;  1NMD A;  2ASO A;  3L4I A;  1SS6 A;  1TYQ B;  2QWO A;  4ISG A;  4FWO A;  4WQ5 C;  3C0B A;  3F5T A;  4YDU A;  1SQK A;  2KKZ A;  3FR0 A;  4B1V A;  3QIC A;  2CGJ A;  2FSJ A;  3MCA B;  3A5N C;  3O9R A;  5AZI B;  5BPN A;  4WF9 L;  3CC2 N;  3VGK A;  2YCH A;  4IFE A;  2P9P B;  4BRG A;  3WXM B;  1CZA N;  4A5B A;  4JD2 B;  3JS6 A;  2OAN A;  3VOV A;  4BGB A;  1HX1 A;  1M1K O;  1NGB A;  5C0Y A;  3O1B A;  4KBO A;  5F1X A;  5JVH L;  2YJF A;  5M1N A;  2YHW A;  3IDH A;  3P39 A;  1ATS A;  1VQ6 N;  1YJ9 N;  1W97 L;  4CZK A;  1JCF A;  4FWR A;  5TKY A;  3ZEU B;  5MLC Q;  1GLC G;  3G71 N;  5BR9 A;  2ZF5 O;  2A3Z A;  3TTF A;  5E26 A;  3EL2 A;  4EHU A;  3VES A;  4FWS A;  3TSU A;  5KQD A;  1D4X A;  2P9S B;  2PBD A;  2HBK A;  2HBL A;  3I33 A;  4IOA L;  4RWT A;  3QFU A;  3WXI A;  4CBX A;  1T3V A;  3WQU A;  3AAQ A;  4L3Q A;  3VEN A;  4CJ7 A;  3EKS A;  1XC3 A;  1VQM N;  3BF3 A;  3GL1 A;  1LCU A;  1OKJ A;  3EO3 A;  5AR0 A;  1X3M A;  3ULE A;  4B1W B;  1Y64 A;  3O80 A;  4MDB A;  4BQL A;  5FPN A;  3TTC A;  2QWL A;  4A61 A;  4H0T B;  3CQX A;  2E2N A;  1BUP A;  4A2B A;  3HOS A;  4GY2 B;  1J6Z A;  5C12 A;  4JEP A;  2P9U A;  2GWK A;  1XQS C;  3E9O A;  3B8A X;  2V52 B;  4B1X B;  1GLE G;  3CCL N;  3EE9 A;  1HJO A;  2HF4 A;  3E9L A;  1OVY A;  3MMV A;  4ISE A;  4DB3 A;  3MX2 A;  3ULE B;  2JWK A;  3CHW A;  2NRV A;  2YI1 A;  3CQY A;  3UB5 A;  1Q86 O;  3L0Q A;  1O13 A;  3D2E A;  3WEE A;  5CHI A;  3CER A;  3L4Q A;  3U9Z A;  4XH1 A;  4BR5 A;  4BC3 A;  4YOT A;  4H0Y B;  1QZ5 A;  3FZF A;  1GLJ O;  4CD1 A;  1LOT B;  1NGD A;  1Z05 A;  2NNW A;  4NLC A;  2IIR A;  2Q31 A;  1JCE A;  4WYB A;  4DHY A;  3PIO L;  3CXC M;  2E2O A;  5GAG P;  3CMA N;  2QWM A;  2P9K A;  2WBN A;  4MDA A;  4BRF A;  2CGL A;  4ILG B;  3SAG A;  2Q0R A;  1YUW A;  2BUP A;  4FPB A;  4WFA L;  3D2E B;  2D0O A;  3DLL L;  3HI0 A;  2NRW A;  4FWM A;  3VF6 A;  2FXU A;  3RSE B;  4FO0 A;  3A5M C;  3U8X A;  3C65 A;  3MWT A;  3DAW A;  3TTD A;  4JKG B;  4MO5 A;  1MA9 B;  4BRO A;  1KAY A;  2HOE A;  4OO1 J;  1KAZ A;  4JKB A;  3SBG A;  1K9M O;  3CJ7 A;  5AQR A;  5HOO A;  5FPD A;  3CCJ N;  1QQN A;  3LDO A;  3SBT A;  3K9K A;  5AZJ B;  5EOY A;  5GIO A;  1YF5 L;  3LL3 A;  4J8F A;  2NRZ A;  4IDH A;  1Q18 A;  1K8K A;  3DXM A;  3SMS A;  3FZL A;  3A8Y A;  4CZL A;  5C2F A;  5AQJ A;  4YOW A;  3FFK B;  1U6Z A;  3T69 A;  3CCV N;  2WUS A;  1GLL O;  5EVZ A;  3JXU A;  3R9P A;  1S22 A;  4H0O A;  3VGM A;  1C0G A;  3QB0 A;  3LDN A;  3O9S A;  4JK8 A;  4H5N A;  1HLU A;  4BR7 A;  1BA0 A;  1NGJ A;  1ATN A;  1XUP O;  3DXM B;  1S72 N;  5AFU H;  3VGL A;  1MWM A;  4BVO A;  2UYT A;  2RE2 A;  3HRG A;  3TSP A;  3MDQ A;  4IO8 A;  4KH4 A;  3D2F A;  3CJ9 A;  3H1V X;  3T7Z A;  4GV3 A;  1VQ4 N;  1G99 A;  1NWK A;  2ASM A;  2Q1N A;  3AGK A;  5JMV A;  5AQT A;  4JNE A;  4M7X A;  2WC9 A;  4BRN A;  5M1F A;  4IO9 L;  1X9J A;  4BG8 A;  3ENB A;  1QHA A;  2QXL A;  2CH5 A;  1VQN N;  3H45 C;  4PL8 A;  5KPT A;  2FLO A;  3OBY A;  2YHX A;  4JHD A;  4BGA A;  1KD1 O;  2IVO A;  3FZK A;  3D2F B;  1QZ6 A;  4R79 A;  1VQK N;  3HOT A;  3EN9 A;  3VEZ A;  2QWP A;  3WXK A;  3CIP A;  4BRL A;  2NZT A;  3SAF A;  4C23 A;  3O08 A;  5AQY A;  5EY4 A;  1QQO A;  3TPQ A;  4B9Q A;  5F2R A;  4JKC A;  4BRC A;  2P9I B;  1VAZ A;  3EKU A;  5CE3 A;  3AY9 A;  1DKG D;  4JHD B;  3O8M A;  1IJJ A;  3HSC A;  3C7N B;  4OPA A;  4AM6 A;  3G4S N;  3J8A A;  4A5A A;  3OW2 M;  3CD6 N;  5GIP A;  1NGF A;  1BWF O;  5F0X A;  1M90 O;  3ZX3 A;  4BC4 A;  4OPH A;  3IUC A;  3KVG A;  4JAX A;  2HBJ A;  2QW9 A;  3TSQ A;  4PHT X;  4BQZ A;  4BC2 A;  4JK9 A;  1DEJ A;  1DGK N;  3LM9 A;  4JKF A;  2HF3 A;  1QQM A;  3Q7C A;  4BG9 A;  5BPM A;  4XH5 A;  5BPL A;  1P8Z A;  1SAZ A;  3C7N A;  2F7T A;  4A62 A;  3PLA A;  3CCR N;  1WOQ A;  1QVG M;  1H1V A;  3R3L A;  3D6R A;  2GUP A;  4CBW A;  4H0P A;  2QI2 A;  5AQV A;  3MN5 A;  3VEX A;  2E1Z A;  3VMF B;  3E66 A;  4A2A A;  1TYQ A;  2D4W A;  5AQH A;  3MN9 A;  3P38 A;  4XH4 A;  3EZW A;  2E1Y A;  1E4G T;  5AFU A;  3CME N;  4H03 B;  2V7Z A;  2YHY A;  3GG4 A;  3SJH A;  5AQU A;  1Q7Y O;  5EX5 A;  2A40 A;  4FWK A;  4JD2 A;  2D1K A;  5FPM A;  3G6E N;  3W3D A;  3QML A;  1SZ2 A;  4MO4 A;  4FVU A;  2NRX A;  3M5R A;  5AQF A;  4GV9 A;  5C10 A;  1P90 A;  1V4T A;  2Q0U A;  3CJA A;  3CI5 A;  4EHT A;  4BRI A;  1EO1 A;  3LDQ A;  1HKG A;  3I55 N;  3CCQ N;  2I7N A;  2AA4 A;  4WQ4 C;  1VQ8 N;  1MDU B;  4H0X B;  5M1K A;  1RDW X;  2QA4 N;  1NLV A;  4BR2 A;  4NB4 A;  1K8A O;  3MWP A;  2P9S A;  5AQN A;  5M1O A;  4WQ5 A;  2PFU A;  4YDU C;  4WFN L;  3CCU N;  1VQP N;  3VF2 A;  3LM2 A;  4K42 A;  3H3N O;  4JKD A;  2A5X A;  4BRE A;  3H3O B;  1EQY A;  3FZH A;  1NGH A;  1T6C A;  5M1P A;  3DXK A;  1YIT N;  3ZYY X;  1YXQ A;  3FE1 A;  3HZ6 A;  1YJN N;  1NGG A;  4JK7 A;  4JKE A;  1E4F T;  2GWJ A;  5LY3 A;  5E84 A;  1ZBS A;  3P31 A;  2P9N A;  3WQT A;  5AQX A;  3H6E A;  5ADX A;  3W0L A;  4YOX A;  2F9T A;  4YOR A;  1ATR A;  2P9U B;  3CCS N;  4H0V B;  3KHY A;  1VQ5 N;  3CCE N;  1KC8 O;  4WCE L;  4I6M B;  5C15 A;  3WUH A;  2IVP A;  5M1Q A;  1VQ7 N;  1BG3 A;  4F9O A;  2Q2R A;  3G25 A;  2VCP A;  2ZWH A;  5BN9 A;  2P9L B;  4ILJ A;  1Q82 O;  5AQL A;  5GAH P;  3IKM A;  4BVP A;  1RGI A;  2VGN A;  3IMX A;  3NMU A;  2ZGY A;  3MK6 A;  4QS9 A;  3I8B A;  4I6M A;  2ZGZ A;  4DQ8 A;  3GE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...