3R1XA

Crystal structure of 2-oxo-3-deoxygalactonate kinase from klebsiella pneumoniae
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
295
structure length
295
Chain Sequence
SNAMTARYIAIDWGSTNLRAWLYQGEECLESRQSEAGVTRLNGRSPAAVLAEITQHWRDGATPVVMAGMVGSNVGWKIAPYLPLPAAFSDIGQQLTAVGDNIWIIPGLCVSRDDNHNVMRGEETQLLGARALAPSSVYVMPGTHCKWVLADRRQIHDFRTVLTGELHHLLLQLSLVGAGLPPQETSAAAFAAGLQRGINNPAVLPQLFEVRASHVLGALPREQVSEFLSGLLIGAEVATLSDTFAGQQAISLVAGSSLTSRYQQAFAAIGREVSAVAGDTAFQTGIRSIAYAVAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-oxo-3-deoxygalactonate kinase
publication title Structure of 2-oxo-3-deoxygalactonate kinase from Klebsiella pneumoniae.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Transferase
total genus 93
structure length 295
sequence length 295
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.58: 2-dehydro-3-deoxygalactonokinase.
pdb deposition date 2011-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05035 DGOK 2-keto-3-deoxy-galactonokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.300 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3r1xA01
3.30.420.310 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3r1xA02
3T69A 3R1XA
chains in the Genus database with same CATH superfamily
3DXKA 1K8AO 4QCLA 2CGKA 3C6UA 4DB3A 4BGAA 3U3GA 2UXDK 2OA8A 1QSSA 4CZJA 4NYNA 3VQCA 2IOCA 3HT3A 4YDUA 4FJ7A 3TSUA 2KHOA 1NJXA 5AQKA 5C12A 5JLHA 2BTFA 1Q81O 3CPEA 4BQLA 2RPIA 4IFVA 1EWQA 1ATNA 1FW6A 4O5BA 4Q5VA 3E9PA 3O3GA 4M45A 2P9LA 3S3MA 1X3NA 2D0BA 2IDOA 3WNEA 3U6FA 4O4GA 2PAVA 2QWRA 4CJUA 4BRDA 3CF5L 3DLLL 3CC2N 1QVFM 4M63C 5E84A 2HF4A 5SWMA 3SAGA 2KFZA 4BRLA 1LWFA 2X74A 2YX6A 3BUZB 4JKCA 3ZETA 1KVBA 2DY4A 4G9ZA 1RFQA 1VAZA 3D45A 3AGRA 2XHBA 3PV8A 2DPNA 3ZT4A 3G71N 3OYMA 4CZHA 4I9LA 3VF2A 1E4GT 4E19A 4JKGB 1KTQA 2FC0A 3F9MA 3ZSZA 1YVUA 3I8DA 1FXXA 3EZ5A 2E2NA 2YCHA 3V81A 4C23A 4H0PA 5CR4A 5AQOA 5KQDA 3L2VA 1A5XA 1RT5A 1WAJA 1HNVA 1N8RO 3EEQA 2UU9K 1Q8IA 3PLAA 2HVHA 1LW0A 3SQ0A 1TKDA 3WXJA 5F0XA 1HKGA 3LZIA 1TUUA 4GV6A 1LWCA 1N34K 4FZYA 3CFPA 3ZT2A 3DWLA 4JI4K 4CEAA 1TK8A 4CK1A 4IJNA 2ATQA 1ESVA 3OYNA 1U04A 2Q0RA 4CI6A 3OYEA 4XEIA 2QXLA 3PY8A 2ZD1A 1C0TA 1Z25A 3MX2A 4GNIA 4Y1DA 5BR8K 4JI6K 3I55N 4XH5A 4DTRA 1S1XA 4FM0A 1X9MA 4B1XB 1TAQA 4CW7B 2V51B 2ZJQL 3CJAA 3OYGA 4NCAA 3ID8A 4O0IA 3KLHA 2VCPA 1RT3A 1GOCA 3HSCA 2Y1JA 4B1VA 4N47A 4H8KA 3ZYYX 3THWB 4BDZA 1SV5A 2R7YA 2YHWA 4FLVA 2HHTA 4JKAA 3HOSA 3OYHA 4CHQA 4PL7A 4DTNA 3MWPA 4DFPA 1VQMN 2WOMA 4FZXC 4ELVA 3OVNA 2PZSA 1C1AA 4KHNA 3U9ZA 2UUCK 4E7LA 3DXKB 2D0OA 4CJTA 3BZCA 3K0SA 4J2BA 1RBTA 5KQ8A 4AH9A 4LC9B 1T6CA 3LAMA 1NG9A 3MXIA 1HKCA 3AVKA 2XY7A 4UY8O 2E6LA 3UIQA 4OPJA 1R0AA 2KKZA 4IG0A 4WQ4A 3U9DA 3OY9A 1VQ5N 3D0PA 3TTDA 3SJJA 3CMEN 3CCMN 4M3UA 4B8AB 3V6DA 1TL3A 3LDNA 2HW3A 4YHHK 2OPQA 1VHXA 1RNHA 2BH1A 1QQMA 1ZBUA 2P9LB 5I3UA 2YHBA 2Z1IA 1W7AA 1L3TA 2QM1A 3E01A 3LP0A 4JI8K 5DM7L 1IKXA 2DFFA 5CZ1A 1VSFA 5FPDA 3K58A 4JYAK 3D6RA 1RT6A 3D7EO 2BUPA 4MFBA 1BIUA 4DMNA 2YJFA 4GW6A 1IV0A 2GBZA 3DRSA 4H5VA 2YNIA 1REVA 3SQ4A 2CH6A 3VQAA 3QIOA 2AJQA 3BDPA 1RILA 1I3AA 4WYBA 1IH7A 4H5RA 5AQSA 3GL1A 3SPZA 4QS7A 3QFUA 2P9KB 5LY3A 1NK6A 2OYQA 1G99A 3LP3A 4H03B 1GLBG 3PX6A 4BRGA 1ASWA 4DU3A 2ZM6K 1YJWN 4AHSA 3AVNA 4I9QA 3DYAA 1TL1A 4DQRA 4GMJB 5J2PA 1NKCA 5AQLA 4PL8A 3AA3A 3B8AX 4HHTA 4KH4A 4A62A 2IIRA 4CIFA 4K0KK 4E3SA 4KHWA 4JI2K 2QKKA 1WN7A 2X6NA 4FW1A 1VQ9N 4JHDA 3OTOK 3HVRA 5I42A 3ENHA 4HUFA 5GAEP 4BRCA 5M1NA 3VOVA 4DSJA 5DK5A 3PO5A 2QEXN 4RW7A 4CFDA 4O44A 2HMIA 4JI0K 3K9JA 2QW9A 4CECA 3QFPA 2PFUA 1QTMA 3AA5X 3W3DA 5J1EA 2G8WA 4FOEA 3WEEB 3HVTA 3V9ZA 1S5JA 4FLWA 4HCCA 1KD1O 4JV5K 4R79A 5JLFA 4OGCA 2IC3A 3CJBA 1UAXA 3NF7A 3VGMA 2AA4A 1SKRA 2Q1NA 4A2AA 3K5LA 2I5JA 1J5EK 4AQYK 5EXWA 1L3SA 4CBWA 3DLHA 1DTTA 2F96A 4LF6K 5H1SQ 4FPBA 3CETA 5BREA 3KLEA 1SL1A 4DV4K 4W5TA 1MU2A 5FRMA 4MO5A 3HPOA 2YKMA 3TARA 3NGZA 1EKEA 3FFKB 3BEXA 3S41A 5A2QO 1T7PA 3FE1A 4L3QA 2UUBK 1RT2A 2FSNA 4O8UA 2P5OA 1VSMA 4PA1A 3OS1A 1FJGK 3ATVA 2W6KA 4CGDA 1L3UA 2QA4N 1SS6A 5TKWA 3H08A 4FWOA 4BRKA 5J2MA 4PUOA 1YIJN 3TWHA 4DR4K 3E9OA 3G6EN 2VGMA 3N4PA 3EL2A 1U47A 4CFBA 3VENA 2FBYA 3DLRA 3SUPA 4CJ7A 2E1ZA 3C94A 4IFYA 4DV5K 2DFHA 3NFAA 2J4RA 5C25A 4LSLA 1NWKA 3AAQA 3CPWM 3H3OB 4KB1A 1HPMA 4LF9K 1YHQN 3PSFA 4FWKA 3SV4A 3AVMA 3CJ9A 5HOOA 2V7YA 1Q7YO 1ATRA 1TK5A 3CFRA 2Q36A 1WLJA 3I8BA 1ZC6A 2H3GX 3EE8A 3UB5A 3OYJA 4IZ9A 4O5FA 1WAFA 1O13A 3SI6A 1JCFA 1T3VA 5AZJA 1BOTO 3CJCA 1VQ7N 5C24A 4CZIA 3NH1A 4JRQA 4CJPA 1U48A 4LF7K 3NHGA 1P90A 2GX9A 3BZKA 2W41A 4JNEA 4KBOA 3SAFA 3OW2M 1RDCA 3K59A 4PKGA 3F73A 3H45C 3P39A 4KV8A 1Z6RA 3RMBA 4JKHA 4N56A 4CZKA 1U2VA 4DUYK 4DWIA 2KZZA 4IXCA 3MEGA 3G4SN 3ZSYA 3SNNA 3SAHA 4YOUA 3C65A 3ZLJA 3BP8A 3V4IA 3PX4A 1KVCA 1RDDA 4JN4A 4NCBA 3DOLA 3O5BA 1LAVA 4JHDB 4AHTA 1IBKK 2HNDA 2PYJA 2DTUA 1JLAA 1X3MA 4M7YA 3VA0A 4DV0K 4C8LA 5D3GA 4IOAL 2ASMA 3CHWA 1HLUA 4CZMA 1NMDA 4DFKA 3PSIA 4FWQA 4ELUA 2D0PA 3LP1A 4M41A 4OLBA 3M8PA 4DS5A 1TV6A 3FFIA 2CH5A 3QICA 1HNWK 5HROA 4BG8A 1RT4A 3J80O 2FSKA 5AQPA 4DF4A 4B3RK 2QK9A 4C8MA 4YNQA 4DV7K 1G15A 3WXIA 3LZJA 3LM9A 3K2PA 4EIAA 4YOTA 1TGOA 1BQMA 4W5RA 1FK9A 1RDBA 3PX0A 3LL3A 3CJ7A 2G8HA 3O3HA 3AVLA 4JRPA 4LSNA 5AJ3K 1BDGA 2NRRA 1JL1A 4LF8K 3HOTA 4BRNA 4J2AA 1U49A 2NRZA 3IFRA 4QS8A 4DQIA 4BE2A 3M8RA 3AY9A 4K41A 3Q7CA 2XRIA 4N76A 1GOBA 3QBWA 4CERA 1GOAA 3ZT1A 3L6QA 4JK9A 3O80A 2GTDA 1YJ9N 2E6MA 3BF3A 4CBUA 3KVGA 3TAQA 3O08A 1KFDA 3MXJA 1N5YA 3VMFB 3AO4A 2A41A 3FZKA 3G25A 3OS0A 1NK7A 3VQ4A 3GG4A 4GV3A 3R6MA 1KLMA 1DKGD 4AHCA 5SZTA 3CCVN 1QE1A 2D0CA 4M3RA 1ZBSA 3KLGA 4C8KA 4KB0A 4E7HA 4AM7A 4BRHA 2GUIA 3EKUA 3TABA 3IDHA 5CE3A 4GVEA 3LALA 1BGXT 4BWMA 1W2BM 4UQGA 1XQSC 1BQNA 4AHRA 2E8AA 4IDHA 1L3VA 1A5WA 3K5MA 3KK3A 5BRFA 4BR7A 4JI5K 3KLFA 4H0XB 1LWEA 2NLXA 1RBVA 2E2OA 4FVUA 3T1YK 2GUPA 1HYZA 4CJEA 3VEWA 1W0HA 4HUGA 5ELZA 1RGIA 3D2FB 4B3SK 3QLHA 1YJNN 3ZSQA 3THYA 2YI1A 3QEPA 1XI1A 3J7AP 2BE2A 1GLLO 2FF3B 1WSJA 4N41A 1DGKN 3VTHA 4H0TB 3V1RA 4B9UA 3GDQA 4CZLA 1VSHA 5J2QA 3O9QA 4KHUA 3V9UA 3NCIA 2O8CA 4IO8A 3V1OA 3J8AA 4F8RA 1HR0K 1KAYA 3QBXA 3FZFA 3NH0A 2QWMA 3DLEA 1JCEA 5LJVA 1JXEA 5EOYA 2D0AA 4FM2A 1NM1A 3ATUA 1RBSA 2VG7A 3SLCA 5FPNA 2UXBK 3WQUA 2KZMA 3A5MC 3P38A 4A59A 3VQ6A 5FLXO 5B8HA 5CYMA 3MK6A 4Y0WA 1RBRA 5AQNA 3DJCA 1WSGA 5HRPA 1GLAG 3MN5A 3OJSA 1IBLK 4CGIA 1CXUA 4H4OA 3O6WA 1QVGM 3LANA 4CIGA 2KLAA 4DQPA 2PBDA 1NGJA 3KK2A 3HBTA 4Z4HA 4DLEA 1UOCA 5HP1A 2ITGA 3AO5A 2YHXA 3KIOA 4IOCL 2HBMA 1BA1A 1X1PA 4BVOA 4CEDA 4CJKA 2QKBA 4DG1A 3MECA 2P9KA 3CXCM 2KQ2A 2VYPA 4LD0A 4BC3A 5FDLA 3VGKA 1XHXA 4JI3K 2OTJN 5BPLA 2A5XA 4KFBA 4FJ8A 5CY4A 3A5LC 5JICA 1OKJA 1ZBHA 1S9GA 4YDUC 3G10A 1K73O 4U67L 3KWGA 5BR9A 2ETJA 4WE1A 5KPTA 3TAGA 3S3NA 3A2FA 5BPNA 3V9SA 4LF4K 3O4QA 4I6MA 1W97L 3I33A 3WXKA 3ZSOA 1OVQA 3M6GA 4BROA 1DEJA 2P9UB 3L2WA 1NK0A 1M90O 3SJHA 3OJUA 1WUAA 1KVAA 2G8VA 2ASOA 3QIPA 1JLQA 4FPAA 3WEEA 3OHRA 1YAGA 1OVYA 3B6PA 3RMDA 1J54A 1TUYA 4FVMA 2QXFA 3O9SA 1JJ2M 3U3YA 4BC2A 1LOTB 1SL2A 4W5OA 4OKKA 2ZJPL 3HSTB 5AQFA 4Z94A 3ZX0A 3AO2A 1NGIA 3T7ZA 4H0VB 1JLBA 1SAZA 1W9HA 2FLOA 3THYB 2O8BB 2E5LK 5BRDA 3HP6A 2A3ZA 2P9SB 4YOVA 4CZEA 4JI7K 1KLNA 1ASUA 4B1YB 2W6LA 4FWSA 1B9DA 3MEDA 4EP4A 4ISEA 4JKBA 5AQZA 3CMAN 2O8CB 4DQQA 1QSYA 1MWKA 1IO2A 5ADXH 3C6TA 1RTDA 4C8NA 5C15A 1XUPO 5GADP 1K8KA 3O8MA 1N32K 1HJRA 1IJJA 3M1FA 3CD6N 3VQBA 4FOIA 3SUNA 4AHVA 2OCEA 2QWLA 4N5SA 1IKVA 1X9JA 1BIZA 3C6HA 2F4VK 4KTQA 4J8FA 4K25A 4K8ZA 4KHYA 3HPHA 1CZ9A 2P5GA 2RHKA 4FLUA 1NOZA 1SL0A 3A5OC 3AV9A 4H4MA 4DR2K 2WFBA 3DAWA 1S1WA 2EX3A 2XY8A 4OJRA 1C0MA 3TPQA 2YNGA 5T7BA 4TSXA 3W0LA 5AQXA 3MWTA 4CZFA 3C7NB 5LJWA 4YFUA 3EYZA 3DI6A 2PY5A 5M1OA 3I0RA 4FYDA 1Y97A 4NLBA 1QZ6A 3L8BA 1NJZA 2BDPA 1HX1A 3CCEN 1C6VA 2A1RA 1KC8O 4WQ4C 5KGXA 4E7IA 4DTPA 3M8QA 3S3OA 5C2FA 3AVFA 4DUZK 3DMJA 5AQYA 2QWQA 4RCHA 4CEFA 1M1KO 4PQUA 1SZ2A 4ZHRA 2OPPA 2UXCK 4B9VA 1GLDG 4I6MB 2YHYA 5JS2A 1NJWA 1VQ6N 5EU7A 3EY1A 3RRGA 3HYFA 5MLCQ 5M1PA 3CG7A 2ITMA 2IS3A 3ISNC 5AZIA 4Z0UA 5M1QA 4CE9A 4CF0A 1WBBA 3BF1A 2ZWHA 3SBGA 2E4LA 4BR4A 3NVKA 1BU6O 4RWTA 1WSHA 2Q31A 4FL9A 2B5JA 3ENBA 2HBKA 1RT7A 2VG6A 4DSFA 1U45A 1J6ZA 3M8SA 1C0UA 2X78A 4QS9A 3VPZA 4KI4A 3L2RA 1IBMK 1QSLA 1WBDA 3CJ1A 3AO1A 4W5NA 2VG5A 1EETA 3UKRB 4JKDA 3LP2A 4FZZA 3T3FA 1QHAA 4DTOA 1NLVA 4YORA 4FLYA 4F4KA 1JLGA 5F1XA 5DMRA 3TTCA 1B92A 4X64K 4IKFA 4EZ6A 4KTWA 4BG9A 1Q82O 4FM1A 4BE1A 3MCAB 2KFNA 1C1BA 2VWBA 2XO7A 1YF5L 2P51A 3CQ8A 3RWUA 4OX9K 5AQWA 4E89A 4NO7A 4OPKA 1WSFA 2GWJA 3CCSN 1B9FA 2PYLA 4ID1A 1D4XA 1BISA 1D8YA 4KO0A 4AILC 4JS4A 1VQNN 4NXNK 4PKIA 3LWLA 1RTIA 4GVMA 4DR5K 4CF2A 3TI0A 4PY5A 1RBUA 4FJNA 1NGDA 5E41A 3QNOA 2A6AA 2Y1IA 4J2DA 3C95A 3CCUN 1K8KB 4WF9L 4F3TA 4ID5A 1EP4A 3IMXA 4HTLA 1X9SA 1GLEG 2GV9A 3R1XA 1VK0A 3HK2A 1Q86O 4KKOA 3T69A 1U4BA 3SYZA 1NU0A 2P9NA 4GY2B 1DT9A 4B1ZA 3L4IA 1BUPA 4J2EA 1HPZA 1Q18A 3THXB 2FBVA 2VQEK 3J81O 5F2RA 2YNFA 4BC4A 5CZ2A 1EXQA 4DTMA 5AQJA 1S6QA 4B3MK 2I7NA 1T44A 2F7TA 1BCOA 4CJQA 4RTFD 1T6DA 3SK3A 4FLTA 5HBMA 1VSJA 3K57A 4B1UB 4DSLA 3MX5A 1N36K 3H1QA 4B9SA 1EX4A 4FWLA 1S1VA 3EE9A 4RW9A 3D2FA 4CGHA 1Q9XA 3AVBA 3F9KA 4JS5A 3AVJA 5C10A 3L3VA 3OYAA 1BG3A 4CHOA 4FWNA 3VQQA 5C2DA 3NF9A 4M3YA 1Z05A 4JI1K 4DR3K 4YOWA 3O4WA 3VA3A 1GLFO 2ZGZA 1HQEA 3VQEA 3JSMA 2WC9A 3EN9A 1JKHA 1LCUA 3VEVA 3MDQA 3OBWA 4FXDA 3RTVA 4Q0BA 5HL7L 1UWBA 1C0FA 5M1KA 3CI5A 3D2EA 1VSIA 1ZXOA 4H0OA 1KAXA 4X65K 5AZIB 2YNHA 5KRTA 3DRPA 4HUEA 4MLEA 3ALYA 3NDKA 1ATSA 3O1BA 1RDAA 1IG9A 3ULDA 4C1NI 1SUQA 4OKJA 1S9EA 4CK2A 3CCQN 2O8DA 5AQGA 5AFUA 1VQ4N 4E0DA 3HI0A 3QNNA 4FJIA 1S1TA 1ZBIA 4BGBA 3OYLA 2Z1HA 4FJKA 3TANA 3SMPA 4V19S 4OPAA 4I2QA 4E1NA 4I2PA 4CHZA 4B3OA 1EO1A 4FSVA 3PUFA 3CM5A 3QETA 4ILJA 3HM8A 1X9WA 2F8TA 4A57A 4FJXA 3O9TA 1NGEA 1ZYQA 1YI2N 5EX5A 3L3UA 4EHTA 1E3MA 3IRXA 1XC9A 1Z26A 4M3TA 3AO3A 3WXLA 3OYKA 4DFMA 1O1WA 4CBXA 5IWAK 4IDKA 1NK9A 2HHQA 3FLCO 4FWMA 4ISGA 1HUXA 1CXQA 3WT0A 3PIPL 2HHWA 4CIEA 4DQ8A 4KTZA 3G0ZA 4B3TK 3JXUA 4IWVA 2QTDA 1KSPA 1YT3A 2GELA 4DR6K 4KRFA 4DS4A 3T19A 5GINA 2P9UA 3L2QA 3ZX2A 3GBTA 1BHLA 1YXQA 1JL2A 3SQ1A 2IVNA 3RVCA 4BE0A 4Z4GA 2B6AA 3MMVA 2P9NB 1QQOA 4PWDA 5HRSA 2O4GA 3UKUA 1NGBA 1VSEA 2P9PB 2WONA 1VQON 3R9PA 2D1KA 3DLBA 5AQIA 1OH8A 2HHVA 2RN2A 1IKWA 3OYDA 1SKSA 2IVOA 4JKFA 3VESA 4AM6A 4MQ3A 3LDQA 3U8XA 1ASVA 1IG8A 4DU4A 4BRQA 2X6SA 4IO9L 4BR9A 1RTJA 1ZBFA 3O9RA 3AGKA 4OVLA 2YV0X 1BWFO 2O8BA 4HVJA 1XNRK 3HP9A 1WSIA 2AP1A 3ULEB 1J5OA 2P9SA 3VTIA 1U6ZA 4L8RB 5AQMA 4BRMA 3E1YA 5HRNA 4BRPA 4DSEA 4B8CA 1GLJO 2OANA 2HHXA 4CFAA 1D5AA 4M7XA 3SQ2A 4BY9C 4B9QA 4Z4FA 1RDUA 2ZQBA 1KCFA 3QINA 3ENOA 3P1GA 3D2EB 1NNEA 5EVZA 1BI4A 1XHZA 1ITGA 1NOYA 4DKWA 3R8EA 4MDBA 3HPGA 4IOXA 1TYQB 2YKNA 2BGGA 2O4IA 1J9AA 4CF8A 4RW4A 3QEWA 3O9UA 1F21A 4CF1A 3DM2A 4DHYA 4CHPA 1S1UA 5KTQA 5KPZA 2O8DB 4BRIA 2Z1GA 3IKMA 4YY3K 2NZTA 2YHAA 1P8ZA 3ZSVA 4JD2B 4NYFA 1E4FT 4MDAA 3P83D 1T03A 4IEEA 3ZX3A 3PIOL 3ZCMA 2A40A 4KHSA 4EZ9A 5KGWA 2HHUA 2Q0UA 4B9MA 2FSJA 1T05A 3AARA 3SMSA 3TAEA 4JKEA 4FCYA 3OYFA 3O3FA 2KTQA 1HNIA 1NGAA 1TK0A 3TSQA 3TTFA 3C7NA 2HVIA 4B1WB 1YTAA 3FZMA 4FW2A 4K43A 4DU1A 1NKEA 3HO1A 1S6PA 5LMNK 2RKIA 1HRHA 1QQNA 1WSEA 1NK4A 1KAZA 1I94K 4O55A 2FF6A 3NF8A 4NCGA 3IAYA 3CERA 4FJ9A 4YOYA 4HWIA 2P9IA 2Q97A 4LFBK 3QERA 2HMPA 3ZSWA 5JS1A 4DSKA 1NGGA 4E7JA 3KLIA 3A5NC 4B9TA 4KPYA 2F8SA 5FPEA 2QWNA 1RDWX 1OH6A 2UYTA 4AF1A 1NJYA 4JK7A 4FLXA 3VETA 4DTSA 3LWMA 3E9LA 3MEEA 5FPMA 3TU5A 3O1WA 2Z1JA 3WXMB 4A61A 4CD3A 4PHTX 1S72N 3NMUA 3ZEUA 3TR8A 5AQTA 4ISFA 4H5WA 4NXMK 5BPMA 2XY5A 4X62K 2E2QA 4NLCA 3UKUB 4CJVA 3P5JA 3CCRN 3NVMA 4EHUA 1YTUA 3H6EA 4BVPA 4PKHA 4F3OA 2OZMA 2BANA 1KFSA 3RSEB 4CJLA 3UKRA 5K14A 5C42A 3MAQA 4BDPA 4CVNE 3RMAA 3CQXA 4XH4A 1A5VA 2KW4A 1CZAN 3P4IA 4CGGA 3LDSA 3H46O 2HBJA 2NRVA 2JWKA 4WCEL 1VSLA 5LL6Z 3E66A 4H5TA 3LDOA 4DQSA 4IBNA 3AA2A 3NGIA 3WQTA 2EWSA 1BL3A 3S9HA 1D9DA 2WBNA 5JVHL 2F9TA 3VEXA 3QEXA 1LW2A 2V7ZA 1L5UA 1DLOA 4CGJA 3LDLA 3MN9A 5IT9O 4H5NA 4B9NA 4EAHD 4WFNL 3V9XA 1BI4B 2QWOA 3QB0A 3WNHA 1MWMA 2NRTA 4ZTFA 4M3XA 4GKJK 3B6OA 2ZGYA 3DOKA 2Q2RA 3ASMA 3DLKA 3VF4A 3CIPA 4CJFA 4O0JA 3P31A 4KAZA 4CEEA 2FXUA 5JMVA 4KH6A 3ZT3A 2P1JA 1HKBA 4CD1A 3KD5E 3GOIA 1QQCA 4BC5A 2O8EA 2E1YA 4XH1A 4LY7A 3QESA 3A0IX 4FJMA 3I0SA 4LF5K 3C0BA 4FO0A 4FJGA 3NE6A 4CJ4A 3K5OA 3NF6A 1V4TA 3KTQA 2GWKA 3THXA 1K9MO 4WFBL 2NRXA 1FKPA 4Z4CA 4C1NK 2OTLN 2NNWA 4FJ5A 5I9EB 2DFEA 5GIPA 4BR5A 3SZ2A 4WQ5A 3FGUA 1HYVA 3DXMA 3HM9A 4EFHA 4IEIA 3FZLA 3LAKA 2W42A 5HLFA 4X66K 1QZ5A 4OLAA 1IKYA 1VQ8N 3V1QA 3ZETB 4I7FA 4BDYA 3DLGA 3J7ZO 1YVNA 4FJJA 4A2BA 4FK4A 2E88A 3NGYA 5M1FA 3CC4N 1ILYA 1QS4A 4G1QA 4K42A 2WUSA 3AVGA 2P9IB 4ELTA 3SCXA 5GAHP 3ZT0A 1NGFA 3M3ZA 1LV5A 2HSTA 3VEZA 4KHPK 2O8FA 3WUHA 5AQQA 4CJ5A 3F5TA 1R59O 3QEVA 3MCPA 3AVCA 2G8UA 3RR8A 4FJLA 1ZBLA 2W40A 4IFEA 5JVGL 3R3LA 5AFUH 3OYCA 2D5RA 3ZSRA 4OO1J 1SQKA 3EO3A 2EHGA 3K9KA 1KQSM 4E1MA 3TAFA 3SV3A 3ZEUB 2IVPA 4KI6A 4CFCA 1JXBA 1UA0A 2JLEA 5DM6L 1KRPA 4LFCK 3ZSXA 3BGRA 3IG1A 3SBTA 3CM6A 4LFAK 1K6YA 4DV6K 2IGIA 1XMQK 2A42A 4WFAL 4WQ5C 5GAGP 4FJHA 3LM2A 4E7KA 3LPUA 5KRSA 3AVIA 2HNZA 2CGJA 1NBWA 3LPTA 2VWKA 4CJWA 3LDPA 1J53A 2G8FA 2IAJA 4H0YB 4Z4IA 3EKSA 3L4QA 3CQYA 1UA1A 3K5NA 4OKEA 1RTHA 4CK3A 3RR7A 1V4SA 4A5BA 4B9LA 5J2NA 5LMUK 3JAMO 3SPYA 4QOZB 1MDUB 2UUAK 4CEZA 1BCMA 2YJEA 4JEPA 3FZHA 1Y64A 3JYTA 3VQPA 4FWPA 5KI6A 3CCLN 5AQRA 1FKOA 1HYSA 3VF6A 3ITHA 3KWIA 4DTJA 4DR7K 2HHSA 4JK8A 3GE1A 2OPSA 2G8IA 3U4LA 4GKKK 1S22A 1WOQA 2QI2A 3VQ9A 4M3WA 2RF2A 3C6AA 4LH4A 1OH5A 4MLHA 3HL8A 4F2RA 1GLCG 3QMLA 2ZJRL 1VSKA 4AHUA 1EQYA 2O8EB 4O8KA 4KH5A 2NRWA 2HB5A 4DTXA 2P9PA 4NB4A 1EWRA 2VQFK 4ILGB 2HOEA 3HRGA 1DTQA 4IG3A 3VGLA 1NGHA 3MN7A 3PO4A 3L2UA 1TAUA 3KD1E 1HJOA 5ADXA 2NRHA 2F9WA 3VERA 3DXMB 3T1AA 4Z4EA 5AQUA 3AVAA 3SUOA 1TVRA 3L0QA 2OPRA 4CJRA 2JGUA 4CEOA 4W5QA 5AQVA 4BR2A 3A8YA 4CJSA 3VN5A 3ULEA 3KK7A 2GEMA 2HF3A 1VQLN 5EY4A 2O8FB 2B4JA 4M42A 3QDKA 3WNGA 2JWLA 3KHYA 3VQDA 4FK2A 1VRUA 4A5AA 4BQZA 1HMVA 1XMOK 4BREA 2ASPA 3HXMA 3TSPA 4RW6A 3IS9A 2NUBA 4DR1K 1CLQA 4KHQA 1Q9YA 2VGNA 4EP5A 3T1HK 4MO4A 1S3XA 3OYBA 1TYQA 1NGCA 4C8OA 3IUCA 4OGEA 4LH5A 5C0YA 3BY5A 5FROA 4M3ZA 3RRHA 2FBXA 1JLFA 4DFJA 4IJAA 5E26A 3I56N 1CZBA 3HJFA 2QWPA 4JD2A 4CJ3A 4DTUA 2FBTA 4ICLA 3CC7N 1JCGA 3OBYA 3OYIA 2G8KA 3M5RA 1LAWA 2OZSA 5KPRA 4GV9A 5TKYA 3MN6A 1VQPN 1RCHA 1WNSA 4FK0A 1N33K 1VQKN 3KKSA 5CHIA 2LSNA 5BN9A 4RW8A 4XIUA 4F2SA 2CGLA 4CESA 2ZF5O 1C0GA 1I39A 1MA9B 4CHNA 3KK1A 4CF9A 3VQ8A 4DCHA 4CCHA 3QEIA 3CYMA 1XNQK 2HHHK 4CZGA 1NMNA 4B08A 3EZWA 1HQUA 3O4NA 1QHTA 3TAPA 3UE5A 1H1VA 2HNYA 4RG8A 1TKZA 3CCJN 3OS2A 4YOXA 4JKGA 2Q3SA 4FWRA 3HTVA 3NBPA 3KJVA 4DLGA 1RT1A 1VRTA 1OH7A 2I7PA 3VEYA 3NH2A 1WB9A 4CGFA 4DV2K 3KKRA 4DSIA 4JLHA 4CEQA 2ZE2A 3FR0A 1BA0A 3OA9A 2WTUA 5HRRA 5BN8A 4BRFA 1TKXA 4CEBA 3TAMA 4ZTJA 1XC3A 5AQHA 4E1JA 1SKWA 4BR0A 3VQ7A 3AA4A 3QO9A 4ILHA 1NK5A 3VEOA 1NK8A 3F2KA 3H3NO 1NKBA 4BRAA 5CYQA 3CFOA 3VQ5A 4OPHA 1YUWA 1KXPA 4DV1K 3RSEA 2V52B 4QAGA 3SUQA 3Q7BA 2A1SA 4BACA 2VWJA 1JLEA 3ID6A 3NAEA 3HZ6A 5AR0A 2XY6A 4K8XA 3V9WA 5BRHA 2E20A 4HTUA 1D9FA 2RE2A 4DV3K 1NJIO 4JAXA 3DRRA 4HCBA 4U7BA 1N6QA 1VSDA 4DF8A 1T8EA 5AZJB 3WNFA 3THWA 3THVA 1JLCA 2D4WA 4CHYA 3J7YP 4F9OA 3KZBA 1HNXK 3RMCA 1XWLA 1YITN 3N4QA 2HBLA 4FLZA 4Y1CA 5GIOA 3AAPA 4KREA 1U2VB 3H1VX 1TKTA 2E2PA 1BO5O 5FRNA 1HNZK 4R5PA 4BWJA 3MXMA 3JS6A 3AVHA 1C1CA
chains in the Genus database with same CATH topology
4CZMA 1NMDA 3DXKA 1QHAA 1K8AO 2CGKA 4FWQA 2D0PA 2EWSA 3WQTA 4BGAA 4DB3A 1NLVA 4YORA 2WBNA 5JVHL 2F9TA 3VEXA 5F1XA 4CZJA 3TTCA 2CH5A 4YDUA 1S72N 2V7ZA 3QICA 3LDLA 3TSUA 2KHOA 4BG8A 3MN9A 4BG9A 1Q82O 4H5NA 5AQKA 5C12A 2BTFA 5JLHA 3MCAB 1Q81O 2FSKA 3CPEA 5AQPA 3QB0A 2QWOA 4BQLA 4EAHD 1ATNA 4WFNL 1MWMA 2NRTA 2VWBA 2ZGYA 1YF5L 3E9PA 2Q2RA 3VF4A 3CIPA 5AQWA 3WXIA 2P9LA 4NO7A 1X3NA 3LM9A 3P31A 2GWJA 3CCSN 5JMVA 2FXUA 4EIAA 1D4XA 4KH6A 2PAVA 4YOTA 2QWRA 1HKBA 4BRDA 4CD1A 3CF5L 3GOIA 3DLLL 3CC2N 1QVFM 4M63C 3LL3A 5E84A 2HF4A 3CJ7A 1VQNN 3SAGA 4BC5A 4PKIA 2E1YA 4BRLA 4XH1A 2YX6A 3A0IX 3BUZB 3C0BA 4FO0A 1BDGA 2NRRA 4JKCA 1NGDA 3HOTA 1V4TA 4BRNA 2A6AA 2GWKA 2NRZA 3ZETA 1K9MO 4WFBL 1K8KB 2NRXA 3IFRA 4QS8A 4WF9L 3CCUN 4G9ZA 1RFQA 4C1NK 1VAZA 3AGRA 3IMXA 4HTLA 2DPNA 3AY9A 1GLEG 4K41A 3G71N 3Q7CA 2OTLN 3QBWA 2NNWA 3L6QA 4JK9A 3R1XA 3O80A 4CZHA 3VF2A 5I9EB 1E4GT 2GTDA 4JKGB 4BR5A 5GIPA 1YJ9N 3BF3A 1Q86O 4WQ5A 4CBUA 3F9MA 3FGUA 3T69A 3DXMA 3KVGA 3O08A 2E2NA 2P9NA 2YCHA 4GY2B 4IEIA 1DT9A 3FZLA 4B1ZA 4C23A 4EFHA 3L4IA 4H0PA 3FZKA 1BUPA 2A41A 1QZ5A 3G25A 5CR4A 5AQOA 3VMFB 1VQ8N 5KQDA 1Q18A 4GV3A 3GG4A 3ZETB 3R6MA 5F2RA 4BC4A 3J7ZO 1YVNA 1DKGD 4A2BA 2E88A 1N8RO 5M1FA 5AQJA 3PLAA 3CCVN 2I7NA 1T44A 2F7TA 3CC4N 1ILYA 1ZBSA 3WXJA 5F0XA 1HKGA 4K42A 4RTFD 2WUSA 1T6DA 2P9IB 4AM7A 4BRHA 5GAHP 1TUUA 3SK3A 3EKUA 1NGFA 3IDHA 3M3ZA 4B1UB 4GV6A 2HSTA 3VEZA 3MX5A 5CE3A 3WUHA 4GVEA 5AQQA 3H1QA 3F5TA 1R59O 1W2BM 4FWLA 1XQSC 3EE9A 3MCPA 3DWLA 3D2FA 2E8AA 4IJNA 1ESVA 5C10A 4IDHA 2W40A 4IFEA 1BG3A 4FWNA 5JVGL 3R3LA 5C2DA 5BRFA 5AFUH 4BR7A 2Q0RA 4CI6A 1Z05A 4OO1J 1SQKA 3EO3A 4H0XB 3K9KA 2NLXA 1KQSM 4YOWA 3O4WA 2E2OA 1GLFO 4FVUA 3ZEUB 2IVPA 4XEIA 2GUPA 2QXLA 2ZGZA 4GNIA 3MX2A 5DM6L 3I55N 2WC9A 4XH5A 3EN9A 3VEWA 4B1XB 1LCUA 5ELZA 1RGIA 2V51B 3D2FB 3MDQA 3OBWA 3VEVA 2ZJQL 3CJAA 5HL7L 3SBTA 1C0FA 5M1KA 3CI5A 1YJNN 2YI1A 3ID8A 3D2EA 2A42A 1GLLO 1ZXOA 2FF3B 2VCPA 4H0OA 1KAXA 3HSCA 1DGKN 5AZIB 3VTHA 4WFAL 4B1VA 4H0TB 4WQ5C 3ZYYX 3GDQA 4CZLA 5GAGP 4MLEA 3LM2A 2YHWA 4JKAA 3HOSA 1ATSA 2CGJA 1NBWA 3O9QA 3O1BA 3LDPA 4PL7A 4C1NI 4IO8A 3CCQN 3MWPA 3J8AA 1VQMN 5AQGA 5AFUA 4H0YB 1VQ4N 3HI0A 1KAYA 3EKSA 3L4QA 3QBXA 4BGBA 3FZFA 2QWMA 3U9ZA 1JCEA 5LJVA 3CQYA 5EOYA 1NM1A 3ATUA 3SLCA 3SMPA 5FPNA 3DXKB 2D0OA 1V4SA 4OPAA 3WQUA 1EO1A 3A5MC 3P38A 4A59A 4A5BA 4FSVA 5B8HA 5KQ8A 4LC9B 1T6CA 1HKCA 1MDUB 3NMUA 3MK6A 4UY8O 4Y0WA 4ILJA 2YJEA 3DJCA 3HM8A 4JEPA 5AQNA 2KKZA 3FZHA 4WQ4A 3U9DA 4A57A 1Y64A 3O9TA 1NGEA 1GLAG 3MN5A 1VQ5N 3TTDA 1YI2N 4FWPA 3CMEN 3CCMN 5EX5A 3CCLN 5AQRA 3O6WA 4EHTA 3VF6A 3KWIA 3LDNA 1QVGM 4JK8A 3GE1A 2KLAA 2PBDA 3U4LA 1NGJA 2BH1A 3HBTA 1QQMA 3WXLA 2P9LB 1S22A 1WOQA 4CBXA 2QI2A 3C6AA 2QM1A 2YHXA 4IOCL 5DM7L 4MLHA 2HBMA 3FLCO 4FWMA 1BA1A 4ISGA 4BVOA 5FPDA 1GLCG 3D6RA 3QMLA 2ZJRL 1HUXA 3PIPL 3WT0A 1EQYA 3D7EO 2BUPA 2P9KA 2YJFA 3CXCM 4O8KA 4KH5A 4DQ8A 2VYPA 2NRWA 4BC3A 3VGKA 3JXUA 4H5VA 2P9PA 4NB4A 4IWVA 2OTJN 4ILGB 2QTDA 5BPLA 2A5XA 2GELA 2HOEA 3HRGA 3A5LC 5JICA 1OKJA 5GINA 2CH6A 3VGLA 4YDUC 1K73O 2P9UA 1NGHA 3ZX2A 3GBTA 3MN7A 4U67L 3KWGA 1YXQA 4WYBA 5BR9A 4H5RA 5AQSA 1HJOA 3GL1A 5ADXA 2NRHA 4QS7A 2F9WA 3QFUA 2P9KB 5KPTA 2IVNA 3RVCA 3VERA 5LY3A 3DXMB 1G99A 3MMVA 5BPNA 2P9NB 1QQOA 4H03B 5AQUA 4I6MA 1GLBG 1W97L 3UKUA 1NGBA 2P9PB 3L0QA 4BRGA 3I33A 3WXKA 1YJWN 5AQVA 1VQON 3M6GA 3R9PA 4BROA 2D1KA 1DEJA 4BR2A 3A8YA 5AQIA 2P9UB 3ULEA 5AQLA 4PL8A 1M90O 3SJHA 2IVOA 4JKFA 3B8AX 3VESA 4AM6A 1WUAA 3KK7A 2GEMA 4KH4A 2HF3A 4A62A 2ASOA 2IIRA 3LDQA 5EY4A 3U8XA 1VQLN 1IG8A 4FPAA 3WEEA 4BRQA 3OHRA 3QDKA 2JWLA 4IO9L 1YAGA 3KHYA 4BR9A 1OVYA 4JHDA 1VQ9N 4A5AA 3O9RA 4BQZA 3AGKA 3ENHA 4BREA 2ASPA 5GAEP 3TSPA 4BRCA 5M1NA 3VOVA 1BWFO 2QEXN 2AP1A 1TUYA 3ULEB 2P9SA 3O9SA 3K9JA 3VTIA 1JJ2M 2VGNA 1U6ZA 4BC2A 1LOTB 2QW9A 5AQMA 4MO4A 3E1YA 4BRMA 4BRPA 1S3XA 1TYQA 3QFPA 1NGCA 2PFUA 3IUCA 3W3DA 1GLJO 2OANA 4FOEA 3WEEB 5C0YA 2ZJPL 5AQFA 4Z94A 4M7XA 3ZX0A 4BY9C 1NGIA 1KD1O 3T7ZA 4H0VB 4B9QA 1SAZA 2FLOA 1RDUA 4R79A 5JLFA 4IJAA 5E26A 3I56N 3CJBA 3ENOA 3VGMA 3D2EB 2AA4A 5BRDA 2QWPA 5EVZA 2A3ZA 4JD2A 2P9SB 4DKWA 4YOVA 4CZEA 3R8EA 2Q1NA 4MDBA 4A2AA 3CC7N 1JCGA 3OBYA 3M5RA 4IOXA 1TYQB 5EXWA 4B1YB 4FWSA 4CBWA 5KPRA 4GV9A 5TKYA 3MN6A 1VQPN 1VQKN 5H1SQ 3O9UA 4FPBA 4ISEA 4JKBA 3CETA 5CHIA 5AQZA 5BN9A 4DHYA 5BREA 3CMAN 5KPZA 4BRIA 2CGLA 3IKMA 2ZF5O 4MO5A 1C0GA 1MWKA 2NZTA 3FFKB 1P8ZA 3BEXA 4JD2B 1MA9B 3S41A 5ADXH 1E4FT 3FE1A 4L3QA 4MDAA 4DCHA 5C15A 4IEEA 1XUPO 2FSNA 4O8UA 3ZX3A 4CZGA 5GADP 1K8KA 3PIOL 2A40A 3ATVA 3O8MA 3EZWA 1IJJA 1SS6A 2QA4N 2Q0UA 3M1FA 5TKWA 3CD6N 4FWOA 1H1VA 3UE5A 4BRKA 4FOIA 2FSJA 3CCJN 1YIJN 3AARA 3SMSA 4YOXA 3E9OA 4JKGA 4JKEA 2VGMA 3G6EN 2QWLA 3N4PA 3EL2A 1NGAA 3TSQA 3TTFA 1X9JA 3C7NA 3HTVA 3FZMA 4FWRA 4K43A 3C6HA 3VENA 4B1WB 2I7PA 4J8FA 4K25A 3VEYA 4CJ7A 2E1ZA 2RHKA 1QQNA 1KAZA 3A5OC 2J4RA 2FF6A 2WFBA 3DAWA 3FR0A 1BA0A 1NWKA 3AAQA 3CERA 3CPWM 3OA9A 4YOYA 5BN8A 3H3OB 4BRFA 3TPQA 1HPMA 4HWIA 1YHQN 2P9IA 4FWKA 3W0LA 1XC3A 5AQHA 4E1JA 5AQXA 2Q97A 3MWTA 4CZFA 3CJ9A 5HOOA 3C7NB 2V7YA 4BR0A 5LJWA 2HMPA 1Q7YO 1ATRA 4ILHA 5M1OA 1NGGA 3VEOA 2Q36A 3A5NC 3F2KA 3I8BA 3H3NO 5FPEA 1ZC6A 2QWNA 4BRAA 1RDWX 2H3GX 3EE8A 4NLBA 1QZ6A 3UB5A 2UYTA 4AF1A 4OPHA 4IZ9A 1HX1A 1YUWA 4JK7A 4O5FA 3CCEN 1KXPA 1O13A 3VETA 3RSEA 1KC8O 2V52B 4WQ4C 1JCFA 1T3VA 5AZJA 3E9LA 3TU5A 5FPMA 4CD3A 3O1WA 5C2FA 1BOTO 3CJCA 3Q7BA 3WXMB 4A61A 5AQYA 4CZIA 4PHTX 2QWQA 1VQ7N 3ZEUA 4RCHA 1M1KO 5AQTA 4ISFA 4H5WA 3ID6A 1P90A 1SZ2A 2GX9A 4JNEA 2W41A 4KBOA 5BPMA 3SAFA 3OW2M 2E2QA 3HZ6A 5AR0A 1GLDG 4I6MB 4NLCA 2YHYA 4PKGA 3UKUB 5BRHA 3H45C 1VQ6N 3P39A 2E20A 3CCRN 1Z6RA 3NVMA 4EHUA 4JKHA 2RE2A 4CZKA 1U2VA 1NJIO 3H6EA 4JAXA 4BVPA 4IXCA 4PKHA 4U7BA 3G4SN 5MLCQ 5M1PA 3RSEB 2ITMA 5AZIA 3SAHA 4YOUA 3C65A 5AZJB 5M1QA 3BP8A 3UKRA 2D4WA 4F9OA 3BF1A 2ZWHA 3KZBA 3SBGA 4BR4A 3NVKA 3CQXA 4XH4A 1BU6O 1YITN 3N4QA 2HBLA 4JN4A 4RWTA 2Q31A 4FL9A 3O5BA 4JHDB 3ENBA 2HBKA 5GIOA 1CZAN 3AAPA 3P4IA 1U2VB 3H1VX 2E2PA 1X3MA 3H46O 4M7YA 1J6ZA 1BO5O 2HBJA 2NRVA 4QS9A 3VPZA 2JWKA 4IOAL 4WCEL 2ASMA 3CJ1A 3JS6A 3E66A 3CHWA 1HLUA 3UKRB 4H5TA 3LDOA 4JKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T69 A;  3R1X A; 
#chains in the Genus database with same CATH topology
 3DXK A;  1K8A O;  4QCL A;  2CGK A;  3C6U A;  4DB3 A;  4BGA A;  3U3G A;  2UXD K;  2OA8 A;  1QSS A;  4CZJ A;  4NYN A;  3VQC A;  2IOC A;  3HT3 A;  4YDU A;  4FJ7 A;  3TSU A;  2KHO A;  1NJX A;  5AQK A;  5C12 A;  5JLH A;  2BTF A;  1Q81 O;  3CPE A;  4BQL A;  2RPI A;  4IFV A;  1EWQ A;  1ATN A;  1FW6 A;  4O5B A;  4Q5V A;  3E9P A;  3O3G A;  4M45 A;  2P9L A;  3S3M A;  1X3N A;  2D0B A;  2IDO A;  3WNE A;  3U6F A;  4O4G A;  2PAV A;  2QWR A;  4CJU A;  4BRD A;  3CF5 L;  3DLL L;  3CC2 N;  1QVF M;  4M63 C;  5E84 A;  2HF4 A;  5SWM A;  3SAG A;  2KFZ A;  4BRL A;  1LWF A;  2X74 A;  2YX6 A;  3BUZ B;  4JKC A;  3ZET A;  1KVB A;  2DY4 A;  4G9Z A;  1RFQ A;  1VAZ A;  3D45 A;  3AGR A;  2XHB A;  3PV8 A;  2DPN A;  3ZT4 A;  3G71 N;  3OYM A;  4CZH A;  4I9L A;  3VF2 A;  1E4G T;  4E19 A;  4JKG B;  1KTQ A;  2FC0 A;  3F9M A;  3ZSZ A;  1YVU A;  3I8D A;  1FXX A;  3EZ5 A;  2E2N A;  2YCH A;  3V81 A;  4C23 A;  4H0P A;  5CR4 A;  5AQO A;  5KQD A;  3L2V A;  1A5X A;  1RT5 A;  1WAJ A;  1HNV A;  1N8R O;  3EEQ A;  2UU9 K;  1Q8I A;  3PLA A;  2HVH A;  1LW0 A;  3SQ0 A;  1TKD A;  3WXJ A;  5F0X A;  1HKG A;  3LZI A;  1TUU A;  4GV6 A;  1LWC A;  1N34 K;  4FZY A;  3CFP A;  3ZT2 A;  3DWL A;  4JI4 K;  4CEA A;  1TK8 A;  4CK1 A;  4IJN A;  2ATQ A;  1ESV A;  3OYN A;  1U04 A;  2Q0R A;  4CI6 A;  3OYE A;  4XEI A;  2QXL A;  3PY8 A;  2ZD1 A;  1C0T A;  1Z25 A;  3MX2 A;  4GNI A;  4Y1D A;  5BR8 K;  4JI6 K;  3I55 N;  4XH5 A;  4DTR A;  1S1X A;  4FM0 A;  1X9M A;  4B1X B;  1TAQ A;  4CW7 B;  2V51 B;  2ZJQ L;  3CJA A;  3OYG A;  4NCA A;  3ID8 A;  4O0I A;  3KLH A;  2VCP A;  1RT3 A;  1GOC A;  3HSC A;  2Y1J A;  4B1V A;  4N47 A;  4H8K A;  3ZYY X;  3THW B;  4BDZ A;  1SV5 A;  2R7Y A;  2YHW A;  4FLV A;  2HHT A;  4JKA A;  3HOS A;  3OYH A;  4CHQ A;  4PL7 A;  4DTN A;  3MWP A;  4DFP A;  1VQM N;  2WOM A;  4FZX C;  4ELV A;  3OVN A;  2PZS A;  1C1A A;  4KHN A;  3U9Z A;  2UUC K;  4E7L A;  3DXK B;  2D0O A;  4CJT A;  3BZC A;  3K0S A;  4J2B A;  1RBT A;  5KQ8 A;  4AH9 A;  4LC9 B;  1T6C A;  3LAM A;  1NG9 A;  3MXI A;  1HKC A;  3AVK A;  2XY7 A;  4UY8 O;  2E6L A;  3UIQ A;  4OPJ A;  1R0A A;  2KKZ A;  4IG0 A;  4WQ4 A;  3U9D A;  3OY9 A;  1VQ5 N;  3D0P A;  3TTD A;  3SJJ A;  3CME N;  3CCM N;  4M3U A;  4B8A B;  3V6D A;  1TL3 A;  3LDN A;  2HW3 A;  4YHH K;  2OPQ A;  1VHX A;  1RNH A;  2BH1 A;  1QQM A;  1ZBU A;  2P9L B;  5I3U A;  2YHB A;  2Z1I A;  1W7A A;  1L3T A;  2QM1 A;  3E01 A;  3LP0 A;  4JI8 K;  5DM7 L;  1IKX A;  2DFF A;  5CZ1 A;  1VSF A;  5FPD A;  3K58 A;  4JYA K;  3D6R A;  1RT6 A;  3D7E O;  2BUP A;  4MFB A;  1BIU A;  4DMN A;  2YJF A;  4GW6 A;  1IV0 A;  2GBZ A;  3DRS A;  4H5V A;  2YNI A;  1REV A;  3SQ4 A;  2CH6 A;  3VQA A;  3QIO A;  2AJQ A;  3BDP A;  1RIL A;  1I3A A;  4WYB A;  1IH7 A;  4H5R A;  5AQS A;  3GL1 A;  3SPZ A;  4QS7 A;  3QFU A;  2P9K B;  5LY3 A;  1NK6 A;  2OYQ A;  1G99 A;  3LP3 A;  4H03 B;  1GLB G;  3PX6 A;  4BRG A;  1ASW A;  4DU3 A;  2ZM6 K;  1YJW N;  4AHS A;  3AVN A;  4I9Q A;  3DYA A;  1TL1 A;  4DQR A;  4GMJ B;  5J2P A;  1NKC A;  5AQL A;  4PL8 A;  3AA3 A;  3B8A X;  4HHT A;  4KH4 A;  4A62 A;  2IIR A;  4CIF A;  4K0K K;  4E3S A;  4KHW A;  4JI2 K;  2QKK A;  1WN7 A;  2X6N A;  4FW1 A;  1VQ9 N;  4JHD A;  3OTO K;  3HVR A;  5I42 A;  3ENH A;  4HUF A;  5GAE P;  4BRC A;  5M1N A;  3VOV A;  4DSJ A;  5DK5 A;  3PO5 A;  2QEX N;  4RW7 A;  4CFD A;  4O44 A;  2HMI A;  4JI0 K;  3K9J A;  2QW9 A;  4CEC A;  3QFP A;  2PFU A;  1QTM A;  3AA5 X;  3W3D A;  5J1E A;  2G8W A;  4FOE A;  3WEE B;  3HVT A;  3V9Z A;  1S5J A;  4FLW A;  4HCC A;  1KD1 O;  4JV5 K;  4R79 A;  5JLF A;  4OGC A;  2IC3 A;  3CJB A;  1UAX A;  3NF7 A;  3VGM A;  2AA4 A;  1SKR A;  2Q1N A;  4A2A A;  3K5L A;  2I5J A;  1J5E K;  4AQY K;  5EXW A;  1L3S A;  4CBW A;  3DLH A;  1DTT A;  2F96 A;  4LF6 K;  5H1S Q;  4FPB A;  3CET A;  5BRE A;  3KLE A;  1SL1 A;  4DV4 K;  4W5T A;  1MU2 A;  5FRM A;  4MO5 A;  3HPO A;  2YKM A;  3TAR A;  3NGZ A;  1EKE A;  3FFK B;  3BEX A;  3S41 A;  5A2Q O;  1T7P A;  3FE1 A;  4L3Q A;  2UUB K;  1RT2 A;  2FSN A;  4O8U A;  2P5O A;  1VSM A;  4PA1 A;  3OS1 A;  1FJG K;  3ATV A;  2W6K A;  4CGD A;  1L3U A;  2QA4 N;  1SS6 A;  5TKW A;  3H08 A;  4FWO A;  4BRK A;  5J2M A;  4PUO A;  1YIJ N;  3TWH A;  4DR4 K;  3E9O A;  3G6E N;  2VGM A;  3N4P A;  3EL2 A;  1U47 A;  4CFB A;  3VEN A;  2FBY A;  3DLR A;  3SUP A;  4CJ7 A;  2E1Z A;  3C94 A;  4IFY A;  4DV5 K;  2DFH A;  3NFA A;  2J4R A;  5C25 A;  4LSL A;  1NWK A;  3AAQ A;  3CPW M;  3H3O B;  4KB1 A;  1HPM A;  4LF9 K;  1YHQ N;  3PSF A;  4FWK A;  3SV4 A;  3AVM A;  3CJ9 A;  5HOO A;  2V7Y A;  1Q7Y O;  1ATR A;  1TK5 A;  3CFR A;  2Q36 A;  1WLJ A;  3I8B A;  1ZC6 A;  2H3G X;  3EE8 A;  3UB5 A;  3OYJ A;  4IZ9 A;  4O5F A;  1WAF A;  1O13 A;  3SI6 A;  1JCF A;  1T3V A;  5AZJ A;  1BOT O;  3CJC A;  1VQ7 N;  5C24 A;  4CZI A;  3NH1 A;  4JRQ A;  4CJP A;  1U48 A;  4LF7 K;  3NHG A;  1P90 A;  2GX9 A;  3BZK A;  2W41 A;  4JNE A;  4KBO A;  3SAF A;  3OW2 M;  1RDC A;  3K59 A;  4PKG A;  3F73 A;  3H45 C;  3P39 A;  4KV8 A;  1Z6R A;  3RMB A;  4JKH A;  4N56 A;  4CZK A;  1U2V A;  4DUY K;  4DWI A;  2KZZ A;  4IXC A;  3MEG A;  3G4S N;  3ZSY A;  3SNN A;  3SAH A;  4YOU A;  3C65 A;  3ZLJ A;  3BP8 A;  3V4I A;  3PX4 A;  1KVC A;  1RDD A;  4JN4 A;  4NCB A;  3DOL A;  3O5B A;  1LAV A;  4JHD B;  4AHT A;  1IBK K;  2HND A;  2PYJ A;  2DTU A;  1JLA A;  1X3M A;  4M7Y A;  3VA0 A;  4DV0 K;  4C8L A;  5D3G A;  4IOA L;  2ASM A;  3CHW A;  1HLU A;  4CZM A;  1NMD A;  4DFK A;  3PSI A;  4FWQ A;  4ELU A;  2D0P A;  3LP1 A;  4M41 A;  4OLB A;  3M8P A;  4DS5 A;  1TV6 A;  3FFI A;  2CH5 A;  3QIC A;  1HNW K;  5HRO A;  4BG8 A;  1RT4 A;  3J80 O;  2FSK A;  5AQP A;  4DF4 A;  4B3R K;  2QK9 A;  4C8M A;  4YNQ A;  4DV7 K;  1G15 A;  3WXI A;  3LZJ A;  3LM9 A;  3K2P A;  4EIA A;  4YOT A;  1TGO A;  1BQM A;  4W5R A;  1FK9 A;  1RDB A;  3PX0 A;  3LL3 A;  3CJ7 A;  2G8H A;  3O3H A;  3AVL A;  4JRP A;  4LSN A;  5AJ3 K;  1BDG A;  2NRR A;  1JL1 A;  4LF8 K;  3HOT A;  4BRN A;  4J2A A;  1U49 A;  2NRZ A;  3IFR A;  4QS8 A;  4DQI A;  4BE2 A;  3M8R A;  3AY9 A;  4K41 A;  3Q7C A;  2XRI A;  4N76 A;  1GOB A;  3QBW A;  4CER A;  1GOA A;  3ZT1 A;  3L6Q A;  4JK9 A;  3O80 A;  2GTD A;  1YJ9 N;  2E6M A;  3BF3 A;  4CBU A;  3KVG A;  3TAQ A;  3O08 A;  1KFD A;  3MXJ A;  1N5Y A;  3VMF B;  3AO4 A;  2A41 A;  3FZK A;  3G25 A;  3OS0 A;  1NK7 A;  3VQ4 A;  3GG4 A;  4GV3 A;  3R6M A;  1KLM A;  1DKG D;  4AHC A;  5SZT A;  3CCV N;  1QE1 A;  2D0C A;  4M3R A;  1ZBS A;  3KLG A;  4C8K A;  4KB0 A;  4E7H A;  4AM7 A;  4BRH A;  2GUI A;  3EKU A;  3TAB A;  3IDH A;  5CE3 A;  4GVE A;  3LAL A;  1BGX T;  4BWM A;  1W2B M;  4UQG A;  1XQS C;  1BQN A;  4AHR A;  2E8A A;  4IDH A;  1L3V A;  1A5W A;  3K5M A;  3KK3 A;  5BRF A;  4BR7 A;  4JI5 K;  3KLF A;  4H0X B;  1LWE A;  2NLX A;  1RBV A;  2E2O A;  4FVU A;  3T1Y K;  2GUP A;  1HYZ A;  4CJE A;  3VEW A;  1W0H A;  4HUG A;  5ELZ A;  1RGI A;  3D2F B;  4B3S K;  3QLH A;  1YJN N;  3ZSQ A;  3THY A;  2YI1 A;  3QEP A;  1XI1 A;  3J7A P;  2BE2 A;  1GLL O;  2FF3 B;  1WSJ A;  4N41 A;  1DGK N;  3VTH A;  4H0T B;  3V1R A;  4B9U A;  3GDQ A;  4CZL A;  1VSH A;  5J2Q A;  3O9Q A;  4KHU A;  3V9U A;  3NCI A;  2O8C A;  4IO8 A;  3V1O A;  3J8A A;  4F8R A;  1HR0 K;  1KAY A;  3QBX A;  3FZF A;  3NH0 A;  2QWM A;  3DLE A;  1JCE A;  5LJV A;  1JXE A;  5EOY A;  2D0A A;  4FM2 A;  1NM1 A;  3ATU A;  1RBS A;  2VG7 A;  3SLC A;  5FPN A;  2UXB K;  3WQU A;  2KZM A;  3A5M C;  3P38 A;  4A59 A;  3VQ6 A;  5FLX O;  5B8H A;  5CYM A;  3MK6 A;  4Y0W A;  1RBR A;  5AQN A;  3DJC A;  1WSG A;  5HRP A;  1GLA G;  3MN5 A;  3OJS A;  1IBL K;  4CGI A;  1CXU A;  4H4O A;  3O6W A;  1QVG M;  3LAN A;  4CIG A;  2KLA A;  4DQP A;  2PBD A;  1NGJ A;  3KK2 A;  3HBT A;  4Z4H A;  4DLE A;  1UOC A;  5HP1 A;  2ITG A;  3AO5 A;  2YHX A;  3KIO A;  4IOC L;  2HBM A;  1BA1 A;  1X1P A;  4BVO A;  4CED A;  4CJK A;  2QKB A;  4DG1 A;  3MEC A;  2P9K A;  3CXC M;  2KQ2 A;  2VYP A;  4LD0 A;  4BC3 A;  5FDL A;  3VGK A;  1XHX A;  4JI3 K;  2OTJ N;  5BPL A;  2A5X A;  4KFB A;  4FJ8 A;  5CY4 A;  3A5L C;  5JIC A;  1OKJ A;  1ZBH A;  1S9G A;  4YDU C;  3G10 A;  1K73 O;  4U67 L;  3KWG A;  5BR9 A;  2ETJ A;  4WE1 A;  5KPT A;  3TAG A;  3S3N A;  3A2F A;  5BPN A;  3V9S A;  4LF4 K;  3O4Q A;  4I6M A;  1W97 L;  3I33 A;  3WXK A;  3ZSO A;  1OVQ A;  3M6G A;  4BRO A;  1DEJ A;  2P9U B;  3L2W A;  1NK0 A;  1M90 O;  3SJH A;  3OJU A;  1WUA A;  1KVA A;  2G8V A;  2ASO A;  3QIP A;  1JLQ A;  4FPA A;  3WEE A;  3OHR A;  1YAG A;  1OVY A;  3B6P A;  3RMD A;  1J54 A;  1TUY A;  4FVM A;  2QXF A;  3O9S A;  1JJ2 M;  3U3Y A;  4BC2 A;  1LOT B;  1SL2 A;  4W5O A;  4OKK A;  2ZJP L;  3HST B;  5AQF A;  4Z94 A;  3ZX0 A;  3AO2 A;  1NGI A;  3T7Z A;  4H0V B;  1JLB A;  1SAZ A;  1W9H A;  2FLO A;  3THY B;  2O8B B;  2E5L K;  5BRD A;  3HP6 A;  2A3Z A;  2P9S B;  4YOV A;  4CZE A;  4JI7 K;  1KLN A;  1ASU A;  4B1Y B;  2W6L A;  4FWS A;  1B9D A;  3MED A;  4EP4 A;  4ISE A;  4JKB A;  5AQZ A;  3CMA N;  2O8C B;  4DQQ A;  1QSY A;  1MWK A;  1IO2 A;  5ADX H;  3C6T A;  1RTD A;  4C8N A;  5C15 A;  1XUP O;  5GAD P;  1K8K A;  3O8M A;  1N32 K;  1HJR A;  1IJJ A;  3M1F A;  3CD6 N;  3VQB A;  4FOI A;  3SUN A;  4AHV A;  2OCE A;  2QWL A;  4N5S A;  1IKV A;  1X9J A;  1BIZ A;  3C6H A;  2F4V K;  4KTQ A;  4J8F A;  4K25 A;  4K8Z A;  4KHY A;  3HPH A;  1CZ9 A;  2P5G A;  2RHK A;  4FLU A;  1NOZ A;  1SL0 A;  3A5O C;  3AV9 A;  4H4M A;  4DR2 K;  2WFB A;  3DAW A;  1S1W A;  2EX3 A;  2XY8 A;  4OJR A;  1C0M A;  3TPQ A;  2YNG A;  5T7B A;  4TSX A;  3W0L A;  5AQX A;  3MWT A;  4CZF A;  3C7N B;  5LJW A;  4YFU A;  3EYZ A;  3DI6 A;  2PY5 A;  5M1O A;  3I0R A;  4FYD A;  1Y97 A;  4NLB A;  1QZ6 A;  3L8B A;  1NJZ A;  2BDP A;  1HX1 A;  3CCE N;  1C6V A;  2A1R A;  1KC8 O;  4WQ4 C;  5KGX A;  4E7I A;  4DTP A;  3M8Q A;  3S3O A;  5C2F A;  3AVF A;  4DUZ K;  3DMJ A;  5AQY A;  2QWQ A;  4RCH A;  4CEF A;  1M1K O;  4PQU A;  1SZ2 A;  4ZHR A;  2OPP A;  2UXC K;  4B9V A;  1GLD G;  4I6M B;  2YHY A;  5JS2 A;  1NJW A;  1VQ6 N;  5EU7 A;  3EY1 A;  3RRG A;  3HYF A;  5MLC Q;  5M1P A;  3CG7 A;  2ITM A;  2IS3 A;  3ISN C;  5AZI A;  4Z0U A;  5M1Q A;  4CE9 A;  4CF0 A;  1WBB A;  3BF1 A;  2ZWH A;  3SBG A;  2E4L A;  4BR4 A;  3NVK A;  1BU6 O;  4RWT A;  1WSH A;  2Q31 A;  4FL9 A;  2B5J A;  3ENB A;  2HBK A;  1RT7 A;  2VG6 A;  4DSF A;  1U45 A;  1J6Z A;  3M8S A;  1C0U A;  2X78 A;  4QS9 A;  3VPZ A;  4KI4 A;  3L2R A;  1IBM K;  1QSL A;  1WBD A;  3CJ1 A;  3AO1 A;  4W5N A;  2VG5 A;  1EET A;  3UKR B;  4JKD A;  3LP2 A;  4FZZ A;  3T3F A;  1QHA A;  4DTO A;  1NLV A;  4YOR A;  4FLY A;  4F4K A;  1JLG A;  5F1X A;  5DMR A;  3TTC A;  1B92 A;  4X64 K;  4IKF A;  4EZ6 A;  4KTW A;  4BG9 A;  1Q82 O;  4FM1 A;  4BE1 A;  3MCA B;  2KFN A;  1C1B A;  2VWB A;  2XO7 A;  1YF5 L;  2P51 A;  3CQ8 A;  3RWU A;  4OX9 K;  5AQW A;  4E89 A;  4NO7 A;  4OPK A;  1WSF A;  2GWJ A;  3CCS N;  1B9F A;  2PYL A;  4ID1 A;  1D4X A;  1BIS A;  1D8Y A;  4KO0 A;  4AIL C;  4JS4 A;  1VQN N;  4NXN K;  4PKI A;  3LWL A;  1RTI A;  4GVM A;  4DR5 K;  4CF2 A;  3TI0 A;  4PY5 A;  1RBU A;  4FJN A;  1NGD A;  5E41 A;  3QNO A;  2A6A A;  2Y1I A;  4J2D A;  3C95 A;  3CCU N;  1K8K B;  4WF9 L;  4F3T A;  4ID5 A;  1EP4 A;  3IMX A;  4HTL A;  1X9S A;  1GLE G;  2GV9 A;  3R1X A;  1VK0 A;  3HK2 A;  1Q86 O;  4KKO A;  3T69 A;  1U4B A;  3SYZ A;  1NU0 A;  2P9N A;  4GY2 B;  1DT9 A;  4B1Z A;  3L4I A;  1BUP A;  4J2E A;  1HPZ A;  1Q18 A;  3THX B;  2FBV A;  2VQE K;  3J81 O;  5F2R A;  2YNF A;  4BC4 A;  5CZ2 A;  1EXQ A;  4DTM A;  5AQJ A;  1S6Q A;  4B3M K;  2I7N A;  1T44 A;  2F7T A;  1BCO A;  4CJQ A;  4RTF D;  1T6D A;  3SK3 A;  4FLT A;  5HBM A;  1VSJ A;  3K57 A;  4B1U B;  4DSL A;  3MX5 A;  1N36 K;  3H1Q A;  4B9S A;  1EX4 A;  4FWL A;  1S1V A;  3EE9 A;  4RW9 A;  3D2F A;  4CGH A;  1Q9X A;  3AVB A;  3F9K A;  4JS5 A;  3AVJ A;  5C10 A;  3L3V A;  3OYA A;  1BG3 A;  4CHO A;  4FWN A;  3VQQ A;  5C2D A;  3NF9 A;  4M3Y A;  1Z05 A;  4JI1 K;  4DR3 K;  4YOW A;  3O4W A;  3VA3 A;  1GLF O;  2ZGZ A;  1HQE A;  3VQE A;  3JSM A;  2WC9 A;  3EN9 A;  1JKH A;  1LCU A;  3VEV A;  3MDQ A;  3OBW A;  4FXD A;  3RTV A;  4Q0B A;  5HL7 L;  1UWB A;  1C0F A;  5M1K A;  3CI5 A;  3D2E A;  1VSI A;  1ZXO A;  4H0O A;  1KAX A;  4X65 K;  5AZI B;  2YNH A;  5KRT A;  3DRP A;  4HUE A;  4MLE A;  3ALY A;  3NDK A;  1ATS A;  3O1B A;  1RDA A;  1IG9 A;  3ULD A;  4C1N I;  1SUQ A;  4OKJ A;  1S9E A;  4CK2 A;  3CCQ N;  2O8D A;  5AQG A;  5AFU A;  1VQ4 N;  4E0D A;  3HI0 A;  3QNN A;  4FJI A;  1S1T A;  1ZBI A;  4BGB A;  3OYL A;  2Z1H A;  4FJK A;  3TAN A;  3SMP A;  4V19 S;  4OPA A;  4I2Q A;  4E1N A;  4I2P A;  4CHZ A;  4B3O A;  1EO1 A;  4FSV A;  3PUF A;  3CM5 A;  3QET A;  4ILJ A;  3HM8 A;  1X9W A;  2F8T A;  4A57 A;  4FJX A;  3O9T A;  1NGE A;  1ZYQ A;  1YI2 N;  5EX5 A;  3L3U A;  4EHT A;  1E3M A;  3IRX A;  1XC9 A;  1Z26 A;  4M3T A;  3AO3 A;  3WXL A;  3OYK A;  4DFM A;  1O1W A;  4CBX A;  5IWA K;  4IDK A;  1NK9 A;  2HHQ A;  3FLC O;  4FWM A;  4ISG A;  1HUX A;  1CXQ A;  3WT0 A;  3PIP L;  2HHW A;  4CIE A;  4DQ8 A;  4KTZ A;  3G0Z A;  4B3T K;  3JXU A;  4IWV A;  2QTD A;  1KSP A;  1YT3 A;  2GEL A;  4DR6 K;  4KRF A;  4DS4 A;  3T19 A;  5GIN A;  2P9U A;  3L2Q A;  3ZX2 A;  3GBT A;  1BHL A;  1YXQ A;  1JL2 A;  3SQ1 A;  2IVN A;  3RVC A;  4BE0 A;  4Z4G A;  2B6A A;  3MMV A;  2P9N B;  1QQO A;  4PWD A;  5HRS A;  2O4G A;  3UKU A;  1NGB A;  1VSE A;  2P9P B;  2WON A;  1VQO N;  3R9P A;  2D1K A;  3DLB A;  5AQI A;  1OH8 A;  2HHV A;  2RN2 A;  1IKW A;  3OYD A;  1SKS A;  2IVO A;  4JKF A;  3VES A;  4AM6 A;  4MQ3 A;  3LDQ A;  3U8X A;  1ASV A;  1IG8 A;  4DU4 A;  4BRQ A;  2X6S A;  4IO9 L;  4BR9 A;  1RTJ A;  1ZBF A;  3O9R A;  3AGK A;  4OVL A;  2YV0 X;  1BWF O;  2O8B A;  4HVJ A;  1XNR K;  3HP9 A;  1WSI A;  2AP1 A;  3ULE B;  1J5O A;  2P9S A;  3VTI A;  1U6Z A;  4L8R B;  5AQM A;  4BRM A;  3E1Y A;  5HRN A;  4BRP A;  4DSE A;  4B8C A;  1GLJ O;  2OAN A;  2HHX A;  4CFA A;  1D5A A;  4M7X A;  3SQ2 A;  4BY9 C;  4B9Q A;  4Z4F A;  1RDU A;  2ZQB A;  1KCF A;  3QIN A;  3ENO A;  3P1G A;  3D2E B;  1NNE A;  5EVZ A;  1BI4 A;  1XHZ A;  1ITG A;  1NOY A;  4DKW A;  3R8E A;  4MDB A;  3HPG A;  4IOX A;  1TYQ B;  2YKN A;  2BGG A;  2O4I A;  1J9A A;  4CF8 A;  4RW4 A;  3QEW A;  3O9U A;  1F21 A;  4CF1 A;  3DM2 A;  4DHY A;  4CHP A;  1S1U A;  5KTQ A;  5KPZ A;  2O8D B;  4BRI A;  2Z1G A;  3IKM A;  4YY3 K;  2NZT A;  2YHA A;  1P8Z A;  3ZSV A;  4JD2 B;  4NYF A;  1E4F T;  4MDA A;  3P83 D;  1T03 A;  4IEE A;  3ZX3 A;  3PIO L;  3ZCM A;  2A40 A;  4KHS A;  4EZ9 A;  5KGW A;  2HHU A;  2Q0U A;  4B9M A;  2FSJ A;  1T05 A;  3AAR A;  3SMS A;  3TAE A;  4JKE A;  4FCY A;  3OYF A;  3O3F A;  2KTQ A;  1HNI A;  1NGA A;  1TK0 A;  3TSQ A;  3TTF A;  3C7N A;  2HVI A;  4B1W B;  1YTA A;  3FZM A;  4FW2 A;  4K43 A;  4DU1 A;  1NKE A;  3HO1 A;  1S6P A;  5LMN K;  2RKI A;  1HRH A;  1QQN A;  1WSE A;  1NK4 A;  1KAZ A;  1I94 K;  4O55 A;  2FF6 A;  3NF8 A;  4NCG A;  3IAY A;  3CER A;  4FJ9 A;  4YOY A;  4HWI A;  2P9I A;  2Q97 A;  4LFB K;  3QER A;  2HMP A;  3ZSW A;  5JS1 A;  4DSK A;  1NGG A;  4E7J A;  3KLI A;  3A5N C;  4B9T A;  4KPY A;  2F8S A;  5FPE A;  2QWN A;  1RDW X;  1OH6 A;  2UYT A;  4AF1 A;  1NJY A;  4JK7 A;  4FLX A;  3VET A;  4DTS A;  3LWM A;  3E9L A;  3MEE A;  5FPM A;  3TU5 A;  3O1W A;  2Z1J A;  3WXM B;  4A61 A;  4CD3 A;  4PHT X;  1S72 N;  3NMU A;  3ZEU A;  3TR8 A;  5AQT A;  4ISF A;  4H5W A;  4NXM K;  5BPM A;  2XY5 A;  4X62 K;  2E2Q A;  4NLC A;  3UKU B;  4CJV A;  3P5J A;  3CCR N;  3NVM A;  4EHU A;  1YTU A;  3H6E A;  4BVP A;  4PKH A;  4F3O A;  2OZM A;  2BAN A;  1KFS A;  3RSE B;  4CJL A;  3UKR A;  5K14 A;  5C42 A;  3MAQ A;  4BDP A;  4CVN E;  3RMA A;  3CQX A;  4XH4 A;  1A5V A;  2KW4 A;  1CZA N;  3P4I A;  4CGG A;  3LDS A;  3H46 O;  2HBJ A;  2NRV A;  2JWK A;  4WCE L;  1VSL A;  5LL6 Z;  3E66 A;  4H5T A;  3LDO A;  4DQS A;  4IBN A;  3AA2 A;  3NGI A;  3WQT A;  2EWS A;  1BL3 A;  3S9H A;  1D9D A;  2WBN A;  5JVH L;  2F9T A;  3VEX A;  3QEX A;  1LW2 A;  2V7Z A;  1L5U A;  1DLO A;  4CGJ A;  3LDL A;  3MN9 A;  5IT9 O;  4H5N A;  4B9N A;  4EAH D;  4WFN L;  3V9X A;  1BI4 B;  2QWO A;  3QB0 A;  3WNH A;  1MWM A;  2NRT A;  4ZTF A;  4M3X A;  4GKJ K;  3B6O A;  2ZGY A;  3DOK A;  2Q2R A;  3ASM A;  3DLK A;  3VF4 A;  3CIP A;  4CJF A;  4O0J A;  3P31 A;  4KAZ A;  4CEE A;  2FXU A;  5JMV A;  4KH6 A;  3ZT3 A;  2P1J A;  1HKB A;  4CD1 A;  3KD5 E;  3GOI A;  1QQC A;  4BC5 A;  2O8E A;  2E1Y A;  4XH1 A;  4LY7 A;  3QES A;  3A0I X;  4FJM A;  3I0S A;  4LF5 K;  3C0B A;  4FO0 A;  4FJG A;  3NE6 A;  4CJ4 A;  3K5O A;  3NF6 A;  1V4T A;  3KTQ A;  2GWK A;  3THX A;  1K9M O;  4WFB L;  2NRX A;  1FKP A;  4Z4C A;  4C1N K;  2OTL N;  2NNW A;  4FJ5 A;  5I9E B;  2DFE A;  5GIP A;  4BR5 A;  3SZ2 A;  4WQ5 A;  3FGU A;  1HYV A;  3DXM A;  3HM9 A;  4EFH A;  4IEI A;  3FZL A;  3LAK A;  2W42 A;  5HLF A;  4X66 K;  1QZ5 A;  4OLA A;  1IKY A;  1VQ8 N;  3V1Q A;  3ZET B;  4I7F A;  4BDY A;  3DLG A;  3J7Z O;  1YVN A;  4FJJ A;  4A2B A;  4FK4 A;  2E88 A;  3NGY A;  5M1F A;  3CC4 N;  1ILY A;  1QS4 A;  4G1Q A;  4K42 A;  2WUS A;  3AVG A;  2P9I B;  4ELT A;  3SCX A;  5GAH P;  3ZT0 A;  1NGF A;  3M3Z A;  1LV5 A;  2HST A;  3VEZ A;  4KHP K;  2O8F A;  3WUH A;  5AQQ A;  4CJ5 A;  3F5T A;  1R59 O;  3QEV A;  3MCP A;  3AVC A;  2G8U A;  3RR8 A;  4FJL A;  1ZBL A;  2W40 A;  4IFE A;  5JVG L;  3R3L A;  5AFU H;  3OYC A;  2D5R A;  3ZSR A;  4OO1 J;  1SQK A;  3EO3 A;  2EHG A;  3K9K A;  1KQS M;  4E1M A;  3TAF A;  3SV3 A;  3ZEU B;  2IVP A;  4KI6 A;  4CFC A;  1JXB A;  1UA0 A;  2JLE A;  5DM6 L;  1KRP A;  4LFC K;  3ZSX A;  3BGR A;  3IG1 A;  3SBT A;  3CM6 A;  4LFA K;  1K6Y A;  4DV6 K;  2IGI A;  1XMQ K;  2A42 A;  4WFA L;  4WQ5 C;  5GAG P;  4FJH A;  3LM2 A;  4E7K A;  3LPU A;  5KRS A;  3AVI A;  2HNZ A;  2CGJ A;  1NBW A;  3LPT A;  2VWK A;  4CJW A;  3LDP A;  1J53 A;  2G8F A;  2IAJ A;  4H0Y B;  4Z4I A;  3EKS A;  3L4Q A;  3CQY A;  1UA1 A;  3K5N A;  4OKE A;  1RTH A;  4CK3 A;  3RR7 A;  1V4S A;  4A5B A;  4B9L A;  5J2N A;  5LMU K;  3JAM O;  3SPY A;  4QOZ B;  1MDU B;  2UUA K;  4CEZ A;  1BCM A;  2YJE A;  4JEP A;  3FZH A;  1Y64 A;  3JYT A;  3VQP A;  4FWP A;  5KI6 A;  3CCL N;  5AQR A;  1FKO A;  1HYS A;  3VF6 A;  3ITH A;  3KWI A;  4DTJ A;  4DR7 K;  2HHS A;  4JK8 A;  3GE1 A;  2OPS A;  2G8I A;  3U4L A;  4GKK K;  1S22 A;  1WOQ A;  2QI2 A;  3VQ9 A;  4M3W A;  2RF2 A;  3C6A A;  4LH4 A;  1OH5 A;  4MLH A;  3HL8 A;  4F2R A;  1GLC G;  3QML A;  2ZJR L;  1VSK A;  4AHU A;  1EQY A;  2O8E B;  4O8K A;  4KH5 A;  2NRW A;  2HB5 A;  4DTX A;  2P9P A;  4NB4 A;  1EWR A;  2VQF K;  4ILG B;  2HOE A;  3HRG A;  1DTQ A;  4IG3 A;  3VGL A;  1NGH A;  3MN7 A;  3PO4 A;  3L2U A;  1TAU A;  3KD1 E;  1HJO A;  5ADX A;  2NRH A;  2F9W A;  3VER A;  3DXM B;  3T1A A;  4Z4E A;  5AQU A;  3AVA A;  3SUO A;  1TVR A;  3L0Q A;  2OPR A;  4CJR A;  2JGU A;  4CEO A;  4W5Q A;  5AQV A;  4BR2 A;  3A8Y A;  4CJS A;  3VN5 A;  3ULE A;  3KK7 A;  2GEM A;  2HF3 A;  1VQL N;  5EY4 A;  2O8F B;  2B4J A;  4M42 A;  3QDK A;  3WNG A;  2JWL A;  3KHY A;  3VQD A;  4FK2 A;  1VRU A;  4A5A A;  4BQZ A;  1HMV A;  1XMO K;  4BRE A;  2ASP A;  3HXM A;  3TSP A;  4RW6 A;  3IS9 A;  2NUB A;  4DR1 K;  1CLQ A;  4KHQ A;  1Q9Y A;  2VGN A;  4EP5 A;  3T1H K;  4MO4 A;  1S3X A;  3OYB A;  1TYQ A;  1NGC A;  4C8O A;  3IUC A;  4OGE A;  4LH5 A;  5C0Y A;  3BY5 A;  5FRO A;  4M3Z A;  3RRH A;  2FBX A;  1JLF A;  4DFJ A;  4IJA A;  5E26 A;  3I56 N;  1CZB A;  3HJF A;  2QWP A;  4JD2 A;  4CJ3 A;  4DTU A;  2FBT A;  4ICL A;  3CC7 N;  1JCG A;  3OBY A;  3OYI A;  2G8K A;  3M5R A;  1LAW A;  2OZS A;  5KPR A;  4GV9 A;  5TKY A;  3MN6 A;  1VQP N;  1RCH A;  1WNS A;  4FK0 A;  1N33 K;  1VQK N;  3KKS A;  5CHI A;  2LSN A;  5BN9 A;  4RW8 A;  4XIU A;  4F2S A;  2CGL A;  4CES A;  2ZF5 O;  1C0G A;  1I39 A;  1MA9 B;  4CHN A;  3KK1 A;  4CF9 A;  3VQ8 A;  4DCH A;  4CCH A;  3QEI A;  3CYM A;  1XNQ K;  2HHH K;  4CZG A;  1NMN A;  4B08 A;  3EZW A;  1HQU A;  3O4N A;  1QHT A;  3TAP A;  3UE5 A;  1H1V A;  2HNY A;  4RG8 A;  1TKZ A;  3CCJ N;  3OS2 A;  4YOX A;  4JKG A;  2Q3S A;  4FWR A;  3HTV A;  3NBP A;  3KJV A;  4DLG A;  1RT1 A;  1VRT A;  1OH7 A;  2I7P A;  3VEY A;  3NH2 A;  1WB9 A;  4CGF A;  4DV2 K;  3KKR A;  4DSI A;  4JLH A;  4CEQ A;  2ZE2 A;  3FR0 A;  1BA0 A;  3OA9 A;  2WTU A;  5HRR A;  5BN8 A;  4BRF A;  1TKX A;  4CEB A;  3TAM A;  4ZTJ A;  1XC3 A;  5AQH A;  4E1J A;  1SKW A;  4BR0 A;  3VQ7 A;  3AA4 A;  3QO9 A;  4ILH A;  1NK5 A;  3VEO A;  1NK8 A;  3F2K A;  3H3N O;  1NKB A;  4BRA A;  5CYQ A;  3CFO A;  3VQ5 A;  4OPH A;  1YUW A;  1KXP A;  4DV1 K;  3RSE A;  2V52 B;  4QAG A;  3SUQ A;  3Q7B A;  2A1S A;  4BAC A;  2VWJ A;  1JLE A;  3ID6 A;  3NAE A;  3HZ6 A;  5AR0 A;  2XY6 A;  4K8X A;  3V9W A;  5BRH A;  2E20 A;  4HTU A;  1D9F A;  2RE2 A;  4DV3 K;  1NJI O;  4JAX A;  3DRR A;  4HCB A;  4U7B A;  1N6Q A;  1VSD A;  4DF8 A;  1T8E A;  5AZJ B;  3WNF A;  3THW A;  3THV A;  1JLC A;  2D4W A;  4CHY A;  3J7Y P;  4F9O A;  3KZB A;  1HNX K;  3RMC A;  1XWL A;  1YIT N;  3N4Q A;  2HBL A;  4FLZ A;  4Y1C A;  5GIO A;  3AAP A;  4KRE A;  1U2V B;  3H1V X;  1TKT A;  2E2P A;  1BO5 O;  5FRN A;  1HNZ K;  4R5P A;  4BWJ A;  3MXM A;  3JS6 A;  3AVH A;  1C1C A; 
#chains in the Genus database with same CATH homology
 4CZM A;  1NMD A;  3DXK A;  1QHA A;  1K8A O;  2CGK A;  4FWQ A;  2D0P A;  2EWS A;  3WQT A;  4BGA A;  4DB3 A;  1NLV A;  4YOR A;  2WBN A;  5JVH L;  2F9T A;  3VEX A;  5F1X A;  4CZJ A;  3TTC A;  2CH5 A;  4YDU A;  1S72 N;  2V7Z A;  3QIC A;  3LDL A;  3TSU A;  2KHO A;  4BG8 A;  3MN9 A;  4BG9 A;  1Q82 O;  4H5N A;  5AQK A;  5C12 A;  2BTF A;  5JLH A;  3MCA B;  1Q81 O;  2FSK A;  3CPE A;  5AQP A;  3QB0 A;  2QWO A;  4BQL A;  4EAH D;  1ATN A;  4WFN L;  1MWM A;  2NRT A;  2VWB A;  2ZGY A;  1YF5 L;  3E9P A;  2Q2R A;  3VF4 A;  3CIP A;  5AQW A;  3WXI A;  2P9L A;  4NO7 A;  1X3N A;  3LM9 A;  3P31 A;  2GWJ A;  3CCS N;  5JMV A;  2FXU A;  4EIA A;  1D4X A;  4KH6 A;  2PAV A;  4YOT A;  2QWR A;  1HKB A;  4BRD A;  4CD1 A;  3CF5 L;  3GOI A;  3DLL L;  3CC2 N;  1QVF M;  4M63 C;  3LL3 A;  5E84 A;  2HF4 A;  3CJ7 A;  1VQN N;  3SAG A;  4BC5 A;  4PKI A;  2E1Y A;  4BRL A;  4XH1 A;  2YX6 A;  3A0I X;  3BUZ B;  3C0B A;  4FO0 A;  1BDG A;  2NRR A;  4JKC A;  1NGD A;  3HOT A;  1V4T A;  4BRN A;  2A6A A;  2GWK A;  2NRZ A;  3ZET A;  1K9M O;  4WFB L;  1K8K B;  2NRX A;  3IFR A;  4QS8 A;  4WF9 L;  3CCU N;  4G9Z A;  1RFQ A;  4C1N K;  1VAZ A;  3AGR A;  3IMX A;  4HTL A;  2DPN A;  3AY9 A;  1GLE G;  4K41 A;  3G71 N;  3Q7C A;  2OTL N;  3QBW A;  2NNW A;  3L6Q A;  4JK9 A;  3R1X A;  3O80 A;  4CZH A;  3VF2 A;  5I9E B;  1E4G T;  2GTD A;  4JKG B;  4BR5 A;  5GIP A;  1YJ9 N;  3BF3 A;  1Q86 O;  4WQ5 A;  4CBU A;  3F9M A;  3FGU A;  3T69 A;  3DXM A;  3KVG A;  3O08 A;  2E2N A;  2P9N A;  2YCH A;  4GY2 B;  4IEI A;  1DT9 A;  3FZL A;  4B1Z A;  4C23 A;  4EFH A;  3L4I A;  4H0P A;  3FZK A;  1BUP A;  2A41 A;  1QZ5 A;  3G25 A;  5CR4 A;  5AQO A;  3VMF B;  1VQ8 N;  5KQD A;  1Q18 A;  4GV3 A;  3GG4 A;  3ZET B;  3R6M A;  5F2R A;  4BC4 A;  3J7Z O;  1YVN A;  1DKG D;  4A2B A;  2E88 A;  1N8R O;  5M1F A;  5AQJ A;  3PLA A;  3CCV N;  2I7N A;  1T44 A;  2F7T A;  3CC4 N;  1ILY A;  1ZBS A;  3WXJ A;  5F0X A;  1HKG A;  4K42 A;  4RTF D;  2WUS A;  1T6D A;  2P9I B;  4AM7 A;  4BRH A;  5GAH P;  1TUU A;  3SK3 A;  3EKU A;  1NGF A;  3IDH A;  3M3Z A;  4B1U B;  4GV6 A;  2HST A;  3VEZ A;  3MX5 A;  5CE3 A;  3WUH A;  4GVE A;  5AQQ A;  3H1Q A;  3F5T A;  1R59 O;  1W2B M;  4FWL A;  1XQS C;  3EE9 A;  3MCP A;  3DWL A;  3D2F A;  2E8A A;  4IJN A;  1ESV A;  5C10 A;  4IDH A;  2W40 A;  4IFE A;  1BG3 A;  4FWN A;  5JVG L;  3R3L A;  5C2D A;  5BRF A;  5AFU H;  4BR7 A;  2Q0R A;  4CI6 A;  1Z05 A;  4OO1 J;  1SQK A;  3EO3 A;  4H0X B;  3K9K A;  2NLX A;  1KQS M;  4YOW A;  3O4W A;  2E2O A;  1GLF O;  4FVU A;  3ZEU B;  2IVP A;  4XEI A;  2GUP A;  2QXL A;  2ZGZ A;  4GNI A;  3MX2 A;  5DM6 L;  3I55 N;  2WC9 A;  4XH5 A;  3EN9 A;  3VEW A;  4B1X B;  1LCU A;  5ELZ A;  1RGI A;  2V51 B;  3D2F B;  3MDQ A;  3OBW A;  3VEV A;  2ZJQ L;  3CJA A;  5HL7 L;  3SBT A;  1C0F A;  5M1K A;  3CI5 A;  1YJN N;  2YI1 A;  3ID8 A;  3D2E A;  2A42 A;  1GLL O;  1ZXO A;  2FF3 B;  2VCP A;  4H0O A;  1KAX A;  3HSC A;  1DGK N;  5AZI B;  3VTH A;  4WFA L;  4B1V A;  4H0T B;  4WQ5 C;  3ZYY X;  3GDQ A;  4CZL A;  5GAG P;  4MLE A;  3LM2 A;  2YHW A;  4JKA A;  3HOS A;  1ATS A;  2CGJ A;  1NBW A;  3O9Q A;  3O1B A;  3LDP A;  4PL7 A;  4C1N I;  4IO8 A;  3CCQ N;  3MWP A;  3J8A A;  1VQM N;  5AQG A;  5AFU A;  4H0Y B;  1VQ4 N;  3HI0 A;  1KAY A;  3EKS A;  3L4Q A;  3QBX A;  4BGB A;  3FZF A;  2QWM A;  3U9Z A;  1JCE A;  5LJV A;  3CQY A;  5EOY A;  1NM1 A;  3ATU A;  3SLC A;  3SMP A;  5FPN A;  3DXK B;  2D0O A;  1V4S A;  4OPA A;  3WQU A;  1EO1 A;  3A5M C;  3P38 A;  4A59 A;  4A5B A;  4FSV A;  5B8H A;  5KQ8 A;  4LC9 B;  1T6C A;  1HKC A;  1MDU B;  3NMU A;  3MK6 A;  4UY8 O;  4Y0W A;  4ILJ A;  2YJE A;  3DJC A;  3HM8 A;  4JEP A;  5AQN A;  2KKZ A;  3FZH A;  4WQ4 A;  3U9D A;  4A57 A;  1Y64 A;  3O9T A;  1NGE A;  1GLA G;  3MN5 A;  1VQ5 N;  3TTD A;  1YI2 N;  4FWP A;  3CME N;  3CCM N;  5EX5 A;  3CCL N;  5AQR A;  3O6W A;  4EHT A;  3VF6 A;  3KWI A;  3LDN A;  1QVG M;  4JK8 A;  3GE1 A;  2KLA A;  2PBD A;  3U4L A;  1NGJ A;  2BH1 A;  3HBT A;  1QQM A;  3WXL A;  2P9L B;  1S22 A;  1WOQ A;  4CBX A;  2QI2 A;  3C6A A;  2QM1 A;  2YHX A;  4IOC L;  5DM7 L;  4MLH A;  2HBM A;  3FLC O;  4FWM A;  1BA1 A;  4ISG A;  4BVO A;  5FPD A;  1GLC G;  3D6R A;  3QML A;  2ZJR L;  1HUX A;  3PIP L;  3WT0 A;  1EQY A;  3D7E O;  2BUP A;  2P9K A;  2YJF A;  3CXC M;  4O8K A;  4KH5 A;  4DQ8 A;  2VYP A;  2NRW A;  4BC3 A;  3VGK A;  3JXU A;  4H5V A;  2P9P A;  4NB4 A;  4IWV A;  2OTJ N;  4ILG B;  2QTD A;  5BPL A;  2A5X A;  2GEL A;  2HOE A;  3HRG A;  3A5L C;  5JIC A;  1OKJ A;  5GIN A;  2CH6 A;  3VGL A;  4YDU C;  1K73 O;  2P9U A;  1NGH A;  3ZX2 A;  3GBT A;  3MN7 A;  4U67 L;  3KWG A;  1YXQ A;  4WYB A;  5BR9 A;  4H5R A;  5AQS A;  1HJO A;  3GL1 A;  5ADX A;  2NRH A;  4QS7 A;  2F9W A;  3QFU A;  2P9K B;  5KPT A;  2IVN A;  3RVC A;  3VER A;  5LY3 A;  3DXM B;  1G99 A;  3MMV A;  5BPN A;  2P9N B;  1QQO A;  4H03 B;  5AQU A;  4I6M A;  1GLB G;  1W97 L;  3UKU A;  1NGB A;  2P9P B;  3L0Q A;  4BRG A;  3I33 A;  3WXK A;  1YJW N;  5AQV A;  1VQO N;  3M6G A;  3R9P A;  4BRO A;  2D1K A;  1DEJ A;  4BR2 A;  3A8Y A;  5AQI A;  2P9U B;  3ULE A;  5AQL A;  4PL8 A;  1M90 O;  3SJH A;  2IVO A;  4JKF A;  3B8A X;  3VES A;  4AM6 A;  1WUA A;  3KK7 A;  2GEM A;  4KH4 A;  2HF3 A;  4A62 A;  2ASO A;  2IIR A;  3LDQ A;  5EY4 A;  3U8X A;  1VQL N;  1IG8 A;  4FPA A;  3WEE A;  4BRQ A;  3OHR A;  3QDK A;  2JWL A;  4IO9 L;  1YAG A;  3KHY A;  4BR9 A;  1OVY A;  4JHD A;  1VQ9 N;  4A5A A;  3O9R A;  4BQZ A;  3AGK A;  3ENH A;  4BRE A;  2ASP A;  5GAE P;  3TSP A;  4BRC A;  5M1N A;  3VOV A;  1BWF O;  2QEX N;  2AP1 A;  1TUY A;  3ULE B;  2P9S A;  3O9S A;  3K9J A;  3VTI A;  1JJ2 M;  2VGN A;  1U6Z A;  4BC2 A;  1LOT B;  2QW9 A;  5AQM A;  4MO4 A;  3E1Y A;  4BRM A;  4BRP A;  1S3X A;  1TYQ A;  3QFP A;  1NGC A;  2PFU A;  3IUC A;  3W3D A;  1GLJ O;  2OAN A;  4FOE A;  3WEE B;  5C0Y A;  2ZJP L;  5AQF A;  4Z94 A;  4M7X A;  3ZX0 A;  4BY9 C;  1NGI A;  1KD1 O;  3T7Z A;  4H0V B;  4B9Q A;  1SAZ A;  2FLO A;  1RDU A;  4R79 A;  5JLF A;  4IJA A;  5E26 A;  3I56 N;  3CJB A;  3ENO A;  3VGM A;  3D2E B;  2AA4 A;  5BRD A;  2QWP A;  5EVZ A;  2A3Z A;  4JD2 A;  2P9S B;  4DKW A;  4YOV A;  4CZE A;  3R8E A;  2Q1N A;  4MDB A;  4A2A A;  3CC7 N;  1JCG A;  3OBY A;  3M5R A;  4IOX A;  1TYQ B;  5EXW A;  4B1Y B;  4FWS A;  4CBW A;  5KPR A;  4GV9 A;  5TKY A;  3MN6 A;  1VQP N;  1VQK N;  5H1S Q;  3O9U A;  4FPB A;  4ISE A;  4JKB A;  3CET A;  5CHI A;  5AQZ A;  5BN9 A;  4DHY A;  5BRE A;  3CMA N;  5KPZ A;  4BRI A;  2CGL A;  3IKM A;  2ZF5 O;  4MO5 A;  1C0G A;  1MWK A;  2NZT A;  3FFK B;  1P8Z A;  3BEX A;  4JD2 B;  1MA9 B;  3S41 A;  5ADX H;  1E4F T;  3FE1 A;  4L3Q A;  4MDA A;  4DCH A;  5C15 A;  4IEE A;  1XUP O;  2FSN A;  4O8U A;  3ZX3 A;  4CZG A;  5GAD P;  1K8K A;  3PIO L;  2A40 A;  3ATV A;  3O8M A;  3EZW A;  1IJJ A;  1SS6 A;  2QA4 N;  2Q0U A;  3M1F A;  5TKW A;  3CD6 N;  4FWO A;  1H1V A;  3UE5 A;  4BRK A;  4FOI A;  2FSJ A;  3CCJ N;  1YIJ N;  3AAR A;  3SMS A;  4YOX A;  3E9O A;  4JKG A;  4JKE A;  2VGM A;  3G6E N;  2QWL A;  3N4P A;  3EL2 A;  1NGA A;  3TSQ A;  3TTF A;  1X9J A;  3C7N A;  3HTV A;  3FZM A;  4FWR A;  4K43 A;  3C6H A;  3VEN A;  4B1W B;  2I7P A;  4J8F A;  4K25 A;  3VEY A;  4CJ7 A;  2E1Z A;  2RHK A;  1QQN A;  1KAZ A;  3A5O C;  2J4R A;  2FF6 A;  2WFB A;  3DAW A;  3FR0 A;  1BA0 A;  1NWK A;  3AAQ A;  3CER A;  3CPW M;  3OA9 A;  4YOY A;  5BN8 A;  3H3O B;  4BRF A;  3TPQ A;  1HPM A;  4HWI A;  1YHQ N;  2P9I A;  4FWK A;  3W0L A;  1XC3 A;  5AQH A;  4E1J A;  5AQX A;  2Q97 A;  3MWT A;  4CZF A;  3CJ9 A;  5HOO A;  3C7N B;  2V7Y A;  4BR0 A;  5LJW A;  2HMP A;  1Q7Y O;  1ATR A;  4ILH A;  5M1O A;  1NGG A;  3VEO A;  2Q36 A;  3A5N C;  3F2K A;  3I8B A;  3H3N O;  5FPE A;  1ZC6 A;  2QWN A;  4BRA A;  1RDW X;  2H3G X;  3EE8 A;  4NLB A;  1QZ6 A;  3UB5 A;  2UYT A;  4AF1 A;  4OPH A;  4IZ9 A;  1HX1 A;  1YUW A;  4JK7 A;  4O5F A;  3CCE N;  1KXP A;  1O13 A;  3VET A;  3RSE A;  1KC8 O;  2V52 B;  4WQ4 C;  1JCF A;  1T3V A;  5AZJ A;  3E9L A;  3TU5 A;  5FPM A;  4CD3 A;  3O1W A;  5C2F A;  1BOT O;  3CJC A;  3Q7B A;  3WXM B;  4A61 A;  5AQY A;  4CZI A;  4PHT X;  2QWQ A;  1VQ7 N;  3ZEU A;  4RCH A;  1M1K O;  5AQT A;  4ISF A;  4H5W A;  3ID6 A;  1P90 A;  1SZ2 A;  2GX9 A;  4JNE A;  2W41 A;  4KBO A;  5BPM A;  3SAF A;  3OW2 M;  2E2Q A;  3HZ6 A;  5AR0 A;  1GLD G;  4I6M B;  4NLC A;  2YHY A;  4PKG A;  3UKU B;  5BRH A;  3H45 C;  1VQ6 N;  3P39 A;  2E20 A;  3CCR N;  1Z6R A;  3NVM A;  4EHU A;  4JKH A;  2RE2 A;  4CZK A;  1U2V A;  1NJI O;  3H6E A;  4JAX A;  4BVP A;  4IXC A;  4PKH A;  4U7B A;  3G4S N;  5MLC Q;  5M1P A;  3RSE B;  2ITM A;  5AZI A;  3SAH A;  4YOU A;  3C65 A;  5AZJ B;  5M1Q A;  3BP8 A;  3UKR A;  2D4W A;  4F9O A;  3BF1 A;  2ZWH A;  3KZB A;  3SBG A;  4BR4 A;  3NVK A;  3CQX A;  4XH4 A;  1BU6 O;  1YIT N;  3N4Q A;  2HBL A;  4JN4 A;  4RWT A;  2Q31 A;  4FL9 A;  3O5B A;  4JHD B;  3ENB A;  2HBK A;  5GIO A;  1CZA N;  3AAP A;  3P4I A;  1U2V B;  3H1V X;  2E2P A;  1X3M A;  3H46 O;  4M7Y A;  1J6Z A;  1BO5 O;  2HBJ A;  2NRV A;  4QS9 A;  3VPZ A;  2JWK A;  4IOA L;  4WCE L;  2ASM A;  3CJ1 A;  3JS6 A;  3E66 A;  3CHW A;  1HLU A;  3UKR B;  4H5T A;  3LDO A;  4JKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...