3R1XA

Crystal structure of 2-oxo-3-deoxygalactonate kinase from klebsiella pneumoniae
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
295
structure length
295
Chain Sequence
SNAMTARYIAIDWGSTNLRAWLYQGEECLESRQSEAGVTRLNGRSPAAVLAEITQHWRDGATPVVMAGMVGSNVGWKIAPYLPLPAAFSDIGQQLTAVGDNIWIIPGLCVSRDDNHNVMRGEETQLLGARALAPSSVYVMPGTHCKWVLADRRQIHDFRTVLTGELHHLLLQLSLVGAGLPPQETSAAAFAAGLQRGINNPAVLPQLFEVRASHVLGALPREQVSEFLSGLLIGAEVATLSDTFAGQQAISLVAGSSLTSRYQQAFAAIGREVSAVAGDTAFQTGIRSIAYAVAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of 2-oxo-3-deoxygalactonate kinase from Klebsiella pneumoniae.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Transferase
molecule keywords 2-oxo-3-deoxygalactonate kinase
total genus 93
structure length 295
sequence length 295
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.58: 2-dehydro-3-deoxygalactonokinase.
pdb deposition date 2011-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05035 DGOK 2-keto-3-deoxy-galactonokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.300 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3r1xA01
3.30.420.310 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3r1xA02
3R1XA 3T69A
chains in the Genus database with same CATH superfamily
3I8BA 5M1OA 4BC4A 4IFVA 2VCPA 2YNHA 2OZSA 1U48A 4BACA 4A5BA 1NGJA 1S1VA 1S1XA 3ZSXA 4Q5VA 3SQ0A 5JMVA 1HNVA 5BPNA 5GAHP 3CC2N 2QWLA 2YJEA 3PX6A 2O4GA 1Z25A 1W0HA 4J2DA 2QK9A 2UXDK 4PL8A 1MWMA 5KPZA 1C0UA 4O0IA 1TK5A 4JLHA 3AV9A 5CYQA 4WE1A 3K0SA 1KXPA 3IFRA 3J8AA 1U6ZA 1TKZA 5FRNA 1K8AO 5AQKA 1BI4B 3CIPA 3UKUA 1MDUB 2OTJN 3TSUA 2NLXA 5LL6Z 3L4IA 4DB3A 1HKGA 4H0VB 3CCSN 1K73O 4CGGA 3VQDA 5HROA 3UKUB 2G8UA 3R6MA 4WQ4A 3CC7N 5LMNK 3UB5A 3VQQA 1C0MA 4CEZA 1RBTA 3KWGA 3PUFA 2W42A 5JLFA 3FZKA 3JAMO 1X3MA 4FVMA 1KVCA 4N47A 1K8KB 2CGLA 4CFDA 5BR9A 5GADP 2UXCK 1NGAA 4FWOA 2B4JA 3R8EA 3ZSRA 3ZYYX 4KV8A 4O8KA 1VQLN 2A41A 1CXUA 2D4WA 3VQ5A 3MXMA 3KLGA 4C23A 1S9EA 5GAGP 4DV0K 3SI6A 4CJKA 4A57A 4M3UA 3BUZB 3DXKB 1GLEG 3MEDA 2F96A 1GLCG 3OS1A 4GY2B 3LP3A 2QM1A 1U2VA 2OPQA 3DXKA 2YHWA 1BHLA 4ZTFA 1TV6A 3C6TA 3KZBA 3PSFA 1GLBG 4JHDB 4CHPA 1YITN 3AA2A 1JCGA 3F5TA 4HWIA 1NJZA 1HJOA 4K43A 1TGOA 1IBKK 4Z4EA 5BRFA 4CGHA 3K5OA 4DR7K 3M8PA 2ITMA 2E2PA 1ASUA 2BTFA 1IJJA 1HR0K 4H8KA 4IOCL 2E2QA 4Z4CA 1YJNN 3OYLA 1NMNA 3T1YK 4DF4A 4Z4FA 3BZKA 4ID5A 1VQ9N 3AO1A 3UE5A 5JVHL 4CEDA 4W5TA 1HPMA 1W97L 3J81O 1YJ9N 4A2AA 4EHTA 3WQUA 5AZIA 2P9PA 3LALA 3VN5A 4DHYA 4BVOA 1D9FA 3RRHA 2P1JA 4KHNA 3S41A 5FPNA 1RTJA 2B6AA 2ETJA 5AQHA 3LDLA 2RPIA 3RRGA 2OPRA 3UKRA 5LJWA 3OTOK 3WXJA 4FW1A 1S72N 4IFEA 3LDOA 3B6OA 1DKGD 1GOAA 2LSNA 3KLFA 4PKIA 3RMBA 4JKBA 1JLCA 4FOIA 2UUAK 2EWSA 3ISNC 4Z4HA 3C95A 3HM9A 2XO7A 2O8CB 4JI8K 2GELA 4B1VA 1XUPO 3QDKA 3T7ZA 1VRUA 2HNZA 4HUEA 2IIRA 4V19S 5GAEP 1SL1A 2Z1GA 4H4MA 3P31A 2BDPA 4DSLA 4CJRA 3WXMB 3THVA 1BL3A 1SKWA 3ZX2A 3TABA 3SV4A 3OBYA 3OYBA 1ASVA 2X6NA 4N76A 4R5PA 3JXUA 1ZC6A 3HM8A 4CERA 1U47A 3MCPA 3SYZA 1S1UA 3HTVA 3O80A 3DMJA 3KKRA 4FM0A 5F2RA 3CI5A 4LSLA 4CJTA 3S9HA 4BG8A 3HBTA 4KFBA 1FKPA 3SUQA 1BUPA 2Q0RA 1XNRK 3EZWA 3OYCA 3ENOA 4M3ZA 3ZSVA 4PKHA 5AQQA 2KFNA 4BWJA 4OKJA 1BG3A 1RTIA 4JKDA 4AHCA 4DQIA 2VWBA 4DKWA 2AA4A 1JL1A 4KB0A 4ZTJA 2IVOA 3D45A 1T05A 1SZ2A 4B3RK 2ZJRL 4CJQA 2RKIA 2RF2A 2CGKA 4F3TA 4BVPA 3AVHA 1UA1A 3EYZA 3QFPA 3CCQN 4FLVA 4F8RA 1J54A 1TK8A 3VEXA 3NH2A 4DR4K 3V4IA 2IS3A 3KK3A 1DT9A 3GG4A 1TUYA 4OX9K 3AVJA 3F73A 4PWDA 1WSIA 1SQKA 4EZ9A 2QWRA 3NGYA 4BRQA 2FBVA 3QERA 1YF5L 1ESVA 5C24A 4M42A 1HNWK 3Q7CA 3CJ7A 3P39A 3VPZA 4HUFA 3DYAA 2AJQA 3SMSA 3SV3A 1T6DA 3EKUA 1Q82O 4Y1CA 4CEEA 4IDKA 3HT3A 2ASMA 1ATSA 5D3GA 3PY8A 3U4LA 4CHOA 3AGRA 3L2RA 3OYAA 2GWKA 4YOTA 1TKDA 1BQMA 4B1YB 3CQYA 4JNEA 3DOKA 1E4GT 1SL0A 3CM5A 4DUYK 2WONA 2Q0UA 3CCJN 3PX4A 2OZMA 4FJ5A 4J8FA 3DXMA 2P9KB 1RT3A 4WQ5C 3KLHA 4FLYA 2V51B 1VSIA 4C8MA 3NFAA 2G8FA 3H08A 3C0BA 3EEQA 3PV8A 3ENBA 4X62K 5AFUH 4DR3K 4DTNA 3G4SN 3HPOA 2P9SA 4LF4K 4PKGA 3IMXA 4YDUC 5KRTA 2HSTA 2PZSA 4IG3A 4NO7A 1J53A 1VQ5N 1BU6O 3DJCA 5CZ2A 2VWJA 2PFUA 4CHZA 3MAQA 5BN9A 5HRRA 3QLHA 3PSIA 3ZEUB 3HVTA 3RVCA 3THWB 2BE2A 4JI3K 3VQBA 1ZBSA 3MWTA 4E7IA 4GV9A 1RDUA 1LOTB 3VQPA 3THXB 3K5LA 4KHUA 3CPEA 3G25A 3H45C 3CXCM 4FZYA 4ID1A 3WNHA 5AQRA 1DGKN 3ID6A 1REVA 3GBTA 2OTLN 2Q1NA 4K8ZA 3ATVA 2ZJPL 3LM9A 4B1WB 4Z94A 4FXDA 1HKCA 4YY3K 3V9WA 4H4OA 4OGEA 4QS7A 1MA9B 3O4WA 3TAGA 3VQ8A 4BR7A 4M3TA 3W0LA 1GOCA 2P9KA 4MLHA 5I3UA 2I7PA 4ISFA 5I42A 1HLUA 1JXEA 4KKOA 4JKGA 4XH5A 4JKHA 1B92A 2FF6A 3K9JA 1NKBA 1NGGA 1SV5A 4GVMA 3WQTA 4KHSA 1HUXA 2VWKA 3QESA 3LANA 4YDUA 2XY5A 5DK5A 4BC5A 5AQXA 3THYA 3LAKA 3OS2A 2UXBK 1NGFA 2A1SA 2YJFA 2DFEA 3DRPA 3KLIA 5FPEA 4M3XA 3DLRA 5DMRA 1WSFA 4B9NA 4EFHA 3HOSA 5F0XA 1U2VB 3CC4N 3CFRA 1BI4A 2E6LA 1R0AA 4AHSA 1QZ5A 4UQGA 3ZETB 1QHAA 2VYPA 4U67L 4Q0BA 5C2FA 3ZT0A 3H1QA 3FZHA 4HVJA 3BF1A 4LF8K 4K41A 3SCXA 1HPZA 1YTAA 1K6YA 4OPJA 4FL9A 1QVGM 2P9IA 4MDAA 3DLEA 3H3NO 3TI0A 4JK9A 4K25A 3THWA 1BISA 1LWFA 5EVZA 3R3LA 4C8KA 2VGMA 4CZIA 1NGDA 3TU5A 4U7BA 1K8KA 1VSKA 4A62A 2XHBA 1VQKN 3FR0A 1ITGA 3AO2A 5E84A 4NXMK 2FF3B 2XRIA 4H0OA 4E1JA 3NF6A 3QNOA 4CFAA 1G99A 3C6UA 4AM7A 3HP9A 4YOVA 1NG9A 4F2RA 1VSDA 2FSJA 4H0PA 1TKXA 5J2NA 4KRFA 1NJWA 4O5FA 3V9SA 2R7YA 4BDPA 1WLJA 3DXMB 2WTUA 2Q3SA 2YNGA 4HHTA 2RE2A 4FJJA 1RCHA 3I33A 3HVRA 3EO3A 1NGIA 5KQDA 1A5VA 4CD3A 3VGKA 3ATUA 4CJPA 1SS6A 4KH5A 4YNQA 4BR5A 2Z1JA 1Z05A 3A5MC 1HYVA 1IO2A 4DLGA 5CZ1A 4FWSA 2QEXN 4I6MA 1C0FA 3IS9A 2H3GX 2UYTA 1J6ZA 4PQUA 2QXFA 4BRPA 1EO1A 3D2EA 1NBWA 4BWMA 2EX3A 2ITGA 5ADXA 2QWOA 1BQNA 3K2PA 2O4IA 4Z4IA 4H5WA 1KVBA 4GW6A 1Y97A 1N8RO 5JLHA 2WFBA 4FWKA 3TSPA 1I39A 4QCLA 2DTUA 2KKZA 5AQUA 3IRXA 1E3MA 2ZJQL 2NRRA 3QMLA 4FK2A 4BRMA 4BRNA 5TKYA 1DLOA 4DSIA 3F9KA 4H5NA 5AJ3K 1BO5O 1RDCA 1RBSA 3BP8A 1XHXA 4GV3A 3MEEA 3NH0A 2WBNA 2YNFA 3NBPA 4A61A 4G1QA 3CJ1A 1JL2A 4KH4A 4KREA 3V9XA 4IXCA 3OW2M 1YHQN 2KFZA 2HBJA 5BR8K 4DFMA 4MQ3A 5C12A 5HBMA 4JI5K 2NRXA 4WFNL 1RT6A 3GDQA 2KLAA 3DAWA 3LDQA 4FZXC 1NKEA 3QIPA 4B3SK 4JKEA 3G10A 4JI7K 4YORA 1O1WA 2QXLA 4CZGA 3V9UA 1H1VA 2VG6A 1WUAA 1C0TA 3J80O 2FBYA 3O8MA 4C1NK 3KK7A 3DLLL 4B9TA 4LF9K 3E9OA 2BH1A 3S3NA 3LP2A 2OYQA 2RHKA 2YV0X 3QINA 3ASMA 3AVIA 3NAEA 1NK9A 2BGGA 2IVNA 3O1WA 3QBWA 4YOYA 1QE1A 3P4IA 4DV3K 2NRZA 3RTVA 5JS1A 1VAZA 3G0ZA 4CJVA 1VHXA 2E6MA 3EY1A 4CJFA 1QQMA 5E41A 3L2VA 3RR7A 4I9QA 3O9TA 4KHQA 3WEEB 2HMIA 4CJEA 4FWMA 5AQNA 5KI6A 3WXLA 4DSJA 4FZZA 3V1OA 1XMOK 3CMAN 2F9TA 3CETA 3U6FA 1WAFA 1VSHA 2HHSA 1FK9A 5EU7A 1C1CA 2VGNA 4B9SA 1P90A 4CGDA 4BRAA 5EXWA 3RMDA 4WYBA 1VRTA 1N34K 4DFPA 1GLFO 3OBWA 2HF3A 5AFUA 5DM6L 3SPZA 1JXBA 4NLBA 1OVYA 3M6GA 4KHWA 5M1PA 3IG1A 5AQIA 2P9PB 3LDNA 2V52B 4IO9L 1NLVA 2CGJA 1S6QA 4MO5A 3DM2A 3OYKA 1IKWA 4YOWA 2D0AA 1GLAG 1TKTA 5HL7L 3ZT4A 4NCBA 3DLHA 3VF4A 1NK6A 3VGMA 4FLTA 4DSFA 3QEVA 2X78A 3VEWA 1QQOA 3DLKA 4IOAL 4DTJA 4ISGA 1LW0A 3JS6A 3JYTA 3OHRA 1EWRA 2GWJA 1NNEA 3S3OA 2P9NA 3OYIA 4DSEA 2HNYA 1U04A 3D7EO 4BGAA 2JGUA 1XI1A 4E1NA 1ZBIA 1S5JA 4FYDA 1IV0A 1U4BA 1LWEA 1D8YA 3O4QA 1VQ4N 4GKJK 3TAPA 2IGIA 2AP1A 5BN8A 5IWAK 4LC9B 1KVAA 4WF9L 5FLXO 4C1NI 3NGIA 1S3XA 4FJGA 2O8BB 2P9NB 5KGXA 1FKOA 4AHTA 3O4NA 4RW8A 4DV1K 4ILHA 3OYHA 3THXA 3SPYA 3TR8A 4I2PA 1N32K 2QA4N 3AA4A 2FSKA 4DU4A 1Y64A 5EOYA 3RMCA 1L3TA 5AQZA 5SZTA 5CY4A 2A3ZA 3QO9A 3FGUA 1JLBA 3CYMA 3F2KA 3T1HK 1XNQK 2P9SB 4OLBA 4AF1A 1A5XA 1RBRA 2P9UA 3FZMA 1V4SA 4DV7K 4W5RA 1OH5A 3K57A 3OY9A 3I56N 5AR0A 1KFSA 3C6HA 2E2OA 4CJ3A 3L3VA 3KD5E 3VA0A 3VF2A 1W7AA 1EETA 1BGXT 1RT4A 3MECA 1F21A 3VTHA 4BQZA 2HOEA 4CJWA 2W41A 1BIUA 2Q31A 4I7FA 4PUOA 1Z6RA 5CYMA 5HOOA 2FSNA 1J5OA 1T7PA 3QEXA 5BREA 3ZX0A 3CCEN 1BIZA 5AQWA 2YI1A 1RBVA 3P83D 4O4GA 2P5GA 4L8RB 3SK3A 2VG7A 4DWIA 5AZJB 1RT2A 3OYEA 1EX4A 1SAZA 4RCHA 3NVMA 1BA0A 3N4QA 1VQ6N 1GLLO 1TL3A 4DTRA 1XC9A 1NGEA 2PYLA 1IBLK 1IH7A 1NK8A 1W9HA 3KJVA 2HW3A 4CHQA 4CJ4A 4DCHA 1HYSA 3C94A 1RDWX 3C7NB 4AHVA 5AQGA 4JEPA 4X64K 1OKJA 3A5OC 5KTQA 4LH5A 4O44A 3T69A 3EN9A 4BDYA 3E66A 1I3AA 4RWTA 2E5LK 4KTQA 2NNWA 2OA8A 4FLXA 1DEJA 4RW4A 3KK2A 1WSGA 1TYQB 4LY7A 4FWRA 3VQEA 3P5JA 1JCFA 1SUQA 1A5WA 3VQ9A 4QS9A 1N6QA 4CW7B 4FJKA 4JK7A 2PAVA 1B9FA 2NRHA 5CR4A 1XC3A 3J7ZO 4PA1A 1KFDA 1WOQA 4IO8A 3VEZA 4YOUA 4AHRA 3SJJA 4CGJA 3NF7A 1OH6A 1W2BM 2E1ZA 3SZ2A 3I8DA 3DRRA 2QWPA 4FJNA 4KHYA 1ZBLA 1NM1A 1VSMA 3AVNA 1M1KO 3L8BA 4B9LA 3O6WA 3LP0A 2B5JA 5GIOA 4NCGA 3BEXA 1GOBA 3U9DA 4F2SA 3CJCA 3TAFA 3LZIA 2JLEA 1HNIA 5HLFA 3HL8A 3AO5A 4FJ8A 5M1KA 1RFQA 4HTUA 1EKEA 3AARA 5HP1A 4OLAA 5C42A 4CE9A 1VQMN 4BRIA 2KHOA 3D2EB 2UUCK 3NCIA 4MO4A 4DTPA 2ATQA 4IJAA 5MLCQ 2NRVA 4KH6A 1WSJA 4OGCA 2Y1JA 2HF4A 3VQ4A 3SBGA 3TAMA 3A2FA 4DTUA 3U9ZA 4DTSA 4JD2B 5FDLA 2ZGYA 3MN5A 2I5JA 2F8SA 2O8DA 1HQUA 4CHYA 4E3SA 1S1WA 3E01A 3TSQA 2GUPA 1N33K 3MN9A 4B1UB 2O8DB 1RNHA 1XHZA 3NH1A 4WFBL 3HPHA 2VG5A 4M63C 3L2QA 4B3OA 3CHWA 1Q18A 1RILA 5KRSA 1X9JA 1YVUA 5DM7L 4FLUA 3MK6A 4DFJA 3VA3A 2ZQBA 5AQOA 3AVBA 3HSTB 3HI0A 3B6PA 4BRCA 3VQ7A 2D5RA 2Q36A 3ZLJA 4DQRA 4FK0A 4B9VA 3AO3A 3RSEB 4K42A 1JJ2M 2NRWA 4N5SA 1T3VA 2XY8A 3LWLA 3D6RA 4H5VA 4RW6A 4CCHA 4DFKA 3AO4A 2HMPA 4I9LA 3ZCMA 4KHPK 3A0IX 2A1RA 5BPLA 1OH8A 4CEQA 1DTQA 1RDDA 3J7YP 3HK2A 4NXNK 1YXQA 4F3OA 4EAHD 1N36K 4A2BA 1WBBA 4JI1K 1NKCA 3T1AA 3QBXA 3WXKA 1V4TA 2G8IA 2FBXA 2OPSA 2YNIA 5E26A 3I0RA 4JKFA 1ZXOA 1WN7A 3LP1A 3L2UA 4JRQA 5J2PA 2F9WA 4OPHA 4BC3A 1RT1A 5JS2A 2QKKA 5BRHA 3BY5A 4JRPA 3WT0A 4ICLA 1K9MO 4J2BA 3KLEA 1UA0A 2KZZA 2HHHK 4CVNE 3CJAA 5AQLA 4UY8O 3CJBA 2E20A 3A8YA 4KTZA 3ZT2A 1FJGK 3EL2A 3FFKB 4CJLA 3EZ5A 4NLCA 2V7YA 4G9ZA 4IZ9A 3F9MA 3DOLA 4BR0A 3VTIA 3CERA 3HPGA 1EP4A 2IC3A 1HKBA 3OYFA 4DR2K 1HQEA 4KTWA 4I2QA 2WOMA 1NJYA 4CEFA 3K5MA 3SUPA 2VQFK 4CZJA 4AHUA 4B1XB 4X65K 3OYGA 1OH7A 1C6VA 4OVLA 4X66K 4KBOA 3W3DA 3WXIA 3S3MA 1CZBA 2ZGZA 1YAGA 3BGRA 4CZLA 1ILYA 4IKFA 4F9OA 1TAUA 3WEEA 3DI6A 2HHVA 2OANA 1VSFA 4EIAA 2WUSA 2I7NA 3T3FA 4B3TK 4M7XA 3C6AA 4O0JA 3D2FA 2O8FA 1NMDA 3BZCA 1S22A 2GV9A 1KRPA 4LF6K 4JS4A 4GNIA 4KI6A 4BRLA 4ELUA 3PLAA 4LH4A 4CFCA 1IG9A 1YVNA 5KPRA 2X6SA 4DQSA 5C25A 3TARA 3AVCA 3SQ1A 4EZ6A 1KAYA 3CF5L 1QZ6A 4CD1A 4CK3A 3VEYA 1ASWA 3VEVA 3ZSOA 4N56A 3SNNA 1ATNA 3D2FB 1NJIO 3K59A 4JKAA 3EE9A 3DRSA 2E8AA 3CMEN 5T7BA 1T44A 1TYQA 4L3QA 4CF2A 3MXIA 3V1QA 2QKBA 1EXQA 3CM6A 2G8HA 3TAEA 1X9MA 5H1SQ 2X74A 5AZJA 3AVGA 3IDHA 5JICA 2YKMA 3HXMA 4BRGA 1JLQA 3M8RA 1R59O 2OCEA 4OO1J 3ZSWA 2P9IB 4DS5A 3DWLA 4LF7K 4BRFA 4A5AA 4AM6A 3A5NC 1XMQK 4LFBK 1JLFA 5J2QA 4JKCA 1OVQA 3NE6A 1KSPA 2GUIA 5GIPA 3DLBA 1NK4A 3O1BA 1DTTA 2FLOA 2XY6A 3CCMN 1HRHA 2Z1HA 1JCEA 2HHQA 5AQYA 4CGFA 1NGCA 1KLNA 4ISEA 4YFUA 3FZLA 1VSLA 2A42A 3QFUA 1N5YA 4FJ9A 2O8CA 5BPMA 3HO1A 4EP5A 3E1YA 3PO5A 3HP6A 3WUHA 3DLGA 1RT5A 2GBZA 1SKRA 4IJNA 1HNXK 4MLEA 3V81A 3BDPA 4JKGB 1I94K 5HRPA 4JI4K 4Y0WA 1WSHA 4KPYA 3A5LC 3IUCA 3VESA 3KTQA 2O8BA 1RDBA 1NOZA 3SQ4A 4DQ8A 2IAJA 4DUZK 5BRDA 2DPNA 3VETA 1WB9A 3RR8A 4CZFA 4NYNA 1JKHA 4W5OA 4BE2A 3MDQA 3CD6N 2DFFA 1QQNA 1X1PA 4C8NA 3LL3A 4BDZA 1MWKA 3H46O 3ENHA 2QW9A 1QVFM 3VF6A 4GMJB 1X3NA 2O8EA 5EX5A 3L3UA 4ILJA 1BDGA 3VOVA 5KPTA 4M41A 3TTFA 3MN6A 4DR1K 1C0GA 3TANA 4CZMA 3GL1A 4IWVA 3QEWA 1VQPN 2F7TA 4FVUA 4BR2A 4FM1A 3C65A 2Z1IA 4BROA 4FJXA 4CEOA 5JVGL 4CF9A 2ZD1A 2KTQA 3ULEA 3OJUA 1VQON 4IEEA 4DLEA 4B9UA 4FJ7A 4M7YA 4H0YB 3MWPA 4CZKA 1HX1A 1NU0A 1U49A 2NUBA 3QETA 1E4FT 4JD2A 1JLAA 1VSEA 3ZSYA 1IKYA 2A6AA 1L3SA 5A2QO 4TSXA 1IKXA 2GX9A 1RGIA 5KGWA 2KW4A 3OJSA 2IVPA 1YI2N 4RW9A 1NJXA 2GTDA 4H5RA 4PHTX 3O5BA 1BOTO 1BCOA 2CH5A 4RG8A 1LCUA 1QS4A 4FPBA 1HNZK 4OKKA 4CEBA 3MCAB 3ZSZA 2G8WA 4DMNA 5LJVA 4JHDA 1VK0A 5C10A 1T6CA 4O8UA 3L6QA 3KIOA 5LMUK 2A5XA 4Y1DA 4DR5K 5TKWA 2E4LA 4CI6A 3I55N 1TL1A 4QS8A 4JK8A 1EQYA 4JYAK 1D4XA 4CK1A 4DQPA 1VQNN 4KAZA 3KHYA 3O3HA 3CCLN 4W5QA 1VSJA 3LPUA 3FE1A 5C15A 5AQSA 3AA5X 2E1YA 1L3UA 3K58A 4ZHRA 2F4VK 3O08A 3O9RA 4ELTA 2O8EB 3HRGA 1LAVA 1J9AA 2D0BA 1NK5A 4CESA 4YOXA 3CFPA 3L0QA 4H03B 3FZFA 4JI2K 1YJWN 3RMAA 3NGZA 3PO4A 1HJRA 1HYZA 2YHXA 3R9PA 4LD0A 3ALYA 2D0PA 3PIPL 3AA3A 5K14A 1RTHA 5C2DA 4BE1A 1CZ9A 3R1XA 4BC2A 1KAXA 1YTUA 4BR4A 1U45A 4B3MK 1BCMA 4XH1A 4HUGA 2HHUA 2J4RA 3WNFA 4LF5K 3ZT1A 4B9QA 1UWBA 1G15A 3TTDA 1B9DA 4DU3A 2KQ2A 4BE0A 3ZT3A 2E2NA 2HBKA 1D5AA 4OKEA 3K5NA 1ZBFA 1YIJN 5ELZA 2Q97A 4AQYK 4K8XA 4DTXA 1TK0A 5AQFA 3CCRN 3OA9A 4J2EA 3G6EN 5J1EA 4JI6K 2Q2RA 1KAZA 2IOCA 4E7KA 4KO0A 3L4QA 4FOEA 5EY4A 2HVIA 3KD1E 3I0SA 4CJUA 4H0XB 3V6DA 2XY7A 4CEAA 1CXQA 3VQAA 3OYJA 5FPMA 2G8VA 3KKSA 3MX5A 4LFAK 5IT9O 4FCYA 4FJHA 2O8FB 3SLCA 4CK2A 4E89A 4B8AB 4EHUA 4IG0A 1GLDG 1QSSA 3SUNA 1KLMA 3B8AX 4ELVA 5AQPA 3LPTA 4DV5K 1LAWA 4CBUA 1YT3A 3ITHA 3HZ6A 4I6MB 4JI0K 3NMUA 4WCEL 2HVHA 4BGBA 1KC8O 2D0CA 5HRSA 4Z0UA 1NGBA 4PY5A 4FWQA 2YHAA 4DSKA 3CJ9A 2UU9K 3VQCA 1IBMK 2ASOA 4AILC 1NK7A 4CFBA 2W6LA 3QEIA 4LSNA 3O9UA 5AQMA 1TAQA 1XWLA 1NWKA 3V9ZA 4B8CA 4CHNA 3L2WA 2P9UB 4XIUA 3U3YA 4CIGA 1QSYA 3KK1A 3VMFB 3GE1A 1L5UA 1RDAA 4H0TB 4M3YA 3N4PA 3AVFA 1EWQA 2QWQA 5ADXH 3OYDA 1ZBHA 3TPQA 3GOIA 3U8XA 4JN4A 3P1GA 2QI2A 4CGIA 4MFBA 2ZF5O 3JSMA 4Z4GA 3QNNA 1J5EK 3OYMA 1CZAN 2ZE2A 3SJHA 2D1KA 3AAQA 1ATRA 1QSLA 4B1ZA 1JLGA 3SMPA 3IAYA 2PBDA 3ZSQA 2F8TA 3AVAA 3HOTA 2P9LA 1TVRA 3ZETA 4FWLA 4IBNA 2YKNA 3ULEB 4WQ5A 4A59A 3M5RA 4FLZA 1KQSM 2QWMA 5C0YA 2KZMA 4CF1A 3O9SA 1D9DA 3WNGA 3FLCO 5I9EB 4KI4A 1JLEA 4RTFD 1BWFO 1XQSC 2V7ZA 3THYB 4CF0A 4DV2K 4BRHA 4DV6K 2E88A 3AVLA 3O3GA 4DS4A 4QAGA 4FPAA 4GVEA 1RBUA 3VQ6A 3IKMA 4F4KA 3NVKA 5CE3A 4CJ5A 3AGKA 4O5BA 3SBTA 3VENA 4GV6A 4YHHK 1WSEA 1C1BA 4CJ7A 1T8EA 3NF8A 5AZIB 1S1TA 4E7JA 4OPAA 3SAFA 3CCUN 3FFIA 4BREA 3LWMA 2EHGA 2QTDA 2BUPA 1X9WA 3P38A 4H5TA 4LFCK 4CZHA 4KB1A 4MDBA 4E19A 3H1VX 1S6PA 4NYFA 4HCBA 4FW2A 3CG7A 2ZM6K 1VQ7N 1SL2A 5SWMA 2NRTA 3MN7A 3M3ZA 4M45A 3ID8A 4BRDA 2YCHA 1ZYQA 1T03A 1Q81O 4E7HA 4JS5A 2DY4A 4CF8A 3SAHA 5GINA 4FSVA 1RT7A 4BQLA 5FRMA 3CQXA 2YHYA 4WQ4C 1IG8A 3T19A 4J2AA 3KVGA 2P51A 3NDKA 3OYNA 4GKKK 3QIOA 4E0DA 2HBLA 4C8LA 4R79A 1Q9XA 4OJRA 1L3VA 4XEIA 4FJMA 1LW2A 3VERA 3LM2A 4BRKA 3TTCA 4IFYA 3PX0A 4FK4A 3MX2A 3CPWM 2Y1IA 1QQCA 1Q9YA 3RSEA 1BA1A 5J2MA 3QICA 4IOXA 4K0KK 1HMVA 4DR6K 3AY9A 4CIFA 2OPPA 3HSCA 4FJLA 5M1NA 1QHTA 3ZX3A 2HBMA 3ZEUA 3TAQA 1QTMA 2FC0A 1UAXA 3VEOA 4RW7A 2JWLA 5AQJA 3EKSA 4M3WA 4B9MA 2HB5A 3NF9A 2FXUA 1FW6A 2P9LB 3M8QA 4HTLA 4FWPA 1KTQA 5M1QA 1IKVA 4ILGB 2CH6A 1NOYA 4CBWA 3SUOA 5HRNA 5AQTA 2PYJA 3AAPA 5FPDA 3O9QA 1TUUA 2W40A 2QWNA 3O3FA 1WNSA 2NZTA 1Z26A 4FO0A 3SQ2A 1LV5A 4B08A 3C7NA 4JAXA 4O55A 1O13A 4FM2A 3KWIA 2PY5A 3PIOL 1WBDA 2ASPA 3J7AP 3RWUA 4NB4A 3AVKA 1CLQA 4HCCA 4CZEA 5M1FA 4CJSA 2A40A 3H3OB 3CCVN 2HNDA 4FLWA 5B8HA 4AH9A 2BANA 4DTOA 4BY9C 4N41A 2JWKA 4E1MA 3LDSA 3QB0A 1SKSA 1Q86O 3OVNA 2UUBK 2IDOA 3ULDA 1C1AA 1KCFA 4XH4A 2ZWHA 2YX6A 3OS0A 3MEGA 3CQ8A 1YUWA 3LAMA 4E7LA 1KD1O 5LY3A 1GLJO 2FBTA 3LZJA 3VGLA 3SAGA 1LWCA 1FXXA 3E9LA 4DG1A 3K9KA 4CBXA 4DQQA 4QOZB 3LDPA 3BF3A 4DV4K 1UOCA 4IDHA 3WNEA 3E9PA 3U3GA 3M1FA 4W5NA 4IEIA 1ZBUA 3HJFA 4DF8A 2VQEK 2RN2A 4DU1A 4NCAA 1NGHA 1X9SA 1P8ZA 4OPKA 2HHWA 1NK0A 2D0OA 4CECA 3G71N 3TWHA 1MU2A 1RTDA 3V1RA 5KQ8A 5FROA 4DTMA 1WAJA 3MXJA 4BR9A 4FJIA 4JV5K 3NHGA 3AVMA 2W6KA 2YHBA 1Q8IA 1VQ8N 1M90O 4PL7A 2WC9A 3UIQA 1S9GA 2DFHA 3Q7BA 3D0PA 3EE8A 4WFAL 2HHTA 2GEMA 3QEPA 4CIEA 3UKRB 4FWNA 4M3RA 4EP4A 1Q7YO 5F1XA 4BG9A 3HYFA 2P5OA 5AQVA 5CHIA 2HHXA 3MMVA 3H6EA 3CFOA 4C8OA 2G8KA 3M8SA
chains in the Genus database with same CATH topology
3I8BA 5M1OA 3O08A 4BC4A 3H3NO 5M1KA 1VQON 4JK9A 1RFQA 3O9RA 4K25A 2VCPA 3HRGA 5EVZA 3AARA 3R3LA 1VQMN 2VGMA 4CZIA 4YOXA 3L0QA 1NGDA 3FZFA 4H03B 3TU5A 4A5BA 4BRIA 2KHOA 3D2EB 1NGJA 4U7BA 1YJWN 1K8KA 4MO4A 4A62A 5JMVA 5BPNA 5GAHP 1VQKN 3FR0A 2YHXA 3R9PA 3PIPL 2D0PA 5E84A 2QWLA 2YJEA 3CC2N 4IJAA 5MLCQ 2NRVA 4KH6A 2FF3B 4H0OA 4PL8A 4E1JA 5C2DA 1MWMA 5KPZA 3R1XA 4BC2A 1KAXA 1G99A 4AM7A 4YOVA 2HF4A 4BR4A 2FSJA 4XH1A 3SBGA 2J4RA 4H0PA 1KXPA 3IFRA 3J8AA 4B9QA 1U6ZA 3TTDA 3U9ZA 1K8AO 4JD2B 4O5FA 5AQKA 3CIPA 2ZGYA 3MN5A 3UKUA 1MDUB 2OTJN 3DXMB 2E2NA 3TSUA 2HBKA 2NLXA 2RE2A 1YIJN 5ELZA 2Q97A 3L4IA 4DB3A 1HKGA 3I33A 2GUPA 4H0VB 3EO3A 3TSQA 3CCSN 1NGIA 3MN9A 5KQDA 5AQFA 1K73O 4B1UB 4CD3A 3CCRN 3OA9A 3VGKA 3G6EN 2Q2RA 3UKUB 1KAZA 3ATUA 4WFBL 3R6MA 4WQ4A 1SS6A 4KH5A 4M63C 3L4QA 3CC7N 3UB5A 4BR5A 4FOEA 5EY4A 1Z05A 3A5MC 3KWGA 3CHWA 4H0XB 1Q18A 4FWSA 5JLFA 2QEXN 3FZKA 1X9JA 4I6MA 5DM7L 3MK6A 1X3MA 5FPMA 1C0FA 2H3GX 2UYTA 3MX5A 1J6ZA 3SLCA 1K8KB 4BRPA 1EO1A 3D2EA 2CGLA 5AQOA 1NBWA 3HI0A 4EHUA 5BR9A 4BRCA 5ADXA 2Q36A 2QWOA 1GLDG 5GADP 3RSEB 1NGAA 3B8AX 4FWOA 4K42A 1JJ2M 4H5WA 2NRWA 1KD1O 1T3VA 5AQPA 3R8EA 3ZYYX 3D6RA 4H5VA 4O8KA 1VQLN 2A41A 2HMPA 4CBUA 1N8RO 2D4WA 5JLHA 2WFBA 4FWKA 3TSPA 3A0IX 2KKZA 5BPLA 3HZ6A 4C23A 5GAGP 5AQUA 4A57A 2ZJQL 3BUZB 4I6MB 3NMUA 3DXKB 4WCEL 2NRRA 1GLEG 3QMLA 4BGBA 1KC8O 4BRMA 4BRNA 5TKYA 1GLCG 1YXQA 1NGBA 4GY2B 4FWQA 4EAHD 4H5NA 4GV3A 4A2BA 1BO5O 2QM1A 3BP8A 1U2VA 3CJ9A 3DXKA 2YHWA 2ASOA 3QBXA 3KZBA 2WBNA 4A61A 3WXKA 3O9UA 5AQMA 1GLBG 1V4TA 4JHDB 1YITN 1JCGA 3CJ1A 5E26A 3F5TA 4HWIA 4KH4A 4JKFA 1NWKA 1ZXOA 1HJOA 4IXCA 2F9WA 4OPHA 2P9UB 4K43A 4BC3A 3OW2M 1YHQN 5BRFA 5BRHA 2HBJA 2ITMA 3WT0A 5C12A 2E2PA 2NRXA 3VMFB 2BTFA 1IJJA 3GE1A 4WFNL 1K9MO 3GDQA 2KLAA 4IOCL 4H0TB 3DAWA 3LDQA 3N4PA 3CJAA 5AQLA 2E2QA 2QWQA 5ADXH 4JKEA 1YJNN 4UY8O 3CJBA 2E20A 3TPQA 3GOIA 3U8XA 4JN4A 2QXLA 4YORA 2QI2A 1VQ9N 4CZGA 1H1VA 1WUAA 3A8YA 3UE5A 2ZF5O 5JVHL 3EL2A 3FFKB 3O8MA 1CZAN 4NLCA 2V7YA 1HPMA 1W97L 4C1NK 4IZ9A 3F9MA 3KK7A 4A2AA 3WQUA 5AZIA 4BR0A 4EHTA 3DLLL 1YJ9N 3SJHA 2D1KA 2P9PA 3E9OA 2BH1A 3AAQA 3VTIA 1ATRA 3CERA 4DHYA 4B1ZA 4BVOA 3SMPA 2RHKA 2PBDA 3S41A 5FPNA 2IVNA 5AQHA 3LDLA 3O1WA 3QBWA 4YOYA 3HOTA 3P4IA 2NRZA 2P9LA 3ZETA 1HKBA 4FWLA 3UKRA 5LJWA 1VAZA 3ULEB 3WXJA 1S72N 4WQ5A 4IFEA 3LDOA 4A59A 4CZJA 1QQMA 1DKGD 4B1XB 3M5RA 1KQSM 4KBOA 4PKIA 2QWMA 3O9TA 5C0YA 4JKBA 4FOIA 3WEEB 3O9SA 3W3DA 2EWSA 3WXIA 4FWMA 5AQNA 2ZGZA 1YAGA 2GELA 3FLCO 3WXLA 4B1VA 1XUPO 3QDKA 5I9EB 3T7ZA 4CZLA 1ILYA 4RTFD 1BWFO 4F9OA 1XQSC 2IIRA 2V7ZA 3CMAN 2F9TA 5GAEP 3CETA 3WEEA 4BRHA 2E88A 3P31A 2OANA 4EIAA 3WXMB 2VGNA 2WUSA 3ZX2A 1P90A 4FPAA 2I7NA 4GVEA 4BRAA 3OBYA 4M7XA 3C6AA 5EXWA 3D2FA 1NMDA 4WYBA 3JXUA 1ZC6A 3HM8A 1S22A 4GNIA 1GLFO 3IKMA 3OBWA 4BRLA 2HF3A 3NVKA 3MCPA 5CE3A 5AFUA 5DM6L 3HTVA 3AGKA 3O80A 4NLBA 3SBTA 3VENA 3PLAA 4GV6A 1OVYA 3M6GA 5F2RA 5M1PA 5AQIA 2P9PB 4CJ7A 1YVNA 3CI5A 3LDNA 5AZIB 4BG8A 3HBTA 2V52B 5KPRA 4IO9L 1NLVA 4G9ZA 1BUPA 2CGJA 2Q0RA 4OPAA 4MO5A 3SAFA 3EZWA 3CCUN 3ENOA 1KAYA 4BREA 4YOWA 3CF5L 1GLAG 2QTDA 4PKHA 5HL7L 2BUPA 5AQQA 1QZ6A 4CD1A 3P38A 3VEYA 4H5TA 3VF4A 4CZHA 3VEVA 1BG3A 4MDBA 1ATNA 3D2FB 3H1VX 4JKDA 3VGMA 1NJIO 2VWBA 3EE9A 4JKAA 4DKWA 2AA4A 3VEWA 1VQ7N 1QQOA 2NRTA 4IOAL 3MN7A 3M3ZA 2IVOA 3ID8A 4ISGA 4BRDA 1SZ2A 2E8AA 3JS6A 2YCHA 3CMEN 1T44A 1TYQA 3OHRA 2ZJRL 4L3QA 1Q81O 2GWJA 3SAHA 5GINA 2P9NA 5H1SQ 4FSVA 4BQLA 5AZJA 3IDHA 2CGKA 3CQXA 5JICA 2YHYA 4WQ4C 1IG8A 4BVPA 3D7EO 4BGAA 4BRGA 1R59O 3QFPA 3CCQN 4OO1J 3KVGA 2P9IB 3DWLA 3VEXA 4BRFA 4A5AA 2HBLA 4AM6A 3A5NC 4R79A 1VQ4N 1DT9A 3GG4A 1TUYA 4JKCA 5GIPA 3O1BA 4XEIA 2AP1A 5BN8A 4LC9B 1SQKA 3VERA 3LM2A 2QWRA 3TTCA 2FLOA 4BRKA 4WF9L 4BRQA 4C1NI 1S3XA 3MX2A 3CPWM 3CCMN 1ESVA 1YF5L 2P9NB 1JCEA 3RSEA 1BA1A 3Q7CA 5AQYA 3CJ7A 4ILHA 3QICA 1NGCA 3P39A 4ISEA 3VPZA 3FZLA 2A42A 4IOXA 3SMSA 3QFUA 1T6DA 3EKUA 1Q82O 3AY9A 2QA4N 3HSCA 2FSKA 2ASMA 1ATSA 1Y64A 5EOYA 5BPMA 3ZX3A 5M1NA 5AQZA 3U4LA 2HBMA 3ZEUA 2A3ZA 3FGUA 3AGRA 3E1YA 3VEOA 2GWKA 4YOTA 3F2KA 2JWLA 3WUHA 5AQJA 3EKSA 4B1YB 3CQYA 2P9SB 4IJNA 4MLEA 4AF1A 4JNEA 3FZMA 4JKGB 2P9UA 1V4SA 2FXUA 1E4GT 2P9LB 3I56N 4HTLA 5AR0A 4Y0WA 4FWPA 3CCJN 2Q0UA 5M1QA 3C6HA 3A5LC 2E2OA 3IUCA 3DXMA 2P9KB 2CH6A 4ILGB 4J8FA 4WQ5C 3VESA 4CBWA 3VF2A 4DQ8A 5AQTA 5BRDA 2V51B 3AAPA 5FPDA 2DPNA 3O9QA 1TUUA 3VETA 4CZFA 2W40A 2QWNA 2NZTA 3VTHA 4BQZA 2HOEA 4FO0A 3C0BA 2W41A 3MDQA 3CD6N 2Q31A 3ENBA 1QQNA 5AFUH 1Z6RA 3C7NA 4JAXA 3G4SN 5HOOA 1O13A 2FSNA 3KWIA 3LL3A 2P9SA 3PIOL 2ASPA 1MWKA 4PKGA 3IMXA 4YDUC 5BREA 3H46O 2HSTA 3ZX0A 3CCEN 3ENHA 4NO7A 2YI1A 4NB4A 1BU6O 2QW9A 3DJCA 5AQWA 3VF6A 1VQ5N 1QVFM 2PFUA 5BN9A 3ZEUB 3SK3A 4CZEA 5M1FA 1X3NA 2A40A 3H3OB 5AZJB 3RVCA 5EX5A 4ILJA 3CCVN 1BDGA 3VOVA 1SAZA 4RCHA 3NVMA 5KPTA 1ZBSA 3MWTA 3TTFA 3MN6A 1C0GA 5B8HA 1BA0A 3N4QA 4GV9A 1RDUA 4CZMA 3GL1A 1LOTB 1VQ6N 1GLLO 4IWVA 4BY9C 1NGEA 2JWKA 3CPEA 3G25A 3H45C 3CXCM 1VQPN 2F7TA 4FVUA 4BR2A 3QB0A 3C65A 5AQRA 1DGKN 3ID6A 4BROA 1Q86O 3GBTA 5JVGL 2Q1NA 2OTLN 3ATVA 4XH4A 2ZJPL 2ZWHA 3LM9A 4B1WB 4Z94A 3ULEA 2YX6A 4DCHA 1RDWX 1HKCA 1YUWA 3C7NB 4IEEA 4JEPA 5AQGA 1GLJO 5LY3A 1OKJA 3A5OC 4M7YA 4H0YB 3MWPA 4QS7A 1MA9B 3VGLA 4CZKA 3T69A 3SAGA 1HX1A 3EN9A 3E66A 3O4WA 3E9LA 4RWTA 1E4FT 2NNWA 3K9KA 4CBXA 4BR7A 4JD2A 3W0LA 1DEJA 3LDPA 3BF3A 2P9KA 4MLHA 2A6AA 4IDHA 1TYQB 2I7PA 3E9PA 4FWRA 3M1FA 4ISFA 2GX9A 1HLUA 1RGIA 4JKGA 4XH5A 4JKHA 2IVPA 2FF6A 1JCFA 4IEIA 1YI2N 3K9JA 2GTDA 4H5RA 4PHTX 1NGGA 4QS9A 3WQTA 3O5BA 1BOTO 1NGHA 2PAVA 2CH5A 4JK7A 1P8ZA 1HUXA 2NRHA 1LCUA 4YDUA 5CR4A 2D0OA 1XC3A 4BC5A 4FPBA 3G71N 5AQXA 3J7ZO 3MCAB 5KQ8A 1NGFA 1WOQA 2YJFA 4BR9A 5LJVA 4JHDA 4IO8A 5C10A 5FPEA 1T6CA 4O8UA 3L6QA 3VEZA 4YOUA 2A5XA 4EFHA 5TKWA 1W2BM 2E1ZA 3HOSA 1VQ8N 4CI6A 5F0XA 1U2VB 3I55N 1M90O 4PL7A 3CC4N 2WC9A 4JK8A 4QS8A 1EQYA 2QWPA 3Q7BA 3EE8A 4WFAL 2GEMA 1NM1A 1M1KO 1D4XA 3UKRB 1QZ5A 4FWNA 3O6WA 3ZETB 1QHAA 2VYPA 4U67L 1Q7YO 5F1XA 4BG9A 5C2FA 1VQNN 5AQVA 5CHIA 3H1QA 3KHYA 3FZHA 5GIOA 3CCLN 3BF1A 3MMVA 3BEXA 3H6EA 4K41A 3FE1A 5C15A 5AQSA 4FL9A 3U9DA 3CJCA 2E1YA 1QVGM 2P9IA 4MDAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R1X A;  3T69 A; 
#chains in the Genus database with same CATH topology
 3I8B A;  5M1O A;  4BC4 A;  4IFV A;  2VCP A;  2YNH A;  2OZS A;  1U48 A;  4BAC A;  4A5B A;  1NGJ A;  1S1V A;  1S1X A;  3ZSX A;  4Q5V A;  3SQ0 A;  5JMV A;  1HNV A;  5BPN A;  5GAH P;  3CC2 N;  2QWL A;  2YJE A;  3PX6 A;  2O4G A;  1Z25 A;  1W0H A;  4J2D A;  2QK9 A;  2UXD K;  4PL8 A;  1MWM A;  5KPZ A;  1C0U A;  4O0I A;  1TK5 A;  4JLH A;  3AV9 A;  5CYQ A;  4WE1 A;  3K0S A;  1KXP A;  3IFR A;  3J8A A;  1U6Z A;  1TKZ A;  5FRN A;  1K8A O;  5AQK A;  1BI4 B;  3CIP A;  3UKU A;  1MDU B;  2OTJ N;  3TSU A;  2NLX A;  5LL6 Z;  3L4I A;  4DB3 A;  1HKG A;  4H0V B;  3CCS N;  1K73 O;  4CGG A;  3VQD A;  5HRO A;  3UKU B;  2G8U A;  3R6M A;  4WQ4 A;  3CC7 N;  5LMN K;  3UB5 A;  3VQQ A;  1C0M A;  4CEZ A;  1RBT A;  3KWG A;  3PUF A;  2W42 A;  5JLF A;  3FZK A;  3JAM O;  1X3M A;  4FVM A;  1KVC A;  4N47 A;  1K8K B;  2CGL A;  4CFD A;  5BR9 A;  5GAD P;  2UXC K;  1NGA A;  4FWO A;  2B4J A;  3R8E A;  3ZSR A;  3ZYY X;  4KV8 A;  4O8K A;  1VQL N;  2A41 A;  1CXU A;  2D4W A;  3VQ5 A;  3MXM A;  3KLG A;  4C23 A;  1S9E A;  5GAG P;  4DV0 K;  3SI6 A;  4CJK A;  4A57 A;  4M3U A;  3BUZ B;  3DXK B;  1GLE G;  3MED A;  2F96 A;  1GLC G;  3OS1 A;  4GY2 B;  3LP3 A;  2QM1 A;  1U2V A;  2OPQ A;  3DXK A;  2YHW A;  1BHL A;  4ZTF A;  1TV6 A;  3C6T A;  3KZB A;  3PSF A;  1GLB G;  4JHD B;  4CHP A;  1YIT N;  3AA2 A;  1JCG A;  3F5T A;  4HWI A;  1NJZ A;  1HJO A;  4K43 A;  1TGO A;  1IBK K;  4Z4E A;  5BRF A;  4CGH A;  3K5O A;  4DR7 K;  3M8P A;  2ITM A;  2E2P A;  1ASU A;  2BTF A;  1IJJ A;  1HR0 K;  4H8K A;  4IOC L;  2E2Q A;  4Z4C A;  1YJN N;  3OYL A;  1NMN A;  3T1Y K;  4DF4 A;  4Z4F A;  3BZK A;  4ID5 A;  1VQ9 N;  3AO1 A;  3UE5 A;  5JVH L;  4CED A;  4W5T A;  1HPM A;  1W97 L;  3J81 O;  1YJ9 N;  4A2A A;  4EHT A;  3WQU A;  5AZI A;  2P9P A;  3LAL A;  3VN5 A;  4DHY A;  4BVO A;  1D9F A;  3RRH A;  2P1J A;  4KHN A;  3S41 A;  5FPN A;  1RTJ A;  2B6A A;  2ETJ A;  5AQH A;  3LDL A;  2RPI A;  3RRG A;  2OPR A;  3UKR A;  5LJW A;  3OTO K;  3WXJ A;  4FW1 A;  1S72 N;  4IFE A;  3LDO A;  3B6O A;  1DKG D;  1GOA A;  2LSN A;  3KLF A;  4PKI A;  3RMB A;  4JKB A;  1JLC A;  4FOI A;  2UUA K;  2EWS A;  3ISN C;  4Z4H A;  3C95 A;  3HM9 A;  2XO7 A;  2O8C B;  4JI8 K;  2GEL A;  4B1V A;  1XUP O;  3QDK A;  3T7Z A;  1VRU A;  2HNZ A;  4HUE A;  2IIR A;  4V19 S;  5GAE P;  1SL1 A;  2Z1G A;  4H4M A;  3P31 A;  2BDP A;  4DSL A;  4CJR A;  3WXM B;  3THV A;  1BL3 A;  1SKW A;  3ZX2 A;  3TAB A;  3SV4 A;  3OBY A;  3OYB A;  1ASV A;  2X6N A;  4N76 A;  4R5P A;  3JXU A;  1ZC6 A;  3HM8 A;  4CER A;  1U47 A;  3MCP A;  3SYZ A;  1S1U A;  3HTV A;  3O80 A;  3DMJ A;  3KKR A;  4FM0 A;  5F2R A;  3CI5 A;  4LSL A;  4CJT A;  3S9H A;  4BG8 A;  3HBT A;  4KFB A;  1FKP A;  3SUQ A;  1BUP A;  2Q0R A;  1XNR K;  3EZW A;  3OYC A;  3ENO A;  4M3Z A;  3ZSV A;  4PKH A;  5AQQ A;  2KFN A;  4BWJ A;  4OKJ A;  1BG3 A;  1RTI A;  4JKD A;  4AHC A;  4DQI A;  2VWB A;  4DKW A;  2AA4 A;  1JL1 A;  4KB0 A;  4ZTJ A;  2IVO A;  3D45 A;  1T05 A;  1SZ2 A;  4B3R K;  2ZJR L;  4CJQ A;  2RKI A;  2RF2 A;  2CGK A;  4F3T A;  4BVP A;  3AVH A;  1UA1 A;  3EYZ A;  3QFP A;  3CCQ N;  4FLV A;  4F8R A;  1J54 A;  1TK8 A;  3VEX A;  3NH2 A;  4DR4 K;  3V4I A;  2IS3 A;  3KK3 A;  1DT9 A;  3GG4 A;  1TUY A;  4OX9 K;  3AVJ A;  3F73 A;  4PWD A;  1WSI A;  1SQK A;  4EZ9 A;  2QWR A;  3NGY A;  4BRQ A;  2FBV A;  3QER A;  1YF5 L;  1ESV A;  5C24 A;  4M42 A;  1HNW K;  3Q7C A;  3CJ7 A;  3P39 A;  3VPZ A;  4HUF A;  3DYA A;  2AJQ A;  3SMS A;  3SV3 A;  1T6D A;  3EKU A;  1Q82 O;  4Y1C A;  4CEE A;  4IDK A;  3HT3 A;  2ASM A;  1ATS A;  5D3G A;  3PY8 A;  3U4L A;  4CHO A;  3AGR A;  3L2R A;  3OYA A;  2GWK A;  4YOT A;  1TKD A;  1BQM A;  4B1Y B;  3CQY A;  4JNE A;  3DOK A;  1E4G T;  1SL0 A;  3CM5 A;  4DUY K;  2WON A;  2Q0U A;  3CCJ N;  3PX4 A;  2OZM A;  4FJ5 A;  4J8F A;  3DXM A;  2P9K B;  1RT3 A;  4WQ5 C;  3KLH A;  4FLY A;  2V51 B;  1VSI A;  4C8M A;  3NFA A;  2G8F A;  3H08 A;  3C0B A;  3EEQ A;  3PV8 A;  3ENB A;  4X62 K;  5AFU H;  4DR3 K;  4DTN A;  3G4S N;  3HPO A;  2P9S A;  4LF4 K;  4PKG A;  3IMX A;  4YDU C;  5KRT A;  2HST A;  2PZS A;  4IG3 A;  4NO7 A;  1J53 A;  1VQ5 N;  1BU6 O;  3DJC A;  5CZ2 A;  2VWJ A;  2PFU A;  4CHZ A;  3MAQ A;  5BN9 A;  5HRR A;  3QLH A;  3PSI A;  3ZEU B;  3HVT A;  3RVC A;  3THW B;  2BE2 A;  4JI3 K;  3VQB A;  1ZBS A;  3MWT A;  4E7I A;  4GV9 A;  1RDU A;  1LOT B;  3VQP A;  3THX B;  3K5L A;  4KHU A;  3CPE A;  3G25 A;  3H45 C;  3CXC M;  4FZY A;  4ID1 A;  3WNH A;  5AQR A;  1DGK N;  3ID6 A;  1REV A;  3GBT A;  2OTL N;  2Q1N A;  4K8Z A;  3ATV A;  2ZJP L;  3LM9 A;  4B1W B;  4Z94 A;  4FXD A;  1HKC A;  4YY3 K;  3V9W A;  4H4O A;  4OGE A;  4QS7 A;  1MA9 B;  3O4W A;  3TAG A;  3VQ8 A;  4BR7 A;  4M3T A;  3W0L A;  1GOC A;  2P9K A;  4MLH A;  5I3U A;  2I7P A;  4ISF A;  5I42 A;  1HLU A;  1JXE A;  4KKO A;  4JKG A;  4XH5 A;  4JKH A;  1B92 A;  2FF6 A;  3K9J A;  1NKB A;  1NGG A;  1SV5 A;  4GVM A;  3WQT A;  4KHS A;  1HUX A;  2VWK A;  3QES A;  3LAN A;  4YDU A;  2XY5 A;  5DK5 A;  4BC5 A;  5AQX A;  3THY A;  3LAK A;  3OS2 A;  2UXB K;  1NGF A;  2A1S A;  2YJF A;  2DFE A;  3DRP A;  3KLI A;  5FPE A;  4M3X A;  3DLR A;  5DMR A;  1WSF A;  4B9N A;  4EFH A;  3HOS A;  5F0X A;  1U2V B;  3CC4 N;  3CFR A;  1BI4 A;  2E6L A;  1R0A A;  4AHS A;  1QZ5 A;  4UQG A;  3ZET B;  1QHA A;  2VYP A;  4U67 L;  4Q0B A;  5C2F A;  3ZT0 A;  3H1Q A;  3FZH A;  4HVJ A;  3BF1 A;  4LF8 K;  4K41 A;  3SCX A;  1HPZ A;  1YTA A;  1K6Y A;  4OPJ A;  4FL9 A;  1QVG M;  2P9I A;  4MDA A;  3DLE A;  3H3N O;  3TI0 A;  4JK9 A;  4K25 A;  3THW A;  1BIS A;  1LWF A;  5EVZ A;  3R3L A;  4C8K A;  2VGM A;  4CZI A;  1NGD A;  3TU5 A;  4U7B A;  1K8K A;  1VSK A;  4A62 A;  2XHB A;  1VQK N;  3FR0 A;  1ITG A;  3AO2 A;  5E84 A;  4NXM K;  2FF3 B;  2XRI A;  4H0O A;  4E1J A;  3NF6 A;  3QNO A;  4CFA A;  1G99 A;  3C6U A;  4AM7 A;  3HP9 A;  4YOV A;  1NG9 A;  4F2R A;  1VSD A;  2FSJ A;  4H0P A;  1TKX A;  5J2N A;  4KRF A;  1NJW A;  4O5F A;  3V9S A;  2R7Y A;  4BDP A;  1WLJ A;  3DXM B;  2WTU A;  2Q3S A;  2YNG A;  4HHT A;  2RE2 A;  4FJJ A;  1RCH A;  3I33 A;  3HVR A;  3EO3 A;  1NGI A;  5KQD A;  1A5V A;  4CD3 A;  3VGK A;  3ATU A;  4CJP A;  1SS6 A;  4KH5 A;  4YNQ A;  4BR5 A;  2Z1J A;  1Z05 A;  3A5M C;  1HYV A;  1IO2 A;  4DLG A;  5CZ1 A;  4FWS A;  2QEX N;  4I6M A;  1C0F A;  3IS9 A;  2H3G X;  2UYT A;  1J6Z A;  4PQU A;  2QXF A;  4BRP A;  1EO1 A;  3D2E A;  1NBW A;  4BWM A;  2EX3 A;  2ITG A;  5ADX A;  2QWO A;  1BQN A;  3K2P A;  2O4I A;  4Z4I A;  4H5W A;  1KVB A;  4GW6 A;  1Y97 A;  1N8R O;  5JLH A;  2WFB A;  4FWK A;  3TSP A;  1I39 A;  4QCL A;  2DTU A;  2KKZ A;  5AQU A;  3IRX A;  1E3M A;  2ZJQ L;  2NRR A;  3QML A;  4FK2 A;  4BRM A;  4BRN A;  5TKY A;  1DLO A;  4DSI A;  3F9K A;  4H5N A;  5AJ3 K;  1BO5 O;  1RDC A;  1RBS A;  3BP8 A;  1XHX A;  4GV3 A;  3MEE A;  3NH0 A;  2WBN A;  2YNF A;  3NBP A;  4A61 A;  4G1Q A;  3CJ1 A;  1JL2 A;  4KH4 A;  4KRE A;  3V9X A;  4IXC A;  3OW2 M;  1YHQ N;  2KFZ A;  2HBJ A;  5BR8 K;  4DFM A;  4MQ3 A;  5C12 A;  5HBM A;  4JI5 K;  2NRX A;  4WFN L;  1RT6 A;  3GDQ A;  2KLA A;  3DAW A;  3LDQ A;  4FZX C;  1NKE A;  3QIP A;  4B3S K;  4JKE A;  3G10 A;  4JI7 K;  4YOR A;  1O1W A;  2QXL A;  4CZG A;  3V9U A;  1H1V A;  2VG6 A;  1WUA A;  1C0T A;  3J80 O;  2FBY A;  3O8M A;  4C1N K;  3KK7 A;  3DLL L;  4B9T A;  4LF9 K;  3E9O A;  2BH1 A;  3S3N A;  3LP2 A;  2OYQ A;  2RHK A;  2YV0 X;  3QIN A;  3ASM A;  3AVI A;  3NAE A;  1NK9 A;  2BGG A;  2IVN A;  3O1W A;  3QBW A;  4YOY A;  1QE1 A;  3P4I A;  4DV3 K;  2NRZ A;  3RTV A;  5JS1 A;  1VAZ A;  3G0Z A;  4CJV A;  1VHX A;  2E6M A;  3EY1 A;  4CJF A;  1QQM A;  5E41 A;  3L2V A;  3RR7 A;  4I9Q A;  3O9T A;  4KHQ A;  3WEE B;  2HMI A;  4CJE A;  4FWM A;  5AQN A;  5KI6 A;  3WXL A;  4DSJ A;  4FZZ A;  3V1O A;  1XMO K;  3CMA N;  2F9T A;  3CET A;  3U6F A;  1WAF A;  1VSH A;  2HHS A;  1FK9 A;  5EU7 A;  1C1C A;  2VGN A;  4B9S A;  1P90 A;  4CGD A;  4BRA A;  5EXW A;  3RMD A;  4WYB A;  1VRT A;  1N34 K;  4DFP A;  1GLF O;  3OBW A;  2HF3 A;  5AFU A;  5DM6 L;  3SPZ A;  1JXB A;  4NLB A;  1OVY A;  3M6G A;  4KHW A;  5M1P A;  3IG1 A;  5AQI A;  2P9P B;  3LDN A;  2V52 B;  4IO9 L;  1NLV A;  2CGJ A;  1S6Q A;  4MO5 A;  3DM2 A;  3OYK A;  1IKW A;  4YOW A;  2D0A A;  1GLA G;  1TKT A;  5HL7 L;  3ZT4 A;  4NCB A;  3DLH A;  3VF4 A;  1NK6 A;  3VGM A;  4FLT A;  4DSF A;  3QEV A;  2X78 A;  3VEW A;  1QQO A;  3DLK A;  4IOA L;  4DTJ A;  4ISG A;  1LW0 A;  3JS6 A;  3JYT A;  3OHR A;  1EWR A;  2GWJ A;  1NNE A;  3S3O A;  2P9N A;  3OYI A;  4DSE A;  2HNY A;  1U04 A;  3D7E O;  4BGA A;  2JGU A;  1XI1 A;  4E1N A;  1ZBI A;  1S5J A;  4FYD A;  1IV0 A;  1U4B A;  1LWE A;  1D8Y A;  3O4Q A;  1VQ4 N;  4GKJ K;  3TAP A;  2IGI A;  2AP1 A;  5BN8 A;  5IWA K;  4LC9 B;  1KVA A;  4WF9 L;  5FLX O;  4C1N I;  3NGI A;  1S3X A;  4FJG A;  2O8B B;  2P9N B;  5KGX A;  1FKO A;  4AHT A;  3O4N A;  4RW8 A;  4DV1 K;  4ILH A;  3OYH A;  3THX A;  3SPY A;  3TR8 A;  4I2P A;  1N32 K;  2QA4 N;  3AA4 A;  2FSK A;  4DU4 A;  1Y64 A;  5EOY A;  3RMC A;  1L3T A;  5AQZ A;  5SZT A;  5CY4 A;  2A3Z A;  3QO9 A;  3FGU A;  1JLB A;  3CYM A;  3F2K A;  3T1H K;  1XNQ K;  2P9S B;  4OLB A;  4AF1 A;  1A5X A;  1RBR A;  2P9U A;  3FZM A;  1V4S A;  4DV7 K;  4W5R A;  1OH5 A;  3K57 A;  3OY9 A;  3I56 N;  5AR0 A;  1KFS A;  3C6H A;  2E2O A;  4CJ3 A;  3L3V A;  3KD5 E;  3VA0 A;  3VF2 A;  1W7A A;  1EET A;  1BGX T;  1RT4 A;  3MEC A;  1F21 A;  3VTH A;  4BQZ A;  2HOE A;  4CJW A;  2W41 A;  1BIU A;  2Q31 A;  4I7F A;  4PUO A;  1Z6R A;  5CYM A;  5HOO A;  2FSN A;  1J5O A;  1T7P A;  3QEX A;  5BRE A;  3ZX0 A;  3CCE N;  1BIZ A;  5AQW A;  2YI1 A;  1RBV A;  3P83 D;  4O4G A;  2P5G A;  4L8R B;  3SK3 A;  2VG7 A;  4DWI A;  5AZJ B;  1RT2 A;  3OYE A;  1EX4 A;  1SAZ A;  4RCH A;  3NVM A;  1BA0 A;  3N4Q A;  1VQ6 N;  1GLL O;  1TL3 A;  4DTR A;  1XC9 A;  1NGE A;  2PYL A;  1IBL K;  1IH7 A;  1NK8 A;  1W9H A;  3KJV A;  2HW3 A;  4CHQ A;  4CJ4 A;  4DCH A;  1HYS A;  3C94 A;  1RDW X;  3C7N B;  4AHV A;  5AQG A;  4JEP A;  4X64 K;  1OKJ A;  3A5O C;  5KTQ A;  4LH5 A;  4O44 A;  3T69 A;  3EN9 A;  4BDY A;  3E66 A;  1I3A A;  4RWT A;  2E5L K;  4KTQ A;  2NNW A;  2OA8 A;  4FLX A;  1DEJ A;  4RW4 A;  3KK2 A;  1WSG A;  1TYQ B;  4LY7 A;  4FWR A;  3VQE A;  3P5J A;  1JCF A;  1SUQ A;  1A5W A;  3VQ9 A;  4QS9 A;  1N6Q A;  4CW7 B;  4FJK A;  4JK7 A;  2PAV A;  1B9F A;  2NRH A;  5CR4 A;  1XC3 A;  3J7Z O;  4PA1 A;  1KFD A;  1WOQ A;  4IO8 A;  3VEZ A;  4YOU A;  4AHR A;  3SJJ A;  4CGJ A;  3NF7 A;  1OH6 A;  1W2B M;  2E1Z A;  3SZ2 A;  3I8D A;  3DRR A;  2QWP A;  4FJN A;  4KHY A;  1ZBL A;  1NM1 A;  1VSM A;  3AVN A;  1M1K O;  3L8B A;  4B9L A;  3O6W A;  3LP0 A;  2B5J A;  5GIO A;  4NCG A;  3BEX A;  1GOB A;  3U9D A;  4F2S A;  3CJC A;  3TAF A;  3LZI A;  2JLE A;  1HNI A;  5HLF A;  3HL8 A;  3AO5 A;  4FJ8 A;  5M1K A;  1RFQ A;  4HTU A;  1EKE A;  3AAR A;  5HP1 A;  4OLA A;  5C42 A;  4CE9 A;  1VQM N;  4BRI A;  2KHO A;  3D2E B;  2UUC K;  3NCI A;  4MO4 A;  4DTP A;  2ATQ A;  4IJA A;  5MLC Q;  2NRV A;  4KH6 A;  1WSJ A;  4OGC A;  2Y1J A;  2HF4 A;  3VQ4 A;  3SBG A;  3TAM A;  3A2F A;  4DTU A;  3U9Z A;  4DTS A;  4JD2 B;  5FDL A;  2ZGY A;  3MN5 A;  2I5J A;  2F8S A;  2O8D A;  1HQU A;  4CHY A;  4E3S A;  1S1W A;  3E01 A;  3TSQ A;  2GUP A;  1N33 K;  3MN9 A;  4B1U B;  2O8D B;  1RNH A;  1XHZ A;  3NH1 A;  4WFB L;  3HPH A;  2VG5 A;  4M63 C;  3L2Q A;  4B3O A;  3CHW A;  1Q18 A;  1RIL A;  5KRS A;  1X9J A;  1YVU A;  5DM7 L;  4FLU A;  3MK6 A;  4DFJ A;  3VA3 A;  2ZQB A;  5AQO A;  3AVB A;  3HST B;  3HI0 A;  3B6P A;  4BRC A;  3VQ7 A;  2D5R A;  2Q36 A;  3ZLJ A;  4DQR A;  4FK0 A;  4B9V A;  3AO3 A;  3RSE B;  4K42 A;  1JJ2 M;  2NRW A;  4N5S A;  1T3V A;  2XY8 A;  3LWL A;  3D6R A;  4H5V A;  4RW6 A;  4CCH A;  4DFK A;  3AO4 A;  2HMP A;  4I9L A;  3ZCM A;  4KHP K;  3A0I X;  2A1R A;  5BPL A;  1OH8 A;  4CEQ A;  1DTQ A;  1RDD A;  3J7Y P;  3HK2 A;  4NXN K;  1YXQ A;  4F3O A;  4EAH D;  1N36 K;  4A2B A;  1WBB A;  4JI1 K;  1NKC A;  3T1A A;  3QBX A;  3WXK A;  1V4T A;  2G8I A;  2FBX A;  2OPS A;  2YNI A;  5E26 A;  3I0R A;  4JKF A;  1ZXO A;  1WN7 A;  3LP1 A;  3L2U A;  4JRQ A;  5J2P A;  2F9W A;  4OPH A;  4BC3 A;  1RT1 A;  5JS2 A;  2QKK A;  5BRH A;  3BY5 A;  4JRP A;  3WT0 A;  4ICL A;  1K9M O;  4J2B A;  3KLE A;  1UA0 A;  2KZZ A;  2HHH K;  4CVN E;  3CJA A;  5AQL A;  4UY8 O;  3CJB A;  2E20 A;  3A8Y A;  4KTZ A;  3ZT2 A;  1FJG K;  3EL2 A;  3FFK B;  4CJL A;  3EZ5 A;  4NLC A;  2V7Y A;  4G9Z A;  4IZ9 A;  3F9M A;  3DOL A;  4BR0 A;  3VTI A;  3CER A;  3HPG A;  1EP4 A;  2IC3 A;  1HKB A;  3OYF A;  4DR2 K;  1HQE A;  4KTW A;  4I2Q A;  2WOM A;  1NJY A;  4CEF A;  3K5M A;  3SUP A;  2VQF K;  4CZJ A;  4AHU A;  4B1X B;  4X65 K;  3OYG A;  1OH7 A;  1C6V A;  4OVL A;  4X66 K;  4KBO A;  3W3D A;  3WXI A;  3S3M A;  1CZB A;  2ZGZ A;  1YAG A;  3BGR A;  4CZL A;  1ILY A;  4IKF A;  4F9O A;  1TAU A;  3WEE A;  3DI6 A;  2HHV A;  2OAN A;  1VSF A;  4EIA A;  2WUS A;  2I7N A;  3T3F A;  4B3T K;  4M7X A;  3C6A A;  4O0J A;  3D2F A;  2O8F A;  1NMD A;  3BZC A;  1S22 A;  2GV9 A;  1KRP A;  4LF6 K;  4JS4 A;  4GNI A;  4KI6 A;  4BRL A;  4ELU A;  3PLA A;  4LH4 A;  4CFC A;  1IG9 A;  1YVN A;  5KPR A;  2X6S A;  4DQS A;  5C25 A;  3TAR A;  3AVC A;  3SQ1 A;  4EZ6 A;  1KAY A;  3CF5 L;  1QZ6 A;  4CD1 A;  4CK3 A;  3VEY A;  1ASW A;  3VEV A;  3ZSO A;  4N56 A;  3SNN A;  1ATN A;  3D2F B;  1NJI O;  3K59 A;  4JKA A;  3EE9 A;  3DRS A;  2E8A A;  3CME N;  5T7B A;  1T44 A;  1TYQ A;  4L3Q A;  4CF2 A;  3MXI A;  3V1Q A;  2QKB A;  1EXQ A;  3CM6 A;  2G8H A;  3TAE A;  1X9M A;  5H1S Q;  2X74 A;  5AZJ A;  3AVG A;  3IDH A;  5JIC A;  2YKM A;  3HXM A;  4BRG A;  1JLQ A;  3M8R A;  1R59 O;  2OCE A;  4OO1 J;  3ZSW A;  2P9I B;  4DS5 A;  3DWL A;  4LF7 K;  4BRF A;  4A5A A;  4AM6 A;  3A5N C;  1XMQ K;  4LFB K;  1JLF A;  5J2Q A;  4JKC A;  1OVQ A;  3NE6 A;  1KSP A;  2GUI A;  5GIP A;  3DLB A;  1NK4 A;  3O1B A;  1DTT A;  2FLO A;  2XY6 A;  3CCM N;  1HRH A;  2Z1H A;  1JCE A;  2HHQ A;  5AQY A;  4CGF A;  1NGC A;  1KLN A;  4ISE A;  4YFU A;  3FZL A;  1VSL A;  2A42 A;  3QFU A;  1N5Y A;  4FJ9 A;  2O8C A;  5BPM A;  3HO1 A;  4EP5 A;  3E1Y A;  3PO5 A;  3HP6 A;  3WUH A;  3DLG A;  1RT5 A;  2GBZ A;  1SKR A;  4IJN A;  1HNX K;  4MLE A;  3V81 A;  3BDP A;  4JKG B;  1I94 K;  5HRP A;  4JI4 K;  4Y0W A;  1WSH A;  4KPY A;  3A5L C;  3IUC A;  3VES A;  3KTQ A;  2O8B A;  1RDB A;  1NOZ A;  3SQ4 A;  4DQ8 A;  2IAJ A;  4DUZ K;  5BRD A;  2DPN A;  3VET A;  1WB9 A;  3RR8 A;  4CZF A;  4NYN A;  1JKH A;  4W5O A;  4BE2 A;  3MDQ A;  3CD6 N;  2DFF A;  1QQN A;  1X1P A;  4C8N A;  3LL3 A;  4BDZ A;  1MWK A;  3H46 O;  3ENH A;  2QW9 A;  1QVF M;  3VF6 A;  4GMJ B;  1X3N A;  2O8E A;  5EX5 A;  3L3U A;  4ILJ A;  1BDG A;  3VOV A;  5KPT A;  4M41 A;  3TTF A;  3MN6 A;  4DR1 K;  1C0G A;  3TAN A;  4CZM A;  3GL1 A;  4IWV A;  3QEW A;  1VQP N;  2F7T A;  4FVU A;  4BR2 A;  4FM1 A;  3C65 A;  2Z1I A;  4BRO A;  4FJX A;  4CEO A;  5JVG L;  4CF9 A;  2ZD1 A;  2KTQ A;  3ULE A;  3OJU A;  1VQO N;  4IEE A;  4DLE A;  4B9U A;  4FJ7 A;  4M7Y A;  4H0Y B;  3MWP A;  4CZK A;  1HX1 A;  1NU0 A;  1U49 A;  2NUB A;  3QET A;  1E4F T;  4JD2 A;  1JLA A;  1VSE A;  3ZSY A;  1IKY A;  2A6A A;  1L3S A;  5A2Q O;  4TSX A;  1IKX A;  2GX9 A;  1RGI A;  5KGW A;  2KW4 A;  3OJS A;  2IVP A;  1YI2 N;  4RW9 A;  1NJX A;  2GTD A;  4H5R A;  4PHT X;  3O5B A;  1BOT O;  1BCO A;  2CH5 A;  4RG8 A;  1LCU A;  1QS4 A;  4FPB A;  1HNZ K;  4OKK A;  4CEB A;  3MCA B;  3ZSZ A;  2G8W A;  4DMN A;  5LJV A;  4JHD A;  1VK0 A;  5C10 A;  1T6C A;  4O8U A;  3L6Q A;  3KIO A;  5LMU K;  2A5X A;  4Y1D A;  4DR5 K;  5TKW A;  2E4L A;  4CI6 A;  3I55 N;  1TL1 A;  4QS8 A;  4JK8 A;  1EQY A;  4JYA K;  1D4X A;  4CK1 A;  4DQP A;  1VQN N;  4KAZ A;  3KHY A;  3O3H A;  3CCL N;  4W5Q A;  1VSJ A;  3LPU A;  3FE1 A;  5C15 A;  5AQS A;  3AA5 X;  2E1Y A;  1L3U A;  3K58 A;  4ZHR A;  2F4V K;  3O08 A;  3O9R A;  4ELT A;  2O8E B;  3HRG A;  1LAV A;  1J9A A;  2D0B A;  1NK5 A;  4CES A;  4YOX A;  3CFP A;  3L0Q A;  4H03 B;  3FZF A;  4JI2 K;  1YJW N;  3RMA A;  3NGZ A;  3PO4 A;  1HJR A;  1HYZ A;  2YHX A;  3R9P A;  4LD0 A;  3ALY A;  2D0P A;  3PIP L;  3AA3 A;  5K14 A;  1RTH A;  5C2D A;  4BE1 A;  1CZ9 A;  3R1X A;  4BC2 A;  1KAX A;  1YTU A;  4BR4 A;  1U45 A;  4B3M K;  1BCM A;  4XH1 A;  4HUG A;  2HHU A;  2J4R A;  3WNF A;  4LF5 K;  3ZT1 A;  4B9Q A;  1UWB A;  1G15 A;  3TTD A;  1B9D A;  4DU3 A;  2KQ2 A;  4BE0 A;  3ZT3 A;  2E2N A;  2HBK A;  1D5A A;  4OKE A;  3K5N A;  1ZBF A;  1YIJ N;  5ELZ A;  2Q97 A;  4AQY K;  4K8X A;  4DTX A;  1TK0 A;  5AQF A;  3CCR N;  3OA9 A;  4J2E A;  3G6E N;  5J1E A;  4JI6 K;  2Q2R A;  1KAZ A;  2IOC A;  4E7K A;  4KO0 A;  3L4Q A;  4FOE A;  5EY4 A;  2HVI A;  3KD1 E;  3I0S A;  4CJU A;  4H0X B;  3V6D A;  2XY7 A;  4CEA A;  1CXQ A;  3VQA A;  3OYJ A;  5FPM A;  2G8V A;  3KKS A;  3MX5 A;  4LFA K;  5IT9 O;  4FCY A;  4FJH A;  2O8F B;  3SLC A;  4CK2 A;  4E89 A;  4B8A B;  4EHU A;  4IG0 A;  1GLD G;  1QSS A;  3SUN A;  1KLM A;  3B8A X;  4ELV A;  5AQP A;  3LPT A;  4DV5 K;  1LAW A;  4CBU A;  1YT3 A;  3ITH A;  3HZ6 A;  4I6M B;  4JI0 K;  3NMU A;  4WCE L;  2HVH A;  4BGB A;  1KC8 O;  2D0C A;  5HRS A;  4Z0U A;  1NGB A;  4PY5 A;  4FWQ A;  2YHA A;  4DSK A;  3CJ9 A;  2UU9 K;  3VQC A;  1IBM K;  2ASO A;  4AIL C;  1NK7 A;  4CFB A;  2W6L A;  3QEI A;  4LSN A;  3O9U A;  5AQM A;  1TAQ A;  1XWL A;  1NWK A;  3V9Z A;  4B8C A;  4CHN A;  3L2W A;  2P9U B;  4XIU A;  3U3Y A;  4CIG A;  1QSY A;  3KK1 A;  3VMF B;  3GE1 A;  1L5U A;  1RDA A;  4H0T B;  4M3Y A;  3N4P A;  3AVF A;  1EWQ A;  2QWQ A;  5ADX H;  3OYD A;  1ZBH A;  3TPQ A;  3GOI A;  3U8X A;  4JN4 A;  3P1G A;  2QI2 A;  4CGI A;  4MFB A;  2ZF5 O;  3JSM A;  4Z4G A;  3QNN A;  1J5E K;  3OYM A;  1CZA N;  2ZE2 A;  3SJH A;  2D1K A;  3AAQ A;  1ATR A;  1QSL A;  4B1Z A;  1JLG A;  3SMP A;  3IAY A;  2PBD A;  3ZSQ A;  2F8T A;  3AVA A;  3HOT A;  2P9L A;  1TVR A;  3ZET A;  4FWL A;  4IBN A;  2YKN A;  3ULE B;  4WQ5 A;  4A59 A;  3M5R A;  4FLZ A;  1KQS M;  2QWM A;  5C0Y A;  2KZM A;  4CF1 A;  3O9S A;  1D9D A;  3WNG A;  3FLC O;  5I9E B;  4KI4 A;  1JLE A;  4RTF D;  1BWF O;  1XQS C;  2V7Z A;  3THY B;  4CF0 A;  4DV2 K;  4BRH A;  4DV6 K;  2E88 A;  3AVL A;  3O3G A;  4DS4 A;  4QAG A;  4FPA A;  4GVE A;  1RBU A;  3VQ6 A;  3IKM A;  4F4K A;  3NVK A;  5CE3 A;  4CJ5 A;  3AGK A;  4O5B A;  3SBT A;  3VEN A;  4GV6 A;  4YHH K;  1WSE A;  1C1B A;  4CJ7 A;  1T8E A;  3NF8 A;  5AZI B;  1S1T A;  4E7J A;  4OPA A;  3SAF A;  3CCU N;  3FFI A;  4BRE A;  3LWM A;  2EHG A;  2QTD A;  2BUP A;  1X9W A;  3P38 A;  4H5T A;  4LFC K;  4CZH A;  4KB1 A;  4MDB A;  4E19 A;  3H1V X;  1S6P A;  4NYF A;  4HCB A;  4FW2 A;  3CG7 A;  2ZM6 K;  1VQ7 N;  1SL2 A;  5SWM A;  2NRT A;  3MN7 A;  3M3Z A;  4M45 A;  3ID8 A;  4BRD A;  2YCH A;  1ZYQ A;  1T03 A;  1Q81 O;  4E7H A;  4JS5 A;  2DY4 A;  4CF8 A;  3SAH A;  5GIN A;  4FSV A;  1RT7 A;  4BQL A;  5FRM A;  3CQX A;  2YHY A;  4WQ4 C;  1IG8 A;  3T19 A;  4J2A A;  3KVG A;  2P51 A;  3NDK A;  3OYN A;  4GKK K;  3QIO A;  4E0D A;  2HBL A;  4C8L A;  4R79 A;  1Q9X A;  4OJR A;  1L3V A;  4XEI A;  4FJM A;  1LW2 A;  3VER A;  3LM2 A;  4BRK A;  3TTC A;  4IFY A;  3PX0 A;  4FK4 A;  3MX2 A;  3CPW M;  2Y1I A;  1QQC A;  1Q9Y A;  3RSE A;  1BA1 A;  5J2M A;  3QIC A;  4IOX A;  4K0K K;  1HMV A;  4DR6 K;  3AY9 A;  4CIF A;  2OPP A;  3HSC A;  4FJL A;  5M1N A;  1QHT A;  3ZX3 A;  2HBM A;  3ZEU A;  3TAQ A;  1QTM A;  2FC0 A;  1UAX A;  3VEO A;  4RW7 A;  2JWL A;  5AQJ A;  3EKS A;  4M3W A;  4B9M A;  2HB5 A;  3NF9 A;  2FXU A;  1FW6 A;  2P9L B;  3M8Q A;  4HTL A;  4FWP A;  1KTQ A;  5M1Q A;  1IKV A;  4ILG B;  2CH6 A;  1NOY A;  4CBW A;  3SUO A;  5HRN A;  5AQT A;  2PYJ A;  3AAP A;  5FPD A;  3O9Q A;  1TUU A;  2W40 A;  2QWN A;  3O3F A;  1WNS A;  2NZT A;  1Z26 A;  4FO0 A;  3SQ2 A;  1LV5 A;  4B08 A;  3C7N A;  4JAX A;  4O55 A;  1O13 A;  4FM2 A;  3KWI A;  2PY5 A;  3PIO L;  1WBD A;  2ASP A;  3J7A P;  3RWU A;  4NB4 A;  3AVK A;  1CLQ A;  4HCC A;  4CZE A;  5M1F A;  4CJS A;  2A40 A;  3H3O B;  3CCV N;  2HND A;  4FLW A;  5B8H A;  4AH9 A;  2BAN A;  4DTO A;  4BY9 C;  4N41 A;  2JWK A;  4E1M A;  3LDS A;  3QB0 A;  1SKS A;  1Q86 O;  3OVN A;  2UUB K;  2IDO A;  3ULD A;  1C1A A;  1KCF A;  4XH4 A;  2ZWH A;  2YX6 A;  3OS0 A;  3MEG A;  3CQ8 A;  1YUW A;  3LAM A;  4E7L A;  1KD1 O;  5LY3 A;  1GLJ O;  2FBT A;  3LZJ A;  3VGL A;  3SAG A;  1LWC A;  1FXX A;  3E9L A;  4DG1 A;  3K9K A;  4CBX A;  4DQQ A;  4QOZ B;  3LDP A;  3BF3 A;  4DV4 K;  1UOC A;  4IDH A;  3WNE A;  3E9P A;  3U3G A;  3M1F A;  4W5N A;  4IEI A;  1ZBU A;  3HJF A;  4DF8 A;  2VQE K;  2RN2 A;  4DU1 A;  4NCA A;  1NGH A;  1X9S A;  1P8Z A;  4OPK A;  2HHW A;  1NK0 A;  2D0O A;  4CEC A;  3G71 N;  3TWH A;  1MU2 A;  1RTD A;  3V1R A;  5KQ8 A;  5FRO A;  4DTM A;  1WAJ A;  3MXJ A;  4BR9 A;  4FJI A;  4JV5 K;  3NHG A;  3AVM A;  2W6K A;  2YHB A;  1Q8I A;  1VQ8 N;  1M90 O;  4PL7 A;  2WC9 A;  3UIQ A;  1S9G A;  2DFH A;  3Q7B A;  3D0P A;  3EE8 A;  4WFA L;  2HHT A;  2GEM A;  3QEP A;  4CIE A;  3UKR B;  4FWN A;  4M3R A;  4EP4 A;  1Q7Y O;  5F1X A;  4BG9 A;  3HYF A;  2P5O A;  5AQV A;  5CHI A;  2HHX A;  3MMV A;  3H6E A;  3CFO A;  4C8O A;  2G8K A;  3M8S A; 
#chains in the Genus database with same CATH homology
 3I8B A;  5M1O A;  3O08 A;  4BC4 A;  3H3N O;  5M1K A;  1VQO N;  4JK9 A;  1RFQ A;  3O9R A;  4K25 A;  2VCP A;  3HRG A;  5EVZ A;  3AAR A;  3R3L A;  1VQM N;  2VGM A;  4CZI A;  4YOX A;  3L0Q A;  1NGD A;  3FZF A;  4H03 B;  3TU5 A;  4A5B A;  4BRI A;  2KHO A;  3D2E B;  1NGJ A;  4U7B A;  1YJW N;  1K8K A;  4MO4 A;  4A62 A;  5JMV A;  5BPN A;  5GAH P;  1VQK N;  3FR0 A;  2YHX A;  3R9P A;  3PIP L;  2D0P A;  5E84 A;  2QWL A;  2YJE A;  3CC2 N;  4IJA A;  5MLC Q;  2NRV A;  4KH6 A;  2FF3 B;  4H0O A;  4PL8 A;  4E1J A;  5C2D A;  1MWM A;  5KPZ A;  3R1X A;  4BC2 A;  1KAX A;  1G99 A;  4AM7 A;  4YOV A;  2HF4 A;  4BR4 A;  2FSJ A;  4XH1 A;  3SBG A;  2J4R A;  4H0P A;  1KXP A;  3IFR A;  3J8A A;  4B9Q A;  1U6Z A;  3TTD A;  3U9Z A;  1K8A O;  4JD2 B;  4O5F A;  5AQK A;  3CIP A;  2ZGY A;  3MN5 A;  3UKU A;  1MDU B;  2OTJ N;  3DXM B;  2E2N A;  3TSU A;  2HBK A;  2NLX A;  2RE2 A;  1YIJ N;  5ELZ A;  2Q97 A;  3L4I A;  4DB3 A;  1HKG A;  3I33 A;  2GUP A;  4H0V B;  3EO3 A;  3TSQ A;  3CCS N;  1NGI A;  3MN9 A;  5KQD A;  5AQF A;  1K73 O;  4B1U B;  4CD3 A;  3CCR N;  3OA9 A;  3VGK A;  3G6E N;  2Q2R A;  3UKU B;  1KAZ A;  3ATU A;  4WFB L;  3R6M A;  4WQ4 A;  1SS6 A;  4KH5 A;  4M63 C;  3L4Q A;  3CC7 N;  3UB5 A;  4BR5 A;  4FOE A;  5EY4 A;  1Z05 A;  3A5M C;  3KWG A;  3CHW A;  4H0X B;  1Q18 A;  4FWS A;  5JLF A;  2QEX N;  3FZK A;  1X9J A;  4I6M A;  5DM7 L;  3MK6 A;  1X3M A;  5FPM A;  1C0F A;  2H3G X;  2UYT A;  3MX5 A;  1J6Z A;  3SLC A;  1K8K B;  4BRP A;  1EO1 A;  3D2E A;  2CGL A;  5AQO A;  1NBW A;  3HI0 A;  4EHU A;  5BR9 A;  4BRC A;  5ADX A;  2Q36 A;  2QWO A;  1GLD G;  5GAD P;  3RSE B;  1NGA A;  3B8A X;  4FWO A;  4K42 A;  1JJ2 M;  4H5W A;  2NRW A;  1KD1 O;  1T3V A;  5AQP A;  3R8E A;  3ZYY X;  3D6R A;  4H5V A;  4O8K A;  1VQL N;  2A41 A;  2HMP A;  4CBU A;  1N8R O;  2D4W A;  5JLH A;  2WFB A;  4FWK A;  3TSP A;  3A0I X;  2KKZ A;  5BPL A;  3HZ6 A;  4C23 A;  5GAG P;  5AQU A;  4A57 A;  2ZJQ L;  3BUZ B;  4I6M B;  3NMU A;  3DXK B;  4WCE L;  2NRR A;  1GLE G;  3QML A;  4BGB A;  1KC8 O;  4BRM A;  4BRN A;  5TKY A;  1GLC G;  1YXQ A;  1NGB A;  4GY2 B;  4FWQ A;  4EAH D;  4H5N A;  4GV3 A;  4A2B A;  1BO5 O;  2QM1 A;  3BP8 A;  1U2V A;  3CJ9 A;  3DXK A;  2YHW A;  2ASO A;  3QBX A;  3KZB A;  2WBN A;  4A61 A;  3WXK A;  3O9U A;  5AQM A;  1GLB G;  1V4T A;  4JHD B;  1YIT N;  1JCG A;  3CJ1 A;  5E26 A;  3F5T A;  4HWI A;  4KH4 A;  4JKF A;  1NWK A;  1ZXO A;  1HJO A;  4IXC A;  2F9W A;  4OPH A;  2P9U B;  4K43 A;  4BC3 A;  3OW2 M;  1YHQ N;  5BRF A;  5BRH A;  2HBJ A;  2ITM A;  3WT0 A;  5C12 A;  2E2P A;  2NRX A;  3VMF B;  2BTF A;  1IJJ A;  3GE1 A;  4WFN L;  1K9M O;  3GDQ A;  2KLA A;  4IOC L;  4H0T B;  3DAW A;  3LDQ A;  3N4P A;  3CJA A;  5AQL A;  2E2Q A;  2QWQ A;  5ADX H;  4JKE A;  1YJN N;  4UY8 O;  3CJB A;  2E20 A;  3TPQ A;  3GOI A;  3U8X A;  4JN4 A;  2QXL A;  4YOR A;  2QI2 A;  1VQ9 N;  4CZG A;  1H1V A;  1WUA A;  3A8Y A;  3UE5 A;  2ZF5 O;  5JVH L;  3EL2 A;  3FFK B;  3O8M A;  1CZA N;  4NLC A;  2V7Y A;  1HPM A;  1W97 L;  4C1N K;  4IZ9 A;  3F9M A;  3KK7 A;  4A2A A;  3WQU A;  5AZI A;  4BR0 A;  4EHT A;  3DLL L;  1YJ9 N;  3SJH A;  2D1K A;  2P9P A;  3E9O A;  2BH1 A;  3AAQ A;  3VTI A;  1ATR A;  3CER A;  4DHY A;  4B1Z A;  4BVO A;  3SMP A;  2RHK A;  2PBD A;  3S41 A;  5FPN A;  2IVN A;  5AQH A;  3LDL A;  3O1W A;  3QBW A;  4YOY A;  3HOT A;  3P4I A;  2NRZ A;  2P9L A;  3ZET A;  1HKB A;  4FWL A;  3UKR A;  5LJW A;  1VAZ A;  3ULE B;  3WXJ A;  1S72 N;  4WQ5 A;  4IFE A;  3LDO A;  4A59 A;  4CZJ A;  1QQM A;  1DKG D;  4B1X B;  3M5R A;  1KQS M;  4KBO A;  4PKI A;  2QWM A;  3O9T A;  5C0Y A;  4JKB A;  4FOI A;  3WEE B;  3O9S A;  3W3D A;  2EWS A;  3WXI A;  4FWM A;  5AQN A;  2ZGZ A;  1YAG A;  2GEL A;  3FLC O;  3WXL A;  4B1V A;  1XUP O;  3QDK A;  5I9E B;  3T7Z A;  4CZL A;  1ILY A;  4RTF D;  1BWF O;  4F9O A;  1XQS C;  2IIR A;  2V7Z A;  3CMA N;  2F9T A;  5GAE P;  3CET A;  3WEE A;  4BRH A;  2E88 A;  3P31 A;  2OAN A;  4EIA A;  3WXM B;  2VGN A;  2WUS A;  3ZX2 A;  1P90 A;  4FPA A;  2I7N A;  4GVE A;  4BRA A;  3OBY A;  4M7X A;  3C6A A;  5EXW A;  3D2F A;  1NMD A;  4WYB A;  3JXU A;  1ZC6 A;  3HM8 A;  1S22 A;  4GNI A;  1GLF O;  3IKM A;  3OBW A;  4BRL A;  2HF3 A;  3NVK A;  3MCP A;  5CE3 A;  5AFU A;  5DM6 L;  3HTV A;  3AGK A;  3O80 A;  4NLB A;  3SBT A;  3VEN A;  3PLA A;  4GV6 A;  1OVY A;  3M6G A;  5F2R A;  5M1P A;  5AQI A;  2P9P B;  4CJ7 A;  1YVN A;  3CI5 A;  3LDN A;  5AZI B;  4BG8 A;  3HBT A;  2V52 B;  5KPR A;  4IO9 L;  1NLV A;  4G9Z A;  1BUP A;  2CGJ A;  2Q0R A;  4OPA A;  4MO5 A;  3SAF A;  3EZW A;  3CCU N;  3ENO A;  1KAY A;  4BRE A;  4YOW A;  3CF5 L;  1GLA G;  2QTD A;  4PKH A;  5HL7 L;  2BUP A;  5AQQ A;  1QZ6 A;  4CD1 A;  3P38 A;  3VEY A;  4H5T A;  3VF4 A;  4CZH A;  3VEV A;  1BG3 A;  4MDB A;  1ATN A;  3D2F B;  3H1V X;  4JKD A;  3VGM A;  1NJI O;  2VWB A;  3EE9 A;  4JKA A;  4DKW A;  2AA4 A;  3VEW A;  1VQ7 N;  1QQO A;  2NRT A;  4IOA L;  3MN7 A;  3M3Z A;  2IVO A;  3ID8 A;  4ISG A;  4BRD A;  1SZ2 A;  2E8A A;  3JS6 A;  2YCH A;  3CME N;  1T44 A;  1TYQ A;  3OHR A;  2ZJR L;  4L3Q A;  1Q81 O;  2GWJ A;  3SAH A;  5GIN A;  2P9N A;  5H1S Q;  4FSV A;  4BQL A;  5AZJ A;  3IDH A;  2CGK A;  3CQX A;  5JIC A;  2YHY A;  4WQ4 C;  1IG8 A;  4BVP A;  3D7E O;  4BGA A;  4BRG A;  1R59 O;  3QFP A;  3CCQ N;  4OO1 J;  3KVG A;  2P9I B;  3DWL A;  3VEX A;  4BRF A;  4A5A A;  2HBL A;  4AM6 A;  3A5N C;  4R79 A;  1VQ4 N;  1DT9 A;  3GG4 A;  1TUY A;  4JKC A;  5GIP A;  3O1B A;  4XEI A;  2AP1 A;  5BN8 A;  4LC9 B;  1SQK A;  3VER A;  3LM2 A;  2QWR A;  3TTC A;  2FLO A;  4BRK A;  4WF9 L;  4BRQ A;  4C1N I;  1S3X A;  3MX2 A;  3CPW M;  3CCM N;  1ESV A;  1YF5 L;  2P9N B;  1JCE A;  3RSE A;  1BA1 A;  3Q7C A;  5AQY A;  3CJ7 A;  4ILH A;  3QIC A;  1NGC A;  3P39 A;  4ISE A;  3VPZ A;  3FZL A;  2A42 A;  4IOX A;  3SMS A;  3QFU A;  1T6D A;  3EKU A;  1Q82 O;  3AY9 A;  2QA4 N;  3HSC A;  2FSK A;  2ASM A;  1ATS A;  1Y64 A;  5EOY A;  5BPM A;  3ZX3 A;  5M1N A;  5AQZ A;  3U4L A;  2HBM A;  3ZEU A;  2A3Z A;  3FGU A;  3AGR A;  3E1Y A;  3VEO A;  2GWK A;  4YOT A;  3F2K A;  2JWL A;  3WUH A;  5AQJ A;  3EKS A;  4B1Y B;  3CQY A;  2P9S B;  4IJN A;  4MLE A;  4AF1 A;  4JNE A;  3FZM A;  4JKG B;  2P9U A;  1V4S A;  2FXU A;  1E4G T;  2P9L B;  3I56 N;  4HTL A;  5AR0 A;  4Y0W A;  4FWP A;  3CCJ N;  2Q0U A;  5M1Q A;  3C6H A;  3A5L C;  2E2O A;  3IUC A;  3DXM A;  2P9K B;  2CH6 A;  4ILG B;  4J8F A;  4WQ5 C;  3VES A;  4CBW A;  3VF2 A;  4DQ8 A;  5AQT A;  5BRD A;  2V51 B;  3AAP A;  5FPD A;  2DPN A;  3O9Q A;  1TUU A;  3VET A;  4CZF A;  2W40 A;  2QWN A;  2NZT A;  3VTH A;  4BQZ A;  2HOE A;  4FO0 A;  3C0B A;  2W41 A;  3MDQ A;  3CD6 N;  2Q31 A;  3ENB A;  1QQN A;  5AFU H;  1Z6R A;  3C7N A;  4JAX A;  3G4S N;  5HOO A;  1O13 A;  2FSN A;  3KWI A;  3LL3 A;  2P9S A;  3PIO L;  2ASP A;  1MWK A;  4PKG A;  3IMX A;  4YDU C;  5BRE A;  3H46 O;  2HST A;  3ZX0 A;  3CCE N;  3ENH A;  4NO7 A;  2YI1 A;  4NB4 A;  1BU6 O;  2QW9 A;  3DJC A;  5AQW A;  3VF6 A;  1VQ5 N;  1QVF M;  2PFU A;  5BN9 A;  3ZEU B;  3SK3 A;  4CZE A;  5M1F A;  1X3N A;  2A40 A;  3H3O B;  5AZJ B;  3RVC A;  5EX5 A;  4ILJ A;  3CCV N;  1BDG A;  3VOV A;  1SAZ A;  4RCH A;  3NVM A;  5KPT A;  1ZBS A;  3MWT A;  3TTF A;  3MN6 A;  1C0G A;  5B8H A;  1BA0 A;  3N4Q A;  4GV9 A;  1RDU A;  4CZM A;  3GL1 A;  1LOT B;  1VQ6 N;  1GLL O;  4IWV A;  4BY9 C;  1NGE A;  2JWK A;  3CPE A;  3G25 A;  3H45 C;  3CXC M;  1VQP N;  2F7T A;  4FVU A;  4BR2 A;  3QB0 A;  3C65 A;  5AQR A;  1DGK N;  3ID6 A;  4BRO A;  1Q86 O;  3GBT A;  5JVG L;  2Q1N A;  2OTL N;  3ATV A;  4XH4 A;  2ZJP L;  2ZWH A;  3LM9 A;  4B1W B;  4Z94 A;  3ULE A;  2YX6 A;  4DCH A;  1RDW X;  1HKC A;  1YUW A;  3C7N B;  4IEE A;  4JEP A;  5AQG A;  1GLJ O;  5LY3 A;  1OKJ A;  3A5O C;  4M7Y A;  4H0Y B;  3MWP A;  4QS7 A;  1MA9 B;  3VGL A;  4CZK A;  3T69 A;  3SAG A;  1HX1 A;  3EN9 A;  3E66 A;  3O4W A;  3E9L A;  4RWT A;  1E4F T;  2NNW A;  3K9K A;  4CBX A;  4BR7 A;  4JD2 A;  3W0L A;  1DEJ A;  3LDP A;  3BF3 A;  2P9K A;  4MLH A;  2A6A A;  4IDH A;  1TYQ B;  2I7P A;  3E9P A;  4FWR A;  3M1F A;  4ISF A;  2GX9 A;  1HLU A;  1RGI A;  4JKG A;  4XH5 A;  4JKH A;  2IVP A;  2FF6 A;  1JCF A;  4IEI A;  1YI2 N;  3K9J A;  2GTD A;  4H5R A;  4PHT X;  1NGG A;  4QS9 A;  3WQT A;  3O5B A;  1BOT O;  1NGH A;  2PAV A;  2CH5 A;  4JK7 A;  1P8Z A;  1HUX A;  2NRH A;  1LCU A;  4YDU A;  5CR4 A;  2D0O A;  1XC3 A;  4BC5 A;  4FPB A;  3G71 N;  5AQX A;  3J7Z O;  3MCA B;  5KQ8 A;  1NGF A;  1WOQ A;  2YJF A;  4BR9 A;  5LJV A;  4JHD A;  4IO8 A;  5C10 A;  5FPE A;  1T6C A;  4O8U A;  3L6Q A;  3VEZ A;  4YOU A;  2A5X A;  4EFH A;  5TKW A;  1W2B M;  2E1Z A;  3HOS A;  1VQ8 N;  4CI6 A;  5F0X A;  1U2V B;  3I55 N;  1M90 O;  4PL7 A;  3CC4 N;  2WC9 A;  4JK8 A;  4QS8 A;  1EQY A;  2QWP A;  3Q7B A;  3EE8 A;  4WFA L;  2GEM A;  1NM1 A;  1M1K O;  1D4X A;  3UKR B;  1QZ5 A;  4FWN A;  3O6W A;  3ZET B;  1QHA A;  2VYP A;  4U67 L;  1Q7Y O;  5F1X A;  4BG9 A;  5C2F A;  1VQN N;  5AQV A;  5CHI A;  3H1Q A;  3KHY A;  3FZH A;  5GIO A;  3CCL N;  3BF1 A;  3MMV A;  3BEX A;  3H6E A;  4K41 A;  3FE1 A;  5C15 A;  5AQS A;  4FL9 A;  3U9D A;  3CJC A;  2E1Y A;  1QVG M;  2P9I A;  4MDA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...