1RTDA

Structure of a catalytic complex of hiv-1 reverse transcriptase: implications for nucleoside analog drug resistance
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
554
structure length
554
Chain Sequence
KISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTDTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDESESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA TEMPLATE FOR REVERSE TRANSCRIPTASE
publication title Structure of a covalently trapped catalytic complex of HIV-1 reverse transcriptase: implications for drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 136
structure length 554
sequence length 554
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rtdA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtdA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtdA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtdA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rtdA05
1NNDA 3CQ8A 1VSMA 3VQAA 4ZP6A 3SNNA 4LY7A 4CGDA 1WSGA 3NGZA 4KHUA 5KT7A 4HUGA 3MR6A 5J2PA 3HP9A 4CFBA 4I2QB 5KFAA 3HPGA 3GIKA 3G86A 5DLGA 1KLMB 1RNHA 4C8KA 2KZMA 1IKXB 4RW7B 4J2DA 3I8DA 1EP4A 5J1EB 3HVWA 3B6OA 2VWJA 1FK9A 2JEFA 4H4MB 4WE1A 5HRPA 3SUPA 3FRZA 4Y1DA 1RTHA 5CZ1A 3PX0A 4CJ5A 2E6LA 4O3RA 2BQRA 4RW8A 4CJ4A 3QNOA 5CZ2A 4KAIA 5KFQA 4LQ9A 2FLNA 5DMRA 3VQDA 4IOBA 3IN5A 5KFWA 4GVMA 4FLXA 2OPQB 1QHTA 4CHOA 3RR7A 3BQ1A 3K58A 1LAWA 4I7FA 2W9AA 4EYIB 1XR6A 4O4GB 3GYNA 2AGPA 2YNIA 4Z4GA 2RPIA 4IFYA 4TQSA 4H54A 4QWDA 2OYQA 3T5KA 1DTQB 3OYCA 4PUOA 2YNGA 2OA8A 3RRHA 4DLGA 5KFFA 4KHWA 5HLFB 1REVA 3AVBA 3I0SB 2WHOA 1QSYA 3M9MB 3ITHB 4KKOA 2UUTA 4HVJA 3M8QA 3N6MA 1I6JA 2E6MA 3CJ3A 1HYVA 2IJNA 2JEIA 3KLEA 4LSLA 5DG8A 2IM1A 3AO1A 3G6VA 3BQ2A 2XY8A 4BDYA 4WFYA 3MEGA 1D1UA 4DL4A 3OJSA 4NZ0A 1KFDA 3RWUA 4FJXA 4CF9A 4Z0UA 2HVIA 4WXWA 4EEYA 4M41A 1SUQA 2WK4A 3V6HA 3DDKA 3LWLA 3Q8RB 3QEWA 3VQ8A 2GIRA 2DFHA 5KG5A 1VSIA 1UOCA 2G8KA 3NAHA 4URGA 3E51A 2ZE2B 2AJQA 2O5DA 1SH0A 4IBNA 3IS9A 4RZRA 2C28A 4I2PA 4NLSA 5KG4A 4KO0A 1NKBA 5I42A 4KTWA 2UVRA 3UR0A 1KSPA 3GV5B 2UUWA 1XC9A 1LWCA 2G8WA 1ZBIA 4OLBA 1KCFA 4DTRA 1U4BA 4JV2A 3C6TB 2HHXA 4GW6A 1J53A 2D0AA 4MK9A 4ZTFA 3VQQA 4IDKA 1RBRA 4YMEA 5HP1A 3VQSA 4IG3A 3NKYA 2W9CB 3V9WA 4B9VA 1TK0A 3RMAA 4E89A 3DOKA 3D0PA 2AX0A 1SKSA 4TY8A 4KTQA 4ELUA 4F4KA 1TL1B 5KFCA 2V4RA 5JS2A 4FS1A 1IKYA 3SPYA 2IAJB 1RT6B 3CDWA 1VRTB 4ICLA 1XR5A 3MEDB 1HYZA 1IH7A 3P5JA 4ZPDA 4ZVGA 2YNFA 1R0AB 4KHYA 4E7LA 4DEZA 3QEIA 2R2RA 3HP6A 2UVUA 3AVGA 4ED1A 4CEQA 5EWFA 4ZHRA 4N76A 3LANA 5EDWA 5L1JA 1N5YA 2P1JA 3MAQA 2RF2B 1U47A 4N56A 3DLKA 2J6UA 3F9KA 2J6TA 3KHHA 3O4NA 4CEZA 1X1PA 1WSJA 5F9NA 3RB0A 4I2QA 4IKFA 2IM0A 4E19A 3LZJA 5DG7A 4C8OA 1IKXA 1UWBB 4RW7A 2WB4A 3VQ9A 5J1EA 3SQ1A 5KFXA 4KB7A 5KG2A 1XHZA 3NL0A 1C1BA 2Y1IA 4ZPBA 3KIOA 2R2TA 4ZVHA 3B6PA 3V9UA 3LP1B 4FJKA 3HO1A 4M42A 3TVKA 2ASJA 3ISNC 2IGIA 2XY6A 5KGXA 4H4OB 2ATLA 4HKQA 4URQU 1JLBB 2D3UA 4WZMA 4Z4HA 2XY7A 4CHPA 5KFZA 3S3MA 5J2MB 4O4GA 4E3SA 4DFMA 4K4VA 3KOAA 1YVUA 4URSA 3VQ6A 1DTQA 4BE0A 3PW5A 1T05B 1JXBA 2XI2A 2W42A 4FLUA 2ILYA 3JSMB 4CF1A 1NK5A 5HLFA 3ZT0A 1L3SA 3OYHA 3I0SA 2IJFA 5SWMA 3C95A 1KHWA 2D3ZA 2BQ3A 2R8GA 2PY5A 4MIBA 5KG7A 3OS2A 3KLHB 1HPZB 4ED0A 4J9PA 4F4WA 4KFBB 2ITGA 2XO7A 2YNHB 3CVKA 4F2RA 4O4RA 4ECRA 4I9LA 2Z1GA 3EPGA 4F4XA 3KHRA 3OYJA 3D28A 3CG7A 2EX3A 1RILA 2DY4A 3L2QA 4EBDA 2C2DA 3GIJA 1WAFA 1Z4UA 3AO2A 3KK2B 4ELTA 3CJ0A 1YTUA 3ULDA 1C0UB 3M9NB 1KHVA 3V9XA 2ZE2A 1LAVA 2BQUA 4K4SA 2P5OA 3QGHA 2FLLA 3NE6A 3PW7A 3ZT2A 3H98A 1VSLA 4DL7A 1BCOA 4M3UA 3PW0A 3OJUA 4PY5A 4OKKA 3QGGA 3AA5X 4NCGB 4QW9A 4DL6A 3DRSB 2E9ZA 4CJPA 3C6TA 4M3WA 4DFJA 4RNFA 1TKXB 3H08A 1VRUB 1EX4A 3PZPA 1YVFA 2PYJA 4DL3A 5J2NB 4KI4A 4DU4A 4KI6A 2Q3SA 3NGYA 4DSIA 4EP5A 3SYZA 1S9GB 3G6XA 2DPIA 4E1MA 1RDBA 4NRUA 2FVQA 5FRNA 1I39A 3NBPA 2W9CA 3BSAA 4GC6A 4JV1A 4DQSA 1NK7A 1D9DA 2R8JA 1O1WA 3KLEB 4FJJA 4FXDA 1A5XA 5DG9A 1Z25A 1TL1A 1WNEA 2D7SA 3H5XA 1N4LA 1RT4A 4X2BA 1G15A 4O55A 3QINA 1RT6A 4B9NA 2XHBA 1VRTA 3KLVA 4M3YA 3MEDA 1RA7A 4IRDA 3P1GA 3AO4A 4B8AB 4ZTJA 4FJLA 1MU2B 1R0AA 5F8MA 3T19A 2HHWA 5KFYA 2HVHA 3C94A 3LP0B 3IS9B 4FYDA 4K4WA 3M8PB 1NK4A 2FJXA 2JLEA 2W9BB 3LPTA 1S97A 1JXEA 1RBUA 2DFEA 2RF2A 4Q8FA 3VQPA 4FM2A 4FK0A 1T94A 3BJYA 1IKWB 4J9SA 3QZ7A 4QCLA 4RG8A 2FJWA 5DGBA 2R2UA 2VG6B 3SV3A 4MK7A 4NCBA 5KTQA 1NK0A 1RT2B 2I5JB 5CYQB 4M3XA 2ZD1B 4KHSA 1SL0A 1UWBA 1ZYQA 4NLUA 4FVMA 3QIPB 4Z4CA 3L2UA 4DSEA 2QXFA 3I5CA 3RMCA 3CFRA 4B8CA 1T03B 1U45A 3NF7A 2AGOA 2OH2A 4DFKA 1BCMA 3LP1A 4WYLA 1JXLA 4FJNA 4HYKA 3OL9A 3CJ4A 3QEXA 5KFNA 4B3OA 3DLBA 4H4OA 2HNYA 1JLBA 1RAJA 3ALYA 1VSFA 3ZSYA 4F8RA 1JX4A 2HNZB 2HMIB 4AHRA 3AVAA 2XGQA 3IRXB 2HAIA 5J2MA 4DFPA 4MKBA 4EP4A 3ASMA 1NOZA 1B9DA 2Z1IA 3O3FA 3KLGB 4J9KA 4C8MA 4CJTA 3SI8A 4CHQA 2HHTA 2OPPB 4ELVA 4DTMA 4KE5A 4M3ZA 1HQUB 3EZ5A 3HK2A 4HTUA 1T05A 3U3YA 4CJEA 3AVLA 1TAUA 1S4FA 3JSMA 1BHLA 4W5OA 3DLKB 1A5VA 3NAIA 1D8YA 4Q5VA 4F2SA 3HYFA 1GOAA 3JYTA 3IAYA 3NGDA 4YR2A 4EO6A 5HRSA 3L2VA 4BWJA 3N6LA 3AVJA 5K14B 2RN2A 3CJ5A 3KLHA 1HPZA 3PR4A 3FDSA 3RBDA 4KFBA 4KB0A 3NHGA 1JL1A 3L8BA 3O3HA 3H2LA 1JL2A 2YNHA 3T5JA 5HRNA 1C1BB 2IM2A 5L9XA 1B9FA 5FRMA 3CDEA 2HHVA 4Q8EA 4ID1A 2FLPA 4DTOA 1LWFA 3FSIA 1S9FA 4FK4A 3H5YA 4QW8A 5EUHA 2FVRA 3KK2A 3AO5A 1RDCA 2BDPA 3GILA 3ZSQA 1C0UA 1W0HA 1D0EA 3RB3A 1X9WA 2GC8A 3RTVA 4ED8A 4OPJA 1N6QB 4CJKA 1IG9A 3RAXA 3AVKA 4OLAA 4RW9B 3KD1E 2JEGA 4XPCA 4IRCA 4ZP7A 1C2PA 4ECVA 3HSTB 4Z4IA 3TANA 2DPJA 3MXIA 2F8SA 3HPOA 4QWCA 3HXMA 4NCGA 3VQEA 3RB4A 4ECYA 2VA3A 3DRSA 4UQGA 4DS5A 3OYKA 3DI6B 4CGIA 2JGUA 1TKXA 4CFAA 1VRUA 1S5JA 3OYDA 2OPRB 3OYNA 5J2NA 4DQIA 4DWIA 4DMNA 5F8GA 3PV8A 1S9GA 1JLCB 2VA2A 1VSEA 3VQ4A 3HVTB 3DMJB 4K4TA 3DM2B 3SI6A 5KFTA 3EYZA 3RBEA 2R8KA 1QE1B 1CXUA 4M95A 5JUMA 1TP7A 3OY9A 3DLEA 2YHAA 4FW1A 3LPUA 5EWGA 2HWIA 5L1KA 2AQ4A 3MECB 4HUFA 4QAGA 4TN2A 2E9RX 1S1VB 3OYAA 2JC0A 3NFAA 3KHLA 3PVXA 2FBYA 1WSHA 1KFSA 3AVNA 4CJUA 3CO9A 3UPFA 3QYYA 3G10A 1S0OA 1B92A 4K4UA 3AV9A 4FZXC 4AHCA 1EKEA 1MU2A 3V6KA 4WFZA 2GUIA 1IKVB 1S1WB 4NCAA 4J2BA 3LP0A 3BDPA 1U09A 5DQHA 3QEPA 1NOYA 3LDSA 2KFZA 2XCAA 3M8PA 1JKHB 3K5NA 2UVVA 2W9BA 4LD0A 1TVRA 4CGHA 4J9MA 5KFIA 2ZQBA 1S10A 3HKWA 5EWEA 1L3VA 1IKWA 4BACA 3KHGA 1S1UB 3PO4A 3NAEA 1SL1A 4EZ6A 2VG6A 3H59A 4OGCA 1RT2A 2I5JA 5F8HA 4MFBB 5CYQA 4TLRA 3NF6A 4CJWA 2BRKA 2F8EX 2ZD1A 3V1QA 2RDJA 1RTDB 1HMVB 3QIPA 3V4IB 4K8ZA 3NBPB 3PUFA 1KLNA 4TQRA 1C1CB 3SFUA 1N48A 4FJ8A 2YKMB 1JLQB 2YV0X 1T03A 4CJVA 4E0DA 4R5PB 1T3NA 3RMDA 3MXJA 3CYMA 2B6AB 3RMBA 3SCXA 1BIUA 4ZVEA 1RT4B 3TR8A 2RDIA 2F8TA 4CGJA 1NHVA 2B43A 5FROA 4RNHA 1VSDA 2D0BA 1XI1A 3MR5A 4W5RA 2JEJA 3I5BA 5FDLB 3SV4A 4YR0A 1LV5A 2HNZA 2KQ2A 2HMIA 4E7KA 3DYAB 3IRXA 4TSXA 4FBTA 4ECXA 1BQNB 4FM1A 4IH6A 3Q8QB 4ECWA 1EXQA 3KLGA 2OPPA 3NCIA 1ZBUA 3CIZA 1HQUA 5KFJA 1LWEB 4NLPA 2HHSA 1LW2B 4KAZA 3MF5A 4RNOA 3LALA 3OYEA 4Y1CA 3DLGB 3QEVA 3ZSOA 2IM3A 4FJMA 3L3UA 2IS3A 4DTXA 3VA3A 4DQQA 4BWMA 3PX6A 3ZSXA 3OYIA 4M94A 4WYWA 4LSNA 4FJ7A 4KTZA 2ASLA 5K14A 3BSOA 3ZSWA 3OS1A 1SL2A 4J9RA 2AGQA 3I5AA 4N5SA 1NKEA 1C1AA 4CEBA 3D5MA 3MFIA 1RCHA 4WXOA 4FBUA 2R2SA 4FW2A 1KRPA 1X9SA 3LP3A 3NF9A 4WFXA 1RT7B 2XWYA 1Q8IA 4B3OB 5KG6A 3M8RA 1TKTB 2VG7B 2HNYB 2GBZA 2VWKA 1RBSA 2LSNA 4CFCA 1N6QA 1WSFA 3AVCA 2PZSA 1HJRA 5KFSA 4RW9A 2QK9A 1GX6A 2OZSA 4KB1A 4IG0A 1EETB 1KVCA 1QAIA 4K4ZA 2E9TA 4H8KA 2AX1A 1UA0A 3BSNA 1TL3B 3I0RB 4AHTA 5KT4A 3DI6A 3M8SA 1JLFB 1QS4A 4AHUA 3CFPA 4E7JA 4Q43A 1NK8A 2OPRA 4MIAA 3TWHA 4BDZA 3LP2B 1K1SA 1NJWA 3L3VA 1JLCA 3JYTB 2YHBA 1C6VA 3HVTA 4G3IA 1ASWA 3DMJA 3DM2A 2XY5A 3CFOA 3TI0A 1DLOA 1K1QA 3PR5B 5DGAA 1QE1A 4J9OA 1ZTTA 2G8VA 1HQEB 3MECA 4LH5A 2FVSA 5JXSA 2G8IA 1S1VA 1NJXA 1LW0A 4QPXA 3KJVB 4DTPA 3CDUA 3OSNA 4Z4EA 1OS5A 2R7YA 3OYMA 1S48A 4R0EA 1LWFB 4RUCA 4FLVA 2QE5A 1YTAA 1IKVA 1S1WA 4QOZB 4Y3CA 1WNSA 2FJVA 4IFVB 5E41A 3HPHA 2GV9A 1S6QB 1JKHA 4FJHA 4YP3A 1CSJA 4J2EA 2Z1HA 3CWJA 3H40A 2HNDB 1QTMA 3QZ8A 4CEDA 1S9EA 1S1UA 3FQKA 3ZT4A 4FJ9A 1Z26A 2PYLA 1L5UA 3MTKA 1HARA 3TAEA 3K5OA 5HROB 4KHMA 4O3PA 1RTIB 4MFBA 1RTDA 1HMVA 4DTUA 2FC0A 3V4IA 1C1CA 2F96A 2KTQA 2YKMA 3OSPA 1JLQA 3TARA 4B9TA 1RYRA 2HHQA 5F9LA 4R5PA 3VA0A 3MEEB 3DLEB 3SFGA 2B6AA 2D5RA 2ATQA 3FQLA 3OLBA 1S49A 4EYHB 4L8RB 1ZBLA 2OPSB 3TABA 3H4BA 3V9ZA 5FDLA 4PWDB 1IM4A 1ZETA 4XO0A 4WZQA 4DQPA 3HM9A 3DYAA 5KG3A 5I3UB 5HRRA 1BQNA 1TK5A 4ECQA 3UIQA 3VN5A 3V1RA 4CJLA 1JLEB 1HNIB 4KV8B 3H4DA 3AA2A 3HHKA 2X6SA 1LWEA 3C6UB 4CJ3A 3QO9B 1TVRB 2A1SA 1LW2A 5C25B 3HJFA 3HL8A 4Q0BB 4NLDA 2KZZA 3DLGA 4ZPAA 1NJYA 3KKSA 2IOCA 4FJGA 1RTJA 3DRPB 4ECZA 4KRFA 3KNAA 3SQ0A 2BRLA 3ZT1A 4FLTA 4ID5B 3T5HA 3ZCMA 1RBTA 2E4LA 1VK0A 4JS5A 4CK1A 3PW2A 4RU9A 4Q44A 1BL3A 3RR8A 1KTQA 2XGPA 4CGFA 4FK2A 4XPEA 2HHUA 1WLJA 1GOCA 3SQ2A 1WN7A 2R8IA 4CJQA 1T8EA 1C0TB 1RT7A 4B9SA 4DL5A 4ZMMA 1TKTA 3AA4A 2VG7A 4O44B 4PQUB 4KPYA 1JLAB 3QLHB 4DQRA 3TAMB 3AVFA 1D9FA 2HW3A 2P5GA 4ED2A 1NK6A 1EETA 3H5UA 1TL3A 3I0RA 4JLHA 4TY9A 3DRRB 1JLFA 4JRQA 4DF8A 4MH8A 1ASUA 3BGRB 4LH4A 4N41A 4K4XA 1HNVB 2ZKUA 3OYLA 4B9LA 1QUVA 4GMJB 4RW4B 1S1TB 4U6PA 4HCCA 5C24B 2IA6A 3LP2A 3IGVA 2BANB 2FVPA 4C8NA 2WONB 1N56A 3QIOA 1NJZA 4CK2A 3AVHA 1U48A 3PO5A 3PJXA 4Q45A 1S6PB 4CE9A 3WNGA 1J5OB 3OLAA 4LSNB 3KLFB 3WNFA 1BGXT 4KREA 2DTUA 4W5NA 4MQ3A 1HQEA 4ED6A 4N47A 4U7CA 2WOMB 3KJVA 4W5QA 3E01B 4Y34A 4ED7A 2EC0A 4DU3A 3QETA 5SZTA 2Z1JA 4NYNA 3QIDA 3OS0A 1BI4B 4J9QA 4MK8A 4KHNA 4IFVA 2XI3A 1S6QA 3K2PA 4CIGA 4ZVFA 3KKRA 5T7BA 4IG0B 5CYMB 4DU1A 3NH2A 4KHQA 5F8IA 2HNDA 1TKZB 4YQWA 1J54A 4BE2A 2V9WA 4EO8A 3V9SA 3G0ZA 3QERA 3PHEA 3PY8A 5J2QB 4F3OA 4CHNA 3A2FA 3MXMA 1D5AA 4OKEA 2QKKA 1UA1A 3OHAA 5HROA 4KBIA 1RTIA 2C2RA 2AU0A 2B4JA 3TAGA 1ZBFA 4ECTA 3KK3B 3AVMA 1VSKA 1Y97A 3LWMA 1DLOB 4OVLA 1QSSA 4M45A 3OL8A 1YT3A 4QWEA 3SZ2A 1I3AA 3MEEA 1U49A 3V6DB 4CHZA 4TYBA 1DTTB 4IH7A 5KFHA 3RAQA 1SV5B 2O4GA 3N6NA 4B08A 1LW0B 3D45A 3K5LA 3S3OA 3L2WA 4CHYA 1BQMB 3NMAA 2OPSA 5C5JA 4PWDA 5KFLA 4C8LA 3QGIA 4M3TA 1SKRA 3AVIA 5I3UA 2I1RA 3IGNA 5KT5A 4AILC 2BGGA 4FJIA 4LQ3A 4DS4A 1TAQA 1JIHA 4DG1A 1RT5B 2J6SA 3OL7A 1TGOA 3NH1A 5KT3A 1RT3B 1JLEA 1KVAA 1HNIA 4ECSA 1CZ9A 4KV8A 2HB5A 4O5BA 4GC7A 3C6UA 1BIZA 2OZMA 3QO9A 5C25A 3GQCA 3VQCA 4W5TA 1FKOB 5L1LA 4FZZA 4Q0BA 1K6YA 4JS4A 1S9EB 1W9HA 2O4IA 2W8KA 3DRPA 1L3UA 3BREA 1XWLA 2FBXA 4XIUA 3OHBA 4K8XA 4ID5A 4J2AA 2YKNB 3LZIA 3KLIA 3OL6A 3O4QA 1HRHA 5L1IA 5KFGA 4CGGA 3L2RA 3G6YA 1HYSB 5KFVA 5KI6A 2QV6A 1WAJA 5KFOA 3O3GA 4O3NA 3WNHA 4NLWA 4ZP9A 2W8LA 1C0TA 1S0MA 4IKAA 4IQXA 1NKCA 4DTSA 3MFHA 1IO2A 4O44A 3CM6A 5HBMB 4PQUA 5F8JA 3M9OB 5DK5A 2RKIB 3DOLA 4NRTA 1GOBA 3IG1B 4CCHA 1JLAA 3QLHA 5DQIA 3T1AA 3TAMA 1VSJA 2X74A 3ICLA 4NLYA 5F8NA 1Q9YA 2C2EA 3KD5E 3KK1B 1XHXA 4NLOA 3PX4A 3T5LA 2HWHA 1W25A 3PW4A 2ILZA 3DRRA 4CJFA 4DSFA 3BGRA 4AHSA 1JLGB 3S3NA 2FBTA 1HNVA 4CEAA 4RW4A 4IRKA 1S1TA 1ZTWA 4DTJA 1RDAA 5C24A 1UAXA 4OGEA 4IH5A 1FKPB 3P83D 2BANA 2WONA 1SKWA 2ASDA 3HT3A 1RTJB 4CF8A 1X9MA 3OYBA 1S6PA 1TV6B 3BSCA 5C42B 2BE2A 1J5OA 1CXQA 3U3GA 4FLZA 3OYGA 2P51A 3ZSRA 3KLFA 4R8UB 3LAKA 1WSIA 4TXSA 3WNEA 4RW6B 3BR9A 5KFUA 2WOMA 2IC3B 2B5JB 4ZP8A 3E01A 4CIEA 1BISA 3GV7B 4CEEA 1KLMA 2KW4A 4CF2A 2VG5B 3OYFA 3K59A 5F8LA 3GIIA 1Q9XA 1BI4A 1NK9A 4CJSA 4H4MA 4ED3A 1RDRA 4OJRA 3THVA 5D3GB 3KTQA 4DF4A 3MR2A 4CF0A 2XC9A 3HVRA 3Q8SB 3TAQA 2WRMA 4JRPA 4OPKA 1VSHA 4JV0A 5CYMA 4EBEA 1ITGA 3ZSVA 4OL8A 3V81B 1U04A 1TKZA 4HUEA 1SH3A 2OPQA 2AWZA 2NUBA 1S1XB 4Z4FA 4FM0A 5J2QA 2R8HA 2CKWA 2DFFA 2G8UA 1NHUA 3CJ2A 1T7PA 3RB6A 2X6NA 3GV8B 1FXXA 5KRSA 4NLQA 3TAFA 1RT1B 4J9LA 3FFIB 2FVCA 3KK3A 3H5SA 4DLEA 5KGWA 3T3FA 1QQCA 4CECA 4G1QB 2IDOA 3ZT3A 4BDPA 5CY4A 3DLRA 3V6DA 2XCPA 4NLVA 3QNNA 1DTTA 1RBVA 1SV5A 4O0IA 3ITHA 5T14A 4K4YA 4CERA 5J2PB 4MKAA 1BQMA 3GIMA 4O3SA 3TQ1A 1QSLA 4DTNA 2BR0A 2ETJA 4NYFA 3TAPA 4RUAA 4E7IA 1EP4B 4PA1A 4O3QA 3UDLA 4IR1A 4CK3A 4ZPCA 1FK9B 2XRIA 4FLYA 1XR7A 4NLTA 3QESA 4WE1B 4EZ9A 4KHRA 1L3TA 1RT5A 4OKJA 4O3OA 1RT3A 1RTHB 3EZUA 4QWBA 4F3TA 4RW8B 2A1RA 2WCXA 1RYSA 4NLXA 3F73A 1FKOA 4ECUA 1F21A 4NYZA 2KFNA 4NLRA 4QWAA 3EY1A 4I9QA 4CIFA 2X78A 2C22A 4I7FB 5KG1A 2D41A 3SUNA 4E1NA 2YNIB 4J9NA 2YKNA 1GX5A 2FBVA 4IFYB 5DLFA 4PUOB 3SPZA 2YNGB 1ASVA 4DSLA 4FLWA 4YFUA 4RNNA 1HYSA 3EPIA 2G8HA 1REVB 2IBKA 4FS2A 4M3RA 3CM5A 4BE1A 4KKOB 4JUZA 3M8QB 3HVAA 1SH2A 5HBMA 5KFRA 2RKIA 4LSLB 3IG1A 3K5MA 3MEGB 4B9UA 3Q8PB 2Y1JA 4YNQA 3KK1A 3VQ5A 4HCBA 1CLQA 2IAJA 5KFDA 4F4ZA 4DG1B 1SUQB 2W7OA 4KSEB 2QKBA 3AA3A 5JS1A 5KFEA 4FJ5A 3ISND 1TK8A 3VQBA 5EU7A 1JLGA 3AO3A 4AHVA 2G8FA 3RRGA 4IR9A 4RNMA 2CJQA 1FKPA 4I2PB 4TYAA 4KO0B 4F50A 5I42B 1TV6A 1MMLA 3SQ4A 1C0MA 5C42A 3BQ0A 4B9MA 1LWCB 4Y2AA 4R8UA 1WSEA 4YR3A 5KT2A 3U6FA 3KLIB 3PJWA 4RW6A 3OVNA 4CFDA 3K57A 1ZBHA 3SUOA 2IC3A 2B5JA 2V0NA 3NH0A 4CEFA 2WTFA 1KVBA 1TKDA 4IDKB 4FZYA 1QAJA 1RDDA 4O0JA 3UQSA 5KFBA 2VG5A 5HP1B 4IG3B 3V1OA 1J9AA 5DQGA 4HHTA 5KFKA 5KFMA 2V4QA 3S9HA 3DOKB 5D3GA 3DOLB 4TY8B 4DSKA 4FCYA 4DL2A 5KRTA 1CZBA 1TQLA 1A5WA 5KFPA 5KG0A 4NLGA 2GIQA 3KMSA 2IMWP 4EBCA 2D0CA 1IKYB 3DLHA 2W7PA 4K50A 3ZSZA 5KT6A 3NDKA 2UVWA 3V81A 3SUQA 4ICLB 3NF8A 4CESA 3SJJA 1S1XA 2EHGA 4CEOA 2YNFB 4F4YA 4DSJA 3KMQA 3MR3A 1S0NA 4CJRA 4Y2CA 1RT1A 3FFIA 2JC1A 1RA6A 2ALZA 4ZHRB 3V6JA 4G1QA 1N5YB 3LAMA 2BE2B 4E7HA 3VQ7A 3NGIA 4AH9A
chains in the Genus database with same CATH superfamily
1NNDA 3CQ8A 1VSMA 2AYBA 4YB6A 5LMUK 3SNNA 3HHLD 2ZBQA 4KGZB 2WC9A 5KT7A 2NRHA 1UEVA 5J2PA 4LMZA 3CF5L 4I2QB 1X9JA 1EKSA 4WJBA 1IKXB 1QAYA 2D9OA 3I8DA 2MPUA 4UZBA 2ZOGA 2Q1LA 1C0FA 1FK9A 2LVWA 1OH8A 2IVOA 3SUPA 3FRZA 1RTHA 1NO8A 3TX8A 4KAIA 4LQ9A 2FHOB 4U7BA 1K0VA 1GT8A 4NI2A 1UP1A 1OVYA 1T3VA 3OXGA 1HLUA 3RR7A 2K06A 3UCUP 2W9AA 4DV2J 4PPZA 3GYNA 5FLXO 4I69A 2AGPA 2V34A 3DN9A 4TQSA 4H54A 1FDDA 4U7UK 2OYQA 3T5KA 3OYCA 4PUOA 5F2RA 4DLGA 4JEPA 2EFPA 5KFFA 1LXJA 4ILGB 2EPIA 1NH7A 4JI8J 3DXMA 5M1NA 2NRXA 2WHOA 3FBBA 1M0SA 2R3VA 3ITHB 4HVJA 3M8QA 3N6MA 2KKHA 2W2MP 3M32B 1HYVA 1YXQA 3Q8YA 2MKIA 4DV2K 3P45B 2RJZA 4ES1A 3FMBA 3BS9A 3OJSA 3RWUA 2YQ3A 4BRQA 1FJ7A 4AE5A 4QPTA 2JHEA 1KC8O 3LWLA 2HFZA 4JI8K 5AXLA 3Q8RB 3WQUA 3MN9A 2DR5A 3FZHA 3KK7A 2D9PA 2A41A 2IPOB 3E51A 1Q81T 3WEEB 2ZE2B 3OPKA 4YS2A 2C28A 2PDAA 2ZKTA 1Y9OA 4JKFA 5I42A 3UDVA 4DCOB 3R7SB 4NZ7A 2JL9A 3BO3A 2XNRA 3CD6N 1HHSA 1KCFA 4CO2A 4BRKA 1J53A 4Y0FA 5ETNA 3FBCA 3VQQA 3PKMA 4DR3F 4BR5A 4CIOA 4IG3A 3MM7A 2CQHA 2YX1A 4E89A 2GX8A 2HAFA 4CLUA 5AQHA 2MQ8A 3D0PA 1SKSA 5HSPA 2LEBA 1WOPA 4IYQA 4PL8A 5B0AA 3GU0A 1TL1B 5KFCA 3BGUA 5JS2A 3O3LA 3SPYA 3L9ZA 2CUYA 2F5GA 1RWOB 3S41A 5DRKA 1XR5A 3MM6B 3HCXA 3ATVA 4ANCA 3WZ0A 3CB4A 1R0AB 4X84A 4DEZA 3PIPL 3HP6A 4CI6A 2BUPA 3HZ6A 1QJHA 3CCLS 4WWSA 2E5GA 2ZH9A 1DQAA 3DNCA 3TYTA 3TUJC 4ED1A 1AA1B 5EWFA 2M8HA 3HSDA 3LANA 4DV7F 1YQHA 1N5YA 4DV3J 3AB2B 4P75A 3MAQA 3IAM9 4HVZA 1S76D 3O5BA 2DRBA 5DZ6A 4DX8H 1VQMN 1X1PA 5CE3A 5F9NA 1X4FA 4IO1A 2IM0A 4FZVA 4DR2F 1N33F 4LSZB 3R3TA 3GJTB 1UWBB 5LL6Z 3BKUA 3TO8A 2H51B 2YHYA 4FF2A 4OYOA 3EUNA 4ZPBA 2J8AA 5BXIA 1CS4A 2BJDA 2RS8A 3M8ZA 1Y3JA 2AJ1A 3HO1A 3TVKA 2O8FA 3ZZ0A 2D3O1 1YITN 4QR2A 4H4OB 2Q36A 2JLGA 2FSJA 1IR0A 4CHPA 4B1XB 2IDLA 1Q1KA 4FF4A 2N3OA 5J2MB 4KRWA 4O4GA 4EU0A 4E3SA 5JLFA 2YWEA 5F3TA 5DJBA 3C15B 3OXLA 1EX8A 3A8KA 3FGUA 4I64A 3US5A 2QWPA 2H5JB 2CDQA 1JXBA 1ZPVA 2W42A 2QX0A 4FLUA 2F4VF 4A8YA 2YQ1A 5F3ZA 3ZT0A 1FA0A 2XMUA 1VISA 2YPZA 1KHWA 2QA4S 4RWTA 5HATA 4LF6F 2NZCA 3R97A 3MD1A 1S59A 3TJAA 4ILRA 3KLHB 2GW8A 4J9PA 1W2BM 4F4WA 3CT9A 2R7SA 2ITGA 2XO7A 2YNHB 3O6QA 4O4RA 1RADB 3FJ2A 2Z1GA 2O8BA 1GMVA 2ITMA 3B78A 3NGKA 1N33J 1F0XA 2XMMA 1ZBTA 2HFOA 4EBDA 1WAFA 2DRAA 1Z4UA 3AARA 1HNZJ 2V8HA 3TRGA 2Y8WA 3GG0A 3HF5A 2V67A 2VDHA 2XLKA 2M8DB 3Q89A 3EKUA 3M8YA 3K89A 3H98A 4M3UA 1RP5A 1OPZA 4CNZA 1E3MA 1HHQA 2XG8A 1VHFA 2RSQA 3AA5X 3DRSB 1N33K 4FF3A 1Q8KA 1VIXA 4OQJA 4KI4A 1U1RA 4M5HA 4ILHA 4KI6A 1HNZK 3QAEA 2FUG9 2V2QA 2Q3SA 3NGYA 4EP5A 3VEXA 3IR7B 2IVFB 5IV3A 2OAUA 5A76A 4E1MA 1VI7A 4ZPVR 3HSZA 3B8AX 1NK7A 1D9DA 2F4VJ 2CQ2A 2J7UA 3Q8UA 1A5XA 2IHR1 3FZ2A 3D67A 3R5JB 3D7SB 1G15A 4LF6J 1JCGA 1RT6A 4B9NA 4WU3A 4M3YA 1RGIA 1UAWA 4IRDA 3QDKA 5HQLA 4UF4A 1QZ5A 4B8AB 3G71N 4DCPB 1MU2B 2E1MC 4FKXA 2HBMA 5KFYA 3C94A 2F4VK 2BJ9A 4ATNA 1UVNA 1VDHA 3RW6A 3D3CJ 3U1LA 1K9MT 3VGMA 2CPJA 1NK4A 2FJXA 3C3LA 4XTTA 2CNKB 3P8BB 3R27A 4LF6K 1T94A 2FHJA 1IKWB 2AJ2A 4DKWA 5KQ8A 2R42A 3D0IE 3ENVA 1RWXB 4NCBA 2D3OR 5E5NA 1NK0A 4KJIA 2ZD1B 2PGCA 1HBOA 3DGPB 3CQXA 3MM7B 2J76E 2Y0SD 2AGOA 3ID6A 1BCMA 3QWPA 4IWVA 1TYQA 3THYB 1RKJA 2OEJA 3OL9A 4B3OA 3DLBA 3MMVA 1W26A 4JHDA 3C65A 3ALYA 3AHPA 4F8RA 3HI0A 1M1KT 1P6TA 3RU0A 4ZPTR 2XGQA 1XUPO 1FWLA 4MKBA 4EP4A 3ASMA 3MCMA 1NOZA 3FVYA 1RHMB 3KLGB 2NRZA 4DTMA 4M3ZA 1HQUB 3L4IA 5T41A 5IFMA 1TAUA 2DIUA 2NYIA 5AQNA 1UJ6A 2VGMA 2J0XA 3NAIA 4HHJA 3AXKA 2WFBA 2ZBCA 3IAYA 1R8AA 4YR2A 4YDDB 4EO6A 5FPMA 5HRSA 1VCTA 2VFVA 2CPYA 2RU3A 4M5MA 1HPZA 3VR1A 1NB2A 1JB0C 3VEVA 1KOHA 3GJRB 4FWNA 5E84A 2V50A 3PLAA 2XHCA 2EKYA 4HL9A 1RE1B 3MCNA 3TSUA 3CDEA 2HHVA 3SAFA 2VF3A 1Q8LA 3VTHA 2H65B 1VQMS 3FSIA 3W64A 2LFVA 1VQ7N 4FK4A 3H5YA 2HF3A 4DR5F 2FVRA 1K73T 1C0UA 1I94F 5CYJA 2QZ8A 4EAHD 4OPJA 1VQ5N 2V4JB 2GMLA 1S4EA 2UU9F 5AQTA 4XPCA 4CP5A 2VASA 5DM6Q 5HQMA 4ECVA 3VEYA 2F8SA 1RWNB 4DS5A 4X4RA 1QHAA 2VFSA 3T9NA 2P9NB 2J9DE 1PBUA 1YITS 1WKKA 2JGUA 1TKXA 3CJBA 1S5JA 1RZMA 5D6GA 4Z94A 1OIAA 2CJXB 1S79A 2PAVA 4L74A 5F8GA 3PV8A 5CCMA 1O13A 2WTUA 5E0OA 3SI6A 3RBEA 5MAOA 2OMOA 1QE1B 3FBEA 5I9EB 4ZIWA 4FWOA 1R89A 5B0GA 5EWGA 1S99A 4QAGA 2DNZA 2E9RX 4FL9A 2DH8A 3C16A 2FBYA 3HSGA 1MG7A 3UKRB 4FWPA 3VETA 2KO1A 3UPFA 3I31A 2RIJA 2F8MA 3V6KA 4WFZA 4A2BA 3W65A 1ICEB 3ZZZA 1IKVB 3D6HB 4OHXA 1U09A 2KHCA 5AQVA 3MPUB 3C6AA 2KFZA 3HFVA 3A13A 1JKHB 3P6YC 4PXCA 3GYGA 4DR5J 1TVRA 4JBCA 5KFIA 5JVGL 1YWXA 2E7WA 4CW7B 5EWEA 1L3VA 3GP9A 4MDAA 3WXKA 2IVMA 5GAEU 1CJUA 3ZTQA 5AJ3F 4XH1A 2UU9J 1CC8A 3WBZA 5U47A 1RI7A 2E66A 2LXUA 1IVZA 2HKEA 2K7KA 2R7WA 1RTDB 3QIPA 3V4IB 2F1FA 3PUFA 4TQRA 2W4PA 2YKMB 4IFEA 3CCMS 2GHPA 4E0DA 3J81j 4DR5K 2BMBA 2BJ8A 2QLFB 2B6AB 1TU0B 3K8WA 3CCSN 4C7QA 3TR8A 2I0XA 1SJ4P 4RNHA 3R9PA 4NLBA 2C3UA 3N28A 2UU9K 5FDLB 3SV4A 1KN6A 1FXRA 1SKUB 1MWQA 1TZ0A 4DX6A 2KQ2A 4E7KA 1MSWD 3IRWP 4TSXA 1F6TA 2NUUG 3VAMA 4FM1A 1FERA 1P27B 2CQPA 3BZCA 3N4PA 3CJKA 2X1GA 4RX6A 4DBQA 2OMLA 4F4AA 2CAJA 2G0CA 4NMXA 2CQ4A 2DRDA 3EN9A 4QS7A 2KLAA 3AA8A 3O1BA 3VPZA 3G71S 3MHYA 1W2IA 3BEXA 2IM3A 4FJMA 1ILYA 2HF4A 1P90A 4QZVB 3VA3A 3MURP 4Y6IA 5K14A 2E8AA 2FJEB 5AZIB 3I5AA 4A5AA 4N5SA 1NKEA 2QGFB 5AJ3J 3MFIA 2JSXA 2XTJP 3ZETB 1X0PA 2DCLA 1VQON 4FW2A 2BZ2A 2Q79A 1FRHA 1D8ZA 1X9SA 3LP3A 3NF9A 5LJVA 3O8WA 2E5JA 4B3OB 3DHWC 4OZ1A 1TKTB 1R0CB 2CGJA 2GVDB 4M1KA 2J0WA 1NMNA 4B3RF 3AVCA 3ENQA 1RTZA 5LOQA 4K0KF 2QK9A 2O8DB 1NGCA 2B56A 4IG0A 1KVCA 1QAIA 5AJ3K 4H8KA 1TL3B 4AL7A 2P9PA 4DI6A 5KT4A 4AHUA 2V8PA 3SCIE 2HSEB 4Q43A 4MYTA 4MIAA 1KNZA 4CQ1A 1FJEB 2E1RA 3FZFA 3TEHB 3ULEB 5AQOA 1C6VA 4G3IA 1ASWA 2NXEA 2N82B 4J8FA 1TUVA 5DGAA 3J7AP 2AEFA 4Y2KA 1T9XA 3MM5A 3MECA 3GONA 2FVSA 1XBWA 1BG3A 3CJAA 4DTPA 4U67L 3OYMA 4RUCA 4YB1P 1YSJA 3M30A 5KOXA 2G2ZA 4IDHA 2MZRA 1YTAA 2K3IA 2IA0A 4Y3CA 1WNSA 2FJVA 5E41A 1PAEX 1S6QB 3MMAB 5A8WB 4MIWA 1NJIT 2IY5B 4H4KA 3DJCA 4J2EA 1SB6A 5EXWA 2Y3YA 2J9EA 4RJVA 4JKCA 1TR0A 2P8IA 3H40A 1VQ7S 1RK8A 1S1UA 4A8MP 3FQKA 3ZT4A 4FJ9A 4PCQA 4J9VA 2PYLA 2E5IA 4QIGA 2HLTA 2J9DA 3OVAA 1VQ5S 5HROB 4KHMA 4O3PA 3QRQA 2Z2MA 4DTUA 1IBKF 1C1CA 3ZZUA 2F96A 3M5RA 1JLQA 1BWEA 4AT1B 4R5PA 4BVPA 3VA0A 4CZFA 3THXB 2HQDA 1NEEA 3WC0A 3ID8A 4ZS6A 1IJJA 1S49A 2JFDA 4L8RB 3SXLA 3BH7B 3D2FB 2QMXA 4PWDB 1IM4A 1ZETA 2B0GA 1EZZB 4DQPA 3DYAA 4JP8A 3B6BA 3JAMU 3IKMA 1DURA 1BQNA 4JV5J 1ZM2A 3I6PA 3JAMO 4CRJA 3UIQA 1GAOA 2WSEC 3V1RA 2QLXA 3TA1A 2KG1A 1HNIB 3D9BA 2OEKA 3HHKA 3HD2A 2IYIA 2JH3A 2A1SA 1TVRB 3U9ZA 2HQ3A 1W7AA 3HJFA 2QO3A 4M5NA 4NLDA 1NU4A 1OO0B 4ZPAA 1F5BA 4B9QA 2HOEA 4NEYA 3KKSA 4KRFA 1YUWA 3SQ0A 2BRLA 1Y64A 4JV5K 4FLTA 1SBRA 4USWA 3EM1A 4E8UA 1RHUB 2AJFE 3ENBA 2NRVA 4CNYA 1KTQA 4B3MF 3QBCA 4WFNQ 4L6V3 5G4DA 1WN7A 4L76A 1FEEA 1T8EA 4DL5A 2FDNA 4ZMMA 3MWBA 2VG7A 2HZCA 3RZAA 4EIAA 4KPYA 2NR0A 4B3TF 1JLAB 4Z7CA 3TAMB 1SQEA 4IOCL 4NPOA 2HW3A 4CLTA 2KU7A 3PFEA 2XMAA 2DGOA 2ZC4A 3OXFA 1X4AA 4HH1A 2XB2D 2RQCA 3I0RA 1HBNB 1JLFA 5D78A 4MH8A 1FTCA 1TL7A 4N41A 3OYLA 4RW4B 1T6DA 4U6PA 1U2RA 5AE1A 4A8XA 2XS5A 1SIWB 2IA6A 3IGVA 1FX2A 2BANB 1N56A 1NJZA 4ZCLA 4C8YA 3WNGA 2YQ0A 4BC9A 3OLAA 4QR1A 5L9NA 5HMWA 4MQ3A 3GSDA 3U02A 1UPMB 4A8WA 1R8CA 1BO5O 2FJBB 1XN9A 4F04B 2V7YA 1Y11A 4PRFA 5SZTA 4H5VA 2Z1JA 1PCAA 1Y3KA 2NXCA 1HBUA 2P9LB 4JB8B 4I67A 2QSFA 1BI4B 2LQ5A 3W2VA 3UD4P 1SJQA 2R4FA 1GLDG 4J9QA 1VBYA 4MK8A 4PPDA 4Z2XA 1RJJA 4ZVFA 2QA2A 2NNWA 1VQOS 2GFFA 2E7VA 5T7BA 4IG0B 3NH2A 2RHQB 1ZM3A 4B3TJ 5HK4A 3G0ZA 3QERA 3PHEA 4AM6A 4BC2A 4K41A 4F3OA 3MXMA 1D5AA 4OKEA 4KBIA 2KRBA 1RTIA 3JSRA 1NDLA 4C0HA 1CJKB 2A5XA 2JRSA 2XYGB 2BJ3A 1KQSM 4BR2A 3A1YG 1QSSA 1AW0A 2P5VA 1SZ2A 1I3AA 4CVNE 1H6KX 3MM5B 2KHOA 2YKAA 1Y0HA 3EO3A 4FOEA 4EHTA 1SV5B 4NA2A 2O4GA 4CH1A 4B3TK 2FZGB 1V6HA 4K42A 3D45A 1M1KO 3VZHA 5GAHI 1BQMB 3NMAA 3OFFA 2OPSA 3MM8A 5KFLA 4C8LA 3I96A 1GXTA 1QVGR 1KVJA 2I1RA 4RUHA 1KAYA 1BC6A 4RBTA 4DS4A 5K8PA 4PL7A 1TAQA 2DHHA 1HW9A 2J6SA 3OL7A 1TGOA 3NH1A 5KT3A 3HZEA 1GLCG 1XC3A 1CZ9A 4KV8A 3C6UA 3QO9A 1AFIA 5C25A 3VQCA 1FKOB 4L72B 4FZZA 1B3TA 1K6YA 3DC2A 3ILLA 4QR0A 1W9HA 2P9CA 2N4CA 2W25A 2PFFB 1CG2A 1CQNA 3RBZA 1FD8A 5G0RB 4J2AA 4PG7A 2YKNB 3Q8VA 5IT4A 1JXVA 4U96A 3ZZRA 4QS8A 4CLLA 3PNIA 3NNHA 4LFAJ 3W7BA 5LL6d 3CO0P 5KFOA 2XZDB 3ZX2A 3O3GA 4K5RA 3PM9A 1C0TA 2CPZA 4IKAA 2KG0A 2DNQA 4FNIA 4WF9Q 1FW6A 1UZHA 3M9OB 5DK5A 3DU5A 4CCHA 1GOBA 2F65A 3IG1B 1N34F 1IJFB 2QG9B 4F0KA 1HR0F 3ICLA 1KWMA 4WP9A 4NLOA 3KUEA 4LFAK 1W25A 3PW4A 2ILZA 1HKGA 4DSFA 1RHQB 2MEWA 3S3NA 3M2VB 1HNVA 4YORA 1S1TA 1ZTWA 1I5OB 3ONQA 4H0PA 2E29A 4IH5A 1FKPB 3R8YA 2XSFA 2J7KA 2IJRA 4CF8A 3V2UC 4NA1A 3BSCA 4LF9J 1PIEA 2DGXA 3OYGA 2P51A 2A10A 1O6XA 4R8UB 3GL1A 3LAKA 3GCWP 2HGLA 2QLWA 4G65A 2V6AA 2QYGA 3HM8A 2VQFF 4CIEA 3MWTA 2FGOA 2E2OA 4H0XB 3CCZA 1UEKA 4CM0A 1KLMA 4CF2A 2WSFC 3K59A 4UOGA 5F8LA 4JI6F 1NK9A 4LR8A 4CJSA 4LF9K 3C2PA 3MR2A 4GV6A 1MA9B 4CF0A 2XC9A 3QRRA 1HA1A 2PBDA 5CABA 2LU1A 4JV0A 1QM9A 3AGRA 3ZSVA 1OY9A 1U04A 2EFOA 1AUDA 2OPQA 1N34J 2NUBA 3A3PB 2U2FA 1HR0J 5J2QA 1F2GA 2CKWA 2DFFA 2CWKA 2HFVA 1KBRA 3RB6A 4NLQA 2VBZA 4J9LA 2ZZMA 2FVCA 2M4MA 3IFRA 1RHRB 2CZ4A 4OHYA 4CZIA 4CECA 2W01A 2DNGA 2COLA 3R3LA 3V6DA 2XCPA 3QNNA 1YIJN 1B0PA 2CFXA 4O0IA 5T14A 1N34K 4CERA 5MLCQ 1HR0K 4XAKA 3TQ1A 1C4CA 4FWMA 3EMTA 3ZLJA 4RUAA 3FFKB 4E7IA 4ZN1A 3KVGA 1EP4B 4P2SA 3LGNA 1T0TV 3D6RA 4O3QA 3U9DA 4CLWA 3MPVA 4N8OA 3WC2A 3NGSA 1ZM9A 4NLTA 1GLEG 4WE1B 1L3TA 3GPAA 1YRXA 2HK2A 1RT3A 4QWBA 4EFAC 4RW8B 1YAGA 3O1WA 3QSYB 4CD3A 4JI6J 2IIHA 1ACMB 2YVSA 3BBCA 1F21A 1S0VA 5ETQA 4QWAA 2X3DA 3VOVA 2MQPA 1B7FA 2X78A 4JI1J 2RAQA 2GWJA 2W4DA 3WXIA 4LIWA 4KYZA 5KG1A 2E5LF 3NMRA 3HHLA 3TU5A 2YNIB 2HG4A 3MMJA 2XEXA 1GX5A 3TR5A 4P9SA 4CLSA 2YNGB 2VBWA 3AQOA 1ASVA 2X3GA 2A6OA 5FPEA 2KB2A 4MAKA 4JI6K 1IQZA 1REVB 4M3RA 1S7IA 2YWGA 4JI1K 4HWIA 4OI0A 1SH2A 4WCEQ 2NSCA 1G6BA 4RTFD 1ATNA 4OPHA 4DPWA 2BKNA 3MEGB 3Q8PB 2QA4G 2YH1A 2B8QA 3U1MA 2FPHX 2HBRB 3KHYA 1HNWF 2W7OA 4KSEB 2YY3A 3WQPA 1U6BA 5JS1A 5KFEA 4FJ5A 2M0GB 5LSRA 2B4OA 1TK8A 3VQBA 1NGDA 1YJWN 4NB4A 2G0IA 3J7YU 5E2QA 2PA8D 3NNCA 4I0WA 4E98A 5HANA 3OQ2A 4KO0B 2ZDOA 4L3KA 3TSQA 2MMYA 3MCSA 1TV6A 5C42A 5D4NA 4Y2AA 5A8RA 1Q82T 4YR3A 1Q95G 4CFDA 4I4BA 1SQKA 4Z7YA 2B5JA 3KWIA 1N5QA 4CEFA 3NH0A 1ZZNA 3R8EA 1X4HA 2CG4A 1QAJA 3HT0A 1SC4B 5HP1B 3V1OA 4HHTA 1F1BB 2V4QA 2CZVC 1NJIO 4XDCA 1REGX 4DL2A 1TQLA 2CQ0A 5ITHA 8AT1B 4NLGA 2BW2A 4OJHA 2IMWP 2DJWA 4DR1F 4NYOA 4UOFA 3NDKA 1X31C 1FEHA 3L4BC 2KXNB 2UVWA 1F2HA 3VVTA 4ICLB 3DDIA 4B3SJ 4CESA 1FJGJ 1S1XA 2HZVA 4CEOA 3VGUA 1HNXJ 3KMQA 3MR3A 1HNWJ 3G2XA 4ZOSA 1PJ5A 3QT7A 4BRHA 3T41A 3FFIA 3D54A 4RLEA 2DO0A 2HVEA 2GHWA 3THWB 4G1QA 1DRZA 3L6QA 3BKTA 2A0FB 5LSOA 3VWSA 3VQAA 4ZP6A 3RVCA 1IN0A 2DISA 2D4WA 4B3SK 1XMQF 4A8KA 1FJGK 4HUGA 1V3RA 1EJ7L 5KFAA 1I51B 3HPGA 3G86A 4CBWA 1JJ2R 2BUNA 1KLMB 1RNHA 4C8KA 4FSVA 1HNWK 2VQEF 2E1YA 3HVWA 3B6OA 4DB3A 3S7RA 5M2PA 4Y1DA 3CC7S 4EGLA 3PX0A 1S6OA 2HRTA 2B4PA 2VODA 4Y0WA 3QNOA 5HVFA 1Z6RA 2QC3A 3KG0A 2DHSA 4FNHA 3IN5A 2AMCB 1HBMB 2Q6CA 4GVMA 2MQMA 2OPQB 1QHTA 1ZZFA 5EY4A 1LAWA 4I7FA 3VZIA 1VQPN 5BREA 5A6PA 4IFYA 2BOPA 3M6GA 1SJRA 7FD1A 1DTQB 4OMFG 2OA8A 1M1HA 2ZNYA 1UJ5A 3HJVA 4LF2A 4KHWA 2XWXA 1YG0A 1FRIA 5RUBA 3M9MB 4KKOA 3J7AN 2KJVA 4H5TA 1M90O 4AFFA 3N4QA 2IM1A 3AO1A 4LF5F 2XY8A 4DL4A 1KFDA 1XMQJ 3RRKA 2HVIA 4EEYA 4M41A 2QFIA 1YIJS 4MLEA 2LU2A 4GVBA 4V1Ak 2LA6A 1YJNN 2DFHA 5KG5A 5BJRA 1VSIA 4ZN3A 4URGA 7FDRA 3IS9A 2RT3A 3AODA 2YWFA 4NLSA 1NSQA 1NKBA 4C3KA 3DLLQ 2W7AA 1KSPA 3GV5B 2UUWA 2GVZB 1XMQK 1LWCA 3FLCO 2DBBA 1ZBIA 1NMEB 4PYDA 4DTRA 2LDYA 3C6TB 2HHXA 2ROPA 3WXJA 5GMEA 4USTA 4J37A 5HL7Q 4RBUA 4ZTFA 1Q7YT 5SUHA 4DUZF 2GTDA 1U26A 4X66J 5DZ7A 4DR6J 1RCXB 3AJ1A 5E26A 2W9CB 4W98A 3G96A 4B9VA 1TK0A 4PKDB 1AFJA 3MOZA 2AX0A 2RILA 4KTQA 2M3DA 3QATA 2ZH3A 4P10A 4F4KA 2Y1RI 1B70B 3MK6A 1IKYA 2I8EA 1FWPA 1VRTB 1IH7A 4LF5J 2ZH5A 2DNRA 4E7LA 4DR6K 4H0VB 3QEIA 3TQEA 4YDUA 2G1DA 4FF1A 2ZBPA 4JI4F 2HGNA 2Y0BB 5M1KA 4CEQA 4FWKA 3O9QA 2Y8YA 4HHHA 4YDUC 2XS7A 2DHAA 2G0JA 2NQPA 3ETMA 2RF2B 1U47A 1VQ9N 1YGYA 1YJWS 1MWZA 1LNQA 3D4JA 4CEZA 4LF5K 1WSJA 1VJQA 2J5AA 5LJ5Y 2CQCA 2ROGA 4E19A 4D3HA 4ZLJA 1UWAA 4RW7A 2WB4A 4CYUB 3VQ9A 5J1EA 3SQ1A 5KFXA 3V5RA 5KG2A 1FXLA 2XSJB 2IRXA 3NL0A 3KIOA 3A5LC 4ZVHA 3V9UA 3K9KA 4M42A 5D4LA 2AP6A 1U2VA 2YWHA 1UJ4A 2IGIA 5AQPA 1HIYA 2Z2YB 3AJDA 3DFEA 1JLBB 2FLOA 2VBYA 3IXQA 2ZHOA 1MN9A 4HTLA 5KFZA 3WIUA 2VBXA 4DFMA 3BF3A 3I32A 3O9SA 3KOAA 1RWVB 3IO1A 2ZEJA 3ELHA 3SAGA 5GADP 4ES3A 4QBUA 3HTVA 3IAS9 8ATCB 3OR1B 1BA0A 3P4IA 4WP8A 4HACB 5HLFA 4FXWA 1L3SA 3I0SA 1YK9A 1WUAA 2DGSA 1EWQA 2BACA 3O08A 4U9RA 2ZUAA 2VGNA 4YOTA 2HWTA 1T02A 4KHPF 2D1CA 4ED0A 1U1KA 1AROP 2E5HA 1HL6A 2H3EB 4KFBB 4OJGA 3CC2S 1APSA 3KJQB 4M5DA 3AGKA 4F2RA 2P9IA 1SC1B 1Z05A 2GEMA 4I9LA 3SSRA 4F4XA 3VAJA 3KHRA 2L9DA 3X1LB 3CG7A 2EX3A 3GIJA 4JI4K 5HJXA 1X5OA 1N88A 3KK2B 5L8RC 1KHVA 3SIPB 3NCRA 2P9UA 4FYVB 3P96A 3ZT2A 3EE3A 1R8HA 4Y65A 2WAQD 1BCOA 4P7TA 3FK4A 4PY5A 1OVQA 4P2XA 2VJUA 1CJTA 3QGGA 4QW9A 2QWLA 3MR7A 2CPDA 3LTOA 2E9ZA 2GS8A 2Q43A 4DFJA 4RNFA 2PE8A 3OD2A 2PYJA 4IOAQ 4RWWA 2O8EB 3I56N 2OFGX 2GA7A 4DSIA 3W0LA 3SYZA 1S9GB 2DPIA 5B0CA 4CZJA 4RBVA 4ZIVA 5FRNA 3NBPA 1VQPS 4JV1A 4DQSA 2R8JA 4DCHA 1X3MA 4M5GA 3LDPA 5DG9A 1WHVA 2D7SA 5KPTA 1N4LA 3AAWB 3QINA 3VV2B 1ZC6A 4R25A 3MEDA 4KHPJ 2DB1A 3AO4A 4BROA 2XMVA 2HHWA 2BE7D 2H1YA 4ENOA 3LP0B 3IS9B 2V52B 1VK8A 3GTYX 1C4AA 2JLEA 3GFZA 1K44A 3OW2R 1S97A 2D74B 1RFQA 1RBUA 6AT1B 2ABYA 1YJNS 3A5MC 2H5IB 2Q31A 2M7SA 3M2RA 3BJYA 1GK8A 1AB8A 3QZ7A 4KHPK 2VG6B 1QD1A 2AEMA 4OYPA 3TX0A 2FJAB 3A8IA 5KTQA 3LH2S 1RT2B 5CYQB 3AT1B 1ZYQA 2UZAA 4H0TB 1N0UA 3DXKB 3CFRA 1T03B 2P9EA 3NF7A 3CTRA 1KAXA 3LP1A 4YOWA 2HQFA 4PXBA 5IXUA 4FYYB 2ZJQQ 5C0YA 3OUYA 4FJNA 4AQYF 2B7CB 2MYFA 3J81O 4AYBD 1RAOA 2H9ZA 1VSFA 2M88A 1SQGA 5I3PA 3CD7A 2HNZB 1OYEA 2HMIB 2Q97A 4AHRA 1DBDA 3JTNA 3IRXB 1OH7A 2YPYA 5E33A 3HI9A 3LL3A 2ROEA 4CJTA 1E6VA 3JS6A 4O0NA 5DM6L 2MKJA 3EZ5A 3HK2A 1T05A 3U3YA 5DM7Q 1WG4A 3VF0B 2PSZA 3JSMA 1WC4A 3I8BA 2XNQA 2ZITA 2MJUA 4H0YB 2GHVC 2HYIB 4Q5VA 2A1BA 2FB0A 2CNOB 3G8QA 2YWWA 3JYTA 2MKKA 4RWXA 3ENAA 4FKYA 2V8GA 2RN2A 1Q86T 5M1OA 4C11A 3GE1A 3RBDA 4KB0A 2J0QD 3NHGA 3U27A 1JL2A 3T5JA 1O51A 2AYGA 5HJYA 1VQ9S 1FHTA 4Q8EA 1FFWB 4ID1A 2FLPA 5BPNA 1S72N 3CCJS 4EHUA 3CMQA 2DR8A 4O5FA 3AO5A 1D0EA 2GC8A 5E3QA 1T9TA 4ED8A 1FRMA 2BKPA 3N01A 3NXZA 3W2WB 4BRLA 2L41A 4RW9B 4AQYJ 4ZP7A 4FPAA 1VQKN 3TPQA 4NCGA 4UQGA 4A46A 5CD4A 5AZJB 4CGIA 4CFAA 1VRUA 2OPRB 1UL3A 4I56A 2ZHAA 2VOOA 5J2NA 3M7VA 4DQIA 4DWIA 3TW0A 3S1TA 5IV4A 3CF5Q 3R1XA 4RU2A 1JLCB 1VSEA 2YWKA 3Q0AA 4K4TA 4KT0C 4AQYK 2KYZA 3EZWA 1TP7A 3OY9A 1G3OA 4X62F 3DLEA 4FW1A 3LPUA 1S1VB 3NFAA 3KHLA 3PVXA 3C14A 4ZK7M 1WSHA 5LM7E 4W92B 1KEKA 1NGBA 1S0OA 2MDAA 4A8SA 4ZITA 1ZPWX 5IOLA 2XO6A 3B4MA 2R7VA 1S1WB 1RABB 2P9UB 4DU7A 3QEPA 1NOYA 3LDSA 1I3OB 2L48A 2XMWA 3M8PA 4LF1A 4CLPA 3K5NA 2UVVA 2W9BA 2DR7A 3LDQA 4J9MA 3EE8A 2ZQBA 5IQQA 4DV5F 4MYUA 3HKWA 3VAKA 1RHKB 4JD2A 4EZ6A 2HSTA 4KPCA 4I6MB 2OANA 2I5JA 5F8HA 4U7UD 2BRKA 2F8EX 3V1QA 2RDJA 1HMVB 3NBPB 2UV8A 1N48A 3TJ8A 2YV0X 1T3NA 3RMDA 4YN3B 3BZKA 4CDIA 3RMBA 2RDIA 2EI5A 2O8CB 2B43A 3I56S 5FROA 2DYAA 3FRYA 2D0BA 1XI1A 1MWKA 2VD3A 1JJ2M 4X62J 4USMA 1R8PA 4ECXA 1IXKA 4ECWA 3K9JA 2KM8B 1Y5IB 2BW7A 2OPPA 2FY1A 1ZBUA 2CQBA 2HZAA 3AD7C 4BS2A 3CE8A 4NLPA 2XHWA 1LW2B 2ZH4A 2VU5A 3EXYA 3ZXWA 3LALA 2BJEA 3OYEA 3M2RB 1NCLA 1ESVA 1YDLA 5H1SV 3CMAS 4X62K 4OV6A 3L3UA 2IS3A 3OHRA 2AW0A 4DQQA 1LEOA 1YI2N 2GGPA 2CJBA 1WACA 1H98A 4KTZA 3MAAA 4DV5J 1SL2A 4WP3A 2IIRA 1C1AA 2CRLA 4WXOA 3AFGA 4JI3F 4PKGA 3D3BJ 4C23A 1HFEL 4NE9C 4C8ZA 4BRMA 3OUYB 1T44A 2CQ3A 2XWYA 5KG6A 3ET6B 3PACA 2VWKA 4CFCA 1MROB 1N6QA 1WSFA 1K8AT 3DWLA 1HJRA 5KFSA 4DV5K 2CJ9A 4ITSA 3MXHP 2OZSA 1EETB 2P9KB 1S57A 4K4ZA 2FXUA 2AX1A 3DI6A 3M8SA 4E7JA 1NK8A 1QY7A 1VLOA 3UN5A 1AZSB 3TUIC 1HI1A 3LP2B 5IC4B 2A3ZA 3C7NA 1K1SA 1NB7A 3L3VA 3JYTB 4CLZA 3HVTA 3DMJA 2YKQA 3DM2A 4JKGB 3TI0A 3CFOA 2VJVA 4N77A 3PR5B 3MX2A 3Q86A 4J9OA 3H46O 4JKBA 1IBMF 2GUPA 1RWMB 3N4WA 5E3PA 3QQCD 3VEWA 1LW0A 4QPXA 5C2DA 3OSNA 4Z4EA 5TKYA 1KP6A 1HWKA 2QMWA 4D3GA 4DV1F 4FLVA 4IO9Q 1Y7PA 2MHNA 1WORA 3F9MA 2MSSA 4IFVB 3HPHA 1IJEB 4P71A 2KL8A 3M6UA 3MCOA 2GAHC 3A8EA 2Z1HA 4ZA1A 3CWJA 1H7WA 1S72S 4TNOA 1QTNB 2KT3A 4CEDA 1EAYC 5HOOA 2DTJA 4BQZA 3MM9A 1VYAA 3K5PA 3D66A 3DRXA 3CJ1A 1HARA 3VF2A 4MFBA 3G82A 4NLCA 1JCEA 5T7LA 3OSPA 3TARA 4B9TA 1VQKS 1VQ4N 2HBLA 4GKJF 3MEEB 3SLCA 2EFVA 3DLEB 3SFGA 2VC1A 3EVWA 5LXYA 2QIFA 2OD6A 3C14B 3OLBA 4WFNL 4EYHB 4UT4A 1X4GA 3PJ9A 5IS2A 1ZBLA 3V9ZA 4X4SA 3FCHA 3KJNB 4XO0A 3A3OB 3VAHA 5C10A 4WZQA 4AXIA 1IBMJ 3HM9A 5B7WA 5B8HA 5I3UB 5HRRA 2WBNA 3A5OC 4ECQA 1X5SA 4TVAB 5K5MA 1JLEB 4DPUA 2GMJA 2MQNA 4C3LA 1LWEA 3UDEA 5FD1A 3OTCA 2VV5A 4Q0BB 3DLGA 3NOCA 5CCLA 1YBAA 1W7WA 2ASYA 4FJGA 1IBMK 1E4GT 5E3AA 3M6VA 4W4MA 1KDNA 3MN6A 4ED4A 2R7QA 3KZBA 4BG9A 4ID5B 1RBTA 2F9TA 2RVJA 2MLXA 1NSPA 1RU2A 1R6YA 4PQAA 1P8ZA 3CXCR 2Z58B 2OCEA 4FK2A 1YBUA 1VIOA 2HHUA 3BO4A 3D2EB 1GOCA 5M1FA 4LBIA 2Z2ZA 2R8IA 5BR9A 1RT7A 4B9SA 4USJC 4TKTA 4O44B 5BPMA 2LXIA 4GKJJ 4X4VA 1JJ4A 4Y28C 3BN4A 1NPRA 2ZVIA 2BM0A 1D9FA 1NUEA 4ED2A 2PIIA 4Z37A 3NVKA 3HMJG 4JLHA 3DRRB 4JRQA 2N7YA 3GOIA 1ASUA 1RBAA 4LH4A 4K4XA 2ZKUA 3M05A 4B9LA 1QUVA 4GMJB 4HCCA 2PD1A 4O8KA 4H5NA 1BHNA 1B64A 4GKJK 2FVPA 4C8NA 2WONB 5IM0A 2CQDA 4A8FA 1U48A 4BRPA 3PJXA 2V5HG 4Q45A 4XK8C 1J5OB 2Z2LA 4IO8A 3JQMA 5D15A 2IMOA 4LVNP 3KLFB 4F3QA 5HMZA 3WNFA 3MAAB 4OIXA 1HQEA 1R43A 4N47A 2AZ3A 1Y4ZB 4U7CA 4USKA 2MXYA 3KJVA 4W5QA 3E01B 4Y34A 1VQLN 4ED7A 2EC0A 4DU3A 2C42A 3QT8A 2OJ3A 5KOWA 1YI2S 4RUBA 3W5XA 4LF8F 3GMGA 4ILMA 3SSQA 4CIGA 1GEHA 4OI3A 1L3KA 3PKYA 3KKRA 3FE1A 2AZ1A 1U0HA 2P2CB 4DU1A 4KHQA 5LXRA 2HNDA 1TKZB 2EFNA 4YQWA 4BE2A 2E2QA 4JN4A 3P5TL 4OI6A 3PY8A 1MW7A 1SJ1A 1CULA 3U7JA 2MKHA 3A2FA 3QMLA 3GLJA 2QKKA 1UA1A 1YZ6A 3L7UA 5AQWA 2AU0A 3CD5A 4OZ0A 1Y97A 3CDAA 1J5EF 4ETZA 3OW2M 4M45A 2YX7A 2V51B 3CCEN 4TU7A 1U49A 2XZWA 4CHZA 4TYBA 4K25A 1DTTB 3ILIA 4IH7A 2NXUA 4YOYA 3KJFB 1LW0B 1K8KB 5ETTA 4NOHA 1N54B 4WF9L 1K0TA 2JZ5A 1VC5A 1JMTA 1C0GA 1XMOJ 4M3TA 3OR2A 4LFCF 1B0TA 3G4SN 3IGNA 2BGGA 1WI6A 3HBTA 3GJQB 3M1VA 2ACMA 3NEKA 4B1VA 4BBYA 3O2IA 3C19A 4ECSA 5HO4A 2X51A 2IRYA 1BQXA 4DV3F 3CMES 3CJ9A 4ISGA 4LF8J 4R79A 4ERDA 3Q7BA 4YY3J 4XDDA 1Q86O 5DDQC 3IM8A 3DRPA 3EDRB 1FXDA 1F5AA 1XWLA 2FBXA 2F7TA 2QL9B 3IMQJ 1RGVA 3KLIA 3O4QA 2APOA 1FX4A 5L1IA 5T7LB 5KFGA 2KVQE 2K1RB 1DEJA 3L2RA 1HYSB 2QV6A 2RU9A 3MWPA 3VF6A 2OO4A 2VZ9A 4O3NA 3SQGB 4LF8K 4A57A 4ZP9A 4YY3K 1FFSB 2BM1A 4IQXA 2I7NA 4AL5A 4UTGA 1YJUA 1J5EJ 5HBMB 4PQUA 5F8JA 4K2JA 4CO3A 2RKIB 1VQYA 3HOTA 3QLHA 3T1AA 1R31A 5F8NA 5B0BA 1UVKA 4KGKA 1VQ4S 3KK1B 3LO3A 1WOSA 4P6QA 3FSXA 1KS2A 2EK1A 2QRRA 5JVGQ 1WG1A 3FZMA 5K20B 4LFCJ 2IVNA 5EN1A 3BGRA 2RS2A 4AHSA 2FBTA 5A0YA 2QM1A 5C24A 1WKLA 1UAXA 1J5EK 3H8YA 3H1VX 1SKWA 3OVBA 3OYBA 1S6PA 3W1YC 4HH0A 1LOUA 3D1OA 4FLZA 2EBGA 1FDBA 3ZSRA 3MZIA 3WNEA 4RW6B 2X1AA 3BM7A 3MMCA 1VQ8N 2LP4A 2WOMA 3CC4N 2IC3B 4FDFA 4Q7AA 4LFCK 2B4UA 2N7CA 1BISA 2KFYA 4CEEA 2JLFA 2PC6A 4QOTA 2KW4A 2VG5B 1PJ6A 3OYFA 2LLZA 3P39A 2L3MA 3DOMA 1HNZF 5ETVA 4C0OC 4H4MA 4ED3A 1RDRA 5D3GB 4DV3K 3J7ZO 3HVRA 4YOEA 1DAXA 2R9LA 3N79A 4JRPA 5KPRA 5CYMA 1ITGA 4OL8A 3V81B 1HI0P 4HUEA 1SH3A 3HFKA 1WF0A 1S77D 4FM0A 4UQTA 2C3YA 3OFHA 3Q24A 3QRPA 2AD9A 1U1PA 1FXXA 5KRSA 3TAFA 1E6YA 1NDCA 3KK3A 1J27A 3H5SA 2YTCA 3CCWA 3VEOA 2IDOA 3CQYA 5AQSA 2V69A 5CY4A 3DLRA 1LQ9A 4F9OA 2J8SA 1RBVA 1FF2A 4PHTX 1JQGA 1LXNA 5J2PB 5AQMA 1NDPA 2HQGA 1EARA 4DPXA 4DTNA 5GAEP 4NYFA 3NNAA 4WCEL 2QT7A 4PA1A 4CK3A 1FK9B 4ZVOB 3LOUA 9ATCB 3NMUA 3W5ZA 2VB6A 1PSDA 3TSPA 1CLFA 1RT5A 4O3OA 1WEZA 1RTHB 3T9ZA 1KQKA 3SJHA 2A1RA 4OO1J 4LUBA 1RYSA 5B0DA 2UXDF 3OBWA 3F73A 4NI2B 4ECUA 2XZTB 3EY1A 3P49B 3KNGA 3QJLA 1YKWA 4BRFA 2UXCJ 2D41A 4F0MA 4J90A 2MZ1A 4E1NA 2OELA 2PEBA 5ADZA 3GBTA 1B0VA 2VL1A 4KH0B 5A8KA 1FTRA 1CJVA 4DUYF 1TMJA 4PUOB 4DR4F 3UVJA 2HVZA 4ILLA 1SS6A 2DKOB 4RNNA 4YFUA 3JTPA 3KXDA 1XK8A 2IBOA 2G8HA 2X7IA 3DXMB 1VBKA 4AXJA 3OTOJ 4U67Q 3MD3A 3M8QB 2RD5C 1DQ8A 3D2WA 4CH7A 2UXCK 3OVSA 2C3MA 5AQJA 2FJDB 2CIMA 4ANEA 4EWTA 4YNQA 1LWXA 3VQ5A 3CCES 4HCBA 3E2EA 4BC4A 3AA3A 2UP1A 4LRAA 2KVIA 2YHXA 2C2MB 3OTOK 4OZNA 1JLGA 3IP0A 3UD5A 2KM8C 3FR0A 1EQYA 3JB9k 3A5NC 3MUMP 4TYAA 4IJNA 5BRDA 5I42B 4MO4A 1RLDA 3SQ4A 1FFGB 4CH0S 3BQ0A 2UXDJ 3K7RA 2AJ4A 1WSEA 3JXUA 3RSEA 3KLIB 1G7CB 3K0JA 3VEZA 1P9QC 3OVNA 2PI5A 3EJMA 1TKDA 1KVBA 4USHA 3AY9A 3MDQA 2MZJA 4LF7F 5LSLA 1ATRA 4FZYA 1RDDA 3UQSA 1P1LA 2DNNA 1SAZA 4DUYJ 2PI4A 2NRRA 4IG3B 2H3GX 4DR4J 1J9AA 5KFKA 3MOJB 3CD6S 1SJ3P 1EO1A 2UXDK 4FCYA 1WKJA 1CZBA 5ETRA 1X4DA 4CZKA 2O01C 1ZS6A 3KMSA 1BY9A 1A6LA 4L73A 5GAHP 2W7PA 4K50A 4IEIA 3UE5A 5KT6A 1YJRA 2O66A 2ZH2A 2QWNA 1Z1ZA 3H3OB 1NAQA 3SUQA 4OYIA 1HWJA 4DUYK 4LF4J 4F4YA 2NPIA 4P52A 1KC8T 4DSJA 4DR4K 4CJRA 3VF4A 4CZMA 1RT1A 3UKUA 1NSAA 3UR3C 3D0HE 1N5YB 1HWLA 3HZGA 1NWKA 1HW8A 4LY7A 3E8OA 1UTAA 3VALA 2MKCA 3MR6A 1N5SA 4RO0A 4KIAA 4LF4K 4USUA 3MUTP 5DLGA 4LFBF 2RHSB 2KZMA 4ZLPA 4J2DA 1FESA 3Q7CA 1VC0A 5EHHA 4H4MB 4ZDNA 2AA4A 1CS4B 4LF7J 2FC9A 1VLYA 2KI2A 2E6LA 2BQRA 4NA3A 2AJ0A 3CC4S 2KRRA 4CJ4A 2O8FB 5E7OB 4WKYA 3SDEA 4EI2A 4ZLLA 5DMRA 3N9UC 5KFWA 4CI0B 4FLXA 3I87A 3RG6A 4M5JA 2AV5A 2XLIA 3N0VA 1V5VA 2XMTA 4EYIB 2EG2A 3R9LA 1VBZA 4O4GB 3DLLL 3HULA 2RPIA 1X5PA 3QAUA 4LF7K 3GJSB 2I38A 1KD1O 4P7VA 3WIVA 3RRHA 2VFUA 2F4FA 3H90A 2GCFA 3AVBA 5HL7L 1O0PA 2XS2A 4QYZJ 4U8YA 3ZZOA 1D09B 2UUTA 7AT1B 3QJJA 1I6JA 3CJ3A 2UYTA 2IJNA 4LSLA 3KDNA 3CIMA 5GMDA 3G6VA 3BQ2A 1DARA 4G1IA 3CPEA 2ZJRL 1NHKL 2VDIA 4WFYA 1D1UA 2E1CA 2MKSA 2EBEA 5D0RA 4Z0UA 3J80U 3MGJA 4WXWA 2G2OA 1JWWA 2O8BB 1SUQA 1X0FA 4BGBA 1HWIA 1RQ0A 2BVZA 1N8RO 3V6HA 4LFBJ 3DDKA 3QEWA 2LDIA 1WI8A 1UOCA 4KH1B 4J7CA 1WB9A 4DV6F 2O5DA 1SH0A 4IBNA 3TZYA 4RZRA 4I2PA 2CH5A 5KG4A 4KTWA 2W4CA 2QJ3A 2UVRA 5AQRA 1PJ7A 4CWBA 1UCNA 2M9KA 1KAZA 4CTAA 3OT9A 2V7ZA 4FPRA 2G8WA 3LM9A 3PRVA 2KYXA 2GO9A 1U4BA 5IC6B 1XERA 4GW6A 4LFBK 1QQMA 4K5SA 3HSCA 2MGZA 4JAXA 2D0AA 2QYCA 4MK9A 1ULRA 2CA9A 4M7YA 3VESA 2XMJA 4IDKA 2F63A 3AH6A 2DGUA 1XNRJ 3M6XA 4N8NA 4YMEA 3IA0A 3EGWB 1EB0A 3TWZA 1X4CA 3V9WA 1Q78A 2CNNB 2EWSA 3DOKA 4JI0F 4TY8A 3M3ZA 4ELUA 3VERA 4J9UE 4UW2A 2V4RA 4FS1A 1G4CA 2H5EA 4OHWA 1FRKA 2C1EB 1RT6B 4PWWA 2MLYA 3R5GA 1R27B 1XTZA 4ZPDA 2VOPA 2YNFA 4KHYA 1YHQN 4PR6A 2R2RA 2C2ZB 3WDOA 4OI1A 5D4OA 3THPA 3AVGA 4ZHRA 3WXLA 4MMOA 5EDWA 1JNZB 5L1JA 2V2KA 4ZCMA 4WTOB 3F9KA 5AE2A 3NLCA 2LYVA 1Q5VA 4DV6J 3L0QA 3KHHA 1H3DA 3O4NA 3H2VE 3R6LB 4I2QA 4ALZA 1RAHB 4IKFA 3NGTA 3LZJA 2R7OA 3NG8A 5DG7A 2V8DA 1NGAA 2DY1A 4C8OA 4U95A 2QXLA 1HBOB 1IKXA 3SBGA 4IUFA 3LPEA 3LUYA 5M2RA 2Y1IA 4GNIA 5IT9U 1F9HA 2R2TA 3JQKA 3B6PA 1TYQB 2AYMA 2EW9A 2E1ZA 1M5KC 1Q81O 2OSQA 2G1HA 4DV6K 3ISNC 2VONA 4B1WB 2DNHA 2XY6A 1RAAB 2JVRA 1YJ7A 5KGXA 4HKQA 4JHDB 1SVDA 2D3UA 4JI0J 1RHJB 4Z4HA 3G8TA 1R59O 3S3MA 3F0NA 4BRAA 2DXEA 1M5SA 3EVOA 4CD1A 3AOAA 2XBPA 4WKRA 1YVUA 1WC5A 2Z57B 1TTHB 2DNMA 3VQ6A 2NZTA 3PW5A 1X8DA 3TEGA 2XI2A 9RUBA 1MDUB 4FPBA 3HHEA 5AE3A 2MZSA 3CERA 4CF1A 4OYMA 3CPWR 3A8JA 1NK5A 4A8QA 5SWMA 4ZVTB 4ER8A 2IFXA 4KQZA 3C95A 4JI0K 2DNOA 4W90B 4JKHA 4C1NK 2D3ZA 3P31A 5AQYA 4NX9A 1Z2LA 2R8GA 3W66A 1NRKA 5GAHU 2PY5A 4MIBA 5KG7A 3OS2A 1HPZB 3LA0A 2YXLA 3EEQA 4TU9A 4JV5F 2UUCF 1FVSA 2CGKA 1HX1A 4YHHJ 4ECRA 2HFUA 3EPGA 2CJKA 1UFWA 2QL7B 3R1HA 4BR4A 6FDRA 1RILA 3J7Z5 2WUSA 3H20A 1H74A 1KVIA 4H5WA 1QVFR 4C4WA 1NPKA 3CJ0A 1C0UB 3M9NB 3WEEA 3V9XA 2ZE2A 5IWAF 2HHHF 3CIPA 2E44A 2FLLA 3LDOA 3NE6A 2B4VA 4DL7A 1SQFA 3PW0A 2W2QP 2LQ8A 3OJUA 4OKKA 2RB7A 2V9KA 4YHHK 1IV0A 2W41A 4CJPA 2DXFA 1U6ZA 1TKXB 3H08A 3PZPA 1NBEB 3MX5A 3GG4A 3QB0A 4DU4A 1GMUA 2PO4A 3G6XA 1OJ4A 2HVDA 3UI3A 1EIYB 3O80A 3BSAA 4GC6A 3TVYA 1UW4A 3U8XA 1O1WA 2Q2RA 3D68A 3ADAC 1Z25A 1TL1A 1WNEA 4HT5A 3C16B 4O55A 3T7ZA 2RMLA 4NMLA 1VS3A 3R2DJ 3MM6A 5A6WA 1BOTO 2POKA 1ROFA 4FJLA 1R0AA 1RKIA 1A7GE 5F8MA 1RDUA 1BMQB 2UUCJ 2HVHA 4X4QA 2BBEA 3QT6A 4FYDA 2ALYB 4K4WA 1M5HA 5ETKA 4XH4A 5DM7L 3ZZYA 2GJFA 2E20A 5IWAJ 2HHHJ 2ZH1A 4RG8A 4ZJQA 1CJUB 4G1PA 2FJWA 4X4NA 2R2UA 1YJVA 3SV3A 4MK7A 5THWA 4OX6A 3T6BA 2UUCK 4M3XA 1SL0A 1UWBA 4FVMA 2ZBRA 3QIPB 3VHQA 3L2UA 4DSEA 2EXUA 4KGMA 3I5CA 1KKHA 3RMCA 1U45A 2OH2A 2HFSA 3H1QA 2VPYB 1IBLF 1UEUA 2WVEA 1WC3A 4OJ3A 4DV0J 2VPXB 5IWAK 2HHHK 1JXLA 5HQ8A 4HYKA 1WF1A 2NZ4A 5LMUJ 4H4OA 1OSCA 2KKZA 1NG9A 2HNYA 1GLAG 1RAJA 2HAIA 5J2MA 3O1LA 2QA4N 1RBLA 3C15A 4C8MA 4CHQA 3CCSS 1RSCA 3W63A 4ELVA 4KE5A 3CJKB 4WYBA 4CJEA 2GQQA 4DV0K 3AVLA 1S4FA 3BF4A 2B9WA 1OY8A 1A5VA 3DKDA 3PYFA 4WPAA 2VFRA 3HYFA 3QFHA 4ZKAA 3NGDA 1YHQS 3CCVN 3L2VA 1TMMA 3KG4A 4BWJA 3N6LA 5K14B 3KLHA 3FDSA 3ILOA 3H2UB 2YNHA 2Q66A 5HRNA 5L9XA 1B9FA 5FRMA 2AYEA 3O6WA 4DTOA 2FHKA 3LDLA 3D6MB 1S9FA 1NMDA 4QW8A 5EUHA 4LR7A 3P4UB 1K9MO 3D6TB 1W0HA 5JVHQ 1WC1A 1IBLJ 4MJKA 4KBOA 1IG9A 3RAXA 5FLXU 4BR0A 2EFQA 4JI2J 2JEGA 4Y2MA 1QQNA 4Z4IA 3HSTB 3MXIA 4JI7F 1LFWA 2RNEA 3HPOA 4QWCA 3VQEA 4JKEA 4ECYA 2VA3A 3DRSA 2P9PB 3ISZA 1NM1A 3OYKA 2JOQA 3ATUA 3OYDA 3FEXB 4LFAF 2K2PA 3KKFA 2L9NA 3CCTA 3OYNA 3PTWA 3J80Y 4WFAL 1S3XA 1OH6A 2VA2A 1NNEA 1IBLK 3J7YP 5HAOA 3QFPA 1HD1A 4UY8T 3FUYA 1RLCL 5KFTA 3EYZA 2ZZTA 2HRUA 4JI2K 1VJWA 4DN9A 1CXUA 3F44A 4LBHA 2EKNA 3IFEA 1X4EA 1F5CA 5L1KA 3MECB 4HUFA 3IR6B 2G9OA 2PEHA 1RAEB 3OYAA 2DD8S 4BRDA 3AVNA 3CO9A 4DV4F 1KONA 1B92A 3AV9A 1WELA 3M30B 4FZXC 1LCUA 1MU2A 1EKEA 4LRDA 4LT6A 2GUIA 1YRTA 3W3SA 4J2BA 3BDPA 1WEXA 2OTLN 5DQHA 2XCAA 4HR2A 2X1BA 4LF9F 4LD0A 4CGHA 4OX9F 1S10A 2DR6A 2NS1B 1IKWA 4BACA 4WFBQ 3KHGA 1S1UB 1PC5A 3UNGC 3NAEA 1SL1A 5L39A 2WVFA 3H59A 3H6EA 4OGCA 1VAZA 4JI7J 4TLRA 3NF6A 4CJWA 2ZD1A 2QTWA 2B8PA 2QL5B 3DGPA 5LJ3Y 4K8ZA 1C1CB 1JLQB 1VHIA 4G6VB 4PG6A 4CJVA 4R5PB 2FY8A 3QNWB 3THYA 3B4DA 1K73O 5AXKA 4YB7A 2F8TA 1FKAF 3FZLA 3BP8A 4CGJA 1VK3A 1NHVA 3FCVA 3MR5A 2JEJA 3I5BA 4OHZA 5GAGI 5E3RA 4JI7K 4QIWD 1IUJA 3DYAB 3F56A 1R8BA 3W9JA 2DGTA 1BQNB 2FTRA 2XULA 2MZQA 4IH6A 1EXQA 3KLGA 2E88A 4DV4J 3CIZA 1HQUA 4B02A 4ZCIA 3UE2A 3C8YA 3QJPA 4YOVA 5IT9Y 3MF5A 2MY7A 4RNOA 1PG5B 1KR4A 4DZDA 4ZJLA 4F26A 2I7PA 3PRDA 4DTXA 4BWMA 3PX6A 3ZSXA 4PZVA 3OYIA 4M94A 5MLCV 2BJ1A 2ASLA 4OX9J 1E4FT 3RW7A 3OBYA 4J9RA 2DNKA 2AGQA 4CZGA 3EZOA 4DV4K 4CEBA 1HPMA 3PIOL 4RCHA 5AXMA 1V4SA 3AJ2A 1KRPA 2QWOA 4DR3J 1RB0A 3L3CA 1TL4A 4TLQA 5HN0A 4WFXA 3R7NB 1Q8IA 3KYLA 1WC6A 3M8RA 3C0BA 3GIRA 2VG7B 4IO9L 2HNYB 2GBZA 2LSNA 1Y5NB 4K59A 3O8MA 2R7TA 2V4JA 2PMWA 3TTFA 4OX9K 1U7LA 2GV1A 4JI1F 4KB1A 3Q23A 2E9TA 3I0RB 1ELOA 2P9NA 4IQMA 3MPDA 1JLFB 4DR3K 1XQSC 2F8HA 1TL7B 1QS4A 4K7QA 4LVOP 5A2QY 2QLBB 1PYSB 1Q18A 4DDFA 2OLWA 4PYAA 4Q2LA 1NJWA 2YHBA 3MN7A 1TUWA 2BKOA 2W1BA 3L09A 1D9AA 4DV7J 3VGLA 1VR6A 2W2OP 1QE1A 1NGIA 2Z8QA 1ZTTA 2G8VA 4LH5A 1UVIA 2FYXA 5JXSA 2G8IA 3QBWA 4KH4A 2NLXA 3CDUA 3UKRA 1H38A 1OS5A 2R7YA 2W6KA 4DR2J 1Z2ZA 1S48A 4R0EA 3E9OA 3CCVS 2CGLA 1HBUB 2CVEA 3ZNJ1 3ENWA 3W2VB 1GLBG 4DV7K 1IKVA 3S8SA 3O44A 4X4PA 4QOZB 2GV9A 1WOQA 1GXUA 1JKHA 3AXMA 4YB5A 1BD6A 3SAHA 1HKCA 1CSJA 1H0HB 3OFEA 1SIZA 3CCMN 1R6VA 2CPFA 3QZ8A 2MSTA 4DR2K 3PG9A 1AT1B 1ZXOA 1FJCA 2Q6BA 1Z26A 1L5UA 3MTKA 4P73A 4WK1A 3P38A 2DGQA 1RTIB 3HDSA 1RTDA 3SCJE 2FF3B 2KN4A 3V4IA 3TA2A 2KTQA 2YKMA 3I82A 2I9SA 1VRQC 3DHXA 1FE0A 3FBFA 5EX0A 2B6AA 2GO8A 1T11A 3UD3P 1DGKN 2WB1D 2A6AA 3MUVP 4K43A 3E3XA 1MMNA 2F3JA 1ITPA 2OPSB 5I4MA 3TABA 3H4BA 3QBXA 5FDLA 1SC6A 3MM8B 4B3SF 4A48A 1FJGF 3HX9A 2BABA 4M63A 5KG3A 2LECA 4HI1A 4H0OA 1HNXF 4TU8A 3BPSP 1RXOB 2B7BB 4M63C 1XNQF 3V4MA 3SBTA 3CCUN 3MI7X 2WBMA 1KQSR 4KV8B 3H4DA 4V19X 3CEDA 3C6UB 5L46A 4GV3A 3QO9B 2ZGYA 2A2CA 2Z0GA 5C25B 3GDQA 3HL8A 4X4OA 1NJYA 3UW1A 5BYSA 2IOCA 1G1XA 1RTJA 2V2VA 2ZOFA 1PILA 2ZOMA 2LQJA 2OTLS 2XLJA 2R7XA 3PRBA 1VK0A 5AZIA 4JS5A 2HEKA 4CK1A