1RTDA

Structure of a catalytic complex of hiv-1 reverse transcriptase: implications for nucleoside analog drug resistance
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
554
structure length
554
Chain Sequence
KISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTDTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDESESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA TEMPLATE FOR REVERSE TRANSCRIPTASE
publication title Structure of a covalently trapped catalytic complex of HIV-1 reverse transcriptase: implications for drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/dna
total genus 136
structure length 554
sequence length 554
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rtdA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtdA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtdA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtdA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rtdA05
2O4GA 3HPHA 4DTRA 4WFZA 1DTTB 2FJVA 4JV0A 1YTAA 2VG5B 3DM2A 3ZSRA 4Q44A 1QQCA 1T94A 4K4ZA 4NYZA 3D28A 4X2BA 3RWUA 3CO9A 4EO6A 1JX4A 3MFIA 2KFNA 4CESA 1S1TB 3KKSA 4HUFA 3BJYA 3V4IA 5FDLB 3T5HA 4DTSA 3L2VA 2FVSA 1S6QA 3KHHA 1HQEB 1S9EB 3DRSA 4NCGA 4QAGA 3KLEB 4LH4A 3CDUA 5KFSA 5KT5A 3V1OA 1LWEA 1HYZA 3HXMA 3MTKA 2IM1A 4RW6B 3T5LA 4FJNA 4CFCA 3H40A 5L1JA 3KD1E 4LY7A 1KLMB 1T03B 4XIUA 4MK9A 3NAIA 3VQ5A 3NCIA 3HVAA 2VWJA 1IKYB 3QIDA 4QWDA 3DLKB 5J2PA 4BE2A 2R2SA 3WNEA 4NRUA 1FKPB 4URGA 1JLCA 5HROB 4F2RA 2HHWA 3MEGA 3I0RB 2IS3A 3O3FA 1ZTWA 1S9GB 3LAKA 2YHBA 3CFPA 5KG2A 4DQIA 3OYCA 3N6MA 5KFTA 3SPZA 2ZKUA 3PW2A 3DRRB 3D45A 1HNIB 2EC0A 3KLHB 2HNYB 3ULDA 2FBXA 3OL7A 4E7LA 4KO0A 2OPRA 1LV5A 3QEIA 4AHSA 1RTJB 3TAFA 4M45A 3OL9A 3SJJA 4PY5A 4CJEA 4FJ5A 4TY9A 4MK7A 3G0ZA 2AX1A 3MFHA 1BHLA 3SFUA 4GW6A 3CDEA 1HMVB 3KK2B 2QK9A 3PW4A 4KE5A 3F73A 1VRTB 3SV4A 1JLGA 5KFEA 5EU7A 3ZT1A 1S0NA 2XCAA 2GBZA 4ELVA 4RUCA 4RNOA 3K5LA 2E9TA 4FJ9A 2YNFB 1HQEA 4OPJA 4KHNA 4CCHA 3AO2A 5F8IA 4DF4A 1LWCB 3M9MB 4O3RA 5KFAA 2V4QA 4JRQA 3AVMA 2IA6A 2QV6A 4Z4GA 2R8JA 1XI1A 4MQ3A 3V1QA 1RTIB 4G3IA 3ZCMA 4CJSA 3AVCA 4ZVEA 5KFIA 4DG1A 3L2UA 5EDWA 3E51A 1TV6A 5HROA 1WAJA 2HMIB 3I0RA 4CJ4A 2PY5A 2FVCA 4LSNA 4DF8A 3ISNC 4IKFA 4M3ZA 1Z4UA 1ASUA 3DOLB 3V1RA 2IGIA 4XO0A 2OPQA 1A5WA 2HW3A 4CJQA 2BRKA 1LW2A 2ZQBA 3QEXA 1ZBIA 1VSHA 2XGPA 5HRRA 3LP0A 1JKHA 4WE1B 4MKBA 1ZBFA 2BRLA 1EXQA 1DTQA 3S3OA 1QSSA 4RG8A 3FRZA 3F9KA 4ZPAA 1BQNA 3OY9A 4B9MA 4URSA 5L1IA 3VN5A 1RT1A 3KNAA 4R0EA 2DTUA 2IC3A 4PQUA 1A5XA 2AGQA 2RDJA 4FJLA 3V9WA 2X78A 3MEEB 2YNIA 3QESA 4M42A 1HMVA 2P1JA 3OYKA 1VSIA 1RT2A 4G1QA 2ATQA 3HO1A 3RB6A 3LANA 2AX0A 4FZZA 3UQSA 4DTOA 3HVWA 4FLUA 2J6UA 1W9HA 2B6AA 5C42A 3H2LA 3HYFA 1TGOA 4FJJA 1FKOA 4FCYA 3SUNA 3QIPA 4OGEA 4O44B 2C28A 1LWCA 1TL3A 4HUGA 2B5JB 2R2TA 3HPOA 1NK0A 3KHGA 1R0AB 4E19A 4N56A 2HWIA 4BE1A 3DMJB 4E89A 3VQ8A 4FBUA 2W42A 4KHUA 3SI8A 4ID5B 3ZSWA 4EZ9A 1S9FA 1S1XA 3OYJA 1U09A 1D9DA 4Q43A 4ZTFA 3M8RA 1IKWB 4DSLA 5I42B 2X6SA 1F21A 1JXEA 5KRTA 4E0DA 4O3SA 4CHYA 3RR8A 3RB0A 3DOLA 4WYLA 1VSEA 4CJRA 4ECVA 4J9PA 4KPYA 3H5UA 4DL7A 5KFDA 2XCPA 4MIAA 4TQRA 2DY4A 1RDRA 4NCAA 2QXFA 3FQKA 3I0SB 3EYZA 3PHEA 4O3QA 3KLGB 2BE2A 2HNZB 4PWDA 4ZPBA 4HCCA 4DFMA 2G8VA 3RRHA 4DL3A 4F4KA 3ITHB 3TVKA 3PY8A 1SKWA 2WONB 3SQ1A 3OYAA 4KHRA 4HCBA 3TANA 1NK7A 1C0UA 3GV7B 2JGUA 4JLHA 4DLGA 3SUOA 3VQ4A 2P5OA 1SUQB 4RZRA 2Y1IA 2OZMA 4DU4A 3DLGB 3SQ4A 4Z0UA 4KAZA 3I8DA 4Q8FA 3VQEA 2FVPA 3TAMA 3QIOA 2XO7A 3L2RA 4R8UB 3TABA 4KB1A 4NLYA 4J2EA 4MIBA 3QEWA 2IM3A 4CF9A 3HVTA 2IAJB 4Q0BB 4KBIA 2W9BA 3C95A 2D5RA 1REVB 1LWFB 5KFYA 4FK0A 3CJ2A 4KI6A 4CIEA 3PR4A 1HJRA 4EBCA 3MECB 2W9CA 1ZETA 4B8CA 4DTNA 4CFDA 4CEBA 5F8NA 3KJVB 1UWBA 1RBVA 4Y34A 4BACA 4KTZA 3BSNA 3MR2A 3UPFA 3GIJA 4CFAA 3NHGA 4F4ZA 4JRPA 2FLPA 4ICLB 2UUTA 4ED7A 1TP7A 4WXWA 2WB4A 1SL0A 5CYQA 3VQDA 3PX6A 2YV0X 4OL8A 3PJXA 4O4GA 4CHQA 5C25A 4I2QB 2KZZA 5I42A 2G8IA 3NGDA 3OJUA 4KREA 2LSNA 4CIFA 3TAQA 3CJ0A 3LP1A 1RT7A 5K14A 1A5VA 3NH0A 4DSJA 2GUIA 1IO2A 3V6DB 3OYNA 4NLSA 2V0NA 1KRPA 1BI4A 4RNMA 1KVAA 4GC6A 3DOKB 3BSOA 1D5AA 4ZPCA 1C0TB 1MU2A 4CJPA 1S1VB 1YT3A 3NH1A 2FLLA 1TQLA 4EBDA 1RTDB 2HHUA 3LP3A 2BQRA 2XGQA 4BDZA 5EWEA 1TKZA 2I5JB 4I2PA 1X1PA 4PUOA 1Z25A 4CE9A 3P83D 2J6TA 2RF2A 3GIIA 1K6YA 1RT6B 2YKNA 3OS2A 3MXJA 5KFRA 3OLAA 4DTUA 4KHYA 3MXIA 5KFXA 1SUQA 4E1NA 2Z1JA 2YNGA 2AGPA 3KMQA 3TR8A 3DRPA 2RDIA 4Y3CA 4EYHB 4Z4IA 3ZSXA 2HHTA 2OPSA 3VQAA 1NHUA 1ZBLA 3OSPA 4AHCA 1GX6A 1EP4A 4FJKA 5DLGA 3DRSB 4NCGB 1RT4A 4FS1A 3ISND 3PO4A 4DQQA 3M8SA 1LWEB 4ZPDA 4FLVA 4ECXA 3O3HA 2AU0A 5KG3A 1VSLA 4C8MA 3BREA 4EO8A 1HYVA 3TWHA 4KHQA 3AA2A 4DTXA 3NF7A 2V4RA 3VQCA 4CGGA 4DTMA 4DEZA 1GX5A 1NKCA 4J2BA 2Z1HA 4DL5A 3L8BA 3M8QA 3SUPA 2D0CA 4NLOA 2F8EX 1JLCB 3BSCA 3V6DA 1LAVA 1NOZA 4IBNA 3MEGB 3RRGA 4WZMA 1QE1A 5F8GA 4AH9A 3CG7A 4Z4CA 3AA5X 3KHRA 1J9AA 4RW4A 3CVKA 5KFPA 4NLXA 4DQSA 4ZHRA 1ZBHA 5J2MA 1U45A 2ILYA 4AHTA 1QAIA 3UR0A 4TYAA 2OZSA 3O4QA 4WFYA 3LWMA 3AV9A 3HHKA 1Q8IA 3KK3A 1CLQA 4KO0B 2OPRB 2QKKA 2D3UA 4FM0A 2O5DA 4OKKA 2FC0A 4TYBA 4L8RB 4FW2A 4K4SA 4TY8A 1SL2A 4N41A 4FK2A 1KTQA 2P51A 5KG1A 1SH2A 3OHAA 1JLGB 3SNNA 4IOBA 4NCBA 2R8GA 3OHBA 5KFVA 1EETA 1WSJA 4TLRA 1RBTA 1HQUB 5KRSA 5F9LA 4NLRA 5KFQA 3KK1A 2X6NA 3H59A 4B3OA 3H98A 4DMNA 4J9SA 1J54A 4ED0A 4E7JA 3DYAA 4ED6A 3EZ5A 4DFJA 4H8KA 5KFFA 4FLWA 3EPIA 4RW8A 1IM4A 4B08A 4FJMA 3OL6A 1JXBA 1TL1A 4IH5A 4QPXA 2DPIA 5FRNA 3V9UA 4KSEB 1IKVA 3MEDA 5KFZA 5DQIA 3ZSQA 1SH3A 1RYSA 2W9AA 4DG1B 2YHAA 1T8EA 3IN5A 2ASLA 1IG9A 4KI4A 3SI6A 1WAFA 2OPPA 3LZJA 1TV6B 4IFVA 3LZIA 4CFBA 3RR7A 1GOBA 4LSNB 5DGAA 3K57A 4RUAA 1S5JA 3TI0A 3NBPA 4NYFA 1RILA 2OPQB 4QWEA 4IKAA 4KHSA 5F8JA 3EPGA 5CY4A 3B6PA 1LW2B 1X9WA 2V9WA 4CGFA 3KLVA 3RAXA 3LP0B 4RNNA 2F8SA 3T1AA 1JKHB 1I6JA 1DTQB 1KHVA 4DQRA 3VQ6A 5KG0A 1BQNB 3PUFA 3C6UB 1RT1B 3PW7A 3P5JA 3OYLA 1TAQA 2IC3B 4PQUB 2ASJA 3VA3A 5KFKA 2W8LA 2E9ZA 1JLBA 4W5QA 2FVRA 3K5OA 2YNIB 3AO5A 5F8LA 5KFMA 5DLFA 4DL6A 4TQSA 3UIQA 4F2SA 3RBDA 1RT2B 4G1QB 4LQ3A 3C6TA 2BANA 3QGGA 4FYDA 1YVFA 2BDPA 1S4FA 1ZYQA 4LQ9A 5KFUA 1HQUA 2B6AB 3M8PA 5C42B 3KD5E 3MXMA 4N76A 1O1WA 3HP9A 1FKOB 4OKEA 4B9UA 3QIPB 1SKSA 4IH7A 4K4UA 1TL3B 4IRDA 4YR3A 2WRMA 2F8TA 2E4LA 4M3XA 3MR5A 4O3NA 1ASVA 1VK0A 5J2NB 2VWKA 4U6PA 1NJYA 4DFPA 4B9VA 3V9XA 4DS5A 4FS2A 2RPIA 4H4OA 1S1XB 1RTHA 2D7SA 1BGXT 2XI3A 1Q9XA 1NNDA 5KFGA 4DL2A 4RW9A 4RW7A 5D3GA 3OSNA 5DMRA 3OYGA 1MMLA 3DI6A 4DL4A 3MAQA 1L3TA 4ELTA 4C8OA 2JC0A 1U48A 5HRNA 4O5BA 3BQ2A 4ED3A 2R8IA 1UOCA 1LW0B 3SUQA 2HHXA 4CJ3A 1W0HA 1XR5A 1C1CA 5KT4A 3PJWA 4ELUA 4NZ0A 2VG7A 4OGCA 1T7PA 3HK2A 2BE2B 1S0MA 4PWDB 1K1QA 4FJIA 4NLDA 2ILZA 4OPKA 3IG1A 4DS4A 2BGGA 3PW0A 3NE6A 3C6UA 2IMWP 2HNDA 3AVKA 3PV8A 3JSMA 4QOZB 3SQ2A 4W5TA 2YNHB 4F3TA 4K4WA 3QEVA 4Z4FA 3AVGA 3NMAA 4FLXA 2ZD1A 1I3AA 1C0UB 3Q8SB 1KLNA 4R5PA 2JEFA 5T14A 4FM2A 3SQ0A 1EX4A 4QW8A 3LWLA 3GQCA 1S6PA 3TAMB 4DSKA 4DSIA 3CYMA 4CK2A 4ZVGA 3HVTB 2W9BB 1S10A 4J9MA 3LPTA 2W7OA 3IAYA 2W9CB 2AGOA 3QNOA 2R8KA 4BWJA 1UWBB 5E41A 2BR0A 4Y1CA 1TKTA 5J2NA 1G15A 2KW4A 2JEGA 3G6XA 2UVWA 4M3RA 1BIUA 1L3UA 3CJ4A 5F9NA 2OA8A 2W8KA 3S3NA 5CYQB 4FJGA 5HLFB 1B9DA 4O4GB 3U3YA 3VQ9A 3QERA 5C25B 5DGBA 3QETA 4RU9A 1C2PA 4ZTJA 3V81B 5F8MA 3LP1B 5L1LA 1RT7B 4CERA 5K14B 5HP1B 1BIZA 4KAIA 1NOYA 1I39A 1LW0A 3M9OB 1N56A 4QWAA 2O4IA 4Y2CA 5DG7A 1VRUA 5KTQA 1WSIA 2OYQA 4W5NA 1BI4B 4AHVA 2R2UA 5KT6A 3QGIA 4N47A 1RA7A 1MU2B 3BQ1A 4O4RA 3WNHA 4DTJA 2QE5A 1XHZA 4CJWA 5HRSA 2FLNA 3QEPA 2ATLA 2DFFA 1TKZB 1TKXA 4H4MA 4I2PB 4PUOB 1WN7A 1L5UA 5DQHA 4O0JA 2RF2B 4M95A 1FK9A 4KV8A 4K8XA 2YKNB 2YNHA 3L3VA 1KHWA 1TKDA 3AVNA 3EY1A 3KLIA 3IS9B 2YNGB 3NAHA 4JV1A 4ECTA 4F4WA 3TAGA 1EKEA 4M3YA 3H4BA 3DRPB 3BQ0A 3ASMA 2FBTA 5I3UA 4M3UA 4KKOA 1T05A 1D9FA 2WHOA 4KB0A 2OPSB 4Q5VA 3RMCA 3CWJA 4F4XA 4ED8A 1S1UA 2HHVA 2GIQA 5C24A 4CJKA 2FBVA 4BDPA 1EP4B 4YR2A 1RT4B 3SYZA 2XY5A 2HVIA 1WSHA 3B6OA 4JS5A 2FJXA 2HWHA 3H4DA 4CJUA 4B8AB 1JLAA 3HVRA 1HPZA 3G6YA 3V6KA 3CFRA 5HLFA 1BISA 4ECZA 4CGHA 3BDPA 3NAEA 3GIKA 1RCHA 4IFYB 4MFBA 1JLFA 2UUWA 3V81A 1NK4A 1KSPA 3V6JA 1B92A 3M8QB 5HP1A 3D5MA 3NF8A 2E6LA 4AILC 1IKXA 1QE1B 3T5JA 1JLEB 3VQBA 3HKWA 1S1WA 5EUHA 4RW4B 4J9KA 2IM2A 3VQSA 3U6FA 2UVRA 3ZT0A 4ZHRB 1TK5A 5J2MB 2FVQA 4GVMA 2QKBA 1TAUA 4I7FA 2HVHA 3CFOA 3QO9A 3KK3B 5KFLA 1KFDA 1VSDA 1K1SA 1RBSA 3AVLA 3NKYA 2IM0A 4KFBA 1RT5B 4O55A 1NKBA 5JS2A 4ZP9A 4CEDA 4ZVFA 3OYHA 3IS9A 3AO1A 2IOCA 4TY8B 4LD0A 4JUZA 3N6LA 3E01A 4YQWA 3V9ZA 4K4XA 1D8YA 4ZMMA 3QZ7A 1WSGA 2CJQA 2J6SA 1VSMA 4C8KA 3OS0A 3CM5A 5DG8A 1NJXA 1EETB 2KQ2A 3QLHB 3CDWA 5CZ2A 2XY8A 4IH6A 2KTQA 5KT2A 4ZP6A 2VG6A 3KK1B 4K8ZA 4B3OB 4C8LA 2NUBA 3DYAB 1CZBA 2D0AA 4CIGA 2A1SA 4NLVA 3K59A 5CYMA 3MF5A 5DG9A 4O0IA 4J2DA 1HYSA 5J1EA 4RW8B 4KTWA 1TL1B 3PO5A 1BQMA 1GOCA 1S0OA 3BGRA 3FFIA 1IKVB 3MEDB 2E9RX 5J2QA 4IFYA 3QGHA 3MR6A 3ZT3A 2XY6A 3LAMA 3EZUA 1RBUA 3H5SA 1YTUA 2G8FA 2OPPB 1N48A 1ZTTA 1TVRA 4IFVB 4BE0A 3PX0A 3OS1A 3M9NB 1JLEA 2BQUA 5DK5A 4Q8EA 3NBPB 4NLWA 1UA1A 1B9FA 3AVJA 3I5CA 2RKIA 3WNGA 4CHZA 3K5MA 5KFBA 2G8WA 3Q8QB 4KTQA 3QZ8A 1Q9YA 3KLFB 2X74A 2XHBA 1KFSA 2D3ZA 3JYTA 4C8NA 2XRIA 4IQXA 5C5JA 4KHWA 1RT5A 4CHNA 4WZQA 5JXSA 4Z4HA 1T3NA 3TQ1A 2Z1IA 4HUEA 4B9SA 1JLBB 5SWMA 4Y1DA 4FZYA 3ZT2A 3C6TB 3OVNA 2P5GA 2BANB 2PZSA 2AWZA 3H08A 4EP4A 3QLHA 3AVIA 5KG7A 3FSIA 3M8PB 3AVBA 5FRMA 2DFEA 3CJ3A 2ZE2A 4KB7A 1RT3A 4DWIA 1NK5A 3NDKA 3ZT4A 4CJTA 5KT7A 5EWFA 4EBEA 4CF8A 3Q8PB 4DSEA 3NFAA 2WK4A 3G6VA 4NLGA 1WNEA 1N6QA 3MR3A 1JLQA 3H5XA 1QSYA 4M3TA 4M41A 4H4OB 4IG0A 4IDKA 1WSEA 1RTHB 4ID1A 4CF0A 1ZBUA 4CGIA 3GYNA 4YFUA 4UQGA 2Y1JA 3NF6A 4RW9B 4RW7B 5D3GB 3LP2A 3CIZA 3DI6B 3SZ2A 2EX3A 2WOMA 4CF1A 1QAJA 3D0PA 1C1AA 1RA6A 2R8HA 4CEEA 4HYKA 1Y97A 1RDCA 4JS4A 4O3PA 1IH7A 1HRHA 2ASDA 3T3FA 3VA0A 2WTFA 3QNNA 4F3OA 1C1CB 5FROA 2JEJA 4EEYA 1SV5A 1HARA 2VG7B 2JEIA 2Q3SA 4ED1A 3ZSOA 1J5OB 3KLFA 4CHPA 3DLEA 2R7YA 2ETJA 2W7PA 3IG1B 4J9LA 4FW1A 5KFHA 2HNDB 1CZ9A 2CKWA 3JSMB 1SKRA 4FZXC 4IRKA 3ICLA 2ZD1B 1ASWA 4FJHA 3KIOA 3NL0A 1XHXA 4R5PB 1XR6A 4E7IA 3HPGA 4HTUA 2GIRA 5HBMB 1DTTA 1S6PB 3VQ7A 4OVLA 3VQQA 4IR9A 4FVMA 2VG5A 2E6MA 4EZ6A 5KFCA 3LDSA 4FK4A 4E7KA 4I9QA 3ZSZA 3L3UA 4FM1A 4ECYA 1S1TA 4KHMA 1TK8A 1RYRA 5FDLA 3K5NA 1VSFA 4GMJB 4E7HA 4OLBA 1CSJA 3L2QA 3OJSA 3CQ8A 1TKTB 1TK0A 4MKAA 3GILA 2EHGA 1QUVA 3TAEA 1S9EA 2XI2A 4Q45A 2GV9A 3KLEA 5CZ1A 1U4BA 4FJ7A 1JIHA 3H5YA 4HVJA 4WYWA 4RW6A 3DDKA 1U49A 2DPJA 5KGWA 5HRPA 4B9TA 3IRXB 3KMSA 1KLMA 1T03A 3OYDA 4TN2A 3SCXA 3KKRA 1IKYA 4CEAA 3LPUA 3DLKA 1VRUB 4FJ8A 1YVUA 3PW5A 3RTVA 3RMBA 1L3SA 2WCXA 1Z26A 4BDYA 1FKPA 4J2AA 3C94A 1QHTA 2I1RA 3QYYA 3SV3A 1S9GA 1J5OA 3T5KA 1NK9A 5JS1A 2FJWA 4FXDA 1TKXB 4H4MB 1QSLA 4TXSA 1L3VA 3KTQA 2IJFA 5KFNA 2IDOA 1FK9B 3ALYA 4KV8B 4J9OA 3DRRA 5KFWA 1HNIA 4M94A 5KGXA 4K4YA 3KLHA 4ECWA 2HNYA 3KLIB 4ZVHA 1BCMA 1RTJA 5HBMA 3GV5B 4YMEA 4J9RA 4K4TA 3RB4A 1BCOA 3DLRA 2IBKA 1NJWA 4HKQA 1X9MA 5I3UB 3HT3A 1NK6A 1OS5A 4KKOB 1T05B 4ECQA 5KFOA 3OYEA 4CHOA 4CJFA 3KK2A 4XPEA 4WXOA 4CEFA 1S1UB 1VRTA 1ITGA 5C24B 4FLYA 4NLPA 3OYMA 4J9QA 3TAPA 2YNFA 4YP3A 4CK3A 3I5AA 2PYLA 1JLAB 1HPZB 5EWGA 1DLOB 5L1KA 3OLBA 5L9XA 4OKJA 2GC8A 2C2EA 3AA4A 4MFBB 1JLFB 1NK8A 3IRXA 2UVVA 3O3GA 3O4NA 2C2DA 1RTIA 2F96A 3OYIA 3KHLA 4MH8A 3AVAA 3G10A 1IKXB 1N4LA 4DU3A 4YNQA 1S48A 1S1WB 4ECSA 2HHSA 1JL2A 3BR9A 2HMIA 3HSTB 4IG3B 3NGIA 3LALA 4ED2A 4CEOA 1KVCA 4I7FB 4ZP7A 1RDBA 4ECUA 1JL1A 3QO9B 4NYNA 5DQGA 1N5YB 3HL8A 4KFBB 3AA3A 3Q8RB 2VA3A 1J53A 1S97A 3OYBA 2AQ4A 4WE1A 1RBRA 4JV2A 1BL3A 3KOAA 4GC7A 1NKEA 1S49A 4N5SA 3E01B 2XWYA 3P1GA 1RDAA 3UDLA 4NRTA 1NHVA 4W5RA 1U47A 3CM6A 4ECRA 3MEEA 4F4YA 4LSLB 3QINA 1W25A 4DQPA 2VG6B 3T19A 4DLEA 3FQLA 3K2PA 1RNHA 4WFXA 4QWBA 1FXXA 5KT3A 2KFZA 1HNVB 3PX4A 3N6NA 2BQ3A 4Z4EA 5KG4A 5CYMB 4DSFA 1HYSB 3TARA 5J1EB 4O44A 1JXLA 2FBYA 3L2WA 1C1BB 1DLOA 2B5JA 1BQMB 1CXQA 3BGRB 3FFIB 3THVA 2OH2A 4TSXA 1X9SA 5J2QB 3A2FA 1R0AA 4ZP8A 2RN2A 3RBEA 3DMJA 1WLJA 4FJXA 2Z1GA 2AJQA 2KZMA 3NF9A 4ID5A 1TVRB 1C6VA 3HM9A 3GV8B 3SPYA 2C22A 1SH0A 3RMDA 1IKWA 3DLBA 4OJRA 4K4VA 2D41A 5JUMA 1NJZA 1D0EA 4CECA 4IG3A 3NH2A 1UA0A 2JC1A 2RKIB 2G8HA 4NLUA 3RB3A 1VSJA 4IRCA 2ITGA 4URQU 5KG6A 3DLHA 4CGDA 5T7BA 4DFKA 4O3OA 2C2RA 1N5YA 3AVFA 5F8HA 2YKMB 3JYTB 4NLTA 3I0SA 4H54A 2XC9A 4I9LA 3HJFA 3KLGA 3FDSA 3PVXA 2HNZA 4Y2AA 4BWMA 3WNFA 4B9NA 4CEZA 1LAWA 4CJ5A 3IGVA 3ZSVA 2VA2A 3ITHA 3NGZA 4PA1A 2WONA 1UAXA 4AHUA 5SZTA 3ZSYA 2JLEA 4CJLA 4LH5A 3AO4A 4FBTA 1WNSA 3I5BA 5KFJA 3GIMA 3K58A 2HHQA 4LSLA 2R2RA 2HAIA 2ALZA 3V6HA 3DM2B 1RAJA 4CEQA 4KRFA 3DLGA 3RMAA 1D1UA 4NLQA 1GOAA 4W5OA 4U7CA 2ZE2B 4RNHA 1HNVA 4QW9A 4RNFA 1XR7A 1RT3B 4R8UA 4B9LA 4J9NA 4DTPA 3SFGA 4CJVA 4AHRA 3V4IB 4CF2A 2IAJA 4Q0BA 3V9SA 1REVA 1LWFA 4EYIB 1C1BA 4QWCA 2G8UA 3MECA 4OLAA 4IR1A 1S6QB 4F8RA 3PZPA 1N6QB 1JLQB 3KJVA 3AO3A 2HB5A 1KVBA 3U3GA 4IG0B 4IDKB 3OYFA 1KCFA 4ICLA 3BSAA 3AVHA 4CK1A 4EP5A 3CJ5A 4MK8A 3RAQA 3LP2B 1U04A 4DU1A 4M3WA 2WOMB 3IGNA 3VQPA 4QCLA 2A1RA 1SL1A 1XC9A 2UVUA 4XPCA 4YR0A 4E3SA 3S9HA 4I2QA 2B43A 3G86A 5J2PB 2PYJA 4K50A 1C0MA 5KG5A 3S3MA 3PR5B 1QTMA 1SV5B 4CGJA 4FLTA 4E1MA 1VSKA 4FLZA 3NGYA 3DLEB 3DOKA 3OL8A 2YKMA 4HHTA 1C0TA 2B4JA 2D0BA 1S1VA 1RTDA 1QS4A 1RDDA 2DFHA 2G8KA 2IJNA 1XWLA 2XY7A 2I5JA 3HP6A 5KI6A 4F50A 1WSFA 1CXUA 1RT6A
chains in the Genus database with same CATH superfamily
3HPHA 2PN6A 1IV0A 4MDAA 1VDHA 1QQCA 1T94A 2KG0A 3BV8A 3D28A 4EO6A 5HQMA 3MFIA 1NO8A 5HI7A 2ZH4A 2GS8A 3DGPB 1CG2A 1I94F 4CESA 4DV1K 2YHWA 1SIWB 3VZHA 3GJRB 2DRDA 4LR7A 2YTCA 2PEHA 3K9JA 3AOCA 2DGQA 4WBFA 2VFVA 5LJ3Y 4N77A 5A0YA 3KHHA 2VHGA 1S9EB 3DRSA 1NGBA 4LH4A 3E66A 4UW2A 2PMHA 5A8WB 5KT5A 3V1OA 1LWEA 2R7XA 3MMAA 3HXMA 4RW6B 4GKJJ 1T03B 4MK9A 4X66K 3NAIA 4USUA 4QWDA 1TUWA 3JXUA 3WNEA 3MN6A 4NRUA 1FKPB 2O1PA 4URGA 1SIZA 3MEGA 3W3DA 4C0HA 1WF1A 3O3FA 2ZM6F 1ZTWA 1S9GB 4H0PA 2I2YA 1JK9B 1OKJA 2HS0A 3T1YJ 2RJZA 2YHBA 4DQIA 4QOTA 3OW2M 4Z37A 1N32F 3BB5A 3OYCA 5ETRA 5MLCQ 1PBAA 3N6MA 5KFTA 3SPZA 2ZKUA 3D45A 3CSKA 1FEHA 3MN5A 3KLHB 2HNYB 3N4QA 2FBXA 3R5CA 3ZLJA 5AE3A 4JI7J 4AHSA 4IJNA 1EIYB 2CQCA 1Y00A 1PAEX 2ERRA 1MSWD 3MPDA 1HNZK 3OL9A 3CE8A 1IBMJ 3ZFVA 4RJVA 2RQ4A 2XMTA 2DR9A 2YJFA 3CNQP 1BOTO 4WQ5C 3UFCX 3SV4A 1JLGA 4C1NI 1S0NA 3H2UB 4C3KA 1O0PA 1YJRA 4FPBA 3K5LA 2E9TA 4FJ9A 1FW6A 1T6DA 1J5EF 4B3SK 4KH1B 1AB8A 2F7VA 5F8IA 4I1TA 2V4QA 4DCHA 3IWXA 3NP5A 2NPFA 1M0SA 3F0NA 1RAHB 1ZPWX 2R8JA 4RCHA 1MWKA 3V1QA 4PG7A 1TELA 2LYVA 3Q7BA 1RWPB 2HG4A 2MPUA 3WIUA 4L72B 5EDWA 1YZ7A 3FMWA 1TV6A 3I0RA 4AM6A 2XMUA 2FVCA 4DF8A 4IKFA 3ISNC 1N8RO 5CCLA 3ZZTA 2IGIA 4JYAJ 2BV3A 4XEIA 2HW3A 2QI2A 3VESA 1VQ4S 3MI7X 1FE4A 3D1OA 5HRRA 4USTA 3K7RA 2OTJN 2RQCA 5JMVA 2ZH9A 4WE1B 3CMQA 2FGCA 3Q7CA 1YJ9S 3PXGa 3FRZA 2V4JA 4DCPB 3F9KA 3CUNA 1FFGB 5KQDA 1ZOTA 3OR1A 4AT1B 4PQUA 3D0GE 3SJHA 3V9WA 2HZCA 3MWTA 3AH6A 4L3KA 5AZIA 4Z2XA 3WXMB 4JNEA 1FRMA 1RT2A 4QIWD 4B3RJ 2UV8A 3GCWP 2AX0A 3BZKA 4GO5X 1W9HA 3DXMA 3G6EN 3MEKA 1FKOA 4O23A 1RZMA 4PPDA 3QIPA 2V8HA 4JI4F 2MKYA 4L3NA 1KVIA 2R2TA 2R7VA 4A8SA 1VQMS 2A41A 3KHGA 1R0AB 3R9LA 4N56A 3G82B 2D3O1 2W42A 3G8TA 2JRSA 4ID5B 4G65A 1E6YA 1S9FA 3JAMU 1XNRJ 3AGKA 5HOOA 5HL7L 1S1XA 4NX9A 3OYJA 4Z94A 2X1FA 3M8RA 1F1BB 5I42B 1DAXA 2X6SA 1AZSA 3DN9A 3IR6B 3RR8A 3F56A 3QWUA 4WYLA 1UEUA 4ECVA 4J9PA 3H5UA 2BACA 5KFDA 3QMQA 2BW2A 2QM1A 2Y9HA 2J4RA 4MIAA 1V6HA 2HS3A 2DY4A 3EICA 2QN6B 3THYA 2HNZB 3CPEA 3PRVA 3OT9A 1JQGA 4F4KA 3FGUA 3PY8A 2IVPA 1SKWA 1P9YA 3SQ1A 2ASYA 4UOCA 4KHRA 3OTOJ 1XK8A 2F4VJ 4HVZA 5AQVA 4E98A 4DLGA 4X4NA 1SUQB 3CCVS 1NJIO 2HHHK 3MTJA 4ZPTR 3I8DA 1GXUA 3VQEA 3D3CJ 2FVPA 3TAMA 2MHEA 1WOPA 1VMBA 2XO7A 3CXCR 2QWRA 4J2EA 1VGYA 2IAJB 4W92B 2W9BA 1REVB 2R7UA 1LWFB 1M5KC 3PR4A 4EBCA 3MPUB 2W9CA 3NCQA 4B8CA 2VKRA 1X8DA 5EX0A 2XZDB 1QAXA 5K5MA 4BACA 1Q82O 4DR3J 4B3MF 2A2DA 2P9SB 3UPFA 2P9NA 1TMJA 1XMOJ 4ED7A 1U7LA 2ZBCA 3KVGA 1LQ9A 2HRYA 1X4CA 4OZJA 3K5PA 3PX6A 2ZOFA 1W7WA 4I2QB 3DGVA 1X4AA 4PCQA 4QIFA 3LP1A 4U96A 1VC5A 3BGFA 1HNXF 1TUGB 3V6DB 3OYNA 3VAJA 3GFHA 1CJKB 3AJ2A 3CD0A 1KVAA 3DOKB 4JI1K 2D9PA 3BSOA 4BGAA 2AD9A 1S1VB 2CPFA 2QRRA 3NH1A 5LXRA 3P45B 1U02A 2BQRA 1AT1B 2XGQA 1TKZA 2I5JB 4I2PA 1X1PA 4KPCA 5CXTA 1A0OB 4PUOA 4FOEA 2J6TA 4BC4A 1X31C 2ZOGA 1K6YA 3PIOL 1FTRA 2L08A 2DB1A 5CH7B 2K1RB 2A6AA 3MN7A 3MXIA 1NDLA 1UVJA 2E2NA 2ZITA 3M6WA 4FNHA 3H42A 2RDIA 4EYHB 2YH1A 3ZSXA 2HHTA 1FWLA 2Y3YA 1XQIA 5H9EK 1NHUA 1YDLA 4DR2K 2RU3A 1RAIB 2ZZNA 2RQMA 1VQMN 4DUZJ 4JI8F 3ISND 3OTEA 4PKGA 4ZPDA 5BRDA 1L3KA 4ECXA 1K8AO 5CZXA 3CCSS 5MLCV 1NXIA 2DPNA 2AU0A 5C2DA 1CLFA 2FZCB 2R7OA 4EO8A 4MLEA 4XH5A 3Q8VA 2M2BA 3NF7A 1GX5A 4J2BA 3M8QA 3ENAA 3SUPA 1IN0A 2LMIA 2MZRA 3NXZA 3CJ8A 4NLOA 2B7CB 1LAVA 1NOZA 4IBNA 4WZMA 1QE1A 5HQ8A 3CG7A 2NRZA 4UTGA 2UYTA 3IFRA 4Q7AA 3AA5X 3OBYA 1J9AA 5KFPA 2H5EA 1ZBHA 5J2MA 2ZH5A 7FDRA 3LWMA 2DR8A 4OMFG 3HHKA 4F3MA 5AJ3J 3U4LA 1PO6A 2O5DA 2VQEJ 3OXLA 1AXQA 2YWWA 4CH7A 2J9CA 1SL2A 4F02A 2P51A 3MM8B 2E5JA 5AQYA 3P39A 1EQYA 4NCBA 1Y0HA 2R8GA 3OHBA 1B7FA 3EO3A 4TLRA 1RBTA 4CD1A 5KRSA 1SPBP 4Y2KA 2CQIA 2QT7A 3KK1A 1GLJO 3H98A 2DR7A 3W3SA 1TL5A 4J9SA 2PD1A 1J54A 2BABA 2YH0A 4ED6A 4QU7A 1FNXH 1U2CA 4LF8J 3AODA 3OTBA 5I3QA 1IM4A 2ATCB 3FKBA 3OL6A 1TL1A 4QPXA 3M32B 1FJGF 3LGNA 4KSEB 4I6YA 3MEDA 2KM8C 4ZK7M 3M05A 5DQIA 1JJ2M 1E4FT 2WC9A 2CJBA 3VAGA 1SH3A 3ZSQA 5C12A 4DV2J 4MO5A 3M8WA 1IG9A 3IN5A 3GR0A 3VETA 3ADAC 2XMMA 3LZJA 4IFVA 2F9DA 5DGAA 2NXEA 4RUAA 1Q8LA 2OPQB 5EX5A 4IKAA 2EG2A 3PRDA 5F8JA 3CCQN 5CY4A 3GMGA 1UW4A 4BRMA 1R31A 3KJFB 1PJ6A 4A8WA 4A59A 2B8QA 4LJMA 2HGMA 3A5NC 2RT3A 3LM9A 2OUGA 3T1AA 1JB0C 1RGIA 2HFZA 2RIJA 4DHYA 1DTQB 1KHVA 4ZJOA 3UE2A 2RRNA 4BRHA 3C65A 1BQNB 1R0BG 4QQBA 2KG1A 3PW7A 1K9MO 1RCOB 4GMKA 3VA3A 3LTOA 1N54B 1N5QA 3VEYA 1MW7A 2CNLB 4C6AA 3K5OA 4ZLJA 5KFMA 2QL9B 2QEXN 4G1QB 4LQ3A 2G2YA 2BANA 2DGUA 3T9NA 3SK3A 2WSFC 1GTHA 1Q95G 4FYDA 2DR6A 2QTDA 1I51B 1PSDA 4NA2A 3W5XA 2W6LA 2X1BA 1Q18A 3MXMA 5K20B 2KYXA 2J0XA 2YPYA 1SKSA 4IH7A 3BO2A 1DURA 3FRYA 5EVZA 4KH6A 1IBKK 4DV7K 2YXLA 4AYBD 3CCSN 3MR5A 1V5IB 1KQFB 4OX9K 1Q7LB 2DD8S 1NJYA 1HNZJ 2VQFK 2A3JA 2NZ4A 4NPOA 3FE1A 3GG1A 1Q9XA 1KBRA 5D3GA 4RW7A 4HTJA 3OSNA 2YCHA 5DMRA 1MMLA 3OYGA 3MAQA 4NEYA 2QMXA 2JC0A 5HRNA 1XMQK 3BQ2A 2R8IA 2KM8B 2OD6A 1LW0B 4DV3K 3SUQA 4EK2A 4BGBA 4CJ3A 3GJTB 3DC2A 1HKGA 3C19A 4B3SJ 2NRRA 1FWKA 1FRIA 4OGCA 4FYVB 5D78A 3HK2A 4DR1K 4PWDB 1JXVA 4FJIA 3N01A 3BM7A 1PCAA 2GJ2A 2DNKA 1SQGA 3C6UA 4DX5A 4JV5K 1BY9A 4LREA 3A3PB 4K4WA 1PJ5A 5CD4H 1VLOA 1VQSA 3DJCA 3J7AN 1TUVA 4P9SA 3BH6B 2PFDA 2JEFA 3CCMS 1NSQA 3FCHA 4FM2A 3SQ0A 3D1HA 3SMZA 4QW8A 3PCOB 1BA0A 2YHYA 3CC2N 4DSIA 2V68A 3R1XA 2OEKA 5GIOA 4FYXB 2OO4A 3P38A 3HKZD 1AYEA 1RWKB 1ZAVA 5IZHA 1WEXA 1S10A 2DH7A 4CO4A 5BXIA 1IM6A 1WI6A 3QNOA 1KOOA 3BGLA 5CHCB 2XBPA 3O5BA 3A4TA 1BG3A 4CJ7A 3L09A 2BR0A 5B08A 5F1XA 4OI2A 5J2NA 4M3RA 3G6XA 3O44A 2NLXA 3ZC4A 4LF4F 5F9NA 2W8KA 3S3NA 4B3TF 5CYQB 4FJGA 3VF6A 3QSIA 3VQ9A 5C25B 4NXNF 1Q82T 4NWBA 1ZM9A 2GGPA 3NS5A 4ZTJA 2Q2RA 5F8MA 3PSFA 1CPZA 1DY3A 4CERA 5K14B 3MMCA 1I39A 3NGUA 1Y7PA 3EVOA 2O4IA 1WSIA 2DXDA 2C2ZB 1BI4B 4DV4F 3GE1A 5IM0B 2CQ2A 5ETNA 3HT0A 3QGIA 5LMUF 3WNHA 1G4CA 1GEHA 4CJWA 5ETQA 5HRSA 3CT9A 4ZCMA 4H4MA 3F5TA 3PKMA 5DQHA 2C2MB 4O0JA 2YNHA 1NLKL 1N5TA 1KHWA 1Q8KA 3DKDA 1RI7A 3CCJS 3AVNA 3KLIA 1HBMA 5A8KB 3KG0A 3WXJA 3FZFA 4LFBK 2HGLA 4QR0A 4CP5A 4JKHA 2BJDA 4JV1A 2OKQA 4DX6A 3GR1A 4F4WA 1VQ7S 4M3YA 2PFUA 3FK4A 3DRPB 4KKOA 1T05A 2WHOA 2OPSB 1R3NA 1BO5O 3DLLL 4YOYA 3IXQA 2A18A 3W66A 4ED8A 2FBVA 2CZ4A 4YR2A 1RT4B 4JKBA 2OMLA 3RG6A 3EEQA 5L38A 3UD4P 4JS5A 4P2XA 1IJJA 5FPMA 1JLAA 3CFRA 1BISA 4ECZA 1FRXA 2NRTA 4CIOA 5BPLA 3ULEA 1RCHA 4GVBA 4IFYB 5JVHQ 2UUWA 2OCEA 3P3DA 2XS2A 2XSFA 3T5JA 2GJIA 1IWAA 3HKWA 2MKCA 5BYSA 5EUHA 3KK7A 2GV1A 2IM2A 1NH8A 3VQSA 3ZT0A 5DM6Q 3BGUA 4GVMA 2QKBA 3RBXA 3QT5A 4I0WA 4I7FA 1KFDA 1VSDA 2CPJA 1RBSA 3NMRA 2IM0A 1Q5YA 3AHPA 3CPWR 2XLIA 1ACMB 4ZP9A 4ZVFA 1YUWA 2NNWA 3IS9A 3AO1A 3HRGA 4OHXA 3V9ZA 2W4PA 1VQKS 1D8YA 4DB3A 2QA4S 2K7KA 3GB0A 4IOAL 1VSMA 3CM5A 1DEJA 4JI1J 1WG5A 2CZ9A 5KT2A 1N33K 2VG6A 5HVFA 4GKJF 3M6GA 4K8ZA 4B3OB 4V19X 4C8LA 3AA9A 2NUBA 1FD8A 3DYAB 4LC9B 2PEBA 2D0AA 2AJ0A 3DXBA 3K59A 4AXJA 1WHXA 4J2DA 5J1EA 2WSCC 2OFGX 3PO5A 1F5CA 2POKA 3R2DJ 3O9RA 1KD1T 3NOCA 4CNYA 4AE5A 5J2QA 4C3LA 4KH0B 4GVLA 3ZT3A 3R3LA 3T1YF 1HWIA 2H48B 5IT9O 1YTUA 4ERDA 2IA0A 2G8FA 2OPPB 4BE0A 5E3QA 2BQUA 2WVEA 2A6MA 4CBUA 1P8ZA 5H9EJ 5BJRA 4CLWA 4JI7F 4FKYA 3I5CA 1BQXA 2RKIA 2LQ9A 3WNGA 1G6BA 1KKHA 1IBMF 2R7SA 4OHYA 5THWA 5IWAK 2MY8A 4NOHA 3UDEA 3Q8QB 5DS7A 2BJ1A 4B1XB 1Q9YA 1VHFA 3UWTA 1NWKA 2X74A 3JQKA 3ZNUA 5FPEA 5AQHA 1RT5A 4H4KA 1DGKN 4MAKA 2A40A 3L9ZA 1RLDA 2ITMA 4YB1P 2RH3A 1RK8A 1JLBB 2ZZMA 3TWZA 4Y1DA 4FZYA 2P5GA 1WG4A 2IIHA 2AWZA 3QLHA 2DIUA 3AVIA 2DCUB 3M8PB 1B70B 4LR8A 1FVQA 2RAQA 4IQMA 2CUYA 1WHYA 3LDNA 1HI0P 3IFEA 3SSRA 2LU2A 1BWFO 3NVMA 5EWFA 4FZVA 1UJ6A 3A1YG 2WK4A 4L73A 2KXNB 1P9QC 1WNEA 5T7LB 3MR3A 4JYAF 3JTNA 1V9OA 2RHSB 3VAHA 3AQPA 1WSEA 2HBQB 1VBZA 1RTHB 2Y1JA 4YFUA 3OVBA 2CWKA 4ZVRB 5AQMA 1OIAA 4Z7YA 5MAOA 2EX3A 1X4DA 3H90A 3BDEA 1J27A 2OLWA 4O3PA 2ZWPA 3PKYA 4M63C 1VIXA 2ASDA 3T3FA 2VBXA 1ZM4A 2WTFA 3QNNA 4F3OA 3TEHB 4PKDB 3GYXB 4JKAA 1SV5A 2VG7B 2JEIA 2IVOA 2Q3SA 2CRLA 4ED1A 4CHPA 1J5OB 3KLFA 3DLEA 5DM7L 2ETJA 2GW8A 4B3RF 4IOXA 3W9JA 1HW9A 3SLCA 4WFBL 1SKRA 3PIOQ 3VVUA 2EBGA 3NL0A 1WB9A 1YKWA 4KGKA 4R5PB 2M5YA 4E7IA 2QA4N 4YHHJ 1S7HA 4HH0A 2UUAK 2L3MA 3EKSA 1DTTA 2IFXA 4IR9A 2FQQB 4EZ6A 3G4SS 3IR7B 3TR5A 4E7KA 3BN4A 1S72S 3BS9A 3U02A 2XEXA 2BE7D 5LM7E 4LBPA 1XNRF 1GK8A 3SMSA 3NLCA 3K5NA 1VSFA 1IVZA 4GMJB 4E7HA 4OLBA 4HT5A 3TRGA 2ZWHA 4WTYA 3CQ8A 1RSCA 2FZGB 4FKXA 2GHPA 3R8EA 3VWSA 2CGKA 3VZIA 1X4EA 1DQAA 2AZ1A 3BYPA 3FEYB 3DDKA 2EC2A 1UPPA 5GAEI 3KZBA 3OYDA 4QR2A 5AQXA 2AJ4A 4TN2A 3TX8A 3UDVA 2J0SD 2HSTA 1RE1B 1OVQA 4CEAA 1F9HA 3MAAB 1VRUB 3HFKA 1Z26A 2GQ2A 4BDYA 3C94A 1BC6A 1QHTA 4FWMA 3OTOF 3SV3A 2F4VF 2JVOA 3GG4A 2MLYA 1KONA 1BLUA 3K8VA 5JS1A 4DV7J 2HFOA 4LIWA 3KTQA 2IJFA 5KFNA 4TNOA 1WSRA 5AQRA 4C2MA 1YRUA 4FYWB 2VQFJ 1FK9B 3GJQB 4M94A 3DOMA 4OI1A 4ECWA 1WDTA 4CM2A 3MMBB 4QIVA 2O66A 4ZVHA 4AL7A 4O8UA 1FDBA 4Y6IA 2QMUB 3I96A 1BCOA 3DLRA 4YMEA 2IBKA 4DR5K 1X4FA 1NJWA 4DV3J 1NK6A 2MKJA 4DR3F 1VK3A 2V51B 2GX9A 1XMOF 3OVAA 2WTUA 2VBYA 3TA1A 2HBMA 4WXOA 3UE5A 1CZAN 1U1OA 4CLTA 4DOZA 4CEFA 4DR1J 4YOUA 3GSIA 4J9QA 4IOCL 3FBBA 2ZHAA 4CWBA 2YNFA 1YJVA 4EAHD 2GIFA 1KR4A 1HPZB 4JV5J 5EWGA 1DLOB 4X62J 4CZCA 5L1KA 4CZIA 3OLBA 2W2NP 5L9XA 4OKJA 2GC8A 2NRHA 4MFBB 3OXFA 1JLFB 3IRXA 2C2OB 4QS9A 3O4NA 4H5TA 4FYYB 1X4BA 2FPHX 2F96A 1Q81T 1JWWA 2MEWA 1NBEB 1TL7B 2ZJRL 5AZJA 3HX9A 2ROPA 2F9WA 1ATRA 4OZ5A 5ETMA 2PE8A 4WP3A 3CERA 3BR9A 4KT0C 4IG3B 1RHRB 3OFEA 3NGIA 2CPDA 4NASA 5H9FK 1QZ6A 1KVCA 2CNNB 1IJEB 3D6MB 3E2EA 4BC9A 3AARA 1WUAA 1RDBA 4NYNA 4RUBA 2HF3A 4U9RA 3C46A 4I6MB 2IRYA 1IWGA 3HHLC 3SCIE 2GNKA 4CH0S 3KOAA 5AT1B 1S49A 4N5SA 3P1GA 2E1PA 4DUZF 1RDAA 2JSXA 2JX2A 4NRTA 2UXBJ 3G4SN 3MEEA 2JWLA 3G2XA 1LEOA 1F5BA 1S72N 1U2VA 1W25A 1WSVA 4DQPA 3UNYA 3Q2TC 3BPDA 3K2PA 1SKUB 1RNHA 3HSDA 3KDOA 1ZA2B 3SIPB 1HNVB 2D69A 3N6NA 4FWKA 1FX4A 1HBOA 4RR5A 2P9LA 5CYMB 3KHYA 4PHTX 4O44A 1SBRA 1T6CA 3W2WA 3SAGA 1QAYA 3ZEUB 2OH2A 3LM2A 4Y65A 4ZP8A 2RN2A 4LFBJ 2Z1GA 4USIA 2WB1D 3NNHA 3TUZC 1W2BR 3HM9A 3WC0A 4QIEA 5AQNA 3SPYA 4BR7A 4OJRA 4K4VA 5JUMA 5AJ3F 1S57A 1NJZA 3CJ1A 2J0WA 4OI3A 4H0YB 3NH2A 1UA0A 2G8HA 2BA9A 2KXHA 3RB3A 2VQEF 1FXLA 3THWB 2ITGA 4OYBA 3L7UA 4URQU 5KG6A 1RDUA 2FJBB 4O3OA 2C2RA 2YX1A 4IEEA 4AQYJ 1EWQA 2HRUA 3JYTB 3KLGA 3FDSA 3PVXA 2M8HA 4DPUA 4KH5A 1K8KB 2DNQA 1DT9A 4BWMA 3ET6A 2XLKA 1FA0A 2NSCA 1Y3JA 5I3PA 3POTB 3DXSX 3O9UA 1NM1A 4PA1A 5D4OA 4LBIA 3HHLB 4LF8F 2H1YA 2VB6A 4FBTA 3GIMA 3K9KA 1FJCA 4LSLA 1G2EA 2R2RA 5ETLA 3V6HA 3DLGA 3ZZPA 3HMJG 2X3GA 1GOAA 4LFAK 2GVDB 4HL9A 4DX8H 2M7SA 4B9LA 3HJVA 4RUHA 4PZVA 1F9FA 2M8DB 4CF2A 4DV2F 4Q0BA 4EYIB 1U2RA 4LF6J 2AV5A 1UFWA 3MECA 1QVGR 4OLAA 4IR1A 1PBUA 4DV1F 2ZH2A 1N6QB 3AO3A 2V67A 2DYAA 1KP6A 5KPRA 5H1SQ 4IXCA 4MK8A 3LP2B 1U04A 4DU1A 4M3WA 1MN9A 2WOMB 4QCLA 5FPNA 4OV6A 5ETOA 3R5BA 1HR0K 3QBCA 4CO1A 3CETA 2V8PA 3S9HA 3TJ8A 3W60A 2VCPA 2B43A 1CEZA 3KNGA 1N33J 2YY3A 4P75A 3S3MA 1OJ4A 1KOHA 3LQVA 2DO0A 1QTMA 4FLTA 4RWXA 4IWVA 3W64A 3OL8A 1SZ2A 3THXA 2MHNA 1RU2A 1XNQK 5B09A 4WK3A 3QJLA 2D0BA 1E4GT 1CS4A 2Q97A 1HWLA 2G8KA 5BYQA 2QYGA 2XY7A 5DJBA 1LNQA 5KI6A 3FUYA 2JWKA 1RWOB 1KQSM 2W01A 1V3SA 5D15A 4BR2A 4ZN3A 1RT6A 4ZCLA 5AQUA 4DTRA 5CA5A 1Q8BA 3VR1A 2VG5B 3DM2A 3P4UB 2JZ5A 1UW9A 3VERA 4X2BA 3RWUA 2N3OA 2MQOA 3R9PA 3CO9A 5EY4A 2WZ1A 1HNZF 1UMJA 1S1TB 5IWAJ 3BJYA 4DTSA 5M2PA 3MUTP 4DR4K 5EN1A 5HO4A 1HQEB 3RSEB 4NCGA 2CFXA 3KLEB 4KR0B 3CDUA 2GEMA 4GY2B 2DGVA 2PDAA 1HYZA 3IKMA 1NM2A 2IM1A 3KDNA 5BR8K 3MHYA 3QSYB 3T5LA 3FGVA 4B3SF 3IC1A 3C7NA 4F9OA 1TZ0A 1KLMB 9ATCB 4XIUA 1R0CB 4ZVSB 1JCGA 3NGRA 3HVAA 2EKNA 1P1TA 3UN2A 4KYZA 5E84A 1HD0A 4BE2A 5HATA 3HHLD 4YS2A 2LA4A 3O8MA 1NH7A 5HROB 2G0JA 1RUSA 1T9UA 4JD2A 1V3RA 2DT9A 4LMZA 1KVKA 4PXEA 4Y0WA 3PW2A 1HNIB 4JK8A 2BKOA 3I8BA 3A8IA 4NYPA 2OPRA 1S59A 1U26A 4PY5A 3RVCA 2KJVA 1FO1A 3QATA 4TY9A 4IOAQ 2EFNA 3G0ZA 4G1PA 3W61A 4OLPA 1BHLA 2YQ1A 3SFUA 3J81U 3CDEA 4A8QA 4KE5A 3F73A 3RGIA 2V34A 3M1FA 2QSWA 1VQ8S 4ISGA 4RUCA 2V7YA 4RNOA 2AEJA 1P8GA 1PAUB 3CJ7A 1ROFA 5GIPA 4DF4A 2V8GA 2IVNA 1FJGK 5G0RA 4JRQA 1F2HA 4NI2A 4X65K 1QUPA 1NGGA 4MQ3A 1H2TZ 4F36A 2UUAJ 1RTIB 3MCAB 3H2VE 4HWIA 1YBUA 2YX7A 3N5BA 2FYXA 4C8YA 2MXYA 2VL1A 5E5NA 1BU6O 3CC4S 1X5OA 4DZDA 4CJ4A 1T9WA 4M3ZA 5DETA 1CJUB 2B9EA 1ASUA 3ILOA 4OLOA 1HUXA 1LW2A 2ZQBA 3QEXA 1ZBIA 1RHQB 4ILHA 1YIJS 2V8DA 1NMNA 5AXMA 4YDUC 2BOPA 1TYQA 4H5NA 1JKHA 1ZBFA 3I4HX 4L76A 4MYTA 1QSSA 2DR5A 3O9SA 4OYIA 5G4DA 1NB7A 3PTWA 4ZPAA 3HDSA 4B9MA 4URSA 2LKZA 4R0EA 2QWLA 3ILJA 2IC3A 2D3OR 1KXPA 2RDJA 4ISFA 2ZGYA 2AEFA 3CQYA 3M6XA 2YNIA 3U27A 1VS3A 3RB6A 3LANA 4OX6A 4FZZA 3NS6A 3VF4A 2XWXA 4PG5A 1V4TA 4LUBA 3HYFA 1TGOA 4EI2A 2ZVSA 5ETVA 3SUNA 4OGEA 1TL3A 3LOUA 2VASA 3HPOA 9RUBA 3AB4B 2QWPA 4E19A 2HWIA 4BE1A 4E89A 3MWBA 4DR5J 4YN3B 1RTZA 3ATUA 1UVIA 1D9DA 2LQJA 2LP4A 3U9ZA 1CJVA 4ZTFA 1IKWB 1M1KT 4XDCA 4X84A 4ATNA 4BRAA 1F21A 5IV3A 4C11A 3DCAA 4CHYA 4ZIVA 1Q53A 5BREA 5FJ4A 2DVIA 4OJGA 2XCPA 4USJC 3VF0B 2GTDA 2K7JA 5DM7Q 2QXFA 3EYZA 2HQGA 2GWJA 4WFBQ 4A46A 4F4AA 4DFMA 3Q86A 1YJWN 2G8VA 4JI1F 4DL3A 4ZPWR 2XNQA 3CCEN 4HT7A 3ITHB 2DRAA 3S8SA 2AMCB 3R5JB 3OYAA 4HCBA 3TANA 1NK7A 5H1SV 1C0UA 1EQ0A 2KKZA 3GV7B 3SUOA 2P5OA 3N5FA 2PBDA 2Y1IA 3KYLA 4Z0UA 2HIYA 4DZ6A 1SJQA 1DZ5A 2O8CB 4OHZA 3QIOA 4ZCIA 5AQLA 2A10A 3SQGA 1VQ8N 1SQKA 4R8UB 3HVTA 5C10A 2D5RA 3BUZB 3BP8A 1BA1A 5ADZA 1ZBTA 2W40A 4CFDA 4W90B 3KJVB 2CQBA 3W0LA 4Y34A 3MR2A 3GIJA 4BVPA 3NHGA 4JRPA 2FLPA 4ICLB 4NXNK 4OI0A 1FNMA 5JLHA 4OL8A 5I42A 3H7HB 3NGDA 4KGMA 3B4MA 2LSNA 3CC4N 4XK8C 4CIFA 3P96A 1RT7A 4PAAA 2XM3A 3G71N 4EUVA 5ETTA 2GUIA 1IO2A 4V1Ak 5E3CA 1ITPA 2V0NA 2CGLA 4GC6A 1YIJN 4WKRA 3U7JA 1D5AA 4ZPCA 1SJFA 1C0TB 1YJNS 1MU2A 4CJPA 1OMSA 1XC3A 1R8HA 1YT3A 1TQLA 4QBUA 2V63A 4EBDA 2IIRA 1RTDB 2HHUA 1PILA 4AUKA 2VV5A 4ED4A 3BBFA 3PHTA 1Z25A 2E1MC 4ED5A 1RP5A 4AL5A 3GIIA 2P9IA 1R8PA 2YKNA 5KFRA 2BE9B 4PWWA 3I56S 4MT1A 2KL8A 3NS7B 1SUQA 2DHXA 2VYPA 3V5RA 2P9UA 4GO7X 5ELZA 1TFYA 5M1QA 1ILYA 4Z4IA 1RGVA 2DNLA 4DMZA 4CRJA 3D6FB 3VQAA 4BRKA 3EGNA 2KJWA 3J7Z5 4GV3A 2KLAA 4A8YA 1IQTA 3S7RA 3HBTA 1VK8A 1GX6A 5A0YB 1EP4A 2DO4A 1GLCG 3DRSB 4C98A 1KAZA 3C16A 4FS1A 4U7BA 3PO4A 3ILLA 2PI5A 3SBGA 1LWEB 1R27B 3MMAB 4LVNP 5GAGP 1XERA 5KG3A 5E3RA 5CZVA 2HF4A 3UVJA 3BREA 1WHVA 3CO0P 4PWUA 3IA0A 4LRDA 2O67A 2NRWA 4DL5A 4ES2A 4IZ9A 4LFAJ 2F8EX 3V6DA 1B64A 3MEGB 3MD3A 4V19S 3P5BP 5F8GA 4P72A 3FLCO 4Z4CA 2MZSA 1RKJA 4RW4A 2WVBA 3CVKA 2FF6A 3CGIA 4WU2A 4NLXA 2GMJA 4YHHF 4DQSA 4ZHRA 3UR0A 2MYFA 4TYAA 3ZZZA 4CTAA 2KT3A 4WFYA 1Q8IA 2MKSA 2QZ8A 1GLLO 1G7CB 3ZTRA 4OYZA 3S41A 2VOPA 2QKKA 2YWGA 4FM0A 2FC0A 5C2GA 1HR0J 2RB7A 4Y0FA 2MGZA 4FW2A 3MCSA 2PGCA 1XIQA 1VR6A 3VEZA 4OZNA 5KG1A 3Q8UA 1VBKA 3OHAA 1JLGB 3SNNA 4DX7A 2BYCA 5KFVA 4L6V3 4EWTA 1EETA 1U0HA 2XTJP 4F0HA 3A3NB 2R3VA 2L9NA 3M6VA 1XNQJ 2X6NA 3R6GB 3H59A 4DMNA 2Y1LB 1D9AA 3EZ5A 2FDNA 1V3ZA 1W2IA 3T1YK 3EPIA 1TTHB 4OX7A 1FWPA 4PL7A 5F2RA 3EX7B 1RBOB 4W98A 4RBTA 4X64K 4DV7F 4OJ1A 1T8EA 3SI6A 1WAFA 3D68A 1GMVA 3C14A 1TV6B 2VQFF 2SXLA 3LZIA 2U2FA 3RR7A 3K57A 2NXUA 2ZH1A 2VBWA 2LCWA 3EWGA 2NR0A 2HQ3A 3JQMA 1YJNN 1H2VZ 1PJ7A 2OEMA 1HW8A 1J6ZA 1X9WA 4DR4J 2V9WA 1MROA 4ANEA 1XMQF 4WF9Q 4CGFA 3KLVA 3JAMO 3M5RA 4I56A 3SCJE 4DV3F 2HMPA 2BW7A 2HLTA 1I6JA 4ILJA 5BR8J 4DQRA 5KG0A 1RWUA 2V4JB 3I56N 3PUFA 3PYGA 2JOQA 3SAFA 3OR1B 4DR1F 4JP8A 4PQUB 2ASJA 4P73A 2VFSA 5GINA 2FVRA 2RU9A 1F6TA 3C0BA 4TQSA 1T3VA 4F2SA 1RT2B 2ALYB 4JV5F 2ZGZA 4X62F 2BUNA 2BDPA 1ZYQA 1GAOA 2CQ1A 3DXMB 3KD5E 1PC5A 3HP9A 4YOVA 1FKOB 3QIPB 1QVFM 2DXFA 1HI8A 2XMVA 2F8TA 4JK7A 1NGAA 3EZWA 1ASVA 4WIIA 3GZ7A 4UF4A 4U6PA 4B9VA 1E6YB 1S1XB 1W26A 1BGXT 2XI3A 4K42A 2ZH8A 2MQQA 4F0MA 4ILMA 1QVGM 1AZSB 3R6MA 3MCNA 2EK1A 4YDXA 1EARA 1OO0B 1W0HA 2LA6A 1C1CA 4BR5A 4ELUA 2YWFA 4B3RK 4J9VA 1OSCA 2D4WA 3THYB 2UXBF 4B02A 1T7PA 4X65J 1K1QA 4JBCA 2MZ1A 2G0IA 3J81Y 4CZMA 2X7IA 2BKNA 2CQ0A 1ZM3A 3IG1A 1YG0A 2O3DA 2HNDA 2XZTB 3JSMA 4UY8O 4F3TA 1HHTP 2FJDB 5LJVA 4USHA 4Z4FA 4FLXA 2FUG9 3MCOA 2JDJA 2Y8YA 2KHCA 3G9CA 3UB5A 3A8YA 1S6PA 3TAMB 3V2UC 2LQBA 2DHAA 3CC7N 3CYMA 4LFBF 2W9BB 5I4MA 2XQCA 4DBQA 2W9CB 5E41A 1WWHA 5IXUA 2N7CA 2P9NB 5LL6d 3OFGA 1VHIA 4DR6J 1TKTA 1R8AA 2DNYA 1G15A 3KWIA 2UVWA 2ZFHA 3LPYA 5HLFB 1C4AA 1B9DA 3VAMA 1KVJA 3H1VX 3QERA 1QD1A 3BO4A 5DGBA 3QETA 2A6OA 1RAGB 2F9TA 4AQYF 3LP1B 1T9TA 2ZOMA 3IR5B 4RWTA 1WOOA 5HP1B 1LW0A 2KYZA 4JK9A 5AQOA 4NL5A 2XYPB 3FZLA 1Y5IB 3RJMB 4AHVA 2R2UA 4N47A 2G2ZA 2Q43A 2B9YA 3FSXA 3QGPA 1JJCB 4P2SA 4O4RA 4BRDA 2QE5A 3QEPA 1TKZB 1TKXA 4I2PB 3WT0A 4PUOB 2YX6A 1ZZFA 1WN7A 2E7VA 1U1RA 1KWMA 2BZ2A 4M95A 4KV8A 2FHJA 4IO9Q 1WACA 2IRUA 3L95X 1RWVB 4M5JA 4FPRA 4LF6F 4ECTA 1KQKA 3IUCA 5FLXU 2FBTA 3W62A 2CJYB 4KB0A 4NZ6A 1Q4RA 4Q5VA 5D77A 4ETXA 4F4XA 2HHVA 2GIQA 5C24A 4WQ4A 4BDPA 3CD6S 2CADA 5AQPA 4C3MA 2XY5A 4L74A 3B6OA 3DU5A 2MKHA 1VI7A 2HWHA 1N33F 3AXKA 3H4DA 4CJUA 4Y00A 3HVRA 3H46O 2YVSA 2QLXA 4CGHA 3BDPA 3D0IE 3UNGC 2CJXB 2M3DA 3I9V9 3IBFB 1WOSA 3M8QB 3I6PA 2XMJA 4K43A 3D5MA 3NF8A 8RUCA 3VMFB 1NMEB 3QBWA 5CHIA 3L7PA 1QE1B 2H3EB 3KG4A 3CJKA 1LOTB 4OJHA 4PYDA 3T41A 3AXMA 1WBDA 3CJSA 2P9EA 1RLCL 6FD1A 4DXLA 3U6FA 5J2MB 3C8YA 3JTPA 2EG1A 3GBTA 1IR2A 1TAUA 2UU9J 2C2NA 1QJHA 1FFSB 2V9KA 2W4CA 3BO3A 1SI9A 3CFOA 3QO9A 1C4CA 4OFZA 1K1SA 2F8MA 2FB0A 4TU9A 4KFBA 2ZZTA 4G6VB 4OYPA 2VFTA 4O55A 5IWAF 5JS2A 3AAPA 2L9DA 1ZXOA 1VQ6S 3OYHA 2HURA 5GAEP 3W8GA 4JUZA 3E01A 4ZMMA 2Q1LA 2CJQA 2J76E 2QYCA 3H3OB 2RRBA 2LEAA 5DG8A 2KQ2A 3CDWA 3R27A 1N36K 1IUJA 2KTQA 2VONA 3Q83A 1M90T 5AXNA 3KK1B 1X60A 2XLJA 1H1VA 3IAS9 3ENOA 3M7VA 4EIAA 4O0IA 1HYSA 1LFWA 2Q66A 2DEJA 4ZKAA 2J8SA 4KTWA 1TL1B 4QIGA 1S0OA 3FFIA 3MEDB 5B7WA 3WEEA 4IFYA 2GO8A 3SCLE 4NO7A 3EDRB 3I4PA 1ZTTA 2HQIA 4IFVB 1NB2A 3M9NB 5DK5A 2AP6A 1S6UA 1UA1A 5FD1A 4K0KJ 3O9QA 1B9FA 1G1XA 4ZLPA 5LMNK 4P7TA 3K5MA 1O5JA 2QL7B 3LA0A 2B51A 2QLWA 1UP1A 2FIUA 3CJBA 2DCLA 4CYUA 1A6LA 5C5JA 4KHWA 1AUSL 4CHNA 4LBHA 1RHUB 1DJ0A 4Z4HA 1VJWA 3P31A 3TQ1A 3NEKA 4QS7A 1NSAA 3H6EA 4I6WA 2ASMA 3QAEA 1SC1B 3ZT2A 4DV6K 3OVNA 3OUYA 4KH4A 1YTYA 2E66A 5D0EA 2BANB 2BJEA 2PZSA 3H08A 1S7IA 5KG7A 3FSIA 4DV2K 3MWPA 2DFEA 3CJ3A 3NG8A 3CD6N 2UUAF 4KB7A 2XYHB 4IDHA 2MSTA 3AY0A 5CABA 2KN4A 4DSEA 4CF8A 4EBEA 3NFAA 3G6VA 4OX8A 5D4PA 3ATVA 2V52B 3H5XA 1S3XA 4X4RA 2CNKB 1RAAB 4LFCK 4WIQA 4IG0A 4IDKA 5F41A 2R7TA 4ID1A 3GYNA 5D3GB 4RW7B 1G3OA 1TU0B 1FDDA 4HHHA 2RQKA 2E44A 3WC2A 3BZCA 4CF1A 2HQCA 3M2RA 4AM7A 1RA6A 4CEEA 4HYKA 4JS4A 3FZ2A 1WF2A 3OPKA 1IH7A 2FSNA 1XMBA 2CPXA 2B4VA 3GDQA 3MM9A 2GCFA 1HARA 4GKKK 4C9DA 1IR0A 3MCMA 3EJMA 2X51A 3C15B 1OH5A 1KC8O 3DU6A 4FW1A 1VQON 1U1PA 2BM1A 2DHSA 5KFHA 4DV0K 2NZCA 2CKWA 1FESA 4FWLA 4FZXC 3ICLA 1VQ6N 4DN0A 4X64J 3QQCD 1ASWA 4P10A 3I31A 2ZH7A 5FIIA 1HWKA 1ICEB 1XN9A 4BC2A 5HBMB 1OY9A 3VQ7A 3VQQA 4FVMA 4UY8T 2FHOB 3LDSA 1FVSA 2C3UA 1IBCB 4EFAC 3N28A 3ZSZA 1Q1KA 3L3UA 4FM1A 4K25A 4ECYA 3VALA 2CYYA 4BC5A 4KHMA 4DR5F 1SC4B 3L6QA 5FDLA 1MNEA 3CDBA 2IY5B 1LXNA 3L2QA 3AJ1A 4A8XA 4ZOSA 1TK0A 4MKAA 3TAEA 1QUVA 4OZ1A 1HWJA 4JOUA 2MLXA 2Q6CA 4FJ7A 1H74A 3SCKE 5ETPA 2CJ9A 1U49A 3CMES 3OBIA 2GGPB 1UAWA 1BD6A 3KMSA 1NPPA 1UVLA 3JB9k 3SCXA 1Q7YO 1IKYA 1UETA 4KRWA 3W2VA 3DLKA 2AYGA 3N4PA 1YVUA 1L3SA 3UR3C 3OHRA 3U1MA 5ITHA 2VGMA 4NA1A 3DHWC 2MQNA 2KU7A 4PABA 1J5OA 3T5KA 1NK9A 2VPZB 1FKAF 1TL4A 1VQ9S 2CXEA 4H4MB 1E6VA 2RD5C 2EW9A 1L3VA 4OZ2A 2WVDA 1H3DA 4HTIA 4RBUA 1OH6A 3LO3A 3DRRA 1R6VA 3QT7A 5F0WA 3KLIB 1HBMB 1YK9A 1DHMA 1RTJA 4JI3J 5F3TA 4DKWA 4DI6A 1H0HB 4ES3A 1Q16B 3AD7C 3GV5B 4K4TA 3UKRA 1ZM2A 5A76A 4HKQA 2HVDA 1T9XA 4KKOB 1T05B 4ECQA 1MMNA 5IS2A 1NDCA 3MZIA 3OYEA 3KK2A 3R97A 1CQMA 3TUJC 3MUMP 2WVCA 3VGSA 4L75A 3B8AX 4B17A 1VRTA 4FLYA 4I6AA 4NLPA 3W5ZA 4PYAA 3OYMA 1FDNA 2ZWOA 3EXYA 3QB0A 4YP3A 4CK3A 3I5AA 3U1NA 2PYLA 2PIIA 3ZTSA 2FTRA 2CPEA 1JLAB 5K9FA 2DGXA 3GG0A 4J91A 1SJ3P 3ULEB 1S77D 2UXCK 2C2EA 1RADB 4JI5J 3AA4A 4GVBB 3EXCX 3HZ6A 2ZBQA 2O8BA 2B8PA 2C2DA 3NVKA 3MGJA 1M5OC 1DKGD 3KHLA 4GRSA 5AQJA 1VOMA 2QFJA 1R8BA 1N4LA 4DU3A 1S48A 2N4DA 3TSPA 4BR0A 2ROEA 2ZUGA 2HMIA 5LY3A 1YLXA 3AA8A 3J80U 4ED2A 4H4KC 4CEOA 1H73A 4I7FB 4ZP7A 4P74A 4ECUA 2RS8A 2EI5A 3KWGA 2V2VA 1WJ9A 1GFWB 1N5YB 3HL8A 4ENOA 2VA3A 1S97A 4BLGA 2AQ4A 3EN9A 2EFOA 4BC7A 1UVNA 1RBRA 3M1VA 4JV2A 1NKEA 4BC3A 1HLWA 2XWYA 2CNOB 2DJWA 1KAYA 5AQWA 5K8MA 3E3XA 3ZZRA 1U47A 3CM6A 4ECRA 2E7XA 2WSEC 4F4YA 4DPWA 3AQOA 1HBUB 2FY8A 3QMLA 2VG6B 2RILA 1U6BA 1WKLA 3O8WA 4QWBA 5KT3A 2KFZA 3B8HA 3HLUA 2GAHC 2QMWA 2A0FB 2CAJA 3B78A 5J1EB 4LFAF 2FXUA 3I9ZA 4A8MP 2E29A 1DLOA 3MM7A 2B5JA 4FXVA 2RRAA 1X9SA 5J2QB 3A2FA 3CMEN 4E2FB 1RCXB 2DY9A 3RBEA 1I5OB 4YB7A 3DMJA 3N0VA 5ADXA 3NF9A 3OW2R 4BREA 2MQPA 4CZGA 2HFVA 4PXCA 5B0EA 2V2ZA 1GMUA 2PC6A 2H5JB 4IG3A 2JC1A 2RKIB 3CCWA 2FLOA 3PG9A 2X1AA 1HR0F 1VQ9N 2ZJQL 4LF9K 3DLHA 4CGDA 1VQ4N 3TVYA 1IR1A 5FLXY 1Y11A 3IMXA 4ILRA 4NLTA 4ZLNA 3I0SA 4H54A 4I9LA 1MWMA 4Q2MA 4Y2AA 4CO5A 2H54B 4B9NA 3MXHP 3I82A 1RBLA 1LAWA 2ZF5O 3W1YC 4CJ5A 4ANCA 1YJ9N 2ZJPQ 2VA2A 1F2GA 3GU0A 1XNQF 3NGZA 1RQ0A 2M0GB 2WONA 5HVGA 5SZTA 3ZSYA 2JLEA 2NQPA 1C0FA 2K8GA 4U7UD 5B0BA 2HHQA 1VYAA 2HPUA 2ALZA 4WK1A 1RAJA 4CEQA 3N4WA 2LFVA 3M2VA 1Z2ZA 1D1UA 2E5IA 4JAXA 3MN9A 4IJAA 1NZ8A 1HNVA 4QW9A 4J9NA 3VOVA 2QL5B 3V4IB 4AHRA 3RUBL 5D0HA 1EZZB 4U67L 2I9SA 4QWCA 4KC5A 1S6QB 1DARA 1FCAA 1HQ2A 1NGIA 2ACYA 3OYFA 1GQEA 3O5TB 3HM8A 1NLVA 4DR4F 3IGNA 1NUEA 1XC9A 4ALZA 4XPCA 4YR0A 1WC6A 5M1KA 1S0VA 1N36J 3RRKA 5BR8F 5J2PB 1M5VC 3A8JA 1N5VA 4USWA 1S79A 5KG5A 1TUYA 2H3GX 3HZEA 2XB2D 5KOWA 1SV5B 4CGJA 2M9KA 1HX1A 4HTLA 2VKZG 2UXDK 4E1MA 1BWVA 3DLEB 3CJAA 3G96A 1U8WA 2UP1A 2Z56B 3CCLS 1QS4A 4K2XA 2HQDA 3OTDA 2DNPA 4BRIA 5D0GA 2CQ4A 2D1CA 3CHWA 5B8HA 1WKJA 3LDLA 2O4GA 1KC8T 4NEZA 4WFZA 1DTTB 2FJVA 1YTAA 3CCVN 2ZC4A 3ZSRA 4Q44A 2VZ9A 2KHOA 4NYZA 5HMZA 5D4NA 3M8ZA 4LT6A 1K44A 5LMNJ 1JX4A 1UVKA 2KFNA 3KKSA 1VQPS 4FP9A 2W2MP 3DNCA 3T5HA 2OTLS 3L2VA 1Q78A 2EVZA 1WC1A 5EXWA 3PNIA 2I7NA 1VISA 4UUXA 5KFSA 1NDPA 1S4EA 4FJNA 4CFCA 4DV6J 3OV7A 3KD1E 2FHKA 4LY7A 2QGFB 2IVFB 3FCVA 4X65F 4PRFA 3VQ5A 3NCIA 2VWJA 3QIDA 3FVYA 4NYOA 3DXKB 2XYGB 2R2SA 3WXLA 3NNCA 3F41A 1JLCA 4YHHK 4F2RA 4OZLA 2HHWA 3A5LC 1FHTA 4BG8A 2BBEA 1D4XA 3ZX3A 1U6ZA 1NCLA 1Q7YT 3CFPA 1VQLS 1DFDA 3TSQA 2OD4A 3PSIA 2EWHA 2ZDOA 5M2UA 4LFCJ 2CDRB 2VF3A 3SDEA 2EC0A 3TTDA 3G87A 2K2PA 3DOMB 1N8RT 3ULDA 1EQMA 4KO0A 3GTYX 3QEIA 2YKAA 3TAFA 1T11A 5LSRA 3UO0A 3WXKA 3SJJA 4CZEA 4CJEA 4FJ5A 2AX1A 4DR6F 3MFHA 2IPOB 1DQ8A 2QK9A 1HMVB 2Z4PA 4BRGA 2W2PP 2W2OP 3Q22A 1GH8A 4OYOA 3PW4A 1RHKB 4GKKJ 1T3OA 5KFEA 3ZTQA 5EU7A 3ILIA 2P5VA 2GBZA 4ANDA 2OSQA 4LRFA 2YNFB 1ATNA 1HQEA 4XAKA 3AO2A 4DV0J 4WFNL 1Y5NB 1LWCB 5KFAA 1ELOA 2C3OA 3KJQB 2BJ9A 2F1FA 3AVMA 3P6YC 1RDWX 4JKGB 4DU7A 4Z4GA 1XI1A 2Z8QA 3OQ2A 3RU0A 4H0OA 2E1CA 4G3IA 1S22A 5K8OA 3ZCMA 4CJSA 4ZVEA 1UZDA 5KFIA 5AZJB 4DG1A 3L2UA 3AOBA 1MWZA 4NA3A 1GLFO 5AFUH 5HROA 5BYRA 4H5VA 3QAUA 2PY5A 3BF4A 1VC6A 1WHWA 4LSNA 1Z4UA 1W7AA 1U2FA 2JJ4D 3DOLB 3V1RA 5KAKA 4XO0A 5A2QU 4CJQA 2BRKA 1FI4A 3FFKB 3TNVA 2DXEA 4USMA 1HWUA 3LP0A 2WFBA 4C4WA 2BRLA 1EXQA 3ENQA 3S3OA 3LGHA 4RG8A 4X4UA 3Q89A 4M5IA 3R5GA 5GAGI 1RT1A 2DTUA 3Q2SC 4X62K 4P71A 3UDCA 1A5XA 3ZETA 2X78A 2CA9A 2W2QP 1XEZA 3MEEB 1T44A 3QESA 3IM8A 2P1JA 2IHR1 1VSIA 1U2VB 1EB0A 3MM6B 2OTLN 4DTOA 2BVZA 3HVWA 2J6UA 3H20A 2B6AA 5C42A 3AGRA 1HBOB 1OQ6A 2P9LB 4FJJA 5GMDA 4FCYA 2KH9A 4O44B 5DDQC 1NJIT 3SXLA 4HUGA 2ADCA 4NZ7A 3W2WB 4H0TB 3UKUA 1NZAA 2A1BA 1NK0A 3JSBA 1OWXA 5BR9A 4WTOB 4ZJQA 4KHUA 1FJ7A 4BRNA 3SI8A 1UEKA 5BRHA 4EZ9A 3TQEA 3O80A 1U09A 2DGOA 3JTOA 3ZX0A 4CZFA 5IC4B 4DSLA 1B99A 3R1LA 3ZZ0A 1B7YB 4E0DA 2N3LA 3O1BA 1VSEA 5TKYA 3VCDA 4CJRA 2QA2A 4KPYA 2UXBK 4DL7A 3CJTA 1VQLN 2R42A 3A8KA 2QLBB 1FRHA 1WORA 3IMQJ 4U95A 1P27B 3DRYA 3PHEA 3KLGB 4O3QA 2BE2A 4DV5J 2UXCJ 2VUGA 3ET6B 1C0GA 4A2BA 4J5OA 3RRHA 2E1AA 1U1NA 1U0SA 4KGZB 2JFDA 1KQGB 3W9HA 2GMLA 3EVWA 3DHXA 2Y0SD 3N79A 3Q8YA 2GJFA 2AYEA 4A8FA 3DWLA 4JLHA 2KI2A 4RZRA 3BEGB 1K47A 2EFPA 2FGOA 4DU4A 5M1OA 3DLGB 3SQ4A 4A62A 7AT1B 3FZHA 4UOFA 1PC4A 2G9OA 1NAQA 3TABA 1U24A 4OYMA 2DNMA 4NLYA 4MIBA 3KG1A 2IM3A 1JJ2R 4CF9A 4Q0BB 2D9OA 5KFYA 3JAMY 4ILLA 4FK0A 2O8FB 3CJ2A 4KI6A 3NNAA 3MECB 2HZVA 4DTNA 1S76D 2MQLA 2UUBK 1UWBA 1RBVA 4KTZA 3BSNA 4PQAA 4CFAA 4ZITA 4K0KF 2NRVA 2UUTA 1AW0A 3C2PA 2AYMA 4WXWA 5GMEA 3J80Y 3HHNB 4AQYK 1JNZB 2WB4A 3VQDA 2HBYB 3PJXA 4O4GA 3AJDA 4CHQA 3MMVA 3OJUA 1QHAA 2V69A 4LF7J 3TAQA 3CJ0A 3SSQA 4F0KA 2XHWA 2Z57B 3PYFA 1K8AT 1A5VA 3CJRA 3SBMA 4NLSA 1UWAA 4RU2A 4P2MA 4RNMA 2G1DA 1RB0A 1SXLA 3THXB 1CS4B 2FLLA 5C15A 1MWYA 2OP5A 3FBFA 4CI6A 3U1LA 4M5LA 3PDNA 2BEFA 2RF2A 4LF6K 1RT6B 3MXJA 2G1HA 3OLAA 1B0TA 2W25A 2ZNYA 3CCZA 2IDLA 4E1NA 4CO3A 3CCMN 5C2CA 2YNGA 2AGPA 4CD3A 5D4LA 1I1GA 3MAHA 3TR8A 4DUYJ 1B3TA 4LF9J 3ID6A 1U1KA 4M5HA 1B4SA 1WTBA 1ZBLA 3L3CA 3VAIA 2DEIA 3OSPA 3PYDA 1BHNA 4FJKA 5DLGA 4NCGB 1XJWB 2CG8A 2GVZA 4KQZA 3M8SA 3J81O 2ZHOA 1U1QA 2YKOA 3WIVA 3L4BC 5DDOC 4FPIA 4A5BA 4KHQA 3AA2A 2V4RA 5HL7Q 3VQCA 1NKCA 4DTMA 4DEZA 1SQEA 4OYXA 3L8BA 2A5XA 2C42A 3LF0A 3QRQA 4YY3K 4CVNE 4X64F 4A8KA 4JD2B 3KHRA 1WUUA 2IVMA 5J1NA 2E8AA 3IBWA 1U45A 2ILYA 4AHTA 1QAIA 1BXNA 2I38A 4M1KA 1N34K 2OZSA 4JI0K 1HIYA 2GWKA 3KK3A 1CLQA 2OPRB 2P9GA 2EXUA 2D3UA 1GLAG 4FF2A 4DR7K 3CCJN 2Y1RI 4NLBA 4L8RB 3FEXB 2WVFA 4K4SA 3O6WA 3R7SB 4TY8A 3H45C 4N41A 1VQ7N 4FK2A 1KTQA 2XO6A 4JEPA 4DPYA 4IOBA 5E26A 2UXDJ 2XMWA 5EOYA 2CH5A 5HVHA 3FEZA 1K9MT 3VGVA 2Q0UA 1HQUB 4HACA 3HI0A 4NLRA 1F3VA 3G6ES 4U8VA 3H3NO 4PXDA 2CJKA 2FY1A 4ED0A 4E7JA 5G0RB 4UUWA 4B1UB 4NI2B 2B3TB 4X4TA 4DFJA 5KFFA 4HHUA 4FLWA 3MURP 4RW8A 4QS8A 1CULA 4YOTA 2DPIA 2XMKA 3H0PA 3R5DA 5F3ZA 4G1IA 3V9UA 1YAGA 1IKVA 3CXCM 3AD9C 3IP0A 2DGTA 2HBZB 2W9AA 2YHAA 4KI4A 1LK5A 2DTJA 1NPRA 3CQXA 1PKUA 2WBRA 1GOBA 3JS9A 4A8OA 3PJ9A 1S5JA 3NBPA 4NYFA 1RILA 2QX0A 4KHSA 3BN7A 2NCKL 2ZJQQ 3GFYA 4JI3F 1LW2B 2P9KB 5KPTA 1S99A 4ES1A 2CQ3A 3RAXA 4BRLA 5K8NA 2F8SA 1TYQB 3HULA 1JKHB 2O8EA 4QJVA 1D8ZA 3WUHA 4MDBA 3GSDA 3P5JA 1TAQA 2IC3B 1K0VA 1QQOA 1Y9OA 4W5QA 2YNIB 3VAFA 1VQKN 5F8LA 5DLFA 3AT1B 3UIQA 3RBDA 3T1HK 3C6TA 3QGGA 4RX6A 1YVFA 3PEHA 1S4FA 2Z2ZA 3VGUA 4JI5F 5KFUA 4CLKA 2E1RA 3BKTA 2MLZA 3EE3A 2QWNA 4P6QA 1O1WA 4FF3A 4OKEA 1SB6A 4B9UA 3D2WA 4U67Q 1Y3KA 1TL3B 2RUSA 3H25A 5A6WA 5LXYA 4MKYA 2F3JA 3TZXA 2E4LA 1NNEA 2DRBA 4O3NA 2NUHA 1VK0A 3AAQA 1GXLA 2MZQA 3D6RA 3ZX2A 5LOQA 4HR2A 4DFPA 5JVHL 4M5DA 1CC8A 2QA1A 4DS5A 2RPIA 4H4OA 2HFUA 2CIMA 5KFGA 4DL2A 1CJVB 4RW9A 1T9YA 3MM5A 3DI6A 4DL4A 1GXTA 1L3TA 1HNWK 1U48A 4C11B 3GFZA 4CBWA 4ED3A 5D0RA 1UOCA 2LXIA 3CJ9A 3HSCA 5DM6L 2CZVC 2Q6BA 1XR5A 2P2CB 2E5LJ 3FBCA 2KT2A 1X3NA 3QWPA 2E1YA 4NLDA 2ILZA 1HA1A 3PW0A 1R7IA 3PM9A 2CDQA 1LKZA 3AVKA 5HSPA 3PV8A 4QOZB 1E3MA 1X3MA 2VU5A 3HFVA 3QPIA 4PG4A 3AVGA 4IO8A 2ZD1A 3J8AA 1WC0A 1C0UB 4EGLA 1XUPO 1KLNA 3D2EA 1OPZA 3GQCA 4K59A 4KIAA 3SQGB 4DSKA 1M5SA 4CK2A 4ZVGA 3HVTB 2DNHA 1BUPA 4J9MA 4DCOB 4PG6A 2K3IA 3QRPA 2W7OA 3HTVA 4QR1A 2AGOA 3D2FA 4K2JA 2R8KA 2GUPA 4UT4A 2NXCA 2MQMA 2ADBA 4M7XA 4Y1CA 4IFEA 4QZVB 5A2QY 3CJ4A 5DDPC 4LF2A 4OQJA 1HBNA 4NLCA 3SSSA 1RABB 2C3MA 2AHOB 4H5RA 3V81B 4I69A 1CVJA 1RT7B 4XTTA 3BBCA 1BIZA 1NOYA 4KAIA 3FZKA 3M9OB 1RAOA 1N56A 4QWAA 1D09B 4JN4A 5AQTA 5KTQA 4YDDB 2W41A 2OYQA 4W5NA 5KPZA 3C66A 3D7EO 5EGYA 1RA7A 1MU2B 1NEEA 4YUDA 4WFAL 1ZC6A 1YJTA 3R7NB 3H8YA 1MMDA 3VEWA 1XHZA 2FLNA 2P9PA 2ATLA 2YQ3A 4OPHA 4NXMK 8ATCB 5M2RA 3ZZUA 4FWNA 2I6WA 2P9IB 3K8WA 2YKNB 3L3VA 2YPZA 2XHCA 2ZVIA 1JCFA 4F04B 2XSJA 3EY1A 5AXLA 3SAHA 2F65A 2LEPA 2DKOB 2AF6A 3VF2A 2MKKA 1WF0A 3NAHA 2P9UB 3VHQA 1VHXA 4UOGA 3H4BA 5I3UA 4BVOA 1YI2S 3B4DA 1D9FA 3K17A 5HJYA 1N88A 2I8EA 1HLUA 3RMCA 3CWJA 2Q0RA 4LF1A 3A5MC 2OFHX 1S1UA 1WDDA 2F63A 1EP4B 3S01A 1LOUA 2H4WB 4Y2MA 2L48A 4WFNQ 3C16B 1ZZNA 4WCEL 3SYZA 1WSHA 1N36F 2NS1B 2FJXA 3FCWA 4HH1A 4B8AB 1PYSB 3V6KA 2DNZ