1RTDA

Structure of a catalytic complex of hiv-1 reverse transcriptase: implications for nucleoside analog drug resistance
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
554
structure length
554
Chain Sequence
KISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTDTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDESESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a covalently trapped catalytic complex of HIV-1 reverse transcriptase: implications for drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/dna
molecule keywords DNA TEMPLATE FOR REVERSE TRANSCRIPTASE
total genus 136
structure length 554
sequence length 554
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rtdA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtdA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtdA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtdA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rtdA05
4Y34A 4FJJA 1S1XB 1S97A 4IFVB 3RB6A 4KAIA 2R8IA 1TVRB 3RRGA 1Z4UA 1KTQA 3HP6A 5L1JA 4CGHA 3FSIA 1HMVB 2ATQA 1JLEA 4C8LA 2FJVA 2OPRA 1HMVA 2OA8A 3HM9A 3OL7A 4K4SA 4HVJA 2AGOA 2E6MA 2W42A 2WOMA 4KRFA 2XY6A 3MR5A 4RG8A 3OS0A 4OKEA 3OYLA 3ALYA 4CGFA 4DTRA 2UUWA 5F8JA 4EYHB 1S6QB 3MEDB 3FQKA 3KNAA 3WNHA 4KKOB 1HRHA 4FZYA 5J2QB 4CFCA 4KTZA 1J5OA 3NL0A 4OLBA 3OS1A 4KV8B 3RBEA 4IR1A 5HP1A 4ECXA 3PW2A 3DMJB 2XCAA 3NH2A 3PX6A 3NBPB 4N41A 1BISA 1NOYA 4CJRA 4J9MA 1W9HA 1BCOA 2ILZA 3QGHA 1VSIA 4M95A 3AVJA 2JLEA 3VQ7A 4J2BA 3ZSXA 2F96A 1CLQA 3DRPA 1WSFA 2D5RA 5EWEA 3LP0A 4M3WA 3DRPB 5CZ2A 4URQU 1RTHA 1D0EA 3K57A 3RMDA 4CJWA 4KE5A 3L2QA 2PY5A 4QWBA 2B6AA 1JLCB 1EXQA 3OLBA 1NJYA 5KG2A 4B9NA 5KG5A 2Y1JA 1UAXA 4J9NA 2KTQA 4F4ZA 1C1AA 1S1WA 3OL8A 5DGBA 1NHUA 2FBXA 3T5KA 2XY5A 4O44B 3SI6A 3H2LA 5CYQA 2RDJA 1ZTWA 4G1QA 4DQRA 4EO8A 4FK2A 4IRDA 2P5OA 5EWGA 4OGEA 1RBRA 2D7SA 1TKXB 4URSA 1TKZA 4H4OA 4KO0B 4X2BA 4QWAA 3AO3A 3OYJA 4E1MA 1J54A 3BGRB 1S0NA 3KLGA 4HYKA 3FQLA 1FKOA 3LAKA 1CZBA 4KB0A 3SQ4A 2IJFA 1VSEA 1DLOA 3RWUA 1IKVA 4NRUA 1VSMA 1JLQA 3RTVA 2J6SA 4NYZA 2XGQA 4GC6A 3PZPA 1UA1A 1QE1A 4CGIA 1S6PA 3UQSA 3HL8A 4NCGA 4Q0BA 4MKBA 2IM0A 1KCFA 3PV8A 2HNDB 1BQMB 1JKHB 3QO9B 3RRHA 3O3GA 4J2AA 1KVBA 2DFHA 3DLBA 1JLFB 3BR9A 4E19A 2YNGB 3PVXA 2X6SA 2RPIA 1JLGB 2R8GA 2YNGA 3VQCA 4Z0UA 2LSNA 1JLGA 3V4IA 4EYIB 2HNZA 4B8AB 1D8YA 4F4XA 3N6NA 4ED8A 3QEIA 4W5TA 5HLFB 4DL5A 4ZP8A 3AA5X 5DGAA 4TYAA 2OPQB 4RW6A 2Z1HA 1JLCA 4EBEA 2YKMB 3LALA 4DS4A 3V1QA 2QV6A 3I0RA 4QPXA 5CYQB 3TAPA 1RILA 3LP1B 4FW1A 2W9AA 3GV8B 4DQPA 3V81A 3VQBA 4YR2A 4TY9A 4AHTA 4EBCA 3B6PA 3L2UA 3DLKB 3IRXA 2XY8A 2AGQA 4IFYA 3RB3A 1MU2A 4K8ZA 2FVPA 4DG1B 1HYSA 4ECSA 3TR8A 4CJEA 4JRPA 1LV5A 3G6XA 2DFFA 4KREA 1RTDA 1T05B 3T1AA 2G8IA 3MXIA 3M8SA 4B9SA 3GV5B 1TVRA 1NKEA 3AVKA 3PUFA 5KFVA 4EBDA 4N5SA 2B4JA 3SQ2A 1RTJB 1JLEB 5KG1A 4FW2A 3OVNA 1TKXA 2XI2A 4BE2A 4F4YA 4ZVEA 1QSLA 5EU7A 4OL8A 4N47A 4Z4IA 2C2EA 2E6LA 3DOLB 4DTMA 2AX0A 3NGZA 2OPPA 5DG7A 3D45A 2FLPA 2CJQA 3DRRB 4ED6A 3V4IB 4IKAA 4NLUA 4YP3A 1KVAA 3DM2A 1IKWA 2D0AA 3AA2A 3QEWA 3V9ZA 4Z4EA 4I9LA 3V1RA 2PYJA 3I0SA 1TV6A 3RR8A 4Y3CA 1GX5A 1S0MA 4DFKA 2YNFA 1WLJA 4FJLA 1S9GA 3NGDA 3PX4A 1FK9B 1LW0A 4ID5B 5KFNA 4CJSA 4DMNA 5J2NB 3VA0A 1FK9A 4ELUA 4FM0A 4TLRA 2WHOA 2X78A 4RNMA 3UR0A 2HHWA 1QUVA 3DLGB 3TVKA 1S1VA 3QGIA 2IBKA 3RMAA 3E01B 2QE5A 4CECA 1LWEB 4FLXA 2HNZB 4CEFA 4R8UB 1IKYA 4CEAA 5CYMA 4O0IA 2R8JA 1JLBB 4XPCA 1EX4A 1TKTA 2UUTA 3G86A 5KT7A 2JEGA 1T05A 4F4WA 5KFWA 4K4VA 1UWBA 3I0RB 2YNIB 5F8IA 4BDPA 1N6QA 3CFRA 3HPGA 3OS2A 2E4LA 1S9EA 4YMEA 4BACA 2FLNA 3WNFA 1VSDA 3QETA 3BQ0A 2IM1A 5KFGA 3K2PA 5KFMA 1WNEA 1RBSA 4ZPDA 4H54A 4F50A 4CHPA 2G8HA 4O4GB 4J9PA 3KOAA 2GC8A 4ECQA 2JC1A 2J6UA 3V9WA 1KHWA 3PJXA 4FM1A 3P83D 2DY4A 4FYDA 3IS9A 1T7PA 2BQRA 4Y1DA 4Q45A 3SJJA 3AVFA 1HQEB 4W5RA 3IS9B 3THVA 3AVNA 4NCBA 2X6NA 5SZTA 1KLMB 2BQ3A 2AGPA 4NCAA 4F2RA 3JSMA 3VQQA 1ZBUA 1Q9YA 5HRRA 1UA0A 5JXSA 1D9FA 2IS3A 4NCGB 1EKEA 4FJMA 4RNHA 4FJXA 3QO9A 4KI4A 4PWDB 4CF2A 4JV1A 3TAEA 4YNQA 5HROA 1T8EA 4FJ7A 4FJ8A 1XHZA 5DG9A 3OJSA 3CDWA 4ZVGA 1S49A 4R8UA 4AHRA 4M3ZA 3H5YA 1N4LA 3E01A 1U48A 1BIZA 4TY8B 4NLWA 2HHUA 1TV6B 3BSOA 3V9SA 2IOCA 4HCCA 3PR5B 1S1TB 1S9GB 4M3UA 2G8KA 5FDLA 4RW6B 2GBZA 3N6MA 4FS1A 2Q3SA 3M8PA 4KHSA 5J2NA 3M8QB 4PUOA 2HMIB 4K4TA 1GOBA 2F8EX 1RT5A 5KFSA 4OKJA 3E51A 4J9LA 2JEJA 3U6FA 1U49A 3D28A 1ZETA 3GILA 2BDPA 3DRSB 1Z26A 4DTPA 2IMWP 4NLGA 4NLRA 4QCLA 4Y2CA 1JLBA 1TAQA 1VRUA 4DG1A 1RDCA 2KW4A 2R8KA 3VQSA 2E9TA 3CM6A 4IG3B 2YNHB 1HNIB 4CIGA 4NLTA 1O1WA 1SKRA 2R8HA 3AVBA 3EYZA 3EZUA 3HHKA 3TQ1A 1HNIA 1TP7A 3AVMA 5KTQA 4TN2A 3NF9A 3QNOA 5KFBA 1K1QA 4XPEA 1RT6B 2ASLA 1SV5A 3M8RA 3EZ5A 3OYFA 1CXUA 1KSPA 3V6HA 4MK8A 3NMAA 4KKOA 5KT5A 1IKXA 3I8DA 4U7CA 1BI4A 3PY8A 5J2QA 3C6UA 4CJLA 4ZP6A 1RT4B 4ELVA 2C2RA 3HYFA 3QEPA 2BANA 1RT4A 1U09A 5KFUA 5F9LA 1ITGA 4IDKB 1CXQA 1CZ9A 3F9KA 3NCIA 1BGXT 3S3NA 1KHVA 5FROA 4ECRA 3N6LA 5EWFA 3CG7A 3JYTA 5KFPA 3QGGA 3PW5A 2JC0A 4FLUA 2VA3A 3BSCA 4CJUA 2VG7B 2Z1GA 3SZ2A 3ZSWA 4RNNA 2OZSA 2HHQA 1LWCB 5KFTA 3PX0A 1A5XA 3SCXA 3MF5A 1SL1A 4F3OA 3NDKA 3ZT4A 3QYYA 1NK6A 5KT6A 3AVHA 1REVB 3ITHB 1IH7A 3QERA 5L1LA 1KFSA 3M8PB 4CHNA 3O3HA 1RBVA 5F8MA 3M8QA 4PUOB 4M94A 3AVCA 2XWYA 4CEEA 2RF2B 3IGNA 4M3TA 4Z4CA 4Z4GA 3HK2A 1RT2B 5SWMA 1KFDA 3L2WA 2AQ4A 2UVRA 4WFXA 3HVTA 2C28A 5CYMB 4NZ0A 3NH1A 2VG5A 2W8LA 1WNSA 1VSKA 2HHXA 1N5YA 1HYSB 2FJXA 3O4QA 1IKYB 5HBMA 4EZ9A 1Q8IA 4KFBB 3MFIA 3H4BA 3HVWA 1JX4A 5D3GA 3H40A 4KTQA 2W7PA 4IKFA 3WNEA 2ATLA 4CJFA 1IKXB 4FCYA 3VQDA 3CJ4A 1XR6A 3KLEA 1D1UA 3OY9A 1SKWA 3CJ3A 4IR9A 2HNYA 4ZHRB 4FZXC 2O5DA 4E7LA 2WTFA 5K14A 2IGIA 2AU0A 4AILC 4K50A 1HNVA 2OH2A 1JL2A 3C94A 1BQMA 4CFAA 4B9LA 3CDUA 1ZBFA 4CERA 3CWJA 4GMJB 3RMCA 2XC9A 4MIAA 4ZP9A 3L3VA 5HRSA 4DLGA 4RW9A 5C42A 3GQCA 2IC3A 4RW9B 4I7FB 3PO5A 1ASVA 2RN2A 3EY1A 3VQ9A 1XWLA 5DLGA 4E1NA 4DSEA 3MXJA 3QIPB 2D0CA 3QLHB 4KB1A 1WAFA 3OL9A 1EETA 2KZMA 1L3UA 4JUZA 3U3YA 1KLMA 1L3SA 1HPZA 4DL7A 1DTTA 3RBDA 4FJ5A 5EUHA 4FLTA 4K4UA 1BL3A 4AHUA 2BQUA 3GIMA 5KFJA 3I5CA 1QHTA 1NK9A 2KQ2A 3MR2A 4ZPBA 1RYSA 3LP0B 2HWHA 4LSLB 1YTUA 4LQ9A 4B9TA 3CM5A 4DTSA 3TI0A 2XRIA 2G8VA 3L2RA 1HJRA 2UVWA 5F8GA 2B5JB 2YKNA 5F8LA 4Q43A 2O4GA 3EPIA 4O3RA 3M9OB 1REVA 4WZQA 1RTHB 5DLFA 4ED0A 2ITGA 4CIFA 4J9RA 2QXFA 5FRNA 4C8KA 1TAUA 2RF2A 4MK7A 1NK4A 4O3PA 3RMBA 3A2FA 4NLYA 2ZE2B 5C24B 5KT2A 4CJQA 1K6YA 5KFZA 1WAJA 3RAXA 3DLRA 1RT1B 4NLVA 2HB5A 1MU2B 4MFBB 2YV0X 4GVMA 3IAYA 4ICLA 3NAHA 1N48A 4M41A 1UOCA 3OYMA 4ZTFA 4ICLB 1HQUA 4MH8A 1S5JA 3TAFA 4IG3A 4IRKA 3SI8A 4IH6A 3ASMA 4DWIA 3MEDA 2WONB 1JIHA 2VWKA 1S4FA 4Y1CA 4IH5A 3KLIA 4J2EA 5L9XA 1IKWB 1T94A 3DYAA 3QIDA 1NK8A 1S1UB 4O55A 3Q8PB 2BE2B 4RW4A 3LWLA 1EETB 2ASJA 3KK1A 4R5PB 1VSJA 4YR0A 3T5LA 3DOKB 1I6JA 4ZP7A 4YFUA 4WXOA 2D3ZA 3VQEA 3V9XA 3CDEA 3H5UA 4FLWA 2DPJA 1JLFA 3D0PA 4H4MA 5I42A 1ASWA 3DOLA 4KB7A 4CE9A 3FRZA 3S3OA 2EHGA 5KFIA 2W8KA 2FBYA 4IG0A 5EDWA 1WN7A 5KRSA 3SUNA 4DSLA 1SKSA 2VWJA 2GV9A 2Z1IA 3BJYA 2P1JA 1C0UA 2HWIA 4ED3A 5FDLB 2CKWA 4N76A 1S10A 4CGJA 1DTTB 4DFPA 1ZBLA 3OYCA 3LWMA 4RW8B 4C8NA 4CGGA 3VQ5A 2WB4A 2ZQBA 4IBNA 3DI6A 4NLPA 3EPGA 3MEEB 4FJHA 4DTNA 3HVTB 2ZD1A 4Q8EA 4KSEB 1HYVA 4KO0A 3VQ6A 2VA2A 4HCBA 2YHAA 4DL3A 1QAJA 5KFRA 4WZMA 3O4NA 5J2MB 3P1GA 1QSYA 3OYBA 4LH4A 3OYEA 4E89A 5JS2A 4IFYB 3SUOA 1DLOB 1W0HA 3TAMB 4CJ5A 1WSJA 3NHGA 4DS5A 3H98A 3MECA 5KFKA 1VSLA 1RT3B 4Y2AA 1JL1A 4AHCA 1NJWA 2R7YA 3K5OA 4EZ6A 4YQWA 3KK2A 4ECYA 2FBTA 3MTKA 5FRMA 1WSIA 3AO1A 2OPRB 4FLZA 1KVCA 3JSMB 4EO6A 2EC0A 5KI6A 4L8RB 4EP4A 1NK0A 4JRQA 4URGA 1I39A 3Q8RB 5KG0A 1C6VA 3ZSQA 1X9SA 1VSHA 4HKQA 3C6TB 2HVHA 3UIQA 4CF9A 3K5NA 3SFGA 4KAZA 5KG6A 5KG4A 3C6TA 4O3QA 4FJIA 4O3NA 3L8BA 1NK5A 1JLQB 2VG7A 3ZSVA 3DRRA 3ZT2A 3JYTB 4I7FA 1TL1B 3DLEB 4DQQA 4TQSA 1J5OB 2I5JB 4E7HA 2IM3A 3RB4A 2D3UA 4MK9A 1XR7A 1C1BB 3Q8SB 3AVLA 3SQ0A 4CF1A 1EP4B 3HXMA 2HAIA 4FK0A 3NBPA 4ECUA 2BRLA 5J2PA 1LW2A 3SPZA 3LP3A 3CQ8A 1I3AA 4KHUA 3KHRA 3DMJA 2FJWA 3G0ZA 5KGWA 1RA7A 5JUMA 4FJGA 2IAJA 3OYGA 4ECTA 3SFUA 1CSJA 3BREA 3ZT3A 4TY8A 3LPTA 2A1SA 3OHAA 2KZZA 1S48A 3CFOA 3BSNA 5L1IA 4KHQA 5KFCA 1N5YB 2B5JA 2YKNB 2OYQA 1W25A 4KPYA 3ISND 3NGYA 1B9DA 4DU1A 1G15A 3MECB 3QEVA 3SV4A 3KJVA 3OYNA 4QAGA 1D5AA 5KT3A 2B6AB 4DQIA 5J1EB 4CK3A 3F73A 2JEIA 2GIQA 3BSAA 2V4RA 2W7OA 3AO2A 1RTDB 1Y97A 4ED1A 3AVAA 3G6VA 1FKPA 3M9NB 1RNHA 4CJTA 4XO0A 2W9BA 3B6OA 2W9BB 4DF4A 4ZVFA 4FLVA 4E0DA 4LQ3A 4FXDA 1SH0A 2PYLA 4B08A 1RTIB 3ISNC 1NNDA 4EEYA 4G3IA 2P51A 3L3UA 2C2DA 1DTQB 4ZMMA 1LAVA 1RTIA 4NYNA 2QKBA 2OPPB 2VG6A 5F9NA 3SPYA 4W5OA 4DTXA 4LY7A 1IKVB 4JS4A 2DFEA 4LSNA 1HQUB 4QOZB 1FKOB 3HJFA 4JLHA 1SUQA 4JS5A 4DFMA 4HHTA 4QWEA 4RW4B 1C1BA 4CEBA 1RTJA 5KRTA 3KD1E 4CHQA 1SL2A 3VN5A 2HNDA 2IJNA 2IA6A 2ZKUA 2BANB 5J2PB 3VQ4A 3KLHA 4IRCA 4IDKA 3OJUA 3HPOA 4PWDA 4K4XA 5DQGA 3RB0A 3KLHB 5DG8A 4KV8A 4O4RA 4B9VA 5KFXA 1YT3A 3KMSA 3RAQA 3OYHA 1JLAB 2Y1IA 4PQUA 3OSNA 1GOAA 3QIOA 1RT2A 4H4MB 4J9KA 4IH7A 1T03B 1TK0A 2WCXA 4J2DA 4CK2A 5L1KA 1LWEA 4FLYA 1ASUA 4XIUA 4ID1A 2YNFB 3FDSA 2W9CA 4O5BA 3OLAA 4I2PB 4CEQA 4OPKA 3V6DB 1F21A 2WRMA 2BRKA 3VA3A 2D0BA 4CGDA 2HVIA 4C8MA 2GIRA 2V4QA 4B3OA 3MXMA 1C2PA 2D41A 3ITHA 3QEXA 2OPQA 2G8WA 3HKWA 3OYDA 5D3GB 4O44A 2HMIA 3PJWA 3V6JA 2KFNA 1RYRA 4KHYA 4O3OA 4FBTA 2QK9A 4CJ3A 3QNNA 3FFIA 5CY4A 2X74A 3ZSRA 2XCPA 4CF0A 3KK3A 3DRSA 2HNYB 1VRUB 4ZHRA 3CIZA 5DK5A 1WSEA 1U47A 4UQGA 4QWDA 2Z1JA 4AH9A 3KLGB 1IM4A 4TQRA 3LP2B 2XHBA 2C22A 4LSNB 2WONA 4CJ4A 1A5VA 3SUPA 3HP9A 5KFOA 2YNIA 3TAQA 1SV5B 1U04A 4IOBA 4R0EA 1OS5A 3H5SA 4DSFA 1ZYQA 3AA3A 3ZCMA 3KHGA 1MMLA 1LWFB 1TGOA 4J9SA 1SH2A 1ZBHA 2R2RA 3SQ1A 2FVRA 4QWCA 4CEZA 1RT6A 4NLSA 4DL4A 3NE6A 3D5MA 1S6PB 3KLIB 4DF8A 3CJ5A 3IG1A 1Z25A 3KLEB 2KFZA 4CJKA 1C0TA 3C95A 5KFYA 3DLHA 1J9AA 4OPJA 3C6UB 3H4DA 2E9ZA 4CEDA 2RKIA 4F4KA 5T7BA 3IN5A 4R5PA 1LW0B 2NUBA 3KD5E 1NKBA 4RUCA 3G6YA 4EP5A 4WFYA 5HROB 1J53A 3DDKA 2E9RX 4Q5VA 4C8OA 1HQEA 3ZT1A 2WK4A 1IG9A 4RW7B 2I5JA 4DL2A 3V6KA 1QAIA 4NLOA 1XR5A 2ASDA 4CJPA 2XGPA 3V6DA 5HLFA 4BDZA 4J9OA 2AX1A 2DPIA 1TQLA 2HW3A 4AHVA 2BGGA 1TKTB 4B3OB 4KTWA 4J9QA 5I3UA 1S1WB 4I2PA 4ED2A 2PZSA 3LZIA 3MEGB 1LW2B 3CJ2A 2FVCA 1C0MA 4B8CA 4K4YA 4PQUB 3T3FA 3HVAA 3TAGA 4CF8A 4FJ9A 3FFIB 4OJRA 1SH3A 4ZPAA 1S0OA 1VSFA 3V81B 4B9MA 3T5JA 4HUGA 2ETJA 4HUEA 2FLLA 4ED7A 1TK8A 4DU4A 3KTQA 3TAMA 5DQHA 4MFBA 5J2MA 3WNGA 3HT3A 3K5MA 1QSSA 3CFPA 3M9MB 4DFJA 4MIBA 3I5AA 3LP2A 5J1EA 3S3MA 5KFDA 4BWMA 1LWFA 4WYLA 1BQNA 1N6QB 4M3RA 4CJVA 1S9FA 1BQNB 1BHLA 4DSKA 1WSGA 1XC9A 2B43A 5DQIA 3TWHA 4Q0BB 4DLEA 4W5NA 4KHNA 4GC7A 1FKPB 5KFLA 1QE1B 3K5LA 3QZ7A 4CEOA 1DTQA 2P5GA 4O4GA 5C25A 2EX3A 1RT1A 3KMQA 4TYBA 3K58A 2GUIA 1X1PA 1XHXA 5JS1A 1U4BA 1YVFA 4B9UA 3GIIA 3KLVA 3DM2B 1L5UA 5I42B 4WXWA 4QW8A 2UVUA 4F8RA 4RNOA 4F2SA 4BE1A 3CYMA 1S1UA 1C1CA 1NJXA 3AA4A 4RW7A 3Q8QB 2R2SA 2G8FA 4RU9A 1LAWA 1HPZB 3KK1B 3TANA 3BDPA 4HTUA 2RKIB 5KFHA 4Q8FA 4I2QB 2FVQA 3MR3A 2FBVA 3MFHA 4F3TA 3RR7A 2ALZA 4K4ZA 1BCMA 1U45A 3L2VA 4CCHA 5HP1B 1RT5B 1S1VB 4QW9A 4LD0A 5KT4A 5KFFA 4CESA 3CJ0A 3TARA 3QESA 4ZVHA 4M42A 4O3SA 5F8NA 3HSTB 3GIKA 3MAQA 2IAJB 4GW6A 5E41A 4FJNA 1C0UB 2YHBA 3AV9A 3HPHA 1TKDA 2V0NA 4Q44A 4PY5A 3IRXB 4ZTJA 3V1OA 3UPFA 2R2TA 1HARA 3KLFA 4DL6A 3NF8A 4YR3A 1RT7A 1RDDA 1XI1A 5C5JA 1RT7B 4NLDA 2IDOA 3KKRA 3UDLA 1S9EB 4FJKA 4MKAA 4TXSA 3NF7A 3ZSOA 2UVVA 1N56A 3OL6A 4E7JA 1YTAA 3QZ8A 2I1RA 2F8SA 1VRTA 3CO9A 2AJQA 1GX6A 2FC0A 1S1XA 1QS4A 1NK7A 3PW7A 4KI6A 4MQ3A 1D9DA 2OPSB 1B9FA 4LH5A 3AO4A 1BI4B 2VG5B 5KFAA 4G1QB 1RDBA 1TK5A 2VG6B 3QINA 4CHOA 1HNVB 1TKZB 4H4OB 4K8XA 3H5XA 4WFZA 4ELTA 1SUQB 4DTUA 3HVRA 2HHSA 3T19A 5C42B 1C1CB 1ZTTA 3DYAB 4CFDA 4O0JA 1NJZA 5KFQA 1RDAA 1RT3A 3QIPA 1NKCA 4DSJA 2XY7A 4OLAA 1KLNA 2J6TA 3H59A 2XI3A 3I0SB 4BDYA 3ZSZA 3BQ2A 3NF6A 1EP4A 4RNFA 2V9WA 5C25B 1NHVA 2JGUA 1JLAA 3PW4A 5KGXA 4OVLA 2IC3B 4Z4FA 3K59A 1GOCA 3NAEA 1YVUA 3OHBA 4FZZA 3KHHA 3LANA 2O4IA 1RDRA 3VQ8A 1HYZA 3NAIA 3NH0A 4AHSA 3LDSA 1BIUA 1TL1A 3DLEA 3NFAA 3OYKA 4I9QA 4DTOA 4ECZA 3G10A 4FVMA 4RW8A 1RBUA 3MEGA 4ZPCA 2BR0A 4JV2A 1R0AB 1JXEA 1NOZA 4BWJA 4E7KA 3DLGA 4RUAA 4NLQA 4OGCA 2G8UA 1A5WA 4RZRA 4JV0A 5KG3A 3KKSA 4CFBA 1JXLA 1QQCA 4W5QA 2FVSA 4IFVA 3U3GA 3P5JA 4E7IA 3KHLA 3LP1A 2ZE2A 2A1RA 3DLKA 2R2UA 1B92A 3MEEA 4WYWA 3ZSYA 2XO7A 2RDIA 2HHTA 4E3SA 3PHEA 3KK3B 5K14B 4CK1A 3BGRA 3IGVA 1L3TA 2YNHA 4WE1B 3ULDA 1RAJA 4N56A 4WE1A 3GIJA 1QTMA 1RCHA 4NLXA 4NYFA 5CZ1A 3ZT0A 4FK4A 4U6PA 3KJVB 1ZBIA 4BE0A 4FM2A 1VRTB 4H8KA 2BE2A 4DQSA 3LAMA 1C0TB 2OPSA 5KG7A 3QLHA 1X9MA 3AVGA 3IG1B 2AWZA 2IM2A 3AVIA 3VQAA 4M3YA 3I5BA 4NRTA 5HRNA 5T14A 1JKHA 2JEFA 4ECVA 3GV7B 5DMRA 4OKKA 4CHZA 4K4WA 3OSPA 2WOMB 3GYNA 4DSIA 3HO1A 3SUQA 3PR4A 1IO2A 1X9WA 4IG0B 1L3VA 3PW0A 4M3XA 1VK0A 3T5HA 1S6QA 4FS2A 3V9UA 3H08A 3PO4A 3O3FA 4KHWA 1FXXA 5I3UB 1LWCA 3MR6A 2HHVA 2YKMA 1KRPA 3DOKA 4PA1A 1TL3A 3OYAA 5HRPA 1JXBA 4KBIA 1TL3B 2ILYA 4KHMA 3LZJA 5F8HA 4DU3A 4ID5A 4I2QA 4HUFA 4M45A 3S9HA 2ZD1B 4ECWA 3NKYA 1RBTA 4DTJA 3AO5A 1T3NA 4LSLA 1SL0A 3LPUA 1T03A 5C24A 4CIEA 4FBUA 3ICLA 3SV3A 1WSHA 4CHYA 3VQPA 3KLFB 3KIOA 5HBMB 3TABA 1S1TA 3SNNA 2DTUA 4DEZA 1K1SA 2QKKA 4KHRA 3SYZA 3BQ1A 2OZMA 1RA6A 4IQXA 5KFEA 4KFBA 2W9CB 2F8TA 3CVKA 1R0AA 4TSXA 3OYIA 3DI6B 4Z4HA 3NGIA 1UWBB 1Q9XA 3KK2B
chains in the Genus database with same CATH superfamily
3AXMA 4Y34A 1CBKA 4FJJA 3MOJB 4EFHA 1S1XB 1S97A 1ATRA 4JI6K 4A8FA 3MMCA 1FRLA 2R8IA 1WWHA 1YJWN 3HP6A 4DCPB 5L1JA 3FSIA 4KH6A 2QRRA 3QICA 1JLEA 1AYEA 4C8LA 1YJNN 2CQ3A 5EHHA 3S01A 2D69A 2E6MA 4C48A 1UJ6A 4KRFA 2YBVA 2H1YA 1M0SA 1E4GT 3DWLA 2DNPA 2J0QD 5HN0A 2UUWA 4EYHB 2E5LF 3I33A 3M1VB 3X1LB 4ZOSA 4BRFA 4RWXA 3OBWA 3HBTA 3ILLA 3CJAA 2HS3A 2AYEA 4OLBA 5AQQA 3RBEA 4N41A 3NWRA 3J8AA 4Z2XA 3B78A 4PCQA 4A8WA 3QFPA 1VSIA 4DZ6A 1C0FA 3ZSXA 4IO9Q 2ZUGA 1S5ZA 3DRPA 1HLUA 1WSFA 2O8FA 4RO0A 4M3WA 3DRPB 2FDNA 1VQ6S 3LH2S 5CZ2A 3D6HB 2H65B 1UWAA 2E7WA 3KWMA 3GLJA 2PY5A 1CS4A 2HF4A 3UWTA 4QWBA 2B6AA 2E7VA 2V63A 5HK4A 5JVHL 1NJYA 2HQ3A 1U0HB 5CABA 2Y1JA 3QBXA 1WDTA 3EGVA 2KTQA 1WUAA 3KKFA 4I6MA 3OL8A 1NHUA 1WOOA 2IRUA 4O44B 3D1HA 3H2LA 8AT1B 4JV5F 2XSFA 4G1QA 4FK2A 1FFGB 1RBRA 2D7SA 5U47A 4KO0B 1RU1A 3PYGA 4QWAA 5GAGP 3GFYA 1UP1A 1VQ9S 3V2UC 3KLGA 1N5VA 1P8ZA 2DVIA 5H1SV 3C46A 3SQ4A 4DU7A 2GFFA 2IJFA 3LTOA 1IKVA 1SB6A 4EU0A 3PFOA 3RTVA 4A8OA 2J6SA 2KVIA 2XGQA 4GC6A 1UA1A 4JI2F 2GHWA 3T6JA 2Q97A 4NCGA 4HI1A 2D3O1 1KONA 2CGJA 1N54B 2EKYA 2HNDB 3ADAC 3DOMB 1JKHB 3LDOA 5B0FA 4ILLA 1XJWB 4J2AA 4WWSA 1HNXJ 1DGKN 5JMNA 1VQKN 3NGRA 3BR9A 4E19A 5HAOA 4USMA 2R8GA 2YNGA 1UW9A 1JLGA 3NMRA 3V4IA 4GKKJ 1NPKA 4PKHA 5A8WB 2VBWA 5GMDA 4D3GA 3QEIA 4LBHA 4W5TA 8RUCA 4B3RK 1U2FA 4TYAA 2Z1HA 2YKMB 1GLJO 4C4WA 4DX5A 4Y0FA 3TAPA 4I68A 3LP1B 1I94F 2GWJA 4JI2K 1E3MA 3GV8B 3HTVA 5C15A 1VHIA 4EBCA 3MUTP 3AARA 1VQ4N 1UVNA 4ERDA 2NPFA 3IRXA 2GVDB 2XY8A 5AQJA 2AGQA 2HF3A 4OJ3A 1MU2A 1HNWK 3VHQA 4DG1B 4LVNP 1VAZA 1HBUB 5F3TA 1LV5A 4ITSA 4L76A 1FD2A 1N32J 2G8IA 3FBBA 1HNZJ 3TSUA 1TUGB 3AVKA 4BRMA 3H0PA 3C0BA 1HBOA 1RTJB 3OVNA 1ZAWA 4K7QA 1TKXA 2Y8WA 1FJGK 3RBZA 4N47A 2E6LA 5IT9O 3LGMA 3DOLB 1EB0A 1T02A 3MI7X 5K8NA 1FJEB 4DTMA 4CO2A 3D7EO 4EHTA 1OY8A 4JI3J 3NGZA 2CQBA 2CPXA 4IKAA 3CCUN 3DM2A 2J9DE 3G87A 1V3RA 2B9YA 2XWXA 1QTNB 4WP3A 1WKKA 1WF2A 2ZF5O 4I9LA 4ZJLA 3GBTA 4Y3CA 1GX5A 1Q16B 2X7IA 2YNFA 2GQCA 1WLJA 4FSVA 3TYTA 3PX4A 1FK9B 1LW0A 4CJSA 1TFYA 1FK9A 2RQMA 4ELUA 4FM0A 3B4MA 5HVHA 4TLRA 2WHOA 2QL9B 1Y5IB 3TVKA 3H2UB 1S1VA 1BWVA 2IBKA 2RQ4A 2HWTA 1VQ5S 3ELHA 1RKIA 1NJIT 1YI2S 3E8OA 3HX9A 3CPWM 1GXLA 3L0QA 2RILA 2JLFA 4DUYJ 4HHUA 5ETSA 1FRJA 3HPGA 2E4LA 4YMEA 5DM6Q 4BACA 2FLNA 1RHUB 2ITMA 3QETA 3RBXA 3THWB 3BQ0A 2KVQE 3IA0A 2YKQA 2OSRA 4KC5A 4RTFD 3POTA 4OYMA 5D4PA 3Q8VA 1WNEA 4CH0S 3FZLA 2K8GA 3L4BC 3US5A 1WBDA 2NZCA 4DV7J 4FKYA 4DV1F 1KHWA 2G13A 1FRIA 3P83D 4K0KK 2DY4A 5A8RA 2Z56B 3GDQA 4BR4A 1HQEB 3AVNA 2X1BA 1Q7LB 1KLMB 2YQ3A 1N34F 5HJXA 1WHVA 1I94J 5GAGU 2BUNA 3VQQA 3IBWA 5HRRA 3CB4A 1D9FA 1RAAB 2C3OA 4MO5A 4FJMA 2MMYA 5DRKA 4AM7A 3QO9A 3CC7N 5ETLA 3JTNA 4JV1A 1T8EA 5HROA 4RX6A 1H0HB 2GQ2A 1FXRA 1YJTA 1OVQA 2YWGA 3MM7A 3FSXA 4RLEA 3OJSA 3W9HA 1N4LA 2VB6A 1BIZA 4TY8B 1TV6B 3IBCB 4OYZA 4WCEQ 3V9SA 4YY3K 2ZM6K 3TVZA 1H38A 3PR5B 2DR7A 3BPSP 4RW6B 3N6MA 5J2NA 1WELA 2EPIA 4BS2A 2CPDA 3M8QB 4K4TA 1GOBA 1HWIA 4OKJA 1NLVA 3MUVP 4J9LA 1OMSA 1HWUA 3CJCA 1V4TA 2P9SB 1LFPA 3DRSB 3GMGA 3FGVA 1BLUA 1U26A 1FEEA 2DIUA 1RDCA 4ZLLA 2KKHA 1H2TZ 1OSCA 4CIGA 3ENVA 3HJVA 2D9PA 4YDXA 3K9JA 5CQGA 3HHKA 1HNIA 1S0VA 5KTQA 1W2BR 3MCAB 1JMTA 2IHR1 3RU0A 2I7NA 4JI8J 2VDIA 4UOFA 1CXUA 5H9EJ 1IKXA 5J2QA 3C6UA 5IT9Y 2OFHX 3HYFA 3VGUA 1ZM3A 3T1HF 1NGJA 1ITGA 1F60B 3WC0A 4IDKB 1IR0A 2CGKA 1IBKK 2VFVA 5A8KA 2ZUAA 1RBOB 2Q43A 2N3OA 1BGXT 4IOAL 3S3NA 4J37A 1UEUA 3D0GE 3R3TA 1D4XA 3FEXB 3CG7A 3JYTA 4PG7A 2DIVA 2DK2A 3M8WA 4EI2A 4C6AA 3JAMY 4CJUA 2MKCA 5IT9U 3ZSWA 1LWCB 2ZGZA 1UZHA 3MF5A 1SL1A 3P5TL 4M5GA 3NLCA 3ZT4A 1TL7B 3DXMA 1REVB 3U1MA 4HHJA 5L1LA 3CJ1A 3P96A 3M8PB 3AODA 2DB1A 5F8MA 3M8QA 3AVCA 1Y64A 4BR2A 4CEEA 1KQSR 2DNYA 2BZ2A 4DR2J 4CO5A 2XZDB 4M3TA 3SCKE 4EHUA 4Z4CA 4X4PA 1RT2B 2HVDA 2Z2ZA 4OX8A 3HVTA 5CYMB 4OJGA 3G9CA 1XMOF 5CZXA 1WNSA 1IJEB 4UY8T 1ITPA 2FZCB 1IKYB 4EZ9A 3GR0A 1Q8IA 3KYLA 2DR5A 4CIOA 3TX0A 1FDAA 2HMPA 2DY9A 2ZH3A 4A47A 2QSWA 1JX4A 2W7PA 2UUBJ 4I6AA 3GCWP 3VQDA 3NGUA 1XR6A 2J4RA 2BYCA 2RHKA 2G0JA 4FZXC 3AAPA 2P9IB 5K14A 5CD4H 2IGIA 3EVOA 2OH2A 1RB0A 1JL2A 1BQMA 4CFAA 1ZBFA 4NA3A 4GMJB 3MDQA 1S6UA 5HRSA 5GVQA 2CQIA 2MGZA 4RW9A 2A2DA 1RAOA 4ETXA 1URRA 2CYYA 4DV6J 2RH3A 5CAAA 1ASVA 2AIRB 2RN2A 4AXIA 3EY1A 3BN4A 1G4CA 3MXJA 4OZ1A 4C2MA 4ISEA 1NGIA 3U3YA 5L9NA 1B7YB 2HFOA 2DXEA 2F65A 5GADU 2CPJA 4B3MJ 3CJTA 3RBDA 1CJVA 3MPWA 2RE1A 2JRSA 2W2QP 3GIMA 2MJUA 3I5CA 1VQPN 1NK9A 1JB0C 5LXRA 4ZPBA 5KQ8A 3O8MA 3LQVA 2WVDA 4DTSA 2FGOA 1ZBTA 3EE9A 1HJRA 2B5JB 1GXUA 2HHHK 3AQPA 2CNOB 1LNQA 3R6MA 3QDKA 2RF2A 4FWLA 3AJDA 3SCJE 3KK7A 4IO1A 1SJ1A 3EL2A 2MJNA 3CC2S 3OXFA 3VQTA 1N5QA 2UV8G 1K6YA 4DOZA 2AZ3A 1RFQA 5AE3A 2QL5B 2K1RB 2E1PA 2ZEJA 2PGCA 4GVMA 4B3RJ 3IAYA 3GYGA 4JV5J 3NAHA 4RUBA 3ZTSA 1N48A 2EK6A 1UOCA 1YSJA 4ZTFA 2XMUA 2UUCK 3R7NB 3MD1A 1NGFA 3H90A 2R7TA 3SI8A 2MQOA 2VWKA 2HLUA 4Y1CA 3T7ZA 3L09A 3DYAA 4DR2F 5CE3A 2VQFF 3ZTOA 3DU6A 2BE2B 3EVWA 4RW4A 3LWLA 2ZGYA 2CJKA 5M1FA 4F02A 1VSJA 3TSPA 1VOMA 4C3LA 1I6JA 4ZP7A 3VERA 1EWQA 5CYJA 4KBOA 2BMBA 1ZS6A 2BW2A 3DHWC 1JLFA 3CCRN 3D0PA 3VAGA 3DOLA 4FNIA 4CE9A 4V1Ak 1RDWX 2CPEA 2W8KA 1YBUA 1K9MO 3SUNA 3FNNA 3A8KA 1SKSA 1UKUA 2QWQA 2GV9A 2UUBF 4BRIA 4ED3A 2E5HA 3N28A 4N76A 1S10A 3O9QA 3PRBA 1IR2A 4CGJA 1ZZNA 1KOHA 3IMXA 2CQ1A 2HQIA 5AXMA 4DFPA 1ZBLA 3VGVA 4JHDB 2A5XA 4FXWA 5FPMA 2QFJA 3VALA 2DGUA 2WB4A 2CNLB 1S7HA 1MMDA 3CJ9A 3FBCA 3A3PB 1N88A 4ATNA 3O8WA 2VQEJ 4Q8EA 3TUPA 3WXJA 3VQ6A 2VA2A 4NA1A 2J76E 3TNVA 1QAJA 2XQCA 3HOSA 1UAWA 1ZOTA 3EN9A 3I96A 4FOEA 1QSYA 1N0VC 2XULA 3G8SA 3OYBA 1QVFR 2R7SA 4BQLA 1DLOB 3TAMB 3NCQA 1U2RA 1YBAA 1R3NA 4YN3B 3MECA 1VSLA 4A8KA 3W2WA 1RT3B 2UXDF 3MN7A 2F4VK 1VJWA 4AHCA 3M1FA 4EZ6A 2ZOFA 3POTB 3MR7A 2EI5A 3R5GA 1WSIA 2FTRA 1KN6A 4DR6F 1KVCA 2DHHA 3W5YA 1XBWA 4IOCQ 4JRQA 4URGA 2EVZA 3ZSQA 1SXLA 3CPWR 4CF9A 3D68A 3SFGA 5KG6A 4XH5A 1B70B 4JYAK 3BH6B 4UOGA 4FJIA 2N82B 2VG7A 4JI7J 2HRTA 3UDVA 4X62K 4C0OC 3ZT2A 3W5ZA 4DCJB 1RCOB 3DLEB 4E7HA 4DX7A 1QZ5A 3RB4A 2R7VA 4MK9A 1XR7A 3Q8SB 3AVLA 3SQ0A 4CF1A 1EP4B 3HXMA 2N4DA 1TYQB 2JWNA 2ADBA 5J2PA 3DGPA 3CQ8A 5AXNA 1I3AA 3FE1A 4KHUA 4P2FA 2X51A 3W3DA 2FJWA 3G0ZA 2F63A 4AFFA 4FJGA 3NVMA 2IAJA 3JS9A 1SC3B 4CZIA 1CSJA 3BREA 1EARA 4PWWA 4R25A 3LPTA 3B6BA 4LBIA 3IM9A 5KFCA 4KPYA 3MAHA 2YXLA 3I55N 4JKDA 3AOCA 3DRYA 3IAS9 4X66K 1D5AA 3N01A 4DQIA 4FWNA 4CK3A 2JEIA 1RAEB 3AO2A 1RTDB 2CQ4A 3QMLA 4JV5K 2HBKA 4ED1A 1TFWA 1W7AA 2ZITA 4CJTA 2HK3A 4PXCA 2LQ9A 3QFUA 1DQ8A 2ZWOA 3CJQA 2PYLA 1MROB 3ISNC 2MKYA 4G3IA 1RAFB 2E5LJ 2P51A 3L3UA 3LDQA 2B7CB 2C2DA 1DTQB 3R9PA 3SMPA 4C9DA 2W7AA 5KOXA 3HDSA 2FUG9 5F9NA 1R31A 2HGLA 2IY5B 2NZTA 1FKOB 4KH1B 4CD3A 4HHTA 1FT8A 1P6TA 1RGVA 3BZKA 3KD1E 4BREA 4CZHA 3VN5A 2IJNA 4PYAA 2ZKUA 4F26A 5C2DA 3C16B 3KLHA 3VZHA 4IDKA 3I9V9 4HACB 1W2IA 4I6YA 4H0PA 4PWDA 3KLHB 2YPZA 2ROEA 5DG8A 4I69A 4B9VA 4H03B 3P6YC 1YT3A 3CMAN 3KMSA 4ZVSB 3QIOA 1RT2A 2MEWA 4H4MB 1CJKA 2F9TA 1KQFB 3I4HX 4AE5A 2WCXA 5L1KA 5AQOA 5DM7Q 1DFDA 4O8KA 3K17A 3ID8A 2XMTA 2BX6A 4OPKA 2FSNA 1OIAA 1F21A 1T3VA 4DV0F 4CGDA 3QEXA 1VQSA 3BF1A 3OYDA 5D3GB 3R1HA 2YX7A 4O44A 1RBAA 3Q22A 1RYRA 2LQ8A 1HBNA 2N4CA 3E2EA 1EX8A 1MWZA 4ZLPA 1JCGA 2RQCA 3M8ZA 2X74A 3ZSRA 4CLFA 1X60A 1T9WA 1RHQB 3P3DA 2Z1JA 4DCOB 1MW7A 4NASA 3J7ZO 3JSYA 3KHYA 2C22A 4LSNB 2PI4A 2W2NP 3ZX3A 2YNIA 1T95A 3TAQA 3ZEUB 4GMKA 4OHVA 3VVTA 2XYGB 3SAGA 1MMLA 1LWFB 4ZA1A 4CZEA 1TGOA 2EW9A 3HSGA 4ZN1A 1E6YB 1SH2A 3SQ1A 4QWCA 4CEZA 3M7VA 4NLSA 2EBGA 1S6PB 3HMJG 4DF8A 3EGWB 3B8AX 1Z25A 4GY2B 1XNQK 4U7UD 3WBZA 2KFZA 3DLHA 2PN6A 4USVA 3RAMA 4M5KA 4OPJA 3C6UB 1WSRA 2M8HA 3H4DA 1Q18A 2M7SA 3IN5A 3J80Y 1PG5B 4DXLA 3EVMA 5A0YB 2QJ3A 3WT0A 4OHXA 5FJ4A 3PACA 5CXTA 3MK6A 1WOQA 3DDKA 1Y0HA 2V8HA 2E9RX 1QY7A 3ZT1A 5F1XA 1N5SA 3EO3A 2HKEA 4X62J 2XLJA 4DL2A 2IMOA 2ASDA 4CJPA 2XGPA 3V6DA 4YOEA 4BDZA 2P9LA 2QEXN 1TQLA 4LF5K 4B3OB 4KTWA 4WP9A 1GH8A 3LZIA 1CJTB 3MEGB 4DV6K 3CSKA 2DY1A 3CJ2A 5M2PA 4M5DA 3T3FA 3TAGA 3FSYA 3D6FB 4OJRA 1S0OA 4A2AA 1TUVA 3V81B 4CLLA 4B9MA 1KC8O 2A3JA 3ULEB 2FLLA 4DU4A 3KTQA 3TAMA 4B1WB 5IZHA 4FWOA 3FMWA 3M9MB 4DI6A 3JS6A 4ZLJA 4DFJA 2QWPA 3I5AA 3LP2A 4X4VA 4WYLA 4Z7YA 1N6QB 1WEXA 2H4YB 1OH8A 4DSKA 1WSGA 4EFAC 3CCMS 2GIFA 4USIA 2A40A 4DLEA 3RZAA 4W5NA 4O0NA 2HSTA 1FKPB 5KFLA 3R27A 3QZ7A 2V67A 3LDNA 1U6ZA 3MPVA 3A12A 4MMOA 5C25A 4UW2A 1LXJA 4TYBA 5DZ6A 2UXBJ 2DTJA 3K58A 4AD6A 3FZ2A 4G6VB 3G82B 3KLVA 5IWAF 4J9UE 1SJ4P 3QRQA 1D8ZA 4KGXB 4JYAF 2G8FA 4PHTX 4DR4J 4RU9A 1HPZB 1U1LA 3HHNB 1NB7A 1S4EA 2FVQA 3MR3A 5GMEA 2CQHA 1WSVA 2BTFA 1BCMA 1OPZA 1U45A 4CCHA 5HP1B 3CNQP 5KFFA 4RCHA 3ZZYA 5AE2A 2ZC4A 2K06A 4M42A 5BYRA 2FY1A 3HD2A 3HSTB 2BUPA 4B3SJ 2V68A 2YHBA 2WVFA 1WI8A 4PY5A 3IRXB 1ZH5A 1LOUA 4DL6A 3ULEA 4LIRA 5JLHA 4YR3A 2VASA 3UW1A 1RDDA 4DKWA 1Q5YA 2IDOA 2P9EA 1RCXB 3UDLA 3JTOA 1S9EB 3M6VA 4N8NA 1LK7A 3I82A 4TXSA 2BJDA 3VETA 1YTAA 3QZ8A 2I1RA 1UFLA 2VBYA 4OYXA 5ETKA 1BU6O 4DV7F 2FC0A 4WFAL 1QS4A 3OR2A 1FESA 4DR5F 4LH5A 3AO4A 4G1IA 2V5HG 3NVKA 5F2RA 3D66A 3CMES 4LUBA 3QINA 2R4FA 1HNVB 2OD4A 2P9KA 4H4OB 2V50A 4OZ0A 3CJSA 4LJMA 4JI0J 4WFZA 1BHNA 4JI1J 4BBYA 1CULA 4BR9A 3GJTB 4CM0A 4BRHA 1ZTTA 1CULB 4CFDA 3ATUA 1NJZA 2DNLA 5KFQA 1RT3A 4X64F 4RU2A 3QIPA 2XMMA 1KLNA 2XI3A 4BDYA 3EGNA 1EP4A 2V9WA 1T3OA 1NHVA 3EDQB 2JGUA 2W6LA 3DXSX 3TZZA 1GLDG 2BVZA 1PKUA 2IC3B 2ZBCA 2K7JA 5GIOA 1UFWA 2HS4A 3O80A 1RP5A 2LDYA 1VQOS 4P73A 3GE1A 1FHTA 3KHHA 5JVGQ 3LANA 1APSA 2O4IA 3BYRA 3M2UB 4NLBA 2ZH6A 3VQ8A 4FYYB 4AHSA 5A2QO 4WQ4A 3I56N 3BPDA 1TELA 1U0HA 3R8EA 4OYIA 1YX2A 4YDDB 2NPIA 2I38A 1HWLA 3PM9A 1H3DA 4I64A 5E3QA 3UN2A 4WFNQ 2AJ0A 1JXEA 4LF5F 4NLQA 2G8UA 3VZIA 2VYPA 2J0WA 2HHPA 2FVSA 3L9ZA 2A1RA 2UXDK 1R6YA 2UXBK 2HHTA 5E3PA 2QLJB 3BGRA 3IGVA 1L3TA 2ASMA 5AQGA 1KR4A 5C2CA 2EWHA 3WXKA 1VHFA 3GIJA 2F8MA 2VKZG 2P9UB 2HBLA 4NYFA 3J7YI 3HI0A 3Q24A 4GRSA 2CPIA 3VAHA 1RGIA 3CCES 4FM2A 4ZJQA 2YH0A 5D0EA 4JKCA 1C0TB 3OTOK 4CLKA 3NNAA 3D67A 3WDOA 4KY3A 1YJ7A 3K8VA 2Q66A 3VQAA 1X9JA 5HRNA 2CADA 2KM8B 4GO5X 4K2JA 4K42A 5T14A 4ECVA 3F56A 2BW7A 4DHYA 2PE8A 2CJXB 3QWUA 4YY3F 2ZM6F 5DETA 1Y4ZB 4OKKA 1Z05A 4CHZA 2KHCA 5LT5A 4A48A 3LOUA 3SUQA 2JVOA 3V5RA 2GELA 1X9WA 4GO7X 2RU9A 1N0UA 3M5RA 4M3XA 4BRAA 1GLEG 2OMOA 3CCSN 1S6QA 2GJ2A 4W92B 1LWCA 4Y65A 2V4JB 1O0PA 3DOKA 4PA1A 3WZ0A 1Q78A 3FBFA 2JFDA 1JXBA 3CDBA 4WPAA 4WP8A 4P2MA 1TL3B 3LGNA 1TUWA 4DV0K 3MPYA 3UDCA 4ID5A 1EIYB 4I2QA 3C2PA 5FPDA 3S9HA 2C1EB 4UTGA 1IBKJ 1SL0A 3LPUA 1RWVB 5C24A 3ICLA 2WSFC 4P74A 2O8EB 2QO3A 2H48B 2KYXA 3TABA 3SNNA 1NPPA 4JKEA 3DAWA 4JI7F 1Z1ZA 2AV5A 2IRYA 2DT9A 4RL1A 1HNWF 3VF0B 5KFEA 2B4UA 1RHRB 2PMHA 3DI6B 1Q86T 2RRNA 4RKUC 3VEVA 3KK2B 1ZAXA 1VQPS 4IFVB 3O5BA 1ZPVA 4KAIA 1TVRB 4MJKA 3SDEA 1KTQA 1RWKB 1IJJA 2V8GA 4CGHA 3MDFA 1PJ5A 3SCIE 5JVGL 2LU2A 2OA8A 3HM9A 1K0VA 3TU5A 2G2YA 1U1NA 1OWXA 2XMVA 3H6EA 3CQXA 2WOMA 1YG0A 2P9PA 1J27A 1O5JA 3MR5A 4M5HA 4AUKA 3OS0A 1XMOJ 3FZBA 2HBYB 3MEDB 4CYUA 5E26A 1Z2ZA 3FQKA 2LDIA 3KNAA 1HRHA 4FZYA 3QPIA 2QA4G 1AXQA 3OTOF 4KTZA 1J5OA 4CT9A 4XTTA 1WUUA 4KV8B 2OTJN 5A76A 3FKBA 2XCAA 4FF3A 3NBPB 1B0TA 4QS9A 5KPRA 4J9MA 4P71A 1W9HA 3Q8UA 4M95A 2C3PA 1IXKA 4WIQA 2VJVA 3AVJA 3KJFB 2U1AA 3AH6A 2I8EA 2PIIA 5CCLA 3SSQA 3R2CJ 1CVJA 4MDBA 3BN7A 2F96A 1CLQA 3D0HE 5BXIA 1VBYA 1JNZB 1D0EA 2GUPA 4PG6A 4CJWA 1NDKA 4KE5A 2DJWA 2JFKA 1JLCB 1RUSA 2GO9A 3A5OC 1EXQA 2QMWA 5GAHU 4B9NA 3ZO7A 3J7Z5 1WOSA 4X65J 5DGBA 3G2XA 3OR2B 4K8RA 3SI6A 2K1RA 5CYQA 3MM9B 4OHWA 1CEZA 2D1CA 3SK3A 4XH1A 5JLFA 2NCKL 1SIWB 1TKXB 4H4OA 4MLEA 3AO3A 3P31A 2VONA 4E1MA 1RAGB 5HI7A 3M2VB 1S0NA 3FQLA 1W2BM 4H0VB 4KB0A 2J7UA 3DFEA 3FVYA 2P9PB 1VSEA 3RGIA 1U6BA 2O8BA 1VSMA 1JLQA 1LCUA 1FTRA 4GKJF 1J6ZA 2CH6A 3PZPA 1CQMA 3BYPA 1EQMA 4YOUA 2CRLA 1S6PA 4P75A 1HHQA 4O23A 1S76D 3NXZA 3RRHA 4B3TK 1HR0K 5HANA 5HVFA 5ETVA 3HKZD 2DH7A 3A1YG 2DFHA 3C14B 2A6OA 1YUWA 1JLFB 3PVXA 4DN0A 1KTVA 1AZSB 2POKA 2ZFHA 3VQCA 2IDEA 4B1XB 2YQ0A 2LSNA 5HMZA 4OZ3A 1VQNN 4EYIB 4DV5F 1D8YA 1IBLF 4YDUA 2DR8A 2W6KA 3QQCD 2RQKA 3P39A 3IFRA 3FGUA 1UJ4A 4JHDA 3ZETB 4ZCIA 2OPQB 3PIOL 5J1NA 1JLCA 2WVCA 3LALA 4OYPA 4OZ2A 4OHYA 2QYGA 5MLCV 2CXEA 2M8DB 3SQOP 4C0HA 1RILA 1U2VB 4R79A 3E66A 2W9AA 2I6WA 3FZMA 4OYAA 1CQNA 4TY9A 4AHTA 1Q8LA 5LM7E 3UB5A 5K8MA 3B6PA 4QS7A 2DISA 2RSQA 1S6OA 3DLKB 1AUDA 4Y2KA 3I8BA 9RUBA 4BVPA 1VIXA 5LMUF 1VDHA 1EKRA 4K8ZA 1WC6A 2YWFA 2GWKA 1HYSA 4DR6J 4JRPA 1BE4A 3D3CJ 3K0JA 1U8WA 1HKAA 4OI1A 1T05B 2MY8A 2V9KA 3MXIA 2V6AA 1YQHA 3PYDA 1NKEA 3W2WB 4V19S 4EBDA 2XNRA 1FD8A 2B4JA 5HL7L 3KG1A 3SQ2A 5KG1A 3JXOA 5BPMA 2Q6CA 4F4YA 3OTEA 2D1KA 2QTWA 2AEJA 4P2SA 4AM6A 4BG8A 5HQMA 2DITA 1QQMA 3KFWX 5C12A 2OPPA 2GCFA 3DRRB 2OTJS 1UETA 4CLTA 1KVAA 3GPAA 1XMOK 1N32F 1Q53A 3AA2A 4YOTA 3M1VA 4Z4EA 3U9ZA 5B8HA 2CPFA 1SQEA 2PYJA 3L4IA 4ZPVR 3RR8A 4W4MA 4JI6F 4JYAJ 4FJLA 3NGDA 3GSIA 4RBTA 1SC1B 2NYHA 4DMNA 2C3YA 4KT0C 2A41A 5J2NB 1XQSC 5GADP 2X78A 2VOPA 5BN9A 4YB5A 2HHWA 1YLXA 3ZC4A 2VZ9A 3DLGB 1A9NB 3MN5A 1DJ0A 2WBMA 1H72C 4YHHK 4FLXA 3TZXA 2HNZB 1NJIO 4CEFA 1IKYA 4PWUA 3FZFA 4DUZK 1XNRK 5AQFA 4U96A 2R8JA 3PJ9A 4XPCA 1KNZA 1TKTA 2E44A 2OEMA 3P4UB 2FIUA 1S72S 3UVJB 2XEXA 5KFWA 2QLBB 3U7JA 3G6EN 2BH1A 3I0RB 2KL8A 4KGZB 5F8IA 1PGZA 1HBNB 3CFRA 5A2QU 3OS2A 1S9EA 5EX0A 2FB0A 3CHWA 2LXIA 2DNRA 4NA2A 5AQWA 5KFGA 2ACMA 2DGVA 3MMJA 2G1DA 2XNQA 4Q7AA 2XZWA 4B3RF 5M1QA 1VQ7N 4C3KA 4F50A 2G8HA 5CHCB 1FEHA 3HRGA 3KOAA 3R97A 5TKYA 1YDLA 1U1PA 2V52B 5C2FA 2GC8A 3ZLJA 2JC1A 2E2NA 3PJXA 4FM1A 4TU7A 3IS9A 4Y1DA 2WSCC 2CVEA 1XERA 2A6AA 3AVFA 3THVA 3OHRA 4D3HA 5D0RA 4F0MA 4DV2K 2BQ3A 2DNGA 5LMNF 3EE8A 4NLCA 4HACA 3C3LA 2R3VA 3V4MA 3AD7C 4RNHA 4Q2LA 2OLWA 4KI4A 4ZCMA 4PWDB 4GNIA 3C8YA 2QWNA 5AQTA 5HJYA 1CJKB 4YOXA 4FJ8A 5DG9A 2EG2A 2XHWA 4R8UA 1WKJA 4AHRA 5I9EB 1FA0A 2CPZA 3H5YA 4LF4K 3E01A 1YZ7A 2OFGX 4P6QA 3ONQA 3LF0A 2HHUA 1SQGA 2IOCA 1S1TB 4AF1A 5EX3A 1S9GB 3BGLA 3FCWA 1LQ9A 2GVZA 2GBZA 3DDIA 3TJAA 4FS1A 2Q3SA 3M8PA 2ASPA 5KFSA 1JJ4A 2HFNA 3F0NA 1VBXA 2OO4A 4DR2K 1VBKA 1YGYA 3M32A 1IVZA 3HI9A 1KD1T 4NLRA 2QWMA 1R59O 1GLLO 4BC5A 4K25A 4DG1A 3VQSA 4CNZA 3SAFA 2E9TA 4IG3B 4CNYA 1I5OB 4PAAA 4NLTA 2EFGA 4USWA 4WTYA 1HBMA 1TP7A 3I87A 3S8SA 3AY0A 4TN2A 2MKHA 5KFBA 1K1QA 1IBLJ 1RT6B 2ASLA 2R7UA 2W4DA 4YB1P 2IBOA 3AQOA 2VQEF 2Q0RA 4C8ZA 2ZH5A 2ZBRA 4MTPA 3VGKA 1V3SA 4X64K 3ID6A 3I8DA 4U7CA 1S77D 3W8GA 4CJLA 4GKJK 4ELVA 2C2RA 3C16A 2NXCA 1KQKA 2C3MA 5KFUA 3F9KA 1CZ9A 3NCIA 1O8BA 3EWGA 4EMDA 2VC0A 1HI8A 4QYRA 5AQHA 2JJ4D 2ZH8A 3H1VX 5KFPA 3UKRA 2JC0A 5K9FA 2DH9A 2FYXA 1PBAA 4YY3J 2ZM6J 2HHQA 4RNNA 2M88A 1KXPA 3PX0A 1VQLS 1A5XA 3D2FA 2XO6A 1VQ6N 2FGCA 3OTBA 3K5PA 3CCLN 3ITHB 4YHHJ 1XQIA 5GAHI 1KFSA 1NMEB 3M2RA 3FZKA 1Y7PA 4LR8A 2XWYA 4H0YB 1CJTA 3R7BB 2RF2B 3TTDA 1VC0A 4NMLA 1BUXA 3RSEA 3HK2A 1U6FA 3BEXA 4IFEA 2AQ4A 2VF3A 2C28A 2O67A 4A61A 4LRDA 4NZ0A 4FDFA 3NH1A 2HHXA 1VSKA 4M8LA 2KXHA 3M8YA 2XB2D 2NRHA 3O4QA 4BR7A 4KPCA 4KFBB 1NEEA 3OVSA 3MFIA 4BC2A 3RJMB 2IA0A 3LM2A 1WG1A 4DV4J 5BPNA 1S99A 2HRYA 3EXYA 3CF5L 1OQ3A 2DGWA 4CJFA 4FCYA 4M7YA 3CJ4A 5ADZA 3D1QA 3ZZUA 3QWPA 2HNYA 4ZHRB 2QL7B 3CC7S 1R6VA 2G0CA 4P7TA 3CDUA 2YI1A 3WEEA 5IC4B 3CJBA 3OFEA 2CQGA 4MIAA 1LWXA 3QMQA 5D15A 3DNCA 2XS7A 3I32A 5C42A 1M5PC 3GQCA 4LF4F 4RW9B 4I7FB 3D1OA 1OVYA 3OR1B 1PYSB 3CCVN 5CA5A 1XWLA 3J7A1 3VQ9A 5HATA 4E1NA 3QIPB 3QLHB 2KZMA 4BROA 2W01A 1IQTA 1L3SA 2VD3A 2HPUA 4DL7A 2FZGB 2LFVA 3DOMA 3D9BA 4KJIA 2HSEB 2UU9K 4FJ5A 4K4UA 2PA8D 4A57A 3QT5A 2BQUA 4H4KC 4CD1A 1PYOB 1YJVA 1KVJA 4UT4A 3JQMA 1YTUA 3T1YK 2PMZD 2CA9A 1Q0NA 4P7VA 3CM5A 2XRIA 2FJAB 2YKNA 4QIEA 5AQKA 3J81U 1WC1A 3IRWP 3UVJA 4A59A 3M9OB 4PKIA 2DNHA 1AROP 3OTDA 1ZAVA 3TRGA 2ITGA 4BRGA 4MT1A 1TL5A 4DBQA 1ATSA 1NK4A 4O3PA 2ZOMA 2VODA 3RMBA 4NLYA 5KT2A 4NXNK 2A6MA 1DBDA 3THWA 2KXFA 5IM0B 4CJQA 4ZLNA 5E5NA 5LL6Z 2PD1A 3RAXA 3DLRA 1RT1B 1ZZFA 2MQQA 4MFBB 1GTHA 1Q5VA 2ZOGA 3MM5B 4NE9C 4M41A 3OYMA 4DPTA 3PYFA 2VFRA 3KG4A 3ZZTA 4M5NA 4IH6A 2WONB 1NZAA 5GAEI 4IXCA 4FZVA 4MLHA 5ITHA 4J2EA 2PFDA 3NNHA 3PIOQ 3JXUA 1NK8A 3UI3A 3AOAA 4JI1K 2ASJA 1UVIA 2APOA 4R5PB 4LR9A 1M5VC 2KFYA 3CCQS 2HEKA 2NRVA 4WXOA 2D3ZA 3VQEA 2A2CA 3MMAA 1GEHA 2DPJA 2HVZA 3IM8A 5LJ5Y 2QEXS 2NR0A 3QAUA 5E2QA 1RACB 2Y9HA 1ASWA 1TZ0A 2JWKA 3S3OA 2EHGA 3CCEN 3MM7B 3HSDA 5GMKa 5EDWA 5KRSA 1RI7A 4DSLA 1FJCA 2BJ1A 4IOAQ 2Z1IA 2SXLA 5L46A 1NGGA 2P1JA 2HWIA 4WYBA 2RRBA 4BLGA 4DV3K 2V4JA 2ZJQL 4DV4K 1B4SA 2O8CB 2BKNA 2E1MC 2OKQA 1EO1A 4JI4K 1Y5NB 1DTTB 2DHAA 3W9JA 3U8XA 4ED4A 3LWMA 3G6ES 5G0RB 4A46A 3MEEB 4FJHA 3DLLQ 3HVTB 4N77A 3MM8A 4JI3F 4KSEB 1M1GA 2E1RA 1HYVA 3DGVA 4AL6A 4KO0A 2IVOA 4HCBA 4WIIA 1VI7A 5J2MB 3P1GA 1F2HA 4LH4A 1RWOB 2J0XA 4USHA 3H42A 3BF3A 2GO8A 1WSJA 3MZIA 3D6TB 3C6HA 2UXDJ 1WI6A 3ZNUA 3A3NB 1T9UA 1UTAA 1JL1A 4ALZA 3O2IA 3CJ7A 2JVRA 2J8AA 2BKPA 4ECYA 4M5IA 4Y28C 4C8YA 5E7OB 4TKTA 5KI6A 1VQ7S 4EP4A 4NO7A 4L8RB 2LVWA 1I39A 3Q8RB 5GAGI 5L38A 4KH0B 1N33K 1C6VA 1VSHA 3D54A 4GKKF 2LXFA 5AQYA 1FVQA 2JNJA 2GV1A 1HD0A 1NK5A 5M2RA 4KRWA 3ZSVA 2NS1B 3NGKA 3DRRA 2QA2A 3JYTB 3J7AP 4LRCA 1Q81T 2IM3A 2L41A 4IYQA 2AD9A 3TA1A 3D3BJ 4ZCKA 3B8HA 2VFSA 4DR6K 5M1NA 5IFMA 4BY9C 1RA7A 4DV3F 5JUMA 3FMBA 3FJ2A 3ILJA 3OYGA 1URNA 4J8FA 1HJOA 4OZNA 1QM9A 1Q79A 4DR1J 4GVBA 3H8YA 4LMZA 2A1SA 3OHAA 2KZZA 3IMQJ 3BSNA 2DRBA 5L1IA 4K0KJ 3ZTRA 2OYQA 2F4FA 1VK8A 4DU1A 1T6DA 3NS7B 2HQFA 2WTUA 3SV4A 2B9WA 4JI5F 5HO4A 5KT3A 2GIQA 3BSAA 4NI2B 1TR0A 1Y97A 3G6VA 1FKPA 1RNHA 4XO0A 4G9ZA 4ZVFA 4FLVA 4E0DA 4LQ3A 4FXDA 1E4FT 1SH0A 1RTIB 2ABYA 2P9IA 1PILA 3PKMA 1UEVA 1RTIA 4ES2A 2QKBA 3PYEA 2VG6A 3SPYA 4W5OA 4DTXA 1IKVB 2J8SA 3OR1A 3CCVS 1RAHB 1HQUB 4ZIVA 2H54B 4YS2A 5HMWA 2MHEA 3U1LA 5AFUH 2CG8A 3MOZA 4Q2MA 4QWEA 3CC2N 1C1BA 4A4JA 1RTJA 2KKZA 2GJIA 1RABB 1SL2A 4CHQA 2HNDA 3KG0A 4AQYK 2BANB 3VQ4A 1A7GE 3TUZC 3R3LA 4K4XA 4JI1F 4WK3A 5KFXA 1B99A 3QRRA 3SMSA 1IBLK 4JD2A 3OYHA 1X31C 2Y1IA 1KS2A 4KR0B 4Z7CA 1F5CA 2BBEA 1TK0A 3BO4A 4J2DA 3D2WA 3Q7BA 3PLAA 1S59A 4GVLA 1LWEA 5RUBA 4FLYA 1ASUA 4XIUA 2CG4A 3FDSA 4ZITA 3N4PA 1YRUA 3RUBL 3V6DB 3VA3A 2D0BA 2HVIA 4C8MA 2V4QA 1NH7A 1NDCA 2FZKB 1N52B 4FBTA 2NYIA 3G96A 4NXMF 4WKRA 1WOPA 2LKZA 2YVSA 2F4VF 3EUNA 4YOVA 4LF2A 3RG6A 4QR0A 3KK3A 2HIQA 2PEBA 1VRUB 3CIZA 1F9EB 3MM5A 4UQGA 4QWDA 4AH9A 1IM4A 3Q8YA 4B1UB 2O8DA 2EFPA 3LP2B 1OH5A 5LSLA 3HFZB 2QWLA 4CJ4A 2FF6A 2BJ8A 3OXGA 3HP9A 1SV5B 2LLZA 1OS5A 4DSFA 3ZCMA 1YIJN 3KHGA 4JI2J 1VYAA 1WG5A 1ZBHA 1MDUB 2PC6A 1RT6A 4DL4A 2AP6A 3NE6A 2GMJA 3CJ5A 2EC2A 4OI0A 3IG1A 1X5SA 4LF7K 1M5KC 3D6RA 4OX9K 4CEDA 4WCEL 2RKIA 4C7QA 3Q86A 1LW0B 2CPYA 2DGTA 3AY9A 3KD5E 1OPIA 1PSDA 4EP5A 2FJBB 1XMQK 3AA8A 4BRLA 2YHXA 3QAEA 4BR0A 2MB0B 2VIHA 1X5TA 3SSSA 1WACA 1K9MT 1QAIA 4NLOA 4LF6K 1XR5A 2B8PA 3ENAA 2RT3A 3GSDA 4CZLA 4QYZK 4AHVA 2P9LB 3CCWA 2JOQA 4ED2A 2YY3A 3FCHA 2K3IA 1LW2B 3CCMN 2FVCA 4PQUB 1EAYC 4FJ9A 3VF2A 1KWMA 2DNNA 2WVBA 4DUZF 4ZPAA 4FVUA 1VSFA 3TP2A 1W26A 4HUEA 4F36A 1C4CA 5B0DA 4DV1K 2V2QA 2BA9A 5DQHA 4MFBA 3K5MA 1QSSA 2Z2LA 3TJ8A 1U1KA 5KFDA 4BWMA 2WZ1A 3GFHA 3OQ2A 3CD6S 2RVJA 2GMLA 4M3RA 4BC4A 1T9TA 4CJVA 3QJLA 1BHLA 4PXEA 3KDNA 4RWWA 3CULA 4YB7A 4X4TA 4Q0BB 4DR4F 1XNQJ 4KHNA 3DXBA 2QA1A 1QE1B 3NCPA 1PC4A 3K5LA 3WX8A 4CEOA 1DTQA 1FTCA 3G8QA 4OV6A 2FD2A 4M5MA 1RT1A 5ETNA 4DR7K 3LPEA 4ILMA 4CO4A 1VRQC 1U4BA 1YVFA 4B9UA 3GIIA 2QTDA 2LCWA 4WXWA 2KO1A 2UVUA 2HBQB 1XEZA 3CCZA 4RNOA 4LF1A 3CJ8A 1KEKA 3BKFA 4HH1A 1WTFA 4PZVA 4YOWA 3KK1B 3TANA 4HTUA 4WTOB 3N4QA 2KHDA 2PAVA 2HFZA 3W5XA 5KFHA 4I2QB 3MN9A 3RYLA 2FBVA 2ALZA 4K4ZA 2YWHA 4C11B 4IZ9A 4LD0A 1ZPWX 2NRTA 3TARA 4ZVHA 2J0SD 5F8NA 2UXCF 3GIKA 3F44A 4GW6A 5E41A 4FJNA 5I3PA 3DC2A 3QT7A 4ZTJA 1VJQA 5BYSA 1HARA 3NF8A 4Y2MA 4QJVA 5AQMA 1G6BA 3NS6A 3KKRA 1IN0A 3ETOA 6AT1B 3KWGA 2RUGA 1MLAA 4MKAA 2ZH4A 2UVVA 1F9FA 1FDDA 4E7JA 1H2UX 1Q86O 1VRTA 1M90T 2P6SA 3KJNB 1S1XA 5FPNA 1NGHA 1NK7A 1D9DA 5KFAA 1XUPO 1RDBA 3J7ZT 1TK5A 2YWEA 3L6QA 2KXNB 1NBWA 2QC3A 2PA3A 1TKZB 1HW8A 3PXGa 1UJ5A 3T19A 5J1PA 3B82A 1NSKL 2E66A 2QZ8A 4KGMA 4AYBD 1H6KX 4B3MF 1RDAA 4DR4K 4LREA 4UUWA 2EG1A 3FUYA 3IWNC 2GJFA 3HSJA 5ETMA 1FWKA 2QN6B 5CR4A 4HH0A 3FK4A 2GGPB 2WSEC 2VQFK 1PO6A 2H3GX 2L9NA 4OVLA 3B4DA 4RUHA 3K59A 1GOCA 3OHBA 1IWAA 3R5AA 3LW5C 1O51A 3T1YF 1D3WA 2QT7A 2MSTA 1HYZA 3NH0A 1Q8KA 1SC4B 3OT9A 1BIUA 3DLEA 2O1PA 3DN9A 4FVMA 1N33F 4CBXA 4RW8A 4XK8C 2KN4A 3MEGA 2XSJA 4DV0J 4E7KA 4OGCA 3AAQA 4JV0A 4I6MB 2DHXA 1QQCA 2L9WA 2ZE2A 2G2OA 4CLUA 2R2UA 3MEEA 4WYWA 2WBRA 2XO7A 2RDIA 3D2EA 3HZ6A 3GP9A 3M6WA 3NY0A 1FDBA 4CO1A 1CZAN 1IQZA 1IBCB 1M1HA 3W60A 2MZ1A 4OPHA 3L7PA 1RAJA 2KJWA 2UYTA 1QTMA 3SJHA 2FC9A 2XYPB 2WUSA 2DGSA 4NI2A 4DPUA 2VJUA 1NCLA 1RZMA 1ZBIA 1VQYA 4OX9F 1U2CA 3A5NC 3NEKA 4FF2A 4H8KA 3WUHA 2P8IA 1X3NA 3SDEB 5BR8F 3L3CA 3A4TA 2OPSA 2V94A 2FQQB 4JP8A 5GAEU 4BC9A 4NRTA 2C3UA 1X4HA 1X4FA 2R7RA 4DR7J 3BO2A 3N5BA 3OPKA 1QUPA 5T7LB 2WOMB 1R43A 2ZH2A 3J80U 1TTHB 3PR4A 3O44A 4B1ZA 4IG0B 1L3VA 2M70A 1VK0A 3T5HA 1D9AA 3PO4A 5E3AA 5DO2A 5D0GA 1WC3A 1KAZA 2F9DA 3MR6A 1IJFB 2CZVC 2HHVA 2YKMA 4OO1J 4B1VA 2KG0A 3AB4B 3M30A 5HRPA 2Z58B 5D6GA 2YHWA 4KBIA 2LMIA 4EIAA 4KHMA 3LZJA 1X0FA 5F8HA 3UO0A 3EZWA 4DU3A 1T9VA 4DZDA 2ZD1B 2YQ1A 2V8PA 1WBBA 1FWPA 3NKYA 1RISA 1RBTA 3AO5A 4U7BA 2MPUA 3Q0AA 3SV3A 4LFBF 2COLA 3AD9C 4K0KF 3VQPA 3KLFB 3IP0A 4B17A 3KIOA 5HBMB 1ZM2A 4QU6A 2VPZB 3JSBA 3M3ZA 4OZLA 3ZZRA 4DEZA 2J9EA 3WQUA 3PFEA 4YORA 1CG2A 2Z8QA 4KHRA 5B0AA 1SBRA 3GOIA 3AGKA 1RA6A 4IQXA 3OUYB 3HHDA 2F8TA 1VGYA 2DXFA 4RR5A 3THXA 1R0AA 4TSXA 3OYIA 4M1KA 3R5JB 3NGIA 1UWBB 1P27B 5B7WA 3OTOJ 3RB6A 3RRGA 2P2CB 3I31A 1Z4UA 1UW4A 2Q0UA 1R89A 2AHOB 1KP6A 1FJGJ 2OPRA 4YB6A 4UOHA 1FXDA 2DNMA 4LFAF 3CCJS 1ACMB 4K4SA 4CZFA 3Q83A 2AGOA 2W42A 2XY6A 4JKGA 2DHSA 1T9YA 2MQLA 2E88A 4OKEA 3OYLA 2LEAA 4MYUA 3FEZA 4CGFA 4DTRA 1P9YA 4LIWA 2E1ZA 1YHQS 1U1RA 3MWBA 2VQFJ 4DR3K 3TOQA 2I7PA 2IPOB 4PKDB 2C2MB 5EOYA 2XYHB 3OS1A 4OLPA 4IR1A 1WEZA 2LA6A 5HP1A 4ECXA 3NH2A 3DMJB 3NMUA 1O13A 1BISA 1NOYA 3PEJA 3L95X 5EX5A 2ILZA 2JLEA 1SJQA 4J2BA 1H73A 4X4QA 2B4PA 2HGMA 1K44A 3D0IE 4WFBQ 1VQNS 5EWEA 3RVCA 1V5IB 1GFWB 5AQUA 1H7WA 4URQU 5CZVA 3SBTA 2HFSA 1GMUA 1RHMB 2UUAJ 4FYXB 3L2QA 2NRXA 3M4XA 3BO3A 3OLBA 5KG2A 1X4DA 4J9NA 4F4ZA 2OJ3A 2E1YA 1C1AA 1WC4A 2F1FA 3O08A 1VR6A 3QSIA 3R5CA 2XY5A 1K73O 2PO4A 3ENHA 4U9RA 3OFGA 2RDJA 1ZTWA 2UU9J 4LRFA 4QIWD 3VPZA 4DQRA 5LJWA 4IRDA 2P5OA 5EWGA 1B64A 2W4CA 3QBCA 2ZHBA 1T44A 1TKZA 1GAOA 3WQTA 3OYJA 4CZGA 2AT1B 2P9KB 2XMKA 3LAKA 1X4AA 3G4SN 2CJAA 5FPEA 4CJ7A 4IUFA 4NYZA 4P52A 2Y1RI 3GYXB 5BRHA 3F2KA 1QE1A 3R5BA 4CGIA 3UQSA 4ER8A 1YRXA 3HL8A 4Q0BA 1KCFA 3PV8A 1ELOA 2F8HA 5HSPA 3QO9B 1PC5A 4KQZA 4JKAA 4NXNJ 2W24A 4K2XA 1TUYA 3O3GA 1YTYA 1KOOA 3OVBA 1FI4A 1Q4RA 3DLBA 4HT5A 2GEMA 2X6SA 2RPIA 3QT6A 2HQGA 3CCTA 1IWGA 2RDDA 4W98A 4N7TA 3M6UA 2HNZA 5H9FJ 5E84A 4OJ1A 4HTLA 3KUHA 2QLXA 5LJ3Y 4DL5A 4ZP8A 3MUMP 3CI5A 5B0EA 4DS4A 3CJRA 5F0UA 9ATCB 2QV6A 3I0RA 3CUNA 3MM6B 1NU0A 1F2GA 1PAEX 4FW1A 2P6TA 4DQPA 5FLXY 3TA2A 4YR2A 3VQBA 4E1JA 4DMZA 3KUGA 3TJ9A 4HI2A 2D4WA 3NGSA 4IFYA 1WC0A 3RB3A 2QYCA 1CS4B 2IJRA 4OX9J 4CJEA 3NCRA 1NMDA 7AT1B 3O3LA 4FF4A 2DKOB 3UCZP 3G6XA 3FEYB 1AB8A 3VWSA 2DFFA 4USKA 4KREA 1RTDA 2OHDA 2XS5A 2PFFB 3T1AA 3M8SA 4ZVUB 2RHSB 3GV5B 3N79A 2DGOA 2QLFB 3H45C 5KFVA 1S57A 5E33A 4N5SA 1JLEB 4FW2A 5F41A 2XI2A 4ZVEA 1QSLA 2QA4N 1KDNA 4OL8A 2CUYA 1EZZB 5E3CA 2C2EA 1ROFA 1QAXA 1R0CB 2D0PA 2WAQD 2BEFA 5LSRA 2YCHA 3D45A 2LEBA 3P5BP 2FLPA 2CJQA 5LY3A 4GV6A 2QMXA 1QZ6A 4YP3A 2CNNB 2N7YA 3VAJA 1IKWA 1OQ6A 2BJEA 4CTAA 2Y0SD 1YITS 4DV2J 2LP4A 3O1LA 3V1RA 3MXHP 1DARA 4FP9A 3QB0A 1TV6A 2A3ZA 1TL4A 3QSYB 1Q81O 2RNEA 1UL3A 2VFTA 1Y9OA 1Y3JA 4ZVRB 4ID5B 2WW8A 3VA0A 3VEYA 2XSJB 3GTYX 4RNMA 2KH9A 4L6V3 1HKCA 2EFVA 3UR0A 3MMBB 3E9PA 1Q82O 2HHHF 3GU0A 3RMAA 2GVDA 1UEKA 1XNRF 3E01B 2Q3PA 4ZIWA 3MURP 4TVAB 1LWEB 4OI2A 2QX0A 4JI0K 4R8UB 2LQJA 2KG1A 4BGBA 5CYMA 4OJHA 1ZBSA 1S79A 2KT5A 1EX4A 4G65A 1S3XA 3G86A 5JICA 3VF4A 5KT7A 4F4WA 3HHLC 1IBKF 1YJUA 1UWBA 1NDPA 1HR0F 3EICA 2YNIB 4BDPA 4ETZA 3WNFA 1B0PA 1VSDA 2FHKA 4ANCA 5FLXU 2PEHA 3T6BA 1LXNA 4OZJA 2V2VA 3UD3P 3PTWA 4LBPA 4OV1A 5KFMA 4CBUA 3HSCA 4ZPDA 1RKJA 4H54A 3VESA 3KZBA 4CHPA 1E6VA 4ZS6A 1N36J 4J9PA 3CMAS 3TPQA 1MWYA 1F1BB 4TNOA 5K20B 3BB5A 2J6UA 3V9WA 4P10A 1MWKA 2M5YA 4DR1F 2BQRA 3BGFA 1VQ8N 2GNKA 3SJJA 1UFKA 4HR2A 4KHPK 3IS9B 5AR0A 2VC1A 4I4BA 5SZTA 2HQCA 1J5EF 2X1GA 4P9SA 1OY6A 4F2RA 3JSMA 2A42A 1ZBUA 1Q9YA 1UA0A 2O66A 4NCGB 2GW8A 1EKEA 1CJUB 3E9OA 4FJXA 4AQYF 1ZXOA 1MMNA 5GINA 4FJ7A 1DRZA 1LOTB 2G4BA 2JWLA 3CDWA 4ZVGA 3W65A 4H5VA 3THYB 3F41A 4M3ZA 3W62A 4JN4A 3D7SB 1NXIA 4FKXA 1U48A 5JVHQ 3BSOA 8ATCB 3TTCA 3A8EA 2KM8C 4M3UA 5FDLA 2NLXA 4PKGA 1W7WA 1RJJA 4OI4A 4PUOA 2QGFB 2F8EX 1RT5A 2WC9A 1P1LA 2HBRB 3U6FA 3EDRB 4LFCJ 2AF6A 1NGEA 1SCJB 5FD1A 4LRAA 2BOAA 4M5DB 2B9XA 2GZOA 4NLGA 2RRAA 2KU7A 1MG7A 4QCLA 2HOEA 1QQOA 1VMBA 2NREA 2E1AA 3UCGA 1JLBA 1VRUA 3HZGA 4DU8A 3CM6A 1HBUA 4KH5A 2YNHB 4LFCF 1K47A 2UUCJ 1SKRA 3K9KA 3G8TA 2R8HA 5IV4A 3EZUA 3FRYA 4CZJA 3TQ1A 2EEYA 1FFWB 1ZM4A 3NF9A 3CD6N 1SV5A 3SLCA 2OCEA 3AT1B 4NOHA 3OYFA 4J7CA 4PL7A 1KSPA 5KT5A 2OAUA 1BI4A 3PY8A 1RT4B 2B4VA 5EGYA 2BANA 1RT4A 2DEIA 3EM1A 4LF9F 4DPYA 1H1VA 3DLLL 2NSBA 2PFUA 1Q1KA 5FROA 2BE7D 3LL3A 3N6LA 1FNMA 5HMXA 3PW5A 4FLUA 3PNIA 2VA3A 3BSCA 3WQPA 2Z1GA 2CQPA 3SZ2A 1NB2A 2LU1A 3PDNA 1VQMS 3J81O 2OZSA 4ZPWR 5GIPA 3SCXA 4F3OA 3E3XA 3BGOP 3QYYA 5LOQA 5KT6A 3AVHA 4BVOA 3PRVA 1IH7A 3QERA 4CHNA 3KUEA 5AQIA 4PUOB 2DNQA 2H3EB 5KOWA 3IGNA 4BRKA 2MZTA 4Z4GA 2YPYA 4ILJA 1QQNA 3L2WA 2VQEK 5IC6B 3RSEB 2DCUB 4DR3J 2UVRA 4WFXA 4C0BA 4UY8O 3VAKA 2VG5A 2W8LA 2IVPA 1N5YA 1HYSB 2FJXA 2C42A 1HNZF 5HBMA 3WXLA 2PI5A 3PIPL 1VLYA 1HX1A 3H4BA 3H40A 3F9MA 4IKFA 3WNEA 1TUUA 4CZMA 3Q2TC 3TVYA 5IXUA 2ATLA 3MHYA 2ASYA 3KLEA 2VBXA 4CH1A 1GQEA 3OY9A 1SKWA 3CJ3A 4C3MA 3BF4A 3BZCA 2O5DA 4E7LA 1TU0B 1X3MA 4K50A 1HNVA 3C94A 2XLKA 4H5WA 3VF6A 2BXJA 4CERA 3CWJA 2H9ZA 3RMCA 2FLOA 2XC9A 4CBWA 4JI5J 3VEZA 3UNYA 2RUSA 4QZVB 1R0BG 2W2PP 4LF8K 1QLNA 4H5NA 4HWIA 1WF1A 5AT1B 4ENOA 4M5JA 5IWAJ 2N3LA 2UXCK 2D3OR 1Y10A 4KB1A 1WAFA 1BMQB 1NLKL 3KJQB 4HLBA 3DXMB 1L3UA 1FKAF 3BR8A 1KLMA 2F4VJ 3SXLA 1HPZA 4HT7A 1ZA2B 2Y0BB 1PYTA 5ELZA 3CW2C 1MA9B 1BQXA 2M0GB 1OYEA 2DXDA 1K8KA 4I67A 2ZJRL 4FLTA 4ZVQB 4AHUA 4B3SF 5KFJA 3EE3A 5H1SQ 3WX4A 2HURA 4K5RA 3LP0B 1HL6A 2HWHA 2G2ZA 2MLZA 4LQ9A 4B9TA 2AJFE 2MLYA 1XTZA 3L2RA 4LR7A 2UVWA 5F8GA 2KRRA 2O4GA 2FHJA 3EPIA 4JAXA 1G2EA 4O3RA 1T6CA 1RTHB 1DQ9A 3VEWA 3SMZA 4ED0A 4CIFA 4J9RA 2ZWHA 3QGPA 4C8KA 4OYOA 3CC4N 1YJ9N 4ANEA 2CJYB 4O5FA 2ZE2B 5G0RA 4ZJOA 5C24B 1N36F 5C0YA 3NRBA 5KFZA 2GX8A 3OBYA 5LL6d 4NLVA 2HB5A 4JI8K 2NLWA 3CPEA 5AQNA 4IO9L 2QI2A 2HG4A 1HQUA 2KJVA 4MH8A 3L7OA 2C2OB 5AQSA 5DZ7A 3H3NO 4IRKA 3ASMA 3MEDA 4CYUB 5C2GA 1JIHA 2V2ZA 3CC4S 4B3TJ 1HR0J 2W40A 3EZOA 3ZNJ1 1VQ4S 3KLIA 1IKWB 1T94A 3QRPA 2CH5A 4MIWA 4B3SK 4CTAB 4JKBA 1EETB 3QT8A 4S0MA 2MTLA 5D77A 3KK1A 4FF1A 4UZCA 2XZTB 3DOKB 1X4CA 1ZC6A 4YFUA 1C4AA 1F6TA 3VEXA 3QJJA 3G25A 3RW7A 3QFWA 4H4MA 1HNZK 5I42A 4KB7A 4M7XA 4PPZA 5KFIA 4IG0A 4Y0WA 2RB7A 5B08A 3BJYA 2JL9A 2HZVA 2CKWA 2GS8A 2CGLA 5A2QY 3J7AN 1M5HA 2B0GA 2VCPA 3VQ5A 4OPAA 2ZQBA 3DI6A 2L08A 3UE2A 3HFKA 3EPGA 4UY85 2AZ1A 3HCXA 4DR3F 4FN5A 2JSXA 2OD6A 1RK8A 4DR1K 3O4NA 1DKGD 2VPYB 2IVYA 2IDLA 4L3KA 2UUCF 3OYEA 2X3GA 2G0IA 2HFVA 4IFYB 3SUOA 3BBBA 1IM6A 2P9NA 3NHGA 4DS5A 1H7XA 4MKVA 3H98A 5K8OA 1YIJS 5KFKA 2ADCA 2VWBA 3ZEUA 3BUZB 1NJWA 2R7YA 3K5OA 4UF4A 2M2BA 4K5SA 4W90B 3ENBA 3ATVA 2W1BA 5FRMA 3AO1A 2OPRB 2YX4A 4FLZA 2EC0A 2WVEA 4CW7B 5HMYA 2BACA 2VICA 1X9SA 4HKQA 3EXCX 3ISZA 3UIQA 3P4IA 1JXVA 4KAZA 3UKRB 1XNRJ 3L8BA 3CMQA 2ZJRQ 4WBFA 4ILRA 1KQSM 1T9XA 4P72A 1TL1B 4DQQA 1RE1B 1J5OB 2I5JB 1X5OA 1FX4A 1HD1A 1FX2A 2D3UA 5CH7B 1C1BB 4QR2A 1LK5A 3GONA 2HAIA 3H46O 4FK0A 3NBPA 2V34A 2H4WB