1RTDA

Structure of a catalytic complex of hiv-1 reverse transcriptase: implications for nucleoside analog drug resistance
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
554
structure length
554
Chain Sequence
KISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTDTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDESESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA TEMPLATE FOR REVERSE TRANSCRIPTASE
publication title Structure of a covalently trapped catalytic complex of HIV-1 reverse transcriptase: implications for drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/dna
total genus 136
structure length 554
sequence length 554
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rtdA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtdA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtdA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtdA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rtdA05
3MR5A 3QLHB 3E01B 1NOZA 4CJQA 3S3MA 4KB7A 4B3OB 4Q0BA 1UWBB 3G6VA 3NGIA 4JRPA 5KFDA 4RNFA 4FBTA 3OYBA 4AHTA 2WOMA 1NKCA 1C6VA 4ICLB 4IKAA 2E6MA 4M41A 3SQ2A 4ED7A 1W9HA 3UIQA 4ED1A 3CIZA 3QERA 3OYMA 1QQCA 4W5NA 4RZRA 3BDPA 1TL1B 1JLCB 4QWAA 4CHQA 4PWDA 3CJ5A 4ECTA 3PZPA 4KHRA 2XO7A 3UQSA 1J53A 4ED8A 4ID1A 2P5OA 5HP1A 2DPJA 5JS2A 4TQRA 4J2DA 4M3TA 4CGIA 4JS4A 3SFGA 1U48A 1LW0A 3DOLB 2OPSA 5KGXA 3C6UB 5L1KA 5KFQA 1WN7A 2I5JA 2R2SA 3IS9A 4N56A 4OPJA 4TY8B 3OLAA 4FCYA 4RW9A 1BCMA 5D3GB 1N48A 4BE0A 4O0IA 1FKPB 4OKEA 3KLGB 4O44A 1Y97A 1IKXA 4MK8A 3RB6A 4CCHA 1C0MA 3KHHA 1D0EA 2A1SA 4DSKA 4RW4B 5KFZA 2WCXA 2J6SA 1RT2A 1WNEA 3TAMA 3EPGA 4QOZB 1BQNB 4NLOA 3QEPA 4JUZA 3MEDB 1FK9A 4K50A 3NF7A 1BCOA 4Z4IA 1D5AA 2RKIA 1S5JA 1WAJA 1S1XA 1D1UA 4MH8A 3LP1B 3HL8A 4OGCA 4B9MA 4FK2A 3ZSWA 1U45A 2P5GA 4BWJA 5J2NB 4E1NA 1Z26A 4F4XA 1LWEB 2HHSA 2XCAA 1QSYA 2HNDA 4EP4A 5DLFA 1JL1A 2YNIB 3HM9A 5KFCA 2KW4A 4MIAA 5HLFB 1RDRA 4ED3A 4C8MA 4DG1A 5EU7A 5I3UB 1S9GB 2XY7A 4LH5A 4K4VA 4CHPA 3NAEA 4ZP8A 3KK2B 2BE2B 3V6DA 1XHXA 4J9KA 4L8RB 2FVSA 2ATLA 4WYLA 3SUNA 3MEGA 3H5YA 3OYFA 4Y3CA 4ZVHA 4FJ7A 2G8VA 2IJNA 4O4RA 2ITGA 4I9QA 3OYNA 2O4IA 4R8UB 1SKWA 1T05A 1TL3A 4LY7A 2IAJB 2XY6A 4NLQA 4NYZA 3CDEA 5F8MA 2QKKA 4FYDA 1J9AA 4KKOA 2FBXA 3EZUA 2HHWA 4DF4A 3L2QA 3CFOA 3UR0A 4FLWA 2BRLA 1RTIB 4Y2CA 2BR0A 1HYSB 1T03A 1S9FA 1IKYB 4M45A 3AVMA 5HROA 4FS2A 4B9UA 4PQUA 4TY9A 3RMCA 1NJXA 3PHEA 1S9EB 2JC0A 2C22A 1NJZA 2VG7A 3OL9A 3L2UA 3Q8QB 2HNZB 4FM0A 4YR0A 3DOKB 1S6PB 1WSGA 4HYKA 4B9SA 1O1WA 3ZT1A 2BQRA 4B9VA 5EUHA 4O4GB 1BIUA 3HP9A 4ECQA 2G8WA 4GMJB 3TI0A 3HPOA 4ZHRA 5KG5A 1SKSA 3V81A 4QWDA 1GX5A 3U3YA 2YKNB 1SUQB 2IC3A 4CJVA 2KFZA 4RNHA 4ECRA 2BDPA 2F8TA 4YR3A 2HNYA 1SV5A 4B08A 1RCHA 2C28A 2BANB 4XO0A 2GC8A 4FJHA 3ZCMA 2ZE2A 5KFJA 3L2VA 4ZTFA 4DF8A 5KFYA 4OVLA 2F8EX 4ELVA 3MR2A 1NK5A 2IJFA 4U6PA 1WSJA 3H08A 1KLMA 2JC1A 1WSHA 4AHCA 3Q8RB 1GOBA 2V4RA 1TKXA 4KTZA 4CERA 1ZBFA 2HWHA 3N6NA 3V6KA 2V0NA 2FBVA 3QETA 3D5MA 4OL8A 5F9NA 1WLJA 4RU9A 4PY5A 1SL0A 2B6AB 1DTQB 4H54A 1MMLA 3CJ2A 4IFYB 1TAQA 2IOCA 5EDWA 3G86A 1RNHA 4BDPA 1ZBHA 3BGRA 2ALZA 2V9WA 3T19A 4Q8FA 2G8UA 3M9NB 3KJVA 3V9UA 5FRNA 1DTTB 4CF0A 3V4IB 4EBDA 4I7FA 4KFBB 4I2PB 1X9SA 3CO9A 2DFEA 4BDZA 3NF6A 4CJKA 3L2WA 3ULDA 3NFAA 2JEIA 2C2EA 1EX4A 2FJXA 2UUTA 2HVHA 1ASVA 1JXLA 1RBVA 2BRKA 2R2TA 3MTKA 4F4WA 3OYDA 3HSTB 2RDIA 3T5JA 4Q45A 3PR4A 1DLOA 1Z25A 3VQCA 3EYZA 1XI1A 3GYNA 1RT1A 2YNFA 4RUAA 3ZSRA 2FVCA 3RR7A 5J2MB 1BI4A 4ZMMA 3HO1A 3AA2A 5J1EB 3TR8A 2ASJA 3SUPA 3QNOA 2FJVA 3GIIA 3DLKA 3HVWA 3HPGA 3OL6A 1RTJB 4CFAA 3E01A 3KK3B 2D5RA 2YV0X 3EPIA 3NMAA 3JYTA 1JLGB 4DMNA 4B3OA 1N56A 4DQPA 4ECVA 3K5MA 2UVVA 4CIGA 1NKEA 1WAFA 4CF9A 3O3FA 3PX0A 3VQEA 4DTPA 1NK6A 4KREA 2X6NA 4FJMA 2HHQA 4M95A 2IM3A 3HHKA 5EWEA 1S97A 4KPYA 4WFZA 3ZT4A 4RNNA 4CJSA 1NK8A 3O4QA 3FQKA 1NJWA 4DSEA 4GC6A 4DWIA 2E9ZA 1TL1A 3CJ0A 4ID5B 3DMJB 3P5JA 3SQ0A 2V4QA 3O3HA 1A5XA 3K2PA 5F8LA 2Y1IA 3PV8A 4J9PA 1BQMB 4N47A 4NLTA 5JUMA 3QEVA 2HHXA 3DRSA 4M3UA 3I0SB 4QW9A 3BR9A 3EZ5A 3SQ1A 2D3UA 4KHQA 2BQUA 3SPZA 4F4KA 1RILA 3PW7A 3OHAA 4J9QA 2X6SA 3K5OA 3ZSQA 4DSIA 3N6LA 3OYEA 4FM1A 4TY8A 4DU1A 4TN2A 4JV0A 3AVCA 1BHLA 5KFGA 1X1PA 2HVIA 3ICLA 2R8GA 4K4TA 4K4WA 1MU2B 5FRMA 1NHUA 1C0UB 1KVAA 5KFAA 1RDDA 2UUWA 1RT3B 4F2SA 4DTUA 4RW4A 3L3VA 4HCBA 3ZSYA 3MXIA 5KRTA 3C95A 3LP0B 1ZETA 3M8QB 2UVRA 4FLVA 2YKMB 1EKEA 2ASDA 4C8KA 3GIJA 4DS5A 1YTAA 3CFRA 4AHVA 1YVFA 1FKOB 5L9XA 3NH1A 1NK7A 5EWFA 1CXUA 4IG3B 2O5DA 1N5YA 2IMWP 3MEEA 3LP1A 3LPUA 1HNIB 4U7CA 4KV8B 4M3ZA 4IRCA 1TP7A 2HMIB 2CJQA 1RTDB 3LWMA 1KCFA 3DLEA 4CEZA 3PR5B 5SZTA 1UOCA 4CIEA 4H8KA 1TVRA 3SV3A 4NLUA 5I3UA 1S9GA 3H2LA 5DG7A 1L3SA 3HVAA 2Z1HA 4CK2A 3LP2A 3KD1E 4IH5A 4MKAA 3CQ8A 4JRQA 4EEYA 1S1TB 4FLZA 3WNHA 5FDLB 1B9FA 1GOAA 5KGWA 3JSMA 3WNFA 4ZP7A 4EZ9A 1G15A 1T8EA 4EZ6A 5CYQA 1NJYA 3RR8A 2Q3SA 5J2QA 4J9SA 4DTMA 2W8LA 3DYAB 4KO0A 4FK0A 5K14B 4RW6B 4JV1A 4HUEA 2FVPA 4QWBA 3VQ5A 2W7PA 1RBUA 3DRPB 4AHRA 4CJFA 3K5LA 1RDAA 3B6PA 2HW3A 3NH2A 4DL3A 4F4ZA 4MQ3A 4G3IA 1RTIA 2PZSA 2D0AA 1LW2B 2P1JA 1VSDA 3DM2B 4M42A 2D0BA 1HJRA 3T5LA 4IR1A 1SKRA 3PW4A 1X9MA 3BSNA 3HKWA 2OPRB 1QS4A 4KHWA 3SJJA 5HRRA 5KG1A 1HMVB 3NGDA 3SNNA 3KLIB 1XR5A 3O3GA 3DOKA 5KFLA 3LP3A 3QGIA 3TVKA 2VG5B 3SQ4A 2XRIA 4WFXA 5L1IA 4MK7A 1BGXT 4WFYA 3OJUA 3S3OA 1YTUA 1VRUB 4ZPCA 3KHLA 2GUIA 1C1BB 3D28A 2ILYA 4KAIA 4NLDA 2HHUA 3NGZA 3D0PA 3IG1A 1S6QB 3QO9B 3DLBA 2XWYA 1EP4B 4WE1A 4DFKA 5KFEA 2YKNA 5KT2A 1T7PA 4GVMA 1XR7A 1TQLA 4UQGA 4DQSA 5DLGA 1U49A 5C42B 3V9ZA 2BANA 1IKVB 1JLEA 5KG7A 2RF2B 1N6QB 3HK2A 1JLFB 4ZP6A 4FJGA 4Y34A 5KFNA 2B5JB 2FBYA 3LAKA 1GOCA 4AHUA 5KFKA 4MIBA 1S48A 3AA5X 1VSEA 4CF1A 4BDYA 1YVUA 4B8AB 4KHUA 4EBEA 2ZKUA 1DTQA 1RDCA 1D9FA 4TQSA 5DK5A 3N6MA 3BQ2A 4KHMA 4OLAA 3QESA 1RT6A 3LZIA 2D3ZA 2E6LA 4XPCA 5I42B 1L3VA 4KFBA 4K4SA 1WSIA 2LSNA 4CGFA 4KRFA 4I2PA 5KT7A 1EETB 3DI6A 4CJLA 3PO5A 3T5HA 4LSLB 2D41A 5KG2A 4R5PB 3ALYA 3AVJA 1TKTB 1KVBA 3I0RA 3KNAA 5C24B 5HRSA 3HXMA 3G0ZA 5FROA 1S1VB 4O55A 2Y1JA 4N41A 2IM1A 2OPQA 2X78A 2W42A 1HNVA 2W9BB 3U3GA 1RT5A 4QW8A 4IH6A 4ZPBA 5J1EA 1REVB 2PYJA 1VSMA 1JLQB 4FJXA 3T3FA 2AJQA 4QWCA 1LWFB 5JXSA 2ZD1B 2G8FA 3KK3A 4EO8A 2W9AA 1T94A 2OYQA 4N5SA 3CM5A 4DL2A 3ZT0A 5KFSA 2R2RA 1KRPA 3AVKA 2VG6A 1S1WA 1LAWA 2W9CB 4RW8B 1CLQA 4RNMA 3M8RA 4CJTA 2FJWA 1HYZA 5SWMA 1OS5A 3AA3A 3RAQA 3FSIA 3DMJA 2GBZA 2YHAA 1VSKA 3G10A 1IO2A 3AVLA 1JKHB 1FXXA 1ZBUA 4CGGA 3OS0A 1SH2A 1D8YA 5KFUA 4B9LA 2KZZA 3V1OA 4O3OA 3ZT2A 4M3RA 4WXOA 4TLRA 2YHBA 3I0SA 1D9DA 2AX0A 1HQUB 3LALA 3C6TA 2HWIA 3IAYA 3KLHA 2PY5A 2P51A 4KAZA 1KHWA 1IKWB 2JLEA 2QKBA 4DFPA 3QGGA 4EO6A 1BL3A 1C1CA 1T3NA 4DL6A 3KKSA 4KI6A 2EX3A 1JLBB 4DQRA 1K6YA 3KKRA 3RBDA 4LSNA 1VSFA 1RT7A 1C0UA 3OSNA 1J5OA 3QNNA 1RT3A 4FJIA 3PW5A 5F8NA 2I1RA 4ELTA 3SPYA 4Q8EA 5DG8A 4ZVFA 3LDSA 2G8HA 3M8QA 3AVNA 3PJXA 3OL8A 1J54A 1S4FA 2F8SA 2R8KA 3P1GA 4IDKA 4MFBA 3CVKA 5C25B 4NLRA 2B43A 1ZYQA 2FLLA 3LAMA 1WSFA 1HNIA 4CJ3A 4OKJA 2YNHB 2XGPA 4KV8A 2JGUA 2FVRA 1Q8IA 4BWMA 3VA0A 4Z4CA 3RB3A 2R8JA 3AA4A 4I2QB 3IS9B 3CJ3A 1HPZB 4C8LA 4IRKA 3H5XA 3OLBA 4J9OA 4Y1DA 3PX4A 1XR6A 4RG8A 4O44B 1TK5A 5DQIA 4JLHA 3I8DA 3VA3A 4ZVEA 2R2UA 3ZT3A 4NLPA 5JS1A 3RB4A 3M8PB 3KTQA 2OPPB 3CJ4A 4QWEA 3DDKA 4TYAA 1TKDA 5FDLA 3KLEA 4WYWA 1TK8A 2QV6A 4QAGA 3M8SA 4AILC 2FVQA 2GV9A 1FK9B 5KFIA 1CZ9A 1LAVA 4RW7B 1S0NA 1R0AA 3QYYA 3DYAA 2B4JA 4FW2A 3KK1A 1S1XB 4RW6A 5K14A 3TAFA 3E51A 3M9MB 4FZZA 4W5OA 3DRPA 2QK9A 1VRTB 4O5BA 3QEWA 4CF2A 4HVJA 4M3WA 5DQHA 2E4LA 2XI2A 4CFBA 1LW2A 2WONB 3QLHA 4K4YA 4W5RA 3DM2A 4FLTA 3RMAA 2UVWA 4IBNA 1UWBA 3NL0A 3PO4A 1S0OA 4KE5A 2HB5A 3F73A 2OPRA 4E0DA 3V1QA 3GQCA 1XHZA 3Q8SB 1NHVA 1C1AA 4ICLA 4FXDA 3KLIA 4ZP9A 2AGOA 4ECZA 1RYSA 2VG5A 4CK1A 2DPIA 5CZ1A 1RBTA 3MEGB 3NH0A 3RMDA 3AV9A 1S49A 2ETJA 1C1BA 3SFUA 1JLCA 4WZQA 1S6QA 3QO9A 4H4OB 2KFNA 4FJ9A 4R0EA 1EP4A 1T05B 4ZPAA 4ED0A 5DMRA 4IH7A 2KTQA 2J6TA 5KT3A 4CJWA 3VQAA 2DY4A 3IGVA 3DOLA 3C6UA 1RBSA 2F96A 4NCAA 1BISA 1IKVA 4CE9A 2RF2A 1N6QA 4FZYA 4IR9A 3HP6A 1RT4B 1T03B 5KG0A 1RDBA 3Q8PB 4GW6A 4C8NA 3IRXB 5DGAA 4Z4HA 4PQUB 4DU3A 5D3GA 2B5JA 1UA1A 1FKPA 4XIUA 1KVCA 2VG7B 3KLGA 4F3TA 1KTQA 3BJYA 3QEIA 4FJJA 5KFXA 4K4UA 3VQDA 3RRHA 3PY8A 1SH3A 2VWJA 3CG7A 2XCPA 4E7KA 5HBMB 3L8BA 3H40A 5KG6A 3CM6A 1S0MA 4NLSA 2OA8A 1BQNA 3OYKA 3UPFA 4E7IA 5L1LA 4CJUA 3LPTA 4DLGA 3MEDA 5F8GA 2CKWA 4Y1CA 5KFVA 2VWKA 1JLAB 1QSSA 1EETA 3T5KA 4X2BA 4J9NA 2G8IA 3PUFA 4LSLA 3OYCA 4HHTA 3GIKA 4ED2A 4R5PA 3H4BA 3G6YA 4DSJA 5KI6A 5DQGA 3LZJA 5KTQA 5J2NA 1S1VA 1ZTTA 2ZE2B 1LWEA 3ASMA 5KT5A 3C94A 1I6JA 4WZMA 4FJLA 3MR3A 2YNIA 4I9LA 3SYZA 2W9BA 3DLGB 5HLFA 4G1QB 4CJEA 3TAPA 1HRHA 2J6UA 1TKXB 3MECB 1REVA 3AVBA 2BGGA 2EC0A 4Z4EA 3KK2A 2BE2A 4Q43A 2ZD1A 4KHYA 1A5WA 3AO3A 4CFCA 4PUOB 4QCLA 3MR6A 3HVTB 5KFWA 3NAHA 3BGRB 1S1UB 4CF8A 1ZBLA 1TV6B 2XGQA 1RA7A 4R8UA 4URQU 1I3AA 3OJSA 2W9CA 4RW8A 1TKZB 4NYFA 2IAJA 3GIMA 4KB0A 1ASUA 4WXWA 4DL5A 2JEJA 3H98A 3NDKA 2VA2A 4CJPA 3HJFA 4O3QA 2JEFA 4EYIB 4FLUA 3MF5A 5T14A 4FK4A 4Q5VA 3OYAA 3RMBA 1DLOB 1F21A 4FJNA 2KZMA 2E9TA 3ZSOA 2AX1A 1HYSA 1VK0A 4O3PA 3KMSA 1IKYA 2YNFB 5KFPA 4PA1A 3PW0A 1C0TB 1S9EA 4MKBA 3O4NA 1VSIA 1HQUA 1HARA 4DEZA 3DLKB 2HNZA 5KRSA 1S6PA 4EP5A 2AWZA 1QHTA 3SZ2A 1RBRA 3TARA 3L3UA 4CIFA 3JYTB 5F8HA 3QIPB 1IKWA 5F9LA 3QINA 2IM2A 1Q9YA 3G6XA 1LWCB 4O4GA 3VQ7A 4FJKA 1JLBA 1ZBIA 4F8RA 1QUVA 3OYIA 2DFFA 2XY8A 3BQ1A 4CHOA 5KG3A 3A2FA 3EY1A 3KD5E 3FFIB 3F9KA 4W5TA 2GIRA 1SUQA 4NYNA 2E9RX 3GILA 2DFHA 4DTNA 5CYMB 4OJRA 3VQBA 3OL7A 4FBUA 1IH7A 4CHZA 3MXMA 2R7YA 4NLXA 3I5CA 5C25A 1L5UA 3L2RA 2EHGA 3DRSB 2NUBA 4QPXA 2YNHA 4YP3A 4BE1A 3P83D 4NRUA 1U04A 3OSPA 4DTJA 4E1MA 1I39A 2XI3A 4FM2A 4I2QA 3OS1A 1HPZA 1NK0A 1HQEB 4URSA 2B6AA 5KFRA 4IFYA 4FLXA 3KLFB 4DFJA 5E41A 4TXSA 3HT3A 3PX6A 2IS3A 4OLBA 3PW2A 3VQ6A 1RTHB 4K4XA 3NBPB 1DTTA 4DSFA 3V4IA 3WNEA 1LV5A 3M8PA 4HCCA 2OPPA 3U6FA 3BQ0A 4CECA 1W0HA 3VN5A 4YR2A 5KFFA 5CY4A 1K1SA 4TSXA 4LQ3A 1Q9XA 3QZ8A 3PJWA 2FC0A 4YMEA 1KFDA 4HUGA 3AVIA 4RW7A 4NRTA 4FZXC 5J2PB 1TAUA 1QE1B 1N5YB 1U09A 3HYFA 3MEEB 4KHNA 2PYLA 4AH9A 3HPHA 4CEFA 1NK4A 5J2MA 2YNGB 4B8CA 2AGPA 1VRTA 2C2DA 3KHRA 5C5JA 4XPEA 4FVMA 3ITHB 1RTJA 2WONA 3MAQA 2R8IA 4ZVGA 5F8IA 4LQ9A 1VSLA 3OY9A 1BIZA 3FQLA 1UAXA 1JLGA 3T1AA 4H4MB 2AU0A 2Z1GA 3DLEB 4FW1A 1TVRB 4IFVB 4J2BA 1QSLA 4CGHA 1WNSA 3LP2B 1JX4A 3CDWA 2XHBA 1WSEA 3MXJA 2AQ4A 5KFMA 2OZSA 1CSJA 3KOAA 4DTSA 3SV4A 3JSMB 4IG0B 3RAXA 5F8JA 1C2PA 4ID5A 4CEEA 5CYQB 4N76A 4BE2A 4H4OA 3MFIA 3VQ8A 1UA0A 5J2QB 3M9OB 3TWHA 5T7BA 4E19A 3DRRB 3NAIA 4ECSA 4KO0B 4HUFA 2XY5A 1BQMA 1IM4A 1K1QA 1YT3A 1KHVA 4NLVA 2WTFA 4DTOA 3LANA 3LWLA 2A1RA 2BQ3A 4NCGB 3NF9A 3OYHA 2FLNA 2RN2A 3KHGA 3SCXA 4JS5A 3V9WA 4CHNA 2ATQA 4IRDA 3TAGA 1RT4A 1QAIA 4YFUA 4DTXA 4Q0BB 3IRXA 1TGOA 3OS2A 3GV8B 2D7SA 2WOMB 1RA6A 4RUCA 1VSJA 1MU2A 3NGYA 3DLHA 2RDJA 4NCBA 4K8ZA 4C8OA 3NE6A 3NCIA 4CJ4A 5HBMA 1B92A 4CK3A 1ITGA 1IG9A 3LP0A 2YKMA 3D45A 4O3SA 4ED6A 4PWDB 3IG1B 3ISND 3QGHA 4IQXA 3VQPA 1FKOA 5DGBA 4O3NA 2UVUA 3KLVA 4WE1B 3K57A 4CFDA 4IOBA 1JLAA 4Q44A 4IG3A 3H5UA 3OVNA 4B9TA 4HTUA 5HP1B 4EYHB 1SL2A 4Z4GA 3OYLA 4MK9A 4OPKA 1LW0B 2OPSB 1JXEA 4NLWA 4BACA 3RTVA 1KSPA 1L3TA 1JLEB 4KBIA 2I5JB 4FJ8A 2HMIA 1W25A 1RTDA 4E89A 3QIDA 3SUOA 3SI6A 4CJ5A 3S9HA 3ISNC 3NF8A 4FS1A 4RW9B 3DLGA 4G1QA 1EXQA 3MECA 4ECYA 3MFHA 1IKXB 3V9SA 3AVHA 4EBCA 3RWUA 4HKQA 4Y2AA 3AVGA 5KFTA 2GIQA 1S1TA 3TABA 1QTMA 4PUOA 3AO4A 2XC9A 4DL4A 1RT2B 3PVXA 3H5SA 3HVTA 3TAMB 3VQ4A 1RT6B 1S1UA 1TV6A 3H59A 2KQ2A 3KIOA 4J9MA 2HHTA 3ZSVA 4DFMA 1TKZA 3DI6B 2ZQBA 2G8KA 2RKIB 2W8KA 4F50A 5DG9A 4CEOA 4ZPDA 5KFHA 4F4YA 1JL2A 4YNQA 3AO2A 2QE5A 3I0RB 2WRMA 4CEBA 1L3UA 3HVRA 5EWGA 2FLPA 4KI4A 3KMQA 5HRNA 2HNDB 2OPQB 1NNDA 1HYVA 2FBTA 1XWLA 3TQ1A 1HNVB 4KTWA 4M3XA 1RT5B 3GV7B 4B9NA 4F3OA 1C0TA 1NK9A 4DG1B 4ELUA 3V6JA 4DQQA 4J9LA 1HMVA 1JIHA 3OYGA 2DTUA 3BREA 3V6DB 2HHVA 3K59A 1NOYA 1N4LA 4Z4FA 3QIPA 4M3YA 3TAQA 3TAEA 2IGIA 1LWCA 1VRUA 5KG4A 3QIOA 4F2RA 4DSLA 2WK4A 2IA6A 3BSAA 2VG6B 4OKKA 3I5BA 1S1WB 1TL3B 2OH2A 1RAJA 3FFIA 3AO1A 3VQQA 2AGQA 4E7HA 4CJRA 3FRZA 4LD0A 4KKOB 5CYMA 1RYRA 3I5AA 2ASLA 5KFBA 5C42A 3IN5A 4O3RA 1B9DA 2C2RA 2X74A 4DQIA 2WB4A 3AO5A 5HROB 5HRPA 4J2EA 1JLFA 3RB0A 4NZ0A 3QEXA 4KSEB 3ZSZA 3GV5B 2R8HA 4E7JA 4CEAA 3AVAA 3C6TB 2IM0A 3S3NA 1X9WA 4LH4A 4KHSA 3FDSA 4ECXA 3KLHB 4CGJA 1HQEA 4FJ5A 4K8XA 4DTRA 1KLNA 1C1CB 3KLFA 2Z1JA 4CEDA 2QXFA 4ZHRB 4LSNB 2WHOA 4TYBA 3QZ7A 4E3SA 3V81B 1RTHA 4KTQA 1RT7B 4OGEA 3NBPA 2VA3A 5I42A 1J5OB 3AVFA 3RBEA 3IGNA 1TK0A 4CGDA 1ZTWA 1SL1A 2IC3B 4J2AA 3UDLA 3BSCA 4ECWA 4GC7A 1TKTA 2HNYB 5C24A 1KFSA 1SV5B 1CXQA 3VQSA 4CEQA 4CESA 3SI8A 4IDKB 3V6HA 5KFOA 3K5NA 2JEGA 4MFBB 4ZTJA 4RNOA 1CZBA 5J2PA 2HAIA 4AHSA 1QE1A 2ILZA 4KB1A 4O0JA 3WNGA 1KLMB 3OYJA 3OHBA 4IKFA 4NLYA 2YNGA 5CZ2A 3NHGA 1JLQA 3K58A 1NKBA 3V9XA 1LWFA 2O4GA 1U4BA 1JXBA 3ITHA 2D0CA 4CHYA 4H4MA 4YQWA 4IFVA 1GX6A 1SH0A 3SUQA 4DL7A 3TANA 1S10A 1QAJA 2IBKA 3VQ9A 4URGA 3NKYA 3KJVB 2OZMA 4K4ZA 4I7FB 5L1JA 4FLYA 3B6OA 1Z4UA 4M94A 3THVA 3DLRA 4JV2A 3KLEB 5KT4A 4IG0A 1ASWA 3V1RA 1A5VA 4J9RA 3CYMA 4W5QA 1XC9A 4E7LA 1VSHA 3CDUA 1JKHA 3CWJA 3H4DA 1R0AB 2RPIA 3DRRA 3KK1B 3BSOA 1RT1B 4Z0UA 2Z1IA 2IDOA 4ECUA 3ZSXA 4DS4A 1BI4B 4NLGA 5KT6A 1U47A 3RRGA 4NCGA 4DU4A 3CFPA 2W7OA 4DLEA
chains in the Genus database with same CATH superfamily
3MZIA 3QLHB 1MA9B 1UZDA 3TO8A 3WZ0A 4PRFA 4YY3F 1UVJA 5K5MA 1U1PA 3KYLA 3GZ7A 2QW9A 4JRPA 4FBTA 2QA1A 1CBKA 5AQKA 5LMNJ 4ICLB 4IKAA 4C8YA 2DIUA 4ED1A 2UXDF 4BRMA 4CBXA 4HHHA 5LSLA 3G4SN 2LDYA 1TL1B 1FWPA 2E2QA 1U26A 2LXIA 4PWDA 1Z1ZA 1KEKA 4DV4J 3CXCM 1CULA 5JVHQ 1NGFA 4ECTA 3MX5A 1RWMB 2A3JA 1U0HB 4ED8A 4PPZA 1RISA 4OI3A 1DHMA 1NBWA 4DBQA 1Q7YO 3CJKA 1U0SA 3C16B 2KKZA 5KFQA 3BBBA 3C19A 3R1HA 3IS9A 4R79A 2IPOB 1H2TZ 2D1CA 4RW9A 5D3GB 3WHIA 1Q7YT 3O9QA 3NWRA 1PSDA 5ETVA 4OKEA 3KLGB 4O44A 1IKXA 3DAWA 2FHOB 4MK8A 3IWLA 4RU2A 2V51B 1D0EA 2X1AA 2X1BA 3FR0A 4RW4B 5KFZA 2E66A 2HZCA 3TJAA 3DLLL 4BC4A 1WNEA 1VQOS 4DR2K 4QOZB 1MG7A 2EFPA 1ZA2B 3MEDB 1FK9A 2BBEA 1WG5A 4ZCIA 1WDTA 3A8KA 2RKIA 4K8RA 1S1XA 4WP9A 2DO0A 2AYBA 4H5RA 4PG8A 4BVOA 2C2ZB 2P5GA 4BWJA 3VAJA 4DV1K 1EAYC 2HHSA 4LRFA 2XCAA 1T9XA 4FKXA 4GMKA 3A5OC 4B3RJ 3HM9A 1T3VA 5KFCA 4MIAA 2JFKA 1NGEA 3P8BB 4DG1A 1M1KO 1ZH5A 3MPWA 1S9GB 3GYGA 1VQPN 3KK2B 4F4AA 3THTA 4L8RB 1HQ2A 4WYLA 3OHRA 1M1KT 1M1GA 1OY8A 4FJ7A 4QR2A 3RBZA 1WF2A 2G8VA 4O4RA 4WQ4C 4MLEA 3CC2N 3TSQA 1ZPWX 1T05A 4ZVQB 2IAJB 2CH6A 3D4JA 4NYZA 4M5IA 2UUBJ 4B3TJ 4CBUA 3EMTA 4KKOA 4DN9A 1WOSA 2FBXA 5G0RA 4OX8A 4C0HA 1R0BG 2X51A 1XERA 4ZVSB 1WBDA 4GKKF 1RWOB 4JNEA 1HYSB 2DR7A 1S9FA 1IKYB 2RMLA 4M45A 3AVMA 1U24A 2Z4PA 2P9UA 4FS2A 2GMHA 3NCQA 1YXQA 3M6WA 1WKJA 1S6PB 1WSGA 4J37A 4WCEQ 4LF4J 2QWOA 2NXUA 3GSDA 4A8FA 2BQRA 4J9UE 4B9VA 4CT9A 5EUHA 3C6AA 1ZOTA 4K2XA 3TI0A 4ZHRA 2H5JB 1NB7A 2GTDA 2DK2A 4WIIA 4QWDA 1NGAA 3U3YA 2YKNB 2V8GA 1SUQB 2UXDJ 4ECRA 4NL5A 2BDPA 1VYAA 2QN6B 3CTRA 1RCHA 3I8BA 2ZE2A 3L2VA 1LK5A 3F9MA 3PEJA 4OVLA 3MR2A 1T6CA 1NK5A 3M6GA 2IJFA 1GTHA 1MLAA 2EEYA 1Q5VA 3Q8RB 4OX6A 1BU6O 2V4RA 4AXIA 3OD2A 3N6NA 3PHTA 2V0NA 3CCQN 3M30B 4OL8A 1IBKK 3CMAS 1RLDA 3QWPA 4PY5A 1SJRA 4BC5A 1HKBA 5IC4B 1ZBTA 5AFUA 3TRGA 4BDPA 2A1BA 2H48B 3BGRA 1KC8T 2VPWB 2W24A 1SVDA 4ES1A 4I7FA 1UMJA 4C2MA 4BDZA 2YH1A 4AT1B 2AA4A 2ZBQA 3T1HK 4MMOA 1ASVA 2PT0A 4YORA 2R2TA 3OYDA 3R6GB 2RDIA 3AAWB 2VQEF 1DLOA 2MY8A 4C9DA 3FCWA 2FQQB 4KBOA 4YOUA 3IM8A 3AY9A 1IJJA 2YNFA 4UOHA 1BI4A 3CQXA 1FEEA 4IJNA 2ZHAA 1GLLO 4JKEA 3QNOA 3SAFA 3J81O 3OL6A 1KOOA 2V7ZA 1B0PA 4DV5K 1OH6A 3QSIA 4K59A 1NKEA 1K9MO 2OI2A 2RIJA 2X6NA 5HMXA 3LPEA 2UV8G 3GLJA 3HHKA 1NK8A 2UXBK 5E3RA 3AQPA 4GVEA 4DSEA 4X4OA 4GC6A 1TL1A 1NGIA 2P9LB 2QRRA 3SQ0A 3CCMN 4FWSA 4GV9A 3A8JA 3O3HA 3TYTA 5F8LA 4PG4A 3B4MA 1TFYA 4LF6K 2FJBB 1FDAA 4M5MA 4JI5K 1BQMB 5JUMA 1F60B 2HHXA 3DRSA 2K06A 3TZYA 1WOPA 3BR9A 1VK8A 1XNQF 3MAHA 2WVDA 2XS7A 2RHSB 2D3UA 5BR8F 2LEBA 3JS9A 4UOCA 4LUBA 3EVMA 2X6SA 2FLOA 3K5OA 5DM7Q 5M1OA 4DCPB 1U1LA 2NREA 1H1VA 1YHQN 1BUPA 4PKIA 3N79A 4LSZB 4QIVA 1KAYA 4ZVTB 2FJAB 4ZLNA 4AE5A 3H90A 4HH0A 4F2SA 4RW4A 4JV5F 1E6VB 3ZSYA 3T7ZA 4QU7A 4LRCA 3E3XA 5KRTA 2Z0GA 1ZETA 2L41A 4NMXA 2FIUA 4UUXA 4ZDNA 3H0PA 4DS5A 2NPIA 1YTAA 3CFRA 2V8HA 4P75A 4AHVA 1JMTA 5L9XA 3TP2A 2ZH6A 4IG3B 1CJTB 2AEFA 2R7SA 4CZIA 5AFUH 5DDRC 3MPDA 5MLCV 1RU2A 1JK9B 1G4CA 3QAEA 4KV8B 1N5SA 1RHUB 1IJEB 2IRYA 3MM7B 1QY7A 1VOMA 2EKYA 4DU8A 2HG4A 2QZ8A 3ELHA 4P52A 5SZTA 5AQWA 4CEZA 4CIEA 1TVRA 3MX2A 2UUAK 3HSCA 1HNZK 1S9GA 3D7SB 5DG7A 4JD2B 4YDUC 3HVAA 4CK2A 4MKAA 2ZHOA 2EWSA 1DRZA 3R7NB 1HKAA 3WNHA 5KGWA 3JSMA 3P6YC 1U25A 3O6QA 1X4HA 2RB7A 1UEUA 1U6FA 2W8LA 2QWPA 4JI3K 2GJ2A 1F9EB 3I31A 4RW6B 4HUEA 1FE0A 3MWBA 4DV3F 2AP6A 2LQ9A 3DRPB 4AHRA 4CJFA 5CHCB 3ZX2A 2HW3A 4ISGA 3NH2A 4LFAF 3VEZA 3MN7A 3EE3A 3WXKA 2J7UA 1HJRA 3HULA 3KWMA 2OPRB 1SC6A 1TL7A 4KHWA 4QYZK 2DGVA 5HRRA 1HMVB 3CCUS 1QTNB 4Y28C 4AM6A 4J8FA 2XRIA 4WFXA 1Q82O 2DR5A 2WSCC 1YTUA 1HHTP 2GUIA 4KAIA 2E1PA 4NLDA 3NGZA 4K42A 4U8YA 3IG1A 4JI4J 3GFHA 3DLBA 3BO4A 2MKSA 4LMZA 2YKNA 1Q82T 4QR1A 2L08A 2M70A 2ZITA 1TQLA 4UQGA 1YI2N 1JLEA 5KG7A 2NPFA 2FSJA 2Y8WA 3A8YA 4LF8K 3U02A 2MQLA 1GOCA 4O5FA 2XEXA 3BO2A 1VSEA 1NB2A 4NA1A 3VF6A 4M5NA 3CCTA 1XNQJ 3H6EA 4FVCA 5THWA 2UU9F 3M30A 5BR8J 4EBEA 1URNA 2ZKUA 2HS0A 1KS2A 3G9CA 3BQ2A 4C48A 1O0PA 1WJ9A 2DY9A 4OLAA 2KU7A 2CPEA 4K0KK 2HBQB 2OHDA 2E6LA 5I42B 1L3VA 4FF3A 2LSNA 4CJLA 3TZWA 1S22A 1RTZA 5IT9U 2HFVA 2V2QA 1CJUB 4FWOA 2QG9B 2Y1JA 3HRGA 1S1VB 3THPA 4O55A 5K9FA 1IUJA 2OPQA 5A8RA 2F9WA 4M63C 1VQ5S 4FPBA 5I9EB 3CCLN 4QW8A 1RAEB 2FC8A 4BRLA 2PYJA 4FJXA 4PABA 5D4NA 2PI4A 1IBLF 5CE3A 3H42A 2ZD1B 5IWAK 2HQ3A 4EO8A 3D2WA 4L73A 1DEJA 4H5TA 1T94A 3W9HA 4RJVA 3DC2A 3CM5A 3TNVA 3ZT0A 2WW8A 1FI4A 1NSAA 2OKQA 5JMNA 1NAQA 4CI0B 4EHTA 3QMLA 2VG6A 4LT6A 1PILA 4I6YA 2MB0B 1LAWA 3JSYA 2HRYA 2W9CB 4RNMA 3M8RA 4CJ7A 1HYZA 2C42A 5B0GA 1FTRA 1IN0A 2VZ9A 2UP1A 1YJ9N 4BRIA 2MLYA 5DS7A 4YB6A 2GZOA 1VSKA 2YX1A 4CGGA 2OTLS 3VCDA 4O3OA 3ZT2A 4Q2MA 3TA2A 4PYAA 4TLRA 2YHBA 1R8HA 3C14A 3UN2A 4I56A 1HQUB 2E5HA 4CH1A 2P6TA 3GSIA 4NWBA 2PFUA 3C6TA 5HQ8A 5E33A 2HAFA 3KLHA 2GO8A 4LFAJ 2P51A 1KHWA 2GJFA 4CLYA 1IKWB 3B8AX 3QGGA 1UJ6A 4DL6A 2AYEA 1GLFO 1JLBB 3KKRA 3G82B 3RBDA 2QLFB 4LSNA 1VSFA 3OSNA 4FJIA 3VR1A 1IM6A 1Y3JA 1E6VA 1S7IA 4Q8EA 1WF0A 5DG8A 4N8NA 2N4DA 1DURA 2E7XA 1U1OA 3SK3A 2WBMA 3R7SB 1JCGA 3CVKA 4NLRA 2I7NA 1CJTA 3K8WA 2FLLA 4ZOSA 2YNHB 2E5LF 4KV8A 2FVRA 1OYEA 2OSQA 3WXMB 3CJ1A 5KQDA 1Q78A 1TUVA 4Z4CA 4LBHA 4PXEA 2IMOA 3DNCA 3MM7A 4I2QB 2DEIA 1HPZB 4XTTA 2Z58B 4YOEA 4C8LA 2W7AA 3ET6B 4IRKA 4J9OA 1JNRB 5DQIA 1Q95G 1J2VA 4ZIWA 4JD2A 3D2FB 3ZT3A 4WFAL 2J9EA 4ALZA 2BE7D 1WC0A 2UV8A 3DDKA 3GJSB 5FJ4A 1TKDA 4WYWA 1W7AA 3HF5A 2UU9J 4QAGA 4MYTA 2V34A 3GPAA 2FVQA 4B3MF 1LAVA 4RW7B 1R0AA 3UN5A 4CQ1A 3L4IA 3GJTB 1EQMA 1Z2LA 2B4JA 2O8BB 4RW6A 4WK1A 4UZBA 4HR2A 1IQTA 1FRLA 3DRPA 4FKYA 3MUTP 2AW0A 1RHRB 3PRVA 4GKJJ 4M3WA 2XSFA 4CO0A 2XI2A 1U2VA 2AZ3A 4K4YA 3GOIA 2DHSA 3T6JA 1R6YA 4HHUA 4KE5A 4E0DA 2OPRA 4ZPTR 1ZAXA 3GQCA 4XDDA 3Q8SB 1PG5B 1OY9A 2MGZB 3O1BA 3VAKA 2F4VF 3M8YA 1V5VA 5FLXO 1BWVA 3BS9A 3R3LA 3EZOA 1SIWB 1RBTA 1IBLJ 3OPKA 2KL8A 1O13A 2B4OA 1JLCA 4HH1A 3R6LB 2KXHA 1GEHA 2DGOA 4H4OB 5LMNK 1JJ2M 4OQJA 1T3OA 3VGSA 2HHPA 1TELA 1QQOA 3Q22A 5LJVA 4PKDB 3GIRA 2HS3A 2YPYA 4TU7A 5EN1A 5DMRA 1BOTO 2KTQA 5KT3A 4N7TA 4MAKA 4UOGA 4JBCA 4BC9A 3DOLA 1HUXA 5E3CA 2AMCB 4A5AA 3Q8YA 4DV4K 1BISA 3C8YA 3IKMA 1YZ6A 4FZYA 4IR9A 3CIPA 2OMLA 1YJRA 1Y5LB 5KG0A 3N4QA 4W4MA 3SCKE 4BRNA 2YWHA 3MDFA 3BKFA 2J0QD 1V6HA 2Z2YB 5GAHU 1FKPA 2YWWA 2VG7B 1SB6A 4F3TA 3CCSS 3BBCA 1WKKA 4H0TB 2YKQA 3UKUB 3RRHA 5GIPA 1FCAA 4LRDA 1QAYA 1RAAB 2XCPA 1SQGA 3H40A 3TSPA 1NRKA 4KC5A 4NLSA 3U27A 1M5PC 2PMZD 3Q8VA 2MKKA 3ZZUA 1VLOA 5F8GA 4I64A 1JLAB 1GLAG 3G25A 5ETQA 3OYCA 4QZVB 5K8PA 2ZM6J 1NWKA 4DSJA 1MDUB 5KI6A 3LZJA 1CJUA 2HK3A 5KTQA 5J2NA 1S1VA 3CETA 2QJ3A 5A2QU 3MR3A 2YNIA 3B4DA 3BGOP 1S76D 3WBZA 4I1TA 3TAPA 1HRHA 1YITS 2J6UA 4KHPF 1FRKA 1VAZA 3NOGA 4Z4EA 2HKEA 3FZBA 2UXCF 4BRQA 2E5LJ 2BE2A 2EWHA 2ZD1A 4L3NA 2P2CB 4B3RK 4JKBA 4RO0A 4CZFA 5F2RA 3CMES 4CF8A 1ZBLA 2XGQA 2VBWA 1SZ2A 1U1MA 2FHMA 1H2UX 2W9CA 4NYFA 3GIMA 1RJJA 4KB0A 3D6TB 3GG1A 4DL5A 3H98A 4CJPA 2XMJA 4FLUA 1H3DA 4JI0F 4FK4A 3OYAA 2O1PA 1X4AA 4OHZA 2RQCA 2KZMA 4ILRA 4JK7A 4YOWA 2PA3A 4WTOB 4PA1A 1FRJA 2UUBK 4B3TK 3VWSA 4FWPA 3LF0A 1HQUA 2A40A 4ES3A 1T02A 5IT9Y 4KH6A 2F9DA 1G3OA 3TARA 3L3UA 4OHWA 3ZZ0A 1IKWA 5F9LA 1Q9YA 2RE2A 3G6XA 4C23A 4FJKA 1JLBA 1YWXA 1VJQA 3G82A 3OYIA 4RUBA 4CHOA 3A2FA 3EY1A 5D6GA 4WFAQ 1RAOA 2F4VJ 2GIRA 4O8UA 2E9RX 5AE1A 3GILA 2IY5B 4QJVA 5CYMB 3RW7A 2HVZA 4NA2A 4YY3K 3OL7A 1IH7A 2H9ZA 4A62A 4KYZA 2E1AA 1VQ5N 3L7OA 2IDEA 4NLXA 4ZVPB 5L39A 4AXJA 1L5UA 2DNMA 5KQ8A 2UXDK 4QPXA 2HBRB 1WEYA 5BRHA 2YNHA 3DXSX 4BE1A 3AGKA 2HFZA 4B1UB 1VQNS 1Z2ZA 4DTJA 4FM2A 1I39A 2XI3A 2JLGA 1UEVA 4Q7AA 3I82A 4I2QA 1HPZA 4URSA 3I56N 2KDOA 4IFYA 3WDOA 3HT3A 3H1QA 1RBAA 1WSVA 4MIWA 3PW2A 3PLAA 4PXCA 3AFGA 3D2FA 4K4XA 3BQ0A 1LXNA 1VCTA 4B1XB 1FRIA 1XEZA 4IZ9A 1IBMJ 4C0OC 1N8RT 4V19S 3C66A 3EE9A 3PJWA 4IO1A 2JNJA 1KFDA 4EMDA 4RW7A 2GIFA 1N5YB 3E66A 4KHNA 3CCRS 4FOEA 1ZM3A 4EAHD 3HTVA 5HN0A 4ZJQA 1Q18A 2AGPA 1U1KA 2C2DA 5C5JA 3L3CA 2KM8B 3O08A 3ITHB 1WEZA 2SXLA 3AD9C 2R8IA 2P8IA 4ZVGA 4LQ9A 3T1AA 4J90A 5GINA 1OH8A 3TQEA 3B78A 1RBOB 1U1QA 4RTFD 4CZGA 2GVZB 3LP2B 2DO4A 3MM9A 4DTSA 1X5SA 4OZ5A 4HL9A 3EE8A 3ZTRA 3TVZA 4BRDA 2DJWA 4CEEA 2XO6A 1FJCA 4H4OA 2JWKA 3VQ8A 2OO4A 4E19A 3DRRB 2J76E 2VASA 4KO0B 3LGMA 3OXLA 5AXMA 4W92B 4YOXA 2HRUA 2KVQE 4DTOA 2CJXB 3LWLA 3NF9A 3CJTA 2GS8A 3QT5A 1XJWB 4TKTA 1GAOA 4DOZA 2K7KA 1X4GA 3WX8A 3TA0A 2XYHB 3KZBA 4Q0BB 2V50A 4FN5A 2DGTA 2DR6A 5CD4A 2VC0A 2HBKA 2WOMB 1RWPB 1R8PA 4MTPA 3CJ9A 3O5BA 2DNYA 4Y00A 1MU2A 3OTEA 3DLHA 2RDJA 4NCBA 1BWEA 4K8ZA 2QWQA 3LA0A 2G1DA 3U9ZA 3NCIA 5ADZA 4CK3A 2OD6A 1ITGA 2NRVA 1X8DA 3LP0A 1LEOA 3D45A 4O3SA 4ED6A 3ISND 4X4TA 4IQXA 2C3MA 4OYMA 4KIAA 3Q24A 3PG9A 4IOBA 1JLAA 2DITA 3W66A 1RACB 3OVNA 1CC7A 2X1GA 4Y2IA 2XS5A 5HP1B 1GTEA 3OYLA 4RBTA 4MK9A 2O8CA 2OPSB 1JXEA 1ZAVA 3J7ZO 2XULA 3OR1B 1KSPA 4BACA 1L3TA 4H0XB 4KBIA 1YJTA 2KRRA 2CPHA 4BRFA 1W25A 3MMJA 3SJHA 3SI6A 3ENWA 4CJ5A 1TYQA 4FS1A 3CB4A 3O9UA 1KQSR 3K0SA 3M2UA 1VQYA 3RWUA 4DV7F 3QICA 3AVGA 5KFTA 3FFKB 3TWZA 4DR3J 4NE9C 3R27A 1TUGB 1RT6B 5AXNA 2YQ3A 3FMWA 3A13A 2BKOA 4H4KC 3QNWB 2HHTA 4XDCA 2CNOB 2J0SD 4U95A 1I94F 4YNQA 3AO2A 3D3CJ 2AKWB 3MMCB 1UKUA 1NH7A 3CNQP 1FNOA 2CQ2A 4F9OA 3NS6A 4AM7A 1HYVA 1RWXB 2ASPA 2IVMA 3CCSN 1HNVB 4M3XA 4F3OA 4ELUA 1XMBA 2A6OA 4J9LA 3OYGA 3POTB 1DQAA 2AP1A 1NOYA 3HD1A 4ZA1A 5GMKa 5A2QY 2BABA 2VQEK 1VQLS 5KG4A 2IYGA 4F2RA 2GA7A 2O3DA 3D54A 2IA6A 3BSAA 3I5BA 1S1WB 1TL3B 5BPLA 3W2VA 2AGQA 4CJRA 4CTAB 1BA0A 3ADAC 5CYMA 1FFWB 5F3TA 5KFBA 5C42A 3IP0A 2CIMA 1IG8A 3IN5A 1YJVA 1BY9A 1U6ZA 1R7IA 2PSZA 3HI0A 3JAMY 4C8ZA 1CQNA 3OFGA 2K3IA 5GMEA 2DNNA 3RB0A 2G0CA 3QEXA 1CJKB 3GV5B 3H8YA 1UPPA 3RSEB 3FKBA 4CEAA 3UN3A 3ZO7A 4A8OA 2R7WA 2M9KA 3UKRB 3R5GA 1Y0HA 4CGJA 4K8XA 2DNQA 4RWWA 4G6VB 4RWXA 2MQOA 3D1QA 2GNKA 2XLKA 3WXIA 4TYBA 4E3SA 4KTQA 2GGPB 4F0MA 2VA3A 3A5MC 4CGDA 1DQ8A 4M5DB 1XNQK 2RS2A 5AR0A 5BR8K 2KHDA 2IC3B 4FPRA 3BSCA 1TKTA 3WXJA 2XMMA 1FJ7A 5C24A 4CEQA 3QT8A 1HNXF 1YDLA 4IDKB 3V6HA 1HHQA 2JEGA 4ZTJA 5GAGP 4AHSA 2VFVA 1RWWB 3ILJA 1AUDA 2F9JA 4PKHA 3MN6A 4FL9A 1K73T 3OUYB 4JV5K 3QBXA 2MPUA 3JTPA 5IM0B 3V9XA 1LWFA 2ZFHA 4BCAA 2O4GA 4B1ZA 3ITHA 4G1PA 4USWA 2HK2A 5AQPA 2HBMA 2AT1B 2VYPA 5LM7E 4E98A 2DNKA 2DH8A 3TANA 2IBKA 1QAJA 4I6MB 4JI2F 4K4ZA 3EGNA 3U1NA 1Z4UA 1SC1B 2RQMA 3SQOP 1Q86T 2QLXA 3AXKA 3CD0A 3V1RA 2J7KA 3OXGA 1KKHA 3EVOA 4ZS6A 2XS2A 2GHWA 1JKHA 3OW2M 3CCES 3T69A 3DRRA 2VKZG 4WPAA 1RT1B 1KQGB 3I55N 3ZSXA 4PG5A 1VQNN 2O8EA 1ATSA 4OX9F 4ZPVR 4DU4A 1NPRA 5LOQA 3O80A 4KGXB 1UWAA 1NOZA 4CJQA 1AROP 2Z57B 3UD3P 3I33A 4Q0BA 2A0FB 5AQJA 5KFDA 1VQ9S 3E2EA 2WOMA 2YWKA 2HF3A 1NKCA 2B4VA 4DV3K 1E3MA 3CIZA 2BEFA 4ZCLA 5M2PA 5D4PA 3VEWA 4LFAK 2RILA 1IXKA 4CHQA 1DZ5A 3PZPA 4KHRA 1VLYA 2XO7A 2A41A 1J53A 3IFRA 3D6MB 2HQIA 4BC3A 1YQHA 2D9OA 4ID1A 1B0VA 2GEMA 1VQ7S 5HP1A 4M3TA 4X4UA 1ACMB 5H9EJ 1U48A 1FXDA 2OPSA 4I4BA 5KGXA 3N01A 3C6UB 1RGIA 3OR1A 4Y65A 4NEYA 4H5NA 5BPNA 1X60A 3OXFA 4N56A 4OPJA 5D0HA 2FHKA 2IVNA 5CXTA 3EKSA 1NSQA 1N32J 2HOEA 4GVLA 2IRUA 4JI6F 1KWMA 2FC9A 3W1YC 4DX6A 2A1SA 1RHKB 4CO1A 3EPGA 1BQNB 2Q3PA 4YB5A 3QEPA 4K50A 1RLCL 2O66A 1YJ7A 3SLCA 4HEA9 1RQ0A 1BCOA 1IJFB 4Z4IA 1D5AA 1WAJA 2CJAA 4GNIA 2N7YA 1D1UA 4MH8A 3LP1B 4USKA 4FK2A 3A8IA 2UU9K 4YN3B 4W90B 1U45A 3ZSWA 2R7TA 4UY8T 2XMUA 4E1NA 4LR7A 3UE2A 4F4XA 1QSYA 4A2AA 5DLFA 2EPIA 1JL1A 2IVPA 3L7PA 3R5JB 4CD1A 1HNXJ 4JOUA 2CNLB 1CZAN 1ELOA 1RDRA 4C8MA 4RWTA 5EU7A 1OPIA 3B54A 2XY7A 4WIQA 4X4RA 4OIXA 3ENBA 1OVQA 5EGYA 5E2QA 3NGTA 1N0UA 5HVHA 1WC5A 3SUNA 3MEGA 1WHYA 2RHQB 3C6HA 1VQSA 2A10A 3WC0A 3NCRA 2ITGA 3GFZA 2O4IA 4R8UB 2O8FA 1TL3A 2ASMA 4YOVA 4NMLA 1F0XA 4JKFA 4ILJA 5B09A 2P9NA 1IBLK 1J9AA 3TA1A 2G13A 4CTAA 2OMOA 4BR0A 2NXCA 3LW5C 3EZUA 3VGTA 3CFOA 3UWTA 3NP5A 1RTIB 4Y2CA 4B3SF 2BR0A 1Q16B 5U47A 1T03A 5HMYA 2CPJA 4PQUA 4HHJA 1SC4B 3RMCA 3WUHA 1CJKA 4ETZA 5IC6B 2OAUA 3RSEA 3Q8QB 4P2SA 1X4BA 2HFUA 3J7AP 3DOKB 1B0TA 4N77A 1S7HA 4OX9J 5M2UA 2H65B 3VAMA 4B9SA 1O1WA 1FTCA 2NRRA 2L48A 2WAQD 1UP1A 2ATCB 3SCIE 2B9YA 2W2PP 3HP9A 4NZ6A 2F7VA 4HTIA 5KG5A 1EO1A 1DGKN 3G8TA 1BO5O 2Z30B 2XM3A 1N52B 5HMZA 3MM5B 3H46O 1TR0A 2IC3A 4CJVA 1Q7LB 4YR3A 1VQMN 3TTCA 2DHXA 2D69A 1WSRA 4QS9A 4CIOA 2BZ2A 4FJHA 4ZTFA 5KFJA 4WFNL 2F8EX 3CJ8A 2ZH4A 3M5RA 2GO9A 2VH7A 1WSJA 3H08A 4BBYA 3EGWB 4C0BA 2JC1A 1WSHA 4AHCA 1WC3A 1XNRJ 1DAXA 1Y10A 3OUYA 1NO8A 1ZBFA 2HWHA 5IM0A 1U6BA 3PKMA 2PAVA 1MN9A 1VQLN 3D5MA 4RU9A 4JKHA 1SL0A 4Z37A 4CW7B 1O6XA 1ZBHA 2MY7A 1GXLA 3R1XA 1HBMB 2LDIA 2G8UA 4I6MA 3FEXB 3QBCA 5FRNA 1DTTB 3V4IB 4BLGA 2E5LK 3THXB 3NF6A 3ILLA 2YX4A 1EX4A 1N0VC 3CJBA 2WSFC 2HVHA 2ZJPL 1JXLA 2ZOGA 2DIVA 5D0RA 1P8GA 1Q81O 3VTIA 3HSTB 3PR4A 2QMXA 1Z25A 3EYZA 1T9VA 1XI1A 1GLEG 3CSKA 2DXDA 3GYNA 1RT1A 4RUAA 2ZH3A 2AJ0A 3RR7A 5J2MB 4CI6A 2F9TA 1NZ8A 4ZMMA 5J1EB 2E1YA 3SUPA 1OVYA 2WBRA 5AQVA 4CFAA 3KK3B 2JX2A 4B3MK 3EPIA 4JEPA 3J7Z5 3JYTA 5H9FJ 4ECVA 2UVVA 4CIGA 2CQ3A 2C3YA 3VQEA 3HCXA 1SQFA 1NK6A 4KREA 4FJMA 3J7AN 1RKJA 3VZHA 2FJEB 2IM3A 1Q53A 2A6MA 2RRBA 5B7WA 3ZT4A 4RNNA 3FQKA 4PXDA 2H3GX 4DX8H 4OI1A 2GUPA 3CJ0A 2V4QA 3AAQA 2DHAA 4FF2A 1A5XA 3K2PA 4DR4F 4PYDA 2BMBA 3BPDA 3M2VA 1NDLA 4OPHA 2Y1IA 2RD5C 5AZJB 4QIEA 1N33J 4J9PA 4N47A 2F4VK 3UE5A 3ENAA 3VERA 4M3UA 4NZ7A 3I0SB 2YQ1A 2HBYB 1N5VA 2PA8D 3TW0A 3AB2B 4M5JA 3VETA 4ZJOA 4X66F 3PW7A 3OHAA 4J9QA 4O8KA 3TTFA 1PC4A 2BOPA 4N8OA 3W3DA 3DU5A 2OSRA 3FZ2A 4B3SJ 4DU1A 2WC9A 5KAKA 3AVCA 3THWB 2RJZA 1X1PA 1FEHA 2R8GA 2P9PA 5FRMA 2R7XA 1C0UB 3CEDA 1RDDA 2ROGA 1RT3B 2PFDA 4HCBA 3C95A 5IXUA 3M8QB 4X64J 4BRGA 1QM9A 2D3O1 1RAGB 3K5PA 2YCHA 1EWQA 1M90T 1JJ2R 1NK7A 2YHWA 4CRJA 3W8PA 3NY0A 3HFZB 3MCPA 1SCJB 4L76A 2QXLA 1H73A 3IR7B 2IMWP 3M7VA 3LP1A 3LPUA 2ZJQL 4LF2A 1NNEA 3CJQA 1IBMK 3IRWP 1NGCA 4GV6A 4IRCA 2HMIB 1EJ7L 5G4DA 3C0BA 4LREA 4YEAA 3DWLA 2QA4S 4WBFA 3ZZYA 5E0OA 2CQBA 4WU2A 4P71A 1KCFA 3DLEA 3J80Y 1NU0A 1RAHB 4H8KA 2FZKB 3SV3A 1H0HB 4NLUA 2NRXA 5HMWA 3FRYA 3UB5A 3PCOB 3KD1E 2LEPA 1ZZFA 4EEYA 1B9FA 4LRAA 4HTJA 1XQSC 1SJ4P 4EZ9A 4LR8A 1BLUA 2HLTA 2GWJA 2CG4A 2CZ9A 3RR8A 4L6V3 3QFWA 2Q3SA 5J2QA 1VQ7N 2XZWA 1SC3B 3DYAB 2NLWA 2YPZA 2WVCA 1H6KX 3MMVA 5BPMA 3I87A 1FWKA 2E5JA 2UXCK 1RCXB 2JFDA 3VGVA 3VALA 5AXLA 2K1RB 3K5LA 1RDAA 3B6PA 4DL3A 1RTIA 2D0AA 4NASA 2FGOA 1X4EA 2P1JA 2P9CA 1VSDA 2D0BA 3HKZD 3T5LA 2PIIA 2WZ1A 1SKRA 1UEKA 1N5TA 1X9MA 3BSNA 5LSRA 1QS4A 4LF1A 2DKOB 3CPWM 3PIPL 3CC4N 3SNNA 1J5EF 3QSYB 3DOKA 3R5BA 4YOTA 3LP3A 3GFXA 3TVKA 4GY2B 3SQ4A 1NUEA 3FSXA 1ZC6A 1NJIO 4ZLPA 4JI0K 3PEHA 3W3SA 3S3OA 1VRUB 2CQGA 3KHLA 1C1BB 2HHUA 3D0PA 2DHGA 2GX9A 1VQ8N 2VC1A 5KFEA 1T7PA 2CUYA 2F3JA 3B6BA 1XR7A 5DLGA 2JOQA 4OZ1A 2ZJPQ 3GG4A 4BRKA 5AQGA 2J0XA 2RF2B 4FPAA 3HK2A 2FGCA 2P9GA 4BVPA 1JLFB 2V9KA 4KGMA 2VFRA 4Y34A 2FBYA 3LAKA 2QTDA 4AHUA 2N4CA 2A2DA 4BDYA 1KAXA 4DV6F 4CT8A 2XQCA 2VONA 4B8AB 2VCPA 3VGLA 1HNWF 4DZDA 3OBWA 5DK5A 1R89A 1HBNB 5D0EA 1CC8A 4KT0C 3LZIA 3ZZZA 4DUTA 4CGFA 5KT7A 3DI6A 1BE4A 3DU6A 3H2UB 4FYWB 3PO5A 3THXA 4WKRA 5GAHI 4P72A 2VJUA 4FWLA 3ALYA 1YSJA 4ES2A 1G6BA 5D4LA 3I0RA 3KNAA 5L9NA 3O9SA 3G0ZA 5A6WA 1WELA 5E26A 2GHVC 2IM1A 1JCFA 1HW9A 5HL7L 5A0YB 1NMNA 3VZIA 2X78A 2W42A 1OPZA 3DXKB 4ZPBA 5J1EA 3ZETA 3T3FA 1IR2A 1E6YA 2G8FA 2CA9A 3F41A 3KK3A 4DR1F 3V2UC 5AQOA 3G96A 1WDDA 5E5NA 3J7YI 4P9SA 2E20A 2YHYA 2Y3YA 2MQPA 2R2RA 1KRPA 5JJBA 3AGRA 4F67A 1WORA 2GJIA 2PI5A 2KT5A 5GIOA 4OV1A 3QMQA 2IVFB 3HI9A 3R9LA 4LBIA 5H1SQ 4FF4A 2YHAA 2JVRA 2NNWA 3G10A 3AVLA 3AXMA 2BXJA 2V4JB 3P4UB 1SH2A 2KZZA 5KFUA 1TUWA 2QLJB 2FSKA 1HPMA 3I0SA 2BUPA 2ZJQQ 3SBGA 2V2KA 1P9QC 1RI7A 3LDNA 4KH5A 4BC2A 2CPYA 4DPYA 4EO6A 1BL3A 3E9OA 4LF7F 1U8SA 3N4WA 2HLUA 5I3QA 2EX3A 2W25A 4DQRA 1LQ9A 3JTNA 1DBDA 4E8UA 1RT7A 1C0UA 4ISEA 1RT3A 4ED4A 4BR7A 2R7QA 1CEZA 1VQPS 4USUA 1J5EJ 2Q0RA 1BXNA 5E3QA 2G8HA 5SUHA 3M8QA 3PJXA 3M8WA 1J54A 1IQZA 4I6WA 1K8KA 5AQXA 2LQBA 2F8SA 1CULB 2R8KA 2CG8A 4MO4A 1WG4A 3EN9A 1Q5YA 4RKUC 1ZYQA 4CLWA 3CC2S 1YBAA 2F65A 2W1BA 4LF8J 6FD1A 5HQLA 2PFFB 3LPYA 1YUWA 4JHDA 3OFFA 4BWMA 3CJKB 5LXYA 5ADXA 2D9PA 2DGWA 3IS9B 4UZCA 5EX3A 1U02A 4BRHA 3GDQA 2IFXA 4O44B 2QA4G 1TK5A 4JLHA 3PIPQ 5JS1A 5BJRA 3QRRA 3RB4A 1V4TA 4H4KA 3NMRA 2YTCA 4UQTA 4QWEA 2CPFA 1B64A 3IAS9 2J4RA 2M8DB 3M8SA 4CP5A 5B0DA 2GV9A 3PYEA 1FK9B 4U7BA 5KFIA 2C2NA 1CZ9A 1S0NA 1KONA 4GVBB 4OZ3A 3DYAA 3KK1A 1S1XB 3M9MB 3JSBA 3CQYA 4W5OA 4Z2XA 1ESVA 1O51A 2V2VA 2QK9A 3QEWA 4CF2A 3SCJE 3TR5A 4HVJA 2ZJRQ 3SMSA 5DQHA 2E4LA 3CCVN 1SQKA 4W5RA 3NGRA 3RMAA 1Y5NB 2UVWA 2EG1A 4J91A 1UWBA 3P39A 5GAGU 4OLPA 3H2VE 2X7IA 4F25A 2G4BA 1I94K 2BX6A 4ZN3A 1Q79A 1RYSA 3ZTPA 1ICEB 5CZ1A 4WFBL 2VBZA 4H03B 4XAKA 3CCQS 1AT1B 1S49A 3J81Y 2Z2MA 1C1BA 2GAGC 1YAGA 5FPMA 3QPIA 2ZBCA 5HI7A 2KFNA 1IR1A 4FJ9A 4AUKA 1T05B 4ZPAA 4ED0A 4A8WA 4IH7A 1P6TA 5M1QA 3Q2SC 3FGUA 5A8KB 5G0RB 2DY4A 3IGVA 2BACA 3BKTA 3FEYB 2F96A 3KWIA 2RF2A 4I68A 1QAXA 3AA8A 3HP6A 3QGPA 1KVKA 4KY3A 3Q8PB 4GW6A 2P9UB 3KG0A 5C2GA 4BRPA 4Z4HA 5M1NA 4F26A 3TTDA 3B8HA 3A4TA 5DDPC 2D0PA 5H9EK 3C3LA 3BJYA 4NXMF 4WJBA 1UCNA 2VOPA 3VQDA 3PY8A 1E4FT 4YB7A 2PC6A 3SDEB 3CM6A 1KD1O 3OYKA 4KH4A 5ADXH 1PAEX 3HHEA 3ZC4A 3LPTA 3PM9A 3RW6A 2KYZA 1QUPA 5LXRA 4RBUA 2KB2A 2MTLA 1QSSA 2G8IA 2BW2A 3PUFA 2QSFA 4A8XA 2A18A 4HHTA 3X1LB 5DQGA 2XMTA 4OJ3A 2V94A 2JZ5A 2ZE2B 3AB4B 4RR5A 1LWEA 2V69A 5KT5A 4WZMA 4FJLA 1P9YA 3SYZA 4EUVA 4GV3A 5HLFA 5JMVA 4LVNP 5RUBA 2EC0A 4P73A 5F0UA 2BJ7A 1F6TA 1WC1A 5FLXU 2RHKA 3W63A 1A5WA 1S12A 3K2YA 5E7OB 5F3ZA 1HNXK 1V3RA 3HVTB 1H74A 3MMBA 5KFWA 3NAHA 2V68A 4FVUA 3BGRB 1WHVA 1K8AO 1S1UB 3Q7CA 2CJKA 1CVJA 1ILYA 2CGLA 4DCHA 3JQMA 2JEJA 2E8AA 4U9RA 1K8AT 3X3UA 1YF5L 2VA2A 3BUZB 4EYIB 3MF5A 5T14A 3RMBA 1DLOB 2YKPA 2V4JA 9RUBA 3ZSOA 2AX1A 3MN9A 3TUIC 2B56A 1W2BM 2YNFB 4JI2K 1Q8LA 4FNHA 1VIXA 3PW0A 1C0TB 1S9EA 4BC7A 2ZNYA 3RG6A 1VSIA 1VISA 2HQDA 4RCHA 2Q1NA 1HARA 4CLLA 1XK8A 4O0NA 1U1RA 2HNZA 2B9XA 4EP5A 1RBRA 1VC5A 5HQMA 4FWKA 4CIFA 4DV2J 1HBOB 5F8HA 3QIPB 4IFEA 2IM2A 4O4GA 1ZBIA 1NGDA 2NRHA 2DFFA 1KN6A 2XY8A 1OYDA 1H7WA 1R0CB 3CE8A 5KG3A 2DHHA 4OX9K 3FFIB 3F9KA 1N5QA 2DFHA 3J7YP 4ITSA 1FE4A 5M1PA 1V3SA 2VPZB 3R5DA 4QOTA 3VQBA 2AEJA 4KR0B 4CHZA 2M52A 3WEEB 3OW2R 2DGXA 3I5CA 2DEJA 4U7UD 3DHWC 2ZH8A 3DRSB 2NUBA 2KT3A 2BTFA 4YP3A 1UTAA 3P83D 1T0TV 4NRUA 1FNXH 1IWAA 1YBUA 2B6AA 3EXCX 1QVFM 1U1NA 4DV1F 2L3MA 4ZVRB 4DFJA 4TXSA 2R7RA 3PX6A 3D0GE 3T1YF 5TKWA 2IS3A 1EKSA 4OLBA 1P27B 1XNRK 1UW9A 2HFOA 1LV5A 3HMJG 3U6FA 4CECA 3N5FA 4UUWA 4CO3A 1W0HA 2HFSA 5JICA 5KFFA 5CY4A 1K1SA 4P6QA 4CH0S 4AQYF 3QZ8A 3IWXA 4B1WB 2X1FA 3CT9A 2W4CA 4GVBA 4DV0J 5J2PB 1TAUA 4JI6K 2Y1RI 1U09A 2GHPA 3HYFA 2PYLA 4AH9A 3HPHA 2XTJP 4CEFA 3ETMA 1NK4A 2PMHA 2YNGB 2CGKA 2AYMA 5ETMA 3KHRA 4XPEA 1HX1A 1B99A 1Y3KA 1X4FA 3L09A 1RTJA 4C1NK 1VSLA 1YI2S 3OY9A 1LFWA 2JJ4D 1BIZA 1JLGA 2AU0A 1YG0A 1GLBG 1TVRB 4IFVB 2CDQA 2EVZA 1WNSA 2ZNZA 1VHXA 1PO6A 1JX4A 2HZAA 2XHBA 3MXJA 3W8GA 3TPQA 1VBYA 1SKUB 3JSMB 2FSNA 4I67A 5H9FK 3QJPA 1FDDA 3P96A 5AE3A 4ID5A 2ZH9A 1UJ4A 4BE2A 4DKWA 1V4SA 4FWQA 1EQ0A 4JI1F 4YDDB 3TWHA 5BR9A 3UNYA 5AZIA 1YT3A 2FB0A 1KHVA 1NU4A 3QQCD 5A8KA 2A1RA 2Q0UA 3PSIA 3OYHA 2HMPA 4BRAA 3TUZC 3KHGA 5KPTA 4JS5A 4CHNA 1UW4A 2ATQA 3O1WA 1A0OB 4DTXA 1N33K 3OS2A 2W01A 2WBNA 2I2YA 1TL7B 1RA6A 4BG9A 4F0HA 3NWGA 5A6PA 2QLWA 3CCLS 4C8OA 4XEIA 5EY4A 6AT1B 1EARA 4DR7F 3R6MA 1S77D 3SDEA 5AQIA 1FXLA 1IG9A 4B3SK 3W7BA 2YKMA 4YY3J 2ZH7A 3AHPA 3IG1B 3DLJA 1SPBP 3VQPA 4F3MA 1FKOA 4HI1A 3KLVA 3K57A 3QJLA 1SBRA 3MD3A 2CQHA 2ADCA 3H5UA 2XYPB 4EYHB 2R4FA 3AD8C 4X64K 4OPKA 1LW0B 1C4AA 4NLWA 2X3GA 3T1HF 1JLEB 4FJ8A 1YJ9S 1RTDA 4E89A 1LFPA 4DR5F 1F9HA 3M05A 3ISNC 3NF8A 4EGLA 1XQIA 3MFHA 3AVHA 1YLXA 4ERDA 3D7EO 5AQTA 2N3LA 4HKQA 4Y2AA 3ENOA 2GIQA 1RGVA 1S1TA 3UCGA 4KRWA 3LQVA 4DL4A 1SJ3P 1RT2B 4OYWA 3PVXA 5AQNA 4PAAA 2C2MB 3HVTA 3TAMB 3FC9A 1ZXOA 1W97L 2GX8A 1S1UA 3H59A 4DV5F 2KQ2A 3T1YJ 2E1CA 3TVYA 3JSRA 3HD2A 3G71S 4KH0B 5ETPA 1HI8A 2I38A 5DG9A 4CEOA 5HOOA 5KFHA 3O3LA 1OO0B 1JL2A 1FVQA 4CM0A 2WRMA 3HVRA 1G1XA 5CZXA 2FLPA 2YWFA 2MSSA 3G6EN 1NHKL 3WT0A 2OPQB 5A8RB 1K47A 3MAAA 4IO8A 4G1IA 4B9NA 1C0TA 1NK9A 2BOAA 1P1LA 3BF4A 3LDQA 3V6JA 2ZBPA 5IQ6A 3AJDA 2HIYA 2DTUA 2HBJA 2ZC3A 5AJ3F 1SJ1A 2CVEA 2VPYB 4X4VA 1JQGA 1N4LA 1HBOA 4HACB 3QIPA 4E2FB 2V8PA 4F3QA 3TAEA 4P2FA 1XIQA 3OTCA 3FUYA 2VV5A 3MPUB 2WW4A 2WK4A 4USVA 2VG6B 4KPCA 2EBEA 3FFIA 4DN0A 3E1YA 2OJ3A 2MHEA 1R27B 5FLXY 3FRZA 1K9MT 1HL6A 3DLLQ 1QLNA 1RYRA 3EDRB 2YBVA 3EGVA 4ILHA 4O3RA 3AY0A 2C2RA 3WEEA 1PYSB 3W2WB 2HIQA 3PRDA 3FCHA 4EIAA 1OH5A 4DQIA 5A76A 2WB4A 5HRPA 4JI1J 4AL5A 2JVOA 3IDHA 3C14B 4WP8A 2R8HA 4E7JA 5KPRA 1FNMA 2ZGZA 1XMOF 3C6TB 8RUCA 3TX0A 3KLHB 3GBTA 3LUYA 4DTRA 2BVZA 1N36F 2ZWOA 4DR4K 2MMYA 4GKKJ 5KOWA 2AIRB 4LSNB 4FF1A 5D78A 4A47A 3UCUP 3RU0A 4LF9F 1ZTWA 3NEKA 3UD4P 3T41A 4X66K 2LU2A 2H1YA 4DR7J 1GLCG 2HNYB 4ZCKA 1CXQA 4ANCA 4CESA 2DXEA 3KDOA 1R59O 5J2PA 3EDQB 2HAIA 1RXOB 4KB1A 4O0JA 3WNGA 4ZPWR 4CZEA 3I32A 1KLMB 4IKFA 1GT8A 3OHBA 3QDKA 2Y1LB 2YNGA 1BG3A 3DCAA 3NHGA 1JLQA 2DT9A 3L7UA 5DZ7A 3D68A 1JXBA 2OTJS 5CYJA 3OVSA 4ER8A 2ZBRA 2LYVA 3QAUA 1GK8A 2ZOMA 4IFVA 3OV7A 3A8EA 1FF2A 3IUCA 4DR5J 3SUQA 1NLVA 3CCZA 3NGKA 1IVZA 2KM8C 3NKYA 5AQQA 4FLYA 3B6OA 2P9EA 3Q89A 3DLRA 1KP6A 2DCUB 4JV2A 1A5VA 5T7LB 2G2YA 2L9WA 4W5QA 2CADA 1XC9A 4E7LA 1YK9A 2N7CA 2AJ1A 2LKZA 1R0AB 1KR4A 4C3KA 3K9KA 2E7VA 3GTYX 4PZVA 2B3TB 1DQ9A 3F5TA 2D74B 4ECUA 4CZLA 3CC7N 1U47A 3RRGA 3VAFA 3KUEA 1CLFA 3CFPA 4DLEA 3D66A 1U2VB 4JK8A 3MPVA 2PD1A 4B3OB 2VQEJ 3NGIA 3Q8UA 2F4FA 4RNFA 3S41A 2EFNA 3UNGC 3CD6N 3UI3A 1VK3A 2E6MA 4M41A 4FXWA 4FDFA 6FDRA 4ED7A 1W9HA 3UIQA 1HWLA 1QHAA 1NCLA 1QQCA 1OSCA 3BP8A 3O6WA 4BROA 5AJ3J 3K7RA 3BKUA 1S99A 4V1Ak 2YI1A 1JLCB 1BD6A 4QWAA 2FZGB 1UFKA 2QEXS 8AT1B 4RLEA 4DJBA 3UQSA 3BF1A 1SJFA 4DCJB 1D09B 1J5EK 1EX8A 4J2DA 4IUFA 4CGIA 2ZH5A 1LNQA 3NNHA 4C4WA 1LW0A 3DOLB 3VPZA 5L1KA 2U1AA 1WN7A 3GP9A 3KUGA 1NPPA 2R2SA 4ED5A 1FRXA 4IO9L 1DKGD 3OLAA 4FCYA 4X4SA 1WBBA 3S6EA 2NZCA 3CPWR 4O0IA 1FKPB 1HI0P 2QLBB 5EXWA 5MAOA 1C0FA 3IMQJ 3PKYA 4CCHA 7FD1A 4OI6A 2NRWA 2E88A 3M1VB 2NR0A 4DSKA 2WCXA 1NBEB 1XMOJ 3KK7A 3MD1A 3OTBA 1RT2A 9ATCB 1U2FA 3TAMA 4AL7A 4NLOA 2UUCF 2WVFA 1N36J 4JUZA 3GJRB 3QFPA 1S5JA 2DBBA 3HL8A 4OGCA 4B9MA 4DV6K 3MM6B 3PYFA 1A7GE 4JV5J 2FY8A 3GCXP 2O67A 2Y0BB 5J2NB 1HNWK 2CQCA 1I5OB 3BR8A 1M5VC 3WIUA 2YNIB 1B70B 3R7BB 2KW4A 3OT9A 4C11A 2C3PA 4ZKAA 2P9SA 4ED3A 5I3UB 1IR0A 1W26A 4CHPA 4K4VA 4P7TA 1KTVA 3NAEA 4ZP8A 3SCLE 2BE2B 1XHXA 4J9KA 1VQ4N 3D3BJ 3DHXA 2FVSA 2Q1LA 2ATLA 4GO5X 4HACA 1F2HA 1Q0NA 3OYFA 4Y3CA 4ZVHA 2N3OA 1WOOA 4UF4A 3I56S 3OYNA 2Q2RA 3D6FB 3BN4A 4PHTX 3PJ9A 4LY7A 3A3PB 1MW7A 1OIAA 4NLQA 5F8MA 3CDEA 2APOA 2MEWA 4FYDA 2YX6A 4BS2A 4YB1P 4DR1K 5B8HA 2CGJA 3D0HE 3UVJB 3L2QA 3UR0A 4FLWA 3C15B 4P2MA 1FFGB 1WACA 3W2WA 4OYOA 1OSDA 3ULHA 2E5IA 3T9NA 4B9UA 3J81j 4WF9L 3W60A 1S79A 4DV3J 3OL9A 4MLHA 4FM0A 4YR0A 2KJWA 4JKGA 3SQGA 1YGYA 2XSJA 3SEOA 5DM6L 1Y7PA 3ZT1A 4BRCA 2V7YA 1SJQA 4ECQA 2G8WA 4ANDA 3PIOL 4KGZB 2KKHA 3G71N 1SKSA 4P10A 2RDDA 4OZLA 5K8MA 4DPOA 4NA3A 1MNEA 2KFZA 5IV4A 2F8TA 2HNYA 4CM2A 2ZDOA 3DN9A 1TZ0A 5LJ5Y 4XO0A 4LF7K 2RVJA 5KFYA 4QS7A 5HVFA 1CPZA 1KLMA 1VI7A 4K25A 1GOBA 1TKXA 4KTZA 2OUGA 4CERA 1YJUA 3V6KA 2W2QP 2FBVA 2MDAA 2MQ8A 5F9NA 3IO1A 3OVBA 3OQ2A 1DTQB 4IFYB 4PPDA 2IOCA 5EDWA 3G86A 1RNHA 1GH8A 4OYPA 2IA0A 4Q8FA 3M9NB 3DDIA 1M5KC 3AAPA 3V9UA 2RSQA 4EBDA 2ACMA 4KFBB 1C4CA 1PYOB 3R8EA 1M5OC 3W64A 1Q1KA 2VB6A 5I3PA 1G99A 4CJKA 2JEIA 2C2EA 3O2IA 3CJRA 4C97A 1KNZA 1MWZA 4HLBA 4PQAA 5T7LA 1RBVA 1RHJB 2H4YB 2BRKA 2W2NP 1IWGA 2QYCA 3TZXA 3PFOA 3VQCA 4UTGA 3H1VX 3LH2S 5L46A 3DKDA 4I6AA 2FVCA 1PJ5A 4Y2KA 3ZTSA 3TR8A 2ASJA 2FJVA 4NPOA 1KQFB 3DLKA 3HVWA 4HWIA 1VS3A 2YV0X 1UZHA 1GMVA 2Y0SD 4QPTA 4DMNA 4B3OA 1URRA 2DY1A 3W5ZA 1N56A 4IO9Q 2RNEA 1HBUA 4CF9A 1SI9A 1VDHA 2RT3A 1MMDA 2HHQA 3MM9B 3M1FA 3EJMA 4WFZA 1NDPA 3O4QA 2E1RA 3G2XA 3VGMA 4DV2K 3DOMB 2J9DE 1NJWA 3CI5A 4DWIA 2E9ZA 1PAUB 2CRLA 3DMJB 1NZAA 1QVGM 2YHXA 1HD0A 3PV8A 2A42A 3TUJC 4X65F 3QEVA 2CVIA 2QA2A 2HVEA 5DDQC 3IFEA 2OTJN 3EZ5A 3SQ1A 5C2FA 2BQUA 2DNOA 4OJHA 4F4KA 1RILA 2EK6A 4MJKA 3ZSQA 4UOFA 1SAZA 2RS8A 3N6LA 1X4CA 1FRMA 4NI2A 2NYIA 4TN2A 4G65A 4JV0A 3MCNA 5KFGA 2EI5A 2HVIA 3KJQB 1FHTA 2BYCA 4K4TA 1MU2B 2DNHA 2VGMA 4BHQA 2UUWA 3M1VA 4DTUA 4IJAA 3L3VA 4HVZA 4DR6F 3MXIA 2DD8S 3LP0B 2PO4A 1N34F 3U1LA 1K0VA 1NDCA 2O5DA 3H3NO 3MEEA 2D3OR 1V9OA 2BKPA 4HI2A 4QIFA 1HNIB 3MM6A 3IR5B 1NDKA 2IIRA 3J7YU 2O8CB 2LQ5A 4WQ5A 1T9WA 4M3ZA 2MQQA 5IS2A 4WCEL 1TP7A 3LOUA 2ZZTA 4DV0K 2XBPA 1TYQB 3DXMB 2KHOA 2IDLA 1UOCA 3VESA 2KN4A 3QATA 2M0GB 1RAFB 3NRBA 4ZIVA 5I3UA 4DDFA 1WF1A 3M2UB 4IDHA 3L4BC 3F2KA 3CQ8A 3ZEUA 4FLZA 1KQKA 3GFYA 3Q2TC 5DM6Q 2QEXN 1GOAA 3WNFA 2DH9A 1T8EA 3PIOQ 4EZ6A 5CYQA 3JAMU 1D3WA 2MQMA 4FYYB 5AT1B 1HWJA 4J9SA 4DTMA 3GMGA 1U2CA 1F9FA 2F63A 2FVPA 4LF5F 1RBUA 2VBYA 3UVJA 4A61A 2NXJA 4LF4F 4MQ3A 2PZSA 3C15A 1LW2B 4B3MJ 2B4PA 5EVZA 1FRHA 3DM2B 4M42A 2MKHA 1MN7A 4IR1A 5M2RA 1F5AA 3EWGA 3PW4A 3ID6A 4TLQA 3HKWA 1UETA 1QD1A 4GO7X 2AJ2A 3W9JA 2WUSA 3NGDA 5KPZA 1XR5A 1RDWX 3QRPA 3VAIA 3PSFA 3JS6A 3WX4A 4MK7A 2QYGA 2MZQA 5L1IA 3V5RA 2R7VA 1BGXT 3HHLD 4H5WA 1RU1A 3D28A 3FSYA 3MOZA 2EFOA 3N5BA 1PGZA 3HHDA 4PWWA 3QO9B 2I9SA 2XWYA 2M88A 5FPEA 1EP4B 4WE1A 5LMUF 3MGJA 2MZ1A 4DFKA 3HHLA 3W2VB 5GAGI 4OZJA 5KT2A 3PNIA 2ZH2A 1X4DA 4DQSA 3LDPA 4AD6A 1U49A 5C42B 2OIHA 3V9ZA 2BJEA 1IKVB 4USHA 2MKJA 2K7JA 2XWXA 2G0JA 3AOBA 4K5RA 1W2BR 4BQLA 4A46A 4ZP6A 4CLKA 4FJGA 1KVIA 3M32B 2B5JB 2FDNA 4LFBF 2HFNA 5KFKA 4X65J 3AA5X 3I55S 3ILOA 3SSQA 2KHCA 1UVKA 3KNGA 3P4IA 2XLIA 5BN9A 1DTQA 1J6ZA 1RDCA 3D6HB 3CDBA 2GVDB 1AZSA 1W7WA 1HKGA 1RAIB 3QESA 1H98A 1HA1A 2D3ZA 3CPEA 4XPCA 3BYRA 4DPXA 1GNKA 4KFBA 4K4SA 4EU0A 1WSIA 1EETB 1VQKS 3T5HA 3BDEA 1NSPA 5KG2A 1WOQA 4R5PB 1OWXA 5B0CA 3SAHA 3AVJA 4QIWD 1TKTB 1KVBA 2FHJD 1LK7A 2FUG9 5C24B 2BM0A 3CXCR 5HRSA 3HXMA 1F1BB 5B0BA 4DR6J 5FROA 2OEJA 5DM7L 1ZBSA 2ZGYA 1ITPA 4M5GA 3T1YK 1T9TA 1GMWD 4OV6A 5FIIA 2FHJA 2POKA 3E9PA 1N34J 3U3GA 1RT5A 2KG0A 2QL9B 4IH6A 1VSMA 3R3TA 1GMWA 4QWCA 1LWFB 2Q36A 2BKNA 2W9AA 1QVFR 2DXFA 3P31A 4AQYK 4F36A 4N5SA 4DL2A 1B4SA 3KHYA 3ZXWA 1HD1A 2ZWPA 3BEXA 3LTOA 2WB1D 4HT7A 4DUYF 4KHPJ 4RW8B 3HT0A 1KXPA 3OA9A 5EX5A 2DGUA 3HBTA 2UXCJ 4CJTA 4V19X 3DOMA 3AA3A 3RAQA 5J1NA 3ATUA 2ZBIA 8ATCB 3DMJA 4DL0C 4DPWA 1IO2A 1D8ZA 1JKHB 2FJDB 3M2RA 3S7RA 1FXXA 1ZBUA 3OS0A 3FJ2A 1D8YA 4B9LA 3V1OA 4M3RA 4WXOA 2O8EB 3G87A 1U2RA 2W6KA 5BYRA 3NMUA 2GFFA 1GLJO 1KQSM 2AYGA 2C1EB 3LALA 4AYBD 3E9LA 4LF5J 4MDBA 3DDNA 2O01C 3GYXB 2HWIA 2KYXA 4JI0J 5ELZA 1YTYA 2XMKA 1OJ4A 2QKBA 1C1CA 4NYPA 1BC6A 4JI1K 4KI6A 1S3XA 4H0PA 3MTJA 4I0WA 1HIYA 1K6YA 4PR6A 2HPUA 3VAHA 1J5OA 4U67L 4JAXA 5DRKA 3IMXA 3PW5A 5F8NA 2JHEA 2J9CA 3CUNA 4ELTA 3TU5A 3MWPA 4ZVFA 3LDSA 3AVNA 1X0PA 3OL8A 1CG2A 3G8QA 3FBEA 2QWLA 1B7YB 4GKKK 2NRTA 2IVOA 1S4FA 2Q6CA 1M5HA 3P1GA 3U1MA 4MFBA 5C25B 2B43A 4M5LA 3JB9k 2R7OA 2QGFB 3LAMA 5TKYA 3EXYA 1WSFA 2NXNA 5LMUJ 1HNIA 2W2OP 1TUUA 3SSSA 4CJ3A 3QB0A 1JJ4A 1Q8IA 4OYXA 2KI2A 4DR7K 3QWUA 4AL6A 3GJQB 1YJWN 1KC8O 2ABYA 1CQMA 4RBVA 5E84A 2DB1A 3CJ3A 4ENOA 2Q97A 2Q66A 3DXMA 1VQ6S 3H5XA 3OLBA 3J7ZT 3PX4A 4Y1DA 1XR6A 4RG8A 3I8DA 4LC9B 2R2UA 4NLPA 2MJNA 3M8PB 4LFBJ 2HRTA 2OPPB 5LL6Z 1NLKL 4NXNF 3KLEA 2ERRA 2QV6A 2I7PA 4AILC 4DR5K 3GE9A 4BY9C 1VBKA 5T41A 1NGBA 4OI4A 3THYA 3IXQA 1JJCB 3TEGA 4FW2A 1NEEA 2HGMA 3SMZA 3TAFA 1P1TA 4YS2A 2Q43A 4FZZA 5ETRA 2OD4A 1VRTB 3CGIA 1UAWA 3UDEA 4O5BA 1LW2A 2WONB 3QLHA 1VQMS 3DM2A 4FLTA 2HURA 5I4MA 4JI4F 3PO4A 4OLOA 2OFGX 5GVQA 3F73A 2PGCA 3BEGB 3V1QA 1XHZA 3VEVA 2CNNB 3CJCA 3P5BP 3O8WA 5C15A 4ICLA 3UO0A 4ZP9A 2NZTA 4CK1A 2MKCA 4PL7A 2M3DA 5B08A 3MEGB 5EX0A 3HOTA 3AV9A 2H54B 1JXVA 3LGNA 4CLTA 3QO9A 3KG4A 2AJFE 2C2KB 2LXFA 4R0EA 1EP4A 2O8FB 1X31C 5CD4H 1U0HA 2JL9A 3MM8B 3SBMA 3CDAA 4DUY