4DUYK

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 27
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4duyK00
4CW7B 4X62K 2VQEK 1IBKK 4JYAK 3J80O 5LL6Z 3J7AP 2UUCK 4DUYK 5LMNK 4V19S 1FJGK 4B3MK 4JI3K 4OX9K 1IBLK 4DV3K 5A2QO 4DR5K 4B3RK 4DV4K 5AJ3K 4LFBK 4JI1K 5LMUK 3J7YP 4DV6K 4DUZK 1XMOK 2F4VK 3T1HK 1HNXK 4K0KK 5FLXO 2UXDK 4DR1K 1N34K 5BR8K 4LF4K 4JI2K 2UXCK 3JAMO 4LF5K 4LF7K 4DR6K 4LF6K 4JV5K 4B3TK 4B3SK 2UUAK 1N33K 1XMQK 4DV0K 2VQFK 1I94K 4YHHK 3OTOK 2UUBK 4AQYK 1HNWK 4DR3K 2E5LK 4DV5K 4JI0K 1XNQK 4JI7K 4X65K 4GKKK 3J81O 4LFCK 4JI4K 2UU9K 4NXMK 4LFAK 3T1YK 1HR0K 4JI5K 4X64K 4LF8K 4JI8K 5IT9O 4LF9K 1J5EK 4X66K 4JI6K 4DV1K 4GKJK 4DV2K 2HHHK 1IBMK 1N36K 4DR4K 1N32K 5IWAK 2UXBK 4DR2K 4NXNK 2ZM6K 4KHPK 4DR7K 4DV7K 4YY3K 1XNRK 1HNZK 4CVNE
chains in the Genus database with same CATH superfamily
1NJYA 4Z94A 2ASOA 3P5JA 4NB4A 1DLOA 4FJHA 4IBNA 3CFPA 3H08A 5SWMA 1WSFA 1HKGA 5AQRA 3T1AA 5F2RA 2VG7A 1YI2N 1YVNA 4WQ4A 3SBTA 4BG9A 1FJGK 4H5WA 4DU4A 4DTUA 1NMNA 2O8BB 4FJGA 3CCMN 1QSYA 3C6UA 4CE9A 1KAYA 4M3XA 4KB1A 4RW9A 3V9UA 1NOYA 4M3TA 5BREA 3HXMA 4YOTA 3VEYA 4AM7A 1UA1A 1K8KA 3HT3A 2JGUA 4JD2B 2YKNA 3WXMB 1NLVA 4BWJA 1GLJO 4OPAA 4KPYA 2DTUA 3CMEN 5M1OA 1HYVA 4I9QA 1IV0A 3LAMA 1YITN 3UIQA 3NH2A 4OGCA 3EYZA 1SKWA 3H3NO 3M1FA 1CZBA 1KAZA 3I0RA 4WFAL 3D2EA 4W5QA 1YTUA 4BRDA 2V7YA 4DV0K 3DXKA 4CGDA 4ILHA 1E3MA 2P51A 1S72N 3VQAA 5C0YA 3LDNA 4YOVA 1TUYA 2E5LK 2BUPA 2G8FA 2OYQA 4CJ3A 4CJRA 2QWQA 3ZT3A 4BRPA 4K42A 4AHVA 4PL7A 1KVCA 3VEOA 1WSHA 3HSTB 3NCIA 3DRPA 4OKEA 3WNFA 3VERA 3VQDA 5J2QA 5FPNA 4LF8K 1LAWA 1J9AA 5AQOA 3R3LA 4E89A 5EU7A 4LD0A 1KD1O 3UE5A 5KI6A 3N4QA 4GKJK 4IDKA 4CEDA 5J2NA 5D3GA 3LDQA 1LCUA 3TSPA 4ILJA 3T7ZA 3DLLL 3THWB 4DR7K 4W5NA 4FK2A 3OYFA 2YHAA 5AQQA 1RT7A 1U2VA 5HRSA 2VGNA 5CR4A 2H3GX 4A5BA 3J7AP 4BRNA 2DFEA 4JHDB 1IG8A 3IAYA 4JI3K 3K2PA 5AZIB 1VQ8N 1I39A 2KZZA 2X78A 5KQDA 1IBLK 1BI4B 1UAXA 3QNNA 4FWQA 3WQUA 5AQWA 5AQTA 4MO5A 3QO9A 4CEFA 3EKSA 1NOZA 3M6GA 3R6MA 4DUZK 1S1TA 4I6MB 3CI5A 4FSVA 4F9OA 3HL8A 2UXDK 4C1NK 4KH5A 2Q2RA 3DYAA 4RW4A 3LDOA 1QVGM 3OW2M 5F0XA 3CETA 2IAJA 1IO2A 1BISA 2IC3A 5M1PA 4XH5A 4DTMA 1XC9A 5AQKA 1S6QA 4HCCA 4H5TA 1B92A 4BRMA 4WYBA 1BUPA 4FM1A 4KH6A 4XH1A 2OANA 2CH5A 3R1XA 4L3QA 2OA8A 2VQFK 1I94K 4M3ZA 4B08A 1TKZA 3RMBA 4Z4EA 3OJUA 2XY7A 4JKFA 2OTLN 1C0TA 2O8EB 4CK3A 4ELVA 4J8FA 1RT2A 4KV8A 1LAVA 4IZ9A 1DEJA 1S5JA 4FXDA 3DWLA 1TK5A 3O5BA 3O80A 4CZGA 4DTPA 1TKDA 2F9TA 3VF4A 1YUWA 4C1NI 4FWKA 1YAGA 1GLEG 1NK7A 4JI8K 3FZHA 1IKYA 2F96A 2WC9A 1NM1A 5GADP 1WSJA 3AVGA 3THXB 4H0VB 3RSEB 3FZLA 2KFNA 4FZYA 3HVTA 3O9UA 1L3TA 3NH1A 1WSIA 3SNNA 3SZ2A 4O5FA 3ZETA 1RTDA 3V9ZA 4DQSA 4RG8A 3M8QA 3TSUA 2VQEK 2NRZA 1SL2A 1S9EA 1IBKK 5LL6Z 4FLZA 4CHOA 4HWIA 1XHXA 4OPKA 3FGUA 3O8MA 2EX3A 3D2FA 3CJBA 3KLGA 2O8DA 4JS5A 4IXCA 4FWPA 1YJ9N 4YDUC 1HQUA 5KPTA 1HJRA 4BQLA 2YX6A 4JRQA 4FM0A 1KFDA 2IVOA 4Y1DA 3ZLJA 2VWBA 4K0KK 1RDUA 4JEPA 3BZKA 3NMUA 1N34K 1ZBSA 4QS9A 3KK3A 1BIUA 3THVA 2ZQBA 1EETA 3EKUA 5FROA 2X6NA 4BR2A 3DMJA 3C65A 4CZIA 4GMJB 4IWVA 3V1QA 4B1YB 4KHNA 3OTOK 2P9KA 5BRDA 1EO1A 5EY4A 3A5OC 3DLGA 3AVHA 3CD6N 2HHXA 4PKGA 4M42A 1VSEA 1HPMA 4YOYA 4CGGA 1W2BM 4KB0A 3M8PA 4CI6A 1IKWA 3NF7A 3ZX3A 1EQYA 1YHQN 5C42A 3DLBA 1O13A 5EX5A 3MDQA 1LWEA 2E2PA 1NGCA 3WNHA 3DM2A 3NFAA 5C24A 5AFUH 4FJ8A 3HI0A 4DV2K 4E1NA 1HKCA 1FK9A 4EP4A 1KVBA 1VQON 2Q97A 2YKMA 2UXBK 2QWNA 2D5RA 1NK5A 3KD5E 1N8RO 5LY3A 4DFMA 4GNIA 1HPZA 4CF2A 2Q0UA 4WE1A 1WAFA 3TAEA 4PQUA 1YT3A 2V52B 4QS7A 3VA0A 1WAJA 1TYQA 4C8LA 3CC2N 4W5RA 2QKBA 5BRHA 1HQEA 4CJUA 4EFHA 3A5NC 5A2QO 2G8KA 3TAPA 2Y1JA 4B8AB 4JI1K 3WNEA 5LMUK 3KJVA 4DWIA 5JVHL 3SV3A 2ZJQL 4DQRA 2AA4A 4F4KA 4CEAA 1T03A 1GOBA 2KW4A 2O8FB 5FDLA 1NK4A 1T8EA 3IG1A 1ITGA 3VTIA 4LF7K 2Z1JA 4EP5A 3WXKA 1NG9A 1U45A 2I5JA 3WEEA 3AAQA 1D9DA 4DLEA 3KWGA 1QHTA 1U6ZA 4O8KA 4I9LA 1Z6RA 2ZD1A 4CESA 4CECA 3AARA 3CQ8A 2Q0RA 3FLCO 3C95A 1WSGA 3DOKA 1KTQA 1OKJA 1U4BA 3H6EA 3LWMA 1TAQA 4GKKK 3TANA 3JSMA 3KLHA 1IKVA 2CGJA 1ASWA 4C8MA 3T1YK 2V7ZA 3VETA 4JK7A 1S9GA 4IFYA 4JI5K 3H1QA 3C7NB 5GIPA 2GTDA 1GLFO 3EO3A 3V1OA 2P9PA 3AVAA 2GUPA 1OH6A 1NJZA 2JWKA 4EZ9A 5C15A 4DF8A 3OHRA 1RT5A 3FE1A 1MA9B 3CF5L 5J2PA 2HB5A 4IFVA 4CHNA 4Q0BA 1VQ7N 4H0YB 4MQ3A 5ADXA 3DAWA 1HUXA 3AAPA 1G99A 3NF8A 4IG3A 1XC3A 1NGHA 3CCQN 3UKUA 2GX9A 4RW6A 1RDCA 4DUYK 5JLFA 4HUEA 3FR0A 1RBTA 3K5MA 1NGIA 3NF6A 3LP3A 3CJAA 3BP8A 3QFUA 1LW0A 3O9TA 4LFBK 1RT1A 4DV6K 3S3MA 3L2RA 1ZBLA 4DQ8A 1ATRA 2ETJA 3QMLA 3L3VA 4H4MA 1HNXK 4PUOA 1Y64A 5MLCQ 4E7KA 2A1SA 4RCHA 3AVBA 4WQ5C 3C0BA 2IIRA 3A5MC 1LWCA 3QICA 5EXWA 1QS4A 3EL2A 2QWOA 3OBYA 2ATQA 1NGDA 3C6AA 4U67L 2FSKA 2D0CA 4H0PA 3L3UA 4JV5K 4B1VA 3LPTA 4BREA 2OPSA 4CJLA 1B9DA 1C0FA 1VQKN 3UKRA 4OGEA 3OY9A 1BCOA 2E20A 1BA0A 1VSLA 4GVMA 3ALYA 1TKXA 3TTDA 3ZT0A 4YNQA 4Q5VA 3F5TA 3WQTA 4FLVA 3K5NA 3QEXA 2HF3A 3OYEA 2XY6A 2VWJA 4CJQA 2D4WA 2YNFA 5LJWA 4JKAA 2YJEA 4H4OA 2B4JA 1NK9A 4QS8A 1NWKA 4A59A 4DKWA 4Z4HA 2IVPA 3AVMA 4CZJA 4JS4A 4LH4A 1X3MA 2YV0X 4O0IA 1BDGA 1RDAA 1K8KB 4KHPK 4E7HA 4YY3K 2HHWA 5HOOA 2QWLA 4CVNE 3EZWA 2XO7A 3LDPA 3RR8A 1KQSM 3CCSN 3G10A 3QBXA 5AQSA 5M1QA 3OYKA 3I55N 2UUCK 2P9UA 2ZF5O 1ZYQA 4B3MK 5C25A 1CXQA 3J8AA 4HVJA 2JWLA 3D2EB 3Q7CA 2G8VA 4FZXC 3DLRA 3DXKB 4DR5K 1VQNN 2OZMA 3J7YP 1YF5L 4TSXA 4A61A 3K5OA 3ENHA 3NE6A 3T69A 3CYMA 3F9MA 2P9LA 4DFKA 3THYA 1NBWA 3OS0A 4CGJA 1NJXA 3QEWA 4ELUA 4J2DA 4QOZB 4OLAA 1TK0A 1RTHA 2HNYA 4BG8A 4DG1A 3U3GA 3LAKA 3ZSOA 4BRHA 2W40A 5E26A 3K9KA 3SJHA 2VCPA 1J5OA 1Z25A 4CGIA 5I42A 3MEGA 2Q36A 5EOYA 2NNWA 4DSKA 3KVGA 1RNHA 3NVMA 4FYDA 4JKEA 4H03B 1F21A 1QZ6A 4HUFA 4JKDA 3OYAA 3VTHA 5AZJA 4BR0A 4BR7A 1U2VB 3PX6A 4GV6A 2UU9K 3PY8A 3W3DA 4H5RA 2HBMA 3SPZA 3OBWA 3E1YA 2FSJA 4K8XA 1TL1A 4M7XA 2QTDA 3NBPA 3O4QA 4DSLA 4JKBA 2KZMA 2D1KA 3QETA 1FW6A 4B3OA 1X9MA 4N56A 5IWAK 2P1JA 2Q31A 3DOLA 3RRGA 4DR2K 4BRKA 1TVRA 4JNEA 2ASMA 3LZJA 2E2QA 1XNRK 1TK8A 2A1RA 1IH7A 4B9SA 3EE8A 4BRCA 2P9IA 1QQNA 3SQ1A 3K0SA 3V9XA 1L3UA 1TL3A 2E6LA 3ZEUA 3TR8A 3JYTA 3DLHA 4KREA 1YIJN 5LMNK 5CY4A 5AQJA 3ID6A 3CQYA 5HRRA 1K6YA 1D4XA 3L4IA 1VQ6N 4G1QA 4CIFA 1C0GA 3HOTA 3HPGA 1BHLA 5BPMA 5HROA 4FOEA 2NRXA 1XMOK 4OKKA 5JS2A 4JKGA 3A0IX 3MEEA 3TAFA 3D6RA 1JLBA 3T1HK 1WB9A 4BR4A 5C2DA 2F4VK 2GBZA 2QW9A 4CZEA 2O4GA 5M1NA 3MN7A 3JAMO 1U49A 1S3XA 4B1ZA 3WXLA 3HP9A 4CJEA 2FXUA 4YDUA 2OTJN 2X6SA 1XQSC 4DTSA 4LF6K 2E1YA 4CJVA 3ZX2A 4NO7A 1RCHA 2HHTA 4ISEA 1QQMA 2LSNA 5BN9A 3EY1A 3KKSA 3QFPA 2G8WA 3KHYA 1Y97A 3MK6A 4H0OA 4ISGA 3MWTA 4M3UA 2GWKA 4ILGB 1KCFA 3K57A 1NMDA 1RBSA 4WQ4C 2VGMA 4ID1A 1NGFA 1P8ZA 4CJ4A 4WCEL 1BQNA 3OYLA 4FWNA 3ZETB 3V1RA 3VGLA 3TABA 5HL7L 1K8AO 4LFCK 1RT4A 4NXMK 2HHVA 4IFEA 2GUIA 3KTQA 3BEXA 3WXIA 1BO5O 4BRFA 5FPEA 1NKCA 3D2FB 2O8DB 3F9KA 3AO1A 3SI6A 1ZBUA 4CBUA 4ICLA 4FJXA 3O1BA 2OZSA 3TAGA 4EAHD 1P90A 4BC3A 1BWFO 4Z4GA 3V9WA 1ZXOA 5GINA 3W0LA 2HNZA 1VSHA 2I7PA 5ELZA 4KHSA 1ILYA 3PX4A 3HVRA 2O4IA 4LC9B 4CW7B 1ATSA 1BCMA 3ASMA 2Y1IA 3I8DA 4K41A 3VMFB 3NH0A 1JKHA 1L5UA 5BR9A 5DM6L 4AHTA 4IDHA 1HRHA 5JICA 4FWOA 1BGXT 4R5PA 3V6DA 1VHXA 1SZ2A 4EZ6A 3U6FA 2P9KB 3O9SA 3O9RA 2D0BA 2NLXA 1FKPA 1BA1A 4BRGA 5CZ2A 2D0AA 1KAXA 3B6PA 1QQCA 5FLXO 4DHYA 1YJWN 4PL8A 2G8IA 4AHRA 4PA1A 5AQLA 3HZ6A 3QERA 1HLUA 1WLJA 3NVKA 2ASPA 4BVOA 4DQQA 4BGBA 4B3SK 3FZFA 2UUAK 1VQ4N 4FL9A 2FBTA 4FCYA 1NU0A 4A62A 1S1UA 2NZTA 1L3SA 1VSMA 4AQYK 4OO1J 4K25A 3CXCM 5CZ1A 4I2QA 2FBYA 4FW2A 2G8HA 2YNHA 1OH8A 1X1PA 1J6ZA 4X65K 5BPLA 4CD3A 2NRVA 1NK8A 3C6HA 3CPEA 4H0TB 1U04A 1SUQA 3J81O 3AO3A 3CCEN 4C8KA 1M90O 4LFAK 3FZKA 4BC2A 4CZMA 4U7BA 4LY7A 3ATVA 4DCHA 3VQPA 1TYQB 4JKHA 1VQLN 2Z1HA 1EXQA 4H5VA 3S41A 1J5EK 2HMPA 1NJWA 1ASVA 3G4SN 3P31A 3QESA 4FJNA 3ULEA 4CBWA 2E1ZA 2DPNA 1LW2A 3EN9A 2FBXA 1CLQA 3BZCA 4B9LA 3ENOA 3LP1A 4KHUA 1MDUB 3HPOA 2HMIA 3RMCA 4F3TA 4DV7K 4DB3A 4MO4A 3WT0A 1JLCA 3U9ZA 1VK0A 4ID5A 3KLEA 4FJIA 1S1XA 4ZTJA 2YCHA 3LPUA 3CC4N 4JLHA 3IFRA 5I9EB 2PZSA 3QINA 1QSSA 3WEEB 2F8SA 2ZGYA 3HRGA 4N5SA 4FJKA 1RFQA 3EZ5A 3T3FA 3PO5A 2FF6A 4CK2A 5AQUA 3V4IA 4CHZA 1H1VA 4N41A 4IJNA 1K9MO 4E7JA 3ENBA 3ZSZA 4J2EA 5C2FA 3EEQA 3U3YA 3TTCA 3Q7BA 3LM9A 3OYIA 2YNIA 3L2UA 3VF2A 1M1KO 3SK3A 3TAMA 4CFBA 2NRRA 1KXPA 2P9NA 4XH4A 3OYDA 4KRFA 1ZC6A 3NDKA 4GVEA 1EP4A 1N6QA 1N33K 4KO0A 1TAUA 3VQBA 2P9PB 4CHPA 5GAGP 2WONA 3AGRA 1HNWK 4WQ5A 4FLTA 4KI4A 1GLBG 2P9SA 4LSLA 3RTVA 4I7FA 3TARA 1C6VA 4YFUA 5GIOA 3CCLN 4NCAA 3VGKA 1S22A 1A5XA 4CFDA 4DQPA 4BC5A 3A2FA 1Q8IA 3TTFA 4B1WB 3PUFA 5AFUA 5AQMA 1BG3A 4OKJA 3P83D 3UKUB 4B9MA 4CZHA 1RDWX 1VSKA 5C12A 5M1FA 1C1BA 4F3OA 1Q82O 3O6WA 2AP1A 3JXUA 3MCAB 1ATNA 4DS4A 3OYNA 4CFAA 5ADXH 3S3NA 3ITHA 4GY2B 2HHHK 2HBKA 4DR4K 2KHOA 3VN5A 4AF1A 3HTVA 5HLFA 4NXNK 1BL3A 2ZM6K 3BUZB 2HF4A 3V81A 3C94A 4O55A 4CF0A 4CF9A 1WNSA 4H5NA 3ZT1A 4BQZA 4X62K 2CH6A 2FC0A 3NGZA 4GV3A 5AQXA 3E9OA 3AVLA 1DGKN 3CFRA 3AA4A 5KGWA 3L4QA 2O8CA 3J80O 4FWRA 3PSFA 2A40A 4KHQA 4PY5A 3CMAN 4PKIA 2RE2A 3D7EO 4OX9K 3AA3A 4ISFA 1TUUA 3CERA 3UKRB 2RN2A 4DV3K 2JLEA 1GLLO 1W9HA 4YOWA 3AY9A 5KQ8A 3QLHA 1MWKA 3VEZA 4AH9A 5FRNA 5B8HA 4IO9L 4DQIA 3AVFA 3TU5A 3KLIA 5AR0A 3PIOL 1Q86O 2ZGZA 4LF5K 3CCVN 4BE0A 1VSIA 5KPZA 1RILA 3CHWA 4DR6K 3SV4A 3MCPA 1Q7YO 3OYBA 1NNEA 3G71N 3I0SA 1KFSA 3E66A 1L3VA 3KD1E 3ISNC 3LDLA 1ASUA 4BE1A 2BGGA 1JXEA 1VSJA 4BRLA 4MDAA 4WFNL 3OS1A 1JCGA 1C0UA 2YNGA 4FOIA 3G25A 4CEZA 3M8RA 4BDZA 1XUPO 3IUCA 2QKKA 4H0XB 4RW8A 3OVNA 3E9PA 4FVUA 1C0MA 3DLEA 3LWLA 2E6MA 4G9ZA 3O3GA 4Z4FA 4M63C 5CE3A 5EVZA 1ESVA 4Z0UA 4BR9A 3SBGA 4BRAA 2VG5A 2P9UB 5IT9O 1RTIA 3F73A 4BRQA 1REVA 3CM5A 4JI6K 4IOCL 1DT9A 5GAHP 5DMRA 4C8OA 4M7YA 2OPQA 3TAQA 2E4LA 4PWDA 4MFBA 2HBJA 5JVGL 3CC7N 1A5WA 4MLHA 4FWLA 4KHWA 2V51B 1NGBA 4IOXA 4KTWA 2R7YA 4CIEA 1X9WA 2P9LB 3THYB 3GBTA 2WOMA 4IG0A 3ZSRA 3FZMA 3P1GA 3VQEA 4UQGA 1JLQA 2W42A 3OS2A 4AILC 5AQFA 5J2MA 2RF2A 4FJ5A 4CZLA 3ZSYA 2YJFA 2W6LA 3NGIA 3DXMA 4DTJA 2EHGA 4IO8A 2BH1A 1VSFA 3E01A 4KBOA 5JMVA 4DFJA 5BPNA 2QM1A 1NKEA 3D45A 3K5LA 3J7ZO 5DK5A 5KRTA 4CHYA 3SMSA 4L8RB 2W6KA 2HHUA 3VQ4A 3SQ4A 1VQMN 5AZJB 2QA4N 4PHTX 5FPMA 2VG6A 4HTUA 3BGRA 3MN5A 4NCBA 2GWJA 3AGKA 3QB0A 5JLHA 4DTOA 1RT3A 1HNVA 5DM7L 3ATUA 1JXBA 4KH4A 1EWQA 4ELTA 5BN8A 2QWMA 3RWUA 4FJJA 1RDDA 4CJ7A 2YHBA 4B9VA 3MMVA 4BRIA 3G0ZA 4HTLA 1I3AA 3E9LA 2X74A 2YHYA 1E4FT 2D0OA 3O1WA 4M3RA 1D5AA 5AQPA 3L8BA 3D0PA 2XY5A 4JI7K 1SL0A 2F8TA 4NYFA 2P9IB 2Q3SA 3PIPL 1VQPN 5LJVA 3ZEUB 3IDHA 3VESA 2QK9A 2Q1NA 3VQ9A 1NGGA 2A6AA 3AVIA 4JN4A 1QHAA 1OVYA 3VEXA 3BY5A 4IJAA 3CJ7A 4CJKA 3OYHA 1KRPA 4DU3A 4C8NA 3OJSA 4EHTA 3HPHA 1KVAA 4BR5A 3H3OB 4CD1A 1NK0A 3P38A 4E7LA 3N4PA 4B1XB 1T44A 2BDPA 2OCEA 4H8KA 3HJFA 4JKGB 4CEOA 5CYMA 1G15A 3HO1A 2B5JA 4FWSA 4Z4CA 1YJNN 1Q18A 3IRXA 2A3ZA 4AHCA 4M45A 2HVIA 4FJLA 4J2AA 3SUNA 4KHYA 3ZSVA 4B1UB 1YXQA 1WN7A 3JS6A 4JYAK 1X3NA 1VRTA 3CM6A 3M8SA 1U47A 4V19S 4BY9C 4KAZA 3L6QA 1QSLA 1BOTO 3IS9A 3SCXA 3AVKA 5AQVA 3OYMA 4BC4A 4BROA 3MN9A 4FJ7A 2Z1IA 3S9HA 3I33A 3QEPA 1UWBA 3IMXA 2D0PA 1BU6O 2YHWA 4DR1K 1SV5A 3F2KA 5BR8K 4DTRA 4KKOA 2GELA 1VQ9N 4ZHRA 3ZX0A 1W97L 2DFFA 2BTFA 4YOUA 1NGAA 3BF1A 3OYJA 2KFZA 4DSIA 3FFKB 1SL1A 4GW6A 4MDBA 4CJFA 2GEMA 5GAEP 2O8BA 2ZE2A 3CQXA 3SPYA 4BVPA 4OLBA 3GOIA 3WNGA 1QVFM 4JK8A 1X9JA 4I2PA 4FVMA 2ZJRL 4E3SA 1SAZA 1EKEA 1MU2A 3MXJA 3KIOA 4A2BA 3L2VA 4FLWA 3H46O 4JD2A 4CEEA 4IEIA 3S3OA 4Y0WA 1HYZA 4JI4K 2F7TA 3QEIA 2KTQA 3LL3A 1IG9A 4OJRA 4Z4IA 2ITMA 4BACA 3K9JA 2NRTA 1UA0A 4XIUA 4M3YA 2PYLA 3WUHA 1NGEA 2KQ2A 2PFUA 3A5LC 1BQMA 4RTFD 3RVCA 1JL2A 1XWLA 4CGHA 2IDOA 3O3HA 4JKCA 2KLAA 4B9NA 2QXLA 3ID8A 4AM6A 3MAQA 3QEVA 3CPWM 1Z05A 1C1CA 3VQ6A 2F9WA 3SUOA 3QDKA 5TKWA 1KSPA 2KKZA 3KK1A 3DRRA 3TPQA 1NJIO 1IJJA 2QWRA 4CK1A 4ZTFA 2J4RA 3CFOA 1NKBA 3OA9A 2VWKA 3QBWA 4A57A 4KTQA 4PKHA 3CCRN 5E84A 4MLEA 4CEBA 4JRPA 4DF4A 2EWSA 1CZ9A 5CHIA 1NK6A 1TGOA 1C1AA 2CGLA 3C6TA 3THWA 3HBTA 4BE2A 2IVNA 1DTTA 4LH5A 1JJ2M 4CERA 3B6OA 1RTJA 2A41A 3KKRA 4JAXA 4DS5A 1E4GT 4NCGA 3A8YA 5BRFA 4DSJA 4CF8A 1LV5A 4JHDA 1T7PA 2BANA 3GDQA 4OPHA 1T6CA 1DTQA 2UYTA 4B3TK 5AZIA 2IS3A 2FLOA 3T19A 3ULEB 1BI4A 1Q81O 1ZBHA 3PV8A 1V4SA 1QZ5A 4JI0K 3P39A 4I6MA 4CCHA 1W0HA 5J1EA 3TSQA 4E0DA 1R0AA 3RRHA 3VENA 5KGXA 2HW3A 4KI6A 1CXUA 3PSIA 5AQHA 3VQCA 5HRPA 5I3UA 1YTAA 1Q9XA 1KLMA 2HOEA 3DJCA 3SQ2A 5JS1A 4LF9K 4O5BA 4BDYA 4CFCA 1SQKA 3CJCA 4C23A 3ZT2A 1KLNA 2RKIA 1HJOA 1EWRA 4HCBA 3M3ZA 4WFBL 1N36K 1N32K 1D8YA 2O8EA 3V9SA 5AQGA 1SKSA 4FLXA 3K58A 4N76A 3RR7A 4GV9A 2DFHA 4HHTA 4EHUA 4DTXA 3CJ9A 4KFBA 3VOVA 1O1WA 1VQ5N 3MEDA 1SS6A 2NRWA 3AVJA 3NF9A 1U48A 4CJ5A 4CBXA 3SMPA 1T05A 2NUBA 2P9NB 1QQOA 3WXJA 1QE1A 4CZFA 3OYGA 4KTZA 1QTMA 5KPRA 3KK7A 3KWIA 2PY5A 4FW1A 3THXA 4K43A 1HNIA 3RSEA 3O4NA 4FJ9A 4DV4K 1GLAG 2P9SB 3CG7A 4B8CA 1VRUA 3OYCA 4R79A 3GG4A 3QIOA 4E1JA 5AQNA 2RHKA 3GE1A 3L2QA 4DLGA 4IKFA 3GL1A 1N5YA 3HM8A 1XI1A 2OPPA 4IEEA 3P4IA 3I56N 3G6EN 3HM9A 4FZZA 3VQ7A 3AO4A 3HYFA 1UOCA 4Y1CA 5E41A 1GLCG 2HHQA 4DTNA 1HYSA 4QCLA 3CIPA 4NLBA 4F2RA 3AV9A 4CHQA 3LZIA 1RGIA 1GOAA 1S6PA 4FK0A 1RDBA 4NYNA 4IOAL 2HVHA 2OPRA 4O4GA 3NHGA 3M5RA 4DU1A 3SLCA 3CCUN 1WBDA 4DMNA 1FXXA 1W7AA 1EX4A 1HR0K 2O8CB 2PAVA 1XHZA 5FPDA 1JLGA 4BGAA 1SKRA 1LWFA 3LANA 1S1WA 4B9TA 4DV1K 5KTQA 4NLCA 1VSDA 2A42A 1J53A 1IBMK 4N47A 2QI2A 1J54A 2B6AA 2IGIA 4CZKA 3AVNA 3RMAA 4RWTA 2DY4A 3BDPA 4EIAA 1R59O 2AJQA 1RBRA 1RBVA 2WFBA 4JI2K 5HP1A 2PBDA 1BIZA 4CJSA 1JCEA 3QNOA 1OH7A 4CIGA 3U4LA 2HBLA 2RPIA 2E2NA 4E1MA 2WUSA 3AA5X 1WOQA 3MECA 4E19A 3AA2A 1TV6A 3SJJA 1JLAA 4YOXA 3ZSWA 2Z1GA 5AJ3K 4F2SA 4BWMA 3PX0A 4FLYA 3O4WA 5K14A 4FPAA 3VEWA 1HMVA 1RT6A 3VQQA 3SQ0A 2P5OA 4LF4K 2UXCK 3QIPA 2G8UA 4E7IA 3VGMA 4M41A 4CEQA 1D9FA 3KZBA 2FSNA 2NRHA 3IKMA 3VQ8A 4CJTA 1HX1A 1RBUA 3KK2A 3HOSA 2E88A 4HUGA 2QEXN 4AHUA 1XMQK 2ZJPL 4CGFA 4J2BA 1Z26A 1Q9YA 2FF3B 4OPJA 2QWPA 4YHHK 5AQIA 4W5OA 2UUBK 2IOCA 4LSNA 3DI6A 2HSTA 4XEIA 3CJ1A 4DR3K 3R8EA 1K73O 4WF9L 5SZTA 2W41A 5FRMA 2O8FA 4FO0A 2I7NA 4RW7A 1JLFA 1LOTB 1WBBA 4F8RA 3KLFA 3SUPA 1JL1A 1YVUA 4X64K 3K59A 1HKBA 4X66K 4AHSA 3ZSQA 3ZYYX 3BF3A 3DXMB 1OVQA 1X9SA 4A5AA 3ULDA 3SAGA 1MWMA 3FFIA 5AQZA 3ZT4A 5KRSA 2ZWHA 2VYPA 1TKTA 4B9UA 3O9QA 3MWPA 4YORA 5HBMA 3PLAA 3B8AX 3VA3A 3PO4A 1JLEA 1WUAA 3VEVA 5C10A 3H45C 3SUQA 2CGKA 2HHSA 4FPBA 1JCFA 3EE9A 4FLUA 2FBVA 3C7NA 3TI0A 2YHXA 4UY8O 3LALA 3LM2A 3AO2A 5AQYA 3MXMA 4DSFA 3SAFA 1CZAN 2XRIA 3DRSA 3LP2A 3AO5A 4B3RK 3NAEA 1B9FA 4QAGA 4CJWA 1OH5A 2E8AA 3VF6A 3L2WA 3UB5A 3MX2A 2YI1A 1GLDG 3LDSA 1T3VA 2QXFA 3H1VX 5CYQA 2WTUA 3LP0A 3MXIA 5HRNA 2ITGA 3SAHA 3SYZA 4K8ZA 1NGJA 1V4TA 3ZSXA 2XY8A 3HK2A 1FKOA 4A2AA 1KC8O 2P5GA 3U9DA 5T7BA 1WSEA 4O0JA 4CF1A 5M1KA 3HSCA 4O44A 2PYJA 3MN6A 5F1XA 4DV5K 3AVCA 3O08A 1VAZA 2HNDA 3I8BA 3ZCMA 1XNQK 4FM2A 4W5TA 2WBNA 4BDPA 3R9PA 1DKGD 5H1SQ 4CJPA 4O8UA 3TWHA 4DSEA 2E2OA 2GV9A 1ZBFA 1S1VA 1GOCA 2XHBA 1IKXA 1T6DA 3HP6A 3DLKA 4DFPA 5TKYA 2A5XA 3RMDA 4OVLA 3U8XA 4B9QA 3CCJN 3O3FA 4M3WA 1A5VA 3L0QA 4FWMA 3NGYA 3MX5A 3VPZA 1ZBIA 4FK4A 2BE2A 3VQ5A 4JK9A 4FJMA 1HNZK
chains in the Genus database with same CATH topology
4CW7B 4X62K 2VQEK 1IBKK 4JYAK 3J80O 5LL6Z 3J7AP 2UUCK 4DUYK 5LMNK 4V19S 1FJGK 4B3MK 4JI3K 4OX9K 1IBLK 4DV3K 5A2QO 4DR5K 4B3RK 4DV4K 5AJ3K 4LFBK 4JI1K 5LMUK 3J7YP 4DV6K 4DUZK 1XMOK 2F4VK 3T1HK 1HNXK 4K0KK 5FLXO 2UXDK 4DR1K 1N34K 5BR8K 4LF4K 4JI2K 2UXCK 3JAMO 4LF5K 4LF7K 4DR6K 4LF6K 4JV5K 4B3TK 4B3SK 2UUAK 1N33K 1XMQK 4DV0K 2VQFK 1I94K 4YHHK 3OTOK 2UUBK 4AQYK 1HNWK 4DR3K 2E5LK 4DV5K 4JI0K 1XNQK 4JI7K 4X65K 4GKKK 3J81O 4LFCK 4JI4K 2UU9K 4NXMK 4LFAK 3T1YK 1HR0K 4JI5K 4X64K 4LF8K 4JI8K 5IT9O 4LF9K 1J5EK 4X66K 4JI6K 4DV1K 4GKJK 4DV2K 2HHHK 1IBMK 1N36K 4DR4K 1N32K 5IWAK 2UXBK 4DR2K 4NXNK 2ZM6K 4KHPK 4DR7K 4DV7K 4YY3K 1XNRK 1HNZK 4CVNE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CW7 B;  4X62 K;  2VQE K;  1IBK K;  4JYA K;  3J80 O;  5LL6 Z;  3J7A P;  2UUC K;  4DUY K;  5LMN K;  4V19 S;  1FJG K;  4B3M K;  4JI3 K;  4OX9 K;  1IBL K;  4DV3 K;  5A2Q O;  4DR5 K;  4B3R K;  4DV4 K;  5AJ3 K;  4LFB K;  4JI1 K;  5LMU K;  3J7Y P;  4DV6 K;  4DUZ K;  1XMO K;  2F4V K;  3T1H K;  1HNX K;  4K0K K;  5FLX O;  2UXD K;  4DR1 K;  1N34 K;  5BR8 K;  4LF4 K;  4JI2 K;  2UXC K;  3JAM O;  4LF5 K;  4LF7 K;  4DR6 K;  4LF6 K;  4JV5 K;  4B3T K;  4B3S K;  2UUA K;  1N33 K;  1XMQ K;  4DV0 K;  2VQF K;  1I94 K;  4YHH K;  3OTO K;  2UUB K;  4AQY K;  1HNW K;  4DR3 K;  2E5L K;  4DV5 K;  4JI0 K;  1XNQ K;  4JI7 K;  4X65 K;  4GKK K;  3J81 O;  4LFC K;  4JI4 K;  2UU9 K;  4NXM K;  4LFA K;  3T1Y K;  1HR0 K;  4JI5 K;  4X64 K;  4LF8 K;  4JI8 K;  5IT9 O;  4LF9 K;  1J5E K;  4X66 K;  4JI6 K;  4DV1 K;  4GKJ K;  4DV2 K;  2HHH K;  1IBM K;  1N36 K;  4DR4 K;  1N32 K;  5IWA K;  2UXB K;  4DR2 K;  4NXN K;  2ZM6 K;  4KHP K;  4DR7 K;  4DV7 K;  4YY3 K;  1XNR K;  1HNZ K;  4CVN E; 
#chains in the Genus database with same CATH topology
 1NJY A;  4Z94 A;  2ASO A;  3P5J A;  4NB4 A;  1DLO A;  4FJH A;  4IBN A;  3CFP A;  3H08 A;  5SWM A;  1WSF A;  1HKG A;  5AQR A;  3T1A A;  5F2R A;  2VG7 A;  1YI2 N;  1YVN A;  4WQ4 A;  3SBT A;  4BG9 A;  1FJG K;  4H5W A;  4DU4 A;  4DTU A;  1NMN A;  2O8B B;  4FJG A;  3CCM N;  1QSY A;  3C6U A;  4CE9 A;  1KAY A;  4M3X A;  4KB1 A;  4RW9 A;  3V9U A;  1NOY A;  4M3T A;  5BRE A;  3HXM A;  4YOT A;  3VEY A;  4AM7 A;  1UA1 A;  1K8K A;  3HT3 A;  2JGU A;  4JD2 B;  2YKN A;  3WXM B;  1NLV A;  4BWJ A;  1GLJ O;  4OPA A;  4KPY A;  2DTU A;  3CME N;  5M1O A;  1HYV A;  4I9Q A;  1IV0 A;  3LAM A;  1YIT N;  3UIQ A;  3NH2 A;  4OGC A;  3EYZ A;  1SKW A;  3H3N O;  3M1F A;  1CZB A;  1KAZ A;  3I0R A;  4WFA L;  3D2E A;  4W5Q A;  1YTU A;  4BRD A;  2V7Y A;  4DV0 K;  3DXK A;  4CGD A;  4ILH A;  1E3M A;  2P51 A;  1S72 N;  3VQA A;  5C0Y A;  3LDN A;  4YOV A;  1TUY A;  2E5L K;  2BUP A;  2G8F A;  2OYQ A;  4CJ3 A;  4CJR A;  2QWQ A;  3ZT3 A;  4BRP A;  4K42 A;  4AHV A;  4PL7 A;  1KVC A;  3VEO A;  1WSH A;  3HST B;  3NCI A;  3DRP A;  4OKE A;  3WNF A;  3VER A;  3VQD A;  5J2Q A;  5FPN A;  4LF8 K;  1LAW A;  1J9A A;  5AQO A;  3R3L A;  4E89 A;  5EU7 A;  4LD0 A;  1KD1 O;  3UE5 A;  5KI6 A;  3N4Q A;  4GKJ K;  4IDK A;  4CED A;  5J2N A;  5D3G A;  3LDQ A;  1LCU A;  3TSP A;  4ILJ A;  3T7Z A;  3DLL L;  3THW B;  4DR7 K;  4W5N A;  4FK2 A;  3OYF A;  2YHA A;  5AQQ A;  1RT7 A;  1U2V A;  5HRS A;  2VGN A;  5CR4 A;  2H3G X;  4A5B A;  3J7A P;  4BRN A;  2DFE A;  4JHD B;  1IG8 A;  3IAY A;  4JI3 K;  3K2P A;  5AZI B;  1VQ8 N;  1I39 A;  2KZZ A;  2X78 A;  5KQD A;  1IBL K;  1BI4 B;  1UAX A;  3QNN A;  4FWQ A;  3WQU A;  5AQW A;  5AQT A;  4MO5 A;  3QO9 A;  4CEF A;  3EKS A;  1NOZ A;  3M6G A;  3R6M A;  4DUZ K;  1S1T A;  4I6M B;  3CI5 A;  4FSV A;  4F9O A;  3HL8 A;  2UXD K;  4C1N K;  4KH5 A;  2Q2R A;  3DYA A;  4RW4 A;  3LDO A;  1QVG M;  3OW2 M;  5F0X A;  3CET A;  2IAJ A;  1IO2 A;  1BIS A;  2IC3 A;  5M1P A;  4XH5 A;  4DTM A;  1XC9 A;  5AQK A;  1S6Q A;  4HCC A;  4H5T A;  1B92 A;  4BRM A;  4WYB A;  1BUP A;  4FM1 A;  4KH6 A;  4XH1 A;  2OAN A;  2CH5 A;  3R1X A;  4L3Q A;  2OA8 A;  2VQF K;  1I94 K;  4M3Z A;  4B08 A;  1TKZ A;  3RMB A;  4Z4E A;  3OJU A;  2XY7 A;  4JKF A;  2OTL N;  1C0T A;  2O8E B;  4CK3 A;  4ELV A;  4J8F A;  1RT2 A;  4KV8 A;  1LAV A;  4IZ9 A;  1DEJ A;  1S5J A;  4FXD A;  3DWL A;  1TK5 A;  3O5B A;  3O80 A;  4CZG A;  4DTP A;  1TKD A;  2F9T A;  3VF4 A;  1YUW A;  4C1N I;  4FWK A;  1YAG A;  1GLE G;  1NK7 A;  4JI8 K;  3FZH A;  1IKY A;  2F96 A;  2WC9 A;  1NM1 A;  5GAD P;  1WSJ A;  3AVG A;  3THX B;  4H0V B;  3RSE B;  3FZL A;  2KFN A;  4FZY A;  3HVT A;  3O9U A;  1L3T A;  3NH1 A;  1WSI A;  3SNN A;  3SZ2 A;  4O5F A;  3ZET A;  1RTD A;  3V9Z A;  4DQS A;  4RG8 A;  3M8Q A;  3TSU A;  2VQE K;  2NRZ A;  1SL2 A;  1S9E A;  1IBK K;  5LL6 Z;  4FLZ A;  4CHO A;  4HWI A;  1XHX A;  4OPK A;  3FGU A;  3O8M A;  2EX3 A;  3D2F A;  3CJB A;  3KLG A;  2O8D A;  4JS5 A;  4IXC A;  4FWP A;  1YJ9 N;  4YDU C;  1HQU A;  5KPT A;  1HJR A;  4BQL A;  2YX6 A;  4JRQ A;  4FM0 A;  1KFD A;  2IVO A;  4Y1D A;  3ZLJ A;  2VWB A;  4K0K K;  1RDU A;  4JEP A;  3BZK A;  3NMU A;  1N34 K;  1ZBS A;  4QS9 A;  3KK3 A;  1BIU A;  3THV A;  2ZQB A;  1EET A;  3EKU A;  5FRO A;  2X6N A;  4BR2 A;  3DMJ A;  3C65 A;  4CZI A;  4GMJ B;  4IWV A;  3V1Q A;  4B1Y B;  4KHN A;  3OTO K;  2P9K A;  5BRD A;  1EO1 A;  5EY4 A;  3A5O C;  3DLG A;  3AVH A;  3CD6 N;  2HHX A;  4PKG A;  4M42 A;  1VSE A;  1HPM A;  4YOY A;  4CGG A;  1W2B M;  4KB0 A;  3M8P A;  4CI6 A;  1IKW A;  3NF7 A;  3ZX3 A;  1EQY A;  1YHQ N;  5C42 A;  3DLB A;  1O13 A;  5EX5 A;  3MDQ A;  1LWE A;  2E2P A;  1NGC A;  3WNH A;  3DM2 A;  3NFA A;  5C24 A;  5AFU H;  4FJ8 A;  3HI0 A;  4DV2 K;  4E1N A;  1HKC A;  1FK9 A;  4EP4 A;  1KVB A;  1VQO N;  2Q97 A;  2YKM A;  2UXB K;  2QWN A;  2D5R A;  1NK5 A;  3KD5 E;  1N8R O;  5LY3 A;  4DFM A;  4GNI A;  1HPZ A;  4CF2 A;  2Q0U A;  4WE1 A;  1WAF A;  3TAE A;  4PQU A;  1YT3 A;  2V52 B;  4QS7 A;  3VA0 A;  1WAJ A;  1TYQ A;  4C8L A;  3CC2 N;  4W5R A;  2QKB A;  5BRH A;  1HQE A;  4CJU A;  4EFH A;  3A5N C;  5A2Q O;  2G8K A;  3TAP A;  2Y1J A;  4B8A B;  4JI1 K;  3WNE A;  5LMU K;  3KJV A;  4DWI A;  5JVH L;  3SV3 A;  2ZJQ L;  4DQR A;  2AA4 A;  4F4K A;  4CEA A;  1T03 A;  1GOB A;  2KW4 A;  2O8F B;  5FDL A;  1NK4 A;  1T8E A;  3IG1 A;  1ITG A;  3VTI A;  4LF7 K;  2Z1J A;  4EP5 A;  3WXK A;  1NG9 A;  1U45 A;  2I5J A;  3WEE A;  3AAQ A;  1D9D A;  4DLE A;  3KWG A;  1QHT A;  1U6Z A;  4O8K A;  4I9L A;  1Z6R A;  2ZD1 A;  4CES A;  4CEC A;  3AAR A;  3CQ8 A;  2Q0R A;  3FLC O;  3C95 A;  1WSG A;  3DOK A;  1KTQ A;  1OKJ A;  1U4B A;  3H6E A;  3LWM A;  1TAQ A;  4GKK K;  3TAN A;  3JSM A;  3KLH A;  1IKV A;  2CGJ A;  1ASW A;  4C8M A;  3T1Y K;  2V7Z A;  3VET A;  4JK7 A;  1S9G A;  4IFY A;  4JI5 K;  3H1Q A;  3C7N B;  5GIP A;  2GTD A;  1GLF O;  3EO3 A;  3V1O A;  2P9P A;  3AVA A;  2GUP A;  1OH6 A;  1NJZ A;  2JWK A;  4EZ9 A;  5C15 A;  4DF8 A;  3OHR A;  1RT5 A;  3FE1 A;  1MA9 B;  3CF5 L;  5J2P A;  2HB5 A;  4IFV A;  4CHN A;  4Q0B A;  1VQ7 N;  4H0Y B;  4MQ3 A;  5ADX A;  3DAW A;  1HUX A;  3AAP A;  1G99 A;  3NF8 A;  4IG3 A;  1XC3 A;  1NGH A;  3CCQ N;  3UKU A;  2GX9 A;  4RW6 A;  1RDC A;  4DUY K;  5JLF A;  4HUE A;  3FR0 A;  1RBT A;  3K5M A;  1NGI A;  3NF6 A;  3LP3 A;  3CJA A;  3BP8 A;  3QFU A;  1LW0 A;  3O9T A;  4LFB K;  1RT1 A;  4DV6 K;  3S3M A;  3L2R A;  1ZBL A;  4DQ8 A;  1ATR A;  2ETJ A;  3QML A;  3L3V A;  4H4M A;  1HNX K;  4PUO A;  1Y64 A;  5MLC Q;  4E7K A;  2A1S A;  4RCH A;  3AVB A;  4WQ5 C;  3C0B A;  2IIR A;  3A5M C;  1LWC A;  3QIC A;  5EXW A;  1QS4 A;  3EL2 A;  2QWO A;  3OBY A;  2ATQ A;  1NGD A;  3C6A A;  4U67 L;  2FSK A;  2D0C A;  4H0P A;  3L3U A;  4JV5 K;  4B1V A;  3LPT A;  4BRE A;  2OPS A;  4CJL A;  1B9D A;  1C0F A;  1VQK N;  3UKR A;  4OGE A;  3OY9 A;  1BCO A;  2E20 A;  1BA0 A;  1VSL A;  4GVM A;  3ALY A;  1TKX A;  3TTD A;  3ZT0 A;  4YNQ A;  4Q5V A;  3F5T A;  3WQT A;  4FLV A;  3K5N A;  3QEX A;  2HF3 A;  3OYE A;  2XY6 A;  2VWJ A;  4CJQ A;  2D4W A;  2YNF A;  5LJW A;  4JKA A;  2YJE A;  4H4O A;  2B4J A;  1NK9 A;  4QS8 A;  1NWK A;  4A59 A;  4DKW A;  4Z4H A;  2IVP A;  3AVM A;  4CZJ A;  4JS4 A;  4LH4 A;  1X3M A;  2YV0 X;  4O0I A;  1BDG A;  1RDA A;  1K8K B;  4KHP K;  4E7H A;  4YY3 K;  2HHW A;  5HOO A;  2QWL A;  4CVN E;  3EZW A;  2XO7 A;  3LDP A;  3RR8 A;  1KQS M;  3CCS N;  3G10 A;  3QBX A;  5AQS A;  5M1Q A;  3OYK A;  3I55 N;  2UUC K;  2P9U A;  2ZF5 O;  1ZYQ A;  4B3M K;  5C25 A;  1CXQ A;  3J8A A;  4HVJ A;  2JWL A;  3D2E B;  3Q7C A;  2G8V A;  4FZX C;  3DLR A;  3DXK B;  4DR5 K;  1VQN N;  2OZM A;  3J7Y P;  1YF5 L;  4TSX A;  4A61 A;  3K5O A;  3ENH A;  3NE6 A;  3T69 A;  3CYM A;  3F9M A;  2P9L A;  4DFK A;  3THY A;  1NBW A;  3OS0 A;  4CGJ A;  1NJX A;  3QEW A;  4ELU A;  4J2D A;  4QOZ B;  4OLA A;  1TK0 A;  1RTH A;  2HNY A;  4BG8 A;  4DG1 A;  3U3G A;  3LAK A;  3ZSO A;  4BRH A;  2W40 A;  5E26 A;  3K9K A;  3SJH A;  2VCP A;  1J5O A;  1Z25 A;  4CGI A;  5I42 A;  3MEG A;  2Q36 A;  5EOY A;  2NNW A;  4DSK A;  3KVG A;  1RNH A;  3NVM A;  4FYD A;  4JKE A;  4H03 B;  1F21 A;  1QZ6 A;  4HUF A;  4JKD A;  3OYA A;  3VTH A;  5AZJ A;  4BR0 A;  4BR7 A;  1U2V B;  3PX6 A;  4GV6 A;  2UU9 K;  3PY8 A;  3W3D A;  4H5R A;  2HBM A;  3SPZ A;  3OBW A;  3E1Y A;  2FSJ A;  4K8X A;  1TL1 A;  4M7X A;  2QTD A;  3NBP A;  3O4Q A;  4DSL A;  4JKB A;  2KZM A;  2D1K A;  3QET A;  1FW6 A;  4B3O A;  1X9M A;  4N56 A;  5IWA K;  2P1J A;  2Q31 A;  3DOL A;  3RRG A;  4DR2 K;  4BRK A;  1TVR A;  4JNE A;  2ASM A;  3LZJ A;  2E2Q A;  1XNR K;  1TK8 A;  2A1R A;  1IH7 A;  4B9S A;  3EE8 A;  4BRC A;  2P9I A;  1QQN A;  3SQ1 A;  3K0S A;  3V9X A;  1L3U A;  1TL3 A;  2E6L A;  3ZEU A;  3TR8 A;  3JYT A;  3DLH A;  4KRE A;  1YIJ N;  5LMN K;  5CY4 A;  5AQJ A;  3ID6 A;  3CQY A;  5HRR A;  1K6Y A;  1D4X A;  3L4I A;  1VQ6 N;  4G1Q A;  4CIF A;  1C0G A;  3HOT A;  3HPG A;  1BHL A;  5BPM A;  5HRO A;  4FOE A;  2NRX A;  1XMO K;  4OKK A;  5JS2 A;  4JKG A;  3A0I X;  3MEE A;  3TAF A;  3D6R A;  1JLB A;  3T1H K;  1WB9 A;  4BR4 A;  5C2D A;  2F4V K;  2GBZ A;  2QW9 A;  4CZE A;  2O4G A;  5M1N A;  3MN7 A;  3JAM O;  1U49 A;  1S3X A;  4B1Z A;  3WXL A;  3HP9 A;  4CJE A;  2FXU A;  4YDU A;  2OTJ N;  2X6S A;  1XQS C;  4DTS A;  4LF6 K;  2E1Y A;  4CJV A;  3ZX2 A;  4NO7 A;  1RCH A;  2HHT A;  4ISE A;  1QQM A;  2LSN A;  5BN9 A;  3EY1 A;  3KKS A;  3QFP A;  2G8W A;  3KHY A;  1Y97 A;  3MK6 A;  4H0O A;  4ISG A;  3MWT A;  4M3U A;  2GWK A;  4ILG B;  1KCF A;  3K57 A;  1NMD A;  1RBS A;  4WQ4 C;  2VGM A;  4ID1 A;  1NGF A;  1P8Z A;  4CJ4 A;  4WCE L;  1BQN A;  3OYL A;  4FWN A;  3ZET B;  3V1R A;  3VGL A;  3TAB A;  5HL7 L;  1K8A O;  4LFC K;  1RT4 A;  4NXM K;  2HHV A;  4IFE A;  2GUI A;  3KTQ A;  3BEX A;  3WXI A;  1BO5 O;  4BRF A;  5FPE A;  1NKC A;  3D2F B;  2O8D B;  3F9K A;  3AO1 A;  3SI6 A;  1ZBU A;  4CBU A;  4ICL A;  4FJX A;  3O1B A;  2OZS A;  3TAG A;  4EAH D;  1P90 A;  4BC3 A;  1BWF O;  4Z4G A;  3V9W A;  1ZXO A;  5GIN A;  3W0L A;  2HNZ A;  1VSH A;  2I7P A;  5ELZ A;  4KHS A;  1ILY A;  3PX4 A;  3HVR A;  2O4I A;  4LC9 B;  4CW7 B;  1ATS A;  1BCM A;  3ASM A;  2Y1I A;  3I8D A;  4K41 A;  3VMF B;  3NH0 A;  1JKH A;  1L5U A;  5BR9 A;  5DM6 L;  4AHT A;  4IDH A;  1HRH A;  5JIC A;  4FWO A;  1BGX T;  4R5P A;  3V6D A;  1VHX A;  1SZ2 A;  4EZ6 A;  3U6F A;  2P9K B;  3O9S A;  3O9R A;  2D0B A;  2NLX A;  1FKP A;  1BA1 A;  4BRG A;  5CZ2 A;  2D0A A;  1KAX A;  3B6P A;  1QQC A;  5FLX O;  4DHY A;  1YJW N;  4PL8 A;  2G8I A;  4AHR A;  4PA1 A;  5AQL A;  3HZ6 A;  3QER A;  1HLU A;  1WLJ A;  3NVK A;  2ASP A;  4BVO A;  4DQQ A;  4BGB A;  4B3S K;  3FZF A;  2UUA K;  1VQ4 N;  4FL9 A;  2FBT A;  4FCY A;  1NU0 A;  4A62 A;  1S1U A;  2NZT A;  1L3S A;  1VSM A;  4AQY K;  4OO1 J;  4K25 A;  3CXC M;  5CZ1 A;  4I2Q A;  2FBY A;  4FW2 A;  2G8H A;  2YNH A;  1OH8 A;  1X1P A;  1J6Z A;  4X65 K;  5BPL A;  4CD3 A;  2NRV A;  1NK8 A;  3C6H A;  3CPE A;  4H0T B;  1U04 A;  1SUQ A;  3J81 O;  3AO3 A;  3CCE N;  4C8K A;  1M90 O;  4LFA K;  3FZK A;  4BC2 A;  4CZM A;  4U7B A;  4LY7 A;  3ATV A;  4DCH A;  3VQP A;  1TYQ B;  4JKH A;  1VQL N;  2Z1H A;  1EXQ A;  4H5V A;  3S41 A;  1J5E K;  2HMP A;  1NJW A;  1ASV A;  3G4S N;  3P31 A;  3QES A;  4FJN A;  3ULE A;  4CBW A;  2E1Z A;  2DPN A;  1LW2 A;  3EN9 A;  2FBX A;  1CLQ A;  3BZC A;  4B9L A;  3ENO A;  3LP1 A;  4KHU A;  1MDU B;  3HPO A;  2HMI A;  3RMC A;  4F3T A;  4DV7 K;  4DB3 A;  4MO4 A;  3WT0 A;  1JLC A;  3U9Z A;  1VK0 A;  4ID5 A;  3KLE A;  4FJI A;  1S1X A;  4ZTJ A;  2YCH A;  3LPU A;  3CC4 N;  4JLH A;  3IFR A;  5I9E B;  2PZS A;  3QIN A;  1QSS A;  3WEE B;  2F8S A;  2ZGY A;  3HRG A;  4N5S A;  4FJK A;  1RFQ A;  3EZ5 A;  3T3F A;  3PO5 A;  2FF6 A;  4CK2 A;  5AQU A;  3V4I A;  4CHZ A;  1H1V A;  4N41 A;  4IJN A;  1K9M O;  4E7J A;  3ENB A;  3ZSZ A;  4J2E A;  5C2F A;  3EEQ A;  3U3Y A;  3TTC A;  3Q7B A;  3LM9 A;  3OYI A;  2YNI A;  3L2U A;  3VF2 A;  1M1K O;  3SK3 A;  3TAM A;  4CFB A;  2NRR A;  1KXP A;  2P9N A;  4XH4 A;  3OYD A;  4KRF A;  1ZC6 A;  3NDK A;  4GVE A;  1EP4 A;  1N6Q A;  1N33 K;  4KO0 A;  1TAU A;  3VQB A;  2P9P B;  4CHP A;  5GAG P;  2WON A;  3AGR A;  1HNW K;  4WQ5 A;  4FLT A;  4KI4 A;  1GLB G;  2P9S A;  4LSL A;  3RTV A;  4I7F A;  3TAR A;  1C6V A;  4YFU A;  5GIO A;  3CCL N;  4NCA A;  3VGK A;  1S22 A;  1A5X A;  4CFD A;  4DQP A;  4BC5 A;  3A2F A;  1Q8I A;  3TTF A;  4B1W B;  3PUF A;  5AFU A;  5AQM A;  1BG3 A;  4OKJ A;  3P83 D;  3UKU B;  4B9M A;  4CZH A;  1RDW X;  1VSK A;  5C12 A;  5M1F A;  1C1B A;  4F3O A;  1Q82 O;  3O6W A;  2AP1 A;  3JXU A;  3MCA B;  1ATN A;  4DS4 A;  3OYN A;  4CFA A;  5ADX H;  3S3N A;  3ITH A;  4GY2 B;  2HHH K;  2HBK A;  4DR4 K;  2KHO A;  3VN5 A;  4AF1 A;  3HTV A;  5HLF A;  4NXN K;  1BL3 A;  2ZM6 K;  3BUZ B;  2HF4 A;  3V81 A;  3C94 A;  4O55 A;  4CF0 A;  4CF9 A;  1WNS A;  4H5N A;  3ZT1 A;  4BQZ A;  4X62 K;  2CH6 A;  2FC0 A;  3NGZ A;  4GV3 A;  5AQX A;  3E9O A;  3AVL A;  1DGK N;  3CFR A;  3AA4 A;  5KGW A;  3L4Q A;  2O8C A;  3J80 O;  4FWR A;  3PSF A;  2A40 A;  4KHQ A;  4PY5 A;  3CMA N;  4PKI A;  2RE2 A;  3D7E O;  4OX9 K;  3AA3 A;  4ISF A;  1TUU A;  3CER A;  3UKR B;  2RN2 A;  4DV3 K;  2JLE A;  1GLL O;  1W9H A;  4YOW A;  3AY9 A;  5KQ8 A;  3QLH A;  1MWK A;  3VEZ A;  4AH9 A;  5FRN A;  5B8H A;  4IO9 L;  4DQI A;  3AVF A;  3TU5 A;  3KLI A;  5AR0 A;  3PIO L;  1Q86 O;  2ZGZ A;  4LF5 K;  3CCV N;  4BE0 A;  1VSI A;  5KPZ A;  1RIL A;  3CHW A;  4DR6 K;  3SV4 A;  3MCP A;  1Q7Y O;  3OYB A;  1NNE A;  3G71 N;  3I0S A;  1KFS A;  3E66 A;  1L3V A;  3KD1 E;  3ISN C;  3LDL A;  1ASU A;  4BE1 A;  2BGG A;  1JXE A;  1VSJ A;  4BRL A;  4MDA A;  4WFN L;  3OS1 A;  1JCG A;  1C0U A;  2YNG A;  4FOI A;  3G25 A;  4CEZ A;  3M8R A;  4BDZ A;  1XUP O;  3IUC A;  2QKK A;  4H0X B;  4RW8 A;  3OVN A;  3E9P A;  4FVU A;  1C0M A;  3DLE A;  3LWL A;  2E6M A;  4G9Z A;  3O3G A;  4Z4F A;  4M63 C;  5CE3 A;  5EVZ A;  1ESV A;  4Z0U A;  4BR9 A;  3SBG A;  4BRA A;  2VG5 A;  2P9U B;  5IT9 O;  1RTI A;  3F73 A;  4BRQ A;  1REV A;  3CM5 A;  4JI6 K;  4IOC L;  1DT9 A;  5GAH P;  5DMR A;  4C8O A;  4M7Y A;  2OPQ A;  3TAQ A;  2E4L A;  4PWD A;  4MFB A;  2HBJ A;  5JVG L;  3CC7 N;  1A5W A;  4MLH A;  4FWL A;  4KHW A;  2V51 B;  1NGB A;  4IOX A;  4KTW A;  2R7Y A;  4CIE A;  1X9W A;  2P9L B;  3THY B;  3GBT A;  2WOM A;  4IG0 A;  3ZSR A;  3FZM A;  3P1G A;  3VQE A;  4UQG A;  1JLQ A;  2W42 A;  3OS2 A;  4AIL C;  5AQF A;  5J2M A;  2RF2 A;  4FJ5 A;  4CZL A;  3ZSY A;  2YJF A;  2W6L A;  3NGI A;  3DXM A;  4DTJ A;  2EHG A;  4IO8 A;  2BH1 A;  1VSF A;  3E01 A;  4KBO A;  5JMV A;  4DFJ A;  5BPN A;  2QM1 A;  1NKE A;  3D45 A;  3K5L A;  3J7Z O;  5DK5 A;  5KRT A;  4CHY A;  3SMS A;  4L8R B;  2W6K A;  2HHU A;  3VQ4 A;  3SQ4 A;  1VQM N;  5AZJ B;  2QA4 N;  4PHT X;  5FPM A;  2VG6 A;  4HTU A;  3BGR A;  3MN5 A;  4NCB A;  2GWJ A;  3AGK A;  3QB0 A;  5JLH A;  4DTO A;  1RT3 A;  1HNV A;  5DM7 L;  3ATU A;  1JXB A;  4KH4 A;  1EWQ A;  4ELT A;  5BN8 A;  2QWM A;  3RWU A;  4FJJ A;  1RDD A;  4CJ7 A;  2YHB A;  4B9V A;  3MMV A;  4BRI A;  3G0Z A;  4HTL A;  1I3A A;  3E9L A;  2X74 A;  2YHY A;  1E4F T;  2D0O A;  3O1W A;  4M3R A;  1D5A A;  5AQP A;  3L8B A;  3D0P A;  2XY5 A;  4JI7 K;  1SL0 A;  2F8T A;  4NYF A;  2P9I B;  2Q3S A;  3PIP L;  1VQP N;  5LJV A;  3ZEU B;  3IDH A;  3VES A;  2QK9 A;  2Q1N A;  3VQ9 A;  1NGG A;  2A6A A;  3AVI A;  4JN4 A;  1QHA A;  1OVY A;  3VEX A;  3BY5 A;  4IJA A;  3CJ7 A;  4CJK A;  3OYH A;  1KRP A;  4DU3 A;  4C8N A;  3OJS A;  4EHT A;  3HPH A;  1KVA A;  4BR5 A;  3H3O B;  4CD1 A;  1NK0 A;  3P38 A;  4E7L A;  3N4P A;  4B1X B;  1T44 A;  2BDP A;  2OCE A;  4H8K A;  3HJF A;  4JKG B;  4CEO A;  5CYM A;  1G15 A;  3HO1 A;  2B5J A;  4FWS A;  4Z4C A;  1YJN N;  1Q18 A;  3IRX A;  2A3Z A;  4AHC A;  4M45 A;  2HVI A;  4FJL A;  4J2A A;  3SUN A;  4KHY A;  3ZSV A;  4B1U B;  1YXQ A;  1WN7 A;  3JS6 A;  4JYA K;  1X3N A;  1VRT A;  3CM6 A;  3M8S A;  1U47 A;  4V19 S;  4BY9 C;  4KAZ A;  3L6Q A;  1QSL A;  1BOT O;  3IS9 A;  3SCX A;  3AVK A;  5AQV A;  3OYM A;  4BC4 A;  4BRO A;  3MN9 A;  4FJ7 A;  2Z1I A;  3S9H A;  3I33 A;  3QEP A;  1UWB A;  3IMX A;  2D0P A;  1BU6 O;  2YHW A;  4DR1 K;  1SV5 A;  3F2K A;  5BR8 K;  4DTR A;  4KKO A;  2GEL A;  1VQ9 N;  4ZHR A;  3ZX0 A;  1W97 L;  2DFF A;  2BTF A;  4YOU A;  1NGA A;  3BF1 A;  3OYJ A;  2KFZ A;  4DSI A;  3FFK B;  1SL1 A;  4GW6 A;  4MDB A;  4CJF A;  2GEM A;  5GAE P;  2O8B A;  2ZE2 A;  3CQX A;  3SPY A;  4BVP A;  4OLB A;  3GOI A;  3WNG A;  1QVF M;  4JK8 A;  1X9J A;  4I2P A;  4FVM A;  2ZJR L;  4E3S A;  1SAZ A;  1EKE A;  1MU2 A;  3MXJ A;  3KIO A;  4A2B A;  3L2V A;  4FLW A;  3H46 O;  4JD2 A;  4CEE A;  4IEI A;  3S3O A;  4Y0W A;  1HYZ A;  4JI4 K;  2F7T A;  3QEI A;  2KTQ A;  3LL3 A;  1IG9 A;  4OJR A;  4Z4I A;  2ITM A;  4BAC A;  3K9J A;  2NRT A;  1UA0 A;  4XIU A;  4M3Y A;  2PYL A;  3WUH A;  1NGE A;  2KQ2 A;  2PFU A;  3A5L C;  1BQM A;  4RTF D;  3RVC A;  1JL2 A;  1XWL A;  4CGH A;  2IDO A;  3O3H A;  4JKC A;  2KLA A;  4B9N A;  2QXL A;  3ID8 A;  4AM6 A;  3MAQ A;  3QEV A;  3CPW M;  1Z05 A;  1C1C A;  3VQ6 A;  2F9W A;  3SUO A;  3QDK A;  5TKW A;  1KSP A;  2KKZ A;  3KK1 A;  3DRR A;  3TPQ A;  1NJI O;  1IJJ A;  2QWR A;  4CK1 A;  4ZTF A;  2J4R A;  3CFO A;  1NKB A;  3OA9 A;  2VWK A;  3QBW A;  4A57 A;  4KTQ A;  4PKH A;  3CCR N;  5E84 A;  4MLE A;  4CEB A;  4JRP A;  4DF4 A;  2EWS A;  1CZ9 A;  5CHI A;  1NK6 A;  1TGO A;  1C1A A;  2CGL A;  3C6T A;  3THW A;  3HBT A;  4BE2 A;  2IVN A;  1DTT A;  4LH5 A;  1JJ2 M;  4CER A;  3B6O A;  1RTJ A;  2A41 A;  3KKR A;  4JAX A;  4DS5 A;  1E4G T;  4NCG A;  3A8Y A;  5BRF A;  4DSJ A;  4CF8 A;  1LV5 A;  4JHD A;  1T7P A;  2BAN A;  3GDQ A;  4OPH A;  1T6C A;  1DTQ A;  2UYT A;  4B3T K;  5AZI A;  2IS3 A;  2FLO A;  3T19 A;  3ULE B;  1BI4 A;  1Q81 O;  1ZBH A;  3PV8 A;  1V4S A;  1QZ5 A;  4JI0 K;  3P39 A;  4I6M A;  4CCH A;  1W0H A;  5J1E A;  3TSQ A;  4E0D A;  1R0A A;  3RRH A;  3VEN A;  5KGX A;  2HW3 A;  4KI6 A;  1CXU A;  3PSI A;  5AQH A;  3VQC A;  5HRP A;  5I3U A;  1YTA A;  1Q9X A;  1KLM A;  2HOE A;  3DJC A;  3SQ2 A;  5JS1 A;  4LF9 K;  4O5B A;  4BDY A;  4CFC A;  1SQK A;  3CJC A;  4C23 A;  3ZT2 A;  1KLN A;  2RKI A;  1HJO A;  1EWR A;  4HCB A;  3M3Z A;  4WFB L;  1N36 K;  1N32 K;  1D8Y A;  2O8E A;  3V9S A;  5AQG A;  1SKS A;  4FLX A;  3K58 A;  4N76 A;  3RR7 A;  4GV9 A;  2DFH A;  4HHT A;  4EHU A;  4DTX A;  3CJ9 A;  4KFB A;  3VOV A;  1O1W A;  1VQ5 N;  3MED A;  1SS6 A;  2NRW A;  3AVJ A;  3NF9 A;  1U48 A;  4CJ5 A;  4CBX A;  3SMP A;  1T05 A;  2NUB A;  2P9N B;  1QQO A;  3WXJ A;  1QE1 A;  4CZF A;  3OYG A;  4KTZ A;  1QTM A;  5KPR A;  3KK7 A;  3KWI A;  2PY5 A;  4FW1 A;  3THX A;  4K43 A;  1HNI A;  3RSE A;  3O4N A;  4FJ9 A;  4DV4 K;  1GLA G;  2P9S B;  3CG7 A;  4B8C A;  1VRU A;  3OYC A;  4R79 A;  3GG4 A;  3QIO A;  4E1J A;  5AQN A;  2RHK A;  3GE1 A;  3L2Q A;  4DLG A;  4IKF A;  3GL1 A;  1N5Y A;  3HM8 A;  1XI1 A;  2OPP A;  4IEE A;  3P4I A;  3I56 N;  3G6E N;  3HM9 A;  4FZZ A;  3VQ7 A;  3AO4 A;  3HYF A;  1UOC A;  4Y1C A;  5E41 A;  1GLC G;  2HHQ A;  4DTN A;  1HYS A;  4QCL A;  3CIP A;  4NLB A;  4F2R A;  3AV9 A;  4CHQ A;  3LZI A;  1RGI A;  1GOA A;  1S6P A;  4FK0 A;  1RDB A;  4NYN A;  4IOA L;  2HVH A;  2OPR A;  4O4G A;  3NHG A;  3M5R A;  4DU1 A;  3SLC A;  3CCU N;  1WBD A;  4DMN A;  1FXX A;  1W7A A;  1EX4 A;  1HR0 K;  2O8C B;  2PAV A;  1XHZ A;  5FPD A;  1JLG A;  4BGA A;  1SKR A;  1LWF A;  3LAN A;  1S1W A;  4B9T A;  4DV1 K;  5KTQ A;  4NLC A;  1VSD A;  2A42 A;  1J53 A;  1IBM K;  4N47 A;  2QI2 A;  1J54 A;  2B6A A;  2IGI A;  4CZK A;  3AVN A;  3RMA A;  4RWT A;  2DY4 A;  3BDP A;  4EIA A;  1R59 O;  2AJQ A;  1RBR A;  1RBV A;  2WFB A;  4JI2 K;  5HP1 A;  2PBD A;  1BIZ A;  4CJS A;  1JCE A;  3QNO A;  1OH7 A;  4CIG A;  3U4L A;  2HBL A;  2RPI A;  2E2N A;  4E1M A;  2WUS A;  3AA5 X;  1WOQ A;  3MEC A;  4E19 A;  3AA2 A;  1TV6 A;  3SJJ A;  1JLA A;  4YOX A;  3ZSW A;  2Z1G A;  5AJ3 K;  4F2S A;  4BWM A;  3PX0 A;  4FLY A;  3O4W A;  5K14 A;  4FPA A;  3VEW A;  1HMV A;  1RT6 A;  3VQQ A;  3SQ0 A;  2P5O A;  4LF4 K;  2UXC K;  3QIP A;  2G8U A;  4E7I A;  3VGM A;  4M41 A;  4CEQ A;  1D9F A;  3KZB A;  2FSN A;  2NRH A;  3IKM A;  3VQ8 A;  4CJT A;  1HX1 A;  1RBU A;  3KK2 A;  3HOS A;  2E88 A;  4HUG A;  2QEX N;  4AHU A;  1XMQ K;  2ZJP L;  4CGF A;  4J2B A;  1Z26 A;  1Q9Y A;  2FF3 B;  4OPJ A;  2QWP A;  4YHH K;  5AQI A;  4W5O A;  2UUB K;  2IOC A;  4LSN A;  3DI6 A;  2HST A;  4XEI A;  3CJ1 A;  4DR3 K;  3R8E A;  1K73 O;  4WF9 L;  5SZT A;  2W41 A;  5FRM A;  2O8F A;  4FO0 A;  2I7N A;  4RW7 A;  1JLF A;  1LOT B;  1WBB A;  4F8R A;  3KLF A;  3SUP A;  1JL1 A;  1YVU A;  4X64 K;  3K59 A;  1HKB A;  4X66 K;  4AHS A;  3ZSQ A;  3ZYY X;  3BF3 A;  3DXM B;  1OVQ A;  1X9S A;  4A5A A;  3ULD A;  3SAG A;  1MWM A;  3FFI A;  5AQZ A;  3ZT4 A;  5KRS A;  2ZWH A;  2VYP A;  1TKT A;  4B9U A;  3O9Q A;  3MWP A;  4YOR A;  5HBM A;  3PLA A;  3B8A X;  3VA3 A;  3PO4 A;  1JLE A;  1WUA A;  3VEV A;  5C10 A;  3H45 C;  3SUQ A;  2CGK A;  2HHS A;  4FPB A;  1JCF A;  3EE9 A;  4FLU A;  2FBV A;  3C7N A;  3TI0 A;  2YHX A;  4UY8 O;  3LAL A;  3LM2 A;  3AO2 A;  5AQY A;  3MXM A;  4DSF A;  3SAF A;  1CZA N;  2XRI A;  3DRS A;  3LP2 A;  3AO5 A;  4B3R K;  3NAE A;  1B9F A;  4QAG A;  4CJW A;  1OH5 A;  2E8A A;  3VF6 A;  3L2W A;  3UB5 A;  3MX2 A;  2YI1 A;  1GLD G;  3LDS A;  1T3V A;  2QXF A;  3H1V X;  5CYQ A;  2WTU A;  3LP0 A;  3MXI A;  5HRN A;  2ITG A;  3SAH A;  3SYZ A;  4K8Z A;  1NGJ A;  1V4T A;  3ZSX A;  2XY8 A;  3HK2 A;  1FKO A;  4A2A A;  1KC8 O;  2P5G A;  3U9D A;  5T7B A;  1WSE A;  4O0J A;  4CF1 A;  5M1K A;  3HSC A;  4O44 A;  2PYJ A;  3MN6 A;  5F1X A;  4DV5 K;  3AVC A;  3O08 A;  1VAZ A;  2HND A;  3I8B A;  3ZCM A;  1XNQ K;  4FM2 A;  4W5T A;  2WBN A;  4BDP A;  3R9P A;  1DKG D;  5H1S Q;  4CJP A;  4O8U A;  3TWH A;  4DSE A;  2E2O A;  2GV9 A;  1ZBF A;  1S1V A;  1GOC A;  2XHB A;  1IKX A;  1T6D A;  3HP6 A;  3DLK A;  4DFP A;  5TKY A;  2A5X A;  3RMD A;  4OVL A;  3U8X A;  4B9Q A;  3CCJ N;  3O3F A;  4M3W A;  1A5V A;  3L0Q A;  4FWM A;  3NGY A;  3MX5 A;  3VPZ A;  1ZBI A;  4FK4 A;  2BE2 A;  3VQ5 A;  4JK9 A;  4FJM A;  1HNZ K; 
#chains in the Genus database with same CATH homology
 4CW7 B;  4X62 K;  2VQE K;  1IBK K;  4JYA K;  3J80 O;  5LL6 Z;  3J7A P;  2UUC K;  4DUY K;  5LMN K;  4V19 S;  1FJG K;  4B3M K;  4JI3 K;  4OX9 K;  1IBL K;  4DV3 K;  5A2Q O;  4DR5 K;  4B3R K;  4DV4 K;  5AJ3 K;  4LFB K;  4JI1 K;  5LMU K;  3J7Y P;  4DV6 K;  4DUZ K;  1XMO K;  2F4V K;  3T1H K;  1HNX K;  4K0K K;  5FLX O;  2UXD K;  4DR1 K;  1N34 K;  5BR8 K;  4LF4 K;  4JI2 K;  2UXC K;  3JAM O;  4LF5 K;  4LF7 K;  4DR6 K;  4LF6 K;  4JV5 K;  4B3T K;  4B3S K;  2UUA K;  1N33 K;  1XMQ K;  4DV0 K;  2VQF K;  1I94 K;  4YHH K;  3OTO K;  2UUB K;  4AQY K;  1HNW K;  4DR3 K;  2E5L K;  4DV5 K;  4JI0 K;  1XNQ K;  4JI7 K;  4X65 K;  4GKK K;  3J81 O;  4LFC K;  4JI4 K;  2UU9 K;  4NXM K;  4LFA K;  3T1Y K;  1HR0 K;  4JI5 K;  4X64 K;  4LF8 K;  4JI8 K;  5IT9 O;  4LF9 K;  1J5E K;  4X66 K;  4JI6 K;  4DV1 K;  4GKJ K;  4DV2 K;  2HHH K;  1IBM K;  1N36 K;  4DR4 K;  1N32 K;  5IWA K;  2UXB K;  4DR2 K;  4NXN K;  2ZM6 K;  4KHP K;  4DR7 K;  4DV7 K;  4YY3 K;  1XNR K;  1HNZ K;  4CVN E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...