4DUYK

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 27
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4duyK00
2HHHK 3T1YK 4NXMK 2UXCK 1N36K 1HNXK 4GKKK 4JI1K 2VQFK 2UUCK 4B3TK 4LF7K 4YY3K 1XMOK 1N32K 4JYAK 4DV7K 4DR7K 5A2QO 4DV4K 1I94K 4YHHK 4DR6K 2UUBK 1HR0K 4OX9K 5LMUK 3J80O 3J7AP 2F4VK 4B3RK 5LL6Z 4DR4K 1XMQK 4DR2K 4LF9K 4X65K 2ZM6K 4X66K 1N33K 2UUAK 4LFBK 4JI4K 4GKJK 1IBKK 2VQEK 4LF5K 3OTOK 4DV6K 4B3MK 1HNZK 4AQYK 4JI2K 5BR8K 1XNQK 1IBLK 2E5LK 4DR5K 4K0KK 4JI3K 4LF4K 4JV5K 4JI8K 3J81O 4DV3K 1J5EK 2UXBK 1XNRK 4DV5K 5IWAK 4DV1K 5AJ3K 5FLXO 4B3SK 4CVNE 4DUZK 4KHPK 4LF8K 5IT9O 4CW7B 4JI6K 5LMNK 4LFCK 4JI7K 1HNWK 4DUYK 4DR3K 3T1HK 4X64K 4LF6K 2UU9K 1FJGK 4DV2K 4X62K 4JI0K 3J7YP 4DV0K 4JI5K 2UXDK 4V19S 1IBMK 4LFAK 3JAMO 1N34K 4NXNK 4DR1K
chains in the Genus database with same CATH superfamily
2HHHK 2YJFA 3AVFA 2P1JA 3O3GA 2GUIA 5M1QA 4YY3K 3S9HA 3A5OC 4JD2A 3SQ2A 4BWMA 1ZXOA 4YNQA 4IOXA 2E2OA 3ULEB 1C1AA 5BR9A 3D0PA 3MWTA 3TPQA 4R79A 3WXMB 1YUWA 3P5JA 4IO9L 3V4IA 5KPTA 3D45A 1YF5L 4CBXA 2XO7A 5LMUK 1Q8IA 1NOYA 2V7YA 4DTOA 4EP5A 3CJ7A 1XI1A 4LF9K 3SJHA 3RRHA 1HNIA 3HPOA 2P9UA 1D4XA 3FFKB 3CCQN 4RW8A 3CJAA 1VAZA 2BDPA 4FJ9A 3VQDA 4F4KA 2ASPA 2Y1IA 3OTOK 1M90O 3CCMN 4CJKA 5M1OA 1JLFA 4FJIA 1K6YA 4B9LA 2VCPA 4H0XB 4JI8K 1SZ2A 4AHVA 4JKAA 4FVMA 2IIRA 3T69A 3M5RA 4DV1K 1RTHA 3H45C 4HCBA 1QS4A 4BR2A 3OS2A 3V9SA 2A1RA 3WT0A 5KGXA 4W5TA 2O8BA 3QEXA 3LANA 3O9UA 2A40A 1XC9A 2F96A 4JHDB 2FLOA 1S9EA 1WB9A 4KTWA 3CXCM 1DEJA 3HK2A 2W6KA 4AHUA 1I3AA 3VEVA 4A5AA 4J2AA 4NYFA 5LJVA 5DK5A 5M1PA 1VQNN 2QWMA 4IFYA 1ZBUA 2RE2A 3E66A 3QIPA 4WQ5C 3OYCA 3OY9A 5HL7L 3ZT1A 3QLHA 1BL3A 4CZHA 4HWIA 4NXMK 4FLZA 4Z4CA 5GAGP 2F8SA 4FM0A 3ZSYA 1NBWA 2KFNA 1NJYA 3DLHA 2WBNA 4CD1A 3ZX2A 4M3RA 4DR7K 3W3DA 3KLHA 3KIOA 1VQ7N 2E6LA 4CF0A 1NKCA 1QSLA 2DFFA 3QETA 1HRHA 4RWTA 4JKCA 2YHXA 3CMAN 4DLEA 5KI6A 4DQQA 4F3OA 2F7TA 1VSLA 3UKRB 2FF6A 3ZX3A 4B1ZA 4UQGA 3CFPA 3VTIA 2YKNA 5CHIA 2OZMA 1XHZA 4ELUA 4KHUA 4DR4K 3THWB 1VRUA 3AO2A 3P38A 4FPAA 3W0LA 3QESA 2I7NA 4PL8A 5AQVA 1N33K 3NGZA 3EE8A 3L2WA 4R5PA 1LWFA 2ZJQL 3VQ9A 2VGNA 4FOIA 2E6MA 1MWKA 2O8FB 3CPWM 4WQ4C 2Q0RA 1M1KO 4DB3A 1ESVA 1D9FA 1GLJO 3JSMA 1KVBA 3BZKA 3K5MA 4FO0A 1BI4A 4CD3A 4M45A 4OJRA 4KI6A 3LWMA 3DXMA 5IT9O 3AVJA 4H0PA 3L2UA 4H5TA 5KPZA 4W5QA 4O5FA 2QWLA 5C15A 3TAEA 4L8RB 3DOLA 3SAFA 3NH1A 1QVFM 1YAGA 4I7FA 5FRNA 1NJXA 4Z4IA 1NGFA 5SZTA 2GX9A 3OYAA 2P9LB 4Q0BA 4ELTA 1VSKA 4NB4A 4YOYA 4B9QA 5FPEA 3CD6N 4ID5A 3THVA 4CZKA 2ETJA 1N36K 1VHXA 2EHGA 3HZ6A 1R0AA 3TU5A 3HI0A 1ATRA 4W5NA 1HPMA 1SUQA 3HT3A 3O3FA 4BRLA 1C0UA 2AA4A 1QSSA 3SPYA 4AHTA 3EKSA 4DG1A 4JD2B 3I0RA 2WOMA 1LAWA 2HBMA 3TABA 3VQPA 3OBYA 4I2PA 4YOVA 3SK3A 3K59A 4K41A 3MXMA 4FJ8A 1ZBFA 1D8YA 1KSPA 2ZE2A 3E9OA 2A41A 3L3UA 3VQ8A 4GW6A 1RTJA 3VENA 4BRFA 1RT6A 4KREA 4FJ7A 1DTTA 1NGEA 3CF5L 4CGHA 1WSEA 1KD1O 4DR2K 3CG7A 4FJKA 4X65K 1BU6O 4DFJA 1K8KA 3L4QA 3F9KA 4CZIA 1J5OA 4DQPA 4N5SA 4N47A 1O1WA 3AAPA 4BRAA 1VQKN 2P9UB 2VQEK 3NF9A 4LF5K 1GLCG 3CQXA 5TKWA 4DSEA 4BGBA 4LH5A 4IG0A 2BH1A 4OPJA 2LSNA 2Q97A 5E26A 4M7XA 4JV5K 3L6QA 3AVBA 3K9KA 5AQZA 4NCBA 3LP2A 4BRKA 2OTJN 2GELA 5KGWA 2PY5A 1VSEA 1VSFA 2NUBA 4ILHA 3I8DA 2JWLA 1TKTA 2Z1IA 3VOVA 5C2DA 3F73A 1P8ZA 2PYLA 1CZ9A 3VETA 4E89A 4JI6K 4WQ5A 1ITGA 2VYPA 4DMNA 4JI7K 3OYBA 1NGBA 2QI2A 2ZGZA 3H3NO 3O8MA 1YI2N 4C8LA 4ZHRA 3CHWA 1NWKA 4JI0K 1S1TA 5F1XA 3NDKA 4M3WA 3NF7A 1BQMA 3DRRA 4K8ZA 3TSQA 4RG8A 4JNEA 5CZ2A 4F2SA 3AVAA 3O4WA 4BC4A 1SAZA 2GWKA 3OYFA 1HYZA 2O8EA 3LDLA 4GKKK 2YNFA 2VQFK 2D4WA 5HOOA 2E2QA 1KC8O 2NRXA 3OYJA 5FDLA 2RF2A 2VWBA 5M1KA 3LP1A 5A2QO 5GINA 4DTPA 2IAJA 3KLFA 1W0HA 2IVPA 2E8AA 4DFKA 3SCXA 4YOTA 1CXUA 1RDCA 2RHKA 3VQ4A 4CI6A 3OS0A 4OX9K 5HP1A 4Y1DA 1NU0A 5CR4A 1G15A 3LWLA 3WQTA 3Q7CA 4IOCL 5C2FA 1MWMA 1HLUA 1ATNA 3LAKA 5KTQA 3AVNA 1SKRA 1VSDA 4B9NA 5J2MA 2QXFA 2F9WA 3QNNA 3ZSXA 3UIQA 4FWRA 4F2RA 3KK3A 1EETA 1WAFA 5HLFA 4C8KA 2HW3A 4ICLA 5JLHA 3U8XA 3MEEA 2E2NA 4YOWA 4CERA 5EX5A 4E7HA 1UA0A 2FSNA 1TVRA 3CJ1A 2Q1NA 1O13A 3K0SA 4LF4K 1T6CA 1JLAA 4J2EA 2I5JA 3CYMA 4YDUA 1C1CA 4H5VA 3VA3A 5M1FA 3H1VX 3AV9A 5AQXA 5KRSA 4A61A 4L3QA 1B9DA 1T03A 4BRQA 1L3UA 4KV8A 4OKEA 3DM2A 4H0TB 1BI4B 4OKKA 4Z0UA 5AQPA 5AJ3K 3HJFA 1TGOA 4DSFA 1KAYA 4BR0A 3BZCA 3M8SA 3DXMB 4WE1A 1A5VA 5HRRA 3NCIA 1GLFO 3CC7N 3ZT4A 2HSTA 2UU9K 4CHQA 1HQEA 2VGMA 3OJSA 3J7YP 4HTUA 2HMPA 2UXDK 1NK5A 1RDUA 3R3LA 1IG9A 3O6WA 4NXNK 4MO4A 4FVUA 4BC2A 4F9OA 1NGDA 2HBJA 3C6AA 4CFDA 5AZIA 4JS5A 1CLQA 2HNZA 5BRFA 2ZQBA 4KHWA 2NRVA 1LW0A 1YTUA 4BRCA 5GAEP 4E7JA 1H1VA 4BDZA 2QKBA 3G10A 1KFSA 3EE9A 4FLTA 4CJ5A 3FGUA 3U9DA 2Z1HA 3J7ZO 3E9LA 4PQUA 5FPDA 1Z05A 1JLBA 2CGJA 3HOSA 3J7AP 4H0VB 3K2PA 3UKUA 1S1WA 4FYDA 4CEAA 3VGLA 4WCEL 4CJUA 3G71N 1X3MA 2X6SA 3VEWA 1QQMA 2A5XA 1RBTA 4KH6A 4FWOA 4M42A 2E4LA 3ZEUA 4C1NK 2RN2A 5BN8A 3OVNA 4FM2A 1TK0A 1K8KB 3M8QA 1YJNN 4A2AA 1VSIA 3IFRA 4Z94A 3IS9A 4PKIA 4KHSA 4M3TA 3SBTA 4HVJA 4IZ9A 3NF8A 1L5UA 2BANA 3AA5X 3BF1A 3CCSN 4DS5A 3C6HA 4M63C 3DAWA 4HUEA 4KRFA 3CCLN 3UB5A 4LD0A 1X9JA 1RBVA 2NRWA 3TAGA 1RT4A 2KTQA 2HHWA 4XIUA 1TUYA 4CF2A 3NH2A 4KB0A 4NYNA 4CVNE 3SQ4A 1D5AA 3MN9A 4CW7B 3O9QA 4N56A 1ASWA 4CJTA 1GOCA 4E1JA 4CGJA 1SS6A 4FSVA 3NVKA 4KHQA 4PY5A 3BEXA 4CGIA 4FWPA 1Q9YA 3VQ5A 1NJWA 1L3TA 2F8TA 2Z1JA 1NK4A 4KPYA 4DV0K 3LZJA 4O55A 3ZT0A 4EFHA 2E88A 4M41A 3O1WA 2D0AA 3ISNC 3VQQA 3WXLA 3HPGA 4CE9A 1WBDA 1VK0A 3V1OA 3SI6A 1WN7A 1OH5A 3SUNA 1WNSA 2YCHA 4GV9A 4JI1K 4PHTX 1K73O 2FC0A 4LF7K 2O8EB 2NLXA 3BY5A 3TI0A 2BGGA 4IG3A 3P1GA 2G8UA 3GBTA 4YOUA 4B9SA 1UWBA 1JLEA 3EYZA 4Z4EA 3NGIA 1ATSA 4EHUA 4B3OA 3OS1A 3RSEA 3OW2M 1SL0A 4CHNA 2ATQA 3ENBA 2OA8A 1ASVA 3FR0A 5AQIA 1FK9A 5LY3A 1EO1A 4EZ9A 3D7EO 3OYIA 4K42A 4DTMA 4LH4A 1KRPA 3QDKA 1V4SA 4DTXA 4FK2A 1ZBSA 4A62A 1K9MO 2E2PA 1CZAN 2QM1A 5BREA 4IFEA 5HRPA 1JL2A 3AGKA 4CEBA 4KAZA 3PV8A 1IBKK 4HUGA 4XH5A 3OA9A 5AQOA 4KTQA 2O4GA 4JKEA 3ZSWA 3D2EA 2HHUA 5AR0A 4JI3K 4B9UA 3CQ8A 3THYA 3GG4A 3U6FA 3ENHA 3QEWA 1YITN 1RT2A 1KQSM 1ZBHA 4KHPK 1IJJA 2ZF5O 1U4BA 4N76A 3ASMA 1IV0A 4C1NI 2PZSA 5FPNA 5FROA 4O5BA 3WXKA 5GIOA 5LMNK 4NLCA 3IMXA 3SUOA 1U6ZA 5F2RA 2XY8A 3HSCA 4ILJA 1B9FA 1QE1A 4H0OA 2QKKA 4FWNA 4E3SA 4QS7A 2IVNA 3AO3A 1HJOA 5JICA 4DQSA 4W5RA 2IDOA 2HHQA 5ELZA 3JAMO 3KK2A 3HSTB 1BA0A 5AQLA 1LOTB 4BC3A 2YKMA 3PIOL 2D0PA 1KLNA 4FJ5A 3NAEA 3T1AA 1NGAA 1QHAA 3AVMA 2OANA 1C0MA 4JYAK 2GEMA 3UE5A 5AQTA 3SNNA 3AA4A 5AZIB 4DV7K 1TAQA 3HYFA 3ZLJA 1L3SA 3CQYA 1I94K 3ID8A 3C6UA 4AH9A 4B1XB 2YNHA 2QWRA 4NO7A 4HHTA 4CFBA 4DSLA 4CK2A 4BE1A 1C1BA 3A5LC 1RBRA 4OLAA 2OZSA 1NK8A 5BN9A 2F9TA 5HRSA 3K58A 2PFUA 4BDYA 2P5OA 1TAUA 4AILC 5LL6Z 1ZYQA 4KTZA 3UKUB 5DMRA 3NVMA 5AQJA 1WBBA 3KWIA 3TAQA 2QWQA 3V9UA 1IKYA 3S3OA 1EX4A 4CIGA 4Q5VA 1LCUA 2CGKA 3VEXA 3EY1A 4CZJA 3LALA 4BR4A 5BPLA 3ZEUB 1QZ6A 4CECA 1L3VA 3VPZA 3QERA 3OYHA 1NGCA 4FZXC 2KLAA 3DYAA 3VQ6A 4QOZB 4C23A 2Q2RA 2R7YA 5LJWA 3VQ7A 2FSJA 1J5EK 3O08A 4B1UB 4FLUA 3AAQA 1Q86O 3V9WA 3ID6A 2KZZA 5FLXO 4O4GA 2RPIA 1NOZA 1MDUB 4MFBA 3PLAA 3DOKA 2CH6A 4CHZA 1XHXA 4E1NA 4LFCK 3C94A 4WFBL 3ENOA 3HVRA 2OPPA 2W41A 1Q81O 1BUPA 1YJWN 2AP1A 1KVCA 2EX3A 4FL9A 1JLGA 1BO5O 4JKFA 4OVLA 2G8KA 2OPRA 3O9RA 3TAMA 4JEPA 1A5WA 4DTNA 3IRXA 5ADXA 2IVOA 4H8KA 4DR1K 1NGHA 1REVA 3WNHA 3ALYA 1RBSA 3QIOA 1RT1A 4OKJA 4YDUC 1YTAA 2FBVA 3DRPA 2YNIA 4FW1A 2OPQA 1IKVA 4QS8A 1GLLO 1GLDG 2YHWA 3IG1A 5AZJA 5GIPA 3OJUA 3CCRN 3TSUA 2YX6A 3AVLA 3OYMA 1FXXA 3MEGA 5EVZA 5FPMA 3AA3A 3QEPA 3V1RA 3CC4N 3V6DA 3RSEB 3RMDA 1V4TA 5JMVA 4FWSA 3L4IA 1GOAA 1Y64A 1FKPA 3T3FA 1YVNA 5H1SQ 2O4IA 1HKBA 4BRHA 1VQ6N 1WSFA 2JGUA 3AGRA 1BCMA 2Z1GA 3WNEA 3VF2A 4I9QA 4JI4K 3CMEN 3SQ1A 2A6AA 4DCHA 3L0QA 4BRNA 4PKHA 4CIFA 2GV9A 4JK8A 3O1BA 2YI1A 4BRGA 1QHTA 4DR5K 4DF4A 5JVGL 1IO2A 1U45A 1BIUA 3I8BA 4FWMA 2B4JA 3D2EB 4IFVA 4FK0A 2D0CA 2XY6A 3THYB 4FJLA 3WQUA 3CM6A 3TTDA 3ZYYX 3WNGA 1SL2A 5HRNA 3CFRA 2HB5A 2NRHA 3TWHA 1WSGA 4JK9A 1TYQA 3B8AX 4CEZA 4U67L 1J9AA 3SUPA 4BREA 3J8AA 4I2QA 5AQQA 3I33A 5M1NA 5CE3A 1SKSA 4GV6A 1HQUA 2FSKA 5TKYA 3OBWA 1Y97A 4CZMA 5I3UA 4KHNA 3CJ9A 3MAQA 3N4QA 1SL1A 3LM9A 1RBUA 1T44A 2O8BB 2KKZA 1S3XA 3MXJA 3U3GA 3LPUA 2YHYA 4DFMA 3EN9A 2Y1JA 2G8FA 4MQ3A 1SV5A 2HHVA 4IEEA 1OVYA 3P39A 4E19A 3HXMA 1QQOA 5F0XA 4IJAA 3SV4A 4KI4A 3K5OA 3SPZA 1NM1A 3MX2A 4FLYA 3PX6A 5AFUA 4GVMA 3CCJN 3KLEA 4QCLA 3L3VA 1HNVA 3TSPA 2OPSA 4CEFA 1NJZA 3ATVA 3D2FA 3CJCA 4IJNA 3SLCA 3S3NA 3D6RA 5CYMA 2QWPA 3HM9A 1QSYA 2AJQA 4M3YA 3AVHA 2B5JA 1XQSC 4FJJA 3SMPA 3FZFA 1U49A 3R1XA 1RGIA 4BVPA 3VN5A 1U2VA 3PX0A 4BGAA 1WUAA 4NCAA 2OCEA 2ZGYA 4DLGA 4J8FA 5JS2A 3ITHA 1EKEA 5AQHA 1E4FT 3KD5E 1X3NA 1WSHA 4IKFA 4M7YA 5CY4A 3GOIA 4U7BA 4DFPA 1NJIO 5CZ1A 4FJHA 3VEYA 3PO5A 4CGDA 3S41A 1BG3A 1C6VA 1OH7A 2HHXA 3BP8A 4CEDA 3U3YA 1S5JA 2VG5A 2HMIA 3H08A 2DY4A 1EQYA 2ASOA 3LAMA 4BDPA 1TKDA 3SMSA 4YOXA 4IEIA 1W2BM 4DQIA 4CZEA 5J2PA 3TAPA 1VQ5N 1ZBLA 2HNYA 4ZTJA 1NMNA 4DQRA 4ISFA 3DWLA 1HYSA 4B8AB 2P9PA 4KO0A 1BHLA 3KZBA 4C8NA 1W7AA 2HBLA 4B3TK 1YXQA 1BIZA 4JKDA 3K5LA 1JLQA 3KWGA 3CPEA 3AVKA 1WOQA 3KHYA 2X78A 2IOCA 3E1YA 3LPTA 3PSFA 1WLJA 4G1QA 1NKBA 5AZJB 3THXA 3CETA 3QBXA 4HTLA 2NRZA 1NMDA 3ZSRA 3B6OA 3OHRA 2QWOA 4M3ZA 4KKOA 4FLWA 2G8VA 4B3RK 5AFUH 1NGJA 1XMQK 3HO1A 1T6DA 1Z6RA 4CJFA 3CC2N 4IO8A 5AQSA 3O9SA 4MDAA 3CCVN 3Q7BA 3LP0A 1X1PA 2UUAK 3VGKA 1RT5A 1KFDA 3KTQA 3V81A 4GKJK 2IGIA 4CFCA 1NK6A 1HNZK 2GTDA 1U47A 1Z25A 1G99A 1VRTA 3QNOA 1HX1A 2P9IA 2HVIA 1E3MA 5KPRA 3LL3A 4FPBA 4HUFA 3R6MA 2UXBK 3HRGA 3NGYA 3MN6A 5C0YA 3CCEN 3RR8A 4HCCA 4O0JA 3I55N 4IXCA 1HKGA 5AQKA 1KXPA 1KAZA 2CH5A 2KFZA 1WAJA 1NGIA 4W5OA 5T7BA 2KW4A 3I0SA 5JLFA 2ZJPL 3QBWA 5BRDA 1YHQN 4X64K 1FJGK 1TYQB 3OYKA 4BROA 3C7NA 4CIEA 4GVEA 5J1EA 1N6QA 1IBMK 3CFOA 4H4MA 5JS1A 1ASUA 3A5NC 1T05A 3EEQA 5AQRA 3LDPA 3P31A 3HL8A 3RRGA 5FRMA 1GLAG 1VQ9N 3KKSA 5AQGA 1SQKA 3FFIA 4A57A 1VQPN 1W9HA 4KFBA 3KK1A 2NZTA 2HF4A 3OYNA 1U04A 2O8DA 3CI5A 5C24A 4CZFA 2BUPA 5EOYA 1X9MA 4A5BA 2FBXA 4DTRA 1DTQA 3ZETA 3A0IX 4GNIA 2GUPA 4B9TA 3VF6A 3BUZB 3F5TA 1RNHA 4CFAA 4H4OA 3KVGA 3E9PA 1W97L 4B8CA 3OYLA 4CCHA 4CBUA 3LZIA 4IDKA 4PL7A 3A5MC 2A42A 2QK9A 3QMLA 2WC9A 4IBNA 3M1FA 1ILYA 3D2FB 1EWRA 2DFHA 4Y1CA 1QTMA 2PYJA 4CF1A 4M3UA 4B3MK 4BVOA 4H5NA 1C0GA 4XH4A 3F2KA 1XNQK 1EWQA 1DT9A 3O5BA 1VQ8N 4JS4A 2J4RA 4K0KK 1HMVA 4CZGA 2VG6A 4B08A 2G8IA 5MLCQ 1U2VB 3LDQA 4DV3K 1TL1A 1XNRK 4FOEA 4H5RA 3SAGA 1K8AO 1KTQA 3T19A 3R9PA 1LWEA 2HF3A 3S3MA 1LAVA 2YV0X 5BRHA 2V51B 2G8WA 3CCUN 3P83D 4ISGA 3SZ2A 5EU7A 4BC5A 3T1HK 3RWUA 4YORA 1TV6A 2W42A 4Z4HA 4JI5K 4CGGA 3QO9A 2UYTA 5BPMA 4LC9B 3SJJA 4LFAK 3VTHA 3NH0A 1N34K 2FBTA 1VQ4N 3NF6A 4OGEA 4BQZA 4KB1A 4CEOA 4I9LA 4K8XA 4XH1A 2OTLN 4JKHA 4RTFD 2P9PB 2D1KA 4DQ8A 3EZ5A 4K43A 2OYQA 3QICA 1S1VA 4FWKA 1X9SA 2E1YA 3M3ZA 1T8EA 4NCGA 4MDBA 4QAGA 4DR6K 4DU4A 3CIPA 1S9GA 2H3GX 4FJGA 1CXQA 4DTUA 1LWCA 5HBMA 3E01A 3FE1A 3DLEA 2ZJRL 3THXB 1X9WA 3DJCA 4OGCA 2F4VK 3QEVA 4BY9C 2NRTA 3AVIA 1LW2A 5DM6L 1QZ5A 1S22A 1RCHA 1KVAA 5AQYA 4UY8O 4E7KA 3EO3A 4CK1A 4DU3A 3MEDA 4BRIA 4RCHA 1Q18A 3OYGA 4RW9A 2DTUA 4CESA 1TK5A 4PKGA 4MLEA 4ELVA 1YVUA 3AVCA 3MCAB 3WXJA 4BRMA 1ZBIA 3BF3A 3SAHA 4AQYK 1IKXA 1HKCA 4M3XA 3WEEA 3F9MA 4RW6A 1BOTO 1TKZA 2IS3A 4JLHA 4OLBA 3J81O 3C0BA 4BG9A 1S1UA 4FWQA 2P9IB 3RTVA 2KQ2A 3T7ZA 5IWAK 3G4SN 1T3VA 5J2NA 4DKWA 2QEXN 1RDAA 4EAHD 1VQLN 3GL1A 1JCEA 4KH5A 2QWNA 4IWVA 4O8UA 3LDSA 3NBPA 4AHRA 3U4LA 5SWMA 2WONA 4AHSA 1EP4A 1NK9A 4BR9A 4K25A 1HUXA 1BA1A 3H3OB 3FZLA 3DXKA 1KCFA 4OPHA 4FM1A 3AY9A 4B1YB 3C7NB 4A59A 3NMUA 4EIAA 3T1YK 2YJEA 2UXCK 3RR7A 3ZSQA 1IKWA 3DI6A 1BDGA 4AHCA 4CJRA 5BPNA 1J54A 1HJRA 1RFQA 3EL2A 1TK8A 3EKUA 1KLMA 4F8RA 3BGRA 2HHTA 5HROA 3IKMA 4JAXA 2O8DB 3H6EA 3B6PA 4CBWA 4CJQA 4YFUA 4PUOA 4BRDA 1UA1A 3ZETB 4FJXA 3M8PA 3VQBA 3AVGA 1MU2A 1UAXA 2P51A 3VGMA 4CHYA 1EXQA 2CGLA 5E84A 3PY8A 3RVCA 1J6ZA 2YHAA 4DSIA 3SUQA 3FZHA 3HP9A 3CM5A 3QB0A 3PIPL 2YNGA 3HOTA 2ZM6K 2B6AA 2HOEA 4C8OA 1VSHA 4H0YB 3V1QA 1F21A 4LFBK 2QTDA 3G6EN 2P9KA 3MMVA 2W6LA 3M8RA 5KQDA 4O0IA 1QVGM 3ZCMA 4DWIA 3M6GA 3N4PA 4CF9A 3ZSZA 1RILA 4NLBA 3AO1A 3KLIA 2Q3SA 4FXDA 3LP3A 3P4IA 3HVTA 1RT3A 3V9XA 4WFAL 3JYTA 4OPKA 4B3SK 3VMFB 1GLEG 4XEIA 4B9MA 4LF8K 3IDHA 3L2QA 1E4GT 1DGKN 2X6NA 4EHTA 4FLVA 3TANA 4Y0WA 1VQON 3MWPA 1R59O 5JVHL 1FKOA 1JCGA 2WTUA 4LF6K 4DV2K 3O80A 3VQEA 5KQ8A 3TTFA 4OPAA 4V19S 3VERA 3K9JA 4CJEA 4KH4A 4CJ7A 4Z4FA 3L2VA 3MX5A 4H5WA 3RMAA 1VQMN 2HVHA 3RMCA 3NE6A 4JKGA 1MA9B 2UUCK 3VQAA 5J2QA 2ASMA 4CHPA 2G8HA 2DFEA 3WXIA 1IH7A 3AO4A 2IC3A 3VEOA 4DTSA 3PO4A 3DLGA 4A2BA 4CEEA 5C12A 2UUBK 1HR0K 2QXLA 3FLCO 4H03B 5ADXH 3G0ZA 1OH8A 4FZYA 1XUPO 3QFUA 4CJ3A 3V9ZA 3VQCA 1GLBG 3TTCA 1RDBA 4DF8A 1RTDA 5D3GA 1SKWA 2Q36A 3H46O 4OO1J 2E20A 3K5NA 2ZD1A 4JK7A 2V52B 4BWJA 4MLHA 1Q82O 4I6MA 3SBGA 3L2RA 4AF1A 2BTFA 3CJBA 2HNDA 1WSIA 4DV6K 3TR8A 4CF8A 4PWDA 3O4QA 2V7ZA 4BR7A 1NLVA 2P9SA 4EP4A 4FCYA 4DSJA 2P9NA 1J53A 2VWKA 1IBLK 5GADP 4O8KA 2A3ZA 3KK7A 1S6PA 3QINA 5AQWA 4B9VA 3WEEB 1JXEA 4CJWA 1VSMA 1NKEA 2WFBA 4BR5A 1TL3A 1NGGA 2BE2A 1UOCA 2O8CA 4FW2A 4LY7A 2FXUA 4ID1A 3SQ0A 3PSIA 1GOBA 4CJVA 4G9ZA 4MO5A 1LV5A 1U48A 3DLBA 4CEQA 2D0BA 3U9ZA 4BQLA 3LDNA 1P90A 1XWLA 4DR3K 4LSLA 3EZWA 1KAXA 4WFNL 4CK3A 5C25A 4E7IA 1YIJN 2VG7A 2Q31A 3MN5A 3DXKB 3AA2A 5KRTA 2DPNA 3OYEA 4B1WB 1OVQA 4AM7A 4JRPA 3DLLL 3A8YA 3IUCA 3ULEA 1XMOK 2P5GA 4F3TA 1N32K 1RDDA 4WQ4A 4JN4A 1QQNA 2PAVA 3JXUA 2KHOA 1C0TA 2PBDA 4CJPA 3RMBA 1BQNA 5K14A 1WSJA 3ZT2A 2E1ZA 3HP6A 3ATUA 4J2DA 4N41A 4C8MA 5E41A 1QQCA 3HPHA 1I39A 3DLKA 3FZMA 4FWLA 5DM7L 1RDWX 1JJ2M 2A1SA 5EXWA 4GMJB 3JS6A 1S1XA 1T7PA 3PX4A 4BE2A 4X66K 3A2FA 3HBTA 3WNFA 3KD1E 3QFPA 4QS9A 2VWJA 4LSNA 5C10A 5BR8K 4Z4GA 1ZC6A 1RTIA 2XY7A 3TARA 2P9KB 4IDHA 4B1VA 4DHYA 3QEIA 2WUSA 2HHSA 1BGXT 3AARA 4DV5K 3MN7A 1DKGD 3O4NA 3FZKA 3HTVA 3LDOA 4JRQA 3KJVA 4DUZK 4DTJA 4GV3A 2ZWHA 2QW9A 3C65A 5I42A 1C0FA 1HPZA 4JHDA 3C6TA 3BDPA 3KKRA 1OH6A 4BACA 4FJNA 1BWFO 1YJ9N 2GWJA 1HNWK 5AQMA 3SV3A 4TSXA 4DUYK 4O44A 4BRPA 3NHGA 4X62K 3IAYA 3MXIA 3VF4A 4ISEA 1A5XA 5AQFA 3MK6A 3ZSVA 2KZMA 4FZZA 1TUUA 1Q7YO 3G25A 4E7LA 4DS4A 2Q0UA 4RW7A 4KBOA 1HNXK 3GDQA 1NK0A 3TAFA 2XY5A 1JL1A 4EZ6A 2EWSA 2JLEA 2XRIA 3ZT3A 4CZLA 1JLCA 1IG8A 2NRRA 3NFAA 3HM8A 2I7PA 4JKGB 2HBKA 2XHBA 1N5YA 4IOAL 1B92A 4DU1A 1JCFA 2X74A 1D9DA 3VESA 1S72N 1XC3A 4DV4K 4YHHK 1FW6A 1OKJA 5EY4A 3C95A 4GY2B 4JKBA 3GE1A 3UKRA 1JXBA 4AM6A 3DRSA 4J2BA 5I9EB 3DLRA 3O3HA 4CJLA 1S6QA 3J80O 2RKIA 1Z26A 3MECA 3O9TA 4E1MA 3THWA 1NG9A 3SYZA 2D5RA 1YT3A 1DLOA 3MCPA 3ZX0A 4FLXA 2ITGA 3DMJA 3KLGA 5C42A 3K57A 1TKXA 3WUHA 1Q9XA 2QA4N 3PUFA 3OYDA 2O8FA 3ZSOA 4FK4A 5GAHP 4BG8A 3VEZA 4CGFA 4I6MB 4JI2K 2JWKA 4PA1A 4E0DA 2W40A 2E5LK 4DSKA 1JKHA 2ITMA 2P9SB 4WF9L 3MDQA 2P9NB 1BISA 4KHYA 4WYBA 2FF3B 4BE0A 5B8HA 3LM2A 3L8BA 3ULDA 2NNWA 5CYQA 1NNEA 2O8CB 4RW4A 5AQUA 2YHBA 1CZBA 1VSJA 4CJ4A 4ZTFA 2FBYA 2GBZA 1BCOA 1N8RO 1NK7A 3CERA 2P9LA 1HYVA 4CHOA 5AQNA 2D0OA 3AO5A 4ILGB 4CJSA 4FJMA 3I56N 1RT7A 3R8EA 3H1QA 3VA0A
chains in the Genus database with same CATH topology
2HHHK 3T1YK 4NXMK 2UXCK 1N36K 1HNXK 4GKKK 4JI1K 2VQFK 2UUCK 4B3TK 4LF7K 4YY3K 1XMOK 1N32K 4JYAK 4DV7K 4DR7K 5A2QO 4DV4K 1I94K 4YHHK 4DR6K 2UUBK 1HR0K 4OX9K 5LMUK 3J80O 3J7AP 2F4VK 4B3RK 5LL6Z 4DR4K 1XMQK 4DR2K 4LF9K 4X65K 2ZM6K 4X66K 1N33K 2UUAK 4LFBK 4JI4K 4GKJK 1IBKK 2VQEK 4LF5K 3OTOK 4DV6K 4B3MK 1HNZK 4AQYK 4JI2K 5BR8K 1XNQK 1IBLK 2E5LK 4DR5K 4K0KK 4JI3K 4LF4K 4JV5K 4JI8K 3J81O 4DV3K 1J5EK 2UXBK 1XNRK 4DV5K 5IWAK 4DV1K 5AJ3K 5FLXO 4B3SK 4CVNE 4DUZK 4KHPK 4LF8K 5IT9O 4CW7B 4JI6K 5LMNK 4LFCK 4JI7K 1HNWK 4DUYK 4DR3K 3T1HK 4X64K 4LF6K 2UU9K 1FJGK 4DV2K 4X62K 4JI0K 3J7YP 4DV0K 4JI5K 2UXDK 4V19S 1IBMK 4LFAK 3JAMO 1N34K 4NXNK 4DR1K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH K;  3T1Y K;  4NXM K;  2UXC K;  1N36 K;  1HNX K;  4GKK K;  4JI1 K;  2VQF K;  2UUC K;  4B3T K;  4LF7 K;  4YY3 K;  1XMO K;  1N32 K;  4JYA K;  4DV7 K;  4DR7 K;  5A2Q O;  4DV4 K;  1I94 K;  4YHH K;  4DR6 K;  2UUB K;  1HR0 K;  4OX9 K;  5LMU K;  3J80 O;  3J7A P;  2F4V K;  4B3R K;  5LL6 Z;  4DR4 K;  1XMQ K;  4DR2 K;  4LF9 K;  4X65 K;  2ZM6 K;  4X66 K;  1N33 K;  2UUA K;  4LFB K;  4JI4 K;  4GKJ K;  1IBK K;  2VQE K;  4LF5 K;  3OTO K;  4DV6 K;  4B3M K;  1HNZ K;  4AQY K;  4JI2 K;  5BR8 K;  1XNQ K;  1IBL K;  2E5L K;  4DR5 K;  4K0K K;  4JI3 K;  4LF4 K;  4JV5 K;  4JI8 K;  3J81 O;  4DV3 K;  1J5E K;  2UXB K;  1XNR K;  4DV5 K;  5IWA K;  4DV1 K;  5AJ3 K;  5FLX O;  4B3S K;  4CVN E;  4DUZ K;  4KHP K;  4LF8 K;  5IT9 O;  4CW7 B;  4JI6 K;  5LMN K;  4LFC K;  4JI7 K;  1HNW K;  4DUY K;  4DR3 K;  3T1H K;  4X64 K;  4LF6 K;  2UU9 K;  1FJG K;  4DV2 K;  4X62 K;  4JI0 K;  3J7Y P;  4DV0 K;  4JI5 K;  2UXD K;  4V19 S;  1IBM K;  4LFA K;  3JAM O;  1N34 K;  4NXN K;  4DR1 K; 
#chains in the Genus database with same CATH topology
 2HHH K;  2YJF A;  3AVF A;  2P1J A;  3O3G A;  2GUI A;  5M1Q A;  4YY3 K;  3S9H A;  3A5O C;  4JD2 A;  3SQ2 A;  4BWM A;  1ZXO A;  4YNQ A;  4IOX A;  2E2O A;  3ULE B;  1C1A A;  5BR9 A;  3D0P A;  3MWT A;  3TPQ A;  4R79 A;  3WXM B;  1YUW A;  3P5J A;  4IO9 L;  3V4I A;  5KPT A;  3D45 A;  1YF5 L;  4CBX A;  2XO7 A;  5LMU K;  1Q8I A;  1NOY A;  2V7Y A;  4DTO A;  4EP5 A;  3CJ7 A;  1XI1 A;  4LF9 K;  3SJH A;  3RRH A;  1HNI A;  3HPO A;  2P9U A;  1D4X A;  3FFK B;  3CCQ N;  4RW8 A;  3CJA A;  1VAZ A;  2BDP A;  4FJ9 A;  3VQD A;  4F4K A;  2ASP A;  2Y1I A;  3OTO K;  1M90 O;  3CCM N;  4CJK A;  5M1O A;  1JLF A;  4FJI A;  1K6Y A;  4B9L A;  2VCP A;  4H0X B;  4JI8 K;  1SZ2 A;  4AHV A;  4JKA A;  4FVM A;  2IIR A;  3T69 A;  3M5R A;  4DV1 K;  1RTH A;  3H45 C;  4HCB A;  1QS4 A;  4BR2 A;  3OS2 A;  3V9S A;  2A1R A;  3WT0 A;  5KGX A;  4W5T A;  2O8B A;  3QEX A;  3LAN A;  3O9U A;  2A40 A;  1XC9 A;  2F96 A;  4JHD B;  2FLO A;  1S9E A;  1WB9 A;  4KTW A;  3CXC M;  1DEJ A;  3HK2 A;  2W6K A;  4AHU A;  1I3A A;  3VEV A;  4A5A A;  4J2A A;  4NYF A;  5LJV A;  5DK5 A;  5M1P A;  1VQN N;  2QWM A;  4IFY A;  1ZBU A;  2RE2 A;  3E66 A;  3QIP A;  4WQ5 C;  3OYC A;  3OY9 A;  5HL7 L;  3ZT1 A;  3QLH A;  1BL3 A;  4CZH A;  4HWI A;  4NXM K;  4FLZ A;  4Z4C A;  5GAG P;  2F8S A;  4FM0 A;  3ZSY A;  1NBW A;  2KFN A;  1NJY A;  3DLH A;  2WBN A;  4CD1 A;  3ZX2 A;  4M3R A;  4DR7 K;  3W3D A;  3KLH A;  3KIO A;  1VQ7 N;  2E6L A;  4CF0 A;  1NKC A;  1QSL A;  2DFF A;  3QET A;  1HRH A;  4RWT A;  4JKC A;  2YHX A;  3CMA N;  4DLE A;  5KI6 A;  4DQQ A;  4F3O A;  2F7T A;  1VSL A;  3UKR B;  2FF6 A;  3ZX3 A;  4B1Z A;  4UQG A;  3CFP A;  3VTI A;  2YKN A;  5CHI A;  2OZM A;  1XHZ A;  4ELU A;  4KHU A;  4DR4 K;  3THW B;  1VRU A;  3AO2 A;  3P38 A;  4FPA A;  3W0L A;  3QES A;  2I7N A;  4PL8 A;  5AQV A;  1N33 K;  3NGZ A;  3EE8 A;  3L2W A;  4R5P A;  1LWF A;  2ZJQ L;  3VQ9 A;  2VGN A;  4FOI A;  2E6M A;  1MWK A;  2O8F B;  3CPW M;  4WQ4 C;  2Q0R A;  1M1K O;  4DB3 A;  1ESV A;  1D9F A;  1GLJ O;  3JSM A;  1KVB A;  3BZK A;  3K5M A;  4FO0 A;  1BI4 A;  4CD3 A;  4M45 A;  4OJR A;  4KI6 A;  3LWM A;  3DXM A;  5IT9 O;  3AVJ A;  4H0P A;  3L2U A;  4H5T A;  5KPZ A;  4W5Q A;  4O5F A;  2QWL A;  5C15 A;  3TAE A;  4L8R B;  3DOL A;  3SAF A;  3NH1 A;  1QVF M;  1YAG A;  4I7F A;  5FRN A;  1NJX A;  4Z4I A;  1NGF A;  5SZT A;  2GX9 A;  3OYA A;  2P9L B;  4Q0B A;  4ELT A;  1VSK A;  4NB4 A;  4YOY A;  4B9Q A;  5FPE A;  3CD6 N;  4ID5 A;  3THV A;  4CZK A;  2ETJ A;  1N36 K;  1VHX A;  2EHG A;  3HZ6 A;  1R0A A;  3TU5 A;  3HI0 A;  1ATR A;  4W5N A;  1HPM A;  1SUQ A;  3HT3 A;  3O3F A;  4BRL A;  1C0U A;  2AA4 A;  1QSS A;  3SPY A;  4AHT A;  3EKS A;  4DG1 A;  4JD2 B;  3I0R A;  2WOM A;  1LAW A;  2HBM A;  3TAB A;  3VQP A;  3OBY A;  4I2P A;  4YOV A;  3SK3 A;  3K59 A;  4K41 A;  3MXM A;  4FJ8 A;  1ZBF A;  1D8Y A;  1KSP A;  2ZE2 A;  3E9O A;  2A41 A;  3L3U A;  3VQ8 A;  4GW6 A;  1RTJ A;  3VEN A;  4BRF A;  1RT6 A;  4KRE A;  4FJ7 A;  1DTT A;  1NGE A;  3CF5 L;  4CGH A;  1WSE A;  1KD1 O;  4DR2 K;  3CG7 A;  4FJK A;  4X65 K;  1BU6 O;  4DFJ A;  1K8K A;  3L4Q A;  3F9K A;  4CZI A;  1J5O A;  4DQP A;  4N5S A;  4N47 A;  1O1W A;  3AAP A;  4BRA A;  1VQK N;  2P9U B;  2VQE K;  3NF9 A;  4LF5 K;  1GLC G;  3CQX A;  5TKW A;  4DSE A;  4BGB A;  4LH5 A;  4IG0 A;  2BH1 A;  4OPJ A;  2LSN A;  2Q97 A;  5E26 A;  4M7X A;  4JV5 K;  3L6Q A;  3AVB A;  3K9K A;  5AQZ A;  4NCB A;  3LP2 A;  4BRK A;  2OTJ N;  2GEL A;  5KGW A;  2PY5 A;  1VSE A;  1VSF A;  2NUB A;  4ILH A;  3I8D A;  2JWL A;  1TKT A;  2Z1I A;  3VOV A;  5C2D A;  3F73 A;  1P8Z A;  2PYL A;  1CZ9 A;  3VET A;  4E89 A;  4JI6 K;  4WQ5 A;  1ITG A;  2VYP A;  4DMN A;  4JI7 K;  3OYB A;  1NGB A;  2QI2 A;  2ZGZ A;  3H3N O;  3O8M A;  1YI2 N;  4C8L A;  4ZHR A;  3CHW A;  1NWK A;  4JI0 K;  1S1T A;  5F1X A;  3NDK A;  4M3W A;  3NF7 A;  1BQM A;  3DRR A;  4K8Z A;  3TSQ A;  4RG8 A;  4JNE A;  5CZ2 A;  4F2S A;  3AVA A;  3O4W A;  4BC4 A;  1SAZ A;  2GWK A;  3OYF A;  1HYZ A;  2O8E A;  3LDL A;  4GKK K;  2YNF A;  2VQF K;  2D4W A;  5HOO A;  2E2Q A;  1KC8 O;  2NRX A;  3OYJ A;  5FDL A;  2RF2 A;  2VWB A;  5M1K A;  3LP1 A;  5A2Q O;  5GIN A;  4DTP A;  2IAJ A;  3KLF A;  1W0H A;  2IVP A;  2E8A A;  4DFK A;  3SCX A;  4YOT A;  1CXU A;  1RDC A;  2RHK A;  3VQ4 A;  4CI6 A;  3OS0 A;  4OX9 K;  5HP1 A;  4Y1D A;  1NU0 A;  5CR4 A;  1G15 A;  3LWL A;  3WQT A;  3Q7C A;  4IOC L;  5C2F A;  1MWM A;  1HLU A;  1ATN A;  3LAK A;  5KTQ A;  3AVN A;  1SKR A;  1VSD A;  4B9N A;  5J2M A;  2QXF A;  2F9W A;  3QNN A;  3ZSX A;  3UIQ A;  4FWR A;  4F2R A;  3KK3 A;  1EET A;  1WAF A;  5HLF A;  4C8K A;  2HW3 A;  4ICL A;  5JLH A;  3U8X A;  3MEE A;  2E2N A;  4YOW A;  4CER A;  5EX5 A;  4E7H A;  1UA0 A;  2FSN A;  1TVR A;  3CJ1 A;  2Q1N A;  1O13 A;  3K0S A;  4LF4 K;  1T6C A;  1JLA A;  4J2E A;  2I5J A;  3CYM A;  4YDU A;  1C1C A;  4H5V A;  3VA3 A;  5M1F A;  3H1V X;  3AV9 A;  5AQX A;  5KRS A;  4A61 A;  4L3Q A;  1B9D A;  1T03 A;  4BRQ A;  1L3U A;  4KV8 A;  4OKE A;  3DM2 A;  4H0T B;  1BI4 B;  4OKK A;  4Z0U A;  5AQP A;  5AJ3 K;  3HJF A;  1TGO A;  4DSF A;  1KAY A;  4BR0 A;  3BZC A;  3M8S A;  3DXM B;  4WE1 A;  1A5V A;  5HRR A;  3NCI A;  1GLF O;  3CC7 N;  3ZT4 A;  2HST A;  2UU9 K;  4CHQ A;  1HQE A;  2VGM A;  3OJS A;  3J7Y P;  4HTU A;  2HMP A;  2UXD K;  1NK5 A;  1RDU A;  3R3L A;  1IG9 A;  3O6W A;  4NXN K;  4MO4 A;  4FVU A;  4BC2 A;  4F9O A;  1NGD A;  2HBJ A;  3C6A A;  4CFD A;  5AZI A;  4JS5 A;  1CLQ A;  2HNZ A;  5BRF A;  2ZQB A;  4KHW A;  2NRV A;  1LW0 A;  1YTU A;  4BRC A;  5GAE P;  4E7J A;  1H1V A;  4BDZ A;  2QKB A;  3G10 A;  1KFS A;  3EE9 A;  4FLT A;  4CJ5 A;  3FGU A;  3U9D A;  2Z1H A;  3J7Z O;  3E9L A;  4PQU A;  5FPD A;  1Z05 A;  1JLB A;  2CGJ A;  3HOS A;  3J7A P;  4H0V B;  3K2P A;  3UKU A;  1S1W A;  4FYD A;  4CEA A;  3VGL A;  4WCE L;  4CJU A;  3G71 N;  1X3M A;  2X6S A;  3VEW A;  1QQM A;  2A5X A;  1RBT A;  4KH6 A;  4FWO A;  4M42 A;  2E4L A;  3ZEU A;  4C1N K;  2RN2 A;  5BN8 A;  3OVN A;  4FM2 A;  1TK0 A;  1K8K B;  3M8Q A;  1YJN N;  4A2A A;  1VSI A;  3IFR A;  4Z94 A;  3IS9 A;  4PKI A;  4KHS A;  4M3T A;  3SBT A;  4HVJ A;  4IZ9 A;  3NF8 A;  1L5U A;  2BAN A;  3AA5 X;  3BF1 A;  3CCS N;  4DS5 A;  3C6H A;  4M63 C;  3DAW A;  4HUE A;  4KRF A;  3CCL N;  3UB5 A;  4LD0 A;  1X9J A;  1RBV A;  2NRW A;  3TAG A;  1RT4 A;  2KTQ A;  2HHW A;  4XIU A;  1TUY A;  4CF2 A;  3NH2 A;  4KB0 A;  4NYN A;  4CVN E;  3SQ4 A;  1D5A A;  3MN9 A;  4CW7 B;  3O9Q A;  4N56 A;  1ASW A;  4CJT A;  1GOC A;  4E1J A;  4CGJ A;  1SS6 A;  4FSV A;  3NVK A;  4KHQ A;  4PY5 A;  3BEX A;  4CGI A;  4FWP A;  1Q9Y A;  3VQ5 A;  1NJW A;  1L3T A;  2F8T A;  2Z1J A;  1NK4 A;  4KPY A;  4DV0 K;  3LZJ A;  4O55 A;  3ZT0 A;  4EFH A;  2E88 A;  4M41 A;  3O1W A;  2D0A A;  3ISN C;  3VQQ A;  3WXL A;  3HPG A;  4CE9 A;  1WBD A;  1VK0 A;  3V1O A;  3SI6 A;  1WN7 A;  1OH5 A;  3SUN A;  1WNS A;  2YCH A;  4GV9 A;  4JI1 K;  4PHT X;  1K73 O;  2FC0 A;  4LF7 K;  2O8E B;  2NLX A;  3BY5 A;  3TI0 A;  2BGG A;  4IG3 A;  3P1G A;  2G8U A;  3GBT A;  4YOU A;  4B9S A;  1UWB A;  1JLE A;  3EYZ A;  4Z4E A;  3NGI A;  1ATS A;  4EHU A;  4B3O A;  3OS1 A;  3RSE A;  3OW2 M;  1SL0 A;  4CHN A;  2ATQ A;  3ENB A;  2OA8 A;  1ASV A;  3FR0 A;  5AQI A;  1FK9 A;  5LY3 A;  1EO1 A;  4EZ9 A;  3D7E O;  3OYI A;  4K42 A;  4DTM A;  4LH4 A;  1KRP A;  3QDK A;  1V4S A;  4DTX A;  4FK2 A;  1ZBS A;  4A62 A;  1K9M O;  2E2P A;  1CZA N;  2QM1 A;  5BRE A;  4IFE A;  5HRP A;  1JL2 A;  3AGK A;  4CEB A;  4KAZ A;  3PV8 A;  1IBK K;  4HUG A;  4XH5 A;  3OA9 A;  5AQO A;  4KTQ A;  2O4G A;  4JKE A;  3ZSW A;  3D2E A;  2HHU A;  5AR0 A;  4JI3 K;  4B9U A;  3CQ8 A;  3THY A;  3GG4 A;  3U6F A;  3ENH A;  3QEW A;  1YIT N;  1RT2 A;  1KQS M;  1ZBH A;  4KHP K;  1IJJ A;  2ZF5 O;  1U4B A;  4N76 A;  3ASM A;  1IV0 A;  4C1N I;  2PZS A;  5FPN A;  5FRO A;  4O5B A;  3WXK A;  5GIO A;  5LMN K;  4NLC A;  3IMX A;  3SUO A;  1U6Z A;  5F2R A;  2XY8 A;  3HSC A;  4ILJ A;  1B9F A;  1QE1 A;  4H0O A;  2QKK A;  4FWN A;  4E3S A;  4QS7 A;  2IVN A;  3AO3 A;  1HJO A;  5JIC A;  4DQS A;  4W5R A;  2IDO A;  2HHQ A;  5ELZ A;  3JAM O;  3KK2 A;  3HST B;  1BA0 A;  5AQL A;  1LOT B;  4BC3 A;  2YKM A;  3PIO L;  2D0P A;  1KLN A;  4FJ5 A;  3NAE A;  3T1A A;  1NGA A;  1QHA A;  3AVM A;  2OAN A;  1C0M A;  4JYA K;  2GEM A;  3UE5 A;  5AQT A;  3SNN A;  3AA4 A;  5AZI B;  4DV7 K;  1TAQ A;  3HYF A;  3ZLJ A;  1L3S A;  3CQY A;  1I94 K;  3ID8 A;  3C6U A;  4AH9 A;  4B1X B;  2YNH A;  2QWR A;  4NO7 A;  4HHT A;  4CFB A;  4DSL A;  4CK2 A;  4BE1 A;  1C1B A;  3A5L C;  1RBR A;  4OLA A;  2OZS A;  1NK8 A;  5BN9 A;  2F9T A;  5HRS A;  3K58 A;  2PFU A;  4BDY A;  2P5O A;  1TAU A;  4AIL C;  5LL6 Z;  1ZYQ A;  4KTZ A;  3UKU B;  5DMR A;  3NVM A;  5AQJ A;  1WBB A;  3KWI A;  3TAQ A;  2QWQ A;  3V9U A;  1IKY A;  3S3O A;  1EX4 A;  4CIG A;  4Q5V A;  1LCU A;  2CGK A;  3VEX A;  3EY1 A;  4CZJ A;  3LAL A;  4BR4 A;  5BPL A;  3ZEU B;  1QZ6 A;  4CEC A;  1L3V A;  3VPZ A;  3QER A;  3OYH A;  1NGC A;  4FZX C;  2KLA A;  3DYA A;  3VQ6 A;  4QOZ B;  4C23 A;  2Q2R A;  2R7Y A;  5LJW A;  3VQ7 A;  2FSJ A;  1J5E K;  3O08 A;  4B1U B;  4FLU A;  3AAQ A;  1Q86 O;  3V9W A;  3ID6 A;  2KZZ A;  5FLX O;  4O4G A;  2RPI A;  1NOZ A;  1MDU B;  4MFB A;  3PLA A;  3DOK A;  2CH6 A;  4CHZ A;  1XHX A;  4E1N A;  4LFC K;  3C94 A;  4WFB L;  3ENO A;  3HVR A;  2OPP A;  2W41 A;  1Q81 O;  1BUP A;  1YJW N;  2AP1 A;  1KVC A;  2EX3 A;  4FL9 A;  1JLG A;  1BO5 O;  4JKF A;  4OVL A;  2G8K A;  2OPR A;  3O9R A;  3TAM A;  4JEP A;  1A5W A;  4DTN A;  3IRX A;  5ADX A;  2IVO A;  4H8K A;  4DR1 K;  1NGH A;  1REV A;  3WNH A;  3ALY A;  1RBS A;  3QIO A;  1RT1 A;  4OKJ A;  4YDU C;  1YTA A;  2FBV A;  3DRP A;  2YNI A;  4FW1 A;  2OPQ A;  1IKV A;  4QS8 A;  1GLL O;  1GLD G;  2YHW A;  3IG1 A;  5AZJ A;  5GIP A;  3OJU A;  3CCR N;  3TSU A;  2YX6 A;  3AVL A;  3OYM A;  1FXX A;  3MEG A;  5EVZ A;  5FPM A;  3AA3 A;  3QEP A;  3V1R A;  3CC4 N;  3V6D A;  3RSE B;  3RMD A;  1V4T A;  5JMV A;  4FWS A;  3L4I A;  1GOA A;  1Y64 A;  1FKP A;  3T3F A;  1YVN A;  5H1S Q;  2O4I A;  1HKB A;  4BRH A;  1VQ6 N;  1WSF A;  2JGU A;  3AGR A;  1BCM A;  2Z1G A;  3WNE A;  3VF2 A;  4I9Q A;  4JI4 K;  3CME N;  3SQ1 A;  2A6A A;  4DCH A;  3L0Q A;  4BRN A;  4PKH A;  4CIF A;  2GV9 A;  4JK8 A;  3O1B A;  2YI1 A;  4BRG A;  1QHT A;  4DR5 K;  4DF4 A;  5JVG L;  1IO2 A;  1U45 A;  1BIU A;  3I8B A;  4FWM A;  2B4J A;  3D2E B;  4IFV A;  4FK0 A;  2D0C A;  2XY6 A;  3THY B;  4FJL A;  3WQU A;  3CM6 A;  3TTD A;  3ZYY X;  3WNG A;  1SL2 A;  5HRN A;  3CFR A;  2HB5 A;  2NRH A;  3TWH A;  1WSG A;  4JK9 A;  1TYQ A;  3B8A X;  4CEZ A;  4U67 L;  1J9A A;  3SUP A;  4BRE A;  3J8A A;  4I2Q A;  5AQQ A;  3I33 A;  5M1N A;  5CE3 A;  1SKS A;  4GV6 A;  1HQU A;  2FSK A;  5TKY A;  3OBW A;  1Y97 A;  4CZM A;  5I3U A;  4KHN A;  3CJ9 A;  3MAQ A;  3N4Q A;  1SL1 A;  3LM9 A;  1RBU A;  1T44 A;  2O8B B;  2KKZ A;  1S3X A;  3MXJ A;  3U3G A;  3LPU A;  2YHY A;  4DFM A;  3EN9 A;  2Y1J A;  2G8F A;  4MQ3 A;  1SV5 A;  2HHV A;  4IEE A;  1OVY A;  3P39 A;  4E19 A;  3HXM A;  1QQO A;  5F0X A;  4IJA A;  3SV4 A;  4KI4 A;  3K5O A;  3SPZ A;  1NM1 A;  3MX2 A;  4FLY A;  3PX6 A;  5AFU A;  4GVM A;  3CCJ N;  3KLE A;  4QCL A;  3L3V A;  1HNV A;  3TSP A;  2OPS A;  4CEF A;  1NJZ A;  3ATV A;  3D2F A;  3CJC A;  4IJN A;  3SLC A;  3S3N A;  3D6R A;  5CYM A;  2QWP A;  3HM9 A;  1QSY A;  2AJQ A;  4M3Y A;  3AVH A;  2B5J A;  1XQS C;  4FJJ A;  3SMP A;  3FZF A;  1U49 A;  3R1X A;  1RGI A;  4BVP A;  3VN5 A;  1U2V A;  3PX0 A;  4BGA A;  1WUA A;  4NCA A;  2OCE A;  2ZGY A;  4DLG A;  4J8F A;  5JS2 A;  3ITH A;  1EKE A;  5AQH A;  1E4F T;  3KD5 E;  1X3N A;  1WSH A;  4IKF A;  4M7Y A;  5CY4 A;  3GOI A;  4U7B A;  4DFP A;  1NJI O;  5CZ1 A;  4FJH A;  3VEY A;  3PO5 A;  4CGD A;  3S41 A;  1BG3 A;  1C6V A;  1OH7 A;  2HHX A;  3BP8 A;  4CED A;  3U3Y A;  1S5J A;  2VG5 A;  2HMI A;  3H08 A;  2DY4 A;  1EQY A;  2ASO A;  3LAM A;  4BDP A;  1TKD A;  3SMS A;  4YOX A;  4IEI A;  1W2B M;  4DQI A;  4CZE A;  5J2P A;  3TAP A;  1VQ5 N;  1ZBL A;  2HNY A;  4ZTJ A;  1NMN A;  4DQR A;  4ISF A;  3DWL A;  1HYS A;  4B8A B;  2P9P A;  4KO0 A;  1BHL A;  3KZB A;  4C8N A;  1W7A A;  2HBL A;  4B3T K;  1YXQ A;  1BIZ A;  4JKD A;  3K5L A;  1JLQ A;  3KWG A;  3CPE A;  3AVK A;  1WOQ A;  3KHY A;  2X78 A;  2IOC A;  3E1Y A;  3LPT A;  3PSF A;  1WLJ A;  4G1Q A;  1NKB A;  5AZJ B;  3THX A;  3CET A;  3QBX A;  4HTL A;  2NRZ A;  1NMD A;  3ZSR A;  3B6O A;  3OHR A;  2QWO A;  4M3Z A;  4KKO A;  4FLW A;  2G8V A;  4B3R K;  5AFU H;  1NGJ A;  1XMQ K;  3HO1 A;  1T6D A;  1Z6R A;  4CJF A;  3CC2 N;  4IO8 A;  5AQS A;  3O9S A;  4MDA A;  3CCV N;  3Q7B A;  3LP0 A;  1X1P A;  2UUA K;  3VGK A;  1RT5 A;  1KFD A;  3KTQ A;  3V81 A;  4GKJ K;  2IGI A;  4CFC A;  1NK6 A;  1HNZ K;  2GTD A;  1U47 A;  1Z25 A;  1G99 A;  1VRT A;  3QNO A;  1HX1 A;  2P9I A;  2HVI A;  1E3M A;  5KPR A;  3LL3 A;  4FPB A;  4HUF A;  3R6M A;  2UXB K;  3HRG A;  3NGY A;  3MN6 A;  5C0Y A;  3CCE N;  3RR8 A;  4HCC A;  4O0J A;  3I55 N;  4IXC A;  1HKG A;  5AQK A;  1KXP A;  1KAZ A;  2CH5 A;  2KFZ A;  1WAJ A;  1NGI A;  4W5O A;  5T7B A;  2KW4 A;  3I0S A;  5JLF A;  2ZJP L;  3QBW A;  5BRD A;  1YHQ N;  4X64 K;  1FJG K;  1TYQ B;  3OYK A;  4BRO A;  3C7N A;  4CIE A;  4GVE A;  5J1E A;  1N6Q A;  1IBM K;  3CFO A;  4H4M A;  5JS1 A;  1ASU A;  3A5N C;  1T05 A;  3EEQ A;  5AQR A;  3LDP A;  3P31 A;  3HL8 A;  3RRG A;  5FRM A;  1GLA G;  1VQ9 N;  3KKS A;  5AQG A;  1SQK A;  3FFI A;  4A57 A;  1VQP N;  1W9H A;  4KFB A;  3KK1 A;  2NZT A;  2HF4 A;  3OYN A;  1U04 A;  2O8D A;  3CI5 A;  5C24 A;  4CZF A;  2BUP A;  5EOY A;  1X9M A;  4A5B A;  2FBX A;  4DTR A;  1DTQ A;  3ZET A;  3A0I X;  4GNI A;  2GUP A;  4B9T A;  3VF6 A;  3BUZ B;  3F5T A;  1RNH A;  4CFA A;  4H4O A;  3KVG A;  3E9P A;  1W97 L;  4B8C A;  3OYL A;  4CCH A;  4CBU A;  3LZI A;  4IDK A;  4PL7 A;  3A5M C;  2A42 A;  2QK9 A;  3QML A;  2WC9 A;  4IBN A;  3M1F A;  1ILY A;  3D2F B;  1EWR A;  2DFH A;  4Y1C A;  1QTM A;  2PYJ A;  4CF1 A;  4M3U A;  4B3M K;  4BVO A;  4H5N A;  1C0G A;  4XH4 A;  3F2K A;  1XNQ K;  1EWQ A;  1DT9 A;  3O5B A;  1VQ8 N;  4JS4 A;  2J4R A;  4K0K K;  1HMV A;  4CZG A;  2VG6 A;  4B08 A;  2G8I A;  5MLC Q;  1U2V B;  3LDQ A;  4DV3 K;  1TL1 A;  1XNR K;  4FOE A;  4H5R A;  3SAG A;  1K8A O;  1KTQ A;  3T19 A;  3R9P A;  1LWE A;  2HF3 A;  3S3M A;  1LAV A;  2YV0 X;  5BRH A;  2V51 B;  2G8W A;  3CCU N;  3P83 D;  4ISG A;  3SZ2 A;  5EU7 A;  4BC5 A;  3T1H K;  3RWU A;  4YOR A;  1TV6 A;  2W42 A;  4Z4H A;  4JI5 K;  4CGG A;  3QO9 A;  2UYT A;  5BPM A;  4LC9 B;  3SJJ A;  4LFA K;  3VTH A;  3NH0 A;  1N34 K;  2FBT A;  1VQ4 N;  3NF6 A;  4OGE A;  4BQZ A;  4KB1 A;  4CEO A;  4I9L A;  4K8X A;  4XH1 A;  2OTL N;  4JKH A;  4RTF D;  2P9P B;  2D1K A;  4DQ8 A;  3EZ5 A;  4K43 A;  2OYQ A;  3QIC A;  1S1V A;  4FWK A;  1X9S A;  2E1Y A;  3M3Z A;  1T8E A;  4NCG A;  4MDB A;  4QAG A;  4DR6 K;  4DU4 A;  3CIP A;  1S9G A;  2H3G X;  4FJG A;  1CXQ A;  4DTU A;  1LWC A;  5HBM A;  3E01 A;  3FE1 A;  3DLE A;  2ZJR L;  3THX B;  1X9W A;  3DJC A;  4OGC A;  2F4V K;  3QEV A;  4BY9 C;  2NRT A;  3AVI A;  1LW2 A;  5DM6 L;  1QZ5 A;  1S22 A;  1RCH A;  1KVA A;  5AQY A;  4UY8 O;  4E7K A;  3EO3 A;  4CK1 A;  4DU3 A;  3MED A;  4BRI A;  4RCH A;  1Q18 A;  3OYG A;  4RW9 A;  2DTU A;  4CES A;  1TK5 A;  4PKG A;  4MLE A;  4ELV A;  1YVU A;  3AVC A;  3MCA B;  3WXJ A;  4BRM A;  1ZBI A;  3BF3 A;  3SAH A;  4AQY K;  1IKX A;  1HKC A;  4M3X A;  3WEE A;  3F9M A;  4RW6 A;  1BOT O;  1TKZ A;  2IS3 A;  4JLH A;  4OLB A;  3J81 O;  3C0B A;  4BG9 A;  1S1U A;  4FWQ A;  2P9I B;  3RTV A;  2KQ2 A;  3T7Z A;  5IWA K;  3G4S N;  1T3V A;  5J2N A;  4DKW A;  2QEX N;  1RDA A;  4EAH D;  1VQL N;  3GL1 A;  1JCE A;  4KH5 A;  2QWN A;  4IWV A;  4O8U A;  3LDS A;  3NBP A;  4AHR A;  3U4L A;  5SWM A;  2WON A;  4AHS A;  1EP4 A;  1NK9 A;  4BR9 A;  4K25 A;  1HUX A;  1BA1 A;  3H3O B;  3FZL A;  3DXK A;  1KCF A;  4OPH A;  4FM1 A;  3AY9 A;  4B1Y B;  3C7N B;  4A59 A;  3NMU A;  4EIA A;  3T1Y K;  2YJE A;  2UXC K;  3RR7 A;  3ZSQ A;  1IKW A;  3DI6 A;  1BDG A;  4AHC A;  4CJR A;  5BPN A;  1J54 A;  1HJR A;  1RFQ A;  3EL2 A;  1TK8 A;  3EKU A;  1KLM A;  4F8R A;  3BGR A;  2HHT A;  5HRO A;  3IKM A;  4JAX A;  2O8D B;  3H6E A;  3B6P A;  4CBW A;  4CJQ A;  4YFU A;  4PUO A;  4BRD A;  1UA1 A;  3ZET B;  4FJX A;  3M8P A;  3VQB A;  3AVG A;  1MU2 A;  1UAX A;  2P51 A;  3VGM A;  4CHY A;  1EXQ A;  2CGL A;  5E84 A;  3PY8 A;  3RVC A;  1J6Z A;  2YHA A;  4DSI A;  3SUQ A;  3FZH A;  3HP9 A;  3CM5 A;  3QB0 A;  3PIP L;  2YNG A;  3HOT A;  2ZM6 K;  2B6A A;  2HOE A;  4C8O A;  1VSH A;  4H0Y B;  3V1Q A;  1F21 A;  4LFB K;  2QTD A;  3G6E N;  2P9K A;  3MMV A;  2W6L A;  3M8R A;  5KQD A;  4O0I A;  1QVG M;  3ZCM A;  4DWI A;  3M6G A;  3N4P A;  4CF9 A;  3ZSZ A;  1RIL A;  4NLB A;  3AO1 A;  3KLI A;  2Q3S A;  4FXD A;  3LP3 A;  3P4I A;  3HVT A;  1RT3 A;  3V9X A;  4WFA L;  3JYT A;  4OPK A;  4B3S K;  3VMF B;  1GLE G;  4XEI A;  4B9M A;  4LF8 K;  3IDH A;  3L2Q A;  1E4G T;  1DGK N;  2X6N A;  4EHT A;  4FLV A;  3TAN A;  4Y0W A;  1VQO N;  3MWP A;  1R59 O;  5JVH L;  1FKO A;  1JCG A;  2WTU A;  4LF6 K;  4DV2 K;  3O80 A;  3VQE A;  5KQ8 A;  3TTF A;  4OPA A;  4V19 S;  3VER A;  3K9J A;  4CJE A;  4KH4 A;  4CJ7 A;  4Z4F A;  3L2V A;  3MX5 A;  4H5W A;  3RMA A;  1VQM N;  2HVH A;  3RMC A;  3NE6 A;  4JKG A;  1MA9 B;  2UUC K;  3VQA A;  5J2Q A;  2ASM A;  4CHP A;  2G8H A;  2DFE A;  3WXI A;  1IH7 A;  3AO4 A;  2IC3 A;  3VEO A;  4DTS A;  3PO4 A;  3DLG A;  4A2B A;  4CEE A;  5C12 A;  2UUB K;  1HR0 K;  2QXL A;  3FLC O;  4H03 B;  5ADX H;  3G0Z A;  1OH8 A;  4FZY A;  1XUP O;  3QFU A;  4CJ3 A;  3V9Z A;  3VQC A;  1GLB G;  3TTC A;  1RDB A;  4DF8 A;  1RTD A;  5D3G A;  1SKW A;  2Q36 A;  3H46 O;  4OO1 J;  2E20 A;  3K5N A;  2ZD1 A;  4JK7 A;  2V52 B;  4BWJ A;  4MLH A;  1Q82 O;  4I6M A;  3SBG A;  3L2R A;  4AF1 A;  2BTF A;  3CJB A;  2HND A;  1WSI A;  4DV6 K;  3TR8 A;  4CF8 A;  4PWD A;  3O4Q A;  2V7Z A;  4BR7 A;  1NLV A;  2P9S A;  4EP4 A;  4FCY A;  4DSJ A;  2P9N A;  1J53 A;  2VWK A;  1IBL K;  5GAD P;  4O8K A;  2A3Z A;  3KK7 A;  1S6P A;  3QIN A;  5AQW A;  4B9V A;  3WEE B;  1JXE A;  4CJW A;  1VSM A;  1NKE A;  2WFB A;  4BR5 A;  1TL3 A;  1NGG A;  2BE2 A;  1UOC A;  2O8C A;  4FW2 A;  4LY7 A;  2FXU A;  4ID1 A;  3SQ0 A;  3PSI A;  1GOB A;  4CJV A;  4G9Z A;  4MO5 A;  1LV5 A;  1U48 A;  3DLB A;  4CEQ A;  2D0B A;  3U9Z A;  4BQL A;  3LDN A;  1P90 A;  1XWL A;  4DR3 K;  4LSL A;  3EZW A;  1KAX A;  4WFN L;  4CK3 A;  5C25 A;  4E7I A;  1YIJ N;  2VG7 A;  2Q31 A;  3MN5 A;  3DXK B;  3AA2 A;  5KRT A;  2DPN A;  3OYE A;  4B1W B;  1OVQ A;  4AM7 A;  4JRP A;  3DLL L;  3A8Y A;  3IUC A;  3ULE A;  1XMO K;  2P5G A;  4F3T A;  1N32 K;  1RDD A;  4WQ4 A;  4JN4 A;  1QQN A;  2PAV A;  3JXU A;  2KHO A;  1C0T A;  2PBD A;  4CJP A;  3RMB A;  1BQN A;  5K14 A;  1WSJ A;  3ZT2 A;  2E1Z A;  3HP6 A;  3ATU A;  4J2D A;  4N41 A;  4C8M A;  5E41 A;  1QQC A;  3HPH A;  1I39 A;  3DLK A;  3FZM A;  4FWL A;  5DM7 L;  1RDW X;  1JJ2 M;  2A1S A;  5EXW A;  4GMJ B;  3JS6 A;  1S1X A;  1T7P A;  3PX4 A;  4BE2 A;  4X66 K;  3A2F A;  3HBT A;  3WNF A;  3KD1 E;  3QFP A;  4QS9 A;  2VWJ A;  4LSN A;  5C10 A;  5BR8 K;  4Z4G A;  1ZC6 A;  1RTI A;  2XY7 A;  3TAR A;  2P9K B;  4IDH A;  4B1V A;  4DHY A;  3QEI A;  2WUS A;  2HHS A;  1BGX T;  3AAR A;  4DV5 K;  3MN7 A;  1DKG D;  3O4N A;  3FZK A;  3HTV A;  3LDO A;  4JRQ A;  3KJV A;  4DUZ K;  4DTJ A;  4GV3 A;  2ZWH A;  2QW9 A;  3C65 A;  5I42 A;  1C0F A;  1HPZ A;  4JHD A;  3C6T A;  3BDP A;  3KKR A;  1OH6 A;  4BAC A;  4FJN A;  1BWF O;  1YJ9 N;  2GWJ A;  1HNW K;  5AQM A;  3SV3 A;  4TSX A;  4DUY K;  4O44 A;  4BRP A;  3NHG A;  4X62 K;  3IAY A;  3MXI A;  3VF4 A;  4ISE A;  1A5X A;  5AQF A;  3MK6 A;  3ZSV A;  2KZM A;  4FZZ A;  1TUU A;  1Q7Y O;  3G25 A;  4E7L A;  4DS4 A;  2Q0U A;  4RW7 A;  4KBO A;  1HNX K;  3GDQ A;  1NK0 A;  3TAF A;  2XY5 A;  1JL1 A;  4EZ6 A;  2EWS A;  2JLE A;  2XRI A;  3ZT3 A;  4CZL A;  1JLC A;  1IG8 A;  2NRR A;  3NFA A;  3HM8 A;  2I7P A;  4JKG B;  2HBK A;  2XHB A;  1N5Y A;  4IOA L;  1B92 A;  4DU1 A;  1JCF A;  2X74 A;  1D9D A;  3VES A;  1S72 N;  1XC3 A;  4DV4 K;  4YHH K;  1FW6 A;  1OKJ A;  5EY4 A;  3C95 A;  4GY2 B;  4JKB A;  3GE1 A;  3UKR A;  1JXB A;  4AM6 A;  3DRS A;  4J2B A;  5I9E B;  3DLR A;  3O3H A;  4CJL A;  1S6Q A;  3J80 O;  2RKI A;  1Z26 A;  3MEC A;  3O9T A;  4E1M A;  3THW A;  1NG9 A;  3SYZ A;  2D5R A;  1YT3 A;  1DLO A;  3MCP A;  3ZX0 A;  4FLX A;  2ITG A;  3DMJ A;  3KLG A;  5C42 A;  3K57 A;  1TKX A;  3WUH A;  1Q9X A;  2QA4 N;  3PUF A;  3OYD A;  2O8F A;  3ZSO A;  4FK4 A;  5GAH P;  4BG8 A;  3VEZ A;  4CGF A;  4I6M B;  4JI2 K;  2JWK A;  4PA1 A;  4E0D A;  2W40 A;  2E5L K;  4DSK A;  1JKH A;  2ITM A;  2P9S B;  4WF9 L;  3MDQ A;  2P9N B;  1BIS A;  4KHY A;  4WYB A;  2FF3 B;  4BE0 A;  5B8H A;  3LM2 A;  3L8B A;  3ULD A;  2NNW A;  5CYQ A;  1NNE A;  2O8C B;  4RW4 A;  5AQU A;  2YHB A;  1CZB A;  1VSJ A;  4CJ4 A;  4ZTF A;  2FBY A;  2GBZ A;  1BCO A;  1N8R O;  1NK7 A;  3CER A;  2P9L A;  1HYV A;  4CHO A;  5AQN A;  2D0O A;  3AO5 A;  4ILG B;  4CJS A;  4FJM A;  3I56 N;  1RT7 A;  3R8E A;  3H1Q A;  3VA0 A; 
#chains in the Genus database with same CATH homology
 2HHH K;  3T1Y K;  4NXM K;  2UXC K;  1N36 K;  1HNX K;  4GKK K;  4JI1 K;  2VQF K;  2UUC K;  4B3T K;  4LF7 K;  4YY3 K;  1XMO K;  1N32 K;  4JYA K;  4DV7 K;  4DR7 K;  5A2Q O;  4DV4 K;  1I94 K;  4YHH K;  4DR6 K;  2UUB K;  1HR0 K;  4OX9 K;  5LMU K;  3J80 O;  3J7A P;  2F4V K;  4B3R K;  5LL6 Z;  4DR4 K;  1XMQ K;  4DR2 K;  4LF9 K;  4X65 K;  2ZM6 K;  4X66 K;  1N33 K;  2UUA K;  4LFB K;  4JI4 K;  4GKJ K;  1IBK K;  2VQE K;  4LF5 K;  3OTO K;  4DV6 K;  4B3M K;  1HNZ K;  4AQY K;  4JI2 K;  5BR8 K;  1XNQ K;  1IBL K;  2E5L K;  4DR5 K;  4K0K K;  4JI3 K;  4LF4 K;  4JV5 K;  4JI8 K;  3J81 O;  4DV3 K;  1J5E K;  2UXB K;  1XNR K;  4DV5 K;  5IWA K;  4DV1 K;  5AJ3 K;  5FLX O;  4B3S K;  4CVN E;  4DUZ K;  4KHP K;  4LF8 K;  5IT9 O;  4CW7 B;  4JI6 K;  5LMN K;  4LFC K;  4JI7 K;  1HNW K;  4DUY K;  4DR3 K;  3T1H K;  4X64 K;  4LF6 K;  2UU9 K;  1FJG K;  4DV2 K;  4X62 K;  4JI0 K;  3J7Y P;  4DV0 K;  4JI5 K;  2UXD K;  4V19 S;  1IBM K;  4LFA K;  3JAM O;  1N34 K;  4NXN K;  4DR1 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...