4DUYK

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 27
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4duyK00
4DV7K 3JAMO 3J7YP 4DR4K 1HNZK 4JI1K 1IBKK 4GKKK 4B3TK 1HNWK 4CW7B 4LF5K 4JI4K 4JI0K 4DR5K 4V19S 4LF7K 3T1YK 3J80O 5LMUK 5LMNK 3T1HK 4DV1K 4YY3K 2UUAK 4YHHK 4OX9K 4JI3K 5AJ3K 4DV4K 4AQYK 1N36K 4X65K 1XNQK 1FJGK 2VQFK 4B3MK 4JI8K 4K0KK 2UU9K 3J7AP 4X62K 2UXCK 1I94K 1HR0K 4LFAK 3J81O 4GKJK 5A2QO 4X64K 4DV6K 4NXNK 1IBMK 4DV0K 1N32K 1XMQK 4LF8K 5IWAK 1XMOK 4X66K 2E5LK 4LF6K 1IBLK 4DR2K 4B3SK 3OTOK 5BR8K 2HHHK 4DR6K 4DUZK 1J5EK 4DR7K 2F4VK 4NXMK 4CVNE 2UUCK 4LFCK 2ZM6K 1N33K 4DUYK 5IT9O 1N34K 4DV3K 4JYAK 2VQEK 4B3RK 5LL6Z 4LFBK 1HNXK 4JI2K 4JV5K 4DV5K 4DR1K 4LF4K 2UUBK 4JI6K 2UXBK 4DR3K 2UXDK 4KHPK 4DV2K 5FLXO 4JI5K 4JI7K 1XNRK 4LF9K
chains in the Genus database with same CATH superfamily
3C7NA 4M41A 1YJ9N 4B08A 5FDLA 4FPBA 2D1KA 3O9TA 3WXJA 1CZAN 3NF7A 1JLAA 4IOAL 2VYPA 3QNOA 5KQ8A 3U9ZA 4CFCA 2BTFA 4B3TK 3C6UA 4K8XA 3LL3A 4MLEA 2A6AA 4N47A 2WTUA 4IFYA 1TK5A 5LMNK 1U47A 3OYHA 1BWFO 4DQIA 5DM6L 1NK8A 5HRNA 4JS5A 3LZJA 2PYLA 3LDOA 3ZSWA 2QI2A 1Q81O 2R7YA 4DSLA 4FL9A 3AAQA 3SUQA 4H5RA 4KHUA 3ATUA 4NYNA 1WSIA 2WONA 2OYQA 1S9EA 3VGKA 1RTHA 4CJ4A 4ISEA 4KH6A 1B9DA 2UU9K 1NGEA 3KD5E 3BZCA 1MWKA 1YAGA 3PLAA 2QWLA 3QDKA 4OO1J 3PSIA 1JXEA 1RBSA 3OYCA 2GELA 1G15A 3RMCA 1E4FT 4K42A 4CJPA 2E2PA 1XMOK 3TARA 3TSUA 3ZETA 4IJNA 4HUGA 4BR9A 4N56A 3OTOK 4HTLA 3H6EA 4DS5A 3DLLL 3KK2A 2ZJRL 3V1RA 3V6DA 5J2QA 1BA1A 1DTQA 3M8PA 3JXUA 4QS8A 1U2VA 1KAXA 4CVNE 3G10A 1ZBHA 3T3FA 2ZM6K 3OBYA 2W40A 3FE1A 3VQCA 3VQ7A 1W97L 1SKWA 4OPJA 2VWKA 2QWQA 4CHYA 3KK3A 3SUOA 3O5BA 2P9IA 4IBNA 1C6VA 4JS4A 3SJJA 1NK5A 1K8KA 4C8MA 4KFBA 1L3SA 3CC7N 3I56N 1T7PA 3LM2A 3AVFA 1W7AA 4DTJA 2YJFA 1S1WA 1D5AA 3CJ9A 3IAYA 3I8BA 4GV3A 4JHDB 4LH4A 1QSYA 1XNRK 2KW4A 1T05A 5EX5A 1RFQA 3FZMA 3VEVA 4CF0A 1RDDA 1FKPA 4M3TA 3TAFA 2AJQA 3C6HA 4Z4GA 4CEQA 1TKZA 1GLBG 3DOKA 1ASUA 1KAYA 1Z25A 4BRQA 5AQFA 3K5LA 4KKOA 1S1XA 4O44A 1EX4A 3T1HK 1HPMA 2G8VA 3HM9A 2GBZA 2RKIA 1JLQA 3ZX0A 5I9EB 1VAZA 1T8EA 4CEEA 5AJ3K 3PX0A 2OPPA 4KI4A 3VQ5A 1CZ9A 4PKHA 4X65K 1FJGK 4K25A 4BROA 3ZT4A 2IAJA 2VGMA 4K0KK 2HHTA 3EKUA 1HR0K 5AQIA 4B9MA 4GVMA 3DYAA 4DSEA 4JKFA 2HMPA 3RR7A 3VQQA 4FYDA 4DLGA 4O8KA 1QQNA 2HMIA 3DI6A 3HP9A 1Q8IA 3TI0A 2QWMA 2Y1IA 4IDHA 3SJHA 2HBJA 4B3SK 4G1QA 4JK9A 1V4SA 1JLCA 4H5TA 4DF8A 2Q97A 3HBTA 3VF6A 2D0AA 4K43A 2UUCK 4FWNA 2VGNA 1TK8A 4TSXA 1UOCA 3HTVA 4JK8A 4DQQA 4DUYK 2NRZA 3HSCA 1WSGA 3CCJN 1NJYA 3OYDA 2YHYA 1X9WA 5HRSA 5KGXA 1UWBA 3MXMA 3HZ6A 2Q36A 2OA8A 1VQ4N 3QESA 2Q2RA 3ULEB 4KBOA 2W6LA 1BQMA 1SL2A 3C7NB 3SMPA 4DQSA 3MN9A 2CH5A 5CYMA 2B6AA 2P9UB 3CETA 3TTCA 3KD1E 1XHXA 4FPAA 1QVFM 1NGDA 4KREA 1YF5L 2EHGA 4AHUA 4Z94A 3CQ8A 2V7YA 1TUUA 3LAMA 1HNZK 4E1NA 1RTDA 4M3ZA 1NGIA 2D0CA 4M3XA 1BQNA 3MXJA 4CZJA 1LWCA 2I7PA 3O3HA 4BC2A 4FWLA 1NG9A 5E41A 2A40A 2HOEA 4Z4CA 3NDKA 3OYBA 5HLFA 4RW8A 1RGIA 5AQPA 4FZXC 3UE5A 4BR7A 3I0SA 1EQYA 5AQWA 3E9PA 3BDPA 1LAVA 4B9UA 3B6OA 2YX6A 1OH6A 1RDBA 4O8UA 4JKDA 4G9ZA 4ID1A 2ITMA 3DXKA 3THWB 3LP0A 1R59O 1L3TA 1OVYA 1W9HA 1VSDA 3O3FA 3U3YA 3R1XA 3OYEA 1ASWA 1ASVA 3OS0A 1KD1O 2QW9A 5E84A 4A5AA 4C8OA 4ZHRA 1KVCA 4FLTA 4KHNA 3UKRA 1NK0A 4BRMA 3SMSA 3CFRA 4WFAL 2QWOA 1RTJA 4E7JA 3AVJA 3AA2A 4Z4FA 1FXXA 3P39A 3MXIA 3THVA 2OTJN 3NH1A 4C1NI 3ATVA 4C8KA 1TUYA 2F4VK 4BWJA 2VG7A 1Z26A 5AFUA 4DQRA 4A61A 1QE1A 2HHSA 1S5JA 3WXMB 3AVIA 1B9FA 4BRHA 1S6PA 3CCEN 4DCHA 5FPEA 3ID8A 3ULEA 3P38A 5J2NA 3NH0A 4ID5A 4NCBA 1TAQA 3HYFA 2UUBK 3ZX3A 2HNZA 4OGEA 2O8BB 4OKJA 2PY5A 4EIAA 3NGZA 4DV2K 3O80A 2E6MA 3WEEB 3TSQA 3D6RA 4A62A 2O8FB 2F9WA 3FZFA 2CGJA 1ATSA 3BP8A 1D9FA 3LP3A 5KRSA 1WBDA 4CEAA 1WUAA 3F9MA 3NVKA 3F73A 4DSKA 3KIOA 3M1FA 1MWMA 4IFEA 4IEEA 1U4BA 4BE2A 1JCGA 3IG1A 5AQUA 3MEEA 3NF6A 3NCIA 3L2UA 2IVOA 3SQ2A 3W3DA 4UQGA 3HXMA 3CC2N 4CHQA 4CD3A 3ITHA 3L2VA 1A5VA 4I6MB 4Q5VA 3EL2A 3JSMA 5C24A 4R5PA 3K0SA 3ZSVA 1RT5A 1JLEA 3FGUA 4MLHA 5M1PA 4AQYK 3S9HA 3OJUA 4M42A 1W0HA 2D0BA 2ZF5O 4QOZB 4DB3A 4LFAK 3VOVA 1VSJA 4GKJK 4CZMA 1X3NA 3GDQA 1KFDA 2KZMA 2IOCA 3W0LA 3THWA 1NGBA 3LM9A 3M8QA 4F4KA 5HROA 4QS9A 4AM7A 2HVHA 2KFNA 4HUEA 4A2BA 1KLNA 2QWRA 3QO9A 1ZBIA 3QFUA 2DTUA 1KFSA 2KFZA 2YNFA 4CJVA 3QETA 3QEVA 4CESA 3E1YA 1HYSA 4EP4A 3WNEA 1YVUA 1TYQA 2DFEA 3QMLA 2JWKA 2VG6A 4DMNA 5AZJA 4J2EA 1N34K 3H1QA 3PSFA 1VQ9N 3KKRA 3WXIA 4LH5A 5EOYA 2E88A 5M1OA 2F8SA 1EWQA 3DLKA 4B1WB 1P90A 4DTUA 5I3UA 2GWJA 3DLBA 1RBUA 4CBWA 4KV8A 1ZC6A 3THXB 3KLHA 3V81A 1DT9A 1BI4B 2HHUA 1I3AA 3MAQA 2KTQA 3P5JA 2YJEA 2IIRA 4FW1A 3DWLA 4HVJA 3AAPA 4CK3A 4FJKA 1BU6O 4RW4A 3LDLA 4JI4K 4R79A 2HNDA 4L3QA 4YNQA 2O8CA 3NGIA 4E3SA 3PX4A 1SKRA 3FZKA 2DFFA 2Z1HA 2NRHA 2BH1A 3SAFA 1D4XA 3KLGA 4M3RA 3SNNA 1BIUA 3FR0A 1K9MO 4W5OA 2GWKA 1EETA 2VQFK 3OW2M 2CGLA 2E20A 2QM1A 2BGGA 3J7AP 3AVNA 1NKCA 1I94K 2HBMA 3SQ1A 3VEZA 3VQDA 4O0IA 1TVRA 2PYJA 1NKEA 1VSLA 2A5XA 4M3WA 1NK6A 5DM7L 3IS9A 4CCHA 4JN4A 4DU4A 1BOTO 1WAFA 5KPTA 3RSEB 3VA0A 2PFUA 4BE1A 1J5OA 2F8TA 1QSSA 3QB0A 2XHBA 2P9UA 2IS3A 4IO9L 1VSEA 4BRKA 1NBWA 5AQHA 4WFNL 2EX3A 3F5TA 4XH4A 1BCOA 4AH9A 4W5TA 1IH7A 5FPNA 4JYAK 4H0VB 2HHVA 1E3MA 3IFRA 1C0UA 2I5JA 3ZSYA 4CJTA 1X9SA 4FJMA 2NRTA 4B9NA 1HX1A 1G99A 1HYZA 1UA1A 1KLMA 3NE6A 1XWLA 3AA3A 2VWJA 5I42A 1DKGD 3O4WA 3SI6A 5AZJB 3QEXA 2F9TA 2GEMA 4NYFA 1SS6A 3M6GA 3VETA 3D2FB 3WNGA 1HRHA 3TU5A 4AHTA 5BRDA 2Y1JA 2Q0UA 3ZSOA 4CD1A 1KAZA 3VQEA 3EO3A 4JEPA 1S1UA 1VQ8N 1WAJA 4NCAA 4EZ6A 3L6QA 5E26A 2J4RA 3K5NA 3THXA 1Q9XA 3AVKA 4DU1A 1KVAA 4H0XB 5LJVA 1SZ2A 4JD2A 4O55A 5AQLA 2FBTA 3O8MA 4Y1DA 2B4JA 3CC4N 4JKGA 3OHRA 1GOBA 4OX9K 4YORA 1ATNA 5KTQA 3B6PA 2P9KB 3MX2A 3H3OB 1LWEA 3IRXA 1N8RO 4A57A 1N36K 3K9JA 2OCEA 1RILA 1ZYQA 3L3UA 4O4GA 4A59A 5JLFA 3A5OC 4BWMA 2D0OA 1NMDA 4N5SA 4KH5A 5AQJA 4DKWA 1N32K 2GUIA 2RF2A 3WXKA 3K2PA 4DFKA 1MA9B 2XRIA 1HNIA 3M8SA 5F0XA 3WNHA 4A5BA 2QXFA 2E2QA 1OKJA 3RR8A 3VQ4A 4FJXA 1TV6A 1TKDA 4PUOA 4B1YB 3CMAN 1NGJA 3V9ZA 3SQ4A 3VGMA 4I2QA 4ISFA 4CJRA 1SKSA 2OPRA 1W2BM 4CHOA 1KVBA 3HRGA 1SL0A 4DLEA 1QSLA 4W5RA 4IFVA 2HSTA 3AVGA 3EYZA 4J8FA 2UXBK 4IEIA 1XC3A 1BISA 3NF9A 3VTHA 1NOZA 3CIPA 3AA4A 2IC3A 3U8XA 1NGFA 5MLCQ 5KRTA 2XY5A 1GLEG 3G25A 5GINA 2YNGA 2RN2A 3C94A 1O13A 3MX5A 1IBKK 2V51B 4IXCA 5CY4A 5JVHL 2P9NA 4ZTFA 4JI0K 3KWGA 3HO1A 4GV6A 3ZT3A 2OANA 3BF1A 3CCMN 1QHTA 5AQMA 5BREA 2AP1A 4ILHA 4LC9B 3V1QA 2O4GA 1KC8O 4PY5A 4QAGA 3V1OA 2W41A 2YNIA 3M8RA 4PL8A 2E8AA 3JS6A 3TAGA 3WNFA 3T7ZA 1P8ZA 3LPUA 4JNEA 2GX9A 2O8DB 3K59A 3CERA 2P51A 3SQ0A 1FK9A 1U2VB 4IG3A 4FSVA 4ILGB 2ASOA 4DV6K 1IBMK 5ADXA 2X78A 4MO5A 3VEYA 1D9DA 4CK1A 1WLJA 1Q18A 4LF6K 3NMUA 3O9UA 1EP4A 4BR4A 3R6MA 4JKEA 2G8WA 4KHSA 1EWRA 1FW6A 4DFMA 3PO5A 1QS4A 3PO4A 5C2DA 5BPLA 1WSHA 2P9IB 2O8EB 3E9LA 3U9DA 4NXMK 2HHQA 3U4LA 4FJJA 3G0ZA 4CGHA 1L3UA 1A5WA 4CI6A 3EE9A 1GLCG 1VQKN 3LWLA 3CD6N 3C65A 4PWDA 2VG5A 4DV3K 2WOMA 3BGRA 1I39A 3HPHA 4FWPA 3MEGA 3DLEA 4CGFA 3QEIA 1REVA 5GIOA 4DR1K 1ATRA 5CR4A 1VSMA 5B8HA 1VQNN 3U3GA 5M1KA 2G8KA 1TGOA 2CGKA 4H0TB 5EVZA 5GADP 3QEWA 4BVOA 1NKBA 4AM6A 4Y1CA 1XI1A 1ZXOA 4CJ3A 4KTWA 4JI7K 1RBVA 2XY6A 1VHXA 1BGXT 3J7YP 3OS1A 3CQXA 4E0DA 2HHXA 1V4TA 4FWQA 1S72N 4BQZA 4CJ5A 3CJAA 4BRFA 2YHAA 2X74A 2HF4A 3DLGA 3QLHA 1MDUB 5CZ2A 4BC4A 1HJRA 4JLHA 3CM6A 3ZSXA 4YHHK 5HOOA 1LOTB 1HUXA 2GV9A 3EZ5A 3ENHA 3EY1A 3G4SN 3C95A 4YDUC 5AZIA 3TAEA 2DY4A 4N76A 2E2NA 5BN9A 3THYB 4B9SA 4FWSA 3L3VA 3UB5A 4B3MK 3EEQA 3O3GA 3KJVA 1RTIA 3ZT0A 2O4IA 2UXCK 2P9LB 3J81O 3V9XA 3WUHA 1LCUA 2VWBA 4JRPA 4DV0K 5EU7A 2P9SA 5BRHA 3CHWA 3VQ8A 1T3VA 4OKEA 2B5JA 4DR6K 5HP1A 2OZSA 3O9RA 3CCSN 3A5LC 3QEPA 1IJJA 3AARA 3D2EB 2P1JA 1CLQA 4J2AA 2A3ZA 1NM1A 4YOYA 3VENA 5AQOA 3J7ZO 5LL6Z 4OGCA 4CIGA 3MCAB 3OYKA 1HNXK 3PUFA 1EXQA 5C42A 1Q9YA 3NGYA 3AGRA 4B9LA 4O0JA 2ZD1A 1BUPA 4BE0A 4FOEA 1NGCA 2QWNA 1DEJA 5HRPA 4DR3K 1ESVA 3SZ2A 4DTMA 4CJSA 5HRRA 1R0AA 5BR9A 1VQ7N 2E2OA 3HPGA 5CZ1A 4F8RA 3M3ZA 4RW7A 1UAXA 3BUZB 4OKKA 3TTDA 4FW2A 4KTQA 5T7BA 4BACA 1K6YA 2FSJA 4LF5K 4RG8A 1C0FA 5K14A 3PIPL 4C1NK 2UYTA 4BDPA 4DV1K 3HPOA 2XY8A 2UUAK 2RHKA 3HP6A 3DOLA 4IZ9A 3RMDA 4FJHA 1XUPO 1XHZA 4WQ4C 1C0GA 1CZBA 1XNQK 3OYIA 4CGJA 3H3NO 3ZEUA 5ADXH 3E01A 1VSHA 5F1XA 1QQMA 2W42A 1SV5A 1GLLO 3SAGA 2EWSA 5ELZA 5M1QA 1QQCA 3I8DA 4FM2A 5GAGP 3LP2A 4NXNK 1SAZA 4NLBA 4BRNA 3NHGA 3E9OA 4BR2A 4CZLA 1NWKA 4BQLA 4U67L 3SYZA 2G8FA 4BY9C 1YJNN 4B1XB 4AHCA 3S3MA 3H45C 3KK7A 4M3YA 1YTUA 3DRSA 4FZYA 4CGIA 2BE2A 4JHDA 3D2FA 4H0OA 4DS4A 3R3LA 1YT3A 1Z05A 2P5OA 5TKWA 1WOQA 1J9AA 5AQZA 1FKOA 2VQEK 3P1GA 3SV4A 4B3RK 1RT2A 3NVMA 4E7HA 2Z1GA 4CZHA 3ZT1A 5AQXA 2ZQBA 1YTAA 1TK0A 4ELVA 2X6NA 2FF3B 3CQYA 4H5WA 4E1JA 4CZKA 4F2RA 3RRGA 3CCRN 1C1AA 2PZSA 4NCGA 3QIOA 1NOYA 2F7TA 2A41A 4CEFA 4J2BA 5FLXO 2FBVA 2ZE2A 4HTUA 4H0YB 5DMRA 2QKKA 1Q86O 4M7XA 3QICA 1RT6A 4DQPA 4B1ZA 4KB0A 2O8EA 1GLJO 4KHQA 1LW2A 5C12A 4BRAA 3C6TA 3CCLN 4MQ3A 4FVMA 3CJBA 4DFJA 3KTQA 5KGWA 4GY2B 1JXBA 2D4WA 4B9VA 4LF7K 4PL7A 1EKEA 3J80O 4KB1A 1RCHA 3KHYA 4CF8A 4LSLA 3L2WA 4YY3K 4BGBA 4MDBA 4E19A 1D8YA 1RNHA 4BRGA 2HBLA 3UIQA 4J2DA 1DTTA 3LDQA 5BRFA 4DG1A 3ENBA 3KLEA 3O9SA 4Y0WA 3D45A 3MK6A 3O9QA 4H5NA 2D0PA 4CGDA 2P9KA 5AQNA 2ZWHA 3OY9A 2BANA 2A1RA 2YKNA 3RVCA 1S1TA 4PKGA 2FXUA 1VQMN 4B3OA 2QWPA 3LALA 3O1BA 2BUPA 3LDNA 5JLHA 5C10A 4PKIA 4YOWA 4FCYA 1XMQK 1DGKN 4GNIA 3P4IA 3NF8A 1IBLK 4DR2K 3T1AA 3N4PA 3ASMA 1HQEA 2CH6A 2IVNA 3VPZA 5AQGA 1X1PA 4CK2A 1NNEA 4FJLA 4O5FA 3O6WA 5JMVA 3CJCA 3T19A 3IKMA 3SBGA 5C15A 3L0QA 4GW6A 4E1MA 5IT9O 2E1ZA 1BA0A 5J2MA 4LFBK 4B8AB 4OJRA 1WSFA 4CZIA 1BG3A 4FWRA 2P5GA 4DF4A 1NGGA 1YUWA 4B8CA 4FLYA 3AA5X 1BO5O 2RPIA 2Q1NA 3LANA 3H46O 3CFPA 4JAXA 1VSIA 5LJWA 4DV7K 4RWTA 3JAMO 3FLCO 4K41A 4CBXA 4HCBA 1ILYA 4JKCA 1NK7A 1T6CA 5KPZA 3AVCA 3D7EO 4FWMA 4K8ZA 3HL8A 4WQ5C 4C8LA 4CFBA 4QS7A 4CJEA 2KQ2A 4DFPA 1L3VA 2A1SA 3CPWM 1DLOA 2VCPA 3UKRB 3TAMA 4FM1A 5AQKA 3AVAA 4BR0A 4H4OA 2F96A 3EN9A 2Q31A 3CFOA 4JI3K 4JKHA 2HBKA 3H1VX 1HKCA 2JWLA 2PAVA 1S22A 4BRLA 4IOCL 5KPRA 2Z1IA 3OYLA 1EO1A 2FC0A 3FFKB 2HNYA 4B1UB 3KK1A 4LD0A 1OH7A 4B9TA 4IO8A 1J6ZA 4CJUA 1JLBA 4WQ4A 3N4QA 2O8DA 1VSFA 4BDYA 4PHTX 4C8NA 3OBWA 2HVIA 4DTPA 1QTMA 2KZZA 1JCEA 1J54A 4IWVA 4CJWA 4Z4IA 4ZTJA 1U04A 4FOIA 2D5RA 3OYNA 4FJGA 1NK9A 3QINA 4CERA 3RMAA 3Q7BA 1NJWA 4W5NA 1RT3A 1KRPA 1KTQA 4DTNA 3HT3A 3SCXA 3MWPA 4XH1A 2WUSA 2KLAA 1YITN 3A2FA 3SAHA 4DV5K 1GOAA 4LF4K 5JICA 4DSJA 3KKSA 1T44A 3OS2A 2FLOA 4YOUA 3V9SA 5KI6A 4JI5K 5JS1A 4CIFA 5J2PA 3C6AA 1BHLA 5SZTA 4OVLA 1BCMA 3DMJA 1LWFA 3QERA 2ITGA 3VTIA 3HVRA 5AQTA 3PV8A 4FK4A 4YOXA 3ZEUB 5H1SQ 1M1KO 4GV9A 4E7IA 1QQOA 1VQLN 3AVHA 3VESA 3SK3A 3DRRA 4HHTA 2DFHA 3ENOA 4H4MA 1HYVA 1VRUA 1JKHA 3MWTA 1HLUA 3VA3A 4CZEA 1BL3A 3NH2A 3IMXA 4IDKA 3ZSQA 2NZTA 3DXMB 4C23A 4EAHD 4PA1A 4Z4HA 1MU2A 4KRFA 1TYQB 3DLRA 3ZT2A 1JL2A 2G8UA 1IG8A 3RRHA 1JL1A 1S1VA 1HJOA 5AQRA 4F2SA 2YNHA 4FJ5A 3L8BA 3SPYA 4GVEA 1LW0A 4FM0A 4KH4A 1VQ5N 3CMEN 2W6KA 4XEIA 1NJIO 3EE8A 2OTLN 3FZHA 4B9QA 3CXCM 2HHHK 4I9QA 4F9OA 3AV9A 2O8FA 2E4LA 3Q7CA 4FZZA 1N33K 3AVMA 3K58A 2OPQA 3FFIA 3SUNA 3CF5L 4BRCA 3JYTA 1X3MA 5AFUH 4AILC 4CJLA 4DWIA 1IO2A 4EFHA 3MN5A 1N6QA 5C25A 4CF1A 5CE3A 3UKUA 4XH5A 1SUQA 5JVGL 1ZBUA 4CF9A 1U49A 1NGHA 1QZ5A 4OPHA 4LF9K 1VK0A 4CZGA 4BDZA 3S3OA 4DR4K 3MN7A 2O8BA 3DM2A 1L5UA 1VSKA 3OJSA 3MN6A 4YFUA 3CYMA 3L4QA 2GUPA 3LDPA 1C0MA 4HUFA 3T1YK 1RDCA 5AQVA 3ALYA 3TTFA 1RT4A 3GBTA 2A42A 4DTSA 1C0TA 1IKWA 2E1YA 4LY7A 3RMBA 3HK2A 4CBUA 1J53A 3K57A 4L8RB 3RSEA 3OYMA 3F2KA 3I0RA 4AHSA 4FK2A 1TAUA 3U6FA 4DHYA 3QNNA 2FF6A 3CJ1A 4JKAA 4B1VA 3QBWA 4IOXA 1RDUA 3HSTB 2QXLA 3K9KA 1K73O 3NAEA 4HCCA 4ELTA 4YOVA 4FLXA 4H8KA 4E7LA 4OPAA 2NRXA 5AQQA 3T69A 2O8CB 3NBPA 1T6DA 1YVNA 3VF2A 4LF8K 5BPNA 4X66K 3KZBA 4Z4EA 4DTXA 5BPMA 4CF2A 4FK0A 4W5QA 3QIPA 4FLWA 2HW3A 5JS2A 1RBRA 4CJ7A 5EXWA 4DR7K 3VGLA 4A2AA 3LWMA 1Y97A 3O4NA 4JRQA 1KXPA 3VEXA 3M5RA 4LFCK 4EP5A 5HL7L 2NRRA 4OLBA 3DRPA 4DSFA 4CHZA 5M1NA 3BZKA 4FXDA 3DJCA 1TL1A 4Z0UA 5TKYA 4ILJA 4CEOA 3LAKA 3A0IX 3O4QA 3ZETB 4BG9A 3AO2A 3ZSRA 4M3UA 1YHQN 3HVTA 2HF3A 5DK5A 2X6SA 3D0PA 1X9JA 3THYA 3A8YA 4M7YA 4MDAA 4KHPK 4CJFA 3DLHA 1GLAG 4WFBL 1HNVA 3P83D 4ELUA 2QTDA 4M63C 4FLVA 2YHBA 4BC3A 4FJ7A 1BDGA 3GG4A 3QBXA 4FLUA 2OPSA 4RW9A 1NJXA 3SPZA 5M1FA 3OYAA 3RTVA 2YKMA 4JI1K 4CHPA 4YDUA 3VQ9A 1RBTA 5LY3A 4BGAA 4DQ8A 1X9MA 1LAWA 1T03A 3VQPA 4I2PA 3WEEA 2RE2A 4QCLA 4CFDA 3K5MA 2KKZA 1GOCA 2QA4N 4CEZA 4WE1A 3QFPA 3TR8A 2H3GX 3VMFB 5F2RA 2P9LA 5AQSA 4BRPA 1CXUA 2NRWA 3WQUA 4AHVA 3C0BA 1A5XA 3KLIA 3ULDA 4BRIA 1VQPN 3ZYYX 1WNSA 3NFAA 2QKBA 2P9SB 1S9GA 1U6ZA 1S6QA 4NLCA 2GTDA 2FSKA 4CE9A 4I6MA 1NJZA 3OYJA 2JLEA 2HB5A 4H0PA 3MEDA 3VQAA 2ETJA 4U7BA 2WFBA 1ZBSA 4YOTA 4FO0A 3TSPA 3S3NA 2XO7A 3DXMA 4DSIA 1NMNA 3VEWA 3O08A 4DUZK 4BRDA 3WQTA 2QK9A 3OA9A 1XQSC 2YHXA 3MCPA 3EKSA 4XIUA 2FBYA 1JLFA 3AVLA 1QHAA 3B8AX 3P31A 3SBTA 1RT7A 3CCUN 4F3OA 5C2FA 3LPTA 3H08A 4RTFD 2NRVA 2ZGYA 2NNWA 2YV0X 4CIEA 3VN5A 4DTOA 3AGKA 3BF3A 3AO3A 3SLCA 4JI2K 1WSEA 4JV5K 1HKBA 4KHYA 3AVBA 3OVNA 1ZBFA 1IKYA 4WQ5A 1H1VA 5GAEP 2XY7A 4WCEL 1O1WA 3TAPA 3HOTA 2ASMA 3SV3A 1IKVA 4KI6A 5FPMA 3TWHA 2HHWA 3GE1A 4EHTA 4CZFA 1Y64A 3TPQA 1UA0A 2G8IA 3CJ7A 2ATQA 2Z1JA 3MMVA 5C0YA 1Q82O 4GKKK 2Q0RA 5CYQA 4CW7B 3IUCA 1LV5A 3ZLJA 4DR5K 4V19S 3EZWA 4AF1A 3VEOA 5FRNA 3I33A 3VF4A 5LMUK 3CCQN 4JD2B 3SUPA 3WXLA 4FJIA 1E4GT 4CEDA 5FPDA 3LP1A 2NUBA 4BREA 1F21A 2IDOA 3HM8A 4MO4A 3TABA 5AR0A 1WN7A 3CPEA 3CI5A 3BEXA 1U45A 1S3XA 1OH8A 4DV4K 1YI2N 1TL3A 4CGGA 2ZGZA 1ITGA 4BG8A 2AA4A 1IKXA 3ZCMA 1HKGA 3ID6A 3VQ6A 1HQUA 4OPKA 3E66A 4IG0A 4CJKA 1K8KB 4WYBA 3OYGA 1BI4A 4IKFA 1YXQA 3G6EN 3PY8A 3I55N 4KHWA 2OZMA 4BC5A 2JGUA 1VQ6N 4MFBA 5KQDA 3J8AA 4IJAA 5GIPA 3LZIA 1BIZA 5IWAK 4WF9L 4RW6A 4FVUA 4FLZA 1TKXA 2WC9A 1SL1A 5SWMA 1QVGM 4FJNA 5BN8A 1VQON 5AZIB 4CECA 1OVQA 3CG7A 1J5EK 5EY4A 4JKBA 5D3GA 4NB4A 1WBBA 1C1CA 4UY8O 1HMVA 1YIJN 2WBNA 2ASPA 4BR5A 3ZSZA 3GL1A 4KPYA 4FJ8A 3VQBA 3CCVN 2PBDA 4I7FA 4NO7A 3TANA 4CEBA 4FWOA 3PIOL 4F3TA 4E89A 2P9PA 4JI6K 3F9KA 1B92A 1C1BA 3CM5A 2YCHA 2UXDK 1JCFA 4BVPA 3O1WA 4OLAA 4PQUA 3L2RA 3D2EA 4KO0A 1WB9A 3V9UA 2YHWA 1NU0A 3L4IA 3PX6A 4H03B 3A5MC 2P9NB 1KCFA 2ZJPL 4ICLA 3V9WA 3RWUA 3L2QA 1TKTA 3DAWA 1HNWK 1Z6RA 3V4IA 1RDAA 5CHIA 3ISNC 5GAHP 1JLGA 1IV0A 2I7NA 4ISGA 4DTRA 3AY9A 4JK7A 1Q7YO 5HBMA 1ZBLA 3OYFA 4M45A 2YI1A 4Q0BA 4GMJB 5J1EA 3AO1A 4RCHA 3S41A 4I9LA 1RT1A 2QEXN 4FJ9A 1KSPA 2IVPA 4HWIA 4JI8K 3AO5A 2ZJQL 1NLVA 2G8HA 2FBXA 2V52B 4X62K 1JJ2M 1SQKA 4JKGB 2LSNA 5A2QO 4X64K 2V7ZA 4FWKA 3A5NC 1NGAA 1KQSM 4LSNA 3GOIA 3HOSA 2BDPA 4N41A 1RDWX 3R9PA 1M90O 4KTZA 2E5LK 1QZ6A 1K8AO 3ZX2A 1CXQA 2KHOA 5BR8K 3AO4A 1OH5A 3K5OA 4E7KA 5FRMA 3BY5A 1XC9A 3KWIA 4CJQA 3MDQA 3VERA 4DU3A 3TAQA 3HI0A 1GLFO 3FZLA 4EHUA 4H5VA 4EZ9A 3G71N 5AQYA 3WT0A 4KAZA 2P9PB 1NK4A 1HPZA 2Q3SA 3HJFA 4AHRA 2FSNA 2NLXA 1GLDG 1IG9A 3IDHA 1U48A 4CFAA 3R8EA 3DXKB 1N5YA 1VRTA 3KVGA 2DPNA 3LDSA 1WSJA 3KLFA 2IGIA 4CHNA 2E6LA 1YJWN 5FROA 4O5BA 3MECA 3UKUB
chains in the Genus database with same CATH topology
4DV7K 3JAMO 3J7YP 4DR4K 1HNZK 4JI1K 1IBKK 4GKKK 4B3TK 1HNWK 4CW7B 4LF5K 4JI4K 4JI0K 4DR5K 4V19S 4LF7K 3T1YK 3J80O 5LMUK 5LMNK 3T1HK 4DV1K 4YY3K 2UUAK 4YHHK 4OX9K 4JI3K 5AJ3K 4DV4K 4AQYK 1N36K 4X65K 1XNQK 1FJGK 2VQFK 4B3MK 4JI8K 4K0KK 2UU9K 3J7AP 4X62K 2UXCK 1I94K 1HR0K 4LFAK 3J81O 4GKJK 5A2QO 4X64K 4DV6K 4NXNK 1IBMK 4DV0K 1N32K 1XMQK 4LF8K 5IWAK 1XMOK 4X66K 2E5LK 4LF6K 1IBLK 4DR2K 4B3SK 3OTOK 5BR8K 2HHHK 4DR6K 4DUZK 1J5EK 4DR7K 2F4VK 4NXMK 4CVNE 2UUCK 4LFCK 2ZM6K 1N33K 4DUYK 5IT9O 1N34K 4DV3K 4JYAK 2VQEK 4B3RK 5LL6Z 4LFBK 1HNXK 4JI2K 4JV5K 4DV5K 4DR1K 4LF4K 2UUBK 4JI6K 2UXBK 4DR3K 2UXDK 4KHPK 4DV2K 5FLXO 4JI5K 4JI7K 1XNRK 4LF9K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV7 K;  3JAM O;  3J7Y P;  4DR4 K;  1HNZ K;  4JI1 K;  1IBK K;  4GKK K;  4B3T K;  1HNW K;  4CW7 B;  4LF5 K;  4JI4 K;  4JI0 K;  4DR5 K;  4V19 S;  4LF7 K;  3T1Y K;  3J80 O;  5LMU K;  5LMN K;  3T1H K;  4DV1 K;  4YY3 K;  2UUA K;  4YHH K;  4OX9 K;  4JI3 K;  5AJ3 K;  4DV4 K;  4AQY K;  1N36 K;  4X65 K;  1XNQ K;  1FJG K;  2VQF K;  4B3M K;  4JI8 K;  4K0K K;  2UU9 K;  3J7A P;  4X62 K;  2UXC K;  1I94 K;  1HR0 K;  4LFA K;  3J81 O;  4GKJ K;  5A2Q O;  4X64 K;  4DV6 K;  4NXN K;  1IBM K;  4DV0 K;  1N32 K;  1XMQ K;  4LF8 K;  5IWA K;  1XMO K;  4X66 K;  2E5L K;  4LF6 K;  1IBL K;  4DR2 K;  4B3S K;  3OTO K;  5BR8 K;  2HHH K;  4DR6 K;  4DUZ K;  1J5E K;  4DR7 K;  2F4V K;  4NXM K;  4CVN E;  2UUC K;  4LFC K;  2ZM6 K;  1N33 K;  4DUY K;  5IT9 O;  1N34 K;  4DV3 K;  4JYA K;  2VQE K;  4B3R K;  5LL6 Z;  4LFB K;  1HNX K;  4JI2 K;  4JV5 K;  4DV5 K;  4DR1 K;  4LF4 K;  2UUB K;  4JI6 K;  2UXB K;  4DR3 K;  2UXD K;  4KHP K;  4DV2 K;  5FLX O;  4JI5 K;  4JI7 K;  1XNR K;  4LF9 K; 
#chains in the Genus database with same CATH topology
 3C7N A;  4M41 A;  1YJ9 N;  4B08 A;  5FDL A;  4FPB A;  2D1K A;  3O9T A;  3WXJ A;  1CZA N;  3NF7 A;  1JLA A;  4IOA L;  2VYP A;  3QNO A;  5KQ8 A;  3U9Z A;  4CFC A;  2BTF A;  4B3T K;  3C6U A;  4K8X A;  3LL3 A;  4MLE A;  2A6A A;  4N47 A;  2WTU A;  4IFY A;  1TK5 A;  5LMN K;  1U47 A;  3OYH A;  1BWF O;  4DQI A;  5DM6 L;  1NK8 A;  5HRN A;  4JS5 A;  3LZJ A;  2PYL A;  3LDO A;  3ZSW A;  2QI2 A;  1Q81 O;  2R7Y A;  4DSL A;  4FL9 A;  3AAQ A;  3SUQ A;  4H5R A;  4KHU A;  3ATU A;  4NYN A;  1WSI A;  2WON A;  2OYQ A;  1S9E A;  3VGK A;  1RTH A;  4CJ4 A;  4ISE A;  4KH6 A;  1B9D A;  2UU9 K;  1NGE A;  3KD5 E;  3BZC A;  1MWK A;  1YAG A;  3PLA A;  2QWL A;  3QDK A;  4OO1 J;  3PSI A;  1JXE A;  1RBS A;  3OYC A;  2GEL A;  1G15 A;  3RMC A;  1E4F T;  4K42 A;  4CJP A;  2E2P A;  1XMO K;  3TAR A;  3TSU A;  3ZET A;  4IJN A;  4HUG A;  4BR9 A;  4N56 A;  3OTO K;  4HTL A;  3H6E A;  4DS5 A;  3DLL L;  3KK2 A;  2ZJR L;  3V1R A;  3V6D A;  5J2Q A;  1BA1 A;  1DTQ A;  3M8P A;  3JXU A;  4QS8 A;  1U2V A;  1KAX A;  4CVN E;  3G10 A;  1ZBH A;  3T3F A;  2ZM6 K;  3OBY A;  2W40 A;  3FE1 A;  3VQC A;  3VQ7 A;  1W97 L;  1SKW A;  4OPJ A;  2VWK A;  2QWQ A;  4CHY A;  3KK3 A;  3SUO A;  3O5B A;  2P9I A;  4IBN A;  1C6V A;  4JS4 A;  3SJJ A;  1NK5 A;  1K8K A;  4C8M A;  4KFB A;  1L3S A;  3CC7 N;  3I56 N;  1T7P A;  3LM2 A;  3AVF A;  1W7A A;  4DTJ A;  2YJF A;  1S1W A;  1D5A A;  3CJ9 A;  3IAY A;  3I8B A;  4GV3 A;  4JHD B;  4LH4 A;  1QSY A;  1XNR K;  2KW4 A;  1T05 A;  5EX5 A;  1RFQ A;  3FZM A;  3VEV A;  4CF0 A;  1RDD A;  1FKP A;  4M3T A;  3TAF A;  2AJQ A;  3C6H A;  4Z4G A;  4CEQ A;  1TKZ A;  1GLB G;  3DOK A;  1ASU A;  1KAY A;  1Z25 A;  4BRQ A;  5AQF A;  3K5L A;  4KKO A;  1S1X A;  4O44 A;  1EX4 A;  3T1H K;  1HPM A;  2G8V A;  3HM9 A;  2GBZ A;  2RKI A;  1JLQ A;  3ZX0 A;  5I9E B;  1VAZ A;  1T8E A;  4CEE A;  5AJ3 K;  3PX0 A;  2OPP A;  4KI4 A;  3VQ5 A;  1CZ9 A;  4PKH A;  4X65 K;  1FJG K;  4K25 A;  4BRO A;  3ZT4 A;  2IAJ A;  2VGM A;  4K0K K;  2HHT A;  3EKU A;  1HR0 K;  5AQI A;  4B9M A;  4GVM A;  3DYA A;  4DSE A;  4JKF A;  2HMP A;  3RR7 A;  3VQQ A;  4FYD A;  4DLG A;  4O8K A;  1QQN A;  2HMI A;  3DI6 A;  3HP9 A;  1Q8I A;  3TI0 A;  2QWM A;  2Y1I A;  4IDH A;  3SJH A;  2HBJ A;  4B3S K;  4G1Q A;  4JK9 A;  1V4S A;  1JLC A;  4H5T A;  4DF8 A;  2Q97 A;  3HBT A;  3VF6 A;  2D0A A;  4K43 A;  2UUC K;  4FWN A;  2VGN A;  1TK8 A;  4TSX A;  1UOC A;  3HTV A;  4JK8 A;  4DQQ A;  4DUY K;  2NRZ A;  3HSC A;  1WSG A;  3CCJ N;  1NJY A;  3OYD A;  2YHY A;  1X9W A;  5HRS A;  5KGX A;  1UWB A;  3MXM A;  3HZ6 A;  2Q36 A;  2OA8 A;  1VQ4 N;  3QES A;  2Q2R A;  3ULE B;  4KBO A;  2W6L A;  1BQM A;  1SL2 A;  3C7N B;  3SMP A;  4DQS A;  3MN9 A;  2CH5 A;  5CYM A;  2B6A A;  2P9U B;  3CET A;  3TTC A;  3KD1 E;  1XHX A;  4FPA A;  1QVF M;  1NGD A;  4KRE A;  1YF5 L;  2EHG A;  4AHU A;  4Z94 A;  3CQ8 A;  2V7Y A;  1TUU A;  3LAM A;  1HNZ K;  4E1N A;  1RTD A;  4M3Z A;  1NGI A;  2D0C A;  4M3X A;  1BQN A;  3MXJ A;  4CZJ A;  1LWC A;  2I7P A;  3O3H A;  4BC2 A;  4FWL A;  1NG9 A;  5E41 A;  2A40 A;  2HOE A;  4Z4C A;  3NDK A;  3OYB A;  5HLF A;  4RW8 A;  1RGI A;  5AQP A;  4FZX C;  3UE5 A;  4BR7 A;  3I0S A;  1EQY A;  5AQW A;  3E9P A;  3BDP A;  1LAV A;  4B9U A;  3B6O A;  2YX6 A;  1OH6 A;  1RDB A;  4O8U A;  4JKD A;  4G9Z A;  4ID1 A;  2ITM A;  3DXK A;  3THW B;  3LP0 A;  1R59 O;  1L3T A;  1OVY A;  1W9H A;  1VSD A;  3O3F A;  3U3Y A;  3R1X A;  3OYE A;  1ASW A;  1ASV A;  3OS0 A;  1KD1 O;  2QW9 A;  5E84 A;  4A5A A;  4C8O A;  4ZHR A;  1KVC A;  4FLT A;  4KHN A;  3UKR A;  1NK0 A;  4BRM A;  3SMS A;  3CFR A;  4WFA L;  2QWO A;  1RTJ A;  4E7J A;  3AVJ A;  3AA2 A;  4Z4F A;  1FXX A;  3P39 A;  3MXI A;  3THV A;  2OTJ N;  3NH1 A;  4C1N I;  3ATV A;  4C8K A;  1TUY A;  2F4V K;  4BWJ A;  2VG7 A;  1Z26 A;  5AFU A;  4DQR A;  4A61 A;  1QE1 A;  2HHS A;  1S5J A;  3WXM B;  3AVI A;  1B9F A;  4BRH A;  1S6P A;  3CCE N;  4DCH A;  5FPE A;  3ID8 A;  3ULE A;  3P38 A;  5J2N A;  3NH0 A;  4ID5 A;  4NCB A;  1TAQ A;  3HYF A;  2UUB K;  3ZX3 A;  2HNZ A;  4OGE A;  2O8B B;  4OKJ A;  2PY5 A;  4EIA A;  3NGZ A;  4DV2 K;  3O80 A;  2E6M A;  3WEE B;  3TSQ A;  3D6R A;  4A62 A;  2O8F B;  2F9W A;  3FZF A;  2CGJ A;  1ATS A;  3BP8 A;  1D9F A;  3LP3 A;  5KRS A;  1WBD A;  4CEA A;  1WUA A;  3F9M A;  3NVK A;  3F73 A;  4DSK A;  3KIO A;  3M1F A;  1MWM A;  4IFE A;  4IEE A;  1U4B A;  4BE2 A;  1JCG A;  3IG1 A;  5AQU A;  3MEE A;  3NF6 A;  3NCI A;  3L2U A;  2IVO A;  3SQ2 A;  3W3D A;  4UQG A;  3HXM A;  3CC2 N;  4CHQ A;  4CD3 A;  3ITH A;  3L2V A;  1A5V A;  4I6M B;  4Q5V A;  3EL2 A;  3JSM A;  5C24 A;  4R5P A;  3K0S A;  3ZSV A;  1RT5 A;  1JLE A;  3FGU A;  4MLH A;  5M1P A;  4AQY K;  3S9H A;  3OJU A;  4M42 A;  1W0H A;  2D0B A;  2ZF5 O;  4QOZ B;  4DB3 A;  4LFA K;  3VOV A;  1VSJ A;  4GKJ K;  4CZM A;  1X3N A;  3GDQ A;  1KFD A;  2KZM A;  2IOC A;  3W0L A;  3THW A;  1NGB A;  3LM9 A;  3M8Q A;  4F4K A;  5HRO A;  4QS9 A;  4AM7 A;  2HVH A;  2KFN A;  4HUE A;  4A2B A;  1KLN A;  2QWR A;  3QO9 A;  1ZBI A;  3QFU A;  2DTU A;  1KFS A;  2KFZ A;  2YNF A;  4CJV A;  3QET A;  3QEV A;  4CES A;  3E1Y A;  1HYS A;  4EP4 A;  3WNE A;  1YVU A;  1TYQ A;  2DFE A;  3QML A;  2JWK A;  2VG6 A;  4DMN A;  5AZJ A;  4J2E A;  1N34 K;  3H1Q A;  3PSF A;  1VQ9 N;  3KKR A;  3WXI A;  4LH5 A;  5EOY A;  2E88 A;  5M1O A;  2F8S A;  1EWQ A;  3DLK A;  4B1W B;  1P90 A;  4DTU A;  5I3U A;  2GWJ A;  3DLB A;  1RBU A;  4CBW A;  4KV8 A;  1ZC6 A;  3THX B;  3KLH A;  3V81 A;  1DT9 A;  1BI4 B;  2HHU A;  1I3A A;  3MAQ A;  2KTQ A;  3P5J A;  2YJE A;  2IIR A;  4FW1 A;  3DWL A;  4HVJ A;  3AAP A;  4CK3 A;  4FJK A;  1BU6 O;  4RW4 A;  3LDL A;  4JI4 K;  4R79 A;  2HND A;  4L3Q A;  4YNQ A;  2O8C A;  3NGI A;  4E3S A;  3PX4 A;  1SKR A;  3FZK A;  2DFF A;  2Z1H A;  2NRH A;  2BH1 A;  3SAF A;  1D4X A;  3KLG A;  4M3R A;  3SNN A;  1BIU A;  3FR0 A;  1K9M O;  4W5O A;  2GWK A;  1EET A;  2VQF K;  3OW2 M;  2CGL A;  2E20 A;  2QM1 A;  2BGG A;  3J7A P;  3AVN A;  1NKC A;  1I94 K;  2HBM A;  3SQ1 A;  3VEZ A;  3VQD A;  4O0I A;  1TVR A;  2PYJ A;  1NKE A;  1VSL A;  2A5X A;  4M3W A;  1NK6 A;  5DM7 L;  3IS9 A;  4CCH A;  4JN4 A;  4DU4 A;  1BOT O;  1WAF A;  5KPT A;  3RSE B;  3VA0 A;  2PFU A;  4BE1 A;  1J5O A;  2F8T A;  1QSS A;  3QB0 A;  2XHB A;  2P9U A;  2IS3 A;  4IO9 L;  1VSE A;  4BRK A;  1NBW A;  5AQH A;  4WFN L;  2EX3 A;  3F5T A;  4XH4 A;  1BCO A;  4AH9 A;  4W5T A;  1IH7 A;  5FPN A;  4JYA K;  4H0V B;  2HHV A;  1E3M A;  3IFR A;  1C0U A;  2I5J A;  3ZSY A;  4CJT A;  1X9S A;  4FJM A;  2NRT A;  4B9N A;  1HX1 A;  1G99 A;  1HYZ A;  1UA1 A;  1KLM A;  3NE6 A;  1XWL A;  3AA3 A;  2VWJ A;  5I42 A;  1DKG D;  3O4W A;  3SI6 A;  5AZJ B;  3QEX A;  2F9T A;  2GEM A;  4NYF A;  1SS6 A;  3M6G A;  3VET A;  3D2F B;  3WNG A;  1HRH A;  3TU5 A;  4AHT A;  5BRD A;  2Y1J A;  2Q0U A;  3ZSO A;  4CD1 A;  1KAZ A;  3VQE A;  3EO3 A;  4JEP A;  1S1U A;  1VQ8 N;  1WAJ A;  4NCA A;  4EZ6 A;  3L6Q A;  5E26 A;  2J4R A;  3K5N A;  3THX A;  1Q9X A;  3AVK A;  4DU1 A;  1KVA A;  4H0X B;  5LJV A;  1SZ2 A;  4JD2 A;  4O55 A;  5AQL A;  2FBT A;  3O8M A;  4Y1D A;  2B4J A;  3CC4 N;  4JKG A;  3OHR A;  1GOB A;  4OX9 K;  4YOR A;  1ATN A;  5KTQ A;  3B6P A;  2P9K B;  3MX2 A;  3H3O B;  1LWE A;  3IRX A;  1N8R O;  4A57 A;  1N36 K;  3K9J A;  2OCE A;  1RIL A;  1ZYQ A;  3L3U A;  4O4G A;  4A59 A;  5JLF A;  3A5O C;  4BWM A;  2D0O A;  1NMD A;  4N5S A;  4KH5 A;  5AQJ A;  4DKW A;  1N32 K;  2GUI A;  2RF2 A;  3WXK A;  3K2P A;  4DFK A;  1MA9 B;  2XRI A;  1HNI A;  3M8S A;  5F0X A;  3WNH A;  4A5B A;  2QXF A;  2E2Q A;  1OKJ A;  3RR8 A;  3VQ4 A;  4FJX A;  1TV6 A;  1TKD A;  4PUO A;  4B1Y B;  3CMA N;  1NGJ A;  3V9Z A;  3SQ4 A;  3VGM A;  4I2Q A;  4ISF A;  4CJR A;  1SKS A;  2OPR A;  1W2B M;  4CHO A;  1KVB A;  3HRG A;  1SL0 A;  4DLE A;  1QSL A;  4W5R A;  4IFV A;  2HST A;  3AVG A;  3EYZ A;  4J8F A;  2UXB K;  4IEI A;  1XC3 A;  1BIS A;  3NF9 A;  3VTH A;  1NOZ A;  3CIP A;  3AA4 A;  2IC3 A;  3U8X A;  1NGF A;  5MLC Q;  5KRT A;  2XY5 A;  1GLE G;  3G25 A;  5GIN A;  2YNG A;  2RN2 A;  3C94 A;  1O13 A;  3MX5 A;  1IBK K;  2V51 B;  4IXC A;  5CY4 A;  5JVH L;  2P9N A;  4ZTF A;  4JI0 K;  3KWG A;  3HO1 A;  4GV6 A;  3ZT3 A;  2OAN A;  3BF1 A;  3CCM N;  1QHT A;  5AQM A;  5BRE A;  2AP1 A;  4ILH A;  4LC9 B;  3V1Q A;  2O4G A;  1KC8 O;  4PY5 A;  4QAG A;  3V1O A;  2W41 A;  2YNI A;  3M8R A;  4PL8 A;  2E8A A;  3JS6 A;  3TAG A;  3WNF A;  3T7Z A;  1P8Z A;  3LPU A;  4JNE A;  2GX9 A;  2O8D B;  3K59 A;  3CER A;  2P51 A;  3SQ0 A;  1FK9 A;  1U2V B;  4IG3 A;  4FSV A;  4ILG B;  2ASO A;  4DV6 K;  1IBM K;  5ADX A;  2X78 A;  4MO5 A;  3VEY A;  1D9D A;  4CK1 A;  1WLJ A;  1Q18 A;  4LF6 K;  3NMU A;  3O9U A;  1EP4 A;  4BR4 A;  3R6M A;  4JKE A;  2G8W A;  4KHS A;  1EWR A;  1FW6 A;  4DFM A;  3PO5 A;  1QS4 A;  3PO4 A;  5C2D A;  5BPL A;  1WSH A;  2P9I B;  2O8E B;  3E9L A;  3U9D A;  4NXM K;  2HHQ A;  3U4L A;  4FJJ A;  3G0Z A;  4CGH A;  1L3U A;  1A5W A;  4CI6 A;  3EE9 A;  1GLC G;  1VQK N;  3LWL A;  3CD6 N;  3C65 A;  4PWD A;  2VG5 A;  4DV3 K;  2WOM A;  3BGR A;  1I39 A;  3HPH A;  4FWP A;  3MEG A;  3DLE A;  4CGF A;  3QEI A;  1REV A;  5GIO A;  4DR1 K;  1ATR A;  5CR4 A;  1VSM A;  5B8H A;  1VQN N;  3U3G A;  5M1K A;  2G8K A;  1TGO A;  2CGK A;  4H0T B;  5EVZ A;  5GAD P;  3QEW A;  4BVO A;  1NKB A;  4AM6 A;  4Y1C A;  1XI1 A;  1ZXO A;  4CJ3 A;  4KTW A;  4JI7 K;  1RBV A;  2XY6 A;  1VHX A;  1BGX T;  3J7Y P;  3OS1 A;  3CQX A;  4E0D A;  2HHX A;  1V4T A;  4FWQ A;  1S72 N;  4BQZ A;  4CJ5 A;  3CJA A;  4BRF A;  2YHA A;  2X74 A;  2HF4 A;  3DLG A;  3QLH A;  1MDU B;  5CZ2 A;  4BC4 A;  1HJR A;  4JLH A;  3CM6 A;  3ZSX A;  4YHH K;  5HOO A;  1LOT B;  1HUX A;  2GV9 A;  3EZ5 A;  3ENH A;  3EY1 A;  3G4S N;  3C95 A;  4YDU C;  5AZI A;  3TAE A;  2DY4 A;  4N76 A;  2E2N A;  5BN9 A;  3THY B;  4B9S A;  4FWS A;  3L3V A;  3UB5 A;  4B3M K;  3EEQ A;  3O3G A;  3KJV A;  1RTI A;  3ZT0 A;  2O4I A;  2UXC K;  2P9L B;  3J81 O;  3V9X A;  3WUH A;  1LCU A;  2VWB A;  4JRP A;  4DV0 K;  5EU7 A;  2P9S A;  5BRH A;  3CHW A;  3VQ8 A;  1T3V A;  4OKE A;  2B5J A;  4DR6 K;  5HP1 A;  2OZS A;  3O9R A;  3CCS N;  3A5L C;  3QEP A;  1IJJ A;  3AAR A;  3D2E B;  2P1J A;  1CLQ A;  4J2A A;  2A3Z A;  1NM1 A;  4YOY A;  3VEN A;  5AQO A;  3J7Z O;  5LL6 Z;  4OGC A;  4CIG A;  3MCA B;  3OYK A;  1HNX K;  3PUF A;  1EXQ A;  5C42 A;  1Q9Y A;  3NGY A;  3AGR A;  4B9L A;  4O0J A;  2ZD1 A;  1BUP A;  4BE0 A;  4FOE A;  1NGC A;  2QWN A;  1DEJ A;  5HRP A;  4DR3 K;  1ESV A;  3SZ2 A;  4DTM A;  4CJS A;  5HRR A;  1R0A A;  5BR9 A;  1VQ7 N;  2E2O A;  3HPG A;  5CZ1 A;  4F8R A;  3M3Z A;  4RW7 A;  1UAX A;  3BUZ B;  4OKK A;  3TTD A;  4FW2 A;  4KTQ A;  5T7B A;  4BAC A;  1K6Y A;  2FSJ A;  4LF5 K;  4RG8 A;  1C0F A;  5K14 A;  3PIP L;  4C1N K;  2UYT A;  4BDP A;  4DV1 K;  3HPO A;  2XY8 A;  2UUA K;  2RHK A;  3HP6 A;  3DOL A;  4IZ9 A;  3RMD A;  4FJH A;  1XUP O;  1XHZ A;  4WQ4 C;  1C0G A;  1CZB A;  1XNQ K;  3OYI A;  4CGJ A;  3H3N O;  3ZEU A;  5ADX H;  3E01 A;  1VSH A;  5F1X A;  1QQM A;  2W42 A;  1SV5 A;  1GLL O;  3SAG A;  2EWS A;  5ELZ A;  5M1Q A;  1QQC A;  3I8D A;  4FM2 A;  5GAG P;  3LP2 A;  4NXN K;  1SAZ A;  4NLB A;  4BRN A;  3NHG A;  3E9O A;  4BR2 A;  4CZL A;  1NWK A;  4BQL A;  4U67 L;  3SYZ A;  2G8F A;  4BY9 C;  1YJN N;  4B1X B;  4AHC A;  3S3M A;  3H45 C;  3KK7 A;  4M3Y A;  1YTU A;  3DRS A;  4FZY A;  4CGI A;  2BE2 A;  4JHD A;  3D2F A;  4H0O A;  4DS4 A;  3R3L A;  1YT3 A;  1Z05 A;  2P5O A;  5TKW A;  1WOQ A;  1J9A A;  5AQZ A;  1FKO A;  2VQE K;  3P1G A;  3SV4 A;  4B3R K;  1RT2 A;  3NVM A;  4E7H A;  2Z1G A;  4CZH A;  3ZT1 A;  5AQX A;  2ZQB A;  1YTA A;  1TK0 A;  4ELV A;  2X6N A;  2FF3 B;  3CQY A;  4H5W A;  4E1J A;  4CZK A;  4F2R A;  3RRG A;  3CCR N;  1C1A A;  2PZS A;  4NCG A;  3QIO A;  1NOY A;  2F7T A;  2A41 A;  4CEF A;  4J2B A;  5FLX O;  2FBV A;  2ZE2 A;  4HTU A;  4H0Y B;  5DMR A;  2QKK A;  1Q86 O;  4M7X A;  3QIC A;  1RT6 A;  4DQP A;  4B1Z A;  4KB0 A;  2O8E A;  1GLJ O;  4KHQ A;  1LW2 A;  5C12 A;  4BRA A;  3C6T A;  3CCL N;  4MQ3 A;  4FVM A;  3CJB A;  4DFJ A;  3KTQ A;  5KGW A;  4GY2 B;  1JXB A;  2D4W A;  4B9V A;  4LF7 K;  4PL7 A;  1EKE A;  3J80 O;  4KB1 A;  1RCH A;  3KHY A;  4CF8 A;  4LSL A;  3L2W A;  4YY3 K;  4BGB A;  4MDB A;  4E19 A;  1D8Y A;  1RNH A;  4BRG A;  2HBL A;  3UIQ A;  4J2D A;  1DTT A;  3LDQ A;  5BRF A;  4DG1 A;  3ENB A;  3KLE A;  3O9S A;  4Y0W A;  3D45 A;  3MK6 A;  3O9Q A;  4H5N A;  2D0P A;  4CGD A;  2P9K A;  5AQN A;  2ZWH A;  3OY9 A;  2BAN A;  2A1R A;  2YKN A;  3RVC A;  1S1T A;  4PKG A;  2FXU A;  1VQM N;  4B3O A;  2QWP A;  3LAL A;  3O1B A;  2BUP A;  3LDN A;  5JLH A;  5C10 A;  4PKI A;  4YOW A;  4FCY A;  1XMQ K;  1DGK N;  4GNI A;  3P4I A;  3NF8 A;  1IBL K;  4DR2 K;  3T1A A;  3N4P A;  3ASM A;  1HQE A;  2CH6 A;  2IVN A;  3VPZ A;  5AQG A;  1X1P A;  4CK2 A;  1NNE A;  4FJL A;  4O5F A;  3O6W A;  5JMV A;  3CJC A;  3T19 A;  3IKM A;  3SBG A;  5C15 A;  3L0Q A;  4GW6 A;  4E1M A;  5IT9 O;  2E1Z A;  1BA0 A;  5J2M A;  4LFB K;  4B8A B;  4OJR A;  1WSF A;  4CZI A;  1BG3 A;  4FWR A;  2P5G A;  4DF4 A;  1NGG A;  1YUW A;  4B8C A;  4FLY A;  3AA5 X;  1BO5 O;  2RPI A;  2Q1N A;  3LAN A;  3H46 O;  3CFP A;  4JAX A;  1VSI A;  5LJW A;  4DV7 K;  4RWT A;  3JAM O;  3FLC O;  4K41 A;  4CBX A;  4HCB A;  1ILY A;  4JKC A;  1NK7 A;  1T6C A;  5KPZ A;  3AVC A;  3D7E O;  4FWM A;  4K8Z A;  3HL8 A;  4WQ5 C;  4C8L A;  4CFB A;  4QS7 A;  4CJE A;  2KQ2 A;  4DFP A;  1L3V A;  2A1S A;  3CPW M;  1DLO A;  2VCP A;  3UKR B;  3TAM A;  4FM1 A;  5AQK A;  3AVA A;  4BR0 A;  4H4O A;  2F96 A;  3EN9 A;  2Q31 A;  3CFO A;  4JI3 K;  4JKH A;  2HBK A;  3H1V X;  1HKC A;  2JWL A;  2PAV A;  1S22 A;  4BRL A;  4IOC L;  5KPR A;  2Z1I A;  3OYL A;  1EO1 A;  2FC0 A;  3FFK B;  2HNY A;  4B1U B;  3KK1 A;  4LD0 A;  1OH7 A;  4B9T A;  4IO8 A;  1J6Z A;  4CJU A;  1JLB A;  4WQ4 A;  3N4Q A;  2O8D A;  1VSF A;  4BDY A;  4PHT X;  4C8N A;  3OBW A;  2HVI A;  4DTP A;  1QTM A;  2KZZ A;  1JCE A;  1J54 A;  4IWV A;  4CJW A;  4Z4I A;  4ZTJ A;  1U04 A;  4FOI A;  2D5R A;  3OYN A;  4FJG A;  1NK9 A;  3QIN A;  4CER A;  3RMA A;  3Q7B A;  1NJW A;  4W5N A;  1RT3 A;  1KRP A;  1KTQ A;  4DTN A;  3HT3 A;  3SCX A;  3MWP A;  4XH1 A;  2WUS A;  2KLA A;  1YIT N;  3A2F A;  3SAH A;  4DV5 K;  1GOA A;  4LF4 K;  5JIC A;  4DSJ A;  3KKS A;  1T44 A;  3OS2 A;  2FLO A;  4YOU A;  3V9S A;  5KI6 A;  4JI5 K;  5JS1 A;  4CIF A;  5J2P A;  3C6A A;  1BHL A;  5SZT A;  4OVL A;  1BCM A;  3DMJ A;  1LWF A;  3QER A;  2ITG A;  3VTI A;  3HVR A;  5AQT A;  3PV8 A;  4FK4 A;  4YOX A;  3ZEU B;  5H1S Q;  1M1K O;  4GV9 A;  4E7I A;  1QQO A;  1VQL N;  3AVH A;  3VES A;  3SK3 A;  3DRR A;  4HHT A;  2DFH A;  3ENO A;  4H4M A;  1HYV A;  1VRU A;  1JKH A;  3MWT A;  1HLU A;  3VA3 A;  4CZE A;  1BL3 A;  3NH2 A;  3IMX A;  4IDK A;  3ZSQ A;  2NZT A;  3DXM B;  4C23 A;  4EAH D;  4PA1 A;  4Z4H A;  1MU2 A;  4KRF A;  1TYQ B;  3DLR A;  3ZT2 A;  1JL2 A;  2G8U A;  1IG8 A;  3RRH A;  1JL1 A;  1S1V A;  1HJO A;  5AQR A;  4F2S A;  2YNH A;  4FJ5 A;  3L8B A;  3SPY A;  4GVE A;  1LW0 A;  4FM0 A;  4KH4 A;  1VQ5 N;  3CME N;  2W6K A;  4XEI A;  1NJI O;  3EE8 A;  2OTL N;  3FZH A;  4B9Q A;  3CXC M;  2HHH K;  4I9Q A;  4F9O A;  3AV9 A;  2O8F A;  2E4L A;  3Q7C A;  4FZZ A;  1N33 K;  3AVM A;  3K58 A;  2OPQ A;  3FFI A;  3SUN A;  3CF5 L;  4BRC A;  3JYT A;  1X3M A;  5AFU H;  4AIL C;  4CJL A;  4DWI A;  1IO2 A;  4EFH A;  3MN5 A;  1N6Q A;  5C25 A;  4CF1 A;  5CE3 A;  3UKU A;  4XH5 A;  1SUQ A;  5JVG L;  1ZBU A;  4CF9 A;  1U49 A;  1NGH A;  1QZ5 A;  4OPH A;  4LF9 K;  1VK0 A;  4CZG A;  4BDZ A;  3S3O A;  4DR4 K;  3MN7 A;  2O8B A;  3DM2 A;  1L5U A;  1VSK A;  3OJS A;  3MN6 A;  4YFU A;  3CYM A;  3L4Q A;  2GUP A;  3LDP A;  1C0M A;  4HUF A;  3T1Y K;  1RDC A;  5AQV A;  3ALY A;  3TTF A;  1RT4 A;  3GBT A;  2A42 A;  4DTS A;  1C0T A;  1IKW A;  2E1Y A;  4LY7 A;  3RMB A;  3HK2 A;  4CBU A;  1J53 A;  3K57 A;  4L8R B;  3RSE A;  3OYM A;  3F2K A;  3I0R A;  4AHS A;  4FK2 A;  1TAU A;  3U6F A;  4DHY A;  3QNN A;  2FF6 A;  3CJ1 A;  4JKA A;  4B1V A;  3QBW A;  4IOX A;  1RDU A;  3HST B;  2QXL A;  3K9K A;  1K73 O;  3NAE A;  4HCC A;  4ELT A;  4YOV A;  4FLX A;  4H8K A;  4E7L A;  4OPA A;  2NRX A;  5AQQ A;  3T69 A;  2O8C B;  3NBP A;  1T6D A;  1YVN A;  3VF2 A;  4LF8 K;  5BPN A;  4X66 K;  3KZB A;  4Z4E A;  4DTX A;  5BPM A;  4CF2 A;  4FK0 A;  4W5Q A;  3QIP A;  4FLW A;  2HW3 A;  5JS2 A;  1RBR A;  4CJ7 A;  5EXW A;  4DR7 K;  3VGL A;  4A2A A;  3LWM A;  1Y97 A;  3O4N A;  4JRQ A;  1KXP A;  3VEX A;  3M5R A;  4LFC K;  4EP5 A;  5HL7 L;  2NRR A;  4OLB A;  3DRP A;  4DSF A;  4CHZ A;  5M1N A;  3BZK A;  4FXD A;  3DJC A;  1TL1 A;  4Z0U A;  5TKY A;  4ILJ A;  4CEO A;  3LAK A;  3A0I X;  3O4Q A;  3ZET B;  4BG9 A;  3AO2 A;  3ZSR A;  4M3U A;  1YHQ N;  3HVT A;  2HF3 A;  5DK5 A;  2X6S A;  3D0P A;  1X9J A;  3THY A;  3A8Y A;  4M7Y A;  4MDA A;  4KHP K;  4CJF A;  3DLH A;  1GLA G;  4WFB L;  1HNV A;  3P83 D;  4ELU A;  2QTD A;  4M63 C;  4FLV A;  2YHB A;  4BC3 A;  4FJ7 A;  1BDG A;  3GG4 A;  3QBX A;  4FLU A;  2OPS A;  4RW9 A;  1NJX A;  3SPZ A;  5M1F A;  3OYA A;  3RTV A;  2YKM A;  4JI1 K;  4CHP A;  4YDU A;  3VQ9 A;  1RBT A;  5LY3 A;  4BGA A;  4DQ8 A;  1X9M A;  1LAW A;  1T03 A;  3VQP A;  4I2P A;  3WEE A;  2RE2 A;  4QCL A;  4CFD A;  3K5M A;  2KKZ A;  1GOC A;  2QA4 N;  4CEZ A;  4WE1 A;  3QFP A;  3TR8 A;  2H3G X;  3VMF B;  5F2R A;  2P9L A;  5AQS A;  4BRP A;  1CXU A;  2NRW A;  3WQU A;  4AHV A;  3C0B A;  1A5X A;  3KLI A;  3ULD A;  4BRI A;  1VQP N;  3ZYY X;  1WNS A;  3NFA A;  2QKB A;  2P9S B;  1S9G A;  1U6Z A;  1S6Q A;  4NLC A;  2GTD A;  2FSK A;  4CE9 A;  4I6M A;  1NJZ A;  3OYJ A;  2JLE A;  2HB5 A;  4H0P A;  3MED A;  3VQA A;  2ETJ A;  4U7B A;  2WFB A;  1ZBS A;  4YOT A;  4FO0 A;  3TSP A;  3S3N A;  2XO7 A;  3DXM A;  4DSI A;  1NMN A;  3VEW A;  3O08 A;  4DUZ K;  4BRD A;  3WQT A;  2QK9 A;  3OA9 A;  1XQS C;  2YHX A;  3MCP A;  3EKS A;  4XIU A;  2FBY A;  1JLF A;  3AVL A;  1QHA A;  3B8A X;  3P31 A;  3SBT A;  1RT7 A;  3CCU N;  4F3O A;  5C2F A;  3LPT A;  3H08 A;  4RTF D;  2NRV A;  2ZGY A;  2NNW A;  2YV0 X;  4CIE A;  3VN5 A;  4DTO A;  3AGK A;  3BF3 A;  3AO3 A;  3SLC A;  4JI2 K;  1WSE A;  4JV5 K;  1HKB A;  4KHY A;  3AVB A;  3OVN A;  1ZBF A;  1IKY A;  4WQ5 A;  1H1V A;  5GAE P;  2XY7 A;  4WCE L;  1O1W A;  3TAP A;  3HOT A;  2ASM A;  3SV3 A;  1IKV A;  4KI6 A;  5FPM A;  3TWH A;  2HHW A;  3GE1 A;  4EHT A;  4CZF A;  1Y64 A;  3TPQ A;  1UA0 A;  2G8I A;  3CJ7 A;  2ATQ A;  2Z1J A;  3MMV A;  5C0Y A;  1Q82 O;  4GKK K;  2Q0R A;  5CYQ A;  4CW7 B;  3IUC A;  1LV5 A;  3ZLJ A;  4DR5 K;  4V19 S;  3EZW A;  4AF1 A;  3VEO A;  5FRN A;  3I33 A;  3VF4 A;  5LMU K;  3CCQ N;  4JD2 B;  3SUP A;  3WXL A;  4FJI A;  1E4G T;  4CED A;  5FPD A;  3LP1 A;  2NUB A;  4BRE A;  1F21 A;  2IDO A;  3HM8 A;  4MO4 A;  3TAB A;  5AR0 A;  1WN7 A;  3CPE A;  3CI5 A;  3BEX A;  1U45 A;  1S3X A;  1OH8 A;  4DV4 K;  1YI2 N;  1TL3 A;  4CGG A;  2ZGZ A;  1ITG A;  4BG8 A;  2AA4 A;  1IKX A;  3ZCM A;  1HKG A;  3ID6 A;  3VQ6 A;  1HQU A;  4OPK A;  3E66 A;  4IG0 A;  4CJK A;  1K8K B;  4WYB A;  3OYG A;  1BI4 A;  4IKF A;  1YXQ A;  3G6E N;  3PY8 A;  3I55 N;  4KHW A;  2OZM A;  4BC5 A;  2JGU A;  1VQ6 N;  4MFB A;  5KQD A;  3J8A A;  4IJA A;  5GIP A;  3LZI A;  1BIZ A;  5IWA K;  4WF9 L;  4RW6 A;  4FVU A;  4FLZ A;  1TKX A;  2WC9 A;  1SL1 A;  5SWM A;  1QVG M;  4FJN A;  5BN8 A;  1VQO N;  5AZI B;  4CEC A;  1OVQ A;  3CG7 A;  1J5E K;  5EY4 A;  4JKB A;  5D3G A;  4NB4 A;  1WBB A;  1C1C A;  4UY8 O;  1HMV A;  1YIJ N;  2WBN A;  2ASP A;  4BR5 A;  3ZSZ A;  3GL1 A;  4KPY A;  4FJ8 A;  3VQB A;  3CCV N;  2PBD A;  4I7F A;  4NO7 A;  3TAN A;  4CEB A;  4FWO A;  3PIO L;  4F3T A;  4E89 A;  2P9P A;  4JI6 K;  3F9K A;  1B92 A;  1C1B A;  3CM5 A;  2YCH A;  2UXD K;  1JCF A;  4BVP A;  3O1W A;  4OLA A;  4PQU A;  3L2R A;  3D2E A;  4KO0 A;  1WB9 A;  3V9U A;  2YHW A;  1NU0 A;  3L4I A;  3PX6 A;  4H03 B;  3A5M C;  2P9N B;  1KCF A;  2ZJP L;  4ICL A;  3V9W A;  3RWU A;  3L2Q A;  1TKT A;  3DAW A;  1HNW K;  1Z6R A;  3V4I A;  1RDA A;  5CHI A;  3ISN C;  5GAH P;  1JLG A;  1IV0 A;  2I7N A;  4ISG A;  4DTR A;  3AY9 A;  4JK7 A;  1Q7Y O;  5HBM A;  1ZBL A;  3OYF A;  4M45 A;  2YI1 A;  4Q0B A;  4GMJ B;  5J1E A;  3AO1 A;  4RCH A;  3S41 A;  4I9L A;  1RT1 A;  2QEX N;  4FJ9 A;  1KSP A;  2IVP A;  4HWI A;  4JI8 K;  3AO5 A;  2ZJQ L;  1NLV A;  2G8H A;  2FBX A;  2V52 B;  4X62 K;  1JJ2 M;  1SQK A;  4JKG B;  2LSN A;  5A2Q O;  4X64 K;  2V7Z A;  4FWK A;  3A5N C;  1NGA A;  1KQS M;  4LSN A;  3GOI A;  3HOS A;  2BDP A;  4N41 A;  1RDW X;  3R9P A;  1M90 O;  4KTZ A;  2E5L K;  1QZ6 A;  1K8A O;  3ZX2 A;  1CXQ A;  2KHO A;  5BR8 K;  3AO4 A;  1OH5 A;  3K5O A;  4E7K A;  5FRM A;  3BY5 A;  1XC9 A;  3KWI A;  4CJQ A;  3MDQ A;  3VER A;  4DU3 A;  3TAQ A;  3HI0 A;  1GLF O;  3FZL A;  4EHU A;  4H5V A;  4EZ9 A;  3G71 N;  5AQY A;  3WT0 A;  4KAZ A;  2P9P B;  1NK4 A;  1HPZ A;  2Q3S A;  3HJF A;  4AHR A;  2FSN A;  2NLX A;  1GLD G;  1IG9 A;  3IDH A;  1U48 A;  4CFA A;  3R8E A;  3DXK B;  1N5Y A;  1VRT A;  3KVG A;  2DPN A;  3LDS A;  1WSJ A;  3KLF A;  2IGI A;  4CHN A;  2E6L A;  1YJW N;  5FRO A;  4O5B A;  3MEC A;  3UKU B; 
#chains in the Genus database with same CATH homology
 4DV7 K;  3JAM O;  3J7Y P;  4DR4 K;  1HNZ K;  4JI1 K;  1IBK K;  4GKK K;  4B3T K;  1HNW K;  4CW7 B;  4LF5 K;  4JI4 K;  4JI0 K;  4DR5 K;  4V19 S;  4LF7 K;  3T1Y K;  3J80 O;  5LMU K;  5LMN K;  3T1H K;  4DV1 K;  4YY3 K;  2UUA K;  4YHH K;  4OX9 K;  4JI3 K;  5AJ3 K;  4DV4 K;  4AQY K;  1N36 K;  4X65 K;  1XNQ K;  1FJG K;  2VQF K;  4B3M K;  4JI8 K;  4K0K K;  2UU9 K;  3J7A P;  4X62 K;  2UXC K;  1I94 K;  1HR0 K;  4LFA K;  3J81 O;  4GKJ K;  5A2Q O;  4X64 K;  4DV6 K;  4NXN K;  1IBM K;  4DV0 K;  1N32 K;  1XMQ K;  4LF8 K;  5IWA K;  1XMO K;  4X66 K;  2E5L K;  4LF6 K;  1IBL K;  4DR2 K;  4B3S K;  3OTO K;  5BR8 K;  2HHH K;  4DR6 K;  4DUZ K;  1J5E K;  4DR7 K;  2F4V K;  4NXM K;  4CVN E;  2UUC K;  4LFC K;  2ZM6 K;  1N33 K;  4DUY K;  5IT9 O;  1N34 K;  4DV3 K;  4JYA K;  2VQE K;  4B3R K;  5LL6 Z;  4LFB K;  1HNX K;  4JI2 K;  4JV5 K;  4DV5 K;  4DR1 K;  4LF4 K;  2UUB K;  4JI6 K;  2UXB K;  4DR3 K;  2UXD K;  4KHP K;  4DV2 K;  5FLX O;  4JI5 K;  4JI7 K;  1XNR K;  4LF9 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...