4DUYK

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 27
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4duyK00
4NXNK 4JI1K 2ZM6K 1I94K 4JI7K 5BR8K 1HNXK 4B3TK 4K0KK 4JI4K 2UUCK 4DV0K 3J81O 4LF5K 4LFAK 1HR0K 4X65K 4DR4K 1FJGK 5AJ3K 1XMOK 4LF4K 2UXCK 4LF8K 1IBKK 3T1YK 3J7AP 5LMNK 1IBMK 1N33K 1HNWK 5FLXO 4OX9K 4DV3K 1HNZK 4JI3K 2UUBK 4LFBK 4LFCK 4DV2K 4DV5K 1N36K 4DV6K 2UXBK 4X64K 5LMUK 4LF7K 4JI5K 3J7YP 2VQFK 3OTOK 4DUZK 4B3RK 4DV4K 4DV1K 4NXMK 1XNRK 5A2QO 5IT9O 4X66K 3T1HK 5IWAK 4KHPK 4LF6K 4YHHK 2E5LK 4CW7B 1XNQK 4DR1K 4DR3K 4GKKK 4GKJK 4DV7K 4DR6K 2UXDK 4JI6K 3J80O 4JI2K 4JYAK 4DR2K 4JV5K 4AQYK 5LL6Z 4DR7K 1N32K 2UUAK 4DUYK 1N34K 4YY3K 3JAMO 4X62K 1IBLK 4JI0K 4CVNE 4V19S 4B3MK 2HHHK 4JI8K 2F4VK 4B3SK 1XMQK 2VQEK 1J5EK 4DR5K 4LF9K 2UU9K
chains in the Genus database with same CATH superfamily
4JI1K 2ZM6K 1HQEA 1W97L 2Q2RA 3EE9A 5ELZA 2FC0A 2BGGA 4JI4K 4AF1A 1Q86O 3CPWM 4B9UA 2O8CB 1NM1A 2Q0RA 4X65K 4M3WA 5AQUA 1Q9XA 3V9SA 1FJGK 1VQKN 4PUOA 3GL1A 4CEQA 4FJMA 2P9NB 4J8FA 4BWJA 4OKEA 4DQIA 2Q3SA 4CK3A 1LAWA 4FWQA 4IJAA 3ZSOA 4U7BA 4B8AB 1NKCA 2F96A 4JEPA 3OVNA 1UOCA 4KREA 3FFIA 4BVOA 2QWOA 3CCQN 1VSIA 4ISEA 5JS2A 4IDKA 4GV9A 5AZIA 2HBLA 4M3TA 2UUBK 1L5UA 4CHOA 1X9MA 3THWB 1IKWA 2XY6A 4IXCA 1S22A 1S6PA 2WFBA 4RCHA 3SMSA 4IG0A 1N36K 4CJUA 3OYAA 4JKFA 2Q31A 4QAGA 3DLBA 1QTMA 3SUNA 3VERA 4FJ7A 3D2FB 3QNOA 4AHVA 1RT1A 4CZIA 1VQ6N 1W0HA 4CZHA 2VG5A 3VA0A 3ZEUB 4WQ4A 3N4QA 4JKBA 4KHPK 3Q7CA 5GADP 2NLXA 1QHAA 3O80A 3OYLA 5EOYA 4CW7B 4Z4IA 3ITHA 2Z1GA 4F2SA 3FGUA 2LSNA 1Z6RA 4CECA 3L2VA 3U6FA 1DKGD 2YNFA 3LPTA 1BHLA 4DTRA 1X3NA 1WNSA 5JICA 1NJXA 2OPRA 3VF6A 3DWLA 3OY9A 3HO1A 3CM5A 4OPAA 1ATRA 3E01A 1L3TA 3HK2A 5AZJB 2E1ZA 1NMDA 1NGDA 2HW3A 1JLQA 4YOUA 3JSMA 4QS8A 1VQLN 2QA4N 1C0MA 1TKXA 3M6GA 3HXMA 1OKJA 4IBNA 3UKUA 2WONA 2ZGZA 1GOCA 3RRHA 1C0FA 4JK8A 4O0JA 1L3VA 2V7ZA 3CJ1A 4G9ZA 3OW2M 5HRPA 3L3VA 4CJEA 3CG7A 2W42A 3VEVA 4K0KK 3V1QA 3CJBA 4KHQA 4FJHA 3TTDA 3J81O 3VEWA 2QM1A 4BC5A 3KD1E 3NHGA 3ALYA 1HR0K 5AQNA 1RTDA 4WQ5C 3OYDA 3O8MA 1MDUB 3F9KA 4E7JA 2UXCK 2IOCA 1NK7A 4CI6A 3SI6A 1N33K 4O8KA 2V52B 4AHTA 1JJ2M 3C7NA 3OBYA 4FM2A 1X9WA 1KAYA 3QICA 3V9UA 4ZTJA 2F8TA 1C1CA 1JLGA 3TAFA 4ELTA 3RR7A 1X1PA 4CJLA 3HP9A 1T44A 4DS5A 4BRMA 3JS6A 3KWIA 3ZSQA 3ZT1A 3VEOA 4N76A 3AA4A 1VQ4N 1D8YA 1IH7A 3LAKA 4FK0A 1NGHA 3AVHA 3U3GA 5FPNA 3LDPA 5AQRA 4KH6A 3AVLA 2FSJA 3VF4A 2VQFK 2G8IA 1QE1A 4NXMK 3NF8A 3ZETB 5IT9O 4DLGA 3EN9A 4KO0A 5FPEA 2HF4A 2D0PA 4CHNA 2O4IA 3GG4A 4HHTA 3LANA 4YOVA 3TPQA 2VGMA 2PZSA 2KFNA 3WEEA 3THVA 5I42A 3CXCM 1M1KO 1NK8A 3MEGA 3ASMA 3DAWA 4NB4A 3T19A 2NRTA 4PKHA 5AQFA 5GAEP 3L2UA 4DTPA 4NYNA 3RMBA 3T3FA 1S1VA 3BZKA 3PV8A 4YDUA 2YNIA 2HNDA 3U4LA 3JXUA 4BG9A 3CMEN 3THXA 3L6QA 5JMVA 4BRFA 2WUSA 1BO5O 2F9TA 5KGXA 5AQKA 1BGXT 5E41A 3CMAN 4BRAA 5C12A 1U45A 1BISA 3NF9A 3VTHA 4XH5A 4RW7A 4W5OA 2QWPA 2O8FB 4KV8A 4H4OA 1U6ZA 3NF6A 1U4BA 4FWKA 1QVGM 3K59A 1KXPA 4C23A 4B9SA 4NCGA 3M5RA 5KI6A 4Q0BA 2FLOA 1WSHA 5BRDA 5MLCQ 4JKGB 3V1OA 4WF9L 2VCPA 2V51B 3VEYA 4DU3A 1JLAA 1BL3A 4CJWA 1HNWK 1Y97A 1TGOA 2Q36A 1TK5A 1B92A 4E7LA 3HJFA 3UKRA 4YNQA 1GLDG 4DQRA 2HVHA 4CGHA 4BRNA 2OPSA 1S5JA 1RTJA 1HNIA 2P9SA 4EAHD 2E88A 2IAJA 2UXBK 3K5MA 5HROA 4M63C 4K8ZA 1BCOA 2FXUA 4DUZK 4H5NA 5KGWA 3H46O 2FSKA 4DV1K 2E6MA 3DLLL 4H5RA 4X66K 3DXKA 4YHHK 3VMFB 1GLCG 2OA8A 4CK2A 2E2QA 4JN4A 3VQAA 4YOTA 3M8SA 3P5JA 3DOLA 1EKEA 4Y1DA 4JI2K 3J8AA 3Q7BA 3E66A 2YHXA 1W7AA 3RSEB 3AY9A 4A2AA 3V9WA 4BY9C 2P5GA 3VQCA 4HUFA 2O8BB 4JS4A 1NKBA 3CD6N 4GV6A 1RGIA 1QHTA 4CGJA 3OYBA 4FO0A 3NVKA 5HLFA 1YVUA 4Z4GA 4CJVA 3HT3A 4MLHA 1RT7A 2O4GA 1XMQK 3PX6A 4R5PA 5TKWA 2HNZA 4C8MA 3AA5X 2ATQA 4KI6A 3H3OB 2P9PA 4E1MA 4H0XB 4JAXA 3LL3A 4CBXA 3AVNA 1NMNA 4DTXA 1LWFA 1SKSA 3MMVA 2QWLA 4CJ5A 4BRHA 4C8OA 4N47A 4LC9B 2P9IB 1TKZA 5F2RA 2IGIA 4GVMA 4IOXA 5BPLA 2RE2A 1QVFM 2I5JA 3QBWA 1IBKK 1OH6A 5LMNK 4BC2A 3HYFA 5AQTA 3VQ8A 3EZWA 4Z4CA 4BRCA 4BG8A 1X9JA 2XRIA 3NF7A 4XEIA 4Z0UA 3TAMA 2G8UA 4G1QA 1N6QA 4YOXA 2QWNA 4B9TA 3TWHA 3TANA 4ZHRA 4ID1A 2G8VA 2UYTA 2VWBA 3IFRA 4O5FA 4B9QA 3E9PA 1ZBIA 1S1XA 2OANA 1YITN 3O4QA 4CJRA 3CJAA 4DKWA 1S1UA 1VSLA 2OTLN 2X6SA 4ISFA 3MWPA 3ID8A 3V1RA 1QS4A 3FZKA 2GBZA 2KQ2A 4JI6K 3J80O 4FJJA 4FVMA 4DFMA 1CZ9A 4WFNL 2RN2A 3ENHA 2Y1IA 4YY3K 3U8XA 3PIOL 1RBVA 3L3UA 4QS9A 3SAFA 1HJOA 4FLZA 3MN6A 1SV5A 3AA3A 4AH9A 4BQLA 1NJWA 4OJRA 4HWIA 4E1JA 1TK8A 3ULEA 3WNGA 2NRWA 5GAHP 4Y1CA 3S3MA 4OGEA 4BR7A 4BRLA 1IJJA 2BUPA 4K25A 4B1UB 3BY5A 5KQDA 4B3TK 4B1VA 3AAQA 1F21A 2AJQA 3D2EB 4DV0K 1KFSA 2YJEA 1RTIA 2Q1NA 2ASOA 3QIPA 5C10A 1B9FA 1XC3A 2XO7A 2D0OA 3KLFA 4DFPA 4M3YA 3S3NA 5AZIB 4AILC 2HHUA 1S72N 1SAZA 4CBUA 3KIOA 4BR0A 2O8EA 1GLAG 1KVAA 3S9HA 4WE1A 4NLBA 1TKDA 1QQMA 5JLFA 1GLJO 4M7YA 3CCJN 2FBTA 4LH4A 4FJKA 1S1WA 2PYJA 4JRQA 1MWKA 3ZX3A 3A5OC 1GOBA 1JCEA 4CJSA 3WQTA 4LSLA 5FROA 3OYJA 3FZHA 4CZFA 4PA1A 4FWLA 3I56N 4W5RA 3QEPA 1XUPO 4DSKA 1SL1A 4BROA 4XIUA 1VQ5N 3BZCA 3CF5L 1Q7YO 4E1NA 4O4GA 5LL6Z 3PO4A 4JKEA 3AVKA 4OKJA 1V4TA 3TI0A 3P38A 1QZ5A 3QB0A 4WYBA 3BF3A 4FZYA 5BRHA 3FZFA 3DLKA 3SPYA 3UKUB 3WNHA 3WT0A 4BREA 1IO2A 3D6RA 3CCUN 1J6ZA 4Z94A 1MWMA 1WBBA 2WC9A 2G8FA 5BPNA 2DFHA 5GINA 2A5XA 4IOAL 5AQSA 4O5BA 4DTMA 4M3ZA 3VQDA 4IEEA 4N56A 5AQYA 3WUHA 1YHQN 2WOMA 3PLAA 3D0PA 4LF5K 4C1NK 4BGBA 4LFAK 4LSNA 1CZAN 4HCCA 4RG8A 5FRNA 2HF3A 3PX0A 5HBMA 4I2QA 1HKBA 3LALA 5F1XA 3C7NB 5AQHA 4OPKA 3J7AP 2FBVA 1EXQA 1SUQA 4JKHA 4FWRA 4Z4FA 2GUPA 3HVTA 4FYDA 4DLEA 3G6EN 4BE0A 2YV0X 3CCRN 2YHYA 3L0QA 4BACA 2FF3B 1V4SA 1BA0A 4MO5A 4JHDB 5JS1A 2VYPA 3H08A 2HBJA 4IEIA 2CGJA 3LAMA 4IFYA 3NGZA 2HMPA 3QFUA 3QETA 3TSPA 5BN9A 1HKGA 1FKOA 3OTOK 1HX1A 3W3DA 4DFJA 5AQXA 3H3NO 3ENOA 2YNHA 1Y64A 2A40A 1NBWA 1EETA 1Q8IA 4F3OA 2E5LK 1X9SA 3DLGA 3QFPA 3AA2A 1OH7A 3QEVA 3VQ5A 3HOSA 3EL2A 3RMDA 1KTQA 4A5BA 5C25A 1JKHA 1S9EA 3H1VX 4DF8A 2DPNA 1IKVA 3LDNA 2ZE2A 5DM7L 4JS5A 1L3UA 3VEZA 5JVHL 1C0TA 1RDDA 2DFEA 2BTFA 4FOEA 4A61A 4KHWA 3AARA 5FRMA 1WUAA 2HSTA 4IJNA 3HVRA 1I39A 2A3ZA 3OYCA 3D45A 3P31A 4DTSA 4CEAA 3GDQA 2YCHA 2NRZA 1RBTA 3FLCO 3QO9A 1W2BM 2PBDA 4FJ9A 3CQXA 3DLHA 1U2VB 1GLEG 1EP4A 3THYA 1CXQA 4H8KA 1RT2A 5K14A 4QOZB 2GEMA 1DGKN 5AQVA 4IWVA 5EXWA 2P9UA 4N41A 3CQYA 3P4IA 3GOIA 3UKRB 4DSFA 4W5NA 1RT4A 4A2BA 2CH6A 4B1YB 4JK9A 3VF2A 5KPRA 4YDUC 4M3RA 2E2PA 1VSJA 3OS1A 2J4RA 1NNEA 3MDQA 4I6MA 5M1PA 3GE1A 2ZD1A 3CHWA 1HNVA 1L3SA 4XH4A 4E89A 4CEOA 4BGAA 3K5LA 3AO2A 3K58A 2GUIA 3L2QA 5LMUK 1DT9A 1FKPA 2GV9A 4CHQA 1K8KB 4DV4K 2KHOA 2B6AA 2W40A 1BQNA 2B5JA 1HKCA 3U9DA 1K73O 4KKOA 3EY1A 4BR5A 5EY4A 3VA3A 2HOEA 4NLCA 4OO1J 4N5SA 1BQMA 1ATSA 3A2FA 5SZTA 1OVQA 4FK4A 3NH1A 3ZSRA 1KVCA 4H0TB 1BDGA 2IDOA 3R6MA 2PYLA 4X62K 4H0PA 4CFAA 3E1YA 3BUZB 4V19S 4QS7A 2F9WA 4ELVA 4FWOA 2OPQA 1VSFA 3VTIA 5I9EB 5I3UA 1T6DA 4H03B 4JI8K 3QMLA 1VHXA 3A0IX 3DRRA 3ZSZA 5CYQA 2GWJA 3OS2A 3SNNA 1NG9A 1RT5A 2P9PB 4GV3A 2JWLA 3CERA 1YVNA 4CJQA 1EWRA 4PL7A 2P9NA 1ZXOA 1ITGA 2HMIA 3C6TA 3MECA 4FZXC 1VQ9N 2V7YA 4FLXA 4CD1A 3DMJA 3OJUA 4L8RB 4XH1A 1ATNA 1NGJA 1KSPA 3HPOA 3VQPA 4B1WB 1VSMA 1SZ2A 1XMOK 2IC3A 4F8RA 3I55N 1NK6A 4KB1A 4HUGA 2X78A 4M45A 2QKBA 4DSEA 5KPZA 1GLFO 3UB5A 1FK9A 3E9LA 4DV3K 1BOTO 1CZBA 3K9KA 1KLMA 3EO3A 1TAUA 1LOTB 2ETJA 4FPBA 4CD3A 4DV2K 1DEJA 1NGCA 3K2PA 2DTUA 3OYFA 4ICLA 3AVBA 4IO8A 2CH5A 5ADXH 1YF5L 2P9LA 4ID5A 1WSGA 1BCMA 3VGLA 2YHAA 4H0OA 5AZJA 2ZF5O 1EX4A 5E84A 2WTUA 5EU7A 1XNQK 5GIPA 4R79A 4UY8O 3CCLN 1VRUA 4H4MA 3KK2A 2QW9A 5C15A 3SUQA 1YJNN 1IBLK 3CPEA 4LH5A 3SUOA 1WSFA 1VQNN 4B3MK 2HHHK 4OPHA 3SUPA 3L8BA 3ULEB 1U04A 5CHIA 4BDZA 1VSDA 2F8SA 1NK9A 4IOCL 1HYZA 4BE2A 3DXMB 1NK0A 3HZ6A 4YORA 2YKMA 4BRDA 1J5EK 3IAYA 4BWMA 3ZSWA 4E7HA 2D4WA 4ILHA 2QWRA 3QESA 1XWLA 3O1WA 3ZT2A 3BDPA 1C0UA 3AO1A 4CZMA 5JLHA 3LWLA 5BN8A 3CQ8A 4PQUA 1YIJN 3CC7N 1VRTA 3KLEA 1REVA 5T7BA 1Z25A 3V9XA 3WXIA 4AM7A 4O55A 4M7XA 3IKMA 4MO4A 4UQGA 3R3LA 3F9MA 3AO4A 2O8EB 2JLEA 1LWCA 4BRGA 2A41A 2RF2A 1WLJA 3SQ4A 2HHTA 4CEDA 4KTWA 1Z05A 3DRSA 2E2NA 2QXLA 3OS0A 3SAHA 3H6EA 3SBGA 4BR2A 1HNZK 2XY8A 3O9SA 3TAQA 3IUCA 4FJNA 3ATUA 3AVAA 3ZETA 4W5TA 1NGAA 2EHGA 3MK6A 3NGYA 3EE8A 3NVMA 3EYZA 1ASVA 1K6YA 2A6AA 3CIPA 1S9GA 4ZTFA 3M8QA 4FWNA 4I9QA 4LD0A 2W41A 4O8UA 4DHYA 2NRXA 2ITGA 4CEZA 1BG3A 3LZIA 1NOZA 1TVRA 4KHSA 4B9VA 1TL1A 3RMCA 4BR4A 4KH5A 2Z1IA 4KPYA 2GX9A 4EP4A 1C1BA 5C0YA 4EHUA 3AGKA 3M8PA 4KTZA 4FXDA 5J1EA 3B6OA 4DF4A 1JL1A 2QWQA 3TTCA 4GKJK 3U9ZA 1ZYQA 2VG6A 4DR6K 1KAZA 1ZBSA 3P39A 3JYTA 1IG9A 4BDPA 3O3GA 3I0RA 3MCAB 1YTAA 2B4JA 3ZSYA 2UUAK 2OZMA 3OA9A 5M1NA 3SPZA 2QK9A 1J9AA 1R59O 3HSTB 4CJ4A 3V81A 4CIGA 2O8FA 3G0ZA 3VGKA 3I33A 3VGMA 1OVYA 1HYSA 1TL3A 3DRPA 2P9KB 1JCFA 3KKSA 1A5XA 3ZX0A 4B8CA 2QXFA 3C6UA 1XC9A 3KLHA 3SQ0A 1U49A 4CZEA 1WSJA 3OJSA 3VQ7A 2G8KA 4RW8A 3HM8A 4CFCA 2IVOA 2VG7A 3TARA 3C94A 4CFDA 4EZ6A 5KRSA 2ZJQL 1JXBA 1ASUA 2YNGA 2WBNA 1MA9B 3LDLA 4DQ8A 3KJVA 1BU6O 3QNNA 1SL2A 1ASWA 3VN5A 4CEFA 4JNEA 1VQ8N 1QSYA 3SQ1A 3VENA 1B9DA 3S41A 2GWKA 2E2OA 2ASMA 4LF4K 3ENBA 5BRFA 2NRRA 4BRQA 3O4NA 2HBMA 2G8WA 2G8HA 1DTTA 1HRHA 3AVFA 5F0XA 1RT6A 1QQCA 4IFVA 4C1NI 1S6QA 5AQWA 1KCFA 5C2FA 4K42A 3NAEA 2HHVA 2DFFA 4KTQA 4CK1A 5J2PA 4NCAA 1IV0A 4ELUA 1VQ7N 4FLYA 5FPMA 1FW6A 1T03A 1LWEA 1M90O 1UWBA 1TV6A 3OYEA 3NMUA 1E4FT 3KZBA 4B9MA 4B1XB 3RRGA 3RSEA 3OYHA 2PAVA 4DTJA 4B1ZA 1VSKA 3PUFA 1YTUA 1HMVA 1JLEA 1Q81O 4KHYA 4GMJB 4BE1A 3P83D 2JGUA 4CZJA 5ADXA 3SJHA 2CGKA 3SLCA 4FLUA 4IZ9A 3OYMA 2BDPA 2OZSA 4AQYK 2FF6A 5CY4A 2ZJRL 1RBUA 1NOYA 3CETA 3AVCA 4YFUA 4Z4EA 4LY7A 4CEBA 1S1TA 1TAQA 4FWSA 1ILYA 1JLFA 5LJWA 2KFZA 2F4VK 3DJCA 4AHUA 1NU0A 4FL9A 1YJ9N 1I94K 1J5OA 3O6WA 3ZT0A 5DMRA 1QSSA 4PY5A 4H5TA 3LDSA 1EWQA 3THYB 4BR9A 5CYMA 2IVPA 4O44A 3S3OA 1E3MA 3OYKA 1J54A 2ZWHA 3AV9A 4A59A 3NFAA 3IS9A 4DR4K 2Z1HA 2FSNA 4CHPA 2KKZA 1TYQA 2E6LA 4F3TA 4F4KA 3ULDA 2E4LA 4BDYA 4JK7A 4FM0A 3T1YK 2Q0UA 4JD2A 4DFKA 2HHWA 3PSFA 4BC3A 4KBOA 2FBXA 4I2PA 1BIUA 4KHUA 3VPZA 3WNFA 3N4PA 4OVLA 2XY5A 4JI3K 1NGBA 3TSUA 2KZZA 1DTQA 2VWKA 5HL7L 3FE1A 4HUEA 4FZZA 4FM1A 3V6DA 1VQMN 4PWDA 4FSVA 3DLRA 3HSCA 4FWPA 1U48A 4DTNA 1D4XA 4DSIA 2A1SA 3RR8A 3QDKA 3BGRA 4DTUA 4E3SA 2P5OA 4WFBL 1WSEA 3LPUA 2YJFA 5AQGA 3O5BA 4CF8A 3I8BA 1SQKA 1E4GT 3CC4N 1JL2A 4J2BA 2D1KA 1HQUA 2D0CA 4Y0WA 5BR9A 4DTOA 2PFUA 3QEWA 1XNRK 5AQIA 3AO3A 3L4IA 5IWAK 1HJRA 3LWMA 2DY4A 3CJ7A 4B9LA 1KC8O 4YOYA 1ESVA 2RPIA 3SZ2A 3CI5A 1C1AA 4JV5K 4WCEL 4PL8A 3MX2A 3CCVN 4DUYK 3T1AA 1N34K 4FCYA 3K0SA 2EX3A 2O8DA 4JI0K 3O9RA 4GVEA 2RKIA 3HBTA 3KK7A 3VQ9A 3VEXA 1RDBA 4EIAA 3WEEB 1Q18A 1SKWA 3F2KA 5HRRA 4FLTA 3D2EA 1FXXA 4TSXA 4W5QA 3NH0A 3DI6A 4CJ3A 4CGIA 1WN7A 4KFBA 3SK3A 4DR5K 2CGLA 3PY8A 2BH1A 2QI2A 4KI4A 1XQSC 3DOKA 3THXB 1TUYA 1TKTA 3KTQA 2JWKA 2AP1A 2E1YA 4KH4A 3TU5A 5C42A 3TABA 1ZBLA 2NRVA 3ZX2A 3SBTA 3V9ZA 4GNIA 3K57A 2YI1A 2Z1JA 3L2RA 1QZ6A 1ZBHA 3LM9A 5BREA 4H0YB 5AJ3K 3NGIA 3R1XA 3BP8A 1X3MA 2H3GX 3AVMA 1UAXA 2FBYA 3LDOA 4BRIA 3WXKA 4HVJA 4K41A 1RDWX 1LCUA 3HPGA 3ATVA 3O9QA 3WNEA 3SCXA 2OCEA 4DSLA 3VETA 1GLLO 3AAPA 4DV5K 4BRPA 4AM6A 1NKEA 3VESA 1R0AA 4CJTA 1LW0A 1NGFA 1JLCA 4MLEA 2P9LB 4CIEA 4LF7K 1KD1O 1WB9A 3PIPL 1HYVA 4B3RK 1T7PA 5EVZA 1HPZA 3O4WA 3SMPA 3MN7A 1RBRA 4CGGA 3LM2A 2KLAA 5FPDA 3T1HK 1NK4A 2W6KA 2P9SB 5DK5A 3AVIA 4OLAA 5LY3A 4B08A 4H5VA 1A5WA 4DR1K 1LV5A 3W0LA 4DV7K 3C6HA 1VK0A 4CHZA 4FJLA 2A1RA 4Z4HA 3QINA 2KTQA 3P1GA 3HTVA 1GLBG 3OHRA 3DXKB 1WSIA 4CJ7A 4C8NA 4K8XA 3IRXA 1CXUA 4ISGA 2IIRA 1HLUA 4B3SK 3CFPA 3SV4A 2HHXA 1QQNA 1UA0A 4LF9K 4NO7A 3J7ZO 4CF2A 3TAGA 1D9FA 4JI7K 4CJFA 4MDAA 3SYZA 1NGEA 1BI4A 3CJ9A 1D9DA 3OBWA 1C6VA 3KWGA 1O1WA 1NK5A 4MFBA 4RTFD 5EX5A 2I7PA 3FFKB 4GY2B 4B3OA 4U67L 4J2EA 3I8DA 1KLNA 3O9TA 2P51A 3U3YA 3QEIA 1YI2N 4FLVA 3TSQA 4FK2A 5CR4A 1KFDA 3B6PA 2X6NA 4DCHA 2O8CA 4CE9A 1RNHA 2OYQA 4JHDA 5M1OA 3O9UA 4PKIA 4CZLA 5KPTA 2ZGYA 2ZQBA 1SL0A 4FJXA 1WOQA 5M1QA 2ZJPL 3F5TA 4CERA 1CLQA 2Y1JA 2BE2A 3NH2A 4YOWA 4LFBK 1LAVA 1N8RO 3MWTA 1NGGA 1J53A 4AHSA 3DLEA 2I7NA 5AFUH 3VOVA 4OPJA 3LP1A 4FJGA 2HHQA 3CCEN 3C65A 3L4QA 3C95A 2HB5A 2VWJA 3RTVA 3THWA 3KK3A 1XHZA 3PX4A 4FJ8A 1D5AA 3T7ZA 4E19A 3ZLJA 2X74A 4JKCA 1T05A 1VSEA 1RILA 3OYGA 3HP6A 4OLBA 1RDUA 3WXMB 4KAZA 3WXLA 2D0AA 4RWTA 3EZ5A 2GTDA 3H45C 3I0SA 3D2FA 3M3ZA 3QERA 4WQ5A 2QTDA 5AQLA 1YUWA 3CFOA 3E9OA 2QWMA 4BVPA 3ZEUA 3K5NA 4M3UA 1HPMA 4CF1A 4RW9A 2D0BA 3M8RA 2UXDK 1WBDA 2NNWA 2QEXN 5CZ1A 5E26A 4DR2K 5HRSA 4M3XA 4DU4A 2XY7A 4GW6A 2IVNA 3CYMA 1N32K 3WQUA 3BF1A 3ZYYX 1T3VA 3MCPA 1SKRA 1GOAA 4CF0A 2D5RA 5HP1A 2IS3A 4JKDA 4A5AA 1BA1A 1T6CA 1P90A 3DM2A 4DQPA 2NUBA 3GBTA 1U2VA 5AQPA 2VQEK 3ZSVA 3OYIA 1TK0A 2UU9K 3MXMA 3O3HA 3O3FA 1WAJA 3A5LC 3PSIA 2ITMA 1NGIA 1SS6A 1HNXK 5KTQA 3WXJA 3KLGA 2R7YA 1T8EA 3ZSXA 1VSHA 5DM6L 1U47A 3VQEA 4I9LA 4DSJA 4IDHA 4CIFA 3FR0A 2RHKA 1RDAA 3QBXA 4C8LA 5TKYA 3K9JA 4AHCA 4I7FA 4NCBA 4JRPA 1IBMK 5C24A 3TR8A 4EFHA 4HCBA 5FLXO 4BC4A 3KK1A 1K8KA 4IKFA 5CE3A 4MDBA 5D3GA 4CZKA 1RDCA 4CEEA 4DB3A 4F2RA 3FZMA 3RWUA 1I3AA 1NWKA 3ZCMA 4X64K 3QLHA 3EKUA 4WFAL 4CBWA 5AQZA 1ZBUA 3FZLA 2PY5A 4RW4A 3AVJA 3A8YA 2E20A 2A42A 3TAPA 4LF6K 1P8ZA 4DS4A 4C8KA 5JVGL 1KQSM 3KKRA 4JKAA 3KD5E 3KVGA 4DR3K 1EQYA 1HUXA 4FJ5A 4FW2A 2YHBA 3O1BA 3QIOA 1O13A 1VQON 4BRKA 5KRTA 1KRPA 4DR7K 1KAXA 4IG3A 2ASPA 1EO1A 1IKYA 2YX6A 3BEXA 3G25A 3VQQA 4DQSA 2KW4A 3HI0A 4RW6A 4CZGA 5AQOA 3LP0A 1YXQA 1ZBFA 2OPPA 5BPMA 3VQBA 3R8EA 1G99A 3OYNA 4FWMA 3CJCA 3SJJA 1RTHA 1XI1A 4CF9A 2P1JA 5B8HA 2HBKA 4L3QA 3V4IA 3TTFA 4AHRA 4E7KA 1WAFA 3T69A 1RCHA 1TYQB 5H1SQ 3AO5A 4FLWA 5HOOA 3R9PA 3B8AX 3CC2N 3UIQA 4JD2B 3SAGA 1K8AO 4HTUA 5CZ2A 3F73A 4O0IA 1NJIO 1YT3A 3DYAA 3LDQA 2W6LA 3LP3A 2GELA 1UA1A 3IDHA 4JKGA 4CGDA 1MU2A 4KB0A 1RT3A 2BANA 3C6AA 4KRFA 1JLBA 1BWFO 4EZ9A 1RBSA 5J2NA 4PKGA 4LFCK 3G71N 3AGRA 4CHYA 4DV6K 3MN5A 3MXIA 3J7YP 1Z26A 3NDKA 1VAZA 1YAGA 2HHSA 2YHWA 1ZC6A 1W9HA 5AFUA 3CFRA 4IO9L 5AQMA 3SV3A 2Q97A 5HRNA 5A2QO 4E7IA 4KHNA 4M41A 1Q9YA 3G10A 3A5MC 3VQ4A 4OGCA 3QEXA 3HM9A 4DQQA 3MXJA 1YJWN 1K9MO 3EKSA 1S3XA 4BQZA 1DLOA 3LP2A 3D7EO 3DXMA 2O8DB 4CGFA 3UE5A 2EWSA 5KQ8A 3PO5A 3SQ2A 4PHTX 3H1QA 4CJPA 2O8BA 4H5WA 4FJIA 3MN9A 1NLVA 4NYFA 3G4SN 5AR0A 4QCLA 5FDLA 4NXNK 3CCSN 1VQPN 3LZJA 5BR8K 1KVBA 3EEQA 4A62A 1IKXA 3ZT4A 2HNYA 5SWMA 2UUCK 4DMNA 1NJZA 4FOIA 5M1FA 2QKKA 5M1KA 1QSLA 4J2AA 3HPHA 3RMAA 3IMXA 4Q5VA 2NZTA 4M42A 4DG1A 4FW1A 2VGNA 4LF8K 3MEEA 3ID6A 4MQ3A 3IG1A 3ZT3A 4DU1A 1OH8A 2YKNA 2P9IA 4EHTA 1XHXA 5LJVA 2HVIA 2AA4A 3CM6A 4OX9K 1RFQA 4CFBA 3TAEA 3C0BA 4E0DA 2E8AA 1A5VA 1OH5A 3M1FA 4DWIA 2P9UB 2OTJN 1IG8A 3KLIA 3RVCA 1BIZA 4CJKA 4JLHA 3AVGA 3MEDA 4CESA 4JI5K 5C2DA 5AQJA 2XHBA 2NRHA 5J2MA 1C0GA 3HOTA 1NJYA 3L2WA 1QQOA 4I6MB 4ILJA 4A57A 1LW2A 4OKKA 3NE6A 3MAQA 3MX5A 4H0VB 1H1VA 3HL8A 2KZMA 4B9NA 5AQQA 1G15A 3NCIA 4GKKK 4EP5A 3ISNC 1N5YA 4ILGB 4JYAK 2P9KA 1JCGA 5GIOA 3K5OA 4F9OA 1TUUA 3CCMN 4FVUA 2F7TA 3JAMO 4CCHA 3A5NC 4FPAA 4CVNE 3O08A 5J2QA 4J2DA 4K43A 3VQ6A 1JXEA 4IFEA 1Q82O 3KHYA 4WQ4C 5GAGP 3HRGA 3NBPA 1BUPA 1BI4B 4HTLA
chains in the Genus database with same CATH topology
4NXNK 4JI1K 2ZM6K 1I94K 4JI7K 5BR8K 1HNXK 4B3TK 4K0KK 4JI4K 2UUCK 4DV0K 3J81O 4LF5K 4LFAK 1HR0K 4X65K 4DR4K 1FJGK 5AJ3K 1XMOK 4LF4K 2UXCK 4LF8K 1IBKK 3T1YK 3J7AP 5LMNK 1IBMK 1N33K 1HNWK 5FLXO 4OX9K 4DV3K 1HNZK 4JI3K 2UUBK 4LFBK 4LFCK 4DV2K 4DV5K 1N36K 4DV6K 2UXBK 4X64K 5LMUK 4LF7K 4JI5K 3J7YP 2VQFK 3OTOK 4DUZK 4B3RK 4DV4K 4DV1K 4NXMK 1XNRK 5A2QO 5IT9O 4X66K 3T1HK 5IWAK 4KHPK 4LF6K 4YHHK 2E5LK 4CW7B 1XNQK 4DR1K 4DR3K 4GKKK 4GKJK 4DV7K 4DR6K 2UXDK 4JI6K 3J80O 4JI2K 4JYAK 4DR2K 4JV5K 4AQYK 5LL6Z 4DR7K 1N32K 2UUAK 4DUYK 1N34K 4YY3K 3JAMO 4X62K 1IBLK 4JI0K 4CVNE 4V19S 4B3MK 2HHHK 4JI8K 2F4VK 4B3SK 1XMQK 2VQEK 1J5EK 4DR5K 4LF9K 2UU9K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN K;  4JI1 K;  2ZM6 K;  1I94 K;  4JI7 K;  5BR8 K;  1HNX K;  4B3T K;  4K0K K;  4JI4 K;  2UUC K;  4DV0 K;  3J81 O;  4LF5 K;  4LFA K;  1HR0 K;  4X65 K;  4DR4 K;  1FJG K;  5AJ3 K;  1XMO K;  4LF4 K;  2UXC K;  4LF8 K;  1IBK K;  3T1Y K;  3J7A P;  5LMN K;  1IBM K;  1N33 K;  1HNW K;  5FLX O;  4OX9 K;  4DV3 K;  1HNZ K;  4JI3 K;  2UUB K;  4LFB K;  4LFC K;  4DV2 K;  4DV5 K;  1N36 K;  4DV6 K;  2UXB K;  4X64 K;  5LMU K;  4LF7 K;  4JI5 K;  3J7Y P;  2VQF K;  3OTO K;  4DUZ K;  4B3R K;  4DV4 K;  4DV1 K;  4NXM K;  1XNR K;  5A2Q O;  5IT9 O;  4X66 K;  3T1H K;  5IWA K;  4KHP K;  4LF6 K;  4YHH K;  2E5L K;  4CW7 B;  1XNQ K;  4DR1 K;  4DR3 K;  4GKK K;  4GKJ K;  4DV7 K;  4DR6 K;  2UXD K;  4JI6 K;  3J80 O;  4JI2 K;  4JYA K;  4DR2 K;  4JV5 K;  4AQY K;  5LL6 Z;  4DR7 K;  1N32 K;  2UUA K;  4DUY K;  1N34 K;  4YY3 K;  3JAM O;  4X62 K;  1IBL K;  4JI0 K;  4CVN E;  4V19 S;  4B3M K;  2HHH K;  4JI8 K;  2F4V K;  4B3S K;  1XMQ K;  2VQE K;  1J5E K;  4DR5 K;  4LF9 K;  2UU9 K; 
#chains in the Genus database with same CATH topology
 4JI1 K;  2ZM6 K;  1HQE A;  1W97 L;  2Q2R A;  3EE9 A;  5ELZ A;  2FC0 A;  2BGG A;  4JI4 K;  4AF1 A;  1Q86 O;  3CPW M;  4B9U A;  2O8C B;  1NM1 A;  2Q0R A;  4X65 K;  4M3W A;  5AQU A;  1Q9X A;  3V9S A;  1FJG K;  1VQK N;  4PUO A;  3GL1 A;  4CEQ A;  4FJM A;  2P9N B;  4J8F A;  4BWJ A;  4OKE A;  4DQI A;  2Q3S A;  4CK3 A;  1LAW A;  4FWQ A;  4IJA A;  3ZSO A;  4U7B A;  4B8A B;  1NKC A;  2F96 A;  4JEP A;  3OVN A;  1UOC A;  4KRE A;  3FFI A;  4BVO A;  2QWO A;  3CCQ N;  1VSI A;  4ISE A;  5JS2 A;  4IDK A;  4GV9 A;  5AZI A;  2HBL A;  4M3T A;  2UUB K;  1L5U A;  4CHO A;  1X9M A;  3THW B;  1IKW A;  2XY6 A;  4IXC A;  1S22 A;  1S6P A;  2WFB A;  4RCH A;  3SMS A;  4IG0 A;  1N36 K;  4CJU A;  3OYA A;  4JKF A;  2Q31 A;  4QAG A;  3DLB A;  1QTM A;  3SUN A;  3VER A;  4FJ7 A;  3D2F B;  3QNO A;  4AHV A;  1RT1 A;  4CZI A;  1VQ6 N;  1W0H A;  4CZH A;  2VG5 A;  3VA0 A;  3ZEU B;  4WQ4 A;  3N4Q A;  4JKB A;  4KHP K;  3Q7C A;  5GAD P;  2NLX A;  1QHA A;  3O80 A;  3OYL A;  5EOY A;  4CW7 B;  4Z4I A;  3ITH A;  2Z1G A;  4F2S A;  3FGU A;  2LSN A;  1Z6R A;  4CEC A;  3L2V A;  3U6F A;  1DKG D;  2YNF A;  3LPT A;  1BHL A;  4DTR A;  1X3N A;  1WNS A;  5JIC A;  1NJX A;  2OPR A;  3VF6 A;  3DWL A;  3OY9 A;  3HO1 A;  3CM5 A;  4OPA A;  1ATR A;  3E01 A;  1L3T A;  3HK2 A;  5AZJ B;  2E1Z A;  1NMD A;  1NGD A;  2HW3 A;  1JLQ A;  4YOU A;  3JSM A;  4QS8 A;  1VQL N;  2QA4 N;  1C0M A;  1TKX A;  3M6G A;  3HXM A;  1OKJ A;  4IBN A;  3UKU A;  2WON A;  2ZGZ A;  1GOC A;  3RRH A;  1C0F A;  4JK8 A;  4O0J A;  1L3V A;  2V7Z A;  3CJ1 A;  4G9Z A;  3OW2 M;  5HRP A;  3L3V A;  4CJE A;  3CG7 A;  2W42 A;  3VEV A;  4K0K K;  3V1Q A;  3CJB A;  4KHQ A;  4FJH A;  3TTD A;  3J81 O;  3VEW A;  2QM1 A;  4BC5 A;  3KD1 E;  3NHG A;  3ALY A;  1HR0 K;  5AQN A;  1RTD A;  4WQ5 C;  3OYD A;  3O8M A;  1MDU B;  3F9K A;  4E7J A;  2UXC K;  2IOC A;  1NK7 A;  4CI6 A;  3SI6 A;  1N33 K;  4O8K A;  2V52 B;  4AHT A;  1JJ2 M;  3C7N A;  3OBY A;  4FM2 A;  1X9W A;  1KAY A;  3QIC A;  3V9U A;  4ZTJ A;  2F8T A;  1C1C A;  1JLG A;  3TAF A;  4ELT A;  3RR7 A;  1X1P A;  4CJL A;  3HP9 A;  1T44 A;  4DS5 A;  4BRM A;  3JS6 A;  3KWI A;  3ZSQ A;  3ZT1 A;  3VEO A;  4N76 A;  3AA4 A;  1VQ4 N;  1D8Y A;  1IH7 A;  3LAK A;  4FK0 A;  1NGH A;  3AVH A;  3U3G A;  5FPN A;  3LDP A;  5AQR A;  4KH6 A;  3AVL A;  2FSJ A;  3VF4 A;  2VQF K;  2G8I A;  1QE1 A;  4NXM K;  3NF8 A;  3ZET B;  5IT9 O;  4DLG A;  3EN9 A;  4KO0 A;  5FPE A;  2HF4 A;  2D0P A;  4CHN A;  2O4I A;  3GG4 A;  4HHT A;  3LAN A;  4YOV A;  3TPQ A;  2VGM A;  2PZS A;  2KFN A;  3WEE A;  3THV A;  5I42 A;  3CXC M;  1M1K O;  1NK8 A;  3MEG A;  3ASM A;  3DAW A;  4NB4 A;  3T19 A;  2NRT A;  4PKH A;  5AQF A;  5GAE P;  3L2U A;  4DTP A;  4NYN A;  3RMB A;  3T3F A;  1S1V A;  3BZK A;  3PV8 A;  4YDU A;  2YNI A;  2HND A;  3U4L A;  3JXU A;  4BG9 A;  3CME N;  3THX A;  3L6Q A;  5JMV A;  4BRF A;  2WUS A;  1BO5 O;  2F9T A;  5KGX A;  5AQK A;  1BGX T;  5E41 A;  3CMA N;  4BRA A;  5C12 A;  1U45 A;  1BIS A;  3NF9 A;  3VTH A;  4XH5 A;  4RW7 A;  4W5O A;  2QWP A;  2O8F B;  4KV8 A;  4H4O A;  1U6Z A;  3NF6 A;  1U4B A;  4FWK A;  1QVG M;  3K59 A;  1KXP A;  4C23 A;  4B9S A;  4NCG A;  3M5R A;  5KI6 A;  4Q0B A;  2FLO A;  1WSH A;  5BRD A;  5MLC Q;  4JKG B;  3V1O A;  4WF9 L;  2VCP A;  2V51 B;  3VEY A;  4DU3 A;  1JLA A;  1BL3 A;  4CJW A;  1HNW K;  1Y97 A;  1TGO A;  2Q36 A;  1TK5 A;  1B92 A;  4E7L A;  3HJF A;  3UKR A;  4YNQ A;  1GLD G;  4DQR A;  2HVH A;  4CGH A;  4BRN A;  2OPS A;  1S5J A;  1RTJ A;  1HNI A;  2P9S A;  4EAH D;  2E88 A;  2IAJ A;  2UXB K;  3K5M A;  5HRO A;  4M63 C;  4K8Z A;  1BCO A;  2FXU A;  4DUZ K;  4H5N A;  5KGW A;  3H46 O;  2FSK A;  4DV1 K;  2E6M A;  3DLL L;  4H5R A;  4X66 K;  3DXK A;  4YHH K;  3VMF B;  1GLC G;  2OA8 A;  4CK2 A;  2E2Q A;  4JN4 A;  3VQA A;  4YOT A;  3M8S A;  3P5J A;  3DOL A;  1EKE A;  4Y1D A;  4JI2 K;  3J8A A;  3Q7B A;  3E66 A;  2YHX A;  1W7A A;  3RSE B;  3AY9 A;  4A2A A;  3V9W A;  4BY9 C;  2P5G A;  3VQC A;  4HUF A;  2O8B B;  4JS4 A;  1NKB A;  3CD6 N;  4GV6 A;  1RGI A;  1QHT A;  4CGJ A;  3OYB A;  4FO0 A;  3NVK A;  5HLF A;  1YVU A;  4Z4G A;  4CJV A;  3HT3 A;  4MLH A;  1RT7 A;  2O4G A;  1XMQ K;  3PX6 A;  4R5P A;  5TKW A;  2HNZ A;  4C8M A;  3AA5 X;  2ATQ A;  4KI6 A;  3H3O B;  2P9P A;  4E1M A;  4H0X B;  4JAX A;  3LL3 A;  4CBX A;  3AVN A;  1NMN A;  4DTX A;  1LWF A;  1SKS A;  3MMV A;  2QWL A;  4CJ5 A;  4BRH A;  4C8O A;  4N47 A;  4LC9 B;  2P9I B;  1TKZ A;  5F2R A;  2IGI A;  4GVM A;  4IOX A;  5BPL A;  2RE2 A;  1QVF M;  2I5J A;  3QBW A;  1IBK K;  1OH6 A;  5LMN K;  4BC2 A;  3HYF A;  5AQT A;  3VQ8 A;  3EZW A;  4Z4C A;  4BRC A;  4BG8 A;  1X9J A;  2XRI A;  3NF7 A;  4XEI A;  4Z0U A;  3TAM A;  2G8U A;  4G1Q A;  1N6Q A;  4YOX A;  2QWN A;  4B9T A;  3TWH A;  3TAN A;  4ZHR A;  4ID1 A;  2G8V A;  2UYT A;  2VWB A;  3IFR A;  4O5F A;  4B9Q A;  3E9P A;  1ZBI A;  1S1X A;  2OAN A;  1YIT N;  3O4Q A;  4CJR A;  3CJA A;  4DKW A;  1S1U A;  1VSL A;  2OTL N;  2X6S A;  4ISF A;  3MWP A;  3ID8 A;  3V1R A;  1QS4 A;  3FZK A;  2GBZ A;  2KQ2 A;  4JI6 K;  3J80 O;  4FJJ A;  4FVM A;  4DFM A;  1CZ9 A;  4WFN L;  2RN2 A;  3ENH A;  2Y1I A;  4YY3 K;  3U8X A;  3PIO L;  1RBV A;  3L3U A;  4QS9 A;  3SAF A;  1HJO A;  4FLZ A;  3MN6 A;  1SV5 A;  3AA3 A;  4AH9 A;  4BQL A;  1NJW A;  4OJR A;  4HWI A;  4E1J A;  1TK8 A;  3ULE A;  3WNG A;  2NRW A;  5GAH P;  4Y1C A;  3S3M A;  4OGE A;  4BR7 A;  4BRL A;  1IJJ A;  2BUP A;  4K25 A;  4B1U B;  3BY5 A;  5KQD A;  4B3T K;  4B1V A;  3AAQ A;  1F21 A;  2AJQ A;  3D2E B;  4DV0 K;  1KFS A;  2YJE A;  1RTI A;  2Q1N A;  2ASO A;  3QIP A;  5C10 A;  1B9F A;  1XC3 A;  2XO7 A;  2D0O A;  3KLF A;  4DFP A;  4M3Y A;  3S3N A;  5AZI B;  4AIL C;  2HHU A;  1S72 N;  1SAZ A;  4CBU A;  3KIO A;  4BR0 A;  2O8E A;  1GLA G;  1KVA A;  3S9H A;  4WE1 A;  4NLB A;  1TKD A;  1QQM A;  5JLF A;  1GLJ O;  4M7Y A;  3CCJ N;  2FBT A;  4LH4 A;  4FJK A;  1S1W A;  2PYJ A;  4JRQ A;  1MWK A;  3ZX3 A;  3A5O C;  1GOB A;  1JCE A;  4CJS A;  3WQT A;  4LSL A;  5FRO A;  3OYJ A;  3FZH A;  4CZF A;  4PA1 A;  4FWL A;  3I56 N;  4W5R A;  3QEP A;  1XUP O;  4DSK A;  1SL1 A;  4BRO A;  4XIU A;  1VQ5 N;  3BZC A;  3CF5 L;  1Q7Y O;  4E1N A;  4O4G A;  5LL6 Z;  3PO4 A;  4JKE A;  3AVK A;  4OKJ A;  1V4T A;  3TI0 A;  3P38 A;  1QZ5 A;  3QB0 A;  4WYB A;  3BF3 A;  4FZY A;  5BRH A;  3FZF A;  3DLK A;  3SPY A;  3UKU B;  3WNH A;  3WT0 A;  4BRE A;  1IO2 A;  3D6R A;  3CCU N;  1J6Z A;  4Z94 A;  1MWM A;  1WBB A;  2WC9 A;  2G8F A;  5BPN A;  2DFH A;  5GIN A;  2A5X A;  4IOA L;  5AQS A;  4O5B A;  4DTM A;  4M3Z A;  3VQD A;  4IEE A;  4N56 A;  5AQY A;  3WUH A;  1YHQ N;  2WOM A;  3PLA A;  3D0P A;  4LF5 K;  4C1N K;  4BGB A;  4LFA K;  4LSN A;  1CZA N;  4HCC A;  4RG8 A;  5FRN A;  2HF3 A;  3PX0 A;  5HBM A;  4I2Q A;  1HKB A;  3LAL A;  5F1X A;  3C7N B;  5AQH A;  4OPK A;  3J7A P;  2FBV A;  1EXQ A;  1SUQ A;  4JKH A;  4FWR A;  4Z4F A;  2GUP A;  3HVT A;  4FYD A;  4DLE A;  3G6E N;  4BE0 A;  2YV0 X;  3CCR N;  2YHY A;  3L0Q A;  4BAC A;  2FF3 B;  1V4S A;  1BA0 A;  4MO5 A;  4JHD B;  5JS1 A;  2VYP A;  3H08 A;  2HBJ A;  4IEI A;  2CGJ A;  3LAM A;  4IFY A;  3NGZ A;  2HMP A;  3QFU A;  3QET A;  3TSP A;  5BN9 A;  1HKG A;  1FKO A;  3OTO K;  1HX1 A;  3W3D A;  4DFJ A;  5AQX A;  3H3N O;  3ENO A;  2YNH A;  1Y64 A;  2A40 A;  1NBW A;  1EET A;  1Q8I A;  4F3O A;  2E5L K;  1X9S A;  3DLG A;  3QFP A;  3AA2 A;  1OH7 A;  3QEV A;  3VQ5 A;  3HOS A;  3EL2 A;  3RMD A;  1KTQ A;  4A5B A;  5C25 A;  1JKH A;  1S9E A;  3H1V X;  4DF8 A;  2DPN A;  1IKV A;  3LDN A;  2ZE2 A;  5DM7 L;  4JS5 A;  1L3U A;  3VEZ A;  5JVH L;  1C0T A;  1RDD A;  2DFE A;  2BTF A;  4FOE A;  4A61 A;  4KHW A;  3AAR A;  5FRM A;  1WUA A;  2HST A;  4IJN A;  3HVR A;  1I39 A;  2A3Z A;  3OYC A;  3D45 A;  3P31 A;  4DTS A;  4CEA A;  3GDQ A;  2YCH A;  2NRZ A;  1RBT A;  3FLC O;  3QO9 A;  1W2B M;  2PBD A;  4FJ9 A;  3CQX A;  3DLH A;  1U2V B;  1GLE G;  1EP4 A;  3THY A;  1CXQ A;  4H8K A;  1RT2 A;  5K14 A;  4QOZ B;  2GEM A;  1DGK N;  5AQV A;  4IWV A;  5EXW A;  2P9U A;  4N41 A;  3CQY A;  3P4I A;  3GOI A;  3UKR B;  4DSF A;  4W5N A;  1RT4 A;  4A2B A;  2CH6 A;  4B1Y B;  4JK9 A;  3VF2 A;  5KPR A;  4YDU C;  4M3R A;  2E2P A;  1VSJ A;  3OS1 A;  2J4R A;  1NNE A;  3MDQ A;  4I6M A;  5M1P A;  3GE1 A;  2ZD1 A;  3CHW A;  1HNV A;  1L3S A;  4XH4 A;  4E89 A;  4CEO A;  4BGA A;  3K5L A;  3AO2 A;  3K58 A;  2GUI A;  3L2Q A;  5LMU K;  1DT9 A;  1FKP A;  2GV9 A;  4CHQ A;  1K8K B;  4DV4 K;  2KHO A;  2B6A A;  2W40 A;  1BQN A;  2B5J A;  1HKC A;  3U9D A;  1K73 O;  4KKO A;  3EY1 A;  4BR5 A;  5EY4 A;  3VA3 A;  2HOE A;  4NLC A;  4OO1 J;  4N5S A;  1BQM A;  1ATS A;  3A2F A;  5SZT A;  1OVQ A;  4FK4 A;  3NH1 A;  3ZSR A;  1KVC A;  4H0T B;  1BDG A;  2IDO A;  3R6M A;  2PYL A;  4X62 K;  4H0P A;  4CFA A;  3E1Y A;  3BUZ B;  4V19 S;  4QS7 A;  2F9W A;  4ELV A;  4FWO A;  2OPQ A;  1VSF A;  3VTI A;  5I9E B;  5I3U A;  1T6D A;  4H03 B;  4JI8 K;  3QML A;  1VHX A;  3A0I X;  3DRR A;  3ZSZ A;  5CYQ A;  2GWJ A;  3OS2 A;  3SNN A;  1NG9 A;  1RT5 A;  2P9P B;  4GV3 A;  2JWL A;  3CER A;  1YVN A;  4CJQ A;  1EWR A;  4PL7 A;  2P9N A;  1ZXO A;  1ITG A;  2HMI A;  3C6T A;  3MEC A;  4FZX C;  1VQ9 N;  2V7Y A;  4FLX A;  4CD1 A;  3DMJ A;  3OJU A;  4L8R B;  4XH1 A;  1ATN A;  1NGJ A;  1KSP A;  3HPO A;  3VQP A;  4B1W B;  1VSM A;  1SZ2 A;  1XMO K;  2IC3 A;  4F8R A;  3I55 N;  1NK6 A;  4KB1 A;  4HUG A;  2X78 A;  4M45 A;  2QKB A;  4DSE A;  5KPZ A;  1GLF O;  3UB5 A;  1FK9 A;  3E9L A;  4DV3 K;  1BOT O;  1CZB A;  3K9K A;  1KLM A;  3EO3 A;  1TAU A;  1LOT B;  2ETJ A;  4FPB A;  4CD3 A;  4DV2 K;  1DEJ A;  1NGC A;  3K2P A;  2DTU A;  3OYF A;  4ICL A;  3AVB A;  4IO8 A;  2CH5 A;  5ADX H;  1YF5 L;  2P9L A;  4ID5 A;  1WSG A;  1BCM A;  3VGL A;  2YHA A;  4H0O A;  5AZJ A;  2ZF5 O;  1EX4 A;  5E84 A;  2WTU A;  5EU7 A;  1XNQ K;  5GIP A;  4R79 A;  4UY8 O;  3CCL N;  1VRU A;  4H4M A;  3KK2 A;  2QW9 A;  5C15 A;  3SUQ A;  1YJN N;  1IBL K;  3CPE A;  4LH5 A;  3SUO A;  1WSF A;  1VQN N;  4B3M K;  2HHH K;  4OPH A;  3SUP A;  3L8B A;  3ULE B;  1U04 A;  5CHI A;  4BDZ A;  1VSD A;  2F8S A;  1NK9 A;  4IOC L;  1HYZ A;  4BE2 A;  3DXM B;  1NK0 A;  3HZ6 A;  4YOR A;  2YKM A;  4BRD A;  1J5E K;  3IAY A;  4BWM A;  3ZSW A;  4E7H A;  2D4W A;  4ILH A;  2QWR A;  3QES A;  1XWL A;  3O1W A;  3ZT2 A;  3BDP A;  1C0U A;  3AO1 A;  4CZM A;  5JLH A;  3LWL A;  5BN8 A;  3CQ8 A;  4PQU A;  1YIJ N;  3CC7 N;  1VRT A;  3KLE A;  1REV A;  5T7B A;  1Z25 A;  3V9X A;  3WXI A;  4AM7 A;  4O55 A;  4M7X A;  3IKM A;  4MO4 A;  4UQG A;  3R3L A;  3F9M A;  3AO4 A;  2O8E B;  2JLE A;  1LWC A;  4BRG A;  2A41 A;  2RF2 A;  1WLJ A;  3SQ4 A;  2HHT A;  4CED A;  4KTW A;  1Z05 A;  3DRS A;  2E2N A;  2QXL A;  3OS0 A;  3SAH A;  3H6E A;  3SBG A;  4BR2 A;  1HNZ K;  2XY8 A;  3O9S A;  3TAQ A;  3IUC A;  4FJN A;  3ATU A;  3AVA A;  3ZET A;  4W5T A;  1NGA A;  2EHG A;  3MK6 A;  3NGY A;  3EE8 A;  3NVM A;  3EYZ A;  1ASV A;  1K6Y A;  2A6A A;  3CIP A;  1S9G A;  4ZTF A;  3M8Q A;  4FWN A;  4I9Q A;  4LD0 A;  2W41 A;  4O8U A;  4DHY A;  2NRX A;  2ITG A;  4CEZ A;  1BG3 A;  3LZI A;  1NOZ A;  1TVR A;  4KHS A;  4B9V A;  1TL1 A;  3RMC A;  4BR4 A;  4KH5 A;  2Z1I A;  4KPY A;  2GX9 A;  4EP4 A;  1C1B A;  5C0Y A;  4EHU A;  3AGK A;  3M8P A;  4KTZ A;  4FXD A;  5J1E A;  3B6O A;  4DF4 A;  1JL1 A;  2QWQ A;  3TTC A;  4GKJ K;  3U9Z A;  1ZYQ A;  2VG6 A;  4DR6 K;  1KAZ A;  1ZBS A;  3P39 A;  3JYT A;  1IG9 A;  4BDP A;  3O3G A;  3I0R A;  3MCA B;  1YTA A;  2B4J A;  3ZSY A;  2UUA K;  2OZM A;  3OA9 A;  5M1N A;  3SPZ A;  2QK9 A;  1J9A A;  1R59 O;  3HST B;  4CJ4 A;  3V81 A;  4CIG A;  2O8F A;  3G0Z A;  3VGK A;  3I33 A;  3VGM A;  1OVY A;  1HYS A;  1TL3 A;  3DRP A;  2P9K B;  1JCF A;  3KKS A;  1A5X A;  3ZX0 A;  4B8C A;  2QXF A;  3C6U A;  1XC9 A;  3KLH A;  3SQ0 A;  1U49 A;  4CZE A;  1WSJ A;  3OJS A;  3VQ7 A;  2G8K A;  4RW8 A;  3HM8 A;  4CFC A;  2IVO A;  2VG7 A;  3TAR A;  3C94 A;  4CFD A;  4EZ6 A;  5KRS A;  2ZJQ L;  1JXB A;  1ASU A;  2YNG A;  2WBN A;  1MA9 B;  3LDL A;  4DQ8 A;  3KJV A;  1BU6 O;  3QNN A;  1SL2 A;  1ASW A;  3VN5 A;  4CEF A;  4JNE A;  1VQ8 N;  1QSY A;  3SQ1 A;  3VEN A;  1B9D A;  3S41 A;  2GWK A;  2E2O A;  2ASM A;  4LF4 K;  3ENB A;  5BRF A;  2NRR A;  4BRQ A;  3O4N A;  2HBM A;  2G8W A;  2G8H A;  1DTT A;  1HRH A;  3AVF A;  5F0X A;  1RT6 A;  1QQC A;  4IFV A;  4C1N I;  1S6Q A;  5AQW A;  1KCF A;  5C2F A;  4K42 A;  3NAE A;  2HHV A;  2DFF A;  4KTQ A;  4CK1 A;  5J2P A;  4NCA A;  1IV0 A;  4ELU A;  1VQ7 N;  4FLY A;  5FPM A;  1FW6 A;  1T03 A;  1LWE A;  1M90 O;  1UWB A;  1TV6 A;  3OYE A;  3NMU A;  1E4F T;  3KZB A;  4B9M A;  4B1X B;  3RRG A;  3RSE A;  3OYH A;  2PAV A;  4DTJ A;  4B1Z A;  1VSK A;  3PUF A;  1YTU A;  1HMV A;  1JLE A;  1Q81 O;  4KHY A;  4GMJ B;  4BE1 A;  3P83 D;  2JGU A;  4CZJ A;  5ADX A;  3SJH A;  2CGK A;  3SLC A;  4FLU A;  4IZ9 A;  3OYM A;  2BDP A;  2OZS A;  4AQY K;  2FF6 A;  5CY4 A;  2ZJR L;  1RBU A;  1NOY A;  3CET A;  3AVC A;  4YFU A;  4Z4E A;  4LY7 A;  4CEB A;  1S1T A;  1TAQ A;  4FWS A;  1ILY A;  1JLF A;  5LJW A;  2KFZ A;  2F4V K;  3DJC A;  4AHU A;  1NU0 A;  4FL9 A;  1YJ9 N;  1I94 K;  1J5O A;  3O6W A;  3ZT0 A;  5DMR A;  1QSS A;  4PY5 A;  4H5T A;  3LDS A;  1EWQ A;  3THY B;  4BR9 A;  5CYM A;  2IVP A;  4O44 A;  3S3O A;  1E3M A;  3OYK A;  1J54 A;  2ZWH A;  3AV9 A;  4A59 A;  3NFA A;  3IS9 A;  4DR4 K;  2Z1H A;  2FSN A;  4CHP A;  2KKZ A;  1TYQ A;  2E6L A;  4F3T A;  4F4K A;  3ULD A;  2E4L A;  4BDY A;  4JK7 A;  4FM0 A;  3T1Y K;  2Q0U A;  4JD2 A;  4DFK A;  2HHW A;  3PSF A;  4BC3 A;  4KBO A;  2FBX A;  4I2P A;  1BIU A;  4KHU A;  3VPZ A;  3WNF A;  3N4P A;  4OVL A;  2XY5 A;  4JI3 K;  1NGB A;  3TSU A;  2KZZ A;  1DTQ A;  2VWK A;  5HL7 L;  3FE1 A;  4HUE A;  4FZZ A;  4FM1 A;  3V6D A;  1VQM N;  4PWD A;  4FSV A;  3DLR A;  3HSC A;  4FWP A;  1U48 A;  4DTN A;  1D4X A;  4DSI A;  2A1S A;  3RR8 A;  3QDK A;  3BGR A;  4DTU A;  4E3S A;  2P5O A;  4WFB L;  1WSE A;  3LPU A;  2YJF A;  5AQG A;  3O5B A;  4CF8 A;  3I8B A;  1SQK A;  1E4G T;  3CC4 N;  1JL2 A;  4J2B A;  2D1K A;  1HQU A;  2D0C A;  4Y0W A;  5BR9 A;  4DTO A;  2PFU A;  3QEW A;  1XNR K;  5AQI A;  3AO3 A;  3L4I A;  5IWA K;  1HJR A;  3LWM A;  2DY4 A;  3CJ7 A;  4B9L A;  1KC8 O;  4YOY A;  1ESV A;  2RPI A;  3SZ2 A;  3CI5 A;  1C1A A;  4JV5 K;  4WCE L;  4PL8 A;  3MX2 A;  3CCV N;  4DUY K;  3T1A A;  1N34 K;  4FCY A;  3K0S A;  2EX3 A;  2O8D A;  4JI0 K;  3O9R A;  4GVE A;  2RKI A;  3HBT A;  3KK7 A;  3VQ9 A;  3VEX A;  1RDB A;  4EIA A;  3WEE B;  1Q18 A;  1SKW A;  3F2K A;  5HRR A;  4FLT A;  3D2E A;  1FXX A;  4TSX A;  4W5Q A;  3NH0 A;  3DI6 A;  4CJ3 A;  4CGI A;  1WN7 A;  4KFB A;  3SK3 A;  4DR5 K;  2CGL A;  3PY8 A;  2BH1 A;  2QI2 A;  4KI4 A;  1XQS C;  3DOK A;  3THX B;  1TUY A;  1TKT A;  3KTQ A;  2JWK A;  2AP1 A;  2E1Y A;  4KH4 A;  3TU5 A;  5C42 A;  3TAB A;  1ZBL A;  2NRV A;  3ZX2 A;  3SBT A;  3V9Z A;  4GNI A;  3K57 A;  2YI1 A;  2Z1J A;  3L2R A;  1QZ6 A;  1ZBH A;  3LM9 A;  5BRE A;  4H0Y B;  5AJ3 K;  3NGI A;  3R1X A;  3BP8 A;  1X3M A;  2H3G X;  3AVM A;  1UAX A;  2FBY A;  3LDO A;  4BRI A;  3WXK A;  4HVJ A;  4K41 A;  1RDW X;  1LCU A;  3HPG A;  3ATV A;  3O9Q A;  3WNE A;  3SCX A;  2OCE A;  4DSL A;  3VET A;  1GLL O;  3AAP A;  4DV5 K;  4BRP A;  4AM6 A;  1NKE A;  3VES A;  1R0A A;  4CJT A;  1LW0 A;  1NGF A;  1JLC A;  4MLE A;  2P9L B;  4CIE A;  4LF7 K;  1KD1 O;  1WB9 A;  3PIP L;  1HYV A;  4B3R K;  1T7P A;  5EVZ A;  1HPZ A;  3O4W A;  3SMP A;  3MN7 A;  1RBR A;  4CGG A;  3LM2 A;  2KLA A;  5FPD A;  3T1H K;  1NK4 A;  2W6K A;  2P9S B;  5DK5 A;  3AVI A;  4OLA A;  5LY3 A;  4B08 A;  4H5V A;  1A5W A;  4DR1 K;  1LV5 A;  3W0L A;  4DV7 K;  3C6H A;  1VK0 A;  4CHZ A;  4FJL A;  2A1R A;  4Z4H A;  3QIN A;  2KTQ A;  3P1G A;  3HTV A;  1GLB G;  3OHR A;  3DXK B;  1WSI A;  4CJ7 A;  4C8N A;  4K8X A;  3IRX A;  1CXU A;  4ISG A;  2IIR A;  1HLU A;  4B3S K;  3CFP A;  3SV4 A;  2HHX A;  1QQN A;  1UA0 A;  4LF9 K;  4NO7 A;  3J7Z O;  4CF2 A;  3TAG A;  1D9F A;  4JI7 K;  4CJF A;  4MDA A;  3SYZ A;  1NGE A;  1BI4 A;  3CJ9 A;  1D9D A;  3OBW A;  1C6V A;  3KWG A;  1O1W A;  1NK5 A;  4MFB A;  4RTF D;  5EX5 A;  2I7P A;  3FFK B;  4GY2 B;  4B3O A;  4U67 L;  4J2E A;  3I8D A;  1KLN A;  3O9T A;  2P51 A;  3U3Y A;  3QEI A;  1YI2 N;  4FLV A;  3TSQ A;  4FK2 A;  5CR4 A;  1KFD A;  3B6P A;  2X6N A;  4DCH A;  2O8C A;  4CE9 A;  1RNH A;  2OYQ A;  4JHD A;  5M1O A;  3O9U A;  4PKI A;  4CZL A;  5KPT A;  2ZGY A;  2ZQB A;  1SL0 A;  4FJX A;  1WOQ A;  5M1Q A;  2ZJP L;  3F5T A;  4CER A;  1CLQ A;  2Y1J A;  2BE2 A;  3NH2 A;  4YOW A;  4LFB K;  1LAV A;  1N8R O;  3MWT A;  1NGG A;  1J53 A;  4AHS A;  3DLE A;  2I7N A;  5AFU H;  3VOV A;  4OPJ A;  3LP1 A;  4FJG A;  2HHQ A;  3CCE N;  3C65 A;  3L4Q A;  3C95 A;  2HB5 A;  2VWJ A;  3RTV A;  3THW A;  3KK3 A;  1XHZ A;  3PX4 A;  4FJ8 A;  1D5A A;  3T7Z A;  4E19 A;  3ZLJ A;  2X74 A;  4JKC A;  1T05 A;  1VSE A;  1RIL A;  3OYG A;  3HP6 A;  4OLB A;  1RDU A;  3WXM B;  4KAZ A;  3WXL A;  2D0A A;  4RWT A;  3EZ5 A;  2GTD A;  3H45 C;  3I0S A;  3D2F A;  3M3Z A;  3QER A;  4WQ5 A;  2QTD A;  5AQL A;  1YUW A;  3CFO A;  3E9O A;  2QWM A;  4BVP A;  3ZEU A;  3K5N A;  4M3U A;  1HPM A;  4CF1 A;  4RW9 A;  2D0B A;  3M8R A;  2UXD K;  1WBD A;  2NNW A;  2QEX N;  5CZ1 A;  5E26 A;  4DR2 K;  5HRS A;  4M3X A;  4DU4 A;  2XY7 A;  4GW6 A;  2IVN A;  3CYM A;  1N32 K;  3WQU A;  3BF1 A;  3ZYY X;  1T3V A;  3MCP A;  1SKR A;  1GOA A;  4CF0 A;  2D5R A;  5HP1 A;  2IS3 A;  4JKD A;  4A5A A;  1BA1 A;  1T6C A;  1P90 A;  3DM2 A;  4DQP A;  2NUB A;  3GBT A;  1U2V A;  5AQP A;  2VQE K;  3ZSV A;  3OYI A;  1TK0 A;  2UU9 K;  3MXM A;  3O3H A;  3O3F A;  1WAJ A;  3A5L C;  3PSI A;  2ITM A;  1NGI A;  1SS6 A;  1HNX K;  5KTQ A;  3WXJ A;  3KLG A;  2R7Y A;  1T8E A;  3ZSX A;  1VSH A;  5DM6 L;  1U47 A;  3VQE A;  4I9L A;  4DSJ A;  4IDH A;  4CIF A;  3FR0 A;  2RHK A;  1RDA A;  3QBX A;  4C8L A;  5TKY A;  3K9J A;  4AHC A;  4I7F A;  4NCB A;  4JRP A;  1IBM K;  5C24 A;  3TR8 A;  4EFH A;  4HCB A;  5FLX O;  4BC4 A;  3KK1 A;  1K8K A;  4IKF A;  5CE3 A;  4MDB A;  5D3G A;  4CZK A;  1RDC A;  4CEE A;  4DB3 A;  4F2R A;  3FZM A;  3RWU A;  1I3A A;  1NWK A;  3ZCM A;  4X64 K;  3QLH A;  3EKU A;  4WFA L;  4CBW A;  5AQZ A;  1ZBU A;  3FZL A;  2PY5 A;  4RW4 A;  3AVJ A;  3A8Y A;  2E20 A;  2A42 A;  3TAP A;  4LF6 K;  1P8Z A;  4DS4 A;  4C8K A;  5JVG L;  1KQS M;  3KKR A;  4JKA A;  3KD5 E;  3KVG A;  4DR3 K;  1EQY A;  1HUX A;  4FJ5 A;  4FW2 A;  2YHB A;  3O1B A;  3QIO A;  1O13 A;  1VQO N;  4BRK A;  5KRT A;  1KRP A;  4DR7 K;  1KAX A;  4IG3 A;  2ASP A;  1EO1 A;  1IKY A;  2YX6 A;  3BEX A;  3G25 A;  3VQQ A;  4DQS A;  2KW4 A;  3HI0 A;  4RW6 A;  4CZG A;  5AQO A;  3LP0 A;  1YXQ A;  1ZBF A;  2OPP A;  5BPM A;  3VQB A;  3R8E A;  1G99 A;  3OYN A;  4FWM A;  3CJC A;  3SJJ A;  1RTH A;  1XI1 A;  4CF9 A;  2P1J A;  5B8H A;  2HBK A;  4L3Q A;  3V4I A;  3TTF A;  4AHR A;  4E7K A;  1WAF A;  3T69 A;  1RCH A;  1TYQ B;  5H1S Q;  3AO5 A;  4FLW A;  5HOO A;  3R9P A;  3B8A X;  3CC2 N;  3UIQ A;  4JD2 B;  3SAG A;  1K8A O;  4HTU A;  5CZ2 A;  3F73 A;  4O0I A;  1NJI O;  1YT3 A;  3DYA A;  3LDQ A;  2W6L A;  3LP3 A;  2GEL A;  1UA1 A;  3IDH A;  4JKG A;  4CGD A;  1MU2 A;  4KB0 A;  1RT3 A;  2BAN A;  3C6A A;  4KRF A;  1JLB A;  1BWF O;  4EZ9 A;  1RBS A;  5J2N A;  4PKG A;  4LFC K;  3G71 N;  3AGR A;  4CHY A;  4DV6 K;  3MN5 A;  3MXI A;  3J7Y P;  1Z26 A;  3NDK A;  1VAZ A;  1YAG A;  2HHS A;  2YHW A;  1ZC6 A;  1W9H A;  5AFU A;  3CFR A;  4IO9 L;  5AQM A;  3SV3 A;  2Q97 A;  5HRN A;  5A2Q O;  4E7I A;  4KHN A;  4M41 A;  1Q9Y A;  3G10 A;  3A5M C;  3VQ4 A;  4OGC A;  3QEX A;  3HM9 A;  4DQQ A;  3MXJ A;  1YJW N;  1K9M O;  3EKS A;  1S3X A;  4BQZ A;  1DLO A;  3LP2 A;  3D7E O;  3DXM A;  2O8D B;  4CGF A;  3UE5 A;  2EWS A;  5KQ8 A;  3PO5 A;  3SQ2 A;  4PHT X;  3H1Q A;  4CJP A;  2O8B A;  4H5W A;  4FJI A;  3MN9 A;  1NLV A;  4NYF A;  3G4S N;  5AR0 A;  4QCL A;  5FDL A;  4NXN K;  3CCS N;  1VQP N;  3LZJ A;  5BR8 K;  1KVB A;  3EEQ A;  4A62 A;  1IKX A;  3ZT4 A;  2HNY A;  5SWM A;  2UUC K;  4DMN A;  1NJZ A;  4FOI A;  5M1F A;  2QKK A;  5M1K A;  1QSL A;  4J2A A;  3HPH A;  3RMA A;  3IMX A;  4Q5V A;  2NZT A;  4M42 A;  4DG1 A;  4FW1 A;  2VGN A;  4LF8 K;  3MEE A;  3ID6 A;  4MQ3 A;  3IG1 A;  3ZT3 A;  4DU1 A;  1OH8 A;  2YKN A;  2P9I A;  4EHT A;  1XHX A;  5LJV A;  2HVI A;  2AA4 A;  3CM6 A;  4OX9 K;  1RFQ A;  4CFB A;  3TAE A;  3C0B A;  4E0D A;  2E8A A;  1A5V A;  1OH5 A;  3M1F A;  4DWI A;  2P9U B;  2OTJ N;  1IG8 A;  3KLI A;  3RVC A;  1BIZ A;  4CJK A;  4JLH A;  3AVG A;  3MED A;  4CES A;  4JI5 K;  5C2D A;  5AQJ A;  2XHB A;  2NRH A;  5J2M A;  1C0G A;  3HOT A;  1NJY A;  3L2W A;  1QQO A;  4I6M B;  4ILJ A;  4A57 A;  1LW2 A;  4OKK A;  3NE6 A;  3MAQ A;  3MX5 A;  4H0V B;  1H1V A;  3HL8 A;  2KZM A;  4B9N A;  5AQQ A;  1G15 A;  3NCI A;  4GKK K;  4EP5 A;  3ISN C;  1N5Y A;  4ILG B;  4JYA K;  2P9K A;  1JCG A;  5GIO A;  3K5O A;  4F9O A;  1TUU A;  3CCM N;  4FVU A;  2F7T A;  3JAM O;  4CCH A;  3A5N C;  4FPA A;  4CVN E;  3O08 A;  5J2Q A;  4J2D A;  4K43 A;  3VQ6 A;  1JXE A;  4IFE A;  1Q82 O;  3KHY A;  4WQ4 C;  5GAG P;  3HRG A;  3NBP A;  1BUP A;  1BI4 B;  4HTL A; 
#chains in the Genus database with same CATH homology
 4NXN K;  4JI1 K;  2ZM6 K;  1I94 K;  4JI7 K;  5BR8 K;  1HNX K;  4B3T K;  4K0K K;  4JI4 K;  2UUC K;  4DV0 K;  3J81 O;  4LF5 K;  4LFA K;  1HR0 K;  4X65 K;  4DR4 K;  1FJG K;  5AJ3 K;  1XMO K;  4LF4 K;  2UXC K;  4LF8 K;  1IBK K;  3T1Y K;  3J7A P;  5LMN K;  1IBM K;  1N33 K;  1HNW K;  5FLX O;  4OX9 K;  4DV3 K;  1HNZ K;  4JI3 K;  2UUB K;  4LFB K;  4LFC K;  4DV2 K;  4DV5 K;  1N36 K;  4DV6 K;  2UXB K;  4X64 K;  5LMU K;  4LF7 K;  4JI5 K;  3J7Y P;  2VQF K;  3OTO K;  4DUZ K;  4B3R K;  4DV4 K;  4DV1 K;  4NXM K;  1XNR K;  5A2Q O;  5IT9 O;  4X66 K;  3T1H K;  5IWA K;  4KHP K;  4LF6 K;  4YHH K;  2E5L K;  4CW7 B;  1XNQ K;  4DR1 K;  4DR3 K;  4GKK K;  4GKJ K;  4DV7 K;  4DR6 K;  2UXD K;  4JI6 K;  3J80 O;  4JI2 K;  4JYA K;  4DR2 K;  4JV5 K;  4AQY K;  5LL6 Z;  4DR7 K;  1N32 K;  2UUA K;  4DUY K;  1N34 K;  4YY3 K;  3JAM O;  4X62 K;  1IBL K;  4JI0 K;  4CVN E;  4V19 S;  4B3M K;  2HHH K;  4JI8 K;  2F4V K;  4B3S K;  1XMQ K;  2VQE K;  1J5E K;  4DR5 K;  4LF9 K;  2UU9 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...