2UUCK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2uucK00
4JI1K 4X65K 1HNXK 4DV4K 4OX9K 4YY3K 2UXBK 1J5EK 2E5LK 4LF9K 5LMNK 4DV3K 2UU9K 1N36K 4DV2K 4DV0K 4LF4K 4B3RK 1I94K 1HNWK 4DR7K 5LL6Z 1XNQK 1IBKK 3J80O 4LFAK 4DUZK 4LFCK 4DV7K 2UUCK 5FLXO 4AQYK 4JYAK 4LF5K 4B3SK 2UXCK 4DR2K 5AJ3K 4DR6K 4JI8K 4K0KK 2ZM6K 5LMUK 4JI3K 2UUBK 4JI0K 4LF8K 4JV5K 3J7YP 4NXMK 2VQFK 4B3MK 4DR4K 4V19S 4DR5K 4LF6K 2HHHK 4GKJK 4DR1K 3JAMO 1HR0K 5A2QO 4JI5K 4LF7K 1XNRK 4DR3K 1N34K 4X64K 4JI6K 1N33K 5BR8K 2F4VK 1HNZK 5IT9O 1IBLK 3J81O 4LFBK 2UUAK 3T1YK 2VQEK 4JI7K 4DV6K 1FJGK 5IWAK 3OTOK 4DV1K 4CVNE 3J7AP 4JI4K 3T1HK 4JI2K 4KHPK 4X62K 4X66K 4B3TK 4YHHK 4CW7B 4DV5K 2UXDK 1XMQK 1N32K 1XMOK 4DUYK 4GKKK 1IBMK 4NXNK
chains in the Genus database with same CATH superfamily
2IVPA 4Y0WA 2KHOA 3UB5A 2O8BA 4OX9K 1LW0A 1ZBFA 1Z05A 4O8KA 1T6DA 1YITN 2HNYA 3H1VX 4FJ5A 4CZGA 4BE0A 2BE2A 3ZYYX 4DR7K 3ZX3A 5FRMA 1S6PA 3E66A 1QE1A 5AZJB 4FJ8A 2ITGA 4FJHA 3QNOA 4BE2A 4ILJA 4DS4A 3ASMA 3NGYA 1XWLA 3VA3A 2W40A 4IG3A 2ITMA 2NRVA 4CBWA 4CHPA 3CPWM 3LP1A 3OYMA 3DLEA 1TYQB 4B9QA 1DKGD 2O8FB 3O5BA 2F8SA 4FWLA 4DFPA 4BR5A 3SMSA 3UKRA 3VF6A 4ISEA 4CJPA 2WONA 3DOLA 4N47A 3D2EA 4IBNA 4DWIA 3LM9A 1HNVA 4H0XB 3L3UA 2A1SA 4OKJA 4KBOA 3JS6A 4CF1A 2R7YA 3GBTA 1QSYA 2G8HA 1K9MO 3NF7A 1JCFA 4E7KA 3FZFA 3PX0A 1SZ2A 1WAFA 2FXUA 3V9SA 4YOVA 4BR9A 3VQAA 4IOCL 1HNZK 2YKNA 3CJ7A 4G9ZA 4BY9C 4CEDA 2Z1GA 4FL9A 3VOVA 2V7YA 1KTQA 2IVOA 3HZ6A 1VQ8N 4KREA 5GIPA 4BRCA 4W5RA 2O8CB 5FDLA 4EP5A 4CGDA 4DU3A 2I5JA 1ZBHA 1XMQK 5C2DA 1SAZA 4QCLA 3MECA 3TAMA 4FCYA 3QEPA 4YFUA 3AVMA 1SS6A 4AILC 3L2VA 5EXWA 4E89A 2FBTA 2XRIA 2FLOA 2YKMA 3D6RA 5AQLA 4NXNK 2E8AA 5BPNA 1RDUA 3QBWA 4FVUA 3JXUA 4B8CA 1BQNA 4E1NA 2WBNA 4A57A 1NKBA 4CZLA 4PHTX 5D3GA 1K6YA 3T1AA 1BWFO 4ID1A 3V4IA 2A42A 3F2KA 1C1BA 3AO4A 3MN7A 5BPLA 1KVCA 3OYDA 4DTJA 1NK7A 3AO1A 1YJWN 4J2EA 3E1YA 2P9IB 4E1JA 4LFCK 4TSXA 5FLXO 1SV5A 4CZMA 5HOOA 5M1PA 4KHWA 5JVHL 3PO5A 3V1RA 1Y64A 3IS9A 2NZTA 4K0KK 4JHDB 3S3MA 2YHBA 3VQ7A 3C6HA 1ZBIA 3EZWA 3TTCA 2D0PA 3A8YA 1S72N 4PWDA 3E9PA 1ILYA 3A5OC 3VESA 4CBXA 4N76A 4CIFA 2ZGYA 3CC7N 3M3ZA 4BRHA 1NJWA 4BACA 1X9SA 3LP3A 1BQMA 4BG9A 3SQ1A 1T7PA 4DR4K 3N4PA 3THWB 1RGIA 3TWHA 2OTLN 4K8XA 2W6KA 1OKJA 2RE2A 5M1NA 3SPYA 2YV0X 4O0JA 1S1VA 4C1NI 1NKCA 1DT9A 1HNIA 5E84A 4DTMA 3VQCA 4OLAA 1XNRK 3SBTA 1OH7A 4AHRA 1SKRA 4CEAA 2PFUA 4FPBA 1BI4A 4JLHA 4BGAA 2QEXN 3MK6A 4CECA 4GV9A 1R0AA 3BP8A 4E7HA 1CXUA 3DLRA 4M7YA 2B4JA 3T1YK 1JL2A 2VQEK 3SUNA 4M7XA 1QVGM 3LDSA 2BANA 4H0YB 3KZBA 3DRPA 4X66K 1NM1A 4FJ9A 4W5NA 4L3QA 5JLFA 2QKBA 3C95A 4DQ8A 3PY8A 1UAXA 1HUXA 2ASOA 4CFCA 2XY7A 1YJ9N 4J8FA 3VQ8A 4KB0A 3GE1A 4JS5A 5AQKA 4YOUA 2KTQA 2HHQA 3S3NA 3OJSA 1OVQA 4CF2A 3F73A 3K9KA 3ZT0A 3QMLA 3AARA 2E2NA 4MFBA 1HLUA 2UU9K 4YNQA 1VSJA 4EP4A 1JKHA 4W5OA 5AQZA 3CMAN 3BUZB 4DV2K 5GAGP 3NGIA 4B3RK 1HJOA 1GLDG 4YOTA 5C0YA 3HTVA 4N41A 3OYJA 4BRLA 4M3TA 1MWMA 5BRHA 1C0GA 3TAEA 1KC8O 4GW6A 3AAPA 4JD2B 3KLGA 2OPQA 2AJQA 2V51B 3VF4A 4RW9A 1HMVA 2HHVA 1A5WA 3ZLJA 4GV3A 1T6CA 1SL1A 3EEQA 4AHSA 4B9MA 3IRXA 4CJ3A 4DR5K 4GY2B 3HO1A 1S1UA 1X1PA 3M8PA 5GAEP 4DR1K 1QS4A 3O3HA 4IFYA 3O9TA 1BCMA 5HP1A 1NK6A 3CCUN 4WYBA 3THYB 4LF7K 1QSSA 1YUWA 4FWRA 3H3OB 5KTQA 3OY9A 4E7JA 4DG1A 1TK8A 5BREA 3I55N 3C6TA 4CJLA 2KFZA 1D9DA 3DLGA 3KD5E 4WQ4C 2QWNA 4CCHA 4FWOA 1QHTA 1D8YA 4CIGA 4WF9L 5IWAK 4KB1A 3V9UA 4CFBA 4JRQA 3BGRA 3ALYA 1YI2N 4BRMA 3IG1A 1N6QA 3OYHA 4BC3A 2P9UB 3P4IA 1VQPN 2IC3A 1N32K 4DTXA 3AVNA 1LW2A 3KD1E 1FKOA 4OLBA 5AQMA 1TVRA 2HF3A 3LM2A 1FXXA 2PYJA 4BRQA 1ITGA 2O8EA 5KGWA 5KRSA 4DV4K 3D45A 3ENHA 5ELZA 4Y1DA 2O8BB 1WUAA 3NAEA 2E5LK 2A3ZA 1KVAA 3HXMA 3AGKA 4OO1J 4CJUA 1L3SA 4CZIA 5J1EA 3U9ZA 1RNHA 3FE1A 3DXMB 4O4GA 2ZF5O 2Y1IA 4N5SA 3AVKA 5CY4A 1J9AA 4MO4A 2NNWA 4A5AA 3C65A 3EKUA 4KI4A 4ZHRA 1OH5A 3OYEA 2KKZA 1BL3A 1ESVA 1TUUA 5LJWA 1WSEA 2NRRA 5E41A 3MEGA 3V1OA 4FLZA 2UUBK 4JI0K 5FPEA 1SL2A 1I39A 3SQ0A 3KVGA 1RBRA 2RN2A 4DQPA 1JJ2M 1VQKN 1ZXOA 3UKRB 3VQ5A 4DSEA 4FJLA 1Q9YA 3THXA 4ICLA 3TSPA 1S1TA 2G8KA 2HHXA 2Y1JA 5EX5A 4R79A 3CJ9A 3CC4N 3D2FA 5J2MA 3FZHA 3O9RA 4JI6K 3K5NA 3L3VA 1K8KA 4BC4A 3M8QA 5SZTA 1XUPO 3C7NA 3U3GA 2WTUA 3CCMN 3DI6A 3HPHA 2VG5A 3WNHA 3CJCA 4RW7A 3T19A 1WSJA 1RCHA 3OTOK 4FLVA 4MDBA 2P9SA 4CD1A 3QDKA 5BR9A 4X62K 1U04A 3PIOL 4EIAA 3CJBA 3FFKB 4M3WA 3DAWA 3KHYA 1XI1A 1VSIA 2G8VA 1Z26A 3SNNA 3M5RA 4CJRA 3HVTA 3PUFA 2ETJA 3QERA 3EL2A 2A6AA 4A59A 3KK2A 3SJJA 3A0IX 1XHXA 4DV3K 5CHIA 4JK8A 4JKEA 5EOYA 5M1OA 3VETA 1BG3A 4Z4IA 4B9LA 4IDHA 5I3UA 2YHWA 4DTSA 4M45A 4JKFA 3MXIA 3ZEUB 4DV7K 4IO9L 4L8RB 3MEDA 3NCIA 3HRGA 4IG0A 3CMEN 3RMAA 3MX5A 3TTFA 3RRGA 2QXFA 1KFSA 1DEJA 1X3NA 3LWLA 4EZ9A 2YHYA 3HOSA 5AQHA 1MDUB 5LMUK 3HP9A 3L2UA 2QWOA 2UYTA 3B8AX 5MLCQ 4FJ7A 4BREA 3RMBA 2P51A 1OH8A 3V9ZA 3LL3A 3VQ6A 1YJNN 1NGBA 1NOZA 3TR8A 5J2QA 3QO9A 1RTHA 2QI2A 2XY6A 2WC9A 4H5RA 5HROA 1L3UA 3LDOA 1E4FT 1VQON 2GUIA 3M6GA 3NH2A 1IH7A 2FSJA 2E4LA 4PA1A 1YT3A 3R3LA 2FBVA 4DLEA 1YXQA 3NF8A 2UUAK 4FWQA 2D0CA 3KK7A 3P31A 4BR0A 3CFPA 4HUGA 3UKUA 5AQSA 1TKDA 3NH0A 3QFPA 1B9DA 4KHPK 1R59O 1EXQA 3S9HA 1IG9A 3C6AA 1JLAA 4DHYA 1VSFA 3OYCA 3VEVA 4WFAL 4J2BA 4FYDA 4M63C 4FM1A 4YOWA 3FZLA 5HRPA 1IKVA 3NGZA 2OZSA 4H5NA 4AHVA 3U3YA 3TI0A 3Q7BA 4DSJA 3THVA 3BDPA 4YY3K 1TAUA 3FGUA 3UIQA 4Z94A 4JK9A 2O4GA 1RFQA 2HF4A 3TPQA 3UE5A 4DV0K 5SWMA 3NFAA 4FWPA 1GLJO 3KLEA 1BUPA 3HBTA 4NYNA 2Q0RA 5CZ1A 4C8NA 1N5YA 1DTTA 3ZSWA 4LFAK 2HB5A 2ZWHA 1VQ4N 4I6MA 2NRHA 3Q7CA 4ILHA 3EZ5A 1YHQN 1JCGA 4ISGA 5C15A 4HHTA 3HSTB 4H4OA 4I2QA 3AVCA 4RW8A 3L6QA 3WQUA 1S6QA 3RMCA 4OKKA 4A2AA 3VTIA 3L2QA 5AQFA 3SV4A 1QTMA 2QW9A 1VQ6N 1X9JA 3LALA 1C6VA 2VGNA 1GOAA 1RDCA 3CETA 4CHQA 5M1FA 2QWPA 1QSLA 5AQYA 4QS9A 4WFNL 1VQMN 3HJFA 3DLBA 2HHSA 3CCRN 5C42A 3QEXA 1IJJA 3U8XA 4ZTFA 4IEIA 2VCPA 5AQVA 3WXLA 5BRFA 4IOXA 2D0BA 1LWCA 3VQQA 4X64K 1RILA 1KRPA 4AHTA 3GL1A 3LPTA 3G4SN 2P9PA 4FJGA 3WXKA 4BRFA 4DSFA 1VSDA 2YNGA 4CGGA 1ATNA 4CGHA 2GV9A 1YAGA 5FRNA 2NLXA 3TTDA 1KLMA 5JICA 1SUQA 3AVJA 4WQ5A 4CJQA 5FPMA 2PBDA 1RT3A 1GLEG 4B08A 4CF9A 5HLFA 3JSMA 3HYFA 2AP1A 2DTUA 4DUYK 1RT1A 1Z6RA 1QZ6A 4JI1K 4CF8A 4FLXA 4CHOA 2FF3B 3ID8A 2E2OA 3ZETA 3QEVA 4LH5A 4K25A 1YTUA 2O8EB 3CERA 4N56A 1J5EK 5LMNK 3R6MA 4HUFA 3H6EA 2HNDA 4WQ5C 1NK5A 4C8KA 1J54A 3LP0A 4QAGA 3RMDA 1I94K 4F9OA 2DY4A 3KWGA 2GTDA 2QTDA 3DWLA 4I2PA 3K5MA 4CJ5A 3S3OA 1FW6A 3SLCA 5DK5A 3CQXA 3KK3A 4JKAA 1GLLO 1MA9B 2G8IA 4CEOA 4DSKA 3EE9A 3BEXA 3TSUA 3ZSRA 1HKCA 3ULEA 3DM2A 4CJEA 3OYLA 4DFKA 1D5AA 1VHXA 4PY5A 4CZKA 3AVBA 1CLQA 3VN5A 4CJVA 1U4BA 1HX1A 4OGCA 4FJIA 1S22A 1NGFA 1X3MA 4G1QA 4DLGA 5C10A 3KLIA 1NK4A 5E26A 3DJCA 4JV5K 1JLGA 4E1MA 3ZSXA 5CYQA 4FJXA 3WQTA 2E20A 2J4RA 2ZJQL 4GKJK 1B92A 4FZYA 3THXB 1C0FA 1U47A 1T3VA 2JWLA 1Y97A 3BZKA 4JNEA 1DTQA 3QEWA 3NMUA 2Z1JA 1NNEA 1WBBA 4H0OA 2F8TA 5HRNA 1U49A 1TKZA 4WFBL 2VYPA 1MU2A 4CF0A 4NCGA 4CFDA 1ATSA 2RF2A 3D2FB 3M1FA 4R5PA 5J2NA 4JS4A 2VWKA 5HRRA 1K8KB 4DTOA 4O44A 3C7NB 1BDGA 3KTQA 4NO7A 1BHLA 1Q18A 2G8WA 1OVYA 4EAHD 1YF5L 4IWVA 3T1HK 3DRSA 4BVPA 3JYTA 1BISA 2P9SB 2O8DA 4EHTA 4A2BA 1SKWA 5KRTA 4NYFA 1J5OA 4AM6A 4MO5A 1XMOK 1JXEA 3SAFA 3O08A 4CESA 4GKKK 3DYAA 2VG6A 3KWIA 3R1XA 4M3XA 3O9UA 3SUOA 1IBMK 2BH1A 2X78A 4DMNA 4KH6A 1KQSM 3HP6A 3U4LA 2QKKA 3OS1A 3CF5L 2P9LB 3OHRA 3VQEA 2E2PA 4Z4HA 3SUQA 4JAXA 1EETA 4KKOA 2D4WA 4KI6A 3HI0A 5DM6L 2YHAA 3P1GA 1EWQA 2GWJA 3RWUA 3C94A 4KHNA 5DMRA 1K8AO 1ASVA 1IBKK 3LDPA 2HBKA 3F9MA 2BUPA 4ELTA 2HBMA 4MLEA 3ENOA 2E6LA 3O6WA 1L3TA 3E9OA 3O80A 5AZIA 4XIUA 4B3SK 3EYZA 5AQTA 2KZZA 3FZKA 3NHGA 3SQ2A 1UA1A 3IMXA 4BR7A 4U7BA 5AJ3K 4FWMA 2IOCA 4C23A 1EP4A 1HRHA 2F9WA 4CEQA 3ZSOA 2VGMA 3KK1A 1F21A 2IGIA 1X9WA 4LF8K 4C8LA 4JN4A 3BY5A 2P9KA 4DKWA 4CFAA 1RT6A 4LF6K 1YTAA 4PKIA 1TL3A 2LSNA 2W6LA 4RW6A 1OH6A 5GAHP 4DCHA 1HR0K 1J6ZA 4KH5A 3H1QA 2P9NA 1VQLN 1NJIO 1Q7YO 3MXJA 4FVMA 4FM0A 3O9SA 1UOCA 2OPSA 2XHBA 4FJKA 1NMDA 4O8UA 3PV8A 3TSQA 3VGLA 4LY7A 4WE1A 3ZT4A 2E6MA 4FLUA 1LV5A 3HL8A 3V9WA 1KXPA 1BU6O 2JLEA 3K9JA 3W3DA 3UKUB 4F2SA 2KW4A 2IDOA 3QNNA 4B3TK 3CI5A 2DFEA 4DTUA 4CW7B 3I0SA 3SCXA 3AA5X 3LDQA 4B9VA 3TANA 3J8AA 4YDUA 1CXQA 4BRNA 3FR0A 1RDBA 4QS7A 4CERA 1S1WA 4BE1A 4MLHA 4CI6A 3I33A 2Q0UA 2OPRA 1DGKN 4M3YA 1FK9A 1IO2A 3FFIA 3HPGA 3CC2N 1JCEA 2PAVA 1TYQA 1VQNN 1HPMA 5HBMA 4BGBA 1L3VA 1TUYA 1KLNA 4B9NA 1RBUA 1U48A 3O4WA 2VWJA 4HVJA 2D1KA 2HSTA 4WCEL 1IKXA 4KHQA 1IG8A 1W0HA 1V4SA 4JKGA 3MCAB 4M41A 4AQYK 4LF5K 4I6MB 4OPJA 1A5VA 3MN5A 1TKTA 4Z4GA 2I7PA 2B6AA 4GNIA 3R8EA 3O1BA 2HVIA 2OA8A 5GADP 5JVGL 4HTLA 3SMPA 2EHGA 3K5LA 1Q8IA 4FK4A 5AQXA 3K58A 4E0DA 3RR7A 1VAZA 3SUPA 4V19S 1I3AA 4FJJA 1GOBA 4CJKA 2YJEA 2WOMA 4ISFA 2RPIA 3AVFA 4BRAA 2OTJN 4QS8A 3ID6A 2ATQA 4FW1A 4H8KA 4I7FA 5ADXA 5BR8K 1RTIA 3VMFB 5GIOA 4H5TA 3AVHA 1DLOA 1ZBLA 2P9PB 2GUPA 3TABA 1ZYQA 3D2EB 2AA4A 4LSLA 1WN7A 4K43A 3WXJA 4AM7A 4YHHK 4M3RA 5M1KA 4B3OA 4NLCA 1O13A 3AA4A 4ZTJA 1KCFA 4F4KA 3ZSZA 1NGEA 1HKBA 1V4TA 2IVNA 3NF6A 4QOZB 4CE9A 4Z0UA 1KAXA 3T3FA 3NBPA 5AFUH 3ZT1A 4FZZA 3CCLN 3AO5A 3AO2A 3I8BA 1NBWA 5EY4A 2WFBA 2F9TA 3VF2A 4CJ7A 1GLFO 3TAFA 3VGKA 3J80O 1WSGA 3VQBA 3K0SA 2D0AA 3LDLA 3SI6A 4BROA 4CJ4A 3KKRA 3O3FA 1EWRA 1B9FA 3ISNC 4W5QA 3ULEB 2YNFA 3LPUA 1NK0A 3CJAA 2XO7A 2DFFA 2KQ2A 1MWKA 3DLKA 2O4IA 1O1WA 3LAMA 3G0ZA 4FWSA 3KIOA 3PX4A 3TU5A 4AH9A 2H3GX 3CCJN 1TK5A 2CGJA 2NRXA 1M1KO 3LP2A 1HQUA 4KTQA 3RTVA 1J53A 4JK7A 1QQMA 1ZBSA 4XH1A 2V52B 1SL0A 2CGLA 3VGMA 3VQ9A 3VENA 2YNIA 3OYNA 3AA3A 1REVA 4RG8A 3J81O 4C8MA 4LFBK 2YX6A 1BIZA 3VEWA 3LANA 3WT0A 4DF4A 4F3TA 3A5NC 4DV1K 4CHNA 2E88A 3OYBA 2HNZA 5TKYA 2UXDK 4I9QA 4FWKA 2RKIA 1RDDA 3ITHA 2O8DB 1C0UA 1BI4B 5HL7L 4FM2A 1BCOA 3O9QA 3OYKA 3DMJA 2Q36A 3K5OA 1C0TA 4BRDA 1HNXK 4JD2A 3HT3A 3C6UA 3NVKA 2HOEA 3DLLL 4E3SA 3O3GA 4AHUA 4AF1A 1S3XA 1VQ9N 2KFNA 3MMVA 4DSLA 3DLHA 3QINA 4FLTA 4MDAA 2ASMA 1VRUA 3QIPA 3OS0A 3G6EN 4IO8A 3LZIA 1RBTA 5M1QA 1RT5A 3IFRA 3EN9A 1KVBA 1NGIA 3BF1A 4M42A 2UUCK 1RTJA 3K57A 4KO0A 1M90O 5KGXA 3K59A 2HHWA 3OYIA 3ZSYA 3HM9A 3A5MC 4JI8K 5JS1A 3D0PA 1RDWX 4BRIA 3SK3A 4Z4EA 3WNFA 5F1XA 5AFUA 5KQDA 4PL7A 3CHWA 1CZAN 4M3ZA 3WNGA 4B3MK 3TAGA 4FOIA 1ZBUA 4H5VA 1W2BM 3WEEA 1NGCA 4K8ZA 5FROA 2P9KB 5I42A 5LY3A 1X9MA 4BDPA 2DPNA 1NKEA 1KAYA 4DFMA 4Y1CA 1EKEA 1YVUA 4KHYA 2HBJA 3KLHA 2P9NB 1GOCA 4CK2A 3HM8A 3IAYA 2YJFA 2HHTA 2JWKA 5BN8A 4FK0A 4K41A 4DB3A 5GINA 4BG8A 4B9UA 3SPZA 4LC9B 1FJGK 4HCBA 3U9DA 1YIJN 4DSIA 3OYAA 1JLQA 1TV6A 1ZC6A 4JI2K 2P5OA 1BIUA 3KKSA 3MAQA 4DV5K 3OS2A 4CJTA 2F7TA 3DXMA 4OJRA 4HUEA 1T8EA 4B9SA 4IZ9A 4KPYA 1U45A 2YHXA 2VG7A 3MWPA 4B1WB 3L4QA 3QB0A 4JRPA 3RSEA 1RT4A 3IKMA 5CZ2A 2B5JA 4DTNA 4U67L 3B6PA 2FBXA 4LSNA 3F5TA 3G10A 4CK3A 3TAPA 3GG4A 3SYZA 4OPHA 1BA0A 1KFDA 1NK8A 1WSIA 3L0QA 1JLEA 1NMNA 4BDYA 4FPAA 3N4QA 1U2VA 2Q97A 3G25A 4BR2A 4OPKA 3L2WA 4OGEA 4DQSA 3QEIA 4CZFA 3ZX0A 3DXKA 2UXCK 4FWNA 3V9XA 1JXBA 4JKGB 5JMVA 4CHZA 5AQNA 1QQNA 2VWBA 3VPZA 3MX2A 1D4XA 3L2RA 1EQYA 2FF6A 1C1CA 3U6FA 4FJMA 4CK1A 3AA2A 2FSNA 1S1XA 4BQZA 3NH1A 3PO4A 4C8OA 1TAQA 4NXMK 3I56N 1IKWA 2P5GA 4Q5VA 2A1RA 3AY9A 1VK0A 3ZX2A 2E2QA 4Z4CA 3CYMA 3JAMO 5AQGA 1G15A 3ATUA 5EU7A 4KAZA 2GBZA 3ZT2A 4CEEA 2W42A 3OYFA 1JLFA 2E1YA 1XC3A 3SBGA 2OZMA 4CD3A 4ID5A 3ZT3A 4IKFA 2Q1NA 2P1JA 3FZMA 4CEFA 5CYMA 3HK2A 4H0TB 3E01A 1C0MA 1ATRA 4KHUA 1D9FA 2I7NA 3VTHA 4BC2A 4CHYA 3ENBA 3VQPA 1BGXT 3MN9A 4B8AB 3ZEUA 3VEYA 4CGJA 4W5TA 4EFHA 4JKHA 4H0PA 3HSCA 3VEOA 4FLWA 2BDPA 1RBSA 1P90A 3EY1A 3CM6A 2KLAA 4KTWA 2UXBK 1SQKA 4YOXA 3KJVA 3H46O 3MCPA 2HW3A 3T7ZA 2Z1IA 2F96A 5AQRA 1HKGA 3V1QA 3H08A 4DFJA 4F8RA 3CQ8A 3IDHA 4BWMA 1W7AA 1XHZA 1HNWK 4OVLA 3H3NO 4CJFA 3NDKA 1GLBG 1XNQK 1ASUA 1KAZA 4JKCA 3OBYA 1T44A 4KFBA 2GWKA 3H45C 5EVZA 5KQ8A 4O5BA 3CCQN 4F2RA 4NCBA 4ELUA 1NGAA 5FPNA 4XH5A 4E7LA 1EX4A 4JEPA 2HVHA 1JLCA 4B1VA 3NE6A 2ZJPL 4GVMA 2KZMA 4UQGA 4JI3K 2WUSA 3B6OA 2ZJRL 1HQEA 1TL1A 1G99A 1HYZA 1K73O 1RT7A 4K42A 2QA4N 3ULDA 3BZCA 4BWJA 3NVMA 4F3OA 2HHHK 4IOAL 5KPZA 4BRKA 4HCCA 4FSVA 1W9HA 3G71N 1VRTA 1NGJA 4JI5K 1E3MA 4FLYA 1P8ZA 1UA0A 5LJVA 2A40A 4O55A 5ADXH 3A2FA 2JGUA 5B8HA 1NJZA 2QWMA 4OPAA 2Z1HA 3WUHA 2PY5A 1SKSA 5C2FA 1VSMA 4IFEA 4CIEA 1QZ5A 4FK2A 1N8RO 2QXLA 2X6SA 3GOIA 2QWQA 4DF8A 4JI4K 3AVAA 3ZCMA 3FLCO 3WXIA 5AQIA 2FBYA 2NRTA 3WXMB 3QESA 1NWKA 4KRFA 1KD1O 5FPDA 3J7ZO 4GMJB 5KI6A 3W0LA 3AV9A 5F0XA 4CEZA 4PKGA 3QFUA 4PKHA 4PQUA 1HJRA 1WBDA 1NJYA 1Q86O 4CZJA 2V7ZA 3P83D 1RDAA 4CJSA 4NLBA 1N36K 1VSKA 5AR0A 5AZJA 4WQ4A 1NLVA 5LL6Z 3O4NA 1VSLA 2D5RA 3NF9A 3O4QA 2GELA 4KV8A 2QWLA 5AQQA 4J2DA 3VEXA 1GLCG 1U6ZA 1TGOA 5DM7L 2O8FA 1WAJA 4BVOA 1YVNA 3EE8A 2ZM6K 2ZE2A 4A62A 4BC5A 5C12A 3RVCA 2ZD1A 3PIPL 1HYVA 3D7EO 4BR4A 4H03B 1A5XA 4Z4FA 4RW4A 3BF3A 3AVGA 2EX3A 5F2RA 3J7YP 3HPOA 1TK0A 4YDUC 4DQQA 2W41A 1T03A 3CFOA 1T05A 3OW2M 1WSHA 2DFHA 2FC0A 5AQWA 3WEEB 5A2QO 3T69A 4IJAA 3P38A 1RBVA 2YI1A 3AAQA 1N34K 4CJWA 3L8BA 1IV0A 1N33K 2F4VK 3RR8A 3PSFA 3HVRA 5IT9O 1LAWA 1WSFA 1XC9A 4RWTA 1CZ9A 4GVEA 4A61A 2O8CA 4MQ3A 4YOYA 2HMPA 5BN9A 1QVFM 5HRSA 4CVNE 1LOTB 2ASPA 3CCEN 4KTZA 3OBWA 4J2AA 1W97L 4E7IA 2Q31A 3MDQA 1HPZA 3QIOA 5C25A 4IDKA 5CE3A 4UY8O 4X65K 1BA1A 4CEBA 4KHSA 1QHAA 4NB4A 1VQ5N 3MXMA 2YNHA 3RSEB 1LWEA 3ZSQA 2YCHA 4LF9K 3CM5A 2RHKA 3CG7A 3HOTA 4LF4K 2XY5A 2ZGZA 2P9IA 3CD6N 4DUZK 2BGGA 5KPTA 1WOQA 4E19A 1LAVA 1U2VB 2FSKA 4JYAK 1CZBA 4FW2A 3CCSN 4DR2K 5JLHA 4JHDA 4IJNA 1NG9A 2D0OA 3DXKB 4DR6K 3CXCM 3VA0A 3ZETB 3PLAA 5AQUA 3SV3A 3LDNA 3AVIA 2NRWA 5AQOA 3KLFA 3CQYA 5AQJA 1NGDA 3THWA 2NUBA 2VQFK 3OA9A 3QETA 3AVLA 5H1SQ 4ELVA 1NGHA 3CIPA 3A5LC 4RTFD 4IFVA 4O5FA 4EZ6A 3I0RA 3SQ4A 3QBXA 2CH5A 4DTRA 3O8MA 1WB9A 4LD0A 4NCAA 3EO3A 5J2PA 3GDQA 1C1AA 3EKSA 3TAQA 4CGIA 4DQRA 4GV6A 4XH4A 1RTDA 4A5BA 1NU0A 1QQOA 1IKYA 3V81A 1IBLK 1L5UA 2XY8A 4DQIA 3ATVA 5KPRA 2P9LA 2QK9A 4JI7K 1NGGA 4DV6K 1Z25A 4FXDA 5CR4A 1NK9A 3DRRA 1KSPA 4C1NK 3OJUA 1UWBA 2PZSA 4FJNA 3VQ4A 3OVNA 3MEEA 4JKDA 2GEMA 1E4GT 5T7BA 4IEEA 4B1ZA 3LZJA 4O0IA 3PSIA 1Q9XA 3AGRA 4CBUA 4BRGA 1FKPA 3LWMA 5K14A 3RRHA 2IAJA 2E1ZA 1WLJA 3AO3A 3VQDA 4FZXC 3M8RA 1HYSA 1RT2A 2QWRA 3VERA 2ZQBA 4CZHA 3SZ2A 1NJXA 2HBLA 5I9EB 1QQCA 2IIRA 3VEZA 5BPMA 1JLBA 4B1XB 1XQSC 3CCVN 5AQPA 3OYGA 4B1YB 2IS3A 3CJ1A 4HWIA 3S41A 2Q2RA 3E9LA 3SAGA 4I9LA 1GLAG 1VQ7N 4CZEA 4H0VB 2GX9A 1S5JA 3MWTA 4DS5A 4B1UB 4Q0BA 4BDZA 4BQLA 4HTUA 4PUOA 2OCEA 4XEIA 3LAKA 3CFRA 3MN6A 3DOKA 4ILGB 3CPEA 2X74A 3P39A 3SJHA 4DU1A 4DU4A 4DTPA 3PX6A 2A41A 1VSEA 3SAHA 3P5JA 3K2PA 4FO0A 3TARA 4EHUA 3R9PA 3I8DA 3L4IA 3THYA 4H4MA 2CGKA 1S9EA 2NRZA 4YORA 2G8FA 2OANA 4PL8A 5AZIB 5TKWA 3V6DA 2OPPA 4DR3K 2CH6A 4B9TA 4M3UA 2PYLA 4FOEA 2HMIA 1ASWA 5C24A 3M8SA 4KH4A 2G8UA 2EWSA 3IUCA 3QICA 2BTFA 3O1WA 1LCUA 4AHCA 4H5WA 1BO5O 4RCHA 3C0BA 1VSHA 2Q3SA 4BRPA 5BRDA 1Q82O 2P9UA 2OYQA 1S9GA 1LWFA 3J7AP 3WNEA 1EO1A 3ZSVA 4LH4A 2HHUA 4CGFA 1TKXA 3QLHA 1Q81O 4JKBA 1NOYA 4OKEA 1BOTO 5JS2A 2QM1A 1WNSA 2A5XA 1H1VA 4IXCA 2X6NA 1JL1A 3F9KA
chains in the Genus database with same CATH topology
4JI1K 4X65K 1HNXK 4DV4K 4OX9K 4YY3K 2UXBK 1J5EK 2E5LK 4LF9K 5LMNK 4DV3K 2UU9K 1N36K 4DV2K 4DV0K 4LF4K 4B3RK 1I94K 1HNWK 4DR7K 5LL6Z 1XNQK 1IBKK 3J80O 4LFAK 4DUZK 4LFCK 4DV7K 2UUCK 5FLXO 4AQYK 4JYAK 4LF5K 4B3SK 2UXCK 4DR2K 5AJ3K 4DR6K 4JI8K 4K0KK 2ZM6K 5LMUK 4JI3K 2UUBK 4JI0K 4LF8K 4JV5K 3J7YP 4NXMK 2VQFK 4B3MK 4DR4K 4V19S 4DR5K 4LF6K 2HHHK 4GKJK 4DR1K 3JAMO 1HR0K 5A2QO 4JI5K 4LF7K 1XNRK 4DR3K 1N34K 4X64K 4JI6K 1N33K 5BR8K 2F4VK 1HNZK 5IT9O 1IBLK 3J81O 4LFBK 2UUAK 3T1YK 2VQEK 4JI7K 4DV6K 1FJGK 5IWAK 3OTOK 4DV1K 4CVNE 3J7AP 4JI4K 3T1HK 4JI2K 4KHPK 4X62K 4X66K 4B3TK 4YHHK 4CW7B 4DV5K 2UXDK 1XMQK 1N32K 1XMOK 4DUYK 4GKKK 1IBMK 4NXNK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 K;  4X65 K;  1HNX K;  4DV4 K;  4OX9 K;  4YY3 K;  2UXB K;  1J5E K;  2E5L K;  4LF9 K;  5LMN K;  4DV3 K;  2UU9 K;  1N36 K;  4DV2 K;  4DV0 K;  4LF4 K;  4B3R K;  1I94 K;  1HNW K;  4DR7 K;  5LL6 Z;  1XNQ K;  1IBK K;  3J80 O;  4LFA K;  4DUZ K;  4LFC K;  4DV7 K;  2UUC K;  5FLX O;  4AQY K;  4JYA K;  4LF5 K;  4B3S K;  2UXC K;  4DR2 K;  5AJ3 K;  4DR6 K;  4JI8 K;  4K0K K;  2ZM6 K;  5LMU K;  4JI3 K;  2UUB K;  4JI0 K;  4LF8 K;  4JV5 K;  3J7Y P;  4NXM K;  2VQF K;  4B3M K;  4DR4 K;  4V19 S;  4DR5 K;  4LF6 K;  2HHH K;  4GKJ K;  4DR1 K;  3JAM O;  1HR0 K;  5A2Q O;  4JI5 K;  4LF7 K;  1XNR K;  4DR3 K;  1N34 K;  4X64 K;  4JI6 K;  1N33 K;  5BR8 K;  2F4V K;  1HNZ K;  5IT9 O;  1IBL K;  3J81 O;  4LFB K;  2UUA K;  3T1Y K;  2VQE K;  4JI7 K;  4DV6 K;  1FJG K;  5IWA K;  3OTO K;  4DV1 K;  4CVN E;  3J7A P;  4JI4 K;  3T1H K;  4JI2 K;  4KHP K;  4X62 K;  4X66 K;  4B3T K;  4YHH K;  4CW7 B;  4DV5 K;  2UXD K;  1XMQ K;  1N32 K;  1XMO K;  4DUY K;  4GKK K;  1IBM K;  4NXN K; 
#chains in the Genus database with same CATH topology
 2IVP A;  4Y0W A;  2KHO A;  3UB5 A;  2O8B A;  4OX9 K;  1LW0 A;  1ZBF A;  1Z05 A;  4O8K A;  1T6D A;  1YIT N;  2HNY A;  3H1V X;  4FJ5 A;  4CZG A;  4BE0 A;  2BE2 A;  3ZYY X;  4DR7 K;  3ZX3 A;  5FRM A;  1S6P A;  3E66 A;  1QE1 A;  5AZJ B;  4FJ8 A;  2ITG A;  4FJH A;  3QNO A;  4BE2 A;  4ILJ A;  4DS4 A;  3ASM A;  3NGY A;  1XWL A;  3VA3 A;  2W40 A;  4IG3 A;  2ITM A;  2NRV A;  4CBW A;  4CHP A;  3CPW M;  3LP1 A;  3OYM A;  3DLE A;  1TYQ B;  4B9Q A;  1DKG D;  2O8F B;  3O5B A;  2F8S A;  4FWL A;  4DFP A;  4BR5 A;  3SMS A;  3UKR A;  3VF6 A;  4ISE A;  4CJP A;  2WON A;  3DOL A;  4N47 A;  3D2E A;  4IBN A;  4DWI A;  3LM9 A;  1HNV A;  4H0X B;  3L3U A;  2A1S A;  4OKJ A;  4KBO A;  3JS6 A;  4CF1 A;  2R7Y A;  3GBT A;  1QSY A;  2G8H A;  1K9M O;  3NF7 A;  1JCF A;  4E7K A;  3FZF A;  3PX0 A;  1SZ2 A;  1WAF A;  2FXU A;  3V9S A;  4YOV A;  4BR9 A;  3VQA A;  4IOC L;  1HNZ K;  2YKN A;  3CJ7 A;  4G9Z A;  4BY9 C;  4CED A;  2Z1G A;  4FL9 A;  3VOV A;  2V7Y A;  1KTQ A;  2IVO A;  3HZ6 A;  1VQ8 N;  4KRE A;  5GIP A;  4BRC A;  4W5R A;  2O8C B;  5FDL A;  4EP5 A;  4CGD A;  4DU3 A;  2I5J A;  1ZBH A;  1XMQ K;  5C2D A;  1SAZ A;  4QCL A;  3MEC A;  3TAM A;  4FCY A;  3QEP A;  4YFU A;  3AVM A;  1SS6 A;  4AIL C;  3L2V A;  5EXW A;  4E89 A;  2FBT A;  2XRI A;  2FLO A;  2YKM A;  3D6R A;  5AQL A;  4NXN K;  2E8A A;  5BPN A;  1RDU A;  3QBW A;  4FVU A;  3JXU A;  4B8C A;  1BQN A;  4E1N A;  2WBN A;  4A57 A;  1NKB A;  4CZL A;  4PHT X;  5D3G A;  1K6Y A;  3T1A A;  1BWF O;  4ID1 A;  3V4I A;  2A42 A;  3F2K A;  1C1B A;  3AO4 A;  3MN7 A;  5BPL A;  1KVC A;  3OYD A;  4DTJ A;  1NK7 A;  3AO1 A;  1YJW N;  4J2E A;  3E1Y A;  2P9I B;  4E1J A;  4LFC K;  4TSX A;  5FLX O;  1SV5 A;  4CZM A;  5HOO A;  5M1P A;  4KHW A;  5JVH L;  3PO5 A;  3V1R A;  1Y64 A;  3IS9 A;  2NZT A;  4K0K K;  4JHD B;  3S3M A;  2YHB A;  3VQ7 A;  3C6H A;  1ZBI A;  3EZW A;  3TTC A;  2D0P A;  3A8Y A;  1S72 N;  4PWD A;  3E9P A;  1ILY A;  3A5O C;  3VES A;  4CBX A;  4N76 A;  4CIF A;  2ZGY A;  3CC7 N;  3M3Z A;  4BRH A;  1NJW A;  4BAC A;  1X9S A;  3LP3 A;  1BQM A;  4BG9 A;  3SQ1 A;  1T7P A;  4DR4 K;  3N4P A;  3THW B;  1RGI A;  3TWH A;  2OTL N;  4K8X A;  2W6K A;  1OKJ A;  2RE2 A;  5M1N A;  3SPY A;  2YV0 X;  4O0J A;  1S1V A;  4C1N I;  1NKC A;  1DT9 A;  1HNI A;  5E84 A;  4DTM A;  3VQC A;  4OLA A;  1XNR K;  3SBT A;  1OH7 A;  4AHR A;  1SKR A;  4CEA A;  2PFU A;  4FPB A;  1BI4 A;  4JLH A;  4BGA A;  2QEX N;  3MK6 A;  4CEC A;  4GV9 A;  1R0A A;  3BP8 A;  4E7H A;  1CXU A;  3DLR A;  4M7Y A;  2B4J A;  3T1Y K;  1JL2 A;  2VQE K;  3SUN A;  4M7X A;  1QVG M;  3LDS A;  2BAN A;  4H0Y B;  3KZB A;  3DRP A;  4X66 K;  1NM1 A;  4FJ9 A;  4W5N A;  4L3Q A;  5JLF A;  2QKB A;  3C95 A;  4DQ8 A;  3PY8 A;  1UAX A;  1HUX A;  2ASO A;  4CFC A;  2XY7 A;  1YJ9 N;  4J8F A;  3VQ8 A;  4KB0 A;  3GE1 A;  4JS5 A;  5AQK A;  4YOU A;  2KTQ A;  2HHQ A;  3S3N A;  3OJS A;  1OVQ A;  4CF2 A;  3F73 A;  3K9K A;  3ZT0 A;  3QML A;  3AAR A;  2E2N A;  4MFB A;  1HLU A;  2UU9 K;  4YNQ A;  1VSJ A;  4EP4 A;  1JKH A;  4W5O A;  5AQZ A;  3CMA N;  3BUZ B;  4DV2 K;  5GAG P;  3NGI A;  4B3R K;  1HJO A;  1GLD G;  4YOT A;  5C0Y A;  3HTV A;  4N41 A;  3OYJ A;  4BRL A;  4M3T A;  1MWM A;  5BRH A;  1C0G A;  3TAE A;  1KC8 O;  4GW6 A;  3AAP A;  4JD2 B;  3KLG A;  2OPQ A;  2AJQ A;  2V51 B;  3VF4 A;  4RW9 A;  1HMV A;  2HHV A;  1A5W A;  3ZLJ A;  4GV3 A;  1T6C A;  1SL1 A;  3EEQ A;  4AHS A;  4B9M A;  3IRX A;  4CJ3 A;  4DR5 K;  4GY2 B;  3HO1 A;  1S1U A;  1X1P A;  3M8P A;  5GAE P;  4DR1 K;  1QS4 A;  3O3H A;  4IFY A;  3O9T A;  1BCM A;  5HP1 A;  1NK6 A;  3CCU N;  4WYB A;  3THY B;  4LF7 K;  1QSS A;  1YUW A;  4FWR A;  3H3O B;  5KTQ A;  3OY9 A;  4E7J A;  4DG1 A;  1TK8 A;  5BRE A;  3I55 N;  3C6T A;  4CJL A;  2KFZ A;  1D9D A;  3DLG A;  3KD5 E;  4WQ4 C;  2QWN A;  4CCH A;  4FWO A;  1QHT A;  1D8Y A;  4CIG A;  4WF9 L;  5IWA K;  4KB1 A;  3V9U A;  4CFB A;  4JRQ A;  3BGR A;  3ALY A;  1YI2 N;  4BRM A;  3IG1 A;  1N6Q A;  3OYH A;  4BC3 A;  2P9U B;  3P4I A;  1VQP N;  2IC3 A;  1N32 K;  4DTX A;  3AVN A;  1LW2 A;  3KD1 E;  1FKO A;  4OLB A;  5AQM A;  1TVR A;  2HF3 A;  3LM2 A;  1FXX A;  2PYJ A;  4BRQ A;  1ITG A;  2O8E A;  5KGW A;  5KRS A;  4DV4 K;  3D45 A;  3ENH A;  5ELZ A;  4Y1D A;  2O8B B;  1WUA A;  3NAE A;  2E5L K;  2A3Z A;  1KVA A;  3HXM A;  3AGK A;  4OO1 J;  4CJU A;  1L3S A;  4CZI A;  5J1E A;  3U9Z A;  1RNH A;  3FE1 A;  3DXM B;  4O4G A;  2ZF5 O;  2Y1I A;  4N5S A;  3AVK A;  5CY4 A;  1J9A A;  4MO4 A;  2NNW A;  4A5A A;  3C65 A;  3EKU A;  4KI4 A;  4ZHR A;  1OH5 A;  3OYE A;  2KKZ A;  1BL3 A;  1ESV A;  1TUU A;  5LJW A;  1WSE A;  2NRR A;  5E41 A;  3MEG A;  3V1O A;  4FLZ A;  2UUB K;  4JI0 K;  5FPE A;  1SL2 A;  1I39 A;  3SQ0 A;  3KVG A;  1RBR A;  2RN2 A;  4DQP A;  1JJ2 M;  1VQK N;  1ZXO A;  3UKR B;  3VQ5 A;  4DSE A;  4FJL A;  1Q9Y A;  3THX A;  4ICL A;  3TSP A;  1S1T A;  2G8K A;  2HHX A;  2Y1J A;  5EX5 A;  4R79 A;  3CJ9 A;  3CC4 N;  3D2F A;  5J2M A;  3FZH A;  3O9R A;  4JI6 K;  3K5N A;  3L3V A;  1K8K A;  4BC4 A;  3M8Q A;  5SZT A;  1XUP O;  3C7N A;  3U3G A;  2WTU A;  3CCM N;  3DI6 A;  3HPH A;  2VG5 A;  3WNH A;  3CJC A;  4RW7 A;  3T19 A;  1WSJ A;  1RCH A;  3OTO K;  4FLV A;  4MDB A;  2P9S A;  4CD1 A;  3QDK A;  5BR9 A;  4X62 K;  1U04 A;  3PIO L;  4EIA A;  3CJB A;  3FFK B;  4M3W A;  3DAW A;  3KHY A;  1XI1 A;  1VSI A;  2G8V A;  1Z26 A;  3SNN A;  3M5R A;  4CJR A;  3HVT A;  3PUF A;  2ETJ A;  3QER A;  3EL2 A;  2A6A A;  4A59 A;  3KK2 A;  3SJJ A;  3A0I X;  1XHX A;  4DV3 K;  5CHI A;  4JK8 A;  4JKE A;  5EOY A;  5M1O A;  3VET A;  1BG3 A;  4Z4I A;  4B9L A;  4IDH A;  5I3U A;  2YHW A;  4DTS A;  4M45 A;  4JKF A;  3MXI A;  3ZEU B;  4DV7 K;  4IO9 L;  4L8R B;  3MED A;  3NCI A;  3HRG A;  4IG0 A;  3CME N;  3RMA A;  3MX5 A;  3TTF A;  3RRG A;  2QXF A;  1KFS A;  1DEJ A;  1X3N A;  3LWL A;  4EZ9 A;  2YHY A;  3HOS A;  5AQH A;  1MDU B;  5LMU K;  3HP9 A;  3L2U A;  2QWO A;  2UYT A;  3B8A X;  5MLC Q;  4FJ7 A;  4BRE A;  3RMB A;  2P51 A;  1OH8 A;  3V9Z A;  3LL3 A;  3VQ6 A;  1YJN N;  1NGB A;  1NOZ A;  3TR8 A;  5J2Q A;  3QO9 A;  1RTH A;  2QI2 A;  2XY6 A;  2WC9 A;  4H5R A;  5HRO A;  1L3U A;  3LDO A;  1E4F T;  1VQO N;  2GUI A;  3M6G A;  3NH2 A;  1IH7 A;  2FSJ A;  2E4L A;  4PA1 A;  1YT3 A;  3R3L A;  2FBV A;  4DLE A;  1YXQ A;  3NF8 A;  2UUA K;  4FWQ A;  2D0C A;  3KK7 A;  3P31 A;  4BR0 A;  3CFP A;  4HUG A;  3UKU A;  5AQS A;  1TKD A;  3NH0 A;  3QFP A;  1B9D A;  4KHP K;  1R59 O;  1EXQ A;  3S9H A;  1IG9 A;  3C6A A;  1JLA A;  4DHY A;  1VSF A;  3OYC A;  3VEV A;  4WFA L;  4J2B A;  4FYD A;  4M63 C;  4FM1 A;  4YOW A;  3FZL A;  5HRP A;  1IKV A;  3NGZ A;  2OZS A;  4H5N A;  4AHV A;  3U3Y A;  3TI0 A;  3Q7B A;  4DSJ A;  3THV A;  3BDP A;  4YY3 K;  1TAU A;  3FGU A;  3UIQ A;  4Z94 A;  4JK9 A;  2O4G A;  1RFQ A;  2HF4 A;  3TPQ A;  3UE5 A;  4DV0 K;  5SWM A;  3NFA A;  4FWP A;  1GLJ O;  3KLE A;  1BUP A;  3HBT A;  4NYN A;  2Q0R A;  5CZ1 A;  4C8N A;  1N5Y A;  1DTT A;  3ZSW A;  4LFA K;  2HB5 A;  2ZWH A;  1VQ4 N;  4I6M A;  2NRH A;  3Q7C A;  4ILH A;  3EZ5 A;  1YHQ N;  1JCG A;  4ISG A;  5C15 A;  4HHT A;  3HST B;  4H4O A;  4I2Q A;  3AVC A;  4RW8 A;  3L6Q A;  3WQU A;  1S6Q A;  3RMC A;  4OKK A;  4A2A A;  3VTI A;  3L2Q A;  5AQF A;  3SV4 A;  1QTM A;  2QW9 A;  1VQ6 N;  1X9J A;  3LAL A;  1C6V A;  2VGN A;  1GOA A;  1RDC A;  3CET A;  4CHQ A;  5M1F A;  2QWP A;  1QSL A;  5AQY A;  4QS9 A;  4WFN L;  1VQM N;  3HJF A;  3DLB A;  2HHS A;  3CCR N;  5C42 A;  3QEX A;  1IJJ A;  3U8X A;  4ZTF A;  4IEI A;  2VCP A;  5AQV A;  3WXL A;  5BRF A;  4IOX A;  2D0B A;  1LWC A;  3VQQ A;  4X64 K;  1RIL A;  1KRP A;  4AHT A;  3GL1 A;  3LPT A;  3G4S N;  2P9P A;  4FJG A;  3WXK A;  4BRF A;  4DSF A;  1VSD A;  2YNG A;  4CGG A;  1ATN A;  4CGH A;  2GV9 A;  1YAG A;  5FRN A;  2NLX A;  3TTD A;  1KLM A;  5JIC A;  1SUQ A;  3AVJ A;  4WQ5 A;  4CJQ A;  5FPM A;  2PBD A;  1RT3 A;  1GLE G;  4B08 A;  4CF9 A;  5HLF A;  3JSM A;  3HYF A;  2AP1 A;  2DTU A;  4DUY K;  1RT1 A;  1Z6R A;  1QZ6 A;  4JI1 K;  4CF8 A;  4FLX A;  4CHO A;  2FF3 B;  3ID8 A;  2E2O A;  3ZET A;  3QEV A;  4LH5 A;  4K25 A;  1YTU A;  2O8E B;  3CER A;  4N56 A;  1J5E K;  5LMN K;  3R6M A;  4HUF A;  3H6E A;  2HND A;  4WQ5 C;  1NK5 A;  4C8K A;  1J54 A;  3LP0 A;  4QAG A;  3RMD A;  1I94 K;  4F9O A;  2DY4 A;  3KWG A;  2GTD A;  2QTD A;  3DWL A;  4I2P A;  3K5M A;  4CJ5 A;  3S3O A;  1FW6 A;  3SLC A;  5DK5 A;  3CQX A;  3KK3 A;  4JKA A;  1GLL O;  1MA9 B;  2G8I A;  4CEO A;  4DSK A;  3EE9 A;  3BEX A;  3TSU A;  3ZSR A;  1HKC A;  3ULE A;  3DM2 A;  4CJE A;  3OYL A;  4DFK A;  1D5A A;  1VHX A;  4PY5 A;  4CZK A;  3AVB A;  1CLQ A;  3VN5 A;  4CJV A;  1U4B A;  1HX1 A;  4OGC A;  4FJI A;  1S22 A;  1NGF A;  1X3M A;  4G1Q A;  4DLG A;  5C10 A;  3KLI A;  1NK4 A;  5E26 A;  3DJC A;  4JV5 K;  1JLG A;  4E1M A;  3ZSX A;  5CYQ A;  4FJX A;  3WQT A;  2E20 A;  2J4R A;  2ZJQ L;  4GKJ K;  1B92 A;  4FZY A;  3THX B;  1C0F A;  1U47 A;  1T3V A;  2JWL A;  1Y97 A;  3BZK A;  4JNE A;  1DTQ A;  3QEW A;  3NMU A;  2Z1J A;  1NNE A;  1WBB A;  4H0O A;  2F8T A;  5HRN A;  1U49 A;  1TKZ A;  4WFB L;  2VYP A;  1MU2 A;  4CF0 A;  4NCG A;  4CFD A;  1ATS A;  2RF2 A;  3D2F B;  3M1F A;  4R5P A;  5J2N A;  4JS4 A;  2VWK A;  5HRR A;  1K8K B;  4DTO A;  4O44 A;  3C7N B;  1BDG A;  3KTQ A;  4NO7 A;  1BHL A;  1Q18 A;  2G8W A;  1OVY A;  4EAH D;  1YF5 L;  4IWV A;  3T1H K;  3DRS A;  4BVP A;  3JYT A;  1BIS A;  2P9S B;  2O8D A;  4EHT A;  4A2B A;  1SKW A;  5KRT A;  4NYF A;  1J5O A;  4AM6 A;  4MO5 A;  1XMO K;  1JXE A;  3SAF A;  3O08 A;  4CES A;  4GKK K;  3DYA A;  2VG6 A;  3KWI A;  3R1X A;  4M3X A;  3O9U A;  3SUO A;  1IBM K;  2BH1 A;  2X78 A;  4DMN A;  4KH6 A;  1KQS M;  3HP6 A;  3U4L A;  2QKK A;  3OS1 A;  3CF5 L;  2P9L B;  3OHR A;  3VQE A;  2E2P A;  4Z4H A;  3SUQ A;  4JAX A;  1EET A;  4KKO A;  2D4W A;  4KI6 A;  3HI0 A;  5DM6 L;  2YHA A;  3P1G A;  1EWQ A;  2GWJ A;  3RWU A;  3C94 A;  4KHN A;  5DMR A;  1K8A O;  1ASV A;  1IBK K;  3LDP A;  2HBK A;  3F9M A;  2BUP A;  4ELT A;  2HBM A;  4MLE A;  3ENO A;  2E6L A;  3O6W A;  1L3T A;  3E9O A;  3O80 A;  5AZI A;  4XIU A;  4B3S K;  3EYZ A;  5AQT A;  2KZZ A;  3FZK A;  3NHG A;  3SQ2 A;  1UA1 A;  3IMX A;  4BR7 A;  4U7B A;  5AJ3 K;  4FWM A;  2IOC A;  4C23 A;  1EP4 A;  1HRH A;  2F9W A;  4CEQ A;  3ZSO A;  2VGM A;  3KK1 A;  1F21 A;  2IGI A;  1X9W A;  4LF8 K;  4C8L A;  4JN4 A;  3BY5 A;  2P9K A;  4DKW A;  4CFA A;  1RT6 A;  4LF6 K;  1YTA A;  4PKI A;  1TL3 A;  2LSN A;  2W6L A;  4RW6 A;  1OH6 A;  5GAH P;  4DCH A;  1HR0 K;  1J6Z A;  4KH5 A;  3H1Q A;  2P9N A;  1VQL N;  1NJI O;  1Q7Y O;  3MXJ A;  4FVM A;  4FM0 A;  3O9S A;  1UOC A;  2OPS A;  2XHB A;  4FJK A;  1NMD A;  4O8U A;  3PV8 A;  3TSQ A;  3VGL A;  4LY7 A;  4WE1 A;  3ZT4 A;  2E6M A;  4FLU A;  1LV5 A;  3HL8 A;  3V9W A;  1KXP A;  1BU6 O;  2JLE A;  3K9J A;  3W3D A;  3UKU B;  4F2S A;  2KW4 A;  2IDO A;  3QNN A;  4B3T K;  3CI5 A;  2DFE A;  4DTU A;  4CW7 B;  3I0S A;  3SCX A;  3AA5 X;  3LDQ A;  4B9V A;  3TAN A;  3J8A A;  4YDU A;  1CXQ A;  4BRN A;  3FR0 A;  1RDB A;  4QS7 A;  4CER A;  1S1W A;  4BE1 A;  4MLH A;  4CI6 A;  3I33 A;  2Q0U A;  2OPR A;  1DGK N;  4M3Y A;  1FK9 A;  1IO2 A;  3FFI A;  3HPG A;  3CC2 N;  1JCE A;  2PAV A;  1TYQ A;  1VQN N;  1HPM A;  5HBM A;  4BGB A;  1L3V A;  1TUY A;  1KLN A;  4B9N A;  1RBU A;  1U48 A;  3O4W A;  2VWJ A;  4HVJ A;  2D1K A;  2HST A;  4WCE L;  1IKX A;  4KHQ A;  1IG8 A;  1W0H A;  1V4S A;  4JKG A;  3MCA B;  4M41 A;  4AQY K;  4LF5 K;  4I6M B;  4OPJ A;  1A5V A;  3MN5 A;  1TKT A;  4Z4G A;  2I7P A;  2B6A A;  4GNI A;  3R8E A;  3O1B A;  2HVI A;  2OA8 A;  5GAD P;  5JVG L;  4HTL A;  3SMP A;  2EHG A;  3K5L A;  1Q8I A;  4FK4 A;  5AQX A;  3K58 A;  4E0D A;  3RR7 A;  1VAZ A;  3SUP A;  4V19 S;  1I3A A;  4FJJ A;  1GOB A;  4CJK A;  2YJE A;  2WOM A;  4ISF A;  2RPI A;  3AVF A;  4BRA A;  2OTJ N;  4QS8 A;  3ID6 A;  2ATQ A;  4FW1 A;  4H8K A;  4I7F A;  5ADX A;  5BR8 K;  1RTI A;  3VMF B;  5GIO A;  4H5T A;  3AVH A;  1DLO A;  1ZBL A;  2P9P B;  2GUP A;  3TAB A;  1ZYQ A;  3D2E B;  2AA4 A;  4LSL A;  1WN7 A;  4K43 A;  3WXJ A;  4AM7 A;  4YHH K;  4M3R A;  5M1K A;  4B3O A;  4NLC A;  1O13 A;  3AA4 A;  4ZTJ A;  1KCF A;  4F4K A;  3ZSZ A;  1NGE A;  1HKB A;  1V4T A;  2IVN A;  3NF6 A;  4QOZ B;  4CE9 A;  4Z0U A;  1KAX A;  3T3F A;  3NBP A;  5AFU H;  3ZT1 A;  4FZZ A;  3CCL N;  3AO5 A;  3AO2 A;  3I8B A;  1NBW A;  5EY4 A;  2WFB A;  2F9T A;  3VF2 A;  4CJ7 A;  1GLF O;  3TAF A;  3VGK A;  3J80 O;  1WSG A;  3VQB A;  3K0S A;  2D0A A;  3LDL A;  3SI6 A;  4BRO A;  4CJ4 A;  3KKR A;  3O3F A;  1EWR A;  1B9F A;  3ISN C;  4W5Q A;  3ULE B;  2YNF A;  3LPU A;  1NK0 A;  3CJA A;  2XO7 A;  2DFF A;  2KQ2 A;  1MWK A;  3DLK A;  2O4I A;  1O1W A;  3LAM A;  3G0Z A;  4FWS A;  3KIO A;  3PX4 A;  3TU5 A;  4AH9 A;  2H3G X;  3CCJ N;  1TK5 A;  2CGJ A;  2NRX A;  1M1K O;  3LP2 A;  1HQU A;  4KTQ A;  3RTV A;  1J53 A;  4JK7 A;  1QQM A;  1ZBS A;  4XH1 A;  2V52 B;  1SL0 A;  2CGL A;  3VGM A;  3VQ9 A;  3VEN A;  2YNI A;  3OYN A;  3AA3 A;  1REV A;  4RG8 A;  3J81 O;  4C8M A;  4LFB K;  2YX6 A;  1BIZ A;  3VEW A;  3LAN A;  3WT0 A;  4DF4 A;  4F3T A;  3A5N C;  4DV1 K;  4CHN A;  2E88 A;  3OYB A;  2HNZ A;  5TKY A;  2UXD K;  4I9Q A;  4FWK A;  2RKI A;  1RDD A;  3ITH A;  2O8D B;  1C0U A;  1BI4 B;  5HL7 L;  4FM2 A;  1BCO A;  3O9Q A;  3OYK A;  3DMJ A;  2Q36 A;  3K5O A;  1C0T A;  4BRD A;  1HNX K;  4JD2 A;  3HT3 A;  3C6U A;  3NVK A;  2HOE A;  3DLL L;  4E3S A;  3O3G A;  4AHU A;  4AF1 A;  1S3X A;  1VQ9 N;  2KFN A;  3MMV A;  4DSL A;  3DLH A;  3QIN A;  4FLT A;  4MDA A;  2ASM A;  1VRU A;  3QIP A;  3OS0 A;  3G6E N;  4IO8 A;  3LZI A;  1RBT A;  5M1Q A;  1RT5 A;  3IFR A;  3EN9 A;  1KVB A;  1NGI A;  3BF1 A;  4M42 A;  2UUC K;  1RTJ A;  3K57 A;  4KO0 A;  1M90 O;  5KGX A;  3K59 A;  2HHW A;  3OYI A;  3ZSY A;  3HM9 A;  3A5M C;  4JI8 K;  5JS1 A;  3D0P A;  1RDW X;  4BRI A;  3SK3 A;  4Z4E A;  3WNF A;  5F1X A;  5AFU A;  5KQD A;  4PL7 A;  3CHW A;  1CZA N;  4M3Z A;  3WNG A;  4B3M K;  3TAG A;  4FOI A;  1ZBU A;  4H5V A;  1W2B M;  3WEE A;  1NGC A;  4K8Z A;  5FRO A;  2P9K B;  5I42 A;  5LY3 A;  1X9M A;  4BDP A;  2DPN A;  1NKE A;  1KAY A;  4DFM A;  4Y1C A;  1EKE A;  1YVU A;  4KHY A;  2HBJ A;  3KLH A;  2P9N B;  1GOC A;  4CK2 A;  3HM8 A;  3IAY A;  2YJF A;  2HHT A;  2JWK A;  5BN8 A;  4FK0 A;  4K41 A;  4DB3 A;  5GIN A;  4BG8 A;  4B9U A;  3SPZ A;  4LC9 B;  1FJG K;  4HCB A;  3U9D A;  1YIJ N;  4DSI A;  3OYA A;  1JLQ A;  1TV6 A;  1ZC6 A;  4JI2 K;  2P5O A;  1BIU A;  3KKS A;  3MAQ A;  4DV5 K;  3OS2 A;  4CJT A;  2F7T A;  3DXM A;  4OJR A;  4HUE A;  1T8E A;  4B9S A;  4IZ9 A;  4KPY A;  1U45 A;  2YHX A;  2VG7 A;  3MWP A;  4B1W B;  3L4Q A;  3QB0 A;  4JRP A;  3RSE A;  1RT4 A;  3IKM A;  5CZ2 A;  2B5J A;  4DTN A;  4U67 L;  3B6P A;  2FBX A;  4LSN A;  3F5T A;  3G10 A;  4CK3 A;  3TAP A;  3GG4 A;  3SYZ A;  4OPH A;  1BA0 A;  1KFD A;  1NK8 A;  1WSI A;  3L0Q A;  1JLE A;  1NMN A;  4BDY A;  4FPA A;  3N4Q A;  1U2V A;  2Q97 A;  3G25 A;  4BR2 A;  4OPK A;  3L2W A;  4OGE A;  4DQS A;  3QEI A;  4CZF A;  3ZX0 A;  3DXK A;  2UXC K;  4FWN A;  3V9X A;  1JXB A;  4JKG B;  5JMV A;  4CHZ A;  5AQN A;  1QQN A;  2VWB A;  3VPZ A;  3MX2 A;  1D4X A;  3L2R A;  1EQY A;  2FF6 A;  1C1C A;  3U6F A;  4FJM A;  4CK1 A;  3AA2 A;  2FSN A;  1S1X A;  4BQZ A;  3NH1 A;  3PO4 A;  4C8O A;  1TAQ A;  4NXM K;  3I56 N;  1IKW A;  2P5G A;  4Q5V A;  2A1R A;  3AY9 A;  1VK0 A;  3ZX2 A;  2E2Q A;  4Z4C A;  3CYM A;  3JAM O;  5AQG A;  1G15 A;  3ATU A;  5EU7 A;  4KAZ A;  2GBZ A;  3ZT2 A;  4CEE A;  2W42 A;  3OYF A;  1JLF A;  2E1Y A;  1XC3 A;  3SBG A;  2OZM A;  4CD3 A;  4ID5 A;  3ZT3 A;  4IKF A;  2Q1N A;  2P1J A;  3FZM A;  4CEF A;  5CYM A;  3HK2 A;  4H0T B;  3E01 A;  1C0M A;  1ATR A;  4KHU A;  1D9F A;  2I7N A;  3VTH A;  4BC2 A;  4CHY A;  3ENB A;  3VQP A;  1BGX T;  3MN9 A;  4B8A B;  3ZEU A;  3VEY A;  4CGJ A;  4W5T A;  4EFH A;  4JKH A;  4H0P A;  3HSC A;  3VEO A;  4FLW A;  2BDP A;  1RBS A;  1P90 A;  3EY1 A;  3CM6 A;  2KLA A;  4KTW A;  2UXB K;  1SQK A;  4YOX A;  3KJV A;  3H46 O;  3MCP A;  2HW3 A;  3T7Z A;  2Z1I A;  2F96 A;  5AQR A;  1HKG A;  3V1Q A;  3H08 A;  4DFJ A;  4F8R A;  3CQ8 A;  3IDH A;  4BWM A;  1W7A A;  1XHZ A;  1HNW K;  4OVL A;  3H3N O;  4CJF A;  3NDK A;  1GLB G;  1XNQ K;  1ASU A;  1KAZ A;  4JKC A;  3OBY A;  1T44 A;  4KFB A;  2GWK A;  3H45 C;  5EVZ A;  5KQ8 A;  4O5B A;  3CCQ N;  4F2R A;  4NCB A;  4ELU A;  1NGA A;  5FPN A;  4XH5 A;  4E7L A;  1EX4 A;  4JEP A;  2HVH A;  1JLC A;  4B1V A;  3NE6 A;  2ZJP L;  4GVM A;  2KZM A;  4UQG A;  4JI3 K;  2WUS A;  3B6O A;  2ZJR L;  1HQE A;  1TL1 A;  1G99 A;  1HYZ A;  1K73 O;  1RT7 A;  4K42 A;  2QA4 N;  3ULD A;  3BZC A;  4BWJ A;  3NVM A;  4F3O A;  2HHH K;  4IOA L;  5KPZ A;  4BRK A;  4HCC A;  4FSV A;  1W9H A;  3G71 N;  1VRT A;  1NGJ A;  4JI5 K;  1E3M A;  4FLY A;  1P8Z A;  1UA0 A;  5LJV A;  2A40 A;  4O55 A;  5ADX H;  3A2F A;  2JGU A;  5B8H A;  1NJZ A;  2QWM A;  4OPA A;  2Z1H A;  3WUH A;  2PY5 A;  1SKS A;  5C2F A;  1VSM A;  4IFE A;  4CIE A;  1QZ5 A;  4FK2 A;  1N8R O;  2QXL A;  2X6S A;  3GOI A;  2QWQ A;  4DF8 A;  4JI4 K;  3AVA A;  3ZCM A;  3FLC O;  3WXI A;  5AQI A;  2FBY A;  2NRT A;  3WXM B;  3QES A;  1NWK A;  4KRF A;  1KD1 O;  5FPD A;  3J7Z O;  4GMJ B;  5KI6 A;  3W0L A;  3AV9 A;  5F0X A;  4CEZ A;  4PKG A;  3QFU A;  4PKH A;  4PQU A;  1HJR A;  1WBD A;  1NJY A;  1Q86 O;  4CZJ A;  2V7Z A;  3P83 D;  1RDA A;  4CJS A;  4NLB A;  1N36 K;  1VSK A;  5AR0 A;  5AZJ A;  4WQ4 A;  1NLV A;  5LL6 Z;  3O4N A;  1VSL A;  2D5R A;  3NF9 A;  3O4Q A;  2GEL A;  4KV8 A;  2QWL A;  5AQQ A;  4J2D A;  3VEX A;  1GLC G;  1U6Z A;  1TGO A;  5DM7 L;  2O8F A;  1WAJ A;  4BVO A;  1YVN A;  3EE8 A;  2ZM6 K;  2ZE2 A;  4A62 A;  4BC5 A;  5C12 A;  3RVC A;  2ZD1 A;  3PIP L;  1HYV A;  3D7E O;  4BR4 A;  4H03 B;  1A5X A;  4Z4F A;  4RW4 A;  3BF3 A;  3AVG A;  2EX3 A;  5F2R A;  3J7Y P;  3HPO A;  1TK0 A;  4YDU C;  4DQQ A;  2W41 A;  1T03 A;  3CFO A;  1T05 A;  3OW2 M;  1WSH A;  2DFH A;  2FC0 A;  5AQW A;  3WEE B;  5A2Q O;  3T69 A;  4IJA A;  3P38 A;  1RBV A;  2YI1 A;  3AAQ A;  1N34 K;  4CJW A;  3L8B A;  1IV0 A;  1N33 K;  2F4V K;  3RR8 A;  3PSF A;  3HVR A;  5IT9 O;  1LAW A;  1WSF A;  1XC9 A;  4RWT A;  1CZ9 A;  4GVE A;  4A61 A;  2O8C A;  4MQ3 A;  4YOY A;  2HMP A;  5BN9 A;  1QVF M;  5HRS A;  4CVN E;  1LOT B;  2ASP A;  3CCE N;  4KTZ A;  3OBW A;  4J2A A;  1W97 L;  4E7I A;  2Q31 A;  3MDQ A;  1HPZ A;  3QIO A;  5C25 A;  4IDK A;  5CE3 A;  4UY8 O;  4X65 K;  1BA1 A;  4CEB A;  4KHS A;  1QHA A;  4NB4 A;  1VQ5 N;  3MXM A;  2YNH A;  3RSE B;  1LWE A;  3ZSQ A;  2YCH A;  4LF9 K;  3CM5 A;  2RHK A;  3CG7 A;  3HOT A;  4LF4 K;  2XY5 A;  2ZGZ A;  2P9I A;  3CD6 N;  4DUZ K;  2BGG A;  5KPT A;  1WOQ A;  4E19 A;  1LAV A;  1U2V B;  2FSK A;  4JYA K;  1CZB A;  4FW2 A;  3CCS N;  4DR2 K;  5JLH A;  4JHD A;  4IJN A;  1NG9 A;  2D0O A;  3DXK B;  4DR6 K;  3CXC M;  3VA0 A;  3ZET B;  3PLA A;  5AQU A;  3SV3 A;  3LDN A;  3AVI A;  2NRW A;  5AQO A;  3KLF A;  3CQY A;  5AQJ A;  1NGD A;  3THW A;  2NUB A;  2VQF K;  3OA9 A;  3QET A;  3AVL A;  5H1S Q;  4ELV A;  1NGH A;  3CIP A;  3A5L C;  4RTF D;  4IFV A;  4O5F A;  4EZ6 A;  3I0R A;  3SQ4 A;  3QBX A;  2CH5 A;  4DTR A;  3O8M A;  1WB9 A;  4LD0 A;  4NCA A;  3EO3 A;  5J2P A;  3GDQ A;  1C1A A;  3EKS A;  3TAQ A;  4CGI A;  4DQR A;  4GV6 A;  4XH4 A;  1RTD A;  4A5B A;  1NU0 A;  1QQO A;  1IKY A;  3V81 A;  1IBL K;  1L5U A;  2XY8 A;  4DQI A;  3ATV A;  5KPR A;  2P9L A;  2QK9 A;  4JI7 K;  1NGG A;  4DV6 K;  1Z25 A;  4FXD A;  5CR4 A;  1NK9 A;  3DRR A;  1KSP A;  4C1N K;  3OJU A;  1UWB A;  2PZS A;  4FJN A;  3VQ4 A;  3OVN A;  3MEE A;  4JKD A;  2GEM A;  1E4G T;  5T7B A;  4IEE A;  4B1Z A;  3LZJ A;  4O0I A;  3PSI A;  1Q9X A;  3AGR A;  4CBU A;  4BRG A;  1FKP A;  3LWM A;  5K14 A;  3RRH A;  2IAJ A;  2E1Z A;  1WLJ A;  3AO3 A;  3VQD A;  4FZX C;  3M8R A;  1HYS A;  1RT2 A;  2QWR A;  3VER A;  2ZQB A;  4CZH A;  3SZ2 A;  1NJX A;  2HBL A;  5I9E B;  1QQC A;  2IIR A;  3VEZ A;  5BPM A;  1JLB A;  4B1X B;  1XQS C;  3CCV N;  5AQP A;  3OYG A;  4B1Y B;  2IS3 A;  3CJ1 A;  4HWI A;  3S41 A;  2Q2R A;  3E9L A;  3SAG A;  4I9L A;  1GLA G;  1VQ7 N;  4CZE A;  4H0V B;  2GX9 A;  1S5J A;  3MWT A;  4DS5 A;  4B1U B;  4Q0B A;  4BDZ A;  4BQL A;  4HTU A;  4PUO A;  2OCE A;  4XEI A;  3LAK A;  3CFR A;  3MN6 A;  3DOK A;  4ILG B;  3CPE A;  2X74 A;  3P39 A;  3SJH A;  4DU1 A;  4DU4 A;  4DTP A;  3PX6 A;  2A41 A;  1VSE A;  3SAH A;  3P5J A;  3K2P A;  4FO0 A;  3TAR A;  4EHU A;  3R9P A;  3I8D A;  3L4I A;  3THY A;  4H4M A;  2CGK A;  1S9E A;  2NRZ A;  4YOR A;  2G8F A;  2OAN A;  4PL8 A;  5AZI B;  5TKW A;  3V6D A;  2OPP A;  4DR3 K;  2CH6 A;  4B9T A;  4M3U A;  2PYL A;  4FOE A;  2HMI A;  1ASW A;  5C24 A;  3M8S A;  4KH4 A;  2G8U A;  2EWS A;  3IUC A;  3QIC A;  2BTF A;  3O1W A;  1LCU A;  4AHC A;  4H5W A;  1BO5 O;  4RCH A;  3C0B A;  1VSH A;  2Q3S A;  4BRP A;  5BRD A;  1Q82 O;  2P9U A;  2OYQ A;  1S9G A;  1LWF A;  3J7A P;  3WNE A;  1EO1 A;  3ZSV A;  4LH4 A;  2HHU A;  4CGF A;  1TKX A;  3QLH A;  1Q81 O;  4JKB A;  1NOY A;  4OKE A;  1BOT O;  5JS2 A;  2QM1 A;  1WNS A;  2A5X A;  1H1V A;  4IXC A;  2X6N A;  1JL1 A;  3F9K A; 
#chains in the Genus database with same CATH homology
 4JI1 K;  4X65 K;  1HNX K;  4DV4 K;  4OX9 K;  4YY3 K;  2UXB K;  1J5E K;  2E5L K;  4LF9 K;  5LMN K;  4DV3 K;  2UU9 K;  1N36 K;  4DV2 K;  4DV0 K;  4LF4 K;  4B3R K;  1I94 K;  1HNW K;  4DR7 K;  5LL6 Z;  1XNQ K;  1IBK K;  3J80 O;  4LFA K;  4DUZ K;  4LFC K;  4DV7 K;  2UUC K;  5FLX O;  4AQY K;  4JYA K;  4LF5 K;  4B3S K;  2UXC K;  4DR2 K;  5AJ3 K;  4DR6 K;  4JI8 K;  4K0K K;  2ZM6 K;  5LMU K;  4JI3 K;  2UUB K;  4JI0 K;  4LF8 K;  4JV5 K;  3J7Y P;  4NXM K;  2VQF K;  4B3M K;  4DR4 K;  4V19 S;  4DR5 K;  4LF6 K;  2HHH K;  4GKJ K;  4DR1 K;  3JAM O;  1HR0 K;  5A2Q O;  4JI5 K;  4LF7 K;  1XNR K;  4DR3 K;  1N34 K;  4X64 K;  4JI6 K;  1N33 K;  5BR8 K;  2F4V K;  1HNZ K;  5IT9 O;  1IBL K;  3J81 O;  4LFB K;  2UUA K;  3T1Y K;  2VQE K;  4JI7 K;  4DV6 K;  1FJG K;  5IWA K;  3OTO K;  4DV1 K;  4CVN E;  3J7A P;  4JI4 K;  3T1H K;  4JI2 K;  4KHP K;  4X62 K;  4X66 K;  4B3T K;  4YHH K;  4CW7 B;  4DV5 K;  2UXD K;  1XMQ K;  1N32 K;  1XMO K;  4DUY K;  4GKK K;  1IBM K;  4NXN K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...