2UUCK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2uucK00
1N34K 4NXMK 4LF9K 4GKJK 4JI8K 4JV5K 4X64K 1XNQK 4DR7K 2VQEK 1IBKK 5IT9O 3OTOK 1IBMK 4JI1K 3T1YK 4DUYK 4B3TK 1HNZK 4DV6K 2E5LK 4X65K 2UXCK 4DR6K 2ZM6K 2UUBK 2UU9K 3J7YP 2UXBK 4V19S 4DV0K 4DR3K 4CW7B 1XNRK 4JYAK 5A2QO 4DV1K 4DR1K 4JI6K 2VQFK 4DV4K 4GKKK 4JI2K 5AJ3K 4DV7K 1XMQK 1IBLK 4DR2K 4JI5K 1N36K 4K0KK 4LF6K 4LFAK 5IWAK 4DR5K 2UUAK 1J5EK 4CVNE 2HHHK 4LF7K 5LMNK 4LF5K 4OX9K 5LL6Z 3J81O 4DUZK 4X62K 5BR8K 1HNWK 4JI4K 4DV2K 4JI7K 1XMOK 4DR4K 4LFBK 2UUCK 2F4VK 4B3MK 1N32K 1I94K 4B3RK 4X66K 4LF4K 3JAMO 3J7AP 4B3SK 3J80O 4NXNK 4AQYK 4LF8K 1FJGK 4DV3K 4DV5K 5LMUK 1HR0K 1N33K 2UXDK 4LFCK 4KHPK 4YY3K 1HNXK 4YHHK 4JI0K 4JI3K 5FLXO 3T1HK
chains in the Genus database with same CATH superfamily
1N34K 2RHKA 2P5OA 5AQQA 3T3FA 3MN5A 3P4IA 3LL3A 4MO5A 4BRFA 4UY8O 3O4QA 3SI6A 3E9PA 4CJRA 3K59A 4CFCA 2IGIA 4FO0A 3U3GA 1LAVA 1BHLA 1J5OA 2ZJRL 4J2BA 3AVMA 1HNIA 4K41A 4CE9A 1IKWA 4AH9A 2HOEA 1QS4A 5KPRA 3FFIA 3ZSZA 2Q97A 2VQFK 4DTJA 4BRIA 1L3VA 3A5LC 3CERA 4NYNA 4LD0A 4FZXC 3CJ9A 5F2RA 1LAWA 3CHWA 3NFAA 3HT3A 4CHQA 1WSGA 4W5RA 2A3ZA 1I3AA 2D4WA 5GINA 3KLHA 3QINA 1WBDA 1C1AA 4LF7K 1RTDA 3VGKA 1TVRA 2HBMA 1CZ9A 2OPSA 1WUAA 1GLDG 3HPHA 5FPNA 4Q5VA 4CZJA 4AF1A 4Z4CA 4KB0A 4IXCA 3NE6A 2IVNA 3IFRA 1XMOK 1ATNA 3VENA 3N4PA 4R5PA 3BF3A 3BZKA 1T8EA 4FLXA 2YCHA 2NRHA 3DOKA 1KRPA 2XHBA 2PYLA 3EY1A 3TI0A 3NH0A 4CJPA 4FJ8A 4LF8K 3MMVA 4KKOA 4F3OA 1RT6A 3DMJA 3ZYYX 1U48A 3CC2N 1X3MA 3EE9A 2G8KA 3ID6A 3CFRA 5K14A 3QESA 4KTZA 2O8CA 2W6KA 3SQ2A 1XNQK 3WEEA 1RT1A 2KKZA 4CZKA 4IFYA 4FJGA 3K58A 3SZ2A 3AA5X 2GUIA 2WOMA 3E1YA 2XRIA 3HK2A 4CZFA 1J6ZA 3QMLA 2G8HA 5JS1A 2WUSA 5TKYA 3WXIA 4FJIA 3SNNA 1TKXA 4HUGA 4KB1A 2P9KB 1D9DA 3O4NA 3MXIA 1EWQA 4E7HA 3R1XA 3CC4N 4DHYA 4HUEA 4HTUA 4BE1A 1K73O 3D0PA 5M1KA 1QQCA 2KTQA 4DV0K 4YFUA 3LDQA 3ID8A 4KH5A 3QEIA 2B5JA 1XNRK 4KH6A 4BRNA 5T7BA 1EP4A 3HZ6A 3U6FA 3VN5A 1HJRA 3M8RA 5AJ3K 4EP5A 1KVCA 3H6EA 1QE1A 1XMQK 1IBLK 4BR4A 4B9UA 3DLLL 5EX5A 3DLEA 3G6EN 3KTQA 1RBRA 3K57A 3PSIA 3TAQA 1QSSA 1K6YA 5M1NA 2OYQA 3EE8A 4CVNE 1JLFA 4PKHA 1SKWA 4JEPA 1Z26A 4KO0A 4FK2A 3FZMA 5J2PA 3VQ6A 3P83D 1U04A 1RNHA 2YX6A 4W5NA 3VQBA 1RDUA 3CPEA 3HPOA 2ETJA 4NCGA 2UUCK 3RMAA 3NHGA 1X9WA 2O8FB 5CYQA 1K8KB 3JAMO 1RT5A 1ZBIA 4ZTFA 4B08A 4Z4IA 3NF6A 3ALYA 4BVOA 4CIEA 2P9IA 3ZSXA 1KAZA 4DQPA 1VRTA 3IRXA 1N33K 2O8EB 2D5RA 3OYHA 4LFCK 4BGAA 3O1BA 3DYAA 3O3HA 4GV9A 3MN9A 5M1PA 3KWGA 3G10A 5LJVA 4HCCA 1FK9A 1IBKK 1BO5O 5TKWA 4NLBA 5AQMA 3OW2M 4CJ4A 3A5MC 1RILA 4H0XB 4H4OA 3LDPA 4JNEA 4I9LA 3QB0A 4DSFA 4QCLA 4IFVA 3ZSOA 3EL2A 3PO4A 1JXEA 5BRHA 5AQKA 3DLGA 4FVMA 3P1GA 1RTJA 3OYJA 4B8AB 1ITGA 2F8TA 1MWKA 1TGOA 4I7FA 2QI2A 2PZSA 2HNZA 4OGCA 3O3GA 2OPPA 1V4TA 3AVHA 4NYFA 4DV1K 2WC9A 2P9NB 4PQUA 3QIOA 5D3GA 2DTUA 4FJ7A 2ZWHA 3TAGA 2CGJA 1S5JA 4CF9A 3R8EA 4DSJA 4PL8A 1X1PA 1RBUA 1NBWA 3V9WA 1VQ4N 4IKFA 2OA8A 3D2EB 5IWAK 4CJWA 4KHQA 4FZYA 3ZLJA 4JRQA 3LPTA 1HX1A 3RMCA 3ASMA 1SUQA 3EO3A 4B9LA 2O8DB 3AVFA 1P8ZA 3EKUA 1A5WA 3LP2A 4ISGA 4A5BA 3NAEA 5AQLA 1SL1A 3M8QA 4N56A 1NJYA 4B8CA 3THVA 4YDUA 4JAXA 4DUZK 4JS5A 2DY4A 2Q0RA 3UKUA 1N6QA 3AVKA 4DCHA 4M42A 4EZ9A 2Y1IA 1W97L 5KPZA 1L3TA 3QEPA 4BWJA 4CESA 2PBDA 1VSHA 1YTAA 3O08A 4K8ZA 4YOUA 4I2QA 2QXLA 3MWPA 4CZHA 3U9ZA 2BTFA 3L4QA 5CYMA 4AQYK 4Q0BA 4CJFA 1BDGA 2OCEA 2D0BA 4H0PA 2BGGA 3WQTA 4O44A 2WBNA 3QEXA 2P9PA 3V9XA 3F73A 4LF9K 4DSLA 1Z6RA 1VSFA 1JCGA 4KTWA 3THWB 1Q9YA 4FLTA 4DU3A 4JK9A 2HBKA 3UKRB 1KD1O 2R7YA 3VPZA 4GV3A 3CMAN 4GMJB 1LW0A 3U4LA 4OLBA 4JD2B 3I33A 4PKGA 4E3SA 5SWMA 1QQMA 4QAGA 4KI6A 3M8PA 4NLCA 4CK1A 2YHBA 4OGEA 5I9EB 1T6CA 4M3RA 4CCHA 4NO7A 3LAKA 3MXJA 1X3NA 3AO2A 2YKNA 4A62A 2EHGA 3C65A 2HVIA 4BWMA 1S3XA 4CW7B 3NGYA 1ZYQA 4JYAK 5J2QA 3NMUA 4IOAL 1S9GA 4CEZA 3PX6A 2DFEA 4GKKK 4JI2K 2BDPA 1OKJA 4FWLA 2ZJPL 1S6PA 3VF2A 3O4WA 4OKJA 3CCJN 4DS5A 4YOTA 4EIAA 2P9LA 3ATUA 1N36K 4CHYA 2HHQA 3LZIA 3UE5A 3NF8A 3FZFA 4DQQA 3OY9A 5BPMA 2KHOA 3KHYA 3E66A 3CCQN 5AQGA 4DFJA 3OYIA 4CERA 4OO1J 2B4JA 1SL2A 4CZEA 3I8BA 4B1VA 4H5NA 2P51A 4BRQA 4DTMA 4KTQA 1KCFA 1C0TA 3TTFA 3ULDA 2NLXA 1YAGA 4C1NI 1CXUA 3O9RA 1H1VA 2HVHA 4FWSA 4DG1A 2G8IA 2ZJQL 4E0DA 4B1ZA 1I94K 4BY9C 4Y0WA 1KSPA 3N4QA 1YIJN 1ASUA 1SZ2A 4CF1A 4A5AA 1BIUA 2CGLA 3AVNA 3VEOA 1NKBA 2CH6A 3ENHA 2KZZA 3DLRA 3SUPA 4FOIA 1Q7YO 1VQ7N 1ZC6A 3LZJA 2AP1A 3WNHA 2UXDK 3FZHA 1J54A 5E41A 4CZIA 3L2QA 1R59O 1HQEA 1NGIA 2HMIA 4YORA 4I2PA 4NXMK 4ZHRA 3QNOA 3LP1A 4BACA 5HOOA 1NK7A 3MCAB 1TKTA 5BREA 4AM7A 4H03B 4DTUA 1TK5A 2VGNA 1GLFO 4CHOA 4ID1A 1QQOA 2ZQBA 1HQUA 1M1KO 3ZT2A 3SUQA 4HUFA 1S1UA 4JRPA 4ILHA 3VGMA 3HSTB 1M90O 3S3OA 4GV6A 4AHTA 1BUPA 3GL1A 4QS7A 4PHTX 4IDKA 4FJHA 1NGGA 4FW2A 4OJRA 1WSJA 3P5JA 2JWLA 4AHSA 4V19S 3B6OA 4KI4A 1VHXA 2FF3B 4CEDA 4CF2A 3ZT1A 3M3ZA 5EY4A 2F7TA 2FBTA 3MDQA 3OBYA 4OKEA 1Q9XA 4A57A 3RSEA 3D2FA 1E4GT 1TL1A 3ZETA 1GLBG 3VEYA 1JLCA 4C8MA 3CCUN 3OYBA 3VQAA 3OYKA 1J5EK 4U7BA 2OPRA 3LWMA 4CK3A 3BZCA 4W5QA 3TARA 1JCEA 5CY4A 4JLHA 5AQVA 4CJ5A 2RPIA 4BDPA 3QO9A 3J81O 4G9ZA 3V9UA 1VSMA 3RRHA 1YI2N 2F9WA 1E4FT 4DWIA 4HVJA 1OVQA 1Q86O 2E20A 4QS8A 5BN9A 1UA0A 4C8LA 4KBOA 4LF4K 3EEQA 1REVA 4JHDB 1LWEA 3WNGA 2ITGA 5AZIB 3OBWA 2Q1NA 2FSNA 3C94A 1HYSA 3NCIA 4IFEA 3Q7BA 4DSIA 3WNEA 2Q36A 2JWKA 3KZBA 4DKWA 1CLQA 4NB4A 1KAXA 3AVLA 3F2KA 3KIOA 5AQWA 1HNVA 1KFDA 1G15A 1NJXA 1K8AO 1C6VA 4L3QA 3NH2A 2ASMA 2AA4A 3WNFA 1BI4B 4KV8A 3S3MA 1NK9A 5IT9O 4CGGA 4H0TB 1IBMK 4KHNA 4O5FA 3HP6A 1S1WA 2X78A 2QWNA 4WF9L 4OKKA 1FW6A 3DXKB 1CZAN 1Q18A 4LY7A 2A6AA 1SV5A 2GBZA 3T1AA 2JGUA 2NRVA 4RTFD 3AO3A 4ELVA 2UXCK 5CZ2A 3SAFA 5AQYA 3UB5A 4CF8A 4GVMA 4DR6K 4H0VB 3KKSA 2E2NA 1NG9A 3OA9A 4BR5A 4NCAA 2UXBK 2FBVA 3H46O 4Z0UA 5DMRA 5JS2A 1JL1A 1VSDA 2A42A 1SKSA 4B9SA 2E6MA 1ZBFA 1KTQA 3CYMA 3ZEUA 3ZCMA 2HHSA 2HF4A 3CCLN 1Y64A 2D1KA 5FPDA 4F8RA 1U49A 1TKZA 4KHYA 2YKMA 1WAJA 4M45A 3O9SA 3HOSA 1HKCA 2VCPA 4JK7A 4HWIA 4ILJA 2RF2A 2NRTA 3OHRA 4OX9K 3P38A 1F21A 5EOYA 4DU4A 1Q8IA 4BGBA 3KLFA 3HXMA 4O0IA 1BA1A 3MECA 4A2AA 2E4LA 4FK0A 3KD1E 5KGXA 1NMDA 5F1XA 3CCVN 3TSPA 4JKDA 3VQQA 1SQKA 4AHVA 1ASVA 3SJJA 2X74A 3EZWA 4B3RK 2VG5A 3SYZA 2HHXA 3G0ZA 1YXQA 4WFBL 3M1FA 2OTJN 3MK6A 3LALA 2IOCA 5J2MA 3LM9A 3OYCA 1HLUA 3DRSA 4XH5A 3KLIA 1SL0A 1VSKA 3WUHA 3CM5A 4CBXA 3IMXA 4M7YA 5AZJB 5HRPA 2P9KA 3M5RA 4FPAA 1GLJO 2IVPA 3DLHA 3KWIA 1C0GA 3SPYA 4BC2A 1T7PA 3SUNA 4J2AA 4CFBA 4BE2A 3VQPA 2GELA 4CJVA 5CE3A 1NJWA 4CZMA 3ZSWA 4Y1DA 1VQ8N 4EFHA 3L0QA 5EXWA 4GY2B 5AQZA 2VWBA 3E9LA 1EQYA 3AVCA 4IBNA 5A2QO 3S41A 5C0YA 3KLGA 3CFPA 4PKIA 4MLEA 2ASPA 4IWVA 3QICA 3M6GA 3PIPL 4JN4A 4M3ZA 1HPZA 3J7ZO 2QW9A 4FJ9A 3FLCO 2FLOA 3I0RA 2G8FA 2NRWA 4AHRA 4GW6A 4O0JA 4BG9A 4CFDA 3KK1A 4BR7A 2KFZA 4MO4A 4BRDA 2IS3A 1EXQA 3GBTA 1UWBA 1S1XA 4YOXA 4PWDA 2O8FA 3LDSA 3WXJA 1HNWK 4OPHA 3O80A 1QZ5A 3C6TA 4MLHA 1IKXA 3T7ZA 2QTDA 4BR2A 4DR4K 2X6SA 2FXUA 3ZSQA 3IDHA 5GAEP 3O3FA 4PUOA 4LSLA 4RWTA 1NGCA 3AA4A 4MDAA 5C12A 4JKGB 3SQ0A 2CGKA 3RMBA 1C0MA 1JLAA 2CH5A 4CJTA 2DFFA 1VQ9N 4H4MA 1D9FA 4O55A 1NGFA 1LOTB 5FROA 3WEEB 4UQGA 1HRHA 3MN7A 4DTPA 5KTQA 5HROA 1UAXA 3RRGA 2ZF5O 1YJ9N 1U47A 4CGFA 4F9OA 1T05A 4BRPA 3ZX3A 3AAPA 4GNIA 3OS2A 4X64K 3TAMA 1NNEA 3ULEB 1JCFA 5GAHP 1NK6A 3JXUA 3P39A 1XI1A 4CGIA 3R6MA 1S72N 2W6LA 4E7JA 5JMVA 4CJSA 3RTVA 1NOYA 3G71N 2GTDA 1B9DA 4FJNA 1GLCG 1NGEA 4CZLA 3OYEA 3PY8A 4DTRA 3AVJA 4CFAA 2P9NA 4CJQA 1IO2A 4O8UA 3JYTA 1GLEG 4IO9L 3ITHA 5BRFA 2F9TA 1JLGA 1XQSC 3A5NC 4B3OA 3D2EA 3MEGA 3DM2A 3ZT4A 4E1NA 4CK2A 1WAFA 3IAYA 2I5JA 5HP1A 3OYFA 1LW2A 4BE0A 4CIFA 1WSFA 1LWFA 3SV4A 2O8DA 4FM1A 3CETA 4I6MB 4C8OA 1SS6A 4K0KK 1T3VA 4M3WA 4WYBA 4KRFA 3BEXA 4FZZA 3C6AA 3U9DA 3KK3A 3D7EO 3HPGA 2E2OA 3HM9A 3RR8A 3KVGA 1KLMA 4LF5K 4RG8A 2BH1A 3L8BA 3WT0A 5AQOA 3SMSA 3PSFA 5FRMA 1XUPO 3K9KA 4AHCA 2YNFA 2FBYA 4KHWA 1QSYA 3AAQA 3TSQA 3HBTA 5AFUA 3HRGA 1HUXA 2QK9A 1OVYA 3L2VA 2PAVA 3PLAA 2BUPA 4C23A 1W0HA 1FJGK 4DV3K 3DLKA 3UKRA 4WQ4C 1YVUA 3FZLA 1C0FA 3LP0A 3S9HA 4KREA 2A40A 4JD2A 4N47A 4PL7A 1DT9A 3VEXA 4PA1A 3Q7CA 1ILYA 3KK2A 4CF0A 1Z25A 1DLOA 5AQRA 1HMVA 2QKBA 4F3TA 1N8RO 1XHXA 3HVRA 4A2BA 1ESVA 4A61A 3QFUA 2VG6A 1QHAA 4MQ3A 3TANA 4BG8A 3LAMA 4FLWA 1EKEA 3PV8A 3OS1A 3MWTA 1ZBSA 3VQEA 5KI6A 2UUBK 3DLBA 3V9SA 3DWLA 2Z1HA 3J8AA 1RDDA 5AQJA 1MWMA 3CIPA 4DF8A 3L3VA 5HRNA 1NK8A 3SAGA 1VQPN 4DMNA 4AILC 1LV5A 5JICA 4M7XA 2FSKA 4HTLA 3SV3A 3G4SN 2B6AA 1D8YA 1C1CA 4IG0A 4BDZA 4JS4A 4JI5K 4M3UA 4B9QA 5E84A 1NK4A 1VQON 5LY3A 4K42A 3K5OA 1KQSM 3UKUB 5AQSA 2E6LA 4OPAA 3VEVA 1I39A 1YJWN 1EWRA 1QTMA 3CCSN 4YOVA 2XY8A 3F5TA 2Q31A 2OTLN 4CJLA 4H5VA 1WNSA 4JKEA 4WCEL 5BPLA 1RT4A 4H5TA 2A5XA 1JL2A 3V9ZA 2P9SB 3BY5A 2Z1JA 4B1UB 4CEAA 2F4VK 1QVGM 4F4KA 1S22A 1G99A 3W3DA 1WBBA 1TAUA 3HP9A 1FKPA 4XEIA 3IKMA 2QWLA 2HNYA 1BA0A 2WONA 4M3YA 3L2RA 5HLFA 4CGJA 4CHZA 5LMUK 2V7ZA 2HHTA 1WSHA 2O8BB 4JI3K 3V6DA 1NGAA 3AV9A 3FGUA 4FLVA 3BUZB 2Q3SA 3THXB 5AQIA 3DI6A 3ZSRA 5AR0A 3PO5A 1IH7A 2D0PA 4J8FA 3WXLA 3VQ9A 3V4IA 2E1YA 1NMNA 4U67L 5C24A 1W9HA 3ENBA 1R0AA 4ID5A 4XH4A 3FE1A 3OVNA 5GIPA 4FW1A 5AQFA 1NKEA 3C7NB 1HKBA 4DSKA 2F8SA 2OPQA 3LWLA 1YITN 3J7YP 5JLFA 1UOCA 3AO1A 1U2VA 4H8KA 3VQ7A 3O1WA 3K0SA 4M41A 3K9JA 2VYPA 4JKCA 2FC0A 2P9UB 2IVOA 4XIUA 3QEVA 3DRRA 4LH4A 1CZBA 3WXKA 2KFNA 3TSUA 2QWQA 3AY9A 3WQUA 4DQ8A 1ZBUA 3CCEN 1FXXA 2YJEA 2NUBA 1OH6A 1EO1A 1U4BA 3K5MA 3VEWA 5ADXA 2Z1IA 3SQ1A 5AQHA 3CG7A 2QWPA 4O5BA 5BPNA 4PY5A 4JI4K 4JHDA 1VQNN 1DGKN 4WE1A 3NF7A 5AZIA 5AQPA 3OJSA 1NGBA 3THYB 3B6PA 4N76A 3TAEA 3HYFA 3QIPA 1C1BA 3HVTA 2ATQA 1U45A 3NVKA 1TL3A 1Q81O 3I56N 4EHUA 1P90A 1A5XA 4H0YB 3VQ4A 1RBVA 1BI4A 4QS9A 4BC4A 4ZTJA 1NJIO 3U8XA 4YY3K 1QZ6A 3WXMB 4JI0K 3O8MA 3P31A 4MFBA 4LC9B 3F9KA 3HSCA 3DXKA 4WQ5C 3SQ4A 2XY7A 4JK8A 3MCPA 2E2PA 2KW4A 4E7KA 2I7PA 1BL3A 1DTTA 5BN8A 2AJQA 2KZMA 2YHAA 1DKGD 3OJUA 3MEEA 3QERA 1ZBHA 4X65K 3H3OB 3LP3A 3HOTA 3A8YA 3ZT3A 1JJ2M 3MXMA 2Z1GA 3L4IA 3ZX2A 1QQNA 3CQXA 5I3UA 5HBMA 3PX0A 4BRCA 2O4GA 1KC8O 4M3TA 3LANA 1RCHA 1YT3A 5SZTA 3PX4A 5FRNA 1RDCA 1L3UA 3BGRA 3VA0A 3UIQA 4E19A 5M1OA 3H1QA 1NGHA 4W5OA 5HL7L 5DK5A 4DV7K 3V1OA 3V81A 4CEBA 1HJOA 4FVUA 3SAHA 3QNNA 3VTIA 1XHZA 1JXBA 4FWOA 2E88A 4BRAA 3VQ5A 1VRUA 1IKYA 5AQNA 3L2UA 5LMNK 4WFNL 3CF5L 3MEDA 2IIRA 3MX2A 1NU0A 2G8UA 4YOYA 3OYNA 2DPNA 3HO1A 3DXMB 4IZ9A 1O1WA 4B9MA 1S9EA 1VSLA 1BG3A 3PIOL 3CXCM 3SJHA 1RTIA 4IEEA 3GDQA 4FJXA 4FJMA 4CI6A 2P1JA 1S6QA 2IDOA 4NCBA 1W7AA 4KHUA 3J7AP 1RT2A 2GWJA 2LSNA 4FYDA 2WFBA 3J80O 1VQKN 2OZMA 3SK3A 3SBGA 2P5GA 1T44A 5AZJA 4CZGA 1HR0K 1IG9A 1GLLO 2EX3A 2W41A 3CM6A 1BU6O 3O5BA 3T19A 1HNXK 3C6HA 4DQSA 3HM8A 2GX9A 2HNDA 2GEMA 3C0BA 3LDOA 1TYQB 2PYJA 2QA4N 3TTDA 4BR0A 1TUUA 3L3UA 3T1YK 3MX5A 4DTSA 1XWLA 3RWUA 2YI1A 5BRDA 4B1WB 4MDBA 1HNZK 3RR7A 3IS9A 1BCMA 3ZX0A 3TAPA 4C8KA 3CD6N 5CR4A 5KQDA 4B9VA 3DOLA 4J2EA 3O9TA 4IJAA 1RT7A 2NRZA 1NK0A 3AVAA 1WN7A 4YOWA 3ZEUB 1KFSA 4DSEA 5EU7A 2QWOA 3FFKB 2V51B 1YVNA 4FWPA 4BVPA 3D6RA 1ZXOA 4DR3K 4WFAL 1IV0A 4JKAA 4CJ7A 5B8HA 3TWHA 4H0OA 3NDKA 4JI6K 4BROA 2W40A 1D5AA 3IG1A 2WTUA 3VQ8A 3OYLA 5LJWA 1TV6A 4O4GA 1QVFM 4WQ4A 3CQ8A 4FXDA 3CJCA 4DR2K 3A5OC 1YHQN 4RW6A 1NK5A 4LF6K 2HF3A 4Z4HA 4YNQA 2ZD1A 3A0IX 2W42A 2J4RA 3ISNC 1IJJA 3EZ5A 4X62K 4JKGA 3VGLA 5AQUA 1BQMA 4DFMA 5MLCQ 4FWQA 4BDYA 3VETA 4EZ6A 3LPUA 4C1NK 4DQIA 3B8AX 2V52B 1DEJA 4W5TA 1S1VA 4FPBA 3AO5A 1ATSA 4CJ3A 2Q0UA 3BF1A 4FWKA 3U3YA 3DRPA 1GLAG 1D4XA 3ZT0A 1TK8A 3ULEA 3CC7N 3VTHA 4B9NA 1XC3A 4KHPK 1CXQA 1K8KA 4KAZA 4FJKA 4Z4EA 4JKHA 4BQZA 4GKJK 3GG4A 4RW9A 1RDWX 5AFUH 5C42A 1HPMA 3VOVA 4B9TA 3CPWM 1MDUB 5KGWA 3L6QA 4CHPA 2VQEK 2GUPA 5DM7L 4N5SA 2O8EA 4CHNA 2BANA 3OTOK 3VF6A 2HHUA 3QBWA 2Q2RA 2O8CB 1DTQA 1NWKA 1T6DA 3LDNA 3O9QA 2E5LK 3TR8A 4Z4GA 4B1XB 4RW8A 4CEEA 2ZE2A 5GAGP 5KRTA 3CMEN 5GADP 3S3NA 2EWSA 4OLAA 1NJZA 1RBSA 4GVEA 5C2DA 1VQMN 3VERA 4CIGA 1VQ5N 1BCOA 4I6MA 2QWRA 1VQLN 2V7YA 4F2SA 4ILGB 4EP4A 2E2QA 4BQLA 3K5NA 2YJFA 2O4IA 4DR5K 2QWMA 3OS0A 3AARA 1HYZA 1TUYA 2GV9A 1Q82O 4A59A 1WSEA 4DLEA 1OH5A 5GIOA 3GOIA 2QXFA 2FF6A 4FM2A 4OPJA 1NKCA 4F2RA 4DF4A 1VSJA 4FLZA 1NGJA 3VEZA 5BR8K 2G8VA 4KPYA 5J2NA 4FK4A 1ZBLA 4LFBK 3O6WA 1SAZA 2IAJA 5JLHA 1W2BM 4B3MK 1N32K 3QFPA 3EKSA 3EYZA 3SUOA 2I7NA 3VMFB 2VG7A 3NGIA 3SLCA 3OYAA 2YHYA 1BQNA 4DV5K 5F0XA 3C6UA 4CEOA 4XH1A 4KHSA 1X9MA 3NVMA 1BWFO 1VSIA 4JV5K 1J9AA 2IC3A 5CZ1A 3W0LA 1X9JA 2P9IB 4EAHD 3V1RA 4DQRA 3KLEA 3NBPA 1B9FA 4K25A 2A1SA 3LM2A 4JI1K 2D0OA 3HL8A 4FCYA 5C2FA 3OYGA 3THWA 4O8KA 3TABA 4B3TK 5C15A 4DV6K 1S1TA 5HRRA 3OYDA 1LCUA 2OZSA 1E3MA 1EETA 1O13A 2E8AA 4RCHA 3K5LA 2ZM6K 4DU1A 3KK7A 2UU9K 3QLHA 3CI5A 1JKHA 3ZSVA 3G25A 4Z4FA 3CCMN 3SMPA 4ELUA 2HMPA 3VQDA 4BC5A 5CHIA 4FJLA 4RW7A 3H08A 1HYVA 3KJVA 4DR1K 2Y1JA 2A1RA 4K43A 1RDBA 5FPMA 2ASOA 4DV4K 1FKOA 3VESA 2HW3A 2DFHA 1T03A 5C25A 2YHXA 4E7IA 5H1SQ 5JVHL 3HJFA 4CEQA 4JKFA 2HBLA 1RDAA 1Y97A 3H45C 1WSIA 2YHWA 2FBXA 5EVZA 4DTXA 4WQ5A 5C10A 2D0AA 1BOTO 4TSXA 2NNWA 2P9SA 2YV0X 3RVCA 1YTUA 1N5YA 2RE2A 2PY5A 2H3GX 3DJCA 1WB9A 3R3LA 4FL9A 3PUFA 4OPKA 3I55N 1YJNN 4B1YB 1KAYA 3A2FA 2YNGA 3QEWA 2VWJA 4K8XA 2O8BA 2RKIA 1IKVA 3AVBA 4QOZB 3TAFA 5I42A 5ADXH 3MN6A 3JSMA 2QEXN 2NRXA 4FLUA 3ENOA 1JLBA 3THXA 4FWNA 1BISA 1OH8A 3AGRA 1VAZA 2XY5A 4CECA 4FOEA 4BC3A 1XC9A 3NGZA 1MA9B 5E26A 3ATVA 2X6NA 4AHUA 1KVBA 4LH5A 4IG3A 2P9PB 5DM6L 3C7NA 5AQTA 3I8DA 4IJNA 3ZSYA 4DUYK 3SCXA 4BRGA 3AVIA 1IG8A 3M8SA 1VQ6N 1L5UA 1U6ZA 2UYTA 4DFKA 1QHTA 2P9UA 3D45A 2NRRA 3O9UA 1RFQA 4E1JA 4CJUA 1GOCA 4BRKA 5KRSA 4BR9A 3E01A 2RN2A 3MAQA 3VF4A 3QBXA 5M1QA 4BRHA 4ISEA 4FJJA 2XY6A 5FDLA 1RT3A 3GE1A 3AA3A 4FJ5A 4DTOA 1ASWA 3FR0A 1HKGA 4BREA 1QSLA 4E7LA 4DTNA 4IEIA 4Z94A 1TK0A 4M3XA 1GOAA 3SPZA 1RTHA 4I9QA 2KLAA 3OYMA 1ATRA 2HHHK 2D0CA 4DLGA 2HB5A 3CJ1A 2P9LB 4JKBA 1WOQA 3CJ7A 2YNHA 4DFPA 4H5WA 3AA2A 3THYA 4RW4A 1EX4A 4JI7K 1BGXT 4IO8A 5J1EA 1BIZA 5ELZA 5KPTA 3BP8A 3EN9A 1UA1A 4FM0A 1RGIA 2GWKA 2HSTA 2OANA 3F9MA 4HHTA 4B3SK 4EHTA 1NOZA 3FZKA 4NXNK 2F96A 3VQCA 3CCRN 1X9SA 3TTCA 1YF5L 2ZGZA 3BDPA 1KXPA 3C95A 3E9OA 1TAQA 4AM6A 3T69A 4BRLA 2QM1A 1VSEA 4CGDA 4J2DA 4BRMA 3IUCA 1TKDA 1V4SA 4E89A 5FPEA 4JI8K 4IOCL 2HHVA 3DAWA 4DR7K 3HI0A 4CJKA 3I0SA 2ZGYA 2G8WA 1JLQA 4ISFA 4C8NA 3RMDA 3H1VX 1JLEA 3CFOA 1YUWA 1NM1A 4YDUC 5M1FA 3HTVA 1GOBA 4CGHA 2YNIA 5HRSA 4FLYA 1C0UA 3AGKA 1U2VB 4OVLA 3LDLA 4CEFA 4ELTA 1OH7A 1L3SA 4R79A 4E1MA 1NGDA 3K2PA 2HHWA 1LWCA 4KH4A 4ICLA 2PFUA 2QKKA 1VK0A 2KQ2A 5JVGL 3H3NO 1K9MO 1A5VA 5BR9A 4KFBA 3VA3A 3JS6A 1KVAA 2BE2A 2FSJA 2A41A 3TU5A 1NLVA 4L8RB 3NF9A 2E1ZA 4Y1CA 3TPQA 4LFAK 1MU2A 3L2WA 5KQ8A 3AO4A 2JLEA 2UUAK 3RSEB 3D2FB 4IOXA 4HCBA 1KLNA 3DXMA 4CD1A 3CJAA 3ZETB 4LSNA 2VWKA 2HBJA 4FWMA 5LL6Z 4DS4A 4IDHA 3QDKA 4N41A 1Z05A 4G1QA 3R9PA 1RBTA 3V1QA 1SKRA 4DV2K 2VGMA 3CJBA 4CD3A 2ITMA 4M63C 3AVGA 4FWRA 4DB3A 4CBUA 1J53A 4X66K 5AQXA 4FSVA 3CQYA 3KD5E 3KKRA 3SBTA 4CBWA 4CJEA 2NZTA 1WLJA 3QETA 3NH1A 4H5RA 2XO7A 1TYQA 4YHHK 1B92A 5FLXO 3T1HK
chains in the Genus database with same CATH topology
1N34K 4NXMK 4LF9K 4GKJK 4JI8K 4JV5K 4X64K 1XNQK 4DR7K 2VQEK 1IBKK 5IT9O 3OTOK 1IBMK 4JI1K 3T1YK 4DUYK 4B3TK 1HNZK 4DV6K 2E5LK 4X65K 2UXCK 4DR6K 2ZM6K 2UUBK 2UU9K 3J7YP 2UXBK 4V19S 4DV0K 4DR3K 4CW7B 1XNRK 4JYAK 5A2QO 4DV1K 4DR1K 4JI6K 2VQFK 4DV4K 4GKKK 4JI2K 5AJ3K 4DV7K 1XMQK 1IBLK 4DR2K 4JI5K 1N36K 4K0KK 4LF6K 4LFAK 5IWAK 4DR5K 2UUAK 1J5EK 4CVNE 2HHHK 4LF7K 5LMNK 4LF5K 4OX9K 5LL6Z 3J81O 4DUZK 4X62K 5BR8K 1HNWK 4JI4K 4DV2K 4JI7K 1XMOK 4DR4K 4LFBK 2UUCK 2F4VK 4B3MK 1N32K 1I94K 4B3RK 4X66K 4LF4K 3JAMO 3J7AP 4B3SK 3J80O 4NXNK 4AQYK 4LF8K 1FJGK 4DV3K 4DV5K 5LMUK 1HR0K 1N33K 2UXDK 4LFCK 4KHPK 4YY3K 1HNXK 4YHHK 4JI0K 4JI3K 5FLXO 3T1HK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N34 K;  4NXM K;  4LF9 K;  4GKJ K;  4JI8 K;  4JV5 K;  4X64 K;  1XNQ K;  4DR7 K;  2VQE K;  1IBK K;  5IT9 O;  3OTO K;  1IBM K;  4JI1 K;  3T1Y K;  4DUY K;  4B3T K;  1HNZ K;  4DV6 K;  2E5L K;  4X65 K;  2UXC K;  4DR6 K;  2ZM6 K;  2UUB K;  2UU9 K;  3J7Y P;  2UXB K;  4V19 S;  4DV0 K;  4DR3 K;  4CW7 B;  1XNR K;  4JYA K;  5A2Q O;  4DV1 K;  4DR1 K;  4JI6 K;  2VQF K;  4DV4 K;  4GKK K;  4JI2 K;  5AJ3 K;  4DV7 K;  1XMQ K;  1IBL K;  4DR2 K;  4JI5 K;  1N36 K;  4K0K K;  4LF6 K;  4LFA K;  5IWA K;  4DR5 K;  2UUA K;  1J5E K;  4CVN E;  2HHH K;  4LF7 K;  5LMN K;  4LF5 K;  4OX9 K;  5LL6 Z;  3J81 O;  4DUZ K;  4X62 K;  5BR8 K;  1HNW K;  4JI4 K;  4DV2 K;  4JI7 K;  1XMO K;  4DR4 K;  4LFB K;  2UUC K;  2F4V K;  4B3M K;  1N32 K;  1I94 K;  4B3R K;  4X66 K;  4LF4 K;  3JAM O;  3J7A P;  4B3S K;  3J80 O;  4NXN K;  4AQY K;  4LF8 K;  1FJG K;  4DV3 K;  4DV5 K;  5LMU K;  1HR0 K;  1N33 K;  2UXD K;  4LFC K;  4KHP K;  4YY3 K;  1HNX K;  4YHH K;  4JI0 K;  4JI3 K;  5FLX O;  3T1H K; 
#chains in the Genus database with same CATH topology
 1N34 K;  2RHK A;  2P5O A;  5AQQ A;  3T3F A;  3MN5 A;  3P4I A;  3LL3 A;  4MO5 A;  4BRF A;  4UY8 O;  3O4Q A;  3SI6 A;  3E9P A;  4CJR A;  3K59 A;  4CFC A;  2IGI A;  4FO0 A;  3U3G A;  1LAV A;  1BHL A;  1J5O A;  2ZJR L;  4J2B A;  3AVM A;  1HNI A;  4K41 A;  4CE9 A;  1IKW A;  4AH9 A;  2HOE A;  1QS4 A;  5KPR A;  3FFI A;  3ZSZ A;  2Q97 A;  2VQF K;  4DTJ A;  4BRI A;  1L3V A;  3A5L C;  3CER A;  4NYN A;  4LD0 A;  4FZX C;  3CJ9 A;  5F2R A;  1LAW A;  3CHW A;  3NFA A;  3HT3 A;  4CHQ A;  1WSG A;  4W5R A;  2A3Z A;  1I3A A;  2D4W A;  5GIN A;  3KLH A;  3QIN A;  1WBD A;  1C1A A;  4LF7 K;  1RTD A;  3VGK A;  1TVR A;  2HBM A;  1CZ9 A;  2OPS A;  1WUA A;  1GLD G;  3HPH A;  5FPN A;  4Q5V A;  4CZJ A;  4AF1 A;  4Z4C A;  4KB0 A;  4IXC A;  3NE6 A;  2IVN A;  3IFR A;  1XMO K;  1ATN A;  3VEN A;  3N4P A;  4R5P A;  3BF3 A;  3BZK A;  1T8E A;  4FLX A;  2YCH A;  2NRH A;  3DOK A;  1KRP A;  2XHB A;  2PYL A;  3EY1 A;  3TI0 A;  3NH0 A;  4CJP A;  4FJ8 A;  4LF8 K;  3MMV A;  4KKO A;  4F3O A;  1RT6 A;  3DMJ A;  3ZYY X;  1U48 A;  3CC2 N;  1X3M A;  3EE9 A;  2G8K A;  3ID6 A;  3CFR A;  5K14 A;  3QES A;  4KTZ A;  2O8C A;  2W6K A;  3SQ2 A;  1XNQ K;  3WEE A;  1RT1 A;  2KKZ A;  4CZK A;  4IFY A;  4FJG A;  3K58 A;  3SZ2 A;  3AA5 X;  2GUI A;  2WOM A;  3E1Y A;  2XRI A;  3HK2 A;  4CZF A;  1J6Z A;  3QML A;  2G8H A;  5JS1 A;  2WUS A;  5TKY A;  3WXI A;  4FJI A;  3SNN A;  1TKX A;  4HUG A;  4KB1 A;  2P9K B;  1D9D A;  3O4N A;  3MXI A;  1EWQ A;  4E7H A;  3R1X A;  3CC4 N;  4DHY A;  4HUE A;  4HTU A;  4BE1 A;  1K73 O;  3D0P A;  5M1K A;  1QQC A;  2KTQ A;  4DV0 K;  4YFU A;  3LDQ A;  3ID8 A;  4KH5 A;  3QEI A;  2B5J A;  1XNR K;  4KH6 A;  4BRN A;  5T7B A;  1EP4 A;  3HZ6 A;  3U6F A;  3VN5 A;  1HJR A;  3M8R A;  5AJ3 K;  4EP5 A;  1KVC A;  3H6E A;  1QE1 A;  1XMQ K;  1IBL K;  4BR4 A;  4B9U A;  3DLL L;  5EX5 A;  3DLE A;  3G6E N;  3KTQ A;  1RBR A;  3K57 A;  3PSI A;  3TAQ A;  1QSS A;  1K6Y A;  5M1N A;  2OYQ A;  3EE8 A;  4CVN E;  1JLF A;  4PKH A;  1SKW A;  4JEP A;  1Z26 A;  4KO0 A;  4FK2 A;  3FZM A;  5J2P A;  3VQ6 A;  3P83 D;  1U04 A;  1RNH A;  2YX6 A;  4W5N A;  3VQB A;  1RDU A;  3CPE A;  3HPO A;  2ETJ A;  4NCG A;  2UUC K;  3RMA A;  3NHG A;  1X9W A;  2O8F B;  5CYQ A;  1K8K B;  3JAM O;  1RT5 A;  1ZBI A;  4ZTF A;  4B08 A;  4Z4I A;  3NF6 A;  3ALY A;  4BVO A;  4CIE A;  2P9I A;  3ZSX A;  1KAZ A;  4DQP A;  1VRT A;  3IRX A;  1N33 K;  2O8E B;  2D5R A;  3OYH A;  4LFC K;  4BGA A;  3O1B A;  3DYA A;  3O3H A;  4GV9 A;  3MN9 A;  5M1P A;  3KWG A;  3G10 A;  5LJV A;  4HCC A;  1FK9 A;  1IBK K;  1BO5 O;  5TKW A;  4NLB A;  5AQM A;  3OW2 M;  4CJ4 A;  3A5M C;  1RIL A;  4H0X B;  4H4O A;  3LDP A;  4JNE A;  4I9L A;  3QB0 A;  4DSF A;  4QCL A;  4IFV A;  3ZSO A;  3EL2 A;  3PO4 A;  1JXE A;  5BRH A;  5AQK A;  3DLG A;  4FVM A;  3P1G A;  1RTJ A;  3OYJ A;  4B8A B;  1ITG A;  2F8T A;  1MWK A;  1TGO A;  4I7F A;  2QI2 A;  2PZS A;  2HNZ A;  4OGC A;  3O3G A;  2OPP A;  1V4T A;  3AVH A;  4NYF A;  4DV1 K;  2WC9 A;  2P9N B;  4PQU A;  3QIO A;  5D3G A;  2DTU A;  4FJ7 A;  2ZWH A;  3TAG A;  2CGJ A;  1S5J A;  4CF9 A;  3R8E A;  4DSJ A;  4PL8 A;  1X1P A;  1RBU A;  1NBW A;  3V9W A;  1VQ4 N;  4IKF A;  2OA8 A;  3D2E B;  5IWA K;  4CJW A;  4KHQ A;  4FZY A;  3ZLJ A;  4JRQ A;  3LPT A;  1HX1 A;  3RMC A;  3ASM A;  1SUQ A;  3EO3 A;  4B9L A;  2O8D B;  3AVF A;  1P8Z A;  3EKU A;  1A5W A;  3LP2 A;  4ISG A;  4A5B A;  3NAE A;  5AQL A;  1SL1 A;  3M8Q A;  4N56 A;  1NJY A;  4B8C A;  3THV A;  4YDU A;  4JAX A;  4DUZ K;  4JS5 A;  2DY4 A;  2Q0R A;  3UKU A;  1N6Q A;  3AVK A;  4DCH A;  4M42 A;  4EZ9 A;  2Y1I A;  1W97 L;  5KPZ A;  1L3T A;  3QEP A;  4BWJ A;  4CES A;  2PBD A;  1VSH A;  1YTA A;  3O08 A;  4K8Z A;  4YOU A;  4I2Q A;  2QXL A;  3MWP A;  4CZH A;  3U9Z A;  2BTF A;  3L4Q A;  5CYM A;  4AQY K;  4Q0B A;  4CJF A;  1BDG A;  2OCE A;  2D0B A;  4H0P A;  2BGG A;  3WQT A;  4O44 A;  2WBN A;  3QEX A;  2P9P A;  3V9X A;  3F73 A;  4LF9 K;  4DSL A;  1Z6R A;  1VSF A;  1JCG A;  4KTW A;  3THW B;  1Q9Y A;  4FLT A;  4DU3 A;  4JK9 A;  2HBK A;  3UKR B;  1KD1 O;  2R7Y A;  3VPZ A;  4GV3 A;  3CMA N;  4GMJ B;  1LW0 A;  3U4L A;  4OLB A;  4JD2 B;  3I33 A;  4PKG A;  4E3S A;  5SWM A;  1QQM A;  4QAG A;  4KI6 A;  3M8P A;  4NLC A;  4CK1 A;  2YHB A;  4OGE A;  5I9E B;  1T6C A;  4M3R A;  4CCH A;  4NO7 A;  3LAK A;  3MXJ A;  1X3N A;  3AO2 A;  2YKN A;  4A62 A;  2EHG A;  3C65 A;  2HVI A;  4BWM A;  1S3X A;  4CW7 B;  3NGY A;  1ZYQ A;  4JYA K;  5J2Q A;  3NMU A;  4IOA L;  1S9G A;  4CEZ A;  3PX6 A;  2DFE A;  4GKK K;  4JI2 K;  2BDP A;  1OKJ A;  4FWL A;  2ZJP L;  1S6P A;  3VF2 A;  3O4W A;  4OKJ A;  3CCJ N;  4DS5 A;  4YOT A;  4EIA A;  2P9L A;  3ATU A;  1N36 K;  4CHY A;  2HHQ A;  3LZI A;  3UE5 A;  3NF8 A;  3FZF A;  4DQQ A;  3OY9 A;  5BPM A;  2KHO A;  3KHY A;  3E66 A;  3CCQ N;  5AQG A;  4DFJ A;  3OYI A;  4CER A;  4OO1 J;  2B4J A;  1SL2 A;  4CZE A;  3I8B A;  4B1V A;  4H5N A;  2P51 A;  4BRQ A;  4DTM A;  4KTQ A;  1KCF A;  1C0T A;  3TTF A;  3ULD A;  2NLX A;  1YAG A;  4C1N I;  1CXU A;  3O9R A;  1H1V A;  2HVH A;  4FWS A;  4DG1 A;  2G8I A;  2ZJQ L;  4E0D A;  4B1Z A;  1I94 K;  4BY9 C;  4Y0W A;  1KSP A;  3N4Q A;  1YIJ N;  1ASU A;  1SZ2 A;  4CF1 A;  4A5A A;  1BIU A;  2CGL A;  3AVN A;  3VEO A;  1NKB A;  2CH6 A;  3ENH A;  2KZZ A;  3DLR A;  3SUP A;  4FOI A;  1Q7Y O;  1VQ7 N;  1ZC6 A;  3LZJ A;  2AP1 A;  3WNH A;  2UXD K;  3FZH A;  1J54 A;  5E41 A;  4CZI A;  3L2Q A;  1R59 O;  1HQE A;  1NGI A;  2HMI A;  4YOR A;  4I2P A;  4NXM K;  4ZHR A;  3QNO A;  3LP1 A;  4BAC A;  5HOO A;  1NK7 A;  3MCA B;  1TKT A;  5BRE A;  4AM7 A;  4H03 B;  4DTU A;  1TK5 A;  2VGN A;  1GLF O;  4CHO A;  4ID1 A;  1QQO A;  2ZQB A;  1HQU A;  1M1K O;  3ZT2 A;  3SUQ A;  4HUF A;  1S1U A;  4JRP A;  4ILH A;  3VGM A;  3HST B;  1M90 O;  3S3O A;  4GV6 A;  4AHT A;  1BUP A;  3GL1 A;  4QS7 A;  4PHT X;  4IDK A;  4FJH A;  1NGG A;  4FW2 A;  4OJR A;  1WSJ A;  3P5J A;  2JWL A;  4AHS A;  4V19 S;  3B6O A;  4KI4 A;  1VHX A;  2FF3 B;  4CED A;  4CF2 A;  3ZT1 A;  3M3Z A;  5EY4 A;  2F7T A;  2FBT A;  3MDQ A;  3OBY A;  4OKE A;  1Q9X A;  4A57 A;  3RSE A;  3D2F A;  1E4G T;  1TL1 A;  3ZET A;  1GLB G;  3VEY A;  1JLC A;  4C8M A;  3CCU N;  3OYB A;  3VQA A;  3OYK A;  1J5E K;  4U7B A;  2OPR A;  3LWM A;  4CK3 A;  3BZC A;  4W5Q A;  3TAR A;  1JCE A;  5CY4 A;  4JLH A;  5AQV A;  4CJ5 A;  2RPI A;  4BDP A;  3QO9 A;  3J81 O;  4G9Z A;  3V9U A;  1VSM A;  3RRH A;  1YI2 N;  2F9W A;  1E4F T;  4DWI A;  4HVJ A;  1OVQ A;  1Q86 O;  2E20 A;  4QS8 A;  5BN9 A;  1UA0 A;  4C8L A;  4KBO A;  4LF4 K;  3EEQ A;  1REV A;  4JHD B;  1LWE A;  3WNG A;  2ITG A;  5AZI B;  3OBW A;  2Q1N A;  2FSN A;  3C94 A;  1HYS A;  3NCI A;  4IFE A;  3Q7B A;  4DSI A;  3WNE A;  2Q36 A;  2JWK A;  3KZB A;  4DKW A;  1CLQ A;  4NB4 A;  1KAX A;  3AVL A;  3F2K A;  3KIO A;  5AQW A;  1HNV A;  1KFD A;  1G15 A;  1NJX A;  1K8A O;  1C6V A;  4L3Q A;  3NH2 A;  2ASM A;  2AA4 A;  3WNF A;  1BI4 B;  4KV8 A;  3S3M A;  1NK9 A;  5IT9 O;  4CGG A;  4H0T B;  1IBM K;  4KHN A;  4O5F A;  3HP6 A;  1S1W A;  2X78 A;  2QWN A;  4WF9 L;  4OKK A;  1FW6 A;  3DXK B;  1CZA N;  1Q18 A;  4LY7 A;  2A6A A;  1SV5 A;  2GBZ A;  3T1A A;  2JGU A;  2NRV A;  4RTF D;  3AO3 A;  4ELV A;  2UXC K;  5CZ2 A;  3SAF A;  5AQY A;  3UB5 A;  4CF8 A;  4GVM A;  4DR6 K;  4H0V B;  3KKS A;  2E2N A;  1NG9 A;  3OA9 A;  4BR5 A;  4NCA A;  2UXB K;  2FBV A;  3H46 O;  4Z0U A;  5DMR A;  5JS2 A;  1JL1 A;  1VSD A;  2A42 A;  1SKS A;  4B9S A;  2E6M A;  1ZBF A;  1KTQ A;  3CYM A;  3ZEU A;  3ZCM A;  2HHS A;  2HF4 A;  3CCL N;  1Y64 A;  2D1K A;  5FPD A;  4F8R A;  1U49 A;  1TKZ A;  4KHY A;  2YKM A;  1WAJ A;  4M45 A;  3O9S A;  3HOS A;  1HKC A;  2VCP A;  4JK7 A;  4HWI A;  4ILJ A;  2RF2 A;  2NRT A;  3OHR A;  4OX9 K;  3P38 A;  1F21 A;  5EOY A;  4DU4 A;  1Q8I A;  4BGB A;  3KLF A;  3HXM A;  4O0I A;  1BA1 A;  3MEC A;  4A2A A;  2E4L A;  4FK0 A;  3KD1 E;  5KGX A;  1NMD A;  5F1X A;  3CCV N;  3TSP A;  4JKD A;  3VQQ A;  1SQK A;  4AHV A;  1ASV A;  3SJJ A;  2X74 A;  3EZW A;  4B3R K;  2VG5 A;  3SYZ A;  2HHX A;  3G0Z A;  1YXQ A;  4WFB L;  3M1F A;  2OTJ N;  3MK6 A;  3LAL A;  2IOC A;  5J2M A;  3LM9 A;  3OYC A;  1HLU A;  3DRS A;  4XH5 A;  3KLI A;  1SL0 A;  1VSK A;  3WUH A;  3CM5 A;  4CBX A;  3IMX A;  4M7Y A;  5AZJ B;  5HRP A;  2P9K A;  3M5R A;  4FPA A;  1GLJ O;  2IVP A;  3DLH A;  3KWI A;  1C0G A;  3SPY A;  4BC2 A;  1T7P A;  3SUN A;  4J2A A;  4CFB A;  4BE2 A;  3VQP A;  2GEL A;  4CJV A;  5CE3 A;  1NJW A;  4CZM A;  3ZSW A;  4Y1D A;  1VQ8 N;  4EFH A;  3L0Q A;  5EXW A;  4GY2 B;  5AQZ A;  2VWB A;  3E9L A;  1EQY A;  3AVC A;  4IBN A;  5A2Q O;  3S41 A;  5C0Y A;  3KLG A;  3CFP A;  4PKI A;  4MLE A;  2ASP A;  4IWV A;  3QIC A;  3M6G A;  3PIP L;  4JN4 A;  4M3Z A;  1HPZ A;  3J7Z O;  2QW9 A;  4FJ9 A;  3FLC O;  2FLO A;  3I0R A;  2G8F A;  2NRW A;  4AHR A;  4GW6 A;  4O0J A;  4BG9 A;  4CFD A;  3KK1 A;  4BR7 A;  2KFZ A;  4MO4 A;  4BRD A;  2IS3 A;  1EXQ A;  3GBT A;  1UWB A;  1S1X A;  4YOX A;  4PWD A;  2O8F A;  3LDS A;  3WXJ A;  1HNW K;  4OPH A;  3O80 A;  1QZ5 A;  3C6T A;  4MLH A;  1IKX A;  3T7Z A;  2QTD A;  4BR2 A;  4DR4 K;  2X6S A;  2FXU A;  3ZSQ A;  3IDH A;  5GAE P;  3O3F A;  4PUO A;  4LSL A;  4RWT A;  1NGC A;  3AA4 A;  4MDA A;  5C12 A;  4JKG B;  3SQ0 A;  2CGK A;  3RMB A;  1C0M A;  1JLA A;  2CH5 A;  4CJT A;  2DFF A;  1VQ9 N;  4H4M A;  1D9F A;  4O55 A;  1NGF A;  1LOT B;  5FRO A;  3WEE B;  4UQG A;  1HRH A;  3MN7 A;  4DTP A;  5KTQ A;  5HRO A;  1UAX A;  3RRG A;  2ZF5 O;  1YJ9 N;  1U47 A;  4CGF A;  4F9O A;  1T05 A;  4BRP A;  3ZX3 A;  3AAP A;  4GNI A;  3OS2 A;  4X64 K;  3TAM A;  1NNE A;  3ULE B;  1JCF A;  5GAH P;  1NK6 A;  3JXU A;  3P39 A;  1XI1 A;  4CGI A;  3R6M A;  1S72 N;  2W6L A;  4E7J A;  5JMV A;  4CJS A;  3RTV A;  1NOY A;  3G71 N;  2GTD A;  1B9D A;  4FJN A;  1GLC G;  1NGE A;  4CZL A;  3OYE A;  3PY8 A;  4DTR A;  3AVJ A;  4CFA A;  2P9N A;  4CJQ A;  1IO2 A;  4O8U A;  3JYT A;  1GLE G;  4IO9 L;  3ITH A;  5BRF A;  2F9T A;  1JLG A;  1XQS C;  3A5N C;  4B3O A;  3D2E A;  3MEG A;  3DM2 A;  3ZT4 A;  4E1N A;  4CK2 A;  1WAF A;  3IAY A;  2I5J A;  5HP1 A;  3OYF A;  1LW2 A;  4BE0 A;  4CIF A;  1WSF A;  1LWF A;  3SV4 A;  2O8D A;  4FM1 A;  3CET A;  4I6M B;  4C8O A;  1SS6 A;  4K0K K;  1T3V A;  4M3W A;  4WYB A;  4KRF A;  3BEX A;  4FZZ A;  3C6A A;  3U9D A;  3KK3 A;  3D7E O;  3HPG A;  2E2O A;  3HM9 A;  3RR8 A;  3KVG A;  1KLM A;  4LF5 K;  4RG8 A;  2BH1 A;  3L8B A;  3WT0 A;  5AQO A;  3SMS A;  3PSF A;  5FRM A;  1XUP O;  3K9K A;  4AHC A;  2YNF A;  2FBY A;  4KHW A;  1QSY A;  3AAQ A;  3TSQ A;  3HBT A;  5AFU A;  3HRG A;  1HUX A;  2QK9 A;  1OVY A;  3L2V A;  2PAV A;  3PLA A;  2BUP A;  4C23 A;  1W0H A;  1FJG K;  4DV3 K;  3DLK A;  3UKR A;  4WQ4 C;  1YVU A;  3FZL A;  1C0F A;  3LP0 A;  3S9H A;  4KRE A;  2A40 A;  4JD2 A;  4N47 A;  4PL7 A;  1DT9 A;  3VEX A;  4PA1 A;  3Q7C A;  1ILY A;  3KK2 A;  4CF0 A;  1Z25 A;  1DLO A;  5AQR A;  1HMV A;  2QKB A;  4F3T A;  1N8R O;  1XHX A;  3HVR A;  4A2B A;  1ESV A;  4A61 A;  3QFU A;  2VG6 A;  1QHA A;  4MQ3 A;  3TAN A;  4BG8 A;  3LAM A;  4FLW A;  1EKE A;  3PV8 A;  3OS1 A;  3MWT A;  1ZBS A;  3VQE A;  5KI6 A;  2UUB K;  3DLB A;  3V9S A;  3DWL A;  2Z1H A;  3J8A A;  1RDD A;  5AQJ A;  1MWM A;  3CIP A;  4DF8 A;  3L3V A;  5HRN A;  1NK8 A;  3SAG A;  1VQP N;  4DMN A;  4AIL C;  1LV5 A;  5JIC A;  4M7X A;  2FSK A;  4HTL A;  3SV3 A;  3G4S N;  2B6A A;  1D8Y A;  1C1C A;  4IG0 A;  4BDZ A;  4JS4 A;  4JI5 K;  4M3U A;  4B9Q A;  5E84 A;  1NK4 A;  1VQO N;  5LY3 A;  4K42 A;  3K5O A;  1KQS M;  3UKU B;  5AQS A;  2E6L A;  4OPA A;  3VEV A;  1I39 A;  1YJW N;  1EWR A;  1QTM A;  3CCS N;  4YOV A;  2XY8 A;  3F5T A;  2Q31 A;  2OTL N;  4CJL A;  4H5V A;  1WNS A;  4JKE A;  4WCE L;  5BPL A;  1RT4 A;  4H5T A;  2A5X A;  1JL2 A;  3V9Z A;  2P9S B;  3BY5 A;  2Z1J A;  4B1U B;  4CEA A;  2F4V K;  1QVG M;  4F4K A;  1S22 A;  1G99 A;  3W3D A;  1WBB A;  1TAU A;  3HP9 A;  1FKP A;  4XEI A;  3IKM A;  2QWL A;  2HNY A;  1BA0 A;  2WON A;  4M3Y A;  3L2R A;  5HLF A;  4CGJ A;  4CHZ A;  5LMU K;  2V7Z A;  2HHT A;  1WSH A;  2O8B B;  4JI3 K;  3V6D A;  1NGA A;  3AV9 A;  3FGU A;  4FLV A;  3BUZ B;  2Q3S A;  3THX B;  5AQI A;  3DI6 A;  3ZSR A;  5AR0 A;  3PO5 A;  1IH7 A;  2D0P A;  4J8F A;  3WXL A;  3VQ9 A;  3V4I A;  2E1Y A;  1NMN A;  4U67 L;  5C24 A;  1W9H A;  3ENB A;  1R0A A;  4ID5 A;  4XH4 A;  3FE1 A;  3OVN A;  5GIP A;  4FW1 A;  5AQF A;  1NKE A;  3C7N B;  1HKB A;  4DSK A;  2F8S A;  2OPQ A;  3LWL A;  1YIT N;  3J7Y P;  5JLF A;  1UOC A;  3AO1 A;  1U2V A;  4H8K A;  3VQ7 A;  3O1W A;  3K0S A;  4M41 A;  3K9J A;  2VYP A;  4JKC A;  2FC0 A;  2P9U B;  2IVO A;  4XIU A;  3QEV A;  3DRR A;  4LH4 A;  1CZB A;  3WXK A;  2KFN A;  3TSU A;  2QWQ A;  3AY9 A;  3WQU A;  4DQ8 A;  1ZBU A;  3CCE N;  1FXX A;  2YJE A;  2NUB A;  1OH6 A;  1EO1 A;  1U4B A;  3K5M A;  3VEW A;  5ADX A;  2Z1I A;  3SQ1 A;  5AQH A;  3CG7 A;  2QWP A;  4O5B A;  5BPN A;  4PY5 A;  4JI4 K;  4JHD A;  1VQN N;  1DGK N;  4WE1 A;  3NF7 A;  5AZI A;  5AQP A;  3OJS A;  1NGB A;  3THY B;  3B6P A;  4N76 A;  3TAE A;  3HYF A;  3QIP A;  1C1B A;  3HVT A;  2ATQ A;  1U45 A;  3NVK A;  1TL3 A;  1Q81 O;  3I56 N;  4EHU A;  1P90 A;  1A5X A;  4H0Y B;  3VQ4 A;  1RBV A;  1BI4 A;  4QS9 A;  4BC4 A;  4ZTJ A;  1NJI O;  3U8X A;  4YY3 K;  1QZ6 A;  3WXM B;  4JI0 K;  3O8M A;  3P31 A;  4MFB A;  4LC9 B;  3F9K A;  3HSC A;  3DXK A;  4WQ5 C;  3SQ4 A;  2XY7 A;  4JK8 A;  3MCP A;  2E2P A;  2KW4 A;  4E7K A;  2I7P A;  1BL3 A;  1DTT A;  5BN8 A;  2AJQ A;  2KZM A;  2YHA A;  1DKG D;  3OJU A;  3MEE A;  3QER A;  1ZBH A;  4X65 K;  3H3O B;  3LP3 A;  3HOT A;  3A8Y A;  3ZT3 A;  1JJ2 M;  3MXM A;  2Z1G A;  3L4I A;  3ZX2 A;  1QQN A;  3CQX A;  5I3U A;  5HBM A;  3PX0 A;  4BRC A;  2O4G A;  1KC8 O;  4M3T A;  3LAN A;  1RCH A;  1YT3 A;  5SZT A;  3PX4 A;  5FRN A;  1RDC A;  1L3U A;  3BGR A;  3VA0 A;  3UIQ A;  4E19 A;  5M1O A;  3H1Q A;  1NGH A;  4W5O A;  5HL7 L;  5DK5 A;  4DV7 K;  3V1O A;  3V81 A;  4CEB A;  1HJO A;  4FVU A;  3SAH A;  3QNN A;  3VTI A;  1XHZ A;  1JXB A;  4FWO A;  2E88 A;  4BRA A;  3VQ5 A;  1VRU A;  1IKY A;  5AQN A;  3L2U A;  5LMN K;  4WFN L;  3CF5 L;  3MED A;  2IIR A;  3MX2 A;  1NU0 A;  2G8U A;  4YOY A;  3OYN A;  2DPN A;  3HO1 A;  3DXM B;  4IZ9 A;  1O1W A;  4B9M A;  1S9E A;  1VSL A;  1BG3 A;  3PIO L;  3CXC M;  3SJH A;  1RTI A;  4IEE A;  3GDQ A;  4FJX A;  4FJM A;  4CI6 A;  2P1J A;  1S6Q A;  2IDO A;  4NCB A;  1W7A A;  4KHU A;  3J7A P;  1RT2 A;  2GWJ A;  2LSN A;  4FYD A;  2WFB A;  3J80 O;  1VQK N;  2OZM A;  3SK3 A;  3SBG A;  2P5G A;  1T44 A;  5AZJ A;  4CZG A;  1HR0 K;  1IG9 A;  1GLL O;  2EX3 A;  2W41 A;  3CM6 A;  1BU6 O;  3O5B A;  3T19 A;  1HNX K;  3C6H A;  4DQS A;  3HM8 A;  2GX9 A;  2HND A;  2GEM A;  3C0B A;  3LDO A;  1TYQ B;  2PYJ A;  2QA4 N;  3TTD A;  4BR0 A;  1TUU A;  3L3U A;  3T1Y K;  3MX5 A;  4DTS A;  1XWL A;  3RWU A;  2YI1 A;  5BRD A;  4B1W B;  4MDB A;  1HNZ K;  3RR7 A;  3IS9 A;  1BCM A;  3ZX0 A;  3TAP A;  4C8K A;  3CD6 N;  5CR4 A;  5KQD A;  4B9V A;  3DOL A;  4J2E A;  3O9T A;  4IJA A;  1RT7 A;  2NRZ A;  1NK0 A;  3AVA A;  1WN7 A;  4YOW A;  3ZEU B;  1KFS A;  4DSE A;  5EU7 A;  2QWO A;  3FFK B;  2V51 B;  1YVN A;  4FWP A;  4BVP A;  3D6R A;  1ZXO A;  4DR3 K;  4WFA L;  1IV0 A;  4JKA A;  4CJ7 A;  5B8H A;  3TWH A;  4H0O A;  3NDK A;  4JI6 K;  4BRO A;  2W40 A;  1D5A A;  3IG1 A;  2WTU A;  3VQ8 A;  3OYL A;  5LJW A;  1TV6 A;  4O4G A;  1QVF M;  4WQ4 A;  3CQ8 A;  4FXD A;  3CJC A;  4DR2 K;  3A5O C;  1YHQ N;  4RW6 A;  1NK5 A;  4LF6 K;  2HF3 A;  4Z4H A;  4YNQ A;  2ZD1 A;  3A0I X;  2W42 A;  2J4R A;  3ISN C;  1IJJ A;  3EZ5 A;  4X62 K;  4JKG A;  3VGL A;  5AQU A;  1BQM A;  4DFM A;  5MLC Q;  4FWQ A;  4BDY A;  3VET A;  4EZ6 A;  3LPU A;  4C1N K;  4DQI A;  3B8A X;  2V52 B;  1DEJ A;  4W5T A;  1S1V A;  4FPB A;  3AO5 A;  1ATS A;  4CJ3 A;  2Q0U A;  3BF1 A;  4FWK A;  3U3Y A;  3DRP A;  1GLA G;  1D4X A;  3ZT0 A;  1TK8 A;  3ULE A;  3CC7 N;  3VTH A;  4B9N A;  1XC3 A;  4KHP K;  1CXQ A;  1K8K A;  4KAZ A;  4FJK A;  4Z4E A;  4JKH A;  4BQZ A;  4GKJ K;  3GG4 A;  4RW9 A;  1RDW X;  5AFU H;  5C42 A;  1HPM A;  3VOV A;  4B9T A;  3CPW M;  1MDU B;  5KGW A;  3L6Q A;  4CHP A;  2VQE K;  2GUP A;  5DM7 L;  4N5S A;  2O8E A;  4CHN A;  2BAN A;  3OTO K;  3VF6 A;  2HHU A;  3QBW A;  2Q2R A;  2O8C B;  1DTQ A;  1NWK A;  1T6D A;  3LDN A;  3O9Q A;  2E5L K;  3TR8 A;  4Z4G A;  4B1X B;  4RW8 A;  4CEE A;  2ZE2 A;  5GAG P;  5KRT A;  3CME N;  5GAD P;  3S3N A;  2EWS A;  4OLA A;  1NJZ A;  1RBS A;  4GVE A;  5C2D A;  1VQM N;  3VER A;  4CIG A;  1VQ5 N;  1BCO A;  4I6M A;  2QWR A;  1VQL N;  2V7Y A;  4F2S A;  4ILG B;  4EP4 A;  2E2Q A;  4BQL A;  3K5N A;  2YJF A;  2O4I A;  4DR5 K;  2QWM A;  3OS0 A;  3AAR A;  1HYZ A;  1TUY A;  2GV9 A;  1Q82 O;  4A59 A;  1WSE A;  4DLE A;  1OH5 A;  5GIO A;  3GOI A;  2QXF A;  2FF6 A;  4FM2 A;  4OPJ A;  1NKC A;  4F2R A;  4DF4 A;  1VSJ A;  4FLZ A;  1NGJ A;  3VEZ A;  5BR8 K;  2G8V A;  4KPY A;  5J2N A;  4FK4 A;  1ZBL A;  4LFB K;  3O6W A;  1SAZ A;  2IAJ A;  5JLH A;  1W2B M;  4B3M K;  1N32 K;  3QFP A;  3EKS A;  3EYZ A;  3SUO A;  2I7N A;  3VMF B;  2VG7 A;  3NGI A;  3SLC A;  3OYA A;  2YHY A;  1BQN A;  4DV5 K;  5F0X A;  3C6U A;  4CEO A;  4XH1 A;  4KHS A;  1X9M A;  3NVM A;  1BWF O;  1VSI A;  4JV5 K;  1J9A A;  2IC3 A;  5CZ1 A;  3W0L A;  1X9J A;  2P9I B;  4EAH D;  3V1R A;  4DQR A;  3KLE A;  3NBP A;  1B9F A;  4K25 A;  2A1S A;  3LM2 A;  4JI1 K;  2D0O A;  3HL8 A;  4FCY A;  5C2F A;  3OYG A;  3THW A;  4O8K A;  3TAB A;  4B3T K;  5C15 A;  4DV6 K;  1S1T A;  5HRR A;  3OYD A;  1LCU A;  2OZS A;  1E3M A;  1EET A;  1O13 A;  2E8A A;  4RCH A;  3K5L A;  2ZM6 K;  4DU1 A;  3KK7 A;  2UU9 K;  3QLH A;  3CI5 A;  1JKH A;  3ZSV A;  3G25 A;  4Z4F A;  3CCM N;  3SMP A;  4ELU A;  2HMP A;  3VQD A;  4BC5 A;  5CHI A;  4FJL A;  4RW7 A;  3H08 A;  1HYV A;  3KJV A;  4DR1 K;  2Y1J A;  2A1R A;  4K43 A;  1RDB A;  5FPM A;  2ASO A;  4DV4 K;  1FKO A;  3VES A;  2HW3 A;  2DFH A;  1T03 A;  5C25 A;  2YHX A;  4E7I A;  5H1S Q;  5JVH L;  3HJF A;  4CEQ A;  4JKF A;  2HBL A;  1RDA A;  1Y97 A;  3H45 C;  1WSI A;  2YHW A;  2FBX A;  5EVZ A;  4DTX A;  4WQ5 A;  5C10 A;  2D0A A;  1BOT O;  4TSX A;  2NNW A;  2P9S A;  2YV0 X;  3RVC A;  1YTU A;  1N5Y A;  2RE2 A;  2PY5 A;  2H3G X;  3DJC A;  1WB9 A;  3R3L A;  4FL9 A;  3PUF A;  4OPK A;  3I55 N;  1YJN N;  4B1Y B;  1KAY A;  3A2F A;  2YNG A;  3QEW A;  2VWJ A;  4K8X A;  2O8B A;  2RKI A;  1IKV A;  3AVB A;  4QOZ B;  3TAF A;  5I42 A;  5ADX H;  3MN6 A;  3JSM A;  2QEX N;  2NRX A;  4FLU A;  3ENO A;  1JLB A;  3THX A;  4FWN A;  1BIS A;  1OH8 A;  3AGR A;  1VAZ A;  2XY5 A;  4CEC A;  4FOE A;  4BC3 A;  1XC9 A;  3NGZ A;  1MA9 B;  5E26 A;  3ATV A;  2X6N A;  4AHU A;  1KVB A;  4LH5 A;  4IG3 A;  2P9P B;  5DM6 L;  3C7N A;  5AQT A;  3I8D A;  4IJN A;  3ZSY A;  4DUY K;  3SCX A;  4BRG A;  3AVI A;  1IG8 A;  3M8S A;  1VQ6 N;  1L5U A;  1U6Z A;  2UYT A;  4DFK A;  1QHT A;  2P9U A;  3D45 A;  2NRR A;  3O9U A;  1RFQ A;  4E1J A;  4CJU A;  1GOC A;  4BRK A;  5KRS A;  4BR9 A;  3E01 A;  2RN2 A;  3MAQ A;  3VF4 A;  3QBX A;  5M1Q A;  4BRH A;  4ISE A;  4FJJ A;  2XY6 A;  5FDL A;  1RT3 A;  3GE1 A;  3AA3 A;  4FJ5 A;  4DTO A;  1ASW A;  3FR0 A;  1HKG A;  4BRE A;  1QSL A;  4E7L A;  4DTN A;  4IEI A;  4Z94 A;  1TK0 A;  4M3X A;  1GOA A;  3SPZ A;  1RTH A;  4I9Q A;  2KLA A;  3OYM A;  1ATR A;  2HHH K;  2D0C A;  4DLG A;  2HB5 A;  3CJ1 A;  2P9L B;  4JKB A;  1WOQ A;  3CJ7 A;  2YNH A;  4DFP A;  4H5W A;  3AA2 A;  3THY A;  4RW4 A;  1EX4 A;  4JI7 K;  1BGX T;  4IO8 A;  5J1E A;  1BIZ A;  5ELZ A;  5KPT A;  3BP8 A;  3EN9 A;  1UA1 A;  4FM0 A;  1RGI A;  2GWK A;  2HST A;  2OAN A;  3F9M A;  4HHT A;  4B3S K;  4EHT A;  1NOZ A;  3FZK A;  4NXN K;  2F96 A;  3VQC A;  3CCR N;  1X9S A;  3TTC A;  1YF5 L;  2ZGZ A;  3BDP A;  1KXP A;  3C95 A;  3E9O A;  1TAQ A;  4AM6 A;  3T69 A;  4BRL A;  2QM1 A;  1VSE A;  4CGD A;  4J2D A;  4BRM A;  3IUC A;  1TKD A;  1V4S A;  4E89 A;  5FPE A;  4JI8 K;  4IOC L;  2HHV A;  3DAW A;  4DR7 K;  3HI0 A;  4CJK A;  3I0S A;  2ZGY A;  2G8W A;  1JLQ A;  4ISF A;  4C8N A;  3RMD A;  3H1V X;  1JLE A;  3CFO A;  1YUW A;  1NM1 A;  4YDU C;  5M1F A;  3HTV A;  1GOB A;  4CGH A;  2YNI A;  5HRS A;  4FLY A;  1C0U A;  3AGK A;  1U2V B;  4OVL A;  3LDL A;  4CEF A;  4ELT A;  1OH7 A;  1L3S A;  4R79 A;  4E1M A;  1NGD A;  3K2P A;  2HHW A;  1LWC A;  4KH4 A;  4ICL A;  2PFU A;  2QKK A;  1VK0 A;  2KQ2 A;  5JVG L;  3H3N O;  1K9M O;  1A5V A;  5BR9 A;  4KFB A;  3VA3 A;  3JS6 A;  1KVA A;  2BE2 A;  2FSJ A;  2A41 A;  3TU5 A;  1NLV A;  4L8R B;  3NF9 A;  2E1Z A;  4Y1C A;  3TPQ A;  4LFA K;  1MU2 A;  3L2W A;  5KQ8 A;  3AO4 A;  2JLE A;  2UUA K;  3RSE B;  3D2F B;  4IOX A;  4HCB A;  1KLN A;  3DXM A;  4CD1 A;  3CJA A;  3ZET B;  4LSN A;  2VWK A;  2HBJ A;  4FWM A;  5LL6 Z;  4DS4 A;  4IDH A;  3QDK A;  4N41 A;  1Z05 A;  4G1Q A;  3R9P A;  1RBT A;  3V1Q A;  1SKR A;  4DV2 K;  2VGM A;  3CJB A;  4CD3 A;  2ITM A;  4M63 C;  3AVG A;  4FWR A;  4DB3 A;  4CBU A;  1J53 A;  4X66 K;  5AQX A;  4FSV A;  3CQY A;  3KD5 E;  3KKR A;  3SBT A;  4CBW A;  4CJE A;  2NZT A;  1WLJ A;  3QET A;  3NH1 A;  4H5R A;  2XO7 A;  1TYQ A;  4YHH K;  1B92 A;  5FLX O;  3T1H K; 
#chains in the Genus database with same CATH homology
 1N34 K;  4NXM K;  4LF9 K;  4GKJ K;  4JI8 K;  4JV5 K;  4X64 K;  1XNQ K;  4DR7 K;  2VQE K;  1IBK K;  5IT9 O;  3OTO K;  1IBM K;  4JI1 K;  3T1Y K;  4DUY K;  4B3T K;  1HNZ K;  4DV6 K;  2E5L K;  4X65 K;  2UXC K;  4DR6 K;  2ZM6 K;  2UUB K;  2UU9 K;  3J7Y P;  2UXB K;  4V19 S;  4DV0 K;  4DR3 K;  4CW7 B;  1XNR K;  4JYA K;  5A2Q O;  4DV1 K;  4DR1 K;  4JI6 K;  2VQF K;  4DV4 K;  4GKK K;  4JI2 K;  5AJ3 K;  4DV7 K;  1XMQ K;  1IBL K;  4DR2 K;  4JI5 K;  1N36 K;  4K0K K;  4LF6 K;  4LFA K;  5IWA K;  4DR5 K;  2UUA K;  1J5E K;  4CVN E;  2HHH K;  4LF7 K;  5LMN K;  4LF5 K;  4OX9 K;  5LL6 Z;  3J81 O;  4DUZ K;  4X62 K;  5BR8 K;  1HNW K;  4JI4 K;  4DV2 K;  4JI7 K;  1XMO K;  4DR4 K;  4LFB K;  2UUC K;  2F4V K;  4B3M K;  1N32 K;  1I94 K;  4B3R K;  4X66 K;  4LF4 K;  3JAM O;  3J7A P;  4B3S K;  3J80 O;  4NXN K;  4AQY K;  4LF8 K;  1FJG K;  4DV3 K;  4DV5 K;  5LMU K;  1HR0 K;  1N33 K;  2UXD K;  4LFC K;  4KHP K;  4YY3 K;  1HNX K;  4YHH K;  4JI0 K;  4JI3 K;  5FLX O;  3T1H K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...