2UUCK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2uucK00
4B3MK 2VQFK 5LMNK 3OTOK 4B3SK 4DV0K 1N34K 1N33K 4OX9K 1XNQK 4B3TK 4DV1K 5FLXO 4JI5K 4V19S 1HNWK 4X65K 4DV3K 4JI8K 4NXNK 5LL6Z 4X66K 4LF9K 4LF5K 3T1HK 4JI4K 4B3RK 4DR3K 1IBKK 4DR1K 5IWAK 4JI6K 5BR8K 4KHPK 4DV6K 4GKJK 4LF8K 4DR6K 4DUYK 4JYAK 4DV7K 4X62K 3J7AP 4DV4K 4CW7B 3JAMO 2F4VK 3J81O 1XNRK 1IBLK 2UU9K 4JI0K 2UXDK 1N36K 1IBMK 1HNXK 4LFAK 4YY3K 3J80O 3J7YP 4X64K 2E5LK 4LFCK 5A2QO 1I94K 4YHHK 1J5EK 4DR5K 2HHHK 4K0KK 4CVNE 2UUAK 2VQEK 2ZM6K 2UXCK 4GKKK 5LMUK 4JI7K 4AQYK 4JI3K 2UXBK 4DR4K 4LF7K 4DV2K 4DR2K 4LF6K 4LFBK 2UUCK 3T1YK 4DR7K 4LF4K 1HNZK 4NXMK 4DV5K 2UUBK 1XMOK 1HR0K 4JI2K 4JI1K 1FJGK 5IT9O 1XMQK 5AJ3K 1N32K 4DUZK 4JV5K
chains in the Genus database with same CATH superfamily
1K6YA 2Z1GA 4DHYA 2ZJRL 2YNIA 4JAXA 5HROA 4QS9A 4DSIA 1XWLA 4OKEA 4CJWA 3R9PA 4JKHA 4FM1A 3SLCA 2HMIA 2YHXA 2O8DB 1RBUA 3K5MA 4OLAA 2GWKA 5EXWA 4AH9A 5C0YA 3ZSYA 4E1JA 2ZJPL 1TKXA 2F9TA 4RTFD 1IBKK 4OKJA 5AQVA 1Z26A 4CFAA 4BR9A 4J8FA 3PSIA 2E8AA 3BEXA 4X62K 3K5NA 5E26A 4JHDA 2G8FA 4AILC 2A5XA 1WN7A 4CEOA 1KVAA 4KB0A 4ILGB 2AJQA 3O1WA 3WT0A 3CC2N 1DKGD 3LPUA 1BHLA 1SL2A 3AAPA 2P1JA 4B8AB 4YY3K 3MN9A 1U48A 3PIPL 1VQMN 3TI0A 2NRZA 3R1XA 4LD0A 1RDCA 3KHYA 1YUWA 4FL9A 4CI6A 1BCMA 3OS1A 4BRFA 5HRPA 3FZLA 1VSHA 2KQ2A 4HTLA 3KJVA 4F2SA 3MMVA 4JKAA 1JXEA 2QA4N 3SUPA 2HF3A 3DWLA 4DQSA 3C95A 2KLAA 3CYMA 3S41A 4JI7K 3NH0A 4FK2A 5F0XA 2IC3A 4LF7K 4KHYA 4BRIA 3CM6A 3ZT1A 2FF3B 3AA4A 2G8HA 1IKWA 4AHSA 4RW4A 4OJRA 1RILA 4B8CA 5I42A 1X9MA 2ZF5O 4CGHA 1VHXA 2QKKA 3NH1A 3TAMA 2X6SA 5FPDA 1QSYA 2NZTA 3AO3A 3V1QA 2XHBA 4CHNA 3TABA 5J2QA 4XH1A 3LAMA 4CIEA 4H03B 3OYAA 3EE9A 3HSCA 2VGMA 1ASVA 2PAVA 2O8CB 3V81A 4B3TK 2P9KB 3O3HA 4DU1A 1TV6A 3VEYA 3CCSN 1KRPA 1S72N 1H1VA 3PY8A 2XY6A 4A5AA 4CJRA 1U45A 3QEIA 5CY4A 1ZBUA 3Q7CA 2YHBA 4MDAA 2J4RA 2QI2A 4E1MA 4BQLA 3PSFA 3CQ8A 1MA9B 4JI6K 1A5WA 3UKUB 1T7PA 2ASOA 3K5LA 4XEIA 1S9GA 4DV7K 4MQ3A 4KH4A 4JK8A 5KTQA 1NGFA 3ENOA 4H4OA 4B9LA 4DSFA 4DU4A 1QVGM 4W5QA 3AVJA 1KC8O 4IBNA 3IKMA 3WQUA 4U67L 4BDYA 1X3NA 3P1GA 3HXMA 3SNNA 4JKBA 4DSJA 2F4VK 4KHSA 2HMPA 4CEQA 1U2VB 2YNHA 3MCAB 2HNYA 2VG6A 1L3SA 4DQ8A 3H6EA 4M3YA 2JWLA 4CZLA 4O5FA 4OPHA 1LWEA 3KLFA 3RTVA 3THYA 2Q97A 5FPMA 1D5AA 3NGYA 2YX6A 1QS4A 3PX0A 1OKJA 4OVLA 3VGKA 4JD2A 3KK1A 2QW9A 4IJAA 3WEEB 4PY5A 1CXUA 5AFUH 1NGBA 4CJFA 3VQAA 3SCXA 4FSVA 4TSXA 5GIOA 4DR2K 1C1AA 3HM8A 1VQ7N 2QK9A 1NU0A 3W3DA 1NNEA 3EO3A 3VENA 1TK8A 5AZJA 4OKKA 1X9WA 2RHKA 4DFMA 3P4IA 1G99A 4CIFA 1VQ9N 4JK9A 3HP9A 1XHZA 1F21A 5AQMA 1YI2N 3NVMA 1CLQA 4E7JA 5DK5A 5CE3A 3I0RA 2KZMA 4L8RB 4FLTA 1YXQA 3CPWM 1NK8A 5HL7L 1Q86O 4R5PA 1XI1A 2KW4A 1K8KB 4OPAA 3ZX0A 1I3AA 2GTDA 3KK7A 4FWMA 4ZTJA 1YT3A 4X65K 3P31A 1WLJA 4IJNA 4PKHA 4JI8K 4B9UA 5LL6Z 3WXKA 1YTUA 3GG4A 4X66K 5AQWA 3QB0A 2FSKA 1RBRA 2W6KA 5CYMA 4CZFA 4CJSA 4NCGA 5C10A 3LAKA 3VEXA 1S1VA 4F9OA 4DF8A 4AF1A 4HCCA 4NB4A 1DTTA 2OPPA 1VSMA 3RSEB 3G25A 3RRGA 1HYSA 2O8EA 1QSLA 1DT9A 4A62A 2P9LA 3E01A 1N6QA 1RT2A 3LALA 3SBTA 5AQXA 1NLVA 2OTJN 3LWMA 1OVQA 3KK3A 1BCOA 3QO9A 3DLKA 1XNRK 4CERA 1KQSM 3H3NO 4YDUC 4KKOA 3SMPA 5B8HA 3UB5A 1LAWA 5EOYA 5A2QO 4FCYA 2YNGA 3ZSZA 2YV0X 4DR5K 3KLHA 4E7HA 3OYEA 1EXQA 4A57A 3GL1A 4FJMA 3OBYA 4KFBA 4CFDA 1RT4A 3THWA 3T19A 4BRLA 3VQPA 3NF8A 1W9HA 2D5RA 5CZ1A 1HR0K 3RMAA 5GAHP 2ZQBA 4ZHRA 3E9PA 1DEJA 4WQ5A 3ZSVA 4YORA 4CJEA 4M3XA 4JKFA 3D45A 5AR0A 3NMUA 4CECA 4FJNA 2P9NB 4CK1A 4NO7A 2Y1JA 1SKSA 3CI5A 3H08A 1N5YA 2QXFA 3OTOK 3U3YA 2Q1NA 1REVA 4KV8A 1N34K 2XO7A 3AA3A 2HSTA 3O9RA 3VEVA 4CHQA 2E1YA 4M3TA 4YOTA 4CEBA 3MECA 4DMNA 1RDDA 4GV9A 4JI5K 1WAJA 2ZGZA 3LWLA 3O9QA 5EU7A 3KLGA 4CGDA 2GWJA 3CJ9A 4EZ6A 3W0LA 1CXQA 5ELZA 4LF5K 4DR3K 4MLEA 2YJEA 4BC2A 2QWPA 2YKNA 3OYGA 1S5JA 4IDHA 3RR7A 3OY9A 3M8QA 4I2PA 1KTQA 2P9PA 2P9SB 3ZSRA 1T03A 3SJHA 1HUXA 1RFQA 2XY7A 3TARA 3CMEN 3AO5A 4I7FA 4PQUA 3NHGA 2NNWA 3OW2M 1WB9A 4BC3A 3PO5A 3JS6A 2VYPA 3SQ4A 3C94A 1E4FT 2PZSA 3A2FA 1YJNN 2F96A 3FFIA 1DLOA 3TSUA 2CGJA 4GVEA 4CZHA 5BREA 5C2DA 1BUPA 1WSFA 4B08A 4KHNA 4UY8O 3ZT3A 5LJWA 4DFKA 3EN9A 2VQEK 3THXA 1ZBLA 3ZLJA 3O9UA 2VG5A 3AAQA 2QM1A 3SPZA 1EWQA 1L3UA 1TYQA 4NYFA 4FZXC 3H3OB 2NRHA 4KHUA 4DR7K 4LF4K 3CPEA 1GLCG 2IVPA 2E2OA 5AZIA 5C25A 4IO8A 4OLBA 3TAGA 3QDKA 1TUYA 3HI0A 3VPZA 3HT3A 1BL3A 3FE1A 4FOEA 4CD1A 1GLBG 4N5SA 4E7LA 2X74A 4LY7A 3EL2A 4BRCA 2GELA 2QXLA 3A5NC 3I8BA 5C12A 4B3SK 4RG8A 3QFPA 3R8EA 4NLBA 4AHTA 3MX5A 1UOCA 5AQUA 5F1XA 3C6TA 5GIPA 3G4SN 3BY5A 4FJXA 1HNWK 1KLNA 4KTWA 4DLGA 4H0XB 1NK7A 4JRPA 4FLZA 4IOXA 4K43A 3CCLN 2RF2A 4IZ9A 3TR8A 1R59O 1NGGA 3L2RA 4O0IA 3RMCA 2JWKA 4CJVA 2NRXA 1UA0A 2RE2A 4BR2A 4CK2A 2PBDA 3CETA 4GW6A 4JLHA 4O44A 3AVBA 4O4GA 2BANA 1BIUA 4ELTA 3NF9A 4JHDB 3BZKA 1VSLA 1QE1A 3RMBA 3HYFA 4EP4A 2G8VA 5M1QA 4EP5A 1IBLK 5HRNA 1T3VA 4N56A 3B6OA 3VQQA 2BH1A 3BGRA 5BRDA 4C1NK 2E5LK 3FZKA 3H1QA 1TKZA 5AQLA 1Q9YA 4CGJA 4KI6A 2HVIA 1NM1A 2QWOA 2P9UB 1K73O 1GOBA 2ZGYA 3IRXA 4EIAA 3V9XA 4CZIA 3K58A 1R0AA 4CEFA 3OYFA 3HO1A 2RKIA 3B8AX 4BRHA 4CEAA 4DTJA 2P5OA 3SBGA 4CZMA 4JRQA 4BRPA 4C8MA 3VMFB 3DI6A 4HUGA 3GE1A 1RT6A 3VA0A 2D1KA 1XMOK 4BROA 3LPTA 5T7BA 5HP1A 4FWOA 3GBTA 1QQCA 3N4PA 3P38A 3NF7A 5AJ3K 4B9TA 3AGRA 3CCRN 1N32K 3TAQA 3MX2A 4I6MA 4PHTX 4CJKA 4BGBA 5AQYA 2O8BA 3IDHA 3HPGA 4V19S 3ZEUA 4U7BA 1YVNA 1BA0A 1ILYA 2IDOA 2Z1IA 3CCMN 3DRRA 4BRAA 4FXDA 3EKUA 4LF9K 1HLUA 2OTLN 3DXKA 4JEPA 2HBJA 3CQYA 4DR1K 4BC4A 2H3GX 3L2QA 4KHPK 3HPHA 1XC9A 1WAFA 1LAVA 5SWMA 4E89A 3NH2A 5JLHA 3G10A 1ZBSA 3T7ZA 4JYAK 2E2PA 2D0OA 4DSEA 4PL7A 2Q3SA 3VQCA 3HM9A 1A5VA 4BR0A 2O8FB 5FRNA 3SAGA 3D2EB 4MFBA 1VQ4N 3ZSWA 4AHVA 4BG8A 1GLJO 1V4TA 4FJ7A 4OO1J 4B9QA 2BDPA 1RGIA 1IBMK 1BQNA 3L2UA 1NJYA 2IAJA 4Z4HA 3PV8A 2HNZA 2EX3A 5BPLA 3VF2A 4KHWA 4W5TA 4CGIA 5AQPA 4B9NA 4K0KK 2FXUA 3OYNA 4CVNE 3D0PA 4GV6A 2CGKA 4ILJA 4CJPA 3B6PA 4Y1CA 3GDQA 4ELUA 1BO5O 3O08A 3QBWA 4Z0UA 1MWMA 4BVPA 3LDSA 4K42A 5JMVA 3QFUA 3CCQN 4DR4K 1XUPO 4BC5A 1Q8IA 4FLWA 3CC4N 2HVHA 3CCUN 4BE1A 3CXCM 1MDUB 4CJ7A 1ZBHA 4MO5A 1YJ9N 2HHQA 2ZE2A 4CZKA 4OPJA 4C8LA 3O4QA 4Q5VA 1NGHA 2HNDA 1L5UA 1J54A 3ULEA 3L2VA 2PYJA 1HX1A 1RBTA 5CR4A 2A40A 3H46O 4YOXA 3ID6A 1N33K 4DTSA 4WE1A 4B1WB 1WSJA 4ISFA 3ZETA 1WBBA 1VRUA 2V51B 3WNGA 4ICLA 3K57A 2E88A 2E4LA 4FJ8A 2Q31A 4FWNA 1SL0A 4XH5A 1NWKA 1VQ6N 4C8KA 5KQ8A 1HJRA 5SZTA 4KB1A 1HPZA 3WNFA 1P8ZA 1TKTA 1Z6RA 3OYJA 4M42A 3EZ5A 2BTFA 2OA8A 3G71N 3OYIA 1D8YA 1HKGA 1EETA 3D2FA 4DQIA 5GAEP 2JGUA 3DLLL 1NMDA 4BDZA 1C0FA 1J9AA 2P9LB 4O55A 1RCHA 3C7NB 5FPNA 3MEDA 2A1SA 2B6AA 2O4IA 4F4KA 4I9LA 2IOCA 3FR0A 4GV3A 3LDOA 3QMLA 4FWPA 4J2DA 3HVRA 3CCVN 2AP1A 3QBXA 4CJ4A 3J8AA 3O9SA 3VN5A 2F9WA 3H1VX 3J7YP 2NUBA 4NYNA 4GMJB 4FW2A 3VQBA 3DOLA 2YCHA 3UKRA 3O1BA 2HHUA 5JS1A 1RTIA 4M3WA 1KLMA 5AQTA 4PKIA 4GY2B 3THWB 4CHPA 1U4BA 2X78A 1CZ9A 1KAXA 2V7YA 3O8MA 2HHWA 4NXMK 3U8XA 3PIOL 4G1QA 3AVGA 4JI2K 4BR7A 3AGKA 4IG3A 4CBUA 4H8KA 3CHWA 2E6LA 1V4SA 3DXMB 4A5BA 4KTQA 5AQRA 3TAFA 3LANA 5GAGP 5AQOA 3S3NA 1QZ5A 2E6MA 4RW6A 1NGJA 4LC9B 4ELVA 5BPMA 3MN6A 1WSHA 4B3OA 3ZT4A 2CH5A 4GVMA 4FJHA 3D7EO 1HKBA 3I0SA 5LY3A 1KFDA 2OCEA 1UWBA 3I55N 3KD5E 4K8ZA 3NGIA 4FJGA 5KRSA 2FSNA 4Y0WA 3SMSA 4WCEL 3LP2A 3QESA 2Z1JA 2VG7A 1B9DA 4DFJA 3VEOA 4CGFA 5J2NA 1IG9A 2IGIA 5HOOA 1W0HA 2YI1A 5MLCQ 3KZBA 2B4JA 3ALYA 4HUEA 4DQQA 4H0VB 3O80A 1NKBA 2DFHA 3LP3A 4W5NA 2VWKA 4YOUA 3TTDA 1IV0A 3J7AP 4DV4K 3T69A 1C6VA 4FYDA 4JK7A 3IG1A 4JNEA 4Y1DA 2HHVA 2HBLA 2EWSA 4L3QA 3I8DA 1J53A 1D4XA 1T8EA 3AV9A 4CFCA 4Q0BA 4CCHA 2I7NA 4QS8A 1LW0A 2HHTA 4BRKA 3ZSQA 1KAYA 2D0BA 3E1YA 1NKEA 4Z4FA 4FJ5A 4Z4GA 4DTNA 4FW1A 1JL2A 1Q81O 2HBMA 4C1NI 4E19A 4BRDA 4M41A 1RDUA 1ATNA 3MCPA 2F7TA 3O6WA 3VQEA 3ZYYX 4DB3A 1X9SA 3IMXA 1LOTB 2D0PA 2O8CA 2CGLA 5C42A 1ASWA 2VWJA 4DQRA 2P9KA 1TYQB 3I33A 5HRSA 1VRTA 4FWRA 3E9LA 4EZ9A 5CYQA 3SUNA 4PL8A 3SAHA 4B9MA 2VCPA 3CJAA 2QWQA 3UKUA 3E9OA 3QNOA 3S3OA 4KPYA 3CMAN 4YOVA 1BOTO 5HLFA 3CG7A 4M3RA 3G0ZA 3L0QA 2Q2RA 3EZWA 4DV1K 5FLXO 3SPYA 4B1YB 5DMRA 4WQ5C 3WNHA 2NRRA 2QWNA 1TUUA 4Z4CA 1T6DA 5AQQA 1ESVA 3ATVA 1A5XA 4JI4K 3MEGA 3SZ2A 3IUCA 1GLEG 1U2VA 4JS4A 4DSKA 1O13A 4CJQA 3CCJN 3K2PA 3WQTA 5DM7L 4DFPA 2QWLA 5TKYA 1YITN 4DTRA 3CQXA 2HBKA 3SJJA 3AA2A 1OVYA 3WXIA 4JKGB 3V4IA 4CF0A 2ITGA 3VF4A 4J2EA 4H0YB 2V7ZA 3MXIA 4FWKA 5M1NA 3WEEA 4CZGA 2W41A 3O3FA 4FJ9A 3LDLA 1Q18A 1XC3A 4CF9A 1LW2A 4HWIA 1HRHA 1JJ2M 4K25A 3SV4A 1IJJA 1YHQN 1BQMA 3U4LA 1WSGA 4LFCK 3CM5A 3MN5A 3LDPA 1J5EK 3KLIA 4BWMA 3VOVA 2Q0UA 4O8UA 3MK6A 2IVOA 4IEIA 4BGAA 3KTQA 3G6EN 4FLUA 1K8KA 4DV2K 1TAQA 4LFBK 3SQ1A 4DV5K 1Q9XA 2BUPA 3MDQA 1GLFO 4DCHA 3CIPA 3QIOA 3FGUA 4FJKA 2X6NA 4FJLA 3L6QA 3L8BA 4NCAA 1C0MA 3T3FA 4DUZK 3KD1E 3CERA 2KFNA 1VAZA 3HJFA 2ATQA 4B3MK 1RBVA 4I6MB 2QWRA 5EVZA 4BQZA 4BDPA 2YJFA 3LDQA 3VA3A 4DV0K 1YAGA 2XY8A 4FO0A 3TSQA 4CIGA 5GADP 2ETJA 4DWIA 1XNQK 4K8XA 3QLHA 3BF3A 4DTMA 3TSPA 1O1WA 1NGEA 4FWSA 4RW7A 1NKCA 1B92A 1HMVA 3LZJA 3NFAA 1BI4A 1FKPA 5LJVA 3F5TA 4B1XB 1QQOA 2UYTA 1X9JA 3TAEA 4A61A 4F2RA 1ATRA 3MXJA 1GOCA 4M7YA 1IG8A 3VEWA 3VQ7A 1NGCA 1GLDG 2GUPA 1TL1A 1NK4A 4C23A 1RT5A 1S9EA 2ZD1A 1HQEA 1WUAA 3F73A 1RDWX 4BRMA 3AO1A 3QERA 2P9IA 1TAUA 4IFEA 3V6DA 1WOQA 2FC0A 4KO0A 3LM9A 4KH6A 4NLCA 4ID1A 2FF6A 4IG0A 2XY5A 3J80O 5J2MA 1C0UA 3NGZA 1TK0A 3FZMA 4E7IA 2JLEA 1Q7YO 1IKXA 1GLAG 1T6CA 4CEZA 1HNIA 3DLEA 3LM2A 3HOTA 2DFFA 3NF6A 5LMUK 1LWFA 3H45C 4E0DA 5H1SQ 1C0TA 3KK2A 1VQON 1DTQA 3T1YK 1D9FA 3L2WA 5I9EB 4FJJA 3ZT2A 3OYKA 1JKHA 4EHTA 4JI1K 1ZC6A 3TTCA 3DRSA 2PFUA 1U6ZA 1XMQK 3A8YA 1TK5A 3AVLA 1JCFA 3ULEB 3P39A 4W5RA 3OJUA 2E1ZA 1GOAA 2QWMA 1EP4A 2P9SA 4IOAL 3VF6A 4ILHA 3R3LA 5M1KA 4KI4A 4H5VA 1CZBA 4DTXA 1C0GA 2A3ZA 4FOIA 2OZMA 3OYHA 4WQ4A 3V9UA 3A5LC 3HP6A 3K5OA 4GNIA 4XH4A 3L3VA 1JLQA 1FW6A 4GKJK 4OGCA 1K8AO 4CHYA 2WC9A 2E20A 4CHZA 4CJUA 4H5TA 3U3GA 3AO4A 1FKOA 2WBNA 1B9FA 1WSIA 4CGGA 4IOCL 5AQJA 4FK0A 5FPEA 3VGLA 4B9SA 1HJOA 4QS7A 1RDBA 4DLEA 3RR8A 1M1KO 3M8PA 2RPIA 4IFYA 1C1CA 4KHQA 1I94K 4E1NA 5JS2A 4YOWA 3MXMA 3ZSXA 1LV5A 3TTFA 3NCIA 4N41A 1QVFM 4MO4A 5AQSA 3ZX2A 3OYMA 4H5NA 4IO9L 4CBXA 3ISNC 4QCLA 3EKSA 3Q7BA 3QIPA 3M1FA 3M8RA 2GUIA 3TANA 3HSTB 3RWUA 5KGXA 4FK4A 2UXBK 1JL1A 1NK6A 3UE5A 1GLLO 2YHAA 3A5OC 4DS5A 4BE2A 4N47A 5FDLA 4IEEA 5EX5A 2ZJQL 1NGAA 3THYB 3ASMA 5FRMA 3T1AA 1VSJA 4ID5A 3MWTA 2YHWA 4DS4A 1JLCA 2YHYA 4F3TA 4JKCA 4KBOA 2CH6A 3OYLA 5AQHA 1QHTA 1BDGA 1RDAA 3L4QA 3V1RA 3ZT0A 1RNHA 4JD2B 1NK5A 4Z4EA 5I3UA 3HPOA 4FLYA 3FZHA 1ZXOA 3V9ZA 2DPNA 3V1OA 3QICA 4A59A 4K41A 3VTIA 1T44A 5AZJB 2HW3A 3CFRA 4CK3A 3BUZB 3THVA 4B3RK 2DTUA 4A2BA 5ADXH 3MWPA 1NOYA 1QHAA 1RTDA 3WXJA 2I5JA 3KWIA 2G8IA 4I2QA 3KLEA 4RW9A 2IIRA 3DLHA 5D3GA 1SKWA 3WXMB 2A42A 1FXXA 1E3MA 2B5JA 2P9UA 1IH7A 4FZYA 3CFOA 1U49A 4M3UA 3HBTA 2OPSA 2HHXA 3SYZA 1KCFA 3DAWA 1IKYA 1JLGA 1L3TA 3EYZA 4LSLA 1OH8A 1QTMA 1BA1A 3OS2A 2OYQA 3NVKA 4HCBA 5E41A 5FROA 3QETA 4OPKA 4YHHK 1WSEA 5C2FA 4BRNA 3CC7N 2O8EB 4UQGA 4HTUA 2UUAK 3K0SA 1I39A 4FPAA 2WTUA 2FSJA 1Y97A 1NJXA 3KWGA 3U9ZA 4PUOA 3QEXA 1NG9A 1YTAA 1NGDA 1Z05A 1WBDA 3O4WA 4JS5A 4AM6A 4B1UB 2ASPA 5AQGA 4BWJA 4IKFA 3ITHA 3PO4A 4PKGA 3O3GA 1VSEA 1RT3A 5IT9O 1NGIA 1VQ5N 1BU6O 3DM2A 4FVUA 1KXPA 1TL3A 3MN7A 1JLFA 2KKZA 1D9DA 4FLVA 2ZWHA 5KI6A 4JKDA 3VQ4A 4MLHA 4E3SA 1EQYA 3A5MC 1ZBIA 4RWTA 3PX4A 2O8DA 2O8FA 4OGEA 3ATUA 4CF2A 1X1PA 5F2RA 1XHXA 3FLCO 3MEEA 3QEWA 1FK9A 3D2EA 3BF1A 1N8RO 3SI6A 4KH5A 4CJLA 1E4GT 3C6AA 4FJIA 3F2KA 3UIQA 5BR8K 4CFBA 2HB5A 3NAEA 5JVGL 4H0OA 1IKVA 4IDKA 4DR6K 1RT7A 4AHRA 4CJ3A 3AVFA 2BE2A 4NCBA 2GV9A 2FBXA 3HVTA 2BGGA 2NRTA 5CHIA 1Q82O 3E66A 3AVCA 3AVIA 4B9VA 4BY9C 2D0AA 1SL1A 1EWRA 4FWLA 1IO2A 3JYTA 3MAQA 3A0IX 4JI0K 2UXDK 3D6RA 1HNXK 2HF4A 1EKEA 4I9QA 3TAPA 3O9TA 3IAYA 4Z4IA 2HHHK 2FBTA 2YNFA 1S3XA 4HHTA 2P9PB 1JLBA 4W5OA 5AQNA 3TWHA 4KRFA 4JKEA 4MDBA 4DF4A 3AVHA 5DM6L 4HVJA 2WONA 4H4MA 3NBPA 1KD1O 4WF9L 3CFPA 4FM2A 2D0CA 1WNSA 2Q0RA 1QQMA 4B1ZA 3KVGA 3CJBA 1DGKN 3K59A 2Y1IA 3OHRA 1YIJN 3BZCA 4FZZA 1HQUA 4HUFA 1P90A 5BR9A 4KTZA 1QSSA 4WFAL 2W6LA 5HRRA 2A41A 3OVNA 4DKWA 5C24A 4PWDA 3THXB 5KQDA 1EO1A 1VSIA 3HTVA 4DU3A 3ZCMA 3NDKA 1KFSA 4AHUA 3U9DA 3K9KA 1J6ZA 3AVAA 3SUOA 3I56N 2OANA 4DG1A 5AQIA 4CJ5A 4AM7A 4BG9A 5AZIB 4DV3K 3C7NA 5M1PA 3EE8A 3QNNA 4M3ZA 1UAXA 1SQKA 1NOZA 3DYAA 2FBYA 3T1HK 2ITMA 3O5BA 1BI4B 4BREA 2NLXA 1ZYQA 2PYLA 4DQPA 4YDUA 4RCHA 4DV6K 1KVCA 2ASMA 2WOMA 3OS0A 1BISA 1KVBA 3VGMA 5JICA 1L3VA 1YJWN 3SV3A 4AHCA 2G8KA 5M1FA 2IVNA 1X3MA 2HHSA 2P9IB 5CZ2A 3M8SA 3J81O 3CJ1A 1S6PA 2UU9K 1LCUA 4C8NA 3LP1A 1N36K 3OJSA 3AVKA 1MU2A 1UA1A 1NK9A 3DXMA 3PX6A 3HK2A 3FFKB 2A6AA 2P5GA 2QKBA 2WUSA 4M7XA 2E2QA 4FPBA 4CJTA 1VQ8N 3M6GA 1JXBA 1TVRA 4J2AA 3NE6A 1JLAA 4BE0A 1MWKA 3EY1A 1ITGA 3HOSA 3U6FA 4EFHA 3RRHA 2NRWA 1S22A 3IS9A 1SAZA 3SAFA 4ISEA 2UUCK 4DTOA 1KSPA 1HNZK 4LF6K 1JCGA 3AY9A 1C1BA 3C0BA 4H5WA 2GBZA 4CZJA 1VQKN 1G15A 2RN2A 2LSNA 1JLEA 2NRVA 5J1EA 1BG3A 5HBMA 5AQKA 4EHUA 3DLBA 1BGXT 4ISGA 2DY4A 1XQSC 3VETA 1HYZA 2VQFK 4CEEA 2F8TA 5LMNK 4CZEA 3QEPA 2I7PA 1HPMA 5ADXA 3OYBA 4WFNL 4OX9K 3OBWA 4B1VA 2P51A 2KHOA 3TPQA 3VEZA 1T05A 2G8UA 4F3OA 2KFZA 1W97L 1CZAN 3OYDA 5JLFA 3SQ2A 1RT1A 4NXNK 3VQ8A 4XIUA 4FLXA 2FBVA 3ENBA 4LH5A 3P5JA 3SUQA 3ENHA 5KPRA 3L4IA 5KPZA 1K9MO 3RMDA 3AA5X 3DLRA 4BACA 3RSEA 2OPRA 3VESA 4DUYK 3V9SA 3R6MA 2O8BB 4RW8A 3LL3A 1KAZA 3S9HA 4CF1A 4FWQA 1J5OA 2A1RA 1SKRA 2AA4A 1BWFO 3BDPA 3ZEUB 5JVHL 3RVCA 4CW7B 5GINA 5AQZA 3DOKA 4R79A 2VWBA 1SZ2A 4LSNA 3JAMO 5J2PA 1NK0A 3M5RA 2GX9A 2KTQA 3VQ6A 3DXKB 5BN9A 5K14A 1U04A 4H0PA 5KPTA 4X64K 1SS6A 3DRPA 1NJZA 5BN8A 3QINA 2GEMA 2QEXN 2OPQA 3V9WA 3HRGA 4H0TB 3VTHA 4WFBL 1ATSA 1EX4A 3ULDA 2FLOA 2F8SA 2O4GA 2VGNA 1SV5A 3VERA 4GKKK 4CD3A 4M63C 4CF8A 5C15A 4H5RA 3HL8A 4DTPA 3HZ6A 4IFVA 4AQYK 4JI3K 3CJ7A 3DMJA 2G8WA 1OH6A 4J2BA 4N76A 1VQNN 4YOYA 2R7YA 4FVMA 2UUBK 4KAZA 1ASUA 1HKCA 3F9KA 1BIZA 1FJGK 2OZSA 3LP0A 3CD6N 3C6UA 3WNEA 3LZIA 1QZ6A 1SUQA 3JXUA 2P9NA 3EEQA 3AVMA 3JSMA 1VQLN 2KZZA 4O0JA 1Y64A 4E7KA 1S1WA 3KKRA 2V52B 5BRFA 3CF5L 5BRHA 4DTUA 3IFRA 1TKDA 1TGOA 3LDNA 3VQ5A 4JKGA 3FZFA 4JN4A 1U47A 2QTDA 1Z25A 4IXCA 2Q36A 4BR4A 4Z94A 2IS3A 2PY5A 5AQFA 1NBWA 4CBWA 1OH5A 4F8RA 3WXLA 1S6QA 1NMNA 1OH7A 3AO2A 4CESA 5IWAK 2E2NA 1RTJA 2YKMA 3DJCA 3S3MA 5BPNA 3M3ZA 1LWCA 4LH4A 5E84A 3OYCA 4LF8K 3C6HA 1W2BM 1YF5L 1ZBFA 5M1OA 5AFUA 4YFUA 1S1UA 4CHOA 3CCEN 3OA9A 2W42A 3VQ9A 3O4NA 5EY4A 3CJCA 3ZETB 3N4QA 2Z1HA 3TU5A 4QOZB 4FM0A 1YVUA 2W40A 1S1TA 4PA1A 5KGWA 3L3UA 1HNVA 4WQ4C 3PUFA 1VSFA 1VQPN 4M45A 3GOIA 4LFAK 3SQ0A 4IWVA 3F9MA 3C65A 1VSKA 3D2FB 4BVOA 3AVNA 3SK3A 3K9JA 4BR5A 4CEDA 1RTHA 2DFEA 2ZM6K 3QEVA 2UXCK 1M90O 4C8OA 4ZTFA 1VK0A 3DLGA 2EHGA 2XRIA 3BP8A 2WFBA 4O8KA 1RBSA 5KRTA 1QQNA 4EAHD 2D4WA 4DSLA 4BRGA 1NJIO 4KREA 1W7AA 3WUHA 1NJWA 4O5BA 3KKSA 4CE9A 1HYVA 5TKWA 4A2AA 4YNQA 3ID8A 3PLAA 4BRQA 4WYBA 3KIOA 3ZSOA 4G9ZA 3P83D 3AARA 1S1XA 1VSDA 3VQDA 2HOEA 3J7ZO 1JCEA 4QAGA 3UKRB 4JV5K 3ZX3A
chains in the Genus database with same CATH topology
4B3MK 2VQFK 5LMNK 3OTOK 4B3SK 4DV0K 1N34K 1N33K 4OX9K 1XNQK 4B3TK 4DV1K 5FLXO 4JI5K 4V19S 1HNWK 4X65K 4DV3K 4JI8K 4NXNK 5LL6Z 4X66K 4LF9K 4LF5K 3T1HK 4JI4K 4B3RK 4DR3K 1IBKK 4DR1K 5IWAK 4JI6K 5BR8K 4KHPK 4DV6K 4GKJK 4LF8K 4DR6K 4DUYK 4JYAK 4DV7K 4X62K 3J7AP 4DV4K 4CW7B 3JAMO 2F4VK 3J81O 1XNRK 1IBLK 2UU9K 4JI0K 2UXDK 1N36K 1IBMK 1HNXK 4LFAK 4YY3K 3J80O 3J7YP 4X64K 2E5LK 4LFCK 5A2QO 1I94K 4YHHK 1J5EK 4DR5K 2HHHK 4K0KK 4CVNE 2UUAK 2VQEK 2ZM6K 2UXCK 4GKKK 5LMUK 4JI7K 4AQYK 4JI3K 2UXBK 4DR4K 4LF7K 4DV2K 4DR2K 4LF6K 4LFBK 2UUCK 3T1YK 4DR7K 4LF4K 1HNZK 4NXMK 4DV5K 2UUBK 1XMOK 1HR0K 4JI2K 4JI1K 1FJGK 5IT9O 1XMQK 5AJ3K 1N32K 4DUZK 4JV5K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3M K;  2VQF K;  5LMN K;  3OTO K;  4B3S K;  4DV0 K;  1N34 K;  1N33 K;  4OX9 K;  1XNQ K;  4B3T K;  4DV1 K;  5FLX O;  4JI5 K;  4V19 S;  1HNW K;  4X65 K;  4DV3 K;  4JI8 K;  4NXN K;  5LL6 Z;  4X66 K;  4LF9 K;  4LF5 K;  3T1H K;  4JI4 K;  4B3R K;  4DR3 K;  1IBK K;  4DR1 K;  5IWA K;  4JI6 K;  5BR8 K;  4KHP K;  4DV6 K;  4GKJ K;  4LF8 K;  4DR6 K;  4DUY K;  4JYA K;  4DV7 K;  4X62 K;  3J7A P;  4DV4 K;  4CW7 B;  3JAM O;  2F4V K;  3J81 O;  1XNR K;  1IBL K;  2UU9 K;  4JI0 K;  2UXD K;  1N36 K;  1IBM K;  1HNX K;  4LFA K;  4YY3 K;  3J80 O;  3J7Y P;  4X64 K;  2E5L K;  4LFC K;  5A2Q O;  1I94 K;  4YHH K;  1J5E K;  4DR5 K;  2HHH K;  4K0K K;  4CVN E;  2UUA K;  2VQE K;  2ZM6 K;  2UXC K;  4GKK K;  5LMU K;  4JI7 K;  4AQY K;  4JI3 K;  2UXB K;  4DR4 K;  4LF7 K;  4DV2 K;  4DR2 K;  4LF6 K;  4LFB K;  2UUC K;  3T1Y K;  4DR7 K;  4LF4 K;  1HNZ K;  4NXM K;  4DV5 K;  2UUB K;  1XMO K;  1HR0 K;  4JI2 K;  4JI1 K;  1FJG K;  5IT9 O;  1XMQ K;  5AJ3 K;  1N32 K;  4DUZ K;  4JV5 K; 
#chains in the Genus database with same CATH topology
 1K6Y A;  2Z1G A;  4DHY A;  2ZJR L;  2YNI A;  4JAX A;  5HRO A;  4QS9 A;  4DSI A;  1XWL A;  4OKE A;  4CJW A;  3R9P A;  4JKH A;  4FM1 A;  3SLC A;  2HMI A;  2YHX A;  2O8D B;  1RBU A;  3K5M A;  4OLA A;  2GWK A;  5EXW A;  4AH9 A;  5C0Y A;  3ZSY A;  4E1J A;  2ZJP L;  1TKX A;  2F9T A;  4RTF D;  1IBK K;  4OKJ A;  5AQV A;  1Z26 A;  4CFA A;  4BR9 A;  4J8F A;  3PSI A;  2E8A A;  3BEX A;  4X62 K;  3K5N A;  5E26 A;  4JHD A;  2G8F A;  4AIL C;  2A5X A;  1WN7 A;  4CEO A;  1KVA A;  4KB0 A;  4ILG B;  2AJQ A;  3O1W A;  3WT0 A;  3CC2 N;  1DKG D;  3LPU A;  1BHL A;  1SL2 A;  3AAP A;  2P1J A;  4B8A B;  4YY3 K;  3MN9 A;  1U48 A;  3PIP L;  1VQM N;  3TI0 A;  2NRZ A;  3R1X A;  4LD0 A;  1RDC A;  3KHY A;  1YUW A;  4FL9 A;  4CI6 A;  1BCM A;  3OS1 A;  4BRF A;  5HRP A;  3FZL A;  1VSH A;  2KQ2 A;  4HTL A;  3KJV A;  4F2S A;  3MMV A;  4JKA A;  1JXE A;  2QA4 N;  3SUP A;  2HF3 A;  3DWL A;  4DQS A;  3C95 A;  2KLA A;  3CYM A;  3S41 A;  4JI7 K;  3NH0 A;  4FK2 A;  5F0X A;  2IC3 A;  4LF7 K;  4KHY A;  4BRI A;  3CM6 A;  3ZT1 A;  2FF3 B;  3AA4 A;  2G8H A;  1IKW A;  4AHS A;  4RW4 A;  4OJR A;  1RIL A;  4B8C A;  5I42 A;  1X9M A;  2ZF5 O;  4CGH A;  1VHX A;  2QKK A;  3NH1 A;  3TAM A;  2X6S A;  5FPD A;  1QSY A;  2NZT A;  3AO3 A;  3V1Q A;  2XHB A;  4CHN A;  3TAB A;  5J2Q A;  4XH1 A;  3LAM A;  4CIE A;  4H03 B;  3OYA A;  3EE9 A;  3HSC A;  2VGM A;  1ASV A;  2PAV A;  2O8C B;  3V81 A;  4B3T K;  2P9K B;  3O3H A;  4DU1 A;  1TV6 A;  3VEY A;  3CCS N;  1KRP A;  1S72 N;  1H1V A;  3PY8 A;  2XY6 A;  4A5A A;  4CJR A;  1U45 A;  3QEI A;  5CY4 A;  1ZBU A;  3Q7C A;  2YHB A;  4MDA A;  2J4R A;  2QI2 A;  4E1M A;  4BQL A;  3PSF A;  3CQ8 A;  1MA9 B;  4JI6 K;  1A5W A;  3UKU B;  1T7P A;  2ASO A;  3K5L A;  4XEI A;  1S9G A;  4DV7 K;  4MQ3 A;  4KH4 A;  4JK8 A;  5KTQ A;  1NGF A;  3ENO A;  4H4O A;  4B9L A;  4DSF A;  4DU4 A;  1QVG M;  4W5Q A;  3AVJ A;  1KC8 O;  4IBN A;  3IKM A;  3WQU A;  4U67 L;  4BDY A;  1X3N A;  3P1G A;  3HXM A;  3SNN A;  4JKB A;  4DSJ A;  2F4V K;  4KHS A;  2HMP A;  4CEQ A;  1U2V B;  2YNH A;  3MCA B;  2HNY A;  2VG6 A;  1L3S A;  4DQ8 A;  3H6E A;  4M3Y A;  2JWL A;  4CZL A;  4O5F A;  4OPH A;  1LWE A;  3KLF A;  3RTV A;  3THY A;  2Q97 A;  5FPM A;  1D5A A;  3NGY A;  2YX6 A;  1QS4 A;  3PX0 A;  1OKJ A;  4OVL A;  3VGK A;  4JD2 A;  3KK1 A;  2QW9 A;  4IJA A;  3WEE B;  4PY5 A;  1CXU A;  5AFU H;  1NGB A;  4CJF A;  3VQA A;  3SCX A;  4FSV A;  4TSX A;  5GIO A;  4DR2 K;  1C1A A;  3HM8 A;  1VQ7 N;  2QK9 A;  1NU0 A;  3W3D A;  1NNE A;  3EO3 A;  3VEN A;  1TK8 A;  5AZJ A;  4OKK A;  1X9W A;  2RHK A;  4DFM A;  3P4I A;  1G99 A;  4CIF A;  1VQ9 N;  4JK9 A;  3HP9 A;  1XHZ A;  1F21 A;  5AQM A;  1YI2 N;  3NVM A;  1CLQ A;  4E7J A;  5DK5 A;  5CE3 A;  3I0R A;  2KZM A;  4L8R B;  4FLT A;  1YXQ A;  3CPW M;  1NK8 A;  5HL7 L;  1Q86 O;  4R5P A;  1XI1 A;  2KW4 A;  1K8K B;  4OPA A;  3ZX0 A;  1I3A A;  2GTD A;  3KK7 A;  4FWM A;  4ZTJ A;  1YT3 A;  4X65 K;  3P31 A;  1WLJ A;  4IJN A;  4PKH A;  4JI8 K;  4B9U A;  5LL6 Z;  3WXK A;  1YTU A;  3GG4 A;  4X66 K;  5AQW A;  3QB0 A;  2FSK A;  1RBR A;  2W6K A;  5CYM A;  4CZF A;  4CJS A;  4NCG A;  5C10 A;  3LAK A;  3VEX A;  1S1V A;  4F9O A;  4DF8 A;  4AF1 A;  4HCC A;  4NB4 A;  1DTT A;  2OPP A;  1VSM A;  3RSE B;  3G25 A;  3RRG A;  1HYS A;  2O8E A;  1QSL A;  1DT9 A;  4A62 A;  2P9L A;  3E01 A;  1N6Q A;  1RT2 A;  3LAL A;  3SBT A;  5AQX A;  1NLV A;  2OTJ N;  3LWM A;  1OVQ A;  3KK3 A;  1BCO A;  3QO9 A;  3DLK A;  1XNR K;  4CER A;  1KQS M;  3H3N O;  4YDU C;  4KKO A;  3SMP A;  5B8H A;  3UB5 A;  1LAW A;  5EOY A;  5A2Q O;  4FCY A;  2YNG A;  3ZSZ A;  2YV0 X;  4DR5 K;  3KLH A;  4E7H A;  3OYE A;  1EXQ A;  4A57 A;  3GL1 A;  4FJM A;  3OBY A;  4KFB A;  4CFD A;  1RT4 A;  3THW A;  3T19 A;  4BRL A;  3VQP A;  3NF8 A;  1W9H A;  2D5R A;  5CZ1 A;  1HR0 K;  3RMA A;  5GAH P;  2ZQB A;  4ZHR A;  3E9P A;  1DEJ A;  4WQ5 A;  3ZSV A;  4YOR A;  4CJE A;  4M3X A;  4JKF A;  3D45 A;  5AR0 A;  3NMU A;  4CEC A;  4FJN A;  2P9N B;  4CK1 A;  4NO7 A;  2Y1J A;  1SKS A;  3CI5 A;  3H08 A;  1N5Y A;  2QXF A;  3OTO K;  3U3Y A;  2Q1N A;  1REV A;  4KV8 A;  1N34 K;  2XO7 A;  3AA3 A;  2HST A;  3O9R A;  3VEV A;  4CHQ A;  2E1Y A;  4M3T A;  4YOT A;  4CEB A;  3MEC A;  4DMN A;  1RDD A;  4GV9 A;  4JI5 K;  1WAJ A;  2ZGZ A;  3LWL A;  3O9Q A;  5EU7 A;  3KLG A;  4CGD A;  2GWJ A;  3CJ9 A;  4EZ6 A;  3W0L A;  1CXQ A;  5ELZ A;  4LF5 K;  4DR3 K;  4MLE A;  2YJE A;  4BC2 A;  2QWP A;  2YKN A;  3OYG A;  1S5J A;  4IDH A;  3RR7 A;  3OY9 A;  3M8Q A;  4I2P A;  1KTQ A;  2P9P A;  2P9S B;  3ZSR A;  1T03 A;  3SJH A;  1HUX A;  1RFQ A;  2XY7 A;  3TAR A;  3CME N;  3AO5 A;  4I7F A;  4PQU A;  3NHG A;  2NNW A;  3OW2 M;  1WB9 A;  4BC3 A;  3PO5 A;  3JS6 A;  2VYP A;  3SQ4 A;  3C94 A;  1E4F T;  2PZS A;  3A2F A;  1YJN N;  2F96 A;  3FFI A;  1DLO A;  3TSU A;  2CGJ A;  4GVE A;  4CZH A;  5BRE A;  5C2D A;  1BUP A;  1WSF A;  4B08 A;  4KHN A;  4UY8 O;  3ZT3 A;  5LJW A;  4DFK A;  3EN9 A;  2VQE K;  3THX A;  1ZBL A;  3ZLJ A;  3O9U A;  2VG5 A;  3AAQ A;  2QM1 A;  3SPZ A;  1EWQ A;  1L3U A;  1TYQ A;  4NYF A;  4FZX C;  3H3O B;  2NRH A;  4KHU A;  4DR7 K;  4LF4 K;  3CPE A;  1GLC G;  2IVP A;  2E2O A;  5AZI A;  5C25 A;  4IO8 A;  4OLB A;  3TAG A;  3QDK A;  1TUY A;  3HI0 A;  3VPZ A;  3HT3 A;  1BL3 A;  3FE1 A;  4FOE A;  4CD1 A;  1GLB G;  4N5S A;  4E7L A;  2X74 A;  4LY7 A;  3EL2 A;  4BRC A;  2GEL A;  2QXL A;  3A5N C;  3I8B A;  5C12 A;  4B3S K;  4RG8 A;  3QFP A;  3R8E A;  4NLB A;  4AHT A;  3MX5 A;  1UOC A;  5AQU A;  5F1X A;  3C6T A;  5GIP A;  3G4S N;  3BY5 A;  4FJX A;  1HNW K;  1KLN A;  4KTW A;  4DLG A;  4H0X B;  1NK7 A;  4JRP A;  4FLZ A;  4IOX A;  4K43 A;  3CCL N;  2RF2 A;  4IZ9 A;  3TR8 A;  1R59 O;  1NGG A;  3L2R A;  4O0I A;  3RMC A;  2JWK A;  4CJV A;  2NRX A;  1UA0 A;  2RE2 A;  4BR2 A;  4CK2 A;  2PBD A;  3CET A;  4GW6 A;  4JLH A;  4O44 A;  3AVB A;  4O4G A;  2BAN A;  1BIU A;  4ELT A;  3NF9 A;  4JHD B;  3BZK A;  1VSL A;  1QE1 A;  3RMB A;  3HYF A;  4EP4 A;  2G8V A;  5M1Q A;  4EP5 A;  1IBL K;  5HRN A;  1T3V A;  4N56 A;  3B6O A;  3VQQ A;  2BH1 A;  3BGR A;  5BRD A;  4C1N K;  2E5L K;  3FZK A;  3H1Q A;  1TKZ A;  5AQL A;  1Q9Y A;  4CGJ A;  4KI6 A;  2HVI A;  1NM1 A;  2QWO A;  2P9U B;  1K73 O;  1GOB A;  2ZGY A;  3IRX A;  4EIA A;  3V9X A;  4CZI A;  3K58 A;  1R0A A;  4CEF A;  3OYF A;  3HO1 A;  2RKI A;  3B8A X;  4BRH A;  4CEA A;  4DTJ A;  2P5O A;  3SBG A;  4CZM A;  4JRQ A;  4BRP A;  4C8M A;  3VMF B;  3DI6 A;  4HUG A;  3GE1 A;  1RT6 A;  3VA0 A;  2D1K A;  1XMO K;  4BRO A;  3LPT A;  5T7B A;  5HP1 A;  4FWO A;  3GBT A;  1QQC A;  3N4P A;  3P38 A;  3NF7 A;  5AJ3 K;  4B9T A;  3AGR A;  3CCR N;  1N32 K;  3TAQ A;  3MX2 A;  4I6M A;  4PHT X;  4CJK A;  4BGB A;  5AQY A;  2O8B A;  3IDH A;  3HPG A;  4V19 S;  3ZEU A;  4U7B A;  1YVN A;  1BA0 A;  1ILY A;  2IDO A;  2Z1I A;  3CCM N;  3DRR A;  4BRA A;  4FXD A;  3EKU A;  4LF9 K;  1HLU A;  2OTL N;  3DXK A;  4JEP A;  2HBJ A;  3CQY A;  4DR1 K;  4BC4 A;  2H3G X;  3L2Q A;  4KHP K;  3HPH A;  1XC9 A;  1WAF A;  1LAV A;  5SWM A;  4E89 A;  3NH2 A;  5JLH A;  3G10 A;  1ZBS A;  3T7Z A;  4JYA K;  2E2P A;  2D0O A;  4DSE A;  4PL7 A;  2Q3S A;  3VQC A;  3HM9 A;  1A5V A;  4BR0 A;  2O8F B;  5FRN A;  3SAG A;  3D2E B;  4MFB A;  1VQ4 N;  3ZSW A;  4AHV A;  4BG8 A;  1GLJ O;  1V4T A;  4FJ7 A;  4OO1 J;  4B9Q A;  2BDP A;  1RGI A;  1IBM K;  1BQN A;  3L2U A;  1NJY A;  2IAJ A;  4Z4H A;  3PV8 A;  2HNZ A;  2EX3 A;  5BPL A;  3VF2 A;  4KHW A;  4W5T A;  4CGI A;  5AQP A;  4B9N A;  4K0K K;  2FXU A;  3OYN A;  4CVN E;  3D0P A;  4GV6 A;  2CGK A;  4ILJ A;  4CJP A;  3B6P A;  4Y1C A;  3GDQ A;  4ELU A;  1BO5 O;  3O08 A;  3QBW A;  4Z0U A;  1MWM A;  4BVP A;  3LDS A;  4K42 A;  5JMV A;  3QFU A;  3CCQ N;  4DR4 K;  1XUP O;  4BC5 A;  1Q8I A;  4FLW A;  3CC4 N;  2HVH A;  3CCU N;  4BE1 A;  3CXC M;  1MDU B;  4CJ7 A;  1ZBH A;  4MO5 A;  1YJ9 N;  2HHQ A;  2ZE2 A;  4CZK A;  4OPJ A;  4C8L A;  3O4Q A;  4Q5V A;  1NGH A;  2HND A;  1L5U A;  1J54 A;  3ULE A;  3L2V A;  2PYJ A;  1HX1 A;  1RBT A;  5CR4 A;  2A40 A;  3H46 O;  4YOX A;  3ID6 A;  1N33 K;  4DTS A;  4WE1 A;  4B1W B;  1WSJ A;  4ISF A;  3ZET A;  1WBB A;  1VRU A;  2V51 B;  3WNG A;  4ICL A;  3K57 A;  2E88 A;  2E4L A;  4FJ8 A;  2Q31 A;  4FWN A;  1SL0 A;  4XH5 A;  1NWK A;  1VQ6 N;  4C8K A;  5KQ8 A;  1HJR A;  5SZT A;  4KB1 A;  1HPZ A;  3WNF A;  1P8Z A;  1TKT A;  1Z6R A;  3OYJ A;  4M42 A;  3EZ5 A;  2BTF A;  2OA8 A;  3G71 N;  3OYI A;  1D8Y A;  1HKG A;  1EET A;  3D2F A;  4DQI A;  5GAE P;  2JGU A;  3DLL L;  1NMD A;  4BDZ A;  1C0F A;  1J9A A;  2P9L B;  4O55 A;  1RCH A;  3C7N B;  5FPN A;  3MED A;  2A1S A;  2B6A A;  2O4I A;  4F4K A;  4I9L A;  2IOC A;  3FR0 A;  4GV3 A;  3LDO A;  3QML A;  4FWP A;  4J2D A;  3HVR A;  3CCV N;  2AP1 A;  3QBX A;  4CJ4 A;  3J8A A;  3O9S A;  3VN5 A;  2F9W A;  3H1V X;  3J7Y P;  2NUB A;  4NYN A;  4GMJ B;  4FW2 A;  3VQB A;  3DOL A;  2YCH A;  3UKR A;  3O1B A;  2HHU A;  5JS1 A;  1RTI A;  4M3W A;  1KLM A;  5AQT A;  4PKI A;  4GY2 B;  3THW B;  4CHP A;  1U4B A;  2X78 A;  1CZ9 A;  1KAX A;  2V7Y A;  3O8M A;  2HHW A;  4NXM K;  3U8X A;  3PIO L;  4G1Q A;  3AVG A;  4JI2 K;  4BR7 A;  3AGK A;  4IG3 A;  4CBU A;  4H8K A;  3CHW A;  2E6L A;  1V4S A;  3DXM B;  4A5B A;  4KTQ A;  5AQR A;  3TAF A;  3LAN A;  5GAG P;  5AQO A;  3S3N A;  1QZ5 A;  2E6M A;  4RW6 A;  1NGJ A;  4LC9 B;  4ELV A;  5BPM A;  3MN6 A;  1WSH A;  4B3O A;  3ZT4 A;  2CH5 A;  4GVM A;  4FJH A;  3D7E O;  1HKB A;  3I0S A;  5LY3 A;  1KFD A;  2OCE A;  1UWB A;  3I55 N;  3KD5 E;  4K8Z A;  3NGI A;  4FJG A;  5KRS A;  2FSN A;  4Y0W A;  3SMS A;  4WCE L;  3LP2 A;  3QES A;  2Z1J A;  2VG7 A;  1B9D A;  4DFJ A;  3VEO A;  4CGF A;  5J2N A;  1IG9 A;  2IGI A;  5HOO A;  1W0H A;  2YI1 A;  5MLC Q;  3KZB A;  2B4J A;  3ALY A;  4HUE A;  4DQQ A;  4H0V B;  3O80 A;  1NKB A;  2DFH A;  3LP3 A;  4W5N A;  2VWK A;  4YOU A;  3TTD A;  1IV0 A;  3J7A P;  4DV4 K;  3T69 A;  1C6V A;  4FYD A;  4JK7 A;  3IG1 A;  4JNE A;  4Y1D A;  2HHV A;  2HBL A;  2EWS A;  4L3Q A;  3I8D A;  1J53 A;  1D4X A;  1T8E A;  3AV9 A;  4CFC A;  4Q0B A;  4CCH A;  2I7N A;  4QS8 A;  1LW0 A;  2HHT A;  4BRK A;  3ZSQ A;  1KAY A;  2D0B A;  3E1Y A;  1NKE A;  4Z4F A;  4FJ5 A;  4Z4G A;  4DTN A;  4FW1 A;  1JL2 A;  1Q81 O;  2HBM A;  4C1N I;  4E19 A;  4BRD A;  4M41 A;  1RDU A;  1ATN A;  3MCP A;  2F7T A;  3O6W A;  3VQE A;  3ZYY X;  4DB3 A;  1X9S A;  3IMX A;  1LOT B;  2D0P A;  2O8C A;  2CGL A;  5C42 A;  1ASW A;  2VWJ A;  4DQR A;  2P9K A;  1TYQ B;  3I33 A;  5HRS A;  1VRT A;  4FWR A;  3E9L A;  4EZ9 A;  5CYQ A;  3SUN A;  4PL8 A;  3SAH A;  4B9M A;  2VCP A;  3CJA A;  2QWQ A;  3UKU A;  3E9O A;  3QNO A;  3S3O A;  4KPY A;  3CMA N;  4YOV A;  1BOT O;  5HLF A;  3CG7 A;  4M3R A;  3G0Z A;  3L0Q A;  2Q2R A;  3EZW A;  4DV1 K;  5FLX O;  3SPY A;  4B1Y B;  5DMR A;  4WQ5 C;  3WNH A;  2NRR A;  2QWN A;  1TUU A;  4Z4C A;  1T6D A;  5AQQ A;  1ESV A;  3ATV A;  1A5X A;  4JI4 K;  3MEG A;  3SZ2 A;  3IUC A;  1GLE G;  1U2V A;  4JS4 A;  4DSK A;  1O13 A;  4CJQ A;  3CCJ N;  3K2P A;  3WQT A;  5DM7 L;  4DFP A;  2QWL A;  5TKY A;  1YIT N;  4DTR A;  3CQX A;  2HBK A;  3SJJ A;  3AA2 A;  1OVY A;  3WXI A;  4JKG B;  3V4I A;  4CF0 A;  2ITG A;  3VF4 A;  4J2E A;  4H0Y B;  2V7Z A;  3MXI A;  4FWK A;  5M1N A;  3WEE A;  4CZG A;  2W41 A;  3O3F A;  4FJ9 A;  3LDL A;  1Q18 A;  1XC3 A;  4CF9 A;  1LW2 A;  4HWI A;  1HRH A;  1JJ2 M;  4K25 A;  3SV4 A;  1IJJ A;  1YHQ N;  1BQM A;  3U4L A;  1WSG A;  4LFC K;  3CM5 A;  3MN5 A;  3LDP A;  1J5E K;  3KLI A;  4BWM A;  3VOV A;  2Q0U A;  4O8U A;  3MK6 A;  2IVO A;  4IEI A;  4BGA A;  3KTQ A;  3G6E N;  4FLU A;  1K8K A;  4DV2 K;  1TAQ A;  4LFB K;  3SQ1 A;  4DV5 K;  1Q9X A;  2BUP A;  3MDQ A;  1GLF O;  4DCH A;  3CIP A;  3QIO A;  3FGU A;  4FJK A;  2X6N A;  4FJL A;  3L6Q A;  3L8B A;  4NCA A;  1C0M A;  3T3F A;  4DUZ K;  3KD1 E;  3CER A;  2KFN A;  1VAZ A;  3HJF A;  2ATQ A;  4B3M K;  1RBV A;  4I6M B;  2QWR A;  5EVZ A;  4BQZ A;  4BDP A;  2YJF A;  3LDQ A;  3VA3 A;  4DV0 K;  1YAG A;  2XY8 A;  4FO0 A;  3TSQ A;  4CIG A;  5GAD P;  2ETJ A;  4DWI A;  1XNQ K;  4K8X A;  3QLH A;  3BF3 A;  4DTM A;  3TSP A;  1O1W A;  1NGE A;  4FWS A;  4RW7 A;  1NKC A;  1B92 A;  1HMV A;  3LZJ A;  3NFA A;  1BI4 A;  1FKP A;  5LJV A;  3F5T A;  4B1X B;  1QQO A;  2UYT A;  1X9J A;  3TAE A;  4A61 A;  4F2R A;  1ATR A;  3MXJ A;  1GOC A;  4M7Y A;  1IG8 A;  3VEW A;  3VQ7 A;  1NGC A;  1GLD G;  2GUP A;  1TL1 A;  1NK4 A;  4C23 A;  1RT5 A;  1S9E A;  2ZD1 A;  1HQE A;  1WUA A;  3F73 A;  1RDW X;  4BRM A;  3AO1 A;  3QER A;  2P9I A;  1TAU A;  4IFE A;  3V6D A;  1WOQ A;  2FC0 A;  4KO0 A;  3LM9 A;  4KH6 A;  4NLC A;  4ID1 A;  2FF6 A;  4IG0 A;  2XY5 A;  3J80 O;  5J2M A;  1C0U A;  3NGZ A;  1TK0 A;  3FZM A;  4E7I A;  2JLE A;  1Q7Y O;  1IKX A;  1GLA G;  1T6C A;  4CEZ A;  1HNI A;  3DLE A;  3LM2 A;  3HOT A;  2DFF A;  3NF6 A;  5LMU K;  1LWF A;  3H45 C;  4E0D A;  5H1S Q;  1C0T A;  3KK2 A;  1VQO N;  1DTQ A;  3T1Y K;  1D9F A;  3L2W A;  5I9E B;  4FJJ A;  3ZT2 A;  3OYK A;  1JKH A;  4EHT A;  4JI1 K;  1ZC6 A;  3TTC A;  3DRS A;  2PFU A;  1U6Z A;  1XMQ K;  3A8Y A;  1TK5 A;  3AVL A;  1JCF A;  3ULE B;  3P39 A;  4W5R A;  3OJU A;  2E1Z A;  1GOA A;  2QWM A;  1EP4 A;  2P9S A;  4IOA L;  3VF6 A;  4ILH A;  3R3L A;  5M1K A;  4KI4 A;  4H5V A;  1CZB A;  4DTX A;  1C0G A;  2A3Z A;  4FOI A;  2OZM A;  3OYH A;  4WQ4 A;  3V9U A;  3A5L C;  3HP6 A;  3K5O A;  4GNI A;  4XH4 A;  3L3V A;  1JLQ A;  1FW6 A;  4GKJ K;  4OGC A;  1K8A O;  4CHY A;  2WC9 A;  2E20 A;  4CHZ A;  4CJU A;  4H5T A;  3U3G A;  3AO4 A;  1FKO A;  2WBN A;  1B9F A;  1WSI A;  4CGG A;  4IOC L;  5AQJ A;  4FK0 A;  5FPE A;  3VGL A;  4B9S A;  1HJO A;  4QS7 A;  1RDB A;  4DLE A;  3RR8 A;  1M1K O;  3M8P A;  2RPI A;  4IFY A;  1C1C A;  4KHQ A;  1I94 K;  4E1N A;  5JS2 A;  4YOW A;  3MXM A;  3ZSX A;  1LV5 A;  3TTF A;  3NCI A;  4N41 A;  1QVF M;  4MO4 A;  5AQS A;  3ZX2 A;  3OYM A;  4H5N A;  4IO9 L;  4CBX A;  3ISN C;  4QCL A;  3EKS A;  3Q7B A;  3QIP A;  3M1F A;  3M8R A;  2GUI A;  3TAN A;  3HST B;  3RWU A;  5KGX A;  4FK4 A;  2UXB K;  1JL1 A;  1NK6 A;  3UE5 A;  1GLL O;  2YHA A;  3A5O C;  4DS5 A;  4BE2 A;  4N47 A;  5FDL A;  4IEE A;  5EX5 A;  2ZJQ L;  1NGA A;  3THY B;  3ASM A;  5FRM A;  3T1A A;  1VSJ A;  4ID5 A;  3MWT A;  2YHW A;  4DS4 A;  1JLC A;  2YHY A;  4F3T A;  4JKC A;  4KBO A;  2CH6 A;  3OYL A;  5AQH A;  1QHT A;  1BDG A;  1RDA A;  3L4Q A;  3V1R A;  3ZT0 A;  1RNH A;  4JD2 B;  1NK5 A;  4Z4E A;  5I3U A;  3HPO A;  4FLY A;  3FZH A;  1ZXO A;  3V9Z A;  2DPN A;  3V1O A;  3QIC A;  4A59 A;  4K41 A;  3VTI A;  1T44 A;  5AZJ B;  2HW3 A;  3CFR A;  4CK3 A;  3BUZ B;  3THV A;  4B3R K;  2DTU A;  4A2B A;  5ADX H;  3MWP A;  1NOY A;  1QHA A;  1RTD A;  3WXJ A;  2I5J A;  3KWI A;  2G8I A;  4I2Q A;  3KLE A;  4RW9 A;  2IIR A;  3DLH A;  5D3G A;  1SKW A;  3WXM B;  2A42 A;  1FXX A;  1E3M A;  2B5J A;  2P9U A;  1IH7 A;  4FZY A;  3CFO A;  1U49 A;  4M3U A;  3HBT A;  2OPS A;  2HHX A;  3SYZ A;  1KCF A;  3DAW A;  1IKY A;  1JLG A;  1L3T A;  3EYZ A;  4LSL A;  1OH8 A;  1QTM A;  1BA1 A;  3OS2 A;  2OYQ A;  3NVK A;  4HCB A;  5E41 A;  5FRO A;  3QET A;  4OPK A;  4YHH K;  1WSE A;  5C2F A;  4BRN A;  3CC7 N;  2O8E B;  4UQG A;  4HTU A;  2UUA K;  3K0S A;  1I39 A;  4FPA A;  2WTU A;  2FSJ A;  1Y97 A;  1NJX A;  3KWG A;  3U9Z A;  4PUO A;  3QEX A;  1NG9 A;  1YTA A;  1NGD A;  1Z05 A;  1WBD A;  3O4W A;  4JS5 A;  4AM6 A;  4B1U B;  2ASP A;  5AQG A;  4BWJ A;  4IKF A;  3ITH A;  3PO4 A;  4PKG A;  3O3G A;  1VSE A;  1RT3 A;  5IT9 O;  1NGI A;  1VQ5 N;  1BU6 O;  3DM2 A;  4FVU A;  1KXP A;  1TL3 A;  3MN7 A;  1JLF A;  2KKZ A;  1D9D A;  4FLV A;  2ZWH A;  5KI6 A;  4JKD A;  3VQ4 A;  4MLH A;  4E3S A;  1EQY A;  3A5M C;  1ZBI A;  4RWT A;  3PX4 A;  2O8D A;  2O8F A;  4OGE A;  3ATU A;  4CF2 A;  1X1P A;  5F2R A;  1XHX A;  3FLC O;  3MEE A;  3QEW A;  1FK9 A;  3D2E A;  3BF1 A;  1N8R O;  3SI6 A;  4KH5 A;  4CJL A;  1E4G T;  3C6A A;  4FJI A;  3F2K A;  3UIQ A;  5BR8 K;  4CFB A;  2HB5 A;  3NAE A;  5JVG L;  4H0O A;  1IKV A;  4IDK A;  4DR6 K;  1RT7 A;  4AHR A;  4CJ3 A;  3AVF A;  2BE2 A;  4NCB A;  2GV9 A;  2FBX A;  3HVT A;  2BGG A;  2NRT A;  5CHI A;  1Q82 O;  3E66 A;  3AVC A;  3AVI A;  4B9V A;  4BY9 C;  2D0A A;  1SL1 A;  1EWR A;  4FWL A;  1IO2 A;  3JYT A;  3MAQ A;  3A0I X;  4JI0 K;  2UXD K;  3D6R A;  1HNX K;  2HF4 A;  1EKE A;  4I9Q A;  3TAP A;  3O9T A;  3IAY A;  4Z4I A;  2HHH K;  2FBT A;  2YNF A;  1S3X A;  4HHT A;  2P9P B;  1JLB A;  4W5O A;  5AQN A;  3TWH A;  4KRF A;  4JKE A;  4MDB A;  4DF4 A;  3AVH A;  5DM6 L;  4HVJ A;  2WON A;  4H4M A;  3NBP A;  1KD1 O;  4WF9 L;  3CFP A;  4FM2 A;  2D0C A;  1WNS A;  2Q0R A;  1QQM A;  4B1Z A;  3KVG A;  3CJB A;  1DGK N;  3K59 A;  2Y1I A;  3OHR A;  1YIJ N;  3BZC A;  4FZZ A;  1HQU A;  4HUF A;  1P90 A;  5BR9 A;  4KTZ A;  1QSS A;  4WFA L;  2W6L A;  5HRR A;  2A41 A;  3OVN A;  4DKW A;  5C24 A;  4PWD A;  3THX B;  5KQD A;  1EO1 A;  1VSI A;  3HTV A;  4DU3 A;  3ZCM A;  3NDK A;  1KFS A;  4AHU A;  3U9D A;  3K9K A;  1J6Z A;  3AVA A;  3SUO A;  3I56 N;  2OAN A;  4DG1 A;  5AQI A;  4CJ5 A;  4AM7 A;  4BG9 A;  5AZI B;  4DV3 K;  3C7N A;  5M1P A;  3EE8 A;  3QNN A;  4M3Z A;  1UAX A;  1SQK A;  1NOZ A;  3DYA A;  2FBY A;  3T1H K;  2ITM A;  3O5B A;  1BI4 B;  4BRE A;  2NLX A;  1ZYQ A;  2PYL A;  4DQP A;  4YDU A;  4RCH A;  4DV6 K;  1KVC A;  2ASM A;  2WOM A;  3OS0 A;  1BIS A;  1KVB A;  3VGM A;  5JIC A;  1L3V A;  1YJW N;  3SV3 A;  4AHC A;  2G8K A;  5M1F A;  2IVN A;  1X3M A;  2HHS A;  2P9I B;  5CZ2 A;  3M8S A;  3J81 O;  3CJ1 A;  1S6P A;  2UU9 K;  1LCU A;  4C8N A;  3LP1 A;  1N36 K;  3OJS A;  3AVK A;  1MU2 A;  1UA1 A;  1NK9 A;  3DXM A;  3PX6 A;  3HK2 A;  3FFK B;  2A6A A;  2P5G A;  2QKB A;  2WUS A;  4M7X A;  2E2Q A;  4FPB A;  4CJT A;  1VQ8 N;  3M6G A;  1JXB A;  1TVR A;  4J2A A;  3NE6 A;  1JLA A;  4BE0 A;  1MWK A;  3EY1 A;  1ITG A;  3HOS A;  3U6F A;  4EFH A;  3RRH A;  2NRW A;  1S22 A;  3IS9 A;  1SAZ A;  3SAF A;  4ISE A;  2UUC K;  4DTO A;  1KSP A;  1HNZ K;  4LF6 K;  1JCG A;  3AY9 A;  1C1B A;  3C0B A;  4H5W A;  2GBZ A;  4CZJ A;  1VQK N;  1G15 A;  2RN2 A;  2LSN A;  1JLE A;  2NRV A;  5J1E A;  1BG3 A;  5HBM A;  5AQK A;  4EHU A;  3DLB A;  1BGX T;  4ISG A;  2DY4 A;  1XQS C;  3VET A;  1HYZ A;  2VQF K;  4CEE A;  2F8T A;  5LMN K;  4CZE A;  3QEP A;  2I7P A;  1HPM A;  5ADX A;  3OYB A;  4WFN L;  4OX9 K;  3OBW A;  4B1V A;  2P51 A;  2KHO A;  3TPQ A;  3VEZ A;  1T05 A;  2G8U A;  4F3O A;  2KFZ A;  1W97 L;  1CZA N;  3OYD A;  5JLF A;  3SQ2 A;  1RT1 A;  4NXN K;  3VQ8 A;  4XIU A;  4FLX A;  2FBV A;  3ENB A;  4LH5 A;  3P5J A;  3SUQ A;  3ENH A;  5KPR A;  3L4I A;  5KPZ A;  1K9M O;  3RMD A;  3AA5 X;  3DLR A;  4BAC A;  3RSE A;  2OPR A;  3VES A;  4DUY K;  3V9S A;  3R6M A;  2O8B B;  4RW8 A;  3LL3 A;  1KAZ A;  3S9H A;  4CF1 A;  4FWQ A;  1J5O A;  2A1R A;  1SKR A;  2AA4 A;  1BWF O;  3BDP A;  3ZEU B;  5JVH L;  3RVC A;  4CW7 B;  5GIN A;  5AQZ A;  3DOK A;  4R79 A;  2VWB A;  1SZ2 A;  4LSN A;  3JAM O;  5J2P A;  1NK0 A;  3M5R A;  2GX9 A;  2KTQ A;  3VQ6 A;  3DXK B;  5BN9 A;  5K14 A;  1U04 A;  4H0P A;  5KPT A;  4X64 K;  1SS6 A;  3DRP A;  1NJZ A;  5BN8 A;  3QIN A;  2GEM A;  2QEX N;  2OPQ A;  3V9W A;  3HRG A;  4H0T B;  3VTH A;  4WFB L;  1ATS A;  1EX4 A;  3ULD A;  2FLO A;  2F8S A;  2O4G A;  2VGN A;  1SV5 A;  3VER A;  4GKK K;  4CD3 A;  4M63 C;  4CF8 A;  5C15 A;  4H5R A;  3HL8 A;  4DTP A;  3HZ6 A;  4IFV A;  4AQY K;  4JI3 K;  3CJ7 A;  3DMJ A;  2G8W A;  1OH6 A;  4J2B A;  4N76 A;  1VQN N;  4YOY A;  2R7Y A;  4FVM A;  2UUB K;  4KAZ A;  1ASU A;  1HKC A;  3F9K A;  1BIZ A;  1FJG K;  2OZS A;  3LP0 A;  3CD6 N;  3C6U A;  3WNE A;  3LZI A;  1QZ6 A;  1SUQ A;  3JXU A;  2P9N A;  3EEQ A;  3AVM A;  3JSM A;  1VQL N;  2KZZ A;  4O0J A;  1Y64 A;  4E7K A;  1S1W A;  3KKR A;  2V52 B;  5BRF A;  3CF5 L;  5BRH A;  4DTU A;  3IFR A;  1TKD A;  1TGO A;  3LDN A;  3VQ5 A;  4JKG A;  3FZF A;  4JN4 A;  1U47 A;  2QTD A;  1Z25 A;  4IXC A;  2Q36 A;  4BR4 A;  4Z94 A;  2IS3 A;  2PY5 A;  5AQF A;  1NBW A;  4CBW A;  1OH5 A;  4F8R A;  3WXL A;  1S6Q A;  1NMN A;  1OH7 A;  3AO2 A;  4CES A;  5IWA K;  2E2N A;  1RTJ A;  2YKM A;  3DJC A;  3S3M A;  5BPN A;  3M3Z A;  1LWC A;  4LH4 A;  5E84 A;  3OYC A;  4LF8 K;  3C6H A;  1W2B M;  1YF5 L;  1ZBF A;  5M1O A;  5AFU A;  4YFU A;  1S1U A;  4CHO A;  3CCE N;  3OA9 A;  2W42 A;  3VQ9 A;  3O4N A;  5EY4 A;  3CJC A;  3ZET B;  3N4Q A;  2Z1H A;  3TU5 A;  4QOZ B;  4FM0 A;  1YVU A;  2W40 A;  1S1T A;  4PA1 A;  5KGW A;  3L3U A;  1HNV A;  4WQ4 C;  3PUF A;  1VSF A;  1VQP N;  4M45 A;  3GOI A;  4LFA K;  3SQ0 A;  4IWV A;  3F9M A;  3C65 A;  1VSK A;  3D2F B;  4BVO A;  3AVN A;  3SK3 A;  3K9J A;  4BR5 A;  4CED A;  1RTH A;  2DFE A;  2ZM6 K;  3QEV A;  2UXC K;  1M90 O;  4C8O A;  4ZTF A;  1VK0 A;  3DLG A;  2EHG A;  2XRI A;  3BP8 A;  2WFB A;  4O8K A;  1RBS A;  5KRT A;  1QQN A;  4EAH D;  2D4W A;  4DSL A;  4BRG A;  1NJI O;  4KRE A;  1W7A A;  3WUH A;  1NJW A;  4O5B A;  3KKS A;  4CE9 A;  1HYV A;  5TKW A;  4A2A A;  4YNQ A;  3ID8 A;  3PLA A;  4BRQ A;  4WYB A;  3KIO A;  3ZSO A;  4G9Z A;  3P83 D;  3AAR A;  1S1X A;  1VSD A;  3VQD A;  2HOE A;  3J7Z O;  1JCE A;  4QAG A;  3UKR B;  4JV5 K;  3ZX3 A; 
#chains in the Genus database with same CATH homology
 4B3M K;  2VQF K;  5LMN K;  3OTO K;  4B3S K;  4DV0 K;  1N34 K;  1N33 K;  4OX9 K;  1XNQ K;  4B3T K;  4DV1 K;  5FLX O;  4JI5 K;  4V19 S;  1HNW K;  4X65 K;  4DV3 K;  4JI8 K;  4NXN K;  5LL6 Z;  4X66 K;  4LF9 K;  4LF5 K;  3T1H K;  4JI4 K;  4B3R K;  4DR3 K;  1IBK K;  4DR1 K;  5IWA K;  4JI6 K;  5BR8 K;  4KHP K;  4DV6 K;  4GKJ K;  4LF8 K;  4DR6 K;  4DUY K;  4JYA K;  4DV7 K;  4X62 K;  3J7A P;  4DV4 K;  4CW7 B;  3JAM O;  2F4V K;  3J81 O;  1XNR K;  1IBL K;  2UU9 K;  4JI0 K;  2UXD K;  1N36 K;  1IBM K;  1HNX K;  4LFA K;  4YY3 K;  3J80 O;  3J7Y P;  4X64 K;  2E5L K;  4LFC K;  5A2Q O;  1I94 K;  4YHH K;  1J5E K;  4DR5 K;  2HHH K;  4K0K K;  4CVN E;  2UUA K;  2VQE K;  2ZM6 K;  2UXC K;  4GKK K;  5LMU K;  4JI7 K;  4AQY K;  4JI3 K;  2UXB K;  4DR4 K;  4LF7 K;  4DV2 K;  4DR2 K;  4LF6 K;  4LFB K;  2UUC K;  3T1Y K;  4DR7 K;  4LF4 K;  1HNZ K;  4NXM K;  4DV5 K;  2UUB K;  1XMO K;  1HR0 K;  4JI2 K;  4JI1 K;  1FJG K;  5IT9 O;  1XMQ K;  5AJ3 K;  1N32 K;  4DUZ K;  4JV5 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...