3O3GA

T. maritima rnase h2 in complex with nucleic acid substrate and calcium ions
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
222
structure length
222
Chain Sequence
GIDELYKKEFGIVAGVDEAGRGCLAGPVVAAAVVLEKEIEGINDSKQLSPAKRERLLDEIMEKAAVGIGIASPEEIDLYNIFNATKLAMNRALENLSVKPSFVLVDGKGIELSVPGTCLVKGDQKSKLIGAASIVAKVFRDRLMSEFHRMYPQFSFHKHKGYATKEHLNEIRKNGVLPIHRLSFEPVLELLTDDLLREFFEKGLISENRFERILNLLGARKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of RNase H2 in Complex with Nucleic Acid Reveal the Mechanism of RNA-DNA Junction Recognition and Cleavage.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase/dna-rna hybrid
molecule keywords Ribonuclease HII
total genus 81
structure length 222
sequence length 222
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2010-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3o3gA00
3B6PA 2IC3A 4KHNA 2Q3SA 1JXEA 2P51A 5HRSA 1ASVA 2JLEA 3LPUA 1X9SA 4FJXA 3KKSA 4K8XA 1QTMA 3WNFA 4DMNA 1BQNA 4ZTFA 4DTSA 1IG9A 5DK5A 1S1XA 4OLAA 1LW0A 1C6VA 2E4LA 3NGIA 3SV4A 3T19A 1CZBA 1NOZA 1SUQA 4NYFA 4B8CA 1S1WA 4KI6A 2AJQA 4CIFA 5HRPA 3TAFA 1RILA 2IS3A 2ZQBA 3VQCA 3MEGA 4Z0UA 2IDOA 3SUPA 4DQPA 2P1JA 4DSFA 3AVMA 4FK0A 3MECA 1U47A 1TAUA 1DTQA 1QS4A 4DU1A 4C8NA 4CK2A 1TL3A 1Q8IA 3PO4A 2OZMA 4I9QA 2DY4A 4Q0BA 3DLGA 1DTTA 4M3ZA 3ZSZA 4NCBA 2OPSA 4KTWA 4IFVA 1XHXA 3IG1A 1KLNA 1VSFA 4EP4A 4Q5VA 3PX0A 5I3UA 5C42A 1YTUA 4CEFA 3WNHA 4IDKA 1BIUA 4M3RA 4FYDA 3G10A 5FDLA 3ZSOA 4UQGA 1S9GA 4M3YA 3VQDA 3ZSVA 3P5JA 4G1QA 3VQBA 4CF0A 4DTRA 2FBXA 4H8KA 2ITGA 4F3TA 4W5QA 3KD1E 3TAQA 3OYCA 2YHAA 4E0DA 4PY5A 1JL2A 2HHXA 4R5PA 4FM0A 1EETA 3OYGA 1KRPA 3SI6A 3VQ4A 2RF2A 2FBTA 3PUFA 2PZSA 1ITGA 3T3FA 3SQ0A 1Q9YA 2HW3A 5KRSA 4AH9A 4FJJA 5C25A 3SUQA 1UA0A 4Z4FA 4ELUA 5HP1A 2PY5A 3NH0A 4KB1A 1TKZA 5KI6A 3DLEA 1BGXT 3B6OA 4O5BA 4E7IA 3O3HA 1XWLA 3ISNC 1CZ9A 1Q9XA 3DOKA 2EHGA 3SUNA 1HYSA 1HNVA 3CFRA 1EXQA 3VQAA 4E7LA 4I2PA 3SZ2A 3SQ1A 3K5NA 2YHBA 1L5UA 3QIOA 1RT7A 1NJZA 1C0MA 5JS2A 2QKKA 4GVMA 3OY9A 3RMAA 1YTAA 2HNYA 4DF8A 1U45A 4DFKA 4DTNA 1HJRA 1X1PA 4I9LA 3NFAA 5HROA 1R0AA 2RN2A 1RBTA 1HQUA 3ALYA 4E89A 3HP6A 3O4QA 1UWBA 3SPZA 1QQCA 4CJSA 3RRHA 4B3OA 3CM6A 2HHUA 1C0TA 1WSHA 4HUGA 4DTXA 5KRTA 3THVA 3LP0A 1NK8A 3I0RA 3TWHA 1X9MA 1A5WA 3HK2A 4DS4A 4AHVA 4E3SA 4CEAA 4CERA 4BE2A 4DSKA 1WSEA 2YV0X 3IAYA 1C1BA 1S1VA 2Y1IA 3AVGA 4LSNA 2FC0A 2O4GA 1WAJA 4RW7A 4CF9A 3L2UA 4OKEA 3K5MA 3SV3A 2DFFA 4OLBA 1B9FA 1DLOA 3S3MA 2HHQA 3QEVA 3VQQA 4FJNA 1EKEA 4F3OA 3OYMA 4C8KA 1S1TA 3OYKA 3SUOA 3KLEA 1KLMA 2A1SA 2ATQA 5J2NA 2F96A 4CHZA 3QEXA 4B08A 4DSIA 1VK0A 3U3YA 3M8PA 4KHQA 4DQSA 3FFIA 4ID1A 3OJUA 1TKTA 2BANA 3CG7A 4IBNA 3VA3A 1X9WA 2OYQA 2F8SA 3CYMA 1U49A 2YNIA 4KREA 2FBVA 1QSLA 1IKXA 3L2VA 4DFJA 1O1WA 4DWIA 4CJPA 1RNHA 5CYQA 1SKRA 1NKBA 4B9NA 3CFPA 3BDPA 4B9UA 1TV6A 2G8FA 5CZ1A 1VSJA 4YFUA 3C6UA 3V9UA 1FKOA 4M3UA 1RTDA 3ZT3A 4HCCA 2O4IA 3OYLA 4CGJA 4B8AB 2YKNA 4J2BA 2XY8A 1IKYA 1VSHA 1JL1A 4OKJA 4Y1CA 1LWCA 2HVIA 3V1QA 3MEEA 4CJWA 1WLJA 4CK1A 1I39A 3TI0A 4F2RA 4CJ3A 2R7YA 4E7HA 3F9KA 3LPTA 4ID5A 5KGXA 3OS2A 3OYFA 3DMJA 1JXBA 4LH4A 4NYNA 3WNGA 4OPKA 3LAMA 1JLAA 1T8EA 2A1RA 4F2SA 4DQRA 3HYFA 3TAGA 1QSYA 2PYJA 4DLEA 1D5AA 4GMJB 3DYAA 3VQEA 4CGGA 1QSSA 3AVNA 3H08A 3M8QA 4FZXC 4AHUA 3HPGA 2G8VA 2E6LA 1UAXA 4W5TA 3ZSYA 1JLQA 2GBZA 3AA3A 2VG6A 3LP1A 4CEZA 3KLHA 3QEWA 4B9TA 1RBUA 1W0HA 3V81A 1TKDA 3ZSXA 5JS1A 1BL3A 2HVHA 1KVAA 2JGUA 3C6TA 2RPIA 3C95A 4CIGA 1QHTA 4RW9A 3AVJA 3L3VA 5EU7A 4YNQA 1J53A 1RDAA 3OYDA 2YKMA 4I7FA 5J2PA 2G8WA 4N41A 4FW1A 4KFBA 2ZE2A 2GV9A 3RMBA 4JRQA 1ZBLA 4LH5A 4KTQA 3AVCA 3U6FA 1ASUA 5SZTA 2P5OA 1RT3A 5FRNA 3OS1A 2KW4A 4M3XA 3HXMA 3SJJA 3VQ8A 1HRHA 4MFBA 4MQ3A 4FK4A 4CEOA 3MXMA 2BGGA 4CJ4A 4KKOA 1JLCA 1C1AA 2P5GA 1BIZA 2XHBA 3P1GA 1TK5A 3HP9A 3D0PA 1WN7A 4J2DA 2X78A 5HBMA 4M3TA 3I0SA 2VG7A 3OYEA 2QK9A 1TK0A 1RT4A 1VSDA 3DM2A 1F21A 4FLZA 2D5RA 4DFPA 2FBYA 4KHYA 3L3UA 2ZD1A 4Z4EA 4DTPA 4O0JA 3NCIA 4JLHA 1WNSA 1GOBA 5T7BA 2Z1HA 4JRPA 1LW2A 3TARA 4KV8A 4EZ6A 3SQ4A 4KI4A 5FRMA 1GOAA 5D3GA 3TABA 1BCMA 4CEEA 4CJ5A 1CXUA 4M42A 4DLGA 3O4NA 3OYAA 1W9HA 2Z1GA 2Y1JA 4OGEA 4CEDA 4PQUA 4E7KA 4FVMA 3KKRA 3L2RA 1NK6A 3AVBA 4FJ7A 3NGYA 3E01A 3JSMA 2B5JA 1IO2A 5CYMA 3QEPA 4KTZA 4DQIA 1ZBFA 5DMRA 4LY7A 4ICLA 1NOYA 2GUIA 5C24A 1JLFA 3T1AA 4AHRA 4FJIA 4QCLA 1BI4B 3AVHA 3SPYA 4KAZA 3KTQA 2VWKA 3S9HA 1N6QA 1RT1A 2OPPA 3P83D 4CGHA 4LSLA 2HHSA 1IH7A 3PO5A 1KTQA 2HNDA 1G15A 1WSJA 1J5OA 3K57A 4DU4A 4PUOA 4CJKA 1TL1A 2B4JA 1I3AA 2D0BA 1A5XA 3DRRA 3SYZA 3HSTB 4RG8A 4BE0A 1SV5A 1SKSA 1TK8A 3AO1A 4NCGA 3CM5A 1NKEA 3D45A 1SKWA 1BCOA 4IG0A 2OPQA 4FJ5A 4BE1A 4O0IA 3QESA 1QE1A 4O4GA 3I8DA 4CF1A 3AO4A 2I5JA 2RKIA 1KCFA 2ETJA 3G0ZA 1K6YA 4H4OA 1SL0A 1TVRA 4CCHA 4CJQA 2YNFA 3LALA 1RTHA 1C0UA 2G8IA 3AVIA 4RW6A 3SQ2A 1JKHA 3RTVA 1CLQA 4GW6A 1A5VA 1T03A 1RBRA 4AHCA 3TAMA 3JYTA 3VQ6A 5SWMA 3V1OA 1VSIA 3V9XA 1SL2A 3ULDA 2YNGA 4FJLA 1D8YA 4CJVA 5FROA 1REVA 4B9SA 1J9AA 4BDYA 1FKPA 4KHWA 3DLHA 1IKWA 1YT3A 2VWJA 4CF2A 3O3GA 4Z4IA 1NJYA 3KK3A 2XO7A 4HHTA 1NJXA 3IRXA 3ZCMA 3NF9A 1HYVA 2BE2A 2EX3A 5CY4A 4JS5A 3EZ5A 2OA8A 4DTMA 3DOLA 3MEDA 4OGCA 1RDBA 1CXQA 4DQQA 3ZT1A 4WE1A 3QETA 1KSPA 4N5SA 1XI1A 3QNOA 3DLBA 2KFNA 4Z4CA 3AA5X 1FK9A 1LAVA 3QINA 3M8RA 1D9FA 3NAEA 4FLVA 1BISA 4C8MA 4CFBA 2KFZA 1TAQA 4KHUA 1EP4A 3NF7A 1GOCA 1T7PA 3LZIA 4Y1DA 4LD0A 4IKFA 3MXIA 3DLKA 4FZZA 3HM9A 1ASWA 3EYZA 1S9EA 4FK2A 3MXJA 5CZ2A 3VQ7A 3K5LA 1D9DA 3ASMA 1VRUA 3K5OA 1L3SA 3HL8A 1RT6A 4FM2A 3CFOA 3DRSA 3U3GA 1ZBIA 3S3OA 3RMCA 2IAJA 3ITHA 4FLWA 3LP3A 4W5RA 4CGDA 4M3WA 4CFAA 2X6SA 3NH1A 2D0AA 2IGIA 4CGFA 3VA0A 3V9SA 1Z25A 3AVLA 4E7JA 3RR8A 1U48A 5KTQA 3M8SA 1BQMA 4FLUA 4CEQA 3OYHA 3L8BA 3V4IA 2YNHA 3KK2A 4AHSA 2E6MA 4O55A 1NK4A 1SL1A 1S6PA 1NKCA 1S6QA 4DSLA 2NUBA 4FJ8A 4RW8A 5J1EA 2PYLA 4N76A 4CJEA 3AA4A 3TAEA 1LAWA 3AO5A 2DFEA 4M41A 5KGWA 1RTIA 3L2QA 3LDSA 1LV5A 4I2QA 4O44A 1LWEA 3ZT2A 3UIQA 3AVFA 4CJUA 4ZTJA 4K8ZA 3K58A 3NE6A 4CFDA 1HNIA 3MAQA 4KB0A 4F4KA 2Z1JA 4C8LA 4ELTA 4CJTA 4E1NA 5J2MA 4CHOA 3AVAA 1HPZA 3ZT4A 2XY5A 4PWDA 3SCXA 3HO1A 2HHWA 3ZSQA 4CHNA 3QLHA 3LP2A 4OVLA 4RW4A 3TR8A 3ZT0A 3OJSA 2HB5A 3HT3A 3V9WA 4DFMA 3ZSWA 4TSXA 4CE9A 3QO9A 1ZBUA 4N47A 1JLBA 4Z4HA 3KLGA 4DTOA 4CEBA 4CHPA 4HVJA 3O3FA 4E1MA 4DTJA 3NF6A 4DU3A 1N5YA 4BDPA 3AA2A 5I42A 4AHTA 4J2EA 1WSIA 3DRPA 1NK7A 1L3VA 1RBSA 1S1UA 2XY7A 5J2QA 2KZZA 1VRTA 3KJVA 2DFHA 2WOMA 4IG3A 4CK3A 4DSEA 3S3NA 4EZ9A 4KHSA 3A2FA 3OYNA 3AO2A 3TANA 1VSMA 1HMVA 2KTQA 4FCYA 4IFYA 4DS5A 3ZSRA 3HVRA 2X6NA 2XRIA 1MU2A 4CESA 1ZYQA 4CECA 1RT2A 5K14A 3LWMA 1XHZA 4ZHRA 3AV9A 1RBVA 4HUFA 2QKBA 3OYBA 3NHGA 2OZSA 1BI4A 3K2PA 4BACA 3DLRA 4FJ9A 3OYIA 4HUEA 1RT5A 3V6DA 2X74A 2HHTA 1B9DA 1FXXA 1VSLA 3VQ5A 3CQ8A 4AILC 1WSFA 4E19A 2XY6A 4C8OA 4QAGA 3QNNA 2B6AA 4CFCA 1L3UA 3AVKA 3LAKA 2HNZA 4W5NA 3V9ZA 4ELVA 4J2AA 4BWJA 3PX6A 4BWMA 3F73A 1J54A 3VN5A 4FLTA 4CF8A 3L2WA 2BDPA 4L8RB 2Z1IA 4XIUA 3K59A 1TKXA 3EY1A 1KFSA 3HJFA 1XC9A 2WONA 3VQ9A 4KO0A 3V1RA 3WNEA 2QXFA 3NDKA 4H4MA 3KD5E 4DTUA 1RDDA 4HTUA 2W42A 1S5JA 1TGOA 4B9MA 3PV8A 3KLIA 4CJLA 2LSNA 3LZJA 4CGIA 4DF4A 1NK5A 4DSJA 1KVBA 4CIEA 1WSGA 3NH2A 4CJFA 3LWLA 3HPHA 3SNNA 3VQPA 4FLXA 3BGRA 4JS4A 4KPYA 4KRFA 1U4BA 1VSEA 3NBPA 4FW2A 1JLGA 3KIOA 3PY8A 2KZMA 3NF8A 1NK0A 4OPJA 2D0CA 3DI6A 4FJGA 3OVNA 3OS0A 4FM1A 1Z26A 3KK1A 5HLFA 4CHQA 3C94A 4OKKA 2G8UA 3LANA 4FJHA 1WAFA 5HRRA 3IS9A 2G8HA 4B9VA 1UOCA 2DTUA 3AO3A 1RCHA 1KVCA 1T05A 4B9LA 4DG1A 1YVUA 2KQ2A 1IKVA 3OYJA 4FJMA 3PX4A 3RRGA 1NJWA 1ZBHA 1KFDA 1HYZA 2HMIA 3NGZA 4EP5A 4OJRA 3KLFA 1UA1A 4NCAA 1BHLA 4M45A 4PA1A 4W5OA 2VG5A 3RWUA 4FJKA 3HPOA 3RMDA 1NK9A 2G8KA 1U04A 1RDCA 5HRNA 3QERA 1L3TA 4FLYA 4FXDA 4CJRA 4HCBA 1LWFA 4Z4GA 4QOZB 4F8RA 4BDZA 1RTJA 3QIPA 5E41A 1HQEA 1VSKA 2F8TA 4FZYA 3RR7A 2OPRA 2IOCA 3QEIA 2HHVA 1C1CA 1JLEA 4CHYA 1Y97A 3HVTA 4N56A 1B92A 3TAPA 1EX4A
chains in the Genus database with same CATH superfamily
1ASVA 3LDLA 3LPUA 3KKSA 4DTSA 1IG9A 5DK5A 1S1XA 1HKCA 5AQWA 3SAHA 3EKUA 1C6VA 3NGIA 3B8AX 2AJQA 1K9MO 5HRPA 4GY2B 3BP8A 4JI3K 3BZCA 3MEGA 4WFBL 2IDOA 3SUPA 5C0YA 2P1JA 4FK0A 4JHDA 1TAUA 4DU1A 3PO4A 1TL3A 2OZMA 2DY4A 2HMPA 4M3ZA 1S22A 3PX0A 2D4WA 5I3UA 4BR7A 3CMAN 4M3RA 5AFUA 3G10A 1S9GA 3MX5A 3VQDA 3IUCA 4DTRA 4IO9L 1HPMA 4FM0A 2ZM6K 2OCEA 3SI6A 3VQ4A 2RF2A 2FBTA 3PUFA 2PZSA 3UB5A 3T3FA 1X9JA 3OBWA 1UA0A 4KB1A 1TKZA 3B6OA 4E7IA 4M63C 1Q9XA 3VGLA 3TTFA 1EXQA 3SQ1A 4I2PA 3K5NA 2YHBA 1X3NA 1Z05A 3MN7A 3U4LA 4BG9A 1NU0A 4MDBA 5HROA 3ALYA 3O4QA 1UWBA 4H5TA 3RRHA 4B3OA 3HRGA 3CM6A 4DR1K 1M1KO 5LJVA 4DTXA 3THVA 1CZAN 3I0RA 4CEAA 4CERA 1WSEA 1S1VA 2FC0A 1WAJA 4BRAA 3K5MA 2DFFA 4FJNA 1T6CA 2E1YA 3KLEA 2KLAA 1C0GA 1YHQN 3C0BA 2UXCK 4BC4A 3OA9A 1BA0A 3OJUA 2BANA 3VA3A 3CERA 1IKXA 1O1WA 3CJAA 3J7ZO 3SK3A 2G8FA 1IBKK 1VSJA 4CD3A 2O4IA 1X3MA 3MWPA 4CGJA 2YKNA 4JN4A 1IKYA 1VSHA 4OKJA 4Y1CA 3IFRA 3D2EB 1XMOK 3ID8A 3V1QA 3K0SA 4CVNE 1I39A 3CMEN 3LPTA 4NLCA 3DMJA 2NRVA 3WNGA 1DGKN 4DQRA 3VQEA 1T6DA 1NBWA 4CGGA 4RTFD 4HWIA 3M8QA 4AHUA 1UAXA 2VGMA 2GBZA 4R79A 3WT0A 1MA9B 3QEWA 4B9TA 4JI8K 2Q1NA 4CIGA 3ULEB 2D1KA 4BC3A 4B3RK 3AARA 2YKMA 4I7FA 5AQXA 1N32K 3U6FA 1ASUA 5FRNA 2P5OA 2KW4A 4MFBA 4MQ3A 4CEOA 3MXMA 2BGGA 4KKOA 2P5GA 1TK5A 3HP9A 4LF9K 3C6AA 4M3TA 1TK0A 2A3ZA 3DM2A 3WQTA 4Z4EA 2VQEK 4YOUA 4WFNL 2HHWA 4KI4A 5M1OA 2Z1HA 3TARA 3MWTA 5FRMA 3JXUA 5M1NA 3E9OA 1GOAA 5D3GA 3DXMB 4BC2A 4M42A 5EY4A 5BPNA 1BG3A 4CEDA 4CZMA 1K8AO 3NGYA 3E01A 2B5JA 4KTZA 1ZBFA 3CJCA 1JLFA 1BI4B 3PSFA 4BRMA 5AQSA 1N6QA 2OPPA 4LSLA 1KTQA 2HNDA 1WSJA 3D2FA 4G9ZA 3FZHA 4PUOA 4YDUA 2B4JA 2D0BA 3SYZA 3HSTB 1TK8A 3CM5A 1NKEA 4IG0A 3D2EA 4YORA 1SAZA 3QESA 1QE1A 3ZYYX 3I8DA 3AO4A 4FOEA 2ETJA 3G0ZA 4BR0A 1Y64A 1SL0A 4CJQA 2YNFA 3LALA 1RTHA 2G8IA 1BA1A 2AA4A 5BPMA 3RTVA 4GW6A 1T03A 3JYTA 5SWMA 3V1OA 4WQ5C 2VGNA 5LMUK 2BH1A 1E4GT 4CW7B 4BDYA 3A5LC 2P9UB 4JKDA 3J81O 3O3GA 3TTCA 4JD2B 5AZIB 1V4SA 4CZHA 3QFUA 4IJNA 2BE2A 2F9TA 5CY4A 3VETA 3MEDA 4IJAA 3QETA 1KSPA 4N5SA 3QNOA 2O8FB 3AA5X 4O8KA 3WXLA 2BTFA 1BISA 4C8MA 1TAQA 2ASMA 3J7AP 3NF7A 5FPDA 4DUYK 1BUPA 1GLDG 1MWMA 3HM9A 3EYZA 4FK2A 3M3ZA 2P9LA 3HSCA 4BR9A 3K5LA 5FPEA 1QZ6A 2E2OA 3K5OA 1ZBIA 3CFOA 3DRSA 5JLFA 3OHRA 3ITHA 4W5RA 4CGDA 1GLJO 4JKHA 3CCVN 1U48A 4BG8A 5AQIA 1BQMA 3OYHA 3DWLA 3ZLJA 1GLEG 3C7NB 2WFBA 5H1SQ 4JK9A 1KQSM 1SL1A 1S6PA 4FJ8A 3AY9A 3AA4A 2HOEA 2DFEA 1RTIA 1S72N 1ZC6A 4O44A 4ZTJA 2QWMA 4JEPA 4KB0A 4C8LA 4E1NA 4CHOA 3AVAA 3ZT4A 2HBMA 4PWDA 3ZSQA 1J5OA 3QLHA 3LP2A 3TR8A 3V9WA 1TUUA 1OVQA 5C12A 4CE9A 3QO9A 5AQUA 1NGCA 4B1WB 4IZ9A 5FLXO 3KLGA 5KPTA 4NXNK 4DTJA 3AA2A 1OVYA 4J2EA 4EHUA 3DRPA 3L4IA 1YIJN 3H1QA 2WOMA 4CK3A 4DSEA 4EZ9A 4JI7K 4DS5A 3UKRA 1BWFO 4LFCK 4ISEA 1YJ9N 2XRIA 1J5EK 1XHZA 3K2PA 1NM1A 4DKWA 3THWA 4BACA 2HBKA 3OYIA 1RT5A 3DXMA 4AILC 4C8OA 3E9PA 1WUAA 4QAGA 3W3DA 4CFCA 4PL7A 2HNZA 5ADXA 3KVGA 4CF8A 3L2WA 2BDPA 1KFSA 3VQ9A 3KD5E 2NRTA 3NDKA 4DTUA 1RDDA 3O9UA 4B1ZA 3VEXA 3EKSA 4GVEA 1WB9A 3A5NC 3LZJA 1Z6RA 1RDWX 4DR2K 3NH2A 3LWLA 3VQPA 4DR3K 4X64K 3BGRA 4FW2A 3NF8A 5KQ8A 1Z26A 4AF1A 1YAGA 5HLFA 2F4VK 3CD6N 3O9QA 3DLLL 2DTUA 2E20A 4DG1A 4H03B 5M1PA 4FJMA 1ZBHA 2FF6A 1HYZA 2HMIA 3PLAA 3TPQA 1BHLA 4PA1A 4W5OA 2VG5A 3RWUA 1HNZK 3CJ1A 1U04A 3ZX3A 1L3TA 3O08A 5JICA 1SZ2A 5AQZA 3ZETB 4QOZB 5E41A 1VSKA 2F8TA 3CJBA 2OPRA 3THYB 3QEIA 3TAPA 1EX4A 3B6PA 1JXEA 4CI6A 1X9SA 3TSUA 3WNFA 4DMNA 4ZTFA 1EWRA 4U7BA 3MN6A 4EFHA 3SV4A 4OPHA 1CZBA 1NOZA 1SUQA 5M1KA 4KH5A 4B8CA 1S1WA 3CF5L 1FW6A 1RILA 4B1YB 4DQPA 2H3GX 4DV0K 3CCQN 3HTVA 4C8NA 4CK2A 3C65A 4Q0BA 4GNIA 4KHPK 3HZ6A 2E2PA 3QBXA 1MDUB 4KTWA 1KLNA 3IG1A 4FWRA 4EP4A 1HJOA 5C42A 3ZSOA 2CH5A 4H8KA 3TAQA 3OYCA 4PY5A 3FLCO 4A57A 3H3NO 4R5PA 1HR0K 4ISGA 1EETA 2ZJPL 4FWMA 4O5FA 3SUQA 2F9WA 3SJHA 3DLEA 4B1XB 4O5BA 3GOIA 1XWLA 1CZ9A 3FR0A 4M7XA 3SUNA 2EHGA 2FSJA 1P90A 4BRIA 1HNVA 3CFRA 5KPRA 1GLAG 3SZ2A 4JV5K 2F7TA 1RT7A 1C0MA 3CCEN 4GVMA 4X66K 1QQOA 1YTAA 4DF8A 4DFKA 3J8AA 2P9PA 4CBXA 3HP6A 2O8CB 3L4QA 1QQCA 3S41A 1C0TA 1WSHA 3LP0A 4DSKA 4CBUA 3G6EN 2YV0X 2V51B 1C1BA 3AVGA 4LSNA 4CF9A 3SV3A 4OKEA 3WQUA 1B9FA 1DLOA 3S3MA 3VQQA 3U8XA 4GV9A 4F3OA 5EXWA 4C8KA 4YOXA 4KBOA 3SUOA 1KLMA 3M5RA 1HX1A 2P9IB 4GKJK 4DSIA 1VK0A 3U3YA 3BF3A 3M8PA 3O1BA 1YJWN 3FFIA 4ID1A 1X9WA 3CG7A 4IBNA 2F8SA 3CYMA 1U49A 4LF6K 2FBVA 3T1HK 4DFJA 4CJPA 5CYQA 1NKBA 2IVOA 2P9KA 5CZ1A 4YFUA 3V9UA 3ZT3A 3DXKA 1HLUA 3OYLA 4B8AB 4J2BA 2XY8A 3GL1A 3CCLN 2HVIA 3MCPA 3IMXA 3MEEA 1N34K 1WLJA 5AQVA 3AAPA 2IVPA 5KGXA 3CCSN 1I94K 2O8EB 3VPZA 1VQ6N 3CJ9A 3CIPA 3K9JA 3A5OC 2QTDA 5ADXH 3AVNA 1NNEA 2G8VA 2E6LA 5GAHP 4H0YB 3V81A 3ENHA 3ZSXA 1KVAA 2JGUA 3C6TA 4BRKA 4OO1J 1QHTA 4RW9A 3AVJA 3L3VA 4OLBA 3OYDA 3SBGA 4V19S 4N41A 2ZGZA 4FW1A 1ZBLA 3D7EO 3AVCA 3OBYA 3FZKA 3VQ8A 1JLCA 5B8HA 2XHBA 4H0TB 3D0PA 2P9SA 5HBMA 2QK9A 2VG7A 3OYEA 1VSDA 1F21A 3RVCA 4DFPA 4KHYA 3L3UA 2ZD1A 3TSQA 4DTPA 3NCIA 1TUYA 5AZJB 4JLHA 1WNSA 5T7BA 1LW2A 2I7NA 4C1NK 2Q36A 3AGKA 1YJNN 1BCMA 2QWOA 3HBTA 3OYAA 1W9HA 2Z1GA 1VQPN 4OGEA 4PQUA 3CI5A 4FVMA 3JAMO 4JI5K 3JSMA 4FSVA 4H0VB 5C24A 3T1AA 2GWJA 1JCEA 3KTQA 2VWKA 3QBWA 3VESA 3S9HA 3P83D 4CGHA 4BRNA 4K43A 2HHSA 2VQFK 2O8BB 3KWGA 1NGIA 1E3MA 4DU4A 4CJKA 1TL1A 2UYTA 2HF4A 2NRRA 4JI4K 1SKWA 1BCOA 5E26A 4BRFA 1Q86O 4O0IA 4O4GA 1M90O 3AVIA 4RW6A 3SQ2A 4JD2A 5AZIA 2ZGYA 3SAFA 5M1FA 5AQMA 1P8ZA 3TAMA 1SL2A 2WBNA 2YNGA 4CJVA 1REVA 1W2BM 1FKPA 4GV6A 3WXMB 4DV2K 1YT3A 2VWJA 4LF4K 2EWSA 1NJYA 3WEEA 4K25A 1NJXA 3NF9A 1SS6A 4JS5A 2OA8A 4DTMA 1RDBA 1CXQA 4DQQA 3ZT1A 3A8YA 4CFBA 2VCPA 4KHUA 1EP4A 4CD1A 3F5TA 3IKMA 3I55N 3LZIA 1WOQA 4Y1DA 4LD0A 3U9ZA 4EHTA 4IKFA 3MXIA 3DLKA 3QICA 1ASWA 1S9EA 3Q7BA 3W0LA 1D9DA 3ASMA 1K8KA 3HL8A 3UKRB 3R1XA 2IAJA 4FLWA 3LP3A 4M3WA 4CFAA 3VA0A 3WXKA 4E7JA 3RR8A 4FLUA 4CEQA 3L8BA 3WXIA 4AHSA 1NK4A 4O55A 3DXKB 1NKCA 1ILYA 2E5LK 1S6QA 4DSLA 4K0KK 2NUBA 5J1EA 3TAEA 3AO5A 4ILHA 5KGWA 1LV5A 2OANA 1LWEA 3AVFA 4MDAA 3U9DA 1DT9A 1ESVA 4F4KA 2Z1JA 4ELTA 2AP1A 4ISFA 2XY5A 4OVLA 4RW4A 4FWLA 4DFMA 4IWVA 4TSXA 2W6KA 1JCGA 4CEBA 3O3FA 2PAVA 1N5YA 3N4PA 3QB0A 4A2AA 3LM2A 1WSIA 2E2NA 1OH7A 1RBSA 2NZTA 3LDOA 2KZZA 4IG3A 3PSIA 3AO2A 3TANA 5BR9A 1NGBA 3ZSRA 4BRQA 1MU2A 4IOXA 4BVPA 4CESA 1ZYQA 4CECA 1RT2A 5K14A 3LWMA 5C10A 2IVNA 5CR4A 3AV9A 4HUFA 5TKYA 3OYBA 2OZSA 2KHOA 5GIPA 3DLRA 4DV7K 4PKGA 3CQ8A 4IOCL 3KWIA 4E19A 2XY6A 3QNNA 2B6AA 1ATSA 2P9NB 5TKWA 3O9RA 1L3UA 4CZKA 4W5NA 1HKBA 5FPNA 4BWJA 3EO3A 4BWMA 3VN5A 1KC8O 1VQ8N 4QS7A 1D4XA 3WNEA 3V1RA 4HTUA 1BO5O 4B9MA 1TGOA 1NMNA 3MX2A 1NK5A 2LSNA 4CGIA 4DF4A 1KVBA 4CIEA 3Q7CA 5AQJA 4KH6A 3O80A 3SNNA 3HPHA 1RDUA 2HF3A 1U4BA 1JLGA 2KZMA 1Q82O 4J8FA 3OS0A 3GE1A 4CHQA 3C94A 3LANA 1Q81O 4FJHA 1WAFA 5MLCQ 4JKCA 2GUPA 1RCHA 1KVCA 3ENOA 4BRHA 4B9LA 4AM6A 3TU5A 3VF4A 1YVUA 2KQ2A 1IKVA 3OYJA 4BR2A 2QA4N 4H0XB 1NG9A 3THYA 3ULEA 4EP5A 1UA1A 5M1QA 4M45A 4FJKA 4CJ7A 3T1YK 4MLHA 2IIRA 4ILJA 3OTOK 1IG8A 3QERA 4CJRA 1LWFA 4Z4GA 1RTJA 3NMUA 3NVMA 1HQEA 5C2DA 3RR7A 1JLEA 4CJ3A 4KV8A 3HVTA 1WBBA 4JK8A 2IC3A 2YHXA 4KHNA 2P51A 4FJXA 1XQSC 2O8EA 1BQNA 1LW0A 1T44A 3MMVA 5IT9O 1IJJA 3FFKB 2ASPA 2HHHK 4NYFA 4B1UB 4KI6A 2P9LB 3KHYA 2ZQBA 4MO5A 4FL9A 3AVMA 1NMDA 1QS4A 1VAZA 1HKGA 1Q8IA 1VQ9N 3DLGA 1DTTA 3J80O 3ZSZA 2OPSA 4IFVA 1XHXA 1VQKN 4L3QA 4QS9A 3RSEB 4Q5VA 4NB4A 2ZJQL 1RFQA 1YTUA 4CEFA 3WNHA 1BIUA 4UQGA 3VQBA 1VQ4N 4F3TA 2ITGA 4W5QA 3KD1E 4FVUA 2YHAA 1YITN 1KRPA 4WCEL 4JI6K 1Q9YA 2O8DA 2JWKA 5KRSA 1LCUA 4AH9A 4FJJA 5C25A 1N33K 4Z4FA 5HP1A 4MO4A 2QEXN 4LFBK 1BGXT 3O3HA 3I56N 1HYSA 1L5UA 3QIOA 1YVNA 5HOOA 1NJZA 3OY9A 3VEOA 1JCFA 1HJRA 1X1PA 2UXDK 4B3SK 4I9LA 4JKBA 2QI2A 3SPZA 4HUGA 5KRTA 1NK8A 3MCAB 4WYBA 4DS4A 4AHVA 4E3SA 3FZFA 4BE2A 4RW7A 2ZWHA 5JVHL 3QEVA 5LMNK 1EKEA 2V7ZA 4KH4A 3THWB 3QDKA 2A1SA 4PKHA 2F96A 3GBTA 3QEXA 2YI1A 4KHQA 1TKTA 2OYQA 2NRZA 4DV5K 4I6MA 2PBDA 1BDGA 4KREA 1QSLA 3L2VA 1RNHA 1SKRA 1KXPA 4B9NA 5CE3A 3LM9A 3BDPA 1TV6A 1FKOA 1RTDA 4HCCA 4YOTA 3ATUA 3CPEA 4PHTX 4IEIA 4IXCA 4JI0K 1LWCA 3EN9A 4YHHK 5AQYA 4CZIA 5LJWA 4CK1A 1N8RO 5HL7L 4F2RA 2R7YA 5JVGL 4E7HA 1XNQK 4OPKA 3LAMA 1JLAA 5EOYA 2QXLA 2A1RA 4F2SA 3TAGA 3HYFA 1QSYA 4DLEA 1D5AA 4GMJB 3QFPA 3D6RA 5EVZA 1QSSA 2A40A 2HBLA 3H08A 2P9IA 4FZXC 1VQMN 3HPGA 2A41A 3MN5A 1JLQA 4A61A 3AA3A 3KLHA 3CCRN 1E4FT 1RBUA 1TKDA 5JS1A 1BL3A 2HVHA 1KD1O 5GIOA 1J53A 2QW9A 2ZE2A 3RMBA 4JRQA 4KTQA 1RT3A 4M3XA 4FK4A 3VEVA 1HRHA 4CJ4A 1C1AA 3L0QA 1WN7A 4BY9C 2X78A 3I0SA 5IWAK 1RT4A 3TSPA 3CHWA 4DUZK 4FLZA 2D5RA 3GDQA 3CC2N 4O0JA 2CGLA 4JRPA 3SBTA 3M1FA 2YHWA 4B3TK 2A6AA 3WUHA 1QHAA 1CXUA 5BR8K 2Y1JA 3EE9A 1K73O 3HOSA 1NK6A 1WBDA 2W40A 4FJ7A 5CYMA 1IO2A 5DMRA 4LY7A 5ELZA 4AHRA 4EIAA 3AVHA 4H5VA 5AQKA 4B3MK 3NVKA 1NGAA 1VQ5N 3VF6A 3K57A 4X65K 3RSEA 1I3AA 3DRRA 3EE8A 4RG8A 2P9NA 4Y0WA 1SV5A 1SKSA 4DQ8A 4FJ5A 5AQLA 4CF1A 2I5JA 2RKIA 4FWNA 2GEMA 1C0UA 2O8DB 2QWQA 2YCHA 1CLQA 1A5VA 1RBRA 4AHCA 1NGHA 2FSNA 3VQ6A 1VSIA 3CXCM 4WQ4C 3THXB 4FJLA 1D8YA 4B9SA 1NJIO 1ZXOA 4CBWA 1IKWA 4Z4IA 4CF2A 2XO7A 5LY3A 4HHTA 3IRXA 3ZCMA 1HYVA 1NGJA 1VQ7N 3EZ5A 3DOLA 4OGCA 4HTLA 4JI1K 4LF8K 3ZETA 1LAVA 3QINA 3M8RA 4B9QA 2E1ZA 3NAEA 2WC9A 4XH4A 4FLVA 4C23A 2J4RA 3ZEUB 5F2RA 1TYQB 1T7PA 3WEEB 4FZZA 4BRGA 4IOAL 2P9KB 2CGKA 5CZ2A 3VQ7A 5GAGP 1VRUA 3CPWM 1L3SA 4LC9B 2P9PB 4A62A 4RCHA 4JKGA 3PIOL 4M7YA 3FZMA 3RMCA 3S3OA 2P9UA 4GKKK 2I7PA 3V9SA 2IGIA 3I8BA 2QM1A 5AQPA 5BRDA 1Z25A 5KTQA 1OH5A 5KQDA 3AAQA 3V4IA 2YNHA 3CJ7A 5KPZA 2E6MA 3P39A 2HBJA 3T69A 1J6ZA 4RW8A 2DPNA 2PYLA 4N76A 4H0PA 1LAWA 3UKUB 4JYAK 4A59A 2Q31A 4I2QA 3UIQA 4CJUA 2W6LA 4JI2K 3PIPL 3K58A 1HNIA 3MAQA 4RWTA 5J2MA 1HPZA 3HO1A 4CHNA 3ZT0A 1W7AA 3OJSA 2HB5A 4K41A 2ZJRL 4N47A 1JLBA 4DTOA 4CHPA 4HVJA 4E1MA 3NF6A 1NWKA 4DU3A 1NGEA 1O13A 4H5WA 2QWLA 4OPAA 5AZJA 4DHYA 1NK7A 1L3VA 1S1UA 2XY7A 3KJVA 4BR5A 1VHXA 3S3NA 3BZKA 5AQNA 3TTDA 5C2FA 3OYNA 4YOVA 4B1VA 1QVGM 4LF7K 1VSMA 2A5XA 1T3VA 3R6MA 5I9EB 3HVRA 1NGDA 4H5RA 2X6NA 4LFAK 2OTJN 4BGBA 4FWKA 4WF9L 3O6WA 1VQON 3FZLA 3LDPA 2QKBA 3NHGA 2HSTA 2YHYA 3G25A 2UUBK 5AJ3K 1B9DA 1FXXA 1QQMA 3P4IA 4E1JA 4ILGB 3G4SN 3VERA 3V9ZA 4ELVA 2E2QA 1RGIA 4XH5A 4BC5A 4J2AA 4IO8A 3PX6A 4NCBA 3F73A 4CZGA 2Z1IA 3K59A 1TKXA 2P9SB 3EY1A 3KK7A 4DR5K 4H0OA 2WONA 4DV6K 4KO0A 2QXFA 4FWOA 1S5JA 3CCUN 3F9MA 3C6HA 3SMPA 2WUSA 4JHDB 3UE5A 4FLXA 3KZBA 4JS4A 4KRFA 3HOTA 1VSEA 3AGRA 1U6ZA 3PY8A 4OPJA 3OVNA 4FM1A 4DR6K 3KK1A 2G8UA 1K8KB 4OKKA 5A2QO 4B9VA 2NRWA 3THXA 1T05A 3K9KA 5AQHA 3PX4A 1TYQA 1KFDA 2YJEA 3E66A 3NGZA 4NCAA 3RMDA 1NK9A 4UY8O 3BF1A 4BGAA 3O1WA 4BRPA 4HCBA 2O8FA 4F8RA 4BDZA 3QIPA 5BN8A 4A5AA 2IOCA 2HHVA 4NXMK 1C1CA 2RE2A 4CHYA 4N56A 3DLBA 2Q3SA 1GLBG 5HRSA 1BOTO 2JLEA 2FLOA 3O4WA 3H1VX 4K8XA 1QTMA 5FPMA 2NNWA 3VGKA 2Q97A 4OLAA 5EX5A 3VOVA 5BREA 2E4LA 3T19A 5AQTA 4GV3A 4MLEA 1NGGA 4CIFA 3TAFA 2IS3A 3VQCA 2CH6A 3H6EA 1XUPO 4Z0UA 5BN9A 4DSFA 3MECA 3MK6A 5DM6L 1U47A 1DTQA 1NLVA 4I9QA 3LL3A 1QQNA 2FSKA 1VSFA 2QWPA 3HI0A 4YOYA 2O8CA 4IDKA 4FYDA 5FDLA 4M3YA 3ZSVA 3P5JA 4G1QA 4CF0A 2FBXA 1YXQA 4E0DA 4OX9K 2HHXA 1JL2A 1C0FA 3OYGA 3BUZB 1ITGA 3SQ0A 3N4QA 5AQFA 2HW3A 4DV4K 5DM7L 4ELUA 2PY5A 3NH0A 5KI6A 3O8MA 3ISNC 4LF5K 1OH6A 3EEQA 3DOKA 4YDUC 3R9PA 3VQAA 4E7LA 5JS2A 2QKKA 3RMAA 1U45A 2HNYA 4DTNA 3F2KA 3NFAA 1R0AA 2RN2A 1KAZA 1HQUA 1RBTA 2W41A 2E88A 1HUXA 4E89A 4JKAA 1XC3A 2HHUA 4CJSA 3MN9A 3CQYA 4BRLA 3EL2A 3HK2A 2D0OA 3TWHA 1X9MA 1A5WA 1EQYA 3IAYA 1GLFO 2WTUA 2Y1IA 2O4GA 3L2UA 4O8UA 2VYPA 2HHQA 3LDNA 3ID6A 3OYMA 1S1TA 3OYKA 3JS6A 3O5BA 1FJGK 2ATQA 4DV1K 1ATRA 5J2NA 4CHZA 4B08A 3A0IX 4DQSA 4FPAA 2PFUA 3E9LA 5CHIA 4XH1A 2YNIA 1YUWA 4DWIA 4DR7K 3CFPA 4B9UA 4C1NI 3L6QA 3CCJN 1ZBSA 3C6UA 4M3UA 3EZWA 2V7YA 1JL1A 4FOIA 4BQLA 4DB3A 4CJWA 3TI0A 1VQNN 3F9KA 4ID5A 3E1YA 3OS2A 3OYFA 4K42A 1JXBA 4LH4A 4NYNA 1T8EA 1XMQK 2PYJA 3DYAA 2V52B 3VF2A 2GELA 2QWNA 3SMSA 4W5TA 3ZSYA 3HM8A 2VG6A 3LP1A 4CEZA 3QMLA 3ATVA 1W0HA 2UU9K 3R3LA 2RPIA 3C95A 4JKEA 4YNQA 5EU7A 5J2PA 1RDAA 3VGMA 2G8WA 2JWLA 1BU6O 4KFBA 2GV9A 2RHKA 4LH5A 5SZTA 3OS1A 3HXMA 3SJJA 2UUCK 1HNXK 1BIZA 4IEEA 3P1GA 4CZLA 1OH8A 4J2DA 4NLBA 2NRHA 3H3OB 2FBYA 1DKGD 4CZJA 2Q2RA 1GOBA 4EZ6A 3SQ4A 4PKIA 5GINA 3TABA 4H5NA 4CJ5A 4CEEA 3GG4A 5F0XA 4DLGA 3O4NA 1XNRK 4FPBA 3ZX0A 2OTLN 3ZEUA 4E7KA 3KKRA 3L2RA 3AVBA 3QEPA 2A42A 4DQIA 4Z94A 4ICLA 1NOYA 2GUIA 4FJIA 4QCLA 2E8AA 3SPYA 4KAZA 3IDHA 1RT1A 5AQRA 1KAXA 4JAXA 4BROA 1IH7A 3BY5A 3PO5A 1G15A 4BREA 4WFAL 3VMFB 3VEWA 1A5XA 4BE0A 3AO1A 4NCGA 2BUPA 3D45A 4NO7A 2OPQA 4BE1A 3DJCA 5LL6Z 3FGUA 3CETA 1ATNA 1KCFA 3G71N 1K6YA 4H4OA 3FE1A 4CCHA 1TVRA 1N36K 3CC4N 4FWPA 1JKHA 5JMVA 3V9XA 2YJFA 3ULDA 3ZX2A 4BVOA 5FROA 3P31A 1J9AA 4KHWA 3DLHA 3WXJA 5GAEP 4WQ4A 2O8BA 5C15A 3KK3A 2FXUA 2EX3A 3VTHA 5AQQA 4WE1A 2KFNA 1XI1A 4Z4CA 1FK9A 1D9FA 1U2VA 4CZFA 2KFZA 3A5MC 2FF3B 4IDHA 1GOCA 3R8EA 4DV3K 2YX6A 2D0PA 3MXJA 1IV0A 4QS8A 5BPLA 3OW2M 3D2FB 4X62K 1RT6A 4FM2A 3U3GA 1R59O 3ENBA 3O9SA 1GLCG 2QWRA 2X6SA 1MWKA 3NH1A 2D0AA 4A2BA 4CGFA 3AVLA 3M8SA 2VWBA 1YF5L 4U67L 3KK2A 1W97L 4BRDA 4PL8A 1Q7YO 3P38A 1QZ5A 1U2VB 4CZEA 4CJEA 4DR4K 4M41A 4BRCA 3L2QA 3LDSA 3ZT2A 4FWQA 4JKFA 4K8ZA 1EO1A 1YI2N 3NE6A 1DEJA 4CFDA 3MDQA 3VEYA 4CJTA 3SCXA 3SLCA 3HT3A 4AQYK 3UKUA 3J7YP 3H46O 3ZSWA 1ZBUA 3CCMN 4Z4HA 4BDPA 1HNWK 5I42A 4XEIA 4AHTA 3O9TA 4IFEA 3M6GA 2GWKA 5J2QA 1VRTA 2DFHA 4KHSA 3A2FA 5AR0A 1HMVA 3VENA 4FCYA 2KTQA 1H1VA 4JKGB 4IFYA 1KAYA 1JJ2M 3CC7N 1GLLO 4JNEA 3DAWA 4AM7A 4ZHRA 1RBVA 1BI4A 4YY3K 3C7NA 4FJ9A 4HUEA 1NGFA 3V6DA 2X74A 2HHTA 1VQLN 3VQ5A 1VSLA 5AQGA 1WSFA 5JLHA 1LOTB 1IBMK 3AVKA 3LAKA 2ASOA 4FO0A 4I6MB 5AQOA 4BR4A 4L8RB 1J54A 4BQZA 4FLTA 5BRFA 4XIUA 3HJFA 1XC9A 3T7ZA 4H4MA 4WQ5A 4F9OA 3CQXA 2W42A 1OKJA 3VTIA 2ITMA 3PV8A 3KLIA 4CJLA 4DSJA 1QVFM 4FWSA 1WSGA 4CJFA 1Q18A 2NLXA 2NRXA 4KPYA 3NBPA 1S3XA 2KKZA 2Q0RA 3KIOA 1NK0A 2D0CA 3DI6A 4FJGA 1G99A 3LDQA 5HRRA 3IS9A 2G8HA 2CGJA 3SAGA 1SQKA 3BEXA 5E84A 1UOCA 3AO3A 4YOWA 2UUAK 3RRGA 1NJWA 3H45C 1IBLK 4OJRA 2Q0UA 3KLFA 4JK7A 3HPOA 2UXBK 5AFUH 2ZF5O 2G8KA 1EWQA 1RDCA 5HRNA 5GADP 4FLYA 4FXDA 5BRHA 4DCHA 2GTDA 3VEZA 5F1XA 4FZYA 2GX9A 1Y97A 1V4TA 4EAHD 4A5BA 1B92A 3I33A
chains in the Genus database with same CATH topology
3B6PA 2IC3A 4KHNA 2Q3SA 1JXEA 2P51A 5HRSA 1ASVA 2JLEA 3LPUA 1X9SA 4FJXA 3KKSA 4K8XA 1QTMA 3WNFA 4DMNA 1BQNA 4ZTFA 4DTSA 1IG9A 5DK5A 1S1XA 4OLAA 1LW0A 1C6VA 2E4LA 3NGIA 3SV4A 3T19A 1CZBA 1NOZA 1SUQA 4NYFA 4B8CA 1S1WA 4KI6A 2AJQA 4CIFA 5HRPA 3TAFA 1RILA 2IS3A 2ZQBA 3VQCA 3MEGA 4Z0UA 2IDOA 3SUPA 4DQPA 2P1JA 4DSFA 3AVMA 4FK0A 3MECA 1U47A 1TAUA 1DTQA 1QS4A 4DU1A 4C8NA 4CK2A 1TL3A 1Q8IA 3PO4A 2OZMA 4I9QA 2DY4A 4Q0BA 3DLGA 1DTTA 4M3ZA 3ZSZA 4NCBA 2OPSA 4KTWA 4IFVA 1XHXA 3IG1A 1KLNA 1VSFA 4EP4A 4Q5VA 3PX0A 5I3UA 5C42A 1YTUA 4CEFA 3WNHA 4IDKA 1BIUA 4M3RA 4FYDA 3G10A 5FDLA 3ZSOA 4UQGA 1S9GA 4M3YA 3VQDA 3ZSVA 3P5JA 4G1QA 3VQBA 4CF0A 4DTRA 2FBXA 4H8KA 2ITGA 4F3TA 4W5QA 3KD1E 3TAQA 3OYCA 2YHAA 4E0DA 4PY5A 1JL2A 2HHXA 4R5PA 4FM0A 1EETA 3OYGA 1KRPA 3SI6A 3VQ4A 2RF2A 2FBTA 3PUFA 2PZSA 1ITGA 3T3FA 3SQ0A 1Q9YA 2HW3A 5KRSA 4AH9A 4FJJA 5C25A 3SUQA 1UA0A 4Z4FA 4ELUA 5HP1A 2PY5A 3NH0A 4KB1A 1TKZA 5KI6A 3DLEA 1BGXT 3B6OA 4O5BA 4E7IA 3O3HA 1XWLA 3ISNC 1CZ9A 1Q9XA 3DOKA 2EHGA 3SUNA 1HYSA 1HNVA 3CFRA 1EXQA 3VQAA 4E7LA 4I2PA 3SZ2A 3SQ1A 3K5NA 2YHBA 1L5UA 3QIOA 1RT7A 1NJZA 1C0MA 5JS2A 2QKKA 4GVMA 3OY9A 3RMAA 1YTAA 2HNYA 4DF8A 1U45A 4DFKA 4DTNA 1HJRA 1X1PA 4I9LA 3NFAA 5HROA 1R0AA 2RN2A 1RBTA 1HQUA 3ALYA 4E89A 3HP6A 3O4QA 1UWBA 3SPZA 1QQCA 4CJSA 3RRHA 4B3OA 3CM6A 2HHUA 1C0TA 1WSHA 4HUGA 4DTXA 5KRTA 3THVA 3LP0A 1NK8A 3I0RA 3TWHA 1X9MA 1A5WA 3HK2A 4DS4A 4AHVA 4E3SA 4CEAA 4CERA 4BE2A 4DSKA 1WSEA 2YV0X 3IAYA 1C1BA 1S1VA 2Y1IA 3AVGA 4LSNA 2FC0A 2O4GA 1WAJA 4RW7A 4CF9A 3L2UA 4OKEA 3K5MA 3SV3A 2DFFA 4OLBA 1B9FA 1DLOA 3S3MA 2HHQA 3QEVA 3VQQA 4FJNA 1EKEA 4F3OA 3OYMA 4C8KA 1S1TA 3OYKA 3SUOA 3KLEA 1KLMA 2A1SA 2ATQA 5J2NA 2F96A 4CHZA 3QEXA 4B08A 4DSIA 1VK0A 3U3YA 3M8PA 4KHQA 4DQSA 3FFIA 4ID1A 3OJUA 1TKTA 2BANA 3CG7A 4IBNA 3VA3A 1X9WA 2OYQA 2F8SA 3CYMA 1U49A 2YNIA 4KREA 2FBVA 1QSLA 1IKXA 3L2VA 4DFJA 1O1WA 4DWIA 4CJPA 1RNHA 5CYQA 1SKRA 1NKBA 4B9NA 3CFPA 3BDPA 4B9UA 1TV6A 2G8FA 5CZ1A 1VSJA 4YFUA 3C6UA 3V9UA 1FKOA 4M3UA 1RTDA 3ZT3A 4HCCA 2O4IA 3OYLA 4CGJA 4B8AB 2YKNA 4J2BA 2XY8A 1IKYA 1VSHA 1JL1A 4OKJA 4Y1CA 1LWCA 2HVIA 3V1QA 3MEEA 4CJWA 1WLJA 4CK1A 1I39A 3TI0A 4F2RA 4CJ3A 2R7YA 4E7HA 3F9KA 3LPTA 4ID5A 5KGXA 3OS2A 3OYFA 3DMJA 1JXBA 4LH4A 4NYNA 3WNGA 4OPKA 3LAMA 1JLAA 1T8EA 2A1RA 4F2SA 4DQRA 3HYFA 3TAGA 1QSYA 2PYJA 4DLEA 1D5AA 4GMJB 3DYAA 3VQEA 4CGGA 1QSSA 3AVNA 3H08A 3M8QA 4FZXC 4AHUA 3HPGA 2G8VA 2E6LA 1UAXA 4W5TA 3ZSYA 1JLQA 2GBZA 3AA3A 2VG6A 3LP1A 4CEZA 3KLHA 3QEWA 4B9TA 1RBUA 1W0HA 3V81A 1TKDA 3ZSXA 5JS1A 1BL3A 2HVHA 1KVAA 2JGUA 3C6TA 2RPIA 3C95A 4CIGA 1QHTA 4RW9A 3AVJA 3L3VA 5EU7A 4YNQA 1J53A 1RDAA 3OYDA 2YKMA 4I7FA 5J2PA 2G8WA 4N41A 4FW1A 4KFBA 2ZE2A 2GV9A 3RMBA 4JRQA 1ZBLA 4LH5A 4KTQA 3AVCA 3U6FA 1ASUA 5SZTA 2P5OA 1RT3A 5FRNA 3OS1A 2KW4A 4M3XA 3HXMA 3SJJA 3VQ8A 1HRHA 4MFBA 4MQ3A 4FK4A 4CEOA 3MXMA 2BGGA 4CJ4A 4KKOA 1JLCA 1C1AA 2P5GA 1BIZA 2XHBA 3P1GA 1TK5A 3HP9A 3D0PA 1WN7A 4J2DA 2X78A 5HBMA 4M3TA 3I0SA 2VG7A 3OYEA 2QK9A 1TK0A 1RT4A 1VSDA 3DM2A 1F21A 4FLZA 2D5RA 4DFPA 2FBYA 4KHYA 3L3UA 2ZD1A 4Z4EA 4DTPA 4O0JA 3NCIA 4JLHA 1WNSA 1GOBA 5T7BA 2Z1HA 4JRPA 1LW2A 3TARA 4KV8A 4EZ6A 3SQ4A 4KI4A 5FRMA 1GOAA 5D3GA 3TABA 1BCMA 4CEEA 4CJ5A 1CXUA 4M42A 4DLGA 3O4NA 3OYAA 1W9HA 2Z1GA 2Y1JA 4OGEA 4CEDA 4PQUA 4E7KA 4FVMA 3KKRA 3L2RA 1NK6A 3AVBA 4FJ7A 3NGYA 3E01A 3JSMA 2B5JA 1IO2A 5CYMA 3QEPA 4KTZA 4DQIA 1ZBFA 5DMRA 4LY7A 4ICLA 1NOYA 2GUIA 5C24A 1JLFA 3T1AA 4AHRA 4FJIA 4QCLA 1BI4B 3AVHA 3SPYA 4KAZA 3KTQA 2VWKA 3S9HA 1N6QA 1RT1A 2OPPA 3P83D 4CGHA 4LSLA 2HHSA 1IH7A 3PO5A 1KTQA 2HNDA 1G15A 1WSJA 1J5OA 3K57A 4DU4A 4PUOA 4CJKA 1TL1A 2B4JA 1I3AA 2D0BA 1A5XA 3DRRA 3SYZA 3HSTB 4RG8A 4BE0A 1SV5A 1SKSA 1TK8A 3AO1A 4NCGA 3CM5A 1NKEA 3D45A 1SKWA 1BCOA 4IG0A 2OPQA 4FJ5A 4BE1A 4O0IA 3QESA 1QE1A 4O4GA 3I8DA 4CF1A 3AO4A 2I5JA 2RKIA 1KCFA 2ETJA 3G0ZA 1K6YA 4H4OA 1SL0A 1TVRA 4CCHA 4CJQA 2YNFA 3LALA 1RTHA 1C0UA 2G8IA 3AVIA 4RW6A 3SQ2A 1JKHA 3RTVA 1CLQA 4GW6A 1A5VA 1T03A 1RBRA 4AHCA 3TAMA 3JYTA 3VQ6A 5SWMA 3V1OA 1VSIA 3V9XA 1SL2A 3ULDA 2YNGA 4FJLA 1D8YA 4CJVA 5FROA 1REVA 4B9SA 1J9AA 4BDYA 1FKPA 4KHWA 3DLHA 1IKWA 1YT3A 2VWJA 4CF2A 3O3GA 4Z4IA 1NJYA 3KK3A 2XO7A 4HHTA 1NJXA 3IRXA 3ZCMA 3NF9A 1HYVA 2BE2A 2EX3A 5CY4A 4JS5A 3EZ5A 2OA8A 4DTMA 3DOLA 3MEDA 4OGCA 1RDBA 1CXQA 4DQQA 3ZT1A 4WE1A 3QETA 1KSPA 4N5SA 1XI1A 3QNOA 3DLBA 2KFNA 4Z4CA 3AA5X 1FK9A 1LAVA 3QINA 3M8RA 1D9FA 3NAEA 4FLVA 1BISA 4C8MA 4CFBA 2KFZA 1TAQA 4KHUA 1EP4A 3NF7A 1GOCA 1T7PA 3LZIA 4Y1DA 4LD0A 4IKFA 3MXIA 3DLKA 4FZZA 3HM9A 1ASWA 3EYZA 1S9EA 4FK2A 3MXJA 5CZ2A 3VQ7A 3K5LA 1D9DA 3ASMA 1VRUA 3K5OA 1L3SA 3HL8A 1RT6A 4FM2A 3CFOA 3DRSA 3U3GA 1ZBIA 3S3OA 3RMCA 2IAJA 3ITHA 4FLWA 3LP3A 4W5RA 4CGDA 4M3WA 4CFAA 2X6SA 3NH1A 2D0AA 2IGIA 4CGFA 3VA0A 3V9SA 1Z25A 3AVLA 4E7JA 3RR8A 1U48A 5KTQA 3M8SA 1BQMA 4FLUA 4CEQA 3OYHA 3L8BA 3V4IA 2YNHA 3KK2A 4AHSA 2E6MA 4O55A 1NK4A 1SL1A 1S6PA 1NKCA 1S6QA 4DSLA 2NUBA 4FJ8A 4RW8A 5J1EA 2PYLA 4N76A 4CJEA 3AA4A 3TAEA 1LAWA 3AO5A 2DFEA 4M41A 5KGWA 1RTIA 3L2QA 3LDSA 1LV5A 4I2QA 4O44A 1LWEA 3ZT2A 3UIQA 3AVFA 4CJUA 4ZTJA 4K8ZA 3K58A 3NE6A 4CFDA 1HNIA 3MAQA 4KB0A 4F4KA 2Z1JA 4C8LA 4ELTA 4CJTA 4E1NA 5J2MA 4CHOA 3AVAA 1HPZA 3ZT4A 2XY5A 4PWDA 3SCXA 3HO1A 2HHWA 3ZSQA 4CHNA 3QLHA 3LP2A 4OVLA 4RW4A 3TR8A 3ZT0A 3OJSA 2HB5A 3HT3A 3V9WA 4DFMA 3ZSWA 4TSXA 4CE9A 3QO9A 1ZBUA 4N47A 1JLBA 4Z4HA 3KLGA 4DTOA 4CEBA 4CHPA 4HVJA 3O3FA 4E1MA 4DTJA 3NF6A 4DU3A 1N5YA 4BDPA 3AA2A 5I42A 4AHTA 4J2EA 1WSIA 3DRPA 1NK7A 1L3VA 1RBSA 1S1UA 2XY7A 5J2QA 2KZZA 1VRTA 3KJVA 2DFHA 2WOMA 4IG3A 4CK3A 4DSEA 3S3NA 4EZ9A 4KHSA 3A2FA 3OYNA 3AO2A 3TANA 1VSMA 1HMVA 2KTQA 4FCYA 4IFYA 4DS5A 3ZSRA 3HVRA 2X6NA 2XRIA 1MU2A 4CESA 1ZYQA 4CECA 1RT2A 5K14A 3LWMA 1XHZA 4ZHRA 3AV9A 1RBVA 4HUFA 2QKBA 3OYBA 3NHGA 2OZSA 1BI4A 3K2PA 4BACA 3DLRA 4FJ9A 3OYIA 4HUEA 1RT5A 3V6DA 2X74A 2HHTA 1B9DA 1FXXA 1VSLA 3VQ5A 3CQ8A 4AILC 1WSFA 4E19A 2XY6A 4C8OA 4QAGA 3QNNA 2B6AA 4CFCA 1L3UA 3AVKA 3LAKA 2HNZA 4W5NA 3V9ZA 4ELVA 4J2AA 4BWJA 3PX6A 4BWMA 3F73A 1J54A 3VN5A 4FLTA 4CF8A 3L2WA 2BDPA 4L8RB 2Z1IA 4XIUA 3K59A 1TKXA 3EY1A 1KFSA 3HJFA 1XC9A 2WONA 3VQ9A 4KO0A 3V1RA 3WNEA 2QXFA 3NDKA 4H4MA 3KD5E 4DTUA 1RDDA 4HTUA 2W42A 1S5JA 1TGOA 4B9MA 3PV8A 3KLIA 4CJLA 2LSNA 3LZJA 4CGIA 4DF4A 1NK5A 4DSJA 1KVBA 4CIEA 1WSGA 3NH2A 4CJFA 3LWLA 3HPHA 3SNNA 3VQPA 4FLXA 3BGRA 4JS4A 4KPYA 4KRFA 1U4BA 1VSEA 3NBPA 4FW2A 1JLGA 3KIOA 3PY8A 2KZMA 3NF8A 1NK0A 4OPJA 2D0CA 3DI6A 4FJGA 3OVNA 3OS0A 4FM1A 1Z26A 3KK1A 5HLFA 4CHQA 3C94A 4OKKA 2G8UA 3LANA 4FJHA 1WAFA 5HRRA 3IS9A 2G8HA 4B9VA 1UOCA 2DTUA 3AO3A 1RCHA 1KVCA 1T05A 4B9LA 4DG1A 1YVUA 2KQ2A 1IKVA 3OYJA 4FJMA 3PX4A 3RRGA 1NJWA 1ZBHA 1KFDA 1HYZA 2HMIA 3NGZA 4EP5A 4OJRA 3KLFA 1UA1A 4NCAA 1BHLA 4M45A 4PA1A 4W5OA 2VG5A 3RWUA 4FJKA 3HPOA 3RMDA 1NK9A 2G8KA 1U04A 1RDCA 5HRNA 3QERA 1L3TA 4FLYA 4FXDA 4CJRA 4HCBA 1LWFA 4Z4GA 4QOZB 4F8RA 4BDZA 1RTJA 3QIPA 5E41A 1HQEA 1VSKA 2F8TA 4FZYA 3RR7A 2OPRA 2IOCA 3QEIA 2HHVA 1C1CA 1JLEA 4CHYA 1Y97A 3HVTA 4N56A 1B92A 3TAPA 1EX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6P A;  2IC3 A;  4KHN A;  2Q3S A;  1JXE A;  2P51 A;  5HRS A;  1ASV A;  2JLE A;  3LPU A;  1X9S A;  4FJX A;  3KKS A;  4K8X A;  1QTM A;  3WNF A;  4DMN A;  1BQN A;  4ZTF A;  4DTS A;  1IG9 A;  5DK5 A;  1S1X A;  4OLA A;  1LW0 A;  1C6V A;  2E4L A;  3NGI A;  3SV4 A;  3T19 A;  1CZB A;  1NOZ A;  1SUQ A;  4NYF A;  4B8C A;  1S1W A;  4KI6 A;  2AJQ A;  4CIF A;  5HRP A;  3TAF A;  1RIL A;  2IS3 A;  2ZQB A;  3VQC A;  3MEG A;  4Z0U A;  2IDO A;  3SUP A;  4DQP A;  2P1J A;  4DSF A;  3AVM A;  4FK0 A;  3MEC A;  1U47 A;  1TAU A;  1DTQ A;  1QS4 A;  4DU1 A;  4C8N A;  4CK2 A;  1TL3 A;  1Q8I A;  3PO4 A;  2OZM A;  4I9Q A;  2DY4 A;  4Q0B A;  3DLG A;  1DTT A;  4M3Z A;  3ZSZ A;  4NCB A;  2OPS A;  4KTW A;  4IFV A;  1XHX A;  3IG1 A;  1KLN A;  1VSF A;  4EP4 A;  4Q5V A;  3PX0 A;  5I3U A;  5C42 A;  1YTU A;  4CEF A;  3WNH A;  4IDK A;  1BIU A;  4M3R A;  4FYD A;  3G10 A;  5FDL A;  3ZSO A;  4UQG A;  1S9G A;  4M3Y A;  3VQD A;  3ZSV A;  3P5J A;  4G1Q A;  3VQB A;  4CF0 A;  4DTR A;  2FBX A;  4H8K A;  2ITG A;  4F3T A;  4W5Q A;  3KD1 E;  3TAQ A;  3OYC A;  2YHA A;  4E0D A;  4PY5 A;  1JL2 A;  2HHX A;  4R5P A;  4FM0 A;  1EET A;  3OYG A;  1KRP A;  3SI6 A;  3VQ4 A;  2RF2 A;  2FBT A;  3PUF A;  2PZS A;  1ITG A;  3T3F A;  3SQ0 A;  1Q9Y A;  2HW3 A;  5KRS A;  4AH9 A;  4FJJ A;  5C25 A;  3SUQ A;  1UA0 A;  4Z4F A;  4ELU A;  5HP1 A;  2PY5 A;  3NH0 A;  4KB1 A;  1TKZ A;  5KI6 A;  3DLE A;  1BGX T;  3B6O A;  4O5B A;  4E7I A;  3O3H A;  1XWL A;  3ISN C;  1CZ9 A;  1Q9X A;  3DOK A;  2EHG A;  3SUN A;  1HYS A;  1HNV A;  3CFR A;  1EXQ A;  3VQA A;  4E7L A;  4I2P A;  3SZ2 A;  3SQ1 A;  3K5N A;  2YHB A;  1L5U A;  3QIO A;  1RT7 A;  1NJZ A;  1C0M A;  5JS2 A;  2QKK A;  4GVM A;  3OY9 A;  3RMA A;  1YTA A;  2HNY A;  4DF8 A;  1U45 A;  4DFK A;  4DTN A;  1HJR A;  1X1P A;  4I9L A;  3NFA A;  5HRO A;  1R0A A;  2RN2 A;  1RBT A;  1HQU A;  3ALY A;  4E89 A;  3HP6 A;  3O4Q A;  1UWB A;  3SPZ A;  1QQC A;  4CJS A;  3RRH A;  4B3O A;  3CM6 A;  2HHU A;  1C0T A;  1WSH A;  4HUG A;  4DTX A;  5KRT A;  3THV A;  3LP0 A;  1NK8 A;  3I0R A;  3TWH A;  1X9M A;  1A5W A;  3HK2 A;  4DS4 A;  4AHV A;  4E3S A;  4CEA A;  4CER A;  4BE2 A;  4DSK A;  1WSE A;  2YV0 X;  3IAY A;  1C1B A;  1S1V A;  2Y1I A;  3AVG A;  4LSN A;  2FC0 A;  2O4G A;  1WAJ A;  4RW7 A;  4CF9 A;  3L2U A;  4OKE A;  3K5M A;  3SV3 A;  2DFF A;  4OLB A;  1B9F A;  1DLO A;  3S3M A;  2HHQ A;  3QEV A;  3VQQ A;  4FJN A;  1EKE A;  4F3O A;  3OYM A;  4C8K A;  1S1T A;  3OYK A;  3SUO A;  3KLE A;  1KLM A;  2A1S A;  2ATQ A;  5J2N A;  2F96 A;  4CHZ A;  3QEX A;  4B08 A;  4DSI A;  1VK0 A;  3U3Y A;  3M8P A;  4KHQ A;  4DQS A;  3FFI A;  4ID1 A;  3OJU A;  1TKT A;  2BAN A;  3CG7 A;  4IBN A;  3VA3 A;  1X9W A;  2OYQ A;  2F8S A;  3CYM A;  1U49 A;  2YNI A;  4KRE A;  2FBV A;  1QSL A;  1IKX A;  3L2V A;  4DFJ A;  1O1W A;  4DWI A;  4CJP A;  1RNH A;  5CYQ A;  1SKR A;  1NKB A;  4B9N A;  3CFP A;  3BDP A;  4B9U A;  1TV6 A;  2G8F A;  5CZ1 A;  1VSJ A;  4YFU A;  3C6U A;  3V9U A;  1FKO A;  4M3U A;  1RTD A;  3ZT3 A;  4HCC A;  2O4I A;  3OYL A;  4CGJ A;  4B8A B;  2YKN A;  4J2B A;  2XY8 A;  1IKY A;  1VSH A;  1JL1 A;  4OKJ A;  4Y1C A;  1LWC A;  2HVI A;  3V1Q A;  3MEE A;  4CJW A;  1WLJ A;  4CK1 A;  1I39 A;  3TI0 A;  4F2R A;  4CJ3 A;  2R7Y A;  4E7H A;  3F9K A;  3LPT A;  4ID5 A;  5KGX A;  3OS2 A;  3OYF A;  3DMJ A;  1JXB A;  4LH4 A;  4NYN A;  3WNG A;  4OPK A;  3LAM A;  1JLA A;  1T8E A;  2A1R A;  4F2S A;  4DQR A;  3HYF A;  3TAG A;  1QSY A;  2PYJ A;  4DLE A;  1D5A A;  4GMJ B;  3DYA A;  3VQE A;  4CGG A;  1QSS A;  3AVN A;  3H08 A;  3M8Q A;  4FZX C;  4AHU A;  3HPG A;  2G8V A;  2E6L A;  1UAX A;  4W5T A;  3ZSY A;  1JLQ A;  2GBZ A;  3AA3 A;  2VG6 A;  3LP1 A;  4CEZ A;  3KLH A;  3QEW A;  4B9T A;  1RBU A;  1W0H A;  3V81 A;  1TKD A;  3ZSX A;  5JS1 A;  1BL3 A;  2HVH A;  1KVA A;  2JGU A;  3C6T A;  2RPI A;  3C95 A;  4CIG A;  1QHT A;  4RW9 A;  3AVJ A;  3L3V A;  5EU7 A;  4YNQ A;  1J53 A;  1RDA A;  3OYD A;  2YKM A;  4I7F A;  5J2P A;  2G8W A;  4N41 A;  4FW1 A;  4KFB A;  2ZE2 A;  2GV9 A;  3RMB A;  4JRQ A;  1ZBL A;  4LH5 A;  4KTQ A;  3AVC A;  3U6F A;  1ASU A;  5SZT A;  2P5O A;  1RT3 A;  5FRN A;  3OS1 A;  2KW4 A;  4M3X A;  3HXM A;  3SJJ A;  3VQ8 A;  1HRH A;  4MFB A;  4MQ3 A;  4FK4 A;  4CEO A;  3MXM A;  2BGG A;  4CJ4 A;  4KKO A;  1JLC A;  1C1A A;  2P5G A;  1BIZ A;  2XHB A;  3P1G A;  1TK5 A;  3HP9 A;  3D0P A;  1WN7 A;  4J2D A;  2X78 A;  5HBM A;  4M3T A;  3I0S A;  2VG7 A;  3OYE A;  2QK9 A;  1TK0 A;  1RT4 A;  1VSD A;  3DM2 A;  1F21 A;  4FLZ A;  2D5R A;  4DFP A;  2FBY A;  4KHY A;  3L3U A;  2ZD1 A;  4Z4E A;  4DTP A;  4O0J A;  3NCI A;  4JLH A;  1WNS A;  1GOB A;  5T7B A;  2Z1H A;  4JRP A;  1LW2 A;  3TAR A;  4KV8 A;  4EZ6 A;  3SQ4 A;  4KI4 A;  5FRM A;  1GOA A;  5D3G A;  3TAB A;  1BCM A;  4CEE A;  4CJ5 A;  1CXU A;  4M42 A;  4DLG A;  3O4N A;  3OYA A;  1W9H A;  2Z1G A;  2Y1J A;  4OGE A;  4CED A;  4PQU A;  4E7K A;  4FVM A;  3KKR A;  3L2R A;  1NK6 A;  3AVB A;  4FJ7 A;  3NGY A;  3E01 A;  3JSM A;  2B5J A;  1IO2 A;  5CYM A;  3QEP A;  4KTZ A;  4DQI A;  1ZBF A;  5DMR A;  4LY7 A;  4ICL A;  1NOY A;  2GUI A;  5C24 A;  1JLF A;  3T1A A;  4AHR A;  4FJI A;  4QCL A;  1BI4 B;  3AVH A;  3SPY A;  4KAZ A;  3KTQ A;  2VWK A;  3S9H A;  1N6Q A;  1RT1 A;  2OPP A;  3P83 D;  4CGH A;  4LSL A;  2HHS A;  1IH7 A;  3PO5 A;  1KTQ A;  2HND A;  1G15 A;  1WSJ A;  1J5O A;  3K57 A;  4DU4 A;  4PUO A;  4CJK A;  1TL1 A;  2B4J A;  1I3A A;  2D0B A;  1A5X A;  3DRR A;  3SYZ A;  3HST B;  4RG8 A;  4BE0 A;  1SV5 A;  1SKS A;  1TK8 A;  3AO1 A;  4NCG A;  3CM5 A;  1NKE A;  3D45 A;  1SKW A;  1BCO A;  4IG0 A;  2OPQ A;  4FJ5 A;  4BE1 A;  4O0I A;  3QES A;  1QE1 A;  4O4G A;  3I8D A;  4CF1 A;  3AO4 A;  2I5J A;  2RKI A;  1KCF A;  2ETJ A;  3G0Z A;  1K6Y A;  4H4O A;  1SL0 A;  1TVR A;  4CCH A;  4CJQ A;  2YNF A;  3LAL A;  1RTH A;  1C0U A;  2G8I A;  3AVI A;  4RW6 A;  3SQ2 A;  1JKH A;  3RTV A;  1CLQ A;  4GW6 A;  1A5V A;  1T03 A;  1RBR A;  4AHC A;  3TAM A;  3JYT A;  3VQ6 A;  5SWM A;  3V1O A;  1VSI A;  3V9X A;  1SL2 A;  3ULD A;  2YNG A;  4FJL A;  1D8Y A;  4CJV A;  5FRO A;  1REV A;  4B9S A;  1J9A A;  4BDY A;  1FKP A;  4KHW A;  3DLH A;  1IKW A;  1YT3 A;  2VWJ A;  4CF2 A;  3O3G A;  4Z4I A;  1NJY A;  3KK3 A;  2XO7 A;  4HHT A;  1NJX A;  3IRX A;  3ZCM A;  3NF9 A;  1HYV A;  2BE2 A;  2EX3 A;  5CY4 A;  4JS5 A;  3EZ5 A;  2OA8 A;  4DTM A;  3DOL A;  3MED A;  4OGC A;  1RDB A;  1CXQ A;  4DQQ A;  3ZT1 A;  4WE1 A;  3QET A;  1KSP A;  4N5S A;  1XI1 A;  3QNO A;  3DLB A;  2KFN A;  4Z4C A;  3AA5 X;  1FK9 A;  1LAV A;  3QIN A;  3M8R A;  1D9F A;  3NAE A;  4FLV A;  1BIS A;  4C8M A;  4CFB A;  2KFZ A;  1TAQ A;  4KHU A;  1EP4 A;  3NF7 A;  1GOC A;  1T7P A;  3LZI A;  4Y1D A;  4LD0 A;  4IKF A;  3MXI A;  3DLK A;  4FZZ A;  3HM9 A;  1ASW A;  3EYZ A;  1S9E A;  4FK2 A;  3MXJ A;  5CZ2 A;  3VQ7 A;  3K5L A;  1D9D A;  3ASM A;  1VRU A;  3K5O A;  1L3S A;  3HL8 A;  1RT6 A;  4FM2 A;  3CFO A;  3DRS A;  3U3G A;  1ZBI A;  3S3O A;  3RMC A;  2IAJ A;  3ITH A;  4FLW A;  3LP3 A;  4W5R A;  4CGD A;  4M3W A;  4CFA A;  2X6S A;  3NH1 A;  2D0A A;  2IGI A;  4CGF A;  3VA0 A;  3V9S A;  1Z25 A;  3AVL A;  4E7J A;  3RR8 A;  1U48 A;  5KTQ A;  3M8S A;  1BQM A;  4FLU A;  4CEQ A;  3OYH A;  3L8B A;  3V4I A;  2YNH A;  3KK2 A;  4AHS A;  2E6M A;  4O55 A;  1NK4 A;  1SL1 A;  1S6P A;  1NKC A;  1S6Q A;  4DSL A;  2NUB A;  4FJ8 A;  4RW8 A;  5J1E A;  2PYL A;  4N76 A;  4CJE A;  3AA4 A;  3TAE A;  1LAW A;  3AO5 A;  2DFE A;  4M41 A;  5KGW A;  1RTI A;  3L2Q A;  3LDS A;  1LV5 A;  4I2Q A;  4O44 A;  1LWE A;  3ZT2 A;  3UIQ A;  3AVF A;  4CJU A;  4ZTJ A;  4K8Z A;  3K58 A;  3NE6 A;  4CFD A;  1HNI A;  3MAQ A;  4KB0 A;  4F4K A;  2Z1J A;  4C8L A;  4ELT A;  4CJT A;  4E1N A;  5J2M A;  4CHO A;  3AVA A;  1HPZ A;  3ZT4 A;  2XY5 A;  4PWD A;  3SCX A;  3HO1 A;  2HHW A;  3ZSQ A;  4CHN A;  3QLH A;  3LP2 A;  4OVL A;  4RW4 A;  3TR8 A;  3ZT0 A;  3OJS A;  2HB5 A;  3HT3 A;  3V9W A;  4DFM A;  3ZSW A;  4TSX A;  4CE9 A;  3QO9 A;  1ZBU A;  4N47 A;  1JLB A;  4Z4H A;  3KLG A;  4DTO A;  4CEB A;  4CHP A;  4HVJ A;  3O3F A;  4E1M A;  4DTJ A;  3NF6 A;  4DU3 A;  1N5Y A;  4BDP A;  3AA2 A;  5I42 A;  4AHT A;  4J2E A;  1WSI A;  3DRP A;  1NK7 A;  1L3V A;  1RBS A;  1S1U A;  2XY7 A;  5J2Q A;  2KZZ A;  1VRT A;  3KJV A;  2DFH A;  2WOM A;  4IG3 A;  4CK3 A;  4DSE A;  3S3N A;  4EZ9 A;  4KHS A;  3A2F A;  3OYN A;  3AO2 A;  3TAN A;  1VSM A;  1HMV A;  2KTQ A;  4FCY A;  4IFY A;  4DS5 A;  3ZSR A;  3HVR A;  2X6N A;  2XRI A;  1MU2 A;  4CES A;  1ZYQ A;  4CEC A;  1RT2 A;  5K14 A;  3LWM A;  1XHZ A;  4ZHR A;  3AV9 A;  1RBV A;  4HUF A;  2QKB A;  3OYB A;  3NHG A;  2OZS A;  1BI4 A;  3K2P A;  4BAC A;  3DLR A;  4FJ9 A;  3OYI A;  4HUE A;  1RT5 A;  3V6D A;  2X74 A;  2HHT A;  1B9D A;  1FXX A;  1VSL A;  3VQ5 A;  3CQ8 A;  4AIL C;  1WSF A;  4E19 A;  2XY6 A;  4C8O A;  4QAG A;  3QNN A;  2B6A A;  4CFC A;  1L3U A;  3AVK A;  3LAK A;  2HNZ A;  4W5N A;  3V9Z A;  4ELV A;  4J2A A;  4BWJ A;  3PX6 A;  4BWM A;  3F73 A;  1J54 A;  3VN5 A;  4FLT A;  4CF8 A;  3L2W A;  2BDP A;  4L8R B;  2Z1I A;  4XIU A;  3K59 A;  1TKX A;  3EY1 A;  1KFS A;  3HJF A;  1XC9 A;  2WON A;  3VQ9 A;  4KO0 A;  3V1R A;  3WNE A;  2QXF A;  3NDK A;  4H4M A;  3KD5 E;  4DTU A;  1RDD A;  4HTU A;  2W42 A;  1S5J A;  1TGO A;  4B9M A;  3PV8 A;  3KLI A;  4CJL A;  2LSN A;  3LZJ A;  4CGI A;  4DF4 A;  1NK5 A;  4DSJ A;  1KVB A;  4CIE A;  1WSG A;  3NH2 A;  4CJF A;  3LWL A;  3HPH A;  3SNN A;  3VQP A;  4FLX A;  3BGR A;  4JS4 A;  4KPY A;  4KRF A;  1U4B A;  1VSE A;  3NBP A;  4FW2 A;  1JLG A;  3KIO A;  3PY8 A;  2KZM A;  3NF8 A;  1NK0 A;  4OPJ A;  2D0C A;  3DI6 A;  4FJG A;  3OVN A;  3OS0 A;  4FM1 A;  1Z26 A;  3KK1 A;  5HLF A;  4CHQ A;  3C94 A;  4OKK A;  2G8U A;  3LAN A;  4FJH A;  1WAF A;  5HRR A;  3IS9 A;  2G8H A;  4B9V A;  1UOC A;  2DTU A;  3AO3 A;  1RCH A;  1KVC A;  1T05 A;  4B9L A;  4DG1 A;  1YVU A;  2KQ2 A;  1IKV A;  3OYJ A;  4FJM A;  3PX4 A;  3RRG A;  1NJW A;  1ZBH A;  1KFD A;  1HYZ A;  2HMI A;  3NGZ A;  4EP5 A;  4OJR A;  3KLF A;  1UA1 A;  4NCA A;  1BHL A;  4M45 A;  4PA1 A;  4W5O A;  2VG5 A;  3RWU A;  4FJK A;  3HPO A;  3RMD A;  1NK9 A;  2G8K A;  1U04 A;  1RDC A;  5HRN A;  3QER A;  1L3T A;  4FLY A;  4FXD A;  4CJR A;  4HCB A;  1LWF A;  4Z4G A;  4QOZ B;  4F8R A;  4BDZ A;  1RTJ A;  3QIP A;  5E41 A;  1HQE A;  1VSK A;  2F8T A;  4FZY A;  3RR7 A;  2OPR A;  2IOC A;  3QEI A;  2HHV A;  1C1C A;  1JLE A;  4CHY A;  1Y97 A;  3HVT A;  4N56 A;  1B92 A;  3TAP A;  1EX4 A; 
#chains in the Genus database with same CATH topology
 1ASV A;  3LDL A;  3LPU A;  3KKS A;  4DTS A;  1IG9 A;  5DK5 A;  1S1X A;  1HKC A;  5AQW A;  3SAH A;  3EKU A;  1C6V A;  3NGI A;  3B8A X;  2AJQ A;  1K9M O;  5HRP A;  4GY2 B;  3BP8 A;  4JI3 K;  3BZC A;  3MEG A;  4WFB L;  2IDO A;  3SUP A;  5C0Y A;  2P1J A;  4FK0 A;  4JHD A;  1TAU A;  4DU1 A;  3PO4 A;  1TL3 A;  2OZM A;  2DY4 A;  2HMP A;  4M3Z A;  1S22 A;  3PX0 A;  2D4W A;  5I3U A;  4BR7 A;  3CMA N;  4M3R A;  5AFU A;  3G10 A;  1S9G A;  3MX5 A;  3VQD A;  3IUC A;  4DTR A;  4IO9 L;  1HPM A;  4FM0 A;  2ZM6 K;  2OCE A;  3SI6 A;  3VQ4 A;  2RF2 A;  2FBT A;  3PUF A;  2PZS A;  3UB5 A;  3T3F A;  1X9J A;  3OBW A;  1UA0 A;  4KB1 A;  1TKZ A;  3B6O A;  4E7I A;  4M63 C;  1Q9X A;  3VGL A;  3TTF A;  1EXQ A;  3SQ1 A;  4I2P A;  3K5N A;  2YHB A;  1X3N A;  1Z05 A;  3MN7 A;  3U4L A;  4BG9 A;  1NU0 A;  4MDB A;  5HRO A;  3ALY A;  3O4Q A;  1UWB A;  4H5T A;  3RRH A;  4B3O A;  3HRG A;  3CM6 A;  4DR1 K;  1M1K O;  5LJV A;  4DTX A;  3THV A;  1CZA N;  3I0R A;  4CEA A;  4CER A;  1WSE A;  1S1V A;  2FC0 A;  1WAJ A;  4BRA A;  3K5M A;  2DFF A;  4FJN A;  1T6C A;  2E1Y A;  3KLE A;  2KLA A;  1C0G A;  1YHQ N;  3C0B A;  2UXC K;  4BC4 A;  3OA9 A;  1BA0 A;  3OJU A;  2BAN A;  3VA3 A;  3CER A;  1IKX A;  1O1W A;  3CJA A;  3J7Z O;  3SK3 A;  2G8F A;  1IBK K;  1VSJ A;  4CD3 A;  2O4I A;  1X3M A;  3MWP A;  4CGJ A;  2YKN A;  4JN4 A;  1IKY A;  1VSH A;  4OKJ A;  4Y1C A;  3IFR A;  3D2E B;  1XMO K;  3ID8 A;  3V1Q A;  3K0S A;  4CVN E;  1I39 A;  3CME N;  3LPT A;  4NLC A;  3DMJ A;  2NRV A;  3WNG A;  1DGK N;  4DQR A;  3VQE A;  1T6D A;  1NBW A;  4CGG A;  4RTF D;  4HWI A;  3M8Q A;  4AHU A;  1UAX A;  2VGM A;  2GBZ A;  4R79 A;  3WT0 A;  1MA9 B;  3QEW A;  4B9T A;  4JI8 K;  2Q1N A;  4CIG A;  3ULE B;  2D1K A;  4BC3 A;  4B3R K;  3AAR A;  2YKM A;  4I7F A;  5AQX A;  1N32 K;  3U6F A;  1ASU A;  5FRN A;  2P5O A;  2KW4 A;  4MFB A;  4MQ3 A;  4CEO A;  3MXM A;  2BGG A;  4KKO A;  2P5G A;  1TK5 A;  3HP9 A;  4LF9 K;  3C6A A;  4M3T A;  1TK0 A;  2A3Z A;  3DM2 A;  3WQT A;  4Z4E A;  2VQE K;  4YOU A;  4WFN L;  2HHW A;  4KI4 A;  5M1O A;  2Z1H A;  3TAR A;  3MWT A;  5FRM A;  3JXU A;  5M1N A;  3E9O A;  1GOA A;  5D3G A;  3DXM B;  4BC2 A;  4M42 A;  5EY4 A;  5BPN A;  1BG3 A;  4CED A;  4CZM A;  1K8A O;  3NGY A;  3E01 A;  2B5J A;  4KTZ A;  1ZBF A;  3CJC A;  1JLF A;  1BI4 B;  3PSF A;  4BRM A;  5AQS A;  1N6Q A;  2OPP A;  4LSL A;  1KTQ A;  2HND A;  1WSJ A;  3D2F A;  4G9Z A;  3FZH A;  4PUO A;  4YDU A;  2B4J A;  2D0B A;  3SYZ A;  3HST B;  1TK8 A;  3CM5 A;  1NKE A;  4IG0 A;  3D2E A;  4YOR A;  1SAZ A;  3QES A;  1QE1 A;  3ZYY X;  3I8D A;  3AO4 A;  4FOE A;  2ETJ A;  3G0Z A;  4BR0 A;  1Y64 A;  1SL0 A;  4CJQ A;  2YNF A;  3LAL A;  1RTH A;  2G8I A;  1BA1 A;  2AA4 A;  5BPM A;  3RTV A;  4GW6 A;  1T03 A;  3JYT A;  5SWM A;  3V1O A;  4WQ5 C;  2VGN A;  5LMU K;  2BH1 A;  1E4G T;  4CW7 B;  4BDY A;  3A5L C;  2P9U B;  4JKD A;  3J81 O;  3O3G A;  3TTC A;  4JD2 B;  5AZI B;  1V4S A;  4CZH A;  3QFU A;  4IJN A;  2BE2 A;  2F9T A;  5CY4 A;  3VET A;  3MED A;  4IJA A;  3QET A;  1KSP A;  4N5S A;  3QNO A;  2O8F B;  3AA5 X;  4O8K A;  3WXL A;  2BTF A;  1BIS A;  4C8M A;  1TAQ A;  2ASM A;  3J7A P;  3NF7 A;  5FPD A;  4DUY K;  1BUP A;  1GLD G;  1MWM A;  3HM9 A;  3EYZ A;  4FK2 A;  3M3Z A;  2P9L A;  3HSC A;  4BR9 A;  3K5L A;  5FPE A;  1QZ6 A;  2E2O A;  3K5O A;  1ZBI A;  3CFO A;  3DRS A;  5JLF A;  3OHR A;  3ITH A;  4W5R A;  4CGD A;  1GLJ O;  4JKH A;  3CCV N;  1U48 A;  4BG8 A;  5AQI A;  1BQM A;  3OYH A;  3DWL A;  3ZLJ A;  1GLE G;  3C7N B;  2WFB A;  5H1S Q;  4JK9 A;  1KQS M;  1SL1 A;  1S6P A;  4FJ8 A;  3AY9 A;  3AA4 A;  2HOE A;  2DFE A;  1RTI A;  1S72 N;  1ZC6 A;  4O44 A;  4ZTJ A;  2QWM A;  4JEP A;  4KB0 A;  4C8L A;  4E1N A;  4CHO A;  3AVA A;  3ZT4 A;  2HBM A;  4PWD A;  3ZSQ A;  1J5O A;  3QLH A;  3LP2 A;  3TR8 A;  3V9W A;  1TUU A;  1OVQ A;  5C12 A;  4CE9 A;  3QO9 A;  5AQU A;  1NGC A;  4B1W B;  4IZ9 A;  5FLX O;  3KLG A;  5KPT A;  4NXN K;  4DTJ A;  3AA2 A;  1OVY A;  4J2E A;  4EHU A;  3DRP A;  3L4I A;  1YIJ N;  3H1Q A;  2WOM A;  4CK3 A;  4DSE A;  4EZ9 A;  4JI7 K;  4DS5 A;  3UKR A;  1BWF O;  4LFC K;  4ISE A;  1YJ9 N;  2XRI A;  1J5E K;  1XHZ A;  3K2P A;  1NM1 A;  4DKW A;  3THW A;  4BAC A;  2HBK A;  3OYI A;  1RT5 A;  3DXM A;  4AIL C;  4C8O A;  3E9P A;  1WUA A;  4QAG A;  3W3D A;  4CFC A;  4PL7 A;  2HNZ A;  5ADX A;  3KVG A;  4CF8 A;  3L2W A;  2BDP A;  1KFS A;  3VQ9 A;  3KD5 E;  2NRT A;  3NDK A;  4DTU A;  1RDD A;  3O9U A;  4B1Z A;  3VEX A;  3EKS A;  4GVE A;  1WB9 A;  3A5N C;  3LZJ A;  1Z6R A;  1RDW X;  4DR2 K;  3NH2 A;  3LWL A;  3VQP A;  4DR3 K;  4X64 K;  3BGR A;  4FW2 A;  3NF8 A;  5KQ8 A;  1Z26 A;  4AF1 A;  1YAG A;  5HLF A;  2F4V K;  3CD6 N;  3O9Q A;  3DLL L;  2DTU A;  2E20 A;  4DG1 A;  4H03 B;  5M1P A;  4FJM A;  1ZBH A;  2FF6 A;  1HYZ A;  2HMI A;  3PLA A;  3TPQ A;  1BHL A;  4PA1 A;  4W5O A;  2VG5 A;  3RWU A;  1HNZ K;  3CJ1 A;  1U04 A;  3ZX3 A;  1L3T A;  3O08 A;  5JIC A;  1SZ2 A;  5AQZ A;  3ZET B;  4QOZ B;  5E41 A;  1VSK A;  2F8T A;  3CJB A;  2OPR A;  3THY B;  3QEI A;  3TAP A;  1EX4 A;  3B6P A;  1JXE A;  4CI6 A;  1X9S A;  3TSU A;  3WNF A;  4DMN A;  4ZTF A;  1EWR A;  4U7B A;  3MN6 A;  4EFH A;  3SV4 A;  4OPH A;  1CZB A;  1NOZ A;  1SUQ A;  5M1K A;  4KH5 A;  4B8C A;  1S1W A;  3CF5 L;  1FW6 A;  1RIL A;  4B1Y B;  4DQP A;  2H3G X;  4DV0 K;  3CCQ N;  3HTV A;  4C8N A;  4CK2 A;  3C65 A;  4Q0B A;  4GNI A;  4KHP K;  3HZ6 A;  2E2P A;  3QBX A;  1MDU B;  4KTW A;  1KLN A;  3IG1 A;  4FWR A;  4EP4 A;  1HJO A;  5C42 A;  3ZSO A;  2CH5 A;  4H8K A;  3TAQ A;  3OYC A;  4PY5 A;  3FLC O;  4A57 A;  3H3N O;  4R5P A;  1HR0 K;  4ISG A;  1EET A;  2ZJP L;  4FWM A;  4O5F A;  3SUQ A;  2F9W A;  3SJH A;  3DLE A;  4B1X B;  4O5B A;  3GOI A;  1XWL A;  1CZ9 A;  3FR0 A;  4M7X A;  3SUN A;  2EHG A;  2FSJ A;  1P90 A;  4BRI A;  1HNV A;  3CFR A;  5KPR A;  1GLA G;  3SZ2 A;  4JV5 K;  2F7T A;  1RT7 A;  1C0M A;  3CCE N;  4GVM A;  4X66 K;  1QQO A;  1YTA A;  4DF8 A;  4DFK A;  3J8A A;  2P9P A;  4CBX A;  3HP6 A;  2O8C B;  3L4Q A;  1QQC A;  3S41 A;  1C0T A;  1WSH A;  3LP0 A;  4DSK A;  4CBU A;  3G6E N;  2YV0 X;  2V51 B;  1C1B A;  3AVG A;  4LSN A;  4CF9 A;  3SV3 A;  4OKE A;  3WQU A;  1B9F A;  1DLO A;  3S3M A;  3VQQ A;  3U8X A;  4GV9 A;  4F3O A;  5EXW A;  4C8K A;  4YOX A;  4KBO A;  3SUO A;  1KLM A;  3M5R A;  1HX1 A;  2P9I B;  4GKJ K;  4DSI A;  1VK0 A;  3U3Y A;  3BF3 A;  3M8P A;  3O1B A;  1YJW N;  3FFI A;  4ID1 A;  1X9W A;  3CG7 A;  4IBN A;  2F8S A;  3CYM A;  1U49 A;  4LF6 K;  2FBV A;  3T1H K;  4DFJ A;  4CJP A;  5CYQ A;  1NKB A;  2IVO A;  2P9K A;  5CZ1 A;  4YFU A;  3V9U A;  3ZT3 A;  3DXK A;  1HLU A;  3OYL A;  4B8A B;  4J2B A;  2XY8 A;  3GL1 A;  3CCL N;  2HVI A;  3MCP A;  3IMX A;  3MEE A;  1N34 K;  1WLJ A;  5AQV A;  3AAP A;  2IVP A;  5KGX A;  3CCS N;  1I94 K;  2O8E B;  3VPZ A;  1VQ6 N;  3CJ9 A;  3CIP A;  3K9J A;  3A5O C;  2QTD A;  5ADX H;  3AVN A;  1NNE A;  2G8V A;  2E6L A;  5GAH P;  4H0Y B;  3V81 A;  3ENH A;  3ZSX A;  1KVA A;  2JGU A;  3C6T A;  4BRK A;  4OO1 J;  1QHT A;  4RW9 A;  3AVJ A;  3L3V A;  4OLB A;  3OYD A;  3SBG A;  4V19 S;  4N41 A;  2ZGZ A;  4FW1 A;  1ZBL A;  3D7E O;  3AVC A;  3OBY A;  3FZK A;  3VQ8 A;  1JLC A;  5B8H A;  2XHB A;  4H0T B;  3D0P A;  2P9S A;  5HBM A;  2QK9 A;  2VG7 A;  3OYE A;  1VSD A;  1F21 A;  3RVC A;  4DFP A;  4KHY A;  3L3U A;  2ZD1 A;  3TSQ A;  4DTP A;  3NCI A;  1TUY A;  5AZJ B;  4JLH A;  1WNS A;  5T7B A;  1LW2 A;  2I7N A;  4C1N K;  2Q36 A;  3AGK A;  1YJN N;  1BCM A;  2QWO A;  3HBT A;  3OYA A;  1W9H A;  2Z1G A;  1VQP N;  4OGE A;  4PQU A;  3CI5 A;  4FVM A;  3JAM O;  4JI5 K;  3JSM A;  4FSV A;  4H0V B;  5C24 A;  3T1A A;  2GWJ A;  1JCE A;  3KTQ A;  2VWK A;  3QBW A;  3VES A;  3S9H A;  3P83 D;  4CGH A;  4BRN A;  4K43 A;  2HHS A;  2VQF K;  2O8B B;  3KWG A;  1NGI A;  1E3M A;  4DU4 A;  4CJK A;  1TL1 A;  2UYT A;  2HF4 A;  2NRR A;  4JI4 K;  1SKW A;  1BCO A;  5E26 A;  4BRF A;  1Q86 O;  4O0I A;  4O4G A;  1M90 O;  3AVI A;  4RW6 A;  3SQ2 A;  4JD2 A;  5AZI A;  2ZGY A;  3SAF A;  5M1F A;  5AQM A;  1P8Z A;  3TAM A;  1SL2 A;  2WBN A;  2YNG A;  4CJV A;  1REV A;  1W2B M;  1FKP A;  4GV6 A;  3WXM B;  4DV2 K;  1YT3 A;  2VWJ A;  4LF4 K;  2EWS A;  1NJY A;  3WEE A;  4K25 A;  1NJX A;  3NF9 A;  1SS6 A;  4JS5 A;  2OA8 A;  4DTM A;  1RDB A;  1CXQ A;  4DQQ A;  3ZT1 A;  3A8Y A;  4CFB A;  2VCP A;  4KHU A;  1EP4 A;  4CD1 A;  3F5T A;  3IKM A;  3I55 N;  3LZI A;  1WOQ A;  4Y1D A;  4LD0 A;  3U9Z A;  4EHT A;  4IKF A;  3MXI A;  3DLK A;  3QIC A;  1ASW A;  1S9E A;  3Q7B A;  3W0L A;  1D9D A;  3ASM A;  1K8K A;  3HL8 A;  3UKR B;  3R1X A;  2IAJ A;  4FLW A;  3LP3 A;  4M3W A;  4CFA A;  3VA0 A;  3WXK A;  4E7J A;  3RR8 A;  4FLU A;  4CEQ A;  3L8B A;  3WXI A;  4AHS A;  1NK4 A;  4O55 A;  3DXK B;  1NKC A;  1ILY A;  2E5L K;  1S6Q A;  4DSL A;  4K0K K;  2NUB A;  5J1E A;  3TAE A;  3AO5 A;  4ILH A;  5KGW A;  1LV5 A;  2OAN A;  1LWE A;  3AVF A;  4MDA A;  3U9D A;  1DT9 A;  1ESV A;  4F4K A;  2Z1J A;  4ELT A;  2AP1 A;  4ISF A;  2XY5 A;  4OVL A;  4RW4 A;  4FWL A;  4DFM A;  4IWV A;  4TSX A;  2W6K A;  1JCG A;  4CEB A;  3O3F A;  2PAV A;  1N5Y A;  3N4P A;  3QB0 A;  4A2A A;  3LM2 A;  1WSI A;  2E2N A;  1OH7 A;  1RBS A;  2NZT A;  3LDO A;  2KZZ A;  4IG3 A;  3PSI A;  3AO2 A;  3TAN A;  5BR9 A;  1NGB A;  3ZSR A;  4BRQ A;  1MU2 A;  4IOX A;  4BVP A;  4CES A;  1ZYQ A;  4CEC A;  1RT2 A;  5K14 A;  3LWM A;  5C10 A;  2IVN A;  5CR4 A;  3AV9 A;  4HUF A;  5TKY A;  3OYB A;  2OZS A;  2KHO A;  5GIP A;  3DLR A;  4DV7 K;  4PKG A;  3CQ8 A;  4IOC L;  3KWI A;  4E19 A;  2XY6 A;  3QNN A;  2B6A A;  1ATS A;  2P9N B;  5TKW A;  3O9R A;  1L3U A;  4CZK A;  4W5N A;  1HKB A;  5FPN A;  4BWJ A;  3EO3 A;  4BWM A;  3VN5 A;  1KC8 O;  1VQ8 N;  4QS7 A;  1D4X A;  3WNE A;  3V1R A;  4HTU A;  1BO5 O;  4B9M A;  1TGO A;  1NMN A;  3MX2 A;  1NK5 A;  2LSN A;  4CGI A;  4DF4 A;  1KVB A;  4CIE A;  3Q7C A;  5AQJ A;  4KH6 A;  3O80 A;  3SNN A;  3HPH A;  1RDU A;  2HF3 A;  1U4B A;  1JLG A;  2KZM A;  1Q82 O;  4J8F A;  3OS0 A;  3GE1 A;  4CHQ A;  3C94 A;  3LAN A;  1Q81 O;  4FJH A;  1WAF A;  5MLC Q;  4JKC A;  2GUP A;  1RCH A;  1KVC A;  3ENO A;  4BRH A;  4B9L A;  4AM6 A;  3TU5 A;  3VF4 A;  1YVU A;  2KQ2 A;  1IKV A;  3OYJ A;  4BR2 A;  2QA4 N;  4H0X B;  1NG9 A;  3THY A;  3ULE A;  4EP5 A;  1UA1 A;  5M1Q A;  4M45 A;  4FJK A;  4CJ7 A;  3T1Y K;  4MLH A;  2IIR A;  4ILJ A;  3OTO K;  1IG8 A;  3QER A;  4CJR A;  1LWF A;  4Z4G A;  1RTJ A;  3NMU A;  3NVM A;  1HQE A;  5C2D A;  3RR7 A;  1JLE A;  4CJ3 A;  4KV8 A;  3HVT A;  1WBB A;  4JK8 A;  2IC3 A;  2YHX A;  4KHN A;  2P51 A;  4FJX A;  1XQS C;  2O8E A;  1BQN A;  1LW0 A;  1T44 A;  3MMV A;  5IT9 O;  1IJJ A;  3FFK B;  2ASP A;  2HHH K;  4NYF A;  4B1U B;  4KI6 A;  2P9L B;  3KHY A;  2ZQB A;  4MO5 A;  4FL9 A;  3AVM A;  1NMD A;  1QS4 A;  1VAZ A;  1HKG A;  1Q8I A;  1VQ9 N;  3DLG A;  1DTT A;  3J80 O;  3ZSZ A;  2OPS A;  4IFV A;  1XHX A;  1VQK N;  4L3Q A;  4QS9 A;  3RSE B;  4Q5V A;  4NB4 A;  2ZJQ L;  1RFQ A;  1YTU A;  4CEF A;  3WNH A;  1BIU A;  4UQG A;  3VQB A;  1VQ4 N;  4F3T A;  2ITG A;  4W5Q A;  3KD1 E;  4FVU A;  2YHA A;  1YIT N;  1KRP A;  4WCE L;  4JI6 K;  1Q9Y A;  2O8D A;  2JWK A;  5KRS A;  1LCU A;  4AH9 A;  4FJJ A;  5C25 A;  1N33 K;  4Z4F A;  5HP1 A;  4MO4 A;  2QEX N;  4LFB K;  1BGX T;  3O3H A;  3I56 N;  1HYS A;  1L5U A;  3QIO A;  1YVN A;  5HOO A;  1NJZ A;  3OY9 A;  3VEO A;  1JCF A;  1HJR A;  1X1P A;  2UXD K;  4B3S K;  4I9L A;  4JKB A;  2QI2 A;  3SPZ A;  4HUG A;  5KRT A;  1NK8 A;  3MCA B;  4WYB A;  4DS4 A;  4AHV A;  4E3S A;  3FZF A;  4BE2 A;  4RW7 A;  2ZWH A;  5JVH L;  3QEV A;  5LMN K;  1EKE A;  2V7Z A;  4KH4 A;  3THW B;  3QDK A;  2A1S A;  4PKH A;  2F96 A;  3GBT A;  3QEX A;  2YI1 A;  4KHQ A;  1TKT A;  2OYQ A;  2NRZ A;  4DV5 K;  4I6M A;  2PBD A;  1BDG A;  4KRE A;  1QSL A;  3L2V A;  1RNH A;  1SKR A;  1KXP A;  4B9N A;  5CE3 A;  3LM9 A;  3BDP A;  1TV6 A;  1FKO A;  1RTD A;  4HCC A;  4YOT A;  3ATU A;  3CPE A;  4PHT X;  4IEI A;  4IXC A;  4JI0 K;  1LWC A;  3EN9 A;  4YHH K;  5AQY A;  4CZI A;  5LJW A;  4CK1 A;  1N8R O;  5HL7 L;  4F2R A;  2R7Y A;  5JVG L;  4E7H A;  1XNQ K;  4OPK A;  3LAM A;  1JLA A;  5EOY A;  2QXL A;  2A1R A;  4F2S A;  3TAG A;  3HYF A;  1QSY A;  4DLE A;  1D5A A;  4GMJ B;  3QFP A;  3D6R A;  5EVZ A;  1QSS A;  2A40 A;  2HBL A;  3H08 A;  2P9I A;  4FZX C;  1VQM N;  3HPG A;  2A41 A;  3MN5 A;  1JLQ A;  4A61 A;  3AA3 A;  3KLH A;  3CCR N;  1E4F T;  1RBU A;  1TKD A;  5JS1 A;  1BL3 A;  2HVH A;  1KD1 O;  5GIO A;  1J53 A;  2QW9 A;  2ZE2 A;  3RMB A;  4JRQ A;  4KTQ A;  1RT3 A;  4M3X A;  4FK4 A;  3VEV A;  1HRH A;  4CJ4 A;  1C1A A;  3L0Q A;  1WN7 A;  4BY9 C;  2X78 A;  3I0S A;  5IWA K;  1RT4 A;  3TSP A;  3CHW A;  4DUZ K;  4FLZ A;  2D5R A;  3GDQ A;  3CC2 N;  4O0J A;  2CGL A;  4JRP A;  3SBT A;  3M1F A;  2YHW A;  4B3T K;  2A6A A;  3WUH A;  1QHA A;  1CXU A;  5BR8 K;  2Y1J A;  3EE9 A;  1K73 O;  3HOS A;  1NK6 A;  1WBD A;  2W40 A;  4FJ7 A;  5CYM A;  1IO2 A;  5DMR A;  4LY7 A;  5ELZ A;  4AHR A;  4EIA A;  3AVH A;  4H5V A;  5AQK A;  4B3M K;  3NVK A;  1NGA A;  1VQ5 N;  3VF6 A;  3K57 A;  4X65 K;  3RSE A;  1I3A A;  3DRR A;  3EE8 A;  4RG8 A;  2P9N A;  4Y0W A;  1SV5 A;  1SKS A;  4DQ8 A;  4FJ5 A;  5AQL A;  4CF1 A;  2I5J A;  2RKI A;  4FWN A;  2GEM A;  1C0U A;  2O8D B;  2QWQ A;  2YCH A;  1CLQ A;  1A5V A;  1RBR A;  4AHC A;  1NGH A;  2FSN A;  3VQ6 A;  1VSI A;  3CXC M;  4WQ4 C;  3THX B;  4FJL A;  1D8Y A;  4B9S A;  1NJI O;  1ZXO A;  4CBW A;  1IKW A;  4Z4I A;  4CF2 A;  2XO7 A;  5LY3 A;  4HHT A;  3IRX A;  3ZCM A;  1HYV A;  1NGJ A;  1VQ7 N;  3EZ5 A;  3DOL A;  4OGC A;  4HTL A;  4JI1 K;  4LF8 K;  3ZET A;  1LAV A;  3QIN A;  3M8R A;  4B9Q A;  2E1Z A;  3NAE A;  2WC9 A;  4XH4 A;  4FLV A;  4C23 A;  2J4R A;  3ZEU B;  5F2R A;  1TYQ B;  1T7P A;  3WEE B;  4FZZ A;  4BRG A;  4IOA L;  2P9K B;  2CGK A;  5CZ2 A;  3VQ7 A;  5GAG P;  1VRU A;  3CPW M;  1L3S A;  4LC9 B;  2P9P B;  4A62 A;  4RCH A;  4JKG A;  3PIO L;  4M7Y A;  3FZM A;  3RMC A;  3S3O A;  2P9U A;  4GKK K;  2I7P A;  3V9S A;  2IGI A;  3I8B A;  2QM1 A;  5AQP A;  5BRD A;  1Z25 A;  5KTQ A;  1OH5 A;  5KQD A;  3AAQ A;  3V4I A;  2YNH A;  3CJ7 A;  5KPZ A;  2E6M A;  3P39 A;  2HBJ A;  3T69 A;  1J6Z A;  4RW8 A;  2DPN A;  2PYL A;  4N76 A;  4H0P A;  1LAW A;  3UKU B;  4JYA K;  4A59 A;  2Q31 A;  4I2Q A;  3UIQ A;  4CJU A;  2W6L A;  4JI2 K;  3PIP L;  3K58 A;  1HNI A;  3MAQ A;  4RWT A;  5J2M A;  1HPZ A;  3HO1 A;  4CHN A;  3ZT0 A;  1W7A A;  3OJS A;  2HB5 A;  4K41 A;  2ZJR L;  4N47 A;  1JLB A;  4DTO A;  4CHP A;  4HVJ A;  4E1M A;  3NF6 A;  1NWK A;  4DU3 A;  1NGE A;  1O13 A;  4H5W A;  2QWL A;  4OPA A;  5AZJ A;  4DHY A;  1NK7 A;  1L3V A;  1S1U A;  2XY7 A;  3KJV A;  4BR5 A;  1VHX A;  3S3N A;  3BZK A;  5AQN A;  3TTD A;  5C2F A;  3OYN A;  4YOV A;  4B1V A;  1QVG M;  4LF7 K;  1VSM A;  2A5X A;  1T3V A;  3R6M A;  5I9E B;  3HVR A;  1NGD A;  4H5R A;  2X6N A;  4LFA K;  2OTJ N;  4BGB A;  4FWK A;  4WF9 L;  3O6W A;  1VQO N;  3FZL A;  3LDP A;  2QKB A;  3NHG A;  2HST A;  2YHY A;  3G25 A;  2UUB K;  5AJ3 K;  1B9D A;  1FXX A;  1QQM A;  3P4I A;  4E1J A;  4ILG B;  3G4S N;  3VER A;  3V9Z A;  4ELV A;  2E2Q A;  1RGI A;  4XH5 A;  4BC5 A;  4J2A A;  4IO8 A;  3PX6 A;  4NCB A;  3F73 A;  4CZG A;  2Z1I A;  3K59 A;  1TKX A;  2P9S B;  3EY1 A;  3KK7 A;  4DR5 K;  4H0O A;  2WON A;  4DV6 K;  4KO0 A;  2QXF A;  4FWO A;  1S5J A;  3CCU N;  3F9M A;  3C6H A;  3SMP A;  2WUS A;  4JHD B;  3UE5 A;  4FLX A;  3KZB A;  4JS4 A;  4KRF A;  3HOT A;  1VSE A;  3AGR A;  1U6Z A;  3PY8 A;  4OPJ A;  3OVN A;  4FM1 A;  4DR6 K;  3KK1 A;  2G8U A;  1K8K B;  4OKK A;  5A2Q O;  4B9V A;  2NRW A;  3THX A;  1T05 A;  3K9K A;  5AQH A;  3PX4 A;  1TYQ A;  1KFD A;  2YJE A;  3E66 A;  3NGZ A;  4NCA A;  3RMD A;  1NK9 A;  4UY8 O;  3BF1 A;  4BGA A;  3O1W A;  4BRP A;  4HCB A;  2O8F A;  4F8R A;  4BDZ A;  3QIP A;  5BN8 A;  4A5A A;  2IOC A;  2HHV A;  4NXM K;  1C1C A;  2RE2 A;  4CHY A;  4N56 A;  3DLB A;  2Q3S A;  1GLB G;  5HRS A;  1BOT O;  2JLE A;  2FLO A;  3O4W A;  3H1V X;  4K8X A;  1QTM A;  5FPM A;  2NNW A;  3VGK A;  2Q97 A;  4OLA A;  5EX5 A;  3VOV A;  5BRE A;  2E4L A;  3T19 A;  5AQT A;  4GV3 A;  4MLE A;  1NGG A;  4CIF A;  3TAF A;  2IS3 A;  3VQC A;  2CH6 A;  3H6E A;  1XUP O;  4Z0U A;  5BN9 A;  4DSF A;  3MEC A;  3MK6 A;  5DM6 L;  1U47 A;  1DTQ A;  1NLV A;  4I9Q A;  3LL3 A;  1QQN A;  2FSK A;  1VSF A;  2QWP A;  3HI0 A;  4YOY A;  2O8C A;  4IDK A;  4FYD A;  5FDL A;  4M3Y A;  3ZSV A;  3P5J A;  4G1Q A;  4CF0 A;  2FBX A;  1YXQ A;  4E0D A;  4OX9 K;  2HHX A;  1JL2 A;  1C0F A;  3OYG A;  3BUZ B;  1ITG A;  3SQ0 A;  3N4Q A;  5AQF A;  2HW3 A;  4DV4 K;  5DM7 L;  4ELU A;  2PY5 A;  3NH0 A;  5KI6 A;  3O8M A;  3ISN C;  4LF5 K;  1OH6 A;  3EEQ A;  3DOK A;  4YDU C;  3R9P A;  3VQA A;  4E7L A;  5JS2 A;  2QKK A;  3RMA A;  1U45 A;  2HNY A;  4DTN A;  3F2K A;  3NFA A;  1R0A A;  2RN2 A;  1KAZ A;  1HQU A;  1RBT A;  2W41 A;  2E88 A;  1HUX A;  4E89 A;  4JKA A;  1XC3 A;  2HHU A;  4CJS A;  3MN9 A;  3CQY A;  4BRL A;  3EL2 A;  3HK2 A;  2D0O A;  3TWH A;  1X9M A;  1A5W A;  1EQY A;  3IAY A;  1GLF O;  2WTU A;  2Y1I A;  2O4G A;  3L2U A;  4O8U A;  2VYP A;  2HHQ A;  3LDN A;  3ID6 A;  3OYM A;  1S1T A;  3OYK A;  3JS6 A;  3O5B A;  1FJG K;  2ATQ A;  4DV1 K;  1ATR A;  5J2N A;  4CHZ A;  4B08 A;  3A0I X;  4DQS A;  4FPA A;  2PFU A;  3E9L A;  5CHI A;  4XH1 A;  2YNI A;  1YUW A;  4DWI A;  4DR7 K;  3CFP A;  4B9U A;  4C1N I;  3L6Q A;  3CCJ N;  1ZBS A;  3C6U A;  4M3U A;  3EZW A;  2V7Y A;  1JL1 A;  4FOI A;  4BQL A;  4DB3 A;  4CJW A;  3TI0 A;  1VQN N;  3F9K A;  4ID5 A;  3E1Y A;  3OS2 A;  3OYF A;  4K42 A;  1JXB A;  4LH4 A;  4NYN A;  1T8E A;  1XMQ K;  2PYJ A;  3DYA A;  2V52 B;  3VF2 A;  2GEL A;  2QWN A;  3SMS A;  4W5T A;  3ZSY A;  3HM8 A;  2VG6 A;  3LP1 A;  4CEZ A;  3QML A;  3ATV A;  1W0H A;  2UU9 K;  3R3L A;  2RPI A;  3C95 A;  4JKE A;  4YNQ A;  5EU7 A;  5J2P A;  1RDA A;  3VGM A;  2G8W A;  2JWL A;  1BU6 O;  4KFB A;  2GV9 A;  2RHK A;  4LH5 A;  5SZT A;  3OS1 A;  3HXM A;  3SJJ A;  2UUC K;  1HNX K;  1BIZ A;  4IEE A;  3P1G A;  4CZL A;  1OH8 A;  4J2D A;  4NLB A;  2NRH A;  3H3O B;  2FBY A;  1DKG D;  4CZJ A;  2Q2R A;  1GOB A;  4EZ6 A;  3SQ4 A;  4PKI A;  5GIN A;  3TAB A;  4H5N A;  4CJ5 A;  4CEE A;  3GG4 A;  5F0X A;  4DLG A;  3O4N A;  1XNR K;  4FPB A;  3ZX0 A;  2OTL N;  3ZEU A;  4E7K A;  3KKR A;  3L2R A;  3AVB A;  3QEP A;  2A42 A;  4DQI A;  4Z94 A;  4ICL A;  1NOY A;  2GUI A;  4FJI A;  4QCL A;  2E8A A;  3SPY A;  4KAZ A;  3IDH A;  1RT1 A;  5AQR A;  1KAX A;  4JAX A;  4BRO A;  1IH7 A;  3BY5 A;  3PO5 A;  1G15 A;  4BRE A;  4WFA L;  3VMF B;  3VEW A;  1A5X A;  4BE0 A;  3AO1 A;  4NCG A;  2BUP A;  3D45 A;  4NO7 A;  2OPQ A;  4BE1 A;  3DJC A;  5LL6 Z;  3FGU A;  3CET A;  1ATN A;  1KCF A;  3G71 N;  1K6Y A;  4H4O A;  3FE1 A;  4CCH A;  1TVR A;  1N36 K;  3CC4 N;  4FWP A;  1JKH A;  5JMV A;  3V9X A;  2YJF A;  3ULD A;  3ZX2 A;  4BVO A;  5FRO A;  3P31 A;  1J9A A;  4KHW A;  3DLH A;  3WXJ A;  5GAE P;  4WQ4 A;  2O8B A;  5C15 A;  3KK3 A;  2FXU A;  2EX3 A;  3VTH A;  5AQQ A;  4WE1 A;  2KFN A;  1XI1 A;  4Z4C A;  1FK9 A;  1D9F A;  1U2V A;  4CZF A;  2KFZ A;  3A5M C;  2FF3 B;  4IDH A;  1GOC A;  3R8E A;  4DV3 K;  2YX6 A;  2D0P A;  3MXJ A;  1IV0 A;  4QS8 A;  5BPL A;  3OW2 M;  3D2F B;  4X62 K;  1RT6 A;  4FM2 A;  3U3G A;  1R59 O;  3ENB A;  3O9S A;  1GLC G;  2QWR A;  2X6S A;  1MWK A;  3NH1 A;  2D0A A;  4A2B A;  4CGF A;  3AVL A;  3M8S A;  2VWB A;  1YF5 L;  4U67 L;  3KK2 A;  1W97 L;  4BRD A;  4PL8 A;  1Q7Y O;  3P38 A;  1QZ5 A;  1U2V B;  4CZE A;  4CJE A;  4DR4 K;  4M41 A;  4BRC A;  3L2Q A;  3LDS A;  3ZT2 A;  4FWQ A;  4JKF A;  4K8Z A;  1EO1 A;  1YI2 N;  3NE6 A;  1DEJ A;  4CFD A;  3MDQ A;  3VEY A;  4CJT A;  3SCX A;  3SLC A;  3HT3 A;  4AQY K;  3UKU A;  3J7Y P;  3H46 O;  3ZSW A;  1ZBU A;  3CCM N;  4Z4H A;  4BDP A;  1HNW K;  5I42 A;  4XEI A;  4AHT A;  3O9T A;  4IFE A;  3M6G A;  2GWK A;  5J2Q A;  1VRT A;  2DFH A;  4KHS A;  3A2F A;  5AR0 A;  1HMV A;  3VEN A;  4FCY A;  2KTQ A;  1H1V A;  4JKG B;  4IFY A;  1KAY A;  1JJ2 M;  3CC7 N;  1GLL O;  4JNE A;  3DAW A;  4AM7 A;  4ZHR A;  1RBV A;  1BI4 A;  4YY3 K;  3C7N A;  4FJ9 A;  4HUE A;  1NGF A;  3V6D A;  2X74 A;  2HHT A;  1VQL N;  3VQ5 A;  1VSL A;  5AQG A;  1WSF A;  5JLH A;  1LOT B;  1IBM K;  3AVK A;  3LAK A;  2ASO A;  4FO0 A;  4I6M B;  5AQO A;  4BR4 A;  4L8R B;  1J54 A;  4BQZ A;  4FLT A;  5BRF A;  4XIU A;  3HJF A;  1XC9 A;  3T7Z A;  4H4M A;  4WQ5 A;  4F9O A;  3CQX A;  2W42 A;  1OKJ A;  3VTI A;  2ITM A;  3PV8 A;  3KLI A;  4CJL A;  4DSJ A;  1QVF M;  4FWS A;  1WSG A;  4CJF A;  1Q18 A;  2NLX A;  2NRX A;  4KPY A;  3NBP A;  1S3X A;  2KKZ A;  2Q0R A;  3KIO A;  1NK0 A;  2D0C A;  3DI6 A;  4FJG A;  1G99 A;  3LDQ A;  5HRR A;  3IS9 A;  2G8H A;  2CGJ A;  3SAG A;  1SQK A;  3BEX A;  5E84 A;  1UOC A;  3AO3 A;  4YOW A;  2UUA K;  3RRG A;  1NJW A;  3H45 C;  1IBL K;  4OJR A;  2Q0U A;  3KLF A;  4JK7 A;  3HPO A;  2UXB K;  5AFU H;  2ZF5 O;  2G8K A;  1EWQ A;  1RDC A;  5HRN A;  5GAD P;  4FLY A;  4FXD A;  5BRH A;  4DCH A;  2GTD A;  3VEZ A;  5F1X A;  4FZY A;  2GX9 A;  1Y97 A;  1V4T A;  4EAH D;  4A5B A;  1B92 A;  3I33 A; 
#chains in the Genus database with same CATH homology
 3B6P A;  2IC3 A;  4KHN A;  2Q3S A;  1JXE A;  2P51 A;  5HRS A;  1ASV A;  2JLE A;  3LPU A;  1X9S A;  4FJX A;  3KKS A;  4K8X A;  1QTM A;  3WNF A;  4DMN A;  1BQN A;  4ZTF A;  4DTS A;  1IG9 A;  5DK5 A;  1S1X A;  4OLA A;  1LW0 A;  1C6V A;  2E4L A;  3NGI A;  3SV4 A;  3T19 A;  1CZB A;  1NOZ A;  1SUQ A;  4NYF A;  4B8C A;  1S1W A;  4KI6 A;  2AJQ A;  4CIF A;  5HRP A;  3TAF A;  1RIL A;  2IS3 A;  2ZQB A;  3VQC A;  3MEG A;  4Z0U A;  2IDO A;  3SUP A;  4DQP A;  2P1J A;  4DSF A;  3AVM A;  4FK0 A;  3MEC A;  1U47 A;  1TAU A;  1DTQ A;  1QS4 A;  4DU1 A;  4C8N A;  4CK2 A;  1TL3 A;  1Q8I A;  3PO4 A;  2OZM A;  4I9Q A;  2DY4 A;  4Q0B A;  3DLG A;  1DTT A;  4M3Z A;  3ZSZ A;  4NCB A;  2OPS A;  4KTW A;  4IFV A;  1XHX A;  3IG1 A;  1KLN A;  1VSF A;  4EP4 A;  4Q5V A;  3PX0 A;  5I3U A;  5C42 A;  1YTU A;  4CEF A;  3WNH A;  4IDK A;  1BIU A;  4M3R A;  4FYD A;  3G10 A;  5FDL A;  3ZSO A;  4UQG A;  1S9G A;  4M3Y A;  3VQD A;  3ZSV A;  3P5J A;  4G1Q A;  3VQB A;  4CF0 A;  4DTR A;  2FBX A;  4H8K A;  2ITG A;  4F3T A;  4W5Q A;  3KD1 E;  3TAQ A;  3OYC A;  2YHA A;  4E0D A;  4PY5 A;  1JL2 A;  2HHX A;  4R5P A;  4FM0 A;  1EET A;  3OYG A;  1KRP A;  3SI6 A;  3VQ4 A;  2RF2 A;  2FBT A;  3PUF A;  2PZS A;  1ITG A;  3T3F A;  3SQ0 A;  1Q9Y A;  2HW3 A;  5KRS A;  4AH9 A;  4FJJ A;  5C25 A;  3SUQ A;  1UA0 A;  4Z4F A;  4ELU A;  5HP1 A;  2PY5 A;  3NH0 A;  4KB1 A;  1TKZ A;  5KI6 A;  3DLE A;  1BGX T;  3B6O A;  4O5B A;  4E7I A;  3O3H A;  1XWL A;  3ISN C;  1CZ9 A;  1Q9X A;  3DOK A;  2EHG A;  3SUN A;  1HYS A;  1HNV A;  3CFR A;  1EXQ A;  3VQA A;  4E7L A;  4I2P A;  3SZ2 A;  3SQ1 A;  3K5N A;  2YHB A;  1L5U A;  3QIO A;  1RT7 A;  1NJZ A;  1C0M A;  5JS2 A;  2QKK A;  4GVM A;  3OY9 A;  3RMA A;  1YTA A;  2HNY A;  4DF8 A;  1U45 A;  4DFK A;  4DTN A;  1HJR A;  1X1P A;  4I9L A;  3NFA A;  5HRO A;  1R0A A;  2RN2 A;  1RBT A;  1HQU A;  3ALY A;  4E89 A;  3HP6 A;  3O4Q A;  1UWB A;  3SPZ A;  1QQC A;  4CJS A;  3RRH A;  4B3O A;  3CM6 A;  2HHU A;  1C0T A;  1WSH A;  4HUG A;  4DTX A;  5KRT A;  3THV A;  3LP0 A;  1NK8 A;  3I0R A;  3TWH A;  1X9M A;  1A5W A;  3HK2 A;  4DS4 A;  4AHV A;  4E3S A;  4CEA A;  4CER A;  4BE2 A;  4DSK A;  1WSE A;  2YV0 X;  3IAY A;  1C1B A;  1S1V A;  2Y1I A;  3AVG A;  4LSN A;  2FC0 A;  2O4G A;  1WAJ A;  4RW7 A;  4CF9 A;  3L2U A;  4OKE A;  3K5M A;  3SV3 A;  2DFF A;  4OLB A;  1B9F A;  1DLO A;  3S3M A;  2HHQ A;  3QEV A;  3VQQ A;  4FJN A;  1EKE A;  4F3O A;  3OYM A;  4C8K A;  1S1T A;  3OYK A;  3SUO A;  3KLE A;  1KLM A;  2A1S A;  2ATQ A;  5J2N A;  2F96 A;  4CHZ A;  3QEX A;  4B08 A;  4DSI A;  1VK0 A;  3U3Y A;  3M8P A;  4KHQ A;  4DQS A;  3FFI A;  4ID1 A;  3OJU A;  1TKT A;  2BAN A;  3CG7 A;  4IBN A;  3VA3 A;  1X9W A;  2OYQ A;  2F8S A;  3CYM A;  1U49 A;  2YNI A;  4KRE A;  2FBV A;  1QSL A;  1IKX A;  3L2V A;  4DFJ A;  1O1W A;  4DWI A;  4CJP A;  1RNH A;  5CYQ A;  1SKR A;  1NKB A;  4B9N A;  3CFP A;  3BDP A;  4B9U A;  1TV6 A;  2G8F A;  5CZ1 A;  1VSJ A;  4YFU A;  3C6U A;  3V9U A;  1FKO A;  4M3U A;  1RTD A;  3ZT3 A;  4HCC A;  2O4I A;  3OYL A;  4CGJ A;  4B8A B;  2YKN A;  4J2B A;  2XY8 A;  1IKY A;  1VSH A;  1JL1 A;  4OKJ A;  4Y1C A;  1LWC A;  2HVI A;  3V1Q A;  3MEE A;  4CJW A;  1WLJ A;  4CK1 A;  1I39 A;  3TI0 A;  4F2R A;  4CJ3 A;  2R7Y A;  4E7H A;  3F9K A;  3LPT A;  4ID5 A;  5KGX A;  3OS2 A;  3OYF A;  3DMJ A;  1JXB A;  4LH4 A;  4NYN A;  3WNG A;  4OPK A;  3LAM A;  1JLA A;  1T8E A;  2A1R A;  4F2S A;  4DQR A;  3HYF A;  3TAG A;  1QSY A;  2PYJ A;  4DLE A;  1D5A A;  4GMJ B;  3DYA A;  3VQE A;  4CGG A;  1QSS A;  3AVN A;  3H08 A;  3M8Q A;  4FZX C;  4AHU A;  3HPG A;  2G8V A;  2E6L A;  1UAX A;  4W5T A;  3ZSY A;  1JLQ A;  2GBZ A;  3AA3 A;  2VG6 A;  3LP1 A;  4CEZ A;  3KLH A;  3QEW A;  4B9T A;  1RBU A;  1W0H A;  3V81 A;  1TKD A;  3ZSX A;  5JS1 A;  1BL3 A;  2HVH A;  1KVA A;  2JGU A;  3C6T A;  2RPI A;  3C95 A;  4CIG A;  1QHT A;  4RW9 A;  3AVJ A;  3L3V A;  5EU7 A;  4YNQ A;  1J53 A;  1RDA A;  3OYD A;  2YKM A;  4I7F A;  5J2P A;  2G8W A;  4N41 A;  4FW1 A;  4KFB A;  2ZE2 A;  2GV9 A;  3RMB A;  4JRQ A;  1ZBL A;  4LH5 A;  4KTQ A;  3AVC A;  3U6F A;  1ASU A;  5SZT A;  2P5O A;  1RT3 A;  5FRN A;  3OS1 A;  2KW4 A;  4M3X A;  3HXM A;  3SJJ A;  3VQ8 A;  1HRH A;  4MFB A;  4MQ3 A;  4FK4 A;  4CEO A;  3MXM A;  2BGG A;  4CJ4 A;  4KKO A;  1JLC A;  1C1A A;  2P5G A;  1BIZ A;  2XHB A;  3P1G A;  1TK5 A;  3HP9 A;  3D0P A;  1WN7 A;  4J2D A;  2X78 A;  5HBM A;  4M3T A;  3I0S A;  2VG7 A;  3OYE A;  2QK9 A;  1TK0 A;  1RT4 A;  1VSD A;  3DM2 A;  1F21 A;  4FLZ A;  2D5R A;  4DFP A;  2FBY A;  4KHY A;  3L3U A;  2ZD1 A;  4Z4E A;  4DTP A;  4O0J A;  3NCI A;  4JLH A;  1WNS A;  1GOB A;  5T7B A;  2Z1H A;  4JRP A;  1LW2 A;  3TAR A;  4KV8 A;  4EZ6 A;  3SQ4 A;  4KI4 A;  5FRM A;  1GOA A;  5D3G A;  3TAB A;  1BCM A;  4CEE A;  4CJ5 A;  1CXU A;  4M42 A;  4DLG A;  3O4N A;  3OYA A;  1W9H A;  2Z1G A;  2Y1J A;  4OGE A;  4CED A;  4PQU A;  4E7K A;  4FVM A;  3KKR A;  3L2R A;  1NK6 A;  3AVB A;  4FJ7 A;  3NGY A;  3E01 A;  3JSM A;  2B5J A;  1IO2 A;  5CYM A;  3QEP A;  4KTZ A;  4DQI A;  1ZBF A;  5DMR A;  4LY7 A;  4ICL A;  1NOY A;  2GUI A;  5C24 A;  1JLF A;  3T1A A;  4AHR A;  4FJI A;  4QCL A;  1BI4 B;  3AVH A;  3SPY A;  4KAZ A;  3KTQ A;  2VWK A;  3S9H A;  1N6Q A;  1RT1 A;  2OPP A;  3P83 D;  4CGH A;  4LSL A;  2HHS A;  1IH7 A;  3PO5 A;  1KTQ A;  2HND A;  1G15 A;  1WSJ A;  1J5O A;  3K57 A;  4DU4 A;  4PUO A;  4CJK A;  1TL1 A;  2B4J A;  1I3A A;  2D0B A;  1A5X A;  3DRR A;  3SYZ A;  3HST B;  4RG8 A;  4BE0 A;  1SV5 A;  1SKS A;  1TK8 A;  3AO1 A;  4NCG A;  3CM5 A;  1NKE A;  3D45 A;  1SKW A;  1BCO A;  4IG0 A;  2OPQ A;  4FJ5 A;  4BE1 A;  4O0I A;  3QES A;  1QE1 A;  4O4G A;  3I8D A;  4CF1 A;  3AO4 A;  2I5J A;  2RKI A;  1KCF A;  2ETJ A;  3G0Z A;  1K6Y A;  4H4O A;  1SL0 A;  1TVR A;  4CCH A;  4CJQ A;  2YNF A;  3LAL A;  1RTH A;  1C0U A;  2G8I A;  3AVI A;  4RW6 A;  3SQ2 A;  1JKH A;  3RTV A;  1CLQ A;  4GW6 A;  1A5V A;  1T03 A;  1RBR A;  4AHC A;  3TAM A;  3JYT A;  3VQ6 A;  5SWM A;  3V1O A;  1VSI A;  3V9X A;  1SL2 A;  3ULD A;  2YNG A;  4FJL A;  1D8Y A;  4CJV A;  5FRO A;  1REV A;  4B9S A;  1J9A A;  4BDY A;  1FKP A;  4KHW A;  3DLH A;  1IKW A;  1YT3 A;  2VWJ A;  4CF2 A;  3O3G A;  4Z4I A;  1NJY A;  3KK3 A;  2XO7 A;  4HHT A;  1NJX A;  3IRX A;  3ZCM A;  3NF9 A;  1HYV A;  2BE2 A;  2EX3 A;  5CY4 A;  4JS5 A;  3EZ5 A;  2OA8 A;  4DTM A;  3DOL A;  3MED A;  4OGC A;  1RDB A;  1CXQ A;  4DQQ A;  3ZT1 A;  4WE1 A;  3QET A;  1KSP A;  4N5S A;  1XI1 A;  3QNO A;  3DLB A;  2KFN A;  4Z4C A;  3AA5 X;  1FK9 A;  1LAV A;  3QIN A;  3M8R A;  1D9F A;  3NAE A;  4FLV A;  1BIS A;  4C8M A;  4CFB A;  2KFZ A;  1TAQ A;  4KHU A;  1EP4 A;  3NF7 A;  1GOC A;  1T7P A;  3LZI A;  4Y1D A;  4LD0 A;  4IKF A;  3MXI A;  3DLK A;  4FZZ A;  3HM9 A;  1ASW A;  3EYZ A;  1S9E A;  4FK2 A;  3MXJ A;  5CZ2 A;  3VQ7 A;  3K5L A;  1D9D A;  3ASM A;  1VRU A;  3K5O A;  1L3S A;  3HL8 A;  1RT6 A;  4FM2 A;  3CFO A;  3DRS A;  3U3G A;  1ZBI A;  3S3O A;  3RMC A;  2IAJ A;  3ITH A;  4FLW A;  3LP3 A;  4W5R A;  4CGD A;  4M3W A;  4CFA A;  2X6S A;  3NH1 A;  2D0A A;  2IGI A;  4CGF A;  3VA0 A;  3V9S A;  1Z25 A;  3AVL A;  4E7J A;  3RR8 A;  1U48 A;  5KTQ A;  3M8S A;  1BQM A;  4FLU A;  4CEQ A;  3OYH A;  3L8B A;  3V4I A;  2YNH A;  3KK2 A;  4AHS A;  2E6M A;  4O55 A;  1NK4 A;  1SL1 A;  1S6P A;  1NKC A;  1S6Q A;  4DSL A;  2NUB A;  4FJ8 A;  4RW8 A;  5J1E A;  2PYL A;  4N76 A;  4CJE A;  3AA4 A;  3TAE A;  1LAW A;  3AO5 A;  2DFE A;  4M41 A;  5KGW A;  1RTI A;  3L2Q A;  3LDS A;  1LV5 A;  4I2Q A;  4O44 A;  1LWE A;  3ZT2 A;  3UIQ A;  3AVF A;  4CJU A;  4ZTJ A;  4K8Z A;  3K58 A;  3NE6 A;  4CFD A;  1HNI A;  3MAQ A;  4KB0 A;  4F4K A;  2Z1J A;  4C8L A;  4ELT A;  4CJT A;  4E1N A;  5J2M A;  4CHO A;  3AVA A;  1HPZ A;  3ZT4 A;  2XY5 A;  4PWD A;  3SCX A;  3HO1 A;  2HHW A;  3ZSQ A;  4CHN A;  3QLH A;  3LP2 A;  4OVL A;  4RW4 A;  3TR8 A;  3ZT0 A;  3OJS A;  2HB5 A;  3HT3 A;  3V9W A;  4DFM A;  3ZSW A;  4TSX A;  4CE9 A;  3QO9 A;  1ZBU A;  4N47 A;  1JLB A;  4Z4H A;  3KLG A;  4DTO A;  4CEB A;  4CHP A;  4HVJ A;  3O3F A;  4E1M A;  4DTJ A;  3NF6 A;  4DU3 A;  1N5Y A;  4BDP A;  3AA2 A;  5I42 A;  4AHT A;  4J2E A;  1WSI A;  3DRP A;  1NK7 A;  1L3V A;  1RBS A;  1S1U A;  2XY7 A;  5J2Q A;  2KZZ A;  1VRT A;  3KJV A;  2DFH A;  2WOM A;  4IG3 A;  4CK3 A;  4DSE A;  3S3N A;  4EZ9 A;  4KHS A;  3A2F A;  3OYN A;  3AO2 A;  3TAN A;  1VSM A;  1HMV A;  2KTQ A;  4FCY A;  4IFY A;  4DS5 A;  3ZSR A;  3HVR A;  2X6N A;  2XRI A;  1MU2 A;  4CES A;  1ZYQ A;  4CEC A;  1RT2 A;  5K14 A;  3LWM A;  1XHZ A;  4ZHR A;  3AV9 A;  1RBV A;  4HUF A;  2QKB A;  3OYB A;  3NHG A;  2OZS A;  1BI4 A;  3K2P A;  4BAC A;  3DLR A;  4FJ9 A;  3OYI A;  4HUE A;  1RT5 A;  3V6D A;  2X74 A;  2HHT A;  1B9D A;  1FXX A;  1VSL A;  3VQ5 A;  3CQ8 A;  4AIL C;  1WSF A;  4E19 A;  2XY6 A;  4C8O A;  4QAG A;  3QNN A;  2B6A A;  4CFC A;  1L3U A;  3AVK A;  3LAK A;  2HNZ A;  4W5N A;  3V9Z A;  4ELV A;  4J2A A;  4BWJ A;  3PX6 A;  4BWM A;  3F73 A;  1J54 A;  3VN5 A;  4FLT A;  4CF8 A;  3L2W A;  2BDP A;  4L8R B;  2Z1I A;  4XIU A;  3K59 A;  1TKX A;  3EY1 A;  1KFS A;  3HJF A;  1XC9 A;  2WON A;  3VQ9 A;  4KO0 A;  3V1R A;  3WNE A;  2QXF A;  3NDK A;  4H4M A;  3KD5 E;  4DTU A;  1RDD A;  4HTU A;  2W42 A;  1S5J A;  1TGO A;  4B9M A;  3PV8 A;  3KLI A;  4CJL A;  2LSN A;  3LZJ A;  4CGI A;  4DF4 A;  1NK5 A;  4DSJ A;  1KVB A;  4CIE A;  1WSG A;  3NH2 A;  4CJF A;  3LWL A;  3HPH A;  3SNN A;  3VQP A;  4FLX A;  3BGR A;  4JS4 A;  4KPY A;  4KRF A;  1U4B A;  1VSE A;  3NBP A;  4FW2 A;  1JLG A;  3KIO A;  3PY8 A;  2KZM A;  3NF8 A;  1NK0 A;  4OPJ A;  2D0C A;  3DI6 A;  4FJG A;  3OVN A;  3OS0 A;  4FM1 A;  1Z26 A;  3KK1 A;  5HLF A;  4CHQ A;  3C94 A;  4OKK A;  2G8U A;  3LAN A;  4FJH A;  1WAF A;  5HRR A;  3IS9 A;  2G8H A;  4B9V A;  1UOC A;  2DTU A;  3AO3 A;  1RCH A;  1KVC A;  1T05 A;  4B9L A;  4DG1 A;  1YVU A;  2KQ2 A;  1IKV A;  3OYJ A;  4FJM A;  3PX4 A;  3RRG A;  1NJW A;  1ZBH A;  1KFD A;  1HYZ A;  2HMI A;  3NGZ A;  4EP5 A;  4OJR A;  3KLF A;  1UA1 A;  4NCA A;  1BHL A;  4M45 A;  4PA1 A;  4W5O A;  2VG5 A;  3RWU A;  4FJK A;  3HPO A;  3RMD A;  1NK9 A;  2G8K A;  1U04 A;  1RDC A;  5HRN A;  3QER A;  1L3T A;  4FLY A;  4FXD A;  4CJR A;  4HCB A;  1LWF A;  4Z4G A;  4QOZ B;  4F8R A;  4BDZ A;  1RTJ A;  3QIP A;  5E41 A;  1HQE A;  1VSK A;  2F8T A;  4FZY A;  3RR7 A;  2OPR A;  2IOC A;  3QEI A;  2HHV A;  1C1C A;  1JLE A;  4CHY A;  1Y97 A;  3HVT A;  4N56 A;  1B92 A;  3TAP A;  1EX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...