3O3GA

T. maritima rnase h2 in complex with nucleic acid substrate and calcium ions
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
222
structure length
222
Chain Sequence
GIDELYKKEFGIVAGVDEAGRGCLAGPVVAAAVVLEKEIEGINDSKQLSPAKRERLLDEIMEKAAVGIGIASPEEIDLYNIFNATKLAMNRALENLSVKPSFVLVDGKGIELSVPGTCLVKGDQKSKLIGAASIVAKVFRDRLMSEFHRMYPQFSFHKHKGYATKEHLNEIRKNGVLPIHRLSFEPVLELLTDDLLREFFEKGLISENRFERILNLLGARKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of RNase H2 in Complex with Nucleic Acid Reveal the Mechanism of RNA-DNA Junction Recognition and Cleavage.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase/dna-rna hybrid
molecule keywords Ribonuclease HII
total genus 81
structure length 222
sequence length 222
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2010-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3o3gA00
4Y1DA 1RDBA 4GVMA 3MXJA 1TAUA 2RPIA 3TAPA 4Z4EA 4HUGA 1VSIA 5J2MA 3PV8A 2ITGA 3SUPA 4B9MA 2DTUA 2GUIA 4E19A 3HP6A 1DTTA 1EXQA 3OS1A 4FK4A 2OPRA 3HK2A 1TAQA 4RW7A 3QNOA 4F8RA 2HMIA 1REVA 3OS0A 3KK1A 1XC9A 2P5OA 2BE2A 3AA4A 1UA0A 1SL2A 3SQ1A 1LWFA 3MECA 1LAWA 1EETA 4CK1A 4KB0A 4ID1A 4RW6A 1BQNA 4KTZA 1MU2A 4DQRA 3ZSXA 1VSDA 3ISNC 4IG0A 4AHCA 3K5LA 3ITHA 3QINA 3V9ZA 3OYKA 1NOZA 4JRPA 4CCHA 3HXMA 2RF2A 2F8TA 4FJMA 4LSNA 3OJUA 3NGYA 3IAYA 1HPZA 2A1SA 4Q5VA 2G8KA 4FJHA 3H08A 2EX3A 3FFIA 4FJNA 4LH4A 4QAGA 3CFPA 1C0MA 3IG1A 3RMCA 4E89A 2B4JA 4H4OA 2O4IA 3SPZA 2FBVA 3SV3A 4HUFA 1NKCA 4FJXA 3AO5A 4B08A 5HROA 3MXMA 1DTQA 3WNFA 1IH7A 1SKWA 1IG9A 4DSIA 2YHAA 1U47A 1KFDA 2XO7A 2B5JA 4CJUA 2OPPA 1JLBA 1JLEA 1VSLA 2YNFA 4RW8A 1QSYA 4TSXA 3DLEA 4FJLA 3SNNA 3OYLA 4DQIA 2KZZA 3SPYA 1IO2A 1RT6A 4FLWA 1L3TA 2A1RA 1RCHA 2HHWA 3ASMA 4CEZA 4FZYA 1YVUA 3HPOA 2HNYA 3O4NA 3VQQA 3V81A 1KTQA 4JS4A 3NH0A 4KAZA 3AA5X 3BGRA 5KRSA 3DLHA 4FJ5A 4CIEA 4CEBA 4ICLA 1S1TA 3TAFA 2P5GA 4IFVA 1WSGA 3AO1A 4M3ZA 1RT7A 4NCBA 2G8WA 3OYAA 4CGIA 4J2AA 3O3GA 4FLUA 1Y97A 4DU4A 3AV9A 4DU3A 3TR8A 5FRNA 4G1QA 4RG8A 2OYQA 1A5VA 3P83D 1UAXA 4J2DA 3NDKA 4CJRA 4BE2A 3KD1E 1S9GA 1KCFA 1UA1A 1U48A 3NF8A 1RBRA 3RR7A 1WSEA 4AHTA 4O4GA 4B9UA 1BGXT 1YT3A 4CJLA 3OYCA 3T3FA 4F3OA 2PZSA 4FJKA 2KFZA 3C94A 2KFNA 5I42A 1RDAA 2HB5A 1C1CA 2HNDA 3KIOA 4AHRA 4OPKA 4FK0A 3EYZA 4M42A 4W5NA 2HHQA 4EP5A 1SKSA 4CK2A 3QLHA 5J1EA 1WAJA 2HNZA 4FW2A 4O5BA 4FW1A 3NH2A 3SQ2A 1LAVA 3VQBA 3JYTA 4CGHA 2W42A 3B6PA 2VG6A 1FK9A 1LW0A 4BWMA 4ELTA 1LWEA 3DOLA 2YV0X 1KVCA 3MEGA 1XWLA 4I9LA 1RT2A 5DMRA 1SKRA 4IKFA 4CF2A 3OYGA 1HQUA 1KLNA 3L2UA 1S9EA 4B3OA 3LANA 4C8KA 3NGZA 2HW3A 1J53A 5C42A 1XI1A 4O55A 1T05A 3LPUA 1SUQA 1WSIA 4I7FA 4KV8A 4BACA 4HTUA 4Z4FA 4B9NA 3LWMA 2OPQA 1IKVA 3ULDA 3V9XA 4OGEA 5HRNA 1KSPA 5HRPA 1KRPA 4CJEA 1S1WA 1Z26A 3KLEA 3C95A 4N47A 1JKHA 2FBYA 3AVHA 4CEEA 3V1OA 3S3NA 4CHYA 3ZCMA 4CEQA 4CJWA 1RTIA 3ZSQA 1TL1A 4WE1A 1SL0A 1NKBA 3DRRA 3OYFA 4M3YA 3TANA 3L8BA 2IGIA 4Y1CA 3K57A 3VQ9A 1JLGA 3ZSVA 3THVA 2OA8A 3IS9A 1TVRA 4NYFA 4CF1A 4Z4IA 2QKBA 1RDCA 4DF8A 1S1XA 1BIZA 1EKEA 1HQEA 1RTJA 4M3RA 3PO4A 4F4KA 2HVIA 3QEWA 4ELVA 4DWIA 4FJIA 3PX6A 5I3UA 1NJYA 1JLCA 4J2BA 3K59A 4PQUA 4KTQA 2PY5A 3LPTA 3K2PA 4OKKA 4E7HA 1IKXA 3NCIA 4DQSA 1IKYA 2QXFA 1TV6A 2X6SA 4N56A 4F3TA 4ID5A 2IS3A 1Q9XA 1WAFA 3AVIA 2D0CA 5CYMA 3V6DA 3U3YA 4N41A 4CHNA 3O3FA 1CXUA 1LW2A 4EZ6A 4KREA 4BDYA 1S6PA 1RTDA 4FZZA 1ZYQA 2G8FA 1T7PA 3SJJA 3IRXA 1BISA 2JGUA 3TAMA 3L2WA 2D0AA 3QIPA 3AVGA 3K5OA 4B8CA 2WONA 1S5JA 3DRSA 1WLJA 1NK6A 4E7IA 4LSLA 4CEAA 4RW9A 4M3XA 2VWJA 2G8IA 1NK5A 2IDOA 4RW4A 4KB1A 4BE0A 1S1VA 3HPHA 4PA1A 3VN5A 1NK0A 3ZSRA 3QEPA 4Q0BA 4OLAA 2ETJA 1ZBLA 3AVNA 4F2RA 2IAJA 2F96A 1CLQA 3CQ8A 3RTVA 1D5AA 1NK9A 1TGOA 4LY7A 3M8PA 4FJ7A 1ASWA 2G8VA 4CJFA 4DMNA 3D45A 4DSLA 4FVMA 3V1QA 4YFUA 4DFKA 3KJVA 3VA0A 4HUEA 1F21A 3LALA 4KHUA 4M3TA 3VQ7A 3SCXA 2E6LA 1HYSA 3F73A 2Y1JA 2AJQA 2D0BA 2E4LA 3T1AA 2KW4A 5JS2A 4M3WA 4E7JA 2IOCA 1B9DA 4KHSA 5KGXA 3VQ6A 2KZMA 3LP1A 3MEDA 3G0ZA 4CJPA 5HLFA 4CJ3A 2OZSA 1JLAA 3TARA 4HCBA 3DLGA 4FJ9A 2OZMA 1RILA 1KVAA 3CM5A 2YHBA 2GV9A 3VQCA 1SV5A 1DLOA 4J2EA 2HHXA 1QE1A 1S6QA 2YKMA 4CGJA 1RDDA 4FLVA 1K6YA 4DTJA 4FM1A 2ZQBA 1BIUA 1C1BA 4CERA 4KI6A 4FLTA 4DSFA 3K58A 1YTUA 3NGIA 4CK3A 4FCYA 2QK9A 1ZBHA 4O44A 3OYDA 1GOAA 1N5YA 3DOKA 3DMJA 4AH9A 4CFAA 4BWJA 1QTMA 1WSJA 2B6AA 3SYZA 1RT5A 4QCLA 1D9FA 4R5PA 3QEVA 2KQ2A 3VQ5A 2DFHA 3I0RA 4AHVA 4CGGA 4FM0A 1RNHA 1L3UA 1WNSA 3CM6A 2G8UA 5E41A 3PX0A 4EP4A 4C8NA 4CEOA 2XY5A 1N6QA 4DFJA 3DLBA 3SQ0A 2WOMA 3HP9A 4DG1A 4NCAA 4CEFA 4OLBA 1I3AA 2EHGA 3M8RA 3WNEA 1O1WA 4KTWA 3SV4A 1CZBA 1RTHA 1WN7A 3AA2A 4KHYA 2P51A 1L3VA 5FRMA 4FYDA 1RBVA 3LZIA 3SI6A 2ATQA 2FBXA 3T19A 5CYQA 1BI4A 4BDPA 3OVNA 5K14A 4FJJA 3VQ8A 5CZ1A 3NHGA 3D0PA 4DFMA 3LDSA 4CJKA 1ASVA 3NH1A 5J2NA 1GOBA 3AVMA 3AO4A 1FKOA 4W5QA 4OKEA 1UWBA 3LP0A 4OVLA 4CF8A 3KK2A 3VA3A 3RMDA 1QHTA 5C24A 1TKDA 1D9DA 4AHUA 3DM2A 3WNHA 4CIGA 1TK0A 4HHTA 1ITGA 3RRHA 4B9TA 4B9LA 4AILC 3RMAA 1XHZA 3TABA 1RT1A 4EZ9A 4KO0A 2BANA 4CHZA 3V9SA 1U4BA 2FBTA 2DY4A 3KLIA 2DFEA 2G8HA 4CESA 4DTOA 1VSFA 4IBNA 3HL8A 2X6NA 5KTQA 3ZT4A 1X9SA 1NK8A 5D3GA 2F8SA 3SUNA 5HRSA 3VQAA 2IC3A 3SQ4A 5DK5A 4KHQA 4DLGA 2YNGA 4CGFA 3SUOA 1B9FA 3ZSWA 4KPYA 3CYMA 3RRGA 3QERA 3PUFA 2O4GA 4HVJA 1ZBUA 3NE6A 3S3OA 3I8DA 1SL1A 1JLQA 1RT3A 1LWCA 1JXEA 2I5JA 4KRFA 4N76A 3KLHA 2Z1GA 3EZ5A 3KD5E 5JS1A 1KLMA 3NFAA 3QESA 1HMVA 4PWDA 2KTQA 4CGDA 4KI4A 1B92A 1ASUA 4GMJB 3OYHA 4OJRA 1RBUA 2XY7A 2VG5A 4JLHA 2R7YA 4NCGA 4Z4GA 4DU1A 1BCOA 1CXQA 5SWMA 2HHUA 1BI4B 1VRUA 3DI6A 3V4IA 2Z1JA 3OS2A 1G15A 3OYEA 2DFFA 4E3SA 1QQCA 4FXDA 3C6UA 3O3HA 2X74A 3OYNA 1R0AA 4DQQA 3CFRA 2JLEA 3AVFA 1JXBA 2XY6A 4CECA 1Q9YA 2XY8A 1RT4A 4ZHRA 3S9HA 4ZTJA 3ZSYA 4K8XA 2Z1HA 3ZT0A 4DTNA 3HPGA 4KKOA 4PUOA 5EU7A 3DLKA 4I2PA 2ZD1A 3QO9A 4IG3A 3OJSA 4H8KA 3ZT2A 4CJQA 3OY9A 4KFBA 4DSKA 1GOCA 1JL2A 1RBSA 3CG7A 4E1MA 1TKZA 2NUBA 1S1UA 4B8AB 4FK2A 3HVTA 3QEXA 3RMBA 1VSEA 1CZ9A 4GW6A 4KHWA 3AVCA 5J2PA 3AVBA 1YTAA 3VQPA 3RWUA 4CEDA 1NK4A 3BDPA 3HM9A 3V1RA 3DYAA 4DTXA 4CFDA 3LZJA 1NJXA 3LWLA 2Q3SA 4YNQA 4DFPA 1HJRA 4H4MA 2XHBA 3QETA 1VRTA 4ZTFA 4ELUA 3HJFA 2Y1IA 3KLFA 3KK3A 3TWHA 1NJWA 3SZ2A 4CFCA 4F2SA 2YNHA 2D5RA 1VSHA 3F9KA 5T7BA 5HBMA 1C0TA 2X78A 3K5NA 4CJ4A 3VQDA 4CFBA 2RKIA 5CZ2A 5CY4A 3SUQA 1QSLA 1VK0A 2FC0A 3ZSOA 1HNVA 1KVBA 2GBZA 2ZE2A 3KKSA 4AHSA 2HHSA 3VQEA 2PYLA 3UIQA 1EX4A 4IFYA 1FXXA 2E6MA 3KTQA 1RBTA 1U45A 4OPJA 1X1PA 4DTSA 4CF9A 3AO3A 3ALYA 5KRTA 4L8RB 1TK8A 1TKXA 3M8QA 4MQ3A 3AVJA 4O0JA 2VWKA 5FROA 1HNIA 1TL3A 1A5XA 4DF4A 4DLEA 3U6FA 3VQ4A 1NJZA 1X9WA 4DTUA 1NOYA 1BHLA 4Z4CA 4K8ZA 3V9UA 1T03A 4C8OA 1WSHA 1TK5A 1ZBFA 3OYJA 1W0HA 1TKTA 4CF0A 1JL1A 4CHPA 1L5UA 3M8SA 3WNGA 3K5MA 3P1GA 1VSJA 4MFBA 3OYBA 4O0IA 2HHVA 4CJVA 3MEEA 1QS4A 2PYJA 5KGWA 1ZBIA 4DTMA 2BGGA 3L2RA 3PO5A 4C8LA 1HRHA 4M45A 3MXIA 2QKKA 1FKPA 3DRPA 1D8YA 2VG7A 4IDKA 3QNNA 1IKWA 1Z25A 3HSTB 3LP2A 3LAKA 1C6VA 3L2VA 2RN2A 3LP3A 3HT3A 3NF9A 3AVKA 4Z4HA 4CJSA 1BCMA 3G10A 1C1AA 3ZSZA 3KLGA 3V9WA 4I9QA 1J9AA 3C6TA 4FJ8A 3NF6A 4FM2A 3A2FA 1C0UA 5FDLA 3OYIA 4W5OA 4E7LA 5SZTA 4DTRA 5HP1A 3MAQA 3KKRA 1L3SA 3QEIA 4CHQA 2P1JA 4E0DA 4C8MA 4OGCA 3B6OA 4W5TA 4DQPA 3L3VA 4LH5A 4FZXC 3TAGA 4DS4A 3DLRA 3L2QA 1X9MA 3LAMA 1Q8IA 2YNIA 5C25A 1J54A 2Z1IA 3HYFA 1VSMA 4BE1A 2LSNA 2OPSA 4B9SA 3HO1A 3QIOA 2HHTA 3NAEA 3AA3A 3HVRA 4DS5A 2HVHA 3S3MA 1U04A 3AVAA 1T8EA 3L3UA 4XIUA 3TAQA 3RR8A 4DSEA 3TAEA 1VSKA 3AVLA 4LD0A 1JLFA 1I39A 4M41A 5J2QA 4N5SA 3PX4A 5KI6A 1EP4A 3AO2A 4B9VA 4DTPA 4I2QA 3PY8A 1NKEA 3TI0A 4UQGA 4DSJA 1XHXA 4PY5A 3ZT3A 4FLYA 4CJTA 1BL3A 1KFSA 4OKJA 1LV5A 3EY1A 4JRQA 1QSSA 4CIFA 2YKNA 4FLZA 1J5OA 3ZT1A 3CFOA 2XRIA 3U3GA 5HRRA 3O4QA 4FLXA 1HYVA 4FJGA 4W5RA 1BQMA 1W9HA 3NF7A 4CHOA 4BDZA 3P5JA 3OYMA 4QOZB 4CJ5A 4E1NA 4CE9A 4JS5A 1UOCA 3E01A 3NBPA 4HCCA 1HYZA 4M3UA 4KHNA 3I0SA 4E7KA 1U49A 4NYNA 1WSFA 1A5WA 4Z0UA 2BDPA 3JSMA 1NK7A
chains in the Genus database with same CATH superfamily
4GVMA 3E9LA 2ZJPL 3E9OA 3HP6A 5AQGA 4I6MB 3DXMB 4M63C 1HKGA 1REVA 1T44A 3OS0A 4LF4K 4K0KK 5GAGP 4CZEA 3CETA 3HSCA 4CK1A 4RW6A 4KTZA 1MU2A 1MDUB 4IG0A 3K5LA 3QINA 1WB9A 5H1SQ 3EL2A 3OJUA 3TU5A 4Q5VA 2EX3A 2Q36A 3CFPA 3CCRN 4E89A 4H4OA 2O4IA 5BRDA 4CZLA 1IH7A 4ILHA 3J7ZO 4FWOA 4H0PA 4FJLA 1IO2A 1GLEG 1L3TA 4WQ5C 1RCHA 3ASMA 3RVCA 4A5AA 3HPOA 5EX5A 1GLJO 3G25A 3ZEUA 4IXCA 5M1KA 2HNYA 4JAXA 3V81A 3J81O 4JS4A 3NH0A 4FPAA 1P90A 1S1TA 1ATSA 1BUPA 3TAFA 4M3ZA 3AO1A 1RT7A 1NLVA 4NCBA 2G8WA 2HBLA 5BN8A 3F5TA 5FPMA 1NM1A 4G1QA 3M3ZA 1A5VA 5F2RA 1DEJA 3P39A 3ZETB 3NF8A 2QTDA 4AHTA 1BGXT 3T3FA 4C1NI 2KFZA 4H0XB 1RGIA 1KAYA 1Q81O 1KXPA 4O5BA 4FW1A 2W42A 3B6PA 2VG6A 1FK9A 3GOIA 4ELTA 4FWLA 1LWEA 1NGBA 5C15A 3DOLA 5DMRA 2P9SA 4A2AA 3IMXA 3VEZA 1HQUA 3LM2A 3T7ZA 1S9EA 4WCEL 4X64K 4DR4K 5C42A 1XI1A 4O55A 3LPUA 4I7FA 4KV8A 4LC9B 2KHOA 3CJAA 4B9NA 3TSPA 4KH4A 5HRPA 4CJEA 4CEEA 4N47A 1JKHA 3AVHA 3ULEA 3ATUA 3S3NA 2QW9A 1YITN 4DV2K 4CEQA 4DR3K 3D2FB 1EO1A 3TANA 3K57A 3U4LA 3VF6A 1JLGA 5BR8K 5HOOA 1BIZA 1HQEA 4M3RA 3UE5A 4F4KA 2ASPA 4PQUA 3K59A 4KTQA 2PY5A 1T3VA 4E7HA 1NGDA 1IG8A 4DQSA 1QVGM 1IKYA 4F3TA 3TPQA 1YIJN 1Q9XA 3CXCM 3P38A 4N41A 2NRXA 4BDYA 3D2FA 2J4RA 3HBTA 3L2WA 3AVGA 3TSQA 4CEAA 2G8IA 2IDOA 2QWLA 1HR0K 4BC3A 1S1VA 2YJFA 4OLAA 2ETJA 1ZBLA 2IAJA 2F96A 1NGHA 3UKRA 1VQ9N 2CGJA 3U9DA 3MN7A 1TGOA 3M8PA 4XH4A 4FO0A 2HBJA 2G8VA 2EWSA 3D45A 3L4QA 4FVMA 3EEQA 2QA4N 1F21A 1EWRA 3IFRA 2O8FB 4IOAL 1HX1A 3L4IA 3T1AA 2KW4A 1IJJA 2IOCA 5GAHP 1HLUA 1G99A 1IBMK 3C6HA 4KBOA 3MX5A 5AQYA 1Q18A 4K43A 1KVAA 1WUAA 1T6DA 1SV5A 4JKDA 4DUZK 4BG9A 4CGJA 4OPHA 3SAFA 3K58A 3O08A 3NGIA 4FCYA 1ZBHA 3G4SN 3OYDA 1N5YA 3QDKA 3U9ZA 3AARA 4QCLA 3QEVA 4AHVA 1RNHA 2O8BA 1WNSA 2G8UA 3KHYA 2HSTA 3KWIA 5E41A 3PX0A 3HM8A 3OW2M 3DLBA 2WOMA 4NCAA 4LF6K 4OLBA 4PKIA 4CZKA 3SV4A 4F9OA 3SBGA 4H03B 3SI6A 1MA9B 2ATQA 4GVEA 1N33K 1YVNA 1NBWA 4GNIA 4PHTX 4FJJA 3FR0A 3VQ8A 3LDSA 5ADXA 2BH1A 5J2NA 4W5QA 3ZLJA 2HF3A 4OVLA 3WNHA 4CIGA 2ZJQL 4M7YA 3RMAA 5KQDA 4EZ9A 2BANA 3DXKB 4CHZA 1U4BA 3KLIA 1NU0A 1K8KB 2DFEA 2GEMA 3H1VX 1NK8A 5D3GA 4BRQA 2F8SA 2VQEK 3VQAA 3MN6A 3I56N 1B9FA 3ZSWA 4YY3K 3CYMA 3RRGA 3LDNA 2P9SB 3THYB 4JKAA 4NB4A 3SMPA 3I8DA 1RT3A 4KRFA 2RE2A 3VERA 1K73O 3BF3A 1XMQK 3OYHA 3A5LC 3CERA 3DXKA 1BCOA 2IIRA 4X62K 4BGBA 1G15A 2P9KA 2WTUA 3VEOA 4WQ4C 5C2DA 1Q9YA 2XY8A 1VHXA 4OX9K 3H46O 3ZSYA 4K8XA 3U8XA 2P9UB 4DTNA 2O8DA 4I2PA 3QBXA 3OJSA 4H8KA 4KFBA 4DSKA 2NUBA 4XH5A 2QWQA 4ILGB 4B8AB 4H0VB 4CZMA 3RMBA 4FL9A 4OPAA 1CZ9A 3AVCA 3O1WA 3AVBA 3FZHA 3MK6A 1NK4A 2HOEA 3LZJA 1NJXA 3WQTA 3LWLA 2Q3SA 4ELUA 1GLAG 2NLXA 1VRTA 4DV5K 3VESA 2YNHA 2ASMA 3D2EB 1WBBA 1VSHA 4JI4K 4FWQA 3K5NA 4DB3A 2P9PB 2RKIA 1QSLA 2NRVA 4UY8O 3WQUA 3VTIA 1X1PA 4DTSA 4BRKA 3CCVN 1Q86O 4CZGA 1TK8A 1TL3A 3U6FA 1A5XA 4J2DA 3VQ4A 1BHLA 5M1PA 5LL6Z 1ZBFA 3OYJA 4CHPA 2ASOA 3WNGA 4BRFA 3P1GA 1XC3A 5AQXA 5C10A 3MMVA 4CJVA 1QS4A 1ZBIA 5CE3A 3PO5A 1HRHA 4M45A 3HZ6A 1Z25A 1N32K 3HSTB 3L2VA 2RN2A 1NGJA 3AVKA 1BCMA 3G10A 1C1AA 1J9AA 3C6TA 4PKHA 1QVFM 4R79A 3OYIA 2FSNA 3A5MC 2BTFA 3OBWA 1EWQA 3QEIA 4CHQA 4IWVA 4C8MA 4DQPA 4FZXC 4LH5A 4JI2K 3DLRA 1M1KO 5C25A 1VSMA 2OPSA 3FZMA 4B9SA 3HO1A 3NAEA 4BR2A 2NRHA 3RR8A 1JLFA 3PX4A 2H3GX 1EP4A 5TKYA 3AO2A 3PY8A 3TI0A 4IEEA 1H1VA 1XHXA 3ZT3A 4CJTA 1S3XA 4OKJA 1QSSA 5M1OA 5AQKA 2YKNA 3GBTA 3CFOA 3U3GA 1ZBSA 5HRRA 3H6EA 1HYVA 4FLXA 3THWA 4FJGA 3TTFA 4E1NA 3E01A 4HCCA 1HYZA 4LF9K 3A0IX 4KHNA 3THXA 1XQSC 4CW7B 3JSMA 1RDBA 3VGLA 2RPIA 4HUGA 5BPLA 4B9MA 4JI0K 1DTTA 4Y0WA 1TAQA 4F8RA 4B3RK 3AAPA 3KK1A 4H0TB 5JVHL 5AQJA 2QWRA 1EETA 5BREA 4B1UB 1BQNA 2NNWA 2V52B 1KAXA 3CIPA 4AHCA 5AQQA 4JI6K 3HXMA 2F8TA 5B8HA 1HPZA 2A1SA 5GAEP 4FJHA 3CJ7A 1WBDA 3QFUA 4WFNL 2ZJRL 3RMCA 5LY3A 5AQFA 1NKCA 2D4WA 3AO5A 4B08A 3WNFA 1IG9A 4JKGA 1U47A 1KFDA 2XO7A 4AM7A 2B5JA 2OPPA 1VQ5N 4A57A 1XUPO 4DQIA 2KZZA 2P9KB 1SZ2A 3EO3A 4FZYA 5EY4A 2W40A 2E2QA 3AA5X 3BGRA 4FJ5A 4CIEA 4CEBA 4ICLA 2P5GA 4IFVA 1WSGA 3EE9A 3OYAA 4J2AA 4AM6A 2E1ZA 1Y97A 3AV9A 2YX6A 3EN9A 2Q0RA 4BREA 4ISGA 3NDKA 3L0QA 4YORA 4BE2A 1QQOA 1KCFA 1VQ8N 4JKHA 1U48A 1RBRA 4FWNA 4YOXA 3ATVA 4CJLA 2PZSA 4FJKA 1SQKA 4FOIA 3DLLL 2KFNA 1RDAA 2HB5A 3O8MA 4W5NA 1KD1O 3EYZA 4M42A 5GINA 4B1YB 1WAJA 2HNZA 2OCEA 4FW2A 3SQ2A 3JYTA 4CGHA 3RSEA 3QFPA 4BWMA 3MEGA 1X3NA 5LMNK 4IKFA 4CF2A 3WUHA 3THXB 2RHKA 4B3OA 3LANA 2F9TA 4C8KA 3NGZA 1T05A 2QWNA 4U7BA 4HTUA 4DCHA 2ZF5O 3LWMA 1IKVA 2A5XA 4IOXA 4OGEA 1KRPA 3QBWA 4B9QA 1Z26A 4BRGA 3C95A 2FBYA 3V1OA 5DM7L 1GLCG 4CHYA 5EXWA 3ZCMA 4PKGA 3ZSQA 1SS6A 1TL1A 1NKBA 4M3YA 2P9PA 5JICA 3MX2A 4Y1CA 3HOTA 4BRMA 4PL8A 3IS9A 1JCEA 1TVRA 2ZGZA 1RDCA 4DF8A 1EKEA 1RTJA 2HVIA 4AF1A 4ELVA 1SAZA 3PX6A 3WXMB 1Q7YO 4J2BA 1LOTB 3LPTA 1IKXA 3VEYA 4A2BA 3AGRA 3NCIA 2X6SA 4N56A 1TV6A 4ID5A 2IS3A 1WAFA 3ZETA 3U3YA 1LW2A 1Z05A 1S6PA 4FZZA 1ZYQA 1BISA 3TAMA 5AZJB 3VF4A 1S5JA 3DRSA 4E7IA 4BQZA 4B3SK 2VWJA 3F2KA 4KB1A 3K0SA 4BE0A 5AQUA 3HPHA 3VGMA 1YAGA 2DPNA 3O9RA 1CLQA 3CJ9A 5LJWA 3UKUB 4DR6K 1VQ6N 1ASWA 5GIPA 3OHRA 3CQXA 4CJFA 4DMNA 4CBWA 4BR7A 4DSLA 1JCGA 4KHUA 3HRGA 4CZIA 2P9LA 2Y1JA 2VWBA 3C7NB 2E4LA 3CPWM 5F0XA 3FZLA 1KAZA 4CJ3A 1JLAA 3TARA 3R6MA 3DLGA 4CBXA 3CM5A 2OZMA 2YHBA 4BG8A 1DLOA 1QE1A 2VCPA 2E2OA 3UB5A 4YHHK 3C7NA 2WUSA 3E1YA 3ZEUB 4V19S 4Z94A 4ISEA 4BC5A 1GOAA 3DMJA 5FPEA 4BWJA 1QTMA 2B6AA 1D9FA 4R5PA 1HKCA 3VQ5A 4CGGA 1JJ2M 4JKFA 4WYBA 4EP4A 4C8NA 1N6QA 1KC8O 4DFJA 1R59O 3HP9A 4DG1A 3SQ0A 4FWKA 3M8RA 2W6LA 1O1WA 1CZBA 3FFKB 5FRMA 1RBVA 3LZIA 1TUUA 3T19A 1OKJA 5AQSA 4BDPA 3CCMN 2O8EB 4DFMA 3NHGA 4YOTA 3KK7A 4CJKA 3CJ1A 3I33A 3AVMA 3LP0A 4CF8A 3KK2A 3VA3A 3LDQA 5LJVA 3DM2A 4HHTA 4B9LA 5C2FA 3SK3A 4BQLA 4GV3A 3N4PA 3VETA 1NJIO 4IBNA 3ZX2A 3HL8A 4DV6K 4X66K 1VQNN 3C65A 2IC3A 4KHQA 5ADXH 3WXIA 2YNGA 4DLGA 4KPYA 3QERA 3S3OA 4HVJA 3H45C 3CQYA 2F4VK 1IBKK 4N76A 3EZ5A 3QESA 4JHDB 4XH1A 1HMVA 4PWDA 1J5EK 3SJHA 4KI4A 4OJRA 1VQON 2VG5A 1NNEA 2QM1A 1Y64A 1CXQA 3LM9A 2FSKA 2HHUA 3ZYYX 1QQCA 3OYNA 3CFRA 1OH7A 1BDGA 4JK8A 1JXBA 1OH6A 4ZTJA 2FF6A 2Z1HA 3HPGA 3E9PA 2D0OA 3QO9A 2GWJA 3CG7A 4NLCA 1S1UA 3HVTA 1BWFO 4DKWA 1U6ZA 3J7YP 3BDPA 4CVNE 3HM9A 1T6CA 3DYAA 5EVZA 4DTXA 2ZGYA 4YNQA 1HJRA 2XHBA 3QETA 2Y1IA 3KK3A 3TWHA 1NJWA 3SZ2A 3H3NO 4F2SA 3I55N 3F9KA 4LF7K 4BRHA 4CJ4A 3R9PA 3LDLA 4CFBA 5CZ2A 4FSVA 3SUQA 3IKMA 2FC0A 3ZSOA 2ZE2A 3KKSA 4AHSA 3VQEA 3VGKA 4E1JA 2YHWA 3GE1A 2O8FA 4DV7K 2YHYA 4CBUA 1U45A 4CF9A 4L8RB 3BP8A 1TKXA 4JKCA 1X9WA 3VEWA 1NJZA 4DTUA 2I7PA 4K8ZA 4JKEA 4C8OA 1W0HA 1TKTA 1TUYA 1JL1A 4CF0A 3M8SA 3K5MA 3OYBA 4O0IA 2HHVA 5LMUK 3K9KA 5KGWA 3MDQA 4DTMA 4C8LA 2QKKA 1E4FT 3DRPA 4WF9L 5AR0A 3RSEB 1IKWA 3W3DA 5A2QO 3C0BA 3LAKA 1C6VA 2YJEA 3HT3A 2HMPA 4CJSA 4I9QA 4YOUA 3O9TA 3NF6A 1C0UA 5FDLA 4E7LA 4W5OA 4DTRA 1S72N 3MAQA 4W5TA 3B6OA 2QWPA 3TAGA 3THWB 1NMDA 3GG4A 2YNIA 1J54A 2Z1IA 3HYFA 4DUYK 3CCLN 1YUWA 1W97L 4A59A 3S3MA 4XIUA 3D2EA 3QB0A 4LD0A 4N5SA 5KI6A 4B9VA 4I2QA 3PIOL 4U67L 2KKZA 4PY5A 2BUPA 5C0YA 4FLYA 1BL3A 1MWMA 3EY1A 2Q97A 3AGKA 3R1XA 2XRIA 2FF3B 4RWTA 4LFBK 1X3MA 5AQPA 2PFUA 3NBPA 4BR9A 2QEXN 3Q7CA 5TKWA 1A5WA 3CC2N 2E5LK 3ENHA 4BRPA 3MXJA 5HL7L 4YOYA 4MLHA 1TAUA 4Z4EA 4BY9C 3CJBA 1EXQA 4KH6A 3F9MA 3KVGA 1HUXA 4A62A 4FK4A 1Z6RA 3QNOA 3HI0A 4BVOA 4JK9A 1GLBG 3S41A 2P5OA 2BE2A 1V4TA 3SQ1A 1LWFA 3MECA 1LAWA 1YJWN 3WXJA 3M5RA 3ZSXA 1VSDA 2YHXA 3ISNC 3P31A 2NRZA 3ITHA 3V9ZA 3OYKA 1NOZA 4CZHA 3MWPA 3ENOA 2RF2A 4B1XB 4FJMA 1VQ7N 3NGYA 2NRTA 2G8KA 3H08A 3FFIA 1C0MA 3OTOK 2Q0UA 4HUFA 4BRIA 1FW6A 3MXMA 1SKWA 4DSIA 1DTQA 3CCEN 1RDWX 4CJUA 1JLBA 1JLEA 1NGIA 3DLEA 3SNNA 4BC4A 3SPYA 3CJCA 5AQWA 2A1RA 3FZFA 4CEZA 1YVUA 2GWKA 4WQ5A 1RDUA 1HPMA 5KPTA 2NRWA 3VQQA 2PAVA 3DLHA 4CJ7A 3J7AP 2D0PA 3MN9A 4YOVA 4H5NA 4CGIA 3O3GA 5BPNA 3PIPL 4DU4A 3TR8A 3BZKA 5CHIA 4RG8A 3P83D 4MDBA 4CJRA 3RR7A 1WSEA 4O4GA 4B9UA 1YT3A 5FPNA 3OYCA 5KPZA 1XNRK 3C94A 5M1QA 5I42A 4FK0A 3KIOA 2HNDA 4AHRA 3O9QA 2HHQA 4FOEA 2CH5A 1SKSA 3QLHA 3A5NC 3NH2A 3VQBA 2WBNA 4IJNA 4BRCA 4BVPA 1KVCA 4I9LA 1RT2A 4YDUC 1SKRA 3OBYA 2CGLA 4MO4A 5AQVA 1J53A 4FPBA 2WC9A 1NGAA 1WSIA 2CH6A 4BACA 1QZ6A 2E2NA 2OPQA 4CD3A 4LF8K 4EFHA 5HRNA 1KSPA 3KLEA 3UKRB 3IUCA 1OH5A 4H5RA 4NXMK 1RTIA 1WOQA 3DRRA 3GL1A 4JEPA 3L8BA 3ZSVA 3THVA 2OA8A 4NYFA 4Z4IA 4CF1A 1S1XA 2V51B 3H1QA 1DKGD 1DT9A 5M1NA 3QEWA 4FJIA 1NJYA 3AAQA 3WT0A 1I94K 1P8ZA 2QI2A 5CYMA 4C23A 1YI2N 4FWSA 3O3FA 4CI6A 4EZ6A 2O8BB 1NWKA 4BR4A 1RTDA 2G8FA 5AQZA 2JGUA 3SBTA 3ULEB 2WONA 1WLJA 2P9UA 2O8DB 4LSLA 4RW9A 2UXCK 5GIOA 4RW4A 1NK5A 4BROA 3ZSRA 4Q0BA 4F2RA 3CQ8A 4EAHD 5AZIA 5F1XA 4A61A 4LY7A 1N36K 2CGKA 1TYQA 4JHDA 3V1QA 4YFUA 1RFQA 3LALA 4M3TA 1LCUA 3VQ7A 3SCXA 3K9JA 2E6LA 1HYSA 3THYA 5JS2A 1B9DA 4KHSA 5KGXA 3CHWA 3LP1A 3MEDA 5HLFA 4CJPA 2OZSA 4RCHA 3VQCA 4J2EA 2HHXA 4IDHA 1YXQA 1RDDA 2ZQBA 1BIUA 4CERA 4KI6A 4FLTA 2V7ZA 2ZWHA 3CF5L 1VQPN 4AH9A 3DAWA 3PLAA 3SYZA 4DV0K 4FM0A 2DFHA 1L3UA 1QZ5A 2GX9A 5EOYA 2A40A 4CEFA 1I3AA 1YF5L 5AFUA 3WNEA 2E20A 4KTWA 1WN7A 4RTFD 5KPRA 3L6QA 4KHYA 2P51A 3NVMA 2HBKA 2FBXA 3CPEA 1YHQN 3LDOA 3OVNA 4MLEA 3WEEA 3ID8A 1ASVA 3NH1A 1GOBA 1FKOA 4OKEA 3MN5A 4B3MK 1D9DA 1NMNA 1QHTA 2A42A 5C24A 1FJGK 1ITGA 4NLBA 4BRAA 4DV1K 1XHZA 3TABA 1ZXOA 3D6RA 3V9SA 2E1YA 2FBTA 4JNEA 2DY4A 2G8HA 1VSFA 5KTQA 4QS7A 3ZT4A 1C0FA 3SUNA 3DXMA 3SQ4A 5DK5A 4DV3K 4CGFA 3PUFA 3NE6A 1SL1A 2I5JA 1LWCA 1JXEA 5AQIA 3CCJN 1HNXK 3NFAA 1NGGA 3BUZB 2KTQA 4LF5K 1B92A 4GMJB 1K8KA 3OA9A 4B1WB 2R7YA 4NCGA 2GTDA 2V7YA 4DU1A 3BZCA 1BI4B 1VRUA 3DI6A 4K41A 3SAHA 3V4IA 3OYEA 2DFFA 4E3SA 3C6UA 2X74A 2Q1NA 4WQ4A 3AVFA 1CZAN 2XY6A 1VAZA 3LDPA 4CECA 3S9HA 4KKOA 4PUOA 3DLKA 4BRDA 4IG3A 3ZT2A 4CJQA 3OY9A 4IZ9A 3VF2A 4FK2A 3M6GA 1VSEA 4GW6A 4KHWA 1YTAA 3VQPA 1E3MA 3H3OB 2OTJN 4NO7A 4DFPA 1D4XA 4H4MA 2VQFK 3HJFA 4FWPA 1U2VA 1DGKN 3CCSN 4CFCA 2FXUA 5T7BA 1C0TA 3VQDA 3O80A 1VK0A 3JXUA 1ATRA 2GBZA 3GDQA 3EE8A 4OO1J 2HHSA 2PYLA 3UIQA 3KTQA 2E6MA 1RBTA 3AO3A 4MQ3A 3AVJA 5FROA 2VWKA 1HNIA 4CZFA 1NOYA 4DLEA 3WXKA 4NXNK 1K8AO 3V9UA 3QMLA 4O5FA 5AQOA 3O5BA 2P9LB 3ZX0A 1L5UA 1NGEA 3BF1A 5BRFA 2UXBK 4MFBA 1V4SA 1N8RO 3VMFB 2VG7A 2IVOA 4IDKA 2F7TA 4C1NK 3CC7N 3NF9A 4Z4HA 4BGAA 3ZSZA 3KLGA 3V9WA 3A2FA 4IO8A 3EKSA 4LFAK 5HP1A 5SZTA 3KKRA 4LFCK 1L3SA 2P1JA 4B3TK 3L3VA 2OANA 5AQRA 4DS4A 1NG9A 3LAMA 1Q8IA 4BE1A 3A8YA 3BEXA 5MLCQ 2LSNA 2O8EA 2IVPA 2HHTA 1HKBA 3AA3A 3HVRA 4DS5A 3O9UA 4DSEA 1VSKA 1GLDG 1I39A 2P9NA 4DTPA 4QS8A 3VTHA 1OVQA 1W7AA 3FZKA 3ZT1A 3CCUN 4BRLA 3CD6N 1BQMA 4BDZA 3CI5A 4BC2A 5KQ8A 4ILJA 3B8AX 3I0SA 3LL3A 1U49A 1WSFA 2BDPA 3VENA 4Y1DA 5AQNA 1NK7A 4CD1A 1XMOK 2F9WA 3VEXA 2FSJA 1J6ZA 5JLFA 3TAPA 5E26A 3T69A 4JN4A 3PV8A 1VSIA 5J2MA 2ITGA 3SUPA 2DTUA 2GUIA 4E19A 4KHPK 4QS9A 4YOWA 3E66A 3OS1A 2OPRA 3ZX3A 3HK2A 4RW7A 4DR1K 2A41A 2HMIA 1ILYA 1XC9A 3AA4A 1UA0A 1SL2A 2O8CA 4KB0A 4ID1A 4DQRA 1BO5O 3IDHA 2HHHK 4JRPA 4JD2A 4CCHA 4JI8K 4JV5K 1HJOA 4WFAL 2ITMA 4LSNA 3IAYA 3J80O 4H5WA 4FJNA 4LH4A 4QAGA 4FWMA 3CC4N 3SMSA 5JLHA 3IG1A 4ISFA 5BN9A 2B4JA 5FPDA 4O8KA 3SPZA 2FBVA 3SV3A 4FJXA 3DWLA 1IBLK 4DR7K 5HROA 2YHAA 3CCQN 4WFBL 2UUBK 3R3LA 5M1FA 1VSLA 3MCAB 2YNFA 4JK7A 4RW8A 5BPMA 3SAGA 4TSXA 1QSYA 1S22A 1VQMN 4KH5A 5AZIB 3OYLA 3MWTA 1RT6A 4FLWA 3VPZA 2HHWA 4B1VA 2NRRA 3O4NA 3CMAN 1KTQA 1C0GA 2QWMA 4KAZA 5KRSA 4A5BA 1QQMA 5AJ3K 1OH8A 4FLUA 4DU3A 3TSUA 5FRNA 2OYQA 1UAXA 3KD1E 1S9GA 4IEIA 1UA1A 2FLOA 4F3OA 3G6EN 2WFBA 4EHTA 4OPKA 1C1CA 4J8FA 4PL7A 4EP5A 4CK2A 3T1HK 3QICA 5J1EA 1LAVA 4EIAA 3NVKA 1ESVA 1LW0A 3A5OC 5CR4A 4EHUA 4GY2B 2YV0X 3P4IA 1XWLA 3OYGA 1EQYA 1KLNA 3WEEB 3L2UA 2HW3A 4X65K 3EZWA 1SUQA 4Z4FA 5JMVA 3ULDA 3V9XA 1S1WA 2ZM6K 4CJWA 3SLCA 1SL0A 4WE1A 3OYFA 2AA4A 1TYQB 2IGIA 3VQ9A 4K42A 3NMUA 2QKBA 4DR2K 4BRNA 5AZJA 3PO4A 1BG3A 4DQ8A 3Q7BA 2HF4A 4DWIA 4JI5K 5I3UA 1JLCA 2P9NB 3C6AA 3W0LA 4OKKA 3FLCO 3K2PA 3HOSA 2QXFA 3T1YK 1MWKA 3AVIA 2D0CA 3V6DA 4IJAA 4CHNA 3JS6A 1GLLO 1CXUA 1QQNA 4JKGB 4KREA 1X9JA 1T7PA 3SJJA 3IRXA 2KLAA 2D0AA 3QIPA 3K5OA 4XEIA 4B8CA 2UU9K 1NK6A 2P9IB 4M3XA 2GUPA 1BU6O 1NGCA 4PA1A 3VN5A 1NK0A 4H0OA 2QXLA 3QEPA 3AVNA 3ENBA 3RTVA 1D5AA 1E4GT 1NK9A 2A6AA 3ID6A 2UUAK 4JI7K 2UYTA 4FJ7A 2Q31A 1N34K 1NGFA 2NZTA 3HTVA 2YCHA 3TTDA 4DFKA 3KJVA 3VA0A 4HUEA 1W2BM 4GV6A 1ZC6A 3F73A 2AJQA 2D0BA 1YJNN 4M3WA 3O4WA 4E7JA 4H5TA 4HWIA 3VQ6A 2KZMA 3G0ZA 4JI1K 4HCBA 4FJ9A 1RILA 2GV9A 2IVNA 4IO9L 1S6QA 4M7XA 2YKMA 4FLVA 1K6YA 4DTJA 4FM1A 1C1BA 3R8EA 1IV0A 1O13A 4DSFA 5AQMA 1YTUA 4CK3A 2QK9A 1BOTO 4O44A 3BY5A 4O8UA 3DOKA 3O1BA 4CFAA 4I6MA 1WSJA 3UKUA 1RT5A 4H5VA 2KQ2A 3I0RA 1XNQK 3CM6A 2XY5A 4CEOA 2EHGA 5AQHA 1OVYA 2E2PA 1RTHA 3AA2A 3O9SA 1L3VA 4FYDA 1Q82O 5CYQA 1BI4A 5K14A 5CZ1A 2W6KA 3D0PA 3AO4A 3MCPA 1UWBA 1JCFA 4CZJA 3RMDA 1TKDA 4AHUA 1TK0A 4B9TA 1HNZK 3M1FA 4JD2B 3RRHA 4AILC 4L3QA 1RT1A 5IT9O 4KO0A 4YDUA 4DR5K 4JKBA 4CESA 4DTOA 2X6NA 1X9SA 4FVUA 2JWKA 5AQLA 5HRSA 5JVGL 2A3ZA 1M90O 3SUOA 1QHAA 3PSFA 2O4GA 4Z4GA 1ZBUA 3JAMO 1JLQA 3AY9A 3KLHA 2D1KA 2Z1GA 3KD5E 5GADP 5JS1A 1KLMA 4FWRA 3PSIA 3VOVA 4CGDA 1ASUA 1U2VB 5AFUH 1RBUA 5ELZA 5I9EB 2XY7A 4JLHA 1ATNA 2VGMA 5SWMA 2OTLN 5AQTA 2Z1JA 3OS2A 4FXDA 3O3HA 1R0AA 4DQQA 2JLEA 4ZHRA 1RT4A 2JWLA 2YI1A 4IFEA 3ZT0A 5EU7A 3VEVA 3CMEN 4BR0A 2ZD1A 1GOCA 1JL2A 1RBSA 2VYPA 5FLXO 1TKZA 4E1MA 3QEXA 3FGUA 2HBMA 4BR5A 5J2PA 3WXLA 3RWUA 4CEDA 3V1RA 4H0YB 4CFDA 4GKJK 4ZTFA 3KLFA 1BA0A 2PBDA 1VQLN 2D5RA 5HBMA 1YJ9N 2X78A 2W41A 1VQ4N 2GELA 1GLFO 3DJCA 5CY4A 1VQKN 5BR9A 1HNVA 1KVBA 4G9ZA 1EX4A 4IFYA 1FXXA 3KZBA 5BRHA 4OPJA 4DV4K 3ALYA 5KRTA 3M8QA 4O0JA 4DF4A 5IWAK 4Z4CA 1T03A 1WSHA 2QWOA 1TK5A 2I7NA 3J8AA 2O8CB 4AQYK 2AP1A 1VSJA 1K9MO 2PYJA 3MEEA 4MO5A 4JI3K 2BGGA 3L2RA 3MXIA 1FKPA 1D8YA 3FE1A 2UXDK 3QNNA 3LP2A 2VGNA 3LP3A 5C12A 1HNWK 5E84A 5DM6L 4FJ8A 4FM2A 2P9IA 4MDAA 4E0DA 3KWGA 4OGCA 4JYAK 3L2QA 1X9MA 3QIOA 4K25A 2HVHA 1U04A 2Q2RA 3AVAA 1T8EA 3L3UA 3TAQA 3TAEA 4DHYA 2E8AA 3AVLA 2UUCK 4M41A 5J2QA 2E88A 4HTLA 3N4QA 3G71N 4GV9A 4GKKK 3O6WA 3TTCA 1NKEA 4UQGA 4DSJA 3D7EO 4B1ZA 1KFSA 1LV5A 4JRQA 4CIFA 4IOCL 4FLZA 1J5OA 3O4QA 4W5RA 1W9HA 3NF7A 4CHOA 3P5JA 3OYMA 1BA1A 4QOZB 4CJ5A 4CE9A 4JS5A 1UOCA 4M3UA 4E7KA 3EKUA 1KQSM 3I8BA 4NYNA 4Z0UA
chains in the Genus database with same CATH topology
4Y1DA 1RDBA 4GVMA 3MXJA 1TAUA 2RPIA 3TAPA 4Z4EA 4HUGA 1VSIA 5J2MA 3PV8A 2ITGA 3SUPA 4B9MA 2DTUA 2GUIA 4E19A 3HP6A 1DTTA 1EXQA 3OS1A 4FK4A 2OPRA 3HK2A 1TAQA 4RW7A 3QNOA 4F8RA 2HMIA 1REVA 3OS0A 3KK1A 1XC9A 2P5OA 2BE2A 3AA4A 1UA0A 1SL2A 3SQ1A 1LWFA 3MECA 1LAWA 1EETA 4CK1A 4KB0A 4ID1A 4RW6A 1BQNA 4KTZA 1MU2A 4DQRA 3ZSXA 1VSDA 3ISNC 4IG0A 4AHCA 3K5LA 3ITHA 3QINA 3V9ZA 3OYKA 1NOZA 4JRPA 4CCHA 3HXMA 2RF2A 2F8TA 4FJMA 4LSNA 3OJUA 3NGYA 3IAYA 1HPZA 2A1SA 4Q5VA 2G8KA 4FJHA 3H08A 2EX3A 3FFIA 4FJNA 4LH4A 4QAGA 3CFPA 1C0MA 3IG1A 3RMCA 4E89A 2B4JA 4H4OA 2O4IA 3SPZA 2FBVA 3SV3A 4HUFA 1NKCA 4FJXA 3AO5A 4B08A 5HROA 3MXMA 1DTQA 3WNFA 1IH7A 1SKWA 1IG9A 4DSIA 2YHAA 1U47A 1KFDA 2XO7A 2B5JA 4CJUA 2OPPA 1JLBA 1JLEA 1VSLA 2YNFA 4RW8A 1QSYA 4TSXA 3DLEA 4FJLA 3SNNA 3OYLA 4DQIA 2KZZA 3SPYA 1IO2A 1RT6A 4FLWA 1L3TA 2A1RA 1RCHA 2HHWA 3ASMA 4CEZA 4FZYA 1YVUA 3HPOA 2HNYA 3O4NA 3VQQA 3V81A 1KTQA 4JS4A 3NH0A 4KAZA 3AA5X 3BGRA 5KRSA 3DLHA 4FJ5A 4CIEA 4CEBA 4ICLA 1S1TA 3TAFA 2P5GA 4IFVA 1WSGA 3AO1A 4M3ZA 1RT7A 4NCBA 2G8WA 3OYAA 4CGIA 4J2AA 3O3GA 4FLUA 1Y97A 4DU4A 3AV9A 4DU3A 3TR8A 5FRNA 4G1QA 4RG8A 2OYQA 1A5VA 3P83D 1UAXA 4J2DA 3NDKA 4CJRA 4BE2A 3KD1E 1S9GA 1KCFA 1UA1A 1U48A 3NF8A 1RBRA 3RR7A 1WSEA 4AHTA 4O4GA 4B9UA 1BGXT 1YT3A 4CJLA 3OYCA 3T3FA 4F3OA 2PZSA 4FJKA 2KFZA 3C94A 2KFNA 5I42A 1RDAA 2HB5A 1C1CA 2HNDA 3KIOA 4AHRA 4OPKA 4FK0A 3EYZA 4M42A 4W5NA 2HHQA 4EP5A 1SKSA 4CK2A 3QLHA 5J1EA 1WAJA 2HNZA 4FW2A 4O5BA 4FW1A 3NH2A 3SQ2A 1LAVA 3VQBA 3JYTA 4CGHA 2W42A 3B6PA 2VG6A 1FK9A 1LW0A 4BWMA 4ELTA 1LWEA 3DOLA 2YV0X 1KVCA 3MEGA 1XWLA 4I9LA 1RT2A 5DMRA 1SKRA 4IKFA 4CF2A 3OYGA 1HQUA 1KLNA 3L2UA 1S9EA 4B3OA 3LANA 4C8KA 3NGZA 2HW3A 1J53A 5C42A 1XI1A 4O55A 1T05A 3LPUA 1SUQA 1WSIA 4I7FA 4KV8A 4BACA 4HTUA 4Z4FA 4B9NA 3LWMA 2OPQA 1IKVA 3ULDA 3V9XA 4OGEA 5HRNA 1KSPA 5HRPA 1KRPA 4CJEA 1S1WA 1Z26A 3KLEA 3C95A 4N47A 1JKHA 2FBYA 3AVHA 4CEEA 3V1OA 3S3NA 4CHYA 3ZCMA 4CEQA 4CJWA 1RTIA 3ZSQA 1TL1A 4WE1A 1SL0A 1NKBA 3DRRA 3OYFA 4M3YA 3TANA 3L8BA 2IGIA 4Y1CA 3K57A 3VQ9A 1JLGA 3ZSVA 3THVA 2OA8A 3IS9A 1TVRA 4NYFA 4CF1A 4Z4IA 2QKBA 1RDCA 4DF8A 1S1XA 1BIZA 1EKEA 1HQEA 1RTJA 4M3RA 3PO4A 4F4KA 2HVIA 3QEWA 4ELVA 4DWIA 4FJIA 3PX6A 5I3UA 1NJYA 1JLCA 4J2BA 3K59A 4PQUA 4KTQA 2PY5A 3LPTA 3K2PA 4OKKA 4E7HA 1IKXA 3NCIA 4DQSA 1IKYA 2QXFA 1TV6A 2X6SA 4N56A 4F3TA 4ID5A 2IS3A 1Q9XA 1WAFA 3AVIA 2D0CA 5CYMA 3V6DA 3U3YA 4N41A 4CHNA 3O3FA 1CXUA 1LW2A 4EZ6A 4KREA 4BDYA 1S6PA 1RTDA 4FZZA 1ZYQA 2G8FA 1T7PA 3SJJA 3IRXA 1BISA 2JGUA 3TAMA 3L2WA 2D0AA 3QIPA 3AVGA 3K5OA 4B8CA 2WONA 1S5JA 3DRSA 1WLJA 1NK6A 4E7IA 4LSLA 4CEAA 4RW9A 4M3XA 2VWJA 2G8IA 1NK5A 2IDOA 4RW4A 4KB1A 4BE0A 1S1VA 3HPHA 4PA1A 3VN5A 1NK0A 3ZSRA 3QEPA 4Q0BA 4OLAA 2ETJA 1ZBLA 3AVNA 4F2RA 2IAJA 2F96A 1CLQA 3CQ8A 3RTVA 1D5AA 1NK9A 1TGOA 4LY7A 3M8PA 4FJ7A 1ASWA 2G8VA 4CJFA 4DMNA 3D45A 4DSLA 4FVMA 3V1QA 4YFUA 4DFKA 3KJVA 3VA0A 4HUEA 1F21A 3LALA 4KHUA 4M3TA 3VQ7A 3SCXA 2E6LA 1HYSA 3F73A 2Y1JA 2AJQA 2D0BA 2E4LA 3T1AA 2KW4A 5JS2A 4M3WA 4E7JA 2IOCA 1B9DA 4KHSA 5KGXA 3VQ6A 2KZMA 3LP1A 3MEDA 3G0ZA 4CJPA 5HLFA 4CJ3A 2OZSA 1JLAA 3TARA 4HCBA 3DLGA 4FJ9A 2OZMA 1RILA 1KVAA 3CM5A 2YHBA 2GV9A 3VQCA 1SV5A 1DLOA 4J2EA 2HHXA 1QE1A 1S6QA 2YKMA 4CGJA 1RDDA 4FLVA 1K6YA 4DTJA 4FM1A 2ZQBA 1BIUA 1C1BA 4CERA 4KI6A 4FLTA 4DSFA 3K58A 1YTUA 3NGIA 4CK3A 4FCYA 2QK9A 1ZBHA 4O44A 3OYDA 1GOAA 1N5YA 3DOKA 3DMJA 4AH9A 4CFAA 4BWJA 1QTMA 1WSJA 2B6AA 3SYZA 1RT5A 4QCLA 1D9FA 4R5PA 3QEVA 2KQ2A 3VQ5A 2DFHA 3I0RA 4AHVA 4CGGA 4FM0A 1RNHA 1L3UA 1WNSA 3CM6A 2G8UA 5E41A 3PX0A 4EP4A 4C8NA 4CEOA 2XY5A 1N6QA 4DFJA 3DLBA 3SQ0A 2WOMA 3HP9A 4DG1A 4NCAA 4CEFA 4OLBA 1I3AA 2EHGA 3M8RA 3WNEA 1O1WA 4KTWA 3SV4A 1CZBA 1RTHA 1WN7A 3AA2A 4KHYA 2P51A 1L3VA 5FRMA 4FYDA 1RBVA 3LZIA 3SI6A 2ATQA 2FBXA 3T19A 5CYQA 1BI4A 4BDPA 3OVNA 5K14A 4FJJA 3VQ8A 5CZ1A 3NHGA 3D0PA 4DFMA 3LDSA 4CJKA 1ASVA 3NH1A 5J2NA 1GOBA 3AVMA 3AO4A 1FKOA 4W5QA 4OKEA 1UWBA 3LP0A 4OVLA 4CF8A 3KK2A 3VA3A 3RMDA 1QHTA 5C24A 1TKDA 1D9DA 4AHUA 3DM2A 3WNHA 4CIGA 1TK0A 4HHTA 1ITGA 3RRHA 4B9TA 4B9LA 4AILC 3RMAA 1XHZA 3TABA 1RT1A 4EZ9A 4KO0A 2BANA 4CHZA 3V9SA 1U4BA 2FBTA 2DY4A 3KLIA 2DFEA 2G8HA 4CESA 4DTOA 1VSFA 4IBNA 3HL8A 2X6NA 5KTQA 3ZT4A 1X9SA 1NK8A 5D3GA 2F8SA 3SUNA 5HRSA 3VQAA 2IC3A 3SQ4A 5DK5A 4KHQA 4DLGA 2YNGA 4CGFA 3SUOA 1B9FA 3ZSWA 4KPYA 3CYMA 3RRGA 3QERA 3PUFA 2O4GA 4HVJA 1ZBUA 3NE6A 3S3OA 3I8DA 1SL1A 1JLQA 1RT3A 1LWCA 1JXEA 2I5JA 4KRFA 4N76A 3KLHA 2Z1GA 3EZ5A 3KD5E 5JS1A 1KLMA 3NFAA 3QESA 1HMVA 4PWDA 2KTQA 4CGDA 4KI4A 1B92A 1ASUA 4GMJB 3OYHA 4OJRA 1RBUA 2XY7A 2VG5A 4JLHA 2R7YA 4NCGA 4Z4GA 4DU1A 1BCOA 1CXQA 5SWMA 2HHUA 1BI4B 1VRUA 3DI6A 3V4IA 2Z1JA 3OS2A 1G15A 3OYEA 2DFFA 4E3SA 1QQCA 4FXDA 3C6UA 3O3HA 2X74A 3OYNA 1R0AA 4DQQA 3CFRA 2JLEA 3AVFA 1JXBA 2XY6A 4CECA 1Q9YA 2XY8A 1RT4A 4ZHRA 3S9HA 4ZTJA 3ZSYA 4K8XA 2Z1HA 3ZT0A 4DTNA 3HPGA 4KKOA 4PUOA 5EU7A 3DLKA 4I2PA 2ZD1A 3QO9A 4IG3A 3OJSA 4H8KA 3ZT2A 4CJQA 3OY9A 4KFBA 4DSKA 1GOCA 1JL2A 1RBSA 3CG7A 4E1MA 1TKZA 2NUBA 1S1UA 4B8AB 4FK2A 3HVTA 3QEXA 3RMBA 1VSEA 1CZ9A 4GW6A 4KHWA 3AVCA 5J2PA 3AVBA 1YTAA 3VQPA 3RWUA 4CEDA 1NK4A 3BDPA 3HM9A 3V1RA 3DYAA 4DTXA 4CFDA 3LZJA 1NJXA 3LWLA 2Q3SA 4YNQA 4DFPA 1HJRA 4H4MA 2XHBA 3QETA 1VRTA 4ZTFA 4ELUA 3HJFA 2Y1IA 3KLFA 3KK3A 3TWHA 1NJWA 3SZ2A 4CFCA 4F2SA 2YNHA 2D5RA 1VSHA 3F9KA 5T7BA 5HBMA 1C0TA 2X78A 3K5NA 4CJ4A 3VQDA 4CFBA 2RKIA 5CZ2A 5CY4A 3SUQA 1QSLA 1VK0A 2FC0A 3ZSOA 1HNVA 1KVBA 2GBZA 2ZE2A 3KKSA 4AHSA 2HHSA 3VQEA 2PYLA 3UIQA 1EX4A 4IFYA 1FXXA 2E6MA 3KTQA 1RBTA 1U45A 4OPJA 1X1PA 4DTSA 4CF9A 3AO3A 3ALYA 5KRTA 4L8RB 1TK8A 1TKXA 3M8QA 4MQ3A 3AVJA 4O0JA 2VWKA 5FROA 1HNIA 1TL3A 1A5XA 4DF4A 4DLEA 3U6FA 3VQ4A 1NJZA 1X9WA 4DTUA 1NOYA 1BHLA 4Z4CA 4K8ZA 3V9UA 1T03A 4C8OA 1WSHA 1TK5A 1ZBFA 3OYJA 1W0HA 1TKTA 4CF0A 1JL1A 4CHPA 1L5UA 3M8SA 3WNGA 3K5MA 3P1GA 1VSJA 4MFBA 3OYBA 4O0IA 2HHVA 4CJVA 3MEEA 1QS4A 2PYJA 5KGWA 1ZBIA 4DTMA 2BGGA 3L2RA 3PO5A 4C8LA 1HRHA 4M45A 3MXIA 2QKKA 1FKPA 3DRPA 1D8YA 2VG7A 4IDKA 3QNNA 1IKWA 1Z25A 3HSTB 3LP2A 3LAKA 1C6VA 3L2VA 2RN2A 3LP3A 3HT3A 3NF9A 3AVKA 4Z4HA 4CJSA 1BCMA 3G10A 1C1AA 3ZSZA 3KLGA 3V9WA 4I9QA 1J9AA 3C6TA 4FJ8A 3NF6A 4FM2A 3A2FA 1C0UA 5FDLA 3OYIA 4W5OA 4E7LA 5SZTA 4DTRA 5HP1A 3MAQA 3KKRA 1L3SA 3QEIA 4CHQA 2P1JA 4E0DA 4C8MA 4OGCA 3B6OA 4W5TA 4DQPA 3L3VA 4LH5A 4FZXC 3TAGA 4DS4A 3DLRA 3L2QA 1X9MA 3LAMA 1Q8IA 2YNIA 5C25A 1J54A 2Z1IA 3HYFA 1VSMA 4BE1A 2LSNA 2OPSA 4B9SA 3HO1A 3QIOA 2HHTA 3NAEA 3AA3A 3HVRA 4DS5A 2HVHA 3S3MA 1U04A 3AVAA 1T8EA 3L3UA 4XIUA 3TAQA 3RR8A 4DSEA 3TAEA 1VSKA 3AVLA 4LD0A 1JLFA 1I39A 4M41A 5J2QA 4N5SA 3PX4A 5KI6A 1EP4A 3AO2A 4B9VA 4DTPA 4I2QA 3PY8A 1NKEA 3TI0A 4UQGA 4DSJA 1XHXA 4PY5A 3ZT3A 4FLYA 4CJTA 1BL3A 1KFSA 4OKJA 1LV5A 3EY1A 4JRQA 1QSSA 4CIFA 2YKNA 4FLZA 1J5OA 3ZT1A 3CFOA 2XRIA 3U3GA 5HRRA 3O4QA 4FLXA 1HYVA 4FJGA 4W5RA 1BQMA 1W9HA 3NF7A 4CHOA 4BDZA 3P5JA 3OYMA 4QOZB 4CJ5A 4E1NA 4CE9A 4JS5A 1UOCA 3E01A 3NBPA 4HCCA 1HYZA 4M3UA 4KHNA 3I0SA 4E7KA 1U49A 4NYNA 1WSFA 1A5WA 4Z0UA 2BDPA 3JSMA 1NK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y1D A;  1RDB A;  4GVM A;  3MXJ A;  1TAU A;  2RPI A;  3TAP A;  4Z4E A;  4HUG A;  1VSI A;  5J2M A;  3PV8 A;  2ITG A;  3SUP A;  4B9M A;  2DTU A;  2GUI A;  4E19 A;  3HP6 A;  1DTT A;  1EXQ A;  3OS1 A;  4FK4 A;  2OPR A;  3HK2 A;  1TAQ A;  4RW7 A;  3QNO A;  4F8R A;  2HMI A;  1REV A;  3OS0 A;  3KK1 A;  1XC9 A;  2P5O A;  2BE2 A;  3AA4 A;  1UA0 A;  1SL2 A;  3SQ1 A;  1LWF A;  3MEC A;  1LAW A;  1EET A;  4CK1 A;  4KB0 A;  4ID1 A;  4RW6 A;  1BQN A;  4KTZ A;  1MU2 A;  4DQR A;  3ZSX A;  1VSD A;  3ISN C;  4IG0 A;  4AHC A;  3K5L A;  3ITH A;  3QIN A;  3V9Z A;  3OYK A;  1NOZ A;  4JRP A;  4CCH A;  3HXM A;  2RF2 A;  2F8T A;  4FJM A;  4LSN A;  3OJU A;  3NGY A;  3IAY A;  1HPZ A;  2A1S A;  4Q5V A;  2G8K A;  4FJH A;  3H08 A;  2EX3 A;  3FFI A;  4FJN A;  4LH4 A;  4QAG A;  3CFP A;  1C0M A;  3IG1 A;  3RMC A;  4E89 A;  2B4J A;  4H4O A;  2O4I A;  3SPZ A;  2FBV A;  3SV3 A;  4HUF A;  1NKC A;  4FJX A;  3AO5 A;  4B08 A;  5HRO A;  3MXM A;  1DTQ A;  3WNF A;  1IH7 A;  1SKW A;  1IG9 A;  4DSI A;  2YHA A;  1U47 A;  1KFD A;  2XO7 A;  2B5J A;  4CJU A;  2OPP A;  1JLB A;  1JLE A;  1VSL A;  2YNF A;  4RW8 A;  1QSY A;  4TSX A;  3DLE A;  4FJL A;  3SNN A;  3OYL A;  4DQI A;  2KZZ A;  3SPY A;  1IO2 A;  1RT6 A;  4FLW A;  1L3T A;  2A1R A;  1RCH A;  2HHW A;  3ASM A;  4CEZ A;  4FZY A;  1YVU A;  3HPO A;  2HNY A;  3O4N A;  3VQQ A;  3V81 A;  1KTQ A;  4JS4 A;  3NH0 A;  4KAZ A;  3AA5 X;  3BGR A;  5KRS A;  3DLH A;  4FJ5 A;  4CIE A;  4CEB A;  4ICL A;  1S1T A;  3TAF A;  2P5G A;  4IFV A;  1WSG A;  3AO1 A;  4M3Z A;  1RT7 A;  4NCB A;  2G8W A;  3OYA A;  4CGI A;  4J2A A;  3O3G A;  4FLU A;  1Y97 A;  4DU4 A;  3AV9 A;  4DU3 A;  3TR8 A;  5FRN A;  4G1Q A;  4RG8 A;  2OYQ A;  1A5V A;  3P83 D;  1UAX A;  4J2D A;  3NDK A;  4CJR A;  4BE2 A;  3KD1 E;  1S9G A;  1KCF A;  1UA1 A;  1U48 A;  3NF8 A;  1RBR A;  3RR7 A;  1WSE A;  4AHT A;  4O4G A;  4B9U A;  1BGX T;  1YT3 A;  4CJL A;  3OYC A;  3T3F A;  4F3O A;  2PZS A;  4FJK A;  2KFZ A;  3C94 A;  2KFN A;  5I42 A;  1RDA A;  2HB5 A;  1C1C A;  2HND A;  3KIO A;  4AHR A;  4OPK A;  4FK0 A;  3EYZ A;  4M42 A;  4W5N A;  2HHQ A;  4EP5 A;  1SKS A;  4CK2 A;  3QLH A;  5J1E A;  1WAJ A;  2HNZ A;  4FW2 A;  4O5B A;  4FW1 A;  3NH2 A;  3SQ2 A;  1LAV A;  3VQB A;  3JYT A;  4CGH A;  2W42 A;  3B6P A;  2VG6 A;  1FK9 A;  1LW0 A;  4BWM A;  4ELT A;  1LWE A;  3DOL A;  2YV0 X;  1KVC A;  3MEG A;  1XWL A;  4I9L A;  1RT2 A;  5DMR A;  1SKR A;  4IKF A;  4CF2 A;  3OYG A;  1HQU A;  1KLN A;  3L2U A;  1S9E A;  4B3O A;  3LAN A;  4C8K A;  3NGZ A;  2HW3 A;  1J53 A;  5C42 A;  1XI1 A;  4O55 A;  1T05 A;  3LPU A;  1SUQ A;  1WSI A;  4I7F A;  4KV8 A;  4BAC A;  4HTU A;  4Z4F A;  4B9N A;  3LWM A;  2OPQ A;  1IKV A;  3ULD A;  3V9X A;  4OGE A;  5HRN A;  1KSP A;  5HRP A;  1KRP A;  4CJE A;  1S1W A;  1Z26 A;  3KLE A;  3C95 A;  4N47 A;  1JKH A;  2FBY A;  3AVH A;  4CEE A;  3V1O A;  3S3N A;  4CHY A;  3ZCM A;  4CEQ A;  4CJW A;  1RTI A;  3ZSQ A;  1TL1 A;  4WE1 A;  1SL0 A;  1NKB A;  3DRR A;  3OYF A;  4M3Y A;  3TAN A;  3L8B A;  2IGI A;  4Y1C A;  3K57 A;  3VQ9 A;  1JLG A;  3ZSV A;  3THV A;  2OA8 A;  3IS9 A;  1TVR A;  4NYF A;  4CF1 A;  4Z4I A;  2QKB A;  1RDC A;  4DF8 A;  1S1X A;  1BIZ A;  1EKE A;  1HQE A;  1RTJ A;  4M3R A;  3PO4 A;  4F4K A;  2HVI A;  3QEW A;  4ELV A;  4DWI A;  4FJI A;  3PX6 A;  5I3U A;  1NJY A;  1JLC A;  4J2B A;  3K59 A;  4PQU A;  4KTQ A;  2PY5 A;  3LPT A;  3K2P A;  4OKK A;  4E7H A;  1IKX A;  3NCI A;  4DQS A;  1IKY A;  2QXF A;  1TV6 A;  2X6S A;  4N56 A;  4F3T A;  4ID5 A;  2IS3 A;  1Q9X A;  1WAF A;  3AVI A;  2D0C A;  5CYM A;  3V6D A;  3U3Y A;  4N41 A;  4CHN A;  3O3F A;  1CXU A;  1LW2 A;  4EZ6 A;  4KRE A;  4BDY A;  1S6P A;  1RTD A;  4FZZ A;  1ZYQ A;  2G8F A;  1T7P A;  3SJJ A;  3IRX A;  1BIS A;  2JGU A;  3TAM A;  3L2W A;  2D0A A;  3QIP A;  3AVG A;  3K5O A;  4B8C A;  2WON A;  1S5J A;  3DRS A;  1WLJ A;  1NK6 A;  4E7I A;  4LSL A;  4CEA A;  4RW9 A;  4M3X A;  2VWJ A;  2G8I A;  1NK5 A;  2IDO A;  4RW4 A;  4KB1 A;  4BE0 A;  1S1V A;  3HPH A;  4PA1 A;  3VN5 A;  1NK0 A;  3ZSR A;  3QEP A;  4Q0B A;  4OLA A;  2ETJ A;  1ZBL A;  3AVN A;  4F2R A;  2IAJ A;  2F96 A;  1CLQ A;  3CQ8 A;  3RTV A;  1D5A A;  1NK9 A;  1TGO A;  4LY7 A;  3M8P A;  4FJ7 A;  1ASW A;  2G8V A;  4CJF A;  4DMN A;  3D45 A;  4DSL A;  4FVM A;  3V1Q A;  4YFU A;  4DFK A;  3KJV A;  3VA0 A;  4HUE A;  1F21 A;  3LAL A;  4KHU A;  4M3T A;  3VQ7 A;  3SCX A;  2E6L A;  1HYS A;  3F73 A;  2Y1J A;  2AJQ A;  2D0B A;  2E4L A;  3T1A A;  2KW4 A;  5JS2 A;  4M3W A;  4E7J A;  2IOC A;  1B9D A;  4KHS A;  5KGX A;  3VQ6 A;  2KZM A;  3LP1 A;  3MED A;  3G0Z A;  4CJP A;  5HLF A;  4CJ3 A;  2OZS A;  1JLA A;  3TAR A;  4HCB A;  3DLG A;  4FJ9 A;  2OZM A;  1RIL A;  1KVA A;  3CM5 A;  2YHB A;  2GV9 A;  3VQC A;  1SV5 A;  1DLO A;  4J2E A;  2HHX A;  1QE1 A;  1S6Q A;  2YKM A;  4CGJ A;  1RDD A;  4FLV A;  1K6Y A;  4DTJ A;  4FM1 A;  2ZQB A;  1BIU A;  1C1B A;  4CER A;  4KI6 A;  4FLT A;  4DSF A;  3K58 A;  1YTU A;  3NGI A;  4CK3 A;  4FCY A;  2QK9 A;  1ZBH A;  4O44 A;  3OYD A;  1GOA A;  1N5Y A;  3DOK A;  3DMJ A;  4AH9 A;  4CFA A;  4BWJ A;  1QTM A;  1WSJ A;  2B6A A;  3SYZ A;  1RT5 A;  4QCL A;  1D9F A;  4R5P A;  3QEV A;  2KQ2 A;  3VQ5 A;  2DFH A;  3I0R A;  4AHV A;  4CGG A;  4FM0 A;  1RNH A;  1L3U A;  1WNS A;  3CM6 A;  2G8U A;  5E41 A;  3PX0 A;  4EP4 A;  4C8N A;  4CEO A;  2XY5 A;  1N6Q A;  4DFJ A;  3DLB A;  3SQ0 A;  2WOM A;  3HP9 A;  4DG1 A;  4NCA A;  4CEF A;  4OLB A;  1I3A A;  2EHG A;  3M8R A;  3WNE A;  1O1W A;  4KTW A;  3SV4 A;  1CZB A;  1RTH A;  1WN7 A;  3AA2 A;  4KHY A;  2P51 A;  1L3V A;  5FRM A;  4FYD A;  1RBV A;  3LZI A;  3SI6 A;  2ATQ A;  2FBX A;  3T19 A;  5CYQ A;  1BI4 A;  4BDP A;  3OVN A;  5K14 A;  4FJJ A;  3VQ8 A;  5CZ1 A;  3NHG A;  3D0P A;  4DFM A;  3LDS A;  4CJK A;  1ASV A;  3NH1 A;  5J2N A;  1GOB A;  3AVM A;  3AO4 A;  1FKO A;  4W5Q A;  4OKE A;  1UWB A;  3LP0 A;  4OVL A;  4CF8 A;  3KK2 A;  3VA3 A;  3RMD A;  1QHT A;  5C24 A;  1TKD A;  1D9D A;  4AHU A;  3DM2 A;  3WNH A;  4CIG A;  1TK0 A;  4HHT A;  1ITG A;  3RRH A;  4B9T A;  4B9L A;  4AIL C;  3RMA A;  1XHZ A;  3TAB A;  1RT1 A;  4EZ9 A;  4KO0 A;  2BAN A;  4CHZ A;  3V9S A;  1U4B A;  2FBT A;  2DY4 A;  3KLI A;  2DFE A;  2G8H A;  4CES A;  4DTO A;  1VSF A;  4IBN A;  3HL8 A;  2X6N A;  5KTQ A;  3ZT4 A;  1X9S A;  1NK8 A;  5D3G A;  2F8S A;  3SUN A;  5HRS A;  3VQA A;  2IC3 A;  3SQ4 A;  5DK5 A;  4KHQ A;  4DLG A;  2YNG A;  4CGF A;  3SUO A;  1B9F A;  3ZSW A;  4KPY A;  3CYM A;  3RRG A;  3QER A;  3PUF A;  2O4G A;  4HVJ A;  1ZBU A;  3NE6 A;  3S3O A;  3I8D A;  1SL1 A;  1JLQ A;  1RT3 A;  1LWC A;  1JXE A;  2I5J A;  4KRF A;  4N76 A;  3KLH A;  2Z1G A;  3EZ5 A;  3KD5 E;  5JS1 A;  1KLM A;  3NFA A;  3QES A;  1HMV A;  4PWD A;  2KTQ A;  4CGD A;  4KI4 A;  1B92 A;  1ASU A;  4GMJ B;  3OYH A;  4OJR A;  1RBU A;  2XY7 A;  2VG5 A;  4JLH A;  2R7Y A;  4NCG A;  4Z4G A;  4DU1 A;  1BCO A;  1CXQ A;  5SWM A;  2HHU A;  1BI4 B;  1VRU A;  3DI6 A;  3V4I A;  2Z1J A;  3OS2 A;  1G15 A;  3OYE A;  2DFF A;  4E3S A;  1QQC A;  4FXD A;  3C6U A;  3O3H A;  2X74 A;  3OYN A;  1R0A A;  4DQQ A;  3CFR A;  2JLE A;  3AVF A;  1JXB A;  2XY6 A;  4CEC A;  1Q9Y A;  2XY8 A;  1RT4 A;  4ZHR A;  3S9H A;  4ZTJ A;  3ZSY A;  4K8X A;  2Z1H A;  3ZT0 A;  4DTN A;  3HPG A;  4KKO A;  4PUO A;  5EU7 A;  3DLK A;  4I2P A;  2ZD1 A;  3QO9 A;  4IG3 A;  3OJS A;  4H8K A;  3ZT2 A;  4CJQ A;  3OY9 A;  4KFB A;  4DSK A;  1GOC A;  1JL2 A;  1RBS A;  3CG7 A;  4E1M A;  1TKZ A;  2NUB A;  1S1U A;  4B8A B;  4FK2 A;  3HVT A;  3QEX A;  3RMB A;  1VSE A;  1CZ9 A;  4GW6 A;  4KHW A;  3AVC A;  5J2P A;  3AVB A;  1YTA A;  3VQP A;  3RWU A;  4CED A;  1NK4 A;  3BDP A;  3HM9 A;  3V1R A;  3DYA A;  4DTX A;  4CFD A;  3LZJ A;  1NJX A;  3LWL A;  2Q3S A;  4YNQ A;  4DFP A;  1HJR A;  4H4M A;  2XHB A;  3QET A;  1VRT A;  4ZTF A;  4ELU A;  3HJF A;  2Y1I A;  3KLF A;  3KK3 A;  3TWH A;  1NJW A;  3SZ2 A;  4CFC A;  4F2S A;  2YNH A;  2D5R A;  1VSH A;  3F9K A;  5T7B A;  5HBM A;  1C0T A;  2X78 A;  3K5N A;  4CJ4 A;  3VQD A;  4CFB A;  2RKI A;  5CZ2 A;  5CY4 A;  3SUQ A;  1QSL A;  1VK0 A;  2FC0 A;  3ZSO A;  1HNV A;  1KVB A;  2GBZ A;  2ZE2 A;  3KKS A;  4AHS A;  2HHS A;  3VQE A;  2PYL A;  3UIQ A;  1EX4 A;  4IFY A;  1FXX A;  2E6M A;  3KTQ A;  1RBT A;  1U45 A;  4OPJ A;  1X1P A;  4DTS A;  4CF9 A;  3AO3 A;  3ALY A;  5KRT A;  4L8R B;  1TK8 A;  1TKX A;  3M8Q A;  4MQ3 A;  3AVJ A;  4O0J A;  2VWK A;  5FRO A;  1HNI A;  1TL3 A;  1A5X A;  4DF4 A;  4DLE A;  3U6F A;  3VQ4 A;  1NJZ A;  1X9W A;  4DTU A;  1NOY A;  1BHL A;  4Z4C A;  4K8Z A;  3V9U A;  1T03 A;  4C8O A;  1WSH A;  1TK5 A;  1ZBF A;  3OYJ A;  1W0H A;  1TKT A;  4CF0 A;  1JL1 A;  4CHP A;  1L5U A;  3M8S A;  3WNG A;  3K5M A;  3P1G A;  1VSJ A;  4MFB A;  3OYB A;  4O0I A;  2HHV A;  4CJV A;  3MEE A;  1QS4 A;  2PYJ A;  5KGW A;  1ZBI A;  4DTM A;  2BGG A;  3L2R A;  3PO5 A;  4C8L A;  1HRH A;  4M45 A;  3MXI A;  2QKK A;  1FKP A;  3DRP A;  1D8Y A;  2VG7 A;  4IDK A;  3QNN A;  1IKW A;  1Z25 A;  3HST B;  3LP2 A;  3LAK A;  1C6V A;  3L2V A;  2RN2 A;  3LP3 A;  3HT3 A;  3NF9 A;  3AVK A;  4Z4H A;  4CJS A;  1BCM A;  3G10 A;  1C1A A;  3ZSZ A;  3KLG A;  3V9W A;  4I9Q A;  1J9A A;  3C6T A;  4FJ8 A;  3NF6 A;  4FM2 A;  3A2F A;  1C0U A;  5FDL A;  3OYI A;  4W5O A;  4E7L A;  5SZT A;  4DTR A;  5HP1 A;  3MAQ A;  3KKR A;  1L3S A;  3QEI A;  4CHQ A;  2P1J A;  4E0D A;  4C8M A;  4OGC A;  3B6O A;  4W5T A;  4DQP A;  3L3V A;  4LH5 A;  4FZX C;  3TAG A;  4DS4 A;  3DLR A;  3L2Q A;  1X9M A;  3LAM A;  1Q8I A;  2YNI A;  5C25 A;  1J54 A;  2Z1I A;  3HYF A;  1VSM A;  4BE1 A;  2LSN A;  2OPS A;  4B9S A;  3HO1 A;  3QIO A;  2HHT A;  3NAE A;  3AA3 A;  3HVR A;  4DS5 A;  2HVH A;  3S3M A;  1U04 A;  3AVA A;  1T8E A;  3L3U A;  4XIU A;  3TAQ A;  3RR8 A;  4DSE A;  3TAE A;  1VSK A;  3AVL A;  4LD0 A;  1JLF A;  1I39 A;  4M41 A;  5J2Q A;  4N5S A;  3PX4 A;  5KI6 A;  1EP4 A;  3AO2 A;  4B9V A;  4DTP A;  4I2Q A;  3PY8 A;  1NKE A;  3TI0 A;  4UQG A;  4DSJ A;  1XHX A;  4PY5 A;  3ZT3 A;  4FLY A;  4CJT A;  1BL3 A;  1KFS A;  4OKJ A;  1LV5 A;  3EY1 A;  4JRQ A;  1QSS A;  4CIF A;  2YKN A;  4FLZ A;  1J5O A;  3ZT1 A;  3CFO A;  2XRI A;  3U3G A;  5HRR A;  3O4Q A;  4FLX A;  1HYV A;  4FJG A;  4W5R A;  1BQM A;  1W9H A;  3NF7 A;  4CHO A;  4BDZ A;  3P5J A;  3OYM A;  4QOZ B;  4CJ5 A;  4E1N A;  4CE9 A;  4JS5 A;  1UOC A;  3E01 A;  3NBP A;  4HCC A;  1HYZ A;  4M3U A;  4KHN A;  3I0S A;  4E7K A;  1U49 A;  4NYN A;  1WSF A;  1A5W A;  4Z0U A;  2BDP A;  3JSM A;  1NK7 A; 
#chains in the Genus database with same CATH topology
 4GVM A;  3E9L A;  2ZJP L;  3E9O A;  3HP6 A;  5AQG A;  4I6M B;  3DXM B;  4M63 C;  1HKG A;  1REV A;  1T44 A;  3OS0 A;  4LF4 K;  4K0K K;  5GAG P;  4CZE A;  3CET A;  3HSC A;  4CK1 A;  4RW6 A;  4KTZ A;  1MU2 A;  1MDU B;  4IG0 A;  3K5L A;  3QIN A;  1WB9 A;  5H1S Q;  3EL2 A;  3OJU A;  3TU5 A;  4Q5V A;  2EX3 A;  2Q36 A;  3CFP A;  3CCR N;  4E89 A;  4H4O A;  2O4I A;  5BRD A;  4CZL A;  1IH7 A;  4ILH A;  3J7Z O;  4FWO A;  4H0P A;  4FJL A;  1IO2 A;  1GLE G;  1L3T A;  4WQ5 C;  1RCH A;  3ASM A;  3RVC A;  4A5A A;  3HPO A;  5EX5 A;  1GLJ O;  3G25 A;  3ZEU A;  4IXC A;  5M1K A;  2HNY A;  4JAX A;  3V81 A;  3J81 O;  4JS4 A;  3NH0 A;  4FPA A;  1P90 A;  1S1T A;  1ATS A;  1BUP A;  3TAF A;  4M3Z A;  3AO1 A;  1RT7 A;  1NLV A;  4NCB A;  2G8W A;  2HBL A;  5BN8 A;  3F5T A;  5FPM A;  1NM1 A;  4G1Q A;  3M3Z A;  1A5V A;  5F2R A;  1DEJ A;  3P39 A;  3ZET B;  3NF8 A;  2QTD A;  4AHT A;  1BGX T;  3T3F A;  4C1N I;  2KFZ A;  4H0X B;  1RGI A;  1KAY A;  1Q81 O;  1KXP A;  4O5B A;  4FW1 A;  2W42 A;  3B6P A;  2VG6 A;  1FK9 A;  3GOI A;  4ELT A;  4FWL A;  1LWE A;  1NGB A;  5C15 A;  3DOL A;  5DMR A;  2P9S A;  4A2A A;  3IMX A;  3VEZ A;  1HQU A;  3LM2 A;  3T7Z A;  1S9E A;  4WCE L;  4X64 K;  4DR4 K;  5C42 A;  1XI1 A;  4O55 A;  3LPU A;  4I7F A;  4KV8 A;  4LC9 B;  2KHO A;  3CJA A;  4B9N A;  3TSP A;  4KH4 A;  5HRP A;  4CJE A;  4CEE A;  4N47 A;  1JKH A;  3AVH A;  3ULE A;  3ATU A;  3S3N A;  2QW9 A;  1YIT N;  4DV2 K;  4CEQ A;  4DR3 K;  3D2F B;  1EO1 A;  3TAN A;  3K57 A;  3U4L A;  3VF6 A;  1JLG A;  5BR8 K;  5HOO A;  1BIZ A;  1HQE A;  4M3R A;  3UE5 A;  4F4K A;  2ASP A;  4PQU A;  3K59 A;  4KTQ A;  2PY5 A;  1T3V A;  4E7H A;  1NGD A;  1IG8 A;  4DQS A;  1QVG M;  1IKY A;  4F3T A;  3TPQ A;  1YIJ N;  1Q9X A;  3CXC M;  3P38 A;  4N41 A;  2NRX A;  4BDY A;  3D2F A;  2J4R A;  3HBT A;  3L2W A;  3AVG A;  3TSQ A;  4CEA A;  2G8I A;  2IDO A;  2QWL A;  1HR0 K;  4BC3 A;  1S1V A;  2YJF A;  4OLA A;  2ETJ A;  1ZBL A;  2IAJ A;  2F96 A;  1NGH A;  3UKR A;  1VQ9 N;  2CGJ A;  3U9D A;  3MN7 A;  1TGO A;  3M8P A;  4XH4 A;  4FO0 A;  2HBJ A;  2G8V A;  2EWS A;  3D45 A;  3L4Q A;  4FVM A;  3EEQ A;  2QA4 N;  1F21 A;  1EWR A;  3IFR A;  2O8F B;  4IOA L;  1HX1 A;  3L4I A;  3T1A A;  2KW4 A;  1IJJ A;  2IOC A;  5GAH P;  1HLU A;  1G99 A;  1IBM K;  3C6H A;  4KBO A;  3MX5 A;  5AQY A;  1Q18 A;  4K43 A;  1KVA A;  1WUA A;  1T6D A;  1SV5 A;  4JKD A;  4DUZ K;  4BG9 A;  4CGJ A;  4OPH A;  3SAF A;  3K58 A;  3O08 A;  3NGI A;  4FCY A;  1ZBH A;  3G4S N;  3OYD A;  1N5Y A;  3QDK A;  3U9Z A;  3AAR A;  4QCL A;  3QEV A;  4AHV A;  1RNH A;  2O8B A;  1WNS A;  2G8U A;  3KHY A;  2HST A;  3KWI A;  5E41 A;  3PX0 A;  3HM8 A;  3OW2 M;  3DLB A;  2WOM A;  4NCA A;  4LF6 K;  4OLB A;  4PKI A;  4CZK A;  3SV4 A;  4F9O A;  3SBG A;  4H03 B;  3SI6 A;  1MA9 B;  2ATQ A;  4GVE A;  1N33 K;  1YVN A;  1NBW A;  4GNI A;  4PHT X;  4FJJ A;  3FR0 A;  3VQ8 A;  3LDS A;  5ADX A;  2BH1 A;  5J2N A;  4W5Q A;  3ZLJ A;  2HF3 A;  4OVL A;  3WNH A;  4CIG A;  2ZJQ L;  4M7Y A;  3RMA A;  5KQD A;  4EZ9 A;  2BAN A;  3DXK B;  4CHZ A;  1U4B A;  3KLI A;  1NU0 A;  1K8K B;  2DFE A;  2GEM A;  3H1V X;  1NK8 A;  5D3G A;  4BRQ A;  2F8S A;  2VQE K;  3VQA A;  3MN6 A;  3I56 N;  1B9F A;  3ZSW A;  4YY3 K;  3CYM A;  3RRG A;  3LDN A;  2P9S B;  3THY B;  4JKA A;  4NB4 A;  3SMP A;  3I8D A;  1RT3 A;  4KRF A;  2RE2 A;  3VER A;  1K73 O;  3BF3 A;  1XMQ K;  3OYH A;  3A5L C;  3CER A;  3DXK A;  1BCO A;  2IIR A;  4X62 K;  4BGB A;  1G15 A;  2P9K A;  2WTU A;  3VEO A;  4WQ4 C;  5C2D A;  1Q9Y A;  2XY8 A;  1VHX A;  4OX9 K;  3H46 O;  3ZSY A;  4K8X A;  3U8X A;  2P9U B;  4DTN A;  2O8D A;  4I2P A;  3QBX A;  3OJS A;  4H8K A;  4KFB A;  4DSK A;  2NUB A;  4XH5 A;  2QWQ A;  4ILG B;  4B8A B;  4H0V B;  4CZM A;  3RMB A;  4FL9 A;  4OPA A;  1CZ9 A;  3AVC A;  3O1W A;  3AVB A;  3FZH A;  3MK6 A;  1NK4 A;  2HOE A;  3LZJ A;  1NJX A;  3WQT A;  3LWL A;  2Q3S A;  4ELU A;  1GLA G;  2NLX A;  1VRT A;  4DV5 K;  3VES A;  2YNH A;  2ASM A;  3D2E B;  1WBB A;  1VSH A;  4JI4 K;  4FWQ A;  3K5N A;  4DB3 A;  2P9P B;  2RKI A;  1QSL A;  2NRV A;  4UY8 O;  3WQU A;  3VTI A;  1X1P A;  4DTS A;  4BRK A;  3CCV N;  1Q86 O;  4CZG A;  1TK8 A;  1TL3 A;  3U6F A;  1A5X A;  4J2D A;  3VQ4 A;  1BHL A;  5M1P A;  5LL6 Z;  1ZBF A;  3OYJ A;  4CHP A;  2ASO A;  3WNG A;  4BRF A;  3P1G A;  1XC3 A;  5AQX A;  5C10 A;  3MMV A;  4CJV A;  1QS4 A;  1ZBI A;  5CE3 A;  3PO5 A;  1HRH A;  4M45 A;  3HZ6 A;  1Z25 A;  1N32 K;  3HST B;  3L2V A;  2RN2 A;  1NGJ A;  3AVK A;  1BCM A;  3G10 A;  1C1A A;  1J9A A;  3C6T A;  4PKH A;  1QVF M;  4R79 A;  3OYI A;  2FSN A;  3A5M C;  2BTF A;  3OBW A;  1EWQ A;  3QEI A;  4CHQ A;  4IWV A;  4C8M A;  4DQP A;  4FZX C;  4LH5 A;  4JI2 K;  3DLR A;  1M1K O;  5C25 A;  1VSM A;  2OPS A;  3FZM A;  4B9S A;  3HO1 A;  3NAE A;  4BR2 A;  2NRH A;  3RR8 A;  1JLF A;  3PX4 A;  2H3G X;  1EP4 A;  5TKY A;  3AO2 A;  3PY8 A;  3TI0 A;  4IEE A;  1H1V A;  1XHX A;  3ZT3 A;  4CJT A;  1S3X A;  4OKJ A;  1QSS A;  5M1O A;  5AQK A;  2YKN A;  3GBT A;  3CFO A;  3U3G A;  1ZBS A;  5HRR A;  3H6E A;  1HYV A;  4FLX A;  3THW A;  4FJG A;  3TTF A;  4E1N A;  3E01 A;  4HCC A;  1HYZ A;  4LF9 K;  3A0I X;  4KHN A;  3THX A;  1XQS C;  4CW7 B;  3JSM A;  1RDB A;  3VGL A;  2RPI A;  4HUG A;  5BPL A;  4B9M A;  4JI0 K;  1DTT A;  4Y0W A;  1TAQ A;  4F8R A;  4B3R K;  3AAP A;  3KK1 A;  4H0T B;  5JVH L;  5AQJ A;  2QWR A;  1EET A;  5BRE A;  4B1U B;  1BQN A;  2NNW A;  2V52 B;  1KAX A;  3CIP A;  4AHC A;  5AQQ A;  4JI6 K;  3HXM A;  2F8T A;  5B8H A;  1HPZ A;  2A1S A;  5GAE P;  4FJH A;  3CJ7 A;  1WBD A;  3QFU A;  4WFN L;  2ZJR L;  3RMC A;  5LY3 A;  5AQF A;  1NKC A;  2D4W A;  3AO5 A;  4B08 A;  3WNF A;  1IG9 A;  4JKG A;  1U47 A;  1KFD A;  2XO7 A;  4AM7 A;  2B5J A;  2OPP A;  1VQ5 N;  4A57 A;  1XUP O;  4DQI A;  2KZZ A;  2P9K B;  1SZ2 A;  3EO3 A;  4FZY A;  5EY4 A;  2W40 A;  2E2Q A;  3AA5 X;  3BGR A;  4FJ5 A;  4CIE A;  4CEB A;  4ICL A;  2P5G A;  4IFV A;  1WSG A;  3EE9 A;  3OYA A;  4J2A A;  4AM6 A;  2E1Z A;  1Y97 A;  3AV9 A;  2YX6 A;  3EN9 A;  2Q0R A;  4BRE A;  4ISG A;  3NDK A;  3L0Q A;  4YOR A;  4BE2 A;  1QQO A;  1KCF A;  1VQ8 N;  4JKH A;  1U48 A;  1RBR A;  4FWN A;  4YOX A;  3ATV A;  4CJL A;  2PZS A;  4FJK A;  1SQK A;  4FOI A;  3DLL L;  2KFN A;  1RDA A;  2HB5 A;  3O8M A;  4W5N A;  1KD1 O;  3EYZ A;  4M42 A;  5GIN A;  4B1Y B;  1WAJ A;  2HNZ A;  2OCE A;  4FW2 A;  3SQ2 A;  3JYT A;  4CGH A;  3RSE A;  3QFP A;  4BWM A;  3MEG A;  1X3N A;  5LMN K;  4IKF A;  4CF2 A;  3WUH A;  3THX B;  2RHK A;  4B3O A;  3LAN A;  2F9T A;  4C8K A;  3NGZ A;  1T05 A;  2QWN A;  4U7B A;  4HTU A;  4DCH A;  2ZF5 O;  3LWM A;  1IKV A;  2A5X A;  4IOX A;  4OGE A;  1KRP A;  3QBW A;  4B9Q A;  1Z26 A;  4BRG A;  3C95 A;  2FBY A;  3V1O A;  5DM7 L;  1GLC G;  4CHY A;  5EXW A;  3ZCM A;  4PKG A;  3ZSQ A;  1SS6 A;  1TL1 A;  1NKB A;  4M3Y A;  2P9P A;  5JIC A;  3MX2 A;  4Y1C A;  3HOT A;  4BRM A;  4PL8 A;  3IS9 A;  1JCE A;  1TVR A;  2ZGZ A;  1RDC A;  4DF8 A;  1EKE A;  1RTJ A;  2HVI A;  4AF1 A;  4ELV A;  1SAZ A;  3PX6 A;  3WXM B;  1Q7Y O;  4J2B A;  1LOT B;  3LPT A;  1IKX A;  3VEY A;  4A2B A;  3AGR A;  3NCI A;  2X6S A;  4N56 A;  1TV6 A;  4ID5 A;  2IS3 A;  1WAF A;  3ZET A;  3U3Y A;  1LW2 A;  1Z05 A;  1S6P A;  4FZZ A;  1ZYQ A;  1BIS A;  3TAM A;  5AZJ B;  3VF4 A;  1S5J A;  3DRS A;  4E7I A;  4BQZ A;  4B3S K;  2VWJ A;  3F2K A;  4KB1 A;  3K0S A;  4BE0 A;  5AQU A;  3HPH A;  3VGM A;  1YAG A;  2DPN A;  3O9R A;  1CLQ A;  3CJ9 A;  5LJW A;  3UKU B;  4DR6 K;  1VQ6 N;  1ASW A;  5GIP A;  3OHR A;  3CQX A;  4CJF A;  4DMN A;  4CBW A;  4BR7 A;  4DSL A;  1JCG A;  4KHU A;  3HRG A;  4CZI A;  2P9L A;  2Y1J A;  2VWB A;  3C7N B;  2E4L A;  3CPW M;  5F0X A;  3FZL A;  1KAZ A;  4CJ3 A;  1JLA A;  3TAR A;  3R6M A;  3DLG A;  4CBX A;  3CM5 A;  2OZM A;  2YHB A;  4BG8 A;  1DLO A;  1QE1 A;  2VCP A;  2E2O A;  3UB5 A;  4YHH K;  3C7N A;  2WUS A;  3E1Y A;  3ZEU B;  4V19 S;  4Z94 A;  4ISE A;  4BC5 A;  1GOA A;  3DMJ A;  5FPE A;  4BWJ A;  1QTM A;  2B6A A;  1D9F A;  4R5P A;  1HKC A;  3VQ5 A;  4CGG A;  1JJ2 M;  4JKF A;  4WYB A;  4EP4 A;  4C8N A;  1N6Q A;  1KC8 O;  4DFJ A;  1R59 O;  3HP9 A;  4DG1 A;  3SQ0 A;  4FWK A;  3M8R A;  2W6L A;  1O1W A;  1CZB A;  3FFK B;  5FRM A;  1RBV A;  3LZI A;  1TUU A;  3T19 A;  1OKJ A;  5AQS A;  4BDP A;  3CCM N;  2O8E B;  4DFM A;  3NHG A;  4YOT A;  3KK7 A;  4CJK A;  3CJ1 A;  3I33 A;  3AVM A;  3LP0 A;  4CF8 A;  3KK2 A;  3VA3 A;  3LDQ A;  5LJV A;  3DM2 A;  4HHT A;  4B9L A;  5C2F A;  3SK3 A;  4BQL A;  4GV3 A;  3N4P A;  3VET A;  1NJI O;  4IBN A;  3ZX2 A;  3HL8 A;  4DV6 K;  4X66 K;  1VQN N;  3C65 A;  2IC3 A;  4KHQ A;  5ADX H;  3WXI A;  2YNG A;  4DLG A;  4KPY A;  3QER A;  3S3O A;  4HVJ A;  3H45 C;  3CQY A;  2F4V K;  1IBK K;  4N76 A;  3EZ5 A;  3QES A;  4JHD B;  4XH1 A;  1HMV A;  4PWD A;  1J5E K;  3SJH A;  4KI4 A;  4OJR A;  1VQO N;  2VG5 A;  1NNE A;  2QM1 A;  1Y64 A;  1CXQ A;  3LM9 A;  2FSK A;  2HHU A;  3ZYY X;  1QQC A;  3OYN A;  3CFR A;  1OH7 A;  1BDG A;  4JK8 A;  1JXB A;  1OH6 A;  4ZTJ A;  2FF6 A;  2Z1H A;  3HPG A;  3E9P A;  2D0O A;  3QO9 A;  2GWJ A;  3CG7 A;  4NLC A;  1S1U A;  3HVT A;  1BWF O;  4DKW A;  1U6Z A;  3J7Y P;  3BDP A;  4CVN E;  3HM9 A;  1T6C A;  3DYA A;  5EVZ A;  4DTX A;  2ZGY A;  4YNQ A;  1HJR A;  2XHB A;  3QET A;  2Y1I A;  3KK3 A;  3TWH A;  1NJW A;  3SZ2 A;  3H3N O;  4F2S A;  3I55 N;  3F9K A;  4LF7 K;  4BRH A;  4CJ4 A;  3R9P A;  3LDL A;  4CFB A;  5CZ2 A;  4FSV A;  3SUQ A;  3IKM A;  2FC0 A;  3ZSO A;  2ZE2 A;  3KKS A;  4AHS A;  3VQE A;  3VGK A;  4E1J A;  2YHW A;  3GE1 A;  2O8F A;  4DV7 K;  2YHY A;  4CBU A;  1U45 A;  4CF9 A;  4L8R B;  3BP8 A;  1TKX A;  4JKC A;  1X9W A;  3VEW A;  1NJZ A;  4DTU A;  2I7P A;  4K8Z A;  4JKE A;  4C8O A;  1W0H A;  1TKT A;  1TUY A;  1JL1 A;  4CF0 A;  3M8S A;  3K5M A;  3OYB A;  4O0I A;  2HHV A;  5LMU K;  3K9K A;  5KGW A;  3MDQ A;  4DTM A;  4C8L A;  2QKK A;  1E4F T;  3DRP A;  4WF9 L;  5AR0 A;  3RSE B;  1IKW A;  3W3D A;  5A2Q O;  3C0B A;  3LAK A;  1C6V A;  2YJE A;  3HT3 A;  2HMP A;  4CJS A;  4I9Q A;  4YOU A;  3O9T A;  3NF6 A;  1C0U A;  5FDL A;  4E7L A;  4W5O A;  4DTR A;  1S72 N;  3MAQ A;  4W5T A;  3B6O A;  2QWP A;  3TAG A;  3THW B;  1NMD A;  3GG4 A;  2YNI A;  1J54 A;  2Z1I A;  3HYF A;  4DUY K;  3CCL N;  1YUW A;  1W97 L;  4A59 A;  3S3M A;  4XIU A;  3D2E A;  3QB0 A;  4LD0 A;  4N5S A;  5KI6 A;  4B9V A;  4I2Q A;  3PIO L;  4U67 L;  2KKZ A;  4PY5 A;  2BUP A;  5C0Y A;  4FLY A;  1BL3 A;  1MWM A;  3EY1 A;  2Q97 A;  3AGK A;  3R1X A;  2XRI A;  2FF3 B;  4RWT A;  4LFB K;  1X3M A;  5AQP A;  2PFU A;  3NBP A;  4BR9 A;  2QEX N;  3Q7C A;  5TKW A;  1A5W A;  3CC2 N;  2E5L K;  3ENH A;  4BRP A;  3MXJ A;  5HL7 L;  4YOY A;  4MLH A;  1TAU A;  4Z4E A;  4BY9 C;  3CJB A;  1EXQ A;  4KH6 A;  3F9M A;  3KVG A;  1HUX A;  4A62 A;  4FK4 A;  1Z6R A;  3QNO A;  3HI0 A;  4BVO A;  4JK9 A;  1GLB G;  3S41 A;  2P5O A;  2BE2 A;  1V4T A;  3SQ1 A;  1LWF A;  3MEC A;  1LAW A;  1YJW N;  3WXJ A;  3M5R A;  3ZSX A;  1VSD A;  2YHX A;  3ISN C;  3P31 A;  2NRZ A;  3ITH A;  3V9Z A;  3OYK A;  1NOZ A;  4CZH A;  3MWP A;  3ENO A;  2RF2 A;  4B1X B;  4FJM A;  1VQ7 N;  3NGY A;  2NRT A;  2G8K A;  3H08 A;  3FFI A;  1C0M A;  3OTO K;  2Q0U A;  4HUF A;  4BRI A;  1FW6 A;  3MXM A;  1SKW A;  4DSI A;  1DTQ A;  3CCE N;  1RDW X;  4CJU A;  1JLB A;  1JLE A;  1NGI A;  3DLE A;  3SNN A;  4BC4 A;  3SPY A;  3CJC A;  5AQW A;  2A1R A;  3FZF A;  4CEZ A;  1YVU A;  2GWK A;  4WQ5 A;  1RDU A;  1HPM A;  5KPT A;  2NRW A;  3VQQ A;  2PAV A;  3DLH A;  4CJ7 A;  3J7A P;  2D0P A;  3MN9 A;  4YOV A;  4H5N A;  4CGI A;  3O3G A;  5BPN A;  3PIP L;  4DU4 A;  3TR8 A;  3BZK A;  5CHI A;  4RG8 A;  3P83 D;  4MDB A;  4CJR A;  3RR7 A;  1WSE A;  4O4G A;  4B9U A;  1YT3 A;  5FPN A;  3OYC A;  5KPZ A;  1XNR K;  3C94 A;  5M1Q A;  5I42 A;  4FK0 A;  3KIO A;  2HND A;  4AHR A;  3O9Q A;  2HHQ A;  4FOE A;  2CH5 A;  1SKS A;  3QLH A;  3A5N C;  3NH2 A;  3VQB A;  2WBN A;  4IJN A;  4BRC A;  4BVP A;  1KVC A;  4I9L A;  1RT2 A;  4YDU C;  1SKR A;  3OBY A;  2CGL A;  4MO4 A;  5AQV A;  1J53 A;  4FPB A;  2WC9 A;  1NGA A;  1WSI A;  2CH6 A;  4BAC A;  1QZ6 A;  2E2N A;  2OPQ A;  4CD3 A;  4LF8 K;  4EFH A;  5HRN A;  1KSP A;  3KLE A;  3UKR B;  3IUC A;  1OH5 A;  4H5R A;  4NXM K;  1RTI A;  1WOQ A;  3DRR A;  3GL1 A;  4JEP A;  3L8B A;  3ZSV A;  3THV A;  2OA8 A;  4NYF A;  4Z4I A;  4CF1 A;  1S1X A;  2V51 B;  3H1Q A;  1DKG D;  1DT9 A;  5M1N A;  3QEW A;  4FJI A;  1NJY A;  3AAQ A;  3WT0 A;  1I94 K;  1P8Z A;  2QI2 A;  5CYM A;  4C23 A;  1YI2 N;  4FWS A;  3O3F A;  4CI6 A;  4EZ6 A;  2O8B B;  1NWK A;  4BR4 A;  1RTD A;  2G8F A;  5AQZ A;  2JGU A;  3SBT A;  3ULE B;  2WON A;  1WLJ A;  2P9U A;  2O8D B;  4LSL A;  4RW9 A;  2UXC K;  5GIO A;  4RW4 A;  1NK5 A;  4BRO A;  3ZSR A;  4Q0B A;  4F2R A;  3CQ8 A;  4EAH D;  5AZI A;  5F1X A;  4A61 A;  4LY7 A;  1N36 K;  2CGK A;  1TYQ A;  4JHD A;  3V1Q A;  4YFU A;  1RFQ A;  3LAL A;  4M3T A;  1LCU A;  3VQ7 A;  3SCX A;  3K9J A;  2E6L A;  1HYS A;  3THY A;  5JS2 A;  1B9D A;  4KHS A;  5KGX A;  3CHW A;  3LP1 A;  3MED A;  5HLF A;  4CJP A;  2OZS A;  4RCH A;  3VQC A;  4J2E A;  2HHX A;  4IDH A;  1YXQ A;  1RDD A;  2ZQB A;  1BIU A;  4CER A;  4KI6 A;  4FLT A;  2V7Z A;  2ZWH A;  3CF5 L;  1VQP N;  4AH9 A;  3DAW A;  3PLA A;  3SYZ A;  4DV0 K;  4FM0 A;  2DFH A;  1L3U A;  1QZ5 A;  2GX9 A;  5EOY A;  2A40 A;  4CEF A;  1I3A A;  1YF5 L;  5AFU A;  3WNE A;  2E20 A;  4KTW A;  1WN7 A;  4RTF D;  5KPR A;  3L6Q A;  4KHY A;  2P51 A;  3NVM A;  2HBK A;  2FBX A;  3CPE A;  1YHQ N;  3LDO A;  3OVN A;  4MLE A;  3WEE A;  3ID8 A;  1ASV A;  3NH1 A;  1GOB A;  1FKO A;  4OKE A;  3MN5 A;  4B3M K;  1D9D A;  1NMN A;  1QHT A;  2A42 A;  5C24 A;  1FJG K;  1ITG A;  4NLB A;  4BRA A;  4DV1 K;  1XHZ A;  3TAB A;  1ZXO A;  3D6R A;  3V9S A;  2E1Y A;  2FBT A;  4JNE A;  2DY4 A;  2G8H A;  1VSF A;  5KTQ A;  4QS7 A;  3ZT4 A;  1C0F A;  3SUN A;  3DXM A;  3SQ4 A;  5DK5 A;  4DV3 K;  4CGF A;  3PUF A;  3NE6 A;  1SL1 A;  2I5J A;  1LWC A;  1JXE A;  5AQI A;  3CCJ N;  1HNX K;  3NFA A;  1NGG A;  3BUZ B;  2KTQ A;  4LF5 K;  1B92 A;  4GMJ B;  1K8K A;  3OA9 A;  4B1W B;  2R7Y A;  4NCG A;  2GTD A;  2V7Y A;  4DU1 A;  3BZC A;  1BI4 B;  1VRU A;  3DI6 A;  4K41 A;  3SAH A;  3V4I A;  3OYE A;  2DFF A;  4E3S A;  3C6U A;  2X74 A;  2Q1N A;  4WQ4 A;  3AVF A;  1CZA N;  2XY6 A;  1VAZ A;  3LDP A;  4CEC A;  3S9H A;  4KKO A;  4PUO A;  3DLK A;  4BRD A;  4IG3 A;  3ZT2 A;  4CJQ A;  3OY9 A;  4IZ9 A;  3VF2 A;  4FK2 A;  3M6G A;  1VSE A;  4GW6 A;  4KHW A;  1YTA A;  3VQP A;  1E3M A;  3H3O B;  2OTJ N;  4NO7 A;  4DFP A;  1D4X A;  4H4M A;  2VQF K;  3HJF A;  4FWP A;  1U2V A;  1DGK N;  3CCS N;  4CFC A;  2FXU A;  5T7B A;  1C0T A;  3VQD A;  3O80 A;  1VK0 A;  3JXU A;  1ATR A;  2GBZ A;  3GDQ A;  3EE8 A;  4OO1 J;  2HHS A;  2PYL A;  3UIQ A;  3KTQ A;  2E6M A;  1RBT A;  3AO3 A;  4MQ3 A;  3AVJ A;  5FRO A;  2VWK A;  1HNI A;  4CZF A;  1NOY A;  4DLE A;  3WXK A;  4NXN K;  1K8A O;  3V9U A;  3QML A;  4O5F A;  5AQO A;  3O5B A;  2P9L B;  3ZX0 A;  1L5U A;  1NGE A;  3BF1 A;  5BRF A;  2UXB K;  4MFB A;  1V4S A;  1N8R O;  3VMF B;  2VG7 A;  2IVO A;  4IDK A;  2F7T A;  4C1N K;  3CC7 N;  3NF9 A;  4Z4H A;  4BGA A;  3ZSZ A;  3KLG A;  3V9W A;  3A2F A;  4IO8 A;  3EKS A;  4LFA K;  5HP1 A;  5SZT A;  3KKR A;  4LFC K;  1L3S A;  2P1J A;  4B3T K;  3L3V A;  2OAN A;  5AQR A;  4DS4 A;  1NG9 A;  3LAM A;  1Q8I A;  4BE1 A;  3A8Y A;  3BEX A;  5MLC Q;  2LSN A;  2O8E A;  2IVP A;  2HHT A;  1HKB A;  3AA3 A;  3HVR A;  4DS5 A;  3O9U A;  4DSE A;  1VSK A;  1GLD G;  1I39 A;  2P9N A;  4DTP A;  4QS8 A;  3VTH A;  1OVQ A;  1W7A A;  3FZK A;  3ZT1 A;  3CCU N;  4BRL A;  3CD6 N;  1BQM A;  4BDZ A;  3CI5 A;  4BC2 A;  5KQ8 A;  4ILJ A;  3B8A X;  3I0S A;  3LL3 A;  1U49 A;  1WSF A;  2BDP A;  3VEN A;  4Y1D A;  5AQN A;  1NK7 A;  4CD1 A;  1XMO K;  2F9W A;  3VEX A;  2FSJ A;  1J6Z A;  5JLF A;  3TAP A;  5E26 A;  3T69 A;  4JN4 A;  3PV8 A;  1VSI A;  5J2M A;  2ITG A;  3SUP A;  2DTU A;  2GUI A;  4E19 A;  4KHP K;  4QS9 A;  4YOW A;  3E66 A;  3OS1 A;  2OPR A;  3ZX3 A;  3HK2 A;  4RW7 A;  4DR1 K;  2A41 A;  2HMI A;  1ILY A;  1XC9 A;  3AA4 A;  1UA0 A;  1SL2 A;  2O8C A;  4KB0 A;  4ID1 A;  4DQR A;  1BO5 O;  3IDH A;  2HHH K;  4JRP A;  4JD2 A;  4CCH A;  4JI8 K;  4JV5 K;  1HJO A;  4WFA L;  2ITM A;  4LSN A;  3IAY A;  3J80 O;  4H5W A;  4FJN A;  4LH4 A;  4QAG A;  4FWM A;  3CC4 N;  3SMS A;  5JLH A;  3IG1 A;  4ISF A;  5BN9 A;  2B4J A;  5FPD A;  4O8K A;  3SPZ A;  2FBV A;  3SV3 A;  4FJX A;  3DWL A;  1IBL K;  4DR7 K;  5HRO A;  2YHA A;  3CCQ N;  4WFB L;  2UUB K;  3R3L A;  5M1F A;  1VSL A;  3MCA B;  2YNF A;  4JK7 A;  4RW8 A;  5BPM A;  3SAG A;  4TSX A;  1QSY A;  1S22 A;  1VQM N;  4KH5 A;  5AZI B;  3OYL A;  3MWT A;  1RT6 A;  4FLW A;  3VPZ A;  2HHW A;  4B1V A;  2NRR A;  3O4N A;  3CMA N;  1KTQ A;  1C0G A;  2QWM A;  4KAZ A;  5KRS A;  4A5B A;  1QQM A;  5AJ3 K;  1OH8 A;  4FLU A;  4DU3 A;  3TSU A;  5FRN A;  2OYQ A;  1UAX A;  3KD1 E;  1S9G A;  4IEI A;  1UA1 A;  2FLO A;  4F3O A;  3G6E N;  2WFB A;  4EHT A;  4OPK A;  1C1C A;  4J8F A;  4PL7 A;  4EP5 A;  4CK2 A;  3T1H K;  3QIC A;  5J1E A;  1LAV A;  4EIA A;  3NVK A;  1ESV A;  1LW0 A;  3A5O C;  5CR4 A;  4EHU A;  4GY2 B;  2YV0 X;  3P4I A;  1XWL A;  3OYG A;  1EQY A;  1KLN A;  3WEE B;  3L2U A;  2HW3 A;  4X65 K;  3EZW A;  1SUQ A;  4Z4F A;  5JMV A;  3ULD A;  3V9X A;  1S1W A;  2ZM6 K;  4CJW A;  3SLC A;  1SL0 A;  4WE1 A;  3OYF A;  2AA4 A;  1TYQ B;  2IGI A;  3VQ9 A;  4K42 A;  3NMU A;  2QKB A;  4DR2 K;  4BRN A;  5AZJ A;  3PO4 A;  1BG3 A;  4DQ8 A;  3Q7B A;  2HF4 A;  4DWI A;  4JI5 K;  5I3U A;  1JLC A;  2P9N B;  3C6A A;  3W0L A;  4OKK A;  3FLC O;  3K2P A;  3HOS A;  2QXF A;  3T1Y K;  1MWK A;  3AVI A;  2D0C A;  3V6D A;  4IJA A;  4CHN A;  3JS6 A;  1GLL O;  1CXU A;  1QQN A;  4JKG B;  4KRE A;  1X9J A;  1T7P A;  3SJJ A;  3IRX A;  2KLA A;  2D0A A;  3QIP A;  3K5O A;  4XEI A;  4B8C A;  2UU9 K;  1NK6 A;  2P9I B;  4M3X A;  2GUP A;  1BU6 O;  1NGC A;  4PA1 A;  3VN5 A;  1NK0 A;  4H0O A;  2QXL A;  3QEP A;  3AVN A;  3ENB A;  3RTV A;  1D5A A;  1E4G T;  1NK9 A;  2A6A A;  3ID6 A;  2UUA K;  4JI7 K;  2UYT A;  4FJ7 A;  2Q31 A;  1N34 K;  1NGF A;  2NZT A;  3HTV A;  2YCH A;  3TTD A;  4DFK A;  3KJV A;  3VA0 A;  4HUE A;  1W2B M;  4GV6 A;  1ZC6 A;  3F73 A;  2AJQ A;  2D0B A;  1YJN N;  4M3W A;  3O4W A;  4E7J A;  4H5T A;  4HWI A;  3VQ6 A;  2KZM A;  3G0Z A;  4JI1 K;  4HCB A;  4FJ9 A;  1RIL A;  2GV9 A;  2IVN A;  4IO9 L;  1S6Q A;  4M7X A;  2YKM A;  4FLV A;  1K6Y A;  4DTJ A;  4FM1 A;  1C1B A;  3R8E A;  1IV0 A;  1O13 A;  4DSF A;  5AQM A;  1YTU A;  4CK3 A;  2QK9 A;  1BOT O;  4O44 A;  3BY5 A;  4O8U A;  3DOK A;  3O1B A;  4CFA A;  4I6M A;  1WSJ A;  3UKU A;  1RT5 A;  4H5V A;  2KQ2 A;  3I0R A;  1XNQ K;  3CM6 A;  2XY5 A;  4CEO A;  2EHG A;  5AQH A;  1OVY A;  2E2P A;  1RTH A;  3AA2 A;  3O9S A;  1L3V A;  4FYD A;  1Q82 O;  5CYQ A;  1BI4 A;  5K14 A;  5CZ1 A;  2W6K A;  3D0P A;  3AO4 A;  3MCP A;  1UWB A;  1JCF A;  4CZJ A;  3RMD A;  1TKD A;  4AHU A;  1TK0 A;  4B9T A;  1HNZ K;  3M1F A;  4JD2 B;  3RRH A;  4AIL C;  4L3Q A;  1RT1 A;  5IT9 O;  4KO0 A;  4YDU A;  4DR5 K;  4JKB A;  4CES A;  4DTO A;  2X6N A;  1X9S A;  4FVU A;  2JWK A;  5AQL A;  5HRS A;  5JVG L;  2A3Z A;  1M90 O;  3SUO A;  1QHA A;  3PSF A;  2O4G A;  4Z4G A;  1ZBU A;  3JAM O;  1JLQ A;  3AY9 A;  3KLH A;  2D1K A;  2Z1G A;  3KD5 E;  5GAD P;  5JS1 A;  1KLM A;  4FWR A;  3PSI A;  3VOV A;  4CGD A;  1ASU A;  1U2V B;  5AFU H;  1RBU A;  5ELZ A;  5I9E B;  2XY7 A;  4JLH A;  1ATN A;  2VGM A;  5SWM A;  2OTL N;  5AQT A;  2Z1J A;  3OS2 A;  4FXD A;  3O3H A;  1R0A A;  4DQQ A;  2JLE A;  4ZHR A;  1RT4 A;  2JWL A;  2YI1 A;  4IFE A;  3ZT0 A;  5EU7 A;  3VEV A;  3CME N;  4BR0 A;  2ZD1 A;  1GOC A;  1JL2 A;  1RBS A;  2VYP A;  5FLX O;  1TKZ A;  4E1M A;  3QEX A;  3FGU A;  2HBM A;  4BR5 A;  5J2P A;  3WXL A;  3RWU A;  4CED A;  3V1R A;  4H0Y B;  4CFD A;  4GKJ K;  4ZTF A;  3KLF A;  1BA0 A;  2PBD A;  1VQL N;  2D5R A;  5HBM A;  1YJ9 N;  2X78 A;  2W41 A;  1VQ4 N;  2GEL A;  1GLF O;  3DJC A;  5CY4 A;  1VQK N;  5BR9 A;  1HNV A;  1KVB A;  4G9Z A;  1EX4 A;  4IFY A;  1FXX A;  3KZB A;  5BRH A;  4OPJ A;  4DV4 K;  3ALY A;  5KRT A;  3M8Q A;  4O0J A;  4DF4 A;  5IWA K;  4Z4C A;  1T03 A;  1WSH A;  2QWO A;  1TK5 A;  2I7N A;  3J8A A;  2O8C B;  4AQY K;  2AP1 A;  1VSJ A;  1K9M O;  2PYJ A;  3MEE A;  4MO5 A;  4JI3 K;  2BGG A;  3L2R A;  3MXI A;  1FKP A;  1D8Y A;  3FE1 A;  2UXD K;  3QNN A;  3LP2 A;  2VGN A;  3LP3 A;  5C12 A;  1HNW K;  5E84 A;  5DM6 L;  4FJ8 A;  4FM2 A;  2P9I A;  4MDA A;  4E0D A;  3KWG A;  4OGC A;  4JYA K;  3L2Q A;  1X9M A;  3QIO A;  4K25 A;  2HVH A;  1U04 A;  2Q2R A;  3AVA A;  1T8E A;  3L3U A;  3TAQ A;  3TAE A;  4DHY A;  2E8A A;  3AVL A;  2UUC K;  4M41 A;  5J2Q A;  2E88 A;  4HTL A;  3N4Q A;  3G71 N;  4GV9 A;  4GKK K;  3O6W A;  3TTC A;  1NKE A;  4UQG A;  4DSJ A;  3D7E O;  4B1Z A;  1KFS A;  1LV5 A;  4JRQ A;  4CIF A;  4IOC L;  4FLZ A;  1J5O A;  3O4Q A;  4W5R A;  1W9H A;  3NF7 A;  4CHO A;  3P5J A;  3OYM A;  1BA1 A;  4QOZ B;  4CJ5 A;  4CE9 A;  4JS5 A;  1UOC A;  4M3U A;  4E7K A;  3EKU A;  1KQS M;  3I8B A;  4NYN A;  4Z0U A; 
#chains in the Genus database with same CATH homology
 4Y1D A;  1RDB A;  4GVM A;  3MXJ A;  1TAU A;  2RPI A;  3TAP A;  4Z4E A;  4HUG A;  1VSI A;  5J2M A;  3PV8 A;  2ITG A;  3SUP A;  4B9M A;  2DTU A;  2GUI A;  4E19 A;  3HP6 A;  1DTT A;  1EXQ A;  3OS1 A;  4FK4 A;  2OPR A;  3HK2 A;  1TAQ A;  4RW7 A;  3QNO A;  4F8R A;  2HMI A;  1REV A;  3OS0 A;  3KK1 A;  1XC9 A;  2P5O A;  2BE2 A;  3AA4 A;  1UA0 A;  1SL2 A;  3SQ1 A;  1LWF A;  3MEC A;  1LAW A;  1EET A;  4CK1 A;  4KB0 A;  4ID1 A;  4RW6 A;  1BQN A;  4KTZ A;  1MU2 A;  4DQR A;  3ZSX A;  1VSD A;  3ISN C;  4IG0 A;  4AHC A;  3K5L A;  3ITH A;  3QIN A;  3V9Z A;  3OYK A;  1NOZ A;  4JRP A;  4CCH A;  3HXM A;  2RF2 A;  2F8T A;  4FJM A;  4LSN A;  3OJU A;  3NGY A;  3IAY A;  1HPZ A;  2A1S A;  4Q5V A;  2G8K A;  4FJH A;  3H08 A;  2EX3 A;  3FFI A;  4FJN A;  4LH4 A;  4QAG A;  3CFP A;  1C0M A;  3IG1 A;  3RMC A;  4E89 A;  2B4J A;  4H4O A;  2O4I A;  3SPZ A;  2FBV A;  3SV3 A;  4HUF A;  1NKC A;  4FJX A;  3AO5 A;  4B08 A;  5HRO A;  3MXM A;  1DTQ A;  3WNF A;  1IH7 A;  1SKW A;  1IG9 A;  4DSI A;  2YHA A;  1U47 A;  1KFD A;  2XO7 A;  2B5J A;  4CJU A;  2OPP A;  1JLB A;  1JLE A;  1VSL A;  2YNF A;  4RW8 A;  1QSY A;  4TSX A;  3DLE A;  4FJL A;  3SNN A;  3OYL A;  4DQI A;  2KZZ A;  3SPY A;  1IO2 A;  1RT6 A;  4FLW A;  1L3T A;  2A1R A;  1RCH A;  2HHW A;  3ASM A;  4CEZ A;  4FZY A;  1YVU A;  3HPO A;  2HNY A;  3O4N A;  3VQQ A;  3V81 A;  1KTQ A;  4JS4 A;  3NH0 A;  4KAZ A;  3AA5 X;  3BGR A;  5KRS A;  3DLH A;  4FJ5 A;  4CIE A;  4CEB A;  4ICL A;  1S1T A;  3TAF A;  2P5G A;  4IFV A;  1WSG A;  3AO1 A;  4M3Z A;  1RT7 A;  4NCB A;  2G8W A;  3OYA A;  4CGI A;  4J2A A;  3O3G A;  4FLU A;  1Y97 A;  4DU4 A;  3AV9 A;  4DU3 A;  3TR8 A;  5FRN A;  4G1Q A;  4RG8 A;  2OYQ A;  1A5V A;  3P83 D;  1UAX A;  4J2D A;  3NDK A;  4CJR A;  4BE2 A;  3KD1 E;  1S9G A;  1KCF A;  1UA1 A;  1U48 A;  3NF8 A;  1RBR A;  3RR7 A;  1WSE A;  4AHT A;  4O4G A;  4B9U A;  1BGX T;  1YT3 A;  4CJL A;  3OYC A;  3T3F A;  4F3O A;  2PZS A;  4FJK A;  2KFZ A;  3C94 A;  2KFN A;  5I42 A;  1RDA A;  2HB5 A;  1C1C A;  2HND A;  3KIO A;  4AHR A;  4OPK A;  4FK0 A;  3EYZ A;  4M42 A;  4W5N A;  2HHQ A;  4EP5 A;  1SKS A;  4CK2 A;  3QLH A;  5J1E A;  1WAJ A;  2HNZ A;  4FW2 A;  4O5B A;  4FW1 A;  3NH2 A;  3SQ2 A;  1LAV A;  3VQB A;  3JYT A;  4CGH A;  2W42 A;  3B6P A;  2VG6 A;  1FK9 A;  1LW0 A;  4BWM A;  4ELT A;  1LWE A;  3DOL A;  2YV0 X;  1KVC A;  3MEG A;  1XWL A;  4I9L A;  1RT2 A;  5DMR A;  1SKR A;  4IKF A;  4CF2 A;  3OYG A;  1HQU A;  1KLN A;  3L2U A;  1S9E A;  4B3O A;  3LAN A;  4C8K A;  3NGZ A;  2HW3 A;  1J53 A;  5C42 A;  1XI1 A;  4O55 A;  1T05 A;  3LPU A;  1SUQ A;  1WSI A;  4I7F A;  4KV8 A;  4BAC A;  4HTU A;  4Z4F A;  4B9N A;  3LWM A;  2OPQ A;  1IKV A;  3ULD A;  3V9X A;  4OGE A;  5HRN A;  1KSP A;  5HRP A;  1KRP A;  4CJE A;  1S1W A;  1Z26 A;  3KLE A;  3C95 A;  4N47 A;  1JKH A;  2FBY A;  3AVH A;  4CEE A;  3V1O A;  3S3N A;  4CHY A;  3ZCM A;  4CEQ A;  4CJW A;  1RTI A;  3ZSQ A;  1TL1 A;  4WE1 A;  1SL0 A;  1NKB A;  3DRR A;  3OYF A;  4M3Y A;  3TAN A;  3L8B A;  2IGI A;  4Y1C A;  3K57 A;  3VQ9 A;  1JLG A;  3ZSV A;  3THV A;  2OA8 A;  3IS9 A;  1TVR A;  4NYF A;  4CF1 A;  4Z4I A;  2QKB A;  1RDC A;  4DF8 A;  1S1X A;  1BIZ A;  1EKE A;  1HQE A;  1RTJ A;  4M3R A;  3PO4 A;  4F4K A;  2HVI A;  3QEW A;  4ELV A;  4DWI A;  4FJI A;  3PX6 A;  5I3U A;  1NJY A;  1JLC A;  4J2B A;  3K59 A;  4PQU A;  4KTQ A;  2PY5 A;  3LPT A;  3K2P A;  4OKK A;  4E7H A;  1IKX A;  3NCI A;  4DQS A;  1IKY A;  2QXF A;  1TV6 A;  2X6S A;  4N56 A;  4F3T A;  4ID5 A;  2IS3 A;  1Q9X A;  1WAF A;  3AVI A;  2D0C A;  5CYM A;  3V6D A;  3U3Y A;  4N41 A;  4CHN A;  3O3F A;  1CXU A;  1LW2 A;  4EZ6 A;  4KRE A;  4BDY A;  1S6P A;  1RTD A;  4FZZ A;  1ZYQ A;  2G8F A;  1T7P A;  3SJJ A;  3IRX A;  1BIS A;  2JGU A;  3TAM A;  3L2W A;  2D0A A;  3QIP A;  3AVG A;  3K5O A;  4B8C A;  2WON A;  1S5J A;  3DRS A;  1WLJ A;  1NK6 A;  4E7I A;  4LSL A;  4CEA A;  4RW9 A;  4M3X A;  2VWJ A;  2G8I A;  1NK5 A;  2IDO A;  4RW4 A;  4KB1 A;  4BE0 A;  1S1V A;  3HPH A;  4PA1 A;  3VN5 A;  1NK0 A;  3ZSR A;  3QEP A;  4Q0B A;  4OLA A;  2ETJ A;  1ZBL A;  3AVN A;  4F2R A;  2IAJ A;  2F96 A;  1CLQ A;  3CQ8 A;  3RTV A;  1D5A A;  1NK9 A;  1TGO A;  4LY7 A;  3M8P A;  4FJ7 A;  1ASW A;  2G8V A;  4CJF A;  4DMN A;  3D45 A;  4DSL A;  4FVM A;  3V1Q A;  4YFU A;  4DFK A;  3KJV A;  3VA0 A;  4HUE A;  1F21 A;  3LAL A;  4KHU A;  4M3T A;  3VQ7 A;  3SCX A;  2E6L A;  1HYS A;  3F73 A;  2Y1J A;  2AJQ A;  2D0B A;  2E4L A;  3T1A A;  2KW4 A;  5JS2 A;  4M3W A;  4E7J A;  2IOC A;  1B9D A;  4KHS A;  5KGX A;  3VQ6 A;  2KZM A;  3LP1 A;  3MED A;  3G0Z A;  4CJP A;  5HLF A;  4CJ3 A;  2OZS A;  1JLA A;  3TAR A;  4HCB A;  3DLG A;  4FJ9 A;  2OZM A;  1RIL A;  1KVA A;  3CM5 A;  2YHB A;  2GV9 A;  3VQC A;  1SV5 A;  1DLO A;  4J2E A;  2HHX A;  1QE1 A;  1S6Q A;  2YKM A;  4CGJ A;  1RDD A;  4FLV A;  1K6Y A;  4DTJ A;  4FM1 A;  2ZQB A;  1BIU A;  1C1B A;  4CER A;  4KI6 A;  4FLT A;  4DSF A;  3K58 A;  1YTU A;  3NGI A;  4CK3 A;  4FCY A;  2QK9 A;  1ZBH A;  4O44 A;  3OYD A;  1GOA A;  1N5Y A;  3DOK A;  3DMJ A;  4AH9 A;  4CFA A;  4BWJ A;  1QTM A;  1WSJ A;  2B6A A;  3SYZ A;  1RT5 A;  4QCL A;  1D9F A;  4R5P A;  3QEV A;  2KQ2 A;  3VQ5 A;  2DFH A;  3I0R A;  4AHV A;  4CGG A;  4FM0 A;  1RNH A;  1L3U A;  1WNS A;  3CM6 A;  2G8U A;  5E41 A;  3PX0 A;  4EP4 A;  4C8N A;  4CEO A;  2XY5 A;  1N6Q A;  4DFJ A;  3DLB A;  3SQ0 A;  2WOM A;  3HP9 A;  4DG1 A;  4NCA A;  4CEF A;  4OLB A;  1I3A A;  2EHG A;  3M8R A;  3WNE A;  1O1W A;  4KTW A;  3SV4 A;  1CZB A;  1RTH A;  1WN7 A;  3AA2 A;  4KHY A;  2P51 A;  1L3V A;  5FRM A;  4FYD A;  1RBV A;  3LZI A;  3SI6 A;  2ATQ A;  2FBX A;  3T19 A;  5CYQ A;  1BI4 A;  4BDP A;  3OVN A;  5K14 A;  4FJJ A;  3VQ8 A;  5CZ1 A;  3NHG A;  3D0P A;  4DFM A;  3LDS A;  4CJK A;  1ASV A;  3NH1 A;  5J2N A;  1GOB A;  3AVM A;  3AO4 A;  1FKO A;  4W5Q A;  4OKE A;  1UWB A;  3LP0 A;  4OVL A;  4CF8 A;  3KK2 A;  3VA3 A;  3RMD A;  1QHT A;  5C24 A;  1TKD A;  1D9D A;  4AHU A;  3DM2 A;  3WNH A;  4CIG A;  1TK0 A;  4HHT A;  1ITG A;  3RRH A;  4B9T A;  4B9L A;  4AIL C;  3RMA A;  1XHZ A;  3TAB A;  1RT1 A;  4EZ9 A;  4KO0 A;  2BAN A;  4CHZ A;  3V9S A;  1U4B A;  2FBT A;  2DY4 A;  3KLI A;  2DFE A;  2G8H A;  4CES A;  4DTO A;  1VSF A;  4IBN A;  3HL8 A;  2X6N A;  5KTQ A;  3ZT4 A;  1X9S A;  1NK8 A;  5D3G A;  2F8S A;  3SUN A;  5HRS A;  3VQA A;  2IC3 A;  3SQ4 A;  5DK5 A;  4KHQ A;  4DLG A;  2YNG A;  4CGF A;  3SUO A;  1B9F A;  3ZSW A;  4KPY A;  3CYM A;  3RRG A;  3QER A;  3PUF A;  2O4G A;  4HVJ A;  1ZBU A;  3NE6 A;  3S3O A;  3I8D A;  1SL1 A;  1JLQ A;  1RT3 A;  1LWC A;  1JXE A;  2I5J A;  4KRF A;  4N76 A;  3KLH A;  2Z1G A;  3EZ5 A;  3KD5 E;  5JS1 A;  1KLM A;  3NFA A;  3QES A;  1HMV A;  4PWD A;  2KTQ A;  4CGD A;  4KI4 A;  1B92 A;  1ASU A;  4GMJ B;  3OYH A;  4OJR A;  1RBU A;  2XY7 A;  2VG5 A;  4JLH A;  2R7Y A;  4NCG A;  4Z4G A;  4DU1 A;  1BCO A;  1CXQ A;  5SWM A;  2HHU A;  1BI4 B;  1VRU A;  3DI6 A;  3V4I A;  2Z1J A;  3OS2 A;  1G15 A;  3OYE A;  2DFF A;  4E3S A;  1QQC A;  4FXD A;  3C6U A;  3O3H A;  2X74 A;  3OYN A;  1R0A A;  4DQQ A;  3CFR A;  2JLE A;  3AVF A;  1JXB A;  2XY6 A;  4CEC A;  1Q9Y A;  2XY8 A;  1RT4 A;  4ZHR A;  3S9H A;  4ZTJ A;  3ZSY A;  4K8X A;  2Z1H A;  3ZT0 A;  4DTN A;  3HPG A;  4KKO A;  4PUO A;  5EU7 A;  3DLK A;  4I2P A;  2ZD1 A;  3QO9 A;  4IG3 A;  3OJS A;  4H8K A;  3ZT2 A;  4CJQ A;  3OY9 A;  4KFB A;  4DSK A;  1GOC A;  1JL2 A;  1RBS A;  3CG7 A;  4E1M A;  1TKZ A;  2NUB A;  1S1U A;  4B8A B;  4FK2 A;  3HVT A;  3QEX A;  3RMB A;  1VSE A;  1CZ9 A;  4GW6 A;  4KHW A;  3AVC A;  5J2P A;  3AVB A;  1YTA A;  3VQP A;  3RWU A;  4CED A;  1NK4 A;  3BDP A;  3HM9 A;  3V1R A;  3DYA A;  4DTX A;  4CFD A;  3LZJ A;  1NJX A;  3LWL A;  2Q3S A;  4YNQ A;  4DFP A;  1HJR A;  4H4M A;  2XHB A;  3QET A;  1VRT A;  4ZTF A;  4ELU A;  3HJF A;  2Y1I A;  3KLF A;  3KK3 A;  3TWH A;  1NJW A;  3SZ2 A;  4CFC A;  4F2S A;  2YNH A;  2D5R A;  1VSH A;  3F9K A;  5T7B A;  5HBM A;  1C0T A;  2X78 A;  3K5N A;  4CJ4 A;  3VQD A;  4CFB A;  2RKI A;  5CZ2 A;  5CY4 A;  3SUQ A;  1QSL A;  1VK0 A;  2FC0 A;  3ZSO A;  1HNV A;  1KVB A;  2GBZ A;  2ZE2 A;  3KKS A;  4AHS A;  2HHS A;  3VQE A;  2PYL A;  3UIQ A;  1EX4 A;  4IFY A;  1FXX A;  2E6M A;  3KTQ A;  1RBT A;  1U45 A;  4OPJ A;  1X1P A;  4DTS A;  4CF9 A;  3AO3 A;  3ALY A;  5KRT A;  4L8R B;  1TK8 A;  1TKX A;  3M8Q A;  4MQ3 A;  3AVJ A;  4O0J A;  2VWK A;  5FRO A;  1HNI A;  1TL3 A;  1A5X A;  4DF4 A;  4DLE A;  3U6F A;  3VQ4 A;  1NJZ A;  1X9W A;  4DTU A;  1NOY A;  1BHL A;  4Z4C A;  4K8Z A;  3V9U A;  1T03 A;  4C8O A;  1WSH A;  1TK5 A;  1ZBF A;  3OYJ A;  1W0H A;  1TKT A;  4CF0 A;  1JL1 A;  4CHP A;  1L5U A;  3M8S A;  3WNG A;  3K5M A;  3P1G A;  1VSJ A;  4MFB A;  3OYB A;  4O0I A;  2HHV A;  4CJV A;  3MEE A;  1QS4 A;  2PYJ A;  5KGW A;  1ZBI A;  4DTM A;  2BGG A;  3L2R A;  3PO5 A;  4C8L A;  1HRH A;  4M45 A;  3MXI A;  2QKK A;  1FKP A;  3DRP A;  1D8Y A;  2VG7 A;  4IDK A;  3QNN A;  1IKW A;  1Z25 A;  3HST B;  3LP2 A;  3LAK A;  1C6V A;  3L2V A;  2RN2 A;  3LP3 A;  3HT3 A;  3NF9 A;  3AVK A;  4Z4H A;  4CJS A;  1BCM A;  3G10 A;  1C1A A;  3ZSZ A;  3KLG A;  3V9W A;  4I9Q A;  1J9A A;  3C6T A;  4FJ8 A;  3NF6 A;  4FM2 A;  3A2F A;  1C0U A;  5FDL A;  3OYI A;  4W5O A;  4E7L A;  5SZT A;  4DTR A;  5HP1 A;  3MAQ A;  3KKR A;  1L3S A;  3QEI A;  4CHQ A;  2P1J A;  4E0D A;  4C8M A;  4OGC A;  3B6O A;  4W5T A;  4DQP A;  3L3V A;  4LH5 A;  4FZX C;  3TAG A;  4DS4 A;  3DLR A;  3L2Q A;  1X9M A;  3LAM A;  1Q8I A;  2YNI A;  5C25 A;  1J54 A;  2Z1I A;  3HYF A;  1VSM A;  4BE1 A;  2LSN A;  2OPS A;  4B9S A;  3HO1 A;  3QIO A;  2HHT A;  3NAE A;  3AA3 A;  3HVR A;  4DS5 A;  2HVH A;  3S3M A;  1U04 A;  3AVA A;  1T8E A;  3L3U A;  4XIU A;  3TAQ A;  3RR8 A;  4DSE A;  3TAE A;  1VSK A;  3AVL A;  4LD0 A;  1JLF A;  1I39 A;  4M41 A;  5J2Q A;  4N5S A;  3PX4 A;  5KI6 A;  1EP4 A;  3AO2 A;  4B9V A;  4DTP A;  4I2Q A;  3PY8 A;  1NKE A;  3TI0 A;  4UQG A;  4DSJ A;  1XHX A;  4PY5 A;  3ZT3 A;  4FLY A;  4CJT A;  1BL3 A;  1KFS A;  4OKJ A;  1LV5 A;  3EY1 A;  4JRQ A;  1QSS A;  4CIF A;  2YKN A;  4FLZ A;  1J5O A;  3ZT1 A;  3CFO A;  2XRI A;  3U3G A;  5HRR A;  3O4Q A;  4FLX A;  1HYV A;  4FJG A;  4W5R A;  1BQM A;  1W9H A;  3NF7 A;  4CHO A;  4BDZ A;  3P5J A;  3OYM A;  4QOZ B;  4CJ5 A;  4E1N A;  4CE9 A;  4JS5 A;  1UOC A;  3E01 A;  3NBP A;  4HCC A;  1HYZ A;  4M3U A;  4KHN A;  3I0S A;  4E7K A;  1U49 A;  4NYN A;  1WSF A;  1A5W A;  4Z0U A;  2BDP A;  3JSM A;  1NK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...