3O3GA

T. maritima rnase h2 in complex with nucleic acid substrate and calcium ions
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
222
structure length
222
Chain Sequence
GIDELYKKEFGIVAGVDEAGRGCLAGPVVAAAVVLEKEIEGINDSKQLSPAKRERLLDEIMEKAAVGIGIASPEEIDLYNIFNATKLAMNRALENLSVKPSFVLVDGKGIELSVPGTCLVKGDQKSKLIGAASIVAKVFRDRLMSEFHRMYPQFSFHKHKGYATKEHLNEIRKNGVLPIHRLSFEPVLELLTDDLLREFFEKGLISENRFERILNLLGARKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna-rna hybrid
molecule keywords Ribonuclease HII
publication title Crystal Structures of RNase H2 in Complex with Nucleic Acid Reveal the Mechanism of RNA-DNA Junction Recognition and Cleavage.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 81
structure length 222
sequence length 222
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2010-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3o3gA00
3NDKA 2D0CA 3OYCA 1A5VA 3AA2A 1S6PA 1TVRA 2YHBA 4M3TA 2DY4A 3FFIA 4KTQA 2BE2A 5FRNA 3IS9A 3DRPA 3KKSA 2BDPA 3AO4A 1FKOA 3OYAA 2XY7A 1LAVA 3L8BA 2DFEA 4CK3A 3VQQA 3KK3A 4N41A 3LP1A 3AVNA 3UIQA 4FJGA 3O3FA 3TARA 2PYJA 3HO1A 4BDPA 1LWFA 1KVBA 1Q8IA 4KHUA 3MEDA 3RRHA 4KHYA 4I9LA 2KZZA 3HPOA 2YV0X 4IDKA 4CEQA 4CK1A 1KFDA 1BI4A 3DLKA 1NKBA 4CJEA 4KHWA 1RT2A 4H4MA 3OJSA 3MAQA 4CE9A 4KO0A 1KSPA 3WNHA 4CIEA 4FJIA 2ITGA 4CK2A 2HHQA 1KVCA 4W5NA 2PYLA 2RPIA 4KHQA 4JLHA 4FJKA 4F8RA 5CYQA 4Z4CA 1ASVA 2HVIA 2VWKA 2ZE2A 3SZ2A 1RTJA 5J2PA 4DTRA 4FCYA 4FJ8A 3PUFA 2KZMA 3KKRA 5HRRA 1TL1A 4RW9A 1VSIA 1WNSA 1JKHA 4FW1A 3LZIA 3OS0A 5KRTA 4NCGA 1CZ9A 2KW4A 2HNYA 3OYDA 4DTJA 3TANA 3DMJA 3MECA 1QSYA 1ZBUA 5CZ2A 1B9DA 4CEFA 4E7LA 2XY8A 1TV6A 5HRNA 2W42A 1JLFA 3I8DA 3CFRA 4JRQA 3AVAA 2QKBA 2HB5A 4FLTA 3AO3A 2KQ2A 3V9WA 4I7FA 1S9GA 3QEWA 4W5RA 4I2QA 1SUQA 4GW6A 3DLBA 4CHPA 2RKIA 1IG9A 1RTDA 1DLOA 4DS4A 4N47A 1L3TA 3AA4A 3OYBA 3K5NA 4FLYA 2X78A 4W5TA 4NCBA 2E6MA 3K5OA 2DTUA 4J2AA 3WNFA 5HBMA 3NAEA 3V9XA 1Q9XA 4KB1A 4KTZA 3KLEA 1RT4A 4FK2A 1B9FA 2G8WA 3K58A 1U47A 3ITHA 2Z1HA 2XO7A 4BE1A 2HNZA 2X6SA 4B08A 4DF8A 1NK8A 4OKKA 4CF0A 4BDZA 1S6QA 5EU7A 1BI4B 2D5RA 4EP4A 3NH2A 3TI0A 2G8FA 1YTUA 1U49A 3V6DA 2Q3SA 1SL2A 3I0SA 1D8YA 4DWIA 1JLAA 4DU4A 2GBZA 1KRPA 2E4LA 3PX6A 2Y1JA 4Z4IA 4IBNA 3HSTB 3PX4A 3SNNA 3VQ9A 1HPZA 1LW0A 1RCHA 1C0TA 4KKOA 3ZSZA 1EXQA 3DRSA 1U04A 3OYNA 1WAJA 4E7IA 1RDAA 4CFAA 4LH4A 3PV8A 4I9QA 2E6LA 2B5JA 1RILA 4EZ6A 3P83D 4OKJA 3C95A 3V9ZA 3HPGA 4OJRA 4OKEA 3QEVA 3DLHA 1U45A 1N6QA 3ZCMA 3LP3A 3M8RA 5J2NA 4CJUA 4CJRA 2Z1IA 4BE0A 4DSEA 4C8MA 2QKKA 4FW2A 1LWCA 4BWMA 4AILC 3KIOA 4LSNA 1W0HA 3WNGA 4Q5VA 3DYAA 3EZ5A 4KRFA 1S1TA 4N56A 1XHXA 1S1UA 3OYLA 5DK5A 4FJXA 3C94A 2VG7A 3JSMA 1HQEA 2XHBA 3AVKA 3O4QA 3ZSVA 3S3NA 5C25A 4O4GA 2G8IA 5CYMA 5DMRA 3L2QA 1J5OA 4KI4A 1UWBA 3TABA 4DSLA 1VSLA 1VSDA 4CJFA 1JLQA 1L3UA 2F8TA 3RMCA 1X9SA 4CF8A 3SUPA 2HMIA 4OVLA 4F3TA 5HLFA 1SKWA 3TAGA 4FJ9A 3VQEA 1Y97A 1NJXA 3ZT3A 1QSLA 3VQAA 4CFCA 3SI6A 3JYTA 1WSFA 3TAFA 3K5LA 1Q9YA 4FZXC 3OYKA 1NK6A 1FK9A 4ID1A 1SL1A 2PZSA 4OGCA 5KRSA 1U4BA 3AVLA 3NF8A 4ID5A 4B9UA 1KLMA 2VWJA 1YVUA 3KD5E 1RBUA 1G15A 4DSFA 5KTQA 3NE6A 3B6OA 3QETA 4E0DA 3KK1A 4E7HA 5FDLA 4BDYA 1NK7A 4ELVA 2OA8A 3OJUA 4PUOA 1QTMA 2KFZA 1RTIA 3MXMA 1XI1A 4FJ5A 2OPRA 4FZYA 2HNDA 4FK0A 4O0JA 3ZT2A 1J53A 4N76A 5FRMA 1U48A 3IRXA 4QAGA 4CF1A 2BANA 3VQ8A 1CZBA 3M8QA 4ELTA 3HVRA 2G8VA 2I5JA 2LSNA 3S9HA 3LP0A 4DSKA 4FLZA 4H8KA 4FLWA 4W5QA 2HVHA 4CJKA 4ICLA 4TSXA 5E41A 2G8KA 4DQIA 1EKEA 3OYGA 2B4JA 3V9UA 4FVMA 2D0AA 3G0ZA 3NF9A 3SUNA 2HHTA 3KK2A 1N5YA 3SUQA 1B92A 3F73A 2XY5A 2OZMA 2FBXA 4W5OA 4DMNA 4HVJA 3LAKA 1YTAA 4F4KA 3AA5X 4LY7A 3RRGA 2HHVA 2JLEA 1LV5A 1UAXA 3AVIA 4Z4EA 2AJQA 4RW4A 3O4NA 4GMJB 4DG1A 4PA1A 3SJJA 1X9WA 2B6AA 1S1VA 5JS1A 4LD0A 2HHXA 1QQCA 4O5BA 1KLNA 4DU1A 4JS5A 3NBPA 4CFDA 4DFPA 4C8NA 3AO5A 4IG0A 1TGOA 4CEOA 3QIPA 3CFPA 1C0UA 3DLGA 1SKSA 1I3AA 3NHGA 3RMDA 4EZ9A 4AH9A 3K57A 4FXDA 3PY8A 1S9EA 1X9MA 4J2DA 3HVTA 2VG5A 4CHQA 4OLAA 4IFYA 3NGIA 3QIOA 2FBTA 3ZSYA 3LPTA 1JLBA 3AVBA 1LW2A 2F96A 2ZQBA 4OPKA 2RN2A 1GOBA 3L3UA 3V81A 3TAEA 1UA1A 3KTQA 4HUFA 4CJ4A 3QNOA 3PO5A 3BGRA 1NKCA 3K59A 1RTHA 1C1AA 5SWMA 1VSKA 5SZTA 1KVAA 3VA3A 4AHCA 1W9HA 2XY6A 3T1AA 1CLQA 4O0IA 1DTQA 1VSFA 4LSLA 1RBTA 4CGJA 4MQ3A 2Z1JA 3T3FA 5J2MA 2YNHA 1IH7A 3KLGA 2IDOA 3U6FA 1ASWA 5KGXA 3HM9A 1KTQA 1VSMA 3C6UA 5T7BA 3ZSRA 3OYEA 2G8UA 4NCAA 2HHSA 4K8XA 3SQ1A 4C8LA 1D5AA 1I39A 4CF2A 3OVNA 3P1GA 1VSEA 2O4GA 1TKXA 3SPZA 4KFBA 4DFKA 1KFSA 2P5OA 4FLVA 5HROA 2WONA 1NJZA 3WNEA 3NF7A 5CY4A 2GUIA 2D0BA 4M3RA 3ZSOA 4KTWA 4L8RB 3G10A 4CJPA 2A1RA 2Y1IA 4AHTA 4LH5A 4K8ZA 3RR8A 3VQCA 4HUGA 2OPQA 1Z26A 3AO1A 4DTMA 4DTXA 4CJSA 3RR7A 1C1BA 1BHLA 1QSSA 1BGXT 4H4OA 1RT1A 2OYQA 3T19A 2IOCA 3V4IA 3KD1E 1RT5A 3CM6A 1TAUA 3CM5A 4E7KA 1HYZA 4Y1CA 3AVHA 1C6VA 4UQGA 4BE2A 3VA0A 2R7YA 1HRHA 4DQSA 1QE1A 3CYMA 4CHOA 4CERA 3QESA 1HYSA 1ZBFA 4HTUA 3OS2A 3F9KA 3LZJA 2A1SA 4XIUA 1T7PA 3SV3A 2HW3A 3VQ4A 1EX4A 1BIUA 4IG3A 2FC0A 1BCOA 3NH0A 1F21A 1VRTA 4M41A 4GVMA 3ALYA 3OYFA 5I42A 4F2RA 3S3OA 4DQRA 3I0RA 4DTPA 4DTUA 4Q0BA 1IKYA 1RDDA 1JL2A 2IC3A 4B8AB 3DM2A 4B8CA 4CECA 1UA0A 3OYHA 4BWJA 3TAMA 4CJ3A 3LPUA 3P5JA 1R0AA 3HP9A 4PWDA 4DFJA 3ZT4A 4C8KA 2HHWA 4DSIA 1TL3A 4RW7A 2F8SA 1C1CA 1EP4A 4DU3A 4WE1A 1A5XA 3HL8A 3SQ2A 3LDSA 4M3YA 3VN5A 1WN7A 1WSGA 3VQ7A 1IKVA 3LWMA 3ASMA 1HMVA 2G8HA 1NJYA 3PX0A 1UOCA 5KGWA 2EX3A 3OY9A 4FLUA 4ZTJA 4Z4GA 4QCLA 1Z25A 2FBVA 1TK8A 4CJVA 3ISNC 2YNGA 4M45A 3SQ4A 4B9NA 3SCXA 1HQUA 4B9VA 3L2RA 1RDCA 1WLJA 2DFHA 1SKRA 4M3UA 2P1JA 3ZT1A 3L2VA 3S3MA 1XC9A 3O3HA 4FM0A 3HK2A 1D9FA 4M3WA 4AHRA 2HHUA 3E01A 3OYIA 3KLFA 3M8PA 4M3ZA 1T05A 3AVGA 2YNIA 3LANA 4DSJA 3DRRA 4CGHA 4FJHA 3K2PA 4NYFA 3D45A 3QEXA 4B9LA 4FJJA 3H08A 4KPYA 3ZT0A 4PY5A 3SPYA 4JRPA 2O4IA 3RTVA 3RMAA 3V9SA 1DTTA 2P51A 4KREA 1VRUA 3NFAA 1WSEA 3LAMA 1L3VA 1RNHA 5J1EA 1TK0A 3CFOA 4E89A 1XWLA 4N5SA 4CCHA 1O1WA 3NCIA 3BDPA 3QERA 4AHVA 1HNVA 2ATQA 2VG6A 1HJRA 1BQNA 1RBRA 4DF4A 4ELUA 1CXUA 4CGFA 1L3SA 4E3SA 3HYFA 3MEGA 3U3GA 4KI6A 4DTNA 5K14A 4FLXA 4CFBA 4HCBA 3LWLA 1J9AA 1C0MA 4CEDA 4HUEA 1L5UA 4M42A 1ZBIA 2X74A 1YT3A 4CJLA 4B3OA 3DLEA 4G1QA 4FJ7A 1GOCA 4IFVA 3V1OA 3VQBA 4DS5A 4Y1DA 1JLCA 3MXIA 4NYNA 1TKDA 2IS3A 3AV9A 3AVFA 2NUBA 5CZ1A 1NK5A 1GOAA 4BACA 1HYVA 3LALA 1FKPA 1ITGA 1RBVA 3ZSWA 3IAYA 1JL1A 5HRSA 4PQUA 4FYDA 4E7JA 4O55A 2XRIA 1IKWA 2GV9A 4Z0UA 4CIFA 4DLEA 4HCCA 3L3VA 3RMBA 1NJWA 5HRPA 3MEEA 3QINA 1HNIA 4CGGA 2IAJA 2WOMA 4RW6A 4KHNA 3K5MA 4M3XA 1LAWA 4CJTA 3HJFA 1VSHA 4R5PA 4B9MA 4DTOA 2OPPA 1LWEA 3QLHA 1NK4A 3QEIA 1BL3A 2FBYA 3DOLA 1SL0A 1X1PA 1BCMA 1IKXA 3KLHA 3ULDA 3HXMA 4DTSA 1BQMA 1EETA 2RF2A 2YNFA 1RDBA 4CEEA 1NOYA 1MU2A 1BISA 4EP5A 2IGIA 4OPJA 3SUOA 4Z4HA 3TAQA 4FK4A 2OPSA 1ZBLA 4C8OA 3M8SA 4YFUA 1TKZA 1D9DA 3NGYA 3NF6A 1TAQA 3V1QA 1VSJA 1WAFA 3MXJA 3CQ8A 4CGDA 4FJNA 3AVCA 1BIZA 4CESA 4FM1A 4FM2A 2PY5A 5HP1A 4CF9A 4J2BA 1K6YA 1VK0A 4ZTFA 4E1MA 4DFMA 3EYZA 4I2PA 5C24A 1NK0A 3NH1A 1WSHA 4AHUA 1QHTA 2KTQA 2OZSA 3IG1A 3ZSXA 4CJ5A 3O3GA 1KCFA 1TKTA 2DFFA 3B6PA 3V1RA 2BGGA 4OLBA 4FJMA 1ASUA 4JS4A 1T03A 1S1XA 1QS4A 3THVA 1A5WA 5FROA 1NOZA 3U3YA 3NGZA 3QEPA 1RBSA 3TAPA 3DLRA 4CEZA 1FXXA 1S5JA 3DI6A 3AVMA 4DQQA 3TR8A 4B9TA 4OGEA 4CJWA 3HT3A 3SYZA 4CEAA 3HP6A 3VQDA 4E19A 1TK5A 2Z1GA 3OYJA 1ZBHA 4F2SA 1JLGA 2JGUA 2QXFA 1ZYQA 4ZHRA 3EY1A 4FZZA 1NKEA 2KFNA 4CGIA 1IO2A 4CJQA 3VQPA 3A2FA 2QK9A 2X6NA 3CG7A 5JS2A 3TWHA 3QNNA 5C42A 1WSJA 4J2EA 4HHTA 1J54A 4CHYA 4F3OA 4CIGA 1JLEA 1RT7A 4MFBA 4YNQA 3KJVA 1T8EA 4B9SA 4CHZA 3C6TA 4AHSA 3KLIA 3L2WA 3PO4A 2YKMA 3VQ6A 4KB0A 4IKFA 1S1WA 3VQ5A 3AA3A 5D3GA 2YKNA 1REVA 4CHNA 3L2UA 3SV4A 1CXQA 1RT3A 1SV5A 4RG8A 3SQ0A 3RWUA 3AO2A 3OYMA 2YHAA 3AVJA 3DOKA 3D0PA 5J2QA 3OS1A 4KAZA 4DLGA 1XHZA 1NK9A 4O44A 4DQPA 4KV8A 3HPHA 4RW8A 4E1NA 5I3UA 1JXEA 2ZD1A 4FJLA 1RT6A 3LP2A 3QO9A 5KI6A 2P5GA 4KHSA 2EHGA 4Z4FA 1JXBA 3ZSQA 2ETJA 1WSIA 4QOZB 4CEBA
chains in the Genus database with same CATH superfamily
4A59A 1NGAA 1S6PA 2W6KA 3WEEA 4M3TA 3MK6A 1IV0A 3KKSA 3Q7BA 3KK3A 4N41A 3AVNA 2PYJA 2KHOA 4H0OA 1KVBA 5AQNA 1JCFA 4GV9A 4CK1A 2W6LA 1NKBA 4KHWA 1RT2A 3CJ1A 5TKWA 1YI2N 2PYLA 4JLHA 4Z4CA 1ASVA 1QQNA 2HVIA 5J2PA 1FW6A 3PUFA 5HRRA 1VSIA 2YHXA 3LZIA 3OS0A 5BPNA 5KRTA 1GLDG 3CCQN 3TANA 1GLCG 3DMJA 4JKGB 4E7LA 3R8EA 5HRNA 3I8DA 3AO3A 1XUPO 3QEWA 2RKIA 4DS4A 4N47A 4FWNA 3OYBA 4H0TB 4FLYA 3PIOL 2X78A 4W5TA 3VF6A 4J2AA 3WNFA 5HBMA 1Q9XA 3M1FA 4KB1A 3KLEA 1IJJA 4FK2A 3K58A 1U47A 5BREA 4EHTA 2XO7A 4BE1A 1NGDA 2G8UA 2HSTA 2G8FA 3SJHA 4DWIA 2O8EB 3ENHA 3CC2N 3DXKA 4G9ZA 3MN9A 4CI6A 3BP8A 1LW0A 1K9MO 4KKOA 3VEVA 5M1NA 5AQZA 4CFAA 4I6MA 4WYBA 1T3VA 3AGRA 2B5JA 1NM1A 3V9ZA 3ENOA 3HTVA 4OKEA 1I94K 3EL2A 3A5MC 3M5RA 3OA9A 1E4FT 2Z1IA 3JS6A 3LL3A 1KD1O 4AILC 1W0HA 3ID8A 4N56A 3OYLA 4FJXA 3MN5A 3JSMA 3AVKA 4ISFA 3S3NA 5AQFA 3CMAN 5DMRA 3WXJA 4ILHA 1OVYA 3THXB 3J7ZO 3BEXA 4JAXA 3RMCA 5EY4A 5C2FA 4F3TA 4FJ9A 3QICA 1WUAA 3IKMA 1HNZK 1NMNA 3SI6A 1OH8A 3S41A 4A61A 1Q9YA 3OYKA 1NK6A 2E1ZA 5KQDA 2PZSA 4DHYA 3VETA 3CQXA 3KD5E 2VWJA 1YVUA 3DXMA 3VPZA 5KTQA 3NE6A 3B6OA 2HF3A 3P4IA 3KK1A 1NK7A 2OA8A 3OJUA 4K43A 1N8RO 5DM7L 1Q18A 1NGFA 1N33K 4O0JA 1J53A 4N76A 5C10A 1BG3A 4MO5A 5FRMA 2F9WA 3MN7A 4CF1A 5AZJA 1CZBA 2I5JA 3S9HA 1DGKN 3ZLJA 3AAQA 4WFAL 1IBLK 3VF4A 3VTIA 4DR1K 2B4JA 2JWKA 2D0AA 4JKAA 3KK2A 1N5YA 3TTFA 4PKHA 2FBXA 4F4KA 3CIPA 3LAKA 4HVJA 2F7TA 4LY7A 3RRGA 1LV5A 4GMJB 2E20A 1S1VA 4LD0A 4DUZK 2HHXA 3N4PA 2VYPA 3THYB 3H1VX 5GIOA 4JS5A 3TTCA 5EOYA 2F9TA 4CEOA 4FVUA 3QIPA 4BC2A 1I3AA 4CZIA 4EZ9A 3K57A 3MMVA 4J2DA 3G4SN 3RVCA 3NGIA 3QIOA 5AQVA 3ZSYA 2ZQBA 2Q2RA 4FWKA 4EHUA 3L0QA 1HKBA 3KTQA 3ZETB 1YIJN 1NKCA 5SWMA 3VA3A 3P38A 3VGMA 2UUCK 1ZC6A 3T1YK 3L4IA 3MWPA 2HVHA 3OYEA 1VSMA 4DR2K 2E2OA 1MDUB 3OVNA 2P9UA 2J4RA 3SPZA 1TKXA 4LFBK 4KFBA 2P5OA 3WNEA 5CY4A 2D0BA 4M3RA 3BF3A 1HR0K 3F5TA 3RR8A 4HUGA 4K42A 4CJSA 3RR7A 3LDLA 3FLCO 2IOCA 4JN4A 3CM6A 4YOYA 4Y1CA 2R7YA 5KQ8A 3QESA 4CERA 3F9KA 1W7AA 4XIUA 4H5VA 1EX4A 4IEIA 2Q0RA 1BO5O 5M1QA 2FC0A 1BCOA 1S22A 1F21A 4WQ5A 3ALYA 3GE1A 3S3OA 4B8CA 2IC3A 4B8AB 4BWJA 1BA0A 4CJ3A 3P5JA 3HP9A 4PWDA 3ZT4A 4RW7A 1EP4A 4ISGA 3O9RA 5HOOA 3VQ7A 1IKVA 3R3LA 1UOCA 3BF1A 4ZTJA 4DV2K 3FZKA 5BRFA 1EWQA 2DFHA 1SKRA 3QBXA 5JVGL 3E9PA 3I8BA 3O3HA 1VAZA 4AHRA 1QQMA 2E8AA 4M3ZA 3CMEN 1T05A 1X9JA 2O8CA 2A41A 2ASMA 4ILJA 1VQ9N 4PY5A 4JRPA 3O4WA 3VTHA 2O4IA 3RMAA 4WQ4A 2P51A 4KREA 3CFOA 5AQWA 1XWLA 4N5SA 4CCHA 4EFHA 1O1WA 3BDPA 3UKUA 4QS9A 5AQUA 1HJRA 1RBRA 3MEGA 3DJCA 3MCPA 4CEDA 1R59O 1YT3A 1YXQA 3TU5A 3TSUA 3DLEA 4G1QA 4JHDA 3O1BA 1Z6RA 4IFVA 2BTFA 4Y1DA 1JLCA 4ILGB 4XEIA 3MXIA 3AV9A 3LALA 1RBVA 1ITGA 4BRIA 1JL1A 5HRSA 4PQUA 4E7JA 1IKWA 4Z0UA 4DLEA 4CIFA 5HRPA 1J6ZA 5AQQA 1HNIA 2HBJA 1LAWA 4GY2B 4JKBA 1LWEA 3QEIA 2FBYA 4BRPA 3DOLA 3KVGA 3FZHA 1BCMA 4DTSA 1BQMA 2RF2A 2ZGZA 1BISA 4EP5A 2IGIA 1NG9A 3SUOA 4FK4A 2Q1NA 3M8SA 1TKZA 3NF6A 1NMDA 1TAQA 3BZCA 4CGDA 4FM1A 1VK0A 4BC4A 4E1MA 4U67L 3D2FB 1NK0A 3NH1A 1KQSM 1QHTA 3IG1A 3ZSXA 1KCFA 4JI5K 1GLAG 2P9NA 3B6PA 3CJCA 4FJMA 1XMQK 2VGMA 3H6EA 1JJ2M 4HWIA 4H5NA 4BGAA 5BN8A 3VQDA 4E19A 2Z1GA 3SK3A 4DV3K 4IOXA 4ZHRA 3EY1A 4K25A 2KFNA 4CGIA 2QK9A 2X6NA 3TWHA 5JS2A 3QNNA 5C42A 4CHYA 4CD1A 1RT7A 3KJVA 1T8EA 3FFKB 2Q0UA 4B9SA 4CHZA 3KLIA 4YY3K 3D7EO 2YKNA 2E2PA 3SQ0A 1CXQA 1EWRA 1RT3A 1JCGA 3AO2A 5J2QA 3PSIA 4O44A 4KV8A 3HPHA 1JCEA 4E1NA 2YJEA 4FJLA 4KHSA 3LP2A 1XMOK 3C65A 2P5GA 2DPNA 3A5OC 3ZSQA 2UYTA 2OCEA 3O1WA 4X66K 4CEBA 2O8FB 5AQRA 3OYCA 3AA2A 2YHBA 4PL7A 2DY4A 1DEJA 5BPLA 1LOTB 2BDPA 2WBNA 4BRLA 1NJIO 1X3NA 1FKOA 3OYAA 3O08A 1VQPN 3VQQA 1TYQA 4BDPA 3ZEUB 3RRHA 4KHYA 3HPOA 2QWQA 2CH5A 5GAEP 3I33A 4H4MA 3CJAA 4NO7A 5GADP 2YCHA 3MAQA 3N4QA 2YHWA 4KHQA 5LJVA 3VEWA 4V19S 2VWKA 3IDHA 4YOXA 1RTJA 2HMPA 3MCAB 4FJ8A 4RW9A 1WNSA 1JKHA 1CZ9A 3OYDA 4DTJA 5KPTA 1QSYA 5CZ2A 2XY8A 2W42A 1JLFA 3CFRA 4JRQA 3AVAA 2QKBA 4FLTA 1OKJA 1FJGK 3V9WA 2QWLA 4IFEA 4W5RA 2NRWA 3QDKA 4K41A 1N34K 4GKJK 1DLOA 3Q7CA 2P9LA 1L3TA 3AA4A 3K5NA 5EX5A 1RT4A 1HPMA 2G8WA 2P9IA 2HNZA 4L8RB 4OKKA 5AZJB 3NH2A 4B3SK 1BI4B 1YTUA 2D1KA 1U49A 3U9ZA 2Q3SA 3V6DA 3I0SA 1D8YA 3NVKA 1VQNN 2ZF5O 4CZHA 2E4LA 4Z4IA 3PX4A 3GDQA 1RCHA 1C0TA 3ZSZA 1WAJA 5C12A 1YHQN 4I9QA 4DUYK 4OKJA 3C95A 4OJRA 3LM2A 4LF5K 1U45A 5J2NA 3M8RA 2FSNA 4JV5K 4BE0A 4O8UA 5FPMA 3KWGA 2QKKA 4NXNK 3WNGA 1Q86O 1T6CA 3DYAA 5AR0A 2VQEK 1S1UA 5DK5A 1YJNN 2BUPA 3O4QA 2P9KA 4CVNE 3HBTA 2G8IA 5I9EB 4YDUA 4CJFA 1YUWA 3CCJN 3L4QA 1X9SA 4CF8A 2HMIA 4OVLA 3SMPA 3VEYA 4DR4K 3SAFA 5LMNK 3TAGA 3E9OA 2I7PA 1EQYA 3HSCA 4X64K 4JK8A 5JICA 2CGJA 1WSFA 4IEEA 4FZXC 4ID1A 3IUCA 3R6MA 4DSFA 4IDHA 1C0GA 2E1YA 3QETA 4E7HA 2P9UB 1QTMA 3RSEA 3MXMA 2OPRA 2NRXA 2HNDA 3OW2M 3IRXA 5AQXA 5ELZA 3JAMO 2YHYA 4A2AA 3D2EA 3QMLA 4JK7A 2G8VA 3CC7N 5TKYA 1KAYA 4FLWA 1MWKA 4W5QA 3A0IX 4CJKA 4X65K 4PL8A 5F1XA 3OYGA 1HNWK 4NXMK 5AZIA 4FVMA 3HZ6A 1VQON 2HHTA 3SUQA 1B92A 2XY5A 2OZMA 2VQFK 4W5OA 4DMNA 1YTAA 3AA5X 3CD6N 1HKGA 1ESVA 2JLEA 1UAXA 3ZYYX 2HHHK 2B6AA 5JS1A 5M1KA 1QQCA 4JI7K 5AQSA 2RHKA 4DU1A 1NGGA 4BREA 4DFPA 2HOEA 1TGOA 3CFPA 1C0UA 4JI6K 5AQKA 4DCHA 1S72N 3NHGA 3RMDA 4FXDA 3U9DA 3VEXA 2VG5A 1LCUA 4IFYA 4XH5A 5A2QO 5BPMA 4OPKA 2RN2A 1GOBA 3L3UA 3V81A 1UA1A 4HUFA 4CJ4A 5SZTA 2WC9A 5F2RA 1NBWA 3T1AA 2QW9A 3C0BA 1K8KB 4MLEA 4LSLA 1J5EK 2FLOA 4MQ3A 2Z1JA 3KLGA 3U6FA 2CGLA 4C1NI 3A5NC 1ASWA 5KGXA 1KTQA 3C6UA 5T7BA 4NCAA 4M7YA 1D5AA 4KH6A 1W97L 3UB5A 2GUPA 2O4GA 3GBTA 1OH6A 4DFKA 1KFSA 3K9KA 5HROA 1EO1A 3VMFB 2GUIA 4DQ8A 3ZSOA 1HUXA 4KTWA 3WUHA 3HOSA 1NGEA 3VQCA 1BOTO 4DTXA 4JHDB 1C1BA 1BHLA 1QSSA 1RT1A 3T19A 1RT5A 1XNQK 3CM5A 4GV6A 5AQMA 4UQGA 3AVHA 4DQSA 1QE1A 4CHOA 4JKFA 1ZBFA 3OS2A 2A1SA 1U6ZA 2QWMA 5LJWA 1GLBG 4IG3A 3C6AA 2HBLA 3G71N 3E66A 3LDOA 4AQYK 2OTLN 4Q0BA 3THWA 4DTUA 3EE8A 4DR7K 1IKYA 4BG8A 1JL2A 1RGIA 1UA0A 2HBKA 4A57A 3LPUA 2P9SA 4DFJA 1TL3A 3WQTA 4JI0K 1C1CA 3SQ2A 4M3YA 3KK7A 3VN5A 3CPWM 4WQ4C 3LWMA 1NJYA 4QCLA 3OY9A 3CCEN 1TK8A 3UKRA 2YNGA 3SQ4A 3SCXA 4BG9A 1RDCA 2P1JA 2IVOA 4JI1K 1D9FA 3LDNA 1T44A 1T6DA 4M3WA 2HHUA 3KLFA 1BWFO 3M8PA 3LANA 3DRRA 2D4WA 3MX5A 4NYFA 5DM6L 1NGCA 4LF7K 3ZT0A 4ISEA 3V9SA 2P9PB 4NLBA 4CZJA 3NFAA 3CI5A 1RNHA 1M90O 4IO9L 1BQNA 3P39A 4CBWA 4CGFA 2O8DA 3HYFA 3U3GA 1U2VA 5K14A 4HCBA 1J9AA 4HUEA 4M42A 1ZBIA 3A8YA 4GNIA 1ATNA 1BDGA 4IJNA 4FJ7A 4JNEA 2FXUA 3I55N 1TKDA 1KXPA 3ZSWA 3IAYA 4CZGA 4FWSA 4HCCA 3L3VA 1NJWA 1OH5A 4WFNL 4CBXA 2O8BA 4CGGA 2A42A 3K5MA 5B8HA 4CJTA 4DTOA 3LDQA 3R9PA 2YJFA 1X1PA 4BRCA 1IKXA 1BUPA 3KLHA 3HXMA 2HF4A 3KWIA 3ULDA 1IG8A 4CEEA 5H1SQ 1MU2A 4OPJA 4CJ7A 3TAQA 3O9QA 1GLJO 4H5TA 4WF9L 5LY3A 3V1QA 3MXJA 1VQ7N 1QZ6A 2PAVA 4OPHA 3AVCA 3EO3A 1K6YA 2QWPA 1WSHA 4AHUA 2OZSA 1OH7A 3V1RA 2DFFA 3FZLA 1ATSA 1ASUA 2IVPA 2UXBK 1S1XA 4NB4A 3U3YA 1NOZA 4OPAA 3QEPA 3TAPA 1QVGM 1FXXA 1S5JA 4JD2A 3AVMA 3ATVA 2YI1A 4OGEA 4CEAA 1TK5A 1YAGA 1ZBHA 4DV7K 1GLEG 2QXFA 1ZYQA 4FZZA 3OBYA 3A2FA 3O5BA 4RWTA 5GIPA 2NRRA 4MDBA 4MFBA 3HM8A 4AHSA 3L2WA 2HBMA 3H3OB 3VQ5A 4PKGA 4BROA 2V7YA 4RG8A 3SAHA 3OYMA 2YHAA 3EE9A 4KAZA 4RW8A 4BRNA 4R79A 1JXEA 4JKGA 1RT6A 5KI6A 4Z4FA 1JXBA 4BGBA 4H03B 4B3RK 4QOZB 4GKKK 1SQKA 3NDKA 2D0CA 4M7XA 3SLCA 5CE3A 1TVRA 3FFIA 2BE2A 5FRNA 4WCEL 3DRPA 4BQZA 3AO4A 1LAVA 2DFEA 4CK3A 3LP1A 4FJGA 4KBOA 3TARA 1LWFA 3J8AA 3C7NB 2A5XA 3FGUA 2VWBA 4I9LA 2YV0X 4IDKA 4CEQA 3DLKA 2PFUA 4XH4A 1IBMK 2O8EA 3OJSA 4KO0A 4BR7A 1KSPA 3WNHA 4CIEA 3MDQA 3O8MA 2ITGA 4CK2A 4FJKA 5AFUH 1D4XA 4JKCA 1NGJA 2ZJQL 2A6AA 3SZ2A 3QB0A 1GLLO 4FCYA 4JYAK 2KZMA 5CR4A 5EVZA 1YJ9N 4DV0K 2HNYA 2QTDA 1B9DA 4CEFA 3CCRN 1TV6A 5JVHL 3PIPL 2HB5A 3E1YA 4I7FA 1S9GA 2NRVA 3T69A 3WEEB 2I7NA 3DLBA 4CHPA 4IOAL 1TUYA 1RTDA 5AQPA 2E88A 3NAEA 3MX2A 3VESA 3RSEB 2KLAA 2X6SA 4DF8A 4BDZA 5EU7A 4EP4A 4BR0A 2E2NA 2UXCK 2AP1A 1SL2A 4DU4A 2GBZA 1KRPA 4A5AA 3PX6A 2Y1JA 4IBNA 3HSTB 3SNNA 3VQ9A 1HPZA 1C0FA 3OYNA 1EXQA 3BY5A 1RDAA 3PV8A 2E6LA 4EZ6A 5AQYA 3DLHA 1N6QA 3ZCMA 2GEMA 3ID6A 4CJRA 4BRQA 4DSEA 4FW2A 4BWMA 4CZKA 5AQLA 4Q5VA 3IMXA 3EZ5A 1S1TA 2W40A 3CCVN 1XHXA 1DT9A 5KPZA 4LF6K 2XHBA 4DR6K 3ZSVA 5C25A 1IBKK 3L2QA 3O9SA 1J5OA 3TABA 4DSLA 1VSDA 3H45C 1JLQA 3SUPA 4QS8A 4DR5K 5HLFA 3CPEA 4OX9K 3VQEA 3GOIA 3U8XA 1HKCA 4AM6A 3CERA 3VQAA 3THYA 5E26A 4CBUA 3K5LA 1FK9A 5KRSA 1U4BA 3AVLA 3NF8A 1KLMA 4K0KK 5ADXH 5AQOA 3B8AX 3DXKB 4BR4A 3CF5L 2ZJRL 2ASOA 5FDLA 4BDYA 4I6MB 4YORA 4IXCA 1XI1A 4FJ5A 1VQ8N 4FZYA 4FK0A 5AQGA 3ZETA 3ZX3A 2BANA 3VQ8A 3WXMB 5LMUK 3HVRA 4ELTA 1QZ5A 5AQJA 3LP0A 4DKWA 4JI4K 4RCHA 4ICLA 4TSXA 3CC4N 2G8KA 4DQIA 3V9UA 3G0ZA 3NF9A 4B1WB 2KKZA 3F73A 4FWRA 4IO8A 1SS6A 1S3XA 5E84A 2HHVA 3H46O 3HRGA 2UUBK 3SJJA 1Q7YO 4O5BA 1HNXK 1KLNA 3H1QA 3NBPA 4CFDA 4KH5A 3VEOA 2NZTA 4C8NA 4IG0A 4IOCL 3DAWA 3DLGA 1SKSA 3DXMB 4AH9A 4X62K 3M6GA 1BA1A 1S9EA 1X9MA 5FPEA 1ATRA 3HVTA 3PY8A 4FOEA 4CHQA 4OLAA 1V4TA 2FBTA 4JKHA 1JLBA 3AVBA 1LW2A 2F96A 2GELA 1KC8O 1E3MA 4FWPA 3K59A 1RTHA 1C1AA 3R1XA 4AHCA 1W9HA 1CLQA 1NGIA 1VSFA 4O0IA 1MA9B 1RBTA 3SMSA 4CGJA 2GWJA 3WXIA 5J2MA 2YNHA 3QBWA 2IDOA 3HM9A 1ZBSA 3ZSRA 1KAXA 4GV3A 4C8LA 1I39A 2EWSA 3D6RA 3L6QA 1HLUA 5AQIA 5JLHA 4JK9A 4FL9A 1NJZA 4OO1J 4PKIA 3E9LA 3G10A 4FWQA 4CJPA 4LF8K 4LH5A 1U2VB 4BR9A 4B3TK 2OPQA 1Z26A 4H0YB 3CJBA 2Q31A 2UUAK 1BGXT 3V4IA 3PLAA 1NGHA 1HYZA 4BE2A 3IFRA 4BVPA 1QVFM 1T7PA 2QI2A 4UY8O 3KHYA 4M41A 1VQ4N 4GVMA 4DQRA 3I0RA 4CECA 1R0AA 2V51B 4QS7A 1VQ6N 3CJ9A 4YHHK 2F8SA 4DU3A 4WE1A 1A5XA 3HL8A 3G25A 1E4GT 4B1XB 3EN9A 4IJAA 1HMVA 3PX0A 4MDAA 2EX3A 5FPNA 1Z25A 3ISNC 4M45A 3O6WA 4J8FA 3DWLA 3L2RA 3L2VA 3S3MA 3AY9A 2QWRA 3BUZB 3E01A 4WFBL 2NRTA 3OYIA 2YNIA 4FWLA 4DSJA 2CH6A 1Q82O 3K2PA 1XNRK 4B9LA 3QEXA 4YOTA 5BN9A 4KPYA 3SPYA 5M1OA 1DTTA 1WSEA 3EEQA 5J1EA 4JD2B 3W3DA 3QERA 3D2FA 1HNVA 5CHIA 3JXUA 4ELUA 1CXUA 3W0LA 4DTNA 4FLXA 1NU0A 4CW7B 1L5UA 4B3OA 4DS5A 4B1ZA 4NYNA 2IS3A 3AVFA 5CZ1A 1NK5A 1WBDA 1FKPA 4FYDA 3EZWA 2GV9A 2XRIA 3EKSA 1WOQA 2GWKA 2WOMA 4RW6A 1VSHA 1V4SA 4R5PA 2OPPA 1NK4A 4M63C 4IWVA 3WXKA 1VQ5N 4BY9C 3SBTA 2JWLA 1EETA 2O8CB 1RDBA 4FSVA 1NOYA 2WTUA 3HI0A 4Z4HA 3EKUA 2OPSA 1ZBLA 1YF5L 4YFUA 4EAHD 3VGKA 4LF9K 4BC3A 3OTOK 1VSJA 1WAFA 4LF4K 1SAZA 1P8ZA 4CESA 1BIZA 4H0XB 4FM2A 2Q36A 3KZBA 5HP1A 1ILYA 1Z05A 3UKUB 4DFMA 3EYZA 4I2PA 2KTQA 4WQ5C 2O8FA 3QFUA 4BR5A 1TKTA 4OLBA 4B1YB 4JS4A 5GAGP 4DR3K 3CJ7A 1T03A 3CHWA 4JI8K 3THVA 5FROA 1DKGD 1RBSA 2OANA 4NLCA 3ZEUA 3TR8A 3WT0A 4YOUA 4CJWA 3HT3A 3SYZA 3HP6A 2UU9K 5AQTA 1OVQA 3OYJA 1X3MA 3J7AP 1NKEA 3BZKA 4CJQA 1IO2A 2UXDK 5AQHA 1WSJA 3ULEA 4HHTA 4F3OA 4MO4A 3OBWA 1JLEA 1HJOA 5GAHP 4YNQA 3C6TA 3PO4A 5FLXO 4BVOA 4DV6K 1RDWX 4KB0A 3AA3A 4A5BA 5D3GA 1NWKA 3L2UA 4MLHA 3AVJA 4BRMA 3OS1A 1BU6O 4DQPA 3MN6A 5BR9A 5C15A 2ETJA 4CZLA 1A5VA 4KHPK 2P9NB 4B9QA 4KTQA 3OHRA 3IS9A 1Q81O 2XY7A 1YJWN 1H1VA 3L8BA 3M3ZA 4FPBA 4JI3K 3HO1A 3UIQA 3O3FA 1Q8IA 5F0XA 4KHUA 3MEDA 2KZZA 3SBGA 1KFDA 1BI4A 2CGKA 1WB9A 4CJEA 1SZ2A 3G6EN 4FOIA 4CE9A 4FJIA 4BQLA 3U4LA 3ZX0A 2HHQA 1KVCA 4W5NA 2RPIA 3VERA 4FO0A 4F8RA 3LM9A 5CYQA 2ZE2A 4CZFA 4DTRA 2FF3B 3O9UA 3KKRA 1TL1A 3P31A 4FW1A 4CD3A 4LFAK 4NCGA 2KW4A 4JI2K 4BR2A 2PBDA 3MECA 1ZBUA 3FZFA 2ASPA 4LC9B 2KQ2A 4H5WA 4I2QA 1SUQA 4GW6A 4AF1A 3C6HA 1IG9A 4Y0WA 2DTUA 4NCBA 2E6MA 3K5OA 4O8KA 3V9XA 1TYQB 4KTZA 1B9FA 3ITHA 2Z1HA 3VF2A 4B08A 1NK8A 4CF0A 4BRHA 1S6QA 2D5RA 3TI0A 2NRHA 1JLAA 2GTDA 3CXCM 1K73O 3FR0A 4E7IA 3DRSA 1U04A 3T1HK 1NGBA 4LH4A 1RDUA 1RILA 3P83D 4BC5A 3HPGA 3QEVA 5EXWA 3FE1A 2E2QA 3LP3A 4EIAA 4CJUA 1W2BM 1N32K 4CZMA 4C8MA 1LWCA 3KIOA 4LSNA 3GG4A 4KRFA 4B1UB 3C94A 2VG7A 3NVMA 1HQEA 4O4GA 5CYMA 4H5RA 4KI4A 1UWBA 3AGKA 1VSLA 2P9LB 1L3UA 5IWAK 2F8TA 4YOVA 4U7BA 5JMVA 1G99A 2V7ZA 1SKWA 1Y97A 2P9IB 1NJXA 3ZT3A 1QSLA 4CFCA 3JYTA 3SAGA 3TAFA 4DV5K 1SL1A 3FZMA 4OGCA 3TPQA 4ID5A 4JKEA 4B9UA 4HTLA 1RBUA 1G15A 2FF6A 4E0DA 2QM1A 4ELVA 4PUOA 1WBBA 2KFZA 1RTIA 3ZT2A 1U48A 2A40A 4QAGA 3M8QA 2ZM6K 1P90A 2LSNA 3PSFA 1K8KA 4DSKA 1NNEA 1O13A 3F9MA 4FLZA 4H8KA 5E41A 1EKEA 1TUUA 4A2BA 3SUNA 5HL7L 2QA4N 2P9KB 2QXLA 3J81O 5BRDA 3AVIA 4DV1K 4Z4EA 3O80A 4RW4A 3O4NA 4DG1A 2AJQA 4PA1A 1X9WA 1CZAN 4F9OA 2QWOA 2NRZA 3F2KA 3AARA 2AA4A 3VGLA 3AO5A 2NNWA 3DLLL 2Q97A 4Z94A 4LFCK 3THXA 4DV4K 2A3ZA 4B1VA 1QHAA 3LPTA 1K8AO 3TAEA 4AM7A 2RE2A 3QNOA 3PO5A 3BGRA 5AJ3K 1VQMN 3WQUA 1VSKA 5AFUA 1KVAA 3J80O 2XY6A 3D2EB 1DTQA 3VENA 3T3FA 1IH7A 2QWNA 2ZWHA 2HHSA 4O5FA 3SQ1A 4K8XA 5AZIB 3I56N 4YDUC 4CF2A 3P1GA 5C2DA 1VSEA 3K9JA 3VEZA 3TTDA 4FLVA 4FWMA 1MWMA 2WONA 3NF7A 3VOVA 2A1RA 2Y1IA 4AHTA 4K8ZA 3GL1A 4DTMA 3AO1A 1VHXA 3TSPA 4C23A 1YITN 5IT9O 4H4OA 2OYQA 2YX6A 3KD1E 2NLXA 5GINA 2F4VK 2P9PA 1TAUA 4GVEA 4E7KA 1ZXOA 1C6VA 3VA0A 1HRHA 1HYSA 3CYMA 4HTUA 2VCPA 4E1JA 3LZJA 3SV3A 2HW3A 3VQ4A 1BIUA 4YOWA 3CQYA 3ZX2A 3NH0A 4L3QA 1VRTA 3OYFA 4F2RA 5I42A 4DTPA 3MWTA 1RDDA 3DM2A 4C1NK 2QEXN 3OYHA 3TAMA 1N36K 3UE5A 4C8KA 2HHWA 4DSIA 3CCMN 5BRHA 1XC3A 4H0PA 4DB3A 3LDSA 2VGNA 1WN7A 1WSGA 2W41A 3ASMA 2G8HA 4Z4GA 1NLVA 5KGWA 4FLUA 2FBVA 4JEPA 4CJVA 2ZJPL 4B9NA 1HQUA 4RTFD 4B9VA 1WLJA 1M1KO 4M3UA 3A5LC 3ZT1A 1XC9A 5M1FA 4FM0A 3HK2A 3O9TA 3AAPA 1GLFO 3AVGA 5LL6Z 3ENBA 4CGHA 4FJHA 3CCLN 3D45A 2OTJN 4FJJA 1VQKN 3H08A 3NMUA 4BRGA 3RTVA 2D0PA 4BRDA 4FWOA 1VRUA 5M1PA 3LAMA 1L3VA 1TK0A 4E89A 2WFBA 3NCIA 5BR8K 3WXLA 4AHVA 2VG6A 2ATQA 4XH1A 4DF4A 1L3SA 4E3SA 4KI6A 4CFBA 3LWLA 1C0MA 2D0OA 2V52B 5ADXA 4A62A 2X74A 3THWB 4CJLA 3ULEB 1GOCA 1QQOA 3V1OA 3VQBA 2P9SB 2NUBA 5C0YA 1GOAA 3CCUN 4BACA 1HYVA 3H3NO 1YVNA 3CETA 4IZ9A 4O55A 3RMBA 3MEEA 3UKRB 3QINA 2FSKA 2IAJA 3HJFA 4KHNA 4M3XA 3CCSN 4B9MA 3QLHA 1BL3A 3ATUA 1SL0A 4H0VB 3LDPA 1RFQA 1KAZA 4BRAA 2YNFA 2GX9A 4C8OA 1D9DA 3NGYA 3CQ8A 4FJNA 2PY5A 2IIRA 4FPAA 4JKDA 4CF9A 4J2BA 4ZTFA 4BRFA 5C24A 2WUSA 5JLFA 2O8DB 4CJ5A 2BGGA 3O3GA 2IVNA 2ZGYA 1QS4A 2FSJA 1A5WA 4PHTX 1XQSC 3NGZA 1HX1A 3K0SA 4BRKA 3DLRA 4CEZA 3C7NA 3DI6A 4DQQA 4B9TA 3TSQA 2E5LK 4B3MK 4F2SA 4CZEA 1JLGA 1Y64A 2JGUA 2O8BB 3QFPA 3VQPA 3CG7A 4J2EA 3T7ZA 1J54A 4CIGA 3J7YP 5FPDA 2BH1A 2YKMA 3VQ6A 4IKFA 1S1WA 1REVA 4CHNA 5MLCQ 3SV4A 1SV5A 3RWUA 3DOKA 3D0PA 2H3GX 5KPRA 4DLGA 1VQLN 1XHZA 1NK9A 4KH4A 2ITMA 5I3UA 2ZD1A 3HOTA 3QO9A 2EHGA 1WSIA
chains in the Genus database with same CATH topology
3NDKA 2D0CA 3OYCA 1A5VA 3AA2A 1S6PA 1TVRA 2YHBA 4M3TA 2DY4A 3FFIA 4KTQA 2BE2A 5FRNA 3IS9A 3DRPA 3KKSA 2BDPA 3AO4A 1FKOA 3OYAA 2XY7A 1LAVA 3L8BA 2DFEA 4CK3A 3VQQA 3KK3A 4N41A 3LP1A 3AVNA 3UIQA 4FJGA 3O3FA 3TARA 2PYJA 3HO1A 4BDPA 1LWFA 1KVBA 1Q8IA 4KHUA 3MEDA 3RRHA 4KHYA 4I9LA 2KZZA 3HPOA 2YV0X 4IDKA 4CEQA 4CK1A 1KFDA 1BI4A 3DLKA 1NKBA 4CJEA 4KHWA 1RT2A 4H4MA 3OJSA 3MAQA 4CE9A 4KO0A 1KSPA 3WNHA 4CIEA 4FJIA 2ITGA 4CK2A 2HHQA 1KVCA 4W5NA 2PYLA 2RPIA 4KHQA 4JLHA 4FJKA 4F8RA 5CYQA 4Z4CA 1ASVA 2HVIA 2VWKA 2ZE2A 3SZ2A 1RTJA 5J2PA 4DTRA 4FCYA 4FJ8A 3PUFA 2KZMA 3KKRA 5HRRA 1TL1A 4RW9A 1VSIA 1WNSA 1JKHA 4FW1A 3LZIA 3OS0A 5KRTA 4NCGA 1CZ9A 2KW4A 2HNYA 3OYDA 4DTJA 3TANA 3DMJA 3MECA 1QSYA 1ZBUA 5CZ2A 1B9DA 4CEFA 4E7LA 2XY8A 1TV6A 5HRNA 2W42A 1JLFA 3I8DA 3CFRA 4JRQA 3AVAA 2QKBA 2HB5A 4FLTA 3AO3A 2KQ2A 3V9WA 4I7FA 1S9GA 3QEWA 4W5RA 4I2QA 1SUQA 4GW6A 3DLBA 4CHPA 2RKIA 1IG9A 1RTDA 1DLOA 4DS4A 4N47A 1L3TA 3AA4A 3OYBA 3K5NA 4FLYA 2X78A 4W5TA 4NCBA 2E6MA 3K5OA 2DTUA 4J2AA 3WNFA 5HBMA 3NAEA 3V9XA 1Q9XA 4KB1A 4KTZA 3KLEA 1RT4A 4FK2A 1B9FA 2G8WA 3K58A 1U47A 3ITHA 2Z1HA 2XO7A 4BE1A 2HNZA 2X6SA 4B08A 4DF8A 1NK8A 4OKKA 4CF0A 4BDZA 1S6QA 5EU7A 1BI4B 2D5RA 4EP4A 3NH2A 3TI0A 2G8FA 1YTUA 1U49A 3V6DA 2Q3SA 1SL2A 3I0SA 1D8YA 4DWIA 1JLAA 4DU4A 2GBZA 1KRPA 2E4LA 3PX6A 2Y1JA 4Z4IA 4IBNA 3HSTB 3PX4A 3SNNA 3VQ9A 1HPZA 1LW0A 1RCHA 1C0TA 4KKOA 3ZSZA 1EXQA 3DRSA 1U04A 3OYNA 1WAJA 4E7IA 1RDAA 4CFAA 4LH4A 3PV8A 4I9QA 2E6LA 2B5JA 1RILA 4EZ6A 3P83D 4OKJA 3C95A 3V9ZA 3HPGA 4OJRA 4OKEA 3QEVA 3DLHA 1U45A 1N6QA 3ZCMA 3LP3A 3M8RA 5J2NA 4CJUA 4CJRA 2Z1IA 4BE0A 4DSEA 4C8MA 2QKKA 4FW2A 1LWCA 4BWMA 4AILC 3KIOA 4LSNA 1W0HA 3WNGA 4Q5VA 3DYAA 3EZ5A 4KRFA 1S1TA 4N56A 1XHXA 1S1UA 3OYLA 5DK5A 4FJXA 3C94A 2VG7A 3JSMA 1HQEA 2XHBA 3AVKA 3O4QA 3ZSVA 3S3NA 5C25A 4O4GA 2G8IA 5CYMA 5DMRA 3L2QA 1J5OA 4KI4A 1UWBA 3TABA 4DSLA 1VSLA 1VSDA 4CJFA 1JLQA 1L3UA 2F8TA 3RMCA 1X9SA 4CF8A 3SUPA 2HMIA 4OVLA 4F3TA 5HLFA 1SKWA 3TAGA 4FJ9A 3VQEA 1Y97A 1NJXA 3ZT3A 1QSLA 3VQAA 4CFCA 3SI6A 3JYTA 1WSFA 3TAFA 3K5LA 1Q9YA 4FZXC 3OYKA 1NK6A 1FK9A 4ID1A 1SL1A 2PZSA 4OGCA 5KRSA 1U4BA 3AVLA 3NF8A 4ID5A 4B9UA 1KLMA 2VWJA 1YVUA 3KD5E 1RBUA 1G15A 4DSFA 5KTQA 3NE6A 3B6OA 3QETA 4E0DA 3KK1A 4E7HA 5FDLA 4BDYA 1NK7A 4ELVA 2OA8A 3OJUA 4PUOA 1QTMA 2KFZA 1RTIA 3MXMA 1XI1A 4FJ5A 2OPRA 4FZYA 2HNDA 4FK0A 4O0JA 3ZT2A 1J53A 4N76A 5FRMA 1U48A 3IRXA 4QAGA 4CF1A 2BANA 3VQ8A 1CZBA 3M8QA 4ELTA 3HVRA 2G8VA 2I5JA 2LSNA 3S9HA 3LP0A 4DSKA 4FLZA 4H8KA 4FLWA 4W5QA 2HVHA 4CJKA 4ICLA 4TSXA 5E41A 2G8KA 4DQIA 1EKEA 3OYGA 2B4JA 3V9UA 4FVMA 2D0AA 3G0ZA 3NF9A 3SUNA 2HHTA 3KK2A 1N5YA 3SUQA 1B92A 3F73A 2XY5A 2OZMA 2FBXA 4W5OA 4DMNA 4HVJA 3LAKA 1YTAA 4F4KA 3AA5X 4LY7A 3RRGA 2HHVA 2JLEA 1LV5A 1UAXA 3AVIA 4Z4EA 2AJQA 4RW4A 3O4NA 4GMJB 4DG1A 4PA1A 3SJJA 1X9WA 2B6AA 1S1VA 5JS1A 4LD0A 2HHXA 1QQCA 4O5BA 1KLNA 4DU1A 4JS5A 3NBPA 4CFDA 4DFPA 4C8NA 3AO5A 4IG0A 1TGOA 4CEOA 3QIPA 3CFPA 1C0UA 3DLGA 1SKSA 1I3AA 3NHGA 3RMDA 4EZ9A 4AH9A 3K57A 4FXDA 3PY8A 1S9EA 1X9MA 4J2DA 3HVTA 2VG5A 4CHQA 4OLAA 4IFYA 3NGIA 3QIOA 2FBTA 3ZSYA 3LPTA 1JLBA 3AVBA 1LW2A 2F96A 2ZQBA 4OPKA 2RN2A 1GOBA 3L3UA 3V81A 3TAEA 1UA1A 3KTQA 4HUFA 4CJ4A 3QNOA 3PO5A 3BGRA 1NKCA 3K59A 1RTHA 1C1AA 5SWMA 1VSKA 5SZTA 1KVAA 3VA3A 4AHCA 1W9HA 2XY6A 3T1AA 1CLQA 4O0IA 1DTQA 1VSFA 4LSLA 1RBTA 4CGJA 4MQ3A 2Z1JA 3T3FA 5J2MA 2YNHA 1IH7A 3KLGA 2IDOA 3U6FA 1ASWA 5KGXA 3HM9A 1KTQA 1VSMA 3C6UA 5T7BA 3ZSRA 3OYEA 2G8UA 4NCAA 2HHSA 4K8XA 3SQ1A 4C8LA 1D5AA 1I39A 4CF2A 3OVNA 3P1GA 1VSEA 2O4GA 1TKXA 3SPZA 4KFBA 4DFKA 1KFSA 2P5OA 4FLVA 5HROA 2WONA 1NJZA 3WNEA 3NF7A 5CY4A 2GUIA 2D0BA 4M3RA 3ZSOA 4KTWA 4L8RB 3G10A 4CJPA 2A1RA 2Y1IA 4AHTA 4LH5A 4K8ZA 3RR8A 3VQCA 4HUGA 2OPQA 1Z26A 3AO1A 4DTMA 4DTXA 4CJSA 3RR7A 1C1BA 1BHLA 1QSSA 1BGXT 4H4OA 1RT1A 2OYQA 3T19A 2IOCA 3V4IA 3KD1E 1RT5A 3CM6A 1TAUA 3CM5A 4E7KA 1HYZA 4Y1CA 3AVHA 1C6VA 4UQGA 4BE2A 3VA0A 2R7YA 1HRHA 4DQSA 1QE1A 3CYMA 4CHOA 4CERA 3QESA 1HYSA 1ZBFA 4HTUA 3OS2A 3F9KA 3LZJA 2A1SA 4XIUA 1T7PA 3SV3A 2HW3A 3VQ4A 1EX4A 1BIUA 4IG3A 2FC0A 1BCOA 3NH0A 1F21A 1VRTA 4M41A 4GVMA 3ALYA 3OYFA 5I42A 4F2RA 3S3OA 4DQRA 3I0RA 4DTPA 4DTUA 4Q0BA 1IKYA 1RDDA 1JL2A 2IC3A 4B8AB 3DM2A 4B8CA 4CECA 1UA0A 3OYHA 4BWJA 3TAMA 4CJ3A 3LPUA 3P5JA 1R0AA 3HP9A 4PWDA 4DFJA 3ZT4A 4C8KA 2HHWA 4DSIA 1TL3A 4RW7A 2F8SA 1C1CA 1EP4A 4DU3A 4WE1A 1A5XA 3HL8A 3SQ2A 3LDSA 4M3YA 3VN5A 1WN7A 1WSGA 3VQ7A 1IKVA 3LWMA 3ASMA 1HMVA 2G8HA 1NJYA 3PX0A 1UOCA 5KGWA 2EX3A 3OY9A 4FLUA 4ZTJA 4Z4GA 4QCLA 1Z25A 2FBVA 1TK8A 4CJVA 3ISNC 2YNGA 4M45A 3SQ4A 4B9NA 3SCXA 1HQUA 4B9VA 3L2RA 1RDCA 1WLJA 2DFHA 1SKRA 4M3UA 2P1JA 3ZT1A 3L2VA 3S3MA 1XC9A 3O3HA 4FM0A 3HK2A 1D9FA 4M3WA 4AHRA 2HHUA 3E01A 3OYIA 3KLFA 3M8PA 4M3ZA 1T05A 3AVGA 2YNIA 3LANA 4DSJA 3DRRA 4CGHA 4FJHA 3K2PA 4NYFA 3D45A 3QEXA 4B9LA 4FJJA 3H08A 4KPYA 3ZT0A 4PY5A 3SPYA 4JRPA 2O4IA 3RTVA 3RMAA 3V9SA 1DTTA 2P51A 4KREA 1VRUA 3NFAA 1WSEA 3LAMA 1L3VA 1RNHA 5J1EA 1TK0A 3CFOA 4E89A 1XWLA 4N5SA 4CCHA 1O1WA 3NCIA 3BDPA 3QERA 4AHVA 1HNVA 2ATQA 2VG6A 1HJRA 1BQNA 1RBRA 4DF4A 4ELUA 1CXUA 4CGFA 1L3SA 4E3SA 3HYFA 3MEGA 3U3GA 4KI6A 4DTNA 5K14A 4FLXA 4CFBA 4HCBA 3LWLA 1J9AA 1C0MA 4CEDA 4HUEA 1L5UA 4M42A 1ZBIA 2X74A 1YT3A 4CJLA 4B3OA 3DLEA 4G1QA 4FJ7A 1GOCA 4IFVA 3V1OA 3VQBA 4DS5A 4Y1DA 1JLCA 3MXIA 4NYNA 1TKDA 2IS3A 3AV9A 3AVFA 2NUBA 5CZ1A 1NK5A 1GOAA 4BACA 1HYVA 3LALA 1FKPA 1ITGA 1RBVA 3ZSWA 3IAYA 1JL1A 5HRSA 4PQUA 4FYDA 4E7JA 4O55A 2XRIA 1IKWA 2GV9A 4Z0UA 4CIFA 4DLEA 4HCCA 3L3VA 3RMBA 1NJWA 5HRPA 3MEEA 3QINA 1HNIA 4CGGA 2IAJA 2WOMA 4RW6A 4KHNA 3K5MA 4M3XA 1LAWA 4CJTA 3HJFA 1VSHA 4R5PA 4B9MA 4DTOA 2OPPA 1LWEA 3QLHA 1NK4A 3QEIA 1BL3A 2FBYA 3DOLA 1SL0A 1X1PA 1BCMA 1IKXA 3KLHA 3ULDA 3HXMA 4DTSA 1BQMA 1EETA 2RF2A 2YNFA 1RDBA 4CEEA 1NOYA 1MU2A 1BISA 4EP5A 2IGIA 4OPJA 3SUOA 4Z4HA 3TAQA 4FK4A 2OPSA 1ZBLA 4C8OA 3M8SA 4YFUA 1TKZA 1D9DA 3NGYA 3NF6A 1TAQA 3V1QA 1VSJA 1WAFA 3MXJA 3CQ8A 4CGDA 4FJNA 3AVCA 1BIZA 4CESA 4FM1A 4FM2A 2PY5A 5HP1A 4CF9A 4J2BA 1K6YA 1VK0A 4ZTFA 4E1MA 4DFMA 3EYZA 4I2PA 5C24A 1NK0A 3NH1A 1WSHA 4AHUA 1QHTA 2KTQA 2OZSA 3IG1A 3ZSXA 4CJ5A 3O3GA 1KCFA 1TKTA 2DFFA 3B6PA 3V1RA 2BGGA 4OLBA 4FJMA 1ASUA 4JS4A 1T03A 1S1XA 1QS4A 3THVA 1A5WA 5FROA 1NOZA 3U3YA 3NGZA 3QEPA 1RBSA 3TAPA 3DLRA 4CEZA 1FXXA 1S5JA 3DI6A 3AVMA 4DQQA 3TR8A 4B9TA 4OGEA 4CJWA 3HT3A 3SYZA 4CEAA 3HP6A 3VQDA 4E19A 1TK5A 2Z1GA 3OYJA 1ZBHA 4F2SA 1JLGA 2JGUA 2QXFA 1ZYQA 4ZHRA 3EY1A 4FZZA 1NKEA 2KFNA 4CGIA 1IO2A 4CJQA 3VQPA 3A2FA 2QK9A 2X6NA 3CG7A 5JS2A 3TWHA 3QNNA 5C42A 1WSJA 4J2EA 4HHTA 1J54A 4CHYA 4F3OA 4CIGA 1JLEA 1RT7A 4MFBA 4YNQA 3KJVA 1T8EA 4B9SA 4CHZA 3C6TA 4AHSA 3KLIA 3L2WA 3PO4A 2YKMA 3VQ6A 4KB0A 4IKFA 1S1WA 3VQ5A 3AA3A 5D3GA 2YKNA 1REVA 4CHNA 3L2UA 3SV4A 1CXQA 1RT3A 1SV5A 4RG8A 3SQ0A 3RWUA 3AO2A 3OYMA 2YHAA 3AVJA 3DOKA 3D0PA 5J2QA 3OS1A 4KAZA 4DLGA 1XHZA 1NK9A 4O44A 4DQPA 4KV8A 3HPHA 4RW8A 4E1NA 5I3UA 1JXEA 2ZD1A 4FJLA 1RT6A 3LP2A 3QO9A 5KI6A 2P5GA 4KHSA 2EHGA 4Z4FA 1JXBA 3ZSQA 2ETJA 1WSIA 4QOZB 4CEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NDK A;  2D0C A;  3OYC A;  1A5V A;  3AA2 A;  1S6P A;  1TVR A;  2YHB A;  4M3T A;  2DY4 A;  3FFI A;  4KTQ A;  2BE2 A;  5FRN A;  3IS9 A;  3DRP A;  3KKS A;  2BDP A;  3AO4 A;  1FKO A;  3OYA A;  2XY7 A;  1LAV A;  3L8B A;  2DFE A;  4CK3 A;  3VQQ A;  3KK3 A;  4N41 A;  3LP1 A;  3AVN A;  3UIQ A;  4FJG A;  3O3F A;  3TAR A;  2PYJ A;  3HO1 A;  4BDP A;  1LWF A;  1KVB A;  1Q8I A;  4KHU A;  3MED A;  3RRH A;  4KHY A;  4I9L A;  2KZZ A;  3HPO A;  2YV0 X;  4IDK A;  4CEQ A;  4CK1 A;  1KFD A;  1BI4 A;  3DLK A;  1NKB A;  4CJE A;  4KHW A;  1RT2 A;  4H4M A;  3OJS A;  3MAQ A;  4CE9 A;  4KO0 A;  1KSP A;  3WNH A;  4CIE A;  4FJI A;  2ITG A;  4CK2 A;  2HHQ A;  1KVC A;  4W5N A;  2PYL A;  2RPI A;  4KHQ A;  4JLH A;  4FJK A;  4F8R A;  5CYQ A;  4Z4C A;  1ASV A;  2HVI A;  2VWK A;  2ZE2 A;  3SZ2 A;  1RTJ A;  5J2P A;  4DTR A;  4FCY A;  4FJ8 A;  3PUF A;  2KZM A;  3KKR A;  5HRR A;  1TL1 A;  4RW9 A;  1VSI A;  1WNS A;  1JKH A;  4FW1 A;  3LZI A;  3OS0 A;  5KRT A;  4NCG A;  1CZ9 A;  2KW4 A;  2HNY A;  3OYD A;  4DTJ A;  3TAN A;  3DMJ A;  3MEC A;  1QSY A;  1ZBU A;  5CZ2 A;  1B9D A;  4CEF A;  4E7L A;  2XY8 A;  1TV6 A;  5HRN A;  2W42 A;  1JLF A;  3I8D A;  3CFR A;  4JRQ A;  3AVA A;  2QKB A;  2HB5 A;  4FLT A;  3AO3 A;  2KQ2 A;  3V9W A;  4I7F A;  1S9G A;  3QEW A;  4W5R A;  4I2Q A;  1SUQ A;  4GW6 A;  3DLB A;  4CHP A;  2RKI A;  1IG9 A;  1RTD A;  1DLO A;  4DS4 A;  4N47 A;  1L3T A;  3AA4 A;  3OYB A;  3K5N A;  4FLY A;  2X78 A;  4W5T A;  4NCB A;  2E6M A;  3K5O A;  2DTU A;  4J2A A;  3WNF A;  5HBM A;  3NAE A;  3V9X A;  1Q9X A;  4KB1 A;  4KTZ A;  3KLE A;  1RT4 A;  4FK2 A;  1B9F A;  2G8W A;  3K58 A;  1U47 A;  3ITH A;  2Z1H A;  2XO7 A;  4BE1 A;  2HNZ A;  2X6S A;  4B08 A;  4DF8 A;  1NK8 A;  4OKK A;  4CF0 A;  4BDZ A;  1S6Q A;  5EU7 A;  1BI4 B;  2D5R A;  4EP4 A;  3NH2 A;  3TI0 A;  2G8F A;  1YTU A;  1U49 A;  3V6D A;  2Q3S A;  1SL2 A;  3I0S A;  1D8Y A;  4DWI A;  1JLA A;  4DU4 A;  2GBZ A;  1KRP A;  2E4L A;  3PX6 A;  2Y1J A;  4Z4I A;  4IBN A;  3HST B;  3PX4 A;  3SNN A;  3VQ9 A;  1HPZ A;  1LW0 A;  1RCH A;  1C0T A;  4KKO A;  3ZSZ A;  1EXQ A;  3DRS A;  1U04 A;  3OYN A;  1WAJ A;  4E7I A;  1RDA A;  4CFA A;  4LH4 A;  3PV8 A;  4I9Q A;  2E6L A;  2B5J A;  1RIL A;  4EZ6 A;  3P83 D;  4OKJ A;  3C95 A;  3V9Z A;  3HPG A;  4OJR A;  4OKE A;  3QEV A;  3DLH A;  1U45 A;  1N6Q A;  3ZCM A;  3LP3 A;  3M8R A;  5J2N A;  4CJU A;  4CJR A;  2Z1I A;  4BE0 A;  4DSE A;  4C8M A;  2QKK A;  4FW2 A;  1LWC A;  4BWM A;  4AIL C;  3KIO A;  4LSN A;  1W0H A;  3WNG A;  4Q5V A;  3DYA A;  3EZ5 A;  4KRF A;  1S1T A;  4N56 A;  1XHX A;  1S1U A;  3OYL A;  5DK5 A;  4FJX A;  3C94 A;  2VG7 A;  3JSM A;  1HQE A;  2XHB A;  3AVK A;  3O4Q A;  3ZSV A;  3S3N A;  5C25 A;  4O4G A;  2G8I A;  5CYM A;  5DMR A;  3L2Q A;  1J5O A;  4KI4 A;  1UWB A;  3TAB A;  4DSL A;  1VSL A;  1VSD A;  4CJF A;  1JLQ A;  1L3U A;  2F8T A;  3RMC A;  1X9S A;  4CF8 A;  3SUP A;  2HMI A;  4OVL A;  4F3T A;  5HLF A;  1SKW A;  3TAG A;  4FJ9 A;  3VQE A;  1Y97 A;  1NJX A;  3ZT3 A;  1QSL A;  3VQA A;  4CFC A;  3SI6 A;  3JYT A;  1WSF A;  3TAF A;  3K5L A;  1Q9Y A;  4FZX C;  3OYK A;  1NK6 A;  1FK9 A;  4ID1 A;  1SL1 A;  2PZS A;  4OGC A;  5KRS A;  1U4B A;  3AVL A;  3NF8 A;  4ID5 A;  4B9U A;  1KLM A;  2VWJ A;  1YVU A;  3KD5 E;  1RBU A;  1G15 A;  4DSF A;  5KTQ A;  3NE6 A;  3B6O A;  3QET A;  4E0D A;  3KK1 A;  4E7H A;  5FDL A;  4BDY A;  1NK7 A;  4ELV A;  2OA8 A;  3OJU A;  4PUO A;  1QTM A;  2KFZ A;  1RTI A;  3MXM A;  1XI1 A;  4FJ5 A;  2OPR A;  4FZY A;  2HND A;  4FK0 A;  4O0J A;  3ZT2 A;  1J53 A;  4N76 A;  5FRM A;  1U48 A;  3IRX A;  4QAG A;  4CF1 A;  2BAN A;  3VQ8 A;  1CZB A;  3M8Q A;  4ELT A;  3HVR A;  2G8V A;  2I5J A;  2LSN A;  3S9H A;  3LP0 A;  4DSK A;  4FLZ A;  4H8K A;  4FLW A;  4W5Q A;  2HVH A;  4CJK A;  4ICL A;  4TSX A;  5E41 A;  2G8K A;  4DQI A;  1EKE A;  3OYG A;  2B4J A;  3V9U A;  4FVM A;  2D0A A;  3G0Z A;  3NF9 A;  3SUN A;  2HHT A;  3KK2 A;  1N5Y A;  3SUQ A;  1B92 A;  3F73 A;  2XY5 A;  2OZM A;  2FBX A;  4W5O A;  4DMN A;  4HVJ A;  3LAK A;  1YTA A;  4F4K A;  3AA5 X;  4LY7 A;  3RRG A;  2HHV A;  2JLE A;  1LV5 A;  1UAX A;  3AVI A;  4Z4E A;  2AJQ A;  4RW4 A;  3O4N A;  4GMJ B;  4DG1 A;  4PA1 A;  3SJJ A;  1X9W A;  2B6A A;  1S1V A;  5JS1 A;  4LD0 A;  2HHX A;  1QQC A;  4O5B A;  1KLN A;  4DU1 A;  4JS5 A;  3NBP A;  4CFD A;  4DFP A;  4C8N A;  3AO5 A;  4IG0 A;  1TGO A;  4CEO A;  3QIP A;  3CFP A;  1C0U A;  3DLG A;  1SKS A;  1I3A A;  3NHG A;  3RMD A;  4EZ9 A;  4AH9 A;  3K57 A;  4FXD A;  3PY8 A;  1S9E A;  1X9M A;  4J2D A;  3HVT A;  2VG5 A;  4CHQ A;  4OLA A;  4IFY A;  3NGI A;  3QIO A;  2FBT A;  3ZSY A;  3LPT A;  1JLB A;  3AVB A;  1LW2 A;  2F96 A;  2ZQB A;  4OPK A;  2RN2 A;  1GOB A;  3L3U A;  3V81 A;  3TAE A;  1UA1 A;  3KTQ A;  4HUF A;  4CJ4 A;  3QNO A;  3PO5 A;  3BGR A;  1NKC A;  3K59 A;  1RTH A;  1C1A A;  5SWM A;  1VSK A;  5SZT A;  1KVA A;  3VA3 A;  4AHC A;  1W9H A;  2XY6 A;  3T1A A;  1CLQ A;  4O0I A;  1DTQ A;  1VSF A;  4LSL A;  1RBT A;  4CGJ A;  4MQ3 A;  2Z1J A;  3T3F A;  5J2M A;  2YNH A;  1IH7 A;  3KLG A;  2IDO A;  3U6F A;  1ASW A;  5KGX A;  3HM9 A;  1KTQ A;  1VSM A;  3C6U A;  5T7B A;  3ZSR A;  3OYE A;  2G8U A;  4NCA A;  2HHS A;  4K8X A;  3SQ1 A;  4C8L A;  1D5A A;  1I39 A;  4CF2 A;  3OVN A;  3P1G A;  1VSE A;  2O4G A;  1TKX A;  3SPZ A;  4KFB A;  4DFK A;  1KFS A;  2P5O A;  4FLV A;  5HRO A;  2WON A;  1NJZ A;  3WNE A;  3NF7 A;  5CY4 A;  2GUI A;  2D0B A;  4M3R A;  3ZSO A;  4KTW A;  4L8R B;  3G10 A;  4CJP A;  2A1R A;  2Y1I A;  4AHT A;  4LH5 A;  4K8Z A;  3RR8 A;  3VQC A;  4HUG A;  2OPQ A;  1Z26 A;  3AO1 A;  4DTM A;  4DTX A;  4CJS A;  3RR7 A;  1C1B A;  1BHL A;  1QSS A;  1BGX T;  4H4O A;  1RT1 A;  2OYQ A;  3T19 A;  2IOC A;  3V4I A;  3KD1 E;  1RT5 A;  3CM6 A;  1TAU A;  3CM5 A;  4E7K A;  1HYZ A;  4Y1C A;  3AVH A;  1C6V A;  4UQG A;  4BE2 A;  3VA0 A;  2R7Y A;  1HRH A;  4DQS A;  1QE1 A;  3CYM A;  4CHO A;  4CER A;  3QES A;  1HYS A;  1ZBF A;  4HTU A;  3OS2 A;  3F9K A;  3LZJ A;  2A1S A;  4XIU A;  1T7P A;  3SV3 A;  2HW3 A;  3VQ4 A;  1EX4 A;  1BIU A;  4IG3 A;  2FC0 A;  1BCO A;  3NH0 A;  1F21 A;  1VRT A;  4M41 A;  4GVM A;  3ALY A;  3OYF A;  5I42 A;  4F2R A;  3S3O A;  4DQR A;  3I0R A;  4DTP A;  4DTU A;  4Q0B A;  1IKY A;  1RDD A;  1JL2 A;  2IC3 A;  4B8A B;  3DM2 A;  4B8C A;  4CEC A;  1UA0 A;  3OYH A;  4BWJ A;  3TAM A;  4CJ3 A;  3LPU A;  3P5J A;  1R0A A;  3HP9 A;  4PWD A;  4DFJ A;  3ZT4 A;  4C8K A;  2HHW A;  4DSI A;  1TL3 A;  4RW7 A;  2F8S A;  1C1C A;  1EP4 A;  4DU3 A;  4WE1 A;  1A5X A;  3HL8 A;  3SQ2 A;  3LDS A;  4M3Y A;  3VN5 A;  1WN7 A;  1WSG A;  3VQ7 A;  1IKV A;  3LWM A;  3ASM A;  1HMV A;  2G8H A;  1NJY A;  3PX0 A;  1UOC A;  5KGW A;  2EX3 A;  3OY9 A;  4FLU A;  4ZTJ A;  4Z4G A;  4QCL A;  1Z25 A;  2FBV A;  1TK8 A;  4CJV A;  3ISN C;  2YNG A;  4M45 A;  3SQ4 A;  4B9N A;  3SCX A;  1HQU A;  4B9V A;  3L2R A;  1RDC A;  1WLJ A;  2DFH A;  1SKR A;  4M3U A;  2P1J A;  3ZT1 A;  3L2V A;  3S3M A;  1XC9 A;  3O3H A;  4FM0 A;  3HK2 A;  1D9F A;  4M3W A;  4AHR A;  2HHU A;  3E01 A;  3OYI A;  3KLF A;  3M8P A;  4M3Z A;  1T05 A;  3AVG A;  2YNI A;  3LAN A;  4DSJ A;  3DRR A;  4CGH A;  4FJH A;  3K2P A;  4NYF A;  3D45 A;  3QEX A;  4B9L A;  4FJJ A;  3H08 A;  4KPY A;  3ZT0 A;  4PY5 A;  3SPY A;  4JRP A;  2O4I A;  3RTV A;  3RMA A;  3V9S A;  1DTT A;  2P51 A;  4KRE A;  1VRU A;  3NFA A;  1WSE A;  3LAM A;  1L3V A;  1RNH A;  5J1E A;  1TK0 A;  3CFO A;  4E89 A;  1XWL A;  4N5S A;  4CCH A;  1O1W A;  3NCI A;  3BDP A;  3QER A;  4AHV A;  1HNV A;  2ATQ A;  2VG6 A;  1HJR A;  1BQN A;  1RBR A;  4DF4 A;  4ELU A;  1CXU A;  4CGF A;  1L3S A;  4E3S A;  3HYF A;  3MEG A;  3U3G A;  4KI6 A;  4DTN A;  5K14 A;  4FLX A;  4CFB A;  4HCB A;  3LWL A;  1J9A A;  1C0M A;  4CED A;  4HUE A;  1L5U A;  4M42 A;  1ZBI A;  2X74 A;  1YT3 A;  4CJL A;  4B3O A;  3DLE A;  4G1Q A;  4FJ7 A;  1GOC A;  4IFV A;  3V1O A;  3VQB A;  4DS5 A;  4Y1D A;  1JLC A;  3MXI A;  4NYN A;  1TKD A;  2IS3 A;  3AV9 A;  3AVF A;  2NUB A;  5CZ1 A;  1NK5 A;  1GOA A;  4BAC A;  1HYV A;  3LAL A;  1FKP A;  1ITG A;  1RBV A;  3ZSW A;  3IAY A;  1JL1 A;  5HRS A;  4PQU A;  4FYD A;  4E7J A;  4O55 A;  2XRI A;  1IKW A;  2GV9 A;  4Z0U A;  4CIF A;  4DLE A;  4HCC A;  3L3V A;  3RMB A;  1NJW A;  5HRP A;  3MEE A;  3QIN A;  1HNI A;  4CGG A;  2IAJ A;  2WOM A;  4RW6 A;  4KHN A;  3K5M A;  4M3X A;  1LAW A;  4CJT A;  3HJF A;  1VSH A;  4R5P A;  4B9M A;  4DTO A;  2OPP A;  1LWE A;  3QLH A;  1NK4 A;  3QEI A;  1BL3 A;  2FBY A;  3DOL A;  1SL0 A;  1X1P A;  1BCM A;  1IKX A;  3KLH A;  3ULD A;  3HXM A;  4DTS A;  1BQM A;  1EET A;  2RF2 A;  2YNF A;  1RDB A;  4CEE A;  1NOY A;  1MU2 A;  1BIS A;  4EP5 A;  2IGI A;  4OPJ A;  3SUO A;  4Z4H A;  3TAQ A;  4FK4 A;  2OPS A;  1ZBL A;  4C8O A;  3M8S A;  4YFU A;  1TKZ A;  1D9D A;  3NGY A;  3NF6 A;  1TAQ A;  3V1Q A;  1VSJ A;  1WAF A;  3MXJ A;  3CQ8 A;  4CGD A;  4FJN A;  3AVC A;  1BIZ A;  4CES A;  4FM1 A;  4FM2 A;  2PY5 A;  5HP1 A;  4CF9 A;  4J2B A;  1K6Y A;  1VK0 A;  4ZTF A;  4E1M A;  4DFM A;  3EYZ A;  4I2P A;  5C24 A;  1NK0 A;  3NH1 A;  1WSH A;  4AHU A;  1QHT A;  2KTQ A;  2OZS A;  3IG1 A;  3ZSX A;  4CJ5 A;  3O3G A;  1KCF A;  1TKT A;  2DFF A;  3B6P A;  3V1R A;  2BGG A;  4OLB A;  4FJM A;  1ASU A;  4JS4 A;  1T03 A;  1S1X A;  1QS4 A;  3THV A;  1A5W A;  5FRO A;  1NOZ A;  3U3Y A;  3NGZ A;  3QEP A;  1RBS A;  3TAP A;  3DLR A;  4CEZ A;  1FXX A;  1S5J A;  3DI6 A;  3AVM A;  4DQQ A;  3TR8 A;  4B9T A;  4OGE A;  4CJW A;  3HT3 A;  3SYZ A;  4CEA A;  3HP6 A;  3VQD A;  4E19 A;  1TK5 A;  2Z1G A;  3OYJ A;  1ZBH A;  4F2S A;  1JLG A;  2JGU A;  2QXF A;  1ZYQ A;  4ZHR A;  3EY1 A;  4FZZ A;  1NKE A;  2KFN A;  4CGI A;  1IO2 A;  4CJQ A;  3VQP A;  3A2F A;  2QK9 A;  2X6N A;  3CG7 A;  5JS2 A;  3TWH A;  3QNN A;  5C42 A;  1WSJ A;  4J2E A;  4HHT A;  1J54 A;  4CHY A;  4F3O A;  4CIG A;  1JLE A;  1RT7 A;  4MFB A;  4YNQ A;  3KJV A;  1T8E A;  4B9S A;  4CHZ A;  3C6T A;  4AHS A;  3KLI A;  3L2W A;  3PO4 A;  2YKM A;  3VQ6 A;  4KB0 A;  4IKF A;  1S1W A;  3VQ5 A;  3AA3 A;  5D3G A;  2YKN A;  1REV A;  4CHN A;  3L2U A;  3SV4 A;  1CXQ A;  1RT3 A;  1SV5 A;  4RG8 A;  3SQ0 A;  3RWU A;  3AO2 A;  3OYM A;  2YHA A;  3AVJ A;  3DOK A;  3D0P A;  5J2Q A;  3OS1 A;  4KAZ A;  4DLG A;  1XHZ A;  1NK9 A;  4O44 A;  4DQP A;  4KV8 A;  3HPH A;  4RW8 A;  4E1N A;  5I3U A;  1JXE A;  2ZD1 A;  4FJL A;  1RT6 A;  3LP2 A;  3QO9 A;  5KI6 A;  2P5G A;  4KHS A;  2EHG A;  4Z4F A;  1JXB A;  3ZSQ A;  2ETJ A;  1WSI A;  4QOZ B;  4CEB A; 
#chains in the Genus database with same CATH topology
 4A59 A;  1NGA A;  1S6P A;  2W6K A;  3WEE A;  4M3T A;  3MK6 A;  1IV0 A;  3KKS A;  3Q7B A;  3KK3 A;  4N41 A;  3AVN A;  2PYJ A;  2KHO A;  4H0O A;  1KVB A;  5AQN A;  1JCF A;  4GV9 A;  4CK1 A;  2W6L A;  1NKB A;  4KHW A;  1RT2 A;  3CJ1 A;  5TKW A;  1YI2 N;  2PYL A;  4JLH A;  4Z4C A;  1ASV A;  1QQN A;  2HVI A;  5J2P A;  1FW6 A;  3PUF A;  5HRR A;  1VSI A;  2YHX A;  3LZI A;  3OS0 A;  5BPN A;  5KRT A;  1GLD G;  3CCQ N;  3TAN A;  1GLC G;  3DMJ A;  4JKG B;  4E7L A;  3R8E A;  5HRN A;  3I8D A;  3AO3 A;  1XUP O;  3QEW A;  2RKI A;  4DS4 A;  4N47 A;  4FWN A;  3OYB A;  4H0T B;  4FLY A;  3PIO L;  2X78 A;  4W5T A;  3VF6 A;  4J2A A;  3WNF A;  5HBM A;  1Q9X A;  3M1F A;  4KB1 A;  3KLE A;  1IJJ A;  4FK2 A;  3K58 A;  1U47 A;  5BRE A;  4EHT A;  2XO7 A;  4BE1 A;  1NGD A;  2G8U A;  2HST A;  2G8F A;  3SJH A;  4DWI A;  2O8E B;  3ENH A;  3CC2 N;  3DXK A;  4G9Z A;  3MN9 A;  4CI6 A;  3BP8 A;  1LW0 A;  1K9M O;  4KKO A;  3VEV A;  5M1N A;  5AQZ A;  4CFA A;  4I6M A;  4WYB A;  1T3V A;  3AGR A;  2B5J A;  1NM1 A;  3V9Z A;  3ENO A;  3HTV A;  4OKE A;  1I94 K;  3EL2 A;  3A5M C;  3M5R A;  3OA9 A;  1E4F T;  2Z1I A;  3JS6 A;  3LL3 A;  1KD1 O;  4AIL C;  1W0H A;  3ID8 A;  4N56 A;  3OYL A;  4FJX A;  3MN5 A;  3JSM A;  3AVK A;  4ISF A;  3S3N A;  5AQF A;  3CMA N;  5DMR A;  3WXJ A;  4ILH A;  1OVY A;  3THX B;  3J7Z O;  3BEX A;  4JAX A;  3RMC A;  5EY4 A;  5C2F A;  4F3T A;  4FJ9 A;  3QIC A;  1WUA A;  3IKM A;  1HNZ K;  1NMN A;  3SI6 A;  1OH8 A;  3S41 A;  4A61 A;  1Q9Y A;  3OYK A;  1NK6 A;  2E1Z A;  5KQD A;  2PZS A;  4DHY A;  3VET A;  3CQX A;  3KD5 E;  2VWJ A;  1YVU A;  3DXM A;  3VPZ A;  5KTQ A;  3NE6 A;  3B6O A;  2HF3 A;  3P4I A;  3KK1 A;  1NK7 A;  2OA8 A;  3OJU A;  4K43 A;  1N8R O;  5DM7 L;  1Q18 A;  1NGF A;  1N33 K;  4O0J A;  1J53 A;  4N76 A;  5C10 A;  1BG3 A;  4MO5 A;  5FRM A;  2F9W A;  3MN7 A;  4CF1 A;  5AZJ A;  1CZB A;  2I5J A;  3S9H A;  1DGK N;  3ZLJ A;  3AAQ A;  4WFA L;  1IBL K;  3VF4 A;  3VTI A;  4DR1 K;  2B4J A;  2JWK A;  2D0A A;  4JKA A;  3KK2 A;  1N5Y A;  3TTF A;  4PKH A;  2FBX A;  4F4K A;  3CIP A;  3LAK A;  4HVJ A;  2F7T A;  4LY7 A;  3RRG A;  1LV5 A;  4GMJ B;  2E20 A;  1S1V A;  4LD0 A;  4DUZ K;  2HHX A;  3N4P A;  2VYP A;  3THY B;  3H1V X;  5GIO A;  4JS5 A;  3TTC A;  5EOY A;  2F9T A;  4CEO A;  4FVU A;  3QIP A;  4BC2 A;  1I3A A;  4CZI A;  4EZ9 A;  3K57 A;  3MMV A;  4J2D A;  3G4S N;  3RVC A;  3NGI A;  3QIO A;  5AQV A;  3ZSY A;  2ZQB A;  2Q2R A;  4FWK A;  4EHU A;  3L0Q A;  1HKB A;  3KTQ A;  3ZET B;  1YIJ N;  1NKC A;  5SWM A;  3VA3 A;  3P38 A;  3VGM A;  2UUC K;  1ZC6 A;  3T1Y K;  3L4I A;  3MWP A;  2HVH A;  3OYE A;  1VSM A;  4DR2 K;  2E2O A;  1MDU B;  3OVN A;  2P9U A;  2J4R A;  3SPZ A;  1TKX A;  4LFB K;  4KFB A;  2P5O A;  3WNE A;  5CY4 A;  2D0B A;  4M3R A;  3BF3 A;  1HR0 K;  3F5T A;  3RR8 A;  4HUG A;  4K42 A;  4CJS A;  3RR7 A;  3LDL A;  3FLC O;  2IOC A;  4JN4 A;  3CM6 A;  4YOY A;  4Y1C A;  2R7Y A;  5KQ8 A;  3QES A;  4CER A;  3F9K A;  1W7A A;  4XIU A;  4H5V A;  1EX4 A;  4IEI A;  2Q0R A;  1BO5 O;  5M1Q A;  2FC0 A;  1BCO A;  1S22 A;  1F21 A;  4WQ5 A;  3ALY A;  3GE1 A;  3S3O A;  4B8C A;  2IC3 A;  4B8A B;  4BWJ A;  1BA0 A;  4CJ3 A;  3P5J A;  3HP9 A;  4PWD A;  3ZT4 A;  4RW7 A;  1EP4 A;  4ISG A;  3O9R A;  5HOO A;  3VQ7 A;  1IKV A;  3R3L A;  1UOC A;  3BF1 A;  4ZTJ A;  4DV2 K;  3FZK A;  5BRF A;  1EWQ A;  2DFH A;  1SKR A;  3QBX A;  5JVG L;  3E9P A;  3I8B A;  3O3H A;  1VAZ A;  4AHR A;  1QQM A;  2E8A A;  4M3Z A;  3CME N;  1T05 A;  1X9J A;  2O8C A;  2A41 A;  2ASM A;  4ILJ A;  1VQ9 N;  4PY5 A;  4JRP A;  3O4W A;  3VTH A;  2O4I A;  3RMA A;  4WQ4 A;  2P51 A;  4KRE A;  3CFO A;  5AQW A;  1XWL A;  4N5S A;  4CCH A;  4EFH A;  1O1W A;  3BDP A;  3UKU A;  4QS9 A;  5AQU A;  1HJR A;  1RBR A;  3MEG A;  3DJC A;  3MCP A;  4CED A;  1R59 O;  1YT3 A;  1YXQ A;  3TU5 A;  3TSU A;  3DLE A;  4G1Q A;  4JHD A;  3O1B A;  1Z6R A;  4IFV A;  2BTF A;  4Y1D A;  1JLC A;  4ILG B;  4XEI A;  3MXI A;  3AV9 A;  3LAL A;  1RBV A;  1ITG A;  4BRI A;  1JL1 A;  5HRS A;  4PQU A;  4E7J A;  1IKW A;  4Z0U A;  4DLE A;  4CIF A;  5HRP A;  1J6Z A;  5AQQ A;  1HNI A;  2HBJ A;  1LAW A;  4GY2 B;  4JKB A;  1LWE A;  3QEI A;  2FBY A;  4BRP A;  3DOL A;  3KVG A;  3FZH A;  1BCM A;  4DTS A;  1BQM A;  2RF2 A;  2ZGZ A;  1BIS A;  4EP5 A;  2IGI A;  1NG9 A;  3SUO A;  4FK4 A;  2Q1N A;  3M8S A;  1TKZ A;  3NF6 A;  1NMD A;  1TAQ A;  3BZC A;  4CGD A;  4FM1 A;  1VK0 A;  4BC4 A;  4E1M A;  4U67 L;  3D2F B;  1NK0 A;  3NH1 A;  1KQS M;  1QHT A;  3IG1 A;  3ZSX A;  1KCF A;  4JI5 K;  1GLA G;  2P9N A;  3B6P A;  3CJC A;  4FJM A;  1XMQ K;  2VGM A;  3H6E A;  1JJ2 M;  4HWI A;  4H5N A;  4BGA A;  5BN8 A;  3VQD A;  4E19 A;  2Z1G A;  3SK3 A;  4DV3 K;  4IOX A;  4ZHR A;  3EY1 A;  4K25 A;  2KFN A;  4CGI A;  2QK9 A;  2X6N A;  3TWH A;  5JS2 A;  3QNN A;  5C42 A;  4CHY A;  4CD1 A;  1RT7 A;  3KJV A;  1T8E A;  3FFK B;  2Q0U A;  4B9S A;  4CHZ A;  3KLI A;  4YY3 K;  3D7E O;  2YKN A;  2E2P A;  3SQ0 A;  1CXQ A;  1EWR A;  1RT3 A;  1JCG A;  3AO2 A;  5J2Q A;  3PSI A;  4O44 A;  4KV8 A;  3HPH A;  1JCE A;  4E1N A;  2YJE A;  4FJL A;  4KHS A;  3LP2 A;  1XMO K;  3C65 A;  2P5G A;  2DPN A;  3A5O C;  3ZSQ A;  2UYT A;  2OCE A;  3O1W A;  4X66 K;  4CEB A;  2O8F B;  5AQR A;  3OYC A;  3AA2 A;  2YHB A;  4PL7 A;  2DY4 A;  1DEJ A;  5BPL A;  1LOT B;  2BDP A;  2WBN A;  4BRL A;  1NJI O;  1X3N A;  1FKO A;  3OYA A;  3O08 A;  1VQP N;  3VQQ A;  1TYQ A;  4BDP A;  3ZEU B;  3RRH A;  4KHY A;  3HPO A;  2QWQ A;  2CH5 A;  5GAE P;  3I33 A;  4H4M A;  3CJA A;  4NO7 A;  5GAD P;  2YCH A;  3MAQ A;  3N4Q A;  2YHW A;  4KHQ A;  5LJV A;  3VEW A;  4V19 S;  2VWK A;  3IDH A;  4YOX A;  1RTJ A;  2HMP A;  3MCA B;  4FJ8 A;  4RW9 A;  1WNS A;  1JKH A;  1CZ9 A;  3OYD A;  4DTJ A;  5KPT A;  1QSY A;  5CZ2 A;  2XY8 A;  2W42 A;  1JLF A;  3CFR A;  4JRQ A;  3AVA A;  2QKB A;  4FLT A;  1OKJ A;  1FJG K;  3V9W A;  2QWL A;  4IFE A;  4W5R A;  2NRW A;  3QDK A;  4K41 A;  1N34 K;  4GKJ K;  1DLO A;  3Q7C A;  2P9L A;  1L3T A;  3AA4 A;  3K5N A;  5EX5 A;  1RT4 A;  1HPM A;  2G8W A;  2P9I A;  2HNZ A;  4L8R B;  4OKK A;  5AZJ B;  3NH2 A;  4B3S K;  1BI4 B;  1YTU A;  2D1K A;  1U49 A;  3U9Z A;  2Q3S A;  3V6D A;  3I0S A;  1D8Y A;  3NVK A;  1VQN N;  2ZF5 O;  4CZH A;  2E4L A;  4Z4I A;  3PX4 A;  3GDQ A;  1RCH A;  1C0T A;  3ZSZ A;  1WAJ A;  5C12 A;  1YHQ N;  4I9Q A;  4DUY K;  4OKJ A;  3C95 A;  4OJR A;  3LM2 A;  4LF5 K;  1U45 A;  5J2N A;  3M8R A;  2FSN A;  4JV5 K;  4BE0 A;  4O8U A;  5FPM A;  3KWG A;  2QKK A;  4NXN K;  3WNG A;  1Q86 O;  1T6C A;  3DYA A;  5AR0 A;  2VQE K;  1S1U A;  5DK5 A;  1YJN N;  2BUP A;  3O4Q A;  2P9K A;  4CVN E;  3HBT A;  2G8I A;  5I9E B;  4YDU A;  4CJF A;  1YUW A;  3CCJ N;  3L4Q A;  1X9S A;  4CF8 A;  2HMI A;  4OVL A;  3SMP A;  3VEY A;  4DR4 K;  3SAF A;  5LMN K;  3TAG A;  3E9O A;  2I7P A;  1EQY A;  3HSC A;  4X64 K;  4JK8 A;  5JIC A;  2CGJ A;  1WSF A;  4IEE A;  4FZX C;  4ID1 A;  3IUC A;  3R6M A;  4DSF A;  4IDH A;  1C0G A;  2E1Y A;  3QET A;  4E7H A;  2P9U B;  1QTM A;  3RSE A;  3MXM A;  2OPR A;  2NRX A;  2HND A;  3OW2 M;  3IRX A;  5AQX A;  5ELZ A;  3JAM O;  2YHY A;  4A2A A;  3D2E A;  3QML A;  4JK7 A;  2G8V A;  3CC7 N;  5TKY A;  1KAY A;  4FLW A;  1MWK A;  4W5Q A;  3A0I X;  4CJK A;  4X65 K;  4PL8 A;  5F1X A;  3OYG A;  1HNW K;  4NXM K;  5AZI A;  4FVM A;  3HZ6 A;  1VQO N;  2HHT A;  3SUQ A;  1B92 A;  2XY5 A;  2OZM A;  2VQF K;  4W5O A;  4DMN A;  1YTA A;  3AA5 X;  3CD6 N;  1HKG A;  1ESV A;  2JLE A;  1UAX A;  3ZYY X;  2HHH K;  2B6A A;  5JS1 A;  5M1K A;  1QQC A;  4JI7 K;  5AQS A;  2RHK A;  4DU1 A;  1NGG A;  4BRE A;  4DFP A;  2HOE A;  1TGO A;  3CFP A;  1C0U A;  4JI6 K;  5AQK A;  4DCH A;  1S72 N;  3NHG A;  3RMD A;  4FXD A;  3U9D A;  3VEX A;  2VG5 A;  1LCU A;  4IFY A;  4XH5 A;  5A2Q O;  5BPM A;  4OPK A;  2RN2 A;  1GOB A;  3L3U A;  3V81 A;  1UA1 A;  4HUF A;  4CJ4 A;  5SZT A;  2WC9 A;  5F2R A;  1NBW A;  3T1A A;  2QW9 A;  3C0B A;  1K8K B;  4MLE A;  4LSL A;  1J5E K;  2FLO A;  4MQ3 A;  2Z1J A;  3KLG A;  3U6F A;  2CGL A;  4C1N I;  3A5N C;  1ASW A;  5KGX A;  1KTQ A;  3C6U A;  5T7B A;  4NCA A;  4M7Y A;  1D5A A;  4KH6 A;  1W97 L;  3UB5 A;  2GUP A;  2O4G A;  3GBT A;  1OH6 A;  4DFK A;  1KFS A;  3K9K A;  5HRO A;  1EO1 A;  3VMF B;  2GUI A;  4DQ8 A;  3ZSO A;  1HUX A;  4KTW A;  3WUH A;  3HOS A;  1NGE A;  3VQC A;  1BOT O;  4DTX A;  4JHD B;  1C1B A;  1BHL A;  1QSS A;  1RT1 A;  3T19 A;  1RT5 A;  1XNQ K;  3CM5 A;  4GV6 A;  5AQM A;  4UQG A;  3AVH A;  4DQS A;  1QE1 A;  4CHO A;  4JKF A;  1ZBF A;  3OS2 A;  2A1S A;  1U6Z A;  2QWM A;  5LJW A;  1GLB G;  4IG3 A;  3C6A A;  2HBL A;  3G71 N;  3E66 A;  3LDO A;  4AQY K;  2OTL N;  4Q0B A;  3THW A;  4DTU A;  3EE8 A;  4DR7 K;  1IKY A;  4BG8 A;  1JL2 A;  1RGI A;  1UA0 A;  2HBK A;  4A57 A;  3LPU A;  2P9S A;  4DFJ A;  1TL3 A;  3WQT A;  4JI0 K;  1C1C A;  3SQ2 A;  4M3Y A;  3KK7 A;  3VN5 A;  3CPW M;  4WQ4 C;  3LWM A;  1NJY A;  4QCL A;  3OY9 A;  3CCE N;  1TK8 A;  3UKR A;  2YNG A;  3SQ4 A;  3SCX A;  4BG9 A;  1RDC A;  2P1J A;  2IVO A;  4JI1 K;  1D9F A;  3LDN A;  1T44 A;  1T6D A;  4M3W A;  2HHU A;  3KLF A;  1BWF O;  3M8P A;  3LAN A;  3DRR A;  2D4W A;  3MX5 A;  4NYF A;  5DM6 L;  1NGC A;  4LF7 K;  3ZT0 A;  4ISE A;  3V9S A;  2P9P B;  4NLB A;  4CZJ A;  3NFA A;  3CI5 A;  1RNH A;  1M90 O;  4IO9 L;  1BQN A;  3P39 A;  4CBW A;  4CGF A;  2O8D A;  3HYF A;  3U3G A;  1U2V A;  5K14 A;  4HCB A;  1J9A A;  4HUE A;  4M42 A;  1ZBI A;  3A8Y A;  4GNI A;  1ATN A;  1BDG A;  4IJN A;  4FJ7 A;  4JNE A;  2FXU A;  3I55 N;  1TKD A;  1KXP A;  3ZSW A;  3IAY A;  4CZG A;  4FWS A;  4HCC A;  3L3V A;  1NJW A;  1OH5 A;  4WFN L;  4CBX A;  2O8B A;  4CGG A;  2A42 A;  3K5M A;  5B8H A;  4CJT A;  4DTO A;  3LDQ A;  3R9P A;  2YJF A;  1X1P A;  4BRC A;  1IKX A;  1BUP A;  3KLH A;  3HXM A;  2HF4 A;  3KWI A;  3ULD A;  1IG8 A;  4CEE A;  5H1S Q;  1MU2 A;  4OPJ A;  4CJ7 A;  3TAQ A;  3O9Q A;  1GLJ O;  4H5T A;  4WF9 L;  5LY3 A;  3V1Q A;  3MXJ A;  1VQ7 N;  1QZ6 A;  2PAV A;  4OPH A;  3AVC A;  3EO3 A;  1K6Y A;  2QWP A;  1WSH A;  4AHU A;  2OZS A;  1OH7 A;  3V1R A;  2DFF A;  3FZL A;  1ATS A;  1ASU A;  2IVP A;  2UXB K;  1S1X A;  4NB4 A;  3U3Y A;  1NOZ A;  4OPA A;  3QEP A;  3TAP A;  1QVG M;  1FXX A;  1S5J A;  4JD2 A;  3AVM A;  3ATV A;  2YI1 A;  4OGE A;  4CEA A;  1TK5 A;  1YAG A;  1ZBH A;  4DV7 K;  1GLE G;  2QXF A;  1ZYQ A;  4FZZ A;  3OBY A;  3A2F A;  3O5B A;  4RWT A;  5GIP A;  2NRR A;  4MDB A;  4MFB A;  3HM8 A;  4AHS A;  3L2W A;  2HBM A;  3H3O B;  3VQ5 A;  4PKG A;  4BRO A;  2V7Y A;  4RG8 A;  3SAH A;  3OYM A;  2YHA A;  3EE9 A;  4KAZ A;  4RW8 A;  4BRN A;  4R79 A;  1JXE A;  4JKG A;  1RT6 A;  5KI6 A;  4Z4F A;  1JXB A;  4BGB A;  4H03 B;  4B3R K;  4QOZ B;  4GKK K;  1SQK A;  3NDK A;  2D0C A;  4M7X A;  3SLC A;  5CE3 A;  1TVR A;  3FFI A;  2BE2 A;  5FRN A;  4WCE L;  3DRP A;  4BQZ A;  3AO4 A;  1LAV A;  2DFE A;  4CK3 A;  3LP1 A;  4FJG A;  4KBO A;  3TAR A;  1LWF A;  3J8A A;  3C7N B;  2A5X A;  3FGU A;  2VWB A;  4I9L A;  2YV0 X;  4IDK A;  4CEQ A;  3DLK A;  2PFU A;  4XH4 A;  1IBM K;  2O8E A;  3OJS A;  4KO0 A;  4BR7 A;  1KSP A;  3WNH A;  4CIE A;  3MDQ A;  3O8M A;  2ITG A;  4CK2 A;  4FJK A;  5AFU H;  1D4X A;  4JKC A;  1NGJ A;  2ZJQ L;  2A6A A;  3SZ2 A;  3QB0 A;  1GLL O;  4FCY A;  4JYA K;  2KZM A;  5CR4 A;  5EVZ A;  1YJ9 N;  4DV0 K;  2HNY A;  2QTD A;  1B9D A;  4CEF A;  3CCR N;  1TV6 A;  5JVH L;  3PIP L;  2HB5 A;  3E1Y A;  4I7F A;  1S9G A;  2NRV A;  3T69 A;  3WEE B;  2I7N A;  3DLB A;  4CHP A;  4IOA L;  1TUY A;  1RTD A;  5AQP A;  2E88 A;  3NAE A;  3MX2 A;  3VES A;  3RSE B;  2KLA A;  2X6S A;  4DF8 A;  4BDZ A;  5EU7 A;  4EP4 A;  4BR0 A;  2E2N A;  2UXC K;  2AP1 A;  1SL2 A;  4DU4 A;  2GBZ A;  1KRP A;  4A5A A;  3PX6 A;  2Y1J A;  4IBN A;  3HST B;  3SNN A;  3VQ9 A;  1HPZ A;  1C0F A;  3OYN A;  1EXQ A;  3BY5 A;  1RDA A;  3PV8 A;  2E6L A;  4EZ6 A;  5AQY A;  3DLH A;  1N6Q A;  3ZCM A;  2GEM A;  3ID6 A;  4CJR A;  4BRQ A;  4DSE A;  4FW2 A;  4BWM A;  4CZK A;  5AQL A;  4Q5V A;  3IMX A;  3EZ5 A;  1S1T A;  2W40 A;  3CCV N;  1XHX A;  1DT9 A;  5KPZ A;  4LF6 K;  2XHB A;  4DR6 K;  3ZSV A;  5C25 A;  1IBK K;  3L2Q A;  3O9S A;  1J5O A;  3TAB A;  4DSL A;  1VSD A;  3H45 C;  1JLQ A;  3SUP A;  4QS8 A;  4DR5 K;  5HLF A;  3CPE A;  4OX9 K;  3VQE A;  3GOI A;  3U8X A;  1HKC A;  4AM6 A;  3CER A;  3VQA A;  3THY A;  5E26 A;  4CBU A;  3K5L A;  1FK9 A;  5KRS A;  1U4B A;  3AVL A;  3NF8 A;  1KLM A;  4K0K K;  5ADX H;  5AQO A;  3B8A X;  3DXK B;  4BR4 A;  3CF5 L;  2ZJR L;  2ASO A;  5FDL A;  4BDY A;  4I6M B;  4YOR A;  4IXC A;  1XI1 A;  4FJ5 A;  1VQ8 N;  4FZY A;  4FK0 A;  5AQG A;  3ZET A;  3ZX3 A;  2BAN A;  3VQ8 A;  3WXM B;  5LMU K;  3HVR A;  4ELT A;  1QZ5 A;  5AQJ A;  3LP0 A;  4DKW A;  4JI4 K;  4RCH A;  4ICL A;  4TSX A;  3CC4 N;  2G8K A;  4DQI A;  3V9U A;  3G0Z A;  3NF9 A;  4B1W B;  2KKZ A;  3F73 A;  4FWR A;  4IO8 A;  1SS6 A;  1S3X A;  5E84 A;  2HHV A;  3H46 O;  3HRG A;  2UUB K;  3SJJ A;  1Q7Y O;  4O5B A;  1HNX K;  1KLN A;  3H1Q A;  3NBP A;  4CFD A;  4KH5 A;  3VEO A;  2NZT A;  4C8N A;  4IG0 A;  4IOC L;  3DAW A;  3DLG A;  1SKS A;  3DXM B;  4AH9 A;  4X62 K;  3M6G A;  1BA1 A;  1S9E A;  1X9M A;  5FPE A;  1ATR A;  3HVT A;  3PY8 A;  4FOE A;  4CHQ A;  4OLA A;  1V4T A;  2FBT A;  4JKH A;  1JLB A;  3AVB A;  1LW2 A;  2F96 A;  2GEL A;  1KC8 O;  1E3M A;  4FWP A;  3K59 A;  1RTH A;  1C1A A;  3R1X A;  4AHC A;  1W9H A;  1CLQ A;  1NGI A;  1VSF A;  4O0I A;  1MA9 B;  1RBT A;  3SMS A;  4CGJ A;  2GWJ A;  3WXI A;  5J2M A;  2YNH A;  3QBW A;  2IDO A;  3HM9 A;  1ZBS A;  3ZSR A;  1KAX A;  4GV3 A;  4C8L A;  1I39 A;  2EWS A;  3D6R A;  3L6Q A;  1HLU A;  5AQI A;  5JLH A;  4JK9 A;  4FL9 A;  1NJZ A;  4OO1 J;  4PKI A;  3E9L A;  3G10 A;  4FWQ A;  4CJP A;  4LF8 K;  4LH5 A;  1U2V B;  4BR9 A;  4B3T K;  2OPQ A;  1Z26 A;  4H0Y B;  3CJB A;  2Q31 A;  2UUA K;  1BGX T;  3V4I A;  3PLA A;  1NGH A;  1HYZ A;  4BE2 A;  3IFR A;  4BVP A;  1QVF M;  1T7P A;  2QI2 A;  4UY8 O;  3KHY A;  4M41 A;  1VQ4 N;  4GVM A;  4DQR A;  3I0R A;  4CEC A;  1R0A A;  2V51 B;  4QS7 A;  1VQ6 N;  3CJ9 A;  4YHH K;  2F8S A;  4DU3 A;  4WE1 A;  1A5X A;  3HL8 A;  3G25 A;  1E4G T;  4B1X B;  3EN9 A;  4IJA A;  1HMV A;  3PX0 A;  4MDA A;  2EX3 A;  5FPN A;  1Z25 A;  3ISN C;  4M45 A;  3O6W A;  4J8F A;  3DWL A;  3L2R A;  3L2V A;  3S3M A;  3AY9 A;  2QWR A;  3BUZ B;  3E01 A;  4WFB L;  2NRT A;  3OYI A;  2YNI A;  4FWL A;  4DSJ A;  2CH6 A;  1Q82 O;  3K2P A;  1XNR K;  4B9L A;  3QEX A;  4YOT A;  5BN9 A;  4KPY A;  3SPY A;  5M1O A;  1DTT A;  1WSE A;  3EEQ A;  5J1E A;  4JD2 B;  3W3D A;  3QER A;  3D2F A;  1HNV A;  5CHI A;  3JXU A;  4ELU A;  1CXU A;  3W0L A;  4DTN A;  4FLX A;  1NU0 A;  4CW7 B;  1L5U A;  4B3O A;  4DS5 A;  4B1Z A;  4NYN A;  2IS3 A;  3AVF A;  5CZ1 A;  1NK5 A;  1WBD A;  1FKP A;  4FYD A;  3EZW A;  2GV9 A;  2XRI A;  3EKS A;  1WOQ A;  2GWK A;  2WOM A;  4RW6 A;  1VSH A;  1V4S A;  4R5P A;  2OPP A;  1NK4 A;  4M63 C;  4IWV A;  3WXK A;  1VQ5 N;  4BY9 C;  3SBT A;  2JWL A;  1EET A;  2O8C B;  1RDB A;  4FSV A;  1NOY A;  2WTU A;  3HI0 A;  4Z4H A;  3EKU A;  2OPS A;  1ZBL A;  1YF5 L;  4YFU A;  4EAH D;  3VGK A;  4LF9 K;  4BC3 A;  3OTO K;  1VSJ A;  1WAF A;  4LF4 K;  1SAZ A;  1P8Z A;  4CES A;  1BIZ A;  4H0X B;  4FM2 A;  2Q36 A;  3KZB A;  5HP1 A;  1ILY A;  1Z05 A;  3UKU B;  4DFM A;  3EYZ A;  4I2P A;  2KTQ A;  4WQ5 C;  2O8F A;  3QFU A;  4BR5 A;  1TKT A;  4OLB A;  4B1Y B;  4JS4 A;  5GAG P;  4DR3 K;  3CJ7 A;  1T03 A;  3CHW A;  4JI8 K;  3THV A;  5FRO A;  1DKG D;  1RBS A;  2OAN A;  4NLC A;  3ZEU A;  3TR8 A;  3WT0 A;  4YOU A;  4CJW A;  3HT3 A;  3SYZ A;  3HP6 A;  2UU9 K;  5AQT A;  1OVQ A;  3OYJ A;  1X3M A;  3J7A P;  1NKE A;  3BZK A;  4CJQ A;  1IO2 A;  2UXD K;  5AQH A;  1WSJ A;  3ULE A;  4HHT A;  4F3O A;  4MO4 A;  3OBW A;  1JLE A;  1HJO A;  5GAH P;  4YNQ A;  3C6T A;  3PO4 A;  5FLX O;  4BVO A;  4DV6 K;  1RDW X;  4KB0 A;  3AA3 A;  4A5B A;  5D3G A;  1NWK A;  3L2U A;  4MLH A;  3AVJ A;  4BRM A;  3OS1 A;  1BU6 O;  4DQP A;  3MN6 A;  5BR9 A;  5C15 A;  2ETJ A;  4CZL A;  1A5V A;  4KHP K;  2P9N B;  4B9Q A;  4KTQ A;  3OHR A;  3IS9 A;  1Q81 O;  2XY7 A;  1YJW N;  1H1V A;  3L8B A;  3M3Z A;  4FPB A;  4JI3 K;  3HO1 A;  3UIQ A;  3O3F A;  1Q8I A;  5F0X A;  4KHU A;  3MED A;  2KZZ A;  3SBG A;  1KFD A;  1BI4 A;  2CGK A;  1WB9 A;  4CJE A;  1SZ2 A;  3G6E N;  4FOI A;  4CE9 A;  4FJI A;  4BQL A;  3U4L A;  3ZX0 A;  2HHQ A;  1KVC A;  4W5N A;  2RPI A;  3VER A;  4FO0 A;  4F8R A;  3LM9 A;  5CYQ A;  2ZE2 A;  4CZF A;  4DTR A;  2FF3 B;  3O9U A;  3KKR A;  1TL1 A;  3P31 A;  4FW1 A;  4CD3 A;  4LFA K;  4NCG A;  2KW4 A;  4JI2 K;  4BR2 A;  2PBD A;  3MEC A;  1ZBU A;  3FZF A;  2ASP A;  4LC9 B;  2KQ2 A;  4H5W A;  4I2Q A;  1SUQ A;  4GW6 A;  4AF1 A;  3C6H A;  1IG9 A;  4Y0W A;  2DTU A;  4NCB A;  2E6M A;  3K5O A;  4O8K A;  3V9X A;  1TYQ B;  4KTZ A;  1B9F A;  3ITH A;  2Z1H A;  3VF2 A;  4B08 A;  1NK8 A;  4CF0 A;  4BRH A;  1S6Q A;  2D5R A;  3TI0 A;  2NRH A;  1JLA A;  2GTD A;  3CXC M;  1K73 O;  3FR0 A;  4E7I A;  3DRS A;  1U04 A;  3T1H K;  1NGB A;  4LH4 A;  1RDU A;  1RIL A;  3P83 D;  4BC5 A;  3HPG A;  3QEV A;  5EXW A;  3FE1 A;  2E2Q A;  3LP3 A;  4EIA A;  4CJU A;  1W2B M;  1N32 K;  4CZM A;  4C8M A;  1LWC A;  3KIO A;  4LSN A;  3GG4 A;  4KRF A;  4B1U B;  3C94 A;  2VG7 A;  3NVM A;  1HQE A;  4O4G A;  5CYM A;  4H5R A;  4KI4 A;  1UWB A;  3AGK A;  1VSL A;  2P9L B;  1L3U A;  5IWA K;  2F8T A;  4YOV A;  4U7B A;  5JMV A;  1G99 A;  2V7Z A;  1SKW A;  1Y97 A;  2P9I B;  1NJX A;  3ZT3 A;  1QSL A;  4CFC A;  3JYT A;  3SAG A;  3TAF A;  4DV5 K;  1SL1 A;  3FZM A;  4OGC A;  3TPQ A;  4ID5 A;  4JKE A;  4B9U A;  4HTL A;  1RBU A;  1G15 A;  2FF6 A;  4E0D A;  2QM1 A;  4ELV A;  4PUO A;  1WBB A;  2KFZ A;  1RTI A;  3ZT2 A;  1U48 A;  2A40 A;  4QAG A;  3M8Q A;  2ZM6 K;  1P90 A;  2LSN A;  3PSF A;  1K8K A;  4DSK A;  1NNE A;  1O13 A;  3F9M A;  4FLZ A;  4H8K A;  5E41 A;  1EKE A;  1TUU A;  4A2B A;  3SUN A;  5HL7 L;  2QA4 N;  2P9K B;  2QXL A;  3J81 O;  5BRD A;  3AVI A;  4DV1 K;  4Z4E A;  3O80 A;  4RW4 A;  3O4N A;  4DG1 A;  2AJQ A;  4PA1 A;  1X9W A;  1CZA N;  4F9O A;  2QWO A;  2NRZ A;  3F2K A;  3AAR A;  2AA4 A;  3VGL A;  3AO5 A;  2NNW A;  3DLL L;  2Q97 A;  4Z94 A;  4LFC K;  3THX A;  4DV4 K;  2A3Z A;  4B1V A;  1QHA A;  3LPT A;  1K8A O;  3TAE A;  4AM7 A;  2RE2 A;  3QNO A;  3PO5 A;  3BGR A;  5AJ3 K;  1VQM N;  3WQU A;  1VSK A;  5AFU A;  1KVA A;  3J80 O;  2XY6 A;  3D2E B;  1DTQ A;  3VEN A;  3T3F A;  1IH7 A;  2QWN A;  2ZWH A;  2HHS A;  4O5F A;  3SQ1 A;  4K8X A;  5AZI B;  3I56 N;  4YDU C;  4CF2 A;  3P1G A;  5C2D A;  1VSE A;  3K9J A;  3VEZ A;  3TTD A;  4FLV A;  4FWM A;  1MWM A;  2WON A;  3NF7 A;  3VOV A;  2A1R A;  2Y1I A;  4AHT A;  4K8Z A;  3GL1 A;  4DTM A;  3AO1 A;  1VHX A;  3TSP A;  4C23 A;  1YIT N;  5IT9 O;  4H4O A;  2OYQ A;  2YX6 A;  3KD1 E;  2NLX A;  5GIN A;  2F4V K;  2P9P A;  1TAU A;  4GVE A;  4E7K A;  1ZXO A;  1C6V A;  3VA0 A;  1HRH A;  1HYS A;  3CYM A;  4HTU A;  2VCP A;  4E1J A;  3LZJ A;  3SV3 A;  2HW3 A;  3VQ4 A;  1BIU A;  4YOW A;  3CQY A;  3ZX2 A;  3NH0 A;  4L3Q A;  1VRT A;  3OYF A;  4F2R A;  5I42 A;  4DTP A;  3MWT A;  1RDD A;  3DM2 A;  4C1N K;  2QEX N;  3OYH A;  3TAM A;  1N36 K;  3UE5 A;  4C8K A;  2HHW A;  4DSI A;  3CCM N;  5BRH A;  1XC3 A;  4H0P A;  4DB3 A;  3LDS A;  2VGN A;  1WN7 A;  1WSG A;  2W41 A;  3ASM A;  2G8H A;  4Z4G A;  1NLV A;  5KGW A;  4FLU A;  2FBV A;  4JEP A;  4CJV A;  2ZJP L;  4B9N A;  1HQU A;  4RTF D;  4B9V A;  1WLJ A;  1M1K O;  4M3U A;  3A5L C;  3ZT1 A;  1XC9 A;  5M1F A;  4FM0 A;  3HK2 A;  3O9T A;  3AAP A;  1GLF O;  3AVG A;  5LL6 Z;  3ENB A;  4CGH A;  4FJH A;  3CCL N;  3D45 A;  2OTJ N;  4FJJ A;  1VQK N;  3H08 A;  3NMU A;  4BRG A;  3RTV A;  2D0P A;  4BRD A;  4FWO A;  1VRU A;  5M1P A;  3LAM A;  1L3V A;  1TK0 A;  4E89 A;  2WFB A;  3NCI A;  5BR8 K;  3WXL A;  4AHV A;  2VG6 A;  2ATQ A;  4XH1 A;  4DF4 A;  1L3S A;  4E3S A;  4KI6 A;  4CFB A;  3LWL A;  1C0M A;  2D0O A;  2V52 B;  5ADX A;  4A62 A;  2X74 A;  3THW B;  4CJL A;  3ULE B;  1GOC A;  1QQO A;  3V1O A;  3VQB A;  2P9S B;  2NUB A;  5C0Y A;  1GOA A;  3CCU N;  4BAC A;  1HYV A;  3H3N O;  1YVN A;  3CET A;  4IZ9 A;  4O55 A;  3RMB A;  3MEE A;  3UKR B;  3QIN A;  2FSK A;  2IAJ A;  3HJF A;  4KHN A;  4M3X A;  3CCS N;  4B9M A;  3QLH A;  1BL3 A;  3ATU A;  1SL0 A;  4H0V B;  3LDP A;  1RFQ A;  1KAZ A;  4BRA A;  2YNF A;  2GX9 A;  4C8O A;  1D9D A;  3NGY A;  3CQ8 A;  4FJN A;  2PY5 A;  2IIR A;  4FPA A;  4JKD A;  4CF9 A;  4J2B A;  4ZTF A;  4BRF A;  5C24 A;  2WUS A;  5JLF A;  2O8D B;  4CJ5 A;  2BGG A;  3O3G A;  2IVN A;  2ZGY A;  1QS4 A;  2FSJ A;  1A5W A;  4PHT X;  1XQS C;  3NGZ A;  1HX1 A;  3K0S A;  4BRK A;  3DLR A;  4CEZ A;  3C7N A;  3DI6 A;  4DQQ A;  4B9T A;  3TSQ A;  2E5L K;  4B3M K;  4F2S A;  4CZE A;  1JLG A;  1Y64 A;  2JGU A;  2O8B B;  3QFP A;  3VQP A;  3CG7 A;  4J2E A;  3T7Z A;  1J54 A;  4CIG A;  3J7Y P;  5FPD A;  2BH1 A;  2YKM A;  3VQ6 A;  4IKF A;  1S1W A;  1REV A;  4CHN A;  5MLC Q;  3SV4 A;  1SV5 A;  3RWU A;  3DOK A;  3D0P A;  2H3G X;  5KPR A;  4DLG A;  1VQL N;  1XHZ A;  1NK9 A;  4KH4 A;  2ITM A;  5I3U A;  2ZD1 A;  3HOT A;  3QO9 A;  2EHG A;  1WSI A; 
#chains in the Genus database with same CATH homology
 3NDK A;  2D0C A;  3OYC A;  1A5V A;  3AA2 A;  1S6P A;  1TVR A;  2YHB A;  4M3T A;  2DY4 A;  3FFI A;  4KTQ A;  2BE2 A;  5FRN A;  3IS9 A;  3DRP A;  3KKS A;  2BDP A;  3AO4 A;  1FKO A;  3OYA A;  2XY7 A;  1LAV A;  3L8B A;  2DFE A;  4CK3 A;  3VQQ A;  3KK3 A;  4N41 A;  3LP1 A;  3AVN A;  3UIQ A;  4FJG A;  3O3F A;  3TAR A;  2PYJ A;  3HO1 A;  4BDP A;  1LWF A;  1KVB A;  1Q8I A;  4KHU A;  3MED A;  3RRH A;  4KHY A;  4I9L A;  2KZZ A;  3HPO A;  2YV0 X;  4IDK A;  4CEQ A;  4CK1 A;  1KFD A;  1BI4 A;  3DLK A;  1NKB A;  4CJE A;  4KHW A;  1RT2 A;  4H4M A;  3OJS A;  3MAQ A;  4CE9 A;  4KO0 A;  1KSP A;  3WNH A;  4CIE A;  4FJI A;  2ITG A;  4CK2 A;  2HHQ A;  1KVC A;  4W5N A;  2PYL A;  2RPI A;  4KHQ A;  4JLH A;  4FJK A;  4F8R A;  5CYQ A;  4Z4C A;  1ASV A;  2HVI A;  2VWK A;  2ZE2 A;  3SZ2 A;  1RTJ A;  5J2P A;  4DTR A;  4FCY A;  4FJ8 A;  3PUF A;  2KZM A;  3KKR A;  5HRR A;  1TL1 A;  4RW9 A;  1VSI A;  1WNS A;  1JKH A;  4FW1 A;  3LZI A;  3OS0 A;  5KRT A;  4NCG A;  1CZ9 A;  2KW4 A;  2HNY A;  3OYD A;  4DTJ A;  3TAN A;  3DMJ A;  3MEC A;  1QSY A;  1ZBU A;  5CZ2 A;  1B9D A;  4CEF A;  4E7L A;  2XY8 A;  1TV6 A;  5HRN A;  2W42 A;  1JLF A;  3I8D A;  3CFR A;  4JRQ A;  3AVA A;  2QKB A;  2HB5 A;  4FLT A;  3AO3 A;  2KQ2 A;  3V9W A;  4I7F A;  1S9G A;  3QEW A;  4W5R A;  4I2Q A;  1SUQ A;  4GW6 A;  3DLB A;  4CHP A;  2RKI A;  1IG9 A;  1RTD A;  1DLO A;  4DS4 A;  4N47 A;  1L3T A;  3AA4 A;  3OYB A;  3K5N A;  4FLY A;  2X78 A;  4W5T A;  4NCB A;  2E6M A;  3K5O A;  2DTU A;  4J2A A;  3WNF A;  5HBM A;  3NAE A;  3V9X A;  1Q9X A;  4KB1 A;  4KTZ A;  3KLE A;  1RT4 A;  4FK2 A;  1B9F A;  2G8W A;  3K58 A;  1U47 A;  3ITH A;  2Z1H A;  2XO7 A;  4BE1 A;  2HNZ A;  2X6S A;  4B08 A;  4DF8 A;  1NK8 A;  4OKK A;  4CF0 A;  4BDZ A;  1S6Q A;  5EU7 A;  1BI4 B;  2D5R A;  4EP4 A;  3NH2 A;  3TI0 A;  2G8F A;  1YTU A;  1U49 A;  3V6D A;  2Q3S A;  1SL2 A;  3I0S A;  1D8Y A;  4DWI A;  1JLA A;  4DU4 A;  2GBZ A;  1KRP A;  2E4L A;  3PX6 A;  2Y1J A;  4Z4I A;  4IBN A;  3HST B;  3PX4 A;  3SNN A;  3VQ9 A;  1HPZ A;  1LW0 A;  1RCH A;  1C0T A;  4KKO A;  3ZSZ A;  1EXQ A;  3DRS A;  1U04 A;  3OYN A;  1WAJ A;  4E7I A;  1RDA A;  4CFA A;  4LH4 A;  3PV8 A;  4I9Q A;  2E6L A;  2B5J A;  1RIL A;  4EZ6 A;  3P83 D;  4OKJ A;  3C95 A;  3V9Z A;  3HPG A;  4OJR A;  4OKE A;  3QEV A;  3DLH A;  1U45 A;  1N6Q A;  3ZCM A;  3LP3 A;  3M8R A;  5J2N A;  4CJU A;  4CJR A;  2Z1I A;  4BE0 A;  4DSE A;  4C8M A;  2QKK A;  4FW2 A;  1LWC A;  4BWM A;  4AIL C;  3KIO A;  4LSN A;  1W0H A;  3WNG A;  4Q5V A;  3DYA A;  3EZ5 A;  4KRF A;  1S1T A;  4N56 A;  1XHX A;  1S1U A;  3OYL A;  5DK5 A;  4FJX A;  3C94 A;  2VG7 A;  3JSM A;  1HQE A;  2XHB A;  3AVK A;  3O4Q A;  3ZSV A;  3S3N A;  5C25 A;  4O4G A;  2G8I A;  5CYM A;  5DMR A;  3L2Q A;  1J5O A;  4KI4 A;  1UWB A;  3TAB A;  4DSL A;  1VSL A;  1VSD A;  4CJF A;  1JLQ A;  1L3U A;  2F8T A;  3RMC A;  1X9S A;  4CF8 A;  3SUP A;  2HMI A;  4OVL A;  4F3T A;  5HLF A;  1SKW A;  3TAG A;  4FJ9 A;  3VQE A;  1Y97 A;  1NJX A;  3ZT3 A;  1QSL A;  3VQA A;  4CFC A;  3SI6 A;  3JYT A;  1WSF A;  3TAF A;  3K5L A;  1Q9Y A;  4FZX C;  3OYK A;  1NK6 A;  1FK9 A;  4ID1 A;  1SL1 A;  2PZS A;  4OGC A;  5KRS A;  1U4B A;  3AVL A;  3NF8 A;  4ID5 A;  4B9U A;  1KLM A;  2VWJ A;  1YVU A;  3KD5 E;  1RBU A;  1G15 A;  4DSF A;  5KTQ A;  3NE6 A;  3B6O A;  3QET A;  4E0D A;  3KK1 A;  4E7H A;  5FDL A;  4BDY A;  1NK7 A;  4ELV A;  2OA8 A;  3OJU A;  4PUO A;  1QTM A;  2KFZ A;  1RTI A;  3MXM A;  1XI1 A;  4FJ5 A;  2OPR A;  4FZY A;  2HND A;  4FK0 A;  4O0J A;  3ZT2 A;  1J53 A;  4N76 A;  5FRM A;  1U48 A;  3IRX A;  4QAG A;  4CF1 A;  2BAN A;  3VQ8 A;  1CZB A;  3M8Q A;  4ELT A;  3HVR A;  2G8V A;  2I5J A;  2LSN A;  3S9H A;  3LP0 A;  4DSK A;  4FLZ A;  4H8K A;  4FLW A;  4W5Q A;  2HVH A;  4CJK A;  4ICL A;  4TSX A;  5E41 A;  2G8K A;  4DQI A;  1EKE A;  3OYG A;  2B4J A;  3V9U A;  4FVM A;  2D0A A;  3G0Z A;  3NF9 A;  3SUN A;  2HHT A;  3KK2 A;  1N5Y A;  3SUQ A;  1B92 A;  3F73 A;  2XY5 A;  2OZM A;  2FBX A;  4W5O A;  4DMN A;  4HVJ A;  3LAK A;  1YTA A;  4F4K A;  3AA5 X;  4LY7 A;  3RRG A;  2HHV A;  2JLE A;  1LV5 A;  1UAX A;  3AVI A;  4Z4E A;  2AJQ A;  4RW4 A;  3O4N A;  4GMJ B;  4DG1 A;  4PA1 A;  3SJJ A;  1X9W A;  2B6A A;  1S1V A;  5JS1 A;  4LD0 A;  2HHX A;  1QQC A;  4O5B A;  1KLN A;  4DU1 A;  4JS5 A;  3NBP A;  4CFD A;  4DFP A;  4C8N A;  3AO5 A;  4IG0 A;  1TGO A;  4CEO A;  3QIP A;  3CFP A;  1C0U A;  3DLG A;  1SKS A;  1I3A A;  3NHG A;  3RMD A;  4EZ9 A;  4AH9 A;  3K57 A;  4FXD A;  3PY8 A;  1S9E A;  1X9M A;  4J2D A;  3HVT A;  2VG5 A;  4CHQ A;  4OLA A;  4IFY A;  3NGI A;  3QIO A;  2FBT A;  3ZSY A;  3LPT A;  1JLB A;  3AVB A;  1LW2 A;  2F96 A;  2ZQB A;  4OPK A;  2RN2 A;  1GOB A;  3L3U A;  3V81 A;  3TAE A;  1UA1 A;  3KTQ A;  4HUF A;  4CJ4 A;  3QNO A;  3PO5 A;  3BGR A;  1NKC A;  3K59 A;  1RTH A;  1C1A A;  5SWM A;  1VSK A;  5SZT A;  1KVA A;  3VA3 A;  4AHC A;  1W9H A;  2XY6 A;  3T1A A;  1CLQ A;  4O0I A;  1DTQ A;  1VSF A;  4LSL A;  1RBT A;  4CGJ A;  4MQ3 A;  2Z1J A;  3T3F A;  5J2M A;  2YNH A;  1IH7 A;  3KLG A;  2IDO A;  3U6F A;  1ASW A;  5KGX A;  3HM9 A;  1KTQ A;  1VSM A;  3C6U A;  5T7B A;  3ZSR A;  3OYE A;  2G8U A;  4NCA A;  2HHS A;  4K8X A;  3SQ1 A;  4C8L A;  1D5A A;  1I39 A;  4CF2 A;  3OVN A;  3P1G A;  1VSE A;  2O4G A;  1TKX A;  3SPZ A;  4KFB A;  4DFK A;  1KFS A;  2P5O A;  4FLV A;  5HRO A;  2WON A;  1NJZ A;  3WNE A;  3NF7 A;  5CY4 A;  2GUI A;  2D0B A;  4M3R A;  3ZSO A;  4KTW A;  4L8R B;  3G10 A;  4CJP A;  2A1R A;  2Y1I A;  4AHT A;  4LH5 A;  4K8Z A;  3RR8 A;  3VQC A;  4HUG A;  2OPQ A;  1Z26 A;  3AO1 A;  4DTM A;  4DTX A;  4CJS A;  3RR7 A;  1C1B A;  1BHL A;  1QSS A;  1BGX T;  4H4O A;  1RT1 A;  2OYQ A;  3T19 A;  2IOC A;  3V4I A;  3KD1 E;  1RT5 A;  3CM6 A;  1TAU A;  3CM5 A;  4E7K A;  1HYZ A;  4Y1C A;  3AVH A;  1C6V A;  4UQG A;  4BE2 A;  3VA0 A;  2R7Y A;  1HRH A;  4DQS A;  1QE1 A;  3CYM A;  4CHO A;  4CER A;  3QES A;  1HYS A;  1ZBF A;  4HTU A;  3OS2 A;  3F9K A;  3LZJ A;  2A1S A;  4XIU A;  1T7P A;  3SV3 A;  2HW3 A;  3VQ4 A;  1EX4 A;  1BIU A;  4IG3 A;  2FC0 A;  1BCO A;  3NH0 A;  1F21 A;  1VRT A;  4M41 A;  4GVM A;  3ALY A;  3OYF A;  5I42 A;  4F2R A;  3S3O A;  4DQR A;  3I0R A;  4DTP A;  4DTU A;  4Q0B A;  1IKY A;  1RDD A;  1JL2 A;  2IC3 A;  4B8A B;  3DM2 A;  4B8C A;  4CEC A;  1UA0 A;  3OYH A;  4BWJ A;  3TAM A;  4CJ3 A;  3LPU A;  3P5J A;  1R0A A;  3HP9 A;  4PWD A;  4DFJ A;  3ZT4 A;  4C8K A;  2HHW A;  4DSI A;  1TL3 A;  4RW7 A;  2F8S A;  1C1C A;  1EP4 A;  4DU3 A;  4WE1 A;  1A5X A;  3HL8 A;  3SQ2 A;  3LDS A;  4M3Y A;  3VN5 A;  1WN7 A;  1WSG A;  3VQ7 A;  1IKV A;  3LWM A;  3ASM A;  1HMV A;  2G8H A;  1NJY A;  3PX0 A;  1UOC A;  5KGW A;  2EX3 A;  3OY9 A;  4FLU A;  4ZTJ A;  4Z4G A;  4QCL A;  1Z25 A;  2FBV A;  1TK8 A;  4CJV A;  3ISN C;  2YNG A;  4M45 A;  3SQ4 A;  4B9N A;  3SCX A;  1HQU A;  4B9V A;  3L2R A;  1RDC A;  1WLJ A;  2DFH A;  1SKR A;  4M3U A;  2P1J A;  3ZT1 A;  3L2V A;  3S3M A;  1XC9 A;  3O3H A;  4FM0 A;  3HK2 A;  1D9F A;  4M3W A;  4AHR A;  2HHU A;  3E01 A;  3OYI A;  3KLF A;  3M8P A;  4M3Z A;  1T05 A;  3AVG A;  2YNI A;  3LAN A;  4DSJ A;  3DRR A;  4CGH A;  4FJH A;  3K2P A;  4NYF A;  3D45 A;  3QEX A;  4B9L A;  4FJJ A;  3H08 A;  4KPY A;  3ZT0 A;  4PY5 A;  3SPY A;  4JRP A;  2O4I A;  3RTV A;  3RMA A;  3V9S A;  1DTT A;  2P51 A;  4KRE A;  1VRU A;  3NFA A;  1WSE A;  3LAM A;  1L3V A;  1RNH A;  5J1E A;  1TK0 A;  3CFO A;  4E89 A;  1XWL A;  4N5S A;  4CCH A;  1O1W A;  3NCI A;  3BDP A;  3QER A;  4AHV A;  1HNV A;  2ATQ A;  2VG6 A;  1HJR A;  1BQN A;  1RBR A;  4DF4 A;  4ELU A;  1CXU A;  4CGF A;  1L3S A;  4E3S A;  3HYF A;  3MEG A;  3U3G A;  4KI6 A;  4DTN A;  5K14 A;  4FLX A;  4CFB A;  4HCB A;  3LWL A;  1J9A A;  1C0M A;  4CED A;  4HUE A;  1L5U A;  4M42 A;  1ZBI A;  2X74 A;  1YT3 A;  4CJL A;  4B3O A;  3DLE A;  4G1Q A;  4FJ7 A;  1GOC A;  4IFV A;  3V1O A;  3VQB A;  4DS5 A;  4Y1D A;  1JLC A;  3MXI A;  4NYN A;  1TKD A;  2IS3 A;  3AV9 A;  3AVF A;  2NUB A;  5CZ1 A;  1NK5 A;  1GOA A;  4BAC A;  1HYV A;  3LAL A;  1FKP A;  1ITG A;  1RBV A;  3ZSW A;  3IAY A;  1JL1 A;  5HRS A;  4PQU A;  4FYD A;  4E7J A;  4O55 A;  2XRI A;  1IKW A;  2GV9 A;  4Z0U A;  4CIF A;  4DLE A;  4HCC A;  3L3V A;  3RMB A;  1NJW A;  5HRP A;  3MEE A;  3QIN A;  1HNI A;  4CGG A;  2IAJ A;  2WOM A;  4RW6 A;  4KHN A;  3K5M A;  4M3X A;  1LAW A;  4CJT A;  3HJF A;  1VSH A;  4R5P A;  4B9M A;  4DTO A;  2OPP A;  1LWE A;  3QLH A;  1NK4 A;  3QEI A;  1BL3 A;  2FBY A;  3DOL A;  1SL0 A;  1X1P A;  1BCM A;  1IKX A;  3KLH A;  3ULD A;  3HXM A;  4DTS A;  1BQM A;  1EET A;  2RF2 A;  2YNF A;  1RDB A;  4CEE A;  1NOY A;  1MU2 A;  1BIS A;  4EP5 A;  2IGI A;  4OPJ A;  3SUO A;  4Z4H A;  3TAQ A;  4FK4 A;  2OPS A;  1ZBL A;  4C8O A;  3M8S A;  4YFU A;  1TKZ A;  1D9D A;  3NGY A;  3NF6 A;  1TAQ A;  3V1Q A;  1VSJ A;  1WAF A;  3MXJ A;  3CQ8 A;  4CGD A;  4FJN A;  3AVC A;  1BIZ A;  4CES A;  4FM1 A;  4FM2 A;  2PY5 A;  5HP1 A;  4CF9 A;  4J2B A;  1K6Y A;  1VK0 A;  4ZTF A;  4E1M A;  4DFM A;  3EYZ A;  4I2P A;  5C24 A;  1NK0 A;  3NH1 A;  1WSH A;  4AHU A;  1QHT A;  2KTQ A;  2OZS A;  3IG1 A;  3ZSX A;  4CJ5 A;  3O3G A;  1KCF A;  1TKT A;  2DFF A;  3B6P A;  3V1R A;  2BGG A;  4OLB A;  4FJM A;  1ASU A;  4JS4 A;  1T03 A;  1S1X A;  1QS4 A;  3THV A;  1A5W A;  5FRO A;  1NOZ A;  3U3Y A;  3NGZ A;  3QEP A;  1RBS A;  3TAP A;  3DLR A;  4CEZ A;  1FXX A;  1S5J A;  3DI6 A;  3AVM A;  4DQQ A;  3TR8 A;  4B9T A;  4OGE A;  4CJW A;  3HT3 A;  3SYZ A;  4CEA A;  3HP6 A;  3VQD A;  4E19 A;  1TK5 A;  2Z1G A;  3OYJ A;  1ZBH A;  4F2S A;  1JLG A;  2JGU A;  2QXF A;  1ZYQ A;  4ZHR A;  3EY1 A;  4FZZ A;  1NKE A;  2KFN A;  4CGI A;  1IO2 A;  4CJQ A;  3VQP A;  3A2F A;  2QK9 A;  2X6N A;  3CG7 A;  5JS2 A;  3TWH A;  3QNN A;  5C42 A;  1WSJ A;  4J2E A;  4HHT A;  1J54 A;  4CHY A;  4F3O A;  4CIG A;  1JLE A;  1RT7 A;  4MFB A;  4YNQ A;  3KJV A;  1T8E A;  4B9S A;  4CHZ A;  3C6T A;  4AHS A;  3KLI A;  3L2W A;  3PO4 A;  2YKM A;  3VQ6 A;  4KB0 A;  4IKF A;  1S1W A;  3VQ5 A;  3AA3 A;  5D3G A;  2YKN A;  1REV A;  4CHN A;  3L2U A;  3SV4 A;  1CXQ A;  1RT3 A;  1SV5 A;  4RG8 A;  3SQ0 A;  3RWU A;  3AO2 A;  3OYM A;  2YHA A;  3AVJ A;  3DOK A;  3D0P A;  5J2Q A;  3OS1 A;  4KAZ A;  4DLG A;  1XHZ A;  1NK9 A;  4O44 A;  4DQP A;  4KV8 A;  3HPH A;  4RW8 A;  4E1N A;  5I3U A;  1JXE A;  2ZD1 A;  4FJL A;  1RT6 A;  3LP2 A;  3QO9 A;  5KI6 A;  2P5G A;  4KHS A;  2EHG A;  4Z4F A;  1JXB A;  3ZSQ A;  2ETJ A;  1WSI A;  4QOZ B;  4CEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...