5C2FA

K428a mutant nuclease domain of the large terminase subunit gp2 of bacterial virus sf6 with manganese and beta-thujaplicinol
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
242
structure length
230
Chain Sequence
MAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTAVEMKQKLGIPSPNLADALMMCMHCPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 2 protein
publication title Two distinct modes of metal ion binding in the nuclease active site of a viral DNA-packaging terminase: insight into the two-metal-ion catalytic mechanism.
pubmed doi rcsb
source organism Enterobacteria phage sf6
molecule tags Metal binding protein
total genus 80
structure length 230
sequence length 242
ec nomenclature
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5c2fA00
5M1FA 5C2DA 3C6AA 4IFEA 5C2FA 3CPEA 4IEEA 5M1OA 5M1NA 4IEIA 5C12A 4IDHA 5M1PA 5M1QA 5C15A 3C6HA 5M1KA 5C10A
chains in the Genus database with same CATH superfamily
1I94K 4DTSA 1DKGD 3HJFA 3O80A 2HMIA 4WQ4A 3QEWA 3HZ6A 3WXMB 1XUPO 3EE9A 1EWRA 3WXKA 1MWKA 1QE1A 4AHRA 2X6NA 1NK6A 3L2WA 1Q7YO 1U6ZA 5C15A 1HX1A 3AVJA 4CEZA 5H1SQ 3LZJA 4K0KK 1XC9A 3I8BA 1VK0A 4JD2A 4GNIA 2PYLA 4E1NA 1VHXA 1SV5A 4IZ9A 4Z4FA 3HOTA 3ID6A 3LWMA 1IV0A 4GY2B 3ULDA 1R59O 4FZZA 3RVCA 4ZHRA 3VA3A 2QW9A 5GAHP 3O9TA 4KKOA 4F3TA 4KTZA 1FK9A 4IFVA 2BTFA 3S41A 1HKGA 2IVOA 4WFNL 3P5JA 3OBWA 4E1MA 4EHTA 3NH0A 1VAZA 3U6FA 4WCEL 1RGIA 3VQAA 4O8KA 2FBXA 3SMSA 1HNZK 2O8CB 1FKOA 1K8AO 3O1WA 3PSIA 4YOTA 3SV4A 5E41A 3CG7A 4W5TA 5LJWA 2YNIA 4DV2K 1BQNA 3H6EA 4BE1A 3IDHA 3WXLA 3ATVA 1RDWX 3KIOA 1U04A 5AZJB 1DTTA 3HBTA 1NNEA 4NXMK 3O3GA 3L8BA 1SQKA 1NKEA 1U47A 2A1SA 1CZAN 3OYIA 4DS4A 1W2BM 5ADXH 1VSLA 4KH4A 4DV0K 4FXDA 1TUUA 1RBSA 3AVGA 3QBXA 4B1WB 1S5JA 4BE2A 3KLFA 4BR9A 1ESVA 3SAGA 3RRHA 2YJFA 4O5FA 2NRRA 3R8EA 3TTCA 4KI4A 5AJ3K 3UIQA 3TAPA 5AR0A 3K0SA 4CFAA 1LAVA 2FBYA 2QI2A 4DHYA 4ELUA 3AGRA 4PKIA 1IG9A 5EY4A 2DFHA 5J1EA 1SKSA 4PY5A 5HRSA 4FW1A 3M8RA 4DFMA 1KAYA 4K41A 5C12A 3IUCA 1KFDA 2NRWA 4BVPA 2V7ZA 4FWOA 5CY4A 3MWTA 1XMOK 1GOAA 1NK9A 4JV5K 3VTIA 1ATNA 1RBVA 5AQRA 1CXUA 3V1OA 4OGCA 3M8QA 1RDUA 3DWLA 2OCEA 4B1UB 2P9NB 4GVEA 2RPIA 2HF4A 4NO7A 3TSUA 1JL1A 3RSEA 5F0XA 5LMUK 2QWRA 3MN7A 3G71N 3KK3A 1IBMK 4JI3K 4WE1A 4EAHD 1MDUB 4C23A 1TK8A 3H08A 3PIPL 5C2FA 5AQWA 5KRSA 3P4IA 5GAEP 2VGNA 4O0JA 3G6EN 3LDSA 4CZGA 4M7YA 3TAMA 4RWTA 1F21A 3FZLA 1K9MO 2E8AA 3SPYA 3HSTB 5C42A 4DSFA 3NVKA 4FJ8A 4FWKA 3ZX2A 4DQ8A 3BZKA 1IKXA 4JI1K 2CH5A 4LF6K 3AA2A 3DAWA 4BDZA 3B8AX 4DS5A 4BWMA 4MLEA 2VGMA 2F9WA 3QIOA 3MAQA 4WYBA 1JLBA 5JS2A 1OH7A 4OPHA 1BHLA 4AH9A 3V9XA 2FSJA 3N4QA 5E26A 5AQXA 2F9TA 2YJEA 3A5NC 4ZTFA 2O8EA 4HUFA 2B6AA 3WNFA 4B9VA 5SWMA 4LY7A 3KHYA 4KH6A 2O4IA 1NGGA 2PY5A 1WUAA 4OKEA 4FJHA 1IKYA 2QWMA 4HTLA 1JCEA 2OA8A 2E2NA 2ZGYA 3O3HA 4IFYA 4C1NK 3PSFA 2ZF5O 2YI1A 4BQLA 3THYA 3TSPA 2B5JA 2KKZA 4DKWA 3CCLN 1YJ9N 3ZT0A 4CI6A 4NYNA 1LV5A 3QLHA 4JI0K 3C7NB 1WSFA 4OPAA 1NJYA 2ATQA 2IOCA 2P9IB 1QVFM 2D1KA 2FSNA 4CJTA 3ZEUA 2H3GX 4O8UA 4W5RA 5AQPA 4DV4K 3QDKA 3G25A 3C95A 4KH5A 2IVNA 2XY7A 4CJKA 3WNGA 1JXBA 2P9SB 3VTHA 1W0HA 1WAFA 1YUWA 2HNYA 3ZSXA 3RTVA 5B8HA 3LM9A 4NCGA 4DR4K 3P1GA 4FLWA 1RDAA 3DLLL 2YV0X 2HBMA 1GOBA 3I8DA 1GLBG 4DMNA 1KAZA 4PL8A 4DB3A 3VEWA 3D45A 3LDOA 1JL2A 5M1PA 4LF7K 4CZHA 4A5BA 5EU7A 3VPZA 3M8SA 2V52B 1BI4B 3H1VX 4JAXA 2HBLA 3AGKA 3ZSQA 4H0PA 4CEBA 3I33A 3BGRA 2QXLA 2YHWA 4FJIA 2IS3A 4BC2A 3A5MC 2RE2A 2OPPA 4I2PA 3R6MA 5TKYA 3SBGA 1JCGA 3KD5E 1VSKA 2XY8A 2OPSA 2YHAA 4FM0A 4FVUA 3GE1A 4H4OA 1HYSA 4FOIA 1TK5A 3ZETA 3NCIA 4CGGA 4RCHA 3MXMA 2E2QA 3K57A 4CGDA 1IJJA 4FSVA 4KHUA 1E4GT 1RFQA 2Y1JA 2OPQA 2OTLN 2ASOA 3TI0A 2Q31A 4DR6K 1VRTA 4X64K 5AQUA 4A62A 3FZHA 2D4WA 3F2KA 3V81A 1LOTB 2KW4A 3RWUA 1BOTO 1HPZA 4HCBA 4KB0A 2HHQA 3RR7A 4OJRA 1EP4A 1ZBSA 3LAMA 3QESA 3VETA 4CGFA 4E19A 5HOOA 4DQIA 2UXBK 4FJGA 1EWQA 1MU2A 3AO1A 1L3SA 2OZMA 4KRFA 5GIPA 2ITMA 4CBXA 1YVUA 5GADP 4HCCA 3NH1A 4HVJA 3TTFA 1VSHA 4KO0A 1YI2N 1GLEG 1VQ4N 2DPNA 2W40A 4DV1K 4BRHA 3CPWM 2G8UA 1HQUA 2P9PB 3A2FA 1RBTA 3CCQN 4LD0A 4KHQA 3ENBA 1GLJO 1VQPN 1GOCA 3TR8A 4BR2A 5KRTA 4DTMA 3SUNA 3C6AA 4IFEA 5FPNA 1RT7A 1U2VB 3CCVN 1X9MA 1C1AA 3VQPA 1LWFA 4DR7K 1OH6A 4M45A 2OYQA 3FGUA 2E2PA 2O8DB 1GLLO 2P9UB 4G1QA 2X78A 4FLYA 4TSXA 4B08A 1VSDA 1QHTA 2QKBA 1N34K 2YHXA 2OZSA 4L3QA 4B9LA 3O4NA 1MWMA 4LF5K 2ZGZA 3BEXA 2QKKA 4MO5A 1HJOA 3J8AA 1TKXA 3DOLA 3VEZA 1XMQK 5DMRA 3VMFB 3K2PA 2O8BB 3E66A 3THXA 3SUPA 4FJXA 1HR0K 1L3UA 3VA0A 1D8YA 3AO2A 4EP5A 1S1UA 3ZSZA 4DV7K 1HQEA 2YKNA 1K8KB 3CJAA 3E01A 3O9SA 1Z6RA 3L4IA 3AA5X 5IT9O 1D9DA 4H5NA 3L6QA 1BGXT 3BY5A 3HYFA 5BRHA 1Q81O 4RW6A 3CD6N 2O8FB 3DXKA 5LMNK 1JCFA 1NJXA 2Q2RA 4IEIA 1S72N 4L8RB 1T3VA 2IAJA 4F2SA 3B6PA 3CI5A 2KHOA 1SKWA 3J80O 1QSSA 1C1CA 1NJWA 3CC7N 2GV9A 4DV6K 3OHRA 3H3OB 3W3DA 3IKMA 2KFNA 2VCPA 2NNWA 1U49A 2UU9K 4Y1DA 2BUPA 4H0TB 3WNEA 4BRIA 5AZIB 4CJPA 4CZKA 3NH2A 2HVHA 4B1XB 3RMAA 5J2NA 4CJ7A 3WEEA 4FWRA 1KLNA 5JICA 3A0IX 1V4SA 4ILHA 3EO3A 1MA9B 4DSJA 1T6DA 3VOVA 4HWIA 4CJSA 4JN4A 1C0GA 1HRHA 3AAQA 5DM7L 1YTUA 4JI4K 4CHNA 3HTVA 1EX4A 4CZMA 3ZLJA 3K5NA 1VRUA 3R1XA 5JVGL 4BGBA 4NCBA 4DV3K 4KFBA 4Z4CA 4FLVA 5BR9A 2E5LK 1VSFA 2FBVA 3OYKA 3HP9A 2XY6A 1YXQA 3LL3A 4KHPK 1QSLA 3D2FB 2E1YA 3OYFA 4DTUA 1NGJA 4DQPA 2UUBK 2QWQA 3VERA 1RTDA 5GINA 3ATUA 4DSLA 1TL3A 2QWLA 3MEDA 3QFUA 3D6RA 4DR5K 5AQNA 2CGLA 1RBUA 4IEEA 4E3SA 4IJNA 5CZ1A 4YFUA 4JI7K 4FWNA 5AQOA 3PO5A 2Q36A 1RTIA 5KGWA 4JKBA 4CESA 3LDNA 2GELA 3L3UA 3QB0A 1VSEA 4BY9C 1T7PA 1S9EA 3S3NA 4FK2A 3MMVA 3I55N 1YT3A 1UOCA 5LL6Z 5JS1A 4XH1A 1VQ7N 1XNRK 3G10A 3ENHA 3H46O 2PZSA 3ZT3A 3HSCA 4B8AB 4Z4HA 5KPRA 3TAGA 1J54A 1S22A 4DTRA 3V6DA 3OYCA 4CBUA 4QS9A 2E2OA 3KLEA 4QOZB 1SKRA 4CZFA 4I2QA 3UKUA 4OLAA 3D2EA 3BF1A 4B9UA 3AVNA 1QS4A 4I6MA 4N76A 3ZT4A 2XHBA 2HNDA 3HM9A 1RDBA 2R7YA 3O9RA 2P9LB 3AO4A 1ZBFA 4A57A 3BP8A 4JRQA 4BG8A 3GBTA 3IFRA 3LP3A 4H5WA 3CJBA 5I42A 5J2QA 1K73O 4CERA 2PYJA 1BIZA 4C8NA 3HRGA 4HHTA 4CF0A 4BR0A 3EL2A 3FR0A 1XWLA 1YIJN 1WSEA 1TYQA 3TARA 1QZ5A 3OJSA 2QA4N 3UB5A 1BU6O 4F4KA 4HTUA 1J5EK 4DF4A 2E88A 3F5TA 4BC3A 4JNEA 5CE3A 4DSIA 3THWB 2I7NA 2NRHA 2NLXA 3ULEA 3H1QA 5AQIA 1KVBA 4B3RK 1DTQA 4AM6A 4DTPA 3WXJA 3AVFA 3N4PA 2KQ2A 3HVTA 5CYQA 3CQ8A 3AVIA 1RT3A 4B1YB 3QMLA 3NAEA 4CJ4A 4BC5A 3EY1A 1XHXA 1YVNA 1JLCA 4IKFA 5CHIA 3DRSA 3R9PA 5M1OA 5AQFA 5C0YA 3RMCA 1T03A 3SUQA 3CQYA 2P9KB 5AQHA 3S3MA 4CEEA 1DGKN 4FJKA 2Q3SA 5DK5A 1CZ9A 1TAQA 3DLKA 4H0YB 4K8XA 4RW7A 3LANA 5MLCQ 3K5OA 4QCLA 3CMAN 2D0CA 3KVGA 3QO9A 3TU5A 3OYAA 4AHTA 4DWIA 3CM5A 5T7BA 3M5RA 1YAGA 3IMXA 2D0OA 3PUFA 4PQUA 3F9MA 4A2BA 4CJ5A 1B92A 1HPMA 3I56N 4M3UA 1EETA 1L5UA 4KBOA 3O9UA 2VG5A 1LWCA 4DG1A 4DFPA 3DJCA 3VQ9A 4DCHA 1NJZA 4CGHA 5K14A 1IBKK 2ZJQL 2HBKA 3QEIA 3RR8A 4A59A 1GLCG 2O8CA 1O1WA 1BO5O 4CHQA 4DUZK 4FK0A 3ALYA 3NVMA 4YY3K 4M3TA 1OH5A 4BRQA 1NGFA 3G4SN 1G15A 1XC3A 3CERA 5LY3A 1ZBHA 1X1PA 3CFRA 4BR4A 3SV3A 5AQSA 4J2DA 4JS4A 3QINA 4K8ZA 3SQ4A 2YNGA 1SZ2A 1KVCA 2F96A 5AZJA 4DSKA 3VQQA 1IBLK 1N32K 3K59A 2W6LA 3M6GA 1JLGA 2HHWA 4E89A 4RW4A 4XEIA 4CJVA 2D0AA 3MN6A 3V9SA 2JLEA 1UAXA 3ZT2A 4CIFA 3MEEA 3HP6A 2RN2A 4K42A 2A41A 1S6PA 3TWHA 4Z4IA 4GW6A 4IOCL 4DR3K 4LH5A 3ZSYA 4O0IA 3W0LA 3F9KA 1YF5L 3I0SA 1RBRA 4CGIA 4FWLA 3RMBA 2D0PA 2NRVA 5HRPA 3EEQA 1HKBA 2E20A 4JI6K 3G0ZA 4H0XB 4FJ5A 4CZJA 1WSIA 2ITGA 3DXMB 3U3GA 4BR7A 4IDKA 3J7YP 1S6QA 1KVAA 4DLEA 3Q7CA 2F8TA 1C6VA 3F73A 2NRZA 3OVNA 3U8XA 4NCAA 2CGKA 4Z0UA 2A3ZA 5AQMA 2G8IA 3CJ1A 1KTQA 1RDCA 3T1YK 4M42A 5BPMA 5FDLA 1NK8A 3O5BA 5BPLA 4DU1A 4DQRA 1T8EA 4BGAA 3CC4N 2P9NA 1ATSA 1S1TA 1SS6A 5FPDA 1Q9YA 3QIPA 3LAKA 4O5BA 4AHCA 3L2VA 1T44A 4AF1A 2OANA 2JGUA 4FJMA 1BA1A 1NU0A 4C8OA 3E9PA 4JI8K 1GLAG 3O8MA 3PV8A 1RT1A 3S9HA 4FWQA 4OVLA 4N47A 3OYBA 3EZ5A 1R0AA 5AQJA 5ELZA 3K58A 2VWKA 2Z1IA 3LM2A 5ADXA 4CHYA 4HUGA 4MLHA 3TAEA 3SJHA 1RT5A 3QEPA 1FW6A 3VEXA 1I3AA 4JKAA 1VQON 3CM6A 4BQZA 3V9UA 4FOEA 3A5LC 1UA0A 4CJEA 1NJIO 3LDQA 1JLQA 1JJ2M 1QQOA 2F7TA 3MCPA 4BROA 3SQ0A 2A40A 3TPQA 4N41A 1XI1A 4PKGA 1T6CA 3LP2A 4XH4A 2HHUA 1B9DA 4JRPA 4H8KA 3NBPA 2IGIA 4KTWA 4Z4GA 1HJRA 1D4XA 2QWNA 2P5GA 4J2BA 1TL1A 4O55A 2WOMA 1C1BA 1O13A 4IO9L 4FLZA 3DRPA 3MDQA 3ZT1A 4JK7A 4ISGA 2LSNA 4JK8A 5F2RA 5KTQA 1IKWA 4DQQA 3LP1A 1EXQA 2HF3A 3QEVA 1M1KO 3MECA 5EOYA 2HMPA 3T3FA 5AQKA 1NMNA 3HI0A 3PO4A 3AV9A 3C7NA 3PX0A 2D5RA 2P9IA 1TKTA 2QK9A 4M41A 1EKEA 2QWPA 4FL9A 3VQDA 3J7ZO 4H4MA 3OY9A 4CF8A 3DOKA 1WSGA 1BUPA 3VEOA 4IOAL 1NK0A 1W9HA 2GX9A 4Q5VA 2P9SA 4CZEA 4EP4A 1NGCA 3V9ZA 3FE1A 4EZ6A 2VYPA 2BH1A 1JLEA 2NRXA 4KHWA 3VQEA 3WQTA 3AO5A 2GTDA 4DU3A 2A42A 2E6MA 3NDKA 1WSJA 3TTDA 2BE2A 2HVIA 3AA4A 3T69A 1XHZA 3VGLA 1ZYQA 4CJWA 4FWMA 1JKHA 1REVA 2YNHA 3EN9A 2GUPA 3MWPA 5D3GA 5JMVA 1BI4A 2B4JA 4IO8A 4FZYA 2WUSA 4H5TA 4EFHA 4G9ZA 4PWDA 1WN7A 3VF4A 4WFAL 3VEYA 1NK7A 1U4BA 3Q7BA 1CLQA 3FFKB 3A8YA 4RW8A 3VN5A 3VQ7A 3SAHA 5GAGP 2Z1HA 4E7LA 4ID1A 2UUAK 2ZJPL 3DRRA 4YOYA 4CJLA 4O44A 5BR8K 1Z05A 4JHDB 1CZBA 3C65A 3OS2A 3KLHA 5TKWA 1BDGA 1Q8IA 1HMVA 1TVRA 2HB5A 2RHKA 3LZIA 1JXEA 5CR4A 1WSHA 1VQLN 1RTJA 5C25A 2DTUA 1SUQA 4A61A 4LF4K 3EZWA 3PX4A 4KI6A 4FPBA 2D0BA 3L4QA 1UWBA 3KKRA 4M3ZA 1S1WA 4MDAA 1WAJA 4BRNA 1L3VA 1X9JA 4JI2K 1VSMA 5AQZA 1N33K 2WTUA 2VWJA 1ILYA 3NGYA 1QSYA 1YHQN 2DY4A 4U7BA 3ITHA 4GV3A 3ZSOA 3CMEN 1TUYA 4ELVA 2Q0RA 2X74A 3TSQA 3MXJA 4BR5A 3MN5A 5E84A 2AJQA 1YJNN 1BA0A 1C0FA 3VENA 1QQCA 3U4LA 4FYDA 2WONA 1B9FA 4B3TK 3FZFA 3HM8A 3UKRB 4ISEA 1W97L 3DLBA 3SCXA 2P9PA 4AHUA 3M8PA 3UE5A 1S1XA 4FWPA 4DU4A 3R3LA 2YX6A 2AA4A 1JLAA 1N8RO 2UUCK 4JKGB 1D5AA 1LW0A 1IH7A 3BZCA 5I3UA 2ZD1A 4GV9A 2Z1GA 5C2DA 1U2VA 3SJJA 3CC2N 3U3YA 3M3ZA 4ID5A 4J2EA 4BDYA 2HHXA 4CZLA 4LSNA 4EHUA 4PUOA 4W5OA 2Y1IA 5FRMA 1Z26A 2ZE2A 2O8DA 2JWLA 2P9UA 4FJJA 2CGJA 3WNHA 2VWBA 3DI6A 5M1KA 1K6YA 4KREA 3VQ5A 2P5OA 4CEAA 3CCSN 2G8VA 4DTXA 4BRLA 4CZIA 4DV5K 4OLBA 1Y64A 4KB1A 4JD2B 1TK0A 2ZQBA 4AHSA 3NF6A 1XNQK 4GMJB 5HRNA 1RT4A 4CJ3A 4B1VA 1FKPA 1CXQA 2O8BA 2QEXN 3QEXA 3NGIA 4CFDA 4PKHA 3KWGA 4GKJK 2QTDA 4CEFA 3OS0A 3C94A 4NYFA 1RT6A 3T7ZA 3NGZA 3KK1A 2UXDK 3L2RA 3LDLA 3BDPA 1VQMN 1K8KA 3DLRA 1LW2A 4DSEA 4H0VB 4ICLA 3MN9A 4DQSA 3ZYYX 1Q18A 1OKJA 2DFFA 3C0BA 2O8FA 4N5SA 1JLFA 3O4WA 5J2MA 4J8FA 4PA1A 3TAQA 3KLIA 4AM7A 1SL0A 4CECA 3CJ9A 3OS1A 1HNWK 1HNXK 4FZXC 5AFUH 4W5QA 4FWSA 1KXPA 3VGMA 1NK4A 3K5LA 1I39A 3FZMA 3EE8A 3AVMA 5BRFA 5JLFA 3SQ1A 2NUBA 2VG6A 3P39A 5AZIA 4BWJA 2V7YA 1U48A 3VQ8A 3KTQA 3CF5L 5BN9A 2OPRA 2UXCK 3RRGA 3H45C 4CD1A 3OJUA 4CHZA 3T1AA 2FXUA 3KKSA 2GWKA 4OGEA 3VQ4A 2QXFA 2YNFA 3FFIA 5AQVA 4E7HA 2NRTA 3H3NO 1Q82O 3QETA 3VQ6A 4FK4A 4ILGB 4CFCA 2EWSA 3GDQA 3L0QA 2W41A 3CIPA 4CVNE 1KD1O 4B3OA 3AVLA 3L3VA 3D2FA 1Q86O 5M1QA 3V1QA 4BACA 4CJFA 2E4LA 5C10A 4CJQA 1S3XA 3K5MA 1BG3A 2V51B 1HUXA 4CHOA 2GWJA 3JS6A 3CCEN 3AVAA 1NBWA 4U67L 3O9QA 1SL2A 4YORA 1BCMA 1WBBA 4KAZA 3GG4A 1KSPA 3ID8A 4C1NI 3ZX0A 4CGJA 4J2AA 4IXCA 3RSEB 4HUEA 1KFSA 2BANA 2PFUA 2HHVA 1BQMA 4FM1A 2I5JA 3C6TA 1VSIA 3C6HA 3WQUA 3PY8A 3OYHA 5AQQA 4B9NA 4R79A 3T1HK 3NHGA 4I9QA 4IDHA 5KGXA 3IG1A 3ZSVA 3KLGA 3OYLA 4BRKA 4PHTX 5BREA 3K9KA 3SMPA 4YDUC 2HNZA 4AHVA 4KHSA 3DM2A 2A5XA 4WQ5A 2OTJN 2Q97A 1N5YA 3GOIA 3LDPA 3NF8A 4M3WA 4M3YA 5HRRA 5AQLA 4FJ9A 4BC4A 3QNOA 4LC9B 3AARA 1ZBLA 4CEQA 4RG8A 4BRMA 1S1VA 3PX6A 4C8KA 4ELTA 4CIGA 5LJVA 4CD3A 5AQGA 5AQTA 5HBMA 4B9TA 4DTOA 3AA3A 2O8EB 4JS5A 2WBNA 5HP1A 1VQ6N 2F8SA 2O4GA 1NWKA 4FLXA 1YTAA 2YHBA 4IG3A 3J7AP 4Z4EA 3LALA 1IKVA 2P9LA 4BRCA 5IWAK 3P83D 3VF2A 3O4QA 2J4RA 2NZTA 3FLCO 3HL8A 4DFJA 4LFCK 1RCHA 1E4FT 4CHPA 2IIRA 4FW2A 1HNIA 4CE9A 2CH6A 3O1BA 3EYZA 4M3XA 4CIEA 5JVHL 1IO2A 3NF7A 1C0UA 3THYB 4BRAA 4M3RA 4XIUA 1TGOA 4CK2A 4FLTA 5M1NA 3OYDA 1FJGK 4QS8A 3VF6A 4BRDA 4B8CA 3T19A 4IOXA 4CBWA 4CW7B 3EKUA 4BG9A 1P8ZA 3THWA 3ZEUB 5AFUA 4N56A 1QQNA 3MEGA 3QBWA 1QTMA 5FPEA 4JYAK 1NM1A 2FSKA 3MCAB 3SQ2A 1TAUA 2QWOA 3SBTA 2WC9A 2JWKA 1BL3A 1QZ6A 2F4VK 4FM2A 3QERA 2ASPA 1HYVA 1VQ9N 4I7FA 3D0PA 4NLCA 4BREA 4H5VA 4UY8O 1XQSC 2P9KA 4MQ3A 2W42A 1KRPA 3CCRN 4H0OA 1LCUA 3OTOK 3HPGA 3JYTA 3L2UA 2W6KA 1QHAA 3PLAA 4X65K 1M90O 1NKCA 1RT2A 4FJNA 4CF9A 3S3OA 4JEPA 1YITN 4Q0BA 2IC3A 1Y97A 4WQ4C 3ZSRA 3CFPA 4BE0A 1BIUA 3V4IA 4IG0A 5C24A 1TV6A 3AAPA 3LWLA 4EIAA 4E7IA 2HHSA 4YNQA 3OW2M 5FLXO 3WT0A 4LF9K 1RDDA 1HKCA 1J5OA 3HOSA 4CCHA 2HOEA 4F2RA 3ZETB 5DM6L 1E3MA 3AVHA 4GKKK 4JI5K 5KPTA 2IVPA 1VQNN 4BRGA 3KK7A 3QFPA 1V4TA 2FF3B 1P90A 1IG8A 3SUOA 1NGBA 4K43A 3OYJA 1DLOA 4KHYA 4I9LA 1X9SA 3CHWA 3LP0A 4NLBA 1HLUA 3DLGA 1ATRA 4F8RA 4C8MA 5M1FA 2QM1A 1BWFO 4YOUA 3KZBA 5HROA 2AP1A 3CPEA 4BRFA 4ILJA 4QAGA 2E1ZA 1SAZA 1T05A 4Y0WA 3ZX3A 4CFBA 4DLGA 1RTHA 5FRNA 2G8KA 1NGHA 2Z1JA 3VESA 2DFEA 4B9QA 1VSJA 4W5NA 1ASUA 1S9GA 2KZMA 1W7AA 5KPZA 1X3MA 3ZCMA 1NGEA 4X62K 4FPAA 2YCHA 2PBDA 2EX3A 4BVOA 4EZ9A 1G99A 1TKZA 3AVBA 3OYGA 4R5PA 4WQ5C 2YHYA 5HL7L 3IS9A 1WOQA 4JK9A 1OVYA 4JLHA 5BPNA 4E7KA 5BN8A 1NOYA 3DXMA 1A5XA 1ZC6A 1OVQA 4QS7A 3SYZA 4WF9L 4H03B 1VQKN 3ASMA 2KFZA 2BDPA 3GL1A 1TKDA 4RTFD 4V19S 1NGIA 2A6AA 3JAMO 3AVCA 4FJ7A 4GV6A 3VQBA 4FLUA 1J9AA 2EHGA 4JKFA 3LPTA 2FC0A 3SLCA 2ZWHA 2A1RA 4B9SA 4O4GA 3MX5A 3DMJA 4YOXA 4OKKA 2VG7A 5KQDA 3QNNA 1ZBIA 3NMUA 2ZM6K 3DLHA 4JKEA 2G8FA 4X66K 3NFAA 1WB9A 1QVGM 3MK6A 4YHHK 3THXB 1FXXA 1NGDA 3MX2A 4CJUA 1ZBUA 3JSMA 1C0MA 3OA9A 1DEJA 4Z94A 4IBNA 4A2AA 3BF3A 4C8LA 4IWVA 4OPKA 1EO1A 3KWIA 4E0DA 3DYAA 3CYMA 3BUZB 3WUHA 3LPUA 2XRIA 1LWEA 3AVKA 1VQ8N 1NG9A 3DXKB 1RNHA 4KHNA 2Q0UA 3P31A 5CZ2A 2BGGA 4MDBA 4DF8A 3EKSA 4DTJA 4CK1A 5EVZA 2GBZA 3ISNC 1A5VA 4DUYK 4MO4A 2I7PA 1VQ5N 2FLOA 3OYEA 1SL1A 4LH4A 3WEEB 5KQ8A 3TAFA 3HO1A 1WLJA 1C0TA 3TANA 3THVA 2ASMA 4DR1K 2Q1NA 1WBDA 3DLEA 2ZJRL 4KTQA 4ZTJA 2GUIA 1KLMA 1J6ZA 4OX9K 3C6UA 1ASVA 1BCOA 4NB4A 3CJCA 4KPYA 3HT3A 4A5AA 1NLVA 3MXIA 1ZXOA 4FCYA 3WXIA 4XH5A 2IDOA 3HXMA 2XO7A 3AY9A 1WNSA 3IRXA 5SZTA 1NMDA 3CJ7A 2UYTA 3K9JA 4CEOA 2E6LA 3OBYA 2ETJA 2RKIA 2HHHK 3CXCM 2HHTA 4Y1CA 3FZKA 5HLFA 3CCJN 1YJWN 4CF1A 4LF8K 3A5OC 1RILA 2FBTA 5JLHA 4JKCA 1KC8O 2KZZA 3U9DA 2PAVA 5KI6A 2VQFK 1NK5A 3O6WA 3TABA 3D7EO 3RMDA 1UA1A 1BISA 4WFBL 4YDUA 3HPOA 4KV8A 3KJVA 3V1RA 3AO3A 4LSLA 3CQXA 1Q9XA 4CK3A 4CJRA 4FVMA 3JXUA 4CEDA 1Z25A 3SNNA 5EXWA 4JKHA 4DFKA 4F9OA 1HNVA 3B6OA 1N6QA 4LFAK 4H5RA 3J81O 1U45A 4E7JA 4E1JA 3VGKA 3CCUN 4DTNA 5BRDA 4B3MK 4B3SK 2WFBA 4MFBA 3E1YA 1J53A 2G8WA 1NGAA 4F3OA 3CETA 1OH8A 5FROA 3SPZA 3IAYA 4YOVA 3OYMA 1LAWA 3QICA 3O3FA 3SZ2A 3E9LA 2G8HA 4DR2K 4FJLA 1ITGA 1NOZA 3E9OA 4IJAA 4JHDA 5I9EB 1L3TA 3NF9A 5F1XA 4M63C 3UKUB 3D2EB 1KQSM 5AQYA 3I0RA 4I6MB 5EX5A 4B1ZA 1X9WA 3ZSWA 1H1VA 3VQCA 3KK2A 2X6SA 1GLDG 4OPJA 4JKDA 2XY5A 2P51A 1EQYA 4UQGA 3HK2A 1GLFO 4YOWA 3M1FA 3U9ZA 2HW3A 3HVRA 3VEVA 4M7XA 5CYMA 3PIOL 2HSTA 4RW9A 1N36K 1QQMA 3KD1E 4GVMA 2VQEK 3CFOA 2YKMA 5GIOA 3SI6A 4OO1J 5FPMA 3CCMN 4NXNK 5A2QO 4B9MA 4LFBK 4FO0A 1NKBA 1KCFA 2KLAA 1TYQB 2HBJA 4CF2A 4BDPA 1X3NA 1DT9A 2RF2A 1ASWA 3UKRA 1D9FA 3P38A 4K25A 2KTQA 3SAFA 3L2QA 1HYZA 1A5WA 4OKJA 3NE6A 3ENOA 3ULEB 1KAXA 3OYNA 4ISFA 4BRPA 3O08A 3HPHA 4JKGA 3V9WA 2P1JA 4AILC 4PL7A 2FF6A 5J2PA 4AQYK 3SK3A 2GEMA
chains in the Genus database with same CATH topology
3E66A 1DKGD 1JJ2M 1QQOA 2F7TA 3O80A 3MCPA 4BROA 2A40A 3TPQA 4WQ4A 4BRAA 3HZ6A 3WXMB 4PKGA 1XUPO 1T6CA 3EE9A 4XH4A 3WXKA 1MWKA 5M1NA 1K8KB 3CJAA 3O9SA 4QS8A 3VF6A 4BRDA 1Q7YO 1Z6RA 1U6ZA 3L4IA 5C15A 4IOXA 4CBWA 1HX1A 1D4XA 4H5NA 3EKUA 4BG9A 5H1SQ 2QWNA 3L6QA 3I8BA 1P8ZA 4JD2A 5BRHA 3ZEUB 4GNIA 5AFUA 1Q81O 1QQNA 3CD6N 3DXKA 1JCFA 3QBWA 4IZ9A 5FPEA 2Q2RA 4IEIA 3HOTA 1S72N 1T3VA 1NM1A 1O13A 2FSKA 3ID6A 3MCAB 4IO9L 3MDQA 4GY2B 2QWOA 1R59O 4JK7A 4ISGA 3SBTA 2WC9A 2JWKA 3CI5A 4JK8A 2KHOA 5F2RA 3RVCA 2QW9A 5GAHP 1QZ6A 3O9TA 2ASPA 1M1KO 2HF3A 2BTFA 3S41A 1VQ9N 3CC7N 3OHRA 1HKGA 2IVOA 3H3OB 4WFNL 5EOYA 3W3DA 3IKMA 2HMPA 2VCPA 2NNWA 3OBWA 4NLCA 4BREA 4EHTA 5AQKA 4H5VA 4UY8O 1VAZA 2BUPA 1XQSC 2P9KA 4H0TB 4BRIA 4WCEL 3HI0A 5AZIB 4CZKA 1RGIA 4B1XB 3C7NA 4CJ7A 3WEEA 4FWRA 4O8KA 3CCRN 3SMSA 5JICA 3A0IX 2P9IA 4H0OA 1LCUA 1V4SA 4ILHA 3EO3A 2QWPA 4FL9A 1MA9B 3J7ZO 1QHAA 1T6DA 3VOVA 4HWIA 3PLAA 1K8AO 1M90O 4JN4A 1C0GA 3O1WA 4YOTA 3AAQA 5DM7L 5LJWA 1BUPA 4JEPA 3VEOA 1YITN 4IOAL 4WQ4C 3HTVA 2GX9A 2P9SA 4CZMA 4CZEA 3H6EA 1NGCA 3FE1A 3IDHA 3R1XA 5JVGL 3WXLA 3ATVA 3AAPA 4BGBA 1RDWX 4EIAA 5AZJB 2VYPA 3HBTA 2BH1A 5BR9A 2NRXA 3OW2M 3WT0A 3WQTA 1HKCA 1YXQA 2GTDA 3LL3A 1SQKA 2A42A 3HOSA 3TTDA 1CZAN 2HOEA 3D2FB 2E1YA 3ZETB 5DM6L 3T69A 1W2BM 3VGLA 5ADXH 4KH4A 1NGJA 4FWMA 1TUUA 3QBXA 2QWQA 3VERA 4B1WB 3EN9A 2GUPA 3ATUA 5KPTA 3MWPA 5GINA 2IVPA 1VQNN 5JMVA 4BRGA 2QWLA 3KK7A 3QFPA 1V4TA 2FF3B 1P90A 4BR9A 1ESVA 1IG8A 3QFUA 1NGBA 3SAGA 4IO8A 3D6RA 2YJFA 4O5FA 2NRRA 4K43A 3R8EA 2WUSA 3TTCA 4H5TA 5AQNA 4EFHA 4G9ZA 2CGLA 3VF4A 3CHWA 4IEEA 4WFAL 4A5AA 4NLBA 4IJNA 3VEYA 1HLUA 1ATRA 3Q7BA 5AR0A 4FWNA 5M1FA 5AQOA 2Q36A 2QI2A 4DHYA 2QM1A 1BWFO 3A8YA 3FFKB 3SAHA 4YOUA 4JKBA 3AGRA 4PKIA 3LDNA 2GELA 5GAGP 3KZBA 3QB0A 5EY4A 2AP1A 2ZJPL 4BY9C 3CPEA 4YOYA 4BRFA 4ILJA 3MMVA 3I55N 1Z05A 4JHDB 3C65A 5TKWA 2E1ZA 1KAYA 4K41A 1BDGA 1SAZA 3IUCA 4Y0WA 5C12A 2RHKA 1VQLN 3ZX3A 2NRWA 5CR4A 4BVPA 2V7ZA 4FWOA 3MWTA 4XH1A 1NGHA 1VQ7N 3VESA 4B9QA 3ENHA 3H46O 4A61A 3VTIA 1ATNA 5AQRA 3EZWA 1X3MA 3HSCA 5KPZA 4FPBA 5KPRA 1NGEA 1RDUA 3L4QA 3DWLA 4FPAA 2YCHA 4B1UB 2PBDA 2P9NB 4BVOA 4MDAA 1G99A 1S22A 4BRNA 4GVEA 1X9JA 4NO7A 2HF4A 3TSUA 4CBUA 4WQ5C 2YHYA 3RSEA 5F0XA 5HL7L 5AQZA 1WOQA 2QWRA 3MN7A 4JK9A 3G71N 1OVYA 1ILYA 4QS9A 4EAHD 5BPNA 1MDUB 1YHQN 4C23A 4U7BA 5BN8A 4GV3A 2E2OA 3DXMA 1ZC6A 3CMEN 4QS7A 3PIPL 5C2FA 1TUYA 5AQWA 4WF9L 4H03B 3P4IA 2Q0RA 5GAEP 3TSQA 4CZFA 2VGNA 3UKUA 1VQKN 3D2EA 3G6EN 3BF1A 3GL1A 3MN5A 4BR5A 5E84A 4CZGA 4M7YA 4RTFD 4RWTA 1YJNN 1BA0A 1C0FA 1NGIA 4I6MA 3VENA 2A6AA 3U4LA 3FZLA 1K9MO 2E8AA 4GV6A 3FZFA 3HM8A 3UKRB 4ISEA 3NVKA 1W97L 4FWKA 4JKFA 3ZX2A 4DQ8A 2P9PA 3O9RA 2P9LB 2ZWHA 3SLCA 2CH5A 3UE5A 4FWPA 3R3LA 2YX6A 3MX5A 4A57A 2AA4A 3BP8A 1N8RO 4YOXA 4BG8A 5KQDA 3GBTA 3NMUA 4JKGB 3IFRA 4JKEA 3DAWA 3B8AX 4MLEA 2VGMA 2F9WA 4H5WA 1U2VA 4WYBA 5C2DA 1QVGM 3CC2N 4GV9A 3MK6A 3M3ZA 3CJBA 1NGDA 3MX2A 4CZLA 4OPHA 1K73O 4EHUA 3HRGA 3OA9A 4BR0A 1DEJA 3EL2A 4Z94A 3FR0A 2FSJA 2JWLA 2P9UA 3N4QA 2CGJA 5E26A 4A2AA 1YIJN 2VWBA 5AQXA 1TYQA 3A5NC 2F9TA 3BF3A 2YJEA 1QZ5A 2QA4N 1EO1A 4IWVA 3UB5A 1BU6O 3KWIA 5M1KA 3CCSN 3BUZB 3KHYA 4BRLA 4CZIA 4KH6A 3WUHA 2E88A 1Y64A 3F5TA 4BC3A 4JNEA 1NGGA 4JD2B 5CE3A 1VQ8N 2I7NA 2NRHA 2NLXA 3DXKB 3ULEA 1WUAA 3H1QA 5AQIA 2Q0UA 2QWMA 3P31A 4AM6A 4B1VA 4HTLA 1JCEA 3WXJA 3N4PA 2QEXN 2E2NA 2ZGYA 4MDBA 4B1YB 3EKSA 3QMLA 4C1NK 2ZF5O 5EVZA 4PKHA 2YI1A 3KWGA 4BC5A 4BQLA 1YVNA 2QTDA 5CHIA 3TSPA 3R9PA 3T7ZA 2KKZA 5AQFA 5M1OA 5C0YA 4MO4A 2I7PA 4DKWA 1VQ5N 3CCLN 2FLOA 3LDLA 1YJ9N 4CI6A 3CQYA 2P9KB 5AQHA 1VQMN 1K8KA 1DGKN 3C7NB 3WEEB 5KQ8A 4H0VB 4OPAA 3MN9A 2P9IB 4H0YB 1QVFM 3ZYYX 1Q18A 2ASMA 2Q1NA 5MLCQ 1OKJA 2D1KA 2FSNA 2ZJRL 3C0BA 3ZEUA 2H3GX 4O8UA 3CMAN 5AQPA 1J6ZA 3KVGA 3QDKA 3O4WA 3G25A 3TU5A 4NB4A 3CJCA 4J8FA 4KH5A 2IVNA 1YAGA 3M5RA 1NLVA 2P9SB 1ZXOA 2D0OA 3IMXA 1YUWA 3F9MA 3VTHA 4AM7A 4A2BA 3CJ9A 3WXIA 4XH5A 5B8HA 1HPMA 5AFUH 3LM9A 3I56N 3AY9A 4KBOA 3O9UA 1NMDA 4FWSA 1KXPA 3CJ7A 3VGMA 3DLLL 3FZMA 3EE8A 2HBMA 2UYTA 5JLFA 5BRFA 3DJCA 1GLBG 3K9JA 1KAZA 4PL8A 3OBYA 3P39A 5AZIA 4DB3A 4DCHA 3VEWA 2V7YA 3LDOA 3CF5L 3CXCM 5M1PA 2HBKA 5BN9A 2ZJQL 3H45C 4CD1A 3FZKA 1GLCG 4A59A 3VPZA 4A5BA 4CZHA 2V52B 1BO5O 2FXUA 3CCJN 1YJWN 2GWKA 3H1VX 3A5OC 3NVMA 4BRQA 1NGFA 4JAXA 5JLHA 3G4SN 2HBLA 4JKCA 3AGKA 1XC3A 1KC8O 3U9DA 3CERA 4H0PA 5LY3A 2PAVA 3I33A 4BR4A 2QXLA 5AQSA 5AQVA 2YHWA 3O6WA 3D7EO 4BC2A 2NRTA 3H3NO 1Q82O 3A5MC 4YDUA 2RE2A 4WFBL 1SZ2A 5AZJA 3R6MA 4ILGB 5TKYA 2EWSA 3GDQA 3SBGA 3L0QA 1JCGA 2W41A 3CIPA 1KD1O 3M6GA 3CQXA 3JXUA 3GE1A 4FVUA 4FOIA 3D2FA 1Q86O 5EXWA 4JKHA 4XEIA 5M1QA 3MN6A 3ZETA 4F9OA 5C10A 1S3XA 1BG3A 2V51B 1HUXA 4K42A 4H5RA 4RCHA 2A41A 2GWJA 2E2QA 3JS6A 3CCEN 1NBWA 4U67L 4E1JA 1IJJA 3O9QA 4FSVA 4YORA 1E4GT 3VGKA 3CCUN 3GG4A 1RFQA 5BRDA 4IOCL 2OTLN 2ASOA 2WFBA 3ID8A 2Q31A 4C1NI 3E1YA 5AQUA 3W0LA 1YF5L 3ZX0A 4A62A 3FZHA 2D4WA 1NGAA 3F2KA 3CETA 4FWLA 1LOTB 4YOVA 2D0PA 4IXCA 3RSEB 3QICA 2NRVA 2PFUA 1HKBA 2E20A 1BOTO 4H0XB 3E9LA 4CZJA 1ZBSA 3DXMB 4BR7A 3VETA 5HOOA 3E9OA 4IJAA 4JHDA 5I9EB 3Q7CA 5F1XA 3C6HA 3WQUA 4M63C 3UKUB 3D2EB 5GIPA 2ITMA 5AQQA 1KQSM 2NRZA 3U8XA 5AQYA 4CBXA 2CGKA 4R79A 5GADP 4IDHA 2A3ZA 5AQMA 3TTFA 4I6MB 5EX5A 4B1ZA 4BRKA 3CJ1A 4PHTX 1H1VA 1YI2N 5BPMA 1GLEG 5BREA 3K9KA 1VQ4N 1GLDG 3SMPA 4JKDA 2DPNA 2W40A 4YDUC 3O5BA 4BRHA 1EQYA 5BPLA 3CPWM 2A5XA 2P9PB 4BGAA 3CC4N 2P9NA 1GLFO 4WQ5A 3CCQN 2OTJN 4YOWA 1ATSA 1SS6A 3M1FA 3U9ZA 5FPDA 2Q97A 3ENBA 1GLJO 1VQPN 3GOIA 3VEVA 4M7XA 3LDPA 3PIOL 4BR2A 2HSTA 3C6AA 4IFEA 5FPNA 1QQMA 5AQLA 1T44A 1U2VB 4AF1A 4BC4A 3CCVN 2OANA 4LC9B 3AARA 1BA1A 3E9PA 4BRMA 5GIOA 4OO1J 1GLAG 3O8MA 5LJVA 5FPMA 3CCMN 3FGUA 2E2PA 4CD3A 1GLLO 2P9UB 5AQTA 4FWQA 5AQGA 4FO0A 2KLAA 1TYQB 2HBJA 1X3NA 5AQJA 1DT9A 5ELZA 3LM2A 2WBNA 5ADXA 1VQ6N 1NWKA 4MLHA 3UKRA 3P38A 4K25A 3SJHA 2YHXA 3VEXA 4JKAA 3SAFA 1VQON 4L3QA 2P9LA 4BRCA 3ENOA 1MWMA 3VF2A 2ZGZA 3BEXA 3ULEB 2J4RA 2NZTA 4MO5A 4BQZA 1HJOA 1KAXA 3FLCO 3J8AA 4FOEA 4ISFA 4BRPA 1E4FT 3O08A 3VEZA 2IIRA 4JKGA 2CH6A 3A5LC 3O1BA 3VMFB 2FF6A 4PL7A 1NJIO 5JVHL 3SK3A 3LDQA 2GEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M1F A;  5C2D A;  3C6A A;  4IFE A;  5C2F A;  3CPE A;  4IEE A;  5M1O A;  5M1N A;  4IEI A;  5C12 A;  4IDH A;  5M1P A;  5M1Q A;  5C15 A;  3C6H A;  5M1K A;  5C10 A; 
#chains in the Genus database with same CATH topology
 1I94 K;  4DTS A;  1DKG D;  3HJF A;  3O80 A;  2HMI A;  4WQ4 A;  3QEW A;  3HZ6 A;  3WXM B;  1XUP O;  3EE9 A;  1EWR A;  3WXK A;  1MWK A;  1QE1 A;  4AHR A;  2X6N A;  1NK6 A;  3L2W A;  1Q7Y O;  1U6Z A;  5C15 A;  1HX1 A;  3AVJ A;  4CEZ A;  5H1S Q;  3LZJ A;  4K0K K;  1XC9 A;  3I8B A;  1VK0 A;  4JD2 A;  4GNI A;  2PYL A;  4E1N A;  1VHX A;  1SV5 A;  4IZ9 A;  4Z4F A;  3HOT A;  3ID6 A;  3LWM A;  1IV0 A;  4GY2 B;  3ULD A;  1R59 O;  4FZZ A;  3RVC A;  4ZHR A;  3VA3 A;  2QW9 A;  5GAH P;  3O9T A;  4KKO A;  4F3T A;  4KTZ A;  1FK9 A;  4IFV A;  2BTF A;  3S41 A;  1HKG A;  2IVO A;  4WFN L;  3P5J A;  3OBW A;  4E1M A;  4EHT A;  3NH0 A;  1VAZ A;  3U6F A;  4WCE L;  1RGI A;  3VQA A;  4O8K A;  2FBX A;  3SMS A;  1HNZ K;  2O8C B;  1FKO A;  1K8A O;  3O1W A;  3PSI A;  4YOT A;  3SV4 A;  5E41 A;  3CG7 A;  4W5T A;  5LJW A;  2YNI A;  4DV2 K;  1BQN A;  3H6E A;  4BE1 A;  3IDH A;  3WXL A;  3ATV A;  1RDW X;  3KIO A;  1U04 A;  5AZJ B;  1DTT A;  3HBT A;  1NNE A;  4NXM K;  3O3G A;  3L8B A;  1SQK A;  1NKE A;  1U47 A;  2A1S A;  1CZA N;  3OYI A;  4DS4 A;  1W2B M;  5ADX H;  1VSL A;  4KH4 A;  4DV0 K;  4FXD A;  1TUU A;  1RBS A;  3AVG A;  3QBX A;  4B1W B;  1S5J A;  4BE2 A;  3KLF A;  4BR9 A;  1ESV A;  3SAG A;  3RRH A;  2YJF A;  4O5F A;  2NRR A;  3R8E A;  3TTC A;  4KI4 A;  5AJ3 K;  3UIQ A;  3TAP A;  5AR0 A;  3K0S A;  4CFA A;  1LAV A;  2FBY A;  2QI2 A;  4DHY A;  4ELU A;  3AGR A;  4PKI A;  1IG9 A;  5EY4 A;  2DFH A;  5J1E A;  1SKS A;  4PY5 A;  5HRS A;  4FW1 A;  3M8R A;  4DFM A;  1KAY A;  4K41 A;  5C12 A;  3IUC A;  1KFD A;  2NRW A;  4BVP A;  2V7Z A;  4FWO A;  5CY4 A;  3MWT A;  1XMO K;  1GOA A;  1NK9 A;  4JV5 K;  3VTI A;  1ATN A;  1RBV A;  5AQR A;  1CXU A;  3V1O A;  4OGC A;  3M8Q A;  1RDU A;  3DWL A;  2OCE A;  4B1U B;  2P9N B;  4GVE A;  2RPI A;  2HF4 A;  4NO7 A;  3TSU A;  1JL1 A;  3RSE A;  5F0X A;  5LMU K;  2QWR A;  3MN7 A;  3G71 N;  3KK3 A;  1IBM K;  4JI3 K;  4WE1 A;  4EAH D;  1MDU B;  4C23 A;  1TK8 A;  3H08 A;  3PIP L;  5C2F A;  5AQW A;  5KRS A;  3P4I A;  5GAE P;  2VGN A;  4O0J A;  3G6E N;  3LDS A;  4CZG A;  4M7Y A;  3TAM A;  4RWT A;  1F21 A;  3FZL A;  1K9M O;  2E8A A;  3SPY A;  3HST B;  5C42 A;  4DSF A;  3NVK A;  4FJ8 A;  4FWK A;  3ZX2 A;  4DQ8 A;  3BZK A;  1IKX A;  4JI1 K;  2CH5 A;  4LF6 K;  3AA2 A;  3DAW A;  4BDZ A;  3B8A X;  4DS5 A;  4BWM A;  4MLE A;  2VGM A;  2F9W A;  3QIO A;  3MAQ A;  4WYB A;  1JLB A;  5JS2 A;  1OH7 A;  4OPH A;  1BHL A;  4AH9 A;  3V9X A;  2FSJ A;  3N4Q A;  5E26 A;  5AQX A;  2F9T A;  2YJE A;  3A5N C;  4ZTF A;  2O8E A;  4HUF A;  2B6A A;  3WNF A;  4B9V A;  5SWM A;  4LY7 A;  3KHY A;  4KH6 A;  2O4I A;  1NGG A;  2PY5 A;  1WUA A;  4OKE A;  4FJH A;  1IKY A;  2QWM A;  4HTL A;  1JCE A;  2OA8 A;  2E2N A;  2ZGY A;  3O3H A;  4IFY A;  4C1N K;  3PSF A;  2ZF5 O;  2YI1 A;  4BQL A;  3THY A;  3TSP A;  2B5J A;  2KKZ A;  4DKW A;  3CCL N;  1YJ9 N;  3ZT0 A;  4CI6 A;  4NYN A;  1LV5 A;  3QLH A;  4JI0 K;  3C7N B;  1WSF A;  4OPA A;  1NJY A;  2ATQ A;  2IOC A;  2P9I B;  1QVF M;  2D1K A;  2FSN A;  4CJT A;  3ZEU A;  2H3G X;  4O8U A;  4W5R A;  5AQP A;  4DV4 K;  3QDK A;  3G25 A;  3C95 A;  4KH5 A;  2IVN A;  2XY7 A;  4CJK A;  3WNG A;  1JXB A;  2P9S B;  3VTH A;  1W0H A;  1WAF A;  1YUW A;  2HNY A;  3ZSX A;  3RTV A;  5B8H A;  3LM9 A;  4NCG A;  4DR4 K;  3P1G A;  4FLW A;  1RDA A;  3DLL L;  2YV0 X;  2HBM A;  1GOB A;  3I8D A;  1GLB G;  4DMN A;  1KAZ A;  4PL8 A;  4DB3 A;  3VEW A;  3D45 A;  3LDO A;  1JL2 A;  5M1P A;  4LF7 K;  4CZH A;  4A5B A;  5EU7 A;  3VPZ A;  3M8S A;  2V52 B;  1BI4 B;  3H1V X;  4JAX A;  2HBL A;  3AGK A;  3ZSQ A;  4H0P A;  4CEB A;  3I33 A;  3BGR A;  2QXL A;  2YHW A;  4FJI A;  2IS3 A;  4BC2 A;  3A5M C;  2RE2 A;  2OPP A;  4I2P A;  3R6M A;  5TKY A;  3SBG A;  1JCG A;  3KD5 E;  1VSK A;  2XY8 A;  2OPS A;  2YHA A;  4FM0 A;  4FVU A;  3GE1 A;  4H4O A;  1HYS A;  4FOI A;  1TK5 A;  3ZET A;  3NCI A;  4CGG A;  4RCH A;  3MXM A;  2E2Q A;  3K57 A;  4CGD A;  1IJJ A;  4FSV A;  4KHU A;  1E4G T;  1RFQ A;  2Y1J A;  2OPQ A;  2OTL N;  2ASO A;  3TI0 A;  2Q31 A;  4DR6 K;  1VRT A;  4X64 K;  5AQU A;  4A62 A;  3FZH A;  2D4W A;  3F2K A;  3V81 A;  1LOT B;  2KW4 A;  3RWU A;  1BOT O;  1HPZ A;  4HCB A;  4KB0 A;  2HHQ A;  3RR7 A;  4OJR A;  1EP4 A;  1ZBS A;  3LAM A;  3QES A;  3VET A;  4CGF A;  4E19 A;  5HOO A;  4DQI A;  2UXB K;  4FJG A;  1EWQ A;  1MU2 A;  3AO1 A;  1L3S A;  2OZM A;  4KRF A;  5GIP A;  2ITM A;  4CBX A;  1YVU A;  5GAD P;  4HCC A;  3NH1 A;  4HVJ A;  3TTF A;  1VSH A;  4KO0 A;  1YI2 N;  1GLE G;  1VQ4 N;  2DPN A;  2W40 A;  4DV1 K;  4BRH A;  3CPW M;  2G8U A;  1HQU A;  2P9P B;  3A2F A;  1RBT A;  3CCQ N;  4LD0 A;  4KHQ A;  3ENB A;  1GLJ O;  1VQP N;  1GOC A;  3TR8 A;  4BR2 A;  5KRT A;  4DTM A;  3SUN A;  3C6A A;  4IFE A;  5FPN A;  1RT7 A;  1U2V B;  3CCV N;  1X9M A;  1C1A A;  3VQP A;  1LWF A;  4DR7 K;  1OH6 A;  4M45 A;  2OYQ A;  3FGU A;  2E2P A;  2O8D B;  1GLL O;  2P9U B;  4G1Q A;  2X78 A;  4FLY A;  4TSX A;  4B08 A;  1VSD A;  1QHT A;  2QKB A;  1N34 K;  2YHX A;  2OZS A;  4L3Q A;  4B9L A;  3O4N A;  1MWM A;  4LF5 K;  2ZGZ A;  3BEX A;  2QKK A;  4MO5 A;  1HJO A;  3J8A A;  1TKX A;  3DOL A;  3VEZ A;  1XMQ K;  5DMR A;  3VMF B;  3K2P A;  2O8B B;  3E66 A;  3THX A;  3SUP A;  4FJX A;  1HR0 K;  1L3U A;  3VA0 A;  1D8Y A;  3AO2 A;  4EP5 A;  1S1U A;  3ZSZ A;  4DV7 K;  1HQE A;  2YKN A;  1K8K B;  3CJA A;  3E01 A;  3O9S A;  1Z6R A;  3L4I A;  3AA5 X;  5IT9 O;  1D9D A;  4H5N A;  3L6Q A;  1BGX T;  3BY5 A;  3HYF A;  5BRH A;  1Q81 O;  4RW6 A;  3CD6 N;  2O8F B;  3DXK A;  5LMN K;  1JCF A;  1NJX A;  2Q2R A;  4IEI A;  1S72 N;  4L8R B;  1T3V A;  2IAJ A;  4F2S A;  3B6P A;  3CI5 A;  2KHO A;  1SKW A;  3J80 O;  1QSS A;  1C1C A;  1NJW A;  3CC7 N;  2GV9 A;  4DV6 K;  3OHR A;  3H3O B;  3W3D A;  3IKM A;  2KFN A;  2VCP A;  2NNW A;  1U49 A;  2UU9 K;  4Y1D A;  2BUP A;  4H0T B;  3WNE A;  4BRI A;  5AZI B;  4CJP A;  4CZK A;  3NH2 A;  2HVH A;  4B1X B;  3RMA A;  5J2N A;  4CJ7 A;  3WEE A;  4FWR A;  1KLN A;  5JIC A;  3A0I X;  1V4S A;  4ILH A;  3EO3 A;  1MA9 B;  4DSJ A;  1T6D A;  3VOV A;  4HWI A;  4CJS A;  4JN4 A;  1C0G A;  1HRH A;  3AAQ A;  5DM7 L;  1YTU A;  4JI4 K;  4CHN A;  3HTV A;  1EX4 A;  4CZM A;  3ZLJ A;  3K5N A;  1VRU A;  3R1X A;  5JVG L;  4BGB A;  4NCB A;  4DV3 K;  4KFB A;  4Z4C A;  4FLV A;  5BR9 A;  2E5L K;  1VSF A;  2FBV A;  3OYK A;  3HP9 A;  2XY6 A;  1YXQ A;  3LL3 A;  4KHP K;  1QSL A;  3D2F B;  2E1Y A;  3OYF A;  4DTU A;  1NGJ A;  4DQP A;  2UUB K;  2QWQ A;  3VER A;  1RTD A;  5GIN A;  3ATU A;  4DSL A;  1TL3 A;  2QWL A;  3MED A;  3QFU A;  3D6R A;  4DR5 K;  5AQN A;  2CGL A;  1RBU A;  4IEE A;  4E3S A;  4IJN A;  5CZ1 A;  4YFU A;  4JI7 K;  4FWN A;  5AQO A;  3PO5 A;  2Q36 A;  1RTI A;  5KGW A;  4JKB A;  4CES A;  3LDN A;  2GEL A;  3L3U A;  3QB0 A;  1VSE A;  4BY9 C;  1T7P A;  1S9E A;  3S3N A;  4FK2 A;  3MMV A;  3I55 N;  1YT3 A;  1UOC A;  5LL6 Z;  5JS1 A;  4XH1 A;  1VQ7 N;  1XNR K;  3G10 A;  3ENH A;  3H46 O;  2PZS A;  3ZT3 A;  3HSC A;  4B8A B;  4Z4H A;  5KPR A;  3TAG A;  1J54 A;  1S22 A;  4DTR A;  3V6D A;  3OYC A;  4CBU A;  4QS9 A;  2E2O A;  3KLE A;  4QOZ B;  1SKR A;  4CZF A;  4I2Q A;  3UKU A;  4OLA A;  3D2E A;  3BF1 A;  4B9U A;  3AVN A;  1QS4 A;  4I6M A;  4N76 A;  3ZT4 A;  2XHB A;  2HND A;  3HM9 A;  1RDB A;  2R7Y A;  3O9R A;  2P9L B;  3AO4 A;  1ZBF A;  4A57 A;  3BP8 A;  4JRQ A;  4BG8 A;  3GBT A;  3IFR A;  3LP3 A;  4H5W A;  3CJB A;  5I42 A;  5J2Q A;  1K73 O;  4CER A;  2PYJ A;  1BIZ A;  4C8N A;  3HRG A;  4HHT A;  4CF0 A;  4BR0 A;  3EL2 A;  3FR0 A;  1XWL A;  1YIJ N;  1WSE A;  1TYQ A;  3TAR A;  1QZ5 A;  3OJS A;  2QA4 N;  3UB5 A;  1BU6 O;  4F4K A;  4HTU A;  1J5E K;  4DF4 A;  2E88 A;  3F5T A;  4BC3 A;  4JNE A;  5CE3 A;  4DSI A;  3THW B;  2I7N A;  2NRH A;  2NLX A;  3ULE A;  3H1Q A;  5AQI A;  1KVB A;  4B3R K;  1DTQ A;  4AM6 A;  4DTP A;  3WXJ A;  3AVF A;  3N4P A;  2KQ2 A;  3HVT A;  5CYQ A;  3CQ8 A;  3AVI A;  1RT3 A;  4B1Y B;  3QML A;  3NAE A;  4CJ4 A;  4BC5 A;  3EY1 A;  1XHX A;  1YVN A;  1JLC A;  4IKF A;  5CHI A;  3DRS A;  3R9P A;  5M1O A;  5AQF A;  5C0Y A;  3RMC A;  1T03 A;  3SUQ A;  3CQY A;  2P9K B;  5AQH A;  3S3M A;  4CEE A;  1DGK N;  4FJK A;  2Q3S A;  5DK5 A;  1CZ9 A;  1TAQ A;  3DLK A;  4H0Y B;  4K8X A;  4RW7 A;  3LAN A;  5MLC Q;  3K5O A;  4QCL A;  3CMA N;  2D0C A;  3KVG A;  3QO9 A;  3TU5 A;  3OYA A;  4AHT A;  4DWI A;  3CM5 A;  5T7B A;  3M5R A;  1YAG A;  3IMX A;  2D0O A;  3PUF A;  4PQU A;  3F9M A;  4A2B A;  4CJ5 A;  1B92 A;  1HPM A;  3I56 N;  4M3U A;  1EET A;  1L5U A;  4KBO A;  3O9U A;  2VG5 A;  1LWC A;  4DG1 A;  4DFP A;  3DJC A;  3VQ9 A;  4DCH A;  1NJZ A;  4CGH A;  5K14 A;  1IBK K;  2ZJQ L;  2HBK A;  3QEI A;  3RR8 A;  4A59 A;  1GLC G;  2O8C A;  1O1W A;  1BO5 O;  4CHQ A;  4DUZ K;  4FK0 A;  3ALY A;  3NVM A;  4YY3 K;  4M3T A;  1OH5 A;  4BRQ A;  1NGF A;  3G4S N;  1G15 A;  1XC3 A;  3CER A;  5LY3 A;  1ZBH A;  1X1P A;  3CFR A;  4BR4 A;  3SV3 A;  5AQS A;  4J2D A;  4JS4 A;  3QIN A;  4K8Z A;  3SQ4 A;  2YNG A;  1SZ2 A;  1KVC A;  2F96 A;  5AZJ A;  4DSK A;  3VQQ A;  1IBL K;  1N32 K;  3K59 A;  2W6L A;  3M6G A;  1JLG A;  2HHW A;  4E89 A;  4RW4 A;  4XEI A;  4CJV A;  2D0A A;  3MN6 A;  3V9S A;  2JLE A;  1UAX A;  3ZT2 A;  4CIF A;  3MEE A;  3HP6 A;  2RN2 A;  4K42 A;  2A41 A;  1S6P A;  3TWH A;  4Z4I A;  4GW6 A;  4IOC L;  4DR3 K;  4LH5 A;  3ZSY A;  4O0I A;  3W0L A;  3F9K A;  1YF5 L;  3I0S A;  1RBR A;  4CGI A;  4FWL A;  3RMB A;  2D0P A;  2NRV A;  5HRP A;  3EEQ A;  1HKB A;  2E20 A;  4JI6 K;  3G0Z A;  4H0X B;  4FJ5 A;  4CZJ A;  1WSI A;  2ITG A;  3DXM B;  3U3G A;  4BR7 A;  4IDK A;  3J7Y P;  1S6Q A;  1KVA A;  4DLE A;  3Q7C A;  2F8T A;  1C6V A;  3F73 A;  2NRZ A;  3OVN A;  3U8X A;  4NCA A;  2CGK A;  4Z0U A;  2A3Z A;  5AQM A;  2G8I A;  3CJ1 A;  1KTQ A;  1RDC A;  3T1Y K;  4M42 A;  5BPM A;  5FDL A;  1NK8 A;  3O5B A;  5BPL A;  4DU1 A;  4DQR A;  1T8E A;  4BGA A;  3CC4 N;  2P9N A;  1ATS A;  1S1T A;  1SS6 A;  5FPD A;  1Q9Y A;  3QIP A;  3LAK A;  4O5B A;  4AHC A;  3L2V A;  1T44 A;  4AF1 A;  2OAN A;  2JGU A;  4FJM A;  1BA1 A;  1NU0 A;  4C8O A;  3E9P A;  4JI8 K;  1GLA G;  3O8M A;  3PV8 A;  1RT1 A;  3S9H A;  4FWQ A;  4OVL A;  4N47 A;  3OYB A;  3EZ5 A;  1R0A A;  5AQJ A;  5ELZ A;  3K58 A;  2VWK A;  2Z1I A;  3LM2 A;  5ADX A;  4CHY A;  4HUG A;  4MLH A;  3TAE A;  3SJH A;  1RT5 A;  3QEP A;  1FW6 A;  3VEX A;  1I3A A;  4JKA A;  1VQO N;  3CM6 A;  4BQZ A;  3V9U A;  4FOE A;  3A5L C;  1UA0 A;  4CJE A;  1NJI O;  3LDQ A;  1JLQ A;  1JJ2 M;  1QQO A;  2F7T A;  3MCP A;  4BRO A;  3SQ0 A;  2A40 A;  3TPQ A;  4N41 A;  1XI1 A;  4PKG A;  1T6C A;  3LP2 A;  4XH4 A;  2HHU A;  1B9D A;  4JRP A;  4H8K A;  3NBP A;  2IGI A;  4KTW A;  4Z4G A;  1HJR A;  1D4X A;  2QWN A;  2P5G A;  4J2B A;  1TL1 A;  4O55 A;  2WOM A;  1C1B A;  1O13 A;  4IO9 L;  4FLZ A;  3DRP A;  3MDQ A;  3ZT1 A;  4JK7 A;  4ISG A;  2LSN A;  4JK8 A;  5F2R A;  5KTQ A;  1IKW A;  4DQQ A;  3LP1 A;  1EXQ A;  2HF3 A;  3QEV A;  1M1K O;  3MEC A;  5EOY A;  2HMP A;  3T3F A;  5AQK A;  1NMN A;  3HI0 A;  3PO4 A;  3AV9 A;  3C7N A;  3PX0 A;  2D5R A;  2P9I A;  1TKT A;  2QK9 A;  4M41 A;  1EKE A;  2QWP A;  4FL9 A;  3VQD A;  3J7Z O;  4H4M A;  3OY9 A;  4CF8 A;  3DOK A;  1WSG A;  1BUP A;  3VEO A;  4IOA L;  1NK0 A;  1W9H A;  2GX9 A;  4Q5V A;  2P9S A;  4CZE A;  4EP4 A;  1NGC A;  3V9Z A;  3FE1 A;  4EZ6 A;  2VYP A;  2BH1 A;  1JLE A;  2NRX A;  4KHW A;  3VQE A;  3WQT A;  3AO5 A;  2GTD A;  4DU3 A;  2A42 A;  2E6M A;  3NDK A;  1WSJ A;  3TTD A;  2BE2 A;  2HVI A;  3AA4 A;  3T69 A;  1XHZ A;  3VGL A;  1ZYQ A;  4CJW A;  4FWM A;  1JKH A;  1REV A;  2YNH A;  3EN9 A;  2GUP A;  3MWP A;  5D3G A;  5JMV A;  1BI4 A;  2B4J A;  4IO8 A;  4FZY A;  2WUS A;  4H5T A;  4EFH A;  4G9Z A;  4PWD A;  1WN7 A;  3VF4 A;  4WFA L;  3VEY A;  1NK7 A;  1U4B A;  3Q7B A;  1CLQ A;  3FFK B;  3A8Y A;  4RW8 A;  3VN5 A;  3VQ7 A;  3SAH A;  5GAG P;  2Z1H A;  4E7L A;  4ID1 A;  2UUA K;  2ZJP L;  3DRR A;  4YOY A;  4CJL A;  4O44 A;  5BR8 K;  1Z05 A;  4JHD B;  1CZB A;  3C65 A;  3OS2 A;  3KLH A;  5TKW A;  1BDG A;  1Q8I A;  1HMV A;  1TVR A;  2HB5 A;  2RHK A;  3LZI A;  1JXE A;  5CR4 A;  1WSH A;  1VQL N;  1RTJ A;  5C25 A;  2DTU A;  1SUQ A;  4A61 A;  4LF4 K;  3EZW A;  3PX4 A;  4KI6 A;  4FPB A;  2D0B A;  3L4Q A;  1UWB A;  3KKR A;  4M3Z A;  1S1W A;  4MDA A;  1WAJ A;  4BRN A;  1L3V A;  1X9J A;  4JI2 K;  1VSM A;  5AQZ A;  1N33 K;  2WTU A;  2VWJ A;  1ILY A;  3NGY A;  1QSY A;  1YHQ N;  2DY4 A;  4U7B A;  3ITH A;  4GV3 A;  3ZSO A;  3CME N;  1TUY A;  4ELV A;  2Q0R A;  2X74 A;  3TSQ A;  3MXJ A;  4BR5 A;  3MN5 A;  5E84 A;  2AJQ A;  1YJN N;  1BA0 A;  1C0F A;  3VEN A;  1QQC A;  3U4L A;  4FYD A;  2WON A;  1B9F A;  4B3T K;  3FZF A;  3HM8 A;  3UKR B;  4ISE A;  1W97 L;  3DLB A;  3SCX A;  2P9P A;  4AHU A;  3M8P A;  3UE5 A;  1S1X A;  4FWP A;  4DU4 A;  3R3L A;  2YX6 A;  2AA4 A;  1JLA A;  1N8R O;  2UUC K;  4JKG B;  1D5A A;  1LW0 A;  1IH7 A;  3BZC A;  5I3U A;  2ZD1 A;  4GV9 A;  2Z1G A;  5C2D A;  1U2V A;  3SJJ A;  3CC2 N;  3U3Y A;  3M3Z A;  4ID5 A;  4J2E A;  4BDY A;  2HHX A;  4CZL A;  4LSN A;  4EHU A;  4PUO A;  4W5O A;  2Y1I A;  5FRM A;  1Z26 A;  2ZE2 A;  2O8D A;  2JWL A;  2P9U A;  4FJJ A;  2CGJ A;  3WNH A;  2VWB A;  3DI6 A;  5M1K A;  1K6Y A;  4KRE A;  3VQ5 A;  2P5O A;  4CEA A;  3CCS N;  2G8V A;  4DTX A;  4BRL A;  4CZI A;  4DV5 K;  4OLB A;  1Y64 A;  4KB1 A;  4JD2 B;  1TK0 A;  2ZQB A;  4AHS A;  3NF6 A;  1XNQ K;  4GMJ B;  5HRN A;  1RT4 A;  4CJ3 A;  4B1V A;  1FKP A;  1CXQ A;  2O8B A;  2QEX N;  3QEX A;  3NGI A;  4CFD A;  4PKH A;  3KWG A;  4GKJ K;  2QTD A;  4CEF A;  3OS0 A;  3C94 A;  4NYF A;  1RT6 A;  3T7Z A;  3NGZ A;  3KK1 A;  2UXD K;  3L2R A;  3LDL A;  3BDP A;  1VQM N;  1K8K A;  3DLR A;  1LW2 A;  4DSE A;  4H0V B;  4ICL A;  3MN9 A;  4DQS A;  3ZYY X;  1Q18 A;  1OKJ A;  2DFF A;  3C0B A;  2O8F A;  4N5S A;  1JLF A;  3O4W A;  5J2M A;  4J8F A;  4PA1 A;  3TAQ A;  3KLI A;  4AM7 A;  1SL0 A;  4CEC A;  3CJ9 A;  3OS1 A;  1HNW K;  1HNX K;  4FZX C;  5AFU H;  4W5Q A;  4FWS A;  1KXP A;  3VGM A;  1NK4 A;  3K5L A;  1I39 A;  3FZM A;  3EE8 A;  3AVM A;  5BRF A;  5JLF A;  3SQ1 A;  2NUB A;  2VG6 A;  3P39 A;  5AZI A;  4BWJ A;  2V7Y A;  1U48 A;  3VQ8 A;  3KTQ A;  3CF5 L;  5BN9 A;  2OPR A;  2UXC K;  3RRG A;  3H45 C;  4CD1 A;  3OJU A;  4CHZ A;  3T1A A;  2FXU A;  3KKS A;  2GWK A;  4OGE A;  3VQ4 A;  2QXF A;  2YNF A;  3FFI A;  5AQV A;  4E7H A;  2NRT A;  3H3N O;  1Q82 O;  3QET A;  3VQ6 A;  4FK4 A;  4ILG B;  4CFC A;  2EWS A;  3GDQ A;  3L0Q A;  2W41 A;  3CIP A;  4CVN E;  1KD1 O;  4B3O A;  3AVL A;  3L3V A;  3D2F A;  1Q86 O;  5M1Q A;  3V1Q A;  4BAC A;  4CJF A;  2E4L A;  5C10 A;  4CJQ A;  1S3X A;  3K5M A;  1BG3 A;  2V51 B;  1HUX A;  4CHO A;  2GWJ A;  3JS6 A;  3CCE N;  3AVA A;  1NBW A;  4U67 L;  3O9Q A;  1SL2 A;  4YOR A;  1BCM A;  1WBB A;  4KAZ A;  3GG4 A;  1KSP A;  3ID8 A;  4C1N I;  3ZX0 A;  4CGJ A;  4J2A A;  4IXC A;  3RSE B;  4HUE A;  1KFS A;  2BAN A;  2PFU A;  2HHV A;  1BQM A;  4FM1 A;  2I5J A;  3C6T A;  1VSI A;  3C6H A;  3WQU A;  3PY8 A;  3OYH A;  5AQQ A;  4B9N A;  4R79 A;  3T1H K;  3NHG A;  4I9Q A;  4IDH A;  5KGX A;  3IG1 A;  3ZSV A;  3KLG A;  3OYL A;  4BRK A;  4PHT X;  5BRE A;  3K9K A;  3SMP A;  4YDU C;  2HNZ A;  4AHV A;  4KHS A;  3DM2 A;  2A5X A;  4WQ5 A;  2OTJ N;  2Q97 A;  1N5Y A;  3GOI A;  3LDP A;  3NF8 A;  4M3W A;  4M3Y A;  5HRR A;  5AQL A;  4FJ9 A;  4BC4 A;  3QNO A;  4LC9 B;  3AAR A;  1ZBL A;  4CEQ A;  4RG8 A;  4BRM A;  1S1V A;  3PX6 A;  4C8K A;  4ELT A;  4CIG A;  5LJV A;  4CD3 A;  5AQG A;  5AQT A;  5HBM A;  4B9T A;  4DTO A;  3AA3 A;  2O8E B;  4JS5 A;  2WBN A;  5HP1 A;  1VQ6 N;  2F8S A;  2O4G A;  1NWK A;  4FLX A;  1YTA A;  2YHB A;  4IG3 A;  3J7A P;  4Z4E A;  3LAL A;  1IKV A;  2P9L A;  4BRC A;  5IWA K;  3P83 D;  3VF2 A;  3O4Q A;  2J4R A;  2NZT A;  3FLC O;  3HL8 A;  4DFJ A;  4LFC K;  1RCH A;  1E4F T;  4CHP A;  2IIR A;  4FW2 A;  1HNI A;  4CE9 A;  2CH6 A;  3O1B A;  3EYZ A;  4M3X A;  4CIE A;  5JVH L;  1IO2 A;  3NF7 A;  1C0U A;  3THY B;  4BRA A;  4M3R A;  4XIU A;  1TGO A;  4CK2 A;  4FLT A;  5M1N A;  3OYD A;  1FJG K;  4QS8 A;  3VF6 A;  4BRD A;  4B8C A;  3T19 A;  4IOX A;  4CBW A;  4CW7 B;  3EKU A;  4BG9 A;  1P8Z A;  3THW A;  3ZEU B;  5AFU A;  4N56 A;  1QQN A;  3MEG A;  3QBW A;  1QTM A;  5FPE A;  4JYA K;  1NM1 A;  2FSK A;  3MCA B;  3SQ2 A;  1TAU A;  2QWO A;  3SBT A;  2WC9 A;  2JWK A;  1BL3 A;  1QZ6 A;  2F4V K;  4FM2 A;  3QER A;  2ASP A;  1HYV A;  1VQ9 N;  4I7F A;  3D0P A;  4NLC A;  4BRE A;  4H5V A;  4UY8 O;  1XQS C;  2P9K A;  4MQ3 A;  2W42 A;  1KRP A;  3CCR N;  4H0O A;  1LCU A;  3OTO K;  3HPG A;  3JYT A;  3L2U A;  2W6K A;  1QHA A;  3PLA A;  4X65 K;  1M90 O;  1NKC A;  1RT2 A;  4FJN A;  4CF9 A;  3S3O A;  4JEP A;  1YIT N;  4Q0B A;  2IC3 A;  1Y97 A;  4WQ4 C;  3ZSR A;  3CFP A;  4BE0 A;  1BIU A;  3V4I A;  4IG0 A;  5C24 A;  1TV6 A;  3AAP A;  3LWL A;  4EIA A;  4E7I A;  2HHS A;  4YNQ A;  3OW2 M;  5FLX O;  3WT0 A;  4LF9 K;  1RDD A;  1HKC A;  1J5O A;  3HOS A;  4CCH A;  2HOE A;  4F2R A;  3ZET B;  5DM6 L;  1E3M A;  3AVH A;  4GKK K;  4JI5 K;  5KPT A;  2IVP A;  1VQN N;  4BRG A;  3KK7 A;  3QFP A;  1V4T A;  2FF3 B;  1P90 A;  1IG8 A;  3SUO A;  1NGB A;  4K43 A;  3OYJ A;  1DLO A;  4KHY A;  4I9L A;  1X9S A;  3CHW A;  3LP0 A;  4NLB A;  1HLU A;  3DLG A;  1ATR A;  4F8R A;  4C8M A;  5M1F A;  2QM1 A;  1BWF O;  4YOU A;  3KZB A;  5HRO A;  2AP1 A;  3CPE A;  4BRF A;  4ILJ A;  4QAG A;  2E1Z A;  1SAZ A;  1T05 A;  4Y0W A;  3ZX3 A;  4CFB A;  4DLG A;  1RTH A;  5FRN A;  2G8K A;  1NGH A;  2Z1J A;  3VES A;  2DFE A;  4B9Q A;  1VSJ A;  4W5N A;  1ASU A;  1S9G A;  2KZM A;  1W7A A;  5KPZ A;  1X3M A;  3ZCM A;  1NGE A;  4X62 K;  4FPA A;  2YCH A;  2PBD A;  2EX3 A;  4BVO A;  4EZ9 A;  1G99 A;  1TKZ A;  3AVB A;  3OYG A;  4R5P A;  4WQ5 C;  2YHY A;  5HL7 L;  3IS9 A;  1WOQ A;  4JK9 A;  1OVY A;  4JLH A;  5BPN A;  4E7K A;  5BN8 A;  1NOY A;  3DXM A;  1A5X A;  1ZC6 A;  1OVQ A;  4QS7 A;  3SYZ A;  4WF9 L;  4H03 B;  1VQK N;  3ASM A;  2KFZ A;  2BDP A;  3GL1 A;  1TKD A;  4RTF D;  4V19 S;  1NGI A;  2A6A A;  3JAM O;  3AVC A;  4FJ7 A;  4GV6 A;  3VQB A;  4FLU A;  1J9A A;  2EHG A;  4JKF A;  3LPT A;  2FC0 A;  3SLC A;  2ZWH A;  2A1R A;  4B9S A;  4O4G A;  3MX5 A;  3DMJ A;  4YOX A;  4OKK A;  2VG7 A;  5KQD A;  3QNN A;  1ZBI A;  3NMU A;  2ZM6 K;  3DLH A;  4JKE A;  2G8F A;  4X66 K;  3NFA A;  1WB9 A;  1QVG M;  3MK6 A;  4YHH K;  3THX B;  1FXX A;  1NGD A;  3MX2 A;  4CJU A;  1ZBU A;  3JSM A;  1C0M A;  3OA9 A;  1DEJ A;  4Z94 A;  4IBN A;  4A2A A;  3BF3 A;  4C8L A;  4IWV A;  4OPK A;  1EO1 A;  3KWI A;  4E0D A;  3DYA A;  3CYM A;  3BUZ B;  3WUH A;  3LPU A;  2XRI A;  1LWE A;  3AVK A;  1VQ8 N;  1NG9 A;  3DXK B;  1RNH A;  4KHN A;  2Q0U A;  3P31 A;  5CZ2 A;  2BGG A;  4MDB A;  4DF8 A;  3EKS A;  4DTJ A;  4CK1 A;  5EVZ A;  2GBZ A;  3ISN C;  1A5V A;  4DUY K;  4MO4 A;  2I7P A;  1VQ5 N;  2FLO A;  3OYE A;  1SL1 A;  4LH4 A;  3WEE B;  5KQ8 A;  3TAF A;  3HO1 A;  1WLJ A;  1C0T A;  3TAN A;  3THV A;  2ASM A;  4DR1 K;  2Q1N A;  1WBD A;  3DLE A;  2ZJR L;  4KTQ A;  4ZTJ A;  2GUI A;  1KLM A;  1J6Z A;  4OX9 K;  3C6U A;  1ASV A;  1BCO A;  4NB4 A;  3CJC A;  4KPY A;  3HT3 A;  4A5A A;  1NLV A;  3MXI A;  1ZXO A;  4FCY A;  3WXI A;  4XH5 A;  2IDO A;  3HXM A;  2XO7 A;  3AY9 A;  1WNS A;  3IRX A;  5SZT A;  1NMD A;  3CJ7 A;  2UYT A;  3K9J A;  4CEO A;  2E6L A;  3OBY A;  2ETJ A;  2RKI A;  2HHH K;  3CXC M;  2HHT A;  4Y1C A;  3FZK A;  5HLF A;  3CCJ N;  1YJW N;  4CF1 A;  4LF8 K;  3A5O C;  1RIL A;  2FBT A;  5JLH A;  4JKC A;  1KC8 O;  2KZZ A;  3U9D A;  2PAV A;  5KI6 A;  2VQF K;  1NK5 A;  3O6W A;  3TAB A;  3D7E O;  3RMD A;  1UA1 A;  1BIS A;  4WFB L;  4YDU A;  3HPO A;  4KV8 A;  3KJV A;  3V1R A;  3AO3 A;  4LSL A;  3CQX A;  1Q9X A;  4CK3 A;  4CJR A;  4FVM A;  3JXU A;  4CED A;  1Z25 A;  3SNN A;  5EXW A;  4JKH A;  4DFK A;  4F9O A;  1HNV A;  3B6O A;  1N6Q A;  4LFA K;  4H5R A;  3J81 O;  1U45 A;  4E7J A;  4E1J A;  3VGK A;  3CCU N;  4DTN A;  5BRD A;  4B3M K;  4B3S K;  2WFB A;  4MFB A;  3E1Y A;  1J53 A;  2G8W A;  1NGA A;  4F3O A;  3CET A;  1OH8 A;  5FRO A;  3SPZ A;  3IAY A;  4YOV A;  3OYM A;  1LAW A;  3QIC A;  3O3F A;  3SZ2 A;  3E9L A;  2G8H A;  4DR2 K;  4FJL A;  1ITG A;  1NOZ A;  3E9O A;  4IJA A;  4JHD A;  5I9E B;  1L3T A;  3NF9 A;  5F1X A;  4M63 C;  3UKU B;  3D2E B;  1KQS M;  5AQY A;  3I0R A;  4I6M B;  5EX5 A;  4B1Z A;  1X9W A;  3ZSW A;  1H1V A;  3VQC A;  3KK2 A;  2X6S A;  1GLD G;  4OPJ A;  4JKD A;  2XY5 A;  2P51 A;  1EQY A;  4UQG A;  3HK2 A;  1GLF O;  4YOW A;  3M1F A;  3U9Z A;  2HW3 A;  3HVR A;  3VEV A;  4M7X A;  5CYM A;  3PIO L;  2HST A;  4RW9 A;  1N36 K;  1QQM A;  3KD1 E;  4GVM A;  2VQE K;  3CFO A;  2YKM A;  5GIO A;  3SI6 A;  4OO1 J;  5FPM A;  3CCM N;  4NXN K;  5A2Q O;  4B9M A;  4LFB K;  4FO0 A;  1NKB A;  1KCF A;  2KLA A;  1TYQ B;  2HBJ A;  4CF2 A;  4BDP A;  1X3N A;  1DT9 A;  2RF2 A;  1ASW A;  3UKR A;  1D9F A;  3P38 A;  4K25 A;  2KTQ A;  3SAF A;  3L2Q A;  1HYZ A;  1A5W A;  4OKJ A;  3NE6 A;  3ENO A;  3ULE B;  1KAX A;  3OYN A;  4ISF A;  4BRP A;  3O08 A;  3HPH A;  4JKG A;  3V9W A;  2P1J A;  4AIL C;  4PL7 A;  2FF6 A;  5J2P A;  4AQY K;  3SK3 A;  2GEM A; 
#chains in the Genus database with same CATH homology
 3E66 A;  1DKG D;  1JJ2 M;  1QQO A;  2F7T A;  3O80 A;  3MCP A;  4BRO A;  2A40 A;  3TPQ A;  4WQ4 A;  4BRA A;  3HZ6 A;  3WXM B;  4PKG A;  1XUP O;  1T6C A;  3EE9 A;  4XH4 A;  3WXK A;  1MWK A;  5M1N A;  1K8K B;  3CJA A;  3O9S A;  4QS8 A;  3VF6 A;  4BRD A;  1Q7Y O;  1Z6R A;  1U6Z A;  3L4I A;  5C15 A;  4IOX A;  4CBW A;  1HX1 A;  1D4X A;  4H5N A;  3EKU A;  4BG9 A;  5H1S Q;  2QWN A;  3L6Q A;  3I8B A;  1P8Z A;  4JD2 A;  5BRH A;  3ZEU B;  4GNI A;  5AFU A;  1Q81 O;  1QQN A;  3CD6 N;  3DXK A;  1JCF A;  3QBW A;  4IZ9 A;  5FPE A;  2Q2R A;  4IEI A;  3HOT A;  1S72 N;  1T3V A;  1NM1 A;  1O13 A;  2FSK A;  3ID6 A;  3MCA B;  4IO9 L;  3MDQ A;  4GY2 B;  2QWO A;  1R59 O;  4JK7 A;  4ISG A;  3SBT A;  2WC9 A;  2JWK A;  3CI5 A;  4JK8 A;  2KHO A;  5F2R A;  3RVC A;  2QW9 A;  5GAH P;  1QZ6 A;  3O9T A;  2ASP A;  1M1K O;  2HF3 A;  2BTF A;  3S41 A;  1VQ9 N;  3CC7 N;  3OHR A;  1HKG A;  2IVO A;  3H3O B;  4WFN L;  5EOY A;  3W3D A;  3IKM A;  2HMP A;  2VCP A;  2NNW A;  3OBW A;  4NLC A;  4BRE A;  4EHT A;  5AQK A;  4H5V A;  4UY8 O;  1VAZ A;  2BUP A;  1XQS C;  2P9K A;  4H0T B;  4BRI A;  4WCE L;  3HI0 A;  5AZI B;  4CZK A;  1RGI A;  4B1X B;  3C7N A;  4CJ7 A;  3WEE A;  4FWR A;  4O8K A;  3CCR N;  3SMS A;  5JIC A;  3A0I X;  2P9I A;  4H0O A;  1LCU A;  1V4S A;  4ILH A;  3EO3 A;  2QWP A;  4FL9 A;  1MA9 B;  3J7Z O;  1QHA A;  1T6D A;  3VOV A;  4HWI A;  3PLA A;  1K8A O;  1M90 O;  4JN4 A;  1C0G A;  3O1W A;  4YOT A;  3AAQ A;  5DM7 L;  5LJW A;  1BUP A;  4JEP A;  3VEO A;  1YIT N;  4IOA L;  4WQ4 C;  3HTV A;  2GX9 A;  2P9S A;  4CZM A;  4CZE A;  3H6E A;  1NGC A;  3FE1 A;  3IDH A;  3R1X A;  5JVG L;  3WXL A;  3ATV A;  3AAP A;  4BGB A;  1RDW X;  4EIA A;  5AZJ B;  2VYP A;  3HBT A;  2BH1 A;  5BR9 A;  2NRX A;  3OW2 M;  3WT0 A;  3WQT A;  1HKC A;  1YXQ A;  2GTD A;  3LL3 A;  1SQK A;  2A42 A;  3HOS A;  3TTD A;  1CZA N;  2HOE A;  3D2F B;  2E1Y A;  3ZET B;  5DM6 L;  3T69 A;  1W2B M;  3VGL A;  5ADX H;  4KH4 A;  1NGJ A;  4FWM A;  1TUU A;  3QBX A;  2QWQ A;  3VER A;  4B1W B;  3EN9 A;  2GUP A;  3ATU A;  5KPT A;  3MWP A;  5GIN A;  2IVP A;  1VQN N;  5JMV A;  4BRG A;  2QWL A;  3KK7 A;  3QFP A;  1V4T A;  2FF3 B;  1P90 A;  4BR9 A;  1ESV A;  1IG8 A;  3QFU A;  1NGB A;  3SAG A;  4IO8 A;  3D6R A;  2YJF A;  4O5F A;  2NRR A;  4K43 A;  3R8E A;  2WUS A;  3TTC A;  4H5T A;  5AQN A;  4EFH A;  4G9Z A;  2CGL A;  3VF4 A;  3CHW A;  4IEE A;  4WFA L;  4A5A A;  4NLB A;  4IJN A;  3VEY A;  1HLU A;  1ATR A;  3Q7B A;  5AR0 A;  4FWN A;  5M1F A;  5AQO A;  2Q36 A;  2QI2 A;  4DHY A;  2QM1 A;  1BWF O;  3A8Y A;  3FFK B;  3SAH A;  4YOU A;  4JKB A;  3AGR A;  4PKI A;  3LDN A;  2GEL A;  5GAG P;  3KZB A;  3QB0 A;  5EY4 A;  2AP1 A;  2ZJP L;  4BY9 C;  3CPE A;  4YOY A;  4BRF A;  4ILJ A;  3MMV A;  3I55 N;  1Z05 A;  4JHD B;  3C65 A;  5TKW A;  2E1Z A;  1KAY A;  4K41 A;  1BDG A;  1SAZ A;  3IUC A;  4Y0W A;  5C12 A;  2RHK A;  1VQL N;  3ZX3 A;  2NRW A;  5CR4 A;  4BVP A;  2V7Z A;  4FWO A;  3MWT A;  4XH1 A;  1NGH A;  1VQ7 N;  3VES A;  4B9Q A;  3ENH A;  3H46 O;  4A61 A;  3VTI A;  1ATN A;  5AQR A;  3EZW A;  1X3M A;  3HSC A;  5KPZ A;  4FPB A;  5KPR A;  1NGE A;  1RDU A;  3L4Q A;  3DWL A;  4FPA A;  2YCH A;  4B1U B;  2PBD A;  2P9N B;  4BVO A;  4MDA A;  1G99 A;  1S22 A;  4BRN A;  4GVE A;  1X9J A;  4NO7 A;  2HF4 A;  3TSU A;  4CBU A;  4WQ5 C;  2YHY A;  3RSE A;  5F0X A;  5HL7 L;  5AQZ A;  1WOQ A;  2QWR A;  3MN7 A;  4JK9 A;  3G71 N;  1OVY A;  1ILY A;  4QS9 A;  4EAH D;  5BPN A;  1MDU B;  1YHQ N;  4C23 A;  4U7B A;  5BN8 A;  4GV3 A;  2E2O A;  3DXM A;  1ZC6 A;  3CME N;  4QS7 A;  3PIP L;  5C2F A;  1TUY A;  5AQW A;  4WF9 L;  4H03 B;  3P4I A;  2Q0R A;  5GAE P;  3TSQ A;  4CZF A;  2VGN A;  3UKU A;  1VQK N;  3D2E A;  3G6E N;  3BF1 A;  3GL1 A;  3MN5 A;  4BR5 A;  5E84 A;  4CZG A;  4M7Y A;  4RTF D;  4RWT A;  1YJN N;  1BA0 A;  1C0F A;  1NGI A;  4I6M A;  3VEN A;  2A6A A;  3U4L A;  3FZL A;  1K9M O;  2E8A A;  4GV6 A;  3FZF A;  3HM8 A;  3UKR B;  4ISE A;  3NVK A;  1W97 L;  4FWK A;  4JKF A;  3ZX2 A;  4DQ8 A;  2P9P A;  3O9R A;  2P9L B;  2ZWH A;  3SLC A;  2CH5 A;  3UE5 A;  4FWP A;  3R3L A;  2YX6 A;  3MX5 A;  4A57 A;  2AA4 A;  3BP8 A;  1N8R O;  4YOX A;  4BG8 A;  5KQD A;  3GBT A;  3NMU A;  4JKG B;  3IFR A;  4JKE A;  3DAW A;  3B8A X;  4MLE A;  2VGM A;  2F9W A;  4H5W A;  1U2V A;  4WYB A;  5C2D A;  1QVG M;  3CC2 N;  4GV9 A;  3MK6 A;  3M3Z A;  3CJB A;  1NGD A;  3MX2 A;  4CZL A;  4OPH A;  1K73 O;  4EHU A;  3HRG A;  3OA9 A;  4BR0 A;  1DEJ A;  3EL2 A;  4Z94 A;  3FR0 A;  2FSJ A;  2JWL A;  2P9U A;  3N4Q A;  2CGJ A;  5E26 A;  4A2A A;  1YIJ N;  2VWB A;  5AQX A;  1TYQ A;  3A5N C;  2F9T A;  3BF3 A;  2YJE A;  1QZ5 A;  2QA4 N;  1EO1 A;  4IWV A;  3UB5 A;  1BU6 O;  3KWI A;  5M1K A;  3CCS N;  3BUZ B;  3KHY A;  4BRL A;  4CZI A;  4KH6 A;  3WUH A;  2E88 A;  1Y64 A;  3F5T A;  4BC3 A;  4JNE A;  1NGG A;  4JD2 B;  5CE3 A;  1VQ8 N;  2I7N A;  2NRH A;  2NLX A;  3DXK B;  3ULE A;  1WUA A;  3H1Q A;  5AQI A;  2Q0U A;  2QWM A;  3P31 A;  4AM6 A;  4B1V A;  4HTL A;  1JCE A;  3WXJ A;  3N4P A;  2QEX N;  2E2N A;  2ZGY A;  4MDB A;  4B1Y B;  3EKS A;  3QML A;  4C1N K;  2ZF5 O;  5EVZ A;  4PKH A;  2YI1 A;  3KWG A;  4BC5 A;  4BQL A;  1YVN A;  2QTD A;  5CHI A;  3TSP A;  3R9P A;  3T7Z A;  2KKZ A;  5AQF A;  5M1O A;  5C0Y A;  4MO4 A;  2I7P A;  4DKW A;  1VQ5 N;  3CCL N;  2FLO A;  3LDL A;  1YJ9 N;  4CI6 A;  3CQY A;  2P9K B;  5AQH A;  1VQM N;  1K8K A;  1DGK N;  3C7N B;  3WEE B;  5KQ8 A;  4H0V B;  4OPA A;  3MN9 A;  2P9I B;  4H0Y B;  1QVF M;  3ZYY X;  1Q18 A;  2ASM A;  2Q1N A;  5MLC Q;  1OKJ A;  2D1K A;  2FSN A;  2ZJR L;  3C0B A;  3ZEU A;  2H3G X;  4O8U A;  3CMA N;  5AQP A;  1J6Z A;  3KVG A;  3QDK A;  3O4W A;  3G25 A;  3TU5 A;  4NB4 A;  3CJC A;  4J8F A;  4KH5 A;  2IVN A;  1YAG A;  3M5R A;  1NLV A;  2P9S B;  1ZXO A;  2D0O A;  3IMX A;  1YUW A;  3F9M A;  3VTH A;  4AM7 A;  4A2B A;  3CJ9 A;  3WXI A;  4XH5 A;  5B8H A;  1HPM A;  5AFU H;  3LM9 A;  3I56 N;  3AY9 A;  4KBO A;  3O9U A;  1NMD A;  4FWS A;  1KXP A;  3CJ7 A;  3VGM A;  3DLL L;  3FZM A;  3EE8 A;  2HBM A;  2UYT A;  5JLF A;  5BRF A;  3DJC A;  1GLB G;  3K9J A;  1KAZ A;  4PL8 A;  3OBY A;  3P39 A;  5AZI A;  4DB3 A;  4DCH A;  3VEW A;  2V7Y A;  3LDO A;  3CF5 L;  3CXC M;  5M1P A;  2HBK A;  5BN9 A;  2ZJQ L;  3H45 C;  4CD1 A;  3FZK A;  1GLC G;  4A59 A;  3VPZ A;  4A5B A;  4CZH A;  2V52 B;  1BO5 O;  2FXU A;  3CCJ N;  1YJW N;  2GWK A;  3H1V X;  3A5O C;  3NVM A;  4BRQ A;  1NGF A;  4JAX A;  5JLH A;  3G4S N;  2HBL A;  4JKC A;  3AGK A;  1XC3 A;  1KC8 O;  3U9D A;  3CER A;  4H0P A;  5LY3 A;  2PAV A;  3I33 A;  4BR4 A;  2QXL A;  5AQS A;  5AQV A;  2YHW A;  3O6W A;  3D7E O;  4BC2 A;  2NRT A;  3H3N O;  1Q82 O;  3A5M C;  4YDU A;  2RE2 A;  4WFB L;  1SZ2 A;  5AZJ A;  3R6M A;  4ILG B;  5TKY A;  2EWS A;  3GDQ A;  3SBG A;  3L0Q A;  1JCG A;  2W41 A;  3CIP A;  1KD1 O;  3M6G A;  3CQX A;  3JXU A;  3GE1 A;  4FVU A;  4FOI A;  3D2F A;  1Q86 O;  5EXW A;  4JKH A;  4XEI A;  5M1Q A;  3MN6 A;  3ZET A;  4F9O A;  5C10 A;  1S3X A;  1BG3 A;  2V51 B;  1HUX A;  4K42 A;  4H5R A;  4RCH A;  2A41 A;  2GWJ A;  2E2Q A;  3JS6 A;  3CCE N;  1NBW A;  4U67 L;  4E1J A;  1IJJ A;  3O9Q A;  4FSV A;  4YOR A;  1E4G T;  3VGK A;  3CCU N;  3GG4 A;  1RFQ A;  5BRD A;  4IOC L;  2OTL N;  2ASO A;  2WFB A;  3ID8 A;  2Q31 A;  4C1N I;  3E1Y A;  5AQU A;  3W0L A;  1YF5 L;  3ZX0 A;  4A62 A;  3FZH A;  2D4W A;  1NGA A;  3F2K A;  3CET A;  4FWL A;  1LOT B;  4YOV A;  2D0P A;  4IXC A;  3RSE B;  3QIC A;  2NRV A;  2PFU A;  1HKB A;  2E20 A;  1BOT O;  4H0X B;  3E9L A;  4CZJ A;  1ZBS A;  3DXM B;  4BR7 A;  3VET A;  5HOO A;  3E9O A;  4IJA A;  4JHD A;  5I9E B;  3Q7C A;  5F1X A;  3C6H A;  3WQU A;  4M63 C;  3UKU B;  3D2E B;  5GIP A;  2ITM A;  5AQQ A;  1KQS M;  2NRZ A;  3U8X A;  5AQY A;  4CBX A;  2CGK A;  4R79 A;  5GAD P;  4IDH A;  2A3Z A;  5AQM A;  3TTF A;  4I6M B;  5EX5 A;  4B1Z A;  4BRK A;  3CJ1 A;  4PHT X;  1H1V A;  1YI2 N;  5BPM A;  1GLE G;  5BRE A;  3K9K A;  1VQ4 N;  1GLD G;  3SMP A;  4JKD A;  2DPN A;  2W40 A;  4YDU C;  3O5B A;  4BRH A;  1EQY A;  5BPL A;  3CPW M;  2A5X A;  2P9P B;  4BGA A;  3CC4 N;  2P9N A;  1GLF O;  4WQ5 A;  3CCQ N;  2OTJ N;  4YOW A;  1ATS A;  1SS6 A;  3M1F A;  3U9Z A;  5FPD A;  2Q97 A;  3ENB A;  1GLJ O;  1VQP N;  3GOI A;  3VEV A;  4M7X A;  3LDP A;  3PIO L;  4BR2 A;  2HST A;  3C6A A;  4IFE A;  5FPN A;  1QQM A;  5AQL A;  1T44 A;  1U2V B;  4AF1 A;  4BC4 A;  3CCV N;  2OAN A;  4LC9 B;  3AAR A;  1BA1 A;  3E9P A;  4BRM A;  5GIO A;  4OO1 J;  1GLA G;  3O8M A;  5LJV A;  5FPM A;  3CCM N;  3FGU A;  2E2P A;  4CD3 A;  1GLL O;  2P9U B;  5AQT A;  4FWQ A;  5AQG A;  4FO0 A;  2KLA A;  1TYQ B;  2HBJ A;  1X3N A;  5AQJ A;  1DT9 A;  5ELZ A;  3LM2 A;  2WBN A;  5ADX A;  1VQ6 N;  1NWK A;  4MLH A;  3UKR A;  3P38 A;  4K25 A;  3SJH A;  2YHX A;  3VEX A;  4JKA A;  3SAF A;  1VQO N;  4L3Q A;  2P9L A;  4BRC A;  3ENO A;  1MWM A;  3VF2 A;  2ZGZ A;  3BEX A;  3ULE B;  2J4R A;  2NZT A;  4MO5 A;  4BQZ A;  1HJO A;  1KAX A;  3FLC O;  3J8A A;  4FOE A;  4ISF A;  4BRP A;  1E4F T;  3O08 A;  3VEZ A;  2IIR A;  4JKG A;  2CH6 A;  3A5L C;  3O1B A;  3VMF B;  2FF6 A;  4PL7 A;  1NJI O;  5JVH L;  3SK3 A;  3LDQ A;  2GEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...