5C2FA

K428a mutant nuclease domain of the large terminase subunit gp2 of bacterial virus sf6 with manganese and beta-thujaplicinol
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
242
structure length
230
Chain Sequence
MAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTAVEMKQKLGIPSPNLADALMMCMHCPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 2 protein
publication title Two distinct modes of metal ion binding in the nuclease active site of a viral DNA-packaging terminase: insight into the two-metal-ion catalytic mechanism.
pubmed doi rcsb
source organism Enterobacteria phage sf6
molecule tags Metal binding protein
total genus 80
structure length 230
sequence length 242
ec nomenclature
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5c2fA00
3C6AA 3C6HA 4IEIA 5M1PA 5C12A 5C15A 4IFEA 5M1FA 4IDHA 5C2DA 5C10A 5C2FA 5M1OA 5M1QA 4IEEA 5M1NA 5M1KA 3CPEA
chains in the Genus database with same CATH superfamily
1HYSA 3RMCA 4FL9A 3CM6A 4CJ4A 3CQXA 3TARA 1S1TA 5C10A 4JK7A 1OH7A 3WNFA 1NMNA 1RDAA 1VSHA 3WQUA 1Q86O 5AQLA 3SMPA 4N5SA 3FZKA 4NXNK 4CZLA 4DTOA 3ID6A 3AVCA 3HT3A 4NYFA 3CFPA 4KTZA 3TAMA 4FJMA 1WOQA 5GAGP 3SJHA 5KTQA 4BQZA 1LOTB 2HB5A 2WUSA 2ZJPL 1IBKK 4RW4A 3S9HA 3C65A 4YDUA 4CK3A 4W5RA 5HOOA 2VWBA 4O55A 4NO7A 1BQNA 4MQ3A 3TTCA 4HCBA 1NK4A 4M3ZA 5GINA 2XO7A 3PLAA 5AQVA 3CCJN 1IKYA 4A5AA 5LJWA 2V7ZA 3S41A 1N5YA 3WXJA 2P5GA 2P9PA 5DM6L 4IG3A 1YUWA 2XY8A 3VEOA 3OTOK 5AZIB 1NK7A 5GAEP 1YJ9N 4FWLA 2E1YA 1MA9B 4DUYK 3A5MC 5BR9A 1RTJA 5DK5A 2JWKA 4PWDA 2HHWA 4KHWA 3KK2A 3HBTA 3ULEA 4B3MK 2G8KA 4X65K 3R3LA 1VHXA 4JRQA 4NCGA 5FPNA 1X3MA 2ZGYA 3BUZB 3THXB 3U3YA 2X78A 1QQOA 3I8BA 4Z4IA 4C1NK 4CJPA 1HNWK 1S6PA 1EQYA 4JI6K 3M1FA 2F4VK 4ICLA 5AQSA 3ITHA 3H1VX 1E4GT 2NUBA 4WCEL 4FW2A 3CHWA 5EVZA 1QVFM 5LY3A 3CMEN 3DRSA 4MDBA 3OYEA 1DLOA 4IBNA 4EAHD 1WLJA 2Q97A 1GLCG 3O08A 3CCVN 4JHDA 4B9QA 1BI4B 1NMDA 1M1KO 3UE5A 2UXBK 1Z05A 4LF6K 1RTHA 3JXUA 1SQKA 2UU9K 2BE2A 4BC5A 3OYHA 4LFBK 1RDBA 1ATNA 2FSNA 2DY4A 4CFBA 5CZ1A 3P39A 3MAQA 3N4QA 4FM2A 4DR7K 4A2BA 5JICA 3D2FB 1IBLK 3WEEB 1LV5A 4OKKA 2X6SA 3L4IA 3LWMA 4CJSA 2O8CB 5C25A 4HCCA 3TAQA 4KV8A 4JRPA 4CJWA 3LDOA 4JN4A 1Q9XA 1W9HA 3AGKA 4AQYK 2WTUA 3RTVA 1NJXA 4FLYA 3MMVA 4RW7A 3SV4A 4KRFA 1NBWA 3TANA 5J2QA 1IH7A 1T44A 2HNZA 5A2QO 1NJYA 3ZSWA 2UUAK 1U04A 3L8BA 4DUZK 4FYDA 4CJ7A 4E1MA 3SQ2A 5AFUA 3ASMA 4RCHA 3ZSYA 3TU5A 4M3UA 3D7EO 4DV3K 1I39A 2GV9A 1VQ4N 4CJ5A 3OYNA 4NB4A 5E41A 4Y0WA 4DSKA 2O8BA 1SV5A 3EN9A 3RMDA 1HQUA 2KFZA 4DSLA 3LWLA 4CEAA 4FJ5A 3LALA 4KHNA 3RWUA 4IO8A 2RPIA 2E2NA 3OVNA 4AHTA 2IVPA 4IFYA 3O3FA 1BHLA 1QHAA 3R1XA 3QLHA 2HBJA 3LM9A 4GV3A 5AQTA 5KQDA 1C6VA 3CJCA 5AZJB 4ELTA 3DLEA 4H8KA 4WQ5A 3D2EA 3OS1A 4KO0A 5BREA 1W7AA 2VG6A 1GOBA 5KQ8A 2OZSA 4EHUA 4BG8A 2ZQBA 2HW3A 3VETA 3VQBA 4J2DA 4BC2A 2P1JA 3KTQA 3CYMA 3SV3A 4DB3A 4KI4A 1LWCA 1RDDA 4HTLA 4W5QA 3K57A 4MO4A 1N36K 4CJUA 2KZZA 4J2BA 3ZX0A 2PYJA 4O4GA 4PL7A 3QEVA 1N33K 5AQMA 3VTIA 4ILHA 4C1NI 5JS1A 3V1RA 3LDPA 3OBYA 4AHSA 1BL3A 2ZGZA 4HHTA 2WFBA 1K8KA 2HOEA 4CZMA 2W40A 2P9LA 3G10A 3MEGA 3VGKA 1WSIA 4H0PA 3P1GA 4IG0A 4B3OA 5AQIA 2HHUA 4DU1A 4AF1A 2QW9A 4RWTA 1A5VA 1NGFA 3KLHA 2NRRA 2D0BA 4M42A 1O1WA 4CGGA 3ZETA 1Z25A 3CC2N 4YORA 3OYAA 2GX9A 2KKZA 1OVYA 1GLEG 4DS5A 1KD1O 4B9LA 2Q3SA 3VOVA 5CE3A 2CGLA 1N32K 2Q0RA 1NGIA 3UKRA 2E2QA 3LL3A 4U7BA 3SQ4A 4PKHA 2HBMA 2CGKA 3H08A 4IOAL 3WUHA 3NF8A 1QE1A 4CJEA 2YHYA 1MU2A 4G1QA 4LSNA 4YDUC 1I94K 2HNYA 4FWQA 3L3VA 2YI1A 4DTMA 4EZ9A 5AFUH 1C0GA 3G25A 4JEPA 4YNQA 2G8HA 3AVFA 1KCFA 3LP3A 2QEXN 3QMLA 1S3XA 2H3GX 3PO5A 2HF3A 4DV2K 3JAMO 1L3SA 4B3TK 2ASMA 2D0CA 3VA0A 3VENA 4CERA 1J9AA 1QSSA 1L3VA 2XY7A 4I9LA 3HK2A 3QIPA 4IOCL 2O8EB 4AM6A 1RDCA 2NRVA 4FJHA 3IDHA 3OBWA 1X9MA 3C0BA 4KH4A 1YF5L 3H1QA 4CEZA 4CF8A 4CHNA 4BE1A 3PX4A 2GBZA 1T8EA 3AVBA 1CLQA 3DYAA 3CCEN 3OYFA 1TK0A 2P9UA 2ASOA 3OHRA 3LP0A 4OPAA 2P9NB 1NKBA 3CCRN 3A5LC 5HLFA 4LF5K 1TUYA 4RW8A 3EEQA 4C8MA 3DMJA 3OY9A 1X3NA 3NF9A 3J7ZO 1IKWA 5M1NA 4H0TB 4OVLA 3AA3A 3KD1E 3RSEA 2IOCA 4MFBA 3HSTB 3AY9A 5HL7L 3G71N 2E6LA 1WNSA 3SAGA 5LL6Z 3H3OB 3V9WA 4DF4A 5AQRA 1NGHA 2IVOA 2YKNA 3HVRA 3IG1A 3I33A 3DM2A 2ITGA 2P5OA 3OS0A 1LAWA 3FZLA 2V51B 5SZTA 3CCLN 4AHCA 2QWNA 5AQWA 4KB1A 4XH1A 1A5XA 1U2VA 2HHTA 1SKRA 2VWKA 5T7BA 4LF4K 4IKFA 3EE9A 1RBRA 4FOEA 1SUQA 3V9ZA 2HHQA 3QNNA 3HZ6A 1XC3A 2KFNA 1ESVA 1L3TA 4CJVA 3J80O 1JLEA 1BA0A 3KKRA 3P38A 4E0DA 1GLFO 5DM7L 5TKYA 3KK3A 4LFCK 1OH8A 5J2PA 3M8RA 4B1ZA 3TTDA 3WQTA 3QFPA 1C1BA 3E01A 1BCOA 4DFKA 1HRHA 5HROA 3KWIA 2VQEK 1WSHA 1BU6O 4YOXA 1YHQN 4J8FA 3QO9A 1K73O 4RG8A 4K8ZA 2I5JA 2GWJA 3TSUA 4DSFA 3NH2A 5I42A 1GLDG 2W6KA 1ASUA 3ZSVA 1U47A 3G6EN 1CXUA 3PX6A 5BRDA 3HVTA 2NNWA 1RTIA 5HRNA 4IDHA 2AJQA 2P9SA 4CF1A 5AQUA 2NRHA 3SPYA 4FWRA 3HP9A 1CZBA 4FLZA 1MWMA 4KH5A 4NLBA 2BUPA 3AO5A 4DTUA 4LC9B 5FPMA 1VRTA 4H0YB 3L2RA 4FJ7A 5FDLA 1NGGA 2D0AA 3E9LA 4OGCA 3K58A 3L0QA 5BN9A 1UWBA 3THWA 3OA9A 5M1OA 3CFRA 2FF3B 4CIGA 3AVHA 1NKCA 4B9NA 4CZFA 2B6AA 1JXEA 1UA0A 4BC3A 1JJ2M 1QSYA 4WQ5C 3PSFA 4DTJA 1WBBA 1RBVA 3ALYA 3ATVA 2G8FA 1HJOA 4BRAA 4B8CA 4EZ6A 3B6PA 3AA2A 3K5LA 1S9GA 3I0RA 1VQLN 3A8YA 4M7YA 2Q2RA 3CERA 1VQON 2CH5A 4RW6A 4WFAL 1HJRA 3E66A 3UIQA 2HHSA 1VQNN 1WSJA 4O5FA 5FLXO 3S3NA 1DTQA 2DFHA 4JI7K 4YHHK 1U6ZA 5IWAK 4FZXC 1NKEA 4I6MB 4OPKA 2NLXA 3O9RA 1CXQA 5HRRA 3C7NB 4JAXA 1NJZA 2VGNA 1NWKA 4Y1CA 3AVLA 4YFUA 1J54A 2RKIA 4LFAK 1Z26A 2F96A 3EO3A 4E3SA 2Q1NA 1VAZA 3BEXA 1RT4A 2P9IB 4CFAA 4JS4A 3MDQA 4BRFA 3N4PA 3MXIA 3O9UA 2PAVA 4E7KA 1XNQK 3J7AP 2OCEA 3P5JA 5EX5A 4ZTJA 1KXPA 1TKZA 3DWLA 4ID1A 1VQ7N 3HRGA 3UKUA 2ZJQL 5LMUK 1VSEA 3AA4A 1NU0A 1HNXK 4X62K 4LD0A 4Y1DA 3T19A 2OZMA 3DRRA 3QEIA 4DR5K 3LDSA 3IKMA 5JS2A 3LANA 4DS4A 5BRFA 4DR2K 5BR8K 4B1VA 1TYQA 3TAFA 2BANA 4GMJB 3FGUA 2IS3A 3AVJA 4KHQA 5FPDA 4TSXA 4GW6A 3EZWA 4OGEA 2I7NA 4DQ8A 3D0PA 3WNEA 3T1YK 3OYCA 1QZ5A 5C12A 3OJUA 1G99A 4CBXA 3SUQA 3MEDA 4JI3K 1SL0A 3O3HA 3VEZA 3VERA 1BQMA 4BRPA 5HRPA 1JLBA 4JKCA 1FXXA 3VESA 1TGOA 4CJRA 2YHXA 1VQKN 4BRGA 3RR8A 2DFFA 1VRUA 3AA5X 5C2FA 2Y1JA 1IO2A 1HNVA 1OKJA 3EL2A 3AVMA 5KGXA 5EXWA 4YOWA 2OPSA 2OTLN 4FZZA 1NK5A 4DU4A 2F9TA 1RNHA 3HL8A 1RBTA 5J2NA 4CZIA 2FSKA 3L2VA 3A5NC 3DJCA 3TWHA 1WBDA 4CF9A 5CY4A 1S9EA 5KPRA 3D45A 2YCHA 3KHYA 3K5MA 1WB9A 2HBLA 3ZT2A 2RHKA 3G4SN 4DTPA 1B9DA 5C15A 2XHBA 4CF0A 1HKBA 3FZMA 3GG4A 3SYZA 1TAQA 3VPZA 1VSKA 3MEEA 2O8FB 1HLUA 3VQCA 4R5PA 5CYQA 2R7YA 3CMAN 3PUFA 2HMIA 4DQPA 5AZIA 1GLLO 1T03A 1JXBA 4E7JA 4I9QA 4F3TA 4BGAA 3FFIA 3DXKB 3WNGA 4XH4A 4DHYA 4DV0K 4BVPA 3CF5L 1RTDA 2UUCK 1XMQK 1JL1A 2QTDA 4C8LA 2OTJN 4Z94A 5FPEA 1CZAN 3U8XA 1Q9YA 4C8OA 5AQYA 3WXIA 2O4IA 3THXA 5AQJA 4CVNE 4KBOA 3CXCM 3VQ5A 1XQSC 4JKGB 3EKUA 3NE6A 1ZC6A 3U6FA 4DWIA 1NLVA 3K9KA 3AO3A 4JKHA 2XY5A 1ZBLA 1NG9A 5CZ2A 5JVGL 1FJGK 2KW4A 4N47A 3L3UA 3NMUA 3A5OC 4FLUA 3WNHA 4H0XB 5IT9O 1T7PA 3CJ1A 5M1FA 3QIOA 1WAJA 4PQUA 2QI2A 4JD2B 3SLCA 4FWMA 4KI6A 2FLOA 2OPQA 1GLAG 1IJJA 4ZTFA 2HBKA 3TSPA 1C0MA 2F8SA 1TK5A 3TTFA 1UA1A 3ZCMA 1BI4A 2A6AA 1ATSA 1JCEA 2F7TA 5GIOA 1QQNA 4CJQA 4DCHA 4UY8O 2QA4N 4CZGA 3SMSA 1GOAA 1RT7A 2ETJA 4LF7K 2V52B 1W97L 3AVIA 1SL1A 3R9PA 3VN5A 4BE2A 1SKWA 4I2PA 3JYTA 4OO1J 3EKSA 3M8SA 2NRXA 3D2FA 3WEEA 1Y64A 4CHYA 1TAUA 3QB0A 3KK7A 4JI8K 3C6HA 4B1YB 2O8CA 2VQFK 4A57A 3OYIA 4M45A 1D8YA 4J2AA 3U9ZA 2E2OA 1D9FA 3MCPA 4FXDA 4F8RA 1HUXA 4FJGA 4BREA 4BR7A 1RDWX 1HQEA 4HUEA 1WSGA 4CJKA 4NCAA 3K2PA 1BCMA 1ASWA 1TUUA 1D4XA 2KLAA 4O5BA 4AILC 1U48A 5AQKA 4B9UA 3C94A 2OPPA 1KRPA 3F9KA 2VCPA 4E1NA 3PX0A 2VWJA 3ZSZA 5F1XA 2O8DB 3MXJA 3QDKA 3QESA 4MLHA 4FJNA 3AAQA 1HNZK 1NM1A 4FJLA 3V1OA 4DLGA 4KHSA 1P8ZA 1T6CA 4PHTX 4DU3A 1DGKN 5E26A 4CHQA 5BPNA 4LY7A 2RN2A 3I0SA 3ZEUB 3ZSXA 1TV6A 2G8UA 3LPTA 2D1KA 2I7PA 1UOCA 4J2EA 1B9FA 1SAZA 3B6OA 2VG5A 4CD1A 2P9KB 5C0YA 2XRIA 3QERA 3FFKB 4JLHA 4CCHA 4JKDA 4QCLA 1LCUA 3SUNA 3GOIA 2E6MA 3NF7A 1HYZA 4ZHRA 5AZJA 5ADXA 4FWSA 4OX9K 4BR5A 4PKIA 4QOZB 4MO5A 2G8IA 1WUAA 3SBTA 3ULDA 2UXCK 3Q7CA 3RR7A 4WQ4A 1VQPN 3MN5A 1S1VA 3EE8A 1DKGD 3SCXA 1QHTA 3THVA 3CQ8A 2RE2A 2IDOA 2FBYA 5KRSA 4YOVA 3KZBA 3DLGA 4OPJA 3NVKA 4OKEA 2GEMA 4FSVA 5CR4A 3CJ9A 1EXQA 4M41A 1YTAA 3HM8A 4N56A 4O0IA 4W5OA 3ID8A 3PY8A 3OYGA 4BRNA 3SAFA 3QICA 4K43A 1BA1A 1KVBA 4YY3K 1KLNA 1S22A 3SQ1A 2D0PA 1IKXA 5B8HA 4BRIA 4JNEA 3I8DA 1BWFO 1QQCA 2HVIA 3I56N 3AO1A 2HHVA 3W0LA 1I3AA 3CC7N 3BF1A 4OJRA 1ZBIA 2DFEA 2A1SA 2Z1HA 3RRGA 1KLMA 4CEBA 4B3RK 4JI1K 5M1QA 2NZTA 4C23A 1KAYA 2GUPA 4M3YA 1EX4A 4CD3A 4UQGA 2J4RA 4FJIA 1JCFA 1L5UA 4JK9A 4CJLA 5AR0A 3KLIA 3FZFA 3K59A 4Z4EA 2QWLA 2HF4A 4FK4A 1EETA 4M3XA 2Z1IA 1IG9A 4CHOA 3A0IX 4CI6A 1VSDA 5AQGA 4FWPA 4F2SA 2A41A 4XEIA 1Q18A 3ENOA 2XY6A 2LSNA 3IS9A 3AO4A 3LP2A 4H0OA 4NXMK 3C6TA 4BR9A 4JV5K 3OYKA 2A42A 1TL1A 3TPQA 4HWIA 1C1CA 4HTUA 3JSMA 4DV6K 5C24A 1T05A 1R0AA 4DFMA 1FKPA 4IWVA 4FWNA 1U4BA 1RT5A 2WBNA 3VEWA 4CZEA 2O8EA 3LP1A 3ZX3A 4DR1K 2P51A 3IMXA 4BQLA 3T7ZA 4BY9C 1C0FA 4DSJA 4GKJK 1H1VA 3W3DA 3CJAA 1NGBA 3AVGA 4B9VA 5I9EB 4FWKA 4JKBA 5GAHP 3LDNA 3ISNC 1REVA 4RW9A 3VGMA 2KHOA 5ADXH 3U3GA 4DMNA 2BGGA 2PFUA 1Q81O 4DFJA 1HKGA 2P9NA 1NK9A 2ZM6K 4Z0UA 2FBTA 3AVNA 4EFHA 1TK8A 1S5JA 3CFOA 3K5NA 1WN7A 4CECA 2NRZA 4Z4GA 4M3WA 4DQQA 4ELUA 2OPRA 2ASPA 4BACA 5H1SQ 1S1WA 1X9SA 1VQ9N 1NGCA 3V9UA 4BC4A 4FPBA 1L3UA 1RT3A 3Q7BA 4CGJA 1E3MA 4FLXA 4QAGA 3DLRA 4BRHA 3S3OA 2OYQA 1JLCA 3BZKA 1ZYQA 4CF2A 3P31A 3MN9A 4CZKA 3NGYA 3LAKA 3DOKA 5AJ3K 3THYB 3HI0A 3PV8A 4A5BA 5BPLA 4OKJA 2GUIA 1NGDA 4JI5K 1QS4A 1F21A 3CPEA 3SI6A 1XMOK 2FSJA 1S1UA 4DSEA 3GDQA 4JK8A 4IXCA 1K9MO 4LSLA 3CJ7A 4BDZA 3DXMB 3TAPA 2Z1JA 1W2BM 4GNIA 1NOYA 4DSIA 1YJNN 4DQSA 4AHRA 3CQYA 4M63C 4CJ3A 5JMVA 2E1ZA 1YXQA 2VG7A 5D3GA 1XI1A 3NBPA 2NRTA 2CGJA 3LPUA 2A3ZA 3NFAA 3VQ8A 3FZHA 1S6QA 4PUOA 3CJBA 1LWFA 2ZF5O 5LMNK 4CFDA 4CK1A 3VMFB 1TKDA 3F9MA 1Q8IA 3M8PA 4IEIA 4JKAA 3VA3A 1YIJN 3DRPA 4IDKA 1Q7YO 1XHXA 1HYVA 2AP1A 5EY4A 4BDYA 3A2FA 3VTHA 3AO2A 4WE1A 5JVHL 4DLEA 1J5EK 3IRXA 3O9SA 5E84A 3OYMA 3NAEA 3SAHA 3V6DA 4AH9A 2A1RA 4U67L 4H5TA 4CBWA 3VGLA 5HRSA 4YOUA 3L4QA 4AHUA 3HJFA 1RDUA 4ISGA 1HX1A 5C2DA 1Y97A 4I7FA 4Q5VA 3TSQA 3VQQA 3V9SA 1G15A 2B5JA 1NNEA 1CZ9A 1KAXA 3P83D 3FE1A 5GADP 3M8QA 1KVCA 1VSJA 4CGHA 3CI5A 4KTWA 1B92A 3CC4N 4A2AA 2PY5A 3KLFA 1HPZA 4CGFA 3PIPL 3K5OA 4BGBA 3O4NA 4PL8A 4W5TA 4ILGB 3T69A 4N76A 2IVNA 3K9JA 2DPNA 3TAEA 4PKGA 4BR2A 4WQ4C 3OYLA 3ENHA 1RFQA 1YTUA 4DTSA 1TVRA 2WC9A 1BG3A 1HPMA 2E88A 1R59O 2PYLA 3RMBA 4YOYA 1OH5A 1ITGA 1OVQA 4AHVA 2P9PB 1NK8A 4B9MA 4CJTA 2HHXA 3J8AA 2Q36A 2QWMA 4FLTA 4I6MA 4IZ9A 4NYNA 1LW0A 4BVOA 2F9WA 1C0TA 4FVMA 1JLQA 5TKWA 3VF4A 3C7NA 3F5TA 2YNFA 2G8VA 3HPHA 4KHPK 3ZSQA 2UYTA 4B08A 4KREA 5JLHA 2HSTA 4DFPA 4W5NA 5AQHA 2OA8A 3ULEB 4EIAA 2JWLA 3QBXA 1YAGA 4B8AB 1TKTA 3V81A 4CIEA 4FVUA 4M7XA 1SL2A 1HMVA 1KFSA 1S1XA 3CIPA 4EP5A 4QS8A 3ZSOA 1HKCA 2P9IA 4C8NA 1XWLA 1IV0A 2ZE2A 2A40A 3AV9A 3WXLA 4CGIA 3J7YP 1ZXOA 4CE9A 4JS5A 1ZBUA 2ZD1A 2YHAA 4DG1A 3SUOA 2YNGA 1ATRA 1K6YA 3PO4A 4FJJA 2FBVA 1NK0A 5AQZA 3QBWA 3DLHA 2BTFA 2KQ2A 5EOYA 3MECA 1KC8O 5C42A 3HP6A 1WAFA 1YITN 5M1PA 5KI6A 3RVCA 4JHDB 3OYJA 4E1JA 2UXDK 4LH5A 3L2QA 5FRMA 4IOXA 4IO9L 3KD5E 3HPGA 4KKOA 3ZT1A 4KH6A 4PY5A 3SUPA 3CCUN 3ZYYX 3IAYA 1N8RO 3LDLA 3I55N 2D0OA 3VQAA 1SKSA 3LDQA 4BRKA 1RT2A 2WONA 1IBMK 2FXUA 2QM1A 5LJVA 4BDPA 3SPZA 4FLWA 2ZJRL 1M90O 2X74A 3SBGA 1RGIA 1XUPO 3U9DA 1LW2A 2HVHA 1BDGA 4GV6A 4BRDA 1DT9A 1BISA 3NF6A 3HYFA 3GL1A 3LZIA 3T3FA 4DV5K 4A61A 3ATUA 5F2RA 1WSEA 2BDPA 2ZWHA 4B1XB 3QEPA 1XHZA 3CPWM 5DMRA 4YOTA 5HP1A 1FK9A 2EHGA 4B1UB 1C1AA 2KTQA 4EHTA 4C8KA 3K0SA 3O3GA 3L2UA 5KPZA 1GLBG 4BG9A 3EZ5A 2GWKA 1YT3A 2O8BB 3H46O 1Z6RA 3SQ0A 3NVMA 2YJFA 4CJFA 4DV4K 3NH0A 2IAJA 3P4IA 4EP4A 4ID5A 3VQPA 4E19A 2W6LA 2IGIA 3CM5A 3HOSA 4MLEA 4DTRA 3VQ6A 4DF8A 1RT1A 2FBXA 1D9DA 3E1YA 3M3ZA 3HM9A 5AQPA 4ELVA 3ZT3A 2O8FA 4BR0A 3OJSA 1C0UA 3O1BA 3D2EB 3AVAA 3H6EA 3MK6A 3ZT0A 4CZJA 4O44A 1VSLA 4F3OA 4DR4K 4ILJA 3JS6A 4JI4K 3ZT4A 3D6RA 4DKWA 1D5AA 4BRMA 4CK2A 1BO5O 4JKEA 3DXKA 3VEYA 4CGDA 4X64K 3GE1A 1FKOA 3VQDA 4FLVA 4B9TA 3E9PA 1EWQA 3O6WA 1BGXT 4DR3K 2FC0A 3FLCO 1YVNA 3O80A 4F9OA 5BRHA 5BN8A 3H3NO 3MWTA 3S3MA 2QKKA 4JKGA 1JLGA 2D4WA 1K8KB 3CD6N 3J81O 4R79A 1ASVA 2P9LB 1BOTO 4QS7A 4HUFA 3OYBA 2B4JA 4O0JA 3ZLJA 3RMAA 1X9WA 3QEWA 3C95A 1GOCA 4FM0A 1TKXA 4CEOA 4H0VB 4BROA 2HNDA 2E2PA 4KTQA 4JD2A 5KGWA 3BY5A 3NGZA 4B9SA 1RBSA 3DOLA 5AQQA 4LF9K 1NGEA 3ZETB 2QKBA 4DTNA 4L3QA 5CHIA 1W0HA 1WSFA 2JLEA 3TAGA 3IFRA 4Z4CA 4CEDA 1IKVA 3UKRB 1J6ZA 1LWEA 2PBDA 1X9JA 4K41A 3O9TA 4LH4A 4FJ9A 3CCSN 1SZ2A 4OPHA 3QNOA 1GLJO 1KAZA 3BGRA 5ELZA 4LF8K 4JYAK 1V4TA 3VEVA 3T1HK 2O4GA 5AQFA 4OLBA 2Q0UA 3BZCA 1JKHA 2HHHK 1VQ6N 1RCHA 2F8TA 2QWPA 3QFUA 3KJVA 3NGIA 4FJKA 3O1WA 1JLFA 3AGRA 1QQMA 5CYMA 3OS2A 2YNIA 1K8AO 3M5RA 1NOZA 4F4KA 4FWOA 2UUBK 1EWRA 1N34K 3MX2A 4DQIA 4KAZA 4FOIA 1OH6A 2DTUA 4K0KK 3NHGA 2ITMA 3DLBA 5K14A 4ISFA 2O8DA 3HOTA 3KWGA 2IC3A 2ATQA 1S72N 1HR0K 1UAXA 2QWOA 1U45A 1ZBFA 1NGAA 2P9UB 4QS9A 3L6QA 3HXMA 1FW6A 2NRWA 2YHBA 1A5WA 2YJEA 4CEFA 4Q0BA 4NCBA 3NH1A 4KFBA 3VQ7A 1NGJA 4IFEA 4BWMA 3ZEUA 5GIPA 1SS6A 2QK9A 1JL2A 3M6GA 1EP4A 3LAMA 4IFVA 5KPTA 3L2WA 2P9KA 2X6NA 4HVJA 3IUCA 3TI0A 4N41A 2GTDA 3AVKA 1VQ8N 2Z1GA 3RSEB 1MDUB 5AQNA 4HUGA 4E7IA 2Q31A 4H5NA 3MWPA 1QTMA 1P90A 3DLLL 2WOMA 3OW2M 3C6UA 5FRNA 2KZMA 3MN7A 3E9OA 4FCYA 4E7HA 2EX3A 1V4SA 3FR0A 4GVEA 4BRQA 4H03B 1VSMA 2AA4A 4E89A 3MXMA 3QETA 4FJ8A 3RRHA 1KVAA 4M3TA 4ISEA 3SNNA 1QSLA 4DQRA 1NJWA 2PZSA 3R6MA 1U2VB 1NJIO 4KB0A 2OANA 4A62A 4OLAA 4F2RA 1IG8A 4AM7A 4KHUA 2VGMA 4GVMA 3KK1A 1RT6A 3T1AA 3TR8A 4X66K 3PIOL 5J2MA 1VQMN 1EO1A 3AARA 5MLCQ 1T6DA 5SWMA 2Y1IA 3DI6A 1KQSM 4O8UA 3KIOA 4CEEA 4WYBA 4CBUA 3CCMN 4B1WB 2E4LA 3O9QA 2QWQA 2VYPA 4CW7B 4H5WA 3WXKA 4BRLA 3CETA 2D5RA 4PA1A 4WF9L 2JGUA 4E7LA 2GELA 3R8EA 4NLCA 4BWJA 4RTFD 3WXMB 2E8AA 1E4FT 2YKMA 1HNIA 3BDPA 1NK6A 3O4WA 4GV9A 4Z4FA 3SK3A 3KVGA 3V9XA 1ZBSA 2P9SB 3SJJA 4BE0A 2QXFA 2QWRA 4BR4A 1DEJA 4JI0K 1VSFA 3MX5A 2E5LK 2HMPA 3EYZA 1XNRK 4XH5A 5AQOA 3UB5A 1RBUA 1MWKA 4A59A 1XC9A 3THWB 3VF2A 2YV0X 5JLFA 3G0ZA 4GKKK 1ILYA 4H5VA 1QVGM 5F0XA 1DTTA 1VK0A 4BRCA 1J53A 3LZJA 3HPOA 4FK2A 3NDKA 3VEXA 2YX6A 4K8XA 3O5BA 3F2KA 1YJWN 4XIUA 3O8MA 5HBMA 2V7YA 3CG7A 3KLGA 3ENBA 3V1QA 4H4OA 1RILA 5AQXA 4B3SK 2QXLA 3TABA 1T3VA 3GBTA 4KHYA 4H5RA 4DTXA 4GY2B 4JI2K 4MDAA 3ZX2A 3H45C 4G9ZA 4V19S 5FROA 1KSPA 2IIRA 2BH1A 1BIUA 3HSCA 5BPMA 4Z4HA 1KFDA 4FK0A 4WFNL 1BUPA 4CESA 4FM1A 3KLEA 3DLKA 4CFCA 4H4MA 5J1EA 2EWSA 1Q82O 4DV1K 3BP8A 3VQEA 1ZBHA 3VF6A 1YI2N 3V4IA 1KTQA 4JKFA 1EKEA 3MCAB 2A5XA 4DR6K 3NCIA 1O13A 3MN6A 1TL3A 2W41A 4CHPA 4L8RB 4I2QA 3AAPA 4CEQA 2E20A 1J5OA 4FJXA 1BIZA 3PSIA 2YNHA 1U49A 3O4QA 4CHZA 3THYA 1JCGA 4CIFA 3CCQN 3U4LA 3KKSA 1VSIA 5KRTA 2W42A 4CZHA 2G8WA 4K42A 3UKUB 3QEXA 4M3RA 5I3UA 2CH6A 3F73A 2YHWA 4IJNA 4FW1A 3DAWA 1N6QA 3B8AX 1LAVA 3DXMA 5M1KA 3VQ4A 3C6AA 3HO1A 5EU7A 3ZSRA 4FO0A 4KPYA 3SZ2A 1TYQB 4IEEA 3OYDA 1QZ6A 4O8KA 4IJAA 3EY1A 4FPAA 3VQ9A 3WT0A 4WFBL 4DV7K 1JLAA 4FZYA 1X1PA 1YVUA 2FF6A 1VQ5N 3QINA 2RF2A 4K25A 3HTVA 3BF3A 3LM2A
chains in the Genus database with same CATH topology
3HZ6A 3GOIA 1XC3A 5KPZA 4FL9A 1GLBG 1ESVA 3CQXA 5AZJA 4BG9A 5ADXA 3P38A 1BA0A 4FWSA 4JK7A 5C10A 4BR5A 2GWKA 1GLFO 4PKIA 5DM7L 4MO5A 3H46O 1Z6RA 5TKYA 1WUAA 3NVMA 2YJFA 3SBTA 3Q7CA 3WQUA 1Q86O 5AQLA 3SMPA 4WQ4A 3FZKA 4B1ZA 1VQPN 3TTDA 3MN5A 4CZLA 3WQTA 3P4IA 3QFPA 3EE8A 1DKGD 3KWIA 1BU6O 4YOXA 1YHQN 3ID6A 4J8FA 3HOSA 4MLEA 1K73O 2RE2A 2GWJA 4YOVA 3TSUA 3E1YA 3KZBA 1GLDG 3M3ZA 3NVKA 2GEMA 3G6EN 1WOQA 4FSVA 5GAGP 3SJHA 5BRDA 5CR4A 3CJ9A 5AQPA 4BQZA 1LOTB 2NNWA 3HM8A 4BR0A 4IDHA 3O1BA 3D2EB 3H6EA 2WUSA 3ID8A 3MK6A 4CZJA 2ZJPL 4BRNA 3SAFA 2P9SA 3QICA 4K43A 4ILJA 1BA1A 1S22A 2D0PA 3JS6A 5B8HA 4BRIA 3D6RA 3C65A 4JNEA 4DKWA 5AQUA 2NRHA 4BRMA 1BO5O 4JKEA 4YDUA 3DXKA 4FWRA 3VEYA 2VWBA 5HOOA 1MWMA 1BWFO 3GE1A 4NO7A 3TTCA 4KH5A 4NLBA 2BUPA 3E9PA 4LC9B 5FPMA 4H0YB 3I56N 3O6WA 1NGGA 3E9LA 5GINA 5LJWA 3L0QA 5BN9A 3FLCO 3PLAA 3OA9A 5AQVA 3W0LA 3CC7N 3BF1A 3CCJN 1YVNA 3O80A 5M1OA 4A5AA 4F9OA 2V7ZA 3S41A 5BN8A 5BRHA 2FF3B 3H3NO 3MWTA 3WXJA 2P9PA 5DM6L 1YUWA 5M1QA 2NZTA 4C23A 4JKGA 4JKDA 4CZFA 1KAYA 2D4WA 2GUPA 3VEOA 4CD3A 1K8KB 4BC3A 1JJ2M 2J4RA 5AZIB 4WQ5C 3CD6N 1JCFA 4JK9A 5GAEP 4R79A 1YJ9N 2P9LB 3ATVA 1BOTO 2E1YA 4FWLA 4QS7A 3FZFA 1MA9B 1HJOA 5AR0A 4BRAA 2QWLA 3A5MC 5BR9A 2HF4A 2JWKA 1VQLN 3A8YA 4M7YA 3A0IX 3HBTA 3ULEA 2Q2RA 3CERA 4H0VB 4BROA 2E2PA 2CH5A 4CI6A 4JD2A 5AQGA 4WFAL 4FWPA 3R3LA 1VQON 2A41A 4XEIA 3E66A 5AQQA 1Q18A 3ENOA 5FPNA 1X3MA 2ZGYA 1VQNN 1NGEA 3BUZB 4H0OA 4O5FA 3ZETB 4BR9A 3I8BA 1QQOA 2A42A 3TPQA 4L3QA 1U6ZA 4C1NK 5CHIA 4HWIA 1EQYA 3IFRA 4I6MB 2NLXA 3M1FA 3O9RA 5AQSA 3UKRB 1J6ZA 2PBDA 4IWVA 3H1VX 4FWNA 3C7NB 1E4GT 1X9JA 2WBNA 4JAXA 3CHWA 3VEWA 4K41A 4CZEA 5EVZA 4WCEL 3O9TA 1QVFM 2VGNA 1NWKA 5LY3A 3ZX3A 1SZ2A 3CCSN 3CMEN 3IMXA 4OPHA 4BQLA 1GLJO 3T7ZA 4BY9C 1C0FA 1KAZA 4MDBA 5ELZA 1H1VA 3W3DA 3CJAA 1NGBA 4EAHD 2Q97A 1V4TA 3VEVA 1GLCG 4FWKA 5I9EB 3EO3A 4JKBA 5GAHP 3LDNA 3O08A 3CCVN 2Q1NA 3VGMA 2KHOA 1VAZA 3BEXA 5AQFA 5ADXH 4JHDA 4B9QA 1NMDA 2Q0UA 1M1KO 3UE5A 2P9IB 1VQ6N 2QWPA 1Z05A 2PFUA 3MDQA 3QFUA 3JXUA 3N4PA 4BRFA 1Q81O 1SQKA 1HKGA 3O1WA 2P9NA 3AGRA 1QQMA 4BC5A 3O9UA 2PAVA 4EFHA 1K8AO 3M5RA 5EX5A 1ATNA 1KXPA 3DWLA 1VQ7N 4FWOA 3HRGA 3UKUA 3MX2A 2NRZA 2ZJQL 4FOIA 2FSNA 2ASPA 5H1SQ 3P39A 3N4QA 2ITMA 1VQ9N 1NGCA 4A2BA 4BC4A 5JICA 4FPBA 3D2FB 3Q7BA 3WEEB 4ISFA 3HOTA 3L4IA 3KWGA 4BRHA 1S72N 3IKMA 2QWOA 2P9UB 1NGAA 4QS9A 3L6QA 3P31A 3MN9A 3LDOA 4JN4A 4CZKA 5BRFA 2NRWA 2YJEA 3HI0A 4B1VA 1TYQA 3AGKA 1NGJA 4A5BA 5BPLA 4IFEA 3ZEUA 5GIPA 1SS6A 3MMVA 3FGUA 1NBWA 1NGDA 3CPEA 2FSJA 3M6GA 3GDQA 4JK8A 1T44A 4IXCA 5FPDA 5KPTA 3EZWA 1K9MO 2I7NA 4DQ8A 3CJ7A 3DXMB 2P9KA 4CJ7A 3IUCA 1W2BM 2GTDA 4GNIA 1QZ5A 5AFUA 1VQ8N 5C12A 1YJNN 1G99A 4RCHA 3RSEB 1MDUB 3CQYA 4M63C 4CBXA 5AQNA 3TU5A 2Q31A 4H5NA 3D7EO 3MWPA 2E1ZA 5JMVA 3VEZA 3VERA 1VQ4N 1YXQA 1P90A 3DLLL 4NB4A 4BRPA 4Y0WA 2NRTA 3EN9A 2CGJA 3OW2M 3MN7A 3E9OA 2A3ZA 4JKCA 3FZHA 1V4SA 3FR0A 4GVEA 3CJBA 3VESA 4BRQA 4H03B 4IO8A 2ZF5O 2AA4A 1VQKN 2YHXA 2E2NA 3VMFB 4BRGA 2IVPA 5C2FA 4ISEA 3F9MA 1OKJA 1QHAA 3R1XA 4IEIA 4JKAA 3EL2A 1YIJN 2HBJA 3R6MA 1U2VB 3LM9A 1NJIO 2OANA 4A62A 5EXWA 1Q7YO 4GV3A 4YOWA 1IG8A 5AQTA 2AP1A 5EY4A 2OTLN 5KQDA 4AM7A 2F9TA 3VTHA 2VGMA 5JVHL 3CJCA 5AZJB 4CZIA 3O9SA 3D2EA 4WQ5A 5E84A 5BREA 3SAHA 3PIOL 1VQMN 2FSKA 1EO1A 3AARA 4U67L 5MLCQ 1T6DA 4H5TA 3A5NC 1KQSM 4CBWA 3VGLA 4O8UA 5KQ8A 3DJCA 4YOUA 4EHUA 4BG8A 3L4QA 5KPRA 3VETA 4WYBA 2YCHA 3KHYA 4BC2A 4CBUA 3CCMN 4B1WB 2HBLA 3O9QA 2QWQA 2VYPA 1RDUA 4ISGA 1HX1A 5C2DA 2RHKA 4DB3A 3TSQA 4H5WA 4HTLA 3WXKA 3CETA 4BRLA 3G4SN 5C15A 4MO4A 1HKBA 4WF9L 1KAXA 3ZX0A 3FZMA 4PL7A 3GG4A 2GELA 3R8EA 4NLCA 3FE1A 5GADP 5AQMA 3VTIA 3VPZA 4ILHA 4RTFD 3WXMB 4C1NI 2E8AA 1E4FT 3CI5A 3LDPA 3OBYA 1HLUA 3CC4N 4A2AA 3CMAN 2ZGZA 3O4WA 3PIPL 4GV9A 4BGBA 4PL8A 3SK3A 3KVGA 4ILGB 1ZBSA 2P9SB 2WFBA 3T69A 1K8KA 2HOEA 4CZMA 5AZIA 1GLLO 2QWRA 4BR4A 2W40A 2IVNA 1DEJA 2P9LA 4BGAA 3MX5A 3DXKB 3K9JA 2DPNA 3VGKA 4XH4A 4DHYA 4H0PA 2HMPA 4PKGA 4BR2A 4BVPA 4WQ4C 3ENHA 4XH5A 3CF5L 1RFQA 5AQIA 5AQOA 3UB5A 4AF1A 2QTDA 2WC9A 1BG3A 1HPMA 2E88A 2OTJN 2QW9A 4Z94A 4RWTA 1R59O 1MWKA 1NGFA 4A59A 5FPEA 3VF2A 4YOYA 1CZAN 5JLFA 2NRRA 3U8XA 5AQYA 3WXIA 3ZETA 3CC2N 2P9PB 5AQJA 1ILYA 4H5VA 1QVGM 5F0XA 4KBOA 4YORA 3CXCM 2GX9A 2KKZA 4BRCA 1OVYA 1XQSC 3J8AA 4JKGB 1GLEG 2Q36A 1KD1O 2QWMA 3EKUA 1ZC6A 4I6MA 3VOVA 5CE3A 2CGLA 2YX6A 1NLVA 2Q0RA 3K9KA 3O5BA 4IZ9A 1NGIA 4JKHA 3VEXA 3UKRA 2E2QA 3LL3A 4BVOA 2F9WA 4U7BA 5JVGL 3F2KA 4PKHA 5AQZA 1YJWN 2HBMA 3F5TA 2V7YA 2CGKA 3C7NA 3O8MA 5TKWA 3VF4A 3A5OC 3WUHA 3NMUA 4IOAL 4H0XB 2UYTA 2YHYA 5JLHA 3CJ1A 3ENBA 5M1FA 4YDUC 2HSTA 4FWQA 5AQXA 5AQHA 2QXLA 3ULEB 1T3VA 2QI2A 2JWLA 2YI1A 3GBTA 3QBXA 4EIAA 4JD2B 1YAGA 4FWMA 3SLCA 5AFUH 4H5RA 2FLOA 1C0GA 1GLAG 3G25A 1IJJA 4GY2B 4JEPA 4MDAA 4FVUA 2HBKA 4M7XA 3TSPA 3ZX2A 2QEXN 3QMLA 3H45C 1S3XA 2H3GX 4G9ZA 3TTFA 2HF3A 3CIPA 2IIRA 2A6AA 2BH1A 4QS8A 1ATSA 1HKCA 1JCEA 2P9IA 3HSCA 2ASMA 5BPMA 2F7TA 5GIOA 1QQNA 3VENA 4DCHA 4UY8O 4WFNL 1BUPA 2A40A 2QA4N 4CZGA 3SMSA 3WXLA 1ZXOA 2V52B 1W97L 4IOCL 2EWSA 3R9PA 1Q82O 3BP8A 4AM6A 3VF6A 3EKSA 1YI2N 1ATRA 4OO1J 2NRVA 3IDHA 4JKFA 3MCAB 3OBWA 2A5XA 3C0BA 4KH4A 1YF5L 2NRXA 3D2FA 3H1QA 3QBWA 2BTFA 3WEEA 1Y64A 5EOYA 3QB0A 3KK7A 1O13A 3MN6A 2W41A 1KC8O 1YITN 3AAPA 3C6HA 4B1YB 5M1PA 3CCEN 4A57A 3RVCA 3U9ZA 2E20A 4JHDB 2P9UA 2E2OA 4E1JA 2ASOA 3OHRA 3MCPA 4OPAA 1JCGA 4IOXA 2P9NB 3CCQN 3U4LA 1HUXA 4IO9L 4BREA 4BR7A 1RDWX 3CCRN 4KH6A 3A5LC 4CZHA 3CCUN 3ZYYX 1N8RO 4K42A 1TUYA 3LDLA 3I55N 3UKUB 2D0OA 4FOEA 2CH6A 3LDQA 1TUUA 1D4XA 2KLAA 2YHWA 4BRKA 4IJNA 5AQKA 1X3NA 3J7ZO 3DAWA 5M1NA 2FXUA 2VCPA 3B8AX 2QM1A 3DXMA 4H0TB 5F1XA 5LJVA 3QDKA 2ZJRL 4MLHA 1M90O 3AAQA 3SBGA 5M1KA 3RSEA 3C6AA 1NM1A 3AY9A 1RGIA 1XUPO 5HL7L 3G71N 3SAGA 3U9DA 1P8ZA 1T6CA 4FO0A 3H3OB 1BDGA 4PHTX 5AQRA 1DGKN 1NGHA 5E26A 4GV6A 1TYQB 2IVOA 4BRDA 1DT9A 5BPNA 3I33A 4IEEA 3GL1A 3ZEUB 1QZ6A 4O8KA 4IJAA 4A61A 4FPAA 3WT0A 3ATUA 3FZLA 5F2RA 4WFBL 2V51B 2ZWHA 3CCLN 4B1XB 2D1KA 2I7PA 2FF6A 1VQ5N 3CPWM 2QWNA 1SAZA 4YOTA 5AQWA 4K25A 4B1UB 4CD1A 2P9KB 5C0YA 3HTVA 4XH1A 1U2VA 4EHTA 3FFKB 3EE9A 3BF3A 3LM2A 1LCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C6A A;  3C6H A;  4IEI A;  5M1P A;  5C12 A;  5C15 A;  4IFE A;  5M1F A;  4IDH A;  5C2D A;  5C10 A;  5C2F A;  5M1O A;  5M1Q A;  4IEE A;  5M1N A;  5M1K A;  3CPE A; 
#chains in the Genus database with same CATH topology
 1HYS A;  3RMC A;  4FL9 A;  3CM6 A;  4CJ4 A;  3CQX A;  3TAR A;  1S1T A;  5C10 A;  4JK7 A;  1OH7 A;  3WNF A;  1NMN A;  1RDA A;  1VSH A;  3WQU A;  1Q86 O;  5AQL A;  3SMP A;  4N5S A;  3FZK A;  4NXN K;  4CZL A;  4DTO A;  3ID6 A;  3AVC A;  3HT3 A;  4NYF A;  3CFP A;  4KTZ A;  3TAM A;  4FJM A;  1WOQ A;  5GAG P;  3SJH A;  5KTQ A;  4BQZ A;  1LOT B;  2HB5 A;  2WUS A;  2ZJP L;  1IBK K;  4RW4 A;  3S9H A;  3C65 A;  4YDU A;  4CK3 A;  4W5R A;  5HOO A;  2VWB A;  4O55 A;  4NO7 A;  1BQN A;  4MQ3 A;  3TTC A;  4HCB A;  1NK4 A;  4M3Z A;  5GIN A;  2XO7 A;  3PLA A;  5AQV A;  3CCJ N;  1IKY A;  4A5A A;  5LJW A;  2V7Z A;  3S41 A;  1N5Y A;  3WXJ A;  2P5G A;  2P9P A;  5DM6 L;  4IG3 A;  1YUW A;  2XY8 A;  3VEO A;  3OTO K;  5AZI B;  1NK7 A;  5GAE P;  1YJ9 N;  4FWL A;  2E1Y A;  1MA9 B;  4DUY K;  3A5M C;  5BR9 A;  1RTJ A;  5DK5 A;  2JWK A;  4PWD A;  2HHW A;  4KHW A;  3KK2 A;  3HBT A;  3ULE A;  4B3M K;  2G8K A;  4X65 K;  3R3L A;  1VHX A;  4JRQ A;  4NCG A;  5FPN A;  1X3M A;  2ZGY A;  3BUZ B;  3THX B;  3U3Y A;  2X78 A;  1QQO A;  3I8B A;  4Z4I A;  4C1N K;  4CJP A;  1HNW K;  1S6P A;  1EQY A;  4JI6 K;  3M1F A;  2F4V K;  4ICL A;  5AQS A;  3ITH A;  3H1V X;  1E4G T;  2NUB A;  4WCE L;  4FW2 A;  3CHW A;  5EVZ A;  1QVF M;  5LY3 A;  3CME N;  3DRS A;  4MDB A;  3OYE A;  1DLO A;  4IBN A;  4EAH D;  1WLJ A;  2Q97 A;  1GLC G;  3O08 A;  3CCV N;  4JHD A;  4B9Q A;  1BI4 B;  1NMD A;  1M1K O;  3UE5 A;  2UXB K;  1Z05 A;  4LF6 K;  1RTH A;  3JXU A;  1SQK A;  2UU9 K;  2BE2 A;  4BC5 A;  3OYH A;  4LFB K;  1RDB A;  1ATN A;  2FSN A;  2DY4 A;  4CFB A;  5CZ1 A;  3P39 A;  3MAQ A;  3N4Q A;  4FM2 A;  4DR7 K;  4A2B A;  5JIC A;  3D2F B;  1IBL K;  3WEE B;  1LV5 A;  4OKK A;  2X6S A;  3L4I A;  3LWM A;  4CJS A;  2O8C B;  5C25 A;  4HCC A;  3TAQ A;  4KV8 A;  4JRP A;  4CJW A;  3LDO A;  4JN4 A;  1Q9X A;  1W9H A;  3AGK A;  4AQY K;  2WTU A;  3RTV A;  1NJX A;  4FLY A;  3MMV A;  4RW7 A;  3SV4 A;  4KRF A;  1NBW A;  3TAN A;  5J2Q A;  1IH7 A;  1T44 A;  2HNZ A;  5A2Q O;  1NJY A;  3ZSW A;  2UUA K;  1U04 A;  3L8B A;  4DUZ K;  4FYD A;  4CJ7 A;  4E1M A;  3SQ2 A;  5AFU A;  3ASM A;  4RCH A;  3ZSY A;  3TU5 A;  4M3U A;  3D7E O;  4DV3 K;  1I39 A;  2GV9 A;  1VQ4 N;  4CJ5 A;  3OYN A;  4NB4 A;  5E41 A;  4Y0W A;  4DSK A;  2O8B A;  1SV5 A;  3EN9 A;  3RMD A;  1HQU A;  2KFZ A;  4DSL A;  3LWL A;  4CEA A;  4FJ5 A;  3LAL A;  4KHN A;  3RWU A;  4IO8 A;  2RPI A;  2E2N A;  3OVN A;  4AHT A;  2IVP A;  4IFY A;  3O3F A;  1BHL A;  1QHA A;  3R1X A;  3QLH A;  2HBJ A;  3LM9 A;  4GV3 A;  5AQT A;  5KQD A;  1C6V A;  3CJC A;  5AZJ B;  4ELT A;  3DLE A;  4H8K A;  4WQ5 A;  3D2E A;  3OS1 A;  4KO0 A;  5BRE A;  1W7A A;  2VG6 A;  1GOB A;  5KQ8 A;  2OZS A;  4EHU A;  4BG8 A;  2ZQB A;  2HW3 A;  3VET A;  3VQB A;  4J2D A;  4BC2 A;  2P1J A;  3KTQ A;  3CYM A;  3SV3 A;  4DB3 A;  4KI4 A;  1LWC A;  1RDD A;  4HTL A;  4W5Q A;  3K57 A;  4MO4 A;  1N36 K;  4CJU A;  2KZZ A;  4J2B A;  3ZX0 A;  2PYJ A;  4O4G A;  4PL7 A;  3QEV A;  1N33 K;  5AQM A;  3VTI A;  4ILH A;  4C1N I;  5JS1 A;  3V1R A;  3LDP A;  3OBY A;  4AHS A;  1BL3 A;  2ZGZ A;  4HHT A;  2WFB A;  1K8K A;  2HOE A;  4CZM A;  2W40 A;  2P9L A;  3G10 A;  3MEG A;  3VGK A;  1WSI A;  4H0P A;  3P1G A;  4IG0 A;  4B3O A;  5AQI A;  2HHU A;  4DU1 A;  4AF1 A;  2QW9 A;  4RWT A;  1A5V A;  1NGF A;  3KLH A;  2NRR A;  2D0B A;  4M42 A;  1O1W A;  4CGG A;  3ZET A;  1Z25 A;  3CC2 N;  4YOR A;  3OYA A;  2GX9 A;  2KKZ A;  1OVY A;  1GLE G;  4DS5 A;  1KD1 O;  4B9L A;  2Q3S A;  3VOV A;  5CE3 A;  2CGL A;  1N32 K;  2Q0R A;  1NGI A;  3UKR A;  2E2Q A;  3LL3 A;  4U7B A;  3SQ4 A;  4PKH A;  2HBM A;  2CGK A;  3H08 A;  4IOA L;  3WUH A;  3NF8 A;  1QE1 A;  4CJE A;  2YHY A;  1MU2 A;  4G1Q A;  4LSN A;  4YDU C;  1I94 K;  2HNY A;  4FWQ A;  3L3V A;  2YI1 A;  4DTM A;  4EZ9 A;  5AFU H;  1C0G A;  3G25 A;  4JEP A;  4YNQ A;  2G8H A;  3AVF A;  1KCF A;  3LP3 A;  2QEX N;  3QML A;  1S3X A;  2H3G X;  3PO5 A;  2HF3 A;  4DV2 K;  3JAM O;  1L3S A;  4B3T K;  2ASM A;  2D0C A;  3VA0 A;  3VEN A;  4CER A;  1J9A A;  1QSS A;  1L3V A;  2XY7 A;  4I9L A;  3HK2 A;  3QIP A;  4IOC L;  2O8E B;  4AM6 A;  1RDC A;  2NRV A;  4FJH A;  3IDH A;  3OBW A;  1X9M A;  3C0B A;  4KH4 A;  1YF5 L;  3H1Q A;  4CEZ A;  4CF8 A;  4CHN A;  4BE1 A;  3PX4 A;  2GBZ A;  1T8E A;  3AVB A;  1CLQ A;  3DYA A;  3CCE N;  3OYF A;  1TK0 A;  2P9U A;  2ASO A;  3OHR A;  3LP0 A;  4OPA A;  2P9N B;  1NKB A;  3CCR N;  3A5L C;  5HLF A;  4LF5 K;  1TUY A;  4RW8 A;  3EEQ A;  4C8M A;  3DMJ A;  3OY9 A;  1X3N A;  3NF9 A;  3J7Z O;  1IKW A;  5M1N A;  4H0T B;  4OVL A;  3AA3 A;  3KD1 E;  3RSE A;  2IOC A;  4MFB A;  3HST B;  3AY9 A;  5HL7 L;  3G71 N;  2E6L A;  1WNS A;  3SAG A;  5LL6 Z;  3H3O B;  3V9W A;  4DF4 A;  5AQR A;  1NGH A;  2IVO A;  2YKN A;  3HVR A;  3IG1 A;  3I33 A;  3DM2 A;  2ITG A;  2P5O A;  3OS0 A;  1LAW A;  3FZL A;  2V51 B;  5SZT A;  3CCL N;  4AHC A;  2QWN A;  5AQW A;  4KB1 A;  4XH1 A;  1A5X A;  1U2V A;  2HHT A;  1SKR A;  2VWK A;  5T7B A;  4LF4 K;  4IKF A;  3EE9 A;  1RBR A;  4FOE A;  1SUQ A;  3V9Z A;  2HHQ A;  3QNN A;  3HZ6 A;  1XC3 A;  2KFN A;  1ESV A;  1L3T A;  4CJV A;  3J80 O;  1JLE A;  1BA0 A;  3KKR A;  3P38 A;  4E0D A;  1GLF O;  5DM7 L;  5TKY A;  3KK3 A;  4LFC K;  1OH8 A;  5J2P A;  3M8R A;  4B1Z A;  3TTD A;  3WQT A;  3QFP A;  1C1B A;  3E01 A;  1BCO A;  4DFK A;  1HRH A;  5HRO A;  3KWI A;  2VQE K;  1WSH A;  1BU6 O;  4YOX A;  1YHQ N;  4J8F A;  3QO9 A;  1K73 O;  4RG8 A;  4K8Z A;  2I5J A;  2GWJ A;  3TSU A;  4DSF A;  3NH2 A;  5I42 A;  1GLD G;  2W6K A;  1ASU A;  3ZSV A;  1U47 A;  3G6E N;  1CXU A;  3PX6 A;  5BRD A;  3HVT A;  2NNW A;  1RTI A;  5HRN A;  4IDH A;  2AJQ A;  2P9S A;  4CF1 A;  5AQU A;  2NRH A;  3SPY A;  4FWR A;  3HP9 A;  1CZB A;  4FLZ A;  1MWM A;  4KH5 A;  4NLB A;  2BUP A;  3AO5 A;  4DTU A;  4LC9 B;  5FPM A;  1VRT A;  4H0Y B;  3L2R A;  4FJ7 A;  5FDL A;  1NGG A;  2D0A A;  3E9L A;  4OGC A;  3K58 A;  3L0Q A;  5BN9 A;  1UWB A;  3THW A;  3OA9 A;  5M1O A;  3CFR A;  2FF3 B;  4CIG A;  3AVH A;  1NKC A;  4B9N A;  4CZF A;  2B6A A;  1JXE A;  1UA0 A;  4BC3 A;  1JJ2 M;  1QSY A;  4WQ5 C;  3PSF A;  4DTJ A;  1WBB A;  1RBV A;  3ALY A;  3ATV A;  2G8F A;  1HJO A;  4BRA A;  4B8C A;  4EZ6 A;  3B6P A;  3AA2 A;  3K5L A;  1S9G A;  3I0R A;  1VQL N;  3A8Y A;  4M7Y A;  2Q2R A;  3CER A;  1VQO N;  2CH5 A;  4RW6 A;  4WFA L;  1HJR A;  3E66 A;  3UIQ A;  2HHS A;  1VQN N;  1WSJ A;  4O5F A;  5FLX O;  3S3N A;  1DTQ A;  2DFH A;  4JI7 K;  4YHH K;  1U6Z A;  5IWA K;  4FZX C;  1NKE A;  4I6M B;  4OPK A;  2NLX A;  3O9R A;  1CXQ A;  5HRR A;  3C7N B;  4JAX A;  1NJZ A;  2VGN A;  1NWK A;  4Y1C A;  3AVL A;  4YFU A;  1J54 A;  2RKI A;  4LFA K;  1Z26 A;  2F96 A;  3EO3 A;  4E3S A;  2Q1N A;  1VAZ A;  3BEX A;  1RT4 A;  2P9I B;  4CFA A;  4JS4 A;  3MDQ A;  4BRF A;  3N4P A;  3MXI A;  3O9U A;  2PAV A;  4E7K A;  1XNQ K;  3J7A P;  2OCE A;  3P5J A;  5EX5 A;  4ZTJ A;  1KXP A;  1TKZ A;  3DWL A;  4ID1 A;  1VQ7 N;  3HRG A;  3UKU A;  2ZJQ L;  5LMU K;  1VSE A;  3AA4 A;  1NU0 A;  1HNX K;  4X62 K;  4LD0 A;  4Y1D A;  3T19 A;  2OZM A;  3DRR A;  3QEI A;  4DR5 K;  3LDS A;  3IKM A;  5JS2 A;  3LAN A;  4DS4 A;  5BRF A;  4DR2 K;  5BR8 K;  4B1V A;  1TYQ A;  3TAF A;  2BAN A;  4GMJ B;  3FGU A;  2IS3 A;  3AVJ A;  4KHQ A;  5FPD A;  4TSX A;  4GW6 A;  3EZW A;  4OGE A;  2I7N A;  4DQ8 A;  3D0P A;  3WNE A;  3T1Y K;  3OYC A;  1QZ5 A;  5C12 A;  3OJU A;  1G99 A;  4CBX A;  3SUQ A;  3MED A;  4JI3 K;  1SL0 A;  3O3H A;  3VEZ A;  3VER A;  1BQM A;  4BRP A;  5HRP A;  1JLB A;  4JKC A;  1FXX A;  3VES A;  1TGO A;  4CJR A;  2YHX A;  1VQK N;  4BRG A;  3RR8 A;  2DFF A;  1VRU A;  3AA5 X;  5C2F A;  2Y1J A;  1IO2 A;  1HNV A;  1OKJ A;  3EL2 A;  3AVM A;  5KGX A;  5EXW A;  4YOW A;  2OPS A;  2OTL N;  4FZZ A;  1NK5 A;  4DU4 A;  2F9T A;  1RNH A;  3HL8 A;  1RBT A;  5J2N A;  4CZI A;  2FSK A;  3L2V A;  3A5N C;  3DJC A;  3TWH A;  1WBD A;  4CF9 A;  5CY4 A;  1S9E A;  5KPR A;  3D45 A;  2YCH A;  3KHY A;  3K5M A;  1WB9 A;  2HBL A;  3ZT2 A;  2RHK A;  3G4S N;  4DTP A;  1B9D A;  5C15 A;  2XHB A;  4CF0 A;  1HKB A;  3FZM A;  3GG4 A;  3SYZ A;  1TAQ A;  3VPZ A;  1VSK A;  3MEE A;  2O8F B;  1HLU A;  3VQC A;  4R5P A;  5CYQ A;  2R7Y A;  3CMA N;  3PUF A;  2HMI A;  4DQP A;  5AZI A;  1GLL O;  1T03 A;  1JXB A;  4E7J A;  4I9Q A;  4F3T A;  4BGA A;  3FFI A;  3DXK B;  3WNG A;  4XH4 A;  4DHY A;  4DV0 K;  4BVP A;  3CF5 L;  1RTD A;  2UUC K;  1XMQ K;  1JL1 A;  2QTD A;  4C8L A;  2OTJ N;  4Z94 A;  5FPE A;  1CZA N;  3U8X A;  1Q9Y A;  4C8O A;  5AQY A;  3WXI A;  2O4I A;  3THX A;  5AQJ A;  4CVN E;  4KBO A;  3CXC M;  3VQ5 A;  1XQS C;  4JKG B;  3EKU A;  3NE6 A;  1ZC6 A;  3U6F A;  4DWI A;  1NLV A;  3K9K A;  3AO3 A;  4JKH A;  2XY5 A;  1ZBL A;  1NG9 A;  5CZ2 A;  5JVG L;  1FJG K;  2KW4 A;  4N47 A;  3L3U A;  3NMU A;  3A5O C;  4FLU A;  3WNH A;  4H0X B;  5IT9 O;  1T7P A;  3CJ1 A;  5M1F A;  3QIO A;  1WAJ A;  4PQU A;  2QI2 A;  4JD2 B;  3SLC A;  4FWM A;  4KI6 A;  2FLO A;  2OPQ A;  1GLA G;  1IJJ A;  4ZTF A;  2HBK A;  3TSP A;  1C0M A;  2F8S A;  1TK5 A;  3TTF A;  1UA1 A;  3ZCM A;  1BI4 A;  2A6A A;  1ATS A;  1JCE A;  2F7T A;  5GIO A;  1QQN A;  4CJQ A;  4DCH A;  4UY8 O;  2QA4 N;  4CZG A;  3SMS A;  1GOA A;  1RT7 A;  2ETJ A;  4LF7 K;  2V52 B;  1W97 L;  3AVI A;  1SL1 A;  3R9P A;  3VN5 A;  4BE2 A;  1SKW A;  4I2P A;  3JYT A;  4OO1 J;  3EKS A;  3M8S A;  2NRX A;  3D2F A;  3WEE A;  1Y64 A;  4CHY A;  1TAU A;  3QB0 A;  3KK7 A;  4JI8 K;  3C6H A;  4B1Y B;  2O8C A;  2VQF K;  4A57 A;  3OYI A;  4M45 A;  1D8Y A;  4J2A A;  3U9Z A;  2E2O A;  1D9F A;  3MCP A;  4FXD A;  4F8R A;  1HUX A;  4FJG A;  4BRE A;  4BR7 A;  1RDW X;  1HQE A;  4HUE A;  1WSG A;  4CJK A;  4NCA A;  3K2P A;  1BCM A;  1ASW A;  1TUU A;  1D4X A;  2KLA A;  4O5B A;  4AIL C;  1U48 A;  5AQK A;  4B9U A;  3C94 A;  2OPP A;  1KRP A;  3F9K A;  2VCP A;  4E1N A;  3PX0 A;  2VWJ A;  3ZSZ A;  5F1X A;  2O8D B;  3MXJ A;  3QDK A;  3QES A;  4MLH A;  4FJN A;  3AAQ A;  1HNZ K;  1NM1 A;  4FJL A;  3V1O A;  4DLG A;  4KHS A;  1P8Z A;  1T6C A;  4PHT X;  4DU3 A;  1DGK N;  5E26 A;  4CHQ A;  5BPN A;  4LY7 A;  2RN2 A;  3I0S A;  3ZEU B;  3ZSX A;  1TV6 A;  2G8U A;  3LPT A;  2D1K A;  2I7P A;  1UOC A;  4J2E A;  1B9F A;  1SAZ A;  3B6O A;  2VG5 A;  4CD1 A;  2P9K B;  5C0Y A;  2XRI A;  3QER A;  3FFK B;  4JLH A;  4CCH A;  4JKD A;  4QCL A;  1LCU A;  3SUN A;  3GOI A;  2E6M A;  3NF7 A;  1HYZ A;  4ZHR A;  5AZJ A;  5ADX A;  4FWS A;  4OX9 K;  4BR5 A;  4PKI A;  4QOZ B;  4MO5 A;  2G8I A;  1WUA A;  3SBT A;  3ULD A;  2UXC K;  3Q7C A;  3RR7 A;  4WQ4 A;  1VQP N;  3MN5 A;  1S1V A;  3EE8 A;  1DKG D;  3SCX A;  1QHT A;  3THV A;  3CQ8 A;  2RE2 A;  2IDO A;  2FBY A;  5KRS A;  4YOV A;  3KZB A;  3DLG A;  4OPJ A;  3NVK A;  4OKE A;  2GEM A;  4FSV A;  5CR4 A;  3CJ9 A;  1EXQ A;  4M41 A;  1YTA A;  3HM8 A;  4N56 A;  4O0I A;  4W5O A;  3ID8 A;  3PY8 A;  3OYG A;  4BRN A;  3SAF A;  3QIC A;  4K43 A;  1BA1 A;  1KVB A;  4YY3 K;  1KLN A;  1S22 A;  3SQ1 A;  2D0P A;  1IKX A;  5B8H A;  4BRI A;  4JNE A;  3I8D A;  1BWF O;  1QQC A;  2HVI A;  3I56 N;  3AO1 A;  2HHV A;  3W0L A;  1I3A A;  3CC7 N;  3BF1 A;  4OJR A;  1ZBI A;  2DFE A;  2A1S A;  2Z1H A;  3RRG A;  1KLM A;  4CEB A;  4B3R K;  4JI1 K;  5M1Q A;  2NZT A;  4C23 A;  1KAY A;  2GUP A;  4M3Y A;  1EX4 A;  4CD3 A;  4UQG A;  2J4R A;  4FJI A;  1JCF A;  1L5U A;  4JK9 A;  4CJL A;  5AR0 A;  3KLI A;  3FZF A;  3K59 A;  4Z4E A;  2QWL A;  2HF4 A;  4FK4 A;  1EET A;  4M3X A;  2Z1I A;  1IG9 A;  4CHO A;  3A0I X;  4CI6 A;  1VSD A;  5AQG A;  4FWP A;  4F2S A;  2A41 A;  4XEI A;  1Q18 A;  3ENO A;  2XY6 A;  2LSN A;  3IS9 A;  3AO4 A;  3LP2 A;  4H0O A;  4NXM K;  3C6T A;  4BR9 A;  4JV5 K;  3OYK A;  2A42 A;  1TL1 A;  3TPQ A;  4HWI A;  1C1C A;  4HTU A;  3JSM A;  4DV6 K;  5C24 A;  1T05 A;  1R0A A;  4DFM A;  1FKP A;  4IWV A;  4FWN A;  1U4B A;  1RT5 A;  2WBN A;  3VEW A;  4CZE A;  2O8E A;  3LP1 A;  3ZX3 A;  4DR1 K;  2P51 A;  3IMX A;  4BQL A;  3T7Z A;  4BY9 C;  1C0F A;  4DSJ A;  4GKJ K;  1H1V A;  3W3D A;  3CJA A;  1NGB A;  3AVG A;  4B9V A;  5I9E B;  4FWK A;  4JKB A;  5GAH P;  3LDN A;  3ISN C;  1REV A;  4RW9 A;  3VGM A;  2KHO A;  5ADX H;  3U3G A;  4DMN A;  2BGG A;  2PFU A;  1Q81 O;  4DFJ A;  1HKG A;  2P9N A;  1NK9 A;  2ZM6 K;  4Z0U A;  2FBT A;  3AVN A;  4EFH A;  1TK8 A;  1S5J A;  3CFO A;  3K5N A;  1WN7 A;  4CEC A;  2NRZ A;  4Z4G A;  4M3W A;  4DQQ A;  4ELU A;  2OPR A;  2ASP A;  4BAC A;  5H1S Q;  1S1W A;  1X9S A;  1VQ9 N;  1NGC A;  3V9U A;  4BC4 A;  4FPB A;  1L3U A;  1RT3 A;  3Q7B A;  4CGJ A;  1E3M A;  4FLX A;  4QAG A;  3DLR A;  4BRH A;  3S3O A;  2OYQ A;  1JLC A;  3BZK A;  1ZYQ A;  4CF2 A;  3P31 A;  3MN9 A;  4CZK A;  3NGY A;  3LAK A;  3DOK A;  5AJ3 K;  3THY B;  3HI0 A;  3PV8 A;  4A5B A;  5BPL A;  4OKJ A;  2GUI A;  1NGD A;  4JI5 K;  1QS4 A;  1F21 A;  3CPE A;  3SI6 A;  1XMO K;  2FSJ A;  1S1U A;  4DSE A;  3GDQ A;  4JK8 A;  4IXC A;  1K9M O;  4LSL A;  3CJ7 A;  4BDZ A;  3DXM B;  3TAP A;  2Z1J A;  1W2B M;  4GNI A;  1NOY A;  4DSI A;  1YJN N;  4DQS A;  4AHR A;  3CQY A;  4M63 C;  4CJ3 A;  5JMV A;  2E1Z A;  1YXQ A;  2VG7 A;  5D3G A;  1XI1 A;  3NBP A;  2NRT A;  2CGJ A;  3LPU A;  2A3Z A;  3NFA A;  3VQ8 A;  3FZH A;  1S6Q A;  4PUO A;  3CJB A;  1LWF A;  2ZF5 O;  5LMN K;  4CFD A;  4CK1 A;  3VMF B;  1TKD A;  3F9M A;  1Q8I A;  3M8P A;  4IEI A;  4JKA A;  3VA3 A;  1YIJ N;  3DRP A;  4IDK A;  1Q7Y O;  1XHX A;  1HYV A;  2AP1 A;  5EY4 A;  4BDY A;  3A2F A;  3VTH A;  3AO2 A;  4WE1 A;  5JVH L;  4DLE A;  1J5E K;  3IRX A;  3O9S A;  5E84 A;  3OYM A;  3NAE A;  3SAH A;  3V6D A;  4AH9 A;  2A1R A;  4U67 L;  4H5T A;  4CBW A;  3VGL A;  5HRS A;  4YOU A;  3L4Q A;  4AHU A;  3HJF A;  1RDU A;  4ISG A;  1HX1 A;  5C2D A;  1Y97 A;  4I7F A;  4Q5V A;  3TSQ A;  3VQQ A;  3V9S A;  1G15 A;  2B5J A;  1NNE A;  1CZ9 A;  1KAX A;  3P83 D;  3FE1 A;  5GAD P;  3M8Q A;  1KVC A;  1VSJ A;  4CGH A;  3CI5 A;  4KTW A;  1B92 A;  3CC4 N;  4A2A A;  2PY5 A;  3KLF A;  1HPZ A;  4CGF A;  3PIP L;  3K5O A;  4BGB A;  3O4N A;  4PL8 A;  4W5T A;  4ILG B;  3T69 A;  4N76 A;  2IVN A;  3K9J A;  2DPN A;  3TAE A;  4PKG A;  4BR2 A;  4WQ4 C;  3OYL A;  3ENH A;  1RFQ A;  1YTU A;  4DTS A;  1TVR A;  2WC9 A;  1BG3 A;  1HPM A;  2E88 A;  1R59 O;  2PYL A;  3RMB A;  4YOY A;  1OH5 A;  1ITG A;  1OVQ A;  4AHV A;  2P9P B;  1NK8 A;  4B9M A;  4CJT A;  2HHX A;  3J8A A;  2Q36 A;  2QWM A;  4FLT A;  4I6M A;  4IZ9 A;  4NYN A;  1LW0 A;  4BVO A;  2F9W A;  1C0T A;  4FVM A;  1JLQ A;  5TKW A;  3VF4 A;  3C7N A;  3F5T A;  2YNF A;  2G8V A;  3HPH A;  4KHP K;  3ZSQ A;  2UYT A;  4B08 A;  4KRE A;  5JLH A;  2HST A;  4DFP A;  4W5N A;  5AQH A;  2OA8 A;  3ULE B;  4EIA A;  2JWL A;  3QBX A;  1YAG A;  4B8A B;  1TKT A;  3V81 A;  4CIE A;  4FVU A;  4M7X A;  1SL2 A;  1HMV A;  1KFS A;  1S1X A;  3CIP A;  4EP5 A;  4QS8 A;  3ZSO A;  1HKC A;  2P9I A;  4C8N A;  1XWL A;  1IV0 A;  2ZE2 A;  2A40 A;  3AV9 A;  3WXL A;  4CGI A;  3J7Y P;  1ZXO A;  4CE9 A;  4JS5 A;  1ZBU A;  2ZD1 A;  2YHA A;  4DG1 A;  3SUO A;  2YNG A;  1ATR A;  1K6Y A;  3PO4 A;  4FJJ A;  2FBV A;  1NK0 A;  5AQZ A;  3QBW A;  3DLH A;  2BTF A;  2KQ2 A;  5EOY A;  3MEC A;  1KC8 O;  5C42 A;  3HP6 A;  1WAF A;  1YIT N;  5M1P A;  5KI6 A;  3RVC A;  4JHD B;  3OYJ A;  4E1J A;  2UXD K;  4LH5 A;  3L2Q A;  5FRM A;  4IOX A;  4IO9 L;  3KD5 E;  3HPG A;  4KKO A;  3ZT1 A;  4KH6 A;  4PY5 A;  3SUP A;  3CCU N;  3ZYY X;  3IAY A;  1N8R O;  3LDL A;  3I55 N;  2D0O A;  3VQA A;  1SKS A;  3LDQ A;  4BRK A;  1RT2 A;  2WON A;  1IBM K;  2FXU A;  2QM1 A;  5LJV A;  4BDP A;  3SPZ A;  4FLW A;  2ZJR L;  1M90 O;  2X74 A;  3SBG A;  1RGI A;  1XUP O;  3U9D A;  1LW2 A;  2HVH A;  1BDG A;  4GV6 A;  4BRD A;  1DT9 A;  1BIS A;  3NF6 A;  3HYF A;  3GL1 A;  3LZI A;  3T3F A;  4DV5 K;  4A61 A;  3ATU A;  5F2R A;  1WSE A;  2BDP A;  2ZWH A;  4B1X B;  3QEP A;  1XHZ A;  3CPW M;  5DMR A;  4YOT A;  5HP1 A;  1FK9 A;  2EHG A;  4B1U B;  1C1A A;  2KTQ A;  4EHT A;  4C8K A;  3K0S A;  3O3G A;  3L2U A;  5KPZ A;  1GLB G;  4BG9 A;  3EZ5 A;  2GWK A;  1YT3 A;  2O8B B;  3H46 O;  1Z6R A;  3SQ0 A;  3NVM A;  2YJF A;  4CJF A;  4DV4 K;  3NH0 A;  2IAJ A;  3P4I A;  4EP4 A;  4ID5 A;  3VQP A;  4E19 A;  2W6L A;  2IGI A;  3CM5 A;  3HOS A;  4MLE A;  4DTR A;  3VQ6 A;  4DF8 A;  1RT1 A;  2FBX A;  1D9D A;  3E1Y A;  3M3Z A;  3HM9 A;  5AQP A;  4ELV A;  3ZT3 A;  2O8F A;  4BR0 A;  3OJS A;  1C0U A;  3O1B A;  3D2E B;  3AVA A;  3H6E A;  3MK6 A;  3ZT0 A;  4CZJ A;  4O44 A;  1VSL A;  4F3O A;  4DR4 K;  4ILJ A;  3JS6 A;  4JI4 K;  3ZT4 A;  3D6R A;  4DKW A;  1D5A A;  4BRM A;  4CK2 A;  1BO5 O;  4JKE A;  3DXK A;  3VEY A;  4CGD A;  4X64 K;  3GE1 A;  1FKO A;  3VQD A;  4FLV A;  4B9T A;  3E9P A;  1EWQ A;  3O6W A;  1BGX T;  4DR3 K;  2FC0 A;  3FLC O;  1YVN A;  3O80 A;  4F9O A;  5BRH A;  5BN8 A;  3H3N O;  3MWT A;  3S3M A;  2QKK A;  4JKG A;  1JLG A;  2D4W A;  1K8K B;  3CD6 N;  3J81 O;  4R79 A;  1ASV A;  2P9L B;  1BOT O;  4QS7 A;  4HUF A;  3OYB A;  2B4J A;  4O0J A;  3ZLJ A;  3RMA A;  1X9W A;  3QEW A;  3C95 A;  1GOC A;  4FM0 A;  1TKX A;  4CEO A;  4H0V B;  4BRO A;  2HND A;  2E2P A;  4KTQ A;  4JD2 A;  5KGW A;  3BY5 A;  3NGZ A;  4B9S A;  1RBS A;  3DOL A;  5AQQ A;  4LF9 K;  1NGE A;  3ZET B;  2QKB A;  4DTN A;  4L3Q A;  5CHI A;  1W0H A;  1WSF A;  2JLE A;  3TAG A;  3IFR A;  4Z4C A;  4CED A;  1IKV A;  3UKR B;  1J6Z A;  1LWE A;  2PBD A;  1X9J A;  4K41 A;  3O9T A;  4LH4 A;  4FJ9 A;  3CCS N;  1SZ2 A;  4OPH A;  3QNO A;  1GLJ O;  1KAZ A;  3BGR A;  5ELZ A;  4LF8 K;  4JYA K;  1V4T A;  3VEV A;  3T1H K;  2O4G A;  5AQF A;  4OLB A;  2Q0U A;  3BZC A;  1JKH A;  2HHH K;  1VQ6 N;  1RCH A;  2F8T A;  2QWP A;  3QFU A;  3KJV A;  3NGI A;  4FJK A;  3O1W A;  1JLF A;  3AGR A;  1QQM A;  5CYM A;  3OS2 A;  2YNI A;  1K8A O;  3M5R A;  1NOZ A;  4F4K A;  4FWO A;  2UUB K;  1EWR A;  1N34 K;  3MX2 A;  4DQI A;  4KAZ A;  4FOI A;  1OH6 A;  2DTU A;  4K0K K;  3NHG A;  2ITM A;  3DLB A;  5K14 A;  4ISF A;  2O8D A;  3HOT A;  3KWG A;  2IC3 A;  2ATQ A;  1S72 N;  1HR0 K;  1UAX A;  2QWO A;  1U45 A;  1ZBF A;  1NGA A;  2P9U B;  4QS9 A;  3L6Q A;  3HXM A;  1FW6 A;  2NRW A;  2YHB A;  1A5W A;  2YJE A;  4CEF A;  4Q0B A;  4NCB A;  3NH1 A;  4KFB A;  3VQ7 A;  1NGJ A;  4IFE A;  4BWM A;  3ZEU A;  5GIP A;  1SS6 A;  2QK9 A;  1JL2 A;  3M6G A;  1EP4 A;  3LAM A;  4IFV A;  5KPT A;  3L2W A;  2P9K A;  2X6N A;  4HVJ A;  3IUC A;  3TI0 A;  4N41 A;  2GTD A;  3AVK A;  1VQ8 N;  2Z1G A;  3RSE B;  1MDU B;  5AQN A;  4HUG A;  4E7I A;  2Q31 A;  4H5N A;  3MWP A;  1QTM A;  1P90 A;  3DLL L;  2WOM A;  3OW2 M;  3C6U A;  5FRN A;  2KZM A;  3MN7 A;  3E9O A;  4FCY A;  4E7H A;  2EX3 A;  1V4S A;  3FR0 A;  4GVE A;  4BRQ A;  4H03 B;  1VSM A;  2AA4 A;  4E89 A;  3MXM A;  3QET A;  4FJ8 A;  3RRH A;  1KVA A;  4M3T A;  4ISE A;  3SNN A;  1QSL A;  4DQR A;  1NJW A;  2PZS A;  3R6M A;  1U2V B;  1NJI O;  4KB0 A;  2OAN A;  4A62 A;  4OLA A;  4F2R A;  1IG8 A;  4AM7 A;  4KHU A;  2VGM A;  4GVM A;  3KK1 A;  1RT6 A;  3T1A A;  3TR8 A;  4X66 K;  3PIO L;  5J2M A;  1VQM N;  1EO1 A;  3AAR A;  5MLC Q;  1T6D A;  5SWM A;  2Y1I A;  3DI6 A;  1KQS M;  4O8U A;  3KIO A;  4CEE A;  4WYB A;  4CBU A;  3CCM N;  4B1W B;  2E4L A;  3O9Q A;  2QWQ A;  2VYP A;  4CW7 B;  4H5W A;  3WXK A;  4BRL A;  3CET A;  2D5R A;  4PA1 A;  4WF9 L;  2JGU A;  4E7L A;  2GEL A;  3R8E A;  4NLC A;  4BWJ A;  4RTF D;  3WXM B;  2E8A A;  1E4F T;  2YKM A;  1HNI A;  3BDP A;  1NK6 A;  3O4W A;  4GV9 A;  4Z4F A;  3SK3 A;  3KVG A;  3V9X A;  1ZBS A;  2P9S B;  3SJJ A;  4BE0 A;  2QXF A;  2QWR A;  4BR4 A;  1DEJ A;  4JI0 K;  1VSF A;  3MX5 A;  2E5L K;  2HMP A;  3EYZ A;  1XNR K;  4XH5 A;  5AQO A;  3UB5 A;  1RBU A;  1MWK A;  4A59 A;  1XC9 A;  3THW B;  3VF2 A;  2YV0 X;  5JLF A;  3G0Z A;  4GKK K;  1ILY A;  4H5V A;  1QVG M;  5F0X A;  1DTT A;  1VK0 A;  4BRC A;  1J53 A;  3LZJ A;  3HPO A;  4FK2 A;  3NDK A;  3VEX A;  2YX6 A;  4K8X A;  3O5B A;  3F2K A;  1YJW N;  4XIU A;  3O8M A;  5HBM A;  2V7Y A;  3CG7 A;  3KLG A;  3ENB A;  3V1Q A;  4H4O A;  1RIL A;  5AQX A;  4B3S K;  2QXL A;  3TAB A;  1T3V A;  3GBT A;  4KHY A;  4H5R A;  4DTX A;  4GY2 B;  4JI2 K;  4MDA A;  3ZX2 A;  3H45 C;  4G9Z A;  4V19 S;  5FRO A;  1KSP A;  2IIR A;  2BH1 A;  1BIU A;  3HSC A;  5BPM A;  4Z4H A;  1KFD A;  4FK0 A;  4WFN L;  1BUP A;  4CES A;  4FM1 A;  3KLE A;  3DLK A;  4CFC A;  4H4M A;  5J1E A;  2EWS A;  1Q82 O;  4DV1 K;  3BP8 A;  3VQE A;  1ZBH A;  3VF6 A;  1YI2 N;  3V4I A;  1KTQ A;  4JKF A;  1EKE A;  3MCA B;  2A5X A;  4DR6 K;  3NCI A;  1O13 A;  3MN6 A;  1TL3 A;  2W41 A;  4CHP A;  4L8R B;  4I2Q A;  3AAP A;  4CEQ A;  2E20 A;  1J5O A;  4FJX A;  1BIZ A;  3PSI A;  2YNH A;  1U49 A;  3O4Q A;  4CHZ A;  3THY A;  1JCG A;  4CIF A;  3CCQ N;  3U4L A;  3KKS A;  1VSI A;  5KRT A;  2W42 A;  4CZH A;  2G8W A;  4K42 A;  3UKU B;  3QEX A;  4M3R A;  5I3U A;  2CH6 A;  3F73 A;  2YHW A;  4IJN A;  4FW1 A;  3DAW A;  1N6Q A;  3B8A X;  1LAV A;  3DXM A;  5M1K A;  3VQ4 A;  3C6A A;  3HO1 A;  5EU7 A;  3ZSR A;  4FO0 A;  4KPY A;  3SZ2 A;  1TYQ B;  4IEE A;  3OYD A;  1QZ6 A;  4O8K A;  4IJA A;  3EY1 A;  4FPA A;  3VQ9 A;  3WT0 A;  4WFB L;  4DV7 K;  1JLA A;  4FZY A;  1X1P A;  1YVU A;  2FF6 A;  1VQ5 N;  3QIN A;  2RF2 A;  4K25 A;  3HTV A;  3BF3 A;  3LM2 A; 
#chains in the Genus database with same CATH homology
 3HZ6 A;  3GOI A;  1XC3 A;  5KPZ A;  4FL9 A;  1GLB G;  1ESV A;  3CQX A;  5AZJ A;  4BG9 A;  5ADX A;  3P38 A;  1BA0 A;  4FWS A;  4JK7 A;  5C10 A;  4BR5 A;  2GWK A;  1GLF O;  4PKI A;  5DM7 L;  4MO5 A;  3H46 O;  1Z6R A;  5TKY A;  1WUA A;  3NVM A;  2YJF A;  3SBT A;  3Q7C A;  3WQU A;  1Q86 O;  5AQL A;  3SMP A;  4WQ4 A;  3FZK A;  4B1Z A;  1VQP N;  3TTD A;  3MN5 A;  4CZL A;  3WQT A;  3P4I A;  3QFP A;  3EE8 A;  1DKG D;  3KWI A;  1BU6 O;  4YOX A;  1YHQ N;  3ID6 A;  4J8F A;  3HOS A;  4MLE A;  1K73 O;  2RE2 A;  2GWJ A;  4YOV A;  3TSU A;  3E1Y A;  3KZB A;  1GLD G;  3M3Z A;  3NVK A;  2GEM A;  3G6E N;  1WOQ A;  4FSV A;  5GAG P;  3SJH A;  5BRD A;  5CR4 A;  3CJ9 A;  5AQP A;  4BQZ A;  1LOT B;  2NNW A;  3HM8 A;  4BR0 A;  4IDH A;  3O1B A;  3D2E B;  3H6E A;  2WUS A;  3ID8 A;  3MK6 A;  4CZJ A;  2ZJP L;  4BRN A;  3SAF A;  2P9S A;  3QIC A;  4K43 A;  4ILJ A;  1BA1 A;  1S22 A;  2D0P A;  3JS6 A;  5B8H A;  4BRI A;  3D6R A;  3C65 A;  4JNE A;  4DKW A;  5AQU A;  2NRH A;  4BRM A;  1BO5 O;  4JKE A;  4YDU A;  3DXK A;  4FWR A;  3VEY A;  2VWB A;  5HOO A;  1MWM A;  1BWF O;  3GE1 A;  4NO7 A;  3TTC A;  4KH5 A;  4NLB A;  2BUP A;  3E9P A;  4LC9 B;  5FPM A;  4H0Y B;  3I56 N;  3O6W A;  1NGG A;  3E9L A;  5GIN A;  5LJW A;  3L0Q A;  5BN9 A;  3FLC O;  3PLA A;  3OA9 A;  5AQV A;  3W0L A;  3CC7 N;  3BF1 A;  3CCJ N;  1YVN A;  3O80 A;  5M1O A;  4A5A A;  4F9O A;  2V7Z A;  3S41 A;  5BN8 A;  5BRH A;  2FF3 B;  3H3N O;  3MWT A;  3WXJ A;  2P9P A;  5DM6 L;  1YUW A;  5M1Q A;  2NZT A;  4C23 A;  4JKG A;  4JKD A;  4CZF A;  1KAY A;  2D4W A;  2GUP A;  3VEO A;  4CD3 A;  1K8K B;  4BC3 A;  1JJ2 M;  2J4R A;  5AZI B;  4WQ5 C;  3CD6 N;  1JCF A;  4JK9 A;  5GAE P;  4R79 A;  1YJ9 N;  2P9L B;  3ATV A;  1BOT O;  2E1Y A;  4FWL A;  4QS7 A;  3FZF A;  1MA9 B;  1HJO A;  5AR0 A;  4BRA A;  2QWL A;  3A5M C;  5BR9 A;  2HF4 A;  2JWK A;  1VQL N;  3A8Y A;  4M7Y A;  3A0I X;  3HBT A;  3ULE A;  2Q2R A;  3CER A;  4H0V B;  4BRO A;  2E2P A;  2CH5 A;  4CI6 A;  4JD2 A;  5AQG A;  4WFA L;  4FWP A;  3R3L A;  1VQO N;  2A41 A;  4XEI A;  3E66 A;  5AQQ A;  1Q18 A;  3ENO A;  5FPN A;  1X3M A;  2ZGY A;  1VQN N;  1NGE A;  3BUZ B;  4H0O A;  4O5F A;  3ZET B;  4BR9 A;  3I8B A;  1QQO A;  2A42 A;  3TPQ A;  4L3Q A;  1U6Z A;  4C1N K;  5CHI A;  4HWI A;  1EQY A;  3IFR A;  4I6M B;  2NLX A;  3M1F A;  3O9R A;  5AQS A;  3UKR B;  1J6Z A;  2PBD A;  4IWV A;  3H1V X;  4FWN A;  3C7N B;  1E4G T;  1X9J A;  2WBN A;  4JAX A;  3CHW A;  3VEW A;  4K41 A;  4CZE A;  5EVZ A;  4WCE L;  3O9T A;  1QVF M;  2VGN A;  1NWK A;  5LY3 A;  3ZX3 A;  1SZ2 A;  3CCS N;  3CME N;  3IMX A;  4OPH A;  4BQL A;  1GLJ O;  3T7Z A;  4BY9 C;  1C0F A;  1KAZ A;  4MDB A;  5ELZ A;  1H1V A;  3W3D A;  3CJA A;  1NGB A;  4EAH D;  2Q97 A;  1V4T A;  3VEV A;  1GLC G;  4FWK A;  5I9E B;  3EO3 A;  4JKB A;  5GAH P;  3LDN A;  3O08 A;  3CCV N;  2Q1N A;  3VGM A;  2KHO A;  1VAZ A;  3BEX A;  5AQF A;  5ADX H;  4JHD A;  4B9Q A;  1NMD A;  2Q0U A;  1M1K O;  3UE5 A;  2P9I B;  1VQ6 N;  2QWP A;  1Z05 A;  2PFU A;  3MDQ A;  3QFU A;  3JXU A;  3N4P A;  4BRF A;  1Q81 O;  1SQK A;  1HKG A;  3O1W A;  2P9N A;  3AGR A;  1QQM A;  4BC5 A;  3O9U A;  2PAV A;  4EFH A;  1K8A O;  3M5R A;  5EX5 A;  1ATN A;  1KXP A;  3DWL A;  1VQ7 N;  4FWO A;  3HRG A;  3UKU A;  3MX2 A;  2NRZ A;  2ZJQ L;  4FOI A;  2FSN A;  2ASP A;  5H1S Q;  3P39 A;  3N4Q A;  2ITM A;  1VQ9 N;  1NGC A;  4A2B A;  4BC4 A;  5JIC A;  4FPB A;  3D2F B;  3Q7B A;  3WEE B;  4ISF A;  3HOT A;  3L4I A;  3KWG A;  4BRH A;  1S72 N;  3IKM A;  2QWO A;  2P9U B;  1NGA A;  4QS9 A;  3L6Q A;  3P31 A;  3MN9 A;  3LDO A;  4JN4 A;  4CZK A;  5BRF A;  2NRW A;  2YJE A;  3HI0 A;  4B1V A;  1TYQ A;  3AGK A;  1NGJ A;  4A5B A;  5BPL A;  4IFE A;  3ZEU A;  5GIP A;  1SS6 A;  3MMV A;  3FGU A;  1NBW A;  1NGD A;  3CPE A;  2FSJ A;  3M6G A;  3GDQ A;  4JK8 A;  1T44 A;  4IXC A;  5FPD A;  5KPT A;  3EZW A;  1K9M O;  2I7N A;  4DQ8 A;  3CJ7 A;  3DXM B;  2P9K A;  4CJ7 A;  3IUC A;  1W2B M;  2GTD A;  4GNI A;  1QZ5 A;  5AFU A;  1VQ8 N;  5C12 A;  1YJN N;  1G99 A;  4RCH A;  3RSE B;  1MDU B;  3CQY A;  4M63 C;  4CBX A;  5AQN A;  3TU5 A;  2Q31 A;  4H5N A;  3D7E O;  3MWP A;  2E1Z A;  5JMV A;  3VEZ A;  3VER A;  1VQ4 N;  1YXQ A;  1P90 A;  3DLL L;  4NB4 A;  4BRP A;  4Y0W A;  2NRT A;  3EN9 A;  2CGJ A;  3OW2 M;  3MN7 A;  3E9O A;  2A3Z A;  4JKC A;  3FZH A;  1V4S A;  3FR0 A;  4GVE A;  3CJB A;  3VES A;  4BRQ A;  4H03 B;  4IO8 A;  2ZF5 O;  2AA4 A;  1VQK N;  2YHX A;  2E2N A;  3VMF B;  4BRG A;  2IVP A;  5C2F A;  4ISE A;  3F9M A;  1OKJ A;  1QHA A;  3R1X A;  4IEI A;  4JKA A;  3EL2 A;  1YIJ N;  2HBJ A;  3R6M A;  1U2V B;  3LM9 A;  1NJI O;  2OAN A;  4A62 A;  5EXW A;  1Q7Y O;  4GV3 A;  4YOW A;  1IG8 A;  5AQT A;  2AP1 A;  5EY4 A;  2OTL N;  5KQD A;  4AM7 A;  2F9T A;  3VTH A;  2VGM A;  5JVH L;  3CJC A;  5AZJ B;  4CZI A;  3O9S A;  3D2E A;  4WQ5 A;  5E84 A;  5BRE A;  3SAH A;  3PIO L;  1VQM N;  2FSK A;  1EO1 A;  3AAR A;  4U67 L;  5MLC Q;  1T6D A;  4H5T A;  3A5N C;  1KQS M;  4CBW A;  3VGL A;  4O8U A;  5KQ8 A;  3DJC A;  4YOU A;  4EHU A;  4BG8 A;  3L4Q A;  5KPR A;  3VET A;  4WYB A;  2YCH A;  3KHY A;  4BC2 A;  4CBU A;  3CCM N;  4B1W B;  2HBL A;  3O9Q A;  2QWQ A;  2VYP A;  1RDU A;  4ISG A;  1HX1 A;  5C2D A;  2RHK A;  4DB3 A;  3TSQ A;  4H5W A;  4HTL A;  3WXK A;  3CET A;  4BRL A;  3G4S N;  5C15 A;  4MO4 A;  1HKB A;  4WF9 L;  1KAX A;  3ZX0 A;  3FZM A;  4PL7 A;  3GG4 A;  2GEL A;  3R8E A;  4NLC A;  3FE1 A;  5GAD P;  5AQM A;  3VTI A;  3VPZ A;  4ILH A;  4RTF D;  3WXM B;  4C1N I;  2E8A A;  1E4F T;  3CI5 A;  3LDP A;  3OBY A;  1HLU A;  3CC4 N;  4A2A A;  3CMA N;  2ZGZ A;  3O4W A;  3PIP L;  4GV9 A;  4BGB A;  4PL8 A;  3SK3 A;  3KVG A;  4ILG B;  1ZBS A;  2P9S B;  2WFB A;  3T69 A;  1K8K A;  2HOE A;  4CZM A;  5AZI A;  1GLL O;  2QWR A;  4BR4 A;  2W40 A;  2IVN A;  1DEJ A;  2P9L A;  4BGA A;  3MX5 A;  3DXK B;  3K9J A;  2DPN A;  3VGK A;  4XH4 A;  4DHY A;  4H0P A;  2HMP A;  4PKG A;  4BR2 A;  4BVP A;  4WQ4 C;  3ENH A;  4XH5 A;  3CF5 L;  1RFQ A;  5AQI A;  5AQO A;  3UB5 A;  4AF1 A;  2QTD A;  2WC9 A;  1BG3 A;  1HPM A;  2E88 A;  2OTJ N;  2QW9 A;  4Z94 A;  4RWT A;  1R59 O;  1MWK A;  1NGF A;  4A59 A;  5FPE A;  3VF2 A;  4YOY A;  1CZA N;  5JLF A;  2NRR A;  3U8X A;  5AQY A;  3WXI A;  3ZET A;  3CC2 N;  2P9P B;  5AQJ A;  1ILY A;  4H5V A;  1QVG M;  5F0X A;  4KBO A;  4YOR A;  3CXC M;  2GX9 A;  2KKZ A;  4BRC A;  1OVY A;  1XQS C;  3J8A A;  4JKG B;  1GLE G;  2Q36 A;  1KD1 O;  2QWM A;  3EKU A;  1ZC6 A;  4I6M A;  3VOV A;  5CE3 A;  2CGL A;  2YX6 A;  1NLV A;  2Q0R A;  3K9K A;  3O5B A;  4IZ9 A;  1NGI A;  4JKH A;  3VEX A;  3UKR A;  2E2Q A;  3LL3 A;  4BVO A;  2F9W A;  4U7B A;  5JVG L;  3F2K A;  4PKH A;  5AQZ A;  1YJW N;  2HBM A;  3F5T A;  2V7Y A;  2CGK A;  3C7N A;  3O8M A;  5TKW A;  3VF4 A;  3A5O C;  3WUH A;  3NMU A;  4IOA L;  4H0X B;  2UYT A;  2YHY A;  5JLH A;  3CJ1 A;  3ENB A;  5M1F A;  4YDU C;  2HST A;  4FWQ A;  5AQX A;  5AQH A;  2QXL A;  3ULE B;  1T3V A;  2QI2 A;  2JWL A;  2YI1 A;  3GBT A;  3QBX A;  4EIA A;  4JD2 B;  1YAG A;  4FWM A;  3SLC A;  5AFU H;  4H5R A;  2FLO A;  1C0G A;  1GLA G;  3G25 A;  1IJJ A;  4GY2 B;  4JEP A;  4MDA A;  4FVU A;  2HBK A;  4M7X A;  3TSP A;  3ZX2 A;  2QEX N;  3QML A;  3H45 C;  1S3X A;  2H3G X;  4G9Z A;  3TTF A;  2HF3 A;  3CIP A;  2IIR A;  2A6A A;  2BH1 A;  4QS8 A;  1ATS A;  1HKC A;  1JCE A;  2P9I A;  3HSC A;  2ASM A;  5BPM A;  2F7T A;  5GIO A;  1QQN A;  3VEN A;  4DCH A;  4UY8 O;  4WFN L;  1BUP A;  2A40 A;  2QA4 N;  4CZG A;  3SMS A;  3WXL A;  1ZXO A;  2V52 B;  1W97 L;  4IOC L;  2EWS A;  3R9P A;  1Q82 O;  3BP8 A;  4AM6 A;  3VF6 A;  3EKS A;  1YI2 N;  1ATR A;  4OO1 J;  2NRV A;  3IDH A;  4JKF A;  3MCA B;  3OBW A;  2A5X A;  3C0B A;  4KH4 A;  1YF5 L;  2NRX A;  3D2F A;  3H1Q A;  3QBW A;  2BTF A;  3WEE A;  1Y64 A;  5EOY A;  3QB0 A;  3KK7 A;  1O13 A;  3MN6 A;  2W41 A;  1KC8 O;  1YIT N;  3AAP A;  3C6H A;  4B1Y B;  5M1P A;  3CCE N;  4A57 A;  3RVC A;  3U9Z A;  2E20 A;  4JHD B;  2P9U A;  2E2O A;  4E1J A;  2ASO A;  3OHR A;  3MCP A;  4OPA A;  1JCG A;  4IOX A;  2P9N B;  3CCQ N;  3U4L A;  1HUX A;  4IO9 L;  4BRE A;  4BR7 A;  1RDW X;  3CCR N;  4KH6 A;  3A5L C;  4CZH A;  3CCU N;  3ZYY X;  1N8R O;  4K42 A;  1TUY A;  3LDL A;  3I55 N;  3UKU B;  2D0O A;  4FOE A;  2CH6 A;  3LDQ A;  1TUU A;  1D4X A;  2KLA A;  2YHW A;  4BRK A;  4IJN A;  5AQK A;  1X3N A;  3J7Z O;  3DAW A;  5M1N A;  2FXU A;  2VCP A;  3B8A X;  2QM1 A;  3DXM A;  4H0T B;  5F1X A;  5LJV A;  3QDK A;  2ZJR L;  4MLH A;  1M90 O;  3AAQ A;  3SBG A;  5M1K A;  3RSE A;  3C6A A;  1NM1 A;  3AY9 A;  1RGI A;  1XUP O;  5HL7 L;  3G71 N;  3SAG A;  3U9D A;  1P8Z A;  1T6C A;  4FO0 A;  3H3O B;  1BDG A;  4PHT X;  5AQR A;  1DGK N;  1NGH A;  5E26 A;  4GV6 A;  1TYQ B;  2IVO A;  4BRD A;  1DT9 A;  5BPN A;  3I33 A;  4IEE A;  3GL1 A;  3ZEU B;  1QZ6 A;  4O8K A;  4IJA A;  4A61 A;  4FPA A;  3WT0 A;  3ATU A;  3FZL A;  5F2R A;  4WFB L;  2V51 B;  2ZWH A;  3CCL N;  4B1X B;  2D1K A;  2I7P A;  2FF6 A;  1VQ5 N;  3CPW M;  2QWN A;  1SAZ A;  4YOT A;  5AQW A;  4K25 A;  4B1U B;  4CD1 A;  2P9K B;  5C0Y A;  3HTV A;  4XH1 A;  1U2V A;  4EHT A;  3FFK B;  3EE9 A;  3BF3 A;  3LM2 A;  1LCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...