5C2FA

K428a mutant nuclease domain of the large terminase subunit gp2 of bacterial virus sf6 with manganese and beta-thujaplicinol
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
242
structure length
230
Chain Sequence
MAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTAVEMKQKLGIPSPNLADALMMCMHCPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Gene 2 protein
publication title Two distinct modes of metal ion binding in the nuclease active site of a viral DNA-packaging terminase: insight into the two-metal-ion catalytic mechanism.
pubmed doi rcsb
source organism Enterobacteria phage sf6
total genus 80
structure length 230
sequence length 242
ec nomenclature
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5c2fA00
4IEIA 5C15A 3CPEA 5C2FA 4IEEA 5M1NA 5C10A 3C6HA 5M1OA 5C12A 4IFEA 4IDHA 5M1QA 5M1PA 5M1FA 5C2DA 3C6AA 5M1KA
chains in the Genus database with same CATH superfamily
5CYQA 3ULEB 4AH9A 4F2SA 3G6EN 1NG9A 2IDOA 3PX0A 1DEJA 4PWDA 3FZLA 3BUZB 3LM2A 1VQ6N 3OBWA 4ISFA 2E20A 4H4MA 5AZIA 4DSKA 4JI4K 4KTWA 2EWSA 4KHSA 2NRZA 2JGUA 4CIEA 1O13A 4CJ3A 4F3OA 2VG5A 4CJLA 4M45A 3D7EO 4M3TA 3A5NC 3CC4N 4BRLA 1VSFA 4CJ5A 2WBNA 4BRDA 1NGHA 3HVTA 3VTHA 4CGIA 3TABA 3L3VA 3SUPA 3THYA 4H8KA 1GOCA 3DRSA 2Z1JA 1NJXA 3WXKA 3DLLL 4DV5K 2GWJA 1BCOA 4FWRA 5AQJA 4FJGA 3B8AX 2D0OA 4CD1A 4FVUA 4KB1A 2V7ZA 3NE6A 1NGEA 1KD1O 5BPNA 1VSHA 3WXJA 4DUYK 1NKEA 5SWMA 4DFJA 4F8RA 2V51B 2KQ2A 1CXQA 1D4XA 1VQNN 4C8KA 2FF6A 3O9TA 3MN9A 5AFUH 1N8RO 3C94A 2HHXA 5AQIA 1X3NA 3J80O 1T03A 1OKJA 1UOCA 3DI6A 5AQTA 2ZWHA 4IDHA 2P9IA 4DR7K 2HHVA 2P5OA 3O4WA 4DSEA 3SJJA 4GV9A 4IEIA 1BO5O 2QWPA 3HZ6A 1EETA 4U67L 2P9SA 4WYBA 4FLZA 2GEMA 1X9SA 1IBLK 4NYFA 3CFPA 3CJ9A 4IBNA 3DOLA 4LF7K 4CBWA 3V9ZA 2RPIA 3KKSA 1ZC6A 1IG9A 3TSUA 1BA1A 4JI2K 2UUAK 2HOEA 2NRRA 4KHUA 1S1UA 3CIPA 3LALA 5DM7L 4O5BA 4B9VA 3JSMA 4KTZA 1HMVA 3D2EA 3WT0A 3L3UA 2UU9K 2ZF5O 3WXLA 1S6QA 2G8FA 5M1FA 4M3XA 2G8WA 1MU2A 4B1WB 4QS7A 3TTCA 2HVHA 2P9KA 1SAZA 1VSEA 1J6ZA 3HTVA 3IRXA 4CEAA 4DR3K 3SQ4A 2FBXA 2EHGA 3CG7A 4CI6A 3HM8A 3L2WA 4RW8A 3J81O 4M42A 1WAFA 4ID5A 1BHLA 2UUCK 1RT3A 2OZMA 1HPZA 3ULDA 3DXKA 4NCBA 3SCXA 5D3GA 1C6VA 5M1KA 1RT5A 3FGUA 4BGBA 4IEEA 3ID8A 4DV7K 1S22A 4KH5A 2PYLA 2UYTA 1SKRA 4H5NA 4PHTX 1S3XA 4BRFA 3OS2A 4F2RA 3NGZA 2OTLN 4DTNA 4FXDA 1GLLO 1TKZA 2Q0RA 3CFRA 2D0BA 2YHAA 4OLAA 4XH4A 4CF9A 2E6MA 4JK9A 4B9NA 3VF4A 3VN5A 3CM5A 3O6WA 4FO0A 3KIOA 3VQ4A 2XY6A 3TAEA 1TKTA 3K9KA 4CJPA 3WQUA 3WUHA 4LFAK 3AO4A 3O3HA 1NGFA 3BGRA 3AO1A 4DQSA 4I2QA 3GOIA 3LPTA 4DV2K 3L4IA 3QBWA 5HRSA 2VWBA 3IMXA 2E6LA 2QI2A 2E2QA 4DU3A 1VHXA 4I6MB 1WSEA 3D0PA 2BH1A 4ILHA 2YHXA 4H5VA 3PY8A 1WSGA 1RT4A 4QAGA 4WQ5C 3HOSA 5KPZA 3HSCA 1BGXT 2QM1A 4XEIA 3F9MA 4IJNA 3OYDA 4O8KA 4OPHA 1LWEA 1MA9B 1T8EA 5E84A 3L2VA 4V19S 2O4IA 2F8SA 1XUPO 1RT1A 1LOTB 4KAZA 3AVLA 4DSIA 4YDUC 2E1ZA 3HPGA 5AQFA 3HXMA 4DF8A 2D5RA 1ATNA 1VSMA 1BA0A 1SKSA 4B9SA 1QQOA 1WAJA 4DV3K 2G8HA 4E0DA 3CMEN 5ELZA 1NGDA 3FZFA 1BIUA 2ETJA 4GV3A 4FCYA 4JKGB 5KGXA 4KHQA 3VEVA 1BG3A 1CZBA 3AVAA 3ZT0A 1EKEA 3I55N 1HUXA 4LFBK 4B3SK 1KQSM 2FSKA 2VWKA 1NMDA 1KRPA 5GAEP 3TAFA 5AZIB 3OYLA 2HB5A 1NJIO 5HRNA 1G99A 1S1XA 2XHBA 4GY2B 3ALYA 4DMNA 1BQMA 5BN8A 2I7NA 1NGGA 4DSLA 4CF8A 3S3NA 1BCMA 4C23A 3OYGA 2PZSA 3TAQA 1VQ5N 4CK1A 3K0SA 2OPPA 4HCCA 2HBLA 3THYB 3SI6A 1X1PA 4PUOA 4M3RA 2AP1A 1KVBA 4A2BA 5BPMA 3WXIA 5KQDA 3VEXA 4IFYA 3MN6A 3PSIA 5AQMA 2H3GX 5CZ2A 3WEEA 4RCHA 1LAVA 4CEBA 4GW6A 2D1KA 3ZSQA 1TVRA 4CJKA 5HRPA 4J2EA 3K9JA 1XWLA 2ZJPL 4M3ZA 4EFHA 1IV0A 4PA1A 1S9EA 3ZX0A 4YOYA 2CGLA 1TUYA 2NRHA 2YJEA 1K8KA 3OBYA 3TSQA 3G0ZA 4MQ3A 4CK2A 1QZ5A 3KLHA 1D8YA 2FBTA 2X6NA 4CZJA 3O1BA 4O0IA 1Q18A 2QKBA 4E7JA 2P9SB 4BC5A 3OYNA 3RRHA 5AQLA 5AQOA 4A59A 4W5QA 4FOEA 4KH6A 4JHDA 4DV0K 5BREA 2G8IA 1SS6A 3BF1A 3RTVA 4YOXA 2W42A 4XH5A 2R7YA 3GBTA 3P83D 3AA5X 4B08A 2GX9A 2P1JA 4YNQA 3I8DA 2Z1GA 2OANA 3L2QA 1RTDA 1A5WA 3THWB 3AVMA 1RBRA 3SUQA 4BR2A 5EOYA 1BI4B 5JMVA 3JXUA 1TAUA 3ZSXA 2QTDA 5C42A 3O9QA 2A5XA 1Q82O 4OPJA 4RWTA 3FE1A 3M8RA 5JS1A 1QSYA 2OTJN 3AO2A 2P9KB 1A5XA 2W6LA 4XH1A 3AO3A 3M8QA 1NK9A 4QS8A 3AA3A 1YHQN 4H0TB 1T44A 3Q7BA 3ID6A 2OPRA 2HVIA 1RBVA 3DXKB 4QS9A 3HOTA 2VYPA 4JI8K 2ZD1A 4CHNA 3S3OA 5ADXA 3HBTA 3QEPA 1RDWX 4B9TA 5KRTA 3NH2A 5C24A 4C8LA 4O0JA 3RR7A 4FLXA 1NJYA 4PQUA 3DLHA 3QIOA 2XY5A 4KV8A 2P9LA 1OH5A 4BR4A 3V9UA 1BUPA 3IKMA 1RTIA 3MMVA 3AV9A 1OVYA 4FJJA 3O1WA 4CZFA 5LMNK 4HUFA 4DTUA 1VQMN 2YJFA 5T7BA 2J4RA 4N41A 3IS9A 1RILA 1TYQA 3KKRA 4CHYA 4AM7A 1S1TA 1ZBLA 4FJ7A 3C6TA 4DLGA 1OH6A 1F21A 3IG1A 4FJNA 4DS5A 4ICLA 1B92A 4CJRA 3SV3A 4DV6K 4WQ4A 1HKCA 1U49A 3D2FB 3A2FA 3NBPA 1Z6RA 4C1NI 1KFDA 3ZSRA 2A41A 2VGMA 2F8TA 1QQNA 4ZHRA 4CEQA 4Y1CA 4DV1K 3V4IA 4E7IA 1YUWA 3VQ6A 4BC3A 2D4WA 1U2VA 4GKKK 3VA3A 3PLAA 4K0KK 3CFOA 4CZIA 3QNOA 4PKIA 2YHWA 2FBVA 5BR9A 1NK6A 4DTXA 1NK7A 3DLEA 1XC9A 4BDYA 3GE1A 2I7PA 3NH1A 1KFSA 2V52B 3DLBA 3F2KA 3MN5A 2A42A 4KI4A 2F7TA 1WB9A 4H03B 1FW6A 1ILYA 2FSNA 2CH6A 1V4SA 5I42A 4FZYA 1NOZA 2P9UA 4WFNL 4JI0K 2ASPA 3K5MA 3R3LA 2O8FA 3EKSA 1KLMA 4NO7A 3RMAA 2QWLA 3ASMA 4PY5A 3VETA 3B6PA 4DFKA 2F9TA 1W97L 1WNSA 1Q7YO 5MLCQ 4AHCA 3EL2A 3DOKA 3A8YA 2YKNA 4C8NA 4KRFA 3M8SA 2YNHA 4HUEA 1VSJA 5HROA 2KTQA 2W41A 4BRHA 3S3MA 2O8EA 4BROA 2W40A 4OVLA 4OKJA 5CR4A 5FROA 4E1JA 4FSVA 2D0PA 3NVMA 3SLCA 1L3TA 4DQ8A 1L3SA 2XY8A 2HBKA 3TAPA 1NK4A 4HCBA 4CGGA 3FLCO 3KVGA 4OJRA 4OKKA 1SUQA 3VERA 4NB4A 4WE1A 3SAGA 3OYAA 4X65K 3RMCA 5M1QA 3CCUN 4YORA 4JYAK 2JWKA 3V6DA 3ZT4A 3UB5A 3LPUA 5AQVA 1O1WA 2HF3A 4BRMA 2GBZA 2NRVA 3OA9A 3O08A 1I3AA 3PX6A 1NM1A 1HX1A 4DQRA 3WEEB 5EX5A 3HT3A 1B9FA 3NGYA 3QB0A 5AZJB 2QWQA 4YFUA 1NJZA 4W5NA 3MEEA 4BR7A 3CCQN 3NCIA 5IT9O 2HMIA 4CFBA 3T19A 3DRPA 1J53A 1EQYA 1WSIA 3EZWA 1WOQA 1FKPA 3SUNA 4FM0A 3W0LA 1DTQA 4JEPA 1YJ9N 4JKAA 4JHDB 3CJ7A 3HPHA 3OJUA 4CF2A 2HSTA 1QVGM 2P5GA 4ZTJA 3CPEA 3ZSZA 4B1UB 1MWKA 1SKWA 2KZZA 2O8DB 4NCAA 4CZMA 3OYFA 3CETA 3P39A 1D9FA 1VQKN 1NGJA 3I0SA 4XIUA 5HP1A 4DF4A 5AQQA 4OLBA 5HOOA 1U04A 3OYBA 1JL1A 3EKUA 1HNVA 1X9WA 5FDLA 3K5LA 4F3TA 3HVRA 2UXBK 4FW2A 4JD2A 1NLVA 1U45A 3VPZA 5AFUA 2FC0A 3P4IA 1N32K 4M41A 3OYIA 4KTQA 4RW7A 5M1PA 3RSEA 3RVCA 5CYMA 3U8XA 5AQKA 5LL6Z 4IJAA 3R1XA 2AA4A 4JKHA 3OJSA 4DFPA 1W2BM 3G4SN 3KHYA 3QFPA 4Z4EA 3VQ7A 1ZBIA 4A62A 4CEDA 1MWMA 2ZJQL 2OZSA 5BRFA 1YJNN 2Z1HA 3MDQA 4CJUA 4Z4IA 3UKUB 4CERA 3O3FA 3MWPA 3CPWM 3ZEUA 4CZLA 1I39A 2BE2A 2E5LK 3WXMB 1NMNA 3SQ1A 1C0GA 4FJMA 1KVAA 5BRDA 3VESA 4FJ9A 2FLOA 3AA2A 3VOVA 3CCLN 1IKWA 4IOAL 4BQZA 3K57A 5BN9A 5CE3A 3EO3A 2Q97A 2A1RA 1GLEG 1FKOA 1TYQB 3V9WA 4CJTA 1JCFA 4CVNE 3K5NA 3TANA 2HF4A 3AVIA 3CM6A 3V9SA 2WFBA 2X6SA 3A0IX 2YNGA 2E8AA 3CJBA 5C0YA 1VRTA 3ENHA 3NF9A 3HPOA 4Q0BA 3ZSVA 3JAMO 1NGCA 3M5RA 3IFRA 1ZYQA 3EZ5A 2XO7A 3UE5A 2QW9A 3I33A 2ZGZA 5J2MA 2NUBA 4BWMA 1U2VB 3CYMA 4B3OA 1SQKA 5KGWA 2ZGYA 3Q7CA 2HBJA 4EP5A 1JCGA 3AVFA 3I56N 3V1RA 4JKBA 3TSPA 4Y0WA 1C1CA 2AJQA 2HHUA 4KBOA 4AHSA 5JLHA 1KCFA 1XNRK 4BE1A 4CEOA 5AQRA 1N5YA 1DTTA 1T6CA 5KI6A 3CCVN 4GNIA 2PY5A 1VQ8N 4JI7K 4DTMA 2KFNA 1T05A 2IVPA 1JJ2M 2WC9A 3FZMA 4HTLA 3ITHA 4CK3A 4ILJA 4FLWA 1XI1A 2ASMA 3A5OC 4CF1A 3KLEA 3U3YA 1HKBA 3CQYA 2ZE2A 4DFMA 3K2PA 3G10A 2O8FB 3H45C 3G71N 2YV0X 4A2AA 4CZHA 1NWKA 3M1FA 3PO4A 4I9LA 2NZTA 2G8VA 3RWUA 2QK9A 5DMRA 4CEFA 1E4FT 3R8EA 3NFAA 4CFDA 4X64K 3LP2A 1P8ZA 1WUAA 3VQCA 2E2PA 1YF5L 2O8EB 4CESA 4RTFD 4EHUA 2GELA 4JKFA 4B3MK 1H1VA 5HRRA 4FM1A 4GMJB 4Q5VA 3THVA 4BWJA 1U4BA 3F9KA 2P9PA 1YT3A 2PFUA 4BR9A 1W9HA 2F4VK 1QS4A 4AHRA 4E1MA 1S72N 1T3VA 4JK7A 3ZT2A 2BUPA 3HRGA 1HPMA 5JICA 5F0XA 3QEWA 1M90O 1YI2N 5AQXA 1IBMK 3SMSA 1VQLN 2ZQBA 2DFFA 4IOXA 3PO5A 1RT7A 3NH0A 3SK3A 3QESA 1IO2A 4O5FA 1RNHA 1M1KO 2IOCA 4CHOA 3ZX3A 1BU6O 3LDSA 3JS6A 4DR6K 4BVPA 2VG7A 4ELUA 3QEIA 1SZ2A 5AQHA 1TKDA 1Z26A 4GVMA 3KK1A 2Q36A 4JS4A 3MX5A 2FXUA 2VGNA 4H5TA 1XMOK 1S1VA 1RDAA 3CC2N 1HQEA 4FLUA 1IH7A 2B5JA 1TV6A 4MDAA 1HYVA 1EO1A 4B3RK 4RW4A 5FRNA 4CE9A 3K58A 2UUBK 3U3GA 3MN7A 4B9QA 1JKHA 3B6OA 3IUCA 3UKRA 2QXFA 4B9UA 3MXIA 1Y64A 2E4LA 4FPAA 4B1VA 3V1QA 4K25A 3LDOA 3SYZA 3VEYA 2WTUA 1CZAN 4BRNA 4LFCK 2OYQA 1ZBFA 1XC3A 4BRGA 2YHYA 1XMQK 2O8BA 1QSLA 3THXA 2JLEA 4CCHA 2QWNA 4EP4A 4DTPA 1T6DA 5AQWA 3SMPA 1YVNA 2YNIA 4JD2B 2P9IB 1SL1A 4BR5A 2QXLA 4B8CA 2BTFA 5FLXO 4E19A 2G8UA 1WSJA 4JKCA 4FJIA 1ZBSA 2PAVA 3KWIA 3PSFA 4CJQA 3ULEA 4CJ7A 4N47A 3O5BA 1LAWA 4LH4A 3E9OA 3OYMA 3U4LA 2UXDK 3K59A 4FWQA 3I0RA 3QEXA 1TAQA 4MDBA 4CBXA 1E3MA 1HNZK 2E88A 2VCPA 1BIZA 1HNXK 3AVHA 3QERA 4AF1A 3QNNA 3QO9A 4CZGA 2WOMA 2VQEK 3D2EB 1X9MA 2YI1A 2HHSA 2IVNA 3CCJN 1Q9YA 4CJ4A 1IKYA 2IVOA 3KLIA 1KC8O 4BRCA 4CECA 3OYCA 5F2RA 2VWJA 3RR8A 3SBTA 4CGHA 3ZLJA 4DU4A 4WFBL 2NLXA 1J5OA 4H0YB 3VQQA 2KKZA 4YOWA 3OYEA 3ATVA 2VQFK 3DLRA 1RDBA 5TKWA 3NF7A 2X78A 3WQTA 1NOYA 3LM9A 4I2PA 4TSXA 4W5RA 3VQ8A 1HR0K 3CERA 3O9UA 3O9RA 4BE0A 2IIRA 4LF8K 4CZEA 4FWNA 4CF0A 4WCEL 4FLVA 2YCHA 1VQPN 4A5BA 4DQQA 1IJJA 3KLFA 4EZ9A 4FJ5A 1EWRA 4LF6K 1QE1A 3QETA 1CLQA 1SL2A 3CMAN 3EYZA 3EN9A 3AAPA 4YOTA 5BR8K 1VQON 4KB0A 1VSLA 2WONA 1N6QA 3O8MA 1ATSA 3PUFA 5AQSA 1NK0A 3O4NA 1ATRA 2QWRA 4JI3K 4NXMK 1WBDA 3CCSN 2YX6A 1VRUA 4UQGA 4W5TA 5FPNA 1JXEA 1BQNA 4FJKA 2BDPA 3BZKA 1X3MA 4JN4A 3E9LA 4Z4CA 1QVFM 1YJWN 4ID1A 4KKOA 1J5EK 5HBMA 3SV4A 4IFVA 3TAGA 3SNNA 2YHBA 4IOCL 3GDQA 4BRPA 4BREA 1N33K 4LD0A 4OGCA 3VEOA 1QQMA 4FZXC 1ZXOA 2BGGA 4MO5A 4Y1DA 3MK6A 4OPKA 1HLUA 4KPYA 2YNFA 4CFCA 1VK0A 2P9NA 4LF4K 3LDNA 4FK2A 3ZSYA 3AVBA 4FZZA 1RTHA 3OYKA 4OPAA 2NRTA 3P5JA 4Z4FA 1YITN 3J7AP 5DK5A 3CQ8A 3T3FA 1XNQK 4K41A 2HBMA 4JNEA 4E7KA 3DLGA 4UY8O 1RT6A 3ZT3A 4B9LA 4KO0A 1HQUA 2IGIA 4HHTA 4DLEA 1TL3A 1L3UA 3J8AA 4NCGA 3HJFA 4DV4K 3ZT1A 5KRSA 1VQ7N 4MLEA 1S9GA 4MO4A 3VMFB 2FF3B 2HNYA 5I3UA 1GLBG 4LY7A 1R0AA 4FOIA 4B8AB 1N36K 1NGBA 4H4OA 2KHOA 1NBWA 4ISEA 4BC2A 1OVQA 1YTAA 2YKMA 3WNGA 3SPYA 3LZIA 2OCEA 3MX2A 2GUPA 3MXMA 2GV9A 4IO9L 3QIPA 3D45A 1RDDA 4M7YA 1K6YA 3VQ9A 1JLEA 2IS3A 3DAWA 3P31A 4LSNA 4AHTA 3C95A 4DU1A 1QHAA 1JLGA 2RHKA 4CJWA 3JYTA 1WBBA 3M8PA 4CHZA 1IG8A 1RBUA 4FPBA 3OYHA 3I8BA 2VG6A 4YHHK 1TK8A 1NNEA 3OTOK 3HM9A 2F9WA 2W6KA 3CJCA 4CHQA 2Q31A 3DJCA 3MEGA 2RE2A 3PX4A 1A5VA 3E1YA 2GWKA 5IWAK 4JI5K 3KD5E 4OKEA 3OVNA 1P90A 2O8BB 3MWTA 4IG3A 4FLTA 3LL3A 3THXB 3HK2A 3SAFA 4KFBA 1NKBA 2LSNA 1Q86O 4B9MA 3AARA 1K8KB 3L4QA 1JLAA 3GG4A 3SPZA 4JKGA 1TK0A 5GAHP 3DM2A 3PIOL 3G25A 5AJ3K 3AAQA 1ESVA 4BG9A 3L0QA 3TTDA 1GLAG 2DFEA 3H46O 3LAMA 4BY9C 3M3ZA 3M6GA 3CXCM 1JLBA 2GUIA 2I5JA 4WQ5A 4OX9K 4M3UA 1RBSA 1C1BA 3TARA 4O55A 4EAHD 1RT2A 2Q2RA 3LZJA 4BDZA 2EX3A 3K5OA 3WNHA 1REVA 2ITGA 4B1YB 3CI5A 3H1VX 4FW1A 5B8HA 4FJHA 1IKXA 4IG0A 4FJ8A 3O4QA 2KZMA 3VGLA 4E7LA 4AM6A 1MDUB 3HSTB 3LDQA 5HLFA 3AY9A 4YDUA 3QMLA 1I94K 2D0AA 2CH5A 3CQXA 2Y1JA 1BOTO 4BG8A 1TL1A 1VSKA 1DT9A 3ENOA 3VA0A 3RRGA 3CJ1A 2PYJA 3VEWA 4BVOA 5DM6L 5J1EA 3E9PA 2KW4A 3O3GA 3S41A 4WQ4C 5E26A 3VGKA 2QWOA 4L8RB 3O80A 3ATUA 3FFIA 4H5WA 1KVCA 3C6AA 5EY4A 1Z25A 3LWLA 5CY4A 4DG1A 4FVMA 4DR1K 3HYFA 4JRQA 2BANA 4YOVA 3C7NA 3WNEA 4PKGA 4U7BA 2ASOA 2Q1NA 3TR8A 3SQ0A 2KFZA 2P9LB 5C2FA 2RKIA 4WFAL 5GAGP 3VTIA 1T7PA 2B4JA 1FXXA 1HKGA 3H08A 3T1YK 4GKJK 1KAYA 3HP6A 3DMJA 4CD3A 5BPLA 3E01A 1BISA 4OGEA 3OY9A 2ATQA 3AO5A 2NNWA 3CCMN 5EXWA 4FK4A 3AVNA 3AVJA 1VSDA 4H0XB 2FSJA 3U9ZA 3ZCMA 5E41A 1KAZA 2FBYA 1NU0A 1D5AA 4CW7B 5TKYA 3VF2A 3KK3A 1RGIA 4AHVA 2B6AA 3EE8A 4Z0UA 1HYZA 4BRAA 4R79A 4CZKA 4MLHA 3THWA 3MCAB 3KD1E 3EY1A 3P38A 2G8KA 4NXNK 1BI4A 4FJXA 4IWVA 4CIFA 1S6PA 1C1AA 1NK5A 4LF9K 5GINA 3QLHA 1J54A 4W5OA 4KHPK 1ASVA 2NRXA 2XY7A 1KSPA 4FWLA 1D9DA 1NKCA 2A3ZA 3LWMA 1JLFA 4LF5K 1CZ9A 3LANA 1SL0A 2HHWA 2P9NB 3ZSWA 3ISNC 2ZM6K 1XQSC 2IC3A 4RG8A 1ZBHA 4Z4HA 3CCEN 3ZSOA 4BQLA 4PKHA 4CEEA 3CCRN 4JI1K 1LV5A 1BL3A 4M3YA 3AVGA 4CBUA 3FR0A 4IXCA 4M63C 3VQPA 4Z94A 4AILC 2O8CA 2IAJA 4JS5A 3NGIA 4FWKA 5J2PA 1C0TA 1HNIA 1KLNA 1HJOA 3LP1A 2P9UB 3D6RA 4JI6K 2HMPA 2O4GA 5AQZA 4DCHA 1DLOA 1WLJA 4BRQA 4OO1J 1WSHA 4DTSA 1FK9A 4JRPA 4EZ6A 5SZTA 2OA8A 3MECA 3KWGA 1VAZA 5LY3A 4HUGA 3IAYA 5AQPA 4DTOA 3A5LC 3AA4A 1YIJN 4B3TK 4FWMA 1RBTA 4ZTFA 2ZJRL 5I9EB 2V7YA 2P51A 3VQDA 4AQYK 4JAXA 1GOBA 4PL7A 5LMUK 1S1WA 3D2FA 3L2UA 4DQPA 4CJSA 5FRMA 3LP3A 4EIAA 5JVHL 1FJGK 2A40A 3DXMA 4A5AA 1TKXA 3AGRA 3OHRA 5HL7L 2HHHK 3KK2A 1HYSA 3CD6N 3IDHA 1NK8A 1WSFA 1KXPA 5EVZA 2QWMA 3NF8A 3F5TA 1OH8A 3R9PA 3ENBA 4DR4K 3SBGA 4G1QA 3W3DA 2RN2A 1IBKK 2CGKA 1EXQA 3L2RA 1Q9XA 4ELTA 2A6AA 2Z1IA 1R59O 4QCLA 2A1SA 4DUZK 3BDPA 4YY3K 4BR0A 4DTRA 2KLAA 1UAXA 1YVUA 3ZETA 1E4GT 5C10A 2CGJA 2D0CA 5KPTA 3TI0A 1L3VA 3PV8A 3VQAA 3HO1A 5F1XA 1WN7A 3QDKA 3GL1A 4G9ZA 1V4TA 1B9DA 4X66K 5LJVA 4E7HA 4DR2K 4JLHA 4KH4A 4FWOA 3BF3A 2HW3A 1HNWK 1UWBA 4ISGA 5JLFA 3OW2M 1X9JA 1JLCA 1U47A 4CJFA 4DB3A 1HRHA 3QBXA 5AQGA 3U6FA 5C25A 1JLQA 1GOAA 4CFAA 3SUOA 4CJVA 1S5JA 3HI0A 3CC7N 5JS2A 4CGJA 3KTQA 3AVCA 2WUSA 1QHTA 1XHXA 2E1YA 1DGKN 4RW9A 4KHWA 2DTUA 1Q81O 2GTDA 3NAEA 1BDGA 4O4GA 1RFQA 4JV5K 3U9DA 3HP9A 5BRHA 5J2NA 3C6UA 4BC4A 3P1GA 2E2NA 3RSEB 3R6MA 4QOZB 1VQ4N 2HHQA 5AZJA 2QKKA 4BE2A 5K14A 4HVJA 3DLKA 3QICA 4NYNA 2Q0UA 2RF2A 1KTQA 3C65A 4E1NA 5KTQA 1HJRA 4BACA 2NRWA 3V9XA 3ZEUB 4K43A 1QSSA 1TGOA 3C7NB 3T1AA 5FPEA 4DSJA 4CEZA 3RMDA 1EWQA 3J7ZO 1RDUA 4BRIA 4I9QA 5FPMA 4C1NK 1RTJA 4IO8A 3NVKA 3F73A 4KHYA 3FZHA 4Z4GA 3NHGA 2DY4A 4DTJA 3FFKB 3J7YP 4FYDA 1C0UA 4IFEA 2O8DA 3MEDA 3EEQA 4A61A 4H0VB 2XRIA 1G15A 5EU7A 4NLBA 3VQ5A 4PL8A 3VF6A 5M1OA 2DFHA 1J9AA 4CHPA 5GIOA 1SV5A 3LP0A 3RMBA 4JK8A 3C0BA 4ILGB 4N5SA 3OS1A 5AQNA 4CGFA 1W0HA 3DWLA 1ASWA 4M3WA 4CJEA 4K8ZA 5GADP 4IDKA 4DS4A 1NGIA 3QFUA 3DYAA 3CHWA 4KREA 3BP8A 3LDPA 4IZ9A 4LC9B 3H1QA 1YAGA 3C6HA 5AQYA 3TU5A 1C0FA 2QA4N 4I7FA 1XHZA 1DKGD 3CF5L 1VSIA 5ADXH 3TWHA 4J8FA 1RCHA 3L8BA 4YOUA 1U48A 1JCEA 1GLJO 3VGMA 4CIGA 4FJLA 3T7ZA 3UKUA 3AGKA 2ITMA 4L3QA 4O8UA 4C8MA 4BDPA 3L6QA 1EX4A 3VEZA 2O8CB 1LWCA 4B1ZA 1OH7A 4N56A 1ZBUA 1RDCA 1QZ6A 2Y1IA 3KK7A 4FLYA 3TTFA 3DRRA 3TAMA 3NDKA 2HNDA 4J2BA 5C2DA 3N4PA 3A5MC 3ZYYX 1GLDG 1GLCG 3O9SA 4FWSA 3VQBA 4ELVA 3V1OA 2OPSA 3T69A 3SZ2A 1ITGA 1TK5A 5J2QA 5M1NA 3KZBA 4AHUA 4WF9L 5H1SQ 1K9MO 3LAKA 4DKWA 4DR5K 1UA1A 3KLGA 4C8OA 3HL8A 2JWLA 3N4QA 5CZ1A 4DHYA 2P9PB 3FZKA 4HWIA 2PBDA 4K8XA 4LH5A 3BEXA 2QEXN 3DXMB 1YTUA 4LSLA 5KQ8A 5C15A 4GV6A 4M7XA 5AQUA 1CXUA 4NLCA 3SJHA 2Q3SA 3V81A 4H0OA 5C12A 4A57A 4DSFA 4E3SA 1LW2A 1GLFO 4GVEA 4CGDA 2X74A 2HHTA 1C0MA 4KHNA 4FWPA 4R5PA 3QINA 3ZETB 1K73O 2E2OA 3UIQA 5AR0A 3VQEA 4FM2A 1N34K 3OS0A 3H6EA 4KI6A 3NMUA 1KAXA 3NF6A 3PIPL 3CJAA 2F96A 3WNFA 4FL9A 4I6MA 4DWIA 3MCPA 3ZX2A 4F9OA 5GIPA 1QTMA 1YXQA 4B1XB 1Q8IA 1EP4A 2HNZA 4DQIA 1QQCA 3OYJA 4X62K 1TUUA 1NGAA 4F4KA 3UKRB 3MXJA 4K42A 1Y97A 3EE9A 1JXBA 5KPRA 1VQ9N 4JKEA 3H3OB 5LJWA 4J2DA 4HTUA 5A2QO 4BRKA 3LDLA 1IKVA 3SAHA 1UA0A 4J2AA 3TPQA 3MAQA 4H0PA 4RW6A 3AVKA 3BZCA 3SQ2A 2OPQA 5CHIA 1W7AA 3QEVA 5FPDA 3S9HA 1NJWA 1LCUA 3H3NO 4IKFA 1K8AO 3VENA 4MFBA 1JL2A 3BY5A 4JKDA 4EHTA 3KJVA 1Z05A 2DPNA 1BWFO 4N76A 1LWFA 3E66A 4O44A 4FK0A 4H5RA 4E89A 1L5UA 4BGAA 5JVGL 1ASUA 1U6ZA 2UXCK 3T1HK 1LW0A
chains in the Genus database with same CATH topology
4K25A 3ULEB 3LDOA 1XQSC 1TYQA 3VEYA 3CCEN 1CZAN 4BRNA 3G6EN 4BQLA 4PKHA 3CCRN 1DEJA 4AM7A 3FZLA 3BUZB 3LM2A 1VQ6N 3OBWA 4ISFA 4CBUA 2E20A 3FR0A 4IXCA 1XC3A 4M63C 4BRGA 2YHYA 4Z94A 5AZIA 2EWSA 2NRZA 4FWKA 1O13A 4WQ4A 1HKCA 3D2FB 2QWNA 1Z6RA 4C1NI 1T6DA 2A41A 2VGMA 3D7EO 3A5NC 5AQWA 1YVNA 3SMPA 1HJOA 4JD2B 4BRLA 3CC4N 2P9UB 3D6RA 2P9IB 1QQNA 5BPMA 2WBNA 4BRDA 1NGHA 2HMPA 3VTHA 5AQZA 4DCHA 4BRQA 4BR5A 1YUWA 2QXLA 2BTFA 4BC3A 4OO1J 2D4WA 1U2VA 4JKCA 3PLAA 1ZBSA 2PAVA 3KWGA 3KWIA 3WXKA 4CZIA 3DLLL 1VAZA 2GWJA 5LY3A 4PKIA 2YHWA 3ULEA 4CJ7A 4FWRA 5AQPA 3O5BA 5AQJA 5BR9A 3B8AX 2D0OA 4CD1A 4FVUA 1YIJN 3A5LC 2V7ZA 3E9OA 1KD1O 1NGEA 3U4LA 5BPNA 4FWMA 3WXJA 3GE1A 2I7PA 2V51B 2V52B 3F2KA 3MN5A 4FWQA 2A42A 1D4XA 4MDBA 1VQNN 4CBXA 2ZJRL 2FF6A 3O9TA 2V7YA 5I9EB 2F7TA 4JAXA 3MN9A 5AFUH 1N8RO 4PL7A 2E88A 1X3NA 2VCPA 3D2FA 5AQIA 1OKJA 4H03B 1ILYA 2FSNA 5AQTA 2CH6A 1V4SA 2ZWHA 4AF1A 4EIAA 5JVHL 4CZGA 2A40A 3DXMA 3D2EB 4IDHA 2P9UA 4WFNL 2P9IA 2YI1A 4A5AA 2IVNA 3CCJN 3AGRA 3OHRA 2ASPA 3O4WA 5HL7L 2IVOA 3R3LA 3EKSA 4GV9A 4NO7A 2QWLA 1KC8O 4BRCA 3CD6N 3IDHA 5F2RA 4IEIA 1BO5O 2QWPA 3HZ6A 3SBTA 4U67L 2P9SA 3VETA 2F9TA 1KXPA 1W97L 5EVZA 2QWMA 4WYBA 2GEMA 5MLCQ 4WFBL 2NLXA 3EL2A 1Q7YO 3CJ9A 3F5TA 4H0YB 3A8YA 2KKZA 3R9PA 3ENBA 4CBWA 4YOWA 3ATVA 3SBGA 1ZC6A 2W41A 5TKWA 3TSUA 3W3DA 3WQTA 4BRHA 2CGKA 1BA1A 4BROA 3LM9A 2A6AA 2W40A 2HOEA 4E1JA 5CR4A 2NRRA 4FSVA 1R59O 3I56N 2D0PA 3CERA 3O9UA 3CIPA 3O9RA 5DM7L 2IIRA 3NVMA 3SLCA 4BR0A 4DQ8A 2HBKA 2KLAA 3ZETA 4CZEA 4FWNA 1E4GT 4WCEL 2YCHA 3FLCO 5C10A 3KVGA 4A5BA 1VQPN 1IJJA 2CGJA 3D2EA 3VERA 3WT0A 4NB4A 5KPTA 3SAGA 2ZF5O 3WXLA 3CMAN 5F1XA 5M1QA 3EN9A 5M1FA 3QDKA 3AAPA 3GL1A 4G9ZA 1V4TA 3CCUN 4YORA 5LJVA 2JWKA 4YOTA 1VQON 3UB5A 4KH4A 5AQVA 2HF3A 4B1WB 4QS7A 4BRMA 4FWOA 2NRVA 3BF3A 3O8MA 3OA9A 3O08A 3TTCA 2P9KA 4ISGA 5JLFA 1ATSA 1SAZA 1J6ZA 3HTVA 5AQSA 3OW2M 1NM1A 1HX1A 1X9JA 3WEEB 1ATRA 5EX5A 2QWRA 4CI6A 3HM8A 3QB0A 5AZJB 4DB3A 3QBXA 2QWQA 5AQGA 2YX6A 3CCSN 5FPNA 3DXKA 4BR7A 3CCQN 1X3MA 4JN4A 3E9LA 5M1KA 3FGUA 4BGBA 4IEEA 3ID8A 1QVFM 1S22A 1YJWN 4KH5A 2UYTA 4H5NA 3HI0A 3CC7N 1EQYA 4PHTX 3EZWA 1WOQA 1S3XA 4BRFA 2WUSA 2E1YA 2OTLN 1DGKN 3W0LA 1Q81O 2GTDA 1GLLO 2Q0RA 4IOCL 4JEPA 3GDQA 4BRPA 4JKAA 1BDGA 4BREA 1YJ9N 4JHDB 4XH4A 3CJ7A 3VEOA 1RFQA 1QQMA 4JK9A 3U9DA 5BRHA 2HSTA 1ZXOA 3VF4A 4MO5A 4BC4A 1QVGM 2E2NA 3RSEB 3O6WA 4FO0A 3R6MA 3CPEA 3MK6A 1HLUA 1VQ4N 4B1UB 1MWKA 5AZJA 2P9NA 3LDNA 4CZMA 3K9KA 3QICA 3CETA 3P39A 3WQUA 3WUHA 1VQKN 1NGJA 2Q0UA 1NGFA 3C65A 4OPAA 2NRTA 1YITN 3GOIA 2NRWA 3ZEUB 4K43A 3L4IA 3QBWA 2VWBA 4K41A 2HBMA 3C7NB 3IMXA 2QI2A 2E2QA 4JNEA 5AQQA 4UY8O 5FPEA 5HOOA 4I6MB 3J7ZO 1RDUA 4BRIA 3EKUA 2BH1A 4ILHA 2YHXA 4H5VA 3J8AA 5FPMA 4C1NK 4IO8A 3NVKA 4JD2A 1NLVA 3FZHA 3VPZA 4WQ5C 5AFUA 3HOSA 3P4IA 5KPZA 3HSCA 5M1PA 3RSEA 2QM1A 3FFKB 4XEIA 5AQKA 3RVCA 3F9MA 3U8XA 1VQ7N 4MLEA 4IJAA 4IJNA 4O8KA 4OPHA 4MO4A 3R1XA 4IFEA 2AA4A 4JKHA 2FF3B 3VMFB 4A61A 1MA9B 4H0VB 1GLBG 5E84A 3KHYA 3QFPA 3G4SN 1W2BM 4NLBA 4FOIA 4A62A 4PL8A 3VF6A 5M1OA 1MWMA 1NGBA 2ZJQL 1XUPO 2KHOA 5BRFA 1NBWA 4ISEA 4BC2A 1LOTB 5GIOA 1YJNN 3MDQA 4JK8A 3UKUB 3C0BA 3MX2A 4ILGB 3MWPA 2GUPA 3CPWM 4IO9L 5AQNA 3ZEUA 4YDUC 4CZLA 2E1ZA 4M7YA 3DWLA 5AQFA 3WXMB 1ATNA 1BA0A 3DAWA 3P31A 1QQOA 1C0GA 5GADP 3CMEN 5ELZA 5BRDA 1NGIA 3VESA 1NGDA 3QFUA 1QHAA 3CHWA 3FZFA 2RHKA 3BP8A 3LDPA 2FLOA 4IZ9A 4LC9B 3H1QA 1YAGA 3C6HA 5AQYA 3VOVA 4GV3A 3CCLN 3TU5A 1C0FA 1IG8A 4IOAL 4FPBA 4BQZA 2QA4N 3I8BA 4JKGB 5BN9A 1DKGD 5CE3A 3CF5L 5ADXH 3EO3A 2F9WA 3CJCA 1BG3A 2Q97A 4J8FA 4YOUA 3VEVA 3I55N 2Q31A 3DJCA 1HUXA 2RE2A 1JCEA 1GLJO 1GLEG 1KQSM 1TYQB 3VGMA 2FSKA 3T7ZA 3E1YA 2GWKA 1NMDA 1JCFA 3UKUA 3AGKA 2ITMA 5GAEP 4L3QA 4O8UA 5AZIB 1P90A 2HF4A 3L6QA 1NJIO 3MWTA 2WFBA 1G99A 3VEZA 4GY2B 3LL3A 4B1ZA 5BN8A 3A0IX 3CJBA 2E8AA 5C0YA 3ENHA 2I7NA 1NGGA 3SAFA 1NGCA 3M5RA 4C23A 1Q86O 3IFRA 1VQ5N 1QZ6A 3KK7A 3AARA 3TTFA 1K8KB 3L4QA 3UE5A 2QW9A 3GG4A 3I33A 2ZGZA 2HBLA 5C2DA 1U2VB 4JKGA 3N4PA 1SQKA 3A5MC 3ZYYX 5GAHP 1GLDG 1GLCG 2ZGYA 2AP1A 3Q7CA 3PIOL 3G25A 2HBJA 1JCGA 3AAQA 3O9SA 4FWSA 3WXIA 4A2BA 1ESVA 4BG9A 3L0QA 4JKBA 3TTDA 1GLAG 3H46O 5KQDA 3TSPA 3VEXA 4Y0WA 3MN6A 4BY9C 3M3ZA 3M6GA 3CXCM 3T69A 5AQMA 4WQ5A 2H3GX 4KBOA 3WEEA 5JLHA 5M1NA 3KZBA 4RCHA 4WF9L 5H1SQ 1K9MO 4DKWA 2D1KA 4EAHD 2JWLA 5AQRA 3K9JA 1T6CA 2Q2RA 3N4QA 4GNIA 3CCVN 1VQ8N 2ZJPL 2IVPA 1JJ2M 2WC9A 4DHYA 2P9PB 4EFHA 3FZMA 3FZKA 4HWIA 4HTLA 3CI5A 3H1VX 2PBDA 4B1YB 4ILJA 3ZX0A 3BEXA 4YOYA 2CGLA 1TUYA 2ASMA 5B8HA 3A5OC 3DXMB 2NRHA 2QEXN 1HKBA 3CQYA 2YJEA 3VGLA 1K8KA 5KQ8A 3OBYA 3TSQA 5C15A 4AM6A 4GV6A 1MDUB 3LDQA 3H45C 4M7XA 5AQUA 3AY9A 1QZ5A 4NLCA 4YDUA 3G71N 3SJHA 3QMLA 4CZJA 4A2AA 3O1BA 2CH5A 1Q18A 3CQXA 4CZHA 1NWKA 2P9SB 3M1FA 4H0OA 4BC5A 5C12A 1BOTO 5AQLA 4BG8A 2NZTA 5AQOA 4A57A 4A59A 4FOEA 4KH6A 4JHDA 1E4FT 3R8EA 5BREA 1DT9A 1P8ZA 1WUAA 1SS6A 3BF1A 3ENOA 4YOXA 2E2PA 1YF5L 3CJ1A 4XH5A 3VEWA 1GLFO 4GVEA 4RTFD 4EHUA 2GELA 3GBTA 4JKFA 4BVOA 5DM6L 3E9PA 1H1VA 3S41A 4WQ4C 4FWPA 5E26A 3VGKA 2QWOA 3O80A 3ATUA 2GX9A 2P9PA 4H5WA 3ZETB 1K73O 2E2OA 2OANA 3C6AA 5EY4A 2PFUA 5AR0A 4BR9A 3H6EA 4BR2A 5EOYA 1S72N 4YOVA 3C7NA 3NMUA 1KAXA 5JMVA 4PKGA 3PIPL 3CJAA 1T3VA 3JXUA 4U7BA 2ASOA 2QTDA 2Q1NA 4FL9A 4I6MA 3MCPA 2A5XA 3O9QA 4JK7A 2P9LB 5C2FA 4WFAL 1Q82O 4RWTA 2BUPA 3ZX2A 5GAGP 3HRGA 4F9OA 5GIPA 3FE1A 1HPMA 3VTIA 1HKGA 1YXQA 5F0XA 4B1XB 5JICA 1KAYA 1M90O 2OTJN 1YI2N 4CD3A 2P9KB 5BPLA 4XH1A 5AQXA 1TUUA 3SMSA 1VQLN 4IOXA 1NGAA 3SK3A 2NNWA 3CCMN 4QS8A 5EXWA 3UKRB 4O5FA 4K42A 1YHQN 4H0TB 3EE9A 1T44A 2FSJA 4H0XB 3U9ZA 3Q7BA 3ID6A 5KPRA 1M1KO 1VQ9N 1KAZA 4JKEA 3H3OB 3ZX3A 5LJWA 1BU6O 5TKYA 3DXKB 4QS9A 3VF2A 2VYPA 1RGIA 3JS6A 3HOTA 3EE8A 4BRKA 3LDLA 4BRAA 4R79A 4BVPA 5ADXA 3SAHA 4CZKA 1SZ2A 4MLHA 5AQHA 4H0PA 3TPQA 3HBTA 3MCAB 1RDWX 3P38A 2Q36A 5CHIA 3MX5A 2FXUA 5FPDA 2VGNA 4IWVA 4H5TA 1LCUA 3H3NO 3CC2N 2P9LA 1K8AO 4BR4A 4MDAA 3VENA 1BUPA 3IKMA 4JKDA 5GINA 1EO1A 3MMVA 4EHTA 1Z05A 2DPNA 1BWFO 1OVYA 2NRXA 4FWLA 3E66A 3O1WA 4CZFA 3MN7A 2A3ZA 4B9QA 3IUCA 3UKRA 4H5RA 4BGAA 5JVGL 1VQMN 2P9NB 1U6ZA 1Y64A 2YJFA 4FPAA 2J4RA 4B1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IEI A;  5C15 A;  3CPE A;  5C2F A;  4IEE A;  5M1N A;  5C10 A;  3C6H A;  5M1O A;  5C12 A;  4IFE A;  4IDH A;  5M1Q A;  5M1P A;  5M1F A;  5C2D A;  3C6A A;  5M1K A; 
#chains in the Genus database with same CATH topology
 5CYQ A;  3ULE B;  4AH9 A;  4F2S A;  3G6E N;  1NG9 A;  2IDO A;  3PX0 A;  1DEJ A;  4PWD A;  3FZL A;  3BUZ B;  3LM2 A;  1VQ6 N;  3OBW A;  4ISF A;  2E20 A;  4H4M A;  5AZI A;  4DSK A;  4JI4 K;  4KTW A;  2EWS A;  4KHS A;  2NRZ A;  2JGU A;  4CIE A;  1O13 A;  4CJ3 A;  4F3O A;  2VG5 A;  4CJL A;  4M45 A;  3D7E O;  4M3T A;  3A5N C;  3CC4 N;  4BRL A;  1VSF A;  4CJ5 A;  2WBN A;  4BRD A;  1NGH A;  3HVT A;  3VTH A;  4CGI A;  3TAB A;  3L3V A;  3SUP A;  3THY A;  4H8K A;  1GOC A;  3DRS A;  2Z1J A;  1NJX A;  3WXK A;  3DLL L;  4DV5 K;  2GWJ A;  1BCO A;  4FWR A;  5AQJ A;  4FJG A;  3B8A X;  2D0O A;  4CD1 A;  4FVU A;  4KB1 A;  2V7Z A;  3NE6 A;  1NGE A;  1KD1 O;  5BPN A;  1VSH A;  3WXJ A;  4DUY K;  1NKE A;  5SWM A;  4DFJ A;  4F8R A;  2V51 B;  2KQ2 A;  1CXQ A;  1D4X A;  1VQN N;  4C8K A;  2FF6 A;  3O9T A;  3MN9 A;  5AFU H;  1N8R O;  3C94 A;  2HHX A;  5AQI A;  1X3N A;  3J80 O;  1T03 A;  1OKJ A;  1UOC A;  3DI6 A;  5AQT A;  2ZWH A;  4IDH A;  2P9I A;  4DR7 K;  2HHV A;  2P5O A;  3O4W A;  4DSE A;  3SJJ A;  4GV9 A;  4IEI A;  1BO5 O;  2QWP A;  3HZ6 A;  1EET A;  4U67 L;  2P9S A;  4WYB A;  4FLZ A;  2GEM A;  1X9S A;  1IBL K;  4NYF A;  3CFP A;  3CJ9 A;  4IBN A;  3DOL A;  4LF7 K;  4CBW A;  3V9Z A;  2RPI A;  3KKS A;  1ZC6 A;  1IG9 A;  3TSU A;  1BA1 A;  4JI2 K;  2UUA K;  2HOE A;  2NRR A;  4KHU A;  1S1U A;  3CIP A;  3LAL A;  5DM7 L;  4O5B A;  4B9V A;  3JSM A;  4KTZ A;  1HMV A;  3D2E A;  3WT0 A;  3L3U A;  2UU9 K;  2ZF5 O;  3WXL A;  1S6Q A;  2G8F A;  5M1F A;  4M3X A;  2G8W A;  1MU2 A;  4B1W B;  4QS7 A;  3TTC A;  2HVH A;  2P9K A;  1SAZ A;  1VSE A;  1J6Z A;  3HTV A;  3IRX A;  4CEA A;  4DR3 K;  3SQ4 A;  2FBX A;  2EHG A;  3CG7 A;  4CI6 A;  3HM8 A;  3L2W A;  4RW8 A;  3J81 O;  4M42 A;  1WAF A;  4ID5 A;  1BHL A;  2UUC K;  1RT3 A;  2OZM A;  1HPZ A;  3ULD A;  3DXK A;  4NCB A;  3SCX A;  5D3G A;  1C6V A;  5M1K A;  1RT5 A;  3FGU A;  4BGB A;  4IEE A;  3ID8 A;  4DV7 K;  1S22 A;  4KH5 A;  2PYL A;  2UYT A;  1SKR A;  4H5N A;  4PHT X;  1S3X A;  4BRF A;  3OS2 A;  4F2R A;  3NGZ A;  2OTL N;  4DTN A;  4FXD A;  1GLL O;  1TKZ A;  2Q0R A;  3CFR A;  2D0B A;  2YHA A;  4OLA A;  4XH4 A;  4CF9 A;  2E6M A;  4JK9 A;  4B9N A;  3VF4 A;  3VN5 A;  3CM5 A;  3O6W A;  4FO0 A;  3KIO A;  3VQ4 A;  2XY6 A;  3TAE A;  1TKT A;  3K9K A;  4CJP A;  3WQU A;  3WUH A;  4LFA K;  3AO4 A;  3O3H A;  1NGF A;  3BGR A;  3AO1 A;  4DQS A;  4I2Q A;  3GOI A;  3LPT A;  4DV2 K;  3L4I A;  3QBW A;  5HRS A;  2VWB A;  3IMX A;  2E6L A;  2QI2 A;  2E2Q A;  4DU3 A;  1VHX A;  4I6M B;  1WSE A;  3D0P A;  2BH1 A;  4ILH A;  2YHX A;  4H5V A;  3PY8 A;  1WSG A;  1RT4 A;  4QAG A;  4WQ5 C;  3HOS A;  5KPZ A;  3HSC A;  1BGX T;  2QM1 A;  4XEI A;  3F9M A;  4IJN A;  3OYD A;  4O8K A;  4OPH A;  1LWE A;  1MA9 B;  1T8E A;  5E84 A;  3L2V A;  4V19 S;  2O4I A;  2F8S A;  1XUP O;  1RT1 A;  1LOT B;  4KAZ A;  3AVL A;  4DSI A;  4YDU C;  2E1Z A;  3HPG A;  5AQF A;  3HXM A;  4DF8 A;  2D5R A;  1ATN A;  1VSM A;  1BA0 A;  1SKS A;  4B9S A;  1QQO A;  1WAJ A;  4DV3 K;  2G8H A;  4E0D A;  3CME N;  5ELZ A;  1NGD A;  3FZF A;  1BIU A;  2ETJ A;  4GV3 A;  4FCY A;  4JKG B;  5KGX A;  4KHQ A;  3VEV A;  1BG3 A;  1CZB A;  3AVA A;  3ZT0 A;  1EKE A;  3I55 N;  1HUX A;  4LFB K;  4B3S K;  1KQS M;  2FSK A;  2VWK A;  1NMD A;  1KRP A;  5GAE P;  3TAF A;  5AZI B;  3OYL A;  2HB5 A;  1NJI O;  5HRN A;  1G99 A;  1S1X A;  2XHB A;  4GY2 B;  3ALY A;  4DMN A;  1BQM A;  5BN8 A;  2I7N A;  1NGG A;  4DSL A;  4CF8 A;  3S3N A;  1BCM A;  4C23 A;  3OYG A;  2PZS A;  3TAQ A;  1VQ5 N;  4CK1 A;  3K0S A;  2OPP A;  4HCC A;  2HBL A;  3THY B;  3SI6 A;  1X1P A;  4PUO A;  4M3R A;  2AP1 A;  1KVB A;  4A2B A;  5BPM A;  3WXI A;  5KQD A;  3VEX A;  4IFY A;  3MN6 A;  3PSI A;  5AQM A;  2H3G X;  5CZ2 A;  3WEE A;  4RCH A;  1LAV A;  4CEB A;  4GW6 A;  2D1K A;  3ZSQ A;  1TVR A;  4CJK A;  5HRP A;  4J2E A;  3K9J A;  1XWL A;  2ZJP L;  4M3Z A;  4EFH A;  1IV0 A;  4PA1 A;  1S9E A;  3ZX0 A;  4YOY A;  2CGL A;  1TUY A;  2NRH A;  2YJE A;  1K8K A;  3OBY A;  3TSQ A;  3G0Z A;  4MQ3 A;  4CK2 A;  1QZ5 A;  3KLH A;  1D8Y A;  2FBT A;  2X6N A;  4CZJ A;  3O1B A;  4O0I A;  1Q18 A;  2QKB A;  4E7J A;  2P9S B;  4BC5 A;  3OYN A;  3RRH A;  5AQL A;  5AQO A;  4A59 A;  4W5Q A;  4FOE A;  4KH6 A;  4JHD A;  4DV0 K;  5BRE A;  2G8I A;  1SS6 A;  3BF1 A;  3RTV A;  4YOX A;  2W42 A;  4XH5 A;  2R7Y A;  3GBT A;  3P83 D;  3AA5 X;  4B08 A;  2GX9 A;  2P1J A;  4YNQ A;  3I8D A;  2Z1G A;  2OAN A;  3L2Q A;  1RTD A;  1A5W A;  3THW B;  3AVM A;  1RBR A;  3SUQ A;  4BR2 A;  5EOY A;  1BI4 B;  5JMV A;  3JXU A;  1TAU A;  3ZSX A;  2QTD A;  5C42 A;  3O9Q A;  2A5X A;  1Q82 O;  4OPJ A;  4RWT A;  3FE1 A;  3M8R A;  5JS1 A;  1QSY A;  2OTJ N;  3AO2 A;  2P9K B;  1A5X A;  2W6L A;  4XH1 A;  3AO3 A;  3M8Q A;  1NK9 A;  4QS8 A;  3AA3 A;  1YHQ N;  4H0T B;  1T44 A;  3Q7B A;  3ID6 A;  2OPR A;  2HVI A;  1RBV A;  3DXK B;  4QS9 A;  3HOT A;  2VYP A;  4JI8 K;  2ZD1 A;  4CHN A;  3S3O A;  5ADX A;  3HBT A;  3QEP A;  1RDW X;  4B9T A;  5KRT A;  3NH2 A;  5C24 A;  4C8L A;  4O0J A;  3RR7 A;  4FLX A;  1NJY A;  4PQU A;  3DLH A;  3QIO A;  2XY5 A;  4KV8 A;  2P9L A;  1OH5 A;  4BR4 A;  3V9U A;  1BUP A;  3IKM A;  1RTI A;  3MMV A;  3AV9 A;  1OVY A;  4FJJ A;  3O1W A;  4CZF A;  5LMN K;  4HUF A;  4DTU A;  1VQM N;  2YJF A;  5T7B A;  2J4R A;  4N41 A;  3IS9 A;  1RIL A;  1TYQ A;  3KKR A;  4CHY A;  4AM7 A;  1S1T A;  1ZBL A;  4FJ7 A;  3C6T A;  4DLG A;  1OH6 A;  1F21 A;  3IG1 A;  4FJN A;  4DS5 A;  4ICL A;  1B92 A;  4CJR A;  3SV3 A;  4DV6 K;  4WQ4 A;  1HKC A;  1U49 A;  3D2F B;  3A2F A;  3NBP A;  1Z6R A;  4C1N I;  1KFD A;  3ZSR A;  2A41 A;  2VGM A;  2F8T A;  1QQN A;  4ZHR A;  4CEQ A;  4Y1C A;  4DV1 K;  3V4I A;  4E7I A;  1YUW A;  3VQ6 A;  4BC3 A;  2D4W A;  1U2V A;  4GKK K;  3VA3 A;  3PLA A;  4K0K K;  3CFO A;  4CZI A;  3QNO A;  4PKI A;  2YHW A;  2FBV A;  5BR9 A;  1NK6 A;  4DTX A;  1NK7 A;  3DLE A;  1XC9 A;  4BDY A;  3GE1 A;  2I7P A;  3NH1 A;  1KFS A;  2V52 B;  3DLB A;  3F2K A;  3MN5 A;  2A42 A;  4KI4 A;  2F7T A;  1WB9 A;  4H03 B;  1FW6 A;  1ILY A;  2FSN A;  2CH6 A;  1V4S A;  5I42 A;  4FZY A;  1NOZ A;  2P9U A;  4WFN L;  4JI0 K;  2ASP A;  3K5M A;  3R3L A;  2O8F A;  3EKS A;  1KLM A;  4NO7 A;  3RMA A;  2QWL A;  3ASM A;  4PY5 A;  3VET A;  3B6P A;  4DFK A;  2F9T A;  1W97 L;  1WNS A;  1Q7Y O;  5MLC Q;  4AHC A;  3EL2 A;  3DOK A;  3A8Y A;  2YKN A;  4C8N A;  4KRF A;  3M8S A;  2YNH A;  4HUE A;  1VSJ A;  5HRO A;  2KTQ A;  2W41 A;  4BRH A;  3S3M A;  2O8E A;  4BRO A;  2W40 A;  4OVL A;  4OKJ A;  5CR4 A;  5FRO A;  4E1J A;  4FSV A;  2D0P A;  3NVM A;  3SLC A;  1L3T A;  4DQ8 A;  1L3S A;  2XY8 A;  2HBK A;  3TAP A;  1NK4 A;  4HCB A;  4CGG A;  3FLC O;  3KVG A;  4OJR A;  4OKK A;  1SUQ A;  3VER A;  4NB4 A;  4WE1 A;  3SAG A;  3OYA A;  4X65 K;  3RMC A;  5M1Q A;  3CCU N;  4YOR A;  4JYA K;  2JWK A;  3V6D A;  3ZT4 A;  3UB5 A;  3LPU A;  5AQV A;  1O1W A;  2HF3 A;  4BRM A;  2GBZ A;  2NRV A;  3OA9 A;  3O08 A;  1I3A A;  3PX6 A;  1NM1 A;  1HX1 A;  4DQR A;  3WEE B;  5EX5 A;  3HT3 A;  1B9F A;  3NGY A;  3QB0 A;  5AZJ B;  2QWQ A;  4YFU A;  1NJZ A;  4W5N A;  3MEE A;  4BR7 A;  3CCQ N;  3NCI A;  5IT9 O;  2HMI A;  4CFB A;  3T19 A;  3DRP A;  1J53 A;  1EQY A;  1WSI A;  3EZW A;  1WOQ A;  1FKP A;  3SUN A;  4FM0 A;  3W0L A;  1DTQ A;  4JEP A;  1YJ9 N;  4JKA A;  4JHD B;  3CJ7 A;  3HPH A;  3OJU A;  4CF2 A;  2HST A;  1QVG M;  2P5G A;  4ZTJ A;  3CPE A;  3ZSZ A;  4B1U B;  1MWK A;  1SKW A;  2KZZ A;  2O8D B;  4NCA A;  4CZM A;  3OYF A;  3CET A;  3P39 A;  1D9F A;  1VQK N;  1NGJ A;  3I0S A;  4XIU A;  5HP1 A;  4DF4 A;  5AQQ A;  4OLB A;  5HOO A;  1U04 A;  3OYB A;  1JL1 A;  3EKU A;  1HNV A;  1X9W A;  5FDL A;  3K5L A;  4F3T A;  3HVR A;  2UXB K;  4FW2 A;  4JD2 A;  1NLV A;  1U45 A;  3VPZ A;  5AFU A;  2FC0 A;  3P4I A;  1N32 K;  4M41 A;  3OYI A;  4KTQ A;  4RW7 A;  5M1P A;  3RSE A;  3RVC A;  5CYM A;  3U8X A;  5AQK A;  5LL6 Z;  4IJA A;  3R1X A;  2AA4 A;  4JKH A;  3OJS A;  4DFP A;  1W2B M;  3G4S N;  3KHY A;  3QFP A;  4Z4E A;  3VQ7 A;  1ZBI A;  4A62 A;  4CED A;  1MWM A;  2ZJQ L;  2OZS A;  5BRF A;  1YJN N;  2Z1H A;  3MDQ A;  4CJU A;  4Z4I A;  3UKU B;  4CER A;  3O3F A;  3MWP A;  3CPW M;  3ZEU A;  4CZL A;  1I39 A;  2BE2 A;  2E5L K;  3WXM B;  1NMN A;  3SQ1 A;  1C0G A;  4FJM A;  1KVA A;  5BRD A;  3VES A;  4FJ9 A;  2FLO A;  3AA2 A;  3VOV A;  3CCL N;  1IKW A;  4IOA L;  4BQZ A;  3K57 A;  5BN9 A;  5CE3 A;  3EO3 A;  2Q97 A;  2A1R A;  1GLE G;  1FKO A;  1TYQ B;  3V9W A;  4CJT A;  1JCF A;  4CVN E;  3K5N A;  3TAN A;  2HF4 A;  3AVI A;  3CM6 A;  3V9S A;  2WFB A;  2X6S A;  3A0I X;  2YNG A;  2E8A A;  3CJB A;  5C0Y A;  1VRT A;  3ENH A;  3NF9 A;  3HPO A;  4Q0B A;  3ZSV A;  3JAM O;  1NGC A;  3M5R A;  3IFR A;  1ZYQ A;  3EZ5 A;  2XO7 A;  3UE5 A;  2QW9 A;  3I33 A;  2ZGZ A;  5J2M A;  2NUB A;  4BWM A;  1U2V B;  3CYM A;  4B3O A;  1SQK A;  5KGW A;  2ZGY A;  3Q7C A;  2HBJ A;  4EP5 A;  1JCG A;  3AVF A;  3I56 N;  3V1R A;  4JKB A;  3TSP A;  4Y0W A;  1C1C A;  2AJQ A;  2HHU A;  4KBO A;  4AHS A;  5JLH A;  1KCF A;  1XNR K;  4BE1 A;  4CEO A;  5AQR A;  1N5Y A;  1DTT A;  1T6C A;  5KI6 A;  3CCV N;  4GNI A;  2PY5 A;  1VQ8 N;  4JI7 K;  4DTM A;  2KFN A;  1T05 A;  2IVP A;  1JJ2 M;  2WC9 A;  3FZM A;  4HTL A;  3ITH A;  4CK3 A;  4ILJ A;  4FLW A;  1XI1 A;  2ASM A;  3A5O C;  4CF1 A;  3KLE A;  3U3Y A;  1HKB A;  3CQY A;  2ZE2 A;  4DFM A;  3K2P A;  3G10 A;  2O8F B;  3H45 C;  3G71 N;  2YV0 X;  4A2A A;  4CZH A;  1NWK A;  3M1F A;  3PO4 A;  4I9L A;  2NZT A;  2G8V A;  3RWU A;  2QK9 A;  5DMR A;  4CEF A;  1E4F T;  3R8E A;  3NFA A;  4CFD A;  4X64 K;  3LP2 A;  1P8Z A;  1WUA A;  3VQC A;  2E2P A;  1YF5 L;  2O8E B;  4CES A;  4RTF D;  4EHU A;  2GEL A;  4JKF A;  4B3M K;  1H1V A;  5HRR A;  4FM1 A;  4GMJ B;  4Q5V A;  3THV A;  4BWJ A;  1U4B A;  3F9K A;  2P9P A;  1YT3 A;  2PFU A;  4BR9 A;  1W9H A;  2F4V K;  1QS4 A;  4AHR A;  4E1M A;  1S72 N;  1T3V A;  4JK7 A;  3ZT2 A;  2BUP A;  3HRG A;  1HPM A;  5JIC A;  5F0X A;  3QEW A;  1M90 O;  1YI2 N;  5AQX A;  1IBM K;  3SMS A;  1VQL N;  2ZQB A;  2DFF A;  4IOX A;  3PO5 A;  1RT7 A;  3NH0 A;  3SK3 A;  3QES A;  1IO2 A;  4O5F A;  1RNH A;  1M1K O;  2IOC A;  4CHO A;  3ZX3 A;  1BU6 O;  3LDS A;  3JS6 A;  4DR6 K;  4BVP A;  2VG7 A;  4ELU A;  3QEI A;  1SZ2 A;  5AQH A;  1TKD A;  1Z26 A;  4GVM A;  3KK1 A;  2Q36 A;  4JS4 A;  3MX5 A;  2FXU A;  2VGN A;  4H5T A;  1XMO K;  1S1V A;  1RDA A;  3CC2 N;  1HQE A;  4FLU A;  1IH7 A;  2B5J A;  1TV6 A;  4MDA A;  1HYV A;  1EO1 A;  4B3R K;  4RW4 A;  5FRN A;  4CE9 A;  3K58 A;  2UUB K;  3U3G A;  3MN7 A;  4B9Q A;  1JKH A;  3B6O A;  3IUC A;  3UKR A;  2QXF A;  4B9U A;  3MXI A;  1Y64 A;  2E4L A;  4FPA A;  4B1V A;  3V1Q A;  4K25 A;  3LDO A;  3SYZ A;  3VEY A;  2WTU A;  1CZA N;  4BRN A;  4LFC K;  2OYQ A;  1ZBF A;  1XC3 A;  4BRG A;  2YHY A;  1XMQ K;  2O8B A;  1QSL A;  3THX A;  2JLE A;  4CCH A;  2QWN A;  4EP4 A;  4DTP A;  1T6D A;  5AQW A;  3SMP A;  1YVN A;  2YNI A;  4JD2 B;  2P9I B;  1SL1 A;  4BR5 A;  2QXL A;  4B8C A;  2BTF A;  5FLX O;  4E19 A;  2G8U A;  1WSJ A;  4JKC A;  4FJI A;  1ZBS A;  2PAV A;  3KWI A;  3PSF A;  4CJQ A;  3ULE A;  4CJ7 A;  4N47 A;  3O5B A;  1LAW A;  4LH4 A;  3E9O A;  3OYM A;  3U4L A;  2UXD K;  3K59 A;  4FWQ A;  3I0R A;  3QEX A;  1TAQ A;  4MDB A;  4CBX A;  1E3M A;  1HNZ K;  2E88 A;  2VCP A;  1BIZ A;  1HNX K;  3AVH A;  3QER A;  4AF1 A;  3QNN A;  3QO9 A;  4CZG A;  2WOM A;  2VQE K;  3D2E B;  1X9M A;  2YI1 A;  2HHS A;  2IVN A;  3CCJ N;  1Q9Y A;  4CJ4 A;  1IKY A;  2IVO A;  3KLI A;  1KC8 O;  4BRC A;  4CEC A;  3OYC A;  5F2R A;  2VWJ A;  3RR8 A;  3SBT A;  4CGH A;  3ZLJ A;  4DU4 A;  4WFB L;  2NLX A;  1J5O A;  4H0Y B;  3VQQ A;  2KKZ A;  4YOW A;  3OYE A;  3ATV A;  2VQF K;  3DLR A;  1RDB A;  5TKW A;  3NF7 A;  2X78 A;  3WQT A;  1NOY A;  3LM9 A;  4I2P A;  4TSX A;  4W5R A;  3VQ8 A;  1HR0 K;  3CER A;  3O9U A;  3O9R A;  4BE0 A;  2IIR A;  4LF8 K;  4CZE A;  4FWN A;  4CF0 A;  4WCE L;  4FLV A;  2YCH A;  1VQP N;  4A5B A;  4DQQ A;  1IJJ A;  3KLF A;  4EZ9 A;  4FJ5 A;  1EWR A;  4LF6 K;  1QE1 A;  3QET A;  1CLQ A;  1SL2 A;  3CMA N;  3EYZ A;  3EN9 A;  3AAP A;  4YOT A;  5BR8 K;  1VQO N;  4KB0 A;  1VSL A;  2WON A;  1N6Q A;  3O8M A;  1ATS A;  3PUF A;  5AQS A;  1NK0 A;  3O4N A;  1ATR A;  2QWR A;  4JI3 K;  4NXM K;  1WBD A;  3CCS N;  2YX6 A;  1VRU A;  4UQG A;  4W5T A;  5FPN A;  1JXE A;  1BQN A;  4FJK A;  2BDP A;  3BZK A;  1X3M A;  4JN4 A;  3E9L A;  4Z4C A;  1QVF M;  1YJW N;  4ID1 A;  4KKO A;  1J5E K;  5HBM A;  3SV4 A;  4IFV A;  3TAG A;  3SNN A;  2YHB A;  4IOC L;  3GDQ A;  4BRP A;  4BRE A;  1N33 K;  4LD0 A;  4OGC A;  3VEO A;  1QQM A;  4FZX C;  1ZXO A;  2BGG A;  4MO5 A;  4Y1D A;  3MK6 A;  4OPK A;  1HLU A;  4KPY A;  2YNF A;  4CFC A;  1VK0 A;  2P9N A;  4LF4 K;  3LDN A;  4FK2 A;  3ZSY A;  3AVB A;  4FZZ A;  1RTH A;  3OYK A;  4OPA A;  2NRT A;  3P5J A;  4Z4F A;  1YIT N;  3J7A P;  5DK5 A;  3CQ8 A;  3T3F A;  1XNQ K;  4K41 A;  2HBM A;  4JNE A;  4E7K A;  3DLG A;  4UY8 O;  1RT6 A;  3ZT3 A;  4B9L A;  4KO0 A;  1HQU A;  2IGI A;  4HHT A;  4DLE A;  1TL3 A;  1L3U A;  3J8A A;  4NCG A;  3HJF A;  4DV4 K;  3ZT1 A;  5KRS A;  1VQ7 N;  4MLE A;  1S9G A;  4MO4 A;  3VMF B;  2FF3 B;  2HNY A;  5I3U A;  1GLB G;  4LY7 A;  1R0A A;  4FOI A;  4B8A B;  1N36 K;  1NGB A;  4H4O A;  2KHO A;  1NBW A;  4ISE A;  4BC2 A;  1OVQ A;  1YTA A;  2YKM A;  3WNG A;  3SPY A;  3LZI A;  2OCE A;  3MX2 A;  2GUP A;  3MXM A;  2GV9 A;  4IO9 L;  3QIP A;  3D45 A;  1RDD A;  4M7Y A;  1K6Y A;  3VQ9 A;  1JLE A;  2IS3 A;  3DAW A;  3P31 A;  4LSN A;  4AHT A;  3C95 A;  4DU1 A;  1QHA A;  1JLG A;  2RHK A;  4CJW A;  3JYT A;  1WBB A;  3M8P A;  4CHZ A;  1IG8 A;  1RBU A;  4FPB A;  3OYH A;  3I8B A;  2VG6 A;  4YHH K;  1TK8 A;  1NNE A;  3OTO K;  3HM9 A;  2F9W A;  2W6K A;  3CJC A;  4CHQ A;  2Q31 A;  3DJC A;  3MEG A;  2RE2 A;  3PX4 A;  1A5V A;  3E1Y A;  2GWK A;  5IWA K;  4JI5 K;  3KD5 E;  4OKE A;  3OVN A;  1P90 A;  2O8B B;  3MWT A;  4IG3 A;  4FLT A;  3LL3 A;  3THX B;  3HK2 A;  3SAF A;  4KFB A;  1NKB A;  2LSN A;  1Q86 O;  4B9M A;  3AAR A;  1K8K B;  3L4Q A;  1JLA A;  3GG4 A;  3SPZ A;  4JKG A;  1TK0 A;  5GAH P;  3DM2 A;  3PIO L;  3G25 A;  5AJ3 K;  3AAQ A;  1ESV A;  4BG9 A;  3L0Q A;  3TTD A;  1GLA G;  2DFE A;  3H46 O;  3LAM A;  4BY9 C;  3M3Z A;  3M6G A;  3CXC M;  1JLB A;  2GUI A;  2I5J A;  4WQ5 A;  4OX9 K;  4M3U A;  1RBS A;  1C1B A;  3TAR A;  4O55 A;  4EAH D;  1RT2 A;  2Q2R A;  3LZJ A;  4BDZ A;  2EX3 A;  3K5O A;  3WNH A;  1REV A;  2ITG A;  4B1Y B;  3CI5 A;  3H1V X;  4FW1 A;  5B8H A;  4FJH A;  1IKX A;  4IG0 A;  4FJ8 A;  3O4Q A;  2KZM A;  3VGL A;  4E7L A;  4AM6 A;  1MDU B;  3HST B;  3LDQ A;  5HLF A;  3AY9 A;  4YDU A;  3QML A;  1I94 K;  2D0A A;  2CH5 A;  3CQX A;  2Y1J A;  1BOT O;  4BG8 A;  1TL1 A;  1VSK A;  1DT9 A;  3ENO A;  3VA0 A;  3RRG A;  3CJ1 A;  2PYJ A;  3VEW A;  4BVO A;  5DM6 L;  5J1E A;  3E9P A;  2KW4 A;  3O3G A;  3S41 A;  4WQ4 C;  5E26 A;  3VGK A;  2QWO A;  4L8R B;  3O80 A;  3ATU A;  3FFI A;  4H5W A;  1KVC A;  3C6A A;  5EY4 A;  1Z25 A;  3LWL A;  5CY4 A;  4DG1 A;  4FVM A;  4DR1 K;  3HYF A;  4JRQ A;  2BAN A;  4YOV A;  3C7N A;  3WNE A;  4PKG A;  4U7B A;  2ASO A;  2Q1N A;  3TR8 A;  3SQ0 A;  2KFZ A;  2P9L B;  5C2F A;  2RKI A;  4WFA L;  5GAG P;  3VTI A;  1T7P A;  2B4J A;  1FXX A;  1HKG A;  3H08 A;  3T1Y K;  4GKJ K;  1KAY A;  3HP6 A;  3DMJ A;  4CD3 A;  5BPL A;  3E01 A;  1BIS A;  4OGE A;  3OY9 A;  2ATQ A;  3AO5 A;  2NNW A;  3CCM N;  5EXW A;  4FK4 A;  3AVN A;  3AVJ A;  1VSD A;  4H0X B;  2FSJ A;  3U9Z A;  3ZCM A;  5E41 A;  1KAZ A;  2FBY A;  1NU0 A;  1D5A A;  4CW7 B;  5TKY A;  3VF2 A;  3KK3 A;  1RGI A;  4AHV A;  2B6A A;  3EE8 A;  4Z0U A;  1HYZ A;  4BRA A;  4R79 A;  4CZK A;  4MLH A;  3THW A;  3MCA B;  3KD1 E;  3EY1 A;  3P38 A;  2G8K A;  4NXN K;  1BI4 A;  4FJX A;  4IWV A;  4CIF A;  1S6P A;  1C1A A;  1NK5 A;  4LF9 K;  5GIN A;  3QLH A;  1J54 A;  4W5O A;  4KHP K;  1ASV A;  2NRX A;  2XY7 A;  1KSP A;  4FWL A;  1D9D A;  1NKC A;  2A3Z A;  3LWM A;  1JLF A;  4LF5 K;  1CZ9 A;  3LAN A;  1SL0 A;  2HHW A;  2P9N B;  3ZSW A;  3ISN C;  2ZM6 K;  1XQS C;  2IC3 A;  4RG8 A;  1ZBH A;  4Z4H A;  3CCE N;  3ZSO A;  4BQL A;  4PKH A;  4CEE A;  3CCR N;  4JI1 K;  1LV5 A;  1BL3 A;  4M3Y A;  3AVG A;  4CBU A;  3FR0 A;  4IXC A;  4M63 C;  3VQP A;  4Z94 A;  4AIL C;  2O8C A;  2IAJ A;  4JS5 A;  3NGI A;  4FWK A;  5J2P A;  1C0T A;  1HNI A;  1KLN A;  1HJO A;  3LP1 A;  2P9U B;  3D6R A;  4JI6 K;  2HMP A;  2O4G A;  5AQZ A;  4DCH A;  1DLO A;  1WLJ A;  4BRQ A;  4OO1 J;  1WSH A;  4DTS A;  1FK9 A;  4JRP A;  4EZ6 A;  5SZT A;  2OA8 A;  3MEC A;  3KWG A;  1VAZ A;  5LY3 A;  4HUG A;  3IAY A;  5AQP A;  4DTO A;  3A5L C;  3AA4 A;  1YIJ N;  4B3T K;  4FWM A;  1RBT A;  4ZTF A;  2ZJR L;  5I9E B;  2V7Y A;  2P51 A;  3VQD A;  4AQY K;  4JAX A;  1GOB A;  4PL7 A;  5LMU K;  1S1W A;  3D2F A;  3L2U A;  4DQP A;  4CJS A;  5FRM A;  3LP3 A;  4EIA A;  5JVH L;  1FJG K;  2A40 A;  3DXM A;  4A5A A;  1TKX A;  3AGR A;  3OHR A;  5HL7 L;  2HHH K;  3KK2 A;  1HYS A;  3CD6 N;  3IDH A;  1NK8 A;  1WSF A;  1KXP A;  5EVZ A;  2QWM A;  3NF8 A;  3F5T A;  1OH8 A;  3R9P A;  3ENB A;  4DR4 K;  3SBG A;  4G1Q A;  3W3D A;  2RN2 A;  1IBK K;  2CGK A;  1EXQ A;  3L2R A;  1Q9X A;  4ELT A;  2A6A A;  2Z1I A;  1R59 O;  4QCL A;  2A1S A;  4DUZ K;  3BDP A;  4YY3 K;  4BR0 A;  4DTR A;  2KLA A;  1UAX A;  1YVU A;  3ZET A;  1E4G T;  5C10 A;  2CGJ A;  2D0C A;  5KPT A;  3TI0 A;  1L3V A;  3PV8 A;  3VQA A;  3HO1 A;  5F1X A;  1WN7 A;  3QDK A;  3GL1 A;  4G9Z A;  1V4T A;  1B9D A;  4X66 K;  5LJV A;  4E7H A;  4DR2 K;  4JLH A;  4KH4 A;  4FWO A;  3BF3 A;  2HW3 A;  1HNW K;  1UWB A;  4ISG A;  5JLF A;  3OW2 M;  1X9J A;  1JLC A;  1U47 A;  4CJF A;  4DB3 A;  1HRH A;  3QBX A;  5AQG A;  3U6F A;  5C25 A;  1JLQ A;  1GOA A;  4CFA A;  3SUO A;  4CJV A;  1S5J A;  3HI0 A;  3CC7 N;  5JS2 A;  4CGJ A;  3KTQ A;  3AVC A;  2WUS A;  1QHT A;  1XHX A;  2E1Y A;  1DGK N;  4RW9 A;  4KHW A;  2DTU A;  1Q81 O;  2GTD A;  3NAE A;  1BDG A;  4O4G A;  1RFQ A;  4JV5 K;  3U9D A;  3HP9 A;  5BRH A;  5J2N A;  3C6U A;  4BC4 A;  3P1G A;  2E2N A;  3RSE B;  3R6M A;  4QOZ B;  1VQ4 N;  2HHQ A;  5AZJ A;  2QKK A;  4BE2 A;  5K14 A;  4HVJ A;  3DLK A;  3QIC A;  4NYN A;  2Q0U A;  2RF2 A;  1KTQ A;  3C65 A;  4E1N A;  5KTQ A;  1HJR A;  4BAC A;  2NRW A;  3V9X A;  3ZEU B;  4K43 A;  1QSS A;  1TGO A;  3C7N B;  3T1A A;  5FPE A;  4DSJ A;  4CEZ A;  3RMD A;  1EWQ A;  3J7Z O;  1RDU A;  4BRI A;  4I9Q A;  5FPM A;  4C1N K;  1RTJ A;  4IO8 A;  3NVK A;  3F73 A;  4KHY A;  3FZH A;  4Z4G A;  3NHG A;  2DY4 A;  4DTJ A;  3FFK B;  3J7Y P;  4FYD A;  1C0U A;  4IFE A;  2O8D A;  3MED A;  3EEQ A;  4A61 A;  4H0V B;  2XRI A;  1G15 A;  5EU7 A;  4NLB A;  3VQ5 A;  4PL8 A;  3VF6 A;  5M1O A;  2DFH A;  1J9A A;  4CHP A;  5GIO A;  1SV5 A;  3LP0 A;  3RMB A;  4JK8 A;  3C0B A;  4ILG B;  4N5S A;  3OS1 A;  5AQN A;  4CGF A;  1W0H A;  3DWL A;  1ASW A;  4M3W A;  4CJE A;  4K8Z A;  5GAD P;  4IDK A;  4DS4 A;  1NGI A;  3QFU A;  3DYA A;  3CHW A;  4KRE A;  3BP8 A;  3LDP A;  4IZ9 A;  4LC9 B;  3H1Q A;  1YAG A;  3C6H A;  5AQY A;  3TU5 A;  1C0F A;  2QA4 N;  4I7F A;  1XHZ A;  1DKG D;  3CF5 L;  1VSI A;  5ADX H;  3TWH A;  4J8F A;  1RCH A;  3L8B A;  4YOU A;  1U48 A;  1JCE A;  1GLJ O;  3VGM A;  4CIG A;  4FJL A;  3T7Z A;  3UKU A;  3AGK A;  2ITM A;  4L3Q A;  4O8U A;  4C8M A;  4BDP A;  3L6Q A;  1EX4 A;  3VEZ A;  2O8C B;  1LWC A;  4B1Z A;  1OH7 A;  4N56 A;  1ZBU A;  1RDC A;  1QZ6 A;  2Y1I A;  3KK7 A;  4FLY A;  3TTF A;  3DRR A;  3TAM A;  3NDK A;  2HND A;  4J2B A;  5C2D A;  3N4P A;  3A5M C;  3ZYY X;  1GLD G;  1GLC G;  3O9S A;  4FWS A;  3VQB A;  4ELV A;  3V1O A;  2OPS A;  3T69 A;  3SZ2 A;  1ITG A;  1TK5 A;  5J2Q A;  5M1N A;  3KZB A;  4AHU A;  4WF9 L;  5H1S Q;  1K9M O;  3LAK A;  4DKW A;  4DR5 K;  1UA1 A;  3KLG A;  4C8O A;  3HL8 A;  2JWL A;  3N4Q A;  5CZ1 A;  4DHY A;  2P9P B;  3FZK A;  4HWI A;  2PBD A;  4K8X A;  4LH5 A;  3BEX A;  2QEX N;  3DXM B;  1YTU A;  4LSL A;  5KQ8 A;  5C15 A;  4GV6 A;  4M7X A;  5AQU A;  1CXU A;  4NLC A;  3SJH A;  2Q3S A;  3V81 A;  4H0O A;  5C12 A;  4A57 A;  4DSF A;  4E3S A;  1LW2 A;  1GLF O;  4GVE A;  4CGD A;  2X74 A;  2HHT A;  1C0M A;  4KHN A;  4FWP A;  4R5P A;  3QIN A;  3ZET B;  1K73 O;  2E2O A;  3UIQ A;  5AR0 A;  3VQE A;  4FM2 A;  1N34 K;  3OS0 A;  3H6E A;  4KI6 A;  3NMU A;  1KAX A;  3NF6 A;  3PIP L;  3CJA A;  2F96 A;  3WNF A;  4FL9 A;  4I6M A;  4DWI A;  3MCP A;  3ZX2 A;  4F9O A;  5GIP A;  1QTM A;  1YXQ A;  4B1X B;  1Q8I A;  1EP4 A;  2HNZ A;  4DQI A;  1QQC A;  3OYJ A;  4X62 K;  1TUU A;  1NGA A;  4F4K A;  3UKR B;  3MXJ A;  4K42 A;  1Y97 A;  3EE9 A;  1JXB A;  5KPR A;  1VQ9 N;  4JKE A;  3H3O B;  5LJW A;  4J2D A;  4HTU A;  5A2Q O;  4BRK A;  3LDL A;  1IKV A;  3SAH A;  1UA0 A;  4J2A A;  3TPQ A;  3MAQ A;  4H0P A;  4RW6 A;  3AVK A;  3BZC A;  3SQ2 A;  2OPQ A;  5CHI A;  1W7A A;  3QEV A;  5FPD A;  3S9H A;  1NJW A;  1LCU A;  3H3N O;  4IKF A;  1K8A O;  3VEN A;  4MFB A;  1JL2 A;  3BY5 A;  4JKD A;  4EHT A;  3KJV A;  1Z05 A;  2DPN A;  1BWF O;  4N76 A;  1LWF A;  3E66 A;  4O44 A;  4FK0 A;  4H5R A;  4E89 A;  1L5U A;  4BGA A;  5JVG L;  1ASU A;  1U6Z A;  2UXC K;  3T1H K;  1LW0 A; 
#chains in the Genus database with same CATH homology
 4K25 A;  3ULE B;  3LDO A;  1XQS C;  1TYQ A;  3VEY A;  3CCE N;  1CZA N;  4BRN A;  3G6E N;  4BQL A;  4PKH A;  3CCR N;  1DEJ A;  4AM7 A;  3FZL A;  3BUZ B;  3LM2 A;  1VQ6 N;  3OBW A;  4ISF A;  4CBU A;  2E20 A;  3FR0 A;  4IXC A;  1XC3 A;  4M63 C;  4BRG A;  2YHY A;  4Z94 A;  5AZI A;  2EWS A;  2NRZ A;  4FWK A;  1O13 A;  4WQ4 A;  1HKC A;  3D2F B;  2QWN A;  1Z6R A;  4C1N I;  1T6D A;  2A41 A;  2VGM A;  3D7E O;  3A5N C;  5AQW A;  1YVN A;  3SMP A;  1HJO A;  4JD2 B;  4BRL A;  3CC4 N;  2P9U B;  3D6R A;  2P9I B;  1QQN A;  5BPM A;  2WBN A;  4BRD A;  1NGH A;  2HMP A;  3VTH A;  5AQZ A;  4DCH A;  4BRQ A;  4BR5 A;  1YUW A;  2QXL A;  2BTF A;  4BC3 A;  4OO1 J;  2D4W A;  1U2V A;  4JKC A;  3PLA A;  1ZBS A;  2PAV A;  3KWG A;  3KWI A;  3WXK A;  4CZI A;  3DLL L;  1VAZ A;  2GWJ A;  5LY3 A;  4PKI A;  2YHW A;  3ULE A;  4CJ7 A;  4FWR A;  5AQP A;  3O5B A;  5AQJ A;  5BR9 A;  3B8A X;  2D0O A;  4CD1 A;  4FVU A;  1YIJ N;  3A5L C;  2V7Z A;  3E9O A;  1KD1 O;  1NGE A;  3U4L A;  5BPN A;  4FWM A;  3WXJ A;  3GE1 A;  2I7P A;  2V51 B;  2V52 B;  3F2K A;  3MN5 A;  4FWQ A;  2A42 A;  1D4X A;  4MDB A;  1VQN N;  4CBX A;  2ZJR L;  2FF6 A;  3O9T A;  2V7Y A;  5I9E B;  2F7T A;  4JAX A;  3MN9 A;  5AFU H;  1N8R O;  4PL7 A;  2E88 A;  1X3N A;  2VCP A;  3D2F A;  5AQI A;  1OKJ A;  4H03 B;  1ILY A;  2FSN A;  5AQT A;  2CH6 A;  1V4S A;  2ZWH A;  4AF1 A;  4EIA A;  5JVH L;  4CZG A;  2A40 A;  3DXM A;  3D2E B;  4IDH A;  2P9U A;  4WFN L;  2P9I A;  2YI1 A;  4A5A A;  2IVN A;  3CCJ N;  3AGR A;  3OHR A;  2ASP A;  3O4W A;  5HL7 L;  2IVO A;  3R3L A;  3EKS A;  4GV9 A;  4NO7 A;  2QWL A;  1KC8 O;  4BRC A;  3CD6 N;  3IDH A;  5F2R A;  4IEI A;  1BO5 O;  2QWP A;  3HZ6 A;  3SBT A;  4U67 L;  2P9S A;  3VET A;  2F9T A;  1KXP A;  1W97 L;  5EVZ A;  2QWM A;  4WYB A;  2GEM A;  5MLC Q;  4WFB L;  2NLX A;  3EL2 A;  1Q7Y O;  3CJ9 A;  3F5T A;  4H0Y B;  3A8Y A;  2KKZ A;  3R9P A;  3ENB A;  4CBW A;  4YOW A;  3ATV A;  3SBG A;  1ZC6 A;  2W41 A;  5TKW A;  3TSU A;  3W3D A;  3WQT A;  4BRH A;  2CGK A;  1BA1 A;  4BRO A;  3LM9 A;  2A6A A;  2W40 A;  2HOE A;  4E1J A;  5CR4 A;  2NRR A;  4FSV A;  1R59 O;  3I56 N;  2D0P A;  3CER A;  3O9U A;  3CIP A;  3O9R A;  5DM7 L;  2IIR A;  3NVM A;  3SLC A;  4BR0 A;  4DQ8 A;  2HBK A;  2KLA A;  3ZET A;  4CZE A;  4FWN A;  1E4G T;  4WCE L;  2YCH A;  3FLC O;  5C10 A;  3KVG A;  4A5B A;  1VQP N;  1IJJ A;  2CGJ A;  3D2E A;  3VER A;  3WT0 A;  4NB4 A;  5KPT A;  3SAG A;  2ZF5 O;  3WXL A;  3CMA N;  5F1X A;  5M1Q A;  3EN9 A;  5M1F A;  3QDK A;  3AAP A;  3GL1 A;  4G9Z A;  1V4T A;  3CCU N;  4YOR A;  5LJV A;  2JWK A;  4YOT A;  1VQO N;  3UB5 A;  4KH4 A;  5AQV A;  2HF3 A;  4B1W B;  4QS7 A;  4BRM A;  4FWO A;  2NRV A;  3BF3 A;  3O8M A;  3OA9 A;  3O08 A;  3TTC A;  2P9K A;  4ISG A;  5JLF A;  1ATS A;  1SAZ A;  1J6Z A;  3HTV A;  5AQS A;  3OW2 M;  1NM1 A;  1HX1 A;  1X9J A;  3WEE B;  1ATR A;  5EX5 A;  2QWR A;  4CI6 A;  3HM8 A;  3QB0 A;  5AZJ B;  4DB3 A;  3QBX A;  2QWQ A;  5AQG A;  2YX6 A;  3CCS N;  5FPN A;  3DXK A;  4BR7 A;  3CCQ N;  1X3M A;  4JN4 A;  3E9L A;  5M1K A;  3FGU A;  4BGB A;  4IEE A;  3ID8 A;  1QVF M;  1S22 A;  1YJW N;  4KH5 A;  2UYT A;  4H5N A;  3HI0 A;  3CC7 N;  1EQY A;  4PHT X;  3EZW A;  1WOQ A;  1S3X A;  4BRF A;  2WUS A;  2E1Y A;  2OTL N;  1DGK N;  3W0L A;  1Q81 O;  2GTD A;  1GLL O;  2Q0R A;  4IOC L;  4JEP A;  3GDQ A;  4BRP A;  4JKA A;  1BDG A;  4BRE A;  1YJ9 N;  4JHD B;  4XH4 A;  3CJ7 A;  3VEO A;  1RFQ A;  1QQM A;  4JK9 A;  3U9D A;  5BRH A;  2HST A;  1ZXO A;  3VF4 A;  4MO5 A;  4BC4 A;  1QVG M;  2E2N A;  3RSE B;  3O6W A;  4FO0 A;  3R6M A;  3CPE A;  3MK6 A;  1HLU A;  1VQ4 N;  4B1U B;  1MWK A;  5AZJ A;  2P9N A;  3LDN A;  4CZM A;  3K9K A;  3QIC A;  3CET A;  3P39 A;  3WQU A;  3WUH A;  1VQK N;  1NGJ A;  2Q0U A;  1NGF A;  3C65 A;  4OPA A;  2NRT A;  1YIT N;  3GOI A;  2NRW A;  3ZEU B;  4K43 A;  3L4I A;  3QBW A;  2VWB A;  4K41 A;  2HBM A;  3C7N B;  3IMX A;  2QI2 A;  2E2Q A;  4JNE A;  5AQQ A;  4UY8 O;  5FPE A;  5HOO A;  4I6M B;  3J7Z O;  1RDU A;  4BRI A;  3EKU A;  2BH1 A;  4ILH A;  2YHX A;  4H5V A;  3J8A A;  5FPM A;  4C1N K;  4IO8 A;  3NVK A;  4JD2 A;  1NLV A;  3FZH A;  3VPZ A;  4WQ5 C;  5AFU A;  3HOS A;  3P4I A;  5KPZ A;  3HSC A;  5M1P A;  3RSE A;  2QM1 A;  3FFK B;  4XEI A;  5AQK A;  3RVC A;  3F9M A;  3U8X A;  1VQ7 N;  4MLE A;  4IJA A;  4IJN A;  4O8K A;  4OPH A;  4MO4 A;  3R1X A;  4IFE A;  2AA4 A;  4JKH A;  2FF3 B;  3VMF B;  4A61 A;  1MA9 B;  4H0V B;  1GLB G;  5E84 A;  3KHY A;  3QFP A;  3G4S N;  1W2B M;  4NLB A;  4FOI A;  4A62 A;  4PL8 A;  3VF6 A;  5M1O A;  1MWM A;  1NGB A;  2ZJQ L;  1XUP O;  2KHO A;  5BRF A;  1NBW A;  4ISE A;  4BC2 A;  1LOT B;  5GIO A;  1YJN N;  3MDQ A;  4JK8 A;  3UKU B;  3C0B A;  3MX2 A;  4ILG B;  3MWP A;  2GUP A;  3CPW M;  4IO9 L;  5AQN A;  3ZEU A;  4YDU C;  4CZL A;  2E1Z A;  4M7Y A;  3DWL A;  5AQF A;  3WXM B;  1ATN A;  1BA0 A;  3DAW A;  3P31 A;  1QQO A;  1C0G A;  5GAD P;  3CME N;  5ELZ A;  5BRD A;  1NGI A;  3VES A;  1NGD A;  3QFU A;  1QHA A;  3CHW A;  3FZF A;  2RHK A;  3BP8 A;  3LDP A;  2FLO A;  4IZ9 A;  4LC9 B;  3H1Q A;  1YAG A;  3C6H A;  5AQY A;  3VOV A;  4GV3 A;  3CCL N;  3TU5 A;  1C0F A;  1IG8 A;  4IOA L;  4FPB A;  4BQZ A;  2QA4 N;  3I8B A;  4JKG B;  5BN9 A;  1DKG D;  5CE3 A;  3CF5 L;  5ADX H;  3EO3 A;  2F9W A;  3CJC A;  1BG3 A;  2Q97 A;  4J8F A;  4YOU A;  3VEV A;  3I55 N;  2Q31 A;  3DJC A;  1HUX A;  2RE2 A;  1JCE A;  1GLJ O;  1GLE G;  1KQS M;  1TYQ B;  3VGM A;  2FSK A;  3T7Z A;  3E1Y A;  2GWK A;  1NMD A;  1JCF A;  3UKU A;  3AGK A;  2ITM A;  5GAE P;  4L3Q A;  4O8U A;  5AZI B;  1P90 A;  2HF4 A;  3L6Q A;  1NJI O;  3MWT A;  2WFB A;  1G99 A;  3VEZ A;  4GY2 B;  3LL3 A;  4B1Z A;  5BN8 A;  3A0I X;  3CJB A;  2E8A A;  5C0Y A;  3ENH A;  2I7N A;  1NGG A;  3SAF A;  1NGC A;  3M5R A;  4C23 A;  1Q86 O;  3IFR A;  1VQ5 N;  1QZ6 A;  3KK7 A;  3AAR A;  3TTF A;  1K8K B;  3L4Q A;  3UE5 A;  2QW9 A;  3GG4 A;  3I33 A;  2ZGZ A;  2HBL A;  5C2D A;  1U2V B;  4JKG A;  3N4P A;  1SQK A;  3A5M C;  3ZYY X;  5GAH P;  1GLD G;  1GLC G;  2ZGY A;  2AP1 A;  3Q7C A;  3PIO L;  3G25 A;  2HBJ A;  1JCG A;  3AAQ A;  3O9S A;  4FWS A;  3WXI A;  4A2B A;  1ESV A;  4BG9 A;  3L0Q A;  4JKB A;  3TTD A;  1GLA G;  3H46 O;  5KQD A;  3TSP A;  3VEX A;  4Y0W A;  3MN6 A;  4BY9 C;  3M3Z A;  3M6G A;  3CXC M;  3T69 A;  5AQM A;  4WQ5 A;  2H3G X;  4KBO A;  3WEE A;  5JLH A;  5M1N A;  3KZB A;  4RCH A;  4WF9 L;  5H1S Q;  1K9M O;  4DKW A;  2D1K A;  4EAH D;  2JWL A;  5AQR A;  3K9J A;  1T6C A;  2Q2R A;  3N4Q A;  4GNI A;  3CCV N;  1VQ8 N;  2ZJP L;  2IVP A;  1JJ2 M;  2WC9 A;  4DHY A;  2P9P B;  4EFH A;  3FZM A;  3FZK A;  4HWI A;  4HTL A;  3CI5 A;  3H1V X;  2PBD A;  4B1Y B;  4ILJ A;  3ZX0 A;  3BEX A;  4YOY A;  2CGL A;  1TUY A;  2ASM A;  5B8H A;  3A5O C;  3DXM B;  2NRH A;  2QEX N;  1HKB A;  3CQY A;  2YJE A;  3VGL A;  1K8K A;  5KQ8 A;  3OBY A;  3TSQ A;  5C15 A;  4AM6 A;  4GV6 A;  1MDU B;  3LDQ A;  3H45 C;  4M7X A;  5AQU A;  3AY9 A;  1QZ5 A;  4NLC A;  4YDU A;  3G71 N;  3SJH A;  3QML A;  4CZJ A;  4A2A A;  3O1B A;  2CH5 A;  1Q18 A;  3CQX A;  4CZH A;  1NWK A;  2P9S B;  3M1F A;  4H0O A;  4BC5 A;  5C12 A;  1BOT O;  5AQL A;  4BG8 A;  2NZT A;  5AQO A;  4A57 A;  4A59 A;  4FOE A;  4KH6 A;  4JHD A;  1E4F T;  3R8E A;  5BRE A;  1DT9 A;  1P8Z A;  1WUA A;  1SS6 A;  3BF1 A;  3ENO A;  4YOX A;  2E2P A;  1YF5 L;  3CJ1 A;  4XH5 A;  3VEW A;  1GLF O;  4GVE A;  4RTF D;  4EHU A;  2GEL A;  3GBT A;  4JKF A;  4BVO A;  5DM6 L;  3E9P A;  1H1V A;  3S41 A;  4WQ4 C;  4FWP A;  5E26 A;  3VGK A;  2QWO A;  3O80 A;  3ATU A;  2GX9 A;  2P9P A;  4H5W A;  3ZET B;  1K73 O;  2E2O A;  2OAN A;  3C6A A;  5EY4 A;  2PFU A;  5AR0 A;  4BR9 A;  3H6E A;  4BR2 A;  5EOY A;  1S72 N;  4YOV A;  3C7N A;  3NMU A;  1KAX A;  5JMV A;  4PKG A;  3PIP L;  3CJA A;  1T3V A;  3JXU A;  4U7B A;  2ASO A;  2QTD A;  2Q1N A;  4FL9 A;  4I6M A;  3MCP A;  2A5X A;  3O9Q A;  4JK7 A;  2P9L B;  5C2F A;  4WFA L;  1Q82 O;  4RWT A;  2BUP A;  3ZX2 A;  5GAG P;  3HRG A;  4F9O A;  5GIP A;  3FE1 A;  1HPM A;  3VTI A;  1HKG A;  1YXQ A;  5F0X A;  4B1X B;  5JIC A;  1KAY A;  1M90 O;  2OTJ N;  1YI2 N;  4CD3 A;  2P9K B;  5BPL A;  4XH1 A;  5AQX A;  1TUU A;  3SMS A;  1VQL N;  4IOX A;  1NGA A;  3SK3 A;  2NNW A;  3CCM N;  4QS8 A;  5EXW A;  3UKR B;  4O5F A;  4K42 A;  1YHQ N;  4H0T B;  3EE9 A;  1T44 A;  2FSJ A;  4H0X B;  3U9Z A;  3Q7B A;  3ID6 A;  5KPR A;  1M1K O;  1VQ9 N;  1KAZ A;  4JKE A;  3H3O B;  3ZX3 A;  5LJW A;  1BU6 O;  5TKY A;  3DXK B;  4QS9 A;  3VF2 A;  2VYP A;  1RGI A;  3JS6 A;  3HOT A;  3EE8 A;  4BRK A;  3LDL A;  4BRA A;  4R79 A;  4BVP A;  5ADX A;  3SAH A;  4CZK A;  1SZ2 A;  4MLH A;  5AQH A;  4H0P A;  3TPQ A;  3HBT A;  3MCA B;  1RDW X;  3P38 A;  2Q36 A;  5CHI A;  3MX5 A;  2FXU A;  5FPD A;  2VGN A;  4IWV A;  4H5T A;  1LCU A;  3H3N O;  3CC2 N;  2P9L A;  1K8A O;  4BR4 A;  4MDA A;  3VEN A;  1BUP A;  3IKM A;  4JKD A;  5GIN A;  1EO1 A;  3MMV A;  4EHT A;  1Z05 A;  2DPN A;  1BWF O;  1OVY A;  2NRX A;  4FWL A;  3E66 A;  3O1W A;  4CZF A;  3MN7 A;  2A3Z A;  4B9Q A;  3IUC A;  3UKR A;  4H5R A;  4BGA A;  5JVG L;  1VQM N;  2P9N B;  1U6Z A;  1Y64 A;  2YJF A;  4FPA A;  2J4R A;  4B1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...