4IG3A

Hiv-1 reverse transcriptase with bound fragment near knuckles site
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 167
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ig3A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig3A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig3A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig3A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ig3A05
2E9RX 3PJXA 3OL6A 4JV1A 4CFCA 2P51A 1S9GA 1L3UA 3G86A 3KLGB 5SWMA 1L3TA 3AVBA 4EYIB 3I8DA 3L2WA 1RBRA 1EX4A 3C94A 3E51A 4EBDA 3TAPA 3GIJA 4OJRA 3EPGA 1UOCA 2IAJB 3U3GA 2EC0A 4IH5A 4NRTA 3TAGA 4Q8EA 3QIPB 4DSEA 4EZ9A 4M3RA 1JXEA 3KLEB 1X9SA 4DS5A 2RF2A 4QWBA 3UQSA 4JRPA 3GILA 4CJPA 4CFDA 3OHBA 1BISA 4IG0A 4TXSA 4HUFA 4OL8A 3QO9A 2OPQB 2OPRB 3SQ0A 4LQ3A 3DLGB 4DTSA 4URGA 4RW8A 2Z1HA 2IC3B 3CM5A 3SV3A 4K4YA 1CLQA 3QNOA 3KJVA 1S1XA 4NCAA 5T7BA 3DLKA 5C25A 5JUMA 1ASVA 2KZZA 4FJLA 1IO2A 3U3YA 4IQXA 3FRZA 1I3AA 4NLSA 1HRHA 4O0IA 4ZVGA 4ELTA 1T03B 1J5OB 4PUOA 1WSHA 1TL3A 3QINA 1SV5B 4FLYA 4F4KA 3OYAA 4FZZA 4KE5A 5J2MA 4CESA 2YNIB 2W7OA 4M45A 2PZSA 4N47A 1NK8A 4FJNA 4CERA 3IG1B 4I2QA 4HCCA 3OYCA 1JLFB 1T05A 3SV4A 2VG6B 4FW2A 4FJJA 4LY7A 5FDLA 3MXJA 4E7LA 2JC1A 1WSFA 2J6UA 2JEFA 4N76A 3LAKA 3HP6A 3MR5A 3CG7A 1WAFA 1N56A 3G0ZA 4RW9B 4IRDA 3PW0A 3NAHA 1WNEA 4W5TA 4PA1A 5J2QB 1HYSB 4NLPA 1XR5A 3N6NA 4DL2A 1RTIB 3S3NA 5C24B 3NF9A 4ECQA 4DSIA 3CVKA 4ZPAA 2YNFB 4RNFA 3NGZA 4OGCA 3GV5B 4OGEA 4IRKA 1T7PA 3OLAA 5J1EB 5KG0A 3NF7A 3ISND 3O3HA 4NLYA 5KFJA 4ZHRA 2PYLA 2YNHA 3VQ9A 1W9HA 3OJUA 2X74A 4CJKA 3LWMA 4AHSA 1S0OA 1RNHA 4DTRA 2OPPA 4ZVEA 2IJFA 4ECYA 2B5JA 2B6AA 1RDRA 4CJRA 3RRGA 1N48A 1C2PA 5DLFA 3ZT0A 1HPZB 1REVB 4NRUA 5JS1A 4W5RA 5EDWA 2FC0A 4DFKA 1S6PA 4M3XA 4ECTA 4CEOA 4CJ4A 3TANA 3V81B 4ED3A 2F8EX 3RB3A 3AA2A 5KFWA 5KFLA 3B6OA 3DOKB 3VQ7A 3I0RA 3V1RA 4PQUA 5KG1A 2B43A 4U7CA 5F9LA 2ALZA 1NJZA 3NAIA 2BQRA 3QNNA 4BE0A 3OJSA 3CO9A 1TKZB 3OSNA 1T3NA 4Z4CA 3N6LA 4CGDA 1RTHB 2R2TA 3PX0A 1NNDA 1HNIB 2HNDA 4QCLA 4FYDA 3SQ2A 4BACA 3NHGA 4IR9A 1KHWA 2JEJA 3NDKA 5KFPA 4KHNA 4WZMA 3VQEA 4RNHA 2QE5A 1JL2A 4NLQA 1NJYA 4CEAA 1GX5A 3VN5A 3QIOA 1EP4B 4DU4A 2P1JA 2R7YA 4Q45A 1FK9A 5CZ1A 1S6QA 4I9QA 5KFYA 1L3SA 3CFRA 2E9TA 4Q5VA 4RNNA 2R8IA 3BQ0A 1ZETA 5KT3A 1IKVB 1VSKA 5J2PA 3SUPA 1BQNA 3KLFB 4OPJA 1KLMA 4KTZA 2UVUA 5K14A 3SPZA 1XHXA 3PW4A 2VA2A 3H2LA 4DQRA 3KKRA 4CGJA 1RDAA 4BWMA 3M8QB 3G6VA 2R2RA 1SUQB 1BI4A 2IM1A 1S1TA 5EWGA 3SQ4A 4KREA 5DQHA 1K6YA 4WXWA 4J9SA 1LAWA 1A5VA 4CJTA 3CYMA 4JS5A 4O4RA 5DG9A 2ATLA 4M41A 4G1QA 4HKQA 5EU7A 3TAEA 1HQUB 1NOYA 3K5OA 4E7JA 4ED8A 3LAMA 1Q9YA 3G6XA 5KG3A 4FXDA 1VSJA 3P1GA 4DL7A 4RZRA 2D0AA 1CZBA 4R8UA 4CK2A 1JLQA 5JXSA 1IKWB 1S5JA 4CF0A 1IM4A 1XHZA 2O4IA 1SH0A 3PZPA 3IN5A 3OL8A 3KLHA 4QOZB 4BDZA 3DMJB 4Q43A 4DLGA 2OPSA 3OS2A 1HQEA 4FM1A 1JLGB 3C6UB 3MEEA 3SUOA 1DTQB 1LWEA 1VSDA 1N4LA 1N6QB 3AO1A 3LP0A 1ASUA 3ZSXA 1IH7A 4W5OA 1TAQA 1S9FA 3H5XA 4B9LA 4FLWA 3OSPA 1S0MA 1RT2B 4FM2A 4B9SA 2HHQA 5FROA 1QAJA 4FCYA 3T5KA 4ID5B 3PVXA 2D0CA 4E7KA 3KMSA 4NLVA 3AA5X 3LWLA 1C1AA 2FJXA 4URSA 3CWJA 2XGQA 2VWJA 1B92A 1DTTB 5DGBA 4ECWA 4K50A 5DLGA 2G8FA 5L9XA 3KLIA 3CM6A 3V6DB 5KT4A 1YTUA 4I7FB 1C1CA 2WRMA 2XY7A 2AGPA 1S1VB 3KHGA 5KFVA 2F8TA 5KT6A 2FJWA 3TABA 4NCGA 1JLEA 3DI6A 2R2SA 3ISNC 2A1SA 1RBVA 3KK3A 4E0DA 3C95A 1BCMA 3C6TB 1EETB 1C0MA 5F8NA 3NGYA 1L3VA 3BSOA 2HNZA 4C8OA 4CEZA 2IA6A 2Z1IA 3PW5A 5KFNA 3LANA 3WNEA 4FLTA 4OLAA 4R5PB 1RA6A 3T3FA 3M8RA 2W42A 3PY8A 3BGRA 3CQ8A 4YQWA 4MK9A 4CF9A 2FVPA 1WAJA 4KB7A 2YKNA 3ITHB 1TV6B 2O4GA 3HVWA 1NKCA 3KHHA 4QWDA 3OHAA 1RTDA 3I5BA 4FJ9A 1Z26A 5D3GA 1XC9A 3LP1B 3HYFA 1QSYA 4NLOA 4NLDA 3T5JA 2ZD1B 2JEGA 4CFAA 3PW2A 4EO8A 4DEZA 4J2BA 2AGOA 3KOAA 3ASMA 5KG5A 1U45A 4HUGA 3MR3A 3DRRB 1X9WA 1K1SA 4KFBB 4Z0UA 1DLOB 1TL1B 2CKWA 4BWJA 3PR5B 3G6YA 4AHTA 3K5NA 1SH2A 3BR9A 2XO7A 4F3TA 1J54A 3V4IA 3KK2A 1VK0A 3G10A 4O4GB 3DLRA 3O3FA 3KHLA 4DFPA 3SUQA 4O3SA 1WLJA 3NF6A 2JLEA 3VQBA 1ZTTA 1N5YA 4FK0A 1BL3A 4CHYA 1HNVA 3KLVA 2XCAA 2VG5B 5KRTA 4H54A 4AHCA 4DTMA 3M9NB 1W25A 3OYBA 4DTOA 1ZBLA 4KHRA 1S1WA 1S97A 1SKWA 4DLEA 3WNHA 2W8KA 4K4UA 3CDWA 3EZ5A 1YTAA 5JS2A 2P5OA 3M8PA 4MK8A 3RAXA 1SKRA 4B8AB 1TKXA 3U6FA 2IMWP 2LSNA 3CFPA 2HVIA 2BGGA 4B9NA 2XI2A 3HPGA 1S9EA 1QAIA 3DLEA 1TVRA 1LW2A 1KHVA 2WOMA 2YNGA 5KG6A 3SI8A 2OH2A 4FM0A 4EO6A 1EKEA 3Q8SB 3AVJA 4M3ZA 2BQ3A 1LWFA 4RUAA 5F8JA 2RF2B 2RKIA 5KFRA 4Y1CA 3OYLA 1WSIA 3SFGA 2WHOA 3NFAA 4DFJA 1JLCA 1TKDA 5KFXA 4QWEA 4TYBA 5HROA 4LH5A 1NKBA 1RTJA 1UWBA 3DYAB 4IG0B 4FVMA 4C8KA 5DG7A 3IRXB 3MECA 4NLRA 3PX4A 1TGOA 4MFBB 3ALYA 5C42B 4IRCA 3NH0A 3MTKA 1SH3A 3BSNA 2UUTA 4DSKA 3KJVB 4CF8A 1JXBA 4CF2A 1S1XB 5KFTA 3TVKA 4URQU 3VQPA 4Q0BA 2WB4A 3ULDA 1L5UA 4DSJA 3DRSA 4ED6A 5F8MA 2C28A 4J2EA 3AO4A 5J2MB 3IGVA 1RDCA 3HM9A 4YMEA 3HPHA 4MKBA 4KO0A 4LSLA 4I2QB 4FS2A 2BE2B 1TKTA 4RW6A 4FLVA 4E1NA 3NAEA 4JUZA 4CJ5A 4F2RA 4AH9A 5F9NA 2HHTA 4YP3A 1RT6A 4WYLA 4KHYA 3QIDA 3OL9A 2UUWA 5KGXA 3SI6A 3GQCA 3H4DA 4QW9A 2GBZA 2G8IA 5I42A 4DS4A 2XI3A 3GV7B 2RDIA 4O55A 2FLPA 1B9DA 2VG7B 3ICLA 1FKPA 2G8WA 4Y3CA 5HBMA 2GC8A 4FK4A 3OYHA 4AILC 2FBYA 3OYMA 2HHUA 2RPIA 4H4MA 3TAMA 1RT4A 4HYKA 4IR1A 1SL2A 2HMIA 3ZT4A 4CIEA 3UPFA 5CZ2A 4ZVHA 3ZT1A 3BSAA 3H98A 4B9UA 2DFEA 4ID1A 2FJVA 1VSHA 5L1JA 4E7HA 1RT3B 3LP3A 2B6AB 2HAIA 2UVVA 4NLGA 4XIUA 3VQ5A 1BQMB 4FBUA 1RBUA 4KTWA 4CJWA 1CXQA 1C0TA 4MIBA 1BGXT 1RBTA 2G8HA 1S6PB 3IS9B 1WSGA 3AVNA 2G8KA 1RAJA 3NH2A 4W5QA 1ASWA 2IAJA 4RW4A 4MK7A 3I0RB 4Y2AA 3RMBA 5L1IA 2ILYA 4TYAA 4O3NA 5KFUA 4DQQA 3FFIA 4OKEA 4FLZA 4F2SA 2AWZA 4PY5A 4ECRA 5DG8A 2ZE2B 3MF5A 3H4BA 1A5XA 2FBXA 5I3UA 4Y34A 4ELUA 2QK9A 2HNDB 1RYSA 4FLUA 1ZBUA 1W0HA 4XO0A 4I2PB 4NLTA 3GIKA 4EEYA 1FKOB 3VQ8A 3AVMA 3RR7A 3RWUA 4F4ZA 5KFCA 3HVTB 3DLGA 5CYMA 3HKWA 2HHXA 4MH8A 1VSIA 4B3OB 4AHVA 2XHBA 2NUBA 1FK9B 4CJLA 4KTQA 4CGFA 3KKSA 4ICLB 1I39A 3V9XA 1J5OA 5KI6A 1TK5A 4LSNB 1JLBB 3WNFA 5J2PB 1BQNB 2IM2A 1CXUA 4J9RA 1LW0B 2HW3A 4KB0A 4ZTJA 1MMLA 3PV8A 1NK0A 4K4VA 1JLFA 3UDLA 5HP1A 3SPYA 1WN7A 4YNQA 1BI4B 4IBNA 4J2DA 4ED0A 3NH1A 4KHMA 4J9KA 1T8EA 2JGUA 1YT3A 3CDUA 1KTQA 1T94A 1JX4A 4NLWA 5J2QA 4WFXA 1RT5B 4G1QB 4QWAA 4CJUA 3QEIA 4CJQA 5F8GA 4KHSA 4KV8A 4KAZA 4J9NA 3L2VA 3E01B 4C8LA 3MR6A 5J1EA 3QYYA 4R8UB 3NKYA 1JLQB 4WE1B 4WYWA 3V6KA 3QETA 1C1BA 4O44B 3MR2A 2W9BB 4GVMA 1LWEB 4IKFA 4YR2A 3LP0B 2E6MA 3QERA 1VRTB 4ECUA 1HMVA 5SZTA 3OYFA 3AVHA 1LWCA 1RYRA 5J2NB 1HPZA 4NYZA 3BDPA 5DQGA 1S1UB 2WONA 3KLIB 3EPIA 4UQGA 4E1MA 2R8KA 4CHZA 4E19A 1IKYA 1C1CB 4ZP6A 4QW8A 1KSPA 3K5MA 4DQIA 2KW4A 4XPEA 3OYEA 2V0NA 2V4RA 2AJQA 2FBVA 1TKZA 4KI6A 3GYNA 2KTQA 3D28A 1TQLA 4Z4FA 4IFYB 2IS3A 3JYTA 1JLEB 4M95A 1NK4A 3DI6B 3UIQA 2I5JA 3H5SA 1MU2B 2IGIA 3VQ4A 3ZSRA 3IAYA 1LV5A 2HHVA 1RDDA 3RRHA 1ZYQA 4DG1A 1Z25A 4TN2A 1QE1A 3FDSA 2HNZB 4Y2CA 3OYJA 4K4WA 4IFVB 3NGIA 4GMJB 2XC9A 3M9MB 3LPTA 1C0UB 3B6PA 3P5JA 3VA3A 3D45A 2YKNB 3LP2B 1IKVA 1TAUA 1RTDB 1IKXB 3KLFA 2YHBA 4KI4A 4F4YA 2BANA 3OYIA 4ED7A 4Z4HA 3AO2A 3K58A 2HWIA 2G8VA 4F4WA 3AVFA 1Q8IA 4ZPDA 3AVIA 3QESA 3L3UA 1QQCA 2GUIA 4E7IA 3M8QA 3I0SB 1ITGA 4ECVA 4DTPA 3HP9A 1J9AA 5EUHA 5KRSA 1D8YA 3MXIA 4NYNA 3KK2B 5KFOA 3NBPA 4KHUA 4BE1A 4OKJA 3V1OA 4DQPA 3AVAA 2W8LA 1NK9A 1HQUA 3MEDB 1OS5A 2D0BA 3MEGB 4CHNA 1VSMA 1U09A 4ZVFA 4GC7A 3AA3A 4CK1A 3DM2B 1F21A 3HSTB 3VQQA 2DFFA 4DF4A 4KHWA 2FLNA 4M3YA 2HNYA 3N6MA 1HYVA 3NF8A 1UA1A 4RG8A 4CEFA 3SNNA 3L2RA 3GV8B 2XRIA 3BREA 4K8XA 3O4QA 3DMJA 1JLGA 3M8PB 3QLHB 3V6HA 1ZBFA 4NYFA 1N6QA 1TKXB 4KPYA 1ZBHA 1RT7B 4CEDA 3KTQA 4ID5A 1R0AA 2EHGA 4CGGA 3DLEB 1TVRB 3PX6A 3L2UA 2FVQA 4J2AA 4NZ0A 5KFSA 2WOMB 4IH6A 3EYZA 4EBEA 1DTTA 1RT1A 4CJ3A 4FJXA 3RB4A 3JSMB 1HJRA 2FVCA 3QEWA 1KFSA 4DU1A 3KK1B 2ZKUA 1YVFA 2QKBA 2RKIB 4JS4A 1RDBA 2XY5A 5KFGA 4KSEB 1D9FA 1U48A 4M3UA 1S1VA 4IDKA 1JLCB 4KKOB 2D41A 4EP4A 4H4OB 3AVKA 1NK7A 1UWBB 5KFZA 4CEBA 5CYQB 3PR4A 1JIHA 3T5HA 3S3MA 4TQSA 3C6TA 1EETA 1VRUA 3HL8A 4TY8B 3AV9A 4IG3A 2BRKA 4CF1A 5HLFA 2GV9A 1CZ9A 1VSFA 1S9GB 5EWFA 3H5UA 4CFBA 2HWHA 3DRSB 2Y1IA 2AX1A 4DL5A 2I1RA 2C2RA 5HRNA 4H8KA 2PYJA 3ITHA 2W9AA 2GIQA 2DY4A 4PWDA 4M42A 4AHRA 5KFBA 3M8SA 4KO0B 3BQ1A 1JLAA 4WFYA 3LP1A 5L1LA 4EP5A 3I5CA 2ZD1A 3VQSA 4IH7A 1JKHA 2DPJA 4L8RB 5KG4A 2ILZA 2W9CA 1B9FA 1ZBIA 4FJ8A 1NHVA 2IJNA 1U4BA 3DRRA 2QXFA 4CGHA 2BQUA 4JRQA 4TLRA 3GIMA 5I42B 2E6LA 2FLLA 5KGWA 1VSLA 3QGHA 3QO9B 2DPIA 3DOLA 4RW8B 4O4GA 1FKPB 4ZTFA 4K4XA 4KAIA 2YKMA 3TARA 1I6JA 4Z4IA 3DLKB 5C25B 2ASJA 2UVRA 4CE9A 2OYQA 1RT4B 4QAGA 3ZSQA 2VG5A 1QSSA 3OYNA 2W7PA 2D3ZA 3TAFA 4PUOB 3HHKA 3AO5A 1TL3B 1IG9A 4K8ZA 2OA8A 3T1AA 3H40A 3TWHA 2HB5A 3FQKA 3M9OB 5KFQA 2X6SA 4DTNA 3NGDA 1T05B 3EY1A 4DTXA 5DK5A 2Z1JA 1C0TB 4OLBA 5FDLB 2XGPA 3IGNA 1A5WA 4FK2A 4DMNA 4FLXA 5FRNA 1D5AA 2IOCA 2KQ2A 3OYGA 4DWIA 1BIZA 4GC6A 2ETJA 4RW4B 3THVA 5C5JA 5KFDA 3LZJA 3MXMA 1NKEA 2XCPA 4HVJA 3FFIB 2ASDA 3RMCA 3CJ4A 2D7SA 3AVCA 5KFEA 2HHWA 4J9OA 5I3UB 4CJVA 4FZYA 1SL0A 3H5YA 4EYHB 2C2EA 5DGAA 2E4LA 4NLUA 4ZP8A 2DFHA 3DYAA 3I5AA 3IRXA 4RW7A 4ZHRB 4DSFA 2YNHB 4MFBA 4CCHA 5F8LA 3DRPA 1S49A 3RR8A 4KRFA 4FZXC 5C42A 4ECSA 4CHQA 5CYMB 3OYDA 4FW1A 1O1WA 1D0EA 2ATQA 3H08A 4YFUA 2OPPB 1U49A 3K5LA 3QGIA 2V9WA 2Q3SA 4O3RA 2B5JB 3EZUA 2E9ZA 1UAXA 3KLGA 3KMQA 4G3IA 3O3GA 3P83D 3BJYA 2OZSA 3LDSA 1SL1A 3TQ1A 4FBTA 1EXQA 2C2DA 4DFMA 4Y1DA 4J9QA 2BE2A 4PQUB 3V9UA 4DL3A 5DMRA 4ZP7A 3SYZA 4ED2A 5HP1B 3QIPA 4XPCA 4TY9A 3KLEA 3SQ1A 3HK2A 3Q8QB 3RB0A 3H59A 4FJHA 3ZSVA 5KFKA 3OY9A 3LALA 5KFAA 1X1PA 4B9VA 4HUEA 3PO4A 1HYZA 2AX0A 2OPQA 2D5RA 1SKSA 2HVHA 4KV8B 2R2UA 2OPRA 2VG7A 3QZ8A 4FJGA 5CY4A 2IC3A 5HRPA 3ZT3A 5KFIA 3HVAA 4J9MA 3HO1A 1S6QB 4NCBA 4RNOA 2IDOA 4E3SA 4CEEA 3V9ZA 4LD0A 1C1BB 1T03A 1K1QA 3DLBA 1KVBA 4ECXA 1SV5A 3T19A 3CJ2A 2YNIA 3QGGA 1KLMB 4CGIA 3PJWA 4F8RA 2XY8A 3F9KA 3LZIA 4WFZA 1QHTA 1Y97A 5K14B 2X78A 1RT3A 3K2PA 3IG1A 4HHTA 1HMVB 4BE2A 1XR7A 4N56A 5KFHA 1BQMA 1LWCB 4C8NA 4F3OA 2VG6A 2XWYA 1KRPA 3Q8RB 1S1TB 3HT3A 4IOBA 4M3WA 4DF8A 4JV2A 4Z4EA 1NK5A 3IS9A 3AVGA 4RW9A 3QZ7A 1WSEA 4F4XA 2JC0A 2WONB 5HRSA 2D3UA 4K4SA 4BDYA 1HYSA 3KIOA 4ZPCA 3ZSWA 1IKYB 1XI1A 3SUNA 2GIRA 2BRLA 1RTIA 2PY5A 5C24A 3CJ5A 2ZE2A 5KG2A 4TSXA 2YNFA 3JYTB 4DQSA 4HCBA 3HXMA 1KVAA 5KT5A 2I5JB 4AHUA 4J9PA 4LQ9A 4X2BA 1NOZA 4TQRA 4I2PA 4CHOA 1U04A 4DG1B 4HTUA 4FJKA 3KLHB 1FKOA 1QE1B 2WCXA 3HVTA 2OPSB 1HQEB 4DSLA 3MEEB 4F50A 4B3OA 4CEQA 3OL7A 4N41A 3HJFA 3S9HA 5FRMA 1TP7A 1S10A 1Q9XA 4E89A 4ICLA 2F96A 4OPKA 3KD5E 3RBDA 3ZSOA 4LSNA 1JLBA 1REVA 5F8IA 2BANB 4KBIA 2ASLA 4CHPA 3VQ6A 3A2FA 3V81A 1LW0A 3MFHA 4GW6A 1HARA 4DL6A 3DOKA 5KTQA 3CIZA 4B08A 4K4TA 2C22A 4JV0A 3VQCA 1RTHA 1U47A 3S3OA 4CIFA 4NCGB 4DTUA 3AO3A 1QTMA 1D1UA 4MKAA 2VA3A 1HNIA 4QWCA 4CK3A 5E41A 3NBPB 3KK3B 1RT5A 3HPOA 4YR0A 3V9WA 2R8GA 3FSIA 1QS4A 3K57A 3RBEA 2G8UA 1KFDA 2FVSA 3RAQA 4O0JA 1G15A 1XWLA 4U6PA 3L2QA 1EP4A 3E01A 1XR6A 1BCOA 3RB6A 3SJJA 3F73A 3OLBA 1QUVA 3BGRB 4RU9A 3AA4A 2OZMA 2EX3A 4WE1A 2HNYB 4O44A 2O5DA 3KNAA 1JL1A 2W9BA 4O3PA 4YR3A 1GOCA 1UA0A 2KZMA 1S4FA 3TR8A 3ZT2A 4CJSA 4KB1A 5D3GB 5EWEA 1RBSA 2R8JA 3RTVA 1VRTA 3GIIA 2WTFA 4CJFA 3CDEA 1TK8A 1R0AB 1C6VA 2RDJA 1RILA 4OKKA 3RMAA 1X9MA 5J2NA 4OVLA 1SUQA 3FQLA 3VA0A 4LH4A 3HVRA 4ED1A 3V1QA 2X6NA 3RMDA 1RT1B 1BHLA 1NJWA 4QPXA 1S1UA 1RCHA 3V4IB 3VQDA 4IDKB 4CJEA 3BSCA 3WNGA 3K59A 1NK6A 1BIUA 5L1KA 1WNSA 1N5YB 5HRRA 3DDKA 4ZP9A 3NL0A 4IFYA 2RN2A 1HNVB 3D0PA 2ITGA 1Z4UA 1VSEA 3ZSZA 5KG7A 4M3TA 4BDPA 2QV6A 2AU0A 1MU2A 2WK4A 4JLHA 2AGQA 3CFOA 1IKWA 3D5MA 3CJ0A 4Z4GA 2Z1GA 2A1RA 3SCXA 4RNMA 4DU3A 4FJIA 1S1WB 1VRUB 5F8HA 3MAQA 4IG3B 1FXXA 3LPUA 5HLFB 3C6UA 4IFVA 1DTQA 4C8MA 1JXLA 4O5BA 4B9MA 3L8BA 2YV0X 1KCFA 1C0UA 4WZQA 1RT2A 4ZPBA 4IKAA 2JEIA 4EZ6A 4PWDB 3LP2A 5KT7A 1S9EB 3SFUA 3VQAA 1LW2B 2V4QA 1IKXA 1GOAA 1QSLA 1JLAB 2YNGB 4Q44A 4B9TA 2VWKA 1GX6A 2DTUA 3TI0A 1JKHB 2J6TA 3OYKA 3V6DA 4I7FA 1LWFB 2FVRA 2W9CB 2KFNA 2HHSA 2F8SA 3BQ2A 4FJ5A 4K4ZA 4FS1A 3NMAA 3ZSYA 2QKKA 1S0NA 3I0SA 3TAQA 1NHUA 3PUFA 3SZ2A 5HROB 1RTJB 2P5GA 3MECB 2YHAA 2KFZA 2FBTA 4KHQA 3DOLB 2BDPA 4W5NA 4FJMA 2YKMB 4MIAA 2R8HA 3OVNA 3MEDA 3MEGA 4RUCA 2ZQBA 1S48A 4Q0BB 1TK0A 3ZCMA 3DM2A 4R5PA 4FJ7A 3AVLA 1KLNA 4EBCA 3QEPA 3KD1E 4ECZA 4I9LA 2J6SA 4O3QA 1TV6A 3KHRA 3MFIA 2IM0A 1CSJA 3V6JA 2Y1JA 3QLHA 4LSLB 4Q8FA 1TKTB 4RW6B 2CJQA 1ZTWA 5KFFA 3PW7A 4ELVA 1WSJA 1RT7A 1RT6B 4J9LA 3NE6A 4ZMMA 1J53A 3DLHA 5KT2A 4MQ3A 3OS0A 5T14A 1GOBA 4CECA 4DL4A 1NJXA 4KFBA 1DLOA 3L3VA 1TL1A 3JSMA 5DQIA 4DTJA 4WXOA 3T5LA 1KVCA 3PO5A 3KK1A 4M94A 2AQ4A 5KFMA 4O3OA 3UR0A 4B8CA 2IM3A 3Q8PB 3O4NA 3OS1A 1LAVA 4KKOA 5HBMB 4H4OA 4R0EA 4N5SA 2B4JA 5CYQA 3V9SA 4H4MB 3TAMB 2BR0A 4RW7B 2IBKA 3PHEA 2XY6A 2HMIB 1D9DA 3DRPB 3QEXA 3NCIA 4CIGA 3QEVA 1RA7A 3CJ3A 1YVUA 2UVWA 4NLXA 4TY8A
chains in the Genus database with same CATH superfamily
3PJXA 3OL6A 1Q7YO 1FJEB 3PIPL 4FOEA 1L3UA 3NP5A 3ONQA 3R5CA 5SWMA 1WBDA 4CLWA 4JV5F 3N28A 4BREA 5JLFA 1EX4A 1WKKA 4EBDA 3ZTOA 4WTYA 4OZ5A 3EPGA 3VVUA 1UWAA 4QU6A 5AQQA 2UXDJ 4IH5A 4NRTA 5IC4B 4EZ9A 1AW0A 4M3RA 4GMKA 4QWBA 2HVEA 4JI3F 4LVOP 2DNHA 1FD2A 2UU9F 1R7IA 3QO9A 1M5PC 2OPQB 4HHHA 1CZAN 2OPRB 4LR8A 4URGA 4RW8A 5H9FK 2Z1HA 1WBBA 3ZZPA 3QNOA 3KJVA 4ATNA 5FJ4A 2A6OA 2XO6A 4NCAA 3DLKA 3MX2A 4FJLA 2LEBA 1IO2A 3U3YA 4IQXA 2X1AA 2E44A 1T03B 2QLXA 1WSHA 3QINA 2YVSA 1VHIA 1FX4A 4DXLA 3U02A 3DXKB 2CJ9A 4DX6A 1NK8A 2ZDOA 3ZO7A 3GBTA 3IG1B 4I2QA 4HCCA 2LEAA 1BA1A 1JLFB 4BBYA 2XZWA 3H6EA 4BRFA 4OX9K 1ROFA 1FJGK 4E7LA 1KD1O 2CNOB 3U9ZA 2BOAA 2DEJA 2VPZB 4X62F 1WAFA 4JN4A 4IRDA 2E29A 3PW0A 4BRQA 2P9EA 4UOFA 4W5TA 3ZXWA 3GZ7A 3ZETA 1NLKL 1RTIB 1MLAA 4OMFG 3S3NA 4ECQA 1EQYA 2NRWA 2AJ0A 3CVKA 3NGRA 1T6DA 3ZC4A 4M7XA 1RACB 2EFQA 3GV5B 3HJVA 4OGEA 4IRKA 1LK5A 3CTRA 5KG0A 4MYUA 3O3HA 1VOMA 4ZHRA 4X64J 3CB4A 4RWXA 5KAKA 1KONA 4DV0K 3HSDA 1B70B 5AE2A 4OYXA 1QTNB 2V52B 1L3KA 1ZAWA 2V5HG 3RRGA 4ZVSB 2XS2A 5DLFA 5JS1A 3Q22A 4W5RA 2W40A 5EDWA 2W01A 3DU5A 3TUIC 1SI9A 2DNQA 3SBMA 3CCLS 3PSIA 4CJ4A 4I6MB 1U1OA 3CHWA 5F0XA 5KFLA 3B6OA 4CI6A 3RYLA 3V1RA 3DCAA 4PQUA 2QSFA 5KG1A 2D0PA 1S59A 2B43A 2E7VA 4HI1A 3N4PA 3QNNA 1YUWA 3OW2M 1RWWB 2UV8G 2NLWA 3I56N 2HRUA 3ZNJ1 3GMGA 5GAGP 4K7QA 4WU2A 1FTRA 1P8GA 3PX0A 2HNDA 3SQ2A 3GJSB 4IR9A 4RUHA 1PO6A 3QSIA 2JEJA 4RNHA 2QE5A 1JL2A 4AQYJ 4CEAA 3CMQA 1M5VC 3VN5A 1EP4B 2P1JA 1X4AA 2LXUA 4CBXA 3EVOA 1FK9A 5CZ1A 5ADXA 3UCGA 1ZOTA 2GO8A 3CD6S 3CFRA 2IYGA 4BY9C 4RNNA 5KT3A 4PQAA 4YY3J 4DUTA 1VSKA 4AM6A 3LA0A 4KTZA 4ZK7M 2POKA 2C3OA 3SPZA 2BZ2A 3D0HE 3NCQA 5D78A 2VA2A 4O0NA 2P9CA 4JBCA 3O9RA 2D9PA 4X4TA 3KKRA 3O9SA 3FCHA 3G6VA 4P2XA 1BI4A 4KREA 3CCQS 1X3MA 1T9TA 3ZZRA 3T1YK 1QZ5A 3CYMA 1K0TA 2ATLA 3CQYA 2DRAA 4F3MA 3B6BA 2C2MB 4OX7A 3WC0A 4ZJLA 4IDHA 3D2WA 5M1PA 3J7ZT 4DDFA 4WIIA 1KS2A 5IT4A 1YVNA 3K5OA 4ED8A 3VAFA 2A0FB 5KG3A 4RZRA 2OTLN 2DCLA 5JXSA 4CF0A 1IKWB 1XHZA 1IM4A 2E1RA 5KPRA 4J7CA 2D0OA 4QOZB 2U1AA 4CW7B 2OPSA 5GADI 3OS2A 1N52B 3C6UB 1F1BB 1NXIA 1IH7A 2BW7A 4DX5A 1S9FA 4B9LA 4B9SA 4OI0A 2HHQA 1QAJA 4CO3A 4USKA 3T5KA 4ID8A 3PVXA 4FO0A 4PHTX 2D0CA 4KC5A 3QFUA 1FJ7A 4NLVA 3AA5X 2Q6CA 1T9XA 2FJXA 4URSA 5K20B 5DGBA 1PYOB 1HIYA 4C6AA 4K50A 5DLGA 3ZYYX 2W2PP 3P4IA 3CM6A 2VDHA 3D67A 1HBOB 1T02A 5AQLA 1VS3A 3KG0A 2GEMA 2C2NA 3F44A 2XY7A 2LQBA 2F9WA 4F7VA 3KJNB 5KFVA 2F8TA 4C0OC 2H3EB 4M5KA 5DM6Q 2J4RA 3Q7CA 2FJWA 1IBKK 4AL6A 2XSJA 2R2SA 4JKHA 4RR5A 4PXEA 4ISEA 3KK3A 3CCVN 3J81O 1U7LA 3CE8A 1L3VA 5AE1A 3WNEA 4FLTA 3VPZA 3C7NA 2YY3A 3PY8A 2W42A 4XEIA 2JL9A 3WXMB 1Q16B 3JAMY 2P9PA 3FZLA 3F0NA 3HVWA 4JKFA 3BV8A 2RSQA 3B8AX 3ENQA 4LFBK 4CFAA 3PW2A 2DR9A 4DEZA 2I38A 3J7AN 2CFXA 3TJ8A 3R5BA 4HHJA 1IWAA 4HUGA 2HEKA 4FYWB 4WYBA 1K1SA 1WC0A 1K9MO 3LGNA 1HWIA 2HHPA 1SH2A 1RSCA 2JJ4D 3UDCA 4P73A 4WBFA 1S72S 1KDNA 1DAXA 1U2RA 2CRLA 2F65A 4O3SA 2O8DA 2DRDA 3VMFB 3NF6A 3L7PA 1N5YA 3PNIA 4FK0A 1BL3A 2WVEA 1HNVA 2VG5B 1U0HA 2QA2A 4H54A 1W7WA 5AFUA 1VQ4N 2R3VA 4NLBA 1PJ7A 2DNYA 5EOYA 1G3OA 2BACA 4KHRA 4K4UA 3C19A 1UFWA 2R7RA 1ZBTA 1YTAA 2JVRA 4Y28C 6AT1B 4MK8A 1SKRA 1TKXA 2LP4A 2HBYB 2J9DA 3G25A 2PI5A 4M63A 3A5NC 2O8EB 2G2OA 4N77A 1XN9A 3I82A 4I6YA 3ZZ0A 2BGGA 5E7OB 2MPUA 2JX2A 2WSCC 4DPTA 2FGOA 3DXMA 2O8CA 2PBDA 1NDLA 4A5BA 1G1XA 3VEWA 3DLJA 2RF2B 2RKIA 1TUWA 2DNLA 2V4JB 3OYLA 4ZIVA 2VODA 2WHOA 1N36J 3MX5A 1JLCA 3C6AA 1BQXA 1ITPA 4LH5A 1UWBA 2J7UA 2FJEB 5DG7A 3EE8A 4LF8F 3MECA 4C48A 4NLRA 4LF9K 3W2WA 4LF6F 3PX4A 1TGOA 4FWRA 2CUYA 3Q8UA 3ALYA 3K9KA 4RWWA 2HLTA 1X5OA 2UUTA 1S3XA 4CVNE 3WC2A 4CF2A 1S1XB 5KFTA 3CCSN 3D6MB 3RU0A 2WSEC 3HT0A 3EICA 3E2EA 1L5UA 3VF0B 3GP9A 3DDNA 3UN2A 2C28A 4ISGA 4NXNJ 5J2MB 3HM9A 5CAAA 1YI2N 1TKTA 4UOHA 1OYEA 2DHSA 4E1NA 4A8MP 2PO4A 4OHWA 2AP1A 3KZBA 5AZJB 4DV2F 4NYPA 3LDLA 4YP3A 1RT6A 2RVJA 3CULA 4AD6A 2DD8S 5FPMA 2MJNA 2KM8B 4CZFA 3WUHA 2GBZA 2ZVIA 4OYMA 5GADU 2X3GA 1B0TA 4CM0A 2VPWB 1URNA 2QTDA 3ICLA 3RGIA 1WKLA 4X66K 2G8WA 1S6OA 4NB4A 1DQAA 1JCEA 1GXLA 3OYHA 3BB5A 1ICEB 1WB9A 1IVZA 1HNZK 4H4MA 4HYKA 1RWNB 3VGVA 4JI8F 4B3RJ 2WW4A 1NGBA 2DNOA 3BF3A 2FHMA 3PHTA 4CIEA 1F9HA 2MY7A 5CZ2A 3BSAA 1CEZA 4L3QA 3H98A 1FRMA 4B9UA 2DFEA 4ID1A 2AHOB 3HSGA 3CCMS 2HGMA 3HHDA 3GPAA 2UVVA 5C2GA 1FWKA 3VQ5A 3FEZA 2LXIA 4FBUA 4OI6A 3A3OB 1CXQA 1BGXT 1S6PB 3IS9B 2GQCA 2D1KA 1H73A 1ASWA 2PMWA 2GW8A 3RMBA 5L1IA 2CPYA 2ILYA 3U1MA 2EK6A 1X4EA 2BE7D 5A6PA 3A5OC 1XTZA 1AB8A 2AWZA 3TZYA 1NJIT 2YWKA 3MF5A 1P9YA 4Y34A 2QK9A 3AJ2A 3ENOA 1W0HA 4XO0A 4NLTA 2KJVA 4P7TA 3VQTA 2ASMA 1Q81T 1WEXA 3RR7A 3RWUA 4F4ZA 3AXKA 2QTWA 4A8KA 8RUCA 4C97A 1URRA 5F0UA 4KTQA 1SCJB 3H3OB 4LF5J 1I39A 3HFZB 1YJTA 1TK5A 1VQ9N 2MLXA 4IO8A 4BQZA 1BQNB 4ZLLA 2PI4A 2GX9A 1JJCB 4AXIA 3CPEA 1FO1A 2I9SA 4ETZA 3ULEB 4AF1A 5LJWA 1MMLA 4W92B 3PV8A 1JLFA 1NNEA 2ZZMA 4YNQA 4J2DA 3VR1A 1JQGA 4KHMA 4PXDA 1P8ZA 3PYFA 1T8EA 4OX9F 1YT3A 1GFWB 3CDUA 1FJGF 4IOXA 4GKJF 1I94K 4NLWA 3UKUA 1VQMS 1RT5B 4A61A 3QEIA 5F8GA 3TYTA 1C0GA 4KHSA 4P2MA 4KY3A 3C3LA 4X4OA 1WUAA 1N33K 1RZMA 3L2VA 3ZZTA 5DDRC 3OUYB 4JD2B 4R8UB 1JLQB 4WYWA 1VGYA 3QETA 1C1BA 3ID6A 1JK9B 1N8RT 2CQ0A 3PKMA 4YEAA 4IKFA 3EL2A 4LIWA 3J7A1 2GGPB 3QERA 1VRTB 4DV4K 5IC6B 1B7YB 3BGFA 1IBMF 5M2RA 5SZTA 1XNQJ 3O4WA 4GVBB 1HI0P 5J2NB 2VF3A 4NE9C 4TLQA 2QRRA 5CA5A 4LF4F 4X4UA 4G65A 4ZOSA 2LA6A 4I6MA 2NXJA 5IQ6A 3KLIB 1X4BA 5AQYA 4K42A 4ZP6A 2AJQA 4KH4A 4KI6A 5D4OA 4M7YA 4A8WA 1TQLA 4Z4FA 1H98A 1AA1B 1V3RA 3AXMA 3DI6B 1S79A 2I5JA 1T9WA 1MU2B 3HOSA 1WHYA 2CGKA 3ZSRA 3EXYA 2DGVA 1JCFA 3UVJA 2R7XA 2RHQB 5D4LA 4DCPB 1QE1A 3NXZA 3FE1A 2HNZB 3QRPA 4IFVB 3NGIA 1KP6A 3IRWP 1YBAA 3LPTA 2K3KA 1QM9A 2HGLA 3P5JA 2UUBJ 4WF9L 2E8AA 4NZ7A 2HSTA 3BS9A 4DUZJ 1RTDB 1FFGB 3CF5L 3D0IE 3BPDA 4F4YA 5CE3A 4ED7A 3EWGA 2V7ZA 4Z4HA 2ZJRL 5EX3A 1QLNA 1R89A 4I64A 1WEZA 2HWIA 4ZPTR 2G8VA 3CCEN 4MJKA 3KK7A 4CLLA 3AVIA 1B99A 3HRGA 3L3UA 4DN0A 4E7IA 1NGHA 1LFPA 2ROGA 3R6GB 2LDIA 1J9AA 3ILOA 1HI1A 3IMXA 2D1CA 4CO0A 3NNAA 5EUHA 2OEMA 1D8YA 4PPDA 5DM7Q 4KHUA 3S8SA 4IEIA 2X3DA 1U24A 1KQSR 4FP9A 4CHNA 2ZJPL 4A2AA 2HVDA 1SJQA 2RU3A 2W25A 3TW0A 5L9NA 2YWGA 3EKUA 4MIWA 2ASPA 4ZVUB 2HNYA 3N6MA 5I3QA 1OKJA 1UA1A 4RG8A 3L2RA 4EGLA 4DV7K 1UTAA 3JSBA 2O8FA 3UNYA 1JXVA 5HQLA 4NYFA 3UCZP 3OQ2A 2X1FA 3CUNA 4KPYA 1O8BA 3KG1A 3M05A 3W2VB 3A13A 4IUFA 2EHGA 4CGGA 1HWLA 3L7UA 5A8KA 3MWPA 3VGLA 3IKMA 4J2AA 2KT3A 2WOMB 3EYZA 1VR6A 4FJXA 2GMHA 4LT6A 3R1XA 4F9OA 2FVCA 3QEWA 1KFSA 4C11A 4DU1A 4JS4A 1RDBA 2NRZA 1HBOA 5KFGA 2OSQA 4QR1A 1U48A 4M3UA 1IBLJ 5IXUA 3EGZA 1NPRA 5ETSA 1Y10A 1NK7A 1ZZNA 1N32F 5KFZA 2C2KB 4KYZA 3PR4A 5D15A 2ZM6F 1VQPN 3QNWB 4ZVTB 2AEFA 3M2UB 4QIVA 2NRRA 4PEOA 2V9KA 4TQSA 2ZWPA 2CNLB 3A8JA 1IBKF 2KXHA 5HLFA 4YB5A 3Q2TC 1EWRA 1VSFA 1WOPA 4DR1K 1BD6A 2IBOA 3Q89A 4K59A 4DL5A 3SCLE 2C2RA 1P27B 2ZC4A 4H8KA 4DV5J 1XMOF 3SBTA 3BZQA 5KPTA 4PWDA 1FF2A 2I8EA 2CVIA 4AHRA 3MPUB 4QYRA 3BQ1A 3N5FA 1B0PA 2MQNA 3ILJA 5L1LA 3DKDA 4JKGB 4IH7A 1JKHA 2UV8A 1NB7A 2ILZA 2W9CA 1ZBIA 1FDDA 5BRHA 2DITA 5BN9A 4G1PA 2J8SA 4CGHA 2DO4A 2F4VJ 1Q95G 4LFBF 5I42B 1D8ZA 1J5EK 4DV3J 2QSWA 1TL5A 3WIVA 3N9UC 3DOLA 4C3LA 1PAUB 3THXA 4B3SK 2XLIA 3JAMO 2YKMA 1R31A 2VQFK 1I6JA 5EVZA 4AL7A 4DCHA 1ZAXA 2HHHF 2UVRA 5GIOA 3H45C 3K7RA 2VG5A 1HNWK 3TAFA 3ET6B 4TU8A 2RD5C 2NUHA 1M90T 2HQFA 1E4FT 1U2VB 1KNZA 4Z37A 4UZBA 3H7HB 3MCAB 3I33A 4H5NA 3TWHA 5KFQA 3CMEN 2MGZB 3CD7A 3O5BA 3FMBA 3EY1A 3G8TA 4X4QA 2O8EA 2Z1JA 5FDLB 5KPZA 3UFCX 1A5WA 4PAAA 2CPZA 3R1LA 5L39A 1D5AA 4HTJA 4ANEA 1MMNA 2GHWA 3TWZA 2D74B 5CZXA 2XZDB 4ZCIA 3MXMA 3N4WA 1VQNN 1PIEA 4HVJA 4BROA 4FZVA 3FFIB 1ULRA 4K25A 1FD8A 2NUUG 1WHWA 5JMVA 4J9OA 3NVMA 5I3UB 2HFZA 4N8NA 1DRZA 4EYHB 2E4LA 1IQZA 2AZ3A 3I5AA 2XBPA 4DSFA 1XUPO 3SCKE 5F8LA 3T6BA 4JYAJ 4P10A 3RR8A 2LQ5A 3MWBA 3OYDA 1HHTP 2UUAF 2YX4A 2OPPB 5BR8K 1WC3A 2IFXA 3QGIA 1VI7A 4YHHF 4PPZA 1VQ5N 1YKWA 2CZ4A 2OZSA 4OZJA 2PC6A 1NEEA 3KKFA 1SL1A 2CQCA 3WHIA 4IXCA 2C2DA 2YH1A 4Y1DA 5IV3A 1TYQB 1O6XA 1NPKA 1KVKA 4DL3A 4NI2A 1QQNA 5AZJA 1DKGD 4ED2A 2VQEF 1DQ8A 4TY9A 3VGKA 3MDFA 1EKSA 1PC5A 2M0GB 1UPMB 5FLXY 2ZH2A 2NRHA 2ZH1A 3ZSVA 1LXNA 2FZCB 3W1YC 5KFAA 1X1PA 1HKGA 3PO4A 3R5DA 4DUYK 2HVHA 4KV8B 2R2UA 3QZ8A 2EFGA 4OLPA 5KFIA 4CO1A 1FCAA 1I51B 3HVAA 1R43A 1S6QB 5K8NA 1EZZB 4RNOA 2IDOA 2LQJA 2E1MC 1RAEB 4LD0A 4DJBA 4PG6A 1K1QA 3T19A 1MROB 2QL7B 1NH8A 3JQKA 3BP8A 1GMVA 2FUG9 5H1SV 3PJWA 3F9KA 1XNRJ 5EXWA 1QHTA 2BBEA 1Y97A 5K14B 1K8KA 3AY9A 3J81U 2DGSA 1HMVB 2V2QA 3J7Z5 4CT8A 4F3OA 2VG6A 4WFAQ 1ZS6A 4B3MJ 3VEZA 1KRPA 4YOUA 3HT3A 4IOBA 1H7XA 4DF8A 2YCHA 2MQ8A 1NK5A 3IS9A 4OV6A 1GLCG 3GL1A 4RW9A 3QZ7A 3HBTA 2JC0A 2WONB 2ABYA 4CO2A 4K4SA 4KH6A 4CD3A 3KIOA 2DNRA 3ZEUB 1YJVA 1NGAA 2KHCA 3CJ5A 2IIHA 2AYGA 2G1DA 1T6CA 4HCBA 5KT5A 4DPWA 1WDDA 3GSIA 2YXLA 1HUXA 1NOZA 4K0KK 2J5AA 1U04A 3KLHB 4KH0B 4NXMJ 1HQEB 3KVGA 4DSLA 3MEEB 1BY9A 1M5HA 1S77D 3OL7A 1U25A 5FRMA 3MDQA 4E89A 2GHPA 1OVYA 1NLVA 1HA1A 2F96A 2AA4A 5CD4A 1NGEA 1FRJA 3I56S 4JI7F 3J7ZO 2ZOFA 4PL8A 1N0VC 2B7BB 2CIMA 2RHSB 4GO5X 4DL6A 3DOKA 1YITN 4I56A 5KTQA 1P90A 4DN9A 4ILHA 5AQNA 5K8PA 2PSZA 3O2IA 4P71A 3G71N 5B0CA 4NCGB 1D1UA 4QWCA 5E41A 3O1WA 2BXJA 3M8ZA 1RT5A 1CC7A 1QS4A 2UP1A 5HQ8A 3RAQA 4O0JA 4CIOA 3KWGA 3FCVA 3EUNA 1KKHA 4C7QA 1VFJA 1XR6A 1LNQA 5C0YA 1CG2A 1BCOA 3RB6A 3OUYA 3F73A 2ZGYA 1PJ5A 1QUVA 2GJFA 4JV5J 2EX3A 1TMJA 1M1KT 3UW1A 4C8ZA 2R4FA 2RHKA 1N33F 4MO5A 2W24A 3KNAA 3HDSA 5B08A 4CLPA 5C2FA 1F5CA 2XMVA 4U67Q 3ZT2A 4CJSA 5LMNF 3CJAA 2GGPA 1ZBSA 1VRTA 1I3OB 1UETA 3GIIA 3VEXA 1YBTA 2K1RA 4ZLJA 1NBEB 3TTCA 2EPIA 2Z58B 2RDJA 1RILA 2WTUA 3RMAA 2Z2MA 5J2NA 1G6BA 1SUQA 3NVKA 1EX8A 3BR8A 1FVQA 4DV4F 2LXFA 4LH4A 1W2BR 2X6NA 1RT1B 1QUPA 4JI3J 1BHLA 1SPBP 4PZVA 2OTLS 2VUGA 1RCHA 2UU9J 3PACA 2AZ1A 4H5WA 4LRDA 5BR9A 3VQDA 4DR6F 1MW7A 1YJ7A 2J0SD 1BIUA 2NCKL 4ITSA 1YJWS 1WNSA 2QWNA 3DDKA 2VGMA 4HTIA 1PYSB 2BM1A 4M3TA 3VGUA 1MU2A 4JLHA 2BABA 4Z4GA 2A1RA 3SCXA 1S76D 2GQ2A 4DU3A 1ESVA 1S1WB 2ZH4A 1OMSA 4IG3B 4JI2K 2CNNB 4QR0A 4IFVA 1DTQA 1JXLA 4O5BA 1Q53A 4B9MA 1KCFA 3IAM9 2MKKA 2YHWA 1WF2A 4ZPBA 4IKAA 3PIOL 2E5JA 4FPRA 3EXCX 4OV1A 1S9EB 4X62J 1UZDA 3IAS9 2HQCA 3N0VA 1QSLA 2B0GA 2YNGB 4B9TA 2DXFA 1GX6A 3TI0A 3CCVS 3POTA 1D4XA 3MM9B 4Y6IA 3V6DA 2HHSA 4FJ5A 3S7RA 4FS1A 1ATSA 2UUCK 3BGUA 3HSZA 1RADB 4J90A 4X4VA 3TAQA 3U7JA 1NHUA 1ILYA 1RTJB 2X1BA 2P5GA 2JFDA 2LECA 5ETTA 2RRAA 1VQ8N 4WK1A 1FRKA 1GMWD 5GAGI 4BRAA 1F3VA 3D68A 2QWLA 1QQOA 4MIAA 4L3KA 3VAIA 1MDUB 2MQQA 2KYZA 3GSDA 2MKSA 2VFTA 1KLNA 4EBCA 3JSYA 3NWGA 2BEFA 3RSEB 3LPYA 1VQLN 2EW9A 4JP8A 3MAHA 2QL9B 3C15B 6FDRA 3IR5B 5FPDA 2ZOMA 3O44A 5MLCQ 3PW7A 3GWCA 4ZCKA 3W2VA 1F0XA 1J53A 3JTNA 3D4JA 4MQ3A 1BDGA 4XDDA 4DKWA 4CECA 1HHSA 4KFBA 1XMQF 1QDUB 1VQ4S 4DTJA 4ZJQA 2C2ZB 2E5LF 3UR0A 4BS2A 3NRBA 3I55N 2IVPA 3GFXA 5HSPA 3CW2C 3T69A 3M5RA 4R0EA 1EWQA 1Q0NA 2F8HA 5C12A 4DR5K 3EJMA 2HFNA 3E1YA 1D9DA 2OD4A 3DRPB 2O66A 3M2UA 3QEXA 3DHWC 4DR3K 3QEVA 2BV3A 5LM7E 1HFEL 4V19S 4NLXA 2E9RX 1DJ0A 2ZH5A 4CFCA 4A8FA 4OI1A 2IIRA 2DHGA 4EYIB 3BH7B 2Y8YA 2AYBA 2BA9A 2GZOA 3UD4P 2KRRA 1DY3A 4JI6K 4DR1F 2YWHA 1UOCA 3DXSX 3OXLA 4F0KA 4JKGA 2YWWA 2QJ3A 1NM2A 3PYEA 3QIPB 4Q8EA 4LF7F 3T1HK 1ATRA 1CULB 3HD1A 4J5OA 4DS5A 2ASOA 4AM7A 3GIRA 1BHNA 3FJ2A 4JRPA 3AGRA 3CCSS 4CJPA 3C8YA 3TX0A 4CFDA 1RI7A 3O9UA 3TPQA 4CZKA 3OHBA 1BISA 4DCJB 4IG0A 4TXSA 1CJUB 4OL8A 4USHA 3VEYA 2SXLA 4WPAA 3HHNB 4DTSA 2IC3B 1U8WA 3SV3A 1YI2S 3ID8A 3K0SA 4YDUA 4E98A 2DY1A 1ASVA 3HTVA 3FRZA 1P9QC 2GNKA 1HRHA 4O0IA 4ELTA 3DAWA 1J5OB 4N8OA 3C0BA 2L3MA 3ET6A 3P5TL 4BVPA 2CWXA 4UZCA 1SV5B 4FLYA 4FZZA 3KFWX 2B4OA 1U2VA 4KE5A 1S4EA 4CESA 2YNIB 1N5VA 3RG6A 2DNGA 4M45A 4N47A 5HMZA 4FJNA 1VISA 1LEOA 3CXCM 2MGZA 1P6TA 2VDIA 5AQKA 4NZ6A 5FDLA 2JC1A 2J6UA 1Q81O 4N76A 3A12A 3IUCA 3MR5A 1KVJA 2ERRA 1NRKA 1IR1A 3NAHA 1WNEA 1IN0A 4WCEL 1S6UA 3PKYA 5C10A 5CD4H 4DL2A 1R3NA 4MKYA 1WTFA 2CJYB 1U1KA 4YB7A 1JNZB 1N34J 2YNFB 4RNFA 3OLAA 1IUJA 3ISND 3CJ7A 4A4JA 3VVTA 3VQ9A 1W9HA 4QIGA 1GLBG 2LDYA 2X74A 3VEOA 3MAAA 1GXUA 3GJQB 4CLFA 4DTRA 2OPPA 4ZVEA 2IJFA 3W3DA 1W2IA 5K8MA 2B6AA 4CJRA 3V5RA 1N48A 1C2PA 4BC7A 4ES3A 1T11A 3AH6A 1X5TA 1F60B 1ATNA 5BR8F 4FOIA 3D6FB 1REVB 2UXDK 3G6EN 2IYIA 2FC0A 4YUDA 4DFKA 5GAGU 5D6GA 4CEOA 1HR0F 3VTHA 4H5RA 5KFWA 3J81j 1RGIA 3I0RA 1O0PA 1ZPWX 1LCUA 4JOUA 4U7CA 2AW0A 2BM0A 2ALZA 3D66A 1NJZA 3NAIA 3PG9A 2AT1B 1HNXJ 2GAGC 4BE0A 1JMTA 3OSNA 4CGDA 1RTHB 1N8RO 3HZEA 1FA0A 1WG5A 1SXLA 3HOTA 1HNIB 3NHGA 1WI6A 2N3OA 1VQ9S 3WDOA 3TP2A 3VQEA 2FJAB 3J80Y 4WQ5A 1KQKA 4RPFA 2CG8A 3U1NA 2WBMA 4DU4A 3FGUA 3U9DA 1S6QA 5KFYA 1KQFB 2E9TA 2FY1A 1SC4B 2R8IA 1WUUA 3D9BA 1GAOA 1IKVB 2DH7A 1H1VA 2NPIA 5GVQA 2UVUA 1Y11A 5K14A 3PDNA 1XHXA 1C0FA 5FLXO 3H2LA 5B0BA 3O8MA 5JICA 2R2RA 2YTCA 5EWGA 5F2RA 4UOGA 2HKEA 2GUPA 1A5VA 2HFUA 3BN7A 4LF6J 5AQJA 4M41A 3ZEUA 3M4XA 5ETKA 2GHVC 2XZTB 1SC1B 1NOYA 4E7JA 4X64K 1Q9YA 3G6XA 1VBZA 4FXDA 5IWAF 1VSJA 4KGMA 3FZHA 1PBAA 1Y5LB 4CK2A 2O4IA 3NMUA 1SH0A 3NOGA 3PZPA 3IN5A 3KLHA 3DMJB 2NZTA 4DLGA 1HQEA 3MEEA 1LWEA 1ELOA 1VSDA 2R7TA 1N4LA 3LP0A 3FK4A 1XQSC 4W5OA 1HBMB 1S0MA 1RT2B 4OI2A 1EHWA 3JAMU 4ID5B 2JNJA 4E7KA 2XYHB 2CQDA 4CWBA 3TZWA 3LWLA 2JZ5A 3TSQA 3C14B 3CWJA 1UKUA 4ECWA 1IJJA 2G8FA 2Y0BB 5A2QY 3FC9A 1YTUA 4I7FB 3D2EB 3FMWA 1R6VA 2WRMA 5F3TA 4BC5A 3TX8A 3MOZA 3Q83A 4R79A 3TO8A 1BOTO 3L7OA 5JVGL 1FJCA 3I9V9 2HFSA 3UO0A 4NCGA 3SAHA 1JLEA 4AQYK 4JI8J 2A1SA 4QR2A 1NZAA 1GLAG 3SXLA 4E0DA 6FD1A 4ZVQB 3VGMA 3CC7N 3C6TB 4FKXA 3QWPA 3J7AP 5GMKa 3BSOA 2Z1IA 2V69A 1UP1A 4M5MA 3PW5A 5KFNA 4OLAA 1RA6A 1WOOA 3CCES 3MMJA 3CQ8A 1WAJA 1VQYA 3CCJN 3ITHB 5DDQC 1TV6B 2O4GA 1NKCA 3KHHA 3OHAA 3TEHB 2KH9A 4LFCF 2YKAA 3GCXP 1X3NA 2JH3A 4YOXA 4J8FA 3EVWA 3EGVA 4OFZA 2AJFE 1XC9A 2VOOA 3SQGB 3BZCA 4NLOA 4KGZB 3HZ6A 2ZD1B 2JEGA 2MYFA 1YZ6A 2AGOA 3ASMA 5KG5A 1U45A 2VFSA 3MR3A 4I1TA 2F9DA 4WQ5C 3H2VE 1X9WA 4JI5F 3A8KA 3EDRB 1VBKA 3MM6B 4B1YB 1DLOB 1YBUA 2XYGB 2CKWA 4BWJA 2BJ9A 2XO7A 2RUGA 2OJ3A 2J76E 1X8DA 2HURA 5T7LB 4Y0FA 4DU8A 1TFWA 3J7YI 1WLJA 1RWVB 2N4DA 4MDAA 1VRQC 4CHYA 1ZZFA 4IO9L 2MZ1A 1RU1A 3OYBA 1NH7A 1QAYA 3SIPB 4LRFA 2JWKA 1S1WA 4DLEA 2W8KA 3EZ5A 1K9MT 4KHPK 2P5OA 4CO5A 1F9EB 4ILRA 1YJRA 5EX5A 2MKCA 1HW8A 1M5OC 1X5SA 4JI2F 2NZCA 2LSNA 2H4YB 5C7PA 2ROEA 2AJ4A 2MZJA 1S9EA 1QAIA 1NU4A 4RWTA 2HS3A 1FFWB 2OO4A 4PXCA 1KHVA 5AQSA 2YNGA 2OH2A 4GKJJ 4FM0A 1VQPS 1FHTA 2HQ3A 4EO6A 5LJVA 4A59A 4CH0S 4M3ZA 2BQ3A 3MM9A 3PEHA 4RUAA 1WSIA 1M90O 3SFGA 3EO3A 4Z94A 4DFJA 1RTJA 3DYAB 4YORA 2AJ1A 4QYZJ 2F63A 3JS9A 2GVDA 4IRCA 3NH0A 1JJ2R 3MTKA 1PC4A 4DSKA 3OFFA 3KJVB 3O3LA 5LJ3Y 1REGX 3D3CJ 3K8WA 2FPHX 1IBMJ 4WKYA 3ULDA 3DRSA 4ZVRB 2FF6A 4WP9A 1RDCA 4LF4J 2W7AA 1KOOA 4KO0A 4I2QB 3L09A 5D0RA 2BE2B 3R6MA 2CJKA 3FKBA 4F2RA 4AH9A 2HHTA 3WXLA 4WYLA 3MN6A 3QIDA 3BKUA 4JKCA 3BO2A 3OL9A 4LFAF 3H4DA 4QW9A 2G8IA 3P38A 1P1TA 4DS4A 3ZETB 4FNHA 1FFSB 4DX7A 3GV7B 3SEOA 4O55A 3I4PA 2FLPA 4YOWA 1B9DA 2VG7B 3HCXA 4Y3CA 4B17A 3CMES 4OQJA 4FK4A 3EEQA 3TUZC 2HHUA 5AJ3F 4FWLA 2RJZA 3ZT4A 1NGIA 3UPFA 4OX6A 3ZT1A 1SQGA 4BRPA 2R9LA 2MHEA 3MTJA 1FWPA 2MY8A 2EFPA 1VQNS 1RT3B 2L48A 2HAIA 5T41A 3W9IA 4NLGA 4DR3F 3CI5A 4XIUA 1BQMB 1RBUA 2NXNA 5C2CA 3BYRA 9RUBA 4L75A 2JVOA 1H38A 2KLAA 4W5QA 1RHMB 1N36K 5KFUA 4OKEA 3CPWR 2M8HA 4F2SA 1SJFA 1K44A 3H4BA 1A5XA 4DB3A 4HACB 1RWPB 4OPHA 4ELUA 2PFFB 2J0QD 1QVGR 2HNDB 4LREA 5BPMA 1HKCA 3W5YA 1VQ5S 1CJUA 4C8YA 1FKOB 1CQNA 3VQ8A 2PAVA 4JI1F 5KFCA 3HVTB 5CYMA 3HKWA 2Q1NA 2QLFB 1VC0A 3R6LB 4NXNK 2NUBA 1FK9B 4CGFA 4J91A 5SUHA 2ZHOA 3KKSA 3AGKA 1J5OA 1AYEA 1WORA 4JKAA 4XH4A 2HQIA 3WNFA 3CDBA 4TU7A 3D1HA 5HVHA 4L74A 1LW0B 3J7YU 4A8YA 3UDLA 2PGCA 1BI4B 3LDQA 4ED0A 3VESA 1N32J 4FPIA 4J9KA 1NMDA 1KTQA 5HJXA 2ZM6J 3WEEA 2LFVA 1JX4A 2MKJA 3DGPA 3W9HA 1OY9A 4CJQA 2R42A 5ETLA 1TFYA 1IBKJ 5AE3A 5HJYA 2CJXB 4P6QA 1DGKN 4B3RK 4CZCA 4J9NA 2F4FA 1RE1B 5HVFA 3CNQP 3D6TB 3MR6A 1VC6A 1HL6A 1WTBA 4HDHA 5LL6d 3AB2B 4BG8A 1UFKA 1XMOJ 2ZH9A 2VBZA 1SS6A 1VK3A 3TSPA 4GVMA 2KG0A 2E2QA 2DR7A 2H5IB 4X65F 1V4SA 2FZKB 4ES1A 3PRDA 1OH5A 1Z2ZA 4ECUA 5IT9Y 1QD1A 5KQ8A 3OYFA 1RAGB 3G4SN 1U1LA 1RYRA 1GT8A 2YQ1A 2C3PA 2QWPA 3FSYA 2P9KA 4M5NA 2R7SA 1AUDA 3TUJC 1NGGA 4BQLA 3CD0A 2Z2ZA 1RHUB 4UQTA 1S1UB 1FNOA 1H2UX 4GVEA 4UQGA 2R8KA 3P49B 4OO1J 1KSPA 4QW8A 3WIUA 2KW4A 5GMEA 3OYEA 1M1KO 2V0NA 2YWFA 3GFZA 2FBVA 4RJVA 5HAOA 3GYNA 2V68A 2IS3A 2HHHJ 3JYTA 4M95A 3P39A 2HF3A 3H5SA 2IGIA 4C3MA 3IAYA 2MKHA 3TJAA 1LV5A 2HHVA 3RRHA 1ZYQA 2YKOA 1Z25A 4LF5K 1MWYA 1HWJA 4MYTA 1RKJA 3BEGB 1UVJA 4RBVA 2XC9A 3VF4A 3C7NB 2Q3PA 1LFWA 1YITS 1KAXA 1C0UB 4OYIA 4RBUA 1NGJA 3DDIA 3VA3A 4FVUA 3LP2B 1ZM4A 1IKVA 1E6YA 2QI2A 2P9NB 3HHLC 3G71S 2YHBA 4WTOB 3FZ2A 4CLKA 2EI5A 4PG7A 3KNGA 1XBWA 1XK8A 2EWHA 4LRBA 1Y64A 5BPNA 4F4WA 4D3GA 3AVFA 4C23A 1FEHA 1QQCA 4WP8A 1OPZA 3OVSA 4EFAC 3TZXA 4DV1F 3J80O 1V6HA 4DTPA 3CCUN 4OIXA 2C3UA 1WKJA 2BKNA 3MXIA 5BPLA 4NYNA 3M6WA 5KFOA 2G4BA 4BE1A 4OKJA 1EQMA 4DQPA 2O8DB 2W8LA 4BGBA 2UUAJ 1NK9A 2HZAA 2HBQB 3AA9A 3W0LA 1VSMA 3SCJE 4LMZA 4GC7A 4CK1A 3HSTB 4YHHJ 2HBKA 4B1UB 4KHWA 2FLNA 1ZM3A 2JWLA 4NASA 4X64F 2LCWA 5G4DA 2ZH3A 2XRIA 4K8XA 3O4QA 3DMJA 5DETA 3RW6A 1XNQK 4O8KA 3OW2R 4YDXA 2Z8QA 3QLHB 2MDAA 4A2BA 1WJ9A 2IDEA 1TKXB 2RE2A 4BGAA 1ZBHA 1HBMA 1RT7B 2VQEJ 4CEDA 3KTQA 4TU9A 4ID5A 5B0AA 3CC2N 3D2FA 2F7VA 3L2UA 4FDFA 2KRBA 1VCTA 4LRAA 4NZ0A 4Z7YA 3C14A 3D0GE 3DXMB 2O8CB 2DNMA 5BYRA 3UE2A 4EBEA 2B9YA 4CJ3A 3JSMB 5D0EA 2CPHA 3IMQJ 3KK1B 1OJ4A 2I0XA 2RKIB 3T6JA 2OCEA 4BRIA 1UJ5A 2XY5A 4DR7J 4JK7A 3KWMA 4KJIA 1JLCB 4P7VA 2D41A 4EP4A 3AVKA 3VAMA 1UWBB 4CEBA 5CYQB 3V2UC 2CADA 1YX2A 2KI2A 3KUGA 3TVYA 3S3MA 2R7OA 3NS7B 4BC2A 3KWIA 4J37A 2KG1A 3C6TA 3HL8A 2UUBK 1Y4ZB 4TY8B 2V2VA 1S9GB 2VD3A 2V8PA 4JI4F 2P6SA 2QIFA 4DUZK 2GAHC 2Q66A 4CFBA 1T95A 3B82A 2AX1A 5HRNA 4PWWA 4KBOA 5A2QO 3ITHA 2W9AA 2GIQA 2YPYA 2F9JA 2CQ2A 1GK8A 3M8SA 1O5JA 1JLAA 3DLLQ 2XMAA 1VQ8S 2B8PA 2F5GA 2BJ3A 2ZD1A 2XMWA 3Q0AA 2QX0A 2DPJA 2NZ4A 2M5YA 4L8RB 5KG4A 2EC2A 4LBPA 2V2ZA 1TUYA 1U4BA 3H3NO 1ZC6A 3VAGA 2BQUA 2CPFA 3EM1A 4DR2K 4W98A 2VFVA 2FLLA 3QGHA 4WFNQ 2DPIA 1VQLS 5T7LA 4BRNA 1JCGA 3S6EA 2ZJQL 4CE9A 3ZSQA 3DU6A 4PUOB 2E2NA 3HHKA 3KUEA 1VQSA 2OA8A 3UN3A 4JI7J 4RX6A 3JS6A 3BO4A 4H0OA 3NGDA 1YSJA 3CCTA 4OLBA 4OYZA 3TTDA 2GV1A 4L72B 2D3O1 3I55S 3D1OA 4KHPF 4FK2A 5FRNA 3VZHA 3K9JA 4U8YA 4DWIA 4UY8T 1Z05A 3THVA 1IBLK 5KFDA 2I2YA 2FSKA 3FBBA 2QWOA 3CJ4A 4L73A 4BCAA 4GO7X 1OO0B 4CJVA 4FZYA 3AB4B 5FLXU 5DGAA 4NLUA 4ZP8A 3D7SB 2DFHA 3DYAA 3BF1A 5J1PA 4RW7A 5GADP 1VQ7N 1HQ2A 2BJ1A 4FYVB 1WF0A 3F5TA 4FZXC 1DURA 4CHQA 2ATQA 4OHVA 3H08A 5LMNJ 4DV5K 3L4BC 4C98A 1NG9A 2OTJN 3KLGA 2B3TB 1YXQA 2VPXB 3P83D 3KHYA 3AA8A 1Q78A 2EWSA 4DV4J 2GWJA 3AHPA 1KAZA 4FBTA 4H4KC 3SK3A 1EARA 4J9QA 3M2RA 2BE2A 2KDOA 4JKDA 1DZ5A 5A8WA 3NLCA 3V9UA 1KXPA 2F4VK 3SYZA 1FERA 4DR6J 1VBXA 4XPCA 3VAHA 3KLEA 1VJWA 1BUXA 3AJ1A 4DV3K 3SQ1A 4EUVA 2XHCA 3Q8QB 4FJHA 3P96A 4PKDB 2ZITA 2VC0A 2W4CA 3UKUB 3DXBA 3BZKA 3Q23A 4HUEA 1HYZA 2B9XA 4YOEA 1SKSA 1S0VA 3M2VA 2VG7A 4FJGA 4JB8B 4IEEA 4K43A 1SJ1A 2V6AA 1RJJA 1T9VA 4NCBA 2P9SB 4CEEA 5K8OA 2I7NA 1C1BB 3BH6B 1Y0HA 4FWNA 4M5DA 2Q97A 3TOQA 3P4UB 4P74A 2X78A 1T9YA 1RHJB 1RT3A 2IRYA 3K2PA 4JI0F 4FXWA 1XR7A 1BQMA 2G9OA 1T0TV 2V51B 3Q8RB 1EB0A 4M3WA 4Z4EA 4OZ2A 5E3RA 4F4XA 5HRSA 1WOQA 4BDYA 1HYSA 2NLXA 1F6TA 4ZPCA 2I7PA 4USMA 2BRLA 2NXCA 4YOVA 5C24A 2KT2A 3MCSA 3OVAA 2WSFC 3SJHA 4HACA 4JYAK 4DQSA 2JLFA 1KVAA 2I5JB 1WC4A 2J8AA 4X2BA 4MT1A 3DFEA 3CCRS 4TQRA 3SAGA 3D6HB 3UVJB 2FHJA 1FKOA 3OD2A 2FZGB 3MMCA 1QE1B 2VPYB 2WCXA 5E33A 3G6ES 3HVTA 2BJ7A 4O23A 1K47A 4NMLA 4Q2LA 1Y5NB 1VQKN 3X3UA 1R8HA 4H5TA 4OPKA 3KD5E 2CXEA 3VGSA 2H3GX 2M52A 1VBYA 4H5VA 4FXVA 3A2FA 1XMQJ 3V81A 1LW0A 1FVSA 4GW6A 1HARA 2HPUA 3NEKA 5CYJA 2VICA 5BN8A 2E5LJ 2KKZA 3WZ0A 3KDOA 3VQCA 3HF5A 1HD0A 2AEMA 3HSCA 4DR4F 2VA3A 2FGCA 1RHKB 3GCWP 3K57A 3IM8A 2G8UA 2FVSA 2X51A 1G15A 2CQ3A 2EBEA 2V8VA 1SJ3P 3ADAC 2LEPA 3OLBA 3OBIA 3H46O 4A8OA 2HNYB 4UUWA 4CNYA 1XNRK 4PG4A 2O8FB 1Q8BA 1GOCA 1UA0A 2KZMA 5ETOA 4H03B 2HGNA 4B3MK 5D3GB 3IBCB 1RBSA 1R0CB 3RTVA 2WTFA 1GLFO 3U4LA 4LF7J 2F7TA 1C6VA 5AXNA 5A8KB 3EVMA 4KIAA 3FQLA 3VA0A 3HVRA 4MAKA 1OH8A 2IRUA 2FHOB 2JRSA 4QPXA 5AQWA 1S1UA 4C11B 4W4MA 1WC1A 4S0MA 4WQ4C 4AT1B 2IY5B 2BJEA 3BSCA 3K59A 5L1KA 4CTAA 3CJRA 1RK8A 2RN2A 1N5QA 2O1PA 1BUPA 2RIJA 4NXMK 3D0PA 1OWXA 2BJ8A 2ITGA 1VSEA 4RL1A 5KG7A 5LSLA 2AGQA 3CFOA 3K0JA 4RNMA 2IDLA 2GWKA 4MLEA 5IT9O 4OLOA 3T41A 2XNRA 1YRXA 1FXXA 2QMUB 3GG0A 1RUSA 5HLFB 4CZGA 3L8BA 2YV0X 5E3AA 2XB2D 1C0UA 2V8GA 2D9OA 3AAWB 1IR0A 1TUGB 2VFUA 3PFEA 2JEIA 4EZ6A 4PWDB 3LP2A 3S1TA 2NSCA 3SFUA 3VQAA 4U9RA 2P9NA 2A3ZA 1LW2B 2V4QA 3LM9A 3I87A 1H3DA 1DT9A 1D09B 2DTUA 1U2CA 5DM6L 1JKHB 3OYKA 4A8QA 4EMDA 2W9CB 3CC7S 5D0HA 1CJKB 2ZHBA 4K4ZA 3R7NB 3ZSYA 3QRQA 3C2PA 1PAEX 3TA2A 3CJCA 5K9FA 1RP5A 4NOHA 2O67A 4KHQA 3DOLB 3CCJS 1CJVB 2BDPA 2N7CA 3OA9A 3THXB 4JV5K 2YKMB 5LMUF 2R8HA 3SQOP 3JTPA 4IYQA 4RUCA 4OYBA 1SJ4P 1NCLA 3CO0P 4PG8A 4R5PA 4HH0A 2WC9A 3DJCA 2HLUA 1RLDA 3QEPA 7FD1A 5HO4A 1EKRA 2J6SA 4O3QA 5U47A 2UXBF 3L9ZA 1HR0J 2Q43A 3V6JA 3QLHA 3MZIA 2C42A 1ZTWA 1VMBA 5AQZA 4PYDA 2FQQB 1WSJA 1RT7A 4JI3K 3NE6A 3SSQA 1RWOB 3N5BA 2UU9K 5KT2A 2WVBA 2KVQE 1FRXA 3UD3P 3L3VA 1TL1A 2XLJA 3JSMA 5DQIA 2G1HA 4WXOA 1KVCA 3KK1A 3W5ZA 4B8CA 1S7IA 2C2OB 1U0SA 5HMXA 1HLWA 4BR4A 5CYQA 4EK2A 2BX6A 3PHEA 2HMIB 2OFHX 3MURP 3P8BB 3MGJA 2BW2A 3CJ3A 4TY8A 4JV1A 4MDBA 1TL7A 2P51A 2V50A 1S9GA 3UNGC 4X62K 3G86A 1L3TA 1NDPA 3AVBA 1WC5A 5BREA 3GB0A 4PRFA 1FXDA 1RBRA 3C94A 1RKIA 1AUSL 1OSDA 3P3DA 4UW2A 4MKVA 3TAPA 3QDKA 2G13A 4F04B 3CSKA 4ILJA 2IAJB 2A2DA 4NI2B 2W2NP 2EC0A 2VKZG 3TAGA 4DSEA 1KBRA 1JXEA 1X9SA 4CP5A 2GVZB 2O8BB 1GXTA 4CJ7A 4XDCA 1LOUA 4E2FB 2XS7A 4EAHD 5IWAJ 2CQPA 2CPJA 4HUFA 2QG9B 2F1FA 1QAXA 1V5IB 2Z2LA 3SQ0A 4DR2F 4LQ3A 3DLGB 3ATVA 3LGMA 3CM5A 4K4YA 3ZTRA 3MN5A 2V8DA 1I3AA 1X7VA 2DNNA 2DHXA 4NLSA 4F0HA 4ZVGA 3CETA 1Q82O 3P31A 4PUOA 2KO1A 2YI1A 4USIA 4JNEA 3A4TA 4KQZA 4NA1A 3M1VB 2W7OA 2L9DA 4HI2A 4H0YB 3OXGA 4ES2A 2M2BA 1K8KB 5B0EA 4OHYA 4CERA 3W7BA 2CZ9A 3P6YC 4ED5A 9ATCB 5D4NA 2VG6B 3QFHA 4I6AA 4FW2A 4FJJA 3MXJA 2LYVA 2JEFA 4I69A 2DCUB 3LDNA 5EGYA 1N56A 4RW9B 2CGJA 2VV5A 5ADXH 5LOQA 2DB1A 1K8AO 5J2QB 1GQEA 4RU2A 2E20A 1UEVA 2XWXA 2FD2A 3NF9A 1WHXA 4OYAA 5ITHA 2BH1A 4LR9A 4ZPAA 3NGZA 1GMUA 2HZCA 2X1GA 2ZH6A 3NF7A 4NLYA 3VZIA 3RJMB 1RBOB 3LM2A 1OY6A 2QFJA 5TKYA 3J80U 3OJUA 4CJKA 4LFCJ 1RNHA 1Y3KA 1UJ6A 2QM1A 1ZM2A 4H0PA 4WWSA 4ECYA 3W62A 4HVZA 3MMVA 3AOAA 2WW8A 5GAEI 3T9ZA 1UVIA 1GEHA 3LDPA 4NRUA 2KXNB 4M5LA 3IFRA 4JI5J 1IBCB 4ECTA 4IOAQ 2FY8A 3FRYA 3TANA 4CLTA 4ED3A 2U2FA 1BXNA 1FNXH 1Q8KA 3DOKB 5AXKA 1R0BG 3T9NA 3OTBA 2FHJD 5THWA 3N6LA 3HLUA 2B9EA 2R2TA 4XAKA 2F4VF 4FL9A 2Z30B 1NNDA 5M1OA 4QCLA 4BACA 3K89A 4P52A 5KFPA 1UL3A 4WZMA 4NLQA 3ZZYA 1NJYA 2ZC3A 1IXKA 2ZBRA 2KJWA 1F9FA 4CZJA 2R7YA 4Q45A 4K41A 3O9TA 1U26A 2HK2A 4I9QA 1L3SA 5HL7Q 2P9SA 4Q5VA 2CQBA 3BQ0A 1ZETA 1RAIB 3L0QA 5J2PA 3SUPA 4IOCQ 1M5SA 4K5RA 4A5AA 1Q5VA 5EX0A 1C4AA 3JTOA 3C46A 1U6BA 2EKYA 2CPXA 2M70A 2H54B 1VQ6N 2K1RB 4DV0F 1SVDA 3JQJA 4CGJA 2DR6A 3M8QB 1SUQB 2WBNA 3IBWA 2IM1A 5DQHA 2WBRA 3QSYB 2CDRB 4WXWA 1OIAA 1NU0A 4J9SA 1HJOA 2RS2A 4CJTA 4X4RA 3R5JB 4O4RA 4FPAA 1N34K 5A2QU 4G1QA 2F8MA 2DGQA 4HKQA 3TAEA 2AMCB 1ACMB 1BU6O 2ZNZA 5A0YA 1RHQB 4L3NA 2FC8A 3P1GA 4DL7A 4KH5A 1DARA 3G4SS 2D0AA 2AYEA 2BKOA 1WOSA 3OL8A 2LQ8A 2COLA 1MWKA 4Q43A 4FM1A 2BUNA 1JLGB 3SUOA 1HWKA 3QAEA 7AT1B 1DTQB 1SQKA 4CM2A 1N6QB 3AO1A 3ZSXA 3H5XA 4IJAA 2JWNA 3G9CA 5FROA 4Q2MA 2EG2A 2GMLA 3A1YG 3AAQA 4OJGA 3ENBA 2MZTA 3MUVP 2EVZA 1C1AA 2HFVA 3GYGA 4LFAJ 3B4DA 2XGQA 1HNXK 1B92A 1DTTB 1X0PA 1M0SA 5AFUH 1VK8A 4A62A 3POTB 2P9LA 1X4HA 2AP6A 3V6DB 5KT4A 5ETVA 1NGFA 1D3WA 1C1CA 3OTOJ 4PABA 2YQ0A 3OPKA 1S1VB 5E0OA 1VIOA 5JVHQ 5KT6A 5HVGA 1OH6A 5AJ3J 2DVIA 4FVCA 4FNIA 4RBTA 1M1HA 3FGVA 4BHQA 3C95A 1Q18A 1C0MA 1EETB 2AKWB 3T1YF 1WWHA 5F8NA 1QZ6A 3LANA 3UI3A 4B1ZA 3IDHA 3T3FA 3M6XA 4OX8A 2Q36A 4YQWA 4MK9A 4CF9A 2FVPA 5BJRA 2MSTA 2YKNA 1CQMA 3CCUS 2DH9A 1MSWD 4FJ9A 5D3GA 3LP1B 4CH1A 3THTA 3HYFA 3O6WA 3VTIA 3JB9k 3T5JA 1VLOA 4DPYA 2G0IA 4ILGB 1H2TZ 1RAFB 1SC3B 1VC5A 4LF6K 3DRRB 4F36A 5DM7L 1F2HA 4KFBB 4CI0B 2CWKA 3PR5B 4AHTA 3K5NA 2MSSA 3BR9A 5CCMA 1J54A 3KK2A 1VK0A 2Q79A 4JI1J 1B3TA 4O4GB 2CDQA 3KHLA 4DFPA 3VF6A 2JLEA 4OZ1A 1ZTTA 3VQBA 2GJ2A 5GAEU 3KLVA 3G2XA 1NB2A 3M9NB 1W25A 3GJRB 1U1NA 4DTOA 2VKRA 3GFYA 3CC2S 5ETQA 3HSJA 4D3HA 4UY85 4WFBQ 4NXMF 3OXFA 1S97A 3IFEA 1SKWA 5FPEA 1QVGM 4NMXA 3LH2S 3R9PA 3M8PA 3RAXA 4B8AB 1U6ZA 2QFIA 2OFGX 1LOTB 1IWGA 2QO3A 2IMWP 4RTFD 2Q31A 3PIPQ 1Z2LA 3O1LA 3DLEA 1TVRA 2GO9A 1LW2A 1DQ9A 4IJNA 4LR7A 5DDPC 5KG6A 3SI8A 3OFEA 1NUEA 2HRTA 3Q8SB 3AVJA 2ZUAA 4U7UD 1YRTA 4LIRA 5F8JA 2ZEJA 2UXCK 1CJKA 4JI8K 4NPOA 4BRGA 2Y1RI 3NFAA 4F4AA 5KFXA 1TKDA 3NG8A 4TYBA 4QWEA 4OZ0A 2DO0A 2P6TA 2ZUGA 4PXBA 2D69A 1NKBA 5DRKA 4IG0B 4C8KA 3IWXA 2J0XA 1HKBA 3NS5A 1KWMA 1CJVA 5GAHP 3A0IX 2G2ZA 3CJBA 1NDCA 4CF8A 1JXBA 3TVKA 4X65J 5I9EB 2NXEA 2LQ9A 4UY8O 1HW9A 2RQMA 2WB4A 4DSJA 2XMKA 2M3DA 2BMBA 4J2EA 4H0XB 3IGVA 4ED4A 1Y7PA 4USTA 3GJTB 2HOEA 1N0UA 4ZJOA 4FS2A 1E4GT 4FLVA 2H1YA 1FXRA 4JUZA 1QVFM 2D4WA 4BRCA 1I5OB 4KHYA 1E3MA 1VQON 2LKZA 3GQCA 1OH7A 3CIMA 1CS4B 1JNRB 2DEIA 3QGPA 2XI3A 2ACYA 3M6GA 2CA9A 4Y65A 5D8HB 3MWTA 3WQTA 1FKPA 2ACMA 2MLYA 2DNZA 3R7BB 2HIQA 1Q8LA 2GC8A 4AILC 2DYAA 3HD2A 2DK2A 3UE5A 2FBYA 2RPIA 2HBMA 1RT4A 3GE9A 1SL2A 2HMIA 3HM8A 3UCUP 3S41A 4OHXA 3MAAB 1UW9A 3TRGA 2GA7A 3QT6A 2QA1A 4LF9F 1DHMA 1VSHA 5L1JA 2KU7A 3H0PA 4E7HA 4X4NA 2B6AB 4GNIA 4RLEA 3QT8A 2B8QA 4KTWA 4CJWA 1C0TA 4GKJK 2DGTA 4MIBA 1RBTA 1WSGA 4N7TA 3BDEA 3AVNA 4DV1J 2G8KA 1RAJA 3BBCA 3BBFA 1AFIA 3OR1A 2RMLA 2IAJA 4RW4A 3I0RB 4Y2AA 3M3ZA 4FWMA 2DHHA 2W4DA 1NGDA 1VQ7S 1T3OA 2DJWA 4DQQA 1YJ9N 4FLZA 1YHQN 2DRBA 2LLZA 4DQ8A 1YDLA 2PE8A 2GVZA 2O8BA 2ZE2B 4QYZK 2QEXN 2RT3A 2OTJS 3F9MA 3CGIA 4I2PB 2OP5A 1IG8A 3GFHA 4EEYA 2DBBA 4FF4A 2Y3YA 4BC9A 2A5XA 3AVMA 3F2KA 2GIFA 1IBMK 3DLGA 2HHXA 4MH8A 3HFVA 4B3OB 3CD5A 1NMNA 2HBLA 4AHVA 2K7KA 4CJLA 4LF4K 3QQCD 4UOCA 4BC3A 4ICLB 3OTEA 3V9XA 4X66F 4HH1A 5KI6A 4LSNB 5A6WA 1JLBB 4EHUA 2NR0A 4DOZA 4FF3A 1HNZF 3M1VA 3VENA 2IRXA 4EI2A 1XJWB 3JSRA 2HW3A 2QZ8A 2VWBA 4ZTJA 2GTDA 5IT9U 2ZH7A 1NK0A 2DXDA 3B54A 3K5PA 3W63A 2EG1A 5HP1A 1WN7A 4IBNA 3NH1A 1I1GA 5C15A 4A8SA 3IXQA 3MD3A 3UKRA 2PD1A 2PMHA 2JGUA 2O3DA 1X4FA 5J2QA 2Q2RA 1K73T 4QWAA 1YZ7A 4PL7A 1WC6A 4FWOA 2A18A 4DBQA 4OZLA 3FFKB 2NREA 4JI4J 2H48B 3QYYA 3NKYA 2OHDA 3V6KA 1UW4A 4CH7A 2HBZB 2W9BB 1RU2A 1F5AA 1LWEB 3FZFA 4WFAL 4YR2A 3LP0B 2XG8A 1GTEA 3NCPA 5LT5A 5CXTA 1MWZA 3WXJA 2QA4N 5HN0A 3AVHA 1LWCA 3EE3A 4KGKA 4F25A 2DR5A 2A41A 4CBWA 2E66A 3MM7B 3W8PA 2VASA 5DQGA 2VB6A 3EPIA 2EKNA 2PIIA 4E1MA 2A2CA 1IKYA 3EGNA 4G9ZA 1PJ6A 2YKPA 4DQIA 3M32B 2BOPA 2V4RA 4KRWA 3US5A 4CLUA 1JLEB 2CQ4A 1NK4A 1UEKA 3VHQA 1VQKS 3UIQA 3CDAA 1G4CA 1NGCA 2H5JB 3CXCR 3THWB 1JWWA 2ZFHA 1YJUA 1RLCL 4DG1A 1RWKB 4TN2A 1BWFO 4GV9A 4JHDA 4GKKJ 5CABA 2XULA 1I94F 2MTLA 1YJWN 1S7HA 2FLOA 3B6PA 4B1XB 2HK3A 5DJBA 4KHPJ 3WT0A 4B3TK 2MQPA 3M6VA 1IKXB 1HLUA 3IP0A 4KI4A 2BANA 3AO2A 2HQGA 3K58A 4Z2XA 5LY3A 4YOTA 1N32K 4KR0B 4NA3A 4ZPDA 3ILLA 3W66A 2MHNA 3QESA 2ZM6K 2VZ9A 4CO4A 1X31C 2GUIA 3M8QA 3I0SB 3CMAN 1ITGA 1X9JA 2GFFA 2BTFA 1NSKL 4ECVA 3CJSA 3HP9A 3R8YA 5KRSA 3QBWA 3GTYX 1KEKA 2HFOA 1O13A 1BG3A 3NBPA 2OANA 2V2KA 3V1OA 3AVAA 2D0BA 4BRHA 2KHDA 5AQXA 1U09A 4ZVFA 1N34F 1XMOK 3DN9A 3AA3A 1IM6A 3TSUA 2DFFA 3EMTA 2ZBQA 3SSSA 4OPAA 4M3YA 4U67L 4OJ3A 3MOJB 1NSAA 4WU3A 1HYVA 1N54B 1YJNN 1B0VA 4LUBA 3GR0A 3BREA 4KGVB 5BYQA 1JLGA 1XEZA 2FHKA 5AQPA 1N6QA 3M8WA 5CHIA 2APOA 3FNNA 3OR2B 3NGSA 1R0AA 2FXUA 2OEKA 3PX6A 2FVQA 5M2PA 3NCRA 2DISA 1DTTA 3AD9C 4FYXB 3RB4A 2XHWA 1HJRA 2HHHK 2QKBA 2L41A 3A8IA 4KSEB 1HNXF 4CZLA 1S1VA 4IDKA 3LUYA 4KKOB 4H4OB 2UZAA <