4IG3A

Hiv-1 reverse transcriptase with bound fragment near knuckles site
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
total genus 167
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ig3A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig3A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig3A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig3A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ig3A05
1FKOB 4DTOA 2G8UA 5I42A 3RR7A 4CJ3A 2HNZA 1SV5B 3FSIA 1W25A 4NYZA 4EYHB 1S6QA 4FJMA 1RBUA 2WCXA 2OZSA 4Y1CA 3OYKA 2HVHA 4F8RA 5SZTA 1NJWA 4ECYA 3H59A 4K4XA 4K8XA 1KLMB 1CLQA 4YFUA 4Z0UA 4FYDA 2VWKA 2R2UA 1C0MA 1TAQA 4KHSA 1IKVB 1BISA 3I0RA 4E1NA 3KK3B 4CJKA 1MU2A 3OYJA 3LZIA 3OSNA 5KFPA 4CEBA 4IKAA 1NKCA 3VQ9A 1RDDA 3KLFB 4KAIA 4CECA 3F9KA 4DS4A 3V81B 3QIPA 1B92A 1U4BA 2ZD1B 4HCCA 3VQQA 1J54A 4EBEA 4B8AB 5FDLA 2I5JB 3AO5A 2KTQA 4JUZA 4CK2A 3VQCA 4HCBA 1EP4A 3SUQA 3FRZA 1VSKA 4FZYA 4CHPA 1FK9A 3DLEB 2XY5A 2ZKUA 4NCBA 2VA3A 1S4FA 2AX0A 4DLGA 2YNHB 1JXBA 4CGFA 3NH1A 4IH5A 4M3XA 3DOKB 5F9NA 4Q44A 4ZTJA 5FRNA 1JLEA 4MKBA 3PW4A 1RDAA 1QHTA 4O0JA 4CJPA 1S10A 2CKWA 1BQNA 5C24A 4NCGB 5J2PA 3P1GA 1IO2A 4FLVA 3OYFA 2DPIA 1WSEA 3QNNA 2ITGA 3AA3A 5KRTA 4FK2A 4FVMA 2ASJA 3OS0A 3KD5E 4O0IA 3MTKA 2BE2A 4FJGA 3TAMA 3KKSA 3I5CA 3VQDA 4CESA 5KFXA 1TL3A 4NLWA 3IG1A 3GIMA 3GIJA 2OA8A 3AO2A 5JUMA 2BGGA 2VG5A 2IBKA 3LANA 3CFPA 3RTVA 1ZBFA 1NK5A 1NKBA 2VG7B 2W9BB 4G1QB 3FQLA 4FZXC 3DLKA 3MEDB 4CEFA 2YNIA 3QEIA 4ID5A 1NHUA 3AA2A 3QEXA 2D3UA 5F8NA 1EX4A 4RNFA 1SV5A 3SQ1A 1ASUA 4CEDA 2UVUA 4B08A 2V0NA 3KLHA 5KFGA 3D45A 1SUQB 4BWMA 3OYIA 1RNHA 4DFPA 1SL2A 4F4YA 1RA6A 3BGRB 4NLDA 4FCYA 5HLFA 3V1QA 3IN5A 3PR4A 1R0AA 2HNYA 4CF8A 3VQ8A 1L5UA 2A1RA 2HHUA 2G8WA 4FJKA 2GBZA 3QETA 1UOCA 4B8CA 4PY5A 3KK1A 5HP1A 5EDWA 2G8FA 4IRCA 2RKIB 1JLCA 4J9MA 1BCOA 1DTTA 1SKSA 2DPJA 5KTQA 5HRPA 4I7FA 3K2PA 1XHZA 3NF9A 3KJVB 1LW2B 2JEFA 4ED2A 3ZSOA 1N5YA 4O4GA 4RZRA 3AVIA 4KI4A 3UPFA 5F8MA 4E7JA 4TQRA 1I3AA 3OYDA 3QLHB 1HQUA 5KFHA 3H40A 2DTUA 1JKHA 5DG7A 1D5AA 1U47A 4F50A 4J9SA 5KFIA 3I8DA 3I5AA 4B3OA 2YKMB 3RWUA 4J2AA 3BSNA 3V6HA 1ZYQA 4Q45A 4Y2CA 4LSNB 2BRLA 4CFDA 3OHAA 4ECZA 1HNIA 1LWCB 3V9XA 1XC9A 3AA5X 2AWZA 2R2TA 2Z1IA 4AHRA 3IS9B 4ID5B 4C8MA 4CF1A 1RBVA 4YMEA 3E01B 1D1UA 2IM2A 3VN5A 2ETJA 4XO0A 3WNEA 4QCLA 4QOZB 4IBNA 4DL2A 1S0NA 2FBXA 2UVWA 3AVLA 4DTPA 5K14B 1LW0B 3DOLA 3K5MA 4Z4CA 3SV3A 3AVJA 4WZMA 3K5NA 5J2NA 4FBTA 2FJVA 1ZETA 2JC1A 3HXMA 4TY9A 4QW8A 3PJXA 3EZ5A 3NCIA 4QWBA 3DM2B 1BQMB 1B9DA 2BQ3A 4CJLA 2AU0A 3VQSA 4FBUA 4RW9B 4AHUA 5KFBA 3DRPB 2YKNB 1QQCA 3KHHA 1JLFA 3CVKA 1S6PB 4WXWA 4E1MA 1RT1A 2D0AA 4M3ZA 1Z26A 4CEEA 4M94A 3NH2A 4G3IA 4N41A 4C8OA 3LP2A 5KFAA 4O3OA 4CF0A 2XC9A 4O55A 2Q3SA 3RRHA 3L3UA 3NGIA 4CEAA 3QGHA 1J9AA 3DRSB 2W8LA 5KG2A 3HVRA 1NK4A 1IG9A 4R8UB 5FRMA 3CJ2A 5CYQA 3OL7A 3I5BA 3ZSQA 1S1XA 1WLJA 4ZP7A 4DL4A 2DFEA 3AO3A 2I5JA 1C1CB 3V9UA 1JLBA 1T94A 3MXJA 5KGXA 2R2RA 3H2LA 3KLFA 1DTQA 2GIQA 3Q8PB 2ASLA 3NHGA 3ISNC 4ZVGA 3BSCA 3V1OA 4I9LA 4CFAA 1N4LA 1WSJA 2HHWA 1U04A 2D3ZA 5DLGA 3BSOA 1QSSA 3AVGA 3MAQA 1XR7A 3KNAA 1TL1A 4KAZA 3OYEA 1QE1B 4MFBA 4NLUA 3QERA 4IOBA 4FK0A 3HP9A 3CDWA 3DOLB 3PW0A 1A5WA 2EX3A 4CEZA 2C22A 1LW0A 1CXUA 1S9EA 4KHNA 4OVLA 1BL3A 3M9NB 4TQSA 5D3GB 5DGAA 1QS4A 3AVBA 1GOBA 2E6LA 3MFHA 3O3GA 4RUAA 1NOYA 2JGUA 4KKOB 4J9RA 4CHOA 1JLQA 2HWIA 4J9PA 1S9EB 1Q9YA 2Z1GA 1RTHA 3AVKA 5F8IA 2V4RA 5F8HA 4WE1A 4DL3A 4CEQA 2WONA 5KFUA 4HUFA 1C0UA 3AV9A 2HHVA 3TANA 2IJNA 1NKEA 3TAMB 5KFQA 4B9NA 3NAHA 1YTUA 2E4LA 3PZPA 4IQXA 2KQ2A 3HJFA 1LW2A 3ZT1A 1U45A 1S1TA 2HNDA 4CCHA 5HROB 4W5RA 4B9SA 3DDKA 3RB0A 3LP1A 3GV7B 1NK0A 4E3SA 2HHQA 2C2EA 2IM3A 3S9HA 2JEJA 2OPRA 3V9ZA 4N76A 5KFJA 3WNHA 4H4MB 3LWLA 4DF4A 1UWBA 1HNIB 3KOAA 1IKXA 4QW9A 4LSNA 1TKZA 4DL5A 4AHTA 3FDSA 4IKFA 3V1RA 1YT3A 3OYBA 1SH2A 3CWJA 4Q0BB 4ZHRB 3HPOA 4CJTA 4CJSA 1RYSA 4LD0A 4Z4HA 3HSTB 1EP4B 1WSIA 2R8GA 3DLRA 4DFMA 3KLHB 3TAEA 4Y1DA 2AGOA 3LALA 1N5YB 4YR2A 2D41A 4N56A 3F73A 4WFZA 1KRPA 2PZSA 2J6TA 4IH7A 2IOCA 3RB3A 4G1QA 3OYAA 3LDSA 3KIOA 1QTMA 3Q8QB 4EP5A 3DLGB 1N48A 1MU2B 3KK3A 1C0TA 4WXOA 1RBTA 3T1AA 5C5JA 2XRIA 3ZCMA 4CF9A 4O3NA 4F3TA 2XHBA 1IKWB 3GIKA 5HRRA 3JYTB 3SQ0A 5KT3A 5HLFB 4K8ZA 3B6PA 1SL1A 5C25B 5EWFA 1XWLA 1VSDA 2F8EX 1N6QA 1RTJB 3N6MA 4PQUA 3T3FA 4DQPA 2ALZA 4URGA 1RTJA 3KLIB 3OYGA 3NKYA 4KI6A 1JL2A 1TK5A 4RW7A 4BE1A 1S6PA 3G6XA 4KREA 4OKKA 2ZE2A 3MEGA 3OL9A 1NNDA 4MQ3A 2Z1HA 4ZVEA 1TAUA 3ULDA 3ZSXA 3NDKA 4EP4A 4L8RB 2YKNA 3DOKA 3IRXA 3ALYA 1WSGA 3DRPA 1W9HA 2YHAA 2DFHA 3MXIA 5KFRA 4E7KA 2YKMA 1BQMA 4NLQA 4J9KA 2FVQA 1RTDA 3QLHA 1S9GB 4EZ9A 3KKRA 1ITGA 5KFNA 4LQ3A 3ZT4A 2FLLA 3M8QB 3PW2A 1BIZA 4GW6A 4PUOA 3KJVA 4NLRA 4JS4A 4M3TA 4R5PB 3VA0A 3PW5A 4E89A 3RR8A 4CJEA 1I39A 1BQNB 5C24B 4IG3B 4J2DA 1IKYB 4Y2AA 3KTQA 2JEGA 4UQGA 4IH6A 4MK9A 4F4KA 3ZT2A 3TVKA 3C94A 3OS2A 2IAJA 3O3HA 2HAIA 3HM9A 3SPYA 4R8UA 4Q5VA 4FS1A 2X6NA 3P83D 2YNHA 5L1KA 4C8KA 4KTZA 1HYSA 1FKPB 4OGCA 2B6AA 4OKJA 3RMDA 4E7HA 5F8JA 4IFYA 1TGOA 2F96A 4M3YA 2QV6A 1JL1A 5DQIA 4DU1A 4IG0A 3QYYA 5F8LA 4O4GB 1IM4A 5EUHA 2OPRB 5DMRA 1VSMA 3TQ1A 1JLAB 4WYWA 3QIPB 1WNEA 4B9TA 1I6JA 2WHOA 3I0SA 3O4QA 3L2VA 4M3UA 3KHGA 4J9NA 1TL3B 3GILA 3DM2A 4J2BA 3JSMA 3V9SA 4N47A 3KHRA 4K50A 4CHNA 4KHQA 3IRXB 4KB7A 3OYHA 1RBRA 1CSJA 5JXSA 1NJZA 4WFXA 3TAGA 1S6QB 1Z4UA 1G15A 4ECRA 2HNZB 4JS5A 2IMWP 1WAJA 5F9LA 3ISND 2UVVA 3CIZA 4IG0B 4NRTA 4FLYA 1TK0A 3DYAB 1ZTWA 4CJVA 1JLQB 5J2PB 1KTQA 4E19A 4FJ8A 3OS1A 1ASWA 3A2FA 4K4WA 2X6SA 3FFIB 3GV5B 3IS9A 4CJWA 4Z4IA 1RT2B 3EYZA 4EBDA 3SUNA 4BDPA 5J2MA 2X78A 3SUOA 1IKWA 4DTXA 1C2PA 3V6DA 1VK0A 3IG1B 4FM2A 4HHTA 3JSMB 3HPHA 4NLXA 3BQ0A 2OPSB 1LWFA 3I0SB 3NH0A 1FK9B 1XR5A 3KHLA 4BDZA 3G6YA 2A1SA 2D5RA 5T7BA 2HHXA 3M9MB 1GOCA 2LSNA 1RT3A 1JLBB 4Z4GA 3SUPA 1RT7B 1HMVB 5L9XA 1GX6A 2BQUA 3SI6A 4CK1A 3LPTA 1S1XB 1DTTB 3T5JA 1DTQB 4AHCA 4DF8A 4W5QA 5DK5A 4IFYB 3O4NA 2GIRA 2BRKA 5CZ1A 1KFSA 4QWDA 3NFAA 3VQ5A 1LWFB 4FLXA 1C1CA 3VQ4A 1L3TA 4FXDA 1HARA 2AJQA 5DQGA 5HRNA 3V6DB 4ICLB 3OSPA 3L2UA 3H5UA 2XY8A 3AA4A 4ECVA 5F8GA 4NYNA 5KT2A 1UWBB 4KSEB 5L1LA 2XGPA 1R0AB 1S1VB 1LAVA 3L2WA 4PA1A 2JEIA 2FC0A 3OJSA 3BGRA 3QESA 2UVRA 3LP1B 2FVPA 2YNFA 4I2PA 2O5DA 4ZTFA 4WZQA 5I42B 4QPXA 4O44A 3M8SA 1N6QB 2W9CA 1Z25A 3OYCA 4JRPA 3T5HA 4J9LA 4RU9A 2WRMA 2FLPA 3HO1A 2ZD1A 4M3WA 2AX1A 4ZPDA 5I3UA 1RT6A 3H08A 4CGIA 1J5OB 3H4DA 3KLGB 2ZQBA 2Y1JA 2VG5B 3CFOA 1C1BB 2O4GA 2Y1IA 2PYJA 4B9LA 2R8HA 4B9VA 4O3QA 5EWGA 1IKVA 2XCPA 4DFJA 1VRTA 2C2DA 3DLHA 1X9SA 3TR8A 3K58A 4DTNA 2BDPA 3HL8A 3SNNA 4RNNA 4DQIA 5I3UB 1D9FA 4FK4A 1U49A 2KFNA 3ZT0A 3EZUA 3QEVA 1KLNA 4E7IA 5KG5A 3K57A 5E41A 4FM0A 5KG1A 3QINA 3QO9A 4ZPBA 4NCGA 3ZSWA 2QXFA 3VQBA 3DI6B 2RF2B 2B4JA 1S0MA 4E7LA 2IM0A 3HT3A 2GC8A 4ZHRA 2XCAA 2B6AB 2RDJA 1WAFA 4TYBA 2E6MA 4QWAA 4FZZA 4M41A 3TWHA 1QSYA 4DU3A 3QNOA 1JKHB 4MFBB 1S1VA 4IR9A 1WNSA 1KHVA 4Q43A 1RAJA 1ZBLA 5JS1A 2BANA 5J1EB 3O3FA 5KFMA 4JV2A 4MK7A 2I1RA 3DLGA 5CY4A 1EKEA 4R0EA 3LZJA 4KHRA 2BR0A 2OZMA 1TKTA 3KK1B 3LP3A 4IRDA 3TI0A 1X1PA 1S1TB 2HNDB 4KB1A 2WB4A 1VSFA 1YVFA 4JLHA 1TKTB 2WTFA 4F4XA 3RRGA 4O3RA 1A5XA 1KFDA 4RW6B 3MFIA 1YTAA 5KG4A 3DRSA 4K4VA 4Q0BA 3H5XA 2XI2A 1HYSB 4QWEA 2OPSA 3S3OA 1HQEB 1S9FA 1WSHA 4HYKA 4CJRA 1RTHB 3SI8A 3M8PB 3GYNA 2FJXA 3MEEA 1TKZB 1KLMA 4URSA 3KMQA 4FLZA 1IKXB 4OPKA 3CG7A 1TV6B 3AO1A 1CZ9A 4CIEA 4W5TA 4KFBB 2B5JB 3NF6A 1KVBA 2RF2A 4KO0B 5L1JA 3KLIA 4KB0A 3KLVA 1SH0A 4ELUA 4R5PA 3PX4A 2IGIA 1VSEA 1CZBA 3MEDA 5KFZA 5KFFA 1RCHA 5C42A 1QE1A 3U6FA 3RMAA 4OL8A 1NOZA 3PY8A 2FVCA 1BI4A 3OY9A 1C0UB 4YP3A 1IH7A 3L8BA 3PW7A 5K14A 4F4ZA 3AVMA 4O5BA 4WFYA 1D8YA 3D0PA 3ICLA 1ZTTA 4KHYA 4CIGA 2BE2B 4FJLA 2HMIB 4DTMA 3PO4A 2QKBA 3B6OA 5T14A 1RT6B 4ED7A 3Q8SB 3RBDA 2ATQA 3NBPB 2HWHA 2ZE2B 3MEGB 2UUTA 2R7YA 2VA2A 1HYZA 3IAYA 4FLUA 5CYQB 5KI6A 5DG8A 4I2PB 2JC0A 2KFZA 4KBIA 4ECSA 4TY8A 3K5OA 3DLBA 1KCFA 4RG8A 2UUWA 4OLAA 1ZBIA 4DTJA 3LAMA 4CHQA 1SL0A 3N6LA 5KGWA 1RILA 1EETB 4H54A 3H5YA 4H4MA 1VSJA 3SQ4A 4F2SA 1T7PA 3ZSRA 2XY7A 3DLEA 3CDUA 5DQHA 2D7SA 1JLCB 2PY5A 4E0DA 5HROA 4RW9A 3KD1E 4LSLA 3V9WA 5FDLB 3L2QA 1REVA 3PJWA 3LWMA 4LQ9A 1TKXA 4BE2A 3SV4A 1SKWA 3V81A 3WNFA 1S48A 3CJ5A 3C95A 5KFVA 3BREA 1TVRA 3M8QA 3VQPA 3SCXA 3VQAA 2C28A 2IC3B 4RUCA 5CZ2A 4ZP9A 3UR0A 3I0RB 2OPQA 3G0ZA 3H98A 3H4BA 3QEWA 1QUVA 2J6UA 1U48A 1FXXA 4NLTA 3SFGA 3RAXA 2KW4A 1FKOA 1X9WA 4GVMA 4GMJB 1RT2A 1SKRA 1RT1B 1NJYA 3Q8RB 4I9QA 3KLEB 1MMLA 1JLFB 4RW7B 3NGYA 1TP7A 2GUIA 4URQU 3BR9A 5KT5A 4TLRA 2F8TA 1LWEB 1L3UA 4ECTA 1S1WB 2P1JA 3RMCA 3C6TB 4MIBA 3OLBA 4ZPCA 4C8NA 4MK8A 3QIOA 4ED3A 4DSJA 1HQEA 4FJIA 1F21A 2FVRA 1NK6A 4BE0A 3HVWA 2P5GA 3TABA 4DSKA 3LP0A 1C6VA 4LH4A 1RYRA 5J2NB 2R8IA 3NF7A 1OS5A 1TVRB 2P5OA 1T05A 4RNHA 4NLGA 4CGHA 4EBCA 4JV0A 4IDKB 4DEZA 2R8JA 1C0TB 4YQWA 2R2SA 4DTRA 2E9ZA 1HNVA 2FBTA 4RNOA 4FJHA 3MECA 1VRUB 1LV5A 2RKIA 3HVTB 3MR3A 4W5OA 4DTSA 3MECB 3PR5B 2RPIA 4XPEA 1QAIA 2DFFA 2XI3A 4XIUA 1HNVB 4CHYA 3HPGA 1BCMA 1RT5B 5KFEA 4KPYA 2ASDA 4TN2A 3SFUA 5HBMA 3PV8A 4DL7A 4DQSA 1O1WA 2VWJA 1N56A 3LP0B 1S97A 1NJXA 3GV8B 3OLAA 2YNGA 1JLGB 4CEOA 3CFRA 4ECUA 2YNGB 3QGGA 1TL1B 3QO9B 3L2RA 4TXSA 1L3VA 4Z4EA 2IAJB 5HBMB 1EXQA 1T03A 4CERA 2EC0A 4CGGA 4DL6A 1SH3A 4JV1A 5JS2A 4PWDA 4WYLA 4BACA 1Q9XA 3THVA 3DRRA 3DLKB 4DG1A 1D0EA 4M95A 5HRSA 4IG3A 2IJFA 2VG7A 2HMIA 2W9BA 2FBYA 1X9MA 3KMSA 3ZSVA 4KRFA 4AH9A 4H4OB 1RTIA 5J2QB 1VRTB 4QAGA 3ZSYA 4ELTA 3OL6A 4CE9A 1T05B 2D0CA 3V4IB 4K4ZA 1A5VA 3CDEA 1J53A 4ZP6A 1GOAA 5KFCA 2EHGA 1RTDB 2FVSA 3UIQA 3MR6A 1VSLA 3RB6A 3CM6A 3SQ2A 4ZMMA 2W9CB 2AQ4A 2GV9A 2G8KA 5KFOA 4O44B 1TQLA 2WOMB 3PO5A 3SYZA 2KZZA 3KLEA 3T5LA 4I2QA 2PYLA 4QWCA 2OYQA 2W8KA 4OJRA 1ZBHA 5EU7A 4F4WA 4DMNA 4DSIA 3M9OB 4CJFA 5FROA 3V6KA 4NLYA 3N6NA 4MH8A 2G8IA 4KHUA 4FW1A 2OPQB 4ID1A 4HUEA 3OHBA 4U7CA 1KHWA 2Z1JA 4FJ9A 5KG0A 3TAQA 4ECWA 4RW6A 4FW2A 2RDIA 4MIAA 5CYMB 3QIDA 3IGNA 3V4IA 1W0HA 1XI1A 3VQ7A 4HKQA 1U09A 2DY4A 4W5NA 4Y34A 4OKEA 1REVB 4KTWA 4LY7A 3KK2B 4ED0A 4EZ6A 4FJ7A 1RT3B 4EO6A 4FJXA 4B9MA 2FJWA 3MXMA 1DLOA 2C2RA 4EEYA 3VQEA 2HHSA 1DLOB 5HP1B 1UA1A 5KFDA 5DLFA 4IR1A 2AGPA 4O3PA 2YHBA 4NCAA 2NUBA 5KT6A 3NAIA 3NF8A 3NMAA 4DSFA 1VSIA 1LWCA 1BI4B 2R8KA 1LAWA 1XHXA 1NK8A 5KFLA 4O4RA 5J2MB 4C8LA 1RDRA 4GC7A 3AVAA 3PX6A 4B3OB 4F3OA 5KG6A 4K4TA 4TSXA 4DU4A 4RW8A 4IFVA 5KG3A 4J9OA 2AGQA 3VA3A 1D9DA 4KO0A 3EPIA 3NGZA 3NE6A 5KT4A 3BDPA 1K1SA 4ZVHA 5L1IA 2P51A 1T3NA 1S1UA 4CFBA 1XR6A 3SZ2A 1BGXT 2HB5A 3L3VA 1ZBUA 4ED1A 4DWIA 4RW4A 3D28A 1NK9A 2IDOA 3M8PA 2IS3A 3EY1A 1L3SA 3OL8A 4OGEA 4CIFA 1WSFA 1RT4A 2OPPA 1S49A 4NRUA 3RBEA 1KSPA 4B9UA 3QEPA 2IM1A 3OJUA 4H8KA 4DQRA 5C42B 1S1UB 3BSAA 2QK9A 5J2QA 3RAQA 3PVXA 1NHVA 4X2BA 3T19A 5KG7A 3G6VA 2G8HA 4RW4B 3LAKA 4CGJA 4ED6A 1CXQA 4BWJA 2OH2A 2W42A 4TYAA 3WNGA 3U3YA 3TAFA 1T8EA 2FBVA 2QKKA 5KFSA 3DMJA 4RW8B 1S5JA 4CFCA 3E01A 3CO9A 2WK4A 2FLNA 4PWDB 2YNIB 1FKPA 4OPJA 4MKAA 1RBSA 4FM1A 1JLEB 4KFBA 4NLOA 4NLPA 3RMBA 1TV6A 5D3GA 3NL0A 5DGBA 3ITHB 4IFVB 4ICLA 2RN2A 4M45A 4EYIB 1TKDA 4OLBA 5KRSA 4KV8B 4O3SA 1JLGA 1IKYA 1HYVA 3CJ4A 1HQUB 2IC3A 3C6UA 3FQKA 1TK8A 4AHSA 3ASMA 3V6JA 4FS2A 4ZPAA 3MR2A 1BHLA 3AVHA 3K5LA 5KFYA 2G8VA 3KK2A 4PUOB 3QZ7A 4I7FB 2X74A 3OVNA 4DSEA 3EPGA 4IRKA 3HP6A 1RDBA 1VRUA 1B9FA 3ZSZA 3HKWA 1RA7A 5EWEA 2HVIA 4NZ0A 4ZP8A 4FJJA 4IDKA 1K6YA 2BANB 1JX4A 1EETA 3RB4A 1HRHA 4DQQA 2V9WA 3M8RA 4YR3A 5CYMA 1JXLA 3U3GA 3OYNA 1J5OA 4ZVFA 2HNYB 3NAEA 4EO8A 3BJYA 4Y3CA 3NGDA 3TAPA 2V4QA 2HW3A 4K4YA 3FFIA 4TY8B 4NYFA 3DMJB 3DI6A 3LP2B 3G10A 3C6TA 1SUQA 5KFTA 1LWEA 4PQUB 3VQ6A 2JLEA 3SJJA 4M42A 3CJ3A 2F8SA 4RNMA 2VG6A 3HVAA 2YV0X 1Y97A 5C25A 3ZT3A 1QAJA 3S3MA 2W7PA 2BQRA 3NBPA 3AVNA 5KT7A 5DG9A 4ELVA 3QZ8A 3UQSA 2WOMA 4FLTA 3JYTA 2E9TA 4HUGA 1UAXA 1WN7A 4K4SA 4CJQA 3MEEB 1RT4B 2OPPB 4CGDA 3PX0A 1KVAA 2XWYA 3T5KA 3AVCA 3PHEA 4CJUA 1HPZB 1RTIB 1YVUA 3QGIA 3GIIA 3AVFA 3SPZA 3KLGA 1KVCA 4DTUA 4GC6A 1RDCA 2XY6A 4CJ4A 3UDLA 3BQ2A 1TKXB 5KFWA 4AHVA 4H4OA 2VG6B 1RT7A 4LSLB 3CQ8A 4FJNA 4DFKA 1T03B 4ECQA 2J6SA 2D0BA 2YNFB 2XO7A 4BDYA 2B43A 4CHZA 2IA6A 4NLSA 3P5JA 3DRRB 4DG1B 3C6UB 1HJRA 2ILZA 4M3RA 5KFKA 3GQCA 2O4IA 2B5JA 4HTUA 1UA0A 4DS5A 2CJQA 3S3NA 1NK7A 4Q8EA 2KZMA 4ED8A 3E51A 3H5SA 1JIHA 3CYMA 3MR5A 2W7OA 4AILC 1VSHA 4YR0A 3BQ1A 3IGVA 4Z4FA 3MF5A 3PUFA 2HHTA 4XPCA 1ASVA 1BIUA 4LH5A 3OYMA 4CF2A 3CJ0A 3HYFA 5SWMA 2ATLA 4NLVA 3CM5A 1C1AA 3HVTA 4DLEA 3DYAA 1QSLA 4JRQA 2QE5A 3K59A 1RT5A 2E9RX 1HMVA 3AO4A 4ECXA 3D5MA 4KHMA 4J2EA 3G86A 4K4UA 4HVJA 3HK2A 2ILYA 4FLWA 1S9GA 4F2RA 2W9AA 4KE5A 4KV8A 2WONB 1HPZA 5J1EA 2XGQA 4WE1B 4DSLA 3LPUA 4KTQA 4J9QA 3HHKA 4CJ5A 1C1BA 3ITHA 1S0OA 4FJ5A 1JXEA 4U6PA 4KHWA 1K1QA 4YNQA 4KKOA 4I2QB 3TARA 1JLAA 1Q8IA 3OYLA 4Q8FA 4CK3A 4N5SA 1S1WA 1GX5A
chains in the Genus database with same CATH superfamily
1SJFA 5LSLA 2G8UA 3AJ1A 2PIIA 3RR7A 2HBQB 1NGBA 3FSIA 3LM9A 4BBYA 4NYZA 5AZJA 2MEWA 5CCMA 2H5EA 2WCXA 2DNPA 2OZSA 4F8RA 1S7HA 2RHKA 3UKRB 4NMLA 3SQOP 3NVMA 4K8XA 1WUAA 2MGZA 4DBQA 3KHYA 3DXKB 5M1QA 2QM1A 3MXHP 3I0RA 1U1OA 2H65B 2QN6B 1MU2A 1SS6A 3LZIA 5KFPA 1NKCA 3VQ9A 4CECA 2DNMA 2BBEA 3U9DA 3F9KA 4DS4A 3W9HA 3V81B 1AZSB 5GAGU 4G1PA 4DZ6A 5FDLA 2I5JB 1B7YB 3ETMA 3HTVA 4CK2A 3RG6A 4DX7A 4HCBA 4KH5A 3SUQA 2AZ3A 1S6OA 3FRZA 2Q1LA 4I6WA 1FK9A 3GL1A 1VQOS 1Y3KA 4DR6J 2AX0A 2N3OA 4ITSA 2LQ8A 3QNWB 1JXBA 1AW0A 4IH5A 4JI6J 3MX2A 5F9NA 3GCXP 1OSDA 4DDFA 5GADU 4LFAF 1JLEA 5GADI 2FY8A 3W65A 1RDAA 4O0JA 3SQGA 1BQNA 4NCGB 1XNRK 1IO2A 4FLVA 3OYFA 1MN9A 4LF9J 1NWKA 1T3VA 3F2KA 4BLGA 4FK2A 1CJVA 5E5NA 3MTKA 4CLZA 1S77D 1Z05A 3W2VA 3JB9k 2EKYA 5AQZA 2CJKA 4C3KA 5KFXA 5GAGP 1XERA 4NLWA 3MZIA 2OA8A 2F7TA 1YHQN 3RTVA 3CFPA 2W9BB 3G71N 1RWUA 2OD4A 2VPYB 2NRZA 3DLKA 4NZ6A 2IVMA 1NHUA 3AA2A 1ATNA 1U24A 2QMUB 2PE8A 5F8NA 1IG8A 2M70A 2LA4A 1HKBA 3K0JA 2PMHA 2QLFB 4M8LA 4OYXA 2VGMA 4ALZA 3OYIA 2P9EA 3BGRB 2GFFA 4BRKA 4H0PA 3TTDA 2MJNA 1NLKL 1TL4A 1T44A 4DV3F 2DNOA 4OIXA 4FJKA 4BVPA 1VQ9N 1CJKA 3T9NA 1FO1A 2HG4A 4B8CA 5AQOA 3WBZA 1FRHA 1XMOF 1W26A 2K1RB 5EDWA 2YQ3A 2V51B 2ATCB 5E3CA 2ZZNA 2E5HA 2MKKA 2DPJA 5HRPA 4I7FA 1XHZA 3NF9A 2KT5A 3FK4A 1LW2B 2KYZA 2A5XA 3UPFA 2HQGA 3NG8A 1DRZA 3QLHB 1HQUA 2DTUA 3H40A 1WUUA 4HDHA 1CJTA 3VVTA 4J9SA 3I5AA 3BYPA 4B3OA 4J2AA 3BSNA 3V6HA 3K8WA 4Q45A 4Y2CA 2GGPA 3GWCA 3K2YA 2BRLA 4CFDA 4ECZA 1XC9A 4F26A 3CUNA 1T0TV 4DN9A 3PRVA 2YHYA 1V3ZA 4LSZB 3IS9B 2FF3B 4ID5B 4CF1A 3E01B 1FESA 4ILHA 3VN5A 2HQCA 2Q31A 4IOCL 3R97A 4IBNA 1LWXA 2UVWA 1WACA 2WBRA 4WWSA 2WVDA 5EY4A 4NA1A 2V7YA 2CADA 5AQRA 2F65A 3AVJA 1GLJO 1Y5NB 1TUVA 3LPYA 4TY9A 3O8WA 2KLAA 1IBKJ 2W4CA 1G4CA 1UEVA 1B9DA 1F6TA 2AU0A 1FW6A 3DRPB 3DXBA 2A3JA 1QQCA 2H5JB 1PJ7A 1JLFA 3X1LB 4MDBA 4WXWA 4E1MA 2ZBPA 4CT9A 4JI1F 2CVEA 2Z8QA 1YVNA 4CO1A 1FT8A 3SCLE 4G3IA 2EC2A 4C2MA 5KPZA 4C8OA 4X66J 1F3VA 4O3OA 4CF0A 3MN5A 3VTHA 1FX2A 1FWLA 2Q3SA 3RRHA 3WXKA 3NWRA 2MKHA 3GOIA 3QGHA 3P45B 1QVFM 1QVGM 1IG9A 1DQAA 2JFDA 3CCSN 3I5BA 1DQ8A 1WLJA 3G25A 2APOA 4DL4A 4DR4F 2VFUA 4IOXA 2JLGA 3L4IA 4DZDA 2DEIA 2ZC4A 2GIQA 2MQLA 3NHGA 3BSCA 4I9LA 2HHWA 1VGYA 4I56A 4CLFA 4NOHA 3GJRB 4LVOP 3AVGA 1XR7A 2W6LA 3EXYA 3QMQA 3OYEA 3HFKA 4NLUA 1KQSR 2Q66A 3PYGA 3TX0A 4DR3F 3CDWA 2K06A 4CEZA 2XS2A 1TFWA 1BL3A 4TQSA 4LT6A 3V2UC 2D3OR 1XMQF 3D7SB 2XWXA 2E6LA 1HBUB 2KYXA 4IXCA 4RUAA 4O0NA 3IAS9 5E3PA 1IBMJ 2X1GA 1JLQA 4USVA 3J80Y 2HWIA 2ZEJA 1XN9A 1S9EB 2Z1GA 3IUCA 5F8IA 5F8HA 4WE1A 4X4SA 1B0PA 2PEHA 3MN7A 2DGUA 2G13A 1NGDA 3TAMB 2QG9B 4M5KA 3EM1A 3NAHA 4BRIA 1YTUA 2E4LA 3SBTA 3CPEA 1XC3A 3LOUA 3J7AP 2NUUG 1U26A 4IQXA 2WVEA 1XK8A 3MUTP 3AJ2A 1UZDA 4JK9A 2K7JA 3RB0A 1XTZA 2OSRA 4USTA 3LP1A 2R7UA 2IY5B 5AQGA 2OPRA 3UE2A 3OXFA 1V5VA 4X4TA 3WDOA 3LDPA 5GADP 1TKZA 2YPZA 4DL5A 2EWSA 4IKFA 2C42A 1YT3A 3OYBA 2B7CB 1SH2A 4QPTA 3CMES 4CJTA 4FPRA 2R7VA 3I56S 2BOPA 4RBUA 3UDCA 4Z4HA 3HSTB 2R42A 4DFMA 3EVWA 4Y28C 3TAEA 3T69A 5HI7A 4YR2A 4N56A 3FJ2A 3MM9A 4EMDA 5HJYA 1KRPA 4IH7A 4U7UD 4Y2KA 1LCUA 2D1CA 2HLUA 2AJ1A 2PMZD 2I2YA 3A8YA 4WQ4C 3LDSA 1VQPN 3KIOA 1BE4A 1ZM4A 3AT1B 1PYSB 4ANDA 3KK3A 2VPXB 3T1AA 2BH1A 2UUCJ 4IJNA 3QJLA 5FD1A 3G82A 4NI2B 3CD6N 4KBOA 4DR1K 1H98A 1YK9A 2HFNA 5AE1A 1TL7B 2W4PA 1NDLA 5C25B 4WCEL 3LTOA 3MMBA 5BR9A 1N6QA 1RTJB 2ZGZA 3K9KA 3O4WA 1FHTA 2V69A 3MMAB 3MM6A 4DQPA 1FE4A 2DGTA 3KLIB 3FBFA 1JL2A 4RW7A 3ZETB 2ZF5O 1S6PA 2ZDOA 4KREA 4X4QA 3MEGA 3OT9A 4Y0WA 1N54B 5D0EA 2V63A 4GV6A 1ZAVA 3DRPA 3G9CA 3MXIA 5KFRA 2KFYA 3O08A 5A8RB 5MLCQ 2YTCA 2FSKA 3QLHA 1S9GB 4EZ9A 5IM0B 4A2BA 4LQ3A 3IR6B 3ZT4A 2FLLA 4PCQA 4X4VA 1SCJB 1R8PA 2GJFA 1GLAG 3CC4S 1VRQC 4M3TA 2O3DA 2A41A 1YJTA 4F3QA 4E89A 2QLWA 3TA2A 5M1NA 1I39A 2H9ZA 1BQNB 4J2DA 1S59A 4IH6A 3ZT2A 2NXUA 2MQOA 3OS2A 2YKQA 2IAJA 5AE2A 4F67A 5A6PA 1N5SA 4FS1A 5AQLA 2X6NA 2YNHA 2GX8A 4LF6K 5BYSA 2B6AA 4OKJA 3RMDA 1IN0A 4JK7A 2HIYA 4M3YA 4DU1A 2N4CA 3BV8A 3WT0A 1IM4A 3H6EA 1TL5A 4WYWA 4LF5J 1KR4A 5HQ8A 3AAQA 4A2AA 1DKGD 3POTB 3F56A 2WHOA 2O8BB 1NDKA 3A5LC 3J7Z5 1U6ZA 4NASA 4M3UA 3KHGA 4J9NA 3DM2A 1QY7A 4LF6F 4MYUA 3C14B 1K9MT 4A8OA 2CIMA 5CHIA 4M63C 4CHNA 4KHQA 4LF1A 3G6ES 3FZBA 4L73A 3EVOA 1R8BA 3KKFA 4WFXA 1S6QB 3T41A 4A8MP 4JI3J 1NG9A 5THWA 1Z4UA 2XMWA 4ECRA 2HNZB 4JS5A 2IMWP 3GCWP 3ISND 1KN6A 3DYAB 1SIZA 3BKFA 5J2PB 1ASWA 4ES1A 5JMVA 1F5AA 2I9SA 3C0BA 1FRKA 2P9NB 2IIHA 2B9WA 1D8ZA 3R6LB 2BTFA 1T95A 4U96A 5J2MA 4OHXA 3SUOA 2QL7B 4OZJA 4ZLLA 4NI2A 2HVEA 3V6DA 4UF4A 4FM2A 3KUHA 3HPHA 4NLXA 1P1LA 1UW9A 4P72A 4OI6A 3BKTA 1LOUA 5E33A 2DIUA 3H42A 3TTFA 1Y0HA 1NHKL 1KOOA 3L7PA 3SUPA 1RABB 4B3SJ 3C16A 5L9XA 3N4WA 4PXDA 2BQUA 1FTRA 4ED4A 3CEDA 2DCLA 2E7VA 2C3UA 4AD6A 5CYJA 4AHCA 4W5QA 5DK5A 1LK5A 3ENHA 3VQ5A 3FVYA 2KJVA 3MPYA 1L3TA 4FXDA 2HFVA 2AJQA 4BRDA 3V6DB 1HNZJ 3H5UA 3R3TA 3AA4A 1VQKS 1W97L 5KT2A 4NYNA 4LR7A 3DXSX 1UWBB 4OX6A 1R0AB 1S1VB 1T3OA 2QT7A 3AOBA 3RSEA 1ZH5A 3CC4N 3LP1B 3ZTRA 2DR7A 2O5DA 4WZQA 3S41A 2EFGA 1IBCB 1HHSA 1N6QB 5E3QA 3C8YA 3OYCA 3NGUA 4YOTA 4JRPA 3MMBB 5IXUA 5GINA 2AJ0A 2WRMA 3HO1A 3H20A 2ZD1A 3MCAB 4N8OA 1FFWB 4LRCA 1U2RA 2CRLA 3TR5A 2QEXS 1SJQA 1J5OB 2W2NP 1HBNB 4Y2MA 4CDIA 2ROPA 2VG5B 3CFOA 2Y1IA 5AR0A 1REGX 4B9LA 5HL7L 3MWPA 2C2DA 4NLCA 2DO4A 4AQYK 5LM7E 4RNNA 3TVZA 3OR2A 3OV7A 2BJEA 1D9FA 1YG0A 2KFNA 1J5EF 1JB0C 3D2FA 5GAEP 2GW8A 5KG5A 1HL6A 1SJ4P 4OI4A 1U1NA 2GO8A 3VQBA 2HLTA 1Q82T 4E7LA 1E3MA 1RWOB 3ENAA 2XCAA 5BPLA 2RDJA 5GIOA 4QWAA 4FZZA 2RUGA 1QSYA 3QNOA 1OH8A 5LMNJ 4IR9A 1WNSA 2ZJRL 3DU6A 5CCLA 1KHVA 4TU7A 3HFVA 4ZN3A 1RAJA 1E4GT 2DNHA 1VAZA 1LEOA 4Y6IA 5D78A 2ZBRA 5KFMA 2F4VF 4P2MA 3WIUA 5CY4A 2Q2RA 1EKEA 3LZJA 4P74A 4KHPK 1AUSL 1RHUB 2OZMA 1VQ4S 1TKTA 3KK1B 3P5BP 5BRHA 3CPWM 1X1PA 3KYLA 2Z2LA 1VSFA 2DITA 1U2FA 2WTFA 4F4XA 1YAGA 3RRGA 4B3SF 4CZIA 2YWGA 1A5XA 2E5LK 4RW6B 3D1OA 1LK7A 1UTAA 3DOMA 3GYXB 2XI2A 4QWEA 1HWIA 1RBOB 2EFQA 4BG8A 5KOWA 3M8PB 1FJGK 2GJIA 1AFIA 1KLMA 2FY1A 1YITN 5L46A 1TV6B 2A6MA 2VB6A 1OH5A 5ETQA 1CZ9A 2VDHA 1ZM3A 2GIFA 2O8FA 3M1FA 2KHDA 4DR2F 1N5VA 2N7YA 2RMLA 1KVBA 2CAJA 5L1JA 3KJQB 2V34A 3D67A 4ELUA 3DCAA 1BY9A 2M0GB 2AEJA 1PYTA 2N3LA 4CRJA 2W41A 2IGIA 3H8YA 2Y8YA 1VSEA 5KFFA 4CBXA 3C6AA 3DN9A 1H7WA 1VFJA 1MDUB 1M5VC 2CQ1A 2FVCA 1PJ5A 4UOCA 1R89A 1RWKB 1TUWA 3QDKA 4ISEA 5K14A 4F4ZA 3AVMA 4O5BA 4CI6A 3Q8YA 2WVBA 2UUBF 1RBLA 2YH0A 1AB8A 2HMIB 2H3EB 3B6OA 2XS7A 3AD8C 1RGIA 2ZC3A 3FFKB 3MEGB 5SUHA 3IMQJ 2UP1A 4USHA 3BN4A 1GH8A 4Z2XA 1HYZA 3CF5L 4X4RA 3BO4A 2K3KA 4FF1A 5KI6A 2HYIB 1ZM9A 2MZQA 4ECSA 3L9ZA 5F3TA 3DLBA 1KCFA 2OLWA 3LAMA 2F3JA 5BRDA 2GTDA 4CHQA 1X4HA 4OV1A 3N6LA 3W3SA 3UN2A 5KGWA 1HFEL 2VQFJ 1EETB 4H54A 3H5YA 4H0YB 3TEHB 1KC8T 2W2QP 2HURA 4LR9A 2XTJP 2MLYA 3HSCA 4UOGA 3PM9A 3R5CA 2YKAA 3KD1E 4NXNK 4JI7K 1P8GA 2E2PA 3AB2B 1Q82O 3GJTB 3PJWA 3SV4A 3W7BA 4BE2A 4NWBA 5A8WB 3UVJB 3CJ5A 3O8MA 2MQ8A 4DUZF 3A1YG 1N0UA 2P2CB 2QFJA 3LDNA 5IT0A 3I0RB 3H98A 3VGKA 3QEWA 1EAYC 4FYWB 2UUAF 1U48A 1FXXA 2FC9A 2J7KA 4ILMA 5HVFA 3RAXA 4OYOA 1RDWX 2HOEA 2RS8A 1ZOTA 4WP9A 3VZIA 4GMJB 4AL5A 1NJYA 1RDUA 1GQEA 3A5NC 4I9QA 2ACMA 4DQ8A 5GMDA 3JTPA 2PFUA 3R5AA 3Q89A 4ZPCA 4MK8A 4K5SA 4QYRA 4FJIA 1NK6A 2VHGA 3EUNA 4OYIA 1UWAA 3MM7B 2R8IA 1ITPA 4KGXB 3JQKA 1TVRB 4OX9K 5KPTA 1R59O 4RNHA 1UEKA 2K7KA 1X3NA 4YQWA 3NOCA 3AOAA 1HNVA 2FBTA 2YKOA 1VRUB 4A8KA 1GMWD 1LV5A 1W2BM 3HVTB 3JS6A 1NPRA 3MECB 3PR5B 4K0KK 1X0PA 4XIUA 3QJPA 2KVIA 1X7VA 2CNLB 4CHYA 1XMOJ 3EWGA 2J8SA 2E2OA 2HIQA 3M8ZA 1PBUA 3PV8A 1P1TA 4DQSA 1O1WA 1S97A 4DV3J 3OLAA 1EO1A 2YNGA 1JLGB 5B0GA 1BWVA 4FWLA 5AQUA 3D1QA 2HHPA 1T02A 4DV5K 1F5BA 1YXQA 4U8YA 1EXQA 3SBGA 3T1HJ 4C11A 1PC4A 3E3XA 2NSCA 1IV0A 3SDEA 3PLAA 5JS2A 4WYLA 1B64A 4QIWD 1Q9XA 4UZCA 2IJFA 3M2UA 2VG7A 5D15A 2FBYA 4BRMA 3T6JA 1H2VZ 3KMSA 2V2VA 3ZSVA 4UW2A 3TZZA 3W64A 4KRFA 3VVUA 3FCWA 3AA9A 4F9OA 4CBUA 2XYGB 1V4SA 1Y00A 3FEYB 1PO6A 2FJBB 3SMSA 2JSXA 1DGKN 3CDEA 2F9TA 2OCEA 2FYXA 2W7AA 1GOAA 1ZXOA 3HI0A 4JKFA 1RTDB 3EKSA 4CZLA 2FVSA 3RB6A 3SQ2A 2OANA 3SSRA 2W9CB 2AQ4A 3VGUA 2GV9A 5AXLA 5KFOA 1R8AA 4IO8A 3E66A 4YOVA 1TQLA 1WC1A 3SYZA 4Z7CA 2Q36A 4ILGB 3KUGA 5LSRA 3KLEA 4JI4K 1FNXH 4UTGA 5ADZA 3T5LA 4I2QA 1FRJA 4F04B 2VJUA 2ZUGA 4CJFA 4LFAJ 4DHYA 5IS2A 2B3TB 5M2RA 2WBNA 5EOYA 4RU2A 3K17A 1OPZA 4OI3A 4HUEA 3H3NO 4U7CA 1KHWA 5ETVA 1RHKB 2X7IA 4JKAA 3IGNA 1W0HA 3VQ7A 5BPMA 2JFKA 3EE3A 1BUPA 4OKEA 4KTWA 4C7QA 2QWOA 3MD1A 4ED0A 1NRKA 1N32K 4FJ7A 1RT3B 2F9WA 3HMJG 3MDQA 3VAIA 1IXKA 1KAZA 2ZGYA 2KU7A 3UD4P 5FLXY 4DR1F 1Q78A 4H0XB 5A0YA 4EU0A 4WQ5A 5KFDA 4ZIVA 2ZOMA 5AQJA 3SDEB 2NUBA 5KT6A 4ETZA 1H74A 4DSFA 2M5YA 2VUGA 2HFOA 2R8KA 1RLDA 3L4BC 4N7TA 3JSYA 1JMTA 2PA3A 4GC7A 5BYRA 4F3OA 1QVFR 4A4JA 2NYHA 4I0WA 5AXKA 3CMAS 4IO1A 4RW8A 3PYFA 2L3MA 5I9EB 1XUPO 3DGVA 3L6QA 2HVDA 3BDPA 2PA8D 3OQ2A 1VC6A 4CFBA 2QA4S 1BGXT 2HB5A 2CPZA 1ZBUA 4BVOA 1NJIT 4ED1A 3CERA 1XQIA 4JD2B 1Y5IB 4IUFA 4CH7A 1B99A 3PG9A 2IS3A 3BO3A 5HMWA 1L3SA 2DO0A 3O9TA 3R9PA 1S3XA 4NRUA 5IT9Y 2X1BA 5LMUK 3GU0A 2ZITA 5H9EK 3BDEA 2PSZA 2Q0RA 4DQRA 4YB5A 1S1UB 2XSFA 3NGSA 4K7QA 3CCJS 2E5LF 3PVXA 3NGTA 4PXCA 3T19A 1U1QA 1HI0P 1K0VA 4QIEA 1HWLA 2NRXA 3WC0A 1EHWA 4OX9F 4BWJA 2QKKA 1T8EA 2BEFA 2WVFA 1CLFA 2H48B 2WK4A 2YNIB 3WX4A 2G2OA 4WP3A 4AXIA 3J80O 4NLPA 3RMBA 2IYIA 4DL0C 3T1YJ 4ZJOA 3NL0A 4IFVB 4ICLA 2BUNA 4M45A 3HHLA 5KRSA 5GAEU 1CJTB 2ZUAA 1HQUB 4I68A 1GLLO 2KRBA 3FQKA 4PWUA 2A2CA 3L95X 1WSRA 3MR2A 1BHLA 5C2FA 1EB0A 3KWIA 2GHWA 1RISA 4KIAA 4G6VB 5L38A 2G8VA 4PUOB 4FO0A 3AQPA 4FN5A 2MY7A 2AA4A 3CJ1A 5EHHA 3FSXA 4FF4A 4DV2K 3HJVA 2QL9B 2MYFA 3ULEA 3M6VA 2JVOA 2W2MP 4W98A 5A8RA 4YOEA 1RWVB 5FJ4A 2BANB 1U2VB 4B1WB 2YX1A 2LXFA 4JOUA 3SIPB 3MI7X 1FRIA 5HQMA 4ZVFA 2HNYB 4EO8A 3BJYA 4TLQA 2FQQB 2WW4A 1HI8A 4LFCJ 3SMZA 5ETSA 2ADBA 2O01C 1RACB 3DMJB 3DI6A 2DRDA 4GKKJ 2VWBA 4K2XA 2HZCA 2JLEA 3G6EN 2KT2A 2U2FA 4RNMA 2AYGA 2VG6A 3THYB 1BC6A 4CZHA 3ZT3A 5C25A 2W7PA 3QZ8A 1NAQA 2CUYA 4OI2A 5BPNA 2B4OA 4HACB 5IWAF 5LXRA 4F36A 4A57A 3VEOA 2G0CA 2NXNA 1W2BR 2OAUA 4ISFA 3CMAN 1YVUA 1JCFA 2RRNA 3MN9A 1KQSM 4P73A 2ZJQL 3KLGA 1KVCA 1LQ9A 2C2ZB 5HVGA 5C7PA 4U7BA 1VC0A 1VI7A 4DUZK 3R7SB 4M1KA 4DFKA 3KNGA 1T03B 1IBLJ 1SJ3P 4DPYA 2EXUA 4NLSA 1NSKL 3C6UB 2LQ9A 2ILZA 3NMUA 2V2ZA 4MLEA 5D8HB 1NK7A 2A18A 2KZMA 3THXA 3ZX0A 4G9ZA 5ETRA 3CGIA 3MR5A 4AILC 3TX8A 1XMQJ 4YEAA 4YR0A 3GZ7A 3IGVA 4Z4FA 3M6UA 4V1Ak 1S76D 3TZWA 1VQ8S 4TU8A 3ZTOA 4DR3J 3IFEA 4WPAA 1T9VA 1RAIB 4OHYA 3HYFA 5SWMA 2ATLA 4NLVA 3CM5A 1KVJA 1C1AA 3DYAA 2QE5A 3K59A 5MLCV 3ZC4A 2E9RX 2KHOA 4U67Q 4KHMA 1VR6A 3G86A 4B3MK 3W63A 3NY0A 4E8UA 2KKHA 3TQEA 2F4VJ 1S9GA 1W7WA 1PILA 3TSUA 4KE5A 3E1YA 4CZGA 1HPZA 3FZMA 4KTQA 5L9NA 1K73O 4CJ5A 4RPFA 4EFHA 3GTYX 1JXEA 4KHWA 1K1QA 3GG4A 4YNQA 4XDDA 4KKOA 1X4CA 1OO0B 3TARA 3QFWA 2BW2A 4ZCMA 1WORA 3M1VA 2UU9F 2VV5A 4CNYA 1I94J 4DX5A 5ETTA 1S1WA 1FKOB 1NBWA 3OTBA 2OD6A 2HNZA 1T9YA 1TYQB 4EYHB 1S6QA 3ENQA 1RBUA 1T9WA 2HVHA 2QI2A 5EXWA 3WQUA 2NCKL 2RE2A 3H59A 4K4XA 2Q97A 1EQ0A 1KLMB 1U0HA 4YFUA 4Z0UA 5ADXA 2DHAA 2CH5A 2BX6A 2VWKA 1BISA 2E1YA 1YJ7A 4E1NA 1YJNN 2ZJQQ 4B02A 5DM6L 4ZJQA 1FKAF 2JWLA 3OSNA 4CEBA 3KLFB 4WIQA 1N34K 2OTJS 3I9ZA 2ZH3A 2ZD1B 1J54A 3PIPL 1UJ6A 4B8AB 5IWAJ 3C65A 2CPDA 3T1HF 3CE8A 2HAFA 2ZZTA 4TNOA 4JV5K 5IM0A 5E3RA 4CHPA 2JH3A 4DR7K 1CQNA 4NXNF 2VA3A 3FUYA 4DLGA 1P9QC 1O51A 2QFIA 3QSIA 4NEZA 3DFEA 1VBXA 1R0CB 4OHWA 2HGLA 3NH1A 1AYEA 4YHHF 2E1AA 4OZ0A 4ZTJA 1E6YB 1VQ8N 3PW4A 4HWIA 1VQ9S 1QHTA 2NLXA 2DJWA 2CKWA 5C24A 3R8YA 4A47A 5J2PA 2MQMA 3P1GA 3MMAA 3KXDA 2DPIA 2W01A 2ITGA 2RQCA 4H4KC 2E88A 1EWQA 5KRTA 4A8SA 3GG1A 2ASJA 3CCVN 3KD5E 3IWXA 3CCQS 2DXEA 2BM1A 3F9MA 2E1PA 3KKSA 3I56N 4CESA 3CCZA 2QJ3A 3ZTQA 3GIMA 3AO2A 2DCUB 1HNXJ 3B78A 4M5GA 2B9YA 2V5HG 1NKBA 2VG7B 4G1QB 3MAAB 4CEFA 1WI8A 3I31A 3QEIA 4PAAA 1EX4A 2KXHA 1SV5A 3FCVA 2MXYA 4WF9Q 2HS3A 5IV3A 1SUQB 4DFPA 3N5BA 1RNHA 4FZVA 2XB2D 1Q8BA 1WKJA 4NLDA 2J0XA 3ZZPA 1I1GA 2P9SB 2HFSA 1P27B 4I1TA 3V1QA 4R79A 1H2UX 2HNYA 3VQ8A 1L5UA 2A1RA 1DARA 2W40A 2DXDA 2V50A 1HBMB 1PBAA 2GBZA 1H2TZ 3QETA 3TW0A 2OI2A 4PY5A 2HK3A 1VDHA 2RKIB 3CCSS 1DTTA 4PQAA 3KG4A 4GMKA 5KTQA 2VONA 2J9DA 3KJVB 4ED2A 2BMBA 3ZSOA 3ZZZA 2MMYA 4KI4A 4ZN1A 2OTLS 1RHQB 3HBTA 3MM7A 5GAHU 4TQRA 1I3AA 4YDXA 1JKHA 4X4PA 1D5AA 3Q7BA 3I8DA 2YKMB 3RWUA 1HKAA 1ZYQA 4LSNB 3OD2A 3M2RB 1HNIA 1LWCB 4DR5K 2R7RA 3AA5X 3BF4A 3R1HA 5EX3A 3FKBA 2Z1IA 4JI1K 4WTYA 4CLUA 1RBVA 1D1UA 2IM2A 3OR2B 1RLCL 3SEOA 2E20A 4QCLA 3WNEA 3NGKA 5B08A 2FBXA 3AVLA 5AQXA 3CC7N 1ZPVA 4X65F 3DOLA 3BGFA 2JX2A 3W1YC 3K5NA 3M2VA 3I9V9 1ZETA 5F0WA 3X3UA 3DWLA 2PO4A 3NCIA 3AD7C 4WFBQ 4DR4J 3QJJA 3BEXA 4CJLA 2XO6A 1YJNS 3VQSA 4FBUA 1HNWJ 4RW9B 2I7NA 4J8FA 2WAQD 3NNHA 2DNQA 3L0QA 2ASPA 3KHHA 1PC5A 5D0HA 4O8UA 2AIRB 4DR2J 1RT1A 2D0AA 1E6YA 4M3ZA 4CEEA 4M94A 4AFFA 1NLVA 4C1NK 2FHJA 4ZLJA 3LP2A 2XC9A 3TZYA 3M05A 4ZCLA 4O55A 2SXLA 4DV1J 1C4CA 2W8LA 5KG2A 5D4LA 1OJ4A 2WSCC 2XLKA 1FNMA 5FRMA 1OSCA 2U1AA 1YJWS 3QB0A 2Q6BA 2DFEA 4DI6A 1N36K 1X5TA 2OEJA 5ETKA 1JLBA 1T94A 1Q4RA 3MXJA 2VBWA 3C7NA 3H2LA 1DTQA 2J9EA 3OR1B 4YB6A 1IR0A 4B9QA 1F0XA 2QA4G 2FGOA 4PWWA 3BZQA 5J1NA 4GKJF 1ZBTA 1WD6A 4W92B 5FPDA 3EDRB 1U7LA 2D3ZA 3FBCA 5E26A 3ZNJ1 5T41A 2CNOB 2GO9A 3BSOA 1QSSA 2UXCK 3E8OA 3N28A 3N01A 1QJHA 3BGOP 2I0XA 5F2RA 1QE1B 2Z56B 3QERA 4HT5A 4FK0A 3HZGA 1VQYA 3DOLB 1FERA 5F0XA 2E29A 3TZXA 3MM5B 3M9NB 1IR1A 2L9NA 2MLZA 1ROFA 1BOTO 1H0HB 2AV5A 2P9KB 3D2FB 4UUXA 3MAAA 3ETOA 4FKXA 4KKOB 4J9RA 1S22A 1C4AA 2LLZA 3WXIA 3FBBA 3WQTA 3D54A 3AVKA 2WONA 2PMWA 4NXMF 2IJNA 1NKEA 4DPWA 4JI0F 3QT7A 3H1QA 4FF2A 2IVPA 4B1VA 4B9NA 4NXMJ 4CNZA 3MMCB 2KQ2A 3IBFB 1J6ZA 3O6QA 3DKDA 5HROB 3KJFB 4B9SA 3N4PA 3HDSA 2QSFA 3QRRA 3GV7B 4L3KA 4BR9A 2OSQA 2EFNA 2P9PB 3G4SN 3V9ZA 2HRYA 4H4MB 1FRMA 4DF4A 3KOAA 1IKXA 2OEKA 2CQ0A 4ETXA 3OFHA 2BE7D 1VQNN 3CWJA 3CC2S 4ZHRB 2RSQA 1PJ6A 3E2EA 2PI5A 3PACA 1WSIA 2R8GA 4LJMA 5AZIB 1T9UA 2HHHK 4Y1DA 5DDPC 3IBWA 2AGOA 1CS4A 2D41A 2PZSA 1N33K 1GTEA 2J6TA 3E9PA 3MPWA 4CO0A 3VGTA 4G1QA 3PXGa 1FWKA 2X1AA 3OYAA 3MDFA 2HK2A 3Q8QB 4EP5A 1MU2B 2B7BB 2DRBA 2RE1A 2HPUA 4FYXB 5G0RA 1WTBA 4ZVUB 5C5JA 2XRIA 4CF9A 4M5JA 2NRRA 4M5IA 1NMEB 3MWTA 2F9DA 2GQCA 5KT3A 3U4LA 3SQ0A 4MLHA 1IWGA 3MX5A 3MPUB 4Q2MA 1UFKA 3B6PA 2EG2A 5EWFA 1RUSA 4DR7F 3N6MA 1VHXA 1NGHA 4OO1J 4PQUA 3QICA 2YKPA 2ALZA 4URGA 1YBAA 4BE1A 4CLLA 1OYDA 3EGWB 3G6XA 1VQ7N 1HBUA 4OKKA 2OELA 1U6BA 3EICA 4X84A 4EP4A 2NXEA 1UPMB 2M4MA 1G7CB 1Q8KA 1HR0F 3DOKA 3IRXA 1JCGA 2YHAA 3FZLA 4CIOA 1Q0NA 3D0HE 2ACYA 1K8KB 2YKMA 2UUAJ 1BQMA 3CJ7A 3N9UC 2HBJA 2CDRB 4NLQA 4J9KA 1YHQS 1EIYB 3VV2B 4B3RJ 1BIZA 4ZJLA 4PUOA 2CGJA 4NLRA 3CCRS 2WBMA 4R5PB 3VA0A 4HI1A 4KC5A 2MTLA 4DPUA 1GXUA 2DGOA 1WELA 4CO5A 1DFDA 3PIOL 3PSIA 5C24B 2A10A 3AY9A 1P9YA 1VQ6S 2N82B 4Y2AA 1S6UA 4MK9A 2GELA 2P9IB 2COLA 3C94A 1JNRB 2HAIA 3HM9A 3OTCA 5L1KA 5AQQA 4OGCA 3DOMB 4E7HA 5F8JA 4OYWA 2EW9A 1PG5B 3I4HX 4RL1A 1N34J 1JL1A 2F8HA 4LF4F 2JL9A 5JMNA 5AE3A 1FNOA 3QIPB 1OY9A 4IQMA 2IBOA 4B9TA 1I6JA 5F1XA 1VQ6N 1U8SA 4RUHA 3L2VA 2YX6A 1TL3B 3OTOF 3CB4A 1KC8O 3IKMA 4N47A 4RBVA 1K44A 2ZH6A 3HSJA 3C3LA 3IRXB 2HZAA 3OYHA 1KONA 1CSJA 1NJZA 3BKUA 3QSYB 5LMUF 5F9LA 4USUA 2UVVA 4IG0B 2NZCA 4NRTA 1NMNA 4E19A 2LCWA 1NM2A 4K4WA 3M8WA 4AL6A 2XS5A 3VOVA 4BRQA 2X6SA 3RU0A 5AQKA 1UVIA 4HTJA 1BO5O 4CJWA 3B82A 1RT2B 4BDPA 2J7WA 1RHMB 3DLLQ 4DTXA 2F4VK 4OYZA 1T6CA 4O5FA 3BQ0A 1J5EJ 2OPSB 2GV1A 4NEYA 4FWSA 1LWFA 2C3PA 3KVGA 1X5PA 2DNZA 3G6YA 4K59A 3WZ0A 3TEGA 5T7BA 2YWWA 2XNQA 3M9MB 1GOCA 1X3MA 2LSNA 3NWGA 2CFXA 1RT7B 1RKIA 4CK1A 4DR3K 2QWMA 2RHQB 2VFVA 1FEHA 2GZOA 4ANCA 3EKUA 4DF8A 5AZIA 1UAWA 3O4NA 4LRAA 4WCEQ 3TUPA 5CZ1A 4QWDA 4EIAA 2MZJA 4FLXA 4KRWA 2FSJA 4I6MA 2LMIA 5KOXA 3WEEA 3BEGB 2GWJA 3LDOA 1HARA 1K8KA 3VR1A 3ENVA 4USJC 3L2UA 2XY8A 1OH7A 5F8GA 2O1PA 4WK1A 2XGPA 2A1BA 4OZ2A 4GKKF 4X4UA 5G4DA 1LAVA 2WSFC 2FC0A 3IC1A 3OJSA 4AUKA 5DDRC 4B3TJ 3AGRA 3QESA 3ZLJA 2UVRA 4Q7AA 2A6AA 4DUZJ 4EFAC 5CD4A 4QPXA 1N5QA 3ZEUA 4DCHA 4MKVA 2RILA 2W9CA 5CAAA 5AXMA 1QQMA 4RU9A 2FLPA 1E6VA 2ZWHA 5K5MA 4M3WA 3Q86A 4FOIA 2GEMA 4CH0S 3H08A 3D0GE 3THWB 3K7RA 1C1BB 2PYJA 1A7GE 1WF2A 2XCPA 4DFJA 4KQZA 4ILJA 3R1LA 1X9SA 1A9NB 2NZTA 2C2KB 5CXTA 4DTNA 3FMWA 2OMLA 1N8RT 4DQIA 3M2UB 4LC9B 3JXUA 4FK4A 1SI9A 1GTHA 3HHNB 4LFCK 4CTAB 4V19X 1YJ9S 3ZSWA 2QXFA 5AQFA 2IM0A 3A8IA 2GC8A 1F2GA 1KVKA 3S7RA 4H0VB 4TYBA 2BYCA 1FJGF 4M41A 4Z94A 3TWHA 4ISGA 4DU3A 2FZCB 2QO3A 4NB4A 1VOMA 9ATCB 2QA1A 3FZ2A 4DV0K 3PEHA 2KH9A 5JS1A 2BANA 5AJ3F 4DV2J 4L74A 4H0TB 1NNEA 3DLGA 3OA9A 3AD9C 1JJ2R 4GVBB 4H0OA 4L76A 2BR0A 3IBCB 5IZHA 4ZLNA 4A46A 2F63A 2ZBQA 2E1MC 4C3MA 4C1NI 4IEEA 1GK8A 2DNNA 3SSQA 2XZDB 2HF3A 2GAHC 4JYAF 5AQHA 1JCEA 3H5XA 1HYSB 1WKLA 2OPSA 1HQEB 3QT5A 1S9FA 3TPQA 1GMUA 4JP8A 4HYKA 1H6KX 4BC2A 3J81O 2BJ9A 1YDLA 2I8EA 1N34F 2A6OA 2I6WA 2L9WA 2CJYB 2F1FA 4JI8K 4KFBB 3J81j 1MMNA 3NF6A 4LBHA 1S7IA 2CZ4A 2RF2A 3HLUA 2WUSA 3R3LA 1K47A 3KLIA 1LKZA 4KB0A 2QL5B 2CPHA 4K2JA 3LDQA 3MM6B 4KHPF 2DBBA 4R5PA 4EWTA 3PX4A 3GG0A 2DKOB 1X0FA 5KFZA 3CJQA 4BR2A 1TTHB 1OPIA 1KP6A 3TTCA 1QE1A 3RMAA 3MM8A 4OL8A 1UVKA 2ZNZA 3TJ9A 1BI4A 3W61A 3L8BA 4BROA 5IT9U 4WFYA 1RWWB 1ZTTA 5BJRA 4CIGA 3P6YC 4DTMA 3POTA 3PO4A 4OX8A 2QIFA 3PEJA 2HWHA 4BRCA 4CW7B 1E6VB 1JK9B 2YJEA 4DV4K 2FHKA 2VA2A 2CYYA 3EVMA 3O2IA 3KWGA 1F1BB 3OBWA 5DG8A 3NLCA 2JC0A 3VWSA 2UXDJ 3DU5A 3CD0A 4KBIA 4TY8A 4EHUA 2HQIA 2MZSA 3ZZTA 3CDAA 4DTJA 2AMCB 2MDAA 2KL8A 3HRGA 1U1RA 1U8WA 4X66F 3CULA 1T7PA 2M9KA 1X8DA 2MZ1A 2YWKA 3M30B 2XY7A 3TU5A 3CDUA 5IFMA 2KN4A 3CETA 1JLCB 3MEKA 3UN5A 3H2UB 4K5RA 3VEZA 1NSQA 3LA0A 1VHFA 3HSDA 3C46A 2DY1A 3N79A 5CA5A 4LSLA 3V9WA 2MZTA 1MW7A 3L2QA 1REVA 2LDIA 3C95A 5KFVA 3M8QA 2C28A 1YWXA 1Y5LB 4LBPA 4RUCA 2HBMA 1ATRA 1MN7A 2OPQA 2IDLA 2UU9K 3K89A 5AQMA 3AGKA 3HF5A 1T9TA 4GVMA 1HR0J 3CCVS 4YY3F 2I38A 4RTFD 4JN4A 1JLFB 2UYTA 4BRGA 3L4QA 4RW7B 2KJWA 2CQBA 4U95A 4URQU 3BR9A 4TLRA 2F8TA 1LWEB 4ECTA 3RMCA 2P1JA 2ALYB 4ILRA 3C6TB 1BHNA 3U02A 2QMWA 2M88A 3QIOA 4DSJA 1HQEA 4BE0A 1RE1B 3HVWA 4PL8A 1CC8A 3CJCA 4LRBA 4DSKA 3A8KA 1RYRA 4LH4A 5J2NB 4CWBA 1AROP 1T05A 4NLGA 4CGHA 4EBCA 2ZKTA 2UUBK 5FLXO 5E2QA 1RSCA 1M0SA 1C0TB 2E9ZA 2OUGA 2DPNA 2DNLA 3CJBA 3J8AA 4ER8A 2R4FA 3MR3A 3T1HK 5BRFA 1K8AO 1VCTA 4GVBA 4C6AA 4CLKA 1HNVB 4DV5J 1D09B 2NPIA 5KFEA 4KPYA 1EZZB 4UOFA 5HBMA 1MROB 5HOOA 3LP0B 3GV8B 5JVHL 1BLUA 1UEUA 4YOUA 4ECUA 3DXMB 3QGGA 1RI7A 5DS7A 4Y2IA 1XMOK 2FGCA 2W24A 3QO9B 4TXSA 2IAJB 5HBMB 1MROA 1T03A 1U2CA 2JRSA 2JLFA 2CQIA 4Z37A 4CGGA 4DL6A 1SH3A 1NJIO 3J7AN 4DX8H 4BACA 3THVA 4DU8A 3DRRA 1D0EA 5HRSA 2YVSA 2UUBJ 3I82A 3A5OC 2R7XA 2LU1A 5D4PA 5BN9A 4H4OB 1VRTB 2OGUA 4ELTA 3OL6A 4CE9A 3OTDA 4K4ZA 1HQ2A 2ROEA 3W62A 3MR6A 2ZHOA 4ZMMA 1CG2A 5KPRA 2PEBA 2UU9J 4FL9A 3EE9A 1UVLA 2PYLA 4XDCA 4FOEA 3M3ZA 2D74B 5GVQA 4DMNA 4CZMA 5B7WA 1Q53A 4LFBJ 4NLYA 4E1JA 2G8IA 4KHUA 2OPQB 3ZO7A 2KKZA 3P5TL 4USWA 2HEKA 3OHBA 4HH0A 4ECWA 3GSIA 3EL2A 2CWXA 2OEMA 3DJCA 3V4IA 4OYBA 2VQEK 1WOSA 1U09A 2DY4A 1CJVB 3EN9A 4ED5A 2EWHA 1XMBA 3BH7B 3KK2B 1UCNA 1N52B 2KT3A 2ZH9A 3MXMA 3VQEA 2GA7A 4DV6K 1DLOB 1HPMA 1UA1A 3T9ZA 4O3PA 2YHBA 2GWKA 3NF8A 3NMAA 4DCJB 2BJ8A 1BI4B 1XHXA 3FEXB 4O4RA 2UXDK 4C8LA 2VBZA 2MZRA 2Q0UA 1VYAA 4ZOSA 4QU7A 4K4TA 2Z57B 5KG3A 4YOYA 2XMVA 1SBRA 2CPEA 1YZ7A 4J9OA 2MLXA 3D6MB 2AGQA 1IBLF 4CZFA 4LF2A 1R0BG 4YS2A 3G8SA 3NGZA 3NE6A 3BF3A 5KT4A 1K1SA 4YDDB 1T3NA 4M5NA 3OHRA 2ZJRQ 1BMQB 4DWIA 4B3MF 4FVCA 2IDOA 1Z2ZA 3OL8A 1HBMA 5H1SV 1WSFA 1RT4A 3RBEA 1FJ7A 2O8BA 3OJUA 2AW0A 3B4MA 3OW2R 3V5RA 3UD3P 3ZXWA 1ZZNA 2RT3A 5DRKA 5M2UA 5T7LB 4CGJA 4JI8J 2M8DB 1CXQA 1HKGA 3IWLA 4TYAA 3WNGA 3R7BB 3TAFA 2FBVA 2MKCA 3VAGA 2DD8S 4PWDB 1FJGJ 1FKPA 3AY0A 4OPJA 3CQXA 1HD1A 2YXLA 5LY3A 3JAMO 1QHAA 4G65A 4WF9L 4BC9A 3WXLA 3M32A 3Q0AA 2ITMA 4JI2F 3G8TA 4ZCIA 5DGBA 1SC3B 2H3GX 5GMKa 1RAOA 2RN2A 5HANA 1YRXA 4EYIB 4JI5F 4QOTA 1TKDA 2Y3YA 4OLBA 4KV8B 1JLGA 1DT9A 1HYVA 3CPWR 3RUBL 3C6UA 1TK8A 1HHQA 3CCUN 5GAEI 4AHSA 4CTAA 4ZPAA 2FHOB 3THTA 2FB0A 2VC0A 3UB5A 3A0IX 1JJ2M 2B9EA 5A8KB 1GNKA 4NYOA 3OVNA 4DSEA 4KH4A 4IRKA 2HBLA 3PIOQ 3RW7A 2M2BA 3J7ZT 1K73T 2HVIA 4NZ0A 1YSJA 5A2QY 1K6YA 3ENOA 2Q79A 1XQSC 2V9WA 3M8RA 4YR3A 1JJCB 1JXLA 3OYNA 3NAEA 1VIXA 2GQ2A 3R5GA 5CE3A 4K4YA 3FFIA 2KRRA 3G10A 5TKWA 3HM8A 5KFTA 3VZHA 2LQJA 4S0MA 3ENWA 3SJJA 2L9DA 4AQYJ 4WFNQ 1QAJA 3O80A 5KT7A 3AVNA 3UQSA 2YY3A 2IRYA 4FLTA 5LL6Z 4HUGA 4CLPA 1VC5A 1NPKA 2OPPB 4C3LA 3PX0A 1KVAA 3AVCA 2V4JB 3VAKA 1R6VA 1Q81T 3TVYA 1RTIB 2LEAA 2HF4A 4HACA 2LECA 3GIIA 2DGWA 3EJMA 4FXWA 4NE9C 3AVFA 3UKUB 1FWPA 2XY6A 4CJ4A 2UXBF 2E2QA 1TKXB 5KFWA 4OZ3A 4F0MA 4AHVA 1UW4A 4CBWA 2R7SA 1GLCG 1KAYA 3CQ8A 4MT1A 4BG9A 3MCNA 4OPAA 1SB6A 2YNFB 1NSAA 2XO7A 1YRTA 2IA6A 3P5JA 2XSJA 3DRRB 3EGNA 5KFKA 2O4IA 2B5JA 1VJQA 1UA0A 2CJQA 3DRYA 3IA0A 2A42A 3E51A 1KOHA 2F4FA 1YI2S 2O8EB 2HQDA 3JS9A 4CVNE 3PUFA 2BKNA 1YIJN 1U2VA 4XPCA 2CQHA 2KXNB 1BIUA 1M5SA 5IC6B 3SAGA 3CJ0A 4B3SK 4FWRA 1QSLA 1XIQA 1OKJA 4NO7A 3MCOA 5TKYA 3R6MA 4HEA9 1HMVA 3AO4A 3W5ZA 4J2EA 3O1BA 5GAHP 3Q23A 2DY9A 1V5IB 1NMDA 4FKYA 4C98A 2ILYA 4FLWA 2JVRA 4DPTA 1RAGB 3IWNC 3I6PA 4KV8A 1NO8A 1C0FA 2WONB 3D1HA 4YUDA 2XGQA 4PG5A 2WFBA 3TYTA 3UE5A 4C48A 2VJVA 4WYBA 2DR8A 1C1BA 3CCUS 3ITHA 3THPA 4O8KA 3SAHA 1FCAA 1Q8IA 3OYLA 4YDUA 4JI3K 4CK3A 4L6V3 1DY3A 4M7XA 3MPDA 1RP5A 3E9OA 1SV5B 1W25A 3UI3A 4FJMA 2H51B 5E84A 4EAHD 3OYKA 1NJWA 1WF0A 2XULA 1KD1T 4RWXA 3GE9A 2P5VA 2CG8A 3JAMU 4UUWA 2LQ5A 1W2IA 1CLQA 2HZVA 4C97A 2R2UA 1C0MA 3Q83A 2P9GA 4BGBA 2VYPA 4XH1A 3KK3B 4LIWA 5HN0A 2Y0SD 5AQIA 1RDDA 1UJ5A 4B1ZA 3CI5A 2YWHA 3MURP 3PIPQ 1B92A 4IJAA 4KYZA 2O66A 3HX9A 3AO5A 1CJUA 5BXIA 5ITHA 3VETA 4FZYA 4ZA1A 1VHIA 2P9UB 5A2QU 2ZKUA 1TUYA 1S4FA 3Q8UA 1Q7LB 4N8NA 1BDGA 3LO3A 2XHWA 4A8XA 4IO9L 4A48A 4CGFA 1OYEA 1O8BA 3J7YP 1V3RA 4K42A 4UY8T 5FRNA 1O0PA 4BC5A 3VF0B 3BR8A 1RCXB 2P9PA 4USKA 4DV5F 4RWTA 1FVSA 4MAKA 4BC3A 1WSEA 3QNNA 5HATA 4P6QA 2DHXA 4CT8A 4F0KA 3AA3A 2VQEF 1QLNA 3S01A 3VGLA 4OYMA 2E5JA 4FVMA 4JNEA 3LUYA 3IO1A 2UUAK 2BE2A 3TAMA 3PDNA 1EJ7L 3I5CA 3VQDA 2PN6A 3J81Y 3P4UB 3IG1A 4FWKA 2VG5A 9RUBA 2IBKA 3LANA 3THWA 1ZBFA 3MM8B 5DM7Q 3FQLA 3KWMA 3QEXA 2D3UA 1JJHA 3SQ1A 4B08A 2UVUA 4NL5A 2V0NA 3KLHA 1FFGB 5KFGA 2IRXA 2VU5A 4BWMA 2YQ1A 5F41A 2VGNA 5BREA 3NEKA 2GCFA 3N0VA 4FSVA 4BRPA 2UUCK 3IN5A 3PR4A 1R0AA 4CF8A 2D1KA 2DISA 1GT8A 2EG1A 2VCPA 4CLYA 3AAWB 2G8WA 1NXIA 2J76E 1UOCA 3ADAC 4OJ1A 4PKIA 1N33J 4M7YA 2V9KA 3KK1A 3TJAA 1O6XA 4FVUA 2E7WA 2HHHJ 2K1RA 4IEIA 1SKSA 3L7OA 3MM9B 2JEFA 1CS4B 3AVIA 5H9FK 4W90B 2HBZB 2KXFA 4E7JA 2H1YA 1UL3A 4P71A 4CLTA 5HVHA 2ZZMA 1WC3A 4CM0A 2ZVIA 4EUVA 3OYDA 5KFHA 1F5CA 4OFZA 5LJVA 5DG7A 3VF6A 5KFIA 2CXEA 2V6AA 2Z4PA 5B8HA 1SJ1A 2QC3A 3CJKB 2JZ5A 2GVZB 3A13A 4R25A 3OHAA 1JQGA 2C2OB 4DXLA 1NU0A 2GVDA 2HMPA 3VENA 3Q7CA 2Q3PA 2R7QA 4IWVA 4AHRA 4BRFA 1WC4A 1X4BA 4YMEA 4PRFA 4LFBK 2RQMA 4CZEA 4M5HA 1Y11A 3WIVA 2UXDF 2ETJA 4XO0A 5IQ6A 4NXMK 1S0NA 2H54B 2LYVA 2XG8A 4DTPA 4OPHA 3PKYA 1LW0B 4A8YA 1WG4A 4JKDA 4XK8C 5GIPA 2VBXA 1P90A 5J2NA 2FJVA 2JC1A 3HXMA 1PIEA 3OFGA 3PJXA 3EZ5A 4ZPVR 4GV3A 3DM2B 2YCHA 1RAFB 2BQ3A 4AM7A 4AHUA 5KFBA 2CPJA 1TELA 2YKNB 4CYUB 3CDBA 2CQDA 3BBFA 3CVKA 2XMJA 2ZH2A 3R2DJ 3O6WA 1KVIA 4N41A 5KFAA 3OBYA 1HW8A 2P6TA 3QFUA 3CCMN 3L3UA 3EDQB 3NGIA 4CEAA 2ZFHA 3HVRA 1NK4A 3ZZYA 3VGMA 1ZA1B 1BQXA 3M6GA 4ZPWR 4A8QA 3ZSQA 3ILIA 4ZP7A 3L09A 2I5JA 1C1CB 3I8BA 3V9UA 2NREA 2G0IA 1N36J 2MHNA 5BYQA 2R2RA 1YIJS 5JVGQ 3SMPA 2EK6A 1DZ5A 1H38A 2ASLA 4CFAA 1N4LA 4DMZA 3C16B 1M5PC 1R8HA 4DV1K 1FD2A 3KNAA 3Q24A 4MFBA 4IOBA 1XJWB 3PSFA 4GNIA 5K8PA 3PW0A 1A5WA 2EX3A 3K0SA 4WFAQ 2OKQA 1LW0A 4KHNA 2W6KA 4H5NA 4OVLA 5IQQA 1LFWA 5D3GB 3WQPA 1GOBA 3AJDA 3MFHA 4IO9Q 1HNWK 4CI0B 2JOQA 5DDOC 4JBCA 1NOYA 3H25A 2PFFB 3DLLL 2JGUA 1YBUA 2Y1RI 4EGLA 3EE8A 1IBKK 1GMWA 1R27B 1M5KC 3U9ZA 3R5JB 2Z0GA 2OIHA 4ZVPB 4OHVA 4RWWA 2MQQA 1Q9YA 2V4RA 2G9OA 1HR0K 4CEQA 4HUFA 1C0UA 3RJMB 3VAHA 4B1UB 3LF0A 5KFQA 1HBNA 1B4SA 4ATNA 3VEYA 3NS7B 4ID8A 4ERDA 2HS4A 2B8QA 3P8BB 3C14A 1WEYA 4JKEA 1LW2A 3ZT1A 1U45A 4GY2B 4CCHA 3NXZA 4F25A 3TUZC 5D77A 4Y00A 3DDKA 1TUGB 2GS8A 3QRPA 3DDIA 4DR5J 3ZZRA 2ZH4A 2HHQA 4E3SA 2MKJA 1BXNA 2JEJA 3MAHA 2OHDA 1A6LA 2QMXA 4KH6A 3WNHA 3OVBA 2YHXA 3BUZB 3F44A 3R7NB 1UWBA 5LJWA 4PABA 2GJ2A 2GGPB 4AHTA 3W5XA 3V1RA 2XZWA 2RQ4A 3J7YI 5DETA 4H5WA 2BV3A 4Q0BB 2Z58B 4OI1A 1ZAXA 4CJSA 3BS9A 3DLRA 4Z7YA 1PGZA 3R9LA 3LALA 1N5YB 3D2WA 1CJUB 3F73A 4WFZA 5AQYA 1S12A 3FLCO 1V4TA 3BPSP 4XAKA 4BQZA 2BJ7A 4A5AA 3TUJC 4YB1P 1QTMA 3G87A 3DLGB 1N48A 1GMVA 3MOZA 3MMJA 4AF1A 2GMLA 3NOGA 5FIIA 2XHBA 3GIKA 2AZ1A 2FD2A 1S5ZA 2AYEA 5LT5A 1H72C 5HLFB 3U1MA 4Q2LA 3CXCR 2P8IA 1VSDA 2F8EX 1M1KO 4JI5J 3FMBA 2EI5A 7FDRA 3T3FA 1RTJA 4OZLA 1Q79A 3OYGA 3NKYA 4KI6A 1TK5A 3SQGB 1CQMA 1HNXK 3RSEB 2YJFA 4MQ3A 4HHJA 4BR7A 3ULHA 1CPZA 4UY8O 3ULDA 3NDKA 4A62A 5K8OA 4L8RB 2YKNA 2P6SA 3ALYA 1WSGA 1W9HA 4JI6F 1YJRA 3AHPA 3GJQB 4HTIA 4JI8F 2IA0A 2BA9A 2DFHA 1VQON 4A59A 1GXLA 5M1PA 3O3LA 2G4BA 4LF7F 2AD9A 2EFOA 4EI2A 2VKZG 3W2VB 5KFNA 4MIWA 4P9SA 4LF9K 3OFFA 1I3OB 1VIOA 4GW6A 2XEXA 4TU9A 4ZIWA 3SCJE 3VEWA 3PW5A 1RAAB 2O67A 3C7NB 4MTPA 4JI6K 3CO0P 2CPIA 5HK4A 4OHZA 3ZNUA 2JEGA 3EO3A 4F4KA 1G99A 3TVKA 4X4OA 4DR6K 3O3HA 1NGCA 4R8UA 4I64A 4Q5VA 3GFXA 4C8KA 4IOCQ 5IWAK 4CM2A 1N32F 1I5OB 3HOTA 4DV0J 4IFYA 2QV6A 5DQIA 4FWQA 4IG0A 5F8LA 4O4GB 4NX9A 4WQ5C 4P2SA 3JQMA 5EUHA 5DMRA 3TQ1A 5HSPA 1X4DA 4M5DB 1YITS 1AZSA 2J0QD 2V2QA 1WNEA 3AFGA 1VBYA 3RRKA 3ZYYX 4UOHA 4IFEA 1S72N 1D4XA 1AUDA 3O4QA 4HTLA 1CJKB 2QLJB 3GILA 4J2BA 4JI0K 3G4SS 1GLDG 1SXLA 3V9SA 1R6YA 3OTOJ 1MWQA 4DHVA 2AP1A 4KB7A 1X60A 3TAGA 1G15A 1NUEA 2R7OA 4P7VA 3FGUA 2ZM6F 1U02A 4FLYA 4WJBA 2POKA 1KQGB 3OS1A 3A3PB 1ZS6A 1UKUA 3GV5B 3IS9A 4Z4IA 3EYZA 4EBDA 4C9DA 4X65K 2X78A 1IKWA 1C2PA 3IG1B 4HHTA 3JSMB 3WEEB 2IJRA 3CD5A 1FXRA 2DR6A 3I0SB 5AQTA 3C19A 3NH0A 1X5SA 2UXCF 2NYIA 1QQNA 1XR5A 3EGVA 4C0HA 4BDZA 2XLIA 4JEPA 2OTJN 2A1SA 2D5RA 2PD1A 4Z4GA 1JLBB 4C0BA 3ISZA 1HMVB 3SI6A 2NLWA 1G6BA 3T5JA 1DTQB 4CD3A 3AXMA 4M5LA 4IFYB 3S6EA 3NFAA 1VQPS 4BQLA 1LWFB 1C1CA 3TP2A 3TSPA 4YHHJ 5KQ8A 3B6BA 4NLBA 1U1KA 1TZ0A 2NRHA 1CULA 2K8GA 2V67A 4KSEB 5L1LA 3GE1A 3HKZD 2GMHA 1PCAA 3SAFA 4PA1A 2KG1A 2PC6A 2UZAA 5C2DA 3BGRA 2DK2A 3S8SA 4DR5F 2FVPA 2YNFA 4I2PA 4IDHA 4ZTFA 2CJBA 2IVYA 4PPZA 3EX7B 2DH9A 3T5HA 1J27A 3GJSB 1V3SA 4AM6A 4J9LA 3H45C 2AX1A 1B0TA 4ZPDA 3NNCA 5I3UA 3W66A 1RT6A 3VAJA 3MWBA 4CGIA 2LXIA 3GPAA 4RLEA 3H4DA 6AT1B 2Y1JA 2MKYA 2O4GA 2AEFA 3P39A 4P7TA 2R8HA 3PKMA 5BR8K 2G2ZA 4B9VA 3VGSA 4O3QA 5EWGA 4PG8A 3TA0A 2UUCF 4B1YB 1NB2A 5B0CA 3DLHA 1VQNS 5EX0A 3K58A 3OTOK 3BBCA 2BDPA 4YOWA 4JI0J 5K8NA 4EK2A 2YX7A 1U49A 3VAFA 1HWKA 4CZJA 4GKKK 5A8KA 5A6WA 4HDGA 4BY9C 1B7FA 4E7IA 4KGVB 3BY5A 3K57A 2NNWA 5J1PA 4WFNL 5E41A 2BW7A 1V6HA 3PNIA 5KG1A 4ZPBA 1J2VA 3SBMA 3KG1A 2B4JA 1S0MA 4LRFA 4CO4A 3HT3A 1QD1A 2B6AB 1Y10A 4WK3A 4WBFA 1WAFA 2E6MA 2QLBB 1JKHB 4MFBB 1S1VA 2RU9A 1YZ6A 1NGEA 3GYGA 3P38A 1KEKA 3FR0A 2XNRA 1ZBLA 3CHWA 1SC4B 2CQ2A 1FXDA 4JV2A 3P3DA 3NGRA 3G2XA 1IJFB 2V8PA 2BKOA 4PZVA 4U9RA 4KHRA 4P2FA 4D3GA 3SLCA 2ZWOA 3ZTSA 1NM1A 3C66A 3LP3A 4IRDA 4MKYA 8ATCB 1S1TB 2HNDB 3M4XA 2WB4A 1G1XA 4MO4A 1TKTB 4LF4J 4O3RA 1VLOA 1SC6A 5I3PA 5GMEA 2CVIA 3MFIA 5KG4A 1VQLN 3T1YK 4K4VA 4B3RK 4Q0BA 1U6FA 3S3OA 2XMTA 1WSHA 4ZVTB 1WSVA 2FJXA 5CZVA 4JB8B 4URSA 3O5BA 2DR9A 5M1KA 1Q5YA 5C0YA 3CG7A 1FDAA 4WKYA 3AO1A 3R5BA 4CIEA 2CQ3A 2LQBA 5KQDA 4QZVB 1ZZFA 4KO0B 2DHHA 1WWHA 5H9EJ 2DGSA 3QGPA 5LMUJ 5JICA 5AQWA 1CZBA 1OMSA 1SQGA 3A3NB 3U6FA 4JI5K 3PY8A 3C15B 1QVGR 3OY9A 1P8ZA 1DQ9A 3F5TA 1NH7A 2DIVA 4XEIA 2BM0A 1ZAWA 2BVZA 3CMEN 1HJOA 3D7EO 3WC2A 3MCSA 3D0PA 2JNJA 1BU6O 4H5TA 5T14A 4ED7A 3Q8SB 2ATQA 2MB0B 1Y9OA 3NBPB 3HZEA 4KH0B 4F4AA 3IAYA 1IQTA 2P9LB 4FLUA 1QAXA 2OTLN 2CH6A 5CYQB 4PL7A 4X64K 4I2PB 4FPIA 1TMJA 4ZS6A 3NRBA