4IG3A

Hiv-1 reverse transcriptase with bound fragment near knuckles site
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
total genus 167
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ig3A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig3A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig3A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig3A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ig3A05
3S3MA 1JXLA 4O44A 2VA2A 3KLEA 2X74A 4AH9A 3DLRA 4RW4A 4CHOA 3VQAA 4OLAA 1BQNB 3ZCMA 4KFBA 2ILYA 3K5MA 3UIQA 4B3OA 4EZ6A 2BQUA 4OKKA 2VG7B 3OYGA 1KHVA 2BGGA 2YKMB 4QPXA 4ED6A 3WNGA 3PV8A 4NLWA 4OGCA 1CLQA 2CKWA 4XIUA 2UVWA 4U6PA 1BHLA 4ED2A 3VQCA 4BACA 3GIJA 3PJWA 4NLUA 4CEFA 2YKNB 4ECYA 1ZBFA 4DL2A 5J2NB 2ETJA 4LH5A 5KG2A 4Z4EA 5DLFA 4CGDA 3QESA 4ZTJA 5KGWA 1SKSA 2HB5A 3MEEB 2LSNA 2V4QA 4KFBB 2YNFA 1RTIA 4CHZA 4JV0A 4EO6A 4F4ZA 3KD1E 3JYTA 3KLEB 4DSFA 3RRHA 5KFXA 1BCOA 3DI6A 5KFWA 4FM1A 2YHBA 1KTQA 3V9XA 1C0TB 4KHUA 3M8PA 1DTTB 4WFZA 3AVNA 4KHRA 4B08A 3M8RA 3DOKB 3ZSZA 2WHOA 3PR4A 4IBNA 4FZYA 3V6DA 1VRTB 1IKYB 1QQCA 4HTUA 2ASLA 1GOAA 3F9KA 4K4WA 1HARA 1RTJA 4DU4A 5KTQA 3FRZA 1JLEA 5KG4A 4JV1A 5F8IA 4F2SA 2AX0A 4IDKB 1HYSB 1XR5A 4F4XA 4W5TA 4CEAA 4R5PB 3BQ2A 3AVKA 3M8PB 3SV4A 3V9ZA 3MEGA 1SKWA 3SNNA 1NNDA 4NRUA 4KE5A 2ASDA 4BDPA 1R0AB 4JS4A 3KLGB 4PUOB 1RDDA 1W9HA 1KLMB 3QGGA 4DS5A 1T03B 4R8UB 5T14A 4N56A 3HJFA 5F9LA 1NK8A 3V4IA 1RTIB 2FVRA 3VQBA 4CCHA 4M3WA 3HM9A 1EP4A 2C2EA 3LWLA 2ZD1A 3TAMB 4LSNB 4EO8A 3PZPA 4OKJA 1LWCA 3H98A 2IMWP 2IM1A 1C0TA 4FJJA 2RDIA 4O3NA 4RNOA 4EBCA 3NAIA 3VQSA 1REVB 5KFZA 4CF0A 3M9OB 4CJWA 3M8SA 4PWDB 3GV8B 1JLBB 1SV5B 4K4TA 4EYHB 4CF1A 3UDLA 1WSIA 3AVFA 1UAXA 3ITHB 2BQRA 4DWIA 4K8ZA 3CFOA 3LP3A 1C1CA 3H4BA 4OVLA 1N5YA 4JV2A 5DG9A 2HVIA 5KFKA 1VSHA 2YNIB 2KZZA 4DL6A 3LZIA 1BQNA 2XY5A 4Z4FA 3M8QA 4BWJA 4PUOA 3SPYA 1JLQA 1S1VA 4FJ9A 5KT5A 2FLNA 2R2TA 3T5JA 2W8LA 3KLGA 3LDSA 2R2UA 2W9AA 2UVUA 4DQSA 4IRKA 2I1RA 2W9BB 3V1QA 3CM6A 5JS1A 1JXEA 5D3GA 2OA8A 2F8TA 3L8BA 4MIAA 4HCCA 4Q0BA 4BWMA 5KFDA 3HL8A 4DF4A 4B3OB 1N5YB 3C6UB 1NHUA 3PX0A 1NJXA 3IAYA 3QNNA 4B9NA 4DTPA 4CFDA 3SUQA 3CJ3A 4IFVB 5CYQA 1QSYA 4DFPA 2HAIA 1RBRA 3KLIB 2D0BA 5J2QA 3IGNA 2OPRB 1RTDB 4H4MB 3VQ6A 4MK8A 5L1LA 1SL1A 2OZSA 3LALA 4HHTA 3QERA 1L3UA 4CIGA 4CEBA 4N41A 2B6AB 3MXIA 1F21A 2FC0A 3Q8RB 1SUQB 2G8WA 4I7FA 3AV9A 2FBVA 3HP6A 4J2AA 1D1UA 3PW2A 4Z0UA 2V0NA 4M3YA 5DGAA 1JLAA 5KI6A 4JRQA 4F8RA 3VA0A 3ZT0A 2IA6A 4B8CA 3LPUA 3LANA 3QIOA 3TQ1A 3DLHA 3AVGA 5DLGA 3JSMA 1ZYQA 3OHAA 2W9BA 1IKXA 2Q3SA 3DRRB 2HHQA 4B9TA 1J9AA 1NK9A 1CSJA 4O3RA 1RILA 3AO3A 5KFNA 4NLDA 5DK5A 4DSLA 4C8OA 5DQIA 2V9WA 3TVKA 2R8JA 3TANA 4ED7A 5FRNA 1DLOA 3QINA 4URQU 2UUTA 5L1KA 3H5YA 4F4WA 1DTQB 3I5CA 5L1IA 4FZXC 3MR2A 1I39A 4H4MA 3OL8A 4ZHRA 1ASWA 4EZ9A 1RT5A 4CIFA 2RKIB 4FLVA 1Z4UA 3HPHA 4E3SA 5KFEA 3G6YA 4DL4A 3F73A 4KBIA 4DQPA 3ISND 3GV7B 1U45A 2F96A 2KTQA 5KFVA 4ZP9A 3OYFA 2YNGA 1UA1A 5KG5A 2ZD1B 2O4GA 5L1JA 4KI6A 3IG1A 1TL3A 3KLFB 3FFIA 4R8UA 5KG6A 4ECZA 3PW5A 1WSGA 4FJMA 3DOLB 1S9FA 3RRGA 4JS5A 4DG1B 3S3OA 3IN5A 2WONB 4EBEA 4AHCA 2XY8A 4NLYA 2XWYA 1LAVA 4J9NA 1S9GA 1HQEB 4URSA 1RT3A 4CK2A 4U7CA 3MFIA 4KB1A 1RTDA 3EZUA 4NLGA 4IDKA 3PX4A 1TL1A 2KW4A 2VWKA 3TAMA 5JS2A 4ELUA 1XHXA 1LW0A 4ECUA 4Y34A 4WYLA 3OYEA 2RF2A 3O4NA 4N47A 1TKTA 3T5LA 3DLKB 1QS4A 4F3OA 2D3ZA 1FKOB 2YNHA 4I2PB 4E89A 1RA6A 4Q5VA 4AILC 3MEDB 2A1RA 1KSPA 3HVRA 4ZVEA 3EPIA 3K2PA 1A5WA 3KK3A 1SH0A 3NL0A 3DOLA 4ZTFA 4DSJA 1RT7A 4LSLB 3BSAA 5SZTA 5KFPA 1JLGA 3AA3A 3TARA 1O1WA 5KGXA 1JLFB 4CHQA 4H4OA 4ID1A 3RMAA 4YR0A 4DU3A 4ECSA 2FBXA 1T3NA 4ED0A 4E19A 2R8IA 2Y1JA 3OS0A 2FJWA 2KZMA 3QIPA 3RB6A 5J2PB 4IOBA 4QWCA 4CFCA 1XHZA 3TAPA 4WXOA 1J54A 3BR9A 3OYIA 1NKCA 5JXSA 4ZVGA 1VRUB 2C2RA 2R8KA 3PO5A 4DTRA 3Q8QB 3TR8A 4KAZA 4KREA 1RYRA 4IG0B 5KRSA 3M8QB 4CGFA 1T8EA 5F8LA 2EC0A 3VQQA 2VG7A 1S9EB 3DLKA 4CJVA 4GC7A 3VN5A 2J6SA 5KFLA 4M42A 3ZSRA 2RF2B 1JLEB 2D0CA 4FS1A 1QAIA 5FDLA 3KLIA 4GVMA 1S0OA 4TSXA 2BDPA 3AA2A 1UOCA 3CJ2A 3KLVA 3OYBA 2KQ2A 4RNHA 1WSHA 2F8SA 3QIDA 2BQ3A 4DQRA 1IG9A 3PW7A 2JLEA 3HKWA 4O5BA 4E1NA 3FSIA 4RW8B 4XPEA 3KK1A 2XI3A 3QIPB 3SI8A 4Z4HA 4DTMA 1JLCB 3DLGA 2QK9A 1RT3B 1IKXB 1S10A 3OS1A 4AHSA 3QLHA 4IRCA 1FKPB 1JLAB 1N56A 2I5JB 4R0EA 4ZP6A 4PQUB 4HKQA 4WXWA 1Q9YA 2OPSA 4QWBA 3G86A 4FJHA 4RW4B 4MFBB 4RZRA 2IGIA 3DRRA 4DTJA 1WNEA 4KRFA 1WN7A 4C8MA 4CHYA 1ASVA 1S1UB 4MK7A 1NKBA 3KHLA 3LAMA 5CYMA 4MK9A 3MR3A 4CJEA 1L3VA 4H8KA 2BRLA 3HVTB 1HMVB 1HQEA 5DMRA 4CJ4A 2B5JA 3HT3A 3CDUA 2YNIA 3VQ7A 1LW2A 1SKRA 4J9RA 1RA7A 3OVNA 1S6QA 4IFYA 4BDZA 3QO9A 3SZ2A 5KFAA 3THVA 3AO2A 2FVQA 4Y2AA 3I5AA 1TP7A 2C2DA 3KK2B 3SFGA 3BQ1A 4ECVA 2BANA 4F4YA 5KFMA 3OYNA 4K4YA 4ECTA 2WONA 4KHYA 4FM2A 1U4BA 2ITGA 1RCHA 3RMBA 4ECWA 1T05A 4OL8A 3AA4A 5KG3A 2ZQBA 3CJ4A 3TAFA 4O0IA 3MECB 4LSNA 4YQWA 4L8RB 5C24A 2E4LA 4UQGA 3TI0A 4M3XA 4IKFA 3FQLA 4ZPDA 3AO4A 3VQPA 2PY5A 3LP1A 3CG7A 5KFIA 4J2DA 3RWUA 3OYMA 1GX6A 3ULDA 1S49A 4CEEA 3LAKA 4MQ3A 5T7BA 3OHBA 3VA3A 1CZBA 5JUMA 4NLVA 4NLOA 4QAGA 4BE2A 3H59A 3JSMB 5F8HA 5FRMA 2IC3B 4KO0B 3P83D 2IM0A 2XRIA 4FK2A 3CYMA 4F3TA 3V9SA 1TKTB 3LPTA 2ZE2A 3VQDA 3QZ7A 2ATQA 4LSLA 4F4KA 4FLXA 4DL5A 3DOKA 1T03A 4KAIA 5EDWA 1D8YA 5KFUA 2OPSB 1K6YA 1WSFA 4HVJA 4FW1A 2B4JA 3RAQA 4FYDA 4F50A 5KT3A 3HPGA 1LWCB 1NK6A 3P5JA 2HHWA 4ICLB 4KHNA 4M95A 3HHKA 1GOCA 2AGQA 4IG3B 4IH7A 2D7SA 3V6DB 2JEGA 1KHWA 1S0MA 1RT1B 3SQ4A 3ALYA 3GIMA 2X6SA 4O44B 1WSEA 4DFMA 4KHWA 3ZSVA 3C6TB 4OPJA 2UVRA 4KI4A 3ITHA 4B9LA 1NK4A 2FBTA 3I8DA 4NCGA 4KB7A 3AVLA 3KMSA 4Z4GA 1MU2B 4DL7A 5D3GB 2G8FA 3SJJA 3HP9A 3I0RB 4CJLA 3DRSB 1S1VB 4NCAA 3S9HA 2HHSA 2JC1A 4QWEA 1XWLA 3D0PA 2UUWA 4B9MA 1S1XA 2DFFA 3O3FA 1BGXT 4JLHA 2P51A 2E9RX 1C6VA 3MXMA 5HRPA 4KKOA 1J53A 2XI2A 1TKXA 4CIEA 3VQ5A 3LP0B 4ED8A 4C8KA 2HWIA 2J6UA 5EWFA 1IKVB 4CJQA 2B6AA 1HMVA 4WE1B 4NLXA 2RN2A 1MU2A 5HLFA 5KT7A 1NJZA 4RUAA 1S1UA 3LZJA 1HQUA 4I2PA 3KIOA 3V6JA 4RU9A 4O3OA 3C6TA 4Q44A 3SYZA 3NDKA 2QE5A 4KKOB 1BISA 5EU7A 3ZSWA 2IJNA 5DQGA 3TABA 3JYTB 4FXDA 3KK3B 4ECXA 4FK0A 4RG8A 2QV6A 4EBDA 1XI1A 2HW3A 3NGIA 5HRNA 4DTNA 3EZ5A 1Y97A 4TXSA 3H2LA 4NLQA 3IGVA 3T5HA 1KFSA 1TL1B 4Q43A 1EXQA 2FLLA 2E6LA 2IDOA 1LWEA 2HMIA 1VSFA 3AVMA 4O55A 4ZMMA 2BR0A 5KT2A 2IM2A 3CVKA 5KFGA 3KHRA 1RYSA 4CE9A 3DM2A 4CJUA 4RW6B 2CJQA 5HRSA 4FBUA 1C1AA 1NOZA 1KLMA 3QGHA 3UR0A 1ZTWA 1FK9B 2VWJA 2QXFA 2BRKA 3OJSA 3AVCA 3OYCA 5K14B 2FVCA 3OS2A 1S4FA 3BGRB 1RBUA 3NAHA 3TWHA 3NKYA 2W8KA 2WK4A 1RAJA 2RDJA 2AU0A 4K8XA 4NZ0A 4FBTA 1VRUA 4FJLA 1BI4A 4J9SA 1KVBA 3IG1B 4FK4A 3CJ0A 4CK3A 3WNEA 1BQMA 2EX3A 1UWBA 3FQKA 3KLHB 2B43A 2AJQA 1S9EA 4DS4A 1YTUA 3BDPA 4QWDA 5HRRA 3E51A 4ELTA 3NHGA 3IRXB 5KFYA 1LWFA 1ASUA 2O5DA 5DG7A 3NCIA 1KFDA 3N6MA 3TAEA 3DLEA 3QEIA 5J2MA 4TY9A 4RW7A 4Q45A 3T1AA 4O3QA 1KVAA 4NCGB 3HXMA 3V9UA 3PHEA 2OYQA 3CO9A 1VSEA 1K1SA 3DDKA 1LWEB 2HMIB 2R2RA 2OZMA 2Z1JA 3V1OA 4BE0A 1RBVA 1SL0A 4NLTA 3RR8A 2BE2A 3IRXA 1TKDA 3EY1A 1D5AA 1SV5A 3OJUA 1L3TA 1RT1A 2AQ4A 1QE1B 2DY4A 3E01B 2IJFA 1LW2B 2AGPA 1HNVA 2YV0X 4E7KA 5CY4A 2W9CA 4CFAA 4IH5A 4DMNA 4ICLA 3DMJA 2ZKUA 4CEDA 2OH2A 4EP4A 4FLWA 4I9LA 4NLRA 3K58A 3KJVA 2BANB 1GX5A 1HYSA 4FLUA 4J2BA 3L2QA 1UWBB 1RT2B 4J9QA 4H4OB 2HHTA 3O3GA 3S3NA 4NYFA 2HNYA 3IS9B 1JKHB 1QE1A 4DG1A 1R0AA 1BI4B 2Z1HA 1SUQA 1XC9A 4CEZA 1LW0B 4W5RA 2P1JA 4JUZA 3C6UA 5FDLB 3M9MB 2QKKA 1S1WB 4TY8B 1RNHA 1SH2A 2AGOA 3CWJA 1IKWA 4CJRA 3RMDA 3ISNC 3OL7A 3MECA 1RDCA 1S1XB 4RUCA 4FZZA 4E7IA 3D45A 3NH1A 1CXQA 3ZSXA 3WNFA 2XY7A 2Y1IA 3U6FA 1JKHA 3Q8PB 4RW9A 2IM3A 3HSTB 1S97A 1C2PA 4IR1A 4CJTA 3O3HA 3EPGA 3H5SA 1A5XA 3L3VA 2HNDB 3GYNA 1DTTA 4M3ZA 2I5JA 4WZMA 2V4RA 3ZT2A 2PYLA 4O3SA 3CFRA 3H4DA 1X9MA 3ZT4A 4DU1A 4DTSA 3OL9A 3BREA 5KFFA 1I3AA 2RPIA 3DMJB 3L2UA 2XGPA 5HLFB 3AVJA 3TAGA 4ZHRB 2PYJA 1Q8IA 3SI6A 1YTAA 3KOAA 1XR6A 3V6HA 2WRMA 2VG5B 3K5LA 3V1RA 3HVWA 4J9OA 4N76A 3OYJA 2ALZA 5HP1A 4E1MA 4ID5B 4ED3A 5J2NA 5KG1A 1WSJA 3AVHA 4CFBA 3QZ8A 1ZBHA 1N6QB 4RW6A 1BQMB 2DFHA 1S9GB 5KFRA 2YKNA 4FM0A 5HBMB 3NGYA 1SH3A 4BDYA 1RBTA 3ZT3A 4I7FB 3RR7A 4CHNA 4B9VA 1KVCA 1RT5B 3G0ZA 3OYKA 2OPPA 1RTHB 1L5UA 4E7JA 1XR7A 3U3GA 1VK0A 4JRPA 3SCXA 1EX4A 5KFOA 5EWEA 3ICLA 4WZQA 3I0RA 3T5KA 4DQIA 4CJPA 3CJ5A 4FJ7A 3NAEA 4KB0A 3HPOA 4LQ9A 4Q8EA 4IFVA 1TKZA 1D9FA 1U09A 4RNMA 3DLGB 5HROA 4TY8A 2OPPB 3DLBA 4FS2A 1SL2A 4Y1CA 5DG8A 1VSIA 3DI6B 4O4GB 3GV5B 4HYKA 4OJRA 4EYIB 1S6QB 1IKVA 5EUHA 4MIBA 1EP4B 4Y1DA 4DSKA 5F8JA 4MFBA 1RT2A 3ASMA 1JXBA 1KCFA 2FVPA 4DFJA 4GC6A 4YR2A 1TQLA 1JLFA 5KFTA 1HRHA 1N4LA 5C42A 1Q9XA 4CF2A 3ZSYA 1JLBA 4G3IA 2XCAA 3RB4A 5L9XA 1HNVB 1TK0A 4TLRA 2W9CB 1YVUA 3CDEA 2G8HA 4ECQA 5J2PA 3PW0A 1HNIB 1TV6A 2P5GA 3OLBA 1WNSA 3AVAA 3MF5A 4IR9A 4RW7B 4ED1A 3BSOA 2QKBA 3NF6A 2BE2B 1YVFA 1VSMA 1EETB 3OSNA 4HUFA 2G8KA 1TKXB 1NOYA 1JL2A 3RMCA 3UQSA 5I3UA 3OYDA 2IC3A 2GC8A 3RBEA 2DFEA 3SQ2A 4AHRA 3K59A 4TQSA 1JL1A 2IS3A 4GW6A 3KHHA 1ITGA 3VQ9A 5C24B 4E0DA 4DTUA 1NKEA 5KT4A 3O4QA 4IG0A 2HNDA 1IO2A 3C95A 5KFCA 1Z25A 3QEXA 2FJXA 4NCBA 3RB3A 3G6XA 4CECA 4DL3A 1U47A 1U04A 5C25A 3CDWA 5KFHA 1CXUA 4M3TA 4WFXA 5KT6A 3A2FA 3OSPA 4LH4A 4PA1A 4NLPA 3QNOA 3NBPA 3SFUA 2R8HA 4EP5A 3I0SB 3NFAA 4DTOA 4J9LA 3H08A 1RT6B 2WOMB 5KFQA 2G8IA 2ZE2B 1X1PA 3KMQA 4YNQA 4CEOA 3D28A 4IKAA 1HNIA 1GOBA 1S6PB 4YR3A 1L3SA 2DPJA 4N5SA 3LWMA 4DSEA 1NK5A 4Q0BB 4IH6A 4LD0A 1S1WA 5HROB 1T7PA 5I3UB 4NRTA 2XY6A 1K1QA 3RBDA 2OPRA 3QYYA 4W5OA 5C25B 1IKYA 4DFKA 1X9WA 2KFNA 3EYZA 5CZ1A 1QSSA 3B6OA 5J1EA 1VSLA 2E6MA 3N6NA 3L3UA 4FJ8A 3HVTA 4CJ3A 3BSCA 2W7OA 4K4VA 4B9SA 2C22A 4E7HA 1NHVA 2YNGB 3NGZA 1HYZA 1JX4A 4CESA 3I5BA 4YMEA 1BIZA 3SPZA 3OYLA 4CJKA 4IQXA 3V81B 5KRTA 3PVXA 3Q8SB 2UVVA 4K4UA 1HQUB 4HCBA 1UA0A 1S6PA 4NLSA 2HHVA 2GBZA 1CZ9A 5SWMA 4I2QA 1FXXA 3ZSQA 3V4IB 1TKZB 4FJ5A 4DSIA 3SV3A 4X2BA 4Q8FA 3NH2A 4O3PA 1VRTA 1S0NA 1RT6A 2WOMA 1J5OA 1HPZA 1TGOA 5E41A 1N48A 4TQRA 1WAJA 3BSNA 5EWGA 4XO0A 4WFYA 3MR6A 4XPCA 1WLJA 4O4RA 1JLCA 4M3RA 3KJVB 3QGIA 1TK8A 1D9DA 3V9WA 2KFZA 2DPIA 4ZVFA 4RNFA 3H5UA 4I2QB 4KHQA 2HHUA 3LP1B 4M3UA 4CF8A 3H5XA 2R2SA 1KLNA 5HBMA 1FKOA 2YNHB 2XCPA 4ZPAA 3MEGB 1TL3B 3KLFA 3QEVA 1Z26A 3QEWA 3DYAA 2WCXA 3GQCA 2ILZA 1C0MA 4TYBA 4C8NA 1VSJA 3QETA 4QWAA 1QHTA 1RTHA 1G15A 4ZVHA 1J5OB 2VG6A 4E7LA 3RB0A 4DTXA 1QUVA 1ZBIA 3B6PA 1KRPA 4O4GA 4OLBA 4ZPCA 1RT4A 3P1GA 3AVIA 3SQ0A 2FBYA 3RAXA 5K14A 5C42B 2D0AA 4IFYB 3NMAA 4CHPA 4Z4CA 1JIHA 1MMLA 2HNZA 1S5JA 4DQQA 3M9NB 2Z1IA 1FK9A 1IH7A 3NF9A 3OYHA 3MAQA 3MXJA 3LP2A 4K4ZA 5KG7A 4Z4IA 3G10A 1LAWA 2E9TA 5DGBA 4PQUA 2J6TA 2X6NA 2HVHA 4HUEA 1C0UA 3DM2B 4CEQA 1U49A 3OYAA 3U3YA 4O0JA 4M45A 4URGA 4QW8A 2YHAA 4TYAA 2W7PA 4OPKA 3KKRA 3MR5A 2A1SA 4ECRA 1BIUA 1RT4B 3CFPA 4YFUA 4MKBA 1HYVA 1RDBA 4CERA 2XO7A 4KSEB 3KK1B 3DRPB 2GUIA 4CJFA 2GV9A 1EKEA 1W25A 4J9MA 3WNHA 3N6LA 1BL3A 3ZT1A 2AWZA 2VG6B 4B9UA 3V6KA 4M94A 4IG3A 3LP0A 4AHVA 4Y3CA 4ELVA 1HPZB 2XC9A 4DEZA 2O4IA 1JLGB 4YP3A 2IAJA 4KTQA 3KLHA 4G1QB 5I42B 4FJIA 4M41A 3L2VA 5J2QB 3SUOA 3NE6A 4RW9B 4FJGA 2GIRA 5DQHA 3BJYA 1OS5A 4DLEA 5J2MB 2EHGA 4HUGA 2HNYB 3IS9A 3NBPB 1HJRA 4R5PA 3I0SA 2FLPA 3CM5A 4QW9A 5KFJA 1ZETA 3PJXA 1NK7A 4FVMA 3DYAB 3PY8A 2Z1GA 4AHUA 2GIQA 3VQEA 4KO0A 2FJVA 3ZSOA 4B8AB 5F8MA 4CGIA 1TAUA 5KFSA 1U48A 2R8GA 4FLYA 1T05B 3OL6A 4FLTA 1C1BA 3PR5B 1TAQA 1REVA 1IM4A 4J2EA 4K50A 4G1QA 5I42A 3E01A 4FW2A 2JC0A 3UPFA 3KK2A 4AHTA 3V81A 3MEEA 2FVSA 4ID5A 3GILA 4CGGA 3SUNA 1C1CB 2D41A 2NUBA 1D0EA 4KTZA 5F8GA 3L2WA 3KKSA 4CGHA 1QAJA 3DRPA 4ZP8A 4FLZA 2WTFA 1A5VA 5J1EB 3MFHA 4EEYA 3NF7A 2ATLA 4IRDA 3KD5E 5C5JA 2R7YA 1VSKA 3D5MA 2PZSA 2F8EX 3L2RA 1TVRB 4MH8A 3KTQA 3HO1A 3KHGA 3MTKA 3NGDA 3TAQA 3BGRA 1IKWB 2E9ZA 1NK0A 2AX1A 2P5OA 1RDRA 3AA5X 3HYFA 4I9QA 1S1TA 4J9KA 5CYQB 1QSLA 5F8NA 2D3UA 1DTQA 1FKPA 1BCMA 3H40A 3K57A 2B5JB 4WYWA 2OPQB 4OKEA 2JEJA 1YT3A 3K5OA 3GIIA 4FJNA 2G8VA 2WB4A 1RTJB 2ASJA 5CZ2A 1C1BB 1VSDA 4DLGA 3OLAA 3T19A 1W0HA 2RKIA 3CIZA 3BQ0A 4PY5A 4GMJB 1T94A 2JEFA 3CQ8A 1LWFB 4NYNA 3FFIB 2YNFB 3K5NA 1B9FA 3SUPA 1X9SA 4K4SA 4KV8A 3PO4A 2IBKA 2HNZB 3GIKA 2VG5A 1TVRA 2JGUA 3PUFA 3QO9B 4QOZB 1ZBLA 1WAFA 4KHSA 1TV6B 5KG0A 3DRSA 3OY9A 4KHMA 3NF8A 4TN2A 4CJSA 4KTWA 3HK2A 1N6QA 3QEPA 3VQ8A 2IOCA 4ZPBA 3VQ4A 4QCLA 2C28A 2IAJB 1LV5A 1RDAA 1NJYA 3DLEB 3AO1A 3MEDA 3AO5A 4FJKA 5KFBA 3AVBA 5HP1B 1DLOB 2HHXA 3PW4A 4W5NA 5FROA 2W42A 3SQ1A 4LY7A 4PWDA 1RT7B 2JEIA 1C0UB 1EETA 4LQ3A 4H54A 4W5QA 1ZBUA 4BE1A 1B9DA 1S48A 1TK5A 2XGQA 4RNNA 1QTMA 3PX6A 1I6JA 4CK1A 3NH0A 3LP2B 4CJ5A 1ZTTA 4NYZA 5F9NA 2YKMA 4KPYA 3T3FA 1NJWA 2XHBA 2G8UA 3KNAA 2D5RA 3G6VA 4CF9A 4OGEA 3FDSA 4WE1A 1RBSA 4Y2CA 4J9PA 2VA3A 1B92A 4FJXA 3QLHB 1S1TB 4DF8A 3C94A 4C8LA 4FCYA 4MKAA 4KV8B 2DTUA 4F2RA 5CYMB 2OPQA 4K4XA 2HWHA 3RTVA 2X78A 3HVAA 4ZP7A 4CGJA 4RW8A 1JLQB
chains in the Genus database with same CATH superfamily
3HX9A 2D74B 3KLEA 4RW4A 1CQMA 1XMOF 3AB2B 3WUHA 3VQAA 3R8YA 1ZBSA 2MYFA 4OLAA 1UJ6A 1I94K 3CB4A 3T1YJ 2ILYA 4DV7K 3R1LA 2HZVA 3K5MA 2ROGA 4B3TK 4HEA9 1TMMA 2FHMA 3TA1A 2BGGA 4ED6A 3WNGA 4FL9A 2L08A 4OGCA 5LMUJ 1CLQA 2IJRA 4U6PA 4DR7K 3OBIA 4ED2A 2NQPA 1NGGA 3VQCA 4BACA 1M90O 3PJWA 4NLUA 1DGKN 1XMQK 5LSRA 2VOOA 3Q7BA 2YKNB 9ATCB 4TU8A 4QU7A 1SAZA 4DL2A 1ZBFA 1SQKA 4CGDA 3QESA 3D1OA 1D4XA 5B0DA 1G1XA 2LSNA 1U26A 3EEQA 1D09B 4EO6A 4WTOB 4CLYA 2Z30B 1NGBA 4GKKJ 1RHUB 2CPHA 3M05A 5KFXA 1M90T 3CD6S 3CIMA 3W2VB 1U02A 4DR2F 4HHHA 3ZZUA 4CZFA 1YIJN 1UCNA 2C2ZB 2CDQA 2Z56B 3HOSA 4EIAA 2FHKA 4IBNA 1VIOA 4PHTX 1KP6A 2QFJA 3A0IX 3C8YA 5KTQA 1JLEA 3EZWA 4JV1A 3UCZP 4F4XA 2GX8A 2V6AA 1Z05A 4CEAA 4HT5A 2M70A 3SNNA 2NRXA 4AXJA 4BDPA 4JS4A 3KLGB 4WIIA 1W9HA 1KLMB 3QGGA 1ESVA 2AYGA 4BG9A 1S6UA 4R8UB 4N56A 3TZXA 1FXLA 2MQOA 2WUSA 1RXOB 3V4IA 4OI2A 1C0GA 3SCLE 3O6WA 1RTIB 2FVRA 3LWLA 4H0PA 3TAMB 2ZWHA 5HJXA 4PCQA 1W2BM 4KGZB 2Q1NA 4FJJA 3HSGA 3R9PA 4EBCA 2IMOA 3FLCO 3CCJS 2A1BA 4UUWA 3VQSA 3H25A 2BJ7A 3DLJA 3M8SA 2SXLA 1EKSA 2B8PA 2HLUA 4UOGA 3K2YA 4EYHB 1VLOA 3CI5A 5E7OB 1UAXA 3ENVA 4CLPA 4OVLA 5C2GA 1CZAN 1C4AA 2YNIB 1WSRA 1BQNA 2YXLA 5E3CA 2XY5A 1H7XA 3PIOL 3M8QA 4BWJA 3BZCA 4PUOA 4WP9A 2FLNA 2W8LA 3P4IA 3KLGA 2UVUA 4IRKA 2FXUA 3F9MA 1KWMA 2OA8A 1S72N 2F8TA 3L8BA 4U9RA 2PMHA 4LF9J 4Q0BA 4HCCA 1SJFA 2VF3A 4B3OB 2PN6A 3OVSA 2CJBA 4Y28C 3TSQA 2FJBB 4DTPA 5RUBA 3O44A 4CFDA 3CULA 4DFPA 1Q53A 2HRTA 1BUPA 3C19A 1WG5A 3N0VA 4QPTA 5J2QA 3FNNA 1M1HA 5CCLA 1RTDB 2E8AA 2IIHA 4WF9L 4GVBB 2QA4N 2FZKB 5ETQA 1QTNB 4N41A 4CEBA 3D3BJ 4E8UA 2DGQA 3CD6N 3D7SB 1F21A 2FC0A 2X7IA 3TUJC 2FBVA 3PW2A 5A6WA 4EU0A 4X84A 1OPIA 1H0HB 4JRQA 1UVJA 1A7GE 4EFAC 4DR7J 3GFXA 1HUXA 3VA0A 1YRUA 4MYUA 3ZT0A 3LANA 5F0WA 3AVGA 1ZYQA 1VQPS 4B9TA 4DV0K 1NK9A 1JCGA 4KHPK 3A8KA 3TVZA 3AO3A 1A6LA 5KFNA 5DK5A 4LFCF 4ED4A 3RUBL 5DQIA 2V9WA 4QJVA 2CPFA 1CULB 3S01A 4ZITA 2EPIA 3R5GA 1Y10A 3QINA 2LEAA 2HK2A 3ZZTA 2QX0A 5L1KA 3BBBA 2JWKA 3Q23A 3BPSP 1HR0J 1I39A 2H4YB 3OL8A 4FYVB 4EZ9A 3G25A 4LUBA 1IM6A 3AQOA 2LDIA 1WHVA 4FLVA 1DZ5A 3CUNA 1M5KC 4DUTA 4JNEA 3G6YA 3D6HB 1AA1B 2QTDA 1TFYA 3M6VA 4KBIA 4LRFA 4DQPA 4LFAF 3KWGA 4NI2B 3TEGA 2DXEA 2HBMA 2JHEA 2DVIA 2XS2A 4Z7CA 5EOYA 5L1JA 4B1XB 2R7RA 4FJMA 3CC7S 3MUTP 3UNGC 1HWKA 2Z8QA 2HBYB 1S57A 3BM7A 5ETKA 2XY8A 1K44A 3O8WA 1RAFB 4J9NA 3LUYA 2EKNA 4URSA 4EHUA 2XMAA 4DV4K 2DR5A 3NOGA 5J1PA 4NLGA 2DR6A 3PX4A 3B8HA 2IYIA 3TAMA 3Q8VA 2ACYA 3A8JA 5AQQA 2X1FA 3NGUA 4ECUA 1O6XA 1FD8A 5D15A 3CCMS 2LQ9A 4G6VB 3E3XA 2RF2A 3O4NA 1HW8A 3T5LA 3DLKB 4F3OA 1QS4A 1DRZA 1DEJA 3K0SA 1XIQA 3HHLA 2AF6A 1FXRA 1WC4A 3U1MA 1H7WA 1SI9A 2WBMA 5BRHA 4GMKA 2N3OA 4DR3F 2RRBA 3NCPA 2VWBA 3K2PA 1A5WA 3KK3A 1SH0A 2BJ9A 3NL0A 3DWLA 1GK8A 5KFPA 1JLGA 4X66K 3AA3A 3JTOA 3TARA 3AQPA 3U8XA 3VERA 4H4OA 3TX0A 3EGNA 3NGKA 2FBXA 5GINA 4J37A 1U1OA 3BB5A 4GVBA 3AJDA 2Q43A 3OS0A 1BG3A 1BXNA 2KN4A 4CFCA 2DJWA 4LRAA 2NNWA 5ADXA 1XBWA 2C2RA 1VRUB 2V50A 2B4UA 3PRBA 1AROP 2OSQA 4DTRA 4AL5A 4CLKA 2ZKTA 1V4TA 4KREA 2I8EA 1T8EA 1FRHA 4KQZA 5F8LA 2FD2A 2VG7A 1S9EB 3DLKA 4CJVA 3W9JA 2J6SA 4YORA 2RF2B 1AUSL 4QYRA 5A8RA 3CJTA 4GVMA 1MN7A 1TZ0A 1VQLS 2KDOA 3CJ2A 1NJIO 4RNHA 3GFZA 2RS2A 2BQ3A 4CM0A 5AQSA 4DQRA 1IG9A 3PW7A 4ISFA 1FJ7A 4O5BA 3FSIA 4CH7A 1Y5IB 2XI3A 3QIPB 4H5WA 4I1TA 4X4PA 3DLGA 3SSRA 4GY2B 2RT3A 1OVYA 4DHYA 4PG5A 5IT9O 2B3TB 2NYHA 2E44A 3UN2A 4PQUB 3P31A 4LRBA 4C0BA 3RJMB 3G86A 3Q83A 3G8TA 4FJHA 4RW4B 2ASMA 3J7YI 2AMCB 2IGIA 5AJ3J 2CFXA 2PO4A 1UEVA 4CHYA 2FGCA 1EZZB 1VR6A 4DJBA 1RAEB 2BUPA 4MK9A 3KG4A 2MDAA 4V19J 4G9ZA 4LF5J 1S6QA 2M3DA 4IFYA 4PPDA 3SK3A 1ZAVA 5KFAA 3SSQA 4OLOA 1TP7A 4K41A 4ECVA 2LCWA 3OYNA 3WQPA 4ECTA 2A6AA 1U4BA 3RGIA 1RCHA 2KG0A 4OL8A 2X1AA 3AA4A 1KAXA 3SSSA 1JJ2R 3H8YA 5GMEA 3MXHP 3G82B 2GAHC 2VQFF 4DQ8A 1ZS6A 4LSNA 3A13A 4YQWA 2OKQA 2E4LA 4R25A 1HLWA 2E1AA 1H3DA 4NEYA 4M3XA 4FVCA 3KKFA 4LF8F 4IKFA 4ES2A 2IY5B 3D2FB 3AO4A 2GVDA 2X51A 5LMUK 3J7ZO 1QY7A 4ILMA 3MPUB 3QAUA 1VQ6S 3ULDA 4CEEA 2V8VA 5C0YA 3M8ZA 3D67A 2MHNA 3VA3A 1NPRA 4PKHA 4QAGA 1RP5A 3H59A 3I9ZA 2IC3B 4KO0B 2XRIA 4LF7K 2CPJA 3LPTA 1S77D 1VBZA 3IRWP 1WJ9A 3VQDA 1SQGA 2IDEA 2ATQA 4LSLA 4ZOSA 3G71N 4KAIA 5EDWA 5KFUA 1WSFA 3UE5A 3GU0A 2KO1A 3SLCA 2YPYA 4CLZA 3IKMA 5KPZA 3OTEA 1NK6A 4PYDA 5AZIA 4M95A 1GOCA 1NGIA 1XQSC 3PIPQ 3D54A 2CQGA 3KHYA 2LEBA 1S0MA 1RT1B 3ALYA 1K8AT 3MWTA 4KHWA 3HTVA 2C3PA 3C6TB 3CMAS 2LA6A 3JXOA 1NGFA 3S1TA 1NK4A 2FBTA 5LMNJ 2IIRA 1F5CA 4QQBA 2AJFE 4Z4GA 1PGZA 3VTHA 1WUAA 5D3GB 1D9AA 1N52B 3S41A 5CR4A 2KL8A 3I0RB 2FHOB 4CJLA 3TJ9A 3S9HA 2GGPA 4NYPA 3AY9A 4QWEA 4DX6A 3AA8A 2BE9B 2O8BA 2Z2YB 3HI9A 2P51A 4DKWA 4JI2J 4L72B 1J53A 4PXDA 1VQ5N 1RHKB 3SMPA 3LP0B 4GVEA 3HHDA 5FD1A 5AQTA 2J6UA 5EWFA 1UZHA 3L4IA 4NZ6A 5F1XA 4CJQA 1S7IA 2GO8A 2ZBCA 2B6AA 1I51B 5DDQC 3MMCA 2ITMA 2V2VA 2RN2A 5HL7L 3CD0A 1KQFB 1MU2A 1RU1A 5KT7A 1U0HA 2AYMA 2HBLA 4AT1B 4I2PA 3KIOA 3V6JA 3EVWA 4PQAA 4TVAB 3OW2R 2HFSA 4RU9A 3C6TA 1X4CA 4A59A 5EU7A 3THXB 4FF4A 5DQGA 4FXDA 4I4BA 4K2XA 2PA8D 4LBPA 2IRUA 3SDEA 1VBKA 2HW3A 5HRNA 2QJ3A 3QFWA 3EZ5A 1QVGR 3H2LA 4NLQA 2GMJA 3T5HA 3MCOA 4U67Q 3OFHA 2LU1A 2H1YA 1TL1B 1D8ZA 2IDOA 3K7RA 4DUYF 3AVMA 5AXMA 3AGRA 1NGEA 3MD3A 1RYSA 1TYQB 2GQQA 1X5PA 1E3MA 3TZYA 4YOVA 3NVKA 1C1AA 1KLMA 4OYZA 1ZTWA 4W92B 2VWJA 2BYCA 5IT9U 3TP2A 1HKGA 2QXFA 2I6WA 3OYCA 5FLXO 3T6BA 4DHVA 1ZM9A 1S4FA 1P6TA 3ENBA 2JWLA 4JOUA 2ZZNA 2WK4A 2MQMA 2AU0A 3GJRB 1CPZA 4K8XA 1EWQA 2OTLN 4FJLA 2J76E 1X31C 3VAHA 2PBDA 1RKIA 1FA0A 1UWBA 3FQKA 3PHTA 4ZJQA 2B43A 1YTUA 1UFWA 4DV3F 3E51A 3NHGA 2GX9A 3ID8A 3AJ1A 5C2DA 1KFDA 3IM8A 4MKVA 5AQHA 2V68A 3N6MA 3CMAN 4JBCA 2VPXB 3KWIA 4A47A 4Q45A 2R42A 4A8KA 4GKJJ 4NCGB 3HXMA 4W98A 1OJ4A 3GOIA 2HIQA 4LFCK 3GE1A 3DDKA 2HMIB 3TNVA 2Z1JA 4BE0A 1RWNB 1SL0A 1XMQJ 2BM1A 2Y0BB 5IOLA 1HA1A 1TKDA 3MGJA 1D5AA 3WHIA 2YX4A 3E01B 4X66F 2HFNA 3MPWA 2AGPA 3I8BA 1FT8A 1W2IA 1WC0A 2HQFA 4FNHA 5L38A 3BDEA 2DCLA 4L75A 2BANB 4J2BA 4DUYJ 5BR8F 5H9EJ 2M8DB 1UWBB 4LF4K 4J9QA 2HHTA 3S3NA 3R5JB 1IV0A 4QU6A 3W3DA 4KGMA 5I9EB 1R0AA 2BTFA 2MZJA 1WOQA 4W5RA 4JUZA 1SH2A 2APOA 1J5EJ 3CWJA 4CJRA 1WHYA 1PC5A 1F2GA 3MECA 4OX8A 4K0KK 1RDCA 3QWUA 1NLVA 3PCOB 3R3LA 3GSDA 4FZZA 3D45A 2AEJA 4I68A 4OO1J 4OMFG 2WTUA 2Y1IA 3WNFA 3U6FA 4FWRA 1JKHA 1KDNA 3IBCB 4CBUA 3CT9A 3EKUA 2PGCA 1PKUA 4IR1A 4CJTA 3O3HA 3H5SA 3GYNA 5EN1A 3ZT2A 3UVJB 2PYLA 5HMYA 2DCUB 1IBMK 2JFKA 2E7WA 3L7OA 1G4CA 4OHYA 1UMJA 2HQDA 1FNXH 3TAGA 4ZHRB 5AQYA 2PI4A 2PYJA 1U1NA 4JV5F 2BJ8A 4HLBA 1Q0NA 2LKZA 4IO9L 2VG5B 4CBXA 3SJHA 1S72S 3HVWA 3TRGA 4J9OA 4N76A 4GV6A 1RHJB 5HP1A 3JQKA 2D4WA 2WSEC 2V2KA 1BQMB 1T9UA 1F9EB 5F3TA 3NGYA 4O8UA 3M32B 5IM0A 3MOJB 4DCHA 2EFVA 5GIPA 1GT8A 4B9VA 1RT5B 1WDDA 2OPPA 1L5UA 4E7JA 1FW6A 2GQCA 4OZ3A 3C7NB 5EX3A 4QS7A 5KFOA 3THYA 3ICLA 3GYGA 4IXCA 2IBOA 3SEOA 3T5KA 4CJPA 1ROFA 3NAEA 2ZOMA 2FY8A 2YBVA 2DISA 4JD2A 3D4JA 3WIUA 4HI1A 3O9UA 3PYEA 5GAHU 5DJBA 3O6QA 1ILYA 1IQZA 1F9HA 3DC2A 4FS2A 2P9GA 3CJAA 2NRZA 4DV1K 1H2UX 4LFBF 2MKHA 4OJRA 1UAWA 1VQ9N 1IKVA 4RBVA 5EUHA 4Y1DA 4DSKA 4PL8A 4DZDA 3DDIA 2YWKA 1HD1A 1FRMA 2CWKA 1KCFA 1FF2A 4QIFA 4BQLA 4IO8A 5GAHI 3L7UA 2N4CA 2DGWA 3U9DA 4ETXA 2M4MA 2C2KB 2Q97A 4C1NI 2K7JA 1Q9XA 1JLBA 1E6VB 4G3IA 1DAXA 1TK0A 2J9CA 4TLRA 1K47A 1NDKA 1HNIB 2P8IA 3OLBA 5DO2A 4H4KA 2AYEA 4DV5J 1YVFA 4HUFA 3R7SB 2G8KA 1TKXB 1IWGA 2CPDA 1JL2A 5IWAK 4CO5A 1OYDA 3FEYB 4LRCA 4CZIA 4TQSA 1VQNN 4YDDB 5C10A 1ITGA 4BREA 5B7WA 5KFCA 3RZAA 1Z25A 4HT7A 4LF6F 3JAMO 4J90A 1N8RO 4FPRA 2MSSA 2MLZA 5KFHA 3KDOA 1WWHA 1RE1B 2LLZA 3OSPA 3P45B 4LH4A 3R3TA 4RWXA 5D4NA 4EP5A 1SJRA 2XMUA 3W5YA 2RSQA 3G8SA 3E9PA 1TUGB 3KMQA 2J4RA 4CEOA 1Q81O 2Z58B 4IKAA 2UUBK 2RU9A 3W8GA 3VAFA 3TOQA 1RCXB 3J7AN 3LWMA 2PSZA 4DSEA 2YX6A 2W2MP 4Q0BB 2A6OA 4H5VA 5I3UB 3OW2M 2OPRA 1ELOA 3QYYA 2B7CB 4DX5A 4DFKA 4CP5A 3RVCA 1S76D 4U7BA 3CJRA 3ADAC 3VAGA 1G99A 1ITPA 4LBHA 2M7SA 4PAAA 1APSA 3THXA 2YNGB 3QICA 5G0RB 4BG8A 3CCVS 3OYLA 2ZJPL 3A8IA 4IOAQ 2UVVA 3CJBA 4H0YB 3RSEB 4B3TJ 3IUCA 1UA0A 1T0TV 2GBZA 1FXXA 3VENA 3ZSQA 1S12A 1TKZB 1YXQA 4PG4A 2A3ZA 1EIYB 4C11B 1IR1A 3W7BA 4O3PA 1VRTA 2ZC4A 5K8NA 1VQ9S 3L7PA 1NAQA 3TTCA 2QL9B 4AXIA 3BSNA 2W2NP 4QYZJ 4OI6A 3KWMA 3N4WA 3Q24A 4M3RA 4N7TA 1TK8A 1D9DA 2YKOA 3V9WA 2C3MA 3G82A 4DV4F 3LP1B 4ISEA 4CF8A 2R3VA 1FKOA 2YNHB 4ZPAA 3QEVA 1Z26A 3QEWA 4ZKAA 1VHIA 2ILZA 4C8NA 3FSXA 3SBGA 3P49B 2FSNA 3QETA 4MMOA 2HRYA 4ZVHA 4WCEQ 4CNYA 2HMPA 4USHA 1GMWA 1J5OB 4DV6F 3B78A 3UD3P 3R6LB 1NGDA 3CD7A 3OTOF 3FBBA 2VBWA 2PI5A 2HFZA 3J7ZT 2GHWA 4DPUA 2BOAA 4FWPA 2HQIA 3U27A 4Z4CA 2XSJA 2A2CA 1MMLA 2HNZA 1B7YB 4JKCA 3CC4N 3MX5A 1FK9A 5EY4A 1IH7A 3VALA 3PM9A 4H5RA 4LT6A 3X3UA 5KG7A 2L9DA 1TYQA 3G10A 4CD1A 2J6TA 4BC5A 4HUEA 1IBKF 3U9ZA 3U3YA 4DR7F 2YHXA 4URGA 4QW8A 2YHAA 4TYAA 2W7PA 4OPKA 3KKRA 3I31A 4IJAA 2A1SA 3OTCA 1MROA 1BIUA 4JI5F 2DNGA 4YFUA 3E66A 3ZX0A 1WORA 1HYVA 4PG6A 4JI8J 3LGHA 1FKAF 1EKEA 4Y0FA 1JJ2M 3QT5A 3WNHA 1N36J 1VQ8N 3W61A 5D6GA 2R7QA 3Q8YA 3VWSA 1X3MA 1B7FA 4X64F 2KVQE 1HPZB 2ATCB 4DEZA 4YP3A 3M6UA 1MSWD 4G1QB 5I42B 4YDUC 3MTJA 1X0FA 4BVPA 2CPIA 4CZHA 3L2VA 2CNLB 5J2QB 3SUOA 3NE6A 4RW9B 1X5TA 4FJGA 2CQ3A 3P5TL 1OS5A 4DLEA 2VQEK 2EHGA 4X65J 4HUGA 3OD2A 2BMBA 3VF2A 1Y7PA 2DKOB 2VC1A 1NK7A 3DYAB 1VQKS 4LVNP 5KFSA 5BRDA 4CO0A 4OZJA 3K9KA 2R8GA 1NXIA 2W4CA 4OV6A 3N01A 1KNZA 3PR5B 3O8MA 3R1XA 4FW2A 2NYIA 1HWJA 3QT6A 3KK7A 4DV2J 4ID5A 3BZKA 1CEZA 2H5JB 2D41A 1W26A 2A2DA 4FKXA 1D0EA 4DV5F 1WB9A 1PJ7A 2P9IB 4CD3A 2BUNA 8RUCA 1QAJA 3LDNA 1ZH5A 4FLZA 5J1EB 4K0KF 5M1OA 4IRDA 3KD5E 1FERA 3IDHA 1VSKA 3D5MA 5ETRA 4LF7F 2F8EX 3GYXB 3I33A 3ILLA 3TAQA 2CPYA 3BGRA 4YEAA 2E9ZA 4P2SA 2P9KA 2YCHA 3H3NO 1M5HA 3Q2TC 4DR2K 5LJ3Y 4J9KA 4DV1F 1DTQA 1RWMB 1Y9OA 3H40A 5EGYA 1AYEA 2P9UB 3CJSA 3K57A 2B5JB 1NO8A 3K5PA 2XZTB 3CDAA 2R7UA 3HHLC 2XSFA 2A0FB 2VFVA 1Y3JA 2WB4A 4CI6A 1RTJB 3D6MB 3EN9A 3B82A 1C1BB 8AT1B 1MN9A 3CJ1A 4M1KA 2UUCJ 3T19A 1RISA 4OFZA 1FEHA 4PY5A 3BQ0A 4FSVA 4LF8K 3FFIB 4B3RJ 1X9SA 5IFMA 4QBUA 1S5ZA 3PO4A 3GIKA 5AXNA 4JHDA 4A2AA 2VG5A 2AYBA 2R7OA 3W2VA 3MI7X 2JGUA 3SCJE 1SJ3P 1ZBLA 3BBCA 3O9QA 4KHSA 5D0GA 4TN2A 4C4WA 2EG1A 3R6MA 3VQ4A 5GMKa 2IAJB 1LV5A 3EL2A 2W6LA 3DOMA 3MEDA 4IO9Q 3L0QA 5C15A 5B8HA 2R7WA 1DLOB 1VOMA 2HHXA 3PW4A 1Y5NB 5IQQA 5FROA 1XNQJ 1NB2A 4L6V3 3MPDA 1IBLF 3C6AA 4LQ3A 1RHRB 4W5QA 4BE1A 3VAMA 1CBKA 3J80O 2XGQA 4FWMA 1I6JA 4CK1A 1MROB 1ZZNA 1RBAA 3C2PA 5D4OA 2YKMA 3ZC4A 3T3FA 4C0HA 2G8UA 1W7WA 2QMUB 3HZEA 4OGEA 3QJPA 4CO1A 1FFWB 1RBSA 3CCMN 2VPWB 1BOTO 3E9LA 2CIMA 2DHSA 3JQMA 2NXEA 2Y1LB 4FF3A 3MM5B 4JI7J 4JB8B 4F2RA 2PE8A 2VODA 1NH7A 1CJKA 5ITHA 2HWHA 4F0HA 2X78A 3HVAA 3IBFB 3GG4A 3J7A1 1U24A 3S3MA 2FDNA 2V51B 5CXTA 3O5BA 1WF0A 5C2CA 2RE2A 1CVJA 1TR0A 1HX1A 2U1AA 2C42A 1XJWB 1BQNB 2RAQA 4KGXB 1JQGA 1VQYA 4EZ6A 2BQUA 1KHVA 2NS1B 3FZKA 4I6AA 3PJ9A 2E2QA 1NB7A 1U0HB 5AZJA 2CQ4A 3IMQJ 1XMOJ 2W2QP 4AYBD 2VGNA 4CEFA 3UDEA 3ZYYX 1QDUB 4DZ6A 1IBLK 3U1NA 4JI5J 4LH5A 1B70B 5KG2A 4JI3K 4FZVA 2EI5A 5DLFA 5GAEU 5H9FK 1H72C 3CQXA 1RGIA 3MEEB 3EXYA 1IN0A 4OJ1A 1FDAA 4KFBB 1KN6A 2YNFA 3J80Y 4O8KA 4JKGA 3KD1E 2NRTA 3JYTA 4EWTA 2RHKA 2V9KA 2B7BB 2CRLA 1BCOA 3DI6A 4XK8C 2O8EA 1UW4A 1FEEA 3DLLQ 3AODA 2RQKA 2YHBA 1KTQA 3HHEA 3BH6B 4OHWA 2GMLA 4RTFD 4KHRA 4RBUA 1UJ5A 3AXKA 1Q86O 3ZSZA 1UTAA 1VGYA 3PR4A 4DV3K 4FZYA 1P90A 4HTUA 2ASLA 1VQON 5TKWA 1HARA 4N8OA 3ZFVA 4DU4A 3QMQA 4AQYK 3A5OC 2AX0A 1RLDA 2DIVA 3C6HA 4BR5A 2CJXB 3KNGA 2J9DE 2LXFA 3RBZA 3MEGA 2HGLA 2ASDA 4NRUA 2IVOA 2RNEA 1R0AB 5AT1B 5T14A 3L4BC 4NWBA 1EQ0A 4BR9A 5F9LA 2KLAA 1WF2A 4QIGA 4YB1P 1EP4A 2C2EA 1N34J 2ZD1A 1I1GA 2DNQA 2DNLA 3ZTOA 4LSNB 1IXKA 4EO8A 5GAGI 2O8FB 1LWCA 3H98A 2IMWP 2RDIA 4O3NA 3B6BA 4RNOA 1OY9A 4EGLA 3THWA 5KFZA 3NP5A 3M9OB 4KH1B 4PWDB 1W97L 1GFWB 1SJ4P 1SV5B 4CF1A 1WSIA 3ITHB 1X3NA 3LP3A 1ACMB 1C1CA 4N8NA 3WZ0A 5DG9A 1K8KA 3TX8A 5IT4A 2DITA 3V5RA 4PKDB 3SQGA 3LZIA 1VQ6N 1Z2ZA 3H20A 5G4DA 3V2UC 4BR2A 3ZX3A 3DGVA 2K06A 3LDSA 3GONA 3NCRA 2W9BB 3V1QA 4P7TA 1JXEA 2Q0UA 5D3GA 4MIAA 5LM7E 5KFDA 1HKBA 4V19X 1N5YB 4ZLJA 2GTDA 1NJXA 2DNMA 3QNNA 2WW4A 3SUQA 3CJ3A 3TR5A 2VD3A 1QSYA 4RU2A 1HLUA 2HAIA 2D0BA 3IGNA 4DV6K 4LR7A 2V8DA 3VQ6A 2A5XA 5T7LA 2OZSA 1N33J 4F9OA 2RS8A 4UOCA 1SUQB 4YUDA 4KH5A 3BZQA 3M30B 3HP6A 3FK4A 3I56S 3TJAA 2WBRA 4NOHA 2NXUA 3RSEA 1HNZJ 4B3MK 4B8CA 3QWPA 3QIOA 3DLHA 3K9JA 4J7CA 2W9BA 1JNZB 5HANA 1NGJA 1R27B 2C3UA 4C97A 4O3RA 3PIOQ 4C8OA 2AEFA 2OFGX 2RVJA 5BR8J 4OZ5A 2Z57B 1HNZF 3M2VB 3TANA 4FYWB 4JYAF 1DLOA 2HQ3A 2CXEA 3WQTA 2HIYA 3CJCA 4FZXC 5CHCB 1EARA 4A8QA 5D4LA 2JLFA 1ASWA 4CIFA 1Z4UA 5BREA 4E3SA 1VC0A 2ZBQA 2G0IA 3DLLL 4Y0WA 2KYXA 4Y00A 3F73A 3QQCD 3VR1A 4NMLA 4RWTA 3AD9C 3ISND 3TZZA 1U45A 1RACB 2NSCA 1NSPA 1NWKA 2F96A 3SIPB 1M1KT 5KG5A 2ZD1B 5ETNA 2ZM6J 2ZUGA 4KI6A 3IG1A 1BWVA 3KLFB 2QM1A 3FFIA 4R8UA 4B02A 2QA1A 5M1PA 4YY3F 1KVIA 2ZWOA 4WYBA 1GMVA 3DRXA 2WONB 1X7VA 4AHCA 4NLYA 3TEHB 4A8YA 2F9TA 4CK2A 4U7CA 4ZCMA 1HI8A 2HK3A 2ZM6F 4KB1A 3CCVN 3EZUA 3QDKA 4BRCA 2UU9K 4JI6K 4A8WA 4IDKA 5D0RA 2KW4A 5GADI 5JMNA 3DFEA 4WK1A 1OH8A 3MM9B 4ELUA 4DXLA 4DR4K 3FMBA 1UPMB 3FEZA 4WYLA 3ZNUA 4B3SF 5HMWA 1TKTA 4QS9A 3G4SN 5HOOA 2HS3A 2D3ZA 3CHWA 1FKOB 2YNHA 3SCIE 2ZBIA 5E3RA 3WDOA 3HVRA 3ONQA 1KBRA 3HBTA 2LEPA 5LL6d 4ZTFA 3SDEB 1HWUA 3BSAA 5SZTA 5KGXA 1NHKL 3F56A 4DU3A 4ECSA 1T3NA 3OXLA 2L3MA 3LW5C 3DXMA 2PFFB 1NDPA 2R8IA 2Y1JA 1DBDA 2FJWA 3QIPA 4QWCA 4LRDA 2P2CB 1YLXA 3IR6B 3Q22A 2AP1A 1NKCA 5JXSA 4ZVGA 4ES1A 4P2FA 3Q8QB 3NY0A 1RYRA 4IG0B 4J9VA 1RWOB 1S79A 2EC0A 4CYUA 3ZZRA 4GC7A 3LL3A 2HPUA 2E2OA 1Q5VA 2D0CA 3CCRN 2EWSA 3L3CA 3KLIA 5M1KA 3AA2A 2MLXA 4YN3B 1RAIB 3OYBA 2Y3YA 3GP9A 1JWWA 3HKWA 4E1NA 2CAJA 2OFHX 4Z4HA 4CLLA 1RT3B 2FHJD 1U1PA 2MKIA 3OS1A 3ZTPA 4AHSA 3QLHA 3THPA 2B4VA 2LYVA 4CLWA 3ZTRA 1H38A 3T1HK 1JLAB 4R0EA 4HKQA 4WXWA 2DHGA 4QWBA 5CZVA 4AUKA 2BX6A 4PL7A 1IQTA 3N9UC 3J8AA 3CCEN 3CCUS 4C8MA 4DB3A 2KVIA 4CYUB 1ASVA 4WP3A 5CYMA 3M8WA 2FTRA 4CJEA 1L3VA 2H3EB 1HMVB 2V7ZA 5DMRA 1N32F 4F4AA 2P9PA 2B5JA 1CQNA 2YNIA 1LW2A 4JKAA 2J7UA 4BDZA 1LXJA 3QO9A 2XHWA 1T9YA 3SZ2A 2FVQA 2H5IB 4Y2AA 3I5AA 2C2DA 2CPXA 2F9DA 1S0VA 3MHYA 2BANA 4CO2A 5HQLA 3JSBA 5KFMA 2K3IA 3SAFA 4KHYA 2ITGA 4P75A 1U2CA 3QBCA 4ILLA 3RMBA 4WQ4C 1Y4ZB 1EQMA 2EC2A 4LJMA 4X4RA 4ILHA 4RUBA 4O0IA 1HHTP 2P6SA 3P8BB 2ZH2A 5HI7A 3DXKA 2WVFA 3D9BA 4DR3J 4UQGA 2MQNA 4NI2A 3FQLA 1J6ZA 4ZPDA 3OTOK 3VQPA 3O3LA 4HTLA 3UCGA 3JQJA 4RO0A 5KFIA 3IAS9 2OELA 3EO3A 3OYMA 1GX6A 1S49A 2AKWB 1QLNA 3GIRA 4RJVA 2UXDK 1GMUA 2E1PA 3W5ZA 2HG4A 3P39A 4NLVA 3CETA 3HT0A 4FK2A 1NSKL 3CYMA 4F3TA 2ZBPA 3V9SA 4NA3A 3OA9A 4KJIA 2ZE2A 1AFJA 2QLFB 3QZ7A 4F4KA 4FLXA 1T03A 2OPSB 1VJQA 2KYZA 4DPOA 4BC7A 4FWOA 3CCRS 1DURA 2W41A 2KXFA 4DU8A 1KQSM 4F50A 1LWCB 3P5JA 2DHHA 2HHWA 3ZX2A 2MTLA 4NXMK 4D3GA 3R6GB 5LXRA 4C98A 2D7SA 2V8GA 2MY8A 3V6DB 1KHWA 3SQ4A 3GIMA 4YOXA 2X6SA 1VQLN 1CS4A 3AJ2A 2E1MC 1YRTA 1WKKA 4JI0K 2UVRA 4DR5F 1NBWA 4B9LA 2XS7A 3THYB 4HTJA 4A8OA 2Q1LA 2LQJA 3KJQB 2UXCJ 1NCLA 2NXCA 4E98A 3CCES 2J8AA 4BRDA 2F40A 4CIOA 4HH1A 1XNQF 4NASA 1S1VB 2JC1A 4MJKA 3SAGA 2J0QD 1M5OC 2HKEA 2UUWA 2XMTA 2RD5C 3D0PA 4JLHA 5JMVA 4Q7AA 2Y8WA 1F60B 1LOUA 4CH0S 2E9RX 1BQXA 3POTB 4ZVTB 5B0EA 5I3QA 2N4DA 4FF1A 3LPYA 3HMJG 1TKXA 4CIEA 2QEXS 2HWIA 4P74A 1Q18A 3CD5A 2QWMA 3B54A 1HMVA 2EFPA 2ABYA 4JI6F 3D6RA 1SKUB 4OPAA 2KHOA 3PYGA 5HLFA 1HQUA 4AFFA 5HVHA 4OYOA 1GLCG 3UD4P 2C2NA 1VLYA 3QNWB 4RKUC 4O3OA 2DD8S 1IBKK 3TABA 3UWTA 1FFGB 5DETA 2MB0B 1ZC6A 1AZSB 1X5SA 4FK0A 2CGLA 4F7VA 4YS2A 1XI1A 4JYAK 3NGIA 4PR6A 4CH1A 3QBWA 3T9ZA 3IGVA 4MDBA 7AT1B 4NO7A 3BKTA 4IZ9A 1FTRA 2HMIA 1VSFA 2E1YA 3GBTA 4LC9B 1WACA 5AE1A 4X62F 2HSTA 3KHRA 4FWLA 3ENWA 2E2PA 3DM2A 4WKRA 4UY85 4JD2B 4RW6B 2CJQA 5HRSA 3HRGA 1B64A 1NOZA 4LSZB 3UR0A 4C11A 2P9IA 1FK9B 4P10A 1AW0A 1PC4A 5MLCV 5IV4A 5K14B 1TL7A 3OS2A 1RAJA 4F26A 3IP0A 3C16A 1BI4A 4C2MA 3FJ2A 5SUHA 1BQMA 2GQ2A 2O8DA 2CUYA 3FCHA 2AJQA 2Q79A 1H98A 1UZDA 4QWDA 4ERDA 5KFYA 1LWFA 3EWGA 1BWFO 3GCXP 2LA4A 4ZN3A 1YJUA 3NCIA 2DEIA 5DM6L 2VPZB 1U1RA 2XZDB 3TAEA 3QFHA 3QRRA 2YHWA 3QEIA 5J2MA 2E66A 1EJ7L 4A2BA 2CJ9A 4O3QA 1KVAA 4DV5K 5CYJA 3JAMY 4Z2XA 4DR1K 3V9UA 3PRDA 1S22A 2JX2A 3V1OA 4OJ3A 2BABA 3RR8A 4NXNF 3BS9A 4QS8A 2BE2A 2WW8A 3EY1A 1RZMA 1L3TA 2VQFK 3OFGA 5AR0A 2AQ4A 3IAM9 5AQJA 2DIUA 2IJFA 2ZH4A 2V7YA 1T9TA 2DGTA 2YY3A 1LKZA 2UXBF 4C9DA 4E7KA 5CY4A 3OTBA 4CFAA 2QEXN 3DMJA 1E4GT 1RWWB 1RI7A 5DDPC 2M0GB 5AQKA 4EP4A 5LMUF 3K58A 2K8GA 4WKYA 1GX5A 5LJWA 5BR9A 3L2QA 2EW9A 1NJIT 4I6MB 2DH7A 2ZOGA 1BHNA 1OYEA 4JI6J 1ZZFA 4JI1K 1U2VB 4NYFA 3IS9B 1QE1A 2DGUA 2YKQA 1LW0B 5AQMA 3B4DA 3MM7B 3C6UA 1S1WB 1P8GA 5KQ8A 5CE3A 2B0GA 3IR7B 3FRYA 4BBYA 3PSIA 4J8FA 3TSUA 5A8WA 4PG8A 3M1FA 4RUCA 1R0BG 4YB7A 5CD4H 3NH1A 2LQ5A 2XY7A 4B17A 3Q8PB 3HSTB 1S97A 3RYLA 1A5XA 1U6BA 4M5NA 5KAKA 4M3ZA 1UVLA 4O3SA 4JI7K 4MYTA 4DU1A 4I6YA 4DTSA 3OL9A 5KFFA 2ZH5A 2RPIA 3DMJB 3OTOJ 3K8WA 2DO4A 2W24A 1U2RA 3DKDA 2W7AA 2XGPA 1U6FA 1GLBG 5HLFB 3BYPA 1Q8IA 1U1KA 1RHQB 4FF2A 1YTAA 3R8EA 1XR6A 1IR0A 5AQGA 2G0JA 3V6HA 2WRMA 4CJ7A 1YBTA 3GTYX 1JCFA 2A42A 3OYJA 2CJAA 4ID5B 4PXEA 5KG1A 3I4PA 4HR2A 4WP8A 3MMBA 1ZBHA 1LXNA 4E1JA 7FD1A 6FDRA 2DFHA 1S9GB 1I3OB 3PTWA 4FM0A 2QN6B 5HK4A 4OX6A 1XMBA 3ENQA 2YWGA 4I7FB 4CZEA 3M1VA 4HHUA 4HDGA 4CHNA 3G0ZA 3ILOA 3OYKA 1RTHB 3U3GA 2VB6A 3A3PB 1UVKA 1MWQA 3W65A 4DR1J 3KUGA 2LVWA 1EX4A 3MEKA 4Q2LA 3OBWA 5EWEA 3M5RA 3QGPA 4LFAK 3CJ5A 2J0WA 2KHDA 3PFOA 2F1FA 4AD6A 2RHSB 2YJFA 4PWUA 1KONA 4IFVA 3QATA 3O9TA 5GAGP 2Z2ZA 1D9FA 5A6PA 2YWWA 3DLBA 1SL2A 3N28A 4Y1CA 2ASPA 3DI6B 2O8EB 4LF4J 3GV5B 2OHDA 2G2OA 3N5FA 1VYAA 4ZLNA 4MFBA 2FF6A 2OLWA 3DNCA 1J2VA 2DYAA 5I3PA 2GS8A 3CCQN 1TQLA 1HRHA 3QFUA 2XCAA 2MKKA 5L9XA 4DR5K 5DS7A 2W9CB 1VAZA 3CDEA 3WEEB 4ECQA 3L9ZA 3MF5A 2RDDA 4RW7B 1EETB 3GDQA 2IDLA 3MMAA 1JB0C 3VGUA 3WX8A 3OYDA 3VAJA 5M1QA 4QR0A 2AJ4A 3VF4A 2VU5A 2WB1D 3FR0A 3K59A 4ZK7M 1JL1A 1GLEG 4GW6A 2K3KA 2AZ3A 4E0DA 2JRSA 3RU0A 5KT4A 2QA4G 2VFRA 3THWB 4H0OA 2VBYA 3MN7A 2E5LK 4CECA 5C25A 3UDCA 2BJ1A 1CXUA 4JAXA 1YWXA 4M3TA 3A2FA 1WD6A 4KBOA 2KI2A 2FHJA 4C48A 4NLPA 1MW7A 1NM1A 1VK8A 3NBPA 1KEKA 1R7IA 1VFJA 4O23A 3NFAA 4X4OA 1ATNA 3ENAA 3I32A 1X1PA 5A2QO 3QT8A 4YOYA 1KVJA 4LR9A 5AQZA 3EGWB 1WC3A 2DPJA 4N5SA 1C0FA 2Z2LA 1CJVA 3MUMP 1TELA 3ILIA 3HFKA 1T7PA 2QFIA 4JV5K 4J5OA 4BQZA 4B3TF 2J7WA 3C65A 2DR9A 2Q31A 3HVTA 2OJ3A 3BSCA 2E5GA 4IYQA 2W7OA 3UNYA 1FI4A 4MIWA 2XYGB 2C22A 1NHVA 4I6WA 3NGZA 1HYZA 3JXUA 4F36A 3SPZA 3HSJA 2EEYA 4CJKA 5KRTA 2Z0GA 3VZIA 1N0UA 4K4UA 4HCBA 1S6PA 2YKPA 3AOCA 4NLSA 2HHVA 3M32A 3NRBA 5IM0B 5SWMA 2HURA 4I2QA 4DSIA 2ROEA 2QMWA 2VIHA 4X2BA 3NH2A 3MCPA 4JI5K 4F25A 1X4AA 2WOMA 4LFBJ 1HPZA 2AZ1A 4XO0A 3ZEUA 1BE4A 1Q95G 4C7QA 1WLJA 3KJVB 1WG4A 4CT9A 1PILA 2VGMA 2DPIA 4ZVFA 3H5UA 2HHUA 5CA5A 4M5MA 4LFBK 3H5XA 2R2SA 2V4JA 1Z6RA 5HBMA 4BRLA 4EI2A 5E0OA 1KAYA 4LF6K 4A5AA 4QWAA 3IXQA 1QHTA 4DX7A 2XWXA 1WTFA 2OEJA 2VG6A 1T11A 3R2CJ 3RB0A 2K2PA 1QUVA 1ZBIA 3B6PA 1WEXA 2VQFJ 2FJAB 4IWVA 2L9WA 1XERA 4WPAA 3OBYA 1RT4A 4MLHA 2L9NA 1N54B 2ZZMA 3DGPB 2XMWA 2DRAA 4XH4A 2OI2A 2UXBK 2DGSA 1BO5O 3I96A 1XUPO 4MKYA 1JJ4A 4JV5J 1S5JA 3R27A 1NU4A 3NF9A 2DNYA 1RJJA 4JI2F 1VQOS 4Y2IA 4Z4IA 1LAWA 2E9TA 5DDRC 3W9HA 2DXDA 2W4PA 4PQUA 2X6NA 2HVHA 1S4EA 3HDSA 3DM2B 1U49A 4CEQA 3OYAA 1XK8A 5IZHA 3ETOA 4U8VA 4O0JA 3EVOA 1OKJA 1SXLA 3NVMA 4ZLLA 5FPEA 1L3KA 2KXNB 2QWPA 1ZA1B 4OI0A 1H2VZ 3M2UA 2OD6A 2XO7A 4OQJA 3DRPB 3VEZA 3K8VA 3FCWA 2HBQB 1U8SA 1BL3A 1WOOA 1GMWD 5DRKA 4XH1A 2AWZA 2VG6B 4B9UA 3LP0A 1CG2A 4M7XA 2FC9A 1V3RA 1UVNA 3HSCA 1CJVB 1UVMA 1GH8A 2IAJA 2HQGA 4JK7A 2NRHA 4FJIA 3VESA 1HR0F 2B56A 4M41A 1B4SA 3OXFA 3F5TA 4GO7X 3VGLA 3D68A 1PIEA 1WI6A 2W4DA 4B3RF 2OGUA 2HNYB 3NBPB 4KRWA 1HJRA 1FJGK 3I0SA 3ZZZA 2FLPA 4FDFA 4QW9A 3W60A 5KFJA 1ZETA 3PJXA 5E84A 1M5SA 4AHUA 1PYTA 2CNNB 2GIQA 3VQEA 4KO0A 5LJVA 3NGTA 1TUUA 1TAUA 2MZTA 3ZZYA 1T05B 2D9OA 4FLTA 1C1BA 3Q2SC 1FCAA 1TAQA 4PWWA 1GLFO 5CHIA 4DBQA 3CC4S 2JC0A 3UPFA 2P9SA 3TWZA 3V81A 3MEEA 2G2YA 3DXSX 4H03B 2JNJA 5K8MA 4CGGA 2AV5A 3SUNA 1VQ5S 1WC6A 4N77A 4B3SK 4RUHA 2FYXA 4KTZA 4QZVB 5F8GA 4CZMA 3L2WA 2JL9A 3M2VA 4CGHA 5L8RC 2UV8G 1NEEA 2J9DA 1PJ5A 4AQYJ 3MFHA 3AGKA 1IUJA 4IJNA 4OYBA 5D77A 5THWA 2PZSA 4O5FA 3BUZB 5AE3A 5D8HB 1TVRB 4MH8A 4OYIA 3KTQA 2QYCA 3IWLA 1KQGB 3MTKA 1YHQN 3NGDA 4K5RA 1VQSA 2CVIA 1IKWB 2ZBRA 1RDRA 2OTJS 3I56N 3Q89A 5D0EA 2IVPA 3CNQP 2MY7A 2QRRA 4I9QA 1S1TA 1RSCA 5CYQB 1QSLA 5F8NA 2X1BA 1FKPA 3FUYA 3EMTA 3H1QA 4A8FA 2F9WA 1CJKB 3J7AP 2B9EA 3K5OA 1YT3A 2QWRA 3D2EA 1B99A 2ASJA 4X64K 5CZ2A 1VSDA 3FC9A 2KU7A 1OO0B 2BH1A 1NDCA 3CIZA 3BGLA 2OCEA 2KKHA 4GNIA 3T1YF 3CQ8A 4NA2A 5FLXU 3FZ2A 3K5NA 1B9FA 1FVSA 4PRFA 3B8AX 4F3QA 2KKZA 2IVFB 1OSCA 1VDHA 1TVRA 3QO9B 4ZVUB 2FJDB 2I0XA 2MJUA 2E1CA 3QBXA 1WUUA 2DGVA 1TV6B 5KG0A 3DRSA 3OY9A 4CJSA 2ZUAA 3BN4A 5HJYA 3HK2A 3QEPA 2DT9A 5LXYA 2IOCA 2XG8A 1HPMA 2C28A 2VOPA 3L09A 5H1SQ 3W8PA 2POKA 1NGAA 2UXDJ 5AQPA 2W42A 2E5JA 4LY7A 1SC4B 1C0UB 1EETA 2MZSA 3MN6A 4XEIA 1QQNA 1ZBUA 3DDNA 3P38A 1TK5A 4OI4A 1QTMA 1MG7A 3R5CA 3LP2B 1ZTTA 3AOAA 4NYZA 4OI3A 2C2MB 1SBRA 3ENOA 3CJ7A 4K59A 3ZETA 2CQ1A 3IFEA 1UW9A 1YJNS 1NUEA 3KNAA 5GAEP 3G6VA 4K25A 4WE1A 4OZ0A 1HWIA 4J9PA 2AEMA 3AAWB 1IG8A 4A8MP 2V94A 4FJXA 1Q8KA 5ETTA 1IBMJ 1IR2A 3C94A 1DFDA 4MKAA 4OYAA 1X8DA 3W63A 5MLCQ 4X4TA 3W64A 3MAAB 3PLAA 1OIAA 1RWPB 1XNQK 3HFVA 2G1HA 4AQYF 1X4HA 3UE2A 2ZWPA 1HW9A 3N4PA 3I87A 3I55S 3CERA 4O44A 1IBMF 3DLRA 3LGNA 1FWLA 4CHOA 1QAYA 1FDDA 1PYOB 2OTJN 3ZCMA 4KFBA 2NSBA 1LK5A 3UIQA 3P6YC 4B3OA 2WVEA 3M2RA 4BRGA 1RAHB 3W1YC 4OKKA 3OYGA 3VVUA 4NLWA 1DQ8A 1Q8LA 4ZCLA 4JN4A 1BHLA 1K8AO 4JKGB 2ASOA 4LBIA 4LF4F 2QWOA 1YF5L 5IC4B 1O8BA 2MQLA 3CJKA 2ZH8A 5A8KA 5J2NB 4WIQA 4Z7YA 2ZH7A 4Z4EA 4DR6J 1BMQB 4ZTJA 1KC8T 5KGWA 2ZJQL 2X1GA 4U96A 3ID6A 4RL1A 1RTIA 2JZ5A 3MMCB 3MCSA 4YB5A 2E5HA 3CXCR 4JV0A 1VQ4N 2W25A 3KLEB 2GIFA 3CCLS 2ZNZA 4LF9F 3V9XA 7FDRA 3L6QA 2HHPA 3M8PA 1SQFA 3FEXB 3ATUA 2PDAA 4XDCA 4B08A 1JCEA 3P4UB 1AZSA 4BRPA 5JICA 3V6DA 3UFCX 3EX7B 4U67L 1IKYB 5HATA 5CCMA 3PG9A 1K9MO 2XBPA 3FRZA 5KG4A 2YQ3A 5F8IA 5FLXY 4IDKB 4KH4A 1XR5A 4DOZA 2F65A 4W5TA 1EHWA 1PG5B 1HKCA 2PFDA 3SV4A 3V9ZA 2OUGA 2KXHA 1SKWA 2CH6A 1YDLA 1NNDA 5E26A 4ZJOA 2YI1A 3G87A 4LF9K 4PUOB 1RDDA 3LM9A 4X4QA 2KJVA 4DS5A 3CPWM 3N5BA 3FE1A 4CVNE 1HBUA 3VQBA 4CCHA 1WBDA 4M3WA 4A8SA 4FYYB 2N7YA 2QZ8A 4AF1A 3PZPA 1K8KB 2IM1A 3O9SA 3TA0A 4ATNA 1FESA 4A5BA 1R8BA 3FCVA 1N8RT 3VMFB 1SIWB 4OYPA 5IWAJ 2OAUA 4PKGA 3NMUA 4JI7F 3BV8A 2XLIA 2ACMA 3JTNA 3GV8B 1PYSB 1JLBB 1E6VA 3CF5L 2LDYA 4WTYA 2YX7A 2UXBJ 4K4TA 2PFUA 1HBNB 3UDLA 3AVFA 1FTCA 2BQRA 4DWIA 4K8ZA 3H4BA 1N5YA 1QVFR 4JV2A 2HVIA 5KFKA 4DPXA 5D78A 2KZZA 4DL6A 4OYMA 3TUPA 1GXLA 1HBMA 2P9LA 5I4MA 1M5PC 4M5DB 3QRQA 3SPYA 2QA2A 2VCPA 4JI0J 3O9RA 2R2TA 3MM9A 3T5JA 3PSFA 3R1HA 3EE9A 3EXCX 4ER8A 4DQSA 2W9AA 3BGFA 2I1RA 2QW9A 5AFUH 3CM6A 4LF1A 3FGVA 4NE9C 4BWMA 1UEKA 1NBEB 3DGPA 3HL8A 2NZTA 5AQOA 3C6UB 1IBCB 4X62J 4B9NA 5JLHA 4IFVB 5HMZA 5CYQA 2ZITA 1QVFM 4XDDA 4X4VA 4M5GA 3A5MC 2FJEB 2WFBA 3WEEA 3GJTB 2IVNA 3VGVA 4MK8A 1SL1A 5E33A 4HHTA 3CDBA 1EO1A 4OV1A 3QERA 5DM7L 4CZCA 1L3UA 3MXIA 1YVNA 1YBUA 2NLXA 4GRSA 3Q8RB 1FJGJ 5FPDA 2G8WA 2BJDA 4J2AA 1D1UA 1HBMB 3GZ7A 2V0NA 4BR4A 4M3YA 3O5TB 4IEEA 2N82B 3HSZA 5IC6B 4HVZA 2M5YA 3LDLA 2IA6A 1K9MT 2B4OA 1BD6A 3TQ1A 2HWTA 1MLAA 2OMOA 1A9NB 4H0VB 5AQFA 3JSMA 2R7XA 1IKXA 3H2UB 2Q3SA 3LA0A 2DB1A 2G13A 4NLDA 4DSLA 1R6VA 4ZVQB 3TVKA 4XTTA 2HSEB 4JHDB 1SS6A 3ZZPA 2I2YA 1X5OA 2UUTA 2X3GA 4ANCA 2WSFC 2XMKA 4UTGA 2CQBA 2E29A 2O1PA 4ZHRA 3KG0A 3HPHA 3IA0A 5LY3A 2VH7A 4H5NA 5E3AA 3UKRA 2GFFA 5HMXA 4JI4J 4EFHA 2KTQA 3PDNA 2CNKB 3OYFA 2RB7A 1UA1A 1XNRF 4YOWA 3P3DA 3HD2A 1Q16B 2O4GA 2HS0A 2A41A 1TL3A 2WC9A 3PW5A 4ECZA 1WSGA 3DOLB 3RRGA 1S9FA 4JS5A 1TL4A 3Q0AA 3S3OA 3VEYA 1H74A 4EBEA 4DPWA 1BC6A 2XWYA 1LAVA 4TKTA 1S9GA 1RT3A 1D3WA 3HFZB 4P2XA 3VZHA 2VWKA 3AT1B 1FRJA 3J7YP 1VS3A 3S7RA 2MPUA 3M2UB 1XEZA 3UW1A 4USKA 4MLEA 1YITN 2K1RB 1Q82T 4B1ZA 3ETMA 1ZAXA 3CF5Q 3G8QA 1M0SA 2KM8C 2DXFA 5DZ7A 4CZKA 3HZGA 2EFOA 3QFPA 4HACB 4AILC 3MEDB 1TL7B 2A1RA 4DCJB 1GXTA 1KSPA 5F41A 2XZWA 4DR2J 2BACA 3VEVA 2O3DA 3EPIA 2N7CA 5BR8K 3DOLA 4DSJA 1RT7A 1T9XA 4CI0B 1N33F 2GV1A 4C8YA 1YI2N 2DNRA 2EWHA 4CHQA 1LCUA 5ADZA 3S8SA 3RMAA 4YR0A 4F67A 1Q4RA 3I82A 3IO1A 1RQ0A 3T7ZA 4M5HA 4E19A 2YQ0A 1HNZK 2V63A 3RB6A 2V4JB 5F3ZA 3TAPA 4WXOA 1N0VC 2RU3A 1H1VA 2XNQA 1RBOB 3OYIA 3E8OA 2VICA 3PO5A 3J81j 2R8KA 1VQ8S 3DHWC 3AA9A 5M2PA 4KAZA 1FO1A 2EG2A 2VKRA 5HL7Q 3H45C 3VN5A 4USIA 4AM7A 2ZVSA 2JVRA 3IBWA 4ZN1A 1N33K 1OQ3A 5FDLA 3CMEN 2O8BB 3F0NA 4TSXA 4OIXA 1BY9A 4BRNA 3KLVA 4OZLA 3UDVA 1KS2A 4BRIA 1QUPA 1REGX 2JLEA 3ZLJA 3A5LC 4XPEA 1R43A 4USTA 3IM9A 4Y6IA 2G4BA 5K8PA 4CLTA 3SI8A 1ZOTA 2P9KB 6AT1B 1PO6A 3NGSA 1S10A 3HF5A 3KJFB 1AUDA 4IRCA 1S7HA 1U6ZA 2I5JB 2OPSA 3FZBA 3MPYA 2RJZA 2E5LJ 2CADA 3AFGA 4MFBB 4RZRA 2M2BA 4GV9A 1MWYA 4ILRA 3HHNB 1RU2A 1WNEA 2B51A 5M2UA 2XS5A 3ET6A 5DM7Q 1WN7A 2V8HA 3UKRB 1GXUA 4GV3A 4AE5A 4MTPA 1S1UB 3EUNA 4K8RA 1VQMN 2XLJA 4MAKA 5BJRA 2MGZB 2BRLA 1HQEA 5JVHL 3I4HX 4CJ4A 1VC6A 3MR7A 2HHHJ 1SKRA 3OVNA 2Q66A 4DR5J 4CTAA 3UN3A 3J81O 2HAFA 3THVA 4A4JA 3AO2A 3M4XA 2DH8A 1RAAB 4UY8T 3SFGA 1ZXOA 4AL6A 1UETA 4K4YA 3KXDA 2WONA 2NCKL 4FM2A 4ECWA 1IBKJ 5U47A 4U7UK 2CQ0A 5KG3A 4C3LA 2ZQBA 1T44A 3TAFA 4OLPA 4EAHD 4DR6K 2A40A 4JI4K 1YJWS 3CJ8A 2KJWA 2V2QA 4L8RB 2UV8A 2CQ2A 3TI0A 2JDJA 2V5HG 1Y11A 2GEMA 1YI2S 5T41A 2LECA 2YH1A 2PY5A 3LP1A 2PD1A 3R7BB 4ITSA 5LSLA 3OT9A 3CJQA 1X9JA 4K7QA 3MCAB 4P7VA 1SC3B 3N4QA 2W2PP 4MQ3A 3MN5A 3OHBA 1CZBA 4BE2A 1YHQS 5F8HA 4U95A 5FRMA 3P83D 2IM0A 5CD4A 4CO4A 2F4FA 4X65F 5KPTA 4DL5A 1K6YA 4GKKF 4F04B 1HR0K 2B4JA 5FPMA 2NPFA 3RAQA 4V19S 1VQNS 1BDGA 1VC5A 4OZ1A 3EJMA 4FYDA 4B3RK 2CJYB 5LJ5Y 4KHNA 4XH5A 5H9EK 1KD1O 2ZHBA 3VF0B 4IG3B 5M1NA 4IH7A 1O5JA 2W6KA 3MM7A 1H73A 2LXUA 4O44B 4DFMA 2YTCA 3ZSVA 3V4MA 3ENHA 4OPJA 4WBFA 2CQIA 1HI0P 2KB2A 1HIYA 4KI4A 2X3DA 1X4EA 4JKDA 3WX4A 4BRQA 3I8DA 4KB7A 2QLWA 3AVLA 2UUAK 4IOCQ 4DL7A 3GR0A 3VAKA 3SBTA 3MM6B 2G8FA 2BZ2A 3W3SA 1SJ1A 1YG0A 3HP9A 1NDLA 2DR7A 3BEGB 3C15A 1R8CA 3NOCA 3R97A 3MD1A 1S1XA 2NXJA 3M7VA 2DFFA 1BGXT 3O3FA 2GZOA 5HAOA 1AXQA 3MXMA 5HRPA 4KC5A 3EVMA 1FNOA 2Q6CA 2ZZTA 2XI2A 3MDQA 4ILGB 5IT9Y 2HFUA 2HHHF 3VQ5A 2M52A 1V3SA 2JWNA 1Y5LB 5DDOC 3R9LA 1Q82O 5ETMA 5IV3A 4L3QA 2HVZA 5GIOA 4M5DA 4WE1B 3AOBA 4NLXA 1RAOA 4H0XB 3NWGA 2OIHA 1XQIA 4JI1F 5ELZA 1RKJA 3T1HF 3LZJA 5J1NA 3GWCA 4USJC 4Q44A 3SYZA 2QE5A 4KKOB 2FSKA 3ZSWA 2IJNA 1YJWN 4YOTA 1T3OA 5G0RA 2ZJQQ 3VOVA 1OH7A 4RG8A 4EBDA 4OI1A 4WFNL 1Y97A 1KFSA 4Q43A 1EXQA 2FLLA 2E6LA 2D9PA 2A10A 2GCFA 1IJJA 2ZH6A 3M6GA 2DEJA 4P73A 4O55A 4KGKA 3SAHA 4ZMMA 1HHQA 4WFAL 2H65B 1CJTB 3BO2A 4I69A 2VDHA 3CVKA 2ZGYA 4HHJA 4CE9A 4USMA 4ILJA 3QGHA 4KH0B 1K73O 3VETA 2BRKA 3AVCA 2QI2A 4ZPWR 5KOXA 1T95A 4BRAA 2JVOA 2FVCA 3H46O 5A8KB 2UP1A 1RBUA 5AQRA 1SIZA 3NAHA 1Q7YT 3NKYA 4BRMA 1FJGF 3IMXA 4NZ0A 1VRUA 3Q86A 3AARA 3IG1B 3CJ0A 3FBEA 4CK3A 3CC7N 3MOZA 2QYGA 1BLUA 1P9YA 3S6EA 1S9EA 1VBYA 1NPPA 4P72A 4RR5A 5HRRA 4ELTA 3IRXB 1KKHA 5F2RA 1ASUA 2ZHOA 4TU9A 3C3LA 1N5SA 1CS4B 3CSKA 2KT2A 2UXDF 3DLEA 2IYGA 3CJKB 4TY9A 4RW7A 4YDXA 2B4PA 1HBOA 5KQDA 1V5IB 4KY3A 3KUEA 5AQVA 3BP8A 2E5IA 2OYQA 2YWEA 4CQ1A 5GAEI 3CO9A 3G9CA 1K1SA 1GLJO 1LWEB 2R2RA 1RBVA 2JJ4D 4NLTA 1ICEB 1X60A 2HYIB 1SV5A 4FNIA 1RB0A 3SBMA 1QE1B 1LW2B 3TJ8A 3IC1A 2PAVA 2YV0X 4K42A 2F8MA 2W9CA 4AL7A 5GAHP 4IH5A 4DUZK 4LFAJ 2QSWA 4CEDA 1WELA 4DR3K 4FLWA 2HVEA 3BGUA 3KJVA 1QVGM 1YJTA 1HYSA 4FLUA 2PA3A 3CCSS 1RT2B 3Q8UA 3ZEUB 2DPNA 2ZH1A 2Y9HA 2CG4A 2HNYA 2HZAA 4DG1A 1KQSR 1BI4B 3A3OB 4CEZA 4DCOB 4G1PA 2P1JA 4JP8A 5FDLB 3NMRA 2HBRB 2H4WB 3O1WA 5K8OA 4QYZK 3KZBA 5GADP 4TY8B 3G6ES 1RNHA 4CNZA 2DNKA 3HHLD 1FXDA 3CXCM 2AGOA 2AJ1A 3EM1A 3ISNC 3T1YK 1MMDA 3G4SS 2VQEF 1S1XB 1WEYA 3O80A