4IG3A

Hiv-1 reverse transcriptase with bound fragment near knuckles site
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Reverse transcriptase/ribonuclease H
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
total genus 167
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ig3A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig3A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig3A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig3A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ig3A05
3OJSA 2KZMA 2FVRA 1EP4A 3V6KA 3THVA 3QEVA 1JL2A 2RDIA 5HP1A 1LW2A 4QWBA 3BQ2A 3B6OA 4FLWA 4O3NA 2G8WA 2OPQB 3KOAA 5CZ2A 4EBDA 1S0MA 1Z25A 4ZP7A 4O3PA 4R8UA 1KRPA 3B6PA 3A2FA 4N5SA 4IOBA 2F8EX 4QWDA 3HVRA 4AH9A 4ZMMA 2W7OA 3KHHA 4Z4FA 1EETB 2ILZA 3TAFA 1C0UA 4YR0A 3SZ2A 2C28A 4RG8A 1S6PB 3NF7A 3M8PB 5KFFA 1JLBB 3F9KA 2AWZA 1TL1B 4AHSA 3VA0A 4F4ZA 5FRNA 1IM4A 4DL6A 2AGQA 4KHYA 3T3FA 3RWUA 4FJIA 3QNOA 1HMVA 1BHLA 4JS5A 4FBTA 4H8KA 5KT3A 1VSJA 4O5BA 2V4QA 1S1UB 3I0SA 4FJJA 4DTRA 4MH8A 4M42A 4IH6A 5F8JA 2BQRA 2O4IA 4FM0A 4J9KA 4PWDA 4CHOA 3V81B 1ITGA 4O3QA 1D5AA 4MFBA 4CJVA 1IKXA 4E1MA 4DSIA 3P1GA 2XHBA 5I42A 1VSKA 5KFLA 4FM1A 1IKYA 2VG5A 4QAGA 4KAZA 2C2DA 3TR8A 4L8RB 3QO9B 1HYZA 3NE6A 3GIKA 3CJ4A 3NGDA 3QIDA 2W9CA 3SQ4A 5DG8A 3QEIA 1LWFB 1NKEA 4FM2A 4JV1A 3HKWA 4J9NA 4E7HA 2AU0A 1C1BB 4Q45A 4G3IA 3OL9A 1RT3A 3HP6A 5KG4A 1TKTB 3GIMA 1T8EA 2RKIA 3V1RA 1RT1B 3HHKA 4EP5A 2FBVA 4X2BA 4WE1B 1VSFA 1Y97A 3ITHA 4CJTA 5L1JA 5DK5A 4URQU 1HYVA 3HO1A 3V1QA 1NJYA 3DOKB 2YV0X 1G15A 3KK3A 3AVJA 1FKOA 1SKRA 2HHWA 3ZT2A 4DLGA 3GV5B 1FK9B 3TI0A 4BDZA 4FLYA 1RTIB 4N47A 4QPXA 3DLRA 2B6AA 4KHUA 4M3YA 5C5JA 3MR5A 1JKHA 3AV9A 4ZPBA 2R8KA 4GVMA 1VRTA 4ZVHA 1BQNB 2D7SA 4OPJA 4FK0A 3H98A 3GIIA 3HVTA 1SH3A 3MEEA 4DQPA 3DRSA 1L3UA 3AO4A 2XGPA 2P1JA 1RBUA 1T94A 3KLFA 1WSHA 2B5JA 4B9MA 3CDWA 1L3TA 3SFUA 5EWEA 5HRPA 4CHYA 4J9RA 4OLAA 3RBEA 4QW8A 3TARA 1BIZA 2ALZA 3SJJA 1LWEA 3DLGB 4DWIA 4NLVA 4HKQA 4DU1A 3O3HA 2Z1JA 4KHWA 4OGCA 5FDLA 4IG0A 4FZXC 1RT4A 3SUOA 2IOCA 1JLFA 3C94A 1S1XA 1TGOA 3TAQA 2R8JA 1REVA 1TV6B 4JRQA 2J6SA 3VQCA 4WFYA 3SQ0A 3V1OA 1TK0A 2UVWA 4IDKB 3L2VA 2F96A 2ITGA 4J2BA 3V9XA 4RW9A 5J2NB 4OL8A 3I8DA 3NDKA 4K4VA 4ED1A 4I2PA 2G8FA 4FS1A 3PW2A 1GX6A 1GX5A 4Y3CA 3V9SA 3C6TB 4CJ4A 2R7YA 4NLWA 1S4FA 4PQUA 3LZIA 3PX4A 1HQEB 3SV4A 2HMIA 4CJSA 2VWJA 4I7FA 3NGZA 3MECB 4Q8FA 5HBMB 3EPIA 1X9SA 3VQPA 4ICLB 1C1CA 3IGNA 4DTOA 4R5PB 3DMJB 1NKBA 4NLXA 4KV8A 1T05B 2JEJA 1EP4B 3UDLA 1CXQA 3LAKA 3KIOA 3MFHA 3AVLA 5HP1B 3BSOA 1LW2B 4FJHA 1VRUA 4F2SA 3GV8B 5DGAA 2J6UA 2GV9A 4KHNA 4DL4A 2X74A 4FJ7A 5KFIA 3CJ3A 4CK2A 2JEIA 4IRCA 3CFPA 1HNVB 3VQQA 3HJFA 1NK8A 2P5GA 1RNHA 1RDDA 2PYJA 1KVCA 3PW4A 4RNOA 4CJFA 2OZSA 4LY7A 4TY8B 4KB0A 4FXDA 4C8NA 1C0UB 1JLQA 1XR7A 2XY7A 1EETA 1JIHA 2JLEA 4ZVFA 3M8RA 4J2EA 3BQ1A 4NCGA 1KCFA 4OKKA 3KTQA 4CEQA 2QKBA 3E51A 3LP1A 3RMBA 4IQXA 2BE2A 1I39A 4ECVA 5KFDA 2XO7A 4JRPA 1WAJA 1A5XA 1HMVB 4ECYA 4O0IA 4KI4A 3H5YA 1SUQA 2XI2A 3I0SB 4WZQA 1U45A 2IC3A 1WNEA 1S1UA 5KG7A 4HCBA 2XY6A 4PWDB 3LP3A 4NLYA 1EKEA 3Q8SB 4TQRA 3V81A 1BISA 3IRXA 4Q44A 2R2TA 3S3OA 2OYQA 4FK4A 3AA3A 3MEGA 3QLHA 4CF0A 4LH5A 1KTQA 1IKYB 2VG5B 2QV6A 1JLCB 3QIPA 3CO9A 4ZPAA 1TK8A 5KFMA 3VA3A 3BGRA 4MK7A 1SH0A 1NK4A 4NRTA 4B08A 4FYDA 3QO9A 2W9CB 3H5UA 2FVCA 3WNGA 1HYSB 3KLVA 3V4IA 2QK9A 1RT3B 4ID5B 4CGHA 5KFPA 5KI6A 3AA4A 3HPHA 3EZUA 2XGQA 2E9RX 3NAIA 4FJNA 3NF6A 2D41A 2RKIB 4ECUA 3DM2A 4F50A 3RR7A 1SV5B 3U3GA 3AVAA 2AJQA 1EXQA 3KNAA 5DLFA 3KK3B 4WFZA 1FKOB 4DTNA 1J53A 4RUAA 1QSYA 4QWEA 3PZPA 4TYAA 3SYZA 4KRFA 3RTVA 3GILA 5KFGA 1JKHB 4NLRA 5F8HA 2HHTA 3KLGB 4HUEA 2HNZA 3SV3A 3LPTA 1X1PA 2VG7A 3KMSA 5KFTA 4C8OA 3OL8A 5KG1A 4YR3A 1U47A 3OHBA 1NJZA 3MEEB 3DRSB 2ETJA 3DLKA 4B9VA 1DLOA 2HHXA 3NL0A 3SFGA 2XY5A 1LWCA 2B5JB 2IMWP 1U49A 1GOCA 1DTQA 2WCXA 1RTHA 2IM0A 1RT2A 1TQLA 3VQ7A 4FLVA 1LWEB 1K1QA 1RCHA 1BCOA 4Z4HA 4DSFA 3K59A 3NH0A 1BCMA 4IFVA 4YFUA 4IFYA 1REVB 1YVUA 5F8MA 4FK2A 1W0HA 1JLEA 1TV6A 1BGXT 4TLRA 1J54A 3I5AA 1U04A 4NLOA 3D0PA 3WNHA 3KKSA 4ZPCA 4RW9B 2IM3A 1D0EA 3KD5E 2W8LA 2J6TA 4BACA 3V9ZA 3HL8A 5J2NA 4I2PB 4CHPA 5F8IA 1S1TA 4PQUB 3KLHA 4ECRA 2HMIB 3BSNA 2OPPA 4IBNA 4F2RA 3PJXA 4I7FB 3NGIA 1CLQA 1SKSA 3NAEA 2IJFA 4HHTA 5DG9A 3MECA 3BREA 3LPUA 3ZSVA 1C1CB 5KFZA 4CGDA 1JL1A 2BDPA 4ICLA 4J2AA 1FXXA 4KV8B 3KHRA 3P83D 3SNNA 3AO1A 3DMJA 3OLAA 4UQGA 3DDKA 1W9HA 4DU3A 2XC9A 2E6MA 5KRSA 4NRUA 2O5DA 1NOZA 2YHAA 4EO6A 2KW4A 5T7BA 4J9SA 3EZ5A 1VRUB 4KO0A 2HVHA 4B9UA 4KPYA 3CJ2A 2D3ZA 4U7CA 3OYDA 4DTXA 4LH4A 4B3OB 1BQMA 1I6JA 5EWGA 3AO5A 2HNYA 4J9MA 1C0MA 2G8VA 5C25A 1HNVA 2VG6A 4KFBA 2UVVA 4BE0A 3I5CA 4R0EA 3TWHA 2C2EA 1RBVA 1JLQB 4TY8A 1RDAA 4CJPA 4NCGB 2LSNA 5L9XA 5J2PA 2ZQBA 3M8SA 3H40A 3LP1B 3U6FA 4OPKA 3PR5B 2BE2B 2EC0A 2BQ3A 4ECZA 1RT7A 1NNDA 4MK8A 3GYNA 4KB1A 1TVRA 3MXMA 4F4XA 4GMJB 3QGIA 1SUQB 1T7PA 1NK6A 2IC3B 3PW0A 2FLPA 3RRGA 3V9UA 1BL3A 3KK2B 3M9NB 4CECA 1RAJA 1X9WA 4QW9A 2FBTA 4J9PA 3OYFA 4H4MA 2YHBA 4EZ9A 3IRXB 4RZRA 3TANA 1JLGA 5KFEA 3MEGB 5DMRA 3QLHB 3ZSQA 4LQ9A 3OJUA 3PX6A 3UR0A 3DYAA 4OLBA 4LSNB 3QIPB 2JEGA 1RDBA 3L3UA 4ZTFA 3BGRB 2YKNA 4DQSA 1Q9XA 1JLCA 5DQGA 2X78A 3EPGA 1CXUA 3V4IB 5KFWA 1HYSA 4M95A 1NJXA 4CJKA 3MR2A 4ID5A 2G8HA 4ED7A 4ZVEA 3AVIA 5D3GA 3OYBA 3QGGA 3ASMA 2E9TA 1NK7A 3QZ7A 3JYTB 3QEXA 3DM2B 3HPOA 4H54A 4B9LA 4JV2A 3DLEB 4J2DA 4H4OA 1SV5A 3TAMB 3QERA 3LZJA 4WXWA 2QE5A 1VSLA 4QWAA 2B43A 3FQKA 4LQ3A 1TAUA 4FBUA 3NCIA 1QS4A 4RW4A 2HNZB 3RMCA 4K4YA 2KFNA 3LANA 4WZMA 4FJ8A 5KFNA 2W42A 3GQCA 3AVHA 3KLGA 2VG7B 3WNFA 2O4GA 2FC0A 2A1SA 4CF1A 1N6QA 4RNFA 3DLKB 1DLOB 4DL2A 2IAJA 3I0RA 1LWCB 5KG6A 3QIOA 1TKDA 4F3TA 4IG3A 4HCCA 4KSEB 3M9OB 1FKPA 4ELUA 2ASLA 3RRHA 4CHQA 4CHZA 5KFRA 1DTQB 5KFYA 3SUQA 1RTHB 1QE1A 5L1KA 1RT2B 4W5RA 2ZD1A 5SWMA 4KI6A 4CIEA 3OYHA 2AX0A 2W9AA 4IFVB 2VA2A 4IFYB 2FJXA 3LALA 1KLNA 4FJMA 5KT4A 2R8HA 1RA7A 4CJUA 1JLEB 2JC1A 4DS5A 5EDWA 3OSPA 3BSAA 4W5OA 1KHWA 5KG2A 3LDSA 2GIQA 5CYQA 5J1EA 2D0BA 3L2QA 3KLEA 3CDUA 3RBDA 4BWMA 4M45A 1S1TB 3MAQA 4RUCA 3SI8A 1QTMA 2CJQA 2W7PA 3KLHB 3V6DA 4Y34A 4CJ5A 3AVNA 1YTAA 5L1LA 3DLHA 2OPPB 3BR9A 4NCAA 3OYMA 1D9DA 2OZMA 1RT5A 4KTZA 4MIBA 4TYBA 5F8GA 3CYMA 5HRRA 2E9ZA 4FW2A 1JXBA 3VQ8A 1JXEA 1HARA 3QETA 1OS5A 1UA1A 3G6VA 4FLTA 4K50A 1S5JA 4DLEA 3HM9A 1BI4B 1IO2A 4TY9A 3MXIA 3T5JA 3ICLA 4M41A 3G86A 5KG3A 1S9GA 2YNGB 1N56A 4IH7A 4DL3A 4ECTA 3P5JA 2GIRA 3AVFA 1XHXA 4XIUA 4CCHA 4KO0B 1D1UA 3K5NA 3PVXA 1RDCA 1R0AA 5I3UA 4RW6B 1D8YA 2BRLA 5HLFA 1HJRA 3K5OA 3RR8A 1IKVA 2V0NA 3JSMA 4O3OA 1BQMB 4WYWA 1JX4A 4DTPA 2HNYB 3AA2A 4CK3A 3M8QA 2JC0A 4B3OA 5C25B 3K5LA 2KTQA 2VG6B 4KFBB 2IS3A 3SUPA 1QSLA 4J9LA 4K8XA 4DFMA 5DGBA 1ZBUA 4CFDA 2BQUA 5T14A 3ZT4A 5C42A 4ECXA 3LP2B 4NLSA 4YP3A 4BDYA 4FVMA 4JS4A 5J2PB 3MXJA 2FJVA 1SL1A 5KT6A 4ID1A 4DF8A 5JS2A 3O4QA 2E4LA 1RT7B 3SPYA 1WSEA 1XR5A 3D28A 3OLBA 3ZSRA 1TVRB 3Q8RB 4O44A 4J9QA 1RDRA 5FRMA 3AVCA 4EBEA 3ALYA 3ZSOA 5KRTA 1Q9YA 4Z0UA 3C6UA 4IR9A 1NHVA 4Q43A 4E89A 5KT2A 3ZT1A 3KHGA 4FJXA 4DEZA 1NK0A 3KK2A 2QXFA 4H4MB 1JLGB 3UQSA 3NF8A 2VA3A 3OY9A 4AHTA 1NHUA 2HAIA 4DU4A 3DYAB 3BSCA 4O3RA 3TQ1A 1U4BA 3U3YA 2YKNB 4LSNA 1NOYA 4CEDA 2GBZA 1UA0A 2D0AA 2CKWA 4O4GB 3CFOA 4F4YA 4KKOB 2BANA 3K5MA 5KFOA 4CERA 1JLAA 3AVKA 1J5OB 4CEEA 1XC9A 3HK2A 3MTKA 1S49A 5D3GB 3IAYA 2AX1A 4CFAA 5KGWA 4IRDA 3NFAA 4ZTJA 3JYTA 3UIQA 1U48A 1C6VA 2IJNA 4DS4A 3KJVB 5HROA 2XWYA 1HPZB 4AHRA 4H4OB 3MR3A 4IR1A 4KE5A 2HHVA 4M3TA 4ED6A 3DLEA 1LW0A 3TAMA 2XRIA 3K57A 1NK5A 2V9WA 4IRKA 4DFJA 2WK4A 3OYKA 4CF2A 2WONB 3PUFA 1HNIA 2ATLA 4CESA 2FLLA 3VQ4A 4RW4B 1QAIA 3DOLA 4IH5A 1CZ9A 3DRPA 4DTUA 3L2UA 2PYLA 4FJKA 2X6SA 4ZVGA 3FFIA 3DRRB 1N6QB 1XI1A 3LP0A 1HRHA 3PW5A 1B9DA 4HUFA 2IAJB 4MKBA 4ECQA 1T3NA 3I0RB 1S1WA 4K4SA 5KFBA 3OYJA 5K14A 4IG3B 4TXSA 1VSHA 4TN2A 4OJRA 1FKPB 4K4WA 3HYFA 4ECSA 3OYIA 4F4KA 2G8UA 1QE1B 4NCBA 3RAXA 3TABA 2ZD1B 2I5JA 5C24A 3OS2A 3FQLA 4Y2CA 4C8KA 2WTFA 4KB7A 4ZHRA 4CJRA 3OS1A 4E7KA 4DG1A 1ASWA 4Y1DA 3MEDB 3OYNA 2EHGA 1CZBA 2UUWA 2KFZA 2HNDA 1ZYQA 3FRZA 4HYKA 3ZSYA 4CFBA 3HPGA 4KHRA 4AHVA 4IKFA 5CYQB 5J1EB 1RYSA 3HT3A 1ZBFA 4K4ZA 4F3OA 4EP4A 1RA6A 1RBRA 4O55A 4KHQA 1VSDA 4MIAA 3KLEB 4Z4CA 3CM5A 1S97A 1YVFA 5L1IA 3V6DB 1T03A 1XHZA 4JLHA 5KFUA 4DL5A 3L2RA 4ELVA 1RT5B 3CWJA 3I5BA 2XY8A 4TSXA 4FS2A 1N5YA 3KKRA 1LAVA 3K58A 4DL7A 3ISND 1LV5A 2DPIA 2FVQA 2ZE2A 4BE2A 3PJWA 4XPEA 1RTDB 3NKYA 3G6YA 1VSIA 1RTJA 1BI4A 4CGFA 2YNFA 4XO0A 1S9GB 3BDPA 5JXSA 3CJ5A 3OVNA 4CEFA 2YNGA 4B9TA 3FSIA 4Q0BA 4WXOA 4B9NA 1TL3A 4RW7A 5I3UB 1R0AB 4CGIA 3NF9A 4ZPDA 1S1VB 5HLFB 1L3SA 2WHOA 1IKVB 4RW6A 3KD1E 3JSMB 4C8MA 3GV7B 2OPRB 1RBSA 4CEZA 3V6JA 2R8GA 2DTUA 3M8QB 5F9NA 3QEPA 4RNHA 3UPFA 5DQHA 4BDPA 1BIUA 1KVAA 5C42B 2HHSA 3Q8QB 3LP2A 5FROA 1YT3A 5KFXA 1XWLA 3RMAA 1IG9A 5F8NA 2F8TA 1DTTA 1TKXA 3H5SA 5KG5A 4YQWA 3QZ8A 4B8AB 3OL7A 4E19A 2PZSA 4O44B 2W8KA 4DTMA 2BRKA 3ZSWA 3QYYA 2UVUA 1C0TA 1L3VA 2R2UA 4DQQA 3IG1A 4NLGA 2WRMA 4IKAA 3C6UB 4EYHB 4AILC 3RB4A 3V6HA 4W5NA 2C22A 4KHSA 4ELTA 4CHNA 3CIZA 3C95A 2YNIA 3S3MA 3AVBA 2OPSA 3G10A 4DSJA 3H4BA 1RYRA 1IH7A 5EU7A 3FDSA 3QESA 4PUOB 4I2QA 4NLPA 1ZBLA 2FBXA 3KLIA 2W9BA 2WB4A 2WOMB 4M3ZA 4FJLA 3BQ0A 4KHMA 2FVSA 1J9AA 3GIJA 2ASJA 4EBCA 2BANB 2EX3A 2YKMA 4O4RA 3SPZA 4BWJA 1JLAB 4DQIA 4O4GA 2P51A 4KKOA 1I3AA 2FBYA 1C2PA 4CF8A 4AHUA 3N6LA 5DG7A 5KFVA 1J5OA 3OYGA 3TVKA 1W25A 2ZKUA 2JEFA 4M3UA 5KFAA 3PR4A 3PHEA 1S0OA 5HROB 1Q8IA 4NLDA 2AQ4A 3T5LA 2IA6A 4FZYA 3KJVA 1HPZA 1LW0B 3CG7A 4E1NA 1S9EB 3G0ZA 4FCYA 4HVJA 1WSJA 1HNIB 2WONA 3DOLB 1WSFA 4NYFA 3ULDA 4CJEA 3DRPB 3DLBA 2UVRA 5CYMB 4Z4GA 1SL2A 3FFIB 1F21A 3AO3A 2RN2A 3NHGA 3HP9A 3OYLA 1S48A 3LP0B 4W5TA 3DRRA 3PO4A 1RT6B 2XI3A 4URSA 5KT7A 4NYNA 1S1WB 5J2QB 4CGJA 2NUBA 2C2RA 1QSSA 5K14B 1GOBA 4MKAA 4JUZA 1SKWA 3RMDA 1LAWA 3NAHA 4U6PA 3NH1A 3SCXA 4NZ0A 2IM2A 2Q3SA 4I9LA 4CF9A 4B9SA 4Q5VA 1NK9A 1WLJA 2I5JB 5C24B 2VWKA 1EX4A 5KFHA 2XCPA 3HSTB 4I9QA 4ZHRB 1XR6A 3N6NA 3H4DA 3KMQA 4QWCA 3MF5A 3PW7A 3IS9B 3OSNA 4WFXA 4DG1B 3G6XA 1B92A 2XCAA 2RF2B 5J2MA 1HQUA 4E7LA 2F8SA 3T19A 1IKWB 1RBTA 3MEDA 2HNDB 4LD0A 2FVPA 4NLUA 1QAJA 1MU2A 3HVAA 3NMAA 1WNSA 4Z4IA 4Y1CA 4G1QB 4RW8A 4B8CA 1S0NA 5JS1A 2FJWA 4GC6A 1ZBIA 1KLMB 3CDEA 1K6YA 4MQ3A 1T03B 2BR0A 3LWMA 5EWFA 1TKZA 3SI6A 3ZT0A 1Z4UA 3KK1B 4FJ9A 3CM6A 5CZ1A 2YNHA 3QEWA 3PX0A 1VSEA 2GUIA 4DMNA 4YMEA 1N4LA 3CJ0A 5DQIA 3LWLA 1N5YB 3S9HA 3NH2A 2HW3A 4Q8EA 2I1RA 4NLQA 3Q8PB 3PY8A 3E01A 4O3SA 3NBPB 1U09A 2ZE2B 1S10A 3SQ2A 1MMLA 1S6QB 4M3XA 5E41A 2HHQA 4AHCA 3ZT3A 1RTJB 1ASVA 1RTDA 2Y1IA 1VSMA 3VQEA 4DSKA 2YNFB 1K1SA 1UWBA 1QUVA 1WSIA 3BJYA 4KAIA 1S9FA 1Z26A 1KSPA 2HVIA 4LSLA 4OKEA 4Q0BB 2RPIA 4FW1A 1TL3B 4JV0A 4RW7B 4M3WA 3OS0A 4YR2A 2DY4A 4QCLA 2HB5A 3DI6A 1QQCA 3S3NA 5EUHA 2D5RA 1RILA 1S1VA 3L3VA 3EYZA 3F73A 3IN5A 4YNQA 2OPRA 5F9LA 4K4UA 3VQ9A 4C8LA 2R2RA 3H2LA 3KHLA 3D45A 4PY5A 5SZTA 3WNEA 2HWHA 1QHTA 2DFEA 2G8IA 1B9FA 5HRSA 3L2WA 1C1AA 2OPQA 1JXLA 2HWIA 1DTTB 4R8UB 1TKXB 3QGHA 3LAMA 3O3FA 3AA5X 4CK1A 3CVKA 4K4XA 1C0TB 1ZBHA 3VQ6A 4XPCA 3IG1B 2E6LA 2P5OA 4K8ZA 4CJWA 3V9WA 4RNMA 4OKJA 2GC8A 4F8RA 4FLXA 1S6PA 4E0DA 1A5VA 3M8PA 3MR6A 1JLBA 3O3GA 5CY4A 1TL1A 2D0CA 3EY1A 4ZP9A 4CEAA 4E7IA 4CFCA 1NJWA 4RNNA 2YNIB 2OPSB 3PV8A 1WSGA 2IGIA 3RB3A 4N56A 5KG0A 4I2QB 3H5XA 4DTJA 4W5QA 4Y2AA 3HXMA 3RAQA 4PUOA 1UAXA 3KLIB 2W9BB 1GOAA 3VQ5A 3HVWA 2V4RA 1D9FA 2Z1HA 4BE1A 2WOMA 3SUNA 4OVLA 3ISNC 4FJGA 2YKMB 5DLGA 4MFBB 5KFSA 1IKXB 5JUMA 2Z1IA 5KFQA 5I42B 2AGOA 3OYEA 2OH2A 2D3UA 4CJLA 1KFDA 2RDJA 3PO5A 1ZETA 1TAQA 4J9OA 3OYCA 3OHAA 4DTSA 2Z1GA 3D5MA 4KTQA 3H59A 3VQBA 2DPJA 4CGGA 4CIGA 4CEBA 1KFSA 1WN7A 1LWFA 3TAEA 2DFFA 2R2SA 3RB6A 2IDOA 3AVGA 1C1BA 3O4NA 1S9EA 1ZTWA 1X9MA 4ED0A 1TKTA 3OYAA 2DFHA 2KZZA 3QINA 3ITHB 1RT1A 2QKKA 4WE1A 4DSEA 5CYMA 4HTUA 4DQRA 4FZZA 3ZSXA 1TP7A 3DOKA 3AO2A 2BGGA 5F8LA 3T5HA 1RT6A 2PY5A 2B6AB 3TAGA 5J2QA 1FK9A 1RTIA 2OA8A 1KVBA 4DSLA 5KFJA 2ASDA 1L5UA 1N48A 1VRTB 3VQAA 1SH2A 1CSJA 3ZSZA 4GC7A 4EYIB 1BQNA 4OGEA 3HVTB 4FLZA 5HRNA 3CFRA 4CJ3A 3MFIA 4FLUA 4M94A 3IS9A 1YTUA 5J2MB 1HQUB 3KLFB 4N76A 4DFKA 4Z4EA 4M3RA 2RF2A 4DF4A 2ILYA 4K4TA 3K2PA 1IKWA 1MU2B 3VQSA 5KFKA 1TK5A 2Y1JA 3RB0A 4RW8B 2FLNA 3QNNA 4ED2A 4E3SA 4G1QA 4GW6A 3AVMA 3IGVA 3DLGA 5FDLB 4IG0B 1RT4B 1KLMA 4F4WA 1JLFB 4TQSA 1TKZB 1S1XB 2R8IA 3NGYA 2B4JA 3T1AA 2YNHB 1VK0A 3VN5A 4ZP6A 4FJ5A 2HHUA 3N6MA 4EO8A 2X6NA 4QOZB 4KBIA 3KK1A 4ECWA 4URGA 2AGPA 2G8KA 4IDKA 3SQ1A 5KGXA 5KT5A 4ED3A 4HUGA 3E01B 4PA1A 3M9MB 4EEYA 3ZCMA 4CEOA 2ATQA 3CQ8A 3VQDA 3NBPA 4RU9A 1S6QA 1ZTTA 5KTQA 4KTWA 3C6TA 3L8BA 4DFPA 2KQ2A 4NLTA 4E7JA 1SL0A 1UWBB 1HQEA 1NKCA 4ED8A 4LSLB 4EZ6A 4ZP8A 1KHVA 1O1WA 4CE9A 3DI6B 3H08A 5HBMA 4KREA 2IBKA 2JGUA 2UUTA 5KFCA 4CJQA 4O0JA 2A1RA 3TAPA 4WYLA 1A5WA 3T5KA 4MK9A 4N41A 4R5PA 4NYZA 1WAFA 4CIFA 2IM1A 3OL6A 1T05A 1ASUA 1UOCA
chains in the Genus database with same CATH superfamily
2GFFA 1X3MA 2FVRA 1EP4A 3W5XA 3IM8A 3R8YA 4ZVUB 4U8VA 1JL2A 5AQXA 3NCQA 4DUYF 4FLWA 2B8PA 2NXEA 3DU5A 1SIZA 1XJWB 1LWXA 1S0MA 2E7VA 4UOFA 2QC3A 2DHGA 1KRPA 4CT9A 4DR7J 1AFJA 4ZMMA 3UKRA 3QAUA 3SCIE 3SCJE 4CLFA 1DQ8A 2R7OA 3TAFA 1C0UA 4YR0A 5B0BA 1C4CA 1S6PB 1YRTA 1VQ8S 3F9KA 2AWZA 3CCQS 3CJCA 4AHSA 3P5TL 2CZ4A 1H1VA 1OVQA 3SDEB 3VA0A 5FRNA 2Q97A 1IM4A 4KHYA 3TNVA 5AJ3K 4USVA 3T3FA 3RWUA 3QNOA 1U1OA 2K1RB 5B0AA 4HL9A 1VSJA 2VB6A 4O5BA 1KONA 1S1UB 4DTRA 3LDLA 2VPYB 3W0LA 2BQRA 2O4IA 1E6YA 5AXKA 4PWDA 3V81B 3BGFA 4DCHA 3GE9A 1IJEB 2JVOA 2IVYA 5ETKA 4CJVA 5HQMA 4E1MA 2E1MC 4TLQA 4P6QA 4A47A 3U9ZA 1P27B 3T9ZA 2GIFA 1VQPN 3GIKA 4ZLLA 3HFKA 4QR0A 3QIDA 3R8EA 3GL1A 2OD6A 3TU5A 4DPTA 3J7YU 3HKWA 2V4JB 4JI6J 2HBRB 2KHOA 1C1BB 4Q45A 5FPEA 1JB0C 1RQ0A 3H2UB 5EN1A 3HP6A 5KG4A 1QVGM 2XYHB 3H1QA 3HHKA 1C4AA 2XG8A 2FBVA 3ZZOA 4MTPA 1VSFA 4JI7F 2RS8A 1NJYA 3F2KA 4IQMA 4PXEA 4AM6A 5F41A 2A18A 2LYVA 2VHGA 2HHWA 3ZT2A 1T9XA 2LDIA 3GV5B 3TI0A 1FK9B 4J90A 3DHXA 1XMQF 2MXYA 4JI2K 5FPDA 5GAHP 4C23A 2R8KA 3DOMB 4GVMA 4ZVHA 3AGRA 4OPJA 2GVDB 4P72A 2QN6B 1YJ7A 1VS3A 1VQ8N 4JV5J 3CCQN 1F6TA 4ANEA 1L3UA 4Q2LA 3KLFA 5D8HB 2B5JA 3SFUA 1BDGA 4P7TA 5T7LA 2ZC4A 1WEXA 2BMBA 2K3KA 2IVOA 5HRPA 4JD2A 3CQXA 4J9RA 4F67A 3DFEA 4NXMK 3H20A 3TARA 3R1XA 4WBFA 2AF6A 1LWEA 5M2RA 3SJJA 2KG1A 4KHWA 5FDLA 1B64A 1QJHA 2IOCA 3O9RA 1S1XA 3D7SB 1REVA 4JRQA 2J6SA 3VQCA 3V1OA 2IDLA 2BM0A 2ITGA 5D15A 2ZJPQ 1P90A 4ZPVR 4WF9Q 1PJ7A 4J2BA 4RW9A 3KDOA 3VGSA 1GXUA 4FS1A 1LFPA 3PW2A 1E6VB 1PSDA 2ZBCA 3C6TB 3V9SA 4WU3A 3LDPA 2HG4A 5U47A 3J80U 4AM7A 3LZIA 3SV4A 1M5HA 1WORA 3NGZA 3SIPB 4M63A 4CIOA 2HOEA 1T6DA 2P9IB 4ZDNA 3IGNA 2O8FA 4DTOA 2NR0A 4R5PB 1VHIA 2BJ8A 1H6KX 5KAKA 1HR0K 1TMJA 3Q83A 2JEJA 1WG5A 2QFIA 1VBXA 1CJTB 2P8IA 1LW2B 4IO8A 3CJBA 2CPJA 3T1YJ 2QWOA 4WU2A 5DGAA 5A8WB 1NH7A 1WDTA 2GV9A 2HRYA 1QTNB 2DNQA 5KFIA 3CJ3A 4CK2A 3CFPA 3HJFA 2P5GA 1KVCA 4RNOA 1EKSA 1N36F 1B3TA 2HEKA 4FXDA 4IJNA 3OTCA 2XY7A 1HNXK 1ZAXA 1WTBA 1EETA 2JLEA 4ZVFA 3M8RA 4NLCA 3BQ1A 2AA4A 4NCGA 3P96A 4CEQA 4WK3A 1ROFA 3BKFA 3CJ8A 4IQXA 4CYUA 4X62F 4BC5A 3KJQB 4LRAA 1YI2S 4ECYA 1FRLA 1GLEG 3BZKA 3E2EA 1SUQA 4OX8A 1URRA 4FPRA 3J7A1 2VQEJ 1WC3A 1WTFA 1MWQA 4JNEA 3Q86A 2PBDA 1EKEA 2VFVA 4A2AA 2QMUB 4FK4A 2UU9F 2W4DA 3QLHA 2AT1B 1UVKA 1KTQA 5BYRA 1OKJA 1IKYB 4FVCA 3QIPA 4KY3A 4JI3K 3JXOA 3HDSA 4ZPAA 1F3FA 2X1GA 3VA3A 3T69A 4MK7A 3OT9A 2GWJA 1SH0A 4NA1A 4NRTA 1EAYC 1ZPVA 4FYDA 4XAKA 3PIPL 4D3HA 3OXFA 1EIYB 1X5PA 1TL4A 4CGHA 3N01A 3NVKA 5KI6A 1M1KT 1UKUA 2D41A 4TVAB 2OO4A 3A5NC 1RUSA 1H74A 3SMZA 3DM2A 1XEZA 3TSUA 4DV7F 3NGKA 1V3SA 3DRYA 4DX5A 2CQ0A 2ZOGA 4LBPA 4DV5F 1Y00A 4YOVA 3O1LA 1AB8A 2P9KA 2Y0SD 5E33A 3THPA 4QWEA 3PZPA 3BO4A 1GLDG 4OZ0A 5A0YB 2XS7A 3GILA 3KZBA 4YOXA 3KLGB 3SV3A 5E3QA 4ZCMA 3LPTA 2ZDPA 4C8OA 3OL8A 2AHOB 2J9DA 3I31A 3MD3A 2HZVA 3MEEB 1T9WA 2ETJA 3M32B 2DNRA 2F4FA 4LF8F 3LW5C 1YI2N 5IWAK 2VFRA 2L41A 2IMWP 3QICA 5ETLA 2E5JA 1IR2A 1RTHA 1JK9B 3CPWR 2IM0A 1V5VA 1TQLA 2CNKB 4FLVA 1DAXA 4IUFA 2PN6A 5A8RA 1X5TA 1N5SA 1F2GA 2VOOA 1GMWA 4JYAF 4ZVRB 1DGKN 4YFUA 2E7XA 5HAOA 4FK2A 3ENAA 1FX4A 4FWNA 2H4WB 2LCWA 2W2QP 4K2JA 4NLOA 3KKSA 3R6MA 4W98A 1N0VC 3KDNA 5J2NA 4I2PB 2GMLA 4WFNL 4EAHD 5F8IA 2POKA 4PQUB 3MPUB 4DN9A 2HMIB 4BR4A 3ZTQA 3IP0A 2KHCA 4F2RA 3QMQA 4I7FB 3SK3A 2B9YA 4C6AA 1VIOA 2ADBA 4YDXA 2E1YA 3BREA 3Q0AA 2NXCA 2WUSA 1JL1A 5C2FA 2BDPA 4ICLA 3CJ9A 2UXDJ 2I6WA 4I69A 2Y1RI 1RADB 2C2NA 3DMJA 3CD0A 3ID8A 4UQGA 4F0MA 5AZJA 4OPHA 1MWYA 3O5TB 1T95A 2YHWA 4J9SA 3EZ5A 1VRUB 1Q7LB 3FZMA 3TRGA 4KO0A 4ETXA 4KPYA 1JXVA 3SSRA 1I6JA 5EWGA 2B4OA 1KVKA 1HWUA 3PFOA 1HNVA 4KFBA 1YBTA 2HS3A 1JLQB 3PYFA 4DV1K 4DI6A 1HBMB 3QFUA 4CJPA 1IBLF 1HWLA 3AHPA 5J2PA 2ZQBA 3M8SA 4AT1B 3GCXP 4JK7A 1FXRA 2HF3A 4ECZA 3VZHA 1HNZF 3CC4S 1UVIA 3GYNA 1U1QA 4MYUA 4I64A 4BRCA 2IC3B 3PW0A 2R4FA 1BL3A 3KK2B 3US5A 1X4EA 3M9NB 4BC2A 4Y0WA 1RAJA 3V2UC 4QW9A 2FBTA 1YJNS 4J9PA 3B6BA 2M0GB 4H4MA 4TNOA 5ETPA 3IRXB 4RZRA 1I94J 3CCES 3DXSX 3MM6B 4FF4A 3UR0A 2GWKA 4O5FA 2JEGA 3BGRB 2YKNA 4DQSA 1LCUA 2GO9A 5BJRA 5GAGU 4IEEA 4NMLA 4BRAA 4DR4J 2X78A 2RRAA 3GR0A 2BKNA 4XDCA 5KFWA 3C0BA 4BHQA 1HD0A 3EZWA 3UD4P 5D3GA 3QGGA 3ASMA 3EL2A 3AJDA 1VC6A 3JYTB 2KL8A 3CDBA 1TUUA 4B9LA 1H0HB 4HACA 1CJUA 1YJTA 4DR5J 3QERA 4WXWA 3O80A 1T9UA 1S77D 4LF6F 4LJMA 3SJHA 1TYQB 4RW4A 2H5IB 3H42A 3ZC4A 5KFNA 2W42A 3GQCA 4A8WA 4NA3A 3BO3A 2O4GA 4X64F 5LSOA 2FC0A 5LY3A 2CNNB 1SQFA 4RNFA 4QU6A 4DKWA 1ELOA 4DV2K 1DLOB 3R3TA 4CW7B 3TQEA 2IAJA 2H3GX 2DGQA 3CC4N 1K8KB 2LP4A 4F3TA 4EFAC 3TUPA 4DV0K 1XNRK 4Z7YA 1FKPA 1AA1B 1Y0HA 2DNHA 1DTQB 4MIWA 4ANDA 4N77A 5L1KA 4A8XA 3CC2S 2AV5A 2V6AA 4IDHA 2ZJPL 1YJNN 3L4QA 2G0IA 3BBCA 4I6AA 1U6FA 3CCEN 2AX0A 4CQ1A 1HNXJ 1S79A 3LALA 3QBCA 4FJMA 4CJUA 3SBTA 3D67A 2DGXA 1KHWA 5KG2A 2VODA 1H38A 2V7ZA 5ITHA 1Q5VA 1FFGB 4MLHA 4HDGA 3L2QA 4LFCJ 2DIUA 3RBDA 2WVEA 1S1TB 4RUCA 1QTMA 2Z2LA 3V6DA 2JLFA 4PEOA 1NNEA 2CQCA 5L1LA 2D1KA 3GSDA 4FL9A 4NCAA 2KH9A 1RT5A 1OQ6A 5F8GA 3CYMA 1VK8A 2PFFB 1X8DA 2W2OP 3QETA 2CG4A 1UA1A 4QS8A 4FLTA 1YK9A 3D2EB 4R79A 2E5LJ 1K0TA 3TZZA 1IO2A 4DR6J 3G86A 3M7VA 2OELA 1A7GE 1N56A 4B3TK 3GG0A 4DL3A 1FDAA 2F1FA 4Z2XA 4ECTA 2JVRA 2GIRA 2ZJQL 1XHXA 1D1UA 3K5NA 5I3UA 4RW6B 5HLFA 2WSCC 4K42A 1U1MA 3K5OA 2V0NA 3JSMA 5HATA 2JSXA 2HNYB 4CK3A 3K17A 2B9WA 2LFVA 1QSLA 4J9LA 4R0JA 1UW9A 1VQNS 3PJ9A 3RU0A 4CFDA 5T14A 3ZT4A 2MQQA 3CC2N 1VQSA 3LP2B 2BJDA 4GO5X 3RSEA 2K06A 4FVMA 1WSVA 4MKYA 3SLCA 2FJVA 1S12A 3GB0A 4YHHF 1C0GA 2C3UA 3SPYA 2FZGB 4FZVA 3Q8RB 2WW4A 4EBEA 3ZSOA 2OHDA 5K8OA 2LEBA 2A6MA 1SI9A 1Q9YA 3GCWP 4IR9A 3TOQA 4E89A 2WVBA 5KT2A 1Q79A 3KHGA 2KXHA 2DISA 2O3DA 5IWAJ 4CH7A 1HX1A 2QXFA 5AFUH 3D2FB 1RCXB 2HAIA 4DU4A 2W7AA 3DYAB 1AYEA 1R8PA 2LQ5A 4IFEA 3BBFA 4DUYK 2D0AA 2R7RA 3CFOA 4DR1J 2MKYA 1J5OB 2DD8S 3HK2A 2KJVA 4LF9J 1S49A 4CFAA 4IRDA 4DPYA 2RRNA 3NFAA 5E3PA 2L9DA 4ZTJA 3TJ8A 3VR1A 1TUGB 4PG5A 1C6VA 5G0RB 3AA8A 3KJVB 5HROA 4DS4A 1HPZB 2HHVA 3MR3A 4IR1A 2QYGA 1EQMA 3DLEA 2FSNA 2W6LA 2M2BA 1LW0A 1JQGA 1WHYA 2V9WA 3BV8A 2KM8C 4GKKF 3O08A 1QQOA 2HWTA 3PUFA 1VQNN 1QAIA 3HBTA 1MNEA 4DTUA 4M5GA 1R43A 4M7YA 3VEWA 4FJKA 2X6SA 2HSTA 3HHLB 2P9EA 4BQLA 1YHQS 1HRHA 4HUFA 4F4AA 3G82A 1B9DA 2YY3A 4K4SA 4BRLA 4IG3B 2PAVA 1J27A 2E8AA 4QPTA 1QE1B 3GR1A 2I5JA 2FJAB 1U1LA 3R2DJ 4Y2CA 1BOTO 4LUBA 4KB7A 4QIWD 3OS1A 2C42A 2UXBF 5ADZA 3MEDB 2E1PA 1A9NB 2J7WA 1CZBA 2UUWA 2KFZA 4DL0C 2HNDA 1ZYQA 4ILMA 5CYQB 5J1EB 1G7CB 1RYSA 3MUMP 4QR1A 4O55A 1VSDA 2QTDA 4HH1A 4K0KF 4MIAA 4Z4CA 3GYGA 4ZN3A 3CM5A 1S97A 2ALYB 2P5VA 3RZAA 3FBBA 3O6WA 3AD9C 3I5BA 4MDAA 3EWGA 4TSXA 4V19X 3MWPA 3R97A 2L3MA 2XMJA 4TU8A 2DPIA 1NHKL 2FVQA 5EX5A 4L3NA 4BE2A 4XPEA 3NCRA 3G6YA 5ETSA 2IJRA 1RAFB 2W01A 3OVNA 2AIRB 2LXUA 2QA1A 1XNQF 4CEFA 3QBXA 2YNGA 2DGSA 1GTHA 1VRQC 3MHYA 2CQDA 4RWTA 3W61A 1APSA 3TJ9A 2HURA 1TL3A 1YHQN 4OYXA 3NF9A 2VFUA 3IWLA 1YSJA 1QDUB 1JJHA 3TEHB 3KD1E 4C8MA 1RBSA 4AFFA 4CEZA 2QWNA 3G87A 5AQQA 3C65A 3NWGA 3DHWC 1N32F 1BA0A 3AJ1A 3ZZPA 5E3CA 3UPFA 3MM9B 1FESA 1VHXA 3MPDA 5A2QO 2F9DA 1HW8A 5C42B 2XSFA 3FBFA 1HUXA 1RBLA 1L3KA 4CBUA 4UT4A 1X7VA 4Y65A 1CPZA 2CZ9A 4ZS6A 3N5FA 4E19A 4O44B 2DGWA 1C0TA 2AEMA 1L3VA 2R2UA 1TZ0A 1FJEB 2YWFA 3EGWB 5H9FK 3C6UB 4AILC 4DV2J 3RB4A 3V6HA 1IJFB 1SC6A 2V2QA 4CI0B 3W3DA 2V68A 5FLXU 2NS1B 3AH6A 5GAHU 2YNIA 2WAQD 2F40A 3G10A 1RB0A 1VI7A 3DXMB 3H4BA 3FDSA 1FJCA 1BMQB 2LU2A 3C6AA 3TTFA 1NGCA 1ZBLA 2KJWA 3IRWP 2O8CA 2W9BA 1GXLA 2WOMB 1MROB 1WBDA 4H4KC 4JI1F 4O4RA 4DQIA 3SPZA 2GMHA 1ZXOA 4AHUA 4V19S 3CPWM 5DG7A 5KFVA 1N36K 2F7TA 1IXKA 4XH1A 2JEFA 2VPXB 4M3UA 4CO1A 2MZTA 3FK4A 4F02A 1HBOA 2JFKA 3BP8A 3EN9A 3U4LA 1LK7A 4WCEQ 1IWAA 1P6TA 4X62K 3CG7A 4E1NA 1S9EB 4YB7A 2WZ1A 4FCYA 2HZAA 1HNIB 3FEZA 2VF3A 2ASPA 3JSYA 3DOLB 3DRPB 2RQKA 3DLBA 2UVRA 4MDBA 2A10A 5D4LA 4Z4GA 2HHPA 4KGZB 3POTA 4ISGA 3J81O 2DBBA 2UU9K 2XI3A 4URSA 1S1WB 1NM1A 3G2XA 4CGJA 1R3NA 1YBUA 2HQGA 4WWSA 2V67A 2AYEA 3SCXA 2Q3SA 2VYPA 5GMDA 2YWKA 1M90O 4B9SA 3VAFA 4OYPA 4KRWA 4ZHRB 3C6HA 3W66A 1GH8A 3IS9B 4ER8A 3C2PA 3TVYA 5J2MA 1KWMA 4KQZA 5LSLA 4E7LA 4X4RA 4BR5A 2F8SA 1H98A 3T19A 1NEEA 5LMUJ 2D1CA 4EK2A 1FE4A 4LD0A 2CPDA 3NMAA 3C3LA 2BV3A 4EGLA 5H9EK 1S59A 1R8BA 4DV7K 4G1QB 4RW8A 4B8CA 1S0NA 4USHA 1CJKB 2AEJA 4H0XB 4DV5K 3BR8A 3GLJA 1H7XA 3CXCR 3MMBA 1T03B 5GINA 5EWFA 5C2CA 3KK1B 3HX9A 4FJ9A 5CZ1A 2NRVA 3QEWA 1NDPA 5DQIA 2AD9A 2HPUA 2VASA 3LWLA 3CPEA 3S9HA 2HW3A 4NLQA 3UCGA 2G9OA 8AT1B 4F0HA 1U09A 2ZE2B 1S10A 1MMLA 4LF8K 4KR0B 3CJ7A 1N34K 4QJVA 4AHCA 4DUYJ 3C15B 1ASVA 3VQEA 3CE8A 5EX3A 3A8YA 5LM7E 3THWB 1NGGA 5E7OB 1KAZA 4FW1A 1X3NA 4OI1A 2DY4A 2V5HG 4BC4A 3UN2A 4AD6A 1U8SA 3VETA 4JYAK 2QSWA 2ZFHA 1RILA 3P49B 3F73A 2CWKA 3W9HA 1YF5L 4K4UA 1RZMA 3T1HF 2W4PA 3KHLA 2M52A 5CHIA 3D45A 3J80Y 5SZTA 3IXQA 2HAFA 3OR2A 3CJAA 2DFEA 2G8IA 4G1IA 3UNYA 2MHNA 1G3OA 2E2OA 1KAYA 2IVMA 1DTTB 3FR0A 1IR1A 3AA5X 4CK1A 1UEUA 4AXJA 1KEKA 4BGBA 3IG1B 3HI9A 3V9WA 4UUWA 4CM2A 1NMNA 3TR5A 4OKJA 4F8RA 1Q82O 1U25A 2YHYA 4A62A 2QWRA 2VD3A 2F4VF 1S6PA 1A5VA 3MR6A 2V2ZA 3EY1A 3R9LA 1RJJA 4CEAA 4RNNA 2QRRA 1WSGA 4JKBA 3I82A 2K1RA 4DTJA 5G4DA 2DNKA 4Y2AA 3HXMA 1QLNA 3QGPA 5HQ8A 3BPDA 1EQYA 3N4QA 3L09A 2BOAA 3VQ5A 1E6YB 3HVWA 2V4RA 1D9FA 4BE1A 4DHVA 2R42A 2YKMB 5KFSA 3AXKA 2O66A 3MCAB 2I0XA 2OSRA 2AGOA 4AXIA 2FJEB 3JB9k 4CJLA 2ZZTA 4JI7J 1U6ZA 1ZETA 3M2VB 5AR0A 3QQCD 3OYCA 1HWKA 1RWOB 2XO6A 2QW9A 5BPNA 1HI1A 1WACA 1Q8KA 4CIGA 2BKOA 1XMQJ 4CEBA 1RTZA 3RBZA 3MMVA 4LIWA 2QTWA 3M4XA 2DFFA 3IR7B 3MCOA 2IDOA 1C1BA 2D69A 5IFMA 5KOWA 2FYXA 2OEKA 5IOLA 1RWUA 2KZZA 3QINA 3WC0A 1WWHA 4NMXA 1DURA 4FYYB 4DXLA 4K43A 4YDUC 1TP7A 1F2HA 2M4MA 3HLUA 2PY5A 4AQYF 2HLUA 3TAGA 3FCVA 1FK9A 2O8BB 4DSLA 1XC3A 5KFJA 2ASDA 4ITSA 2KKHA 4KGMA 2I2YA 3VQAA 4C8ZA 1CSJA 3DOMA 4JKAA 1XQSC 4PR6A 3N5BA 4BRPA 4CJ3A 3P5BP 1UP1A 3MFIA 2BUPA 1HHTP 2ZVIA 3ZETB 3KLFB 4DFKA 4Z4EA 2RF2A 4DF4A 4LRBA 2NPIA 1B4SA 2ILYA 4JD2B 5F0UA 5KFKA 4E3SA 2HBJA 1S76D 2E20A 3IGVA 1FRIA 5FDLB 2G4BA 5D0EA 2F9TA 1KLMA 2JHEA 4ZOSA 4LF6K 1Z2ZA 1NRKA 1TKZB 1S1XB 3NGYA 3ZZUA 3IBCB 1HNWK 4B02A 2ZM6F 4ZP6A 3CCLS 3WXKA 4CZLA 2G8KA 4X64K 3SQ1A 1FDBA 4HUGA 3ZCMA 4AYBD 2ATQA 3CQ8A 3EXYA 1FNOA 1S6QA 2CRLA 3PIOQ 4H5RA 4KTWA 3C6TA 4DFPA 4ZLPA 2AJ0A 3W2WB 3DRXA 3OFGA 4DR2J 1FEEA 4ZPWR 4GV6A 3ET6B 4LSLB 2KFYA 3Q22A 2H54B 2BJ9A 3A8EA 1GLFO 2GVZB 1YRUA 4HVZA 5ETOA 2P9IA 4YY3F 5B8HA 4GKJF 4O0JA 2UUCF 4WYLA 1A5WA 1RAIB 3T5KA 3F9MA 4MK9A 3ELHA 4R5PA 3UCZP 5E84A 2IM1A 2EXUA 4JI4K 3GONA 2KZMA 2DNZA 2HBMA 5B09A 3THVA 3QEVA 1CJTA 4OZ1A 2MSSA 2MQNA 4C98A 4U95A 3J81j 1LW2A 1GT8A 4M5DB 3BQ2A 1GMVA 3H7HB 3VTIA 1NH8A 4NOHA 2XLIA 5BRFA 5CZ2A 5IT0A 3CIMA 1W97L 1U2VA 3R1LA 4C9DA 3RW6A 5HVFA 3G25A 3A2FA 4N5SA 4LRCA 4AH9A 3HTVA 3NS5A 1F0XA 4M63C 4Z4FA 1EETB 2UU9J 4RLEA 2J0WA 2ZOFA 3P8BB 3NF7A 2OCEA 1O0PA 2HVDA 3EICA 1TL1B 2VDIA 5ETTA 3MGJA 1R0BG 5KPTA 1TMMA 3CCLN 4AUKA 2CPYA 4ES3A 3O4WA 2P9UB 4M42A 2VGMA 4UY85 3ISZA 1D5AA 2P9CA 1NZAA 1UJ6A 4WCEL 4UTGA 1IV0A 3NLCA 4DV7J 1T9VA 2XHBA 3UKUB 1VSKA 5KFLA 4LFBK 1IKYA 4FYXB 4OYOA 4L8RB 2HVEA 3AOCA 2CXEA 3NE6A 2EFGA 3B82A 4LR9A 4YHHK 2FB0A 5TKYA 3QEIA 2Z57B 4JV1A 3CD6S 4E7HA 1NGIA 2P2CB 1R27B 4YOYA 3EE9A 2OLWA 2VFTA 2AP1A 4RUHA 3QRRA 3S6EA 1TKTB 2DPNA 2J0QD 3GIMA 1M5SA 2DYAA 2E1CA 4WE1B 4HT5A 1Y97A 4ERDA 4KT0C 5L1JA 4URQU 1HYVA 3V1QA 1XMOK 2YV0X 3QT7A 1VISA 3AVJA 4DLGA 4FLYA 4N47A 4DR3J 2V8DA 5A0YA 3MR5A 5E26A 3AV9A 1N33K 3FRYA 1BQNB 2RMLA 5BREA 3GIIA 2MZQA 4RR5A 1RWWB 3TA2A 3MEEA 1RBAA 2V7YA 2P1JA 1WC1A 3CDWA 3R6GB 4I4BA 1VQ7S 1M5PC 4DPOA 1J6ZA 3ZTRA 4OLAA 5L38A 4C3MA 3RBEA 3M2UA 3U9DA 5A8RB 3DLGB 2C3YA 2V2KA 4NLVA 3WXIA 4OGCA 4IG0A 2FY8A 1HHSA 3TTCA 3SUOA 3J7YP 4PWUA 2R8JA 4BR7A 4OYZA 5J1PA 3NNAA 2RS2A 2GS8A 2HS4A 3IA0A 9RUBA 4WFAQ 2UVWA 4IDKB 2A40A 2CQIA 2F96A 4A59A 4OZ2A 1FJ7A 3V9XA 4OYWA 1VQYA 5J2NB 3NDKA 3CD6N 4I2PA 3PG9A 3D6RA 4CJ4A 1RSCA 4NLWA 4PQUA 3MI7X 1HQEB 4CO2A 3FBEA 2HMIA 4GVBB 4DCOB 1UVMA 4I7FA 3ENWA 5DRKA 1X4CA 5EXWA 5HBMB 3EPIA 1X9SA 3VQPA 1SPBP 4ICLB 2X51A 4AL6A 3BZCA 2DRAA 3JAMY 1PKUA 3D7EO 1N54B 3PTWA 4DN0A 3BH6B 1WJ9A 3DMJB 4NLXA 2NSCA 1T05B 1IBLJ 1X4AA 4EIAA 2YWEA 4HI1A 1X4DA 3AB2B 1HNZJ 4LF1A 4JP8A 4CWBA 1FDNA 4K0KK 5KQDA 1VRUA 2XB2D 1RDWX 2E1AA 3M1VB 5JVHQ 4NXNF 4IRCA 1HNVB 1NK8A 1VQ7N 1JLQA 1XR7A 1FF2A 3B8HA 4OJ1A 5AZIB 1JIHA 1HBMA 3FCHA 5D4OA 4QIFA 3W5YA 2XBPA 4M5JA 3RMBA 2UUBF 2KYZA 1I39A 3IBFB 3Q8YA 1A5XA 2UXCK 3R5CA 2NXJA 4O0IA 4HLBA 3R1HA 3MZIA 3I0SB 4WZQA 2IC3A 2E44A 1WNEA 4BRFA 4ZIWA 4PPDA 4HCBA 3G71S 1M5OC 1PC5A 4NLYA 4TQRA 2DXFA 1P1LA 3IRXA 3S3OA 1N32K 3MM6A 4CBWA 4OX9F 2LXFA 2HHHJ 2VG5B 3EZOA 4KPCA 2QV6A 3CO9A 1Q16B 1TK8A 5KFMA 3ZX2A 3BGRA 2ZWOA 2QLXA 4LF6J 2NRHA 4C97A 5KPRA 2CJBA 3H5UA 3SQOP 2FVCA 5B08A 3BF1A 3I4HX 2Z56B 2MKKA 4LF4J 2J8SA 3OTEA 3H2VE 1RT3B 3PEHA 3WC2A 3R5AA 4USKA 4FWPA 3HPHA 2XGQA 2E9RX 1FJGF 3HD2A 3NAIA 4NWBA 3NGSA 2RKIB 3MCPA 4NXMF 2QA4S 1KVIA 2J9CA 3U3GA 3AVAA 2AJQA 3KNAA 3KK3B 1R6VA 3OW2R 4DTNA 3NWRA 4RUAA 1QSYA 1PCAA 3SYZA 3PRDA 2LQJA 1TYQA 4JK9A 1JKHB 2HHTA 2XMUA 4M7XA 1WF0A 3EMTA 1X1PA 3KMSA 4JI1K 5KFTA 3CCJS 2B7BB 2QA2A 3DRSB 2EFPA 3EGVA 1DLOA 2ZVSA 2HHXA 1IWGA 3PCOB 3NL0A 2NSBA 4G65A 2XY5A 4BRIA 1K8KA 1Q82T 1DTQA 2XHCA 2CGLA 4X66J 3G6ES 3VQ7A 3G71N 2QGFB 2BW7A 2QWMA 2MGZB 2YH1A 2G2OA 5D78A 3K9JA 1BCOA 4MO4A 4M5IA 3TO8A 4Z4HA 2CJKA 1BCMA 3LM9A 4C7QA 3PIOL 5F8MA 4DZDA 1OSCA 1W0HA 2B0GA 4TKTA 3OQ2A 4TLRA 1J54A 7FDRA 2D3O1 1U04A 2QG9B 5AQZA 2MZ1A 4KIAA 4ZPCA 3CCRS 2W8LA 2J6TA 2BJ3A 1UL3A 3V9ZA 3KK7A 1E3MA 3MCMA 4OJGA 4CHPA 1S1TA 1UMJA 3T6JA 1H2UX 1XN9A 4WP8A 2F7VA 4X65F 3GZ7A 3PJXA 1HBNB 4PRFA 3NGIA 5B7WA 4DUZJ 2QA4N 3P6YC 5LJ3Y 5DG9A 3MECA 2UUAF 3RG6A 1C1CB 5DZ7A 4CGDA 3D2EA 1EWRA 3ENBA 1SS6A 1RWKB 3DWLA 2QXLA 4YHHJ 2OGUA 1NWKA 3HHEA 3OR1A 2E6MA 5KRSA 2DR5A 4NRUA 2C1EB 4QYZJ 1NOZA 3CJTA 3AODA 2DIVA 4A8KA 3CCJN 2RHSB 3GJSB 1H7WA 2IYGA 4RWXA 4B9UA 2D3ZA 3SBGA 5C15A 1Q5YA 1RHJB 4DTXA 5FPNA 4OZLA 1NUEA 2Q79A 5FJ4A 2YI1A 2HNYA 5D6GA 4J9MA 3MWTA 1NPKA 5D77A 2C3OA 1JMTA 4ZCKA 4CO5A 1ZBTA 1BY9A 4TY8A 1HWIA 3G6EN 2VH7A 3VAKA 1WD6A 2LSNA 2FGOA 4C4WA 2FHOB 3W9IA 3LP1B 5C10A 3PR5B 2BE2B 1RAHB 3EXCX 2DH8A 4BREA 4KGVB 4MK8A 1BUPA 3MXMA 4F4XA 1HBUA 2XYPB 4NL5A 3TW0A 1NK6A 3WIVA 5HK4A 3RRGA 3J7YI 3E1YA 3V9UA 5THWA 1TUVA 1TU0B 3CCRN 4OI6A 5I3PA 4ZVSB 5EY4A 3SEOA 3OBYA 4DU7A 4OZJA 4EZ9A 5HL7Q 3D2FA 4L73A 3TANA 5KFEA 3MEGB 5DMRA 2D0PA 3ZSQA 3T1HK 3DYAA 9ATCB 3BBBA 1QVFM 2B8QA 3L3UA 4DV6F 3FSXA 2XEXA 1Q9XA 1GLJO 2HBKA 4GKKJ 1XQIA 5DDQC 2XLKA 1I1GA 3I56S 5DQGA 4ID8A 1F5CA 5CA5A 5LXRA 4BR0A 2FIUA 3CD5A 1HYSA 3BN7A 4CJKA 3G4SS 1K73O 4FPIA 4LC9B 3VAIA 2MZRA 3I8BA 3AAPA 3CCSS 4X4VA 2FHJD 3HM8A 5G0RA 3DLEB 5M1KA 1VSLA 3R5BA 3R27A 1OQ3A 3GPAA 3FQKA 4LQ3A 2OTJS 1TAUA 1RACB 3D2WA 2UXBJ 4ZKAA 2HYIB 1QS4A 2HNZB 3RMCA 1NGDA 2KFNA 4WZMA 4FJ8A 3M6UA 4WP9A 3AVHA 3VAJA 3K5PA 1Y5NB 2A1SA 5JICA 4DL2A 3M6WA 5KG6A 2GX8A 2CJYB 4IG3A 4HCCA 2CJ9A 4K0KJ 4CHQA 4WIIA 1URNA 5KFRA 3SUQA 3F41A 1QE1A 3EKSA 1RT2B 3TX0A 2P9PB 4WFAL 4XK8C 4ZITA 1ZOTA 1RWNB 4CIEA 4RWWA 2R7UA 1GLCG 5BPLA 3EE8A 5GAGP 2DNPA 4UOGA 3MMCB 4IFYB 1KLNA 4CZMA 1JLEB 4OI2A 4DS5A 3OSPA 5E0OA 3AB4B 3BSAA 2VBYA 3GFZA 4Y2IA 3LPEA 3LDSA 5CYQA 4FYWB 5J1EA 1B70B 3I56N 1XNQJ 3FEXB 4CH1A 4U96A 4AQYK 4M45A 2BVZA 3G4SN 3M6XA 2CJQA 4BG8A 4Y34A 3ENVA 2XZDB 3DLHA 2OPPB 1D9DA 3CCSN 4KTZA 4B9QA 1CLFA 3RAMA 3WXMB 1NSKL 1JXBA 1JXEA 1Y5IB 2IRUA 3MCSA 1F9HA 1RWMB 4RJVA 5KPZA 1KC8O 1BHNA 4DLEA 1S5JA 3LPYA 4QZVB 2OTJN 5AQPA 5JVHL 2D3OR 4M41A 4OLOA 1M1KO 2YNGB 1RLCL 5FD1A 1ZH5A 2XLJA 1SC3B 4DMZA 5M2PA 2HK2A 1D8YA 3MM7B 5L39A 2KVQE 1DQAA 2BRLA 1HJRA 1KQSR 1HJOA 4O3OA 1BQMB 5LSRA 3E9LA 3AQOA 2ZM6K 2A0FB 3ZTSA 4B3OA 3O9SA 2VG6B 3O9QA 1QQMA 1PAEX 2NRTA 3MM9A 2J4RA 5C42A 3G8QA 3MAAB 2FQQB 4ZN1A 4BDYA 1BQXA 3J80O 5CR4A 1ESVA 4JS4A 3EUNA 1SL1A 3KUEA 4PCQA 3FLCO 2IRYA 1RT7B 2CG8A 3D28A 1TVRB 4O44A 4J9QA 2YKOA 1GMUA 3SAFA 3C6UA 2V51B 2MKCA 4YY3K 4GKJK 2UUCK 2DNGA 4BVOA 5AE2A 2NZ4A 1JLGB 3UQSA 3NF8A 3OY9A 3S7RA 3BSCA 3DXMA 3VF2A 3I55S 1U4BA 3U3YA 2OD4A 2O8CB 1NOYA 3MOJB 3R9PA 2CPZA 1MROA 4F9OA 5GADU 5BR8J 4F4YA 3K5MA 2HQFA 2RUGA 1XC9A 2CNLB 2E88A 4CEEA 4Y00A 3PEJA 2CYYA 2W40A 5HQLA 4NE9C 5JVGL 3FE1A 1J2VA 5ETVA 1WG4A 3CMES 1U48A 3BEGB 1CBKA 5IV3A 4H4OB 1VQ5S 2OMLA 1NJIO 4A8MP 1EJ7L 3ETOA 3G8TA 1NK5A 1VIXA 1JNZB 2WK4A 5BR9A 3OYKA 2M88A 3HFVA 1HNIA 3DOLA 4IH5A 3DRPA 4Y2MA 2GGPB 4W90B 4JI6F 2ACMA 3WBZA 1RU2A 1WF1A 5CCMA 2NZCA 1TUYA 3CMQA 1N6QB 1XI1A 4RU2A 1Q4RA 2QLBB 4H0TB 4MKBA 2C3MA 4R25A 3UR3C 1S1WA 5KFBA 4TXSA 5I3QA 4OJRA 1S7HA 2ZD1B 3OS2A 5AQUA 4A61A 4DQ8A 4ZHRA 3KKFA 1NU4A 4BCAA 2V69A 5CQGA 2DCUB 4H0OA 3I55N 1Q7YO 3KJNB 3QJJA 1MG7A 1PJ5A 2W41A 2ZH5A 2J8AA 3R7NB 1T11A 3HPGA 4AHVA 3QSIA 4FOIA 1CJKA 3HFZB 2J5AA 3Q8UA 5J1NA 1YVFA 1AUDA 2FY1A 1T03A 1BA1A 2JWKA 4JLHA 5KFUA 1FRKA 1LK5A 1RHRB 2ITMA 1RAEB 4CJ7A 2E2PA 4FS2A 3CMEN 2YCHA 1JJ2M 2KN4A 3WX8A 3KKRA 4Y6IA 1LAVA 1VQ5N 1LV5A 2I8EA 1RLDA 2ZE2A 2R7TA 2YQ0A 3BYRA 4BS2A 3C15A 1Q95G 4CGFA 3DDNA 2HBYB 3BDPA 5JXSA 1UTAA 3EDRB 5AQNA 4BRGA 5IS2A 5HANA 4B9NA 4CO0A 1IBMJ 4FKYA 2ZH1A 2MKIA 1VFJA 4KHPK 3ID6A 2D74B 1IKVB 1F5AA 3G8SA 3M8QB 2F4VJ 2EI5A 4WQ5A 5BN9A 3MMAB 2R7XA 3QEPA 5IC6B 3OR2B 5LJ5Y 2DR8A 5CABA 3KHYA 2X3GA 3UFCX 3PXGa 3Q8QB 1CQMA 3CJRA 5FROA 1Q18A 3RMAA 1VR6A 2QMXA 1IG9A 1DTTA 3H5SA 1VQLS 4YQWA 3QZ8A 3QFPA 3VGKA 3UI3A 5HL7L 3L7PA 2W8KA 5CD4A 5GAGI 3QYYA 4BY9C 2DO4A 1RGVA 4DQQA 3IG1A 2D4WA 2WRMA 4IKAA 4NEYA 3D0HE 2KU7A 4DDFA 3OW2M 4DU8A 1ZC6A 4L72B 4NASA 1U2RA 1TFWA 3JQJA 2C22A 4XDDA 1SJ4P 4ELTA 3CIZA 1MW7A 5K8PA 3S3MA 3R2CJ 1IH7A 5EU7A 3QESA 5AQYA 3VAMA 4NLPA 3BS9A 3SCLE 4JOUA 2IIHA 1VQKS 2RAQA 2H5EA 2WB4A 4A8OA 3JQKA 4JN4A 4FJLA 3BQ0A 2ASJA 2XMVA 1NGBA 2BANB 2YKMA 2EX3A 4BWJA 4NXNK 1FTCA 3ZZ0A 1YKWA 4KKOA 3GSIA 3J7ZO 3N6LA 2EFNA 4GVLA 4LSZB 3OYGA 3M2VA 2V8GA 1W25A 4WQ4A 1TFYA 2PO4A 3PR4A 2LA4A 4AQYJ 2V34A 1S0OA 3L3CA 4CBXA 2NYHA 1DZ5A 1Q8IA 2HGMA 2AQ4A 3T5LA 3CCVS 2AZ3A 2CQBA 4FZYA 2UUBK 2VQFK 2KB2A 5F3TA 2LXIA 3E9PA 1RK8A 4HVJA 3TX8A 1QHAA 1ULRA 2ZH4A 2MZJA 2RSQA 1WSFA 3ULDA 4CJEA 1VMBA 3DGPB 1LQ9A 5AFUA 1OYEA 3MUVP 1SL2A 3FFIB 1F21A 4S0MA 1LOTB 2V8PA 1S48A 3LP0B 4C0OC 3DRRA 5LMNJ 4W5TA 4H5WA 1FEHA 1VQLN 4OZ5A 4OX9K 4NYNA 2C2RA 1GOBA 4MKAA 4JUZA 2VWBA 2QWLA 2O8BA 1CJVB 4BVPA 3L7OA 3W65A 4I9LA 2IM2A 4CF9A 4CLPA 4Q5VA 2VWKA 5KFHA 2KYXA 4I9QA 2KT5A 3MPWA 1XR6A 4F25A 3KMQA 4QWCA 4ZVQB 4DG1B 4A8QA 1B92A 1PYOB 3ZETA 2XCAA 2RF2B 1KKHA 2CZVC 2DVIA 1G2EA 1FJGK 1IJJA 2YWWA 2FVPA 1RAAB 2KO1A 3QRPA 4YOTA 1VQKN 3EDQB 5JS1A 1NDKA 2CFXA 4GC6A 1ZBIA 5CCLA 3K9KA 1KLMB 3LDNA 4PG7A 4ED4A 1K8AO 4BR9A 4BRNA 2E5HA 1NGJA 2DGUA 3LWMA 1TKZA 2QO3A 3VZIA 4CZIA 1OPZA 4YY3J 3CM6A 2XNRA 3PX0A 4GKJJ 1VSEA 3MMJA 2UUCJ 1U26A 2W25A 4B3SF 1N5YB 2Q6CA 2I1RA 2AJFE 3Q8PB 2F63A 3CCVN 3UD5A 3W9JA 2CNOB 4O3SA 1S72S 4ILJA 1S6QB 4LF7F 4I6MB 4FWSA 5E41A 1K73T 2Y9HA 1RTDA 3FJ2A 3H45C 1VSMA 3VEVA 2YNFB 3W2WA 3CI5A 1WSIA 3ZYYX 4KAIA 1S9FA 4JEPA 1UCNA 3A4TA 1HLWA 4QS9A 2HVIA 3ET6A 4LSLA 4N8OA 3VESA 2RQCA 4RW7B 2GVZA 4M3WA 4YR2A 4QCLA 2HB5A 5A8KB 3ATVA 3R7SB 1QQCA 4CLUA 2DEJA 5EUHA 4CO3A 2D5RA 1S1VA 1GNKA 1K47A 2OPRA 2VFSA 3JAMO 2OEMA 3FZHA 2R2RA 3H2LA 1T3VA 2OFHX 4PY5A 2P9NB 3U27A 2GHPA 3WT0A 2DHAA 1R6YA 1QHTA 4FN5A 1Q1KA 2NLXA 4M5DA 4ZLJA 1JXLA 1U2VB 1SB6A 3PRVA 1TKXB 3QGHA 4RBUA 4Z7CA 3W1YC 3LAMA 3O3FA 3CVKA 4K4XA 1HHQA 3OXLA 2MLZA 4C0HA 4X65K 2ZJQQ 3AARA 2IPOB 3Q89A 1UETA 2GC8A 4UQTA 2UUAK 4OV1A 4Z37A 3SQGB 1KBRA 3MURP 1TL1A 3CSKA 1G1XA 1OY9A 2OPSB 3AXMA 4KGXB 2IBOA 3RB3A 4N8NA 5E2QA 2WBMA 4I2QB 4PUOA 2J9EA 3KLIB 5AQTA 1YIJS 2B9XA 2P9UA 1KQFB 2Z1HA 3W8PA 2X7IA 1S72N 3ISNC 2G1HA 4LF5F 2EPIA 2ZBIA 2D3UA 1X0PA 1YLXA 2RDJA 3UKUA 1AW0A 2HBLA 4J9OA 4B3MK 2ZWHA 1DKGD 3D5MA 2RILA 3OTOK 3D68A 2YHXA 5BN8A 5MLCV 1U02A 4RPFA 1I94F 3AJ2A 4QQBA 1KC8T 3H3NO 3CF5Q 1WN7A 2I7PA 3TAEA 2QA4G 4H0YB 3PKYA 3KUGA 4ED0A 2KXNB 1TKTA 3KWIA 4C3LA 3OYAA 2DFHA 4X4NA 1KQGB 2Q43A 4WE1A 4DSEA 1ZPWX 3FZ2A 4DQRA 4EHUA 1SKUB 4FZZA 2GO8A 1F9FA 4G1PA 4CLZA 2WSEC 1BU6O 1RT6A 3LOUA 4OI4A 5J2QA 2DNMA 4DV6K 2L9WA 1L5UA 3R7BB 1N48A 4DR5F 1V6HA 1R0CB 4B3RK 4GC7A 1BQNA 1LNQA 2NPFA 2N3OA 2HGLA 4FLZA 5M1OA 1JJCB 5HRNA 4NPOA 3U8XA 4KH5A 3CFRA 3VMFB 1YZ6A 1J5EF 1FFSB 2HFOA 1HQUB 5E5NA 1N34F 3ADAC 1WOOA 2O8DB 2B56A 1IKWA 1SQGA 1MU2B 3VOVA 4USTA 1WC0A 3M2UB 4P7VA 1YIJN 2Y1JA 4RCHA 2G0CA 1KR4A 4ED2A 1VQ4S 3D6MB 1QVGR 4GW6A 3CJSA 3DLGA 4IG0B 5E3AA 2ZBQA 5DO2A 2NYIA 3HKZD 3T1AA 4MO5A 2ASOA 3VN5A 4YOWA 4UOHA 3N6MA 4EO8A 1RWVB 5D4PA 4ECWA 4URGA 3T7ZA 3S41A 4IDKA 5AJ3J 2HIYA 1YJ9S 1YUWA 2XNQA 5C7PA 3E01B 2GQCA 3WQPA 4PA1A 4CEOA 1EQ0A 3WQTA 3VQDA 4CLSA 2ADCA 1ZTTA 4DV4F 2KQ2A 3IBWA 4DX7A 4E7JA 1HQEA 1OY8A 1W2BR 3D9BA 4GVBA 1VQ6S 4ED8A 1KHVA 4LFCF 3KXDA 4TU9A 3FCWA 1NJIT 1FKAF 5HBMA 4RTFD 2RNEA 2VIHA 4EMDA 3A5LC 1U2CA 4N41A 3Q2TC 4BRMA 1WAFA 3OL6A 1T05A 2EVZA 2O1PA 4U8YA 5M2UA 2UUBJ 3W62A 3V6KA 4IYQA 1PIEA 3FZFA 4QWBA 5GAHI 4O3NA 3KOAA 1KP6A 4UOCA 1X4HA 4EBDA 2N3LA 2FTRA 2V8VA 1O8BA 4R8UA 1VK3A 2V50A 3M1VA 2HFVA 5SUHA 3TEGA 4IOBA 4QWDA 4DZ6A 2IHR1 3KHHA 1Q86T 1YX2A 3IFEA 2ILZA 4OX9J 1VQ4N 2C28A 5AZIA 4PAAA 1S99A 5KFFA 2ZHAA 2WBRA 4JI2J 4DL6A 3FC9A 1Q7YT 5LJWA 2DH7A 1BHLA 4JS5A 4FBTA 4F3MA 4H8KA 1LXNA 1P8GA 3P39A 1IM6A 1N5VA 3I0SA 3LUYA 1YJ9N 5F8JA 1Y10A 1FJGJ 3VF0B 4RBVA 2H3EB 1ITGA 2ZEJA 2W2MP 2CPIA 2CIMA 2BA9A 2NUUG 4NXMJ 1HPMA 3HJVA 4MJKA 3CCTA 2J0XA 2XMAA 4FM1A 2VG5A 4KAZA 2C2DA 1VQ6N 3TR8A 1NMDA 2NNWA 4ATNA 1U2FA 2GJIA 2V52B 3NGDA 2DHHA 1S3XA 3WUHA 3SQ4A 2EBEA 5DG8A 1NKEA 4FM2A 1X4GA 4J9NA 4UW2A 2AU0A 3K89A 1Z05A 4G3IA 3O1WA 3OL9A 1RT3A 5AQOA 5DM7Q 3FZBA 2Q0UA 5FLXO 1NLKL 1M5KC 1SQEA 2M70A 2RKIA 5HMYA 1RT1B 2M3DA 1LEOA 4EP5A 4X2BA 4DR1F 3ITHA 4CJTA 2K7KA 3HO1A 1MWMA 3GU0A 4DR7K 3DCAA 3KK3A 1SKRA 3LGHA 2I38A 1UFWA 1RE1B 4BDZA 1RTIB 1DFDA 4QPXA 5KOXA 2B6AA 1HNWF 3DLRA 2CGJA 2EWHA 2ACYA 4M3YA 5C5JA 1JKHA 2O01C 3KG4A 3S1TA 5JMNA 3ENHA 3VTHA 2CJXB 1HR0J 3NRBA 3H98A 3VGUA 2CGKA 2V8HA 1ICEB 1SZ2A 5M1NA 2P9GA 2FHJA 1ATRA 4DQPA 1KOHA 3DRSA 3AO4A 3CULA 1RBUA 1WSHA 1GLLO 1F9EB 4EU0A 5D0RA 5EWEA 3L4IA 4YS2A 3OVBA 4XEIA 4QYRA 2DK2A 4CHYA 4E1JA 4KH1B 4K7QA 3C7NA 1BIZA 4YUDA 2MGZA 4X65J 2Z1JA 3PFEA 4FZXC 4QIEA 3MK6A 3JSRA 3C94A 3K8WA 3TAQA 2UUAJ 4JI4F 4HR2A 3AOBA 2K7JA 4WP3A 4ZVPB 4JI6K 3SQ0A 1TK0A 3L2VA 3JAMU 3O9UA 1VC5A 3Q2SC 1GLBG 4OL8A 1NB2A 3J7ZT 4ED1A 1ATSA 4Y3CA 2VPZB 1S4FA 1TL5A 3MN7A 1LKZA 2C2OB 3OBIA 4C1NI 4CJSA 3I4PA 1HBNA 3EEQA 3MECB 4Q8FA 2PEBA 3EGZA 1GK8A 1NB7A 4JI3J 3DLLQ 1C1CA 2A3ZA 1GAOA 3VVTA 5EVZA 2Z4PA 1P8ZA 1NKBA 5IT9U 5AQWA 3BGLA 1I5OB 4GNIA 3IAS9 3JXUA 1TELA 5AQVA 3OR1B 3UDLA 4QU7A 1CXQA 3KIOA 3PSIA 1VJWA 5K9FA 2UYTA 1FERA 3EX7B 4OJ3A 4FPBA 5HP1B 3BSOA 4FJHA 5BXIA 1W26A 3CQYA 3GV8B 4JHDB 2J6UA 1FTRA 1KDNA 2XMTA 4KHNA 4DL4A 2X74A 2ZZMA 4F36A 2Z30B 3U1MA 1OVYA 4H4KA 3SSQA 4OI3A 1U7LA 2W6KA 4CJFA 2OZSA 4YB6A 4TY8B 4LFBF 4KB0A 3CGIA 3RBXA 4J2EA 3AA9A 3C8YA 2XMKA 4J9UE 4OKKA 1FRHA 3KTQA 3MN9A 5EX0A 4PKDB 3E51A 3LP1A 4KH0B 4YB5A 2BACA 2BE2A 3TSQA 2RHKA 4ECVA 2XO7A 4JRPA 1WAJA 1O6XA 1HMVB 1HBUB 1FCAA 3E66A 2H65B 4KI4A 4I1TA 2XI2A 3KJFB 1U45A 2DNLA 3CD7A 3M2RB 1K8AT 3R3LA 1XMOF 3Q8SB 1YXQA 1ZZNA 1BISA 3CF5L 1UPMB 3AA3A 3MEGA 4LH5A 3TA1A 1RWPB 3H46O 2XM3A 5L8RC 3J7AP 1N33F 1NK4A 4B08A 4CNYA 3QO9A 5C2GA 3ULEB 2W9CB 3FMWA 2V63A 4DCPB 4DPXA 1HYSB 1KQKA 2FSKA 1X9JA 1LXJA 2R7WA 1V3RA 1A0OB 3N4WA 2OMOA 1HD1A 2L48A 1WOQA 5KFPA 3AA4A 1H2TZ 1XERA 3T1YK 4LBIA 3HOSA 1K9MO 2FZKB 4A2BA 3VEYA 4ECUA 2A6OA 2A3JA 4ZVTB 4CTAB 3RR7A 3TZXA 1JJ4A 1V3ZA 1CZAN 5DLFA 1FKOB 4F0KA 3F5TA 4FPAA 5HMZA 2VONA 4JAXA 4KRFA 5KFGA 4NLRA 2Z2MA 2HNZA 4FXWA 3O9TA 2VCPA 4UUXA 2IFXA 2AYGA 3OHBA 3D3CJ 1NJZA 4PL8A 4B9VA 4O8UA 3SFGA 1ZAVA 4JK8A 2VQEK 3K7RA 1NSAA 4CZKA 4ZIVA 5IQQA 1GOCA 4K5SA 1YJRA 3ZX0A 1HFEL 2WCXA 3KWMA 2MQMA 4HH0A 4B1UB 1RT2A 2P9PA 2CPHA 1UZHA 2B7CB 4LIRA 3N9UC 1K1QA 4ZPTR 5KQ8A 4DV1J 3NH0A 3MMCA 3TUJC 4IFYA 2G1DA 1JLEA 2GUPA 2RRBA 1TV6A 1NZ8A 2K3IA 3HHLC 3I5AA 1QQNA 3WNHA 2IM3A 1D0EA 1QAXA 1V4TA 4UY8T 2MY7A 5LMUF 1CS4A 2G0JA 5HOOA 2VBZA 3LH2S 2PA3A 1NPRA 5HN0A 2CQ3A 4P2XA 1DEJA 3W3SA 3GWCA 4P73A 3C66A 3BSNA 1PJ6A 2VOPA 2OPPA 1UJ4A 1U0HA 3U7JA 4WFBQ 2KG0A 1FD8A 2RT3A 1UFKA 2HFUA 3NMUA 2IJFA 3VF4A 2W1BA 5L9NA 3LPUA 5KFZA 4ETZA 1WUAA 2W24A 3MN6A 3IC1A 3FZLA 1FXXA 4KV8B 1DQ9A 3M05A 2A6AA 4QS7A 2UXCF 4A8SA 3DDKA 2NREA 4DU3A 3GP9A 1JCFA 5GAEU 3B8AX 5CZVA 3CHWA 2YHAA 2FJDB 2MLYA 3UNGC 3A8KA 3D66A 2HVHA 3MM7A 3CJ2A 2F9JA 5F0XA 3OYDA 4B3OB 5AE3A 1BQMA 3AO5A 1VQOS 1C0MA 1QY7A 2DRDA 2LA6A 2G8VA 3MEKA 3ZTOA 2VG6A 2UVVA 4BE0A 2PE8A 3KWGA 4B3SK 4BC3A 2CQ4A 2C2EA 3THYB 1RDAA 3JS6A 3MAAA 2NRRA 2LU1A 1H72C 3VEZA 4LF7K 2X1BA 2QLJB 5CH7B 3TZWA 4OPKA 2EC0A 2BQ3A 1HQ2A 2QSFA 1CC7A 3I87A 1RT7A 1NNDA 2G2YA 1RXOB 4KB1A 1NGHA 2YKAA 3RW7A 4DX6A 1TVRA 4P2FA 4GMJB 2VGNA 4X4QA 1T7PA 2MLXA 3FFKB 2J9DE 4A8FA 2B9EA 3M6VA 4DV0J 1X9WA 1WEZA 1XNRJ 1CC8A 3GMGA 1ZZFA 4USMA 3OYFA 1Q8BA 2WFBA 2YHBA 3IR5B 2ZBRA 1ZA1B 1JLGA 4NLBA 2H4YB 4YDUA 5AXLA 3PX6A 3UW1A 1RDBA 5DM7L 1JLCA 1VQ9S 1RWXB 2MSTA 2Y1LB 1YJWS 2UXDK 3A3OB 5K8MA 3VENA 4HWIA 4NEZA 2EK1A 3UE2A 3EPGA 2R3VA 3V4IB 3E8OA 5IXUA 1G6BA 4PXDA 3MR2A 1V5IB 2F9WA 3M3ZA 4ID5A 1PGZA 2G8HA 3R5DA 1B0VA 3OYBA 3UE5A 1MWKA 2E9TA 4JKGA 3WEEA 1QM9A 3QZ7A 3EO3A 3I32A 1CQNA 3QEXA 2EK6A 4JV2A 3J81Y 4J2DA 4H4OA 3GJQB 1SV5A 3NEKA 2LQ8A 2B43A 4W4MA 1VQON 4FBUA 3NCIA 4H5NA 5RUBA 4HT7A 3F56A 2GGPA 1NSPA 2VG7B 1Q78A 3NY0A 1HA1A 4I6WA 4LF5K 3CNQP 1N6QA 1MLAA 4B3TJ 2LKZA 3M30B 4FVUA 3DLKB 4PWWA 2I9SA 5DS7A 3SSSA 1W2BM 2BTFA 1LWCB 1TKDA 4KSEB 3M9OB 3CT9A 3HOTA 3SAGA 4ELUA 3RRHA 1Q8LA 5KFYA 4PXBA 1I94K 4W5RA 2ZD1A 4KI6A 4LVOP 4DUTA 3O1BA 3OYHA 1Y9OA 3CIPA 1WUUA 2P9LA 1EZZB 3EM1A 3QT6A 1SQKA 4IFVB 2VA2A 2KKZA 2BM1A 2FJXA 1EWQA 1FDDA 5KT4A 4DR4K 2R8HA 3ZXWA 2JC1A 3D1OA 5EDWA 3HI0A 5IC4B 4OX6A 1VQ9N 1YJWN 1KXPA 2GIQA 4NB4A 2PI4A 2BE7D 4HDHA 3OVSA 3OPKA 1NM2A 3D1QA 4ZJQA 1BE4A 4ZJLA 3OXGA 1UVJA 1RGIA 4BWMA 2G13A 3KYLA 2U2FA 3DLLL 1ZM2A 1PAUB 3MAQA 3FNNA 2GEMA 4FF1A 2W7PA 3KLHB 3AD7C 4CJ5A 3AVNA 2A1BA 4DR5K 1YTAA 4RUBA 2CWXA 1QAYA 1Z2LA 3D3BJ 4PZVA 3OYMA 2OZMA 3UN3A 3VGTA 1VBKA 4FW2A 3AAQA 3VQ8A 4J8FA 2CQHA 4FNIA 1J5EK 3G6VA 2RJZA 4K50A 4K25A 2BXJA 5AE1A 3HM9A 1VCTA 3AFGA 1NU0A 2N4CA 3ICLA 4HTIA 5KG3A 3FEYB 4IH7A 1GFWB 3MUTP 3P5JA 4AL7A 2MYFA 3TUIC 3AVFA 4BC9A 1MSWD 3GIRA 3PVXA 1RDCA 3CEDA 1IKVA 4DR2F 1VJQA 1JX4A 4FDFA 3M8QA 2JC0A 5C25B 2KTQA 3MMAA 3HRGA 2CDRB 5DGBA 1UEVA 1F1BB 1ZBUA 2DH9A 1YDLA 1BG3A 4NLSA 4YP3A 1X31C 2KHDA 4U7UK 2PD1A 1Q53A 3RRKA 2QX0A 4ID1A 1WDDA 4DV4K 5JS2A 4M5HA 2QWQA 2E4LA 1UWAA 3D1HA 3TVZA 1XR5A 5EOYA 3OLBA 3TSPA 1RDRA 3OD2A 2ZH8A 2RHQB 3BGOP 2JX2A 4LFCK 4BLGA 4Z0UA 4M5NA 1NHVA 3D0GE 4Q43A 3G96A 4ZJOA 3ZT1A 2R7VA 2HFSA 1SCJB 1H2VZ 4DEZA 3TTDA 3CJKB 2ZUAA 4WQ5C 3IM9A 2VA3A 4AHTA 1NHUA 1WOSA 3BUZB 2VBXA 3TQ1A 1UEKA 3O6QA 4MAKA 4LSNA 3QWPA 2UP1A 2GBZA 3BH7B 3O8MA 2E5LK 3A13A 1SIWB 4DR6K 2MMYA 5LL6d 4C3KA 4KKOB 2BANA 2YXLA 2WC9A 2AX1A 3PHTA 2SXLA 4LFAF 3A1YG 2IJNA 3BPSP 4AHRA 1SJFA 4KE5A 1S22A 2ZH3A 4PKIA 3TAMA 6AT1B 3K57A 2W2PP 1XK8A 4RL1A 3ZZYA 2BJ1A 2HFZA 3OV7A 2V2VA 1WG1A 2ATLA 2QLWA 3RUBL 2FLLA 2C3PA 3VQ4A 2GAHC 1HKCA 5I9EB 3L2UA 3DGPA 4Q2MA 1E4FT 4I0WA 4ZVGA 1FNMA 5E3RA 1DY3A 4H5VA 4P2SA 3FFIA 3NGTA 3DRRB 2BZ2A 4OJHA 2FC9A 1NGFA 4MMOA 3LP0A 3FBCA 4MKVA 2MJUA 3PW5A 4ECQA 1NCLA 3I0RB 4ENOA 1FRJA 4WQ4C 1XTZA 4TN2A 1WKKA 4K4WA 2FHMA 4NZ6A 3HYFA 4ECSA 3OYIA 1CJVA 1FWKA 2G8UA 4NCBA 1IR0A 3RAXA 3TABA 4DBQA 4FWMA 3FQLA 1FHTA 2Z2ZA 2DEIA 2VUGA 1JCGA 1U8WA 2WTFA 2GW8A 3O2IA 4DR3F 4B3SJ 3NP5A 4DG1A 1ASWA 4Y1DA 3M8WA 1RDUA 5MLCQ 5GADP 3ZFVA 2EHGA 1X4FA 2OTLS 4LF7J 5T41A 5DM6Q 4HYKA 4DR1K 1HI8A 4KC5A 3ZSYA 2LQ9A 4KHRA 4WFBL 4LF9K 5BPMA 1ZBFA 4F3OA 4EP4A 3W64A 3HD1A 1RA6A 4KHQA 2P9SA 3KLEB 1FX2A 1XBWA 5H9FJ 2BABA 2ATCB 2JWNA 5L1IA