4IG3A

Hiv-1 reverse transcriptase with bound fragment near knuckles site
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Reverse transcriptase/ribonuclease H
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
total genus 167
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ig3A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig3A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig3A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig3A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ig3A05
5DG7A 5J2QA 4BWJA 5KT4A 5JXSA 4Y2AA 1LWEA 5KFZA 2JGUA 3CJ2A 3VQCA 1HPZB 4J2EA 4K4VA 5F8NA 3OYHA 4CJPA 4HKQA 1KLMA 1N6QB 4CFAA 3TQ1A 4E1MA 4CEOA 5KT6A 3VQEA 4Z4FA 4RW6B 1RBRA 1YT3A 1J54A 1Z25A 4B9UA 3B6PA 4CJ3A 4CGDA 2W7PA 5KG4A 4ZP9A 4CJFA 3AO2A 4I9LA 4K4UA 4BE2A 2ETJA 4OKKA 1NOZA 2FBTA 1QE1B 3V9SA 2XGQA 2YKMB 3OL8A 4TLRA 3KHHA 1U48A 1N5YB 1QSSA 4F3OA 1RYSA 2R8GA 3KK2A 2Z1HA 4QWDA 1NK7A 1T03A 4Z4HA 2GIRA 1S1VB 3DOKB 2YNGA 4HCBA 4M3XA 4FJHA 1RT2A 1LWCA 5J2MA 1JX4A 1UAXA 2FVSA 4RNMA 2XY8A 1TKTB 3MAQA 3WNFA 3KKSA 1RTDA 4CGHA 2FVCA 1K1SA 4R5PB 2XI2A 2FJVA 3GIJA 4WFYA 1RT3B 3ASMA 5K14B 5CY4A 1RA6A 2ASDA 5C25A 4CK1A 4B9TA 5F9LA 4Q8FA 4KHUA 3C6UA 4CEZA 4ED7A 4MFBB 4R8UB 1NK8A 3QLHB 4RUAA 3K5NA 3BSOA 2OPQA 4HUEA 3KD1E 4NLSA 5KG2A 4DU3A 1K1QA 1JKHB 4CJWA 2O5DA 2ZE2A 3PY8A 1QQCA 1FKPA 3FRZA 3NAHA 4ZVEA 2VG7A 3KKRA 4K50A 2P5GA 3KK1B 2R2UA 5SZTA 4X2BA 2XRIA 3ULDA 3OS0A 3IG1B 4J9PA 1EKEA 3SUNA 4RU9A 3AO4A 4J9NA 4CK3A 1S9EA 4DLGA 1RT5B 4DQSA 2XWYA 3ZT4A 5KFSA 4ED0A 2IA6A 3P83D 3LDSA 3HVTA 2R8IA 4K4TA 4ED8A 1CZBA 3DOLA 4FM0A 2RF2A 3KTQA 2WOMA 4DLEA 2BGGA 1IKXB 3F73A 1UA0A 4HVJA 4NCGA 3BREA 1IO2A 1Q9XA 1U47A 4O4GA 3CJ5A 2CKWA 4J9MA 4HUFA 4YFUA 1NKCA 3CM6A 4DTOA 3OL7A 5KT7A 1RT6A 4RW9A 1S48A 3KHRA 4ID5B 1TQLA 4BE1A 4Y34A 3B6OA 4LSNB 1S6PB 5EDWA 3Q8PB 4LQ3A 2AU0A 2BE2A 1VRTA 4JRQA 4F2SA 4E19A 2F8TA 5KG1A 1NK0A 5DG9A 5KI6A 4KHQA 3M9MB 1TK5A 4AHTA 3KMSA 1LW0B 4FJGA 5HP1A 2R8KA 1QHTA 3IS9A 5KFVA 1B9DA 3ZSRA 4DWIA 5JS1A 3M8QA 3AO1A 4CJTA 2FVRA 2DFHA 2IAJB 3I0SA 2D7SA 4CGIA 4NCBA 4KHWA 4ECTA 3QINA 3TAMB 2OPSB 1FK9A 3HVRA 4FLTA 1RBSA 3NGIA 1HQUB 2D0AA 1DLOA 4OJRA 4ZPBA 3M9NB 2W9AA 2ASJA 4CEFA 4MKAA 3PO5A 2X74A 5DMRA 1OS5A 4KSEB 3KLIB 4ECXA 1JLFA 5D3GA 1WLJA 3LP1B 4ZPCA 4DSKA 1U49A 1LAVA 2HWHA 4CEEA 4O4RA 2ZD1B 4JS5A 3OYEA 1NK6A 4CJSA 3O3FA 2YNHB 5KFRA 1BL3A 3H08A 4KTQA 3NAEA 3AVBA 4N56A 1ZYQA 1RDDA 1S1UB 5T7BA 1S0OA 4CF2A 1J5OB 3CWJA 1VSMA 5KRTA 1LWEB 2VA3A 3RB4A 5KFCA 3T5JA 1IG9A 4F4KA 1KLMB 2GIQA 2J6UA 1EX4A 5CZ1A 3EY1A 3RR8A 1Z4UA 3G10A 3C94A 4Z4IA 4B9NA 4DU1A 1QSLA 4DSLA 5EWFA 3G6XA 4FLVA 3ISND 3LP2A 1RDRA 3ZSXA 4IFVA 3V9WA 3CG7A 4IG0B 5T14A 1UA1A 2JEIA 3NF8A 1L3UA 3H4BA 4J9RA 2XC9A 3MR3A 4C8KA 5EUHA 4CESA 3NCIA 3KK2B 3K5OA 3OY9A 4I7FA 1A5XA 5KFPA 1XWLA 4Y3CA 1T03B 5L1LA 1NJZA 4IKAA 2YNGB 3HT3A 4J2BA 4GC7A 5KFGA 3DRRA 1RT2B 1LWCB 5J2MB 1S49A 4NLTA 1NOYA 3BSAA 4CEBA 1XI1A 4AILC 3ZSOA 3IAYA 5KFWA 4EEYA 3G86A 3CVKA 3NF7A 1RTDB 3QIDA 2E9TA 2WHOA 1S6QA 2IMWP 2AGPA 5C25B 3I0RA 2CJQA 1TK0A 4MFBA 5KFDA 4FS2A 3C6UB 1LWFA 2C22A 4DQRA 4HTUA 5KFXA 3SJJA 2HHQA 4MK8A 4H4MB 3IRXB 2DY4A 2BRKA 1WSIA 4FK2A 4QPXA 3KHGA 4ECSA 2OPQB 4EBEA 2FVQA 3FSIA 2E6LA 4LD0A 2HMIA 4JV2A 1L3VA 1JXBA 2HVIA 1JL1A 2ZE2B 2F8SA 3NHGA 3RAXA 1FKPB 4FJMA 5KG0A 1RTHA 4O44A 3HSTB 1S10A 3NH1A 3MEDA 3DYAA 3D5MA 4EYIB 2B6AA 1XR7A 2A1SA 2VG7B 3KK1A 5KG7A 1L3TA 2V4RA 1L5UA 3DLGA 3ZSQA 1F21A 4E7KA 3LALA 3DLRA 3GIIA 4B8CA 4O3QA 1TL3B 4FM2A 2FVPA 2QKBA 3D0PA 4TY8A 3BQ1A 4CCHA 3S3MA 1WAFA 5JS2A 3RB3A 4ED3A 3RRHA 3OHAA 2R8HA 4YMEA 3U3YA 1IKVA 3PHEA 4O0IA 5DGBA 3GIKA 4ECUA 1RCHA 3DOLB 2RF2B 4LH4A 3M8PA 4KRFA 3TAFA 4BWMA 3PZPA 1IKXA 1S9GB 4IR9A 2AQ4A 3DMJA 2V4QA 3NFAA 4ZVHA 1NJWA 4J9QA 5DQIA 5KFLA 4O4GB 3DRPA 4J9LA 5DGAA 4IG3A 4DTPA 2JC1A 3AVJA 1RT6B 4RW9B 4DL7A 4UQGA 2HHXA 2BQUA 3DM2B 4W5TA 2G8VA 2KZZA 4CEDA 2IJFA 1CZ9A 1Y97A 2BE2B 3MR5A 1VRTB 2WK4A 1QAJA 3I5AA 3ZSWA 5E41A 3QEIA 4CJQA 4CE9A 1T8EA 1HQEB 4FLYA 1X9WA 3KNAA 4CF9A 5HP1B 3BQ2A 3PUFA 3IS9B 2Z1GA 4RG8A 3M8QB 1LAWA 4F4YA 3I0SB 3VQPA 1HJRA 1R0AA 2OZSA 4CECA 2UUTA 4N5SA 4AHCA 4IOBA 3TAEA 4ELVA 4FXDA 1DLOB 4RNFA 1YVFA 2HNYA 5KG5A 4L8RB 3CJ3A 4EO8A 1S1TA 1JL2A 4PUOA 1BISA 4OGCA 2HVHA 3ZT1A 5KTQA 1JLFB 4ZTFA 5D3GB 3ZCMA 4KHSA 3PX6A 2DPIA 4FK4A 4CGJA 1TKZA 3NL0A 4Y1DA 5F8HA 3QGHA 1IM4A 2IGIA 3H98A 1WSEA 2C2EA 1KSPA 2PZSA 1S9FA 3OYBA 3ZT3A 3EYZA 1T7PA 4CK2A 4Q43A 3CDUA 1J5OA 4KB0A 4AHVA 3E01A 1CXQA 3NF6A 4F4XA 3VA3A 4M42A 1JLCA 3JSMA 5F8JA 3L2QA 3NGDA 4JS4A 1JXLA 4EO6A 3OYDA 1C1CA 1LV5A 3AA2A 4LH5A 4RNHA 3H4DA 5I42A 4Z0UA 1RT1B 4DL3A 4DU4A 2AJQA 1NHVA 3GV7B 2QV6A 3V9XA 1Z26A 4YQWA 1U4BA 2V0NA 3MR2A 3CJ4A 1BQMB 4RNOA 2WCXA 1WSFA 4DL4A 1RT4A 3LP2B 4IFVB 3VQ8A 3IGNA 4IG0A 2WONA 1ZTTA 3K2PA 4OLAA 4ICLA 2C2DA 1KHWA 4IRDA 2GC8A 4M94A 4I7FB 2G8FA 4C8LA 4ECWA 1D9DA 3P5JA 3CJ0A 4M3UA 3QEWA 3DRRB 4CJ4A 3T5HA 4FLUA 4E7IA 4DTJA 1HMVA 3CIZA 3HPOA 4KKOA 5KFKA 1C1BB 4FZXC 2XY6A 4E7JA 1S6QB 3CFPA 3NBPA 2QXFA 3QIOA 4NLYA 4DF8A 3HO1A 3QZ8A 2YHAA 3AVGA 3I0RB 2G8KA 2DPJA 4ZVFA 2HW3A 1LWFB 1RTJA 3MR6A 4G3IA 4H4MA 3IRXA 1S97A 4FJKA 4DTSA 2D41A 4EBCA 3V1OA 4MKBA 2VWJA 2HMIB 4CEQA 2XHBA 3V81A 1RTHB 4O44B 5F8GA 4DTNA 3MEDB 3DYAB 3OVNA 2B6AB 3E51A 5CYQA 4EP4A 3V4IA 2AX1A 2Z1IA 2X6NA 2ATLA 3DLGB 1W25A 2G8IA 1TL3A 3TANA 5DQHA 3V1RA 4E7LA 2UVRA 4TY8B 3LAKA 5KFIA 3MXMA 3OS1A 2XCPA 2IM2A 3RBDA 5KFTA 1C0UB 3MFIA 2IS3A 2FLNA 5F9NA 4DSFA 3QIPB 4FZZA 1EXQA 4ED1A 1JLGA 3SI8A 4Y1CA 1QTMA 4FYDA 2J6SA 3LP0B 1IKVB 3VN5A 3QGIA 2G8HA 4ELUA 3M8PB 3PJXA 3WNGA 4YR2A 1S9GA 3PR4A 4EYHB 3HXMA 2BDPA 4KE5A 3V6DA 2BQ3A 3L2WA 3DMJB 1NJXA 3T19A 2D3UA 3DRSA 2QK9A 4DF4A 3AA3A 3GV5B 1REVB 3DRPB 4U6PA 3KLEA 3ITHA 4IG3B 3TI0A 1U45A 1HYZA 2QKKA 4Q45A 2OZMA 2P1JA 4LY7A 1NK9A 1HYSA 3DM2A 3KHLA 4WYLA 3RTVA 4B9VA 5J1EA 4J9SA 3ISNC 1J9AA 2W42A 4Q0BB 1I6JA 3H5UA 4IKFA 1BQNA 3DLBA 2JLEA 3LPTA 1GOCA 3OYLA 4WE1B 4H4OA 2HNDA 4FCYA 4CERA 4KI6A 3QEVA 2C28A 4KHNA 3WNHA 3SNNA 4M3WA 3AVAA 1HQEA 1S0MA 5KFQA 1D9FA 4KAZA 2IM1A 4J2DA 3OHBA 4CIGA 3NH0A 3VQBA 3KK3B 3QO9A 4RZRA 3FQKA 3EZUA 3NMAA 5KFMA 4W5RA 5F8MA 1R0AB 2D0CA 2BRLA 5HLFA 1RNHA 1J53A 1TVRA 1TKXA 4FVMA 1SKWA 2UUWA 4M3TA 4I2QA 2Y1IA 5L9XA 4KB7A 3GV8B 3MXIA 2HNYB 5HRRA 1DTQA 1ZBFA 1S1TB 3V1QA 2JC0A 4PUOB 1GX5A 4WFXA 3PO4A 4IRKA 4CHQA 3MEEB 4CHNA 4JV0A 1MMLA 4Q44A 4DG1A 3DLKA 1N56A 3TABA 1QAIA 3V6HA 3AO5A 2RKIA 3RMAA 3RB6A 4MK9A 1B9FA 3SZ2A 3SQ4A 1TKZB 4K4WA 1JLQA 3KD5E 4FM1A 3QERA 4ECZA 3AVMA 4IH5A 2AWZA 4LSLA 4NLQA 2BANA 2PY5A 4TQSA 1TV6A 3PR5B 1JLEA 1HRHA 4N41A 4M41A 3TAPA 3E01B 4DMNA 1TGOA 3GQCA 1JLCB 1S1XB 3JSMB 4W5OA 2JEGA 3H5XA 3VA0A 1C1CB 4BACA 5I42B 1RT1A 1SKRA 4FJIA 1QUVA 1A5WA 2GUIA 3H40A 4CJEA 3K58A 4CJLA 1BQMA 4TY9A 4KFBA 4RUCA 3A2FA 1RT4B 5KFAA 4N47A 4Q8EA 1IKWB 3OYJA 2P5OA 3UR0A 2WONB 2R7YA 4ICLB 4KV8A 5DLFA 3KOAA 3I8DA 2ATQA 4Q5VA 3BSCA 3MECA 2B4JA 3OYKA 3CFOA 4B9SA 2RDJA 3M8RA 2YNFA 3DLEA 1JLAA 3SQ0A 4FJLA 4ED2A 3BQ0A 4ZVGA 4DL6A 3EPIA 1RT7A 4FLZA 3VQAA 3THVA 4H54A 4OL8A 3CFRA 3RBEA 4CJUA 3KLHA 5DG8A 3AVLA 1HMVB 4ZHRA 4ZMMA 5KFBA 4KKOB 1C1BA 3AVKA 3SPYA 1DTTA 2R2TA 4YNQA 3TARA 3NBPB 2EC0A 4NLUA 1RBTA 1JLBB 4PY5A 3OYNA 1RBUA 4NLWA 2AGQA 1RTJB 3HKWA 1WSHA 2KW4A 1NKEA 1VRUB 3QEPA 1D5AA 2FJXA 4C8NA 1U04A 5KG6A 4IQXA 3NGYA 5CYMA 4QOZB 3AA5X 3FFIA 4NLDA 4CFCA 3HK2A 5KFYA 2FJWA 1C0TA 4K8XA 1LW2A 3V81B 4ED6A 2IC3A 3KLGA 3K57A 4RW4A 3K5MA 3GIMA 3L3UA 5CYQB 3HYFA 4O0JA 3V4IB 4HCCA 4U7CA 3G6VA 4KI4A 4CIEA 4FBTA 1NK5A 4DSIA 1HARA 4B08A 3RR7A 1GX6A 4CFDA 3H5YA 1ZBIA 3IGVA 3AVNA 4YR3A 2DFEA 3U6FA 3FDSA 1C0UA 2HAIA 5JUMA 3V6KA 2W8LA 3TAGA 1ASUA 1Q8IA 3AO3A 2GV9A 3QIPA 3CO9A 1D8YA 3JYTA 4NYZA 4IR1A 1JLGB 3LP0A 3OLAA 2JEJA 3OYGA 3NGZA 4KTWA 3ZSZA 5HRSA 1KVBA 3QESA 2ITGA 4MK7A 1VSIA 3T1AA 1KTQA 4DQIA 1ZBHA 5EWEA 3V6DB 3Q8QB 4DEZA 2VG6A 3IN5A 4AHSA 3DRSB 3O4QA 2HHSA 3QYYA 1REVA 1KFSA 4BDZA 1KRPA 1YTAA 3KLEB 4Y2CA 3ITHB 5F8IA 1N4LA 1D0EA 3AV9A 3OYFA 1NK4A 1Q9YA 4XPCA 4DSEA 4FK0A 2HNZA 1NJYA 3RMCA 4E3SA 4QCLA 1HYSB 4DS5A 4E7HA 1KCFA 5J1EB 3O3HA 5C42A 4Q0BA 1WNEA 1BQNB 2R2RA 3HHKA 1TL1B 4QWEA 3CDWA 3L2VA 4WE1A 4H4OB 2HNDB 4QWAA 1HNVA 2HHVA 2OYQA 1RILA 1TAUA 4PQUA 1C6VA 1TAQA 5DK5A 4FW1A 4CJ5A 3HVAA 4O3RA 3KK3A 1C2PA 1KVAA 2OPPA 3QO9B 1ZETA 3QZ7A 2RDIA 4KHYA 4CHZA 1EETB 3HPGA 4QWCA 2RN2A 1RYRA 3O4NA 4IDKB 5KFEA 1BHLA 2E6MA 4QW8A 5HLFB 4I2PB 4CJKA 4CEAA 1TVRB 1TKXB 3BSNA 4I2QB 2W9BB 1HNIA 3RB0A 1VSFA 2HB5A 1DTQB 3VQSA 4NRUA 4M3RA 4KB1A 4J9OA 2KTQA 3MEEA 3QEXA 4ZP8A 2IBKA 4KAIA 4EBDA 4NRTA 3PW0A 4M95A 3N6LA 4NYFA 4AH9A 4YR0A 3QETA 4DG1B 3DLKB 3H5SA 3VQ9A 4LQ9A 4AHUA 2RKIB 4RNNA 3MTKA 2KZMA 4WFZA 1JLQB 5KFOA 4CGGA 2DTUA 2Q3SA 4LSLB 1SUQA 3N6NA 2BANB 1I3AA 1TV6B 4ZP7A 1QS4A 1S5JA 4CF0A 4XPEA 2WRMA 1JLEB 5DLGA 4TQRA 2OH2A 3MF5A 3OL6A 4FJ8A 1O1WA 2IM3A 1CLQA 1S1XA 3T5LA 4B8AB 2VG5A 5J2NB 1UWBA 1IKYA 1BI4A 3C6TA 3BDPA 3V9ZA 1ASVA 4R0EA 4DFKA 5KGXA 3BR9A 3K59A 3SUOA 4F4ZA 1SL2A 3FQLA 4KFBB 3L2RA 3SUQA 3MXJA 3C95A 2XGPA 1IKWA 3RMBA 1FKOA 2VWKA 2RPIA 3PVXA 2E9ZA 3LWLA 4KV8B 3HM9A 5KG3A 3PW7A 3MECB 3QNNA 3NH2A 2UVWA 2XCAA 2YNFB 3DLEB 1JLAB 1WN7A 2I1RA 2R2SA 1KVCA 3KMQA 1RT7B 3L2UA 4M45A 4WXWA 1JIHA 1GOBA 3LANA 3GYNA 4WXOA 4XIUA 4FW2A 2W9CB 4G1QA 3KLHB 4ZHRB 1SV5A 3KJVA 4GMJB 3Q8RB 1DTTB 3VQ6A 1EP4A 3F9KA 1JLBA 3ICLA 4KO0A 1GOAA 5F8LA 3SYZA 1NHUA 3PW4A 2F96A 1KLNA 1BCOA 2X6SA 3BGRA 3NKYA 4O55A 4HUGA 1YVUA 1VRUA 3MEGA 1U09A 4TN2A 3TAQA 3EPGA 1WSJA 5CYMB 2EHGA 4ECRA 3OYMA 3LAMA 1W9HA 3TR8A 3FFIB 3SV4A 5EU7A 3DDKA 1WNSA 5C5JA 1C0TB 4CHPA 1X9MA 1LW2B 3SQ2A 2IC3B 3KLGB 4IH7A 4QW9A 2D0BA 3EZ5A 1CSJA 4RW4B 4ZPAA 4RW7A 1S1WB 3KLFA 4F2RA 3ALYA 4C8OA 2BR0A 1XR6A 3UDLA 4CHYA 4K8ZA 1NKBA 4B3OB 2HHTA 3BJYA 2HHUA 1CXUA 2EX3A 3AVCA 3I5BA 2F8EX 3PX4A 1YTUA 4DFMA 4O5BA 4GC6A 4BDPA 3P1GA 1X1PA 3JYTB 2UVUA 4TYAA 1BCMA 1ZBLA 4TSXA 3PJWA 4CJVA 4IBNA 4CIFA 3UQSA 5HROA 4F50A 3SQ1A 3L3VA 1TKDA 1TP7A 2B5JA 5HBMA 4Z4GA 1BIZA 4ZTJA 3V6JA 2X78A 4CHOA 1TK8A 2O4IA 2VG6B 3O3GA 1XC9A 4BE0A 4K4ZA 2OPRB 2V9WA 1S0NA 5KT5A 3PW2A 3SFGA 3RMDA 4PWDA 3LWMA 4E0DA 1VSEA 4B9LA 3RRGA 3PX0A 4DS4A 5DQGA 2HNZB 4DL5A 1XHXA 1T05A 3AVFA 4OKJA 3KLVA 3G6YA 5C42B 4DL2A 2VA2A 3GILA 4NCAA 1TL1A 3SV3A 2XY5A 3HP6A 1IH7A 4WZQA 1I39A 3NE6A 2ILYA 4URGA 1HNVB 5SWMA 3MFHA 2YKNB 4J9KA 1K6YA 4MQ3A 4ECYA 4FLWA 4PQUB 5EWGA 1BIUA 5KRSA 4RW8A 5KT2A 4DTMA 2OPPB 3S3OA 3HVWA 1EETA 5KFNA 1ZBUA 4IDKA 3ZSVA 4ELTA 2PYLA 5C24B 4KPYA 4NLOA 2PYJA 4I2PA 1RDAA 4Z4CA 2YNIA 3L8BA 2AX0A 2W9BA 4URQU 4FJ5A 1HNIB 4CGFA 3DI6A 1S4FA 2W8KA 2ILZA 2OA8A 2QE5A 4DTRA 3LPUA 4Z4EA 4YP3A 3S3NA 2WTFA 4C8MA 3VQDA 1B92A 4I9QA 2UVVA 2YV0X 3NDKA 2G8UA 1MU2A 4MIBA 3T5KA 4NLPA 4JRPA 4XO0A 2D3ZA 3HPHA 4EP5A 4KBIA 1RTIA 2Z1JA 3HP9A 2FC0A 5FDLA 1SUQB 3M8SA 2LSNA 4KTZA 4NLRA 4AHRA 2FLPA 1T3NA 1RAJA 2IJNA 4K4YA 4GW6A 4IFYA 2HWIA 2JEFA 2XY7A 1JXEA 5I3UA 2I5JA 1SH0A 1NNDA 1A5VA 3QGGA 1SH3A 2VG5B 5J2NA 1UWBB 4OKEA 1SL1A 1IKYB 5J2PA 3C6TB 1BI4B 3T3FA 4DFJA 4FJJA 3LP3A 5J2QB 1SH2A 1HPZA 3V9UA 1ITGA 5KFJA 2YHBA 4DSJA 3PV8A 1N6QA 1FKOB 3CYMA 4QAGA 2WB4A 4HHTA 4RW6A 2B43A 4JUZA 1XHZA 4DFPA 1KHVA 4TXSA 5KFHA 2A1RA 2HHWA 4HYKA 1VSHA 3LZJA 3SUPA 1QE1A 2KQ2A 2YKMA 3NF9A 1N48A 1RBVA 3CQ8A 4ZP6A 4GVMA 3RWUA 4FJNA 2W9CA 2XO7A 1N5YA 2R8JA 3OJSA 3SCXA 4FJ7A 4G1QB 4MH8A 4FLXA 4M3ZA 1SV5B 5L1JA 1S1VA 3DOKA 3KJVB 1XR5A 1VSDA 2NUBA 1EP4B 4FBUA 4CF1A 3H2LA 3PW5A 3HL8A 4KO0B 2ZKUA 5KFFA 4EZ6A 4NLVA 1TKTA 1FXXA 3AVHA 4CFBA 4PA1A 4DQQA 2IDOA 1HYVA 1X9SA 4OVLA 3BGRB 3UPFA 4R5PA 3NAIA 4MIAA 4BDYA 1RT3A 3MEGB 2KFZA 5K14A 4O3PA 3ZT0A 4KHMA 4IRCA 1C0MA 4K4XA 3VQQA 4R8UA 4OPJA 4FJXA 3QLHA 3N6MA 4E89A 1VSLA 3OS2A 1RA7A 3UIQA 1VSJA 4WZMA 4JV1A 1T94A 4RW7B 1S1WA 4JLHA 5KGWA 4M3YA 3KLFB 4QWBA 1JKHA 3OYIA 4B3OA 3SPZA 4B9MA 1SKSA 2ASLA 2IM0A 5HRNA 2O4GA 4ECVA 5KT3A 1C1AA 4NLGA 1QSYA 3H59A 3CM5A 3TVKA 4K4SA 3IG1A 3AA4A 3OYCA 5KFUA 2G8WA 5HROB 2FBYA 3VQ7A 4DQPA 1ASWA 4ID1A 5L1IA 3OSPA 3OLBA 1RT5A 5L1KA 4URSA 1S9EB 2FLLA 2B5JB 5HBMB 3KIOA 3HVTB 4W5QA 1RDBA 2OPRA 3SI6A 5CZ2A 4F4WA 2WOMB 4WYWA 2AGOA 4PWDB 4O3NA 4IH6A 3OJUA 4F3TA 3ZT2A 4NCGB 1T05B 3SFUA 4E1NA 3OL9A 5HRPA 4OGEA 2KFNA 3ZSYA 4NYNA 3M9OB 3D28A 3D45A 4CJRA 2W7OA 4OLBA 2C2RA 2BQRA 5FROA 1L3SA 4FJ9A 5FRMA 3K5LA 2J6TA 2YKNA 4ID5A 4TYBA 4KREA 4LSNA 1S6PA 1WSGA 2ALZA 3G0ZA 2D5RA 3VQ5A 4FS1A 4RW8B 4O3SA 3Q8SB 2Y1JA 3CDEA 3WNEA 5C24A 4DTUA 1WAJA 2P51A 1LW0A 2XI3A 2YNIB 1UOCA 1D1UA 3HJFA 1RDCA 1W0HA 3DI6B 3QNOA 3RAQA 2IAJA 4NZ0A 4DTXA 3DLHA 2ZQBA 3TAMA 2OPSA 3TWHA 1FK9B 4EZ9A 1HQUA 4KHRA 1MU2B 4W5NA 2DFFA 4J2AA 5FRNA 3AVIA 1RTIB 1BGXT 2GBZA 4CF8A 3KLIA 2E9RX 4OPKA 5FDLB 3LP1A 4NLXA 3OYAA 1KFDA 4N76A 2FBVA 1SL0A 1VK0A 2ZD1A 4IFYB 5I3UB 2I5JB 3VQ4A 4O3OA 2YNHA 4F8RA 1ZTWA 2FBXA 4ECQA 3I5CA 1G15A 2E4LA 3U3GA 3OSNA 2IOCA 4ZPDA 3S9HA 1S1UA 4H8KA 3LZIA 5J2PB 4FZYA 1VSKA
chains in the Genus database with same CATH superfamily
3HMJG 2CQGA 3L4BC 5JXSA 4ATNA 3FFKB 1LWEA 3UKUA 1HPZB 1QLNA 4J2EA 4CJPA 1NZ8A 1KLMA 3WX4A 1RAIB 4E1MA 5H9FK 4CEOA 1TU0B 4Z4FA 4RW6B 3PXGa 4B9UA 2ZWHA 4CJ3A 5H1SQ 4ZP9A 4CJFA 3G4SS 2NR0A 1WB9A 2AJ4A 3EO3A 4NZ6A 5IM0B 1QVFM 4BE2A 2MZ1A 3EGZA 3WEEA 1G7CB 4DUYK 1NOZA 2HHHF 2YKMB 4ILRA 5IT0A 4JI8F 4F3OA 2JRSA 1YJWN 1LXNA 2AEFA 4QWDA 3JB9k 4Z4HA 2CVIA 2GIRA 1YQHA 1FJ7A 2ZITA 3O1BA 4WQ4A 2E2QA 1NNEA 3T69A 1TL7B 4I56A 1LWCA 3CJ8A 1UAXA 2DNKA 5HI7A 1X8DA 2I8EA 1RUSA 3KKSA 3D2EB 2FQQB 1RTDA 4OI4A 2CQ2A 1X7VA 2Y8YA 4FPAA 3A4TA 2KRRA 3ASMA 5CY4A 1NSAA 4IO8A 2GX9A 1XMQF 2X7IA 5F9LA 3C6AA 4ED7A 4R8UB 4MKYA 1NK8A 4OZLA 2H3GX 3W0LA 3I9ZA 2ATCB 3BSOA 1NLVA 3VEWA 4NLSA 5AQZA 5D0RA 2VL1A 5F1XA 1JKHB 2FY1A 4CJWA 5H1SV 1YIJN 2O5DA 1BWVA 3K5PA 5FPDA 1E6VA 3MM6A 4DN9A 1B0VA 4V19X 2L41A 4J9PA 2XMMA 1EKEA 2KT3A 2YI1A 3G9CA 2BMBA 3SUNA 4RU9A 3AO4A 3LL3A 4CK3A 5A0YB 1FWLA 1RHQB 2F65A 3ZX3A 5KFSA 1P9QC 3HVTA 2R8IA 4UUXA 2CG4A 3N9UC 4Q7AA 3OR1A 3D6TB 2POKA 3KTQA 2WOMA 5BJRA 2VOPA 3V5RA 1HD1A 3F73A 1UA0A 4HVJA 3AB2B 4NCGA 3CSKA 3BREA 3NOCA 4Z37A 4J9MA 1BQXA 4YFUA 5IOLA 4DV4K 2C2NA 4DBQA 3HFKA 4GO7X 3B6OA 1S6PB 1RISA 3BZKA 2NSBA 4FYXB 2EFGA 5AJ3J 4Z7CA 4DR3J 1HI1A 1WI6A 4M5DB 3O5TB 2A41A 1X4FA 2AZ3A 5KG1A 1KVIA 4A8XA 4WPAA 1RBOB 4HT5A 1VGYA 1HWLA 1TK5A 3SAGA 4AHTA 4EUVA 3KMSA 5IFMA 2R8KA 2AJ1A 2A0FB 3IS9A 5FIIA 3VOVA 3OTOF 4LFBF 1GAOA 1DBDA 1XMOJ 2RE2A 5HL7L 5EY4A 4NCBA 4OI0A 3EE3A 2JWLA 4WP9A 3QINA 2OPSB 4FO0A 4FLTA 5B0CA 1WELA 3NGIA 3ZEUA 2E7XA 2KHCA 2DCUB 2D0AA 3G4SN 2M0GB 4ZPBA 3M9NB 2W9AA 4ZVSB 2ASJA 2HZVA 5AQPA 3LDQA 3PO5A 1M1GA 2JFDA 4EU0A 2HRYA 3SMPA 1OS5A 1X5OA 3KLIB 1T3OA 3ZXWA 1X4BA 4DSKA 1LAVA 1QD1A 4RUBA 4O4RA 1SKUB 4K7QA 4ZS6A 2YWGA 2EFOA 4IEEA 4ZJQA 2WW8A 1JJ2M 3TVYA 4KTQA 4OZJA 3K9JA 4AUKA 2LKZA 1YUWA 4ILGB 1RDDA 2WB1D 2BJ1A 4DCJB 3OW2R 1N88A 1IBMK 2O67A 3OVSA 5KRTA 1P8GA 1RWPB 2B0GA 3QFPA 1FWKA 2MZTA 3RB4A 5KFCA 3T5JA 4F4KA 2GIQA 2J6UA 5CZ1A 4TNOA 5KOWA 3NNCA 1Z4UA 3RRKA 1OVYA 2W2NP 5T7LB 1KQSM 3EVWA 3G6XA 4USIA 4OX9K 5C2CA 3HTVA 3ISND 5L46A 3P49B 3V9WA 4IG0B 2QLJB 4WTYA 2XC9A 4C8KA 5EUHA 2CZ4A 1OH5A 3OY9A 1CULA 2V52B 4Y3CA 1T03B 5L1LA 2YNGB 3HT3A 2RQ4A 1RT2B 3MHYA 1NOYA 2UZAA 3BSAA 1XI1A 1JQGA 2CXEA 2YWHA 3ZSOA 2H65B 2HSTA 4EEYA 3G86A 3CVKA 3NF7A 2BOPA 4DV2F 3QIDA 2E9TA 1A6LA 1S6QA 5L38A 4MAKA 1RXOB 4ILMA 1V4SA 2NCKL 5C25B 2ZZMA 3I0RA 2CJQA 4DQRA 4HTUA 3H8YA 5KFXA 3VALA 4CZGA 4P74A 2H5IB 4MK8A 3G8QA 4FYWB 4QPXA 5KOXA 1HLWA 2OPQB 3TUPA 2GQ2A 4LD0A 3C16A 2HMIA 3N5BA 1L3VA 2HVIA 5AQRA 2RE1A 1T44A 1FKPB 5GINA 3HZ6A 2CRLA 4O44A 1CZAN 3DN9A 1YF5L 1VQSA 2A1SA 2YY3A 4KPCA 3FEXB 5KG7A 4BC5A 3OXFA 2CQIA 2N4DA 3DLRA 3GIIA 4A5AA 2DR9A 3AGKA 4TY8A 3S3MA 2Y0BB 4ED3A 4WCEL 5HATA 2L9WA 3Q89A 3VVTA 3PHEA 4DV1F 1TL4A 1RCHA 2RF2B 2AV5A 3RJMB 2JWNA 1CS4B 4A61A 2UUCK 4IR9A 1R8HA 1EQYA 2BABA 2V4QA 4HTJA 3NFAA 2Q3PA 1SVDA 1Q1KA 2P6TA 5KFLA 2HBLA 4O4GB 1VQOS 3I8BA 3DRPA 1WDDA 2VBWA 3M8ZA 4PPZA 4U67Q 3ZC4A 1WSRA 1QVGM 1S5ZA 1NDKA 2J0WA 3ZZRA 3O3LA 3GP9A 2BQUA 3DM2B 1QZ6A 3U27A 1LFPA 4ES2A 1DRZA 2G8VA 4CEDA 1Y97A 2QWPA 4LF4K 1OSDA 2NXUA 4BLGA 3MR5A 1VRTB 1TFYA 1QAJA 1RWKB 4LF2A 2E2OA 3QEIA 1VBYA 3NWGA 1HQEB 1NGAA 1ICEB 1X9WA 3KNAA 4FLYA 3IKMA 3R7SB 1H72C 1GXUA 4YDXA 5HP1B 3PUFA 3MD3A 3KWIA 5C15A 3HI9A 1LAWA 2UXBF 4GV3A 3I0SB 2KM8B 1W2BR 2OZSA 2C3OA 4CECA 3VEZA 2Y9HA 3TAEA 1HW9A 1DQ8A 4FXDA 1X0FA 1YVFA 3CW2C 3OBIA 4EO8A 1JL2A 1FDDA 4TU9A 2HVHA 1NMDA 2H5JB 1RB0A 1JLFB 4U96A 4KHSA 3PX6A 1YBTA 2GW8A 4FK4A 5DDOC 4PCQA 3B8AX 3OPKA 3MURP 2IGIA 2DHGA 2C2EA 1RCXB 2COLA 1S9FA 2VGNA 1VDHA 3MMJA 1T7PA 4AQYF 4AXJA 8ATCB 3RW7A 3NF6A 3ZTSA 5BR8F 3L2QA 2LA4A 1JXLA 4EO6A 3OYDA 4LH5A 1FRHA 4JI7K 1ROFA 2V2KA 4KJIA 2BJ9A 4DL3A 4DU4A 1NHVA 2N3OA 5AQJA 2BE7D 1WOQA 5T7LA 4ZLJA 3CGIA 4CZLA 3MR2A 5AXLA 2WCXA 1RI7A 1WSFA 1HIYA 3TSUA 3LP2B 4HEA9 1VQ8S 4IG0A 2B56A 3SMSA 3NS5A 4ANEA 3J8AA 1KHWA 3GPAA 1NO8A 4Q2LA 4DQ8A 3AB4B 4M94A 2Y1LB 4NL5A 1KQFB 4C8LA 2G8FA 4ECWA 2DT9A 4OLOA 2ASYA 4M3UA 5LMUF 2IY5B 4M63A 1ZM4A 4CJ4A 1R59O 1NJIT 5IT9U 4FLUA 3TQEA 4YEAA 2ZM6K 2LMIA 3TZXA 2XY6A 5IS2A 3BV8A 4NLYA 3IWXA 2QWLA 3QATA 3GCWP 4DV6J 1IBLK 1FE0A 4RJVA 2P9LB 4USHA 2Z57B 1RADB 1RTJA 1V4TA 3PRDA 1S97A 2D41A 3QMQA 2IHR1 2QI2A 1VQ6S 2RQKA 2WVCA 5AR0A 4FOEA 3GTYX 4QIEA 3IXQA 1VQON 2MQLA 3V81A 5F8GA 2F40A 4NB4A 4QR2A 3E51A 1QQOA 4CO3A 1UZHA 2Z1IA 2X6NA 1IJJA 3DLGB 1W7AA 2E29A 5AQSA 3EKUA 3L7OA 5J1NA 3ENWA 4DUZK 4FF3A 5KQ8A 3W8PA 5B09A 1KONA 2F8HA 3B4MA 3MXMA 4CP5A 3RBDA 5GAHU 4BY9C 5KFTA 3TUZC 3MX5A 3NNAA 3MFIA 2IS3A 2C3UA 1U0SA 2PI4A 2X1BA 4A2BA 4Y1CA 2J6SA 3MR7A 2P9IA 3QGIA 3ZZZA 2G8HA 2Q2RA 1P1TA 3S6EA 2AJ2A 2BACA 3I4PA 3PJXA 4EIAA 4YR2A 2R7XA 3DU5A 2BDPA 4DV5K 4KE5A 1FT8A 1X0PA 1NJXA 3T19A 1JB0C 1K0VA 1PJ5A 3F0NA 2DHHA 3GV5B 3A13A 3AA3A 4DR7F 2DHXA 4U9RA 3E9OA 3TI0A 4GV6A 2P9EA 1RAHB 1KXPA 2QKKA 2DB1A 4J90A 4UZBA 1HYSA 3DM2A 1N36J 4X4NA 1GXLA 4WYLA 4WCEQ 1YWXA 3H5UA 4HVZA 3LPTA 1DARA 4QS8A 1FJGF 2HNDA 4KI6A 3LDNA 3WNHA 4M3WA 3KXDA 5I9EB 1HQEA 3IFRA 3R3TA 5KFQA 4WU2A 3CE8A 1KR4A 4J2DA 3A3OB 3OHBA 2VCPA 4C8ZA 3VQBA 1DURA 2VHGA 5B0AA 1HR0K 3KK3B 4W4MA 4JI6F 3QFUA 2HAFA 2WAQD 3EZUA 4JI3F 5KFMA 4W5RA 2BRLA 4A57A 3H20A 1CQNA 1SKWA 2UUWA 4U7UK 1VCTA 2YVSA 5L9XA 3H2VE 1DTQA 5HMYA 1S1TB 4N8NA 4PUOB 3DXMB 4M5IA 4A62A 1VQ8N 3O4WA 5BN9A 4X4QA 2KVIA 3V6HA 3RMAA 3SZ2A 3SQ4A 5DRKA 4K4WA 1JLQA 3KD5E 5LSRA 4FM1A 3QT8A 2V63A 2AWZA 1V3SA 1VRQC 4CM0A 1HRHA 3TAPA 2NZCA 4H8KA 3E01B 2K3KA 3GFZA 2B7BB 4DMNA 5T41A 5GAHI 3JSMB 3DLJA 3H5XA 3VA0A 4RUHA 4UY85 3C7NA 3D66A 3L7PA 4BACA 4FJIA 2BJ8A 1A5WA 4NI2B 2FB0A 2DGVA 4CJEA 3K58A 2AEJA 3ZTRA 5C10A 3A2FA 2E20A 3Q22A 2R7WA 4Q8EA 2P5OA 1VQ6N 2W40A 1ZAVA 4KV8A 4Q5VA 2LA6A 2QC3A 2B4JA 3D2FA 4LRBA 2CFXA 3DXSX 4ED2A 5B08A 2WSEC 1YRTA 4J5OA 4A8OA 4Z94A 3THVA 3LM2A 4H54A 4OL8A 3QT6A 2E66A 4X4OA 1X3NA 2HHHK 1SZ2A 3RBEA 2P9SB 3KLHA 2ASPA 4JI8K 1OY9A 5KFBA 4JI1J 2A18A 3VV2B 3AVKA 3NBPB 3LUYA 2EC0A 4NLUA 4PKDB 3OYNA 2QWRA 1RBUA 2WUSA 5DETA 4BROA 4OHVA 1UEVA 2KU7A 1YXQA 3TWZA 1NKEA 1T02A 1XNQJ 2YH0A 4C98A 3NWRA 4PG5A 4WFAQ 2IBOA 4F26A 4C8NA 2EFPA 3NGYA 1XMQK 4A8WA 3HK2A 4CLWA 1WEXA 2QWOA 4TVAB 4TU8A 3L3UA 3BH6B 3HYFA 4HI2A 3G6VA 3CCJS 4CIEA 2HFSA 3RR7A 1N0UA 1FNMA 1ZBIA 5KQDA 2P5VA 3AVNA 2R42A 2VOOA 3U6FA 4QYRA 1Q8IA 4K25A 3R2CJ 3CO9A 2DGSA 1RE1B 2CWKA 5K20B 2V68A 3VPZA 9ATCB 1U6ZA 4DPYA 4BR0A 1MNEA 1QUPA 2YKOA 5I4MA 3NGZA 2ZC4A 2O8FB 1KVBA 1GLLO 2HQ3A 1U02A 4FF4A 4CTAA 3UE5A 1AFJA 4DEZA 3M1VA 2WBNA 2GVDB 2ZJRL 1FO1A 1KVKA 1YTAA 3CHWA 5D78A 3W9IA 3ITHB 5F8IA 1N4LA 4U8VA 4X62F 3I6PA 1Q9YA 4C1NI 4U8YA 5BYSA 1ZAWA 1ULRA 3RMCA 4QCLA 1G4CA 2FC9A 3UVJA 4E7HA 3JAMO 1R31A 1BQNB 3WX8A 3SBGA 3CDWA 5C0YA 4CZHA 4B1WB 5AQIA 1MN9A 2OYQA 4KHPJ 4HDHA 1TAUA 5AQWA 1PJ6A 4DV7J 4FW1A 3QFHA 3KK3A 3UDCA 5JVGL 1RWMB 2OPPA 1ZETA 1NLKL 2WFBA 3JTOA 1Q16B 4CHZA 1EETB 3HPGA 2VPXB 1RYRA 5KFEA 1BHLA 2JSXA 1U1KA 3HT0A 3VMFB 4CJKA 1TVRB 1TKXB 3BSNA 2W9BB 2V9KA 2CNLB 4KB1A 3DXMA 3OTOK 4LFBK 2KLAA 1BUXA 4KAIA 2ZHAA 3PW0A 2RRNA 4B3MF 3O8WA 2EWSA 2XMVA 4AHUA 2B9WA 2DPNA 3CIPA 3IR7B 2DTUA 2Q3SA 5JLFA 4LBPA 3N6NA 2Q6BA 2QT7A 1TV6B 2FSNA 2W2OP 4F3MA 5DLGA 5J1PA 2HF4A 1F60B 2OH2A 4HR2A 3T5LA 3EXYA 4LSZB 4DR6J 4RL1A 4JI2J 1IKYA 4NO7A 2MEWA 3HJVA 1S72S 4C4WA 3V9ZA 4R0EA 1PILA 2J76E 5KGXA 2DD8S 5BN8A 4F4ZA 3VGMA 1V5VA 3SUQA 2CPDA 4X4UA 3C95A 1WKJA 1FKOA 3M2UB 2VWKA 1CEZA 5CZVA 5DM6L 2EWHA 2J9DE 5KG3A 2HQCA 2QWQA 3MECB 3QNNA 3NH2A 3P96A 3MTJA 3DLEB 1OVQA 2I1RA 3MM8A 1WG1A 3T41A 5E84A 2WVBA 3CCJN 4BRDA 1JIHA 4WXOA 3GYNA 2OANA 1FESA 3BS9A 2Q79A 2M88A 5HK4A 2GHPA 1UPMB 1VQ7S 2O3DA 4F0MA 2HPUA 1VQ9S 3C65A 3Q8RB 2BTFA 1DTTB 4UZCA 4PXEA 1EP4A 3F9KA 3PKMA 2MTLA 2R7RA 3FBBA 4CLYA 4DV3J 3KFWX 2QA1A 3SYZA 3J7ZO 3FE1A 3FCVA 1KLNA 4WYBA 3Q86A 4P2XA 4HUGA 4EHUA 1YVUA 4DV2K 1U09A 2EVZA 3MM7A 2ROEA 3WXKA 4FF2A 5F0UA 5CYMB 4ECRA 3OYMA 1W9HA 2KRBA 3RBXA 4H0XB 3FBEA 3ZX0A 5EU7A 1WNSA 2DEIA 5C5JA 4CHPA 2C2MB 3J7YI 2V7YA 1CSJA 4RW4B 4ZPAA 2E2PA 3GDQA 4BVPA 4CH7A 3TX0A 3LPEA 4C8OA 5B0DA 1ACMB 3UDLA 3CJAA 3P38A 2MKJA 3BJYA 2O8EA 2KL8A 3CB4A 5ETKA 1BDGA 3I5BA 2F8EX 4LFAF 2GTDA 5LMNF 3D4JA 2ZH8A 4NA1A 2PFDA 4JHDB 2ZJPL 1X1PA 3JYTB 4Y0WA 5JMVA 1UVLA 1X4GA 4TYAA 1ZBLA 3PJWA 5AQVA 4NLCA 1AYEA 5ETOA 2C2OB 2DHAA 2HBMA 2Q31A 3V6JA 3ZX2A 4LF1A 4MTPA 3O3GA 5H9EK 3HCXA 2JLGA 4LF9J 1S0NA 3T9ZA 4X64J 1UVNA 4B9LA 1LFWA 3M6WA 2HNZB 1WC6A 4Y65A 4YB6A 1NMEB 4LF7K 2CAJA 2R7UA 3U9ZA 4ZOSA 2VA2A 3GILA 5AQMA 3HSZA 1Q81O 3SV3A 4BRAA 2G2OA 3MMAB 2K1RB 4URGA 3PIPL 1WHWA 2FD2A 1K6YA 2CGJA 1YBUA 1DAXA 4JKAA 4MQ3A 2W1BA 1EQ0A 4PQUB 1OPZA 1UW9A 2VYPA 3JAMY 3VEXA 3TZZA 1IJFB 5KRSA 1OH7A 1RHUB 5IV4A 4ALZA 3VAJA 1EETA 1ZBUA 2ZJRQ 5CR4A 5C24B 3ET6B 1S72N 4Z4CA 2YNIA 3W66A 4WFNL 3AAQA 2NUHA 2W9BA 3B4DA 4I1TA 1HKAA 1MWMA 4X66J 5EHHA 2UXBK 3UNGC 1X4HA 4M5HA 3LPUA 3JSRA 1OKJA 1B92A 1K47A 3VEOA 1MU2A 2O8BB 2KHDA 3TO8A 1UMJA 4H03B 1XNRF 4EP5A 3H2UB 1D09B 4IO9L 1VQNS 4YUDA 5FDLA 3M8SA 1W26A 2FLPA 1R8BA 2F4VJ 4K4YA 4GW6A 3W2VB 3AOBA 2VFTA 3N4PA 2JEFA 3HHEA 1VQ7N 4S0MA 1JXEA 5I3UA 1VQ9N 1SB6A 2W24A 3QPIA 4YB5A 1AA1B 4FYVB 4LR9A 1SL1A 3W9JA 4CZIA 1DFDA 1SH2A 4DDFA 3V9UA 1ITGA 1M90O 2YHBA 1FRKA 3AHPA 3O6WA 4RBTA 5EOYA 1N6QA 5BR8K 2F63A 1R3NA 3MAAB 5E5NA 3HHNB 1OY6A 1WOSA 2LDYA 1ZOTA 4RWXA 2RRAA 3EVOA 5DZ7A 3NGUA 3LZJA 3DKDA 2B4PA 4B3TK 1H2VZ 2VPWB 1HBNA 1FE4A 1RBVA 2EPIA 4ZP6A 3RWUA 4ES1A 3GR0A 3ULEA 3SCXA 4FJ7A 3BF1A 4B17A 2HBJA 1EWRA 3CPEA 4PKGA 3DOKA 3QWUA 2NUBA 1PSDA 4DR4J 4PXBA 4CF1A 3H2LA 3HL8A 4KO0B 5KFFA 4EZ6A 1FXXA 1QHAA 4DQQA 5DM6Q 3O9UA 4OVLA 8AT1B 3BGRB 4JI4F 3BGFA 3NAIA 1RT3A 3MEGB 1RSCA 5K14A 1CJVA 4KHMA 4K4XA 3HHDA 2YXLA 2E1AA 1OQ6A 3THXB 1A0OB 4E89A 1WF0A 1VSLA 2BKPA 4U7UD 4WWSA 2ERRA 4JV1A 2QL5B 4FXWA 3W3DA 1K8KA 1CJUB 1ZH5A 1AZSB 5KGWA 4M3YA 1HJOA 1AB8A 2CPIA 3T7ZA 2OD4A 1DJ0A 4ECVA 2NRWA 4BR7A 1SI9A 3THYA 3S7RA 1SAZA 2CQ3A 3C14B 3AFGA 3P45B 3H59A 4C0BA 4DUTA 5A8RB 4KQZA 2DNPA 3O8MA 1VR6A 2G8WA 2FBYA 4JI0F 3Q23A 3LOUA 5L1IA 1Q79A 2CG8A 3C2PA 3EE9A 3U4LA 1RT5A 4PXDA 1BG3A 4J91A 2VF3A 4CBWA 4W5QA 2MQMA 1R89A 1RDBA 2FSKA 2P9UA 4M5KA 1E3MA 2FDNA 4BGBA 2VPYB 4WYWA 4O3NA 5MLCQ 3U02A 5CQGA 4F3TA 2B4VA 2RHQB 1NRKA 4OGEA 3D28A 1UWAA 2ZJPQ 2HG4A 4DR7K 3MMAA 1VQNN 1L3SA 4PYAA 4ID5A 3BF4A 4KREA 4ILLA 5BPNA 3VQ5A 3ULHA 3NP5A 1FTCA 1J2VA 1LK7A 1U8WA 1LEOA 3CCZA 1T9WA 2M8DB 3ENBA 4MJKA 4LF6J 4YB1P 5C24A 1FJGK 2ABYA 2HOEA 2FZGB 3FCHA 4A8KA 3HJFA 1UOCA 1FNOA 2HS3A 2H54B 1ZZNA 2HWTA 1KAZA 3DI6B 3RAQA 4NZ0A 2MZSA 4DTXA 4JI3K 2DIUA 3DLHA 3TWHA 3M2VA 2E1YA 1SQEA 4BRMA 1EO1A 3FEYB 3CNQP 2M3DA 2V34A 4RBVA 3H1VX 2PEBA 2YBVA 2XYHB 5MLCV 3CDAA 5LJWA 4OPKA 4N76A 3OYAA 2BUNA 4FWLA 1JCFA 1SL0A 1C0FA 4IFYB 3J7Z5 3ZO7A 4YHHJ 5EVZA 2OLWA 4WK1A 2GWJA 2YNHA 2FBXA 3KYLA 2H1YA 3MWPA 3U3GA 4H5RA 4FZYA 5DG7A 4CLKA 5CCLA 1LNQA 1B0TA 2H4YB 5IQ6A 3VETA 4TLQA 3VQCA 1E6YA 2GAGC 2IIRA 1VQMS 1VFJA 1VBKA 3OYHA 5DM7L 2D1KA 5AZIA 3W3SA 2CNKB 4KH6A 1NAQA 2XWXA 3BGOP 1MROB 1RBRA 1NMNA 1J54A 2XSJB 4EMDA 1Z25A 4IO9Q 4O5FA 2QYCA 3MPUB 4OYXA 3THPA 5GAEI 1U1RA 2XMKA 2XS5A 5IWAJ 4FVCA 4IQMA 3R1XA 1F6TA 4W98A 2HFZA 1QE1B 3GE9A 5LOQA 2YPZA 4ZN1A 3KHHA 1QSSA 3PIOL 2EG1A 3KK2A 4H4KC 1NK7A 2JVOA 4H0VB 1S1VB 4TU7A 1N33F 5ETPA 2FVSA 1HBMB 4RNMA 1TKTB 3MAQA 1BA0A 4CGHA 4ERDA 2FVCA 3THTA 3DFEA 2ZBIA 5DDQC 4R5PB 2XI2A 1FW6A 2L48A 3GIJA 3CCVS 4CK1A 2E2NA 4OHYA 1I94K 4Q8FA 3C6UA 4CEZA 1N34J 4RUAA 3UCZP 3K5NA 1VQLS 2R7TA 5BXIA 4DXLA 3NVMA 2MMYA 1VLYA 3KD1E 1CJUA 1AZSA 1K1QA 4DR5F 3MDFA 4OI6A 3OBYA 2ZE2A 3PY8A 2NRVA 3FRZA 3CJKA 2IFXA 2XMJA 1HNXF 4KGVB 2VG7A 3KKRA 2P5GA 2R2UA 2Q0UA 3TRGA 2EEYA 1S99A 4ZIVA 1XJWB 1FJEB 4V1Ak 5G4DA 4OV6A 3PYFA 4OZ0A 4J9NA 4DLGA 2J8SA 1UP1A 1TELA 4K0KF 4L3NA 4KT0C 3F2KA 4ED8A 4J8FA 3DOLA 4FM0A 2YKAA 2HBYB 4RU2A 3MCMA 1TUUA 3BO2A 3M32A 1NG9A 2D3O1 2XLIA 3CCRS 4HHJA 1IO2A 3MUTP 2A6OA 1UVMA 2KB2A 3CJ5A 4F67A 1RWWB 1IR2A 2YJFA 3CCTA 3O80A 3OL7A 5KT7A 4RW9A 1RWNB 2NNWA 3R9LA 5F3TA 4Y34A 4LSNB 1X4AA 5EDWA 2X3DA 2AU0A 2C3PA 5BPMA 1NXIA 1MMNA 4R0JA 4V19S 4F2SA 4E19A 3DGPB 2YCHA 3A5OC 3DXKB 2XG8A 4MDAA 3DU6A 4M5GA 1WOPA 2JX2A 2BJDA 1XEZA 2JLFA 2OJ3A 4DR1J 4DCPB 1QHTA 1OYDA 1VQMN 3ZSRA 3C46A 5JS1A 3M8QA 2NYHA 2DFHA 2IAJB 3GU0A 1SQKA 4ECTA 4ZPWR 3TAMB 1G2EA 3HVRA 3DOMB 2XLKA 4IOXA 1HQUB 1DLOA 2HGLA 1R6YA 3LDOA 3T1HJ 2X74A 1O0PA 1CJKA 1RHRB 3LP1B 4ZPCA 2VGMA 1KTVA 4B3MK 2EK6A 2K7KA 3R5DA 3LDLA 3VF0B 2BJ3A 5E3QA 2V7ZA 2NXNA 4IFEA 4JK9A 3AGRA 3CJRA 3EGNA 4CJSA 3O3FA 5KFRA 1BL3A 3H08A 2M4MA 2DNQA 4LF8F 4JKCA 4N56A 2IYGA 4F7VA 4FDFA 1S0OA 1J5OB 4IWVA 3CWJA 2KDOA 4JV5J 1RFQA 2DITA 1N54B 4ID8A 4OI2A 2E5LJ 3ENHA 1URNA 1EX4A 3CCVN 3RR8A 3EY1A 3AT1B 3FMWA 3G10A 4Z4IA 3NVKA 4L73A 1QSLA 4DSLA 1VQLN 2GJFA 3JQKA 3GSIA 2AF6A 4DUYF 3MN5A 2CGLA 3R5AA 3CG7A 1X3MA 3H45C 3EMTA 2BH1A 7AT1B 3H4BA 4QYZJ 3MR3A 2I38A 2VQEK 1QVFR 4FZVA 3K5OA 3MMVA 1VBZA 3J7ZT 4USUA 1N8RO 4LR8A 4JI5J 2F9WA 4GO5X 5K8MA 1HLUA 2Z2LA 3AAWB 1KQKA 4GC7A 3KK7A 3X3UA 5DM7Q 3GSDA 1HBUA 5J2MB 1S49A 2FGOA 1Q8BA 4NLTA 4WQ5C 3UCUP 1RP5A 5BREA 1XMOF 1VQ4S 3IBCB 2WHOA 5ETTA 3MK6A 1TMMA 2KI2A 2J8AA 1TK0A 4MT1A 3RYLA 2ZH7A 4FS2A 2RHKA 1N32K 1FJCA 2PIIA 5KAKA 3SJJA 2RB7A 3IRXB 2BRKA 1WSIA 4FK2A 4FNIA 2OTJS 4LUBA 2ZUAA 2FHOB 4CH1A 3FSIA 2E6LA 4RCHA 2HURA 4GV9A 3CCRN 4JV2A 2E1ZA 5HJXA 2F8SA 3NHGA 2N7YA 7FD1A 4FJMA 1N0VC 2DISA 3NH1A 3MEDA 3MM5B 3D5MA 3UKRB 2DNOA 1FVSA 1L3TA 4YOEA 4KGZB 3KHYA 2CJAA 3VGSA 3LALA 1TL3B 3JAMU 1UL3A 2CDRB 2QKBA 4J9VA 2Q66A 3D0PA 4CCHA 1KN6A 5JS2A 3QWPA 3RB3A 5C2FA 3GCXP 3OHAA 2R8HA 2UU9J 5LMNK 5LJVA 2NRXA 1NDCA 4YMEA 1IKVA 2ZOFA 3OVBA 4ISFA 4O0IA 5DGBA 3FLCO 2GX8A 4ZCLA 4JKHA 1Y00A 2O01C 1Q81T 2ZH3A 3W63A 1UETA 1WC4A 4BWMA 1TMJA 3PZPA 1S9GB 1SJQA 3BYPA 4X4SA 2AQ4A 4ZVHA 1NJWA 1R27B 4DV4F 2DRBA 3R8EA 3SSSA 4J9LA 3PRVA 4IG3A 3MM9A 2P2CB 3SBTA 5JICA 2C3MA 3TZYA 1RT6B 3TJ9A 1Y5LB 4PXCA 2HHXA 2DJWA 4UOHA 1AUSL 2VFUA 3RAMA 2WTUA 2KZZA 2IJFA 2BE2B 3BO3A 1BUPA 1ELOA 4P6QA 2NSCA 2P9KA 2P9CA 2KT2A 3SEOA 4B9QA 4CF9A 4P7TA 3BQ2A 2DBBA 4F4YA 1R0AA 1RWUA 3QBWA 1I5OB 4IOBA 1SJ3P 1U2FA 1IQTA 4RNFA 5AZJB 4CT8A 2HNYA 1RU1A 3D0GE 4YY3J 4JYAJ 2QL9B 3HBTA 5D3GB 1UVIA 4CGJA 1TKZA 2MSTA 3NL0A 2GQCA 4LFCJ 5F8HA 3OW2M 3QAUA 1M90T 2C2ZB 1WSEA 1KSPA 1NGEA 2PZSA 3ZT3A 2FIUA 1IBMF 2KVQE 5DO2A 1J5OA 4Q43A 2VUGA 3BN7A 1CXQA 4FKXA 2FHMA 4F4XA 1VQ4N 1JLCA 5F8JA 2DR5A 3Q24A 4JS4A 3GWCA 4A8SA 1C1CA 3WXIA 2AP6A 4RNHA 2ZBPA 4Z0UA 4L74A 1TUVA 3SBMA 2I0XA 2QV6A 1Z26A 2HKEA 4HTLA 4FWOA 2DCLA 1NGDA 4JKBA 4JD2A 2OTJN 1H3DA 1U24A 1RCOB 3NEKA 1MWKA 4IFVB 1LKZA 3MUVP 2UXCK 1BO5O 2MY8A 1Y7PA 4IRDA 1JCEA 2WSCC 4I7FB 1HUXA 4DR2J 3HD1A 2WBMA 2VB6A 1MW7A 3EN9A 3CJ0A 3US5A 3QEWA 2VQFJ 3DRRB 4FP9A 2CQHA 3A5NC 3BPSP 3O44A 2BOAA 2MJUA 3EE8A 3T5HA 4E7IA 2HMPA 1X5TA 4ANCA 4KKOA 2HFUA 1C1BB 4E7JA 1WTBA 4ZCKA 1WUUA 4QZVB 4DZDA 3GONA 4LIRA 3SSRA 3AVGA 3R27A 4FPRA 4P71A 1LWFB 1WD6A 2X1GA 4UT4A 3O08A 2XYGB 3ATVA 2VASA 3IRXA 4DTSA 2OELA 3B54A 5U47A 3BP8A 4JI4K 2EG2A 4MKBA 2AMCB 4B02A 2VICA 2VBXA 4PEOA 3UW1A 1OYEA 2XHBA 3CC4S 5CAAA 4X4VA 2O8DA 4DL0C 5GAHP 1RTHB 3UKRA 3AQOA 2MLYA 3DYAB 2B6AB 2DR7A 1JJ4A 2PE8A 3V4IA 5CH7B 3TTDA 2AX1A 5M1KA 4G1IA 1ZBSA 4DV0J 2RQMA 4C48A 1TL3A 4YB7A 4CZKA 1T6DA 3W5XA 2HFNA 5DQHA 2MDAA 3MWBA 2UVRA 2FJAB 3LAKA 3UCGA 2IM2A 4LMZA 1C0UB 2HVDA 4ENOA 1GLBG 2FLNA 2AW0A 1S4EA 4DSFA 3QIPB 2ROGA 1Y3JA 4ED1A 1JLGA 3L6QA 4B1XB 1G99A 2HRTA 2E44A 1P9YA 3U7JA 4ELUA 3OFFA 4CJ7A 3M8PB 3WNGA 4JI0K 1S9GA 5A8KA 2R7QA 3PR4A 4EYHB 3V6DA 3WQUA 4QIGA 3IFEA 3DMJB 2V67A 2OEMA 4EGLA 1WKKA 2QK9A 2I7PA 6AT1B 3H6EA 4USTA 4B1VA 3DDNA 2OFGX 1HYZA 2F7TA 4Q45A 4PL7A 3ZLJA 3CJBA 4B9VA 1SIZA 5J1EA 3PEJA 3RVCA 1HFEL 4LF4F 3ISNC 1J9AA 2W42A 1I6JA 5HN0A 2V69A 4H4OA 3ZZUA 2UV8A 3QEVA 4KY3A 4DV6F 3CMQA 1UKUA 1J6ZA 1D9FA 2IM1A 4M8LA 2RSQA 2V8HA 1KAYA 3W2WA 3NH0A 4UOGA 4RZRA 2HF3A 1YK9A 4ZA1A 3FQKA 3DHWC 4QU7A 4FWRA 5E2QA 1HNWJ 4NEZA 2ZWPA 2D0CA 5HLFA 2K7JA 3OUYB 1NBWA 1TL5A 3NGKA 4EK2A 1Q8KA 4OHXA 1RGVA 3MXIA 4F25A 2JC0A 3PO4A 1S7IA 4H4KA 3A12A 4DG1A 3DLKA 3UD3P 2KG1A 3AO5A 1G6BA 2RAQA 3RB6A 2KN4A 4Y00A 2CYYA 2AYEA 4XEIA 5ITHA 2GV1A 3VAHA 4OI3A 1F3VA 3GR1A 3HZGA 1O6XA 4N41A 2QJ3A 1TGOA 3EZWA 5HMZA 4W5OA 3AXKA 2JEGA 4JI7F 3RZAA 2QTWA 5I42B 3CD6S 3BF3A 4NXNF 5HOOA 2JFKA 2RNEA 2KG0A 4DV1J 1YRXA 4KFBA 1RT4B 5KFAA 4CLUA 1IKWB 3OYJA 1CBKA 2WONB 2LECA 4ICLB 3I8DA 2ATQA 1WBDA 3PLAA 4FWMA 2HRUA 1RQ0A 3OYKA 3CC4N 2RDJA 1EHWA 4FJLA 1JLAA 4DZ6A 3BQ0A 4ZVGA 3GJQB 3I31A 3THWB 4FLZA 4USWA 1VYAA 2J7UA 5E3CA 1F2HA 2CQCA 2MKKA 5DG8A 2ZF5O 2APOA 3AVLA 1HMVB 5M2UA 1XK8A 3DNCA 4ZMMA 1C1BA 3OVAA 4E8UA 1FFGB 1N33K 2E1PA 4USMA 5LXYA 3ZETA 3EZOA 1VIXA 5LL6Z 5LL6d 2VBZA 1UVKA 2KW4A 1T0TV 1VQKS 5C12A 3VAGA 2FJXA 5KG6A 4IQXA 4KH4A 3RU0A 4DPOA 3VF2A 4QOZB 4PG7A 3CCWA 3FFIA 3PHTA 2FJWA 3CETA 1C0TA 4K8XA 4OX6A 1KD1O 2CQBA 2YWFA 3NOGA 3CIMA 2NLWA 4ED4A 3GIMA 5CYQB 1QJHA 4AL6A 4U7CA 2D69A 1R8PA 2OTLS 5GADI 2FHJA 4DSIA 4DR5K 4ZLPA 1HARA 4B08A 1B4SA 2UXDK 4CFDA 1EAYC 3IGVA 4WFBL 1Q95G 8RUCA 1ZPVA 2AYBA 1HNXK 3FDSA 1C0UA 3V6KA 3GE1A 2GZOA 3TUJC 2DY1A 3AO3A 3QIPA 4AQYJ 2LCWA 1H73A 3Q8UA 3OLAA 2JEJA 3OYGA 3WC2A 1JCGA 4ZPTR 1HI8A 2ITGA 4DV5F 2YKQA 3M5RA 2AYGA 4ZVOB 1RDWX 2GELA 4CT9A 2VG6A 2EBGA 4AHSA 3DRSB 1WOOA 3QYYA 2WSFC 5BYRA 2DK2A 3KLEB 2DGOA 2CQ1A 1D0EA 4NXMJ 4ZIWA 1SJ1A 4FK0A 2FTRA 2PSZA 5M1QA 4E3SA 4CNZA 1KCFA 3MMCB 1FDBA 3J81j 5M2PA 4JI1F 2R2RA 2ZGYA 1TL1B 2RHSB 1HNVA 3HM8A 2CQ4A 2HHVA 5LMUJ 2ACYA 5LSOA 5AFUA 3IMQJ 4I6MB 4CJ5A 1HR0F 3OD2A 4LRDA 2F9JA 2D9PA 1C2PA 3EVMA 3QO9B 3CMES 3QZ7A 1NGGA 1P90A 3J7YP 5GIPA 3O4NA 3A8JA 3CD6N 2VDHA 5HJYA 3FNNA 2N4CA 4I2QB 1UJ4A 3QICA 4I67A 3VQSA 5A8WA 2ZH1A 3AH6A 3LH2S 3M30B 4X4PA 3QEXA 4ZP8A 1GMWD 3DLLL 4NRTA 4M95A 4NYFA 3H5SA 5C2GA 4LQ9A 2RKIB 2KXHA 2ZOMA 4RNNA 4WQ5A 1VK8A 1WC5A 2KZMA 4WFZA 3NNHA 5BRDA 2G0JA 4LVNP 2MXYA 4LSLB 1SUQA 2BANB 4RKUC 1I3AA 4CF0A 2CA9A 4XPEA 1JLEB 5K8NA 3ZZ0A 3V4MA 2IM3A 3BH7B 1MWZA 2CPFA 2VG5A 4LBIA 1TZ0A 3MGJA 1UWBA 1H1VA 1BI4A 3C6TA 3BDPA 2B4UA 3W65A 4DFKA 2J0QD 2FGCA 3BR9A 2IDLA 3ENAA 3L2RA 4GVEA 2PO4A 4CBXA 1VQKN 2CH6A 3RMBA 1IKWA 1GMWA 1N8RT 3OHRA 1H6KX 3LWLA 1WUAA 3PW7A 2P9NB 4PABA 3MCNA 2UVWA 2KM8C 4YORA 2XCAA 2YNFB 4G6VB 1RT7B 3L2UA 4M45A 1IV0A 1QM9A 4KHPF 2GQQA 2OTLN 1GOBA 5LJ3Y 4DV7F 3MWTA 4WU3A 4XIUA 1MLAA 3D9BA 5AJ3K 4DHYA 4DR3K 4ZHRB 4GVBA 1SQGA 3KJVA 3AQPA 2BM0A 3FJ2A 2XHWA 4FSVA 2DVIA 2MGZA 2KH9A 1GOAA 1B0PA 1ZPWX 2J0SD 3AJDA 3RG6A 2IVFB 2X6SA 4JI6J 1BA1A 3IBWA 1XMOK 2DTJA 3OR2A 4LBHA 4G65A 2DEJA 2NYIA 4LVOP 1VLOA 3D67A 2NPFA 1JNRB 4ISEA 1ZA1B 1LW2B 3FSYA 4JNEA 4USKA 2IC3B 3KLGB 2LEPA 4IH7A 2PI5A 2A6MA 1D8ZA 2BW7A 4CLLA 2MQPA 2VWBA 1U6FA 4B3OB 1SPBP 2BJEA 1EKRA 2HHUA 2HQGA 1BD6A 3AVCA 2CPJA 3BR8A 4JI2F 4PRFA 4O5BA 4PAAA 2WW4A 4I68A 4GC6A 4K2XA 4X4TA 2UVUA 4TSXA 3CMEN 2W6KA 3UQSA 1WACA 3AA8A 5HROA 4F50A 3SQ1A 1TKDA 4L72B 4F04B 1CVJA 5HBMA 4PG6A 1BIZA 2GIFA 4AF1A 2GAHC 4ZVUB 2ZVIA 4BE0A 4K4ZA 1ZAXA 2V9WA 4ANDA 5ETLA 4PWDA 3LWMA 1M5KC 4WFBQ 3PX0A 4DS4A 4BHQA 5DQGA 4FYYB 4DL5A 1XHXA 1T05A 1SJ4P 3G6YA 5C42B 2XMTA 1VC6A 1TL1A 2XY5A 4WZQA 3NE6A 4GKKJ 2MQOA 1J27A 1BHNA 4H5WA 1L3KA 4BREA 3DXBA 3E9PA 1WWHA 4FLWA 4I6MA 4F02A 2MKIA 1CJTA 4XH1A 1BIUA 3MMBB 3G25A 3MPYA 3EKSA 4DTMA 3S3OA 3HVWA 2ASMA 2RMLA 3ZSVA 2ROPA 2PYLA 3AXMA 3IWLA 4NLOA 2A5XA 2PYJA 1RDAA 3IM9A 5EXWA 1HNIB 4CGFA 4XTTA 3KVGA 3M30A 2OA8A 2V8VA 4HACB 4Z4EA 3FSXA 4YP3A 3S3NA 1FRXA 3VQDA 4I9QA 2YV0X 1FCAA 3NDKA 3TOQA 2D0PA 2AJFE 4XO0A 3HPHA 2B51A 5LJ5Y 3EJMA 2YHXA 1J5EJ 2NPIA 1T3NA 1RAJA 5CHCB 3DWLA 3N5FA 2H5EA 1EIYB 1Q82O 2DGUA 2I5JA 1S22A 1SH0A 4CD1A 3C15B 3QGGA 5LXRA 3T1YJ 4MIWA 2V8GA 3G82A 2DNMA 4FJJA 3CJCA 4HDGA 4K59A 5AE1A 3BO4A 5B0FA 1HPZA 2HS0A 3NGTA 2YQ0A 1FTRA 2RUGA 2ZUGA 1PO6A 1VHXA 2GMHA 4X64F 3CQXA 5E3PA 3ZZYA 3KG0A 2Q97A 4RW6A 1XHZA 5AQOA 4DFPA 1KNZA 2JWKA 1KHVA 4TXSA 2NLXA 3VF4A 2HK3A 3HSJA 5IM0A 4HYKA 4X62J 3SUPA 2ADCA 2KQ2A 2M2BA 2YKMA 1N48A 3HSGA 4FJNA 1BLUA 3S1TA 2G1DA 4DPWA 3OJSA 2WVFA 5JVHL 4G1QB 4MO5A 2CADA 3SDEB 1G3OA 2XYPB 1SV5B 5L1JA 2LFVA 4XH5A 2RT3A 1B64A 1TL7A 1TFWA 3PW5A 3AD9C 2KO1A 3D2EA 2IDOA 1UJ6A 1FXDA 2JL9A 4BDYA 2KFZA 3RGIA 3ZT0A 4XAKA 3R6MA 3BKTA 1YJRA 3VQQA 4EI2A 4R8UA 4OPJA 3OFEA 2F3JA 1B7YB 3PG9A 3N6MA 1RA7A 4RLEA 3M2RB 3UIQA 5JMNA 4DB3A 2E1CA 3G71S 4RW7B 3QT5A 3KLFB 4QWBA 1JKHA 2F4VF 4B3OA 1ATRA 1Z05A 3SPZA 4B9MA 4R79A 2EFQA 4LJMA 2FF6A 2ASLA 5HRNA 2Q1LA 5KT3A 1C1AA 2DXFA 4CLSA 2XO6A 2WZ1A 2PFUA 1UPPA 3QJJA 4K4SA 4RX6A 2YWKA 2JJ4D 4HI1A 1YBAA 2LVWA 5GAEP 3OYCA 2DGXA 2HYIB 4LF5J 3FCWA 1OO0B 5A0YA 4NPOA 4ITSA 3OLBA 2VKZG 5L1KA 1S9EB 4C11B 2XHCA 2B5JB 3Q7BA 2MKSA 1YDLA 3KIOA 1B70B 5AQUA 2DXEA 3QSIA 3TA2A 1R0CB 3BY5A 1D4XA 2OCEA 5CZ2A 4F4WA 2AGOA 4CYUB 2ZOGA 1X5SA 2FY8A 4OYAA 4B3SJ 4LF7F 3CD5A 4DX6A 3FMBA 3ZSYA 3D45A 4CZEA 2C2RA 1Q18A 2BQRA 4DR4F 3L0QA 5FRMA 3K5LA 2J6TA 1FRMA 1SC6A 3ILOA 1S6PA 2GGPB 3C3LA 1HWJA 1RAEB 1R43A 4F36A 4M5DA 5G0RB 4RW8B 1NDLA 3DRXA 3TTFA 4CZFA 2IYIA 1U2VB 2FXUA 3UFCX 3PSIA 1FRLA 1QQMA 1TYQB 2P51A 4DV6K 2ZNYA 2XI3A 3HHLB 3H3OB 2O8CB 4BRLA 1D1UA 5M1FA 1W0HA 2BYCA 4CO1A 1PJ7A 2CWXA 2OPSA 2IVYA 2KT5A 1FK9B 3P39A 1U0HB 4W5NA 1HBOB 1GTEA 1W97L 2LP4A 4EFAC 1APSA 1RTIB 3FZ2A 4H5VA 4CF8A 2RDDA 3KLIA 2Y8WA 2E9RX 2MB0B 4LRFA 3C6HA 4NLXA 1HPMA 3OFHA 2OIHA 5HVFA 4UOCA 3SQGB 4BQZA 2A1BA 3ZYYX 4UUWA 3LTOA 4OV1A 4AD6A 5DDRC 3BKFA 4UF4A 2V6AA 4LFAJ 3BBBA 2DO4A 4ECQA 1G15A 1BOTO 2E4LA 2C1EB 4DKWA 4MYUA 5AQFA 3OTDA 5HL7Q 1FXLA 3LZIA 5J2PB 2D0OA 4BWJA 3O1LA 5KT4A 3OA9A 2IMOA 1SIWB 5KFZA 2JGUA 3CJ2A 1HWKA 5F8NA 3I87A 1N5QA 3CJTA 4NYOA 4B1ZA 3IA0A 3TQ1A 1NGCA 5KT6A 2EFVA 1WI8A 1YT3A 2YH1A 4YDDB 3SJHA 2GWKA 4BRQA 3B6PA 4NXNK 4CGDA 2W7PA 5KG4A 4JAXA 5D15A 3AO2A 1S6OA 3G6ES 4I9LA 4CIOA 4B3TF 3G71N 3L9ZA 2FBTA 2XS2A 2HFVA 3OL8A 4TLRA 1N36K 1HNZJ 1N5YB 1RYSA 2R8GA 4LIWA 2Z1HA 3WT0A 4PG4A 2VJUA 1T03A 1Z2ZA 4CLFA 2YNGA 2GS8A 4ZLLA 3TJ8A 4M3XA 4FJHA 3F56A 4OJGA 2AD9A 1RT2A 1JX4A 4YN3B 3DAWA 5BYQA 6FDRA 4OX8A 4WBFA 2KXNB 1K1SA 1EWQA 2YPYA 2FJVA 1PC5A 1QTNB 1KD1T 2G2ZA 3PYEA 5D4PA 5LY3A 5C25A 1XMBA 4B9TA 3UO0A 4KHUA 2EKNA 3JXUA 2AYMA 3QLHB 1H98A 3UE2A 2OPQA 1E4FT 2YHYA 3QT7A 5KG2A 4DU3A 4QPTA 1Y9OA 1KDNA 1FKPA 4YHHF 4ZVEA 1XNRJ 4Y6IA 4K50A 5SZTA 2QYGA 4X2BA 2XRIA 3OS0A 2PGCA 1HL6A 4BGAA 3IG1B 3IUCA 2E5GA 3BEXA 5M1OA 2XZTB 1KVJA 1OWXA 1A9NB 2PMHA 1S9EA 3V2UC 5ETQA 4DQSA 2XWYA 2MKCA 3ZT4A 2IA6A 3P83D 3LDSA 1RLCL 2GA7A 3HOTA 3CT9A 2QGFB 5IWAF 2RF2A 2M9KA 1UZDA 3L95X 4DLEA 1CS4A 1XBWA 3K0SA 5EX3A 1IKXB 4CO4A 3TA1A 3SCLE 2D1CA 1Q9XA 1R6VA 4O4GA 2CKWA 4HUFA 1R8CA 2F9TA 4E98A 3DDIA 1NKCA 2ZJQL 3CM6A 1HHSA 5I3PA 1VK3A 4CLZA 4DTOA 2CNNB 1OH6A 2BKOA 2C42A 5M1NA 4TKTA 3KG1A 3CUNA 4OYPA 4J7CA 5GAGI 3Q8PB 4LRAA 1TTHB 3NCQA 4MLHA 3BDEA 1VRTA 4Y2KA 4JRQA 4JI1K 2F8TA 1NK0A 1Q4RA 3VEVA 1YZ7A 5DG9A 5KI6A 4KHQA 2ZBQA 4YOVA 4B3RJ 1LW0B 3P31A 4FJGA 5HP1A 1N34F 1CLFA 3CCUS 1KQGB 2FVRA 3I0SA 1XNQK 4CGIA 4RR5A 1FK9A 2ZDOA 4BRNA 3UR3C 4OJRA 2ACMA 3DC2A 3W5ZA 4CEFA 3QRPA 2QLXA 5M2RA 3G6EN 5EGYA 1RKJA 1NPRA 3I56S 1T9XA 4KSEB 1JLFA 1WLJA 3M6XA 1EB0A 1FI4A 4HL9A 1U49A 2HWHA 4CEEA 2ZD1B 4BC9A 3WXMB 1XTZA 3NY0A 3OYEA 1NK6A 1I1GA 1Z1ZA 2RU3A 2U2FA 4KC5A 3NAEA 3AVBA 2V4JB 1ZYQA 3M7VA 1S1UB 2QFIA 4CF2A 4DX5A 3VVUA 1VSMA 4GKJJ 1LWEB 1RK8A 3UKUB 5E3RA 3WIVA 1ZM3A 1XQSC 1KLMB 1RLDA 4ILHA 1HA1A 2AEMA 3RSEB 2Q1NA 2XQCA 4B9NA 4DU1A 1F5AA 5EWFA 2PFFB 2JH3A 5E26A 3LP2A 1K9MO 2BM1A 9RUBA 3WEEB 1UA1A 4MYTA 3D1QA 4CESA 2BZ2A 4H5NA 3NCIA 2UP1A 1A5XA 5KFPA 3MI7X 1XWLA 1V3RA 3CCLS 4IKAA 4J2BA 3CPWM 1NSKL 3F44A 1LWCB 1SQFA 4KHPK 4CEBA 4DR1F 4DV7K 3IAYA 5KFWA 1SBRA 5E33A 4IJNA 1RTDB 1A7GE 3H46O 3EDQB 1NJIO 1PBAA 1KOOA 1I94F 2P9LA 1IWAA 5D4OA 4BBYA 2ITMA 2XSFA 2C22A 1UEKA 2KFYA 2YWWA 3CDBA 2HHQA 2DNRA 4GNIA 2DY4A 2W4PA 1U2CA 3KHGA 3T1HF 1CPZA 2DGQA 3MPWA 2VZ9A 2FVQA 2OFHX 2GHVC 2IRUA 1DT9A 3UN5A 4W90B 1JXBA 5B0BA 1Q53A 3IM8A 3RAXA 1E6VB 3FZLA 3MM6B 2M7SA 3I32A 3WC0A 1WHXA 3K9KA 2O1PA 3DLGA 3UWTA 1F21A 4E7KA 1WG5A 2W25A 4O3QA 3BGLA 4FM2A 4JV5F 2CPHA 3CQYA 1URRA 1GEHA 2E5LF 3J7AN 4P9SA 2DH8A 4DR6K 2W2PP 3R97A 2AP1A 2QLWA 4JI2K 2KYZA 4P52A 1IG8A 4Y2IA 4C0OC 1H38A 4X65J 3ZTOA 5HQMA 3EM1A 2WC9A 3CCUN 3OR1B 3SSQA 3W9HA 4LH4A 4ZVTB 1QAYA 4KRFA 1F5CA 1IKXA 3N0VA 2CH5A 2KJVA 2BA9A 2R7SA 2DH9A 1M0SA 4BC2A 4CZJA 4J9QA 4FN5A 1RAGB 2MZJA 5GIOA 4JI5F 3EEQA 5MAOA 1DKGD 2JC1A 1F9FA 1UW4A 3I56N 2QLBB 4DL7A 3P4UB 4UQGA 3D6MB 2XTJP 1GTHA 4W5TA 1IBKJ 1WDTA 4XK8C 1PKUA 2WK4A 2R9LA 3I5AA 3GFHA 2J7WA 4CJQA 2CJ9A 2VJVA 3A3PB 3ILLA 4DV3K 3OFGA 4NMXA 4BCAA 3IS9B 4RG8A 5FJ4A 4FWNA 2R7OA 3EDRB 2UUTA 1WORA 4N5SA 2ZJQQ 4QBUA 5CXTA 2CGKA 3ZEUB 3O5BA 5KG5A 4L8RB 5A2QO 3ENVA 3TA0A 1S1TA 4PUOA 1PYOB 1BISA 4OGCA 3ZT1A 3PDNA 3PTWA 5KTQA 3J7YU 4A8FA 4ZTFA 3ZCMA 2RH3A 5IT4A 2DPIA 2C2KB 1AROP 5FD1A 2DNLA 4CO2A 3R5CA 3UD5A 3CCLN 3QGHA 3H98A 4H0YB 3OYBA 3EYZA 4CK2A 4KIAA 4KB0A 4AHVA 3E01A 4M5JA 1NPKA 2UUBF 2A42A 1RBAA 3VA3A 4M42A 4BRPA 3JSMA 2ZFHA 2E5JA 3NGDA 2OMOA 3AA2A 3H4DA 3VQTA 1RT1B 4AL7A 4V19J 3RSEA 5LSLA 2AJQA 4NI2A 4MMOA 1H7XA 2B8QA 3GV7B 4L3QA 3V9XA 4K0KJ 3QBCA 1YSJA 3Q2SC 2LEBA 4DHVA 1NH7A 4BC3A 3E3XA 2ZNZA 2LU2A 2V0NA 3UB5A 3UN3A 3CJ4A 1BQMB 1ZXOA 4LF9K 4DL4A 1YRUA 4X64K 3K2PA 1ZTTA 4OLAA 2VQEF 5JLHA 1W2IA 1IXKA 3M3ZA 3DHXA 1CULB 2NS1B 5HVGA 1D9DA 3P5JA 1HHTP 4BRKA 1WSVA 2P9SA 4DTJA 1U1NA 3CIZA 3HPOA 4E1JA 1GMUA 1GQEA 4FZXC 1S6QB 3NBPA 3QIOA 3HO1A 1FDNA 3QZ8A 3I0RB 1N32F 4ZVFA 1OMSA 2I2YA 5FPNA 5DJBA 2HVEA 4YY3F 2ZH6A 4JYAF 3R5BA 5A76A 3EGVA 3V1OA 4X66K 2RVJA 1T9YA 3C16B 2HMIB 4WJBA 4ES3A 3JQJA 2PT0A 4CEQA 2GMJA 4O44B 3D54A 4LFCF 3PCOB 1Y0HA 2ATLA 2CJXB 2F4VK 4U67L 3TANA 3V1RA 3D0IE 2NXEA 1UEUA 4TY8B 3NS7B 1X9JA 5KFIA 3OS1A 2HQIA 4LF8J 1HKGA 4I4BA 2FC8A 4E2FB 4FZZA 2M52A 1EXQA 3SI8A 5SUHA 4IDHA 3LP0B 4NEYA 4I6WA 3VN5A 3GYGA 4OI1A 1F3FA 2LLZA 3O9RA 2JDJA 2O8FA 5H9FJ 3CCSS 1JNZB 2XZWA 3HXMA 5GVQA 3EXCX 2BQ3A 3L2WA 3A8EA 3LGHA 2IVNA 2BUPA 2GVDA 4DF4A 4K41A 1REVB 3DRPB 3CC7S 4DR2F 4YOUA 3ITHA 3WIUA 5CCMA 4DUYJ 4RTFD 2NRRA 1G1XA 2OZMA 2VQFF 4JKGB 2P1JA 4LY7A 3QDKA 3KHLA 2W7AA 4Z2XA 3BN4A 4J9SA 2HBKA 4Q0BB 5IC4B 1BQNA 3DLBA 2JLEA 4BRCA 4WE1B 4C3MA 4FCYA 1NZAA 3BZCA 3ZTPA 4WK3A 4DR4K 3AVAA 1S0MA 4KAZA 2FLOA 3WDOA 2LU1A 3CTRA 3NMAA 2RILA 4AYBD 4EFHA 2RRBA 2GO9A 3K89A 1J53A 1TVRA 5GADP 2PMZD 1TKXA 4C8YA 2CUYA 2OEKA 4KB7A 3GV8B 5HRRA 1XN9A 3V1QA 1GX5A 4WFXA 3MEEB 4M5NA 3VEYA 4CHNA 4P72A 1FDAA 4WKYA 4CM2A 2AHOB 5ADZA 1N56A 4DV0F 3IR5B 3SMZA 1B9FA 4MK9A 3CD7A 5A2QY 4O8UA 4L75A 2QW9A 3AAPA 5JVGQ 1U1LA 2V8PA 1TV6A 5CYJA 3PR5B 3IRWP 4K2JA 2AZ1A 4IYQA 3CO0P 2OGUA 2FYXA 1AXQA 1HWUA 2ZH2A 3VAIA 2YWEA 2XNRA 3FGVA 1RT1A 1NUEA 1QUVA 5AQTA 4CJLA 1BQMA 3E1YA 2RUSA 4RUCA 2UXCF 4N47A 3M2UA 2OSRA 4FXVA 5DLFA 3TW0A 2GHWA 3KOAA 3UD4P 2FJEB 3BSCA 3MECA 5F0XA 4CRJA 3CFOA 2CZ9A 3R5GA 4DV4J 3DLEA 3SQ0A 2R7VA 1VHIA 3EPIA 2CNOB 4LC9B 2R3VA 3CFRA 2ZH4A 5BRHA 2KXFA 4CJUA 3POTB 1FX4A 3A5MC 3SPYA 1DTTA 3TARA 2GO8A 1HNWF 3LM9A 2MQ8A 4LF6K 2HK2A 1JLBB 4PY5A 3MOZA 3TR5A 2H51B 4YOXA 5AXNA 4KH0B 1RTJB 2NZ4A 3HKWA 1ATNA 4H0TB 2HS4A 4UY8O 3CCSN 1VRUB 3GLJA 1D5AA 2W2QP 3DCAA 2DRDA 2A3JA 5CYMA 1LOUA 4A47A 3KWGA 3AA5X 1YGYA 4NLDA 4IO1A 3LW5C 5KFYA 2K2PA 3CC7N 3V81B 4ED6A 4A8QA 4RW4A 1N52B 1P27B 3K5MA 3VR1A 3D6RA 3TU5A 3QRQA 4AFFA 4O0JA 4HCCA 4KI4A 2YX7A 4CQ1A 1JJCB 3W64A 1YJVA 3MPVA 3W61A 3H5YA 1H2UX 1Y4ZB 5AQNA 3ILJA 4YR3A 4YHHK 4JKFA 4G9ZA 2RIJA 2UYTA 2W8LA 3TAGA 3IWNC 4JHDA 1IBMJ 1VAZA 3MXHP 3JYTA 1U1QA 3CXCM 4NYZA 4IR1A 3LP0A 3FRYA 2P9IB 3QESA 3L7UA 1KWMA 1VSIA 3SK3A 1ZBHA 4OYMA 5EWEA 4C3LA 5L39A 3IN5A 2VV5A 4P2FA 2HHSA 4OX9J 1REVA 1KFSA 4BDZA 4MO4A 1KRPA 4NASA 4Y2CA 5K8PA 3NGSA 5IWAK 2UUAF 2J9EA 4ZLNA 3OYFA 1T95A 5GAEU 4XPCA 4JKGA 3ZNUA 2HNZA 3M05A 3TPQA 1B3TA 3QJLA 1HYSB 3BM7A 3U1NA 3O3HA 4Q0BA 1WNEA 2ZZNA 1YX2A 3G8TA 4ZPVR 4DN0A 4QWEA 3K8WA 4WE1A 1AT1B 2K1RA 2HNDB 2FJBB