4IG3A

Hiv-1 reverse transcriptase with bound fragment near knuckles site
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
556
structure length
556
Chain Sequence
b'MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Reverse transcriptase/ribonuclease H
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
total genus 167
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ig3A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig3A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig3A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ig3A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ig3A05
1VSKA 1FKOA 1QS4A 3PW0A 2HHXA 3FQKA 4K4YA 4IG3B 3VQCA 1HJRA 3ZSXA 1S1UA 4YQWA 1JLGA 4CJRA 2ASDA 1SUQA 5DQGA 1UA1A 3DRSA 2OZSA 3LPUA 1U04A 3PJWA 4CJVA 1SL1A 1K1QA 4E7IA 4B3OB 4W5QA 1JX4A 3AVJA 4EP4A 2V0NA 2B43A 2G8UA 4M3RA 3QEIA 2PY5A 3NGYA 1RT4A 3K57A 1SKSA 3ALYA 4FK4A 1N56A 1RT5B 3O4QA 3C6UB 5HP1B 3ZSYA 3HP6A 3QYYA 3KK2A 5KT2A 4FJ7A 2E4LA 1RT7B 2LSNA 1JLBB 1EX4A 1TKXB 1S0MA 1J53A 3D5MA 1S1XA 1JLQA 5E41A 1DTQB 3V81A 1S0OA 4ZPAA 3RB4A 2XI3A 3OJUA 4R8UA 3PW2A 5CY4A 3SZ2A 3PX0A 4B9MA 3BQ1A 3KLVA 2VG7A 4NLYA 1NNDA 5KT3A 1NJWA 5CZ2A 2EHGA 4DQIA 1IKWB 2CJQA 4B8AB 3G6VA 3SYZA 3CM5A 4M3WA 2WONB 5KT5A 4KE5A 4M95A 1T94A 2R8KA 2Z1HA 4CHNA 4N76A 3OYAA 4HUFA 2EX3A 5KFOA 3SJJA 3V9XA 4DTSA 1S6QA 3QGHA 2UVWA 3HL8A 4DTJA 1ZBLA 3L2VA 3V6KA 3OL6A 4ECSA 2W9CA 3F9KA 2R8HA 2ZD1A 3ZT3A 4ZVEA 1UAXA 3LPTA 4L8RB 1NJZA 4N56A 4KKOB 1BISA 3PO4A 4URSA 5KFRA 4CJLA 1NK9A 3TAPA 3Q8PB 4FLVA 3FFIB 2AU0A 4NLDA 3NH2A 3SCXA 2ZE2A 5C24B 1C1BA 1CSJA 4CECA 2NUBA 4CJUA 4MFBB 2B5JA 3LP2A 2ASJA 2HNDB 4MK7A 3MR6A 4DL3A 2AGQA 1TKDA 2ATQA 1VSDA 4MKBA 4R5PB 4RW7B 2HNYA 2DPIA 2DY4A 2D7SA 2HWIA 3SFUA 1VRUA 4OVLA 1RTHB 4FJ8A 1MMLA 1HQUB 4BWJA 3ZSQA 4Y2AA 4QWAA 4XPEA 4ICLA 2IM3A 4KO0A 5EWFA 1BGXT 1JLEA 1NHVA 4RUAA 2Z1IA 2JEIA 5JXSA 4FYDA 3KJVA 1B92A 3OY9A 4IFVA 5KFFA 1SH3A 2BQ3A 4MK9A 4OL8A 4DG1B 4YR3A 5HLFB 4KHQA 2BE2B 2BRKA 3TWHA 3CDUA 1S1TA 5C42B 3OVNA 4O3QA 1RILA 4BDPA 1TL3A 3HPGA 2IGIA 4QAGA 4MQ3A 4RNHA 3ULDA 1LWFB 1S4FA 3NF6A 4JV1A 4NLRA 1IKYA 1QSYA 1S5JA 4ZVHA 3AA2A 4HYKA 3V6DA 5K14B 4DL2A 1WSEA 4ED7A 4JRQA 3NBPA 3M8PA 4ZHRB 1X1PA 2DFFA 3C94A 3CFRA 4FJHA 3AO3A 1O1WA 4FM0A 4PQUA 2CKWA 1EXQA 2AJQA 4NLWA 3OL9A 3N6NA 2V4RA 4RNNA 2OPQA 2IJFA 3WNGA 5CYQB 4J2AA 2Z1JA 1KLNA 4B8CA 3QIDA 3HK2A 1HNVA 2B6AA 5SZTA 1QAJA 5I42B 3SUQA 1GOAA 4FM1A 5J2PB 1EKEA 2HMIA 4H54A 4CJ5A 3RBEA 5F8IA 5KG7A 1DLOA 3TQ1A 1G15A 1QHTA 4I9QA 4O4GB 4FLTA 1HYZA 5JUMA 2HAIA 3AA5X 3DM2A 4Y34A 4WE1A 1J5OB 4U7CA 1TK0A 1S1VA 1RYSA 3V9SA 3DOLB 2JLEA 4KTWA 2BQUA 3BDPA 4DSEA 4YMEA 1VRTB 4WFYA 1IH7A 2E6MA 3BQ0A 4O55A 3JYTB 1FK9B 1RDBA 2VG6B 3RB0A 3SI6A 2B4JA 3WNHA 3DLKB 1YVFA 4W5OA 4O3SA 1EETA 4QWDA 3EZ5A 4FJMA 3FQLA 3T5JA 1ZBIA 4AHVA 3M9NB 3RMDA 5J2NB 3L2WA 4FZZA 5CYMB 5FROA 4GVMA 3MEGB 3UR0A 4K4XA 1KFDA 1WSJA 3PW7A 3TVKA 1RTIB 4FW2A 3HVRA 4CJKA 5T14A 1HPZB 3H4BA 3LZJA 3KLIA 3PV8A 1REVA 3TR8A 4CIFA 5DQIA 3KLHA 4FBUA 4M3XA 1N6QA 1S6PB 3IGVA 3LP3A 2YKMA 3SQ2A 4IDKB 3AV9A 4J9PA 4FJJA 3OYHA 2XGPA 5KFZA 3DMJA 3FDSA 1GX5A 2GIQA 3G0ZA 4ZVGA 3UQSA 2G8HA 1TGOA 2OA8A 1HMVB 4HHTA 4JS4A 4F3OA 2O4IA 4M94A 5L1IA 3PZPA 1KCFA 4K50A 2WK4A 3DLBA 3D28A 2KZZA 1Q9YA 2A1RA 1U09A 2AQ4A 1RDRA 1QSLA 4BWMA 2EC0A 4ELTA 1S1WA 4FW1A 4Y1CA 2AGPA 3BJYA 3UPFA 3V4IA 4OGCA 1RBVA 3NAHA 3RB3A 2JGUA 1ZTWA 4FZXC 4M3TA 1N5YA 3PVXA 4RW8B 4KPYA 3DLEB 1S49A 3K5MA 4IRCA 1JIHA 4RW9A 1TKTB 2HNZB 1RBRA 3AA3A 1T3NA 1S1UB 5HROA 2BQRA 1S97A 3AVIA 3VN5A 3DRSB 1S0NA 2BGGA 2X74A 2YKNB 4Z4IA 3AO4A 1JLCA 5KFAA 4GMJB 2IOCA 3MFIA 4WZQA 5DG8A 1SV5A 2XRIA 4FJGA 2VG5A 2OPSA 4J9QA 1RT6A 2RKIA 4O44A 2P5GA 2O5DA 4CGJA 2BR0A 3NDKA 4IR9A 2W8KA 4FM2A 4Q8EA 4LSNA 1SH0A 4Q0BB 3C6TA 3I0SB 4DL7A 4E7HA 2WTFA 2HHWA 4FLXA 3QGGA 5CZ1A 1BQNA 4I2PA 1IKXA 5KI6A 4TSXA 2C2RA 4XIUA 4OKEA 3NGZA 2HVHA 4DU3A 3JSMA 2VG7B 4TQRA 4FJ5A 3OYLA 1NKEA 4ECZA 1C1CB 2RF2A 1ZBHA 2ASLA 4EEYA 4DQRA 4WXWA 2IDOA 1W25A 3CDEA 3K59A 5J2MA 4RNMA 4ZP8A 3DYAA 3AVLA 3AVCA 2D0BA 4OKJA 3OHAA 4FZYA 4KFBA 3AVMA 3G86A 3FRZA 1I6JA 4K4VA 4ECUA 4J9NA 1T7PA 1LW0B 2YNGB 1HNIB 5KFPA 4AILC 2FVPA 5KFJA 1IKVB 3QIPA 2W9AA 4Z4FA 3I5CA 3DLGB 4OLAA 2WB4A 3L3VA 3DRPB 3BGRA 4ZMMA 1S48A 2G8FA 3MEDA 4O3PA 4Q43A 1BQMB 5KG6A 2R8GA 1YVUA 1NK6A 3IG1A 4MIBA 4RW4A 1WSHA 3H08A 5F8HA 4CIEA 1D9DA 2FLLA 2B5JB 4NYNA 3LWLA 2G8WA 2QXFA 1TKZA 4OKKA 3T5KA 3B6OA 3OYFA 3RAXA 2HB5A 4RW6A 4QW8A 4DQPA 2HNYB 1LWEA 5KFXA 1VRUB 3SUOA 1TVRB 1QQCA 5KFDA 5KG3A 4E7LA 2AGOA 2YNIA 4HUGA 2XHBA 4Q44A 2VA3A 5FDLA 4OPKA 4E19A 3V9WA 3NAIA 4Z4GA 1L3VA 3QNNA 2FBXA 3L2RA 1C0TB 1RT2B 3T5HA 4DL6A 4KHWA 4EBDA 4CIGA 5D3GB 1T05B 2HHVA 4GC6A 4JV0A 4NRUA 3LP1A 4IRDA 1VSMA 3KK1A 3I0RB 5HBMB 3H5YA 4G3IA 4EBCA 2YV0X 2XY6A 5KG4A 4CGGA 1RTJA 4KHMA 5DLGA 4FLZA 4DEZA 1A5XA 4ED2A 2BANA 4ZTFA 5F8JA 1TV6B 3BSCA 3BSAA 3HPOA 3IAYA 4TY8A 4ED0A 3CYMA 2VWKA 2HHUA 4KB7A 1RDDA 1X9SA 4H4MA 3ZSOA 1FKPB 1Z4UA 1ZYQA 3KHLA 5J2QB 3V1RA 3ZSRA 4NYFA 1S9GA 4K4SA 3KKRA 1IG9A 4ID1A 4BE1A 1IM4A 2PZSA 1BL3A 2QV6A 1YT3A 4E1MA 3RWUA 3KIOA 2W42A 3MECA 4WYLA 3NAEA 2ATLA 3QIOA 3H40A 2J6SA 2Q3SA 3PX4A 4AHRA 2DPJA 3K5NA 3M8RA 4PWDA 4EO6A 1IO2A 3E01B 1S9EB 3RR8A 1HNVB 4M42A 4IKAA 1KFSA 1KTQA 3PW4A 4CJQA 2D41A 3SPYA 2UVRA 3DOKA 1WNSA 5I3UA 2IAJA 2X6SA 4DLEA 5KRTA 1DLOB 2I5JA 2QK9A 3DI6A 1CXUA 1VSLA 1BI4A 4IG0B 4IOBA 3CJ3A 5F8NA 2F8EX 3CFOA 4FJXA 3ITHB 4PUOA 1J9AA 2VWJA 2YNHB 2I1RA 3MEEA 3OSPA 4M3UA 4C8MA 3ISNC 1B9FA 3SFGA 3QESA 1U4BA 2DFHA 2Z1GA 4KI4A 5KFGA 3VQ7A 1F21A 3E51A 3IGNA 2RDIA 4CJWA 3K58A 3DRRB 5FRNA 4ZVFA 1RBTA 4CF8A 3GIJA 2FJVA 1K6YA 1ZETA 4KHRA 4X2BA 4K4WA 4I7FB 3LP0B 3HXMA 4W5RA 2AWZA 3KLIB 3G6YA 4CFBA 3NH1A 4FJ9A 2WRMA 1ZBUA 3IS9A 1HYSB 3T3FA 3RMCA 5KFEA 2WOMA 1QAIA 4B9VA 1N4LA 1RT1B 2IJNA 3VQ6A 3VQ4A 2JEGA 1NKBA 3SQ4A 4C8OA 5EWGA 1JL1A 4DL4A 3V9UA 1SH2A 3LAKA 2IC3A 2GC8A 3L2UA 1S1WB 3KTQA 3OYIA 3TAMB 1T03B 4IH6A 1VK0A 3U6FA 3ZT4A 4O5BA 2D5RA 3CJ5A 3SV3A 1LWCA 2O4GA 4ED3A 2JC0A 3AO5A 3BSNA 3QZ7A 2XC9A 4CK2A 3H4DA 3TI0A 3KLGB 3AVFA 3VQDA 5SWMA 4IG3A 2FVSA 5HROB 1CZ9A 3VQ9A 2YNFA 1WAFA 4HTUA 4DS4A 2C28A 3K5OA 2FJXA 4LQ9A 3HYFA 3D0PA 3OYMA 1RA7A 3QINA 1JLCB 4KV8A 1TAUA 2W7PA 2XY8A 4YNQA 4G1QA 2VG5B 3NKYA 4R0EA 3KLEB 4NLSA 4YP3A 4O44B 3OL8A 2KW4A 2D0AA 3P5JA 4W5TA 1LAVA 3O4NA 1KLMB 4OGEA 4E3SA 3V1QA 2WHOA 1RT5A 5HP1A 3QZ8A 4K4TA 2DTUA 1RT7A 1JLAB 2IA6A 4CCHA 1JLBA 1WSGA 1TKXA 1QTMA 4B9NA 1HYVA 3ZSVA 1FXXA 3QLHA 1DTQA 3OJSA 4ED6A 3PR5B 3EYZA 4I2QB 5F8GA 4UQGA 4NCBA 3EY1A 5DGAA 4KB1A 2P1JA 1D1UA 5JS1A 1SKWA 1VSFA 2RF2B 2G8KA 4KSEB 4EBEA 3HJFA 1IKWA 4AHUA 3RMBA 1ITGA 4LSLB 2WCXA 2FC0A 4DWIA 3EPGA 3CJ2A 4C8NA 2R2TA 3NE6A 5C25B 4BACA 3ISND 1RNHA 3QERA 3PO5A 3KD1E 5EDWA 3MXJA 4EYIB 5HRSA 3KOAA 4F2RA 4DFJA 1LAWA 4NCGB 3M8QA 1XI1A 1NKCA 4KAIA 4ECQA 4DTXA 2QE5A 4IKFA 2HVIA 3QIPB 4KHYA 1GOCA 4KKOA 1YTUA 3CIZA 3A2FA 3FFIA 1TQLA 3PHEA 4IQXA 3IG1B 5C24A 1X9MA 3M9MB 1LW2A 1C0UB 4MFBA 1L3TA 4RNFA 1JKHB 2OPPB 4E89A 3IN5A 3NMAA 1Q9XA 3VQ8A 4R5PA 4E7KA 4RW6B 4RW7A 2JEJA 3H98A 2C2EA 4E1NA 4FLUA 2P5OA 4ZPDA 1RTHA 1HQUA 1NHUA 3MR5A 3F73A 4H4OA 4ID5B 4ZTJA 5FDLB 1RBUA 2GIRA 4CGHA 4CGDA 1R0AB 1EP4B 4O3OA 4TXSA 1TL1B 3BREA 1S9FA 4N47A 1YTAA 4FJNA 3MF5A 4QCLA 4JRPA 5DQHA 4KTZA 4DG1A 1UWBB 4O3RA 5HLFA 3SI8A 3QO9B 1U48A 2BE2A 1FKOB 4M45A 4EZ6A 5DK5A 3HVTA 5C42A 4Z4EA 1JLGB 1I39A 1SUQB 3ZCMA 4F2SA 5F8MA 4CHOA 5F9LA 2W8LA 5KFNA 3CJ4A 1UA0A 5JS2A 1NOYA 3GV5B 4NLUA 3SV4A 4OJRA 4HCBA 3KLFA 3SUNA 3TAGA 5K14A 3KK3A 3KHRA 5EWEA 1QE1A 1RT4B 4ZHRA 2Y1JA 1RTDA 2F96A 3TABA 2RPIA 1RYRA 3L2QA 3VQSA 5KG5A 3KK2B 2X78A 4F4YA 2D0CA 2XCPA 2IM0A 2R2SA 5HRRA 1TAQA 5CYQA 3BR9A 3Q8SB 3G6XA 4J9OA 3NCIA 1S1XB 1JLQB 4DQSA 5KFVA 3V81B 4IH5A 1RA6A 3RRHA 4N41A 4IH7A 4R8UB 4JLHA 4E7JA 4OPJA 4HCCA 5I42A 1HQEA 1S10A 5J2PA 1WAJA 3ZT1A 3GV8B 2GV9A 2I5JB 3LANA 1WLJA 3OYDA 4CHZA 1A5VA 4EP5A 4O4GA 4JUZA 2AX1A 1J5OA 3KMSA 4J9RA 4DSKA 3DOLA 4ECVA 1I3AA 4CGIA 4PUOB 3IRXA 3PW5A 3B6PA 3CO9A 1TK8A 4F4KA 3KHGA 1VRTA 3VQ5A 4CEFA 1S6QB 5KFQA 3JYTA 1FK9A 4URGA 3ASMA 5L1KA 2OPRA 3H59A 4CJEA 3OL7A 2VG6A 2W9CB 3N6LA 4KRFA 2ZD1B 4NLVA 2UUTA 3AVBA 4CEOA 4CGFA 3AO2A 3OYNA 4H8KA 3DLKA 5KG0A 3LWMA 5L1LA 1VSEA 2ALZA 4LH4A 5KFCA 3U3GA 5J2NA 2ZE2B 3EPIA 3M8SA 4NCAA 4DLGA 3GYNA 1BCOA 3MEGA 1C1BB 1TK5A 4ELUA 2J6UA 3O3GA 1RTIA 2OYQA 1Z26A 3LP2B 2GBZA 1KVCA 4LY7A 1HPZA 2D3ZA 5KFHA 2R2UA 1KSPA 4MIAA 2KQ2A 5KFKA 1S6PA 4J9SA 4IDKA 4DU1A 4CK3A 4IBNA 4W5NA 2E9ZA 1DTTA 4ZPCA 3MTKA 4CF2A 4ICLB 1HMVA 4KO0B 2XCAA 1JLEB 3GIKA 4DMNA 5KGWA 3NH0A 3KJVB 1RT3A 4K4UA 3V6HA 4IFVB 2FBTA 4J2DA 3OS1A 3AVNA 2YHBA 5DG7A 3AVGA 1L3SA 4EO8A 4YFUA 5KFWA 3VQQA 1S1TB 4J9LA 5L9XA 4J9MA 4CF1A 2KFZA 3LALA 1TL3B 1NK5A 4F4ZA 3QEVA 4KREA 4KAZA 1NOZA 4CFDA 4DTPA 4RW8A 3DLEA 3AA4A 1IKYB 2ILZA 4KHSA 1TKTA 2HNZA 1JL2A 3NFAA 4K8XA 3V6DB 2YNFB 3KHHA 3VQEA 4YR0A 5KFMA 4XO0A 1JLFA 4F4XA 2YKNA 3NBPB 3M8PB 1UOCA 4CF9A 4ZP6A 4DQQA 4PQUB 4KV8B 4MK8A 1WSIA 3VQAA 3CDWA 4IRKA 3RR7A 2FBYA 3OLBA 2OPQB 5C5JA 3CWJA 4G1QB 1WNEA 2V4QA 3GV7B 1RAJA 3Q8QB 2AX0A 4Y1DA 4AHCA 5J1EA 2UUWA 5L1JA 3OYKA 4RNOA 2B6AB 1D5AA 3OYJA 3N6MA 3H2LA 2HWHA 4NLOA 1J54A 4Q0BA 3CJ0A 2HMIB 4QOZB 3I0SA 3I5AA 2R8IA 4NYZA 3LZIA 4KBIA 3KMQA 3GILA 3NGIA 3QLHB 4LD0A 3DM2B 4WE1B 4E0DA 3V6JA 1S1VB 4BE0A 4IFYA 3NL0A 1U49A 1OS5A 4J2BA 4DF8A 3ZT2A 1C1CA 4BDZA 3TAEA 3DLRA 3QEPA 3T5LA 3V9ZA 3TARA 3NF9A 3KD5E 4ECRA 3HHKA 4DL5A 2R2RA 3K5LA 2E6LA 4NRTA 1C2PA 3HM9A 3MAQA 2F8TA 1MU2A 3BSOA 4LH5A 2OH2A 3TANA 5KT7A 1EETB 3KNAA 5T7BA 2FJWA 4FK0A 3G10A 4XPCA 5F8LA 5KRSA 4DFKA 4ED8A 4LQ3A 3M8QB 1LW0A 1BCMA 2YNGA 1QSSA 1HNIA 4FCYA 3AO1A 1N48A 1IKVA 1Z25A 1XWLA 2IBKA 2R8JA 4RG8A 1KHVA 1KHWA 4TN2A 3DLGA 4FJLA 5KG1A 3NHGA 1REVB 3WNFA 3DRPA 3KLHB 1N6QB 2YKMB 5KGXA 1BQMA 4CHPA 3V1OA 1BHLA 3RB6A 3CM6A 3EZUA 2C22A 2E9RX 3DMJB 1LW2B 3QEXA 3KKSA 4CEZA 4HVJA 3OYEA 1C0MA 2ILYA 4NZ0A 4I9LA 1VSHA 4IR1A 4CF0A 4HUEA 4NLQA 3ICLA 3MR3A 4M3ZA 4M3YA 3RTVA 3SPZA 4FLWA 5KFTA 1RBSA 1TVRA 3H5XA 3RBDA 4RZRA 1U47A 4CHYA 4O0IA 1NK0A 4H4OB 4CJPA 4CHQA 2ETJA 2ZQBA 3V4IB 1C0TA 1RT2A 1KVAA 4CEAA 5D3GA 1T05A 3RAQA 2W9BA 4B9SA 2FVRA 1N5YB 4YR2A 4CK1A 4CFAA 3I5BA 5HRPA 3I0RA 5HBMA 4QWEA 4B9UA 4DTMA 4RU9A 1JXBA 4RW9B 2E9TA 3DDKA 3HVAA 2XY5A 3HVTB 4KB0A 3QEWA 3BQ2A 3HSTB 4CE9A 4DTOA 1WSFA 1TV6A 1CXQA 2G8IA 3SQ1A 1XR5A 1U45A 4B3OA 4TQSA 4B08A 5DGBA 1BIUA 4AH9A 4URQU 4KTQA 1FKPA 3OS2A 1SV5B 5J2QA 3KLFB 3OSNA 1SL0A 2OPSB 4FJKA 4GW6A 1C6VA 3PY8A 1RT6B 2RKIB 3KK3B 1QE1B 4F50A 4PY5A 2RDJA 4WFZA 1RTDB 3NGDA 2J6TA 4CEDA 4LSNB 3C6UA 4TYAA 3UDLA 3C6TB 4DFMA 5KFSA 3SNNA 1TP7A 1BQNB 2FLNA 3U3YA 3VA0A 3H5SA 3E01A 1S9EA 1ASUA 4I2PB 3H5UA 5F9NA 1IKXB 4FVMA 4DS5A 3THVA 1SL2A 1HQEB 3L3UA 5KFUA 2HW3A 3JSMB 4Y2CA 4MKAA 3WNEA 1ASWA 4CFCA 4F8RA 2KZMA 1RDAA 4ELVA 4IG0A 5J2MB 3ZSWA 3HO1A 3SUPA 4ECXA 4CEEA 3T1AA 3DYAB 2UVUA 2PYLA 4ZP9A 4BE2A 4FS2A 2WONA 2FLPA 5KFYA 3LAMA 2BRLA 3ITHA 3IRXB 4WFXA 2QKBA 2YNHA 4KFBB 1CZBA 4CEQA 1JXLA 4DSIA 5KTQA 4ECTA 2OPRB 4Q5VA 4J2EA 3OYCA 2Y1IA 4J9KA 1B9DA 2KTQA 3VQPA 4NLPA 3BGRB 4WXOA 1NK7A 3DRRA 4F4WA 2HHTA 3GQCA 3MEDB 4Z0UA 4NLTA 2ZKUA 5KFIA 4RW4B 4CJ3A 4NLXA 3I8DA 2C2DA 2YHAA 4DU4A 2KFNA 3UIQA 5KFLA 1T8EA 2G8VA 1XHXA 4I7FA 3LP0A 4M41A 1HRHA 1TKZB 2OZMA 2V9WA 1W0HA 2HNDA 3MXIA 3VQBA 1ASVA 4FK2A 3P1GA 2JC1A 2JEFA 1LWEB 1HYSA 5DLFA 3CG7A 2FBVA 1KVBA 1D9FA 1DTTB 2YNIB 2PYJA 1RT1A 5EUHA 3HP9A 3MXMA 4ED1A 5EU7A 4FS1A 3AVAA 4O3NA 1RT3B 1Y97A 2DFEA 1D0EA 4B9TA 1RCHA 3QGIA 3OLAA 2QKKA 2BDPA 1SKRA 4AHSA 3LP1B 3KK1B 4BDYA 2F8SA 4OLBA 2IM2A 3TAMA 1RTJB 1T03A 5DMRA 3QETA 4TY9A 2BANB 3P83D 1LV5A 1BIZA 1NK8A 4DSLA 4EYHB 4TY8B 1LWFA 2VA2A 3S3MA 3FSIA 4QWBA 2XGQA 2GUIA 1KRPA 1Q8IA 3NF8A 3RMAA 4H4MB 3HVWA 4Q8FA 3KLGA 5KFBA 3PJXA 1X9WA 2RN2A 4CJFA 1S9GB 3TAQA 1JLFB 3PR4A 1XR7A 2IM1A 4AHTA 1JXEA 4FBTA 3PX6A 2HHSA 4CERA 2UVVA 5KG2A 1L5UA 4F3TA 3VA3A 4WYWA 4QWCA 3OYGA 3MECB 4HKQA 3NF7A 2XI2A 3KLEA 1L3UA 2HHQA 4PWDB 3ZT0A 3D45A 4QW9A 4O4RA 3HKWA 4CEBA 5J1EB 4KHUA 4JV2A 4B9LA 4DF4A 4DTUA 1KLMA 3AVKA 1NJYA 4KHNA 3DOKB 5I3UB 2IAJB 4N5SA 1JLAA 1RDCA 2R7YA 2ITGA 3DI6B 1BI4B 4DSJA 2IS3A 1GX6A 1D8YA 4C8LA 4ZPBA 2P51A 4ZP7A 4I2QA 4ECYA 4NLGA 2A1SA 4IFYB 2FVQA 4KI6A 5HRNA 4GC7A 3CFPA 2XO7A 4FXDA 1GOBA 3C95A 1C1AA 3T19A 1ZBFA 3MEEB 3ZSZA 2D3UA 3AVHA 4Z4HA 3S3NA 4LSLA 3CQ8A 4JS5A 1CLQA 3PUFA 5DG9A 1MU2B 1A5WA 4CESA 1XR6A 5C25A 3MR2A 3K2PA 1ZTTA 3CVKA 4RUCA 5KT4A 3TAFA 4WZMA 4TYBA 4NCGA 1W9HA 1NJXA 3DLHA 5FRMA 5CYMA 4ECWA 4Z4CA 1VSIA 3O3FA 4C8KA 4CJ4A 1VSJA 3GIMA 4QPXA 1NK4A 4TLRA 4FJIA 4CJTA 4FLYA 1XHZA 3S9HA 3QO9A 4DFPA 3IS9B 3MFHA 4K8ZA 3HT3A 4CJSA 2WOMB 1C0UA 1JKHA 2XY7A 2FVCA 4K4ZA 3O3HA 1XC9A 2OPPA 3LDSA 3SQ0A 3OHBA 3OS0A 3OYBA 3HPHA 1WN7A 4Y3CA 2IC3B 5KT6A 4DTNA 4DSFA 3M9OB 4Q45A 4ID5A 2W7OA 1K1SA 1QUVA 3Q8RB 2IMWP 4U6PA 4O0JA 4EZ9A 1R0AA 1EP4A 3S3OA 4PA1A 3RRGA 1TL1A 1LWCB 1HARA 4DTRA 4MH8A 3QNOA 2W9BB 3L8BA 1UWBA 2XWYA 3GIIA 2X6NA
chains in the Genus database with same CATH superfamily
3P3DA 1VSKA 1GNKA 2HHXA 4IG3B 3MZIA 2BKPA 2DGXA 4YQWA 4CJRA 1SUQA 1DHMA 3DRSA 5IC6B 3LPUA 1RISA 3PJWA 3QGPA 4CJVA 4L73A 1K1QA 2IYGA 1KDNA 3D6MB 2B7CB 1WSVA 1JX4A 3VAFA 4DBQA 3CJAA 3D3BJ 2V0NA 4M3RA 1RWVB 4NMLA 3NOGA 4WJBA 4U8VA 4FPAA 3RZAA 3K57A 1SKSA 4H5WA 2L9NA 3CC7N 1R7IA 1FNMA 1SS6A 1RT5B 3HP6A 3ZSYA 4UOHA 4K0KK 4FJ7A 1RT7B 1TKXB 3DXMB 1J53A 3U9DA 3MMCA 1DTQB 3V81A 1V5VA 4ZPAA 3NNHA 4YY3K 3PX0A 3BQ1A 3PYEA 1FRJA 2VG7A 1PJ5A 1F5CA 1NDLA 1Q8BA 2DISA 3WX4A 2M9KA 4WFNL 2CJQA 4B8AB 5LSOA 3O1LA 3GWCA 2ZITA 3CM5A 2WONB 4PG5A 4KE5A 4A47A 1RAGB 2F3JA 3OYAA 4HUFA 2FZKB 1DAXA 4WCEQ 3AQOA 3VESA 1Q86O 5BYSA 1RBAA 3SJJA 2GVZA 2R7WA 2BTFA 1U02A 4DTJA 3PIOL 2BYCA 1Y64A 3DLLQ 4QYZJ 5GVQA 2YHYA 2B4OA 4IDHA 3OL6A 3F9KA 3E9LA 4X4TA 3ZT3A 1UAXA 3ID6A 2GGPB 2YWKA 4M5HA 3TAPA 2W01A 1B4SA 2AU0A 4NLDA 1OO0B 1R8BA 3EKUA 2OJ3A 1R31A 3K9JA 4MK7A 4DCJB 3BO2A 1UEVA 5GMEA 4OLOA 4OLPA 4R5PB 4JEPA 4EHUA 1GLJO 2DPIA 5ETQA 2D7SA 3H45C 1HQUB 4BWJA 5GADI 1MSWD 3ULHA 1JLEA 1K0VA 1ILYA 2X1FA 2JEIA 2I2YA 4Z2XA 4ALZA 5IT4A 4FYDA 1B92A 4IO1A 3HX9A 1FJGK 4FPBA 2CGLA 2PMWA 4MK9A 4HVZA 1Y7PA 2Q31A 1WEZA 1EHWA 1FKAF 4ZPVR 2C42A 4RBTA 2BE2B 3MMAA 2XYPB 3IP0A 3FBEA 3J7Z5 5C42B 3OVNA 1TL3A 3HPGA 1E6YB 2AJ1A 3G9CA 3G6ES 4ZJLA 4CZJA 2FPHX 4RNHA 3M2UA 2D9PA 3ULDA 1IXKA 1YJNN 5TKYA 4BRGA 1U1KA 3MXHP 4MLHA 2RS2A 4ZVHA 2QEXS 2A3ZA 3VTIA 4B3TK 3OFGA 2NZTA 5G0RA 3I55N 1WSEA 2Q0UA 2K3IA 4ED7A 5A8KB 5BN9A 3C94A 3CFRA 4FJHA 3AO3A 4PQUA 2Z8QA 1XNQF 2AJQA 2HFOA 1EXQA 3I9ZA 1OVYA 2N7YA 2IJFA 2M3DA 2YI1A 1DBDA 2VPZB 4YOTA 3DKDA 3QWPA 2N82B 3HK2A 3L4IA 4CW7B 2HG4A 2B6AA 2UV8A 3K0JA 4NPOA 1NDCA 3THXA 4H54A 3RW6A 4DQ8A 1HBNB 3RBEA 3S6EA 4OO1J 4F26A 4BRIA 4DPUA 3PKMA 4ISGA 3C6AA 2HAIA 1HW8A 4BC9A 3DM2A 4Y34A 1J5OB 1YIJN 1TK0A 1S1VA 2JLEA 4G1IA 5DZ6A 1QAXA 1NM2A 2DGSA 1UTAA 5EN1A 1PJ7A 4R79A 1VRTB 5BPNA 2QYGA 3L0QA 2FQQB 2VG6B 5CH7B 2KYXA 3TW0A 3WNHA 4EHTA 4LF4J 2D74B 3PLAA 3T5JA 4Y2IA 3M9NB 1IJFB 3CJTA 2WSCC 3L2WA 4OQJA 2IHR1 4WKRA 5CYMB 1ZPWX 3G82A 5FROA 2P9KB 1MROB 3MEGB 4FW2A 3TVKA 4P7VA 3ZXWA 3R8YA 3H4BA 3KLIA 1MWYA 1REVA 2NRXA 4RU2A 2Q1NA 3EMTA 6FD1A 1S6PB 3IGVA 3LP3A 3SQ2A 4J9PA 1N0VC 1V6HA 3SAGA 2O8BA 3IO1A 2VJVA 2GIQA 4C8ZA 3UQSA 1H3DA 2GAGC 2UUAK 3THPA 1O0PA 2ZZMA 4HHTA 2HFUA 3MM7B 1KCFA 5BRHA 2YQ1A 2R4FA 1B99A 3CJKA 1PGZA 2LEPA 1OMSA 3DLBA 3IUCA 2A1RA 1KONA 3AJDA 4F0HA 2ZZNA 1WBDA 4Y1CA 4ZCIA 4IZ9A 3BJYA 3UVJA 3RB3A 4B3MF 2ZH5A 1ZTWA 4FZXC 3DXKB 2XMMA 2MQOA 4OYOA 5DM7Q 4H4KC 1YBTA 4C3MA 1TKTB 3DFEA 1RBRA 1T3NA 3EGZA 2V67A 3DDNA 3FC9A 1S97A 2BGGA 2O8FB 1HW9A 2GQQA 4I67A 1ZM4A 4DHYA 1VQ9S 1N32K 4DR4K 2ZJQL 3FZFA 3J7AP 1S0VA 1VK3A 3DXBA 2Z2MA 4CO3A 2MQMA 2VQEJ 2O5DA 1TL7A 4UF4A 2B51A 3I33A 3CJ9A 3R6MA 4YDDB 5B0DA 3CJ1A 2PT0A 3TPQA 4E8UA 1IN0A 5CYJA 1M1KO 2GTDA 4X66K 1H2TZ 4E7HA 4JI6F 4BC3A 1GTHA 2M88A 3QGGA 4F25A 5CZ1A 3T1YK 3Q2SC 5IV3A 4A48A 2RT3A 3G87A 1FJEB 5T7LA 3MAAB 1SQKA 3QQCD 5HATA 1S12A 2V7ZA 1GLFO 3UB5A 4ECZA 1C1CB 3FBFA 1ZBHA 2ASLA 3NG8A 3W0LA 1KTVA 1X8DA 3BR8A 3K59A 4ZVOB 4JI2K 3NOCA 3DYAA 4AQYK 1EX8A 1WKJA 2QA4N 5I4MA 3AVMA 3FRZA 1I6JA 4ECUA 2XS2A 3MWTA 3VF0B 4KBOA 3LW5C 4AILC 4IOAL 1M5VC 3CCLN 1X4EA 4FPIA 2QT7A 4DR7F 1S48A 2GZOA 3G8SA 1SCJB 2F9DA 3R27A 2LECA 3TTDA 4Q43A 5KG6A 1I51B 5LSRA 2R7SA 2J8SA 4A8WA 5F8HA 1D9DA 5ETOA 2RUSA 2QWOA 2QXFA 2IMOA 1TKZA 1K73T 2Z2LA 3T5KA 1UZHA 4USIA 4IWVA 2HB5A 5AQGA 3GR1A 3CNQP 2UXBK 5C2GA 1QQCA 3R1HA 4LMZA 4BC2A 4IOCQ 4Q44A 4OFZA 4AYBD 4RUHA 3MUTP 3M1VB 4OPKA 2ADCA 3QNNA 2J8AA 4ES3A 4KHWA 3D6FB 4OJGA 5D3GB 3Q24A 2ZJPQ 2K7KA 4IRDA 3H5YA 1LOUA 4EBCA 2YV0X 4CGGA 5L8RC 2GQ2A 4FLZA 4C2MA 4NA1A 4DEZA 1R3NA 3D2EB 4DR1K 1A5XA 2E1CA 4ED2A 1UWAA 4ZTFA 2PEBA 5F8JA 4ILLA 3G4SN 1WC6A 3IAYA 4ED0A 3CYMA 2HHUA 4KB7A 2WTUA 1X0FA 1X9SA 1U2VA 1VQNN 2QL7B 3ZSOA 1ZYQA 3V1RA 2JWNA 2BOAA 2MQLA 2MQ8A 4LREA 1GK8A 3ZSRA 1S9GA 4K4SA 3KKRA 4ID1A 3FFKB 1NB2A 3VTHA 3KJFB 2PZSA 4DCPB 2UUBF 1FHTA 1BL3A 5C0YA 2QM1A 1MWMA 2UUCJ 2BA9A 4E1MA 3RWUA 2W42A 4Q2LA 4F02A 3K5NA 4P10A 4USHA 2IIRA 4NXMJ 2J4RA 3E01B 3OR2A 1FTRA 2JLGA 1B0PA 4W98A 3J7ZO 2GMLA 1T9WA 5I3UA 1DLOB 4OZ3A 4CLSA 3WC2A 2ZEJA 1CXUA 4IG0B 1S7HA 2YH1A 1YJ9S 3CJ3A 2F8EX 1TUUA 3MM9B 3P5TL 3QFUA 2VGNA 5AZIB 4BRQA 1RWWB 3FGVA 2W1BA 1M1HA 3O2IA 3MEEA 4C8MA 5D8HB 5JICA 2UXDF 2J0SD 1AW0A 4CLZA 5TKWA 3J8AA 2RD5C 3QESA 3VQ7A 2WVBA 3IGNA 3L7PA 1YTYA 3JS9A 2MLZA 4CJWA 3DRRB 2GJFA 4KH6A 2BJ7A 3GIJA 2P8IA 2PEHA 3I9V9 2ACMA 2DGOA 3VAKA 2JFDA 4X2BA 3HLUA 4I7FB 1QJHA 2P9LB 3HXMA 3PFEA 4W5RA 4CYUB 3G6YA 5CE3A 4FJ9A 4B1WB 3IS9A 5JMNA 3Q0AA 1SJ3P 3RMCA 1RDWX 3I8BA 4NLCA 2V50A 4B9VA 1RT1B 4CLTA 3M8YA 3VQ4A 4GO5X 2MY7A 3TQEA 3DAWA 1IBMK 5EWGA 1IBKK 1P1TA 2OFGX 5IFMA 1SH2A 2IC3A 2QWQA 3SQGA 5FLXO 3OYIA 2HGMA 5E3AA 1XMQJ 4IH6A 3C66A 2IPOB 3U6FA 2AF6A 1RHQB 2D5RA 4GNIA 3BB5A 4U7BA 3TP2A 1IQZA 1AT1B 1UL3A 3BSNA 2ZOGA 1JWWA 2B9WA 2XC9A 3THTA 1NO8A 4KGZB 1TMJA 1T9XA 5SWMA 2ZWHA 4HTUA 3K5OA 2FJXA 2ZBRA 3QRQA 3D0PA 2F5GA 3CJCA 2F1FA 4YB7A 4A5AA 4KH5A 3CMAN 1NCLA 3VCDA 3M4XA 2W7PA 4L3QA 1R8CA 4YNQA 4G1QA 3NKYA 2XZTB 2EVZA 4K41A 3KLEB 4O44B 5DM6Q 3OL8A 2E44A 3NNCA 4A46A 1LAVA 3O4NA 3V1QA 2WHOA 2DJWA 5HP1A 4DI6A 3QT6A 1URRA 3THYB 3OD2A 4CCHA 5HO4A 4DOZA 1SQEA 1RKIA 4ZJOA 3S1TA 1UFKA 3RYLA 3AB2B 3PR5B 3CETA 3QDKA 4PL8A 5F8GA 1J27A 2NUHA 3WXIA 2XMJA 1UPPA 1D1UA 1VSFA 2RF2B 1IKWA 4AHUA 1NGDA 5ETNA 4X4RA 3NCQA 4DWIA 3MM5B 3EPGA 3U1NA 3KG0A 5K20B 2R2TA 3NE6A 2Z2ZA 2YTCA 1Y0HA 1BUXA 2VF3A 3MXJA 1RABB 3R3LA 3OTDA 1VFJA 1IR0A 1DJ0A 2J9DE 4KAIA 4TVAB 3H20A 5F2RA 2GUPA 3N5BA 3UKUB 3DRYA 4CZCA 1C0GA 3AA8A 2EK1A 2NZ4A 1FF2A 2W25A 3JS6A 4MTPA 1LK7A 4HACA 3D0HE 5JVHQ 3MPWA 4NI2B 2QW9A 3M9MB 4ZVUB 5M1NA 1LW2A 1VC6A 4WP9A 1H7XA 4DV2K 1VC0A 4RNFA 2C3YA 5LSLA 1K8KA 4FNIA 4OYWA 2DITA 3MX5A 3VQ8A 3H98A 2P9IA 5IZHA 3SBGA 4WF9L 4I6AA 2DR5A 1ULRA 1OPZA 3A5OC 3BH7B 2O67A 3LPEA 4U7UD 3DGPB 3FGUA 5EXWA 5FDLB 1M5HA 4C98A 2O1PA 4CGHA 3V5RA 1NLVA 1IBCB 3BREA 1N5VA 1S9FA 4JRPA 5DQHA 3A3NB 1VJQA 1UWBB 3HJVA 3KWGA 4ZITA 3RGIA 6AT1B 3R7SB 4PAAA 5CA5A 1X0PA 4JI0K 1SUQB 3OUYA 4F2SA 4Z7CA 1I94J 2FHKA 3EE3A 5F9LA 2W8LA 3CJ4A 3HOSA 4JI4K 3GSDA 2YXLA 1NOYA 2V52B 5THWA 3SUNA 2OAUA 1NGGA 4CVNE 3FSXA 3ZX3A 4JI7K 4WBFA 5EWEA 3KHYA 2AA4A 1RTDA 1UVIA 2RPIA 2Z4PA 1F0XA 3SMZA 2XCPA 3E1YA 2F4FA 3GMGA 5HRRA 2XHCA 1TAQA 5CYQA 1VBKA 2F9JA 3G6XA 1DQAA 4DPWA 3BPSP 3QICA 3UD3P 1VQOS 3V81B 1W7AA 2KRBA 4HHUA 4JLHA 5I42A 1HQEA 5J2PA 3GV8B 3LANA 4PXDA 3CCVS 3OYDA 4N7TA 1IJEB 1SIWB 4EP5A 4MKYA 3BYPA 2AZ3A 4JUZA 4ZVQB 4J9RA 1FCAA 3JTPA 3ONQA 4OZNA 4LFBK 1X5PA 3H7HB 3VALA 4HH0A 5FLXU 5F0UA 2VQFK 2GVZB 5KFQA 1SAZA 1FK9A 3THWA 4A8OA 3ASMA 5L1KA 4CJEA 4KRFA 1RK8A 3MI7X 3N4PA 1GLCG 1NGAA 1RBOB 3HKZD 2FLOA 2J0WA 3HTVA 1YJVA 4YHHF 4LH4A 2OTJN 3L95X 5J2NA 4CLWA 4NCAA 3KDOA 4KRWA 1FDAA 3CQXA 3DRXA 4DZ6A 3MEKA 4GV9A 4DJBA 2WC9A 2GBZA 5KFHA 4DV1J 4MJKA 2HHHK 4PWWA 2KQ2A 5AQSA 2FY1A 3OTOJ 4IBNA 1DTTA 5BYQA 1NWKA 3MTKA 1M5PC 1OKJA 4CF2A 2POKA 1JLEB 2V7YA 4IJAA 1FRIA 3NH0A 2VB6A 3WQPA 4DUYJ 3V6HA 4OYZA 3OS1A 5J1NA 2YHBA 1ZXOA 5DG7A 4HEA9 4WKYA 4FXVA 2V6AA 3VGSA 3MMAB 1C4AA 2KHDA 2W6LA 2PMZD 4OV1A 4Z94A 3OVAA 1TL3B 3GG4A 4F4ZA 3KG4A 4KAZA 2BJ3A 2DVIA 3M2UB 3AA4A 2ILZA 3WXLA 5ETVA 1HHSA 1R8PA 2E2PA 3CD7A 5G0RB 1JLFA 5AJ3J 4UY8T 2ZVSA 2K2PA 4TNOA 4ZP6A 4PQUB 4KV8B 3W9HA 3W61A 2W4DA 3ENVA 3I4HX 3OLBA 1CULA 3CWJA 1WNEA 1DQ9A 1RAJA 3CCES 4Y1DA 4AHCA 5J1EA 1GFWB 2B6AB 3JXUA 4OYXA 3BZQA 3H2LA 2BUPA 4X62K 4NLOA 1KVKA 4Q0BA 4DV5F 3CJ0A 3THXB 2AYGA 4NWBA 3LZIA 4KBIA 3KMQA 3QLHB 4ILRA 2PA8D 1YJTA 1KQSR 2FJDB 2CPYA 3DM2B 2GO8A 4U67L 2XWXA 3DXSX 1S1VB 2P9PA 3LGMA 3ILLA 1O13A 4JI3F 4DF8A 2NXCA 1RHRB 3OFFA 3SCKE 3N28A 2WBNA 3MAHA 3T5LA 4AL6A 1YRUA 5HQMA 4MYUA 4ZVTB 4DL5A 3CDBA 2DNZA 2LU1A 3HM9A 5B08A 3M30A 2QX0A 1MU2A 3D1QA 4LH5A 5AQHA 2FJWA 5F8LA 1GT8A 1J5EF 2YNGA 1QSSA 2A40A 1HNIA 2PD1A 4FCYA 1PJ6A 3G82B 3QRRA 4RG8A 4H0TB 3CD6N 3NHGA 1REVB 4LF6K 3SAHA 4CHPA 1QZ5A 1YJWN 2C22A 4U95A 4DV7F 4KJIA 1K9MT 3FR0A 3TA0A 4CF0A 1GH8A 3CJKB 3HHLA 3ICLA 1YLXA 3H5XA 1U47A 3M5RA 1FEEA 2ITMA 3E9PA 3ZZPA 4PR6A 3IFRA 4CHQA 1WC3A 2UV8G 5BR8J 4IEIA 2ETJA 1VQ6N 3HZGA 3UVJB 1RT2A 3OTBA 5ETSA 4OPAA 3W5YA 4B9SA 1T05A 3NP5A 2W9BA 3NS6A 4P74A 3I5BA 2DYAA 1CVJA 4DTMA 1IVZA 2YX7A 3DDKA 3W3DA 1HQ2A 4CE9A 2CPIA 3T7ZA 1WSFA 1CJKA 1SB6A 2QSFA 2G8IA 3FBBA 3C0BA 3SQ1A 4P73A 4RCHA 4LF9F 4PRFA 2YQ3A 2YWFA 4KTQA 1FKPA 4ID8A 5J2QA 2QMWA 3KLFB 3OSNA 1SL0A 1OH8A 2R3VA 1H7WA 1TL7B 1FXRA 3R5BA 3MN7A 1MG7A 3CC7S 1WF1A 3I96A 3A5LC 2P9GA 4UY85 4B02A 1VQ8N 4TYAA 2QI2A 4DFMA 1CC8A 3O1WA 4O5FA 2PI4A 2FLNA 2ZBPA 1ASUA 5T7LB 4IJNA 4AUKA 1WUAA 2E5JA 5KFUA 4OMFG 3B4DA 2HQFA 5DRKA 2ASMA 4CFCA 4NASA 2KZMA 1E3MA 4DV0F 2GA7A 5LXRA 4FWSA 2ASPA 4MIWA 4CEEA 3T1AA 3DYAB 2I7PA 2K06A 4FS2A 4YS2A 2GWJA 3LAMA 2BRLA 3IRXB 3CIMA 3D3CJ 2QGFB 2YNHA 1K0TA 4CEQA 3PSIA 3FSYA 2JOQA 3NY0A 4Q5VA 4J9KA 1NZAA 5FPEA 3GE9A 1B9DA 3SAFA 1SC4B 2ZF5O 4JI8K 1FXLA 4OPHA 3BM7A 1BO5O 1NK7A 2P9SA 4BG9A 3P39A 1WD6A 3SEOA 3GQCA 2ZKUA 3I8DA 4OZ2A 3J7YP 4PXBA 1N0UA 1T8EA 3B78A 1TKZB 3ID8A 2V34A 1Q4RA 2DK2A 1I3OB 2JC1A 2UZAA 2JEFA 1HYSA 1HJOA 1FD2A 2B4UA 3R9LA 2CGKA 1KVBA 3ZTSA 1S22A 3F56A 1MN9A 3Q8YA 4FS1A 2WW8A 2EFPA 1R8HA 4O3NA 1Y97A 3I6PA 2DNPA 4B9TA 3NRBA 4OHWA 5JVHL 3CW2C 1JJ2R 5KQDA 1FRMA 1MN7A 4BDYA 2CPEA 2RIJA 4OLBA 4BBYA 2RE2A 3MR7A 3QETA 2FJBB 1EQMA 1LV5A 3K2YA 5HL7Q 3ISZA 4EYHB 3AAPA 1YJNS 1HX1A 1LWFA 1X4FA 2XGQA 1KRPA 1Q8IA 3HVWA 4Q8FA 1UW9A 3KLGA 1HWLA 4QS7A 5KFBA 5AQNA 3OFHA 4RWTA 4CJFA 1WDTA 3I55S 3BO4A 4LF8F 1S9GB 1MDUB 3TAQA 5HK4A 1BA0A 1XR7A 2HOEA 1XNQJ 2FXUA 4OYAA 5FIIA 5HJXA 1EZZB 4DU7A 4QWCA 3OYGA 3J7AN 2PAVA 1OY6A 4FSVA 3ZZYA 4O4RA 3OR2B 2XZWA 2MKCA 4ZN3A 4B9LA 4DF4A 1MNEA 4DTUA 3CCJN 5I3UB 5K8PA 1RDCA 2R7YA 3TSQA 3SMSA 1EQ0A 3W3SA 2H4YB 1KWMA 1D8YA 3FMWA 4J91A 3VGTA 1YIJS 2P51A 2H3EB 4ECYA 3JQKA 3PFOA 5HRNA 4OJ3A 2B9YA 1O51A 1CJTA 1ZBFA 4BR7A 3MEEB 1JJ4A 2VJUA 1IWAA 1U8SA 4LSLA 3MK6A 3GG1A 4FNHA 2GV1A 2Y0BB 4HTLA 3PUFA 3O44A 5DG9A 1VR6A 1XR6A 5C25A 3MR2A 1HNZF 2DO4A 1NAQA 4KY3A 1ZTTA 4ZLJA 1OQ3A 4NCGA 2BM0A 3DLHA 2O66A 1N36K 2AP1A 2NSBA 4CJTA 4IO9Q 3I32A 1FDNA 2DR7A 1S7IA 4PEOA 2BJ9A 5H9EK 1UEKA 3IS9B 2RE1A 4C4WA 3H1VX 3PEHA 4CJSA 3GZ7A 1Q16B 1NGEA 3SQOP 2M52A 2XY7A 3Q8UA 2FVCA 4K4ZA 2OPPA 1OYDA 3IWNC 1VGYA 3LDSA 3QATA 4FP9A 1WN7A 4Y3CA 2IC3B 1FA0A 2D9OA 3SQGB 2W24A 4F0KA 1XBWA 2DGWA 3AT1B 3Q8RB 4O0JA 4B3MJ 3CHWA 3J7YU 2NRZA 4QBUA 1KQKA 3S3OA 4PA1A 2GQCA 5CXTA 4DX5A 1R89A 4DTRA 4MH8A 3OBWA 4QIEA 1ZH5A 3TUJC 2F4VJ 5AQXA 3EL2A 2Q6CA 1CJVA 1WF2A 2GIFA 5AQIA 1JLGA 2VKZG 3A8EA 1Y3KA 1T6CA 1U04A 1T02A 2KM8B 2UU9F 2HQ3A 3G6EN 4E7IA 4O0NA 4F36A 3AVJA 4CJ7A 2G8UA 1B70B 3QEIA 2PY5A 1UVLA 4CO1A 1Y5LB 3NGYA 1BQXA 4NEYA 3UNYA 2C3UA 3BH6B 4JI6J 3C6UB 5HP1B 1Q7YT 4Z7YA 3VEVA 3KK2A 3D6RA 4FVUA 4HHJA 1Q18A 1BWVA 1NDKA 4BGAA 5E41A 2M0GB 1S0OA 1HR0F 3RB4A 2XI3A 3OJUA 4R8UA 5LMNK 5CY4A 3SZ2A 2J7WA 5LL6d 2GX8A 1NJWA 1IKWB 1J2VA 2AYMA 4A8QA 3G6VA 2HBZB 1X5OA 3WEEA 4M3WA 1VQ5N 5D15A 1T94A 2FF6A 2QA4S 4X4VA 2IVMA 3J80O 4N76A 2EX3A 3CCTA 3MOZA 4DTSA 1TR0A 4UY8O 3HL8A 1ZBLA 2DGUA 3O1BA 2W9CA 4UZBA 3K8VA 4A5BA 2HGLA 2R8HA 2BOPA 4OYMA 4L8RB 1NJZA 3CCLS 3PO4A 4DR7J 3C3LA 1WTFA 3M1FA 2CG4A 2CH5A 4A8FA 4CJLA 3VGLA 2M70A 4CZKA 3O9UA 4HACB 2W40A 2E5LK 5AXKA 2VBWA 3NH2A 2C2KB 3AD9C 1VIOA 2ZE2A 2ZFHA 5L46A 1C1BA 1CSJA 1VJWA 2E88A 2B5JA 2HNDB 1UZDA 4DL3A 2AGQA 1TKDA 1K8KB 2ATQA 1IM6A 2HF4A 2B4VA 5A8RA 2ZH8A 2P9IB 3CB4A 2HWIA 4UOFA 3SFUA 1VRUA 2YPYA 4JKAA 3ZTRA 4KO0A 4OHYA 1BGXT 1UW4A 3IRWP 1HBOA 1T44A 4RUAA 2BVZA 2XULA 5H9FK 5JXSA 4IFVA 2MHEA 4KGKA 3RW7A 5H1SQ 2RVJA 4BRHA 2GVDA 3W5ZA 3JTOA 5AQTA 2U2FA 4PPDA 1S1TA 1LEOA 1RGVA 1RILA 4DPOA 2DXEA 4BCAA 3E66A 3OUYB 2ATCB 2MZRA 3G4SS 3QSYB 4QAGA 1FXDA 1WHXA 2WBRA 4WQ5C 1DEJA 1S4FA 1IBLF 3T69A 1VQNS 4CI0B 2KXNB 2H5IB 5AQVA 4ED5A 2AJFE 2UUBJ 3VEXA 4JRQA 3M8PA 1TUWA 1KC8T 2LXUA 2MSTA 1K9MO 3FUYA 3N6NA 2A6OA 2OPQA 4PABA 3WNGA 5AQRA 5CYQB 5D0HA 4J2AA 2HF3A 4CWBA 2JSXA 5AFUH 4CT9A 2W4CA 2G9OA 4BRLA 5I42B 3QT8A 3SUQA 4FM1A 5J2PB 5E84A 5AXLA 1VCTA 1GLBG 4NZ7A 3SBTA 2DNRA 1HNWF 1G15A 2HRUA 5JUMA 4WE1A 2IRYA 4U7CA 3H90A 2HBYB 3V9SA 1V3SA 2DRAA 3BDPA 4DSEA 2UXDJ 2MGZA 1IH7A 3W2WA 3BQ0A 3K5PA 1VS3A 4O55A 3TR5A 5CR4A 1FK9B 3J81O 3THWB 1RWMB 1HFEL 2QJ3A 1BE4A 3I82A 2ZC3A 1XN9A 4C0BA 5CD4H 2ZH2A 3LGNA 4DV3F 4W5OA 2X3GA 5ADZA 1IQTA 4O3SA 1EETA 4J5OA 3O5TB 3ZZUA 3EZ5A 3FQLA 1ZBIA 3MD3A 4P6QA 2E2QA 3OBYA 5J2NB 2GW8A 4ISFA 4FZZA 4K4XA 2D1CA 3D7SB 2Z2YB 1WSJA 5T14A 3PV8A 2RAQA 5CHIA 1N6QA 2B9EA 1KQGB 5FLXY 5KFZA 3G0ZA 4ZVGA 3CC2N 2CPZA 2OA8A 1R0BG 4F3OA 4PKIA 2O4IA 3EXCX 2VV5A 5L1IA 2LQJA 3PTWA 2K7JA 2N3LA 1S6OA 3EN9A 4Z37A 2KZZA 5EOYA 1Q9YA 2BW7A 3Q89A 3SBMA 2AQ4A 1RDRA 4F9OA 2EC0A 1S1WA 2KLAA 1Y00A 4FW1A 2GEMA 3VPZA 2AGPA 1HI0P 4OX9K 3VVUA 1NPRA 2UYTA 4C11A 4OGCA 2BKOA 2JGUA 3RRKA 4M3TA 1N5YA 4JNEA 1SJ4P 1F5BA 2KG1A 1S49A 3K5MA 4GKKF 5HJYA 4GVEA 3SSRA 1JIHA 2QTDA 5IWAK 5M1KA 1LKZA 1QQMA 1TUGB 1S1UB 1H0HB 3AVIA 3VN5A 5HN0A 3J80U 2X74A 1ATSA 3W7BA 3E8OA 2KG0A 3AXMA 3CMAS 2MEWA 1JLCA 4DV6K 4GMJB 4ZCMA 2IOCA 2HZVA 1CULB 2A6MA 2EWHA 1SV5A 4KH1B 2XRIA 2XLJA 2VG5A 2DR6A 4J9QA 2E1AA 1RT6A 2C2MB 2P5GA 3UCZP 4IR9A 2KYZA 2CJAA 1TFWA 2BV3A 4B3RF 3CMQA 4Q8EA 2QL9B 2SXLA 4FKYA 2HZCA 2BABA 4Q0BB 1HUXA 3CERA 2NXUA 2UUCF 2E1RA 2Q3PA 5B0CA 4FLXA 2I0XA 4BR0A 1BQNA 2AZ1A 5KI6A 2C2RA 2HVHA 4WIIA 4DU3A 2P9PB 4DR2F 3JTNA 4G9ZA 4TQRA 2VZ9A 3OYLA 2RJZA 4DR3K 1BDGA 3AXKA 4WXWA 2IDOA 1BXNA 3J7YI 3CJSA 3CDEA 2KKZA 2I38A 2AYBA 1FWKA 1BLUA 1V9OA 1QHAA 2QG9B 1UJ6A 3A0IX 4N8NA 4FZYA 1ZM3A 2C2NA 1GMUA 2RSQA 3PIPQ 4JI1K 3CJBA 4J9NA 3KUEA 1T7PA 2YNGB 2CQBA 1HNIB 5KFPA 1TELA 4LRBA 2JL9A 1HNXF 1NH8A 1FE0A 3QIPA 2HRYA 2QLBB 5L39A 3ENOA 4JKDA 3AARA 2GHVC 3L3VA 3R1XA 2H4WB 2G8FA 1AZSA 2VC1A 3IG1A 4RW4A 4QS8A 2AKWB 1JK9B 4ZN1A 5JLHA 4DR6F 4FL9A 4M5GA 5E3CA 3B6OA 4CTAA 3RAXA 3FZLA 3HHLB 3NWRA 3AOBA 4QW8A 4DQPA 2HNYB 1W2BR 1JQGA 1ELOA 3ZTQA 1XK8A 3SSQA 2YNIA 2MKSA 1WOQA 1R8AA 3G2XA 3IR7B 3L4QA 3BEGB 3UCGA 4E19A 3R5GA 1L3VA 1HBMA 1RT2B 3T5HA 4DL6A 4P52A 3MPVA 1T05B 1RLDA 3PYGA 1IV0A 4GC6A 4NRUA 3KK1A 1VSMA 2VFVA 1RTJA 3MX2A 4KHMA 4AXJA 4DMZA 5DLGA 5F0WA 3VERA 2W4PA 1XEZA 3KUGA 4KHPK 1CJKB 3BSCA 3BSAA 5AE1A 3HPOA 2Y9HA 4L3NA 1BU6O 2VWKA 1RU1A 1RDDA 3J81U 4JKCA 3KJQB 1FKPB 2NLWA 4LF5F 3KHLA 3HSDA 5J2QB 1SVDA 4X4PA 1NSQA 3HSGA 2V8GA 3GU0A 2QV6A 5AQJA 2CAJA 2ZOMA 3A8KA 4ZKAA 1QTNB 3NAEA 3PX4A 4WFNQ 2J6SA 4AHRA 3M8RA 4UUXA 5DO2A 1IO2A 1YRXA 1E4GT 4H5TA 1HNVB 4P2SA 3I4PA 4M42A 4IKAA 1KFSA 4WQ4C 2FJAB 4RUBA 3KWIA 1JCEA 2UVRA 3DOKA 3KKFA 4OI6A 2X6SA 1OIAA 3GCWP 2I5JA 3CCSN 3VAGA 3PIOQ 1YXQA 2ZM6F 4YOWA 3IMXA 1QY7A 4IOBA 5CCMA 2FGCA 1ZAVA 3M6XA 1Y10A 4IUFA 4FJXA 2ZJRQ 2YNHB 1YVNA 4M3UA 2HLUA 3VGMA 1B9FA 3P4UB 2UP1A 4UQTA 3PACA 1OVQA 2Z1GA 4KI4A 5KFGA 3PDNA 1F21A 3KVGA 3IMQJ 4YHHJ 2RDIA 5D78A 1LWXA 1ZBTA 2OTJS 4BR5A 3O8WA 2FJVA 1FNXH 5E26A 1ZETA 1Q7YO 2GWKA 2K8GA 2A18A 1U1MA 5DDOC 3BEXA 5GIOA 1U2RA 3NH1A 4ZDNA 4QIFA 3EGVA 4CO0A 2RU9A 1HYSB 2DY1A 3D1OA 3C15A 5KFEA 2WOMA 4DR5F 3BDEA 3DGVA 3HHDA 3B8HA 2IBOA 4CLLA 2OTLS 2DCUB 1BD6A 4C8OA 4PXEA 4DL4A 8ATCB 1F9EB 1UCNA 4LR9A 2GC8A 4KPCA 2HQDA 3NLCA 3L2UA 3KTQA 5B0AA 4H5RA 2IDLA 4ZIWA 5HANA 1KAYA 4DUZF 1VAZA 3CJ5A 3CPEA 3SV3A 2PGCA 2AIRB 2JC0A 1BOTO 4LJMA 3FKBA 1EWQA 1OY8A 1QVFR 2EFVA 3VF6A 4CK2A 3KLGB 2MY8A 1F2HA 1FI4A 5HROB 3VQ9A 2APOA 5CZXA 4ZVPB 4M7XA 1I94F 2IA0A 1VRQC 1FX4A 1EIYB 1NSAA 2KL8A 1T6DA 4MKVA 4LVOP 4H5VA 4YP3A 1M90T 2D0AA 3P5JA 5A2QO 2O01C 1JMTA 4W5TA 3O5BA 2RU3A 4DV5J 1AROP 3AGKA 2PFUA 2VPXB 3W64A 2DTUA 4RWXA 3MWPA 1JLBA 1WSGA 2KHCA 2XMAA 4TU8A 3IR5B 4JI3J 4KB1A 1FDDA 2VFSA 1ZS6A 1B0TA 5EX0A 2B7BB 3UWTA 5HMWA 3OXGA 1CJTB 1SKWA 2G8KA 1RKJA 3HJFA 2X3DA 4USMA 1VBXA 1ITGA 4LSLB 2R7TA 4A61A 3MUMP 3U02A 3AB4B 2C1EB 3C2PA 3CSKA 5C25B 4BACA 1RNHA 2JFKA 3OPKA 3DC2A 3W62A 5EDWA 1J5EJ 5HRSA 2CIMA 1PCAA 3KOAA 4DFJA 4ANDA 1LAWA 4NCGB 3M8QA 2E7WA 1XI1A 1NKCA 1KC8O 4ECQA 4DTXA 5U47A 2H5EA 3TOQA 1X3NA 1GOCA 1FD8A 4KKOA 1YTUA 1YJUA 2CNOB 2CPHA 3A2FA 5ETLA 3OR1A 3R6GB 3FFIA 2VBXA 2FSNA 4CBWA 1YJWS 1X9MA 4C6AA 1N5QA 4LF4K 2PSZA 3KFWX 2J7KA 4X4SA 1K47A 2QC3A 4H0VB 2OPPB 3ZEUA 4E89A 3NGRA 3QPIA 3TZXA 3M6GA 5AE2A 5F1XA 4F04B 4DV1F 2BEFA 4RW6B 4RW7A 3WT0A 1WB9A 4E1NA 4FLUA 4PQAA 1RTHA 2KI2A 3LF0A 4CBXA 2HS4A 2HHPA 2HQGA 4XDCA 2HFZA 2FDNA 5B8HA 1Q0NA 1VQ6S 4EI2A 4CGDA 4JI4J 4O3OA 4B3SF 4N47A 3SCJE 4FJNA 5IT0A 1RU2A 4DUYF 2ZH6A 1XUPO 1WOOA 2I8EA 4O3RA 2AEFA 2A2CA 2ZJQQ 1PBUA 4JI7J 4FXWA 3G96A 4PG8A 1GMVA 1CJVB 4FYXB 1H72C 4EZ6A 3A8YA 3HVTA 1JLGB 3ZYYX 2BH1A 2A6AA 3QMQA 4NXNF 3ZCMA 4LF9J 1VBZA 4CHOA 4WFBL 4ZOSA 1U6FA 5CHCB 4OI1A 4LFCF 3E9OA 2AJ0A 5D4NA 3GV5B 1FDBA 1PC4A 2FHOB 5IT9O 2LEAA 4F3QA 3CXCR 2Y1JA 3TABA 2F96A 5AJ3F 2XZDB 1VQ8S 3CD5A 2DNOA 4GY2B 3VQSA 4PKHA 3KK2B 2HMPA 3NCRA 4F4YA 3H25A 3Q8SB 3NCIA 2YKPA 4DQSA 2FSKA 1RA6A 3RRHA 4R8UB 3CJ7A 4E7JA 1HIYA 4OPJA 1DARA 4DZDA 1G2EA 1S10A 3W66A 2YWWA 1VMBA 4G65A 1WAJA 2VQEK 1NU4A 4DV0J 2V69A 4CHZA 2QZ8A 1A5VA 4ZA1A 4O4GA 4IOAQ 1VQLS 2CQPA 1N33F 3WEEB 3DOLA 1ZM9A 1FWPA 1I3AA 1WC0A 4IQMA 4PUOB 2VKRA 3B6PA 2WBMA 1TK8A 3KHGA 3VQ5A 4BC5A 2LQBA 1V5IB 4NA2A 3HZ6A 2VWBA 3JYTA 5T41A 4URGA 5DDRC 2OPRA 2DIUA 2W9CB 5E3RA 3AOCA 3AVBA 4CGFA 3OYNA 4H8KA 5DDPC 3AH6A 2C3MA 1WDDA 3LWMA 2QWRA 1VSEA 4FVCA 2J76E 2FYXA 4QR0A 2A42A 4PWUA 1RAHB 2ZE2B 3EPIA 1JJCB 4DLGA 1BCOA 1C1BB 1TK5A 5D0GA 3Q7BA 2J6UA 1RTIA 4QU7A 3M2VA 1HPZA 4QIWD 1KSPA 4A8YA 3TTCA 3CCWA 5A8RB 2N7CA 1IWGA 2RDDA 4IDKA 2YCHA 3BKTA 2V68A 4W5NA 4FF4A 2BZ2A 2E9ZA 5A2QU 1HMVA 4KO0B 1HBOB 4BREA 3V2UC 4OJHA 2OD6A 2XG8A 1RT3A 4K4UA 4IFVB 3AVNA 1O5JA 3P49B 1L3SA 2GVDB 4EO8A 2O8EA 1F3VA 1NHKL 3R2CJ 2YX4A 1S1TB 4J9LA 2UXCF 4KH0B 3TZZA 3A13A 2ZH7A 4YDUC 3ETOA 5BR8F 3QEVA 2R7QA 4CFDA 4DTPA 4YUDA 3EE8A 1XNRF 2DHSA 2DCLA 3DLEA 4YB6A 3ZZZA 1DRZA 2IIHA 1SBRA 2MZTA 4WK1A 2HNZA 4LF8J 1JL2A 4NE9C 2CWKA 2FY8A 3QJLA 4K8XA 2YNFB 5KFMA 2DKOB 3KDNA 2YKNA 3M8PB 5M2UA 5EVZA 4C9DA 4CLFA 4QS9A 1TUVA 5F41A 1WSIA 2DEIA 2KB2A 4IRKA 3RR7A 1IG8A 2OPQB 4DXLA 3GJQB 2ZHBA 1D3WA 5ITHA 3Q8QB 4JYAF 4ZPTR 5FD1A 4RNOA 1D5AA 3CCJS 4J90A 4QOZB 3I0SA 3I5AA 3UCUP 4BY9C 2IVFB 2IFXA 4C8YA 4WE1B 1VQPN 1AA1B 5A76A 2RRBA 4IFYA 4ES2A 2F9TA 3WXJA 1OS5A 4NXMK 2V2QA 3EVOA 2MGZB 2HWTA 3DLRA 4X65F 3V9ZA 3KD5E 1XMOF 3K5LA 1HNZJ 3MAQA 2F8TA 4LF7F 1F5AA 4FF2A 1X4GA 3MN9A 3TU5A 1P9YA 4YORA 1EETB 3KNAA 4A2BA 3G10A 4XPCA 5KRSA 4DFKA 3N4QA 5AQOA 4OX6A 4ED8A 1LW0A 2LP4A 4OYPA 1S5ZA 1N48A 1Z25A 4H03B 1XWLA 4FWLA 1VOMA 2IVOA 3R6LB 4OZ1A 4U8YA 3DLGA 4FJLA 2JJ4D 3DN9A 3S8SA 1DT9A 2ZJRL 3WNFA 3DRPA 1N6QB 1BQMA 4LUBA 5DETA 3QWUA 3CM6A 1UFLA 5C7PA 3AODA 3IDHA 5IT9U 3KKSA 4CEZA 1PBAA 3UDCA 1GQEA 3BBCA 1WOSA 3T9NA 1WG1A 3MTJA 4HUEA 1NGBA 1TVRA 3TX0A 4RZRA 2VU5A 3FRYA 1GMWD 3Q23A 4H4OB 1VQ7N 2F9WA 4C11B 1GXLA 1C0TA 1KVAA 3HFZB 4CEAA 5D77A 3RAQA 2FVRA 2CJ9A 1N5YB 1PC5A 1Z2LA 1HWUA 5LMUF 4LFAJ 3I0RA 5HBMA 4B9UA 1B7FA 1LOTB 1HHQA 1R27B 3US5A 2E9TA 2G4BA 3HVAA 4X64F 5C15A 2UU9J 4DTOA 3UI3A 3SMPA 3PEJA 1TV6A 2OFHX 1KP6A 4OI0A 2GHWA 4PZVA 1XMQK 1Y11A 2LKZA 2KXHA 1BIUA 3CCMN 2YX6A 1SV5B 2KT5A 4NA3A 3ENHA 3JAMO 1RT6B 3VVTA 3KK3B 1QE1B 1X4HA 5MLCV 4F50A 2VBZA 4CEDA 2K3KA 2GNKA 3EGWB 1N34F 3UDLA 3NEKA 1SJQA 3SNNA 2ZHAA 3VGUA 3JQJA 1HR0J 1BQNB 1S9EA 3E2EA 1WWHA 5F9NA 2Q66A 2DEJA 2AD9A 3OV7A 3WUHA 2HW3A 2MQNA 3J80Y 1HA1A 3D66A 5JMVA 1WACA 1TL5A 4F8RA 3N4WA 3W5XA 1RDAA 3CCUN 4ELVA 3A8JA 4ANCA 1VLOA 4JI5F 4I0WA 3SUPA 3HZEA 3HI9A 1ITPA 1VQ5S 3CCZA 2CXEA 2WONA 5KFYA 2E7XA 3ITHA 2B0GA 1KAXA 1HKCA 1WC5A 1QVGR 3TWZA 2RQMA 4DSIA 2OO4A 2A1BA 3OYCA 2VGMA 2LMIA 1U1PA 3HD2A 4BRMA 3CC4N 2Q1LA 2GGPA 3OQ2A 4USKA 2Z58B 3U1MA 4WF9Q 1N52B 2DNNA 3Q2TC 1M90O 2C2OB 2HVEA 1MW7A 1AZSB 3GIRA 2NS1B 3EDRB 1SKUB 3O08A 4RW4B 2OANA 5D6GA 2XO6A 3WQTA 2C2DA 2YHAA 3P4IA 2G8VA 1XHXA 3LP0A 3CJRA 4M41A 2OZMA 1KXPA 4CTAB 3B82A 4OZ5A 1X60A 4DV4F 5DLFA 4K43A 4I6YA 1D9FA 2YNIB 2N4CA 3HP9A 5ETKA 5EU7A 2XM3A 5GINA 1S99A 4DDFA 3AVAA 1SI9A 3OVBA 2DFEA 3UE5A 2HRTA 1RCHA 3QGIA 4JKEA 3OLAA 3D6TB 1RDUA 3CE8A 4AHSA 1AXQA 3KK1B 2ZHOA 2E8AA 3H42A 2E2OA 3QT7A 4XK8C 1RTJB 1KQSM 1M0SA 4JKGA 4C48A 2EW9A 4TY9A 2QO3A 1E6YA 3FZKA 3GL1A 4DSLA 1UJ5A 1IBLJ 4UT4A 3FSIA 2Q2RA 3W2VB 1BG3A 3NF8A 2MKHA 2OELA 1NUEA 1U7LA 3SCLE 3WIUA 2XB2D 3VWSA 4CO2A 3T41A 5IS2A 2F4VF 1Y9OA 2CUYA 2JRSA 2CPXA 3MOJB 1RWUA 3PR4A 4K0KF 1GLDG 1T95A 4FBTA 3A12A 3BPDA 2GJ2A 4NL5A 3HDSA 4LR7A 2UVVA 5BN8A 1H98A 3VA3A 4WYWA 4HKQA 2JWLA 1I94K 3WHIA 4YY3F 3D45A 4QW9A 3HT0A 3H2UB 4CEBA 4KHUA 3QB0A 4JV2A 2DRDA 1KLMA 1XTZA 1V4SA 1HNWJ 1NJYA 4AM6A 4KHNA 3DOKB 2BJEA 2ITGA 3J81Y 4DSJA 1PAUB 3BN4A 1HL6A 2CQ1A 4EGLA 4I2QA 4NLGA 1C4CA 2GAHC 1RAEB 5F3ZA 2XNRA 2VPWB 4FXDA 3C14B 4MO4A 1KD1T 1VC5A 3EX7B 3T19A 4OZLA 2D3UA 3AVHA 3S3NA 2JLFA 3H8YA 1T9TA 2Q79A 4FZVA 4KQZA 4DV3J 1DQ8A 2XMWA 3ZZRA 2YQ0A 3IR6B 4RUCA 4WZMA 4TYBA 1NJXA 1ZAWA 5CYMA 2QWPA 8AT1B 2BJ8A 3CDAA 2WVEA 4L6V3 5IOLA 4C8KA 2QA4G 4CJ4A 1VSJA 2Z56B 1FFWB 2PC6A 2V2VA 4ILHA 1ZA1B 1XHZA 1G7CB 4DFPA 4I4BA 3D68A 3EKSA 2FC9A 2BACA 2WOMB 3JAMU 3CC2S 3TYTA 2G13A 2JHEA 2BJDA 3G8QA 4WWSA 3VGVA 3OYBA 1HKAA 4Q45A 7FDRA 2A41A 2DY9A 2Y0SD 2W7OA 3A1YG 3C7NA 3OTOK 4V19J 1TL1A 4CM2A 1FWLA 1HARA 2XHWA 3HOTA 3DXKA 4GKKJ 5B0EA 5AQQA 4B3TF 3C16B 1FKOA 1FW6A 2F65A 3PW0A 3LDNA 4K4YA 1HJRA 3ZSXA 2M7SA 2ASDA 2XMUA 2XMVA 5DQGA 4XDDA 3NGTA 3TVZA 3NCPA 4B3OB 3FVYA 4W5QA 1WF0A 4IYQA 2NSCA 4CP5A 4QU6A 2XMKA 4U67Q 1X4BA 4B3RJ 4DCOB 2Q0RA 1IUJA 1Q82T 4FK4A 1N56A 2EEYA 5BXIA 3QYYA 1HWKA 2E4LA 1AB8A 2LSNA 1JLBB 5AJ3K 1YRTA 1S0MA 3D5MA 2NNWA 1S1XA 3FCWA 4WTYA 3IC1A 4DR2J 3MAAA 4FWNA 4CNZA 3PW2A 4B9MA 4NEZA 1NNDA 5CZ2A 1OH6A 5M2RA 1M5OC 2EHGA 4FWPA 4DQIA 3CCRN 4M63C 2E5LJ 4E1JA 4MO5A 5KT5A 1HI8A 2NRRA 4CZHA 3DNCA 2E20A 3BO3A 2R8KA 2MHNA 4CHNA 2CPJA 4ETZA 1JJ2M 4XTTA 2FF3B 5KFOA 3R1LA 3S41A 3V9XA 1HNXJ 1S6QA 2XSJA 3QGHA 2UVWA 3TZWA 1YITN 3V6KA 4ECSA 2CVEA 4DN0A 1CZAN 3MCAB 1TYQB 4KKOB 2YWHA 4FYVB 1OY9A 3NS5A 2AT1B 3OR1B 4CIOA 3OBIA 4FLVA 3FFIB 2UUAF 5H9FJ 3MUVP 2MTLA 1SC6A 3SCXA 4QR1A 4DR6J 3T1HK 2PI5A 1UVKA 3Q22A 4CECA 2NUBA 4CJUA 3LP2A 1GLLO 1Y4ZB 3ZEUB 3MR6A 2MKJA 4RW7B 1U6ZA 2HVDA 5HVFA 1WUUA 2DY4A 4OVLA 1RTHB 1FRXA 4FJ8A 4I6WA 3ZSQA 4XPEA 4ICLA 1JNZB 2JVRA 1NHVA 3NGKA 2EFNA 2Z1IA 4BLGA 3HSJA 2VDIA 3TZYA 2L3MA 2HPUA 2BQ3A 1ZC6A 3D7EO 3HCXA 5AQZA 1FFSB 1YGYA 2I9SA 4BRNA 5ADXH 1VHFA 4GV3A 4O3QA 4BDPA 1N32F 4DR4F 1QD1A 4MDAA 1X4AA 2MQQA 1T0TV 4LF5J 3NF6A 5BR8K 4CLPA 3QBWA 3KK7A 2ZVIA 1IKYA 1S5JA 2QFIA 3JSBA 3AA2A 1NU0A 3RBZA 4HYKA 4M1KA 3V6DA 3GLJA 3SJHA 4D3HA 4HT7A 3NBPA 5C12A 4X66F 2DFFA 4FM0A 4QYRA 2CKWA 5E33A 4N8OA 3OL9A 2EKNA 1SZ2A 3CQYA 2Z1JA 4YOEA 3LPYA 1PYSB 3QIDA 1NB7A 2PMHA 5AZJA 1AUDA 3FZBA 3RSEA 1QAJA 1GOAA 3Q86A 1EKEA 2HMIA 2ZM6J 4JI2F 2VYPA 3R3TA 2OSRA 3AHPA 3CCSS 5KG7A 1DLOA 1NMNA 3TQ1A 4AQYF 2VD3A 2CNLB 1QHTA 4I9QA 4O4GB 4FLTA 3R5JB 3MCOA 2WUSA 3ZTOA 1RYSA 3TEGA 3O4WA 3DOLB 1BC6A 3HSZA 1PO6A 2B8QA 3MPYA 4KTWA 4W4MA 1IJJA 4BGBA 4YMEA 4WFYA 2BX6A 4B1VA 3R2DJ 3QAUA 3ULEA 3JYTB 1RACB 1YJRA 3RB0A 2BBEA 5KOWA 2K1RB 5M1FA 3H0PA 4JD2A 2BUNA 4QWDA 2HVZA 4HR2A 2KT2A 4M5IA 2HBKA 4FJMA 1VQMN 3UDVA 3OVSA 3F0NA 4PKDB 2EG1A 3A4TA 4GVMA 3QT5A 3IKMA 4OHXA 2WFBA 3PW7A 1RTIB 1YKWA 4X84A 2UXBF 1HPZB 3TR8A 4CIFA 4FBUA 4M3XA 5FJ4A 6FDRA 4DPXA 4IDKB 3WZ0A 3AV9A 5D0EA 3MURP 4DR5J 1TUYA 4FJJA 5M1PA 2XTJP 5LL6Z 1TGOA 4CM0A 2DTJA 1HMVB 4C3KA 3P45B 4CLKA 4M94A 1R6YA 3PZPA 1ESVA 2DNMA 2FJEB 2CG8A 3TUIC 1U1QA 4K50A 2JX2A 3R7NB 1RBLA 1PSDA 5IQ6A 5SUHA 1QSLA 4BC4A 2O8EB 4BWMA 1RAFB 4DR1F 4ELTA 4JOUA 4DUZJ 3U7JA 1LXJA 3ZZTA 2Y8WA 4FWMA 3UPFA 3L3CA 3VEOA 3NAHA 3P8BB 4CLYA 4CZLA 4KPYA 4PHTX 3DLEB 4RWWA 3IWXA 1NPKA 4RX6A 2HNZB 4HTIA 2DR9A 3OXFA 2BQRA 1P8ZA 3DRSB 5A2QY 2YKNB 1EAYC 4RKUC 2Q97A 3MFIA 2ZOFA 4CI6A 2OPSA 3W60A 2CNNB 4O44A 4CGJA 1D9AA 3NS7B 2NRWA 3NDKA 1NSKL 2W8KA 1NGFA 4AD6A 2RUGA 4FM2A 4Y2KA 2OP5A 4P2MA 4LSNA 1B3TA 3I0SB 4DL0C 4DL7A 3RVCA 4USWA 2ZH1A 3ZO7A 2WTFA 2IVPA 1SJRA 1XNQK 4F7VA 2Z30B 2CRLA 4O8UA 2QWMA 3MMCB 3CCQN 4I2PA 1IKXA 1UJ4A 4TSXA 3NGZA 4OKEA 3JSMA 2VG7B 2DNKA 1Q78A 4S0MA 2RF2A 3K9KA 1M1GA 2CDRB 1W25A 4WPAA 3DDIA 1A0OB 4ZP8A 4V19X 1WORA 1FERA 1KVIA 1T3VA 2RHQB 2EBGA 3AY9A 2VOOA 5BREA 2IYIA 4DCHA 1LW0B 2Q6BA 5KFJA 3UKUA 3AD8C 1EQYA 1HBUA 2DNHA 9RUBA 1EB0A 3DLGB 4JB8B 1YBAA 2E5HA 2WB4A 2VL1A 3DRPB 4ZMMA 1S6UA 4WP3A 2CQDA 1NGCA 4O3PA 4KYZA 1BQMB 4YDXA 4CO5A 1NK6A 4MIBA 4HI2A 3S01A 4CIEA 2FHJD 3O9RA 1IBMF 4RTFD 1IBKF 4NYNA 4BRDA 3VAMA 4YN3B 5K9FA 4OKKA 2RQCA 1ZZFA 3UDEA 2M5YA 5KFXA 2XLIA 2OEJA 1TVRB 4BS2A 5KFDA 3K7RA 3PRBA 1KOHA 4HUGA 2XHBA 1KD1O 2VA3A 4B3SJ 5FDLA 4XH1A 2OTLN 3L7UA 3V9WA 3L2RA 1C0TB 2HBQB 3CT9A 2ACYA 2QLFB 3BKUA 4X4OA 2HHVA 3LP1A 3I0RB 5HBMB 3CD0A 1T9UA 5KG4A 1PAEX 3MMBA 3P6YC 5AQLA 4NXNJ 2MDAA 2BANA 5IT9Y 4CD1A 2H51B 3M6UA 1TV6B 4LFCJ 1YZ7A 2LVWA 3BUZB 3U8XA 4B3MK 4H4MA 4X4UA 2YX1A 2QSWA 3NNAA 4GVBA 1JB0C 2CQ2A 4C23A 2GMHA 3SK3A 2F4VK 5M1QA 2OGUA 1YT3A 2C3OA 1K73O 3KIOA 4ES1A 3MECA 4WYLA 1P9QC 3QIOA 4EMDA 1S9EB 4NMXA 3VHQA 4D3GA 3NWGA 2E1ZA 3OXLA 3CPWR 1KTQA 4ILMA 2N3OA 4WQ5A 4BRFA 3OW2R 5I3PA 3SPYA 1WNSA 2IAJA 4DLEA 3ET6A 5KRTA 3VOVA 3DI6A 1VSLA 1BI4A 1V3RA 4JI6K 1N33J 1UPMB 5F8NA 4HTJA 3CFOA 3JSYA 5LM7E 3ITHB 1RWOB 2J9DA 3M6WA 1MMNA 2I1RA 3OSPA 5LJ5Y 1RAOA 3ISNC 2FSJA 3TUPA 3B6BA 2R9LA 3SFGA 4KC5A 3VZIA 2ROGA 4Y28C 2RQKA 2XS7A 1UKUA 1DFDA 1TTHB 3ZFVA 3K58A 1WSRA 3HD1A 1HKBA 3SXLA 5GAHP 1B64A 2P9CA 4DV2F 1ACMB 1Q82O 1NH7A 1K6YA 1YI2N 4KHRA 4UTGA 4RLEA 5B0FA 4K4WA 1OSDA 3LP0B 5AQKA 2AWZA 3KLIB 1FTCA 4CFBA 2V8VA 1ZBUA 3MDFA 3RAMA 5LY3A 3AAWB 4YOVA 2DXFA 4DR7K 2O8BB 2ROEA 2A0FB 3M2RA 2CJXB 4BQZA 1NKBA 4I6MA 3VMFB 3SQ4A 2DXDA 3V9UA 3LAKA 1WG5A 1WEXA 3R5DA 4U9RA 1ZOTA 2UXCJ 4JI0F 4JKGB 1VK0A 4PXCA 4O5BA 4LRAA 1LWCA 4JI4F 2O4GA 1XNRJ 4ED3A 3QRPA 2WB1D 3I31A 5B09A 3QZ7A 3IWLA 2EK6A 1UEUA 1E6VA 3H4DA 4JI7F 5BRDA 5HMZA 2O8DA 1RZMA 4M5MA 5AQFA 1CZ9A 5IXUA 5HVHA 4DS4A 3POTA 1CEZA 1O8BA 3HYFA 3ILJA 1RA7A 3MD1A 5JVGL 2ERRA 4HWIA 4KV8A 3TVYA 2YH0A 3HF5A 2XY8A 3VENA 1HWJA 3MWBA 4JYAJ 4R0EA 2ROPA 1NJIT 2DRBA 3RJMB 3MCNA 1KLMB 2V5HG 4OGEA 4E3SA 5AQPA 3QZ8A 4K4TA 3BV8A 2UUBK 2QLJB 4JV5J 2VDHA 3TA1A 3ZSVA 1FXXA 3QMLA 3QLHA 3EICA 4LFBF 3OJSA 2P9NA 4ED6A 1VQPS 1U1NA 3EYZA 4I2QB 4FKXA 4UQGA 2EPIA 2VQFF 1W2BM 4H0XB 1EO1A 5JS1A 4X65J 3LQVA 1XMOJ 2B9XA 1DY3A 3MMVA 3RMBA 4LF7J 1VQLN 1NEEA 2FC0A 2ZBQA 4DN9A 4P2FA 3ISND 4KGVB 3PO5A 3KD1E 5KAKA 1MWKA 1ATRA 3QFHA 4F2RA 1QAYA 3P5BP 3MN5A 5ETTA 1XC3A 2KN4A 2QE5A 2C2ZB 5D0RA 4IKFA 2UXDK 4L74A 1VHXA 2HHHF 3L09A 4GV6A 2D3O1 1VYAA 1TQLA 3PHEA 4IQXA 5B0BA 1QM9A 4DU8A 1TZ0A 5C24A 3CEDA 3ZZ0A 2BW2A 2LDIA 4IXCA 4J7CA 1PYTA 2JWKA 4MFBA 3P38A 4WYBA 3IN5A 2Q43A 3NMAA 1Q9XA 3IBWA 2KO1A 1Q79A 2JEJA 2C2EA 5AQMA 1U25A 2DGQA 4ZPDA 5GAHU 4RPFA 3P96A 5G4DA 1VQ7S 1PILA 3BF4A 4ZTJA 2VIHA 3C7NB 3HHNB 4CZMA 4LRCA 1RAAB 1TL1B 1H74A 2QMXA 2ZNZA 1YTAA 3MF5A 5LMUJ 1D4XA 4A8KA 4DG1A 5HLFA 3D2WA 3SI8A 4GRSA 2DB1A 4X64J 1GEHA 1U48A 4Q2MA 2R7VA 2AMCB 1FKOB 2KKHA 4FDFA 2QRRA 2IRUA 4ANEA 4M45A 5DK5A 3KG1A 3JAMY 1F60B 4Z4EA 1I1GA 1A6LA 4ZS6A 4GKJJ 3F9MA 5KFNA 1UA0A 5JS2A 2NQPA 1U2VB 2LA6A 1W26A 3AOAA 4HDHA 3CCMS 1H38A 4HCBA 3KLFA 3ZLJA 3TAGA 3LTOA 3GJRB 5K14A 4QQBA 1EKRA 4X62F 4BC7A 4PG6A 3KHRA 4OI2A 2PE8A 4ZHRA 2NXEA 2CQ4A 1YHQS 1N34J 2V51B 4FOIA 1X31C 1RYRA 2E5GA 4ERDA 2DD8S 2X78A 2D0CA 3UE2A 4MYTA 1CJUA 3BR9A 3O8MA 1S1XB 1K8AT 2P9UA 2JDJA 1UVMA 4N41A 3MGJA 2NYIA 2OEMA 4QJVA 1YK9A 4C7QA 3BF3A 3EEQA 3H46O 1WI6A 1BA1A 4JI5J 3CCUS 4YOXA 2ZUGA 3BGOP 5M1OA 2RH3A 2AX1A 2HGNA 4OI3A 2YBVA 2RILA 3KMSA 1G1XA 1T3OA 4ECVA 3IRXA 1GXTA 1OWXA 3CO9A 4F4KA 3LGHA 4CEFA 5BJRA 1S6QB 2XSJB 3HRGA 2HFSA 4FWOA 2IJRA 4CQ1A 2ZDPA 1JJHA 4NLVA 3CC4S 4LF6F 3QJJA 1F1BB 4WQ4A 2NUUG 3DLKA 1KS2A 2DNYA 5KG0A 1X5SA 2XMTA 1NGIA 4CZEA 2JNJA 3PXGa 2AEJA