4JI2K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 26
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji2K00
3J7AP 1HNWK 1IBKK 3J80O 4GKJK 4X65K 5IWAK 4NXMK 4DV7K 4OX9K 1XNQK 4DV0K 4LFCK 4LF6K 4DV2K 4DR4K 1N36K 4KHPK 4DR7K 4DV1K 1IBLK 3OTOK 2UXCK 4AQYK 4YY3K 1IBMK 2VQFK 4JI7K 1N34K 4DV3K 4JI5K 4B3RK 3J7YP 4DUYK 5LL6Z 1HNZK 5IT9O 4LF4K 4DV4K 4X66K 4V19S 4DR6K 3JAMO 4LF5K 4GKKK 3J81O 4B3SK 4JI6K 2ZM6K 1N32K 4JI4K 4LFAK 2E5LK 4DR1K 4CVNE 2HHHK 4JI1K 5A2QO 2F4VK 4JYAK 4CW7B 4K0KK 1XNRK 4NXNK 4B3TK 2VQEK 5BR8K 4DV6K 4JI8K 4DR2K 5LMUK 2UU9K 4LFBK 1HNXK 1FJGK 2UUAK 4JI3K 4DV5K 1HR0K 4DR3K 1J5EK 5AJ3K 4JV5K 5FLXO 4X64K 1I94K 4B3MK 2UUCK 4DR5K 4LF8K 4DUZK 3T1YK 2UXDK 1XMOK 2UXBK 4JI2K 1XMQK 4LF9K 4LF7K 4YHHK 4X62K 2UUBK 4JI0K 5LMNK 3T1HK 1N33K
chains in the Genus database with same CATH superfamily
2GTDA 4CJRA 3CC7N 1HNWK 3U9ZA 1XQSC 1I3AA 2FLOA 4ELTA 4KKOA 4FLXA 3OYFA 1VQ8N 2F9TA 2DFHA 2I5JA 2QXFA 3WNEA 4EP5A 4OX9K 2RHKA 4LFCK 1IKYA 1LOTB 1BOTO 4RW4A 3ZSOA 3HK2A 4KHPK 3HJFA 2NRHA 3FFIA 3FZMA 4H0YB 2A1RA 4ELVA 3A0IX 5I3UA 1DKGD 2GEMA 5F0XA 1BIUA 4EIAA 1KCFA 5JLHA 1S6PA 3DI6A 3RTVA 3H3NO 4IEEA 3QEVA 4DFJA 3MXJA 5AR0A 4CIEA 1L3TA 2Z1IA 2IAJA 2QEXN 2O8BA 1ZC6A 2D5RA 1BG3A 2VG7A 4MDAA 1NGIA 4XH5A 3R1XA 3W0LA 3G10A 1ZBSA 3DLEA 3UKRB 5BREA 2W42A 2E5LK 3AVCA 4BE1A 3O1BA 3C6UA 4K25A 3H3OB 1XNRK 1KAXA 1L3UA 5DM7L 4ZTFA 1G15A 1NJYA 3OYEA 4A5AA 4KHYA 2B5JA 4OLAA 3VA0A 3MEDA 4BR7A 3QFPA 1KRPA 2P5OA 4CF2A 3P83D 4QS7A 1EO1A 3E01A 4RCHA 5J2PA 3D2FA 4M7YA 1SAZA 4JNEA 4CZGA 3DOKA 3BZKA 2O8DB 1I94K 1YITN 3ULEB 4CESA 4CI6A 3TAEA 4DR5K 1ZXOA 5BN8A 1REVA 1RTHA 4E3SA 4JN4A 2FBVA 4F2SA 4YFUA 5AQJA 1BQMA 3U8XA 2P9KB 1VSJA 2UXBK 3CCLN 1RFQA 3V1QA 1CLQA 1QHAA 5FDLA 4WQ5C 3HPHA 1VQLN 2FBXA 3F5TA 3OJUA 1LV5A 5EY4A 2UUBK 5FROA 3WEEB 1NJZA 2OZMA 4KO0A 1YT3A 5AQIA 5AQSA 2ZGYA 4K42A 2P9NB 3HYFA 3V9ZA 1N6QA 4E7KA 3SPYA 4KHWA 4FVMA 1BHLA 1RTJA 4FWQA 4E7JA 2QWQA 4H4OA 2HHSA 4M3UA 1FXXA 1E3MA 4DR4K 1O13A 1HRHA 4JKHA 3GDQA 4GNIA 4DR7K 5M1NA 1A5XA 1YJWN 4AHUA 1W2BM 4A5BA 4CJ3A 1JXBA 2KZZA 1C0MA 1WSFA 5AQQA 3RSEA 2ZJQL 3FZFA 3CI5A 3ZCMA 3S3OA 3AVJA 3DLHA 2P1JA 3CERA 4CFCA 1HJOA 4CECA 3MCPA 3SQ4A 1ASVA 4GKKK 3BF1A 4M41A 2DFFA 4DLEA 4FLWA 3PIOL 3RMAA 3TU5A 3D2EA 2A40A 2I7NA 1QSLA 3K5LA 2JWLA 1WSEA 1X1PA 2QWOA 1K8KA 3VQBA 3MN9A 1SS6A 3N4QA 3IKMA 4B1ZA 1GLJO 2QWRA 1OH8A 1LAVA 4OPJA 3K58A 4CJPA 4Q0BA 3RWUA 1L3VA 2YJFA 3VEZA 3KTQA 4ELUA 3LANA 3UKUA 4FJHA 1VAZA 4EZ6A 1NK6A 2G8KA 3DXKB 3HO1A 2PYJA 3SBGA 3O08A 4H8KA 3CCSN 4CF8A 5JVGL 1VSHA 3AVIA 1BGXT 1QSSA 5AQMA 2WUSA 3DLLL 1ASUA 1C6VA 3VENA 4CGJA 3CXCM 3TAPA 5HL7L 2P9IB 1QS4A 4FL9A 3VQ8A 3O3HA 4DFKA 3AVAA 3OVNA 1S1VA 4TSXA 4KH6A 4NLCA 1QTMA 4CBXA 4I6MA 3ZEUA 4I2QA 3TI0A 4CHPA 1XMQK 2B6AA 4FOEA 2NRVA 4O44A 1BIZA 4AILC 4YHHK 5CYMA 1TYQA 3F2KA 3TWHA 4X62K 3NH1A 1KC8O 4H0VB 3ZT0A 3KKRA 5M1QA 1TAQA 4JD2A 4FK4A 4DSFA 3CPWM 4KH4A 1RDCA 2E4LA 3MK6A 3O4WA 4BR9A 4Z4CA 3MWTA 2B4JA 4J2DA 3QEIA 4JHDB 3H1QA 1RBSA 4LF6K 1XWLA 4FWKA 4M3WA 4IZ9A 3HOTA 1R0AA 3LP0A 1D5AA 4Z4IA 2UXCK 4IFEA 3V4IA 3QNOA 4DTJA 2E1YA 4WQ4C 3H45C 1C0FA 3G4SN 4A61A 4CCHA 3MX5A 3SV3A 3V1RA 5AQUA 3DYAA 5I42A 4JKAA 4IJNA 5AFUH 4CHYA 1TKZA 2VWKA 1N32K 3HP9A 4BGBA 3VETA 4B1WB 4BRNA 4JKCA 4JYAK 1YXQA 3UKRA 4GY2B 4CD1A 4FJ8A 2ITMA 2F8TA 4BRQA 3AO2A 5BRDA 1NK0A 4L3QA 2IGIA 3G71N 1S1TA 4DV6K 4KHUA 2F9WA 4FLUA 1NK8A 3E1YA 4K43A 4FXDA 2NLXA 3E66A 3PSFA 2P9NA 3DRRA 4CFAA 4B9UA 3LDLA 3P4IA 1HUXA 1IKXA 4Y1CA 5CR4A 3SI6A 3HRGA 1OH6A 5MLCQ 4PL8A 1TGOA 3LP1A 4YOTA 4B3OA 4FJGA 4F3TA 4CBWA 4H0XB 4M63C 4DQIA 1KTQA 4ICLA 4IWVA 4MO5A 1NMNA 1JLFA 1YIJN 2YHAA 3OHRA 4Z0UA 4O0IA 3EZ5A 1T6CA 4CF9A 4PKIA 5EVZA 3E9LA 4DU3A 4C1NK 1UAXA 4JKFA 3CCJN 2HOEA 4BWMA 4CJ7A 3O8MA 4F4KA 3LL3A 4X65K 4DG1A 4KRFA 3O6WA 3WXJA 4I2PA 4NXMK 2P9PA 3HSCA 4KPYA 4JEPA 3M6GA 1VSDA 3CFRA 2QM1A 4I9QA 2PY5A 1N36K 3ZX3A 3FFKB 4W5QA 3VOVA 1Z26A 4JK7A 1CZAN 3PSIA 2V51B 5CZ2A 1H1VA 3GBTA 1J54A 3CIPA 4M42A 5M1OA 2Z1GA 3RMCA 3AGRA 2I7PA 3BZCA 2X78A 3VGMA 1NGFA 2IS3A 4BACA 1DTTA 3CG7A 2E6LA 3KLGA 5I9EB 5HRPA 5C2FA 2P9UA 1TYQB 4FPAA 2ZE2A 4HWIA 3LDQA 3ATVA 2E88A 4DQQA 3OS0A 4CZJA 4DS4A 3JYTA 2OCEA 4ILGB 4DB3A 1W0HA 4J8FA 3VQPA 1VRUA 1GLLO 2FSNA 4E7HA 4DTPA 3THXA 2XY8A 3CJCA 4OPHA 3AVNA 3EL2A 3IS9A 4ILJA 2E8AA 4OGCA 3AV9A 5AQGA 1FJGK 2KW4A 1X3NA 2VG6A 5T7BA 4B9NA 5EU7A 4X64K 1Q7YO 3BP8A 4CHNA 4XIUA 1JCFA 4FWPA 3CD6N 2KKZA 5F2RA 1XUPO 3RR7A 3HI0A 2BGGA 3L8BA 4J2AA 3VN5A 4LF7K 3D2FB 4FM1A 4PKHA 3VEVA 4BR0A 3A5OC 4BRMA 1U45A 2G8WA 1MWKA 4CERA 3EN9A 5CZ1A 3HPGA 3J80O 2Q31A 1Q18A 4M7XA 2HMPA 1XNQK 5M1PA 3O9TA 3CQXA 4M3YA 1RT6A 2W40A 5CYQA 3TSQA 4Z4HA 4FJJA 1N8RO 2CGJA 1Z6RA 1MDUB 2CH5A 5BR9A 5BRHA 4BE0A 3VQEA 2HBMA 1C1CA 5AQRA 3TTDA 1RT7A 3MEEA 1KVBA 1MA9B 4KREA 1YTUA 4E1JA 1LWFA 4B9LA 1ITGA 2WONA 1IV0A 1KSPA 4DV4K 3B6OA 3IDHA 4DR6K 3A2FA 5KRSA 1VQON 3J81O 1VSEA 3ZSRA 2ZM6K 4FOIA 1K9MO 1GLBG 4B8CA 4E89A 2QTDA 4CW7B 3CQ8A 3VEYA 4IDKA 1NLVA 3M3ZA 1SQKA 2WC9A 3SJHA 4ISEA 3AVKA 4OJRA 1QQOA 4GVEA 3ZT1A 4OKJA 4EZ9A 3NCIA 1FK9A 1HYVA 4CZHA 1A5VA 1A5WA 1U6ZA 3FLCO 5LMUK 4DFMA 4FPBA 5EOYA 1P8ZA 4W5TA 5GAHP 4CEAA 3DRPA 3CM6A 4IO8A 3M8SA 5FLXO 3RVCA 2HMIA 3K9KA 1EP4A 4U7BA 1KFDA 2IVNA 5HOOA 4BRKA 5CHIA 3RR8A 1TAUA 1BA1A 1Q81O 3KK1A 1JCGA 1VQ6N 4CF1A 3D6RA 3AVGA 2FBTA 5KI6A 5BPNA 2F96A 4GMJB 4RW7A 4CGHA 1X9SA 5AQZA 4I7FA 4E7LA 4M3XA 3CMEN 1W9HA 1JXEA 3SUPA 1NMDA 4MLEA 4BRGA 1YHQN 3VF2A 4J2EA 1KAYA 3V9WA 2NRWA 3LZIA 3VQ5A 4HHTA 2HHWA 3SCXA 3OYLA 5AZIB 3OA9A 4DV7K 4N5SA 4DV2K 4DTNA 1K6YA 3HTVA 1KVAA 2QWMA 3THYB 5KRTA 2D4WA 2G8IA 3CC2N 5JICA 1N34K 5GAEP 2O4IA 3NVMA 1YTAA 1NK5A 4B3RK 5LL6Z 4MDBA 2RF2A 4BDZA 3HBTA 3VQCA 3SMPA 2OPSA 3GOIA 4Y0WA 1RBUA 2D0PA 3ZETA 1J9AA 3PY8A 1MU2A 3O9SA 3CCVN 4GW6A 2NZTA 4B9SA 1GLAG 3QEPA 4JKEA 3CM5A 4HTLA 3V6DA 1K8AO 3O9UA 4KAZA 2OTJN 4FZZA 5JLFA 3HVRA 4JS5A 1EETA 1RDAA 2NUBA 4XEIA 4O4GA 1OVQA 4AHTA 5H1SQ 3A8YA 4B08A 1G99A 2G8VA 4LSNA 4PUOA 3A5NC 2E20A 4CZLA 2QWPA 2IC3A 4JKGB 1DTQA 2CH6A 3C65A 3QERA 4H5TA 3IAYA 1QQCA 3TR8A 4L8RB 2CGKA 4CHOA 4EHUA 4BE2A 3OJSA 4CEDA 4BC5A 3KK7A 4Q5VA 4LF9K 5E41A 1QQMA 3HM9A 1BDGA 2YX6A 1EWQA 1S9GA 3K2PA 4I9LA 5K14A 3ID6A 3NGIA 4IJAA 3CFOA 2E1ZA 1D8YA 1TK8A 2O8FB 4CHZA 4PWDA 1Z25A 3CFPA 1C1BA 3CF5L 1KAZA 1S1XA 2IDOA 3LDOA 3HT3A 1SL0A 2BANA 2A6AA 3DXKA 3CETA 3TTCA 5GADP 4QS9A 4EHTA 1Z05A 1RILA 1YUWA 4FWMA 2P9SA 4BRHA 2AP1A 3HZ6A 3OY9A 4HCBA 1NGBA 1T8EA 1WSHA 3FR0A 1EKEA 4KTWA 5DM6L 3ZSYA 2P51A 3MWPA 1LWCA 4QS8A 3SBTA 3OS1A 2KTQA 2HBKA 3IUCA 1JLEA 2ITGA 5TKYA 1HYSA 1CZBA 3WNGA 3TPQA 1TL1A 1BI4B 1S5JA 1JJ2M 3WQTA 2VG5A 4BR5A 5HRSA 3H1VX 4CVNE 3F73A 3KLIA 1WBBA 4HVJA 3SUOA 2E6MA 2P9KA 3OS2A 3I33A 1WB9A 4PKGA 1ZBLA 1EXQA 4B3TK 3K5OA 3THWB 1V4TA 3QB0A 4RW9A 4FW1A 2O8BB 2BTFA 2FC0A 4KHSA 4UY8O 3SQ2A 3L3UA 5AQOA 2Q36A 3D2EB 1JCEA 1S9EA 3SQ1A 3WNFA 1HNXK 3THVA 4DCHA 2ZWHA 5GINA 1OKJA 3M8RA 2FSKA 2RPIA 3SK3A 4B9VA 4DMNA 4KTQA 4FYDA 1B9DA 4DU4A 3FE1A 1S1WA 3KWIA 4B3MK 3RRHA 2J4RA 3OYGA 1RDUA 5C42A 3AVMA 4OO1J 1IG8A 4C8KA 4B1VA 2GBZA 3SNNA 4WCEL 3FZLA 1RBVA 4FO0A 2EHGA 3RMBA 4CJWA 3F9MA 4BVOA 4Z4FA 4YOWA 2X6SA 1Q8IA 3LWMA 3OYJA 1SUQA 4RWTA 3KD1E 3AA5X 1N33K 3ZT2A 1RT1A 5F1XA 3NF9A 1U2VB 4R5PA 1HKGA 1NKBA 4C8MA 4LD0A 2G8HA 4FJ5A 4BRCA 3CC4N 4KFBA 2OPPA 3GE1A 2P9SB 3HP6A 1T03A 3ZT4A 3VMFB 2G8UA 5AQTA 3VTIA 2P5GA 3QFUA 1ATNA 4IEIA 4CEZA 1Q9YA 3DLBA 3EKSA 3T3FA 3LPTA 4DFPA 2F8SA 4BVPA 4JI7K 4NLBA 3JS6A 4OKEA 1L3SA 4DV3K 5HLFA 1NGEA 3VA3A 4AF1A 3TTFA 1GLDG 5HBMA 4JKBA 1BUPA 1OH7A 3VQ9A 3AO4A 1C0UA 2Q0RA 3O3FA 1U48A 3K0SA 4FJLA 3NF7A 3V1OA 3WXKA 4FWRA 2QKBA 5C10A 4JI4K 2H3GX 1HPZA 3BF3A 3NAEA 1WAFA 4FZYA 3OBYA 3BEXA 4GV6A 1X3MA 4I6MB 4IDHA 1WSGA 2YNIA 5AQNA 4GV3A 3EYZA 3PX0A 2A41A 5E84A 1YI2N 2GUIA 3D45A 5ADXA 1YVNA 3C6AA 4CZMA 1VSIA 4CK3A 3P38A 4DR3K 1S1UA 3ITHA 3ULDA 2ZGZA 3L4IA 4CFBA 4H0PA 1WAJA 3B6PA 3OYCA 5ADXH 2NRZA 2ZD1A 3E9OA 4CEFA 3OYHA 1RBRA 3K59A 2Z1JA 1SKWA 2OZSA 1FKOA 1ZBUA 3SQ0A 3CYMA 4B9TA 3T19A 1XMOK 1YF5L 3QETA 1KD1O 5BPMA 2IVPA 5JS2A 4W5NA 4ZHRA 5KQDA 5KPZA 4IKFA 2OPQA 3I56N 3U4LA 1TUUA 2KZMA 4O5FA 3A5LC 3L2UA 3R8EA 1HYZA 2F7TA 3SUQA 4WQ4A 4PHTX 1T7PA 1K73O 2O8CB 2HF4A 2YNGA 1NGHA 3NH2A 1JL1A 3VPZA 1BL3A 1IBLK 2P9LA 5J2NA 4EAHD 3KKSA 3HXMA 3G0ZA 2HBJA 1FKPA 4PL7A 3MXIA 4PQUA 4FLTA 2VWBA 4K8XA 3QLHA 2IOCA 2BE2A 4BC3A 4DQPA 1XC3A 3W3DA 4BDYA 2HSTA 4CJ4A 5FRNA 2NRTA 1LAWA 4DQSA 5DMRA 3L2QA 4LF4K 1RBTA 5JVHL 3F9KA 3LAKA 4M3RA 5FPEA 5B8HA 5BRFA 2HNZA 1QVGM 4H5NA 4JRPA 4J2BA 1U4BA 4FJMA 3UB5A 2GX9A 3SUNA 1VQMN 4NXNK 3CJ1A 1Q9XA 2W6LA 1RCHA 3L0QA 4CJ5A 1XI1A 1D9FA 3NFAA 3S41A 3CCUN 1BWFO 1YJNN 1GLEG 4FK2A 3A5MC 1C0TA 1VSKA 1EQYA 3PIPL 4DV5K 3MXMA 1JLAA 3LAMA 3U3GA 5AJ3K 4JV5K 4NYNA 1TKDA 3C6TA 2BDPA 3J8AA 2ASMA 1T6DA 3ID8A 3LP2A 4E19A 3T1YK 1QQNA 1RT5A 3UKUB 4JS4A 3PX6A 1WBDA 4DU1A 1NOYA 4WF9L 2NNWA 3RMDA 1E4FT 4FM0A 3GL1A 2WOMA 3O1WA 3OYBA 3MECA 4FJ7A 3T1HK 4BC4A 1QVFM 4KB1A 4WFNL 2HHQA 4BY9C 3K57A 4MO4A 1Y64A 3C0BA 3NHGA 4LC9B 4DKWA 3V9UA 4DV0K 3TARA 4H0OA 4B8AB 1NKEA 1NGAA 4FWLA 2VWJA 3TAQA 4CF0A 4DV1K 4KHNA 2OPRA 4ISGA 2D0OA 4E1NA 4WYBA 2ZQBA 4AQYK 3HVTA 3J7ZO 2YI1A 3THXB 2QWNA 2VQFK 4CJKA 2HHVA 2QW9A 5AQVA 4CJQA 3M8QA 4O55A 1S6QA 3B8AX 4NCGA 3EKUA 1NJXA 1VQ7N 1RNHA 2BH1A 3H08A 5CE3A 5IT9O 3CCQN 4MFBA 4DQ8A 3C94A 4V19S 4BG9A 4JRQA 4LH5A 1F21A 5KGXA 3Q7BA 4PY5A 3NE6A 3TANA 5AQXA 4JI1K 3BUZB 2AA4A 1RT3A 3S3NA 3QINA 1WN7A 4FJXA 4E0DA 4GVMA 2YNFA 1X9JA 1GOBA 3VQ6A 3QIPA 4RW8A 1HPMA 4BRLA 4JI8K 1ATSA 4GV9A 3CHWA 2UU9K 3E9PA 3AA4A 3MCAB 4LFBK 4FZXC 3V9XA 1YVUA 4OKKA 1SL2A 4DF8A 3DLGA 1Q86O 1GLCG 5AZIA 4BRIA 3KLHA 2RKIA 1HKCA 2BUPA 4O5BA 4CE9A 4CEEA 3N4PA 4CJUA 5AZJA 1ILYA 2E2PA 5FPDA 4DUZK 2UXDK 3TAMA 1NK9A 4DTSA 3TAFA 1J53A 3L6QA 3FZKA 1QE1A 2PBDA 4BQZA 4B9MA 1NNEA 3NBPA 5C25A 3K5NA 4CZEA 3LWLA 1VQ9N 2VGNA 1TK5A 1N5YA 3HM8A 5BPLA 5E26A 1X9WA 3O80A 1V4SA 1LWEA 1IBKK 4B1XB 4HCCA 3AVBA 1VQKN 2D0CA 3ENOA 4FW2A 3OYKA 5J2MA 4BR2A 3SZ2A 4C8NA 2GWJA 1HJRA 4KBOA 4CEQA 2YV0X 3VTHA 2Y1JA 1NGDA 2HHUA 3SV4A 1CXUA 1EX4A 4IFYA 4DSJA 2E2OA 3AGKA 1KQSM 5C15A 2DY4A 3ZSWA 3TSUA 3S3MA 1HNZK 4CK1A 4B1UB 4A2AA 4DTUA 3OBWA 3R6MA 3ASMA 4KI4A 3OYDA 2GWKA 4N76A 1SKSA 3O3GA 3K9JA 4IO9L 2ATQA 2V52B 4CZIA 3VQ4A 3DM2A 4K0KK 3KIOA 4CGIA 3QIOA 2EWSA 1BQNA 4K8ZA 1SL1A 3ULEA 1ESVA 2O8EB 4CD3A 2YHWA 3IG1A 1R59O 4NB4A 3EE8A 4DR2K 5TKWA 1L5UA 2P9UB 2YCHA 2KHOA 2JGUA 4JI3K 1HR0K 4IOCL 5SWMA 2LSNA 1MWMA 2VCPA 3SYZA 3IRXA 1U47A 4JAXA 2FF6A 1QZ6A 1BA0A 3KK2A 4FSVA 3O9QA 1HX1A 2A3ZA 4BG8A 2A5XA 4JI2K 2ASOA 4YDUA 4Z4GA 2QI2A 2YNHA 3K5MA 4NCBA 4QCLA 3HOSA 1J5OA 4YOXA 1BCOA 3CQYA 4R79A 4QOZB 4FJ9A 1NJWA 2HVIA 5AFUA 2O8DA 2IVOA 4EFHA 2VGMA 3ZSVA 3PO5A 5HP1A 1VQ5N 3JXUA 4KV8A 3HSTB 1XHXA 1GOAA 3WNHA 3QDKA 4IXCA 3O9RA 3SAHA 2O8EA 3AO3A 3D7EO 3ZETB 2PZSA 1IG9A 2YKMA 3OTOK 5FRMA 1IJJA 3I0RA 1T05A 1YJ9N 3OW2M 4AHRA 2OA8A 2VYPA 1W97L 1WNSA 3OYNA 4HUGA 2A1SA 4F8RA 4YOUA 1NG9A 2ASPA 1W7AA 4M45A 2CGLA 1HMVA 4BRAA 4DUYK 1S72N 1O1WA 5C24A 3OYAA 2XHBA 2ETJA 1NU0A 4JI6K 4JLHA 4FLYA 4LFAK 3CCMN 2KFZA 3SPZA 4YORA 1DEJA 1JLCA 1QSYA 2FXUA 2QWLA 4F3OA 3KK3A 1RDWX 3VF6A 3UIQA 5C12A 1VSLA 1IO2A 1CXQA 2R7YA 3KLFA 4KB0A 3LALA 1JKHA 3MMVA 4H5WA 3ENBA 1J6ZA 5AQHA 1VRTA 3EEQA 4QAGA 3PV8A 3RSEB 1RGIA 4DTOA 1VQPN 2P9PB 2PAVA 2HW3A 3SMSA 3TAGA 3AY9A 4F2RA 3NDKA 1BO5O 4BRDA 5M1KA 5J1EA 4YDUC 2QA4N 2JWKA 3WXLA 2NRRA 2HB5A 5C0YA 4XH4A 4BC2A 3G6EN 1HNIA 1K8KB 3TABA 4AH9A 3MAQA 5HROA 3I8DA 1Y97A 1WUAA 3CCRN 3I0SA 2DPNA 1LW2A 3CPEA 3IFRA 2HBLA 3DXMB 3DXMA 1UOCA 1QZ5A 4OPKA 1IKVA 2HHTA 5AQWA 3NF8A 5C2DA 1HNVA 1KVCA 4ID1A 4BWJA 3NMUA 4CJSA 3C95A 2W41A 5BN9A 4FM2A 3THYA 2A42A 1ZBIA 1WLJA 4IOXA 3AVFA 2QK9A 2P9LB 3WXIA 3QEWA 2OYQA 1BISA 3LPUA 1NJIO 4IG0A 3L2VA 4PA1A 2Q97A 4DSEA 1D9DA 2WTUA 4JHDA 1YAGA 3JAMO 3ATUA 3MN7A 4B3SK 2DTUA 5J2QA 1HQUA 2KQ2A 4DTMA 2NRXA 1UA0A 1RT4A 1ZYQA 1HLUA 4M3TA 2YHYA 1I39A 4DR1K 1U04A 4CGDA 3T7ZA 1BCMA 1NGJA 1BU6O 5A2QO 4YOYA 1HQEA 4C23A 5JS1A 5AQKA 1VQNN 2IIRA 3FZHA 3V9SA 3AVHA 4LSLA 5KQ8A 4HUFA 1NK4A 1GLFO 3SAFA 3CJAA 4DSIA 1DGKN 2DFEA 4A62A 3KZBA 3SLCA 3H46O 3LM9A 4BQLA 3VGKA 4O8UA 4O8KA 1M90O 1U2VA 2YHBA 4KI6A 3FGUA 4IG3A 3C6HA 1JL2A 4RW6A 4HTUA 3WXMB 4OPAA 1XC9A 5EXWA 2O8CA 4FVUA 4DS5A 4AM6A 4JK8A 1DT9A 3QO9A 2YKNA 1WOQA 1RDDA 2D1KA 2XRIA 2FF3B 2FSJA 2O4GA 2Q3SA 4XH1A 3L3VA 5LMNK 3NGZA 2PYLA 5KGWA 4BRFA 3CJ9A 3PLAA 4A59A 1EWRA 4OVLA 2V7YA 4BDPA 2Q0UA 4GKJK 1B92A 4JKDA 4E7IA 1NBWA 4C1NI 1X9MA 4BRPA 3L2RA 2HF3A 3GG4A 1TUYA 5FPMA 1TV6A 4FCYA 4DTXA 4JI5K 3AO5A 1WSIA 2E2QA 3J7YP 1RT2A 5GIOA 3T69A 3EO3A 4WE1A 1XHZA 4X66K 1SZ2A 1ATRA 4N56A 3EE9A 3PUFA 4IBNA 4NCAA 3DAWA 3KJVA 2XY7A 5HRRA 3L4QA 1RTDA 3QICA 5LY3A 2HVHA 1KLMA 1NOZA 1JLGA 3RRGA 4CBUA 4DTRA 4AHSA 3U3YA 1TKTA 3CJBA 4FLZA 5BR8K 2FBYA 1M1KO 2D0AA 3WT0A 5LJWA 2YHXA 1TK0A 3QNNA 3C7NA 2V7ZA 1FW6A 2X6NA 3MN6A 3QMLA 3ZYYX 2XY6A 4FJNA 5KPTA 3MDQA 3WQUA 1U49A 1SKRA 4KH5A 2UYTA 4JD2B 2E2NA 3VQDA 4NO7A 1P90A 1VHXA 1TL3A 4H03B 4LF8K 2ZF5O 1VQ4N 2G8FA 4ILHA 3VEXA 3DRSA 4CJVA 4FJKA 3EY1A 3VESA 4RG8A 3ENHA 5AZJB 3MEGA 4BREA 4JKGA 4UQGA 4H5VA 3CMAN 3KHYA 4U67L 4CK2A 1B9FA 4FJIA 3J7AP 4H5RA 1KXPA 3Q7CA 5DK5A 3CJ7A 3S9HA 5GIPA 3O4QA 2Q2RA 1UA1A 3AAQA 3EZWA 1LW0A 4N41A 4FK0A 4B9QA 1SV5A 1LCUA 3G25A 4W5OA 1OH5A 3LDNA 4BR4A 4G9ZA 1D4XA 4RTFD 5EX5A 4CHQA 3JSMA 1RDBA 1UWBA 4LY7A 1IBMK 3BY5A 3LM2A 1S22A 4CJLA 2OANA 2GUPA 4CEOA 3HL8A 3O5BA 1C0GA 1GOCA 2YJEA 1T3VA 3P1GA 1C1AA 3ZSQA 3CCEN 3VGLA 4H4MA 2XY5A 4LF5K 3WEEA 3V81A 4LH4A 3LP3A 1KFSA 2Q1NA 3DWLA 4BGAA 1TVRA 4ISFA 3NF6A 2F4VK 4G1QA 3DMJA 1VSMA 4DSKA 3P5JA 2VQEK 4MLHA 4N47A 1NWKA 2WBNA 4FWOA 2KFNA 3NGYA 4B1YB 4O0JA 3KLEA 1T44A 4DWIA 1VSFA 2HNDA 3QEXA 3ALYA 4CJEA 3DLKA 5KPRA 4Y1DA 4CIGA 1IH7A 2QKKA 3R9PA 3P31A 4IFVA 3VF4A 4WFBL 3IMXA 5AQLA 4CJTA 1J5EK 2HHXA 4E1MA 4JK9A 4A57A 5FPNA 3DJCA 4AHVA 3DLRA 2OTLN 4A2BA 3U9DA 3NVKA 2PFUA 2XO7A 4FWSA 3BDPA 1IKWA 5GAGP 2WFBA 3U6FA 3QBWA 3ZT3A 2AJQA 1ZBHA 1HKBA 3WUHA 3KWGA 3ZSXA 3VEWA 3BGRA 4DHYA 4M3ZA 2GV9A 3LDPA 4CJFA 3I55N 5CY4A 1JLQA 3VEOA 5SZTA 3D0PA 5ELZA 4ZTJA 2EX3A 3MX2A 2ZJRL 2P9IA 4CIFA 3NH0A 4F9OA 3R3LA 5IWAK 5D3GA 3PX4A 1OVYA 1ASWA 2ZJPL 3LZJA 2Y1IA 1ZBFA 4WFAL 4YNQA 3L2WA 3P39A 3KD5E 3LDSA 4AHCA 3HPOA 1E4GT 4DF4A 3ZX2A 4YY3K 4C8LA 3ZLJA 3M8PA 1Q82O 3UE5A 1BI4A 3O4NA 5HRNA 4CZKA 2D0BA 3ISNC 4YOVA 3C7NB 3T1AA 2JLEA 4HUEA 1NK7A 4KHQA 3VQQA 3DOLA 3M1FA 5KTQA 1CZ9A 3SAGA 3VQAA 3ZX0A 2W6KA 4ID5A 3QESA 4KTZA 4BROA 2KLAA 4W5RA 3MN5A 5AQPA 2HHHK 3AO1A 4FLVA 3THWA 3QBXA 1DLOA 3TSPA 4C8OA 1WSJA 4OLBA 3I8BA 4DSLA 4AM7A 4DLGA 3VQ7A 4Z94A 2RE2A 5AQYA 3OYIA 4NYFA 4EP4A 2UUAK 3AAPA 1NGCA 2O8FA 5M1FA 2GELA 1TKXA 3ZSZA 3AA3A 4CGFA 4CEBA 3AA2A 4CGGA 3KVGA 4FWNA 2Z1HA 2RN2A 1RTIA 4DQRA 3SJJA 1NM1A 5JMVA 2UUCK 3VERA 1KLNA 4CZFA 4IOAL 2QXLA 5AQFA 3ZEUB 4CFDA 4K41A 3OYMA 1VK0A 1QHTA 1JLBA 1S3XA 3PO4A 4H0TB 3M5RA 1NGGA 3AARA 4Z4EA 3H6EA 4OGEA 4WQ5A 5LJVA 4JI0K 3AVLA 2HNYA 4MQ3A 1NKCA 2X74A
chains in the Genus database with same CATH topology
3J7AP 1HNWK 1IBKK 3J80O 4GKJK 4X65K 5IWAK 4NXMK 4DV7K 4OX9K 1XNQK 4DV0K 4LFCK 4LF6K 4DV2K 4DR4K 1N36K 4KHPK 4DR7K 4DV1K 1IBLK 3OTOK 2UXCK 4AQYK 4YY3K 1IBMK 2VQFK 4JI7K 1N34K 4DV3K 4JI5K 4B3RK 3J7YP 4DUYK 5LL6Z 1HNZK 5IT9O 4LF4K 4DV4K 4X66K 4V19S 4DR6K 3JAMO 4LF5K 4GKKK 3J81O 4B3SK 4JI6K 2ZM6K 1N32K 4JI4K 4LFAK 2E5LK 4DR1K 4CVNE 2HHHK 4JI1K 5A2QO 2F4VK 4JYAK 4CW7B 4K0KK 1XNRK 4NXNK 4B3TK 2VQEK 5BR8K 4DV6K 4JI8K 4DR2K 5LMUK 2UU9K 4LFBK 1HNXK 1FJGK 2UUAK 4JI3K 4DV5K 1HR0K 4DR3K 1J5EK 5AJ3K 4JV5K 5FLXO 4X64K 1I94K 4B3MK 2UUCK 4DR5K 4LF8K 4DUZK 3T1YK 2UXDK 1XMOK 2UXBK 4JI2K 1XMQK 4LF9K 4LF7K 4YHHK 4X62K 2UUBK 4JI0K 5LMNK 3T1HK 1N33K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A P;  1HNW K;  1IBK K;  3J80 O;  4GKJ K;  4X65 K;  5IWA K;  4NXM K;  4DV7 K;  4OX9 K;  1XNQ K;  4DV0 K;  4LFC K;  4LF6 K;  4DV2 K;  4DR4 K;  1N36 K;  4KHP K;  4DR7 K;  4DV1 K;  1IBL K;  3OTO K;  2UXC K;  4AQY K;  4YY3 K;  1IBM K;  2VQF K;  4JI7 K;  1N34 K;  4DV3 K;  4JI5 K;  4B3R K;  3J7Y P;  4DUY K;  5LL6 Z;  1HNZ K;  5IT9 O;  4LF4 K;  4DV4 K;  4X66 K;  4V19 S;  4DR6 K;  3JAM O;  4LF5 K;  4GKK K;  3J81 O;  4B3S K;  4JI6 K;  2ZM6 K;  1N32 K;  4JI4 K;  4LFA K;  2E5L K;  4DR1 K;  4CVN E;  2HHH K;  4JI1 K;  5A2Q O;  2F4V K;  4JYA K;  4CW7 B;  4K0K K;  1XNR K;  4NXN K;  4B3T K;  2VQE K;  5BR8 K;  4DV6 K;  4JI8 K;  4DR2 K;  5LMU K;  2UU9 K;  4LFB K;  1HNX K;  1FJG K;  2UUA K;  4JI3 K;  4DV5 K;  1HR0 K;  4DR3 K;  1J5E K;  5AJ3 K;  4JV5 K;  5FLX O;  4X64 K;  1I94 K;  4B3M K;  2UUC K;  4DR5 K;  4LF8 K;  4DUZ K;  3T1Y K;  2UXD K;  1XMO K;  2UXB K;  4JI2 K;  1XMQ K;  4LF9 K;  4LF7 K;  4YHH K;  4X62 K;  2UUB K;  4JI0 K;  5LMN K;  3T1H K;  1N33 K; 
#chains in the Genus database with same CATH topology
 2GTD A;  4CJR A;  3CC7 N;  1HNW K;  3U9Z A;  1XQS C;  1I3A A;  2FLO A;  4ELT A;  4KKO A;  4FLX A;  3OYF A;  1VQ8 N;  2F9T A;  2DFH A;  2I5J A;  2QXF A;  3WNE A;  4EP5 A;  4OX9 K;  2RHK A;  4LFC K;  1IKY A;  1LOT B;  1BOT O;  4RW4 A;  3ZSO A;  3HK2 A;  4KHP K;  3HJF A;  2NRH A;  3FFI A;  3FZM A;  4H0Y B;  2A1R A;  4ELV A;  3A0I X;  5I3U A;  1DKG D;  2GEM A;  5F0X A;  1BIU A;  4EIA A;  1KCF A;  5JLH A;  1S6P A;  3DI6 A;  3RTV A;  3H3N O;  4IEE A;  3QEV A;  4DFJ A;  3MXJ A;  5AR0 A;  4CIE A;  1L3T A;  2Z1I A;  2IAJ A;  2QEX N;  2O8B A;  1ZC6 A;  2D5R A;  1BG3 A;  2VG7 A;  4MDA A;  1NGI A;  4XH5 A;  3R1X A;  3W0L A;  3G10 A;  1ZBS A;  3DLE A;  3UKR B;  5BRE A;  2W42 A;  2E5L K;  3AVC A;  4BE1 A;  3O1B A;  3C6U A;  4K25 A;  3H3O B;  1XNR K;  1KAX A;  1L3U A;  5DM7 L;  4ZTF A;  1G15 A;  1NJY A;  3OYE A;  4A5A A;  4KHY A;  2B5J A;  4OLA A;  3VA0 A;  3MED A;  4BR7 A;  3QFP A;  1KRP A;  2P5O A;  4CF2 A;  3P83 D;  4QS7 A;  1EO1 A;  3E01 A;  4RCH A;  5J2P A;  3D2F A;  4M7Y A;  1SAZ A;  4JNE A;  4CZG A;  3DOK A;  3BZK A;  2O8D B;  1I94 K;  1YIT N;  3ULE B;  4CES A;  4CI6 A;  3TAE A;  4DR5 K;  1ZXO A;  5BN8 A;  1REV A;  1RTH A;  4E3S A;  4JN4 A;  2FBV A;  4F2S A;  4YFU A;  5AQJ A;  1BQM A;  3U8X A;  2P9K B;  1VSJ A;  2UXB K;  3CCL N;  1RFQ A;  3V1Q A;  1CLQ A;  1QHA A;  5FDL A;  4WQ5 C;  3HPH A;  1VQL N;  2FBX A;  3F5T A;  3OJU A;  1LV5 A;  5EY4 A;  2UUB K;  5FRO A;  3WEE B;  1NJZ A;  2OZM A;  4KO0 A;  1YT3 A;  5AQI A;  5AQS A;  2ZGY A;  4K42 A;  2P9N B;  3HYF A;  3V9Z A;  1N6Q A;  4E7K A;  3SPY A;  4KHW A;  4FVM A;  1BHL A;  1RTJ A;  4FWQ A;  4E7J A;  2QWQ A;  4H4O A;  2HHS A;  4M3U A;  1FXX A;  1E3M A;  4DR4 K;  1O13 A;  1HRH A;  4JKH A;  3GDQ A;  4GNI A;  4DR7 K;  5M1N A;  1A5X A;  1YJW N;  4AHU A;  1W2B M;  4A5B A;  4CJ3 A;  1JXB A;  2KZZ A;  1C0M A;  1WSF A;  5AQQ A;  3RSE A;  2ZJQ L;  3FZF A;  3CI5 A;  3ZCM A;  3S3O A;  3AVJ A;  3DLH A;  2P1J A;  3CER A;  4CFC A;  1HJO A;  4CEC A;  3MCP A;  3SQ4 A;  1ASV A;  4GKK K;  3BF1 A;  4M41 A;  2DFF A;  4DLE A;  4FLW A;  3PIO L;  3RMA A;  3TU5 A;  3D2E A;  2A40 A;  2I7N A;  1QSL A;  3K5L A;  2JWL A;  1WSE A;  1X1P A;  2QWO A;  1K8K A;  3VQB A;  3MN9 A;  1SS6 A;  3N4Q A;  3IKM A;  4B1Z A;  1GLJ O;  2QWR A;  1OH8 A;  1LAV A;  4OPJ A;  3K58 A;  4CJP A;  4Q0B A;  3RWU A;  1L3V A;  2YJF A;  3VEZ A;  3KTQ A;  4ELU A;  3LAN A;  3UKU A;  4FJH A;  1VAZ A;  4EZ6 A;  1NK6 A;  2G8K A;  3DXK B;  3HO1 A;  2PYJ A;  3SBG A;  3O08 A;  4H8K A;  3CCS N;  4CF8 A;  5JVG L;  1VSH A;  3AVI A;  1BGX T;  1QSS A;  5AQM A;  2WUS A;  3DLL L;  1ASU A;  1C6V A;  3VEN A;  4CGJ A;  3CXC M;  3TAP A;  5HL7 L;  2P9I B;  1QS4 A;  4FL9 A;  3VQ8 A;  3O3H A;  4DFK A;  3AVA A;  3OVN A;  1S1V A;  4TSX A;  4KH6 A;  4NLC A;  1QTM A;  4CBX A;  4I6M A;  3ZEU A;  4I2Q A;  3TI0 A;  4CHP A;  1XMQ K;  2B6A A;  4FOE A;  2NRV A;  4O44 A;  1BIZ A;  4AIL C;  4YHH K;  5CYM A;  1TYQ A;  3F2K A;  3TWH A;  4X62 K;  3NH1 A;  1KC8 O;  4H0V B;  3ZT0 A;  3KKR A;  5M1Q A;  1TAQ A;  4JD2 A;  4FK4 A;  4DSF A;  3CPW M;  4KH4 A;  1RDC A;  2E4L A;  3MK6 A;  3O4W A;  4BR9 A;  4Z4C A;  3MWT A;  2B4J A;  4J2D A;  3QEI A;  4JHD B;  3H1Q A;  1RBS A;  4LF6 K;  1XWL A;  4FWK A;  4M3W A;  4IZ9 A;  3HOT A;  1R0A A;  3LP0 A;  1D5A A;  4Z4I A;  2UXC K;  4IFE A;  3V4I A;  3QNO A;  4DTJ A;  2E1Y A;  4WQ4 C;  3H45 C;  1C0F A;  3G4S N;  4A61 A;  4CCH A;  3MX5 A;  3SV3 A;  3V1R A;  5AQU A;  3DYA A;  5I42 A;  4JKA A;  4IJN A;  5AFU H;  4CHY A;  1TKZ A;  2VWK A;  1N32 K;  3HP9 A;  4BGB A;  3VET A;  4B1W B;  4BRN A;  4JKC A;  4JYA K;  1YXQ A;  3UKR A;  4GY2 B;  4CD1 A;  4FJ8 A;  2ITM A;  2F8T A;  4BRQ A;  3AO2 A;  5BRD A;  1NK0 A;  4L3Q A;  2IGI A;  3G71 N;  1S1T A;  4DV6 K;  4KHU A;  2F9W A;  4FLU A;  1NK8 A;  3E1Y A;  4K43 A;  4FXD A;  2NLX A;  3E66 A;  3PSF A;  2P9N A;  3DRR A;  4CFA A;  4B9U A;  3LDL A;  3P4I A;  1HUX A;  1IKX A;  4Y1C A;  5CR4 A;  3SI6 A;  3HRG A;  1OH6 A;  5MLC Q;  4PL8 A;  1TGO A;  3LP1 A;  4YOT A;  4B3O A;  4FJG A;  4F3T A;  4CBW A;  4H0X B;  4M63 C;  4DQI A;  1KTQ A;  4ICL A;  4IWV A;  4MO5 A;  1NMN A;  1JLF A;  1YIJ N;  2YHA A;  3OHR A;  4Z0U A;  4O0I A;  3EZ5 A;  1T6C A;  4CF9 A;  4PKI A;  5EVZ A;  3E9L A;  4DU3 A;  4C1N K;  1UAX A;  4JKF A;  3CCJ N;  2HOE A;  4BWM A;  4CJ7 A;  3O8M A;  4F4K A;  3LL3 A;  4X65 K;  4DG1 A;  4KRF A;  3O6W A;  3WXJ A;  4I2P A;  4NXM K;  2P9P A;  3HSC A;  4KPY A;  4JEP A;  3M6G A;  1VSD A;  3CFR A;  2QM1 A;  4I9Q A;  2PY5 A;  1N36 K;  3ZX3 A;  3FFK B;  4W5Q A;  3VOV A;  1Z26 A;  4JK7 A;  1CZA N;  3PSI A;  2V51 B;  5CZ2 A;  1H1V A;  3GBT A;  1J54 A;  3CIP A;  4M42 A;  5M1O A;  2Z1G A;  3RMC A;  3AGR A;  2I7P A;  3BZC A;  2X78 A;  3VGM A;  1NGF A;  2IS3 A;  4BAC A;  1DTT A;  3CG7 A;  2E6L A;  3KLG A;  5I9E B;  5HRP A;  5C2F A;  2P9U A;  1TYQ B;  4FPA A;  2ZE2 A;  4HWI A;  3LDQ A;  3ATV A;  2E88 A;  4DQQ A;  3OS0 A;  4CZJ A;  4DS4 A;  3JYT A;  2OCE A;  4ILG B;  4DB3 A;  1W0H A;  4J8F A;  3VQP A;  1VRU A;  1GLL O;  2FSN A;  4E7H A;  4DTP A;  3THX A;  2XY8 A;  3CJC A;  4OPH A;  3AVN A;  3EL2 A;  3IS9 A;  4ILJ A;  2E8A A;  4OGC A;  3AV9 A;  5AQG A;  1FJG K;  2KW4 A;  1X3N A;  2VG6 A;  5T7B A;  4B9N A;  5EU7 A;  4X64 K;  1Q7Y O;  3BP8 A;  4CHN A;  4XIU A;  1JCF A;  4FWP A;  3CD6 N;  2KKZ A;  5F2R A;  1XUP O;  3RR7 A;  3HI0 A;  2BGG A;  3L8B A;  4J2A A;  3VN5 A;  4LF7 K;  3D2F B;  4FM1 A;  4PKH A;  3VEV A;  4BR0 A;  3A5O C;  4BRM A;  1U45 A;  2G8W A;  1MWK A;  4CER A;  3EN9 A;  5CZ1 A;  3HPG A;  3J80 O;  2Q31 A;  1Q18 A;  4M7X A;  2HMP A;  1XNQ K;  5M1P A;  3O9T A;  3CQX A;  4M3Y A;  1RT6 A;  2W40 A;  5CYQ A;  3TSQ A;  4Z4H A;  4FJJ A;  1N8R O;  2CGJ A;  1Z6R A;  1MDU B;  2CH5 A;  5BR9 A;  5BRH A;  4BE0 A;  3VQE A;  2HBM A;  1C1C A;  5AQR A;  3TTD A;  1RT7 A;  3MEE A;  1KVB A;  1MA9 B;  4KRE A;  1YTU A;  4E1J A;  1LWF A;  4B9L A;  1ITG A;  2WON A;  1IV0 A;  1KSP A;  4DV4 K;  3B6O A;  3IDH A;  4DR6 K;  3A2F A;  5KRS A;  1VQO N;  3J81 O;  1VSE A;  3ZSR A;  2ZM6 K;  4FOI A;  1K9M O;  1GLB G;  4B8C A;  4E89 A;  2QTD A;  4CW7 B;  3CQ8 A;  3VEY A;  4IDK A;  1NLV A;  3M3Z A;  1SQK A;  2WC9 A;  3SJH A;  4ISE A;  3AVK A;  4OJR A;  1QQO A;  4GVE A;  3ZT1 A;  4OKJ A;  4EZ9 A;  3NCI A;  1FK9 A;  1HYV A;  4CZH A;  1A5V A;  1A5W A;  1U6Z A;  3FLC O;  5LMU K;  4DFM A;  4FPB A;  5EOY A;  1P8Z A;  4W5T A;  5GAH P;  4CEA A;  3DRP A;  3CM6 A;  4IO8 A;  3M8S A;  5FLX O;  3RVC A;  2HMI A;  3K9K A;  1EP4 A;  4U7B A;  1KFD A;  2IVN A;  5HOO A;  4BRK A;  5CHI A;  3RR8 A;  1TAU A;  1BA1 A;  1Q81 O;  3KK1 A;  1JCG A;  1VQ6 N;  4CF1 A;  3D6R A;  3AVG A;  2FBT A;  5KI6 A;  5BPN A;  2F96 A;  4GMJ B;  4RW7 A;  4CGH A;  1X9S A;  5AQZ A;  4I7F A;  4E7L A;  4M3X A;  3CME N;  1W9H A;  1JXE A;  3SUP A;  1NMD A;  4MLE A;  4BRG A;  1YHQ N;  3VF2 A;  4J2E A;  1KAY A;  3V9W A;  2NRW A;  3LZI A;  3VQ5 A;  4HHT A;  2HHW A;  3SCX A;  3OYL A;  5AZI B;  3OA9 A;  4DV7 K;  4N5S A;  4DV2 K;  4DTN A;  1K6Y A;  3HTV A;  1KVA A;  2QWM A;  3THY B;  5KRT A;  2D4W A;  2G8I A;  3CC2 N;  5JIC A;  1N34 K;  5GAE P;  2O4I A;  3NVM A;  1YTA A;  1NK5 A;  4B3R K;  5LL6 Z;  4MDB A;  2RF2 A;  4BDZ A;  3HBT A;  3VQC A;  3SMP A;  2OPS A;  3GOI A;  4Y0W A;  1RBU A;  2D0P A;  3ZET A;  1J9A A;  3PY8 A;  1MU2 A;  3O9S A;  3CCV N;  4GW6 A;  2NZT A;  4B9S A;  1GLA G;  3QEP A;  4JKE A;  3CM5 A;  4HTL A;  3V6D A;  1K8A O;  3O9U A;  4KAZ A;  2OTJ N;  4FZZ A;  5JLF A;  3HVR A;  4JS5 A;  1EET A;  1RDA A;  2NUB A;  4XEI A;  4O4G A;  1OVQ A;  4AHT A;  5H1S Q;  3A8Y A;  4B08 A;  1G99 A;  2G8V A;  4LSN A;  4PUO A;  3A5N C;  2E20 A;  4CZL A;  2QWP A;  2IC3 A;  4JKG B;  1DTQ A;  2CH6 A;  3C65 A;  3QER A;  4H5T A;  3IAY A;  1QQC A;  3TR8 A;  4L8R B;  2CGK A;  4CHO A;  4EHU A;  4BE2 A;  3OJS A;  4CED A;  4BC5 A;  3KK7 A;  4Q5V A;  4LF9 K;  5E41 A;  1QQM A;  3HM9 A;  1BDG A;  2YX6 A;  1EWQ A;  1S9G A;  3K2P A;  4I9L A;  5K14 A;  3ID6 A;  3NGI A;  4IJA A;  3CFO A;  2E1Z A;  1D8Y A;  1TK8 A;  2O8F B;  4CHZ A;  4PWD A;  1Z25 A;  3CFP A;  1C1B A;  3CF5 L;  1KAZ A;  1S1X A;  2IDO A;  3LDO A;  3HT3 A;  1SL0 A;  2BAN A;  2A6A A;  3DXK A;  3CET A;  3TTC A;  5GAD P;  4QS9 A;  4EHT A;  1Z05 A;  1RIL A;  1YUW A;  4FWM A;  2P9S A;  4BRH A;  2AP1 A;  3HZ6 A;  3OY9 A;  4HCB A;  1NGB A;  1T8E A;  1WSH A;  3FR0 A;  1EKE A;  4KTW A;  5DM6 L;  3ZSY A;  2P51 A;  3MWP A;  1LWC A;  4QS8 A;  3SBT A;  3OS1 A;  2KTQ A;  2HBK A;  3IUC A;  1JLE A;  2ITG A;  5TKY A;  1HYS A;  1CZB A;  3WNG A;  3TPQ A;  1TL1 A;  1BI4 B;  1S5J A;  1JJ2 M;  3WQT A;  2VG5 A;  4BR5 A;  5HRS A;  3H1V X;  4CVN E;  3F73 A;  3KLI A;  1WBB A;  4HVJ A;  3SUO A;  2E6M A;  2P9K A;  3OS2 A;  3I33 A;  1WB9 A;  4PKG A;  1ZBL A;  1EXQ A;  4B3T K;  3K5O A;  3THW B;  1V4T A;  3QB0 A;  4RW9 A;  4FW1 A;  2O8B B;  2BTF A;  2FC0 A;  4KHS A;  4UY8 O;  3SQ2 A;  3L3U A;  5AQO A;  2Q36 A;  3D2E B;  1JCE A;  1S9E A;  3SQ1 A;  3WNF A;  1HNX K;  3THV A;  4DCH A;  2ZWH A;  5GIN A;  1OKJ A;  3M8R A;  2FSK A;  2RPI A;  3SK3 A;  4B9V A;  4DMN A;  4KTQ A;  4FYD A;  1B9D A;  4DU4 A;  3FE1 A;  1S1W A;  3KWI A;  4B3M K;  3RRH A;  2J4R A;  3OYG A;  1RDU A;  5C42 A;  3AVM A;  4OO1 J;  1IG8 A;  4C8K A;  4B1V A;  2GBZ A;  3SNN A;  4WCE L;  3FZL A;  1RBV A;  4FO0 A;  2EHG A;  3RMB A;  4CJW A;  3F9M A;  4BVO A;  4Z4F A;  4YOW A;  2X6S A;  1Q8I A;  3LWM A;  3OYJ A;  1SUQ A;  4RWT A;  3KD1 E;  3AA5 X;  1N33 K;  3ZT2 A;  1RT1 A;  5F1X A;  3NF9 A;  1U2V B;  4R5P A;  1HKG A;  1NKB A;  4C8M A;  4LD0 A;  2G8H A;  4FJ5 A;  4BRC A;  3CC4 N;  4KFB A;  2OPP A;  3GE1 A;  2P9S B;  3HP6 A;  1T03 A;  3ZT4 A;  3VMF B;  2G8U A;  5AQT A;  3VTI A;  2P5G A;  3QFU A;  1ATN A;  4IEI A;  4CEZ A;  1Q9Y A;  3DLB A;  3EKS A;  3T3F A;  3LPT A;  4DFP A;  2F8S A;  4BVP A;  4JI7 K;  4NLB A;  3JS6 A;  4OKE A;  1L3S A;  4DV3 K;  5HLF A;  1NGE A;  3VA3 A;  4AF1 A;  3TTF A;  1GLD G;  5HBM A;  4JKB A;  1BUP A;  1OH7 A;  3VQ9 A;  3AO4 A;  1C0U A;  2Q0R A;  3O3F A;  1U48 A;  3K0S A;  4FJL A;  3NF7 A;  3V1O A;  3WXK A;  4FWR A;  2QKB A;  5C10 A;  4JI4 K;  2H3G X;  1HPZ A;  3BF3 A;  3NAE A;  1WAF A;  4FZY A;  3OBY A;  3BEX A;  4GV6 A;  1X3M A;  4I6M B;  4IDH A;  1WSG A;  2YNI A;  5AQN A;  4GV3 A;  3EYZ A;  3PX0 A;  2A41 A;  5E84 A;  1YI2 N;  2GUI A;  3D45 A;  5ADX A;  1YVN A;  3C6A A;  4CZM A;  1VSI A;  4CK3 A;  3P38 A;  4DR3 K;  1S1U A;  3ITH A;  3ULD A;  2ZGZ A;  3L4I A;  4CFB A;  4H0P A;  1WAJ A;  3B6P A;  3OYC A;  5ADX H;  2NRZ A;  2ZD1 A;  3E9O A;  4CEF A;  3OYH A;  1RBR A;  3K59 A;  2Z1J A;  1SKW A;  2OZS A;  1FKO A;  1ZBU A;  3SQ0 A;  3CYM A;  4B9T A;  3T19 A;  1XMO K;  1YF5 L;  3QET A;  1KD1 O;  5BPM A;  2IVP A;  5JS2 A;  4W5N A;  4ZHR A;  5KQD A;  5KPZ A;  4IKF A;  2OPQ A;  3I56 N;  3U4L A;  1TUU A;  2KZM A;  4O5F A;  3A5L C;  3L2U A;  3R8E A;  1HYZ A;  2F7T A;  3SUQ A;  4WQ4 A;  4PHT X;  1T7P A;  1K73 O;  2O8C B;  2HF4 A;  2YNG A;  1NGH A;  3NH2 A;  1JL1 A;  3VPZ A;  1BL3 A;  1IBL K;  2P9L A;  5J2N A;  4EAH D;  3KKS A;  3HXM A;  3G0Z A;  2HBJ A;  1FKP A;  4PL7 A;  3MXI A;  4PQU A;  4FLT A;  2VWB A;  4K8X A;  3QLH A;  2IOC A;  2BE2 A;  4BC3 A;  4DQP A;  1XC3 A;  3W3D A;  4BDY A;  2HST A;  4CJ4 A;  5FRN A;  2NRT A;  1LAW A;  4DQS A;  5DMR A;  3L2Q A;  4LF4 K;  1RBT A;  5JVH L;  3F9K A;  3LAK A;  4M3R A;  5FPE A;  5B8H A;  5BRF A;  2HNZ A;  1QVG M;  4H5N A;  4JRP A;  4J2B A;  1U4B A;  4FJM A;  3UB5 A;  2GX9 A;  3SUN A;  1VQM N;  4NXN K;  3CJ1 A;  1Q9X A;  2W6L A;  1RCH A;  3L0Q A;  4CJ5 A;  1XI1 A;  1D9F A;  3NFA A;  3S41 A;  3CCU N;  1BWF O;  1YJN N;  1GLE G;  4FK2 A;  3A5M C;  1C0T A;  1VSK A;  1EQY A;  3PIP L;  4DV5 K;  3MXM A;  1JLA A;  3LAM A;  3U3G A;  5AJ3 K;  4JV5 K;  4NYN A;  1TKD A;  3C6T A;  2BDP A;  3J8A A;  2ASM A;  1T6D A;  3ID8 A;  3LP2 A;  4E19 A;  3T1Y K;  1QQN A;  1RT5 A;  3UKU B;  4JS4 A;  3PX6 A;  1WBD A;  4DU1 A;  1NOY A;  4WF9 L;  2NNW A;  3RMD A;  1E4F T;  4FM0 A;  3GL1 A;  2WOM A;  3O1W A;  3OYB A;  3MEC A;  4FJ7 A;  3T1H K;  4BC4 A;  1QVF M;  4KB1 A;  4WFN L;  2HHQ A;  4BY9 C;  3K57 A;  4MO4 A;  1Y64 A;  3C0B A;  3NHG A;  4LC9 B;  4DKW A;  3V9U A;  4DV0 K;  3TAR A;  4H0O A;  4B8A B;  1NKE A;  1NGA A;  4FWL A;  2VWJ A;  3TAQ A;  4CF0 A;  4DV1 K;  4KHN A;  2OPR A;  4ISG A;  2D0O A;  4E1N A;  4WYB A;  2ZQB A;  4AQY K;  3HVT A;  3J7Z O;  2YI1 A;  3THX B;  2QWN A;  2VQF K;  4CJK A;  2HHV A;  2QW9 A;  5AQV A;  4CJQ A;  3M8Q A;  4O55 A;  1S6Q A;  3B8A X;  4NCG A;  3EKU A;  1NJX A;  1VQ7 N;  1RNH A;  2BH1 A;  3H08 A;  5CE3 A;  5IT9 O;  3CCQ N;  4MFB A;  4DQ8 A;  3C94 A;  4V19 S;  4BG9 A;  4JRQ A;  4LH5 A;  1F21 A;  5KGX A;  3Q7B A;  4PY5 A;  3NE6 A;  3TAN A;  5AQX A;  4JI1 K;  3BUZ B;  2AA4 A;  1RT3 A;  3S3N A;  3QIN A;  1WN7 A;  4FJX A;  4E0D A;  4GVM A;  2YNF A;  1X9J A;  1GOB A;  3VQ6 A;  3QIP A;  4RW8 A;  1HPM A;  4BRL A;  4JI8 K;  1ATS A;  4GV9 A;  3CHW A;  2UU9 K;  3E9P A;  3AA4 A;  3MCA B;  4LFB K;  4FZX C;  3V9X A;  1YVU A;  4OKK A;  1SL2 A;  4DF8 A;  3DLG A;  1Q86 O;  1GLC G;  5AZI A;  4BRI A;  3KLH A;  2RKI A;  1HKC A;  2BUP A;  4O5B A;  4CE9 A;  4CEE A;  3N4P A;  4CJU A;  5AZJ A;  1ILY A;  2E2P A;  5FPD A;  4DUZ K;  2UXD K;  3TAM A;  1NK9 A;  4DTS A;  3TAF A;  1J53 A;  3L6Q A;  3FZK A;  1QE1 A;  2PBD A;  4BQZ A;  4B9M A;  1NNE A;  3NBP A;  5C25 A;  3K5N A;  4CZE A;  3LWL A;  1VQ9 N;  2VGN A;  1TK5 A;  1N5Y A;  3HM8 A;  5BPL A;  5E26 A;  1X9W A;  3O80 A;  1V4S A;  1LWE A;  1IBK K;  4B1X B;  4HCC A;  3AVB A;  1VQK N;  2D0C A;  3ENO A;  4FW2 A;  3OYK A;  5J2M A;  4BR2 A;  3SZ2 A;  4C8N A;  2GWJ A;  1HJR A;  4KBO A;  4CEQ A;  2YV0 X;  3VTH A;  2Y1J A;  1NGD A;  2HHU A;  3SV4 A;  1CXU A;  1EX4 A;  4IFY A;  4DSJ A;  2E2O A;  3AGK A;  1KQS M;  5C15 A;  2DY4 A;  3ZSW A;  3TSU A;  3S3M A;  1HNZ K;  4CK1 A;  4B1U B;  4A2A A;  4DTU A;  3OBW A;  3R6M A;  3ASM A;  4KI4 A;  3OYD A;  2GWK A;  4N76 A;  1SKS A;  3O3G A;  3K9J A;  4IO9 L;  2ATQ A;  2V52 B;  4CZI A;  3VQ4 A;  3DM2 A;  4K0K K;  3KIO A;  4CGI A;  3QIO A;  2EWS A;  1BQN A;  4K8Z A;  1SL1 A;  3ULE A;  1ESV A;  2O8E B;  4CD3 A;  2YHW A;  3IG1 A;  1R59 O;  4NB4 A;  3EE8 A;  4DR2 K;  5TKW A;  1L5U A;  2P9U B;  2YCH A;  2KHO A;  2JGU A;  4JI3 K;  1HR0 K;  4IOC L;  5SWM A;  2LSN A;  1MWM A;  2VCP A;  3SYZ A;  3IRX A;  1U47 A;  4JAX A;  2FF6 A;  1QZ6 A;  1BA0 A;  3KK2 A;  4FSV A;  3O9Q A;  1HX1 A;  2A3Z A;  4BG8 A;  2A5X A;  4JI2 K;  2ASO A;  4YDU A;  4Z4G A;  2QI2 A;  2YNH A;  3K5M A;  4NCB A;  4QCL A;  3HOS A;  1J5O A;  4YOX A;  1BCO A;  3CQY A;  4R79 A;  4QOZ B;  4FJ9 A;  1NJW A;  2HVI A;  5AFU A;  2O8D A;  2IVO A;  4EFH A;  2VGM A;  3ZSV A;  3PO5 A;  5HP1 A;  1VQ5 N;  3JXU A;  4KV8 A;  3HST B;  1XHX A;  1GOA A;  3WNH A;  3QDK A;  4IXC A;  3O9R A;  3SAH A;  2O8E A;  3AO3 A;  3D7E O;  3ZET B;  2PZS A;  1IG9 A;  2YKM A;  3OTO K;  5FRM A;  1IJJ A;  3I0R A;  1T05 A;  1YJ9 N;  3OW2 M;  4AHR A;  2OA8 A;  2VYP A;  1W97 L;  1WNS A;  3OYN A;  4HUG A;  2A1S A;  4F8R A;  4YOU A;  1NG9 A;  2ASP A;  1W7A A;  4M45 A;  2CGL A;  1HMV A;  4BRA A;  4DUY K;  1S72 N;  1O1W A;  5C24 A;  3OYA A;  2XHB A;  2ETJ A;  1NU0 A;  4JI6 K;  4JLH A;  4FLY A;  4LFA K;  3CCM N;  2KFZ A;  3SPZ A;  4YOR A;  1DEJ A;  1JLC A;  1QSY A;  2FXU A;  2QWL A;  4F3O A;  3KK3 A;  1RDW X;  3VF6 A;  3UIQ A;  5C12 A;  1VSL A;  1IO2 A;  1CXQ A;  2R7Y A;  3KLF A;  4KB0 A;  3LAL A;  1JKH A;  3MMV A;  4H5W A;  3ENB A;  1J6Z A;  5AQH A;  1VRT A;  3EEQ A;  4QAG A;  3PV8 A;  3RSE B;  1RGI A;  4DTO A;  1VQP N;  2P9P B;  2PAV A;  2HW3 A;  3SMS A;  3TAG A;  3AY9 A;  4F2R A;  3NDK A;  1BO5 O;  4BRD A;  5M1K A;  5J1E A;  4YDU C;  2QA4 N;  2JWK A;  3WXL A;  2NRR A;  2HB5 A;  5C0Y A;  4XH4 A;  4BC2 A;  3G6E N;  1HNI A;  1K8K B;  3TAB A;  4AH9 A;  3MAQ A;  5HRO A;  3I8D A;  1Y97 A;  1WUA A;  3CCR N;  3I0S A;  2DPN A;  1LW2 A;  3CPE A;  3IFR A;  2HBL A;  3DXM B;  3DXM A;  1UOC A;  1QZ5 A;  4OPK A;  1IKV A;  2HHT A;  5AQW A;  3NF8 A;  5C2D A;  1HNV A;  1KVC A;  4ID1 A;  4BWJ A;  3NMU A;  4CJS A;  3C95 A;  2W41 A;  5BN9 A;  4FM2 A;  3THY A;  2A42 A;  1ZBI A;  1WLJ A;  4IOX A;  3AVF A;  2QK9 A;  2P9L B;  3WXI A;  3QEW A;  2OYQ A;  1BIS A;  3LPU A;  1NJI O;  4IG0 A;  3L2V A;  4PA1 A;  2Q97 A;  4DSE A;  1D9D A;  2WTU A;  4JHD A;  1YAG A;  3JAM O;  3ATU A;  3MN7 A;  4B3S K;  2DTU A;  5J2Q A;  1HQU A;  2KQ2 A;  4DTM A;  2NRX A;  1UA0 A;  1RT4 A;  1ZYQ A;  1HLU A;  4M3T A;  2YHY A;  1I39 A;  4DR1 K;  1U04 A;  4CGD A;  3T7Z A;  1BCM A;  1NGJ A;  1BU6 O;  5A2Q O;  4YOY A;  1HQE A;  4C23 A;  5JS1 A;  5AQK A;  1VQN N;  2IIR A;  3FZH A;  3V9S A;  3AVH A;  4LSL A;  5KQ8 A;  4HUF A;  1NK4 A;  1GLF O;  3SAF A;  3CJA A;  4DSI A;  1DGK N;  2DFE A;  4A62 A;  3KZB A;  3SLC A;  3H46 O;  3LM9 A;  4BQL A;  3VGK A;  4O8U A;  4O8K A;  1M90 O;  1U2V A;  2YHB A;  4KI6 A;  3FGU A;  4IG3 A;  3C6H A;  1JL2 A;  4RW6 A;  4HTU A;  3WXM B;  4OPA A;  1XC9 A;  5EXW A;  2O8C A;  4FVU A;  4DS5 A;  4AM6 A;  4JK8 A;  1DT9 A;  3QO9 A;  2YKN A;  1WOQ A;  1RDD A;  2D1K A;  2XRI A;  2FF3 B;  2FSJ A;  2O4G A;  2Q3S A;  4XH1 A;  3L3V A;  5LMN K;  3NGZ A;  2PYL A;  5KGW A;  4BRF A;  3CJ9 A;  3PLA A;  4A59 A;  1EWR A;  4OVL A;  2V7Y A;  4BDP A;  2Q0U A;  4GKJ K;  1B92 A;  4JKD A;  4E7I A;  1NBW A;  4C1N I;  1X9M A;  4BRP A;  3L2R A;  2HF3 A;  3GG4 A;  1TUY A;  5FPM A;  1TV6 A;  4FCY A;  4DTX A;  4JI5 K;  3AO5 A;  1WSI A;  2E2Q A;  3J7Y P;  1RT2 A;  5GIO A;  3T69 A;  3EO3 A;  4WE1 A;  1XHZ A;  4X66 K;  1SZ2 A;  1ATR A;  4N56 A;  3EE9 A;  3PUF A;  4IBN A;  4NCA A;  3DAW A;  3KJV A;  2XY7 A;  5HRR A;  3L4Q A;  1RTD A;  3QIC A;  5LY3 A;  2HVH A;  1KLM A;  1NOZ A;  1JLG A;  3RRG A;  4CBU A;  4DTR A;  4AHS A;  3U3Y A;  1TKT A;  3CJB A;  4FLZ A;  5BR8 K;  2FBY A;  1M1K O;  2D0A A;  3WT0 A;  5LJW A;  2YHX A;  1TK0 A;  3QNN A;  3C7N A;  2V7Z A;  1FW6 A;  2X6N A;  3MN6 A;  3QML A;  3ZYY X;  2XY6 A;  4FJN A;  5KPT A;  3MDQ A;  3WQU A;  1U49 A;  1SKR A;  4KH5 A;  2UYT A;  4JD2 B;  2E2N A;  3VQD A;  4NO7 A;  1P90 A;  1VHX A;  1TL3 A;  4H03 B;  4LF8 K;  2ZF5 O;  1VQ4 N;  2G8F A;  4ILH A;  3VEX A;  3DRS A;  4CJV A;  4FJK A;  3EY1 A;  3VES A;  4RG8 A;  3ENH A;  5AZJ B;  3MEG A;  4BRE A;  4JKG A;  4UQG A;  4H5V A;  3CMA N;  3KHY A;  4U67 L;  4CK2 A;  1B9F A;  4FJI A;  3J7A P;  4H5R A;  1KXP A;  3Q7C A;  5DK5 A;  3CJ7 A;  3S9H A;  5GIP A;  3O4Q A;  2Q2R A;  1UA1 A;  3AAQ A;  3EZW A;  1LW0 A;  4N41 A;  4FK0 A;  4B9Q A;  1SV5 A;  1LCU A;  3G25 A;  4W5O A;  1OH5 A;  3LDN A;  4BR4 A;  4G9Z A;  1D4X A;  4RTF D;  5EX5 A;  4CHQ A;  3JSM A;  1RDB A;  1UWB A;  4LY7 A;  1IBM K;  3BY5 A;  3LM2 A;  1S22 A;  4CJL A;  2OAN A;  2GUP A;  4CEO A;  3HL8 A;  3O5B A;  1C0G A;  1GOC A;  2YJE A;  1T3V A;  3P1G A;  1C1A A;  3ZSQ A;  3CCE N;  3VGL A;  4H4M A;  2XY5 A;  4LF5 K;  3WEE A;  3V81 A;  4LH4 A;  3LP3 A;  1KFS A;  2Q1N A;  3DWL A;  4BGA A;  1TVR A;  4ISF A;  3NF6 A;  2F4V K;  4G1Q A;  3DMJ A;  1VSM A;  4DSK A;  3P5J A;  2VQE K;  4MLH A;  4N47 A;  1NWK A;  2WBN A;  4FWO A;  2KFN A;  3NGY A;  4B1Y B;  4O0J A;  3KLE A;  1T44 A;  4DWI A;  1VSF A;  2HND A;  3QEX A;  3ALY A;  4CJE A;  3DLK A;  5KPR A;  4Y1D A;  4CIG A;  1IH7 A;  2QKK A;  3R9P A;  3P31 A;  4IFV A;  3VF4 A;  4WFB L;  3IMX A;  5AQL A;  4CJT A;  1J5E K;  2HHX A;  4E1M A;  4JK9 A;  4A57 A;  5FPN A;  3DJC A;  4AHV A;  3DLR A;  2OTL N;  4A2B A;  3U9D A;  3NVK A;  2PFU A;  2XO7 A;  4FWS A;  3BDP A;  1IKW A;  5GAG P;  2WFB A;  3U6F A;  3QBW A;  3ZT3 A;  2AJQ A;  1ZBH A;  1HKB A;  3WUH A;  3KWG A;  3ZSX A;  3VEW A;  3BGR A;  4DHY A;  4M3Z A;  2GV9 A;  3LDP A;  4CJF A;  3I55 N;  5CY4 A;  1JLQ A;  3VEO A;  5SZT A;  3D0P A;  5ELZ A;  4ZTJ A;  2EX3 A;  3MX2 A;  2ZJR L;  2P9I A;  4CIF A;  3NH0 A;  4F9O A;  3R3L A;  5IWA K;  5D3G A;  3PX4 A;  1OVY A;  1ASW A;  2ZJP L;  3LZJ A;  2Y1I A;  1ZBF A;  4WFA L;  4YNQ A;  3L2W A;  3P39 A;  3KD5 E;  3LDS A;  4AHC A;  3HPO A;  1E4G T;  4DF4 A;  3ZX2 A;  4YY3 K;  4C8L A;  3ZLJ A;  3M8P A;  1Q82 O;  3UE5 A;  1BI4 A;  3O4N A;  5HRN A;  4CZK A;  2D0B A;  3ISN C;  4YOV A;  3C7N B;  3T1A A;  2JLE A;  4HUE A;  1NK7 A;  4KHQ A;  3VQQ A;  3DOL A;  3M1F A;  5KTQ A;  1CZ9 A;  3SAG A;  3VQA A;  3ZX0 A;  2W6K A;  4ID5 A;  3QES A;  4KTZ A;  4BRO A;  2KLA A;  4W5R A;  3MN5 A;  5AQP A;  2HHH K;  3AO1 A;  4FLV A;  3THW A;  3QBX A;  1DLO A;  3TSP A;  4C8O A;  1WSJ A;  4OLB A;  3I8B A;  4DSL A;  4AM7 A;  4DLG A;  3VQ7 A;  4Z94 A;  2RE2 A;  5AQY A;  3OYI A;  4NYF A;  4EP4 A;  2UUA K;  3AAP A;  1NGC A;  2O8F A;  5M1F A;  2GEL A;  1TKX A;  3ZSZ A;  3AA3 A;  4CGF A;  4CEB A;  3AA2 A;  4CGG A;  3KVG A;  4FWN A;  2Z1H A;  2RN2 A;  1RTI A;  4DQR A;  3SJJ A;  1NM1 A;  5JMV A;  2UUC K;  3VER A;  1KLN A;  4CZF A;  4IOA L;  2QXL A;  5AQF A;  3ZEU B;  4CFD A;  4K41 A;  3OYM A;  1VK0 A;  1QHT A;  1JLB A;  1S3X A;  3PO4 A;  4H0T B;  3M5R A;  1NGG A;  3AAR A;  4Z4E A;  3H6E A;  4OGE A;  4WQ5 A;  5LJV A;  4JI0 K;  3AVL A;  2HNY A;  4MQ3 A;  1NKC A;  2X74 A; 
#chains in the Genus database with same CATH homology
 3J7A P;  1HNW K;  1IBK K;  3J80 O;  4GKJ K;  4X65 K;  5IWA K;  4NXM K;  4DV7 K;  4OX9 K;  1XNQ K;  4DV0 K;  4LFC K;  4LF6 K;  4DV2 K;  4DR4 K;  1N36 K;  4KHP K;  4DR7 K;  4DV1 K;  1IBL K;  3OTO K;  2UXC K;  4AQY K;  4YY3 K;  1IBM K;  2VQF K;  4JI7 K;  1N34 K;  4DV3 K;  4JI5 K;  4B3R K;  3J7Y P;  4DUY K;  5LL6 Z;  1HNZ K;  5IT9 O;  4LF4 K;  4DV4 K;  4X66 K;  4V19 S;  4DR6 K;  3JAM O;  4LF5 K;  4GKK K;  3J81 O;  4B3S K;  4JI6 K;  2ZM6 K;  1N32 K;  4JI4 K;  4LFA K;  2E5L K;  4DR1 K;  4CVN E;  2HHH K;  4JI1 K;  5A2Q O;  2F4V K;  4JYA K;  4CW7 B;  4K0K K;  1XNR K;  4NXN K;  4B3T K;  2VQE K;  5BR8 K;  4DV6 K;  4JI8 K;  4DR2 K;  5LMU K;  2UU9 K;  4LFB K;  1HNX K;  1FJG K;  2UUA K;  4JI3 K;  4DV5 K;  1HR0 K;  4DR3 K;  1J5E K;  5AJ3 K;  4JV5 K;  5FLX O;  4X64 K;  1I94 K;  4B3M K;  2UUC K;  4DR5 K;  4LF8 K;  4DUZ K;  3T1Y K;  2UXD K;  1XMO K;  2UXB K;  4JI2 K;  1XMQ K;  4LF9 K;  4LF7 K;  4YHH K;  4X62 K;  2UUB K;  4JI0 K;  5LMN K;  3T1H K;  1N33 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...