4JI2K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 26
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji2K00
4JI6K 4LFCK 4LF9K 1XMOK 1N33K 4DV1K 4NXNK 2VQEK 4JI1K 4LF5K 4X62K 1IBMK 4V19S 4DV4K 4DV2K 1IBLK 4B3TK 4JI8K 4YY3K 3J7AP 3OTOK 1N32K 4LF4K 4JI0K 4LFBK 4GKJK 1IBKK 4B3SK 4DUZK 4JV5K 4B3MK 4DUYK 4NXMK 4DR6K 4DR1K 5BR8K 3J81O 4B3RK 4X65K 2VQFK 4LFAK 3J7YP 2UUAK 4KHPK 4CVNE 4DR4K 5LMNK 3T1HK 2UU9K 3JAMO 3T1YK 2E5LK 2UXCK 2ZM6K 4DV0K 4DV7K 1N36K 2UUBK 4JI3K 4JI5K 1HNZK 4DR3K 2UXDK 1XMQK 4JI2K 4JI4K 2HHHK 4JI7K 1HNXK 4DR2K 5A2QO 4X64K 5IT9O 4LF7K 4K0KK 5LL6Z 5IWAK 1J5EK 2F4VK 4DV5K 2UUCK 4GKKK 4LF6K 4JYAK 4CW7B 4DR7K 1HNWK 4AQYK 5AJ3K 3J80O 1N34K 1XNQK 2UXBK 1FJGK 1XNRK 4YHHK 5LMUK 1I94K 1HR0K 5FLXO 4LF8K 4DV3K 4DR5K 4DV6K 4X66K 4OX9K
chains in the Genus database with same CATH superfamily
2NRVA 2X6SA 4AHTA 1D5AA 3G10A 3SQ2A 3NF9A 3OYGA 1WAFA 3UE5A 2V51B 4BRLA 2WC9A 2A6AA 1RDUA 1NGFA 4I2QA 4M3UA 1IBLK 5HRNA 4ICLA 3D2EB 2RKIA 3HVRA 5AQTA 4HHTA 4B9VA 3L3UA 1RTDA 1T6CA 1TYQB 4JKBA 3SAFA 2BANA 3FZFA 1YJNN 4B9LA 4FPAA 5F2RA 4DR1K 3THYB 5C25A 2P9KA 1TKDA 4B3RK 1C1CA 3S3NA 4NYNA 5HOOA 4BRDA 1LWEA 1V4SA 4M63C 1ASWA 2UU9K 1NJZA 1GLAG 4I9QA 4XH1A 3P5JA 1W7AA 1T6DA 4CFCA 3D45A 3TAEA 1J54A 1WNSA 3P4IA 4DR3K 2QW9A 3K5OA 3VTIA 4DG1A 2NRZA 4RW9A 4CGFA 4KB1A 2EWSA 1TAUA 2HB5A 4BC3A 4BR7A 1EQYA 3HL8A 4E1JA 4A5BA 1XQSC 4BRFA 2WUSA 3PUFA 1N6QA 2KZMA 3OYHA 1HYSA 2F8SA 1ZYQA 2HBKA 3C7NA 4EFHA 3MWTA 3H6EA 1NOZA 4CF2A 2FSJA 2P9UB 1LAVA 4KH4A 4DS4A 1HNWK 3C6TA 1RBRA 3KKSA 4WE1A 3VF2A 1L3UA 5AJ3K 4O5BA 2QXFA 3RMDA 3ATUA 4W5OA 3MN9A 4JD2A 4AHSA 3ULDA 5MLCQ 5AQQA 3HOSA 1ZBSA 4FWOA 4RTFD 4Z94A 3VPZA 4H5VA 4W5NA 3LDNA 5FLXO 1DGKN 5HLFA 1OVQA 2BTFA 4CIEA 3QNOA 2O8DB 2IVNA 3ZSQA 3QESA 2AJQA 4DU3A 1S6PA 1QS4A 4UY8O 3KK3A 3SV4A 3LPTA 1JL2A 4GV9A 4FJ9A 3U3YA 1VQNN 2D0BA 3IG1A 1ESVA 1BOTO 5HRRA 5CY4A 5SZTA 1BIUA 2OTLN 4NCGA 2A3ZA 2QM1A 5AZJB 1B9FA 3SPZA 4JV5K 1JXBA 1NMDA 4J2EA 3O80A 4NXMK 1VQ9N 3CJ1A 3EEQA 1NK0A 1C1BA 3VGMA 3J81O 4HUGA 1NK4A 4FJLA 5M1QA 3VEXA 3UKRB 4DF8A 2VQFK 1OKJA 4DFJA 3KLHA 3V1RA 4NCAA 3CF5L 4ISFA 3KLFA 2E5LK 3DM2A 4JKCA 4XH5A 4BWJA 3SMPA 1UAXA 3P83D 1DT9A 3UIQA 3SQ0A 4OLAA 3E01A 2QI2A 5GAHP 1MDUB 1BG3A 4MQ3A 3F9MA 1JLEA 1YTUA 1IJJA 1Q9YA 2VWBA 1HX1A 1YUWA 4B1YB 1NK9A 3HRGA 4MLEA 3OBYA 3CMAN 2NNWA 5ELZA 1GOAA 5LL6Z 1VQ5N 3B6PA 1KAYA 3A0IX 4BRAA 1KXPA 1WAJA 3CCJN 5JICA 3QERA 1Q7YO 5AQGA 3KD5E 1T7PA 4BRMA 2P9LB 4FM0A 1TL1A 4NO7A 4CZKA 1IH7A 5EX5A 4J2BA 4DQSA 3E9OA 3W3DA 2ZJQL 1IV0A 5BREA 1XNQK 1X9SA 3NE6A 3VEWA 4FJ5A 1KVAA 4H03B 4M7XA 3SJJA 2YHYA 4O0IA 2ZGZA 3CJBA 3QFUA 1EKEA 3HI0A 4K8ZA 4DHYA 1RNHA 2H3GX 4C8NA 3TR8A 1MU2A 3CJ7A 2KZZA 4O0JA 4KHQA 4YFUA 1IBMK 4CF9A 3VQDA 1Q18A 1SL2A 5GAEP 3THXA 3DXMA 4CGIA 2BE2A 4CHZA 4CJ4A 3OYMA 4G1QA 4DU1A 5FRNA 1QHAA 2QEXN 3FFKB 2GUPA 3I55N 3O1BA 3OS1A 4DF4A 1VSKA 4OGCA 1NJXA 5AQRA 4DTPA 1S1XA 1NJWA 1HPZA 5GAGP 2NLXA 4BRQA 4EP5A 3CHWA 4RWTA 4OGEA 3NVKA 1J6ZA 5LMNK 1BWFO 2W6KA 1E3MA 3BF1A 4DTRA 3T19A 2QA4N 1EO1A 4H0PA 3CQYA 3MEGA 4KFBA 5M1FA 2O8BA 3VF6A 3ZCMA 4EP4A 4CGHA 1NOYA 3DOLA 4FWQA 2O8CB 2IC3A 5DM6L 1TKXA 3QIPA 4OLBA 2KW4A 3AA2A 3RR7A 2KFNA 2GWKA 2E4LA 3U4LA 1TGOA 1HKCA 1SL0A 4A61A 1BL3A 1TKTA 1RDBA 4LY7A 2R7YA 3MXIA 4FW2A 1GLDG 4JKFA 1S1VA 3IKMA 4C8OA 2GTDA 3SJHA 4MO4A 3QB0A 2F9WA 1QZ6A 1CXQA 4C1NK 2W6LA 3VQBA 4DSLA 2EHGA 1XNRK 3AO5A 2GUIA 4DQ8A 1S6QA 4CGGA 3KTQA 2VCPA 3D2EA 4GW6A 3C95A 1KC8O 3WQUA 4DB3A 5DK5A 3NFAA 4OPHA 4CEZA 4FM1A 1RBSA 1ZC6A 2P1JA 2RPIA 1LV5A 4LFCK 3THYA 3TTFA 3AARA 2KLAA 1XWLA 1V4TA 3CFPA 4GV3A 4JI1K 4CF0A 1S22A 3NBPA 5SWMA 4CHPA 2AA4A 3LZIA 4QS9A 3PSIA 3A5LC 3LDOA 1ILYA 5BN9A 1EX4A 3ZEUA 2YHXA 2F7TA 4WQ5C 3CMEN 4DU4A 3M3ZA 3QINA 4CZEA 4DWIA 3FZMA 4HCCA 4LFAK 3TANA 4E19A 4AHCA 1ATSA 2Q0UA 3ZETA 4M45A 4H5NA 2YHBA 3N4PA 4Z4HA 5ADXH 4YOTA 3FZHA 2OPSA 3DYAA 1XMQK 4TSXA 3FLCO 4FZXC 2HF3A 2VGMA 3PSFA 3TAFA 4I2PA 1D9FA 4B9TA 3K57A 3AGRA 2FSKA 1K8AO 3LPUA 4DQQA 5IWAK 3ZSXA 1NWKA 1QVGM 3PX4A 2F4VK 4H0YB 4DV5K 1VSEA 4OPJA 4AHRA 4IJNA 3M8RA 4FJHA 4DR7K 2P9PA 4DLGA 3SCXA 5KPTA 3VTHA 1Q9XA 3AVJA 1FXXA 3CC2N 1VQMN 1N34K 4KKOA 2GEMA 3TSQA 4JKGB 2QWMA 1FKPA 3OS2A 3VA0A 4JN4A 3QEXA 5GIOA 1JLCA 4FL9A 4IG0A 1U2VA 2Z1IA 5AQOA 1JCEA 3KWGA 1RT2A 4IEEA 1GLFO 1A5WA 3TTDA 5AZJA 2Y1IA 2WTUA 4BR9A 3V6DA 1EXQA 3PX6A 1S5JA 2J4RA 1NM1A 1RT6A 3SAHA 1BI4B 4YOWA 4DV1K 4B1UB 3UKRA 1XHZA 3IAYA 5AZIB 3UKUB 4OJRA 4Z4IA 1BIZA 2QWQA 1NG9A 4BC4A 4IZ9A 1T05A 4H5RA 5KQDA 3V9WA 4B3MK 4YOXA 2HVHA 1Z25A 2YJEA 4ELVA 1CZ9A 1TKZA 3ISNC 3V9ZA 3O4NA 3CCQN 3C6HA 3I0RA 1VSIA 3O3HA 4NCBA 4JK9A 3C6AA 3AV9A 4YOYA 1VQON 3RR8A 3MN7A 3B8AX 1U45A 4KTWA 4KHYA 5HP1A 3KK1A 4ID1A 3H45C 2PYLA 4FJJA 4E0DA 4N41A 4PL7A 3LDLA 3KZBA 4B9SA 4I9LA 3VQQA 1VQ4N 4CI6A 1RDCA 4PY5A 4M3XA 5KTQA 4KTQA 3DAWA 4DTJA 1FK9A 4XH4A 2WOMA 3WUHA 2HBLA 4CF1A 5D3GA 4PQUA 2HBMA 3VQCA 3E1YA 4KI4A 2QKKA 4RG8A 4LF6K 2DFEA 3EY1A 1SKWA 2OZMA 3KVGA 1NK5A 1W2BM 4BVOA 1XC9A 3QMLA 1GOBA 3THWB 3L6QA 3VEZA 3V9XA 1KFDA 3W0LA 3WXMB 2UXBK 1R59O 3H1QA 5EXWA 3D2FB 3SYZA 3CETA 3KKRA 2ASOA 2X78A 3MXMA 4DQIA 2Z1HA 2ATQA 4JK7A 4B8CA 2ZWHA 1F21A 3G4SN 3PY8A 3AY9A 1ZXOA 4FOEA 4B1VA 3DLRA 5AQUA 5TKYA 4WQ4C 4FJMA 3CC4N 4JI6K 3ZX0A 1YTAA 1KRPA 2WONA 3ALYA 1K8KB 1KD1O 4HWIA 3L2WA 1NGDA 2PYJA 3TU5A 3QEPA 3VQPA 3OJUA 4JI8K 4AH9A 2B6AA 1L3VA 2NUBA 1RILA 1LWFA 1JCFA 2I7PA 3SBTA 2A5XA 2HF4A 1Y64A 2X74A 4BACA 4JKDA 2HOEA 3U8XA 4CJEA 2ZQBA 5BRHA 4DUZK 5AFUH 1VRTA 1VK0A 3HVTA 3RMCA 2O8CA 5TKWA 3VN5A 3R6MA 4BQLA 3TTCA 3MEDA 1C0MA 4BE2A 4CJRA 3T1YK 4OPAA 4Z4CA 4KH5A 2A1RA 4CJ7A 1J5OA 3WXKA 1RTIA 2JWLA 4DQRA 3CCEN 3LWLA 2QWPA 2D1KA 1HNZK 2UXDK 2HHWA 4GY2B 4JKHA 4JS4A 1K73O 3I8BA 3QDKA 3HZ6A 1Y97A 4IOCL 2G8UA 1EETA 3L0QA 4FK4A 3LANA 3FR0A 3BZCA 2YI1A 5A2QO 1D4XA 1RBUA 3S3OA 4CIFA 4LSNA 1X1PA 4H0TB 2LSNA 4O55A 1J5EK 1VSJA 4ILJA 5J2MA 1EWQA 5FRMA 5HRPA 4IO8A 3HXMA 2QKBA 4CERA 1S72N 3KK7A 1HPMA 3GBTA 3QO9A 1YT3A 2QWLA 3MECA 1ZBUA 3J80O 3KJVA 5CYQA 1NMNA 5C42A 2BGGA 4PA1A 4YNQA 2P9IB 1S9EA 1SKSA 1M1KO 1TK0A 1VQ7N 4KRFA 1QTMA 5KGXA 2GV9A 4MLHA 4BRCA 1HR0K 3OJSA 2Q0RA 4UQGA 3OYDA 5JLFA 5JLHA 4IOAL 2VWKA 1KLMA 1IKXA 1L5UA 3ENHA 3P31A 4E7JA 3G0ZA 3AVFA 4AHVA 1U48A 3WXJA 1ZBLA 1HKGA 1UOCA 2YX6A 5LY3A 2BDPA 4B9UA 3ZSWA 4RCHA 3NH2A 5GADP 3MXJA 4LF5K 2D0PA 2DFFA 1QHTA 3TARA 5E41A 2P9NB 4GVMA 3CYMA 3V4IA 1S3XA 3L2UA 3R1XA 4JHDB 2ZE2A 3RVCA 2FBYA 2AP1A 3SBGA 5JVHL 1JLGA 4BVPA 1MA9B 2XHBA 3RMAA 4KHWA 4CBWA 4AILC 4FJKA 4CJQA 3O3GA 3O08A 4GVEA 1NKBA 1SKRA 3ATVA 3T1HK 4KTZA 2WBNA 3LAKA 4DV0K 4N47A 4DTUA 2UUBK 2BUPA 3LM2A 1LAWA 3OW2M 3O5BA 4NB4A 5BPLA 4FJGA 1QE1A 2IGIA 4JI7K 2X6NA 5EOYA 3NDKA 4CFBA 3HTVA 3AVAA 4DFKA 1YJ9N 2CGJA 2QTDA 4JKGA 4K42A 1GLJO 1P90A 4CJTA 5GINA 3H3NO 4LD0A 1LWCA 1JLAA 3O9TA 1JL1A 4ZHRA 2YNFA 3ID6A 5DM7L 2GWJA 4F2RA 4DTNA 3SUPA 4PKGA 2OANA 4C8MA 1WB9A 4A62A 4B1XB 3NGYA 1QQCA 4CW7B 4WQ5A 3OS0A 4CZFA 1DEJA 4BDPA 3OYKA 3FGUA 1BQMA 5FROA 3F2KA 4HUEA 4M3TA 2P5OA 3SQ1A 5C0YA 2IAJA 4J2AA 3DLGA 3I56N 4DR5K 3U3GA 1QQMA 3BGRA 3KLEA 4KREA 1BDGA 4FWLA 3DLHA 3CCRN 1NGHA 1XHXA 4FZZA 3T69A 4CK2A 4FWNA 4RW6A 3OYNA 3HJFA 3MMVA 3M1FA 1NK7A 2P9SA 1SS6A 4PHTX 1RBVA 3M5RA 3BP8A 1DLOA 3N4QA 4XIUA 4YY3K 5E26A 5CZ2A 4KH6A 3AVLA 2W42A 3DXKB 3R8EA 2O8FA 3VQ4A 4PUOA 1EWRA 5KPZA 3HYFA 1Z05A 1W9HA 3K5LA 3NMUA 4FOIA 4E7IA 2Q3SA 4CJWA 3V1OA 3A5OC 3HM8A 3DOKA 2Y1JA 3KLIA 3SZ2A 1KTQA 1RCHA 5KI6A 1NGBA 2JWKA 1TUYA 3JXUA 5I9EB 1N36K 4CFAA 4LH4A 5I42A 4Z4FA 1WSGA 2HHHK 3PIOL 4CZMA 1Q82O 3I0SA 4O5FA 5AR0A 3E9PA 4CK3A 2F8TA 1WN7A 1SAZA 4FWMA 4OPKA 2VYPA 4LF7K 1RTHA 4B08A 5BRDA 4H4OA 3S9HA 5GIPA 4R79A 3LDPA 5B8HA 1YI2N 3QEIA 1HQEA 3DLKA 4BGAA 3PX0A 1VHXA 1CLQA 4WFBL 3MEEA 3SQ4A 3O4WA 3H1VX 3VEOA 1KVCA 2HHSA 3HK2A 5CZ1A 5J2QA 2XY5A 3NF8A 4PKIA 5HBMA 3HOTA 4BR5A 2A40A 1K8KA 4GMJB 3RWUA 2YKNA 5K14A 2E20A 1UA0A 4OKEA 2XO7A 2NRTA 1JJ2M 4FCYA 2IVOA 3SAGA 3KLGA 3TAPA 3V9SA 1C0TA 2VG7A 4FK2A 3NHGA 1YXQA 2KTQA 2G8KA 2QXLA 4BROA 2FC0A 4BREA 4Q0BA 4CEQA 4CJSA 3HPHA 4CD1A 3T3FA 4BQZA 3VA3A 1TK8A 1RT1A 4W5TA 2FBVA 3OTOK 3CERA 1L3TA 3MX2A 2G8FA 3IDHA 1ATNA 1REVA 3CJ9A 1Q8IA 1HKBA 1TYQA 4B1ZA 3ULEB 3CPEA 1QZ5A 4FM2A 3V9UA 1N5YA 2P9KB 3LP2A 3DLBA 1ZBHA 4OVLA 3CCUN 3O9QA 3LP1A 1HNIA 2P5GA 4FPBA 3R3LA 4DSJA 1VSDA 3C6UA 3LWMA 3OA9A 2HHVA 4CECA 3ZX3A 5LJWA 4CVNE 4B1WB 5I3UA 1KVBA 4HTLA 4DTOA 2CH5A 4JLHA 5JS2A 1YVUA 3CCVN 5J2PA 4EIAA 1VQKN 3LZJA 2ZJPL 2D0OA 5CE3A 4HCBA 3QEWA 4WQ4A 2PBDA 4A57A 3AVMA 3CM5A 4WF9L 2E6MA 1WUAA 3S41A 4FK0A 1X3NA 3VERA 4LH5A 3VMFB 3ZT0A 4FLVA 4E7HA 2FLOA 4CHQA 3HM9A 1FKOA 4GV6A 1KQSM 1S1WA 3GOIA 3O3FA 4HUFA 4O8KA 4Z0UA 3CCLN 4F4KA 3LAMA 3C7NB 4QAGA 5KPRA 4E7KA 4GKKK 1BU6O 3GG4A 4DTMA 2O8EB 2VG6A 2P9UA 2FF3B 2E1ZA 1RT4A 5ADXA 3HT3A 3TAQA 4JKEA 3THVA 3VQAA 1GLLO 4JD2B 1O1WA 2EX3A 3CFRA 2Q36A 2RE2A 3ZYYX 3BY5A 1C0FA 4KBOA 2VWJA 1D8YA 3P38A 3IFRA 2QWNA 4ILHA 2OCEA 2O8DA 2P51A 2NRWA 3QLHA 4CESA 4OX9K 2CGLA 1XUPO 1GLCG 3L2RA 3EKUA 4C8LA 3K2PA 5J1EA 3ENBA 3IMXA 2ZGYA 4WYBA 1T44A 5FPMA 1Z26A 4C23A 4FZYA 4YDUC 4IFEA 4QS7A 1QSLA 1I3AA 2DY4A 2E6LA 3C94A 4BDZA 1X9JA 4FWRA 4Y0WA 3OBWA 3SUQA 3SI6A 1VQPN 3O8MA 2DTUA 3LL3A 3EE8A 3S3MA 1K9MO 1OVYA 2HHQA 1LW2A 3VQ6A 4FLTA 1L3SA 3J7YP 2UUAK 4IBNA 3EE9A 1T03A 3P1GA 4K25A 3OYIA 5JMVA 2XY7A 4E1MA 3LDQA 1NJIO 2HHXA 5BRFA 3ZT2A 4PL8A 3VESA 4M7YA 4U67L 2V52B 3AVCA 4DSKA 3P39A 3CQ8A 1E4FT 1SZ2A 3PV8A 2A41A 4QS8A 3MAQA 4DR2K 4FJNA 3ASMA 1JLBA 4X64K 3CCSN 3O1WA 5AQIA 1X9MA 3K5MA 5E84A 1B9DA 5C2FA 2PY5A 1RBTA 3O4QA 1UWBA 2RHKA 4ZTJA 2IS3A 5FPNA 3KD1E 4BY9C 4E89A 2P9LA 5AQZA 1YF5L 1M90O 2FXUA 4JAXA 4ELTA 1OH8A 1UA1A 1HRHA 3FZKA 3AGKA 4RW7A 4CJUA 3AA4A 1QVFM 1WBBA 3AVBA 3VGKA 3HP6A 2Z1GA 1O13A 4LF8K 3TSUA 3JSMA 4BRGA 1NGEA 1T3VA 4Z4EA 1KSPA 3GDQA 5F0XA 4LF9K 1TV6A 4M3ZA 1N33K 4CJVA 4O4GA 5HROA 1Q86O 3CG7A 3THXB 3DRPA 3ENOA 3DXMB 5AQSA 5AQWA 4KPYA 3ZX2A 4CBXA 4E3SA 1S1TA 4G9ZA 3DLLL 4FYDA 3ZSRA 4JI0K 4FVUA 4B3OA 3QEVA 4DQPA 2ZJRL 4B9QA 5KRTA 2PZSA 2D4WA 1IO2A 2PAVA 5KRSA 4DUYK 2JLEA 3VEVA 4DR6K 1B92A 3NVMA 1JLQA 2D5RA 3M8PA 3OYEA 1RT5A 3SUOA 3AVGA 3VQ9A 3MCPA 2FBTA 1JLFA 2YHAA 5AQKA 3QBWA 4DR4K 1A5VA 3G6EN 4KB0A 4JRQA 4BRKA 2KKZA 5H1SQ 2UXCK 2ZM6K 4DV7K 1X3MA 2HSTA 2Q1NA 4RW4A 3U6FA 4OO1J 4BE0A 4CE9A 1VAZA 4H8KA 4JI5K 4JI2K 4YOUA 4H5WA 4CJFA 4RW8A 3AVNA 3C0BA 1BGXT 3WQTA 5AFUA 4BRPA 1NK6A 4JEPA 1BA1A 5IT9O 3OHRA 1GOCA 3T7ZA 5AQJA 3QFPA 5JVGL 1CZBA 4L3QA 3NH1A 2OTJN 4IOXA 4FWSA 4KV8A 1QQNA 4DSFA 1MWKA 1KAXA 1U6ZA 4PKHA 1YIJN 1LW0A 5AQLA 4FLWA 3LM9A 1FJGK 3IS9A 3TABA 5C24A 4YHHK 4FXDA 3ZSZA 1HNVA 1TK5A 1CXUA 1K6YA 3A5MC 2RN2A 3QICA 3ID8A 5FDLA 1TVRA 5M1KA 3DLEA 3EZWA 5BPNA 2G8VA 1LOTB 3G25A 4I7FA 5AQHA 4ISEA 3ULEA 4X66K 1S1UA 4CEOA 4EAHD 2E2NA 1NBWA 4H0OA 1A5XA 4W5RA 3H3OB 3CD6N 2VQEK 1LCUA 3VGLA 2O4IA 4CCHA 3WEEB 4CEFA 4FLZA 4M42A 5C15A 4DV2K 1VQ8N 3J7AP 1N32K 2HMPA 2OYQA 4IFYA 3K5NA 3M8SA 2GBZA 3JYTA 3H46O 3ZEUB 1IBKK 3WNHA 1TAQA 1RDDA 1QQOA 3AAQA 2YKMA 1I39A 2NRHA 1EP4A 1HJOA 3VQEA 4CGJA 2HMIA 4FLYA 5C10A 4Q5VA 4B9NA 1RT3A 3EN9A 1HYVA 4AF1A 4KHPK 3ZETB 3SPYA 1U49A 4DTXA 2KFZA 3ZSYA 3WNFA 4JI3K 3OY9A 1SV5A 1QSSA 2O8EA 3I8DA 3D6RA 2NRRA 5HL7L 4KHNA 4DLEA 4J2DA 3EKSA 2XRIA 4O8UA 3PLAA 3LDSA 3U9ZA 3TWHA 4IDKA 3OYBA 4WCEL 4YORA 4DSEA 3CPWM 2B5JA 4JK8A 4J8FA 3PO5A 3QNNA 3ZT3A 2P9PB 1VSLA 4AQYK 2CH6A 3RRGA 1KLNA 2UYTA 5AQFA 4QOZB 3MWPA 3AA3A 5EY4A 2IDOA 4PWDA 3DWLA 3AVIA 3MN6A 3AVKA 3BDPA 1U2VB 4ISGA 2YNHA 3O6WA 3CJAA 4IXCA 4B8AB 2IIRA 4DSIA 1SL1A 2W40A 1NKCA 1YVNA 2HHUA 5AQMA 4O44A 3QIOA 3WXIA 1IG8A 2FSNA 1BI4A 3LP0A 4N5SA 3D7EO 3KIOA 1ITGA 4L8RB 4XEIA 4F3TA 1VSFA 2HBJA 2Q31A 4N56A 5AZIA 3UKUA 1WSFA 4LFBK 3VENA 3SV3A 4DS5A 4CZGA 2NRXA 5M1PA 3HPOA 3O9SA 3HP9A 2YNGA 4HVJA 1OH5A 4DCHA 4N76A 4FJXA 3HSTB 1TL3A 3VQ8A 3CC7N 2FF6A 5AQXA 1NNEA 5BR9A 4LSLA 3ZSVA 3L8BA 1IG9A 3UB5A 5C12A 1NGCA 1SQKA 1OH6A 1JXEA 3MCAB 4AHUA 2XY6A 2Q2RA 3AVHA 4BE1A 3CJCA 4CHYA 4BDYA 2IOCA 1ZBFA 4CJKA 2ZF5O 3EO3A 4IWVA 2G8HA 3QBXA 4FVMA 3K9KA 4NLCA 4BRHA 4YDUA 1YJWN 1DTQA 2VGNA 4CEEA 1W0HA 4K0KK 2OPPA 2XY8A 1X9WA 3CCMN 4BR2A 3OYFA 3MN5A 4CGDA 2I5JA 3BZKA 3IRXA 3GL1A 2HW3A 4I6MB 3CM6A 3THWA 3NF7A 2VG5A 4IO9L 4ELUA 1E4GT 3FZLA 1WOQA 4IDHA 1VRUA 4JNEA 3PIPL 1S9GA 4KI6A 4H0XB 3DI6A 4JS5A 3D2FA 1C6VA 1BA0A 5M1OA 1HQUA 3RSEB 3L2VA 3ITHA 4FO0A 2PFUA 3NGZA 5M1NA 4Y1DA 5BN8A 4AM6A 3K0SA 4A5AA 3AO1A 1R0AA 5AQPA 1MWMA 3AO2A 2DPNA 3NGIA 2I7NA 1NKEA 1NGAA 3FE1A 4K8XA 1JKHA 4CHNA 3RRHA 3TAGA 1YITN 4U7BA 5J2NA 1WSEA 3BF3A 4X62K 3WNEA 2YJFA 3LP3A 4FWPA 4V19S 5FPDA 5CHIA 1P8ZA 1G15A 4LF4K 1IKYA 4JRPA 2O4GA 1U4BA 1N8RO 4CJ3A 3KK2A 1KFSA 4IJAA 3HSCA 1XI1A 3L2QA 4X65K 3FFIA 1TUUA 3K9JA 3M8QA 4H4MA 3EL2A 3A8YA 1CZAN 2E2OA 4Z4GA 4BR4A 4M3RA 2A1SA 2G8WA 4EZ6A 4IKFA 4KHSA 3HO1A 1RGIA 4LC9B 3LALA 1RDWX 3VF4A 4BWMA 2E1YA 1NGJA 4CZHA 4IG3A 3ZT4A 3DRSA 3WT0A 4C8KA 3L4IA 3ZLJA 3RTVA 4QCLA 5JS1A 3ZT1A 1HUXA 4CEAA 1JCGA 1WSJA 1FW6A 3TAMA 2HNYA 4B9MA 3RMBA 1HNXK 5HRSA 1C0UA 1OH7A 1GLBG 4K43A 2ETJA 1WBDA 5CYMA 2V7ZA 3JS6A 3MK6A 4IEIA 4KO0A 5C2DA 2RF2A 2UUCK 2W41A 1BQNA 4JYAK 3V1QA 4KAZA 2D0CA 2QWOA 3A2FA 1WSHA 4CEDA 3TSPA 2E2PA 1SUQA 4DFPA 5T7BA 2G8IA 3SLCA 4IFVA 3D0PA 4FJIA 3DRRA 3WEEA 1W97L 2P9IA 1U04A 1KAZA 4YOVA 1IKWA 4CFDA 5AQVA 1BO5O 3KHYA 4DMNA 4HTUA 2ITGA 4WFAL 2Z1JA 1G99A 3F5TA 2A42A 1DKGD 2YV0X 3IUCA 2ASPA 5LJVA 4NLBA 5BPMA 2QK9A 1HJRA 4CJLA 2ITMA 3NCIA 3OYCA 4NXNK 3V81A 4BRNA 2YCHA 4CZIA 1J53A 3DJCA 1XC3A 4DV4K 2ASMA 2P9NA 3I33A 4BGBA 5EU7A 3BUZB 4JHDA 2OA8A 3OYJA 4CZLA 4E1NA 4CJPA 2KQ2A 3VQ5A 2QWRA 1RTJA 3TI0A 4BC5A 4ID5A 3SMSA 1KCFA 2HHTA 4BR0A 4R5PA 4ZTFA 1WSIA 4BC2A 3O9RA 1IKVA 1BCOA 1D9DA 4W5QA 1WLJA 4FSVA 4CEBA 3U9DA 2GX9A 3L3VA 4FLXA 3MDQA 3CFOA 4JI4K 1T8EA 1BUPA 2HVIA 1BISA 3E9LA 4BRIA 3B6OA 3SNNA 3HPGA 1NU0A 5CR4A 1HYZA 1C0GA 4K41A 5KQ8A 3KWIA 3EYZA 4A2BA 5F1XA 4KHUA 1YHQN 3VEYA 3AAPA 4CHOA 3HBTA 4CK1A 3WNGA 4CIGA 3Q7BA 3OYLA 1ZBIA 4FLUA 1VSHA 2JGUA 1C1AA 4A59A 4FJ7A 4E7LA 2OPRA 1I94K 2FBXA 4CF8A 4F9OA 1U47A 1RFQA 4DV6K 3AO4A 3T1AA 3R9PA 4BG8A 4EHUA 1VSMA 4WFNL 4M3WA 3CIPA 4EHTA 3SK3A 1J9AA 2B4JA 2BH1A 2CGKA 4GNIA 1XMOK 3G71N 3F73A 4CJ5A 2P9SB 4F2SA 3CXCM 2Q97A 3ZSOA 1NGGA 2GELA 3PO4A 4B3TK 4OKKA 2HNDA 2DFHA 4BG9A 4EZ9A 2O8FB 4GKJK 3F9KA 4C1NI 5KGWA 3DXKA 4B3SK 1ASUA 1HMVA 1NK8A 4MDBA 3OVNA 1VQLN 3C65A 3K59A 4MFBA 1NLVA 4CZJA 2F96A 1RDAA 4M3YA 4F3OA 5BR8K 1NJYA 1Z6RA 5DMRA 3WXLA 2KHOA 3CQXA 4DTSA 4A2AA 1HLUA 2ZD1A 3OYAA 3JAMO 2IVPA 3VQ7A 3NF6A 3AO3A 2HNZA 1NGIA 3CI5A 3TPQA 3SUNA 3NH0A 3AA5X 2YNIA 2F9TA 4H0VB 3VOVA 4I6MA 3K58A 1H1VA 4F8RA 3Q7CA 1BCMA 1DTTA 4CBUA 3A5NC 3E66A 3J7ZO 4FJ8A 4H5TA 3QETA 3RSEA 1QSYA 1YAGA 3VETA 2NZTA 1Q81O 3MX5A 3J8AA 2OZSA 5AQYA 1GLEG 2O8BB 4AM7A 5AQNA 2V7YA 4NYFA 4OKJA 4MO5A 3GE1A 5FPEA 1RT7A 2WFBA 2YHWA 1ASVA 4JKAA 2E8AA 5EVZA 4MDAA 4DKWA 3NAEA 3O9UA 4M41A 1VQ6N 3M6GA 1BHLA 2D0AA 2OPQA 3L4QA 5LMUK 3BEXA 2E88A 4FWKA 3EZ5A 3H08A 1ATRA 4FW1A 4Y1CA 4DV3K 2E2QA 4CD3A 4DFMA 3DMJA 4ILGB
chains in the Genus database with same CATH topology
4JI6K 4LFCK 4LF9K 1XMOK 1N33K 4DV1K 4NXNK 2VQEK 4JI1K 4LF5K 4X62K 1IBMK 4V19S 4DV4K 4DV2K 1IBLK 4B3TK 4JI8K 4YY3K 3J7AP 3OTOK 1N32K 4LF4K 4JI0K 4LFBK 4GKJK 1IBKK 4B3SK 4DUZK 4JV5K 4B3MK 4DUYK 4NXMK 4DR6K 4DR1K 5BR8K 3J81O 4B3RK 4X65K 2VQFK 4LFAK 3J7YP 2UUAK 4KHPK 4CVNE 4DR4K 5LMNK 3T1HK 2UU9K 3JAMO 3T1YK 2E5LK 2UXCK 2ZM6K 4DV0K 4DV7K 1N36K 2UUBK 4JI3K 4JI5K 1HNZK 4DR3K 2UXDK 1XMQK 4JI2K 4JI4K 2HHHK 4JI7K 1HNXK 4DR2K 5A2QO 4X64K 5IT9O 4LF7K 4K0KK 5LL6Z 5IWAK 1J5EK 2F4VK 4DV5K 2UUCK 4GKKK 4LF6K 4JYAK 4CW7B 4DR7K 1HNWK 4AQYK 5AJ3K 3J80O 1N34K 1XNQK 2UXBK 1FJGK 1XNRK 4YHHK 5LMUK 1I94K 1HR0K 5FLXO 4LF8K 4DV3K 4DR5K 4DV6K 4X66K 4OX9K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI6 K;  4LFC K;  4LF9 K;  1XMO K;  1N33 K;  4DV1 K;  4NXN K;  2VQE K;  4JI1 K;  4LF5 K;  4X62 K;  1IBM K;  4V19 S;  4DV4 K;  4DV2 K;  1IBL K;  4B3T K;  4JI8 K;  4YY3 K;  3J7A P;  3OTO K;  1N32 K;  4LF4 K;  4JI0 K;  4LFB K;  4GKJ K;  1IBK K;  4B3S K;  4DUZ K;  4JV5 K;  4B3M K;  4DUY K;  4NXM K;  4DR6 K;  4DR1 K;  5BR8 K;  3J81 O;  4B3R K;  4X65 K;  2VQF K;  4LFA K;  3J7Y P;  2UUA K;  4KHP K;  4CVN E;  4DR4 K;  5LMN K;  3T1H K;  2UU9 K;  3JAM O;  3T1Y K;  2E5L K;  2UXC K;  2ZM6 K;  4DV0 K;  4DV7 K;  1N36 K;  2UUB K;  4JI3 K;  4JI5 K;  1HNZ K;  4DR3 K;  2UXD K;  1XMQ K;  4JI2 K;  4JI4 K;  2HHH K;  4JI7 K;  1HNX K;  4DR2 K;  5A2Q O;  4X64 K;  5IT9 O;  4LF7 K;  4K0K K;  5LL6 Z;  5IWA K;  1J5E K;  2F4V K;  4DV5 K;  2UUC K;  4GKK K;  4LF6 K;  4JYA K;  4CW7 B;  4DR7 K;  1HNW K;  4AQY K;  5AJ3 K;  3J80 O;  1N34 K;  1XNQ K;  2UXB K;  1FJG K;  1XNR K;  4YHH K;  5LMU K;  1I94 K;  1HR0 K;  5FLX O;  4LF8 K;  4DV3 K;  4DR5 K;  4DV6 K;  4X66 K;  4OX9 K; 
#chains in the Genus database with same CATH topology
 2NRV A;  2X6S A;  4AHT A;  1D5A A;  3G10 A;  3SQ2 A;  3NF9 A;  3OYG A;  1WAF A;  3UE5 A;  2V51 B;  4BRL A;  2WC9 A;  2A6A A;  1RDU A;  1NGF A;  4I2Q A;  4M3U A;  1IBL K;  5HRN A;  4ICL A;  3D2E B;  2RKI A;  3HVR A;  5AQT A;  4HHT A;  4B9V A;  3L3U A;  1RTD A;  1T6C A;  1TYQ B;  4JKB A;  3SAF A;  2BAN A;  3FZF A;  1YJN N;  4B9L A;  4FPA A;  5F2R A;  4DR1 K;  3THY B;  5C25 A;  2P9K A;  1TKD A;  4B3R K;  1C1C A;  3S3N A;  4NYN A;  5HOO A;  4BRD A;  1LWE A;  1V4S A;  4M63 C;  1ASW A;  2UU9 K;  1NJZ A;  1GLA G;  4I9Q A;  4XH1 A;  3P5J A;  1W7A A;  1T6D A;  4CFC A;  3D45 A;  3TAE A;  1J54 A;  1WNS A;  3P4I A;  4DR3 K;  2QW9 A;  3K5O A;  3VTI A;  4DG1 A;  2NRZ A;  4RW9 A;  4CGF A;  4KB1 A;  2EWS A;  1TAU A;  2HB5 A;  4BC3 A;  4BR7 A;  1EQY A;  3HL8 A;  4E1J A;  4A5B A;  1XQS C;  4BRF A;  2WUS A;  3PUF A;  1N6Q A;  2KZM A;  3OYH A;  1HYS A;  2F8S A;  1ZYQ A;  2HBK A;  3C7N A;  4EFH A;  3MWT A;  3H6E A;  1NOZ A;  4CF2 A;  2FSJ A;  2P9U B;  1LAV A;  4KH4 A;  4DS4 A;  1HNW K;  3C6T A;  1RBR A;  3KKS A;  4WE1 A;  3VF2 A;  1L3U A;  5AJ3 K;  4O5B A;  2QXF A;  3RMD A;  3ATU A;  4W5O A;  3MN9 A;  4JD2 A;  4AHS A;  3ULD A;  5MLC Q;  5AQQ A;  3HOS A;  1ZBS A;  4FWO A;  4RTF D;  4Z94 A;  3VPZ A;  4H5V A;  4W5N A;  3LDN A;  5FLX O;  1DGK N;  5HLF A;  1OVQ A;  2BTF A;  4CIE A;  3QNO A;  2O8D B;  2IVN A;  3ZSQ A;  3QES A;  2AJQ A;  4DU3 A;  1S6P A;  1QS4 A;  4UY8 O;  3KK3 A;  3SV4 A;  3LPT A;  1JL2 A;  4GV9 A;  4FJ9 A;  3U3Y A;  1VQN N;  2D0B A;  3IG1 A;  1ESV A;  1BOT O;  5HRR A;  5CY4 A;  5SZT A;  1BIU A;  2OTL N;  4NCG A;  2A3Z A;  2QM1 A;  5AZJ B;  1B9F A;  3SPZ A;  4JV5 K;  1JXB A;  1NMD A;  4J2E A;  3O80 A;  4NXM K;  1VQ9 N;  3CJ1 A;  3EEQ A;  1NK0 A;  1C1B A;  3VGM A;  3J81 O;  4HUG A;  1NK4 A;  4FJL A;  5M1Q A;  3VEX A;  3UKR B;  4DF8 A;  2VQF K;  1OKJ A;  4DFJ A;  3KLH A;  3V1R A;  4NCA A;  3CF5 L;  4ISF A;  3KLF A;  2E5L K;  3DM2 A;  4JKC A;  4XH5 A;  4BWJ A;  3SMP A;  1UAX A;  3P83 D;  1DT9 A;  3UIQ A;  3SQ0 A;  4OLA A;  3E01 A;  2QI2 A;  5GAH P;  1MDU B;  1BG3 A;  4MQ3 A;  3F9M A;  1JLE A;  1YTU A;  1IJJ A;  1Q9Y A;  2VWB A;  1HX1 A;  1YUW A;  4B1Y B;  1NK9 A;  3HRG A;  4MLE A;  3OBY A;  3CMA N;  2NNW A;  5ELZ A;  1GOA A;  5LL6 Z;  1VQ5 N;  3B6P A;  1KAY A;  3A0I X;  4BRA A;  1KXP A;  1WAJ A;  3CCJ N;  5JIC A;  3QER A;  1Q7Y O;  5AQG A;  3KD5 E;  1T7P A;  4BRM A;  2P9L B;  4FM0 A;  1TL1 A;  4NO7 A;  4CZK A;  1IH7 A;  5EX5 A;  4J2B A;  4DQS A;  3E9O A;  3W3D A;  2ZJQ L;  1IV0 A;  5BRE A;  1XNQ K;  1X9S A;  3NE6 A;  3VEW A;  4FJ5 A;  1KVA A;  4H03 B;  4M7X A;  3SJJ A;  2YHY A;  4O0I A;  2ZGZ A;  3CJB A;  3QFU A;  1EKE A;  3HI0 A;  4K8Z A;  4DHY A;  1RNH A;  2H3G X;  4C8N A;  3TR8 A;  1MU2 A;  3CJ7 A;  2KZZ A;  4O0J A;  4KHQ A;  4YFU A;  1IBM K;  4CF9 A;  3VQD A;  1Q18 A;  1SL2 A;  5GAE P;  3THX A;  3DXM A;  4CGI A;  2BE2 A;  4CHZ A;  4CJ4 A;  3OYM A;  4G1Q A;  4DU1 A;  5FRN A;  1QHA A;  2QEX N;  3FFK B;  2GUP A;  3I55 N;  3O1B A;  3OS1 A;  4DF4 A;  1VSK A;  4OGC A;  1NJX A;  5AQR A;  4DTP A;  1S1X A;  1NJW A;  1HPZ A;  5GAG P;  2NLX A;  4BRQ A;  4EP5 A;  3CHW A;  4RWT A;  4OGE A;  3NVK A;  1J6Z A;  5LMN K;  1BWF O;  2W6K A;  1E3M A;  3BF1 A;  4DTR A;  3T19 A;  2QA4 N;  1EO1 A;  4H0P A;  3CQY A;  3MEG A;  4KFB A;  5M1F A;  2O8B A;  3VF6 A;  3ZCM A;  4EP4 A;  4CGH A;  1NOY A;  3DOL A;  4FWQ A;  2O8C B;  2IC3 A;  5DM6 L;  1TKX A;  3QIP A;  4OLB A;  2KW4 A;  3AA2 A;  3RR7 A;  2KFN A;  2GWK A;  2E4L A;  3U4L A;  1TGO A;  1HKC A;  1SL0 A;  4A61 A;  1BL3 A;  1TKT A;  1RDB A;  4LY7 A;  2R7Y A;  3MXI A;  4FW2 A;  1GLD G;  4JKF A;  1S1V A;  3IKM A;  4C8O A;  2GTD A;  3SJH A;  4MO4 A;  3QB0 A;  2F9W A;  1QZ6 A;  1CXQ A;  4C1N K;  2W6L A;  3VQB A;  4DSL A;  2EHG A;  1XNR K;  3AO5 A;  2GUI A;  4DQ8 A;  1S6Q A;  4CGG A;  3KTQ A;  2VCP A;  3D2E A;  4GW6 A;  3C95 A;  1KC8 O;  3WQU A;  4DB3 A;  5DK5 A;  3NFA A;  4OPH A;  4CEZ A;  4FM1 A;  1RBS A;  1ZC6 A;  2P1J A;  2RPI A;  1LV5 A;  4LFC K;  3THY A;  3TTF A;  3AAR A;  2KLA A;  1XWL A;  1V4T A;  3CFP A;  4GV3 A;  4JI1 K;  4CF0 A;  1S22 A;  3NBP A;  5SWM A;  4CHP A;  2AA4 A;  3LZI A;  4QS9 A;  3PSI A;  3A5L C;  3LDO A;  1ILY A;  5BN9 A;  1EX4 A;  3ZEU A;  2YHX A;  2F7T A;  4WQ5 C;  3CME N;  4DU4 A;  3M3Z A;  3QIN A;  4CZE A;  4DWI A;  3FZM A;  4HCC A;  4LFA K;  3TAN A;  4E19 A;  4AHC A;  1ATS A;  2Q0U A;  3ZET A;  4M45 A;  4H5N A;  2YHB A;  3N4P A;  4Z4H A;  5ADX H;  4YOT A;  3FZH A;  2OPS A;  3DYA A;  1XMQ K;  4TSX A;  3FLC O;  4FZX C;  2HF3 A;  2VGM A;  3PSF A;  3TAF A;  4I2P A;  1D9F A;  4B9T A;  3K57 A;  3AGR A;  2FSK A;  1K8A O;  3LPU A;  4DQQ A;  5IWA K;  3ZSX A;  1NWK A;  1QVG M;  3PX4 A;  2F4V K;  4H0Y B;  4DV5 K;  1VSE A;  4OPJ A;  4AHR A;  4IJN A;  3M8R A;  4FJH A;  4DR7 K;  2P9P A;  4DLG A;  3SCX A;  5KPT A;  3VTH A;  1Q9X A;  3AVJ A;  1FXX A;  3CC2 N;  1VQM N;  1N34 K;  4KKO A;  2GEM A;  3TSQ A;  4JKG B;  2QWM A;  1FKP A;  3OS2 A;  3VA0 A;  4JN4 A;  3QEX A;  5GIO A;  1JLC A;  4FL9 A;  4IG0 A;  1U2V A;  2Z1I A;  5AQO A;  1JCE A;  3KWG A;  1RT2 A;  4IEE A;  1GLF O;  1A5W A;  3TTD A;  5AZJ A;  2Y1I A;  2WTU A;  4BR9 A;  3V6D A;  1EXQ A;  3PX6 A;  1S5J A;  2J4R A;  1NM1 A;  1RT6 A;  3SAH A;  1BI4 B;  4YOW A;  4DV1 K;  4B1U B;  3UKR A;  1XHZ A;  3IAY A;  5AZI B;  3UKU B;  4OJR A;  4Z4I A;  1BIZ A;  2QWQ A;  1NG9 A;  4BC4 A;  4IZ9 A;  1T05 A;  4H5R A;  5KQD A;  3V9W A;  4B3M K;  4YOX A;  2HVH A;  1Z25 A;  2YJE A;  4ELV A;  1CZ9 A;  1TKZ A;  3ISN C;  3V9Z A;  3O4N A;  3CCQ N;  3C6H A;  3I0R A;  1VSI A;  3O3H A;  4NCB A;  4JK9 A;  3C6A A;  3AV9 A;  4YOY A;  1VQO N;  3RR8 A;  3MN7 A;  3B8A X;  1U45 A;  4KTW A;  4KHY A;  5HP1 A;  3KK1 A;  4ID1 A;  3H45 C;  2PYL A;  4FJJ A;  4E0D A;  4N41 A;  4PL7 A;  3LDL A;  3KZB A;  4B9S A;  4I9L A;  3VQQ A;  1VQ4 N;  4CI6 A;  1RDC A;  4PY5 A;  4M3X A;  5KTQ A;  4KTQ A;  3DAW A;  4DTJ A;  1FK9 A;  4XH4 A;  2WOM A;  3WUH A;  2HBL A;  4CF1 A;  5D3G A;  4PQU A;  2HBM A;  3VQC A;  3E1Y A;  4KI4 A;  2QKK A;  4RG8 A;  4LF6 K;  2DFE A;  3EY1 A;  1SKW A;  2OZM A;  3KVG A;  1NK5 A;  1W2B M;  4BVO A;  1XC9 A;  3QML A;  1GOB A;  3THW B;  3L6Q A;  3VEZ A;  3V9X A;  1KFD A;  3W0L A;  3WXM B;  2UXB K;  1R59 O;  3H1Q A;  5EXW A;  3D2F B;  3SYZ A;  3CET A;  3KKR A;  2ASO A;  2X78 A;  3MXM A;  4DQI A;  2Z1H A;  2ATQ A;  4JK7 A;  4B8C A;  2ZWH A;  1F21 A;  3G4S N;  3PY8 A;  3AY9 A;  1ZXO A;  4FOE A;  4B1V A;  3DLR A;  5AQU A;  5TKY A;  4WQ4 C;  4FJM A;  3CC4 N;  4JI6 K;  3ZX0 A;  1YTA A;  1KRP A;  2WON A;  3ALY A;  1K8K B;  1KD1 O;  4HWI A;  3L2W A;  1NGD A;  2PYJ A;  3TU5 A;  3QEP A;  3VQP A;  3OJU A;  4JI8 K;  4AH9 A;  2B6A A;  1L3V A;  2NUB A;  1RIL A;  1LWF A;  1JCF A;  2I7P A;  3SBT A;  2A5X A;  2HF4 A;  1Y64 A;  2X74 A;  4BAC A;  4JKD A;  2HOE A;  3U8X A;  4CJE A;  2ZQB A;  5BRH A;  4DUZ K;  5AFU H;  1VRT A;  1VK0 A;  3HVT A;  3RMC A;  2O8C A;  5TKW A;  3VN5 A;  3R6M A;  4BQL A;  3TTC A;  3MED A;  1C0M A;  4BE2 A;  4CJR A;  3T1Y K;  4OPA A;  4Z4C A;  4KH5 A;  2A1R A;  4CJ7 A;  1J5O A;  3WXK A;  1RTI A;  2JWL A;  4DQR A;  3CCE N;  3LWL A;  2QWP A;  2D1K A;  1HNZ K;  2UXD K;  2HHW A;  4GY2 B;  4JKH A;  4JS4 A;  1K73 O;  3I8B A;  3QDK A;  3HZ6 A;  1Y97 A;  4IOC L;  2G8U A;  1EET A;  3L0Q A;  4FK4 A;  3LAN A;  3FR0 A;  3BZC A;  2YI1 A;  5A2Q O;  1D4X A;  1RBU A;  3S3O A;  4CIF A;  4LSN A;  1X1P A;  4H0T B;  2LSN A;  4O55 A;  1J5E K;  1VSJ A;  4ILJ A;  5J2M A;  1EWQ A;  5FRM A;  5HRP A;  4IO8 A;  3HXM A;  2QKB A;  4CER A;  1S72 N;  3KK7 A;  1HPM A;  3GBT A;  3QO9 A;  1YT3 A;  2QWL A;  3MEC A;  1ZBU A;  3J80 O;  3KJV A;  5CYQ A;  1NMN A;  5C42 A;  2BGG A;  4PA1 A;  4YNQ A;  2P9I B;  1S9E A;  1SKS A;  1M1K O;  1TK0 A;  1VQ7 N;  4KRF A;  1QTM A;  5KGX A;  2GV9 A;  4MLH A;  4BRC A;  1HR0 K;  3OJS A;  2Q0R A;  4UQG A;  3OYD A;  5JLF A;  5JLH A;  4IOA L;  2VWK A;  1KLM A;  1IKX A;  1L5U A;  3ENH A;  3P31 A;  4E7J A;  3G0Z A;  3AVF A;  4AHV A;  1U48 A;  3WXJ A;  1ZBL A;  1HKG A;  1UOC A;  2YX6 A;  5LY3 A;  2BDP A;  4B9U A;  3ZSW A;  4RCH A;  3NH2 A;  5GAD P;  3MXJ A;  4LF5 K;  2D0P A;  2DFF A;  1QHT A;  3TAR A;  5E41 A;  2P9N B;  4GVM A;  3CYM A;  3V4I A;  1S3X A;  3L2U A;  3R1X A;  4JHD B;  2ZE2 A;  3RVC A;  2FBY A;  2AP1 A;  3SBG A;  5JVH L;  1JLG A;  4BVP A;  1MA9 B;  2XHB A;  3RMA A;  4KHW A;  4CBW A;  4AIL C;  4FJK A;  4CJQ A;  3O3G A;  3O08 A;  4GVE A;  1NKB A;  1SKR A;  3ATV A;  3T1H K;  4KTZ A;  2WBN A;  3LAK A;  4DV0 K;  4N47 A;  4DTU A;  2UUB K;  2BUP A;  3LM2 A;  1LAW A;  3OW2 M;  3O5B A;  4NB4 A;  5BPL A;  4FJG A;  1QE1 A;  2IGI A;  4JI7 K;  2X6N A;  5EOY A;  3NDK A;  4CFB A;  3HTV A;  3AVA A;  4DFK A;  1YJ9 N;  2CGJ A;  2QTD A;  4JKG A;  4K42 A;  1GLJ O;  1P90 A;  4CJT A;  5GIN A;  3H3N O;  4LD0 A;  1LWC A;  1JLA A;  3O9T A;  1JL1 A;  4ZHR A;  2YNF A;  3ID6 A;  5DM7 L;  2GWJ A;  4F2R A;  4DTN A;  3SUP A;  4PKG A;  2OAN A;  4C8M A;  1WB9 A;  4A62 A;  4B1X B;  3NGY A;  1QQC A;  4CW7 B;  4WQ5 A;  3OS0 A;  4CZF A;  1DEJ A;  4BDP A;  3OYK A;  3FGU A;  1BQM A;  5FRO A;  3F2K A;  4HUE A;  4M3T A;  2P5O A;  3SQ1 A;  5C0Y A;  2IAJ A;  4J2A A;  3DLG A;  3I56 N;  4DR5 K;  3U3G A;  1QQM A;  3BGR A;  3KLE A;  4KRE A;  1BDG A;  4FWL A;  3DLH A;  3CCR N;  1NGH A;  1XHX A;  4FZZ A;  3T69 A;  4CK2 A;  4FWN A;  4RW6 A;  3OYN A;  3HJF A;  3MMV A;  3M1F A;  1NK7 A;  2P9S A;  1SS6 A;  4PHT X;  1RBV A;  3M5R A;  3BP8 A;  1DLO A;  3N4Q A;  4XIU A;  4YY3 K;  5E26 A;  5CZ2 A;  4KH6 A;  3AVL A;  2W42 A;  3DXK B;  3R8E A;  2O8F A;  3VQ4 A;  4PUO A;  1EWR A;  5KPZ A;  3HYF A;  1Z05 A;  1W9H A;  3K5L A;  3NMU A;  4FOI A;  4E7I A;  2Q3S A;  4CJW A;  3V1O A;  3A5O C;  3HM8 A;  3DOK A;  2Y1J A;  3KLI A;  3SZ2 A;  1KTQ A;  1RCH A;  5KI6 A;  1NGB A;  2JWK A;  1TUY A;  3JXU A;  5I9E B;  1N36 K;  4CFA A;  4LH4 A;  5I42 A;  4Z4F A;  1WSG A;  2HHH K;  3PIO L;  4CZM A;  1Q82 O;  3I0S A;  4O5F A;  5AR0 A;  3E9P A;  4CK3 A;  2F8T A;  1WN7 A;  1SAZ A;  4FWM A;  4OPK A;  2VYP A;  4LF7 K;  1RTH A;  4B08 A;  5BRD A;  4H4O A;  3S9H A;  5GIP A;  4R79 A;  3LDP A;  5B8H A;  1YI2 N;  3QEI A;  1HQE A;  3DLK A;  4BGA A;  3PX0 A;  1VHX A;  1CLQ A;  4WFB L;  3MEE A;  3SQ4 A;  3O4W A;  3H1V X;  3VEO A;  1KVC A;  2HHS A;  3HK2 A;  5CZ1 A;  5J2Q A;  2XY5 A;  3NF8 A;  4PKI A;  5HBM A;  3HOT A;  4BR5 A;  2A40 A;  1K8K A;  4GMJ B;  3RWU A;  2YKN A;  5K14 A;  2E20 A;  1UA0 A;  4OKE A;  2XO7 A;  2NRT A;  1JJ2 M;  4FCY A;  2IVO A;  3SAG A;  3KLG A;  3TAP A;  3V9S A;  1C0T A;  2VG7 A;  4FK2 A;  3NHG A;  1YXQ A;  2KTQ A;  2G8K A;  2QXL A;  4BRO A;  2FC0 A;  4BRE A;  4Q0B A;  4CEQ A;  4CJS A;  3HPH A;  4CD1 A;  3T3F A;  4BQZ A;  3VA3 A;  1TK8 A;  1RT1 A;  4W5T A;  2FBV A;  3OTO K;  3CER A;  1L3T A;  3MX2 A;  2G8F A;  3IDH A;  1ATN A;  1REV A;  3CJ9 A;  1Q8I A;  1HKB A;  1TYQ A;  4B1Z A;  3ULE B;  3CPE A;  1QZ5 A;  4FM2 A;  3V9U A;  1N5Y A;  2P9K B;  3LP2 A;  3DLB A;  1ZBH A;  4OVL A;  3CCU N;  3O9Q A;  3LP1 A;  1HNI A;  2P5G A;  4FPB A;  3R3L A;  4DSJ A;  1VSD A;  3C6U A;  3LWM A;  3OA9 A;  2HHV A;  4CEC A;  3ZX3 A;  5LJW A;  4CVN E;  4B1W B;  5I3U A;  1KVB A;  4HTL A;  4DTO A;  2CH5 A;  4JLH A;  5JS2 A;  1YVU A;  3CCV N;  5J2P A;  4EIA A;  1VQK N;  3LZJ A;  2ZJP L;  2D0O A;  5CE3 A;  4HCB A;  3QEW A;  4WQ4 A;  2PBD A;  4A57 A;  3AVM A;  3CM5 A;  4WF9 L;  2E6M A;  1WUA A;  3S41 A;  4FK0 A;  1X3N A;  3VER A;  4LH5 A;  3VMF B;  3ZT0 A;  4FLV A;  4E7H A;  2FLO A;  4CHQ A;  3HM9 A;  1FKO A;  4GV6 A;  1KQS M;  1S1W A;  3GOI A;  3O3F A;  4HUF A;  4O8K A;  4Z0U A;  3CCL N;  4F4K A;  3LAM A;  3C7N B;  4QAG A;  5KPR A;  4E7K A;  4GKK K;  1BU6 O;  3GG4 A;  4DTM A;  2O8E B;  2VG6 A;  2P9U A;  2FF3 B;  2E1Z A;  1RT4 A;  5ADX A;  3HT3 A;  3TAQ A;  4JKE A;  3THV A;  3VQA A;  1GLL O;  4JD2 B;  1O1W A;  2EX3 A;  3CFR A;  2Q36 A;  2RE2 A;  3ZYY X;  3BY5 A;  1C0F A;  4KBO A;  2VWJ A;  1D8Y A;  3P38 A;  3IFR A;  2QWN A;  4ILH A;  2OCE A;  2O8D A;  2P51 A;  2NRW A;  3QLH A;  4CES A;  4OX9 K;  2CGL A;  1XUP O;  1GLC G;  3L2R A;  3EKU A;  4C8L A;  3K2P A;  5J1E A;  3ENB A;  3IMX A;  2ZGY A;  4WYB A;  1T44 A;  5FPM A;  1Z26 A;  4C23 A;  4FZY A;  4YDU C;  4IFE A;  4QS7 A;  1QSL A;  1I3A A;  2DY4 A;  2E6L A;  3C94 A;  4BDZ A;  1X9J A;  4FWR A;  4Y0W A;  3OBW A;  3SUQ A;  3SI6 A;  1VQP N;  3O8M A;  2DTU A;  3LL3 A;  3EE8 A;  3S3M A;  1K9M O;  1OVY A;  2HHQ A;  1LW2 A;  3VQ6 A;  4FLT A;  1L3S A;  3J7Y P;  2UUA K;  4IBN A;  3EE9 A;  1T03 A;  3P1G A;  4K25 A;  3OYI A;  5JMV A;  2XY7 A;  4E1M A;  3LDQ A;  1NJI O;  2HHX A;  5BRF A;  3ZT2 A;  4PL8 A;  3VES A;  4M7Y A;  4U67 L;  2V52 B;  3AVC A;  4DSK A;  3P39 A;  3CQ8 A;  1E4F T;  1SZ2 A;  3PV8 A;  2A41 A;  4QS8 A;  3MAQ A;  4DR2 K;  4FJN A;  3ASM A;  1JLB A;  4X64 K;  3CCS N;  3O1W A;  5AQI A;  1X9M A;  3K5M A;  5E84 A;  1B9D A;  5C2F A;  2PY5 A;  1RBT A;  3O4Q A;  1UWB A;  2RHK A;  4ZTJ A;  2IS3 A;  5FPN A;  3KD1 E;  4BY9 C;  4E89 A;  2P9L A;  5AQZ A;  1YF5 L;  1M90 O;  2FXU A;  4JAX A;  4ELT A;  1OH8 A;  1UA1 A;  1HRH A;  3FZK A;  3AGK A;  4RW7 A;  4CJU A;  3AA4 A;  1QVF M;  1WBB A;  3AVB A;  3VGK A;  3HP6 A;  2Z1G A;  1O13 A;  4LF8 K;  3TSU A;  3JSM A;  4BRG A;  1NGE A;  1T3V A;  4Z4E A;  1KSP A;  3GDQ A;  5F0X A;  4LF9 K;  1TV6 A;  4M3Z A;  1N33 K;  4CJV A;  4O4G A;  5HRO A;  1Q86 O;  3CG7 A;  3THX B;  3DRP A;  3ENO A;  3DXM B;  5AQS A;  5AQW A;  4KPY A;  3ZX2 A;  4CBX A;  4E3S A;  1S1T A;  4G9Z A;  3DLL L;  4FYD A;  3ZSR A;  4JI0 K;  4FVU A;  4B3O A;  3QEV A;  4DQP A;  2ZJR L;  4B9Q A;  5KRT A;  2PZS A;  2D4W A;  1IO2 A;  2PAV A;  5KRS A;  4DUY K;  2JLE A;  3VEV A;  4DR6 K;  1B92 A;  3NVM A;  1JLQ A;  2D5R A;  3M8P A;  3OYE A;  1RT5 A;  3SUO A;  3AVG A;  3VQ9 A;  3MCP A;  2FBT A;  1JLF A;  2YHA A;  5AQK A;  3QBW A;  4DR4 K;  1A5V A;  3G6E N;  4KB0 A;  4JRQ A;  4BRK A;  2KKZ A;  5H1S Q;  2UXC K;  2ZM6 K;  4DV7 K;  1X3M A;  2HST A;  2Q1N A;  4RW4 A;  3U6F A;  4OO1 J;  4BE0 A;  4CE9 A;  1VAZ A;  4H8K A;  4JI5 K;  4JI2 K;  4YOU A;  4H5W A;  4CJF A;  4RW8 A;  3AVN A;  3C0B A;  1BGX T;  3WQT A;  5AFU A;  4BRP A;  1NK6 A;  4JEP A;  1BA1 A;  5IT9 O;  3OHR A;  1GOC A;  3T7Z A;  5AQJ A;  3QFP A;  5JVG L;  1CZB A;  4L3Q A;  3NH1 A;  2OTJ N;  4IOX A;  4FWS A;  4KV8 A;  1QQN A;  4DSF A;  1MWK A;  1KAX A;  1U6Z A;  4PKH A;  1YIJ N;  1LW0 A;  5AQL A;  4FLW A;  3LM9 A;  1FJG K;  3IS9 A;  3TAB A;  5C24 A;  4YHH K;  4FXD A;  3ZSZ A;  1HNV A;  1TK5 A;  1CXU A;  1K6Y A;  3A5M C;  2RN2 A;  3QIC A;  3ID8 A;  5FDL A;  1TVR A;  5M1K A;  3DLE A;  3EZW A;  5BPN A;  2G8V A;  1LOT B;  3G25 A;  4I7F A;  5AQH A;  4ISE A;  3ULE A;  4X66 K;  1S1U A;  4CEO A;  4EAH D;  2E2N A;  1NBW A;  4H0O A;  1A5X A;  4W5R A;  3H3O B;  3CD6 N;  2VQE K;  1LCU A;  3VGL A;  2O4I A;  4CCH A;  3WEE B;  4CEF A;  4FLZ A;  4M42 A;  5C15 A;  4DV2 K;  1VQ8 N;  3J7A P;  1N32 K;  2HMP A;  2OYQ A;  4IFY A;  3K5N A;  3M8S A;  2GBZ A;  3JYT A;  3H46 O;  3ZEU B;  1IBK K;  3WNH A;  1TAQ A;  1RDD A;  1QQO A;  3AAQ A;  2YKM A;  1I39 A;  2NRH A;  1EP4 A;  1HJO A;  3VQE A;  4CGJ A;  2HMI A;  4FLY A;  5C10 A;  4Q5V A;  4B9N A;  1RT3 A;  3EN9 A;  1HYV A;  4AF1 A;  4KHP K;  3ZET B;  3SPY A;  1U49 A;  4DTX A;  2KFZ A;  3ZSY A;  3WNF A;  4JI3 K;  3OY9 A;  1SV5 A;  1QSS A;  2O8E A;  3I8D A;  3D6R A;  2NRR A;  5HL7 L;  4KHN A;  4DLE A;  4J2D A;  3EKS A;  2XRI A;  4O8U A;  3PLA A;  3LDS A;  3U9Z A;  3TWH A;  4IDK A;  3OYB A;  4WCE L;  4YOR A;  4DSE A;  3CPW M;  2B5J A;  4JK8 A;  4J8F A;  3PO5 A;  3QNN A;  3ZT3 A;  2P9P B;  1VSL A;  4AQY K;  2CH6 A;  3RRG A;  1KLN A;  2UYT A;  5AQF A;  4QOZ B;  3MWP A;  3AA3 A;  5EY4 A;  2IDO A;  4PWD A;  3DWL A;  3AVI A;  3MN6 A;  3AVK A;  3BDP A;  1U2V B;  4ISG A;  2YNH A;  3O6W A;  3CJA A;  4IXC A;  4B8A B;  2IIR A;  4DSI A;  1SL1 A;  2W40 A;  1NKC A;  1YVN A;  2HHU A;  5AQM A;  4O44 A;  3QIO A;  3WXI A;  1IG8 A;  2FSN A;  1BI4 A;  3LP0 A;  4N5S A;  3D7E O;  3KIO A;  1ITG A;  4L8R B;  4XEI A;  4F3T A;  1VSF A;  2HBJ A;  2Q31 A;  4N56 A;  5AZI A;  3UKU A;  1WSF A;  4LFB K;  3VEN A;  3SV3 A;  4DS5 A;  4CZG A;  2NRX A;  5M1P A;  3HPO A;  3O9S A;  3HP9 A;  2YNG A;  4HVJ A;  1OH5 A;  4DCH A;  4N76 A;  4FJX A;  3HST B;  1TL3 A;  3VQ8 A;  3CC7 N;  2FF6 A;  5AQX A;  1NNE A;  5BR9 A;  4LSL A;  3ZSV A;  3L8B A;  1IG9 A;  3UB5 A;  5C12 A;  1NGC A;  1SQK A;  1OH6 A;  1JXE A;  3MCA B;  4AHU A;  2XY6 A;  2Q2R A;  3AVH A;  4BE1 A;  3CJC A;  4CHY A;  4BDY A;  2IOC A;  1ZBF A;  4CJK A;  2ZF5 O;  3EO3 A;  4IWV A;  2G8H A;  3QBX A;  4FVM A;  3K9K A;  4NLC A;  4BRH A;  4YDU A;  1YJW N;  1DTQ A;  2VGN A;  4CEE A;  1W0H A;  4K0K K;  2OPP A;  2XY8 A;  1X9W A;  3CCM N;  4BR2 A;  3OYF A;  3MN5 A;  4CGD A;  2I5J A;  3BZK A;  3IRX A;  3GL1 A;  2HW3 A;  4I6M B;  3CM6 A;  3THW A;  3NF7 A;  2VG5 A;  4IO9 L;  4ELU A;  1E4G T;  3FZL A;  1WOQ A;  4IDH A;  1VRU A;  4JNE A;  3PIP L;  1S9G A;  4KI6 A;  4H0X B;  3DI6 A;  4JS5 A;  3D2F A;  1C6V A;  1BA0 A;  5M1O A;  1HQU A;  3RSE B;  3L2V A;  3ITH A;  4FO0 A;  2PFU A;  3NGZ A;  5M1N A;  4Y1D A;  5BN8 A;  4AM6 A;  3K0S A;  4A5A A;  3AO1 A;  1R0A A;  5AQP A;  1MWM A;  3AO2 A;  2DPN A;  3NGI A;  2I7N A;  1NKE A;  1NGA A;  3FE1 A;  4K8X A;  1JKH A;  4CHN A;  3RRH A;  3TAG A;  1YIT N;  4U7B A;  5J2N A;  1WSE A;  3BF3 A;  4X62 K;  3WNE A;  2YJF A;  3LP3 A;  4FWP A;  4V19 S;  5FPD A;  5CHI A;  1P8Z A;  1G15 A;  4LF4 K;  1IKY A;  4JRP A;  2O4G A;  1U4B A;  1N8R O;  4CJ3 A;  3KK2 A;  1KFS A;  4IJA A;  3HSC A;  1XI1 A;  3L2Q A;  4X65 K;  3FFI A;  1TUU A;  3K9J A;  3M8Q A;  4H4M A;  3EL2 A;  3A8Y A;  1CZA N;  2E2O A;  4Z4G A;  4BR4 A;  4M3R A;  2A1S A;  2G8W A;  4EZ6 A;  4IKF A;  4KHS A;  3HO1 A;  1RGI A;  4LC9 B;  3LAL A;  1RDW X;  3VF4 A;  4BWM A;  2E1Y A;  1NGJ A;  4CZH A;  4IG3 A;  3ZT4 A;  3DRS A;  3WT0 A;  4C8K A;  3L4I A;  3ZLJ A;  3RTV A;  4QCL A;  5JS1 A;  3ZT1 A;  1HUX A;  4CEA A;  1JCG A;  1WSJ A;  1FW6 A;  3TAM A;  2HNY A;  4B9M A;  3RMB A;  1HNX K;  5HRS A;  1C0U A;  1OH7 A;  1GLB G;  4K43 A;  2ETJ A;  1WBD A;  5CYM A;  2V7Z A;  3JS6 A;  3MK6 A;  4IEI A;  4KO0 A;  5C2D A;  2RF2 A;  2UUC K;  2W41 A;  1BQN A;  4JYA K;  3V1Q A;  4KAZ A;  2D0C A;  2QWO A;  3A2F A;  1WSH A;  4CED A;  3TSP A;  2E2P A;  1SUQ A;  4DFP A;  5T7B A;  2G8I A;  3SLC A;  4IFV A;  3D0P A;  4FJI A;  3DRR A;  3WEE A;  1W97 L;  2P9I A;  1U04 A;  1KAZ A;  4YOV A;  1IKW A;  4CFD A;  5AQV A;  1BO5 O;  3KHY A;  4DMN A;  4HTU A;  2ITG A;  4WFA L;  2Z1J A;  1G99 A;  3F5T A;  2A42 A;  1DKG D;  2YV0 X;  3IUC A;  2ASP A;  5LJV A;  4NLB A;  5BPM A;  2QK9 A;  1HJR A;  4CJL A;  2ITM A;  3NCI A;  3OYC A;  4NXN K;  3V81 A;  4BRN A;  2YCH A;  4CZI A;  1J53 A;  3DJC A;  1XC3 A;  4DV4 K;  2ASM A;  2P9N A;  3I33 A;  4BGB A;  5EU7 A;  3BUZ B;  4JHD A;  2OA8 A;  3OYJ A;  4CZL A;  4E1N A;  4CJP A;  2KQ2 A;  3VQ5 A;  2QWR A;  1RTJ A;  3TI0 A;  4BC5 A;  4ID5 A;  3SMS A;  1KCF A;  2HHT A;  4BR0 A;  4R5P A;  4ZTF A;  1WSI A;  4BC2 A;  3O9R A;  1IKV A;  1BCO A;  1D9D A;  4W5Q A;  1WLJ A;  4FSV A;  4CEB A;  3U9D A;  2GX9 A;  3L3V A;  4FLX A;  3MDQ A;  3CFO A;  4JI4 K;  1T8E A;  1BUP A;  2HVI A;  1BIS A;  3E9L A;  4BRI A;  3B6O A;  3SNN A;  3HPG A;  1NU0 A;  5CR4 A;  1HYZ A;  1C0G A;  4K41 A;  5KQ8 A;  3KWI A;  3EYZ A;  4A2B A;  5F1X A;  4KHU A;  1YHQ N;  3VEY A;  3AAP A;  4CHO A;  3HBT A;  4CK1 A;  3WNG A;  4CIG A;  3Q7B A;  3OYL A;  1ZBI A;  4FLU A;  1VSH A;  2JGU A;  1C1A A;  4A59 A;  4FJ7 A;  4E7L A;  2OPR A;  1I94 K;  2FBX A;  4CF8 A;  4F9O A;  1U47 A;  1RFQ A;  4DV6 K;  3AO4 A;  3T1A A;  3R9P A;  4BG8 A;  4EHU A;  1VSM A;  4WFN L;  4M3W A;  3CIP A;  4EHT A;  3SK3 A;  1J9A A;  2B4J A;  2BH1 A;  2CGK A;  4GNI A;  1XMO K;  3G71 N;  3F73 A;  4CJ5 A;  2P9S B;  4F2S A;  3CXC M;  2Q97 A;  3ZSO A;  1NGG A;  2GEL A;  3PO4 A;  4B3T K;  4OKK A;  2HND A;  2DFH A;  4BG9 A;  4EZ9 A;  2O8F B;  4GKJ K;  3F9K A;  4C1N I;  5KGW A;  3DXK A;  4B3S K;  1ASU A;  1HMV A;  1NK8 A;  4MDB A;  3OVN A;  1VQL N;  3C65 A;  3K59 A;  4MFB A;  1NLV A;  4CZJ A;  2F96 A;  1RDA A;  4M3Y A;  4F3O A;  5BR8 K;  1NJY A;  1Z6R A;  5DMR A;  3WXL A;  2KHO A;  3CQX A;  4DTS A;  4A2A A;  1HLU A;  2ZD1 A;  3OYA A;  3JAM O;  2IVP A;  3VQ7 A;  3NF6 A;  3AO3 A;  2HNZ A;  1NGI A;  3CI5 A;  3TPQ A;  3SUN A;  3NH0 A;  3AA5 X;  2YNI A;  2F9T A;  4H0V B;  3VOV A;  4I6M A;  3K58 A;  1H1V A;  4F8R A;  3Q7C A;  1BCM A;  1DTT A;  4CBU A;  3A5N C;  3E66 A;  3J7Z O;  4FJ8 A;  4H5T A;  3QET A;  3RSE A;  1QSY A;  1YAG A;  3VET A;  2NZT A;  1Q81 O;  3MX5 A;  3J8A A;  2OZS A;  5AQY A;  1GLE G;  2O8B B;  4AM7 A;  5AQN A;  2V7Y A;  4NYF A;  4OKJ A;  4MO5 A;  3GE1 A;  5FPE A;  1RT7 A;  2WFB A;  2YHW A;  1ASV A;  4JKA A;  2E8A A;  5EVZ A;  4MDA A;  4DKW A;  3NAE A;  3O9U A;  4M41 A;  1VQ6 N;  3M6G A;  1BHL A;  2D0A A;  2OPQ A;  3L4Q A;  5LMU K;  3BEX A;  2E88 A;  4FWK A;  3EZ5 A;  3H08 A;  1ATR A;  4FW1 A;  4Y1C A;  4DV3 K;  2E2Q A;  4CD3 A;  4DFM A;  3DMJ A;  4ILG B; 
#chains in the Genus database with same CATH homology
 4JI6 K;  4LFC K;  4LF9 K;  1XMO K;  1N33 K;  4DV1 K;  4NXN K;  2VQE K;  4JI1 K;  4LF5 K;  4X62 K;  1IBM K;  4V19 S;  4DV4 K;  4DV2 K;  1IBL K;  4B3T K;  4JI8 K;  4YY3 K;  3J7A P;  3OTO K;  1N32 K;  4LF4 K;  4JI0 K;  4LFB K;  4GKJ K;  1IBK K;  4B3S K;  4DUZ K;  4JV5 K;  4B3M K;  4DUY K;  4NXM K;  4DR6 K;  4DR1 K;  5BR8 K;  3J81 O;  4B3R K;  4X65 K;  2VQF K;  4LFA K;  3J7Y P;  2UUA K;  4KHP K;  4CVN E;  4DR4 K;  5LMN K;  3T1H K;  2UU9 K;  3JAM O;  3T1Y K;  2E5L K;  2UXC K;  2ZM6 K;  4DV0 K;  4DV7 K;  1N36 K;  2UUB K;  4JI3 K;  4JI5 K;  1HNZ K;  4DR3 K;  2UXD K;  1XMQ K;  4JI2 K;  4JI4 K;  2HHH K;  4JI7 K;  1HNX K;  4DR2 K;  5A2Q O;  4X64 K;  5IT9 O;  4LF7 K;  4K0K K;  5LL6 Z;  5IWA K;  1J5E K;  2F4V K;  4DV5 K;  2UUC K;  4GKK K;  4LF6 K;  4JYA K;  4CW7 B;  4DR7 K;  1HNW K;  4AQY K;  5AJ3 K;  3J80 O;  1N34 K;  1XNQ K;  2UXB K;  1FJG K;  1XNR K;  4YHH K;  5LMU K;  1I94 K;  1HR0 K;  5FLX O;  4LF8 K;  4DV3 K;  4DR5 K;  4DV6 K;  4X66 K;  4OX9 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...