4JI2K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji2K00
4JI0K 4LFCK 2VQEK 4DR1K 2E5LK 4YHHK 4DUZK 3J80O 4JV5K 1IBLK 4DR2K 5FLXO 4B3SK 5IT9O 4JI3K 4K0KK 1J5EK 4B3TK 2UXDK 4DV6K 1XNRK 2UUBK 4JYAK 1N34K 4LFAK 1HR0K 4JI4K 4CW7B 4X64K 3JAMO 3J7AP 1HNWK 4DR5K 1I94K 4DUYK 4GKJK 4X66K 2UUCK 5BR8K 2UU9K 4X62K 2VQFK 2UXBK 4GKKK 4AQYK 4NXMK 4JI1K 4CVNE 4LF6K 4LF4K 4JI5K 4DV2K 3J81O 4B3RK 1FJGK 4DV0K 5LL6Z 4DV1K 3OTOK 4X65K 3J7YP 2F4VK 4JI2K 5IWAK 1HNZK 4YY3K 4DV3K 4DR6K 1XMOK 4DR7K 4LF9K 4V19S 2HHHK 4DV4K 4LF8K 4NXNK 4DV7K 4DV5K 5AJ3K 4JI7K 1N33K 5LMUK 1XMQK 1XNQK 4DR4K 5LMNK 1IBMK 5A2QO 1IBKK 4LF7K 1N32K 4JI8K 4DR3K 4KHPK 1HNXK 4LFBK 4JI6K 4LF5K 1N36K 2UXCK 4B3MK 2ZM6K 4OX9K 2UUAK 3T1YK 3T1HK
chains in the Genus database with same CATH superfamily
1J9AA 5AQXA 3VEZA 3NMUA 1UA1A 3VOVA 3DM2A 3KLIA 4DTOA 3THXB 4I9LA 5HRPA 1NK7A 3EN9A 2XY7A 4YOVA 1NG9A 5BN8A 4RW7A 3BDPA 4A5AA 5AQNA 4F4KA 3QFPA 3K2PA 2F7TA 3AVKA 3AA5X 4KFBA 3EEQA 5LY3A 4B1UB 3VQQA 1BI4B 4FLXA 1JLQA 3UB5A 3JAMO 3CF5L 1TVRA 2NRTA 1HYVA 4J2DA 4DB3A 3MXIA 5M1NA 3TTFA 1TL1A 4CGDA 3O4WA 4GV6A 3MN6A 2IDOA 2WTUA 4B1VA 3EKUA 4ZTJA 1IKYA 4DTJA 3V4IA 3RMCA 3ZETA 3E9PA 3CCRN 4C8NA 3QEWA 5HBMA 2W41A 3O4NA 3OS0A 3ALYA 2ZGYA 1NK6A 3OHRA 5LJWA 1RTHA 2EHGA 1LAVA 2OTJN 3K5LA 4DSFA 4FLVA 3AVFA 3FZFA 2ATQA 5HRRA 4EHTA 2A42A 1YHQN 3LP1A 5FPEA 3BZKA 4PHTX 3ZX0A 5AQGA 4B1XB 1QHTA 4ILGB 5C25A 1C1AA 3NH1A 1Z05A 4QOZB 3KIOA 2E1YA 1L3SA 4FW2A 1JJ2M 4I6MB 4TSXA 5KGXA 3LPTA 4IG3A 4DLGA 1X3MA 4JI6K 4PKHA 1VQLN 1RTIA 4JKGA 2QKKA 1Q7YO 3LL3A 2HHQA 1K8AO 1HX1A 5I42A 2ZQBA 3DOKA 4KRFA 3FR0A 3U4LA 4Y1CA 4OO1J 1ZBHA 4ILHA 5E84A 4DTNA 2CGJA 2YNFA 1JCFA 1KD1O 4JV5K 1MWMA 3M8QA 2FBTA 2F9WA 1EO1A 3SAHA 1HRHA 3HPGA 5K14A 2UXDK 4BRPA 4NLBA 3TAFA 3O9SA 3M8PA 4IDHA 4KHSA 1SKRA 4A2AA 1L5UA 1KXPA 4DR5K 4F8RA 3F5TA 3HSCA 2E2OA 3G25A 5EOYA 3O9QA 4ELUA 2WC9A 4B9QA 4CBUA 3AGRA 3KZBA 4GY2B 1NGDA 4AF1A 3KD1E 2IAJA 2A40A 5EX5A 1J6ZA 2Z1GA 3IS9A 4W5QA 4PWDA 3LP0A 1GLAG 3ITHA 4OKEA 3LP3A 1BIUA 3QEIA 3MX2A 4FJ9A 4A57A 3RVCA 3M1FA 3H6EA 3E9LA 3FGUA 2B5JA 3BGRA 2QKBA 4DV2K 4B3RK 1BHLA 2R7YA 4IOCL 2KZZA 3NF7A 4DKWA 2F4VK 2WBNA 3ZETB 2V52B 4M7XA 2RHKA 4B9TA 4FWQA 2CH6A 3K57A 2NRWA 1DEJA 3NF8A 3VF6A 1YF5L 4BRMA 3LDQA 4V19S 1VRUA 2G8IA 4NXNK 1SKWA 1WSIA 2O8BA 4U67L 3QNNA 1D9DA 4H0YB 3B6PA 4IWVA 4DR4K 1L3VA 2IGIA 1IBMK 3D6RA 3MWTA 5KQ8A 3GE1A 3DLEA 4EAHD 4JK8A 4KPYA 3H45C 4CGIA 4ZHRA 1HNXK 1NLVA 1ZBSA 1HYSA 4CEDA 4HCCA 4ID5A 4BG8A 4DU1A 1U49A 1U04A 2YHWA 3O08A 4CF0A 4BR9A 4IG0A 2UUAK 3T1YK 4B1ZA 2DFEA 4CHOA 1TUYA 2VGMA 1K9MO 3HO1A 3Q7BA 3U8XA 1FXXA 1IKXA 1T7PA 3L2WA 3SAFA 3VQ8A 1G15A 2CH5A 3O4QA 3R9PA 3PSIA 1VSJA 5AQYA 4R79A 2UUBK 4BRNA 1HJRA 4EIAA 4DFKA 3VESA 1TGOA 1HR0K 1QTMA 2P9PB 2ZE2A 1D4XA 3PO5A 2YHYA 3TAGA 4DUYK 4YDUC 5AR0A 3G71N 1SL2A 1RT1A 3ENOA 1WB9A 1RT7A 3K5OA 3A5MC 4C1NI 4C8MA 1Q9XA 3L6QA 2Q31A 2ASOA 4CIFA 4ELTA 1VQ9N 1UAXA 4RWTA 3AO3A 1B9DA 2HB5A 1CXUA 1NBWA 2FC0A 2YX6A 1VQ4N 3GL1A 4Q5VA 4IEEA 5J2QA 2XO7A 1LOTB 4CEEA 3SI6A 2FF6A 4YY3K 3IFRA 2QWQA 4AHSA 2IIRA 4BGBA 2J4RA 1A5WA 3HRGA 3VQ4A 1ASUA 5JICA 3DJCA 5CYMA 3V1RA 4ISFA 1BG3A 4FVMA 5AJ3K 5CY4A 5KQDA 1WNSA 4JKDA 1OH8A 2P5OA 1KAZA 1W2BM 1BIZA 3HPHA 4DTXA 4FK4A 2O8BB 1D9FA 2IC3A 2YNGA 3KKSA 4JI8K 2AP1A 4DR3K 4DFJA 3A5OC 4ZTFA 4RG8A 1KRPA 3K5NA 4R5PA 4BC2A 4CEOA 2V7ZA 2WFBA 1RCHA 3GG4A 3ZSVA 3KLFA 4CFDA 5JLFA 3MECA 4DHYA 1RDWX 1W9HA 3CQYA 3J80O 2PZSA 1KCFA 4FCYA 1XQSC 4E1MA 3P4IA 4CZEA 4BDPA 4N41A 3NHGA 1VSEA 2E2PA 3MXJA 4DU3A 3C6UA 4LFAK 4CEAA 3VPZA 4OPHA 4X64K 1K6YA 3PSFA 1LCUA 4IOXA 1RTJA 2YI1A 1SKSA 4KHQA 2HHSA 3TR8A 3W0LA 3S3MA 1GLDG 3VA0A 2QK9A 4XH5A 2O4IA 1RDCA 1N5YA 3V9ZA 3TTCA 4E7IA 4YNQA 3VA3A 4C23A 2FF3B 5DMRA 4FWMA 1T03A 2WOMA 1RBRA 3M6GA 4HUGA 1C0TA 4JN4A 2HBKA 5AQQA 4Z4FA 2OPPA 3QBXA 3VQ6A 3HT3A 1Z26A 5JS2A 3CFRA 4FJ5A 4Z4HA 5SWMA 4XH1A 4M3WA 1W97L 3WNFA 3JYTA 3BY5A 1Z6RA 1NGCA 4MLHA 4M3RA 4YDUA 3SV4A 3GDQA 1BUPA 2NRZA 4JHDB 2D0CA 4CZKA 3CQXA 4BR7A 4CFBA 4ISGA 3CJAA 4KAZA 3RR8A 4KBOA 4KHPK 1HLUA 2ITMA 3B6OA 4CZFA 5C15A 3CC4N 4O8KA 5BR9A 5AQIA 1IJJA 4B3MK 1Q86O 2W42A 2GWKA 2QXLA 3ATUA 4OX9K 3HXMA 3T1HK 1C0GA 5J2NA 2VWJA 3I8DA 3ISNC 2KKZA 1Q8IA 3V81A 3QFUA 3NCIA 3T69A 5HP1A 4B9VA 1RDUA 4IO8A 4PL7A 5IT9O 3G4SN 3EZWA 3QESA 1BL3A 4CZMA 5FDLA 1QQOA 4MDAA 3C7NA 4JS4A 4FWSA 4RTFD 1EP4A 4B9LA 2P9NA 1HUXA 1SS6A 4BRQA 4CD1A 3O3HA 4CJ5A 4WYBA 3J7AP 1BO5O 4CJSA 2Q97A 3L3UA 1S5JA 5AQFA 2GV9A 1V4TA 4UQGA 2OPSA 3D2FB 1DLOA 2BANA 3Q7CA 1U2VB 1E4GT 1WN7A 2DPNA 1T6DA 1NJZA 4CECA 3J81O 3C95A 4FZZA 2HSTA 4DFPA 2GX9A 4QS9A 1X9JA 4M63C 3HL8A 4MO4A 4ISEA 1J54A 2QWRA 3SQ2A 2ZGZA 2WUSA 3LP2A 3IAYA 2PY5A 4DG1A 4FM0A 4EP5A 3RSEB 1HKGA 2FSKA 4DSJA 1VRTA 3AVAA 3C6TA 4DV4K 4BRKA 2Z1IA 4K8XA 4H5WA 4JI7K 4F2RA 3CM5A 4A59A 4JKHA 2O8CA 4JD2A 2PBDA 2QEXN 3OYHA 3RWUA 5BRHA 1MDUB 2BUPA 3D7EO 3DOLA 3SLCA 3SUQA 1NU0A 1IKWA 1RBUA 1NOZA 1SL1A 3E1YA 4DCHA 5HRSA 2YV0X 3L2UA 5AQWA 3NF9A 1R59O 1EXQA 1JCEA 1NGFA 3C6HA 1VQKN 1QS4A 5AQOA 1X1PA 4CIGA 5JVGL 1SV5A 1JLGA 3QIOA 1HYZA 4BQLA 3CC2N 3QB0A 2P9IA 3KK1A 3AAPA 1K8KA 1X9SA 5I3UA 1IG8A 4K0KK 4BRIA 3HP9A 5GAEP 2P9KA 5LJVA 4Z4IA 4JKCA 4AILC 4CZHA 4BDYA 3VQ9A 1BWFO 5FRMA 1NK4A 4RW6A 1TKXA 3RTVA 3K9KA 1XI1A 3CHWA 5EVZA 2HHVA 3IDHA 1GLCG 2DFFA 1MU2A 3SQ1A 4IFEA 3R8EA 2QWLA 3CQ8A 2Z1JA 4DTSA 1RBTA 1GOAA 2PAVA 3I56N 2HNYA 2NRRA 2OTLN 2O8FB 1CZAN 3MDQA 1ZBIA 1FJGK 5F1XA 3SPZA 4NLCA 3JXUA 1LWFA 1BA0A 3LAKA 3LDNA 3WXJA 3SQ0A 4CZJA 4MDBA 5CE3A 1S72N 1H1VA 3DLLL 3SAGA 5T7BA 2QTDA 1VQPN 1HNIA 1A5VA 1LWCA 3CM6A 4CJPA 3ZT2A 1Z25A 5AQTA 3SBGA 4PY5A 4YOTA 3OYNA 3PX6A 5M1PA 4HTUA 3WNEA 3E66A 4CHQA 1ASWA 2PFUA 5LMUK 3I0SA 4W5OA 4M3ZA 2X6NA 3VTIA 1VK0A 4LSNA 2P5GA 5A2QO 1JCGA 4M3XA 1JL2A 4B8CA 1RDBA 3TABA 5HROA 2O8CB 4RW4A 4E89A 1LW2A 4CK2A 1S1WA 4F9OA 4LFBK 4BRHA 3BP8A 4DTUA 3TAEA 4LH5A 2KFNA 3AVCA 4FJMA 5DM7L 4JKFA 1U6ZA 4XIUA 4Z4GA 3AA2A 4E7JA 1S1TA 4FWLA 3C94A 1DTTA 3BZCA 5AZJA 1YIJN 3P31A 1QSYA 3ZSYA 4Z4EA 3ULDA 1WAJA 3KWIA 4JI3K 3PY8A 4BACA 2W6LA 3HM9A 5AFUH 1EQYA 1VHXA 1XNRK 3SMSA 3J8AA 2YNHA 1P8ZA 4ICLA 1JL1A 3P83D 4FZXC 3ENBA 3QEVA 1D8YA 2P9KB 4HHTA 4C1NK 1YJ9N 3U6FA 3QIPA 1OKJA 5ELZA 3I33A 3ID6A 3VTHA 1ILYA 2ZD1A 5CZ1A 3CI5A 4M45A 2Y1JA 3PX4A 1S6PA 3P39A 2VGNA 3R3LA 3CCQN 4Z94A 4RW9A 3HZ6A 2Q0RA 3HTVA 1GLBG 4GVMA 4LF4K 3TAQA 1VSDA 1KFDA 2JWLA 3OYFA 3IKMA 1TV6A 3J7YP 1S1VA 1DT9A 2QA4N 4KH6A 4J2AA 2KW4A 3OYIA 2ZJQL 3LANA 4FLTA 2Q1NA 3GBTA 1I3AA 3L2RA 1TUUA 2W40A 1ZBLA 4BR0A 1OH5A 4WQ4C 4HVJA 1VSIA 4B1YB 5AQRA 2YHXA 1OVQA 4F3TA 2QXFA 2KFZA 2F8SA 2P9UA 5KRSA 4PQUA 4L3QA 1S22A 1XMQK 1Q18A 1EETA 3LWLA 3ENHA 1VAZA 4OLAA 2KZMA 1EWQA 3PV8A 1KVAA 1RT4A 3QMLA 1MA9B 2X6SA 4XEIA 3BF3A 5JVHL 3KLHA 4FYDA 1XHZA 3VQDA 1VSKA 1N8RO 5B8HA 4IFYA 3V9UA 4E3SA 5ADXH 2O8EA 4BGAA 4BE1A 4UY8O 4G1QA 1C0FA 5HL7L 4JKBA 3WXIA 4DS5A 4CJTA 4DR2K 3AO2A 4M42A 3OS1A 5AZJB 4GNIA 3SNNA 5E41A 4CJWA 3NVKA 3TARA 4H5TA 4NO7A 1WBBA 4FJKA 1YT3A 2YHAA 3ULEA 4I2QA 2D0OA 1RT5A 2O8DA 3VQBA 3NGIA 2Q2RA 4DSEA 4GKJK 1BQMA 4JKGB 3ZSOA 3CCEN 2EX3A 2UUCK 3DLGA 1NOYA 1NK5A 4B1WB 3VEOA 3KJVA 2A1SA 1VSHA 4HWIA 2RF2A 4LH4A 3CJ7A 4AQYK 5HRNA 4KHYA 3LDOA 3CCVN 3VGKA 4KB0A 4CVNE 3D45A 4W5NA 3JSMA 2GELA 3ZSQA 4BROA 1EX4A 4OVLA 4LSLA 2YKMA 2YJFA 4RW8A 3N4PA 3O3FA 4CJLA 2OZSA 3A5NC 3AVGA 2HF4A 5GIOA 4U7BA 3TSQA 4K43A 1J53A 1W7AA 3ZSXA 3TTDA 5AQJA 2V7YA 4B9SA 4QAGA 2AJQA 3LDLA 3MCAB 3S9HA 3SJJA 3V6DA 1WLJA 1SL0A 2YHBA 5JS1A 3CCSN 2OYQA 3LPUA 4H4MA 1ATNA 3PO4A 1Q9YA 5SZTA 4B9UA 2YKNA 3ZSWA 4YFUA 3CFOA 5FPNA 3VEYA 4BC3A 3F73A 1GLJO 3OYJA 3NAEA 4BY9C 3VQ5A 4JI0K 4YOUA 5AQUA 4BRGA 4FJIA 4WQ4A 4OJRA 1E4FT 2B4JA 1SQKA 4B3SK 1REVA 1RTDA 3QO9A 1JLAA 4PUOA 1S9EA 3RR7A 2E4LA 3SJHA 4CCHA 2ZF5O 4AHCA 1U47A 4H0TB 4FWNA 3PX0A 3LZIA 1YITN 4FWKA 2A41A 4G9ZA 3ZEUA 4FWOA 4JK9A 1T44A 4Y0WA 1NMDA 5C12A 4O5BA 1IH7A 4BVOA 5TKYA 5M1FA 4IO9L 3KLGA 4WCEL 2O8DB 2GBZA 3VGLA 4AH9A 4DQRA 5DK5A 1FW6A 3A0IX 5GAGP 1VSFA 3HPOA 3WQUA 1A5XA 4IJAA 4BRCA 3BF1A 3HSTB 2YNIA 5GIPA 3K58A 1BOTO 3C6AA 3O9TA 4DV1K 3M8RA 3HVTA 1JXBA 4DU4A 4H8KA 4K41A 3UKRA 5BRFA 4CHNA 1UA0A 5EXWA 4OKKA 2BE2A 3I55N 3SQ4A 4Q0BA 4BC5A 1NGHA 4CERA 4DV3K 5CR4A 1HPZA 1GLLO 2HHHK 1ZBFA 4Y1DA 3T7ZA 2NRXA 2QM1A 3ZX2A 4GV9A 1N33K 4PKIA 4BC4A 3U3YA 4NB4A 1B9FA 1NKBA 1TK0A 5FRNA 4FLWA 3O6WA 3OYBA 3NE6A 1NGAA 3ZT0A 4NCGA 1KVBA 4FWRA 4AM6A 1NKCA 3C65A 3DAWA 3WXLA 3B8AX 2P9LA 1XHXA 5J1EA 3VN5A 3KWGA 1HQUA 4FPAA 2H3GX 4KHWA 2ITGA 3NBPA 3V1OA 1VQON 4JAXA 5J2MA 1L3TA 1WSFA 2FSNA 4KKOA 3OYMA 3LZJA 3O1WA 4CJRA 2VQEK 4O0JA 1KLNA 2UYTA 3ZT3A 2NZTA 2F96A 3ZX3A 1ITGA 5JMVA 5F2RA 4JLHA 5M1OA 3NVMA 1E3MA 2HMIA 3SUNA 3THVA 4B3TK 1RT3A 2WONA 3ZT4A 4CBXA 2P9SA 1T05A 4WFAL 4LD0A 5CHIA 4FLUA 3OA9A 4DQQA 1N6QA 1ZBUA 3DLBA 4FJGA 4DWIA 3CJCA 1BGXT 4B9NA 5BR8K 2Z1HA 4X62K 4KTQA 4BVPA 4K25A 3ZEUB 1RBVA 3CXCM 4BRFA 3L3VA 1YAGA 5C2FA 3WEEA 3RMBA 2HBJA 3O9RA 2IOCA 5AQHA 3CCJN 5C10A 2NRVA 5LL6Z 4X65K 5F0XA 3L2QA 4FLYA 3DXMA 1QVFM 3CJ9A 2W6KA 3UKUA 1G99A 4CGGA 4DR6K 3DI6A 4DQPA 4BR2A 2D1KA 3KK3A 1NM1A 2E8AA 3UKRB 3BEXA 2YCHA 1X9WA 4DQSA 5FROA 5FPDA 2HHWA 3THXA 5GINA 2XY8A 5BPLA 5DM6L 3ZLJA 2GTDA 1KLMA 1HMVA 3M3ZA 3EZ5A 5LMNK 3SCXA 4BRDA 3EYZA 3HYFA 3AVLA 2IVOA 4FM2A 4CHYA 1EWRA 4DF8A 3P38A 4A62A 1WUAA 3NDKA 2HHUA 1BQNA 3O5BA 3FLCO 5KI6A 4AHVA 4IXCA 3NF6A 2ZWHA 2VWKA 2UXCK 2DY4A 3WNHA 4IOAL 2P9LB 4LY7A 4H0PA 4CZGA 3OBYA 4O5FA 3OYLA 4FLZA 3MX5A 3H1VX 1YJWN 1B92A 1Y64A 2D5RA 3NFAA 2AA4A 3HOTA 4LFCK 4E1NA 5CYQA 4H0VB 4DUZK 4B3OA 3MCPA 5M1KA 1S6QA 5E26A 3PIPL 3SV3A 1RT6A 1BCOA 4W5RA 3VEVA 2BGGA 3NH0A 1Q81O 3R6MA 2KLAA 3DRRA 4CFCA 2D4WA 4JYAK 4MLEA 5GAHP 4E7LA 4H5VA 5CZ2A 4CJEA 1NJXA 5C24A 3FZHA 4EP4A 1YVNA 4AHUA 2E6LA 2PYLA 4E7KA 3DMJA 1TK8A 3OJSA 1JKHA 4MQ3A 1MWKA 4FJHA 1WSEA 2YJEA 4OGEA 4CJUA 1T6CA 1YI2N 2GUIA 1ASVA 2G8UA 4NYFA 3DRSA 4JI5K 1IKVA 2V51B 2ETJA 1RBSA 2IVNA 3WEEB 4MO5A 2ZJPL 1S1UA 3VEXA 3C7NB 5I9EB 3H3OB 3HBTA 4CJ3A 2P9NB 3DWLA 3KTQA 3DXMB 2HF3A 2DFHA 4CEQA 3EE9A 4BRLA 4QCLA 3CETA 4K8ZA 3UKUB 4DF4A 1T8EA 4YOWA 4AHRA 4OKJA 2P1JA 3AVNA 4JS5A 3G6EN 4FXDA 3KHYA 1ZXOA 4BWMA 2QWOA 3S3OA 3E01A 4CEBA 3C0BA 4FJ8A 2NLXA 3FZLA 4M3YA 3L8BA 3D2EA 1NKEA 4JEPA 3VQAA 3MEDA 5KPTA 4FL9A 4BDZA 3RRGA 1O13A 4DMNA 3V1QA 4CI6A 4F2SA 5JLHA 4FZYA 4DSLA 1L3UA 1ZYQA 4DLEA 3P1GA 1RDDA 3V9WA 3T19A 3DLKA 3A8YA 1HQEA 1WSHA 3VMFB 2E5LK 4YHHK 3HJFA 4L8RB 2E6MA 1IBLK 4FJLA 4HUEA 4A2BA 4CZLA 3TWHA 5HLFA 1QZ6A 5AQVA 3AVIA 5AQLA 4DSIA 4JD2B 3L0QA 1J5EK 4CF8A 3HM8A 2G8WA 1JLBA 2G8KA 1NWKA 5KRTA 5KPRA 3LM9A 3T1AA 4OPKA 1X3NA 2E2QA 1XC3A 2KQ2A 4JI4K 2XY5A 2FBVA 3HOSA 1HNWK 4KH5A 5MLCQ 4CF1A 1OVYA 1I94K 4BR4A 3AY9A 1KAYA 5BRDA 1CZBA 3DYAA 4I9QA 4M3UA 1XUPO 1HJOA 4JKEA 4CGHA 2JWKA 2VQFK 4FK0A 1DGKN 2P9IB 1K8KB 2A3ZA 2QWNA 4DS4A 3MN7A 4KH4A 3NH2A 1QHAA 4KREA 2A1RA 1FKPA 1VSMA 2OA8A 3WUHA 1C0UA 3LDPA 4C8LA 1KVCA 3UE5A 3AO1A 1UOCA 4DFMA 1NK9A 4YOYA 4CEZA 3K5MA 1XMOK 3OYKA 1BCMA 1NGGA 2D0BA 3G0ZA 4DV7K 3T3FA 3E9OA 1NJIO 3DLHA 3DXKA 2NUBA 3KD5E 3I0RA 5J2PA 2F8TA 1U45A 1JLCA 2A5XA 3VENA 1CZ9A 1N32K 2XHBA 2LSNA 4B9MA 1ESVA 2IVPA 1SUQA 1GOCA 2X78A 2P9PA 2O4GA 3TANA 1ZC6A 4DTMA 1C0MA 3R1XA 4Z0UA 3D2EB 2RKIA 4Z4CA 3ZT1A 2HMPA 1P90A 1U4BA 3CIPA 2Q3SA 4W5TA 1QVGM 2OANA 1RFQA 1TAQA 2I7NA 1FK9A 1WBDA 3VERA 1QE1A 2HBLA 2PYJA 2ASMA 4CJQA 1XWLA 4FJ7A 3N4QA 3VQEA 3CPEA 4FJNA 3F2KA 1RT2A 3GOIA 3QICA 1SZ2A 1TAUA 3LAMA 1M90O 3ATVA 4IZ9A 2QWPA 1N34K 4JKAA 4ILJA 3OY9A 4OLBA 3THWA 1KAXA 2IS3A 2ZJRL 5BPNA 2X74A 3WNGA 3AVMA 1QQNA 3LM2A 1C6VA 4H03B 3IMXA 4CJKA 4BREA 3LDSA 3OYEA 3AAQA 2DTUA 3QDKA 3HP6A 3CCLN 1VSLA 3VGMA 4FK2A 5AQMA 4E1JA 2E2NA 3VF4A 1FKOA 4WFBL 3SUPA 1UWBA 1VQ8N 5HOOA 4YORA 4CK3A 4IJNA 2BTFA 1DKGD 2VG6A 4DV0K 2QW9A 1KTQA 3CG7A 5C0YA 2P51A 1D5AA 1J5OA 1WSJA 4O8UA 3WXMB 4EZ9A 3H1QA 5IWAK 1HNZK 4IKFA 4EHUA 2HNZA 2FSJA 1LV5A 3QBWA 4K42A 4J8FA 4NYNA 3PIOL 3SK3A 1I39A 5GADP 2D0PA 1NJYA 3ZSRA 4LF8K 3O8MA 3D0PA 3OVNA 4OPJA 4QS7A 4JRQA 3V9SA 3PLAA 3TPQA 4HUFA 4CGJA 3AV9A 4B08A 3SPYA 1NMNA 1KSPA 3W3DA 3MAQA 1XNQK 5C42A 1YUWA 4CJ7A 3CMEN 3U9ZA 1X9MA 4PKGA 1DTQA 3H46O 3WXKA 2OCEA 1CXQA 3RRHA 4PA1A 1QQMA 4H0XB 4ELVA 1KC8O 3MEGA 3U9DA 3DXKB 5EY4A 3KK2A 3SYZA 2E1ZA 3AO5A 1LW0A 4BE0A 3WT0A 4FM1A 1CLQA 1BU6O 2XRIA 4FJXA 1LAWA 5C2DA 2QI2A 3M5RA 3EKSA 4CHZA 2Q0UA 3QERA 4FSVA 1S1XA 1C1BA 1R0AA 1YTAA 2P9UB 2CGLA 3O3GA 2VYPA 4EFHA 3OJUA 3QNOA 1YJNN 4WQ5C 1GLEG 2FBYA 4KV8A 4AM7A 4DV6K 3SZ2A 1OH6A 3O1BA 2VCPA 4DQ8A 3VQ7A 4H0OA 5AQKA 1EKEA 4KHNA 3ZCMA 3HI0A 3A5LC 4CBWA 2HW3A 4J2BA 3THWB 4ID1A 4NCBA 2VWBA 2UU9K 5EU7A 2O8EB 3OYAA 3KLEA 5D3GA 3H08A 4N5SA 4RCHA 4GKKK 2UXBK 1F21A 5M1QA 4JHDA 3TI0A 3SMPA 4CK1A 4NXMK 1NGEA 4CESA 5KPZA 4JI1K 1RNHA 1U48A 4LF6K 1JLEA 5BPMA 3QINA 2FLOA 4BRAA 1VQ6N 4E7HA 1NJWA 4FVUA 2RE2A 4FWPA 4XH4A 1T3VA 5H1SQ 4EZ6A 2HHXA 3K0SA 3ULEB 4CD3A 2JLEA 3ID8A 4QS8A 4NCAA 5BREA 4JNEA 3SBTA 2VG5A 3MN5A 2HNDA 2G8FA 3BUZB 3THYA 3DRPA 1OH7A 1V4SA 2ASPA 4C8OA 4CIEA 1RDAA 4FOIA 3HK2A 3CYMA 3L4QA 2Q36A 3FE1A 1HKCA 3O9UA 5AQZA 4BWJA 4BE2A 3UIQA 3ASMA 3QLHA 4JRPA 2D0AA 3NGYA 3U3GA 4IFVA 4GVEA 4KTZA 1N36K 3K9JA 1TKZA 4WF9L 2HVIA 1TL3A 1BA1A 1TKDA 3IRXA 3AA4A 2NNWA 1VQ7N 3KKRA 2HBMA 3AA3A 2CGKA 4GW6A 3VEWA 4O4GA 2VG7A 3D2FA 3OYGA 1U2VA 2G8VA 3AARA 4O44A 3MWPA 3IUCA 4H5NA 5FLXO 1QSSA 3VQCA 4DTRA 4E0DA 4CFAA 4KI6A 1JXEA 2I7PA 1C1CA 3EL2A 4GV3A 1YVUA 3VQPA 3VF2A 3WQTA 3HVRA 4DTPA 3RSEA 1SAZA 5AFUA 3O80A 4KTWA 4FPBA 1TYQA 5KGWA 4KHUA 2G8HA 4X66K 2HVHA 2B6AA 1Q82O 3OYDA 1IO2A 1Y97A 4BQZA 2FXUA 3AVBA 3J7ZO 3ZSZA 4HTLA 3SUOA 3KK7A 1NGIA 4I7FA 3TAPA 3MMVA 3OTOK 1BDGA 4I2PA 3V9XA 3AO4A 1HNVA 3QETA 1S9GA 3L4IA 4WQ5A 2EWSA 3PUFA 2QWMA 2A6AA 4M41A 5FPMA 1QSLA 3K59A 3CJ1A 4O0IA 1KFSA 4LF9K 4FO0A 4WE1A 4F3OA 4M7YA 2GWJA 4DV5K 2GUPA 3LALA 2RPIA 2KTQA 3FZMA 1RILA 4MFBA 3CFPA 4KO0A 5AQSA 4WFNL 4FW1A 1HPMA 4OGCA 4BR5A 2HOEA 4N76A 1VQ5N 3TSPA 3THYB 4A5BA 1M1KO 4J2EA 4LF7K 4DQIA 1WAFA 5AZIA 3TAMA 4CHPA 3FZKA 1YTUA 4GMJB 2BDPA 3CPWM 3RMDA 3FFIA 4IDKA 4LF5K 2I5JA 3AGKA 4E19A 3RMAA 1VQNN 3VETA 2ZM6K 1NNEA 2E20A 1VQMN 3KVGA 3CCUN 2OZMA 1WOQA 4IEIA 1W0HA 1XC9A 1JLFA 4CJVA 2OPRA 4CJFA 4DR1K 1QZ5A 2Y1IA 5ADXA 2FBXA 3L2VA 3F9MA 2O8FA 1NK8A 1BI4A 1NGBA 1KQSM 4IBNA 3A2FA 3MN9A 5AQPA 4PL8A 3LWMA 3IG1A 4YOXA 4KB1A 3AVJA 4A61A 2RN2A 2GEMA 4N47A 3H3NO 2KHOA 4CW7B 1YXQA 3I8BA 4C8KA 1RGIA 3P5JA 4M3TA 5KTQA 3OS2A 2JGUA 1NK0A 3CC7N 3EY1A 3ZYYX 1TYQB 1HKBA 4HCBA 1NGJA 1IV0A 2F9TA 3TSUA 1LWEA 4FJJA 2E88A 1BISA 1K73O 4CE9A 4AHTA 3AVHA 4N56A 4CGFA 3S3NA 4JI2K 3CJBA 2OPQA 3DLRA 2P9SB 4CJ4A 4LC9B 3CMAN 3JS6A 4CZIA 5BN9A 4CF9A 2HHTA 1GLFO 3OBWA 4O55A 3EO3A 4JK7A 3CCMN 2XY6A 3MEEA 4DR7K 1GOBA 4H4OA 1IG9A 4FOEA 1O1WA 3MXMA 3EE8A 1TKTA 4I6MA 4CEFA 4H5RA 3M8SA 1QQCA 3CERA 1S3XA 1IBKK 3QEXA 4OPAA 3FFKB 3S41A 4KI4A 5TKWA 2NRHA 3OW2M 1ATRA 3F9KA 3OYCA 1WSGA 3TU5A 1ATSA 4BG9A 3NGZA 3G10A 4CF2A 4B8AB 1TK5A 3QEPA 5AZIB 4DSKA 3MK6A 2BH1A 3CD6N
chains in the Genus database with same CATH topology
4JI0K 4LFCK 2VQEK 4DR1K 2E5LK 4YHHK 4DUZK 3J80O 4JV5K 1IBLK 4DR2K 5FLXO 4B3SK 5IT9O 4JI3K 4K0KK 1J5EK 4B3TK 2UXDK 4DV6K 1XNRK 2UUBK 4JYAK 1N34K 4LFAK 1HR0K 4JI4K 4CW7B 4X64K 3JAMO 3J7AP 1HNWK 4DR5K 1I94K 4DUYK 4GKJK 4X66K 2UUCK 5BR8K 2UU9K 4X62K 2VQFK 2UXBK 4GKKK 4AQYK 4NXMK 4JI1K 4CVNE 4LF6K 4LF4K 4JI5K 4DV2K 3J81O 4B3RK 1FJGK 4DV0K 5LL6Z 4DV1K 3OTOK 4X65K 3J7YP 2F4VK 4JI2K 5IWAK 1HNZK 4YY3K 4DV3K 4DR6K 1XMOK 4DR7K 4LF9K 4V19S 2HHHK 4DV4K 4LF8K 4NXNK 4DV7K 4DV5K 5AJ3K 4JI7K 1N33K 5LMUK 1XMQK 1XNQK 4DR4K 5LMNK 1IBMK 5A2QO 1IBKK 4LF7K 1N32K 4JI8K 4DR3K 4KHPK 1HNXK 4LFBK 4JI6K 4LF5K 1N36K 2UXCK 4B3MK 2ZM6K 4OX9K 2UUAK 3T1YK 3T1HK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI0 K;  4LFC K;  2VQE K;  4DR1 K;  2E5L K;  4YHH K;  4DUZ K;  3J80 O;  4JV5 K;  1IBL K;  4DR2 K;  5FLX O;  4B3S K;  5IT9 O;  4JI3 K;  4K0K K;  1J5E K;  4B3T K;  2UXD K;  4DV6 K;  1XNR K;  2UUB K;  4JYA K;  1N34 K;  4LFA K;  1HR0 K;  4JI4 K;  4CW7 B;  4X64 K;  3JAM O;  3J7A P;  1HNW K;  4DR5 K;  1I94 K;  4DUY K;  4GKJ K;  4X66 K;  2UUC K;  5BR8 K;  2UU9 K;  4X62 K;  2VQF K;  2UXB K;  4GKK K;  4AQY K;  4NXM K;  4JI1 K;  4CVN E;  4LF6 K;  4LF4 K;  4JI5 K;  4DV2 K;  3J81 O;  4B3R K;  1FJG K;  4DV0 K;  5LL6 Z;  4DV1 K;  3OTO K;  4X65 K;  3J7Y P;  2F4V K;  4JI2 K;  5IWA K;  1HNZ K;  4YY3 K;  4DV3 K;  4DR6 K;  1XMO K;  4DR7 K;  4LF9 K;  4V19 S;  2HHH K;  4DV4 K;  4LF8 K;  4NXN K;  4DV7 K;  4DV5 K;  5AJ3 K;  4JI7 K;  1N33 K;  5LMU K;  1XMQ K;  1XNQ K;  4DR4 K;  5LMN K;  1IBM K;  5A2Q O;  1IBK K;  4LF7 K;  1N32 K;  4JI8 K;  4DR3 K;  4KHP K;  1HNX K;  4LFB K;  4JI6 K;  4LF5 K;  1N36 K;  2UXC K;  4B3M K;  2ZM6 K;  4OX9 K;  2UUA K;  3T1Y K;  3T1H K; 
#chains in the Genus database with same CATH topology
 1J9A A;  5AQX A;  3VEZ A;  3NMU A;  1UA1 A;  3VOV A;  3DM2 A;  3KLI A;  4DTO A;  3THX B;  4I9L A;  5HRP A;  1NK7 A;  3EN9 A;  2XY7 A;  4YOV A;  1NG9 A;  5BN8 A;  4RW7 A;  3BDP A;  4A5A A;  5AQN A;  4F4K A;  3QFP A;  3K2P A;  2F7T A;  3AVK A;  3AA5 X;  4KFB A;  3EEQ A;  5LY3 A;  4B1U B;  3VQQ A;  1BI4 B;  4FLX A;  1JLQ A;  3UB5 A;  3JAM O;  3CF5 L;  1TVR A;  2NRT A;  1HYV A;  4J2D A;  4DB3 A;  3MXI A;  5M1N A;  3TTF A;  1TL1 A;  4CGD A;  3O4W A;  4GV6 A;  3MN6 A;  2IDO A;  2WTU A;  4B1V A;  3EKU A;  4ZTJ A;  1IKY A;  4DTJ A;  3V4I A;  3RMC A;  3ZET A;  3E9P A;  3CCR N;  4C8N A;  3QEW A;  5HBM A;  2W41 A;  3O4N A;  3OS0 A;  3ALY A;  2ZGY A;  1NK6 A;  3OHR A;  5LJW A;  1RTH A;  2EHG A;  1LAV A;  2OTJ N;  3K5L A;  4DSF A;  4FLV A;  3AVF A;  3FZF A;  2ATQ A;  5HRR A;  4EHT A;  2A42 A;  1YHQ N;  3LP1 A;  5FPE A;  3BZK A;  4PHT X;  3ZX0 A;  5AQG A;  4B1X B;  1QHT A;  4ILG B;  5C25 A;  1C1A A;  3NH1 A;  1Z05 A;  4QOZ B;  3KIO A;  2E1Y A;  1L3S A;  4FW2 A;  1JJ2 M;  4I6M B;  4TSX A;  5KGX A;  3LPT A;  4IG3 A;  4DLG A;  1X3M A;  4JI6 K;  4PKH A;  1VQL N;  1RTI A;  4JKG A;  2QKK A;  1Q7Y O;  3LL3 A;  2HHQ A;  1K8A O;  1HX1 A;  5I42 A;  2ZQB A;  3DOK A;  4KRF A;  3FR0 A;  3U4L A;  4Y1C A;  4OO1 J;  1ZBH A;  4ILH A;  5E84 A;  4DTN A;  2CGJ A;  2YNF A;  1JCF A;  1KD1 O;  4JV5 K;  1MWM A;  3M8Q A;  2FBT A;  2F9W A;  1EO1 A;  3SAH A;  1HRH A;  3HPG A;  5K14 A;  2UXD K;  4BRP A;  4NLB A;  3TAF A;  3O9S A;  3M8P A;  4IDH A;  4KHS A;  1SKR A;  4A2A A;  1L5U A;  1KXP A;  4DR5 K;  4F8R A;  3F5T A;  3HSC A;  2E2O A;  3G25 A;  5EOY A;  3O9Q A;  4ELU A;  2WC9 A;  4B9Q A;  4CBU A;  3AGR A;  3KZB A;  4GY2 B;  1NGD A;  4AF1 A;  3KD1 E;  2IAJ A;  2A40 A;  5EX5 A;  1J6Z A;  2Z1G A;  3IS9 A;  4W5Q A;  4PWD A;  3LP0 A;  1GLA G;  3ITH A;  4OKE A;  3LP3 A;  1BIU A;  3QEI A;  3MX2 A;  4FJ9 A;  4A57 A;  3RVC A;  3M1F A;  3H6E A;  3E9L A;  3FGU A;  2B5J A;  3BGR A;  2QKB A;  4DV2 K;  4B3R K;  1BHL A;  2R7Y A;  4IOC L;  2KZZ A;  3NF7 A;  4DKW A;  2F4V K;  2WBN A;  3ZET B;  2V52 B;  4M7X A;  2RHK A;  4B9T A;  4FWQ A;  2CH6 A;  3K57 A;  2NRW A;  1DEJ A;  3NF8 A;  3VF6 A;  1YF5 L;  4BRM A;  3LDQ A;  4V19 S;  1VRU A;  2G8I A;  4NXN K;  1SKW A;  1WSI A;  2O8B A;  4U67 L;  3QNN A;  1D9D A;  4H0Y B;  3B6P A;  4IWV A;  4DR4 K;  1L3V A;  2IGI A;  1IBM K;  3D6R A;  3MWT A;  5KQ8 A;  3GE1 A;  3DLE A;  4EAH D;  4JK8 A;  4KPY A;  3H45 C;  4CGI A;  4ZHR A;  1HNX K;  1NLV A;  1ZBS A;  1HYS A;  4CED A;  4HCC A;  4ID5 A;  4BG8 A;  4DU1 A;  1U49 A;  1U04 A;  2YHW A;  3O08 A;  4CF0 A;  4BR9 A;  4IG0 A;  2UUA K;  3T1Y K;  4B1Z A;  2DFE A;  4CHO A;  1TUY A;  2VGM A;  1K9M O;  3HO1 A;  3Q7B A;  3U8X A;  1FXX A;  1IKX A;  1T7P A;  3L2W A;  3SAF A;  3VQ8 A;  1G15 A;  2CH5 A;  3O4Q A;  3R9P A;  3PSI A;  1VSJ A;  5AQY A;  4R79 A;  2UUB K;  4BRN A;  1HJR A;  4EIA A;  4DFK A;  3VES A;  1TGO A;  1HR0 K;  1QTM A;  2P9P B;  2ZE2 A;  1D4X A;  3PO5 A;  2YHY A;  3TAG A;  4DUY K;  4YDU C;  5AR0 A;  3G71 N;  1SL2 A;  1RT1 A;  3ENO A;  1WB9 A;  1RT7 A;  3K5O A;  3A5M C;  4C1N I;  4C8M A;  1Q9X A;  3L6Q A;  2Q31 A;  2ASO A;  4CIF A;  4ELT A;  1VQ9 N;  1UAX A;  4RWT A;  3AO3 A;  1B9D A;  2HB5 A;  1CXU A;  1NBW A;  2FC0 A;  2YX6 A;  1VQ4 N;  3GL1 A;  4Q5V A;  4IEE A;  5J2Q A;  2XO7 A;  1LOT B;  4CEE A;  3SI6 A;  2FF6 A;  4YY3 K;  3IFR A;  2QWQ A;  4AHS A;  2IIR A;  4BGB A;  2J4R A;  1A5W A;  3HRG A;  3VQ4 A;  1ASU A;  5JIC A;  3DJC A;  5CYM A;  3V1R A;  4ISF A;  1BG3 A;  4FVM A;  5AJ3 K;  5CY4 A;  5KQD A;  1WNS A;  4JKD A;  1OH8 A;  2P5O A;  1KAZ A;  1W2B M;  1BIZ A;  3HPH A;  4DTX A;  4FK4 A;  2O8B B;  1D9F A;  2IC3 A;  2YNG A;  3KKS A;  4JI8 K;  2AP1 A;  4DR3 K;  4DFJ A;  3A5O C;  4ZTF A;  4RG8 A;  1KRP A;  3K5N A;  4R5P A;  4BC2 A;  4CEO A;  2V7Z A;  2WFB A;  1RCH A;  3GG4 A;  3ZSV A;  3KLF A;  4CFD A;  5JLF A;  3MEC A;  4DHY A;  1RDW X;  1W9H A;  3CQY A;  3J80 O;  2PZS A;  1KCF A;  4FCY A;  1XQS C;  4E1M A;  3P4I A;  4CZE A;  4BDP A;  4N41 A;  3NHG A;  1VSE A;  2E2P A;  3MXJ A;  4DU3 A;  3C6U A;  4LFA K;  4CEA A;  3VPZ A;  4OPH A;  4X64 K;  1K6Y A;  3PSF A;  1LCU A;  4IOX A;  1RTJ A;  2YI1 A;  1SKS A;  4KHQ A;  2HHS A;  3TR8 A;  3W0L A;  3S3M A;  1GLD G;  3VA0 A;  2QK9 A;  4XH5 A;  2O4I A;  1RDC A;  1N5Y A;  3V9Z A;  3TTC A;  4E7I A;  4YNQ A;  3VA3 A;  4C23 A;  2FF3 B;  5DMR A;  4FWM A;  1T03 A;  2WOM A;  1RBR A;  3M6G A;  4HUG A;  1C0T A;  4JN4 A;  2HBK A;  5AQQ A;  4Z4F A;  2OPP A;  3QBX A;  3VQ6 A;  3HT3 A;  1Z26 A;  5JS2 A;  3CFR A;  4FJ5 A;  4Z4H A;  5SWM A;  4XH1 A;  4M3W A;  1W97 L;  3WNF A;  3JYT A;  3BY5 A;  1Z6R A;  1NGC A;  4MLH A;  4M3R A;  4YDU A;  3SV4 A;  3GDQ A;  1BUP A;  2NRZ A;  4JHD B;  2D0C A;  4CZK A;  3CQX A;  4BR7 A;  4CFB A;  4ISG A;  3CJA A;  4KAZ A;  3RR8 A;  4KBO A;  4KHP K;  1HLU A;  2ITM A;  3B6O A;  4CZF A;  5C15 A;  3CC4 N;  4O8K A;  5BR9 A;  5AQI A;  1IJJ A;  4B3M K;  1Q86 O;  2W42 A;  2GWK A;  2QXL A;  3ATU A;  4OX9 K;  3HXM A;  3T1H K;  1C0G A;  5J2N A;  2VWJ A;  3I8D A;  3ISN C;  2KKZ A;  1Q8I A;  3V81 A;  3QFU A;  3NCI A;  3T69 A;  5HP1 A;  4B9V A;  1RDU A;  4IO8 A;  4PL7 A;  5IT9 O;  3G4S N;  3EZW A;  3QES A;  1BL3 A;  4CZM A;  5FDL A;  1QQO A;  4MDA A;  3C7N A;  4JS4 A;  4FWS A;  4RTF D;  1EP4 A;  4B9L A;  2P9N A;  1HUX A;  1SS6 A;  4BRQ A;  4CD1 A;  3O3H A;  4CJ5 A;  4WYB A;  3J7A P;  1BO5 O;  4CJS A;  2Q97 A;  3L3U A;  1S5J A;  5AQF A;  2GV9 A;  1V4T A;  4UQG A;  2OPS A;  3D2F B;  1DLO A;  2BAN A;  3Q7C A;  1U2V B;  1E4G T;  1WN7 A;  2DPN A;  1T6D A;  1NJZ A;  4CEC A;  3J81 O;  3C95 A;  4FZZ A;  2HST A;  4DFP A;  2GX9 A;  4QS9 A;  1X9J A;  4M63 C;  3HL8 A;  4MO4 A;  4ISE A;  1J54 A;  2QWR A;  3SQ2 A;  2ZGZ A;  2WUS A;  3LP2 A;  3IAY A;  2PY5 A;  4DG1 A;  4FM0 A;  4EP5 A;  3RSE B;  1HKG A;  2FSK A;  4DSJ A;  1VRT A;  3AVA A;  3C6T A;  4DV4 K;  4BRK A;  2Z1I A;  4K8X A;  4H5W A;  4JI7 K;  4F2R A;  3CM5 A;  4A59 A;  4JKH A;  2O8C A;  4JD2 A;  2PBD A;  2QEX N;  3OYH A;  3RWU A;  5BRH A;  1MDU B;  2BUP A;  3D7E O;  3DOL A;  3SLC A;  3SUQ A;  1NU0 A;  1IKW A;  1RBU A;  1NOZ A;  1SL1 A;  3E1Y A;  4DCH A;  5HRS A;  2YV0 X;  3L2U A;  5AQW A;  3NF9 A;  1R59 O;  1EXQ A;  1JCE A;  1NGF A;  3C6H A;  1VQK N;  1QS4 A;  5AQO A;  1X1P A;  4CIG A;  5JVG L;  1SV5 A;  1JLG A;  3QIO A;  1HYZ A;  4BQL A;  3CC2 N;  3QB0 A;  2P9I A;  3KK1 A;  3AAP A;  1K8K A;  1X9S A;  5I3U A;  1IG8 A;  4K0K K;  4BRI A;  3HP9 A;  5GAE P;  2P9K A;  5LJV A;  4Z4I A;  4JKC A;  4AIL C;  4CZH A;  4BDY A;  3VQ9 A;  1BWF O;  5FRM A;  1NK4 A;  4RW6 A;  1TKX A;  3RTV A;  3K9K A;  1XI1 A;  3CHW A;  5EVZ A;  2HHV A;  3IDH A;  1GLC G;  2DFF A;  1MU2 A;  3SQ1 A;  4IFE A;  3R8E A;  2QWL A;  3CQ8 A;  2Z1J A;  4DTS A;  1RBT A;  1GOA A;  2PAV A;  3I56 N;  2HNY A;  2NRR A;  2OTL N;  2O8F B;  1CZA N;  3MDQ A;  1ZBI A;  1FJG K;  5F1X A;  3SPZ A;  4NLC A;  3JXU A;  1LWF A;  1BA0 A;  3LAK A;  3LDN A;  3WXJ A;  3SQ0 A;  4CZJ A;  4MDB A;  5CE3 A;  1S72 N;  1H1V A;  3DLL L;  3SAG A;  5T7B A;  2QTD A;  1VQP N;  1HNI A;  1A5V A;  1LWC A;  3CM6 A;  4CJP A;  3ZT2 A;  1Z25 A;  5AQT A;  3SBG A;  4PY5 A;  4YOT A;  3OYN A;  3PX6 A;  5M1P A;  4HTU A;  3WNE A;  3E66 A;  4CHQ A;  1ASW A;  2PFU A;  5LMU K;  3I0S A;  4W5O A;  4M3Z A;  2X6N A;  3VTI A;  1VK0 A;  4LSN A;  2P5G A;  5A2Q O;  1JCG A;  4M3X A;  1JL2 A;  4B8C A;  1RDB A;  3TAB A;  5HRO A;  2O8C B;  4RW4 A;  4E89 A;  1LW2 A;  4CK2 A;  1S1W A;  4F9O A;  4LFB K;  4BRH A;  3BP8 A;  4DTU A;  3TAE A;  4LH5 A;  2KFN A;  3AVC A;  4FJM A;  5DM7 L;  4JKF A;  1U6Z A;  4XIU A;  4Z4G A;  3AA2 A;  4E7J A;  1S1T A;  4FWL A;  3C94 A;  1DTT A;  3BZC A;  5AZJ A;  1YIJ N;  3P31 A;  1QSY A;  3ZSY A;  4Z4E A;  3ULD A;  1WAJ A;  3KWI A;  4JI3 K;  3PY8 A;  4BAC A;  2W6L A;  3HM9 A;  5AFU H;  1EQY A;  1VHX A;  1XNR K;  3SMS A;  3J8A A;  2YNH A;  1P8Z A;  4ICL A;  1JL1 A;  3P83 D;  4FZX C;  3ENB A;  3QEV A;  1D8Y A;  2P9K B;  4HHT A;  4C1N K;  1YJ9 N;  3U6F A;  3QIP A;  1OKJ A;  5ELZ A;  3I33 A;  3ID6 A;  3VTH A;  1ILY A;  2ZD1 A;  5CZ1 A;  3CI5 A;  4M45 A;  2Y1J A;  3PX4 A;  1S6P A;  3P39 A;  2VGN A;  3R3L A;  3CCQ N;  4Z94 A;  4RW9 A;  3HZ6 A;  2Q0R A;  3HTV A;  1GLB G;  4GVM A;  4LF4 K;  3TAQ A;  1VSD A;  1KFD A;  2JWL A;  3OYF A;  3IKM A;  1TV6 A;  3J7Y P;  1S1V A;  1DT9 A;  2QA4 N;  4KH6 A;  4J2A A;  2KW4 A;  3OYI A;  2ZJQ L;  3LAN A;  4FLT A;  2Q1N A;  3GBT A;  1I3A A;  3L2R A;  1TUU A;  2W40 A;  1ZBL A;  4BR0 A;  1OH5 A;  4WQ4 C;  4HVJ A;  1VSI A;  4B1Y B;  5AQR A;  2YHX A;  1OVQ A;  4F3T A;  2QXF A;  2KFZ A;  2F8S A;  2P9U A;  5KRS A;  4PQU A;  4L3Q A;  1S22 A;  1XMQ K;  1Q18 A;  1EET A;  3LWL A;  3ENH A;  1VAZ A;  4OLA A;  2KZM A;  1EWQ A;  3PV8 A;  1KVA A;  1RT4 A;  3QML A;  1MA9 B;  2X6S A;  4XEI A;  3BF3 A;  5JVH L;  3KLH A;  4FYD A;  1XHZ A;  3VQD A;  1VSK A;  1N8R O;  5B8H A;  4IFY A;  3V9U A;  4E3S A;  5ADX H;  2O8E A;  4BGA A;  4BE1 A;  4UY8 O;  4G1Q A;  1C0F A;  5HL7 L;  4JKB A;  3WXI A;  4DS5 A;  4CJT A;  4DR2 K;  3AO2 A;  4M42 A;  3OS1 A;  5AZJ B;  4GNI A;  3SNN A;  5E41 A;  4CJW A;  3NVK A;  3TAR A;  4H5T A;  4NO7 A;  1WBB A;  4FJK A;  1YT3 A;  2YHA A;  3ULE A;  4I2Q A;  2D0O A;  1RT5 A;  2O8D A;  3VQB A;  3NGI A;  2Q2R A;  4DSE A;  4GKJ K;  1BQM A;  4JKG B;  3ZSO A;  3CCE N;  2EX3 A;  2UUC K;  3DLG A;  1NOY A;  1NK5 A;  4B1W B;  3VEO A;  3KJV A;  2A1S A;  1VSH A;  4HWI A;  2RF2 A;  4LH4 A;  3CJ7 A;  4AQY K;  5HRN A;  4KHY A;  3LDO A;  3CCV N;  3VGK A;  4KB0 A;  4CVN E;  3D45 A;  4W5N A;  3JSM A;  2GEL A;  3ZSQ A;  4BRO A;  1EX4 A;  4OVL A;  4LSL A;  2YKM A;  2YJF A;  4RW8 A;  3N4P A;  3O3F A;  4CJL A;  2OZS A;  3A5N C;  3AVG A;  2HF4 A;  5GIO A;  4U7B A;  3TSQ A;  4K43 A;  1J53 A;  1W7A A;  3ZSX A;  3TTD A;  5AQJ A;  2V7Y A;  4B9S A;  4QAG A;  2AJQ A;  3LDL A;  3MCA B;  3S9H A;  3SJJ A;  3V6D A;  1WLJ A;  1SL0 A;  2YHB A;  5JS1 A;  3CCS N;  2OYQ A;  3LPU A;  4H4M A;  1ATN A;  3PO4 A;  1Q9Y A;  5SZT A;  4B9U A;  2YKN A;  3ZSW A;  4YFU A;  3CFO A;  5FPN A;  3VEY A;  4BC3 A;  3F73 A;  1GLJ O;  3OYJ A;  3NAE A;  4BY9 C;  3VQ5 A;  4JI0 K;  4YOU A;  5AQU A;  4BRG A;  4FJI A;  4WQ4 A;  4OJR A;  1E4F T;  2B4J A;  1SQK A;  4B3S K;  1REV A;  1RTD A;  3QO9 A;  1JLA A;  4PUO A;  1S9E A;  3RR7 A;  2E4L A;  3SJH A;  4CCH A;  2ZF5 O;  4AHC A;  1U47 A;  4H0T B;  4FWN A;  3PX0 A;  3LZI A;  1YIT N;  4FWK A;  2A41 A;  4G9Z A;  3ZEU A;  4FWO A;  4JK9 A;  1T44 A;  4Y0W A;  1NMD A;  5C12 A;  4O5B A;  1IH7 A;  4BVO A;  5TKY A;  5M1F A;  4IO9 L;  3KLG A;  4WCE L;  2O8D B;  2GBZ A;  3VGL A;  4AH9 A;  4DQR A;  5DK5 A;  1FW6 A;  3A0I X;  5GAG P;  1VSF A;  3HPO A;  3WQU A;  1A5X A;  4IJA A;  4BRC A;  3BF1 A;  3HST B;  2YNI A;  5GIP A;  3K58 A;  1BOT O;  3C6A A;  3O9T A;  4DV1 K;  3M8R A;  3HVT A;  1JXB A;  4DU4 A;  4H8K A;  4K41 A;  3UKR A;  5BRF A;  4CHN A;  1UA0 A;  5EXW A;  4OKK A;  2BE2 A;  3I55 N;  3SQ4 A;  4Q0B A;  4BC5 A;  1NGH A;  4CER A;  4DV3 K;  5CR4 A;  1HPZ A;  1GLL O;  2HHH K;  1ZBF A;  4Y1D A;  3T7Z A;  2NRX A;  2QM1 A;  3ZX2 A;  4GV9 A;  1N33 K;  4PKI A;  4BC4 A;  3U3Y A;  4NB4 A;  1B9F A;  1NKB A;  1TK0 A;  5FRN A;  4FLW A;  3O6W A;  3OYB A;  3NE6 A;  1NGA A;  3ZT0 A;  4NCG A;  1KVB A;  4FWR A;  4AM6 A;  1NKC A;  3C65 A;  3DAW A;  3WXL A;  3B8A X;  2P9L A;  1XHX A;  5J1E A;  3VN5 A;  3KWG A;  1HQU A;  4FPA A;  2H3G X;  4KHW A;  2ITG A;  3NBP A;  3V1O A;  1VQO N;  4JAX A;  5J2M A;  1L3T A;  1WSF A;  2FSN A;  4KKO A;  3OYM A;  3LZJ A;  3O1W A;  4CJR A;  2VQE K;  4O0J A;  1KLN A;  2UYT A;  3ZT3 A;  2NZT A;  2F96 A;  3ZX3 A;  1ITG A;  5JMV A;  5F2R A;  4JLH A;  5M1O A;  3NVM A;  1E3M A;  2HMI A;  3SUN A;  3THV A;  4B3T K;  1RT3 A;  2WON A;  3ZT4 A;  4CBX A;  2P9S A;  1T05 A;  4WFA L;  4LD0 A;  5CHI A;  4FLU A;  3OA9 A;  4DQQ A;  1N6Q A;  1ZBU A;  3DLB A;  4FJG A;  4DWI A;  3CJC A;  1BGX T;  4B9N A;  5BR8 K;  2Z1H A;  4X62 K;  4KTQ A;  4BVP A;  4K25 A;  3ZEU B;  1RBV A;  3CXC M;  4BRF A;  3L3V A;  1YAG A;  5C2F A;  3WEE A;  3RMB A;  2HBJ A;  3O9R A;  2IOC A;  5AQH A;  3CCJ N;  5C10 A;  2NRV A;  5LL6 Z;  4X65 K;  5F0X A;  3L2Q A;  4FLY A;  3DXM A;  1QVF M;  3CJ9 A;  2W6K A;  3UKU A;  1G99 A;  4CGG A;  4DR6 K;  3DI6 A;  4DQP A;  4BR2 A;  2D1K A;  3KK3 A;  1NM1 A;  2E8A A;  3UKR B;  3BEX A;  2YCH A;  1X9W A;  4DQS A;  5FRO A;  5FPD A;  2HHW A;  3THX A;  5GIN A;  2XY8 A;  5BPL A;  5DM6 L;  3ZLJ A;  2GTD A;  1KLM A;  1HMV A;  3M3Z A;  3EZ5 A;  5LMN K;  3SCX A;  4BRD A;  3EYZ A;  3HYF A;  3AVL A;  2IVO A;  4FM2 A;  4CHY A;  1EWR A;  4DF8 A;  3P38 A;  4A62 A;  1WUA A;  3NDK A;  2HHU A;  1BQN A;  3O5B A;  3FLC O;  5KI6 A;  4AHV A;  4IXC A;  3NF6 A;  2ZWH A;  2VWK A;  2UXC K;  2DY4 A;  3WNH A;  4IOA L;  2P9L B;  4LY7 A;  4H0P A;  4CZG A;  3OBY A;  4O5F A;  3OYL A;  4FLZ A;  3MX5 A;  3H1V X;  1YJW N;  1B92 A;  1Y64 A;  2D5R A;  3NFA A;  2AA4 A;  3HOT A;  4LFC K;  4E1N A;  5CYQ A;  4H0V B;  4DUZ K;  4B3O A;  3MCP A;  5M1K A;  1S6Q A;  5E26 A;  3PIP L;  3SV3 A;  1RT6 A;  1BCO A;  4W5R A;  3VEV A;  2BGG A;  3NH0 A;  1Q81 O;  3R6M A;  2KLA A;  3DRR A;  4CFC A;  2D4W A;  4JYA K;  4MLE A;  5GAH P;  4E7L A;  4H5V A;  5CZ2 A;  4CJE A;  1NJX A;  5C24 A;  3FZH A;  4EP4 A;  1YVN A;  4AHU A;  2E6L A;  2PYL A;  4E7K A;  3DMJ A;  1TK8 A;  3OJS A;  1JKH A;  4MQ3 A;  1MWK A;  4FJH A;  1WSE A;  2YJE A;  4OGE A;  4CJU A;  1T6C A;  1YI2 N;  2GUI A;  1ASV A;  2G8U A;  4NYF A;  3DRS A;  4JI5 K;  1IKV A;  2V51 B;  2ETJ A;  1RBS A;  2IVN A;  3WEE B;  4MO5 A;  2ZJP L;  1S1U A;  3VEX A;  3C7N B;  5I9E B;  3H3O B;  3HBT A;  4CJ3 A;  2P9N B;  3DWL A;  3KTQ A;  3DXM B;  2HF3 A;  2DFH A;  4CEQ A;  3EE9 A;  4BRL A;  4QCL A;  3CET A;  4K8Z A;  3UKU B;  4DF4 A;  1T8E A;  4YOW A;  4AHR A;  4OKJ A;  2P1J A;  3AVN A;  4JS5 A;  3G6E N;  4FXD A;  3KHY A;  1ZXO A;  4BWM A;  2QWO A;  3S3O A;  3E01 A;  4CEB A;  3C0B A;  4FJ8 A;  2NLX A;  3FZL A;  4M3Y A;  3L8B A;  3D2E A;  1NKE A;  4JEP A;  3VQA A;  3MED A;  5KPT A;  4FL9 A;  4BDZ A;  3RRG A;  1O13 A;  4DMN A;  3V1Q A;  4CI6 A;  4F2S A;  5JLH A;  4FZY A;  4DSL A;  1L3U A;  1ZYQ A;  4DLE A;  3P1G A;  1RDD A;  3V9W A;  3T19 A;  3DLK A;  3A8Y A;  1HQE A;  1WSH A;  3VMF B;  2E5L K;  4YHH K;  3HJF A;  4L8R B;  2E6M A;  1IBL K;  4FJL A;  4HUE A;  4A2B A;  4CZL A;  3TWH A;  5HLF A;  1QZ6 A;  5AQV A;  3AVI A;  5AQL A;  4DSI A;  4JD2 B;  3L0Q A;  1J5E K;  4CF8 A;  3HM8 A;  2G8W A;  1JLB A;  2G8K A;  1NWK A;  5KRT A;  5KPR A;  3LM9 A;  3T1A A;  4OPK A;  1X3N A;  2E2Q A;  1XC3 A;  2KQ2 A;  4JI4 K;  2XY5 A;  2FBV A;  3HOS A;  1HNW K;  4KH5 A;  5MLC Q;  4CF1 A;  1OVY A;  1I94 K;  4BR4 A;  3AY9 A;  1KAY A;  5BRD A;  1CZB A;  3DYA A;  4I9Q A;  4M3U A;  1XUP O;  1HJO A;  4JKE A;  4CGH A;  2JWK A;  2VQF K;  4FK0 A;  1DGK N;  2P9I B;  1K8K B;  2A3Z A;  2QWN A;  4DS4 A;  3MN7 A;  4KH4 A;  3NH2 A;  1QHA A;  4KRE A;  2A1R A;  1FKP A;  1VSM A;  2OA8 A;  3WUH A;  1C0U A;  3LDP A;  4C8L A;  1KVC A;  3UE5 A;  3AO1 A;  1UOC A;  4DFM A;  1NK9 A;  4YOY A;  4CEZ A;  3K5M A;  1XMO K;  3OYK A;  1BCM A;  1NGG A;  2D0B A;  3G0Z A;  4DV7 K;  3T3F A;  3E9O A;  1NJI O;  3DLH A;  3DXK A;  2NUB A;  3KD5 E;  3I0R A;  5J2P A;  2F8T A;  1U45 A;  1JLC A;  2A5X A;  3VEN A;  1CZ9 A;  1N32 K;  2XHB A;  2LSN A;  4B9M A;  1ESV A;  2IVP A;  1SUQ A;  1GOC A;  2X78 A;  2P9P A;  2O4G A;  3TAN A;  1ZC6 A;  4DTM A;  1C0M A;  3R1X A;  4Z0U A;  3D2E B;  2RKI A;  4Z4C A;  3ZT1 A;  2HMP A;  1P90 A;  1U4B A;  3CIP A;  2Q3S A;  4W5T A;  1QVG M;  2OAN A;  1RFQ A;  1TAQ A;  2I7N A;  1FK9 A;  1WBD A;  3VER A;  1QE1 A;  2HBL A;  2PYJ A;  2ASM A;  4CJQ A;  1XWL A;  4FJ7 A;  3N4Q A;  3VQE A;  3CPE A;  4FJN A;  3F2K A;  1RT2 A;  3GOI A;  3QIC A;  1SZ2 A;  1TAU A;  3LAM A;  1M90 O;  3ATV A;  4IZ9 A;  2QWP A;  1N34 K;  4JKA A;  4ILJ A;  3OY9 A;  4OLB A;  3THW A;  1KAX A;  2IS3 A;  2ZJR L;  5BPN A;  2X74 A;  3WNG A;  3AVM A;  1QQN A;  3LM2 A;  1C6V A;  4H03 B;  3IMX A;  4CJK A;  4BRE A;  3LDS A;  3OYE A;  3AAQ A;  2DTU A;  3QDK A;  3HP6 A;  3CCL N;  1VSL A;  3VGM A;  4FK2 A;  5AQM A;  4E1J A;  2E2N A;  3VF4 A;  1FKO A;  4WFB L;  3SUP A;  1UWB A;  1VQ8 N;  5HOO A;  4YOR A;  4CK3 A;  4IJN A;  2BTF A;  1DKG D;  2VG6 A;  4DV0 K;  2QW9 A;  1KTQ A;  3CG7 A;  5C0Y A;  2P51 A;  1D5A A;  1J5O A;  1WSJ A;  4O8U A;  3WXM B;  4EZ9 A;  3H1Q A;  5IWA K;  1HNZ K;  4IKF A;  4EHU A;  2HNZ A;  2FSJ A;  1LV5 A;  3QBW A;  4K42 A;  4J8F A;  4NYN A;  3PIO L;  3SK3 A;  1I39 A;  5GAD P;  2D0P A;  1NJY A;  3ZSR A;  4LF8 K;  3O8M A;  3D0P A;  3OVN A;  4OPJ A;  4QS7 A;  4JRQ A;  3V9S A;  3PLA A;  3TPQ A;  4HUF A;  4CGJ A;  3AV9 A;  4B08 A;  3SPY A;  1NMN A;  1KSP A;  3W3D A;  3MAQ A;  1XNQ K;  5C42 A;  1YUW A;  4CJ7 A;  3CME N;  3U9Z A;  1X9M A;  4PKG A;  1DTQ A;  3H46 O;  3WXK A;  2OCE A;  1CXQ A;  3RRH A;  4PA1 A;  1QQM A;  4H0X B;  4ELV A;  1KC8 O;  3MEG A;  3U9D A;  3DXK B;  5EY4 A;  3KK2 A;  3SYZ A;  2E1Z A;  3AO5 A;  1LW0 A;  4BE0 A;  3WT0 A;  4FM1 A;  1CLQ A;  1BU6 O;  2XRI A;  4FJX A;  1LAW A;  5C2D A;  2QI2 A;  3M5R A;  3EKS A;  4CHZ A;  2Q0U A;  3QER A;  4FSV A;  1S1X A;  1C1B A;  1R0A A;  1YTA A;  2P9U B;  2CGL A;  3O3G A;  2VYP A;  4EFH A;  3OJU A;  3QNO A;  1YJN N;  4WQ5 C;  1GLE G;  2FBY A;  4KV8 A;  4AM7 A;  4DV6 K;  3SZ2 A;  1OH6 A;  3O1B A;  2VCP A;  4DQ8 A;  3VQ7 A;  4H0O A;  5AQK A;  1EKE A;  4KHN A;  3ZCM A;  3HI0 A;  3A5L C;  4CBW A;  2HW3 A;  4J2B A;  3THW B;  4ID1 A;  4NCB A;  2VWB A;  2UU9 K;  5EU7 A;  2O8E B;  3OYA A;  3KLE A;  5D3G A;  3H08 A;  4N5S A;  4RCH A;  4GKK K;  2UXB K;  1F21 A;  5M1Q A;  4JHD A;  3TI0 A;  3SMP A;  4CK1 A;  4NXM K;  1NGE A;  4CES A;  5KPZ A;  4JI1 K;  1RNH A;  1U48 A;  4LF6 K;  1JLE A;  5BPM A;  3QIN A;  2FLO A;  4BRA A;  1VQ6 N;  4E7H A;  1NJW A;  4FVU A;  2RE2 A;  4FWP A;  4XH4 A;  1T3V A;  5H1S Q;  4EZ6 A;  2HHX A;  3K0S A;  3ULE B;  4CD3 A;  2JLE A;  3ID8 A;  4QS8 A;  4NCA A;  5BRE A;  4JNE A;  3SBT A;  2VG5 A;  3MN5 A;  2HND A;  2G8F A;  3BUZ B;  3THY A;  3DRP A;  1OH7 A;  1V4S A;  2ASP A;  4C8O A;  4CIE A;  1RDA A;  4FOI A;  3HK2 A;  3CYM A;  3L4Q A;  2Q36 A;  3FE1 A;  1HKC A;  3O9U A;  5AQZ A;  4BWJ A;  4BE2 A;  3UIQ A;  3ASM A;  3QLH A;  4JRP A;  2D0A A;  3NGY A;  3U3G A;  4IFV A;  4GVE A;  4KTZ A;  1N36 K;  3K9J A;  1TKZ A;  4WF9 L;  2HVI A;  1TL3 A;  1BA1 A;  1TKD A;  3IRX A;  3AA4 A;  2NNW A;  1VQ7 N;  3KKR A;  2HBM A;  3AA3 A;  2CGK A;  4GW6 A;  3VEW A;  4O4G A;  2VG7 A;  3D2F A;  3OYG A;  1U2V A;  2G8V A;  3AAR A;  4O44 A;  3MWP A;  3IUC A;  4H5N A;  5FLX O;  1QSS A;  3VQC A;  4DTR A;  4E0D A;  4CFA A;  4KI6 A;  1JXE A;  2I7P A;  1C1C A;  3EL2 A;  4GV3 A;  1YVU A;  3VQP A;  3VF2 A;  3WQT A;  3HVR A;  4DTP A;  3RSE A;  1SAZ A;  5AFU A;  3O80 A;  4KTW A;  4FPB A;  1TYQ A;  5KGW A;  4KHU A;  2G8H A;  4X66 K;  2HVH A;  2B6A A;  1Q82 O;  3OYD A;  1IO2 A;  1Y97 A;  4BQZ A;  2FXU A;  3AVB A;  3J7Z O;  3ZSZ A;  4HTL A;  3SUO A;  3KK7 A;  1NGI A;  4I7F A;  3TAP A;  3MMV A;  3OTO K;  1BDG A;  4I2P A;  3V9X A;  3AO4 A;  1HNV A;  3QET A;  1S9G A;  3L4I A;  4WQ5 A;  2EWS A;  3PUF A;  2QWM A;  2A6A A;  4M41 A;  5FPM A;  1QSL A;  3K59 A;  3CJ1 A;  4O0I A;  1KFS A;  4LF9 K;  4FO0 A;  4WE1 A;  4F3O A;  4M7Y A;  2GWJ A;  4DV5 K;  2GUP A;  3LAL A;  2RPI A;  2KTQ A;  3FZM A;  1RIL A;  4MFB A;  3CFP A;  4KO0 A;  5AQS A;  4WFN L;  4FW1 A;  1HPM A;  4OGC A;  4BR5 A;  2HOE A;  4N76 A;  1VQ5 N;  3TSP A;  3THY B;  4A5B A;  1M1K O;  4J2E A;  4LF7 K;  4DQI A;  1WAF A;  5AZI A;  3TAM A;  4CHP A;  3FZK A;  1YTU A;  4GMJ B;  2BDP A;  3CPW M;  3RMD A;  3FFI A;  4IDK A;  4LF5 K;  2I5J A;  3AGK A;  4E19 A;  3RMA A;  1VQN N;  3VET A;  2ZM6 K;  1NNE A;  2E20 A;  1VQM N;  3KVG A;  3CCU N;  2OZM A;  1WOQ A;  4IEI A;  1W0H A;  1XC9 A;  1JLF A;  4CJV A;  2OPR A;  4CJF A;  4DR1 K;  1QZ5 A;  2Y1I A;  5ADX A;  2FBX A;  3L2V A;  3F9M A;  2O8F A;  1NK8 A;  1BI4 A;  1NGB A;  1KQS M;  4IBN A;  3A2F A;  3MN9 A;  5AQP A;  4PL8 A;  3LWM A;  3IG1 A;  4YOX A;  4KB1 A;  3AVJ A;  4A61 A;  2RN2 A;  2GEM A;  4N47 A;  3H3N O;  2KHO A;  4CW7 B;  1YXQ A;  3I8B A;  4C8K A;  1RGI A;  3P5J A;  4M3T A;  5KTQ A;  3OS2 A;  2JGU A;  1NK0 A;  3CC7 N;  3EY1 A;  3ZYY X;  1TYQ B;  1HKB A;  4HCB A;  1NGJ A;  1IV0 A;  2F9T A;  3TSU A;  1LWE A;  4FJJ A;  2E88 A;  1BIS A;  1K73 O;  4CE9 A;  4AHT A;  3AVH A;  4N56 A;  4CGF A;  3S3N A;  4JI2 K;  3CJB A;  2OPQ A;  3DLR A;  2P9S B;  4CJ4 A;  4LC9 B;  3CMA N;  3JS6 A;  4CZI A;  5BN9 A;  4CF9 A;  2HHT A;  1GLF O;  3OBW A;  4O55 A;  3EO3 A;  4JK7 A;  3CCM N;  2XY6 A;  3MEE A;  4DR7 K;  1GOB A;  4H4O A;  1IG9 A;  4FOE A;  1O1W A;  3MXM A;  3EE8 A;  1TKT A;  4I6M A;  4CEF A;  4H5R A;  3M8S A;  1QQC A;  3CER A;  1S3X A;  1IBK K;  3QEX A;  4OPA A;  3FFK B;  3S41 A;  4KI4 A;  5TKW A;  2NRH A;  3OW2 M;  1ATR A;  3F9K A;  3OYC A;  1WSG A;  3TU5 A;  1ATS A;  4BG9 A;  3NGZ A;  3G10 A;  4CF2 A;  4B8A B;  1TK5 A;  3QEP A;  5AZI B;  4DSK A;  3MK6 A;  2BH1 A;  3CD6 N; 
#chains in the Genus database with same CATH homology
 4JI0 K;  4LFC K;  2VQE K;  4DR1 K;  2E5L K;  4YHH K;  4DUZ K;  3J80 O;  4JV5 K;  1IBL K;  4DR2 K;  5FLX O;  4B3S K;  5IT9 O;  4JI3 K;  4K0K K;  1J5E K;  4B3T K;  2UXD K;  4DV6 K;  1XNR K;  2UUB K;  4JYA K;  1N34 K;  4LFA K;  1HR0 K;  4JI4 K;  4CW7 B;  4X64 K;  3JAM O;  3J7A P;  1HNW K;  4DR5 K;  1I94 K;  4DUY K;  4GKJ K;  4X66 K;  2UUC K;  5BR8 K;  2UU9 K;  4X62 K;  2VQF K;  2UXB K;  4GKK K;  4AQY K;  4NXM K;  4JI1 K;  4CVN E;  4LF6 K;  4LF4 K;  4JI5 K;  4DV2 K;  3J81 O;  4B3R K;  1FJG K;  4DV0 K;  5LL6 Z;  4DV1 K;  3OTO K;  4X65 K;  3J7Y P;  2F4V K;  4JI2 K;  5IWA K;  1HNZ K;  4YY3 K;  4DV3 K;  4DR6 K;  1XMO K;  4DR7 K;  4LF9 K;  4V19 S;  2HHH K;  4DV4 K;  4LF8 K;  4NXN K;  4DV7 K;  4DV5 K;  5AJ3 K;  4JI7 K;  1N33 K;  5LMU K;  1XMQ K;  1XNQ K;  4DR4 K;  5LMN K;  1IBM K;  5A2Q O;  1IBK K;  4LF7 K;  1N32 K;  4JI8 K;  4DR3 K;  4KHP K;  1HNX K;  4LFB K;  4JI6 K;  4LF5 K;  1N36 K;  2UXC K;  4B3M K;  2ZM6 K;  4OX9 K;  2UUA K;  3T1Y K;  3T1H K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...