4WE1A

Crystal structure of hiv-1 reverse transcriptase in complex with 5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)-2-naphthonitrile (jlj600)
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
547
structure length
542
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Picomolar Inhibitors of HIV-1 Reverse Transcriptase: Design and Crystallography of Naphthyl Phenyl Ethers.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Hydrolase
molecule keywords Gag-Pol polyprotein
total genus 140
structure length 542
sequence length 547
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4we1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4we1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4we1A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4we1A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4we1A05
4HCBA 2ASLA 1RBRA 3OYLA 4CJWA 3AA4A 1N56A 3C6UB 4CF0A 1K1QA 5HRPA 4CEQA 1N48A 4RNFA 4FLYA 3D28A 4DL5A 4ECQA 4CESA 4M3ZA 3SJJA 4IG3B 3CG7A 1Q9YA 2R2SA 4IG0B 3TAGA 4F4YA 3FDSA 3VQ5A 4KHMA 4KKOA 4HCCA 3DRRA 1NJZA 4FM0A 2RDIA 4QAGA 1LWFB 2GC8A 1RT4B 1D9FA 4FZXC 1W25A 3A2FA 3VN5A 4CEZA 4CHPA 4JS5A 4TY8B 4OLAA 2YKMB 1KSPA 4DS4A 2VWJA 1ZBLA 4I7FA 3TAQA 3PW0A 2AWZA 3PUFA 3BREA 3AA5X 3V6HA 5KG4A 4IDKB 4ECRA 2B4JA 1HQUB 5HRRA 3OYKA 1S10A 2QKBA 3T5HA 1NK9A 3V9ZA 4TSXA 2C22A 3KHHA 4N56A 2D0CA 3NHGA 1N6QB 3QLHA 4O3SA 1S6QB 5KFAA 3RB0A 3JSMA 4C8NA 1LV5A 3M8QA 2UUTA 3GIMA 5FDLB 4QWAA 3V9UA 3GV7B 4J9NA 2HNYA 4FW1A 1X9SA 3Q8PB 4IR9A 1HNVA 1OS5A 2YKMA 1MMLA 4I7FB 3ZCMA 1RA6A 3KMQA 1TV6B 4IFYB 3ZSRA 1CZBA 5DLGA 4O4GA 3MFIA 3DRPB 2IOCA 4FK2A 3JYTB 3P5JA 2KTQA 2QE5A 1BQMB 3MEGA 3RTVA 3I0RA 1MU2A 1TKZA 3ASMA 3AO5A 5FRMA 5F8MA 3NAIA 3M8QB 3QO9B 1S1TB 4CGFA 4W5NA 4ECVA 3M9OB 4KV8A 2C2RA 1WSFA 1JLCA 1L3TA 4U6PA 2XWYA 5JS1A 3CQ8A 2BR0A 5EU7A 2XI3A 3DMJA 3AVMA 4DSIA 3CWJA 1RT3A 3I5AA 4CJ4A 4TN2A 3UQSA 3E01A 2P51A 1KHWA 2PZSA 3L3UA 2XY5A 2HAIA 1S6PB 2OPQB 1MU2B 5KT6A 4B3OA 4CEFA 4XPCA 1XHZA 2WONA 5KT7A 1T05B 2YKNB 4MKBA 3NBPB 4I9LA 4KV8B 5KFJA 3ICLA 2G8UA 5K14A 5L1IA 2ASDA 4YR0A 2HNDB 1NJYA 3HSTB 2KFZA 3V1RA 3DMJB 4K4UA 1IKXA 4DTOA 1RDAA 4EZ9A 4BWMA 3CJ3A 2GV9A 4KPYA 4RW6A 4J2BA 2AX1A 3MFHA 4PY5A 4NRTA 1C1AA 1VSMA 4DL7A 5KFIA 3QIPB 1QSLA 4W5TA 2FVCA 1S6PA 2OPQA 2IBKA 5CY4A 4DF8A 4MFBA 3BDPA 5KG3A 3AO3A 3M9MB 4QW9A 4Z4FA 2OPPA 2BRLA 3IG1A 1XR7A 1IKYB 1TL1B 4CJSA 4Q45A 4YP3A 1S1WA 2WHOA 3NH2A 3FRZA 4M45A 3RRGA 1Q9XA 3AA2A 1IKXB 4LSNB 3K58A 3CFOA 2HMIA 4FCYA 3IS9A 3HVRA 4NLPA 4M42A 5HROA 4CHQA 4MFBB 4FJGA 2FBXA 1N5YB 4NLOA 3DLKB 3M8PA 4OJRA 1TL3A 4CHNA 3SI8A 5DGAA 4GMJB 1RTJB 1LWEB 4CFCA 2YNFB 4H8KA 4RNNA 4J9SA 2DFFA 4KHWA 4CHZA 4WFYA 2I5JB 3UR0A 1RBUA 1L3VA 3KD1E 4LSNA 3SCXA 2BGGA 2Y1JA 4IKAA 4YNQA 4QWDA 4FBUA 1NK4A 3UIQA 3K57A 3KK1A 1FK9B 3BQ1A 1U45A 4FK4A 4DTNA 4K50A 3NF9A 3UDLA 4JRQA 4B9VA 3LP2B 3OYCA 4EZ6A 2E9TA 1TQLA 1HJRA 3K2PA 4AHRA 3K5OA 5C42B 4WZMA 1KFDA 1LWEA 4IH7A 3OYBA 2YNFA 3FFIA 1WNSA 2I5JA 3RR8A 3TAMB 3CJ4A 4KKOB 2X6NA 4KREA 4LSLB 1IKVB 1T3NA 4O3PA 3H08A 5CYQB 5HBMB 5I3UB 3HHKA 4K4XA 4WE1B 4LH4A 3NGIA 1GX5A 4O3QA 4DQQA 1XI1A 3HL8A 5KFDA 2V4RA 4FW2A 4TYAA 4QWCA 4CEEA 1WAJA 3TWHA 4CJKA 2DPJA 1O1WA 3AO1A 4OKKA 5EWGA 2HVIA 2JC1A 3ZSXA 4CFAA 4FVMA 3HP6A 1S6QA 2WRMA 4Z0UA 1NJXA 1TAQA 4FXDA 3FQKA 4OPJA 3CFRA 1S9GA 4DG1B 4W5RA 1ASUA 4K4WA 3OYAA 2IA6A 5F8JA 1YTUA 3DI6A 5CYQA 5HBMA 4K4SA 3WNHA 3HVTB 2UUWA 3SQ1A 4WE1A 1RTDB 1S9EB 4FK0A 1TP7A 4ZP9A 2R8GA 4NCGA 1J9AA 5T14A 1JLQB 1FKPB 1ZETA 3NL0A 1VSKA 2AGQA 3I5CA 2HW3A 4FZYA 5DQHA 1QSSA 4O44A 5EWEA 2IM1A 3C6TA 3DLEB 1ASWA 4CECA 1TKZB 1IG9A 4FBTA 1B9FA 2Z1JA 3LP1B 5KFYA 3C6UA 3OYIA 1RTIA 2G8WA 3H5UA 3MXMA 3F73A 2VG7B 3SI6A 1JLCB 3PW5A 4IG3A 3AA3A 3HVTA 4CCHA 4XPEA 4ZP7A 1RTDA 2YHAA 3SQ4A 2EHGA 1U48A 3L2WA 5F8IA 3ULDA 5KFLA 3BJYA 3MTKA 1RT3B 4ZTJA 1EETA 1KVBA 3C95A 3TARA 3HP9A 4TY8A 4RZRA 4QCLA 3BSNA 3CFPA 1D9DA 3FSIA 3RBDA 2HWIA 1C1BB 4BDZA 3WNEA 1VSLA 5KFKA 4DL6A 4AHVA 2BE2B 2WTFA 4ED2A 2W8LA 2YKNA 3KMSA 1U04A 2HNDA 4CK3A 3CM5A 4ED8A 1S5JA 3QEVA 3QLHB 5KFVA 4CJTA 4FM1A 2D5RA 1YTAA 2ITGA 3ZT0A 4Z4IA 5F8HA 4X2BA 2FBTA 1JLEB 1RYSA 4M3XA 3OYNA 4Y1CA 4FLZA 1HNVB 2RPIA 4M41A 3KNAA 1RT5A 1HQEA 4ED3A 1RT2B 4MK9A 1IM4A 3AO4A 1X9WA 1D5AA 5J2MA 5F8LA 4CHOA 3VQBA 3CIZA 1VRTA 4ELVA 4IRDA 1RDBA 4B9TA 3L3VA 3CDUA 3MF5A 3NF8A 1BQMA 4GVMA 3D0PA 3I0RB 5D3GA 2XI2A 4DQPA 4MK8A 5KFGA 3KKRA 3ZT1A 4CGDA 1EP4B 2XY7A 3ZSWA 4HUEA 3AVCA 4F4XA 2OPSB 3QEIA 5EUHA 4J9RA 1VSJA 4Q43A 2IAJA 1VSFA 3DM2B 4RW4A 4CGHA 2FBVA 4O3NA 2IMWP 4CF2A 1VRUA 3VQ6A 1U49A 2IC3A 1RDDA 1S49A 3MEEA 3SNNA 4DMNA 2XRIA 4URGA 4YQWA 1ZTWA 5J2MB 1TL3B 4DSFA 2AX0A 4E7IA 5KFUA 4NLWA 3LPTA 4G1QA 1BI4A 4C8MA 3KIOA 4B8CA 3G0ZA 4DWIA 2FVQA 2XGQA 3LANA 3RMCA 1J5OA 1JX4A 1JL2A 1I39A 4M3UA 2HHXA 3SZ2A 4BE0A 3K59A 1C1CA 2YNIB 4F50A 3D5MA 2IDOA 1UOCA 3HYFA 4RW4B 5KFBA 4DFJA 2OA8A 3RWUA 4PQUB 4CGGA 4I2PB 4H4OB 4ECYA 4RW6B 3LAKA 5F9LA 1X1PA 3MR6A 4TQSA 4CJFA 4ELTA 4AHTA 3IRXB 1S4FA 3FFIB 3AVHA 4IFVB 1LW2B 4E7HA 1L5UA 3AVLA 3TAMA 4DU1A 3NMAA 4CEDA 1S9FA 1DTTA 1BCOA 3OL7A 3H5XA 1IKVA 4ZMMA 4HKQA 4DSLA 2JC0A 2G8IA 1J54A 4J2DA 3QEPA 1KHVA 4CEBA 5I3UA 2BRKA 3GV8B 3VQ9A 1WSGA 3PZPA 2KFNA 2CJQA 1RCHA 4PQUA 2R8KA 4DTUA 3M8RA 3V6JA 4WXWA 3GQCA 4XIUA 1HARA 3QIDA 3VQDA 3KK3A 1YVFA 3QZ7A 3IRXA 4QOZB 2UVWA 4N41A 3LDSA 3BSAA 2JEJA 4O5BA 5HROB 1Y97A 2D0BA 3L2UA 4ZP8A 2ZE2B 4M3RA 5KG6A 3SUNA 4KB0A 1ZBIA 1NNDA 3DI6B 4NLRA 1HNIA 5F8GA 1K1SA 2RKIA 1VSHA 2OZMA 2HHQA 4MIAA 4LD0A 4CGJA 1T7PA 5DG9A 2BQUA 2CKWA 4J9OA 4FLUA 3NDKA 1SUQB 3L2RA 1JXLA 4Z4GA 2V9WA 3OHBA 2ILZA 4FJ7A 5JUMA 3Q8RB 1KLMB 1RT6A 1RYRA 1TKDA 4O44B 1QAIA 4KHSA 3GIJA 4CHYA 2VG6B 2XGPA 5EWFA 3HVWA 3G6VA 3F9KA 4B08A 3V1OA 1RTIB 1D8YA 1ASVA 4RUCA 3OYEA 4CJ3A 3D45A 3L8BA 1REVA 1FKOA 3VQ7A 2JEFA 4MH8A 1D0EA 3K5MA 5L1JA 4FJJA 5T7BA 3VQQA 3OLBA 5DK5A 3ZSZA 1EETB 5CZ2A 1LW0B 4EBCA 3G86A 4KE5A 3T1AA 2W9AA 4NYNA 3KLEB 4DSEA 1EKEA 3PO4A 4ID1A 2W7PA 3OSNA 2R7YA 1L3UA 4G3IA 4WFZA 3NH1A 3PW2A 4FJIA 4FJXA 1BQNB 2O4IA 3B6PA 4WFXA 2X6SA 3N6NA 1CSJA 1GOBA 3QEWA 3QEXA 2ZQBA 3RB3A 5JS2A 3H4DA 4RUAA 3ZT2A 2B6AB 3PHEA 4KHQA 3O3HA 5SWMA 5KT5A 1FXXA 4R8UB 4ECTA 3CJ2A 1LWFA 3EYZA 1DLOA 3PX4A 1T03A 4K4TA 3NH0A 4EBEA 3AVIA 4O55A 3DLRA 1QAJA 1HQEB 1RT2A 2AQ4A 2OZSA 3QETA 2XY6A 2KZMA 4DU4A 2PYJA 4C8LA 4FJNA 3RAQA 1NK5A 3OHAA 4PA1A 4WZQA 1CXQA 4DSJA 4MK7A 1BQNA 4MQ3A 4Q0BB 3EY1A 3QIOA 3CO9A 3AVJA 1N6QA 3MR5A 3KHRA 3H5SA 4IRKA 1RDCA 1XC9A 3E51A 5KFHA 4U7CA 1CZ9A 5CYMB 5HRNA 5JXSA 2XC9A 3MXJA 4AHSA 4NLUA 1HPZB 1NOZA 3KK2A 4EYIB 4TY9A 2YNHB 1JLBB 1N4LA 2F96A 1SH0A 2YHBA 1Z25A 4RW9A 1WNEA 2JEIA 4JS4A 1SV5B 3OVNA 2AJQA 3JYTA 1CXUA 5KGWA 2I1RA 4DSKA 3PVXA 4OKEA 4IBNA 1XR6A 1WLJA 3QO9A 4GW6A 3DOKB 2J6UA 4QWBA 4F3TA 4AHUA 4B9NA 3NF6A 3VQCA 1QQCA 5KFPA 2ETJA 4J9KA 2HHUA 3V4IB 4RNOA 3DRSA 3O3GA 3HJFA 5KT2A 5KFXA 4I2PA 4CGIA 2YNHA 4N5SA 4KB1A 4CIGA 4ZPCA 4K4YA 4C8KA 3AVGA 1LW2A 2HHSA 3LZIA 1EXQA 3EZ5A 3EZUA 4KTWA 3SPZA 2C28A 3OL8A 4J9PA 1NK8A 1RDRA 1R0AA 2FVSA 3LP0B 4CEAA 3CJ5A 1RNHA 1UA0A 4TXSA 1SKRA 3LWMA 1T94A 1GX6A 3I5BA 3SYZA 3U3GA 5SZTA 4KSEB 4CIFA 2B5JB 5CZ1A 1Z26A 3TAFA 4ZP6A 4BDYA 2BANB 3G10A 4JLHA 5KG2A 1TAUA 2ATQA 3V4IA 1S97A 5DGBA 3HVAA 2OPSA 4B9LA 3SQ0A 4ZPAA 2XCAA 1TKTA 3SUQA 4ZTFA 3KK3B 2IAJB 1J53A 3O4NA 4FYDA 4CEOA 3KLFA 5HLFB 3Q8SB 4CJ5A 3PX0A 2A1SA 2DTUA 2DY4A 2FJVA 4FJMA 2R2UA 5DQIA 5KFCA 1HNIB 5J2NA 4KAZA 3OLAA 2E6MA 4M95A 2DFEA 1RBVA 2ZKUA 5F9NA 2YNGB 5KT4A 3VQ8A 5KG5A 2RF2A 5KFFA 1TKTB 1X9MA 1KLMA 1DTQA 4KHRA 3FQLA 4MKAA 4KRFA 3HXMA 3KLFB 5HLFA 2WCXA 1N5YA 4DTSA 4NYZA 4H4OA 3SPYA 4B9MA 1SH3A 1GOAA 1HRHA 1FKOB 1T8EA 4ZPBA 1I3AA 5J2NB 3KLIA 3QYYA 4IFVA 3T5JA 4DFMA 4FJHA 3EPIA 1HYSA 5KG1A 4Y3CA 1NKEA 3NGYA 3BSOA 4CF9A 4F2SA 4BWJA 1DTTB 4E1MA 4ICLB 1LW0A 1S1UB 2V0NA 3Q8QB 4RW8B 1S1VB 3TVKA 3GIKA 4KHNA 1KLNA 1JKHA 4J9LA 3CDWA 3S3NA 4DTRA 4NLYA 1L3SA 3LP2A 1JLFB 2GIQA 4I2QB 3AVBA 2VA2A 4WYWA 1IH7A 4HUGA 1UWBB 1I6JA 2A1RA 4EYHB 4W5OA 5J2QA 1B9DA 3NGZA 3NAEA 4NRUA 2P5OA 2FC0A 1QHTA 2OYQA 2ZE2A 3OL6A 2FBYA 4NZ0A 4LSLA 3V81A 4E7LA 1ZTTA 3K5LA 4DLEA 3RBEA 4JUZA 3MR2A 3AV9A 3HT3A 3KLGA 1RILA 4RW8A 4YR3A 4DL4A 4CJVA 1VSEA 4QPXA 4L8RB 4IKFA 3OYMA 4XO0A 2VG5B 3ITHB 4Q8EA 3OYHA 4JV2A 1G15A 4RG8A 3DYAA 2D3UA 2W9BA 2PY5A 3TANA 1SUQA 4CF1A 2UVRA 2D7SA 4OKJA 3SUPA 3PR5B 3HPHA 2F8TA 3BGRB 5J2QB 4Q0BA 3GYNA 1F21A 4FJ9A 4KAIA 3T5LA 3SQ2A 5KFSA 3MEDA 4DL3A 3I8DA 3M8SA 5FROA 4Y1DA 2BQ3A 4JRPA 1KVAA 3T19A 2EC0A 1C0UA 3QZ8A 2KW4A 4FLWA 4K8ZA 2R2RA 4Y2AA 3KLGB 4FJ8A 4ID5A 2R8IA 1XHXA 4Z4HA 3RMAA 2HVHA 1S9EA 2RDJA 2FLNA 1B92A 4NCAA 3KK2B 4WXOA 3JSMB 3DYAB 1JLBA 2QKKA 4H4MB 3CM6A 5FDLA 3H4BA 4O0JA 1HYZA 1BCMA 1UAXA 4H54A 2X78A 4AHCA 3CDEA 3C6TB 3DLEA 3DOLA 4DS5A 3SV4A 5KFQA 4FZZA 4CJLA 1JXEA 1TV6A 3NFAA 1NJWA 3OS2A 2FLLA 3DOKA 2KQ2A 1EX4A 5KGXA 3QNNA 4OGCA 3DRPA 4DEZA 2VG7A 1RT7A 2W7OA 3BSCA 1KVCA 1NHUA 2HHVA 3PO5A 4ID5B 3U3YA 4DL2A 2IM3A 2WB4A 3MEGB 1W0HA 2B6AA 3TAEA 2EX3A 4JV1A 4JV0A 4CFDA 2Z1HA 4NLXA 4CF8A 2G8HA 2UVUA 3ISND 2QK9A 4YR2A 1DLOB 3PV8A 4KTZA 2AU0A 4FM2A 2HHTA 1TGOA 1XR5A 3DLGA 3LP0A 3KLHB 5J1EB 4PWDA 2V4QA 3NKYA 2BE2A 5DLFA 1JL1A 4NLVA 4F4WA 4TLRA 1IKWA 3KJVB 1RBSA 1KTQA 5KI6A 4NLQA 2B5JA 3RB4A 3OY9A 3GV5B 2BANA 2R8JA 5E41A 4KO0A 1LWCB 3LALA 3ALYA 2HNZA 4R0EA 3NE6A 4FLXA 1BHLA 5EDWA 1BGXT 4N47A 2E9RX 2Z1IA 2Y1IA 4O3RA 1T05A 4B9SA 4I9QA 5DMRA 1JLEA 3BQ2A 4NYFA 3QGGA 5KFTA 4WYLA 4DTPA 2XO7A 3V6DB 4QW8A 4ECSA 1A5XA 3MXIA 5C24B 1GOCA 5KTQA 1SL2A 3WNFA 4YMEA 4EP4A 1HPZA 4DLGA 1S0NA 2ASJA 2WOMB 5DG8A 3KLHA 4PWDB 3PJWA 3H5YA 2IJNA 3EPGA 4LQ3A 1SV5A 3HO1A 4M3TA 2IM2A 4LQ9A 1VSIA 2QXFA 4KHYA 3TI0A 4PUOB 4K8XA 4Q8FA 1LWCA 4KO0B 2YNGA 2HNZB 2ALZA 1A5WA 3MECA 1XWLA 3T5KA 1U09A 3OYDA 3OYFA 1S1WB 2B43A 2R2TA 2FJWA 1RA7A 2HHWA 3V6DA 5C24A 1A5VA 1VRUB 4F4ZA 2IC3B 2OPRB 3MEEB 3PJXA 3VQSA 3AVNA 1TK5A 3OS1A 2FJXA 3ZT3A 4G1QB 1IO2A 2W9CB 2DPIA 4KFBB 3KOAA 2BDPA 4OVLA 4PUOA 1HYSB 2RN2A 1C2PA 2XHBA 3M9NB 3OJUA 4CFBA 4FS1A 1QS4A 1J5OB 1Z4UA 3IGNA 4KBIA 1R0AB 3O3FA 3DLKA 4E7JA 1KRPA 1S1UA 2YV0X 4OPKA 1C1CB 1S1VA 3KKSA 2JLEA 1RTJA 4EP5A 4F4KA 3MAQA 3ZSYA 1JXBA 1JKHB 3OYGA 4DFKA 1ITGA 4CK1A 2OPRA 1TK0A 2ATLA 4BDPA 4O3OA 2BQRA 3QINA 4M3YA 3I0SA 4URQU 4LY7A 3LWLA 3VQAA 1TVRB 1FK9A 1NK7A 4KFBA 3V6KA 3AVFA 1BIZA 4DU3A 4Q44A 4ZHRB 5KFNA 1RAJA 5KFZA 1Q8IA 1BIUA 5L1LA 4HYKA 3VQEA 5C42A 3OL9A 1JLGB 3G6YA 5FRNA 4OLBA 5KG0A 2VG5A 3ITHA 2GUIA 3KTQA 3ZT4A 1QUVA 3VQ4A 4E0DA 2W9BB 3RMBA 2F8SA 2IGIA 3BGRA 1TVRA 3HM9A 1TKXA 2VA3A 1CLQA 2ZD1B 4ZVGA 3GIIA 4ZHRA 1RT1B 1BISA 5KRSA 3KLIB 2RKIB 5F8NA 1YT3A 5KRTA 2F8EX 1JIHA 2WK4A 2IJFA 5C25B 4DF4A 4IG0A 4ECWA 2IS3A 3DLHA 4EBDA 3L2QA 3RRHA 3DRRB 4ED7A 4IH5A 1NK0A 4E89A 2E9ZA 1RT6B 4O0IA 1JLAA 4IOBA 3S3MA 4FJ5A 2VG6A 1TKXB 4TQRA 4CK2A 3U6FA 3RAXA 3TQ1A 1JLFA 5L9XA 3OYJA 4NCGB 2IM0A 4I2QA 2FVPA 1FKPA 1JLQA 3HKWA 1S0OA 1RT1A 2FLPA 4NLDA 3THVA 3KHLA 3PX6A 4CJPA 1S0MA 4E3SA 4F8RA 4Z4EA 4R5PB 1QE1A 4Y34A 3K5NA 2P5GA 4ECZA 3RR7A 3LP1A 3H59A 3BQ0A 4J2EA 1WSJA 3WNGA 4GC6A 4N76A 3V81B 2GBZA 3SFUA 1NOYA 1HMVB 1C0TB 5KFWA 3SUOA 5DQGA 1JLAB 2LSNA 4ZVHA 4E19A 4NLGA 1BL3A 1SKWA 3PW7A 4IFYA 3LAMA 4CJRA 5J1EA 3ZSQA 1WSHA 1IKWB 3KJVA 2W42A 1ZBUA 1ZYQA 2C2DA 1NK6A 4ELUA 4RW7A 3CYMA 3MEDB 1QE1B 1C1BA 3MR3A 5HP1B 3PR4A 3V9XA 4F3OA 4Z4CA 1C0UB 3KHGA 3UPFA 1VSDA 4R8UA 4B9UA 4DTMA 1HMVA 2G8VA 1C0TA 1T03B 4FJLA 3IAYA 1NKCA 4DTJA 3B6OA 1WAFA 3HPOA 1LAWA 1YVUA 4CJUA 3CJ0A 2PYLA 4KHUA 4OGEA 4CJEA 1RTHB 2JGUA 2WOMA 3TAPA 4H4MA 3ZSOA 1WN7A 3AVKA 2QV6A 2VWKA 2R8HA 3OJSA 4CE9A 1NKBA 1RT4A 3DOLB 1S48A 2OH2A 3AO2A 4ED0A 2P1JA 1RT5B 3V9SA 5KFMA 2O5DA 4IDKA 4M3WA 2WONB 5HP1A 3VQPA 1HQUA 3MECB 1RT7B 4HVJA 4ZVFA 3TABA 4NCBA 4ZPDA 1VRTB 5CYMA 3QGHA 5KT3A 4DTXA 3RMDA 5D3GB 4F2RA 3TR8A 1EP4A 1RTHA 3N6LA 2C2EA 2Z1GA 4KI6A 4RW9B 3N6MA 3VA3A 4DQIA 2HNYB 4Y2CA 4GC7A 3DM2A 4CIEA 3VA0A 3DDKA 2D0AA 4J9QA 1LAVA 4IR1A 3SFGA 3DLGB 3H40A 4RNHA 4E7KA 4BE1A 4O4GB 4HHTA 2OPPB 4ECXA 3IGVA 1IKYA 1TL1A 1TK8A 4J2AA 3L2VA 5I42B 4KB7A 1HYVA 1BI4B 3O4QA 4KI4A 3V1QA 3NAHA 2G8KA 3DRSB 3PY8A 2GIRA 1S1TA 2D3ZA 3KLVA 3S3OA 4FLVA 1U47A 2YNIA 1C6VA 3SV3A 1SH2A 4LH5A 4EO6A 5KG7A 4M94A 3NCIA 1SL0A 5KFRA 4HTUA 1SKSA 2HB5A 2J6SA 2JEGA 1K6YA 4RU9A 1W9HA 3E01B 1JLGA 4OL8A 3QERA 5I42A 3QGIA 1NHVA 3ISNC 4B3OB 1WSEA 3LPUA 1RBTA 2DFHA 4FS2A 1ZBHA 3GILA 3C94A 2W8KA 4FLTA 3NBPA 1WSIA 4DQSA 5K14B 4K4VA 3LZJA 5J2PB 5HRSA 3KD5E 4FJKA 2ZD1A 2HWHA 4ED6A 2X74A 2NUBA 2FVRA 4Q5VA 4EO8A 4DQRA 4ECUA 4AH9A 4E1NA 4O4RA 1U4BA 2ILYA 2W9CA 1ZBFA 4TYBA 4IRCA 4URSA 1QSYA 4B8AB 1KCFA 4J9MA 3S9HA 3QNOA 3QIPA 5C25A 4KTQA 2E4LA 5L1KA 2RF2B 4DFPA 1C0MA 4K4ZA 2D41A 2XCPA 3RB6A 1DTQB 4IQXA 3IG1B 1KFSA 3PW4A 3P1GA 3T3FA 2O4GA 3G6XA 5J2PA 4W5QA 5C5JA 3LP3A 2XY8A 4UQGA 2AGOA 3BR9A 5KFOA 3H2LA 4YFUA 5DG7A 1QTMA 3I0SB 2KZZA 4AILC 3AVAA 1S1XB 2HMIB 3IS9B 4EEYA 4BACA 2AGPA 4BE2A 4R5PA 3HK2A 3V9WA 4CJQA 4ZVEA 2Q3SA 3H98A 3DLBA 1S9GB 4ICLA 4DG1A 4RNMA 3M8PB 1VK0A 4C8OA 1REVB 3IN5A 4QWEA 4MIBA 3NF7A 2UVVA 2E6LA 1SL1A 3HPGA 3QESA 4CERA 4NLSA 1D1UA 5KFEA 4ED1A 2J6TA 3ZSVA 3P83D 3OS0A 4HUFA 1UA1A 4IH6A 4NLTA 2G8FA 3CVKA 1UWBA 3KK1B 3KLEA 1S1XA 3OSPA 3NGDA 4RW7B
chains in the Genus database with same CATH superfamily
3WQPA 1B0TA 3C15A 1FRLA 3C6UB 1HA1A 5IC4B 4CEQA 2UXBJ 1T95A 3O80A 2VJVA 4CESA 4M3ZA 4ZCIA 4P6QA 2ZUAA 4B3MJ 4QS7A 3AJ1A 2IHR1 3I33A 3VQ5A 4FYYB 2C3MA 4KKOA 2XZWA 4G6VB 1K44A 2Z2YB 3QRQA 4FM0A 2NLXA 1F5AA 1PAEX 4RJVA 4IOCL 2Q0RA 3VN5A 4CEZA 4CHPA 2O3DA 1FVQA 3EXYA 3R3TA 4I7FA 4OYMA 2AWZA 3BREA 3FZ2A 4IDKB 4LF5K 4P52A 4ECRA 2B4JA 3IXQA 1LFPA 2KVQE 1NK9A 3V9ZA 4F36A 3HSJA 1W2IA 2FLOA 2FJAB 4N56A 2I8EA 1OYEA 3QLHA 4X4TA 4O3SA 3CJKB 5BXIA 3QRRA 2UUTA 3GIMA 4QWAA 3NNAA 1SC3B 3V9UA 4IEEA 4LBIA 1Q7YO 4WU3A 4J9NA 2HNYA 2RRNA 2WZ1A 1FW6A 3Q8PB 4IR9A 2NYHA 4X4RA 3FZMA 2YKMA 1MMLA 4JI7J 4YB7A 4ANDA 1TV6B 4I68A 3AQPA 3ZSRA 2V2KA 5LJ5Y 4B3MF 2IOCA 2CGLA 1WSVA 1YIJS 1RFQA 2KTQA 3MEKA 2P9NA 2QE5A 2I9SA 2YXLA 2YPYA 1IVZA 3NP5A 3DFEA 2J0SD 1Q7LB 5CHIA 2CJYB 2XWYA 2IRXA 1DARA 1Y5LB 1R6VA 3M5RA 2DXDA 4DX8H 1U1LA 2DH9A 4AXIA 2YX7A 4DV1K 5LXRA 4CJ4A 1I94K 4TN2A 2NXJA 4A62A 4HH1A 3E01A 4PL8A 4R79A 2RS8A 1KHWA 3WXMB 2PZSA 3UCGA 2GQQA 3AH6A 1FDNA 3P6YC 1S6PB 2OPQB 1MU2B 3MM8B 1RE1B 4S0MA 5CD4H 2UP1A 2QA2A 4UUXA 3DGPB 3Q8UA 2OMLA 5K14A 2QYGA 2K7KA 4DR1F 3CCUS 2ASDA 2HNDB 1RXOB 3HSTB 3CIMA 3PCOB 4K4UA 1IKXA 4BWMA 2CGJA 3CJ3A 4J2BA 4ILJA 3GFYA 2ROGA 4O5FA 3H7HB 2G2YA 5B0FA 4JI6K 5KFIA 5A8WA 4W5TA 3POTA 4O0NA 5CY4A 4DF8A 2HIQA 5KG3A 3PEHA 1WC4A 4EU0A 1U2VA 1WBDA 1YJNS 3IG1A 1IKYB 4Q45A 4XDCA 1S1WA 3A8KA 3ZNJ1 3FRZA 2DPNA 1HFEL 3D0IE 4M45A 4LSNB 2Z56B 3K58A 3CFOA 3MM9A 4JB8B 5GAGP 2OEMA 3I8BA 2XS2A 5JICA 3ET6B 4MFBB 4FJGA 1M5HA 3IUCA 3R5GA 3JQMA 5LSRA 3SI8A 2QMUB 1LWEB 2V4JA 4CFCA 2XM3A 1SJ3P 2MKIA 3RRKA 4CHZA 4WFYA 5ETSA 1XMQK 1HX1A 3UR0A 1L3VA 4E1JA 4OJGA 4FBUA 4WU2A 3S41A 1YGYA 3K57A 3KK1A 2G0IA 4LIRA 3BQ1A 3ISZA 2P8IA 4K50A 2VOOA 3UDLA 4B9VA 1Y4ZB 1C0GA 3OYCA 1YITN 4DZ6A 5DDRC 1HJRA 3K2PA 4DUYJ 1UKUA 3EWGA 1YVNA 4WZMA 1KFDA 4JK9A 3IKMA 3TAMB 1J5EJ 3Q89A 1V4SA 3J80Y 3FVYA 1IKVB 5DDQC 1M1KO 2VB6A 1M1GA 1UETA 5CYQB 5HBMB 6AT1B 1Y3KA 5I3UB 2IJRA 1OQ6A 2JNJA 4LH4A 3NGIA 4O3QA 3ZZTA 1BXNA 3ELHA 5KFDA 4FW2A 3W5ZA 2E5HA 2UUCJ 3OTEA 2QX0A 3W63A 4JV5F 3AO1A 5E3RA 4OKKA 5EWGA 2JFKA 2HVIA 4Y28C 5J1NA 4O8UA 3HP6A 2WRMA 1HD0A 3MD3A 3FEXB 4OPJA 5BYSA 4FKYA 1SQGA 1VIXA 1ASUA 3OR2B 2IA6A 2FHMA 3WNHA 3I87A 2UUWA 1DHMA 4WE1A 1PJ6A 1RBAA 1AB8A 3MDFA 2XMJA 4ZVTB 4NCGA 3JSBA 5T14A 1IBMJ 5AQKA 1FDBA 3MMBB 1VYAA 3OTDA 4HT7A 5GMDA 4UY8O 4OYAA 4NX9A 2IM1A 1QVFR 4NZ7A 2Z1JA 5I3PA 2YKPA 4OZ2A 3DAWA 3F73A 4ETZA 1JLCB 1CS4B 3HVTA 5HMXA 3Q0AA 5B0CA 3AGKA 3O1LA 3SQ4A 3BZQA 3VAKA 2VU5A 1U48A 2I38A 1YI2S 3DRYA 3BJYA 3BF1A 3MTKA 1KVBA 1FE4A 2A5XA 3C6AA 3DNCA 4Z37A 1AYEA 4TY8A 4RZRA 3G4SS 1T6CA 1BUPA 3CFPA 1D9DA 1C1BB 1KBRA 1F0XA 4BDZA 4CZHA 3L95X 2ZGZA 2YKNA 1CJTA 1HWJA 4KYZA 1GFWB 3B8HA 2LKZA 4NA1A 4LRCA 4JV5K 4OV6A 5KFVA 4CJTA 5M1NA 3CCRS 4FM1A 3D68A 2UXDJ 2D5RA 1KKHA 1YTAA 1AXQA 1PBAA 1N0UA 4Z4IA 1RK8A 4H0YB 2LVWA 3U27A 3OYNA 4Y1CA 4LFAJ 1HNVB 3IO1A 2ZVIA 4M41A 2YH1A 2OTLN 1HHQA 4EUVA 3H1QA 3KNAA 2PN6A 2BJ8A 3AO4A 2EWSA 4AQYJ 3JS9A 4ZCLA 4CHOA 3PYDA 3Q7BA 2VV5A 1FXRA 5C15A 3CIZA 3CDUA 3AAQA 2ZH3A 3NF8A 1BQMA 3I0RB 4DQPA 3KKRA 3J81O 4DOZA 4CGDA 4HUEA 2OPSB 2DGXA 5EUHA 3ZO7A 4J9RA 2DBBA 1VSJA 4Q43A 4IWVA 3K0JA 2M4MA 1D3WA 2IAJA 1VSFA 3KG1A 3VHQA 1U6BA 1UWAA 2MQNA 1JQGA 4O3NA 2IMWP 3K8WA 1VRUA 3GFXA 5A6PA 1R8HA 2E5GA 4C8ZA 4FPIA 4PXDA 2NXEA 3AD7C 2N3LA 3KHYA 2QO3A 4J37A 4F0KA 4E7IA 3HDSA 4YDUC 2QT7A 2E1YA 3CC2S 3ZETA 1F1BB 3AB2B 3ILJA 5L38A 1M5KC 2EPIA 5K5MA 1I39A 3GDQA 3VGVA 3SZ2A 1OSDA 4F50A 1CEZA 2IDOA 2IVMA 4RW4B 1DKGD 2WAQD 2AP6A 5MLCV 3BKTA 2OA8A 2PA3A 4PQUB 1T0TV 2LMIA 4JYAK 4ZVUB 4ECYA 2VF3A 3DXSX 4CJFA 2E2PA 4DL0C 3FFIB 2EBGA 4E7HA 1G99A 3AVLA 4OYPA 4WFNL 4CEDA 3A13A 1OIAA 4ZMMA 1NSPA 4Z7YA 2CQ3A 3CCMS 3VAMA 3K9JA 4GKKJ 2GUPA 3CCLN 1WSGA 2EFPA 2KFNA 5AZJA 3UVJA 2OELA 3B4DA 2R8KA 2DR6A 4DTUA 1S77D 1NDKA 1N88A 2OI2A 3V6JA 3S1TA 4LFBK 4XIUA 1HARA 3D6TB 3M2UA 2GW8A 3UWTA 4J7CA 2HBJA 2UVWA 2L9DA 2V2ZA 3ZXWA 1KC8T 4DV2J 3BSAA 4FYXB 4DR2J 2GJ2A 4O5BA 2ZE2B 4M3RA 1Q16B 1TL5A 1ZBIA 4BG8A 4RWTA 2BM0A 1EQ0A 1FTCA 1HNIA 5DETA 4LD0A 1BE4A 1H38A 4CGJA 3IM8A 2RQCA 4FLUA 3SK3A 3FZKA 1SUQB 2V9WA 2ZJRL 5K9FA 4HWIA 5E3CA 1MWQA 2GZOA 1RT6A 3ULHA 4KHSA 1FWPA 4CHYA 4OZ5A 2XGPA 1BWEA 3T1YK 4DCHA 3G6VA 3NGRA 3JS6A 1S7IA 2E1CA 3CCJN 3CCQS 1G6BA 4CI6A 3BDEA 1FKOA 3VQ7A 1MROB 1D0EA 3K5MA 1R8BA 4HACB 2QXLA 5DK5A 5CXTA 4DUYK 5CZ2A 4LFCJ 1IBLJ 2VFSA 3T1AA 4AL6A 3KLEB 3EVOA 1SJ1A 3EX7B 2B4PA 2W7PA 3TSPA 4WFZA 3KWMA 4PL7A 1N36K 5IS2A 1U0HA 4C23A 1Z05A 2VUGA 4TU7A 4WFXA 1SQFA 4KHPJ 3N6NA 4PPZA 4FN5A 1YZ7A 1IWGA 3C6HA 4CLYA 1NPKA 5IWAF 3EN9A 3ATVA 4M5JA 3BEXA 5C10A 4XTTA 4IUFA 5GMKa 3H25A 1T03A 4K4TA 4KT0C 2XYGB 4B3SF 2AQ4A 3A8IA 4UOCA 1Q5YA 2PYJA 1NGHA 3OHAA 3L4QA 4PA1A 2BH1A 3BF4A 4CZMA 3SQGA 3VVTA 3O5BA 3SAGA 3QT6A 4A61A 3EY1A 3QIOA 2A2DA 2NYIA 4NXNF 2A0FB 2YQ0A 1H2UX 4OMFG 1UMJA 1RDCA 3GIRA 1JXVA 3MWBA 3CJCA 4IFEA 5JXSA 2EFVA 4X66K 2MHNA 1HNWF 1M1HA 3KK2A 1X0FA 4H5VA 2YNHB 1NGIA 3ZTSA 4ILLA 1WNEA 4JI0F 3DU5A 1W97L 4DUYF 5KGWA 4LF4J 3T1HJ 4WKYA 4HDHA 4WKRA 4E8UA 4HDGA 3RU0A 4CLLA 4UZCA 4JI3F 3PKMA 4IBNA 1XR6A 2SXLA 3DOKB 4QWBA 4F3TA 2QLBB 4K59A 4B9NA 2JWLA 3M4XA 3RZAA 2ZBRA 2YVSA 2BJ9A 4MLEA 3OTOK 2ABYA 1CQMA 4OZJA 4ANEA 3HJFA 4OZ1A 1HLWA 3VGSA 1R27B 4CGIA 3BYRA 2ASMA 4CH0S 2EFNA 3AD8C 3GR1A 3CHWA 3OA9A 4LF8F 4IOAQ 3CO0P 4JV5J 5CHCB 1XNQJ 3A5MC 4LF7J 4LFAF 3EZ5A 3EZUA 3PRDA 3SPZA 3OL8A 1L3KA 1TL7A 1N34F 4DQ8A 1RDRA 1EQMA 2AT1B 3LP0B 1FNOA 2RIJA 3CJ5A 1N5QA 2HSTA 1GX6A 3I5BA 2HIYA 3UD5A 2DYAA 1RABB 5A76A 4CIFA 4P7VA 5CZ1A 3TAFA 1OPIA 2BW2A 2BXJA 5E84A 3FLCO 3UI3A 2LDIA 1YJUA 2XCAA 2CVEA 5F2RA 2MPUA 1FNXH 1NB7A 5IXUA 4DR6K 3UKUB 3AFGA 1WWHA 4CJ5A 3MXHP 4QYRA 3CIPA 2DY4A 2FF3B 2W2OP 3AOCA 4FWQA 4GKJK 1UVIA 1WEYA 4KAZA 3OLAA 2E6MA 2D1CA 1FHTA 3VGTA 2RD5C 2YWKA 1RBVA 2ZKUA 3PRBA 3H2VE 2MXYA 4LF8J 2DR9A 5KG5A 1EZZB 3VVUA 4MAKA 3BV8A 3MM9B 2GTDA 1QDUB 2HMPA 1GAOA 1R0BG 3PDNA 3U1NA 2Y8YA 1UZDA 3KLFB 4CH1A 2KG1A 5C2GA 4H4OA 3SPYA 2GHPA 3RUBL 1FX4A 9ATCB 2BKNA 1HRHA 5LSLA 3KLIA 4OX7A 4O8KA 1IBCB 4DV1J 4FJHA 2HWTA 2QL5B 1SC1B 1HYSA 3NGYA 1WOOA 1DTTB 1LCUA 1B99A 2HS0A 5A6WA 1M5OC 1GTEA 1S1UB 1FRJA 3U1LA 4HTIA 1YHQN 2V0NA 3Q8QB 2E1PA 2RH3A 4QZVB 1WACA 1MG7A 1JKHA 4J9LA 3CDWA 3FEYB 4DTRA 2HK3A 2GIQA 2XMWA 1NMEB 1DQ8A 4FF3A 4L3NA 2B56A 4U9RA 1Z6RA 1UWBB 4EYHB 1U1OA 2DO0A 4W5OA 1B9DA 2GAGC 3NOGA 2QM1A 2FZCB 1U7LA 1GQEA 4ANCA 3UCZP 4OJ1A 2VPXB 1DJ0A 2FBYA 4NZ0A 2ZJQL 3VAGA 5IT9Y 2NCKL 3CCSN 2BE9B 1RGVA 1Y00A 3RBEA 1S6OA 4GO7X 3HT3A 3KLGA 1RILA 1WC5A 2ZZTA 4DL4A 1IJJA 4JK7A 3E66A 4RKUC 4B9QA 1NMNA 3DYAA 2D3UA 2AJ1A 1EX8A 1AUSL 2XLKA 1AT1B 4C11B 1V3ZA 3JB9k 2E7VA 1FEHA 3SUPA 2F8TA 2DGVA 3GYNA 3MMVA 2FDNA 4KAIA 4DCJB 5KFSA 3MEDA 3M8SA 5FROA 4FF4A 2ACYA 1TUVA 2EC0A 2LXUA 3CC7S 3CT9A 2Q31A 2W40A 2BJDA 2JH3A 4DV5F 3CMES 1NSQA 1HBNA 4Z4HA 3RMAA 2HVHA 1HLUA 3H20A 4U67L 3T9NA 3JSMB 3VZIA 4H4MB 3A8JA 5FDLA 3WXIA 1YBAA 4O0JA 2GFFA 4GV6A 1UJ5A 4BRFA 2A3ZA 4DR5J 1FRIA 4KRWA 5KFQA 4HVZA 5FJ4A 1H0HB 1YJWS 3NFAA 2KQ2A 3CTRA 3ZZRA 2W7OA 4QU6A 3IMQJ 1NHUA 3PO5A 3BPSP 4ID5B 1EKSA 2E1ZA 1BWFO 2HF3A 5AJ3K 3TTCA 4P9SA 1W0HA 3OT9A 2EKYA 2HHHF 4JV0A 2Z1HA 2G8HA 2UVUA 4LF9K 2CH6A 1YX2A 5BYRA 3BO2A 4YR2A 4DR7J 2V7YA 3PV8A 3CDBA 4KTZA 4KIAA 2Z2LA 4FM2A 4F04B 1TGOA 3HSZA 3GG0A 3LGHA 2DH7A 4LR9A 2UXCK 2XHCA 2XZDB 1HNZF 3MCSA 3KJVB 1RBSA 1WG5A 2CXEA 4FXVA 2XS5A 5AQMA 1VRQC 3OY9A 2CPZA 4KO0A 1TMJA 2HNZA 4FLXA 2FJDB 2CIMA 3IR7B 1LKZA 1BHLA 4N47A 2E9RX 1KQSM 2Y1IA 2DRAA 1T05A 4B9SA 5B0EA 2QG9B 3ILOA 3P49B 5KPRA 3IAM9 1SC6A 1A5XA 3MXIA 1HKBA 5KTQA 2MKCA 3SMZA 2XYPB 4YMEA 3DCAA 1WUAA 3I55N 2ASJA 1YRUA 1VQ8N 1KP6A 2O1PA 2IJNA 4PG8A 4LF6K 2AYMA 2KHDA 5HMYA 1VQ5N 2B8PA 2V50A 4A4JA 1S3XA 2YNGA 2ALZA 3CUNA 5B0GA 2OHDA 1UVLA 2HGNA 4H5TA 3T5KA 4MO4A 2R2TA 2A2CA 1OY6A 4N7TA 1WF1A 3MCPA 5ADXA 5CE3A 3NCRA 5C24A 4LFBF 1VRUB 3VQSA 1WHWA 4ES3A 4X65F 3CJ7A 2RHQB 2CQ1A 1LQ9A 4EGLA 1TK5A 1X60A 2QRRA 3MPWA 1OYDA 1H72C 4DN9A 4KFBB 3EGZA 3IBFB 1R59O 3ZZYA 2BDPA 4CP5A 3BZCA 4PUOA 3MCNA 2WW4A 3CCTA 1XNQF 3M6XA 1QD1A 4CFBA 1ZM9A 4KBIA 2VFVA 1R0AB 3O3FA 4IDHA 3H3NO 1U2CA 4LF5J 4GVEA 4OPKA 3QFWA 1YI2N 2DNQA 4B3TK 4QIFA 2UXDK 4F4KA 3ZSYA 1QM9A 1JXBA 2O8EB 3QJJA 1RWMB 3PRVA 1HNWJ 1ZZFA 2BQRA 2MMYA 2NNWA 1O8BA 2CWXA 5EXWA 1AA1B 4LY7A 4YOWA 1FK9A 1S5ZA 2K1RB 1BIZA 2RNEA 3TYTA 1RUSA 4Q44A 4JI3J 3CQYA 4A8MP 2P9UA 2MGZA 5KFZA 4YB6A 1ICEB 2J9EA 3HZGA 3THPA 4LF6J 2R7VA 3NCPA 3VQEA 3THXA 3OL9A 1JLGB 2GA7A 3DXKA 2GUIA 1YTYA 1TL4A 1QUVA 3TZXA 2AJ2A 1W2BR 4LSZB 1XK8A 2HZVA 2OSQA 4K2XA 5D0RA 1T9XA 2D74B 2ZDOA 1TVRA 2XULA 1N36F 1DRZA 2J8SA 3NGTA 4H0VB 3CI5A 2VA3A 4FNHA 5DZ7A 2X3DA 1RI7A 4ZVGA 3GIIA 4ZHRA 1U1RA 3D2FB 1VQ4N 5AQGA 1BISA 5KRSA 1OVYA 1XNRF 1JCEA 3OR1B 4PKIA 2WB1D 3ENWA 2ZGYA 3GE9A 4BC5A 4AF1A 1T11A 4DF4A 2KHCA 2DCUB 1YLXA 1YIJN 4EBDA 3DRRB 1AFIA 1RT6B 2LQBA 2XSJA 5BPLA 1NXIA 3S3MA 2IYIA 4WK1A 3IFEA 4CK2A 3U6FA 1VQLN 7FDRA 3TQ1A 2PO4A 5L9XA 3OYJA 3V2UC 1VQPS 2CGKA 4I2QA 1JLQA 3J81Y 3HKWA 4DN0A 2W41A 1RT1A 2FLPA 3O9SA 3THVA 4QU7A 3KHLA 3VALA 2VQFF 2EG2A 1S0MA 1NM2A 4Z4EA 3O8WA 4ECZA 2L41A 3H59A 4J2EA 4W90B 3H8YA 4GC6A 1NBEB 2F9WA 2GBZA 3FRYA 2CPIA 2BA9A 1NOYA 4P73A 3QBXA 3FGVA 2B9WA 5DQGA 1JLAB 4E19A 1F60B 4ZITA 4M7YA 4BRNA 1SKWA 3ZX0A 3DN9A 2I6WA 4CJRA 3MM7A 2C2DA 2DEJA 2LXIA 3J80U 2DD8S 2UUCK 1YQHA 1NM1A 3CYMA 4KGVB 3MR3A 3CCWA 4CLSA 4GV3A 4OHYA 1C0UB 2YH0A 3Q23A 3P5TL 1HMVA 3D1QA 2G8VA 1T03B 2H5IB 2EK6A 4FJLA 1ATRA 3IAYA 3Q2SC 1NKCA 4DTJA 3B6OA 4I6WA 5C2CA 4BR5A 1YVUA 3CJ0A 2PYLA 5BR8F 2BYCA 2JGUA 4B1VA 1ROFA 2VBWA 3TAPA 2O8FA 1WN7A 2VQFJ 2Y8WA 3TEGA 1WTBA 3D7SB 1F9HA 1WUUA 5AXNA 1RT5B 2VPWB 3C3LA 1H73A 2O5DA 2UYTA 2L9WA 4CZCA 5HP1A 3MECB 3FSXA 2JHEA 4HVJA 3D4JA 2HQIA 4ZPDA 1KVJA 2X3GA 3QGHA 1G7CB 5CZXA 2FUG9 2VICA 2UUBJ 1EP4A 4X4OA 3PACA 2G4BA 3GYXB 2GJIA 2FD2A 2NZTA 4P2MA 3N6MA 2ZVSA 2CPHA 3DM2A 4F3MA 1ILYA 2EFOA 4FWSA 2D0AA 3JXOA 2Q97A 1RWXB 2DRDA 3H40A 3N28A 4RNHA 5GVQA 2OPPB 1U26A 2CFXA 1TL1A 2EFGA 4EWTA 1HYVA 1BI4B 3O4QA 4MYTA 3TA2A 3DXBA 2VPZB 3N5FA 4TKTA 3B4MA 2A6OA 4UT4A 4LMZA 3U7JA 1C6VA 5AQYA 4EO6A 4PG4A 2A42A 4QIWD 2QSWA 4TNOA 1QVFM 4IEIA 4CO4A 2AJ0A 3UB5A 2LFVA 3OTCA 3QERA 2DXFA 3UNGC 2Q43A 4ZPWR 3L3CA 1K47A 4I6MB 4NEYA 3HI0A 3KNGA 4B3OB 2POKA 1RBOB 4LFCK 1RBTA 2ZHOA 4FS2A 1UFWA 4JKDA 4L73A 4U7UD 4FLTA 2F1FA 2E88A 4DQSA 3FNNA 2P6TA 2L3MA 2BEFA 3W2VB 3FFKB 4AL5A 1DFDA 2OJ3A 3BR8A 4PCQA 3LL3A 3IWXA 4AH9A 4E1NA 3Q86A 2W9CA 1WC3A 4TYBA 3IR5B 2DGQA 1KD1O 1CJUB 3A3PB 4HH0A 4IO9Q 2NZCA 2EWHA 1GTHA 2GS8A 2W2MP 4DFPA 4K4ZA 2CPEA 1K8AT 4ILHA 3IM9A 1KFSA 3PW4A 1BA1A 5M2UA 5J2PA 2J4RA 4U8YA 5C5JA 2YTCA 3H2LA 4YFUA 2A41A 3KUGA 2B9YA 3RW7A 2MQMA 4GKKF 3UD4P 3M1VB 4QYZK 2YKAA 4BACA 2QWRA 1UJ4A 1RWNB 3G71N 5CAAA 4LRFA 2KL8A 3DLBA 4ED5A 1S9GB 3OW2M 1C4AA 5DDPC 3N4PA 2AZ1A 1VK0A 1B0PA 1REVB 4M5DB 4QWEA 3NF7A 3QESA 1OWXA 5KFEA 4X65J 2J6TA 2A6AA 5AJ3J 2FF6A 4HUFA 5IM0B 3J81U 3CVKA 3SSRA 3VEZA 3Q2TC 1UWBA 3WHIA 1FJGK 3MD1A 1SS6A 4HCBA 5D4LA 2V8PA 2VD3A 2PFFB 4CJWA 3AA4A 1N56A 5JVGL 1U2RA 5HRPA 1UP1A 4CLTA 3D28A 4DL5A 2X1FA 2XHWA 4NE9C 2F8MA 1WC1A 3P96A 3W64A 4Y6IA 1MMNA 1Q9YA 4M63C 5D8HB 2Q36A 3TQEA 2R2SA 2K2PA 4KHMA 4YHHF 4HCCA 1NJZA 2RDIA 3LA0A 2GC8A 1RT4B 1D9FA 3TWZA 1W25A 2M70A 2DNPA 3A2FA 2PC6A 4JS5A 5G4DA 4DS4A 3TAQA 1VAZA 5KG4A 3N5BA 5HRRA 3UR3C 3HM8A 1S10A 2QKBA 3SJHA 4X62J 2ZM6J 4TSXA 3BM7A 3TVZA 3A8YA 1TUWA 3QQCD 3F56A 4CT9A 5KFAA 3JSMA 4C8NA 3M8QA 2VJUA 5FDLB 2ZZNA 4FW1A 3VEVA 1X9SA 4ZS6A 4ZN1A 1YZ6A 1ZM3A 2MKYA 4QIEA 4DV7J 4I7FB 1GH8A 4I4BA 4IFYB 2HFVA 1YJWN 5KPTA 5DLGA 2C1EB 4C6AA 3JYTB 2Z2ZA 2HBYB 1Y5NB 1NAQA 5FLXO 3ZZZA 1TKZA 3THYA 2YBVA 1S22A 4W5NA 4FYVB 2GCFA 5B0BA 5RUBA 3M9OB 4DV4K 4P2FA 2RUSA 5JS1A 3CQ8A 5EU7A 2XI3A 3AVMA 1HBOB 3GCXP 3ADAC 3TO8A 1RWWB 1BUXA 2HQGA 3CWJA 4BRMA 3I5AA 1RAAB 3N01A 1X9JA 2C3UA 1NH8A 3UQSA 4FWNA 3BGLA 2P51A 2EI5A 4BVPA 2XY5A 2GIFA 2GVZB 1T05B 4UY8T 4MKBA 3MHYA 3NBPB 3NWGA 4Z2XA 5AQHA 3T1HF 3FC9A 3ICLA 2Q6BA 4CTAA 1F5BA 4JAXA 4J9VA 2KFZA 4HTLA 3UDVA 4DTOA 1S72N 1RDAA 5DM6Q 3TSUA 2RVJA 4KPYA 4RW6A 3H90A 4NRTA 3QB0A 4Y0FA 2OTJN 3K7RA 3QIPB 3DLLL 2FVCA 1S6PA 2OPQA 2KT3A 2IPOB 3EDQB 4KBOA 1UVMA 4BY9C 5KQDA 2BRLA 1XR7A 3VAJA 4YP3A 2GMJA 2QFJA 3QPIA 4XH1A 3D3CJ 3UN5A 4DUZJ 3RRGA 1Q9XA 2GGPA 5BR8J 1IKXB 3I96A 5CYJA 2JVOA 1BC6A 1RAEB 4JI2F 2VFRA 4M42A 4AUKA 1RWOB 1Y10A 2RDDA 1N5YB 4NLOA 2O8CA 2F4VK 3M8PA 2KYXA 1YBUA 5DGAA 3VCDA 5AQFA 1DAXA 4GMJB 2YNFB 4H8KA 4J9SA 5D15A 4KHWA 3IBCB 2UUBF 3KD1E 4LSNA 3SCXA 4P2SA 2Z8QA 2Y1JA 2BGGA 4IKAA 4QWDA 3UIQA 3S7RA 1FK9B 1U45A 2R7TA 4DTNA 3NF9A 3CC7N 2ZH7A 3LP2B 4UUWA 4EZ6A 1TQLA 5EX0A 4DUZF 1LWEA 2V4JB 4ER8A 3RR8A 2WTUA 2CH5A 1U1MA 1FVSA 4KKOB 3P39A 2BE7D 4ZDNA 2CQCA 4O3PA 3VGLA 3ENHA 1G1XA 2UUAK 5A8RB 4CNZA 1GX5A 3RVCA 2I2YA 3G96A 2B4UA 3HL8A 3O4WA 4QWCA 3BBBA 3W5XA 4CEEA 3TWHA 1VQ4S 1O1WA 4MO5A 7FD1A 4DPWA 2XBPA 3ZSXA 4CFAA 1KEKA 4ILMA 4FVMA 3E8OA 3CJKA 4FXDA 1IJEB 5THWA 2JWKA 3OVBA 1U1QA 4AM6A 4AQYF 3SEOA 3NXZA 3DI6A 3CCZA 4L3KA 5CYQA 5HBMA 5M2PA 1E6YA 3MCMA 3SQ1A 4ZCMA 1RTDB 4FK0A 1TP7A 4QJVA 1X0PA 4ZP9A 3M30B 2R8GA 2OP5A 1RTZA 4JKAA 1JLQB 1HR0F 5ADXH 2HW3A 5DQHA 4O44A 3QWPA 2R7XA 2GQCA 1K73T 2MSSA 1NG9A 1ASWA 4NB4A 3D66A 4OFZA 4FBTA 1VHXA 5GIPA 4DX5A 1Z2LA 3H3OB 3SI6A 4IG3A 3AA3A 2DO4A 4GVBB 4CCHA 4NASA 4ZP7A 5H9FJ 2EHGA 6FD1A 2YQ3A 2PDAA 3L2WA 5F8IA 3SBTA 3ZZUA 3MM7B 3C95A 1VQ5S 4NA3A 3TARA 3HP9A 1GK8A 2OD4A 3BSNA 3M05A 3FSIA 3BB5A 2HWIA 1P8GA 3MURP 3KUEA 4AT1B 5KFKA 1FFGB 1NGCA 2BZ2A 4AHVA 2BE2B 5JJBA 3DGPA 3JQJA 4DR5F 1U04A 4V19X 3QSIA 2HNDA 3PNIA 4ED8A 2MZQA 2W2NP 1QAXA 4OZLA 2E5LF 2XNQA 3ZT0A 1UPMB 4MMOA 5F8HA 2ZBCA 4X2BA 2FBTA 1JLEB 1RYSA 1X5PA 4QIGA 2E1MC 1VHFA 2H51B 2A40A 1RT5A 1NBWA 4ED3A 1RT2B 3O1WA 3MX2A 5I4MA 3JAMO 4FP9A 5EN1A 2OIHA 4IRDA 2QMWA 3L3VA 3MF5A 3MMJA 4GVMA 5AE3A 3E2EA 4DR1K 2O8DA 1MWZA 3ZT1A 1EP4B 3ZSWA 2PMHA 3BYPA 4M63A 4JKGA 4LF9J 2CPJA 1RHQB 2C2ZB 5ETNA 2VCPA 5LJVA 3M2RB 1K0VA 2ADCA 2OMOA 3DM2B 1URNA 5IT0A 2CQIA 1ZAXA 4CGHA 2NRTA 2BVZA 2FC8A 2ZM6K 4F02A 1XQSC 3BZKA 3SNNA 4USMA 2L08A 5ETOA 4IO9L 3LO3A 4DSFA 3VF6A 2J76E 5KFUA 3U9DA 4NLWA 4NO7A 1A7GE 1BI4A 4B1UB 4C8MA 3G0ZA 1OH5A 4KGMA 1HJOA 1R8PA 2P9PA 4RLEA 3R8YA 3D6HB 2GVDB 4FPRA 2GJFA 1JX4A 2HHXA 5IT9U 5JLHA 4OI0A 5DZ6A 1X4DA 4B3RK 2OGUA 2V67A 1IWAA 3WZ0A 4FF2A 1PC4A 1O6XA 2AW0A 3CMEN 5E3AA 3JXUA 4CWBA 4CZFA 1C0FA 4I2PB 1N33F 4NLCA 5D0GA 2KVIA 3MR6A 3G87A 4AHTA 1S4FA 4IFVB 1LW2B 3UDEA 1HPMA 1FJGJ 3TAMA 4I6MA 2O8BB 1S9FA 1BCOA 1RAFB 1IKVA 2G8IA 2YWEA 2LA6A 1NDCA 1KHVA 5I3UA 2ROPA 3GV8B 4NI2A 2HF4A 2DTJA 1KAYA 1EARA 3PZPA 2MHEA 3WC2A 2DNZA 4PQUA 4MT1A 5LMUK 5LT5A 4U7UK 2QMXA 2V68A 3KK3A 4CZJA 4QOZB 4N41A 3AARA 3OXFA 2V52B 1S4EA 2JEJA 2V5HG 5HROB 3ZTRA 3L2UA 5DS7A 5KG6A 2CA9A 4KB0A 4A8KA 1SZ2A 3K2YA 1NNDA 2NQPA 4FO0A 2QZ8A 4NLRA 1VQ7S 1K1SA 4J9UE 1VSHA 2FXUA 4CZEA 5DG9A 4I6YA 1JJ4A 3KFWX 3U02A 5AQOA 1JXLA 4Z4GA 2RE1A 2RB7A 4FJ7A 3Q8RB 1KLMB 3LPYA 2AJFE 4DV4J 2H54B 1IR0A 2VG6B 1FX2A 5EWFA 1VS3A 5GMEA 2CG4A 4CJ3A 2XMVA 2VC0A 1LK7A 3L8BA 1REVA 1NRKA 2V34A 1N33K 5D0HA 4FWRA 5LY3A 1XERA 4MH8A 2F5GA 2ROEA 4KJIA 3C16A 2CZ9A 2DNNA 2V8DA 2HFZA 1ZPWX 5FLXY 1LW0B 4EBCA 3MUVP 3M6VA 3P3DA 2W9AA 2RRBA 3IAS9 4GKKK 3PO4A 5EGYA 1B4SA 4PKDB 2NUHA 2R7RA 1N32K 2R7YA 3NH1A 3CCUN 4PKHA 2RE2A 4FJXA 1D4XA 3B6PA 1REGX 2X6SA 1CSJA 4Y65A 5E7OB 1VR6A 3J7YU 5JS2A 4BROA 3ZT2A 2B6AB 5B0AA 5M1FA 3PXGa 4KHQA 3O3HA 1X7VA 4JYAJ 2XNRA 1I1GA 5KT5A 4DV6F 1FXXA 2CQ2A 3W1YC 3ETMA 1PYOB 2FZKB 1JNZB 4O55A 3DLRA 1QAJA 1Q86T 1NWKA 2QEXN 2MJUA 3MCOA 2KZMA 3SMPA 4DU4A 2H3EB 4FJNA 1VDHA 4JI0K 4WZQA 1SJFA 2I7NA 1O0PA 1UZHA 4MQ3A 4FWLA 1VIOA 3HD2A 1VHIA 2VYPA 4Q0BB 4D3HA 5AR0A 2LEBA 3KHRA 4BLGA 1H7XA 1Q8BA 1R6YA 3VV2B 2BJ7A 3RSEB 1TFWA 1YK9A 2H4WB 3E51A 4WPAA 2F7VA 2Z57B 1KWMA 1CZ9A 3BPDA 5HRNA 1PJ7A 4AHSA 1RU1A 4NLUA 1NOZA 1U0SA 1JLBB 1NGDA 1SJQA 1Z25A 2JEIA 3W8PA 4LF4F 3JYTA 3CC2N 3CD5A 2VGMA 3IRWP 1X3NA 2QA4N 3NG8A 2IVOA 4GW6A 2J6UA 4M5LA 5FPMA 2GMHA 2HHPA 4P75A 2DK2A 1UFLA 4UQTA 4IO1A 4J9KA 2HHUA 2R7UA 1S99A 3GCWP 2YNHA 3HX9A 4Q2MA 3K0SA 1FF2A 3LGMA 4YOXA 1R89A 2BJEA 4MKYA 2KB2A 4BRLA 4K4YA 2HG4A 4M1KA 2ZOMA 1IUJA 4BS2A 3W5YA 2HHSA 4BRPA 4KTWA 2C28A 5CQGA 4J9PA 2N7CA 1VBZA 1NK8A 3OVAA 5HJYA 4CEAA 4TXSA 1SKRA 1YJ7A 4AFFA 3R6LB 4P71A 3GBTA 3U3GA 2CQGA 4ZP6A 4BDYA 2JL9A 2P9IB 2BANB 5KG2A 4ZVRB 2RUGA 3ZZPA 1LFWA 3SQ0A 2IRYA 2NXCA 1RBLA 4BRHA 4ZTFA 1X31C 1B70B 1GLJO 4OQJA 1XMOJ 3J8AA 3ZEUA 1JCGA 2K3IA 5HLFB 2CJBA 4WWSA 2A1SA 3F44A 2G2OA 5LMNK 2EFQA 4NXMF 2H9ZA 1YWXA 2DTUA 2FJVA 1MA9B 2R2UA 5DQIA 1HNIB 5J2NA 2MKKA 2E29A 2PMZD 2FHKA 4OYXA 5D6GA 2ZF5O 5KT4A 4NYPA 4A8QA 3VQ8A 3TTFA 3DOMA 4DPTA 3PFOA 5KFFA 4A8FA 1T9VA 2M9KA 3I9ZA 1YKWA 1FRXA 5GADI 4KHRA 4DPUA 2XMMA 4A8YA 4KRFA 3HXMA 4DR1J 2VASA 2UU9J 1N5YA 4NYZA 5AZIA 1QQNA 2YX6A 1SH3A 5GAHI 4JI4F 3PSFA 1QHAA 1FKOB 2FHOB 3SMSA 3QJPA 4AQYK 2YX4A 3T5JA 1FXDA 3CJBA 2ZDPA 3EMTA 5KG1A 1BHNA 4CF9A 3KKFA 3PIPL 4ICLB 4X66F 5T7LB 2VH7A 2CRLA 4RW8B 1S1VB 2P9GA 3GIKA 2W01A 4X4NA 4WJBA 1KLNA 1WEXA 1LXJA 1IQZA 3R5CA 4NLYA 5T41A 2HHHJ 3LP2A 1JLFB 1U0HB 1ZBSA 1IH7A 1I6JA 5J2QA 3MAHA 3NGUA 2U1AA 3NGZA 3A12A 3NAEA 3TUIC 2M0GB 2ZC4A 2RSQA 5L9NA 1ZTTA 3K5LA 1UFKA 2DGUA 3AV9A 4N8NA 4WK3A 1HWKA 2LECA 1S59A 4F3QA 1VSEA 4L8RB 4KR0B 4IKFA 3CJQA 4XO0A 3ITHB 1R3NA 4C98A 5F41A 2PY5A 3AGRA 2J0QD 4YN3B 3SQGB 1VC5A 1YJVA 1N34K 5HN0A 3HPHA 2FJEB 2ZWOA 1F21A 3EJMA 3SSSA 3MMAA 3SQ2A 3VF0B 1XEZA 1PGZA 1FD8A 3V5RA 1KVAA 3QZ8A 1HHSA 4K8ZA 3OBWA 4USIA 3KLGB 2IDEA 1E6YB 3MUTP 4C0HA 2E44A 3WEEB 1XTZA 2RDJA 2FLNA 4NCAA 2MLZA 5IWAJ 3KK2B 4DR6F 4ID8A 3DYAB 2E2QA 2QKKA 4C11A 1N33J 3NCQA 4CBWA 4QOTA 1HYZA 3WXKA 3GG1A 3EGVA 1M5SA 4AHCA 2HLUA 2YWHA 3AOAA 4FZZA 3OFFA 2H48B 3T1YJ 2HRYA 4C8YA 1YJ9S 3DOKA 3G25A 3MN5A 3BSCA 2P9LB 3U3YA 3MEGB 3TAEA 4LBPA 4LRAA 4GKJJ 2ADBA 4USUA 3ISND 4G65A 3JTOA 1DLOB 2IFXA 2AU0A 1HR0K 4X62K 3GB0A 3QAUA 3QT7A 2PI5A 1TL7B 3GPAA 2DHXA 2DITA 2GEMA 3DLGA 2V4QA 3LP0A 3KLHB 4PWDA 5DLFA 2NXUA 2BE2A 1NZ8A 2PA8D 1P9QC 4BRCA 4GO5X 4MJKA 2I7PA 2CPYA 3SAFA 1LWCB 4R0EA 2ASPA 1J5EF 3G6ES 5EDWA 2Z1IA 3PM9A 1N54B 3UE2A 5G0RB 1P1TA 1JLEA 2B9EA 5H9EJ 5KFTA 4WYLA 4DTPA 3BH6B 5B08A 1KQSR 1IN0A 4ECSA 2UXBK 3UKUA 4N77A 4XK8C 1HPZA 2FTRA 1CJKA 5JVHQ 3JTPA 3PJWA 3HO1A 4DCPB 1SV5A 1PAUB 3X3UA 1M5VC 3EUNA 2V6AA 1KAZA 1FERA 1VSIA 4OZ3A 2QXFA 4DR5K 1GLLO 4KO0B 4C97A 2CQDA 2HNZB 2QWQA 2CZ4A 2AYEA 1UAWA 2BACA 4YDUA 2B43A 3C2PA 5E5NA 3EE8A 1A5VA 3F9MA 3QSYB 7AT1B 4AD6A 5CD4A 2VODA 3O6QA 2E1RA 3OS1A 1XIQA 3ZT3A 3OFHA 4LJMA 2DPIA 3KOAA 3PIOL 4OVLA 1HYSB 2BMBA 2RN2A 1C2PA 3LPEA 2B0GA 4FS1A 2GVDA 3IGNA 3OVSA 3M6GA 1EWQA 1Z2ZA 1KRPA 4E7JA 3F2KA 1S1UA 2YV0X 4OO1J 5I9EB 4LR7A 5BRDA 1UCNA 1WHVA 2JLEA 3KJNB 2E2NA 3MAQA 1KDNA 2GO9A 1JKHB 5LJWA 2M88A 4DFKA 4W98A 3E3XA 4JHDB 4CK1A 3OBYA 1H74A 2ATLA 3QINA 4D3GA 4URQU 3HOSA 3VERA 4FNIA 1QLNA 4U96A 5CCMA 3O08A 1NK7A 1NZAA 4KFBA 3AVFA 5FIIA 2CNLB 1U02A 2CZVC 4JI2J 4OI1A 2U2FA 1Q8IA 4HTJA 2ZJPQ 1AUDA 1H2VZ 4HYKA 3FUYA 4USVA 1HWIA 4NI2B 2O67A 2H3GX 2Q79A 4RL1A 5E33A 3KTQA 3ZT4A 2VKRA 1JMTA 4W92B 3U8XA 2WVDA 3NVMA 3IP0A 3RMBA 4DV0K 1CC8A 3HHEA 4C1NI 1H98A 1HW8A 1SIZA 2CJAA 3KXDA 2R42A 4GNIA 3SBGA 4M5MA 1FRKA 5DO2A 2GQ2A 1P9YA 4IYQA 1HBNB 2QI2A 2HQCA 3Q83A 2WK4A 5C25B 1SB6A 2DNHA 3J7AN 2W6KA 4IH5A 3HI9A 4E89A 1ZXOA 4O0IA 1J2VA 5LMUF 4FJ5A 2V69A 4H03B 3CCVN 2VG6A 3PIPQ 4TQRA 5AQIA 3O2IA 3RAXA 3R9PA 1CJVB 3MN9A 1I94F 5TKWA 1FKPA 5LOQA 1F3VA 1ZBTA 1E6VA 2MQQA 1YITS 4WP3A 2L9NA 4ZLLA 1O5JA 4F8RA 1T3OA 4R5PB 4I1TA 1QE1A 1UTAA 3LP1A 4PG7A 3BQ0A 2WVCA 3KUHA 4N76A 3V81B 1WF0A 1SQEA 1NLKL 5A8KA 4K5SA 3VAFA 2V8GA 2LSNA 4W4MA 4X84A 3G8SA 3CJTA 4CBUA 3DKDA 4NLGA 1BL3A 3LAMA 4M5KA 3ZSQA 1WSHA 2NR0A 4LT6A 2DNYA 5F1XA 3KJVA 4PWWA 2KN4A 4ISFA 1NB2A 1FJEB 2RQ4A 2P9NB 4ELUA 1Q81O 2PSZA 1VC6A 2DGSA 2RU9A 2UXDF 2Z2MA 2UZAA 3R1LA 4YY3K 3V9XA 3TP2A 2DHSA 1VQON 3QMLA 3CCQN 2ATCB 2CQPA 1SCJB 3N4QA 1GLAG 2X1GA 1B0VA 4C9DA 1LAWA 2XMAA 4KHUA 2ASYA 3D9BA 1RTHB 3D54A 3R7NB 2HSEB 3I55S 1TYQA 1VQKS 4USWA 1BQXA 1G3OA 2NPIA 3OJSA 1NKBA 2HBQB 2UXCF 5E2QA 3DOLB 2HBRB 4M5GA 3V9SA 1VQ7N 2DHHA 2COLA 3TRGA 3LUYA 3NS6A 5EHHA 4BRDA 2B51A 3VQPA 1HQUA 3ONQA 4PXBA 1RT7B 1I3OB 1HKCA 1VRTB 1RQ0A 3WX8A 3TTDA 4ES1A 3E9LA 4PXCA 2IBOA 5JLFA 4HT5A 4F2RA 3TR8A 4KH1B 2LXFA 1NGEA 4YOVA 2D0PA 3VESA 1P6TA 3CPWR 4KI6A 4GKJF 3VA3A 1WOSA 4DQIA 2UUBK 4Y2CA 1ZM2A 3W2WA 4K25A 4LF7K 2HK2A 4IR1A 3EVWA 3G4SN 2A3JA 8ATCB 2BTFA 2DEIA 1U2VB 4O4GB 1GMWA 1LOUA 2QTDA 4HHTA 4ECXA 3IGVA 3P4IA 1IKYA 1TK8A 2HVZA 1K8AO 5I42B 1X4EA 4KB7A 4KI4A 4DUZK 2ZH8A 3PY8A 2RS2A 3ZZ0A 3IWLA 2P9EA 1S1TA 5K8PA 3KLVA 2UXCJ 2G0CA 3S3OA 1TU0B 1U47A 2YNIA 1SH2A 4LH5A 4BR9A 1I5OB 5GAHP 3NCIA 5KFRA 1KQKA 2P9UB 4MYUA 2JEGA 3MWPA 4K41A 2HURA 1URRA 4RU9A 1XMBA 4JD2B 3CCEN 3THXB 3C14B 1JLGA 4OL8A 1EAYC 4RUBA 1EKRA 4YDXA 3ISNC 3LTOA 2Y3YA 3LPUA 2QEXS 4LF5F 3GILA 4NXNK 2P5VA 1NPPA 1WSIA 2VFTA 3PEJA 4K4VA 1N5VA 4OJ3A 5HRSA 4UOFA 2FGOA 4H4KC 2HWHA 1FNMA 3W66A 1LK5A 1IBKK 3GSIA 4Q5VA 4LBHA 4DQRA 3O5TB 4ECUA 1ATSA 2NXNA 4JI1K 4IRCA 1KCFA 4KTQA 2K7JA 2IVPA 2E4LA 4JEPA 4LF7F 1C0MA 2F8HA 1Q82T 3DHWC 2FY8A 3K9KA 5EOYA 1S6UA 3P1GA 2O4GA 2K8GA 5ETQA 3ZC4A 5KFOA 5AZIB 1RHJB 4LR8A 4DV3K 2CJXB 3I0SB 4AILC 1X5OA 5LMNF 5B09A 1S1XB 5ETTA 3NWRA 3DDNA 2HMIB 3IS9B 4EEYA 3HK2A 2VKZG 2AMCB 2BBEA 4ZVEA 3AJDA 4RTFD 4ICLA 3JSRA 1IBLF 1XNRJ 4C8OA 1PC5A 9RUBA 4I56A 2E6LA 2A1BA 3HPGA 5F0XA 3JAMU 4X4SA 2F63A 1GMUA 4MIWA 1TMMA 2KT2A 3P83D 4QR0A 3WC0A 3EXCX 2G8FA 1VQMS 5B7WA 1Q8KA 2E5LK 3ID8A 1U25A 4JI1J 3GTYX 2ASLA 2JRSA 1RBRA 3OYLA 4RPFA 4CF0A 1K1QA 5ELZA 1N48A 4ECQA 4DR4J 3SJJA 4WCEL 3EZOA 1FD2A 4CLZA 1HNXK 3DJCA 4IG0B 4F4YA 3FDSA 4JI8K 4TLQA 3FBEA 1NU0A 4HHHA 2AEFA 3S01A 2CPFA 5IM0A 3TJ8A 2XLJA 2C2MB 4PXEA 4DR3K 1KOOA 4TY8B 1HWUA 2VWJA 3HD1A 2VC1A 3AA5X 5K8MA 3OYKA 3T5HA 1CJTB 3R2DJ 2KFYA 2KM8B 3QICA 1Y0HA 3MGJA 3IMXA 2D0CA 3HFZB 3NHGA 2CADA 1N6QB 1S6QB 3RB0A 1PJ5A 5D0EA 2ZH6A 3KG0A 3GV7B 4YOUA 1OH8A 2CNNB 2LQ8A 3MM6B 1HNVA 1OS5A 3WBZA 2BOAA 3ZCMA 1LNQA 1ZAWA 3KMQA 1GXLA 4DV6J 1Q82O 3M6UA 2J7WA 1BO5O 5K20B 1V5IB 4FK2A 1SPBP 4NA2A 1CULB 3P5JA 3FEZA 1BQMB 1V9OA 3MEGA 1PG5B 2VDIA 3I0RA 1FESA 3ASMA 3AO5A 3I4HX 1FEEA 3NAIA 3M8QB 4DB3A 3I32A 1MNEA 3UW1A 4TU9A 4KV8A 2C2RA 1WSFA 4U6PA 2JDJA 1RISA 3EICA 2BR0A 4E98A 3DMJA 1AROP 4DSIA 1S57A 1RADB 2CQ0A 3CE8A 4I67A 3TX0A 4JNEA 4RWXA 1RT3A 5D78A 4ERDA 3L3UA 5DM6L 2HAIA 3QGPA 3D7EO 4V19S 1RKIA 2GHVC 5KT6A 5E3QA 4B3OA 4DR3F 1H1VA 5BREA 4CEFA 3BH7B 2WONA 3R7SB 2FYXA 4AL7A 2XB2D 5KFJA 2G8UA 2YCHA 4C3MA 2QL9B 1GT8A 3NS5A 2NLWA 2HEKA 3D67A 3I4PA 4YR0A 1HR0J 1NJYA 2ZJPL 2G1HA 3EKUA 4EZ9A 1VC0A 1NGJA 3MFHA 3CJ8A 3PTWA 4KY3A 2ASOA 2ZJRQ 4PY5A 1C1AA 1HBUA 2LA4A 4U95A 2YY3A 1I51B 2KI2A 5DM7L 4LFAK 1VQ9N 3ZX2A 3BDPA 3O9UA 2GVZA 4AYBD 3M9MB 3CXCR 4Z4FA 4CJSA 2WHOA 3SLCA 1GXUA 1Q95G 4CZKA 3NNHA 1KXPA 2BJ3A 3CJRA 4CLUA 1KTVA 4OZNA 1M5PC 3TVYA 2ZZMA 1QQOA 3MPUB 2NRWA 1YBTA 4NLPA 3LDLA 5A2QO 3TEHB 4ZJQA 2VQEK 2HBZB 2FBXA 2UU9K 1RCOB 2FSKA 2J5AA 2IVYA 4K5RA 2C3PA 1TL3A 4OIXA 3TUJC 5BJRA 3KYLA 2Q1LA 2I5JB 4PKGA 4A8XA 3SIPB 1UJ6A 5D4PA 4YNQA 1V3RA 4DR7F 4WQ5A 4QR1A 4FK4A 4USTA 4A5BA 4JRQA 4P72A 1P8ZA 5LM7E 2V2QA 3NRBA 2ZC3A 4AHRA 1VQNS 3RAMA 4NWBA 1GLDG 2YKQA 4IH7A 3OYBA 2YNFA 1WNSA 1V4TA 2PMWA 2RRAA 2CDRB 4HACA 2MZRA 4PG5A 4KREA 1FFWB 1Q79A 1XN9A 4GVLA 4ZOSA 3HHKA 2DCLA 3BS9A 4DQQA 6FDRA 1XI1A 1E4GT 3FE1A 2V4RA 2HFOA 1LEOA 2HBKA 1FWLA 1YG0A 4CNYA 4CJKA 2HBLA 3ID6A 1NO8A 2QC3A 4DV5J 4F0MA 2DNLA 1M90T 2FPHX 1NJXA 4Z0UA 1TAQA 3FSYA 3FQKA 3PYEA 2O01C 4DG1B 5B8HA 4K4WA 3PYGA 5F8JA 5I3QA 1F9EB 2MLXA 5A8RA 1O51A 4A2AA 1SKUB 2JZ5A 5H9FK 2HFUA 1D09B 4M5HA 4M5NA 1J9AA 2IIRA 1FKPB 2DT9A 1ZETA 1T9WA 3NL0A 1VSKA 4OYBA 3I5CA 3QWUA 2N7YA 4OHVA 4FZYA 5EWEA 1W7WA 3C6TA 3DLEB 1HUXA 4CECA 2PEHA 4HR2A 4OYWA 1TKZB 3THYB 1IG9A 3LP1B 5KFYA 3C6UA 3OYIA 1RTIA 3H5UA 3AY0A 2VG7B 2VBZA 3CCSS 2B4OA 4XPEA 1RTDA 1SQKA 3THWB 2OCEA 3BKUA 2DHGA 4A5AA 1WORA 4ZTJA 1EETA 3SSQA 3ZLJA 2CQ4A 4B02A 5GADU 2ZITA 1U1NA 3HSGA 4QCLA 5KOXA 2WVBA 2Y1LB 3TU5A 3GL1A 4EAHD 4DHVA 5TKYA 2OLWA 2VBXA 1VSLA 3BBFA 4DL6A 4OZ0A 2WTFA 3W3DA 3KMSA 4F9OA 2NRVA 4DV5K 3M3ZA 1P27B 2P6SA 4CK3A 3O9RA 3QLHB 1NGAA 5AJ3F 2HRUA 5IZHA 4DDFA 4WQ4C 2ZWHA 5E26A 3N0VA 3VTHA 4KHPF 3DWLA 4RO0A 1N8RT 2PE8A 2MZSA 4FLZA 1RHMB 2RPIA 2KJWA 1N36J 1HQEA 3OXLA 2C2NA 1UEKA 5AQWA 4DKWA 5D4OA 3A3NB 1D5AA 3CCLS 5J2MA 4BREA 3EGWB 1VRTA 4ELVA 4DR4F 3B82A 1RDBA 3W9IA 5M1KA 5HQ8A 4JI4K 2W7AA 3T1HK 3OBIA 2I0XA 4MK8A 1N5TA 2XY7A 3AVCA 1RHRB 3QEIA 1RP5A 4H5WA 4H0XB 4PQAA 1DQAA 3S6EA 2LQJA 3DDIA 3FKBA 2P9KB 2FBVA 4FL9A 5L8RC 3VQ6A 2IC3A 2YWFA 1S49A 3MEEA 3LDOA 3Q24A 1QY7A 2DR8A 3VF2A 2XRIA 1KOHA 4P2XA 2ZBQA 4LRDA 4TVAB 4PR6A 5IC6B 8AT1B 3CPWM 3LPTA 5BRHA 3SDEA 3HJVA 3AAWB 4DWIA 3KIOA 4B8CA 2O8DB 2B4VA 1WKLA 1J5OA 4M3UA 1A6LA 3UO0A 4JKGB 4C3KA 2FC9A 3K59A 1C1CA 2YNIB 2WFBA 3A1YG 3D2EA 5LSOA 2CNKB 1UOCA 3HYFA 2HVDA 3OD2A 4K7QA 5KFBA 1X3MA 3HHNB 3WUHA 4DFJA 3C7NA 3KWGA 4CGGA 4H4OB 2KH9A 4JD2A 5AQZA 2HS4A 2KYZA 1X1PA 4DV2K 5GAGI 3IRXB 3CCES 3AVHA 2QA4G 1F5CA 4JI7K 2AYGA 2FZGB 4KHPK 4DU1A 2P9PB 2H1YA 3L7UA 1DTTA 2QLXA 3H5XA 4JI6J 3EM1A 2JC0A 1NEEA 2QLJB 1X4AA 4J2DA 2ZWPA 2LU1A 4RBVA 3QEPA 4NXMK 3SBMA 2FQQB 2E66A 3VQ9A 4V1Ak 2CJQA 3VEWA 1RCHA 2WW8A 4G9ZA 3M8RA 4WXWA 2J8AA 4RWWA 3GQCA 3VETA 3OHRA 1YVFA 3QZ7A 3BF3A 3T41A 3RW6A 1Y97A 4FKXA 2O8BA 4ZP8A 2JJ4D 3ET6A 4DR3J 3WQUA 5KPZA 5GAGU 3SUNA 3DI6B 5JMVA 5F8GA 4HEA9 1RKJA 2CJKA 2OZMA 2K3KA 2HHQA 2VOPA 1T7PA 2BQUA 1N5SA 1UL3A 4ZPTR 2ILZA 5JUMA 1RYRA 4O44B 4DCOB 3GIJA 3UD3P 2LU2A 4JI6F 3N4WA 3RJMB 3QBCA 1N32F 3F9KA 3V1OA 3PJ9A 2GX8A 2F40A 1ZA2B 1ASVA 4RUCA 3D45A 4BRQA 2G13A 1VLOA 2JEFA 4GVBA 4O23A 2ZJQQ 2DGOA 5L1JA 4FJJA 3HHLC 5T7BA 2V63A 2NPFA 3ZSZA 1ZH5A 3R5JB 3G86A 4Q7AA 1FI4A 2KRRA 4DSEA 2QW9A 4WTYA 1TFYA 1S76D 1EKEA 5IQQA 3G6EN 1HHTP 3NOCA 1JNRB 1GXTA 2ZOGA 3CGIA 4G3IA 2N82B 1L3UA 2E5JA 2G9OA 1WHYA 3PW2A 4UTGA 4C7QA 4FJIA 1BQNB 2FJBB 4ZVOB 1GOBA 3QEXA 3IR6B 2ZQBA 4EIAA 5HJXA 5HO4A 3PHEA 3W9HA 1WBBA 1NGBA 5ETPA 4BVOA 4R8UB 3J7YP 4NPOA 3EYZA 2EVZA 3CJAA 3PX4A 3CD0A 3NH0A 2B7BB 5KAKA 4EBEA 4J90A 3AVIA 3L4IA 3HTVA 2FIUA 1RT2A 2OZSA 2XY6A 4C8LA 2DNOA 4B3MK 3DLJA 1CXQA 3MMBA 4MK7A 3D6MB 1DQ9A 4IZ9A 2FY1A 1XMOF 3CO9A 3AVJA 4BQZA 1N6QA 4KC5A 3C19A 4WP8A 2FHJA 2BUPA 2NSCA 4JI5K 3QFHA 3CULA 1JJ2M 2ZH2A 5KFHA 2DVIA 4BHQA 5CYMB 3O3LA 4KH6A 3G71S 4I0WA 5FLXU 3MXJA 1BD6A 3VAIA 3FZHA 4EYIB 1N4LA 2YHBA 4LVOP 2MZ1A 1F6TA 4JS4A 2AJQA 1CXUA 4DX6A 2I1RA 1W7AA 4DSKA 2DGTA 1WLJA 4OPHA 3QFPA 5MLCQ 3FZBA 4L74A 3GFZA 4ILGB 3NF6A 3VQCA 2KKZA 2ETJA 4CYUB 3OPKA 2JLFA 3D2WA 3V4IB 4RNOA 3DRSA 5KT2A 5AXLA 4I2PA 2HQ3A 2GX9A 1WDDA 3TW0A 4KB1A 1ZA1B 3G8QA 4CIGA 3H0PA 1FA0A 1TELA 2G1DA 4ZPCA 4PHTX 3PHTA 4C8KA 3GE1A 5F0UA 1LW2A 1RU2A 1EXQA 3GONA 1VK3A 1RZMA 3LDPA 2OFHX 2UXBF 1R0AA 2EW9A 4H0OA 4NYOA 4BGAA 3FGUA 3SYZA 1UVJA 2WSFC 2BV3A 2PGCA 4R0JA 2B5JB 4UF4A 2O8EA 3G10A 4JLHA 3I82A 3GR0A 5DGBA 2OPSA 4B9LA 1DEJA 1K8KA 1NPRA 4ZPAA 4YS2A 1TKTA 3FMWA 3KK3B 2IAJB 3GJQB 1CPZA 3O4NA 4FYDA 1H3DA 3QDKA 3PX0A 4A46A 5M1OA 1NNEA 3MM5A 4HL9A 4PRFA 4FJMA 5KFCA 4F0HA 2DFEA 3M32B 3MDQA 1YDLA 5F9NA 1QVGM 5GIOA 1MWYA 2KKHA 5EX3A 4YEAA 1KLMA 3G82A 3FQLA 3TOQA 2R9LA 4DV7F 2QWLA 5HLFA 1PILA 4FZVA 2MLYA 4DTSA 3D2FA 4JI4J 1S72S 2AF6A 2N3OA 1GOAA 2BABA 3FMBA 1T8EA 4ZPBA 1I3AA 2OO4A 5J2NB 2Q0UA 2X1AA 4CI0B 1VJWA 4OX6A 1TUUA 1ZPVA 4DFMA 3EPIA 1J27A 4Y3CA 3GLJA 1H7WA 4U67Q 3BSOA 4F2SA 3ILIA 4E1MA 3A8EA 1LW0A 1QJHA 3AODA 3TVKA 2XSJB 4KHNA 1RAHB 4PEOA 3T7ZA 4FPBA 3S3NA 2DY1A 3M6WA 4I2QB 3BO4A 2HAFA 5B0DA 2VA2A 2RQKA 4Z7CA 3UKRB 4QPTA 5AQJA 1OO0B 2P5OA 2P9CA 1FCAA 1QHTA 4BC7A 2OYQA 2ZE2A 3LW5C 3OL6A 2P2CB 4K42A 4E7LA 5ETKA 2CQHA 2GELA 4RW8A