4WE1A

Crystal structure of hiv-1 reverse transcriptase in complex with 5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)-2-naphthonitrile (jlj600)
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
547
structure length
542
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title Picomolar Inhibitors of HIV-1 Reverse Transcriptase: Design and Crystallography of Naphthyl Phenyl Ethers.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Hydrolase
total genus 140
structure length 542
sequence length 547
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4we1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4we1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4we1A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4we1A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4we1A05
1T3NA 3EPIA 4JS5A 2W9AA 3DRRB 4M3UA 2RF2B 3CDUA 4W5RA 3V6DA 2I5JB 2WONA 3GV7B 2VA2A 4BE1A 2WK4A 5FRNA 1HYVA 4DTMA 4CEFA 3LP2B 5DQIA 4DTUA 3V1RA 5KFMA 1BQMB 1RT2B 3OL7A 2HVIA 1BI4A 4M41A 4M45A 1CLQA 5KFFA 5KGXA 1IKXB 1WNSA 4IG3A 2XWYA 3SYZA 1LW0A 5J2MA 1WSJA 5F8IA 3H59A 3NKYA 2XY8A 5HROB 2DFEA 1U49A 3MEEA 1JLEB 1RTDA 1O1WA 1I3AA 1G15A 3AVNA 2V4QA 3IN5A 3DI6A 3DDKA 2O4GA 1KTQA 1MU2A 1HNVB 4TYAA 3ZCMA 4Q44A 4WFYA 1JLCB 1HMVA 4O3NA 3HT3A 4JV0A 3I5BA 4WYWA 1WSEA 2FC0A 3OYNA 1IH7A 3MEGA 4CJPA 4CGDA 3O4QA 3PR4A 2OH2A 3ZSYA 2GBZA 2Z1IA 1VSFA 4WE1A 3DLRA 2IAJA 3RWUA 4DTXA 1Q8IA 2GC8A 4ECRA 3MR2A 1N6QA 4GC7A 3V6HA 1S97A 4DQQA 4DLGA 3OJSA 1EETB 2VG6A 4EO6A 4JS4A 4ZP9A 2VG5B 3F9KA 1X1PA 2D3ZA 2ZD1A 5DLFA 4K4WA 4RW8A 1J5OA 4OKEA 3BSCA 4YQWA 3TAQA 2OYQA 5EWFA 3QEXA 4YR2A 4PY5A 3I5AA 3OL6A 4CHYA 2AX0A 3OYBA 4KO0B 4F8RA 3K5MA 3KLIB 4DF8A 4QWAA 1KLMB 1JX4A 5EU7A 4FZZA 3K59A 2G8IA 2HHQA 3WNGA 2YKNA 4EEYA 3T5HA 4CIEA 4Y1DA 3KK2A 3T5JA 4R8UA 1LW2B 1KVAA 1WSFA 4RW4B 3C94A 3QIPA 1IKVA 4KB1A 4ED2A 4ZPDA 4CESA 3RBEA 4AILC 3OS1A 3OYDA 3TI0A 3HP6A 4MFBA 4NLSA 1RYRA 1TK8A 3QYYA 3KIOA 1WAJA 5KFGA 4KHSA 5J1EB 2UUWA 2XHBA 4EZ9A 4ZVFA 2XY6A 5KFBA 3ALYA 2ETJA 4O4GB 2P5OA 3OYAA 4CJWA 3ITHB 4RNMA 1CZBA 4TLRA 3AVLA 1S1VA 1QSYA 4EBEA 4KTQA 4NRUA 4EBDA 3AA2A 4CEZA 1N5YA 2BRKA 3TABA 2R8IA 1SUQA 4U6PA 4YMEA 1YTAA 1D9FA 3O3GA 4WFZA 2KZMA 3C6UB 2HAIA 1S6QA 5KFJA 3CDWA 4FJ9A 4WXOA 4ELTA 2BDPA 5KFRA 5KT4A 1QAIA 3DRRA 2RF2A 4ID5A 4RW6B 5KT3A 3G10A 3GQCA 2I5JA 1MMLA 1SV5B 1C2PA 3M8QB 1GOAA 3D0PA 4F50A 3TAGA 5DG9A 3FQKA 5JXSA 3LP2A 4MH8A 5D3GB 4KFBB 4CJTA 4HHTA 4Z4HA 2JEJA 3GYNA 1BQMA 5KFZA 1K6YA 3Q8PB 2AX1A 4JV2A 4FLTA 3QGHA 3LAKA 3DYAA 2IJFA 2OA8A 4CJQA 5CYQA 2RDJA 1BQNB 3AA3A 1WAFA 4FK2A 4DFPA 4OGCA 4OJRA 3CJ2A 5J2PB 1VSIA 4J9KA 3VQBA 3KLEA 4URSA 3NGIA 3SFUA 1BL3A 2RDIA 2FVQA 1DTTB 3P5JA 4KI4A 3JSMB 3AO5A 3SV3A 4CGIA 5L1LA 3PO5A 3I8DA 3OYGA 2YNFB 3VQQA 3HP9A 3L3UA 4LD0A 4DU3A 3ZSRA 4FLZA 5L1JA 4E3SA 3RB4A 1RTIB 4HYKA 3HPGA 4F3OA 4G1QB 3V6JA 4CJRA 5KFOA 4MK8A 2PZSA 3S9HA 2HHXA 4G3IA 3OS0A 3LP0B 1HYZA 4DSKA 1EETA 4IRCA 5KFDA 1K1QA 1JXBA 4YR3A 4AHCA 4CEQA 2VG5A 3MR3A 1GOBA 4DWIA 4KREA 4FLYA 4W5OA 1EP4A 3OYFA 1JXEA 1S1XA 2OPPA 2VG7B 4ELVA 3SQ2A 1X9SA 4KO0A 4DG1A 1L3TA 1HQUB 4E7IA 1FKPB 3NDKA 4RNHA 3QNNA 1I39A 3SPZA 4DSEA 1UAXA 5F8MA 4TY9A 3LPTA 1KCFA 3WNEA 2Y1IA 3PZPA 3JYTB 3VQ6A 4K4XA 4NYNA 1LW2A 4I9LA 3IS9B 4DFJA 1JKHB 3U3YA 3VQ4A 4MQ3A 3KMSA 4ZPBA 4DL6A 4DSFA 1HNIB 2DPJA 3H2LA 3TAMA 1U09A 2XY7A 4O44B 1VRTA 2XI2A 2OPRB 2E9TA 1S1TB 1C0TB 4DS5A 1RT3A 4ED8A 3QZ7A 2E6MA 4IG0B 4FJKA 2FVRA 4BDYA 4K4SA 1LWCA 4I7FB 4DU1A 3DRPB 5C42A 4O4GA 3V9SA 1TL1A 3AVMA 3L2UA 1NHUA 3HXMA 3ZT1A 1S0OA 2O5DA 3QEWA 3ITHA 3BQ2A 5KG4A 4KAZA 2OPQB 4CJVA 1VRUA 5DMRA 2R2SA 3KLGB 3OLBA 2ILZA 3VQPA 5KG0A 3RMCA 1S1WA 4CERA 3TARA 4DF4A 2FBYA 5KFSA 1IKYB 4K4TA 2BQRA 3RBDA 3RTVA 4YNQA 3NGDA 1BIUA 3C6UA 2BRLA 2Z1JA 2OPSB 4OKKA 4RNFA 3SZ2A 4DLEA 1BISA 4KV8B 2B5JB 4O3SA 4J9NA 3BREA 4OPJA 2G8UA 1UWBA 3QETA 3TAFA 2W9BA 2FLPA 1QQCA 5D3GA 2AWZA 4KFBA 1FK9A 3N6LA 1RT5A 2AGQA 5L1IA 1TKZB 3V1QA 5F8GA 3HVWA 4K8XA 1L3VA 3ISNC 1R0AB 1HQEB 4KHRA 2DFHA 3FSIA 4CEDA 3LZIA 4DL5A 3H5YA 3O3HA 4Q0BB 2D41A 3H08A 3V4IB 3KHLA 5J2PA 3AVJA 1RAJA 3RB6A 2HNZA 4TY8A 3HKWA 4NLXA 3THVA 1RDAA 5KI6A 4CJLA 4Y1CA 4TN2A 3S3MA 4IH5A 3JSMA 4NCGB 4FYDA 3CIZA 3LWLA 4HKQA 1HYSB 4CK2A 4QOZB 2YNFA 1K1SA 4HUEA 2GIRA 3CO9A 1RTIA 2YKMA 1D1UA 1LAVA 3M8SA 3KD5E 1ASUA 4I2QB 2FVSA 4N5SA 3SUQA 4NLGA 2B4JA 2HNDB 4RUCA 1W9HA 3LP0A 4W5TA 4E7HA 4IKAA 3ZSZA 5E41A 4J2DA 4NLUA 2ILYA 2E6LA 4K4ZA 5KFUA 4O0JA 4CEAA 5KFWA 3EYZA 1KVCA 3T19A 1S9GB 3BGRB 2PY5A 4ED7A 4OVLA 4O3PA 1ITGA 3DLEB 4IFYB 4K4VA 2HHVA 3ZT0A 4IBNA 1HQUA 1T7PA 1FKPA 1SKRA 3QGGA 4RZRA 4FVMA 4DQPA 4HVJA 3OY9A 4O55A 3WNFA 1TAUA 1JLGA 1QHTA 3M9OB 5CZ2A 1CXUA 4KHQA 3AVKA 3JYTA 3VQEA 3QGIA 4ZVHA 5C5JA 3AVFA 3DLHA 1RT4A 3OYEA 3IS9A 1SL1A 1JKHA 1IKWB 1Q9XA 4TSXA 1HNIA 4BWMA 3QLHA 1DTQB 2X6NA 4FW1A 5CYMA 3MR6A 2OPRA 3BSOA 1ASWA 3V6KA 3H5SA 2ZKUA 3LAMA 1ZBFA 2ZE2B 3MAQA 2UVVA 1C0TA 1C1BA 3C6TB 5DGBA 2ALZA 3BQ1A 3PO4A 4CE9A 1J9AA 4J2EA 4CJFA 3M8PB 4IG0A 4WXWA 2HMIB 3D45A 2WRMA 2ZQBA 3DRPA 5KT6A 1NKBA 1L5UA 4KKOA 3EY1A 4WYLA 4IKFA 1U45A 5C24B 1T03B 4RNOA 1NJZA 1ZTWA 3KLGA 4MKBA 4ZTFA 4NLTA 3PJXA 1J53A 4BDZA 3AV9A 3KLFA 4DMNA 2YNHA 3VA0A 4C8KA 1FXXA 1JLBA 1IKYA 3SQ0A 3LP1B 4EYHB 4E7JA 2HHUA 2W42A 5HP1A 2BANA 2XGQA 3NBPA 2NUBA 4B9VA 1JLAA 2HNYB 3KHRA 4IFVA 3NF7A 3DLGB 3IGVA 5HRRA 5KRTA 4GC6A 4KV8A 3S3NA 4LH5A 1SH2A 3FFIA 3SFGA 3CFRA 1S9EA 5DQHA 1VSJA 5KG5A 3OHAA 3SUOA 3SCXA 3ZSOA 1DLOB 3M9MB 3V9ZA 4EYIB 3AO4A 2R8JA 4JLHA 3SI6A 3Q8QB 1TK5A 4QWEA 3AA5X 4LY7A 3TR8A 3DRSA 1SKWA 3SV4A 3AO2A 2JEIA 3V9XA 1R0AA 4PA1A 3QZ8A 3T5LA 4JRQA 1XC9A 4Q0BA 3OL8A 4HUGA 1RDRA 4CFDA 1Z26A 5J2QB 3OYMA 1KFSA 4RUAA 1C0UB 2FBTA 3V81B 4CHQA 3OYCA 1TL3B 4PWDB 1VSLA 4RW7A 3IAYA 1RT1B 2X6SA 2RKIB 3MFHA 1TKXB 2BE2B 1RBTA 2IGIA 1S5JA 4JV1A 4B9SA 3OYIA 4W5QA 1ZYQA 4CGJA 2W9CA 4N76A 2FBXA 1VSKA 2PYLA 4I2QA 2E4LA 3MEDB 4K4YA 3KK3B 3DM2B 4NLRA 3OYKA 4H54A 4CGHA 3CQ8A 3Q8RB 2HVHA 3H4BA 5KG3A 4HCBA 4KSEB 4TQRA 3GV8B 1ZBUA 2R8HA 1C1AA 3AO3A 4CF2A 2C2RA 1A5WA 2JEFA 4DL7A 1NK5A 3NH1A 1IM4A 2XO7A 3MR5A 3NL0A 1S9GA 4WZQA 5HRNA 3HSTB 3MECB 2QKBA 1ZBHA 3KKRA 5KFTA 3CJ5A 3RB0A 4AHTA 3RR8A 3DOKB 1RT6B 2YNGB 1IO2A 4DTSA 3P83D 4LSLB 4LSNB 1WN7A 3BSNA 1TK0A 1S10A 4R5PA 3VQDA 4KHNA 3VQAA 1RTJB 5I3UB 3VQSA 1QS4A 3CYMA 4ECTA 2Z1HA 3BJYA 4ECUA 3NGYA 1DTQA 4JRPA 4Q8EA 1S0NA 3P1GA 2IM0A 4F2RA 1NK6A 1NOYA 1GX6A 3C6TA 4BDPA 3HPHA 1LWFB 5EDWA 1KHVA 1T8EA 4Q45A 4DL3A 2CJQA 2IBKA 1BHLA 1RT2A 2HMIA 3NF9A 4FS1A 1S0MA 2HHTA 3KTQA 1S1UB 2AU0A 5SWMA 1IKXA 4PUOB 2YHAA 4UQGA 1QSLA 3GIKA 3CJ0A 5HROA 4F4KA 3SPYA 3N6MA 1JLEA 3L2WA 3HVTB 1RBUA 3SQ1A 4B8AB 5KG6A 4OPKA 4KPYA 4E1MA 2FJXA 3DOLB 3EPGA 1HNVA 1VK0A 1JLCA 4PQUB 2VWKA 4Z0UA 4CHZA 3ZSWA 3PV8A 1J54A 1LV5A 1S9FA 3KLHB 3PW5A 4WZMA 4NCAA 2YV0X 1TVRB 4RG8A 3E01B 3L2VA 5EUHA 3KNAA 1ZBLA 4QWBA 3H98A 4KHWA 3KK1B 2WCXA 2B6AB 4CJSA 4CCHA 5I42B 4AHVA 4QAGA 4M3TA 1DLOA 4O3QA 2R8KA 1XR5A 3OSNA 3K57A 4N41A 3NH0A 4XIUA 3VQCA 4B3OB 3G86A 2EC0A 2C2EA 3DMJB 4QPXA 5KRSA 4F4YA 3NH2A 1OS5A 1ZETA 4OGEA 4ZHRB 2D0AA 2F8SA 5DGAA 2QXFA 4ECXA 2WOMB 2J6TA 5FRMA 2PYJA 3NFAA 1KLNA 3PW0A 3KLIA 4CEEA 2G8HA 1KLMA 3PX0A 1VSHA 4NYFA 4B9UA 4FBUA 4EP5A 3QEVA 1REVB 3NE6A 4MK7A 3HL8A 3HHKA 4J9SA 4HUFA 2OZMA 3IGNA 4NRTA 4FJHA 1C0UA 4IR1A 1HPZB 1N56A 4RW4A 3V81A 4M94A 1XR6A 2W8KA 2IM3A 3QESA 4NLVA 4PWDA 4IQXA 1TKTB 1D0EA 4B8CA 2ASLA 1RT1A 4ECQA 2RKIA 2BE2A 4I2PB 3CJ4A 4ZVGA 4CF1A 4K50A 4ECVA 2D5RA 4FW2A 3KOAA 3A2FA 1UOCA 3V9WA 1QSSA 3PW2A 2AGOA 3DLBA 5KFHA 1YTUA 5J1EA 3KK3A 4FCYA 3DM2A 5KFXA 1XHXA 4ZPAA 3NF8A 4OLAA 4BE0A 5KFLA 3UIQA 2C22A 4CF0A 4GW6A 1JLQB 4H4OB 1CXQA 2IM1A 3ISND 5EWGA 4ZMMA 3TWHA 1TV6B 4RW9B 1WSGA 1N4LA 2JEGA 4ZPCA 1BI4B 3SNNA 4IG3B 4Q43A 3HVRA 3HYFA 2YNGA 3LDSA 1NNDA 4TXSA 3T1AA 1RTDB 4LSLA 4LSNA 3OJUA 2F8TA 1W0HA 5L9XA 3FRZA 2R7YA 1B9DA 1WLJA 2F8EX 4CECA 2W7OA 1L3SA 2FJWA 1HMVB 4RW6A 2CKWA 4KB7A 1QTMA 1TP7A 1RA7A 1YVUA 3OYJA 1SV5A 3M8QA 1QE1B 4DTPA 4TYBA 3MEGB 4NZ0A 3NAEA 2VA3A 4WE1B 2IAJB 3I5CA 3I0SB 4BWJA 2KW4A 3MXJA 4CJUA 2KQ2A 1KHWA 5SZTA 3H4DA 1N6QB 2EX3A 4O3OA 1EX4A 1A5VA 4NLPA 2YNIB 3QEIA 2UUTA 4M3XA 4EO8A 4FS2A 3AVGA 4B9MA 3PX4A 4FJ8A 2RPIA 4F4WA 5F8HA 4NYZA 1BIZA 1BQNA 4O4RA 2ZD1B 4FJXA 5KG2A 3TANA 1J5OB 4IH6A 4N47A 3DOLA 4Q8FA 1NKEA 2GUIA 4DQSA 2FVPA 1DTTA 3SUPA 5JS1A 1LWEB 3OS2A 2EHGA 3RMDA 3QIDA 4CJ4A 3KLHA 1QUVA 4XO0A 4ED3A 5HBMB 2YKNB 4MK9A 1KSPA 4ZP6A 4B9LA 4M3WA 1BGXT 3ZT3A 2W8LA 5DG8A 2D0CA 4B9TA 4G1QA 2Z1GA 4MIBA 1S49A 3RMAA 4CJ5A 4DL2A 5KGWA 3TAEA 2B6AA 5DQGA 4GVMA 1WSIA 3CFPA 4NLDA 4MFBB 3RMBA 3HO1A 4NLYA 3U3GA 3RB3A 4E89A 4K8ZA 4F4XA 4B3OA 3IRXB 3DMJA 4I9QA 2FVCA 3CM5A 1UA1A 2VG7A 4FM2A 3CVKA 1X9WA 2G8WA 4N56A 4ELUA 1XI1A 1RILA 4M42A 3PJWA 3QINA 4DTRA 4IRKA 3K5LA 3L8BA 1REVA 3NCIA 1N5YB 1CZ9A 5KT5A 2E9ZA 5F8LA 3VQ7A 4FXDA 3ZT4A 4FLWA 2KZZA 4EBCA 1WNEA 4O44A 1TKTA 3C95A 4IR9A 5F9NA 5L1KA 4I2PA 1S1TA 4CK3A 1S6QB 3B6PA 1BCOA 4CFCA 2E9RX 1RTHB 2W7PA 4B9NA 2J6UA 4KI6A 1RBRA 4OLBA 4X2BA 4FJMA 3HVAA 4ZP8A 4I7FA 4ID5B 1JL1A 2UVWA 3T5KA 1JLQA 4H4OA 2JC1A 4MKAA 3AA4A 1Z25A 4ECZA 2OPQA 4B08A 1TV6A 4RW9A 2A1RA 1TQLA 4AHUA 5KFPA 4E0DA 3SJJA 4FZXC 4KHYA 3HM9A 3TVKA 4CHPA 3LPUA 4Z4EA 4MIAA 4ICLB 2XGPA 3DYAB 4U7CA 4ID1A 4DFMA 5CYQB 4Y3CA 4FJ7A 1S48A 3UR0A 3ZSVA 3VQ9A 2O4IA 4ED6A 2P5GA 2IC3B 2OPSA 2R2RA 2AQ4A 3KLEB 3NAHA 5HRPA 5KFVA 1RA6A 3LANA 2B5JA 1S4FA 5KFQA 4CJEA 3IG1B 2XCAA 2FLLA 4FJNA 1SL2A 5DLGA 4E7KA 3KHGA 1QE1A 4DTOA 4EP4A 3DLKB 4Z4FA 4QW8A 4O0IA 2HHSA 1IG9A 2IJNA 4ECYA 5KFAA 3QERA 5KTQA 4DSLA 3I0SA 5J2NB 1TKZA 3KD1E 1RBSA 3ZSQA 4K4UA 1QAJA 3LALA 2YNIA 1HQEA 5C25B 4AH9A 2IM2A 4YR0A 3CG7A 3V4IA 3TQ1A 1C0MA 3PR5B 2QKKA 3M8RA 3O4NA 4LQ3A 4NCBA 4F3TA 1EP4B 4CJ3A 1S1XB 2OPPB 2BGGA 4WFXA 4QW9A 3AVIA 4NCGA 2XC9A 4DG1B 1LWEA 4ZP7A 2UVRA 3F73A 4CGGA 4C8OA 1RYSA 1HYSA 1FKOB 1WSHA 2D7SA 5FDLB 3PW7A 5HBMA 3MXMA 2IOCA 3E51A 4ZVEA 2Q3SA 3OYHA 2A1SA 4M3ZA 1SL0A 4AHRA 3FDSA 5K14B 4NLWA 3CDEA 2KFZA 2BQ3A 2XY5A 2HNDA 2WTFA 2ATLA 3SUNA 2ITGA 1Q9YA 3TAMB 3NMAA 1VRTB 2IDOA 4ED1A 4M95A 1NK0A 1RT7B 4BACA 2HHWA 4Y2AA 1RT3B 2C28A 3WNHA 3SQ4A 4E7LA 1A5XA 3IRXA 4KAIA 3BGRA 2AGPA 1U47A 4KHMA 1RCHA 4C8NA 3NF6A 1C1CB 1LWCB 3DLEA 4IFYA 3RR7A 5C42B 2XI3A 1RNHA 3MXIA 2G8FA 4IOBA 1TL1B 3ULDA 4KE5A 2J6SA 5F8NA 4W5NA 1HARA 1F21A 4GMJB 1VRUB 3OLAA 1YVFA 3H5UA 4CEBA 1S1WB 1IKWA 3OSPA 4DFKA 2HWHA 3L3VA 5T14A 4CK1A 3ZSXA 2DTUA 3V1OA 3UQSA 4ZTJA 2ZE2A 5HLFB 4IH7A 2R8GA 1RTHA 1YT3A 4KB0A 4FJ5A 5KFEA 2X78A 3M8PA 4DTNA 1U4BA 3CM6A 3G6XA 1UWBB 1RBVA 1B9FA 2QE5A 5T7BA 2W9BB 1C6VA 4CF8A 4J9OA 3QO9B 5C24A 3H5XA 2P1JA 3HJFA 1T03A 3PHEA 1NK9A 1VSMA 3VA3A 1FK9B 1RT5B 5KG7A 4HTUA 2KFNA 4DSJA 3ZT2A 2V4RA 3PY8A 3OHBA 3KJVB 2HW3A 3LP1A 1HJRA 4ICLA 1JLFB 3TAPA 2FBVA 1SH3A 4YFUA 3LWMA 4H4MB 4J9LA 2HNYA 3LZJA 3DLGA 4L8RB 1XWLA 5KFIA 2IC3A 2Y1JA 3BSAA 2HNZB 4TY8B 3QEPA 5KT2A 1T05B 2HB5A 3RAQA 3IG1A 3Q8SB 3V9UA 1VSEA 3VN5A 3AVAA 4OKJA 3VQ5A 4DL4A 4CIGA 1RDBA 5KFYA 3K5NA 3DLKA 5F8JA 2YKMB 1NK4A 5J2NA 4YP3A 1BCMA 4LQ9A 3AVHA 2D3UA 2LSNA 2DFFA 1T94A 3S3OA 3RAXA 4CF9A 2IA6A 4J9MA 4DS4A 5C25A 1Y97A 5KFNA 4ECWA 3GV5B 2P51A 4CIFA 4OL8A 2WHOA 4NLQA 3EZUA 4DSIA 3NHGA 2V0NA 4FJJA 4FLXA 5KG1A 5J2QA 3MFIA 3MTKA 3H40A 3NGZA 2HWIA 5F9LA 1S6PB 2JC0A 3I0RB 4KTWA 3U6FA 3QNOA 1TKDA 3EZ5A 4EZ6A 3PVXA 3VQ8A 1KRPA 1FKOA 1TL3A 3SI8A 4LH4A 2B43A 5FDLA 4IDKB 1JLGB 4KTZA 5DG7A 4FM0A 1TKXA 4JUZA 3PUFA 3BR9A 4RNNA 2IMWP 1JL2A 4ECSA 2XCPA 3NAIA 5K14A 3N6NA 3RRGA 1JIHA 1RT4B 4RU9A 1CSJA 3L2QA 3MEDA 1EKEA 3PX6A 2JGUA 1SH0A 3KHHA 3L2RA 3GIIA 3QLHB 2JLEA 4Q5VA 5CYMB 3AVCA 1NJXA 3V6DB 2WONB 3ICLA 1JXLA 3GIMA 1RT7A 3CJ3A 4J9PA 3T3FA 4F2SA 3FQLA 4Y2CA 3LP3A 1C1BB 3GILA 4C8LA 1RDCA 5CZ1A 3AVBA 4CFAA 4FJGA 1L3UA 3BDPA 4FJIA 4DU4A 4Z4CA 1NOZA 1C1CA 3MECA 1NJWA 1LW0B 1I6JA 5J2MB 1U48A 4KKOB 3MF5A 2ASJA 3DOKA 1RT6A 2G8VA 3BQ0A 5JS2A 3B6OA 3MEEB 2OZSA 2X74A 4FBTA 1ASVA 2YHBA 4J2AA 1NHVA 4CHOA 3KLFB 1RTJA 2YNHB 3DI6B 2BQUA 1SKSA 1MU2B 1LAWA 5I3UA 1JLBB 2RN2A 3O3FA 2XRIA 5HP1B 2BANB 1TGOA 3RRHA 1NK8A 3NBPB 1JLAB 3K5OA 4IFVB 1NJYA 5HLFA 2WB4A 1LWFA 4R0EA 2R2UA 4KHUA 4BE2A 1UA0A 5KT7A 4CGFA 3FFIB 5KFCA 1NK7A 4KBIA 4CFBA 4DQIA 4Z4IA 2FJVA 2QV6A 1S1UA 4FZYA 4C8MA 2DY4A 2DPIA 1S9EB 4PUOA 3QIOA 1HRHA 2D0BA 3D5MA 4E19A 4KRFA 3K58A 1XHZA 3QO9A 2VG6B 4FLUA 3KMQA 4M3RA 4FK0A 4QWDA 4O5BA 3CWJA 4ED0A 1N48A 3HVTA 3M9NB 3HK2A 4RW8B 4F4ZA 2KTQA 2VWJA 3DRSB 4J9RA 3KJVA 4M3YA 4FLVA 3D28A 1TAQA 2BR0A 3GIJA 3AO1A 4PQUA 1JLFA 2GIQA 3K2PA 4H4MA 4XPCA 1ZTTA 3KLVA 4O3RA 4FM1A 2QK9A 2R2TA 3OVNA 1B92A 5DK5A 1NKCA 5CY4A 1EXQA 4J2BA 4DQRA 1TVRA 2ASDA 3E01A 1KFDA 3KK2B 1T05A 2C2DA 4CHNA 4R8UB 3UDLA 2FLNA 5KFKA 1ZBIA 1RDDA 4H8KA 3KK1A 3QIPB 1IKVB 4HCCA 3UPFA 3ASMA 3OYLA 5I42A 5FROA 4RW7B 1GX5A 2AJQA 2F96A 2V9WA 2ATQA 1W25A 4URQU 4J9QA 4FK4A 1VSDA 2W9CB 3CFOA 3HPOA 5HRSA 3G6VA 4IRDA 1D5AA 4ZHRA 2UVUA 4CEOA 4Z4GA 1Z4UA 5EWEA 2WOMA 4XPEA 4TQSA 3G0ZA 4Y34A 5JUMA 1X9MA 1GOCA 4DEZA 1S1VB 1U04A 4FJLA 1D9DA 4DTJA 2G8KA 4URGA 4NLOA 3KKSA 1HPZA 2IS3A 1S6PA 4AHSA 3I0RA 4QWCA 1SUQB 4CJKA 4IDKA 2I1RA 1D8YA 3OL9A 3G6YA 1KVBA 4R5PB 4QCLA 3PW4A 2GV9A 4E1NA 1XR7A
chains in the Genus database with same CATH superfamily
5IS2A 5C0YA 4RL1A 3QDKA 2W9AA 2DNKA 2A10A 2QT7A 2GV1A 1FRMA 1ZM9A 3OV7A 4GVBB 2VA2A 2WK4A 5M2RA 1URRA 2PMHA 4CEFA 2GW8A 4DTUA 3C14A 1Q86T 2ZJRQ 2E44A 2ZH7A 3K89A 3HX9A 3NGUA 5KFFA 3JS6A 1IKXB 1WNSA 4IG3A 1LW0A 1OSCA 3MR7A 4DR1J 3AD8C 1U49A 2DFEA 2CZVC 1S6OA 3JSRA 2J0WA 4DBQA 1O1WA 1I3AA 3AVNA 1X0FA 2VOPA 3O9UA 2V4QA 4WCEL 4OYBA 3IN5A 2FJEB 2QN6B 3VAHA 1HNVB 3W8PA 3QT7A 4J37A 4FVCA 1JLCB 1HMVA 2DY1A 4O3NA 1JCEA 3I4PA 4HI2A 3VR1A 4DUTA 5LM7E 3MM7A 3PR4A 2OH2A 2CGLA 4WE1A 3DLRA 3P5TL 1VQPS 2OANA 4X84A 4ZCLA 3MR2A 2QIFA 3V4MA 2XM3A 3OJSA 3EE9A 3JTOA 1CJTA 4DR4J 4BC7A 1J2VA 1W26A 3VAIA 1PSDA 1V4SA 1GQEA 2GMHA 2HF4A 4JS4A 2V7ZA 1SJ3P 3MD1A 2E1CA 1VQ4S 4QBUA 2MZSA 2CUYA 2OYQA 4YQWA 1IV0A 8ATCB 4DR2K 3QEXA 3LM9A 2E5IA 3HRGA 1CS4A 3OUYB 4OJHA 3UW1A 4DV3K 3K5MA 1YI2S 3D6MB 4UY8T 3KLIB 1GLCG 4QWAA 1QZ5A 2L9WA 5DS7A 4FZZA 2G8IA 2HHQA 2MDAA 3T41A 3QBCA 3T5JA 4R8UA 2BH1A 4OV6A 3D3CJ 1CLFA 4IYQA 4ED2A 1YJ9N 2AJFE 1BY9A 3NCQA 3OS1A 3CC4N 4MFBA 3VGKA 3GYGA 4NLSA 1IR0A 3M6XA 3QYYA 5C7PA 2W4CA 1HW9A 3EGVA 2ZNZA 4KHSA 4U7BA 2UUWA 4NEYA 4DV6K 3R6LB 1FEEA 4K42A 6AT1B 2XY6A 2ETJA 1CQNA 2P5OA 3K9KA 4M5JA 4U67L 1SQKA 2RT3A 3AA9A 2P9SA 2YI1A 1NO8A 1YJ7A 2HSTA 1RHQB 2MQMA 4C8ZA 1S1VA 2OFGX 4U8YA 4EBEA 1OMSA 4NRUA 1NMNA 1T44A 2ZWOA 3T7ZA 2YX1A 1SUQA 4PKIA 4ILJA 4WQ4C 3O3GA 1R8AA 3W5YA 2HAIA 5KFJA 4AL6A 4DUYK 2M7SA 2BUPA 1UW9A 5KFRA 1U1LA 3AGRA 3QAUA 4C3MA 2NZCA 1U2FA 4JKEA 2RU9A 1YRTA 3HBTA 3CI5A 1GOAA 3D0PA 5KQ8A 1LKZA 4JKGA 1UFLA 3LP2A 1XMBA 5D3GB 4HHTA 4Z4HA 2CPFA 3GYNA 1ZAVA 3PRBA 1C0GA 3E9PA 1CULA 3PIOL 2COLA 3M7VA 1V4TA 2AX1A 4B1YB 2CQIA 4DV4F 4YDUC 2KU7A 3G71S 1F2GA 5LXRA 4OGCA 1XNQJ 2YX7A 4J9KA 3KLEA 3SFUA 3J81O 3CJ8A 1DTTB 1X60A 3JSMB 4CGIA 1ILYA 2HBMA 3PKMA 1RAFB 1KWMA 2YNFB 2EWSA 4CT9A 1T9VA 4FLZA 4BR2A 4E3SA 2JOQA 1RTIB 4M5DB 2FXUA 4FOIA 1FJGF 4F3OA 4G1QB 1MG7A 5C2FA 3TP2A 2AYMA 4CJRA 4FL9A 3BGFA 2PZSA 2PEBA 1EETA 5AQRA 4YR3A 2DPNA 2GVZA 3MCNA 3P31A 1M90O 5E84A 4B3SF 2AF6A 4RLEA 2WBMA 2WC9A 3BKFA 4GVEA 2BJ3A 2DO4A 3P45B 2CPYA 3HHEA 1JCFA 2GVDB 2GIFA 3R3LA 4F25A 4RNHA 1GMWA 4FPRA 5HVHA 4DSEA 4LJMA 1XMQK 5A6PA 4A2AA 4L72B 2DCUB 1KCFA 4BRQA 4LFCF 3CC2N 2O01C 2O67A 1QY7A 4K4XA 1LW2A 4I9LA 2LQJA 2VONA 5MLCQ 1FXRA 3U3YA 1X7VA 3VQ4A 4ZPBA 3TAMA 1U09A 3TJ9A 3OA9A 3BGLA 5H9EK 1S1TB 2VZ9A 3HSJA 4QYZK 2G1DA 5JICA 2VU5A 1X9JA 3PM9A 2KL8A 1I94F 5CZVA 5T41A 5DZ6A 2Y0SD 4EMDA 3V9SA 2B7CB 3AVMA 2IRYA 2AP1A 5JVGQ 3ZT1A 3CCEN 1S0OA 4DKWA 3ITHA 2VPWB 2HBKA 1XN9A 4CJVA 1T9UA 1BOTO 1TTHB 3KLGB 3OLBA 2VD3A 3G6ES 1IKYB 1Y5NB 2GNKA 1P8GA 2UUCK 4BRPA 2Q66A 2FJDB 3NGDA 4MIWA 2B9WA 2OPSB 4OKKA 2VPZB 4USTA 2HBQB 4DLEA 1BISA 3OVBA 2BVZA 4KV8B 1WHYA 3QJLA 5F2RA 3IC1A 4OPJA 4QOTA 1YJRA 2G8UA 3IWXA 2AYBA 3QFPA 1UWBA 1PYSB 3TAFA 2DXFA 1JB0C 4AQYK 3VGTA 5BJRA 4KFBA 3CD0A 2I0XA 2P6SA 3N6LA 5L1IA 3QSIA 3V1QA 1NHKL 3HVWA 2Y8WA 4BLGA 4EK2A 4KHPJ 2C2ZB 5HL7L 3O3HA 4Q0BB 2WBRA 3CJAA 5J2PA 3HHLA 4LF5K 2L3MA 4D3GA 3HKWA 2DH9A 2QFJA 5KI6A 2RUGA 4TN2A 4NE9C 2ZJRL 3GFXA 3LWLA 3SDEA 4HKQA 3VGMA 2MY8A 1HYSB 3GDQA 4QOZB 3J7A1 1HWIA 3D6FB 2Q0RA 3EL2A 1V6HA 2E5GA 2V7YA 3MI7X 4HUEA 3CO9A 4CO1A 2M70A 4BRDA 3ZETA 4RUCA 3LP0A 2EG2A 4W5TA 2YH1A 4BQZA 4NLUA 2FLOA 4Y0WA 3R2CJ 4FWKA 5A8WA 4GNIA 1S9GB 3BGRB 4P7VA 2Z57B 5CAAA 2XLKA 5IQQA 1KD1T 3NCPA 4X66K 3SAHA 1FKPA 2D0OA 4DR2F 3MM9B 1SKRA 3QGGA 1M1KT 2ZHOA 4AXJA 2KXHA 3GONA 3BR8A 4P73A 4BS2A 3M2RB 2ZH4A 3GU0A 1QHTA 4YB5A 3TO8A 1G6BA 4KHQA 3AVKA 1P90A 3M30B 5C5JA 1RCXB 4NO7A 3D7SB 1RT4A 3IS9A 4HI1A 3L4BC 4TSXA 3TPQA 1DTQB 2F8MA 2DKOB 2VFVA 4QU6A 1ASWA 3C6TB 3BQ1A 2YWHA 4RWWA 1FW6A 2LQBA 2VBXA 1CC7A 3MOZA 1XERA 4WXWA 3IFRA 2V68A 3D45A 3B6BA 3UWTA 2QYCA 2Y9HA 3FCWA 1L5UA 4DV6F 4XAKA 3EY1A 1HWKA 1ZOTA 5C24B 3KG0A 5I3QA 4OZ3A 3DRXA 4I6AA 4A47A 2XLJA 4RNOA 4Z37A 2W1BA 4NLTA 3PJXA 1J53A 4BDZA 3THYA 2YJEA 3SMSA 1RAEB 4ZS6A 3VA0A 1JLBA 4OMFG 5HP1A 2V52B 4OX6A 2ERRA 5K5MA 3GWCA 2NUBA 4B9VA 1Y10A 1JLAA 2HNYB 4IFVA 2R4FA 3IGVA 1YBAA 1SCJB 1KN6A 1SH2A 4K43A 4TVAB 3SFGA 5HJYA 2XYPB 2RQMA 5DQHA 2MQQA 3BBFA 2HHHK 3W5ZA 4FKXA 3SCXA 3M6GA 2H5EA 3ZZOA 5GIPA 4U7UK 1ZPWX 4JLHA 5A76A 2OSRA 3VMFB 1TK5A 3WC2A 1DJ0A 4QWEA 1S0VA 4JI6J 5CQGA 1FTRA 1SKWA 2GGPB 1R0AA 3NNAA 4PA1A 3D1QA 4BQLA 2W01A 2RUSA 1Q79A 1U24A 1RDRA 1Z26A 4E98A 2E5LF 4GKJJ 2BE9B 1KFSA 3OYMA 1X4EA 2ZDPA 2FBTA 3RVCA 1TUYA 2CDQA 1SAZA 4PWDB 4RW7A 1TKXB 1RBTA 2VGMA 2PEHA 1S5JA 3OYIA 2FBXA 3TA1A 2E4LA 3WXKA 3DM2B 2RILA 2Z0GA 3OYKA 3NGRA 3Q8RB 1IBKK 3GV8B 1ZBUA 2R8HA 3P4UB 4LF4J 3U9DA 3AO3A 4CF2A 2C2RA 2JEFA 1PO6A 1NK5A 3MUTP 2ZBPA 3MR5A 3CE8A 1K0VA 4BRHA 4CYUA 4WF9L 2K1RB 1VQ9S 2QKBA 3MECB 4X64J 3U9ZA 1WHVA 2LVWA 2YQ3A 4HEA9 1K47A 3KKRA 3FR0A 4AHTA 3O9TA 3J7YU 3LDQA 2GJFA 4JK9A 1V5IB 3P83D 1PBAA 2B9YA 4XDCA 1TK0A 4YDXA 3VESA 4R5PA 4JKBA 2O3DA 3D6TB 2OTLS 2ZITA 2WZ1A 1U8SA 4M5GA 4DR4K 1MW7A 5F0XA 4Q8EA 2K3IA 2FSNA 3GE1A 4DCPB 1S0NA 1W7AA 1NK6A 3TOQA 1VISA 2LP4A 3HPHA 3MWTA 2HQ3A 3N01A 2VHGA 3H45C 1RT2A 1Q5YA 3N5BA 1QQNA 4OYMA 4DCJB 1HLUA 5SWMA 4PUOB 2YHAA 2FGOA 4UQGA 3CQXA 1QSLA 3GIKA 1CEZA 5M1QA 2AJ1A 3CJ0A 1WJ9A 1R3NA 4M7XA 2DISA 3N6MA 2ZVIA 3SEOA 3TEHB 3KHYA 4KPYA 3P49B 1VJQA 1P1LA 3SJHA 2Z56B 3TUJC 4PQUB 1EWRA 2VWKA 1TYQA 5A2QU 4Z0UA 1IBCB 1YQHA 4CHZA 1B4SA 2AJ2A 2YWEA 3ZSWA 4J5OA 1J54A 1LV5A 2LU2A 2NXUA 2CPDA 2KDOA 2YV0X 4RG8A 1TMJA 3E01B 3L2VA 1OPIA 5C12A 1FE0A 3KNAA 1ZBLA 1NDPA 2G0CA 2JRSA 3H98A 4N8NA 3KK1B 1MN7A 3NVMA 2B6AB 5EXWA 4CCHA 3UKRA 2V2QA 5AQVA 4MYUA 4A62A 3D2EA 4WFBQ 2CQ4A 3K57A 2CPXA 3FEYB 4NB4A 4MYTA 2B4UA 4B3OB 2AIRB 2F3JA 3GLJA 1OS5A 4PXDA 1ZETA 3GSDA 2QXFA 4ZVPB 1U6FA 2PYJA 1PC4A 3TR5A 2GFFA 3D2WA 3PW0A 2W2OP 1X8DA 3RBZA 1HKCA 1KLMA 3PX0A 2E1YA 2WB1D 4LRAA 2G2ZA 4DR5J 1Q18A 5IM0A 1YTYA 1RLCL 4L74A 2NS1B 3IGNA 5ETMA 4NRTA 2C3OA 1C0UA 3RZAA 3I8BA 1OQ3A 4JHDA 4M94A 3VEWA 3QESA 5A0YB 1R89A 1TKTB 2ASLA 2CXEA 1DFDA 4I2PB 4CF1A 4K50A 3JAMU 4TNOA 4FW2A 4U7UD 1UOCA 1QSSA 2J9DE 2AGOA 1TFWA 1YTUA 5AQTA 1WF0A 5J1EA 3G8TA 1VQ5S 4R25A 5KFXA 4ZPAA 3NF8A 4BE0A 4OQJA 4PL7A 2JFDA 1EX8A 3BP8A 2HVZA 2MZJA 5GADU 4ZMMA 2ZH5A 2UP1A 4JNEA 1FDDA 3CMEN 5I3PA 3F9MA 2V63A 3GR1A 1WBBA 3GTYX 1RKIA 2DH8A 2ZWHA 4P10A 1HA1A 1RQ0A 4CD3A 2YNGA 4C0OC 1ZM4A 4LSNA 2RAQA 3OJUA 2XS5A 4GO7X 1RU1A 3FRZA 5AQZA 4IOCL 2GQCA 2N4CA 1TFYA 1QAXA 2W7OA 2N3OA 5EOYA 2W41A 3IAS9 2I38A 3P5BP 2QSFA 4X4PA 5IOLA 4TYBA 1ZBTA 2IVYA 4NZ0A 3FMBA 3I5CA 1LFPA 3FBFA 3MXJA 2AA4A 2HZVA 3C15B 2DIVA 1S12A 1NDCA 3FKBA 4NLPA 2H4WB 4K2XA 4CW7B 2DTJA 4EO8A 1NBWA 2F4VF 5A8KA 3PX4A 4FJ8A 5F8HA 4NYZA 4P2SA 2ASOA 3W9IA 3N4QA 3EKUA 3SCLE 3AA8A 1VQ7N 3DOLA 1Y5IB 3D1OA 1KAZA 1NKEA 3NCRA 3ISZA 4DQSA 1KP6A 4ZCMA 5IT4A 3I9V9 2KJVA 5J1NA 4LF1A 2V67A 4CZIA 4C3KA 4PKGA 3J80Y 4CJ4A 4YHHF 1ZS6A 3N79A 1NWKA 5I9EB 5H1SQ 4MK9A 2O8BB 4ZP6A 3R27A 4AL7A 4MIBA 4DR6J 2DHGA 3QPIA 4K0KJ 4PXBA 4KGKA 3SQGB 3RMAA 2IRUA 4DL2A 1M1KO 1T11A 1WSIA 4GVMA 4CP5A 4DV2J 5HQLA 3RMBA 2XMMA 4JI1K 4E89A 4K8ZA 4F4XA 3AY9A 2GHVC 3T1YJ 4I4BA 4I9QA 2FVCA 1K8KA 1UA1A 3CM5A 2KYZA 3R6MA 2V8HA 1RILA 3PJWA 3T9ZA 4OZ0A 1REVA 4I6WA 3NCIA 1YDLA 1VQMS 2A6AA 5KT5A 1LEOA 3FMWA 5F8LA 2BX6A 4OIXA 3ZT4A 3DNCA 4DR3K 4HHUA 4DZDA 4IR9A 4IZ9A 4FP9A 5E5NA 3SMZA 2RE2A 3MTJA 1S6QB 3B6PA 1RTHB 1I1GA 1FO1A 4B9NA 1ZAWA 5B08A 4X2BA 4WFAQ 3THXA 2OGUA 3MMJA 4KHPK 2UVWA 5IT9Y 3T5KA 1JLQA 4H4OA 2QWOA 2JC1A 4MKAA 3AA4A 1Z25A 3ZFVA 1RWPB 2LMIA 4B08A 1TV6A 4RW9A 3GOIA 1MN9A 2J0SD 1WOOA 4FWLA 3SJJA 1N36K 3DLLQ 1Q7YO 3TNVA 2A6MA 3LPUA 4Z4EA 4ICLB 1VQKS 1QUPA 4IOAQ 1VBZA 3DYAB 2CYYA 2V51B 2QLXA 3VF0B 1VK3A 4PAAA 2O4IA 4ED6A 2AQ4A 4DPUA 2NXEA 2UUBJ 1NPRA 3GJSB 1APSA 3CCSN 4BGAA 3D68A 3NS6A 4CO0A 2AP6A 2X3GA 1FERA 2CIMA 1QE1A 4Z4FA 3DLKB 3V2UC 4DR4F 4QW8A 4O0IA 2RQCA 3M1FA 5KFAA 1DT9A 3QERA 5KTQA 3WDOA 2HOEA 5J2NB 3MPYA 1FESA 4FN5A 3DRYA 2PI4A 1QAJA 3TVYA 2YNIA 3M2VB 5C25B 1LOTB 3ZNUA 4OX9J 2GZOA 4P75A 2KM8B 4YR0A 2OJ3A 3V4IA 2CQPA 4X65K 2QKKA 3L4IA 3LA0A 4LQ3A 4JOUA 2YX4A 2D3OR 5K8MA 1YSJA 1BG3A 1EP4B 4QW9A 3M5RA 1ESVA 4DG1B 2RD5C 2UVRA 2DEJA 3CCJS 3VGLA 1XIQA 3AXMA 3TJ8A 2D9OA 2X51A 3KWMA 2GMLA 3EZWA 4ZN1A 1FKOB 3QJJA 2HFUA 3GE9A 1PKUA 1WSHA 4C98A 3WXJA 3I55S 5MLCV 4ZVEA 3ZEUB 3EVWA 2A1SA 1SL0A 3AGKA 3SSRA 4GV6A 4O8UA 4RU2A 3CDEA 3NNHA 2HNDA 2ATLA 2GAGC 1VRTB 4M95A 4B1WB 1RT7B 4BACA 5GMEA 1U1OA 2B4VA 4Y2AA 3CF5Q 1RT3B 4K8RA 2PI5A 3H42A 3MWBA 3SQ4A 1A5XA 3IRXA 4PWUA 3PYEA 5FLXY 3D2FB 1RCHA 3RR7A 2BJ1A 4H0PA 3PFEA 3MXIA 3NS7B 1TL1B 3ULDA 1OH6A 4KE5A 5F8NA 1HARA 4A5BA 5SUHA 5F1XA 2XYHB 1XNRJ 3PEJA 1F21A 4GMJB 4KH4A 2CPJA 3P4IA 1YVFA 5FPEA 3H5UA 3RJMB 2IHR1 4B1UB 4CEBA 1S1WB 4WFBL 3O5BA 3LTOA 1LK7A 1RDUA 4KQZA 3CCMS 3ZSXA 4ZTJA 4CZCA 5HLFB 4P6QA 2RRBA 5KFEA 4JN4A 4JI6K 4KH6A 3TZZA 3M8PA 4DTNA 3RG6A 3BM7A 2B3TB 3G6XA 3BYPA 4CF8A 2CJKA 2X1BA 1T03A 2ZBCA 2ZJQQ 2LECA 1VSMA 4N77A 5KG7A 4GKJK 2N7YA 1YUWA 3WZ0A 2KFNA 1XNQF 1GMUA 5BR8K 4KC5A 3SSSA 3KJVB 4RBUA 1HQ2A 1HJRA 3TAPA 1SH3A 3CEDA 5AJ3K 4PKHA 3G4SS 1XWLA 2V2ZA 2Y1JA 2NSCA 2QLBB 1OIAA 1LK5A 3R5AA 4I56A 5C15A 3IG1A 3DHXA 3VEXA 3J7AP 3VN5A 3MAAA 3UNYA 2Q3PA 5CYJA 2FY8A 5C2GA 4DL4A 1ZC6A 2UUAJ 1RDBA 4LF4K 3JQMA 5JVHQ 6FDRA 2P9LA 2UXDJ 2YKMB 4IEEA 3W2VA 4X64K 4PYAA 3H1QA 2ROGA 2CRLA 2DFFA 1R8PA 2DO0A 1NJIT 3RAXA 4CF9A 2MTLA 2A41A 1SZ2A 3PRDA 4DV7J 4CIFA 4OL8A 4DSIA 4NLQA 3EZUA 4FJJA 4WIQA 4FLXA 5J2QA 2W24A 1H7WA 3MTKA 1W2IA 3SMPA 2F9TA 2XMJA 2WUSA 1IXKA 1X3MA 3UKUA 2JC0A 4KTWA 3WQTA 3W2WB 2OD4A 1HX1A 3VWSA 1TKDA 3QFWA 3PVXA 2DITA 2WSFC 3SI8A 3H2UB 3CCUN 4HT5A 2B43A 3D9BA 4KTZA 3G2XA 4ECSA 2XCPA 5K14A 1HBMB 3FBCA 3N6NA 3RRGA 4JK7A 1OVQA 4RU9A 1HIYA 2J0XA 3MEDA 1HPMA 4FPBA 3L2QA 1VQ4N 1SH0A 3QLHB 1TUWA 5CYMB 2VQFK 3OW2M 4DR7K 4J9PA 3LP3A 1UFWA 3BBCA 4C8LA 2E5JA 3EN9A 1WOSA 3OTEA 3C14B 1K44A 3VENA 1LXNA 3FBEA 3ENVA 4FWNA 1FDBA 2DGWA 2I6WA 1LW0B 4UY85 2XMUA 1GLBG 1VAZA 1VQ6S 1RT6A 5KOWA 4N8OA 1FD8A 2L08A 2ZJPQ 1T3VA 3DJCA 1NHVA 2YNHB 1FRHA 4DCOB 3IWLA 5B09A 1Q8BA 1IBMK 2RN2A 3O3FA 1TGOA 3NBPB 3CD5A 3MM7B 3P6YC 3K5OA 2VBYA 1LWFA 1EKSA 1KQGB 3UCUP 4KHUA 1G4CA 1UA0A 5BREA 5KFCA 5D6GA 4C8MA 2YBVA 1S9EB 2V2KA 1RP5A 2GAHC 1HRHA 4PG4A 1H98A 4E19A 3EE8A 3OR1A 2FD2A 3KG4A 3OR2B 5DM6Q 4KHPF 4DR5K 2OEJA 4PG7A 5M1FA 3ETOA 2NZTA 2VWJA 3DRSB 4KGMA 1CS4B 1R8BA 3D28A 3HULA 2QO3A 2BR0A 1H72C 3AO1A 3GP9A 2HFZA 2V2VA 1JLFA 4XDDA 1HBUB 2GIQA 1CJUA 4H4MA 4XPCA 2QK9A 1RWWB 1JJCB 2R2TA 2KM8C 2MLXA 5T7LA 2QC3A 3DKDA 2M52A 5K20B 5DK5A 1RUSA 1EXQA 1RGVA 4DQRA 4WTYA 4M5IA 1KFDA 1T05A 1N8RT 3HFKA 4R8UB 1RGIA 4HACA 5BYSA 1RDDA 2K7KA 4H8KA 5IC6B 2AD9A 2MJNA 3CQYA 3UPFA 3WX4A 3G8SA 1IG8A 3CJKA 3LDOA 5A2QO 4ES3A 2VUGA 2ZC4A 8AT1B 2ATQA 1W25A 5M2PA 4URQU 2VGNA 3AFGA 2BKNA 3ULHA 1VSDA 4UZBA 1D5AA 4Z4GA 4X62J 3A8YA 4F9OA 4K5RA 1WSVA 4L3NA 2P9SB 3BO2A 1R27B 1DKGD 4BRIA 2QX0A 1SIWB 1X9MA 1GOCA 4DEZA 1S1VB 2PT0A 1DURA 1Q82T 4WK1A 1NGCA 3M6VA 4NLOA 2WSEC 1HPZA 3HDSA 1S6PA 4AHSA 4JAXA 4H0VB 1SUQB 3R97A 1M5OC 3IR6B 4IDKA 1BE4A 3UE5A 2RMLA 3FJ2A 1KVBA 3O1BA 5HMZA 2F4FA 1XR7A 2DNYA 1ZAXA 5AQPA 2B7BB 4JS5A 1RWOB 2EXUA 5IV4A 1RE1B 1HHSA 3A13A 1WOQA 1N0UA 3V6DA 3GV7B 2I7PA 5BRFA 3ID6A 3LP2B 1LNQA 2QZ8A 3V1RA 1AZSB 4DN0A 3JAMO 3FGVA 4ILGB 2HVIA 4NXMK 2ZNYA 3J81Y 4M41A 1CLQA 1YLXA 5KGXA 5AT1B 2N7CA 5J2MA 1U1QA 3NKYA 1K9MO 5HROB 4A8MP 4CM2A 3MEEA 1JLEB 1RTDA 4B3TK 4DQ8A 1F6TA 3GFYA 4OV1A 4DU7A 3OBIA 1ZA1B 2QXLA 3S8SA 5LJ5Y 2L41A 4DR6K 2QGFB 3FVYA 4TKTA 4NPOA 5M2UA 3TSPA 3AH6A 2C2MB 4JV0A 3CCQS 1NXIA 1RWNB 3A0IX 2OI2A 3PHTA 2FC0A 2NSBA 1IVZA 3OYNA 2VFUA 3MEGA 4QR2A 3O4QA 3ZSYA 4FXVA 3CULA 3RWUA 4A8WA 3MCSA 1Q8IA 4I64A 1N6QA 4JI6F 5AXLA 1SQEA 1WKKA 4ATNA 1EETB 1YZ6A 5HANA 1Y7PA 5G0RA 3RU0A 1EHWA 4ZP9A 2GVZB 2L9DA 1X1PA 2D3ZA 2ZD1A 5DLFA 4M5HA 4RW8A 4X4OA 1J5OA 3TAQA 2XSJB 5EWFA 2QM1A 4P71A 2CWKA 4B3MK 4GKJF 1BLUA 3VAGA 3OYBA 4ZVRB 5BR8F 1BDGA 4G65A 2UZAA 5FIIA 3HI9A 4BVOA 4J7CA 4F67A 2FTRA 2WVCA 5HVGA 2E1RA 3WNGA 2YKNA 2E2PA 4EEYA 4F36A 2P9EA 1LW2B 4UOCA 4RW4B 1WACA 4YOVA 4KB1A 1IKVA 2I2YA 3ET6B 2FZCB 4FDFA 2ZC3A 2H51B 1RYRA 1TK8A 2MGZB 3NEKA 4LF4F 3KIOA 4ZPVR 2ASYA 1WAJA 1QAYA 2G1HA 2FQQB 3GB0A 3H20A 4ZIWA 4X64F 4G9ZA 2ZOMA 4ZPWR 3IUCA 2L48A 3OYAA 4CJWA 3OHRA 3ITHB 5HK4A 1CZBA 1FNOA 1SKUB 4YOUA 1I5OB 4NXNJ 3AA2A 1RFQA 4CEZA 5JVHL 2BRKA 1ELOA 1S6UA 4FYYB 2R8IA 2QTDA 5HATA 3EUNA 1E6VB 4BR5A 3SSQA 1YRUA 4OHYA 3GL1A 4RTFD 4FYWB 4WFZA 2KZMA 1G99A 1R59O 2RRAA 3CDWA 4FJ9A 2CPHA 4ELTA 4PZVA 4HTJA 4KGZB 3Q2SC 1QAIA 4GRSA 1YKWA 5KT3A 1FD2A 2I5JA 1MMLA 1SV5B 1C2PA 2HFNA 3L7PA 3C6HA 5EX5A 4USHA 3M4XA 1HI1A 4MH8A 4JI5K 4KFBB 2J76E 4DR7F 2W2NP 1RK8A 2VASA 4TU9A 1K6YA 3Q86A 3I6PA 4B3RK 4JV2A 1VYAA 3UCGA 2R7OA 5EVZA 2IJFA 2FF3B 4Z7CA 3P96A 4QIWD 2JWKA 3AA3A 4CZGA 1TU0B 1HKBA 5J2PB 1VSIA 3R7SB 2HFOA 4D3HA 2QL7B 2OD6A 5L46A 3Q2TC 3P5JA 1S7IA 3L95X 3SDEB 3GCWP 5H1SV 4XK8C 5L1LA 3PO5A 3L0QA 3WIVA 5GADP 4NMLA 2EFVA 2DEIA 3VQQA 3HP9A 3L3UA 4F02A 5L1JA 2AYEA 4QU7A 4K2JA 1HFEL 1ZZNA 4WP3A 4OPAA 4IEIA 4B17A 3MOJB 3V6JA 1Y64A 2ZJPL 1AT1B 4IJNA 1WG1A 5KFOA 5AXNA 2HHXA 5AFUA 4G3IA 5M1KA 3LP0B 4DSKA 3PIPQ 1XNRK 1WC1A 4C48A 1RACB 2P5VA 3MR3A 4FWMA 3EVMA 1FJGJ 1GOBA 4DWIA 2NQPA 4KREA 4JI4K 4FLYA 4NZ6A 1OSDA 2PA3A 4DR5F 5A8WB 3BO4A 3M3ZA 3UVJB 1VQYA 1JXEA 1S1XA 2OPPA 4ELVA 2X1FA 1X9SA 3GIRA 2B8PA 1BC6A 1FKPB 4PEOA 2HLTA 3BKTA 4LRBA 1HD1A 5F8MA 4B3SJ 3LPTA 1DAXA 4E1JA 3B54A 2ZUGA 1JNRB 1A9NB 4NYNA 1SIZA 3IS9B 4A57A 2JFKA 1KOOA 2PN6A 4MQ3A 1RI7A 3KMSA 4DSFA 2BJ8A 1HW8A 2DPJA 2R7RA 1L3KA 4O44B 2XI2A 2OTJN 2E9TA 2YHYA 5CR4A 2WVFA 5AE3A 2DY9A 1NGJA 2F1FA 1IWGA 1C4AA 1CJVA 2NXNA 1U8WA 4WK3A 1Z2LA 3MN5A 2OEMA 1O6XA 2KG1A 3T9NA 4K4SA 1LWCA 4I7FB 4DU1A 4O4GA 1GK8A 1X5OA 5D8HB 4OYOA 2YWKA 2DNZA 1VQOS 4M8LA 3BQ2A 2OPQB 2V4JA 4RCHA 1UCNA 5LSLA 3THYB 3RMCA 1B0TA 2VIHA 4PG6A 2FBYA 4K4TA 5CHCB 3PG9A 1U02A 2Z1JA 2HAFA 3BGOP 4RNFA 3SZ2A 3PEHA 1GFWB 4W92B 3DOMB 2B5JB 4J9NA 2ZBRA 3U7JA 2ZZNA 2DR8A 1MWMA 3QETA 2W9BA 2HIYA 5CD4A 4PYDA 1RHJB 4A8YA 3AXKA 2B4OA 1HNXJ 2H1YA 4KGVB 2LQ9A 2HFSA 3R1XA 1TKZB 3O9SA 1N33J 2V69A 4Y6IA 4K8XA 3ISNC 2H5JB 1R0AB 1Q8LA 2B9XA 2OTLN 3W9JA 1UVLA 3ZTQA 5GAEU 3H5YA 3QRQA 1EARA 1RAJA 3RB6A 2HNZA 4FVUA 4BC2A 4TY8A 4NLXA 4B3TF 4OLPA 4Y1CA 4BRFA 3H46O 4NCGB 4LUBA 3QJPA 4DR6F 4K0KF 1QHAA 2NRXA 3KJQB 2NREA 2CGKA 4DV2F 4OI0A 3AJ1A 2GIRA 4USKA 3CCLS 4P74A 1LAVA 5AZIB 2FZGB 2O8DA 4NASA 4N5SA 3L4QA 3T1YF 2B51A 1RISA 3WEEA 3VEZA 1QQMA 5E41A 4J2DA 2KKHA 4KR0B 4CEAA 5KFWA 3PXGa 4CH1A 4CLKA 1KC8O 3Q7BA 4CYUB 1P1TA 3DLEB 4K4VA 3ZT0A 1RAAB 3BF3A 3WNFA 1JLGA 2CZ9A 3M9OB 5BN9A 5CZ2A 1CXUA 3VQEA 3QGIA 3DLHA 3HM8A 1SL1A 1JKHA 1YJNN 4LFAK 1HNIA 4BWMA 2X6NA 4DV3J 2VWBA 3MR6A 2OPRA 3BSOA 3H5SA 2O8FA 1WF2A 1C0TA 1C1BA 2CQ2A 3ATUA 3W62A 3PO4A 1NH8A 4OI4A 1J9AA 4CJFA 1X4HA 4FWRA 5BPLA 3R9PA 2I9SA 4F26A 2WRMA 2ZQBA 5M1OA 4AE5A 4QIVA 4KKOA 5ADXH 4WYLA 2OP5A 1U45A 3CGIA 3NXZA 3AARA 4WQ4A 1DY3A 5B0FA 4LF9K 3DGPB 1T95A 4USJC 3KLFA 3Q89A 3RAMA 4C8KA 2CVEA 2RU3A 3LP1B 3TA2A 2CG8A 3LO3A 2W42A 2UV8A 3PSFA 2QW9A 2XGQA 1TYQB 4ANDA 3P8BB 4P52A 3NF7A 1VQ5N 2R9LA 5HRRA 1FT8A 4ZLPA 2XSFA 1EIYB 4GC6A 3T6BA 4LH5A 2H5IB 3FFIA 2E8AA 5AQQA 4WP8A 2KLAA 4X62K 1VQLS 4F0HA 3OHAA 3O6QA 3ZSOA 3PKYA 1FX4A 3V9ZA 2M8HA 4OO1J 3D2EB 3Q8YA 2IIHA 2R8JA 3SCKE 4DUYJ 4JI5F 3G82A 2QA2A 1BHNA 3AO2A 4CLTA 3V9XA 2B9EA 2BBEA 3T5LA 4KBOA 4JRQA 1XC9A 3FSYA 3T69A 3X3UA 4A2BA 4FZVA 4LRFA 2QWLA 3HSCA 1C0UB 3AAQA 4YY3K 1TL3B 2I7NA 2BJEA 3IAYA 3C66A 3MFHA 2IGIA 3RGIA 4B9SA 4WU3A 1IBLK 2Z2YB 3HLUA 4CGJA 4I6MA 2W9CA 4N76A 2APOA 2MY7A 2PYLA 4I2QA 4CJ7A 2PE8A 4H54A 4CGHA 3DXSX 1T3OA 1HHTP 4G6VB 1LQ9A 2UXBJ 1NG9A 1XNRF 3I33A 2XO7A 3D6HB 3D0HE 2AEFA 1BMQB 2HZAA 5B0AA 4NI2A 3KG1A 4MJKA 5DM7L 4GV9A 1XBWA 3RR8A 4GO5X 2G4BA 1TUVA 2WW8A 4W4MA 1HWUA 2YNGB 4LSNB 2XMKA 1KEKA 3BSNA 1YITS 3VQDA 3VQAA 2RE1A 1GAOA 3MXHP 5E0OA 1B0PA 1RJJA 3BZQA 4EU0A 4KRWA 3CC7S 3B4MA 2VPYB 1WTFA 3PYFA 4GVBA 3GJRB 1GX6A 3FCHA 2FJBB 1XMQJ 4DV1K 4UT4A 5EDWA 1KHVA 4Q45A 4DL3A 2NYHA 3OW2R 3BO3A 3NP5A 3SBMA 1MMNA 3CIMA 1IKXA 2EFOA 5EHHA 1MWKA 3BF1A 1EWQA 5A8KB 3QQCD 4F4KA 1BA0A 3H90A 3L2WA 3TJAA 1RBUA 4QYZJ 5KG6A 1FNXH 4OPKA 3DOLB 1H6KX 2RS8A 1HNVA 1VK0A 1JLCA 1M5SA 3MUMP 1VC0A 3ULEA 2CJAA 3GPAA 3I9ZA 2UUAF 5B0GA 3PW5A 4P72A 4BR4A 1TVRB 4DU8A 3N28A 2UXDF 5AXMA 4QWBA 2DNRA 5E7OB 2RRNA 2E5HA 4KHWA 3MX2A 3GMGA 2UUCJ 2DT9A 4M3TA 4O3QA 2QA1A 2R8KA 1XR5A 4JKCA 3CNQP 2CPEA 1VQKN 4OLOA 1AYEA 4DV7F 3CT9A 3T1HJ 2EVZA 3VQCA 3AODA 4DI6A 2EC0A 1SC3B 4QPXA 3NH2A 4ZHRB 3OUYA 3VGVA 2WOMB 2NRWA 3NFAA 4QR0A 3KLIA 4YORA 2G8HA 4NYFA 4AQYJ 4B9UA 3IR5B 3ZZZA 3I31A 4FBUA 2FDNA 1REVB 2RHKA 4MK7A 3WHIA 1UJ4A 5HI7A 1RWKB 3HL8A 4NA1A 4DX8H 4HUFA 2OZMA 4JKAA 2HPUA 1N56A 2KRBA 3V81A 2HF3A 1UKUA 2W8KA 3O9QA 2GHPA 1FRXA 3SAFA 2RKIA 4GMKA 2BE2A 4ZVGA 4FPAA 1MWYA 4CQ1A 2D5RA 2XB2D 3A2FA 1M90T 4LF5J 3V9WA 4AUKA 4JI8K 3CB4A 1SJRA 2LEAA 5KFHA 5KQDA 1LCUA 2OEKA 3THXB 5AQSA 4M5MA 4USUA 3DLJA 1JLQB 4H4OB 1U7LA 2GELA 5G4DA 1CXQA 3O6WA 3OVAA 1TV6B 4RW9B 2JEGA 1BI4B 5GAGU 2KHDA 4KJIA 4LRDA 3VF6A 3MEKA 4Q43A 3HVRA 3QB0A 2MQLA 1YHQN 2PMZD 4LFBK 2C1EB 2RDDA 2MB0B 3T1AA 2F8TA 2V94A 3IBWA 2YHXA 2F8EX 1ZXOA 3R8YA 3FCVA 2MMYA 2LKZA 3PFOA 2CKWA 1N5QA 2DHHA 4KB7A 1TP7A 4X66J 1RA7A 1Q81O 4BREA 1QE1B 1NZAA 1WC6A 5TKWA 3NAEA 1PIEA 2IAJB 3VPZA 1YJ9S 4BRLA 5SZTA 3H4DA 2EX3A 4O3OA 1H2TZ 1EX4A 3CC4S 1WKJA 4M5LA 2YNIB 1WI8A 4M3XA 4FS2A 3AVGA 1HNZJ 4OJGA 4CI0B 2RPIA 3KZBA 1YJUA 1UZHA 4O4RA 3CCMN 2EC2A 4CLPA 2ROEA 3D1HA 3TANA 2PSZA 3GZ7A 4Q8FA 3ENWA 3FEXB 2LYVA 1WG5A 1FJEB 3Q8VA 1S72S 1DTTA 5LT5A 3IR7B 4FYVB 4L3QA 4B1VA 4J91A 1JJ2M 3QIDA 1NMDA 3KLHA 1QUVA 2CNNB 4ED3A 5L38A 4M3WA 4M5DA 1BGXT 3ZT3A 4P9SA 4DPYA 5DG8A 4B9TA 2MLYA 4G1QA 1PG5B 4LMZA 3T6JA 1S49A 2DR5A 1J6ZA 3IWNC 3TAEA 4CTAB 4FNHA 2M4MA 4DV5K 4NLDA 5F3TA 2K2PA 4X62F 1UVIA 3VAFA 3F5TA 3U3GA 3RB3A 1RAOA 3C46A 3IRXB 3G4SN 3DMJA 1NB7A 2MZQA 1T9XA 5LMNK 4Y00A 3A8KA 1X9WA 5CXTA 3O2IA 2HS3A 2HHHJ 1KKHA 3RW7A 2QL5B 1N5YB 4RWXA 4FXDA 3VQ7A 2BKPA 2DGTA 3MGJA 4FLWA 2KZZA 2DBBA 4LF7K 4EBCA 4PXCA 3BZKA 3VQTA 1RKJA 1UAWA 1FRIA 2GQQA 1S1TA 4YY3F 1HNXK 1BCOA 3LPYA 4CFCA 2XMVA 1UTAA 2W7PA 1N33K 4UZCA 1X5PA 3V5RA 2L9NA 1RBRA 4C8YA 4OLBA 3HVAA 4ID5B 4JV5K 2RB7A 1FWPA 4ECZA 1U0SA 2YKOA 2AKWB 2RQKA 4JKHA 1O5JA 3R9LA 5KFPA 5DDRC 4E0DA 1S3XA 3W61A 4FZXC 1RBLA 3TVKA 2BJDA 4CHPA 2QG9B 3P39A 3UN3A 4X4TA 1B99A 2LEBA 3HSDA 5CYQB 1IBKJ 3IXQA 4ZJOA 4FJ7A 1X4AA 2OPSA 2R2RA 1FFWB 3NAHA 5HRPA 1Q4RA 5KFVA 3TVZA 3IG1B 2DNOA 3MAAB 2LDYA 5E3RA 4CO3A 4Y2KA 1SL2A 3E9LA 4E7KA 2QA4G 4QYRA 3CC2S 1AW0A 1DEJA 1XMOK 2XS7A 2IJNA 4ECYA 2P9LB 2UXCK 2P8IA 3PDNA 1VQ6N 1VIOA 3KD1E 1RBSA 4JBCA 3H0PA 5FPDA 3ZZYA 3BKUA 1SJQA 1JK9B 1UW4A 1ZPVA 2IDEA 4DV0K 2XTJP 1FVSA 2IM2A 2HURA 4BR7A 1KDNA 3M8RA 4V19X 4NCBA 3M2UB 4OI6A 3A8IA 2BGGA 3AVIA 2EKNA 1HUXA 3CCES 1S77D 3F73A 1B70B 4C8OA 2BEFA 3WXLA 1HYSA 1XQSC 2KT5A 3MPUB 2D7SA 2LEPA 5HBMA 2IOCA 3OYHA 4AHRA 2EFGA 1HHQA 4H0YB 5K14B 2B0GA 2DHSA 1MWZA 4V19S 1ZM2A 4NLWA 2KFZA 3E66A 2RVJA 2ITGA 4DPTA 1Q9YA 3THPA 5EN1A 2VH7A 5E3QA 3NMAA 1QJHA 2IDOA 3LW5C 3W64A 3IMXA 2V9KA 2YWGA 2C28A 3WNHA 3M8YA 3ENHA 3UO0A 5ETPA 3N9UC 4IJAA 3BGRA 2AGPA 1YBUA 4NXNF 2DYAA 5C42B 4NEZA 4JI2K 3ATVA 4ER8A 4CIOA 3MM9A 5KAKA 2C2OB 1TUUA 3TUZC 4W5NA 3S41A 3MAHA 1VRUB 1Y0HA 1EQ0A 1SQGA 4ILLA 2HWHA 1S76D 2PD1A 4CDIA 3M1VA 2JVRA 2DTUA 1OQ6A 4FF4A 2BKOA 3B8AX 4ZA1A 5AQNA 1YT3A 1WHXA 2Q6CA 3SBTA 4TU7A 1U4BA 2VFTA 5BYQA 2ZH2A 1P8ZA 2GWKA 5IXUA 2E7VA 2K7JA 4JI8F 4XH1A 4JYAJ 2PFUA 1RBVA 1S22A 2QE5A 3UDVA 1HKGA 1C6VA 2IFXA 4RO0A 4G1PA 2ZWPA 5C24A 2VCPA 3AOCA 1FK9B 1RT5B 1YF5L 2AV5A 1FVQA 3OHBA 1R8CA 1BWVA 1D8ZA 5AR0A 3ENAA 2YY3A 3WC0A 1JLFB 2FBVA 5EGYA 1N5VA 5A6WA 4H4MB 4YB6A 3ZX2A 3LF0A 2R7WA 2HNYA 5T7LB 4L8RB 2M2BA 5A2QY 2IC3A 1MMDA 3PTWA 4LF2A 3KVGA 3U02A 1T05B 4OYZA 2HB5A 4WJBA 4UOHA 3RAQA 1QLNA 3V9UA 4V1Ak 1U0HA 2LLZA 4IFEA 3HOTA 1HBOA 3AVAA 2F7VA 1WF1A 2R7SA 4CIGA 2PO4A 2LCWA 1AUSL 1TL4A 2GUPA 3CJKB 4H03B 1FE4A 2UXBK 3KWGA 2WVBA 3O4WA 5F8JA 2QWQA 4YP3A 3OTCA 2W2MP 2HQCA 2GGPA 2YWFA 4C9DA 4J9MA 4ECWA 5LMUJ 3TSUA 3ETMA 2P51A 5F0WA 2QLWA 4WYBA 1WEZA 3NHGA 2V0NA 4FKYA 2NUHA 3CCQN 4NZ7A 4OI3A 3KWIA 3MFIA 3H40A 3C7NB 3IM8A 2FC9A 1S6PB 1QTNB 4DZ6A 4UTGA 5IC4B 3VQ8A 5FDLA 4IDKB 1S5ZA 1WORA 5DG7A 4AT1B 1TKXA 2KH9A 4JUZA 1AXQA 2BTFA 2GJ2A 3NAIA 3JAMY 2ALYB 1GLLO 3KHHA 4IO9L 4NOHA 5HSPA 1WUUA 3AVCA 2G9OA 3V6DB 4ETZA 1X4CA 4ZVOB 3T3FA 4F2SA 3W9HA 3L3CA 3GILA 5GAGI 2DR9A 3AVBA 4CFAA 1WC5A 3IDHA 4DU4A 3U1MA 4BC3A 4Z4CA 4DJBA 4FXWA 2MEWA 4JEPA 2K1RA 1C1CA 3MECA 2QEXS 4O0NA 5J2MB 2Y0BB 4YB1P 3BQ0A 3RSEB 3MEEB 2X74A 3WT0A 4MLHA 2ACYA 1D9AA 4JI1J 4J2AA 1GLJO 3QFUA 2F9DA 4C7QA 3OFEA 3A3NB 1Q78A 2BANB 2BOAA 4YN3B 4LREA 4LF7F 1ATSA 5BRHA 3G8QA 1JQGA 3T1HK 2R2UA 1MNEA 3TUIC 4BE2A 1HNXF 2F9JA 1NK7A 4CFBA 4DQIA 1N33F 3RUBL 2DPIA 4PUOA 3QIOA 2HVEA 5BPMA 3D5MA 4DR3J 2XULA 3K58A 1XHZA 4FLUA 5G0RB 2E1PA 4Y2IA 3KMQA 4M3RA 4JV5F 4FK0A 1N48A 4RW8B 2O8EB 2A2DA 1N52B 2GEMA 2BZ2A 4LR7A 2J9DA 1EKRA 4BRAA 4NWBA 4JI0J 4FLVA 1UEKA 4PQUA 1YJVA 4FM1A 3MM8B 2BJ7A 5LY3A 2J7KA 1YK9A 2GWJA 3E01A 2P9NA 3MWPA 2C2DA 4CHNA 1FWLA 1E3MA 4QPTA 5KFKA 1N36J 3LGHA 1GEHA 5DO2A 1DBDA 3KK1A 3ZYYX 1IKVB 2Q6BA 4JB8B 2W6KA 1UWAA 4CWBA 4JP8A 3TW0A 4ZJQA 5FD1A 3Q23A 1GT8A 3VZIA 2V9WA 5L39A 2MZTA 4PR6A 3B4DA 3K0SA 1XMOF 2WVDA 1PBUA 3CFOA 3HPOA 3G6VA 4IRDA 3BDEA 1BD6A 5F3ZA 2G0IA 1X4FA 2ZH9A 2C2NA 5JUMA 5J1PA 4KH0B 5KOXA 1DZ5A 1U04A 2P9KB 1XQIA 2DNNA 5HMXA 3I0RA 2UU9J 4H4KC 5A0YA 2MKHA 3AD7C 3H2VE 2P9UA 4DV3F 1IJFB 5BN8A 3OL9A 4QCLA 3PW4A 2GV9A 4X65J 1T3NA 2NRHA 1NRKA 4ZPTR 4BGBA 4EWTA 3CDUA 4HH1A 4W5RA 1HNZK 2I5JB 2WONA 2PFDA 4RKUC 2XMWA 5FRNA 1HYVA 1VMBA 2Z2ZA 1IUJA 5DRKA 3SLCA 2RJZA 2HSEB 3GJTB 2G0JA 3J81U 1T9TA 3OL7A 4M45A 3R7BB 3FZMA 1DQ9A 2XWYA 3SYZA 2ZZMA 1WSJA 2XY8A 4P7TA 3C16B 3DXKB 4LBPA 4JI2F 2VDIA 4BRNA 5CA5A 2P9GA 1G15A 5DDPC 1YAGA 2JWNA 3LL3A 3DDKA 1KTQA 1MU2A 3QRRA 4TYAA 3ZCMA 1HL6A 3HT3A 4BRCA 2FY1A 3I5BA 1WSEA 2CNLB 1TL7A 5AQGA 3TTDA 4CJPA 3TSQA 3MM5A 2GBZA 4PWWA 3WUHA 4DTXA 2GC8A 4BG8A 4ECRA 3HSZA 4DUYF 3C15A 2R7QA 3SCIE 4GC7A 3V6HA 1Q7YT 1WC3A 4DQQA 1SB6A 4DLGA 4JI3K 2VG6A 5GAHU 5AQIA 1VC5A 5H9FK 2CJYB 1BWFO 3CJQA 4OKEA 2J0QD 1OYEA 3MZIA 4YUDA 4PY5A 2GJIA 3I5AA 3OL6A 4CHYA 2AX0A 1AA1B 5DZ7A 1CBKA 2XHWA 4ZN3A 1AUDA 1OVYA 1XC3A 2EBEA 2P9PA 4BRKA 5EU7A 3K59A 3MK6A 1O0PA 2NCKL 2O8BA 4Y1DA 3KK2A 2OLWA 4DHYA 2VFSA 5BR8J 1WSFA 3HT0A 5K8OA 3C94A 4BC4A 4ZPDA 4K5SA 4U8VA 4EFHA 4AILC 3QSYB 3TI0A 3OYDA 5AJ3J 4WCEQ 3WQUA 4O8KA 1VLOA 1S7HA 3DAWA 1V3RA 2UXBF 5KFGA 3WXIA 5EX0A 1GH8A 3CHWA 2RSQA 2NR0A 1VFJA 4ZVFA 1MDUB 3ALYA 4O4GB 3HZ6A 1OH7A 2HHPA 1RB0A 2KHCA 3K8WA 2V4JB 2VICA 5C2CA 1TR0A 1QSYA 4CO5A 4EBDA 1WDDA 3DGVA 3NVKA 2BYCA 2XBPA 4U6PA 5MAOA 2FSJA 1VQ7S 2HBZB 1D9FA 1E4FT 1S6QA 1QD1A 4OYWA 4WXOA 1XMQF 2Q97A 1EZZB 4QS9A 3DRRA 2AHOB 2RF2A 1KR4A 1R43A 4RW6B 3CPWM 3G10A 3NWRA 1VGYA 1UZDA 1YX2A 1FFSB 3M8QB 5DG9A 5JXSA 6FD1A 2B56A 2JEJA 1ULRA 3NOCA 5LL6Z 1BQMA 3TEGA 1MA9B 2J9CA 4F3MA 1URNA 3HZGA 4MAKA 4JD2B 2HZCA 3HD1A 1LXJA 4A8XA 4C97A 3QGHA 3DYAA 2VQFJ 2DD8S 4CJQA 2RDJA 4DR7J 2N82B 1BQNB 4L76A 1WAFA 4FK2A 2DB1A 3CJ2A 1OWXA 5E33A 3VF4A 1F3FA 3VQBA 3S01A 2BJ9A 4URSA 3NGIA 5D0GA 1U1MA 1BL3A 4MKYA 1N32J 2FVQA 4F7VA 5IV3A 3AO5A 4U67Q 4A46A 3NWGA 3HD2A 1RABB 1F0XA 3O44A 5AE2A 4W98A 2OCEA 2UUCF 4LD0A 4DU3A 3BPDA 2EBGA 5JVGL 3RB4A 5GAGP 1RZMA 1C4CA 4LF8J 2XZTB 3T1HF 2F40A 2IVNA 3NLCA 1NM1A 2ZHBA 3S9HA 3WEEB 3W1YC 1IBMJ 4BG9A 1HYZA 3UD4P 4IRCA 1WG4A 3R5DA 1RHRB 2DK2A 4CEQA 2VG5A 3LOUA 2C3YA 5AQLA 4OZ5A 4AQYF 3SXLA 4AD6A 1M5PC 1M1GA 3MMAB 1EP4A 3OYFA 2VG7B 1OJ4A 2XMAA 4KO0A 4DG1A 3M8ZA 1L3TA 1V5VA 2I8EA 5ADZA 4OX8A 3VAKA 5D4OA 3CJRA 3K2YA 1I39A 2W2PP 3CJTA 1UAXA 1Y11A 4KPCA 4TY9A 3WNEA 2HK3A 1FNMA 2VF3A 3PZPA 1JJ2R 4LF5F 1JKHB 4JYAK 1RWMB 4CLLA 4DL6A 3ZZPA 1HNIB 4J8FA 4JKDA 2MQNA 2XY7A 1VRTA 1VK8A 2OPRB 3BS9A 5THWA 3VEVA 1O8BA 3QWUA 3CCSS 1C0TB 1N54B 2CGJA 4DS5A 1RT3A 5BPNA 4ED8A 5JMNA 2D74B 2Z8QA 1BA1A 3QZ7A 2FJAB 3MPVA 3MDQA 4BDYA 1UETA 4HDHA 4DV4K 3WXMB 5BR9A 4LR9A 1TL1A 1KNZA 1PYTA 4GV3A 3PYGA 2IMOA 2A1BA 2F9WA 2G2YA 2ILZA 3VQPA 5KG0A 1S1WA 1NPPA 4DF4A 4OYPA 3J7ZT 4ZLJA 2XG8A 1TL5A 3CCWA 2MZRA 7FD1A 4OHZA 3RTVA 3RBDA 4X66F 4YNQA 1FRLA 1GLEG 2ZBIA 3C6UA 2BRLA 1QVGM 3CCTA 5B0EA 2VBZA 2ZH6A 4O3SA 3FK4A 4QIEA 2MQPA 5LMUK 1AROP 1FDNA 5ETTA 2FLPA 1PAUB 4ES1A 1HNZF 2AWZA 3ZC4A 2HLUA 4USMA 3QATA 3CCVS 2NNWA 1CG2A 5F8GA 1YITN 1L3VA 1RHKB 1HQEB 1OH8A 1G2EA 3FSIA 4CEDA 3LZIA 2D41A 3H08A 3BYRA 2MQOA 2NLWA 4J90A 1RDAA 3H25A 1ATNA 4IH5A 4WTOB 1OH5A 1FXDA 2CPZA 4NXMJ 4FYDA 3BH7B 3CIZA 4CK2A 1VIXA 3MMCA 2JNJA 2F5GA 4O23A 1U2RA 4B3TJ 1FCAA 2YKMA 1I94K 1D1UA 2H9ZA 5DDQC 4A8FA 2VKZG 4ANEA 4I2QB 3SUQA 3ZNJ1 1W9HA 1OY9A 2VBWA 2QSWA 1SJ1A 4E7HA 5A8RA 4IKAA 2HHHF 3MURP 5D0RA 3EYZA 4PRFA 5AQJA 2HMPA 4ES2A 4JI3F 4XTTA 1RDWX 3LM2A 5FPNA 2PY5A 4O3PA 3JXUA 4IFYB 5LSRA 2HHVA 4IBNA 4FSVA 1HQUA 1T7PA 3W2WA 4FVMA 4DQPA 4HVJA 4HR2A 1T02A 4KIAA 3OY9A 3BN7A 1TAUA 2KRRA 1KTVA 5I4MA 3JYTA 1H74A 4ZVHA 1NM2A 1FHTA 2QA4S 3AVFA 2W25A 1HBMA 3OYEA 1IKWB 3OQ2A 1VCTA 4B3MJ 5HL7Q 1Q9XA 3QLHA 3AB4B 5BXIA 5CYMA 3M6WA 3LAMA 1ZBFA 2ZE2B 1F5AA 4OHWA 2RHQB 2ALZA 4J2EA 4IG0A 1JCGA 3U4LA 4JI0K 2R7UA 5HQMA 1SC4B 1P27B 3DRPA 2SXLA 3W3DA 2HRUA 3H6EA 2CAJA 1RAIB 4IKFA 1N0VC 2AYGA 1IBKF 4PL8A 1NJZA 1ZTWA 2J7UA 2XZDB 4Y28C 2R42A 3AV9A 4DMNA 2HVDA 2YNHA 3BZCA 3IKMA 1FXXA 2XQCA 3SQ0A 1EQMA 4E7JA 3TZYA 2HHUA 3ULEB 3GG0A 3NBPA 4XH5A 3KHRA 1PGZA 4WQ5C 3DLGB 2FHKA 1M5VC 3N5FA 3S3NA 3EE3A 1WWHA 1U2VA 1VHIA 3ENQA 4CZEA 1WKLA 5GAHI 3CFRA 2MPUA 3CCUS 2OSQA 4B1XB 1S9EA 3GSIA 5KG5A 1Q16B 1K9MT 3ZZ0A 4EYIB 3OR2A 3ADAC 2FHOB 5GMKa 3Q8QB 2ZFHA 1R7IA 3AA5X 4FOEA 5K9FA 2XNQA 3DRSA 1JJ4A 3SV4A 2JEIA 2UU9K 5CHIA 2J7WA 3QZ8A 1HBUA 1MROA 1NDLA 1OY8A 4QS7A 3OL8A 4HUGA 1BUXA 4CFDA 2MHEA 4JI5J 4FF3A 3F44A 1KONA 3VEYA 1U2CA 5HMYA 2V34A 1GLDG 4E2FB 4MMOA 4NLBA 3V81B 4B3RJ 4CHQA 2GHWA 3FFKB 3NG8A 2BM0A 2IYGA 2X6SA 3NMUA 2RKIB 5GMDA 1J5EJ 2BE2B 4AM6A 4JV1A 2GO8A 4RJVA 1U1NA 3OTDA 1NGEA 3JSYA 1LWXA 4WWSA 3VGUA 3DU5A 2DGOA 2VV5A 2HVHA 3H4BA 5KG3A 4KSEB 4TQRA 3W3SA 4DXLA 1S72N 1YBTA 1SQFA 1A5WA 1FJ7A 1NB2A 4DL7A 3NH1A 3J7YI 3NL0A 2BA9A 3VVUA 3HSTB 4ILMA 1AFIA 1EAYC 1N34J 1WBDA 2XZWA 5KFTA 3CJ5A 1KBRA 4QQBA 4DX6A 3DOKB 1CJKA 1IO2A 2D9PA 2A42A 1S10A 2V6AA 4JI4J 1RTJB 5F41A 2X1AA 2HBYB 1G3OA 5I3UB 3VQSA 1REGX 1QS4A 1RU2A 1Q0NA 3CJBA 3QBXA 2Z1HA 4ECUA 3NGYA 1W2BM 2CVIA 3P1GA 5AZJA 1XUPO 4JYAF 2IM0A 2YKQA 1EB0A 4ID8A 5DJBA 3CIPA 4BDPA 4F04B 1AZSA 1A7GE 1T8EA 3Q83A 2CJQA 1BHLA 1M5HA 3MM6A 2M0GB 2HMIA 2NLXA 2KXFA 3KDOA 4FS1A 1K8AO 1S0MA 4RPFA 1S1UB 2X3DA 1VQNS 3AAWB 2CNOB 3DC2A 1UVKA 1KVKA 5HROA 3A8EA 3SPYA 2J8AA 1JLEA 4ILRA 2E5LK 3HVTB 3SQ1A 3MN6A 4B8AB 2FJXA 1WEYA 1V3SA 2WSCC 3NGTA 5AQFA 3J7AN 1NLKL 2JWLA 3QBWA 4YDDB 1OY6A 4CZJA 3FZHA 3PV8A 3HOSA 1D4XA 1V9OA 3KLHB 2DNHA 4WF9Q 2E20A 4DX5A 4I68A 2CFXA 4IUFA 2IPOB 2GX8A 5GINA 2WCXA 1K73T 1NMEB 5I42B 4AHVA 4GKKK 3KJFB 2JX2A 1DLOA 5LMUF 1ZM3A 3RBXA 3W60A 3NH0A 2MQ8A 1G1XA 2E2QA 1GXUA 2XSJA 2C2EA 3DMJB 1CVJA 1QVFR 4F4YA 1YVNA 4OGEA 2D0AA 2F8SA 2V8PA 5DGAA 3VVTA 4ECXA 3NY0A 3A4TA 5FRMA 3SCJE 3DFEA 4LVNP 1VS3A 1KLNA 4CLSA 4CEEA 2XEXA 3UFCX 1T9YA 3QEVA 5D0EA 2W4DA 1GTEA 3ZX3A 3KFWX 2Q31A 4HWIA 2VQEJ 3UN5A 1NCLA 3HHKA 4P2XA 2KXNB 3ZTOA 4J9SA 4A5AA 5D4PA 2RHSB 1NGGA 4RW4A 4IDHA 1VQPN 1XR6A 4USVA 4IQXA 1T0TV 1D0EA 3ET6A 5B7WA 4B8CA 1RT1A 4ETXA 4ECQA 2R7VA 1O51A 3CJ4A 1E6YB 2MGZA 4DPXA 3PW2A 2FPHX 3DLBA 3J7ZO 2D0PA 4E8UA 1MSWD 3KK3A 4FCYA 5GADI 1XHXA 1NEEA 1O13A 5KFLA 4A8KA 3UIQA 2C22A 2BM1A 4CF0A 3VAJA 2CH5A 3VCDA 4C4WA 4H5VA 5EWGA 3JQJA 1YI2N 3HKZD 3TWHA 3F56A 3U1LA 4H0TB 1WSGA 1N32K 1N4LA 1PJ7A 2YPZA 4DX7A 4JI1F 2BUNA 4M5KA 3R5BA 5DETA 4CBWA 3SNNA 4IG3B 1X4GA 4KGXB 4UUXA 4MKVA 1P6TA 3U27A 3HYFA 4BVPA