4WE1A

Crystal structure of hiv-1 reverse transcriptase in complex with 5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)-2-naphthonitrile (jlj600)
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
547
structure length
542
Chain Sequence
b'ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title Picomolar Inhibitors of HIV-1 Reverse Transcriptase: Design and Crystallography of Naphthyl Phenyl Ethers.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Hydrolase
total genus 140
structure length 542
sequence length 547
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4we1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4we1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4we1A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4we1A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4we1A05
1FK9A 4M3RA 1WN7A 4KHYA 1NNDA 3HK2A 3GIKA 1LW0A 2FVQA 5C25B 4N76A 4DTOA 1XC9A 3O3HA 4E7JA 1EXQA 5T7BA 4PUOB 5KFGA 3LAMA 1SH0A 4DQSA 4IG0A 4M95A 3V6DB 1TP7A 4NLWA 1K1QA 4WYLA 2VA3A 4C8LA 4JS5A 1LWEB 3CJ4A 1BGXT 4MFBB 4Z4EA 1T03B 2AJQA 1SH3A 4FVMA 1DTQA 1S1VB 1JLGA 5L1IA 1FKOB 3BSCA 3QEIA 1NKCA 3D0PA 2HNZB 4ECTA 3AA2A 4KE5A 4QOZB 1JLBA 4Z0UA 3AO1A 3CIZA 4KFBB 4B8AB 1RT3B 4O0IA 4KREA 2HB5A 1C1CA 4WFZA 4CK1A 5JXSA 1A5XA 2ZQBA 5EDWA 1KCFA 2F8SA 1MMLA 1IKWA 3BSOA 4ED1A 3LWMA 3O3FA 4CGIA 4EP4A 4ELTA 1QSLA 5DG7A 3GIIA 3AV9A 3MR5A 4J9PA 3OYNA 3FSIA 1S1WA 4EYIB 4DFJA 4KAIA 4RW7A 3BGRB 3HXMA 1UWBB 3SYZA 2D0BA 3DLKA 3QZ8A 3GQCA 3HM9A 5KFHA 4DL6A 2XHBA 3V4IA 1JLQA 4O55A 2FLNA 1ZBHA 2AQ4A 4KHQA 3LPTA 3KMQA 3TAFA 4J2DA 3IG1B 4RUAA 3NH0A 4RUCA 5EU7A 3MAQA 3PV8A 2D0AA 3RTVA 4MK8A 4I2PB 2F8TA 1RDAA 4ZTFA 3H4BA 4JV0A 3RR7A 4O3NA 2B6AA 1RT1A 3VN5A 1EP4B 1TV6A 3S9HA 4OPKA 3WNEA 4NLXA 4E89A 3GIMA 4ID5A 2P5OA 3QERA 1ASVA 4J2EA 1RAJA 1YTUA 2B43A 5HBMB 1TL3A 1G15A 5KFBA 4DSJA 3K58A 1EETB 3LP3A 2BE2B 3BSAA 3DRPB 1IO2A 1Y97A 2OPQB 1HJRA 2XO7A 3WNGA 4J9NA 5J2NB 1L5UA 4OKJA 3OL7A 1W25A 3JSMA 4WXOA 3I0SA 4CIEA 5KFKA 1CXUA 3GV5B 5HP1B 4ECSA 4OLAA 1J53A 4W5QA 2UUTA 2JEIA 2YNIB 3G86A 4CJRA 3PX4A 1VSMA 2QXFA 4KHRA 4M3YA 4F3OA 3G0ZA 3VQSA 1RT6B 4RNOA 4FS1A 3SPZA 3QGIA 3KLEB 3KHRA 3NBPB 1S1UA 3OYAA 1D9FA 1TKZA 4CGJA 2R8GA 3LZIA 2ALZA 5I42A 4RW9A 2V4RA 1BCMA 3ITHB 2W7OA 1S0NA 1QE1A 1WNSA 1TQLA 4DFMA 3DRRB 1I39A 1XHZA 2FVPA 3C6UA 4GMJB 1TKXA 4IH7A 3L2WA 4DSLA 1D5AA 3RBEA 1EX4A 1R0AA 3LP0A 4QAGA 4RW6A 5KFUA 3MFHA 2QKBA 3L2RA 4DLGA 4J9SA 4ZVGA 3SQ1A 3MECB 4QW9A 4YP3A 4FM1A 1MU2B 4Q44A 1S9GA 4LQ9A 2F8EX 1TL1B 5KG4A 2DPIA 1IKYA 4FLYA 5KFZA 4LH5A 3KD5E 4NLGA 1UOCA 3SQ2A 5KFEA 2EC0A 5KFDA 3SJJA 3ZT2A 2RKIB 4CIFA 2VG5B 2BQ3A 4PY5A 3OLBA 4E3SA 4TYBA 3I5CA 3CJ0A 2ZD1A 3ALYA 2YKNB 2FVSA 1VRUB 4TY8B 4IG3B 4CGFA 1HMVB 1NK7A 4I9LA 3NHGA 2W9CA 3DOKA 2C2DA 3CFOA 5HRNA 4H54A 3PW0A 4Y34A 5I3UA 2RF2B 3K5OA 1RT2B 4NCGB 3GILA 3KLGB 3ZT4A 4O4GB 4CEQA 2R2UA 3KOAA 4NCAA 4FJNA 2BANA 3AVCA 3DYAB 4FJMA 1S48A 2R8JA 4BWJA 3EY1A 4NLRA 4O44B 1KFDA 4DQRA 3HT3A 1KVBA 5KG2A 2R8HA 2LSNA 4ZHRB 1RDCA 3IRXA 4GW6A 4DF8A 1JLAA 1JXLA 4KV8B 4DS5A 5JS1A 1VK0A 1NK8A 3MEEB 3H2LA 4KO0A 3TVKA 5CYMA 3AVGA 2XGPA 4FJIA 5F8MA 1IKXB 4CK3A 1GX6A 4CE9A 4O0JA 4B9TA 1HYZA 2IC3A 5HRSA 1KSPA 4ICLA 2WONB 1JIHA 4ZPDA 3LALA 5L1JA 1BQMA 3AA5X 3DLHA 2ATLA 4DSKA 4I2QB 1ASUA 1X9SA 2OYQA 4DQPA 4K8XA 2FVRA 3T3FA 1XI1A 4K50A 1RA6A 2YHBA 4FW1A 4XPCA 1I3AA 3HPHA 1S0MA 2ITGA 3PJWA 3KTQA 1GOBA 1J54A 2D7SA 4FJXA 2P1JA 3OYEA 3CQ8A 4KHUA 4ZPBA 2F96A 4HVJA 1YTAA 3VQ4A 5HLFA 3SPYA 2HNYA 3V6KA 3DLEA 4ZP8A 2G8KA 2PYJA 1BHLA 4BACA 2BQUA 3T5KA 4K4SA 4CJ5A 3OYLA 1HYSA 4IDKA 1WSGA 4M41A 2G8VA 2IDOA 4NLSA 3P5JA 3TAMA 1RTDB 4CJEA 4DG1A 2IBKA 4K4TA 3T5JA 1FK9B 2W7PA 4CJKA 1NK5A 2FVCA 1LW0B 4O3QA 1DTTA 3MEGA 1KLMA 3MXJA 4CJ4A 3SUQA 4Q8FA 4C8OA 5F8JA 2VG6B 4DS4A 4F4XA 1C1AA 3AVFA 1JL2A 1TGOA 5FDLA 2Y1IA 4MK9A 5SWMA 4Q45A 4Q0BA 3RBDA 1A5VA 3LDSA 3FFIA 1NJWA 4WFXA 3KIOA 3SZ2A 5KG7A 4XPEA 3PO4A 1SKSA 4O3SA 2YNHB 4N41A 1HQEA 1DTQB 3KD1E 1N5YA 2QE5A 4RZRA 3RR8A 3UPFA 2W42A 1JLGB 1NKEA 1C2PA 3OS1A 1HYVA 1RBUA 1W0HA 4CFCA 5F8IA 4AHVA 4KTZA 2VWJA 3OYDA 4CGHA 1FKPB 3DLBA 4KBIA 1JLBB 4FCYA 1CSJA 1T7PA 3QEWA 1TKTB 3HYFA 4CEZA 3OYCA 1X9WA 4IH5A 3QO9A 3AVMA 4IFVB 2VG7B 3TARA 2OA8A 3RMBA 1WAFA 3P1GA 4URQU 3LP1A 2W9BA 3OYGA 3L3UA 2E9TA 3E01B 3RRHA 4TXSA 2J6UA 5KT5A 1QHTA 4PQUA 4DTMA 3G6VA 4H8KA 4RW7B 1DLOB 4LQ3A 3IAYA 1QAJA 3ULDA 4KHSA 1JXEA 4CHYA 1JLQB 5L9XA 4FS2A 4F2SA 5DLGA 2FBYA 1ITGA 3OYIA 2XCPA 1WSEA 4ELUA 1C1BA 3QIDA 3QETA 3I0RB 4DU4A 1T05A 1S1TA 2AU0A 2D41A 4DQIA 3EZUA 2IJFA 2BGGA 4AILC 3NKYA 2OPPA 4IR9A 5DG8A 3BQ1A 2X6SA 3ZSXA 4ED2A 1J5OA 4O3PA 1ZYQA 2R8IA 3IGVA 4ZP6A 4TQRA 2DY4A 3HKWA 2B6AB 4WE1A 3HL8A 1RT1B 1TV6B 4LSNA 4ECQA 4FJKA 3C95A 2O4IA 4CJUA 5HROB 4EBCA 3UIQA 4ZTJA 2O5DA 1Q9YA 1BI4A 2VA2A 1VRTB 4J2BA 3M9OB 2RN2A 3SNNA 2KW4A 1C0MA 5KFVA 3DI6A 3QNOA 3AA3A 1TL3B 3N6MA 3EYZA 5HRRA 3KKSA 2G8HA 1D9DA 2YV0X 1XWLA 1S1XA 3G6YA 5DGBA 4QWDA 2YHAA 2I5JA 4ECZA 1O1WA 4LD0A 4W5OA 3OS2A 3VQ5A 1U4BA 5KT6A 3C6TA 1CLQA 2XY7A 3QIPA 2A1RA 1RA7A 3CDEA 4QCLA 3OYJA 3OYFA 3JSMB 4ECVA 3MEDA 4ZVEA 5CY4A 3SUOA 3TANA 4CHZA 2HHUA 2NUBA 3RB0A 4GC7A 2HHQA 3BREA 5J2MA 4RG8A 2KZZA 2IM1A 1Z4UA 3RB3A 3S3NA 4OLBA 4NLQA 2BRKA 4F4KA 1QSYA 1RTHA 3D5MA 4C8NA 2AGOA 3VQQA 4DL2A 3A2FA 3U6FA 3N6NA 2HAIA 3PW2A 3AVBA 4U6PA 4GC6A 3DMJB 1S1UB 4ZPAA 5KFFA 4K4WA 4JV1A 5I42B 4RW9B 2J6SA 3RAQA 3OL8A 4WZMA 3DLGA 4CJSA 3NAHA 2GBZA 1RT5A 3DM2A 2UUWA 3QESA 4W5RA 4N5SA 1IKVA 4TY9A 5F8LA 1TKXB 2V4QA 3BR9A 3NF8A 2YNGB 3DOLA 2IM0A 3VQCA 3KK2B 4IR1A 4GVMA 4KHMA 1RT7A 2ZE2A 5J2QA 5DQGA 4M3XA 1S9GB 1T8EA 3NDKA 2P5GA 1IKYB 3OSNA 1KHWA 2HMIA 3TAPA 1LAWA 5C42B 3M8QA 1JKHA 1CZBA 4PA1A 4IRKA 3SV3A 4J9LA 4MIAA 1T3NA 4E1NA 4F4YA 3VQ8A 3GIJA 3PZPA 4CJPA 4XIUA 2ZD1B 2FC0A 2X78A 4B3OB 2FJWA 3RRGA 1RTIA 5T14A 4HCBA 1VSJA 1S49A 2W9CB 2OH2A 3DOKB 1N4LA 4CJLA 4OKEA 2ATQA 5KFRA 2Z1GA 3SUNA 1YT3A 1C0TA 4FJGA 1TKDA 3AVIA 1HRHA 3VQBA 4YMEA 3M9NB 3V81A 2GIQA 3H98A 2PYLA 2XY5A 3VQ6A 2AGQA 4R5PA 1KHVA 4MIBA 4RNHA 3FQLA 2V9WA 4IKFA 3CFPA 2BANB 4FLXA 3DRSA 4YR0A 4J9MA 1NK4A 1N56A 2WOMA 2KQ2A 1WAJA 3K59A 5KFYA 4E7KA 3BJYA 3IRXB 4KKOA 3PY8A 5DQIA 2RDJA 4KB1A 4KO0B 5CYMB 5K14A 4NLDA 2OZSA 3HVTB 3QLHA 3UR0A 4N56A 4FZXC 1C0UA 4F4ZA 3NF7A 1S6PA 2IC3B 3LZJA 4ICLB 3SI8A 1UA0A 4CGDA 1L3SA 3HSTB 1S9EB 3FQKA 5KFPA 3HP9A 3PO5A 4N47A 4M3ZA 1S0OA 2YKMB 3ISNC 3H5YA 3F9KA 5J1EA 1OS5A 1NKBA 5C24B 4PUOA 3T1AA 4KSEB 4ED0A 4CHOA 3MXIA 3K2PA 1NJYA 3V6JA 4K4UA 4CF2A 4O4RA 3NCIA 2HNYB 2BRLA 3DLEB 4CIGA 1XR5A 2ZKUA 1K6YA 2E6MA 3I8DA 3SCXA 4DL7A 1BQNA 3KHGA 2CJQA 2IMWP 2IA6A 1KRPA 1HYSB 4IDKB 3CJ3A 4I7FA 3TAMB 2OPRA 3KJVA 3NAIA 4KAZA 1N6QA 4DWIA 4HKQA 1REVA 3OYMA 4MH8A 2B5JB 3OHAA 1LWFA 1RT3A 4DFPA 3AVNA 5CYQB 4ID1A 1DTTB 5EWGA 4HUFA 3KLHA 4DF4A 5FDLB 2HHSA 4WXWA 1RYSA 1SL2A 4FK4A 3AVHA 4DU3A 2E4LA 3VA3A 1ZBLA 4ED8A 1TAQA 3TR8A 1S6QA 4NRUA 3OJUA 2HVIA 4BDPA 1TK0A 3BGRA 4FLZA 4NLPA 4Z4CA 4DTPA 1BISA 3K5NA 2Z1JA 1WSHA 4R0EA 4M3WA 4ED6A 3KLIB 3RB4A 4RW8B 4NYNA 3S3MA 2XY8A 4JRPA 4IOBA 3AVLA 3CWJA 3IG1A 3ZCMA 5KG0A 2DFFA 5DK5A 4NLTA 3U3YA 1BCOA 3KLVA 3KLFB 5JUMA 1D1UA 2FJXA 4K4ZA 3JYTB 1SV5B 4DL4A 3QO9B 4EZ9A 4EO8A 2BR0A 4MK7A 5DGAA 4KHNA 4ED3A 3LP1B 2W9BB 4RNMA 3ZT1A 3M8SA 4CEDA 4KTQA 4FLTA 2B4JA 4CF1A 3L3VA 4OGCA 4Y2AA 4PQUB 4ZP7A 3AVKA 3NAEA 4FW2A 5C5JA 3LAKA 4J2AA 2WTFA 5CZ2A 4M45A 1LW2A 2HHWA 4AHTA 4CEAA 1SL0A 3RWUA 1T94A 4DLEA 1XHXA 3V1RA 2G8IA 2GUIA 1C1BB 3E51A 4RNFA 5SZTA 4K8ZA 1JLCA 1HQUB 1T05B 4IRDA 3MR6A 1KTQA 3VQDA 1RT4A 4OVLA 3HHKA 4DTRA 1ZBFA 5J2PA 2FBTA 4CEEA 1J5OB 3NL0A 3GV7B 2IGIA 3GV8B 3AO5A 1S97A 4FJ5A 4QPXA 2PY5A 2XY6A 1BI4B 1RCHA 4Y1DA 3ZSQA 4URGA 4FJ8A 3PX0A 4ZVFA 4J9QA 1RBSA 4PWDA 1RT6A 2DFHA 3SI6A 1WSFA 4IBNA 1Q8IA 4DU1A 5KRTA 1VSLA 1S1XB 3V9SA 2DFEA 4KI6A 4QW8A 1RDBA 2JEJA 4CJTA 1WLJA 2HHXA 3M8PA 3C6TB 2VWKA 2AGPA 4DL5A 2WHOA 5KFMA 3QIPB 3HVWA 4LH4A 1SKWA 4YR2A 5DMRA 5KG3A 4G1QA 4BE1A 5KT7A 4YFUA 3V9XA 4B8CA 3TWHA 4IG0B 1KVAA 1IH7A 3MECA 1NHUA 5L1KA 5JS2A 5KGXA 5J2MB 1TL1A 4QWEA 1S4FA 3V9UA 2HHTA 4CHPA 1RTHB 3L8BA 1ZTTA 2RKIA 1RBVA 2FBVA 2IOCA 4JV2A 4DQQA 4G3IA 2O4GA 1WNEA 1XR6A 4CJFA 4M3TA 2FLLA 3ICLA 3G10A 4R8UA 4OJRA 4KHWA 4E1MA 2XWYA 4Y2CA 4ZMMA 4CHNA 3CVKA 1VRUA 1HMVA 3DLGB 5KFXA 4CHQA 1RT5B 1C1CB 4Y3CA 4F50A 2UVRA 3PW5A 2RF2A 4M94A 2G8FA 1IKWB 2X6NA 4DTNA 4OPJA 4FJ7A 4NLVA 3RMCA 2IJNA 2BQRA 3DYAA 1S1WB 1RT7B 2ZE2B 3RMAA 2G8UA 5J2QB 5EWEA 1ZTWA 4LSLA 3CJ5A 2Z1HA 4KB7A 2FLPA 4DEZA 4C8KA 3DLKB 4DTJA 3V4IB 3KK1A 2AWZA 3G6XA 3TAEA 1LAVA 3MF5A 4K4YA 2KFZA 3TI0A 4H4OA 1GOCA 1QQCA 1UAXA 1IKXA 4HCCA 3QNNA 4M3UA 3FRZA 3K5MA 2WONA 5KGWA 1RTIB 1JLEA 4J9KA 3K5LA 3OSPA 1BIZA 4KRFA 4ID5B 3LPUA 5FRMA 4AH9A 5D3GA 1TVRA 5F8GA 4CEFA 4IRCA 4CESA 3L2VA 1W9HA 4HTUA 1I6JA 3AO3A 3DRSB 3CFRA 3BSNA 2XI3A 3OL9A 3OJSA 3QEPA 1RDDA 1VSHA 4CF9A 3TQ1A 3PR5B 5KFQA 4EP5A 4TN2A 1VSFA 4QWCA 3QEXA 2W8KA 1L3UA 2IS3A 4L8RB 1U49A 4ECYA 4TSXA 4Z4IA 2XC9A 4FBUA 5K14B 2EHGA 3MR3A 2R8KA 3QLHB 4EBDA 1SL1A 4EBEA 3I0SB 4E19A 1S6PB 3K57A 4WFYA 3NGZA 1RDRA 1TK8A 2V0NA 4AHRA 3Q8PB 3NH2A 4YR3A 1WSJA 1HPZA 4ELVA 2YNFA 3VQAA 3LWLA 1NOZA 4DTUA 2PZSA 5J1EB 2VG6A 1QUVA 4FJ9A 2EX3A 4IFYA 3HPOA 4OL8A 1BIUA 4NYFA 3AVAA 4KI4A 1HNIA 1NOYA 3SV4A 1B9FA 4K4XA 4CK2A 1ZBUA 3CM6A 1TKZB 2YNHA 5KT3A 4CECA 5DQHA 2GC8A 3CDUA 3SQ0A 1WSIA 4TYAA 3OL6A 4KPYA 2KTQA 4CCHA 1K1SA 1F21A 1QE1B 5KG1A 3SFGA 1BQNB 4LY7A 3BDPA 4H4MA 2QV6A 3IS9A 4ZVHA 3C6UB 3L2QA 4I7FB 1FKPA 3HPGA 1R0AB 2OPRB 3KJVB 3LP0B 3GYNA 1N6QB 4RW6B 1REVB 1TKTA 2HVHA 1LWFB 3ZSVA 4IFVA 4EZ6A 3HO1A 4Y1CA 3VQ7A 2VG7A 3LP2A 2W9AA 4HUEA 3V6HA 3KLHB 2P51A 3O4NA 2ASJA 3E01A 3OHBA 2R2TA 1U45A 4KTWA 4TLRA 4IH6A 3RAXA 3ZSZA 1S6QB 2BDPA 4FK2A 1HNVA 2KZMA 1DLOA 3T5HA 1B92A 1X1PA 3U3GA 4ECRA 2DPJA 5F8NA 3KHLA 3NGDA 1JLFA 1L3VA 1GX5A 4AHUA 3KK3A 5DG9A 2HNDA 4NCBA 3I0RA 3VA0A 5I3UB 4F3TA 5KFTA 3NMAA 5EWFA 1LWCA 4BE0A 2RDIA 3BQ2A 4RW4A 3MXMA 2C2RA 4J9OA 1JXBA 5L1LA 4FZYA 1RTJA 2OPSA 3Q8RB 2HWHA 3QYYA 3OYBA 5HROA 1SUQA 3EZ5A 2JC1A 1S10A 2XI2A 1VRTA 2C2EA 3ZSYA 2DTUA 2R2SA 2E6LA 1JLAB 3I5BA 1IG9A 4NRTA 1BL3A 2X74A 3ZSWA 3H5SA 5KI6A 1X9MA 2ILYA 3N6LA 1LW2B 2IAJA 3UDLA 2UVUA 4DSFA 4B9UA 3SFUA 4QWBA 4DTSA 1J9AA 4E7LA 1BQMB 3PX6A 5F9LA 1JLCB 4YNQA 1HARA 2WK4A 5C25A 1RT4B 1XR7A 4CJQA 3H40A 5J2PB 3ASMA 1SKRA 3KMSA 4FBTA 3T19A 2AX0A 2D5RA 1QTMA 4BDYA 3V6DA 2D3ZA 4JS4A 1LWEA 2J6TA 4MFBA 1U47A 1T03A 4URSA 4K4VA 5HLFB 1S1VA 2JC0A 5EUHA 4JLHA 3SUPA 1FKOA 4CF0A 4RU9A 4B9MA 4PWDB 5KTQA 2HNZA 3KHHA 1KLNA 5F8HA 3NE6A 1KFSA 3DMJA 3P83D 2WB4A 2QK9A 2C28A 4DG1B 4CFBA 4J9RA 3M8PB 4B9SA 5KFCA 3F73A 4F2RA 4RNNA 4KFBA 4WYWA 4AHCA 1NK0A 4NLYA 5FRNA 4B9LA 5KFJA 3KNAA 3MEGB 3OS0A 1KLMB 1D0EA 2WCXA 1S5JA 3UQSA 4HHTA 4E7IA 5DLFA 3NF6A 4Q5VA 3EPIA 4G1QB 2R2RA 3H4DA 5HRPA 4FM0A 1RNHA 1N48A 3CO9A 4Q0BB 2YNGA 4NZ0A 5F9NA 1TK5A 3MTKA 4FM2A 4CFAA 3KK2A 3FFIB 2GV9A 4Q43A 3ZSOA 3PVXA 1Z26A 1UWBA 4Z4GA 4EYHB 1HQEB 4YQWA 1N5YB 4OGEA 2G8WA 5C42A 1A5WA 1ZBIA 3QGGA 4EEYA 5KFWA 4CF8A 2A1SA 1LV5A 1Q9XA 4FXDA 2ILZA 4JUZA 1FXXA 1VSKA 4R8UB 3TABA 4C8MA 1U48A 2W8LA 4I2PA 2UVWA 4B3OA 4CJWA 3B6PA 5KG6A 3DLRA 3PUFA 1EP4A 3QEVA 2JLEA 4TQSA 1Z25A 3ZSRA 1CZ9A 1YVFA 3CJ2A 1NJXA 1NK6A 3H08A 1L3TA 3SQ4A 4FJLA 2JGUA 2Y1JA 3HP6A 4FYDA 4W5NA 3M8RA 1VSDA 5HBMA 4WZQA 1NJZA 4FLWA 1EETA 4B9NA 2BE2A 3EPGA 5KT4A 1RILA 3HVRA 3OY9A 4LSLB 2I1RA 4Q8EA 4B08A 3RMDA 4HUGA 3DRPA 4QWAA 1JL1A 3KK1B 3V9ZA 2OPQA 5KFAA 2HWIA 3H5UA 3VQEA 3L2UA 3FDSA 1S1TB 3DDKA 4FZZA 4DMNA 4H4OB 5J2NA 2XCAA 3BQ0A 4F4WA 3CM5A 4IKAA 3MFIA 3HVTA 2OPPB 4MQ3A 1IM4A 2AX1A 3PHEA 4DFKA 4MKBA 1JLEB 5HP1A 4WE1B 1S9EA 4LSNB 2XGQA 4FLVA 3AO4A 2YKMA 2YNIA 5D3GB 1TVRB 2E9RX 3OVNA 3V1OA 3THVA 5KFNA 3O3GA 4NLOA 5C24A 3PW4A 3DI6B 1ZETA 4FJJA 4ZPCA 3RB6A 1QS4A 4BDZA 3HJFA 1S9FA 4W5TA 4KB0A 2CKWA 3QGHA 3CYMA 3KLEA 1NK9A 3NBPA 4B9VA 2I5JB 2QKKA 1U04A 3TAQA 3AO2A 3ITHA 5KRSA 4HYKA 3OYKA 3H5XA 1JX4A 3ZT3A 4XO0A 2OZMA 4FLUA 3DRRA 4ZP9A 4CJVA 3PR4A 4JRQA 3QZ7A 1VSEA 1UA1A 4CERA 3O4QA 3MEDB 2ETJA 2HHVA 1B9DA 2B5JA 3H59A 2XRIA 4NYZA 1MU2A 5CYQA 2IM2A 5KT2A 3NGIA 1NHVA 4NLUA 1HPZB 4I9QA 2YNFB 4ED7A 5CZ1A 4EO6A 3V1QA 4CGGA 3T5LA 4F8RA 4O3RA 1SH2A 1QAIA 4IFYB 3M9MB 3NFAA 1HNIB 5KFLA 2VG5A 3ZT0A 3C94A 1D8YA 4ECWA 3CG7A 5KFIA 3Q8QB 4CJ3A 2D3UA 1CXQA 2YKNA 3NF9A 4TY8A 4IG3A 2R7YA 1EKEA 3KLIA 5E41A 4RW8A 4ECXA 3KKRA 4UQGA 3DM2B 3IGNA 4H4MB 3OLAA 1IKVB 3IS9B 1QSSA 4AHSA 4E0DA 1RT2A 4NCGA 4CEBA 3OYHA 5KFOA 3KLGA 3KLFA 4DTXA 4FK0A 5KFSA 4O4GA 3DOLB 2E9ZA 3JYTA 1SV5A 3Q8SB 3PJXA 1TAUA 3ISND 2D0CA 3LP2B 2IM3A 4O44A 4BWMA 1ASWA 5KG5A 2HW3A 2JEFA 1KVCA 2HMIB 2FBXA 4CFDA 3LANA 1RBTA 4ZHRA 3M8QB 4MKAA 1JKHB 5FROA 3QIOA 4KV8A 3MEEA 3AA4A 3NH1A 1HNVB 3D45A 3D28A 3AVJA 4DSEA 1U09A 3V9WA 1JLFB 2ASDA 3KK3B 3VQ9A 2HNDB 3HVAA 4I2QA 1HQUA 1C0TB 3I5AA 4OKKA 2JEGA 1LWCB 3V81B 2C22A 4M42A 4RW4B 3WNHA 4R5PB 1RBRA 2RPIA 2Z1IA 2WRMA 3MR2A 3PW7A 3IN5A 1RTJB 4E7HA 2OPSB 2UVVA 4Z4FA 4U7CA 2WOMB 4DL3A 1RYRA 2FJVA 3WNFA 1SUQB 4BE2A 1YVUA 3S3OA 4O5BA 1C6VA 3B6OA 3CDWA 2KFNA 4O3OA 4DSIA 4FJHA 2ASLA 3VQPA 4KKOB 3NGYA 1GOAA 1VSIA 3QINA 4IQXA 4ECUA 2Q3SA 1RTDA 1C0UB 2IAJB 4Z4HA 2GIRA 4CEOA 4X2BA 3TAGA
chains in the Genus database with same CATH superfamily
2MY8A 1WN7A 1OH7A 2D1CA 1NNDA 5A6WA 5D0EA 3CHWA 3FNNA 1KC8T 3IUCA 1RK8A 2RS8A 2A2DA 1ZM3A 4N76A 4FF2A 2C2OB 3TEGA 2DXEA 1NPPA 4OJGA 4P7TA 2B4UA 5ETQA 2ZUGA 4ZVRB 2QMXA 1TP7A 4DDFA 1K1QA 4WYLA 2VA3A 4JS5A 1BGXT 4Z4EA 1GAOA 3OHRA 2A6MA 4DX8H 5H9EK 3RW6A 5L1IA 1FKOB 3BSCA 1NKCA 1DBDA 5M1PA 1XQIA 1YRXA 2MQNA 3RSEB 4A2BA 2UXDK 2V68A 3C6AA 2DNYA 1LNQA 2QA1A 4NXNJ 2RAQA 1HWJA 5AQVA 3K8VA 1RT3B 4OX9K 2KO1A 1MMDA 2WAQD 4OJHA 5JXSA 1A5XA 3NS5A 4H03B 1SPBP 3BSOA 2RNEA 2UUBF 4ELTA 2QW9A 1DAXA 2HHHJ 3GIIA 3AV9A 3MR5A 4J9PA 1S1WA 1R8AA 4KAIA 3MDQA 3VZIA 4DV4J 2VH7A 2BV3A 1YJNS 3DLKA 4WFBQ 3KDNA 4JI3J 1Y11A 2Q97A 4BRGA 3JQMA 2J0WA 1WOSA 3BYRA 2GW8A 4M5DA 3HHNB 4KHQA 3VEWA 5LM7E 4J2DA 3GJRB 2HOEA 5EU7A 2OEKA 4ZTFA 2JZ5A 1N32J 2B6AA 5AZIA 2M3DA 1H0HB 4NLXA 2ZJPL 2E29A 3FC9A 1RAJA 3W62A 3TUPA 1YTUA 2HBZB 2B43A 1AUSL 1RDUA 3CMES 3BH7B 2G1HA 4DR1K 1G15A 5KOWA 2I6WA 5GAGI 3R7BB 1IR1A 4CLFA 1ZM9A 3QRQA 3M8WA 1LK5A 5DM7Q 1VQ9S 2V8HA 1HJRA 4CDIA 3W1YC 3CJCA 2XO7A 1KAZA 3EKUA 3TU5A 4G1IA 1BG3A 3OV7A 1Q95G 4JI0K 5J2NB 2CQBA 5F0XA 3N0VA 2DO4A 3BO4A 3ZYYX 3R5AA 4CIEA 1CXUA 5L8RC 6AT1B 2NS1B 4LF4J 1J53A 4ZITA 2GJIA 4OLAA 1K9MO 4CO1A 2EKYA 3Q8UA 2WZ1A 2YNIB 3G86A 3J7YP 4CJRA 4HH1A 1VSMA 4DQ8A 2QFJA 5K5MA 3I4HX 5HSPA 4M3YA 2UUAJ 3G0ZA 2QX0A 1QZ5A 2H4YB 1QQNA 1MMNA 4CGJA 1U7LA 2Z2YB 4MMOA 1HIYA 4F26A 3GFZA 3Q24A 1BCMA 2EXUA 4FWNA 2R7VA 1YZ7A 1S0NA 2EWHA 3M1VA 4JBCA 1QE1A 5ETTA 1R6YA 1WNSA 3CDBA 1TQLA 2P9NB 3DRRB 2YHXA 1WOPA 4JAXA 4A8SA 1TKXA 4IH7A 4IZ9A 3BGFA 3I8BA 3R6MA 3LP0A 4PCQA 5KFUA 2QKBA 4NXMF 4DLGA 4J9SA 4ZVGA 2YJEA 1N34F 4YP3A 3THYB 1FKAF 4ID8A 2AP6A 1S9GA 2F8EX 1TL1B 1IKYA 2DNNA 4FLYA 5KFZA 3JQJA 4IOCL 4NA2A 4AQYJ 3NGSA 1Q53A 1QQOA 2EC0A 4M63C 3SJJA 3ZT2A 5GADP 4CIFA 2VG5B 3OLBA 3WXJA 4TYBA 3ENWA 3I5CA 1OYDA 2ZH7A 3CJ0A 3WT0A 1YSJA 2YKNB 3O4WA 4HDGA 4DCOB 1FD2A 4Y34A 2O8BB 4NCGB 3HZEA 3KLGB 4DR6F 4NCAA 4OX8A 3DYAB 2GHWA 3V4MA 1IQTA 1U0SA 2N3LA 4DQRA 3R5BA 3HT3A 2E44A 2LSNA 4ZHRB 3M30A 4GW6A 4LF6K 4KV8B 3CW2C 3RBXA 3FZMA 4KO0A 2XGPA 2YWWA 3VF4A 5HRSA 4ZPDA 1TUWA 2J9DA 2L9DA 5L1JA 4BCAA 3DLHA 2ATLA 3HHLC 3R3TA 1X9SA 4K8XA 3T1YJ 1Q5VA 3PCOB 1XI1A 4NXNF 2YI1A 1RA6A 3TZXA 3NNCA 2ASMA 1RHJB 1GOBA 1S22A 4WF9Q 1NMNA 4UOCA 3CQ8A 3ZXWA 1Y5LB 4ZPBA 3A5LC 3VQ4A 2CPZA 3DLEA 3G82A 1VQ4S 2NYHA 3O9QA 4BACA 3M3ZA 3IWLA 2BQUA 4A5AA 4DV4F 5CHCB 5IS2A 4IDKA 2G8VA 3DU6A 2XB2D 2IDOA 4OZ3A 2KHCA 4XH4A 1U1NA 4WQ4C 2W7PA 4CJKA 1RHRB 1NK5A 1LW0B 2D4WA 3FEYB 1BWEA 4CRJA 1WHXA 1F9EB 4L6V3 3MXJA 1IBCB 2V7ZA 4DS4A 1C1AA 1YX2A 5E3PA 1YK9A 3J81j 2Y1IA 2MKHA 3ILLA 3NNHA 2Z56B 4LR9A 2PGCA 4WFXA 1TL5A 5KG7A 4B02A 4XPEA 3SZ2A 3PO4A 4HHUA 1AROP 1SKSA 4O23A 3WIUA 3M7VA 1HQEA 4DR7J 3I31A 2BMBA 4MLHA 3ULEA 1JLGB 3HT0A 3OS1A 3F44A 1Q82T 1Q79A 2L3MA 1W0HA 4CFCA 3SMPA 2PMWA 1HJOA 4ATNA 2R7TA 3OYDA 4LFCK 1FKPB 4I67A 2P5VA 4YY3J 1CSJA 3ZZUA 1NGCA 2DHSA 3HYFA 4CEZA 1X9WA 3H3NO 3OYCA 4IH5A 2GMJA 4DUZK 1CVJA 3B4DA 1RHQB 3AQOA 4TU8A 3CCZA 2M9KA 3GPAA 2VB6A 1TELA 2HZAA 3POTB 2VKRA 2CPDA 1QVFR 5F1XA 4DJBA 4NPOA 3R7NB 2RHQB 3RRHA 4LF4F 4TXSA 4FVUA 4DTMA 1UJ6A 4RW7B 1DLOB 1R59O 2LCWA 1HLUA 2K8GA 2UUAF 2GTDA 4KHSA 3VGUA 4KH1B 4QYRA 1MN7A 1JLQB 4A4JA 1WUUA 4F2SA 3OYIA 1YBUA 2FGOA 1S1TA 2AU0A 4PEOA 2XQCA 4Y2KA 1HBNB 2YWHA 3MAAB 5JMNA 2NZCA 4AILC 2OPPA 3FRYA 5DG8A 1J5OA 4O3PA 1AZSA 2OAUA 2DY4A 1IBLK 3D4JA 1TV6B 3DDIA 4EBCA 4JI4J 2UUCJ 1Q9YA 2VONA 3K0JA 1HL6A 2CZVC 2VA2A 3SNNA 1V4TA 4AD6A 1D4XA 1TL3B 4J7CA 5LT5A 4CQ1A 3NRBA 2HLUA 1M1KO 2G2YA 4JB8B 3ZZ0A 2YHAA 4CZEA 3MEKA 4ECZA 3OS2A 1U4BA 3B8AX 2GVDA 4LFBF 1WI6A 5BR8K 3F56A 3CDEA 4QCLA 2IA0A 2DIVA 2ROEA 3TA1A 1X5TA 3JSMB 1MW7A 2ABYA 3SUOA 2HHUA 4JHDB 2GO9A 3RB0A 4GC7A 2U2FA 1NJIO 2NZ4A 2A0FB 3AOAA 4NMLA 2FC8A 3L4QA 3UVJA 3S3NA 2XMKA 5I3PA 2GNKA 3KWGA 4JI5K 1F9HA 2OLWA 4DR4K 2AGOA 1WKLA 4OZJA 3U6FA 1N8RT 2HAIA 2B51A 3JTOA 3AVBA 4ZPAA 1VQNN 4RW9B 2J6SA 1RWPB 3L7OA 2GQCA 3PYFA 3DLGA 1F1BB 1WJ9A 2GBZA 1RT5A 5IQ6A 4PXBA 4RR5A 4N5SA 2AJFE 3JTPA 2BEFA 1YI2S 2V4QA 4RL1A 3NF8A 1U1RA 1VIXA 3A5NC 3KK2B 1VBKA 4KHMA 1RT7A 2ZE2A 1DGKN 5J2QA 2EG2A 4H0VB 4M3XA 3GYXB 3MK6A 3OSNA 1KHWA 4BR2A 3EICA 3M8QA 2HS0A 1JKHA 3SV3A 4J9LA 4MIAA 3S8SA 1T3NA 3AD7C 2DHHA 2V2VA 5HATA 3PZPA 4C3KA 4EUVA 3DAWA 2ZD1B 2X78A 4UY8O 4KY3A 3RRGA 1M5PC 4QU7A 1RTIA 3NWGA 1S49A 2W9CB 3DOKB 2ATQA 3SUNA 3SCLE 2HQFA 4YMEA 1S6OA 3QFPA 1JJ2M 2F4FA 4KR0B 3QDKA 2PYLA 2GHVC 4MIBA 4RNHA 3FQLA 4NB4A 2EW9A 3CFPA 3KXDA 4TNOA 4J9MA 4P71A 2KQ2A 2WOMA 1QQMA 3P5TL 3EGNA 4E7KA 5BPNA 4OPAA 3G4SS 1V9OA 3IRXB 3K89A 1FJEB 2P9UB 1KTVA 3G71S 2RDJA 4KB1A 5CYMB 5K14A 1HI1A 2OZSA 3HVTB 4N56A 3LDNA 1S6PA 2ZZNA 1ZZNA 2YPYA 3FBBA 1UA0A 1TFYA 3GOIA 3HSTB 5CXTA 3PFEA 5KFPA 4WWSA 3MM8A 2VPZB 4N47A 4KH5A 1M5VC 3ISNC 3KJFB 4P9SA 4YY3F 1OS5A 2DHXA 1ATSA 1KEKA 5C24B 3T1AA 4KSEB 2MSSA 2VPYB 1NJYA 2HBQB 3JS6A 3MTJA 4K4UA 3OTCA 3FMBA 4CF2A 4BY9C 1UW9A 4O4RA 1RBAA 1FRKA 1XR5A 2ZKUA 3NVMA 2OSQA 4CZCA 1BQNA 3AAWB 4ZN1A 2CJQA 2W4DA 1S7IA 3D6MB 3PIPQ 1NO8A 4RKUC 4DCHA 3KJVA 3NAIA 4AFFA 2V8PA 4RWWA 3OHAA 1SS6A 1RT3A 3AVNA 5CYQB 5ELZA 3L6QA 3UKUA 4QS9A 3KLHA 1E6YB 1RKJA 1I3OB 5FDLB 4WXWA 1RYSA 5FLXY 1SL2A 4FK4A 2CUYA 2PBDA 2K1RA 4P2MA 5A8WB 1S6QA 4LSZB 4BDPA 1TK0A 5EHHA 4CTAB 2Z1JA 3N9UC 2V67A 2DGQA 4R0EA 2GGPA 4ED6A 3PHTA 2HEKA 4RW8B 4YDUC 1REGX 4IOBA 2GV1A 5KG0A 2DFFA 3OR2A 4NLTA 4L3NA 1WI8A 2FJXA 2HGMA 3C66A 2OUGA 2BR0A 2WUSA 1VRQC 1X4AA 2LQJA 1OY8A 4OYZA 3LP1B 4RNMA 2OMOA 4KTQA 2B4JA 3HHLA 1UVNA 1HR0K 1S76D 4CF1A 3A3PB 1AT1B 3EXCX 1PG5B 3E8OA 5A2QU 5F2RA 1AB8A 2QA4N 4XAKA 4AHTA 1G7CB 1YGYA 3DU5A 2DR9A 2QWRA 1OQ3A 2Q36A 3HSZA 4FPIA 2G8IA 2RQMA 2EC2A 4IRDA 4YORA 3MR6A 2MLXA 2DNPA 1SJFA 2L48A 2NUHA 4CLUA 4OYAA 3HHKA 4L75A 3D7SB 3NL0A 2VFSA 1F5AA 4GKKK 4CI0B 3IMQJ 5KQDA 3ATVA 1NZAA 1VQ7N 1CJUB 3WX4A 2MKIA 4WQ4A 5GINA 4WU2A 1WELA 2OGUA 4HWIA 2E5JA 1RCHA 1OKJA 3RJMB 3AARA 2HMPA 2VC1A 3CIPA 4JI8J 5DM7L 1VI7A 2DXFA 2DFHA 5IM0B 2N82B 3SI6A 2O8CB 3MN5A 2CQGA 1Q8IA 1VSLA 3V9SA 4UUXA 4PWUA 1WLJA 5ETLA 2HHXA 2O67A 4DL5A 1VMBA 4FNIA 3QIPB 3HVWA 4LH4A 2LLZA 5DMRA 1Q1KA 3CC4N 1SB6A 2L08A 2QXLA 3V9XA 2RRAA 3K0SA 4ZOSA 4IG0B 1BD6A 5JS2A 2ZJRQ 2F63A 2PIIA 1TL1A 3AXMA 3I4PA 3F2KA 4H0OA 3V9UA 4CZFA 1RTHB 4B3SK 2E5HA 2D1KA 4ISEA 4JV2A 4G3IA 3MWPA 3NWRA 1RBOB 1N54B 4E1MA 3ID6A 1YG0A 1GNKA 1JNZB 1NEEA 3AOCA 2XS5A 2CZ9A 4Y3CA 3GE1A 3DHXA 5IZHA 3PW5A 3W8GA 2G8FA 4LREA 1H7WA 1IKWB 4KGVB 4LF8K 4NLVA 2E2QA 1VCTA 2HAFA 3RMCA 1DJ0A 3JQKA 2IJNA 1FJGJ 3THXB 1EHWA 2BW2A 3DYAA 1WD6A 1C4CA 4OFZA 3I9V9 5EWEA 2Z1HA 1OJ4A 4RU2A 1TL4A 4OHZA 3MXHP 2AA4A 4AM6A 2Q6BA 4KB7A 4DEZA 4C8KA 1XMOJ 5IFMA 4KH6A 1EZZB 3TAEA 1LAVA 1T9UA 5E7OB 4U7BA 3TI0A 2G0CA 2N7YA 2XMVA 5LMNJ 5JMVA 7AT1B 1JJ4A 3K5LA 4J9KA 1SQFA 2IHR1 2E20A 4KRFA 3FBCA 4C8YA 2AP1A 1K8KB 3LGHA 3LPUA 3OFGA 3PRVA 5F8GA 3A0IX 1NSQA 4ZLJA 3VALA 1Z05A 3VOVA 1BA1A 2HHPA 2FHJD 3CD6N 3BO2A 3DRSB 3CFRA 3BSNA 1NH8A 4CF9A 1VSHA 3TQ1A 4IXCA 2AZ3A 4EP5A 2HF4A 3AY9A 5T41A 4QS8A 1T0TV 4BREA 2CJXB 3FFKB 1GQEA 2KVIA 3FEZA 4QWCA 3ZTPA 2GZOA 1L3UA 3GG4A 4PG6A 1U49A 4OZLA 4M5LA 4OYWA 4IFEA 2AF6A 4CZHA 1YITN 2OO4A 1WG5A 4FBUA 4WK1A 2VICA 2EHGA 3MR3A 3D68A 1SL1A 2XSJB 4E19A 2DT9A 3SAHA 2V51B 1A0OB 2VU5A 1VQ5S 4WFYA 3ZZTA 3CC2N 3O1LA 1RXOB 1RDRA 1TK8A 2DH7A 2L41A 3T69A 4DV2K 4FZVA 1BDGA 2PZSA 2A6OA 5JLFA 3CO0P 2ZZTA 1JCGA 1RLDA 2HK3A 4Y28C 3R7SB 4DR2F 1B9FA 5EX3A 3D2WA 5HK4A 5CCMA 3ZX3A 1TKZB 1QHAA 1WBBA 4PRFA 4LFAJ 3UO0A 2GC8A 4K25A 3RAMA 3SQ0A 4C0HA 2KTQA 4TYAA 3BH6B 5GAHU 1X4GA 3ONQA 3Q8VA 1F21A 3WZ0A 3BDPA 3WDOA 4H4MA 3GB0A 3CJTA 3DLJA 3L2QA 1F60B 4LIWA 1FKPA 3HPGA 3UD3P 1R0AB 3SSRA 3FZKA 1WC6A 4RW6B 1RWUA 1WSRA 2MZSA 4BGBA 5IV3A 3SK3A 4EZ6A 2KT5A 4U8YA 4ANDA 3LP2A 4LF1A 2K3KA 2KDOA 2P51A 1TYQB 3OFHA 3H7HB 2DR6A 1DT9A 1N5VA 4A47A 2MZTA 4OI2A 1C0FA 4WJBA 4IH6A 2AJ4A 3W61A 3RAXA 2SXLA 4FK2A 4FWSA 1RU2A 4C23A 4WCEL 5C2CA 1DLOA 3BBBA 5DZ6A 2VF3A 4NZ6A 3JAMU 2B7CB 4LJMA 5FPMA 2IDLA 1BUPA 3VF2A 3WBZA 3MAAA 3I55S 5AJ3J 2RDIA 3BQ2A 3TWZA 4DU8A 3OPKA 2C2RA 3MM7B 3OTOK 5L1LA 2FB0A 1YJTA 2A40A 5GMEA 1KN6A 1OPIA 5HQMA 2YVSA 2YHWA 1IBKK 1S10A 3ZSYA 2PAVA 2R2SA 2DNZA 2IIHA 3HSJA 1OY6A 1JLAB 3DXKB 3LQVA 1VQON 4OZ5A 3CCSN 4USTA 1BL3A 2X74A 3H5SA 1PYSB 1X9MA 3N6LA 1LW2B 2IAJA 3UDLA 2YCHA 2UVUA 2Z2ZA 1NGEA 3D0IE 3SFUA 1W7AA 3JAMO 2YQ0A 2EBEA 1YBAA 2MKSA 1RT4B 2WBMA 2ZH9A 2QYGA 2ZGYA 3T19A 1S4EA 4JI1J 1U47A 1UW4A 1JCEA 4URSA 4HTLA 4K4VA 2V52B 4FL9A 1S1VA 4F0MA 1VS3A 3V2UC 2GWKA 5EUHA 4JLHA 1IM6A 3C14B 1OSCA 4B9MA 4PWDB 1VC0A 1K9MT 3C3LA 2JLFA 5GIPA 1B3TA 3KHHA 2CQDA 1KLNA 3BN7A 1KFSA 2WB4A 1XMOF 3GJSB 4WYBA 2CNKB 1VC5A 3PRBA 5K8MA 2C2NA 2VFVA 4RNNA 4NLYA 4B9LA 3UE5A 5LMNF 3P39A 4HHTA 3IO1A 5DLFA 1A9NB 4BRLA 4ZDNA 2R2RA 4B1XB 5HRPA 2V8VA 4LBHA 4FM0A 1N48A 3KFWX 1KONA 1TK5A 4C11B 3KK2A 4DZDA 4IO9Q 2GV9A 5EOYA 1RGIA 1UWBA 2LEPA 4DV7J 3IXQA 4Z4GA 3U4LA 3FBFA 2ZH2A 4MJKA 2KJVA 1A5WA 4JV5J 3P31A 4AF1A 2ZM6K 1FXXA 5B0DA 3TABA 2GUPA 4I2PA 1RTZA 4CJWA 3B6PA 1U1KA 1VOMA 2B4VA 1IN0A 4BR9A 4NL5A 1Z25A 3CETA 2A41A 4I0WA 5LL6d 3SDEB 3U9DA 4BC2A 3CJ2A 1NJXA 4P52A 2DNQA 3SQ4A 4X66F 2X1BA 4K7QA 4B3TK 3M8RA 3CCQS 5HBMA 2VCPA 1WC0A 3OW2M 4YN3B 3LA0A 4MTPA 3VGSA 4DV3K 2BE2A 4F0KA 3EPGA 1RILA 2NSCA 4LSLB 5ETOA 3RMDA 3AY0A 1LOTB 4DR3K 1YWXA 1JL1A 5ITHA 1XIQA 2V7YA 4OV1A 2BA9A 4FWLA 3L2UA 3KG1A 4M5MA 3BQ0A 3HVTA 3MFIA 5E5NA 1A7GE 1H98A 1BWFO 1JLEB 5DDQC 1G2EA 4YOTA 4LSNB 1NGIA 3CMEN 2XGQA 4FLVA 2HGLA 2H4WB 3AO4A 3T1HK 5D3GB 1YRUA 1WSVA 4NLOA 5C24A 5AQZA 1GXUA 1VQ9N 4ZPCA 1QS4A 3HJFA 1U1QA 1G3OA 3KLEA 3W5ZA 1NK9A 3D2EA 3NBPA 3VF0B 3ET6B 3TAQA 3AO2A 3ITHA 3UR3C 3NNAA 5CQGA 3B6BA 2E5LK 4FLUA 4FXWA 4N8NA 4HACA 4JI2J 3TX8A 3PTWA 4PL7A 4CH7A 5AQLA 4EFHA 2ETJA 1WG4A 1J27A 2YH1A 3HD2A 2O8FB 4JKBA 1MU2A 5CYQA 2UU9K 4LMZA 5AJ3F 4CBUA 1HPZB 4ED7A 5B0EA 4F8RA 1E6YA 1SH2A 3I33A 4IFYB 3SIPB 1W7WA 3M9MB 2H9ZA 5A8WA 3BF3A 5KFLA 3ZT0A 4DV0J 2N3OA 3CG7A 3LL3A 3EGWB 4UT4A 3Q8QB 2CPJA 1CXQA 3BZKA 4IG3A 1T9WA 5LJWA 1EKEA 3PIPL 3MPYA 5ETNA 4RW8A 3UCGA 3Q8YA 4E0DA 1RT2A 3CCWA 1FFWB 5CABA 2BM1A 1AFIA 4FK0A 3MX5A 5KPZA 2JLGA 1IBMF 1KP6A 2YX1A 2GJ2A 3Q8SB 5EX5A 5D0HA 4JKFA 4BWMA 5KG5A 2JEFA 2FBXA 1RBTA 1NB2A 4X4VA 2VFTA 4Z37A 5FROA 3EE9A 3HULA 3O2IA 3PXGa 3P4UB 3QBCA 1UFWA 3AVJA 4LRBA 4DSEA 2HG4A 4BG8A 2AT1B 1JLFB 2H5JB 1GH8A 3QBWA 1J5EF 4JI6J 1KR4A 1XMQF 1WC5A 3R5CA 1HNZF 4J9UE 1MDUB 3I5AA 2UUBK 1RKIA 2LP4A 3EEQA 1EQ0A 4I6YA 2WSCC 3A5MC 4CZLA 2KN4A 4RW4B 5LSRA 5MLCQ 4R5PB 2KKZA 1QAYA 4HTJA 2PI5A 2OPSB 4OI1A 2FJVA 4DZ6A 1SUQB 1YVUA 1K73T 1C6VA 3B6OA 4K41A 2Y1RI 3CDWA 4EU0A 3GMGA 1D8ZA 3VQPA 1BO5O 3NGYA 2O8CA 5A8RA 1SJ4P 1GOAA 5AQPA 2HFOA 4IQXA 4ECUA 2P6TA 1FXLA 1RTDA 1C0UB 1WORA 4X2BA 4DI6A 5M1OA 4KHYA 4NZ7A 3HK2A 2B8QA 1RP5A 3O9UA 2APOA 2MEWA 2FVQA 1M1KT 3CCRS 5C25B 2Q6CA 4DTOA 1T6DA 4E7JA 1EXQA 1OVQA 5T7BA 3QGPA 3FZBA 3DGPA 3KJNB 4IG0A 3ZTQA 5E26A 4LRCA 3V6DB 4NLWA 1VQ4N 1VBZA 1QUPA 2KRRA 2AJQA 1SH3A 5M2RA 4FVMA 1LOUA 4OLPA 4JKGA 3FSYA 3K17A 3QEIA 4IDHA 3UCUP 2HNZB 1NJIT 3AA2A 3CQXA 5H1SQ 3N79A 2ZKTA 3CMAS 1VBYA 4Z0UA 3AO1A 3W5YA 2ADCA 3VGMA 3CIZA 4KFBB 4QYZJ 4O0IA 2QLXA 4KREA 4ZCLA 4PR6A 4KRWA 3T9NA 1IKWA 1Q86O 2Z2LA 2E2PA 2ZJRL 3H20A 4CGIA 3MM6A 1X4FA 1NGFA 4KGMA 4P72A 1HI8A 2W41A 3BGRB 1HHQA 3HXMA 2YKPA 3W5XA 4P2SA 4DL6A 4F02A 2XHBA 2NRHA 4U8VA 4O55A 1QJHA 5DM6Q 1NDKA 2YWFA 4JK9A 3WQUA 2KT2A 5AXNA 3EX7B 3C8YA 3VHQA 3PV8A 1XNQJ 2D0AA 2F8TA 5ETSA 1V6HA 1KQFB 1RDAA 2FJDB 3BZQA 2IRXA 1RT1A 2HPUA 3OR1B 1EP4B 3S9HA 4NMXA 4OYMA 4JI2F 4BROA 1K8KA 4K2XA 3M8YA 3QERA 4QIEA 4UY8T 3O6QA 3J7ZT 3Q7BA 1U8SA 1WEYA 3BEXA 5KFBA 3K58A 5HI7A 1EETB 5J1PA 3FZFA 2ZBRA 4K42A 5GAGP 5LMUJ 1OYEA 2Q2RA 3N4WA 2X1FA 3VEZA 1Y97A 2ZF5O 4EFAC 2OPQB 2IVMA 1SC3B 4X4QA 1NLVA 3WNGA 4J9NA 3MWBA 3IBFB 4DR6K 2FZGB 3OL7A 3MI7X 2LKZA 3D9BA 3SSSA 2G1DA 5JVGL 2ZBPA 5KFKA 4W98A 5HP1B 4W5QA 1X0FA 2QLBB 4NASA 2MQOA 2JEIA 1S57A 2CWKA 4F04B 2PMZD 3E1YA 2RE2A 2MKYA 3MMCB 1RT6B 4DN0A 4HDHA 2UV8G 3KHRA 4FOIA 4K0KJ 2YQ1A 1D9FA 3ENOA 1TKZA 3Q89A 4DPOA 1MSWD 3B54A 3LZIA 2A1BA 5I42A 3Q0AA 1DQAA 3VEOA 3M6UA 5DS7A 1X5SA 2MJUA 3G8QA 3L2WA 3GTYX 3L7UA 3N4QA 1R0AA 3MCOA 4XH5A 4OV6A 4JI6F 1KAXA 3ZEUA 4RW6A 2VC0A 2X3DA 2EK1A 1GXTA 2Q31A 4USWA 1WC3A 4H4KC 5KG4A 4BR0A 4EHUA 2CPFA 3E9OA 4NLGA 3MUTP 1Q5YA 5KFEA 3AB4B 3PYDA 5RUBA 1ICEB 1VDHA 3RU0A 3OA9A 4ZKAA 4TY8B 1HMVB 1NK7A 4F36A 3ILOA 4I9LA 2CRLA 2W2MP 2C2DA 1OQ6A 2Y9HA 3CFOA 2D69A 2K7KA 1I94F 2RF2B 4HT5A 1Y10A 1HW9A 2HSTA 3NS6A 4P6QA 3JTNA 3H2UB 3S6EA 3ZT4A 3HFZB 3HTVA 5LJVA 1B7YB 4MDBA 3DXMA 2CWXA 1S48A 2P6SA 2R8JA 4C3LA 3EY1A 2AJ0A 1KFDA 1EAYC 1SC1B 3M6GA 5IT4A 1D3WA 1N33J 4WP9A 1RDCA 4DF8A 3DXKA 1JLAA 2IY5B 2CGKA 3D1QA 1VK0A 3AVGA 2BW7A 1U2VA 1XNRJ 4JP8A 1IKXB 2O8DA 1GX6A 2DNKA 4CE9A 4B9TA 4O0JA 5JICA 3R5GA 1TUGB 1HYZA 2IC3A 2WONB 1JIHA 3CMQA 2PA3A 1Q0NA 1MWKA 2GMHA 2V69A 4MYUA 3OBYA 4DSKA 4I2QB 1ASUA 3I56N 1N52B 4LF4K 4DQPA 1WOQA 3VTIA 3H1QA 2V8DA 4HVZA 3HZGA 2HK2A 2J0QD 3HSDA 3HM8A 2MHNA 1I3AA 3AA8A 2ITGA 3PJWA 2D7SA 5AQJA 2P1JA 4CM0A 3G4SN 3PKYA 4KHUA 5CD4H 2JX2A 3G71N 1PKUA 3ZZZA 4ZP8A 3C14A 1BHLA 4ILHA 2AHOB 4K4SA 2K2PA 3BF1A 1HNXK 3K9KA 5AQXA 1HLWA 1HYSA 1WSGA 3PG9A 3P5JA 4BR5A 3NOGA 1Y3JA 2QM1A 2ASPA 2FVCA 1CBKA 4E8UA 5FLXU 1EQMA 1DTTA 1XTZA 1VQNS 3SUQA 1CJVA 2JVRA 4M5GA 1VK3A 2FC9A 3AVFA 1TGOA 4YOXA 3CCES 4ES1A 4MK9A 4OJ1A 2AYBA 4Q45A 5CD4A 1RQ0A 4C11A 3DWLA 5H9EJ 4LFBK 4CZKA 3PYGA 2YNHB 2BKOA 2OANA 3M6XA 3UDVA 3KD1E 2QE5A 2PE8A 3RR8A 3UPFA 1NKEA 4JI7K 1C2PA 2UXDJ 1RBUA 1F2HA 4I4BA 3OUYB 2XMUA 4AHVA 2DITA 5LMUF 4BVOA 2J7WA 3AD8C 4OX9J 5ADZA 1T7PA 4FYXB 3O5BA 2EFVA 3QO9A 4JKHA 3TARA 5BN9A 3RMBA 1WAFA 1NXIA 2W9BA 4DV6K 2P9PA 3F41A 3O9RA 1QTNB 4X64F 5KT5A 2E8AA 1MWQA 2RDDA 1MWMA 3CCJN 2VQFF 1EJ7L 4H8KA 2EPIA 4AT1B 3GJTB 1QAJA 1V3SA 1JXEA 4XDDA 4DHVA 4FS2A 5DLGA 1ITGA 2F4VK 1C1BA 2BXJA 2D41A 4M5DB 4M5IA 3EZUA 2BGGA 3NKYA 2GJFA 2VUGA 4IR9A 3VEYA 4DUYK 1XN9A 2W2NP 2X6SA 2LEAA 1X4CA 4ILGB 2XHCA 2IFXA 2B6AB 3HL8A 4ECQA 4LSNA 5AZIB 3BR8A 6FDRA 2N4DA 1YJVA 4RBVA 2O5DA 4DX5A 1IR0A 1RAFB 1VRTB 1Q8KA 4LF9F 3M9OB 2RN2A 3MCPA 5JJBA 5E0OA 3AA3A 3SAFA 3EYZA 2G8HA 1DURA 4JN4A 4YOVA 5GAHI 4JD2B 2NRVA 5DGBA 3M8ZA 4QZVB 4CZGA 3OTDA 1DEJA 3ET6A 2NXNA 5HMXA 1B4SA 1N36F 5KT6A 4A61A 2XY7A 2DVIA 2FY8A 2A1RA 3GZ7A 2Q0RA 1X31C 3EWGA 2MKJA 3HSCA 4ZVEA 5CY4A 1K0TA 2C3OA 2O8FA 3EVMA 1Z4UA 3NGTA 1FWPA 1O5JA 1S6UA 1OPZA 2OTJN 1QSYA 3D5MA 4C8NA 3DXBA 3VQQA 2I2YA 2WBNA 2NZTA 5JLHA 5KFFA 5EY4A 2ZITA 3BBFA 2B8PA 3RAQA 3TO8A 4WZMA 4CJSA 2RU9A 3M1VB 3OFEA 1XNRF 2UUWA 4W5RA 5F8LA 2XTJP 1TKXB 4JEPA 1XEZA 3CERA 3TAGA 5A0YA 5SUHA 3N5FA 5BRDA 3AFGA 4ILLA 2MHEA 1ULRA 2VGNA 4GVMA 2DXDA 4IO1A 1S9GB 2ZHAA 1Q7LB 1T8EA 3VEVA 3NDKA 1VQPN 1QAXA 1M90O 1IKYB 4WPAA 3L95X 4HT7A 4ES2A 1X4HA 3QJLA 5C42B 4OO1J 4PA1A 1RHUB 5K8OA 3AAQA 1WDDA 2CZ4A 2HIQA 3CIMA 3ZNUA 3IAS9 3IFEA 4CJPA 1KAYA 1FWLA 3X3UA 1FDNA 3TYTA 4B3OB 5IC4B 1V5VA 2V6AA 3GSIA 5T14A 4FSVA 1VSJA 2ZBQA 2A3ZA 2DISA 4S0MA 2OH2A 1M5HA 4OKEA 1FFSB 2Z1GA 1S72S 1HRHA 2XWXA 2MKKA 4UQTA 2QWNA 2GIQA 1WDTA 4Q2MA 4FWRA 2HFUA 5HL7Q 5BR9A 2FQQB 1Y3KA 3KG0A 5CR4A 3VQ6A 1N5QA 3P49B 2AGQA 4R5PA 1RDWX 1FO1A 2V9WA 1UJ4A 4LIRA 4GVBA 4UOFA 4ED5A 5ETVA 3SMSA 3NVKA 2VBZA 3K59A 4ILJA 4CH1A 5KFYA 3VF6A 5GIOA 5D15A 3HZ6A 2R3VA 4LF6J 4CH0S 5C15A 4E1JA 3BN4A 4C3MA 1HKAA 4B9QA 4LF5K 3LGNA 5DQIA 1BQXA 3HKZD 4KO0B 2C1EB 3QLHA 3UR0A 1C0UA 4NX9A 2XBPA 2IYGA 3LZJA 3SI8A 4USUA 1Z2ZA 1L3SA 4CGDA 3H0PA 5A76A 3CXCR 3FQKA 2CJAA 3PO5A 1S0OA 2YKMB 4KH0B 3H5YA 4OX9F 3F9KA 4GMKA 2F5GA 3QAEA 4X4PA 2NLXA 2PEBA 3MXIA 4DR5F 1P90A 4CLLA 1RWVB 1HHSA 4LF2A 3Q22A 1VBXA 4P10A 3D0GE 3JSYA 3DLEB 4EI2A 3G82B 3MM5A 4RUHA 4I6AA 3NCPA 3ZTSA 3KHGA 2IMWP 3A4TA 4IDKB 1FA0A 1AW0A 2P9KA 3OFFA 2HBJA 4KAZA 5IWAJ 1REVA 1WEZA 4MH8A 3OT9A 4ETXA 3LDLA 2B5JB 4C0BA 1LWFA 2PO4A 1UFKA 1HKCA 2DYAA 4OZ0A 3MZIA 2CPEA 2F9TA 5EWGA 4EGLA 3R5DA 4DF4A 4DU3A 1TAQA 3TR8A 3BY5A 4NRUA 3D67A 3SQOP 1ZOTA 3BGRA 4OHVA 3K5NA 3R2CJ 3ULEB 4M3WA 1C0GA 1IG8A 2RQCA 4C98A 2XY8A 1SBRA 4FP9A 1LXJA 2KG1A 3CWJA 2ZC4A 3PSIA 3ZCMA 4IUFA 4A8XA 1ATNA 1BCOA 4DUZJ 3KLFB 2RQ4A 4K4ZA 3M2RA 1SC4B 1SV5B 4DL4A 1RAEB 4EZ9A 2E1RA 3C19A 4DN9A 4ED3A 2KLAA 2NXEA 3ENQA 2AEJA 3M8SA 4CEDA 3TVZA 4FLTA 1AUDA 2D3OR 2D3O1 1QVFM 4OGCA 1APSA 5H9FK 2CVEA 4J2AA 3LM9A 2HHWA 3TSUA 3CD6S 5BREA 3N5BA 2YKQA 4Q2LA 1B64A 3I55N 4KPCA 3U27A 5BPLA 3V1RA 2GUIA 4NLBA 2V8GA 3E51A 5SZTA 4K8ZA 1HQUB 1O0PA 4IEEA 1KTQA 2HS3A 2XS2A 2J4RA 2LQ9A 4DTRA 1CZAN 1J2VA 1UVIA 4CEEA 1J5OB 1IBLJ 1AZSB 2QRRA 1YITS 4ZLPA 2W2OP 3L9ZA 3PSFA 3M05A 3BYPA 3J7A1 3OXGA 2XY6A 3CC2S 4Y1DA 3ZSQA 5LXRA 1TUYA 1RBSA 1RT6A 4KGZB 1JNRB 1U02A 4DU1A 2ZVSA 3R9PA 3TA0A 3ENBA 5KPTA 3SCJE 4A8WA 1RDBA 2MLYA 4IJNA 3M8PA 5BR8J 4ER8A 2E1ZA 3ZNJ1 2AGPA 4DHYA 1HW8A 2WVCA 1CLFA 4ZVUB 3L3CA 4Z2XA 3T6BA 4G1QA 2H5IB 1JXVA 3K8WA 2G2OA 3CJ1A 3QB0A 2DRBA 2FPHX 2P9LA 5KGXA 3UVJB 1RHKB 4V19X 2XM3A 4CHPA 4DB3A 2ADBA 1ZTTA 2FBVA 1PAEX 1T95A 3SCKE 4DQQA 2PT0A 2DH8A 1IWAA 1Y5IB 3G10A 4A8OA 1FI4A 4R8UA 4LRDA 3QBXA 4RBUA 3AB2B 4Y2CA 4ZMMA 3CJSA 1HMVA 3DLGB 2IYIA 1T11A 1RT5B 1LCUA 4ZIWA 1VJQA 3KWIA 2UVRA 4B1VA 2RF2A 1U6BA 2V2KA 2GQ2A 4X65K 4DTNA 4OPJA 4DR2K 4FJ7A 2HQDA 3U1MA 1YAGA 1F2GA 1RFQA 1UPMB 2BQRA 3WXIA 4B1YB 3G8SA 1U26A 1RT7B 2ZE2B 1NU4A 5J2QB 1ITPA 1ZTWA 6FD1A 2GEMA 2EG1A 3IR7B 1GLJO 4DTJA 4PXEA 4M8LA 3TJAA 3V4IB 4LF7J 3BS9A 3G6XA 2FF6A 4K4YA 2KFZA 1W2BR 2I7NA 3GSDA 4F25A 4WIQA 1OIAA 2M2BA 1UZDA 1IKXA 1NZ8A 1VQOS 4HCCA 3CCSS 3QNNA 4M3UA 2WONA 5KGWA 1HD1A 2QMWA 2DD8S 1RTIB 3DOMA 3OSPA 2P9IB 1VQ8N 5CZXA 2KKHA 2ZWHA 1URNA 4K5SA 4ID5B 5FRMA 2BVZA 1TVRA 5IWAF 2AYMA 4IRCA 4H0PA 3L2VA 4JNEA 4HTUA 3AO3A 3EMTA 3CJBA 2ZBIA 2BJ3A 2XI3A 3OL9A 3IR5B 3OJSA 2POKA 2RILA 2NXJA 5KPRA 2FD2A 2D74B 3SLCA 3AH6A 5AQWA 3QEXA 1WOOA 3FEXB 3W9HA 4K59A 4ECYA 3C6HA 3AAPA 4Z4IA 2XC9A 5I3QA 4G65A 3DLLQ 2BTFA 5K14B 3C16A 4EBEA 1S6PB 2VODA 1MROA 4F4AA 3NGZA 2V0NA 1Y00A 1WSJA 5D4NA 3MM8B 2YNFA 3PACA 4OIXA 1NGBA 2EK6A 3GDQA 1QUVA 4FJ9A 2FHKA 2EX3A 3HPOA 4KI4A 1HNIA 5HMWA 3SV4A 4K4XA 1XK8A 4CK2A 2QFIA 2IIRA 2YNHA 2Y0SD 4U7UD 4JYAF 1AA1B 1TZ0A 3CDUA 1K44A 5BPMA 1WSIA 3LUYA 4FO0A 2J5AA 4CCHA 4HHJA 1Y4ZB 3SFGA 1BQNB 4LY7A 3OUYA 2QV6A 5E2QA 4RX6A 2Z0GA 3H46O 3IS9A 1YJRA 3A8KA 1WTBA 1YTYA 3KJVB 1R8HA 4I64A 2NR0A 2B0GA 4C2MA 2HVHA 3BBCA 3ZSVA 3HHLD 5DDPC 1XJWB 4B17A 3UKUB 2E2OA 4HUEA 3EO3A 4PKIA 3QRRA 2V2QA 3GR0A 1MNEA 4CLKA 3KLHB 1NNEA 4P2FA 3OHBA 2BX6A 2R2TA 2K1RB 1TR0A 4LBPA 1S79A 1YDLA 3ZSZA 1S6QB 1HNVA 3MCSA 5HVHA 1V3ZA 3U3GA 4ECRA 2DPJA 4IEIA 5F8NA 1Q86T 4N8OA 5LMNK 1FX2A 2LA4A 1GX5A 3M1FA 1Q81O 3IDHA 5DG9A 2GGPB 3CUNA 3W3DA 4WP8A 3QFUA 5I3UB 2ZEJA 4F3TA 5EWFA 1ZAWA 2C2MB 3FCWA 4CLPA 3OR2B 3D6TB 4DCJB 2KG0A 4J9OA 1JXBA 5HAOA 4FZYA 3TVYA 2HWHA 4IOXA 1RJJA 3QYYA 2QA2A 2QLJB 1SAZA 4BS2A 2A3JA 4OYPA 2JC1A 4KT0C 1VRTA 2XYHB 2C2EA 1HR0J 9ATCB 4I68A 2XMTA 4DOZA 3HHLB 2FIUA 4DX7A 2OTLS 3CTRA 1UFLA 3AD9C 4JD2A 4M1KA 4W92B 2ILYA 3VGVA 1H1VA 2RIJA 1P27B 1H6KX 5D4PA 4DTSA 3EE3A 1J9AA 1BQMB 4X66K 2XMAA 1YJUA 1HWKA 1SI9A 4YNQA 5HOOA 3VERA 3TJ9A 4E2FB 5ETRA 4GKKJ 3FBEA 2H54B 3ZZYA 1DRZA 3WXMB 5LSLA 3GIRA 1FTRA 2AX0A 2D5RA 5GMKa 2DY9A 2PC6A 4PKDB 2OP5A 5FPDA 2MZJA 1LWEA 4MFBA 1T03A 4B3MF 1YJWS 1XBWA 2W01A 4MKVA 2AKWB 4PG4A 3Q2SC 1VHXA 2GA7A 4YOWA 1HBUB 3MURP 3TTDA 3BKUA 4ED4A 3L0QA 2K06A 3P83D 2F7TA 4LF7F 3CF5L 1IUJA 4CFBA 3CCRN 1E6VB 3US5A 1X0PA 5C12A 5L9NA 2PD1A 5KFCA 1CJTA 5KFJA 1KLMB 1T3OA 1D0EA 2WCXA 1S5JA 3NF6A 3U1NA 1EWQA 2NRZA 5HN0A 4WK3A 3OTBA 3K5PA 3CO9A 4NZ0A 1Q7YO 1Z26A 5TKYA 1P6TA 4B3SJ 3I32A 4YQWA 1N5YB 3W8PA 5C42A 1JB0C 3CMAN 1Q9XA 3MN6A 1TUUA 2BYCA 1M1GA 3UKRB 1UWAA 2O66A 2PSZA 3ZC4A 4A8QA 3ENVA 3GE9A 4C8MA 1HNWK 1U48A 2W8LA 5AJ3K 4B3OA 5KG6A 1FDDA 3VAMA 2B56A 2DGTA 3DLRA 1PBUA 4TQSA 2M8DB 1CZ9A 3F5TA 4LF8J 3H08A 3HFVA 4FYDA 3EM1A 5AFUH 1X9JA 3ZZPA 1Y7PA 2F8MA 4QR0A 3HVRA 3OY9A 2QT7A 2RJZA 2EVZA 4C4WA 4B08A 1WWHA 4WU3A 2YXLA 3DRPA 5IQQA 4XDCA 1HI0P 3JSRA 4TVAB 1MA9B 3CULA 1V3RA 2LXFA 3E3XA 1IBMK 3UDCA 4IKAA 1ZA1B 4MQ3A 4QS7A 4HLBA 3CCTA 2AX1A 1H74A 2EFQA 3BPDA 3PHEA 2BUNA 2VPWB 4C1NK 2I38A 2OHDA 3M32B 5HL7L 5DO2A 5IT0A 1GT8A 2CH6A 2YKMA 2V63A 5AFUA 3FE1A 2GAHC 2J9CA 3THVA 2VBWA 3O3GA 2C3PA 1ZETA 3EKSA 4RO0A 4BDZA 2DCLA 3LDPA 4KB0A 2CKWA 3UNGC 4ZLNA 5BRFA 1J5EK 3AXKA 1XMQK 4B9VA 1HNZK 5AZJB 2RQKA 3ZX0A 2LU2A 2HHHF 4HYKA 1OO0B 3OYKA 1U1LA 4XO0A 5GVQA 4CJVA 1Y0HA 4NA3A 3U7JA 4JRQA 3QZ7A 2JL9A 1VSEA 1UA1A 4CERA 4JI3F 3SSQA 3MEDB 3EGZA 2JWLA 4ILMA 2OKQA 3P6YC 3MDFA 1B9DA 2B5JA 2NRTA 3VAGA 5EGYA 2KFYA 3VAKA 3CPEA 2ZH5A 1MWYA 3IBWA 1NHVA 2WVFA 1WHVA 4I9QA 5CZ1A 1PSDA 2Z4PA 4EIAA 4CGGA 3T5LA 3H3OB 3RZAA 4ANEA 1N32F 1QVGR 2H51B 4USVA 5JVHQ 2WTUA 3KK7A 1HR0F 3VTHA 1U2CA 4YB7A 2FHOB 3CD0A 1M0SA 2R7YA 1RE1B 3KUHA 3MOZA 4UY85 3TPQA 2HBKA 3IGNA 4H4MB 3OLAA 4YB5A 4RLEA 1IKVB 4AHSA 4RWTA 4OZNA 3OYHA 5KFOA 2FJBB 4WQ5A 3KLFA 4DTXA 4O4GA 3DOLB 2E9ZA 2V4JA 1SV5A 2NCKL 4X4SA 2V9KA 1UVJA 3ISND 3QJJA 3LP2B 2IM3A 3FK4A 4O44A 2HW3A 1KVCA 3N4PA 2HQ3A 1KNZA 4I6MA 2U1AA 3QIOA 4UTGA 1IR2A 3MEEA 1EKSA 3NH1A 2J0XA 4ETZA 4BQLA 3V9WA 5EX0A 2AYGA 4BRPA 2DJWA 1AXQA 4GVLA 2G13A 3C7NA 4ZN3A 1FRJA 1X3MA 2HRTA 1HQUA 3D7EO 1C0TB 4OKKA 3W7BA 1SJQA 1K73O 2M5YA 3OTOJ 4M42A 2Z1IA 4BG9A 3PW7A 4A2AA 4E7HA 2UVVA 1SJ3P 1IBKJ 2WSEC 4EAHD 1RWNB 4BE2A 2HBRB 3S3OA 3ZZOA 1K0VA 2JDJA 4O3OA 3EVOA 1WF2A 4FJHA 3DFEA 1B70B 3L09A 1P1TA 1VGYA 5T7LB 4BRIA 1VISA 4AQYF 2IAJB 2DGUA 2GIRA 5K8NA 1FK9A 4M3RA 4QU6A 1HKBA 1R8PA 3UNYA 2E1AA 3GFYA 2P2CB 1XC9A 1VHIA 5KFGA 3R9LA 3LAMA 4MKYA 1SH0A 3MX2A 2CAJA 5M1FA 5AXLA 4LF8F 1PYTA 3MM9A 4C8LA 3HD1A 3CJ4A 4WTYA 4J90A 2B7BB 1T9YA 3W9IA 1DTQA 1S1VB 3W2WA 1QLNA 2J76E 4QBUA 5B09A 1NU0A 4CLWA 1UCNA 2FHMA 3D0PA 3GFHA 4UOHA 1SXLA 3CC7N 2CDQA 4ECTA 4DPUA 4RJVA 1JLBA 5AQMA 2JFDA 4B8AB 1VHFA 3CCEN 4W4MA 4CK1A 5EDWA 3MPWA 3GLJA 4M7XA 1KD1O 3LWMA 3HOTA 3P96A 4EP4A 3A8IA 3HHEA 1QSLA 3CCVN 2ZHOA 2PDAA 2J7KA 4DFJA 3T1YF 2XNQA 4C9DA 1UWBB 2D0BA 2IVFB 1OMSA 5KFHA 2W4PA 2ZM6J 3V4IA 4AM7A 3DXSX 1QY7A 3C15A 3R1HA 1ZBHA 5CAAA 2ZVIA 2NLWA 1VYAA 3LPTA 3KUGA 3KMQA 2AIRB 3TAFA 3R1XA 3IG1B 5DETA 4RUAA 3NH0A 1CS4A 1M90T 3RTVA 4MK8A 4I2PB 2MY7A 3J7ZO 3H4BA 3RR7A 4O3NA 3VN5A 5E3CA 2P9IA 2RH3A 4BGAA 4B3TJ 4E89A 5BYRA 1NSKL 1FF2A 4ID5A 2P5OA 5CHIA 3GONA 5ETMA 5HBMB 4X4TA 3I56S 3ADAC 3TUZC 2Q79A 1M5KC 3R3LA 2BE2B 1OVYA 4WBFA 1HFEL 2RRNA 2VZ9A 1I94K 1P8ZA 2AV5A 5AQSA 2CG8A 4M5KA 1A6LA 2PA8D 2B4OA 4CZJA 2AZ1A 4CT8A 3THWA 4DR7F 1LQ9A 2VWBA 3O8WA 2MLZA 2XNRA 3UDEA 2KU7A 4ECSA 1NM2A 1FE4A 1BHNA 3T1HJ 4M5NA 3VAHA 4USKA 2X7IA 2QXFA 4F3OA 3R27A 1HWLA 3SPZA 3QGIA 3KLEB 3D2EB 3NBPB 1S1UA 2KM8B 2R8GA 1PIEA 2OFHX 3D0HE 3PRDA 4I69A 2V4RA 3DLLL 1ZA2B 3ITHB 2W7OA 2E5LJ 3WC0A 3W0LA 4DFMA 2W6KA 1XHZA 2DRDA 3PNIA 1WF0A 4GMJB 4HACB 4DSLA 3MMAA 5HVGA 1D5AA 1EX4A 4BRNA 4QAGA 2UU9J 3SQ1A 3MECB 3CPWR 4V1Ak 2W1BA 1MU2B 4QOTA 5MLCV 4Q44A 1HKGA 1VR6A 3HI0A 4LQ9A 3OTOF 1WC4A 1LFWA 3MD3A 3KD5E 4M5HA 4KGXB 1WACA 2IVPA 4WFAQ 4KH4A 5KFDA 5E3RA 2V34A 4JI4F 3J81Y 2BQ3A 2UUCF 4PY5A 1RISA 1G99A 3BV8A 3UD5A 3CCJS 1VRUB 4IG3B 4CGFA 3OQ2A 1R0BG 1NMDA 4FF3A 3G25A 3MD1A 3PW0A 1R6VA 5I3UA 3KVGA 3K5OA 1RT2B 3TSQA 2CQ4A 4NEZA 3BUZB 3GILA 4FPRA 2J8AA 4WIIA 5THWA 2DNHA 4CEQA 4FJNA 2BANA 3AVCA 2EKNA 4KHPJ 4GY2B 3HX9A 1IJFB 2F65A 3UCZP 2K3IA 4DPTA 4F7VA 1N88A 2F9JA 5C2DA 1Y64A 2E1CA 1YXQA 3VAFA 5LMUK 3VCDA 1F6TA 1G4CA 1RWWB 5D4LA 4WFBL 1UVLA 1GMWA 4B3RK 3O6WA 3CD7A 2GAGC 1UPPA 4LRFA 4PG5A 5F8MA 2ZWPA 4CK3A 1S72N 1KSPA 4ICLA 5H1SV 4XK8C 3LALA 3QFHA 1BQMA 2UUBJ 4U7UK 1AYEA 2KT3A 4U95A 3EN9A 2FVRA 2I7PA 4X64K 3T3FA 1F3VA 2K7JA 3NCQA 4DPWA 3QPIA 3A8YA 4K50A 2VQFK 3TZYA 2YHBA 4FW1A 4FPBA 4XPCA 3HPHA 4ZJLA 1BE4A 4RPFA 4FJXA 3OYEA 4D3GA 1X8DA 2F96A 1YTAA 3I6PA 1U8WA 2HNYA 3V6KA 3NEKA 3EGVA 2G8KA 2F7VA 2ROPA 1HBUA 1R0CB 5A8RB 5L38A 3T5KA 4CJ5A 1IV0A 3OYLA 2OTJS 8RUCA 5HMYA 4NLSA 3TAMA 4PXDA 1RTDB 4CJEA 4K4TA 1E6VA 4P74A 2L9NA 3T9ZA 3T5JA 1ZAVA 2RS2A 4L72B 4K43A 4O3QA 4LF9K 4BR4A 1KLMA 1GTHA 4CJ4A 5BN8A 1OY9A 3DC2A 4C8OA 1Z2LA 2UXCK 2CQ0A 2VG6B 4F4XA 1EWRA 2BKPA 3DGPB 2KM8C 5SWMA 4C6AA 3P5BP 2YX4A 1NJWA 5E84A 1N36K 3BKTA 3KIOA 1V5IB 1N5YA 4JKGB 4RZRA 1VQ6S 3EE8A 2W42A 1QZ6A 1WKKA 1VQPS 3UKRA 1JK9B 4KTZA 2VWJA 3QMLA 3DLBA 3LDOA 1DKGD 1O13A 1LXNA 3TR5A 3AVMA 4IFVB 2CQCA 2MQQA 4G9ZA 1KQSR 3CJAA 2OA8A 3DRXA 3P1GA 4URQU 3OYGA 2E9TA 2UXBK 2XSFA 1G1XA 3PKMA 3MM6B 3T1HF 1QHTA 4PQUA 3G6VA 1SIWB 2GVZB 1RWOB 3U9ZA 2GX8A 5DRKA 2LEBA 1XNRK 4CHYA 1B0PA 2KVQE 2XCPA 1WSEA 4ELUA 3QETA 3BF4A 1W97L 1WHWA 3MWTA 4DU4A 1T05A 2KXNB 1PBAA 4DQIA 1UVKA 4BVPA 2EBGA 4DCPB 4Y00A 1S3XA 1NPKA 3BQ1A 3TTCA 3ZSXA 4ZVQB 4O0NA 2R8IA 4ZP6A 4PPDA 3HKWA 4M5JA 1RT1B 3M32A 1MN9A 1YJ9N 4B1ZA 1Q8LA 5AR0A 4FJKA 2YWGA 3C95A 3PYEA 3UIQA 1BI4A 2KI2A 4J2BA 1R27B 2KW4A 1C0MA 1DQ8A 2B9EA 3O80A 4ISGA 5HRRA 3IM9A 3KKSA 1D9DA 1S1XA 4I6WA 3TZWA 4BRFA 2BH1A 2BJ7A 2VBXA 4LD0A 4W5OA 2HFZA 5AZJA 3VQ5A 5GAHP 3R1LA 1GLEG 3C6TA 3S1TA 5L39A 4DR6J 4KIAA 1SJ1A 4X62K 1NSPA 3OYJA 4LVNP 1IJJA 3G96A 2DKOB 1S7HA 2JRSA 1UAWA 4ITSA 4PQAA 4O8KA 4ZPWR 3MEDA 2RSQA 3QSIA 3TANA 3HF5A 3EUNA 4CHZA 4YHHK 3MCNA 2OMLA 1QM9A 2HHQA 2A18A 5J2MA 2KZZA 2IM1A 1NGHA 1F3FA 4OLBA 4NLQA 2BRKA 1RUSA 4WF9L 5C10A 4Z7CA 9RUBA 2B9XA 4KHPF 4MT1A 1S12A 1YBTA 3A12A 3I82A 3PW2A 2Y8YA 3TOQA 3DMJB 5IXUA 1FCAA 4WKRA 4K4WA 4JV1A 2JWNA 1ACMB 3W9JA 5I42B 1NGDA 5BYSA 3OL8A 2FLOA 2M70A 3R8EA 2Y8WA 4R25A 3GJQB 1IKVA 2E88A 4A57A 4DR5K 3ZEUB 5LY3A 3DOLA 2RVJA 2DGOA 3VQCA 1AFJA 4IR1A 5DQGA 2DNLA 3G6EN 2HRYA 4W90B 5JVHL 4FPAA 4ZVSB 4AL5A 2I9SA 2J9EA 2YHYA 4E1NA 3M2VA 2ZJQQ 3VQ8A 3GIJA 3U8XA 1Q16B 4XIUA 2W2PP 2FC0A 4JI8F 5C7PA 5EXWA 4AXJA 4HCBA 3QAUA 2CPXA 4CJLA 3N28A 1YRTA 4R0JA 4TLQA 5KFRA 1YT3A 1C0TA 4FJGA 3ENAA 3AVIA 3MUVP 3H98A 2XY5A 3FZHA 3D3BJ 1Q81T 3ISZA 4FLXA 3FGUA 3DXMB 4YR0A 1NK4A 2XLIA 2HQCA 3D1OA 1WAJA 3IWXA 3LOUA 5LSOA 2MZQA 2P9EA 4XTTA 3J8AA 3PLAA 3BJYA 2CQ1A 3WC2A 2MYFA 2MDAA 2W4CA 4HHHA 2ZHBA 1U2VB 5T7LA 2HURA 2O8DB 4FZXC 1YHQN 3QT5A 4F4ZA 3WX8A 2IC3B 5AQYA 2HBYB 4F9OA 2JSXA 3LO3A 1FHTA 4GKJJ 5J1EA 4USJC 2MZRA 3TEHB 4ED0A 4CHOA 1E4GT 4V19S 3EJMA 2BOAA 3VENA 3LGMA 2UYTA 1GLLO 4CO5A 4Z7YA 3NCIA 1FJGF 4CIGA 2E6MA 1HNXJ 3SCXA 1MWZA 2E66A 3J80U 4DL7A 2OCEA 4LT6A 3NP5A 2R7WA 1HYSB 3CJ3A 4I7FA 1K8AO 3GG1A 2OPRA 4O5FA 3QICA 2QZ8A 1N6QA 4DWIA 2G2ZA 2VD3A 2J8SA 3NXZA 4ID1A 1DTTB 3I9ZA 1U0HB 3VVUA 1CJVB 4HUFA 3H6EA 2VKZG 3ATUA 1URRA 2H3GX 3J7YU 3FMWA 4ES3A 3VA3A 4FWQA 3FCVA 4ED8A 1H38A 4LFBJ 3OJUA 1GLFO 3R6GB 1B99A 4DKWA 4FLZA 1B0VA 4JI7J 3SBGA 1NLKL 3A8EA 4QIGA 3RB4A 3WEEB 1Q7YT 4NYNA 3X1LB 1SC6A 3AVLA 3J80O 3IG1A 4DV5K 3U3YA 3KLVA 4CLSA 3G87A 5JUMA 1X5PA 1D1UA 3JYTB 1CC8A 4RTFD 3QO9B 1H73A 3VESA 4MK7A 3Q23A 4KHNA 3H90A 4DV6J 2CPYA 1GLDG 3C0BA 2XZWA 2W9BB 2H48B 4BRAA 2HBMA 1VQ8S 2P9PB 3ILIA 2QGFB 4Y2AA 2ASYA 3DNCA 2KH9A 2NQPA 1EARA 1C4AA 1SCJB 3NAEA 4FW2A 5GADU 3EDRB 5C5JA 2WTFA 1WC1A 1CC7A 1SL0A 2F4VJ 4CEAA 1T94A 4DLEA 2YKAA 3TSPA 2QEXN 4F3QA 3VGLA 2E7XA 1C1BB 3DDNA 1JLCA 5F3TA 1FNMA 4DUYJ 3VQDA 4LFAF 1RLCL 1ZBFA 3VETA 5J2PA 3LPYA 4Y2IA 2B3TB 4OPHA 1RSCA 2MB0B 1NSAA 5MAOA 3MR7A 1BLUA 5HMZA 4IYQA 3GV7B 2IGIA 5D0GA 3AO5A 2C2KB 1S97A 4WP3A 4FJ5A 3H2VE 4QPXA 1Z1ZA 2PY5A 3EXYA 4YDXA 2OTLN 3BM7A 2Q3PA 3ULHA 4NA1A 4URGA 2HLTA 4ZVFA 5HQLA 3UN3A 5DJBA 1WSFA 4IBNA 3VQTA 2M52A 2LXUA 2BJ1A 2QLFB 2VQEK 5HJYA 4A46A 4KI6A 3IBCB 3I96A 2CPIA 1S77D 4CJTA 1UL3A 2C42A 2HF3A 2ZZMA 3VR1A 2VWKA 5IWAK 4FWKA 2WHOA 5KFMA 1SKWA 2HVDA 5B08A 3VGKA 4BE1A 4WKYA 4AL7A 1H2TZ 4YUDA 2YY3A 4YFUA 1PJ5A 3BZCA 1YJWN 4FF1A 2RUSA 3TWHA 3RRKA 1IH7A 3MECA 1NHUA 2NPFA 1HBOA 2I8EA 4BC4A 1O8BA 3CDAA 3IKMA 1GFWB 3O9SA 4WCEQ 1NGGA 3L8BA 4H5WA 4KQZA 4CT9A 4BHQA 4DV1K 1RBVA 2IOCA 3MCAB 2CNOB 4U67Q 1WNEA 2O4GA 4NYPA 4M3TA 3QSYB 5DDRC 4OJRA