4WE1A

Crystal structure of hiv-1 reverse transcriptase in complex with 5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)-2-naphthonitrile (jlj600)
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
547
structure length
542
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Gag-Pol polyprotein
publication title Picomolar Inhibitors of HIV-1 Reverse Transcriptase: Design and Crystallography of Naphthyl Phenyl Ethers.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
total genus 140
structure length 542
sequence length 547
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4we1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4we1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4we1A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4we1A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4we1A05
1NK5A 4ECZA 4FLYA 4DS5A 4CESA 4RW6A 5CZ1A 1X1PA 4DTNA 3L8BA 1OS5A 3P5JA 3U3GA 4NYZA 5KFHA 1S1UB 2OH2A 1FK9B 3SJJA 2OYQA 4ZTJA 3AO4A 3NGYA 3QEXA 2R8HA 4K4VA 1S9EB 1J5OB 2IM1A 1C1BB 3OS0A 3VQCA 4DTPA 3MEEA 2BQ3A 2J6TA 2P5GA 4LSLA 2HNDA 4FYDA 1T03A 4ICLA 3K57A 4IFYA 4R8UB 2XRIA 3TWHA 3DLGA 4KV8B 4DWIA 5KFTA 4DEZA 1RTIA 4DTUA 3SV3A 5KFBA 4CJRA 1TKXB 1CZ9A 5J2NA 1VRTA 2PY5A 4NCBA 3NAIA 4FLUA 4YR3A 3TAMA 2DFFA 1HPZB 1BIUA 5C25A 3SUQA 1WSFA 4DU4A 3SI6A 3DM2A 4KKOA 1X9SA 1RT5A 2W8LA 4FK4A 4IRKA 4H54A 3KK2A 2KZZA 3I5AA 4OGEA 1NHVA 3KLEA 4NLYA 2W7PA 1C6VA 3H4DA 3KHLA 3T1AA 3DOKB 5KG1A 1ZYQA 4CHYA 1NJXA 2W9AA 5F8IA 1NK7A 4EO6A 1RTDA 1HMVA 4Y2AA 1SL2A 3RBDA 3ISNC 3K2PA 4FW1A 3RB3A 3M8QA 4C8MA 2P5OA 4NLTA 1C0UB 4H4OA 3LP2A 1QE1A 1MU2B 1Y97A 1TL3A 1CZBA 5FRMA 1SKRA 3H2LA 1ASWA 4ED2A 2WONB 1N5YA 4KHMA 2JC0A 3LP1B 2GV9A 3IAYA 3DLKB 2RDIA 4Z4EA 4DG1B 3OYLA 1S97A 2HNYB 3RBEA 2E9ZA 1LW0A 2BANA 4NZ0A 4IH6A 3FQLA 4KPYA 3V6DA 5KFSA 4ZP8A 3ZSXA 5F8NA 1I39A 4EP4A 1U4BA 2R8KA 2YKNB 4X2BA 4ECVA 2RKIA 1QSLA 5J2MA 3SFGA 3VQPA 3CFRA 1RT6A 2PZSA 4IRCA 3LPTA 2KZMA 3QO9A 4CF1A 1KLNA 3BGRB 1KVBA 2IC3B 4KRFA 1CXUA 3VQAA 4UQGA 4RUCA 3IGVA 1RYRA 3M8RA 1HNVB 5DLFA 3BJYA 1HYZA 5KG2A 3OYEA 1D5AA 3M9NB 3QEPA 1L3UA 3IG1B 4KAZA 1VSFA 2AGQA 4OJRA 4QWAA 5DGAA 3A2FA 2B5JB 3VA0A 3SV4A 2JEFA 4O3SA 2UVRA 4CEZA 3OYMA 1VSJA 3OYHA 3ZSVA 2D0BA 2O5DA 5C24B 1JKHB 4AHTA 3OJSA 4B3OB 4IR9A 3SNNA 3PW2A 4NYNA 3KD1E 2ZKUA 4EO8A 4MIBA 1RTJB 3HVWA 2IMWP 4KI4A 3WNHA 3LZJA 4TYAA 1LWFA 3NFAA 3M8PA 1TK5A 2X78A 3DRRB 3E01A 1KLMB 4NCAA 3NBPB 5KG5A 5F8LA 1TKDA 1XWLA 1T8EA 2B43A 2IAJA 1REVB 3TAFA 5HRNA 3K59A 3DLEA 2YHAA 4R5PB 4F4WA 3VQEA 1K1QA 2JC1A 2IM3A 3KKSA 4RNNA 3SUPA 1UOCA 3V9ZA 4ED1A 5HBMA 3ZT0A 1SV5B 3LP0A 3VQQA 3OL7A 3V81B 4N47A 3E51A 4J2AA 3EY1A 3QEWA 4YFUA 2IA6A 4KFBA 3KLHB 1GX6A 4CGGA 1Z4UA 2HHUA 3G6XA 1VSMA 4CHPA 1U45A 1JXBA 3GILA 5J1EB 3PHEA 3MECA 5KFLA 4J9NA 1LWCA 3BR9A 4WYWA 5KFFA 4KHYA 2OA8A 3HVTB 2E9RX 3CM5A 1W9HA 4WE1A 3RB0A 3WNGA 4KO0B 4NLVA 1RT2B 3FFIB 1JLFA 5HP1B 4QCLA 3I0SA 5KT3A 1RBUA 1JLAB 4ZVFA 3CG7A 1SH3A 2B4JA 3SQ4A 4E3SA 3ZSWA 1D1UA 3GV8B 2ASJA 4IFVB 3KNAA 4H4MA 4DL3A 1VRUB 2FJVA 1S6QB 2VG7B 1JXEA 3V9UA 5KFEA 1HRHA 3GIIA 1D0EA 4EP5A 3IS9A 1T94A 3RRGA 2YNIA 3DLBA 3SUNA 3Q8PB 3RR7A 4BACA 4FJ9A 3AVLA 4KAIA 2D3ZA 4MKBA 4RZRA 2E6MA 4FJXA 3HVAA 1TKZA 3AA3A 5D3GB 3KLVA 1KRPA 1SUQA 4KBIA 4DTXA 1VK0A 3FDSA 4TY9A 3QZ8A 4E19A 1YVUA 1RBSA 4KB1A 4J2EA 3D28A 3OLBA 1S1WB 3AVMA 4F2SA 3LDSA 2B6AB 4IG3B 1BQMB 3DI6A 1WNEA 5CYQB 4AH9A 3G6VA 4RNHA 4E7HA 3FRZA 3PX6A 2W9CB 3H5YA 4IOBA 1L3SA 3OHBA 3HPOA 4O3PA 4K4XA 4NLGA 2JEJA 4W5OA 3KK3B 3AO1A 4J9QA 1S0NA 4EYHB 3NL0A 4ZPBA 4JV2A 1S9GB 4IG0A 1UWBA 4Z4IA 2V4QA 3NF7A 5KFNA 4K8ZA 1VSLA 2F8TA 4ZPAA 4W5RA 1C2PA 4B8CA 4I9LA 1T05A 1T7PA 1NK8A 1VSEA 3RMBA 1A5XA 4CFAA 5HROA 2X74A 3AVGA 3VQ9A 3V9SA 3P1GA 3RMAA 3B6OA 2IM2A 3KLIB 2AX0A 3OYDA 4KB7A 4KI6A 1X9WA 5CY4A 2ZE2A 2GC8A 2XO7A 1GX5A 3HKWA 3KLFA 4MK9A 3BQ0A 4DF4A 1JIHA 4JV1A 4PA1A 1QQCA 4J9MA 4NLUA 4CF2A 3I8DA 2HNZA 2WHOA 4CK1A 2YHBA 3QYYA 3VQ6A 2BRLA 5KFUA 3PVXA 1C0MA 1JLQB 1LAVA 1BIZA 1SKWA 1IO2A 3Q8RB 4YP3A 3UDLA 4DQIA 4WFXA 1K1SA 4NLPA 5KFGA 2F8EX 4RW8B 3G10A 1R0AB 4I9QA 1TKTB 2QKBA 4CGJA 2UUWA 4C8NA 4FS2A 1VSDA 4CK3A 1S1TA 4MFBA 4ECRA 1W25A 1ZBIA 2AGOA 1VSKA 5JXSA 3L3UA 4TSXA 1BQNB 2EC0A 4CJVA 1KSPA 4E7LA 3KJVA 4EBDA 3KK1A 4DFJA 4CJKA 2RN2A 3GIJA 5JS2A 4ECQA 3NH1A 3HO1A 2Y1IA 3NE6A 4M41A 1LWEA 4B9TA 1FK9A 5KG0A 5FDLB 1B92A 3AVFA 2VWJA 5C42A 5DGBA 3RAQA 3OYBA 1K6YA 1S9EA 1B9FA 1J5OA 5JUMA 2HHXA 1U49A 4PWDB 1C1BA 4CJWA 2LSNA 3MEDB 4FS1A 1S1XA 4QW8A 4F4YA 1BI4A 2O4IA 4DSLA 5KFQA 3LP3A 3EPIA 2O4GA 2Z1JA 4KV8A 4DL6A 2DPIA 4FW2A 1JX4A 1WSGA 1N48A 1TKXA 3VQ7A 3NKYA 4CJTA 3CWJA 3V6JA 5F8MA 4CHOA 3BDPA 4J2DA 1HPZA 4CEEA 1XC9A 1KCFA 3NH0A 4Q8EA 2P1JA 4EYIB 4OPKA 4LSNA 4K4YA 2IJNA 4FLZA 4Z0UA 4N56A 3JSMA 3S9HA 4DU1A 4JS4A 4B9SA 4FM1A 3DMJB 4RW7B 2VA3A 4G1QB 2FBVA 4HUGA 3C6UB 3QGIA 1ZBFA 2C2DA 2ILZA 4Y34A 3V4IB 3HSTB 4ED7A 3DOKA 2XWYA 3AO3A 3KOAA 5CYMA 1KVCA 4O44B 2FBYA 1ASUA 4FJ7A 1JLGA 3NGDA 2BQRA 3O4QA 3LANA 3V6HA 4ECSA 1EETB 3OS2A 4HUEA 4HHTA 3F73A 1RT7B 1QUVA 3PX4A 1C0UA 3H4BA 1NKCA 4GC7A 3CFPA 3PX0A 1Z26A 4ECWA 3GIMA 4WFZA 3LP1A 1TVRA 5SWMA 4ID5B 1WAJA 4Y1DA 2PYLA 4IDKA 4XO0A 2FLLA 3LZIA 3H5SA 1WSJA 4DLEA 5KFYA 4FBTA 4K4ZA 1RBVA 4WYLA 3HP9A 4RG8A 1LW2A 3QEVA 4NYFA 2ZQBA 5K14B 2FJXA 4URGA 3MR3A 1N56A 2XCAA 4Q0BB 2VG5B 5KFRA 4CCHA 4DTRA 2E9TA 1DTQA 1N4LA 3GQCA 4H8KA 1TL1B 2ETJA 3CJ2A 5J2PA 2CJQA 3G0ZA 1RDCA 4N5SA 4NLDA 2IC3A 1VSIA 4J9LA 4JV0A 2QXFA 5KFXA 1DTTA 3MEEB 3PJWA 1NJYA 4IQXA 3IG1A 2HNDB 4FLVA 4ICLB 4BDZA 3C95A 3AO2A 4FJGA 5DQHA 1A5WA 2D5RA 3DLGB 4TN2A 1EX4A 4FJ8A 2B5JA 3NGZA 3QINA 4CF9A 1RTIB 2Z1IA 1S6PB 4KSEB 4DSFA 5KFKA 5C24A 5J2NB 3VN5A 1JKHA 4CJLA 2HHQA 1GOCA 1S1VA 5KRSA 3DLHA 4OGCA 5KI6A 1DLOA 3TAMB 3OL9A 4FJJA 4O4RA 3ZSZA 4FVMA 1CXQA 4CEQA 3GYNA 2QE5A 4KKOB 1RT5B 4CIFA 4CJEA 3QGHA 4M3WA 3KK2B 4CGHA 3HL8A 3OL6A 2BE2A 4HUFA 1XR6A 4F4XA 2Y1JA 3KLEB 3DRRA 2WCXA 4URSA 2RPIA 3PW7A 2DFHA 3NBPA 4RU9A 4WXWA 3K5MA 4NCGA 5KG6A 3V1QA 1HMVB 4O5BA 1IG9A 1REVA 4ELTA 4IBNA 3OYFA 4N76A 3V6KA 5FROA 3T19A 3OYAA 4O3RA 1JLCA 3RMCA 2ATLA 3KMQA 4R5PA 1N6QB 3M8QB 4LH5A 4DSIA 3AVNA 1KHVA 3CIZA 3ZSYA 4DQSA 2D0CA 3LP2B 1TL3B 5E41A 3RMDA 3RB4A 3ZT2A 4JRPA 5KFIA 4C8KA 5KTQA 4I2PA 2WOMB 4ZP7A 2JEGA 1BCMA 1L5UA 4J2BA 1ITGA 2I1RA 1IKWA 4ZTFA 1GOBA 4I2QA 1SKSA 2OPQA 5J1EA 4K8XA 4QWCA 1NNDA 5DQGA 4HTUA 4Y2CA 2BANB 3HVTA 4BDPA 5F9LA 3IN5A 2PYJA 5KFPA 4O4GB 3V6DB 2JLEA 5EU7A 4RNOA 2ALZA 1QSYA 3RB6A 1S0MA 3TAEA 2X6NA 2W42A 3V9XA 5HP1A 2E4LA 1JLAA 1EKEA 4GW6A 4OL8A 4O0JA 4RNFA 1RT6B 2Z1HA 1YTAA 3BSCA 4E7KA 4CJPA 2XY8A 1HARA 3S3MA 1CSJA 2X6SA 3OSPA 1QTMA 1S4FA 5KT7A 3ITHA 4HCBA 3VQ5A 2VG6A 2R2RA 4DL2A 2HHSA 4O3NA 3U3YA 1CLQA 4FLXA 1IKXB 2G8WA 2UVWA 1EP4A 2G8UA 2OPSA 3ZSRA 2KTQA 5FRNA 5I42B 1U47A 1NJZA 3KLGA 4EBCA 4ED6A 4ID1A 3TAGA 4DU3A 3I0RB 3VQBA 4CK2A 3LWLA 4EZ6A 5KT4A 1D9FA 4M3UA 2JEIA 3U6FA 4KTQA 2D41A 2KFNA 1UA0A 1S1WA 4LH4A 2AJQA 2B6AA 4KB0A 4IG3A 2YNHA 4RW9B 5KG4A 3ULDA 2W9BB 1BQMA 3AVIA 2YKMA 4M42A 2FVRA 4IH7A 4TLRA 1ZTWA 1TV6A 2KW4A 3PY8A 3M8PB 4HYKA 3UIQA 2Z1GA 3E01B 2C22A 1HNIA 3PW0A 3NF9A 1NJWA 4FXDA 4PQUA 4YMEA 3KK3A 3MR5A 1FKOB 3P83D 1BISA 1SL1A 4MH8A 1JXLA 3AA5X 1S9GA 3SQ2A 4QW9A 4M3ZA 4NRUA 4CERA 2YNGB 4Z4CA 3VQDA 2HVHA 3RTVA 3O3FA 2WK4A 1NKBA 3OLAA 3D5MA 1TQLA 3TAQA 4ZPCA 4CFCA 5T14A 2W8KA 5F8JA 4DMNA 3G6YA 4O0IA 1BGXT 4LD0A 4TY8A 2J6SA 3MEGA 4K4TA 3SZ2A 2FVQA 1YT3A 4OPJA 5KGXA 3NGIA 4AHUA 3CYMA 2FC0A 1GOAA 3PR4A 2XC9A 3QLHB 3RRHA 1TP7A 1RBTA 2V4RA 3HT3A 1IKVB 1LV5A 4WE1B 3OSNA 1TAUA 4LY7A 3IRXA 1RA6A 4DS4A 4JS5A 4CGFA 4G3IA 4F8RA 1JLFB 3LALA 4Q44A 5KFOA 1RYSA 4CJ3A 2A1SA 3TR8A 4B9NA 4IH5A 4J9RA 1ZTTA 4EBEA 4DSKA 1Q8IA 4H4MB 5I3UB 2XCPA 2J6UA 4PY5A 4F3OA 3CJ3A 5JS1A 4MK7A 5EWGA 1JLEB 2R2SA 3EZ5A 3NH2A 4E7JA 4RW8A 3FSIA 1C0TA 3HYFA 1TKTA 3HXMA 3H5UA 3HK2A 3WNEA 2HMIA 3ZT1A 1RDAA 4BE1A 4FM2A 4NLXA 2IDOA 4ECXA 1O1WA 2RF2A 1TK0A 1RT4B 4M3YA 4FJHA 1FKPA 3KMSA 4ELVA 4MKAA 2C2EA 3C6TB 4CF8A 3ISND 2ZD1B 4KHQA 4FK2A 1RTHB 1TAQA 4FJMA 3PV8A 4CEOA 4PUOB 3D45A 4URQU 5C5JA 1RDDA 3DRSB 3QNNA 2GUIA 1ZBLA 3PW5A 3NF6A 3L2VA 1RT1A 5FDLA 4QPXA 5L1JA 1NOZA 2F8SA 1HQUB 3S3OA 3QESA 2I5JB 4PWDA 2D0AA 5L1KA 5SZTA 3MEDA 3HM9A 3G86A 3CJ5A 3AV9A 3QEIA 2XY6A 1UWBB 3AVJA 1UAXA 4GMJB 1I3AA 4NLOA 3H5XA 3SUOA 3TQ1A 1RT3B 4CFDA 4FZXC 2YNFA 5KFWA 4J9SA 2A1RA 4ECUA 1RCHA 1HYSA 4AHCA 5HROB 1RDBA 3AO5A 5DLGA 1JLBA 3RR8A 3Q8SB 4NLRA 3UQSA 4QWBA 2DTUA 4C8LA 2ZE2B 4NLSA 4YNQA 1LAWA 2AWZA 4MQ3A 1RDRA 1S1UA 3ZCMA 2OPRB 4G1QA 4IRDA 3S3NA 4ED0A 3JYTB 3V4IA 3D0PA 4ZVGA 4TQRA 4O3QA 4DFMA 3OYIA 3DOLB 4O44A 3MR2A 4K4SA 2FJWA 5HLFB 3DYAB 4R8UA 3QZ7A 1D9DA 3PO5A 2EX3A 1RT7A 5J2QB 3OVNA 4R0EA 1BHLA 2G8IA 4O55A 1U48A 4CJ4A 3BQ2A 3C94A 1IKYB 2Q3SA 3OYGA 4Q5VA 1NK0A 2R2UA 3ASMA 2G8HA 2ASDA 4ID5A 1HQEB 2OPPB 4DTMA 1ZBUA 2WTFA 2FVPA 5KT5A 1S1TB 3TVKA 2FBTA 1C1CB 3N6NA 4JRQA 3QIPB 3CM6A 3OS1A 5K14A 2HW3A 4YQWA 3OYKA 1WSIA 2ILYA 3M8SA 3AVHA 3KK1B 2QKKA 1RBRA 3V1RA 3BREA 3CDEA 3ZSQA 1VSHA 4GC6A 3KHRA 4HCCA 3MXIA 1J53A 1TL1A 4OKEA 1LWEB 4M3RA 4BDYA 5C42B 4Y1CA 1KHWA 4KHWA 1MU2A 4M94A 4AHSA 3MTKA 1S1XB 5F8GA 3SI8A 1BI4B 2KQ2A 2IM0A 2XI2A 2WONA 5KT2A 4Z4HA 4IKFA 4U6PA 2HHVA 4MK8A 4KTWA 3L2QA 3DLKA 4W5NA 4WZMA 3ZSOA 4DG1A 4CJUA 3SQ0A 2HNYA 2D3UA 4CEFA 4CFBA 4ZHRB 4I7FB 4QOZB 2P51A 4OKJA 4QWEA 1S6PA 3OYNA 2FLNA 1NKEA 2GBZA 4CGIA 3PO4A 3K5LA 4EEYA 1XR7A 3SQ1A 4RW4B 3DRPB 2YKNA 3L2WA 3I5BA 4LSNB 3BSNA 1Q9YA 4RW6B 3MR6A 3JSMB 3HVRA 4B9UA 3BGRA 4CF0A 5EDWA 1MMLA 4ZP6A 1FXXA 1HNVA 4AHVA 5CYMB 4DTSA 1YTUA 2V9WA 4LSLB 3NHGA 1T03B 1JLGB 4J9KA 4IFYB 3KHGA 4CJSA 5DQIA 4BE0A 1N6QA 4FM0A 4ZVEA 5HRPA 5KG3A 1T3NA 1HYVA 4LQ3A 2HB5A 5KFZA 2OZSA 4CGDA 3N6MA 1VRTB 4NRTA 3KD5E 4F2RA 2WOMA 4NLQA 1Z25A 2R8JA 4B3OA 3TI0A 2ATQA 1TVRB 5KFAA 4IDKB 2AX1A 3EYZA 5C25B 3ZT4A 3KTQA 3HJFA 1NOYA 3DM2B 2XGQA 4Q43A 2WB4A 3AVAA 4DF8A 4DTOA 4NLWA 1RTJA 1LW2B 3VQSA 1U04A 4CHNA 3QERA 1TGOA 3CJ0A 1ZETA 4K4WA 3DLRA 4DQRA 3AVCA 4B9VA 4O4GA 4KREA 1G15A 1WLJA 4Q45A 1KLMA 1XHXA 4CEBA 4M45A 1RAJA 2KFZA 2NUBA 1RTDB 5EUHA 4M3TA 4FZYA 1L3TA 1DTQB 1B9DA 1WN7A 5KFVA 3OL8A 4WFYA 5J2PB 1BCOA 1D8YA 5HRRA 2VWKA 4L8RB 2G8VA 4B9MA 1DTTB 3OY9A 3CDUA 4ZMMA 4H4OB 1QE1B 3DDKA 1S0OA 2IS3A 1SV5A 5L9XA 3LAKA 3V81A 4N41A 3MAQA 5EWFA 1SH2A 1IKXA 3K5OA 3SFUA 3KIOA 4FLTA 1N5YB 4CJ5A 3AVKA 3KLHA 1XI1A 5I42A 3O3GA 3TABA 2DFEA 3QNOA 4W5QA 4RNMA 4CHQA 1NHUA 4E1NA 3QETA 1LW0B 5L1IA 3I0RA 4WXOA 1RILA 3V9WA 3SPZA 3PR5B 4YR2A 1NK6A 1S1VB 2FVCA 4XIUA 1EXQA 5KFMA 5KG7A 1DLOB 4RUAA 4KO0A 3SPYA 1RT2A 5KFJA 3FFIA 4MIAA 4CIEA 4RW9A 4M95A 2W9BA 2RKIB 3HP6A 5J2MB 2DPJA 1U09A 4KE5A 2BRKA 2HHTA 3THVA 3QO9B 2BE2B 1Q9XA 1KFSA 3T5JA 4ED8A 4IFVA 2AQ4A 2BR0A 2V0NA 1VRUA 1S6QA 2VG7A 3CFOA 1FKOA 3VQ4A 4NCGB 4DFKA 1WNSA 3LPUA 2HAIA 2IGIA 4CIGA 2UUTA 1S10A 4ZVHA 3F9KA 1JLCB 3T5KA 1UA1A 4ECTA 2YNGA 3I5CA 4DQPA 4ECYA 4AHRA 3OHAA 3UPFA 4B08A 5D3GA 4E7IA 3SCXA 2R2TA 3CO9A 3L2RA 3ZT3A 3BSOA 4I2PB 4CECA 5DG8A 4F4ZA 2XHBA 1SH0A 3EPGA 5DMRA 3MFHA 4IR1A 3CDWA 1IKWB 4KHUA 1A5VA 4I2QB 4B9LA 5CYQA 2OPQB 3SYZA 3QLHA 1S48A 3NMAA 4B8AB 1ASVA 2W9CA 1QAIA 4JLHA 1LWFB 3T5LA 1IKVA 3OYCA 3HPHA 3QIDA 3K58A 3O4NA 3MXMA 4KHSA 4TQSA 4DQQA 2IAJB 4FJ5A 3QGGA 3ALYA 4FLWA 2C28A 3MF5A 3DLEB 2XI3A 2F96A 4DSEA 3H59A 3V1OA 3CJ4A 1NK9A 4HKQA 4HVJA 2ASLA 5I3UA 5EWEA 3ITHB 4FJNA 3FQKA 2VG6B 1BL3A 2UVUA 1JLEA 4CJFA 5HBMB 5DK5A 4K4UA 3LP0B 1C1AA 3M9OB 5KRTA 5KFCA 1QAJA 3L3VA 1EP4B 3O3HA 4TXSA 3T5HA 4F50A 3GV5B 3T3FA 3KLIA 2OPSB 3PZPA 3QIOA 4KFBB 4FJIA 3KLGB 4WZQA 4C8OA 3GIKA 3MECB 5KFDA 4QAGA 1LWCB 1RT4A 3OJUA 3C6TA 2IOCA 2ZD1A 4IKAA 4W5TA 4ELUA 2VA2A 1IM4A 4E0DA 1RTHA 4LQ9A 2YNHB 1I6JA 2HWHA 4E89A 3CQ8A 2YKMB 3I0SB 2R8GA 4PUOA 1TV6B 2FVSA 1KFDA 5KGWA 1QSSA 2OZMA 3DRSA 5T7BA 1YVFA 3VA3A 1JLQA 1HNIB 3RAXA 1ZBHA 2XGPA 4AILC 1HQUA 4PQUB 4FZZA 3UR0A 2E6LA 1WAFA 2I5JA 3IS9B 3IGNA 5KT6A 2YNIB 2DY4A 3AA4A 5L1LA 4KHNA 1J54A 1R0AA 4DLGA 1JL1A 4K50A 2CKWA 4DSJA 3NCIA 3NF8A 1TKZB 1HJRA 3KKRA 4FBUA 2XY7A 2FBXA 3L2UA 4ZP9A 1RT3A 3K5NA 1SUQB 4KHRA 2W7OA 5CZ2A 4TY8B 4QWDA 1WSEA 1L3VA 1BQNA 4CHZA 3MEGB 2BDPA 4CJQA 3CVKA 4CEDA 3DI6B 2AU0A 3RWUA 4FJLA 4ED3A 3NAEA 2OPRA 4ZPDA 2JGUA 1X9MA 3IRXB 2BQUA 2R7YA 3JYTA 4Q8FA 4Z4GA 2BGGA 4BE2A 3MXJA 4YR0A 4Z4FA 2G8FA 3DOLA 3TAPA 4DL7A 4IG0B 3TANA 3LWMA 5HLFA 3DYAA 4EZ9A 4J9OA 1JL2A 3WNFA 4FJKA 3EZUA 4DL4A 1KVAA 5HRSA 1QS4A 4OKKA 4F3TA 4DTJA 3TARA 5J2QA 1XR5A 3PW4A 1T05B 3MFIA 1IKYA 1XHZA 1W0HA 4XPEA 4O3OA 3Q8QB 3NAHA 1SL0A 3H08A 4M3XA 1C0TB 2QK9A 5F9NA 1NK4A 2D7SA 4BWJA 1HQEA 2OPPA 4TYBA 1TK8A 2HMIB 4OLAA 3N6LA 2IJFA 1C1CA 3LAMA 4XPCA 3VQ8A 2RF2B 3H98A 2UVVA 4CE9A 3OYJA 3QIPA 1FKPB 2RDJA 2ITGA 2WRMA 2HHWA 3KLFB 4OLBA 3DMJA 4RW7A 2AGPA 3PJXA 5F8HA 3BQ1A 3PUFA 4CEAA 3C6UA 3KHHA 4DL5A 3HHKA 2GIQA 3B6PA 1WSHA 2IBKA 1RNHA 2HNZB 3AA2A 1S49A 2HVIA 2QV6A 1EETA 4E1MA 1RT1B 3AVBA 4DFPA 4Y3CA 2R8IA 4GVMA 4FCYA 3M9MB 2EHGA 1KTQA 2GIRA 4FK0A 2XY5A 5DG9A 4BWMA 1RA7A 1IH7A 3HPGA 3BSAA 1S5JA 5DG7A 2C2RA 4JUZA 2G8KA 1J9AA 4MFBB 4F4KA 3H40A 4ZHRA 4I7FA 4J9PA 2YNFB 3ICLA 4U7CA 4KTZA 1HYSB 2FLPA 4OVLA 1QHTA 1S9FA 3KJVB 1JLBB 3NDKA 3GV7B 4Q0BA 4RW4A 2VG5A 3DRPA 1F21A 2YV0X 2HWIA
chains in the Genus database with same CATH superfamily
3IA0A 3D6FB 2A6AA 4G1IA 2J8SA 2MMYA 2LA4A 1X1PA 1FFWB 1ZBSA 3P5JA 5KFHA 3VALA 3HHNB 4DV5J 4V1Ak 4C97A 2HZVA 4ZJOA 1C1BB 3OS0A 4JAXA 3MEEA 2HWTA 5C12A 3LUYA 2P5GA 4OZ3A 4ICLA 2XRIA 3BYPA 5GAGP 4LF6J 3DLGA 3GJQB 4KV8B 3UCGA 5KFTA 5J1NA 1TKXB 1N33J 3NS6A 3BUZB 5CXTA 2C3PA 2C3MA 1VQ6S 1TL4A 3DGVA 3PSFA 2V9KA 2YCHA 1HPZB 2MHEA 3TA1A 1I94J 4NO7A 3U4LA 3SI6A 4DU4A 2EXUA 2YHXA 5B8HA 1X9SA 4FK4A 1Q8LA 2W8LA 4NA2A 2QG9B 1M1KO 2V2ZA 3CUNA 4B3RK 3H90A 3P31A 1U1OA 4NLYA 1U6FA 1GNKA 2CNNB 2QMWA 3ILIA 4X62F 4CHYA 4OYZA 4FL9A 4Y2AA 3MM7B 2LQ5A 2N4CA 3RBDA 2CQ1A 1SQEA 4ANDA 4ANEA 1X4HA 3P96A 4D3GA 1Q7LB 2D9OA 5KOWA 1UP1A 4NLTA 3TQEA 1EAYC 1NPPA 4LF9F 1TL3A 1RK8A 4A48A 2XB2D 1CZBA 5D4NA 2WAQD 1SKRA 3R3LA 5H1SV 1ASWA 2BJ3A 2UXBF 2WONB 3N79A 2JC0A 3LP1B 1N8RO 3IAYA 4DG1B 3AB2B 1S97A 2DIVA 3RBEA 2RRBA 2E9ZA 1T9TA 2XULA 2U2FA 4PYDA 2F65A 5G0RA 1UTAA 4ZP8A 1JJHA 3I4HX 5BRDA 1S99A 1U4BA 1HBNB 2WBMA 2RAQA 2XSJB 2CJYB 2RKIA 1QSLA 2GVZA 5J2MA 4OYMA 4B1VA 4NB4A 1IR0A 2PZSA 4IRCA 1HIYA 1KLNA 4FDFA 3T1HJ 2K3IA 2ZJQL 4KRFA 2J0QD 3IGVA 5LSLA 3POTB 1HNVB 2CZ9A 2XS5A 1HYZA 1WSRA 1D5AA 5GAHI 3HKZD 2X3DA 3NS7B 1VSFA 2GHWA 2GMLA 4BC2A 3A2FA 4AM7A 4HHUA 4DV7F 1Q86T 3CD6N 5F41A 1TUVA 3OYMA 2C3OA 2ROEA 2D0BA 4BRNA 1OPIA 3UFCX 2O5DA 2WVFA 1JJ2R 3QPIA 3I9V9 5C24B 4CLUA 1NGEA 5GAEU 4G9ZA 2ZNZA 3QT8A 2CH5A 4EO8A 4MIBA 3VGTA 2FY8A 3IBCB 2IMWP 3WNHA 1HWLA 2HF4A 3G71N 3GP9A 3M8PA 2LDIA 1TK5A 2X78A 1HBUB 4K0KJ 4ATNA 4LFAK 5F8LA 2BM1A 4L73A 3E9OA 4DR1F 2B43A 1R0CB 2PMHA 4PG4A 3CO0P 3TEHB 2ABYA 3TAFA 5ADXA 3DLEA 3N4WA 3NVKA 3VQEA 5IM0B 3DNCA 5L39A 4RNNA 2O67A 2KH9A 4ED1A 2AZ3A 3ZT0A 2YY3A 3O5BA 3FNNA 3WZ0A 3QEWA 2N7CA 3G2XA 4KFBA 5FLXU 1GX6A 5IV3A 1Z4UA 3OHRA 4M5IA 4PG5A 1FRLA 5J1EB 4M63C 1LWCA 4DCPB 2E9RX 3EL2A 3NWGA 2J0SD 1CQNA 4YY3J 2ITMA 1JLFA 3CCSS 3I0SA 3KG0A 5KT3A 1RBUA 1CJVA 3UKUA 3NXZA 8RUCA 1BY9A 3SQ4A 4ZLNA 3DLLL 2VPXB 2XMVA 1ZM9A 4H4MA 2XYHB 4DL3A 1VRUB 3JXOA 1EQ0A 2VG7B 5AQXA 3GIIA 1S79A 1T94A 2YNIA 2M7SA 3MCSA 3HSJA 3SUNA 2MLZA 2V4JA 2LECA 3JB9k 3AVLA 4KAIA 2D3ZA 1FRIA 2CVEA 3MCAB 4CD3A 5LXYA 3CCQN 3AA3A 3KLVA 1V3ZA 1SC1B 1YBAA 2BKOA 2DISA 1RISA 1LK7A 1VC5A 1S1WB 3OT9A 3SBMA 4IJAA 5GADU 3LDSA 4HWIA 1F5CA 1NJIT 3L4IA 4XEIA 3DI6A 3LM2A 4AH9A 4E7HA 4LBIA 2QWLA 1VQMS 1TFWA 1VQPN 3QSYB 1TL5A 2BOAA 3BS9A 3OHBA 1NGGA 3HPOA 4J9VA 4X64F 4CO4A 3KK3B 3AO1A 1W26A 2H4WB 2MXYA 4Z94A 3WC0A 2P9IA 1J6ZA 1UWBA 3NF7A 4K8ZA 2LCWA 5ELZA 2F8TA 5HVHA 4JI5J 3HT0A 4U8YA 5J1PA 3ZZRA 3FBEA 1N0UA 3E66A 2D3O1 2L9DA 1SPBP 1NK8A 1VSEA 1A9NB 2X74A 3AVGA 3VTHA 2B0GA 3KLIB 2AX0A 3EE9A 4KB7A 4FOIA 1X9WA 3NNCA 5CY4A 2A10A 1W97L 4CIOA 2Y8YA 4WP8A 3BQ0A 3WXMB 1JIHA 3MCNA 1QQCA 3QMQA 3BH7B 4CF2A 1EB0A 3J7AP 3I8DA 2CQHA 1XJWB 2BRLA 4HTLA 1C0MA 1VJQA 3R9LA 3IMXA 3IC1A 3O9RA 2QLBB 2J9CA 2G9OA 4I9QA 1FX4A 3P49B 5GMDA 1YSJA 2UUWA 5CQGA 1FI4A 1ZBIA 2F8MA 3U02A 1UAWA 1ZPWX 4TSXA 1VFJA 1WC1A 1B4SA 1O51A 2Q66A 4DFJA 2E1ZA 3V2UC 3GIJA 3HZEA 2VQFK 3FBFA 5AQOA 3TUJC 3EXCX 3DHWC 1BOTO 1LWEA 5KG0A 2BM0A 3BEXA 5C42A 4DU8A 3OYBA 1K6YA 3THXA 1J5OA 2ZWPA 2ZZNA 5C10A 4B3RF 2CFXA 4WBFA 3MEDB 4FS1A 3TJAA 3W62A 3N5FA 1YJWS 3SSSA 1BI4A 1B3TA 4DSLA 1P9YA 3PIOL 4JI2J 2O4GA 4DL6A 2GS8A 3NCRA 4FW2A 1JX4A 4H5VA 3A4TA 3ZXWA 4HL9A 2W2PP 1P8ZA 2VQEK 3J81Y 3VQ7A 4CJTA 4CHOA 3H2UB 3EUNA 4CEEA 3OUYA 4Q8EA 1JNRB 2P1JA 2ACYA 4OPKA 4LSNA 4K4YA 3A3NB 3M2VB 2ZITA 3BY5A 1Q95G 3S9HA 4RW7B 2MQNA 3D6RA 4KJIA 4K25A 1NBWA 3V4IB 3T41A 2FHKA 5AXNA 1D09B 1FXDA 4ED7A 3HSTB 3AO3A 3KOAA 3M6XA 5CYMA 2CUYA 2BMBA 1ZZFA 1ASUA 2OMOA 3M30A 3BBBA 2HHHJ 1JLGA 1JCFA 2HBQB 3LANA 4CH7A 4USWA 3OS2A 2HVDA 4HUEA 3EMTA 1NB2A 4OO1J 1VQ9S 1C0UA 3BBCA 5MLCQ 1VYAA 2LQBA 1TVRA 2CZ4A 3GG1A 3K8VA 3CT9A 5GAGU 2FLLA 3LZIA 5KFYA 1Q86O 4K4ZA 4WYLA 4FNHA 3VGUA 3IKMA 3QEVA 4OI3A 3DCAA 3Q2TC 3AT1B 2FJXA 5IQ6A 4QU6A 3RVCA 5ADXH 4YOXA 1T02A 1NM1A 2E2PA 4HACA 1N56A 5D4PA 2XCAA 2B4VA 5KFRA 2FLOA 1C4AA 3CIMA 1N4LA 4BRMA 4ISEA 3GQCA 3G0ZA 2JSXA 2IC3A 4J9LA 3MM5A 4IYQA 4A46A 3L9ZA 2QXFA 5KFXA 1OPZA 3PJWA 1N36J 2D1CA 2YQ1A 1JJ2M 5CZXA 4C3KA 1H2VZ 1A5WA 4LFAF 3BKTA 3IWXA 3EJMA 4DB3A 3VZHA 3ZX2A 1EX4A 3IWLA 2HQDA 4YOTA 2VKZG 4WQ5A 1S6PB 2W2NP 2AYMA 5KFKA 2KB2A 4K59A 3MAAB 4NI2B 1GOCA 5KRSA 3DLHA 1QAYA 3OR1A 2K2PA 4OI2A 4O4RA 4FWLA 4WFAL 1CXQA 4CEQA 4OHYA 4KKOB 1RT5B 2VYPA 4CIFA 5AE2A 2ZVSA 3KK2B 3OL6A 3BGFA 4LVOP 3KLEB 4URSA 2RPIA 3PW7A 5GINA 2BTFA 2KDOA 3A8IA 1WTBA 2N82B 3K5MA 3D68A 5KG6A 4O5BA 2QIFA 2ALYB 1REVA 3V6KA 4CBWA 3PNIA 2Y3YA 5FROA 3OYAA 3RMCA 1JLCA 1MROA 3KMQA 4R5PA 1YG0A 4P2SA 4X84A 3KDOA 1KHVA 2D0CA 5DRKA 3LP2B 1EIYB 1ATNA 4FVUA 3RMDA 1KTVA 3RB4A 3CD7A 1KAXA 4ILLA 2CPDA 1Q18A 4BR7A 2JEGA 2GV1A 2CH6A 4FYWB 5ETMA 3CCMS 4IOCL 2R3VA 3VETA 2BE7D 5DQGA 2DYAA 4OZNA 3EM1A 5DJBA 1HWIA 2O8FB 2JLEA 5EU7A 3WUHA 4RNOA 1TU0B 3CJ9A 4U67Q 1NGCA 2RE2A 3Q8VA 1NZAA 4MDAA 1OSDA 2W42A 5HP1A 1NJIO 4DPYA 2E4LA 4CNYA 1EKEA 4RNFA 1RT6B 3E3XA 1W7AA 3D2WA 3TZYA 4JKFA 4CLTA 1DQ8A 5KT7A 2R2RA 4Y0WA 4DL2A 1GLCG 3DU5A 3NEKA 1CLQA 5CABA 4FLXA 3EWGA 1VI7A 2G8UA 2DNLA 1HFEL 5FRNA 5I42B 1KBRA 3HX9A 3TW0A 2VH7A 4ID1A 4A8MP 3TAGA 3MUMP 3I0RB 2VD3A 6FDRA 4TVAB 3VQBA 3LWLA 4EZ6A 5KT4A 3QGPA 4BG9A 1D9FA 4FWMA 2D41A 2KFNA 4J5OA 3OTOJ 3NMRA 4DKWA 1FRMA 4KB0A 2YNHA 5KG4A 3HHLA 2YKMA 2FVRA 5CD4A 1TV6A 2KW4A 3PY8A 2N3LA 1VBKA 4IOAQ 2Z1GA 1V3RA 1NJWA 1B7FA 4YMEA 4JKGA 3UD3P 4X4TA 4MH8A 3AA5X 3DXMB 5F2RA 3DGPB 1Q1KA 3SQ2A 3D9BA 1DURA 3PRDA 2DD8S 1Y5NB 2HVHA 2R7VA 3V5RA 2WK4A 5RUBA 1NKBA 3D5MA 4CFCA 1BGXT 4OHVA 3FZLA 2HLTA 2PA8D 2EW9A 4P7TA 4L3QA 4DQ8A 1GOAA 1WKJA 1WSVA 1OY8A 2G2YA 1ZOTA 2BKPA 5BPLA 1ELOA 1TP7A 4ZVUB 2KVQE 2OO4A 4WE1B 2QGFB 4DUYJ 3LF0A 2IYGA 3CJRA 1TAUA 3IRXA 3IAM9 2PO4A 1WI8A 4C2MA 4F02A 2V5HG 1RYSA 4PXBA 2A1SA 4OYXA 3MMBA 2IVOA 1U0SA 3TR8A 4WFBQ 1NGIA 4WU3A 3ZZYA 3W5YA 4EBEA 5H9FK 2P9SB 1Q8IA 4OYOA 3OW2R 4PXDA 5BPMA 2VQFF 5AZIB 5I3UB 2XCPA 2J6UA 1QJHA 1T44A 3WIVA 1O6XA 2FJDB 2E1YA 2FJAB 1N32K 1KR4A 2QC3A 4TKTA 3NGRA 1FD2A 1H73A 1T6DA 5LMNK 3VWSA 5FJ4A 1OWXA 3FSIA 3WXKA 1C0TA 1M0SA 1TKTA 2ACMA 2JHEA 2CADA 1RAHB 2VGNA 4BE1A 2WVDA 3BF3A 2JOQA 5AQUA 3UDCA 3C6TB 4CF8A 2ZD1B 1VQKS 3OXFA 2VQEF 4KHQA 4FJMA 2RU3A 2KO1A 3KG4A 3OVAA 1LOTB 2B9YA 4URQU 5C5JA 2DGTA 3ZC4A 2Y1RI 2RQMA 2M9KA 4OPAA 3PW5A 3NF6A 1NOZA 2HS4A 3TJ8A 4QPXA 3ENVA 3GYGA 1YITN 5EXWA 5JICA 1X9JA 1JJ4A 2I5JB 4PWDA 4KH0B 4F3QA 4X4VA 5L1KA 2D4WA 2QM1A 1FNXH 3AV9A 1UAXA 3C15A 2PAVA 1B7YB 1HNWJ 1I3AA 4NLOA 1Q4RA 3DRXA 2G2ZA 1RDWX 4J9SA 2A1RA 1YJTA 4USTA 4F0HA 4A2BA 4OQJA 2XM3A 1RDBA 3AO5A 4PKGA 2J76E 4Q2MA 4NLSA 4Y0FA 5E3PA 3E8OA 3D6TB 4BC9A 1HX1A 3ZCMA 2OPRB 3IM8A 4G1QA 4NZ7A 3LDPA 4ZOSA 4ED0A 3JYTB 3U9ZA 2Q1LA 5ETSA 1HWKA 3OYIA 1YJNS 2GZOA 4UUWA 4NE9C 3M6GA 2FJWA 2AKWB 1YTYA 3DYAB 2ZH7A 4LF2A 3UDVA 1V5VA 2EX3A 2OD6A 4U95A 3C65A 4DV1K 2VB6A 3OVNA 2G8IA 1U48A 5D6GA 3CDAA 1IKYB 3VEYA 2Q3SA 4CLYA 4JI8J 4BR5A 5H9EK 1CULB 2E5HA 4KH6A 4WF9L 4ID5A 4ZVTB 2BJ8A 2FVPA 2LMIA 1S1TB 5KT5A 1A0OB 1C1CB 3P4UB 4RU2A 4NX9A 5FPNA 3QIPB 4ZDNA 4F0KA 1UETA 3CMAS 3M8SA 2MEWA 4CZLA 3KK1B 2QKKA 3ZSQA 2UU9J 3M32B 1GMVA 2XSFA 3MUTP 4MO5A 3QAEA 3VF4A 3MWBA 4HCCA 4BR2A 2P9KB 1TL1A 4M3RA 1RCXB 5BYSA 4BDYA 3CGIA 2W2OP 4Y1CA 4RPFA 2BOPA 3CJCA 2JWLA 3BM7A 4M94A 3DXBA 3P5BP 5D78A 4IUFA 2A3ZA 2EKYA 1S1XB 5F8GA 3GOIA 2Q97A 2WONA 2NYHA 4MK8A 1VCTA 3VPZA 4JI0J 4WZMA 4C0HA 4DG1A 5KOXA 2HSTA 4CJUA 3SQ0A 4AXJA 3PIPL 4I7FB 1HNZJ 2X3GA 4A62A 3OYNA 2FLNA 1LCUA 3PO4A 2GBZA 3K5LA 4CWBA 3CC2N 2WB1D 2AD9A 1P90A 3J7YI 3DRPB 3MAHA 2XZTB 1HBNA 2XSJA 3L2WA 3I5BA 3MPUB 5K8MA 3AXKA 2QYGA 3MR6A 3JSMB 1Q8KA 3EKUA 4B9UA 3SCIE 4USKA 3MM6B 4ZP6A 1FJGJ 1M5OC 3CF5L 1IJEB 1HNVA 3EZOA 5IWAK 4WIQA 4L3NA 3IBFB 2KRRA 3ILJA 1H38A 4CDIA 4LSLB 1T03B 2J0XA 3LA0A 2PIIA 3A0IX 2RDDA 4L3KA 4ZVEA 3VCDA 3HFVA 4X4QA 4FXVA 5KG3A 3BYRA 3TSQA 4OZJA 5CD4H 4B3SJ 1VRTB 4NRTA 4F2RA 3RRKA 2WOMA 2HPUA 4USMA 3WXIA 5KQDA 1Z25A 5IC4B 4IDKB 3EYZA 2MB0B 3KTQA 1H98A 3ZT4A 3TX0A 3OA9A 3DM2B 2NPIA 2HFVA 4NLWA 1RCOB 1LW2B 3UE2A 2ZOMA 1FRHA 3W63A 4QS9A 1FT8A 4RWXA 1FO1A 4O4GA 1HBUA 1WLJA 1TR0A 1SC4B 3CJKB 2KFZA 2ROGA 2NUBA 2YVSA 4JI7K 1J27A 2HFZA 5BREA 1WN7A 2HF3A 3B82A 3GG4A 4LREA 5J2PB 4F67A 3Q24A 5HRRA 3M8WA 5IM0A 1R6YA 1BXNA 4OZ0A 5BN8A 4I64A 4DV3J 5L9XA 3LAKA 4N41A 5EWFA 1SH2A 2DT9A 4NXNJ 3KIOA 4FLTA 3K8WA 1N54B 1F6TA 3TUPA 1XI1A 7AT1B 3O3GA 5LSOA 3E9LA 4W5QA 3PYEA 3BO4A 5HATA 3V9WA 3PR5B 4CTAA 3CPWM 1NSAA 1OYEA 3OBIA 2CJBA 1EXQA 2OP5A 2P9LB 1AA1B 4RUAA 3BPSP 4K2JA 2DPNA 2YHYA 2E8AA 4MIAA 4CIEA 4GNIA 2W9BA 1T3OA 2NQPA 4C0BA 3J80U 2VPWB 2Z58B 5E3RA 1NHKL 1IBMJ 3A3PB 3QO9B 2RIJA 2BE2B 3PFEA 2HBMA 4W4MA 4ZPVR 1YX2A 4LR9A 1ZS6A 2AZ1A 5A2QY 2BR0A 1NM2A 1Q5VA 1VRUA 4E2FB 2VG7A 5AQTA 3G96A 2QSWA 3VQ4A 3DLJA 1TUWA 1YGYA 2V6AA 2DJWA 3IR5B 3T5KA 1N5VA 4ECTA 3I5CA 3VEXA 3UN3A 4JI6K 3EGNA 4E98A 4JI4J 4E7IA 1KAYA 3L2RA 2DNRA 2QFJA 3ZT3A 1HBOA 3GDQA 2UUBK 1YJ9N 4KHPK 4O23A 2ZZTA 1WHXA 1Z6RA 1N32F 1UJ5A 3MFHA 4IR1A 4LF8J 3LL3A 3D4JA 4B9LA 5LMNF 2AYGA 2OPQB 3NMAA 4DN9A 4JLHA 4OYPA 3HPHA 3OW2M 3FEYB 2RT3A 3RBXA 3PSIA 4I6YA 4KHSA 3A5OC 1MNEA 3IBWA 3O1LA 4ZCIA 3FZBA 2IAJB 5BRFA 3MF5A 2F96A 4DR7J 5MLCV 1XMOJ 3V1OA 3CJ4A 2WBRA 2IYIA 5EVZA 3FQKA 3SAGA 1BL3A 2UVUA 1JLEA 3LP0B 4LRAA 3U7JA 3DHXA 3M9OB 2V2VA 3CC4N 3N9UC 3BN4A 4UOFA 3GV5B 4BLGA 3KLIA 4FJIA 2M0GB 3NGKA 4WK1A 3OJUA 3A5LC 4ED5A 2F40A 5DM6L 2IOCA 4LRCA 1C0FA 3PRVA 1SQFA 4GKKK 2Z30B 4BC4A 3CI5A 2W40A 2FJEB 1VQ7N 3CCRS 4CH1A 4ZN3A 5AQRA 3UCZP 4PUOA 4U8VA 2OZMA 2BV3A 2EVZA 1HNIB 4AILC 3EICA 3R5DA 1LQ9A 3IGNA 4EAHD 4CYUB 2VIHA 3RSEA 1J54A 1UVIA 3D7EO 2WZ1A 4X62J 3NF8A 2Q3PA 2F5GA 4Y2KA 3TA2A 2XY7A 2GCFA 3RJMB 4ZP9A 3PYFA 2W7OA 1G7CB 2CIMA 1CPZA 1L3VA 3O80A 3O8MA 2MZQA 4CHZA 4DV1F 5EGYA 3I56N 3LTOA 3G82B 5ADZA 2M2BA 4CEDA 1U26A 1M5HA 1URRA 5HL7L 2UXBJ 1G3OA 5CHIA 4FJLA 4ED3A 2VV5A 2OIHA 3NAEA 3FCVA 3MURP 1Q5YA 1TL7B 3EDRB 5B0DA 1W7WA 3DJCA 2WC9A 4BE2A 3OFEA 4YR0A 2BGGA 2ZNYA 3ZO7A 3DOLA 4TNOA 2EK6A 3VEZA 4EZ9A 3O1BA 4WP9A 1K44A 2YQ0A 3C66A 3MGJA 4DL4A 1KVAA 3ZTOA 4F3TA 4FPBA 1XR5A 4PPZA 3B8AX 2CQBA 4Z7CA 1W0HA 2DNQA 1BQXA 4DOZA 3NAHA 4C98A 1PSDA 2XMMA 1BUPA 3BPDA 2J7UA 3EVWA 1TK8A 2HMIB 1V6HA 3IFEA 4NASA 3N6LA 5JVGQ 2RJZA 2IVMA 3BGLA 1F3FA 3KLFB 4OLBA 4DV7J 4RW7A 4A8FA 3CCES 4DL5A 4HR2A 2MGZB 3JQJA 3HHKA 3DRYA 1WSHA 2HFUA 3R7SB 2IFXA 3K7RA 1NDPA 1S49A 3ZYYX 5LY3A 2CPZA 1RT1B 3AVBA 4RO0A 4UY85 2MQQA 1TMMA 3VR1A 3MMAA 4O5FA 4IO8A 2EHGA 4UUXA 1FF2A 2I0XA 5DG9A 1WOQA 3SXLA 3HRGA 3QWUA 5IWAF 1SJQA 4IO9Q 5DG7A 4JUZA 3WIUA 4LFBJ 2DNOA 4DR1J 4RKUC 4MAKA 4V19J 3ICLA 3HHLD 1SCJB 1QQMA 5LJWA 4W98A 1HW8A 5KPTA 2FLPA 3VF6A 3SMSA 1M1HA 5M1NA 1B70B 4LFCK 2E1MC 1F21A 2KM8C 3SMPA 3R1XA 1SC6A 1NK5A 1WF2A 4FLYA 1WHYA 4DS5A 3MCMA 5CZ1A 2IVNA 1WBBA 3U3GA 4NYZA 1S1UB 4BRGA 2OH2A 1FK9B 1MN7A 4RUHA 2IM1A 3QFWA 2I9SA 4U7BA 2E1AA 2ZWHA 5E3CA 3K57A 1YUWA 4R8UB 4Z7YA 2VICA 3LGNA 3LDNA 4JI7F 4NPOA 4OI6A 3CC7N 2K7JA 1YI2N 4DWIA 3EXYA 3QRQA 3J7Z5 4DTUA 5KFBA 2QO3A 2HOEA 1JQGA 3NOCA 4MDBA 4A8XA 3NAIA 4FLUA 3D0IE 1BIUA 1RBLA 3SUQA 3ZX0A 3HBTA 4KKOA 2NRVA 1RT5A 1HJOA 1H0HB 3CXCR 2MSTA 4YB1P 3KWMA 3KK2A 2DXEA 4LMZA 2LXIA 4OGEA 5HOOA 1B0TA 1H2TZ 3KLEA 3VF0B 4M8LA 2W7PA 4C48A 5E5NA 3KHLA 1HNXK 5F8IA 4KGXB 1NK7A 3W8GA 2HS3A 1QVFR 1HUXA 3ISNC 2RHKA 1SZ2A 2E5LK 4FW1A 3RB3A 3PDNA 2QLWA 4C8MA 2AW0A 2X51A 4IEIA 3GJTB 3LP2A 1QE1A 1MU2B 1YZ7A 4ED2A 1ROFA 3IAS9 4X64J 4KHMA 4EFHA 4QPTA 3C8YA 3OYLA 3SLCA 2HNYB 4J9UE 4BRPA 1UCNA 3FR0A 1LW0A 4LR7A 1XNRK 4JI6F 4W92B 5AR0A 2H54B 2XMTA 5F8NA 4EP4A 1OYDA 2UUBF 4X2BA 4KHPF 4JKBA 3M3ZA 2MKCA 1RT6A 1WEZA 2PMWA 5K8OA 3LPTA 2KZMA 4DPTA 4KH1B 3BGRB 2FC8A 5AQMA 2O8CB 1FXLA 4UQGA 4RUCA 5ETRA 3BJYA 2GQQA 4QZVB 4GKJK 5KG2A 3OYEA 4WWSA 4PL7A 3IG1B 2MKYA 3K0SA 4KAZA 3NLCA 2AGQA 4OJRA 4ILMA 2JVRA 5DGAA 3Q7BA 2B5JB 2B9XA 3VA0A 1VQLS 3IP0A 1KOOA 4C3MA 1VSJA 1QY7A 3EVOA 4YDDB 3OJSA 3FBBA 3CCZA 2UXDK 2I7NA 2A3JA 4IR9A 4WCEL 3PW2A 2VZ9A 1FESA 1RTJB 4KI4A 1T3VA 2JWNA 3LZJA 1KEKA 3NFAA 3R9PA 3T6JA 3W5ZA 3HD1A 4QIVA 4JI1K 4BVOA 4NCAA 1X5TA 1NMEB 5LJVA 2A42A 3NBPB 5KG5A 1TKDA 5LJ5Y 4GKKF 3DOMB 3KZBA 2FC9A 4USUA 2P5VA 1VRQC 3B8HA 5C2DA 5E7OB 2YHAA 2OFGX 2PGCA 3MZIA 1RAEB 2RILA 4FF1A 1K1QA 4MYUA 3KKSA 3WHIA 1UOCA 1TELA 4ZLJA 5I3QA 1SV5B 3MXHP 3VQQA 2PBDA 3OL7A 2N7YA 3V81B 3K2YA 4N47A 2W4DA 2KJWA 4J2AA 2J9EA 1PGZA 5M2PA 5LMUK 4FO0A 3SQGB 4B3RJ 3M2UA 3G6XA 1JXBA 1RHKB 3CCJS 3R8YA 3AY9A 3O1WA 3PHEA 2D69A 1T9VA 4J9NA 4I68A 3V4MA 5KFFA 2MQPA 2B4UA 2W1BA 2OA8A 4KHYA 4WQ4A 3CM5A 1QVGR 1GLFO 3H3NO 3T6BA 4WE1A 4IOXA 4O8KA 2D1KA 3FFIB 4P73A 1RHUB 6AT1B 5AQPA 4E3SA 3ZSWA 1XMQK 1X7VA 4BRQA 2ASJA 4JN4A 2DNZA 5C2FA 3TO8A 5AZIA 5B0GA 4ZVSB 2CGJA 5KFEA 4OZ5A 4TU7A 1D0EA 3QJPA 4OYBA 3K0JA 4FJ9A 1E4FT 2DO0A 2E88A 4H4KC 5AZJB 1B99A 2IRYA 4YORA 4GO5X 1EARA 3SDEB 4XTTA 1SUQA 4KBIA 4PABA 1VK0A 1TYQA 4E19A 1VQ4S 1P9QC 4UY8T 2B8PA 2DGSA 1YVUA 1RBSA 4KB1A 5B0EA 1YRXA 3OLBA 1WWHA 1SKUB 3AVMA 1RJJA 2FIUA 3FZ2A 1BQMB 3CCSN 1WNEA 1K0TA 3G6VA 1OH8A 2HBJA 4RNHA 3VGVA 2W9CB 1MSWD 1PYTA 2GHPA 3H5YA 2MDAA 3AXMA 4DV0K 4IOBA 4RBUA 4WTOB 4ILGB 4GVLA 4NLGA 3IR6B 4IQMA 5ETLA 4J9QA 4RJVA 2DNHA 1S0NA 1ESVA 2JH3A 4P2FA 1WHWA 4ZPBA 2GTDA 2CPIA 4DR5K 1EJ7L 4P7VA 2ROPA 4Z4IA 4DN0A 4KY3A 4FWOA 1CVJA 1C2PA 3TP2A 4B8CA 1T05A 3KHYA 2V94A 4U96A 5K9FA 4NA3A 3ZTRA 2VKRA 3VESA 3GFYA 5E26A 2LEAA 3UE5A 3VQ9A 3V9SA 1AZSB 4JD2A 2IM2A 3OYDA 3G6ES 1P27B 1IR2A 1YHQS 1G1XA 3THWA 2GC8A 3PG9A 2KU7A 2VC1A 2L9NA 3HCXA 4LFAJ 2P9PB 1ZXOA 1VQNS 2ASOA 3BO3A 4DF4A 4AUKA 4JKCA 2M3DA 5ETVA 1F2HA 2HRTA 2QLXA 3M6WA 4LFCF 2WHOA 3TYTA 5KFUA 3CJSA 2QFIA 2HGLA 5D77A 1BIZA 2YX4A 1D9AA 3I82A 1VHXA 4WFXA 3TJ9A 5A8RB 1VBXA 4NLPA 2CQDA 1Q53A 5KFGA 4CLPA 1S7IA 3GB0A 5A2QO 1CULA 3I8BA 3A3OB 2QKBA 2VBXA 2ZHBA 3L95X 1HI1A 2ZHAA 4FS2A 3J7A1 1S1TA 4MFBA 4LF4J 2LLZA 1FEHA 5JXSA 2AJ1A 1BQNB 1EKRA 2EC0A 3TTFA 4CJVA 1I3OB 1KSPA 3KJVA 3CCTA 4EBDA 4IDHA 5JVHL 2UV8G 3KK1A 4TU8A 2BJEA 4CJKA 1YJVA 2Y1IA 2VF3A 1RHRB 3S7RA 4AM6A 3AJ1A 1F5BA 5FDLB 2VWJA 1VLYA 3MN5A 1S9EA 2HHXA 1U49A 4Q7AA 1IBCB 5A8KB 2GAGC 3N28A 2BUNA 1S1XA 4QW8A 4F4YA 4DDFA 1HNXF 3MHYA 3LP3A 3EPIA 2OLWA 3KFWX 1MA9B 3VERA 5CCLA 2DPIA 2W2MP 2ZH9A 1N48A 2E5LF 3W9HA 1S59A 1UZHA 3V6JA 2CXEA 1VMBA 5F8MA 1JCGA 4FPRA 1SVDA 1MG7A 1Q79A 3NH0A 1H3DA 4N56A 3JSMA 2DRBA 3N4QA 4H0VB 3MM9B 4WTYA 3LPEA 4QR0A 2IA0A 2FBVA 1U2RA 3C6UB 3I6PA 3QGIA 2GGPB 1XNRF 3DOKA 5CH7B 2H9ZA 1J5EK 4R25A 1KVCA 1FRJA 2CA9A 3O4QA 2J9DE 3V6HA 2CG8A 2AJ4A 3QFPA 3F73A 1RT7B 1QUVA 2DIUA 1S4EA 1NKCA 2PC6A 2I7PA 1Z26A 4GMKA 9RUBA 4ECWA 3GJSB 4CJ7A 1UWAA 3MN9A 2MY7A 4GKJF 4IDKA 3H5SA 4DLEA 1PC4A 2ZH8A 3HP9A 4RG8A 1LW2A 1CG2A 5K14B 3M4XA 1VIXA 4URGA 4BRHA 3QJJA 4M5DB 1YAGA 2VG5B 2HK3A 3CJKA 3AGRA 1VLOA 2ZKTA 3EN9A 3L4QA 5HI7A 5HVFA 1E6VB 1MW7A 2UXDF 1RHQB 2L3MA 1D4XA 3ATVA 4OZ2A 3TX8A 4GO7X 2ETJA 5J2PA 4MO4A 1OY9A 1RDCA 4NLDA 3TEGA 4ETZA 1VQ9N 2HIYA 1WHVA 4JI1F 1REGX 1ZA2B 1OMSA 1RZMA 2B9EA 3FMWA 1NJYA 4PKDB 2HNDB 4FLVA 3AD7C 3C95A 4JHDB 4PR6A 5DQHA 5K20B 2D5RA 1SC3B 2LYVA 3NGZA 3CD6S 3SEOA 4YDXA 3ZZUA 2RHQB 3DDNA 3LM9A 5AJ3K 5IT9U 3AD8C 4DSFA 1IR1A 5J2NB 3VN5A 1JKHA 2B8QA 2HHQA 2VQFJ 4OGCA 5KI6A 3H7HB 3FGUA 4OZ1A 4H5NA 4FJJA 1UJ6A 1UFKA 5LMUF 3G71S 1SBRA 2KHOA 2BE2A 3DRRA 2AT1B 1TMJA 2YH1A 3FCHA 4UZBA 2AJFE 4HLBA 5D8HB 2ZF5O 2C2ZB 3H6EA 5M1PA 4BCAA 5CR4A 3V1QA 1IG9A 4RWWA 2RH3A 2V2KA 4AXIA 4ED4A 2I38A 3T19A 3H20A 2VQEJ 1N6QB 3M8QB 4LH5A 4DSIA 1T11A 3GJRB 3G87A 2XS7A 3ZSYA 3BZKA 1XMQF 1J2VA 4ILJA 4JRPA 5GAEP 2XHWA 2QA4G 2GJIA 5KTQA 2DNKA 4ZP7A 1BCMA 1QVGM 4Y2MA 1NSQA 3VEOA 3MWTA 1ITGA 2I1RA 2OPQA 5KQ8A 4K8XA 4QWCA 1WC4A 3ADAC 2BANB 2MYFA 3HVTA 4UY8O 3ZX3A 2EFGA 2M52A 3V6DB 4MYTA 3GR0A 1I5OB 1CBKA 2X6NA 1EHWA 4JV5K 1GLJO 1JLAA 4GW6A 4OL8A 2UUCK 3BBFA 2Z1HA 3KYLA 2QWRA 4E7KA 4DV6K 2XY8A 3CB4A 4PG7A 5AT1B 3IRWP 1CSJA 3HZGA 2X6SA 1IV0A 3MD3A 1KXPA 4DV0F 4GV3A 4FYXB 3M6UA 3ZETB 3U3YA 1IKXB 2KN4A 3ZSRA 4NLCA 1NJZA 4DR5F 4EBCA 5DM7Q 2O8DB 3AA8A 2X1BA 4DU3A 1RWOB 2P8IA 4EWTA 2IVFB 2JEIA 4KTQA 3U6FA 1NU4A 1ILYA 4MLHA 2QWNA 2B4PA 1WORA 2B6AA 4IG3A 3EEQA 4RW9B 2LDYA 4DPWA 3ULDA 1Q8BA 5C2CA 1DFDA 1X3NA 4GVEA 1ZTWA 1VQPS 2F7TA 4P10A 3U1NA 3TZXA 3UIQA 3J7ZO 2C22A 1HNIA 2KT5A 3PW0A 4ZPTR 3NF9A 4K8RA 1FKOB 4FF2A 3OTBA 4CYUA 4NEZA 1XN9A 3HSZA 5BYRA 1JXLA 1S9GA 5F0WA 1RWXB 4OMFG 4QW9A 4AL5A 3UN2A 3VAGA 4NRUA 3VQDA 2G1DA 3ETOA 3RTVA 3O3FA 2IBOA 2OAUA 5AQLA 1TQLA 3OD2A 4LRFA 3MDFA 5L8RC 5T14A 2W8KA 1ICEB 5F8JA 2KJVA 3UWTA 3THYB 4BRAA 2ZH5A 1XUPO 4LD0A 1RBOB 2J6SA 4WP3A 1RE1B 2ERRA 2MKSA 3SZ2A 5GADP 2VODA 3Q7CA 2H65B 4AHUA 3G82A 3CYMA 5HANA 2FC0A 2XC9A 3R7BB 1F3VA 3DWLA 3RRHA 5F3ZA 3M7VA 1IKVB 1NGJA 1F1BB 2D0OA 1TL7A 1X0FA 4G3IA 4Q44A 5KFOA 4NZ6A 3C7NA 3M2RB 3KUGA 4J9RA 3P4IA 1VOMA 1GFWB 3FC9A 4H5RA 3R7NB 4PY5A 5JS1A 4TLQA 4WJBA 1W2IA 2QMXA 1U1MA 3NH2A 1RAIB 1K47A 4RW8A 1SB6A 2B4OA 3US5A 3H5UA 3HK2A 1CJUA 2HMIA 1RDAA 2B3TB 3MOJB 5FPMA 1RT4B 2LU1A 4ELVA 1O5JA 3OFFA 3NNAA 2MGZA 4FYVB 1RTHB 1WKKA 1NNEA 4M5HA 3R6MA 5HQ8A 3CJ1A 3EDQB 4A8SA 4RBVA 3D45A 4CZMA 3DRSB 3U9DA 3D0GE 1RT1A 1GTHA 2A41A 3S3OA 2Q0RA 3CMEN 1GAOA 3AOAA 4OPHA 2D0AA 2QYCA 2HBYB 3HM9A 2ZBRA 3L7OA 3G86A 4ZVPB 4YOUA 1VQSA 1XBWA 3DXKA 2V8DA 4YB5A 2VDHA 1J5EF 1NH7A 4DR3K 2FXUA 1WDTA 1P1LA 1M1GA 4FZXC 5KFWA 4ECUA 3MPYA 1RCHA 3H2VE 2MLXA 5HROB 1NBEB 1VQKN 3Q8SB 2AJ0A 1JMTA 3GSDA 2DTUA 4CLFA 2FHJA 2ZE2B 3W2VB 4YNQA 2CQCA 1LAWA 4XDDA 4MQ3A 2AJ2A 5CA5A 1RDRA 1S57A 1S1UA 5BR9A 1UVMA 3MTJA 4IRDA 5E3QA 3S3NA 3FCWA 2CPXA 2E66A 3PKMA 3D0PA 1K0VA 4DFMA 5JMNA 3D67A 4O44A 2CJ9A 3CCWA 1H2UX 2GJFA 1Q7YO 3CCVS 1X4BA 2KL8A 4K4SA 5HLFB 2BW7A 4R8UA 1OY6A 2P9NB 1MWQA 4R0EA 2DGVA 4C8ZA 4O55A 4CJ4A 3C94A 2MJNA 4BRLA 5L9NA 5AQVA 2AV5A 3A5NC 1NK0A 2R2UA 2YKOA 1XQSC 2MKJA 2OPPB 4OX8A 3N5BA 2MQ8A 3L0QA 3TVKA 3FEZA 4RUBA 2OHDA 3CM6A 2HW3A 4YQWA 5A8WB 1ULRA 1R27B 5AJ3F 1DKGD 3V1RA 3CDEA 5H9FJ 3G4SN 1R8AA 5CAAA 3L09A 4J37A 1EZZB 1NUEA 3BKUA 1KNZA 3AQPA 5AQKA 1NGAA 3AB4B 1RADB 2VFTA 1ZM2A 1KHWA 4M5MA 4KHWA 2IJRA 4AL6A 1MU2A 2JL9A 4HI1A 4XH4A 1R3NA 2KQ2A 2IM0A 4Z4HA 2PN6A 3W60A 3ZSOA 2HNYA 4CEFA 2F4FA 5AQIA 5E2QA 4ZHRB 3I32A 4QOZB 2P51A 3CNQP 1PJ6A 2DR8A 1PC5A 3CMAN 3BN7A 1UW9A 3MMCB 3R1LA 2ZWOA 5K5MA 4RW4B 4OV1A 2KT2A 4EGLA 1Q9YA 3HI9A 3OTOK 3K89A 4KT0C 3BGRA 4CF0A 1WC3A 2BUPA 5EDWA 2O8CA 1N5TA 4XAKA 4C23A 2P6TA 3WEEA 5G4DA 2WSCC 3NHGA 3BV8A 1GXLA 5GMEA 4LRDA 2WVEA 3CJAA 4CJSA 3JAMU 2QA1A 5DQIA 3D3BJ 4BE0A 2YWFA 4JV5F 2FF6A 2YWEA 2UUCF 3FEXB 5HRPA 4DV6F 4LQ3A 2OZSA 2BXJA 1VC6A 1BLUA 3TTCA 2E2QA 4ALZA 3D7SB 1H6KX 1SJ1A 1IUJA 4PAAA 1R8CA 4LIRA 4OV6A 2VWBA 2XGQA 2LEPA 3BEGB 1CC7A 3C3LA 1RTJA 1U1LA 1ZM4A 3VQSA 1SJ3P 4CHNA 4YB7A 2RD5C 4DQRA 4B9VA 3DLRA 3C14A 4KREA 1OQ3A 4JK7A 4Q45A 4YHHK 4KR0B 3R5GA 2HVZA 1OQ6A 2Q0UA 1RAJA 3OVBA 4M3TA 4DUYK 1X0PA 4LF7K 1B9DA 3SQOP 1NPRA 5E0OA 2ADBA 3FGVA 4ISGA 2PEBA 1LK5A 4CLKA 5H9EJ 2ZOFA 3W66A 2G8VA 3OY9A 1IBLK 3DDKA 2YX6A 2DGUA 1SV5A 3D66A 2ZC3A 3V81A 4ZITA 3VQTA 3SFUA 2AYEA 3AVKA 4X4NA 3SQGA 2DFEA 3GE9A 2QL7B 3QNOA 4RNMA 1NHUA 3QETA 4OFZA 2KG1A 1RILA 1ZPVA 1GLBG 4KIAA 3LOUA 2FUG9 5G0RB 1S1VB 4XIUA 5KG7A 3CQXA 3SPYA 5KFJA 3FFIA 2HFNA 4M95A 1HD0A 2RKIB 2GVZB 5J2MB 2DPJA 2BRKA 2HHTA 1WI6A 2MHNA 1YWXA 2C2KB 3B4DA 3T5JA 1FKAF 2Q6BA 2NZTA 4X65K 1Y9OA 4OIXA 3D6HB 4C11A 3CFOA 4N77A 4NCGB 1QDUB 4DFKA 1RXOB 2HAIA 2KRBA 2IGIA 2UUTA 1S10A 5M2RA 4ZVHA 2YNGA 1PIEA 3L7PA 4AHRA 5AZJA 4V19X 2CPEA 2G13A 4DJBA 3OFGA 4I67A 2R2TA 3CCUN 2YWWA 2XYPB 3Q8UA 4I2PB 4CECA 4F4ZA 3UVJA 2E7WA 2RB7A 3H1QA 4PKIA 2K3KA 3EPGA 4A8KA 5HMYA 1IKWB 1Z05A 1YKWA 3QLHA 1S48A 2W9CA 1QAIA 1D8ZA 1S12A 2NXUA 1DHMA 2G0IA 2ADCA 4CZHA 4DQQA 3QAUA 3DC2A 4FLWA 2C28A 3DLEB 4KGVB 4FVCA 3ILOA 2HAFA 3R2CJ 3KNGA 2HQ3A 4OLOA 3NNHA 3M8YA 3EX7B 4QR2A 2W41A 1RKIA 2CQ0A 4LUBA 2F4VK 5DK5A 4ZJLA 1C1AA 2MKHA 4A61A 4TXSA 2KKZA 4KFBB 2N4DA 3KLGB 2EI5A 4AQYK 1HKBA 1FEEA 3W5XA 4QAGA 1LWCB 1N5QA 4U67L 4DR3F 1IWGA 4PG8A 4A8OA 2PI5A 3F9MA 4JI7J 2O01C 4ELUA 1IM4A 4WPAA 1RTZA 4E0DA 3D1OA 1I6JA 1S77D 2HWHA 5AQJA 3I0SB 4RBTA 1Y10A 3UKUB 2QMUB 2H3EB 2MZTA 4Y6IA 5EX3A 5GAGI 2FVSA 1KFDA 5KGWA 2FSKA 2HQFA 1AW0A 1HQUA 3NVMA 4PQUB 1WAFA 2YNIB 2NRRA 2VFVA 3AA4A 1GXTA 1WF0A 3W7BA 2CG4A 3ET6A 2FHOB 4DSJA 3NCIA 2ZJRQ 3F5TA 3KKRA 3P38A 4FBUA 2H5EA 1RT3A 3K5NA 4P72A 2AA4A 5CZ2A 2UYTA 4A8QA 3OR2A 1BQNA 1TZ0A 2QEXN 3MEGB 1X5SA 1OH5A 1HNZK 1C0GA 2DR6A 2QW9A 3QNWB 2A2DA 1VDHA 3CVKA 1R43A 3HSCA 1KVJA 4IOAL 3DI6B 4IWVA 3RWUA 1QLNA 3LDLA 2YKQA 1MN9A 1NLVA 2ZBIA 2E7XA 1QQNA 2DCUB 5A8KA 2CQ3A 3MXJA 4JI6J 3ULEA 1UVJA 2P9IB 2OUGA 2F9TA 3ZZZA 4J9OA 2JX2A 5D0GA 2Z0GA 3RYLA 2UUBJ 3EZUA 3Q86A 4KHPJ 5CZVA 4OKKA 1WD6A 3GWCA 1QQOA 1N34K 2BJDA 5J2QA 3MFIA 5IXUA 4O3OA 3Q8QB 3QSIA 3H08A 4M3XA 4A2AA 2QK9A 2O8EA 1NK4A 1HQEA 4TYBA 3L6QA 3B54A 4OLAA 4WKYA 2F9JA 4B3SK 2RF2B 1I51B 3H98A 2UVVA 4CE9A 1HI8A 3OYJA 1FKPB 3MM9A 2WRMA 3CJTA 4Y2IA 3PJXA 2B51A 5F8HA 3C6UA 2RHSB 2GGPA 4WFBL 5B08A 4NWBA 2AF6A 1VK3A 5IOLA 4QOTA 4JKEA 2DHGA 1CZAN 2IBKA 1T9WA 2GVDA 1RNHA 3AA2A 3IWNC 2QV6A 3K5PA 1YJ7A 3OPKA 3OTOF 2L48A 3ZTPA 2CQ4A 2XYGB 2NUHA 3I33A 4Y3CA 4GVMA 3M9MB 4C6AA 1FWLA 1KTQA 2GIRA 3PYDA 3ZEUA 3TSUA 2KYZA 2CQGA 1RA7A 5D0EA 1VBYA 3BSAA 2QRRA 3VOVA 2W4PA 2VCPA 1CJKA 2CAJA 3OTDA 1J9AA 3C46A 3SCJE 4B02A 2ZH1A 4GKKJ 1APSA 3H40A 4J9PA 3K17A 4KTZA 1HYSB 4OVLA 1QHTA 4S0MA 2JFKA 2W2QP 4M5DA 3CC2S 1WELA 3CCEN 1JLBB 3KG1A 3GV7B 2VG5A 2YV0X 2HWIA 3O3LA 1GQEA 5IFMA 4RW6A 2M5YA 3GZ7A 3L8BA 4U9RA 1OS5A 1YF5L 1U6ZA 3KXDA 3C6AA 2OYQA 2JJ4D 3AO4A 3NGYA 3THXB 3WXLA 1J5OB 1A7GE 4MTPA 4FF4A 2HQGA 3JTOA 1VQ5S 4DTPA 2VOOA 2BQ3A 3NGTA 4FYDA 4YHHF 2HNDA 1R7IA 2MQMA 3ZTSA 4JHDA 4IFYA 2XBPA 2DH9A 3MM8A 3TWHA 4OI1A 4NA1A 4DUYF 2ZDPA 3B78A 3NCPA 4LF7F 3CJBA 1VQ8N 4XK8C 3SV3A 5HJXA 1CZ9A 1VQOS 2PFDA 1AUDA 1QD1A 5J2NA 5LM7E 4NCBA 1IBLF 3FE1A 4CLWA 3DAWA 1WG5A 4N8OA 5C25A 2MZ1A 4FN5A 2UUAK 3AOCA 1RBAA 2ZC4A 4H54A 4TU9A 5HMZA 1R6VA 2R42A 1PCAA 3I5AA 4LF8K 4NEYA 5CYJA 1NHVA 4OYAA 1C6VA 3QFHA 3T1AA 2RMLA 5KG1A 1NJXA 1TUUA 1RTDA 1WEXA 2V67A 5EY4A 3J8AA 5GIOA 3M8QA 1G4CA 1YRUA 2NXNA 2LQ8A 1C0UB 4H4OA 1Y97A 8AT1B 1WEYA 1PJ5A 2GHVC 2CQ2A 2ZJPQ 4X65F 3H2LA 2MKKA 5GMKa 1N5YA 2GV9A 1PAUB 2RDIA 2OMLA 2V63A 3QWPA 1ZA1B 3CERA 2BANA 5T41A 4NZ0A 3RZAA 4IH6A 3FQLA 2OEJA 4KPYA 3V6DA 2BW2A 4CNZA 2HRYA 4HACB 2ZBPA 1IN0A 2EG1A 2YKNB 1HBMB 4UF4A 4BROA 2YHWA 2DNYA 2CJAA 3SFGA 4HHJA 3VQPA 5AXMA 3CFRA 4UOGA 2BBEA 2LFVA 1K8KA 1HKAA 4LF5K 2IC3B 1NSPA 3MM5B 1CXUA 3VQAA 1S5ZA 1UVLA 1BA1A 3M9NB 3ZETA 4C1NK 2OANA 4ZPWR 1RUSA 1Z2ZA 2WVCA 3QDKA 3ID8A 4CZIA 4ETXA 4I1TA 3SV4A 2O8DA 2JEFA 4O3SA 3CTRA 1AXQA 4LFCJ 2FHJD 3FRYA 2AIRB 3MPVA 3R97A 2I2YA 2OJ3A 4B3OB 3OR1B 3EE3A 3AFGA 2F4VF 3O6QA 2G1HA 3B6BA 3RGIA 4RR5A 3AOBA 2IDEA 1SIZA 4NYNA 3KD1E 4CP5A 5AE1A 3JSYA 3HVWA 4B1ZA 3W8PA 1LWFA 4XH1A 3TSPA 1Q16B 4AQYF 2VFSA 3NY0A 1GTEA 1XWLA 2JZ5A 2UXCJ 1REVB 3JS9A 5HRNA 3DKDA 3K59A 2HS0A 1VAZA 2VBZA 1MROB 4R5PB 1WDDA 3W3DA 2JC1A 4PPDA 2IM3A 2WW8A 2XNQA 3V9ZA 4N7TA 5HBMA 3CC4S 3E51A 2EEYA 1PO6A 1NU0A 3EY1A 4YFUA 2ZGYA 3KLHB 4CGGA 2HHUA 4CHPA 1VSMA 2P9UB 2YKAA 2ZFHA 4OI0A 3MECA 2M88A 4F36A 4WYWA 1QZ6A 1W9HA 2WVBA 4NXMK 2DHSA 4KO0B 1VQ7S 3QBCA 1RT2B 2M70A 2GWKA 4BRFA 5HP1B 3UNGC 2MZSA 3OXGA 1SH3A 3CPWR 1HNZF 2B4JA 4ID8A 4CM2A 3AARA 2LEBA 2MSSA 2V68A 5KPRA 4IFVB 3KNAA 2FJVA 1S6QB 2Z2YB 3SSQA 3TPQA 3PTWA 3IS9A 2RQKA 5DDOC 3RR7A 4BACA 5T7LA 4X4SA 3FBCA 4MKBA 4RZRA 4FJXA 1TKZA 3QRPA 1RWNB 4LVNP 3R8EA 3CCJN 2KHCA 1DARA 4F7VA 2QLFB 1U2FA 1XNQK 4M63A 3FDSA 5E84A 1UJ4A 4LFBK 1R8HA 4J2EA 3GYXB 1N34F 1WF1A 3I56S 2BABA 2QTDA 4F2SA 3TUZC 2YPZA 3ENQA 3NWRA 5THWA 2V50A 1AROP 1R8PA 3UKRB 1NO8A 1BWVA 2DNMA 2CRLA 4GKJJ 3NRBA 4JBCA 4B3SF 4R79A 4KPCA 4O3PA 1EX8A 3IMQJ 2VDIA 1IBKJ 4JKGB 4EYHB 4J90A 3NL0A 4JV2A 3MMJA 4IG0A 1SIWB 1EWQA 1U1RA 5KFNA 4AD6A 4ZLLA 4FWKA 5A0YA 2UXDJ 1T7PA 3QATA 3D54A 5GAHP 2DR9A 4CFAA 5HROA 2RQ4A 4DX8H 4JI1J 3VGKA 1E4GT 1WTFA 2ZE2A 2FD2A 2XO7A 4BS2A 3G8SA 3I55N 2ZDOA 4IZ9A 2FY1A 4MK9A 2XZWA 1OSCA 4PA1A 4IO1A 2GELA 1FWKA 3D3CJ 2C42A 4CZFA 2B9WA 2HNZA 1FTCA 3GFHA 3QYYA 3EKSA 2IY5B 2IPOB 2LXFA 1JLQB 1T95A 1IO2A 2QWMA 3UDLA 4KQZA 3EVMA 4HT5A 2BVZA 2F3JA 2Z2ZA 4OJ1A 2F8EX 3NS5A 3IUCA 1U8WA 1TKTB 4CO3A 5FPEA 4CK3A 3M8ZA 2I6WA 5HJYA 2RVJA 2AGOA 4ZVQB 2ZGZA 4B3MK 3HI0A 4KGKA 3D2EA 4DUZJ 3L3UA 5A6WA 4NMLA 2G0CA 5A8WA 5M1FA 4OX7A 4OHZA 2RUGA 4KYZA 1FHTA 1XMQJ 2VPYB 3JAMO 1FJCA 3KJQB 3Q8YA 4AL7A 2RN2A 5JS2A 4ECQA 3NH1A 5K8NA 1VC0A 3QT5A 4G65A 3THPA 4I6AA 2FYXA 4M41A 4ISFA 2UUAF 4IEEA 4B9TA 2FHMA 1V4TA 3RAQA 1B9FA 5JUMA 1U0HB 4PWDB 1X5OA 2M8DB 4LF8F 1C1BA 3EZWA 4B3TJ 4FWQA 2O4IA 2YX1A 5KFQA 3E2EA 3P6YC 2AP1A 3C15B 2L41A 4JYAK 1FDDA 4KV8A 2Z1JA 5DO2A 3CC7S 3UI3A 1YI2S 3H0PA 1WSGA 1TKXA 1IJJA 4AFFA 4DR2K 1SQGA 1M5PC 5HSPA 3NKYA 4WFNQ 1X4EA 3BDPA 3DDIA 4J2DA 1HPZA 5B0CA 2RNEA 4DV0J 4V19S 4EYIB 5BJRA 4PRFA 4FLZA 4CO0A 3VEWA 4PL8A 1QUPA 1H74A 2B56A 4FM1A 3DMJB 4DR5J 4G1QB 4ZCKA 2VA3A 2XS2A 4HUGA 1ZBFA 3J7AN 1LEOA 4LR8A 3UD5A 3AJ2A 2FBYA 2PD1A 3MM7A 4FJ7A 4CM0A 3L4BC 2BQRA 4ECSA 4BY9C 3M6VA 4HHTA 1WJ9A 1JB0C 3H4BA 4QYZJ 5C2GA 4H0XB 3CFPA 2HBZB 3PX0A 4LF5F 1V3SA 3A5MC 5JVGL 2ASPA 4CI6A 4P71A 3LP1A 5SWMA 2PYLA 4ID5B 1PJ7A 1WAJA 4Y1DA 5E3AA 4XO0A 3GLJA 1WSJA 1GMWD 3UW1A 4FBTA 1RBVA 4WQ5C 4NYFA 1KS2A 2RE1A 1T6CA 2VJUA 4YOYA 2Z4PA 2VOPA 5ETQA 3MR3A 3H45C 3HZ6A 5IV4A 2XHCA 3ZFVA 4FP9A 3HSGA 1S72N 2E9TA 3CIPA 1E3MA 2DGQA 5AQYA 1IVZA 1L3KA 3GG0A 4H8KA 3W1YC 1TL1B 3CJ2A 4JKHA 2HFSA 4N5SA 1VSIA 4DBQA 3EO3A 4JV0A 3POTA 4HH1A 5FLXO 4IO9L 1UPPA 2OD4A 4IQXA 4UTGA 2GMJA 3TTDA 4ZKAA 1DY3A 3UR3C 3HOTA 1UMJA 4FJ8A 2DCLA 2R7OA 3QINA 1RTIB 2DNPA 4P6QA 3NGUA 5C24A 4M5LA 4O8UA 1S1VA 4GV9A 4F9OA 3TAMB 4B9QA 2GUPA 4FVMA 2GO9A 2KKHA 2KM8B 4KGZB 1GLLO 1MWMA 4CJEA 1RAGB 4CGHA 2PE8A 4OX9K 4HUFA 1XR6A 2Y1JA 4DR6K 2HMPA 2W01A 4RU9A 2H48B 4NCGA 2J9DA 1HMVB 4NXMF 3JTPA 4IBNA 3A8EA 3OYFA 4N76A 2VASA 4RL1A 4BC3A 4O3RA 2ATLA 2RS8A 4CD1A 4Y28C 3AVNA 1X4FA 2GX8A 1U2CA 3CIZA 4DX7A 3GCWP 1W2BR 4GVBB 4OHXA 4I2PA 3JSBA 2WOMB 1L5UA 1DJ0A 3ETMA 2ZHOA 2FZGB 5FIIA 3JXUA 4XDCA 2L08A 2XTJP 1IKWA 2V8GA 2AHOB 3WQUA 1QZ5A 3HFZB 3MOZA 2CJXB 5J1EA 3ATUA 1NNDA 4HTUA 3MUVP 4FOEA 4RTFD 1C4CA 1J5EJ 4BDPA 4I6WA 5KFPA 4O4GB 1XNQF 2DRAA 3RB6A 1N5SA 1HD1A 1Q81T 3TAEA 1UEKA 2W6LA 4LFBF 2NSBA 3HHLC 3V9XA 3FSYA 2OFHX 4CRJA 1YTAA 3BSCA 4CJPA 2JLFA 2EC2A 4JI3J 3S3MA 4FXWA 3WBZA 3ISZA 1S4FA 2ZH4A 1HQ2A 4HCBA 2HHSA 4O3NA 3GSIA 2G8WA 3BP8A 4PG6A 3MCOA 2XEXA 4K7QA 3KUEA 2H4YB 4F0MA 2JNJA 3G8TA 3KLGA 1BO5O 1TFYA 3HHDA 4ED6A 5D4LA 3ULHA 2R7XA 3VAHA 2J5AA 2IMOA 5AQZA 4GV6A 4CTAB 4M3UA 2DK2A 5AQWA 4LF4K 1UFWA 1FWPA 3T1YK 1UA0A 3RG6A 1S1WA 1UVKA 4F04B 2YWGA 2J8AA 2W9BB 1HKCA 3N0VA 4ZS6A 2K06A 4IH7A 3MCPA 3HM8A 2GFFA 1KC8T 3E01B 4C0OC 4FXDA 4I6MB 4PQUA 2GWJA 3I96A 3MR5A 3KK3A 2PMZD 3P83D 1X4CA 2O1PA 1T9XA 1SL1A 4WYBA 5F1XA 2NPFA 5AJ3J 2J0WA 1UL3A 4EK2A 2WFBA 1X8DA 4CERA 2BKNA 8ATCB 5D4OA 3TAQA 4ZPCA 3IO1A 4FF3A 4QIEA 5HMWA 2C3YA 5HAOA 1HBOB 1ZH5A 1JWWA 3MEGA 3FJ2A 3PACA 3SCLE 1YT3A 2OTLN 5KGXA 3NGIA 3KWGA 3VHQA 4EUVA 3PR4A 2ZH3A 2EG2A 3VVTA 4H0PA 4ERDA 3HT3A 2V4RA 1LV5A 2G4BA 4HI2A 2PDAA 4B3MF 4DS4A 4JS5A 3O2IA 4CGFA 4F8RA 4BRDA 4X66K 4L75A 4H0YB 4CJ3A 1S3XA 3VAIA 1EQMA 2WSEC 4IH5A 3JS6A 1FFSB 1EWRA 1YDLA 3U1LA 3J81U 3J80Y 2E5JA 5BYQA 2IRUA 4DV4K 4MK7A 2QN6B 5EWGA 2NNWA 3AA9A 1JLEB 4H0OA 2W25A 3EZ5A 4CW7B 3GTYX 4P75A 4CZKA 3I9ZA 3HXMA 3P8BB 4NLXA 3G9CA 1O8BA 2RF2A 4JYAF 4FJHA 1FKPA 3MDQA 4MKAA 2C2EA 1QHAA 2OTJN 2AEFA 1RHJB 4JV5J 3CHWA 1FNOA 4H5WA 5GAHU 2UUCJ 1GLAG 4DR2F 3FKBA 4DV6J 1LNQA 4LF9J 3RU0A 1TAQA 2LXUA 3O9TA 3W65A 1YLXA 4PUOB 4DR4K 5LJ3Y 5B0FA 2GUIA 1ZBLA 3L2VA 5L1JA 2P9CA 1IM6A 5BR8K 3QESA 1RWVB 3MEDA 4PWWA 2CPFA 1VJWA 2PA3A 2QA4S 3MN7A 3CJ5A 3QEIA 3RSEB 4PYAA 3D1QA 1ZAWA 5CHCB 3KWIA 2FF3B 3R6LB