4WE1A

Crystal structure of hiv-1 reverse transcriptase in complex with 5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)-2-naphthonitrile (jlj600)
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
547
structure length
542
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title Picomolar Inhibitors of HIV-1 Reverse Transcriptase: Design and Crystallography of Naphthyl Phenyl Ethers.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Hydrolase
total genus 140
structure length 542
sequence length 547
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4we1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4we1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4we1A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4we1A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4we1A05
3AVLA 1GX6A 1EKEA 4NLRA 4F2RA 3OYGA 1HNVB 1QE1B 3VQ7A 4M42A 4FJLA 1KSPA 5FDLB 4KO0B 5KG6A 3VQQA 3ZT1A 1S49A 1RILA 1RT5A 2VG5B 4W5QA 4I7FA 5J2PB 1LAWA 4EYHB 2HMIB 5J1EB 1WSFA 1UWBA 3I0RA 3L2WA 1EP4B 2HHWA 3T5LA 3D45A 1D8YA 4DL6A 4TY9A 1LW0A 4B9LA 3HKWA 3G0ZA 2I5JB 2F96A 3BGRB 1TV6A 2BRKA 1XR6A 3PW0A 3OL8A 4I2PA 4IH7A 4CJQA 1DLOA 3VQ8A 4CJWA 1WSHA 2O4GA 5HP1B 3KMSA 1LAVA 3ZSOA 4DTXA 3PO5A 4JV0A 5CZ2A 3AVJA 4B8CA 3RB0A 3P5JA 3OYBA 5KFVA 3MF5A 3T5HA 2FJWA 1LWFB 1W25A 3MECA 4RNNA 2F8SA 1JLQA 5JS1A 2WOMB 2OPRB 4ED8A 4O4GB 1TL3B 3HVRA 1KLMB 3U6FA 4ECXA 3QZ8A 4WFYA 3V1QA 4Q8EA 1N6QA 3MXJA 3FFIA 1IKVA 4IQXA 5KFYA 4FJXA 3KLIA 2VG6B 3CJ2A 3CVKA 1YVUA 2IAJA 3HT3A 4KV8B 3MR6A 5DG9A 3K5MA 4YP3A 3HSTB 4CF8A 3PX6A 3QEVA 1S6PA 4FJMA 3HK2A 3CDEA 4WFXA 4BE1A 3VA0A 2QE5A 2UVWA 1QAJA 4G3IA 4OPJA 3ZSRA 1QSSA 4FS1A 1L3VA 3ISND 4NLTA 1ZETA 3AVMA 1DTTA 4WZMA 4B9TA 4M94A 4CEAA 1SL2A 3P83D 1RTHB 1RTDA 4ED6A 4B3OB 4Q0BB 2C2DA 3QIPB 3O3HA 3LPUA 1JIHA 4CK1A 3RB3A 3KMQA 3OVNA 2XC9A 3UIQA 4IG3B 4CGHA 3RR7A 3SI6A 1NK6A 3CIZA 3C6TB 3LAKA 4F3TA 5F8HA 1ASUA 3KLFA 4FXDA 4C8OA 3VN5A 3LAMA 2E6LA 3PW7A 5F8NA 1TK0A 3PJXA 2KQ2A 1S1WB 2HHUA 2G8KA 3THVA 3JYTB 4K4TA 4CIEA 1GOCA 3VQDA 4J9RA 3D5MA 2RPIA 2C22A 4KBIA 2XI3A 3KHHA 1WN7A 1T03A 3AA2A 4EEYA 1D9DA 4E19A 4LD0A 3V4IA 1J5OA 2IJFA 2AGQA 2J6SA 1JLFA 1RBSA 5C42B 3HPGA 3KK1B 1REVA 5KG4A 3NF8A 1K1SA 1K1QA 3KJVA 2OH2A 2G8IA 2IC3A 1S1UB 3HL8A 2FLPA 4R5PA 3VQPA 3Q8PB 1RA6A 3LP0B 2AX0A 3BJYA 1TK8A 5KFPA 1RDDA 4CFDA 3OJUA 4ZP6A 4I9QA 3IRXA 1KHVA 1NKBA 2R8JA 2DFFA 4O3OA 2YKMA 3V81A 3FRZA 3TAEA 4IDKA 1TVRB 5C5JA 4RW4A 3DDKA 4URSA 4IKFA 4HTUA 4RUCA 5CZ1A 4JLHA 1VRUA 2IOCA 1RTJA 4CJ3A 2HNZB 2XRIA 4IFYB 2G8FA 3SV4A 3C6UA 3TAFA 4JUZA 2JC0A 4DLEA 3KD1E 3OJSA 3FQLA 2KW4A 3L3VA 3OHBA 4YR2A 2KFNA 2HWIA 3DLHA 3QZ7A 3BR9A 3H5UA 3ISNC 3RB6A 4E0DA 1SKRA 4DQPA 4ID1A 4FCYA 2QKKA 1D5AA 3V9ZA 4GMJB 2KZZA 4ED3A 3L8BA 3QIDA 4XPCA 4H8KA 2CKWA 1XR7A 4CJ4A 1BI4A 3KLVA 2P1JA 4ID5B 4FW1A 3SUNA 1SH0A 4CEZA 3EPGA 4ED7A 3WNHA 4HHTA 4ZVGA 1VSJA 4UQGA 4DTMA 5I42A 3M8QA 4RNMA 2XY6A 4ED0A 4K4WA 3MAQA 2IMWP 1WSGA 5KFIA 1RBUA 1UA1A 3TAMA 4KHYA 3CDUA 1LWCB 3OS1A 3NH1A 2G8WA 3HM9A 5KFAA 3KHLA 5HBMA 5KGXA 3NF9A 4NLWA 2VA2A 4AH9A 3OYLA 5J2QA 2GBZA 4M45A 5KFOA 4ECSA 1VSHA 1QSYA 5KG5A 4ZPAA 3DYAB 4LH5A 4URGA 4AHCA 1BCMA 4DQSA 4BWMA 4DS5A 2A1RA 4K4XA 3VQ4A 4IG0B 1MMLA 4W5OA 2XWYA 3NL0A 3TI0A 5HRRA 1CZ9A 1FK9B 1HJRA 3OYJA 3QIOA 3GYNA 5KRSA 3L2QA 1TKZB 4FBTA 4OKKA 1S6QB 4DS4A 1BGXT 5KFMA 3SQ0A 1NJZA 2WONB 3VQBA 5KT6A 1J54A 1FKOB 4H54A 3NGZA 4O44A 1Z26A 1S4FA 5KI6A 2I1RA 2D0AA 2BQRA 4LSNB 1NK8A 2OPPB 3RRHA 3CM6A 1WAFA 2BGGA 4RU9A 4M41A 1A5WA 2IA6A 4OJRA 3EZUA 2C2RA 3OS0A 5DQHA 1QQCA 3BQ2A 2D0BA 3ZSZA 4CJLA 1QS4A 2R8IA 2V4RA 1C0TB 3NDKA 4ECUA 1XR5A 4I2QB 4OKJA 3CJ5A 3KLEA 3ZT4A 1K6YA 2WCXA 4Y34A 3QEIA 1HNIB 5J2MB 1Q9YA 1FKPA 2Z1JA 3V6JA 4DL7A 3QEXA 2ZKUA 3F9KA 3ZT0A 1SL0A 4U7CA 2Z1GA 4Q8FA 3CFOA 1BL3A 4M3TA 2XHBA 1DTQB 2B6AA 1KTQA 5HROB 4E1NA 4O3NA 4RW8B 3A2FA 2AGOA 1S0OA 4F4YA 2GV9A 3QNNA 4C8MA 3MXMA 1BQNB 3CM5A 2HNYB 3AVIA 4E89A 1IKXA 4CFCA 3JSMB 4TY8B 3EY1A 3OYNA 3CFRA 1T05B 1N5YB 4DTUA 1C1CA 2RDJA 1LWEB 2GIQA 4W5NA 1S5JA 5KT5A 3KK2A 4FBUA 2FBVA 3WNFA 4DQQA 3HVAA 3P1GA 3V6DA 4DTSA 4N41A 3PUFA 5DQGA 3SUPA 4F2SA 3EYZA 1GOAA 4CIGA 3RWUA 1XC9A 3QESA 3PJWA 2OPSB 3AVKA 2O4IA 1IKWB 3M8PA 4Q43A 2XY7A 4F3OA 4ECRA 3AO5A 2G8UA 4FZXC 4CF9A 3SI8A 2OZSA 2BANA 3KIOA 4M95A 2VA3A 1HQEB 3DOLA 4B9VA 1MU2A 2AU0A 4ECVA 1SV5A 4M3WA 2B5JA 3I5CA 3RBDA 3QLHA 2VWJA 4RW9A 4TN2A 1NK5A 4FZYA 4LY7A 3C95A 3IN5A 4CJPA 4JV2A 4TQRA 1JLCA 1NOZA 4F4XA 1I3AA 3PHEA 2W8LA 1I39A 4URQU 3K5OA 3DMJA 3SUOA 4NLQA 2YNFA 1YTUA 2YKNA 2YNHB 3O4NA 4YR0A 4MQ3A 4ECYA 2PZSA 3NCIA 4MFBA 4ZVHA 3NAEA 1S0MA 1Z25A 1WAJA 4NLPA 3DRSA 4BWJA 3RMBA 4FJ9A 3CWJA 5C25A 4DSIA 5FROA 4LH4A 2JEJA 4F8RA 1UWBB 3ICLA 4GC7A 1TL1A 1C0UA 3I0RB 3OYCA 1ZBIA 3K5NA 3DLBA 1RA7A 4HUFA 2D3ZA 3RMAA 1QTMA 4RNOA 1HMVA 2UUWA 4WFZA 1C0MA 4DG1B 1LW0B 4O0IA 4N56A 3CG7A 1TV6B 4CEFA 4FM1A 3MR5A 3SQ1A 3KHGA 4I2PB 3SV3A 1C1BB 4FLTA 5EU7A 3LP2A 4BE2A 3QNOA 3QETA 2HVHA 2HNDB 2RF2B 2ZD1A 4CEOA 5EUHA 3HP6A 2JEGA 1ZBLA 2IDOA 4Z4CA 4CCHA 4J9SA 4CHOA 1RYRA 1RBVA 3S3OA 3LP1A 5SZTA 4WE1A 4C8NA 3G6YA 3V9UA 3PR5B 1VSDA 4KAZA 4J9MA 3MECB 3UPFA 4DSFA 4FJKA 1JLQB 3E01B 2FLLA 1NJXA 3O4QA 1NHUA 4EBEA 4IFVA 1U04A 3AVHA 2HHQA 1N6QB 3V6HA 1IKVB 3NKYA 3VQSA 3KLIB 1RTIA 1Q8IA 4HUGA 3MXIA 4RW7A 4OLAA 4JS5A 3WNGA 1S6PB 1RT2B 1KFSA 2PYLA 1N56A 5KFTA 3ALYA 3TARA 2RKIA 3RAQA 4H4MA 3UQSA 1ITGA 4MK7A 3CDWA 1TQLA 4CECA 1XHZA 1DTTB 3NHGA 3SUQA 3TAQA 2R7YA 4IRCA 1NK9A 2KZMA 2AJQA 4IKAA 1RTDB 3BSNA 1KVBA 5HLFA 1CZBA 1JLGA 2YNIB 4IR9A 5KFFA 3AVNA 4RW6A 5CYMA 1NHVA 4EO6A 5KFWA 1HNVA 2FLNA 3SQ4A 3S9HA 4C8KA 1C6VA 3OS2A 4ICLA 2ASDA 4GVMA 1QUVA 4OKEA 4GW6A 3T3FA 4K4ZA 1WSIA 3KLFB 3PW4A 2DPIA 2D3UA 5KFJA 1XHXA 1B9DA 3PR4A 3L3UA 2W7OA 1BCOA 3K58A 4HVJA 3H59A 3PO4A 3N6MA 4J9NA 2XCPA 1YVFA 1HQUB 3OSPA 5F8IA 4CGIA 4EP5A 4NCAA 1VSKA 1S1VA 3LZJA 1WNSA 3V4IB 1J5OB 3BSAA 1IKYB 3KLHA 3BGRA 5F8MA 1RT7B 1D9FA 5KFHA 4E7KA 4NYNA 2GIRA 1REVB 2EHGA 1L3TA 4DFKA 4ZMMA 3OL7A 1B9FA 3KJVB 2ITGA 5DLFA 2ZE2A 2AQ4A 3DLEA 3NF7A 4R0EA 2B4JA 4I9LA 5KT3A 2ZQBA 3VA3A 4FM2A 3SCXA 2WB4A 2XCAA 3CO9A 3DOKB 1TAUA 1SH2A 3RAXA 4CJRA 3HPOA 4PUOA 5KG1A 1LWFA 3GIMA 4FJGA 1JLEA 3H4DA 1J53A 2KTQA 4NZ0A 2HHVA 1U48A 1JLBB 4IDKB 1S9GA 4CK3A 3MR3A 4RW4B 2OPRA 4F4ZA 1WSEA 5KG2A 2VG7A 4EBCA 5F8LA 4LSLB 4RG8A 5HRSA 3C6UB 4ECZA 4CHYA 4J9OA 4KB1A 2VG6A 3O3FA 2BQ3A 3NGDA 1VSMA 5KFCA 1BIZA 3D0PA 2UVRA 3TABA 4JRPA 1NKCA 3SYZA 3DRRA 2Z1IA 1RT1B 4ZVEA 2IM3A 2R8KA 3AVCA 3KK3B 3TVKA 3VQ6A 2W9CA 2D5RA 1S48A 2P51A 2HW3A 2OPQA 4NCBA 1NNDA 5L1IA 3AVFA 3OL9A 1RTHA 3K57A 3M9MB 3KLGB 4MK9A 4B3OA 4J9PA 2EX3A 5I42B 4NYFA 3M8QB 3GIIA 4FJHA 3LPTA 4DTOA 1TP7A 4QWAA 4HUEA 1EETA 4DLGA 4EO8A 3C6TA 4DQIA 5J2QB 3MEGA 4OVLA 4NCGA 4OL8A 2WHOA 1JL1A 3MTKA 1NK7A 4K50A 4IRKA 4OGCA 3SZ2A 2HAIA 3BREA 4KFBA 4FJ8A 4FS2A 3RMDA 5KG0A 2ILYA 3PX4A 3PV8A 3JYTA 1ZTWA 3RTVA 4WXOA 1T7PA 2YNGB 2OA8A 3QYYA 4YNQA 1ZYQA 4N76A 1KCFA 1L3SA 3H40A 1JXEA 3UDLA 4EZ9A 3I0SA 1RT4A 5KFRA 3NBPA 3KTQA 1TKXA 2XO7A 4J2DA 3IS9A 2A1SA 4E1MA 2Y1JA 4TXSA 2C28A 4O44B 4KHRA 3ZSYA 4O3PA 3PY8A 1YT3A 5KFEA 4FJ5A 4B9NA 2E9RX 1HPZB 3Q8QB 3MEDB 3LP0A 4NRTA 1C2PA 4Y1DA 4KSEB 1T94A 1HARA 4J2AA 2JGUA 3I5AA 3NH0A 2AGPA 3H98A 4CK2A 2W7PA 3K59A 4IH5A 4NLUA 5DLGA 3GIKA 4IFYA 3KLEB 1I6JA 1GOBA 3OYIA 4ZTFA 2JLEA 3AV9A 2FVCA 1T8EA 2DTUA 1IM4A 3O3GA 3PW5A 2D7SA 3DI6A 2IM2A 2BRLA 4KKOA 4O55A 2IS3A 1RCHA 3H08A 3NH2A 3HJFA 3DLKB 3MR2A 3ZSQA 4KAIA 4IH6A 4U6PA 2B6AB 2D0CA 4CJSA 4KI4A 1BISA 3EZ5A 4E7LA 3B6PA 1TK5A 1X9MA 4CJKA 1CLQA 3BSOA 5L1KA 3I8DA 1C1AA 2PYJA 2DFEA 4CGGA 4O0JA 3AVGA 4Z4IA 4FLUA 3OHAA 4FJIA 1ZBFA 4KREA 5KFDA 1A5XA 3V9SA 4O3RA 1C1CB 1IO2A 2C2EA 2HB5A 4DWIA 3ZT3A 1L5UA 3ITHB 3Q8RB 4O4RA 4CHQA 2NUBA 3KK2B 4Z4FA 4DQRA 1G15A 2UVUA 2E9TA 1UOCA 4FLYA 4ED1A 3DYAA 4K4UA 3RR8A 1CSJA 2ATLA 4PWDA 3NFAA 3SNNA 4ELVA 4N5SA 4DF8A 1JKHB 3TQ1A 2OYQA 4JS4A 3OYMA 3SQ2A 5KFGA 3GV5B 4J9QA 3AO4A 4CESA 3H5XA 1TKZA 4XIUA 1VRTA 2GC8A 2V0NA 1W0HA 3M9NB 4XPEA 1WLJA 5KG7A 1RT6A 1MU2B 2WONA 4FLXA 3T19A 2WTFA 2B43A 4ZVFA 2B5JB 1FKOA 5F9LA 3OY9A 1KHWA 1JLAB 3QERA 4LSNA 1ZBHA 1N4LA 1JLCB 3RB4A 4QPXA 2LSNA 2BDPA 4LQ3A 1A5VA 3G10A 2W42A 4M3YA 1BQMA 5D3GB 4CF0A 3DMJB 1OS5A 2YNFB 4DEZA 4KTWA 3T5KA 5HRPA 2YKNB 4DU3A 3TAGA 4Q45A 1S1TB 3NF6A 1C0TA 1HYSB 4CGJA 3DLGA 3AA4A 2AX1A 1N48A 3IG1B 2ILZA 5J2NA 3G86A 4O3SA 4GC6A 4FZZA 3OYAA 4FJNA 1FXXA 5C25B 2BE2B 2FBYA 3RMCA 3BQ1A 2O5DA 3QO9A 1TL1B 1C0UB 4YQWA 3G6VA 2BR0A 4CJVA 3DRPB 5C24A 1HMVB 1U47A 3RBEA 4R8UA 3S3MA 1DTQA 5HROA 4YFUA 4CHPA 1O1WA 4ZTJA 1X1PA 3DM2B 1J9AA 2R8HA 1S9EA 3OL6A 1ZTTA 4Y2CA 4E7JA 5K14B 3LP2B 4DL5A 5KFUA 2G8VA 5DMRA 2ZD1B 4JV1A 1X9WA 2D41A 4QWCA 3JSMA 4IOBA 3PVXA 2WRMA 3GV7B 4F4WA 3AVAA 3H5SA 4DL4A 3HVTA 1N5YA 5DGAA 4XO0A 1S1XA 4CE9A 1S0NA 2FVPA 4ZPBA 3OYDA 3B6OA 1LW2A 4DFMA 1RT3A 1RT5B 4I7FB 2Y1IA 4BACA 3CJ0A 4X2BA 3OYFA 1BIUA 4ZPDA 4FLVA 1T3NA 1TKTA 5I3UA 4KB0A 5E41A 1IKWA 4DSLA 1TGOA 2CJQA 4E7IA 4NLXA 4QCLA 4FJ7A 4PA1A 1RTIB 3V6KA 4KTZA 3QEPA 1VSFA 4Q44A 1S10A 2ETJA 2AWZA 3LDSA 1DLOB 5FRNA 2RKIB 4MIBA 3HPHA 5CYQA 3H4BA 3BDPA 2R2RA 3GV8B 4CEBA 5KFZA 4B08A 4MK8A 5DK5A 2J6UA 1NK4A 5HLFB 4NLSA 4FYDA 1R0AA 4DFJA 4ELUA 4CJUA 2VWKA 1JLGB 4Z4HA 3ZSWA 1S9FA 4RW6B 4KB7A 4K4VA 3CQ8A 5CYMB 1SUQA 5KG3A 4Z4GA 2BQUA 1EX4A 3FFIB 4ICLB 4J9LA 1L3UA 4ZHRA 1KRPA 2IAJB 3V1RA 5JXSA 2GUIA 3GQCA 1UAXA 2KFZA 1WSJA 4OGEA 3PZPA 4H4OA 4DG1A 1S1VB 1JL2A 1KFDA 4MKAA 3LANA 1Q9XA 3KLHB 3N6NA 4KHQA 3MEEA 4G1QA 4PQUA 1C1BA 1QHTA 1VSEA 4ECTA 5KTQA 4CEEA 2HNDA 2RF2A 2FJVA 3QGHA 4B9UA 2ZE2B 4RUAA 3DLEB 4Z0UA 2W9BA 3QGGA 4Y3CA 1QE1A 2QXFA 2Z1HA 1U45A 4KHMA 4K4SA 2HHSA 3I5BA 5FDLA 5T14A 4KO0A 5EWGA 4PUOB 4DSJA 1JLEB 5JUMA 3NGYA 3NGIA 4OLBA 3AO3A 4K8XA 2VG5A 3SJJA 3QGIA 5HRNA 5J2PA 3E01A 1S9GB 1U09A 1U49A 2HMIA 5J1EA 2VG7B 4O5BA 5F8JA 4CEDA 1EP4A 2WK4A 4QWBA 4NRUA 1JXLA 3H2LA 1VSLA 1RBTA 2FVRA 2FVSA 2QK9A 3M9OB 4DL2A 4AHRA 1T03B 5KGWA 3HO1A 4TYBA 2I5JA 4DTPA 4AHUA 3S3NA 4J2BA 1JLFB 4ZP8A 3SFGA 3TAPA 1RT2A 2IM1A 4M3XA 3DRRB 4NLDA 5HP1A 1CXUA 3ZCMA 1NOYA 4C8LA 4HYKA 4F50A 4M3ZA 1LV5A 1D0EA 2W9CB 2IC3B 5T7BA 2OPQB 2HHTA 3LWMA 1S97A 4R5PB 4E7HA 4ECQA 1HYVA 3L2RA 3VQCA 4IBNA 3SPYA 3IRXB 2R2TA 1KLNA 4DMNA 2YKMB 3V81B 3TANA 3HP9A 2WOMA 4RZRA 4DTJA 4O4GA 1TL3A 2YNIA 1KLMA 2W8KA 4DF4A 1YTAA 3CYMA 1VRUB 4DFPA 1RTJB 1NJWA 3KD5E 1EETB 2FBXA 2QKBA 2XI2A 5JS2A 4Q5VA 2V4QA 2HVIA 4ZP7A 1IH7A 3MEGB 4NCGB 1SH3A 4KHUA 4KV8A 1GX5A 4QW8A 4KFBB 3LP3A 2X74A 4ED2A 4TLRA 1RBRA 2R2SA 2DY4A 1HQUA 3FSIA 2E6MA 5FRMA 1TAQA 4KPYA 3GILA 1RDBA 4J9KA 1BI4B 3M8SA 3U3GA 5DG8A 1IKYA 2F8TA 3V1OA 3I0SB 1RT4B 4KHSA 1RT7A 4FK2A 3NBPB 1TKXB 2E4LA 3KHRA 4Q0BA 3IS9B 1NKEA 1ASWA 4B9SA 3QIPA 2JC1A 4N47A 4IR1A 3TAMB 1WNEA 3G6XA 5KT4A 3VQ5A 4MKBA 1HRHA 4M3UA 3DOKA 4IG3A 5HBMB 3L2VA 2ATQA 1RDAA 4CJ5A 2X6NA 4BE0A 1JLBA 1ASVA 5DGBA 4OPKA 4TSXA 3NMAA 1S1WA 4WYLA 4AHSA 5KRTA 4LSLA 5KFNA 5KFBA 4WXWA 3T5JA 2IBKA 4J2EA 4RNFA 4DTNA 3PX0A 4AHTA 1RDRA 4WZQA 2XGQA 3DI6B 3ASMA 1IG9A 5C42A 4NLYA 4KKOB 3KK1A 2EC0A 1RT1A 3VQAA 5CY4A 4DL3A 4ECWA 4FM0A 3KK3A 4EP4A 4B9MA 1S1UA 4YR3A 2DFHA 1JX4A 3DLRA 4PY5A 1BHLA 1Z4UA 4IRDA 4LQ9A 1HYZA 4CJTA 3C94A 3VQEA 3KLGA 3EPIA 5SWMA 4TQSA 4Y2AA 2Q3SA 1TVRA 2IGIA 3BSCA 4MIAA 3QINA 2FBTA 4EZ6A 3HYFA 2G8HA 2HNZA 2P5OA 3NE6A 4DSEA 4KHWA 4NLVA 4ZPCA 3OSNA 1FKPB 5L9XA 3ULDA 4M3RA 1VSIA 4DU1A 3KNAA 4PWDB 2ASJA 3TWHA 2RDIA 2X78A 2YNGA 4BDYA 1KVCA 4FJJA 1VRTB 1RNHA 4FW2A 4W5RA 4ID5A 2XGPA 3FDSA 2V9WA 1RT6B 4DSKA 4CFBA 2P5GA 2FJXA 3BQ0A 4L8RB 1SKSA 4AILC 3LZIA 1IKXB 2IJNA 1VK0A 3HHKA 1HPZA 3HXMA 3MEDA 5EWFA 1LWCA 5KFXA 1BQMB 4MH8A 3ZT2A 1UA0A 5KFKA 1NK0A 4E3SA 4QW9A 5KT2A 3V6DB 2FVQA 4FVMA 1Y97A 2HWHA 1D1UA 4QWDA 3ZSVA 1TKDA 1KVAA 3GIJA 2XY8A 5KFQA 3DLGB 4HKQA 4IG0A 4CERA 3M8PB 4FK0A 4NLOA 1FK9A 5J2NB 2YV0X 3VQ9A 3KKRA 4Z4EA 3TR8A 4CGDA 4FK4A 3LWLA 3IAYA 2BANB 4W5TA 2J6TA 1F21A 1S6QA 3QO9B 4O3QA 3KKSA 4CF1A 3DOLB 4QAGA 1SV5B 4DTRA 5C24B 2F8EX 3F73A 1EXQA 3NAHA 3QLHB 3OYEA 4RW9B 4AHVA 3DLKA 4R8UB 4DU4A 4NLGA 2OPPA 4KE5A 3QEWA 4BDPA 5L1LA 2JEIA 2OZMA 3HVWA 1S9EB 4FLZA 4B8AB 4CHNA 1XWLA 1CXQA 3AO2A 3KOAA 4NYZA 2RN2A 4K4YA 1JXBA 2IM0A 4Y1CA 1RAJA 4MFBB 4CFAA 3HVTB 4I2QA 1S1XB 4YMEA 2UUTA 2UVVA 3ITHA 3IGNA 3DRSB 1LW2B 1RT3B 4CHZA 1HNIA 3MFHA 5J2MA 3CFPA 4HCCA 2R8GA 1NJYA 3V9XA 1QAIA 3H5YA 3RRGA 4HCBA 4CF2A 1TKTB 3T1AA 4TYAA 1JKHA 5DG7A 5I3UB 2JEFA 5L1JA 1W9HA 4JRQA 2HHXA 4RW8A 4BDZA 1ZBUA 1BQNA 4EYIB 2E9ZA 2HNYA 3Q8SB 3OLAA 2R2UA 3CJ3A 2ASLA 5CYQB 1JLAA 2YHAA 3AO1A 3ZSXA 4TY8A 1T05A 4CJEA 5F8GA 3SPZA 3LP1B 4WE1B 2DPJA 1LWEA 5KT7A 1B92A 3OYHA 5KFLA 5D3GA 4QOZB 3M8RA 3L2UA 4K8ZA 1X9SA 2QV6A 1R0AB 4KRFA 3V9WA 3D28A 4ELTA 3K2PA 1S1TA 4CJFA 1SUQB 3AVBA 3N6LA 4IFVB 1HYSA 2OPSA 3AA3A 4F4KA 4KTQA 5EDWA 2XY5A 1XI1A 3IG1A 4EBDA 4ZHRB 3OLBA 4KI6A 3NAIA 4QWEA 4ZP9A 4FLWA 2BE2A 3U3YA 4RW7B 3K5LA 1HQEA 1SKWA 3LALA 3OYKA 3MFIA 4CIFA 3WNEA 3DRPA 3UR0A 5EWEA 3E51A 4H4MB 4H4OB 4WYWA 1SL1A 1QSLA 1RYSA 4KHNA 2ALZA 1RDCA 4CGFA 2YHBA 3PW2A 3DM2A 3IGVA 4RNHA 4CEQA 3MEEB 4G1QB 2W9AA 4PQUB 5F9NA 5K14A 2PY5A 3FQKA 2FC0A 5KFSA 1U4BA 2X6SA 3AA5X 5DQIA 3CJ4A 3SFUA 2YNHA 2W9BB
chains in the Genus database with same CATH superfamily
1SJ4P 3LDQA 3VQ7A 3DJCA 2IIHA 4M42A 5FDLB 4J9UE 3S01A 4QYZK 1ICEB 3ZT1A 1RWPB 1MWMA 4X84A 5F3TA 5J2PB 5D4PA 1LAWA 2HMIB 1YI2N 5J1EB 3W2VA 1UWBA 3H1QA 3AY9A 2YH1A 1VQ6S 2NREA 1FHTA 3BKUA 1W2IA 4DL6A 2PMZD 1VQLN 1OH7A 4OZLA 4MAKA 4B9LA 3HKWA 4X65K 3WUHA 2O8CB 3CCVS 2BKNA 2CRLA 1XR6A 4ZPWR 3MURP 4A5AA 1YAGA 1DLOA 3JXUA 4CJWA 3PRVA 1NEEA 2O4GA 1LAVA 4DTXA 5IWAF 4JV0A 5CZ2A 1ZOTA 1MLAA 1Y0HA 3W66A 4RBUA 1Z05A 3H3NO 3RB0A 4NOHA 3D9BA 4NXMK 2W2OP 2JFDA 3OYBA 3IDHA 1LWFB 2MGZA 5D15A 4RNNA 3CCSS 1JLQA 3A8KA 2OPRB 2BM1A 1GXTA 1TL3B 2FHOB 3M32A 4P2FA 4CIOA 3WHIA 1LK5A 4WQ5A 4Q8EA 5AQPA 4I69A 1VJQA 5LM7E 2R4FA 5KFYA 4FJXA 1E6YB 3E1YA 4MLEA 1NGCA 1YVUA 4KV8B 1MG7A 3MR6A 3J7AP 4YP3A 2C2MB 2KHOA 4CF8A 5T7LB 3AQPA 3W2WA 3OW2M 3CDEA 4WFXA 4OPJA 1QAJA 4G3IA 3ZSRA 3RBXA 1L3VA 1ZETA 2CVEA 3AVMA 3H2VE 3EO3A 5AQGA 4WZMA 1DRZA 3BZKA 3QAEA 4F4AA 4B3OB 3ENBA 4CZGA 2C2DA 5FPEA 3C66A 1LWXA 1UVNA 4M5KA 2D9PA 5LL6Z 4ZPVR 4ZVTB 2IYGA 3QRPA 3RB3A 4JKCA 5HMZA 4HACB 3BF1A 3I56N 3UIQA 4IG3B 3RR7A 2UUAK 3CIZA 3C6TB 3OVSA 2YPYA 4C8OA 2M8HA 3I33A 2E6LA 5BREA 2KQ2A 2HHUA 2G8KA 2QRRA 4YOXA 3PIOL 4K4TA 1GOCA 1HWJA 4QS8A 3D5MA 4CD3A 5JLFA 2RPIA 1S57A 1GMVA 4NPOA 2D3O1 4WQ5C 4LD0A 3V4IA 2H48B 5C42B 4C7QA 2OI2A 4DR7J 1LK7A 2MKCA 1B4SA 1K1QA 5IQ6A 1VISA 2IC3A 5C10A 3TZXA 1X4EA 4R5PA 3VQPA 1TMMA 2ZOFA 3CC2N 1RA6A 3LP0B 2UXBF 4MT1A 3BJYA 5KFPA 4DMZA 2P5VA 3RW6A 4YEAA 4ZP6A 2M88A 5HMXA 3IRXA 4UTGA 2R8JA 2DFFA 3M2RA 4OHVA 4WFNQ 3T41A 3CHWA 4RW4A 4HTUA 3OD2A 5CZ1A 1RTJA 2XRIA 1U26A 3SV4A 1OY8A 4JHDA 4U95A 3MAAB 3OJSA 1MWYA 4K8RA 2L9NA 3HHLB 1VQNN 4ALZA 2Q79A 1WC3A 3GFYA 3B8HA 3DXBA 3CERA 2ERRA 1WHYA 4E0DA 2DH9A 3VF0B 3B6BA 3L8BA 3EDQB 2CKWA 1XR7A 2P9KA 1BI4A 4YOYA 3SUNA 3LPEA 3UW1A 1NM2A 2Y9HA 3DGVA 4USTA 4CT8A 4KGZB 1DGKN 2XY6A 3DFEA 1HBNA 3DU5A 3MAQA 1KONA 3CDUA 2F9TA 3KWGA 4OI3A 1SXLA 4USKA 3WDOA 4FOEA 3HM9A 3KHLA 4G1IA 4NYOA 4AH9A 3L3CA 2LEPA 2GBZA 4ECSA 1N0VC 3NG8A 4JI2F 4LH5A 4L75A 2VOPA 1NO8A 4LF5J 2A1RA 1AW0A 1HNZJ 1MMLA 4W5OA 3SCJE 3NL0A 5HRRA 1FK9B 1TKZB 4UOGA 4DOZA 4FBTA 1BA0A 3NCQA 1S22A 2WONB 1FX4A 1M1HA 1FKOB 3W63A 4CM2A 1Z26A 2YJEA 3N79A 4LSNB 4UOCA 2OPPB 2RSQA 3RRHA 4M5HA 4KC5A 2OANA 3DU6A 2F7TA 1A5WA 1VQ4S 4OJRA 3EZUA 2C2RA 5DQHA 4I56A 2Q6BA 3BQ2A 2D0BA 4CJLA 2OELA 2WW4A 2IVPA 2R8IA 3NDKA 4OKJA 3CJ5A 3R1HA 3NGUA 3EXCX 4FWOA 4DV7K 4U67Q 4CRJA 1CJTA 1N36J 3U27A 5CABA 4I67A 4DL7A 1NPRA 1XTZA 3EVMA 1BL3A 4V1Ak 1DTQB 1PBUA 5KOWA 2HQ3A 4A46A 2KG1A 3A2FA 1S0OA 3ILIA 4QYZJ 1QZ5A 2I2YA 4LF7F 4G65A 2HNYB 2MJNA 2ZH8A 4DB3A 4OI6A 1IKXA 3DDIA 3J7ZO 3T69A 4OI2A 2NZCA 3TJAA 4MO5A 4TY8B 2ZNZA 2RDJA 3FCWA 1LWEB 1S5JA 4X65J 2FBVA 2MQPA 3P1GA 3V6DA 3QATA 2ZEJA 3PUFA 2EWHA 3IWXA 3L95X 5DQGA 3SUPA 5CZVA 3PYEA 4JI1K 2DIUA 2V51B 1G99A 4QS9A 3AVKA 1IKWB 2XY7A 2O3DA 5GADP 3L6QA 4ECRA 4CF9A 4NXMJ 1U0HA 1HQEB 2CDRB 4H4KA 4CH7A 1Q16B 3FMBA 3HJVA 3RBDA 2CQGA 3ZNJ1 3CCTA 4TN2A 5GIOA 2ZJQL 4RUHA 2Q97A 4FF2A 3TQEA 3SSRA 2I8EA 2V9KA 3WC0A 4F4XA 1I3AA 4OZ5A 1CZAN 2DO0A 3K5OA 2V68A 4IOCQ 2YNFA 2E1MC 1YTUA 2YNHB 3CCMS 1HR0K 2NXUA 4BR0A 4C48A 4MQ3A 2PZSA 2ZH3A 4MFBA 4KJIA 3NAEA 3BGFA 2C1EB 1Z25A 3R6GB 1Y9OA 1KQKA 4A8XA 2BXJA 4JAXA 3MMCB 3QBXA 2AW0A 3CCUS 1NMEB 3A0IX 3D3BJ 3OTDA 3CCLS 1BU6O 1YG0A 5FROA 5M1NA 2HG4A 3W2VB 4F8RA 1UWBB 3ICLA 4GC7A 2V2ZA 1JCEA 1TL1A 1C0UA 3IR5B 3RMAA 4C2MA 2RDDA 4B02A 4DG1B 4AYBD 2QSFA 4CEFA 3MR5A 2UUAJ 5M2RA 2N7YA 1DKGD 1C1BB 1CJUB 2WB1D 3QNOA 4BE2A 4DR1K 2DIVA 2HVHA 3QETA 3J81j 2ZD1A 4PCQA 3W5XA 3EL2A 4H4KC 4CCHA 1UZDA 2YWFA 3E9LA 2BKOA 1V4TA 3N28A 3GE1A 4DV3F 3VTHA 3S3OA 4WE1A 4C8NA 3BV8A 3MPDA 5CQGA 2MGZB 3JAMO 2C3YA 3HBTA 4DSFA 2QWRA 1JLQB 3E01B 2DR6A 4DZ6A 4LVOP 3M32B 4J9VA 3R5JB 2KKHA 5AT1B 3D6MB 1U04A 2HHQA 3KG1A 3CD6S 3NKYA 1FERA 1VI7A 1RDWX 2MY8A 3R5GA 4XH1A 4O8KA 1FX2A 5I3QA 4CLUA 4JI3K 1WJ9A 2P6SA 1XUPO 1KFSA 4BG9A 2RKIA 3UQSA 1ITGA 1EIYB 2B7CB 3PHTA 5FIIA 1TQLA 4CECA 4X65F 2NRTA 4DPXA 2R7YA 4IRCA 1KBRA 4J90A 2AJQA 1ATSA 4OLPA 3EUNA 4DX6A 4BRKA 2AJFE 1CZBA 4O8UA 2N3LA 2KI2A 3SMSA 3K9KA 5IV4A 5GMKa 1JLGA 2HBJA 4IR9A 1F2HA 1QLNA 4C8KA 5KFWA 3S9HA 2V5HG 4NXMF 2RD5C 5EN1A 1JMTA 3ILLA 3OS2A 4ZVRB 2F4FA 3MPVA 4OKEA 4NXNK 1WSIA 4B3TF 5KFJA 1NMDA 2DGSA 3L3UA 3JAMY 3VVUA 2CPJA 4C97A 2W7OA 2LP4A 3P5TL 4HVJA 3H59A 3OQ2A 3PO4A 1QTNB 4J9NA 4AQYJ 4P2SA 1HQUB 4NMXA 1UEKA 3MDFA 1QHAA 1WNSA 4OZ0A 3EGWB 3V4IB 3BSAA 3KLHA 5F8MA 3D2EA 4G1PA 2XQCA 1L3TA 4DFKA 3OL7A 1B9FA 1KKHA 4C3KA 1S76D 2ITGA 2GAGC 4CZFA 2B4JA 5KT3A 3DRXA 9ATCB 1H72C 2EWSA 1WSRA 2XCAA 4OHZA 3CO9A 1H1VA 4GKJK 3DOKB 1SH2A 3RAXA 5ADXA 1J53A 2AF6A 2KTQA 1OO0B 2HHVA 1U48A 1X4AA 3BYRA 4RW4B 3ZX0A 4F4ZA 1WSEA 5KG2A 4CP5A 2ACYA 3OXGA 2VDIA 1RACB 2DHXA 2QA4S 1IV0A 4ZITA 2GMLA 3RU0A 4J9OA 5AQSA 2UUAF 3AOCA 2M0GB 2BQ3A 4QQBA 2DR5A 3SYZA 2PA3A 1KVJA 4DR4K 4NLBA 3G6EN 3WQPA 3PKMA 2VGNA 4B1ZA 3KK3B 1S48A 2PGCA 2OPQA 3WQTA 4JI7K 4ISGA 2P9KB 1XERA 1NNDA 5L1IA 2E2QA 1JJCB 3EX7B 1FXRA 2FUG9 2KDOA 3M9MB 3KLGB 2HS3A 3K57A 4MK9A 2UP1A 4DV7J 2EX3A 4YOWA 4NYFA 2B7BB 2LU2A 1HBNB 4K2XA 3ID8A 1TL7A 5CHIA 4C3LA 4B3MF 2VZ9A 1UETA 4ILGB 4EO8A 3QDKA 4OVLA 2WHOA 5HK4A 2QWLA 3RMDA 5KG0A 3PX4A 1G7CB 2QSWA 3RTVA 2YNGB 3SEOA 3VV2B 5DETA 4L3KA 3AD7C 2JDJA 2CQ3A 2EFQA 4GV6A 1RT4A 2YWHA 2Y1JA 2A1SA 2C28A 1X5PA 2FZCB 4KHRA 3CCJS 3ZSYA 1NJIT 1YT3A 4JI1J 4M5GA 2E9RX 4BR5A 2LVWA 2OEMA 2OTJS 2DHAA 2QA2A 5LMNK 1W7WA 3CE8A 2VBXA 2NYIA 4N8OA 4A8OA 1NZ8A 2JGUA 1N34K 2AGPA 4USIA 3H98A 4YDDB 3BF3A 1NH7A 1SQGA 2GX8A 3K8VA 4NLUA 3AJDA 1I6JA 4BY9C 4UZCA 1GOBA 3W3SA 3OYIA 3BZCA 2QMUB 2YWEA 3DAWA 1BOTO 1PSDA 1U8WA 1CJTB 4AUKA 3AB4B 3GTYX 3H08A 4LF9J 4A59A 3O8MA 1EQ0A 3FBFA 3MR2A 3Q8YA 1HR0J 2OCEA 3SAHA 3EZ5A 2AZ1A 3BSOA 3E9OA 1O6XA 3I8DA 2X3DA 5GAGI 3GOIA 3AVGA 4FLUA 2GZOA 4A47A 3SCLE 4KREA 2JHEA 3V9SA 1X0PA 3J7Z5 3UN3A 4O3RA 3JQKA 1JCGA 2HB5A 1HD0A 2HGNA 1GEHA 4O4RA 2NUBA 2VQFF 4FF1A 4DV0K 2F8HA 2PBDA 2KT3A 2G2YA 2G1HA 2Z8QA 3GU0A 4ELVA 1REGX 2MLXA 4DR1J 2IIRA 2OYQA 4JS4A 3V5RA 3SQ2A 2VH7A 3RRKA 4AM6A 2FD2A 1VRTA 2GC8A 1U0HB 4RJVA 4Z2XA 5IXUA 2E7XA 1RT6A 4ZVFA 3P8BB 3U7JA 1JXVA 2EXUA 3TZZA 4AE5A 2RQCA 1NLVA 1SQFA 3QERA 1ZBHA 1N4LA 3RB4A 4OZNA 2LSNA 2BDPA 5KQ8A 4AXIA 5D0RA 1A5VA 1WDDA 4C3MA 2P9SA 3J80Y 3O6WA 3DXMA 2BJDA 2P9UB 2O8FA 4M63A 1AYEA 4FWQA 2YNFB 1TL4A 2V50A 4KTWA 5HRPA 4ETZA 4JK9A 3TAGA 3DLGA 1OVQA 2EFVA 2GIFA 5ETNA 1N48A 4Y6IA 2VB6A 1KOHA 1Q7YO 3RMCA 3BQ1A 4EWTA 2AJ1A 3CQXA 3NMUA 3FEZA 1TL1B 1C0UB 4YQWA 3PACA 2XNRA 3H8YA 4HHJA 4CZMA 1B7YB 3RBEA 3S3MA 2PFFB 4BC9A 4CHPA 1IR2A 2XS7A 1X1PA 1H7WA 2OMLA 4ZCMA 2XMTA 4LRFA 2B8QA 3KG0A 3THYA 4NXNJ 5IZHA 4Y2CA 1X4BA 5A8RA 3TA1A 1N88A 2HLUA 4DL5A 3MUMP 2J76E 5DMRA 2ZD1B 2VC1A 3CULA 3C14A 2D41A 4QWCA 4IOBA 7FD1A 3AVAA 5DGAA 4DUYK 4XO0A 1S1XA 2BW2A 1VQ7S 2GUPA 2JWKA 4I7FB 2Y1IA 1NSKL 4BACA 4OYMA 4ZPDA 3A5MC 1HR0F 5GIPA 3OFEA 5FPNA 4NLCA 4M63C 2H9ZA 2HVZA 1SJFA 4DSLA 3NOGA 2CJQA 4FPAA 4NLXA 2CDQA 3VAMA 5M1PA 5M1OA 4Y2IA 4GKJJ 3I9ZA 2VU5A 3I87A 4Q44A 2ETJA 3UN5A 1IR1A 5FRNA 2RKIB 4ZLLA 1RWVB 4CO3A 1Q7YT 3BDPA 4IUFA 2RU3A 3VZIA 4CEBA 4FXWA 5EXWA 5HJYA 2DCUB 3HFVA 4B08A 1CBKA 1U7LA 2V2VA 5AZIA 4NLSA 1EO1A 3IKMA 3FZMA 2FGCA 2VWKA 1U2CA 1JLGB 1PILA 4DR4J 3QFWA 4KB7A 4RWXA 1IXKA 2FC8A 3OPKA 4A8WA 3M8YA 1EX4A 2QWOA 3BDEA 2BZ2A 1RBAA 3CCRS 3ENHA 4JI7J 3JAMU 3R97A 5E5NA 2HHHK 1FT8A 3Q7CA 1R7IA 3GQCA 1UAXA 2KFZA 4CJ7A 5GADU 3WXKA 5BPNA 4F36A 3K2YA 2J9DE 1PYSB 8AT1B 3PEJA 4MKAA 3LANA 2W24A 4LBIA 1Q9XA 3KLHB 3A3PB 4JI3F 4DU8A 3MEEA 4PQUA 1YIJN 1QHTA 1KAXA 3ZNUA 5ETVA 4HDGA 1VFJA 2QWQA 1HA1A 3MHYA 2Z1HA 3SJHA 2HHSA 5T14A 4KO0A 4PRFA 1Q8KA 3ETMA 4Z7CA 3CPWM 1JNZB 3NGIA 4OLBA 3AO3A 2VG5A 3QGIA 4EFAC 1PO6A 4Y2KA 1FDNA 3IR7B 5B7WA 4O5FA 1F1BB 4QWBA 1QAYA 1I94K 3D0IE 1RBTA 2KKZA 1QVGR 4WP3A 1T03B 3HO1A 5AJ3K 1VQ6N 4A4JA 1EX8A 2B4VA 5LMNJ 4J2BA 3S3NA 1JLFB 1E6VB 1RT2A 4NLDA 1N34J 1IJFB 1RWOB 2KVIA 3N0VA 1YX2A 4F50A 1O13A 3CCVN 1D0EA 1YKWA 2OPQB 1V3RA 2D74B 1P90A 5IOLA 3L7PA 5DRKA 3VQCA 3RSEA 3CJCA 3MCAB 1FO1A 3SPYA 2E1ZA 1KD1O 2ATCB 4F0KA 2R2TA 1KLNA 2ZITA 2YKMB 3HP9A 2WOMA 4WFAQ 3NS7B 4O4GA 2M9KA 2IVMA 1CJKA 4DF4A 1TL7B 4ZN3A 2U2FA 1NJWA 1Y5NB 3CCSN 3M1VB 2FBXA 4GKJF 1TFWA 2QKBA 2XI2A 3GB0A 3CC4S 1W2BR 1YJVA 2P9IA 1SH3A 2EFGA 2IRUA 1GX5A 1YJTA 2V67A 2R7TA 4ED2A 5GINA 4TLRA 2DY4A 1O0PA 2E6MA 4CLFA 3G71S 1RDBA 4EUVA 4J9KA 3M8SA 3QRQA 2RS2A 3WXIA 3MX2A 4BRFA 1RT4B 1RT7A 4FOIA 4DR4F 2E4LA 3N4QA 4DV0J 4B9SA 3T1YF 4N47A 2VBYA 2CXEA 4IR1A 3PXGa 2PI4A 1WNEA 3VWSA 4LBHA 1N54B 3GMGA 3U9ZA 2YTCA 1P9QC 2ATQA 1RDAA 3E66A 4FYXB 1ASVA 4OPKA 4P2MA 2CNNB 2DGXA 2RT3A 4LIRA 2LXUA 5KFBA 4HI1A 3DHWC 1KD1T 3SAGA 4WIQA 5CA5A 4DR3K 1W97L 3U1MA 4HDHA 3CXCM 1YUWA 1RDRA 4WZQA 4YDUC 1N33K 2XGQA 3UD3P 3HI9A 1IG9A 4NLYA 4BQZA 1RADB 5E3RA 4CO1A 1UTAA 2NYHA 2VL1A 4FM0A 4EP4A 1RKJA 1URRA 3ATVA 2R7RA 4PY5A 3DLRA 1JX4A 2F9DA 2HWTA 1Z4UA 4IRDA 4LQ9A 5HI7A 4CJTA 3C94A 3VQEA 5E26A 4BRAA 4DPOA 3MMBA 3PSFA 3AT1B 4Y2AA 2Q3SA 2VD3A 3GBTA 3G8QA 2QX0A 2G8HA 4CZCA 4DSEA 2MMYA 3ZZYA 5LMNF 4NLVA 2VONA 3O9TA 4TVAB 2E8AA 2JWLA 5L9XA 3K0SA 3IC1A 1N34F 4BGBA 3M05A 1VSIA 2C42A 3F56A 4M5NA 2DNZA 3OTBA 4L6V3 2HZAA 3QAUA 2G0CA 1NDKA 1GH8A 2B56A 1VRTB 2MZJA 1RNHA 3LM2A 4W5RA 4DUYJ 4ID5A 4JKFA 1RT6B 4CFBA 2RMLA 1UWAA 2ASPA 3OW2R 4AILC 2XO6A 3MZIA 1TL5A 4L76A 3FCVA 1VK0A 2QWNA 3J80U 1LWCA 5KFXA 3ZLJA 4MH8A 3DXMB 1V3SA 4TLQA 2YX4A 4E3SA 5KT2A 5K9FA 1WEYA 1UCNA 4JK7A 4OYBA 4RWWA 3ZSVA 2VPYB 4EAHD 5KFQA 1SAZA 3DLGB 2P9LA 4IG0A 1A0OB 4I6YA 2VUGA 3CMES 3W0LA 3EZOA 1S77D 2NRZA 3QFUA 3TA2A 3NS6A 3AFGA 3IAM9 4O3QA 3DOLB 4DTRA 3PCOB 3OUYA 3OYEA 4AHVA 3DLKA 1ZZFA 4GRSA 3CCES 4UY8O 4DU4A 1HLWA 3HI0A 4PWUA 5E0OA 5AFUH 2C2NA 4BDPA 4PKIA 1Q95G 2HBKA 1IJEB 3HVWA 1AUSL 4B8AB 4QU6A 5A8RB 1XWLA 2HHHJ 2JWNA 3FSYA 2P9PA 1R6VA 3H25A 1P27B 3TVZA 3AH6A 1VQ4N 3OFGA 2QFJA 4CFAA 5FJ4A 4I2QA 2QA1A 2MKYA 1S1XB 4YMEA 5JMNA 1HNIA 1GLLO 4LVNP 4CW7B 4HCCA 2W2NP 2R8GA 3BR8A 5E84A 2QLFB 2X1AA 4CF2A 4YB7A 1JKHA 5DG7A 2IDLA 3JQMA 1VQSA 4JRQA 2CPEA 2OGUA 2RB7A 4NASA 3MTJA 4B1XB 2CG8A 5BPLA 4QR1A 1BQNA 2DD8S 2E9ZA 3NGKA 3Q8SB 1EB0A 1HKCA 2R2UA 2DHGA 2RHKA 1JLAA 3AO1A 1NRKA 2B9EA 2DHHA 3U4LA 4MTPA 3AODA 4ZA1A 5F8GA 1I94J 1H3DA 3SPZA 2DPJA 1Y00A 2Y1LB 3OYHA 2CQ4A 4UY8T 3R6MA 5AZIB 4QOZB 5AJ3J 3MM7A 2QV6A 5H1SV 3D28A 2HSEB 3BUZB 4C9DA 4MIWA 1JJ4A 3K2PA 3OBWA 2BJ7A 3P39A 2AYGA 4PWWA 3N6LA 4PG4A 4ETXA 5EDWA 1XI1A 3MMVA 2MZRA 2M52A 1W7AA 1NDLA 3NAIA 2XS5A 1YBUA 4ZP9A 4FLWA 3C15A 3U3YA 4RW7B 1AUDA 3LALA 2ZJPL 4B1VA 3UR0A 5EWEA 3E51A 3WBZA 1YJRA 4WU2A 6FDRA 1ZH5A 2CPZA 4FWNA 3U02A 2XWXA 3FK4A 3GJTB 2YHBA 2ZWOA 3GWCA 3DM2A 3D0GE 3MEEB 4FSVA 4PQUB 5F9NA 3I6PA 1IN0A 3UB5A 4AM7A 3P45B 4CI0B 2X6SA 2QZ8A 2AJ0A 3TUJC 4JI8J 2PEHA 1WEXA 3UR3C 1YLXA 3OYGA 4BROA 1HNWK 4KO0B 5A2QY 3D4JA 1JB0C 5JVHQ 2GQQA 3CCMN 2I7PA 1NDPA 1S49A 1RT5A 2VG5B 4I4BA 4HL9A 2XSJA 4W5QA 2NPIA 1FDDA 3NCRA 2VICA 1NPPA 3UE2A 2MLYA 2LXFA 2DGTA 4H5VA 3CCUN 4K0KF 1VLYA 4LR9A 3CCLN 1UJ6A 1D8YA 2KJWA 3FBCA 2MB0B 4TY9A 3GE9A 4DPYA 3ZYYX 3B4MA 1S72S 2F96A 1TV6A 3OTCA 4IH7A 4F04B 2DEJA 3VQ8A 2KRRA 5F0XA 2F1FA 4E1JA 3ZSOA 3VALA 2NSCA 7AT1B 3DXKB 4CBUA 2KN4A 3NVKA 1HKGA 3HSJA 1IBMK 5KFVA 3C46A 1P9YA 3RSEB 1R8CA 3N4PA 4DR3J 2FJWA 3OA9A 4CT9A 2CZ4A 1WC1A 2GQ2A 5JS1A 2WOMB 2GW8A 4O4GB 3HVRA 1CJKB 2CZVC 1K73O 4ECXA 2M8DB 3V1QA 1NH8A 2APOA 1N6QA 4ZLPA 5AQFA 4IQXA 2VG6B 5DG9A 3HSTB 3KJFB 3CD6N 2DGWA 3LDNA 2XLKA 4LIWA 5HANA 3HK2A 4ERDA 3VA0A 2QE5A 3PFOA 4NLTA 4S0MA 4B9TA 5AJ3F 2ZC3A 4WCEL 1IR0A 4CNZA 1BLUA 3HHNB 1RAHB 2XTJP 2R7QA 3FZHA 4CYUA 3S8SA 2XHWA 3EE8A 4FVUA 3EEQA 7FDRA 1EKSA 1BY9A 3LAKA 2XMJA 5F8HA 1FEEA 3PW7A 1UFKA 4F02A 2W1BA 1KNZA 4ER8A 4BRLA 1TK0A 2A0FB 3THVA 2QT7A 2FHJD 3JYTB 1UEVA 2LQ8A 4CIEA 3VQDA 2QEXS 3VAJA 2Z58B 1NGJA 5CD4A 4OQJA 1XMOF 3PJ9A 5M1FA 4LFAF 4E19A 2IJFA 1KC8O 2J6SA 2J5AA 1RBSA 4USHA 1U2VA 3HLUA 1REVA 4RKUC 4BR4A 5KG4A 3NF8A 3LW5C 2IVYA 1OQ3A 2OH2A 5H9FK 2MYFA 2DBBA 2WBMA 2YCHA 2DGUA 4FNIA 1TK8A 1M1KT 3C2PA 1KHVA 3UDEA 3BY5A 2VF3A 3I31A 4O3OA 3V81A 3FRZA 4IDKA 1FEHA 4ZCIA 5C5JA 4J8FA 4RUCA 3BN7A 1NGGA 4JLHA 1FNXH 3TTDA 1X60A 2F7VA 3ATUA 3TAFA 4CZLA 1DQ9A 1SPBP 3JS6A 3D6FB 3WX8A 2FF3B 4YR2A 2OJ3A 2NZTA 2QA4N 3Q22A 3DLHA 5GAEP 3X1LB 1RBLA 3H5UA 1J5EK 4ID1A 4FCYA 1DJ0A 1D5AA 4GMJB 2UXDK 2JNJA 3PNIA 5HQMA 4DR3F 4H8KA 3KLVA 4ID5B 2Z2LA 1N33F 4CEZA 3DHXA 4ZVQB 4DZDA 4CQ1A 4ED7A 3WNHA 4QIVA 4A8KA 4HWIA 3M4XA 2RQKA 1DBDA 3FZFA 4UQGA 3GCXP 4DTMA 3GLJA 1G2EA 2HVDA 3JXOA 4ED0A 2HRTA 4K4WA 1X9JA 2IMWP 5AXKA 4P7VA 1RBUA 1KC8T 1T9VA 1HI8A 4E8UA 1ZAWA 1LWCB 5BRDA 3OS1A 3GL1A 5HBMA 3W62A 5KGXA 3NF9A 2CPIA 2VA2A 3OYLA 1FJ7A 5J2QA 5KFOA 3BS9A 2MSTA 3DYAB 3KG4A 4EMDA 4AHCA 3BO2A 4DS5A 4K4XA 3VQ4A 2FIUA 5A76A 2MKJA 3ZTQA 4IG0B 3IMXA 2K2PA 3QIOA 2YX6A 2ZH5A 3UFCX 5GMEA 4DS4A 5KFMA 1SJ1A 1JJ2R 1BWFO 5DO2A 3VQBA 5KT6A 3M2VA 3NGZA 4H54A 4O44A 4XK8C 2DKOB 2N4DA 4OMFG 2D0AA 4P72A 4UY85 5EOYA 2PFDA 1NK8A 3M3ZA 3GDQA 2GGPA 3CM6A 1WAFA 4PHTX 1KXPA 3HD1A 2UUBK 2AJ4A 3OS0A 1RHMB 2WBRA 3ZSZA 4FPIA 5AQRA 2P9PB 2OTJN 1QS4A 5AXMA 2KU7A 1C0TB 4Y28C 4I2QB 3LGMA 4C1NI 3VAHA 1HNIB 3IAS9 5A8WA 1S79A 4AT1B 2WVDA 3BKFA 3GJQB 2FLOA 4FWSA 4ZVUB 3ZT0A 4KBOA 4CO4A 3CFOA 1VC0A 4LF8J 4DR2K 3F0NA 1QVFR 5F3ZA 3BB5A 2B4UA 4EHTA 3GZ7A 2W01A 4UOHA 1CQNA 4L73A 1HNWJ 2AGOA 3A5NC 3UN2A 3HOSA 1KQFB 1BQNB 1UKUA 4X66K 5AE3A 2C3PA 4U96A 5DM6Q 1S3XA 2QG9B 3JSMB 3QSYB 3JTPA 3CFRA 1N5YB 4DTUA 2FY1A 2H5JB 1WD6A 5KT5A 1PC5A 2JRSA 4YS2A 1GOAA 4CIGA 1G4CA 3PJWA 5ETSA 2XBPA 3D6HB 3Q89A 3IR6B 2PIIA 1D8ZA 4KIAA 1NWKA 1OPIA 3AO5A 1ZAXA 4P75A 4FZXC 3PLAA 1UZHA 2ZH9A 4BRHA 2BANA 1IBMJ 3KIOA 3BKTA 4WQ4A 1CG2A 1GLAG 1AZSA 2VA3A 4H0TB 4DV1F 4B9VA 4ECVA 4JI4F 2MDAA 2AZ3A 3G87A 3QLHA 2XMKA 4RW9A 1W26A 2NZ4A 3C95A 4CJPA 4TQRA 1ZPVA 1NOZA 3GSIA 4KH1B 2V2KA 2E5IA 3QPIA 4IEIA 3D2FA 2RRAA 1P1LA 5IQQA 2QWMA 3SUOA 4USUA 3K8WA 2A1BA 2YKNA 3O4NA 2I6WA 1ZM4A 1EARA 3LM9A 1YQHA 2FGOA 4FWRA 4L3NA 3RMBA 2XSJB 4FJ9A 5KQDA 3NGRA 2JEJA 3DLBA 1MN9A 2J0WA 1QTMA 4RNOA 4A62A 2VPWB 1QUPA 2B8PA 3GONA 4WTOB 1X5TA 3VEOA 4ZVSB 3IWNC 4ISEA 4LFBK 1TV6B 5F0WA 3CIMA 3KHGA 2DGOA 5HOOA 2HRYA 2LDYA 5BR8F 2RF2B 4CEOA 4WQ4C 5EUHA 2IDOA 3LUYA 1RQ0A 1NU4A 4ID8A 1RBVA 2QA4G 1P8GA 2MHEA 2RHQB 5SZTA 2PMWA 1Y3KA 3PR5B 2H54B 1VSDA 5GMDA 4KAZA 3MN5A 5CXTA 4FJKA 1GLBG 1LKZA 2CPFA 3O6QA 2FLLA 1NJXA 3O4QA 5AQLA 1NHUA 1YVNA 1VQ7N 3TWZA 1S99A 3HF5A 3HT0A 3AVHA 1BUPA 4RPFA 1HNWF 5H9FJ 1N6QB 4B17A 1VQOS 2C3UA 3VQSA 1FRMA 3X3UA 5IC6B 3NEKA 1Q8IA 4HUGA 3MXIA 3LL3A 3P6YC 1WBDA 4JS5A 4WKRA 1ACMB 1S7IA 4A8FA 3TNVA 3CSKA 1CULA 1R8BA 3TARA 3QSIA 1HWKA 4AL7A 4YOVA 3CDWA 4KGKA 1XHZA 5K8OA 3NHGA 1NHKL 1HIYA 1RLCL 4IKAA 3CJQA 3BSNA 5HLFA 3AGRA 2HFZA 2E88A 2X3GA 1SC6A 3AVNA 2DNOA 4RW6A 1J5EJ 1NHVA 5DJBA 1Q79A 4EO6A 2FLNA 3SQ4A 4ILJA 5LY3A 1IBMF 2PE8A 4DPUA 2UXDJ 3IFEA 3T3FA 1QUVA 2ZUAA 3T6BA 3IBCB 4NEZA 3AQOA 3M6UA 5ITHA 3JTOA 3CCRN 1ULRA 3N6MA 3SIPB 5IT9O 3PFEA 1O5JA 3TSPA 2ZWPA 4NCAA 5L46A 4LF2A 3LZJA 2O8CA 4C11A 1T44A 4GKKK 4DU7A 4G9ZA 1D9FA 1U2VB 1REVB 3DXSX 3OBIA 5HVGA 5IFMA 4CO5A 1WDTA 2CJYB 4I9LA 2MPUA 2W6KA 4FM2A 1UFLA 4DX5A 3ID6A 4KH4A 2V52B 4FJGA 1LWFA 5AE2A 1FVQA 2E2NA 4QS7A 1DHMA 1JLBB 1GMWD 4IDKB 2BJ1A 1S9GA 3TEGA 4CK3A 2OPRA 3OVAA 2VG7A 5RUBA 4EBCA 2PN6A 5F8LA 3CJKA 2RQMA 4LSLB 5ETMA 3L09A 4RG8A 4ECZA 4CHYA 2MQLA 2KXHA 4ZJOA 2X1GA 5FLXY 2CJAA 2JH3A 2OLWA 1VSMA 2UVRA 4JRPA 2UUBJ 2Z1IA 3MCOA 2IM3A 1RDUA 5E3PA 2R8KA 3TVKA 3FC9A 5DM7Q 2W9CA 2D5RA 2HW3A 1FRXA 5DZ6A 5IT9Y 4WTYA 2ZBIA 5A6PA 1WF1A 4XEIA 1GLJO 4OHYA 3OL9A 2GCFA 4U8YA 1YHQS 4B3OA 3TTCA 4J9PA 5AQZA 4H0OA 3MPWA 1X4CA 3LPTA 2ITMA 1VK3A 3J7A1 2YBVA 1XEZA 4DR2J 3GR1A 4QWAA 8ATCB 4HUEA 4DLGA 4A5BA 2KHDA 4ILHA 3C6TA 3NNHA 5J2QB 4NCGA 4QU7A 4OL8A 2WZ1A 4OGCA 2CQPA 2HAIA 2ZZNA 4FJ8A 2GVZB 4KHPK 2HGLA 4OLOA 4FS2A 1FFGB 1QQOA 5DDQC 4WXOA 1T7PA 2OA8A 1F6TA 4HTLA 2G1DA 2JLFA 4ZOSA 2CGJA 1KCFA 1L3SA 2QL7B 1JXEA 3UDLA 4EZ9A 3GIRA 5KFRA 3NBPA 3M2VB 3G71N 1J5EF 4O44B 3I8BA 1KAZA 2J0XA 3PY8A 4BRPA 3K0JA 2IA0A 2ZOMA 2UXDF 3S41A 4B9NA 2PAVA 2PT0A 3MEDB 3LP0A 4NRTA 2HBZB 4WFBL 4KR0B 4J7CA 1SQKA 5ADXH 3QMLA 1T94A 2I0XA 4JI2K 4Z37A 3WXJA 2VC0A 2W7PA 3K59A 2W2MP 5DLGA 4CH0S 3GIKA 4CNYA 4FWPA 4LREA 1VRQC 5A8WB 4CVNE 3H90A 3DWLA 2DTUA 4ISFA 1DQAA 1VS3A 2NUHA 1VYAA 2D7SA 4NB4A 1DT9A 4B1UB 4ZCLA 4KKOA 4O55A 2DRAA 2IS3A 5JVGL 4N7TA 3NH2A 2B9XA 1FJGK 1PAEX 2ZH7A 4QIWD 3DN9A 2CVIA 1FJCA 4E7LA 4X4UA 3B6PA 3B54A 1X9MA 1CLQA 5L1KA 2PYJA 2DFEA 3NCPA 2QLXA 1T9XA 3M2UB 2A3JA 1WKKA 2XMUA 3BPSP 1RHRB 3BBBA 3QICA 1RWWB 3WIUA 2YHWA 3GR0A 3ZT3A 4I68A 3ITHB 2Z57B 1RWXB 1WACA 2UUBF 1XIQA 4FPBA 4LFBJ 4RCHA 4FLYA 3VAKA 2RRBA 4YOUA 3AA9A 3RR8A 2ZH2A 1U1KA 2ATLA 4PWDA 3NFAA 1JQGA 5DZ7A 3S1TA 4N5SA 3CTRA 3OYMA 4MO4A 1UPPA 5AE1A 4LRCA 3AO4A 4CESA 3H5XA 2KFYA 2XM3A 1TKZA 3KUEA 2V0NA 2V34A 1AZSB 5GAEU 2KHCA 5KG7A 4LF7K 2WONA 1WOOA 3T19A 1FKOA 5F9LA 1RHKB 3QJJA 1Q4RA 2DH7A 1XNQK 4H0YB 4IDHA 4FZVA 4LSNA 3TEHB 2HK3A 1RAFB 4QPXA 2GFFA 1D09B 2OKQA 4CZKA 5L9NA 1S12A 3ZTOA 4LQ3A 1OIAA 2L48A 3TOQA 1Y5IB 2W4CA 3R5CA 3D2FB 4X66F 4JP8A 2R7OA 4BRQA 1FNMA 3UNGC 1PYOB 3NGTA 3T5KA 2AIRB 2YKNB 3MM8B 5EX5A 3PG9A 2OTLS 1HYSB 5E2QA 2OMOA 2O01C 1LQ9A 3IG1B 1U1MA 3BGLA 4GC6A 2VQEF 4FZZA 3OYAA 4FJNA 1FXXA 2FBYA 2P9EA 1FRKA 3VVTA 1CS4A 3IWLA 3CMEN 3ZETA 3AB2B 1PIEA 4PG6A 3DRPB 5C24A 3P4UB 5G0RA 1K0VA 1UW4A 1U47A 4R8UA 3H3OB 1DTQA 3PIOQ 3AAPA 2HBYB 4NEYA 2YKOA 2XZTB 1O1WA 3KNGA 2MQQA 3CCEN 1OY9A 2FSJA 2OSQA 1UVKA 5K20B 2HOEA 3MOZA 3EXYA 2G8VA 1T6DA 5ELZA 3A8EA 1CJVA 1B0PA 1X9WA 1PKUA 1R0CB 1FW6A 1LEOA 3H5SA 4OHWA 4C8YA 3L0QA 4ILMA 1YI2S 1S0NA 2FVPA 3B6OA 5HQLA 1W2BM 1LW2A 4DFMA 4KGXB 2JVRA 4GKKJ 5LJ3Y 4X2BA 1RHJB 3NOCA 4BC7A 4KGMA 1M5VC 3GP9A 4WK3A 3DLLL 4KB0A 5E41A 1IKWA 1TGOA 3RW7A 2OAUA 2CPHA 1LXJA 4FJ7A 1VSFA 1S10A 4ITSA 2YWGA 3F44A 1RSCA 4FL9A 1VHFA 2GX9A 3HPHA 5CYQA 6AT1B 1U6ZA 1X0FA 1BUXA 3GCWP 2IHR1 2HF3A 2DNPA 4DUZK 2HSTA 4DV3K 4MK8A 5DK5A 1TELA 2J6UA 1IBLK 3WX4A 5HLFB 2R7WA 1K44A 1OPZA 4ES1A 4DFJA 4ELUA 4CJUA 1GMUA 5LSRA 4JYAK 2L9WA 4Z4HA 1S9FA 4RW6B 3A8YA 4PABA 3CQ8A 1ITPA 3HCXA 1H98A 2HLTA 4QOTA 3FFIB 2AJ2A 3MMCA 2UXBJ 1KRPA 2IAJB 2RHSB 2RAQA 4BVOA 1RXOB 3M6GA 4RX6A 2UXCK 5JXSA 5F2RA 2NR0A 3ET6B 4H4OA 4DG1A 4ED4A 2YQ1A 3P31A 4C11B 3N6NA 4KHQA 2N82B 1HWIA 1C1BA 1Z6RA 1CJUA 4PEOA 2DO4A 4RUAA 2MQOA 3QGPA 4OX9F 3TP2A 5H9EK 1MWQA 2QXFA 4K4SA 3I5BA 3HZEA 5EWGA 4DSJA 5ETQA 1I5OB 3AHPA 3NGYA 3R8YA 4B3TK 4K8XA 3SJJA 1M5SA 4ATNA 3E01A 1S9GB 2VG7B 1OWXA 4O5BA 5BXIA 1RAAB 3CJKB 1Y7PA 2WK4A 3H2LA 5FLXU 5B0GA 2FVRA 2CPYA 1R89A 3R8EA 1ZM2A 3OT9A 3VCDA 2MQ8A 3R1LA 3VETA 3UD5A 3A1YG 4TYBA 2I5JA 2NXNA 1VBZA 4AHUA 3KXDA 4WP9A 4ZP8A 3TAPA 1YBTA 4P6QA 2IM1A 1GFWB 3GG0A 2DRDA 3HSDA 4JI2J 3ZCMA 4C8LA 3QFPA 5IT9U 1LV5A 2W9CB 1S72N 3ZO7A 2HHTA 3NRBA 2PA8D 3EJMA 3QRRA 2MKHA 3L2RA 2O8BA 4GKKF 4AD6A 2W4DA 1TFYA 1NGBA 2MZ1A 1TZ0A 2Q43A 3TANA 2XLJA 3J81O 4DTJA 1KLMA 1ZZNA 1VRUB 4DFPA 3KD5E 1FJGJ 2NCKL 2V4QA 3BO4A 1SS6A 3CJ1A 1PAUB 4KQZA 4ZP7A 2IYIA 4NCGB 2EKNA 4KHUA 5B0AA 1X5OA 2R7XA 3QNWB 1QQNA 2X74A 3UDCA 1HQUA 5GAHP 5FRMA 1S59A 2NNWA 2B4OA 1VK8A 4FK2A 3NBPB 4BGAA 5ETOA 2QLJB 3OTEA 1NKEA 2ZUGA 1ASWA 3JSBA 2JC1A 3Q8UA 2LEBA 4ZJLA 3TAMB 3VENA 2ZJQQ 1DAXA 1KQGB 3OXLA 1CEZA 4B3MK 3MM6A 1OSDA 2OP5A 1RTZA 3DOKA 2CNLB 2HZCA 1R31A 3R7BB 1ATRA 5E3AA 2BW7A 1RAIB 5DGBA 2MHNA 2KXFA 5AQKA 4LF7J 2XS2A 3NMAA 1TUVA 2VFUA 3MCSA 1S1WA 3VR1A 1XQIA 5KFNA 2IBKA 4RNFA 1XNQJ 4DTNA 1H2VZ 4OYOA 2GVDB 5AZJA 4AHTA 2GHWA 4BC2A 4CZJA 3N5FA 5D77A 2QEXN 1MROA 4KKOB 4KHPF 3KJNB 2HZVA 4PYAA 2EC0A 3KDNA 3LGNA 3TZWA 1NU0A 3KK3A 1E3MA 4OZ3A 3ELHA 2DNQA 1S1UA 2DFHA 2ZBRA 5A0YA 1HYZA 4X4PA 3G4SS 1RHQB 4PAAA 4H0XB 1KWMA 2DXDA 3KLGA 2W41A 2PFUA 4W92B 2WTUA 2ZH1A 1AROP 1NCLA 1VIXA 2ZZTA 5JLHA 3ENWA 5DDRC 2I7NA 2IGIA 1LOUA 3BSCA 3QINA 1BO5O 2XMVA 3E2EA 3MGJA 1FJEB 4ZPCA 4GV3A 3W7BA 3W5YA 1FKPB 3VGSA 5LMUK 3ULDA 3C6HA 2BX6A 3B4DA 3FR0A 1Q1KA 4PWDB 4RWTA 2Z2MA 3TWHA 4QBUA 4IO8A 1LFWA 2LQBA 2YNGA 2CWXA 5AQHA 4EIAA 2DTJA 4FJJA 3ISZA 5EY4A 1U24A 3NMRA 1VC6A 1NGDA 2XGPA 1HBMA 3R7SB 2HQDA 4YY3K 4C0HA 3CETA 2P5GA 2E7WA 1YRXA 4LRDA 2QJ3A 1WC6A 3BH7B 2FJXA 3BQ0A 2CH5A 1WBBA 1M90O 4L8RB 1SKSA 2Q6CA 4PKGA 3LZIA 1FJGF 4AL6A 4RTFD 4JKGA 2A6MA 5EWFA 4M1KA 1X4FA 3CCZA 1VQPS 2GWKA 3CF5L 3ZT2A 5KFKA 4FVMA 1HWLA 2VQFK 1Y97A 1WWHA 2HWHA 3FEXB 3QT6A 1KVAA 3CD5A 4GVEA 5BN9A 4C6AA 2OIHA 1T9TA 4CLKA 4CERA 4BRDA 1YJWS 3M8PB 1HHSA 4FK0A 4DN0A 4CGDA 1YDLA 3TJ9A 4DV3J 3LWLA 3AAWB 3LA0A 1F21A 1CS4B 4R25A 4WF9L 4CF1A 3ZETB 4DUTA 2LECA 4P2XA 2WFBA 1SV5B 2F9WA 4A2AA 5C24B 2E5LF 3F73A 5G0RB 1NBWA 5AR0A 4E2FB 4JYAJ 4R8UB 4FN5A 4NLGA 1FXDA 1K47A 4KE5A 1HKBA 3TX8A 1CC7A 3KWMA 3VQTA 1ELOA 5L1LA 5F1XA 1RABB 4FLZA 3O9UA 9RUBA 2FSKA 4KGVB 3AO2A 3M6XA 1CJVB 1XNQF 1U1OA 4Y1CA 1WSVA 2UXCJ 4MDBA 2UUTA 1M90T 2R7UA 3DRSB 1LW2B 1X4HA 3CFPA 2B51A 2YKAA 4ZIWA 4JI0K 3Q24A 5AQQA 3RRGA 1R6YA 3UI3A 2JEFA 5JMVA 2PI5A 5L1JA 2JOQA 3TW0A 5H9EJ 3FMWA 1FWLA 3FZKA 4RW8A 1FNOA 4B3TJ 1EZZB 3O5BA 3AD8C 2ASLA 5CYQB 2ZGYA 2RJZA 3FEYB 4AL5A 2COLA 2ZHAA 2DISA 1FRHA 4PZVA 3LP1B 2HHPA 5KT7A 1B92A 3POTA 2P9UA 4JI6K 4K8ZA 4PL8A 1YJNS 3GJSB 3M30A 5GVQA 5IT0A 1X4GA 3D54A 4IFVB 2DR7A 4A57A 4DV5K 1WOQA 2PEBA 1J2VA 1M5PC 3MEKA 4C98A 1O51A 3EN9A 1Y11A 2QLBB 4BC5A 3K5LA 5HL7L 5C2DA 1R43A 1WKLA 2ZJRL 1SKWA 2FHMA 1KOOA 3MFIA 5AQUA 2ABYA 4CIFA 3WNEA 1U6FA 4H4MB 4H4OB 3PIPL 4YHHK 1RYSA 4KHNA 1RDCA 3A12A 1Q82O 1RUSA 4K42A 2U1AA 3IGVA 2Q3PA 4IJAA 4CEQA 2WW8A 4IWVA 1Q86O 5KFSA 1WKJA 1WC5A 2G2ZA 3CJ4A 3SFUA 4DF8A 3THWB 3AVLA 1RWMB 3D2WA 1GX6A 4XTTA 4NLRA 1HNVB 2CJ9A 4DUZF 1KSPA 1UVLA 4B1WB 5C15A 5KG6A 1UFWA 4QYRA 1IBLF 1RILA 4I7FA 2BJ9A 4EYHB 4C4WA 4JYAF 2BJ8A 2LMIA 1APSA 3I0RA 3L2WA 2HHWA 3KHYA 1Q0NA 5C0YA 2WSFC 2G0JA 3D45A 2LFVA 1IBKK 4YB6A 1VQ5S 3G0ZA 1GQEA 3SQOP 4B3MJ 4OZJA 2I5JB 4P74A 3BGRB 3PW0A 4A8SA 4OYAA 3VGLA 3OL8A 4I2PA 3TZYA 2UXCF 2NUUG 1WSHA 2OSRA 2VJUA 3AVJA 3Q23A 4FWMA 4X64K 4Y00A 3HD2A 1SQEA 3C19A 2O8BB 2J9CA 1BHNA 5ETTA 3T5HA 1W25A 1VQMS 1FF2A 1SC1B 1Q82T 4M5IA 1J6ZA 4ED8A 1FKAF 1U1PA 1KLMB 1YBAA 2G0IA 5B8HA 2KM8C 4WFYA 4DX7A 1P6TA 1Q86T 4F0MA 4F3QA 5AQWA 1QJHA 5D78A 1C0GA 4ZVPB 3HSGA 5C2GA 1JWWA 3WEEA 3K5MA 1VQON 1JJ2M 3MPYA 3O4WA 1F5AA 3T1HF 4FJMA 3VTIA 1JJHA 5CR4A 4CLTA 2FJAB 1QSSA 3LGHA 2UZAA 3AJ2A 2UU9K 1WHVA 3ISND 2X1BA 1NLKL 3FCHA 1DTTA 4M94A 1SL2A 3P83D 1RTHB 2QTDA 3RVCA 4ED6A 1LCUA 2QMWA 4W98A 4P10A 4A48A 1D4XA 1GLCG 2CQ1A 5E7OB 3SQGA 4X4VA 2B0GA 3EGNA 5IT4A 3MM6B 1T9UA 4K7QA 3SI6A 1WHWA 2BH1A 1ASUA 1FRLA 3LAMA 5F8NA 4YY3J 2BJ3A 1S1WB 5K8NA 2Y0SD 2VFTA 1KS2A 3TO8A 1QVFM 3QFHA 2Z0GA 4J9RA 2C22A 4KBIA 2YHXA 2XI3A 5AZJB 1NPKA 1WN7A 1AT1B 1NJIO 1T03A 3AA2A 1SBRA 3R27A 1JLFA 1E6VA 2CPDA 2YX7A 5IM0B 2XLIA 5KPTA 1MROB 3DGPB 3HPGA 2XZDB 1GLDG 1NNEA 2VQFJ 4CTAA 2CQHA 3TSQA 3KJVA 3T1YK 4Y0FA 2G8IA 3BZQA 1S1UB 2O8DA 4Y2MA 4OX8A 4LF6K 5A0YB 3RYLA 2FHJA 3Q8PB 2ADCA 4X4SA 3TU5A 4PKDB 1K8AO 4WWSA 4I9QA 4WP8A 4ENOA 2YKMA 3BEGB 1ZBTA 1IQZA 1P8ZA 3UKRA 4URSA 4IKFA 4PG8A 2RRNA 2DR9A 3UCUP 2CGLA 4CJ3A 2DNGA 4IFYB 3M1VA 2G8FA 4JUZA 4I6MA 4IFEA 3ENOA 3KD1E 3FQLA 2KW4A 3OHBA 3SBTA 2LU1A 2KFNA 1R59O 2ZHOA 3DRYA 3BR9A 2KG0A 4DQPA 1O8BA 2QKKA 5AQXA 4A61A 4ED3A 4OZ1A 4DI6A 1S6OA 5AFUA 2NS1B 2K8GA 4L74A 2R9LA 4FW1A 1HBMB 4BRCA 4IOAL 2NLWA 1XC3A 2V8VA 2B9WA 4XH5A 4OI0A 5I42A 3M8QA 4JI0J 4RNMA 2N3OA 3M6WA 3QMQA 2DB1A 4FYYB 2CAJA 4JKGB 4QJVA 1MWKA 4IO9L 4L72B 3BN4A 5HO4A 4LFCK 3NH1A 2ZH4A 2G8WA 3AD9C 3JS9A 1F5BA 5KFAA 1GT8A 2JFKA 2CJXB 2LCWA 4NLWA 1H7XA 4M45A 3CD7A 1VSHA 1QSYA 1ZBSA 4N8NA 2O8EB 4DQSA 1HLUA 1T0TV 2UV8A 1K8AT 2D9OA 2NPFA 2OD6A 1TUYA 2XWYA 1CZ9A 3JB9k 1HJRA 1CPZA 3OYJA 4MKVA 3GYNA 2K3KA 3L2QA 4A8MP 3R5DA 3VGKA 5LMUF 3PEHA 3F2KA 3FNNA 1BGXT 3U8XA 1NJZA 3AARA 4OPHA 3DCAA 3SK3A 2BVZA 5GAHU 3M6VA 4LF1A 3P38A 1S4FA 1NSQA 4DX8H 4DV5J 5T41A 3CW2C 4UOFA 4RU9A 4M41A 4BRIA 2IA6A 4YY3F 3D0HE 2GAHC 1QQCA 1X3NA 1FDBA 2A40A 3L4BC 4M7XA 1XR5A 3ZT4A 2WCXA 4Y34A 2F4VK 2V8GA 3S7RA 3IUCA 1VC5A 3VGVA 4U7BA 2C3MA 2HS4A 2VOOA 3MD1A 4DCPB 1WF2A 2GHVC 2XMAA 3QEXA 2ZKUA 4O23A 3RBZA 2Z1GA 2Z4PA 3RZAA 1VCTA 4Q8FA 2E5JA 2XHBA 1M1GA 1LFPA 5HROB 4E1NA 4O3NA 2V4JB 4RW8B 3BP8A 2WVFA 4DQ8A 2GMJA 4F4YA 3QNNA 4C8MA 2AYBA 3FUYA 3MXMA 5H1SQ 3CM5A 1H2UX 2CADA 2GNKA 2QYCA 2OO4A 4CFCA 1WELA 3EY1A 3OYNA 4LR7A 2FXUA 1C1CA 1KTVA 1X7VA 4DJBA 1IBKJ 3POTB 4CZHA 3KK2A 4DQQA 4FBUA 3WNFA 1V5VA 3HVAA 4DTSA 4N41A 1HNXK 4JI3J 2IMOA 2FSNA 2EK1A 2EC2A 2O1PA 1VQ9S 4JKAA 2V6AA 3M30B 3RWUA 1XC9A 3QESA 1N5TA 1RFQA 2O4IA 4NE9C 3T6JA 1I51B 3QWUA 4Q43A 4NZ7A 2P9NA 3DNCA 2OZSA 1P1TA 4JI0F 1YGYA 3DOLA 2C3OA 1MU2A 2PMHA 2AU0A 1HD1A 3TRGA 2NRHA 4LF5K 2F9JA 3I5CA 2MKKA 4U8VA 1NK5A 4FZYA 4LY7A 4DR5F 3IN5A 4JV2A 1JLCA 1Y3JA 4LRAA 3ENAA 1KVIA 3A4TA 1K9MO 4OYXA 4CWBA 4URQU 3ZTPA 2KM8B 3DMJA 4NLQA 3TSUA 2Q1LA 4H03B 4YR0A 4ECYA 1UP1A 1L3KA 3NCIA 1NMNA 3UE5A 4ZVHA 2J9EA 1DY3A 3A3NB 4PXEA 4NLPA 2CJBA 1FD2A 2UU9J 4PXBA 3A8IA 2OTLN 4JI6F 2ASMA 4FWLA 3CJ8A 5C25A 4DSIA 5CAAA 3I0RB 3OYCA 1ZBIA 3K5NA 4M5MA 1RA7A 4HUFA 2D3ZA 2V63A 1RWUA 4DV5F 2RNEA 1C0MA 3E8OA 4U7UK 3MAHA 5LXYA 4O0IA 1X3MA 4RBTA 1XMQK 4JBCA 2YWKA 1HI0P 1MDUB 1N36K 4I2PB 2HIQA 3SV3A 5JICA 5EU7A 3LP2A 4IJNA 2MXYA 2HNDB 3OR2B 3HP6A 1B7FA 1UJ5A 1ZBLA 4YHHF 3MWPA 1OH8A 4JKDA 2VKRA 3VGTA 4J9SA 4CHOA 5L39A 1SCJB 4IXCA 3OFHA 2J4RA 1WG5A 1BDGA 1WG1A 3CMQA 1T3VA 3M8ZA 1K9MT 4K0KK 2IVOA 4EBEA 1VMBA 3OXFA 5CZXA 3T1YJ 3VEWA 3GFHA 4BCAA 4LF6J 3N5BA 4X4OA 1FTRA 1RTIA 1FFWB 2VIHA 4RW7A 3QT7A 3WEEB 4OLAA 2Y0BB 3QB0A 3WNGA 1NDCA 3SCKE 2PYLA 1N56A 5LJ5Y 3ALYA 4BREA 2ZM6K 2BM0A 1OSCA 3GG1A 5HVFA 5BYSA 1IBKF 5D4OA 2JLGA 1F9HA 3BBFA 1DTTB 1XN9A 1SIWB 2PSZA 3US5A 3TAQA 5C2CA 1NK9A 2VODA 5GAGP 2DEIA 2KZMA 1NBEB 3HZ6A 3M8WA 1SVDA 2GJIA 1G1XA 2K7KA 2YNIB 3SQGB 5KFFA 4RUBA 5CYMA 4X64F 3HZGA 3QT5A 1RE1B 3VGMA 4ICLA 2E66A 1SJQA 3PW4A 2DPIA 3BYPA 2D3UA 5IC4B 1H2TZ 3IFRA 1BCOA 3K58A 3FSXA 3H2UB 2XCPA 3DOMA 3FZ2A 4OYIA 4MYTA 1ZA2B 4EP5A 1VSKA 4LFCJ 2KT5A 4PPZA 2D0OA 1IKYB 2GWJA 4E7KA 4NYNA 4ZMMA 4GO7X 4CTAB 4CI6A 4LJMA 4NWBA 3KJVB 5DLFA 3DXKA 3PKYA 2O8DB 2J9DA 4IO1A 2UU9F 2ZQBA 2FDNA 2WB4A 4Z7YA 1TAUA 3HPOA 4PUOA 2WBNA 3O44A 4NZ0A 3ZZOA 3MR3A 5AXNA 3UKRB 4KRWA 3SXLA 1KEKA 4K5SA 4KH6A 4BRGA 3KZBA 4YDUA 5HRSA 2RQ4A 4I6MB 1XMOK 2GV1A 4KB1A 4LFAK 2VG6A 5GADI 2HAFA 3MMAA 2X7IA 5EGYA 5KFCA 3TABA 4J91A 1NKCA 1HBUA 3SSSA 2QI2A 4GVBA 1RT1B 2VBWA 1GMWA 3AOBA 5BN8A 1I3OB 3PM9A 5C12A 2CJKA 1YJ7A 2F4VJ 4DCJB 5K8PA 1HKAA 3CJBA 1YZ7A 5D0HA 2CQ0A 5I42B 2BV3A 3M8QB 1U2FA 2W7AA 4CLYA 3KJQB 4DTOA 1IBCB 4LF6F 1A7GE 4W90B 1TP7A 1FRIA 2CUYA 4FO0A 1FDAA 1PGZA 4Q2MA 1HUXA 1WORA 1RBOB 2ROGA 2VASA 1FVSA 2AHOB 3MEGA 2AYEA 2CIMA 3V4MA 3MTKA 1NK7A 4IRKA 2Q0RA 4Z94A 4CBXA 3FVYA 3PV8A 3JYTA 2CQ2A 3RAMA 3R1XA 2RVJA 4YNQA 1TU0B 4JB8B 2YI1A 3MCMA 3MXHP 1U6BA 5HMWA 1MNEA 3EM1A 2OFHX 3KTQA 1TKXA 2ZKTA 3IS9A 3AY0A 1HNXJ 4E1MA 4TXSA 3T9NA 3T7ZA 3H7HB 4KH0B 4MJKA 1Q78A 3W8PA 3O3LA 4AQYK 2ZJPQ 2GS8A 5KFEA 4FJ5A 5KPRA 1CC8A 1HPZB 1MWZA 2B4PA 1KAYA 3Q8QB 1VIOA 2HEKA 2HFNA 5D0GA 1C2PA 4Y1DA 4KSEB 4K41A 1HARA 2VFVA 3CEDA 3HSZA 4DPWA 1RP5A 2Q1NA 4H5TA 3I5AA 3NH0A 1XNRK 2W6LA 4CK2A 2Z2YB 2HFSA 1SI9A 2LLZA 4CH1A 4LFCF 1SC4B 8RUCA 4ZTFA 2JLEA 3QT8A 3AV9A 4TU7A 3R6LB 2K1RB 1PC4A 2R7SA 5K5MA 3PW5A 3R3LA 3DI6A 5ETLA 2IM2A 1AFJA 2BRLA 1EJ7L 3D7SB 1RCHA 3Q86A 3HJFA 3GSDA 3O9RA 3ZSQA 4KAIA 4IH6A 1ESVA 4U6PA 1GLEG 3C8YA 2D0CA 4CJSA 4KI4A 1HPMA 1BISA 2WC9A 2EG2A 3GJRB 4K25A 2BACA 1TK5A 3W9HA 2DGQA 3ZX3A 2YH0A 2IJRA 1C1AA 2XHCA 4CGGA 4DXLA 2J8AA 2KYXA 3CB4A 4O0JA 4Z4IA 5J1NA 3OHAA 2OD4A 1ZBFA 3G4SN 1XBWA 1T6CA 5FPDA 3F9MA 4DCHA 2NQPA 1C1CB 1IO2A 3FBEA 2C2EA 1EAYC 3Q8RB 4CHQA 5BPMA 1EQYA 3KK2B 2X1FA 1XMQJ 3TVYA 1G15A 4DR7F 1F2GA 5HMYA 2O66A 5LJVA 1UOCA 3DYAA 4K4UA 1CSJA 3CNQP 2EKYA