4WE1A

Crystal structure of hiv-1 reverse transcriptase in complex with 5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)-2-naphthonitrile (jlj600)
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
547
structure length
542
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Picomolar Inhibitors of HIV-1 Reverse Transcriptase: Design and Crystallography of Naphthyl Phenyl Ethers.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Hydrolase
molecule keywords Gag-Pol polyprotein
total genus 140
structure length 542
sequence length 547
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4we1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4we1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4we1A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4we1A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4we1A05
2HNDA 1L3SA 1WAJA 5K14A 1CZBA 4ECYA 4BACA 1S1WB 5KFMA 5DLFA 3ZSVA 1BQNB 1NOYA 2ILYA 1BCOA 4DU3A 4DTOA 3D5MA 3BSAA 5CZ1A 2A1RA 3SCXA 3AA5X 4Y2CA 3OL8A 4F4WA 3TI0A 4Q44A 3Q8RB 3M8QB 3KNAA 4HUFA 1NJZA 5FDLB 5KFVA 3PW4A 3VQAA 4G1QA 5J1EA 4OGEA 1IKXA 1RT7A 4TYBA 4CK1A 3S3MA 5KFTA 1HQEB 4X2BA 4RNFA 1WN7A 1X9SA 3U6FA 3LWMA 3O3FA 1EKEA 2YKMA 3M8PB 4AHUA 4JV1A 4CJRA 4LQ9A 1QSYA 5KFQA 3FFIA 1D5AA 4FJNA 5KT7A 3O3GA 1GOBA 1A5WA 4B9TA 4J9LA 5KG6A 4ELVA 3AO1A 4PQUB 3F9KA 1UA1A 4U6PA 1HARA 3LP0A 1YVFA 1RT3B 4MFBB 4UQGA 4KTZA 1T05B 3ULDA 4WE1B 1T3NA 3BR9A 4CEQA 2OPRA 3ASMA 3ZSZA 4R5PA 1TVRB 2XY8A 3MXJA 3ZSRA 5SZTA 5FDLA 1T03B 1CXUA 3I0SA 2KZZA 2FVCA 1GX5A 5JXSA 4O4RA 4LD0A 4CESA 4WYLA 3OYBA 5KFLA 2BANA 3DLKB 4AHCA 3VQSA 3PO4A 2YKNB 3KK1B 3NMAA 3PHEA 1HNVB 3HVTB 4QWAA 1RT5A 3OHBA 4O3SA 2VG7A 3SJJA 4Z4GA 2R8GA 1EP4A 1NHVA 2AQ4A 4ZPCA 5CYMA 4JRQA 5C24B 3LPUA 3HO1A 1HPZA 3AO2A 3IG1A 3KLFB 4W5OA 1S5JA 4XIUA 1NJWA 4NLSA 3K5LA 2HW3A 5KFKA 1S10A 5CYQB 5DQHA 2XC9A 4CHNA 1RT6A 4ED7A 4B3OA 1WSGA 3M9NB 5J2MB 4Y2AA 3T19A 2EHGA 3SPYA 1U48A 4HCCA 2P5OA 2HAIA 1NOZA 3NAHA 4DLEA 4CGHA 2R8JA 5C42A 2C22A 5L9XA 1EETA 2AGQA 2ZD1A 1YT3A 4BWJA 1JLGB 4CFCA 2JEFA 3V1RA 5CYMB 5E41A 1SKSA 3HVTA 1S1TA 1S1VB 3OLBA 2KTQA 4O4GB 5KFNA 3SQ4A 3NGZA 4EBEA 1QE1A 1S48A 3M8RA 4ZVGA 2R8HA 3DLKA 3DI6B 2XGPA 3ITHB 4OGCA 2G8UA 3MAQA 3B6PA 3SNNA 2D7SA 4CJSA 3QEIA 4FZXC 1XI1A 3RMCA 5KTQA 3P5JA 2RF2B 1DTQA 1KHVA 4ICLA 3HSTB 3QERA 4FJJA 4WFXA 4CEDA 3PR5B 1FXXA 1T05A 2B6AA 1S97A 2YNIA 4F4YA 4KRFA 2UVVA 3S3OA 4DQRA 2IOCA 3MEGA 3TVKA 1C0MA 2FLPA 4DWIA 1DLOA 4Q8FA 4IDKB 4GW6A 1FKPA 4N76A 3KK2B 1U04A 2B6AB 2YV0X 4Z4IA 3NGDA 3FDSA 4JS4A 1T8EA 3KHRA 4RZRA 4DSFA 4ICLB 1HQEA 3HVRA 1LW0B 4B9NA 2IDOA 3SI6A 3I5CA 1XC9A 3HK2A 4M94A 4MK7A 4W5RA 2JC1A 3JYTA 3IN5A 2EX3A 1ZBHA 1KLMB 1HMVB 2RPIA 3OYJA 3AVIA 2OPPA 3OYFA 2PY5A 1NNDA 1BI4A 3QO9B 3KKSA 3BQ2A 3I0RB 3CJ3A 5F8HA 3LAKA 1C1BA 1S1WA 1CSJA 1SH3A 2FJXA 3VQQA 1L3VA 4B8CA 3QGGA 4ID5B 1Z26A 1K6YA 4EBCA 5J2NB 1FKPB 2VA2A 3OYAA 4IDKA 4E19A 4MIAA 1KRPA 4FM0A 3KLHB 1HMVA 1C1CB 1WNSA 2VG6B 4XPCA 3NF7A 3MEGB 1U47A 4ELTA 1D9DA 3H5YA 2PYJA 2XY7A 4YFUA 2YNFB 4RNNA 2W9CB 3NF6A 1Z25A 2IM0A 5CYQA 4IRCA 1S6QB 3C6UB 3LPTA 4DTUA 1VSLA 4NLYA 1L3TA 5C24A 1JXBA 1LWEA 1RDBA 3AA3A 3F73A 3L8BA 2XI3A 1CLQA 4FJXA 3H5UA 1HYSA 4AHSA 1IH7A 4LSLB 4HUGA 4WXWA 1QE1B 4NLGA 4RNMA 3KMSA 1K1QA 4Z4CA 1A5VA 1S6PB 4O4GA 2B43A 1B92A 4O55A 3AVKA 4OVLA 2YHAA 5C25A 3PUFA 1TK8A 3H5XA 2W42A 3MECA 3OYMA 4TSXA 4I9QA 3KK3B 1BIUA 4CF8A 1JLAA 4E7JA 4DQIA 3VA0A 1QS4A 4DL4A 2KW4A 3QYYA 2B4JA 4KSEB 4I7FB 5EU7A 3MECB 3RB6A 4YQWA 4MFBA 1SH0A 4PUOB 4GC7A 1D0EA 3OS0A 3K5MA 4LSLA 3MEDB 1WSJA 4ECVA 1KSPA 3NF8A 3ZT0A 4BWMA 3FQKA 2HHVA 4O5BA 1S1UB 4CGGA 4WFZA 3DLHA 3H08A 1TKZB 1RA6A 4J2EA 3MR6A 1RAJA 3H2LA 1S6QA 1ZTWA 3SPZA 1VSKA 3QO9A 1YTAA 5J2PB 3U3GA 2WONB 4E3SA 1FKOA 4DTPA 4IH7A 4CF0A 1XR5A 3TAQA 2R2UA 1S9EA 2R2RA 3QZ7A 3K57A 4J9KA 5KT4A 2IS3A 1S4FA 3VQ9A 1WNEA 3OYCA 4EO6A 5KFPA 2G8VA 1U4BA 4ZTFA 1HPZB 3K5OA 3L2WA 1LW0A 4DSKA 2BQUA 4CERA 4FS2A 2IC3B 4J2AA 1MU2A 3RB0A 1ZBIA 2VG7B 1ASWA 2D41A 2W7OA 5SWMA 3EZUA 3QLHB 3LP0B 5KG5A 3AVBA 3KK1A 4CHZA 4TQSA 3IRXB 1HJRA 1LV5A 5KFXA 3PX4A 5F8GA 3N6NA 2AX1A 4R8UA 3RBEA 4KI6A 2VWJA 4RUAA 2F8SA 3DM2B 2BE2B 3H59A 1TVRA 1LWCB 4KO0B 3GIIA 4CE9A 1NHUA 4HCBA 1IKWA 2D0CA 1G15A 3MTKA 5KGXA 4HTUA 2OPQA 2E9RX 4G1QB 3CJ2A 1YTUA 2AGOA 3T5KA 1N56A 1S1XA 4B9MA 4F3OA 5KGWA 1VRUA 3CDUA 4IRKA 1VSEA 4M42A 1C0TB 3ITHA 1WSHA 3QINA 3KD1E 1XR6A 4DF8A 2G8IA 3IRXA 5KFCA 2J6TA 2E4LA 5F9LA 2GIQA 3ZT2A 3QLHA 1DTTB 3MEEA 2G8HA 4O3QA 1YVUA 4DTRA 2YNIB 3VQ8A 3QGIA 2ALZA 1BL3A 2ITGA 3C6TA 5HRNA 4NYNA 1BGXT 2HWIA 5J1EB 1DTQB 4IBNA 2O4GA 3V9ZA 1VSIA 2IA6A 1TAUA 4OLBA 1VSDA 2D0BA 3DLGB 4NCGB 3PW0A 2GV9A 4K50A 1Z4UA 3KLGA 3GIMA 4RW7B 4FJLA 2X6NA 4B8AB 4DQSA 3IGNA 5I3UA 3VQEA 4KFBA 1CZ9A 3DLRA 2IAJB 4O3OA 3WNHA 5JS1A 4DFJA 2V0NA 3HL8A 4CEBA 5KFYA 4NLWA 3U3YA 2HNDB 2BDPA 3SUQA 4RW6A 1RT5B 2LSNA 1SUQB 1HNVA 4AILC 1B9DA 3HPOA 5D3GA 3T1AA 3G86A 2R2SA 3GIKA 1S0OA 1EX4A 4OKJA 4DFKA 1JL1A 4HUEA 4ZHRA 1T7PA 3OYLA 3DLGA 3ZSQA 3QIOA 3MFIA 3PW5A 1RYSA 2IM3A 3VQCA 2JEGA 1RTDA 1JLFA 3CVKA 4Q0BA 2XCPA 1NJXA 3SFUA 2GIRA 4H8KA 4KI4A 4DTXA 3QESA 4WFYA 1N48A 1RT3A 3DMJA 4CJPA 2BGGA 4TY8A 3AVHA 3Q8QB 3DRSA 4QWCA 2DFFA 5HBMB 2FVRA 1JLEB 2QKBA 5J2QA 3V81B 1ZYQA 1TKXA 1IG9A 1LWEB 4FW2A 5I42A 1LAVA 4Q5VA 1Q9XA 4FYDA 4CFBA 4DTJA 3LP2A 3VQ6A 1IKVB 4KHNA 2IAJA 1QTMA 4AH9A 4CJ4A 4DTNA 4IFVB 2YNFA 5HP1B 3OL9A 3HPHA 3JSMA 3HT3A 2XY6A 3WNGA 4CIGA 5F8LA 1C1CA 3EPGA 4R8UB 4Z4EA 4CIEA 4LSNB 4LY7A 4DSIA 3KLIB 2PYLA 1S9GB 3C95A 1IKYA 4NLVA 4ID5A 5KFHA 2O4IA 4ZP7A 1FK9B 3DOKA 3DRRB 3ICLA 5F8JA 4CHPA 3CWJA 3KHGA 1W9HA 3RMAA 3LWLA 1BI4B 3NDKA 1NK9A 1TKTB 1RBTA 1TKDA 4CFAA 2E6MA 3T5JA 4C8OA 1O1WA 4M3RA 4F50A 4KREA 3CFPA 2UUWA 3CQ8A 4ECWA 3RAXA 4U7CA 3NAIA 4G3IA 2FBTA 3JYTB 1VSHA 4RW9A 4H4MA 4PWDA 5KG1A 3AVFA 4E1NA 1VK0A 4CJLA 1F21A 4FLXA 4NYFA 5KFGA 3QNOA 5KG7A 3PW2A 5HRSA 1KVCA 1BQNA 1N4LA 3CO9A 3V1QA 1NK8A 1I6JA 1KTQA 4C8NA 4M41A 3L2VA 1NJYA 4KKOA 4ED8A 3V4IA 5J2QB 3V81A 4CJFA 1QSSA 1I39A 4QW9A 3IAYA 3AVLA 3CFRA 3KLEA 3AVJA 2BR0A 2YHBA 4CGFA 1RT4A 3DMJB 2ASDA 4WXOA 5KRTA 3UDLA 1RDCA 3OSNA 1X1PA 4N5SA 2HNYB 3AVNA 1SKWA 4K8ZA 2IM2A 4J2BA 4OLAA 3AO4A 3QNNA 4MIBA 2I1RA 1VRTA 1C6VA 4K4ZA 1Q8IA 2GC8A 1XHXA 3AO3A 1CXQA 3GIJA 1RTJB 3QEXA 3GILA 2WONA 3TAPA 2F8TA 1HYSB 4R0EA 3TAMA 1NKCA 4FLZA 3M9OB 5HLFA 4AHVA 4CHYA 4IQXA 4C8LA 4WZMA 1C1AA 4B9SA 3QEPA 3LP3A 2O5DA 5JS2A 4IG3B 1SL1A 3QZ8A 3G6VA 3IS9A 2W9CA 3NBPB 4Z4HA 4DQQA 4ZVEA 5I3UB 3CM5A 2GUIA 2VG6A 3OYHA 3B6OA 3I8DA 3TANA 4KHQA 1I3AA 4FLVA 4PA1A 4DL6A 1QUVA 4Q45A 4FJHA 4DL3A 5J2NA 2B5JA 4OJRA 4H4OA 4AHRA 3PR4A 3VA3A 3NH0A 4OPJA 4M3UA 2BQRA 1EP4B 4W5NA 2OH2A 4NLRA 3C6TB 2J6SA 1TV6A 2QK9A 4MQ3A 3V9WA 3I0RA 5L1IA 1SL0A 3QIPA 5KFAA 2IJFA 4IFYA 1RBSA 2IGIA 2YNHA 2XO7A 4QAGA 1VSJA 5L1LA 1KLMA 1KHWA 1SH2A 4HHTA 3DYAA 2BRKA 3OJSA 1IO2A 5FROA 1RBUA 3VQDA 3SV4A 4F2SA 3D45A 3RB3A 3G0ZA 1TAQA 4CJUA 3GV5B 2JLEA 3L3UA 4CJKA 4K4YA 1JXEA 3AO5A 3DDKA 3WNFA 4I2PB 3BDPA 3HHKA 1RT1B 1TL1A 3V9UA 1RILA 2XHBA 4CGDA 2RDJA 3S3NA 1C2PA 4CJ5A 4FK2A 5KG2A 1HNIB 4EYIB 1DLOB 3KLHA 2IBKA 1GOAA 2YNHB 3V6KA 3S9HA 1N5YA 3TR8A 1REVA 3QIPB 4CJ3A 2VG5A 1XR7A 4KKOB 2WCXA 1WSFA 4M3TA 3MXMA 3BQ1A 3NH2A 2QXFA 1TK0A 5KFFA 2D0AA 4FXDA 4FJKA 5KFRA 3UIQA 3D28A 4CJTA 1C1BB 3NHGA 4E0DA 4NRTA 2KFNA 1ZTTA 4EZ6A 1RDRA 4I9LA 4DG1A 4PWDB 4YR2A 1JLBB 4IG0B 2KFZA 3UR0A 1HQUB 3PO5A 4E89A 2DPIA 1SV5A 1BQMB 1U49A 5KFZA 5KFJA 1SV5B 4ZP8A 4O3NA 4ED1A 4CF9A 4ZMMA 1MMLA 4F4ZA 3WNEA 4IKFA 4ED3A 1QQCA 2RKIA 3V9XA 4NLTA 3IS9B 4DL7A 1XHZA 1IKVA 4DL2A 3A2FA 4QW8A 3LP2B 1B9FA 1S1TB 5DG7A 2FJWA 4FJIA 3BSCA 1TKXB 4NZ0A 1RTHA 1ZBLA 3KK2A 2I5JB 3LP1A 4CHQA 4HKQA 5HLFB 3H98A 4XO0A 3RBDA 1J5OB 1S1UA 2WRMA 3PX6A 4DQPA 4MH8A 2XGQA 4JRPA 1T94A 1EXQA 1N6QA 3OL6A 3OYKA 3PVXA 3QEVA 2NUBA 4DU4A 4B9VA 5KFUA 4KHUA 4KB1A 4J9PA 4K8XA 1TK5A 2E6LA 4O44B 2ZKUA 1JKHB 3PJWA 4RU9A 4DLGA 1R0AA 3HP9A 3E51A 5EWGA 3HP6A 1ZBUA 1Q9YA 3ZSYA 2G8KA 3BJYA 3HM9A 1UAXA 2XRIA 3VQBA 4URQU 3KLFA 1W0HA 5FRMA 5F8IA 4URGA 3CG7A 2X74A 1TQLA 3M8SA 3VQ4A 4MK9A 3VQ5A 4ZHRB 5FRNA 1XWLA 3T5LA 1K1SA 4FM1A 4DS4A 4ZPAA 2IM1A 3DI6A 3E01B 1NKBA 2WK4A 5DLGA 3V6HA 2ILZA 4FZYA 1RTJA 4IFYB 3SQ2A 4ZP9A 4CHOA 4DSLA 2ATQA 3K2PA 5C5JA 4H54A 1JIHA 2Z1HA 4IOBA 2BRLA 3AV9A 4F3TA 1W25A 3MF5A 2XCAA 1SKRA 2OYQA 1NK0A 5KFBA 3TAFA 2P5GA 1QAIA 2C2RA 1JLFB 1GX6A 3HYFA 1ZETA 3EPIA 1RDDA 2D3ZA 1QSLA 2D3UA 4CEAA 3SYZA 4IR1A 2RN2A 4YP3A 2V4QA 3O4QA 3H4BA 2OPSA 1JL2A 1RA7A 3NE6A 1C0UB 4BDPA 5KFDA 2IMWP 2D5RA 2PZSA 3OY9A 2JGUA 4FJ9A 4QCLA 2XWYA 1BHLA 4J9SA 1SUQA 1N6QB 1J5OA 3TAEA 4O0JA 2Y1IA 5KFOA 3M8PA 4JV0A 4RW8B 3QIDA 3OYDA 2YNGA 1TL3A 3SUOA 4JLHA 4ZVHA 3BSNA 3LZJA 3P83D 2HMIA 2C28A 4KHYA 3KLIA 4AHTA 2RKIB 4M3WA 2OPPB 3DLEB 4EZ9A 3TAGA 1ASVA 4RG8A 2G8FA 2XI2A 4FBTA 2DY4A 4NCGA 1BQMA 5F9NA 4QWEA 3LALA 4ED6A 1T03A 1RT2A 3SQ1A 5T14A 4IFVA 4KB0A 2OPQB 4CF2A 3KHLA 3NCIA 4JV2A 1LWFA 2CJQA 4DMNA 4Z4FA 5KFIA 3AVMA 3DM2A 2DTUA 4K4TA 4FK4A 2V4RA 3SQ0A 4YNQA 5HBMA 3L2QA 4E1MA 2VG5B 4WZQA 3VQPA 1RTIA 2FVQA 4F4KA 3KLEB 2HHQA 3L2UA 3FSIA 1HNIA 3O4NA 5HRPA 2HHTA 4BDZA 1BISA 3VN5A 5KG4A 4KTQA 1TL1B 3K5NA 2YKMB 4BE0A 4C8KA 4O3RA 3HJFA 5KFEA 4OL8A 4DFPA 4ELUA 1RT1A 5DMRA 3SZ2A 1BCMA 1RTDB 3NFAA 4DEZA 4CFDA 2WHOA 4FLUA 2C2EA 4DF4A 3AA2A 3FQLA 1RYRA 1UWBB 3G6XA 4ID1A 3KHHA 4WYWA 4FS1A 4FCYA 3OYGA 1LAWA 2W8KA 3SI8A 3BREA 4ZPDA 1RTIB 3TQ1A 5KT2A 2W8LA 3TABA 2HMIB 4CIFA 4IH5A 4KHSA 4CK2A 4NCAA 2ASJA 4EP4A 1S1VA 3HKWA 5F8MA 4M95A 1J54A 2F96A 3BSOA 5K14B 4ED0A 4NLPA 4ECRA 4TLRA 5HRRA 1R0AB 5KT6A 4CCHA 3ZSXA 3RRHA 4LSNA 4J9RA 2P1JA 2OPSB 5J2MA 5D3GB 4OPKA 4IG3A 3ISND 3HPGA 4RUCA 3NF9A 4IH6A 3K59A 2R7YA 2AGPA 5CZ2A 4KV8A 1RTHB 4CK3A 1Y97A 3SUPA 4M3ZA 4N41A 4OKKA 3V6DB 1UA0A 2X6SA 5KI6A 3V1OA 4NLOA 2W7PA 4YR3A 3Q8PB 5T7BA 1D1UA 4E7KA 3RTVA 2ZE2B 3E01A 4NLDA 1VRTB 3RAQA 3BGRA 5DG8A 4TYAA 4OKEA 3DOLA 5EWEA 4MKAA 3EY1A 1S1XB 5L1JA 4ZTJA 4KBIA 3NAEA 3DLBA 3QEWA 3KJVA 4KHRA 2HNZA 2AU0A 4FLWA 1D8YA 4WE1A 3N6LA 2ZQBA 1LWCA 4KO0A 4RW4B 1KCFA 3I5AA 3OYIA 1JKHA 3GQCA 3MR5A 3TARA 5L1KA 4CJWA 2KQ2A 3KD5E 4LH5A 4DTSA 2W9AA 4TXSA 2DFEA 3V4IB 2HWHA 3FFIB 4E7HA 1UWBA 5DG9A 2C2DA 1TP7A 3G6YA 2IC3A 3NGYA 4TN2A 2EC0A 5KRSA 4J9MA 3KLVA 4ECSA 1S9FA 4O44A 3SV3A 3ZT1A 3SUNA 5KFSA 3VQ7A 3DYAB 1ASUA 4H4MB 2DPJA 3LZIA 2QV6A 4PY5A 3C94A 4JS5A 1HQUA 4IKAA 4K4SA 4DG1B 5J2PA 3GV8B 3PV8A 1WSEA 2I5JA 3M9MB 2V9WA 3PW7A 1TL3B 2YNGB 1KLNA 3ISNC 2ETJA 1VSMA 1LWFB 2HHSA 4ECZA 4DFMA 2JEIA 3DRRA 4QWBA 4ECUA 1LW2B 3ZCMA 1S9GA 2WB4A 5DQIA 3RB4A 1REVB 4Z0UA 3ZSWA 4EEYA 1RT2B 4EO8A 3ZT3A 3DLEA 5HP1A 4DL5A 3D0PA 3T3FA 2OA8A 2FBVA 1VRUB 3NL0A 1NK6A 1L3UA 1NK5A 2FVPA 2F8EX 1WLJA 2R8KA 4I2PA 3KTQA 4I7FA 2UVUA 3RMBA 2HHWA 3EYZA 4F2RA 3CJ0A 4QWDA 1IKWB 2WTFA 2W9BB 4DU1A 2IJNA 4FLYA 2BE2A 1JLQB 5KT3A 3RR7A 3DRSB 2FLNA 4O0IA 1JLCB 3TWHA 4MKBA 4J9NA 4ZVFA 2FVSA 4RW4A 4O3PA 3MR2A 1S0NA 3HXMA 2A1SA 2HNZB 4IR9A 4Q0BB 3EZ5A 3DRPB 3KMQA 4GMJB 3CJ4A 4FJGA 3AVAA 1X9MA 2RF2A 4EBDA 2ATLA 3V9SA 4K4VA 1RDAA 3MXIA 4C8MA 3DOLB 3PJXA 4URSA 4I2QA 3N6MA 3KOAA 4IRDA 5KT5A 4F8RA 2HVIA 2ZE2A 4BDYA 3UQSA 1JLCA 5DQGA 3BQ0A 4FJ5A 3NBPA 4ZP6A 4RW6B 2R2TA 3P1GA 4Y34A 5KG3A 3OLAA 3OVNA 3IG1B 1TGOA 1J53A 4N47A 2W9BA 4KV8B 4CEZA 4FJ7A 2E9ZA 4H4OB 1BIZA 5DK5A 4F4XA 4JUZA 5DGBA 1S0MA 4FZZA 3THVA 3PY8A 3CDEA 3UPFA 4RNOA 2DFHA 4RW7A 3AVCA 2BANB 2JEJA 4FM2A 2HVHA 1NKEA 3PX0A 1NK7A 1RT6B 3NKYA 4KTWA 3KLGB 2ASLA 2BQ3A 4I2QB 3KIOA 1JLBA 4IG0A 4ECQA 4FVMA 1JLAB 3LP1B 3KK3A 3ALYA 1KVAA 3CFOA 4ECXA 2WOMB 4CEEA 3MEEB 3AVGA 3TAMB 4M3XA 3K58A 1SL2A 1HYZA 4PQUA 1DTTA 3IGVA 4NLXA 5EUHA 4NCBA 5KFWA 1HRHA 1WAFA 1C0TA 3JSMB 1JLQA 2VA3A 3V6JA 4YMEA 5CY4A 4M3YA 2E9TA 2OPRB 2HNYA 4KAIA 2QE5A 2Z1GA 3HVWA 1JX4A 5I42B 2Z1JA 2P51A 4CEFA 4N56A 1JLEA 1GOCA 3SFGA 2FJVA 4QOZB 4HVJA 3OS1A 2Z1IA 4E7LA 3I5BA 4CEOA 4M45A 4FJMA 1N5YB 3OHAA 4CJQA 4B08A 4K4XA 1S49A 1A5XA 1X9WA 3CM6A 1RCHA 4HYKA 1TKTA 1KFSA 4FJ8A 4BE1A 1LW2A 1QAJA 2Y1JA 4ECTA 4YR0A 4Q8EA 4E7IA 1TV6B 2WOMA 4EP5A 5EDWA 4DSJA 3H5SA 3MFHA 2VWKA 1MU2B 3OJUA 5KG0A 3DOKB 1RBVA 1IKXB 1RT7B 2UVRA 2CKWA 4FK0A 3KJVB 2HHXA 4ED2A 4NLQA 4W5TA 4LQ3A 1U09A 1IKYB 5C42B 1D9FA 3GV7B 3H4DA 3NH1A 2UUTA 4L8RB 1IM4A 4CGJA 1S9EB 3CYMA 4NLUA 1L5UA 3CJ5A 3Q8SB 2UVWA 1J9AA 1FKOB 2G8WA 1HYVA 3L3VA 3G10A 3OYNA 3QETA 3OS2A 3MR3A 1KVBA 4J2DA 2FBYA 2HB5A 4KHWA 2FBXA 4ZPBA 4CECA 2HHUA 1TKZA 2QKKA 4Q43A 2OZMA 4RW8A 4Y1CA 4KE5A 1FK9A 1JLGA 2AWZA 5F8NA 3O3HA 4K4UA 1JXLA 2KZMA 4K4WA 4DSEA 4FBUA 2B5JB 4BE2A 3MEDA 1U45A 5EWFA 4KFBB 1C0UA 5HROA 4EYHB 1QHTA 4PUOA 3HVAA 3CIZA 3GYNA 4Y3CA 4CJVA 3I0SB 3KKRA 3FRZA 4KHMA 3LAMA 4B9LA 3ZSOA 3AA4A 3ZT4A 2JC0A 4CGIA 4R5PB 4GVMA 1RBRA 4RNHA 4NYZA 1RNHA 5C25B 3LDSA 2XY5A 3OYEA 2GBZA 3DRPA 3H40A 1ZBFA 1S6PA 4TY9A 2Q3SA 5JUMA 5HROB 3BGRB 4TY8B 1RT4B 2AX0A 2YKNA 4LH4A 3L2RA 4J9QA 4XPEA 2X78A 4DTMA 2FC0A 3NGIA 4NRUA 3T5HA 3QGHA 2R8IA 4GC6A 4KPYA 5DGAA 1UOCA 3PZPA 4W5QA 3V6DA 4CJEA 4TQRA 4FW1A 2OZSA 4B9UA 1OS5A 4KB7A 3CDWA 3C6UA 2ZD1B 3RR8A 1EETB 1VSFA 2FLLA 3RWUA 2J6UA 3LANA 2RDIA 4J9OA 2AJQA 4FLTA 3RRGA 4RW9B 1NK4A 3M8QA 3RMDA 1KFDA 3OL7A 4Y1DA 4MK8A 4DS5A 4B3OB 4KAZA 4QPXA 1WSIA 3OSPA 4CF1A 1ITGA
chains in the Genus database with same CATH superfamily
2E44A 1L3SA 4QOTA 3QDKA 3I55S 5K14A 1IQZA 1CZBA 2D1CA 4X4SA 2OKQA 4CI0B 2GVZB 1CQMA 2OSRA 5AQVA 4FPIA 2NSCA 3D5MA 1CJUB 3SCXA 4Y2CA 4RBTA 1SCJB 1RACB 3M8QB 3GJTB 5K8OA 5DO2A 1XK8A 3UWTA 1RDUA 3K17A 2DNNA 1B64A 3PW4A 1N0VC 4CLUA 3T6JA 1IBLJ 2DIVA 3A8JA 4CK1A 2HBJA 5M2RA 1Q79A 4X2BA 4RNFA 2V2VA 3HSZA 3MM5B 2WVEA 4ERDA 1KAYA 4M63C 2IIRA 2CNNB 1VRQC 4F3MA 4LQ9A 3P31A 3OUYB 2V2ZA 1D5AA 2IYIA 5FLXU 3O3GA 1GOBA 3UI3A 1UA1A 3UD3P 1Q86O 3ID8A 1HARA 2HSEB 3R1HA 2GA7A 3HKZD 3KJNB 4NASA 3GBTA 2UXBJ 1GH8A 1NSQA 2HG4A 4CYUA 1T05B 1HUXA 4WE1B 4KPCA 2HRUA 2I38A 3NNAA 4R5PA 2VKRA 3OBIA 5IFMA 3MXJA 2D3O1 1M1GA 2DR6A 1EAYC 3BBBA 4EAHD 4QZVB 2KZZA 2VUGA 3M1FA 5JXSA 5LMNJ 1RAIB 5KFLA 1X4CA 4AHCA 4GO7X 3PO4A 1OIAA 3HZ6A 3HVTB 4O8UA 1VBYA 4CZCA 4X64J 1J27A 4ZPCA 4JRQA 1S3XA 2KKZA 1CS4A 4W5OA 3UKRA 5CYQB 5DQHA 2PFFB 3J80Y 1RT6A 4M1KA 3LTOA 2PDAA 3MWPA 3Q23A 4IJAA 4NXNJ 3WC0A 1RWWB 2ZH5A 3D3BJ 2WBRA 5CAAA 2IMOA 3HHNB 4CGHA 2C22A 3LL3A 2DRBA 3B8HA 2AGQA 1NO8A 1JLGB 4QIVA 2JEFA 3J8AA 1S1VB 3OLBA 2LXFA 4CLZA 3SQ4A 3D2EB 2C2OB 3F9MA 3N4PA 4I6AA 3NGZA 4JKAA 1K44A 3BDEA 3W7BA 4H5NA 4DPXA 1KVJA 2CQ4A 3SQGA 3GYGA 2XGPA 3ITHB 3FZHA 4P9SA 2P9PB 1ZZFA 2G8UA 5D0HA 4X64K 1UVIA 4ISFA 3QEIA 1XI1A 5C2CA 2C3MA 2G1HA 2F8HA 1QVGR 3GE1A 4WU2A 1FXXA 2GO8A 2YNIA 4FXVA 1WC3A 4DQRA 3MEGA 3R2CJ 1C0MA 2FLPA 3LM9A 4B1ZA 1P1TA 2OP5A 2XZDB 2EBGA 2WW8A 4PCQA 1H72C 4N76A 4WFNQ 1G6BA 2E5LF 2E29A 1FF2A 3NGDA 1Q16B 4JS4A 1LK7A 4DSFA 2OTLN 1R27B 1GLJO 5A8KB 2HURA 1XC9A 3CC2N 2QXLA 4CM2A 4W5RA 1Y0HA 2JC1A 3MX2A 3JYTA 1O51A 2B9XA 2WVDA 4NYOA 3MMAB 1EB0A 1FRMA 5C7PA 3G8SA 2J9DE 5E2QA 1HNXJ 3AVIA 1WTBA 2GWJA 2QEXS 4CNYA 3J80O 3QO9B 5CYJA 4C1NK 1U24A 2FJAB 3CGIA 2R7TA 3VCDA 2N4DA 2MQLA 1HQ2A 1OSCA 2DHAA 4ZS6A 2CH6A 1Z26A 2ZDOA 3MK6A 3NS6A 3AAWB 1KRPA 3IBCB 1WNSA 4W92B 3NF7A 2VODA 2PYJA 4OLPA 4RNNA 2W9CB 1F9EB 5CYQA 3E8OA 1XNRJ 2QWPA 1DQAA 2CPYA 4DTUA 2FJEB 1L3TA 2YVSA 2XSFA 4ANCA 1YJNN 2H54B 3RJMB 2V2KA 3R1XA 1ZBSA 1IBCB 2MYFA 1JNRB 1VQMS 4YOYA 4B17A 4AHSA 4HUGA 3SK3A 2JHEA 1SKUB 4NLGA 4RNMA 3KMSA 3VAHA 4X64F 4AL5A 4LFBF 2DY9A 4LF2A 2O8DB 3JTPA 1B0PA 1B92A 2A40A 1VK3A 3AVKA 4EFHA 3H5XA 4XEIA 3CD0A 4IO9Q 2QSWA 1D8ZA 1ZAVA 3VA0A 5G0RB 1QS4A 1IM6A 4F02A 5D78A 1JMTA 4BY9C 4UOHA 3CCMS 5FLXY 3A8EA 4PUOB 2Q97A 2H5IB 1VQ8N 3AJ1A 2BJEA 3HI9A 5FIIA 4GC7A 5HMXA 4YEAA 3ZT0A 2EFNA 4HH0A 4B3TJ 2HHVA 4KH4A 4O5BA 4AE5A 4J91A 2CUYA 3H08A 4PPZA 3KJQB 1RAEB 2H3GX 3C16A 3M2VA 1Z2ZA 3MR6A 2ZJPQ 1S6QA 1ZTWA 2RE2A 3KZBA 3K0SA 2JRSA 3QO9A 3K5PA 1YTAA 2K1RA 1U8WA 1YVNA 2V51B 1XR5A 3C14B 2MKYA 1L3KA 5IT4A 3QZ7A 1S79A 2IS3A 3BH6B 1WNEA 2M5YA 3OYCA 1OYEA 5KFPA 1U4BA 2CH5A 3CJAA 5LJ5Y 1BMQB 1U1LA 2PA8D 4FS2A 1MU2A 4FWRA 1HFEL 3OVAA 4ZJQA 4P2SA 2AEJA 1ASWA 1NH8A 3QLHB 3LP0B 2RE1A 3AVBA 3KK1A 5M1KA 1KOHA 4TQSA 1RCXB 4DV0J 1VJQA 1LV5A 5KFXA 3PX4A 4DJBA 5F8GA 2C2MB 3P38A 2AX1A 4R8UA 5CD4A 1FX4A 2DGWA 2VWJA 3CXCR 1RK8A 4RUAA 3H42A 2F8SA 1RAAB 4DV5J 4ER8A 4YY3J 4IJNA 4CZMA 1FCAA 2LMIA 1G15A 3MN9A 5GAEP 1NGJA 2E9RX 4G1QB 4PXCA 1YTUA 1CULB 1WF2A 3CMEN 1TU0B 1VSEA 3D6HB 8AT1B 4PKGA 2AYEA 4IZ9A 4JI3K 3KD1E 4DF8A 1RXOB 1A9NB 2G8IA 3IRXA 5KFCA 2XULA 2E4LA 2GIQA 5JMVA 4AXIA 3ZT2A 2RSQA 5GADU 3LA0A 3HD2A 5HSPA 2J9EA 3MEEA 2N3LA 3UE2A 4O3QA 1YVUA 4DZDA 1OPZA 4ALZA 3QGIA 4ZJOA 2ALZA 5HRNA 4DR3F 4NA2A 2ZITA 4JI3J 5J1EB 4IBNA 1XERA 3E3XA 5LL6Z 1WBBA 2IA6A 2ZH4A 3U9DA 1VSDA 3DLGB 3HSGA 1Z4UA 3HOSA 1HKBA 3KLGA 1K8AO 2RRAA 4OI3A 5AZIA 4B8AB 1N5QA 5I3UA 3VQEA 4M5JA 1YRUA 1HI0P 1RGVA 4O3OA 4P2FA 1JCFA 2V0NA 2DITA 5KFYA 2FYXA 2CFXA 4OJ3A 4OIXA 2ZWHA 4RW6A 5HMYA 1SUQB 4BVOA 3JXOA 5GAEI 1VQ9N 2W41A 3BY5A 4Z7CA 3T1AA 3G86A 2QA4G 4WIIA 2R2SA 5GAEU 3RG6A 5CZVA 1EX4A 4OKJA 4DFKA 4QR0A 2CPJA 3TX0A 3D1QA 3OYLA 4FYXB 1ZM9A 3QIOA 1U7LA 1RYSA 2IM3A 3VEOA 4JKHA 2JEGA 1RTDA 1JLFA 5IC4B 3X1LB 4Q0BA 4LF5J 3SFUA 4H8KA 4KI4A 1N52B 3OTEA 3LGNA 4U7BA 4DX5A 1YJVA 4QIGA 2YWEA 2BEFA 5GAGU 2VBXA 1FJCA 3DRSA 4QWCA 2XZTB 2J76E 5HBMB 4IDHA 5HI7A 3DRXA 3V81B 1U0HA 1DARA 5KQ8A 4FW2A 5I42A 4DTJA 3LP2A 1R0BG 3CJSA 1IKVB 3R5AA 4OV1A 1MMDA 4A8WA 2IAJA 2DCUB 2NQPA 4DTNA 4IFVB 2O01C 3OL9A 3QFWA 3HPHA 2V7YA 4WF9Q 4YOTA 2J4RA 1H74A 1C1CA 3CJ9A 4GVEA 3DGPB 5FPMA 3BZCA 2VQFJ 4DV7K 2UXCK 2FHJD 1IKYA 2E5HA 1YIJS 3KWMA 4B1YB 5KFHA 4F04B 3DXKA 3O4WA 2HS4A 1FK9B 2OD4A 1BWVA 3PIOL 5AQMA 3ICLA 4CHPA 4CTAA 1FT8A 1P9YA 1ZM3A 2YWFA 3G4SS 3ZZPA 3LDPA 1TKTB 3E9OA 4OYBA 5HN0A 1O1WA 1DY3A 2MKHA 3HFVA 4CO3A 4C8YA 2UUWA 3CQ8A 4G3IA 2IY5B 4YB5A 3CF5Q 3RVCA 3AVFA 1JB0C 1F21A 4OHVA 4JD2B 5JLHA 1NK8A 4E8UA 1VQPN 3ETMA 4M41A 3BBCA 2LQ5A 1NMNA 2VU5A 2RQCA 3IAYA 1KQSM 3AVLA 3R6GB 4U67L 3CFRA 3AVJA 5C2FA 2YHBA 5B08A 2QN6B 2YX4A 2ADCA 1PCAA 1NB2A 3VQTA 1RT4A 3DMJB 4K2XA 1Q5YA 4N5SA 3HZGA 3D4JA 3FFKB 4K8ZA 3AGRA 4MO5A 2MTLA 3AO4A 3JSRA 2CZ4A 4XK8C 1C6VA 3NWRA 1O0PA 2KT5A 3AO3A 1CXQA 2VV5A 4WP3A 1HKAA 3HHLA 1RTJB 3P8BB 2HBQB 4CZKA 3LGHA 1RZMA 2DIUA 5JJBA 3B82A 2ZBQA 1YGYA 3DGVA 4LF8K 4AHVA 4CHYA 4IQXA 2HWTA 3LQVA 3QEPA 3A3PB 3MUTP 5C2DA 5JS2A 3MMBA 1SL1A 3QZ8A 4B3TF 4ILLA 1S7HA 1Q5VA 2L9DA 2MQQA 3CM5A 4KGMA 2GUIA 3OYHA 2HIYA 3B6OA 1U2VB 3I8DA 1XMQK 2GJ2A 4DL6A 4B3RK 1RCOB 1N36J 2EKYA 4DL3A 5J2NA 3GTYX 2BKPA 1T95A 4AHRA 2HBKA 2K7KA 3NH0A 1B7YB 4OPJA 1GLDG 3BO4A 2KVQE 4NLRA 2IRUA 4RJVA 3O1LA 5JVGL 3MAHA 4PWUA 2Y1LB 1SL0A 3QIPA 1AYEA 2ZHOA 4LFBJ 2YNHA 4QAGA 5L1LA 2DXFA 4RWWA 3T69A 3OJSA 1N33J 1RBUA 2A6MA 4DR3K 3G0ZA 1JJHA 3GV5B 1JXEA 4K4YA 2UV8A 4XTTA 2F1FA 3UR3C 3HHKA 1Q8KA 3BBFA 3D1OA 3SAHA 5LMUJ 2EW9A 4GVBB 3VGVA 3S3NA 5K8MA 1KDNA 1V4TA 2XLIA 3MN7A 4KY3A 3KLHA 4JKFA 4HLBA 1N5YA 1Q7LB 2F9TA 1YI2N 4CJ3A 3DLLQ 2CQHA 4M3TA 3IC1A 5KFFA 5ETPA 5MLCQ 1PSDA 4E0DA 3ENVA 1ZTTA 4EZ6A 4JK7A 2A2CA 1EWRA 4QIFA 4LMZA 2DPIA 2QYGA 1OVYA 5CHCB 5KFZA 1DJ0A 1TUVA 4F4ZA 4PRFA 5E84A 4ED3A 2RKIA 3Q24A 3V9XA 3H25A 2UUCK 3E66A 4J9VA 4CD1A 2YKOA 5FPNA 3OXGA 4J8FA 3TA0A 4FJIA 3R27A 3KK2A 2I5JB 3A8IA 3CTRA 4CHQA 3H98A 2QWOA 1J5OB 2P6TA 2WRMA 5LXRA 3CCJN 4RUBA 3CNQP 1BWEA 3VPZA 3OL6A 3QEVA 4B9VA 4K8XA 1K8AT 4HTJA 3TZXA 4RU9A 4DLGA 1R0AA 1Q18A 1VQ6N 5EWGA 1N32J 1OQ6A 3BEGB 3MPUB 1RLDA 2XRIA 3DDIA 5F8IA 3CG7A 2X74A 1YRTA 5HJXA 3VQ4A 1FKAF 4ZHRB 5F0UA 3CCSS 5HL7Q 1K1SA 4ZPAA 2IM1A 2F40A 3CE8A 2E1MC 3V6HA 1X4BA 1EQMA 3NG8A 2UXDF 4IFYB 3PNIA 4FZYA 4CHOA 4DSLA 3H0PA 1F2GA 4H54A 4IOBA 3MF5A 3QT8A 1NK0A 2FDNA 3TAFA 2P5GA 2C2RA 1JLFB 3O9TA 1GAOA 5L9NA 2IRYA 1RDDA 5H9EK 3SYZA 5EOYA 4E98A 2CGLA 2ZBCA 4OHXA 4UY8T 3O9RA 3R6LB 3H4BA 1C0UB 3UKUB 2CNKB 4FJ9A 4QCLA 2XWYA 1XQIA 3JAMU 1BHLA 1SUQA 1N6QB 4OZ3A 4WBFA 2Y1IA 3VEZA 4RW8B 1FEEA 1K9MO 3L6QA 1UWAA 1P90A 4FWKA 2UUBF 2Q31A 3LZJA 3P83D 4KHYA 3C7NA 3KLIA 4M3WA 4U96A 3DLEB 4EZ9A 4RG8A 2XI2A 4FBTA 2DY4A 4NCGA 1R31A 4QWEA 1T03A 1RT2A 4WKYA 2E20A 2MZQA 3QMQA 3ZX2A 3RAMA 2PFDA 1QVFM 3A5LC 3NCIA 4B1WB 3JQKA 4P71A 2YI1A 1LWFA 2A18A 3N79A 5BR9A 2ACMA 3ZC4A 2WSFC 3I96A 2PC6A 2SXLA 1X8DA 1ZS6A 4K4TA 2DTUA 2IVNA 5KPRA 2BBEA 4E1MA 5IZHA 4ZIWA 3KLEB 4F4KA 2HHQA 3A12A 2HHTA 2AW0A 3JTOA 2NR0A 1V6HA 3HJFA 4OL8A 1KQFB 2DRAA 2W2MP 4DFPA 1RT1A 2XYHB 1BCMA 2QLFB 4DEZA 2DH9A 2WHOA 2UUAF 2KRRA 2NLWA 3AA2A 2XG8A 4ZVOB 2AJ0A 1WKJA 3OYGA 1LAWA 4K25A 4DX6A 1AT1B 3SI8A 3H3OB 5M2PA 3SQGB 4K0KF 2CZ9A 3D0HE 2BTFA 1Y64A 1SJ1A 5TKWA 2HMIB 2MGZB 4CIFA 3SAFA 4IH5A 3EO3A 3CJRA 3M32B 4NCAA 2ASJA 1J54A 2F96A 3VF6A 4NLPA 1UEKA 3CIPA 1IBKK 5CR4A 2JLFA 3CMAN 1FRKA 3JSBA 2OUGA 4CCHA 3ZSXA 2VC0A 1DAXA 4J9RA 3T1HF 4ZPVR 3EJMA 3HPGA 4RUCA 4H4KA 2P9GA 4IH6A 1FDNA 3K59A 5E7OB 3R8YA 3MD3A 1U1KA 4CK3A 1Y97A 4JI5K 4OHZA 2FJBB 2KXNB 4OKKA 1UA0A 3N28A 5KI6A 3WBZA 4A8OA 2W7PA 1S72S 1D1UA 5GMEA 2ZE2B 2V5HG 4DV1K 4DCJB 5B0BA 1VRTB 3RAQA 3BGRA 5DG8A 5T41A 4OKEA 1MA9B 2KU7A 3DOLA 3EY1A 1X4HA 1S1XB 5L1JA 3HX9A 3NAEA 4A8FA 5TKYA 4YORA 3CIMA 4KHRA 2HNZA 2AU0A 4BRFA 4KO0A 4O0NA 4YB1P 2Q1NA 3R97A 1YWXA 1Q8LA 3ATUA 3M1VB 2H5EA 4FWMA 1TFYA 3UCZP 4PZVA 2DFEA 1AUDA 5FLXO 4C98A 4I6YA 3FFIB 4E7HA 4BS2A 2GX8A 3QJPA 2BJ9A 2C2DA 2CADA 1HKCA 4MMOA 3FSXA 4KGZB 2XEXA 1NH7A 2A3JA 3KLVA 4FKXA 4O44A 3SV3A 4LF6K 3DU5A 1Y5LB 1VOMA 1ASUA 2Q6CA 2RB7A 3LZIA 3THTA 4PY5A 5J1PA 1UW4A 2XLJA 3DXMA 5KAKA 4PQAA 4K4SA 4DG1B 3KJFB 1N34F 3GV8B 3PV8A 4B1XB 3D66A 2V9WA 2NXJA 3MAAB 5EVZA 2J9CA 3B6BA 2BM0A 2PA3A 2J7WA 3JSYA 5AQJA 1VQLS 1LW2B 3ZCMA 5AQFA 3RB4A 4JHDA 4Z0UA 3FZMA 4EEYA 3N4QA 4EO8A 3NOCA 1Q86T 3CC4N 2D0OA 5MAOA 3UCGA 1RHRB 3DLEA 3T3FA 3D0PA 3F56A 2FBVA 2L9WA 1NK6A 1L3UA 1NK5A 2F9DA 2RRNA 4BHQA 4PG7A 2Y8YA 2UVUA 3F2KA 4K42A 3EYZA 4F2RA 1SJFA 1SI9A 1H2TZ 2W4DA 1OWXA 3OXLA 2W9BB 3U02A 1JLQB 2DB1A 1QM9A 2YXLA 1E6YA 3BN4A 2LDIA 4K59A 2FLNA 1QLNA 4O0IA 4ZVFA 4JI3F 4F9OA 3PRBA 1TYQA 5AR0A 3ENWA 2FHKA 1S0NA 3TSQA 4Q0BB 2VBYA 3PYFA 2F4VK 3C2PA 3O1BA 2EVZA 2DY1A 2YWWA 3Q2SC 2VASA 1HWIA 3DOLB 3ADAC 3PJXA 4URSA 3G71S 4I2QA 3PACA 4IRDA 2L3MA 3CJKB 1T9UA 4F8RA 4A8MP 2MZRA 4OJ1A 4JKDA 3W2VB 3MURP 1CBKA 2XS5A 1P6TA 1NJIT 4MKVA 4ZP6A 4C11A 1RWXB 4PAAA 3P1GA 3NLCA 4Y34A 4USUA 4OLOA 2ASPA 4C0HA 2RHKA 2W9BA 2AD9A 2CQ1A 2CA9A 3L4IA 1RISA 1WF0A 2K3KA 5DK5A 4F4XA 4JUZA 5DGBA 3B78A 4L74A 4B3RF 4FZZA 4LRDA 4FWQA 3PY8A 4YDDB 3IM8A 2DFHA 4E2FB 3T1YF 1N5SA 1VQSA 2NRWA 2JEJA 3RW6A 1WHWA 5IQQA 3JAMO 1WSRA 3PSIA 2AV5A 2ASLA 4IO9L 2V50A 2GW8A 2VJVA 3UKRB 1RWPB 1Q4RA 3NMUA 3HHLD 3BP8A 2P9SA 4OI4A 2BYCA 2C3PA 1PYOB 2V8PA 3FZFA 4PQUA 2KM8C 2NXUA 4L76A 3DHWC 3K0JA 4CZFA 1FNOA 4WU3A 2G2YA 5CHIA 1JLQA 4DR6J 4USKA 5CY4A 4HDGA 4M3YA 2E9TA 1QJHA 2CQCA 4IQMA 4UY8O 2OPRB 5BYSA 2DHGA 2QE5A 4A8KA 3HVWA 2P51A 5CCLA 5ETNA 4A59A 4CEFA 4N56A 3FKBA 3AQPA 4JI1K 2FJVA 3OS1A 4F0MA 1V3SA 3OHAA 4CJQA 1A5XA 1X9WA 3CM6A 3AY0A 2GELA 4ZIVA 1WDTA 2JZ5A 4OHWA 4FJ8A 2MKKA 1LW2A 3ZNUA 3TTCA 4ZCMA 4ECTA 2O8FA 4Q8EA 4JKGA 4OMFG 2BZ2A 3MFHA 2VWKA 4DUZK 1MU2B 4I67A 3OJUA 5KG0A 1IKXB 5H1SQ 1R59O 2DTJA 1U09A 1IKYB 5C42B 4A4JA 3W9HA 3R9PA 3NH1A 1NPPA 1PAUB 2A6OA 4CGJA 3VENA 1YBTA 3CJ5A 3Q8SB 2UVWA 1J9AA 3L95X 1FKOB 2G8WA 4WCEQ 5ETRA 1HYVA 3NRBA 4DHYA 2DKOB 3OS2A 2LA6A 3M6XA 4ZLNA 4ZA1A 4ZPBA 2X51A 3AD9C 4OYIA 2QKKA 2KG1A 1T3VA 4DR6K 1VQ4N 5FPEA 2MQMA 3G6ES 5F8NA 1JXLA 4I68A 2KZMA 4XH4A 4FBUA 2B5JB 4BE2A 3W5ZA 3MEDA 2DNRA 4KFBB 4EYHB 1I51B 4YN3B 1WOOA 3HVAA 4CZHA 4LF4K 3KKRA 4NXMK 3ZSOA 3ZT4A 4R5PB 4GVMA 1SB6A 3E9LA 3M32A 1RU1A 2WAQD 2OD6A 1HLUA 4XPEA 2X78A 1RAFB 4DTMA 3R6MA 4OZ5A 3SJHA 4CO0A 4NRUA 4CZEA 4JKEA 1NZAA 3NGTA 4GC6A 5DGAA 1SAZA 2KT2A 4K0KJ 2VF3A 5BRHA 2BKNA 3LDLA 3AY9A 3EVMA 4AYBD 3DXBA 2FLLA 3RWUA 3PFOA 2B8PA 2RDIA 2Y3YA 2EWSA 3S8SA 4BC4A 2XS2A 4OX6A 4Y1DA 2XMKA 1ESVA 4QPXA 8RUCA 2BV3A 1JK9B 3OSPA 4CF1A 2COLA 4LFAJ 4X4PA 4ECYA 5B0AA 4MTPA 5KFMA 4DR3J 4CO5A 4CWBA 2ROPA 3U1LA 4DTOA 5CZ1A 3CCQN 1FXLA 3JAMY 2P9IA 1UKUA 5A8WB 1NPRA 3TI0A 2HVDA 4Q44A 3G4SN 5CXTA 2F5GA 1OVQA 5KFVA 1K47A 2AIRB 1NGEA 1RT7A 3WXJA 2GMJA 2W6LA 3WX8A 4LRBA 2ACYA 5F41A 4LBPA 3LWMA 3O3FA 1W2IA 3M8PB 2QL9B 2Z8QA 2GVDB 4USJC 3NNHA 2RH3A 3OPKA 5D0EA 1DBDA 1VLOA 4V19X 4B9TA 4PQUB 4U6PA 3MM9B 2YTCA 4CBWA 2CPHA 1CULA 4MFBB 3UVJB 4UQGA 2QEXN 1YHQS 1WOPA 2AT1B 2ZH2A 3BYRA 2PMZD 3ULDA 4CEQA 4OX7A 3ZSZA 1TVRB 4LFCF 5SZTA 1FJEB 2G9OA 2HLUA 1T02A 3OR2B 3UDEA 4LD0A 4WYLA 5LSLA 4K41A 5F1XA 3DC2A 1NAQA 1CC7A 4OYXA 3NMAA 2XMVA 4C23A 1HNVB 4Z4GA 3OHBA 4HI2A 3SJJA 5LSRA 3LO3A 4FYVB 2E1ZA 1AUSL 5HQ8A 5CYMA 3ENHA 9RUBA 1PC4A 3O6QA 4QS8A 3K5LA 4ZLPA 4F25A 1GFWB 1TTHB 3S1TA 4CHNA 3E1YA 1XN9A 5M1NA 4ED7A 1X31C 3M9NB 3VVTA 2Z56B 4WFAL 4DV7F 4HHHA 3KVGA 4M7YA 5BJRA 3NAHA 1QD1A 3L9ZA 3MM7A 5L9XA 4KBOA 3M2VB 1EETA 1IBLF 1APSA 3VTHA 3AAQA 1YT3A 3TA2A 4CFCA 4JI8K 3EEQA 3EKSA 2UXBK 1S1TA 3TUIC 4FNHA 2KTQA 5LMNK 5KFNA 2CGJA 3K9KA 4C11B 5AJ3J 2QC3A 4CQ1A 4IOCL 3M8RA 4DQ8A 3NMRA 3DLKA 1CJVB 3WEEA 3HTVA 2CQPA 3B4DA 1SC6A 4OGCA 4OYOA 2VDHA 3A5MC 3B6PA 1QVGM 4FZXC 3A3NB 3Q89A 3BUZB 3N9UC 5KPTA 1DTQA 4ICLA 1VQNN 2GMHA 1VQ9S 3QERA 4WFXA 2ITMA 1EHWA 1T05A 3HSDA 2B6AA 1ACMB 1S97A 1HWUA 4ZITA 3G82A 5D15A 3TVKA 3MUMP 2HGNA 1SQGA 2CNOB 3OVBA 4IDKB 1WI6A 4PG6A 3TEGA 4ZVPB 3P49B 3KK2B 2B6AB 4YOWA 2HPUA 4Z4IA 4OQJA 3US5A 3KHRA 1BC6A 2FC9A 3O44A 1HQEA 3QJJA 1LW0B 2IDOA 2RILA 3OTOK 1VIXA 4M94A 4MK7A 1WWHA 2N82B 2LLZA 3IN5A 3DDNA 2EC2A 3UB5A 1HMVB 2RPIA 1R43A 1WEZA 1HR0K 1NU4A 3OYFA 4Z37A 1NRKA 4DV1J 3CJ3A 3VVUA 3NGRA 4LF8J 4TU9A 5THWA 3VQQA 5BYQA 1U25A 2JWNA 4NX9A 3CCMN 3AA9A 1K6YA 3FC9A 2BW7A 1IR2A 3WIVA 4FXWA 1NBEB 3SCLE 3CDAA 4DR4F 4IDKA 5D4LA 4E19A 3JQMA 4FM0A 4PG8A 1YJ7A 3ZLJA 1XMQF 5D4OA 3CJQA 4XPCA 1IQTA 4USVA 3MEGB 1FTCA 2XY7A 5KPZA 3FZKA 4LF7F 1Z25A 3TVYA 2IM0A 2I7NA 4A8XA 2V34A 2M8DB 1NSAA 2ZZTA 3EDRB 3C6UB 2AZ1A 2O8EA 4F4AA 3D6TB 2J0XA 4MIWA 4LFAK 4FJXA 5IC6B 2UP1A 1PAEX 2QMWA 4GV6A 1HYSA 1S6OA 4Y65A 1Q81O 4LSLB 1QE1B 2XTJP 5AZJA 4CM0A 1CJKA 4DUYF 2JJ4D 2CRLA 1I3OB 4WIQA 5JVHQ 5C25A 1NMEB 3QT5A 2FXUA 3OVSA 4PG5A 2F7VA 4BC9A 1JLAA 1K73T 4DQIA 2PGCA 2KW4A 3QYYA 2B4JA 1EJ7L 4RU2A 4AT1B 3J7YI 4B3SJ 2V8VA 1NDPA 2W2OP 1X5PA 4OZJA 5ETLA 3NF8A 2UUBJ 3ZZ0A 2P9NB 4PYDA 1CS4B 2NRHA 3DLHA 4I64A 1QY7A 2HBRB 2RDDA 2CG8A 3SPZA 1VSKA 1MN9A 2AKWB 5J2PB 3U3GA 2MDAA 4E3SA 4DV4J 4CF0A 1NHKL 2R2UA 5LL6d 3QAUA 5KOWA 2R2RA 5IWAK 2VICA 1Y3JA 3MXHP 1S4EA 1QQNA 2M70A 2M0GB 3ATVA 4LC9B 3VQ9A 4EO6A 1SC1B 2G8VA 2X3GA 1HLWA 1HWKA 5CCMA 2VD3A 3K5OA 3W9JA 3L2WA 4DSKA 2FQQB 3QMLA 3GPAA 4FDFA 2BQUA 2VBZA 4J2AA 2EKNA 3RB0A 4DV5K 1ZBIA 4C8ZA 2VFTA 9ATCB 2W7OA 4NZ6A 5AFUH 2KL8A 5E3QA 1B0VA 5CABA 1WI8A 2OEMA 3DM2B 2EFGA 3PXGa 4KO0B 3GIIA 4CE9A 4HCBA 1S5ZA 2GZOA 3MTKA 3CD5A 4HTUA 3PYGA 4JB8B 3EVOA 3DFEA 2APOA 3IAM9 1LFWA 4F3OA 4IRKA 5B8HA 1NNEA 3EGVA 5JICA 4M42A 3OTDA 1C0TB 4M5DB 2QJ3A 3AXKA 3ULHA 5A2QU 3KG1A 3LPEA 2G8HA 1VQ8S 2XMUA 4DTRA 4BR2A 5F3TA 4HHJA 1OPIA 4GV9A 2ITGA 5ETKA 4OZNA 4ILGB 1BGXT 2HWIA 3VEWA 1YJ9N 4LFBK 1DTQB 3M6WA 4OLBA 2D0BA 4NCGB 1UEVA 3PW0A 4K50A 3TRGA 3H45C 3DGPA 3GIMA 4FJLA 4DN9A 1HNZJ 5H1SV 3ETOA 2XMJA 1ITPA 1CZ9A 2XMTA 3DLRA 3C15B 3A0IX 5FD1A 2AJ4A 2V4JB 3N5BA 3HL8A 2Z0GA 1R8PA 1HBNB 3C3LA 2J0SD 1H7XA 3SDEB 5GAGI 2R7UA 3U4LA 3TEHB 1SJQA 1T0TV 5B0DA 2BOAA 3N0VA 1RT5B 2LSNA 3M8YA 1WEYA 3HJVA 3Q86A 3K7RA 1IJJA 4DR6F 1RWOB 3FUYA 4KYZA 2YCHA 1PC5A 2Z4PA 3A5OC 5AQTA 4FP9A 4ZHRA 1T7PA 4I1TA 3ZSQA 2KB2A 2GFFA 3A1YG 4ZK7M 3PW5A 2MKJA 3VQCA 2NRRA 2G0IA 1BY9A 2VKZG 1RBOB 3MTJA 4K8RA 1IN0A 4AM6A 2HBLA 4O5FA 1RT3A 1N8RT 4JI0K 5EY4A 4A5BA 2ZKTA 5CH7B 4F67A 2UXCF 3FBFA 3Q8QB 3AVHA 3EE9A 3TJ9A 4Y0WA 3QQCD 2DFFA 4BRQA 4HEA9 3T1YJ 2FVRA 2BMBA 1JLEB 5J2QA 4JI7J 4BRAA 3VZHA 1IG9A 1LWEB 3J81j 4FO0A 4FYDA 3SAGA 2E1PA 2Z30B 5LJ3Y 3VQ6A 4MT1A 4EIAA 4BRNA 4AH9A 5F0WA 2X7IA 1U1OA 3I6PA 3WNGA 5F8LA 2DR8A 1AFJA 3CCUS 4A2BA 4R8UB 1ATSA 3QSYB 4LSNB 2BJDA 4NOHA 4XDDA 4BQLA 3PIPL 2PYLA 2G13A 3MMJA 3L7OA 4KH0B 2DGUA 4ZP7A 2QA4S 3DCAA 3CWJA 2D4WA 1W9HA 4ETZA 2VWBA 3LWLA 1YJRA 2UYTA 5F3ZA 5GMDA 1F5BA 4CFAA 3PKYA 2E6MA 5AE3A 4C8OA 4F50A 5GINA 4OX9J 1A7GE 2A3ZA 3RAXA 4DR1K 4U7CA 3NAIA 2FBTA 4CLPA 3JYTB 1VSHA 4PWDA 3CUNA 5KG1A 4NXNF 4J9UE 3AD7C 3CCLS 2ROGA 3BZKA 3R9LA 3PW2A 4RCHA 1KVCA 4IXCA 2QGFB 2F9JA 4ZVUB 1NJYA 3V4IA 3V81A 1U0HB 4OI1A 3MGJA 3W9IA 3DLJA 1I39A 4QW9A 1WHYA 3CQYA 2E7VA 2BR0A 4CGFA 1X0PA 3W2VA 5B0FA 2XNRA 1OMSA 4JYAF 3ENAA 1Q82O 4LFCK 1UP1A 4WXOA 3OFGA 3UDLA 2HZVA 2Q0RA 1X5TA 3J81O 3R7NB 2HNYB 4U8VA 1SKWA 3BV8A 2IM2A 4J2BA 4OLAA 4FSVA 2PO4A 4PWWA 3QNNA 4MIBA 3HRGA 4HT7A 2I1RA 2M3DA 2UUCF 2W2PP 4K4ZA 1Q8IA 1YBAA 1XHXA 2JFDA 3CC4S 1RUSA 1Y7PA 2YY3A 1E6YB 4YDUA 5AQGA 1VYAA 5BR8J 5IXUA 3MMBB 4ZVRB 2P9SB 4FLZA 3M9OB 5HLFA 1E6VA 4JI4J 4GKKJ 3OBWA 4C8LA 3GFHA 2R7OA 4FPRA 2O5DA 1VS3A 5E3RA 4PXBA 4GKJF 3A4TA 3IS9A 2NUUG 3MR7A 2I9SA 3BB5A 2HFSA 2OFGX 1TFWA 2YPZA 4WQ5C 4OYAA 4BR4A 1Q1KA 2BW2A 4ED4A 2MMYA 4KHQA 4NI2A 3VESA 3TNVA 4Q45A 2MXYA 3NNCA 3TUZC 2B5JA 4H4OA 3BF1A 2IFXA 4G65A 3PR4A 3O1WA 2HQ3A 3MD1A 3H2UB 2E2QA 1TV6A 1NBWA 2RQ4A 3J7Z5 5A0YB 4FF3A 3BF4A 5KFAA 4IFYA 1F5CA 2IGIA 1JCEA 4CNZA 2DO4A 1KHWA 2XZWA 1SIWB 3CCES 1IO2A 3VQDA 3O9SA 2WBNA 1TAQA 2JLEA 3EXCX 3FBEA 5AE2A 5HANA 1EO1A 1Z6RA 1I5OB 5CA5A 3BDPA 1F1BB 1X4AA 4GO5X 4HT5A 3OD2A 3V9UA 1RILA 2XHBA 1RQ0A 4WK3A 2ZC4A 1HW8A 1N54B 2H51B 4QU6A 1C2PA 4TVAB 4CJ5A 4M7XA 5ADZA 2IBKA 4N8OA 5BPLA 1S57A 3TR8A 1J5EJ 1XR7A 1VBXA 4AL7A 1WSFA 1RGIA 3BQ1A 3IR6B 1TK0A 2HYIB 3CJ1A 1BQXA 5A8RA 4M5MA 4FXDA 5KFRA 3D28A 5EHHA 3TPQA 2KLAA 2IA0A 1RDRA 1RB0A 2WBMA 4DG1A 4PWDB 1WTFA 4CLLA 3TQEA 4RL1A 2YHXA 3C65A 1JLBB 4X4QA 4QR1A 2YWGA 1NGGA 3P5TL 5LT5A 2NS1B 2CYYA 5KFJA 1SV5B 4ED1A 1B3TA 1F9HA 3NGUA 2R7QA 4A8YA 3IS9B 3T9ZA 4DL7A 1XHZA 3T6BA 4DL2A 4WCEL 1KD1T 3D7SB 1B9FA 3HFKA 2LYVA 3ULEB 2R4FA 3VALA 1RTHA 2E1RA 4FF1A 4QS7A 3VTIA 2RHSB 3QGPA 2FZKB 2EFVA 5HLFB 5C15A 4FL9A 4XO0A 3PX6A 4CH1A 3I9V9 4DQPA 4FPBA 2XGQA 1FESA 4JRPA 4IYQA 4RR5A 2WC9A 1NUEA 3PVXA 4DU4A 4KB1A 4J9PA 4BC2A 3AHPA 1TK5A 2Y8WA 2LXUA 4UQTA 3E51A 1ZBUA 2ZZNA 3ZSYA 1F9FA 2PI4A 4BR7A 3HM9A 1UAXA 1GXLA 2GQ2A 3BKFA 4URQU 1WC6A 3THYA 3O8WA 2QTWA 2PI5A 4URGA 1DHMA 2AA4A 5DM7L 2DHHA 2XWXA 2PFUA 4YOXA 2IDLA 4MK9A 4ES1A 1XWLA 3T5LA 3NGSA 4R0JA 3E01B 1NKBA 3SEOA 2WK4A 2O66A 3MCNA 1RTJA 2R7VA 5DZ6A 4FZVA 3K2PA 2WUSA 1U1QA 3ILOA 3FGUA 2C42A 5KFBA 3VR1A 2QLJB 2ADBA 1GX6A 2KI2A 1VQMN 3EPIA 1QSLA 3VF4A 1YJNS 4YP3A 3K2YA 4DUYK 5AQWA 3O4QA 1RA7A 3NE6A 3RBXA 3OFFA 1GMVA 3ZFVA 4USWA 2ZJQL 5KFDA 1R7IA 2UV8G 1XUPO 3TAEA 3M8PA 1KWMA 3G87A 3QRQA 4IWVA 3IR5B 1Z2LA 1URNA 3IFEA 3UNYA 3EXYA 3OYDA 3D68A 2W01A 1W7AA 4ZVHA 3BSNA 5LJVA 5AXLA 2HMIA 1GMWA 3GFZA 1C0GA 2YBVA 4AHTA 3KDOA 1VMBA 3ZTPA 1ASVA 1S0VA 2G8FA 1LKZA 4A48A 4ATNA 3J80U 3UE5A 3G25A 1CJTB 2OPQB 5BN8A 4I69A 1GLBG 3VGTA 1T9XA 2D3OR 1S76D 4DMNA 4Z7YA 1R8BA 3AVMA 4ENOA 4CDIA 3NCRA 4X4UA 4FK4A 2V4RA 4JI2K 4CW7B 1XMOK 4X4TA 1NM2A 3VQPA 1RTIA 1O6XA 3MPWA 2DK2A 3HSJA 3O4NA 5HRPA 3HD1A 3CEDA 1VC0A 3VN5A 4A2AA 1GXUA 2XNQA 5KG4A 1AFIA 4JI8J 3VAFA 4C8KA 4O3RA 3OHRA 5KFEA 4H4KC 1HBMB 3GG4A 1PILA 4ELUA 5DMRA 2VIHA 3SZ2A 4CZIA 2HHHJ 2DISA 3U1MA 4FLUA 3DHXA 2CJAA 4FWNA 4V1Ak 2ZVIA 3G6XA 4ID1A 2F8MA 1UAWA 2HK2A 2W8KA 2EBEA 2FY1A 4H0OA 3BPSP 3H1QA 5KT2A 2VCPA 1AXQA 2WSCC 1TL4A 2RS2A 3C16B 2NPIA 3NWGA 3HKWA 3QSIA 3CD7A 1HBOA 1T6DA 1M90T 4DR7F 5K14B 4K0KK 5F0XA 3OTCA 1G99A 3V2UC 4ECRA 2IRXA 1QAYA 2B9EA 4XH5A 1TMMA 2KDOA 1H1VA 1IG8A 3FJ2A 2V8HA 2OAUA 1M1HA 1YJTA 4DDFA 2DGSA 2OPSB 3I32A 3U1NA 1HHSA 4OPKA 4IG3A 2YX7A 2R7YA 1NWKA 1VI7A 4KV8A 4H0YB 3M5RA 3O6WA 2PIIA 5LMUF 1BA0A 4UOGA 5C0YA 4BR9A 3DKDA 3V1OA 4WFAQ 5M1FA 4CLKA 3HZEA 2HVEA 2G2ZA 4E7KA 4CT8A 2XS7A 4Q2MA 4JEPA 3PEJA 4DR2K 1QZ5A 3D54A 3IBFB 2BOPA 2MSTA 3GE9A 4BC7A 5HQMA 3OV7A 4WFNL 1IJEB 4KBIA 3WT0A 3FRYA 3FBCA 3N5FA 3DLBA 4AM7A 3L7PA 3S7RA 7FDRA 4JI2F 3S6EA 4WE1A 3DLLL 2PEBA 3I5AA 3QT7A 1JKHA 3GQCA 1CJKB 3MR5A 4P73A 1BO5O 4NO7A 1VFJA 1MNEA 4DTSA 2CPDA 2LKZA 1YF5L 1TL7B 3V4IB 4HL9A 4M63A 3NP5A 3OUYA 1TR0A 2J0WA 4DR1J 1TP7A 4U8YA 4JD2A 3D67A 4X4OA 4IOXA 3CCRS 4YOUA 2EEYA 3NGYA 4TN2A 4UZBA 2EC0A 4JV5F 4JAXA 4J37A 4W4MA 1NGIA 3VQ7A 5AQQA 4H4MB 2QV6A 1NGDA 1VHXA 3C94A 4JS5A 3ZZUA 2ZH3A 1QZ6A 1HKGA 5H9FK 2PBDA 1N33F 2I5JA 2N7CA 4QYZK 1DGKN 3C46A 5L8RC 1TL3B 2V8DA 4DCPB 2RS8A 1LWFB 2ZM6K 4ECZA 2VYPA 4ECUA 2WB4A 1REVB 3ZSWA 3UCUP 5I3QA 4NB4A 3ZT3A 2V2QA 3ET6B 4GVBA 4P2XA 3NL0A 4FKYA 3ZZTA 2F8EX 2OCEA 1WLJA 5IV4A 1R0CB 4I2PA 3OBYA 2UXBF 3CJ0A 2ZOMA 3V5RA 3OTOJ 1IKWB 1UJ4A 1NEEA 3IBWA 5FJ4A 5ITHA 1RBAA 1Y00A 3MCOA 2IBOA 4OV6A 2WTFA 4A61A 1VISA 2MJUA 3RR7A 3O8MA 2YX6A 2CQBA 3DRSB 2L48A 2FSJA 3BPDA 4OPAA 1JLCB 4MKBA 2CAJA 4J9NA 2FVSA 4O3PA 1WOSA 2GX9A 2HFZA 1QUPA 2A1SA 4IR9A 3J7YP 2VQFK 3KMQA 4GMJB 2IIHA 3BGLA 3T9NA 1X9MA 2FY8A 2YX1A 2ATLA 3R3LA 2KYZA 4C8MA 2RU9A 1ELOA 3EMTA 4W98A 3MEKA 2HS0A 2CPEA 2G4BA 1TELA 2ZE2A 3HCXA 4BDYA 4YY3K 4JI8F 4AQYF 5DQGA 3BQ0A 1OY9A 2B51A 4FJ5A 3DJCA 4OJGA 4RW6B 4DCHA 3OVNA 4A57A 3IG1B 3L7UA 4USTA 1U2FA 2OGUA 2DJWA 1FI4A 3PKMA 4Y2KA 4CEZA 2E9ZA 3GG1A 4H4OB 1BIZA 1T44A 3CCLN 2DEJA 7FD1A 1S0MA 1KEKA 3GMGA 2E1YA 3I9ZA 3UPFA 4GNIA 4BQZA 4FM2A 2H4WB 3PHTA 1NKEA 2MQPA 1IWGA 1QQOA 4DV2K 3SCKE 1ATNA 3KIOA 1UPPA 4FF4A 1JLBA 4GV3A 4H0PA 2Q3PA 5A6PA 4RTFD 4FVMA 1JLAB 3LP1B 1SQEA 2K06A 4Y2IA 3KK3A 5GVQA 3VF0B 4QYZJ 1DURA 3GFXA 1KVAA 3CFOA 1MROB 2Y9HA 2HQGA 1SL2A 1HYZA 3VZIA 1DTTA 1W7WA 4NLXA 5GMKa 5EUHA 2PMWA 4ZCIA 2Q0UA 1XNQJ 2GVDA 3MMAA 2HBYB 1EQYA 2VA3A 1VQ4S 2FF3B 2MPUA 2DR7A 1W2BM 3H8YA 2Z1JA 2CQ0A 4WQ5A 4DV3K 2XSJA 1GTEA 1JLEA 1GOCA 4QOZB 2Z1IA 1FRXA 3SMZA 2HZCA 2RU3A 4K4XA 3M1VA 2B7CB 1RCHA 4DV0K 1QHAA 1TUUA 1TKTA 4DV1F 1QAJA 3ZETA 4A47A 2Y1JA 5DM6Q 4WTOB 4F36A 3WXIA 4E7IA 2MKSA 4EP5A 4DSJA 3KYLA 3DOKB 5D0RA 2HHXA 2CKWA 4KT0C 3HHLC 2HQIA 2GCFA 2UUTA 3D6MB 2DPNA 4U7UD 1F0XA 1L5UA 1FJGJ 2XMMA 1UJ5A 2R9LA 3L3VA 1TUWA 3P45B 3G10A 1EQ0A 3F0NA 4N8NA 3G8QA 4HTIA 2K1RB 3TJ8A 2FJDB 3W8PA 3W63A 2V52B 5ADXH 5E3PA 2XHCA 1GTHA 5HK4A 1HBNA 1IBMK 4K4UA 3QT6A 4M5LA 1RHMB 1O13A 1K0TA 3MCAB 2BX6A 1S59A 1WDDA 2FZGB 3W62A 5C12A 4OYWA 1SBRA 4NZ7A 1OH6A 1X7VA 1KD1O 3K8WA 1FDDA 3LAMA 4B9LA 3ENQA 1RWUA 1RBRA 1EARA 3MWTA 3E2EA 2GBZA 1ZBFA 2B4VA 2E5IA 3BGRB 4PEOA 1RT4B 1FJ7A 2QWRA 2VDIA 2CIMA 3OW2R 1KKHA 3CC7S 4JI5J 1BU6O 2D0PA 1X60A 4W5QA 2MZTA 2O1PA 3PIOQ 2F7TA 2CPXA 4TQRA 4FW1A 4B9UA 1OS5A 1M5VC 4B3RJ 2UUAK 3CCWA 2ZD1B 1AZSA 1FO1A 3HULA 2J6UA 2P5VA 2OANA 4J9OA 3W5XA 2AJQA 4FLTA 1NK4A 2OTLS 3EZWA 3KUHA 3GL1A 4EK2A 1ZAXA 1WSIA 3JS9A 4KRWA 2RUGA 4BACA 2NXNA 3U27A 1DFDA 1NOYA 1M5HA 1BCOA 1FXRA 4DU3A 3H90A 3C6HA 3ZX0A 3C66A 3Q22A 3OL8A 5BN9A 4FWLA 4JI6K 3Q8RB 3W3DA 1NDCA 3KNAA 2FTRA 4FNIA 4LR8A 1NJZA 3VQAA 5JVGQ 3F44A 2UUAJ 1IKXA 4OYPA 4TYBA 5D0GA 5L38A 3IFRA 3S3MA 4GKJJ 3WIUA 4M5GA 6AT1B 2R7RA 4X62J 3J81Y 5ETQA 1ULRA 2YKMA 5IQ6A 4JV1A 4CJRA 2XB2D 1ZAWA 5KFQA 4YHHK 5KT7A 3SCIE 3EUNA 4J9LA 3P96A 3AO1A 2I7PA 4DU8A 4OX9K 1GLLO 4WTYA 4QPTA 2Z2ZA 1X4EA 3R5GA 4KTZA 5BRFA 4C0OC 4KJIA 4H5TA 2OPRA 2RUSA 3PFEA 1LFPA 2LEAA 2Y0SD 3ZSRA 5E33A 2CZVC 5FDLA 2DH7A 2DNHA 1T03B 1CXUA 3IDHA 3GJSB 2FVCA 2KKHA 1GX5A 2C2NA 4O4RA 2KG0A 2BANA 3LDOA 3DLKB 2JNJA 3VQSA 4LRCA 5D4PA 1IBLK 2YHWA 1RT5A 4O3SA 4PG4A 2VG7A 4Q7AA 1VC6A 4BRCA 2HAFA 3W65A 4I56A 2P9LB 3GJQB 2MB0B 2AQ4A 5C24B 3HO1A 3AO2A 4YS2A 4XIUA 1S5JA 1NJWA 4ED5A 2V4JA 2BJ3A 1FD2A 4H03B 1HNWK 4B3OA 4A8SA 1YI2S 1QTNB 4TU7A 1WSGA 5AQOA 4I6MB 3C8YA 1VQKN 2ASOA 4X4VA 2EHGA 1WUAA 1NOZA 2MLXA 4JI0J 2VOOA 2YWHA 4DLEA 2YQ3A 2UU9K 3BS9A 2R8JA 4L3QA 4FYYB 5BPNA 4BWJA 3EX7B 4ZVSB 4CVNE 3FK4A 5E41A 5BYRA 1SKSA 4IO8A 4EUVA 5AQLA 4IO1A 2W4PA 5AQHA 4WWSA 1QE1A 2FGCA 1BHNA 1JJ2M 4XAKA 4XDCA 4AXJA 2Q2RA 2W40A 2IVMA 3FEZA 4DHVA 2AZ3A 3BO2A 1U1PA 5AZIB 1R6YA 5LM7E 3J7ZT 5GIPA 3O80A 4CJSA 5KTQA 2H1YA 3P5JA 2RF2B 3FEYB 2HLTA 5F2RA 2ZGYA 3HSTB 2V63A 4FJJA 2G1DA 1H6KX 4YDXA 3OW2M 2MZSA 4F4YA 3S3OA 3OQ2A 3PJ9A 2CQ2A 2IOCA 3CXCM 2E7XA 1SC3B 2UUBK 3VAJA 1GLEG 4GW6A 1LCUA 2DH8A 1WC0A 1SJ3P 1WG5A 1FW6A 1XMOF 1U04A 3AXMA 2DGTA 2YV0X 3WXMB 2B56A 4FWOA 3LDQA 2VGMA 4GVLA 2O8EB 1NCLA 1YX2A 4RZRA 2KHCA 4B9NA 2GV1A 1T9WA 3I5CA 3R3TA 3HK2A 5E26A 2QX0A 3S41A 2ZC3A 1W97L 2N3OA 3NOGA 1KLMB 1WORA 4LRAA 1WF1A 3FR0A 2OPPA 2PY5A 1I94F 1DT9A 1PO6A 3RSEA 1G4CA 2YKAA 2MJNA 3KKSA 4YHHF 1FWPA 3QRRA 2GGPB 1S1WA 1CSJA 1SH3A 4CO1A 1HX1A 4CTAB 2FJXA 1L3VA 5IT9U 4I4BA 2YKQA 2QSFA 5HVFA 4WFBQ 4ID5B 2O8FB 1S22A 4EBCA 1KVIA 5J2NB 1YUWA 2ZJPL 1CLFA 4DL0C 1FKPB 2OHDA 4C3LA 2AYGA 3FNNA 3CHWA 1C1CB 2VG6B 4CZGA 4JK9A 4ELTA 2M2BA 3U7JA 2YNFB 4RBVA 2DNYA 1S6UA 1BUPA 1YG0A 2FHMA 3WX4A 4NLYA 1RDBA 1LWEA 2CJXB 3AA3A 1WHVA 2XI3A 4L3NA 3I4HX 3H5UA 3MCMA 3IA0A 3WXLA 4EWTA 1KS2A 4KQZA 5BREA 4JNEA 2QFIA 5ETTA 3MN5A 3HF5A 1SS6A 2V9KA 1W2BR 1UETA 5AJ3F 4Z4CA 4LIRA 2B43A 1NMDA 2MY7A 3OYMA 4CF8A 4JOUA 4E7JA 1SQFA 4DL4A 4KSEB 2NREA 3SXLA 2DHXA 2R7XA 3RB6A 2L08A 1VLYA 2EI5A 3ZTSA 3OS0A 3K5MA 3MEDB 1FX2A 4ECVA 4JI4F 4GKKF 5EGYA 2RVJA 1S1UB 4WFZA 3SDEA 2KXFA 3SSRA 2OMOA 2BE9B 4YY3F 1F5AA 1HBUA 2KVIA 1N5TA 1VQYA 8ATCB 4J2EA 1XTZA 1Z1ZA 5A6WA 4R79A 5IOLA 2WONB 4S0MA 1FKOA 2N7YA 1QVFR 4IH7A 3TAQA 1S9EA 3CCSN 3AOCA 3BKUA 3K57A 3MM6A 4J9KA 3W3SA 5KT4A 1D09B 2P9UB 3MM8A 4ZTFA 3MPVA 1HPZB 2K3IA 1LW0A 1X4DA 3IO1A 4MYUA 2P9LA 1B0TA 3IKMA 2ALYB 1VQ6S 4DPOA 4CERA 5BPMA 4WFBL 3EZOA 2VG7B 2FSKA 2CQIA 2GGPA 3EZUA 1ZC6A 3TTFA 2Y1RI 1HJRA 4CLSA 3KG4A 2X1GA 5GAHU 3N6NA 2BUNA 1JWWA 4G1IA 2Q43A 4KI6A 4GY2B 1BG3A 2B9WA 2AYBA 3FZBA 1VQ7S 5BXIA 1TVRA 2HFVA 4K43A 1NHUA 1IKWA 4OFZA 5M1PA 1TZ0A 1FRJA 2ZOGA 2OPQA 4OX9F 3TZWA 3G9CA 2WSEC 3HLUA 2AGOA 3T5KA 3THXA 4B9MA 4EFAC 4DPUA 5KGWA 1VRUA 3CO0P 2KO1A 3ET6A 2YQ1A 5IWAJ 1WSHA 2LVWA 4M5IA 2J6TA 4I0WA 1BD6A 1DTTB 1ZBTA 4NLCA 2VHGA 3VGKA 2YNIB 4JI5F 4RO0A 1BL3A 4W90B 3ZZRA 1ZA2B 4K5SA 1U26A 4KHPK 2O4GA 3V9ZA 1HNXF 1TAUA 2M88A 1FRHA 2XLKA 1N0UA 1M5PC 1VQ5S 2AJFE 2BJ8A 2BE7D 4RW7B 3SBTA 2DGXA 4HH1A 2C1EB 1N32F 2X6NA 2MHNA 1FXDA 4DQSA 3M30A 2CJYB 3TZZA 3E9PA 2CPFA 4JI7F 1P27B 4TNOA 2DT9A 3VV2B 3MZIA 3EGWB 4H5WA 3SIPB 1J6ZA 4CEBA 3FLCO 4NLWA 3U3YA 3QWPA 2E66A 1FFWB 2HNDB 1H98A 2QO3A 3SUQA 1VR6A 4LF8F 4AILC 1B9DA 4TU8A 3GIKA 5D8HB 2Z2MA 2Q79A 2FZCB 1DZ5A 4ZLLA 2BXJA 4BG8A 4LF5F 2KM8B 1N34J 1JJ4A 1NJXA 3OA9A 4JI4K 4GKKK 4DTXA 3QESA 4WFYA 2NYIA 3QWUA 2BGGA 4D3HA 2BH1A 1TKXA 3KK7A 1LAVA 4Q5VA 1Q9XA 2GHPA 3MX5A 1VDHA 4JKBA 4KHNA 2V68A 4DR2J 3J7AN 4V19S 4CRJA 2W1BA 2XY6A 3JSMA 3CCQS 3NS7B 3MI7X 3EPGA 5AQYA 4NA1A 4CIEA 4V19J 3HHDA 4LY7A 4ILJA 3THWB 1NGCA 2NRTA 1S9GB 3C95A 3CCEN 1JXVA 4QQBA 3IWXA 3DOKA 4L6V3 2ABYA 2XQCA 3RMAA 1ZM4A 1U1MA 1BI4B 2PN6A 4LRFA 2QW9A 3I4PA 5LMNF 3CFPA 3O5TB 4B1UB 3B54A 4H4MA 2F65A 5A8KA 4JI1F 1YIJN 3UNGC 4C0BA 3QNOA 3JB9k 5KG7A 5HRSA 1FDAA 1BQNA 2ASYA 3T1HJ 1WELA 1KTQA 3L2VA 1U6FA 2AYMA 1BUXA 5J2QB 5ETOA 4ZPTR 4CJFA 1AA1B 3H6EA 3AB4B 3KLEA 1IBKJ 1OH8A 4USHA 3CPEA 4LF4F 3GONA 2ASDA 2XYPB 2A1BA 1RDCA 3J81U 3OSNA 3UO0A 3CPWM 1Y10A 4AFFA 2O8BA 4BBYA 2R7SA 4JBCA 4I6WA 2ZH1A 4JV5K 2GC8A 3GCWP 1CJVA 3WEEB 5L39A 1V4SA 3CCZA 3GIJA 3TJAA 3VEYA 3QEXA 2WONA 1GT8A 1HYSB 3TAMA 1IBKF 1REGX 1GLAG 1KQGB 3MCSA 5HO4A 1K0VA 4WZMA 4U7UK 2B4PA 2RMLA 3R5CA 3K9JA 1C1AA 4Y0FA 3LP3A 1IR1A 2X3DA 3FCVA 4RWTA 2FHJA 1K8KA 4IG3B 4JK8A 2W9CA 1YKWA 4PABA 3MPYA 4BCAA 4DQQA 4Z4HA 1R89A 1C4AA 2VG6A 4JP8A 2XMWA 2FB0A 3TANA 1Q0NA 5JLFA 3JS6A 1ATRA 1PYTA 4FJHA 5G0RA 1VQLN 5FPDA 1WBDA 3PM9A 5E0OA 4M3UA 4GMKA 2BQRA 3P6YC 4BRPA 2J6SA 1NG9A 2QK9A 3V9WA 2ZOFA 2ZH9A 2NLXA 4LFAF 1VQNS 4OYZA 1RBSA 5GIOA 2XO7A 3F5TA 4EI2A 2BUPA 5LXYA 1SH2A 3AH6A 3DYAA 4HHTA 1X5OA 1WEXA 3D45A 2H9ZA 1R6VA 3GR1A 4BROA 5HVHA 4CJKA 3AO5A 1PBAA 3KG0A 3CD6N 3DDKA 2ZF5O 5GADP 1YAGA 1HJOA 5H9FJ 2CJBA 2GJFA 4A5AA 3R5BA 1J2VA 2E1AA 1OO0B 2E8AA 3TYTA 4FK2A 3D6FB 3ZO7A 5KG2A 1HNIB 1GOAA 2MLZA 4HR2A 2YNHB 3V6KA 3S9HA 5HAOA 4K2JA 2WCXA 2AF6A 5IM0B 4TLQA 3NH2A 1WUUA 3H7HB 2ZBIA 4FJKA 1JQGA 4CJTA 4ANEA 4B1VA 4YHHJ 2RD5C 4YR2A 2Q6BA 1I94K 4WKRA 1N34K 4IG0B 1FJGF 2KFZA 1HQUB 3ZYYX 2CWKA 3EVWA 3ILLA 2FPHX 4DXLA 1ICEB 1U49A 1B99A 3GFYA 3NCQA 1VQOS 2D74B 4ZP8A 1LXNA 2M4MA 4O3NA 2Z57B 2VPZB 1MMLA 3WNEA 2HRTA 1QQCA 4NXMF 2OEKA 2QG9B 1VBZA 4X84A 3QBCA 2NRZA 4DV2F 3L4QA 3A2FA 3CJBA 3MN6A 2DNMA 1S1TB 2P6SA 3NGKA 1OKJA 1SXLA 1TKXB 1YJ9S 2JWKA 2C3YA 2HFNA 4HKQA 1S1UA 5H9EJ 2J5AA 3LW5C 2KJWA 4ZLJA 4MH8A 1T94A 1EXQA 2CWXA 5C2GA 1HD0A 3OYKA 3CJ8A 3ZZOA 5KFUA 1YSJA 2O3DA 4F7VA 1S77D 2E6LA 2ZKUA 4BRGA 4MDAA 3HP9A 3W64A 3HP6A 2B4OA 2PD1A 4DUTA 3BEXA 1Q9YA 3TR5A 2W24A 2G8KA 3BJYA 4ETXA 3VQBA 3PG9A 4DV7J 4O23A 4UY85 1W0HA 1RI7A 1TQLA 5JVHL 5AXKA 4NWBA 3VQ5A 5FRNA 1WKLA 4FN5A 2NZCA 4DS4A 4U9RA 4KC5A 2QMXA 1H0HB 3CSKA 2ILZA 4RBUA 5LOQA 2X1AA 4ZP9A 2ATQA 3AARA 2VQEK 2Z1HA 1JIHA 4CBXA 3OR2A 3BKTA 1NGFA 2HBMA 3AOAA 1W25A 3SLCA 2XCAA 2OYQA 4BRHA 5DM6L 1QAIA 2FIUA 2LQ9A 4DX7A 4RX6A 3HYFA 5AQNA 2D3ZA 2ZFHA 5AJ3K 2D3UA 4CEAA 4CYUB 4IR1A 3MM7B 2VGNA 3UN3A 2V4QA 3LPYA 3JTNA 2OPSA 1GLCG 1FA0A 2PZSA 3OY9A 2JGUA 4LVNP 2OFHX 2ROEA 1WC1A 1YRXA 5KFOA 3GU0A 2E2OA 3R1LA 4H5VA