4K0KK

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4k0kK00
5LL6Z 4JYAK 4DV1K 5BR8K 2UUBK 4LF5K 2VQEK 4GKKK 1XMQK 1XNRK 2UUCK 4LF6K 5LMNK 3J7AP 2UXCK 3JAMO 4DR6K 1HR0K 4JV5K 5IWAK 4DV7K 4AQYK 1J5EK 3T1HK 4DV4K 3J7YP 3OTOK 4LF8K 4JI4K 5A2QO 4DR5K 4DR1K 1FJGK 1N36K 4B3TK 3T1YK 4DUZK 4JI5K 1XNQK 5LMUK 1IBLK 4B3MK 4DV5K 2UXBK 1N34K 4K0KK 4GKJK 4JI6K 4JI0K 2E5LK 4DV3K 4JI7K 1HNWK 2UUAK 5IT9O 1XMOK 1N32K 4DR3K 4YY3K 4DV0K 4V19S 2VQFK 4NXNK 4OX9K 4DR2K 2UXDK 4JI8K 4NXMK 4X66K 5AJ3K 4CVNE 1IBMK 4LFAK 4B3RK 1HNXK 4DR4K 1IBKK 4LF9K 4X65K 4CW7B 4DV6K 4X62K 4LF7K 4DR7K 1I94K 2F4VK 2UU9K 4DUYK 1HNZK 2ZM6K 5FLXO 3J81O 4KHPK 3J80O 2HHHK 4B3SK 4LF4K 4JI2K 4X64K 4DV2K 4YHHK 1N33K 4LFBK 4JI1K 4JI3K 4LFCK
chains in the Genus database with same CATH superfamily
3E1YA 4O8KA 3U9DA 3AGKA 3MX2A 2BGGA 4E0DA 3CERA 2DPNA 3EE8A 3U3GA 1RDAA 2A42A 5HRNA 2R7YA 4C8MA 1XMQK 4KHSA 1ZC6A 4BRAA 2O8FA 2OA8A 3AVLA 3MDQA 3CC7N 2P9IB 4DR6K 4JV5K 3C6TA 4CGDA 5JICA 4LF8K 2IVOA 3THVA 4IEEA 4FWSA 3TAFA 5HP1A 4JRQA 1TKDA 1U04A 1KQSM 2ETJA 1FW6A 2BUPA 4B1YB 3S3NA 4M63C 3KD5E 3ZX0A 4BQZA 3EE9A 1RT3A 3DRPA 3F5TA 4JKAA 4AM7A 2D0AA 3PUFA 3D45A 1NJYA 4OPAA 1NK4A 3KD1E 3BGRA 4R79A 4JI5K 4KFBA 1M90O 4E7HA 1KD1O 1R59O 2QXLA 3WQTA 3AA4A 3MEGA 4IDHA 2HW3A 3R9PA 3AO4A 3TTDA 2A3ZA 2W41A 4BE2A 3AAPA 1NK6A 1ITGA 3VGLA 4KRFA 4MFBA 4JK8A 2YHAA 4IO9L 5FPDA 1SKSA 3MN9A 4KKOA 3GE1A 5BRFA 3SV3A 4FCYA 3ENBA 3K59A 3CJBA 2ZGYA 2Q97A 2DFEA 4B3RK 3H45C 4CHNA 3F9KA 3NHGA 4BC3A 2Q2RA 5JMVA 1XQSC 4FSVA 4QAGA 1YXQA 1TKXA 1Q9YA 5F1XA 3I33A 1C0FA 2RF2A 1WSIA 1RT1A 3L6QA 3AVAA 5FLXO 2Q31A 3HM8A 2HHHK 3CCQN 3R3LA 4LFBK 4Z4EA 5M1NA 3DXKA 4BRFA 4YOYA 4YORA 1Q82O 4KB0A 1X1PA 1SS6A 4DCHA 1A5WA 5AQRA 4E3SA 3I8DA 2UUCK 4BDPA 2HMPA 3HTVA 1WSGA 1HYZA 1KAZA 1VQLN 3I0SA 4R5PA 3R8EA 4RW7A 4JS4A 3CQ8A 4QS8A 3NDKA 4DV7K 1KVAA 4NYNA 1Z05A 3AVGA 3Q7BA 4CHQA 4YOTA 1QQOA 3OYLA 3VA0A 1B92A 1RILA 3KK7A 1W7AA 3C6UA 1JLCA 2E4LA 3SPZA 2YHXA 1N36K 1C0UA 4CF1A 2FC0A 2QA4N 4DKWA 1J53A 3VEWA 4DTNA 4BWMA 1Q9XA 4N76A 3WNFA 2I5JA 1V4SA 3O1WA 2XY6A 1RTHA 1ZXOA 4H0PA 1UWBA 3NFAA 1VQ8N 4GV9A 2YHBA 3U9ZA 3L2QA 3L0QA 3HL8A 1TUYA 4CEOA 4KREA 5M1KA 1T3VA 5CHIA 4H5VA 4O55A 3K5MA 2QI2A 4DU1A 2Z1JA 2NRHA 3G25A 4QOZB 1JLFA 1DLOA 2IS3A 3NF9A 3CC2N 4CF8A 4NYFA 1VQ6N 4E1JA 4LF9K 4C8LA 3G0ZA 2PZSA 4BRDA 1QZ6A 1TGOA 3TANA 4FJ7A 4CJKA 4EIAA 3V9UA 2E6MA 4PKHA 2NRWA 3RVCA 4C8OA 4IDKA 3FFIA 1CZBA 2GV9A 1OH7A 3PX0A 2F9TA 3AY9A 4PKIA 4CE9A 3OYEA 1TKTA 3M3ZA 4YOWA 3CJ9A 4DTMA 4G1QA 4MO4A 3ZT4A 4FK4A 4H0VB 1BHLA 2ASMA 3NH1A 2P9KB 1B9FA 3WNEA 4O4GA 2E1ZA 4BR0A 1J5OA 1XNRK 4E1MA 2IVNA 3OHRA 3EKUA 1MA9B 2OZMA 3SUQA 3VERA 3VGKA 4FZYA 1SV5A 1LCUA 3VQAA 3HPOA 2QM1A 2VYPA 1W2BM 5BPMA 1NOZA 4JI4K 1NMDA 4C1NI 4CZJA 4FOIA 4OKJA 1HYVA 1LOTB 1VQ9N 1FJGK 3SQ0A 1ZBFA 3U6FA 4DLGA 2PYJA 4JHDA 4DUZK 3BF1A 3O9QA 4MO5A 1BA1A 1GLEG 1S1VA 1D9DA 4DFPA 3V81A 4H0TB 1OVQA 4DSJA 4CF9A 1RT5A 4K0KK 2OPPA 5AQJA 3K5NA 1JL2A 3AGRA 2HOEA 3F9MA 2O8EB 3FZFA 4HVJA 1JLBA 4DB3A 2ZGZA 2GTDA 4FWMA 3P31A 3VA3A 5LJWA 3ULDA 3LWMA 3JS6A 4CFBA 1WOQA 1RTDA 2G8KA 3DXMA 4EHTA 4IEIA 5FRMA 2P9SA 4CI6A 1T8EA 5KI6A 3AVCA 2QKBA 1VSHA 4CIEA 3LP2A 4BR5A 5GADP 4DSKA 4FJGA 4W5NA 3P39A 2KZZA 2ZJPL 3ZSZA 1I94K 3OYAA 4DTRA 1ZBIA 3LWLA 1LAVA 1NGJA 1REVA 3NF6A 2D0PA 3KLFA 3QEWA 5K14A 1RNHA 4KHPK 4M3YA 3THWB 4E7KA 3PLAA 2E2PA 2FF6A 2X6NA 4DTSA 3CF5L 1JLEA 3AA2A 3D2EB 3CFRA 2ZJRL 2FF3B 1SKRA 4N56A 1LW2A 3HSTB 4Y1CA 4KH4A 3ZYYX 2O8FB 2IGIA 1VSIA 4CK2A 5IWAK 1KAYA 2I7PA 5HRPA 4F3TA 3L4IA 3IS9A 3A5OC 3HOSA 3WXIA 4IKFA 1CZ9A 2E2QA 4ZHRA 3VQ8A 3E66A 1P90A 4CGHA 3LPUA 3VQBA 2FSJA 3S3OA 1EWRA 4H5NA 3ALYA 2O4IA 3OBYA 5ELZA 1VQNN 4DU3A 1NWKA 4CGJA 3K58A 4H4OA 1VSEA 1NBWA 4C8NA 3C6HA 1X3MA 3LANA 4RW9A 3ZSWA 2P1JA 4PUOA 4KH6A 3O8MA 4JK7A 4RW6A 4CZLA 1HNWK 3CXCM 4AF1A 2VGNA 1KCFA 3OYHA 1TAUA 4LH5A 3BUZB 5BRDA 1NK0A 3BZCA 3K9JA 2A5XA 1L3VA 3O9SA 4CEDA 3O3HA 4CJVA 3OY9A 3RMAA 1XHZA 3SUOA 1S3XA 1IBKK 4A5AA 4OKKA 3THYB 3GDQA 1HNVA 5LJVA 4FWQA 4DLEA 1ATNA 4ID1A 2E88A 5M1PA 2HNYA 4M3ZA 3CJ1A 4B9QA 4J8FA 1KVCA 4YFUA 1QSSA 3B6PA 1S72N 2G8FA 3KWGA 3FZMA 1NJZA 3P38A 3H6EA 1EO1A 2BANA 4FWNA 5AQIA 5J2NA 5AQHA 4OKEA 2RHKA 5EX5A 1LW0A 2ZF5O 4FL9A 3OYFA 3DXKB 1GLCG 4JI3K 3HSCA 4B1ZA 1NGBA 4O8UA 1JLQA 3QFPA 3TAQA 2WOMA 4JYAK 3V1RA 3D2FA 5SWMA 5BR8K 4RW4A 4KV8A 3ZCMA 1E3MA 1CZAN 5HROA 1O13A 4JNEA 3MECA 3CD6N 3QEPA 1W97L 3M5RA 3JAMO 4J2DA 3N4PA 4BR2A 1X9SA 3SBTA 4B9SA 4NLCA 4JKBA 1UAXA 3KJVA 1EXQA 3OTOK 2HMIA 3D0PA 3TAGA 4CEQA 2E20A 4IFYA 4HUGA 4LY7A 1RT2A 1VQON 1H1VA 1IKWA 2WONA 3QETA 1FKPA 4BGBA 1BU6O 4E1NA 1YF5L 4E89A 3O3FA 2YNFA 3BP8A 4AHVA 3R1XA 2D0BA 1T44A 3M6GA 4M3XA 4XH5A 3EO3A 1ZBLA 4CBUA 1TV6A 1FXXA 2A1SA 3MMVA 1TL1A 4PA1A 3HVTA 4O0IA 2FSNA 2YKMA 2F8SA 3SCXA 3VEOA 2NRTA 4DTJA 1OH8A 4FWKA 3CCVN 3I0RA 4UQGA 3OS0A 5DMRA 1TVRA 1OVYA 1NU0A 3L3UA 3AVBA 2A6AA 3PSFA 3G10A 4O5FA 1IBMK 2G8WA 2ITMA 2YNHA 2Z1HA 5DM6L 4PL7A 1UA1A 1XWLA 4HTUA 4ISGA 3TPQA 1WB9A 4DV6K 1VRUA 2Y1IA 2PYLA 3M8SA 4J2EA 2O8DA 4FLYA 2D0CA 3QERA 3VQPA 2UU9K 4A59A 2EX3A 5GAGP 4Z4HA 1BI4A 1YJWN 3E01A 3OYDA 4IFVA 3PIOL 4OO1J 4BVOA 1N5YA 4FPBA 4WCEL 2VG7A 3HXMA 4PHTX 4CZFA 5DM7L 2GUPA 1Y64A 3DJCA 3U4LA 3AO5A 2P9NA 5EU7A 3ENOA 4E19A 4AHUA 3HOTA 4GMJB 4IXCA 3OYKA 1K6YA 3L8BA 4H0XB 4ID5A 5GIPA 3CCUN 5LMNK 1X9JA 4CF0A 3O08A 2AP1A 4B8AB 1D9FA 2PY5A 1D4XA 1XUPO 1QQMA 4KO0A 5AQPA 4DQQA 3AARA 3SBGA 1NKBA 3LM9A 4CIGA 5GIOA 1HYSA 4HUEA 1WNSA 3QFUA 2J4RA 1HKCA 1IO2A 5HRSA 1KTQA 4JHDB 1HRHA 3SLCA 3ZT0A 4QCLA 1Q86O 3MN7A 2GX9A 5AR0A 4DQPA 2XY5A 4PQUA 4Y1DA 4CD3A 3EY1A 5AQXA 3C65A 4B1WB 1S1TA 2RE2A 4GKJK 4JI6K 2OPSA 2YI1A 3W0LA 3ITHA 5ADXA 5GAHP 4CJFA 4IJAA 5C42A 5EVZA 4CZMA 3DXMB 4OGCA 4K42A 3TABA 4DS4A 2P9SB 2XRIA 4DV0K 4KTQA 3D7EO 2NZTA 4V19S 4I7FA 4CJ5A 3L2WA 3CHWA 3IDHA 5LY3A 2KFNA 1Y97A 5AJ3K 3WXKA 3VQCA 1T03A 2VCPA 3A5MC 4B9LA 4FWPA 1NGDA 3EEQA 1SL0A 1C1BA 1S9GA 2E1YA 3KLGA 1S1UA 1W0HA 3VQ9A 2QK9A 1ASUA 2G8VA 1S9EA 3QB0A 3QO9A 3ZT3A 2JGUA 3PX6A 4YHHK 4KI6A 1WN7A 5CE3A 3RMDA 2QWNA 2V7ZA 3H3NO 1IKVA 3I55N 4G9ZA 3HT3A 3V9SA 3DOLA 2DTUA 3KK2A 5AQWA 2GBZA 3VMFB 4CGGA 2EHGA 4O5BA 3THYA 3PO5A 4AHSA 4H8KA 5E84A 3VPZA 4DSFA 4FK0A 1DEJA 2PAVA 3SI6A 4CERA 1HR0K 3K5LA 4FJIA 2HBKA 4OVLA 1W9HA 2G8HA 1U2VA 1C6VA 4FO0A 2E8AA 4CJWA 3MN5A 3H08A 3KHYA 4WFNL 1YHQN 4NCBA 4FJXA 5F2RA 3ZSXA 5AQNA 2BH1A 3DYAA 4FJKA 5AQQA 4B9UA 3T69A 2VWBA 4DTUA 4ELUA 4KI4A 1BA0A 4JKFA 1GOBA 1RT4A 2QEXN 2Q3SA 5BPLA 4YNQA 1YUWA 4BDYA 1NM1A 2P9LA 2VWKA 3U3YA 1QVGM 1QZ5A 3KWIA 3KZBA 4A62A 4DF4A 4BC4A 1BIUA 2RKIA 4YY3K 1GLAG 5AQSA 2OYQA 2VQFK 3GBTA 2QWQA 1VQPN 3O6WA 3VQQA 1GLBG 1JJ2M 3PO4A 4OX9K 2W6LA 2YKNA 3K2PA 2FBYA 1WBBA 4YOUA 4CK1A 4BROA 5C12A 4BRPA 4X65K 4CW7B 5M1QA 3B6OA 1D8YA 1YJ9N 3IG1A 3ATVA 4W5OA 4B9TA 4H0OA 3ZT1A 4QS7A 4MLHA 2HB5A 4DQIA 4LC9B 1S5JA 4PY5A 2FLOA 3FLCO 4IO8A 3OYCA 1S1XA 1WLJA 4EP5A 3O1BA 4M42A 4MQ3A 2FSKA 4DMNA 4FZXC 3D2FB 1L5UA 4K43A 5MLCQ 4F8RA 4DV1K 3KK3A 1Q18A 4CGFA 3MCAB 3GL1A 4LF6K 2YHWA 2YHYA 5CYMA 3VQDA 4PWDA 3I56N 3M1FA 3KIOA 5H1SQ 1TKZA 4NCGA 4U67L 2QTDA 2Q0UA 2D0OA 3RR8A 4IWVA 4M7YA 1RBUA 4EHUA 4JLHA 3VF2A 1DGKN 3TR8A 1EX4A 2Y1JA 5A2QO 2X78A 1RT6A 2Z1GA 5HLFA 4DR5K 3T1AA 2NNWA 4DR1K 4EP4A 2O8BA 3T1YK 1YTAA 1D5AA 2W40A 3VGMA 5F0XA 1RT7A 1KLMA 4C1NK 2QW9A 4FK2A 3BZKA 3WT0A 3C0BA 5KTQA 1U4BA 3VETA 4JEPA 3KLHA 4FJ5A 2JLEA 1Z25A 1YVNA 1G15A 1RDUA 4BRCA 2YJFA 4CJRA 2BTFA 4Z4GA 1HUXA 4K8XA 3SAFA 2A40A 2WFBA 2IC3A 2HF3A 1TAQA 3ATUA 4O0JA 4BRNA 4M45A 3O4NA 4J2AA 1DTQA 4CJLA 5HOOA 1IJJA 1L3UA 5HBMA 4B1XB 4CBWA 3AO2A 5JVGL 1BISA 4E7JA 2UYTA 4ELVA 1RDWX 5C25A 3DLLL 4FVUA 2O8DB 1UA0A 5SZTA 1XC3A 1CLQA 1BI4B 3WXMB 1HNZK 2O8CA 1HPZA 3E9OA 4DQRA 1U49A 4KHQA 2G8IA 2ATQA 3MX5A 3DLGA 3BEXA 1I3AA 3FGUA 3SAHA 1TUUA 5J2PA 4DQ8A 3PSIA 4GVEA 4MLEA 1BDGA 5AQZA 2CGKA 4LFCK 5AQGA 4WQ4A 4FOEA 2P9NB 4WFAL 4HTLA 1M1KO 1L3TA 2YV0X 2O4GA 4NO7A 3M8RA 2V51B 4BREA 2KFZA 3ZSRA 4J2BA 3RRHA 4FVMA 1LV5A 1QSYA 3LP3A 4FJ9A 4IZ9A 4GKKK 3AVKA 4CEFA 3TSQA 4A2AA 4CCHA 1GLDG 1BGXT 3VQ6A 3J7AP 4WFBL 1QTMA 3DOKA 4LSNA 4OPHA 3A5NC 3LM2A 3LAMA 3SMPA 1FK9A 3HZ6A 1VQ5N 5JS2A 4JKEA 2GWKA 3V9WA 1IKYA 4CJQA 4FPAA 4L8RB 5AZIA 4IFEA 4BQLA 1Q7YO 3EZ5A 5KQ8A 4H0YB 3DLRA 4M7XA 3LDSA 1IBLK 5D3GA 4FM1A 3CQYA 3HYFA 4M3TA 1SUQA 3QEIA 5AQMA 5C2DA 1NGGA 4CJ7A 2A41A 4B1VA 4CJ4A 1GOCA 3IRXA 1YJNN 3VESA 1JCEA 2HVIA 3TAPA 4IG3A 3VENA 4KAZA 3QBWA 1N32K 4I2QA 1A5XA 4CZIA 1JXEA 2HHUA 4NXNK 4OPJA 2YNIA 2EWSA 1WSFA 2KLAA 3BY5A 5GINA 1E4FT 5AQYA 3NH2A 1T6DA 3PIPL 3RTVA 1G99A 1YAGA 2HHVA 3H1QA 3J8AA 3SUNA 1NGHA 2RPIA 3LZIA 3E9LA 4Z4FA 4H5TA 3ID8A 4OGEA 1RDDA 4XH4A 3LDOA 4KTZA 3O9UA 4BC2A 5JVHL 1KLNA 1NK9A 1CXUA 3SV4A 4NB4A 5AQKA 3J81O 3CCJN 5AFUA 3LP0A 4ZTFA 3J80O 3LDNA 3MXMA 1RBVA 1TYQA 3QDKA 1C1AA 3N4QA 2X6SA 3VOVA 3P83D 4BRMA 1VQ7N 4ILHA 5LL6Z 2PFUA 4F3OA 4FWOA 3A0IX 3IMXA 3UKRA 1MWKA 3AAQA 2IAJA 2UUBK 3RWUA 4LF5K 1HJOA 1FKOA 4JKGA 1HKBA 3G71N 1U2VB 1MU2A 2NRRA 3ZEUB 2VGMA 5BREA 3ZSYA 1L3SA 1Q8IA 1X9WA 3CFPA 2D1KA 5FPEA 2HNDA 4NLBA 3H1VX 3CMEN 3LDLA 4B9MA 3C94A 3MWPA 3C7NB 1YI2N 2GUIA 4FJNA 1K8KB 3G6EN 4FZZA 1JKHA 3CIPA 3SNNA 4RG8A 3OYNA 3AVNA 2P51A 5KQDA 1WAFA 3O9RA 4ILGB 1U45A 4HCBA 4GV6A 3WQUA 4JN4A 3HM9A 2P9LB 2AA4A 1E4GT 1LAWA 4ILJA 1BO5O 3AA3A 3RSEA 1Q81O 1B9DA 5AZJA 4CD1A 2E2OA 3KVGA 4DSIA 2GWJA 1HLUA 2XO7A 2QWPA 1GLLO 4CHPA 4GNIA 5M1FA 1RBTA 1SAZA 4DR2K 3NF8A 4CFAA 2P5GA 4AHRA 3ENHA 1NKCA 3GOIA 4WE1A 3DLEA 2FBTA 3A8YA 3S9HA 4C23A 1F21A 1S1WA 3EKSA 1ASVA 3F2KA 4DR7K 3HP9A 3VQ5A 4I6MA 1ATSA 4FLTA 4DUYK 3OBWA 4OLAA 5FPNA 1SKWA 5FDLA 1VSJA 4BRQA 4BR7A 4KH5A 1OH6A 4DV2K 3UKUA 5J2QA 2HSTA 1U47A 5CYQA 2KQ2A 2Q1NA 4JD2A 3O9TA 5KGXA 3LP1A 5KGWA 3NE6A 2NRZA 3SAGA 4CZKA 4DS5A 2B4JA 3O4QA 4B9NA 5KPZA 3ZX3A 1NGAA 2VG5A 3DLBA 2ZQBA 3FZKA 4H4MA 1QSLA 3J7YP 3V9XA 2P9UA 4I9LA 3KKSA 4KHUA 3ASMA 4U7BA 4JAXA 2VG6A 2CH6A 2FBXA 1RBRA 1JXBA 3TWHA 2E6LA 2O8BB 2PBDA 3LPTA 3WNGA 4A57A 2IOCA 1NGCA 3AA5X 3DMJA 5C15A 3MAQA 4CECA 4TSXA 5BN8A 3OS1A 4EAHD 1BIZA 1XHXA 4KBOA 3SYZA 1NK7A 2BDPA 2XY7A 2GELA 3TI0A 5C0YA 2Q0RA 4IG0A 4CJEA 3NCIA 4DV3K 4GW6A 2KZMA 5JS1A 3SQ2A 2BE2A 4W5TA 4MDBA 2P9PA 3WEEA 5GAEP 4WYBA 4FM0A 3ISNC 1VSLA 4B8CA 1MDUB 3RMBA 4UY8O 4CFDA 1P8ZA 2I7NA 3W3DA 2OPQA 4CJTA 3EYZA 1QHAA 3UIQA 1Z26A 4OPKA 3EZWA 4NXMK 4X66K 3KLIA 4CVNE 3CETA 3THXA 1SQKA 2F7TA 3SQ1A 2CGLA 4CBXA 4X62K 4LF7K 3J7ZO 3IUCA 1HQUA 1EETA 4DTXA 4L3QA 3C6AA 4A61A 4EZ9A 2O8CB 5C24A 3P1GA 2X74A 3P5JA 5J1EA 5AQUA 4B3SK 1C0TA 4XEIA 4ELTA 1BL3A 4JI1K 4B08A 1VQMN 2JWLA 4M3WA 1EQYA 4F2SA 3CM5A 4KPYA 1RDBA 4WQ5C 4CZGA 3HBTA 4OJRA 2NRVA 4IOXA 1VSFA 4NCAA 2WUSA 2HNZA 3KK1A 5EY4A 3HVRA 4M3RA 5AQVA 4FJHA 2B5JA 4EZ6A 5E26A 1T7PA 4FLVA 3FE1A 3CYMA 4ISFA 1DKGD 3OVNA 3WXJA 4MDAA 4BRGA 4YOVA 3O4WA 4AQYK 1J5EK 3H3OB 4CEBA 1HMVA 5BPNA 4BG9A 2HHWA 2ASOA 3OS2A 4JS5A 3VF4A 1YT3A 5AZIB 4DWIA 4B3TK 4RWTA 1RFQA 3NH0A 4GV3A 2NUBA 2OPRA 4IOAL 3H46O 2HHQA 3T19A 3O3GA 1C1CA 1HJRA 3VEZA 3VQ4A 2CGJA 2UXBK 5CR4A 4BR4A 4FJLA 4A2BA 4JI0K 3AVHA 3BF3A 3ZEUA 5I3UA 3ZSVA 4WQ4C 4DTOA 3IFRA 2D4WA 3LZJA 3L2UA 3OYGA 3V1QA 4DR3K 3C7NA 3DM2A 3TARA 2F96A 2VWJA 1JCGA 1K8KA 3HP6A 3NGYA 1R0AA 2UXDK 3QMLA 2A1RA 1ESVA 3NVKA 1VHXA 4H03B 4M3UA 4DR4K 2QWRA 3K9KA 1S6PA 3HPHA 5KPRA 1KAXA 3PV8A 3NMUA 5CZ1A 2KKZA 4A5BA 2HF4A 4BVPA 4Q5VA 2HBLA 2GEMA 5AQOA 2IVPA 1ZBUA 1VSMA 3HPGA 4AILC 1IH7A 1KVBA 1TYQB 3CI5A 5BR9A 4BE1A 1WAJA 1EWQA 2DY4A 4K41A 3M8PA 3ZSQA 4WF9L 4CEEA 1ATRA 4EFHA 3SQ4A 3HO1A 3L3VA 1BOTO 3CM6A 4Z4CA 3UKRB 5ADXH 1J54A 5M1OA 1OKJA 3WNHA 1TK0A 1UOCA 2OCEA 3DAWA 3SMSA 4N5SA 3JYTA 2VQEK 1YIJN 2YX6A 1JLAA 4JKGB 2HHXA 2QWLA 2ZD1A 4DFKA 4LH4A 4FJ8A 3CJ7A 3ULEA 4BRHA 4XH1A 5B8HA 3QEXA 3VEXA 1SL2A 3NVMA 5FPMA 4CK3A 3V1OA 2HHSA 4N41A 2LSNA 3F73A 2G8UA 1OH5A 4BC5A 1WSHA 2XY8A 4BY9C 3VTIA 4CZEA 3NGZA 3E9PA 1WSEA 4IJNA 4IOCL 4DV5K 3A2FA 2ZWHA 3VTHA 4CEZA 4YOXA 1BCMA 3RSEB 1QQNA 2HBJA 1BUPA 3SK3A 2E5LK 5AZJB 3JSMA 1XMOK 3EN9A 3LDQA 5FROA 1DT9A 4K25A 1WBDA 3NGIA 1RTJA 2ASPA 2DFHA 2Q36A 4FW2A 1KFDA 3TSUA 3SJJA 3CC4N 1N6QA 2F8TA 3VQ7A 4B9VA 4DF8A 3QLHA 3MXJA 4BWJA 3D6RA 4FWLA 1GLJO 4JI8K 1I39A 1RGIA 4LFAK 4Z4IA 3CCRN 1HNXK 3HRGA 4WQ5A 4N47A 2HBMA 1RDCA 3BDPA 1Z6RA 2QWOA 3I8BA 3OYJA 1JCFA 4FLWA 4I6MB 3AVJA 4CGIA 2HVHA 2OTJN 3QEVA 4DSLA 2IIRA 4GVMA 3SUPA 4B1UB 2ZM6K 1V4TA 5BN9A 4F2RA 3C95A 4DHYA 1NJWA 4LF4K 3UKUB 4Q0BA 3V9ZA 2KHOA 3OYMA 3CCMN 3P4IA 1YTUA 4ZTJA 1HNIA 1RCHA 1NGIA 3ZETA 1NG9A 1X3NA 4JD2B 3ZSOA 2XHBA 3MEDA 1IG8A 3TTFA 3CG7A 3PY8A 2YJEA 2YCHA 4HCCA 1BQNA 4F4KA 4FXDA 3T3FA 5CY4A 3MN6A 4KB1A 3DI6A 5AQTA 2P9IA 2P9UB 4BR9A 3CMAN 1NK8A 3NAEA 3K57A 3GG4A 5FRNA 2W6KA 3CFOA 3ID6A 4Z94A 3S41A 4K8ZA 3HK2A 1GOAA 4HUFA 5KRSA 4RCHA 4JKCA 2ZJQL 3TSPA 3ZX2A 1IV0A 1XNQK 1HKGA 3FZLA 3CPEA 1QHTA 2QWMA 3S3MA 4BRKA 5I9EB 1VQ4N 4KHWA 4B3MK 3V6DA 3OJUA 1NJIO 3TTCA 4AM6A 1X9MA 2FBVA 3A5LC 4B3OA 4C8KA 1VAZA 1HQEA 4JI7K 2P9PB 5JLFA 3WEEB 2V52B 2KW4A 1C0GA 4CFCA 4FLUA 3LALA 4PKGA 3QIPA 4LD0A 2ZE2A 3RR7A 3Q7CA 2WC9A 2OTLN 3CCLN 5KRTA 3CCSN 4AH9A 4H5RA 2OZSA 1K73O 4CZHA 3L4QA 4CHYA 3THXB 3QNOA 3HI0A 4O44A 5AQLA 1VK0A 4CHZA 3TU5A 1SZ2A 1CXQA 3AVMA 1ASWA 1DTTA 4DFJA 2QXFA 4Y0WA 3UB5A 3AVFA 1K8AO 1IG9A 3DWLA 3VN5A 1ZYQA 5EXWA 2B6AA 4M41A 2RN2A 4KTWA 1LWCA 3OYIA 4CIFA 4BACA 2FXUA 3O5BA 4CEAA 1NMNA 5E41A 1TK8A 1QVFM 1J6ZA 1BWFO 4X64K 4YDUC 3OJSA 3OA9A 4KHYA 3WXLA 3K0SA 1VSDA 4CJPA 3PX4A 3KLEA 5KPTA 4CJSA 4BRLA 4XIUA 1LWFA 4CJ3A 4I9QA 1JL1A 4AHTA 4CJUA 3AO3A 4BDZA 3TAEA 2NLXA 3MWTA 2UXCK 2DFFA 1T6CA 1ZBSA 4DTPA 1HPMA 4PL8A 4FWRA 1BG3A 3FFKB 1QQCA 4DV4K 3RRGA 3TAMA 4LSLA 4RTFD 4W5RA 3VEYA 4FLZA 4BE0A 1ILYA 1JLGA 3K5OA 3M8QA 5AQFA 5J2MA 3DRSA 2AJQA 4DSEA 2E2NA 3QICA 3QBXA 4I2PA 2CH5A 1VSKA 4E7IA 3B8AX 4DQSA 3O80A 1YVUA 5EOYA 4DFMA 1NGEA 3DLHA 2D5RA 5I42A 5IT9O 1S22A 3DRRA 4FYDA 3JXUA 4ISEA 4RW8A 2WTUA 3SJHA 1EP4A 4DG1A 3R6MA 3DLKA 5BRHA 3ZT2A 2F9WA 3QINA 2WBNA 4Z0UA 3CJCA 2P5OA 4FJMA 1TL3A 5TKYA 2H3GX 1NGFA 2QKKA 4E7LA 1ZBHA 4CF2A 3ZLJA 1GLFO 3FR0A 1WUAA 4CESA 3G4SN 2F4VK 1EKEA 5DK5A 1XC9A 4F9OA 1QE1A 4GY2B 3WUHA 3MXIA 3OYBA 4BRIA 1NNEA 4HWIA 1N8RO 1NOYA 4JKDA 1NLVA 1N33K 3FZHA 3CQXA 3QIOA 1BQMA 3RMCA 4W5QA 3L2VA 5HRRA 1LWEA 4JRPA 2P9KA 3CCEN 4IBNA 1IKXA 4FJJA 3CPWM 4BG8A 4FLXA 4FW1A 2JWKA 1VQKN 1XI1A 3QESA 5T7BA 3LL3A 3ULEB 2NRXA 3T1HK 3V4IA 1MWMA 1T05A 2V7YA 2HHTA 3IKMA 1C0MA 2OANA 1KSPA 3MEEA 3CJAA 3OW2M 1A5VA 3SPYA 2YNGA 3AV9A 3NF7A 1QS4A 4FM2A 1VRTA 3HJFA 3U8XA 5HL7L 5LMUK 5AFUH 1KRPA 5C10A 1N34K 3SZ2A 4JKHA 1NKEA 3LAKA 1K9MO 1SL1A 4H5WA 1TK5A 1RBSA 3AO1A 2UUAK 2O8EA 3KKRA 1S6QA 4AHCA 1KFSA 3AVIA 2Z1IA 3UE5A 1KC8O 3T7ZA 4KHNA 4OLBA 3LDPA 4CHOA 2ITGA 4YDUA 2KTQA 4HHTA 2IDOA 1U6ZA 1U48A 4JK9A 3VF6A 1KXPA 5JLHA 5CZ2A 4BGAA 5C2FA 1WSJA 1J9AA 3MCPA 1NJXA 3KTQA 3NBPA 4ICLA 4DU4A 3QNNA 3MK6A 1HX1A 1RTIA 3VQEA 3IAYA 1NK5A 3VEVA 4JI2K 2W42A 4QS9A 1YITN 3ZETB 3THWA 3EL2A 1O1WA 5TKWA 1BCOA 3L2RA 3D2EA
chains in the Genus database with same CATH topology
5LL6Z 4JYAK 4DV1K 5BR8K 2UUBK 4LF5K 2VQEK 4GKKK 1XMQK 1XNRK 2UUCK 4LF6K 5LMNK 3J7AP 2UXCK 3JAMO 4DR6K 1HR0K 4JV5K 5IWAK 4DV7K 4AQYK 1J5EK 3T1HK 4DV4K 3J7YP 3OTOK 4LF8K 4JI4K 5A2QO 4DR5K 4DR1K 1FJGK 1N36K 4B3TK 3T1YK 4DUZK 4JI5K 1XNQK 5LMUK 1IBLK 4B3MK 4DV5K 2UXBK 1N34K 4K0KK 4GKJK 4JI6K 4JI0K 2E5LK 4DV3K 4JI7K 1HNWK 2UUAK 5IT9O 1XMOK 1N32K 4DR3K 4YY3K 4DV0K 4V19S 2VQFK 4NXNK 4OX9K 4DR2K 2UXDK 4JI8K 4NXMK 4X66K 5AJ3K 4CVNE 1IBMK 4LFAK 4B3RK 1HNXK 4DR4K 1IBKK 4LF9K 4X65K 4CW7B 4DV6K 4X62K 4LF7K 4DR7K 1I94K 2F4VK 2UU9K 4DUYK 1HNZK 2ZM6K 5FLXO 3J81O 4KHPK 3J80O 2HHHK 4B3SK 4LF4K 4JI2K 4X64K 4DV2K 4YHHK 1N33K 4LFBK 4JI1K 4JI3K 4LFCK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LL6 Z;  4JYA K;  4DV1 K;  5BR8 K;  2UUB K;  4LF5 K;  2VQE K;  4GKK K;  1XMQ K;  1XNR K;  2UUC K;  4LF6 K;  5LMN K;  3J7A P;  2UXC K;  3JAM O;  4DR6 K;  1HR0 K;  4JV5 K;  5IWA K;  4DV7 K;  4AQY K;  1J5E K;  3T1H K;  4DV4 K;  3J7Y P;  3OTO K;  4LF8 K;  4JI4 K;  5A2Q O;  4DR5 K;  4DR1 K;  1FJG K;  1N36 K;  4B3T K;  3T1Y K;  4DUZ K;  4JI5 K;  1XNQ K;  5LMU K;  1IBL K;  4B3M K;  4DV5 K;  2UXB K;  1N34 K;  4K0K K;  4GKJ K;  4JI6 K;  4JI0 K;  2E5L K;  4DV3 K;  4JI7 K;  1HNW K;  2UUA K;  5IT9 O;  1XMO K;  1N32 K;  4DR3 K;  4YY3 K;  4DV0 K;  4V19 S;  2VQF K;  4NXN K;  4OX9 K;  4DR2 K;  2UXD K;  4JI8 K;  4NXM K;  4X66 K;  5AJ3 K;  4CVN E;  1IBM K;  4LFA K;  4B3R K;  1HNX K;  4DR4 K;  1IBK K;  4LF9 K;  4X65 K;  4CW7 B;  4DV6 K;  4X62 K;  4LF7 K;  4DR7 K;  1I94 K;  2F4V K;  2UU9 K;  4DUY K;  1HNZ K;  2ZM6 K;  5FLX O;  3J81 O;  4KHP K;  3J80 O;  2HHH K;  4B3S K;  4LF4 K;  4JI2 K;  4X64 K;  4DV2 K;  4YHH K;  1N33 K;  4LFB K;  4JI1 K;  4JI3 K;  4LFC K; 
#chains in the Genus database with same CATH topology
 3E1Y A;  4O8K A;  3U9D A;  3AGK A;  3MX2 A;  2BGG A;  4E0D A;  3CER A;  2DPN A;  3EE8 A;  3U3G A;  1RDA A;  2A42 A;  5HRN A;  2R7Y A;  4C8M A;  1XMQ K;  4KHS A;  1ZC6 A;  4BRA A;  2O8F A;  2OA8 A;  3AVL A;  3MDQ A;  3CC7 N;  2P9I B;  4DR6 K;  4JV5 K;  3C6T A;  4CGD A;  5JIC A;  4LF8 K;  2IVO A;  3THV A;  4IEE A;  4FWS A;  3TAF A;  5HP1 A;  4JRQ A;  1TKD A;  1U04 A;  1KQS M;  2ETJ A;  1FW6 A;  2BUP A;  4B1Y B;  3S3N A;  4M63 C;  3KD5 E;  3ZX0 A;  4BQZ A;  3EE9 A;  1RT3 A;  3DRP A;  3F5T A;  4JKA A;  4AM7 A;  2D0A A;  3PUF A;  3D45 A;  1NJY A;  4OPA A;  1NK4 A;  3KD1 E;  3BGR A;  4R79 A;  4JI5 K;  4KFB A;  1M90 O;  4E7H A;  1KD1 O;  1R59 O;  2QXL A;  3WQT A;  3AA4 A;  3MEG A;  4IDH A;  2HW3 A;  3R9P A;  3AO4 A;  3TTD A;  2A3Z A;  2W41 A;  4BE2 A;  3AAP A;  1NK6 A;  1ITG A;  3VGL A;  4KRF A;  4MFB A;  4JK8 A;  2YHA A;  4IO9 L;  5FPD A;  1SKS A;  3MN9 A;  4KKO A;  3GE1 A;  5BRF A;  3SV3 A;  4FCY A;  3ENB A;  3K59 A;  3CJB A;  2ZGY A;  2Q97 A;  2DFE A;  4B3R K;  3H45 C;  4CHN A;  3F9K A;  3NHG A;  4BC3 A;  2Q2R A;  5JMV A;  1XQS C;  4FSV A;  4QAG A;  1YXQ A;  1TKX A;  1Q9Y A;  5F1X A;  3I33 A;  1C0F A;  2RF2 A;  1WSI A;  1RT1 A;  3L6Q A;  3AVA A;  5FLX O;  2Q31 A;  3HM8 A;  2HHH K;  3CCQ N;  3R3L A;  4LFB K;  4Z4E A;  5M1N A;  3DXK A;  4BRF A;  4YOY A;  4YOR A;  1Q82 O;  4KB0 A;  1X1P A;  1SS6 A;  4DCH A;  1A5W A;  5AQR A;  4E3S A;  3I8D A;  2UUC K;  4BDP A;  2HMP A;  3HTV A;  1WSG A;  1HYZ A;  1KAZ A;  1VQL N;  3I0S A;  4R5P A;  3R8E A;  4RW7 A;  4JS4 A;  3CQ8 A;  4QS8 A;  3NDK A;  4DV7 K;  1KVA A;  4NYN A;  1Z05 A;  3AVG A;  3Q7B A;  4CHQ A;  4YOT A;  1QQO A;  3OYL A;  3VA0 A;  1B92 A;  1RIL A;  3KK7 A;  1W7A A;  3C6U A;  1JLC A;  2E4L A;  3SPZ A;  2YHX A;  1N36 K;  1C0U A;  4CF1 A;  2FC0 A;  2QA4 N;  4DKW A;  1J53 A;  3VEW A;  4DTN A;  4BWM A;  1Q9X A;  4N76 A;  3WNF A;  2I5J A;  1V4S A;  3O1W A;  2XY6 A;  1RTH A;  1ZXO A;  4H0P A;  1UWB A;  3NFA A;  1VQ8 N;  4GV9 A;  2YHB A;  3U9Z A;  3L2Q A;  3L0Q A;  3HL8 A;  1TUY A;  4CEO A;  4KRE A;  5M1K A;  1T3V A;  5CHI A;  4H5V A;  4O55 A;  3K5M A;  2QI2 A;  4DU1 A;  2Z1J A;  2NRH A;  3G25 A;  4QOZ B;  1JLF A;  1DLO A;  2IS3 A;  3NF9 A;  3CC2 N;  4CF8 A;  4NYF A;  1VQ6 N;  4E1J A;  4LF9 K;  4C8L A;  3G0Z A;  2PZS A;  4BRD A;  1QZ6 A;  1TGO A;  3TAN A;  4FJ7 A;  4CJK A;  4EIA A;  3V9U A;  2E6M A;  4PKH A;  2NRW A;  3RVC A;  4C8O A;  4IDK A;  3FFI A;  1CZB A;  2GV9 A;  1OH7 A;  3PX0 A;  2F9T A;  3AY9 A;  4PKI A;  4CE9 A;  3OYE A;  1TKT A;  3M3Z A;  4YOW A;  3CJ9 A;  4DTM A;  4G1Q A;  4MO4 A;  3ZT4 A;  4FK4 A;  4H0V B;  1BHL A;  2ASM A;  3NH1 A;  2P9K B;  1B9F A;  3WNE A;  4O4G A;  2E1Z A;  4BR0 A;  1J5O A;  1XNR K;  4E1M A;  2IVN A;  3OHR A;  3EKU A;  1MA9 B;  2OZM A;  3SUQ A;  3VER A;  3VGK A;  4FZY A;  1SV5 A;  1LCU A;  3VQA A;  3HPO A;  2QM1 A;  2VYP A;  1W2B M;  5BPM A;  1NOZ A;  4JI4 K;  1NMD A;  4C1N I;  4CZJ A;  4FOI A;  4OKJ A;  1HYV A;  1LOT B;  1VQ9 N;  1FJG K;  3SQ0 A;  1ZBF A;  3U6F A;  4DLG A;  2PYJ A;  4JHD A;  4DUZ K;  3BF1 A;  3O9Q A;  4MO5 A;  1BA1 A;  1GLE G;  1S1V A;  1D9D A;  4DFP A;  3V81 A;  4H0T B;  1OVQ A;  4DSJ A;  4CF9 A;  1RT5 A;  4K0K K;  2OPP A;  5AQJ A;  3K5N A;  1JL2 A;  3AGR A;  2HOE A;  3F9M A;  2O8E B;  3FZF A;  4HVJ A;  1JLB A;  4DB3 A;  2ZGZ A;  2GTD A;  4FWM A;  3P31 A;  3VA3 A;  5LJW A;  3ULD A;  3LWM A;  3JS6 A;  4CFB A;  1WOQ A;  1RTD A;  2G8K A;  3DXM A;  4EHT A;  4IEI A;  5FRM A;  2P9S A;  4CI6 A;  1T8E A;  5KI6 A;  3AVC A;  2QKB A;  1VSH A;  4CIE A;  3LP2 A;  4BR5 A;  5GAD P;  4DSK A;  4FJG A;  4W5N A;  3P39 A;  2KZZ A;  2ZJP L;  3ZSZ A;  1I94 K;  3OYA A;  4DTR A;  1ZBI A;  3LWL A;  1LAV A;  1NGJ A;  1REV A;  3NF6 A;  2D0P A;  3KLF A;  3QEW A;  5K14 A;  1RNH A;  4KHP K;  4M3Y A;  3THW B;  4E7K A;  3PLA A;  2E2P A;  2FF6 A;  2X6N A;  4DTS A;  3CF5 L;  1JLE A;  3AA2 A;  3D2E B;  3CFR A;  2ZJR L;  2FF3 B;  1SKR A;  4N56 A;  1LW2 A;  3HST B;  4Y1C A;  4KH4 A;  3ZYY X;  2O8F B;  2IGI A;  1VSI A;  4CK2 A;  5IWA K;  1KAY A;  2I7P A;  5HRP A;  4F3T A;  3L4I A;  3IS9 A;  3A5O C;  3HOS A;  3WXI A;  4IKF A;  1CZ9 A;  2E2Q A;  4ZHR A;  3VQ8 A;  3E66 A;  1P90 A;  4CGH A;  3LPU A;  3VQB A;  2FSJ A;  3S3O A;  1EWR A;  4H5N A;  3ALY A;  2O4I A;  3OBY A;  5ELZ A;  1VQN N;  4DU3 A;  1NWK A;  4CGJ A;  3K58 A;  4H4O A;  1VSE A;  1NBW A;  4C8N A;  3C6H A;  1X3M A;  3LAN A;  4RW9 A;  3ZSW A;  2P1J A;  4PUO A;  4KH6 A;  3O8M A;  4JK7 A;  4RW6 A;  4CZL A;  1HNW K;  3CXC M;  4AF1 A;  2VGN A;  1KCF A;  3OYH A;  1TAU A;  4LH5 A;  3BUZ B;  5BRD A;  1NK0 A;  3BZC A;  3K9J A;  2A5X A;  1L3V A;  3O9S A;  4CED A;  3O3H A;  4CJV A;  3OY9 A;  3RMA A;  1XHZ A;  3SUO A;  1S3X A;  1IBK K;  4A5A A;  4OKK A;  3THY B;  3GDQ A;  1HNV A;  5LJV A;  4FWQ A;  4DLE A;  1ATN A;  4ID1 A;  2E88 A;  5M1P A;  2HNY A;  4M3Z A;  3CJ1 A;  4B9Q A;  4J8F A;  1KVC A;  4YFU A;  1QSS A;  3B6P A;  1S72 N;  2G8F A;  3KWG A;  3FZM A;  1NJZ A;  3P38 A;  3H6E A;  1EO1 A;  2BAN A;  4FWN A;  5AQI A;  5J2N A;  5AQH A;  4OKE A;  2RHK A;  5EX5 A;  1LW0 A;  2ZF5 O;  4FL9 A;  3OYF A;  3DXK B;  1GLC G;  4JI3 K;  3HSC A;  4B1Z A;  1NGB A;  4O8U A;  1JLQ A;  3QFP A;  3TAQ A;  2WOM A;  4JYA K;  3V1R A;  3D2F A;  5SWM A;  5BR8 K;  4RW4 A;  4KV8 A;  3ZCM A;  1E3M A;  1CZA N;  5HRO A;  1O13 A;  4JNE A;  3MEC A;  3CD6 N;  3QEP A;  1W97 L;  3M5R A;  3JAM O;  4J2D A;  3N4P A;  4BR2 A;  1X9S A;  3SBT A;  4B9S A;  4NLC A;  4JKB A;  1UAX A;  3KJV A;  1EXQ A;  3OTO K;  2HMI A;  3D0P A;  3TAG A;  4CEQ A;  2E20 A;  4IFY A;  4HUG A;  4LY7 A;  1RT2 A;  1VQO N;  1H1V A;  1IKW A;  2WON A;  3QET A;  1FKP A;  4BGB A;  1BU6 O;  4E1N A;  1YF5 L;  4E89 A;  3O3F A;  2YNF A;  3BP8 A;  4AHV A;  3R1X A;  2D0B A;  1T44 A;  3M6G A;  4M3X A;  4XH5 A;  3EO3 A;  1ZBL A;  4CBU A;  1TV6 A;  1FXX A;  2A1S A;  3MMV A;  1TL1 A;  4PA1 A;  3HVT A;  4O0I A;  2FSN A;  2YKM A;  2F8S A;  3SCX A;  3VEO A;  2NRT A;  4DTJ A;  1OH8 A;  4FWK A;  3CCV N;  3I0R A;  4UQG A;  3OS0 A;  5DMR A;  1TVR A;  1OVY A;  1NU0 A;  3L3U A;  3AVB A;  2A6A A;  3PSF A;  3G10 A;  4O5F A;  1IBM K;  2G8W A;  2ITM A;  2YNH A;  2Z1H A;  5DM6 L;  4PL7 A;  1UA1 A;  1XWL A;  4HTU A;  4ISG A;  3TPQ A;  1WB9 A;  4DV6 K;  1VRU A;  2Y1I A;  2PYL A;  3M8S A;  4J2E A;  2O8D A;  4FLY A;  2D0C A;  3QER A;  3VQP A;  2UU9 K;  4A59 A;  2EX3 A;  5GAG P;  4Z4H A;  1BI4 A;  1YJW N;  3E01 A;  3OYD A;  4IFV A;  3PIO L;  4OO1 J;  4BVO A;  1N5Y A;  4FPB A;  4WCE L;  2VG7 A;  3HXM A;  4PHT X;  4CZF A;  5DM7 L;  2GUP A;  1Y64 A;  3DJC A;  3U4L A;  3AO5 A;  2P9N A;  5EU7 A;  3ENO A;  4E19 A;  4AHU A;  3HOT A;  4GMJ B;  4IXC A;  3OYK A;  1K6Y A;  3L8B A;  4H0X B;  4ID5 A;  5GIP A;  3CCU N;  5LMN K;  1X9J A;  4CF0 A;  3O08 A;  2AP1 A;  4B8A B;  1D9F A;  2PY5 A;  1D4X A;  1XUP O;  1QQM A;  4KO0 A;  5AQP A;  4DQQ A;  3AAR A;  3SBG A;  1NKB A;  3LM9 A;  4CIG A;  5GIO A;  1HYS A;  4HUE A;  1WNS A;  3QFU A;  2J4R A;  1HKC A;  1IO2 A;  5HRS A;  1KTQ A;  4JHD B;  1HRH A;  3SLC A;  3ZT0 A;  4QCL A;  1Q86 O;  3MN7 A;  2GX9 A;  5AR0 A;  4DQP A;  2XY5 A;  4PQU A;  4Y1D A;  4CD3 A;  3EY1 A;  5AQX A;  3C65 A;  4B1W B;  1S1T A;  2RE2 A;  4GKJ K;  4JI6 K;  2OPS A;  2YI1 A;  3W0L A;  3ITH A;  5ADX A;  5GAH P;  4CJF A;  4IJA A;  5C42 A;  5EVZ A;  4CZM A;  3DXM B;  4OGC A;  4K42 A;  3TAB A;  4DS4 A;  2P9S B;  2XRI A;  4DV0 K;  4KTQ A;  3D7E O;  2NZT A;  4V19 S;  4I7F A;  4CJ5 A;  3L2W A;  3CHW A;  3IDH A;  5LY3 A;  2KFN A;  1Y97 A;  5AJ3 K;  3WXK A;  3VQC A;  1T03 A;  2VCP A;  3A5M C;  4B9L A;  4FWP A;  1NGD A;  3EEQ A;  1SL0 A;  1C1B A;  1S9G A;  2E1Y A;  3KLG A;  1S1U A;  1W0H A;  3VQ9 A;  2QK9 A;  1ASU A;  2G8V A;  1S9E A;  3QB0 A;  3QO9 A;  3ZT3 A;  2JGU A;  3PX6 A;  4YHH K;  4KI6 A;  1WN7 A;  5CE3 A;  3RMD A;  2QWN A;  2V7Z A;  3H3N O;  1IKV A;  3I55 N;  4G9Z A;  3HT3 A;  3V9S A;  3DOL A;  2DTU A;  3KK2 A;  5AQW A;  2GBZ A;  3VMF B;  4CGG A;  2EHG A;  4O5B A;  3THY A;  3PO5 A;  4AHS A;  4H8K A;  5E84 A;  3VPZ A;  4DSF A;  4FK0 A;  1DEJ A;  2PAV A;  3SI6 A;  4CER A;  1HR0 K;  3K5L A;  4FJI A;  2HBK A;  4OVL A;  1W9H A;  2G8H A;  1U2V A;  1C6V A;  4FO0 A;  2E8A A;  4CJW A;  3MN5 A;  3H08 A;  3KHY A;  4WFN L;  1YHQ N;  4NCB A;  4FJX A;  5F2R A;  3ZSX A;  5AQN A;  2BH1 A;  3DYA A;  4FJK A;  5AQQ A;  4B9U A;  3T69 A;  2VWB A;  4DTU A;  4ELU A;  4KI4 A;  1BA0 A;  4JKF A;  1GOB A;  1RT4 A;  2QEX N;  2Q3S A;  5BPL A;  4YNQ A;  1YUW A;  4BDY A;  1NM1 A;  2P9L A;  2VWK A;  3U3Y A;  1QVG M;  1QZ5 A;  3KWI A;  3KZB A;  4A62 A;  4DF4 A;  4BC4 A;  1BIU A;  2RKI A;  4YY3 K;  1GLA G;  5AQS A;  2OYQ A;  2VQF K;  3GBT A;  2QWQ A;  1VQP N;  3O6W A;  3VQQ A;  1GLB G;  1JJ2 M;  3PO4 A;  4OX9 K;  2W6L A;  2YKN A;  3K2P A;  2FBY A;  1WBB A;  4YOU A;  4CK1 A;  4BRO A;  5C12 A;  4BRP A;  4X65 K;  4CW7 B;  5M1Q A;  3B6O A;  1D8Y A;  1YJ9 N;  3IG1 A;  3ATV A;  4W5O A;  4B9T A;  4H0O A;  3ZT1 A;  4QS7 A;  4MLH A;  2HB5 A;  4DQI A;  4LC9 B;  1S5J A;  4PY5 A;  2FLO A;  3FLC O;  4IO8 A;  3OYC A;  1S1X A;  1WLJ A;  4EP5 A;  3O1B A;  4M42 A;  4MQ3 A;  2FSK A;  4DMN A;  4FZX C;  3D2F B;  1L5U A;  4K43 A;  5MLC Q;  4F8R A;  4DV1 K;  3KK3 A;  1Q18 A;  4CGF A;  3MCA B;  3GL1 A;  4LF6 K;  2YHW A;  2YHY A;  5CYM A;  3VQD A;  4PWD A;  3I56 N;  3M1F A;  3KIO A;  5H1S Q;  1TKZ A;  4NCG A;  4U67 L;  2QTD A;  2Q0U A;  2D0O A;  3RR8 A;  4IWV A;  4M7Y A;  1RBU A;  4EHU A;  4JLH A;  3VF2 A;  1DGK N;  3TR8 A;  1EX4 A;  2Y1J A;  5A2Q O;  2X78 A;  1RT6 A;  2Z1G A;  5HLF A;  4DR5 K;  3T1A A;  2NNW A;  4DR1 K;  4EP4 A;  2O8B A;  3T1Y K;  1YTA A;  1D5A A;  2W40 A;  3VGM A;  5F0X A;  1RT7 A;  1KLM A;  4C1N K;  2QW9 A;  4FK2 A;  3BZK A;  3WT0 A;  3C0B A;  5KTQ A;  1U4B A;  3VET A;  4JEP A;  3KLH A;  4FJ5 A;  2JLE A;  1Z25 A;  1YVN A;  1G15 A;  1RDU A;  4BRC A;  2YJF A;  4CJR A;  2BTF A;  4Z4G A;  1HUX A;  4K8X A;  3SAF A;  2A40 A;  2WFB A;  2IC3 A;  2HF3 A;  1TAQ A;  3ATU A;  4O0J A;  4BRN A;  4M45 A;  3O4N A;  4J2A A;  1DTQ A;  4CJL A;  5HOO A;  1IJJ A;  1L3U A;  5HBM A;  4B1X B;  4CBW A;  3AO2 A;  5JVG L;  1BIS A;  4E7J A;  2UYT A;  4ELV A;  1RDW X;  5C25 A;  3DLL L;  4FVU A;  2O8D B;  1UA0 A;  5SZT A;  1XC3 A;  1CLQ A;  1BI4 B;  3WXM B;  1HNZ K;  2O8C A;  1HPZ A;  3E9O A;  4DQR A;  1U49 A;  4KHQ A;  2G8I A;  2ATQ A;  3MX5 A;  3DLG A;  3BEX A;  1I3A A;  3FGU A;  3SAH A;  1TUU A;  5J2P A;  4DQ8 A;  3PSI A;  4GVE A;  4MLE A;  1BDG A;  5AQZ A;  2CGK A;  4LFC K;  5AQG A;  4WQ4 A;  4FOE A;  2P9N B;  4WFA L;  4HTL A;  1M1K O;  1L3T A;  2YV0 X;  2O4G A;  4NO7 A;  3M8R A;  2V51 B;  4BRE A;  2KFZ A;  3ZSR A;  4J2B A;  3RRH A;  4FVM A;  1LV5 A;  1QSY A;  3LP3 A;  4FJ9 A;  4IZ9 A;  4GKK K;  3AVK A;  4CEF A;  3TSQ A;  4A2A A;  4CCH A;  1GLD G;  1BGX T;  3VQ6 A;  3J7A P;  4WFB L;  1QTM A;  3DOK A;  4LSN A;  4OPH A;  3A5N C;  3LM2 A;  3LAM A;  3SMP A;  1FK9 A;  3HZ6 A;  1VQ5 N;  5JS2 A;  4JKE A;  2GWK A;  3V9W A;  1IKY A;  4CJQ A;  4FPA A;  4L8R B;  5AZI A;  4IFE A;  4BQL A;  1Q7Y O;  3EZ5 A;  5KQ8 A;  4H0Y B;  3DLR A;  4M7X A;  3LDS A;  1IBL K;  5D3G A;  4FM1 A;  3CQY A;  3HYF A;  4M3T A;  1SUQ A;  3QEI A;  5AQM A;  5C2D A;  1NGG A;  4CJ7 A;  2A41 A;  4B1V A;  4CJ4 A;  1GOC A;  3IRX A;  1YJN N;  3VES A;  1JCE A;  2HVI A;  3TAP A;  4IG3 A;  3VEN A;  4KAZ A;  3QBW A;  1N32 K;  4I2Q A;  1A5X A;  4CZI A;  1JXE A;  2HHU A;  4NXN K;  4OPJ A;  2YNI A;  2EWS A;  1WSF A;  2KLA A;  3BY5 A;  5GIN A;  1E4F T;  5AQY A;  3NH2 A;  1T6D A;  3PIP L;  3RTV A;  1G99 A;  1YAG A;  2HHV A;  3H1Q A;  3J8A A;  3SUN A;  1NGH A;  2RPI A;  3LZI A;  3E9L A;  4Z4F A;  4H5T A;  3ID8 A;  4OGE A;  1RDD A;  4XH4 A;  3LDO A;  4KTZ A;  3O9U A;  4BC2 A;  5JVH L;  1KLN A;  1NK9 A;  1CXU A;  3SV4 A;  4NB4 A;  5AQK A;  3J81 O;  3CCJ N;  5AFU A;  3LP0 A;  4ZTF A;  3J80 O;  3LDN A;  3MXM A;  1RBV A;  1TYQ A;  3QDK A;  1C1A A;  3N4Q A;  2X6S A;  3VOV A;  3P83 D;  4BRM A;  1VQ7 N;  4ILH A;  5LL6 Z;  2PFU A;  4F3O A;  4FWO A;  3A0I X;  3IMX A;  3UKR A;  1MWK A;  3AAQ A;  2IAJ A;  2UUB K;  3RWU A;  4LF5 K;  1HJO A;  1FKO A;  4JKG A;  1HKB A;  3G71 N;  1U2V B;  1MU2 A;  2NRR A;  3ZEU B;  2VGM A;  5BRE A;  3ZSY A;  1L3S A;  1Q8I A;  1X9W A;  3CFP A;  2D1K A;  5FPE A;  2HND A;  4NLB A;  3H1V X;  3CME N;  3LDL A;  4B9M A;  3C94 A;  3MWP A;  3C7N B;  1YI2 N;  2GUI A;  4FJN A;  1K8K B;  3G6E N;  4FZZ A;  1JKH A;  3CIP A;  3SNN A;  4RG8 A;  3OYN A;  3AVN A;  2P51 A;  5KQD A;  1WAF A;  3O9R A;  4ILG B;  1U45 A;  4HCB A;  4GV6 A;  3WQU A;  4JN4 A;  3HM9 A;  2P9L B;  2AA4 A;  1E4G T;  1LAW A;  4ILJ A;  1BO5 O;  3AA3 A;  3RSE A;  1Q81 O;  1B9D A;  5AZJ A;  4CD1 A;  2E2O A;  3KVG A;  4DSI A;  2GWJ A;  1HLU A;  2XO7 A;  2QWP A;  1GLL O;  4CHP A;  4GNI A;  5M1F A;  1RBT A;  1SAZ A;  4DR2 K;  3NF8 A;  4CFA A;  2P5G A;  4AHR A;  3ENH A;  1NKC A;  3GOI A;  4WE1 A;  3DLE A;  2FBT A;  3A8Y A;  3S9H A;  4C23 A;  1F21 A;  1S1W A;  3EKS A;  1ASV A;  3F2K A;  4DR7 K;  3HP9 A;  3VQ5 A;  4I6M A;  1ATS A;  4FLT A;  4DUY K;  3OBW A;  4OLA A;  5FPN A;  1SKW A;  5FDL A;  1VSJ A;  4BRQ A;  4BR7 A;  4KH5 A;  1OH6 A;  4DV2 K;  3UKU A;  5J2Q A;  2HST A;  1U47 A;  5CYQ A;  2KQ2 A;  2Q1N A;  4JD2 A;  3O9T A;  5KGX A;  3LP1 A;  5KGW A;  3NE6 A;  2NRZ A;  3SAG A;  4CZK A;  4DS5 A;  2B4J A;  3O4Q A;  4B9N A;  5KPZ A;  3ZX3 A;  1NGA A;  2VG5 A;  3DLB A;  2ZQB A;  3FZK A;  4H4M A;  1QSL A;  3J7Y P;  3V9X A;  2P9U A;  4I9L A;  3KKS A;  4KHU A;  3ASM A;  4U7B A;  4JAX A;  2VG6 A;  2CH6 A;  2FBX A;  1RBR A;  1JXB A;  3TWH A;  2E6L A;  2O8B B;  2PBD A;  3LPT A;  3WNG A;  4A57 A;  2IOC A;  1NGC A;  3AA5 X;  3DMJ A;  5C15 A;  3MAQ A;  4CEC A;  4TSX A;  5BN8 A;  3OS1 A;  4EAH D;  1BIZ A;  1XHX A;  4KBO A;  3SYZ A;  1NK7 A;  2BDP A;  2XY7 A;  2GEL A;  3TI0 A;  5C0Y A;  2Q0R A;  4IG0 A;  4CJE A;  3NCI A;  4DV3 K;  4GW6 A;  2KZM A;  5JS1 A;  3SQ2 A;  2BE2 A;  4W5T A;  4MDB A;  2P9P A;  3WEE A;  5GAE P;  4WYB A;  4FM0 A;  3ISN C;  1VSL A;  4B8C A;  1MDU B;  3RMB A;  4UY8 O;  4CFD A;  1P8Z A;  2I7N A;  3W3D A;  2OPQ A;  4CJT A;  3EYZ A;  1QHA A;  3UIQ A;  1Z26 A;  4OPK A;  3EZW A;  4NXM K;  4X66 K;  3KLI A;  4CVN E;  3CET A;  3THX A;  1SQK A;  2F7T A;  3SQ1 A;  2CGL A;  4CBX A;  4X62 K;  4LF7 K;  3J7Z O;  3IUC A;  1HQU A;  1EET A;  4DTX A;  4L3Q A;  3C6A A;  4A61 A;  4EZ9 A;  2O8C B;  5C24 A;  3P1G A;  2X74 A;  3P5J A;  5J1E A;  5AQU A;  4B3S K;  1C0T A;  4XEI A;  4ELT A;  1BL3 A;  4JI1 K;  4B08 A;  1VQM N;  2JWL A;  4M3W A;  1EQY A;  4F2S A;  3CM5 A;  4KPY A;  1RDB A;  4WQ5 C;  4CZG A;  3HBT A;  4OJR A;  2NRV A;  4IOX A;  1VSF A;  4NCA A;  2WUS A;  2HNZ A;  3KK1 A;  5EY4 A;  3HVR A;  4M3R A;  5AQV A;  4FJH A;  2B5J A;  4EZ6 A;  5E26 A;  1T7P A;  4FLV A;  3FE1 A;  3CYM A;  4ISF A;  1DKG D;  3OVN A;  3WXJ A;  4MDA A;  4BRG A;  4YOV A;  3O4W A;  4AQY K;  1J5E K;  3H3O B;  4CEB A;  1HMV A;  5BPN A;  4BG9 A;  2HHW A;  2ASO A;  3OS2 A;  4JS5 A;  3VF4 A;  1YT3 A;  5AZI B;  4DWI A;  4B3T K;  4RWT A;  1RFQ A;  3NH0 A;  4GV3 A;  2NUB A;  2OPR A;  4IOA L;  3H46 O;  2HHQ A;  3T19 A;  3O3G A;  1C1C A;  1HJR A;  3VEZ A;  3VQ4 A;  2CGJ A;  2UXB K;  5CR4 A;  4BR4 A;  4FJL A;  4A2B A;  4JI0 K;  3AVH A;  3BF3 A;  3ZEU A;  5I3U A;  3ZSV A;  4WQ4 C;  4DTO A;  3IFR A;  2D4W A;  3LZJ A;  3L2U A;  3OYG A;  3V1Q A;  4DR3 K;  3C7N A;  3DM2 A;  3TAR A;  2F96 A;  2VWJ A;  1JCG A;  1K8K A;  3HP6 A;  3NGY A;  1R0A A;  2UXD K;  3QML A;  2A1R A;  1ESV A;  3NVK A;  1VHX A;  4H03 B;  4M3U A;  4DR4 K;  2QWR A;  3K9K A;  1S6P A;  3HPH A;  5KPR A;  1KAX A;  3PV8 A;  3NMU A;  5CZ1 A;  2KKZ A;  4A5B A;  2HF4 A;  4BVP A;  4Q5V A;  2HBL A;  2GEM A;  5AQO A;  2IVP A;  1ZBU A;  1VSM A;  3HPG A;  4AIL C;  1IH7 A;  1KVB A;  1TYQ B;  3CI5 A;  5BR9 A;  4BE1 A;  1WAJ A;  1EWQ A;  2DY4 A;  4K41 A;  3M8P A;  3ZSQ A;  4WF9 L;  4CEE A;  1ATR A;  4EFH A;  3SQ4 A;  3HO1 A;  3L3V A;  1BOT O;  3CM6 A;  4Z4C A;  3UKR B;  5ADX H;  1J54 A;  5M1O A;  1OKJ A;  3WNH A;  1TK0 A;  1UOC A;  2OCE A;  3DAW A;  3SMS A;  4N5S A;  3JYT A;  2VQE K;  1YIJ N;  2YX6 A;  1JLA A;  4JKG B;  2HHX A;  2QWL A;  2ZD1 A;  4DFK A;  4LH4 A;  4FJ8 A;  3CJ7 A;  3ULE A;  4BRH A;  4XH1 A;  5B8H A;  3QEX A;  3VEX A;  1SL2 A;  3NVM A;  5FPM A;  4CK3 A;  3V1O A;  2HHS A;  4N41 A;  2LSN A;  3F73 A;  2G8U A;  1OH5 A;  4BC5 A;  1WSH A;  2XY8 A;  4BY9 C;  3VTI A;  4CZE A;  3NGZ A;  3E9P A;  1WSE A;  4IJN A;  4IOC L;  4DV5 K;  3A2F A;  2ZWH A;  3VTH A;  4CEZ A;  4YOX A;  1BCM A;  3RSE B;  1QQN A;  2HBJ A;  1BUP A;  3SK3 A;  2E5L K;  5AZJ B;  3JSM A;  1XMO K;  3EN9 A;  3LDQ A;  5FRO A;  1DT9 A;  4K25 A;  1WBD A;  3NGI A;  1RTJ A;  2ASP A;  2DFH A;  2Q36 A;  4FW2 A;  1KFD A;  3TSU A;  3SJJ A;  3CC4 N;  1N6Q A;  2F8T A;  3VQ7 A;  4B9V A;  4DF8 A;  3QLH A;  3MXJ A;  4BWJ A;  3D6R A;  4FWL A;  1GLJ O;  4JI8 K;  1I39 A;  1RGI A;  4LFA K;  4Z4I A;  3CCR N;  1HNX K;  3HRG A;  4WQ5 A;  4N47 A;  2HBM A;  1RDC A;  3BDP A;  1Z6R A;  2QWO A;  3I8B A;  3OYJ A;  1JCF A;  4FLW A;  4I6M B;  3AVJ A;  4CGI A;  2HVH A;  2OTJ N;  3QEV A;  4DSL A;  2IIR A;  4GVM A;  3SUP A;  4B1U B;  2ZM6 K;  1V4T A;  5BN9 A;  4F2R A;  3C95 A;  4DHY A;  1NJW A;  4LF4 K;  3UKU B;  4Q0B A;  3V9Z A;  2KHO A;  3OYM A;  3CCM N;  3P4I A;  1YTU A;  4ZTJ A;  1HNI A;  1RCH A;  1NGI A;  3ZET A;  1NG9 A;  1X3N A;  4JD2 B;  3ZSO A;  2XHB A;  3MED A;  1IG8 A;  3TTF A;  3CG7 A;  3PY8 A;  2YJE A;  2YCH A;  4HCC A;  1BQN A;  4F4K A;  4FXD A;  3T3F A;  5CY4 A;  3MN6 A;  4KB1 A;  3DI6 A;  5AQT A;  2P9I A;  2P9U B;  4BR9 A;  3CMA N;  1NK8 A;  3NAE A;  3K57 A;  3GG4 A;  5FRN A;  2W6K A;  3CFO A;  3ID6 A;  4Z94 A;  3S41 A;  4K8Z A;  3HK2 A;  1GOA A;  4HUF A;  5KRS A;  4RCH A;  4JKC A;  2ZJQ L;  3TSP A;  3ZX2 A;  1IV0 A;  1XNQ K;  1HKG A;  3FZL A;  3CPE A;  1QHT A;  2QWM A;  3S3M A;  4BRK A;  5I9E B;  1VQ4 N;  4KHW A;  4B3M K;  3V6D A;  3OJU A;  1NJI O;  3TTC A;  4AM6 A;  1X9M A;  2FBV A;  3A5L C;  4B3O A;  4C8K A;  1VAZ A;  1HQE A;  4JI7 K;  2P9P B;  5JLF A;  3WEE B;  2V52 B;  2KW4 A;  1C0G A;  4CFC A;  4FLU A;  3LAL A;  4PKG A;  3QIP A;  4LD0 A;  2ZE2 A;  3RR7 A;  3Q7C A;  2WC9 A;  2OTL N;  3CCL N;  5KRT A;  3CCS N;  4AH9 A;  4H5R A;  2OZS A;  1K73 O;  4CZH A;  3L4Q A;  4CHY A;  3THX B;  3QNO A;  3HI0 A;  4O44 A;  5AQL A;  1VK0 A;  4CHZ A;  3TU5 A;  1SZ2 A;  1CXQ A;  3AVM A;  1ASW A;  1DTT A;  4DFJ A;  2QXF A;  4Y0W A;  3UB5 A;  3AVF A;  1K8A O;  1IG9 A;  3DWL A;  3VN5 A;  1ZYQ A;  5EXW A;  2B6A A;  4M41 A;  2RN2 A;  4KTW A;  1LWC A;  3OYI A;  4CIF A;  4BAC A;  2FXU A;  3O5B A;  4CEA A;  1NMN A;  5E41 A;  1TK8 A;  1QVF M;  1J6Z A;  1BWF O;  4X64 K;  4YDU C;  3OJS A;  3OA9 A;  4KHY A;  3WXL A;  3K0S A;  1VSD A;  4CJP A;  3PX4 A;  3KLE A;  5KPT A;  4CJS A;  4BRL A;  4XIU A;  1LWF A;  4CJ3 A;  4I9Q A;  1JL1 A;  4AHT A;  4CJU A;  3AO3 A;  4BDZ A;  3TAE A;  2NLX A;  3MWT A;  2UXC K;  2DFF A;  1T6C A;  1ZBS A;  4DTP A;  1HPM A;  4PL8 A;  4FWR A;  1BG3 A;  3FFK B;  1QQC A;  4DV4 K;  3RRG A;  3TAM A;  4LSL A;  4RTF D;  4W5R A;  3VEY A;  4FLZ A;  4BE0 A;  1ILY A;  1JLG A;  3K5O A;  3M8Q A;  5AQF A;  5J2M A;  3DRS A;  2AJQ A;  4DSE A;  2E2N A;  3QIC A;  3QBX A;  4I2P A;  2CH5 A;  1VSK A;  4E7I A;  3B8A X;  4DQS A;  3O80 A;  1YVU A;  5EOY A;  4DFM A;  1NGE A;  3DLH A;  2D5R A;  5I42 A;  5IT9 O;  1S22 A;  3DRR A;  4FYD A;  3JXU A;  4ISE A;  4RW8 A;  2WTU A;  3SJH A;  1EP4 A;  4DG1 A;  3R6M A;  3DLK A;  5BRH A;  3ZT2 A;  2F9W A;  3QIN A;  2WBN A;  4Z0U A;  3CJC A;  2P5O A;  4FJM A;  1TL3 A;  5TKY A;  2H3G X;  1NGF A;  2QKK A;  4E7L A;  1ZBH A;  4CF2 A;  3ZLJ A;  1GLF O;  3FR0 A;  1WUA A;  4CES A;  3G4S N;  2F4V K;  1EKE A;  5DK5 A;  1XC9 A;  4F9O A;  1QE1 A;  4GY2 B;  3WUH A;  3MXI A;  3OYB A;  4BRI A;  1NNE A;  4HWI A;  1N8R O;  1NOY A;  4JKD A;  1NLV A;  1N33 K;  3FZH A;  3CQX A;  3QIO A;  1BQM A;  3RMC A;  4W5Q A;  3L2V A;  5HRR A;  1LWE A;  4JRP A;  2P9K A;  3CCE N;  4IBN A;  1IKX A;  4FJJ A;  3CPW M;  4BG8 A;  4FLX A;  4FW1 A;  2JWK A;  1VQK N;  1XI1 A;  3QES A;  5T7B A;  3LL3 A;  3ULE B;  2NRX A;  3T1H K;  3V4I A;  1MWM A;  1T05 A;  2V7Y A;  2HHT A;  3IKM A;  1C0M A;  2OAN A;  1KSP A;  3MEE A;  3CJA A;  3OW2 M;  1A5V A;  3SPY A;  2YNG A;  3AV9 A;  3NF7 A;  1QS4 A;  4FM2 A;  1VRT A;  3HJF A;  3U8X A;  5HL7 L;  5LMU K;  5AFU H;  1KRP A;  5C10 A;  1N34 K;  3SZ2 A;  4JKH A;  1NKE A;  3LAK A;  1K9M O;  1SL1 A;  4H5W A;  1TK5 A;  1RBS A;  3AO1 A;  2UUA K;  2O8E A;  3KKR A;  1S6Q A;  4AHC A;  1KFS A;  3AVI A;  2Z1I A;  3UE5 A;  1KC8 O;  3T7Z A;  4KHN A;  4OLB A;  3LDP A;  4CHO A;  2ITG A;  4YDU A;  2KTQ A;  4HHT A;  2IDO A;  1U6Z A;  1U48 A;  4JK9 A;  3VF6 A;  1KXP A;  5JLH A;  5CZ2 A;  4BGA A;  5C2F A;  1WSJ A;  1J9A A;  3MCP A;  1NJX A;  3KTQ A;  3NBP A;  4ICL A;  4DU4 A;  3QNN A;  3MK6 A;  1HX1 A;  1RTI A;  3VQE A;  3IAY A;  1NK5 A;  3VEV A;  4JI2 K;  2W42 A;  4QS9 A;  1YIT N;  3ZET B;  3THW A;  3EL2 A;  1O1W A;  5TKW A;  1BCO A;  3L2R A;  3D2E A; 
#chains in the Genus database with same CATH homology
 5LL6 Z;  4JYA K;  4DV1 K;  5BR8 K;  2UUB K;  4LF5 K;  2VQE K;  4GKK K;  1XMQ K;  1XNR K;  2UUC K;  4LF6 K;  5LMN K;  3J7A P;  2UXC K;  3JAM O;  4DR6 K;  1HR0 K;  4JV5 K;  5IWA K;  4DV7 K;  4AQY K;  1J5E K;  3T1H K;  4DV4 K;  3J7Y P;  3OTO K;  4LF8 K;  4JI4 K;  5A2Q O;  4DR5 K;  4DR1 K;  1FJG K;  1N36 K;  4B3T K;  3T1Y K;  4DUZ K;  4JI5 K;  1XNQ K;  5LMU K;  1IBL K;  4B3M K;  4DV5 K;  2UXB K;  1N34 K;  4K0K K;  4GKJ K;  4JI6 K;  4JI0 K;  2E5L K;  4DV3 K;  4JI7 K;  1HNW K;  2UUA K;  5IT9 O;  1XMO K;  1N32 K;  4DR3 K;  4YY3 K;  4DV0 K;  4V19 S;  2VQF K;  4NXN K;  4OX9 K;  4DR2 K;  2UXD K;  4JI8 K;  4NXM K;  4X66 K;  5AJ3 K;  4CVN E;  1IBM K;  4LFA K;  4B3R K;  1HNX K;  4DR4 K;  1IBK K;  4LF9 K;  4X65 K;  4CW7 B;  4DV6 K;  4X62 K;  4LF7 K;  4DR7 K;  1I94 K;  2F4V K;  2UU9 K;  4DUY K;  1HNZ K;  2ZM6 K;  5FLX O;  3J81 O;  4KHP K;  3J80 O;  2HHH K;  4B3S K;  4LF4 K;  4JI2 K;  4X64 K;  4DV2 K;  4YHH K;  1N33 K;  4LFB K;  4JI1 K;  4JI3 K;  4LFC K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...