4K0KK

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4k0kK00
2UUCK 4JYAK 4NXNK 1J5EK 1XMQK 4LF9K 1N33K 4B3SK 4LFCK 1XNRK 2UUAK 3T1HK 3J80O 4JI4K 4DV3K 4OX9K 4JI1K 4DV0K 4X66K 4JI6K 4LF6K 4KHPK 1N36K 3J81O 4B3TK 4DUZK 4K0KK 4LF7K 1HR0K 1N32K 3T1YK 4DV4K 2UXCK 4JI0K 5BR8K 4DUYK 4YY3K 4CVNE 4DR7K 4JI7K 2UUBK 4JV5K 4NXMK 4LF4K 3J7YP 4DV7K 4LF8K 2UU9K 4X64K 1XNQK 4DV2K 2VQEK 4DR2K 1XMOK 4AQYK 4B3RK 5A2QO 4GKJK 5LMUK 4DR4K 5AJ3K 1HNZK 2UXBK 4DV5K 4DV1K 4DR1K 1IBLK 5IWAK 4YHHK 4DR5K 4JI2K 1N34K 1I94K 1FJGK 4X65K 2VQFK 2E5LK 1IBMK 1IBKK 1HNWK 4DR3K 3JAMO 2ZM6K 4B3MK 3J7AP 1HNXK 4V19S 3OTOK 4DV6K 4JI8K 4GKKK 4LF5K 4JI5K 4DR6K 5LL6Z 4X62K 5FLXO 5IT9O 2HHHK 4JI3K 4CW7B 2F4VK 4LFAK 5LMNK 4LFBK 2UXDK
chains in the Genus database with same CATH superfamily
4BR9A 1MWMA 4B9UA 4FJIA 1C1CA 1BCMA 3PSFA 4M41A 4CJSA 3V81A 1REVA 4YOUA 4BQZA 1N8RO 2P51A 4IFYA 3DOLA 3AO3A 4KTQA 3RRGA 3O9SA 3THXB 3D0PA 1K73O 2VWKA 4JKAA 1CZBA 2O8FB 1VRTA 3RMBA 3OYGA 4BR5A 5GINA 3PY8A 3LDPA 4BRGA 3KLIA 4DUZK 4CD3A 3MWPA 5TKWA 3QO9A 4LF7K 3CQYA 4H5VA 1G99A 5EVZA 3S3OA 2Y1IA 3HZ6A 1RBVA 3I8DA 1WLJA 2JWLA 1JLBA 4FSVA 3JS6A 3MCPA 3R1XA 3ATUA 3FZFA 4JEPA 4OJRA 4BDPA 3L3UA 4BG8A 2NNWA 4BROA 2UXBK 4GVEA 1NK0A 3NH1A 3SPYA 3QMLA 3U4LA 2YHXA 4PQUA 4K41A 2GWJA 3ULEB 2W42A 3O8MA 4O5BA 1H1VA 2QTDA 4RW6A 1RFQA 3RR7A 4BRDA 4CFDA 4DG1A 1NKCA 5BN8A 3Q7CA 3ZSYA 4YORA 5CYMA 3MEEA 3BEXA 3M3ZA 4CEQA 2PY5A 2KHOA 1G15A 3THYA 1QVGM 1IV0A 4IZ9A 3SZ2A 3AVLA 3VQAA 1LV5A 3D2EA 3CHWA 4FLUA 3VQ5A 1T7PA 2YKMA 3U8XA 1WSEA 4B1VA 4CJ5A 3PIOL 1U48A 2QXFA 4LFAK 1BQNA 2PYLA 4F3OA 2OCEA 4CEDA 1VSEA 4G1QA 2ZD1A 1GLLO 1SKWA 5GAHP 1T6CA 3QERA 5KPZA 2B6AA 2D0AA 1KCFA 1TUUA 2YKNA 3T1HK 3K0SA 4GW6A 3HL8A 3CCEN 1BI4A 4KFBA 2ASPA 1YTUA 4CK2A 1BU6O 4CZJA 4JN4A 3ZSOA 4JI1K 3G71N 4DSFA 2O4IA 1NOZA 3EE8A 2X74A 4BRQA 2HW3A 4DLEA 5CE3A 3DLKA 3FFKB 3Q7BA 1HR0K 3DI6A 3L8BA 1RT6A 3AO2A 1B92A 4PKIA 4WCEL 1MWKA 4BACA 5DM7L 1Z25A 4LF4K 3J7YP 4DV7K 3V6DA 3KTQA 1NMDA 1VRUA 4F9OA 1SUQA 1ATSA 1DTQA 4M42A 3CMAN 4OPJA 2HOEA 2ZQBA 4NB4A 3T69A 4DR1K 3G6EN 2Q2RA 4IDHA 3OS1A 3VTIA 1ASUA 4CJTA 4ELTA 4BDYA 4CGJA 4W5TA 1R59O 2IDOA 1A5XA 4OPKA 1NJZA 1ZBUA 3ZETB 1U04A 4FJHA 3NGZA 5AQNA 4DSJA 1YITN 4N47A 4KI6A 5EY4A 1L3UA 3NF9A 4FLYA 4YOTA 1IKYA 1YIJN 3OJUA 1RDCA 4CZMA 4ID1A 5J2NA 4LD0A 5KGXA 1BQMA 2HNYA 4DV6K 2CH5A 1ZYQA 4RG8A 4JI5K 3ZSRA 4PL7A 3DLBA 3DMJA 4X62K 2A6AA 5IT9O 3OYIA 4CW7B 3HM8A 1RT7A 1DTTA 4CJKA 3SV4A 3SV3A 2G8IA 4DF8A 4DSLA 2O8CB 3TU5A 1ZBLA 5MLCQ 4JKGA 2ZJRL 5AQGA 3MXMA 4NCBA 1LW0A 1WNSA 4CIEA 2YJEA 3K5NA 5AZJB 2VGNA 4CERA 2QI2A 4OKJA 3TARA 5K14A 1IKXA 5AQFA 4ILHA 4JNEA 4CGDA 4O4GA 3AY9A 4DSIA 3VTHA 3H3OB 4KKOA 3QDKA 3K5OA 4CI6A 1T44A 1GLDG 4FJ5A 4K42A 3LDQA 2H3GX 4DTMA 4B3TK 5HROA 2I7PA 3O4WA 3VF2A 3V9WA 4JKHA 3LM9A 3T1YK 4AHRA 3BZCA 4HCCA 3MN6A 4IOXA 2WC9A 1TVRA 4CF2A 3EO3A 1YJWN 4I6MA 3O3HA 3OYMA 2NZTA 4LF8K 2W6KA 4FWLA 4ZTJA 5H1SQ 4U7BA 4W5NA 3CFRA 3DLLL 2GUPA 3LANA 1TV6A 2QM1A 4FJ9A 4DR4K 3RMAA 3KLHA 1NK7A 3CCSN 4CBUA 1HRHA 2A5XA 4CESA 3GE1A 1SKRA 4AF1A 1U47A 3QBXA 4WE1A 4HTLA 3TTDA 4ISFA 3L0QA 3MN5A 3ZCMA 3O5BA 3QNNA 4H0YB 1RBTA 1UA1A 3VQCA 1QVFM 4XH4A 3MAQA 2E6LA 4JK8A 2G8WA 1HNXK 1GLAG 3C7NA 5AQIA 3V1QA 5BPMA 5CHIA 1HMVA 1VQ9N 3DYAA 2Q1NA 4FWKA 3NGIA 1QE1A 1VQ8N 3VQEA 3O9UA 3MECA 3THVA 3SBGA 1LAWA 4MDAA 2UXDK 2KFNA 3EKSA 1T6DA 1XHZA 1NMNA 3VA0A 4CD1A 2QWLA 3U3GA 4B1ZA 3CC7N 4CZIA 2R7YA 4LFCK 3OYNA 1VSJA 3W0LA 4JS5A 3O3GA 2D4WA 1KAZA 2OPSA 4E7IA 3DLHA 3V4IA 4A5AA 4JI6K 1N36K 1YVUA 4TSXA 1RCHA 1Q9YA 1JCFA 5GIOA 4JHDA 4PKGA 4OKEA 3VESA 4JI0K 1TK0A 5AQSA 3L2QA 1DKGD 4JV5K 4YFUA 2WBNA 2GV9A 2HHXA 4DTNA 3N4PA 3UKRA 4ISGA 2HMIA 3NVKA 1VSIA 2NRHA 3LPUA 4WQ4C 3H3NO 1VSHA 3GG4A 5LJWA 2V52B 3VQ7A 1U2VB 4BDZA 4DV5K 4B9LA 5BRHA 3FZLA 2W41A 4FWNA 1VSKA 4ID5A 1Q18A 3ZSVA 1J6ZA 4JI2K 1N34K 4C8KA 2RN2A 1HKBA 4FZZA 4NYFA 3THXA 1RNHA 3VF6A 4EP5A 2OYQA 3D2FA 1YTAA 1QQMA 3N4QA 3IUCA 3O1WA 1E4FT 4NLCA 1HNVA 1WBDA 1MU2A 2QW9A 3MN7A 3NF8A 4MDBA 3HP6A 5JLHA 4KHYA 4GKKK 2CGLA 4K43A 4N56A 3NAEA 3LZIA 4E7KA 4BRHA 3OW2M 2Q3SA 1NU0A 1VSDA 3VQBA 3O4QA 3RR8A 4A62A 1ZXOA 4IWVA 5ADXH 1X9JA 3AVCA 3TSUA 3H1VX 4DHYA 4AILC 4MLHA 5B8HA 3ID8A 3ZX0A 4YOXA 1BISA 5JVGL 2HVIA 3ZYYX 2J4RA 3LDLA 3QB0A 1RTJA 3PSIA 1YVNA 4XEIA 4IOAL 1RILA 4HTUA 4FJKA 4OGCA 3M5RA 4JRQA 4A57A 4Y1DA 4M3UA 1Q81O 3ULEA 1EKEA 2B5JA 3KHYA 2KQ2A 3WNEA 3D6RA 1EP4A 3I0SA 5AQMA 3BF1A 2DPNA 3GL1A 4FJMA 2WFBA 1CXUA 3MEGA 3G4SN 4K0KK 1VK0A 2AP1A 5TKYA 1KFDA 3SAGA 1LCUA 1NK9A 3VEYA 3R3LA 4Z0UA 5BR8K 2QWMA 3V9SA 2GBZA 5M1OA 2GX9A 4M7XA 5AQHA 3HRGA 4E7HA 1KAYA 3GOIA 3OYBA 3V9ZA 4DFKA 3F73A 3IFRA 2OZMA 1XMOK 1E4GT 4BVPA 4CJQA 4B3RK 4LSNA 2XY6A 5KQ8A 3CC2N 2D1KA 2IAJA 1IBLK 4YNQA 4DR5K 1BG3A 1VSLA 5GAEP 4F4KA 1BA0A 1NKEA 3AAPA 3H46O 2P9PA 4KHWA 3L4IA 5DM6L 4ILJA 2ASMA 2YI1A 3P5JA 5AQPA 3FZHA 1HKGA 5AQYA 5C42A 1KC8O 4CHYA 4M7YA 2HHWA 4AHSA 4JKEA 4CJRA 3F9MA 5SWMA 2D5RA 4E1JA 3VEZA 3C6UA 3J8AA 4HWIA 2FXUA 3VF4A 3HP9A 1BIUA 3IS9A 3OJSA 3GDQA 4H5RA 4FW2A 4YDUC 1LWEA 1VAZA 4F8RA 3FR0A 3HK2A 2GTDA 2O4GA 5EXWA 3HO1A 4H0OA 1KAXA 3ID6A 3CJ1A 4Z4IA 2ASOA 4Q5VA 4CJPA 4JK7A 2PYJA 2D0PA 1VQON 3ZETA 4H03B 1S1WA 1IJJA 3SMPA 4FW1A 2P9KB 5GAGP 4AM7A 3J7ZO 3OYDA 1YXQA 1X1PA 3L2UA 4KHPK 1NK6A 4H0VB 1ESVA 4DQ8A 1S1TA 3AVMA 4KH6A 3OYEA 3HVRA 3DLGA 4KBOA 2HBJA 4BG9A 2G8UA 5DMRA 1S72N 3HI0A 2P5GA 4NCGA 3P39A 3HPGA 4B9SA 3ZEUB 3KLFA 4B9NA 1D4XA 3S41A 2O8DB 3HVTA 4GKJK 2Q0RA 2W6LA 4FJXA 4BR4A 3WT0A 2E2QA 3WNFA 3HOSA 3KWGA 1U49A 3CCUN 3LP3A 1DT9A 1NGHA 2NRTA 3T19A 3LM2A 4BQLA 2WONA 3KIOA 5AZJA 3ZX3A 2KW4A 5AQXA 1C1BA 4C1NK 1WSFA 2O8BB 3P31A 1TKTA 3WXMB 1HNWK 4YOVA 1T3VA 3AVHA 5AQLA 4QS8A 3ZSWA 1EWRA 3CMEN 2VG6A 3SUOA 2P9SA 3WQTA 4YOYA 3OYAA 3U9ZA 3RWUA 1XWLA 4CEAA 1RT5A 4BREA 1OKJA 1JJ2M 3TTCA 4CIFA 2HHHK 3OS2A 5BPNA 1XQSC 4E3SA 1K9MO 4CF0A 3LWLA 2ZGZA 3SLCA 3CF5L 4KI4A 2NRXA 5M1FA 1NGFA 4A5BA 1XI1A 4BY9C 3ZSZA 3NH2A 3CJ9A 2P5OA 3TSQA 1I39A 4OLAA 5KTQA 4FYDA 4BR0A 4HUFA 1K8KB 4QOZB 1TAQA 2NRRA 4CJ3A 1L3TA 4M3YA 1S3XA 3O4NA 4O0IA 1W0HA 4CJFA 1JLCA 3RSEA 3O1BA 4CJLA 4AM6A 4IDKA 3IKMA 3IAYA 1TGOA 1LWFA 3QINA 4QCLA 4FM2A 1R0AA 2UXCK 1C1AA 3QEVA 4DB3A 4M63C 4CVNE 2P9NB 2QKBA 4DFMA 3M6GA 2OPRA 3DLRA 1P90A 4J2BA 1ZBHA 4DU3A 2VQEK 4DR2K 1O1WA 1CZ9A 3AGRA 4FJNA 3I8BA 4YDUA 3CM6A 5AQWA 3HSCA 5AJ3K 4W5RA 3WEEB 3CPWM 1KRPA 3LAKA 4DV1K 3LALA 4IG3A 2RPIA 3H45C 3MMVA 4ILGB 3E9LA 3KLEA 3E01A 1J9AA 3CIPA 2F8TA 3PX4A 3B8AX 4MLEA 2FSJA 3TPQA 2Z1GA 1WOQA 2YNGA 3VN5A 4A2AA 1NGGA 3WNHA 2CGJA 4M3WA 3CG7A 2F96A 3L2RA 1Y64A 4CF8A 3KLGA 1FXXA 1GOBA 1NBWA 3VGMA 3A8YA 4JI8K 1TK8A 1IKWA 1VQ4N 1W9HA 4B9MA 4FK2A 2ZJQL 4CGIA 4BRCA 4CZHA 3PLAA 3EZ5A 3P1GA 5J2MA 4CEFA 3B6PA 3W3DA 4MFBA 1EXQA 4JAXA 4ELUA 4FLWA 2P9LA 1YT3A 4EP4A 5C10A 1KD1O 3MX5A 4CHNA 3DRRA 3F5TA 4JYAK 3VMFB 2KZMA 3VEXA 3I55N 3C6TA 4CJUA 1JLEA 5KRSA 3M8RA 1D9FA 1U2VA 2WTUA 2F7TA 1W7AA 4LF9K 3OA9A 4DTXA 3O9QA 5KPTA 1ASVA 1U4BA 1MDUB 4CJVA 4FVUA 1Z26A 4NO7A 5M1PA 3J80O 5FRMA 3ULDA 5KRTA 1IG8A 4BE1A 3E9PA 1KFSA 3AVJA 3T3FA 1B9FA 1Z05A 4RWTA 2A3ZA 3QFPA 4GV3A 4XH1A 3K57A 2FC0A 3AVGA 1NGDA 1JL2A 5C15A 3V1OA 1N32K 1NK5A 2FSKA 4O8KA 4CEZA 1DGKN 1D5AA 1VHXA 4F2SA 3U6FA 4FK0A 4B1UB 4FPAA 1IO2A 3IRXA 1UOCA 4IEEA 2V51B 2YHWA 4EIAA 5EX5A 4RCHA 3KK2A 4ELVA 3I33A 1A5WA 4BE2A 1NGEA 3VQ9A 1HNIA 1WSIA 3CJBA 1U45A 3TAQA 2KKZA 2XY5A 1SQKA 4EHUA 4ICLA 5A2QO 4RW9A 4FLVA 4H4OA 2OTJN 4DTPA 2E20A 3HYFA 1Q82O 1X9MA 2ZWHA 2E8AA 4EZ6A 2NLXA 3PO4A 2QWNA 4CHOA 4M3ZA 1HPMA 4AHUA 4EHTA 2E4LA 3S9HA 4BGAA 3PX0A 2HVHA 4B3MK 3ZX2A 2BGGA 1VQMN 4LH5A 5I3UA 4FPBA 4B1XB 3CCLN 3AA3A 4CCHA 2HSTA 5FPDA 2X6NA 2O8EA 3VEVA 3TTFA 1SL1A 4K8XA 4IOCL 4HCBA 1NGJA 4FLTA 4B1YB 4BRKA 1RDBA 3LPTA 3DLEA 4H5TA 3L2VA 4BC2A 2UUCK 3MEDA 2G8VA 3AA4A 5DK5A 4CJEA 3D2EB 1J5EK 2WOMA 4JD2A 3EL2A 5F1XA 1TYQB 4DWIA 3O3FA 5AZIB 1W97L 4IFVA 2UUAK 1T05A 1GLFO 1GLCG 1NLVA 3SQ2A 2P9IA 5HRRA 2G8KA 3SCXA 1YUWA 4KPYA 4OX9K 3ZLJA 4DTRA 1U6ZA 5C24A 5HP1A 2FBTA 4JKBA 4H5WA 2ZE2A 4AHTA 3SAHA 3AGKA 4B8AB 4DUYK 3ZT2A 1QZ5A 4DF4A 1BI4B 4WYBA 1VQ7N 4GY2B 3OYCA 4CEOA 3KK3A 3WXKA 3NBPA 3CERA 3ENOA 5J2QA 1S1UA 3EN9A 1RTDA 2DTUA 2DFFA 4FCYA 5BRDA 3HBTA 2ZF5O 3TAFA 2VGMA 3V1RA 2Z1JA 1GLJO 2XY8A 1JLQA 4E0DA 5AQRA 1C0TA 2IIRA 1QSSA 2QWOA 3PX6A 3T1AA 4F3TA 2X6SA 3PIPL 3C65A 2RHKA 1X9SA 2XRIA 3MXJA 1XUPO 2OPQA 1SKSA 3L3VA 4WQ5C 3J7AP 2XY7A 3K5LA 3DXMB 3A5OC 4DMNA 3ZSQA 1C0FA 4NCAA 1YI2N 4LY7A 1XC3A 1NJWA 3MDQA 3SMSA 3AA5X 4M45A 3NCIA 4L3QA 5LJVA 2O8FA 1ZBSA 1W2BM 3CFOA 3CD6N 4DTOA 1JXBA 3FGUA 5BPLA 1S5JA 3CCRN 2D0BA 2KLAA 4DQSA 4DSKA 4BR2A 4OGEA 2O8BA 1WAFA 3FZMA 4JKGB 3A5NC 2CGKA 1FK9A 4DSEA 4IFEA 3CCQN 3R9PA 4FVMA 4CJWA 2IC3A 4FLZA 3HPHA 3VQQA 3WXIA 1YHQN 4YY3K 2E2NA 1M90O 4JI7K 1NGBA 4CGFA 2HBLA 4HVJA 1LWCA 3LP2A 1N5YA 4GV6A 3AVFA 4O0JA 3BUZB 2A40A 5JS2A 5F2RA 3DXKB 3VERA 2ZGYA 1UA0A 1K8AO 3NE6A 4H0XB 3E9OA 5FROA 5LMUK 1QHAA 2YNIA 4KAZA 4R79A 4RW4A 4FJ7A 1HX1A 1K8KA 2GEMA 4XIUA 3FFIA 2AA4A 4IKFA 1B9DA 1FJGK 3QEXA 3THWB 4X65K 1QSLA 4BC5A 2E88A 3ALYA 1C0GA 4W5QA 2QWRA 3K9JA 4EZ9A 3LL3A 5BN9A 4A59A 1TKZA 1UWBA 3TABA 3BP8A 3BDPA 3NF6A 4HUEA 4UY8O 4GNIA 1WSJA 3OTOK 4J8FA 3S3NA 1BGXT 3VGKA 1ILYA 4B9VA 2Y1JA 4FWSA 1CXQA 3CPEA 3NF7A 1KTQA 4H8KA 4FM1A 3G0ZA 3HPOA 4KRFA 4AH9A 4KB1A 1BWFO 1HPZA 1BO5O 3E1YA 3LAMA 2BE2A 2NRVA 3AARA 3C7NB 3VA3A 3WUHA 4O5FA 3TI0A 3PUFA 5KI6A 3VGLA 4JS4A 5FRNA 1SS6A 4H0PA 1BL3A 1VQPN 4E19A 1TK5A 1WAJA 2HHQA 1L5UA 3TAPA 1JLGA 5AQKA 4BRAA 4C8LA 3HXMA 1SL2A 3OS0A 3IG1A 2AJQA 4EFHA 1JL1A 1OVQA 3QNOA 4Z4GA 2V7ZA 4H0TB 4DV0K 1Q86O 4X66K 4FLXA 1D8YA 2YNHA 4DS4A 4WQ5A 2F9TA 3VQ6A 4FM0A 5JVHL 3QBWA 4I7FA 1NGIA 4B8CA 4B1WB 2QXLA 3O80A 4CHPA 2FBXA 4IJAA 2UUBK 4DTSA 2GUIA 2OTLN 3AVAA 1GOAA 3SBTA 4UQGA 2YCHA 2P1JA 3D7EO 3WNGA 1F21A 3SI6A 1RBUA 4CK3A 4JLHA 1EWQA 3VPZA 4Z4FA 4DTJA 3CC4N 3KKRA 3MWTA 1FW6A 3HTVA 3KJVA 4WFNL 2Q97A 1WUAA 4O8UA 4C8OA 4G9ZA 5CR4A 1TL1A 3UKRB 2ETJA 4DQQA 1SAZA 4HUGA 1ASWA 4L8RB 2P9UB 1NWKA 4DFJA 2QK9A 4PWDA 3AVIA 2O8CA 1HYZA 2YHYA 2PAVA 1C0UA 4DR6K 1KSPA 3O9RA 1S22A 4CK1A 4B08A 4M3RA 3D2FB 3SJJA 4CGGA 3NHGA 1L3SA 3DOKA 2HB5A 3QICA 4LH4A 5C25A 4C1NI 1S6QA 3EY1A 1V4SA 4NXNK 3DM2A 1NM1A 5AQJA 3L2WA 5HRNA 1ZBIA 1Q7YO 3SUQA 3CJ7A 4FJGA 1KVCA 1NJIO 3ENHA 2BUPA 1S9GA 3HT3A 1EETA 4JI4K 3ZT3A 4DV3K 3OYJA 5AQQA 3M8PA 1BOTO 1QS4A 4KTZA 1YJNN 5AQUA 1RT1A 5SZTA 4FWRA 4FZYA 4OPAA 1QHTA 2A42A 3G25A 4E89A 1EX4A 2DFHA 1YAGA 2HHVA 3ASMA 2ZJPL 5FDLA 3NH0A 2NUBA 5AQTA 2FBVA 1NGCA 4BRPA 3K2PA 4KHQA 4E7LA 3U9DA 2A1RA 3QIPA 2IVOA 3RMDA 2UU9K 3CCMN 4R5PA 2F9WA 3CQXA 4CZKA 4BWJA 4CZEA 2RE2A 4MQ3A 3BZKA 2E1ZA 1M1KO 1IH7A 4ISEA 5BR9A 3F9KA 5ELZA 4BC3A 4KHNA 4J2EA 1MA9B 4CFCA 5JS1A 1J5OA 2HNZA 3ATVA 1V4TA 4WF9L 1TYQA 1OH5A 1VSFA 5AZIA 2KZZA 5BREA 1ZC6A 1Y97A 2HHTA 3AV9A 2HHSA 1IKVA 3RMCA 4DR3K 3JAMO 3SAFA 3LDSA 2VG5A 3B6OA 2W40A 4DU1A 4BGBA 2HNDA 5J1EA 2QA4N 1T8EA 4DKWA 1NNEA 3KVGA 1QSYA 1X9WA 4CBWA 5CYQA 2P9PB 3UB5A 3TSPA 3ZT0A 4YOWA 5J2PA 2IS3A 4J2DA 1J53A 3AO1A 1RDAA 2FSNA 4I9QA 1HKCA 2Q36A 4LFBK 2ATQA 4GMJB 4JKFA 4JRPA 3MK6A 4LSLA 1N6QA 1EO1A 3BY5A 3HSTB 4Y1CA 1WN7A 1TKDA 1K6YA 4BRLA 3OHRA 4B9TA 4FWOA 2F8SA 2BH1A 3VQDA 1XMQK 3AVBA 5KGWA 4BE0A 3TANA 1ATNA 3CCVN 3MN9A 3QFUA 1JLFA 2IOCA 3C94A 3UKUB 4IEIA 1NGAA 5AQZA 2EX3A 2XO7A 4CJ7A 3CQ8A 2I7NA 4DQIA 3ISNC 3OYFA 1C6VA 2CH6A 4JKDA 3R8EA 4CE9A 2E2OA 2NRWA 1BCOA 1IG9A 4ZTFA 1RGIA 1OH7A 4IO8A 3JSMA 2DY4A 1QQCA 1XHXA 1HUXA 5AFUA 1S1VA 4KTWA 4DV4K 1CZAN 4Z4CA 3DXMA 4NYNA 3T7ZA 3HOTA 3HM9A 3VOVA 2GWKA 5HBMA 4CHZA 3C0BA 4KHUA 3CJAA 4DV2K 5C2DA 4O55A 2YJFA 3QEIA 3AVKA 4RW7A 1HLUA 4Z94A 3EKUA 1Z6RA 3EE9A 4IXCA 4JKCA 5AQOA 4KH4A 4DU4A 3BF3A 1TL3A 3SNNA 3FLCO 5CZ1A 4CEBA 1KXPA 4OO1J 3PO5A 2X78A 4WFAL 2VQFK 4KB0A 3OBYA 1OH6A 1SL0A 1IBMK 1VSMA 2HBMA 1IBKK 4A2BA 2ZM6K 1BDGA 1NK8A 1VQLN 3C6HA 2HF3A 4IO9L 2Z1HA 4DS5A 4FJJA 3RVCA 4U67L 3DJCA 3LP1A 1HJOA 1NK4A 4LF5K 3M1FA 4FZXC 1RTIA 4B3OA 5LL6Z 4Y0WA 1P8ZA 4N76A 1VQNN 1XC9A 3P4IA 3JXUA 4CEEA 3M8QA 4IJNA 1WB9A 2EHGA 2FF6A 3EYZA 4OPHA 1JLAA 2RKIA 2P9SB 4CF1A 3SPZA 1YJ9N 1D9DA 2YHAA 3O6WA 3K9KA 5AQVA 3NGYA 3CXCM 3DXKA 2WUSA 3TWHA 3CM5A 2Z1IA 2BDPA 2E1YA 4JK9A 4CZLA 5ADXA 4B3SK 3NVMA 4CJ4A 1XNRK 1NJYA 3MCAB 1TAUA 3CJCA 4CGHA 4DLGA 4PKHA 1UAXA 3KK1A 4K8ZA 4PY5A 5M1NA 4RTFD 1JCEA 4FOEA 3CCJN 3THWA 1FKOA 1RT2A 1S6PA 4GV9A 3AO5A 3K5MA 2JGUA 4CBXA 5KQDA 3J81O 2KFZA 3THYB 2QWQA 5HOOA 3SYZA 3VEOA 1SV5A 3AA2A 1BIZA 1TKXA 3SK3A 1KLMA 3I0RA 1JKHA 2OPPA 4ZHRA 3SQ4A 5E26A 4I9LA 1RT3A 3RSEB 4E1NA 1DLOA 4N5SA 1KLNA 5F0XA 4AQYK 1ZBFA 2VCPA 3G10A 4FO0A 4B9QA 3P83D 3OYKA 1HNZK 4C8NA 1BA1A 1NKBA 4E1MA 2I5JA 4CFBA 5I42A 2JWKA 2B4JA 5HL7L 3KKSA 3KD1E 5T7BA 1I94K 2QEXN 4I2QA 5E41A 3VQPA 3RTVA 4QS7A 2YHBA 3SQ1A 2FLOA 5HRSA 4E7JA 2IVNA 3LWMA 3DAWA 3ENBA 2E6MA 3IDHA 3ZT4A 1QTMA 4EAHD 5JICA 5FPNA 2HF4A 4F2RA 1LAVA 5EU7A 3SUNA 2PZSA 2OZSA 5LY3A 1HJRA 3KK7A 3ZT1A 3PV8A 5FLXO 4AHCA 1ITGA 1J54A 5AFUH 2D0CA 5GADP 3GBTA 4FOIA 1QQOA 5LMNK 1S9EA 4HHTA 3QEPA 2A41A 1Q9XA 3OYLA 1WSGA 4CZFA 2P9KA 2E2PA 4H4MA 4OVLA 3FE1A 3H1QA 3LZJA 3SUPA 2QKKA 5C0YA 1N33K 5CZ2A 3VENA 2FF3B 3I56N 3A5LC 2IVPA 2Q31A 3CYMA 3WXLA 2OANA 2Q0UA 2DFEA 2P9LB 3QIOA 3V9UA 1GLBG 4CF9A 3QLHA 3KD5E 2FBYA 4Z4EA 3AO4A 3U3YA 3NDKA 3VETA 3NMUA 5E84A 3ZEUA 4LF6K 2P9UA 1L3VA 1T03A 3VEWA 2YX6A 1KQSM 3CI5A 4CZGA 2O8DA 5FPMA 4BRNA 1RBRA 5JLFA 1WSHA 1HYSA 5FPEA 5HRPA 2ITMA 4J2AA 4DR7K 3S3MA 3C6AA 4NXMK 3OYHA 2HHUA 2GELA 3D45A 2HBKA 2VG7A 4X64K 5CY4A 4BRIA 4FWQA 5EOYA 4M3TA 1GLEG 4KV8A 1QQNA 1OVYA 3C95A 1VQ5N 1O13A 3OY9A 1DEJA 3TAGA 2D0OA 3WXJA 1HYVA 5BRFA 3O08A 1BHLA 4BRFA 3V9XA 3L6QA 3TAEA 3VQ8A 3DWLA 5C2FA 4MO5A 1HQEA 3F2KA 1E3MA 4H5NA 2UYTA 4K25A 5GIPA 5M1KA 3CFPA 4DQRA 3LDNA 2E5LK 3DRSA 3MX2A 2JLEA 4DQPA 1NJXA 3ITHA 4CFAA 5M1QA 5D3GA 3OVNA 1SZ2A 4I6MB 5JMVA 3K59A 3SJHA 4IG0A 3LDOA 5C12A 4PUOA 4JI3K 4BC4A 4M3XA 4AHVA 4KHSA 3AAQA 4N41A 1RDUA 4PL8A 3H6EA 5HLFA 2A1SA 3WQUA 4FL9A 2V7YA 1X3MA 1HQUA 4DCHA 3EEQA 3SQ0A 1QZ6A 4Q0BA 4C23A 3R6MA 4A61A 2O8EB 1ATRA 1VQKN 4FWPA 1X3NA 4GVMA 4CHQA 4BWMA 4PHTX 3BGRA 3UE5A 4CIGA 3DRPA 4BR7A 2P9NA 1LOTB 4QS9A 1RTHA 4KH5A 4W5OA 5KPRA 4WFBL 3OBWA 3NFAA 4BVOA 4DTUA 3TR8A 3RRHA 1VQ6N 2LSNA 2PFUA 4JD2B 2HMPA 1I3AA 1Q8IA 3HJFA 1OH8A 2VWBA 2VYPA 3WEEA 3A0IX 5AR0A 3ZSXA 2P9IB 5I9EB 3L4QA 3KWIA 2BANA 4FXDA 2PBDA 1XNQK 3QEWA 4MO4A 3LP0A 2OA8A 4CECA 2EWSA 3EZWA 3MXIA 4O44A 1JCGA 1BUPA 2RF2A 3H08A 1YF5L 4OLBA 3O9TA 1NG9A 3A5MC 3CETA 1FKPA 1CLQA 4LC9B 3P38A 3TAMA 4KREA 5IWAK 2KTQA 2QWPA 3AVNA 1EQYA 3QETA 3E66A 1A5VA 4IBNA 4NLBA 4YHHK 3JYTA 2VWJA 4FJ8A 3KZBA 1RT4A 4RW8A 4FWMA 1KVAA 2XHBA 2NRZA 3UKUA 4OKKA 3QESA 4FJLA 2ITGA 3K58A 3A2FA 4WQ4A 1JXEA 4C8MA 2G8FA 1TUYA 3FZKA 3IMXA 1WBBA 1LW2A 3VQ4A 4BRMA 4Z4HA 2BTFA 2YV0X 4DFPA 2IGIA 4JHDB 4PA1A 4V19S 3M8SA 1S1XA 1C0MA 3UIQA 1RDDA 4KO0A 4QAGA 1RDWX 2G8HA 1RBSA 2YNFA 1KVBA 4XH5A 2F4VK 1GOCA 4I2PA 4FK4A 1NOYA
chains in the Genus database with same CATH topology
2UUCK 4JYAK 4NXNK 1J5EK 1XMQK 4LF9K 1N33K 4B3SK 4LFCK 1XNRK 2UUAK 3T1HK 3J80O 4JI4K 4DV3K 4OX9K 4JI1K 4DV0K 4X66K 4JI6K 4LF6K 4KHPK 1N36K 3J81O 4B3TK 4DUZK 4K0KK 4LF7K 1HR0K 1N32K 3T1YK 4DV4K 2UXCK 4JI0K 5BR8K 4DUYK 4YY3K 4CVNE 4DR7K 4JI7K 2UUBK 4JV5K 4NXMK 4LF4K 3J7YP 4DV7K 4LF8K 2UU9K 4X64K 1XNQK 4DV2K 2VQEK 4DR2K 1XMOK 4AQYK 4B3RK 5A2QO 4GKJK 5LMUK 4DR4K 5AJ3K 1HNZK 2UXBK 4DV5K 4DV1K 4DR1K 1IBLK 5IWAK 4YHHK 4DR5K 4JI2K 1N34K 1I94K 1FJGK 4X65K 2VQFK 2E5LK 1IBMK 1IBKK 1HNWK 4DR3K 3JAMO 2ZM6K 4B3MK 3J7AP 1HNXK 4V19S 3OTOK 4DV6K 4JI8K 4GKKK 4LF5K 4JI5K 4DR6K 5LL6Z 4X62K 5FLXO 5IT9O 2HHHK 4JI3K 4CW7B 2F4VK 4LFAK 5LMNK 4LFBK 2UXDK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUC K;  4JYA K;  4NXN K;  1J5E K;  1XMQ K;  4LF9 K;  1N33 K;  4B3S K;  4LFC K;  1XNR K;  2UUA K;  3T1H K;  3J80 O;  4JI4 K;  4DV3 K;  4OX9 K;  4JI1 K;  4DV0 K;  4X66 K;  4JI6 K;  4LF6 K;  4KHP K;  1N36 K;  3J81 O;  4B3T K;  4DUZ K;  4K0K K;  4LF7 K;  1HR0 K;  1N32 K;  3T1Y K;  4DV4 K;  2UXC K;  4JI0 K;  5BR8 K;  4DUY K;  4YY3 K;  4CVN E;  4DR7 K;  4JI7 K;  2UUB K;  4JV5 K;  4NXM K;  4LF4 K;  3J7Y P;  4DV7 K;  4LF8 K;  2UU9 K;  4X64 K;  1XNQ K;  4DV2 K;  2VQE K;  4DR2 K;  1XMO K;  4AQY K;  4B3R K;  5A2Q O;  4GKJ K;  5LMU K;  4DR4 K;  5AJ3 K;  1HNZ K;  2UXB K;  4DV5 K;  4DV1 K;  4DR1 K;  1IBL K;  5IWA K;  4YHH K;  4DR5 K;  4JI2 K;  1N34 K;  1I94 K;  1FJG K;  4X65 K;  2VQF K;  2E5L K;  1IBM K;  1IBK K;  1HNW K;  4DR3 K;  3JAM O;  2ZM6 K;  4B3M K;  3J7A P;  1HNX K;  4V19 S;  3OTO K;  4DV6 K;  4JI8 K;  4GKK K;  4LF5 K;  4JI5 K;  4DR6 K;  5LL6 Z;  4X62 K;  5FLX O;  5IT9 O;  2HHH K;  4JI3 K;  4CW7 B;  2F4V K;  4LFA K;  5LMN K;  4LFB K;  2UXD K; 
#chains in the Genus database with same CATH topology
 4BR9 A;  1MWM A;  4B9U A;  4FJI A;  1C1C A;  1BCM A;  3PSF A;  4M41 A;  4CJS A;  3V81 A;  1REV A;  4YOU A;  4BQZ A;  1N8R O;  2P51 A;  4IFY A;  3DOL A;  3AO3 A;  4KTQ A;  3RRG A;  3O9S A;  3THX B;  3D0P A;  1K73 O;  2VWK A;  4JKA A;  1CZB A;  2O8F B;  1VRT A;  3RMB A;  3OYG A;  4BR5 A;  5GIN A;  3PY8 A;  3LDP A;  4BRG A;  3KLI A;  4DUZ K;  4CD3 A;  3MWP A;  5TKW A;  3QO9 A;  4LF7 K;  3CQY A;  4H5V A;  1G99 A;  5EVZ A;  3S3O A;  2Y1I A;  3HZ6 A;  1RBV A;  3I8D A;  1WLJ A;  2JWL A;  1JLB A;  4FSV A;  3JS6 A;  3MCP A;  3R1X A;  3ATU A;  3FZF A;  4JEP A;  4OJR A;  4BDP A;  3L3U A;  4BG8 A;  2NNW A;  4BRO A;  2UXB K;  4GVE A;  1NK0 A;  3NH1 A;  3SPY A;  3QML A;  3U4L A;  2YHX A;  4PQU A;  4K41 A;  2GWJ A;  3ULE B;  2W42 A;  3O8M A;  4O5B A;  1H1V A;  2QTD A;  4RW6 A;  1RFQ A;  3RR7 A;  4BRD A;  4CFD A;  4DG1 A;  1NKC A;  5BN8 A;  3Q7C A;  3ZSY A;  4YOR A;  5CYM A;  3MEE A;  3BEX A;  3M3Z A;  4CEQ A;  2PY5 A;  2KHO A;  1G15 A;  3THY A;  1QVG M;  1IV0 A;  4IZ9 A;  3SZ2 A;  3AVL A;  3VQA A;  1LV5 A;  3D2E A;  3CHW A;  4FLU A;  3VQ5 A;  1T7P A;  2YKM A;  3U8X A;  1WSE A;  4B1V A;  4CJ5 A;  3PIO L;  1U48 A;  2QXF A;  4LFA K;  1BQN A;  2PYL A;  4F3O A;  2OCE A;  4CED A;  1VSE A;  4G1Q A;  2ZD1 A;  1GLL O;  1SKW A;  5GAH P;  1T6C A;  3QER A;  5KPZ A;  2B6A A;  2D0A A;  1KCF A;  1TUU A;  2YKN A;  3T1H K;  3K0S A;  4GW6 A;  3HL8 A;  3CCE N;  1BI4 A;  4KFB A;  2ASP A;  1YTU A;  4CK2 A;  1BU6 O;  4CZJ A;  4JN4 A;  3ZSO A;  4JI1 K;  3G71 N;  4DSF A;  2O4I A;  1NOZ A;  3EE8 A;  2X74 A;  4BRQ A;  2HW3 A;  4DLE A;  5CE3 A;  3DLK A;  3FFK B;  3Q7B A;  1HR0 K;  3DI6 A;  3L8B A;  1RT6 A;  3AO2 A;  1B92 A;  4PKI A;  4WCE L;  1MWK A;  4BAC A;  5DM7 L;  1Z25 A;  4LF4 K;  3J7Y P;  4DV7 K;  3V6D A;  3KTQ A;  1NMD A;  1VRU A;  4F9O A;  1SUQ A;  1ATS A;  1DTQ A;  4M42 A;  3CMA N;  4OPJ A;  2HOE A;  2ZQB A;  4NB4 A;  3T69 A;  4DR1 K;  3G6E N;  2Q2R A;  4IDH A;  3OS1 A;  3VTI A;  1ASU A;  4CJT A;  4ELT A;  4BDY A;  4CGJ A;  4W5T A;  1R59 O;  2IDO A;  1A5X A;  4OPK A;  1NJZ A;  1ZBU A;  3ZET B;  1U04 A;  4FJH A;  3NGZ A;  5AQN A;  4DSJ A;  1YIT N;  4N47 A;  4KI6 A;  5EY4 A;  1L3U A;  3NF9 A;  4FLY A;  4YOT A;  1IKY A;  1YIJ N;  3OJU A;  1RDC A;  4CZM A;  4ID1 A;  5J2N A;  4LD0 A;  5KGX A;  1BQM A;  2HNY A;  4DV6 K;  2CH5 A;  1ZYQ A;  4RG8 A;  4JI5 K;  3ZSR A;  4PL7 A;  3DLB A;  3DMJ A;  4X62 K;  2A6A A;  5IT9 O;  3OYI A;  4CW7 B;  3HM8 A;  1RT7 A;  1DTT A;  4CJK A;  3SV4 A;  3SV3 A;  2G8I A;  4DF8 A;  4DSL A;  2O8C B;  3TU5 A;  1ZBL A;  5MLC Q;  4JKG A;  2ZJR L;  5AQG A;  3MXM A;  4NCB A;  1LW0 A;  1WNS A;  4CIE A;  2YJE A;  3K5N A;  5AZJ B;  2VGN A;  4CER A;  2QI2 A;  4OKJ A;  3TAR A;  5K14 A;  1IKX A;  5AQF A;  4ILH A;  4JNE A;  4CGD A;  4O4G A;  3AY9 A;  4DSI A;  3VTH A;  3H3O B;  4KKO A;  3QDK A;  3K5O A;  4CI6 A;  1T44 A;  1GLD G;  4FJ5 A;  4K42 A;  3LDQ A;  2H3G X;  4DTM A;  4B3T K;  5HRO A;  2I7P A;  3O4W A;  3VF2 A;  3V9W A;  4JKH A;  3LM9 A;  3T1Y K;  4AHR A;  3BZC A;  4HCC A;  3MN6 A;  4IOX A;  2WC9 A;  1TVR A;  4CF2 A;  3EO3 A;  1YJW N;  4I6M A;  3O3H A;  3OYM A;  2NZT A;  4LF8 K;  2W6K A;  4FWL A;  4ZTJ A;  5H1S Q;  4U7B A;  4W5N A;  3CFR A;  3DLL L;  2GUP A;  3LAN A;  1TV6 A;  2QM1 A;  4FJ9 A;  4DR4 K;  3RMA A;  3KLH A;  1NK7 A;  3CCS N;  4CBU A;  1HRH A;  2A5X A;  4CES A;  3GE1 A;  1SKR A;  4AF1 A;  1U47 A;  3QBX A;  4WE1 A;  4HTL A;  3TTD A;  4ISF A;  3L0Q A;  3MN5 A;  3ZCM A;  3O5B A;  3QNN A;  4H0Y B;  1RBT A;  1UA1 A;  3VQC A;  1QVF M;  4XH4 A;  3MAQ A;  2E6L A;  4JK8 A;  2G8W A;  1HNX K;  1GLA G;  3C7N A;  5AQI A;  3V1Q A;  5BPM A;  5CHI A;  1HMV A;  1VQ9 N;  3DYA A;  2Q1N A;  4FWK A;  3NGI A;  1QE1 A;  1VQ8 N;  3VQE A;  3O9U A;  3MEC A;  3THV A;  3SBG A;  1LAW A;  4MDA A;  2UXD K;  2KFN A;  3EKS A;  1T6D A;  1XHZ A;  1NMN A;  3VA0 A;  4CD1 A;  2QWL A;  3U3G A;  4B1Z A;  3CC7 N;  4CZI A;  2R7Y A;  4LFC K;  3OYN A;  1VSJ A;  3W0L A;  4JS5 A;  3O3G A;  2D4W A;  1KAZ A;  2OPS A;  4E7I A;  3DLH A;  3V4I A;  4A5A A;  4JI6 K;  1N36 K;  1YVU A;  4TSX A;  1RCH A;  1Q9Y A;  1JCF A;  5GIO A;  4JHD A;  4PKG A;  4OKE A;  3VES A;  4JI0 K;  1TK0 A;  5AQS A;  3L2Q A;  1DKG D;  4JV5 K;  4YFU A;  2WBN A;  2GV9 A;  2HHX A;  4DTN A;  3N4P A;  3UKR A;  4ISG A;  2HMI A;  3NVK A;  1VSI A;  2NRH A;  3LPU A;  4WQ4 C;  3H3N O;  1VSH A;  3GG4 A;  5LJW A;  2V52 B;  3VQ7 A;  1U2V B;  4BDZ A;  4DV5 K;  4B9L A;  5BRH A;  3FZL A;  2W41 A;  4FWN A;  1VSK A;  4ID5 A;  1Q18 A;  3ZSV A;  1J6Z A;  4JI2 K;  1N34 K;  4C8K A;  2RN2 A;  1HKB A;  4FZZ A;  4NYF A;  3THX A;  1RNH A;  3VF6 A;  4EP5 A;  2OYQ A;  3D2F A;  1YTA A;  1QQM A;  3N4Q A;  3IUC A;  3O1W A;  1E4F T;  4NLC A;  1HNV A;  1WBD A;  1MU2 A;  2QW9 A;  3MN7 A;  3NF8 A;  4MDB A;  3HP6 A;  5JLH A;  4KHY A;  4GKK K;  2CGL A;  4K43 A;  4N56 A;  3NAE A;  3LZI A;  4E7K A;  4BRH A;  3OW2 M;  2Q3S A;  1NU0 A;  1VSD A;  3VQB A;  3O4Q A;  3RR8 A;  4A62 A;  1ZXO A;  4IWV A;  5ADX H;  1X9J A;  3AVC A;  3TSU A;  3H1V X;  4DHY A;  4AIL C;  4MLH A;  5B8H A;  3ID8 A;  3ZX0 A;  4YOX A;  1BIS A;  5JVG L;  2HVI A;  3ZYY X;  2J4R A;  3LDL A;  3QB0 A;  1RTJ A;  3PSI A;  1YVN A;  4XEI A;  4IOA L;  1RIL A;  4HTU A;  4FJK A;  4OGC A;  3M5R A;  4JRQ A;  4A57 A;  4Y1D A;  4M3U A;  1Q81 O;  3ULE A;  1EKE A;  2B5J A;  3KHY A;  2KQ2 A;  3WNE A;  3D6R A;  1EP4 A;  3I0S A;  5AQM A;  3BF1 A;  2DPN A;  3GL1 A;  4FJM A;  2WFB A;  1CXU A;  3MEG A;  3G4S N;  4K0K K;  1VK0 A;  2AP1 A;  5TKY A;  1KFD A;  3SAG A;  1LCU A;  1NK9 A;  3VEY A;  3R3L A;  4Z0U A;  5BR8 K;  2QWM A;  3V9S A;  2GBZ A;  5M1O A;  2GX9 A;  4M7X A;  5AQH A;  3HRG A;  4E7H A;  1KAY A;  3GOI A;  3OYB A;  3V9Z A;  4DFK A;  3F73 A;  3IFR A;  2OZM A;  1XMO K;  1E4G T;  4BVP A;  4CJQ A;  4B3R K;  4LSN A;  2XY6 A;  5KQ8 A;  3CC2 N;  2D1K A;  2IAJ A;  1IBL K;  4YNQ A;  4DR5 K;  1BG3 A;  1VSL A;  5GAE P;  4F4K A;  1BA0 A;  1NKE A;  3AAP A;  3H46 O;  2P9P A;  4KHW A;  3L4I A;  5DM6 L;  4ILJ A;  2ASM A;  2YI1 A;  3P5J A;  5AQP A;  3FZH A;  1HKG A;  5AQY A;  5C42 A;  1KC8 O;  4CHY A;  4M7Y A;  2HHW A;  4AHS A;  4JKE A;  4CJR A;  3F9M A;  5SWM A;  2D5R A;  4E1J A;  3VEZ A;  3C6U A;  3J8A A;  4HWI A;  2FXU A;  3VF4 A;  3HP9 A;  1BIU A;  3IS9 A;  3OJS A;  3GDQ A;  4H5R A;  4FW2 A;  4YDU C;  1LWE A;  1VAZ A;  4F8R A;  3FR0 A;  3HK2 A;  2GTD A;  2O4G A;  5EXW A;  3HO1 A;  4H0O A;  1KAX A;  3ID6 A;  3CJ1 A;  4Z4I A;  2ASO A;  4Q5V A;  4CJP A;  4JK7 A;  2PYJ A;  2D0P A;  1VQO N;  3ZET A;  4H03 B;  1S1W A;  1IJJ A;  3SMP A;  4FW1 A;  2P9K B;  5GAG P;  4AM7 A;  3J7Z O;  3OYD A;  1YXQ A;  1X1P A;  3L2U A;  4KHP K;  1NK6 A;  4H0V B;  1ESV A;  4DQ8 A;  1S1T A;  3AVM A;  4KH6 A;  3OYE A;  3HVR A;  3DLG A;  4KBO A;  2HBJ A;  4BG9 A;  2G8U A;  5DMR A;  1S72 N;  3HI0 A;  2P5G A;  4NCG A;  3P39 A;  3HPG A;  4B9S A;  3ZEU B;  3KLF A;  4B9N A;  1D4X A;  3S41 A;  2O8D B;  3HVT A;  4GKJ K;  2Q0R A;  2W6L A;  4FJX A;  4BR4 A;  3WT0 A;  2E2Q A;  3WNF A;  3HOS A;  3KWG A;  1U49 A;  3CCU N;  3LP3 A;  1DT9 A;  1NGH A;  2NRT A;  3T19 A;  3LM2 A;  4BQL A;  2WON A;  3KIO A;  5AZJ A;  3ZX3 A;  2KW4 A;  5AQX A;  1C1B A;  4C1N K;  1WSF A;  2O8B B;  3P31 A;  1TKT A;  3WXM B;  1HNW K;  4YOV A;  1T3V A;  3AVH A;  5AQL A;  4QS8 A;  3ZSW A;  1EWR A;  3CME N;  2VG6 A;  3SUO A;  2P9S A;  3WQT A;  4YOY A;  3OYA A;  3U9Z A;  3RWU A;  1XWL A;  4CEA A;  1RT5 A;  4BRE A;  1OKJ A;  1JJ2 M;  3TTC A;  4CIF A;  2HHH K;  3OS2 A;  5BPN A;  1XQS C;  4E3S A;  1K9M O;  4CF0 A;  3LWL A;  2ZGZ A;  3SLC A;  3CF5 L;  4KI4 A;  2NRX A;  5M1F A;  1NGF A;  4A5B A;  1XI1 A;  4BY9 C;  3ZSZ A;  3NH2 A;  3CJ9 A;  2P5O A;  3TSQ A;  1I39 A;  4OLA A;  5KTQ A;  4FYD A;  4BR0 A;  4HUF A;  1K8K B;  4QOZ B;  1TAQ A;  2NRR A;  4CJ3 A;  1L3T A;  4M3Y A;  1S3X A;  3O4N A;  4O0I A;  1W0H A;  4CJF A;  1JLC A;  3RSE A;  3O1B A;  4CJL A;  4AM6 A;  4IDK A;  3IKM A;  3IAY A;  1TGO A;  1LWF A;  3QIN A;  4QCL A;  4FM2 A;  1R0A A;  2UXC K;  1C1A A;  3QEV A;  4DB3 A;  4M63 C;  4CVN E;  2P9N B;  2QKB A;  4DFM A;  3M6G A;  2OPR A;  3DLR A;  1P90 A;  4J2B A;  1ZBH A;  4DU3 A;  2VQE K;  4DR2 K;  1O1W A;  1CZ9 A;  3AGR A;  4FJN A;  3I8B A;  4YDU A;  3CM6 A;  5AQW A;  3HSC A;  5AJ3 K;  4W5R A;  3WEE B;  3CPW M;  1KRP A;  3LAK A;  4DV1 K;  3LAL A;  4IG3 A;  2RPI A;  3H45 C;  3MMV A;  4ILG B;  3E9L A;  3KLE A;  3E01 A;  1J9A A;  3CIP A;  2F8T A;  3PX4 A;  3B8A X;  4MLE A;  2FSJ A;  3TPQ A;  2Z1G A;  1WOQ A;  2YNG A;  3VN5 A;  4A2A A;  1NGG A;  3WNH A;  2CGJ A;  4M3W A;  3CG7 A;  2F96 A;  3L2R A;  1Y64 A;  4CF8 A;  3KLG A;  1FXX A;  1GOB A;  1NBW A;  3VGM A;  3A8Y A;  4JI8 K;  1TK8 A;  1IKW A;  1VQ4 N;  1W9H A;  4B9M A;  4FK2 A;  2ZJQ L;  4CGI A;  4BRC A;  4CZH A;  3PLA A;  3EZ5 A;  3P1G A;  5J2M A;  4CEF A;  3B6P A;  3W3D A;  4MFB A;  1EXQ A;  4JAX A;  4ELU A;  4FLW A;  2P9L A;  1YT3 A;  4EP4 A;  5C10 A;  1KD1 O;  3MX5 A;  4CHN A;  3DRR A;  3F5T A;  4JYA K;  3VMF B;  2KZM A;  3VEX A;  3I55 N;  3C6T A;  4CJU A;  1JLE A;  5KRS A;  3M8R A;  1D9F A;  1U2V A;  2WTU A;  2F7T A;  1W7A A;  4LF9 K;  3OA9 A;  4DTX A;  3O9Q A;  5KPT A;  1ASV A;  1U4B A;  1MDU B;  4CJV A;  4FVU A;  1Z26 A;  4NO7 A;  5M1P A;  3J80 O;  5FRM A;  3ULD A;  5KRT A;  1IG8 A;  4BE1 A;  3E9P A;  1KFS A;  3AVJ A;  3T3F A;  1B9F A;  1Z05 A;  4RWT A;  2A3Z A;  3QFP A;  4GV3 A;  4XH1 A;  3K57 A;  2FC0 A;  3AVG A;  1NGD A;  1JL2 A;  5C15 A;  3V1O A;  1N32 K;  1NK5 A;  2FSK A;  4O8K A;  4CEZ A;  1DGK N;  1D5A A;  1VHX A;  4F2S A;  3U6F A;  4FK0 A;  4B1U B;  4FPA A;  1IO2 A;  3IRX A;  1UOC A;  4IEE A;  2V51 B;  2YHW A;  4EIA A;  5EX5 A;  4RCH A;  3KK2 A;  4ELV A;  3I33 A;  1A5W A;  4BE2 A;  1NGE A;  3VQ9 A;  1HNI A;  1WSI A;  3CJB A;  1U45 A;  3TAQ A;  2KKZ A;  2XY5 A;  1SQK A;  4EHU A;  4ICL A;  5A2Q O;  4RW9 A;  4FLV A;  4H4O A;  2OTJ N;  4DTP A;  2E20 A;  3HYF A;  1Q82 O;  1X9M A;  2ZWH A;  2E8A A;  4EZ6 A;  2NLX A;  3PO4 A;  2QWN A;  4CHO A;  4M3Z A;  1HPM A;  4AHU A;  4EHT A;  2E4L A;  3S9H A;  4BGA A;  3PX0 A;  2HVH A;  4B3M K;  3ZX2 A;  2BGG A;  1VQM N;  4LH5 A;  5I3U A;  4FPB A;  4B1X B;  3CCL N;  3AA3 A;  4CCH A;  2HST A;  5FPD A;  2X6N A;  2O8E A;  3VEV A;  3TTF A;  1SL1 A;  4K8X A;  4IOC L;  4HCB A;  1NGJ A;  4FLT A;  4B1Y B;  4BRK A;  1RDB A;  3LPT A;  3DLE A;  4H5T A;  3L2V A;  4BC2 A;  2UUC K;  3MED A;  2G8V A;  3AA4 A;  5DK5 A;  4CJE A;  3D2E B;  1J5E K;  2WOM A;  4JD2 A;  3EL2 A;  5F1X A;  1TYQ B;  4DWI A;  3O3F A;  5AZI B;  1W97 L;  4IFV A;  2UUA K;  1T05 A;  1GLF O;  1GLC G;  1NLV A;  3SQ2 A;  2P9I A;  5HRR A;  2G8K A;  3SCX A;  1YUW A;  4KPY A;  4OX9 K;  3ZLJ A;  4DTR A;  1U6Z A;  5C24 A;  5HP1 A;  2FBT A;  4JKB A;  4H5W A;  2ZE2 A;  4AHT A;  3SAH A;  3AGK A;  4B8A B;  4DUY K;  3ZT2 A;  1QZ5 A;  4DF4 A;  1BI4 B;  4WYB A;  1VQ7 N;  4GY2 B;  3OYC A;  4CEO A;  3KK3 A;  3WXK A;  3NBP A;  3CER A;  3ENO A;  5J2Q A;  1S1U A;  3EN9 A;  1RTD A;  2DTU A;  2DFF A;  4FCY A;  5BRD A;  3HBT A;  2ZF5 O;  3TAF A;  2VGM A;  3V1R A;  2Z1J A;  1GLJ O;  2XY8 A;  1JLQ A;  4E0D A;  5AQR A;  1C0T A;  2IIR A;  1QSS A;  2QWO A;  3PX6 A;  3T1A A;  4F3T A;  2X6S A;  3PIP L;  3C65 A;  2RHK A;  1X9S A;  2XRI A;  3MXJ A;  1XUP O;  2OPQ A;  1SKS A;  3L3V A;  4WQ5 C;  3J7A P;  2XY7 A;  3K5L A;  3DXM B;  3A5O C;  4DMN A;  3ZSQ A;  1C0F A;  4NCA A;  1YI2 N;  4LY7 A;  1XC3 A;  1NJW A;  3MDQ A;  3SMS A;  3AA5 X;  4M45 A;  3NCI A;  4L3Q A;  5LJV A;  2O8F A;  1ZBS A;  1W2B M;  3CFO A;  3CD6 N;  4DTO A;  1JXB A;  3FGU A;  5BPL A;  1S5J A;  3CCR N;  2D0B A;  2KLA A;  4DQS A;  4DSK A;  4BR2 A;  4OGE A;  2O8B A;  1WAF A;  3FZM A;  4JKG B;  3A5N C;  2CGK A;  1FK9 A;  4DSE A;  4IFE A;  3CCQ N;  3R9P A;  4FVM A;  4CJW A;  2IC3 A;  4FLZ A;  3HPH A;  3VQQ A;  3WXI A;  1YHQ N;  4YY3 K;  2E2N A;  1M90 O;  4JI7 K;  1NGB A;  4CGF A;  2HBL A;  4HVJ A;  1LWC A;  3LP2 A;  1N5Y A;  4GV6 A;  3AVF A;  4O0J A;  3BUZ B;  2A40 A;  5JS2 A;  5F2R A;  3DXK B;  3VER A;  2ZGY A;  1UA0 A;  1K8A O;  3NE6 A;  4H0X B;  3E9O A;  5FRO A;  5LMU K;  1QHA A;  2YNI A;  4KAZ A;  4R79 A;  4RW4 A;  4FJ7 A;  1HX1 A;  1K8K A;  2GEM A;  4XIU A;  3FFI A;  2AA4 A;  4IKF A;  1B9D A;  1FJG K;  3QEX A;  3THW B;  4X65 K;  1QSL A;  4BC5 A;  2E88 A;  3ALY A;  1C0G A;  4W5Q A;  2QWR A;  3K9J A;  4EZ9 A;  3LL3 A;  5BN9 A;  4A59 A;  1TKZ A;  1UWB A;  3TAB A;  3BP8 A;  3BDP A;  3NF6 A;  4HUE A;  4UY8 O;  4GNI A;  1WSJ A;  3OTO K;  4J8F A;  3S3N A;  1BGX T;  3VGK A;  1ILY A;  4B9V A;  2Y1J A;  4FWS A;  1CXQ A;  3CPE A;  3NF7 A;  1KTQ A;  4H8K A;  4FM1 A;  3G0Z A;  3HPO A;  4KRF A;  4AH9 A;  4KB1 A;  1BWF O;  1HPZ A;  1BO5 O;  3E1Y A;  3LAM A;  2BE2 A;  2NRV A;  3AAR A;  3C7N B;  3VA3 A;  3WUH A;  4O5F A;  3TI0 A;  3PUF A;  5KI6 A;  3VGL A;  4JS4 A;  5FRN A;  1SS6 A;  4H0P A;  1BL3 A;  1VQP N;  4E19 A;  1TK5 A;  1WAJ A;  2HHQ A;  1L5U A;  3TAP A;  1JLG A;  5AQK A;  4BRA A;  4C8L A;  3HXM A;  1SL2 A;  3OS0 A;  3IG1 A;  2AJQ A;  4EFH A;  1JL1 A;  1OVQ A;  3QNO A;  4Z4G A;  2V7Z A;  4H0T B;  4DV0 K;  1Q86 O;  4X66 K;  4FLX A;  1D8Y A;  2YNH A;  4DS4 A;  4WQ5 A;  2F9T A;  3VQ6 A;  4FM0 A;  5JVH L;  3QBW A;  4I7F A;  1NGI A;  4B8C A;  4B1W B;  2QXL A;  3O80 A;  4CHP A;  2FBX A;  4IJA A;  2UUB K;  4DTS A;  2GUI A;  2OTL N;  3AVA A;  1GOA A;  3SBT A;  4UQG A;  2YCH A;  2P1J A;  3D7E O;  3WNG A;  1F21 A;  3SI6 A;  1RBU A;  4CK3 A;  4JLH A;  1EWQ A;  3VPZ A;  4Z4F A;  4DTJ A;  3CC4 N;  3KKR A;  3MWT A;  1FW6 A;  3HTV A;  3KJV A;  4WFN L;  2Q97 A;  1WUA A;  4O8U A;  4C8O A;  4G9Z A;  5CR4 A;  1TL1 A;  3UKR B;  2ETJ A;  4DQQ A;  1SAZ A;  4HUG A;  1ASW A;  4L8R B;  2P9U B;  1NWK A;  4DFJ A;  2QK9 A;  4PWD A;  3AVI A;  2O8C A;  1HYZ A;  2YHY A;  2PAV A;  1C0U A;  4DR6 K;  1KSP A;  3O9R A;  1S22 A;  4CK1 A;  4B08 A;  4M3R A;  3D2F B;  3SJJ A;  4CGG A;  3NHG A;  1L3S A;  3DOK A;  2HB5 A;  3QIC A;  4LH4 A;  5C25 A;  4C1N I;  1S6Q A;  3EY1 A;  1V4S A;  4NXN K;  3DM2 A;  1NM1 A;  5AQJ A;  3L2W A;  5HRN A;  1ZBI A;  1Q7Y O;  3SUQ A;  3CJ7 A;  4FJG A;  1KVC A;  1NJI O;  3ENH A;  2BUP A;  1S9G A;  3HT3 A;  1EET A;  4JI4 K;  3ZT3 A;  4DV3 K;  3OYJ A;  5AQQ A;  3M8P A;  1BOT O;  1QS4 A;  4KTZ A;  1YJN N;  5AQU A;  1RT1 A;  5SZT A;  4FWR A;  4FZY A;  4OPA A;  1QHT A;  2A42 A;  3G25 A;  4E89 A;  1EX4 A;  2DFH A;  1YAG A;  2HHV A;  3ASM A;  2ZJP L;  5FDL A;  3NH0 A;  2NUB A;  5AQT A;  2FBV A;  1NGC A;  4BRP A;  3K2P A;  4KHQ A;  4E7L A;  3U9D A;  2A1R A;  3QIP A;  2IVO A;  3RMD A;  2UU9 K;  3CCM N;  4R5P A;  2F9W A;  3CQX A;  4CZK A;  4BWJ A;  4CZE A;  2RE2 A;  4MQ3 A;  3BZK A;  2E1Z A;  1M1K O;  1IH7 A;  4ISE A;  5BR9 A;  3F9K A;  5ELZ A;  4BC3 A;  4KHN A;  4J2E A;  1MA9 B;  4CFC A;  5JS1 A;  1J5O A;  2HNZ A;  3ATV A;  1V4T A;  4WF9 L;  1TYQ A;  1OH5 A;  1VSF A;  5AZI A;  2KZZ A;  5BRE A;  1ZC6 A;  1Y97 A;  2HHT A;  3AV9 A;  2HHS A;  1IKV A;  3RMC A;  4DR3 K;  3JAM O;  3SAF A;  3LDS A;  2VG5 A;  3B6O A;  2W40 A;  4DU1 A;  4BGB A;  2HND A;  5J1E A;  2QA4 N;  1T8E A;  4DKW A;  1NNE A;  3KVG A;  1QSY A;  1X9W A;  4CBW A;  5CYQ A;  2P9P B;  3UB5 A;  3TSP A;  3ZT0 A;  4YOW A;  5J2P A;  2IS3 A;  4J2D A;  1J53 A;  3AO1 A;  1RDA A;  2FSN A;  4I9Q A;  1HKC A;  2Q36 A;  4LFB K;  2ATQ A;  4GMJ B;  4JKF A;  4JRP A;  3MK6 A;  4LSL A;  1N6Q A;  1EO1 A;  3BY5 A;  3HST B;  4Y1C A;  1WN7 A;  1TKD A;  1K6Y A;  4BRL A;  3OHR A;  4B9T A;  4FWO A;  2F8S A;  2BH1 A;  3VQD A;  1XMQ K;  3AVB A;  5KGW A;  4BE0 A;  3TAN A;  1ATN A;  3CCV N;  3MN9 A;  3QFU A;  1JLF A;  2IOC A;  3C94 A;  3UKU B;  4IEI A;  1NGA A;  5AQZ A;  2EX3 A;  2XO7 A;  4CJ7 A;  3CQ8 A;  2I7N A;  4DQI A;  3ISN C;  3OYF A;  1C6V A;  2CH6 A;  4JKD A;  3R8E A;  4CE9 A;  2E2O A;  2NRW A;  1BCO A;  1IG9 A;  4ZTF A;  1RGI A;  1OH7 A;  4IO8 A;  3JSM A;  2DY4 A;  1QQC A;  1XHX A;  1HUX A;  5AFU A;  1S1V A;  4KTW A;  4DV4 K;  1CZA N;  4Z4C A;  3DXM A;  4NYN A;  3T7Z A;  3HOT A;  3HM9 A;  3VOV A;  2GWK A;  5HBM A;  4CHZ A;  3C0B A;  4KHU A;  3CJA A;  4DV2 K;  5C2D A;  4O55 A;  2YJF A;  3QEI A;  3AVK A;  4RW7 A;  1HLU A;  4Z94 A;  3EKU A;  1Z6R A;  3EE9 A;  4IXC A;  4JKC A;  5AQO A;  4KH4 A;  4DU4 A;  3BF3 A;  1TL3 A;  3SNN A;  3FLC O;  5CZ1 A;  4CEB A;  1KXP A;  4OO1 J;  3PO5 A;  2X78 A;  4WFA L;  2VQF K;  4KB0 A;  3OBY A;  1OH6 A;  1SL0 A;  1IBM K;  1VSM A;  2HBM A;  1IBK K;  4A2B A;  2ZM6 K;  1BDG A;  1NK8 A;  1VQL N;  3C6H A;  2HF3 A;  4IO9 L;  2Z1H A;  4DS5 A;  4FJJ A;  3RVC A;  4U67 L;  3DJC A;  3LP1 A;  1HJO A;  1NK4 A;  4LF5 K;  3M1F A;  4FZX C;  1RTI A;  4B3O A;  5LL6 Z;  4Y0W A;  1P8Z A;  4N76 A;  1VQN N;  1XC9 A;  3P4I A;  3JXU A;  4CEE A;  3M8Q A;  4IJN A;  1WB9 A;  2EHG A;  2FF6 A;  3EYZ A;  4OPH A;  1JLA A;  2RKI A;  2P9S B;  4CF1 A;  3SPZ A;  1YJ9 N;  1D9D A;  2YHA A;  3O6W A;  3K9K A;  5AQV A;  3NGY A;  3CXC M;  3DXK A;  2WUS A;  3TWH A;  3CM5 A;  2Z1I A;  2BDP A;  2E1Y A;  4JK9 A;  4CZL A;  5ADX A;  4B3S K;  3NVM A;  4CJ4 A;  1XNR K;  1NJY A;  3MCA B;  1TAU A;  3CJC A;  4CGH A;  4DLG A;  4PKH A;  1UAX A;  3KK1 A;  4K8Z A;  4PY5 A;  5M1N A;  4RTF D;  1JCE A;  4FOE A;  3CCJ N;  3THW A;  1FKO A;  1RT2 A;  1S6P A;  4GV9 A;  3AO5 A;  3K5M A;  2JGU A;  4CBX A;  5KQD A;  3J81 O;  2KFZ A;  3THY B;  2QWQ A;  5HOO A;  3SYZ A;  3VEO A;  1SV5 A;  3AA2 A;  1BIZ A;  1TKX A;  3SK3 A;  1KLM A;  3I0R A;  1JKH A;  2OPP A;  4ZHR A;  3SQ4 A;  5E26 A;  4I9L A;  1RT3 A;  3RSE B;  4E1N A;  1DLO A;  4N5S A;  1KLN A;  5F0X A;  4AQY K;  1ZBF A;  2VCP A;  3G10 A;  4FO0 A;  4B9Q A;  3P83 D;  3OYK A;  1HNZ K;  4C8N A;  1BA1 A;  1NKB A;  4E1M A;  2I5J A;  4CFB A;  5I42 A;  2JWK A;  2B4J A;  5HL7 L;  3KKS A;  3KD1 E;  5T7B A;  1I94 K;  2QEX N;  4I2Q A;  5E41 A;  3VQP A;  3RTV A;  4QS7 A;  2YHB A;  3SQ1 A;  2FLO A;  5HRS A;  4E7J A;  2IVN A;  3LWM A;  3DAW A;  3ENB A;  2E6M A;  3IDH A;  3ZT4 A;  1QTM A;  4EAH D;  5JIC A;  5FPN A;  2HF4 A;  4F2R A;  1LAV A;  5EU7 A;  3SUN A;  2PZS A;  2OZS A;  5LY3 A;  1HJR A;  3KK7 A;  3ZT1 A;  3PV8 A;  5FLX O;  4AHC A;  1ITG A;  1J54 A;  5AFU H;  2D0C A;  5GAD P;  3GBT A;  4FOI A;  1QQO A;  5LMN K;  1S9E A;  4HHT A;  3QEP A;  2A41 A;  1Q9X A;  3OYL A;  1WSG A;  4CZF A;  2P9K A;  2E2P A;  4H4M A;  4OVL A;  3FE1 A;  3H1Q A;  3LZJ A;  3SUP A;  2QKK A;  5C0Y A;  1N33 K;  5CZ2 A;  3VEN A;  2FF3 B;  3I56 N;  3A5L C;  2IVP A;  2Q31 A;  3CYM A;  3WXL A;  2OAN A;  2Q0U A;  2DFE A;  2P9L B;  3QIO A;  3V9U A;  1GLB G;  4CF9 A;  3QLH A;  3KD5 E;  2FBY A;  4Z4E A;  3AO4 A;  3U3Y A;  3NDK A;  3VET A;  3NMU A;  5E84 A;  3ZEU A;  4LF6 K;  2P9U A;  1L3V A;  1T03 A;  3VEW A;  2YX6 A;  1KQS M;  3CI5 A;  4CZG A;  2O8D A;  5FPM A;  4BRN A;  1RBR A;  5JLF A;  1WSH A;  1HYS A;  5FPE A;  5HRP A;  2ITM A;  4J2A A;  4DR7 K;  3S3M A;  3C6A A;  4NXM K;  3OYH A;  2HHU A;  2GEL A;  3D45 A;  2HBK A;  2VG7 A;  4X64 K;  5CY4 A;  4BRI A;  4FWQ A;  5EOY A;  4M3T A;  1GLE G;  4KV8 A;  1QQN A;  1OVY A;  3C95 A;  1VQ5 N;  1O13 A;  3OY9 A;  1DEJ A;  3TAG A;  2D0O A;  3WXJ A;  1HYV A;  5BRF A;  3O08 A;  1BHL A;  4BRF A;  3V9X A;  3L6Q A;  3TAE A;  3VQ8 A;  3DWL A;  5C2F A;  4MO5 A;  1HQE A;  3F2K A;  1E3M A;  4H5N A;  2UYT A;  4K25 A;  5GIP A;  5M1K A;  3CFP A;  4DQR A;  3LDN A;  2E5L K;  3DRS A;  3MX2 A;  2JLE A;  4DQP A;  1NJX A;  3ITH A;  4CFA A;  5M1Q A;  5D3G A;  3OVN A;  1SZ2 A;  4I6M B;  5JMV A;  3K59 A;  3SJH A;  4IG0 A;  3LDO A;  5C12 A;  4PUO A;  4JI3 K;  4BC4 A;  4M3X A;  4AHV A;  4KHS A;  3AAQ A;  4N41 A;  1RDU A;  4PL8 A;  3H6E A;  5HLF A;  2A1S A;  3WQU A;  4FL9 A;  2V7Y A;  1X3M A;  1HQU A;  4DCH A;  3EEQ A;  3SQ0 A;  1QZ6 A;  4Q0B A;  4C23 A;  3R6M A;  4A61 A;  2O8E B;  1ATR A;  1VQK N;  4FWP A;  1X3N A;  4GVM A;  4CHQ A;  4BWM A;  4PHT X;  3BGR A;  3UE5 A;  4CIG A;  3DRP A;  4BR7 A;  2P9N A;  1LOT B;  4QS9 A;  1RTH A;  4KH5 A;  4W5O A;  5KPR A;  4WFB L;  3OBW A;  3NFA A;  4BVO A;  4DTU A;  3TR8 A;  3RRH A;  1VQ6 N;  2LSN A;  2PFU A;  4JD2 B;  2HMP A;  1I3A A;  1Q8I A;  3HJF A;  1OH8 A;  2VWB A;  2VYP A;  3WEE A;  3A0I X;  5AR0 A;  3ZSX A;  2P9I B;  5I9E B;  3L4Q A;  3KWI A;  2BAN A;  4FXD A;  2PBD A;  1XNQ K;  3QEW A;  4MO4 A;  3LP0 A;  2OA8 A;  4CEC A;  2EWS A;  3EZW A;  3MXI A;  4O44 A;  1JCG A;  1BUP A;  2RF2 A;  3H08 A;  1YF5 L;  4OLB A;  3O9T A;  1NG9 A;  3A5M C;  3CET A;  1FKP A;  1CLQ A;  4LC9 B;  3P38 A;  3TAM A;  4KRE A;  5IWA K;  2KTQ A;  2QWP A;  3AVN A;  1EQY A;  3QET A;  3E66 A;  1A5V A;  4IBN A;  4NLB A;  4YHH K;  3JYT A;  2VWJ A;  4FJ8 A;  3KZB A;  1RT4 A;  4RW8 A;  4FWM A;  1KVA A;  2XHB A;  2NRZ A;  3UKU A;  4OKK A;  3QES A;  4FJL A;  2ITG A;  3K58 A;  3A2F A;  4WQ4 A;  1JXE A;  4C8M A;  2G8F A;  1TUY A;  3FZK A;  3IMX A;  1WBB A;  1LW2 A;  3VQ4 A;  4BRM A;  4Z4H A;  2BTF A;  2YV0 X;  4DFP A;  2IGI A;  4JHD B;  4PA1 A;  4V19 S;  3M8S A;  1S1X A;  1C0M A;  3UIQ A;  1RDD A;  4KO0 A;  4QAG A;  1RDW X;  2G8H A;  1RBS A;  2YNF A;  1KVB A;  4XH5 A;  2F4V K;  1GOC A;  4I2P A;  4FK4 A;  1NOY A; 
#chains in the Genus database with same CATH homology
 2UUC K;  4JYA K;  4NXN K;  1J5E K;  1XMQ K;  4LF9 K;  1N33 K;  4B3S K;  4LFC K;  1XNR K;  2UUA K;  3T1H K;  3J80 O;  4JI4 K;  4DV3 K;  4OX9 K;  4JI1 K;  4DV0 K;  4X66 K;  4JI6 K;  4LF6 K;  4KHP K;  1N36 K;  3J81 O;  4B3T K;  4DUZ K;  4K0K K;  4LF7 K;  1HR0 K;  1N32 K;  3T1Y K;  4DV4 K;  2UXC K;  4JI0 K;  5BR8 K;  4DUY K;  4YY3 K;  4CVN E;  4DR7 K;  4JI7 K;  2UUB K;  4JV5 K;  4NXM K;  4LF4 K;  3J7Y P;  4DV7 K;  4LF8 K;  2UU9 K;  4X64 K;  1XNQ K;  4DV2 K;  2VQE K;  4DR2 K;  1XMO K;  4AQY K;  4B3R K;  5A2Q O;  4GKJ K;  5LMU K;  4DR4 K;  5AJ3 K;  1HNZ K;  2UXB K;  4DV5 K;  4DV1 K;  4DR1 K;  1IBL K;  5IWA K;  4YHH K;  4DR5 K;  4JI2 K;  1N34 K;  1I94 K;  1FJG K;  4X65 K;  2VQF K;  2E5L K;  1IBM K;  1IBK K;  1HNW K;  4DR3 K;  3JAM O;  2ZM6 K;  4B3M K;  3J7A P;  1HNX K;  4V19 S;  3OTO K;  4DV6 K;  4JI8 K;  4GKK K;  4LF5 K;  4JI5 K;  4DR6 K;  5LL6 Z;  4X62 K;  5FLX O;  5IT9 O;  2HHH K;  4JI3 K;  4CW7 B;  2F4V K;  4LFA K;  5LMN K;  4LFB K;  2UXD K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...