1RBTA

Structural study of mutants of escherichia coli ribonuclease hi with enhanced thermostability
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADGKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Structural study of mutants of Escherichia coli ribonuclease HI with enhanced thermostability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
total genus 53
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rbtA00
1IG9A 1ZBHA 2ITGA 3PO4A 1TK5A 4KAZA 4M45A 1NK9A 3VQ8A 1Y97A 3K59A 3OYHA 1RBTA 4OLAA 1KVBA 3KLGA 1QQCA 1U47A 3CG7A 1J54A 2O4GA 4B8AB 1FKPA 4AHVA 5C42A 4N41A 2XY5A 2YHBA 2XHBA 3VA0A 3RMAA 4CJTA 4PWDA 1RT1A 1ZBIA 4OPJA 3OS1A 2Z1GA 3O3HA 4IFVA 3QNOA 3M8SA 3OJUA 2P51A 1WSHA 4AHTA 1XC9A 2HHUA 4OVLA 1KLMA 1JL1A 2XRIA 5HRNA 3AVHA 4FM0A 2QXFA 3S3NA 2Z1IA 2KFZA 1LWFA 2DFEA 3CM5A 3D45A 2W42A 3V1RA 3AO3A 4IKFA 4J2DA 1WSJA 3HPGA 4LH4A 4M42A 1L3TA 1RBVA 3AO4A 2OZSA 1ZBUA 1NJZA 1DTTA 1QHTA 3AO2A 3HVTA 1WAJA 3C95A 2ZQBA 4N56A 3NH1A 2OPQA 4CGFA 4BDYA 2EX3A 1Q9XA 1WN7A 3KD1E 1RDDA 3SV3A 1N5YA 1VSHA 4FJHA 3DMJA 3NH0A 3CYMA 4CJUA 5I42A 4YNQA 4DFPA 4CEEA 3OY9A 1S1TA 1VSLA 1WAFA 3ASMA 4CE9A 1ASWA 1J9AA 1KFDA 3V4IA 4N76A 2EHGA 5HROA 3FFIA 1CXQA 3LPTA 3VA3A 4OLBA 1CZBA 4CEBA 2ETJA 2YV0X 4DTSA 1RBSA 1KLNA 1L3UA 1ASVA 4E3SA 1Q8IA 1W9HA 4DSIA 4FLZA 3SUNA 4CJ5A 5KRSA 5KGXA 1REVA 1BGXT 1HYSA 4CJWA 1RDCA 1DLOA 4IDKA 4J2BA 1D9FA 3LALA 4KTQA 4W5RA 1RT5A 2YNGA 3NF8A 3O4QA 1S1UA 4E89A 1X9WA 5K14A 1BL3A 1B92A 1CZ9A 4NCGA 3K2PA 4MQ3A 4E7KA 4CCHA 4FJKA 1A5VA 2IGIA 4KHSA 3MEEA 1UA0A 3PX0A 1YTAA 1VRTA 3SI6A 3AA2A 3L2WA 4HUFA 3QESA 1QE1A 1GOCA 1TAQA 3SPZA 4KO0A 4JS4A 4F3OA 2RN2A 1NJYA 3HPOA 3AV9A 1BI4B 1JKHA 1LAWA 4Y1CA 4CJKA 2FBTA 2WONA 3ZSXA 4ID1A 4C8MA 4CFAA 4CEZA 3TARA 4J2EA 2R7YA 4B9NA 3TAQA 2VG5A 5FROA 2HW3A 4CFDA 3T1AA 1EETA 1UWBA 3VQPA 2X6SA 1S6PA 3MXMA 4FJ5A 2PY5A 1JLQA 1TK0A 1B9DA 3RRHA 1LW0A 3QEXA 2Z1HA 3L2UA 3VQCA 3EYZA 3THVA 3NGYA 4ID5A 1U4BA 2HVHA 4RG8A 3TR8A 1TKTA 3VQDA 3OS2A 1Q9YA 1KVCA 3OYEA 4CJSA 4BE0A 2HHSA 1RDAA 1YTUA 4HVJA 2BGGA 3LANA 5CY4A 3V1OA 1XHXA 2GV9A 4BWJA 3F73A 1A5WA 3QEWA 3AVLA 4FLVA 2IC3A 1U45A 1C0UA 4KI4A 2OPSA 4DTJA 3AA3A 2RF2A 1LW2A 4M3WA 4OKJA 3OYGA 2ZE2A 2G8WA 1HQEA 1RBUA 2VG7A 3ZSZA 4CEDA 4CGHA 1KSPA 4CEQA 4HUEA 1EXQA 1B9FA 4KHUA 3IRXA 1J5OA 1S1XA 4Q0BA 4NYFA 4OKEA 3KK2A 1QS4A 1SL2A 4F3TA 4CGJA 1X9MA 2DFHA 2YKNA 1WNSA 1S1VA 1BIUA 2XY7A 1SKWA 1JLBA 1WSEA 4W5NA 2JLEA 3P1GA 3KTQA 3L2QA 1IKWA 3AVMA 3DOKA 4QAGA 4CECA 1VK0A 2YNIA 1JLEA 3WNHA 1JLFA 1NKEA 3WNEA 4DU1A 4FJJA 4KHNA 1HQUA 4CJRA 3K57A 2G8FA 3HP6A 2KZMA 3AVBA 2OPRA 4OPKA 5JS1A 3ZSRA 4DF8A 4J2AA 3NGIA 4BWMA 4CF0A 3QETA 1EKEA 4IFYA 1HYZA 3HL8A 2RKIA 4H4MA 1EP4A 2XO7A 2A1RA 4FLYA 3QERA 1WLJA 3V9SA 4FW2A 3TAMA 4DQSA 1GOAA 3ZSOA 3QEIA 3U3YA 2KQ2A 2XY6A 3LAKA 4DTNA 2G8UA 5FDLA 3B6PA 3I0SA 2E6MA 3DM2A 2ZD1A 3NBPA 4C8NA 2KFNA 1VSDA 4ZTFA 3ZSWA 3L3VA 4DLEA 2A1SA 3NCIA 3EY1A 1TVRA 2BE2A 4CHOA 2OPPA 1HNVA 1RBRA 1ZBFA 1HPZA 3SQ0A 1CLQA 3QEPA 5CZ2A 1L3SA 2HB5A 1WSIA 3B6OA 2B4JA 3QIPA 1RT7A 4KB1A 3U6FA 3SV4A 1RTJA 1D9DA 4DSLA 4CHQA 2Y1JA 1NK4A 4FJXA 1RCHA 3PY8A 4I9QA 4DSJA 3V1QA 4CHPA 3KLHA 4F4KA 3ZSVA 1RT4A 4E1NA 2KW4A 4B9LA 1RT3A 1S9EA 1D5AA 2JGUA 3V6DA 3SUOA 3S3MA 3HO1A 1IKYA 3RMDA 4DQPA 4Z4GA 4CJLA 3DYAA 4KKOA 3NGZA 2RPIA 3OYMA 3HM9A 1C0MA 4GW6A 4CFCA 4M3RA 5EU7A 3ZT4A 4FW1A 1KRPA 3VQAA 1ITGA 3KLFA 3PO5A 3EZ5A 3TANA 1I3AA 4F2RA 4AH9A 2FBXA 3TWHA 1GOBA 2D0AA 4OGEA 2YNFA 4CEFA 4FJGA 3AVAA 4RW4A 4PUOA 2X74A 4DG1A 4FZXC 3SYZA 1J53A 1UA1A 1VSKA 1K6YA 4GMJB 4E19A 3AA5X 4NYNA 4DF4A 1TKXA 3V9UA 1TL3A 3HP9A 3SPYA 4K8XA 1JLCA 3RMBA 1KVAA 3VQ7A 4AHSA 5J2MA 1SKRA 4W5QA 1NJXA 4FZYA 4C8KA 3K5MA 3TABA 1JLGA 3V9WA 4C8LA 3MEGA 1I39A 3BDPA 5FRNA 3D0PA 4RW7A 4DQRA 4HUGA 4CJVA 2OA8A 4KREA 2HHQA 1HNIA 4GVMA 1HJRA 4RW9A 4E0DA 4DQQA 4YFUA 1TKZA 1Z26A 1NKBA 3KD5E 1IH7A 5T7BA 4QOZB 2D0BA 2B6AA 1LWEA 3ITHA 4PQUA 4FM2A 3IS9A 2ATQA 1VSFA 4OGCA 4XIUA 2OYQA 2KTQA 4E7LA 3DLKA 3ZT2A 2E6LA 3I8DA 4KTZA 3T3FA 2F8SA 4CGIA 4FYDA 2VG6A 3AVIA 5D3GA 1IO2A 4O0JA 3VQBA 1T8EA 4CHZA 1O1WA 2D0CA 2HMIA 4TSXA 1TGOA 3HT3A 1BISA 4N47A 4CIFA 4FJ8A 4EZ9A 1Z25A 3NH2A 4CGGA 3G10A 5CYQA 3O4NA 4B08A 4G1QA 3QINA 1SUQA 2IDOA 1BIZA 4OJRA 4PA1A 4CF8A 1RNHA 4FJMA 1LAVA 1NJWA 5DMRA 3K58A 3I0RA 2P5GA 4C8OA 3T19A 4FJLA 1JLAA 1XWLA 4CJ3A 2HNDA 3PX6A 1QSYA 1A5XA 4LD0A 2HHTA 3MECA 2YKMA 3DI6A 3KLIA 3WNGA 4CIGA 3P5JA 1T03A 4W5TA 4B9UA 4NCBA 2HHVA 1L5UA 3V9ZA 3RR7A 1VSIA 5DK5A 4CF1A 3KLEA 3LWLA 4ZTJA 1FXXA 3ALYA 5HRRA 1KCFA 3HXMA 4CGDA 5KTQA 2E4LA 1RT2A 4Z4HA 4M3XA 4FCYA 3MEDA 4NCAA 4B9TA 4DU3A 3RTVA 3DRRA 1ZYQA 1RTIA 4I9LA 4M3ZA 2AJQA 2F96A 3AVNA 5C25A 3CQ8A 4LSNA 4CK2A 4HHTA 2B5JA 5I3UA 3PUFA 3VQQA 3AVKA 3BGRA 4LSLA 3TAGA 3L2VA 4M3TA 2IS3A 3M8PA 3NF7A 1HMVA 4DMNA 4FM1A 1G15A 4RW8A 1FK9A 3CFPA 4ELUA 3SUQA 4KPYA 3AVJA 5KI6A 4DSKA 2PYJA 5SWMA 1QSLA 4FJ7A 3TI0A 3LP3A 4I7FA 4JLHA 1S6QA 3VQ5A 3NF9A 4FLWA 1LV5A 4Z4IA 3IAYA 4CF9A 4KI6A 4CEAA 1MU2A 5J2QA 4O5BA 4DS4A 4DTXA 3C94A 4BE1A 1HRHA 3KK3A 1JL2A 4CHNA 1NK8A 3K5NA 3WNFA 3LP2A 2IOCA 1ASUA 1IKVA 4O55A 4JRPA 4FVMA 1RILA 4DQIA 4AILC 3QIOA 4EZ6A 4CJ4A 4DTRA 4KRFA 4Y1DA 3OYLA 3SCXA 3SZ2A 4CJFA 1U49A 2HNYA 1ZBLA 3HJFA 1C1CA 3V81A 2Y1IA 1XHZA 1NK5A 3VQEA 4EP4A 2G8VA 4CFBA 4B9MA 3LZIA 3OYFA 3OJSA 3MXIA 4DTPA 1UAXA 1C1BA 1RTHA 3AO1A 2HNZA 4PY5A 4Z4FA 3LDSA 3IG1A 4DU4A 1W0HA 1BCMA 2D5RA 4FJ9A 1S5JA 1C6VA 3RWUA 3SJJA 4QCLA 1R0AA 4O4GA 1FKOA 4M41A 3JSMA 3QNNA 3SQ1A 2I5JA 3LZJA 3ULDA 3M8QA 4FJNA 1BQMA 1SV5A 3O3FA 3LP0A 3RRGA 4KV8A 4E1MA 2IAJA 3HVRA 4AHCA 3OYCA 2LSNA 4OKKA 4BDZA 2BDPA 2PYLA 5KGWA 3KK1A 4DTMA 1VSJA 3NF6A 4FXDA 3LP1A 1S1WA 4FLXA 3QEVA 2YHAA 3CFRA 1NK0A 4KHYA 4F2SA 2DTUA 4M3UA 3UIQA 3AVFA 3JYTA 4MFBA 3U3GA 4Z0UA 1BQNA 4DFMA 1C1AA 3AO5A 1UOCA 3OYAA 4B9VA 3G0ZA 3ZSQA 4FJIA 4E7JA 2QK9A 4CEOA 1NK7A 5CZ1A 4CJEA 4CK3A 2QKBA 4CJQA 1NK6A 4EP5A 3DRSA 3ISNC 3V9XA 4WE1A 2O4IA 3VQ6A 1F21A 4DWIA 1C0TA 5HP1A 3VQ9A 3ZT3A 4I2QA 3TAFA 3TAEA 4DFKA 1VRUA 2G8HA 3C6UA 1KTQA 1X1PA 4CHYA 1SL1A 4Z4CA 4I2PA 3MAQA 3DLHA 3NDKA 1TL1A 2X6NA 2GUIA 4CERA 2VWJA 4DSEA 4HCCA 2HVIA 3MXJA 3OYIA 4CJPA 4F8RA 4E7IA 4CK1A 3DLBA 1VSEA 3F9KA 4IG3A 1T05A 3C6TA 3CFOA 4CESA 2DY4A 1SKSA 4AHUA 3S3OA 3VQ4A 3TAPA 1RDBA 1VSMA 4LY7A 5HRPA 3L2RA 2BANA 3CM6A 4B3OA 2GBZA 3H08A 4DTUA 1TKDA 5FRMA 3OS0A 1L3VA 3DRPA 4B8CA 4BE2A 4H8KA 2HHWA 2DFFA 1HYVA 3LAMA 4ICLA 3K5LA 4E7HA 2Z1JA 3OYBA 4K8ZA 4CIEA 4ZHRA 4IG0A 3ZSYA 3PX4A 4Q5VA 2NUBA 3KKRA 1CXUA 1TV6A 1YT3A 2WOMA 1EX4A 2FBVA 2VWKA 5HRSA 4DFJA 3HYFA 4ELVA 3KKSA 4Z4EA 3ZT0A 3ZCMA 5SZTA 4HTUA 1KFSA 3SQ2A 3PV8A 3SNNA 3NE6A 3DLRA 4DTOA 4HCBA 3OYNA 1S9GA 4ELTA 3L8BA 3K5OA 3P83D 4KHQA 2G8IA 4O0IA 2XY8A 3M8RA 4KFBA 1XI1A 1NOZA 4AHRA 5KRTA 2QKKA 3E01A 1X9SA 3RMCA 4W5OA 4CF2A 4BACA 1QTMA 5J2PA 4UQGA 4M3YA 3NHGA 1SL0A 4LH5A 1JXBA 3OVNA 3L3UA 5C24A 2Q3SA 3NFAA 5JS2A 3OYKA 1D8YA 3AVCA 4DLGA 1TK8A 2G8KA 3NAEA 4JRQA 4BDPA 2X78A 1RTDA 3AA4A 5HBMA 3SQ4A 3DLGA 1NOYA 4L8RB 3HSTB 4R5PA 2OZMA 1BHLA 1WSGA 4FLTA 4KHWA 2KZZA 4KTWA 4DS5A 1U48A 3SUPA 3A2FA 2YNHA 3LPUA 5J2NA 3S9HA 1BI4A 5HLFA 1N6QA 1TAUA 3VN5A 1IKXA 1JXEA 3QO9A 5J1EA 3ZT1A 1DTQA 3OYJA 3RR8A 3DOLA 3KJVA 1YVUA 3OYDA 4IBNA 4JS5A 3HPHA 4N5SA 3QLHA 5CYMA 3HK2A 4H4OA 5E41A 4FK4A 4DSFA 2PZSA 1LWCA 1QSSA 3DLEA 4B9SA 1RT6A 1WSFA 4FLUA 4FK0A 4O44A 3LWMA 1NKCA 2HHXA 2P5OA 2FC0A 2FBYA 2P1JA 3O3GA 1U04A 4RW6A 4FK2A 1T7PA 4FZZA 2F8TA 3AVGA 4KB0A 3KIOA 1BCOA
chains in the Genus database with same CATH superfamily
4JKCA 2VWBA 1Y97A 4BRGA 1KVBA 1RDWX 4PKIA 4IO8A 1U47A 1J54A 4IOXA 1FKPA 5GAEP 3RMAA 3CJ7A 1NJIO 3O3HA 2P51A 4A5BA 5ADXA 1KLMA 4FM0A 4K25A 3AVHA 4Y0WA 1YXQA 5JLHA 1NGBA 4IKFA 1WSJA 3WEEB 1RBVA 2OZSA 1ZBUA 1NJZA 1QHTA 3HVTA 1OH8A 1WAJA 1VHXA 3FZKA 1Q9XA 3KD1E 3SV3A 1N5YA 5AZJA 3VMFB 3Q7CA 4CE9A 1ASWA 3AAPA 1KFDA 5M1KA 4DV5K 3P39A 1YF5L 1C0FA 1CXQA 3VA3A 1ASVA 4E3SA 4MO5A 1QZ5A 3OBWA 4CJ5A 5KRSA 3E66A 4BRCA 4RWTA 3THYB 3E9OA 3N4QA 1DLOA 4IDKA 3WEEA 5F0XA 3NF8A 3PIOL 3CPEA 3H3NO 5K14A 1BL3A 1CZ9A 4FJKA 4E7KA 4KHSA 1YI2N 4FPBA 3VTIA 3SPZA 4JS4A 2O8BB 3HPOA 4AM7A 1LAWA 4YOXA 4C8MA 4DR1K 3TARA 2HSTA 3TAQA 5FROA 2X6SA 4JKGB 1OH6A 2E2OA 4OO1J 3QEXA 4BG9A 2NRWA 3NGYA 2HVHA 3BP8A 1KVCA 5DM6L 4O5FA 4FWOA 4BE0A 2HHSA 1YTUA 4HVJA 5CY4A 3GE1A 3MK6A 2O8BA 2GV9A 2OPSA 1J6ZA 3OYGA 1HQEA 2VG7A 3ZSZA 4CEDA 4HUEA 2EWSA 1VQMN 4JKGA 2W41A 3W3DA 3KK2A 1SL2A 4B1XB 2DFHA 3PSIA 2XY7A 4U7BA 3P1GA 3K9KA 3L2QA 5LJWA 1IKWA 5M1PA 3AVMA 1KAXA 5KQDA 1VK0A 2YNIA 1JLEA 1NKEA 3ZLJA 4KHNA 3O9SA 3K57A 2KZMA 1NGJA 3ATUA 4DF8A 4CF0A 1EKEA 4A61A 2XO7A 2A1RA 1EP4A 3BZCA 4FLYA 3QEIA 1VQ5N 3LAKA 3I0SA 4JI4K 3J7ZO 4ZTFA 4DHYA 4GVEA 2Q31A 3CMAN 2BE2A 4CHOA 2YHWA 1RBRA 1ZBFA 1HPZA 2FF6A 5H1SQ 3QEPA 1CLQA 2UUCK 3QIPA 1WUAA 4LF4K 4KB1A 4DSLA 1BA1A 4CHQA 1NK4A 5BREA 4JI8K 2VGNA 3PY8A 3CCVN 3D7EO 3ZSVA 4BRHA 4OPHA 1TYQA 4B9LA 2JGUA 4DV3K 4KKOA 3OYMA 1X9JA 4CFCA 1NGEA 4M3RA 5EU7A 3ZYYX 3VQAA 4B3MK 3TANA 3PO5A 4B3SK 2QWNA 2HHHK 2YNFA 1W2BM 3SAFA 4PUOA 4DG1A 3SYZA 2CH6A 4JHDB 4GMJB 4E19A 3F9MA 4NYNA 3V9UA 2YJFA 1KVAA 5LMNK 3Q7BA 4W5QA 5JMVA 3CJ1A 3VEZA 3TABA 1JLGA 2V7ZA 3LDLA 4BRPA 2VCPA 3V9WA 2QWOA 3BDPA 4HUGA 1E4FT 4KREA 1HNIA 4GVMA 3DJCA 3KWGA 5BPMA 4QOZB 5T7BA 5EOYA 2P9UA 3IS9A 2ATQA 3DLKA 2E6LA 3VPZA 4CGIA 1Q81O 5D3GA 1T8EA 5TKYA 4CHZA 4N47A 4EZ9A 5FPDA 4CGGA 3O4NA 4G1QA 3QINA 4IJAA 4OJRA 2P9IB 5DMRA 5EY4A 3I0RA 1Q86O 4IOCL 3CCMN 2KLAA 4CJ3A 3PX6A 3AARA 5DM7L 2YKMA 3DI6A 3WNGA 1VSIA 5LMUK 2FLOA 3VEYA 2QEXN 3CD6N 2CH5A 4CGDA 2E4LA 1IBKK 3HOTA 4FCYA 4B9TA 4DU3A 2NRZA 3VEOA 3G4SN 2AJQA 2F96A 3CXCM 3GL1A 4BY9C 2P9IA 3AVKA 4LSLA 1HMVA 1G15A 2KKZA 2RHKA 4FWQA 4H5WA 5C2FA 3LM9A 2PYJA 5SWMA 2JWLA 4JLHA 1LV5A 4Z4IA 4BC4A 5AQIA 4Z94A 1HRHA 2QWRA 3WNFA 4GY2B 4JRPA 1V4SA 1S3XA 4BC3A 4Y1DA 3OYLA 5C12A 3SZ2A 5CR4A 3CJ9A 3HJFA 1C1CA 2Y1IA 3ENBA 4JKEA 2G8VA 4B9MA 3OJSA 2FXUA 4DTPA 1UAXA 2P9NA 1C1BA 2V7YA 4PY5A 3RWUA 4DV2K 3SJJA 4DV4K 1NGFA 3ULDA 3M8QA 4KH4A 4H0PA 1QQMA 2F9WA 3O3FA 3LP0A 3RRGA 1NGAA 2W6LA 1K73O 4AHCA 1HX1A 1JCEA 4BDZA 2PYLA 2HBKA 2OTLN 3NF6A 4FXDA 4KHYA 4FLXA 3HZ6A 4CZKA 3CCRN 4MFBA 2D0OA 1BQNA 3N4PA 3AO5A 1UOCA 3OYAA 4QS7A 5GADP 2HOEA 2QKBA 4EAHD 4CJQA 3A5LC 4EP5A 4BRIA 2O4IA 3WT0A 3VQ6A 2E1YA 5KPRA 5HP1A 3ZT3A 5C15A 4DFKA 3C6UA 1SL1A 4I2PA 2X6NA 2GUIA 3OBYA 2VWJA 4HCCA 3MN7A 3THWB 1XC3A 1VSEA 1T05A 3C6TA 4AHUA 3K0SA 1RDBA 3DWLA 3L2RA 2P9LB 4EIAA 2W6KA 1TKDA 3R1XA 1L3VA 1WB9A 3LAMA 4ICLA 4E7HA 2KHOA 2Z1JA 3OYBA 1VQNN 1BUPA 2UXBK 3A5OC 1CXUA 2FBVA 4DFJA 2WOMA 1N34K 5HRSA 4I6MB 3A5NC 4H0OA 1YHQN 3PV8A 3DLRA 5AQLA 3THWA 2NRTA 4DTOA 4HCBA 3OYNA 3K5OA 5M1QA 2GWJA 4FPAA 4O0IA 3M8RA 5KRTA 2QKKA 1IV0A 3E01A 1ZXOA 4M3YA 3CF5L 2ASPA 1JXBA 4LH5A 3OVNA 1NNEA 3HTVA 2HBMA 4WFAL 1TK8A 2X78A 2QM1A 1RTDA 3AA4A 4KHPK 1NOYA 2OZMA 5ELZA 4FLTA 1IG8A 1W7AA 4I6MA 4KHWA 4KTWA 2KZZA 3SUPA 5HLFA 4BGAA 1TAUA 3VN5A 1IKXA 1O13A 3OYJA 2QW9A 4ILJA 3G6EN 5CYMA 5E41A 4FK4A 4DSFA 4WFNL 1QSSA 5BN8A 3GG4A 1WSFA 2BTFA 4XEIA 4FLUA 2HHXA 3SJHA 4A59A 5GAGP 1T7PA 3VETA 4FZZA 2YHYA 3AVGA 4KB0A 3KIOA 3NHGA 4BE1A 1IG9A 1ZBHA 3CQYA 5KPZA 4KAZA 1NK9A 1JCGA 1RBTA 2ZM6K 3KLGA 1QQCA 1NGGA 5AR0A 4IZ9A 2E5LK 4AHVA 2XHBA 4PWDA 1RT1A 2YHXA 3CC2N 1OH5A 2Z1GA 4IFVA 3QNOA 1XC9A 1SAZA 4C1NK 1YJWN 4OVLA 1JL1A 2XRIA 2O8EA 3CM5A 2W42A 4J2DA 1L3TA 3AO4A 3MWPA 4WFBL 3C95A 3O9TA 3JAMO 4N56A 4DUYK 3NH1A 4ISFA 2EX3A 1WN7A 1NGIA 1RDDA 1M90O 1HKCA 4FJHA 3EE9A 3NH0A 3CYMA 5M1FA 4JI3K 1S1TA 4LF8K 1X3MA 3V4IA 1ZBSA 5HROA 3FFIA 1CZBA 2GTDA 2YV0X 3LL3A 4DTSA 4IWVA 1W9HA 2P9SB 3CJBA 4XH1A 5KGXA 1BGXT 4CJWA 1NLVA 3M1FA 1ZC6A 4K41A 5IWAK 3O4QA 5ADXH 2WFBA 3C7NB 4JK9A 4RCHA 2WTUA 3PX0A 2PFUA 3AA2A 4HUFA 1GOCA 2FSJA 4KO0A 5B8HA 4NB4A 1Z05A 3AV9A 2CGJA 1BI4B 2GEMA 3DXMA 4A2BA 2FBTA 2WONA 1N33K 3D2FB 3VGMA 4CFAA 2R7YA 3MX5A 1EETA 3VQPA 3MXMA 2CGKA 1TK0A 3RRHA 3QBWA 3VQCA 2FSKA 1U4BA 2IVOA 3C7NA 1YIJN 4CJSA 3CERA 3TSUA 2BGGA 3TPQA 2UUAK 4A5AA 3CHWA 3U4LA 3V1OA 3QEWA 4BWJA 1A5WA 4FLVA 4CZGA 1T6CA 5HOOA 5KPTA 1LW2A 1KD1O 4M3WA 4OKJA 5BRDA 2G8WA 1KSPA 4PKGA 1EXQA 2VYPA 3IRXA 1S1XA 4Q0BA 4NYFA 4F3TA 4CGJA 1WNSA 1S1VA 1RFQA 1WSEA 4JD2A 4XH5A 4QAGA 3SAHA 2FF3B 4DU1A 4BRFA 1HQUA 4CJRA 3AVBA 2OPRA 4OPKA 2ZJQL 5F1XA 2O8CA 3FLCO 1EQYA 4B3TK 3QETA 1HYZA 3WXMB 3HL8A 4B1VA 4R79A 1VQ4N 2ZF5O 3QERA 4DQSA 2G8UA 4C8NA 5FDLA 3NBPA 5AZJB 1QVGM 1VSDA 2V52B 3L3VA 3ZEUA 3EY1A 3UE5A 1GLBG 5AQTA 5CZ2A 3B6OA 2B4JA 3U6FA 3VF2A 1RTJA 2QI2A 1NBWA 1EWRA 3THXA 4I9QA 4DSJA 4F4KA 4E1NA 2KW4A 1EO1A 4B1YB 3HO1A 3SUOA 1IKYA 3CCUN 3RMDA 4DV0K 4DQPA 4Z4GA 3NGZA 1P8ZA 3L4QA 5LJVA 1KRPA 4C1NI 2ZWHA 1ITGA 4BRDA 2YI1A 5AFUA 3TWHA 4PL7A 4FJGA 4DR6K 4RW4A 2X74A 3AA5X 3HP9A 1J5EK 1JLCA 2F4VK 5J2MA 1SKRA 3QFUA 5I9EB 1NJXA 4C8LA 3MEGA 3FZMA 4H5NA 4LF7K 4GV3A 4RW7A 4DQRA 2OA8A 4JV5K 3J80O 2HHQA 3ZX3A 1YJ9N 1M1KO 1HJRA 4RW9A 4E0DA 4CZEA 4DQQA 1XQSC 3O9QA 1NKBA 4PQUA 1LWEA 2B6AA 4DQ8A 4H5RA 4B3RK 3KVGA 4C23A 4XIUA 2KTQA 1YUWA 3CQXA 3T3FA 2VG6A 2HMIA 3HT3A 4CZMA 4CIFA 1XUPO 3G10A 2Q1NA 4FJMA 2JWKA 3K58A 2P5GA 3T19A 1XWLA 4BRNA 2HNDA 1QSYA 3CJAA 3MECA 4B9UA 3P5JA 4W5TA 1KAZA 3L6QA 3RR7A 3LWLA 4CF1A 1NGDA 3ALYA 5HRRA 3ZX2A 4Z4HA 1Z6RA 3MEDA 3OTOK 4NCAA 4IOAL 1RTIA 4M3ZA 1IJJA 4HHTA 3VERA 3VQQA 3L2VA 3M8PA 3NF7A 5GIOA 4FM1A 1ATRA 4RW8A 1XNRK 3SUQA 1YVNA 5KI6A 2YX6A 4I7FA 3VQ5A 1GLJO 3VTHA 3IAYA 4CEAA 1MU2A 5J2QA 1TYQB 3F5TA 4O5BA 4DS4A 5AQRA 2E1ZA 1NK8A 3LP2A 3J81O 2Q0RA 4O55A 1RILA 4EZ6A 4AILC 4DTRA 4KRFA 3TTCA 4CJFA 5JVGL 1ZBLA 3SMSA 3V81A 3VQEA 3LZIA 1RTHA 3AO1A 4Z4FA 4PL8A 1BCMA 1S5JA 1C6VA 4O4GA 3JSMA 4WQ5A 5AQYA 1WBBA 4BC5A 3RVCA 1BQMA 4B1WB 1NM1A 4KV8A 2IAJA 1U2VA 3OYCA 2BDPA 4ILGB 3OA9A 3CETA 4BC2A 4WQ5C 2P9UB 3K9JA 3LP1A 3QEVA 4GKKK 1XNQK 4F2SA 2DTUA 3UIQA 3AVFA 2AA4A 4ISEA 5AQOA 3M3ZA 3M5RA 2D1KA 1QZ6A 3ZSQA 4FJIA 2QK9A 4CEOA 5CZ1A 4CK3A 3RSEA 5BN9A 3DRSA 1HJOA 3V9XA 1BU6O 1ILYA 4DWIA 1F21A 4BR9A 3VQ9A 3TSQA 2ZJPL 3TAFA 3MAQA 3DLHA 4BR7A 1HUXA 2HVIA 3MXJA 3CCLN 1ESVA 3CFOA 5BPNA 4LY7A 4IEIA 4BGBA 4IXCA 4ISGA 5A2QO 3SLCA 3CIPA 3R8EA 3EL2A 4H8KA 4AF1A 4JN4A 3QBXA 4FJNA 3R3LA 4Q5VA 1QQOA 1YT3A 4JKAA 1EX4A 2VWKA 2W40A 1DKGD 1MDUB 3ZT0A 3ZCMA 4HTUA 1KFSA 4LF6K 4BVOA 4KHQA 1XI1A 3W0LA 1NOZA 1XMQK 4HWIA 1X9SA 4W5OA 2QXLA 4BACA 1QTMA 2IIRA 1SL0A 2I7PA 3NAEA 4JRQA 4BDPA 1NGCA 2P9PA 3IUCA 1QHAA 1BHLA 1WSGA 2UXDK 2ITMA 4DS5A 1P90A 3O08A 3DAWA 1G99A 4YORA 2P9NB 4E1JA 3ZT1A 1DTQA 1YVUA 3OYDA 4IBNA 4JS5A 3VOVA 3HPHA 3QLHA 4H4OA 1K8AO 2PZSA 1LWCA 3IFRA 3DLEA 4B9SA 4LF9K 1RT6A 4FK0A 3LWMA 2ZJRL 4DV1K 5GIPA 2HF3A 4RW6A 5GINA 2F8TA 3CJCA 2HBLA 4CBUA 3SCXA 2ZGYA 4DKWA 2ITGA 1TK5A 2Q0UA 4M45A 3K59A 3OYHA 1HNZK 4OLAA 4K43A 3CG7A 2O4GA 4B8AB 4H5VA 2H3GX 2WUSA 2QA4N 1ZBIA 4OPJA 1BG3A 3OS1A 3BF3A 4H03B 3OJUA 2HHUA 4AHTA 3S3NA 2QXFA 2Z1IA 3MN9A 4DR5K 4X66K 2KFZA 3D45A 4OPAA 3V1RA 3HPGA 1S22A 1KAYA 5FRMA 3MCPA 1X3NA 3AO2A 2OPQA 4BDYA 1SZ2A 3O9RA 1VSHA 3DMJA 4CJUA 5I42A 4DFPA 3OY9A 1NGHA 1WAFA 3ASMA 5E26A 1J9AA 4N76A 3CC7N 4CEBA 1KLNA 2ETJA 1RBSA 1Q8IA 4GV9A 1BA0A 4JKHA 4JAXA 4FLZA 4DSIA 3CCJN 3SUNA 5AQXA 3ENOA 3KK7A 1REVA 1VQON 4EHUA 1HYSA 1BO5O 3MMVA 4J2BA 1D9FA 3UKRA 1RT5A 4MDAA 1S1UA 2YCHA 4E89A 1JCFA 4PHTX 3P4IA 4MQ3A 1KXPA 1A5VA 2IGIA 2QTDA 1YTAA 3QESA 1QE1A 4BROA 2F9TA 4DB3A 4F3OA 1NJYA 4CJKA 4JI7K 4J2EA 3DXKA 3O6WA 4YOUA 4K42A 4CFDA 1B9DA 2Z1HA 3L2UA 3EYZA 3NVMA 4ID5A 4RG8A 3TR8A 1TKTA 3VQDA 3OS2A 1Q9YA 1ATSA 1GLFO 4YHHK 3O9UA 2YJEA 4H0TB 4EHTA 2QWPA 2WBNA 2O8FA 2IC3A 1C0UA 1BOTO 4DTJA 3VGKA 3AA3A 2RF2A 3E1YA 2ZE2A 1RBUA 1OKJA 2DPNA 3WQTA 1J5OA 3HM8A 1QS4A 1X9MA 2YKNA 3WUHA 1SKWA 3LDNA 4CZIA 4W5NA 2JLEA 3KTQA 4KH5A 3UKUB 2QWQA 3DOKA 4IDHA 4HTLA 5AQMA 3WNHA 4FJJA 4H0YB 4B1UB 2G8FA 2O8EB 5JS1A 3EO3A 3ZSRA 3JS6A 4BWMA 3NGIA 1VAZA 2PBDA 5C0YA 4FVUA 2RKIA 4H4MA 1WLJA 3V9SA 4FW2A 3TAMA 4CBXA 1GOAA 2WC9A 3ZSOA 3U3YA 4BG8A 4DTNA 3ID6A 3B6PA 2E6MA 3DM2A 1V4TA 4NLCA 1TVRA 3UKUA 2OPPA 1HNVA 2HB5A 3QDKA 4FSVA 1RT7A 1T6DA 1GLLO 3SV4A 1T3VA 1H1VA 4FJXA 4ILHA 1RCHA 1HNWK 3V1QA 4CHPA 3KLHA 3DLLL 2A41A 1S9EA 1D5AA 4CJ7A 3V6DA 3S3MA 3LDQA 3D6RA 3H3OB 2RPIA 1C0MA 4GW6A 3ZT4A 4FW1A 5EX5A 3C0BA 1I3AA 5KQ8A 2FBXA 1K9MO 2D0AA 4OGEA 2E20A 3OHRA 4CEFA 3AVAA 1D4XA 1UA1A 5AQWA 3DXMB 1VSKA 1K6YA 1TKXA 1TL3A 2OANA 5AQNA 1N36K 4K8XA 4FZYA 4CZHA 4C8KA 4YOVA 3ZETA 1I39A 4X65K 5EVZA 4J8FA 2A40A 3T69A 1RDUA 1NMNA 3VEXA 3U9ZA 2UUBK 5AJ3K 4YFUA 2O8DA 1TKZA 1Z26A 2HBJA 1IH7A 4H5TA 4CD1A 2D0BA 3ITHA 4OGCA 1VSFA 2OYQA 3EE8A 3ULEB 3J7YP 2NRHA 1DT9A 3ZT2A 3I8DA 4E7LA 4YOWA 4KH6A 4FYDA 3AVIA 4B9QA 1NMDA 3VQBA 1O1WA 2D0CA 4TSXA 1TGOA 2ASOA 1Z25A 5AFUH 5CYQA 2IDOA 4CF8A 3KHYA 1RNHA 4JD2B 3BEXA 3I56N 4FJLA 3EKSA 3EKUA 2A3ZA 2HHTA 2NLXA 1VQLN 4NCBA 3AGKA 3V9ZA 1E4GT 5DK5A 3ULEA 2O8CB 4ZTJA 1HLUA 3MN6A 1KCFA 3HXMA 1RT2A 4FL9A 1SQKA 1E3MA 1CZAN 1MWMA 4CW7B 4MDBA 1MWKA 1GLDG 1QVFM 3AVNA 5C25A 4DCHA 4LSNA 4CK2A 3EN9A 5FPMA 3PLAA 5I3UA 3PUFA 3ZEUB 3TAGA 2IS3A 3U9DA 4DMNA 3CC4N 1FK9A 4ELUA 3AVJA 4LFCK 4X62K 2OCEA 4BRAA 5BRFA 1QSLA 3THXB 1C0GA 4JKDA 4FLWA 3MWTA 3U8XA 4CF9A 4DTXA 3C94A 3B8AX 2UYTA 2IOCA 1R59O 3IKMA 4FVMA 4DQIA 3QIOA 3GBTA 1VQPN 1NK5A 4EP4A 3CCQN 4CFBA 5AQVA 1T44A 3I8BA 5CHIA 3IG1A 4FJ9A 1W0HA 2D5RA 4QCLA 3LM2A 1R0AA 1FKOA 1Y64A 3QNNA 3SQ1A 2I5JA 1U6ZA 5AQHA 3IMXA 4E1MA 4BREA 3HVRA 2LSNA 5KGWA 3KK1A 4DTMA 4BR0A 4A57A 1VSJA 4JI6K 3D2EA 1S1WA 4NO7A 3PIPL 2YHAA 2Q36A 1NK0A 4WF9L 3U3GA 1OVYA 4Z0UA 4DFMA 4B9VA 3G0ZA 5F2RA 2IVNA 3FGUA 5JVHL 1NK7A 4CJEA 1NK6A 3ISNC 4WE1A 4X64K 4I2QA 2E2NA 3TAEA 2OTJN 1VRUA 4QS9A 1X1PA 4Z4CA 1TL1A 4DSEA 4CERA 4M7XA 4CJPA 4E7IA 4CK1A 3DLBA 2J4RA 2NRRA 3F9KA 4IG3A 4CESA 1SKSA 3S3OA 1OH7A 3VQ4A 1VSMA 5HRPA 3CPWM 5EXWA 1Q82O 2BANA 3CM6A 4B3OA 1LCUA 3H08A 4DTUA 5AQJA 3J8AA 1TUYA 5AQKA 3DRPA 4B8CA 4BE2A 2HHWA 2DFFA 3LDPA 1HYVA 3FZHA 4CIEA 4FOIA 2E88A 4ELVA 3KKSA 4Z4EA 3QFPA 1GLAG 1DEJA 2E2QA 4B1ZA 4FOEA 4BR5A 3QB0A 2GELA 3L8BA 3O1WA 2XY8A 3THYA 3F2KA 3FZFA 3RMCA 4CF2A 3A5MC 5J2PA 3AAQA 2IVPA 4UQGA 2P9KB 3SBGA 3CI5A 3L3UA 5C24A 2Q3SA 3NFAA 1D8YA 3AVCA 4DLGA 3VEVA 2G8KA 4FWSA 4CD3A 5HBMA 3SQ4A 3DLGA 3HSTB 3J7AP 4WYBA 3FE1A 1MA9B 2E8AA 3T7ZA 1U48A 3LPUA 3S9HA 1N8RO 5AQFA 3SMPA 3QO9A 5J1EA 3NMUA 3RR8A 3KJVA 3I33A 1WBDA 4N5SA 1KC8O 5JLFA 2P9KA 5M1OA 1BDGA 2A5XA 2P5OA 2FC0A 1U2VB 4NLBA 3ZX0A 3O3GA 2VGMA 2BUPA 2VQEK 3CMEN 2AP1A 1BCOA 1GLEG 3PO4A 5BPLA 3EEQA 4FWNA 3VQ8A 3G71N 3AY9A 4JEPA 3RSEB 5JICA 1HPMA 5M1NA 1HNXK 5C42A 4N41A 4MO4A 2YHBA 3VA0A 2XY5A 1GLCG 4CJTA 4CVNE 4PKHA 2D4WA 4M7YA 3M8SA 2HMPA 1WSHA 4FWLA 5HRNA 3GOIA 2UXCK 2GUPA 1LWFA 2DFEA 3AO3A 4LH4A 3L0QA 3O4WA 4FWKA 4M42A 1DTTA 3EZWA 2ZQBA 4OX9K 2QWLA 3QMLA 4CGFA 5AQQA 4LF5K 3SAGA 4BRQA 4JNEA 4WCEL 4YNQA 4CEEA 3MCAB 1VSLA 3H1VX 3C65A 4YOYA 4YDUA 3CCEN 2EHGA 1WOQA 3LPTA 4OLBA 3T1HK 1L3UA 4JI5K 3VGLA 4NXMK 3H45C 3T1YK 5LL6Z 5E84A 1RDCA 4DV6K 4YDUC 3LALA 4KTQA 4W5RA 2YNGA 1X9WA 1B92A 4NCGA 3L4IA 3K2PA 3O5BA 4CCHA 3MEEA 1UA0A 2A42A 2P9PB 2Q2RA 1VRTA 3SI6A 1EWQA 3L2WA 1TAQA 4AQYK 2RN2A 4DR3K 1FW6A 1I94K 2VQFK 4Y1CA 1JKHA 4FO0A 4JHDA 3ZSXA 4ID1A 3P31A 4CEZA 1IBMK 4B9NA 2VG5A 3MN5A 4KBOA 2HW3A 2FSNA 3T1AA 1ATNA 1UWBA 4DV7K 1S6PA 3SBTA 4FJ5A 2PY5A 1JLQA 3BZKA 1LW0A 3THVA 3O1BA 1HKBA 3OYEA 4EFHA 3HOSA 1VQ6N 4UY8O 1RDAA 4JKBA 3LANA 4CZJA 1SS6A 1XHXA 4A2AA 5BR9A 3F73A 3AVLA 4BR2A 4BRLA 4H0XB 1U45A 4KI4A 3OW2M 1JJ2M 4QS8A 4GNIA 4CGHA 4CEQA 2Q97A 1B9FA 4JK7A 3CCSN 4KHUA 4U67L 3FR0A 4OKEA 1W97L 3O80A 1BIUA 1JLBA 3TSPA 3VENA 4CECA 1XMOK 3VEWA 1JLFA 3WNEA 4JI0K 5GAHP 4CBWA 3HP6A 1LOTB 4RTFD 3JXUA 4J2AA 3G25A 4IFYA 3BY5A 2XY6A 5AQUA 2KQ2A 4L3QA 2KFNA 2ZD1A 2E2PA 4LFAK 3ZSWA 3WXJA 4DLEA 2A1SA 3NCIA 3M6GA 3C6HA 3UB5A 3SQ0A 1L3SA 1WSIA 1D9DA 2Y1JA 2GX9A 1VQKN 3TTFA 4DR4K 3BUZB 1RT4A 3WXLA 1RT3A 3UKRB 4CJLA 3DYAA 4FWRA 3HM9A 4XH4A 4WQ4A 2D0PA 2NRXA 5TKWA 3KLFA 4F2RA 3EZ5A 4AH9A 1GOBA 1N32K 3FZLA 4FZXC 1NU0A 1J53A 5FLXO 3E9PA 4O8KA 3ATVA 4WQ4C 4DF4A 3KWIA 3HI0A 5MLCQ 3DXKB 3SPYA 3RMBA 3VQ7A 4AHSA 4O8UA 5BRHA 1KQSM 4AM6A 1DGKN 3R6MA 2HF4A 3K5MA 1TUUA 1OVQA 5FRNA 3D0PA 1K8KB 1FJGK 4CJVA 4DUZK 4CZLA 4FWMA 4JI1K 2QWMA 3KD5E 2NZTA 4FM2A 2O8FB 1BWFO 4KTZA 2F8SA 4JKFA 4H0VB 1IO2A 4O0JA 4NXNK 1BISA 4FJ8A 3NH2A 4BR4A 4LFBK 4B08A 1YAGA 1SUQA 1BIZA 4PA1A 4BQLA 3TTDA 2UU9K 1LAVA 1K8KA 4C8OA 3VF4A 1JLAA 5AQGA 4F9OA 3H6EA 3I55N 1A5XA 4LD0A 4CIGA 1QQNA 3KLIA 2HHVA 1T03A 1L5UA 1VQ7N 5AQSA 3KLEA 1FXXA 2P9LA 3A0IX 5FPEA 4FWPA 5KTQA 4M3XA 3RTVA 3DRRA 1ZYQA 4I9LA 3CQ8A 2B5JA 4BQZA 4MLEA 1HR0K 3BGRA 4M3TA 1NG9A 3CFPA 4KPYA 5BR8K 4DSKA 4K0KK 4FJ7A 3TI0A 3LP3A 1S6QA 3NF9A 5FPNA 1NWKA 5AQZA 4KI6A 4DR7K 4IEEA 3VF6A 3KK3A 1JL2A 4CHNA 3K5NA 2NRVA 1ASUA 1IKVA 4CJ4A 1Q7YO 1U49A 2HNYA 1XHZA 3HBTA 2GWKA 3BF1A 4DR2K 3OYFA 3H46O 3MXIA 3KZBA 2HNZA 3HSCA 3LDSA 4DU4A 4M41A 3PSFA 3VESA 5HL7L 3LZJA 1IBLK 3ZETB 3MX2A 1SV5A 4LC9B 3MDQA 3ID8A 4BVPA 5AZIB 3O8MA 4OKKA 2O8DB 4JYAK 3E9LA 4IO9L 2CGLA 3CFRA 4M3UA 3JYTA 4CZFA 1C1AA 3SK3A 2ASMA 4GV6A 1Q18A 4E7JA 3GDQA 4JK8A 3C6AA 3H1QA 4A62A 3TU5A 1VQ9N 1C0TA 2G8HA 1KTQA 2I7NA 1RGIA 5AZIA 2F7TA 4CHYA 3R9PA 3NDKA 3OYIA 1S72N 4F8RA 4BRMA 2A6AA 2DY4A 3TAPA 5C2DA 3P38A 3LDOA 3QICA 2GBZA 3OS0A 3NVKA 3K5LA 4K8ZA 2BH1A 4ZHRA 4IG0A 3ZSYA 3PX4A 3KKRA 2NUBA 1NJWA 1TV6A 2ZGZA 3ENHA 4YY3K 3HYFA 5SZTA 3HRGA 3SQ2A 3SNNA 3NE6A 4GKJK 2P9SA 4IFEA 1VQ8N 1S9GA 4ELTA 1HKGA 3P83D 1YITN 2G8IA 4KFBA 4MLHA 4AHRA 1YJNN 4V19S 5JS2A 3OYKA 3IDHA 4M63C 4L8RB 3WXKA 4R5PA 2V51B 3AGRA 3A2FA 4IJNA 2YNHA 5J2NA 1BI4A 1N6QA 3D2FA 4YOTA 3S41A 3A8YA 1JXEA 5IT9O 3WXIA 3DOLA 3FFKB 4JI2K 4CI6A 4G9ZA 3HK2A 5AQPA 3WQUA 5C10A 4O44A 4BRKA 1NKCA 2FBYA 2RE2A 2P1JA 2NNWA 1U04A 4FK2A 2PAVA 5CE3A 3D2EB 5LY3A
chains in the Genus database with same CATH topology
1IG9A 1ZBHA 2ITGA 3PO4A 1TK5A 4KAZA 4M45A 1NK9A 3VQ8A 1Y97A 3K59A 3OYHA 1RBTA 4OLAA 1KVBA 3KLGA 1QQCA 1U47A 3CG7A 1J54A 2O4GA 4B8AB 1FKPA 4AHVA 5C42A 4N41A 2XY5A 2YHBA 2XHBA 3VA0A 3RMAA 4CJTA 4PWDA 1RT1A 1ZBIA 4OPJA 3OS1A 2Z1GA 3O3HA 4IFVA 3QNOA 3M8SA 3OJUA 2P51A 1WSHA 4AHTA 1XC9A 2HHUA 4OVLA 1KLMA 1JL1A 2XRIA 5HRNA 3AVHA 4FM0A 2QXFA 3S3NA 2Z1IA 2KFZA 1LWFA 2DFEA 3CM5A 3D45A 2W42A 3V1RA 3AO3A 4IKFA 4J2DA 1WSJA 3HPGA 4LH4A 4M42A 1L3TA 1RBVA 3AO4A 2OZSA 1ZBUA 1NJZA 1DTTA 1QHTA 3AO2A 3HVTA 1WAJA 3C95A 2ZQBA 4N56A 3NH1A 2OPQA 4CGFA 4BDYA 2EX3A 1Q9XA 1WN7A 3KD1E 1RDDA 3SV3A 1N5YA 1VSHA 4FJHA 3DMJA 3NH0A 3CYMA 4CJUA 5I42A 4YNQA 4DFPA 4CEEA 3OY9A 1S1TA 1VSLA 1WAFA 3ASMA 4CE9A 1ASWA 1J9AA 1KFDA 3V4IA 4N76A 2EHGA 5HROA 3FFIA 1CXQA 3LPTA 3VA3A 4OLBA 1CZBA 4CEBA 2ETJA 2YV0X 4DTSA 1RBSA 1KLNA 1L3UA 1ASVA 4E3SA 1Q8IA 1W9HA 4DSIA 4FLZA 3SUNA 4CJ5A 5KRSA 5KGXA 1REVA 1BGXT 1HYSA 4CJWA 1RDCA 1DLOA 4IDKA 4J2BA 1D9FA 3LALA 4KTQA 4W5RA 1RT5A 2YNGA 3NF8A 3O4QA 1S1UA 4E89A 1X9WA 5K14A 1BL3A 1B92A 1CZ9A 4NCGA 3K2PA 4MQ3A 4E7KA 4CCHA 4FJKA 1A5VA 2IGIA 4KHSA 3MEEA 1UA0A 3PX0A 1YTAA 1VRTA 3SI6A 3AA2A 3L2WA 4HUFA 3QESA 1QE1A 1GOCA 1TAQA 3SPZA 4KO0A 4JS4A 4F3OA 2RN2A 1NJYA 3HPOA 3AV9A 1BI4B 1JKHA 1LAWA 4Y1CA 4CJKA 2FBTA 2WONA 3ZSXA 4ID1A 4C8MA 4CFAA 4CEZA 3TARA 4J2EA 2R7YA 4B9NA 3TAQA 2VG5A 5FROA 2HW3A 4CFDA 3T1AA 1EETA 1UWBA 3VQPA 2X6SA 1S6PA 3MXMA 4FJ5A 2PY5A 1JLQA 1TK0A 1B9DA 3RRHA 1LW0A 3QEXA 2Z1HA 3L2UA 3VQCA 3EYZA 3THVA 3NGYA 4ID5A 1U4BA 2HVHA 4RG8A 3TR8A 1TKTA 3VQDA 3OS2A 1Q9YA 1KVCA 3OYEA 4CJSA 4BE0A 2HHSA 1RDAA 1YTUA 4HVJA 2BGGA 3LANA 5CY4A 3V1OA 1XHXA 2GV9A 4BWJA 3F73A 1A5WA 3QEWA 3AVLA 4FLVA 2IC3A 1U45A 1C0UA 4KI4A 2OPSA 4DTJA 3AA3A 2RF2A 1LW2A 4M3WA 4OKJA 3OYGA 2ZE2A 2G8WA 1HQEA 1RBUA 2VG7A 3ZSZA 4CEDA 4CGHA 1KSPA 4CEQA 4HUEA 1EXQA 1B9FA 4KHUA 3IRXA 1J5OA 1S1XA 4Q0BA 4NYFA 4OKEA 3KK2A 1QS4A 1SL2A 4F3TA 4CGJA 1X9MA 2DFHA 2YKNA 1WNSA 1S1VA 1BIUA 2XY7A 1SKWA 1JLBA 1WSEA 4W5NA 2JLEA 3P1GA 3KTQA 3L2QA 1IKWA 3AVMA 3DOKA 4QAGA 4CECA 1VK0A 2YNIA 1JLEA 3WNHA 1JLFA 1NKEA 3WNEA 4DU1A 4FJJA 4KHNA 1HQUA 4CJRA 3K57A 2G8FA 3HP6A 2KZMA 3AVBA 2OPRA 4OPKA 5JS1A 3ZSRA 4DF8A 4J2AA 3NGIA 4BWMA 4CF0A 3QETA 1EKEA 4IFYA 1HYZA 3HL8A 2RKIA 4H4MA 1EP4A 2XO7A 2A1RA 4FLYA 3QERA 1WLJA 3V9SA 4FW2A 3TAMA 4DQSA 1GOAA 3ZSOA 3QEIA 3U3YA 2KQ2A 2XY6A 3LAKA 4DTNA 2G8UA 5FDLA 3B6PA 3I0SA 2E6MA 3DM2A 2ZD1A 3NBPA 4C8NA 2KFNA 1VSDA 4ZTFA 3ZSWA 3L3VA 4DLEA 2A1SA 3NCIA 3EY1A 1TVRA 2BE2A 4CHOA 2OPPA 1HNVA 1RBRA 1ZBFA 1HPZA 3SQ0A 1CLQA 3QEPA 5CZ2A 1L3SA 2HB5A 1WSIA 3B6OA 2B4JA 3QIPA 1RT7A 4KB1A 3U6FA 3SV4A 1RTJA 1D9DA 4DSLA 4CHQA 2Y1JA 1NK4A 4FJXA 1RCHA 3PY8A 4I9QA 4DSJA 3V1QA 4CHPA 3KLHA 4F4KA 3ZSVA 1RT4A 4E1NA 2KW4A 4B9LA 1RT3A 1S9EA 1D5AA 2JGUA 3V6DA 3SUOA 3S3MA 3HO1A 1IKYA 3RMDA 4DQPA 4Z4GA 4CJLA 3DYAA 4KKOA 3NGZA 2RPIA 3OYMA 3HM9A 1C0MA 4GW6A 4CFCA 4M3RA 5EU7A 3ZT4A 4FW1A 1KRPA 3VQAA 1ITGA 3KLFA 3PO5A 3EZ5A 3TANA 1I3AA 4F2RA 4AH9A 2FBXA 3TWHA 1GOBA 2D0AA 4OGEA 2YNFA 4CEFA 4FJGA 3AVAA 4RW4A 4PUOA 2X74A 4DG1A 4FZXC 3SYZA 1J53A 1UA1A 1VSKA 1K6YA 4GMJB 4E19A 3AA5X 4NYNA 4DF4A 1TKXA 3V9UA 1TL3A 3HP9A 3SPYA 4K8XA 1JLCA 3RMBA 1KVAA 3VQ7A 4AHSA 5J2MA 1SKRA 4W5QA 1NJXA 4FZYA 4C8KA 3K5MA 3TABA 1JLGA 3V9WA 4C8LA 3MEGA 1I39A 3BDPA 5FRNA 3D0PA 4RW7A 4DQRA 4HUGA 4CJVA 2OA8A 4KREA 2HHQA 1HNIA 4GVMA 1HJRA 4RW9A 4E0DA 4DQQA 4YFUA 1TKZA 1Z26A 1NKBA 3KD5E 1IH7A 5T7BA 4QOZB 2D0BA 2B6AA 1LWEA 3ITHA 4PQUA 4FM2A 3IS9A 2ATQA 1VSFA 4OGCA 4XIUA 2OYQA 2KTQA 4E7LA 3DLKA 3ZT2A 2E6LA 3I8DA 4KTZA 3T3FA 2F8SA 4CGIA 4FYDA 2VG6A 3AVIA 5D3GA 1IO2A 4O0JA 3VQBA 1T8EA 4CHZA 1O1WA 2D0CA 2HMIA 4TSXA 1TGOA 3HT3A 1BISA 4N47A 4CIFA 4FJ8A 4EZ9A 1Z25A 3NH2A 4CGGA 3G10A 5CYQA 3O4NA 4B08A 4G1QA 3QINA 1SUQA 2IDOA 1BIZA 4OJRA 4PA1A 4CF8A 1RNHA 4FJMA 1LAVA 1NJWA 5DMRA 3K58A 3I0RA 2P5GA 4C8OA 3T19A 4FJLA 1JLAA 1XWLA 4CJ3A 2HNDA 3PX6A 1QSYA 1A5XA 4LD0A 2HHTA 3MECA 2YKMA 3DI6A 3KLIA 3WNGA 4CIGA 3P5JA 1T03A 4W5TA 4B9UA 4NCBA 2HHVA 1L5UA 3V9ZA 3RR7A 1VSIA 5DK5A 4CF1A 3KLEA 3LWLA 4ZTJA 1FXXA 3ALYA 5HRRA 1KCFA 3HXMA 4CGDA 5KTQA 2E4LA 1RT2A 4Z4HA 4M3XA 4FCYA 3MEDA 4NCAA 4B9TA 4DU3A 3RTVA 3DRRA 1ZYQA 1RTIA 4I9LA 4M3ZA 2AJQA 2F96A 3AVNA 5C25A 3CQ8A 4LSNA 4CK2A 4HHTA 2B5JA 5I3UA 3PUFA 3VQQA 3AVKA 3BGRA 4LSLA 3TAGA 3L2VA 4M3TA 2IS3A 3M8PA 3NF7A 1HMVA 4DMNA 4FM1A 1G15A 4RW8A 1FK9A 3CFPA 4ELUA 3SUQA 4KPYA 3AVJA 5KI6A 4DSKA 2PYJA 5SWMA 1QSLA 4FJ7A 3TI0A 3LP3A 4I7FA 4JLHA 1S6QA 3VQ5A 3NF9A 4FLWA 1LV5A 4Z4IA 3IAYA 4CF9A 4KI6A 4CEAA 1MU2A 5J2QA 4O5BA 4DS4A 4DTXA 3C94A 4BE1A 1HRHA 3KK3A 1JL2A 4CHNA 1NK8A 3K5NA 3WNFA 3LP2A 2IOCA 1ASUA 1IKVA 4O55A 4JRPA 4FVMA 1RILA 4DQIA 4AILC 3QIOA 4EZ6A 4CJ4A 4DTRA 4KRFA 4Y1DA 3OYLA 3SCXA 3SZ2A 4CJFA 1U49A 2HNYA 1ZBLA 3HJFA 1C1CA 3V81A 2Y1IA 1XHZA 1NK5A 3VQEA 4EP4A 2G8VA 4CFBA 4B9MA 3LZIA 3OYFA 3OJSA 3MXIA 4DTPA 1UAXA 1C1BA 1RTHA 3AO1A 2HNZA 4PY5A 4Z4FA 3LDSA 3IG1A 4DU4A 1W0HA 1BCMA 2D5RA 4FJ9A 1S5JA 1C6VA 3RWUA 3SJJA 4QCLA 1R0AA 4O4GA 1FKOA 4M41A 3JSMA 3QNNA 3SQ1A 2I5JA 3LZJA 3ULDA 3M8QA 4FJNA 1BQMA 1SV5A 3O3FA 3LP0A 3RRGA 4KV8A 4E1MA 2IAJA 3HVRA 4AHCA 3OYCA 2LSNA 4OKKA 4BDZA 2BDPA 2PYLA 5KGWA 3KK1A 4DTMA 1VSJA 3NF6A 4FXDA 3LP1A 1S1WA 4FLXA 3QEVA 2YHAA 3CFRA 1NK0A 4KHYA 4F2SA 2DTUA 4M3UA 3UIQA 3AVFA 3JYTA 4MFBA 3U3GA 4Z0UA 1BQNA 4DFMA 1C1AA 3AO5A 1UOCA 3OYAA 4B9VA 3G0ZA 3ZSQA 4FJIA 4E7JA 2QK9A 4CEOA 1NK7A 5CZ1A 4CJEA 4CK3A 2QKBA 4CJQA 1NK6A 4EP5A 3DRSA 3ISNC 3V9XA 4WE1A 2O4IA 3VQ6A 1F21A 4DWIA 1C0TA 5HP1A 3VQ9A 3ZT3A 4I2QA 3TAFA 3TAEA 4DFKA 1VRUA 2G8HA 3C6UA 1KTQA 1X1PA 4CHYA 1SL1A 4Z4CA 4I2PA 3MAQA 3DLHA 3NDKA 1TL1A 2X6NA 2GUIA 4CERA 2VWJA 4DSEA 4HCCA 2HVIA 3MXJA 3OYIA 4CJPA 4F8RA 4E7IA 4CK1A 3DLBA 1VSEA 3F9KA 4IG3A 1T05A 3C6TA 3CFOA 4CESA 2DY4A 1SKSA 4AHUA 3S3OA 3VQ4A 3TAPA 1RDBA 1VSMA 4LY7A 5HRPA 3L2RA 2BANA 3CM6A 4B3OA 2GBZA 3H08A 4DTUA 1TKDA 5FRMA 3OS0A 1L3VA 3DRPA 4B8CA 4BE2A 4H8KA 2HHWA 2DFFA 1HYVA 3LAMA 4ICLA 3K5LA 4E7HA 2Z1JA 3OYBA 4K8ZA 4CIEA 4ZHRA 4IG0A 3ZSYA 3PX4A 4Q5VA 2NUBA 3KKRA 1CXUA 1TV6A 1YT3A 2WOMA 1EX4A 2FBVA 2VWKA 5HRSA 4DFJA 3HYFA 4ELVA 3KKSA 4Z4EA 3ZT0A 3ZCMA 5SZTA 4HTUA 1KFSA 3SQ2A 3PV8A 3SNNA 3NE6A 3DLRA 4DTOA 4HCBA 3OYNA 1S9GA 4ELTA 3L8BA 3K5OA 3P83D 4KHQA 2G8IA 4O0IA 2XY8A 3M8RA 4KFBA 1XI1A 1NOZA 4AHRA 5KRTA 2QKKA 3E01A 1X9SA 3RMCA 4W5OA 4CF2A 4BACA 1QTMA 5J2PA 4UQGA 4M3YA 3NHGA 1SL0A 4LH5A 1JXBA 3OVNA 3L3UA 5C24A 2Q3SA 3NFAA 5JS2A 3OYKA 1D8YA 3AVCA 4DLGA 1TK8A 2G8KA 3NAEA 4JRQA 4BDPA 2X78A 1RTDA 3AA4A 5HBMA 3SQ4A 3DLGA 1NOYA 4L8RB 3HSTB 4R5PA 2OZMA 1BHLA 1WSGA 4FLTA 4KHWA 2KZZA 4KTWA 4DS5A 1U48A 3SUPA 3A2FA 2YNHA 3LPUA 5J2NA 3S9HA 1BI4A 5HLFA 1N6QA 1TAUA 3VN5A 1IKXA 1JXEA 3QO9A 5J1EA 3ZT1A 1DTQA 3OYJA 3RR8A 3DOLA 3KJVA 1YVUA 3OYDA 4IBNA 4JS5A 3HPHA 4N5SA 3QLHA 5CYMA 3HK2A 4H4OA 5E41A 4FK4A 4DSFA 2PZSA 1LWCA 1QSSA 3DLEA 4B9SA 1RT6A 1WSFA 4FLUA 4FK0A 4O44A 3LWMA 1NKCA 2HHXA 2P5OA 2FC0A 2FBYA 2P1JA 3O3GA 1U04A 4RW6A 4FK2A 1T7PA 4FZZA 2F8TA 3AVGA 4KB0A 3KIOA 1BCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IG9 A;  1ZBH A;  2ITG A;  3PO4 A;  1TK5 A;  4KAZ A;  4M45 A;  1NK9 A;  3VQ8 A;  1Y97 A;  3K59 A;  3OYH A;  1RBT A;  4OLA A;  1KVB A;  3KLG A;  1QQC A;  1U47 A;  3CG7 A;  1J54 A;  2O4G A;  4B8A B;  1FKP A;  4AHV A;  5C42 A;  4N41 A;  2XY5 A;  2YHB A;  2XHB A;  3VA0 A;  3RMA A;  4CJT A;  4PWD A;  1RT1 A;  1ZBI A;  4OPJ A;  3OS1 A;  2Z1G A;  3O3H A;  4IFV A;  3QNO A;  3M8S A;  3OJU A;  2P51 A;  1WSH A;  4AHT A;  1XC9 A;  2HHU A;  4OVL A;  1KLM A;  1JL1 A;  2XRI A;  5HRN A;  3AVH A;  4FM0 A;  2QXF A;  3S3N A;  2Z1I A;  2KFZ A;  1LWF A;  2DFE A;  3CM5 A;  3D45 A;  2W42 A;  3V1R A;  3AO3 A;  4IKF A;  4J2D A;  1WSJ A;  3HPG A;  4LH4 A;  4M42 A;  1L3T A;  1RBV A;  3AO4 A;  2OZS A;  1ZBU A;  1NJZ A;  1DTT A;  1QHT A;  3AO2 A;  3HVT A;  1WAJ A;  3C95 A;  2ZQB A;  4N56 A;  3NH1 A;  2OPQ A;  4CGF A;  4BDY A;  2EX3 A;  1Q9X A;  1WN7 A;  3KD1 E;  1RDD A;  3SV3 A;  1N5Y A;  1VSH A;  4FJH A;  3DMJ A;  3NH0 A;  3CYM A;  4CJU A;  5I42 A;  4YNQ A;  4DFP A;  4CEE A;  3OY9 A;  1S1T A;  1VSL A;  1WAF A;  3ASM A;  4CE9 A;  1ASW A;  1J9A A;  1KFD A;  3V4I A;  4N76 A;  2EHG A;  5HRO A;  3FFI A;  1CXQ A;  3LPT A;  3VA3 A;  4OLB A;  1CZB A;  4CEB A;  2ETJ A;  2YV0 X;  4DTS A;  1RBS A;  1KLN A;  1L3U A;  1ASV A;  4E3S A;  1Q8I A;  1W9H A;  4DSI A;  4FLZ A;  3SUN A;  4CJ5 A;  5KRS A;  5KGX A;  1REV A;  1BGX T;  1HYS A;  4CJW A;  1RDC A;  1DLO A;  4IDK A;  4J2B A;  1D9F A;  3LAL A;  4KTQ A;  4W5R A;  1RT5 A;  2YNG A;  3NF8 A;  3O4Q A;  1S1U A;  4E89 A;  1X9W A;  5K14 A;  1BL3 A;  1B92 A;  1CZ9 A;  4NCG A;  3K2P A;  4MQ3 A;  4E7K A;  4CCH A;  4FJK A;  1A5V A;  2IGI A;  4KHS A;  3MEE A;  1UA0 A;  3PX0 A;  1YTA A;  1VRT A;  3SI6 A;  3AA2 A;  3L2W A;  4HUF A;  3QES A;  1QE1 A;  1GOC A;  1TAQ A;  3SPZ A;  4KO0 A;  4JS4 A;  4F3O A;  2RN2 A;  1NJY A;  3HPO A;  3AV9 A;  1BI4 B;  1JKH A;  1LAW A;  4Y1C A;  4CJK A;  2FBT A;  2WON A;  3ZSX A;  4ID1 A;  4C8M A;  4CFA A;  4CEZ A;  3TAR A;  4J2E A;  2R7Y A;  4B9N A;  3TAQ A;  2VG5 A;  5FRO A;  2HW3 A;  4CFD A;  3T1A A;  1EET A;  1UWB A;  3VQP A;  2X6S A;  1S6P A;  3MXM A;  4FJ5 A;  2PY5 A;  1JLQ A;  1TK0 A;  1B9D A;  3RRH A;  1LW0 A;  3QEX A;  2Z1H A;  3L2U A;  3VQC A;  3EYZ A;  3THV A;  3NGY A;  4ID5 A;  1U4B A;  2HVH A;  4RG8 A;  3TR8 A;  1TKT A;  3VQD A;  3OS2 A;  1Q9Y A;  1KVC A;  3OYE A;  4CJS A;  4BE0 A;  2HHS A;  1RDA A;  1YTU A;  4HVJ A;  2BGG A;  3LAN A;  5CY4 A;  3V1O A;  1XHX A;  2GV9 A;  4BWJ A;  3F73 A;  1A5W A;  3QEW A;  3AVL A;  4FLV A;  2IC3 A;  1U45 A;  1C0U A;  4KI4 A;  2OPS A;  4DTJ A;  3AA3 A;  2RF2 A;  1LW2 A;  4M3W A;  4OKJ A;  3OYG A;  2ZE2 A;  2G8W A;  1HQE A;  1RBU A;  2VG7 A;  3ZSZ A;  4CED A;  4CGH A;  1KSP A;  4CEQ A;  4HUE A;  1EXQ A;  1B9F A;  4KHU A;  3IRX A;  1J5O A;  1S1X A;  4Q0B A;  4NYF A;  4OKE A;  3KK2 A;  1QS4 A;  1SL2 A;  4F3T A;  4CGJ A;  1X9M A;  2DFH A;  2YKN A;  1WNS A;  1S1V A;  1BIU A;  2XY7 A;  1SKW A;  1JLB A;  1WSE A;  4W5N A;  2JLE A;  3P1G A;  3KTQ A;  3L2Q A;  1IKW A;  3AVM A;  3DOK A;  4QAG A;  4CEC A;  1VK0 A;  2YNI A;  1JLE A;  3WNH A;  1JLF A;  1NKE A;  3WNE A;  4DU1 A;  4FJJ A;  4KHN A;  1HQU A;  4CJR A;  3K57 A;  2G8F A;  3HP6 A;  2KZM A;  3AVB A;  2OPR A;  4OPK A;  5JS1 A;  3ZSR A;  4DF8 A;  4J2A A;  3NGI A;  4BWM A;  4CF0 A;  3QET A;  1EKE A;  4IFY A;  1HYZ A;  3HL8 A;  2RKI A;  4H4M A;  1EP4 A;  2XO7 A;  2A1R A;  4FLY A;  3QER A;  1WLJ A;  3V9S A;  4FW2 A;  3TAM A;  4DQS A;  1GOA A;  3ZSO A;  3QEI A;  3U3Y A;  2KQ2 A;  2XY6 A;  3LAK A;  4DTN A;  2G8U A;  5FDL A;  3B6P A;  3I0S A;  2E6M A;  3DM2 A;  2ZD1 A;  3NBP A;  4C8N A;  2KFN A;  1VSD A;  4ZTF A;  3ZSW A;  3L3V A;  4DLE A;  2A1S A;  3NCI A;  3EY1 A;  1TVR A;  2BE2 A;  4CHO A;  2OPP A;  1HNV A;  1RBR A;  1ZBF A;  1HPZ A;  3SQ0 A;  1CLQ A;  3QEP A;  5CZ2 A;  1L3S A;  2HB5 A;  1WSI A;  3B6O A;  2B4J A;  3QIP A;  1RT7 A;  4KB1 A;  3U6F A;  3SV4 A;  1RTJ A;  1D9D A;  4DSL A;  4CHQ A;  2Y1J A;  1NK4 A;  4FJX A;  1RCH A;  3PY8 A;  4I9Q A;  4DSJ A;  3V1Q A;  4CHP A;  3KLH A;  4F4K A;  3ZSV A;  1RT4 A;  4E1N A;  2KW4 A;  4B9L A;  1RT3 A;  1S9E A;  1D5A A;  2JGU A;  3V6D A;  3SUO A;  3S3M A;  3HO1 A;  1IKY A;  3RMD A;  4DQP A;  4Z4G A;  4CJL A;  3DYA A;  4KKO A;  3NGZ A;  2RPI A;  3OYM A;  3HM9 A;  1C0M A;  4GW6 A;  4CFC A;  4M3R A;  5EU7 A;  3ZT4 A;  4FW1 A;  1KRP A;  3VQA A;  1ITG A;  3KLF A;  3PO5 A;  3EZ5 A;  3TAN A;  1I3A A;  4F2R A;  4AH9 A;  2FBX A;  3TWH A;  1GOB A;  2D0A A;  4OGE A;  2YNF A;  4CEF A;  4FJG A;  3AVA A;  4RW4 A;  4PUO A;  2X74 A;  4DG1 A;  4FZX C;  3SYZ A;  1J53 A;  1UA1 A;  1VSK A;  1K6Y A;  4GMJ B;  4E19 A;  3AA5 X;  4NYN A;  4DF4 A;  1TKX A;  3V9U A;  1TL3 A;  3HP9 A;  3SPY A;  4K8X A;  1JLC A;  3RMB A;  1KVA A;  3VQ7 A;  4AHS A;  5J2M A;  1SKR A;  4W5Q A;  1NJX A;  4FZY A;  4C8K A;  3K5M A;  3TAB A;  1JLG A;  3V9W A;  4C8L A;  3MEG A;  1I39 A;  3BDP A;  5FRN A;  3D0P A;  4RW7 A;  4DQR A;  4HUG A;  4CJV A;  2OA8 A;  4KRE A;  2HHQ A;  1HNI A;  4GVM A;  1HJR A;  4RW9 A;  4E0D A;  4DQQ A;  4YFU A;  1TKZ A;  1Z26 A;  1NKB A;  3KD5 E;  1IH7 A;  5T7B A;  4QOZ B;  2D0B A;  2B6A A;  1LWE A;  3ITH A;  4PQU A;  4FM2 A;  3IS9 A;  2ATQ A;  1VSF A;  4OGC A;  4XIU A;  2OYQ A;  2KTQ A;  4E7L A;  3DLK A;  3ZT2 A;  2E6L A;  3I8D A;  4KTZ A;  3T3F A;  2F8S A;  4CGI A;  4FYD A;  2VG6 A;  3AVI A;  5D3G A;  1IO2 A;  4O0J A;  3VQB A;  1T8E A;  4CHZ A;  1O1W A;  2D0C A;  2HMI A;  4TSX A;  1TGO A;  3HT3 A;  1BIS A;  4N47 A;  4CIF A;  4FJ8 A;  4EZ9 A;  1Z25 A;  3NH2 A;  4CGG A;  3G10 A;  5CYQ A;  3O4N A;  4B08 A;  4G1Q A;  3QIN A;  1SUQ A;  2IDO A;  1BIZ A;  4OJR A;  4PA1 A;  4CF8 A;  1RNH A;  4FJM A;  1LAV A;  1NJW A;  5DMR A;  3K58 A;  3I0R A;  2P5G A;  4C8O A;  3T19 A;  4FJL A;  1JLA A;  1XWL A;  4CJ3 A;  2HND A;  3PX6 A;  1QSY A;  1A5X A;  4LD0 A;  2HHT A;  3MEC A;  2YKM A;  3DI6 A;  3KLI A;  3WNG A;  4CIG A;  3P5J A;  1T03 A;  4W5T A;  4B9U A;  4NCB A;  2HHV A;  1L5U A;  3V9Z A;  3RR7 A;  1VSI A;  5DK5 A;  4CF1 A;  3KLE A;  3LWL A;  4ZTJ A;  1FXX A;  3ALY A;  5HRR A;  1KCF A;  3HXM A;  4CGD A;  5KTQ A;  2E4L A;  1RT2 A;  4Z4H A;  4M3X A;  4FCY A;  3MED A;  4NCA A;  4B9T A;  4DU3 A;  3RTV A;  3DRR A;  1ZYQ A;  1RTI A;  4I9L A;  4M3Z A;  2AJQ A;  2F96 A;  3AVN A;  5C25 A;  3CQ8 A;  4LSN A;  4CK2 A;  4HHT A;  2B5J A;  5I3U A;  3PUF A;  3VQQ A;  3AVK A;  3BGR A;  4LSL A;  3TAG A;  3L2V A;  4M3T A;  2IS3 A;  3M8P A;  3NF7 A;  1HMV A;  4DMN A;  4FM1 A;  1G15 A;  4RW8 A;  1FK9 A;  3CFP A;  4ELU A;  3SUQ A;  4KPY A;  3AVJ A;  5KI6 A;  4DSK A;  2PYJ A;  5SWM A;  1QSL A;  4FJ7 A;  3TI0 A;  3LP3 A;  4I7F A;  4JLH A;  1S6Q A;  3VQ5 A;  3NF9 A;  4FLW A;  1LV5 A;  4Z4I A;  3IAY A;  4CF9 A;  4KI6 A;  4CEA A;  1MU2 A;  5J2Q A;  4O5B A;  4DS4 A;  4DTX A;  3C94 A;  4BE1 A;  1HRH A;  3KK3 A;  1JL2 A;  4CHN A;  1NK8 A;  3K5N A;  3WNF A;  3LP2 A;  2IOC A;  1ASU A;  1IKV A;  4O55 A;  4JRP A;  4FVM A;  1RIL A;  4DQI A;  4AIL C;  3QIO A;  4EZ6 A;  4CJ4 A;  4DTR A;  4KRF A;  4Y1D A;  3OYL A;  3SCX A;  3SZ2 A;  4CJF A;  1U49 A;  2HNY A;  1ZBL A;  3HJF A;  1C1C A;  3V81 A;  2Y1I A;  1XHZ A;  1NK5 A;  3VQE A;  4EP4 A;  2G8V A;  4CFB A;  4B9M A;  3LZI A;  3OYF A;  3OJS A;  3MXI A;  4DTP A;  1UAX A;  1C1B A;  1RTH A;  3AO1 A;  2HNZ A;  4PY5 A;  4Z4F A;  3LDS A;  3IG1 A;  4DU4 A;  1W0H A;  1BCM A;  2D5R A;  4FJ9 A;  1S5J A;  1C6V A;  3RWU A;  3SJJ A;  4QCL A;  1R0A A;  4O4G A;  1FKO A;  4M41 A;  3JSM A;  3QNN A;  3SQ1 A;  2I5J A;  3LZJ A;  3ULD A;  3M8Q A;  4FJN A;  1BQM A;  1SV5 A;  3O3F A;  3LP0 A;  3RRG A;  4KV8 A;  4E1M A;  2IAJ A;  3HVR A;  4AHC A;  3OYC A;  2LSN A;  4OKK A;  4BDZ A;  2BDP A;  2PYL A;  5KGW A;  3KK1 A;  4DTM A;  1VSJ A;  3NF6 A;  4FXD A;  3LP1 A;  1S1W A;  4FLX A;  3QEV A;  2YHA A;  3CFR A;  1NK0 A;  4KHY A;  4F2S A;  2DTU A;  4M3U A;  3UIQ A;  3AVF A;  3JYT A;  4MFB A;  3U3G A;  4Z0U A;  1BQN A;  4DFM A;  1C1A A;  3AO5 A;  1UOC A;  3OYA A;  4B9V A;  3G0Z A;  3ZSQ A;  4FJI A;  4E7J A;  2QK9 A;  4CEO A;  1NK7 A;  5CZ1 A;  4CJE A;  4CK3 A;  2QKB A;  4CJQ A;  1NK6 A;  4EP5 A;  3DRS A;  3ISN C;  3V9X A;  4WE1 A;  2O4I A;  3VQ6 A;  1F21 A;  4DWI A;  1C0T A;  5HP1 A;  3VQ9 A;  3ZT3 A;  4I2Q A;  3TAF A;  3TAE A;  4DFK A;  1VRU A;  2G8H A;  3C6U A;  1KTQ A;  1X1P A;  4CHY A;  1SL1 A;  4Z4C A;  4I2P A;  3MAQ A;  3DLH A;  3NDK A;  1TL1 A;  2X6N A;  2GUI A;  4CER A;  2VWJ A;  4DSE A;  4HCC A;  2HVI A;  3MXJ A;  3OYI A;  4CJP A;  4F8R A;  4E7I A;  4CK1 A;  3DLB A;  1VSE A;  3F9K A;  4IG3 A;  1T05 A;  3C6T A;  3CFO A;  4CES A;  2DY4 A;  1SKS A;  4AHU A;  3S3O A;  3VQ4 A;  3TAP A;  1RDB A;  1VSM A;  4LY7 A;  5HRP A;  3L2R A;  2BAN A;  3CM6 A;  4B3O A;  2GBZ A;  3H08 A;  4DTU A;  1TKD A;  5FRM A;  3OS0 A;  1L3V A;  3DRP A;  4B8C A;  4BE2 A;  4H8K A;  2HHW A;  2DFF A;  1HYV A;  3LAM A;  4ICL A;  3K5L A;  4E7H A;  2Z1J A;  3OYB A;  4K8Z A;  4CIE A;  4ZHR A;  4IG0 A;  3ZSY A;  3PX4 A;  4Q5V A;  2NUB A;  3KKR A;  1CXU A;  1TV6 A;  1YT3 A;  2WOM A;  1EX4 A;  2FBV A;  2VWK A;  5HRS A;  4DFJ A;  3HYF A;  4ELV A;  3KKS A;  4Z4E A;  3ZT0 A;  3ZCM A;  5SZT A;  4HTU A;  1KFS A;  3SQ2 A;  3PV8 A;  3SNN A;  3NE6 A;  3DLR A;  4DTO A;  4HCB A;  3OYN A;  1S9G A;  4ELT A;  3L8B A;  3K5O A;  3P83 D;  4KHQ A;  2G8I A;  4O0I A;  2XY8 A;  3M8R A;  4KFB A;  1XI1 A;  1NOZ A;  4AHR A;  5KRT A;  2QKK A;  3E01 A;  1X9S A;  3RMC A;  4W5O A;  4CF2 A;  4BAC A;  1QTM A;  5J2P A;  4UQG A;  4M3Y A;  3NHG A;  1SL0 A;  4LH5 A;  1JXB A;  3OVN A;  3L3U A;  5C24 A;  2Q3S A;  3NFA A;  5JS2 A;  3OYK A;  1D8Y A;  3AVC A;  4DLG A;  1TK8 A;  2G8K A;  3NAE A;  4JRQ A;  4BDP A;  2X78 A;  1RTD A;  3AA4 A;  5HBM A;  3SQ4 A;  3DLG A;  1NOY A;  4L8R B;  3HST B;  4R5P A;  2OZM A;  1BHL A;  1WSG A;  4FLT A;  4KHW A;  2KZZ A;  4KTW A;  4DS5 A;  1U48 A;  3SUP A;  3A2F A;  2YNH A;  3LPU A;  5J2N A;  3S9H A;  1BI4 A;  5HLF A;  1N6Q A;  1TAU A;  3VN5 A;  1IKX A;  1JXE A;  3QO9 A;  5J1E A;  3ZT1 A;  1DTQ A;  3OYJ A;  3RR8 A;  3DOL A;  3KJV A;  1YVU A;  3OYD A;  4IBN A;  4JS5 A;  3HPH A;  4N5S A;  3QLH A;  5CYM A;  3HK2 A;  4H4O A;  5E41 A;  4FK4 A;  4DSF A;  2PZS A;  1LWC A;  1QSS A;  3DLE A;  4B9S A;  1RT6 A;  1WSF A;  4FLU A;  4FK0 A;  4O44 A;  3LWM A;  1NKC A;  2HHX A;  2P5O A;  2FC0 A;  2FBY A;  2P1J A;  3O3G A;  1U04 A;  4RW6 A;  4FK2 A;  1T7P A;  4FZZ A;  2F8T A;  3AVG A;  4KB0 A;  3KIO A;  1BCO A; 
#chains in the Genus database with same CATH topology
 4JKC A;  2VWB A;  1Y97 A;  4BRG A;  1KVB A;  1RDW X;  4PKI A;  4IO8 A;  1U47 A;  1J54 A;  4IOX A;  1FKP A;  5GAE P;  3RMA A;  3CJ7 A;  1NJI O;  3O3H A;  2P51 A;  4A5B A;  5ADX A;  1KLM A;  4FM0 A;  4K25 A;  3AVH A;  4Y0W A;  1YXQ A;  5JLH A;  1NGB A;  4IKF A;  1WSJ A;  3WEE B;  1RBV A;  2OZS A;  1ZBU A;  1NJZ A;  1QHT A;  3HVT A;  1OH8 A;  1WAJ A;  1VHX A;  3FZK A;  1Q9X A;  3KD1 E;  3SV3 A;  1N5Y A;  5AZJ A;  3VMF B;  3Q7C A;  4CE9 A;  1ASW A;  3AAP A;  1KFD A;  5M1K A;  4DV5 K;  3P39 A;  1YF5 L;  1C0F A;  1CXQ A;  3VA3 A;  1ASV A;  4E3S A;  4MO5 A;  1QZ5 A;  3OBW A;  4CJ5 A;  5KRS A;  3E66 A;  4BRC A;  4RWT A;  3THY B;  3E9O A;  3N4Q A;  1DLO A;  4IDK A;  3WEE A;  5F0X A;  3NF8 A;  3PIO L;  3CPE A;  3H3N O;  5K14 A;  1BL3 A;  1CZ9 A;  4FJK A;  4E7K A;  4KHS A;  1YI2 N;  4FPB A;  3VTI A;  3SPZ A;  4JS4 A;  2O8B B;  3HPO A;  4AM7 A;  1LAW A;  4YOX A;  4C8M A;  4DR1 K;  3TAR A;  2HST A;  3TAQ A;  5FRO A;  2X6S A;  4JKG B;  1OH6 A;  2E2O A;  4OO1 J;  3QEX A;  4BG9 A;  2NRW A;  3NGY A;  2HVH A;  3BP8 A;  1KVC A;  5DM6 L;  4O5F A;  4FWO A;  4BE0 A;  2HHS A;  1YTU A;  4HVJ A;  5CY4 A;  3GE1 A;  3MK6 A;  2O8B A;  2GV9 A;  2OPS A;  1J6Z A;  3OYG A;  1HQE A;  2VG7 A;  3ZSZ A;  4CED A;  4HUE A;  2EWS A;  1VQM N;  4JKG A;  2W41 A;  3W3D A;  3KK2 A;  1SL2 A;  4B1X B;  2DFH A;  3PSI A;  2XY7 A;  4U7B A;  3P1G A;  3K9K A;  3L2Q A;  5LJW A;  1IKW A;  5M1P A;  3AVM A;  1KAX A;  5KQD A;  1VK0 A;  2YNI A;  1JLE A;  1NKE A;  3ZLJ A;  4KHN A;  3O9S A;  3K57 A;  2KZM A;  1NGJ A;  3ATU A;  4DF8 A;  4CF0 A;  1EKE A;  4A61 A;  2XO7 A;  2A1R A;  1EP4 A;  3BZC A;  4FLY A;  3QEI A;  1VQ5 N;  3LAK A;  3I0S A;  4JI4 K;  3J7Z O;  4ZTF A;  4DHY A;  4GVE A;  2Q31 A;  3CMA N;  2BE2 A;  4CHO A;  2YHW A;  1RBR A;  1ZBF A;  1HPZ A;  2FF6 A;  5H1S Q;  3QEP A;  1CLQ A;  2UUC K;  3QIP A;  1WUA A;  4LF4 K;  4KB1 A;  4DSL A;  1BA1 A;  4CHQ A;  1NK4 A;  5BRE A;  4JI8 K;  2VGN A;  3PY8 A;  3CCV N;  3D7E O;  3ZSV A;  4BRH A;  4OPH A;  1TYQ A;  4B9L A;  2JGU A;  4DV3 K;  4KKO A;  3OYM A;  1X9J A;  4CFC A;  1NGE A;  4M3R A;  5EU7 A;  3ZYY X;  3VQA A;  4B3M K;  3TAN A;  3PO5 A;  4B3S K;  2QWN A;  2HHH K;  2YNF A;  1W2B M;  3SAF A;  4PUO A;  4DG1 A;  3SYZ A;  2CH6 A;  4JHD B;  4GMJ B;  4E19 A;  3F9M A;  4NYN A;  3V9U A;  2YJF A;  1KVA A;  5LMN K;  3Q7B A;  4W5Q A;  5JMV A;  3CJ1 A;  3VEZ A;  3TAB A;  1JLG A;  2V7Z A;  3LDL A;  4BRP A;  2VCP A;  3V9W A;  2QWO A;  3BDP A;  4HUG A;  1E4F T;  4KRE A;  1HNI A;  4GVM A;  3DJC A;  3KWG A;  5BPM A;  4QOZ B;  5T7B A;  5EOY A;  2P9U A;  3IS9 A;  2ATQ A;  3DLK A;  2E6L A;  3VPZ A;  4CGI A;  1Q81 O;  5D3G A;  1T8E A;  5TKY A;  4CHZ A;  4N47 A;  4EZ9 A;  5FPD A;  4CGG A;  3O4N A;  4G1Q A;  3QIN A;  4IJA A;  4OJR A;  2P9I B;  5DMR A;  5EY4 A;  3I0R A;  1Q86 O;  4IOC L;  3CCM N;  2KLA A;  4CJ3 A;  3PX6 A;  3AAR A;  5DM7 L;  2YKM A;  3DI6 A;  3WNG A;  1VSI A;  5LMU K;  2FLO A;  3VEY A;  2QEX N;  3CD6 N;  2CH5 A;  4CGD A;  2E4L A;  1IBK K;  3HOT A;  4FCY A;  4B9T A;  4DU3 A;  2NRZ A;  3VEO A;  3G4S N;  2AJQ A;  2F96 A;  3CXC M;  3GL1 A;  4BY9 C;  2P9I A;  3AVK A;  4LSL A;  1HMV A;  1G15 A;  2KKZ A;  2RHK A;  4FWQ A;  4H5W A;  5C2F A;  3LM9 A;  2PYJ A;  5SWM A;  2JWL A;  4JLH A;  1LV5 A;  4Z4I A;  4BC4 A;  5AQI A;  4Z94 A;  1HRH A;  2QWR A;  3WNF A;  4GY2 B;  4JRP A;  1V4S A;  1S3X A;  4BC3 A;  4Y1D A;  3OYL A;  5C12 A;  3SZ2 A;  5CR4 A;  3CJ9 A;  3HJF A;  1C1C A;  2Y1I A;  3ENB A;  4JKE A;  2G8V A;  4B9M A;  3OJS A;  2FXU A;  4DTP A;  1UAX A;  2P9N A;  1C1B A;  2V7Y A;  4PY5 A;  3RWU A;  4DV2 K;  3SJJ A;  4DV4 K;  1NGF A;  3ULD A;  3M8Q A;  4KH4 A;  4H0P A;  1QQM A;  2F9W A;  3O3F A;  3LP0 A;  3RRG A;  1NGA A;  2W6L A;  1K73 O;  4AHC A;  1HX1 A;  1JCE A;  4BDZ A;  2PYL A;  2HBK A;  2OTL N;  3NF6 A;  4FXD A;  4KHY A;  4FLX A;  3HZ6 A;  4CZK A;  3CCR N;  4MFB A;  2D0O A;  1BQN A;  3N4P A;  3AO5 A;  1UOC A;  3OYA A;  4QS7 A;  5GAD P;  2HOE A;  2QKB A;  4EAH D;  4CJQ A;  3A5L C;  4EP5 A;  4BRI A;  2O4I A;  3WT0 A;  3VQ6 A;  2E1Y A;  5KPR A;  5HP1 A;  3ZT3 A;  5C15 A;  4DFK A;  3C6U A;  1SL1 A;  4I2P A;  2X6N A;  2GUI A;  3OBY A;  2VWJ A;  4HCC A;  3MN7 A;  3THW B;  1XC3 A;  1VSE A;  1T05 A;  3C6T A;  4AHU A;  3K0S A;  1RDB A;  3DWL A;  3L2R A;  2P9L B;  4EIA A;  2W6K A;  1TKD A;  3R1X A;  1L3V A;  1WB9 A;  3LAM A;  4ICL A;  4E7H A;  2KHO A;  2Z1J A;  3OYB A;  1VQN N;  1BUP A;  2UXB K;  3A5O C;  1CXU A;  2FBV A;  4DFJ A;  2WOM A;  1N34 K;  5HRS A;  4I6M B;  3A5N C;  4H0O A;  1YHQ N;  3PV8 A;  3DLR A;  5AQL A;  3THW A;  2NRT A;  4DTO A;  4HCB A;  3OYN A;  3K5O A;  5M1Q A;  2GWJ A;  4FPA A;  4O0I A;  3M8R A;  5KRT A;  2QKK A;  1IV0 A;  3E01 A;  1ZXO A;  4M3Y A;  3CF5 L;  2ASP A;  1JXB A;  4LH5 A;  3OVN A;  1NNE A;  3HTV A;  2HBM A;  4WFA L;  1TK8 A;  2X78 A;  2QM1 A;  1RTD A;  3AA4 A;  4KHP K;  1NOY A;  2OZM A;  5ELZ A;  4FLT A;  1IG8 A;  1W7A A;  4I6M A;  4KHW A;  4KTW A;  2KZZ A;  3SUP A;  5HLF A;  4BGA A;  1TAU A;  3VN5 A;  1IKX A;  1O13 A;  3OYJ A;  2QW9 A;  4ILJ A;  3G6E N;  5CYM A;  5E41 A;  4FK4 A;  4DSF A;  4WFN L;  1QSS A;  5BN8 A;  3GG4 A;  1WSF A;  2BTF A;  4XEI A;  4FLU A;  2HHX A;  3SJH A;  4A59 A;  5GAG P;  1T7P A;  3VET A;  4FZZ A;  2YHY A;  3AVG A;  4KB0 A;  3KIO A;  3NHG A;  4BE1 A;  1IG9 A;  1ZBH A;  3CQY A;  5KPZ A;  4KAZ A;  1NK9 A;  1JCG A;  1RBT A;  2ZM6 K;  3KLG A;  1QQC A;  1NGG A;  5AR0 A;  4IZ9 A;  2E5L K;  4AHV A;  2XHB A;  4PWD A;  1RT1 A;  2YHX A;  3CC2 N;  1OH5 A;  2Z1G A;  4IFV A;  3QNO A;  1XC9 A;  1SAZ A;  4C1N K;  1YJW N;  4OVL A;  1JL1 A;  2XRI A;  2O8E A;  3CM5 A;  2W42 A;  4J2D A;  1L3T A;  3AO4 A;  3MWP A;  4WFB L;  3C95 A;  3O9T A;  3JAM O;  4N56 A;  4DUY K;  3NH1 A;  4ISF A;  2EX3 A;  1WN7 A;  1NGI A;  1RDD A;  1M90 O;  1HKC A;  4FJH A;  3EE9 A;  3NH0 A;  3CYM A;  5M1F A;  4JI3 K;  1S1T A;  4LF8 K;  1X3M A;  3V4I A;  1ZBS A;  5HRO A;  3FFI A;  1CZB A;  2GTD A;  2YV0 X;  3LL3 A;  4DTS A;  4IWV A;  1W9H A;  2P9S B;  3CJB A;  4XH1 A;  5KGX A;  1BGX T;  4CJW A;  1NLV A;  3M1F A;  1ZC6 A;  4K41 A;  5IWA K;  3O4Q A;  5ADX H;  2WFB A;  3C7N B;  4JK9 A;  4RCH A;  2WTU A;  3PX0 A;  2PFU A;  3AA2 A;  4HUF A;  1GOC A;  2FSJ A;  4KO0 A;  5B8H A;  4NB4 A;  1Z05 A;  3AV9 A;  2CGJ A;  1BI4 B;  2GEM A;  3DXM A;  4A2B A;  2FBT A;  2WON A;  1N33 K;  3D2F B;  3VGM A;  4CFA A;  2R7Y A;  3MX5 A;  1EET A;  3VQP A;  3MXM A;  2CGK A;  1TK0 A;  3RRH A;  3QBW A;  3VQC A;  2FSK A;  1U4B A;  2IVO A;  3C7N A;  1YIJ N;  4CJS A;  3CER A;  3TSU A;  2BGG A;  3TPQ A;  2UUA K;  4A5A A;  3CHW A;  3U4L A;  3V1O A;  3QEW A;  4BWJ A;  1A5W A;  4FLV A;  4CZG A;  1T6C A;  5HOO A;  5KPT A;  1LW2 A;  1KD1 O;  4M3W A;  4OKJ A;  5BRD A;  2G8W A;  1KSP A;  4PKG A;  1EXQ A;  2VYP A;  3IRX A;  1S1X A;  4Q0B A;  4NYF A;  4F3T A;  4CGJ A;  1WNS A;  1S1V A;  1RFQ A;  1WSE A;  4JD2 A;  4XH5 A;  4QAG A;  3SAH A;  2FF3 B;  4DU1 A;  4BRF A;  1HQU A;  4CJR A;  3AVB A;  2OPR A;  4OPK A;  2ZJQ L;  5F1X A;  2O8C A;  3FLC O;  1EQY A;  4B3T K;  3QET A;  1HYZ A;  3WXM B;  3HL8 A;  4B1V A;  4R79 A;  1VQ4 N;  2ZF5 O;  3QER A;  4DQS A;  2G8U A;  4C8N A;  5FDL A;  3NBP A;  5AZJ B;  1QVG M;  1VSD A;  2V52 B;  3L3V A;  3ZEU A;  3EY1 A;  3UE5 A;  1GLB G;  5AQT A;  5CZ2 A;  3B6O A;  2B4J A;  3U6F A;  3VF2 A;  1RTJ A;  2QI2 A;  1NBW A;  1EWR A;  3THX A;  4I9Q A;  4DSJ A;  4F4K A;  4E1N A;  2KW4 A;  1EO1 A;  4B1Y B;  3HO1 A;  3SUO A;  1IKY A;  3CCU N;  3RMD A;  4DV0 K;  4DQP A;  4Z4G A;  3NGZ A;  1P8Z A;  3L4Q A;  5LJV A;  1KRP A;  4C1N I;  2ZWH A;  1ITG A;  4BRD A;  2YI1 A;  5AFU A;  3TWH A;  4PL7 A;  4FJG A;  4DR6 K;  4RW4 A;  2X74 A;  3AA5 X;  3HP9 A;  1J5E K;  1JLC A;  2F4V K;  5J2M A;  1SKR A;  3QFU A;  5I9E B;  1NJX A;  4C8L A;  3MEG A;  3FZM A;  4H5N A;  4LF7 K;  4GV3 A;  4RW7 A;  4DQR A;  2OA8 A;  4JV5 K;  3J80 O;  2HHQ A;  3ZX3 A;  1YJ9 N;  1M1K O;  1HJR A;  4RW9 A;  4E0D A;  4CZE A;  4DQQ A;  1XQS C;  3O9Q A;  1NKB A;  4PQU A;  1LWE A;  2B6A A;  4DQ8 A;  4H5R A;  4B3R K;  3KVG A;  4C23 A;  4XIU A;  2KTQ A;  1YUW A;  3CQX A;  3T3F A;  2VG6 A;  2HMI A;  3HT3 A;  4CZM A;  4CIF A;  1XUP O;  3G10 A;  2Q1N A;  4FJM A;  2JWK A;  3K58 A;  2P5G A;  3T19 A;  1XWL A;  4BRN A;  2HND A;  1QSY A;  3CJA A;  3MEC A;  4B9U A;  3P5J A;  4W5T A;  1KAZ A;  3L6Q A;  3RR7 A;  3LWL A;  4CF1 A;  1NGD A;  3ALY A;  5HRR A;  3ZX2 A;  4Z4H A;  1Z6R A;  3MED A;  3OTO K;  4NCA A;  4IOA L;  1RTI A;  4M3Z A;  1IJJ A;  4HHT A;  3VER A;  3VQQ A;  3L2V A;  3M8P A;  3NF7 A;  5GIO A;  4FM1 A;  1ATR A;  4RW8 A;  1XNR K;  3SUQ A;  1YVN A;  5KI6 A;  2YX6 A;  4I7F A;  3VQ5 A;  1GLJ O;  3VTH A;  3IAY A;  4CEA A;  1MU2 A;  5J2Q A;  1TYQ B;  3F5T A;  4O5B A;  4DS4 A;  5AQR A;  2E1Z A;  1NK8 A;  3LP2 A;  3J81 O;  2Q0R A;  4O55 A;  1RIL A;  4EZ6 A;  4AIL C;  4DTR A;  4KRF A;  3TTC A;  4CJF A;  5JVG L;  1ZBL A;  3SMS A;  3V81 A;  3VQE A;  3LZI A;  1RTH A;  3AO1 A;  4Z4F A;  4PL8 A;  1BCM A;  1S5J A;  1C6V A;  4O4G A;  3JSM A;  4WQ5 A;  5AQY A;  1WBB A;  4BC5 A;  3RVC A;  1BQM A;  4B1W B;  1NM1 A;  4KV8 A;  2IAJ A;  1U2V A;  3OYC A;  2BDP A;  4ILG B;  3OA9 A;  3CET A;  4BC2 A;  4WQ5 C;  2P9U B;  3K9J A;  3LP1 A;  3QEV A;  4GKK K;  1XNQ K;  4F2S A;  2DTU A;  3UIQ A;  3AVF A;  2AA4 A;  4ISE A;  5AQO A;  3M3Z A;  3M5R A;  2D1K A;  1QZ6 A;  3ZSQ A;  4FJI A;  2QK9 A;  4CEO A;  5CZ1 A;  4CK3 A;  3RSE A;  5BN9 A;  3DRS A;  1HJO A;  3V9X A;  1BU6 O;  1ILY A;  4DWI A;  1F21 A;  4BR9 A;  3VQ9 A;  3TSQ A;  2ZJP L;  3TAF A;  3MAQ A;  3DLH A;  4BR7 A;  1HUX A;  2HVI A;  3MXJ A;  3CCL N;  1ESV A;  3CFO A;  5BPN A;  4LY7 A;  4IEI A;  4BGB A;  4IXC A;  4ISG A;  5A2Q O;  3SLC A;  3CIP A;  3R8E A;  3EL2 A;  4H8K A;  4AF1 A;  4JN4 A;  3QBX A;  4FJN A;  3R3L A;  4Q5V A;  1QQO A;  1YT3 A;  4JKA A;  1EX4 A;  2VWK A;  2W40 A;  1DKG D;  1MDU B;  3ZT0 A;  3ZCM A;  4HTU A;  1KFS A;  4LF6 K;  4BVO A;  4KHQ A;  1XI1 A;  3W0L A;  1NOZ A;  1XMQ K;  4HWI A;  1X9S A;  4W5O A;  2QXL A;  4BAC A;  1QTM A;  2IIR A;  1SL0 A;  2I7P A;  3NAE A;  4JRQ A;  4BDP A;  1NGC A;  2P9P A;  3IUC A;  1QHA A;  1BHL A;  1WSG A;  2UXD K;  2ITM A;  4DS5 A;  1P90 A;  3O08 A;  3DAW A;  1G99 A;  4YOR A;  2P9N B;  4E1J A;  3ZT1 A;  1DTQ A;  1YVU A;  3OYD A;  4IBN A;  4JS5 A;  3VOV A;  3HPH A;  3QLH A;  4H4O A;  1K8A O;  2PZS A;  1LWC A;  3IFR A;  3DLE A;  4B9S A;  4LF9 K;  1RT6 A;  4FK0 A;  3LWM A;  2ZJR L;  4DV1 K;  5GIP A;  2HF3 A;  4RW6 A;  5GIN A;  2F8T A;  3CJC A;  2HBL A;  4CBU A;  3SCX A;  2ZGY A;  4DKW A;  2ITG A;  1TK5 A;  2Q0U A;  4M45 A;  3K59 A;  3OYH A;  1HNZ K;  4OLA A;  4K43 A;  3CG7 A;  2O4G A;  4B8A B;  4H5V A;  2H3G X;  2WUS A;  2QA4 N;  1ZBI A;  4OPJ A;  1BG3 A;  3OS1 A;  3BF3 A;  4H03 B;  3OJU A;  2HHU A;  4AHT A;  3S3N A;  2QXF A;  2Z1I A;  3MN9 A;  4DR5 K;  4X66 K;  2KFZ A;  3D45 A;  4OPA A;  3V1R A;  3HPG A;  1S22 A;  1KAY A;  5FRM A;  3MCP A;  1X3N A;  3AO2 A;  2OPQ A;  4BDY A;  1SZ2 A;  3O9R A;  1VSH A;  3DMJ A;  4CJU A;  5I42 A;  4DFP A;  3OY9 A;  1NGH A;  1WAF A;  3ASM A;  5E26 A;  1J9A A;  4N76 A;  3CC7 N;  4CEB A;  1KLN A;  2ETJ A;  1RBS A;  1Q8I A;  4GV9 A;  1BA0 A;  4JKH A;  4JAX A;  4FLZ A;  4DSI A;  3CCJ N;  3SUN A;  5AQX A;  3ENO A;  3KK7 A;  1REV A;  1VQO N;  4EHU A;  1HYS A;  1BO5 O;  3MMV A;  4J2B A;  1D9F A;  3UKR A;  1RT5 A;  4MDA A;  1S1U A;  2YCH A;  4E89 A;  1JCF A;  4PHT X;  3P4I A;  4MQ3 A;  1KXP A;  1A5V A;  2IGI A;  2QTD A;  1YTA A;  3QES A;  1QE1 A;  4BRO A;  2F9T A;  4DB3 A;  4F3O A;  1NJY A;  4CJK A;  4JI7 K;  4J2E A;  3DXK A;  3O6W A;  4YOU A;  4K42 A;  4CFD A;  1B9D A;  2Z1H A;  3L2U A;  3EYZ A;  3NVM A;  4ID5 A;  4RG8 A;  3TR8 A;  1TKT A;  3VQD A;  3OS2 A;  1Q9Y A;  1ATS A;  1GLF O;  4YHH K;  3O9U A;  2YJE A;  4H0T B;  4EHT A;  2QWP A;  2WBN A;  2O8F A;  2IC3 A;  1C0U A;  1BOT O;  4DTJ A;  3VGK A;  3AA3 A;  2RF2 A;  3E1Y A;  2ZE2 A;  1RBU A;  1OKJ A;  2DPN A;  3WQT A;  1J5O A;  3HM8 A;  1QS4 A;  1X9M A;  2YKN A;  3WUH A;  1SKW A;  3LDN A;  4CZI A;  4W5N A;  2JLE A;  3KTQ A;  4KH5 A;  3UKU B;  2QWQ A;  3DOK A;  4IDH A;  4HTL A;  5AQM A;  3WNH A;  4FJJ A;  4H0Y B;  4B1U B;  2G8F A;  2O8E B;  5JS1 A;  3EO3 A;  3ZSR A;  3JS6 A;  4BWM A;  3NGI A;  1VAZ A;  2PBD A;  5C0Y A;  4FVU A;  2RKI A;  4H4M A;  1WLJ A;  3V9S A;  4FW2 A;  3TAM A;  4CBX A;  1GOA A;  2WC9 A;  3ZSO A;  3U3Y A;  4BG8 A;  4DTN A;  3ID6 A;  3B6P A;  2E6M A;  3DM2 A;  1V4T A;  4NLC A;  1TVR A;  3UKU A;  2OPP A;  1HNV A;  2HB5 A;  3QDK A;  4FSV A;  1RT7 A;  1T6D A;  1GLL O;  3SV4 A;  1T3V A;  1H1V A;  4FJX A;  4ILH A;  1RCH A;  1HNW K;  3V1Q A;  4CHP A;  3KLH A;  3DLL L;  2A41 A;  1S9E A;  1D5A A;  4CJ7 A;  3V6D A;  3S3M A;  3LDQ A;  3D6R A;  3H3O B;  2RPI A;  1C0M A;  4GW6 A;  3ZT4 A;  4FW1 A;  5EX5 A;  3C0B A;  1I3A A;  5KQ8 A;  2FBX A;  1K9M O;  2D0A A;  4OGE A;  2E20 A;  3OHR A;  4CEF A;  3AVA A;  1D4X A;  1UA1 A;  5AQW A;  3DXM B;  1VSK A;  1K6Y A;  1TKX A;  1TL3 A;  2OAN A;  5AQN A;  1N36 K;  4K8X A;  4FZY A;  4CZH A;  4C8K A;  4YOV A;  3ZET A;  1I39 A;  4X65 K;  5EVZ A;  4J8F A;  2A40 A;  3T69 A;  1RDU A;  1NMN A;  3VEX A;  3U9Z A;  2UUB K;  5AJ3 K;  4YFU A;  2O8D A;  1TKZ A;  1Z26 A;  2HBJ A;  1IH7 A;  4H5T A;  4CD1 A;  2D0B A;  3ITH A;  4OGC A;  1VSF A;  2OYQ A;  3EE8 A;  3ULE B;  3J7Y P;  2NRH A;  1DT9 A;  3ZT2 A;  3I8D A;  4E7L A;  4YOW A;  4KH6 A;  4FYD A;  3AVI A;  4B9Q A;  1NMD A;  3VQB A;  1O1W A;  2D0C A;  4TSX A;  1TGO A;  2ASO A;  1Z25 A;  5AFU H;  5CYQ A;  2IDO A;  4CF8 A;  3KHY A;  1RNH A;  4JD2 B;  3BEX A;  3I56 N;  4FJL A;  3EKS A;  3EKU A;  2A3Z A;  2HHT A;  2NLX A;  1VQL N;  4NCB A;  3AGK A;  3V9Z A;  1E4G T;  5DK5 A;  3ULE A;  2O8C B;  4ZTJ A;  1HLU A;  3MN6 A;  1KCF A;  3HXM A;  1RT2 A;  4FL9 A;  1SQK A;  1E3M A;  1CZA N;  1MWM A;  4CW7 B;  4MDB A;  1MWK A;  1GLD G;  1QVF M;  3AVN A;  5C25 A;  4DCH A;  4LSN A;  4CK2 A;  3EN9 A;  5FPM A;  3PLA A;  5I3U A;  3PUF A;  3ZEU B;  3TAG A;  2IS3 A;  3U9D A;  4DMN A;  3CC4 N;  1FK9 A;  4ELU A;  3AVJ A;  4LFC K;  4X62 K;  2OCE A;  4BRA A;  5BRF A;  1QSL A;  3THX B;  1C0G A;  4JKD A;  4FLW A;  3MWT A;  3U8X A;  4CF9 A;  4DTX A;  3C94 A;  3B8A X;  2UYT A;  2IOC A;  1R59 O;  3IKM A;  4FVM A;  4DQI A;  3QIO A;  3GBT A;  1VQP N;  1NK5 A;  4EP4 A;  3CCQ N;  4CFB A;  5AQV A;  1T44 A;  3I8B A;  5CHI A;  3IG1 A;  4FJ9 A;  1W0H A;  2D5R A;  4QCL A;  3LM2 A;  1R0A A;  1FKO A;  1Y64 A;  3QNN A;  3SQ1 A;  2I5J A;  1U6Z A;  5AQH A;  3IMX A;  4E1M A;  4BRE A;  3HVR A;  2LSN A;  5KGW A;  3KK1 A;  4DTM A;  4BR0 A;  4A57 A;  1VSJ A;  4JI6 K;  3D2E A;  1S1W A;  4NO7 A;  3PIP L;  2YHA A;  2Q36 A;  1NK0 A;  4WF9 L;  3U3G A;  1OVY A;  4Z0U A;  4DFM A;  4B9V A;  3G0Z A;  5F2R A;  2IVN A;  3FGU A;  5JVH L;  1NK7 A;  4CJE A;  1NK6 A;  3ISN C;  4WE1 A;  4X64 K;  4I2Q A;  2E2N A;  3TAE A;  2OTJ N;  1VRU A;  4QS9 A;  1X1P A;  4Z4C A;  1TL1 A;  4DSE A;  4CER A;  4M7X A;  4CJP A;  4E7I A;  4CK1 A;  3DLB A;  2J4R A;  2NRR A;  3F9K A;  4IG3 A;  4CES A;  1SKS A;  3S3O A;  1OH7 A;  3VQ4 A;  1VSM A;  5HRP A;  3CPW M;  5EXW A;  1Q82 O;  2BAN A;  3CM6 A;  4B3O A;  1LCU A;  3H08 A;  4DTU A;  5AQJ A;  3J8A A;  1TUY A;  5AQK A;  3DRP A;  4B8C A;  4BE2 A;  2HHW A;  2DFF A;  3LDP A;  1HYV A;  3FZH A;  4CIE A;  4FOI A;  2E88 A;  4ELV A;  3KKS A;  4Z4E A;  3QFP A;  1GLA G;  1DEJ A;  2E2Q A;  4B1Z A;  4FOE A;  4BR5 A;  3QB0 A;  2GEL A;  3L8B A;  3O1W A;  2XY8 A;  3THY A;  3F2K A;  3FZF A;  3RMC A;  4CF2 A;  3A5M C;  5J2P A;  3AAQ A;  2IVP A;  4UQG A;  2P9K B;  3SBG A;  3CI5 A;  3L3U A;  5C24 A;  2Q3S A;  3NFA A;  1D8Y A;  3AVC A;  4DLG A;  3VEV A;  2G8K A;  4FWS A;  4CD3 A;  5HBM A;  3SQ4 A;  3DLG A;  3HST B;  3J7A P;  4WYB A;  3FE1 A;  1MA9 B;  2E8A A;  3T7Z A;  1U48 A;  3LPU A;  3S9H A;  1N8R O;  5AQF A;  3SMP A;  3QO9 A;  5J1E A;  3NMU A;  3RR8 A;  3KJV A;  3I33 A;  1WBD A;  4N5S A;  1KC8 O;  5JLF A;  2P9K A;  5M1O A;  1BDG A;  2A5X A;  2P5O A;  2FC0 A;  1U2V B;  4NLB A;  3ZX0 A;  3O3G A;  2VGM A;  2BUP A;  2VQE K;  3CME N;  2AP1 A;  1BCO A;  1GLE G;  3PO4 A;  5BPL A;  3EEQ A;  4FWN A;  3VQ8 A;  3G71 N;  3AY9 A;  4JEP A;  3RSE B;  5JIC A;  1HPM A;  5M1N A;  1HNX K;  5C42 A;  4N41 A;  4MO4 A;  2YHB A;  3VA0 A;  2XY5 A;  1GLC G;  4CJT A;  4CVN E;  4PKH A;  2D4W A;  4M7Y A;  3M8S A;  2HMP A;  1WSH A;  4FWL A;  5HRN A;  3GOI A;  2UXC K;  2GUP A;  1LWF A;  2DFE A;  3AO3 A;  4LH4 A;  3L0Q A;  3O4W A;  4FWK A;  4M42 A;  1DTT A;  3EZW A;  2ZQB A;  4OX9 K;  2QWL A;  3QML A;  4CGF A;  5AQQ A;  4LF5 K;  3SAG A;  4BRQ A;  4JNE A;  4WCE L;  4YNQ A;  4CEE A;  3MCA B;  1VSL A;  3H1V X;  3C65 A;  4YOY A;  4YDU A;  3CCE N;  2EHG A;  1WOQ A;  3LPT A;  4OLB A;  3T1H K;  1L3U A;  4JI5 K;  3VGL A;  4NXM K;  3H45 C;  3T1Y K;  5LL6 Z;  5E84 A;  1RDC A;  4DV6 K;  4YDU C;  3LAL A;  4KTQ A;  4W5R A;  2YNG A;  1X9W A;  1B92 A;  4NCG A;  3L4I A;  3K2P A;  3O5B A;  4CCH A;  3MEE A;  1UA0 A;  2A42 A;  2P9P B;  2Q2R A;  1VRT A;  3SI6 A;  1EWQ A;  3L2W A;  1TAQ A;  4AQY K;  2RN2 A;  4DR3 K;  1FW6 A;  1I94 K;  2VQF K;  4Y1C A;  1JKH A;  4FO0 A;  4JHD A;  3ZSX A;  4ID1 A;  3P31 A;  4CEZ A;  1IBM K;  4B9N A;  2VG5 A;  3MN5 A;  4KBO A;  2HW3 A;  2FSN A;  3T1A A;  1ATN A;  1UWB A;  4DV7 K;  1S6P A;  3SBT A;  4FJ5 A;  2PY5 A;  1JLQ A;  3BZK A;  1LW0 A;  3THV A;  3O1B A;  1HKB A;  3OYE A;  4EFH A;  3HOS A;  1VQ6 N;  4UY8 O;  1RDA A;  4JKB A;  3LAN A;  4CZJ A;  1SS6 A;  1XHX A;  4A2A A;  5BR9 A;  3F73 A;  3AVL A;  4BR2 A;  4BRL A;  4H0X B;  1U45 A;  4KI4 A;  3OW2 M;  1JJ2 M;  4QS8 A;  4GNI A;  4CGH A;  4CEQ A;  2Q97 A;  1B9F A;  4JK7 A;  3CCS N;  4KHU A;  4U67 L;  3FR0 A;  4OKE A;  1W97 L;  3O80 A;  1BIU A;  1JLB A;  3TSP A;  3VEN A;  4CEC A;  1XMO K;  3VEW A;  1JLF A;  3WNE A;  4JI0 K;  5GAH P;  4CBW A;  3HP6 A;  1LOT B;  4RTF D;  3JXU A;  4J2A A;  3G25 A;  4IFY A;  3BY5 A;  2XY6 A;  5AQU A;  2KQ2 A;  4L3Q A;  2KFN A;  2ZD1 A;  2E2P A;  4LFA K;  3ZSW A;  3WXJ A;  4DLE A;  2A1S A;  3NCI A;  3M6G A;  3C6H A;  3UB5 A;  3SQ0 A;  1L3S A;  1WSI A;  1D9D A;  2Y1J A;  2GX9 A;  1VQK N;  3TTF A;  4DR4 K;  3BUZ B;  1RT4 A;  3WXL A;  1RT3 A;  3UKR B;  4CJL A;  3DYA A;  4FWR A;  3HM9 A;  4XH4 A;  4WQ4 A;  2D0P A;  2NRX A;  5TKW A;  3KLF A;  4F2R A;  3EZ5 A;  4AH9 A;  1GOB A;  1N32 K;  3FZL A;  4FZX C;  1NU0 A;  1J53 A;  5FLX O;  3E9P A;  4O8K A;  3ATV A;  4WQ4 C;  4DF4 A;  3KWI A;  3HI0 A;  5MLC Q;  3DXK B;  3SPY A;  3RMB A;  3VQ7 A;  4AHS A;  4O8U A;  5BRH A;  1KQS M;  4AM6 A;  1DGK N;  3R6M A;  2HF4 A;  3K5M A;  1TUU A;  1OVQ A;  5FRN A;  3D0P A;  1K8K B;  1FJG K;  4CJV A;  4DUZ K;  4CZL A;  4FWM A;  4JI1 K;  2QWM A;  3KD5 E;  2NZT A;  4FM2 A;  2O8F B;  1BWF O;  4KTZ A;  2F8S A;  4JKF A;  4H0V B;  1IO2 A;  4O0J A;  4NXN K;  1BIS A;  4FJ8 A;  3NH2 A;  4BR4 A;  4LFB K;  4B08 A;  1YAG A;  1SUQ A;  1BIZ A;  4PA1 A;  4BQL A;  3TTD A;  2UU9 K;  1LAV A;  1K8K A;  4C8O A;  3VF4 A;  1JLA A;  5AQG A;  4F9O A;  3H6E A;  3I55 N;  1A5X A;  4LD0 A;  4CIG A;  1QQN A;  3KLI A;  2HHV A;  1T03 A;  1L5U A;  1VQ7 N;  5AQS A;  3KLE A;  1FXX A;  2P9L A;  3A0I X;  5FPE A;  4FWP A;  5KTQ A;  4M3X A;  3RTV A;  3DRR A;  1ZYQ A;  4I9L A;  3CQ8 A;  2B5J A;  4BQZ A;  4MLE A;  1HR0 K;  3BGR A;  4M3T A;  1NG9 A;  3CFP A;  4KPY A;  5BR8 K;  4DSK A;  4K0K K;  4FJ7 A;  3TI0 A;  3LP3 A;  1S6Q A;  3NF9 A;  5FPN A;  1NWK A;  5AQZ A;  4KI6 A;  4DR7 K;  4IEE A;  3VF6 A;  3KK3 A;  1JL2 A;  4CHN A;  3K5N A;  2NRV A;  1ASU A;  1IKV A;  4CJ4 A;  1Q7Y O;  1U49 A;  2HNY A;  1XHZ A;  3HBT A;  2GWK A;  3BF1 A;  4DR2 K;  3OYF A;  3H46 O;  3MXI A;  3KZB A;  2HNZ A;  3HSC A;  3LDS A;  4DU4 A;  4M41 A;  3PSF A;  3VES A;  5HL7 L;  3LZJ A;  1IBL K;  3ZET B;  3MX2 A;  1SV5 A;  4LC9 B;  3MDQ A;  3ID8 A;  4BVP A;  5AZI B;  3O8M A;  4OKK A;  2O8D B;  4JYA K;  3E9L A;  4IO9 L;  2CGL A;  3CFR A;  4M3U A;  3JYT A;  4CZF A;  1C1A A;  3SK3 A;  2ASM A;  4GV6 A;  1Q18 A;  4E7J A;  3GDQ A;  4JK8 A;  3C6A A;  3H1Q A;  4A62 A;  3TU5 A;  1VQ9 N;  1C0T A;  2G8H A;  1KTQ A;  2I7N A;  1RGI A;  5AZI A;  2F7T A;  4CHY A;  3R9P A;  3NDK A;  3OYI A;  1S72 N;  4F8R A;  4BRM A;  2A6A A;  2DY4 A;  3TAP A;  5C2D A;  3P38 A;  3LDO A;  3QIC A;  2GBZ A;  3OS0 A;  3NVK A;  3K5L A;  4K8Z A;  2BH1 A;  4ZHR A;  4IG0 A;  3ZSY A;  3PX4 A;  3KKR A;  2NUB A;  1NJW A;  1TV6 A;  2ZGZ A;  3ENH A;  4YY3 K;  3HYF A;  5SZT A;  3HRG A;  3SQ2 A;  3SNN A;  3NE6 A;  4GKJ K;  2P9S A;  4IFE A;  1VQ8 N;  1S9G A;  4ELT A;  1HKG A;  3P83 D;  1YIT N;  2G8I A;  4KFB A;  4MLH A;  4AHR A;  1YJN N;  4V19 S;  5JS2 A;  3OYK A;  3IDH A;  4M63 C;  4L8R B;  3WXK A;  4R5P A;  2V51 B;  3AGR A;  3A2F A;  4IJN A;  2YNH A;  5J2N A;  1BI4 A;  1N6Q A;  3D2F A;  4YOT A;  3S41 A;  3A8Y A;  1JXE A;  5IT9 O;  3WXI A;  3DOL A;  3FFK B;  4JI2 K;  4CI6 A;  4G9Z A;  3HK2 A;  5AQP A;  3WQU A;  5C10 A;  4O44 A;  4BRK A;  1NKC A;  2FBY A;  2RE2 A;  2P1J A;  2NNW A;  1U04 A;  4FK2 A;  2PAV A;  5CE3 A;  3D2E B;  5LY3 A; 
#chains in the Genus database with same CATH homology
 1IG9 A;  1ZBH A;  2ITG A;  3PO4 A;  1TK5 A;  4KAZ A;  4M45 A;  1NK9 A;  3VQ8 A;  1Y97 A;  3K59 A;  3OYH A;  1RBT A;  4OLA A;  1KVB A;  3KLG A;  1QQC A;  1U47 A;  3CG7 A;  1J54 A;  2O4G A;  4B8A B;  1FKP A;  4AHV A;  5C42 A;  4N41 A;  2XY5 A;  2YHB A;  2XHB A;  3VA0 A;  3RMA A;  4CJT A;  4PWD A;  1RT1 A;  1ZBI A;  4OPJ A;  3OS1 A;  2Z1G A;  3O3H A;  4IFV A;  3QNO A;  3M8S A;  3OJU A;  2P51 A;  1WSH A;  4AHT A;  1XC9 A;  2HHU A;  4OVL A;  1KLM A;  1JL1 A;  2XRI A;  5HRN A;  3AVH A;  4FM0 A;  2QXF A;  3S3N A;  2Z1I A;  2KFZ A;  1LWF A;  2DFE A;  3CM5 A;  3D45 A;  2W42 A;  3V1R A;  3AO3 A;  4IKF A;  4J2D A;  1WSJ A;  3HPG A;  4LH4 A;  4M42 A;  1L3T A;  1RBV A;  3AO4 A;  2OZS A;  1ZBU A;  1NJZ A;  1DTT A;  1QHT A;  3AO2 A;  3HVT A;  1WAJ A;  3C95 A;  2ZQB A;  4N56 A;  3NH1 A;  2OPQ A;  4CGF A;  4BDY A;  2EX3 A;  1Q9X A;  1WN7 A;  3KD1 E;  1RDD A;  3SV3 A;  1N5Y A;  1VSH A;  4FJH A;  3DMJ A;  3NH0 A;  3CYM A;  4CJU A;  5I42 A;  4YNQ A;  4DFP A;  4CEE A;  3OY9 A;  1S1T A;  1VSL A;  1WAF A;  3ASM A;  4CE9 A;  1ASW A;  1J9A A;  1KFD A;  3V4I A;  4N76 A;  2EHG A;  5HRO A;  3FFI A;  1CXQ A;  3LPT A;  3VA3 A;  4OLB A;  1CZB A;  4CEB A;  2ETJ A;  2YV0 X;  4DTS A;  1RBS A;  1KLN A;  1L3U A;  1ASV A;  4E3S A;  1Q8I A;  1W9H A;  4DSI A;  4FLZ A;  3SUN A;  4CJ5 A;  5KRS A;  5KGX A;  1REV A;  1BGX T;  1HYS A;  4CJW A;  1RDC A;  1DLO A;  4IDK A;  4J2B A;  1D9F A;  3LAL A;  4KTQ A;  4W5R A;  1RT5 A;  2YNG A;  3NF8 A;  3O4Q A;  1S1U A;  4E89 A;  1X9W A;  5K14 A;  1BL3 A;  1B92 A;  1CZ9 A;  4NCG A;  3K2P A;  4MQ3 A;  4E7K A;  4CCH A;  4FJK A;  1A5V A;  2IGI A;  4KHS A;  3MEE A;  1UA0 A;  3PX0 A;  1YTA A;  1VRT A;  3SI6 A;  3AA2 A;  3L2W A;  4HUF A;  3QES A;  1QE1 A;  1GOC A;  1TAQ A;  3SPZ A;  4KO0 A;  4JS4 A;  4F3O A;  2RN2 A;  1NJY A;  3HPO A;  3AV9 A;  1BI4 B;  1JKH A;  1LAW A;  4Y1C A;  4CJK A;  2FBT A;  2WON A;  3ZSX A;  4ID1 A;  4C8M A;  4CFA A;  4CEZ A;  3TAR A;  4J2E A;  2R7Y A;  4B9N A;  3TAQ A;  2VG5 A;  5FRO A;  2HW3 A;  4CFD A;  3T1A A;  1EET A;  1UWB A;  3VQP A;  2X6S A;  1S6P A;  3MXM A;  4FJ5 A;  2PY5 A;  1JLQ A;  1TK0 A;  1B9D A;  3RRH A;  1LW0 A;  3QEX A;  2Z1H A;  3L2U A;  3VQC A;  3EYZ A;  3THV A;  3NGY A;  4ID5 A;  1U4B A;  2HVH A;  4RG8 A;  3TR8 A;  1TKT A;  3VQD A;  3OS2 A;  1Q9Y A;  1KVC A;  3OYE A;  4CJS A;  4BE0 A;  2HHS A;  1RDA A;  1YTU A;  4HVJ A;  2BGG A;  3LAN A;  5CY4 A;  3V1O A;  1XHX A;  2GV9 A;  4BWJ A;  3F73 A;  1A5W A;  3QEW A;  3AVL A;  4FLV A;  2IC3 A;  1U45 A;  1C0U A;  4KI4 A;  2OPS A;  4DTJ A;  3AA3 A;  2RF2 A;  1LW2 A;  4M3W A;  4OKJ A;  3OYG A;  2ZE2 A;  2G8W A;  1HQE A;  1RBU A;  2VG7 A;  3ZSZ A;  4CED A;  4CGH A;  1KSP A;  4CEQ A;  4HUE A;  1EXQ A;  1B9F A;  4KHU A;  3IRX A;  1J5O A;  1S1X A;  4Q0B A;  4NYF A;  4OKE A;  3KK2 A;  1QS4 A;  1SL2 A;  4F3T A;  4CGJ A;  1X9M A;  2DFH A;  2YKN A;  1WNS A;  1S1V A;  1BIU A;  2XY7 A;  1SKW A;  1JLB A;  1WSE A;  4W5N A;  2JLE A;  3P1G A;  3KTQ A;  3L2Q A;  1IKW A;  3AVM A;  3DOK A;  4QAG A;  4CEC A;  1VK0 A;  2YNI A;  1JLE A;  3WNH A;  1JLF A;  1NKE A;  3WNE A;  4DU1 A;  4FJJ A;  4KHN A;  1HQU A;  4CJR A;  3K57 A;  2G8F A;  3HP6 A;  2KZM A;  3AVB A;  2OPR A;  4OPK A;  5JS1 A;  3ZSR A;  4DF8 A;  4J2A A;  3NGI A;  4BWM A;  4CF0 A;  3QET A;  1EKE A;  4IFY A;  1HYZ A;  3HL8 A;  2RKI A;  4H4M A;  1EP4 A;  2XO7 A;  2A1R A;  4FLY A;  3QER A;  1WLJ A;  3V9S A;  4FW2 A;  3TAM A;  4DQS A;  1GOA A;  3ZSO A;  3QEI A;  3U3Y A;  2KQ2 A;  2XY6 A;  3LAK A;  4DTN A;  2G8U A;  5FDL A;  3B6P A;  3I0S A;  2E6M A;  3DM2 A;  2ZD1 A;  3NBP A;  4C8N A;  2KFN A;  1VSD A;  4ZTF A;  3ZSW A;  3L3V A;  4DLE A;  2A1S A;  3NCI A;  3EY1 A;  1TVR A;  2BE2 A;  4CHO A;  2OPP A;  1HNV A;  1RBR A;  1ZBF A;  1HPZ A;  3SQ0 A;  1CLQ A;  3QEP A;  5CZ2 A;  1L3S A;  2HB5 A;  1WSI A;  3B6O A;  2B4J A;  3QIP A;  1RT7 A;  4KB1 A;  3U6F A;  3SV4 A;  1RTJ A;  1D9D A;  4DSL A;  4CHQ A;  2Y1J A;  1NK4 A;  4FJX A;  1RCH A;  3PY8 A;  4I9Q A;  4DSJ A;  3V1Q A;  4CHP A;  3KLH A;  4F4K A;  3ZSV A;  1RT4 A;  4E1N A;  2KW4 A;  4B9L A;  1RT3 A;  1S9E A;  1D5A A;  2JGU A;  3V6D A;  3SUO A;  3S3M A;  3HO1 A;  1IKY A;  3RMD A;  4DQP A;  4Z4G A;  4CJL A;  3DYA A;  4KKO A;  3NGZ A;  2RPI A;  3OYM A;  3HM9 A;  1C0M A;  4GW6 A;  4CFC A;  4M3R A;  5EU7 A;  3ZT4 A;  4FW1 A;  1KRP A;  3VQA A;  1ITG A;  3KLF A;  3PO5 A;  3EZ5 A;  3TAN A;  1I3A A;  4F2R A;  4AH9 A;  2FBX A;  3TWH A;  1GOB A;  2D0A A;  4OGE A;  2YNF A;  4CEF A;  4FJG A;  3AVA A;  4RW4 A;  4PUO A;  2X74 A;  4DG1 A;  4FZX C;  3SYZ A;  1J53 A;  1UA1 A;  1VSK A;  1K6Y A;  4GMJ B;  4E19 A;  3AA5 X;  4NYN A;  4DF4 A;  1TKX A;  3V9U A;  1TL3 A;  3HP9 A;  3SPY A;  4K8X A;  1JLC A;  3RMB A;  1KVA A;  3VQ7 A;  4AHS A;  5J2M A;  1SKR A;  4W5Q A;  1NJX A;  4FZY A;  4C8K A;  3K5M A;  3TAB A;  1JLG A;  3V9W A;  4C8L A;  3MEG A;  1I39 A;  3BDP A;  5FRN A;  3D0P A;  4RW7 A;  4DQR A;  4HUG A;  4CJV A;  2OA8 A;  4KRE A;  2HHQ A;  1HNI A;  4GVM A;  1HJR A;  4RW9 A;  4E0D A;  4DQQ A;  4YFU A;  1TKZ A;  1Z26 A;  1NKB A;  3KD5 E;  1IH7 A;  5T7B A;  4QOZ B;  2D0B A;  2B6A A;  1LWE A;  3ITH A;  4PQU A;  4FM2 A;  3IS9 A;  2ATQ A;  1VSF A;  4OGC A;  4XIU A;  2OYQ A;  2KTQ A;  4E7L A;  3DLK A;  3ZT2 A;  2E6L A;  3I8D A;  4KTZ A;  3T3F A;  2F8S A;  4CGI A;  4FYD A;  2VG6 A;  3AVI A;  5D3G A;  1IO2 A;  4O0J A;  3VQB A;  1T8E A;  4CHZ A;  1O1W A;  2D0C A;  2HMI A;  4TSX A;  1TGO A;  3HT3 A;  1BIS A;  4N47 A;  4CIF A;  4FJ8 A;  4EZ9 A;  1Z25 A;  3NH2 A;  4CGG A;  3G10 A;  5CYQ A;  3O4N A;  4B08 A;  4G1Q A;  3QIN A;  1SUQ A;  2IDO A;  1BIZ A;  4OJR A;  4PA1 A;  4CF8 A;  1RNH A;  4FJM A;  1LAV A;  1NJW A;  5DMR A;  3K58 A;  3I0R A;  2P5G A;  4C8O A;  3T19 A;  4FJL A;  1JLA A;  1XWL A;  4CJ3 A;  2HND A;  3PX6 A;  1QSY A;  1A5X A;  4LD0 A;  2HHT A;  3MEC A;  2YKM A;  3DI6 A;  3KLI A;  3WNG A;  4CIG A;  3P5J A;  1T03 A;  4W5T A;  4B9U A;  4NCB A;  2HHV A;  1L5U A;  3V9Z A;  3RR7 A;  1VSI A;  5DK5 A;  4CF1 A;  3KLE A;  3LWL A;  4ZTJ A;  1FXX A;  3ALY A;  5HRR A;  1KCF A;  3HXM A;  4CGD A;  5KTQ A;  2E4L A;  1RT2 A;  4Z4H A;  4M3X A;  4FCY A;  3MED A;  4NCA A;  4B9T A;  4DU3 A;  3RTV A;  3DRR A;  1ZYQ A;  1RTI A;  4I9L A;  4M3Z A;  2AJQ A;  2F96 A;  3AVN A;  5C25 A;  3CQ8 A;  4LSN A;  4CK2 A;  4HHT A;  2B5J A;  5I3U A;  3PUF A;  3VQQ A;  3AVK A;  3BGR A;  4LSL A;  3TAG A;  3L2V A;  4M3T A;  2IS3 A;  3M8P A;  3NF7 A;  1HMV A;  4DMN A;  4FM1 A;  1G15 A;  4RW8 A;  1FK9 A;  3CFP A;  4ELU A;  3SUQ A;  4KPY A;  3AVJ A;  5KI6 A;  4DSK A;  2PYJ A;  5SWM A;  1QSL A;  4FJ7 A;  3TI0 A;  3LP3 A;  4I7F A;  4JLH A;  1S6Q A;  3VQ5 A;  3NF9 A;  4FLW A;  1LV5 A;  4Z4I A;  3IAY A;  4CF9 A;  4KI6 A;  4CEA A;  1MU2 A;  5J2Q A;  4O5B A;  4DS4 A;  4DTX A;  3C94 A;  4BE1 A;  1HRH A;  3KK3 A;  1JL2 A;  4CHN A;  1NK8 A;  3K5N A;  3WNF A;  3LP2 A;  2IOC A;  1ASU A;  1IKV A;  4O55 A;  4JRP A;  4FVM A;  1RIL A;  4DQI A;  4AIL C;  3QIO A;  4EZ6 A;  4CJ4 A;  4DTR A;  4KRF A;  4Y1D A;  3OYL A;  3SCX A;  3SZ2 A;  4CJF A;  1U49 A;  2HNY A;  1ZBL A;  3HJF A;  1C1C A;  3V81 A;  2Y1I A;  1XHZ A;  1NK5 A;  3VQE A;  4EP4 A;  2G8V A;  4CFB A;  4B9M A;  3LZI A;  3OYF A;  3OJS A;  3MXI A;  4DTP A;  1UAX A;  1C1B A;  1RTH A;  3AO1 A;  2HNZ A;  4PY5 A;  4Z4F A;  3LDS A;  3IG1 A;  4DU4 A;  1W0H A;  1BCM A;  2D5R A;  4FJ9 A;  1S5J A;  1C6V A;  3RWU A;  3SJJ A;  4QCL A;  1R0A A;  4O4G A;  1FKO A;  4M41 A;  3JSM A;  3QNN A;  3SQ1 A;  2I5J A;  3LZJ A;  3ULD A;  3M8Q A;  4FJN A;  1BQM A;  1SV5 A;  3O3F A;  3LP0 A;  3RRG A;  4KV8 A;  4E1M A;  2IAJ A;  3HVR A;  4AHC A;  3OYC A;  2LSN A;  4OKK A;  4BDZ A;  2BDP A;  2PYL A;  5KGW A;  3KK1 A;  4DTM A;  1VSJ A;  3NF6 A;  4FXD A;  3LP1 A;  1S1W A;  4FLX A;  3QEV A;  2YHA A;  3CFR A;  1NK0 A;  4KHY A;  4F2S A;  2DTU A;  4M3U A;  3UIQ A;  3AVF A;  3JYT A;  4MFB A;  3U3G A;  4Z0U A;  1BQN A;  4DFM A;  1C1A A;  3AO5 A;  1UOC A;  3OYA A;  4B9V A;  3G0Z A;  3ZSQ A;  4FJI A;  4E7J A;  2QK9 A;  4CEO A;  1NK7 A;  5CZ1 A;  4CJE A;  4CK3 A;  2QKB A;  4CJQ A;  1NK6 A;  4EP5 A;  3DRS A;  3ISN C;  3V9X A;  4WE1 A;  2O4I A;  3VQ6 A;  1F21 A;  4DWI A;  1C0T A;  5HP1 A;  3VQ9 A;  3ZT3 A;  4I2Q A;  3TAF A;  3TAE A;  4DFK A;  1VRU A;  2G8H A;  3C6U A;  1KTQ A;  1X1P A;  4CHY A;  1SL1 A;  4Z4C A;  4I2P A;  3MAQ A;  3DLH A;  3NDK A;  1TL1 A;  2X6N A;  2GUI A;  4CER A;  2VWJ A;  4DSE A;  4HCC A;  2HVI A;  3MXJ A;  3OYI A;  4CJP A;  4F8R A;  4E7I A;  4CK1 A;  3DLB A;  1VSE A;  3F9K A;  4IG3 A;  1T05 A;  3C6T A;  3CFO A;  4CES A;  2DY4 A;  1SKS A;  4AHU A;  3S3O A;  3VQ4 A;  3TAP A;  1RDB A;  1VSM A;  4LY7 A;  5HRP A;  3L2R A;  2BAN A;  3CM6 A;  4B3O A;  2GBZ A;  3H08 A;  4DTU A;  1TKD A;  5FRM A;  3OS0 A;  1L3V A;  3DRP A;  4B8C A;  4BE2 A;  4H8K A;  2HHW A;  2DFF A;  1HYV A;  3LAM A;  4ICL A;  3K5L A;  4E7H A;  2Z1J A;  3OYB A;  4K8Z A;  4CIE A;  4ZHR A;  4IG0 A;  3ZSY A;  3PX4 A;  4Q5V A;  2NUB A;  3KKR A;  1CXU A;  1TV6 A;  1YT3 A;  2WOM A;  1EX4 A;  2FBV A;  2VWK A;  5HRS A;  4DFJ A;  3HYF A;  4ELV A;  3KKS A;  4Z4E A;  3ZT0 A;  3ZCM A;  5SZT A;  4HTU A;  1KFS A;  3SQ2 A;  3PV8 A;  3SNN A;  3NE6 A;  3DLR A;  4DTO A;  4HCB A;  3OYN A;  1S9G A;  4ELT A;  3L8B A;  3K5O A;  3P83 D;  4KHQ A;  2G8I A;  4O0I A;  2XY8 A;  3M8R A;  4KFB A;  1XI1 A;  1NOZ A;  4AHR A;  5KRT A;  2QKK A;  3E01 A;  1X9S A;  3RMC A;  4W5O A;  4CF2 A;  4BAC A;  1QTM A;  5J2P A;  4UQG A;  4M3Y A;  3NHG A;  1SL0 A;  4LH5 A;  1JXB A;  3OVN A;  3L3U A;  5C24 A;  2Q3S A;  3NFA A;  5JS2 A;  3OYK A;  1D8Y A;  3AVC A;  4DLG A;  1TK8 A;  2G8K A;  3NAE A;  4JRQ A;  4BDP A;  2X78 A;  1RTD A;  3AA4 A;  5HBM A;  3SQ4 A;  3DLG A;  1NOY A;  4L8R B;  3HST B;  4R5P A;  2OZM A;  1BHL A;  1WSG A;  4FLT A;  4KHW A;  2KZZ A;  4KTW A;  4DS5 A;  1U48 A;  3SUP A;  3A2F A;  2YNH A;  3LPU A;  5J2N A;  3S9H A;  1BI4 A;  5HLF A;  1N6Q A;  1TAU A;  3VN5 A;  1IKX A;  1JXE A;  3QO9 A;  5J1E A;  3ZT1 A;  1DTQ A;  3OYJ A;  3RR8 A;  3DOL A;  3KJV A;  1YVU A;  3OYD A;  4IBN A;  4JS5 A;  3HPH A;  4N5S A;  3QLH A;  5CYM A;  3HK2 A;  4H4O A;  5E41 A;  4FK4 A;  4DSF A;  2PZS A;  1LWC A;  1QSS A;  3DLE A;  4B9S A;  1RT6 A;  1WSF A;  4FLU A;  4FK0 A;  4O44 A;  3LWM A;  1NKC A;  2HHX A;  2P5O A;  2FC0 A;  2FBY A;  2P1J A;  3O3G A;  1U04 A;  4RW6 A;  4FK2 A;  1T7P A;  4FZZ A;  2F8T A;  3AVG A;  4KB0 A;  3KIO A;  1BCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...