1RBTA

Structural study of mutants of escherichia coli ribonuclease hi with enhanced thermostability
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADGKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural study of mutants of Escherichia coli ribonuclease HI with enhanced thermostability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE H
total genus 53
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rbtA00
3IAYA 3MEDA 3KK3A 3NBPA 3SCXA 3V1QA 4BE0A 2RN2A 2G8HA 2E6MA 3SV3A 3WNFA 4CIGA 3ZT2A 1QTMA 1ASWA 1L3TA 2KZMA 4PQUA 3VQQA 3NH2A 4EP4A 1S9EA 3KIOA 2WOMA 3O3HA 3TR8A 4NCGA 3OS0A 3OS2A 2VG6A 4IG0A 1WN7A 1JLAA 5CZ1A 3ZSXA 1NK0A 2G8IA 3OY9A 1EETA 1LW0A 1RT5A 1WSIA 1BI4B 1LWCA 3AO3A 3NH0A 4CJTA 4FJIA 1JL2A 4M3ZA 5HRSA 2HB5A 3B6OA 2D0CA 4FK2A 3SNNA 1Q9XA 5HLFA 3ISNC 4E0DA 3S3OA 3ZT3A 1RTDA 1RILA 4FLVA 3VQ6A 4CJ3A 2O4IA 3C6UA 4OKKA 2RKIA 2HMIA 3LP1A 2XO7A 3L2WA 1CZBA 5HRPA 4J2DA 3RWUA 1GOCA 3V9UA 3VQ4A 2DFFA 2XRIA 3AA5X 1YVUA 5DK5A 4LSNA 4BWMA 4CF2A 4DSEA 3AVFA 2OPPA 4E1NA 1VSJA 2ZQBA 1WSJA 4IDKA 2QK9A 1RT3A 4HUEA 5D3GA 2HHUA 2OZMA 4KHNA 2F8SA 4HVJA 1FKOA 3MXJA 1RT6A 3QO9A 4CEZA 3SPYA 4FJXA 3SZ2A 2X74A 3KKRA 4NYNA 1F21A 1S9GA 4CEQA 1JLBA 3A2FA 4M3UA 3ALYA 3AVAA 3QIOA 4RW6A 3AO1A 1SUQA 3EZ5A 4E89A 3OYKA 3QNNA 3ZT0A 1S5JA 1SKWA 1WSFA 1RDDA 3HPHA 3O3FA 1TKTA 4DMNA 3L2RA 4DG1A 1U4BA 2FC0A 4AHUA 1QSLA 1IG9A 3H08A 3V9XA 4B8AB 4ELTA 4C8LA 4BDYA 4CEDA 5KGWA 4GVMA 4FJLA 2KFNA 4FK0A 3O4NA 1JXEA 3K5MA 3AV9A 4F3OA 2G8FA 3QLHA 1KLMA 3HPGA 4CHNA 3SPZA 3L2QA 4DU4A 2HNDA 4JS4A 1WNSA 1ZYQA 3AVIA 3PX4A 3L2UA 1L3SA 1NOYA 2HHTA 2G8WA 2Y1IA 1RDBA 1RCHA 3HSTB 3P83D 4M3WA 3EYZA 4DTRA 3QNOA 4O0JA 4PA1A 3HP6A 3S3NA 3U3GA 4KRFA 3IS9A 3L3UA 3HPOA 3SV4A 1RTJA 3NGYA 4FJJA 3HL8A 4C8NA 4M3XA 4JRPA 1QSSA 2A1RA 1VSLA 3P5JA 3SQ2A 4KTZA 1L3VA 1Q9YA 3MEEA 1DTQA 1SL0A 3TABA 1JXBA 3HYFA 1RT4A 1W0HA 4F8RA 3PX0A 3NDKA 1WAJA 4LH4A 1TAUA 3QESA 3V9SA 1WLJA 4FXDA 3V6DA 1KTQA 3K57A 2HHSA 1C1BA 2VG5A 3V9WA 3S3MA 1X9MA 1B92A 5FROA 4CJ4A 4CF1A 1CXQA 4CK3A 3UIQA 4Q0BA 3VQ8A 1VSIA 1BCOA 1JLGA 4FJ7A 1HNVA 4W5RA 4DTJA 4NCBA 4CHYA 3RR7A 1JLQA 2P1JA 4LH5A 4CJRA 3DLGA 3OJUA 1ITGA 3TAFA 3TARA 4M42A 1I39A 1IKVA 1TVRA 1QS4A 3ZT4A 1IKYA 3WNHA 3RMBA 3ZSQA 4DLEA 3PO4A 4KV8A 1ASUA 3HVTA 4QCLA 4ID1A 2BANA 5KRSA 3T19A 2KW4A 4CF0A 3LWLA 4WE1A 4CJWA 3KLGA 1Z26A 4C8OA 4DFMA 4B9SA 4H4MA 3DOLA 4BDPA 3NF8A 1R0AA 4CEAA 3JSMA 3ZSOA 2JGUA 2ATQA 4GW6A 3K5LA 4FLXA 2HNYA 1SL2A 3KD1E 4EP5A 4HCCA 1X1PA 5J1EA 3QEIA 4F3TA 2NUBA 3AO5A 3SQ4A 1NK4A 4ELUA 4FM1A 2XY8A 1CLQA 4DS5A 3NF7A 1NK8A 3OYIA 2VWKA 3C94A 3LP0A 4CEFA 2FBXA 1RT1A 1NKEA 2ZE2A 4J2BA 4DU3A 4DSFA 1N5YA 4JRQA 2DFEA 4CJKA 4FCYA 1X9SA 1J9AA 4CE9A 1UA0A 3V1RA 4XIUA 4MQ3A 3QEPA 4B08A 4HTUA 1VSMA 3MXIA 5DMRA 1T03A 2LSNA 4J2EA 1A5XA 3TAGA 1T8EA 4RW4A 4O5BA 4Y1DA 4OJRA 1S6PA 3TAEA 3OJSA 3TANA 3LPTA 1XI1A 2IGIA 4FLZA 3CYMA 1C0MA 4FK4A 1IKXA 1KVAA 4AHSA 1BIUA 3RMDA 3K2PA 5I3UA 4FJNA 5KI6A 4KAZA 1A5VA 4O4GA 4CHQA 4HUFA 5HROA 4KI6A 1U04A 2D0AA 2OZSA 4DSKA 4Z4IA 1BQNA 1DTTA 4BACA 3VN5A 4PY5A 4CEOA 3EY1A 1N6QA 1RBTA 2IAJA 4RW7A 3ZSWA 5T7BA 3OYHA 1BCMA 4E7HA 4CJFA 4FM0A 5HRNA 3ZSZA 4IFVA 1SV5A 4I9QA 4IBNA 1RT7A 1UA1A 3D45A 3VQAA 2F96A 4AHTA 4KO0A 1NK9A 3AVMA 3JYTA 4I2QA 3DRRA 1NJYA 2YNHA 4CFAA 4E1MA 4FZYA 3CG7A 4I2PA 4YNQA 3V4IA 3IG1A 4CESA 2D5RA 3NCIA 3ULDA 1S1TA 3KK1A 1K6YA 4Z4CA 1U48A 4JS5A 4MFBA 3HK2A 3QIPA 4FJ8A 3VQDA 1TKXA 3QINA 5K14A 3U6FA 4Z4FA 1G15A 1U47A 4C8KA 3NGZA 1D8YA 2P5OA 2X6NA 3LDSA 4DTSA 1EKEA 3HO1A 4O0IA 3THVA 4O55A 2IS3A 1TK0A 2I5JA 2HHWA 1VSFA 3NH1A 4HUGA 2YHBA 4B9TA 4CEBA 4E7LA 4DFPA 3V81A 1KCFA 3CFOA 4HCBA 4DWIA 1FXXA 3LP2A 1HMVA 3AVBA 3VQ9A 3WNGA 1EX4A 3RRGA 2P5GA 1C0UA 4F2SA 3K58A 3VQ5A 4E19A 4E3SA 5J2NA 1HQUA 3AO2A 4BWJA 3QEXA 1XC9A 3M8SA 4KHQA 3LANA 3B6PA 1LAVA 4K8XA 3VA0A 2IOCA 2GV9A 3OYAA 4CF9A 1ZBFA 3ZSRA 4CIFA 5SWMA 4PUOA 3LP3A 4K8ZA 1RDAA 2OPQA 3K59A 3AVGA 4BE2A 2RF2A 4CFCA 4FLTA 1LWFA 3T1AA 1T7PA 4FJGA 3T3FA 3AVKA 4H8KA 2Z1IA 3V1OA 4CK2A 2R7YA 5FRMA 2F8TA 1TGOA 1QQCA 5KGXA 3KD5E 4DS4A 3DLKA 2W42A 3HP9A 3OYLA 3I0SA 3OYFA 4OPKA 4ZTJA 2XY7A 3VQEA 1ASVA 3AO4A 4CIEA 4DLGA 1NK7A 4B9UA 4LSLA 4W5QA 3AVLA 1NJZA 3VQCA 4DTXA 1U49A 1VRUA 3G10A 4N76A 1KFDA 2XHBA 1KLNA 4B9MA 4M3TA 3HM9A 1JLFA 3LALA 4CCHA 1XHZA 4RW8A 4EZ6A 2P51A 1C6VA 3DM2A 2XY5A 4IFYA 3FFIA 4W5OA 2B4JA 1XWLA 3RTVA 4FYDA 4AH9A 1FK9A 2Z1HA 3KKSA 4H4OA 2FBVA 1KVBA 3MAQA 4HHTA 4DQSA 3NE6A 4AHCA 3DRPA 1L5UA 2Q3SA 5JS1A 3AVCA 3AVHA 4CFBA 2ITGA 4OPJA 5C25A 4YFUA 1D9DA 3KTQA 4KB0A 2YNIA 4FW2A 2ETJA 1C0TA 4OGEA 3LZJA 4QAGA 1S1UA 1UOCA 3OYJA 4DTNA 2WONA 3PV8A 4FJKA 4E7JA 2DY4A 4UQGA 4W5NA 4TSXA 1TL1A 4AHRA 2YNGA 3NF6A 4M41A 4B9LA 1CXUA 4DSIA 4DSLA 3M8PA 1HRHA 1VSDA 5CYMA 2FBYA 4KHYA 1WAFA 3ZCMA 4B3OA 2YKMA 4NYFA 2RPIA 4OKJA 4DQQA 3BDPA 1KFSA 4B9VA 3TI0A 5EU7A 2B6AA 2PY5A 1Q8IA 2X6SA 3IRXA 4Z0UA 5CY4A 1WSHA 1HJRA 4KFBA 3WNEA 5J2MA 1W9HA 5J2PA 3LZIA 5CZ2A 1XHXA 4CJLA 4CHOA 3QETA 1VSHA 4OLAA 3OYMA 1DLOA 1S1WA 1TKZA 4CJEA 4FJMA 1S1VA 3OYDA 1NK5A 4OGCA 3KLHA 3SI6A 4FZXC 3DLEA 4W5TA 4CJPA 4FM2A 2B5JA 4DFKA 2EX3A 3SYZA 3DLHA 1YTUA 1ZBUA 2HHXA 4KB1A 1VSKA 3KLFA 4OVLA 3OYEA 3SJJA 1T05A 4I7FA 4CGDA 1LW2A 2FBTA 3OYCA 1JL1A 1REVA 1NK6A 3SUOA 3AVNA 1A5WA 4Q5VA 3PX6A 4RW9A 2YKNA 1HQEA 3QEVA 4DSJA 4FJ9A 3TAQA 2HVHA 3QERA 4CGIA 2YNFA 4R5PA 1RT2A 3AA2A 3O4QA 3LAMA 1B9FA 4G1QA 5CYQA 4OLBA 3HT3A 4NCAA 3L8BA 1TAQA 4CERA 2DTUA 3DYAA 1LWEA 1QHTA 5HP1A 4F4KA 4C8MA 1Y97A 3LWMA 3KK2A 2IDOA 1HYZA 1RTHA 3MEGA 1NOZA 2VWJA 3RMAA 1QE1A 3TAPA 2G8VA 3HJFA 1QSYA 4OKEA 3NHGA 3NF9A 2Z1GA 2X78A 3HVRA 3NGIA 1TV6A 2JLEA 1U45A 1NJXA 2OPRA 1J53A 1RTIA 3V9ZA 2QKKA 1BL3A 3KLIA 4GMJB 3L3VA 1SKRA 5HBMA 3TWHA 5HRRA 4FJHA 3S9HA 2EHGA 4AHVA 4Z4EA 4LD0A 1RBRA 1VK0A 1JLEA 4ZHRA 1HPZA 3O3GA 2YV0X 3LAKA 3I8DA 3DLRA 3I0RA 4KHWA 4AILC 1HNIA 1RBVA 3PY8A 2GUIA 5KRTA 4FW1A 2HW3A 4DTOA 3RMCA 1YT3A 4DTMA 4CF8A 4CGGA 1C1AA 5KTQA 1KVCA 4DTPA 3BGRA 1CZ9A 2E6LA 3VQ7A 3HXMA 1KSPA 1FKPA 4DTUA 4LY7A 2XY6A 3D0PA 2G8UA 4FJ5A 1C1CA 3PUFA 4DF8A 1MU2A 4KKOA 4J2AA 2HHVA 3K5OA 4FLYA 2OPSA 3OYGA 3U3YA 1BGXT 5C24A 4N41A 1EXQA 4DQIA 4BE1A 3M8RA 3SUQA 4B9NA 3SUNA 3DMJA 4DFJA 3G0ZA 1JKHA 4O44A 1HYVA 2PYJA 1IO2A 4Y1CA 4N56A 1UWBA 4CFDA 3NFAA 4RG8A 1NJWA 4FZZA 5SZTA 3SUPA 2GBZA 2HNZA 1RNHA 1IH7A 3C95A 2Z1JA 2IC3A 3VQPA 3CM6A 4M3YA 1D5AA 2PYLA 1EP4A 4IKFA 5E41A 1BI4A 4CGFA 1KRPA 2BGGA 3MECA 1ZBLA 4QOZB 3LPUA 3DLBA 3CQ8A 3VQBA 1TK8A 2DFHA 3DOKA 1GOBA 2KFZA 4ELVA 5J2QA 1S6QA 5FDLA 2O4GA 4L8RB 4E7KA 3DRSA 1VSEA 1WSEA 4CJUA 3CFPA 3AA4A 4DU1A 1J5OA 3PO5A 3OS1A 4DQPA 4N5SA 4CGHA 4FVMA 3MXMA 1YTAA 2YHAA 4B8CA 4CGJA 3SQ1A 1LV5A 3KLEA 1GOAA 3RR8A 4KHSA 1VRTA 2QXFA 2PZSA 1O1WA 2OYQA 2OA8A 3ZSYA 4FLWA 3OYNA 4CEEA 4DQRA 4Z4GA 1IKWA 4KTQA 1RBUA 1S1XA 1NKCA 3RRHA 4CK1A 1BIZA 1L3UA 4JLHA 1WSGA 4CJQA 3OVNA 3CFRA 4DF4A 3OYBA 1SL1A 1RDCA 1BQMA 2KTQA 3ZT1A 1BISA 3AVJA 4CHPA 4KI4A 3F73A 2D0BA 3SQ0A 3M8QA 1J54A 4ID5A 3F9KA 3NAEA 3ZSVA 1SKSA 1RBSA 2KQ2A 1NKBA 4FLUA 1TK5A 2Y1JA 3P1GA 4M45A 1D9FA 3L2VA 4CJVA 1TL3A 4EZ9A 3E01A 3ITHA 4I9LA 1ZBHA 4BDZA 1B9DA 1I3AA 2A1SA 1LAWA 4F2RA 4M3RA 1ZBIA 4CJ5A 3KJVA 4IG3A 2G8KA 1TKDA 4PWDA 4CECA 4ZTFA 2VG7A 1X9WA 4KHUA 2ZD1A 4KREA 4KTWA 5FRNA 1HYSA 2BDPA 3DI6A 4ICLA 3QEWA 3TAMA 3CM5A 5C42A 3K5NA 2BE2A 4Z4HA 5I42A 4CHZA 3C6TA 2E4LA 1JLCA 1UAXA 1BHLA 3AA3A 4N47A 5JS2A 3ASMA 2HVIA 2KZZA 1Z25A 4CJSA 3VA3A 2QKBA 4E7IA 4KPYA 2HHQA 2AJQA
chains in the Genus database with same CATH superfamily
3KK3A 3NBPA 4BE0A 3SV3A 4XH1A 1ILYA 4CIGA 4WQ4A 1QTMA 1ASWA 1L3TA 5AQFA 3VEOA 3VQQA 4PQUA 2KZMA 3KIOA 3J81O 1OH8A 3OS0A 3W0LA 3A0IX 4C1NI 2A40A 3OY9A 1RT5A 3AO3A 4M3ZA 1JL2A 4DV6K 2QWQA 3QBWA 3SNNA 1T44A 5HLFA 3ZX2A 3HRGA 1IJJA 3VETA 2YHYA 1RILA 3VQ6A 1XUPO 2EWSA 3L2WA 1IBLK 2Q97A 2DFFA 1XQSC 1IG8A 3HM8A 4CF2A 2OPPA 4E1NA 1HLUA 4IDKA 2HHUA 5ELZA 4BC4A 4HUEA 2OZMA 4KHNA 4HVJA 2HMPA 3VF6A 4CEZA 4FJXA 2X74A 4NYNA 1F21A 1S9GA 1JLBA 4M3UA 3F5TA 3EZ5A 3QIOA 4DV0K 4OO1J 3OYKA 5DM6L 1XNQK 3C6HA 3ZT0A 3I33A 1SKWA 5GAGP 1TKTA 5BPLA 4DG1A 2ZGYA 4LFBK 2PFUA 4B1WB 2F9TA 3OW2M 3K5MA 3SPZA 4DU4A 4JS4A 3ZETA 2F9WA 1NOYA 3FZFA 5GINA 2Y1IA 5BN8A 3P83D 4M3WA 3O9UA 4O0JA 2ZJRL 5EY4A 4KRFA 3IS9A 4M3XA 5AQYA 1VSLA 3P5JA 1Q9YA 4KTZA 3ULEB 3MEEA 1DTQA 3HYFA 3SJHA 1N34K 3CJBA 1Z05A 3ID6A 5ADXA 1WLJA 3V6DA 2E1YA 3V9WA 4IDHA 1B92A 1Z6RA 4CK3A 3VQ8A 1QHAA 1JLGA 4IFEA 4NCBA 1VQ9N 4CJRA 3TARA 1I39A 1QS4A 3ZT4A 5KQ8A 4DLEA 5KRSA 3T19A 1Z26A 4DFMA 4H4MA 1GLDG 4CEAA 3VESA 4FLXA 3SK3A 2UUBK 1KAZA 4HCCA 5J1EA 3AO5A 3H45C 4ELUA 4MDAA 4DS5A 2NRZA 4BVOA 3OYIA 2A6AA 3C94A 1NKEA 1N5YA 4DSFA 2DFEA 1MDUB 1CZAN 1VQON 4PKIA 4MQ3A 1VSMA 4H0YB 3MXIA 1A5XA 4RW4A 4G9ZA 1ATNA 3THWB 5AQKA 1ZBSA 3LDQA 4FLZA 3CYMA 2OCEA 4PL7A 4FK4A 4AHSA 3ZETB 4Z4IA 1BQNA 3U4LA 1Y64A 1RBTA 3SMSA 4CZJA 4B9QA 3NVKA 3KK7A 4FM0A 3ZSZA 3MN5A 3D45A 4IEEA 4AHTA 3DXKB 1BG3A 2VQEK 1NK9A 3JYTA 3SBTA 4O8UA 4E1MA 3ULDA 3NCIA 3U9ZA 4Z4CA 3DLLL 3WXMB 4MFBA 3HK2A 1S72N 1NGCA 3U6FA 1TKXA 3QINA 5FPMA 5K14A 4Z4FA 1G15A 1U47A 4DR7K 2P5OA 5KPTA 2X6NA 3CJCA 1EKEA 1X9JA 4LFAK 3QICA 4IO8A 4CEBA 4E7LA 4DFPA 3V81A 3R1XA 5AQPA 3HOSA 4EZ6A 3PSFA 1HMVA 3AVBA 2P5GA 3ATUA 3HZ6A 1HNWK 1C0UA 5AFUH 1NJIO 4QS7A 1HQUA 2QXLA 1XC9A 3O1BA 3A5OC 4YOVA 3ZSRA 2O8CB 1EQYA 3L4IA 4K8ZA 1RDAA 2OPQA 4BE2A 2VCPA 1LWFA 2CGKA 3T1AA 1T7PA 4FJGA 3ZYYX 3T3FA 3V1OA 2R7YA 4K41A 4O8KA 4JN4A 3CMAN 3VEYA 4CZGA 4HTLA 4WFAL 4OPKA 1VQLN 4CIEA 4W5QA 2WBNA 2BUPA 4HWIA 4JI4K 1VRUA 1NG9A 3WT0A 5BRHA 3LALA 1E4FT 3PIPL 2QWLA 4DV5K 3DM2A 5EVZA 4B1YB 4XH5A 4OPHA 4ILHA 1N33K 4GV6A 4PKHA 1FK9A 2W40A 4DHYA 4CVNE 5CR4A 4EHUA 4HHTA 4DQSA 3EEQA 1GLLO 4JHDB 3DRPA 5JS1A 3KTQA 4OPJA 1GLCG 3LZJA 3DXKA 3CCUN 5FRMA 4QAGA 4DTNA 2DY4A 3CF5L 2CH5A 4AHRA 4B9LA 4CZEA 1HRHA 4B3OA 4B9VA 3M6GA 4JKBA 3IRXA 3SAFA 4KFBA 4BRHA 5J2PA 5J2MA 3LZIA 3QB0A 1JJ2M 3LDOA 4CZHA 1VSHA 4OLAA 1DLOA 1TKZA 5M1QA 4OGCA 3KLHA 3SI6A 4FM2A 4CJPA 1HNZK 1ZBUA 2HHXA 4OVLA 4BG9A 5TKWA 3SJJA 1REVA 3MMVA 4Y0WA 3AVNA 1A5WA 4Q5VA 3PX6A 1HQEA 3AAQA 4FJ9A 3QERA 1ATRA 4FWRA 3LAMA 3HT3A 3DYAA 2VGMA 4F4KA 1VQPN 1OH7A 3LWMA 3EZWA 1RTHA 1NOZA 1QSYA 5AQUA 3NGIA 2X78A 2Z1GA 2JLEA 2OPRA 3HJFA 3KLIA 1SKRA 2W6KA 4Z4EA 4MLHA 4BRFA 3N4PA 3I8DA 2E8AA 4H0XB 1HKGA 4KHWA 4AILC 2D0PA 5GAEP 3VGLA 4B3RK 1YT3A 4DTMA 4CZLA 4JHDA 3RSEA 5M1KA 1KSPA 3A5LC 4OPAA 4FJ5A 3PUFA 4KKOA 5AFUA 2HHVA 3EKUA 4WFBL 4U67L 2OPSA 1U6ZA 1EXQA 5JVHL 3SUNA 2PYJA 4O44A 4Y1CA 4CI6A 4CFDA 3NFAA 4IO9L 2HNZA 3CM6A 1EP4A 4H0TB 1ZBLA 3LPUA 3DLBA 3CQ8A 5JLHA 2HF4A 1NGJA 3WQTA 3UKUB 4ELVA 3J7YP 1S6QA 4FWOA 4E7KA 4DR2K 3LDNA 1WSEA 4CJUA 3AA4A 2ZWHA 1WOQA 4FVMA 3BF3A 1NBWA 3E9PA 4BR9A 3KLEA 4IOXA 4KHSA 1BOTO 1NGEA 4BREA 4FLWA 3OYNA 1HR0K 4Z4GA 1IKWA 3THYA 3RRHA 2YX6A 4JAXA 3CQXA 4RTFD 4CJQA 3CCSN 3OYBA 1SL1A 1BQMA 4NLBA 1TYQB 4CHPA 4KI4A 2D0BA 2P9UA 3M8QA 3NVMA 3MX2A 2ZJPL 1NGGA 2Y1JA 4CBUA 4B3TK 1I3AA 2GTDA 4F2RA 4CJ5A 1SQKA 3HTVA 2BDPA 3CM5A 5C42A 1J6ZA 3K5NA 4CZMA 2UU9K 1NWKA 4K0KK 4N47A 1NGBA 4A2BA 1N8RO 4RWTA 3AY9A 3VA3A 2QKBA 4E7IA 4KPYA 2AJQA 3K0SA 4M7YA 2RN2A 2G8HA 3I8BA 3CMEN 4EP4A 1S9EA 4NCGA 4JI1K 1WN7A 2NNWA 4K43A 3EKSA 2G8IA 1LW0A 1LWCA 5ADXH 4FJIA 5AJ3K 3UE5A 3B6OA 2D0CA 5DM7L 4FK2A 2ZJQL 2O8DA 3T1YK 2V7YA 2HBJA 2YJEA 4H5WA 1CZBA 3F2KA 5HRPA 4YDUC 4I6MA 3RWUA 3V9UA 3AA5X 4LSNA 4XEIA 4H03B 2GWKA 4B1XB 3O08A 3O9QA 2ZQBA 1VHXA 4DQ8A 2F8SA 1FKOA 3SPYA 3SZ2A 3KKRA 3GG4A 2I7NA 3ALYA 2P9UB 4RW6A 2WTUA 1EWRA 5LMUK 3EO3A 2Q31A 1K8KA 2QI2A 1RDDA 3HPHA 4DMNA 3ENOA 3CC4N 4JKGA 4B8AB 4CEDA 2RHKA 5KGWA 4FJLA 3CPEA 3QLHA 4YHHK 4CHNA 3MN9A 1XMQK 3PX4A 3L2UA 5LJVA 2G8WA 1RDBA 1M1KO 1ESVA 3QNOA 3BEXA 3RVCA 3FGUA 4A5BA 4BVPA 3L3UA 4BRGA 3SV4A 1RTJA 4FJJA 4C8NA 3E66A 3UKRB 1QSSA 3JXUA 3SQ2A 1KAXA 1YXQA 2KLAA 4F8RA 3P4IA 3NDKA 3CJAA 5AQOA 2HHSA 2VG5A 4OX9K 3TSPA 1NMDA 2O8DB 4FJ7A 5HL7L 4NXNK 4LH5A 3DLGA 1IKVA 5IWAK 3ZSQA 3PO4A 4QCLA 1YJNN 3LWLA 4C8OA 1BWFO 3TTDA 4CJWA 3CIPA 3JAMO 3NF8A 1TUUA 2JGUA 4JYAK 2ATQA 3K5LA 3KD1E 1SL2A 1U2VB 5F0XA 3QEIA 5C2DA 4F3TA 2NUBA 4FWQA 3SQ4A 3CCMN 3NF7A 3DJCA 1NK8A 2VWKA 4JK9A 1RT1A 1EO1A 2ZE2A 1IBMK 4JNEA 1H1VA 2VWBA 4PL8A 4FWPA 4XIUA 3QEPA 5B8HA 1T8EA 1LOTB 3CI5A 4JKGB 4B1ZA 5AQIA 1C0MA 3G71N 2PBDA 1IKXA 4B1UB 1BIUA 5I3UA 4FJNA 4O4GA 2OZSA 3KWIA 3VN5A 3BY5A 3O4WA 2IAJA 3ZSWA 1BCMA 1P8ZA 2CGLA 4E7HA 3VERA 2HHHK 3HSCA 1N32K 4IBNA 1RT7A 4IJAA 2HBKA 3VQAA 2F96A 2Q0UA 3AVMA 3KWGA 3UKRA 2YNHA 4FZYA 3CG7A 4I2PA 1DGKN 1YUWA 2D5RA 3PLAA 3CETA 4M63C 1SAZA 3QIPA 4YOUA 5M1NA 3NGZA 1NGAA 4DTSA 4IEIA 1S22A 3HO1A 2Q0RA 4F9OA 1X3MA 1Q81O 2I5JA 2HHWA 3CCRN 2YHBA 4MO5A 4FWKA 1KCFA 3CFOA 5AZJB 2E2NA 1YHQN 4F2SA 3FLCO 1QZ6A 3K58A 3VQ5A 4LF9K 4AQYK 4E3SA 5J2NA 4X64K 1YAGA 3AO2A 4BWJA 3QEXA 5FPEA 3M8SA 4KHQA 1RFQA 3B6PA 4K8XA 5BRDA 2Q2RA 3CCEN 3OYAA 5AQJA 4KBOA 5BPMA 1U2VA 3AVGA 4CFCA 2Z1IA 4LF7K 5EOYA 1TGOA 3DLKA 3I0SA 3U9DA 3O1WA 1NK7A 2NRHA 3AVLA 1NJZA 3VQCA 2QTDA 3G10A 5AQVA 1KFDA 4M3TA 3N4QA 3L0QA 5KPRA 4H5RA 5TKYA 1XHZA 2IIRA 3ULEA 2XY5A 4A62A 3TTFA 4IFYA 3FFIA 4W5OA 2B4JA 4FYDA 2FSJA 4A57A 4H4OA 2FBVA 1KVBA 5LL6Z 3MAQA 4R79A 2QEXN 1VQKN 1D9DA 5C25A 2ETJA 2G8UA 1S1UA 1UOCA 2AP1A 5AQXA 4GV9A 2ZGZA 4TSXA 1TL1A 3ZX0A 4YOXA 3THXB 4DSLA 4CZKA 2FBYA 3ZCMA 5C12A 2RPIA 4OKJA 2QWRA 2O8BB 1KFSA 2B6AA 2PY5A 1Q8IA 4DR6K 4BR2A 1MA9B 3IDHA 4KH4A 4CJLA 4CHOA 4Z94A 5AZJA 3OYMA 1S1WA 4FJMA 1I94K 1S1VA 3OYDA 1D4XA 4FZXC 3DLEA 1YTUA 4DFKA 2EX3A 5BN9A 3GOIA 4KB1A 3OTOK 5E84A 4BR5A 1NGIA 4C1NK 3SUOA 1NK6A 4RW9A 2YJFA 3QEVA 2HVHA 4IZ9A 3DWLA 3AA2A 3O80A 4G1QA 1BU6O 4BQLA 1LWEA 1QHTA 1E4GT 2NRVA 3FR0A 3MEGA 3TAPA 5BRFA 3HVRA 4DB3A 4JD2A 3RR7A 3L3VA 5HBMA 3TWHA 5HRRA 2UUCK 2YI1A 4LD0A 4MLEA 2E2OA 5AQTA 1HPZA 4DV4K 2D4WA 3SAHA 3I0RA 3PY8A 5KRTA 4E1JA 4FW1A 4DTOA 1QVFM 2UXCK 5KTQA 1C1AA 3FE1A 1KVCA 4DTPA 2E6LA 1FKPA 4LY7A 4DV3K 2WUSA 5C24A 3E9OA 4DQIA 3THXA 4WQ4C 4DFJA 4N56A 4WF9L 2O8BA 1GLEG 2GBZA 1FJGK 3D7EO 2I7PA 2Z1JA 4M3YA 1OVYA 1D5AA 1BI4A 1KRPA 4DCHA 4YORA 3WEEA 3VQBA 1DEJA 1TK8A 1GOBA 2HOEA 4LF5K 3P39A 4L8RB 2OTJN 1VSEA 4DU1A 1J5OA 1T3VA 3QMLA 3OS1A 4LF6K 2CGJA 5HOOA 1LV5A 3RR8A 2QXFA 2PZSA 1O1WA 2OYQA 4CEEA 4DQRA 2P9SA 1RBUA 3MX5A 1MWMA 2V7ZA 1NKCA 4JEPA 1V4TA 4BQZA 3ZT1A 1BISA 3AVJA 3F73A 3SQ0A 1J54A 3NAEA 3ZSVA 2KQ2A 4FLUA 3H46O 3EN9A 4EZ9A 5IT9O 3E01A 3WQUA 2A1SA 4M3RA 4IG3A 4H5TA 1WB9A 4ISEA 4CECA 2VG7A 4KHUA 4KTWA 5FRNA 3PIOL 4AF1A 1SS6A 2HSTA 2F4VK 5GIPA 5C10A 3J7AP 4Z4HA 1NLVA 1MWKA 2E4LA 1JLCA 4LF8K 2HVIA 2A5XA 4BR0A 3IAYA 3CQYA 3V1QA 3WNFA 4YOTA 1OVQA 3ZT2A 3G25A 3NH2A 2WOMA 3L6QA 4BRPA 4H5NA 3ID8A 3TR8A 3OS2A 2W6LA 5CZ1A 1HNXK 3AGKA 2P9NB 4A61A 1BI4B 3NH0A 3CC7N 5HRSA 3CC2N 4X66K 5F2RA 1Q9XA 3ZEUA 1G99A 3ISNC 1BO5O 4WQ5C 5AQSA 3ZT3A 4PHTX 3TPQA 3S3OA 4KH6A 2E1ZA 3S41A 4A2AA 4BRKA 2RKIA 2XO7A 5MLCQ 4J2DA 1GOCA 3VQ4A 3M3ZA 3WXJA 2XRIA 5DK5A 4BWMA 2IVPA 1WSJA 4CJ7A 4JI6K 4FOEA 3NMUA 3MXJA 3QO9A 2HBMA 3A2FA 5LY3A 3AVAA 2IVNA 1SUQA 4E89A 3QNNA 3W3DA 1WSFA 3L2RA 3RSEB 1U4BA 2FC0A 4AHUA 1C0GA 2E5LK 1IG9A 4YOWA 3V9XA 3D2FA 4GVMA 4CD3A 3O4NA 1JXEA 1BDGA 3AV9A 3D2EB 2G8FA 3HPGA 4CBWA 1WNSA 4O5FA 1RCHA 3HSTB 4H0PA 3EYZA 4PA1A 3HP6A 2QA4N 3HPOA 3HL8A 3QFUA 3UKUA 2A1RA 1L3VA 3IMXA 3PSIA 4WFNL 1JXBA 1RT4A 1W0HA 3A8YA 1YJWN 1TAUA 3QESA 2DPNA 2P9NA 4ILJA 5FROA 4CF1A 2FSNA 1VSIA 3QFPA 3ZEUB 4W5RA 4BR7A 4CW7B 2P1JA 5CHIA 2P9KB 4M42A 1ITGA 3TAFA 5BPNA 5JVGL 1KD1O 1JCGA 3JS6A 2ITMA 1TYQA 4KV8A 1ASUA 3HVTA 3AAPA 4CF0A 2KW4A 2DTUA 4WE1A 3KLGA 4JI0K 1YITN 2P9IA 3JSMA 3ZSOA 1ATSA 1WUAA 2HNYA 4EP5A 2UYTA 4FM1A 5KQDA 4GNIA 2Q36A 3IFRA 3LP0A 4XH4A 4J2BA 4DU3A 4CJKA 4FCYA 4CE9A 1Q7YO 1NNEA 3TAGA 4Y1DA 4OJRA 3EE8A 1S6PA 3D2FB 3M5RA 3OJSA 3LPTA 4ISGA 4BRMA 3D2EA 3VTHA 4LFCK 5M1PA 1KVAA 3RMDA 5AQHA 4CHQA 4YY3K 2D0AA 1DTTA 4BACA 3EY1A 4RW7A 5T7BA 1QVGM 2F7TA 4CJFA 5HRNA 4EIAA 1UA1A 5LMNK 4K25A 1BA0A 4KO0A 3A5MC 3DRRA 2P9PB 4CFAA 5AQLA 4YNQA 1NGFA 3V4IA 3FZKA 1K6YA 1U48A 3MCAB 5AQWA 4C8KA 4YDUA 1D8YA 1WBDA 1JCFA 4O55A 2IS3A 2QWMA 5EX5A 4B3MK 4HUGA 3NH1A 3GDQA 4B9TA 2P9KA 1QQMA 4DWIA 3LP2A 4BRCA 3RRGA 3VQ9A 1QQNA 4BRLA 3TTCA 5E26A 2P9IB 4BRIA 3MWTA 3VA0A 2IOCA 2VGNA 4CIFA 5SWMA 4PUOA 3TSQA 2HF3A 3LP3A 2RF2A 3AVKA 4H8KA 4EHTA 4A5AA 2QM1A 3DXMA 3KD5E 3MN7A 4ZTJA 3OYLA 3OYFA 2P9LB 2XY7A 3VQEA 4ILGB 3AO4A 3CERA 3F9MA 4B9UA 4LSLA 4DUYK 3CCLN 1U49A 2CH6A 1DT9A 4B9MA 5BR8K 3ENBA 4JI5K 1JLFA 3R9PA 4RW8A 1W2BM 2P51A 1C6VA 3VF4A 1Q18A 1VAZA 2D1KA 4H0VB 1XWLA 2H3GX 3RTVA 4QS8A 3CPWM 2QWOA 2Z1HA 3KKSA 3NE6A 2Q3SA 4GKKK 3WXKA 4CFBA 2ITGA 4YFUA 2YNIA 4FW2A 4JI2K 4OGEA 4GY2B 3PV8A 2QW9A 4FJKA 3OYJA 5GIOA 4QS9A 2P9PA 4UQGA 3FZLA 3H6EA 3LDPA 5JLFA 3R3LA 3NF6A 4BY9C 3J7ZO 4DSIA 3KVGA 4KHYA 1VSDA 4GV3A 4NYFA 3LDLA 2O8FB 3TI0A 2X6SA 4Z0UA 5CY4A 1HJRA 3WNEA 2ASPA 4IJNA 3SLCA 1XHXA 3QETA 2D0OA 5C2FA 1HKCA 1NK5A 4WYBA 1GLFO 3DLHA 4DR1K 3SYZA 1KXPA 1VSKA 3KLFA 3OYEA 5M1OA 2W41A 1T05A 1LW2A 1X3NA 2FBTA 1JL1A 4BC3A 1W97L 4FWLA 4FWSA 3C6AA 2YKNA 2YHXA 3TAQA 2V51B 1VQ8N 1RT2A 3O4QA 4NCAA 1TAQA 1R59O 2UXDK 2YHWA 4C8MA 1Y97A 2BH1A 1OKJA 4JKCA 1IV0A 1HYZA 2P9LA 4U7BA 4OKEA 3NF9A 1JCEA 2KHOA 3LL3A 1TV6A 1BL3A 2FSKA 4IOCL 4FJHA 4AHVA 3TU5A 3CCJN 3WXIA 1KC8O 4LC9B 1RBRA 1VK0A 1JLEA 4ZHRA 3O8MA 3O3GA 2YV0X 3LAKA 1RBVA 2V52B 2HW3A 4DV2K 3RMCA 4CGGA 2GUPA 2FLOA 3VQ7A 5GADP 2XY6A 3O9SA 3D0PA 1C1CA 3VEZA 4DF8A 1MU2A 3H1QA 4FLYA 3OYGA 4BC5A 1BGXT 3M8RA 4B9NA 1YVNA 1VQ7N 3DMJA 3K9KA 3G0ZA 1JKHA 1HYVA 3VENA 3Q7CA 2FF6A 1NJWA 3CJ7A 5SZTA 2O8FA 1IH7A 3C95A 2IC3A 2BGGA 4JKDA 4V19S 3DOKA 2GELA 2AA4A 5FDLA 2UUAK 2O4GA 5I9EB 4DQPA 3CFPA 2A3ZA 3E1YA 3BP8A 5H1SQ 4N5SA 3MXMA 1YTAA 4B8CA 4RCHA 3SQ1A 1GOAA 1VRTA 4BR4A 2E2PA 2OA8A 3ZSYA 4CBXA 2QWNA 4DR3K 1S1XA 3T7ZA 1BIZA 1L3UA 3C0BA 1J5EK 3ATVA 3CFRA 5JICA 4FWMA 1T6CA 2GX9A 3AGRA 3F9KA 5AQZA 1NKBA 1TK5A 1D9FA 4M45A 4CJVA 3AARA 3ITHA 2ZM6K 5BREA 4BDZA 1B9DA 1LAWA 1ZBIA 1ZC6A 3KJVA 4PKGA 2NRWA 5A2QO 1YF5L 5KPZA 3T69A 2BTFA 4X65K 3DI6A 3QEWA 5FPNA 5GAHP 2WC9A 5I42A 4CHZA 2VYPA 3LM2A 1BHLA 3ASMA 5AQGA 2KZZA 2YCHA 3VMFB 3THWA 2HHQA 4JI8K 3MEDA 4KHPK 3SCXA 4YOYA 3VPZA 2E6MA 5LJWA 1FW6A 3P38A 3O3HA 2VG6A 4IG0A 1JLAA 3ZSXA 1NK0A 1EETA 3R6MA 4MDBA 3CCQN 1WSIA 4CJTA 3C7NA 2HB5A 4FPAA 4BROA 4BRNA 4E0DA 1RTDA 4FLVA 3KHYA 4CJ3A 3I55N 2O4IA 3C6UA 4OKKA 2HMIA 3LP1A 3O6WA 3Q7BA 3MK6A 1RGIA 1RDWX 2ASOA 4JK7A 4JD2B 1YVUA 4NLCA 2A41A 2NRTA 4DSEA 3AVFA 2PAVA 3ZLJA 1VSJA 2QK9A 1RT3A 5D3GA 3BZKA 1RT6A 4WCEL 2NRRA 4CEQA 3AO1A 4H0OA 1S5JA 3MN6A 5AQNA 3WXLA 3P31A 3O3FA 1S3XA 4IWVA 1QZ5A 1QSLA 5EXWA 3BUZB 3H08A 4GKJK 2O8CA 4ELTA 4C8LA 4BDYA 2KFNA 4FK0A 4F3OA 1KLMA 3L2QA 1NMNA 2HNDA 1ZYQA 2O8EA 3AVIA 3KZBA 1L3SA 2HHTA 3EL2A 3K9JA 1KQSM 4DTRA 4FOIA 3S3NA 3U3GA 4BRAA 3WEEB 3NGYA 4B1VA 4JRPA 1K73O 1SL0A 4C23A 4FSVA 3TABA 3PX0A 3LM9A 1WAJA 4LH4A 4FXDA 3V9SA 1KTQA 1NGHA 4WQ5A 3VEXA 3K57A 1C1BA 3S3MA 4JKHA 3C7NB 1X9MA 1VQMN 1IBKK 1VQ4N 4CJ4A 1CXQA 3VTIA 1TUYA 2P9SB 3UIQA 4Q0BA 1BCOA 1HNVA 4DTJA 4CHYA 1BA1A 1JLQA 4IXCA 3OJUA 2E2QA 2RE2A 1TVRA 1IKYA 3WNHA 3RMBA 5AQMA 3OA9A 4H5VA 4ID1A 2BANA 5J2QA 3VGMA 4JKEA 4B9SA 3DOLA 4BDPA 1R0AA 2VQFK 1HX1A 4K42A 4BGBA 1DKGD 4GW6A 4DR4K 1X1PA 1NK4A 4CZFA 1CLQA 2XY8A 1HKBA 4DV7K 4CEFA 2FBXA 5C15A 1XC3A 1N36K 4JRQA 1NM1A 1X9SA 1J9AA 1UA0A 3V1RA 4B08A 4HTUA 5DMRA 1T03A 2LSNA 4J2EA 4O5BA 3J80O 3TAEA 2FF3B 3TANA 3FZHA 4MO4A 1M90O 3QDKA 1XI1A 3L4QA 2IGIA 3I56N 3K2PA 2O8EB 5KI6A 4KAZA 1A5VA 5HROA 4KI6A 4HUFA 1U04A 4DSKA 2JWKA 4NO7A 4PY5A 4CEOA 1N6QA 3OYHA 3H3NO 4IFVA 1SV5A 4I9QA 3HBTA 2E88A 4DUZK 4I2QA 1NJYA 1WBBA 3IG1A 4CESA 1HUXA 1S1TA 3KK1A 4EFHA 1Q82O 4JS5A 4FJ8A 3VQDA 3CCVN 1ZXOA 3OBWA 3LDSA 4O0IA 3VF2A 3THVA 1TK0A 1VSFA 4JKAA 4FL9A 3SMPA 3G6EN 4HCBA 1FXXA 3WNGA 1EX4A 4FVUA 4A59A 4E19A 2A42A 1RDUA 3LANA 1LAVA 2GV9A 1KAYA 4LF4K 3BZCA 3MCPA 4CF9A 4JI7K 1C0FA 1ZBFA 1E3MA 4B3SK 4BRQA 3K59A 4FLTA 4M7XA 1LCUA 5BR9A 4CK2A 2F8TA 1GLBG 4J8FA 2OANA 1QQCA 5KGXA 4DS4A 1YJ9N 2W42A 3HP9A 3R8EA 1ASVA 4DLGA 4JI3K 1P90A 3O9TA 3M1FA 4DTXA 3J8AA 2QWPA 1QQOA 3SBGA 4N76A 2XHBA 1KLNA 3THYB 3CXCM 3HM9A 3EE9A 4CCHA 5AQRA 3QBXA 2ASMA 1XNRK 3SAGA 1K9MO 4AH9A 4DV1K 4FO0A 4BGAA 3OHRA 4AHCA 1L5UA 3AVCA 3AVHA 4KB0A 2IVOA 2NZTA 4JK8A 2KFZA 1C0TA 3GBTA 4AM7A 2WONA 4E7JA 4W5NA 3O9RA 2YNGA 4M41A 1CXUA 4GVEA 1W7AA 3M8PA 5CYMA 1WAFA 2YKMA 3D6RA 1XMOK 2JWLA 4DQQA 1Q86O 3BDPA 2NRXA 5EU7A 1WSHA 2GEMA 5F1XA 1W9HA 4UY8O 5CZ2A 2ZF5O 3C65A 4CJEA 3MWPA 5AZIB 3VEVA 1OH6A 4W5TA 2B5JA 3GE1A 2NLXA 4I7FA 4CGDA 3OYCA 3GL1A 2Q1NA 3ZX3A 4DSJA 1NGDA 3WUHA 4BRDA 4CGIA 4L3QA 2YNFA 4R5PA 3IKMA 3UB5A 4OLBA 1B9FA 5CYQA 4DR5K 3H3OB 3L8BA 3DAWA 4CERA 3MDQA 3E9LA 5HP1A 3KK2A 2IDOA 2VWJA 3RMAA 1T6DA 4NB4A 1QE1A 2G8VA 4I6MB 1GLAG 3NHGA 3BF1A 4JKFA 3FFKB 1U45A 1NJXA 2HBLA 3CJ1A 1J53A 1RTIA 3V9ZA 2QKKA 4GMJB 4JV5K 5CE3A 3S9HA 2EHGA 1VQ5N 1HJOA 3DLRA 3OBYA 1NU0A 1HNIA 2GUIA 3H1VX 3CJ9A 1OH5A 1YIJN 4CF8A 1K8KB 3BGRA 1CZ9A 2E20A 3HXMA 2WFBA 4DTUA 4X62K 4J2AA 5M1FA 3HI0A 3K5OA 5AR0A 3U3YA 3O5BA 1VQNN 4N41A 4BE1A 3SUQA 5C0YA 1K8AO 1IO2A 1UWBA 4DKWA 4RG8A 3VGKA 1BUPA 4FZZA 3FZMA 3SUPA 1RNHA 3VQPA 3IUCA 5FLXO 2PYLA 4IKFA 5E41A 4CGFA 2J4RA 4QOZB 3A5NC 3MECA 4NXMK 1VQ6N 3U8XA 2DFHA 5AZIA 3CD6N 3TSUA 4EAHD 4ISFA 3DRSA 3G4SN 2UXBK 3PO5A 3DXMB 4CGHA 2GWJA 1HPMA 4IOAL 2YHAA 4CGJA 3HOTA 2OTLN 4FWNA 3VOVA 3CHWA 4KTQA 1GLJO 1O13A 4CK1A 5FPDA 1EWQA 4JLHA 1WSGA 3OVNA 4DF4A 3B8AX 3T1HK 1RDCA 2KTQA 4BG8A 3ENHA 4ID5A 4CZIA 1SKSA 1RBSA 4KH5A 3P1GA 3L2VA 1TL3A 1ZBHA 4I9LA 5AQQA 1YI2N 2KKZA 2G8KA 1TKDA 4PWDA 4ZTFA 4AM6A 1X9WA 1V4SA 4FPBA 2ZD1A 4KREA 1SZ2A 1HYSA 2FXUA 4ICLA 3TAMA 3VEWA 4BC2A 2BE2A 5JMVA 3C6TA 1UAXA 3AA3A 4CD1A 5JS2A 1Z25A 4CJSA
chains in the Genus database with same CATH topology
3IAYA 3MEDA 3KK3A 3NBPA 3SCXA 3V1QA 4BE0A 2RN2A 2G8HA 2E6MA 3SV3A 3WNFA 4CIGA 3ZT2A 1QTMA 1ASWA 1L3TA 2KZMA 4PQUA 3VQQA 3NH2A 4EP4A 1S9EA 3KIOA 2WOMA 3O3HA 3TR8A 4NCGA 3OS0A 3OS2A 2VG6A 4IG0A 1WN7A 1JLAA 5CZ1A 3ZSXA 1NK0A 2G8IA 3OY9A 1EETA 1LW0A 1RT5A 1WSIA 1BI4B 1LWCA 3AO3A 3NH0A 4CJTA 4FJIA 1JL2A 4M3ZA 5HRSA 2HB5A 3B6OA 2D0CA 4FK2A 3SNNA 1Q9XA 5HLFA 3ISNC 4E0DA 3S3OA 3ZT3A 1RTDA 1RILA 4FLVA 3VQ6A 4CJ3A 2O4IA 3C6UA 4OKKA 2RKIA 2HMIA 3LP1A 2XO7A 3L2WA 1CZBA 5HRPA 4J2DA 3RWUA 1GOCA 3V9UA 3VQ4A 2DFFA 2XRIA 3AA5X 1YVUA 5DK5A 4LSNA 4BWMA 4CF2A 4DSEA 3AVFA 2OPPA 4E1NA 1VSJA 2ZQBA 1WSJA 4IDKA 2QK9A 1RT3A 4HUEA 5D3GA 2HHUA 2OZMA 4KHNA 2F8SA 4HVJA 1FKOA 3MXJA 1RT6A 3QO9A 4CEZA 3SPYA 4FJXA 3SZ2A 2X74A 3KKRA 4NYNA 1F21A 1S9GA 4CEQA 1JLBA 3A2FA 4M3UA 3ALYA 3AVAA 3QIOA 4RW6A 3AO1A 1SUQA 3EZ5A 4E89A 3OYKA 3QNNA 3ZT0A 1S5JA 1SKWA 1WSFA 1RDDA 3HPHA 3O3FA 1TKTA 4DMNA 3L2RA 4DG1A 1U4BA 2FC0A 4AHUA 1QSLA 1IG9A 3H08A 3V9XA 4B8AB 4ELTA 4C8LA 4BDYA 4CEDA 5KGWA 4GVMA 4FJLA 2KFNA 4FK0A 3O4NA 1JXEA 3K5MA 3AV9A 4F3OA 2G8FA 3QLHA 1KLMA 3HPGA 4CHNA 3SPZA 3L2QA 4DU4A 2HNDA 4JS4A 1WNSA 1ZYQA 3AVIA 3PX4A 3L2UA 1L3SA 1NOYA 2HHTA 2G8WA 2Y1IA 1RDBA 1RCHA 3HSTB 3P83D 4M3WA 3EYZA 4DTRA 3QNOA 4O0JA 4PA1A 3HP6A 3S3NA 3U3GA 4KRFA 3IS9A 3L3UA 3HPOA 3SV4A 1RTJA 3NGYA 4FJJA 3HL8A 4C8NA 4M3XA 4JRPA 1QSSA 2A1RA 1VSLA 3P5JA 3SQ2A 4KTZA 1L3VA 1Q9YA 3MEEA 1DTQA 1SL0A 3TABA 1JXBA 3HYFA 1RT4A 1W0HA 4F8RA 3PX0A 3NDKA 1WAJA 4LH4A 1TAUA 3QESA 3V9SA 1WLJA 4FXDA 3V6DA 1KTQA 3K57A 2HHSA 1C1BA 2VG5A 3V9WA 3S3MA 1X9MA 1B92A 5FROA 4CJ4A 4CF1A 1CXQA 4CK3A 3UIQA 4Q0BA 3VQ8A 1VSIA 1BCOA 1JLGA 4FJ7A 1HNVA 4W5RA 4DTJA 4NCBA 4CHYA 3RR7A 1JLQA 2P1JA 4LH5A 4CJRA 3DLGA 3OJUA 1ITGA 3TAFA 3TARA 4M42A 1I39A 1IKVA 1TVRA 1QS4A 3ZT4A 1IKYA 3WNHA 3RMBA 3ZSQA 4DLEA 3PO4A 4KV8A 1ASUA 3HVTA 4QCLA 4ID1A 2BANA 5KRSA 3T19A 2KW4A 4CF0A 3LWLA 4WE1A 4CJWA 3KLGA 1Z26A 4C8OA 4DFMA 4B9SA 4H4MA 3DOLA 4BDPA 3NF8A 1R0AA 4CEAA 3JSMA 3ZSOA 2JGUA 2ATQA 4GW6A 3K5LA 4FLXA 2HNYA 1SL2A 3KD1E 4EP5A 4HCCA 1X1PA 5J1EA 3QEIA 4F3TA 2NUBA 3AO5A 3SQ4A 1NK4A 4ELUA 4FM1A 2XY8A 1CLQA 4DS5A 3NF7A 1NK8A 3OYIA 2VWKA 3C94A 3LP0A 4CEFA 2FBXA 1RT1A 1NKEA 2ZE2A 4J2BA 4DU3A 4DSFA 1N5YA 4JRQA 2DFEA 4CJKA 4FCYA 1X9SA 1J9AA 4CE9A 1UA0A 3V1RA 4XIUA 4MQ3A 3QEPA 4B08A 4HTUA 1VSMA 3MXIA 5DMRA 1T03A 2LSNA 4J2EA 1A5XA 3TAGA 1T8EA 4RW4A 4O5BA 4Y1DA 4OJRA 1S6PA 3TAEA 3OJSA 3TANA 3LPTA 1XI1A 2IGIA 4FLZA 3CYMA 1C0MA 4FK4A 1IKXA 1KVAA 4AHSA 1BIUA 3RMDA 3K2PA 5I3UA 4FJNA 5KI6A 4KAZA 1A5VA 4O4GA 4CHQA 4HUFA 5HROA 4KI6A 1U04A 2D0AA 2OZSA 4DSKA 4Z4IA 1BQNA 1DTTA 4BACA 3VN5A 4PY5A 4CEOA 3EY1A 1N6QA 1RBTA 2IAJA 4RW7A 3ZSWA 5T7BA 3OYHA 1BCMA 4E7HA 4CJFA 4FM0A 5HRNA 3ZSZA 4IFVA 1SV5A 4I9QA 4IBNA 1RT7A 1UA1A 3D45A 3VQAA 2F96A 4AHTA 4KO0A 1NK9A 3AVMA 3JYTA 4I2QA 3DRRA 1NJYA 2YNHA 4CFAA 4E1MA 4FZYA 3CG7A 4I2PA 4YNQA 3V4IA 3IG1A 4CESA 2D5RA 3NCIA 3ULDA 1S1TA 3KK1A 1K6YA 4Z4CA 1U48A 4JS5A 4MFBA 3HK2A 3QIPA 4FJ8A 3VQDA 1TKXA 3QINA 5K14A 3U6FA 4Z4FA 1G15A 1U47A 4C8KA 3NGZA 1D8YA 2P5OA 2X6NA 3LDSA 4DTSA 1EKEA 3HO1A 4O0IA 3THVA 4O55A 2IS3A 1TK0A 2I5JA 2HHWA 1VSFA 3NH1A 4HUGA 2YHBA 4B9TA 4CEBA 4E7LA 4DFPA 3V81A 1KCFA 3CFOA 4HCBA 4DWIA 1FXXA 3LP2A 1HMVA 3AVBA 3VQ9A 3WNGA 1EX4A 3RRGA 2P5GA 1C0UA 4F2SA 3K58A 3VQ5A 4E19A 4E3SA 5J2NA 1HQUA 3AO2A 4BWJA 3QEXA 1XC9A 3M8SA 4KHQA 3LANA 3B6PA 1LAVA 4K8XA 3VA0A 2IOCA 2GV9A 3OYAA 4CF9A 1ZBFA 3ZSRA 4CIFA 5SWMA 4PUOA 3LP3A 4K8ZA 1RDAA 2OPQA 3K59A 3AVGA 4BE2A 2RF2A 4CFCA 4FLTA 1LWFA 3T1AA 1T7PA 4FJGA 3T3FA 3AVKA 4H8KA 2Z1IA 3V1OA 4CK2A 2R7YA 5FRMA 2F8TA 1TGOA 1QQCA 5KGXA 3KD5E 4DS4A 3DLKA 2W42A 3HP9A 3OYLA 3I0SA 3OYFA 4OPKA 4ZTJA 2XY7A 3VQEA 1ASVA 3AO4A 4CIEA 4DLGA 1NK7A 4B9UA 4LSLA 4W5QA 3AVLA 1NJZA 3VQCA 4DTXA 1U49A 1VRUA 3G10A 4N76A 1KFDA 2XHBA 1KLNA 4B9MA 4M3TA 3HM9A 1JLFA 3LALA 4CCHA 1XHZA 4RW8A 4EZ6A 2P51A 1C6VA 3DM2A 2XY5A 4IFYA 3FFIA 4W5OA 2B4JA 1XWLA 3RTVA 4FYDA 4AH9A 1FK9A 2Z1HA 3KKSA 4H4OA 2FBVA 1KVBA 3MAQA 4HHTA 4DQSA 3NE6A 4AHCA 3DRPA 1L5UA 2Q3SA 5JS1A 3AVCA 3AVHA 4CFBA 2ITGA 4OPJA 5C25A 4YFUA 1D9DA 3KTQA 4KB0A 2YNIA 4FW2A 2ETJA 1C0TA 4OGEA 3LZJA 4QAGA 1S1UA 1UOCA 3OYJA 4DTNA 2WONA 3PV8A 4FJKA 4E7JA 2DY4A 4UQGA 4W5NA 4TSXA 1TL1A 4AHRA 2YNGA 3NF6A 4M41A 4B9LA 1CXUA 4DSIA 4DSLA 3M8PA 1HRHA 1VSDA 5CYMA 2FBYA 4KHYA 1WAFA 3ZCMA 4B3OA 2YKMA 4NYFA 2RPIA 4OKJA 4DQQA 3BDPA 1KFSA 4B9VA 3TI0A 5EU7A 2B6AA 2PY5A 1Q8IA 2X6SA 3IRXA 4Z0UA 5CY4A 1WSHA 1HJRA 4KFBA 3WNEA 5J2MA 1W9HA 5J2PA 3LZIA 5CZ2A 1XHXA 4CJLA 4CHOA 3QETA 1VSHA 4OLAA 3OYMA 1DLOA 1S1WA 1TKZA 4CJEA 4FJMA 1S1VA 3OYDA 1NK5A 4OGCA 3KLHA 3SI6A 4FZXC 3DLEA 4W5TA 4CJPA 4FM2A 2B5JA 4DFKA 2EX3A 3SYZA 3DLHA 1YTUA 1ZBUA 2HHXA 4KB1A 1VSKA 3KLFA 4OVLA 3OYEA 3SJJA 1T05A 4I7FA 4CGDA 1LW2A 2FBTA 3OYCA 1JL1A 1REVA 1NK6A 3SUOA 3AVNA 1A5WA 4Q5VA 3PX6A 4RW9A 2YKNA 1HQEA 3QEVA 4DSJA 4FJ9A 3TAQA 2HVHA 3QERA 4CGIA 2YNFA 4R5PA 1RT2A 3AA2A 3O4QA 3LAMA 1B9FA 4G1QA 5CYQA 4OLBA 3HT3A 4NCAA 3L8BA 1TAQA 4CERA 2DTUA 3DYAA 1LWEA 1QHTA 5HP1A 4F4KA 4C8MA 1Y97A 3LWMA 3KK2A 2IDOA 1HYZA 1RTHA 3MEGA 1NOZA 2VWJA 3RMAA 1QE1A 3TAPA 2G8VA 3HJFA 1QSYA 4OKEA 3NHGA 3NF9A 2Z1GA 2X78A 3HVRA 3NGIA 1TV6A 2JLEA 1U45A 1NJXA 2OPRA 1J53A 1RTIA 3V9ZA 2QKKA 1BL3A 3KLIA 4GMJB 3L3VA 1SKRA 5HBMA 3TWHA 5HRRA 4FJHA 3S9HA 2EHGA 4AHVA 4Z4EA 4LD0A 1RBRA 1VK0A 1JLEA 4ZHRA 1HPZA 3O3GA 2YV0X 3LAKA 3I8DA 3DLRA 3I0RA 4KHWA 4AILC 1HNIA 1RBVA 3PY8A 2GUIA 5KRTA 4FW1A 2HW3A 4DTOA 3RMCA 1YT3A 4DTMA 4CF8A 4CGGA 1C1AA 5KTQA 1KVCA 4DTPA 3BGRA 1CZ9A 2E6LA 3VQ7A 3HXMA 1KSPA 1FKPA 4DTUA 4LY7A 2XY6A 3D0PA 2G8UA 4FJ5A 1C1CA 3PUFA 4DF8A 1MU2A 4KKOA 4J2AA 2HHVA 3K5OA 4FLYA 2OPSA 3OYGA 3U3YA 1BGXT 5C24A 4N41A 1EXQA 4DQIA 4BE1A 3M8RA 3SUQA 4B9NA 3SUNA 3DMJA 4DFJA 3G0ZA 1JKHA 4O44A 1HYVA 2PYJA 1IO2A 4Y1CA 4N56A 1UWBA 4CFDA 3NFAA 4RG8A 1NJWA 4FZZA 5SZTA 3SUPA 2GBZA 2HNZA 1RNHA 1IH7A 3C95A 2Z1JA 2IC3A 3VQPA 3CM6A 4M3YA 1D5AA 2PYLA 1EP4A 4IKFA 5E41A 1BI4A 4CGFA 1KRPA 2BGGA 3MECA 1ZBLA 4QOZB 3LPUA 3DLBA 3CQ8A 3VQBA 1TK8A 2DFHA 3DOKA 1GOBA 2KFZA 4ELVA 5J2QA 1S6QA 5FDLA 2O4GA 4L8RB 4E7KA 3DRSA 1VSEA 1WSEA 4CJUA 3CFPA 3AA4A 4DU1A 1J5OA 3PO5A 3OS1A 4DQPA 4N5SA 4CGHA 4FVMA 3MXMA 1YTAA 2YHAA 4B8CA 4CGJA 3SQ1A 1LV5A 3KLEA 1GOAA 3RR8A 4KHSA 1VRTA 2QXFA 2PZSA 1O1WA 2OYQA 2OA8A 3ZSYA 4FLWA 3OYNA 4CEEA 4DQRA 4Z4GA 1IKWA 4KTQA 1RBUA 1S1XA 1NKCA 3RRHA 4CK1A 1BIZA 1L3UA 4JLHA 1WSGA 4CJQA 3OVNA 3CFRA 4DF4A 3OYBA 1SL1A 1RDCA 1BQMA 2KTQA 3ZT1A 1BISA 3AVJA 4CHPA 4KI4A 3F73A 2D0BA 3SQ0A 3M8QA 1J54A 4ID5A 3F9KA 3NAEA 3ZSVA 1SKSA 1RBSA 2KQ2A 1NKBA 4FLUA 1TK5A 2Y1JA 3P1GA 4M45A 1D9FA 3L2VA 4CJVA 1TL3A 4EZ9A 3E01A 3ITHA 4I9LA 1ZBHA 4BDZA 1B9DA 1I3AA 2A1SA 1LAWA 4F2RA 4M3RA 1ZBIA 4CJ5A 3KJVA 4IG3A 2G8KA 1TKDA 4PWDA 4CECA 4ZTFA 2VG7A 1X9WA 4KHUA 2ZD1A 4KREA 4KTWA 5FRNA 1HYSA 2BDPA 3DI6A 4ICLA 3QEWA 3TAMA 3CM5A 5C42A 3K5NA 2BE2A 4Z4HA 5I42A 4CHZA 3C6TA 2E4LA 1JLCA 1UAXA 1BHLA 3AA3A 4N47A 5JS2A 3ASMA 2HVIA 2KZZA 1Z25A 4CJSA 3VA3A 2QKBA 4E7IA 4KPYA 2HHQA 2AJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IAY A;  3MED A;  3KK3 A;  3NBP A;  3SCX A;  3V1Q A;  4BE0 A;  2RN2 A;  2G8H A;  2E6M A;  3SV3 A;  3WNF A;  4CIG A;  3ZT2 A;  1QTM A;  1ASW A;  1L3T A;  2KZM A;  4PQU A;  3VQQ A;  3NH2 A;  4EP4 A;  1S9E A;  3KIO A;  2WOM A;  3O3H A;  3TR8 A;  4NCG A;  3OS0 A;  3OS2 A;  2VG6 A;  4IG0 A;  1WN7 A;  1JLA A;  5CZ1 A;  3ZSX A;  1NK0 A;  2G8I A;  3OY9 A;  1EET A;  1LW0 A;  1RT5 A;  1WSI A;  1BI4 B;  1LWC A;  3AO3 A;  3NH0 A;  4CJT A;  4FJI A;  1JL2 A;  4M3Z A;  5HRS A;  2HB5 A;  3B6O A;  2D0C A;  4FK2 A;  3SNN A;  1Q9X A;  5HLF A;  3ISN C;  4E0D A;  3S3O A;  3ZT3 A;  1RTD A;  1RIL A;  4FLV A;  3VQ6 A;  4CJ3 A;  2O4I A;  3C6U A;  4OKK A;  2RKI A;  2HMI A;  3LP1 A;  2XO7 A;  3L2W A;  1CZB A;  5HRP A;  4J2D A;  3RWU A;  1GOC A;  3V9U A;  3VQ4 A;  2DFF A;  2XRI A;  3AA5 X;  1YVU A;  5DK5 A;  4LSN A;  4BWM A;  4CF2 A;  4DSE A;  3AVF A;  2OPP A;  4E1N A;  1VSJ A;  2ZQB A;  1WSJ A;  4IDK A;  2QK9 A;  1RT3 A;  4HUE A;  5D3G A;  2HHU A;  2OZM A;  4KHN A;  2F8S A;  4HVJ A;  1FKO A;  3MXJ A;  1RT6 A;  3QO9 A;  4CEZ A;  3SPY A;  4FJX A;  3SZ2 A;  2X74 A;  3KKR A;  4NYN A;  1F21 A;  1S9G A;  4CEQ A;  1JLB A;  3A2F A;  4M3U A;  3ALY A;  3AVA A;  3QIO A;  4RW6 A;  3AO1 A;  1SUQ A;  3EZ5 A;  4E89 A;  3OYK A;  3QNN A;  3ZT0 A;  1S5J A;  1SKW A;  1WSF A;  1RDD A;  3HPH A;  3O3F A;  1TKT A;  4DMN A;  3L2R A;  4DG1 A;  1U4B A;  2FC0 A;  4AHU A;  1QSL A;  1IG9 A;  3H08 A;  3V9X A;  4B8A B;  4ELT A;  4C8L A;  4BDY A;  4CED A;  5KGW A;  4GVM A;  4FJL A;  2KFN A;  4FK0 A;  3O4N A;  1JXE A;  3K5M A;  3AV9 A;  4F3O A;  2G8F A;  3QLH A;  1KLM A;  3HPG A;  4CHN A;  3SPZ A;  3L2Q A;  4DU4 A;  2HND A;  4JS4 A;  1WNS A;  1ZYQ A;  3AVI A;  3PX4 A;  3L2U A;  1L3S A;  1NOY A;  2HHT A;  2G8W A;  2Y1I A;  1RDB A;  1RCH A;  3HST B;  3P83 D;  4M3W A;  3EYZ A;  4DTR A;  3QNO A;  4O0J A;  4PA1 A;  3HP6 A;  3S3N A;  3U3G A;  4KRF A;  3IS9 A;  3L3U A;  3HPO A;  3SV4 A;  1RTJ A;  3NGY A;  4FJJ A;  3HL8 A;  4C8N A;  4M3X A;  4JRP A;  1QSS A;  2A1R A;  1VSL A;  3P5J A;  3SQ2 A;  4KTZ A;  1L3V A;  1Q9Y A;  3MEE A;  1DTQ A;  1SL0 A;  3TAB A;  1JXB A;  3HYF A;  1RT4 A;  1W0H A;  4F8R A;  3PX0 A;  3NDK A;  1WAJ A;  4LH4 A;  1TAU A;  3QES A;  3V9S A;  1WLJ A;  4FXD A;  3V6D A;  1KTQ A;  3K57 A;  2HHS A;  1C1B A;  2VG5 A;  3V9W A;  3S3M A;  1X9M A;  1B92 A;  5FRO A;  4CJ4 A;  4CF1 A;  1CXQ A;  4CK3 A;  3UIQ A;  4Q0B A;  3VQ8 A;  1VSI A;  1BCO A;  1JLG A;  4FJ7 A;  1HNV A;  4W5R A;  4DTJ A;  4NCB A;  4CHY A;  3RR7 A;  1JLQ A;  2P1J A;  4LH5 A;  4CJR A;  3DLG A;  3OJU A;  1ITG A;  3TAF A;  3TAR A;  4M42 A;  1I39 A;  1IKV A;  1TVR A;  1QS4 A;  3ZT4 A;  1IKY A;  3WNH A;  3RMB A;  3ZSQ A;  4DLE A;  3PO4 A;  4KV8 A;  1ASU A;  3HVT A;  4QCL A;  4ID1 A;  2BAN A;  5KRS A;  3T19 A;  2KW4 A;  4CF0 A;  3LWL A;  4WE1 A;  4CJW A;  3KLG A;  1Z26 A;  4C8O A;  4DFM A;  4B9S A;  4H4M A;  3DOL A;  4BDP A;  3NF8 A;  1R0A A;  4CEA A;  3JSM A;  3ZSO A;  2JGU A;  2ATQ A;  4GW6 A;  3K5L A;  4FLX A;  2HNY A;  1SL2 A;  3KD1 E;  4EP5 A;  4HCC A;  1X1P A;  5J1E A;  3QEI A;  4F3T A;  2NUB A;  3AO5 A;  3SQ4 A;  1NK4 A;  4ELU A;  4FM1 A;  2XY8 A;  1CLQ A;  4DS5 A;  3NF7 A;  1NK8 A;  3OYI A;  2VWK A;  3C94 A;  3LP0 A;  4CEF A;  2FBX A;  1RT1 A;  1NKE A;  2ZE2 A;  4J2B A;  4DU3 A;  4DSF A;  1N5Y A;  4JRQ A;  2DFE A;  4CJK A;  4FCY A;  1X9S A;  1J9A A;  4CE9 A;  1UA0 A;  3V1R A;  4XIU A;  4MQ3 A;  3QEP A;  4B08 A;  4HTU A;  1VSM A;  3MXI A;  5DMR A;  1T03 A;  2LSN A;  4J2E A;  1A5X A;  3TAG A;  1T8E A;  4RW4 A;  4O5B A;  4Y1D A;  4OJR A;  1S6P A;  3TAE A;  3OJS A;  3TAN A;  3LPT A;  1XI1 A;  2IGI A;  4FLZ A;  3CYM A;  1C0M A;  4FK4 A;  1IKX A;  1KVA A;  4AHS A;  1BIU A;  3RMD A;  3K2P A;  5I3U A;  4FJN A;  5KI6 A;  4KAZ A;  1A5V A;  4O4G A;  4CHQ A;  4HUF A;  5HRO A;  4KI6 A;  1U04 A;  2D0A A;  2OZS A;  4DSK A;  4Z4I A;  1BQN A;  1DTT A;  4BAC A;  3VN5 A;  4PY5 A;  4CEO A;  3EY1 A;  1N6Q A;  1RBT A;  2IAJ A;  4RW7 A;  3ZSW A;  5T7B A;  3OYH A;  1BCM A;  4E7H A;  4CJF A;  4FM0 A;  5HRN A;  3ZSZ A;  4IFV A;  1SV5 A;  4I9Q A;  4IBN A;  1RT7 A;  1UA1 A;  3D45 A;  3VQA A;  2F96 A;  4AHT A;  4KO0 A;  1NK9 A;  3AVM A;  3JYT A;  4I2Q A;  3DRR A;  1NJY A;  2YNH A;  4CFA A;  4E1M A;  4FZY A;  3CG7 A;  4I2P A;  4YNQ A;  3V4I A;  3IG1 A;  4CES A;  2D5R A;  3NCI A;  3ULD A;  1S1T A;  3KK1 A;  1K6Y A;  4Z4C A;  1U48 A;  4JS5 A;  4MFB A;  3HK2 A;  3QIP A;  4FJ8 A;  3VQD A;  1TKX A;  3QIN A;  5K14 A;  3U6F A;  4Z4F A;  1G15 A;  1U47 A;  4C8K A;  3NGZ A;  1D8Y A;  2P5O A;  2X6N A;  3LDS A;  4DTS A;  1EKE A;  3HO1 A;  4O0I A;  3THV A;  4O55 A;  2IS3 A;  1TK0 A;  2I5J A;  2HHW A;  1VSF A;  3NH1 A;  4HUG A;  2YHB A;  4B9T A;  4CEB A;  4E7L A;  4DFP A;  3V81 A;  1KCF A;  3CFO A;  4HCB A;  4DWI A;  1FXX A;  3LP2 A;  1HMV A;  3AVB A;  3VQ9 A;  3WNG A;  1EX4 A;  3RRG A;  2P5G A;  1C0U A;  4F2S A;  3K58 A;  3VQ5 A;  4E19 A;  4E3S A;  5J2N A;  1HQU A;  3AO2 A;  4BWJ A;  3QEX A;  1XC9 A;  3M8S A;  4KHQ A;  3LAN A;  3B6P A;  1LAV A;  4K8X A;  3VA0 A;  2IOC A;  2GV9 A;  3OYA A;  4CF9 A;  1ZBF A;  3ZSR A;  4CIF A;  5SWM A;  4PUO A;  3LP3 A;  4K8Z A;  1RDA A;  2OPQ A;  3K59 A;  3AVG A;  4BE2 A;  2RF2 A;  4CFC A;  4FLT A;  1LWF A;  3T1A A;  1T7P A;  4FJG A;  3T3F A;  3AVK A;  4H8K A;  2Z1I A;  3V1O A;  4CK2 A;  2R7Y A;  5FRM A;  2F8T A;  1TGO A;  1QQC A;  5KGX A;  3KD5 E;  4DS4 A;  3DLK A;  2W42 A;  3HP9 A;  3OYL A;  3I0S A;  3OYF A;  4OPK A;  4ZTJ A;  2XY7 A;  3VQE A;  1ASV A;  3AO4 A;  4CIE A;  4DLG A;  1NK7 A;  4B9U A;  4LSL A;  4W5Q A;  3AVL A;  1NJZ A;  3VQC A;  4DTX A;  1U49 A;  1VRU A;  3G10 A;  4N76 A;  1KFD A;  2XHB A;  1KLN A;  4B9M A;  4M3T A;  3HM9 A;  1JLF A;  3LAL A;  4CCH A;  1XHZ A;  4RW8 A;  4EZ6 A;  2P51 A;  1C6V A;  3DM2 A;  2XY5 A;  4IFY A;  3FFI A;  4W5O A;  2B4J A;  1XWL A;  3RTV A;  4FYD A;  4AH9 A;  1FK9 A;  2Z1H A;  3KKS A;  4H4O A;  2FBV A;  1KVB A;  3MAQ A;  4HHT A;  4DQS A;  3NE6 A;  4AHC A;  3DRP A;  1L5U A;  2Q3S A;  5JS1 A;  3AVC A;  3AVH A;  4CFB A;  2ITG A;  4OPJ A;  5C25 A;  4YFU A;  1D9D A;  3KTQ A;  4KB0 A;  2YNI A;  4FW2 A;  2ETJ A;  1C0T A;  4OGE A;  3LZJ A;  4QAG A;  1S1U A;  1UOC A;  3OYJ A;  4DTN A;  2WON A;  3PV8 A;  4FJK A;  4E7J A;  2DY4 A;  4UQG A;  4W5N A;  4TSX A;  1TL1 A;  4AHR A;  2YNG A;  3NF6 A;  4M41 A;  4B9L A;  1CXU A;  4DSI A;  4DSL A;  3M8P A;  1HRH A;  1VSD A;  5CYM A;  2FBY A;  4KHY A;  1WAF A;  3ZCM A;  4B3O A;  2YKM A;  4NYF A;  2RPI A;  4OKJ A;  4DQQ A;  3BDP A;  1KFS A;  4B9V A;  3TI0 A;  5EU7 A;  2B6A A;  2PY5 A;  1Q8I A;  2X6S A;  3IRX A;  4Z0U A;  5CY4 A;  1WSH A;  1HJR A;  4KFB A;  3WNE A;  5J2M A;  1W9H A;  5J2P A;  3LZI A;  5CZ2 A;  1XHX A;  4CJL A;  4CHO A;  3QET A;  1VSH A;  4OLA A;  3OYM A;  1DLO A;  1S1W A;  1TKZ A;  4CJE A;  4FJM A;  1S1V A;  3OYD A;  1NK5 A;  4OGC A;  3KLH A;  3SI6 A;  4FZX C;  3DLE A;  4W5T A;  4CJP A;  4FM2 A;  2B5J A;  4DFK A;  2EX3 A;  3SYZ A;  3DLH A;  1YTU A;  1ZBU A;  2HHX A;  4KB1 A;  1VSK A;  3KLF A;  4OVL A;  3OYE A;  3SJJ A;  1T05 A;  4I7F A;  4CGD A;  1LW2 A;  2FBT A;  3OYC A;  1JL1 A;  1REV A;  1NK6 A;  3SUO A;  3AVN A;  1A5W A;  4Q5V A;  3PX6 A;  4RW9 A;  2YKN A;  1HQE A;  3QEV A;  4DSJ A;  4FJ9 A;  3TAQ A;  2HVH A;  3QER A;  4CGI A;  2YNF A;  4R5P A;  1RT2 A;  3AA2 A;  3O4Q A;  3LAM A;  1B9F A;  4G1Q A;  5CYQ A;  4OLB A;  3HT3 A;  4NCA A;  3L8B A;  1TAQ A;  4CER A;  2DTU A;  3DYA A;  1LWE A;  1QHT A;  5HP1 A;  4F4K A;  4C8M A;  1Y97 A;  3LWM A;  3KK2 A;  2IDO A;  1HYZ A;  1RTH A;  3MEG A;  1NOZ A;  2VWJ A;  3RMA A;  1QE1 A;  3TAP A;  2G8V A;  3HJF A;  1QSY A;  4OKE A;  3NHG A;  3NF9 A;  2Z1G A;  2X78 A;  3HVR A;  3NGI A;  1TV6 A;  2JLE A;  1U45 A;  1NJX A;  2OPR A;  1J53 A;  1RTI A;  3V9Z A;  2QKK A;  1BL3 A;  3KLI A;  4GMJ B;  3L3V A;  1SKR A;  5HBM A;  3TWH A;  5HRR A;  4FJH A;  3S9H A;  2EHG A;  4AHV A;  4Z4E A;  4LD0 A;  1RBR A;  1VK0 A;  1JLE A;  4ZHR A;  1HPZ A;  3O3G A;  2YV0 X;  3LAK A;  3I8D A;  3DLR A;  3I0R A;  4KHW A;  4AIL C;  1HNI A;  1RBV A;  3PY8 A;  2GUI A;  5KRT A;  4FW1 A;  2HW3 A;  4DTO A;  3RMC A;  1YT3 A;  4DTM A;  4CF8 A;  4CGG A;  1C1A A;  5KTQ A;  1KVC A;  4DTP A;  3BGR A;  1CZ9 A;  2E6L A;  3VQ7 A;  3HXM A;  1KSP A;  1FKP A;  4DTU A;  4LY7 A;  2XY6 A;  3D0P A;  2G8U A;  4FJ5 A;  1C1C A;  3PUF A;  4DF8 A;  1MU2 A;  4KKO A;  4J2A A;  2HHV A;  3K5O A;  4FLY A;  2OPS A;  3OYG A;  3U3Y A;  1BGX T;  5C24 A;  4N41 A;  1EXQ A;  4DQI A;  4BE1 A;  3M8R A;  3SUQ A;  4B9N A;  3SUN A;  3DMJ A;  4DFJ A;  3G0Z A;  1JKH A;  4O44 A;  1HYV A;  2PYJ A;  1IO2 A;  4Y1C A;  4N56 A;  1UWB A;  4CFD A;  3NFA A;  4RG8 A;  1NJW A;  4FZZ A;  5SZT A;  3SUP A;  2GBZ A;  2HNZ A;  1RNH A;  1IH7 A;  3C95 A;  2Z1J A;  2IC3 A;  3VQP A;  3CM6 A;  4M3Y A;  1D5A A;  2PYL A;  1EP4 A;  4IKF A;  5E41 A;  1BI4 A;  4CGF A;  1KRP A;  2BGG A;  3MEC A;  1ZBL A;  4QOZ B;  3LPU A;  3DLB A;  3CQ8 A;  3VQB A;  1TK8 A;  2DFH A;  3DOK A;  1GOB A;  2KFZ A;  4ELV A;  5J2Q A;  1S6Q A;  5FDL A;  2O4G A;  4L8R B;  4E7K A;  3DRS A;  1VSE A;  1WSE A;  4CJU A;  3CFP A;  3AA4 A;  4DU1 A;  1J5O A;  3PO5 A;  3OS1 A;  4DQP A;  4N5S A;  4CGH A;  4FVM A;  3MXM A;  1YTA A;  2YHA A;  4B8C A;  4CGJ A;  3SQ1 A;  1LV5 A;  3KLE A;  1GOA A;  3RR8 A;  4KHS A;  1VRT A;  2QXF A;  2PZS A;  1O1W A;  2OYQ A;  2OA8 A;  3ZSY A;  4FLW A;  3OYN A;  4CEE A;  4DQR A;  4Z4G A;  1IKW A;  4KTQ A;  1RBU A;  1S1X A;  1NKC A;  3RRH A;  4CK1 A;  1BIZ A;  1L3U A;  4JLH A;  1WSG A;  4CJQ A;  3OVN A;  3CFR A;  4DF4 A;  3OYB A;  1SL1 A;  1RDC A;  1BQM A;  2KTQ A;  3ZT1 A;  1BIS A;  3AVJ A;  4CHP A;  4KI4 A;  3F73 A;  2D0B A;  3SQ0 A;  3M8Q A;  1J54 A;  4ID5 A;  3F9K A;  3NAE A;  3ZSV A;  1SKS A;  1RBS A;  2KQ2 A;  1NKB A;  4FLU A;  1TK5 A;  2Y1J A;  3P1G A;  4M45 A;  1D9F A;  3L2V A;  4CJV A;  1TL3 A;  4EZ9 A;  3E01 A;  3ITH A;  4I9L A;  1ZBH A;  4BDZ A;  1B9D A;  1I3A A;  2A1S A;  1LAW A;  4F2R A;  4M3R A;  1ZBI A;  4CJ5 A;  3KJV A;  4IG3 A;  2G8K A;  1TKD A;  4PWD A;  4CEC A;  4ZTF A;  2VG7 A;  1X9W A;  4KHU A;  2ZD1 A;  4KRE A;  4KTW A;  5FRN A;  1HYS A;  2BDP A;  3DI6 A;  4ICL A;  3QEW A;  3TAM A;  3CM5 A;  5C42 A;  3K5N A;  2BE2 A;  4Z4H A;  5I42 A;  4CHZ A;  3C6T A;  2E4L A;  1JLC A;  1UAX A;  1BHL A;  3AA3 A;  4N47 A;  5JS2 A;  3ASM A;  2HVI A;  2KZZ A;  1Z25 A;  4CJS A;  3VA3 A;  2QKB A;  4E7I A;  4KPY A;  2HHQ A;  2AJQ A; 
#chains in the Genus database with same CATH topology
 3KK3 A;  3NBP A;  4BE0 A;  3SV3 A;  4XH1 A;  1ILY A;  4CIG A;  4WQ4 A;  1QTM A;  1ASW A;  1L3T A;  5AQF A;  3VEO A;  3VQQ A;  4PQU A;  2KZM A;  3KIO A;  3J81 O;  1OH8 A;  3OS0 A;  3W0L A;  3A0I X;  4C1N I;  2A40 A;  3OY9 A;  1RT5 A;  3AO3 A;  4M3Z A;  1JL2 A;  4DV6 K;  2QWQ A;  3QBW A;  3SNN A;  1T44 A;  5HLF A;  3ZX2 A;  3HRG A;  1IJJ A;  3VET A;  2YHY A;  1RIL A;  3VQ6 A;  1XUP O;  2EWS A;  3L2W A;  1IBL K;  2Q97 A;  2DFF A;  1XQS C;  1IG8 A;  3HM8 A;  4CF2 A;  2OPP A;  4E1N A;  1HLU A;  4IDK A;  2HHU A;  5ELZ A;  4BC4 A;  4HUE A;  2OZM A;  4KHN A;  4HVJ A;  2HMP A;  3VF6 A;  4CEZ A;  4FJX A;  2X74 A;  4NYN A;  1F21 A;  1S9G A;  1JLB A;  4M3U A;  3F5T A;  3EZ5 A;  3QIO A;  4DV0 K;  4OO1 J;  3OYK A;  5DM6 L;  1XNQ K;  3C6H A;  3ZT0 A;  3I33 A;  1SKW A;  5GAG P;  1TKT A;  5BPL A;  4DG1 A;  2ZGY A;  4LFB K;  2PFU A;  4B1W B;  2F9T A;  3OW2 M;  3K5M A;  3SPZ A;  4DU4 A;  4JS4 A;  3ZET A;  2F9W A;  1NOY A;  3FZF A;  5GIN A;  2Y1I A;  5BN8 A;  3P83 D;  4M3W A;  3O9U A;  4O0J A;  2ZJR L;  5EY4 A;  4KRF A;  3IS9 A;  4M3X A;  5AQY A;  1VSL A;  3P5J A;  1Q9Y A;  4KTZ A;  3ULE B;  3MEE A;  1DTQ A;  3HYF A;  3SJH A;  1N34 K;  3CJB A;  1Z05 A;  3ID6 A;  5ADX A;  1WLJ A;  3V6D A;  2E1Y A;  3V9W A;  4IDH A;  1B92 A;  1Z6R A;  4CK3 A;  3VQ8 A;  1QHA A;  1JLG A;  4IFE A;  4NCB A;  1VQ9 N;  4CJR A;  3TAR A;  1I39 A;  1QS4 A;  3ZT4 A;  5KQ8 A;  4DLE A;  5KRS A;  3T19 A;  1Z26 A;  4DFM A;  4H4M A;  1GLD G;  4CEA A;  3VES A;  4FLX A;  3SK3 A;  2UUB K;  1KAZ A;  4HCC A;  5J1E A;  3AO5 A;  3H45 C;  4ELU A;  4MDA A;  4DS5 A;  2NRZ A;  4BVO A;  3OYI A;  2A6A A;  3C94 A;  1NKE A;  1N5Y A;  4DSF A;  2DFE A;  1MDU B;  1CZA N;  1VQO N;  4PKI A;  4MQ3 A;  1VSM A;  4H0Y B;  3MXI A;  1A5X A;  4RW4 A;  4G9Z A;  1ATN A;  3THW B;  5AQK A;  1ZBS A;  3LDQ A;  4FLZ A;  3CYM A;  2OCE A;  4PL7 A;  4FK4 A;  4AHS A;  3ZET B;  4Z4I A;  1BQN A;  3U4L A;  1Y64 A;  1RBT A;  3SMS A;  4CZJ A;  4B9Q A;  3NVK A;  3KK7 A;  4FM0 A;  3ZSZ A;  3MN5 A;  3D45 A;  4IEE A;  4AHT A;  3DXK B;  1BG3 A;  2VQE K;  1NK9 A;  3JYT A;  3SBT A;  4O8U A;  4E1M A;  3ULD A;  3NCI A;  3U9Z A;  4Z4C A;  3DLL L;  3WXM B;  4MFB A;  3HK2 A;  1S72 N;  1NGC A;  3U6F A;  1TKX A;  3QIN A;  5FPM A;  5K14 A;  4Z4F A;  1G15 A;  1U47 A;  4DR7 K;  2P5O A;  5KPT A;  2X6N A;  3CJC A;  1EKE A;  1X9J A;  4LFA K;  3QIC A;  4IO8 A;  4CEB A;  4E7L A;  4DFP A;  3V81 A;  3R1X A;  5AQP A;  3HOS A;  4EZ6 A;  3PSF A;  1HMV A;  3AVB A;  2P5G A;  3ATU A;  3HZ6 A;  1HNW K;  1C0U A;  5AFU H;  1NJI O;  4QS7 A;  1HQU A;  2QXL A;  1XC9 A;  3O1B A;  3A5O C;  4YOV A;  3ZSR A;  2O8C B;  1EQY A;  3L4I A;  4K8Z A;  1RDA A;  2OPQ A;  4BE2 A;  2VCP A;  1LWF A;  2CGK A;  3T1A A;  1T7P A;  4FJG A;  3ZYY X;  3T3F A;  3V1O A;  2R7Y A;  4K41 A;  4O8K A;  4JN4 A;  3CMA N;  3VEY A;  4CZG A;  4HTL A;  4WFA L;  4OPK A;  1VQL N;  4CIE A;  4W5Q A;  2WBN A;  2BUP A;  4HWI A;  4JI4 K;  1VRU A;  1NG9 A;  3WT0 A;  5BRH A;  3LAL A;  1E4F T;  3PIP L;  2QWL A;  4DV5 K;  3DM2 A;  5EVZ A;  4B1Y B;  4XH5 A;  4OPH A;  4ILH A;  1N33 K;  4GV6 A;  4PKH A;  1FK9 A;  2W40 A;  4DHY A;  4CVN E;  5CR4 A;  4EHU A;  4HHT A;  4DQS A;  3EEQ A;  1GLL O;  4JHD B;  3DRP A;  5JS1 A;  3KTQ A;  4OPJ A;  1GLC G;  3LZJ A;  3DXK A;  3CCU N;  5FRM A;  4QAG A;  4DTN A;  2DY4 A;  3CF5 L;  2CH5 A;  4AHR A;  4B9L A;  4CZE A;  1HRH A;  4B3O A;  4B9V A;  3M6G A;  4JKB A;  3IRX A;  3SAF A;  4KFB A;  4BRH A;  5J2P A;  5J2M A;  3LZI A;  3QB0 A;  1JJ2 M;  3LDO A;  4CZH A;  1VSH A;  4OLA A;  1DLO A;  1TKZ A;  5M1Q A;  4OGC A;  3KLH A;  3SI6 A;  4FM2 A;  4CJP A;  1HNZ K;  1ZBU A;  2HHX A;  4OVL A;  4BG9 A;  5TKW A;  3SJJ A;  1REV A;  3MMV A;  4Y0W A;  3AVN A;  1A5W A;  4Q5V A;  3PX6 A;  1HQE A;  3AAQ A;  4FJ9 A;  3QER A;  1ATR A;  4FWR A;  3LAM A;  3HT3 A;  3DYA A;  2VGM A;  4F4K A;  1VQP N;  1OH7 A;  3LWM A;  3EZW A;  1RTH A;  1NOZ A;  1QSY A;  5AQU A;  3NGI A;  2X78 A;  2Z1G A;  2JLE A;  2OPR A;  3HJF A;  3KLI A;  1SKR A;  2W6K A;  4Z4E A;  4MLH A;  4BRF A;  3N4P A;  3I8D A;  2E8A A;  4H0X B;  1HKG A;  4KHW A;  4AIL C;  2D0P A;  5GAE P;  3VGL A;  4B3R K;  1YT3 A;  4DTM A;  4CZL A;  4JHD A;  3RSE A;  5M1K A;  1KSP A;  3A5L C;  4OPA A;  4FJ5 A;  3PUF A;  4KKO A;  5AFU A;  2HHV A;  3EKU A;  4WFB L;  4U67 L;  2OPS A;  1U6Z A;  1EXQ A;  5JVH L;  3SUN A;  2PYJ A;  4O44 A;  4Y1C A;  4CI6 A;  4CFD A;  3NFA A;  4IO9 L;  2HNZ A;  3CM6 A;  1EP4 A;  4H0T B;  1ZBL A;  3LPU A;  3DLB A;  3CQ8 A;  5JLH A;  2HF4 A;  1NGJ A;  3WQT A;  3UKU B;  4ELV A;  3J7Y P;  1S6Q A;  4FWO A;  4E7K A;  4DR2 K;  3LDN A;  1WSE A;  4CJU A;  3AA4 A;  2ZWH A;  1WOQ A;  4FVM A;  3BF3 A;  1NBW A;  3E9P A;  4BR9 A;  3KLE A;  4IOX A;  4KHS A;  1BOT O;  1NGE A;  4BRE A;  4FLW A;  3OYN A;  1HR0 K;  4Z4G A;  1IKW A;  3THY A;  3RRH A;  2YX6 A;  4JAX A;  3CQX A;  4RTF D;  4CJQ A;  3CCS N;  3OYB A;  1SL1 A;  1BQM A;  4NLB A;  1TYQ B;  4CHP A;  4KI4 A;  2D0B A;  2P9U A;  3M8Q A;  3NVM A;  3MX2 A;  2ZJP L;  1NGG A;  2Y1J A;  4CBU A;  4B3T K;  1I3A A;  2GTD A;  4F2R A;  4CJ5 A;  1SQK A;  3HTV A;  2BDP A;  3CM5 A;  5C42 A;  1J6Z A;  3K5N A;  4CZM A;  2UU9 K;  1NWK A;  4K0K K;  4N47 A;  1NGB A;  4A2B A;  1N8R O;  4RWT A;  3AY9 A;  3VA3 A;  2QKB A;  4E7I A;  4KPY A;  2AJQ A;  3K0S A;  4M7Y A;  2RN2 A;  2G8H A;  3I8B A;  3CME N;  4EP4 A;  1S9E A;  4NCG A;  4JI1 K;  1WN7 A;  2NNW A;  4K43 A;  3EKS A;  2G8I A;  1LW0 A;  1LWC A;  5ADX H;  4FJI A;  5AJ3 K;  3UE5 A;  3B6O A;  2D0C A;  5DM7 L;  4FK2 A;  2ZJQ L;  2O8D A;  3T1Y K;  2V7Y A;  2HBJ A;  2YJE A;  4H5W A;  1CZB A;  3F2K A;  5HRP A;  4YDU C;  4I6M A;  3RWU A;  3V9U A;  3AA5 X;  4LSN A;  4XEI A;  4H03 B;  2GWK A;  4B1X B;  3O08 A;  3O9Q A;  2ZQB A;  1VHX A;  4DQ8 A;  2F8S A;  1FKO A;  3SPY A;  3SZ2 A;  3KKR A;  3GG4 A;  2I7N A;  3ALY A;  2P9U B;  4RW6 A;  2WTU A;  1EWR A;  5LMU K;  3EO3 A;  2Q31 A;  1K8K A;  2QI2 A;  1RDD A;  3HPH A;  4DMN A;  3ENO A;  3CC4 N;  4JKG A;  4B8A B;  4CED A;  2RHK A;  5KGW A;  4FJL A;  3CPE A;  3QLH A;  4YHH K;  4CHN A;  3MN9 A;  1XMQ K;  3PX4 A;  3L2U A;  5LJV A;  2G8W A;  1RDB A;  1M1K O;  1ESV A;  3QNO A;  3BEX A;  3RVC A;  3FGU A;  4A5B A;  4BVP A;  3L3U A;  4BRG A;  3SV4 A;  1RTJ A;  4FJJ A;  4C8N A;  3E66 A;  3UKR B;  1QSS A;  3JXU A;  3SQ2 A;  1KAX A;  1YXQ A;  2KLA A;  4F8R A;  3P4I A;  3NDK A;  3CJA A;  5AQO A;  2HHS A;  2VG5 A;  4OX9 K;  3TSP A;  1NMD A;  2O8D B;  4FJ7 A;  5HL7 L;  4NXN K;  4LH5 A;  3DLG A;  1IKV A;  5IWA K;  3ZSQ A;  3PO4 A;  4QCL A;  1YJN N;  3LWL A;  4C8O A;  1BWF O;  3TTD A;  4CJW A;  3CIP A;  3JAM O;  3NF8 A;  1TUU A;  2JGU A;  4JYA K;  2ATQ A;  3K5L A;  3KD1 E;  1SL2 A;  1U2V B;  5F0X A;  3QEI A;  5C2D A;  4F3T A;  2NUB A;  4FWQ A;  3SQ4 A;  3CCM N;  3NF7 A;  3DJC A;  1NK8 A;  2VWK A;  4JK9 A;  1RT1 A;  1EO1 A;  2ZE2 A;  1IBM K;  4JNE A;  1H1V A;  2VWB A;  4PL8 A;  4FWP A;  4XIU A;  3QEP A;  5B8H A;  1T8E A;  1LOT B;  3CI5 A;  4JKG B;  4B1Z A;  5AQI A;  1C0M A;  3G71 N;  2PBD A;  1IKX A;  4B1U B;  1BIU A;  5I3U A;  4FJN A;  4O4G A;  2OZS A;  3KWI A;  3VN5 A;  3BY5 A;  3O4W A;  2IAJ A;  3ZSW A;  1BCM A;  1P8Z A;  2CGL A;  4E7H A;  3VER A;  2HHH K;  3HSC A;  1N32 K;  4IBN A;  1RT7 A;  4IJA A;  2HBK A;  3VQA A;  2F96 A;  2Q0U A;  3AVM A;  3KWG A;  3UKR A;  2YNH A;  4FZY A;  3CG7 A;  4I2P A;  1DGK N;  1YUW A;  2D5R A;  3PLA A;  3CET A;  4M63 C;  1SAZ A;  3QIP A;  4YOU A;  5M1N A;  3NGZ A;  1NGA A;  4DTS A;  4IEI A;  1S22 A;  3HO1 A;  2Q0R A;  4F9O A;  1X3M A;  1Q81 O;  2I5J A;  2HHW A;  3CCR N;  2YHB A;  4MO5 A;  4FWK A;  1KCF A;  3CFO A;  5AZJ B;  2E2N A;  1YHQ N;  4F2S A;  3FLC O;  1QZ6 A;  3K58 A;  3VQ5 A;  4LF9 K;  4AQY K;  4E3S A;  5J2N A;  4X64 K;  1YAG A;  3AO2 A;  4BWJ A;  3QEX A;  5FPE A;  3M8S A;  4KHQ A;  1RFQ A;  3B6P A;  4K8X A;  5BRD A;  2Q2R A;  3CCE N;  3OYA A;  5AQJ A;  4KBO A;  5BPM A;  1U2V A;  3AVG A;  4CFC A;  2Z1I A;  4LF7 K;  5EOY A;  1TGO A;  3DLK A;  3I0S A;  3U9D A;  3O1W A;  1NK7 A;  2NRH A;  3AVL A;  1NJZ A;  3VQC A;  2QTD A;  3G10 A;  5AQV A;  1KFD A;  4M3T A;  3N4Q A;  3L0Q A;  5KPR A;  4H5R A;  5TKY A;  1XHZ A;  2IIR A;  3ULE A;  2XY5 A;  4A62 A;  3TTF A;  4IFY A;  3FFI A;  4W5O A;  2B4J A;  4FYD A;  2FSJ A;  4A57 A;  4H4O A;  2FBV A;  1KVB A;  5LL6 Z;  3MAQ A;  4R79 A;  2QEX N;  1VQK N;  1D9D A;  5C25 A;  2ETJ A;  2G8U A;  1S1U A;  1UOC A;  2AP1 A;  5AQX A;  4GV9 A;  2ZGZ A;  4TSX A;  1TL1 A;  3ZX0 A;  4YOX A;  3THX B;  4DSL A;  4CZK A;  2FBY A;  3ZCM A;  5C12 A;  2RPI A;  4OKJ A;  2QWR A;  2O8B B;  1KFS A;  2B6A A;  2PY5 A;  1Q8I A;  4DR6 K;  4BR2 A;  1MA9 B;  3IDH A;  4KH4 A;  4CJL A;  4CHO A;  4Z94 A;  5AZJ A;  3OYM A;  1S1W A;  4FJM A;  1I94 K;  1S1V A;  3OYD A;  1D4X A;  4FZX C;  3DLE A;  1YTU A;  4DFK A;  2EX3 A;  5BN9 A;  3GOI A;  4KB1 A;  3OTO K;  5E84 A;  4BR5 A;  1NGI A;  4C1N K;  3SUO A;  1NK6 A;  4RW9 A;  2YJF A;  3QEV A;  2HVH A;  4IZ9 A;  3DWL A;  3AA2 A;  3O80 A;  4G1Q A;  1BU6 O;  4BQL A;  1LWE A;  1QHT A;  1E4G T;  2NRV A;  3FR0 A;  3MEG A;  3TAP A;  5BRF A;  3HVR A;  4DB3 A;  4JD2 A;  3RR7 A;  3L3V A;  5HBM A;  3TWH A;  5HRR A;  2UUC K;  2YI1 A;  4LD0 A;  4MLE A;  2E2O A;  5AQT A;  1HPZ A;  4DV4 K;  2D4W A;  3SAH A;  3I0R A;  3PY8 A;  5KRT A;  4E1J A;  4FW1 A;  4DTO A;  1QVF M;  2UXC K;  5KTQ A;  1C1A A;  3FE1 A;  1KVC A;  4DTP A;  2E6L A;  1FKP A;  4LY7 A;  4DV3 K;  2WUS A;  5C24 A;  3E9O A;  4DQI A;  3THX A;  4WQ4 C;  4DFJ A;  4N56 A;  4WF9 L;  2O8B A;  1GLE G;  2GBZ A;  1FJG K;  3D7E O;  2I7P A;  2Z1J A;  4M3Y A;  1OVY A;  1D5A A;  1BI4 A;  1KRP A;  4DCH A;  4YOR A;  3WEE A;  3VQB A;  1DEJ A;  1TK8 A;  1GOB A;  2HOE A;  4LF5 K;  3P39 A;  4L8R B;  2OTJ N;  1VSE A;  4DU1 A;  1J5O A;  1T3V A;  3QML A;  3OS1 A;  4LF6 K;  2CGJ A;  5HOO A;  1LV5 A;  3RR8 A;  2QXF A;  2PZS A;  1O1W A;  2OYQ A;  4CEE A;  4DQR A;  2P9S A;  1RBU A;  3MX5 A;  1MWM A;  2V7Z A;  1NKC A;  4JEP A;  1V4T A;  4BQZ A;  3ZT1 A;  1BIS A;  3AVJ A;  3F73 A;  3SQ0 A;  1J54 A;  3NAE A;  3ZSV A;  2KQ2 A;  4FLU A;  3H46 O;  3EN9 A;  4EZ9 A;  5IT9 O;  3E01 A;  3WQU A;  2A1S A;  4M3R A;  4IG3 A;  4H5T A;  1WB9 A;  4ISE A;  4CEC A;  2VG7 A;  4KHU A;  4KTW A;  5FRN A;  3PIO L;  4AF1 A;  1SS6 A;  2HST A;  2F4V K;  5GIP A;  5C10 A;  3J7A P;  4Z4H A;  1NLV A;  1MWK A;  2E4L A;  1JLC A;  4LF8 K;  2HVI A;  2A5X A;  4BR0 A;  3IAY A;  3CQY A;  3V1Q A;  3WNF A;  4YOT A;  1OVQ A;  3ZT2 A;  3G25 A;  3NH2 A;  2WOM A;  3L6Q A;  4BRP A;  4H5N A;  3ID8 A;  3TR8 A;  3OS2 A;  2W6L A;  5CZ1 A;  1HNX K;  3AGK A;  2P9N B;  4A61 A;  1BI4 B;  3NH0 A;  3CC7 N;  5HRS A;  3CC2 N;  4X66 K;  5F2R A;  1Q9X A;  3ZEU A;  1G99 A;  3ISN C;  1BO5 O;  4WQ5 C;  5AQS A;  3ZT3 A;  4PHT X;  3TPQ A;  3S3O A;  4KH6 A;  2E1Z A;  3S41 A;  4A2A A;  4BRK A;  2RKI A;  2XO7 A;  5MLC Q;  4J2D A;  1GOC A;  3VQ4 A;  3M3Z A;  3WXJ A;  2XRI A;  5DK5 A;  4BWM A;  2IVP A;  1WSJ A;  4CJ7 A;  4JI6 K;  4FOE A;  3NMU A;  3MXJ A;  3QO9 A;  2HBM A;  3A2F A;  5LY3 A;  3AVA A;  2IVN A;  1SUQ A;  4E89 A;  3QNN A;  3W3D A;  1WSF A;  3L2R A;  3RSE B;  1U4B A;  2FC0 A;  4AHU A;  1C0G A;  2E5L K;  1IG9 A;  4YOW A;  3V9X A;  3D2F A;  4GVM A;  4CD3 A;  3O4N A;  1JXE A;  1BDG A;  3AV9 A;  3D2E B;  2G8F A;  3HPG A;  4CBW A;  1WNS A;  4O5F A;  1RCH A;  3HST B;  4H0P A;  3EYZ A;  4PA1 A;  3HP6 A;  2QA4 N;  3HPO A;  3HL8 A;  3QFU A;  3UKU A;  2A1R A;  1L3V A;  3IMX A;  3PSI A;  4WFN L;  1JXB A;  1RT4 A;  1W0H A;  3A8Y A;  1YJW N;  1TAU A;  3QES A;  2DPN A;  2P9N A;  4ILJ A;  5FRO A;  4CF1 A;  2FSN A;  1VSI A;  3QFP A;  3ZEU B;  4W5R A;  4BR7 A;  4CW7 B;  2P1J A;  5CHI A;  2P9K B;  4M42 A;  1ITG A;  3TAF A;  5BPN A;  5JVG L;  1KD1 O;  1JCG A;  3JS6 A;  2ITM A;  1TYQ A;  4KV8 A;  1ASU A;  3HVT A;  3AAP A;  4CF0 A;  2KW4 A;  2DTU A;  4WE1 A;  3KLG A;  4JI0 K;  1YIT N;  2P9I A;  3JSM A;  3ZSO A;  1ATS A;  1WUA A;  2HNY A;  4EP5 A;  2UYT A;  4FM1 A;  5KQD A;  4GNI A;  2Q36 A;  3IFR A;  3LP0 A;  4XH4 A;  4J2B A;  4DU3 A;  4CJK A;  4FCY A;  4CE9 A;  1Q7Y O;  1NNE A;  3TAG A;  4Y1D A;  4OJR A;  3EE8 A;  1S6P A;  3D2F B;  3M5R A;  3OJS A;  3LPT A;  4ISG A;  4BRM A;  3D2E A;  3VTH A;  4LFC K;  5M1P A;  1KVA A;  3RMD A;  5AQH A;  4CHQ A;  4YY3 K;  2D0A A;  1DTT A;  4BAC A;  3EY1 A;  4RW7 A;  5T7B A;  1QVG M;  2F7T A;  4CJF A;  5HRN A;  4EIA A;  1UA1 A;  5LMN K;  4K25 A;  1BA0 A;  4KO0 A;  3A5M C;  3DRR A;  2P9P B;  4CFA A;  5AQL A;  4YNQ A;  1NGF A;  3V4I A;  3FZK A;  1K6Y A;  1U48 A;  3MCA B;  5AQW A;  4C8K A;  4YDU A;  1D8Y A;  1WBD A;  1JCF A;  4O55 A;  2IS3 A;  2QWM A;  5EX5 A;  4B3M K;  4HUG A;  3NH1 A;  3GDQ A;  4B9T A;  2P9K A;  1QQM A;  4DWI A;  3LP2 A;  4BRC A;  3RRG A;  3VQ9 A;  1QQN A;  4BRL A;  3TTC A;  5E26 A;  2P9I B;  4BRI A;  3MWT A;  3VA0 A;  2IOC A;  2VGN A;  4CIF A;  5SWM A;  4PUO A;  3TSQ A;  2HF3 A;  3LP3 A;  2RF2 A;  3AVK A;  4H8K A;  4EHT A;  4A5A A;  2QM1 A;  3DXM A;  3KD5 E;  3MN7 A;  4ZTJ A;  3OYL A;  3OYF A;  2P9L B;  2XY7 A;  3VQE A;  4ILG B;  3AO4 A;  3CER A;  3F9M A;  4B9U A;  4LSL A;  4DUY K;  3CCL N;  1U49 A;  2CH6 A;  1DT9 A;  4B9M A;  5BR8 K;  3ENB A;  4JI5 K;  1JLF A;  3R9P A;  4RW8 A;  1W2B M;  2P51 A;  1C6V A;  3VF4 A;  1Q18 A;  1VAZ A;  2D1K A;  4H0V B;  1XWL A;  2H3G X;  3RTV A;  4QS8 A;  3CPW M;  2QWO A;  2Z1H A;  3KKS A;  3NE6 A;  2Q3S A;  4GKK K;  3WXK A;  4CFB A;  2ITG A;  4YFU A;  2YNI A;  4FW2 A;  4JI2 K;  4OGE A;  4GY2 B;  3PV8 A;  2QW9 A;  4FJK A;  3OYJ A;  5GIO A;  4QS9 A;  2P9P A;  4UQG A;  3FZL A;  3H6E A;  3LDP A;  5JLF A;  3R3L A;  3NF6 A;  4BY9 C;  3J7Z O;  4DSI A;  3KVG A;  4KHY A;  1VSD A;  4GV3 A;  4NYF A;  3LDL A;  2O8F B;  3TI0 A;  2X6S A;  4Z0U A;  5CY4 A;  1HJR A;  3WNE A;  2ASP A;  4IJN A;  3SLC A;  1XHX A;  3QET A;  2D0O A;  5C2F A;  1HKC A;  1NK5 A;  4WYB A;  1GLF O;  3DLH A;  4DR1 K;  3SYZ A;  1KXP A;  1VSK A;  3KLF A;  3OYE A;  5M1O A;  2W41 A;  1T05 A;  1LW2 A;  1X3N A;  2FBT A;  1JL1 A;  4BC3 A;  1W97 L;  4FWL A;  4FWS A;  3C6A A;  2YKN A;  2YHX A;  3TAQ A;  2V51 B;  1VQ8 N;  1RT2 A;  3O4Q A;  4NCA A;  1TAQ A;  1R59 O;  2UXD K;  2YHW A;  4C8M A;  1Y97 A;  2BH1 A;  1OKJ A;  4JKC A;  1IV0 A;  1HYZ A;  2P9L A;  4U7B A;  4OKE A;  3NF9 A;  1JCE A;  2KHO A;  3LL3 A;  1TV6 A;  1BL3 A;  2FSK A;  4IOC L;  4FJH A;  4AHV A;  3TU5 A;  3CCJ N;  3WXI A;  1KC8 O;  4LC9 B;  1RBR A;  1VK0 A;  1JLE A;  4ZHR A;  3O8M A;  3O3G A;  2YV0 X;  3LAK A;  1RBV A;  2V52 B;  2HW3 A;  4DV2 K;  3RMC A;  4CGG A;  2GUP A;  2FLO A;  3VQ7 A;  5GAD P;  2XY6 A;  3O9S A;  3D0P A;  1C1C A;  3VEZ A;  4DF8 A;  1MU2 A;  3H1Q A;  4FLY A;  3OYG A;  4BC5 A;  1BGX T;  3M8R A;  4B9N A;  1YVN A;  1VQ7 N;  3DMJ A;  3K9K A;  3G0Z A;  1JKH A;  1HYV A;  3VEN A;  3Q7C A;  2FF6 A;  1NJW A;  3CJ7 A;  5SZT A;  2O8F A;  1IH7 A;  3C95 A;  2IC3 A;  2BGG A;  4JKD A;  4V19 S;  3DOK A;  2GEL A;  2AA4 A;  5FDL A;  2UUA K;  2O4G A;  5I9E B;  4DQP A;  3CFP A;  2A3Z A;  3E1Y A;  3BP8 A;  5H1S Q;  4N5S A;  3MXM A;  1YTA A;  4B8C A;  4RCH A;  3SQ1 A;  1GOA A;  1VRT A;  4BR4 A;  2E2P A;  2OA8 A;  3ZSY A;  4CBX A;  2QWN A;  4DR3 K;  1S1X A;  3T7Z A;  1BIZ A;  1L3U A;  3C0B A;  1J5E K;  3ATV A;  3CFR A;  5JIC A;  4FWM A;  1T6C A;  2GX9 A;  3AGR A;  3F9K A;  5AQZ A;  1NKB A;  1TK5 A;  1D9F A;  4M45 A;  4CJV A;  3AAR A;  3ITH A;  2ZM6 K;  5BRE A;  4BDZ A;  1B9D A;  1LAW A;  1ZBI A;  1ZC6 A;  3KJV A;  4PKG A;  2NRW A;  5A2Q O;  1YF5 L;  5KPZ A;  3T69 A;  2BTF A;  4X65 K;  3DI6 A;  3QEW A;  5FPN A;  5GAH P;  2WC9 A;  5I42 A;  4CHZ A;  2VYP A;  3LM2 A;  1BHL A;  3ASM A;  5AQG A;  2KZZ A;  2YCH A;  3VMF B;  3THW A;  2HHQ A;  4JI8 K;  3MED A;  4KHP K;  3SCX A;  4YOY A;  3VPZ A;  2E6M A;  5LJW A;  1FW6 A;  3P38 A;  3O3H A;  2VG6 A;  4IG0 A;  1JLA A;  3ZSX A;  1NK0 A;  1EET A;  3R6M A;  4MDB A;  3CCQ N;  1WSI A;  4CJT A;  3C7N A;  2HB5 A;  4FPA A;  4BRO A;  4BRN A;  4E0D A;  1RTD A;  4FLV A;  3KHY A;  4CJ3 A;  3I55 N;  2O4I A;  3C6U A;  4OKK A;  2HMI A;  3LP1 A;  3O6W A;  3Q7B A;  3MK6 A;  1RGI A;  1RDW X;  2ASO A;  4JK7 A;  4JD2 B;  1YVU A;  4NLC A;  2A41 A;  2NRT A;  4DSE A;  3AVF A;  2PAV A;  3ZLJ A;  1VSJ A;  2QK9 A;  1RT3 A;  5D3G A;  3BZK A;  1RT6 A;  4WCE L;  2NRR A;  4CEQ A;  3AO1 A;  4H0O A;  1S5J A;  3MN6 A;  5AQN A;  3WXL A;  3P31 A;  3O3F A;  1S3X A;  4IWV A;  1QZ5 A;  1QSL A;  5EXW A;  3BUZ B;  3H08 A;  4GKJ K;  2O8C A;  4ELT A;  4C8L A;  4BDY A;  2KFN A;  4FK0 A;  4F3O A;  1KLM A;  3L2Q A;  1NMN A;  2HND A;  1ZYQ A;  2O8E A;  3AVI A;  3KZB A;  1L3S A;  2HHT A;  3EL2 A;  3K9J A;  1KQS M;  4DTR A;  4FOI A;  3S3N A;  3U3G A;  4BRA A;  3WEE B;  3NGY A;  4B1V A;  4JRP A;  1K73 O;  1SL0 A;  4C23 A;  4FSV A;  3TAB A;  3PX0 A;  3LM9 A;  1WAJ A;  4LH4 A;  4FXD A;  3V9S A;  1KTQ A;  1NGH A;  4WQ5 A;  3VEX A;  3K57 A;  1C1B A;  3S3M A;  4JKH A;  3C7N B;  1X9M A;  1VQM N;  1IBK K;  1VQ4 N;  4CJ4 A;  1CXQ A;  3VTI A;  1TUY A;  2P9S B;  3UIQ A;  4Q0B A;  1BCO A;  1HNV A;  4DTJ A;  4CHY A;  1BA1 A;  1JLQ A;  4IXC A;  3OJU A;  2E2Q A;  2RE2 A;  1TVR A;  1IKY A;  3WNH A;  3RMB A;  5AQM A;  3OA9 A;  4H5V A;  4ID1 A;  2BAN A;  5J2Q A;  3VGM A;  4JKE A;  4B9S A;  3DOL A;  4BDP A;  1R0A A;  2VQF K;  1HX1 A;  4K42 A;  4BGB A;  1DKG D;  4GW6 A;  4DR4 K;  1X1P A;  1NK4 A;  4CZF A;  1CLQ A;  2XY8 A;  1HKB A;  4DV7 K;  4CEF A;  2FBX A;  5C15 A;  1XC3 A;  1N36 K;  4JRQ A;  1NM1 A;  1X9S A;  1J9A A;  1UA0 A;  3V1R A;  4B08 A;  4HTU A;  5DMR A;  1T03 A;  2LSN A;  4J2E A;  4O5B A;  3J80 O;  3TAE A;  2FF3 B;  3TAN A;  3FZH A;  4MO4 A;  1M90 O;  3QDK A;  1XI1 A;  3L4Q A;  2IGI A;  3I56 N;  3K2P A;  2O8E B;  5KI6 A;  4KAZ A;  1A5V A;  5HRO A;  4KI6 A;  4HUF A;  1U04 A;  4DSK A;  2JWK A;  4NO7 A;  4PY5 A;  4CEO A;  1N6Q A;  3OYH A;  3H3N O;  4IFV A;  1SV5 A;  4I9Q A;  3HBT A;  2E88 A;  4DUZ K;  4I2Q A;  1NJY A;  1WBB A;  3IG1 A;  4CES A;  1HUX A;  1S1T A;  3KK1 A;  4EFH A;  1Q82 O;  4JS5 A;  4FJ8 A;  3VQD A;  3CCV N;  1ZXO A;  3OBW A;  3LDS A;  4O0I A;  3VF2 A;  3THV A;  1TK0 A;  1VSF A;  4JKA A;  4FL9 A;  3SMP A;  3G6E N;  4HCB A;  1FXX A;  3WNG A;  1EX4 A;  4FVU A;  4A59 A;  4E19 A;  2A42 A;  1RDU A;  3LAN A;  1LAV A;  2GV9 A;  1KAY A;  4LF4 K;  3BZC A;  3MCP A;  4CF9 A;  4JI7 K;  1C0F A;  1ZBF A;  1E3M A;  4B3S K;  4BRQ A;  3K59 A;  4FLT A;  4M7X A;  1LCU A;  5BR9 A;  4CK2 A;  2F8T A;  1GLB G;  4J8F A;  2OAN A;  1QQC A;  5KGX A;  4DS4 A;  1YJ9 N;  2W42 A;  3HP9 A;  3R8E A;  1ASV A;  4DLG A;  4JI3 K;  1P90 A;  3O9T A;  3M1F A;  4DTX A;  3J8A A;  2QWP A;  1QQO A;  3SBG A;  4N76 A;  2XHB A;  1KLN A;  3THY B;  3CXC M;  3HM9 A;  3EE9 A;  4CCH A;  5AQR A;  3QBX A;  2ASM A;  1XNR K;  3SAG A;  1K9M O;  4AH9 A;  4DV1 K;  4FO0 A;  4BGA A;  3OHR A;  4AHC A;  1L5U A;  3AVC A;  3AVH A;  4KB0 A;  2IVO A;  2NZT A;  4JK8 A;  2KFZ A;  1C0T A;  3GBT A;  4AM7 A;  2WON A;  4E7J A;  4W5N A;  3O9R A;  2YNG A;  4M41 A;  1CXU A;  4GVE A;  1W7A A;  3M8P A;  5CYM A;  1WAF A;  2YKM A;  3D6R A;  1XMO K;  2JWL A;  4DQQ A;  1Q86 O;  3BDP A;  2NRX A;  5EU7 A;  1WSH A;  2GEM A;  5F1X A;  1W9H A;  4UY8 O;  5CZ2 A;  2ZF5 O;  3C65 A;  4CJE A;  3MWP A;  5AZI B;  3VEV A;  1OH6 A;  4W5T A;  2B5J A;  3GE1 A;  2NLX A;  4I7F A;  4CGD A;  3OYC A;  3GL1 A;  2Q1N A;  3ZX3 A;  4DSJ A;  1NGD A;  3WUH A;  4BRD A;  4CGI A;  4L3Q A;  2YNF A;  4R5P A;  3IKM A;  3UB5 A;  4OLB A;  1B9F A;  5CYQ A;  4DR5 K;  3H3O B;  3L8B A;  3DAW A;  4CER A;  3MDQ A;  3E9L A;  5HP1 A;  3KK2 A;  2IDO A;  2VWJ A;  3RMA A;  1T6D A;  4NB4 A;  1QE1 A;  2G8V A;  4I6M B;  1GLA G;  3NHG A;  3BF1 A;  4JKF A;  3FFK B;  1U45 A;  1NJX A;  2HBL A;  3CJ1 A;  1J53 A;  1RTI A;  3V9Z A;  2QKK A;  4GMJ B;  4JV5 K;  5CE3 A;  3S9H A;  2EHG A;  1VQ5 N;  1HJO A;  3DLR A;  3OBY A;  1NU0 A;  1HNI A;  2GUI A;  3H1V X;  3CJ9 A;  1OH5 A;  1YIJ N;  4CF8 A;  1K8K B;  3BGR A;  1CZ9 A;  2E20 A;  3HXM A;  2WFB A;  4DTU A;  4X62 K;  4J2A A;  5M1F A;  3HI0 A;  3K5O A;  5AR0 A;  3U3Y A;  3O5B A;  1VQN N;  4N41 A;  4BE1 A;  3SUQ A;  5C0Y A;  1K8A O;  1IO2 A;  1UWB A;  4DKW A;  4RG8 A;  3VGK A;  1BUP A;  4FZZ A;  3FZM A;  3SUP A;  1RNH A;  3VQP A;  3IUC A;  5FLX O;  2PYL A;  4IKF A;  5E41 A;  4CGF A;  2J4R A;  4QOZ B;  3A5N C;  3MEC A;  4NXM K;  1VQ6 N;  3U8X A;  2DFH A;  5AZI A;  3CD6 N;  3TSU A;  4EAH D;  4ISF A;  3DRS A;  3G4S N;  2UXB K;  3PO5 A;  3DXM B;  4CGH A;  2GWJ A;  1HPM A;  4IOA L;  2YHA A;  4CGJ A;  3HOT A;  2OTL N;  4FWN A;  3VOV A;  3CHW A;  4KTQ A;  1GLJ O;  1O13 A;  4CK1 A;  5FPD A;  1EWQ A;  4JLH A;  1WSG A;  3OVN A;  4DF4 A;  3B8A X;  3T1H K;  1RDC A;  2KTQ A;  4BG8 A;  3ENH A;  4ID5 A;  4CZI A;  1SKS A;  1RBS A;  4KH5 A;  3P1G A;  3L2V A;  1TL3 A;  1ZBH A;  4I9L A;  5AQQ A;  1YI2 N;  2KKZ A;  2G8K A;  1TKD A;  4PWD A;  4ZTF A;  4AM6 A;  1X9W A;  1V4S A;  4FPB A;  2ZD1 A;  4KRE A;  1SZ2 A;  1HYS A;  2FXU A;  4ICL A;  3TAM A;  3VEW A;  4BC2 A;  2BE2 A;  5JMV A;  3C6T A;  1UAX A;  3AA3 A;  4CD1 A;  5JS2 A;  1Z25 A;  4CJS A; 
#chains in the Genus database with same CATH homology
 3IAY A;  3MED A;  3KK3 A;  3NBP A;  3SCX A;  3V1Q A;  4BE0 A;  2RN2 A;  2G8H A;  2E6M A;  3SV3 A;  3WNF A;  4CIG A;  3ZT2 A;  1QTM A;  1ASW A;  1L3T A;  2KZM A;  4PQU A;  3VQQ A;  3NH2 A;  4EP4 A;  1S9E A;  3KIO A;  2WOM A;  3O3H A;  3TR8 A;  4NCG A;  3OS0 A;  3OS2 A;  2VG6 A;  4IG0 A;  1WN7 A;  1JLA A;  5CZ1 A;  3ZSX A;  1NK0 A;  2G8I A;  3OY9 A;  1EET A;  1LW0 A;  1RT5 A;  1WSI A;  1BI4 B;  1LWC A;  3AO3 A;  3NH0 A;  4CJT A;  4FJI A;  1JL2 A;  4M3Z A;  5HRS A;  2HB5 A;  3B6O A;  2D0C A;  4FK2 A;  3SNN A;  1Q9X A;  5HLF A;  3ISN C;  4E0D A;  3S3O A;  3ZT3 A;  1RTD A;  1RIL A;  4FLV A;  3VQ6 A;  4CJ3 A;  2O4I A;  3C6U A;  4OKK A;  2RKI A;  2HMI A;  3LP1 A;  2XO7 A;  3L2W A;  1CZB A;  5HRP A;  4J2D A;  3RWU A;  1GOC A;  3V9U A;  3VQ4 A;  2DFF A;  2XRI A;  3AA5 X;  1YVU A;  5DK5 A;  4LSN A;  4BWM A;  4CF2 A;  4DSE A;  3AVF A;  2OPP A;  4E1N A;  1VSJ A;  2ZQB A;  1WSJ A;  4IDK A;  2QK9 A;  1RT3 A;  4HUE A;  5D3G A;  2HHU A;  2OZM A;  4KHN A;  2F8S A;  4HVJ A;  1FKO A;  3MXJ A;  1RT6 A;  3QO9 A;  4CEZ A;  3SPY A;  4FJX A;  3SZ2 A;  2X74 A;  3KKR A;  4NYN A;  1F21 A;  1S9G A;  4CEQ A;  1JLB A;  3A2F A;  4M3U A;  3ALY A;  3AVA A;  3QIO A;  4RW6 A;  3AO1 A;  1SUQ A;  3EZ5 A;  4E89 A;  3OYK A;  3QNN A;  3ZT0 A;  1S5J A;  1SKW A;  1WSF A;  1RDD A;  3HPH A;  3O3F A;  1TKT A;  4DMN A;  3L2R A;  4DG1 A;  1U4B A;  2FC0 A;  4AHU A;  1QSL A;  1IG9 A;  3H08 A;  3V9X A;  4B8A B;  4ELT A;  4C8L A;  4BDY A;  4CED A;  5KGW A;  4GVM A;  4FJL A;  2KFN A;  4FK0 A;  3O4N A;  1JXE A;  3K5M A;  3AV9 A;  4F3O A;  2G8F A;  3QLH A;  1KLM A;  3HPG A;  4CHN A;  3SPZ A;  3L2Q A;  4DU4 A;  2HND A;  4JS4 A;  1WNS A;  1ZYQ A;  3AVI A;  3PX4 A;  3L2U A;  1L3S A;  1NOY A;  2HHT A;  2G8W A;  2Y1I A;  1RDB A;  1RCH A;  3HST B;  3P83 D;  4M3W A;  3EYZ A;  4DTR A;  3QNO A;  4O0J A;  4PA1 A;  3HP6 A;  3S3N A;  3U3G A;  4KRF A;  3IS9 A;  3L3U A;  3HPO A;  3SV4 A;  1RTJ A;  3NGY A;  4FJJ A;  3HL8 A;  4C8N A;  4M3X A;  4JRP A;  1QSS A;  2A1R A;  1VSL A;  3P5J A;  3SQ2 A;  4KTZ A;  1L3V A;  1Q9Y A;  3MEE A;  1DTQ A;  1SL0 A;  3TAB A;  1JXB A;  3HYF A;  1RT4 A;  1W0H A;  4F8R A;  3PX0 A;  3NDK A;  1WAJ A;  4LH4 A;  1TAU A;  3QES A;  3V9S A;  1WLJ A;  4FXD A;  3V6D A;  1KTQ A;  3K57 A;  2HHS A;  1C1B A;  2VG5 A;  3V9W A;  3S3M A;  1X9M A;  1B92 A;  5FRO A;  4CJ4 A;  4CF1 A;  1CXQ A;  4CK3 A;  3UIQ A;  4Q0B A;  3VQ8 A;  1VSI A;  1BCO A;  1JLG A;  4FJ7 A;  1HNV A;  4W5R A;  4DTJ A;  4NCB A;  4CHY A;  3RR7 A;  1JLQ A;  2P1J A;  4LH5 A;  4CJR A;  3DLG A;  3OJU A;  1ITG A;  3TAF A;  3TAR A;  4M42 A;  1I39 A;  1IKV A;  1TVR A;  1QS4 A;  3ZT4 A;  1IKY A;  3WNH A;  3RMB A;  3ZSQ A;  4DLE A;  3PO4 A;  4KV8 A;  1ASU A;  3HVT A;  4QCL A;  4ID1 A;  2BAN A;  5KRS A;  3T19 A;  2KW4 A;  4CF0 A;  3LWL A;  4WE1 A;  4CJW A;  3KLG A;  1Z26 A;  4C8O A;  4DFM A;  4B9S A;  4H4M A;  3DOL A;  4BDP A;  3NF8 A;  1R0A A;  4CEA A;  3JSM A;  3ZSO A;  2JGU A;  2ATQ A;  4GW6 A;  3K5L A;  4FLX A;  2HNY A;  1SL2 A;  3KD1 E;  4EP5 A;  4HCC A;  1X1P A;  5J1E A;  3QEI A;  4F3T A;  2NUB A;  3AO5 A;  3SQ4 A;  1NK4 A;  4ELU A;  4FM1 A;  2XY8 A;  1CLQ A;  4DS5 A;  3NF7 A;  1NK8 A;  3OYI A;  2VWK A;  3C94 A;  3LP0 A;  4CEF A;  2FBX A;  1RT1 A;  1NKE A;  2ZE2 A;  4J2B A;  4DU3 A;  4DSF A;  1N5Y A;  4JRQ A;  2DFE A;  4CJK A;  4FCY A;  1X9S A;  1J9A A;  4CE9 A;  1UA0 A;  3V1R A;  4XIU A;  4MQ3 A;  3QEP A;  4B08 A;  4HTU A;  1VSM A;  3MXI A;  5DMR A;  1T03 A;  2LSN A;  4J2E A;  1A5X A;  3TAG A;  1T8E A;  4RW4 A;  4O5B A;  4Y1D A;  4OJR A;  1S6P A;  3TAE A;  3OJS A;  3TAN A;  3LPT A;  1XI1 A;  2IGI A;  4FLZ A;  3CYM A;  1C0M A;  4FK4 A;  1IKX A;  1KVA A;  4AHS A;  1BIU A;  3RMD A;  3K2P A;  5I3U A;  4FJN A;  5KI6 A;  4KAZ A;  1A5V A;  4O4G A;  4CHQ A;  4HUF A;  5HRO A;  4KI6 A;  1U04 A;  2D0A A;  2OZS A;  4DSK A;  4Z4I A;  1BQN A;  1DTT A;  4BAC A;  3VN5 A;  4PY5 A;  4CEO A;  3EY1 A;  1N6Q A;  1RBT A;  2IAJ A;  4RW7 A;  3ZSW A;  5T7B A;  3OYH A;  1BCM A;  4E7H A;  4CJF A;  4FM0 A;  5HRN A;  3ZSZ A;  4IFV A;  1SV5 A;  4I9Q A;  4IBN A;  1RT7 A;  1UA1 A;  3D45 A;  3VQA A;  2F96 A;  4AHT A;  4KO0 A;  1NK9 A;  3AVM A;  3JYT A;  4I2Q A;  3DRR A;  1NJY A;  2YNH A;  4CFA A;  4E1M A;  4FZY A;  3CG7 A;  4I2P A;  4YNQ A;  3V4I A;  3IG1 A;  4CES A;  2D5R A;  3NCI A;  3ULD A;  1S1T A;  3KK1 A;  1K6Y A;  4Z4C A;  1U48 A;  4JS5 A;  4MFB A;  3HK2 A;  3QIP A;  4FJ8 A;  3VQD A;  1TKX A;  3QIN A;  5K14 A;  3U6F A;  4Z4F A;  1G15 A;  1U47 A;  4C8K A;  3NGZ A;  1D8Y A;  2P5O A;  2X6N A;  3LDS A;  4DTS A;  1EKE A;  3HO1 A;  4O0I A;  3THV A;  4O55 A;  2IS3 A;  1TK0 A;  2I5J A;  2HHW A;  1VSF A;  3NH1 A;  4HUG A;  2YHB A;  4B9T A;  4CEB A;  4E7L A;  4DFP A;  3V81 A;  1KCF A;  3CFO A;  4HCB A;  4DWI A;  1FXX A;  3LP2 A;  1HMV A;  3AVB A;  3VQ9 A;  3WNG A;  1EX4 A;  3RRG A;  2P5G A;  1C0U A;  4F2S A;  3K58 A;  3VQ5 A;  4E19 A;  4E3S A;  5J2N A;  1HQU A;  3AO2 A;  4BWJ A;  3QEX A;  1XC9 A;  3M8S A;  4KHQ A;  3LAN A;  3B6P A;  1LAV A;  4K8X A;  3VA0 A;  2IOC A;  2GV9 A;  3OYA A;  4CF9 A;  1ZBF A;  3ZSR A;  4CIF A;  5SWM A;  4PUO A;  3LP3 A;  4K8Z A;  1RDA A;  2OPQ A;  3K59 A;  3AVG A;  4BE2 A;  2RF2 A;  4CFC A;  4FLT A;  1LWF A;  3T1A A;  1T7P A;  4FJG A;  3T3F A;  3AVK A;  4H8K A;  2Z1I A;  3V1O A;  4CK2 A;  2R7Y A;  5FRM A;  2F8T A;  1TGO A;  1QQC A;  5KGX A;  3KD5 E;  4DS4 A;  3DLK A;  2W42 A;  3HP9 A;  3OYL A;  3I0S A;  3OYF A;  4OPK A;  4ZTJ A;  2XY7 A;  3VQE A;  1ASV A;  3AO4 A;  4CIE A;  4DLG A;  1NK7 A;  4B9U A;  4LSL A;  4W5Q A;  3AVL A;  1NJZ A;  3VQC A;  4DTX A;  1U49 A;  1VRU A;  3G10 A;  4N76 A;  1KFD A;  2XHB A;  1KLN A;  4B9M A;  4M3T A;  3HM9 A;  1JLF A;  3LAL A;  4CCH A;  1XHZ A;  4RW8 A;  4EZ6 A;  2P51 A;  1C6V A;  3DM2 A;  2XY5 A;  4IFY A;  3FFI A;  4W5O A;  2B4J A;  1XWL A;  3RTV A;  4FYD A;  4AH9 A;  1FK9 A;  2Z1H A;  3KKS A;  4H4O A;  2FBV A;  1KVB A;  3MAQ A;  4HHT A;  4DQS A;  3NE6 A;  4AHC A;  3DRP A;  1L5U A;  2Q3S A;  5JS1 A;  3AVC A;  3AVH A;  4CFB A;  2ITG A;  4OPJ A;  5C25 A;  4YFU A;  1D9D A;  3KTQ A;  4KB0 A;  2YNI A;  4FW2 A;  2ETJ A;  1C0T A;  4OGE A;  3LZJ A;  4QAG A;  1S1U A;  1UOC A;  3OYJ A;  4DTN A;  2WON A;  3PV8 A;  4FJK A;  4E7J A;  2DY4 A;  4UQG A;  4W5N A;  4TSX A;  1TL1 A;  4AHR A;  2YNG A;  3NF6 A;  4M41 A;  4B9L A;  1CXU A;  4DSI A;  4DSL A;  3M8P A;  1HRH A;  1VSD A;  5CYM A;  2FBY A;  4KHY A;  1WAF A;  3ZCM A;  4B3O A;  2YKM A;  4NYF A;  2RPI A;  4OKJ A;  4DQQ A;  3BDP A;  1KFS A;  4B9V A;  3TI0 A;  5EU7 A;  2B6A A;  2PY5 A;  1Q8I A;  2X6S A;  3IRX A;  4Z0U A;  5CY4 A;  1WSH A;  1HJR A;  4KFB A;  3WNE A;  5J2M A;  1W9H A;  5J2P A;  3LZI A;  5CZ2 A;  1XHX A;  4CJL A;  4CHO A;  3QET A;  1VSH A;  4OLA A;  3OYM A;  1DLO A;  1S1W A;  1TKZ A;  4CJE A;  4FJM A;  1S1V A;  3OYD A;  1NK5 A;  4OGC A;  3KLH A;  3SI6 A;  4FZX C;  3DLE A;  4W5T A;  4CJP A;  4FM2 A;  2B5J A;  4DFK A;  2EX3 A;  3SYZ A;  3DLH A;  1YTU A;  1ZBU A;  2HHX A;  4KB1 A;  1VSK A;  3KLF A;  4OVL A;  3OYE A;  3SJJ A;  1T05 A;  4I7F A;  4CGD A;  1LW2 A;  2FBT A;  3OYC A;  1JL1 A;  1REV A;  1NK6 A;  3SUO A;  3AVN A;  1A5W A;  4Q5V A;  3PX6 A;  4RW9 A;  2YKN A;  1HQE A;  3QEV A;  4DSJ A;  4FJ9 A;  3TAQ A;  2HVH A;  3QER A;  4CGI A;  2YNF A;  4R5P A;  1RT2 A;  3AA2 A;  3O4Q A;  3LAM A;  1B9F A;  4G1Q A;  5CYQ A;  4OLB A;  3HT3 A;  4NCA A;  3L8B A;  1TAQ A;  4CER A;  2DTU A;  3DYA A;  1LWE A;  1QHT A;  5HP1 A;  4F4K A;  4C8M A;  1Y97 A;  3LWM A;  3KK2 A;  2IDO A;  1HYZ A;  1RTH A;  3MEG A;  1NOZ A;  2VWJ A;  3RMA A;  1QE1 A;  3TAP A;  2G8V A;  3HJF A;  1QSY A;  4OKE A;  3NHG A;  3NF9 A;  2Z1G A;  2X78 A;  3HVR A;  3NGI A;  1TV6 A;  2JLE A;  1U45 A;  1NJX A;  2OPR A;  1J53 A;  1RTI A;  3V9Z A;  2QKK A;  1BL3 A;  3KLI A;  4GMJ B;  3L3V A;  1SKR A;  5HBM A;  3TWH A;  5HRR A;  4FJH A;  3S9H A;  2EHG A;  4AHV A;  4Z4E A;  4LD0 A;  1RBR A;  1VK0 A;  1JLE A;  4ZHR A;  1HPZ A;  3O3G A;  2YV0 X;  3LAK A;  3I8D A;  3DLR A;  3I0R A;  4KHW A;  4AIL C;  1HNI A;  1RBV A;  3PY8 A;  2GUI A;  5KRT A;  4FW1 A;  2HW3 A;  4DTO A;  3RMC A;  1YT3 A;  4DTM A;  4CF8 A;  4CGG A;  1C1A A;  5KTQ A;  1KVC A;  4DTP A;  3BGR A;  1CZ9 A;  2E6L A;  3VQ7 A;  3HXM A;  1KSP A;  1FKP A;  4DTU A;  4LY7 A;  2XY6 A;  3D0P A;  2G8U A;  4FJ5 A;  1C1C A;  3PUF A;  4DF8 A;  1MU2 A;  4KKO A;  4J2A A;  2HHV A;  3K5O A;  4FLY A;  2OPS A;  3OYG A;  3U3Y A;  1BGX T;  5C24 A;  4N41 A;  1EXQ A;  4DQI A;  4BE1 A;  3M8R A;  3SUQ A;  4B9N A;  3SUN A;  3DMJ A;  4DFJ A;  3G0Z A;  1JKH A;  4O44 A;  1HYV A;  2PYJ A;  1IO2 A;  4Y1C A;  4N56 A;  1UWB A;  4CFD A;  3NFA A;  4RG8 A;  1NJW A;  4FZZ A;  5SZT A;  3SUP A;  2GBZ A;  2HNZ A;  1RNH A;  1IH7 A;  3C95 A;  2Z1J A;  2IC3 A;  3VQP A;  3CM6 A;  4M3Y A;  1D5A A;  2PYL A;  1EP4 A;  4IKF A;  5E41 A;  1BI4 A;  4CGF A;  1KRP A;  2BGG A;  3MEC A;  1ZBL A;  4QOZ B;  3LPU A;  3DLB A;  3CQ8 A;  3VQB A;  1TK8 A;  2DFH A;  3DOK A;  1GOB A;  2KFZ A;  4ELV A;  5J2Q A;  1S6Q A;  5FDL A;  2O4G A;  4L8R B;  4E7K A;  3DRS A;  1VSE A;  1WSE A;  4CJU A;  3CFP A;  3AA4 A;  4DU1 A;  1J5O A;  3PO5 A;  3OS1 A;  4DQP A;  4N5S A;  4CGH A;  4FVM A;  3MXM A;  1YTA A;  2YHA A;  4B8C A;  4CGJ A;  3SQ1 A;  1LV5 A;  3KLE A;  1GOA A;  3RR8 A;  4KHS A;  1VRT A;  2QXF A;  2PZS A;  1O1W A;  2OYQ A;  2OA8 A;  3ZSY A;  4FLW A;  3OYN A;  4CEE A;  4DQR A;  4Z4G A;  1IKW A;  4KTQ A;  1RBU A;  1S1X A;  1NKC A;  3RRH A;  4CK1 A;  1BIZ A;  1L3U A;  4JLH A;  1WSG A;  4CJQ A;  3OVN A;  3CFR A;  4DF4 A;  3OYB A;  1SL1 A;  1RDC A;  1BQM A;  2KTQ A;  3ZT1 A;  1BIS A;  3AVJ A;  4CHP A;  4KI4 A;  3F73 A;  2D0B A;  3SQ0 A;  3M8Q A;  1J54 A;  4ID5 A;  3F9K A;  3NAE A;  3ZSV A;  1SKS A;  1RBS A;  2KQ2 A;  1NKB A;  4FLU A;  1TK5 A;  2Y1J A;  3P1G A;  4M45 A;  1D9F A;  3L2V A;  4CJV A;  1TL3 A;  4EZ9 A;  3E01 A;  3ITH A;  4I9L A;  1ZBH A;  4BDZ A;  1B9D A;  1I3A A;  2A1S A;  1LAW A;  4F2R A;  4M3R A;  1ZBI A;  4CJ5 A;  3KJV A;  4IG3 A;  2G8K A;  1TKD A;  4PWD A;  4CEC A;  4ZTF A;  2VG7 A;  1X9W A;  4KHU A;  2ZD1 A;  4KRE A;  4KTW A;  5FRN A;  1HYS A;  2BDP A;  3DI6 A;  4ICL A;  3QEW A;  3TAM A;  3CM5 A;  5C42 A;  3K5N A;  2BE2 A;  4Z4H A;  5I42 A;  4CHZ A;  3C6T A;  2E4L A;  1JLC A;  1UAX A;  1BHL A;  3AA3 A;  4N47 A;  5JS2 A;  3ASM A;  2HVI A;  2KZZ A;  1Z25 A;  4CJS A;  3VA3 A;  2QKB A;  4E7I A;  4KPY A;  2HHQ A;  2AJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...