1RBTA

Structural study of mutants of escherichia coli ribonuclease hi with enhanced thermostability
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADGKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Structural study of mutants of Escherichia coli ribonuclease HI with enhanced thermostability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
total genus 53
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rbtA00
3D45A 4DQPA 4J2AA 3QEVA 2B5JA 4FJJA 4JLHA 1SL1A 1QTMA 1TK5A 4N41A 3NH2A 4B08A 3KK1A 2BDPA 1IKYA 1CXQA 3IRXA 1WSHA 3ULDA 4RW6A 5I3UA 4E19A 3SYZA 3ZSWA 4W5QA 2PZSA 2HHQA 3AVFA 1C0MA 1JLFA 1QHTA 3K2PA 1QE1A 1TVRA 3OYGA 3T3FA 4CGFA 3PX4A 1NJXA 3BGRA 3NGZA 3V6DA 5CZ1A 1U45A 4DFPA 1CXUA 2B4JA 2YHBA 4CF8A 4B3OA 1RT7A 3QEPA 2HHTA 4N5SA 4HCBA 4B9TA 1RT2A 4B9UA 4FK4A 1BI4A 2KZZA 4DG1A 3LANA 1NJZA 3DLGA 3TAQA 2G8KA 3V1QA 3M8RA 4J2BA 3DLBA 4EP4A 3M8SA 4FVMA 4FM0A 4RG8A 1RBVA 4M45A 2G8WA 4ELUA 4KO0A 4Z0UA 1BCMA 4PQUA 1X9SA 3LWMA 4FK2A 1VSHA 1VSEA 2XHBA 4DU1A 4FLYA 1U49A 1KTQA 4CERA 4O0JA 4CFCA 3NHGA 3HPGA 3LP0A 4KB0A 4DQRA 4FJ5A 3LZIA 3PO4A 4LY7A 3PUFA 4FZXC 3AA3A 4OLAA 4IBNA 4DSLA 1X1PA 4W5TA 2HHUA 1W9HA 4BDZA 1RT4A 4Q0BA 1S9GA 2OPRA 3HP9A 4C8MA 3SCXA 4CHPA 2VG6A 5J2MA 5FRNA 3K5LA 5HRSA 2XY6A 4FJ9A 3LP1A 2BANA 1NK8A 1VSLA 2IDOA 3SI6A 1U48A 1HJRA 4GVMA 1T05A 4DTNA 2ZQBA 1RILA 4KKOA 2G8UA 1EP4A 3OYNA 2IAJA 4YNQA 2YNGA 4KV8A 4LH4A 3THVA 1RDBA 4CJSA 4CGJA 4DFJA 3QESA 1U04A 1FXXA 1RBSA 1KFDA 1L3SA 1C1BA 4KHYA 1D5AA 3NF7A 4QCLA 2F8SA 3DOKA 1Z26A 3O3HA 4F2RA 4E7JA 4I7FA 3OYMA 3B6PA 4AHRA 1FKPA 2IC3A 3P83D 1SKWA 1S9EA 4FLXA 4W5NA 4M3ZA 5I42A 3VQQA 4AHTA 1NOYA 3O4NA 2YKMA 1ITGA 1WSEA 3OYLA 3QEWA 4DWIA 4FJLA 4KTWA 3AVBA 3ZT2A 1KVAA 3NE6A 4G1QA 4B8CA 4DFMA 4FLUA 1JLAA 3SPZA 3V1RA 1VSIA 4HTUA 2PYLA 1BIUA 1CZ9A 1RTIA 1RT3A 4KTZA 3OYCA 4CF1A 2ETJA 3RRHA 1SV5A 2EHGA 1J5OA 2IOCA 3QO9A 1QSSA 1WSFA 3CM5A 3QIPA 2GV9A 4OKKA 1S1WA 1U47A 4HUEA 5D3GA 4Z4FA 3ZT4A 1XHXA 3CM6A 3KLFA 3G10A 2HNYA 3AVLA 4KFBA 3VQ4A 5CY4A 2HHVA 4CIGA 1S1TA 1RCHA 4E3SA 2RKIA 2QKBA 3L2WA 4H4MA 1QQCA 1RDAA 4DTUA 4B9VA 2Z1IA 2YHAA 3RR7A 4DSEA 1L3UA 3K5MA 4KHUA 3SQ0A 4F3OA 4DTSA 2F96A 4NYFA 4H4OA 3AVCA 4RW8A 3PO5A 4KHNA 4Z4IA 3LAKA 3AVGA 4BE1A 4JS4A 5HRPA 3U3GA 1TL3A 4DSFA 1TV6A 1X9WA 1T03A 4FJGA 3RWUA 1R0AA 4M41A 3ZT1A 1FK9A 3OYAA 4FJXA 1EX4A 1KLMA 5C25A 3AVHA 2O4GA 4O5BA 3ZSXA 2X6NA 3ZT0A 1ASVA 3HYFA 3TAEA 2G8VA 4F4KA 4FJ8A 3AA5X 2KZMA 4DS5A 2XO7A 3IG1A 3VQAA 3OY9A 4DSKA 1KCFA 4IFYA 3O3FA 4N76A 1ZBFA 3OYDA 4CJQA 4CIFA 1I39A 4I9LA 2QKKA 1JXEA 3HP6A 3HL8A 4O0IA 4DQIA 2HMIA 3IAYA 5KGXA 4IDKA 4GMJB 2XY5A 4FLVA 3HSTB 4C8KA 3WNFA 3V9SA 1VSFA 2D5RA 4KRFA 2KFNA 1C6VA 4W5RA 2G8HA 4L8RB 3PV8A 4E89A 3DLRA 4MFBA 4CJLA 1RDCA 4R5PA 3OVNA 4BDYA 3VQ8A 4CF0A 1NKBA 1WAJA 3MEGA 2D0BA 3RTVA 4CCHA 4CEQA 1NJYA 5FDLA 3V4IA 1REVA 4Z4EA 1HQUA 1D8YA 3K59A 4CGGA 3AO4A 3S3OA 3SQ2A 1L3TA 1NJWA 3KLGA 3C94A 3BDPA 4F2SA 3AVIA 3MEDA 4OGEA 4CFAA 3OS0A 5HRRA 4CEFA 4CF9A 3K57A 1N5YA 3ITHA 1VSKA 3S9HA 3VQEA 3NF8A 1KRPA 3OS2A 4CF2A 5KRTA 3CG7A 5E41A 4Z4CA 4B8AB 2BE2A 2ZE2A 4IKFA 3QIOA 3EY1A 1VK0A 4NYNA 5KI6A 4FW1A 3KJVA 3PX6A 3F73A 4AHVA 3RMDA 2YNHA 3SPYA 1HRHA 1LAWA 3EZ5A 3HVTA 3MAQA 4B9SA 2DTUA 1QS4A 1KFSA 2VG5A 4O55A 3S3NA 3SUNA 3PY8A 3TAFA 4LD0A 5HRNA 4ZHRA 4E7IA 4K8ZA 4KPYA 2GUIA 1JL1A 4NCGA 3L2QA 3DYAA 4CEBA 4MQ3A 3SQ1A 3M8PA 3DRRA 3QEIA 4ELVA 4Z4HA 4FLZA 2NUBA 3I0RA 4LSLA 1Z25A 4OJRA 1RT1A 1TGOA 3HPOA 3KK3A 2VWJA 4JS5A 1LWFA 4DTRA 3RMBA 1LV5A 4BACA 1HYSA 3OYFA 2A1RA 3E01A 5KTQA 2P5OA 3L3VA 4CGIA 3LZJA 1EKEA 1WSIA 4FJMA 3AVAA 3CFPA 4CEEA 3NF9A 3V9XA 4M42A 1D9FA 4DTXA 4FZYA 2Z1JA 3L8BA 1JLEA 2OPSA 2LSNA 3MECA 2ITGA 4E1NA 1A5VA 1RNHA 3T19A 4CJRA 1TL1A 3ZSRA 4ID5A 2VG7A 4CE9A 4HVJA 1N6QA 5J1EA 1Y97A 4CGHA 1BCOA 5J2PA 4RW7A 3TR8A 3LP2A 5HBMA 3L3UA 2E4LA 3QNNA 3QINA 4JRQA 1SL2A 4E7LA 1S5JA 3TWHA 4CEAA 1C1CA 2WONA 1I3AA 4K8XA 3M8QA 4ID1A 1NK9A 4HHTA 5JS1A 2FBTA 2KQ2A 4BWJA 1UAXA 2OPQA 1LW2A 3DRSA 3KKSA 3ZSQA 4CHQA 1RTDA 2GBZA 1F21A 1JLQA 4FLTA 4DFKA 2X78A 4CEOA 4IFVA 4I9QA 4NCBA 4W5OA 4M3XA 4KB1A 2HW3A 3L2UA 1JXBA 4DLEA 1IKWA 2XRIA 3I8DA 3K5NA 3L2RA 3HM9A 1NKCA 1J54A 1L5UA 3FFIA 2IS3A 3QETA 3SUOA 3V1OA 3NGIA 1LWCA 3G0ZA 1EETA 1LW0A 3AO1A 4UQGA 3U6FA 4CK3A 5HP1A 1KVCA 2E6MA 3PX0A 3KLIA 3WNGA 3SZ2A 4B9NA 5FROA 4Q5VA 1K6YA 3L2VA 2QK9A 3C95A 3IS9A 4AILC 3RMCA 2P5GA 3VA3A 3H08A 4N47A 1J53A 2D0CA 4CJ3A 4CHOA 3CFRA 2IGIA 1HYZA 4LH5A 1IKXA 2DY4A 4CJPA 1HQEA 1RT6A 4AHCA 3V81A 1JL2A 1RBUA 2DFHA 3ALYA 3TAGA 3QEXA 1T7PA 2HHSA 2BGGA 4Y1DA 3NDKA 2PYJA 1YTAA 5HLFA 2ZD1A 1VRUA 4IG0A 2WOMA 3ISNC 4OPJA 2W42A 3NH0A 1CLQA 3AA2A 3AO3A 3LWLA 3U3YA 3P1GA 4CHYA 3MEEA 3KKRA 1UA1A 4PY5A 1TKTA 2RF2A 3O4QA 1TKZA 4M3RA 3V9WA 4BE2A 4NCAA 3NBPA 3QNOA 2JGUA 3AVMA 1SL0A 3ZSYA 3KLHA 3SV3A 3T1AA 3CFOA 1TKXA 3P5JA 5CZ2A 3V9ZA 1B9DA 4FW2A 2XY7A 1HYVA 4PA1A 1QSLA 1Q9YA 2RPIA 3SQ4A 2HHWA 2OZMA 4H8KA 3F9KA 2FBVA 3NFAA 3KK2A 1IKVA 3DI6A 1KLNA 4ZTFA 3ZSVA 4ZTJA 2HNZA 3NH1A 4CFBA 4HUGA 3AVKA 3V9UA 4FJNA 1BI4B 1YVUA 5K14A 4AHUA 3OJUA 3OYJA 1BISA 4BDPA 4E0DA 3ZSZA 3RRGA 3DOLA 4RW4A 2OYQA 3ZCMA 2PY5A 5C42A 4DQSA 2FBXA 4CJKA 3K58A 1XI1A 1HNVA 4Z4GA 1VRTA 3HK2A 3VQ9A 1RTHA 1JKHA 1XWLA 2YNIA 3DLHA 4AH9A 1GOCA 2DFEA 4WE1A 3NAEA 1C1AA 5C24A 3HXMA 1C0UA 1YTUA 2G8FA 1IO2A 2RN2A 4CHZA 2YKNA 4EP5A 4CHNA 2XY8A 1S1XA 1S1VA 5JS2A 1TAQA 1T8EA 3KD5E 4M3WA 4FZZA 4KREA 3HO1A 2R7YA 4OKEA 4OPKA 4CJTA 1W0HA 1QSYA 4DQQA 3UIQA 3AV9A 3A2FA 1NK5A 2FC0A 4KHSA 3OYEA 3OS1A 1LWEA 1UOCA 2HNDA 3LPTA 3C6UA 4CEDA 4FJIA 3SNNA 4OGCA 5DMRA 1B92A 4E1MA 2E6LA 3AA4A 3DMJA 2OPPA 1A5WA 4KHQA 1WSGA 3S3MA 1NKEA 1RT5A 2ATQA 4PUOA 5T7BA 3KTQA 3KD1E 1NOZA 4CJVA 4HUFA 2YNFA 3QERA 3RR8A 3WNEA 4EZ9A 1MU2A 1CZBA 4I2QA 4QOZB 4FK0A 3NGYA 4PWDA 3DLEA 1B9FA 4TSXA 5EU7A 4BWMA 1WNSA 3AO2A 4DTPA 1NK6A 1J9AA 1YT3A 3AVJA 3NF6A 3ZT3A 4J2EA 4KHWA 2JLEA 2VWKA 3B6OA 3C6TA 3VQBA 3VQDA 4FCYA 1L3VA 4B9MA 4DSIA 4CJEA 1DTQA 1S1UA 4CEZA 4FXDA 1SKRA 4E7KA 2X74A 1JLGA 4E7HA 2Q3SA 2AJQA 3K5OA 3VN5A 2B6AA 4KI6A 3TAMA 4QAGA 1DTTA 1UA0A 1Q8IA 4CIEA 4KAZA 3HT3A 3WNHA 3LPUA 3OYBA 1BGXT 1LAVA 4DF8A 2QXFA 3TARA 1XC9A 4F3TA 1RBRA 3LALA 5SWMA 1UWBA 4DS4A 4DU3A 4C8NA 4OKJA 4AHSA 1ZBLA 2I5JA 4N56A 2OA8A 4C8OA 4J2DA 4JRPA 3DM2A 4CJUA 4DU4A 1ASWA 3OYKA 1TK8A 2Y1JA 4CK1A 3OYIA 1S6QA 1GOBA 1C0TA 4CJWA 1RDDA 4XIUA 3SJJA 4FM1A 2KW4A 4DTOA 3QLHA 1VSDA 1A5XA 1ZBUA 3DRPA 3SV4A 4I2PA 4CGDA 2Z1HA 3AO5A 1GOAA 3TI0A 4M3UA 4CECA 1BIZA 3O3GA 3NCIA 4RW9A 1O1WA 2Y1IA 1VSMA 1IG9A 1TAUA 1G15A 2YV0X 1TKDA 4EZ6A 1KVBA 3VQ6A 4FYDA 3VQCA 1SUQA 1IH7A 2A1SA 1RTJA 4DLGA 4DSJA 1X9MA 4HCCA 3EYZA 2P1JA 1D9DA 1HMVA 2O4IA 4O44A 3TAPA 1WN7A 1KSPA 3VA0A 2D0AA 3ZSOA 2P51A 3SUPA 4DF4A 3VQ7A 4FLWA 4KTQA 2F8TA 3LP3A 1NK4A 3LDSA 4FJHA 5KGWA 3JSMA 1JLCA 4FM2A 1FKOA 1RBTA 3MXJA 3MXIA 4FJ7A 2HVHA 4CK2A 3DLKA 3AVNA 3HJFA 3MXMA 1EXQA 4LSNA 5SZTA 5J2NA 3CYMA 3OYHA 5CYQA 3VQ5A 1S6PA 1WAFA 3OJSA 1BQNA 4FJKA 1WLJA 4ICLA 3VQPA 3TABA 1BQMA 3RMAA 4C8LA 4CJFA 3KIOA 4CJ5A 5FRMA 5KRSA 5HROA 4DMNA 4DTJA 4F8RA 5DK5A 1BL3A 1BHLA 1HPZA 2Z1GA 4Y1CA 2KFZA 4O4GA 4OVLA 5CYMA 3I0SA 4DTMA 4B9LA 2HHXA 1Q9XA 1ZBIA 2DFFA 4BE0A 3LAMA 5J2QA 3TANA 1TK0A 3SUQA 4GW6A 3D0PA 4IG3A 2X6SA 1DLOA 1ZYQA 1HNIA 3KLEA 1VSJA 2OZSA 3HPHA 3ASMA 3HVRA 4M3TA 4ELTA 4YFUA 4CFDA 1ASUA 1SKSA 3JYTA 3CQ8A 4M3YA 4OLBA 2HVIA 4CESA 1JLBA 2EX3A 1WSJA 4CJ4A 2HB5A 2FBYA 1XHZA 1U4BA 4KI4A 1NK0A 1ZBHA 2G8IA 1NK7A 2KTQA
chains in the Genus database with same CATH superfamily
4XH4A 1QTMA 4B08A 1BA1A 1IKYA 4NO7A 3H46O 1DKGD 2P9IA 4RW6A 4FSVA 5BR8K 4BRGA 4E19A 1K9MO 4JI4K 1QE1A 3OYGA 3T3FA 4ISEA 4CZGA 1NJXA 2B4JA 1RT7A 4HCBA 4B9TA 2VGMA 2W40A 1NJZA 5M1FA 4YOYA 3TAQA 4EP4A 3M8SA 2EWSA 1RBVA 4ELUA 5GIPA 1BCMA 3LWMA 1VSHA 4FLYA 3NVKA 1YUWA 3EE8A 4LY7A 4A2BA 3O9SA 3P38A 5TKWA 5AQGA 3P31A 2Q0RA 1X1PA 4BDZA 1WBDA 3SCXA 2VG6A 2VCPA 1VQ9N 3K5LA 5C0YA 4G9ZA 5AFUA 2YHWA 1T05A 2G8UA 1NGDA 2ZQBA 2ZM6K 4A57A 2IAJA 2YNGA 4CGJA 3EN9A 3DXKA 4DFJA 3QESA 1U04A 1ZC6A 5EX5A 4CZEA 1KFDA 1C1BA 4KHYA 4QCLA 2HBLA 4EAHD 5GIOA 1BU6O 3O3HA 1U6ZA 4JNEA 2NRHA 4YDUC 2P9SB 2QWMA 1VQ7N 3TSUA 4W5NA 4M3ZA 3HTVA 3C6HA 2QI2A 3WXKA 1WSEA 4DWIA 1ATSA 4FJLA 3J7AP 2O8EB 3AVBA 4G1QA 5AQQA 4B8CA 2P9UA 3SPZA 2D0OA 1BIUA 3RVCA 1RT3A 1NWKA 2ETJA 3H1VX 2EHGA 3RRHA 3QO9A 4BREA 1HKBA 4YHHK 1U47A 4Z4FA 3ZT4A 3C0BA 3GDQA 4KHPK 1K8KA 3LM2A 3D7EO 4IO8A 5CY4A 2QWOA 4DTUA 2FSKA 2YHAA 3RR7A 4KHUA 1NU0A 3SQ0A 1VQLN 2F96A 4NYFA 4H4OA 3AVCA 4KHNA 3ID6A 4BE1A 3DXMB 3MMVA 3U3GA 1TL3A 1T03A 1TV6A 3SK3A 3RWUA 4BC5A 3ZT1A 2UU9K 2ZF5O 2BGGA 1VQMN 1ASVA 4BRDA 4F4KA 4FWPA 3IG1A 5AQFA 4XH1A 3IDHA 2QKKA 4I9LA 1WOQA 1JXEA 3BZCA 2QWNA 1HNWK 3JS6A 2HMIA 2QWPA 2GX9A 4GMJB 2XY5A 4C8KA 3THXB 3VF6A 5BRDA 3MN9A 3WNFA 4KRFA 2D5RA 3OBYA 4YORA 2G8HA 3FZKA 4FWMA 3HZ6A 1IBLK 3QDKA 3E9LA 1OKJA 1NJYA 5FDLA 2NNWA 1REVA 4FOEA 3V4IA 4Z4EA 1D8YA 4A5AA 4JD2A 4ISFA 3K59A 3AO4A 1L3TA 1DT9A 1VHXA 4BG8A 4CFAA 5BR9A 3ITHA 4JEPA 4FWLA 4QS9A 4JK9A 5GAEP 3OS2A 3T69A 4BRNA 4CF2A 1GLLO 2BE2A 2ZE2A 4GKJK 2VQEK 2NRTA 3PX6A 3RMDA 3F73A 2QWRA 3IFRA 3EZ5A 5GAHP 4B9SA 2DTUA 2HMPA 1NMNA 3PY8A 4YDUA 2O8BB 3PIOL 3O80A 4CBUA 4KH5A 3DRRA 3E1YA 2NUBA 4DTRA 1RT1A 2WBNA 4BGAA 4BR9A 3ULEA 2UYTA 5KTQA 2UUBK 2P5OA 3L3VA 3F5TA 1EKEA 1WSIA 1KQSM 2E2PA 2PFUA 5FPNA 5B8HA 2Z1JA 3L8BA 4B3RK 4H5WA 1N6QA 2IIRA 3TR8A 2WFBA 4BGBA 1YIJN 5HOOA 3TWHA 5FPMA 4BC4A 2KQ2A 2BH1A 3DRSA 2WUSA 4FLTA 1O13A 1TUYA 4OX9K 3M1FA 2HOEA 1XNQK 1IKWA 2XRIA 4YY3K 1J54A 3FFIA 3SUOA 3O1BA 5HP1A 3U6FA 2E6MA 2UXCK 3SZ2A 3EL2A 4B9NA 4ILGB 2V7ZA 3L2VA 4Y0WA 3O9TA 3RMCA 3CC2N 1J53A 4CJ3A 3CFRA 2DY4A 4AHCA 4DV0K 2E8AA 1RBUA 3ALYA 1T7PA 4Y1DA 2NRZA 3MX2A 4JYAK 4IG0A 2WOMA 3ISNC 3M6GA 4H0YB 3LWLA 3U3YA 4CHYA 4HWIA 2RF2A 3J81O 2FSNA 1I94K 3QNOA 3U4LA 3ZSYA 2AA4A 3CFOA 1TKXA 3FLCO 3V9ZA 3D2EB 4FW2A 3T7ZA 1N34K 1OH7A 1HYVA 2ASMA 3NVMA 2RPIA 4GV6A 3BF3A 3H6EA 4H8KA 1U2VB 2YHYA 1LCUA 3EEQA 5H1SQ 2HNZA 3A5MC 4WFBL 3J8AA 3AVKA 4YOXA 3OYJA 4BDPA 1NGFA 2KHOA 2P9KA 3RRGA 3DOLA 3CCVN 1HUXA 5C42A 1XI1A 1IBMK 3LDPA 3VQ9A 1RTHA 1JKHA 2YNIA 4UY8O 3B8AX 2G8FA 2RN2A 4EP5A 4CHNA 2KLAA 1QVFM 1S1VA 1HX1A 1X3MA 1YITN 4M3WA 1C0GA 3L4IA 4CW7B 5LMNK 4OPKA 1NK5A 2W6LA 5AQJA 4BRQA 3OYEA 1EQYA 1MA9B 1QQMA 4CEDA 5DMRA 4A61A 5F1XA 3UE5A 2OPPA 3P39A 1VAZA 5T7BA 3KTQA 4PHTX 3QERA 4NLBA 3MCPA 4EZ9A 1MU2A 4QOZB 4I2QA 5KPRA 3NGYA 3DLEA 4BRCA 1WNSA 2P9LB 4DTPA 1ILYA 3NF6A 3ID8A 5AQZA 2VWKA 3C6TA 2PAVA 4CBWA 1DTQA 3SLCA 4AM7A 4FXDA 1SKRA 2A5XA 4Z94A 2B6AA 3TAMA 4QAGA 1J5EK 3CI5A 3OYBA 5M1QA 4WFNL 4DS4A 1SAZA 2I5JA 3U9DA 4WQ4A 3DWLA 2GEMA 3SBTA 4CK1A 1OH5A 4XIUA 2I7PA 3FZLA 2RHKA 1VQON 1A5XA 2Z1HA 3TI0A 4ISGA 3VF2A 3DAWA 3NCIA 2E1ZA 3SMPA 1G15A 4EZ6A 1KVBA 4YOVA 4DSJA 4HCCA 3EYZA 3CC4N 1WBBA 4QS8A 1D9DA 2O4IA 3VETA 3BEXA 4DF4A 1XC3A 4KTQA 3CJ7A 4FJHA 5KPTA 5BRHA 3WXLA 2O8DA 4FVUA 1FKOA 3JAMO 4WYBA 3DLKA 1EXQA 3VQPA 2JWLA 3RMAA 3EZWA 5FRMA 4MO4A 5HROA 3FFKB 4DMNA 4DTJA 5DK5A 1BL3A 1BHLA 3K9KA 3VGKA 2KFZA 2ASOA 3I0SA 4DTMA 3IMXA 1KAYA 3R8EA 3TANA 1TK0A 2QEXN 3SUQA 1TYQB 4GW6A 3D0PA 1DLOA 1ZYQA 3KLEA 3CJ9A 4BR4A 3ASMA 1ATNA 4LFAK 4M3TA 3WXIA 4I6MB 4YOUA 3FZFA 2FBYA 1NK7A 2GWKA 2B5JA 1Q86O 1NGAA 4FJJA 4BR5A 1SL1A 3NH2A 3KK1A 3KZBA 4PKGA 1W97L 3F2KA 2PZSA 3AVFA 4U7BA 3K2PA 3NGZA 5CZ1A 1U45A 1CXUA 4B3OA 3K0SA 1RT2A 4B9UA 3QFUA 4DG1A 3LANA 3DLGA 3V1QA 4PKIA 3M8RA 4J2BA 4FM0A 4FVMA 4C1NI 2G8WA 3WQTA 5C2FA 3VEVA 1X9SA 4DV6K 2XHBA 5EVZA 4CERA 3L4QA 4CFCA 3HPGA 3LP0A 3KVGA 3D2FB 3LZIA 2E2QA 5AQLA 4FZXC 3AA3A 4OLAA 4W5TA 4GY2B 2BTFA 4MDAA 1NK8A 5GADP 1VSLA 1XMQK 1U48A 1RILA 4KKOA 3OYNA 1SS6A 4YNQA 4KV8A 1RDBA 4WCEL 1RBSA 3NF7A 1JCFA 3CJ1A 4K42A 4DR5K 1DGKN 2A42A 5M1PA 4FLXA 2HBMA 3HRGA 1ITGA 3R9PA 2WC9A 3OYLA 4AM6A 1BA0A 3NE6A 4RWTA 4FLUA 3KK7A 1HKCA 2GTDA 1N33K 4DB3A 4HTUA 1CZ9A 4KTZA 1V4TA 4GV3A 2IOCA 3G71N 3HI0A 5AZJB 3QIPA 2GV9A 3VEWA 2QM1A 1XHXA 4B3TK 5BN8A 2HHVA 1MWMA 4CIGA 1S1TA 3C7NB 2D1KA 4E3SA 2RKIA 2KKZA 4C1NK 4H4MA 2QKBA 1E3MA 1RDAA 2Z1IA 4DSEA 3K5MA 4QS7A 4F3OA 4RW8A 3PO5A 4K0KK 4JN4A 3AGRA 5KPZA 4JHDB 4BR0A 2OCEA 1YJWN 3I8BA 1X9WA 5AJ3K 3BUZB 3R3LA 1R0AA 3TTDA 1FK9A 1T6CA 4FJXA 5C25A 3VTIA 4FJ8A 3ZT0A 2X6NA 1BDGA 3VQAA 3OY9A 2OANA 3O3FA 4DSKA 3H3NO 1BOTO 2VWBA 4CJQA 4CIFA 1I39A 3G25A 5BN9A 3UKRB 4O0IA 4DQIA 3IAYA 3H1QA 3HSTB 2CH6A 2KFNA 1VSFA 4W5RA 4E89A 1RDCA 2P9PB 3VQ8A 1NKBA 1WAJA 2D0BA 4CEQA 3DXMA 5GAGP 4JK7A 3AARA 3S3OA 4F2SA 3AVIA 3MEDA 4OGEA 5HRRA 4CEFA 1H1VA 3KWGA 3S9HA 4FWQA 3NF8A 4H0XB 3EO3A 3OHRA 3CXCM 5AZIB 5KRTA 4BC2A 3CG7A 4Z4CA 4EFHA 3MDQA 3EY1A 5KI6A 3KJVA 4FW1A 4H0OA 4AHVA 2YNHA 3HVTA 3MAQA 3SBGA 3O9QA 4O55A 4CZIA 1RGIA 3TAFA 4LD0A 4BRFA 2A40A 4EHTA 2Q0UA 4OO1J 4DR7K 3T1YK 5JLFA 4ELVA 3I0RA 4LSLA 1Z25A 4OJRA 3HPOA 3KK3A 3WEEB 1K8AO 1QZ6A 1HYSA 3OYFA 1XUPO 3VENA 4FJMA 3V9XA 4PL8A 1NM1A 4FZYA 3O9UA 2OPSA 5LJWA 2LSNA 4FWKA 4CJRA 1A5VA 3J7YP 3QEWA 3ZSRA 2V51B 4JKGB 1BCOA 4H0VB 3ZEUB 4RW7A 2P9NB 5AQMA 3THWB 4JRQA 2O8BA 2Q97A 3QBXA 5AQHA 4IOAL 1C1CA 2WONA 4NLCA 1VQ4N 1IBKK 2FLOA 3KKSA 4WQ5A 3ZSQA 5BPLA 1JLQA 2X78A 4CEOA 4IFVA 2HW3A 5IT9O 3I8DA 1QVGM 1KD1O 1OVQA 3HM9A 1L5UA 3OTOK 3UKUA 1WUAA 5JVGL 3V1OA 3ATVA 3G0ZA 1EETA 1KVCA 3TU5A 3PX0A 3KLIA 4Q5VA 1K6YA 1MDUB 1BUPA 3C95A 2AP1A 4N47A 1HYZA 1IKXA 3GE1A 4BRPA 1TAUA 1ZBSA 3VPZA 2PYJA 3NDKA 1VRUA 2YI1A 3UB5A 1T6DA 4H5NA 5TKYA 4OPJA 3FGUA 4CZJA 4PY5A 3MEEA 1UA1A 3O4QA 4WFAL 4NCAA 4BE2A 3NBPA 3AVMA 4LF6K 4IDHA 3SV3A 3CCUN 2XY7A 5FPDA 1QSLA 3AY9A 3QMLA 4O8KA 3NFAA 3KK2A 4J8FA 4DR4K 2QTDA 3ZSVA 4JKEA 1Q81O 3NH1A 1EO1A 4BR2A 4HUGA 4FJNA 1FJGK 4F9OA 4DQSA 2FBXA 2YX6A 5AR0A 1GOCA 3NAEA 3PIPL 3HXMA 5C24A 1C0UA 3CERA 2QW9A 2RE2A 1YTUA 4CHZA 2YKNA 5JS2A 1TAQA 2NZTA 1Z6RA 3LDOA 4KREA 2E20A 3HO1A 2R7YA 1KXPA 5HL7L 2FC0A 3JXUA 1LWEA 1KC8O 2E6LA 2O8CB 3S3MA 1RT5A 3TSPA 3CCJN 4PUOA 3EKUA 4CJVA 2YNFA 3TPQA 4KH6A 3WNEA 1CZBA 2Q36A 4PWDA 4BWMA 1B9FA 3H45C 5EU7A 1NK6A 1YT3A 5JVHL 2E5LK 1FW6A 4L3QA 4DSIA 1S1UA 3IUCA 4JI8K 2X74A 2Q3SA 1DTTA 4FWOA 1Q8IA 4LFCK 4KAZA 2P9UB 3TARA 3LPUA 3WQUA 2QXFA 4DCHA 1GLJO 3LALA 1UWBA 5C15A 4AHSA 4OKJA 1ZBLA 3A0IX 4N56A 2J4RA 3A8YA 1ASWA 1YJNN 1TK8A 2Y1JA 1S6QA 1K8KB 1RDDA 3SJJA 3QLHA 3DRPA 1NGEA 4CGDA 1GOAA 1BIZA 2Y1IA 1O1WA 4B1YB 5CR4A 4DLGA 2GELA 2P1JA 1P8ZA 1VQ6N 4O44A 3CMAN 4LF5K 3M3ZA 2D0AA 3ZSOA 4CZKA 3VQ7A 4WQ4C 3WXMB 4DV7K 4CZMA 5FLXO 4FJ7A 3MXJA 3MXIA 4CK2A 3G4SN 3MXMA 3A5LC 3VQ5A 4R79A 4BY9C 3AAQA 4ICLA 3U9ZA 1RFQA 5DM7L 1BQMA 2W6KA 4JI2K 2VGNA 4M63C 2Z1GA 5AQNA 5CYMA 5CHIA 4B9LA 5ADXH 3IKMA 3CCRN 4BVOA 1YAGA 3VESA 3HM8A 4JD2B 3DJCA 3L0QA 5LL6Z 3ENOA 4ELTA 1SKSA 4CD1A 3JYTA 3CCMN 5EY4A 1JLBA 4CJ4A 1U4BA 2HB5A 1N36K 4KI4A 4MLHA 4K8ZA 2KTQA 2GUPA 2O8FA 3QEVA 3HOTA 2Q2RA 3H3OB 2E1YA 2BDPA 3IRXA 5AQWA 3ULDA 5I3UA 3ZSWA 5DM6L 4W5QA 2HHQA 1QHAA 1QHTA 4X62K 3SMSA 2D0PA 3PX4A 3BGRA 3V6DA 1TYQA 4DFPA 4CF8A 3QEPA 4N5SA 1K73O 2BUPA 4MDBA 4FK4A 1BI4A 2KZZA 4O8UA 4GKKK 3ULEB 2G8KA 3VOVA 3DLBA 2Q1NA 4B1UB 4RG8A 2FSJA 3CD6N 1T44A 1U49A 1KTQA 3NHGA 3RSEB 4KB0A 4FJ5A 4XH5A 3PO4A 3VEYA 1JJ2M 4IEIA 1NLVA 1RT4A 1S9GA 4CHPA 4IEEA 3VF4A 5J2MA 5FRNA 3O08A 5HRSA 4BQLA 4FJ9A 3LP1A 2BANA 2CGJA 2IDOA 4B1WB 4DR3K 3SI6A 1EP4A 3LDNA 3THVA 2V7YA 1L3SA 5AQVA 2UXBK 1Z26A 4F2RA 3E66A 4I7FA 4ILJA 3OYMA 3B6PA 3FZHA 4JAXA 3SAGA 1Y64A 1S9EA 2JWKA 4B1XB 3VQQA 5I42A 3BP8A 3AGKA 3O4NA 1GLEG 2ZGYA 4KTWA 3ZT2A 5KQ8A 3I33A 3O8MA 4KH4A 1JLAA 1VSIA 2HBJA 2PYLA 4MLEA 3OYCA 5AQSA 4CF1A 4FO0A 1J5OA 3BY5A 2FF3B 4OKKA 5D3GA 2NRWA 3CM6A 3G10A 2QA4N 1ATRA 2HNYA 1NMDA 1DEJA 2YJEA 1L3UA 3ZX0A 3AVGA 3E9OA 1OH6A 4DV3K 2P9KB 5LMUK 5AQOA 4BG9A 3OYAA 5BREA 1EX4A 1G99A 4O5BA 3HYFA 2CGKA 2NRVA 2XO7A 4IFYA 4IOCL 1ZBFA 5E84A 3OYDA 1HNXK 3TSQA 3HP6A 4CZLA 3C7NA 1EWRA 3CQXA 5KGXA 1NGBA 3A5NC 1VQPN 1M1KO 2A3ZA 5E26A 4BVPA 1C6VA 2A41A 5AQKA 3RTVA 4CCHA 3VERA 3ZETA 1Q7YO 1HQUA 5KQDA 3VGMA 3SQ2A 1NJWA 3KLGA 3BDPA 5AQRA 1NGJA 4CF9A 1V4SA 3K57A 4BC3A 1SQKA 1GLBG 1KRPA 1HNZK 5AQUA 5E41A 4M7XA 5IWAK 4B8AB 2NLXA 4IKFA 1VK0A 4NYNA 2YJFA 1HRHA 1QS4A 2VG5A 1S3XA 3SUNA 5HRNA 3OBWA 4ZHRA 4IO9L 2F4VK 3GG4A 4E7IA 2GUIA 1JL1A 1TUUA 4NCGA 2I7NA 5ADXA 2E88A 4MQ3A 3SQ1A 5M1NA 1OH8A 3VTHA 4Z4HA 4FLZA 2VWJA 4JS5A 3RMBA 4BACA 1NNEA 3LZJA 3QFPA 3AVAA 3CFPA 4CEEA 4M42A 5AZIA 3BZKA 4IZ9A 1D9FA 3VEOA 4OPHA 4DTXA 3C6AA 5BPMA 3MECA 3E9PA 4E1NA 2ITGA 3T19A 4ID5A 4HVJA 2NRRA 5MLCQ 5HBMA 2E4LA 3QNNA 4E7LA 3ZLJA 2W41A 5FPEA 4CEAA 4JV5K 3N4QA 3WT0A 4K8XA 2O8DB 3M8QA 3QICA 4JK8A 1NK9A 4HHTA 1UAXA 2OPQA 2GWJA 3WUHA 1RTDA 3HOSA 1F21A 4YOTA 4I9QA 4BRKA 4W5OA 1P90A 4KB1A 4B3SK 3L2UA 4DLEA 1M90O 3K5NA 3L2RA 1NKCA 1GLCG 3CHWA 5CE3A 4LF9K 1YJ9N 2IS3A 3CJCA 1LWCA 1LW0A 4FPAA 4CK3A 3CIPA 1J6ZA 2P9SA 4RCHA 5AQTA 3THWA 4GV9A 4AILC 3H08A 1C0FA 2D0CA 4A59A 4CHOA 2O8EA 4WQ5C 4LH5A 1NGGA 1D4XA 5HLFA 3MN6A 2W42A 1CLQA 3AA2A 3AO3A 2H3GX 3P1GA 4M3RA 2OTLN 1VQNN 2JGUA 1SL0A 4BRIA 2DPNA 3T1AA 5BRFA 5CZ2A 3THYB 1Q9YA 3SQ4A 2HHWA 3F9KA 2FF6A 4MO5A 1KLNA 1YXQA 3W3DA 4C23A 1S72N 2HHHK 3Q7CA 1BISA 3ZSZA 1VQ8N 4HTLA 3ZCMA 2PY5A 4JKFA 4Z4GA 3HK2A 1HNVA 1VRTA 2NRXA 1XWLA 4AH9A 3D6RA 2DFEA 4WE1A 1C1AA 3Q7BA 4CVNE 4CZHA 1GLFO 1IO2A 1NBWA 4IFEA 2XY8A 4BR7A 1NJIO 1T8EA 3KD5E 4FZZA 3THXA 4GVEA 4H5TA 5GINA 1W0HA 4DQQA 3AV9A 3OS1A 3LPTA 3C6UA 4FJIA 3SNNA 4BQZA 4OGCA 3R1XA 4E1MA 3AA4A 3DMJA 4IJAA 4M7YA 1A5WA 4KHQA 1NKEA 3J80O 4HUFA 4AF1A 4FK0A 3VGLA 3TTFA 1BO5O 3AO2A 1OVYA 3AVJA 1XMOK 4J2EA 1E4FT 2IVNA 2JLEA 4BRLA 3B6OA 4B9MA 3VQBA 1L3VA 4CJEA 4CEZA 3MCAB 1S22A 4E7KA 1JLGA 4E7HA 2AJQA 3K5OA 4ILHA 1UA0A 1T3VA 4CIEA 3HT3A 1LAVA 4DF8A 1XC9A 4LFBK 5SWMA 4X66K 2ZJRL 4J2DA 2O8CA 3DM2A 4DU4A 1YI2N 3OYKA 3NMUA 3ATUA 3OYIA 4CJWA 4LF4K 4DTOA 3SV4A 1X9JA 3AO5A 3O3GA 4RW9A 4KBOA 1VSMA 1TKDA 2YCHA 3VQ6A 3QBWA 4DR1K 5ELZA 1WN7A 1KSPA 3SUPA 4JI5K 2F8TA 4OPAA 1NK4A 3VEZA 5KGWA 3O1WA 1JLCA 2HVHA 2D4WA 1GLDG 3AVNA 3HJFA 5SZTA 5J2NA 3CYMA 4A2AA 1WAFA 3OJSA 1JCGA 1WLJA 1LOTB 3CJBA 4C8LA 3KWIA 4BROA 4EIAA 1QZ5A 3MN5A 1W7AA 4B9QA 2HF3A 4F8RA 2P9IB 1HPZA 4Y1CA 4O4GA 2HHXA 1Q9XA 1ZBIA 3MK6A 5J2QA 3SAFA 4IG3A 2X6SA 2OZSA 3HPHA 3CCQN 1ASUA 3CPWM 4FWSA 3CQ8A 4M3YA 4OLBA 1WSJA 4JI0K 1NK0A 1ZBHA 2G8IA 4O5FA 3D45A 1NGHA 5LY3A 4DQPA 4JLHA 4JKDA 1TK5A 4CBXA 1CXQA 4IXCA 3D2EA 1WSHA 4CI6A 4H5VA 2QXLA 3SYZA 1C0MA 1JLFA 1U2VA 1TVRA 4CGFA 4DV2K 2YHBA 2HHTA 3FR0A 4DUZK 3DXKB 5EOYA 4M45A 4KO0A 4Z0UA 2A6AA 4PQUA 4FK2A 2HBKA 1VSEA 2V52B 4DQ8A 4DU1A 4O0JA 3LL3A 3HBTA 4DQRA 3DLLL 3MX5A 5AQIA 3PUFA 1W2BM 4IBNA 1Q82O 4DSLA 1KAZA 2HHUA 1W9HA 4X64K 4Q0BA 3U8XA 2OPRA 3EKSA 3HP9A 3QB0A 4C8MA 2QWLA 2UUAK 2XY6A 1HJRA 4GVMA 4DTNA 5C10A 4LH4A 4CJSA 1FXXA 1D5AA 5M1OA 3UKUB 4AQYK 1HPMA 2F8SA 3DOKA 3G6EN 2P9LA 4E7JA 3RSEA 4H5RA 3OW2M 3VMFB 4AHRA 1NGIA 1FKPA 2IC3A 3P83D 4JI7K 1SKWA 4FL9A 3PSIA 3S41A 4AHTA 1NOYA 4FWNA 2YKMA 3HSCA 1HKGA 1KVAA 2IVOA 4DFMA 3V1RA 5F0XA 3I55N 1RTIA 1SV5A 1QSSA 1WSFA 3CM5A 1S1WA 4HUEA 1JCEA 3CF5L 3KLFA 3GL1A 3AVLA 4KFBA 3VQ4A 4JKHA 2HSTA 1RCHA 4B1ZA 3L2WA 1QQCA 4B9VA 4NB4A 4DTSA 4Z4IA 1XNRK 3LAKA 1X3NA 2Q31A 4JS4A 5HRPA 4DSFA 4FJGA 4M41A 1KLMA 3AVHA 2O4GA 4K41A 3ZSXA 2G8VA 3TAEA 3AA5X 3K9JA 2KZMA 5AQYA 4DS5A 5AQXA 1KCFA 4N76A 2ZGZA 3O6WA 3AAPA 3HL8A 3ZX3A 4H0PA 3GBTA 2UUCK 4IDKA 4FLVA 1HJOA 2PBDA 3V9SA 4BRHA 4L8RB 3J7ZO 3PV8A 3DLRA 4MFBA 4CJLA 4R5PA 3OVNA 4BDYA 3W0LA 4CF0A 4PKHA 4EHUA 3MEGA 4CZFA 4CGGA 3CCSN 3O9RA 3OA9A 3SJHA 3C94A 3OS0A 4I6MA 2F7TA 3GOIA 1VSKA 3VQEA 1IG8A 4DKWA 3MN7A 4JKCA 5C12A 3PLAA 2ZJPL 4DV5K 3QIOA 5C2DA 2FXUA 1NG9A 4J2AA 3SPYA 3LDLA 1LAWA 1RDUA 5AQPA 1KFSA 3S3NA 5JLHA 4IWVA 4KPYA 3L2QA 3DYAA 4CEBA 2OTJN 3M8PA 3QEIA 4IOXA 4GNIA 1TGOA 1LWFA 1LV5A 2UXDK 2A1RA 3E01A 4CGIA 1MWKA 3NF9A 3CETA 4DV4K 3FE1A 3CCEN 5I9EB 1YF5L 2YHXA 3KHYA 1JLEA 1GLAG 3F9MA 3MWPA 1RNHA 1N5YA 4N41A 1TL1A 2VG7A 3D2FA 4BRAA 4CE9A 5J1EA 1Y97A 4CGHA 4NXMK 5J2PA 1N8RO 3LP2A 3L3UA 3O5BA 4A62A 3QINA 1SL2A 1YVNA 4DR2K 1S5JA 4V19S 4B1VA 4DR6K 1I3AA 3O4WA 4ID1A 1CZAN 5JS1A 2FBTA 3T1HK 3L6QA 4BWJA 1LW2A 4CHQA 2ZJQL 2GBZA 4NCBA 4DFKA 1YHQN 3VEXA 4JI3K 3BF1A 4M3XA 1JXBA 4JI6K 1NGCA 5JMVA 3QETA 3NGIA 4UQGA 3AO1A 3LM9A 3WNGA 5FROA 2QK9A 3IS9A 2P5GA 3VA3A 3N4PA 2CGLA 4H0TB 2IGIA 4CJPA 1HQEA 1RT6A 4RTFD 3V81A 1JL2A 2DFHA 3TAGA 1QQOA 4PL7A 3QEXA 2HHSA 3PSFA 1YTAA 4JKAA 2ZD1A 3NH0A 5AZJA 3KKRA 1TKTA 1R59O 2O8FB 1TKZA 3V9WA 2CH5A 3KLHA 1ZXOA 3P5JA 1B9DA 4PA1A 5F2RA 2OZMA 4B3MK 4YOWA 5JICA 2FBVA 4IJNA 3LDQA 3FZMA 5AFUH 1IKVA 3DI6A 4ZTFA 2E2OA 4ZTJA 4JHDA 4CFBA 5BPNA 3V9UA 1BI4B 1YVUA 5K14A 4AHUA 3OJUA 4E0DA 4RW4A 4DUYK 4JI1K 2OYQA 3M5RA 4CJKA 3K58A 3CJAA 3DLHA 3CCLN 1QQNA 3UKRA 1S1XA 3THYA 3ZYYX 1N32K 3EE9A 3MWTA 4E1JA 4OKEA 1QSYA 4CJTA 3UIQA 3ENBA 2F9WA 3A2FA 4K25A 4KHSA 2P9PA 4JKBA 1UOCA 2HNDA 3CQYA 3R6MA 5M1KA 1SZ2A 1B92A 3I56N 1WSGA 4DHYA 2ATQA 4WF9L 4XEIA 3KD1E 1NOZA 2VYPA 4CJ7A 3RR8A 3A5OC 1VQ5N 4TSXA 1J9AA 3ZT3A 4KHWA 2HF4A 4FPBA 3VQDA 4FCYA 4CD3A 2QWQA 1Z05A 3VN5A 4KI6A 3C65A 1XQSC 1HR0K 2ZWHA 3WNHA 1IJJA 1BGXT 1ESVA 4F3TA 4U67L 1RBRA 4DU3A 4C8NA 2OA8A 4C8OA 4JRPA 4LF7K 4CJUA 1E4GT 2F9TA 1BWFO 1GOBA 1C0TA 4FM1A 2KW4A 3WEEA 1VSDA 1ZBUA 4I2PA 2ITMA 4M3UA 4CECA 1IG9A 2YV0X 3SAHA 1HLUA 5A2QO 3VQCA 1SUQA 1IH7A 4FYDA 2A1SA 1RTJA 1IV0A 1BG3A 1X9MA 5EXWA 4JKGA 1HMVA 4H03B 4K43A 3TAPA 3ZEUA 1Q18A 2P9NA 4FOIA 3VA0A 4A5BA 2P51A 1WB9A 4DV1K 4FLWA 3CPEA 3LP3A 1RDWX 3LDSA 3JSMA 4FM2A 1RBTA 1VQKN 3CMEN 3P4IA 4BRMA 4LF8K 4LSNA 3TTCA 3OYHA 5CYQA 1S6PA 4NXNK 1BQNA 2ASPA 4X65K 4FJKA 3TABA 3ZX2A 2E2NA 4CJFA 3KIOA 4LC9B 4CJ5A 5KRSA 3CC7N 2IVPA 2WTUA 4OVLA 3ZETB 3ENHA 2DFFA 4BE0A 3LAMA 2VQFK 1HNIA 1VSJA 3HVRA 4YFUA 4CFDA 1EWQA 4FWRA 2HVIA 1KAXA 2EX3A 3WXJA 4CESA 1XHZA 5LJVA
chains in the Genus database with same CATH topology
3D45A 4DQPA 4J2AA 3QEVA 2B5JA 4FJJA 4JLHA 1SL1A 1QTMA 1TK5A 4N41A 3NH2A 4B08A 3KK1A 2BDPA 1IKYA 1CXQA 3IRXA 1WSHA 3ULDA 4RW6A 5I3UA 4E19A 3SYZA 3ZSWA 4W5QA 2PZSA 2HHQA 3AVFA 1C0MA 1JLFA 1QHTA 3K2PA 1QE1A 1TVRA 3OYGA 3T3FA 4CGFA 3PX4A 1NJXA 3BGRA 3NGZA 3V6DA 5CZ1A 1U45A 4DFPA 1CXUA 2B4JA 2YHBA 4CF8A 4B3OA 1RT7A 3QEPA 2HHTA 4N5SA 4HCBA 4B9TA 1RT2A 4B9UA 4FK4A 1BI4A 2KZZA 4DG1A 3LANA 1NJZA 3DLGA 3TAQA 2G8KA 3V1QA 3M8RA 4J2BA 3DLBA 4EP4A 3M8SA 4FVMA 4FM0A 4RG8A 1RBVA 4M45A 2G8WA 4ELUA 4KO0A 4Z0UA 1BCMA 4PQUA 1X9SA 3LWMA 4FK2A 1VSHA 1VSEA 2XHBA 4DU1A 4FLYA 1U49A 1KTQA 4CERA 4O0JA 4CFCA 3NHGA 3HPGA 3LP0A 4KB0A 4DQRA 4FJ5A 3LZIA 3PO4A 4LY7A 3PUFA 4FZXC 3AA3A 4OLAA 4IBNA 4DSLA 1X1PA 4W5TA 2HHUA 1W9HA 4BDZA 1RT4A 4Q0BA 1S9GA 2OPRA 3HP9A 4C8MA 3SCXA 4CHPA 2VG6A 5J2MA 5FRNA 3K5LA 5HRSA 2XY6A 4FJ9A 3LP1A 2BANA 1NK8A 1VSLA 2IDOA 3SI6A 1U48A 1HJRA 4GVMA 1T05A 4DTNA 2ZQBA 1RILA 4KKOA 2G8UA 1EP4A 3OYNA 2IAJA 4YNQA 2YNGA 4KV8A 4LH4A 3THVA 1RDBA 4CJSA 4CGJA 4DFJA 3QESA 1U04A 1FXXA 1RBSA 1KFDA 1L3SA 1C1BA 4KHYA 1D5AA 3NF7A 4QCLA 2F8SA 3DOKA 1Z26A 3O3HA 4F2RA 4E7JA 4I7FA 3OYMA 3B6PA 4AHRA 1FKPA 2IC3A 3P83D 1SKWA 1S9EA 4FLXA 4W5NA 4M3ZA 5I42A 3VQQA 4AHTA 1NOYA 3O4NA 2YKMA 1ITGA 1WSEA 3OYLA 3QEWA 4DWIA 4FJLA 4KTWA 3AVBA 3ZT2A 1KVAA 3NE6A 4G1QA 4B8CA 4DFMA 4FLUA 1JLAA 3SPZA 3V1RA 1VSIA 4HTUA 2PYLA 1BIUA 1CZ9A 1RTIA 1RT3A 4KTZA 3OYCA 4CF1A 2ETJA 3RRHA 1SV5A 2EHGA 1J5OA 2IOCA 3QO9A 1QSSA 1WSFA 3CM5A 3QIPA 2GV9A 4OKKA 1S1WA 1U47A 4HUEA 5D3GA 4Z4FA 3ZT4A 1XHXA 3CM6A 3KLFA 3G10A 2HNYA 3AVLA 4KFBA 3VQ4A 5CY4A 2HHVA 4CIGA 1S1TA 1RCHA 4E3SA 2RKIA 2QKBA 3L2WA 4H4MA 1QQCA 1RDAA 4DTUA 4B9VA 2Z1IA 2YHAA 3RR7A 4DSEA 1L3UA 3K5MA 4KHUA 3SQ0A 4F3OA 4DTSA 2F96A 4NYFA 4H4OA 3AVCA 4RW8A 3PO5A 4KHNA 4Z4IA 3LAKA 3AVGA 4BE1A 4JS4A 5HRPA 3U3GA 1TL3A 4DSFA 1TV6A 1X9WA 1T03A 4FJGA 3RWUA 1R0AA 4M41A 3ZT1A 1FK9A 3OYAA 4FJXA 1EX4A 1KLMA 5C25A 3AVHA 2O4GA 4O5BA 3ZSXA 2X6NA 3ZT0A 1ASVA 3HYFA 3TAEA 2G8VA 4F4KA 4FJ8A 3AA5X 2KZMA 4DS5A 2XO7A 3IG1A 3VQAA 3OY9A 4DSKA 1KCFA 4IFYA 3O3FA 4N76A 1ZBFA 3OYDA 4CJQA 4CIFA 1I39A 4I9LA 2QKKA 1JXEA 3HP6A 3HL8A 4O0IA 4DQIA 2HMIA 3IAYA 5KGXA 4IDKA 4GMJB 2XY5A 4FLVA 3HSTB 4C8KA 3WNFA 3V9SA 1VSFA 2D5RA 4KRFA 2KFNA 1C6VA 4W5RA 2G8HA 4L8RB 3PV8A 4E89A 3DLRA 4MFBA 4CJLA 1RDCA 4R5PA 3OVNA 4BDYA 3VQ8A 4CF0A 1NKBA 1WAJA 3MEGA 2D0BA 3RTVA 4CCHA 4CEQA 1NJYA 5FDLA 3V4IA 1REVA 4Z4EA 1HQUA 1D8YA 3K59A 4CGGA 3AO4A 3S3OA 3SQ2A 1L3TA 1NJWA 3KLGA 3C94A 3BDPA 4F2SA 3AVIA 3MEDA 4OGEA 4CFAA 3OS0A 5HRRA 4CEFA 4CF9A 3K57A 1N5YA 3ITHA 1VSKA 3S9HA 3VQEA 3NF8A 1KRPA 3OS2A 4CF2A 5KRTA 3CG7A 5E41A 4Z4CA 4B8AB 2BE2A 2ZE2A 4IKFA 3QIOA 3EY1A 1VK0A 4NYNA 5KI6A 4FW1A 3KJVA 3PX6A 3F73A 4AHVA 3RMDA 2YNHA 3SPYA 1HRHA 1LAWA 3EZ5A 3HVTA 3MAQA 4B9SA 2DTUA 1QS4A 1KFSA 2VG5A 4O55A 3S3NA 3SUNA 3PY8A 3TAFA 4LD0A 5HRNA 4ZHRA 4E7IA 4K8ZA 4KPYA 2GUIA 1JL1A 4NCGA 3L2QA 3DYAA 4CEBA 4MQ3A 3SQ1A 3M8PA 3DRRA 3QEIA 4ELVA 4Z4HA 4FLZA 2NUBA 3I0RA 4LSLA 1Z25A 4OJRA 1RT1A 1TGOA 3HPOA 3KK3A 2VWJA 4JS5A 1LWFA 4DTRA 3RMBA 1LV5A 4BACA 1HYSA 3OYFA 2A1RA 3E01A 5KTQA 2P5OA 3L3VA 4CGIA 3LZJA 1EKEA 1WSIA 4FJMA 3AVAA 3CFPA 4CEEA 3NF9A 3V9XA 4M42A 1D9FA 4DTXA 4FZYA 2Z1JA 3L8BA 1JLEA 2OPSA 2LSNA 3MECA 2ITGA 4E1NA 1A5VA 1RNHA 3T19A 4CJRA 1TL1A 3ZSRA 4ID5A 2VG7A 4CE9A 4HVJA 1N6QA 5J1EA 1Y97A 4CGHA 1BCOA 5J2PA 4RW7A 3TR8A 3LP2A 5HBMA 3L3UA 2E4LA 3QNNA 3QINA 4JRQA 1SL2A 4E7LA 1S5JA 3TWHA 4CEAA 1C1CA 2WONA 1I3AA 4K8XA 3M8QA 4ID1A 1NK9A 4HHTA 5JS1A 2FBTA 2KQ2A 4BWJA 1UAXA 2OPQA 1LW2A 3DRSA 3KKSA 3ZSQA 4CHQA 1RTDA 2GBZA 1F21A 1JLQA 4FLTA 4DFKA 2X78A 4CEOA 4IFVA 4I9QA 4NCBA 4W5OA 4M3XA 4KB1A 2HW3A 3L2UA 1JXBA 4DLEA 1IKWA 2XRIA 3I8DA 3K5NA 3L2RA 3HM9A 1NKCA 1J54A 1L5UA 3FFIA 2IS3A 3QETA 3SUOA 3V1OA 3NGIA 1LWCA 3G0ZA 1EETA 1LW0A 3AO1A 4UQGA 3U6FA 4CK3A 5HP1A 1KVCA 2E6MA 3PX0A 3KLIA 3WNGA 3SZ2A 4B9NA 5FROA 4Q5VA 1K6YA 3L2VA 2QK9A 3C95A 3IS9A 4AILC 3RMCA 2P5GA 3VA3A 3H08A 4N47A 1J53A 2D0CA 4CJ3A 4CHOA 3CFRA 2IGIA 1HYZA 4LH5A 1IKXA 2DY4A 4CJPA 1HQEA 1RT6A 4AHCA 3V81A 1JL2A 1RBUA 2DFHA 3ALYA 3TAGA 3QEXA 1T7PA 2HHSA 2BGGA 4Y1DA 3NDKA 2PYJA 1YTAA 5HLFA 2ZD1A 1VRUA 4IG0A 2WOMA 3ISNC 4OPJA 2W42A 3NH0A 1CLQA 3AA2A 3AO3A 3LWLA 3U3YA 3P1GA 4CHYA 3MEEA 3KKRA 1UA1A 4PY5A 1TKTA 2RF2A 3O4QA 1TKZA 4M3RA 3V9WA 4BE2A 4NCAA 3NBPA 3QNOA 2JGUA 3AVMA 1SL0A 3ZSYA 3KLHA 3SV3A 3T1AA 3CFOA 1TKXA 3P5JA 5CZ2A 3V9ZA 1B9DA 4FW2A 2XY7A 1HYVA 4PA1A 1QSLA 1Q9YA 2RPIA 3SQ4A 2HHWA 2OZMA 4H8KA 3F9KA 2FBVA 3NFAA 3KK2A 1IKVA 3DI6A 1KLNA 4ZTFA 3ZSVA 4ZTJA 2HNZA 3NH1A 4CFBA 4HUGA 3AVKA 3V9UA 4FJNA 1BI4B 1YVUA 5K14A 4AHUA 3OJUA 3OYJA 1BISA 4BDPA 4E0DA 3ZSZA 3RRGA 3DOLA 4RW4A 2OYQA 3ZCMA 2PY5A 5C42A 4DQSA 2FBXA 4CJKA 3K58A 1XI1A 1HNVA 4Z4GA 1VRTA 3HK2A 3VQ9A 1RTHA 1JKHA 1XWLA 2YNIA 3DLHA 4AH9A 1GOCA 2DFEA 4WE1A 3NAEA 1C1AA 5C24A 3HXMA 1C0UA 1YTUA 2G8FA 1IO2A 2RN2A 4CHZA 2YKNA 4EP5A 4CHNA 2XY8A 1S1XA 1S1VA 5JS2A 1TAQA 1T8EA 3KD5E 4M3WA 4FZZA 4KREA 3HO1A 2R7YA 4OKEA 4OPKA 4CJTA 1W0HA 1QSYA 4DQQA 3UIQA 3AV9A 3A2FA 1NK5A 2FC0A 4KHSA 3OYEA 3OS1A 1LWEA 1UOCA 2HNDA 3LPTA 3C6UA 4CEDA 4FJIA 3SNNA 4OGCA 5DMRA 1B92A 4E1MA 2E6LA 3AA4A 3DMJA 2OPPA 1A5WA 4KHQA 1WSGA 3S3MA 1NKEA 1RT5A 2ATQA 4PUOA 5T7BA 3KTQA 3KD1E 1NOZA 4CJVA 4HUFA 2YNFA 3QERA 3RR8A 3WNEA 4EZ9A 1MU2A 1CZBA 4I2QA 4QOZB 4FK0A 3NGYA 4PWDA 3DLEA 1B9FA 4TSXA 5EU7A 4BWMA 1WNSA 3AO2A 4DTPA 1NK6A 1J9AA 1YT3A 3AVJA 3NF6A 3ZT3A 4J2EA 4KHWA 2JLEA 2VWKA 3B6OA 3C6TA 3VQBA 3VQDA 4FCYA 1L3VA 4B9MA 4DSIA 4CJEA 1DTQA 1S1UA 4CEZA 4FXDA 1SKRA 4E7KA 2X74A 1JLGA 4E7HA 2Q3SA 2AJQA 3K5OA 3VN5A 2B6AA 4KI6A 3TAMA 4QAGA 1DTTA 1UA0A 1Q8IA 4CIEA 4KAZA 3HT3A 3WNHA 3LPUA 3OYBA 1BGXT 1LAVA 4DF8A 2QXFA 3TARA 1XC9A 4F3TA 1RBRA 3LALA 5SWMA 1UWBA 4DS4A 4DU3A 4C8NA 4OKJA 4AHSA 1ZBLA 2I5JA 4N56A 2OA8A 4C8OA 4J2DA 4JRPA 3DM2A 4CJUA 4DU4A 1ASWA 3OYKA 1TK8A 2Y1JA 4CK1A 3OYIA 1S6QA 1GOBA 1C0TA 4CJWA 1RDDA 4XIUA 3SJJA 4FM1A 2KW4A 4DTOA 3QLHA 1VSDA 1A5XA 1ZBUA 3DRPA 3SV4A 4I2PA 4CGDA 2Z1HA 3AO5A 1GOAA 3TI0A 4M3UA 4CECA 1BIZA 3O3GA 3NCIA 4RW9A 1O1WA 2Y1IA 1VSMA 1IG9A 1TAUA 1G15A 2YV0X 1TKDA 4EZ6A 1KVBA 3VQ6A 4FYDA 3VQCA 1SUQA 1IH7A 2A1SA 1RTJA 4DLGA 4DSJA 1X9MA 4HCCA 3EYZA 2P1JA 1D9DA 1HMVA 2O4IA 4O44A 3TAPA 1WN7A 1KSPA 3VA0A 2D0AA 3ZSOA 2P51A 3SUPA 4DF4A 3VQ7A 4FLWA 4KTQA 2F8TA 3LP3A 1NK4A 3LDSA 4FJHA 5KGWA 3JSMA 1JLCA 4FM2A 1FKOA 1RBTA 3MXJA 3MXIA 4FJ7A 2HVHA 4CK2A 3DLKA 3AVNA 3HJFA 3MXMA 1EXQA 4LSNA 5SZTA 5J2NA 3CYMA 3OYHA 5CYQA 3VQ5A 1S6PA 1WAFA 3OJSA 1BQNA 4FJKA 1WLJA 4ICLA 3VQPA 3TABA 1BQMA 3RMAA 4C8LA 4CJFA 3KIOA 4CJ5A 5FRMA 5KRSA 5HROA 4DMNA 4DTJA 4F8RA 5DK5A 1BL3A 1BHLA 1HPZA 2Z1GA 4Y1CA 2KFZA 4O4GA 4OVLA 5CYMA 3I0SA 4DTMA 4B9LA 2HHXA 1Q9XA 1ZBIA 2DFFA 4BE0A 3LAMA 5J2QA 3TANA 1TK0A 3SUQA 4GW6A 3D0PA 4IG3A 2X6SA 1DLOA 1ZYQA 1HNIA 3KLEA 1VSJA 2OZSA 3HPHA 3ASMA 3HVRA 4M3TA 4ELTA 4YFUA 4CFDA 1ASUA 1SKSA 3JYTA 3CQ8A 4M3YA 4OLBA 2HVIA 4CESA 1JLBA 2EX3A 1WSJA 4CJ4A 2HB5A 2FBYA 1XHZA 1U4BA 4KI4A 1NK0A 1ZBHA 2G8IA 1NK7A 2KTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D45 A;  4DQP A;  4J2A A;  3QEV A;  2B5J A;  4FJJ A;  4JLH A;  1SL1 A;  1QTM A;  1TK5 A;  4N41 A;  3NH2 A;  4B08 A;  3KK1 A;  2BDP A;  1IKY A;  1CXQ A;  3IRX A;  1WSH A;  3ULD A;  4RW6 A;  5I3U A;  4E19 A;  3SYZ A;  3ZSW A;  4W5Q A;  2PZS A;  2HHQ A;  3AVF A;  1C0M A;  1JLF A;  1QHT A;  3K2P A;  1QE1 A;  1TVR A;  3OYG A;  3T3F A;  4CGF A;  3PX4 A;  1NJX A;  3BGR A;  3NGZ A;  3V6D A;  5CZ1 A;  1U45 A;  4DFP A;  1CXU A;  2B4J A;  2YHB A;  4CF8 A;  4B3O A;  1RT7 A;  3QEP A;  2HHT A;  4N5S A;  4HCB A;  4B9T A;  1RT2 A;  4B9U A;  4FK4 A;  1BI4 A;  2KZZ A;  4DG1 A;  3LAN A;  1NJZ A;  3DLG A;  3TAQ A;  2G8K A;  3V1Q A;  3M8R A;  4J2B A;  3DLB A;  4EP4 A;  3M8S A;  4FVM A;  4FM0 A;  4RG8 A;  1RBV A;  4M45 A;  2G8W A;  4ELU A;  4KO0 A;  4Z0U A;  1BCM A;  4PQU A;  1X9S A;  3LWM A;  4FK2 A;  1VSH A;  1VSE A;  2XHB A;  4DU1 A;  4FLY A;  1U49 A;  1KTQ A;  4CER A;  4O0J A;  4CFC A;  3NHG A;  3HPG A;  3LP0 A;  4KB0 A;  4DQR A;  4FJ5 A;  3LZI A;  3PO4 A;  4LY7 A;  3PUF A;  4FZX C;  3AA3 A;  4OLA A;  4IBN A;  4DSL A;  1X1P A;  4W5T A;  2HHU A;  1W9H A;  4BDZ A;  1RT4 A;  4Q0B A;  1S9G A;  2OPR A;  3HP9 A;  4C8M A;  3SCX A;  4CHP A;  2VG6 A;  5J2M A;  5FRN A;  3K5L A;  5HRS A;  2XY6 A;  4FJ9 A;  3LP1 A;  2BAN A;  1NK8 A;  1VSL A;  2IDO A;  3SI6 A;  1U48 A;  1HJR A;  4GVM A;  1T05 A;  4DTN A;  2ZQB A;  1RIL A;  4KKO A;  2G8U A;  1EP4 A;  3OYN A;  2IAJ A;  4YNQ A;  2YNG A;  4KV8 A;  4LH4 A;  3THV A;  1RDB A;  4CJS A;  4CGJ A;  4DFJ A;  3QES A;  1U04 A;  1FXX A;  1RBS A;  1KFD A;  1L3S A;  1C1B A;  4KHY A;  1D5A A;  3NF7 A;  4QCL A;  2F8S A;  3DOK A;  1Z26 A;  3O3H A;  4F2R A;  4E7J A;  4I7F A;  3OYM A;  3B6P A;  4AHR A;  1FKP A;  2IC3 A;  3P83 D;  1SKW A;  1S9E A;  4FLX A;  4W5N A;  4M3Z A;  5I42 A;  3VQQ A;  4AHT A;  1NOY A;  3O4N A;  2YKM A;  1ITG A;  1WSE A;  3OYL A;  3QEW A;  4DWI A;  4FJL A;  4KTW A;  3AVB A;  3ZT2 A;  1KVA A;  3NE6 A;  4G1Q A;  4B8C A;  4DFM A;  4FLU A;  1JLA A;  3SPZ A;  3V1R A;  1VSI A;  4HTU A;  2PYL A;  1BIU A;  1CZ9 A;  1RTI A;  1RT3 A;  4KTZ A;  3OYC A;  4CF1 A;  2ETJ A;  3RRH A;  1SV5 A;  2EHG A;  1J5O A;  2IOC A;  3QO9 A;  1QSS A;  1WSF A;  3CM5 A;  3QIP A;  2GV9 A;  4OKK A;  1S1W A;  1U47 A;  4HUE A;  5D3G A;  4Z4F A;  3ZT4 A;  1XHX A;  3CM6 A;  3KLF A;  3G10 A;  2HNY A;  3AVL A;  4KFB A;  3VQ4 A;  5CY4 A;  2HHV A;  4CIG A;  1S1T A;  1RCH A;  4E3S A;  2RKI A;  2QKB A;  3L2W A;  4H4M A;  1QQC A;  1RDA A;  4DTU A;  4B9V A;  2Z1I A;  2YHA A;  3RR7 A;  4DSE A;  1L3U A;  3K5M A;  4KHU A;  3SQ0 A;  4F3O A;  4DTS A;  2F96 A;  4NYF A;  4H4O A;  3AVC A;  4RW8 A;  3PO5 A;  4KHN A;  4Z4I A;  3LAK A;  3AVG A;  4BE1 A;  4JS4 A;  5HRP A;  3U3G A;  1TL3 A;  4DSF A;  1TV6 A;  1X9W A;  1T03 A;  4FJG A;  3RWU A;  1R0A A;  4M41 A;  3ZT1 A;  1FK9 A;  3OYA A;  4FJX A;  1EX4 A;  1KLM A;  5C25 A;  3AVH A;  2O4G A;  4O5B A;  3ZSX A;  2X6N A;  3ZT0 A;  1ASV A;  3HYF A;  3TAE A;  2G8V A;  4F4K A;  4FJ8 A;  3AA5 X;  2KZM A;  4DS5 A;  2XO7 A;  3IG1 A;  3VQA A;  3OY9 A;  4DSK A;  1KCF A;  4IFY A;  3O3F A;  4N76 A;  1ZBF A;  3OYD A;  4CJQ A;  4CIF A;  1I39 A;  4I9L A;  2QKK A;  1JXE A;  3HP6 A;  3HL8 A;  4O0I A;  4DQI A;  2HMI A;  3IAY A;  5KGX A;  4IDK A;  4GMJ B;  2XY5 A;  4FLV A;  3HST B;  4C8K A;  3WNF A;  3V9S A;  1VSF A;  2D5R A;  4KRF A;  2KFN A;  1C6V A;  4W5R A;  2G8H A;  4L8R B;  3PV8 A;  4E89 A;  3DLR A;  4MFB A;  4CJL A;  1RDC A;  4R5P A;  3OVN A;  4BDY A;  3VQ8 A;  4CF0 A;  1NKB A;  1WAJ A;  3MEG A;  2D0B A;  3RTV A;  4CCH A;  4CEQ A;  1NJY A;  5FDL A;  3V4I A;  1REV A;  4Z4E A;  1HQU A;  1D8Y A;  3K59 A;  4CGG A;  3AO4 A;  3S3O A;  3SQ2 A;  1L3T A;  1NJW A;  3KLG A;  3C94 A;  3BDP A;  4F2S A;  3AVI A;  3MED A;  4OGE A;  4CFA A;  3OS0 A;  5HRR A;  4CEF A;  4CF9 A;  3K57 A;  1N5Y A;  3ITH A;  1VSK A;  3S9H A;  3VQE A;  3NF8 A;  1KRP A;  3OS2 A;  4CF2 A;  5KRT A;  3CG7 A;  5E41 A;  4Z4C A;  4B8A B;  2BE2 A;  2ZE2 A;  4IKF A;  3QIO A;  3EY1 A;  1VK0 A;  4NYN A;  5KI6 A;  4FW1 A;  3KJV A;  3PX6 A;  3F73 A;  4AHV A;  3RMD A;  2YNH A;  3SPY A;  1HRH A;  1LAW A;  3EZ5 A;  3HVT A;  3MAQ A;  4B9S A;  2DTU A;  1QS4 A;  1KFS A;  2VG5 A;  4O55 A;  3S3N A;  3SUN A;  3PY8 A;  3TAF A;  4LD0 A;  5HRN A;  4ZHR A;  4E7I A;  4K8Z A;  4KPY A;  2GUI A;  1JL1 A;  4NCG A;  3L2Q A;  3DYA A;  4CEB A;  4MQ3 A;  3SQ1 A;  3M8P A;  3DRR A;  3QEI A;  4ELV A;  4Z4H A;  4FLZ A;  2NUB A;  3I0R A;  4LSL A;  1Z25 A;  4OJR A;  1RT1 A;  1TGO A;  3HPO A;  3KK3 A;  2VWJ A;  4JS5 A;  1LWF A;  4DTR A;  3RMB A;  1LV5 A;  4BAC A;  1HYS A;  3OYF A;  2A1R A;  3E01 A;  5KTQ A;  2P5O A;  3L3V A;  4CGI A;  3LZJ A;  1EKE A;  1WSI A;  4FJM A;  3AVA A;  3CFP A;  4CEE A;  3NF9 A;  3V9X A;  4M42 A;  1D9F A;  4DTX A;  4FZY A;  2Z1J A;  3L8B A;  1JLE A;  2OPS A;  2LSN A;  3MEC A;  2ITG A;  4E1N A;  1A5V A;  1RNH A;  3T19 A;  4CJR A;  1TL1 A;  3ZSR A;  4ID5 A;  2VG7 A;  4CE9 A;  4HVJ A;  1N6Q A;  5J1E A;  1Y97 A;  4CGH A;  1BCO A;  5J2P A;  4RW7 A;  3TR8 A;  3LP2 A;  5HBM A;  3L3U A;  2E4L A;  3QNN A;  3QIN A;  4JRQ A;  1SL2 A;  4E7L A;  1S5J A;  3TWH A;  4CEA A;  1C1C A;  2WON A;  1I3A A;  4K8X A;  3M8Q A;  4ID1 A;  1NK9 A;  4HHT A;  5JS1 A;  2FBT A;  2KQ2 A;  4BWJ A;  1UAX A;  2OPQ A;  1LW2 A;  3DRS A;  3KKS A;  3ZSQ A;  4CHQ A;  1RTD A;  2GBZ A;  1F21 A;  1JLQ A;  4FLT A;  4DFK A;  2X78 A;  4CEO A;  4IFV A;  4I9Q A;  4NCB A;  4W5O A;  4M3X A;  4KB1 A;  2HW3 A;  3L2U A;  1JXB A;  4DLE A;  1IKW A;  2XRI A;  3I8D A;  3K5N A;  3L2R A;  3HM9 A;  1NKC A;  1J54 A;  1L5U A;  3FFI A;  2IS3 A;  3QET A;  3SUO A;  3V1O A;  3NGI A;  1LWC A;  3G0Z A;  1EET A;  1LW0 A;  3AO1 A;  4UQG A;  3U6F A;  4CK3 A;  5HP1 A;  1KVC A;  2E6M A;  3PX0 A;  3KLI A;  3WNG A;  3SZ2 A;  4B9N A;  5FRO A;  4Q5V A;  1K6Y A;  3L2V A;  2QK9 A;  3C95 A;  3IS9 A;  4AIL C;  3RMC A;  2P5G A;  3VA3 A;  3H08 A;  4N47 A;  1J53 A;  2D0C A;  4CJ3 A;  4CHO A;  3CFR A;  2IGI A;  1HYZ A;  4LH5 A;  1IKX A;  2DY4 A;  4CJP A;  1HQE A;  1RT6 A;  4AHC A;  3V81 A;  1JL2 A;  1RBU A;  2DFH A;  3ALY A;  3TAG A;  3QEX A;  1T7P A;  2HHS A;  2BGG A;  4Y1D A;  3NDK A;  2PYJ A;  1YTA A;  5HLF A;  2ZD1 A;  1VRU A;  4IG0 A;  2WOM A;  3ISN C;  4OPJ A;  2W42 A;  3NH0 A;  1CLQ A;  3AA2 A;  3AO3 A;  3LWL A;  3U3Y A;  3P1G A;  4CHY A;  3MEE A;  3KKR A;  1UA1 A;  4PY5 A;  1TKT A;  2RF2 A;  3O4Q A;  1TKZ A;  4M3R A;  3V9W A;  4BE2 A;  4NCA A;  3NBP A;  3QNO A;  2JGU A;  3AVM A;  1SL0 A;  3ZSY A;  3KLH A;  3SV3 A;  3T1A A;  3CFO A;  1TKX A;  3P5J A;  5CZ2 A;  3V9Z A;  1B9D A;  4FW2 A;  2XY7 A;  1HYV A;  4PA1 A;  1QSL A;  1Q9Y A;  2RPI A;  3SQ4 A;  2HHW A;  2OZM A;  4H8K A;  3F9K A;  2FBV A;  3NFA A;  3KK2 A;  1IKV A;  3DI6 A;  1KLN A;  4ZTF A;  3ZSV A;  4ZTJ A;  2HNZ A;  3NH1 A;  4CFB A;  4HUG A;  3AVK A;  3V9U A;  4FJN A;  1BI4 B;  1YVU A;  5K14 A;  4AHU A;  3OJU A;  3OYJ A;  1BIS A;  4BDP A;  4E0D A;  3ZSZ A;  3RRG A;  3DOL A;  4RW4 A;  2OYQ A;  3ZCM A;  2PY5 A;  5C42 A;  4DQS A;  2FBX A;  4CJK A;  3K58 A;  1XI1 A;  1HNV A;  4Z4G A;  1VRT A;  3HK2 A;  3VQ9 A;  1RTH A;  1JKH A;  1XWL A;  2YNI A;  3DLH A;  4AH9 A;  1GOC A;  2DFE A;  4WE1 A;  3NAE A;  1C1A A;  5C24 A;  3HXM A;  1C0U A;  1YTU A;  2G8F A;  1IO2 A;  2RN2 A;  4CHZ A;  2YKN A;  4EP5 A;  4CHN A;  2XY8 A;  1S1X A;  1S1V A;  5JS2 A;  1TAQ A;  1T8E A;  3KD5 E;  4M3W A;  4FZZ A;  4KRE A;  3HO1 A;  2R7Y A;  4OKE A;  4OPK A;  4CJT A;  1W0H A;  1QSY A;  4DQQ A;  3UIQ A;  3AV9 A;  3A2F A;  1NK5 A;  2FC0 A;  4KHS A;  3OYE A;  3OS1 A;  1LWE A;  1UOC A;  2HND A;  3LPT A;  3C6U A;  4CED A;  4FJI A;  3SNN A;  4OGC A;  5DMR A;  1B92 A;  4E1M A;  2E6L A;  3AA4 A;  3DMJ A;  2OPP A;  1A5W A;  4KHQ A;  1WSG A;  3S3M A;  1NKE A;  1RT5 A;  2ATQ A;  4PUO A;  5T7B A;  3KTQ A;  3KD1 E;  1NOZ A;  4CJV A;  4HUF A;  2YNF A;  3QER A;  3RR8 A;  3WNE A;  4EZ9 A;  1MU2 A;  1CZB A;  4I2Q A;  4QOZ B;  4FK0 A;  3NGY A;  4PWD A;  3DLE A;  1B9F A;  4TSX A;  5EU7 A;  4BWM A;  1WNS A;  3AO2 A;  4DTP A;  1NK6 A;  1J9A A;  1YT3 A;  3AVJ A;  3NF6 A;  3ZT3 A;  4J2E A;  4KHW A;  2JLE A;  2VWK A;  3B6O A;  3C6T A;  3VQB A;  3VQD A;  4FCY A;  1L3V A;  4B9M A;  4DSI A;  4CJE A;  1DTQ A;  1S1U A;  4CEZ A;  4FXD A;  1SKR A;  4E7K A;  2X74 A;  1JLG A;  4E7H A;  2Q3S A;  2AJQ A;  3K5O A;  3VN5 A;  2B6A A;  4KI6 A;  3TAM A;  4QAG A;  1DTT A;  1UA0 A;  1Q8I A;  4CIE A;  4KAZ A;  3HT3 A;  3WNH A;  3LPU A;  3OYB A;  1BGX T;  1LAV A;  4DF8 A;  2QXF A;  3TAR A;  1XC9 A;  4F3T A;  1RBR A;  3LAL A;  5SWM A;  1UWB A;  4DS4 A;  4DU3 A;  4C8N A;  4OKJ A;  4AHS A;  1ZBL A;  2I5J A;  4N56 A;  2OA8 A;  4C8O A;  4J2D A;  4JRP A;  3DM2 A;  4CJU A;  4DU4 A;  1ASW A;  3OYK A;  1TK8 A;  2Y1J A;  4CK1 A;  3OYI A;  1S6Q A;  1GOB A;  1C0T A;  4CJW A;  1RDD A;  4XIU A;  3SJJ A;  4FM1 A;  2KW4 A;  4DTO A;  3QLH A;  1VSD A;  1A5X A;  1ZBU A;  3DRP A;  3SV4 A;  4I2P A;  4CGD A;  2Z1H A;  3AO5 A;  1GOA A;  3TI0 A;  4M3U A;  4CEC A;  1BIZ A;  3O3G A;  3NCI A;  4RW9 A;  1O1W A;  2Y1I A;  1VSM A;  1IG9 A;  1TAU A;  1G15 A;  2YV0 X;  1TKD A;  4EZ6 A;  1KVB A;  3VQ6 A;  4FYD A;  3VQC A;  1SUQ A;  1IH7 A;  2A1S A;  1RTJ A;  4DLG A;  4DSJ A;  1X9M A;  4HCC A;  3EYZ A;  2P1J A;  1D9D A;  1HMV A;  2O4I A;  4O44 A;  3TAP A;  1WN7 A;  1KSP A;  3VA0 A;  2D0A A;  3ZSO A;  2P51 A;  3SUP A;  4DF4 A;  3VQ7 A;  4FLW A;  4KTQ A;  2F8T A;  3LP3 A;  1NK4 A;  3LDS A;  4FJH A;  5KGW A;  3JSM A;  1JLC A;  4FM2 A;  1FKO A;  1RBT A;  3MXJ A;  3MXI A;  4FJ7 A;  2HVH A;  4CK2 A;  3DLK A;  3AVN A;  3HJF A;  3MXM A;  1EXQ A;  4LSN A;  5SZT A;  5J2N A;  3CYM A;  3OYH A;  5CYQ A;  3VQ5 A;  1S6P A;  1WAF A;  3OJS A;  1BQN A;  4FJK A;  1WLJ A;  4ICL A;  3VQP A;  3TAB A;  1BQM A;  3RMA A;  4C8L A;  4CJF A;  3KIO A;  4CJ5 A;  5FRM A;  5KRS A;  5HRO A;  4DMN A;  4DTJ A;  4F8R A;  5DK5 A;  1BL3 A;  1BHL A;  1HPZ A;  2Z1G A;  4Y1C A;  2KFZ A;  4O4G A;  4OVL A;  5CYM A;  3I0S A;  4DTM A;  4B9L A;  2HHX A;  1Q9X A;  1ZBI A;  2DFF A;  4BE0 A;  3LAM A;  5J2Q A;  3TAN A;  1TK0 A;  3SUQ A;  4GW6 A;  3D0P A;  4IG3 A;  2X6S A;  1DLO A;  1ZYQ A;  1HNI A;  3KLE A;  1VSJ A;  2OZS A;  3HPH A;  3ASM A;  3HVR A;  4M3T A;  4ELT A;  4YFU A;  4CFD A;  1ASU A;  1SKS A;  3JYT A;  3CQ8 A;  4M3Y A;  4OLB A;  2HVI A;  4CES A;  1JLB A;  2EX3 A;  1WSJ A;  4CJ4 A;  2HB5 A;  2FBY A;  1XHZ A;  1U4B A;  4KI4 A;  1NK0 A;  1ZBH A;  2G8I A;  1NK7 A;  2KTQ A; 
#chains in the Genus database with same CATH topology
 4XH4 A;  1QTM A;  4B08 A;  1BA1 A;  1IKY A;  4NO7 A;  3H46 O;  1DKG D;  2P9I A;  4RW6 A;  4FSV A;  5BR8 K;  4BRG A;  4E19 A;  1K9M O;  4JI4 K;  1QE1 A;  3OYG A;  3T3F A;  4ISE A;  4CZG A;  1NJX A;  2B4J A;  1RT7 A;  4HCB A;  4B9T A;  2VGM A;  2W40 A;  1NJZ A;  5M1F A;  4YOY A;  3TAQ A;  4EP4 A;  3M8S A;  2EWS A;  1RBV A;  4ELU A;  5GIP A;  1BCM A;  3LWM A;  1VSH A;  4FLY A;  3NVK A;  1YUW A;  3EE8 A;  4LY7 A;  4A2B A;  3O9S A;  3P38 A;  5TKW A;  5AQG A;  3P31 A;  2Q0R A;  1X1P A;  4BDZ A;  1WBD A;  3SCX A;  2VG6 A;  2VCP A;  1VQ9 N;  3K5L A;  5C0Y A;  4G9Z A;  5AFU A;  2YHW A;  1T05 A;  2G8U A;  1NGD A;  2ZQB A;  2ZM6 K;  4A57 A;  2IAJ A;  2YNG A;  4CGJ A;  3EN9 A;  3DXK A;  4DFJ A;  3QES A;  1U04 A;  1ZC6 A;  5EX5 A;  4CZE A;  1KFD A;  1C1B A;  4KHY A;  4QCL A;  2HBL A;  4EAH D;  5GIO A;  1BU6 O;  3O3H A;  1U6Z A;  4JNE A;  2NRH A;  4YDU C;  2P9S B;  2QWM A;  1VQ7 N;  3TSU A;  4W5N A;  4M3Z A;  3HTV A;  3C6H A;  2QI2 A;  3WXK A;  1WSE A;  4DWI A;  1ATS A;  4FJL A;  3J7A P;  2O8E B;  3AVB A;  4G1Q A;  5AQQ A;  4B8C A;  2P9U A;  3SPZ A;  2D0O A;  1BIU A;  3RVC A;  1RT3 A;  1NWK A;  2ETJ A;  3H1V X;  2EHG A;  3RRH A;  3QO9 A;  4BRE A;  1HKB A;  4YHH K;  1U47 A;  4Z4F A;  3ZT4 A;  3C0B A;  3GDQ A;  4KHP K;  1K8K A;  3LM2 A;  3D7E O;  4IO8 A;  5CY4 A;  2QWO A;  4DTU A;  2FSK A;  2YHA A;  3RR7 A;  4KHU A;  1NU0 A;  3SQ0 A;  1VQL N;  2F96 A;  4NYF A;  4H4O A;  3AVC A;  4KHN A;  3ID6 A;  4BE1 A;  3DXM B;  3MMV A;  3U3G A;  1TL3 A;  1T03 A;  1TV6 A;  3SK3 A;  3RWU A;  4BC5 A;  3ZT1 A;  2UU9 K;  2ZF5 O;  2BGG A;  1VQM N;  1ASV A;  4BRD A;  4F4K A;  4FWP A;  3IG1 A;  5AQF A;  4XH1 A;  3IDH A;  2QKK A;  4I9L A;  1WOQ A;  1JXE A;  3BZC A;  2QWN A;  1HNW K;  3JS6 A;  2HMI A;  2QWP A;  2GX9 A;  4GMJ B;  2XY5 A;  4C8K A;  3THX B;  3VF6 A;  5BRD A;  3MN9 A;  3WNF A;  4KRF A;  2D5R A;  3OBY A;  4YOR A;  2G8H A;  3FZK A;  4FWM A;  3HZ6 A;  1IBL K;  3QDK A;  3E9L A;  1OKJ A;  1NJY A;  5FDL A;  2NNW A;  1REV A;  4FOE A;  3V4I A;  4Z4E A;  1D8Y A;  4A5A A;  4JD2 A;  4ISF A;  3K59 A;  3AO4 A;  1L3T A;  1DT9 A;  1VHX A;  4BG8 A;  4CFA A;  5BR9 A;  3ITH A;  4JEP A;  4FWL A;  4QS9 A;  4JK9 A;  5GAE P;  3OS2 A;  3T69 A;  4BRN A;  4CF2 A;  1GLL O;  2BE2 A;  2ZE2 A;  4GKJ K;  2VQE K;  2NRT A;  3PX6 A;  3RMD A;  3F73 A;  2QWR A;  3IFR A;  3EZ5 A;  5GAH P;  4B9S A;  2DTU A;  2HMP A;  1NMN A;  3PY8 A;  4YDU A;  2O8B B;  3PIO L;  3O80 A;  4CBU A;  4KH5 A;  3DRR A;  3E1Y A;  2NUB A;  4DTR A;  1RT1 A;  2WBN A;  4BGA A;  4BR9 A;  3ULE A;  2UYT A;  5KTQ A;  2UUB K;  2P5O A;  3L3V A;  3F5T A;  1EKE A;  1WSI A;  1KQS M;  2E2P A;  2PFU A;  5FPN A;  5B8H A;  2Z1J A;  3L8B A;  4B3R K;  4H5W A;  1N6Q A;  2IIR A;  3TR8 A;  2WFB A;  4BGB A;  1YIJ N;  5HOO A;  3TWH A;  5FPM A;  4BC4 A;  2KQ2 A;  2BH1 A;  3DRS A;  2WUS A;  4FLT A;  1O13 A;  1TUY A;  4OX9 K;  3M1F A;  2HOE A;  1XNQ K;  1IKW A;  2XRI A;  4YY3 K;  1J54 A;  3FFI A;  3SUO A;  3O1B A;  5HP1 A;  3U6F A;  2E6M A;  2UXC K;  3SZ2 A;  3EL2 A;  4B9N A;  4ILG B;  2V7Z A;  3L2V A;  4Y0W A;  3O9T A;  3RMC A;  3CC2 N;  1J53 A;  4CJ3 A;  3CFR A;  2DY4 A;  4AHC A;  4DV0 K;  2E8A A;  1RBU A;  3ALY A;  1T7P A;  4Y1D A;  2NRZ A;  3MX2 A;  4JYA K;  4IG0 A;  2WOM A;  3ISN C;  3M6G A;  4H0Y B;  3LWL A;  3U3Y A;  4CHY A;  4HWI A;  2RF2 A;  3J81 O;  2FSN A;  1I94 K;  3QNO A;  3U4L A;  3ZSY A;  2AA4 A;  3CFO A;  1TKX A;  3FLC O;  3V9Z A;  3D2E B;  4FW2 A;  3T7Z A;  1N34 K;  1OH7 A;  1HYV A;  2ASM A;  3NVM A;  2RPI A;  4GV6 A;  3BF3 A;  3H6E A;  4H8K A;  1U2V B;  2YHY A;  1LCU A;  3EEQ A;  5H1S Q;  2HNZ A;  3A5M C;  4WFB L;  3J8A A;  3AVK A;  4YOX A;  3OYJ A;  4BDP A;  1NGF A;  2KHO A;  2P9K A;  3RRG A;  3DOL A;  3CCV N;  1HUX A;  5C42 A;  1XI1 A;  1IBM K;  3LDP A;  3VQ9 A;  1RTH A;  1JKH A;  2YNI A;  4UY8 O;  3B8A X;  2G8F A;  2RN2 A;  4EP5 A;  4CHN A;  2KLA A;  1QVF M;  1S1V A;  1HX1 A;  1X3M A;  1YIT N;  4M3W A;  1C0G A;  3L4I A;  4CW7 B;  5LMN K;  4OPK A;  1NK5 A;  2W6L A;  5AQJ A;  4BRQ A;  3OYE A;  1EQY A;  1MA9 B;  1QQM A;  4CED A;  5DMR A;  4A61 A;  5F1X A;  3UE5 A;  2OPP A;  3P39 A;  1VAZ A;  5T7B A;  3KTQ A;  4PHT X;  3QER A;  4NLB A;  3MCP A;  4EZ9 A;  1MU2 A;  4QOZ B;  4I2Q A;  5KPR A;  3NGY A;  3DLE A;  4BRC A;  1WNS A;  2P9L B;  4DTP A;  1ILY A;  3NF6 A;  3ID8 A;  5AQZ A;  2VWK A;  3C6T A;  2PAV A;  4CBW A;  1DTQ A;  3SLC A;  4AM7 A;  4FXD A;  1SKR A;  2A5X A;  4Z94 A;  2B6A A;  3TAM A;  4QAG A;  1J5E K;  3CI5 A;  3OYB A;  5M1Q A;  4WFN L;  4DS4 A;  1SAZ A;  2I5J A;  3U9D A;  4WQ4 A;  3DWL A;  2GEM A;  3SBT A;  4CK1 A;  1OH5 A;  4XIU A;  2I7P A;  3FZL A;  2RHK A;  1VQO N;  1A5X A;  2Z1H A;  3TI0 A;  4ISG A;  3VF2 A;  3DAW A;  3NCI A;  2E1Z A;  3SMP A;  1G15 A;  4EZ6 A;  1KVB A;  4YOV A;  4DSJ A;  4HCC A;  3EYZ A;  3CC4 N;  1WBB A;  4QS8 A;  1D9D A;  2O4I A;  3VET A;  3BEX A;  4DF4 A;  1XC3 A;  4KTQ A;  3CJ7 A;  4FJH A;  5KPT A;  5BRH A;  3WXL A;  2O8D A;  4FVU A;  1FKO A;  3JAM O;  4WYB A;  3DLK A;  1EXQ A;  3VQP A;  2JWL A;  3RMA A;  3EZW A;  5FRM A;  4MO4 A;  5HRO A;  3FFK B;  4DMN A;  4DTJ A;  5DK5 A;  1BL3 A;  1BHL A;  3K9K A;  3VGK A;  2KFZ A;  2ASO A;  3I0S A;  4DTM A;  3IMX A;  1KAY A;  3R8E A;  3TAN A;  1TK0 A;  2QEX N;  3SUQ A;  1TYQ B;  4GW6 A;  3D0P A;  1DLO A;  1ZYQ A;  3KLE A;  3CJ9 A;  4BR4 A;  3ASM A;  1ATN A;  4LFA K;  4M3T A;  3WXI A;  4I6M B;  4YOU A;  3FZF A;  2FBY A;  1NK7 A;  2GWK A;  2B5J A;  1Q86 O;  1NGA A;  4FJJ A;  4BR5 A;  1SL1 A;  3NH2 A;  3KK1 A;  3KZB A;  4PKG A;  1W97 L;  3F2K A;  2PZS A;  3AVF A;  4U7B A;  3K2P A;  3NGZ A;  5CZ1 A;  1U45 A;  1CXU A;  4B3O A;  3K0S A;  1RT2 A;  4B9U A;  3QFU A;  4DG1 A;  3LAN A;  3DLG A;  3V1Q A;  4PKI A;  3M8R A;  4J2B A;  4FM0 A;  4FVM A;  4C1N I;  2G8W A;  3WQT A;  5C2F A;  3VEV A;  1X9S A;  4DV6 K;  2XHB A;  5EVZ A;  4CER A;  3L4Q A;  4CFC A;  3HPG A;  3LP0 A;  3KVG A;  3D2F B;  3LZI A;  2E2Q A;  5AQL A;  4FZX C;  3AA3 A;  4OLA A;  4W5T A;  4GY2 B;  2BTF A;  4MDA A;  1NK8 A;  5GAD P;  1VSL A;  1XMQ K;  1U48 A;  1RIL A;  4KKO A;  3OYN A;  1SS6 A;  4YNQ A;  4KV8 A;  1RDB A;  4WCE L;  1RBS A;  3NF7 A;  1JCF A;  3CJ1 A;  4K42 A;  4DR5 K;  1DGK N;  2A42 A;  5M1P A;  4FLX A;  2HBM A;  3HRG A;  1ITG A;  3R9P A;  2WC9 A;  3OYL A;  4AM6 A;  1BA0 A;  3NE6 A;  4RWT A;  4FLU A;  3KK7 A;  1HKC A;  2GTD A;  1N33 K;  4DB3 A;  4HTU A;  1CZ9 A;  4KTZ A;  1V4T A;  4GV3 A;  2IOC A;  3G71 N;  3HI0 A;  5AZJ B;  3QIP A;  2GV9 A;  3VEW A;  2QM1 A;  1XHX A;  4B3T K;  5BN8 A;  2HHV A;  1MWM A;  4CIG A;  1S1T A;  3C7N B;  2D1K A;  4E3S A;  2RKI A;  2KKZ A;  4C1N K;  4H4M A;  2QKB A;  1E3M A;  1RDA A;  2Z1I A;  4DSE A;  3K5M A;  4QS7 A;  4F3O A;  4RW8 A;  3PO5 A;  4K0K K;  4JN4 A;  3AGR A;  5KPZ A;  4JHD B;  4BR0 A;  2OCE A;  1YJW N;  3I8B A;  1X9W A;  5AJ3 K;  3BUZ B;  3R3L A;  1R0A A;  3TTD A;  1FK9 A;  1T6C A;  4FJX A;  5C25 A;  3VTI A;  4FJ8 A;  3ZT0 A;  2X6N A;  1BDG A;  3VQA A;  3OY9 A;  2OAN A;  3O3F A;  4DSK A;  3H3N O;  1BOT O;  2VWB A;  4CJQ A;  4CIF A;  1I39 A;  3G25 A;  5BN9 A;  3UKR B;  4O0I A;  4DQI A;  3IAY A;  3H1Q A;  3HST B;  2CH6 A;  2KFN A;  1VSF A;  4W5R A;  4E89 A;  1RDC A;  2P9P B;  3VQ8 A;  1NKB A;  1WAJ A;  2D0B A;  4CEQ A;  3DXM A;  5GAG P;  4JK7 A;  3AAR A;  3S3O A;  4F2S A;  3AVI A;  3MED A;  4OGE A;  5HRR A;  4CEF A;  1H1V A;  3KWG A;  3S9H A;  4FWQ A;  3NF8 A;  4H0X B;  3EO3 A;  3OHR A;  3CXC M;  5AZI B;  5KRT A;  4BC2 A;  3CG7 A;  4Z4C A;  4EFH A;  3MDQ A;  3EY1 A;  5KI6 A;  3KJV A;  4FW1 A;  4H0O A;  4AHV A;  2YNH A;  3HVT A;  3MAQ A;  3SBG A;  3O9Q A;  4O55 A;  4CZI A;  1RGI A;  3TAF A;  4LD0 A;  4BRF A;  2A40 A;  4EHT A;  2Q0U A;  4OO1 J;  4DR7 K;  3T1Y K;  5JLF A;  4ELV A;  3I0R A;  4LSL A;  1Z25 A;  4OJR A;  3HPO A;  3KK3 A;  3WEE B;  1K8A O;  1QZ6 A;  1HYS A;  3OYF A;  1XUP O;  3VEN A;  4FJM A;  3V9X A;  4PL8 A;  1NM1 A;  4FZY A;  3O9U A;  2OPS A;  5LJW A;  2LSN A;  4FWK A;  4CJR A;  1A5V A;  3J7Y P;  3QEW A;  3ZSR A;  2V51 B;  4JKG B;  1BCO A;  4H0V B;  3ZEU B;  4RW7 A;  2P9N B;  5AQM A;  3THW B;  4JRQ A;  2O8B A;  2Q97 A;  3QBX A;  5AQH A;  4IOA L;  1C1C A;  2WON A;  4NLC A;  1VQ4 N;  1IBK K;  2FLO A;  3KKS A;  4WQ5 A;  3ZSQ A;  5BPL A;  1JLQ A;  2X78 A;  4CEO A;  4IFV A;  2HW3 A;  5IT9 O;  3I8D A;  1QVG M;  1KD1 O;  1OVQ A;  3HM9 A;  1L5U A;  3OTO K;  3UKU A;  1WUA A;  5JVG L;  3V1O A;  3ATV A;  3G0Z A;  1EET A;  1KVC A;  3TU5 A;  3PX0 A;  3KLI A;  4Q5V A;  1K6Y A;  1MDU B;  1BUP A;  3C95 A;  2AP1 A;  4N47 A;  1HYZ A;  1IKX A;  3GE1 A;  4BRP A;  1TAU A;  1ZBS A;  3VPZ A;  2PYJ A;  3NDK A;  1VRU A;  2YI1 A;  3UB5 A;  1T6D A;  4H5N A;  5TKY A;  4OPJ A;  3FGU A;  4CZJ A;  4PY5 A;  3MEE A;  1UA1 A;  3O4Q A;  4WFA L;  4NCA A;  4BE2 A;  3NBP A;  3AVM A;  4LF6 K;  4IDH A;  3SV3 A;  3CCU N;  2XY7 A;  5FPD A;  1QSL A;  3AY9 A;  3QML A;  4O8K A;  3NFA A;  3KK2 A;  4J8F A;  4DR4 K;  2QTD A;  3ZSV A;  4JKE A;  1Q81 O;  3NH1 A;  1EO1 A;  4BR2 A;  4HUG A;  4FJN A;  1FJG K;  4F9O A;  4DQS A;  2FBX A;  2YX6 A;  5AR0 A;  1GOC A;  3NAE A;  3PIP L;  3HXM A;  5C24 A;  1C0U A;  3CER A;  2QW9 A;  2RE2 A;  1YTU A;  4CHZ A;  2YKN A;  5JS2 A;  1TAQ A;  2NZT A;  1Z6R A;  3LDO A;  4KRE A;  2E20 A;  3HO1 A;  2R7Y A;  1KXP A;  5HL7 L;  2FC0 A;  3JXU A;  1LWE A;  1KC8 O;  2E6L A;  2O8C B;  3S3M A;  1RT5 A;  3TSP A;  3CCJ N;  4PUO A;  3EKU A;  4CJV A;  2YNF A;  3TPQ A;  4KH6 A;  3WNE A;  1CZB A;  2Q36 A;  4PWD A;  4BWM A;  1B9F A;  3H45 C;  5EU7 A;  1NK6 A;  1YT3 A;  5JVH L;  2E5L K;  1FW6 A;  4L3Q A;  4DSI A;  1S1U A;  3IUC A;  4JI8 K;  2X74 A;  2Q3S A;  1DTT A;  4FWO A;  1Q8I A;  4LFC K;  4KAZ A;  2P9U B;  3TAR A;  3LPU A;  3WQU A;  2QXF A;  4DCH A;  1GLJ O;  3LAL A;  1UWB A;  5C15 A;  4AHS A;  4OKJ A;  1ZBL A;  3A0I X;  4N56 A;  2J4R A;  3A8Y A;  1ASW A;  1YJN N;  1TK8 A;  2Y1J A;  1S6Q A;  1K8K B;  1RDD A;  3SJJ A;  3QLH A;  3DRP A;  1NGE A;  4CGD A;  1GOA A;  1BIZ A;  2Y1I A;  1O1W A;  4B1Y B;  5CR4 A;  4DLG A;  2GEL A;  2P1J A;  1P8Z A;  1VQ6 N;  4O44 A;  3CMA N;  4LF5 K;  3M3Z A;  2D0A A;  3ZSO A;  4CZK A;  3VQ7 A;  4WQ4 C;  3WXM B;  4DV7 K;  4CZM A;  5FLX O;  4FJ7 A;  3MXJ A;  3MXI A;  4CK2 A;  3G4S N;  3MXM A;  3A5L C;  3VQ5 A;  4R79 A;  4BY9 C;  3AAQ A;  4ICL A;  3U9Z A;  1RFQ A;  5DM7 L;  1BQM A;  2W6K A;  4JI2 K;  2VGN A;  4M63 C;  2Z1G A;  5AQN A;  5CYM A;  5CHI A;  4B9L A;  5ADX H;  3IKM A;  3CCR N;  4BVO A;  1YAG A;  3VES A;  3HM8 A;  4JD2 B;  3DJC A;  3L0Q A;  5LL6 Z;  3ENO A;  4ELT A;  1SKS A;  4CD1 A;  3JYT A;  3CCM N;  5EY4 A;  1JLB A;  4CJ4 A;  1U4B A;  2HB5 A;  1N36 K;  4KI4 A;  4MLH A;  4K8Z A;  2KTQ A;  2GUP A;  2O8F A;  3QEV A;  3HOT A;  2Q2R A;  3H3O B;  2E1Y A;  2BDP A;  3IRX A;  5AQW A;  3ULD A;  5I3U A;  3ZSW A;  5DM6 L;  4W5Q A;  2HHQ A;  1QHA A;  1QHT A;  4X62 K;  3SMS A;  2D0P A;  3PX4 A;  3BGR A;  3V6D A;  1TYQ A;  4DFP A;  4CF8 A;  3QEP A;  4N5S A;  1K73 O;  2BUP A;  4MDB A;  4FK4 A;  1BI4 A;  2KZZ A;  4O8U A;  4GKK K;  3ULE B;  2G8K A;  3VOV A;  3DLB A;  2Q1N A;  4B1U B;  4RG8 A;  2FSJ A;  3CD6 N;  1T44 A;  1U49 A;  1KTQ A;  3NHG A;  3RSE B;  4KB0 A;  4FJ5 A;  4XH5 A;  3PO4 A;  3VEY A;  1JJ2 M;  4IEI A;  1NLV A;  1RT4 A;  1S9G A;  4CHP A;  4IEE A;  3VF4 A;  5J2M A;  5FRN A;  3O08 A;  5HRS A;  4BQL A;  4FJ9 A;  3LP1 A;  2BAN A;  2CGJ A;  2IDO A;  4B1W B;  4DR3 K;  3SI6 A;  1EP4 A;  3LDN A;  3THV A;  2V7Y A;  1L3S A;  5AQV A;  2UXB K;  1Z26 A;  4F2R A;  3E66 A;  4I7F A;  4ILJ A;  3OYM A;  3B6P A;  3FZH A;  4JAX A;  3SAG A;  1Y64 A;  1S9E A;  2JWK A;  4B1X B;  3VQQ A;  5I42 A;  3BP8 A;  3AGK A;  3O4N A;  1GLE G;  2ZGY A;  4KTW A;  3ZT2 A;  5KQ8 A;  3I33 A;  3O8M A;  4KH4 A;  1JLA A;  1VSI A;  2HBJ A;  2PYL A;  4MLE A;  3OYC A;  5AQS A;  4CF1 A;  4FO0 A;  1J5O A;  3BY5 A;  2FF3 B;  4OKK A;  5D3G A;  2NRW A;  3CM6 A;  3G10 A;  2QA4 N;  1ATR A;  2HNY A;  1NMD A;  1DEJ A;  2YJE A;  1L3U A;  3ZX0 A;  3AVG A;  3E9O A;  1OH6 A;  4DV3 K;  2P9K B;  5LMU K;  5AQO A;  4BG9 A;  3OYA A;  5BRE A;  1EX4 A;  1G99 A;  4O5B A;  3HYF A;  2CGK A;  2NRV A;  2XO7 A;  4IFY A;  4IOC L;  1ZBF A;  5E84 A;  3OYD A;  1HNX K;  3TSQ A;  3HP6 A;  4CZL A;  3C7N A;  1EWR A;  3CQX A;  5KGX A;  1NGB A;  3A5N C;  1VQP N;  1M1K O;  2A3Z A;  5E26 A;  4BVP A;  1C6V A;  2A41 A;  5AQK A;  3RTV A;  4CCH A;  3VER A;  3ZET A;  1Q7Y O;  1HQU A;  5KQD A;  3VGM A;  3SQ2 A;  1NJW A;  3KLG A;  3BDP A;  5AQR A;  1NGJ A;  4CF9 A;  1V4S A;  3K57 A;  4BC3 A;  1SQK A;  1GLB G;  1KRP A;  1HNZ K;  5AQU A;  5E41 A;  4M7X A;  5IWA K;  4B8A B;  2NLX A;  4IKF A;  1VK0 A;  4NYN A;  2YJF A;  1HRH A;  1QS4 A;  2VG5 A;  1S3X A;  3SUN A;  5HRN A;  3OBW A;  4ZHR A;  4IO9 L;  2F4V K;  3GG4 A;  4E7I A;  2GUI A;  1JL1 A;  1TUU A;  4NCG A;  2I7N A;  5ADX A;  2E88 A;  4MQ3 A;  3SQ1 A;  5M1N A;  1OH8 A;  3VTH A;  4Z4H A;  4FLZ A;  2VWJ A;  4JS5 A;  3RMB A;  4BAC A;  1NNE A;  3LZJ A;  3QFP A;  3AVA A;  3CFP A;  4CEE A;  4M42 A;  5AZI A;  3BZK A;  4IZ9 A;  1D9F A;  3VEO A;  4OPH A;  4DTX A;  3C6A A;  5BPM A;  3MEC A;  3E9P A;  4E1N A;  2ITG A;  3T19 A;  4ID5 A;  4HVJ A;  2NRR A;  5MLC Q;  5HBM A;  2E4L A;  3QNN A;  4E7L A;  3ZLJ A;  2W41 A;  5FPE A;  4CEA A;  4JV5 K;  3N4Q A;  3WT0 A;  4K8X A;  2O8D B;  3M8Q A;  3QIC A;  4JK8 A;  1NK9 A;  4HHT A;  1UAX A;  2OPQ A;  2GWJ A;  3WUH A;  1RTD A;  3HOS A;  1F21 A;  4YOT A;  4I9Q A;  4BRK A;  4W5O A;  1P90 A;  4KB1 A;  4B3S K;  3L2U A;  4DLE A;  1M90 O;  3K5N A;  3L2R A;  1NKC A;  1GLC G;  3CHW A;  5CE3 A;  4LF9 K;  1YJ9 N;  2IS3 A;  3CJC A;  1LWC A;  1LW0 A;  4FPA A;  4CK3 A;  3CIP A;  1J6Z A;  2P9S A;  4RCH A;  5AQT A;  3THW A;  4GV9 A;  4AIL C;  3H08 A;  1C0F A;  2D0C A;  4A59 A;  4CHO A;  2O8E A;  4WQ5 C;  4LH5 A;  1NGG A;  1D4X A;  5HLF A;  3MN6 A;  2W42 A;  1CLQ A;  3AA2 A;  3AO3 A;  2H3G X;  3P1G A;  4M3R A;  2OTL N;  1VQN N;  2JGU A;  1SL0 A;  4BRI A;  2DPN A;  3T1A A;  5BRF A;  5CZ2 A;  3THY B;  1Q9Y A;  3SQ4 A;  2HHW A;  3F9K A;  2FF6 A;  4MO5 A;  1KLN A;  1YXQ A;  3W3D A;  4C23 A;  1S72 N;  2HHH K;  3Q7C A;  1BIS A;  3ZSZ A;  1VQ8 N;  4HTL A;  3ZCM A;  2PY5 A;  4JKF A;  4Z4G A;  3HK2 A;  1HNV A;  1VRT A;  2NRX A;  1XWL A;  4AH9 A;  3D6R A;  2DFE A;  4WE1 A;  1C1A A;  3Q7B A;  4CVN E;  4CZH A;  1GLF O;  1IO2 A;  1NBW A;  4IFE A;  2XY8 A;  4BR7 A;  1NJI O;  1T8E A;  3KD5 E;  4FZZ A;  3THX A;  4GVE A;  4H5T A;  5GIN A;  1W0H A;  4DQQ A;  3AV9 A;  3OS1 A;  3LPT A;  3C6U A;  4FJI A;  3SNN A;  4BQZ A;  4OGC A;  3R1X A;  4E1M A;  3AA4 A;  3DMJ A;  4IJA A;  4M7Y A;  1A5W A;  4KHQ A;  1NKE A;  3J80 O;  4HUF A;  4AF1 A;  4FK0 A;  3VGL A;  3TTF A;  1BO5 O;  3AO2 A;  1OVY A;  3AVJ A;  1XMO K;  4J2E A;  1E4F T;  2IVN A;  2JLE A;  4BRL A;  3B6O A;  4B9M A;  3VQB A;  1L3V A;  4CJE A;  4CEZ A;  3MCA B;  1S22 A;  4E7K A;  1JLG A;  4E7H A;  2AJQ A;  3K5O A;  4ILH A;  1UA0 A;  1T3V A;  4CIE A;  3HT3 A;  1LAV A;  4DF8 A;  1XC9 A;  4LFB K;  5SWM A;  4X66 K;  2ZJR L;  4J2D A;  2O8C A;  3DM2 A;  4DU4 A;  1YI2 N;  3OYK A;  3NMU A;  3ATU A;  3OYI A;  4CJW A;  4LF4 K;  4DTO A;  3SV4 A;  1X9J A;  3AO5 A;  3O3G A;  4RW9 A;  4KBO A;  1VSM A;  1TKD A;  2YCH A;  3VQ6 A;  3QBW A;  4DR1 K;  5ELZ A;  1WN7 A;  1KSP A;  3SUP A;  4JI5 K;  2F8T A;  4OPA A;  1NK4 A;  3VEZ A;  5KGW A;  3O1W A;  1JLC A;  2HVH A;  2D4W A;  1GLD G;  3AVN A;  3HJF A;  5SZT A;  5J2N A;  3CYM A;  4A2A A;  1WAF A;  3OJS A;  1JCG A;  1WLJ A;  1LOT B;  3CJB A;  4C8L A;  3KWI A;  4BRO A;  4EIA A;  1QZ5 A;  3MN5 A;  1W7A A;  4B9Q A;  2HF3 A;  4F8R A;  2P9I B;  1HPZ A;  4Y1C A;  4O4G A;  2HHX A;  1Q9X A;  1ZBI A;  3MK6 A;  5J2Q A;  3SAF A;  4IG3 A;  2X6S A;  2OZS A;  3HPH A;  3CCQ N;  1ASU A;  3CPW M;  4FWS A;  3CQ8 A;  4M3Y A;  4OLB A;  1WSJ A;  4JI0 K;  1NK0 A;  1ZBH A;  2G8I A;  4O5F A;  3D45 A;  1NGH A;  5LY3 A;  4DQP A;  4JLH A;  4JKD A;  1TK5 A;  4CBX A;  1CXQ A;  4IXC A;  3D2E A;  1WSH A;  4CI6 A;  4H5V A;  2QXL A;  3SYZ A;  1C0M A;  1JLF A;  1U2V A;  1TVR A;  4CGF A;  4DV2 K;  2YHB A;  2HHT A;  3FR0 A;  4DUZ K;  3DXK B;  5EOY A;  4M45 A;  4KO0 A;  4Z0U A;  2A6A A;  4PQU A;  4FK2 A;  2HBK A;  1VSE A;  2V52 B;  4DQ8 A;  4DU1 A;  4O0J A;  3LL3 A;  3HBT A;  4DQR A;  3DLL L;  3MX5 A;  5AQI A;  3PUF A;  1W2B M;  4IBN A;  1Q82 O;  4DSL A;  1KAZ A;  2HHU A;  1W9H A;  4X64 K;  4Q0B A;  3U8X A;  2OPR A;  3EKS A;  3HP9 A;  3QB0 A;  4C8M A;  2QWL A;  2UUA K;  2XY6 A;  1HJR A;  4GVM A;  4DTN A;  5C10 A;  4LH4 A;  4CJS A;  1FXX A;  1D5A A;  5M1O A;  3UKU B;  4AQY K;  1HPM A;  2F8S A;  3DOK A;  3G6E N;  2P9L A;  4E7J A;  3RSE A;  4H5R A;  3OW2 M;  3VMF B;  4AHR A;  1NGI A;  1FKP A;  2IC3 A;  3P83 D;  4JI7 K;  1SKW A;  4FL9 A;  3PSI A;  3S41 A;  4AHT A;  1NOY A;  4FWN A;  2YKM A;  3HSC A;  1HKG A;  1KVA A;  2IVO A;  4DFM A;  3V1R A;  5F0X A;  3I55 N;  1RTI A;  1SV5 A;  1QSS A;  1WSF A;  3CM5 A;  1S1W A;  4HUE A;  1JCE A;  3CF5 L;  3KLF A;  3GL1 A;  3AVL A;  4KFB A;  3VQ4 A;  4JKH A;  2HST A;  1RCH A;  4B1Z A;  3L2W A;  1QQC A;  4B9V A;  4NB4 A;  4DTS A;  4Z4I A;  1XNR K;  3LAK A;  1X3N A;  2Q31 A;  4JS4 A;  5HRP A;  4DSF A;  4FJG A;  4M41 A;  1KLM A;  3AVH A;  2O4G A;  4K41 A;  3ZSX A;  2G8V A;  3TAE A;  3AA5 X;  3K9J A;  2KZM A;  5AQY A;  4DS5 A;  5AQX A;  1KCF A;  4N76 A;  2ZGZ A;  3O6W A;  3AAP A;  3HL8 A;  3ZX3 A;  4H0P A;  3GBT A;  2UUC K;  4IDK A;  4FLV A;  1HJO A;  2PBD A;  3V9S A;  4BRH A;  4L8R B;  3J7Z O;  3PV8 A;  3DLR A;  4MFB A;  4CJL A;  4R5P A;  3OVN A;  4BDY A;  3W0L A;  4CF0 A;  4PKH A;  4EHU A;  3MEG A;  4CZF A;  4CGG A;  3CCS N;  3O9R A;  3OA9 A;  3SJH A;  3C94 A;  3OS0 A;  4I6M A;  2F7T A;  3GOI A;  1VSK A;  3VQE A;  1IG8 A;  4DKW A;  3MN7 A;  4JKC A;  5C12 A;  3PLA A;  2ZJP L;  4DV5 K;  3QIO A;  5C2D A;  2FXU A;  1NG9 A;  4J2A A;  3SPY A;  3LDL A;  1LAW A;  1RDU A;  5AQP A;  1KFS A;  3S3N A;  5JLH A;  4IWV A;  4KPY A;  3L2Q A;  3DYA A;  4CEB A;  2OTJ N;  3M8P A;  3QEI A;  4IOX A;  4GNI A;  1TGO A;  1LWF A;  1LV5 A;  2UXD K;  2A1R A;  3E01 A;  4CGI A;  1MWK A;  3NF9 A;  3CET A;  4DV4 K;  3FE1 A;  3CCE N;  5I9E B;  1YF5 L;  2YHX A;  3KHY A;  1JLE A;  1GLA G;  3F9M A;  3MWP A;  1RNH A;  1N5Y A;  4N41 A;  1TL1 A;  2VG7 A;  3D2F A;  4BRA A;  4CE9 A;  5J1E A;  1Y97 A;  4CGH A;  4NXM K;  5J2P A;  1N8R O;  3LP2 A;  3L3U A;  3O5B A;  4A62 A;  3QIN A;  1SL2 A;  1YVN A;  4DR2 K;  1S5J A;  4V19 S;  4B1V A;  4DR6 K;  1I3A A;  3O4W A;  4ID1 A;  1CZA N;  5JS1 A;  2FBT A;  3T1H K;  3L6Q A;  4BWJ A;  1LW2 A;  4CHQ A;  2ZJQ L;  2GBZ A;  4NCB A;  4DFK A;  1YHQ N;  3VEX A;  4JI3 K;  3BF1 A;  4M3X A;  1JXB A;  4JI6 K;  1NGC A;  5JMV A;  3QET A;  3NGI A;  4UQG A;  3AO1 A;  3LM9 A;  3WNG A;  5FRO A;  2QK9 A;  3IS9 A;  2P5G A;  3VA3 A;  3N4P A;  2CGL A;  4H0T B;  2IGI A;  4CJP A;  1HQE A;  1RT6 A;  4RTF D;  3V81 A;  1JL2 A;  2DFH A;  3TAG A;  1QQO A;  4PL7 A;  3QEX A;  2HHS A;  3PSF A;  1YTA A;  4JKA A;  2ZD1 A;  3NH0 A;  5AZJ A;  3KKR A;  1TKT A;  1R59 O;  2O8F B;  1TKZ A;  3V9W A;  2CH5 A;  3KLH A;  1ZXO A;  3P5J A;  1B9D A;  4PA1 A;  5F2R A;  2OZM A;  4B3M K;  4YOW A;  5JIC A;  2FBV A;  4IJN A;  3LDQ A;  3FZM A;  5AFU H;  1IKV A;  3DI6 A;  4ZTF A;  2E2O A;  4ZTJ A;  4JHD A;  4CFB A;  5BPN A;  3V9U A;  1BI4 B;  1YVU A;  5K14 A;  4AHU A;  3OJU A;  4E0D A;  4RW4 A;  4DUY K;  4JI1 K;  2OYQ A;  3M5R A;  4CJK A;  3K58 A;  3CJA A;  3DLH A;  3CCL N;  1QQN A;  3UKR A;  1S1X A;  3THY A;  3ZYY X;  1N32 K;  3EE9 A;  3MWT A;  4E1J A;  4OKE A;  1QSY A;  4CJT A;  3UIQ A;  3ENB A;  2F9W A;  3A2F A;  4K25 A;  4KHS A;  2P9P A;  4JKB A;  1UOC A;  2HND A;  3CQY A;  3R6M A;  5M1K A;  1SZ2 A;  1B92 A;  3I56 N;  1WSG A;  4DHY A;  2ATQ A;  4WF9 L;  4XEI A;  3KD1 E;  1NOZ A;  2VYP A;  4CJ7 A;  3RR8 A;  3A5O C;  1VQ5 N;  4TSX A;  1J9A A;  3ZT3 A;  4KHW A;  2HF4 A;  4FPB A;  3VQD A;  4FCY A;  4CD3 A;  2QWQ A;  1Z05 A;  3VN5 A;  4KI6 A;  3C65 A;  1XQS C;  1HR0 K;  2ZWH A;  3WNH A;  1IJJ A;  1BGX T;  1ESV A;  4F3T A;  4U67 L;  1RBR A;  4DU3 A;  4C8N A;  2OA8 A;  4C8O A;  4JRP A;  4LF7 K;  4CJU A;  1E4G T;  2F9T A;  1BWF O;  1GOB A;  1C0T A;  4FM1 A;  2KW4 A;  3WEE A;  1VSD A;  1ZBU A;  4I2P A;  2ITM A;  4M3U A;  4CEC A;  1IG9 A;  2YV0 X;  3SAH A;  1HLU A;  5A2Q O;  3VQC A;  1SUQ A;  1IH7 A;  4FYD A;  2A1S A;  1RTJ A;  1IV0 A;  1BG3 A;  1X9M A;  5EXW A;  4JKG A;  1HMV A;  4H03 B;  4K43 A;  3TAP A;  3ZEU A;  1Q18 A;  2P9N A;  4FOI A;  3VA0 A;  4A5B A;  2P51 A;  1WB9 A;  4DV1 K;  4FLW A;  3CPE A;  3LP3 A;  1RDW X;  3LDS A;  3JSM A;  4FM2 A;  1RBT A;  1VQK N;  3CME N;  3P4I A;  4BRM A;  4LF8 K;  4LSN A;  3TTC A;  3OYH A;  5CYQ A;  1S6P A;  4NXN K;  1BQN A;  2ASP A;  4X65 K;  4FJK A;  3TAB A;  3ZX2 A;  2E2N A;  4CJF A;  3KIO A;  4LC9 B;  4CJ5 A;  5KRS A;  3CC7 N;  2IVP A;  2WTU A;  4OVL A;  3ZET B;  3ENH A;  2DFF A;  4BE0 A;  3LAM A;  2VQF K;  1HNI A;  1VSJ A;  3HVR A;  4YFU A;  4CFD A;  1EWQ A;  4FWR A;  2HVI A;  1KAX A;  2EX3 A;  3WXJ A;  4CES A;  1XHZ A;  5LJV A; 
#chains in the Genus database with same CATH homology
 3D45 A;  4DQP A;  4J2A A;  3QEV A;  2B5J A;  4FJJ A;  4JLH A;  1SL1 A;  1QTM A;  1TK5 A;  4N41 A;  3NH2 A;  4B08 A;  3KK1 A;  2BDP A;  1IKY A;  1CXQ A;  3IRX A;  1WSH A;  3ULD A;  4RW6 A;  5I3U A;  4E19 A;  3SYZ A;  3ZSW A;  4W5Q A;  2PZS A;  2HHQ A;  3AVF A;  1C0M A;  1JLF A;  1QHT A;  3K2P A;  1QE1 A;  1TVR A;  3OYG A;  3T3F A;  4CGF A;  3PX4 A;  1NJX A;  3BGR A;  3NGZ A;  3V6D A;  5CZ1 A;  1U45 A;  4DFP A;  1CXU A;  2B4J A;  2YHB A;  4CF8 A;  4B3O A;  1RT7 A;  3QEP A;  2HHT A;  4N5S A;  4HCB A;  4B9T A;  1RT2 A;  4B9U A;  4FK4 A;  1BI4 A;  2KZZ A;  4DG1 A;  3LAN A;  1NJZ A;  3DLG A;  3TAQ A;  2G8K A;  3V1Q A;  3M8R A;  4J2B A;  3DLB A;  4EP4 A;  3M8S A;  4FVM A;  4FM0 A;  4RG8 A;  1RBV A;  4M45 A;  2G8W A;  4ELU A;  4KO0 A;  4Z0U A;  1BCM A;  4PQU A;  1X9S A;  3LWM A;  4FK2 A;  1VSH A;  1VSE A;  2XHB A;  4DU1 A;  4FLY A;  1U49 A;  1KTQ A;  4CER A;  4O0J A;  4CFC A;  3NHG A;  3HPG A;  3LP0 A;  4KB0 A;  4DQR A;  4FJ5 A;  3LZI A;  3PO4 A;  4LY7 A;  3PUF A;  4FZX C;  3AA3 A;  4OLA A;  4IBN A;  4DSL A;  1X1P A;  4W5T A;  2HHU A;  1W9H A;  4BDZ A;  1RT4 A;  4Q0B A;  1S9G A;  2OPR A;  3HP9 A;  4C8M A;  3SCX A;  4CHP A;  2VG6 A;  5J2M A;  5FRN A;  3K5L A;  5HRS A;  2XY6 A;  4FJ9 A;  3LP1 A;  2BAN A;  1NK8 A;  1VSL A;  2IDO A;  3SI6 A;  1U48 A;  1HJR A;  4GVM A;  1T05 A;  4DTN A;  2ZQB A;  1RIL A;  4KKO A;  2G8U A;  1EP4 A;  3OYN A;  2IAJ A;  4YNQ A;  2YNG A;  4KV8 A;  4LH4 A;  3THV A;  1RDB A;  4CJS A;  4CGJ A;  4DFJ A;  3QES A;  1U04 A;  1FXX A;  1RBS A;  1KFD A;  1L3S A;  1C1B A;  4KHY A;  1D5A A;  3NF7 A;  4QCL A;  2F8S A;  3DOK A;  1Z26 A;  3O3H A;  4F2R A;  4E7J A;  4I7F A;  3OYM A;  3B6P A;  4AHR A;  1FKP A;  2IC3 A;  3P83 D;  1SKW A;  1S9E A;  4FLX A;  4W5N A;  4M3Z A;  5I42 A;  3VQQ A;  4AHT A;  1NOY A;  3O4N A;  2YKM A;  1ITG A;  1WSE A;  3OYL A;  3QEW A;  4DWI A;  4FJL A;  4KTW A;  3AVB A;  3ZT2 A;  1KVA A;  3NE6 A;  4G1Q A;  4B8C A;  4DFM A;  4FLU A;  1JLA A;  3SPZ A;  3V1R A;  1VSI A;  4HTU A;  2PYL A;  1BIU A;  1CZ9 A;  1RTI A;  1RT3 A;  4KTZ A;  3OYC A;  4CF1 A;  2ETJ A;  3RRH A;  1SV5 A;  2EHG A;  1J5O A;  2IOC A;  3QO9 A;  1QSS A;  1WSF A;  3CM5 A;  3QIP A;  2GV9 A;  4OKK A;  1S1W A;  1U47 A;  4HUE A;  5D3G A;  4Z4F A;  3ZT4 A;  1XHX A;  3CM6 A;  3KLF A;  3G10 A;  2HNY A;  3AVL A;  4KFB A;  3VQ4 A;  5CY4 A;  2HHV A;  4CIG A;  1S1T A;  1RCH A;  4E3S A;  2RKI A;  2QKB A;  3L2W A;  4H4M A;  1QQC A;  1RDA A;  4DTU A;  4B9V A;  2Z1I A;  2YHA A;  3RR7 A;  4DSE A;  1L3U A;  3K5M A;  4KHU A;  3SQ0 A;  4F3O A;  4DTS A;  2F96 A;  4NYF A;  4H4O A;  3AVC A;  4RW8 A;  3PO5 A;  4KHN A;  4Z4I A;  3LAK A;  3AVG A;  4BE1 A;  4JS4 A;  5HRP A;  3U3G A;  1TL3 A;  4DSF A;  1TV6 A;  1X9W A;  1T03 A;  4FJG A;  3RWU A;  1R0A A;  4M41 A;  3ZT1 A;  1FK9 A;  3OYA A;  4FJX A;  1EX4 A;  1KLM A;  5C25 A;  3AVH A;  2O4G A;  4O5B A;  3ZSX A;  2X6N A;  3ZT0 A;  1ASV A;  3HYF A;  3TAE A;  2G8V A;  4F4K A;  4FJ8 A;  3AA5 X;  2KZM A;  4DS5 A;  2XO7 A;  3IG1 A;  3VQA A;  3OY9 A;  4DSK A;  1KCF A;  4IFY A;  3O3F A;  4N76 A;  1ZBF A;  3OYD A;  4CJQ A;  4CIF A;  1I39 A;  4I9L A;  2QKK A;  1JXE A;  3HP6 A;  3HL8 A;  4O0I A;  4DQI A;  2HMI A;  3IAY A;  5KGX A;  4IDK A;  4GMJ B;  2XY5 A;  4FLV A;  3HST B;  4C8K A;  3WNF A;  3V9S A;  1VSF A;  2D5R A;  4KRF A;  2KFN A;  1C6V A;  4W5R A;  2G8H A;  4L8R B;  3PV8 A;  4E89 A;  3DLR A;  4MFB A;  4CJL A;  1RDC A;  4R5P A;  3OVN A;  4BDY A;  3VQ8 A;  4CF0 A;  1NKB A;  1WAJ A;  3MEG A;  2D0B A;  3RTV A;  4CCH A;  4CEQ A;  1NJY A;  5FDL A;  3V4I A;  1REV A;  4Z4E A;  1HQU A;  1D8Y A;  3K59 A;  4CGG A;  3AO4 A;  3S3O A;  3SQ2 A;  1L3T A;  1NJW A;  3KLG A;  3C94 A;  3BDP A;  4F2S A;  3AVI A;  3MED A;  4OGE A;  4CFA A;  3OS0 A;  5HRR A;  4CEF A;  4CF9 A;  3K57 A;  1N5Y A;  3ITH A;  1VSK A;  3S9H A;  3VQE A;  3NF8 A;  1KRP A;  3OS2 A;  4CF2 A;  5KRT A;  3CG7 A;  5E41 A;  4Z4C A;  4B8A B;  2BE2 A;  2ZE2 A;  4IKF A;  3QIO A;  3EY1 A;  1VK0 A;  4NYN A;  5KI6 A;  4FW1 A;  3KJV A;  3PX6 A;  3F73 A;  4AHV A;  3RMD A;  2YNH A;  3SPY A;  1HRH A;  1LAW A;  3EZ5 A;  3HVT A;  3MAQ A;  4B9S A;  2DTU A;  1QS4 A;  1KFS A;  2VG5 A;  4O55 A;  3S3N A;  3SUN A;  3PY8 A;  3TAF A;  4LD0 A;  5HRN A;  4ZHR A;  4E7I A;  4K8Z A;  4KPY A;  2GUI A;  1JL1 A;  4NCG A;  3L2Q A;  3DYA A;  4CEB A;  4MQ3 A;  3SQ1 A;  3M8P A;  3DRR A;  3QEI A;  4ELV A;  4Z4H A;  4FLZ A;  2NUB A;  3I0R A;  4LSL A;  1Z25 A;  4OJR A;  1RT1 A;  1TGO A;  3HPO A;  3KK3 A;  2VWJ A;  4JS5 A;  1LWF A;  4DTR A;  3RMB A;  1LV5 A;  4BAC A;  1HYS A;  3OYF A;  2A1R A;  3E01 A;  5KTQ A;  2P5O A;  3L3V A;  4CGI A;  3LZJ A;  1EKE A;  1WSI A;  4FJM A;  3AVA A;  3CFP A;  4CEE A;  3NF9 A;  3V9X A;  4M42 A;  1D9F A;  4DTX A;  4FZY A;  2Z1J A;  3L8B A;  1JLE A;  2OPS A;  2LSN A;  3MEC A;  2ITG A;  4E1N A;  1A5V A;  1RNH A;  3T19 A;  4CJR A;  1TL1 A;  3ZSR A;  4ID5 A;  2VG7 A;  4CE9 A;  4HVJ A;  1N6Q A;  5J1E A;  1Y97 A;  4CGH A;  1BCO A;  5J2P A;  4RW7 A;  3TR8 A;  3LP2 A;  5HBM A;  3L3U A;  2E4L A;  3QNN A;  3QIN A;  4JRQ A;  1SL2 A;  4E7L A;  1S5J A;  3TWH A;  4CEA A;  1C1C A;  2WON A;  1I3A A;  4K8X A;  3M8Q A;  4ID1 A;  1NK9 A;  4HHT A;  5JS1 A;  2FBT A;  2KQ2 A;  4BWJ A;  1UAX A;  2OPQ A;  1LW2 A;  3DRS A;  3KKS A;  3ZSQ A;  4CHQ A;  1RTD A;  2GBZ A;  1F21 A;  1JLQ A;  4FLT A;  4DFK A;  2X78 A;  4CEO A;  4IFV A;  4I9Q A;  4NCB A;  4W5O A;  4M3X A;  4KB1 A;  2HW3 A;  3L2U A;  1JXB A;  4DLE A;  1IKW A;  2XRI A;  3I8D A;  3K5N A;  3L2R A;  3HM9 A;  1NKC A;  1J54 A;  1L5U A;  3FFI A;  2IS3 A;  3QET A;  3SUO A;  3V1O A;  3NGI A;  1LWC A;  3G0Z A;  1EET A;  1LW0 A;  3AO1 A;  4UQG A;  3U6F A;  4CK3 A;  5HP1 A;  1KVC A;  2E6M A;  3PX0 A;  3KLI A;  3WNG A;  3SZ2 A;  4B9N A;  5FRO A;  4Q5V A;  1K6Y A;  3L2V A;  2QK9 A;  3C95 A;  3IS9 A;  4AIL C;  3RMC A;  2P5G A;  3VA3 A;  3H08 A;  4N47 A;  1J53 A;  2D0C A;  4CJ3 A;  4CHO A;  3CFR A;  2IGI A;  1HYZ A;  4LH5 A;  1IKX A;  2DY4 A;  4CJP A;  1HQE A;  1RT6 A;  4AHC A;  3V81 A;  1JL2 A;  1RBU A;  2DFH A;  3ALY A;  3TAG A;  3QEX A;  1T7P A;  2HHS A;  2BGG A;  4Y1D A;  3NDK A;  2PYJ A;  1YTA A;  5HLF A;  2ZD1 A;  1VRU A;  4IG0 A;  2WOM A;  3ISN C;  4OPJ A;  2W42 A;  3NH0 A;  1CLQ A;  3AA2 A;  3AO3 A;  3LWL A;  3U3Y A;  3P1G A;  4CHY A;  3MEE A;  3KKR A;  1UA1 A;  4PY5 A;  1TKT A;  2RF2 A;  3O4Q A;  1TKZ A;  4M3R A;  3V9W A;  4BE2 A;  4NCA A;  3NBP A;  3QNO A;  2JGU A;  3AVM A;  1SL0 A;  3ZSY A;  3KLH A;  3SV3 A;  3T1A A;  3CFO A;  1TKX A;  3P5J A;  5CZ2 A;  3V9Z A;  1B9D A;  4FW2 A;  2XY7 A;  1HYV A;  4PA1 A;  1QSL A;  1Q9Y A;  2RPI A;  3SQ4 A;  2HHW A;  2OZM A;  4H8K A;  3F9K A;  2FBV A;  3NFA A;  3KK2 A;  1IKV A;  3DI6 A;  1KLN A;  4ZTF A;  3ZSV A;  4ZTJ A;  2HNZ A;  3NH1 A;  4CFB A;  4HUG A;  3AVK A;  3V9U A;  4FJN A;  1BI4 B;  1YVU A;  5K14 A;  4AHU A;  3OJU A;  3OYJ A;  1BIS A;  4BDP A;  4E0D A;  3ZSZ A;  3RRG A;  3DOL A;  4RW4 A;  2OYQ A;  3ZCM A;  2PY5 A;  5C42 A;  4DQS A;  2FBX A;  4CJK A;  3K58 A;  1XI1 A;  1HNV A;  4Z4G A;  1VRT A;  3HK2 A;  3VQ9 A;  1RTH A;  1JKH A;  1XWL A;  2YNI A;  3DLH A;  4AH9 A;  1GOC A;  2DFE A;  4WE1 A;  3NAE A;  1C1A A;  5C24 A;  3HXM A;  1C0U A;  1YTU A;  2G8F A;  1IO2 A;  2RN2 A;  4CHZ A;  2YKN A;  4EP5 A;  4CHN A;  2XY8 A;  1S1X A;  1S1V A;  5JS2 A;  1TAQ A;  1T8E A;  3KD5 E;  4M3W A;  4FZZ A;  4KRE A;  3HO1 A;  2R7Y A;  4OKE A;  4OPK A;  4CJT A;  1W0H A;  1QSY A;  4DQQ A;  3UIQ A;  3AV9 A;  3A2F A;  1NK5 A;  2FC0 A;  4KHS A;  3OYE A;  3OS1 A;  1LWE A;  1UOC A;  2HND A;  3LPT A;  3C6U A;  4CED A;  4FJI A;  3SNN A;  4OGC A;  5DMR A;  1B92 A;  4E1M A;  2E6L A;  3AA4 A;  3DMJ A;  2OPP A;  1A5W A;  4KHQ A;  1WSG A;  3S3M A;  1NKE A;  1RT5 A;  2ATQ A;  4PUO A;  5T7B A;  3KTQ A;  3KD1 E;  1NOZ A;  4CJV A;  4HUF A;  2YNF A;  3QER A;  3RR8 A;  3WNE A;  4EZ9 A;  1MU2 A;  1CZB A;  4I2Q A;  4QOZ B;  4FK0 A;  3NGY A;  4PWD A;  3DLE A;  1B9F A;  4TSX A;  5EU7 A;  4BWM A;  1WNS A;  3AO2 A;  4DTP A;  1NK6 A;  1J9A A;  1YT3 A;  3AVJ A;  3NF6 A;  3ZT3 A;  4J2E A;  4KHW A;  2JLE A;  2VWK A;  3B6O A;  3C6T A;  3VQB A;  3VQD A;  4FCY A;  1L3V A;  4B9M A;  4DSI A;  4CJE A;  1DTQ A;  1S1U A;  4CEZ A;  4FXD A;  1SKR A;  4E7K A;  2X74 A;  1JLG A;  4E7H A;  2Q3S A;  2AJQ A;  3K5O A;  3VN5 A;  2B6A A;  4KI6 A;  3TAM A;  4QAG A;  1DTT A;  1UA0 A;  1Q8I A;  4CIE A;  4KAZ A;  3HT3 A;  3WNH A;  3LPU A;  3OYB A;  1BGX T;  1LAV A;  4DF8 A;  2QXF A;  3TAR A;  1XC9 A;  4F3T A;  1RBR A;  3LAL A;  5SWM A;  1UWB A;  4DS4 A;  4DU3 A;  4C8N A;  4OKJ A;  4AHS A;  1ZBL A;  2I5J A;  4N56 A;  2OA8 A;  4C8O A;  4J2D A;  4JRP A;  3DM2 A;  4CJU A;  4DU4 A;  1ASW A;  3OYK A;  1TK8 A;  2Y1J A;  4CK1 A;  3OYI A;  1S6Q A;  1GOB A;  1C0T A;  4CJW A;  1RDD A;  4XIU A;  3SJJ A;  4FM1 A;  2KW4 A;  4DTO A;  3QLH A;  1VSD A;  1A5X A;  1ZBU A;  3DRP A;  3SV4 A;  4I2P A;  4CGD A;  2Z1H A;  3AO5 A;  1GOA A;  3TI0 A;  4M3U A;  4CEC A;  1BIZ A;  3O3G A;  3NCI A;  4RW9 A;  1O1W A;  2Y1I A;  1VSM A;  1IG9 A;  1TAU A;  1G15 A;  2YV0 X;  1TKD A;  4EZ6 A;  1KVB A;  3VQ6 A;  4FYD A;  3VQC A;  1SUQ A;  1IH7 A;  2A1S A;  1RTJ A;  4DLG A;  4DSJ A;  1X9M A;  4HCC A;  3EYZ A;  2P1J A;  1D9D A;  1HMV A;  2O4I A;  4O44 A;  3TAP A;  1WN7 A;  1KSP A;  3VA0 A;  2D0A A;  3ZSO A;  2P51 A;  3SUP A;  4DF4 A;  3VQ7 A;  4FLW A;  4KTQ A;  2F8T A;  3LP3 A;  1NK4 A;  3LDS A;  4FJH A;  5KGW A;  3JSM A;  1JLC A;  4FM2 A;  1FKO A;  1RBT A;  3MXJ A;  3MXI A;  4FJ7 A;  2HVH A;  4CK2 A;  3DLK A;  3AVN A;  3HJF A;  3MXM A;  1EXQ A;  4LSN A;  5SZT A;  5J2N A;  3CYM A;  3OYH A;  5CYQ A;  3VQ5 A;  1S6P A;  1WAF A;  3OJS A;  1BQN A;  4FJK A;  1WLJ A;  4ICL A;  3VQP A;  3TAB A;  1BQM A;  3RMA A;  4C8L A;  4CJF A;  3KIO A;  4CJ5 A;  5FRM A;  5KRS A;  5HRO A;  4DMN A;  4DTJ A;  4F8R A;  5DK5 A;  1BL3 A;  1BHL A;  1HPZ A;  2Z1G A;  4Y1C A;  2KFZ A;  4O4G A;  4OVL A;  5CYM A;  3I0S A;  4DTM A;  4B9L A;  2HHX A;  1Q9X A;  1ZBI A;  2DFF A;  4BE0 A;  3LAM A;  5J2Q A;  3TAN A;  1TK0 A;  3SUQ A;  4GW6 A;  3D0P A;  4IG3 A;  2X6S A;  1DLO A;  1ZYQ A;  1HNI A;  3KLE A;  1VSJ A;  2OZS A;  3HPH A;  3ASM A;  3HVR A;  4M3T A;  4ELT A;  4YFU A;  4CFD A;  1ASU A;  1SKS A;  3JYT A;  3CQ8 A;  4M3Y A;  4OLB A;  2HVI A;  4CES A;  1JLB A;  2EX3 A;  1WSJ A;  4CJ4 A;  2HB5 A;  2FBY A;  1XHZ A;  1U4B A;  4KI4 A;  1NK0 A;  1ZBH A;  2G8I A;  1NK7 A;  2KTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...