1RBTA

Structural study of mutants of escherichia coli ribonuclease hi with enhanced thermostability
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADGKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE H
publication title Structural study of mutants of Escherichia coli ribonuclease HI with enhanced thermostability.
pubmed doi rcsb
source organism Escherichia coli
total genus 53
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rbtA00
3NGYA 3ZT3A 3KD1E 3SYZA 3RR8A 1TKXA 3QEPA 4AHSA 2PY5A 4KHYA 2QXFA 2KTQA 1KFDA 3BGRA 1TAUA 1ITGA 3FFIA 2JGUA 3T3FA 1JLQA 2E6LA 4CEEA 5KGXA 4BWJA 3NE6A 3NFAA 4NYNA 1YT3A 1WSHA 4KFBA 2XHBA 2EHGA 3OYAA 1WSJA 4B9MA 3QEVA 4HUFA 2YNHA 3C95A 3OS1A 4ELUA 4FJNA 1Q8IA 3RMDA 1KTQA 4M3ZA 1KFSA 2PYJA 3OY9A 2XY8A 4Z4CA 1C6VA 2HNYA 2WONA 1HQEA 3MEEA 3OYFA 1VSEA 3CM6A 4FM2A 3TABA 1U45A 4GVMA 2P51A 1JLGA 3K58A 2DFFA 4OVLA 4RW4A 3IRXA 1SV5A 1UAXA 3C94A 3NH1A 3KLEA 2XO7A 3V1OA 3LANA 3HT3A 3ZT2A 3NHGA 4RW7A 2G8UA 4FJXA 4LH4A 1NK4A 4CHZA 4M3WA 2OPRA 4Q5VA 1D9FA 3F73A 4CJ5A 4ZTFA 3AO1A 1FK9A 1RTHA 3DLGA 4DFMA 4FJJA 1CZ9A 1CXUA 2GUIA 1RDCA 4CGDA 4N5SA 3OJUA 4KHUA 2JLEA 4DQSA 2G8HA 4NCAA 3OYMA 4DTUA 4O5BA 1S1WA 1RCHA 4M3UA 1GOBA 1CZBA 2VG7A 4OKJA 3OS0A 3DLRA 1S9EA 1SL0A 4BE0A 3G10A 3KKSA 1EETA 4CFCA 5FDLA 5CYMA 1RDBA 3VQAA 4DSEA 3RMBA 1XC9A 4ZTJA 5CZ2A 4OLBA 4HTUA 4DF8A 1IO2A 2KZZA 4C8LA 1EP4A 1YTAA 4FW2A 2OYQA 4HCBA 1TVRA 4J2BA 5D3GA 3QINA 4OLAA 1Y97A 3AO4A 3DOLA 1JLBA 1RDDA 1X9SA 4FK2A 3U3GA 5C24A 3ZSXA 4CF9A 5JS2A 4AHUA 4FM1A 4FZZA 3OYLA 3HSTB 1VSDA 4I9LA 1RT6A 3NDKA 3DMJA 4XIUA 5J2NA 4NCGA 1NJYA 4FYDA 2VWJA 3AVHA 3QLHA 1NK8A 4HCCA 3L3VA 4FLYA 2G8FA 4YNQA 4E0DA 4FJ5A 3QEWA 5CY4A 3T1AA 4CFBA 4NYFA 1Q9YA 3B6PA 4DQQA 1KLNA 4EP4A 2I5JA 4F3OA 3WNFA 3U3YA 3CFOA 5I42A 3VQCA 4CF1A 4DG1A 4TSXA 2XY7A 3ZSQA 4CCHA 4FJ9A 4CJEA 4FCYA 1ZBUA 5CZ1A 4E3SA 2G8KA 1WSFA 4B9UA 1HPZA 2G8IA 2KZMA 1U47A 3V9SA 1IH7A 4RG8A 2F8SA 4F3TA 4KREA 4CJSA 1WAJA 3ZSWA 4CHNA 4JRQA 4KAZA 2D0CA 1TGOA 4UQGA 3AVLA 4AHCA 4I2PA 3VA0A 4FJHA 4GMJB 2HHUA 2YKMA 1QS4A 2Y1IA 1QHTA 4B3OA 3ZT0A 3V9UA 3RWUA 4J2EA 4W5NA 3SQ0A 1TK8A 4DSIA 1VSJA 4DU1A 3DYAA 1GOAA 4E1MA 3RMAA 3TWHA 4K8ZA 1U48A 3M8RA 1D8YA 1REVA 2G8WA 2QKKA 3ZSYA 2B4JA 2ETJA 3VQ8A 1LWFA 3NAEA 4Z4FA 2Q3SA 2F8TA 2OPQA 3SQ4A 3MXJA 4PA1A 4BDZA 4BE1A 4K8XA 3LP1A 4FZXC 5HP1A 4C8OA 2FBYA 3OYNA 4C8KA 5C25A 2HW3A 4CEBA 3A2FA 4M3YA 4O4GA 4CGJA 1KSPA 1IKXA 4DTPA 1U04A 4HUEA 4G1QA 1Z25A 1JKHA 2VG5A 4Y1DA 4CEOA 2B6AA 4DQRA 3OYDA 2IOCA 3AVKA 3LAMA 4FJKA 2F96A 4CGIA 2ATQA 4M3RA 3PX0A 1MU2A 1HNVA 3NCIA 3SUOA 3V9WA 1N5YA 3QESA 2KQ2A 4B9SA 1WSEA 2HB5A 2ZD1A 1T05A 4PUOA 4DFKA 2PZSA 4ID1A 3SQ1A 1I39A 3HP9A 4AHRA 4FVMA 1IKVA 1HMVA 5HRSA 1TKDA 1NKBA 2OA8A 4OPKA 1U49A 3PY8A 1B9DA 4M3TA 4PQUA 3ZSOA 4CJLA 2IC3A 4BDPA 4E19A 3RMCA 4FLUA 1SL2A 1S6PA 1BGXT 1FKOA 3LWMA 1NJZA 3EZ5A 4HHTA 2ZQBA 4MFBA 4FK4A 3L2WA 4CK3A 1RT2A 3B6OA 1L3TA 1NK5A 1UA0A 2ZE2A 1KRPA 3MEDA 4JLHA 1WAFA 1ASUA 1RT5A 4DQPA 4KHWA 3RTVA 2HVHA 2LSNA 2BDPA 1JLEA 4B9NA 4E89A 4OGCA 3P1GA 3E01A 1RT4A 2RN2A 1UA1A 3TAQA 3LALA 4FM0A 4O0JA 4RW6A 1KVCA 4CJUA 4PY5A 3MAQA 1TK5A 4Z4GA 1FXXA 4CJVA 1ZBHA 2RKIA 4CHQA 4R5PA 2HNZA 4KI4A 3L3UA 5E41A 5HRNA 4DS4A 1T8EA 4BDYA 1FKPA 5I3UA 2HHTA 2YKNA 5DMRA 3IS9A 1LW0A 4OPJA 1UOCA 1BI4B 2IDOA 3HPGA 4KTQA 4LSLA 4EP5A 3TAPA 2HHSA 4FLZA 4CHYA 4ID5A 2FBVA 4FW1A 1O1WA 5HRPA 4KHSA 4OJRA 1DTTA 3OYJA 3SQ2A 1S5JA 2GV9A 3T19A 4N56A 1ZBLA 3AO2A 4CEDA 3QEIA 3QO9A 4DFPA 1U4BA 5DK5A 4DWIA 2HMIA 4M42A 4DSFA 2KW4A 3WNGA 3ALYA 3LAKA 1KVAA 1TL1A 4F8RA 1ASVA 2IGIA 3AA4A 4H4MA 1D9DA 1VRUA 1BL3A 4CJRA 1C0TA 1K6YA 2E6MA 3V9ZA 4LH5A 2PYLA 4FXDA 1L3UA 2P1JA 1BQNA 2YHBA 1RBVA 5KI6A 3CQ8A 2RF2A 2WOMA 1HYZA 2RPIA 3LPTA 4LSNA 4CF2A 5SZTA 4DSKA 3K57A 1KVBA 3OJSA 1JXBA 4I9QA 4Z4IA 3OYIA 1UWBA 4YFUA 1VSHA 3RR7A 3AVNA 1NK6A 3VA3A 3MXMA 3SJJA 1NJXA 4N76A 3AVIA 2X74A 3ISNC 2X6SA 4GW6A 1C0UA 2XRIA 1J5OA 4CECA 5EU7A 4F2SA 1WN7A 3DRRA 2Z1IA 3NF7A 2KFZA 3WNEA 3KLGA 4DSJA 4NCBA 2IS3A 2OZSA 3L2RA 3HL8A 3S3NA 4CJWA 2R7YA 3RRHA 4BE2A 1TK0A 2QKBA 4CK2A 1BHLA 4DTXA 4WE1A 3HYFA 1R0AA 3LP3A 4KKOA 4Z4EA 4IG0A 1BIZA 1S1XA 1S6QA 3AO5A 3VQQA 1T03A 5FROA 1JLFA 3I0RA 5CYQA 3TAGA 2YNGA 3NF9A 4I2QA 4CIEA 1QQCA 2HHVA 1LV5A 4DTMA 3EY1A 4LY7A 3NF6A 2ITGA 5T7BA 3M8SA 4ZHRA 1J53A 4B9VA 4DTJA 3TAEA 1RT7A 2Z1GA 4BWMA 3V4IA 3OYEA 3HVRA 3THVA 1TL3A 3JSMA 3L8BA 3AVJA 4H4OA 2A1SA 3O3GA 4H8KA 3JYTA 4AILC 3QETA 3LZJA 3KKRA 3C6UA 1JLCA 1TAQA 3M8PA 3AVMA 3KIOA 4CJTA 4FLXA 4ELTA 3HK2A 1NKEA 4Q0BA 2B5JA 3S3OA 1NK7A 1BIUA 2D0AA 1HJRA 3VQEA 2D0BA 1RT3A 1S9GA 4E1NA 3HXMA 2HVIA 5HRRA 3AVGA 3D45A 4KO0A 4CF8A 4KB0A 3MEGA 1LW2A 2FBXA 2VG6A 2OPSA 3IG1A 3AA5X 4QOZB 1NJWA 4W5QA 3SPYA 1SUQA 4AHVA 4Y1CA 4FJ7A 5FRNA 3LDSA 4CGHA 1JL1A 3KD5E 2G8VA 3DLBA 4CIGA 1VK0A 1VSIA 3WNHA 1S1TA 2Z1HA 4AH9A 4DS5A 3AVFA 4DF4A 4IDKA 1SKSA 3CG7A 4DTOA 1C1AA 2FBTA 3O3FA 4CJFA 3OYKA 3I0SA 4CJ3A 1A5VA 2DY4A 3CFRA 1SL1A 1F21A 1L5UA 3O4NA 4FLVA 1X9MA 3LZIA 4IBNA 1YTUA 3HO1A 3DM2A 4KV8A 4KI6A 4EZ6A 3QNNA 4FLTA 3SV3A 1XHZA 4DTRA 2YNIA 4CGGA 3ASMA 1EKEA 4IFYA 3D0PA 1ASWA 2YV0X 3HP6A 5J2QA 4FZYA 3SUNA 4KHQA 2X6NA 4OKEA 5J2PA 4CEQA 2P5OA 1ZBIA 1HYVA 1VRTA 3LP2A 2VWKA 1NK9A 4W5OA 3SUPA 3KLHA 1S1UA 2OPPA 5KRSA 3DRSA 3V1RA 1QE1A 1EX4A 3DLEA 3P83D 4QAGA 3L2VA 3PO4A 3G0ZA 1RTIA 1HYSA 1TKTA 4M45A 3SV4A 4CEAA 4CFDA 3OYHA 3VQDA 3S9HA 3V1QA 3AA2A 1N6QA 1LAVA 1L3SA 5FRMA 3P5JA 1QSSA 4KPYA 3I8DA 4ICLA 2FC0A 3K5LA 3NBPA 4E7IA 3ZSRA 3S3MA 3VQBA 2DFEA 4L8RB 4J2AA 3ITHA 3OYGA 3CM5A 1J54A 2O4GA 3HVTA 3TAMA 1HQUA 3VQ6A 4O0IA 1SKWA 3K5OA 3LWLA 4B08A 1LAWA 3O3HA 3KLIA 1A5WA 3TI0A 4DU4A 3IAYA 1C1BA 4BACA 1QSYA 3DOKA 3VQ5A 1YVUA 3AVBA 4J2DA 3KK2A 4DLGA 3RRGA 5KRTA 5K14A 1Q9XA 2IAJA 3K5NA 4B8AB 1HNIA 4IFVA 4FLWA 4DMNA 3BDPA 5HBMA 3SNNA 1RBRA 3OVNA 3L2QA 4JS5A 1XHXA 4CF0A 3U6FA 4FJGA 5J1EA 5JS1A 1JLAA 4AHTA 4CGFA 3TARA 2A1RA 3ULDA 3KTQA 2HHXA 4OGEA 3LP0A 3V6DA 1RNHA 3AV9A 5SWMA 3VN5A 1QTMA 1A5XA 2EX3A 4RW9A 3DI6A 4QCLA 4CJPA 3SUQA 5J2MA 1ZBFA 4CERA 1IKYA 3NF8A 3F9KA 5HLFA 2DFHA 1C0MA 4C8NA 3EYZA 4N41A 3AVAA 3ZSVA 2Y1JA 1BQMA 1JL2A 4HVJA 3QIOA 3ZT1A 1RTDA 4CEFA 4B9LA 3NH2A 4DFJA 1DTQA 3VQPA 3OYBA 4E7KA 1RDAA 1WLJA 3CFPA 4IG3A 3KLFA 2NUBA 3AO3A 4CEZA 1LWEA 3TR8A 3HPOA 1XI1A 1NOZA 1W9HA 1B92A 1TKZA 2BE2A 2D5RA 3QNOA 4KHNA 5HROA 2QK9A 3V9XA 4DU3A 3OYCA 1TV6A 4F2RA 1RBSA 1RBUA 1VSKA 4Z0UA 4E7JA 1B9FA 3QERA 1HRHA 1SKRA 4JRPA 1NK0A 1JXEA 4FJ8A 4M3XA 4B9TA 4FJIA 4OKKA 4DTNA 3HM9A 4RW8A 3ZT4A 2KFNA 2AJQA 2DTUA 1C1CA 3L2UA 3K59A 1CXQA 2P5GA 2XY5A 3ZCMA 1CLQA 3VQ9A 1BISA 3HJFA 3AVCA 4W5TA 4HUGA 3KJVA 4E7HA 4DTSA 2E4LA 3K2PA 3QEXA 4MQ3A 1BCMA 4KTZA 1VSMA 2YNFA 1BI4A 4CFAA 4CE9A 2BANA 2HHWA 1WSIA 1WNSA 1Z26A 4DSLA 3LPUA 1VSLA 3SCXA 3SI6A 4O44A 3SZ2A 4N47A 3KK1A 3ZSZA 3VQ4A 4E7LA 3M8QA 4FJLA 2Z1JA 3C6TA 3O4QA 2XY6A 4CESA 1KCFA 1VSFA 3PX4A 4CJKA 1KLMA 4C8MA 3MXIA 4F4KA 2O4IA 1ZYQA 4CJ4A 4DLEA 1NOYA 4CJQA 3UIQA 1W0HA 4IKFA 4JS4A 4CHPA 1J9AA 3H08A 1IKWA 1WSGA 3K5MA 5C42A 4DQIA 4FJMA 1LWCA 1GOCA 3PX6A 3DRPA 2OZMA 2X78A 3DLKA 5KGWA 4ELVA 3OS2A 2BGGA 3VQ7A 3TAFA 1DLOA 4KB1A 1X9WA 2YHAA 1RILA 4CHOA 4I7FA 1S1VA 2GBZA 2HHQA 1EXQA 2W42A 3CYMA 4KTWA 4EZ9A 4W5RA 4B8CA 4M41A 4KRFA 3NGZA 4CIFA 4Z4HA 1IG9A 1RTJA 3SPZA 1T7PA 4LD0A 4PWDA 1RT1A 3KK3A 3AA3A 3NGIA 3TANA 3NH0A 1XWLA 1BCOA 4O55A 2HNDA 4CK1A 1L3VA 3DLHA 3MECA 1NKCA 1D5AA 1RBTA 3V81A 1G15A 3PV8A 3PO5A 4FK0A 1QSLA 3QIPA 1X1PA 3PUFA 1I3AA 5KTQA 3HPHA
chains in the Genus database with same CATH superfamily
2ASOA 1TKXA 4Y0WA 4KHYA 2A42A 5GAGP 4BRKA 5AQHA 4AM7A 3T3FA 1JLQA 4BWJA 3SAHA 1GLJO 3ID8A 1WSHA 5AQUA 4B9MA 3M3ZA 2P9IA 4HUFA 2YNHA 3C95A 3OS1A 5JMVA 4ELUA 3RMDA 4GNIA 3WXMB 4AQYK 3O80A 1KTQA 1VQKN 4GV6A 4Z4CA 3TABA 3OYFA 2V7YA 4GVMA 3TSPA 4DV7K 2NZTA 4ZTFA 3HTVA 1SV5A 1UAXA 3D7EO 3IRXA 3LANA 3ZT2A 3HRGA 5AQOA 4M3WA 4CJ5A 3ZEUB 3FZLA 1CXUA 3OJUA 2JLEA 4B3TK 1ATNA 4DTUA 4X65K 2P9PB 1CZBA 1SL0A 2IIRA 4HTLA 4JI8K 4A5AA 5FDLA 4XH5A 1RGIA 2YI1A 5AQTA 4ZTJA 4OLBA 4HTUA 2KZZA 4FW2A 4HCBA 4OLAA 1Y97A 4FK2A 2WBNA 5C24A 5BRFA 3ZSXA 5JS2A 3OYLA 3KHYA 3EN9A 3DMJA 4JEPA 4B9QA 1Z05A 3WQTA 4HCCA 4E0DA 4FLYA 4YNQA 5CR4A 3E9OA 4CFBA 4NYFA 1HUXA 1KLNA 4F3OA 4O8UA 3U3YA 2PBDA 4MO5A 2Q31A 4DG1A 3MN5A 3ZSQA 4FJ9A 3O1WA 5CZ1A 1N34K 2KZMA 3J8AA 5TKWA 3AGRA 4BC3A 1U47A 3V9SA 2F8SA 4YOWA 4UQGA 2YHWA 3AVLA 4AHCA 4FJHA 4BG8A 2WUSA 3ZT0A 1OKJA 4IFEA 3V9UA 4W5NA 1TK8A 1VSJA 4DU1A 1REVA 3VQ8A 3NAEA 1HKCA 4IDHA 4K8XA 5AZJA 2FBYA 3OYNA 3A2FA 3VGMA 2QI2A 4CGJA 1KSPA 4DTPA 2O8EA 4G1QA 2B6AA 2IOCA 3AVKA 3LAMA 5LJVA 3SUOA 1N8RO 4B9SA 2HB5A 2ZD1A 3SQ1A 1I39A 4AHRA 1IKVA 2A41A 4Z94A 1TKDA 1VQLN 4FL9A 4H0VB 1X3NA 3GL1A 1U49A 1B9DA 4JD2A 4CJLA 4E19A 1SL2A 1S6PA 1BGXT 3EZ5A 2ZQBA 2ZGYA 2F9TA 4MFBA 4FK4A 4JV5K 4CK3A 5AZIA 2E2OA 2OTJN 4DQPA 3RTVA 2KHOA 4K41A 1WB9A 2LSNA 3CC7N 3H1QA 4E89A 4OGCA 3E01A 3TAQA 1TK5A 3GDQA 2UUAK 1FXXA 3ATUA 4O8KA 4DS4A 4PL8A 4BDYA 4QS7A 5I3UA 2HHTA 2YKNA 5GINA 3D2FB 3PLAA 1UOCA 4BR2A 2HHSA 1QZ5A 4EIAA 2NRTA 2GV9A 4N56A 1ZBLA 3AO2A 2CGKA 3WT0A 3QEIA 2KW4A 3VEVA 3D2EA 3H6EA 1KVAA 1TL1A 2IGIA 1VRUA 4IZ9A 2E8AA 1C0TA 2E6MA 1RFQA 4BREA 1QQOA 4BR5A 2YHBA 5KI6A 2RF2A 2WOMA 3RSEB 2RPIA 3LPTA 5SZTA 1QHAA 1VQMN 1Z6RA 3K57A 1JXBA 1T6CA 2YCHA 4BRLA 3AVNA 1NK6A 2D4WA 1NJXA 2QWMA 2X74A 2VQEK 5M1FA 4H03B 4F2SA 5MLCQ 2Z1IA 3KLGA 4GKKK 4DR4K 2NRRA 4BE2A 2W6LA 3HYFA 4KKOA 5LMNK 3J7AP 4A2AA 3KWGA 5AQKA 3CJAA 3KZBA 1JLFA 5CYQA 4I2QA 4CIEA 1QQCA 4ILHA 4LY7A 5C10A 5T7BA 4DTJA 3V4IA 3OYEA 3ZEUA 1TL3A 3JSMA 3I56N 2A1SA 4AILC 3LZJA 3KKRA 4YORA 1JLCA 4FLXA 2FXUA 4IOAL 5LY3A 2B5JA 3S3OA 2P9PA 1NGAA 2HVIA 2D0BA 4DV5K 2P9KA 3CIPA 3O9RA 4E1NA 4CBUA 3D45A 5KPTA 4KB0A 5AQQA 5AQXA 3VEWA 2EWSA 2VG6A 2OPSA 2AP1A 4W5QA 3SPYA 1SUQA 4Y1CA 3DWLA 1JCFA 4X66K 3O4WA 3DLLL 3KD5E 3AAPA 1VSIA 3WNHA 4AH9A 2I7PA 5BN9A 4JN4A 3FGUA 1C1AA 2FBTA 4CJFA 1Q82O 3OYKA 3I0SA 4JAXA 1L5UA 4FLVA 4NO7A 1HPMA 1SZ2A 4KV8A 4GY2B 5EVZA 1P90A 4FLTA 2ZJRL 3THYB 4CD3A 3C6AA 3D0PA 2YJEA 3THWB 3SUNA 5J2PA 4CEQA 2ASPA 4CZIA 2VYPA 1KD1O 3L4IA 4W5OA 3KLHA 1S1UA 5KRSA 4BG9A 1EX4A 5LMUK 1RTIA 4CEAA 3S9HA 2QXLA 3N4PA 4DR1K 3VF2A 1L3SA 3P5JA 3I8DA 3K5LA 2Q0UA 4J2AA 1NGFA 3CM5A 4LFCK 5BR9A 3K5OA 4IWVA 1LAWA 2HBJA 4BRMA 3O9SA 3J7ZO 4RTFD 1HX1A 4CZKA 4J2DA 4DLGA 4IOCL 4B8AB 2GUPA 4DMNA 2HMPA 3L2QA 1XHXA 3CCMN 1JLAA 4AHTA 2HHXA 3TARA 1RNHA 3BY5A 3AV9A 1XNQK 3UKUB 5M1KA 3SUQA 4L3QA 1XMQK 3F9KA 3DJCA 3MDQA 1C0MA 4LF6K 3B8AX 2A40A 3NH2A 4DFJA 3G71N 4IG3A 2NUBA 3AO3A 1TUUA 4DCHA 1W9HA 1B92A 4FWQA 5HROA 4BRDA 1RBSA 1Q7YO 1VSKA 1SKRA 3CJCA 1B9FA 4EHUA 4LF8K 4M3XA 2WTUA 4DTNA 2AJQA 2DTUA 3O9QA 1C1CA 2P5GA 4E1JA 3ZCMA 3H3OB 3VQ9A 1BISA 3AVCA 3VMFB 4BVOA 1EQYA 3KJVA 3QICA 1OVQA 3D2FA 4MQ3A 1VSMA 3WEEB 2NNWA 4BRNA 3SCXA 3TTDA 3SZ2A 4N47A 4FJLA 4CESA 3TSQA 1KCFA 4BR9A 4DV4K 4CJKA 3MXIA 1ZYQA 4DR7K 3I8BA 3M6GA 4CJQA 4CHPA 3H08A 1IKWA 1EWRA 3PX6A 3DRPA 2ZJPL 3RSEA 4BGAA 3DLKA 1GLCG 1DLOA 2YHAA 1ZBSA 2W42A 3CYMA 4Z4HA 4PKIA 2GELA 3SAGA 4JI3K 3NGIA 4BY9C 3NH0A 1XWLA 3KK7A 1L3VA 2HNDA 3DLHA 3QB0A 3V81A 4GVEA 1G15A 3K2PA 3QEXA 5KTQA 1GLAG 3KD1E 3SYZA 3RR8A 3SMPA 2QTDA 4AHSA 2PY5A 3MMVA 1BA0A 2KTQA 1KFDA 1ITGA 3FFIA 2JGUA 1NBWA 2E6LA 5KGXA 3NE6A 1QVGM 3P39A 3S41A 3FFKB 4NYNA 4KFBA 4I6MA 4FJNA 3LM2A 4M3ZA 3OY9A 2XY8A 2Q1NA 2HNYA 1NOYA 1HQEA 3MEEA 4JHDB 3CM6A 2P51A 3K58A 3CQXA 2DFFA 4RW4A 5BPMA 2XO7A 3NH1A 3C94A 4K25A 4LF9K 3NHGA 4K42A 2ZM6K 1NK4A 5CE3A 2OANA 4CHZA 4Q5VA 2ITMA 3AO1A 1RTHA 2OCEA 4DQSA 1Q18A 4M3UA 1RCHA 1GOBA 4IEIA 4C1NK 1S9EA 2F4VK 1YXQA 3IMXA 4QS9A 3QFPA 3CMEN 3VQAA 1XC9A 1H1VA 3PSFA 1IO2A 3VTIA 4C8LA 3THYA 4J2BA 2J4RA 4HWIA 1YITN 3AO4A 3THWA 1NWKA 4DKWA 1RDDA 5GAEP 1X9SA 5FPMA 3DXMB 2HBKA 1OH5A 4NXMK 4FZZA 2FSJA 2FSNA 3G4SN 4NCGA 1NK8A 4M63C 3L3VA 2G8FA 3CERA 4FJ5A 4DB3A 3QEWA 4B1VA 2ZWHA 3CFOA 3VQCA 5ELZA 1XNRK 4CJEA 4FCYA 1WSFA 2G8IA 4FOEA 3OW2M 4CJSA 1LOTB 3ZSWA 3LDQA 4UY8O 2HHUA 3G6EN 1QS4A 3ID6A 1T3VA 4J2EA 1NMNA 3CETA 1GOAA 5M1PA 1P8ZA 2JWKA 1U48A 4YOXA 3M8RA 3VPZA 1ILYA 5EY4A 2B4JA 2QWPA 2F7TA 3UKUA 3CXCM 3CCRN 1N33K 2F8TA 3FR0A 2OPQA 3SQ4A 1XUPO 3MXJA 4BDZA 1BA1A 1T6DA 3LP1A 4FZXC 2HW3A 4O4GA 2VWBA 4HUEA 5DM6L 3OHRA 4Y1DA 4CEOA 4DQRA 3OYDA 1TYQA 2ATQA 4M3RA 3PX0A 4MDAA 3A5OC 5BR8K 1WSEA 1T05A 2PZSA 4ID1A 3HP9A 4B3MK 5HRSA 1NKBA 2OA8A 5ADXA 5TKYA 4PQUA 5AQYA 2IC3A 1FKOA 3L2WA 5M1NA 1KRPA 3MEDA 4CZHA 3G25A 1RT5A 3WEEA 3QMLA 3ZETB 3AY9A 1VQ8N 1ZC6A 2E20A 3P1GA 2NRHA 2RN2A 3LALA 5E84A 4DV0K 4FM0A 4RW6A 3AAQA 4BR4A 4F9OA 3VERA 4CJUA 1NGGA 4Z4GA 1OH8A 4YDUA 3C6HA 4CHQA 1ZBHA 1DEJA 3L3UA 4A62A 5HRNA 3SAFA 1FKPA 5DMRA 3IS9A 1LW0A 4JI6K 5IWAK 3PIPL 3TAPA 4CHYA 3EL2A 2P9KB 4OJRA 3SQ2A 3T19A 1U4BA 4A2BA 2H3GX 2HMIA 3WNGA 3ALYA 3LAKA 4H4MA 1BL3A 4CJRA 1K6YA 4PKGA 4WFAL 3K9KA 1L3UA 1RBVA 4KH6A 1YVNA 5AFUA 3OJSA 4KBOA 4Z4IA 4YFUA 1SAZA 3VA3A 3ATVA 4IO9L 4GW6A 1QVFM 4H0TB 4CECA 3CJBA 2KFZA 3R6MA 2ASMA 3WNEA 4DSJA 3P38A 4CD1A 4JHDA 1R59O 4DR3K 1BIZA 3ZX0A 1S6QA 3SJHA 3VQQA 1Q86O 3TAGA 1LV5A 5EX5A 3M8SA 2ITGA 3CCJN 3TAEA 1YIJN 1RT7A 3UB5A 3O3GA 4H8KA 1N36K 4DV2K 3EZWA 2HBLA 3MWTA 4Q0BA 1NKEA 1NK7A 2E1ZA 2BUPA 3VQEA 1RT3A 2ZGZA 4BR7A 4JKHA 1LW2A 2FBXA 3AA5X 4FPAA 4QOZB 1NJWA 3LDNA 1WOQA 1YF5L 1QQMA 5C2FA 3AGKA 2NRWA 1VK0A 3VGKA 3WUHA 5FPEA 1S1TA 2Z1HA 3DXMA 4DS5A 4NXNK 1SKSA 3CG7A 3O3FA 4CJ3A 2DY4A 3CFRA 2D0PA 1F21A 4V19S 3EE8A 1X3MA 3O4NA 1X9MA 3LZIA 2IVPA 3HO1A 3DM2A 3ZX2A 4JKCA 4EZ6A 3QNNA 1XHZA 1NGEA 3F2KA 3W0LA 4FZYA 4KHQA 4OKEA 1ZBIA 2P5OA 4FWPA 1RDUA 4IEEA 1ZXOA 3TTCA 3ENHA 3DLEA 1E3MA 4M45A 3SV4A 4CFDA 3CJ7A 1LAVA 1HNWK 5FRMA 4KPYA 2FC0A 3QFUA 4CI6A 4E7IA 3S3MA 1VAZA 2IVOA 5BREA 3ITHA 2UU9K 4MLEA 4LFAK 3HVTA 1HQUA 2ZF5O 4O0IA 4H5VA 3JAMO 4DV1K 3TI0A 4DU4A 3VQ5A 3I33A 4ILGB 5K14A 2IAJA 1HNIA 4IFVA 3BDPA 1RBRA 4BRGA 3U6FA 2A1RA 4CBWA 3ULDA 4FVUA 5GIPA 4JKFA 3SBTA 1A5XA 2EX3A 5GIOA 3DI6A 4QCLA 4CJPA 5J2MA 4LFBK 3R3LA 3NF8A 4JI5K 4N41A 1J6ZA 4IXCA 3VF4A 4CEFA 3WXLA 1DTQA 2UUCK 3VQPA 4C23A 3KLFA 1NM1A 1LWEA 3ZETA 3MCAB 3HOTA 2BE2A 4FWNA 3CC4N 2QK9A 3F5TA 3OYCA 4JRPA 1JXEA 4B9TA 3HM9A 3ZT4A 3HJFA 3CPWM 2UXDK 4I6MB 4E7HA 1HNXK 1FW6A 2NLXA 1BCMA 3MCPA 2QEXN 1QQNA 4CE9A 4PL7A 4DSLA 3LPUA 3K9JA 4O44A 3ZSZA 4U7BA 2Z1JA 3O4QA 1I94K 1NGDA 3TSUA 3MN6A 2QM1A 4IJAA 4BC2A 2O4IA 3JS6A 4CJ4A 2E2PA 4IKFA 4YDUC 5LL6Z 3K5MA 1J9AA 5C42A 1LWCA 4BQZA 2X78A 4A57A 3SLCA 3GE1A 3VQ7A 2E2NA 3TAFA 2QWQA 1X9WA 4I7FA 1S1VA 4EZ9A 1BUPA 3MX2A 4KRFA 1NLVA 3NGZA 1IG9A 3SPZA 4JK9A 4LD0A 4FWLA 3TANA 1OH6A 3R8EA 3MECA 3CHWA 1D5AA 1RBTA 3PV8A 3M5RA 3QIPA 3ENBA 1X1PA 3PUFA 1I3AA 2Q97A 4CZMA 3LDLA 5BN8A 1NGHA 3VETA 3BF1A 2XHBA 3OYAA 1WSJA 5GADP 3QEVA 2O8BB 4MLHA 3WQUA 1Q8IA 1LCUA 3SBGA 1KFSA 2PYJA 3KWIA 2UYTA 1C6VA 4BRHA 4FM2A 1VSEA 3LDOA 2JWLA 2KKZA 1JLGA 4J8FA 4OVLA 3HT3A 3OA9A 4RW7A 2CGJA 4H0PA 1HKBA 2OPRA 4WFNL 3DLGA 4A61A 5BRDA 3UKRB 3OBYA 4FJJA 1M90O 1CZ9A 3VEYA 3C65A 1RDCA 4N5SA 2G8HA 5F1XA 4NCAA 2A3ZA 1SS6A 2VG7A 1XQSC 4A59A 4CZJA 2CH5A 3KKSA 3P31A 1RDBA 5CZ2A 3EO3A 4K43A 4B1WB 4JYAK 1YTAA 4WQ4A 3H46O 3FZFA 1TYQB 4GV9A 1JCEA 1OH7A 1XC3A 4CF9A 4FM1A 4BRIA 4OX9K 4JI2K 4YOYA 5J2NA 4JI4K 4FYDA 4X64K 3QLHA 3QDKA 3TU5A 5CY4A 1E4FT 1Q9YA 3FLCO 2I5JA 1NMDA 3WNFA 3WXIA 4TSXA 1W7AA 3IFRA 2G8KA 1ZBUA 4B9UA 3PIOL 3IDHA 4FOIA 1IH7A 4RG8A 4F3TA 2O8FB 4JRQA 4CHNA 2D0OA 2D0CA 4GMJB 2YKMA 2NRXA 4DUZK 1QHTA 3E1YA 4B3OA 3RWUA 3SQ0A 1NGJA 1C0FA 5JVGL 1D8YA 2G8WA 2QKKA 3ZSYA 3FE1A 1LWFA 3AARA 3DXKB 5M1QA 4PA1A 1WBDA 4CZGA 4C8KA 5C25A 5LJWA 4WYBA 1IKXA 4B3SK 1U04A 4DHYA 1JKHA 2VG5A 1IV0A 3O1BA 4CGIA 2UXBK 3V9WA 1N5YA 3QESA 3VEOA 1HMVA 2FF3B 3ZSOA 4BRPA 3RMCA 4FLUA 1NJZA 4GV3A 3CCQN 4HHTA 2Q2RA 2QA4N 4R79A 2WFBA 5FLXO 3B6OA 4YY3K 1L3TA 1NK5A 1IJJA 5EOYA 2ZE2A 3BZKA 5JLFA 1WAFA 2QWRA 1ASUA 4KHWA 3O08A 3QBXA 2P9UB 1JLEA 3ULEB 1VHXA 1NNEA 1RT4A 1UA1A 3CPEA 3U4LA 1KAYA 4O0JA 4H5TA 4ILJA 1S22A 2RKIA 2HNZA 4KI4A 2HOEA 2DPNA 5E41A 1T8EA 4OPJA 3N4QA 1BI4B 4LSLA 1HR0K 4FSVA 4FW1A 4ID5A 1DTTA 3OYJA 1S5JA 3EKSA 1XMOK 4CEDA 4NLBA 3EKUA 4DWIA 5DK5A 4M42A 4DSFA 4JK8A 4F8RA 1GLDG 3AA4A 1D9DA 4DUYK 3KVGA 3V9ZA 4FXDA 1SQKA 3O5BA 4CZFA 5DM7L 1VQ4N 4CF2A 3SMSA 4CJ7A 4I9QA 1KVBA 4H0XB 3OYIA 5IT9O 3MXMA 3SJJA 5KQ8A 3ISNC 2X6SA 2W6KA 2XRIA 3TTFA 5AQSA 1WN7A 3DRRA 4EFHA 2O8BA 4NCBA 2IS3A 2NRVA 3ZX3A 4WFBL 3S3NA 4CJWA 3RRHA 1TK0A 2QKBA 4CK2A 1BHLA 3HM8A 4WE1A 3BUZB 4MDBA 2KLAA 4JK7A 1MA9B 4RCHA 4Z4EA 4IG0A 1S1XA 3THXB 2V52B 5FROA 3CJ9A 3I0RA 2YNGA 3NF9A 4DR2K 2HHVA 4OPAA 4ISFA 3CCVN 1VQON 3NF6A 1J53A 1GLBG 3HVRA 3UKRA 1J5EK 3AVJA 4H4OA 3QETA 3C6UA 1VQ5N 1FJGK 1TAQA 3M8PA 3AVMA 4CJTA 5I9EB 3K0SA 4ELTA 3HK2A 3IUCA 4FWKA 1BIUA 3HXMA 1S9GA 3AVGA 4CF8A 4KO0A 3H1VX 3IG1A 1K73O 4AHVA 4FJ7A 3LDSA 1K8AO 1JL1A 3DLBA 3JXUA 3VEZA 3E9PA 4CIGA 2P9NB 4M7XA 1MWMA 5KQDA 4DTOA 3GG4A 1OVYA 1A5VA 1HJOA 2Q36A 1DT9A 3O9TA 1Q81O 3BZCA 4NLCA 3OTOK 4IFYA 1EKEA 4WQ4C 5J2QA 1VQ9N 4H0OA 1NJIO 1HYVA 2UXCK 2FLOA 2O8FA 3LP2A 1NK9A 4X62K 3SUPA 1G99A 4EAHD 5BPLA 3HZ6A 3P83D 4QAGA 3L2VA 3PO4A 3J80O 4G9ZA 1HYSA 3VQDA 3AA2A 3Q7CA 5C15A 3MX5A 3I55N 3H45C 3VQBA 1NGIA 1ATSA 3SK3A 1J54A 2O4GA 5AQZA 2CGLA 3TAMA 3DXKA 1SKWA 5AQGA 3LWLA 3IAYA 3O3HA 3E66A 3KLIA 4BACA 2ZJQL 3K5NA 5E26A 2YX6A 3FZHA 4FJGA 4AM6A 3U9DA 5JS1A 4CGFA 3OBWA 3R1XA 3CJ1A 3LP0A 4FO0A 3VN5A 4BRFA 1QTMA 3L4QA 4XEIA 3HI0A 1KAZA 1ZBFA 4CERA 1IKYA 2FSKA 2DFHA 3EYZA 1BO5O 2Y1JA 1BQMA 3QIOA 4B9LA 3OYBA 4E7KA 1WLJA 4FWMA 4CEZA 3HPOA 3TR8A 1XI1A 5AQVA 1TKZA 2P9UA 4JKBA 3ULEA 2V51B 3V9XA 4DU3A 3VENA 4F2RA 1RBUA 4E7JA 1KXPA 4Z0UA 3QERA 1IBLK 4FJ8A 1HRHA 1NK0A 4FJIA 4OKKA 2KFNA 3K59A 1CXQA 2XY5A 4W5TA 4HUGA 4DTSA 2E4LA 3TPQA 2YNFA 5F0XA 1T44A 1BI4A 2VCPA 4OPHA 4JI7K 2P9LB 2BANA 1WNSA 1Z26A 4U67L 3KK1A 4JI0K 3M8QA 3C6TA 2XY6A 3PSIA 1ESVA 3H3NO 1KC8O 1VSFA 1K9MO 3PX4A 1KLMA 2QWNA 4C8MA 4F4KA 4DLEA 1W0HA 4NB4A 4JS4A 3M1FA 1HLUA 4BRAA 4BRCA 5C0YA 3CCEN 2HHHK 4KB1A 5AQLA 1RILA 4CHOA 2GBZA 1EXQA 3C0BA 4W5RA 4B8CA 4M41A 4CIFA 1RTJA 2YHYA 1T7PA 3E9LA 4PWDA 3WXKA 3AA3A 1BCOA 4O55A 4CK1A 3PO5A 4B3RK 3HPHA 3NGYA 1N6QA 3ZT3A 3THXA 3QEPA 3F9MA 2QXFA 3CI5A 3BGRA 1TAUA 3VEXA 1GLLO 4CEEA 3O6WA 3NFAA 1YT3A 3VOVA 2EHGA 3ZLJA 2BTFA 3LL3A 4H5NA 4B1ZA 2WONA 1U45A 2QW9A 1EO1A 2QWLA 5JICA 3KLEA 1YI2N 2G8UA 3LM9A 3V1OA 4YOVA 4FJXA 4LH4A 2GWJA 5AQWA 3A5NC 2GX9A 1D9FA 3F73A 1FK9A 4DFMA 2P9NA 2GUIA 4KHUA 4CGDA 5AQRA 3C7NA 3OYMA 4DV3K 4O5BA 1S1WA 4OKJA 3OS0A 3DLRA 4BE0A 3G10A 2WC9A 1EETA 4CFCA 4DSEA 5CYMA 4IO8A 3RMBA 4DR6K 1HKGA 2A5XA 4DF8A 2VGNA 1EP4A 3DAWA 2OYQA 1TVRA 5D3GA 4JKGB 3QINA 4JI1K 3DOLA 4YOUA 1JLBA 4H0YB 1YJNN 1GLEG 3U3GA 2GEMA 1DKGD 4AHUA 3QBWA 3HSTB 1VSDA 5BRHA 4I9LA 1RT6A 3NDKA 1U2VB 4XIUA 1NJYA 2VWJA 3AVHA 4B1YB 5H1SQ 3T1AA 4WF9L 5JVHL 3B6PA 4DQQA 4EP4A 5F2RA 3D6RA 5I42A 5AQIA 3BP8A 4CF1A 2XY7A 4CCHA 5C2DA 4E3SA 3U8XA 1HPZA 2O8CB 4IOXA 4KREA 1QZ6A 1WAJA 4KAZA 1TGOA 4I2PA 3VA0A 2Y1IA 5AQNA 1VQNN 3GBTA 2P9SB 1NG9A 2O8DB 2HBMA 3DYAA 4E1MA 3RMAA 3TWHA 4K8ZA 4OO1J 3VF6A 2Q0RA 2ETJA 4BC4A 4Z4FA 2Q3SA 5AJ3K 4A5BA 2HF3A 4BE1A 5HP1A 4C8OA 2FF6A 3NVMA 4CEBA 4M3YA 1Z25A 1YAGA 4FJKA 5FPNA 2F96A 3MN9A 1MU2A 1HNVA 2HF4A 3NCIA 4PUOA 2KQ2A 4YOTA 4C1NI 4DFKA 4BROA 4FVMA 2GWKA 4FPBA 3CD6N 1BDGA 4OPKA 4M3TA 3PY8A 1NU0A 4BDPA 3VESA 2GTDA 3LWMA 3A5MC 4GKJK 1RT2A 1UA0A 5M1OA 4JLHA 4BQLA 4WQ5A 2AA4A 2W41A 2HVHA 2P9LA 2BDPA 2OTLN 5AR0A 4B9NA 2RE2A 3RVCA 4K0KK 1KVCA 4PY5A 4FWRA 4KH5A 3MAQA 4CJVA 4R5PA 1V4TA 1E4GT 4JKEA 4BVPA 1YJWN 1CZAN 4KH4A 5KPRA 5AQMA 5HOOA 2IDOA 3HPGA 1V4SA 4KTQA 3O9UA 4IJNA 4EP5A 4FLZA 2FBVA 5C12A 1O1WA 5HRPA 1YUWA 5AQFA 3R9PA 4KHSA 1K8KB 1M1KO 4M7YA 2NRZA 3QO9A 4BC5A 4DFPA 3MK6A 1ASVA 5FPDA 4LH5A 2PYLA 2P1JA 1BQNA 4PKHA 1S72N 4JKDA 1C0GA 4LSNA 1HYZA 3CQ8A 3BEXA 4CBXA 4DSIA 4DSKA 3CCUN 5A2QO 1VQ6N 1MDUB 1UWBA 2HSTA 1VSHA 5EXWA 3U9ZA 3RR7A 2PAVA 3P4IA 4N76A 4AF1A 3AVIA 1C0UA 1J5OA 5EU7A 3NF7A 2E2QA 1TUYA 2OZSA 3L2RA 3HL8A 4ISGA 1HNZK 2R7YA 4JKAA 4DTXA 4EHTA 1R0AA 1D4XA 3EEQA 1BOTO 3LP3A 1IBKK 3AO5A 4CZLA 1T03A 1GLFO 1DGKN 4DTMA 3EY1A 5GAHP 1W2BM 4YHHK 4ZHRA 4B9VA 4RWTA 2Z1GA 4BWMA 3CCSN 3THVA 1YJ9N 1MWKA 3L8BA 3JYTA 2P9IB 1VQPN 3KIOA 3L0QA 2E5LK 3T1HK 2D0AA 1HJRA 2YJFA 5HRRA 1BG3A 3EE9A 3MEGA 4LF4K 1W97L 4XH4A 3BF3A 5AQPA 4DR5K 5FRNA 3LDPA 4CGHA 3WXJA 3T1YK 4JKGA 3J81O 2G8VA 2E1YA 3A5LC 3HBTA 4KHPK 4DF4A 3ENOA 3AVFA 4IDKA 3ZYYX 1U2VA 2BH1A 1SL1A 3A0IX 2W40A 2YHXA 4IBNA 1YTUA 1U6ZA 3A8YA 1VQ7N 4KI6A 5KPZA 3SV3A 4DTRA 2YNIA 4CGGA 4BR0A 1YHQN 3ASMA 4LC9B 1NGCA 1ASWA 3CQYA 2YV0X 4FWOA 3HP6A 3O8MA 2X6NA 4CW7B 2O8CA 1BU6O 1VRTA 2D1KA 2VWKA 3T69A 5HL7L 1JCGA 2OPPA 3DRSA 2QWOA 1QE1A 3V1RA 5ADXH 3J7YP 4DQ8A 4ISEA 3G0ZA 1TKTA 2P9SA 3OYHA 3V1QA 2O8DA 1QSSA 2E88A 4ICLA 2F9WA 3NBPA 3ZSRA 2DFEA 4L8RB 3MWPA 2VGMA 3OYGA 3VQ6A 4B08A 1BWFO 1A5WA 1Y64A 1C1BA 1QSYA 1KAXA 3DOKA 1YVUA 3AVBA 3KK2A 3RRGA 5KRTA 4PHTX 1Q9XA 2UUBK 4WCEL 2VQFK 4FLWA 5HBMA 4BGBA 3SNNA 3OVNA 4JS5A 4CF0A 2PFUA 5AQJA 5J1EA 5CHIA 3KTQA 4OGEA 2RHKA 3V6DA 5SWMA 3T7ZA 1IG8A 4MO4A 2I7NA 4RW9A 5AZJB 3IKMA 4LF7K 3W3DA 3CC2N 4B1UB 5HLFA 4C8NA 3Q7BA 4CVNE 3AVAA 3ZSVA 3CMAN 4HVJA 1JL2A 2O8EB 3HOSA 3ZT1A 3FZKA 1RTDA 2A6AA 3GOIA 1ATRA 1RDAA 3CFPA 2V7ZA 1NOZA 1KQSM 4KHNA 2D5RA 3QNOA 1WBBA 3NVKA 1WUAA 1TV6A 5AFUH 4JD2B 4DV6K 1JJ2M 4CZEA 3CF5L 4FWSA 4RW8A 4JNEA 3L2UA 1O13A 1CLQA 5AZIB 3VTHA 3MN7A 4KTZA 2IVNA 4CFAA 4BRQA 1NGBA 4XH1A 4WQ5C 1S3XA 2HHWA 1WSIA 4H5WA 5JLHA 1VSLA 3SI6A 1K8KA 4E7LA 3VQ4A 1RDWX 5B8HA 4B1XB 2CH6A 1N32K 4H5RA 3UIQA 3FZMA 4DQIA 1WSGA 5BPNA 4FJMA 1GOCA 2OZMA 3VGLA 3NMUA 3C7NB 5KGWA 4ELVA 3OS2A 2BGGA 4O5FA 3HSCA 3UE5A 1IBMK 2HHQA 4KTWA 4LF5K 1X9JA 1RT1A 3L6QA 3KK3A 3D2EB 3CCLN 1EWQA 1NKCA 4FK0A 1QSLA 4QS8A
chains in the Genus database with same CATH topology
3NGYA 3ZT3A 3KD1E 3SYZA 3RR8A 1TKXA 3QEPA 4AHSA 2PY5A 4KHYA 2QXFA 2KTQA 1KFDA 3BGRA 1TAUA 1ITGA 3FFIA 2JGUA 3T3FA 1JLQA 2E6LA 4CEEA 5KGXA 4BWJA 3NE6A 3NFAA 4NYNA 1YT3A 1WSHA 4KFBA 2XHBA 2EHGA 3OYAA 1WSJA 4B9MA 3QEVA 4HUFA 2YNHA 3C95A 3OS1A 4ELUA 4FJNA 1Q8IA 3RMDA 1KTQA 4M3ZA 1KFSA 2PYJA 3OY9A 2XY8A 4Z4CA 1C6VA 2HNYA 2WONA 1HQEA 3MEEA 3OYFA 1VSEA 3CM6A 4FM2A 3TABA 1U45A 4GVMA 2P51A 1JLGA 3K58A 2DFFA 4OVLA 4RW4A 3IRXA 1SV5A 1UAXA 3C94A 3NH1A 3KLEA 2XO7A 3V1OA 3LANA 3HT3A 3ZT2A 3NHGA 4RW7A 2G8UA 4FJXA 4LH4A 1NK4A 4CHZA 4M3WA 2OPRA 4Q5VA 1D9FA 3F73A 4CJ5A 4ZTFA 3AO1A 1FK9A 1RTHA 3DLGA 4DFMA 4FJJA 1CZ9A 1CXUA 2GUIA 1RDCA 4CGDA 4N5SA 3OJUA 4KHUA 2JLEA 4DQSA 2G8HA 4NCAA 3OYMA 4DTUA 4O5BA 1S1WA 1RCHA 4M3UA 1GOBA 1CZBA 2VG7A 4OKJA 3OS0A 3DLRA 1S9EA 1SL0A 4BE0A 3G10A 3KKSA 1EETA 4CFCA 5FDLA 5CYMA 1RDBA 3VQAA 4DSEA 3RMBA 1XC9A 4ZTJA 5CZ2A 4OLBA 4HTUA 4DF8A 1IO2A 2KZZA 4C8LA 1EP4A 1YTAA 4FW2A 2OYQA 4HCBA 1TVRA 4J2BA 5D3GA 3QINA 4OLAA 1Y97A 3AO4A 3DOLA 1JLBA 1RDDA 1X9SA 4FK2A 3U3GA 5C24A 3ZSXA 4CF9A 5JS2A 4AHUA 4FM1A 4FZZA 3OYLA 3HSTB 1VSDA 4I9LA 1RT6A 3NDKA 3DMJA 4XIUA 5J2NA 4NCGA 1NJYA 4FYDA 2VWJA 3AVHA 3QLHA 1NK8A 4HCCA 3L3VA 4FLYA 2G8FA 4YNQA 4E0DA 4FJ5A 3QEWA 5CY4A 3T1AA 4CFBA 4NYFA 1Q9YA 3B6PA 4DQQA 1KLNA 4EP4A 2I5JA 4F3OA 3WNFA 3U3YA 3CFOA 5I42A 3VQCA 4CF1A 4DG1A 4TSXA 2XY7A 3ZSQA 4CCHA 4FJ9A 4CJEA 4FCYA 1ZBUA 5CZ1A 4E3SA 2G8KA 1WSFA 4B9UA 1HPZA 2G8IA 2KZMA 1U47A 3V9SA 1IH7A 4RG8A 2F8SA 4F3TA 4KREA 4CJSA 1WAJA 3ZSWA 4CHNA 4JRQA 4KAZA 2D0CA 1TGOA 4UQGA 3AVLA 4AHCA 4I2PA 3VA0A 4FJHA 4GMJB 2HHUA 2YKMA 1QS4A 2Y1IA 1QHTA 4B3OA 3ZT0A 3V9UA 3RWUA 4J2EA 4W5NA 3SQ0A 1TK8A 4DSIA 1VSJA 4DU1A 3DYAA 1GOAA 4E1MA 3RMAA 3TWHA 4K8ZA 1U48A 3M8RA 1D8YA 1REVA 2G8WA 2QKKA 3ZSYA 2B4JA 2ETJA 3VQ8A 1LWFA 3NAEA 4Z4FA 2Q3SA 2F8TA 2OPQA 3SQ4A 3MXJA 4PA1A 4BDZA 4BE1A 4K8XA 3LP1A 4FZXC 5HP1A 4C8OA 2FBYA 3OYNA 4C8KA 5C25A 2HW3A 4CEBA 3A2FA 4M3YA 4O4GA 4CGJA 1KSPA 1IKXA 4DTPA 1U04A 4HUEA 4G1QA 1Z25A 1JKHA 2VG5A 4Y1DA 4CEOA 2B6AA 4DQRA 3OYDA 2IOCA 3AVKA 3LAMA 4FJKA 2F96A 4CGIA 2ATQA 4M3RA 3PX0A 1MU2A 1HNVA 3NCIA 3SUOA 3V9WA 1N5YA 3QESA 2KQ2A 4B9SA 1WSEA 2HB5A 2ZD1A 1T05A 4PUOA 4DFKA 2PZSA 4ID1A 3SQ1A 1I39A 3HP9A 4AHRA 4FVMA 1IKVA 1HMVA 5HRSA 1TKDA 1NKBA 2OA8A 4OPKA 1U49A 3PY8A 1B9DA 4M3TA 4PQUA 3ZSOA 4CJLA 2IC3A 4BDPA 4E19A 3RMCA 4FLUA 1SL2A 1S6PA 1BGXT 1FKOA 3LWMA 1NJZA 3EZ5A 4HHTA 2ZQBA 4MFBA 4FK4A 3L2WA 4CK3A 1RT2A 3B6OA 1L3TA 1NK5A 1UA0A 2ZE2A 1KRPA 3MEDA 4JLHA 1WAFA 1ASUA 1RT5A 4DQPA 4KHWA 3RTVA 2HVHA 2LSNA 2BDPA 1JLEA 4B9NA 4E89A 4OGCA 3P1GA 3E01A 1RT4A 2RN2A 1UA1A 3TAQA 3LALA 4FM0A 4O0JA 4RW6A 1KVCA 4CJUA 4PY5A 3MAQA 1TK5A 4Z4GA 1FXXA 4CJVA 1ZBHA 2RKIA 4CHQA 4R5PA 2HNZA 4KI4A 3L3UA 5E41A 5HRNA 4DS4A 1T8EA 4BDYA 1FKPA 5I3UA 2HHTA 2YKNA 5DMRA 3IS9A 1LW0A 4OPJA 1UOCA 1BI4B 2IDOA 3HPGA 4KTQA 4LSLA 4EP5A 3TAPA 2HHSA 4FLZA 4CHYA 4ID5A 2FBVA 4FW1A 1O1WA 5HRPA 4KHSA 4OJRA 1DTTA 3OYJA 3SQ2A 1S5JA 2GV9A 3T19A 4N56A 1ZBLA 3AO2A 4CEDA 3QEIA 3QO9A 4DFPA 1U4BA 5DK5A 4DWIA 2HMIA 4M42A 4DSFA 2KW4A 3WNGA 3ALYA 3LAKA 1KVAA 1TL1A 4F8RA 1ASVA 2IGIA 3AA4A 4H4MA 1D9DA 1VRUA 1BL3A 4CJRA 1C0TA 1K6YA 2E6MA 3V9ZA 4LH5A 2PYLA 4FXDA 1L3UA 2P1JA 1BQNA 2YHBA 1RBVA 5KI6A 3CQ8A 2RF2A 2WOMA 1HYZA 2RPIA 3LPTA 4LSNA 4CF2A 5SZTA 4DSKA 3K57A 1KVBA 3OJSA 1JXBA 4I9QA 4Z4IA 3OYIA 1UWBA 4YFUA 1VSHA 3RR7A 3AVNA 1NK6A 3VA3A 3MXMA 3SJJA 1NJXA 4N76A 3AVIA 2X74A 3ISNC 2X6SA 4GW6A 1C0UA 2XRIA 1J5OA 4CECA 5EU7A 4F2SA 1WN7A 3DRRA 2Z1IA 3NF7A 2KFZA 3WNEA 3KLGA 4DSJA 4NCBA 2IS3A 2OZSA 3L2RA 3HL8A 3S3NA 4CJWA 2R7YA 3RRHA 4BE2A 1TK0A 2QKBA 4CK2A 1BHLA 4DTXA 4WE1A 3HYFA 1R0AA 3LP3A 4KKOA 4Z4EA 4IG0A 1BIZA 1S1XA 1S6QA 3AO5A 3VQQA 1T03A 5FROA 1JLFA 3I0RA 5CYQA 3TAGA 2YNGA 3NF9A 4I2QA 4CIEA 1QQCA 2HHVA 1LV5A 4DTMA 3EY1A 4LY7A 3NF6A 2ITGA 5T7BA 3M8SA 4ZHRA 1J53A 4B9VA 4DTJA 3TAEA 1RT7A 2Z1GA 4BWMA 3V4IA 3OYEA 3HVRA 3THVA 1TL3A 3JSMA 3L8BA 3AVJA 4H4OA 2A1SA 3O3GA 4H8KA 3JYTA 4AILC 3QETA 3LZJA 3KKRA 3C6UA 1JLCA 1TAQA 3M8PA 3AVMA 3KIOA 4CJTA 4FLXA 4ELTA 3HK2A 1NKEA 4Q0BA 2B5JA 3S3OA 1NK7A 1BIUA 2D0AA 1HJRA 3VQEA 2D0BA 1RT3A 1S9GA 4E1NA 3HXMA 2HVIA 5HRRA 3AVGA 3D45A 4KO0A 4CF8A 4KB0A 3MEGA 1LW2A 2FBXA 2VG6A 2OPSA 3IG1A 3AA5X 4QOZB 1NJWA 4W5QA 3SPYA 1SUQA 4AHVA 4Y1CA 4FJ7A 5FRNA 3LDSA 4CGHA 1JL1A 3KD5E 2G8VA 3DLBA 4CIGA 1VK0A 1VSIA 3WNHA 1S1TA 2Z1HA 4AH9A 4DS5A 3AVFA 4DF4A 4IDKA 1SKSA 3CG7A 4DTOA 1C1AA 2FBTA 3O3FA 4CJFA 3OYKA 3I0SA 4CJ3A 1A5VA 2DY4A 3CFRA 1SL1A 1F21A 1L5UA 3O4NA 4FLVA 1X9MA 3LZIA 4IBNA 1YTUA 3HO1A 3DM2A 4KV8A 4KI6A 4EZ6A 3QNNA 4FLTA 3SV3A 1XHZA 4DTRA 2YNIA 4CGGA 3ASMA 1EKEA 4IFYA 3D0PA 1ASWA 2YV0X 3HP6A 5J2QA 4FZYA 3SUNA 4KHQA 2X6NA 4OKEA 5J2PA 4CEQA 2P5OA 1ZBIA 1HYVA 1VRTA 3LP2A 2VWKA 1NK9A 4W5OA 3SUPA 3KLHA 1S1UA 2OPPA 5KRSA 3DRSA 3V1RA 1QE1A 1EX4A 3DLEA 3P83D 4QAGA 3L2VA 3PO4A 3G0ZA 1RTIA 1HYSA 1TKTA 4M45A 3SV4A 4CEAA 4CFDA 3OYHA 3VQDA 3S9HA 3V1QA 3AA2A 1N6QA 1LAVA 1L3SA 5FRMA 3P5JA 1QSSA 4KPYA 3I8DA 4ICLA 2FC0A 3K5LA 3NBPA 4E7IA 3ZSRA 3S3MA 3VQBA 2DFEA 4L8RB 4J2AA 3ITHA 3OYGA 3CM5A 1J54A 2O4GA 3HVTA 3TAMA 1HQUA 3VQ6A 4O0IA 1SKWA 3K5OA 3LWLA 4B08A 1LAWA 3O3HA 3KLIA 1A5WA 3TI0A 4DU4A 3IAYA 1C1BA 4BACA 1QSYA 3DOKA 3VQ5A 1YVUA 3AVBA 4J2DA 3KK2A 4DLGA 3RRGA 5KRTA 5K14A 1Q9XA 2IAJA 3K5NA 4B8AB 1HNIA 4IFVA 4FLWA 4DMNA 3BDPA 5HBMA 3SNNA 1RBRA 3OVNA 3L2QA 4JS5A 1XHXA 4CF0A 3U6FA 4FJGA 5J1EA 5JS1A 1JLAA 4AHTA 4CGFA 3TARA 2A1RA 3ULDA 3KTQA 2HHXA 4OGEA 3LP0A 3V6DA 1RNHA 3AV9A 5SWMA 3VN5A 1QTMA 1A5XA 2EX3A 4RW9A 3DI6A 4QCLA 4CJPA 3SUQA 5J2MA 1ZBFA 4CERA 1IKYA 3NF8A 3F9KA 5HLFA 2DFHA 1C0MA 4C8NA 3EYZA 4N41A 3AVAA 3ZSVA 2Y1JA 1BQMA 1JL2A 4HVJA 3QIOA 3ZT1A 1RTDA 4CEFA 4B9LA 3NH2A 4DFJA 1DTQA 3VQPA 3OYBA 4E7KA 1RDAA 1WLJA 3CFPA 4IG3A 3KLFA 2NUBA 3AO3A 4CEZA 1LWEA 3TR8A 3HPOA 1XI1A 1NOZA 1W9HA 1B92A 1TKZA 2BE2A 2D5RA 3QNOA 4KHNA 5HROA 2QK9A 3V9XA 4DU3A 3OYCA 1TV6A 4F2RA 1RBSA 1RBUA 1VSKA 4Z0UA 4E7JA 1B9FA 3QERA 1HRHA 1SKRA 4JRPA 1NK0A 1JXEA 4FJ8A 4M3XA 4B9TA 4FJIA 4OKKA 4DTNA 3HM9A 4RW8A 3ZT4A 2KFNA 2AJQA 2DTUA 1C1CA 3L2UA 3K59A 1CXQA 2P5GA 2XY5A 3ZCMA 1CLQA 3VQ9A 1BISA 3HJFA 3AVCA 4W5TA 4HUGA 3KJVA 4E7HA 4DTSA 2E4LA 3K2PA 3QEXA 4MQ3A 1BCMA 4KTZA 1VSMA 2YNFA 1BI4A 4CFAA 4CE9A 2BANA 2HHWA 1WSIA 1WNSA 1Z26A 4DSLA 3LPUA 1VSLA 3SCXA 3SI6A 4O44A 3SZ2A 4N47A 3KK1A 3ZSZA 3VQ4A 4E7LA 3M8QA 4FJLA 2Z1JA 3C6TA 3O4QA 2XY6A 4CESA 1KCFA 1VSFA 3PX4A 4CJKA 1KLMA 4C8MA 3MXIA 4F4KA 2O4IA 1ZYQA 4CJ4A 4DLEA 1NOYA 4CJQA 3UIQA 1W0HA 4IKFA 4JS4A 4CHPA 1J9AA 3H08A 1IKWA 1WSGA 3K5MA 5C42A 4DQIA 4FJMA 1LWCA 1GOCA 3PX6A 3DRPA 2OZMA 2X78A 3DLKA 5KGWA 4ELVA 3OS2A 2BGGA 3VQ7A 3TAFA 1DLOA 4KB1A 1X9WA 2YHAA 1RILA 4CHOA 4I7FA 1S1VA 2GBZA 2HHQA 1EXQA 2W42A 3CYMA 4KTWA 4EZ9A 4W5RA 4B8CA 4M41A 4KRFA 3NGZA 4CIFA 4Z4HA 1IG9A 1RTJA 3SPZA 1T7PA 4LD0A 4PWDA 1RT1A 3KK3A 3AA3A 3NGIA 3TANA 3NH0A 1XWLA 1BCOA 4O55A 2HNDA 4CK1A 1L3VA 3DLHA 3MECA 1NKCA 1D5AA 1RBTA 3V81A 1G15A 3PV8A 3PO5A 4FK0A 1QSLA 3QIPA 1X1PA 3PUFA 1I3AA 5KTQA 3HPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NGY A;  3ZT3 A;  3KD1 E;  3SYZ A;  3RR8 A;  1TKX A;  3QEP A;  4AHS A;  2PY5 A;  4KHY A;  2QXF A;  2KTQ A;  1KFD A;  3BGR A;  1TAU A;  1ITG A;  3FFI A;  2JGU A;  3T3F A;  1JLQ A;  2E6L A;  4CEE A;  5KGX A;  4BWJ A;  3NE6 A;  3NFA A;  4NYN A;  1YT3 A;  1WSH A;  4KFB A;  2XHB A;  2EHG A;  3OYA A;  1WSJ A;  4B9M A;  3QEV A;  4HUF A;  2YNH A;  3C95 A;  3OS1 A;  4ELU A;  4FJN A;  1Q8I A;  3RMD A;  1KTQ A;  4M3Z A;  1KFS A;  2PYJ A;  3OY9 A;  2XY8 A;  4Z4C A;  1C6V A;  2HNY A;  2WON A;  1HQE A;  3MEE A;  3OYF A;  1VSE A;  3CM6 A;  4FM2 A;  3TAB A;  1U45 A;  4GVM A;  2P51 A;  1JLG A;  3K58 A;  2DFF A;  4OVL A;  4RW4 A;  3IRX A;  1SV5 A;  1UAX A;  3C94 A;  3NH1 A;  3KLE A;  2XO7 A;  3V1O A;  3LAN A;  3HT3 A;  3ZT2 A;  3NHG A;  4RW7 A;  2G8U A;  4FJX A;  4LH4 A;  1NK4 A;  4CHZ A;  4M3W A;  2OPR A;  4Q5V A;  1D9F A;  3F73 A;  4CJ5 A;  4ZTF A;  3AO1 A;  1FK9 A;  1RTH A;  3DLG A;  4DFM A;  4FJJ A;  1CZ9 A;  1CXU A;  2GUI A;  1RDC A;  4CGD A;  4N5S A;  3OJU A;  4KHU A;  2JLE A;  4DQS A;  2G8H A;  4NCA A;  3OYM A;  4DTU A;  4O5B A;  1S1W A;  1RCH A;  4M3U A;  1GOB A;  1CZB A;  2VG7 A;  4OKJ A;  3OS0 A;  3DLR A;  1S9E A;  1SL0 A;  4BE0 A;  3G10 A;  3KKS A;  1EET A;  4CFC A;  5FDL A;  5CYM A;  1RDB A;  3VQA A;  4DSE A;  3RMB A;  1XC9 A;  4ZTJ A;  5CZ2 A;  4OLB A;  4HTU A;  4DF8 A;  1IO2 A;  2KZZ A;  4C8L A;  1EP4 A;  1YTA A;  4FW2 A;  2OYQ A;  4HCB A;  1TVR A;  4J2B A;  5D3G A;  3QIN A;  4OLA A;  1Y97 A;  3AO4 A;  3DOL A;  1JLB A;  1RDD A;  1X9S A;  4FK2 A;  3U3G A;  5C24 A;  3ZSX A;  4CF9 A;  5JS2 A;  4AHU A;  4FM1 A;  4FZZ A;  3OYL A;  3HST B;  1VSD A;  4I9L A;  1RT6 A;  3NDK A;  3DMJ A;  4XIU A;  5J2N A;  4NCG A;  1NJY A;  4FYD A;  2VWJ A;  3AVH A;  3QLH A;  1NK8 A;  4HCC A;  3L3V A;  4FLY A;  2G8F A;  4YNQ A;  4E0D A;  4FJ5 A;  3QEW A;  5CY4 A;  3T1A A;  4CFB A;  4NYF A;  1Q9Y A;  3B6P A;  4DQQ A;  1KLN A;  4EP4 A;  2I5J A;  4F3O A;  3WNF A;  3U3Y A;  3CFO A;  5I42 A;  3VQC A;  4CF1 A;  4DG1 A;  4TSX A;  2XY7 A;  3ZSQ A;  4CCH A;  4FJ9 A;  4CJE A;  4FCY A;  1ZBU A;  5CZ1 A;  4E3S A;  2G8K A;  1WSF A;  4B9U A;  1HPZ A;  2G8I A;  2KZM A;  1U47 A;  3V9S A;  1IH7 A;  4RG8 A;  2F8S A;  4F3T A;  4KRE A;  4CJS A;  1WAJ A;  3ZSW A;  4CHN A;  4JRQ A;  4KAZ A;  2D0C A;  1TGO A;  4UQG A;  3AVL A;  4AHC A;  4I2P A;  3VA0 A;  4FJH A;  4GMJ B;  2HHU A;  2YKM A;  1QS4 A;  2Y1I A;  1QHT A;  4B3O A;  3ZT0 A;  3V9U A;  3RWU A;  4J2E A;  4W5N A;  3SQ0 A;  1TK8 A;  4DSI A;  1VSJ A;  4DU1 A;  3DYA A;  1GOA A;  4E1M A;  3RMA A;  3TWH A;  4K8Z A;  1U48 A;  3M8R A;  1D8Y A;  1REV A;  2G8W A;  2QKK A;  3ZSY A;  2B4J A;  2ETJ A;  3VQ8 A;  1LWF A;  3NAE A;  4Z4F A;  2Q3S A;  2F8T A;  2OPQ A;  3SQ4 A;  3MXJ A;  4PA1 A;  4BDZ A;  4BE1 A;  4K8X A;  3LP1 A;  4FZX C;  5HP1 A;  4C8O A;  2FBY A;  3OYN A;  4C8K A;  5C25 A;  2HW3 A;  4CEB A;  3A2F A;  4M3Y A;  4O4G A;  4CGJ A;  1KSP A;  1IKX A;  4DTP A;  1U04 A;  4HUE A;  4G1Q A;  1Z25 A;  1JKH A;  2VG5 A;  4Y1D A;  4CEO A;  2B6A A;  4DQR A;  3OYD A;  2IOC A;  3AVK A;  3LAM A;  4FJK A;  2F96 A;  4CGI A;  2ATQ A;  4M3R A;  3PX0 A;  1MU2 A;  1HNV A;  3NCI A;  3SUO A;  3V9W A;  1N5Y A;  3QES A;  2KQ2 A;  4B9S A;  1WSE A;  2HB5 A;  2ZD1 A;  1T05 A;  4PUO A;  4DFK A;  2PZS A;  4ID1 A;  3SQ1 A;  1I39 A;  3HP9 A;  4AHR A;  4FVM A;  1IKV A;  1HMV A;  5HRS A;  1TKD A;  1NKB A;  2OA8 A;  4OPK A;  1U49 A;  3PY8 A;  1B9D A;  4M3T A;  4PQU A;  3ZSO A;  4CJL A;  2IC3 A;  4BDP A;  4E19 A;  3RMC A;  4FLU A;  1SL2 A;  1S6P A;  1BGX T;  1FKO A;  3LWM A;  1NJZ A;  3EZ5 A;  4HHT A;  2ZQB A;  4MFB A;  4FK4 A;  3L2W A;  4CK3 A;  1RT2 A;  3B6O A;  1L3T A;  1NK5 A;  1UA0 A;  2ZE2 A;  1KRP A;  3MED A;  4JLH A;  1WAF A;  1ASU A;  1RT5 A;  4DQP A;  4KHW A;  3RTV A;  2HVH A;  2LSN A;  2BDP A;  1JLE A;  4B9N A;  4E89 A;  4OGC A;  3P1G A;  3E01 A;  1RT4 A;  2RN2 A;  1UA1 A;  3TAQ A;  3LAL A;  4FM0 A;  4O0J A;  4RW6 A;  1KVC A;  4CJU A;  4PY5 A;  3MAQ A;  1TK5 A;  4Z4G A;  1FXX A;  4CJV A;  1ZBH A;  2RKI A;  4CHQ A;  4R5P A;  2HNZ A;  4KI4 A;  3L3U A;  5E41 A;  5HRN A;  4DS4 A;  1T8E A;  4BDY A;  1FKP A;  5I3U A;  2HHT A;  2YKN A;  5DMR A;  3IS9 A;  1LW0 A;  4OPJ A;  1UOC A;  1BI4 B;  2IDO A;  3HPG A;  4KTQ A;  4LSL A;  4EP5 A;  3TAP A;  2HHS A;  4FLZ A;  4CHY A;  4ID5 A;  2FBV A;  4FW1 A;  1O1W A;  5HRP A;  4KHS A;  4OJR A;  1DTT A;  3OYJ A;  3SQ2 A;  1S5J A;  2GV9 A;  3T19 A;  4N56 A;  1ZBL A;  3AO2 A;  4CED A;  3QEI A;  3QO9 A;  4DFP A;  1U4B A;  5DK5 A;  4DWI A;  2HMI A;  4M42 A;  4DSF A;  2KW4 A;  3WNG A;  3ALY A;  3LAK A;  1KVA A;  1TL1 A;  4F8R A;  1ASV A;  2IGI A;  3AA4 A;  4H4M A;  1D9D A;  1VRU A;  1BL3 A;  4CJR A;  1C0T A;  1K6Y A;  2E6M A;  3V9Z A;  4LH5 A;  2PYL A;  4FXD A;  1L3U A;  2P1J A;  1BQN A;  2YHB A;  1RBV A;  5KI6 A;  3CQ8 A;  2RF2 A;  2WOM A;  1HYZ A;  2RPI A;  3LPT A;  4LSN A;  4CF2 A;  5SZT A;  4DSK A;  3K57 A;  1KVB A;  3OJS A;  1JXB A;  4I9Q A;  4Z4I A;  3OYI A;  1UWB A;  4YFU A;  1VSH A;  3RR7 A;  3AVN A;  1NK6 A;  3VA3 A;  3MXM A;  3SJJ A;  1NJX A;  4N76 A;  3AVI A;  2X74 A;  3ISN C;  2X6S A;  4GW6 A;  1C0U A;  2XRI A;  1J5O A;  4CEC A;  5EU7 A;  4F2S A;  1WN7 A;  3DRR A;  2Z1I A;  3NF7 A;  2KFZ A;  3WNE A;  3KLG A;  4DSJ A;  4NCB A;  2IS3 A;  2OZS A;  3L2R A;  3HL8 A;  3S3N A;  4CJW A;  2R7Y A;  3RRH A;  4BE2 A;  1TK0 A;  2QKB A;  4CK2 A;  1BHL A;  4DTX A;  4WE1 A;  3HYF A;  1R0A A;  3LP3 A;  4KKO A;  4Z4E A;  4IG0 A;  1BIZ A;  1S1X A;  1S6Q A;  3AO5 A;  3VQQ A;  1T03 A;  5FRO A;  1JLF A;  3I0R A;  5CYQ A;  3TAG A;  2YNG A;  3NF9 A;  4I2Q A;  4CIE A;  1QQC A;  2HHV A;  1LV5 A;  4DTM A;  3EY1 A;  4LY7 A;  3NF6 A;  2ITG A;  5T7B A;  3M8S A;  4ZHR A;  1J53 A;  4B9V A;  4DTJ A;  3TAE A;  1RT7 A;  2Z1G A;  4BWM A;  3V4I A;  3OYE A;  3HVR A;  3THV A;  1TL3 A;  3JSM A;  3L8B A;  3AVJ A;  4H4O A;  2A1S A;  3O3G A;  4H8K A;  3JYT A;  4AIL C;  3QET A;  3LZJ A;  3KKR A;  3C6U A;  1JLC A;  1TAQ A;  3M8P A;  3AVM A;  3KIO A;  4CJT A;  4FLX A;  4ELT A;  3HK2 A;  1NKE A;  4Q0B A;  2B5J A;  3S3O A;  1NK7 A;  1BIU A;  2D0A A;  1HJR A;  3VQE A;  2D0B A;  1RT3 A;  1S9G A;  4E1N A;  3HXM A;  2HVI A;  5HRR A;  3AVG A;  3D45 A;  4KO0 A;  4CF8 A;  4KB0 A;  3MEG A;  1LW2 A;  2FBX A;  2VG6 A;  2OPS A;  3IG1 A;  3AA5 X;  4QOZ B;  1NJW A;  4W5Q A;  3SPY A;  1SUQ A;  4AHV A;  4Y1C A;  4FJ7 A;  5FRN A;  3LDS A;  4CGH A;  1JL1 A;  3KD5 E;  2G8V A;  3DLB A;  4CIG A;  1VK0 A;  1VSI A;  3WNH A;  1S1T A;  2Z1H A;  4AH9 A;  4DS5 A;  3AVF A;  4DF4 A;  4IDK A;  1SKS A;  3CG7 A;  4DTO A;  1C1A A;  2FBT A;  3O3F A;  4CJF A;  3OYK A;  3I0S A;  4CJ3 A;  1A5V A;  2DY4 A;  3CFR A;  1SL1 A;  1F21 A;  1L5U A;  3O4N A;  4FLV A;  1X9M A;  3LZI A;  4IBN A;  1YTU A;  3HO1 A;  3DM2 A;  4KV8 A;  4KI6 A;  4EZ6 A;  3QNN A;  4FLT A;  3SV3 A;  1XHZ A;  4DTR A;  2YNI A;  4CGG A;  3ASM A;  1EKE A;  4IFY A;  3D0P A;  1ASW A;  2YV0 X;  3HP6 A;  5J2Q A;  4FZY A;  3SUN A;  4KHQ A;  2X6N A;  4OKE A;  5J2P A;  4CEQ A;  2P5O A;  1ZBI A;  1HYV A;  1VRT A;  3LP2 A;  2VWK A;  1NK9 A;  4W5O A;  3SUP A;  3KLH A;  1S1U A;  2OPP A;  5KRS A;  3DRS A;  3V1R A;  1QE1 A;  1EX4 A;  3DLE A;  3P83 D;  4QAG A;  3L2V A;  3PO4 A;  3G0Z A;  1RTI A;  1HYS A;  1TKT A;  4M45 A;  3SV4 A;  4CEA A;  4CFD A;  3OYH A;  3VQD A;  3S9H A;  3V1Q A;  3AA2 A;  1N6Q A;  1LAV A;  1L3S A;  5FRM A;  3P5J A;  1QSS A;  4KPY A;  3I8D A;  4ICL A;  2FC0 A;  3K5L A;  3NBP A;  4E7I A;  3ZSR A;  3S3M A;  3VQB A;  2DFE A;  4L8R B;  4J2A A;  3ITH A;  3OYG A;  3CM5 A;  1J54 A;  2O4G A;  3HVT A;  3TAM A;  1HQU A;  3VQ6 A;  4O0I A;  1SKW A;  3K5O A;  3LWL A;  4B08 A;  1LAW A;  3O3H A;  3KLI A;  1A5W A;  3TI0 A;  4DU4 A;  3IAY A;  1C1B A;  4BAC A;  1QSY A;  3DOK A;  3VQ5 A;  1YVU A;  3AVB A;  4J2D A;  3KK2 A;  4DLG A;  3RRG A;  5KRT A;  5K14 A;  1Q9X A;  2IAJ A;  3K5N A;  4B8A B;  1HNI A;  4IFV A;  4FLW A;  4DMN A;  3BDP A;  5HBM A;  3SNN A;  1RBR A;  3OVN A;  3L2Q A;  4JS5 A;  1XHX A;  4CF0 A;  3U6F A;  4FJG A;  5J1E A;  5JS1 A;  1JLA A;  4AHT A;  4CGF A;  3TAR A;  2A1R A;  3ULD A;  3KTQ A;  2HHX A;  4OGE A;  3LP0 A;  3V6D A;  1RNH A;  3AV9 A;  5SWM A;  3VN5 A;  1QTM A;  1A5X A;  2EX3 A;  4RW9 A;  3DI6 A;  4QCL A;  4CJP A;  3SUQ A;  5J2M A;  1ZBF A;  4CER A;  1IKY A;  3NF8 A;  3F9K A;  5HLF A;  2DFH A;  1C0M A;  4C8N A;  3EYZ A;  4N41 A;  3AVA A;  3ZSV A;  2Y1J A;  1BQM A;  1JL2 A;  4HVJ A;  3QIO A;  3ZT1 A;  1RTD A;  4CEF A;  4B9L A;  3NH2 A;  4DFJ A;  1DTQ A;  3VQP A;  3OYB A;  4E7K A;  1RDA A;  1WLJ A;  3CFP A;  4IG3 A;  3KLF A;  2NUB A;  3AO3 A;  4CEZ A;  1LWE A;  3TR8 A;  3HPO A;  1XI1 A;  1NOZ A;  1W9H A;  1B92 A;  1TKZ A;  2BE2 A;  2D5R A;  3QNO A;  4KHN A;  5HRO A;  2QK9 A;  3V9X A;  4DU3 A;  3OYC A;  1TV6 A;  4F2R A;  1RBS A;  1RBU A;  1VSK A;  4Z0U A;  4E7J A;  1B9F A;  3QER A;  1HRH A;  1SKR A;  4JRP A;  1NK0 A;  1JXE A;  4FJ8 A;  4M3X A;  4B9T A;  4FJI A;  4OKK A;  4DTN A;  3HM9 A;  4RW8 A;  3ZT4 A;  2KFN A;  2AJQ A;  2DTU A;  1C1C A;  3L2U A;  3K59 A;  1CXQ A;  2P5G A;  2XY5 A;  3ZCM A;  1CLQ A;  3VQ9 A;  1BIS A;  3HJF A;  3AVC A;  4W5T A;  4HUG A;  3KJV A;  4E7H A;  4DTS A;  2E4L A;  3K2P A;  3QEX A;  4MQ3 A;  1BCM A;  4KTZ A;  1VSM A;  2YNF A;  1BI4 A;  4CFA A;  4CE9 A;  2BAN A;  2HHW A;  1WSI A;  1WNS A;  1Z26 A;  4DSL A;  3LPU A;  1VSL A;  3SCX A;  3SI6 A;  4O44 A;  3SZ2 A;  4N47 A;  3KK1 A;  3ZSZ A;  3VQ4 A;  4E7L A;  3M8Q A;  4FJL A;  2Z1J A;  3C6T A;  3O4Q A;  2XY6 A;  4CES A;  1KCF A;  1VSF A;  3PX4 A;  4CJK A;  1KLM A;  4C8M A;  3MXI A;  4F4K A;  2O4I A;  1ZYQ A;  4CJ4 A;  4DLE A;  1NOY A;  4CJQ A;  3UIQ A;  1W0H A;  4IKF A;  4JS4 A;  4CHP A;  1J9A A;  3H08 A;  1IKW A;  1WSG A;  3K5M A;  5C42 A;  4DQI A;  4FJM A;  1LWC A;  1GOC A;  3PX6 A;  3DRP A;  2OZM A;  2X78 A;  3DLK A;  5KGW A;  4ELV A;  3OS2 A;  2BGG A;  3VQ7 A;  3TAF A;  1DLO A;  4KB1 A;  1X9W A;  2YHA A;  1RIL A;  4CHO A;  4I7F A;  1S1V A;  2GBZ A;  2HHQ A;  1EXQ A;  2W42 A;  3CYM A;  4KTW A;  4EZ9 A;  4W5R A;  4B8C A;  4M41 A;  4KRF A;  3NGZ A;  4CIF A;  4Z4H A;  1IG9 A;  1RTJ A;  3SPZ A;  1T7P A;  4LD0 A;  4PWD A;  1RT1 A;  3KK3 A;  3AA3 A;  3NGI A;  3TAN A;  3NH0 A;  1XWL A;  1BCO A;  4O55 A;  2HND A;  4CK1 A;  1L3V A;  3DLH A;  3MEC A;  1NKC A;  1D5A A;  1RBT A;  3V81 A;  1G15 A;  3PV8 A;  3PO5 A;  4FK0 A;  1QSL A;  3QIP A;  1X1P A;  3PUF A;  1I3A A;  5KTQ A;  3HPH A; 
#chains in the Genus database with same CATH topology
 2ASO A;  1TKX A;  4Y0W A;  4KHY A;  2A42 A;  5GAG P;  4BRK A;  5AQH A;  4AM7 A;  3T3F A;  1JLQ A;  4BWJ A;  3SAH A;  1GLJ O;  3ID8 A;  1WSH A;  5AQU A;  4B9M A;  3M3Z A;  2P9I A;  4HUF A;  2YNH A;  3C95 A;  3OS1 A;  5JMV A;  4ELU A;  3RMD A;  4GNI A;  3WXM B;  4AQY K;  3O80 A;  1KTQ A;  1VQK N;  4GV6 A;  4Z4C A;  3TAB A;  3OYF A;  2V7Y A;  4GVM A;  3TSP A;  4DV7 K;  2NZT A;  4ZTF A;  3HTV A;  1SV5 A;  1UAX A;  3D7E O;  3IRX A;  3LAN A;  3ZT2 A;  3HRG A;  5AQO A;  4M3W A;  4CJ5 A;  3ZEU B;  3FZL A;  1CXU A;  3OJU A;  2JLE A;  4B3T K;  1ATN A;  4DTU A;  4X65 K;  2P9P B;  1CZB A;  1SL0 A;  2IIR A;  4HTL A;  4JI8 K;  4A5A A;  5FDL A;  4XH5 A;  1RGI A;  2YI1 A;  5AQT A;  4ZTJ A;  4OLB A;  4HTU A;  2KZZ A;  4FW2 A;  4HCB A;  4OLA A;  1Y97 A;  4FK2 A;  2WBN A;  5C24 A;  5BRF A;  3ZSX A;  5JS2 A;  3OYL A;  3KHY A;  3EN9 A;  3DMJ A;  4JEP A;  4B9Q A;  1Z05 A;  3WQT A;  4HCC A;  4E0D A;  4FLY A;  4YNQ A;  5CR4 A;  3E9O A;  4CFB A;  4NYF A;  1HUX A;  1KLN A;  4F3O A;  4O8U A;  3U3Y A;  2PBD A;  4MO5 A;  2Q31 A;  4DG1 A;  3MN5 A;  3ZSQ A;  4FJ9 A;  3O1W A;  5CZ1 A;  1N34 K;  2KZM A;  3J8A A;  5TKW A;  3AGR A;  4BC3 A;  1U47 A;  3V9S A;  2F8S A;  4YOW A;  4UQG A;  2YHW A;  3AVL A;  4AHC A;  4FJH A;  4BG8 A;  2WUS A;  3ZT0 A;  1OKJ A;  4IFE A;  3V9U A;  4W5N A;  1TK8 A;  1VSJ A;  4DU1 A;  1REV A;  3VQ8 A;  3NAE A;  1HKC A;  4IDH A;  4K8X A;  5AZJ A;  2FBY A;  3OYN A;  3A2F A;  3VGM A;  2QI2 A;  4CGJ A;  1KSP A;  4DTP A;  2O8E A;  4G1Q A;  2B6A A;  2IOC A;  3AVK A;  3LAM A;  5LJV A;  3SUO A;  1N8R O;  4B9S A;  2HB5 A;  2ZD1 A;  3SQ1 A;  1I39 A;  4AHR A;  1IKV A;  2A41 A;  4Z94 A;  1TKD A;  1VQL N;  4FL9 A;  4H0V B;  1X3N A;  3GL1 A;  1U49 A;  1B9D A;  4JD2 A;  4CJL A;  4E19 A;  1SL2 A;  1S6P A;  1BGX T;  3EZ5 A;  2ZQB A;  2ZGY A;  2F9T A;  4MFB A;  4FK4 A;  4JV5 K;  4CK3 A;  5AZI A;  2E2O A;  2OTJ N;  4DQP A;  3RTV A;  2KHO A;  4K41 A;  1WB9 A;  2LSN A;  3CC7 N;  3H1Q A;  4E89 A;  4OGC A;  3E01 A;  3TAQ A;  1TK5 A;  3GDQ A;  2UUA K;  1FXX A;  3ATU A;  4O8K A;  4DS4 A;  4PL8 A;  4BDY A;  4QS7 A;  5I3U A;  2HHT A;  2YKN A;  5GIN A;  3D2F B;  3PLA A;  1UOC A;  4BR2 A;  2HHS A;  1QZ5 A;  4EIA A;  2NRT A;  2GV9 A;  4N56 A;  1ZBL A;  3AO2 A;  2CGK A;  3WT0 A;  3QEI A;  2KW4 A;  3VEV A;  3D2E A;  3H6E A;  1KVA A;  1TL1 A;  2IGI A;  1VRU A;  4IZ9 A;  2E8A A;  1C0T A;  2E6M A;  1RFQ A;  4BRE A;  1QQO A;  4BR5 A;  2YHB A;  5KI6 A;  2RF2 A;  2WOM A;  3RSE B;  2RPI A;  3LPT A;  5SZT A;  1QHA A;  1VQM N;  1Z6R A;  3K57 A;  1JXB A;  1T6C A;  2YCH A;  4BRL A;  3AVN A;  1NK6 A;  2D4W A;  1NJX A;  2QWM A;  2X74 A;  2VQE K;  5M1F A;  4H03 B;  4F2S A;  5MLC Q;  2Z1I A;  3KLG A;  4GKK K;  4DR4 K;  2NRR A;  4BE2 A;  2W6L A;  3HYF A;  4KKO A;  5LMN K;  3J7A P;  4A2A A;  3KWG A;  5AQK A;  3CJA A;  3KZB A;  1JLF A;  5CYQ A;  4I2Q A;  4CIE A;  1QQC A;  4ILH A;  4LY7 A;  5C10 A;  5T7B A;  4DTJ A;  3V4I A;  3OYE A;  3ZEU A;  1TL3 A;  3JSM A;  3I56 N;  2A1S A;  4AIL C;  3LZJ A;  3KKR A;  4YOR A;  1JLC A;  4FLX A;  2FXU A;  4IOA L;  5LY3 A;  2B5J A;  3S3O A;  2P9P A;  1NGA A;  2HVI A;  2D0B A;  4DV5 K;  2P9K A;  3CIP A;  3O9R A;  4E1N A;  4CBU A;  3D45 A;  5KPT A;  4KB0 A;  5AQQ A;  5AQX A;  3VEW A;  2EWS A;  2VG6 A;  2OPS A;  2AP1 A;  4W5Q A;  3SPY A;  1SUQ A;  4Y1C A;  3DWL A;  1JCF A;  4X66 K;  3O4W A;  3DLL L;  3KD5 E;  3AAP A;  1VSI A;  3WNH A;  4AH9 A;  2I7P A;  5BN9 A;  4JN4 A;  3FGU A;  1C1A A;  2FBT A;  4CJF A;  1Q82 O;  3OYK A;  3I0S A;  4JAX A;  1L5U A;  4FLV A;  4NO7 A;  1HPM A;  1SZ2 A;  4KV8 A;  4GY2 B;  5EVZ A;  1P90 A;  4FLT A;  2ZJR L;  3THY B;  4CD3 A;  3C6A A;  3D0P A;  2YJE A;  3THW B;  3SUN A;  5J2P A;  4CEQ A;  2ASP A;  4CZI A;  2VYP A;  1KD1 O;  3L4I A;  4W5O A;  3KLH A;  1S1U A;  5KRS A;  4BG9 A;  1EX4 A;  5LMU K;  1RTI A;  4CEA A;  3S9H A;  2QXL A;  3N4P A;  4DR1 K;  3VF2 A;  1L3S A;  3P5J A;  3I8D A;  3K5L A;  2Q0U A;  4J2A A;  1NGF A;  3CM5 A;  4LFC K;  5BR9 A;  3K5O A;  4IWV A;  1LAW A;  2HBJ A;  4BRM A;  3O9S A;  3J7Z O;  4RTF D;  1HX1 A;  4CZK A;  4J2D A;  4DLG A;  4IOC L;  4B8A B;  2GUP A;  4DMN A;  2HMP A;  3L2Q A;  1XHX A;  3CCM N;  1JLA A;  4AHT A;  2HHX A;  3TAR A;  1RNH A;  3BY5 A;  3AV9 A;  1XNQ K;  3UKU B;  5M1K A;  3SUQ A;  4L3Q A;  1XMQ K;  3F9K A;  3DJC A;  3MDQ A;  1C0M A;  4LF6 K;  3B8A X;  2A40 A;  3NH2 A;  4DFJ A;  3G71 N;  4IG3 A;  2NUB A;  3AO3 A;  1TUU A;  4DCH A;  1W9H A;  1B92 A;  4FWQ A;  5HRO A;  4BRD A;  1RBS A;  1Q7Y O;  1VSK A;  1SKR A;  3CJC A;  1B9F A;  4EHU A;  4LF8 K;  4M3X A;  2WTU A;  4DTN A;  2AJQ A;  2DTU A;  3O9Q A;  1C1C A;  2P5G A;  4E1J A;  3ZCM A;  3H3O B;  3VQ9 A;  1BIS A;  3AVC A;  3VMF B;  4BVO A;  1EQY A;  3KJV A;  3QIC A;  1OVQ A;  3D2F A;  4MQ3 A;  1VSM A;  3WEE B;  2NNW A;  4BRN A;  3SCX A;  3TTD A;  3SZ2 A;  4N47 A;  4FJL A;  4CES A;  3TSQ A;  1KCF A;  4BR9 A;  4DV4 K;  4CJK A;  3MXI A;  1ZYQ A;  4DR7 K;  3I8B A;  3M6G A;  4CJQ A;  4CHP A;  3H08 A;  1IKW A;  1EWR A;  3PX6 A;  3DRP A;  2ZJP L;  3RSE A;  4BGA A;  3DLK A;  1GLC G;  1DLO A;  2YHA A;  1ZBS A;  2W42 A;  3CYM A;  4Z4H A;  4PKI A;  2GEL A;  3SAG A;  4JI3 K;  3NGI A;  4BY9 C;  3NH0 A;  1XWL A;  3KK7 A;  1L3V A;  2HND A;  3DLH A;  3QB0 A;  3V81 A;  4GVE A;  1G15 A;  3K2P A;  3QEX A;  5KTQ A;  1GLA G;  3KD1 E;  3SYZ A;  3RR8 A;  3SMP A;  2QTD A;  4AHS A;  2PY5 A;  3MMV A;  1BA0 A;  2KTQ A;  1KFD A;  1ITG A;  3FFI A;  2JGU A;  1NBW A;  2E6L A;  5KGX A;  3NE6 A;  1QVG M;  3P39 A;  3S41 A;  3FFK B;  4NYN A;  4KFB A;  4I6M A;  4FJN A;  3LM2 A;  4M3Z A;  3OY9 A;  2XY8 A;  2Q1N A;  2HNY A;  1NOY A;  1HQE A;  3MEE A;  4JHD B;  3CM6 A;  2P51 A;  3K58 A;  3CQX A;  2DFF A;  4RW4 A;  5BPM A;  2XO7 A;  3NH1 A;  3C94 A;  4K25 A;  4LF9 K;  3NHG A;  4K42 A;  2ZM6 K;  1NK4 A;  5CE3 A;  2OAN A;  4CHZ A;  4Q5V A;  2ITM A;  3AO1 A;  1RTH A;  2OCE A;  4DQS A;  1Q18 A;  4M3U A;  1RCH A;  1GOB A;  4IEI A;  4C1N K;  1S9E A;  2F4V K;  1YXQ A;  3IMX A;  4QS9 A;  3QFP A;  3CME N;  3VQA A;  1XC9 A;  1H1V A;  3PSF A;  1IO2 A;  3VTI A;  4C8L A;  3THY A;  4J2B A;  2J4R A;  4HWI A;  1YIT N;  3AO4 A;  3THW A;  1NWK A;  4DKW A;  1RDD A;  5GAE P;  1X9S A;  5FPM A;  3DXM B;  2HBK A;  1OH5 A;  4NXM K;  4FZZ A;  2FSJ A;  2FSN A;  3G4S N;  4NCG A;  1NK8 A;  4M63 C;  3L3V A;  2G8F A;  3CER A;  4FJ5 A;  4DB3 A;  3QEW A;  4B1V A;  2ZWH A;  3CFO A;  3VQC A;  5ELZ A;  1XNR K;  4CJE A;  4FCY A;  1WSF A;  2G8I A;  4FOE A;  3OW2 M;  4CJS A;  1LOT B;  3ZSW A;  3LDQ A;  4UY8 O;  2HHU A;  3G6E N;  1QS4 A;  3ID6 A;  1T3V A;  4J2E A;  1NMN A;  3CET A;  1GOA A;  5M1P A;  1P8Z A;  2JWK A;  1U48 A;  4YOX A;  3M8R A;  3VPZ A;  1ILY A;  5EY4 A;  2B4J A;  2QWP A;  2F7T A;  3UKU A;  3CXC M;  3CCR N;  1N33 K;  2F8T A;  3FR0 A;  2OPQ A;  3SQ4 A;  1XUP O;  3MXJ A;  4BDZ A;  1BA1 A;  1T6D A;  3LP1 A;  4FZX C;  2HW3 A;  4O4G A;  2VWB A;  4HUE A;  5DM6 L;  3OHR A;  4Y1D A;  4CEO A;  4DQR A;  3OYD A;  1TYQ A;  2ATQ A;  4M3R A;  3PX0 A;  4MDA A;  3A5O C;  5BR8 K;  1WSE A;  1T05 A;  2PZS A;  4ID1 A;  3HP9 A;  4B3M K;  5HRS A;  1NKB A;  2OA8 A;  5ADX A;  5TKY A;  4PQU A;  5AQY A;  2IC3 A;  1FKO A;  3L2W A;  5M1N A;  1KRP A;  3MED A;  4CZH A;  3G25 A;  1RT5 A;  3WEE A;  3QML A;  3ZET B;  3AY9 A;  1VQ8 N;  1ZC6 A;  2E20 A;  3P1G A;  2NRH A;  2RN2 A;  3LAL A;  5E84 A;  4DV0 K;  4FM0 A;  4RW6 A;  3AAQ A;  4BR4 A;  4F9O A;  3VER A;  4CJU A;  1NGG A;  4Z4G A;  1OH8 A;  4YDU A;  3C6H A;  4CHQ A;  1ZBH A;  1DEJ A;  3L3U A;  4A62 A;  5HRN A;  3SAF A;  1FKP A;  5DMR A;  3IS9 A;  1LW0 A;  4JI6 K;  5IWA K;  3PIP L;  3TAP A;  4CHY A;  3EL2 A;  2P9K B;  4OJR A;  3SQ2 A;  3T19 A;  1U4B A;  4A2B A;  2H3G X;  2HMI A;  3WNG A;  3ALY A;  3LAK A;  4H4M A;  1BL3 A;  4CJR A;  1K6Y A;  4PKG A;  4WFA L;  3K9K A;  1L3U A;  1RBV A;  4KH6 A;  1YVN A;  5AFU A;  3OJS A;  4KBO A;  4Z4I A;  4YFU A;  1SAZ A;  3VA3 A;  3ATV A;  4IO9 L;  4GW6 A;  1QVF M;  4H0T B;  4CEC A;  3CJB A;  2KFZ A;  3R6M A;  2ASM A;  3WNE A;  4DSJ A;  3P38 A;  4CD1 A;  4JHD A;  1R59 O;  4DR3 K;  1BIZ A;  3ZX0 A;  1S6Q A;  3SJH A;  3VQQ A;  1Q86 O;  3TAG A;  1LV5 A;  5EX5 A;  3M8S A;  2ITG A;  3CCJ N;  3TAE A;  1YIJ N;  1RT7 A;  3UB5 A;  3O3G A;  4H8K A;  1N36 K;  4DV2 K;  3EZW A;  2HBL A;  3MWT A;  4Q0B A;  1NKE A;  1NK7 A;  2E1Z A;  2BUP A;  3VQE A;  1RT3 A;  2ZGZ A;  4BR7 A;  4JKH A;  1LW2 A;  2FBX A;  3AA5 X;  4FPA A;  4QOZ B;  1NJW A;  3LDN A;  1WOQ A;  1YF5 L;  1QQM A;  5C2F A;  3AGK A;  2NRW A;  1VK0 A;  3VGK A;  3WUH A;  5FPE A;  1S1T A;  2Z1H A;  3DXM A;  4DS5 A;  4NXN K;  1SKS A;  3CG7 A;  3O3F A;  4CJ3 A;  2DY4 A;  3CFR A;  2D0P A;  1F21 A;  4V19 S;  3EE8 A;  1X3M A;  3O4N A;  1X9M A;  3LZI A;  2IVP A;  3HO1 A;  3DM2 A;  3ZX2 A;  4JKC A;  4EZ6 A;  3QNN A;  1XHZ A;  1NGE A;  3F2K A;  3W0L A;  4FZY A;  4KHQ A;  4OKE A;  1ZBI A;  2P5O A;  4FWP A;  1RDU A;  4IEE A;  1ZXO A;  3TTC A;  3ENH A;  3DLE A;  1E3M A;  4M45 A;  3SV4 A;  4CFD A;  3CJ7 A;  1LAV A;  1HNW K;  5FRM A;  4KPY A;  2FC0 A;  3QFU A;  4CI6 A;  4E7I A;  3S3M A;  1VAZ A;  2IVO A;  5BRE A;  3ITH A;  2UU9 K;  4MLE A;  4LFA K;  3HVT A;  1HQU A;  2ZF5 O;  4O0I A;  4H5V A;  3JAM O;  4DV1 K;  3TI0 A;  4DU4 A;  3VQ5 A;  3I33 A;  4ILG B;  5K14 A;  2IAJ A;  1HNI A;  4IFV A;  3BDP A;  1RBR A;  4BRG A;  3U6F A;  2A1R A;  4CBW A;  3ULD A;  4FVU A;  5GIP A;  4JKF A;  3SBT A;  1A5X A;  2EX3 A;  5GIO A;  3DI6 A;  4QCL A;  4CJP A;  5J2M A;  4LFB K;  3R3L A;  3NF8 A;  4JI5 K;  4N41 A;  1J6Z A;  4IXC A;  3VF4 A;  4CEF A;  3WXL A;  1DTQ A;  2UUC K;  3VQP A;  4C23 A;  3KLF A;  1NM1 A;  1LWE A;  3ZET A;  3MCA B;  3HOT A;  2BE2 A;  4FWN A;  3CC4 N;  2QK9 A;  3F5T A;  3OYC A;  4JRP A;  1JXE A;  4B9T A;  3HM9 A;  3ZT4 A;  3HJF A;  3CPW M;  2UXD K;  4I6M B;  4E7H A;  1HNX K;  1FW6 A;  2NLX A;  1BCM A;  3MCP A;  2QEX N;  1QQN A;  4CE9 A;  4PL7 A;  4DSL A;  3LPU A;  3K9J A;  4O44 A;  3ZSZ A;  4U7B A;  2Z1J A;  3O4Q A;  1I94 K;  1NGD A;  3TSU A;  3MN6 A;  2QM1 A;  4IJA A;  4BC2 A;  2O4I A;  3JS6 A;  4CJ4 A;  2E2P A;  4IKF A;  4YDU C;  5LL6 Z;  3K5M A;  1J9A A;  5C42 A;  1LWC A;  4BQZ A;  2X78 A;  4A57 A;  3SLC A;  3GE1 A;  3VQ7 A;  2E2N A;  3TAF A;  2QWQ A;  1X9W A;  4I7F A;  1S1V A;  4EZ9 A;  1BUP A;  3MX2 A;  4KRF A;  1NLV A;  3NGZ A;  1IG9 A;  3SPZ A;  4JK9 A;  4LD0 A;  4FWL A;  3TAN A;  1OH6 A;  3R8E A;  3MEC A;  3CHW A;  1D5A A;  1RBT A;  3PV8 A;  3M5R A;  3QIP A;  3ENB A;  1X1P A;  3PUF A;  1I3A A;  2Q97 A;  4CZM A;  3LDL A;  5BN8 A;  1NGH A;  3VET A;  3BF1 A;  2XHB A;  3OYA A;  1WSJ A;  5GAD P;  3QEV A;  2O8B B;  4MLH A;  3WQU A;  1Q8I A;  1LCU A;  3SBG A;  1KFS A;  2PYJ A;  3KWI A;  2UYT A;  1C6V A;  4BRH A;  4FM2 A;  1VSE A;  3LDO A;  2JWL A;  2KKZ A;  1JLG A;  4J8F A;  4OVL A;  3HT3 A;  3OA9 A;  4RW7 A;  2CGJ A;  4H0P A;  1HKB A;  2OPR A;  4WFN L;  3DLG A;  4A61 A;  5BRD A;  3UKR B;  3OBY A;  4FJJ A;  1M90 O;  1CZ9 A;  3VEY A;  3C65 A;  1RDC A;  4N5S A;  2G8H A;  5F1X A;  4NCA A;  2A3Z A;  1SS6 A;  2VG7 A;  1XQS C;  4A59 A;  4CZJ A;  2CH5 A;  3KKS A;  3P31 A;  1RDB A;  5CZ2 A;  3EO3 A;  4K43 A;  4B1W B;  4JYA K;  1YTA A;  4WQ4 A;  3H46 O;  3FZF A;  1TYQ B;  4GV9 A;  1JCE A;  1OH7 A;  1XC3 A;  4CF9 A;  4FM1 A;  4BRI A;  4OX9 K;  4JI2 K;  4YOY A;  5J2N A;  4JI4 K;  4FYD A;  4X64 K;  3QLH A;  3QDK A;  3TU5 A;  5CY4 A;  1E4F T;  1Q9Y A;  3FLC O;  2I5J A;  1NMD A;  3WNF A;  3WXI A;  4TSX A;  1W7A A;  3IFR A;  2G8K A;  1ZBU A;  4B9U A;  3PIO L;  3IDH A;  4FOI A;  1IH7 A;  4RG8 A;  4F3T A;  2O8F B;  4JRQ A;  4CHN A;  2D0O A;  2D0C A;  4GMJ B;  2YKM A;  2NRX A;  4DUZ K;  1QHT A;  3E1Y A;  4B3O A;  3RWU A;  3SQ0 A;  1NGJ A;  1C0F A;  5JVG L;  1D8Y A;  2G8W A;  2QKK A;  3ZSY A;  3FE1 A;  1LWF A;  3AAR A;  3DXK B;  5M1Q A;  4PA1 A;  1WBD A;  4CZG A;  4C8K A;  5C25 A;  5LJW A;  4WYB A;  1IKX A;  4B3S K;  1U04 A;  4DHY A;  1JKH A;  2VG5 A;  1IV0 A;  3O1B A;  4CGI A;  2UXB K;  3V9W A;  1N5Y A;  3QES A;  3VEO A;  1HMV A;  2FF3 B;  3ZSO A;  4BRP A;  3RMC A;  4FLU A;  1NJZ A;  4GV3 A;  3CCQ N;  4HHT A;  2Q2R A;  2QA4 N;  4R79 A;  2WFB A;  5FLX O;  3B6O A;  4YY3 K;  1L3T A;  1NK5 A;  1IJJ A;  5EOY A;  2ZE2 A;  3BZK A;  5JLF A;  1WAF A;  2QWR A;  1ASU A;  4KHW A;  3O08 A;  3QBX A;  2P9U B;  1JLE A;  3ULE B;  1VHX A;  1NNE A;  1RT4 A;  1UA1 A;  3CPE A;  3U4L A;  1KAY A;  4O0J A;  4H5T A;  4ILJ A;  1S22 A;  2RKI A;  2HNZ A;  4KI4 A;  2HOE A;  2DPN A;  5E41 A;  1T8E A;  4OPJ A;  3N4Q A;  1BI4 B;  4LSL A;  1HR0 K;  4FSV A;  4FW1 A;  4ID5 A;  1DTT A;  3OYJ A;  1S5J A;  3EKS A;  1XMO K;  4CED A;  4NLB A;  3EKU A;  4DWI A;  5DK5 A;  4M42 A;  4DSF A;  4JK8 A;  4F8R A;  1GLD G;  3AA4 A;  1D9D A;  4DUY K;  3KVG A;  3V9Z A;  4FXD A;  1SQK A;  3O5B A;  4CZF A;  5DM7 L;  1VQ4 N;  4CF2 A;  3SMS A;  4CJ7 A;  4I9Q A;  1KVB A;  4H0X B;  3OYI A;  5IT9 O;  3MXM A;  3SJJ A;  5KQ8 A;  3ISN C;  2X6S A;  2W6K A;  2XRI A;  3TTF A;  5AQS A;  1WN7 A;  3DRR A;  4EFH A;  2O8B A;  4NCB A;  2IS3 A;  2NRV A;  3ZX3 A;  4WFB L;  3S3N A;  4CJW A;  3RRH A;  1TK0 A;  2QKB A;  4CK2 A;  1BHL A;  3HM8 A;  4WE1 A;  3BUZ B;  4MDB A;  2KLA A;  4JK7 A;  1MA9 B;  4RCH A;  4Z4E A;  4IG0 A;  1S1X A;  3THX B;  2V52 B;  5FRO A;  3CJ9 A;  3I0R A;  2YNG A;  3NF9 A;  4DR2 K;  2HHV A;  4OPA A;  4ISF A;  3CCV N;  1VQO N;  3NF6 A;  1J53 A;  1GLB G;  3HVR A;  3UKR A;  1J5E K;  3AVJ A;  4H4O A;  3QET A;  3C6U A;  1VQ5 N;  1FJG K;  1TAQ A;  3M8P A;  3AVM A;  4CJT A;  5I9E B;  3K0S A;  4ELT A;  3HK2 A;  3IUC A;  4FWK A;  1BIU A;  3HXM A;  1S9G A;  3AVG A;  4CF8 A;  4KO0 A;  3H1V X;  3IG1 A;  1K73 O;  4AHV A;  4FJ7 A;  3LDS A;  1K8A O;  1JL1 A;  3DLB A;  3JXU A;  3VEZ A;  3E9P A;  4CIG A;  2P9N B;  4M7X A;  1MWM A;  5KQD A;  4DTO A;  3GG4 A;  1OVY A;  1A5V A;  1HJO A;  2Q36 A;  1DT9 A;  3O9T A;  1Q81 O;  3BZC A;  4NLC A;  3OTO K;  4IFY A;  1EKE A;  4WQ4 C;  5J2Q A;  1VQ9 N;  4H0O A;  1NJI O;  1HYV A;  2UXC K;  2FLO A;  2O8F A;  3LP2 A;  1NK9 A;  4X62 K;  3SUP A;  1G99 A;  4EAH D;  5BPL A;  3HZ6 A;  3P83 D;  4QAG A;  3L2V A;  3PO4 A;  3J80 O;  4G9Z A;  1HYS A;  3VQD A;  3AA2 A;  3Q7C A;  5C15 A;  3MX5 A;  3I55 N;  3H45 C;  3VQB A;  1NGI A;  1ATS A;  3SK3 A;  1J54 A;  2O4G A;  5AQZ A;  2CGL A;  3TAM A;  3DXK A;  1SKW A;  5AQG A;  3LWL A;  3IAY A;  3O3H A;  3E66 A;  3KLI A;  4BAC A;  2ZJQ L;  3K5N A;  5E26 A;  2YX6 A;  3FZH A;  4FJG A;  4AM6 A;  3U9D A;  5JS1 A;  4CGF A;  3OBW A;  3R1X A;  3CJ1 A;  3LP0 A;  4FO0 A;  3VN5 A;  4BRF A;  1QTM A;  3L4Q A;  4XEI A;  3HI0 A;  1KAZ A;  1ZBF A;  4CER A;  1IKY A;  2FSK A;  2DFH A;  3EYZ A;  1BO5 O;  2Y1J A;  1BQM A;  3QIO A;  4B9L A;  3OYB A;  4E7K A;  1WLJ A;  4FWM A;  4CEZ A;  3HPO A;  3TR8 A;  1XI1 A;  5AQV A;  1TKZ A;  2P9U A;  4JKB A;  3ULE A;  2V51 B;  3V9X A;  4DU3 A;  3VEN A;  4F2R A;  1RBU A;  4E7J A;  1KXP A;  4Z0U A;  3QER A;  1IBL K;  4FJ8 A;  1HRH A;  1NK0 A;  4FJI A;  4OKK A;  2KFN A;  3K59 A;  1CXQ A;  2XY5 A;  4W5T A;  4HUG A;  4DTS A;  2E4L A;  3TPQ A;  2YNF A;  5F0X A;  1T44 A;  1BI4 A;  2VCP A;  4OPH A;  4JI7 K;  2P9L B;  2BAN A;  1WNS A;  1Z26 A;  4U67 L;  3KK1 A;  4JI0 K;  3M8Q A;  3C6T A;  2XY6 A;  3PSI A;  1ESV A;  3H3N O;  1KC8 O;  1VSF A;  1K9M O;  3PX4 A;  1KLM A;  2QWN A;  4C8M A;  4F4K A;  4DLE A;  1W0H A;  4NB4 A;  4JS4 A;  3M1F A;  1HLU A;  4BRA A;  4BRC A;  5C0Y A;  3CCE N;  2HHH K;  4KB1 A;  5AQL A;  1RIL A;  4CHO A;  2GBZ A;  1EXQ A;  3C0B A;  4W5R A;  4B8C A;  4M41 A;  4CIF A;  1RTJ A;  2YHY A;  1T7P A;  3E9L A;  4PWD A;  3WXK A;  3AA3 A;  1BCO A;  4O55 A;  4CK1 A;  3PO5 A;  4B3R K;  3HPH A;  3NGY A;  1N6Q A;  3ZT3 A;  3THX A;  3QEP A;  3F9M A;  2QXF A;  3CI5 A;  3BGR A;  1TAU A;  3VEX A;  1GLL O;  4CEE A;  3O6W A;  3NFA A;  1YT3 A;  3VOV A;  2EHG A;  3ZLJ A;  2BTF A;  3LL3 A;  4H5N A;  4B1Z A;  2WON A;  1U45 A;  2QW9 A;  1EO1 A;  2QWL A;  5JIC A;  3KLE A;  1YI2 N;  2G8U A;  3LM9 A;  3V1O A;  4YOV A;  4FJX A;  4LH4 A;  2GWJ A;  5AQW A;  3A5N C;  2GX9 A;  1D9F A;  3F73 A;  1FK9 A;  4DFM A;  2P9N A;  2GUI A;  4KHU A;  4CGD A;  5AQR A;  3C7N A;  3OYM A;  4DV3 K;  4O5B A;  1S1W A;  4OKJ A;  3OS0 A;  3DLR A;  4BE0 A;  3G10 A;  2WC9 A;  1EET A;  4CFC A;  4DSE A;  5CYM A;  4IO8 A;  3RMB A;  4DR6 K;  1HKG A;  2A5X A;  4DF8 A;  2VGN A;  1EP4 A;  3DAW A;  2OYQ A;  1TVR A;  5D3G A;  4JKG B;  3QIN A;  4JI1 K;  3DOL A;  4YOU A;  1JLB A;  4H0Y B;  1YJN N;  1GLE G;  3U3G A;  2GEM A;  1DKG D;  4AHU A;  3QBW A;  3HST B;  1VSD A;  5BRH A;  4I9L A;  1RT6 A;  3NDK A;  1U2V B;  4XIU A;  1NJY A;  2VWJ A;  3AVH A;  4B1Y B;  5H1S Q;  3T1A A;  4WF9 L;  5JVH L;  3B6P A;  4DQQ A;  4EP4 A;  5F2R A;  3D6R A;  5I42 A;  5AQI A;  3BP8 A;  4CF1 A;  2XY7 A;  4CCH A;  5C2D A;  4E3S A;  3U8X A;  1HPZ A;  2O8C B;  4IOX A;  4KRE A;  1QZ6 A;  1WAJ A;  4KAZ A;  1TGO A;  4I2P A;  3VA0 A;  2Y1I A;  5AQN A;  1VQN N;  3GBT A;  2P9S B;  1NG9 A;  2O8D B;  2HBM A;  3DYA A;  4E1M A;  3RMA A;  3TWH A;  4K8Z A;  4OO1 J;  3VF6 A;  2Q0R A;  2ETJ A;  4BC4 A;  4Z4F A;  2Q3S A;  5AJ3 K;  4A5B A;  2HF3 A;  4BE1 A;  5HP1 A;  4C8O A;  2FF6 A;  3NVM A;  4CEB A;  4M3Y A;  1Z25 A;  1YAG A;  4FJK A;  5FPN A;  2F96 A;  3MN9 A;  1MU2 A;  1HNV A;  2HF4 A;  3NCI A;  4PUO A;  2KQ2 A;  4YOT A;  4C1N I;  4DFK A;  4BRO A;  4FVM A;  2GWK A;  4FPB A;  3CD6 N;  1BDG A;  4OPK A;  4M3T A;  3PY8 A;  1NU0 A;  4BDP A;  3VES A;  2GTD A;  3LWM A;  3A5M C;  4GKJ K;  1RT2 A;  1UA0 A;  5M1O A;  4JLH A;  4BQL A;  4WQ5 A;  2AA4 A;  2W41 A;  2HVH A;  2P9L A;  2BDP A;  2OTL N;  5AR0 A;  4B9N A;  2RE2 A;  3RVC A;  4K0K K;  1KVC A;  4PY5 A;  4FWR A;  4KH5 A;  3MAQ A;  4CJV A;  4R5P A;  1V4T A;  1E4G T;  4JKE A;  4BVP A;  1YJW N;  1CZA N;  4KH4 A;  5KPR A;  5AQM A;  5HOO A;  2IDO A;  3HPG A;  1V4S A;  4KTQ A;  3O9U A;  4IJN A;  4EP5 A;  4FLZ A;  2FBV A;  5C12 A;  1O1W A;  5HRP A;  1YUW A;  5AQF A;  3R9P A;  4KHS A;  1K8K B;  1M1K O;  4M7Y A;  2NRZ A;  3QO9 A;  4BC5 A;  4DFP A;  3MK6 A;  1ASV A;  5FPD A;  4LH5 A;  2PYL A;  2P1J A;  1BQN A;  4PKH A;  1S72 N;  4JKD A;  1C0G A;  4LSN A;  1HYZ A;  3CQ8 A;  3BEX A;  4CBX A;  4DSI A;  4DSK A;  3CCU N;  5A2Q O;  1VQ6 N;  1MDU B;  1UWB A;  2HST A;  1VSH A;  5EXW A;  3U9Z A;  3RR7 A;  2PAV A;  3P4I A;  4N76 A;  4AF1 A;  3AVI A;  1C0U A;  1J5O A;  5EU7 A;  3NF7 A;  2E2Q A;  1TUY A;  2OZS A;  3L2R A;  3HL8 A;  4ISG A;  1HNZ K;  2R7Y A;  4JKA A;  4DTX A;  4EHT A;  1R0A A;  1D4X A;  3EEQ A;  1BOT O;  3LP3 A;  1IBK K;  3AO5 A;  4CZL A;  1T03 A;  1GLF O;  1DGK N;  4DTM A;  3EY1 A;  5GAH P;  1W2B M;  4YHH K;  4ZHR A;  4B9V A;  4RWT A;  2Z1G A;  4BWM A;  3CCS N;  3THV A;  1YJ9 N;  1MWK A;  3L8B A;  3JYT A;  2P9I B;  1VQP N;  3KIO A;  3L0Q A;  2E5L K;  3T1H K;  2D0A A;  1HJR A;  2YJF A;  5HRR A;  1BG3 A;  3EE9 A;  3MEG A;  4LF4 K;  1W97 L;  4XH4 A;  3BF3 A;  5AQP A;  4DR5 K;  5FRN A;  3LDP A;  4CGH A;  3WXJ A;  3T1Y K;  4JKG A;  3J81 O;  2G8V A;  2E1Y A;  3A5L C;  3HBT A;  4KHP K;  4DF4 A;  3ENO A;  3AVF A;  4IDK A;  3ZYY X;  1U2V A;  2BH1 A;  1SL1 A;  3A0I X;  2W40 A;  2YHX A;  4IBN A;  1YTU A;  1U6Z A;  3A8Y A;  1VQ7 N;  4KI6 A;  5KPZ A;  3SV3 A;  4DTR A;  2YNI A;  4CGG A;  4BR0 A;  1YHQ N;  3ASM A;  4LC9 B;  1NGC A;  1ASW A;  3CQY A;  2YV0 X;  4FWO A;  3HP6 A;  3O8M A;  2X6N A;  4CW7 B;  2O8C A;  1BU6 O;  1VRT A;  2D1K A;  2VWK A;  3T69 A;  5HL7 L;  1JCG A;  2OPP A;  3DRS A;  2QWO A;  1QE1 A;  3V1R A;  5ADX H;  3J7Y P;  4DQ8 A;  4ISE A;  3G0Z A;  1TKT A;  2P9S A;  3OYH A;  3V1Q A;  2O8D A;  1QSS A;  2E88 A;  4ICL A;  2F9W A;  3NBP A;  3ZSR A;  2DFE A;  4L8R B;  3MWP A;  2VGM A;  3OYG A;  3VQ6 A;  4B08 A;  1BWF O;  1A5W A;  1Y64 A;  1C1B A;  1QSY A;  1KAX A;  3DOK A;  1YVU A;  3AVB A;  3KK2 A;  3RRG A;  5KRT A;  4PHT X;  1Q9X A;  2UUB K;  4WCE L;  2VQF K;  4FLW A;  5HBM A;  4BGB A;  3SNN A;  3OVN A;  4JS5 A;  4CF0 A;  2PFU A;  5AQJ A;  5J1E A;  5CHI A;  3KTQ A;  4OGE A;  2RHK A;  3V6D A;  5SWM A;  3T7Z A;  1IG8 A;  4MO4 A;  2I7N A;  4RW9 A;  5AZJ B;  3IKM A;  4LF7 K;  3W3D A;  3CC2 N;  4B1U B;  5HLF A;  4C8N A;  3Q7B A;  4CVN E;  3AVA A;  3ZSV A;  3CMA N;  4HVJ A;  1JL2 A;  2O8E B;  3HOS A;  3ZT1 A;  3FZK A;  1RTD A;  2A6A A;  3GOI A;  1ATR A;  1RDA A;  3CFP A;  2V7Z A;  1NOZ A;  1KQS M;  4KHN A;  2D5R A;  3QNO A;  1WBB A;  3NVK A;  1WUA A;  1TV6 A;  5AFU H;  4JD2 B;  4DV6 K;  1JJ2 M;  4CZE A;  3CF5 L;  4FWS A;  4RW8 A;  4JNE A;  3L2U A;  1O13 A;  1CLQ A;  5AZI B;  3VTH A;  3MN7 A;  4KTZ A;  2IVN A;  4CFA A;  4BRQ A;  1NGB A;  4XH1 A;  4WQ5 C;  1S3X A;  2HHW A;  1WSI A;  4H5W A;  5JLH A;  1VSL A;  3SI6 A;  1K8K A;  4E7L A;  3VQ4 A;  1RDW X;  5B8H A;  4B1X B;  2CH6 A;  1N32 K;  4H5R A;  3UIQ A;  3FZM A;  4DQI A;  1WSG A;  5BPN A;  4FJM A;  1GOC A;  2OZM A;  3VGL A;  3NMU A;  3C7N B;  5KGW A;  4ELV A;  3OS2 A;  2BGG A;  4O5F A;  3HSC A;  3UE5 A;  1IBM K;  2HHQ A;  4KTW A;  4LF5 K;  1X9J A;  1RT1 A;  3L6Q A;  3KK3 A;  3D2E B;  3CCL N;  1EWQ A;  1NKC A;  4FK0 A;  1QSL A;  4QS8 A; 
#chains in the Genus database with same CATH homology
 3NGY A;  3ZT3 A;  3KD1 E;  3SYZ A;  3RR8 A;  1TKX A;  3QEP A;  4AHS A;  2PY5 A;  4KHY A;  2QXF A;  2KTQ A;  1KFD A;  3BGR A;  1TAU A;  1ITG A;  3FFI A;  2JGU A;  3T3F A;  1JLQ A;  2E6L A;  4CEE A;  5KGX A;  4BWJ A;  3NE6 A;  3NFA A;  4NYN A;  1YT3 A;  1WSH A;  4KFB A;  2XHB A;  2EHG A;  3OYA A;  1WSJ A;  4B9M A;  3QEV A;  4HUF A;  2YNH A;  3C95 A;  3OS1 A;  4ELU A;  4FJN A;  1Q8I A;  3RMD A;  1KTQ A;  4M3Z A;  1KFS A;  2PYJ A;  3OY9 A;  2XY8 A;  4Z4C A;  1C6V A;  2HNY A;  2WON A;  1HQE A;  3MEE A;  3OYF A;  1VSE A;  3CM6 A;  4FM2 A;  3TAB A;  1U45 A;  4GVM A;  2P51 A;  1JLG A;  3K58 A;  2DFF A;  4OVL A;  4RW4 A;  3IRX A;  1SV5 A;  1UAX A;  3C94 A;  3NH1 A;  3KLE A;  2XO7 A;  3V1O A;  3LAN A;  3HT3 A;  3ZT2 A;  3NHG A;  4RW7 A;  2G8U A;  4FJX A;  4LH4 A;  1NK4 A;  4CHZ A;  4M3W A;  2OPR A;  4Q5V A;  1D9F A;  3F73 A;  4CJ5 A;  4ZTF A;  3AO1 A;  1FK9 A;  1RTH A;  3DLG A;  4DFM A;  4FJJ A;  1CZ9 A;  1CXU A;  2GUI A;  1RDC A;  4CGD A;  4N5S A;  3OJU A;  4KHU A;  2JLE A;  4DQS A;  2G8H A;  4NCA A;  3OYM A;  4DTU A;  4O5B A;  1S1W A;  1RCH A;  4M3U A;  1GOB A;  1CZB A;  2VG7 A;  4OKJ A;  3OS0 A;  3DLR A;  1S9E A;  1SL0 A;  4BE0 A;  3G10 A;  3KKS A;  1EET A;  4CFC A;  5FDL A;  5CYM A;  1RDB A;  3VQA A;  4DSE A;  3RMB A;  1XC9 A;  4ZTJ A;  5CZ2 A;  4OLB A;  4HTU A;  4DF8 A;  1IO2 A;  2KZZ A;  4C8L A;  1EP4 A;  1YTA A;  4FW2 A;  2OYQ A;  4HCB A;  1TVR A;  4J2B A;  5D3G A;  3QIN A;  4OLA A;  1Y97 A;  3AO4 A;  3DOL A;  1JLB A;  1RDD A;  1X9S A;  4FK2 A;  3U3G A;  5C24 A;  3ZSX A;  4CF9 A;  5JS2 A;  4AHU A;  4FM1 A;  4FZZ A;  3OYL A;  3HST B;  1VSD A;  4I9L A;  1RT6 A;  3NDK A;  3DMJ A;  4XIU A;  5J2N A;  4NCG A;  1NJY A;  4FYD A;  2VWJ A;  3AVH A;  3QLH A;  1NK8 A;  4HCC A;  3L3V A;  4FLY A;  2G8F A;  4YNQ A;  4E0D A;  4FJ5 A;  3QEW A;  5CY4 A;  3T1A A;  4CFB A;  4NYF A;  1Q9Y A;  3B6P A;  4DQQ A;  1KLN A;  4EP4 A;  2I5J A;  4F3O A;  3WNF A;  3U3Y A;  3CFO A;  5I42 A;  3VQC A;  4CF1 A;  4DG1 A;  4TSX A;  2XY7 A;  3ZSQ A;  4CCH A;  4FJ9 A;  4CJE A;  4FCY A;  1ZBU A;  5CZ1 A;  4E3S A;  2G8K A;  1WSF A;  4B9U A;  1HPZ A;  2G8I A;  2KZM A;  1U47 A;  3V9S A;  1IH7 A;  4RG8 A;  2F8S A;  4F3T A;  4KRE A;  4CJS A;  1WAJ A;  3ZSW A;  4CHN A;  4JRQ A;  4KAZ A;  2D0C A;  1TGO A;  4UQG A;  3AVL A;  4AHC A;  4I2P A;  3VA0 A;  4FJH A;  4GMJ B;  2HHU A;  2YKM A;  1QS4 A;  2Y1I A;  1QHT A;  4B3O A;  3ZT0 A;  3V9U A;  3RWU A;  4J2E A;  4W5N A;  3SQ0 A;  1TK8 A;  4DSI A;  1VSJ A;  4DU1 A;  3DYA A;  1GOA A;  4E1M A;  3RMA A;  3TWH A;  4K8Z A;  1U48 A;  3M8R A;  1D8Y A;  1REV A;  2G8W A;  2QKK A;  3ZSY A;  2B4J A;  2ETJ A;  3VQ8 A;  1LWF A;  3NAE A;  4Z4F A;  2Q3S A;  2F8T A;  2OPQ A;  3SQ4 A;  3MXJ A;  4PA1 A;  4BDZ A;  4BE1 A;  4K8X A;  3LP1 A;  4FZX C;  5HP1 A;  4C8O A;  2FBY A;  3OYN A;  4C8K A;  5C25 A;  2HW3 A;  4CEB A;  3A2F A;  4M3Y A;  4O4G A;  4CGJ A;  1KSP A;  1IKX A;  4DTP A;  1U04 A;  4HUE A;  4G1Q A;  1Z25 A;  1JKH A;  2VG5 A;  4Y1D A;  4CEO A;  2B6A A;  4DQR A;  3OYD A;  2IOC A;  3AVK A;  3LAM A;  4FJK A;  2F96 A;  4CGI A;  2ATQ A;  4M3R A;  3PX0 A;  1MU2 A;  1HNV A;  3NCI A;  3SUO A;  3V9W A;  1N5Y A;  3QES A;  2KQ2 A;  4B9S A;  1WSE A;  2HB5 A;  2ZD1 A;  1T05 A;  4PUO A;  4DFK A;  2PZS A;  4ID1 A;  3SQ1 A;  1I39 A;  3HP9 A;  4AHR A;  4FVM A;  1IKV A;  1HMV A;  5HRS A;  1TKD A;  1NKB A;  2OA8 A;  4OPK A;  1U49 A;  3PY8 A;  1B9D A;  4M3T A;  4PQU A;  3ZSO A;  4CJL A;  2IC3 A;  4BDP A;  4E19 A;  3RMC A;  4FLU A;  1SL2 A;  1S6P A;  1BGX T;  1FKO A;  3LWM A;  1NJZ A;  3EZ5 A;  4HHT A;  2ZQB A;  4MFB A;  4FK4 A;  3L2W A;  4CK3 A;  1RT2 A;  3B6O A;  1L3T A;  1NK5 A;  1UA0 A;  2ZE2 A;  1KRP A;  3MED A;  4JLH A;  1WAF A;  1ASU A;  1RT5 A;  4DQP A;  4KHW A;  3RTV A;  2HVH A;  2LSN A;  2BDP A;  1JLE A;  4B9N A;  4E89 A;  4OGC A;  3P1G A;  3E01 A;  1RT4 A;  2RN2 A;  1UA1 A;  3TAQ A;  3LAL A;  4FM0 A;  4O0J A;  4RW6 A;  1KVC A;  4CJU A;  4PY5 A;  3MAQ A;  1TK5 A;  4Z4G A;  1FXX A;  4CJV A;  1ZBH A;  2RKI A;  4CHQ A;  4R5P A;  2HNZ A;  4KI4 A;  3L3U A;  5E41 A;  5HRN A;  4DS4 A;  1T8E A;  4BDY A;  1FKP A;  5I3U A;  2HHT A;  2YKN A;  5DMR A;  3IS9 A;  1LW0 A;  4OPJ A;  1UOC A;  1BI4 B;  2IDO A;  3HPG A;  4KTQ A;  4LSL A;  4EP5 A;  3TAP A;  2HHS A;  4FLZ A;  4CHY A;  4ID5 A;  2FBV A;  4FW1 A;  1O1W A;  5HRP A;  4KHS A;  4OJR A;  1DTT A;  3OYJ A;  3SQ2 A;  1S5J A;  2GV9 A;  3T19 A;  4N56 A;  1ZBL A;  3AO2 A;  4CED A;  3QEI A;  3QO9 A;  4DFP A;  1U4B A;  5DK5 A;  4DWI A;  2HMI A;  4M42 A;  4DSF A;  2KW4 A;  3WNG A;  3ALY A;  3LAK A;  1KVA A;  1TL1 A;  4F8R A;  1ASV A;  2IGI A;  3AA4 A;  4H4M A;  1D9D A;  1VRU A;  1BL3 A;  4CJR A;  1C0T A;  1K6Y A;  2E6M A;  3V9Z A;  4LH5 A;  2PYL A;  4FXD A;  1L3U A;  2P1J A;  1BQN A;  2YHB A;  1RBV A;  5KI6 A;  3CQ8 A;  2RF2 A;  2WOM A;  1HYZ A;  2RPI A;  3LPT A;  4LSN A;  4CF2 A;  5SZT A;  4DSK A;  3K57 A;  1KVB A;  3OJS A;  1JXB A;  4I9Q A;  4Z4I A;  3OYI A;  1UWB A;  4YFU A;  1VSH A;  3RR7 A;  3AVN A;  1NK6 A;  3VA3 A;  3MXM A;  3SJJ A;  1NJX A;  4N76 A;  3AVI A;  2X74 A;  3ISN C;  2X6S A;  4GW6 A;  1C0U A;  2XRI A;  1J5O A;  4CEC A;  5EU7 A;  4F2S A;  1WN7 A;  3DRR A;  2Z1I A;  3NF7 A;  2KFZ A;  3WNE A;  3KLG A;  4DSJ A;  4NCB A;  2IS3 A;  2OZS A;  3L2R A;  3HL8 A;  3S3N A;  4CJW A;  2R7Y A;  3RRH A;  4BE2 A;  1TK0 A;  2QKB A;  4CK2 A;  1BHL A;  4DTX A;  4WE1 A;  3HYF A;  1R0A A;  3LP3 A;  4KKO A;  4Z4E A;  4IG0 A;  1BIZ A;  1S1X A;  1S6Q A;  3AO5 A;  3VQQ A;  1T03 A;  5FRO A;  1JLF A;  3I0R A;  5CYQ A;  3TAG A;  2YNG A;  3NF9 A;  4I2Q A;  4CIE A;  1QQC A;  2HHV A;  1LV5 A;  4DTM A;  3EY1 A;  4LY7 A;  3NF6 A;  2ITG A;  5T7B A;  3M8S A;  4ZHR A;  1J53 A;  4B9V A;  4DTJ A;  3TAE A;  1RT7 A;  2Z1G A;  4BWM A;  3V4I A;  3OYE A;  3HVR A;  3THV A;  1TL3 A;  3JSM A;  3L8B A;  3AVJ A;  4H4O A;  2A1S A;  3O3G A;  4H8K A;  3JYT A;  4AIL C;  3QET A;  3LZJ A;  3KKR A;  3C6U A;  1JLC A;  1TAQ A;  3M8P A;  3AVM A;  3KIO A;  4CJT A;  4FLX A;  4ELT A;  3HK2 A;  1NKE A;  4Q0B A;  2B5J A;  3S3O A;  1NK7 A;  1BIU A;  2D0A A;  1HJR A;  3VQE A;  2D0B A;  1RT3 A;  1S9G A;  4E1N A;  3HXM A;  2HVI A;  5HRR A;  3AVG A;  3D45 A;  4KO0 A;  4CF8 A;  4KB0 A;  3MEG A;  1LW2 A;  2FBX A;  2VG6 A;  2OPS A;  3IG1 A;  3AA5 X;  4QOZ B;  1NJW A;  4W5Q A;  3SPY A;  1SUQ A;  4AHV A;  4Y1C A;  4FJ7 A;  5FRN A;  3LDS A;  4CGH A;  1JL1 A;  3KD5 E;  2G8V A;  3DLB A;  4CIG A;  1VK0 A;  1VSI A;  3WNH A;  1S1T A;  2Z1H A;  4AH9 A;  4DS5 A;  3AVF A;  4DF4 A;  4IDK A;  1SKS A;  3CG7 A;  4DTO A;  1C1A A;  2FBT A;  3O3F A;  4CJF A;  3OYK A;  3I0S A;  4CJ3 A;  1A5V A;  2DY4 A;  3CFR A;  1SL1 A;  1F21 A;  1L5U A;  3O4N A;  4FLV A;  1X9M A;  3LZI A;  4IBN A;  1YTU A;  3HO1 A;  3DM2 A;  4KV8 A;  4KI6 A;  4EZ6 A;  3QNN A;  4FLT A;  3SV3 A;  1XHZ A;  4DTR A;  2YNI A;  4CGG A;  3ASM A;  1EKE A;  4IFY A;  3D0P A;  1ASW A;  2YV0 X;  3HP6 A;  5J2Q A;  4FZY A;  3SUN A;  4KHQ A;  2X6N A;  4OKE A;  5J2P A;  4CEQ A;  2P5O A;  1ZBI A;  1HYV A;  1VRT A;  3LP2 A;  2VWK A;  1NK9 A;  4W5O A;  3SUP A;  3KLH A;  1S1U A;  2OPP A;  5KRS A;  3DRS A;  3V1R A;  1QE1 A;  1EX4 A;  3DLE A;  3P83 D;  4QAG A;  3L2V A;  3PO4 A;  3G0Z A;  1RTI A;  1HYS A;  1TKT A;  4M45 A;  3SV4 A;  4CEA A;  4CFD A;  3OYH A;  3VQD A;  3S9H A;  3V1Q A;  3AA2 A;  1N6Q A;  1LAV A;  1L3S A;  5FRM A;  3P5J A;  1QSS A;  4KPY A;  3I8D A;  4ICL A;  2FC0 A;  3K5L A;  3NBP A;  4E7I A;  3ZSR A;  3S3M A;  3VQB A;  2DFE A;  4L8R B;  4J2A A;  3ITH A;  3OYG A;  3CM5 A;  1J54 A;  2O4G A;  3HVT A;  3TAM A;  1HQU A;  3VQ6 A;  4O0I A;  1SKW A;  3K5O A;  3LWL A;  4B08 A;  1LAW A;  3O3H A;  3KLI A;  1A5W A;  3TI0 A;  4DU4 A;  3IAY A;  1C1B A;  4BAC A;  1QSY A;  3DOK A;  3VQ5 A;  1YVU A;  3AVB A;  4J2D A;  3KK2 A;  4DLG A;  3RRG A;  5KRT A;  5K14 A;  1Q9X A;  2IAJ A;  3K5N A;  4B8A B;  1HNI A;  4IFV A;  4FLW A;  4DMN A;  3BDP A;  5HBM A;  3SNN A;  1RBR A;  3OVN A;  3L2Q A;  4JS5 A;  1XHX A;  4CF0 A;  3U6F A;  4FJG A;  5J1E A;  5JS1 A;  1JLA A;  4AHT A;  4CGF A;  3TAR A;  2A1R A;  3ULD A;  3KTQ A;  2HHX A;  4OGE A;  3LP0 A;  3V6D A;  1RNH A;  3AV9 A;  5SWM A;  3VN5 A;  1QTM A;  1A5X A;  2EX3 A;  4RW9 A;  3DI6 A;  4QCL A;  4CJP A;  3SUQ A;  5J2M A;  1ZBF A;  4CER A;  1IKY A;  3NF8 A;  3F9K A;  5HLF A;  2DFH A;  1C0M A;  4C8N A;  3EYZ A;  4N41 A;  3AVA A;  3ZSV A;  2Y1J A;  1BQM A;  1JL2 A;  4HVJ A;  3QIO A;  3ZT1 A;  1RTD A;  4CEF A;  4B9L A;  3NH2 A;  4DFJ A;  1DTQ A;  3VQP A;  3OYB A;  4E7K A;  1RDA A;  1WLJ A;  3CFP A;  4IG3 A;  3KLF A;  2NUB A;  3AO3 A;  4CEZ A;  1LWE A;  3TR8 A;  3HPO A;  1XI1 A;  1NOZ A;  1W9H A;  1B92 A;  1TKZ A;  2BE2 A;  2D5R A;  3QNO A;  4KHN A;  5HRO A;  2QK9 A;  3V9X A;  4DU3 A;  3OYC A;  1TV6 A;  4F2R A;  1RBS A;  1RBU A;  1VSK A;  4Z0U A;  4E7J A;  1B9F A;  3QER A;  1HRH A;  1SKR A;  4JRP A;  1NK0 A;  1JXE A;  4FJ8 A;  4M3X A;  4B9T A;  4FJI A;  4OKK A;  4DTN A;  3HM9 A;  4RW8 A;  3ZT4 A;  2KFN A;  2AJQ A;  2DTU A;  1C1C A;  3L2U A;  3K59 A;  1CXQ A;  2P5G A;  2XY5 A;  3ZCM A;  1CLQ A;  3VQ9 A;  1BIS A;  3HJF A;  3AVC A;  4W5T A;  4HUG A;  3KJV A;  4E7H A;  4DTS A;  2E4L A;  3K2P A;  3QEX A;  4MQ3 A;  1BCM A;  4KTZ A;  1VSM A;  2YNF A;  1BI4 A;  4CFA A;  4CE9 A;  2BAN A;  2HHW A;  1WSI A;  1WNS A;  1Z26 A;  4DSL A;  3LPU A;  1VSL A;  3SCX A;  3SI6 A;  4O44 A;  3SZ2 A;  4N47 A;  3KK1 A;  3ZSZ A;  3VQ4 A;  4E7L A;  3M8Q A;  4FJL A;  2Z1J A;  3C6T A;  3O4Q A;  2XY6 A;  4CES A;  1KCF A;  1VSF A;  3PX4 A;  4CJK A;  1KLM A;  4C8M A;  3MXI A;  4F4K A;  2O4I A;  1ZYQ A;  4CJ4 A;  4DLE A;  1NOY A;  4CJQ A;  3UIQ A;  1W0H A;  4IKF A;  4JS4 A;  4CHP A;  1J9A A;  3H08 A;  1IKW A;  1WSG A;  3K5M A;  5C42 A;  4DQI A;  4FJM A;  1LWC A;  1GOC A;  3PX6 A;  3DRP A;  2OZM A;  2X78 A;  3DLK A;  5KGW A;  4ELV A;  3OS2 A;  2BGG A;  3VQ7 A;  3TAF A;  1DLO A;  4KB1 A;  1X9W A;  2YHA A;  1RIL A;  4CHO A;  4I7F A;  1S1V A;  2GBZ A;  2HHQ A;  1EXQ A;  2W42 A;  3CYM A;  4KTW A;  4EZ9 A;  4W5R A;  4B8C A;  4M41 A;  4KRF A;  3NGZ A;  4CIF A;  4Z4H A;  1IG9 A;  1RTJ A;  3SPZ A;  1T7P A;  4LD0 A;  4PWD A;  1RT1 A;  3KK3 A;  3AA3 A;  3NGI A;  3TAN A;  3NH0 A;  1XWL A;  1BCO A;  4O55 A;  2HND A;  4CK1 A;  1L3V A;  3DLH A;  3MEC A;  1NKC A;  1D5A A;  1RBT A;  3V81 A;  1G15 A;  3PV8 A;  3PO5 A;  4FK0 A;  1QSL A;  3QIP A;  1X1P A;  3PUF A;  1I3A A;  5KTQ A;  3HPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...