3QO9A

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with tsao-t, a non-nucleoside rt inhibitor (nnrti)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
553
structure length
553
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAISQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ ribonuclease H
publication title Crystal Structure of tert-Butyldimethylsilyl-spiroaminooxathioledioxide-thymine (TSAO-T) in Complex with HIV-1 Reverse Transcriptase (RT) Redefines the Elastic Limits of the Non-nucleoside Inhibitor-Binding Pocket.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase, hydrolase/inhibitor
total genus 139
structure length 553
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3qo9A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qo9A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qo9A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qo9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3qo9A05
4CK2A 2Z1GA 1BQMB 3ZT0A 4NLVA 2G8IA 2EX3A 4OVLA 3TR8A 3OLBA 4CHPA 2OPPA 3RB4A 2I5JB 2DY4A 4DLEA 3FQLA 4CF2A 1WAJA 3PUFA 3S3MA 2RF2A 1UA1A 3V81B 4OGCA 4RW7A 1TKTA 3CDWA 4W5NA 3AA2A 4N76A 3KHLA 3HVAA 4KHRA 2D0CA 2VG6B 4MH8A 4FYDA 4XIUA 3BR9A 3V9WA 3BREA 3LP0A 1Z26A 1J54A 1JLEB 3OS2A 4KFBB 4Z0UA 4DU4A 4FJ9A 4CIFA 2OH2A 4IBNA 2ASLA 4JRPA 4NLYA 2PYLA 5KFTA 1QE1A 3HL8A 1CSJA 1SKWA 2E9TA 3QIPB 3BSCA 5SWMA 1ASUA 3VQ5A 1EP4B 4E1NA 3Q8RB 4FJ8A 5EWGA 1C0TB 3PW7A 4CJEA 3SQ1A 4ZPAA 2GBZA 4TY8B 5F8GA 4IH6A 3VQ7A 4H8KA 4RW4A 1Q9YA 1T3NA 4WE1A 1VK0A 1MU2B 5KFPA 2P1JA 4CEEA 4K8ZA 2ILZA 4YP3A 3M9OB 1RBSA 1WSFA 2XC9A 1YVFA 3KHGA 3IN5A 3A2FA 4C8NA 2UUWA 4QW9A 1SKSA 4BE0A 2R8IA 3KK1B 5L1LA 4TLRA 3H2LA 3LP1B 2P5GA 4K4SA 1S6QB 3QNNA 1RBTA 4LSNB 2Z1HA 3OLAA 4O55A 3VQBA 2ALZA 4DU3A 1SH3A 5C25A 3RAQA 5SZTA 3M8QA 3TARA 1C1AA 1NKEA 5KFEA 3NKYA 1RDAA 1LW0A 5HBMA 3AO4A 4I9QA 3RTVA 3OL7A 3KD5E 2FBYA 2ATLA 5KFVA 1XR7A 3I5CA 2WCXA 1NK0A 4ZPBA 1JLCA 1S1WA 3RMAA 2HNDB 2R7YA 1XC9A 5F8HA 3M8RA 3DDKA 2B43A 4MK9A 2XGQA 4K4YA 2F8SA 4CJTA 1RA7A 4IR9A 5KFIA 1LAWA 2IAJB 4CF1A 3OYCA 2YKNB 4JV1A 1X1PA 5J2NA 2HVHA 5K14A 1KRPA 3SYZA 1BCOA 4OPJA 3C6TA 4LSLA 4ZHRB 5DQIA 2WHOA 4NLOA 4CEAA 3EPIA 2IGIA 4NLUA 3MAQA 3DOKB 3G10A 3K57A 1ZTTA 4F3OA 2HB5A 4O4RA 3KLFA 2BQUA 2V4QA 3QGHA 4M3YA 1N4LA 5KG5A 3KK3B 4H4MB 2R2SA 2YNFA 5F9NA 4CGGA 2ASDA 2P51A 1HNIA 3M9MB 4CGFA 1IKVA 5EU7A 1B92A 4B9TA 3TI0A 4FJGA 4NLGA 4UQGA 4DU1A 4Z4FA 3QIOA 4K8XA 1XR5A 4NLWA 3AVGA 4F4ZA 4CFCA 3KJVA 1T8EA 4DS5A 4URSA 3NAEA 3DRRB 3DYAA 2HW3A 2HVIA 3OY9A 3AO1A 3V1RA 4E7IA 2IM2A 3ZCMA 4OLAA 4DQIA 4ED2A 3LWLA 5L1JA 4CFDA 5HRNA 1QTMA 1JXBA 3NFAA 5KFBA 3GIJA 1NNDA 3DMJA 1ASVA 4NRUA 5J1EA 3H40A 3RMBA 3BQ0A 2XO7A 1CXUA 2GUIA 3O4QA 5F8IA 4E89A 2D0AA 4CFAA 1S1TA 4TYBA 4J9RA 4BDYA 3WNHA 3KMQA 2I1RA 4Y2AA 4WYLA 1IKYA 5C5JA 1TL1A 1BHLA 1U47A 2C28A 4FLXA 4DSLA 5KT4A 1Q9XA 5HLFB 3VA0A 1S0OA 1TK0A 4I2PA 4PUOB 3NGYA 3PX6A 4ZP8A 4G3IA 1RDDA 3HJFA 4LH4A 1TP7A 3GYNA 3GQCA 4CHQA 4DL5A 3VQAA 1W9HA 1FKPA 3HPHA 4URGA 4QOZB 4KBIA 2R2RA 4GC7A 5J2PA 1TKXA 4DTMA 1JXLA 5KGXA 1FKOA 2HNZB 4FK0A 3DM2A 4NCGB 2W9AA 3G6YA 2VG5B 3DI6A 4DL6A 1S1XB 2DFEA 1J9AA 3ISND 4KHWA 4I9LA 2G8UA 5I42A 1RTJA 3OHBA 4FZXC 3QETA 2QE5A 4E3SA 5C42A 4GC6A 2DPJA 5EDWA 2BANA 3QEIA 1SL0A 1JX4A 3BSOA 4M42A 1GX5A 3NF9A 1DTTB 4KAZA 2WK4A 1WNSA 4Y34A 4YFUA 4O4GB 4CK1A 1TAUA 1YTAA 4ED1A 5KFZA 2OPQB 3K2PA 1GOBA 3QO9A 3QGIA 4MKBA 1C0UB 4RUCA 4FW2A 1C0MA 3I0SA 3NH1A 1WSGA 4MIAA 4FLTA 3NF8A 3MEGA 1ZYQA 3QESA 2HMIB 2W9BB 3RMDA 1RT3B 5DLGA 4EBEA 2OPRA 2WTFA 3ITHA 4BWJA 2CJQA 5JXSA 2RDJA 3OYHA 1J5OB 4ELUA 4EZ6A 4FJIA 3OS1A 1HPZB 3NH2A 3I0RA 1TQLA 1T03A 3KKSA 2W7PA 1O1WA 4Z4HA 4IRKA 5DQHA 2YNGB 4N56A 3E01B 1NK8A 3TAFA 3SPYA 5KG2A 2XI3A 1RT7B 2W9CB 3NF6A 2VA3A 4I2QA 2AJQA 1HARA 3K58A 1TK8A 1R0AA 3AVIA 3L3UA 5KG3A 1RTIA 2BRKA 3T5LA 1KVBA 1RT4A 4J9NA 4DL7A 2WOMA 3T5JA 4AHVA 4OKKA 1LWFB 4AHSA 4FJJA 1C1CB 4F4XA 4DSEA 4DFPA 1KVAA 1SL2A 3KHRA 4R8UA 1LWEB 1QAJA 4KREA 1BIZA 3TABA 1B9FA 3RB6A 3C94A 3G0ZA 4CJ3A 1KLMB 3PW2A 1RT3A 1JXEA 4J9LA 3KIOA 3KK2A 5FROA 1N6QB 2X78A 3V9ZA 2O4GA 1S9EB 2AGOA 4AH9A 4H4OB 4KB0A 4ED3A 2IS3A 4J9PA 4KV8A 3PZPA 1TK5A 3KLHA 4F4WA 2FBXA 3ISNC 3AVKA 3T1AA 1TV6B 4HUGA 3VQEA 4G1QA 4RNNA 3NAIA 3KLGA 3EY1A 2IJFA 3SJJA 2XY8A 4ICLB 3JSMA 4FLZA 5KFAA 4RNFA 3HP9A 3B6PA 5I3UB 1IKXB 3PW4A 1T94A 3VQSA 1FK9B 5KFDA 2PYJA 3CDEA 3CJ5A 3AA3A 5JS2A 2YHBA 5CYMA 4ZP7A 4ECXA 4CE9A 1JIHA 1SUQA 3L3VA 3NAHA 3H08A 4DMNA 1NKBA 1VRTB 3U3YA 4CJWA 3DLEB 4HTUA 4CGDA 2KFNA 4DFKA 2X6NA 5HROB 2E9RX 4CEFA 3DRPA 5DG8A 2HHWA 3RB0A 4ED7A 3SPZA 1RBVA 2Q3SA 4AHRA 4CFBA 1QAIA 3NH0A 2ZD1A 2OPPB 5EWEA 4ZTJA 4ELVA 1RNHA 2ZKUA 2RF2B 3S9HA 2R2TA 4RW7B 4WXWA 1TKTB 3H98A 4J2BA 4DLGA 4PQUB 3LAMA 1UOCA 4CJSA 1U48A 3MEEA 2UUTA 1LW2A 2BGGA 4FM1A 3ZSZA 3LP0B 2UVRA 1L3TA 3RWUA 3K5NA 3N6NA 4ZVFA 3LAKA 1RA6A 4DTJA 4F4YA 4IRCA 4XPCA 1NJYA 4DL4A 2Z1IA 5KFWA 1VSDA 1N56A 3AVCA 4NLQA 1VSLA 1QE1B 1WN7A 4QWBA 2YHAA 2OZSA 3QEWA 4U6PA 5HRRA 4FW1A 1CLQA 1K1QA 5F8JA 3GV8B 4KHMA 3VA3A 3L2VA 4MIBA 1JKHA 2YV0X 4RW4B 5KFQA 3D45A 4K4XA 3IRXA 4FJKA 5KT3A 4WE1B 4ECWA 3AA4A 3VQ8A 4IFYA 3OL9A 1XHZA 4ELTA 3OYBA 4DQRA 4FJXA 3LANA 2XI2A 3V1OA 4PQUA 1B9DA 4CIGA 4IDKA 2FJWA 2AGPA 4M3WA 4QWAA 3DOLA 2ZE2A 1UAXA 4R0EA 3D5MA 4EEYA 4I7FA 2KFZA 3CFPA 5KFLA 3PX0A 4FBTA 2W42A 2G8WA 4XO0A 3C6UA 1BISA 5C25B 4DTPA 4ZVGA 3HT3A 3M8QB 3IG1A 5F8LA 4J2EA 1JLQA 2O4IA 4YNQA 1LW0B 5HBMB 4NRTA 2KTQA 1CZBA 3NBPA 4CEBA 5CYQA 2AQ4A 1NHVA 1JLCB 4QW8A 3ALYA 2C22A 1S1WB 3SUOA 3OYIA 4Q0BA 2VWKA 3BJYA 1S48A 3MTKA 5J2NB 5K14B 3MR3A 4CJVA 4CJ5A 1L5UA 1Y97A 3C6TB 4LSLB 4J9OA 4F4KA 2XRIA 4X2BA 3AVMA 3KLEB 1C2PA 4ECUA 3M8SA 1NK7A 1DLOA 1VSIA 3CG7A 4K50A 3KLFB 2RDIA 3L8BA 3CM5A 1L3VA 3HP6A 1S10A 2JGUA 3D0PA 2PZSA 2A1RA 4JRQA 2YNFB 2XCAA 1HNIB 4CGHA 3RBDA 4KHUA 3RRGA 3NGDA 1IKVB 3CWJA 2D41A 1VSKA 3WNEA 3H4DA 1A5WA 4EYHB 2HHVA 3EYZA 4ECZA 3O3HA 3AVFA 4NCBA 4CEQA 4M45A 3LP2A 4MFBA 1A5VA 2QK9A 3KJVB 2QKBA 4O5BA 1ZBLA 3ASMA 3NCIA 3DYAB 4C8MA 3L2WA 3NGZA 3NF7A 5KGWA 1S97A 1NK6A 4Q8EA 3AVBA 2VWJA 1N48A 2G8KA 2IBKA 3MEDA 3KD1E 4IG0A 4CHYA 3I5AA 3C95A 3UPFA 4DFMA 4JLHA 3OYFA 1U09A 4ED6A 3KLEA 3H5YA 3CJ2A 3DMJB 3PR5B 5J1EB 4LQ9A 3UDLA 2V9WA 3RR8A 2RKIA 3G6XA 2DTUA 2G8FA 4CHOA 3Q8SB 1QS4A 1S1TB 3ZT1A 3QEXA 5J2MA 4RW6A 3OJUA 3GILA 3SNNA 2HHTA 2JEFA 4J2DA 2Z1JA 4KRFA 1L3UA 4O3PA 1IKYB 1TL1B 4B9SA 4KI4A 1ZBIA 4Q5VA 3KLVA 3TANA 1Q8IA 3K5OA 2W8KA 4WFZA 1QSSA 1JLGA 2JEGA 4TSXA 4I2PB 1RT6A 3FFIA 5KG7A 3AVHA 4DF4A 1HMVA 1W25A 3M8PA 1FKPB 4Y1DA 4Z4EA 3PJWA 5J2PB 1TKXB 4ECQA 1SV5A 4J9KA 4CEOA 2FVPA 1FKOB 4NLRA 1TKDA 4IR1A 5FDLA 4DSFA 3DM2B 4QAGA 1GOCA 3DI6B 4FZYA 1S6PA 4FJLA 5I42B 1RTJB 3OYDA 1RYSA 3JYTA 4NLXA 3OVNA 5C42B 2KW4A 4DTXA 4QWCA 4B9VA 4CCHA 2BANB 4CERA 3QEVA 1YT3A 4Y1CA 2FC0A 3NMAA 1SL1A 3KLIA 4WZQA 1EXQA 1IH7A 3OYEA 3VQ9A 3KTQA 4F2RA 3MXMA 1NK9A 4TQSA 1D5AA 4YMEA 4KE5A 1HRHA 2FBVA 4FLUA 1RT1A 3QO9B 3MR5A 1DTQA 4IFVA 2E6LA 4BE2A 3I0SB 5F8MA 1D9FA 3P5JA 4FJ5A 4J9SA 4FK4A 4RW8A 1RBRA 3MEGB 2QKKA 4FM0A 2WONA 2OPRB 3AVLA 4K4VA 5KFHA 3ITHB 3TVKA 3GIKA 5KG6A 3OYNA 1TKZA 1S9FA 2YNIA 1HQEA 1JLAA 5KFXA 1ASWA 3I0RB 1T03B 3VQ6A 4C8OA 1HQUA 3H5XA 3SUNA 1LAVA 4KKOA 1X9MA 1D0EA 4M94A 4HKQA 4N41A 4W5OA 4K4ZA 4ZPCA 1WLJA 1REVA 4I2QB 4XPEA 4IKFA 1R0AB 4YQWA 4FJ7A 1RTIB 4RNHA 1ITGA 4TY9A 1X9SA 4ED8A 4WZMA 1RT4B 3QZ8A 1N5YA 2GC8A 2FLLA 3PV8A 2WOMB 3DRSA 2F8TA 2GIRA 2YNHA 1VSJA 2RPIA 3VQDA 4CJQA 4R8UB 1VSHA 3QERA 1JL1A 4BWMA 3HSTB 4H54A 2V4RA 4L8RB 5DK5A 2BQ3A 4CF8A 2XWYA 3CVKA 1JL2A 1U49A 4BACA 2HHXA 4Y3CA 2D3UA 3KK2B 1WSJA 1RTDA 1YVUA 4HVJA 1J53A 4TXSA 4ECVA 2FLPA 4NLTA 4OJRA 3TWHA 3K5LA 3KMSA 3V9SA 3VQ4A 4KV8B 2J6SA 3ZSRA 2YKMA 3QGGA 5KFCA 3KLHB 1Z4UA 3CYMA 5C24A 4ZP9A 1Z25A 2ILYA 3MECA 4OPKA 4ZMMA 3O4NA 1RT5A 2VG7A 4G1QB 3KLGB 2G8VA 2B5JB 2V0NA 3PX4A 2OPSA 3DLKB 3JSMB 2GIQA 4IQXA 5KFRA 3ZSQA 4ECYA 2A1SA 2LSNA 5DMRA 3LWMA 3G86A 1S9GA 3PR4A 3V1QA 3VQCA 3BGRA 4DSJA 1EKEA 3HHKA 1WAFA 3AO3A 3IS9A 5CYMB 4KO0B 1SUQB 4M3RA 2XY6A 1KHVA 3MFHA 4DQSA 3V4IA 2WB4A 3K59A 4EO6A 5F8NA 2IMWP 3V6DA 1KTQA 3PHEA 2E4LA 2Y1IA 3NDKA 3PO4A 1UWBA 2B6AA 4KTZA 1SH0A 4GVMA 4DS4A 3CIZA 1D8YA 2IC3A 3DRPB 3BSAA 2RN2A 1LWCA 4EBCA 2B4JA 1S0MA 2ZD1B 3DLGA 1L3SA 3SQ4A 3QLHA 3H5UA 4FCYA 2IJNA 1NK4A 2B5JA 3RR7A 4B3OA 5CZ1A 2IM1A 4OGEA 1F21A 3DLKA 2XCPA 3F73A 4AHUA 3Q8PB 4ED0A 4W5QA 4IH7A 2FVSA 4E7JA 3V6HA 4CESA 2JLEA 4DG1A 3OYLA 1VRUA 1D9DA 3CFRA 2BE2A 2AX0A 1CZ9A 1BQNA 3O3GA 3BQ2A 3DLHA 3MEEB 5JS1A 1LW2B 5KG4A 4QPXA 5KFUA 4E0DA 1KSPA 5J2QA 3BQ1A 4KO0A 4Z4IA 4IG3A 3H4BA 1HYSA 4MK7A 4AHTA 1D1UA 3MXJA 4K4WA 4B9NA 3LP3A 1JLBA 3T3FA 5CZ2A 3ZSVA 3HVTA 5KRTA 5KFKA 4DQQA 3SZ2A 4AILC 3SCXA 2HNYA 3PO5A 3MR6A 3OYAA 4PY5A 1JKHB 4O44A 1NKCA 1YTUA 1KVCA 3IRXB 3SFUA 4CGIA 4IFYB 4R5PA 3LPTA 1RTHA 4U7CA 4HCCA 4LH5A 1S5JA 1HNVA 4RW9A 4KAIA 4HCBA 1XI1A 4IDKB 2BRLA 1QHTA 3EPGA 3DOLB 2ZE2B 4DWIA 4NYNA 2R8JA 1ZBUA 4ID1A 3MF5A 1S1VA 4Q45A 4GW6A 1VSFA 3H5SA 2C2EA 5D3GA 1HYZA 1JLFA 4I7FB 1SKRA 2W7OA 1NOYA 2QV6A 5KFJA 4CECA 4ZVEA 3PW5A 1BI4A 3C6UB 3HXMA 4CIEA 3U6FA 4BE1A 1TGOA 4K4UA 3IG1B 4W5TA 1JLQB 2Y1JA 4ECRA 1TVRA 1TL3A 3NBPB 1ZETA 3AO2A 3O3FA 4FK2A 3VN5A 5CYQB 3CQ8A 4TN2A 4OL8A 4NYZA 4Q0BB 4QWEA 2UVUA 4GMJB 3QINA 1T05A 4MK8A 3OJSA 3ZT4A 2X74A 1C1BA 5DLFA 2NUBA 1EETA 4NLDA 4C8LA 2F8EX 4O3SA 3IAYA 1FXXA 3AA5X 3HYFA 4F3TA 3HPOA 4FVMA 4EBDA 2O5DA 2HHSA 1RT2A 1DLOB 4DL3A 3TAMA 4DSKA 3GIMA 5HP1A 2XY7A 2AU0A 5JUMA 3S3OA 1IKWA 4IKAA 3RBEA 3BSNA 4ECSA 4JS4A 1IG9A 4Q43A 2R8KA 3OS0A 4KI6A 4QWDA 3PW0A 4ID5A 3QZ7A 3FSIA 4RG8A 4PWDA 4CEZA 4FS2A 2J6TA 4ECTA 4YR2A 2D3ZA 3LP2B 4MFBB 1S1UA 4Z4CA 4C8KA 2KZMA 3ZSXA 4B8AB 1VSMA 4DEZA 4HHTA 1NK5A 5L9XA 3HM9A 2IDOA 4M95A 3E51A 3ICLA 1BQMA 1NJZA 3MEDB 4IG0B 2UVVA 4EZ9A 5HRSA 2EC0A 4RNMA 2I5JA 3KKRA 2XHBA 4O0IA 3AVAA 3RB3A 3V81A 2RKIB 3N6LA 2FLNA 3CJ3A 1NOZA 3TAEA 4E7KA 4B9UA 1K6YA 4E19A 5J2MB 4RW6B 2VG6A 3ULDA 3ZT2A 1S0NA 4FJHA 4NLSA 4K4TA 3P1GA 4RUAA 3QIDA 2PY5A 4URQU 1RDBA 4CK3A 5KT5A 1JLEA 4OKJA 4KFBA 4CJRA 4O0JA 1RDCA 1JLGB 4ZP6A 5DG7A 3H59A 1RAJA 2KQ2A 1BIUA 2W8LA 1RT6B 4NZ0A 3FFIB 5DGBA 3OYGA 4M3ZA 4ZPDA 3QIPA 3SI6A 4KB1A 3WNGA 1EX4A 1S49A 4FZZA 1EP4A 1HMVB 5T14A 2KZZA 2D0BA 3UIQA 3M8PB 1C0TA 3G6VA 2JC0A 3RMCA 1KFDA 3CDUA 4TY8A 3CFOA 2IOCA 4Y2CA 5FRMA 1WNEA 4WYWA 4CJ4A 1SV5B 4JS5A 1MU2A 5FDLB 2R8HA 4Z4GA 3OHAA 1QUVA 3V9UA 1SH2A 1VSEA 5DGAA 1S6PB 3HK2A 1OS5A 1S4FA 5FRNA 1BCMA 1QSLA 3LZJA 4EYIB 3SV4A 3RAXA 4KHNA 3KK1A 3JYTB 5T7BA 3LP1A 4CF0A 4PA1A 1S6QA 2XGPA 3V6JA 4LSNA 4FBUA 3KLIB 3MFIA 4OLBA 1IM4A 5KFOA 4IOBA 1ZTWA 4E1MA 4J9MA 1W0HA 4FLWA 2IM0A 2JEIA 4TQRA 4IH5A 1RT1B 1CXQA 3Q8QB 4LD0A 3VQQA 3OL6A 3CO9A 1DTQB 4IFVB 5KFYA 4MQ3A 4E7LA 4BDPA 2AX1A 4WXOA 4FLYA 2HWHA 3P83D 4B9LA 3HO1A 4F8RA 4E7HA 4RW8B 1QSYA 2HNDA 4CF9A 4YR3A 2D7SA 2WONB 3M9NB 1NJWA 3MR2A 5EUHA 2IAJA 2E6MA 2YKNA 3QEPA 3EZ5A 1IO2A 2FJVA 1TKZB 2YNIB 5KT7A 4ZHRA 1HQEB 4KHSA 1JLAB 3F9KA 3HKWA 3MXIA 1HQUB 4FM2A 4YR0A 3DOKA 1X9WA 4CJKA 4LY7A 3I8DA 4KKOB 3HPGA 3T5HA 2ASJA 1REVB 1XHXA 2BDPA 1MMLA 3KK3A 4H4MA 4CJLA 1TAQA 4NLPA 4WFYA 1BGXT 4JV0A 2EHGA 4DFJA 4O3RA 4EO8A 4M3UA 4CEDA 3DLBA 1N5YB 3PVXA 5KT2A 2OYQA 3AVNA 4HUEA 4CJPA 4BDZA 3DRSB 2YNHB 3SUPA 2X6SA 1RILA 2HAIA 3DRRA 3OYKA 3TAPA 4FJNA 2C2RA 1QQCA 3IGNA 5EWFA 2HHUA 2FJXA 2OA8A 2ETJA 4JUZA 4M41A 4O3NA 1RTDB 4ZTFA 4WFXA 1I39A 1RYRA 2G8HA 5KFMA 1I3AA 3UQSA 2YKMB 3D28A 5KRSA 5C24B 3MECB 3NGIA 4HYKA 1BL3A 3OYMA 4NYFA 1RT5B 2VG7B 4Q44A 2R8GA 4HUFA 1RDRA 3N6MA 3EZUA 3OL8A 2R2UA 4B9MA 4F2SA 2AGQA 4RNOA 2OPSB 3BDPA 3LALA 3RRHA 2JC1A 1S9GB 2FVCA 4B08A 3BGRB 1U45A 5HLFA 2FVRA 2ZQBA 3IS9B 1T7PA 4PUOA 3LPUA 2QXFA 3ZSYA 1KCFA 4KTWA 3V4IB 2IA6A 1U04A 3AO5A 4DL2A 4ZVHA 3V6DB 1UA0A 3T5KA 1KLNA 4IRDA 4NCAA 5KFGA 3L2RA 3SFGA 4RU9A 1UWBB 2B6AB 3NHGA 4CJFA 3KNAA 2OZMA 2HNZA 2IC3B 4CHNA 1LWCB 1U4BA 3SV3A 3DLGB 4NCGA 2VG5A 3QLHB 1S1XA 2XY5A 2CKWA 3HVRA 2FVQA 3AV9A 4B3OB 4OKEA 1LV5A 4KTQA 4F50A 1ZBHA 3CJ4A 4DG1B 4DQPA 1VRUB 3FQKA 5L1IA 4CGJA 2HHQA 2AWZA 4J9QA 2BE2B 3GV5B 1BQNB 3PJXA 1DTTA 5J2QB 3S3NA 1A5XA 1RCHA 4IG3B 2UVWA 4O4GA 3LDSA 1HYSB 4CHZA 2FBTA 3CJ0A 2OPQA 3SUQA 4DTNA 3WNFA 1C0UA 4FJMA 3I5BA 1G15A 4DTOA 3QNOA 1JLBB 4KPYA 1KFSA 3HVTB 2F96A 4AHCA 2E9ZA 3OSPA 1C6VA 3AVJA 4KB7A 2HMIA 2W9BA 3SQ0A 4N47A 2IM3A 4CJUA 4KHQA 4DTSA 2HNYB 5KG0A 4O44B 1J5OA 3L2UA 1HPZA 3KOAA 3TAQA 5KI6A 3HVWA 4R5PB 2WRMA 4JV2A 3TAGA 1RBUA 2J6UA 1RTHB 1GOAA 4J2AA 1HNVB 2YNGA 2P5OA 3E01A 4W5RA 4RW9B 3V9XA 3ZT3A 1WSHA 4MKAA 3FDSA 1RT7A 4B8CA 2W9CA 5E41A 2DFHA 2ATQA 4DTRA 3UR0A 1NJXA 1S1VB 5KTQA 4M3TA 3ZSWA 3IGVA 1I6JA 5D3GB 3VQPA 1JLFB 2HWIA 3QYYA 4O3QA 3CM6A 3SQ2A 1BI4B 4EP4A 4DSIA 3THVA 1LWFA 1C1CA 3K5MA 4FS1A 4FXDA 1GX6A 1LWEA 1TVRB 1TL3B 4LQ3A 5KFNA 1KLMA 3B6OA 1HJRA 3TQ1A 1N6QA 1NHUA 4Q8FA 4KHYA 3GV7B 3V6KA 1S9EA 4QCLA 1XWLA 5CY4A 1T05B 4H4OA 4TYAA 1WSIA 5KFSA 1ZBFA 5L1KA 1C1BB 5F9LA 3NE6A 1EETB 3T19A 3GIIA 3SI8A 4FLVA 1TV6A 5DQGA 3LZIA 5KFFA 1WSEA 2C2DA 2DPIA 4EP5A 3KHHA 1RT2B 3TAMB 1HYVA 4O3OA 4ICLA 2BR0A 2D5RA 3NL0A 2DFFA 5HP1B 3U3GA 5I3UA 1IKWB 1IKXA 3DLRA 1K1SA 5HRPA 2BQRA 1FK9A 4M3XA 3L2QA 4ID5B 5KG1A 2ITGA 5KT6A 4RZRA 1KHWA 2GV9A 4DF8A 4PWDB 4N5SA 3ZSOA 3OSNA 3PY8A 1VRTA 1XR6A 1S1UB 5DG9A 3DLEA 3OYJA 2VA2A 5HROA 4KSEB 2JEJA 4DTUA 3FRZA
chains in the Genus database with same CATH superfamily
4LFAK 2DR6A 1RCXB 3JTNA 3ELHA 3QBWA 3RB4A 3HF5A 2QRRA 1JCGA 2DY4A 1VQNN 3FQLA 4CF2A 3EEQA 2RF2A 3D6RA 1TKTA 1ATNA 3AA2A 1CQMA 4ZPVR 1ZM3A 4KHRA 4ALZA 4Z94A 2VG6B 4MH8A 1CC7A 2KL8A 1Q16B 3OFGA 3ZC4A 1Z26A 1SXLA 1WOSA 3NMRA 4DU4A 4KFBB 3PIOL 4M5GA 3WXIA 1R8CA 4PWUA 4JKHA 2VZ9A 4KGXB 3LW5C 1LFWA 1FX2A 2CDQA 1QE1A 1CSJA 3GG4A 4UZCA 1NO8A 3VQ5A 1EP4B 4EAHD 4CJEA 3DDIA 6FD1A 4ZPAA 1BQXA 4TY8B 2GBZA 3TTFA 5BRFA 5CA5A 1DQAA 1HA1A 1SC3B 3I32A 3UB5A 2MJUA 4K8ZA 4YP3A 4BVOA 4CDIA 3R5DA 1RBSA 3HMJG 2F5GA 2GHWA 3BDEA 2UUWA 2IJRA 3KDOA 4BE0A 2R8IA 5L1LA 1VI7A 3H2LA 4BBYA 1VLYA 3LP1B 2P5GA 2L9WA 2V6AA 2ALZA 1REGX 4DV2K 4WFAQ 1GNKA 2MKIA 3G2XA 3CD5A 2OJ3A 4M5MA 3M8QA 4CH1A 1NKEA 5KFEA 1CULB 2CNLB 1HLWA 3OBWA 2J7KA 4GKJJ 2RHQB 2QWLA 1OY8A 2K1RA 3A8KA 5AQZA 4QIEA 3I5CA 2UV8A 5KQ8A 1WI8A 3M8RA 4PKHA 4UUXA 2VQEF 1A7GE 1VQMS 2WUSA 4K5SA 4CF1A 3OYCA 5J2NA 2DISA 3S8SA 4TU9A 2VH7A 1KRPA 1GLFO 2QA1A 2GVZA 5M1OA 5HMWA 4NLUA 2W4CA 4CO3A 3A3OB 4BGAA 2XULA 4GRSA 1VQON 3UN2A 2UXCF 1GLCG 2CQ0A 4NOHA 3O9TA 1N4LA 1Y5NB 5CZXA 3KK3B 2UUBK 1Q82T 3CJ8A 3AGKA 1ZA1B 1RAEB 4B9TA 4LFCK 5A8KB 4K8XA 2KRRA 4NLWA 1HKGA 3AVGA 4DX5A 5H9EJ 4Y28C 1H6KX 4ES2A 1LNQA 4URSA 4B3RJ 3DRRB 3DYAA 2HVIA 2HBLA 3AO1A 3V1RA 5I9EB 4B1UB 4HWIA 1Z6RA 1NGFA 3ENAA 4LFBK 4JNEA 4WCEL 5AQHA 4X4NA 2NYIA 4JYAF 2DXFA 4HHJA 2MQLA 5KFBA 3GIJA 3DMJA 1ASVA 3H40A 3VGKA 2PEBA 3O4QA 2D0AA 3B8AX 3ID6A 3NOGA 2X3GA 2VU5A 3D0GE 4BDYA 3WNHA 3SSSA 3GJRB 2JZ5A 2I1RA 4Y2AA 4L76A 1U47A 1KVJA 2DNNA 3BP8A 2C28A 3KUGA 1N33J 1NG9A 4DSLA 2NS1B 2NR0A 1UJ4A 2RQCA 3VA0A 3UKUA 1TK0A 4I2PA 3CCMS 1MWZA 1KQSM 1RDDA 1V5VA 2V8PA 3TEHB 4JAXA 3HJFA 5IOLA 1E3MA 1HBNA 4K59A 3D4JA 2V2KA 2FHJA 1SJFA 1TKXA 1Z2LA 4KIAA 4CIOA 1JXLA 1X4HA 1FKOA 2OD4A 2VPXB 4DL6A 4F0KA 2G8UA 1U1RA 3TVZA 2QE5A 4E3SA 1U2CA 4GC6A 2CJYB 3QAEA 2V63A 4A57A 5IC6B 3BS9A 1VQNS 3AAWB 1T6CA 2LVWA 2A6AA 2YX1A 4DR3F 1FEEA 4KAZA 1RWUA 4Y34A 2QL7B 4RO0A 4H5NA 1TAUA 4CK1A 1SJ1A 3U1MA 3QGIA 3JAMU 1C0UB 4RUCA 3CT9A 4EWTA 1FJGJ 4C23A 1W2IA 4DZ6A 3T9NA 3GWCA 2CPIA 3P45B 1ZYQA 2HMIB 4EBEA 1LOUA 3VQTA 2CJQA 4J9VA 1GXLA 3OYHA 1SC6A 5M2PA 1HPZB 1ATSA 3ZEUA 3NH2A 1E6VA 2MXYA 4AL5A 4ERDA 2Q79A 4LR8A 2WB1D 2BA9A 3K2YA 2Q1LA 3C7NA 2JWLA 2NXUA 2GQ2A 4UY8T 4W4MA 5CH7B 5KG2A 3O08A 3UKRB 5L39A 4X65F 3TA1A 1RT7B 2LEPA 4J37A 2VONA 3BB5A 2GX9A 3MAHA 1TK8A 1A9NB 3C6HA 5AXMA 1ROFA 3RYLA 3UO0A 1UFKA 1UW9A 1RTIA 1WC6A 3R6GB 3AHPA 4WWSA 3MCAB 1PO6A 4XAKA 1FFSB 3TZXA 2Q36A 2BJ3A 4DL7A 2WOMA 2CQ3A 4AHVA 4OKKA 1R43A 4F4XA 4DFPA 5GAEP 3DGPB 4R8UA 1OQ6A 3C94A 5A8WA 4DOZA 4CJ3A 4JKBA 1JXEA 3KIOA 4J9LA 4ZN1A 2Q43A 3MCOA 3G82B 3WHIA 1N54B 2ZBIA 4AH9A 2P6SA 1I94F 1XUPO 3HZ6A 2OANA 4ED3A 3VENA 4JK9A 1TK5A 4BRDA 1YJNN 2Y3YA 3FZKA 4OYBA 3ISNC 3AVKA 3O6QA 3A8IA 3LGHA 4G1QA 3KLGA 4F0HA 4K5RA 1N36J 4JI4J 1VK3A 3F56A 2IJFA 1M5KC 4AQYF 2AEFA 2LEBA 3X3UA 5GAHP 1VMBA 2ZNZA 3HP9A 1T94A 2QJ3A 2PYJA 5JS2A 1KVKA 4A2AA 1VQOS 2E1ZA 2MZTA 1IBLJ 4ZP7A 4ECXA 4DKWA 1Y7PA 1JIHA 1SUQA 2MZSA 3L4QA 4A8YA 4DMNA 3OTOK 1NKBA 1NU4A 1VRTB 4CJWA 4HTUA 3NNHA 1KAXA 3ATUA 2KO1A 2CPDA 2DIVA 2OELA 5AZIB 4J5OA 1KAYA 2FZCB 4QZVB 5F41A 4LF9K 2KFYA 1RBVA 4AHRA 1FVQA 4CFBA 4HI1A 3GPAA 3OXFA 2OPPB 2NRWA 5EWEA 4DDFA 1TUUA 4ZTJA 3SXLA 3W2WB 3C16B 3S9HA 1NJIT 5C2GA 3H98A 5IM0B 2VGMA 3SEOA 2ASPA 1EB0A 3AA8A 3CD0A 3C46A 2XYPB 1UOCA 3UVJA 1JJ4A 5AQOA 1HI1A 4FM1A 2RS8A 1AFIA 2PA8D 3ZSZA 3LP0B 4JI7K 2UVRA 2XG8A 1L3TA 1BG3A 4F9OA 3K5NA 3N6NA 4L3KA 4ZVFA 1IV0A 3H3NO 4F4YA 1ZH5A 1WUUA 1VSDA 3KFWX 4M5IA 4QWBA 2YHAA 3K89A 4KGMA 4U6PA 4HH1A 3DU6A 3CC4N 1VBYA 2HS4A 5F8JA 3L2VA 3LGMA 1RHQB 3PXGa 4DX6A 1ZBTA 2YY3A 2YV0X 4RW4B 3D45A 4K4XA 2GAGC 4ZCIA 4WE1B 4WFAL 3T6BA 4ELTA 4YOTA 3OYBA 4FJXA 3V1OA 3GSDA 1ITPA 1Q5YA 4OZ2A 3MCSA 4MMOA 2Q1NA 3GDQA 2DNMA 1EHWA 3QFPA 1Y9OA 2AIRB 3ADAC 2COLA 1RAGB 5AXNA 3ENWA 3QWUA 2ZWPA 4FBTA 3NGKA 3W8PA 4DTPA 4K7QA 3ONQA 5HBMB 4KH4A 4NRTA 4FSVA 4DB3A 2Z2ZA 2KDOA 5LSRA 5BRDA 1HWUA 3DXKB 5CYQA 3H90A 2LYVA 2YI1A 3SUOA 2PI4A 4BG8A 1WKLA 1N0VC 4DR5F 4YOWA 3VZHA 2ZJQL 3VERA 4LRDA 1ULRA 2IMOA 4NMXA 3I9V9 3LF0A 4CJVA 3LPEA 1Y97A 4LSLB 2C2NA 3R8YA 2CGJA 3IMXA 1UJ6A 3KLEB 1MWMA 1VSIA 4H5VA 2YQ0A 3CG7A 3KLFB 3L8BA 2JFKA 5JLHA 1L3VA 4M5DB 2JGUA 2EKYA 2PZSA 3I87A 2A1RA 1FD2A 1MA9B 1EQMA 1VQYA 3CWJA 3TUPA 2IVNA 4JI8J 3EUNA 3HJVA 3ZZTA 4N8OA 4DV3J 2ASYA 2HHVA 3EYZA 4ECZA 3AVFA 4CEQA 4M45A 1CG2A 4FVUA 3LP2A 4MFBA 2QK9A 2QGFB 1HBMB 1ZBLA 3NCIA 3NGZA 3IAS9 3NF7A 5KGWA 5ADZA 3WC2A 1N48A 5LMNJ 4M5HA 3MEDA 4DPXA 3KD1E 4CHYA 1VC5A 5ETNA 4NPOA 2YWWA 4ED6A 3KLEA 5F0UA 2UU9K 3PR5B 3UDLA 2V9WA 4DR6K 1R27B 3ET6A 3THWB 2LCWA 2J0XA 3Q8SB 2G1HA 4L6V3 4CLKA 1ACMB 1N8RO 5IS2A 1A6LA 1YJNS 3GILA 2XS2A 2JEFA 4J2DA 1VGYA 4AXJA 4B9SA 1IWAA 2HIYA 4CI0B 4KI4A 1ZBIA 1GMUA 1OY9A 2DYAA 3F9MA 5D4NA 4WFZA 2AZ3A 1QVGR 1KDNA 2B51A 1HD0A 3MPVA 4CO2A 4DF4A 4BRCA 4AYBD 2KM8B 1FKPB 1UZDA 4DV4J 3WXMB 3OXLA 1SJ3P 1B3TA 5AQQA 5HATA 5J2PB 4J9KA 1TMMA 2HS0A 3V5RA 3JQKA 5B7WA 4FZYA 5BR9A 1S6PA 2J5AA 3OYDA 1RYSA 3AOCA 3PYGA 3OVNA 4B3TJ 4QIGA 3SIPB 4YHHJ 2P9SB 2V5HG 4ANDA 3O1WA 3W3SA 2JDJA 2BANB 1R0CB 4JI6F 1SL1A 1B7FA 3MN7A 4F2RA 3W5YA 4LRCA 3G6EN 2CRLA 1JB0C 4YMEA 1DFDA 1LFPA 4I56A 5MAOA 1V5IB 2YWHA 2EK6A 3MR5A 3D2WA 1DTQA 4IFVA 2C3OA 2WFBA 4PG8A 1N88A 1XMOJ 3E9LA 3MEGB 2E44A 3QRRA 2W4PA 3FFKB 3PM9A 1UEKA 3ITHB 3TVKA 3OYNA 1S9FA 1HQEA 1JLAA 5KFXA 1ASWA 2PC6A 3CC4S 3W9IA 3SUNA 4CYUA 4KKOA 4NI2B 1D0EA 2E7XA 1UVNA 1H1VA 4HKQA 2XZWA 3POTA 2V51B 4CBWA 3OV7A 5ETOA 1NH7A 4OYOA 2OI2A 3G8TA 3R9LA 4I2QB 2B7CB 4YQWA 4RNHA 2E1YA 2ADBA 3OD2A 2V8GA 3N79A 4OV1A 1VBXA 3FEYB 3IBCB 5GADI 4HDHA 4P2SA 2GIRA 4ETXA 4C8ZA 2V94A 4CJQA 2MLZA 3PJ9A 1S7HA 2BQ3A 4GKJF 1FA0A 3L7OA 4G9ZA 4BRGA 3MUVP 3HHLD 3KK2B 2ZNYA 3VF4A 1KD1O 3D6TB 4NLTA 1KP6A 3KMSA 4RL1A 3VQ4A 3GE1A 4KV8B 2RDDA 3CJKA 3PIPQ 3VAMA 4ZP9A 2ILYA 3G87A 2QC3A 2VG7A 4BROA 4FYYB 2B5JB 1PGZA 2V0NA 1NZAA 3MWTA 3PX4A 3H8YA 3VEZA 3ZSQA 5KFRA 2P6TA 3VZIA 3H2VE 4ZK7M 4LBPA 3OFEA 3VQCA 2VWBA 1EKEA 1WAFA 3IA0A 1VLOA 1Q18A 1I3OB 2Y1LB 3IS9A 4KO0B 1YJVA 2IA0A 2MQMA 4FKYA 2NSCA 4M3RA 2HHHF 4X84A 2G0IA 2OHDA 3MFHA 5F1XA 4RUHA 2ABYA 4EO6A 5F8NA 2ZC4A 5ETKA 2XSJA 3PO4A 4KTZA 3KG0A 4OJ1A 1SH0A 4DS4A 4GVMA 4MYUA 4B1WB 2RN2A 2DRBA 2ZD1B 2E1MC 3JAMY 3H5UA 1CJVB 2DTJA 1NK4A 2B5JA 4WU2A 3RR7A 1PYTA 3WEEB 2ZGZA 4A5BA 2PIIA 5AE1A 3VTIA 1M5SA 3LDQA 1ESVA 3ULEB 1T9UA 5LMUF 3BBFA 2JLEA 3OYLA 3FLCO 1VRUA 1FRJA 2NREA 3VAHA 3CFRA 2AX0A 5FPNA 2QLBB 2E1RA 5KG4A 5IT9U 4NEYA 4KO0A 4CP5A 1HYSA 2LU1A 4DR2J 1D1UA 1WHWA 2HAFA 2ZHOA 5CZ2A 2HOEA 1JCEA 1BU6O 3SZ2A 4MKYA 1YK9A 3SDEA 2HNYA 5K8NA 4WTOB 3ZX3A 1Q7YT 4PY5A 1NKCA 3CB4A 4CGIA 5LJ5Y 4R5PA 4U7CA 1RTHA 1IJFB 4HCCA 1S5JA 2XHWA 1Y11A 4KAIA 4IDKB 2BRLA 2CYYA 2O3DA 3OTOF 1URRA 3DOLB 2EFQA 3DC2A 1ZBUA 3GCWP 4ID1A 3IMQJ 3VESA 1TL4A 5THWA 4PL8A 2LEAA 5D3GA 1JLFA 4I6MA 1S76D 1SKRA 5HMXA 2KHDA 3FZMA 4ZVEA 3PW5A 3C6UB 4XK8C 4BRLA 3CPWR 4K4UA 3IG1B 1TYQB 2E1PA 2WBRA 4GMKA 3ZETA 2MKJA 1WACA 1TVRA 1GLLO 1VAZA 2IYGA 4NXNF 1O8BA 3AO2A 4FK2A 2W7AA 3G6ES 3VN5A 4BLGA 1DQ8A 1OVQA 3WC0A 3QMQA 2W6KA 4PYAA 4QWEA 1T05A 1TFYA 3ZT4A 3W64A 2X74A 3ZX2A 3R2DJ 4GV9A 4UOCA 2NUBA 4DX7A 1Z1ZA 4NLDA 4GKKJ 5KOWA 3IAYA 1Y3JA 3HPOA 3TPQA 2V4JA 4QJVA 2GHPA 4Z2XA 4EBDA 3QJJA 4C11B 4Q2LA 3T1HJ 5JUMA 2GW8A 1SKUB 1HNXK 1HHQA 1RHKB 1AZSB 1K9MT 1WEXA 1XERA 1DRZA 3AB2B 3MPYA 2A10A 1BWVA 4JI0F 5H9FJ 4RG8A 4PWDA 3HFVA 4OI2A 4WTYA 4FS2A 3EXYA 3HD2A 5K8OA 2X51A 4NL5A 4Z4CA 2DVIA 1VSMA 4DEZA 2QI2A 1U6FA 4ILGB 4MTPA 4DUTA 4LBIA 4P9SA 3LH2S 3PHTA 4OO1J 1N32K 2P9NB 2DNHA 1BQMA 3Q8UA 3IBWA 2CPEA 4GVBA 2FSNA 2I5JA 3M7VA 2ITMA 3W9JA 2LXUA 3V81A 2RKIB 1RWMB 2FLNA 2PFUA 3T1YK 4E7KA 3VEYA 1MW7A 3ZZ0A 4RW6B 1N36F 3QQCD 1S0NA 4YY3K 5A2QU 1ZAWA 4K4TA 1GH8A 1HI8A 3P1GA 1U8WA 2GVDB 4X4TA 4KT0C 3E1YA 1RAFB 1CJUB 2IDEA 2HK2A 5FPMA 2GZOA 3ENVA 4ZP6A 1HNZF 1IBKJ 3H59A 1RAJA 5CABA 1IBLF 1GXUA 2B8QA 1EX4A 4FZZA 3AOBA 2Q0RA 2DPNA 2KZZA 3OVSA 4CI6A 3G6VA 2JC0A 1KFDA 1MWYA 5JMNA 2IOCA 3MR7A 5E3PA 1Y5IB 1S79A 3QRQA 1SV5B 3G4SN 4JS5A 2C2KB 1IR2A 4PEOA 5FDLB 2R8HA 1QUVA 1YJTA 1VSEA 4BRMA 1UFLA 1K8KB 5DGAA 1WWHA 2JWKA 2G4BA 5FRNA 1BCMA 2Z2YB 1U6BA 3LZJA 4H4KC 4KHNA 4KY3A 3JYTB 4K41A 1OKJA 4PA1A 1QZ5A 1XC3A 3Q23A 3K9JA 4U96A 4PRFA 4FBUA 2XTJP 2XO6A 3MFIA 1XJWB 2MB0B 3Q2SC 2DGXA 2XSFA 4E1MA 4ILMA 3FZLA 5CR4A 4J9MA 2F3JA 4FLWA 3MM8A 3IM8A 2E5IA 1CXQA 3VQQA 3OL6A 2I7PA 2M2BA 4DR6F 2P8IA 1TL7B 2EBEA 5KFYA 4E7LA 2AX1A 1XQSC 2HWHA 4X62F 2IIRA 4E7HA 4M7YA 4CF9A 1VYAA 3VF2A 3FEZA 2WONB 4KHPJ 3MR2A 2IAJA 3QAUA 2HZCA 4V19X 3CXCR 5FIIA 1IO2A 2EFVA 3HHLB 3PFOA 5KT7A 3N28A 3F9KA 3BY5A 1HQUB 3DOKA 3CJQA 2C3MA 3IR6B 1WD6A 3DXSX 2W40A 3CCJN 2ASJA 2VODA 2IRUA 1M1GA 2QMUB 3FBBA 3PYEA 1REVB 2MQQA 2HQCA 1H73A 3IFRA 1UVJA 4NLPA 2BJDA 2CG8A 4WFYA 3BO4A 2EHGA 3J7YI 1B4SA 3JQJA 1MDUB 2OYQA 3AVNA 4HUEA 4CJPA 4BDZA 3DRSB 3M2RB 2DGQA 1VBZA 3PIPL 1D09B 2MTLA 1TFWA 2C2RA 1QQCA 2HHUA 3DNCA 2ETJA 1RTDB 4U9RA 4B3MF 1RI7A 5GAGI 5IWAF 2GELA 4M5NA 2D0PA 4BCAA 5C24B 2F63A 5CXTA 1QVGM 1RT5B 1NGIA 4HTLA 2R8GA 4HI2A 4XEIA 4HUFA 1RDRA 2R2UA 2LQBA 4F2SA 2AGQA 3TA2A 5F0WA 4X66J 4USWA 2BW2A 5L46A 2MQPA 3RRHA 1FTRA 4LF6K 4K43A 2MLYA 3CJCA 4OYWA 3TUZC 4OX8A 3M2RA 5HLFA 1T7PA 3RJMB 1UTAA 1FD8A 1ATRA 4JI8F 4HDGA 4KTWA 1HD1A 3AO5A 1GTHA 2CFXA 3V6DB 1RLDA 3T5KA 1KLNA 2LA6A 2F8HA 1UWBB 1S4EA 2B6AB 1K8AT 3NHGA 3CCQN 3BF3A 4CHNA 4NEZA 1LWCB 1VISA 1NXIA 3HULA 5H9EK 4NCGA 3QLHB 1S1XA 4JI1J 2WZ1A 1OH6A 4B3RK 1N34J 3AV9A 1YVNA 2AYBA 1DY3A 3JSBA 1HR0J 5B09A 4AL6A 2RUGA 1LCUA 2CJ9A 3SQOP 3FCWA 4DG1B 1WSRA 1NSKL 2B9XA 3SCKE 5IXUA 4CGJA 1YJ7A 3IR7B 3P8BB 4QS9A 3MCPA 3PJXA 1IQZA 5J2QB 3S3NA 1A5XA 4O4GA 2YQ3A 2DEIA 2RS2A 1OPIA 1XNRJ 2B0GA 2PFFB 4DTNA 2F7TA 1AT1B 3WNFA 2Q3PA 2VPWB 3BO2A 4NASA 4I69A 3QNOA 1JLBB 4KPYA 3DJCA 1KFSA 4OYMA 1GLBG 2OO4A 3AVJA 1FTCA 3SQ0A 1OSDA 1N33K 3BYRA 2WVBA 4DV4F 2EVZA 4AT1B 1U0SA 3L2UA 1X5PA 3KOAA 5GADU 3MAAB 2A3JA 1X0PA 5M1PA 4NE9C 3IUCA 2J6UA 1GOAA 4J2AA 2RQMA 3E01A 4F3QA 1FI4A 3V9XA 3ZT3A 3NVKA 3MN6A 2AT1B 3HKZD 2MQ8A 3R9PA 1U25A 2F40A 2CH5A 3JQMA 3PCOB 4A8QA 3SQ2A 2YCHA 3D2EB 2DGSA 4CTAA 2E5JA 1BI4B 4HR2A 4DSIA 3THVA 1Q4RA 2KN4A 4FPIA 2PN6A 2KKZA 5DDPC 3H0PA 2KJVA 3ZNUA 1TL3B 2ZZNA 4MLEA 4ZLPA 5KFNA 2EFGA 4WKYA 2VBYA 3DHXA 1ZC6A 1P27B 2PSZA 1NHKL 1F6TA 1P90A 4Q8FA 1XWLA 5CY4A 2DNGA 4C1NI 1XMOF 4P7TA 1ZBFA 1C1BB 5F9LA 2CVIA 1J5EK 1EJ7L 3FJ2A 3NE6A 5LXRA 4B3SK 2V67A 3QT7A 3MX2A 2E5GA 2YWKA 3N9UC 4ES3A 2FXUA 1RT2B 4ICLA 1CZAN 2D5RA 3CNQP 3NL0A 1Q86T 4NYOA 2DFFA 5AQPA 4CVNE 5I3UA 3MMBA 1K1SA 1VQLN 1FK9A 4CO5A 4FL9A 3M1VB 4ZJOA 2K7KA 1H38A 3CCJS 4ID5B 1LEOA 4MLHA 5KG1A 2GMHA 4MO5A 3W66A 2YPYA 1YSJA 3CF5L 3UDVA 2GV9A 1NDKA 1NMEB 3ZSOA 2LKZA 1XR6A 3DLEA 1X0FA 2HVZA 1GLAG 1F5BA 2QX0A 5IT9Y 4FF3A 3SMZA 4CK2A 3M6XA 2G8IA 3H46O 4OI0A 5A6PA 3F41A 1UPMB 1CS4A 3L6QA 4DLEA 1WAJA 2GMJA 3PUFA 3S3MA 2CGLA 1FRXA 2RRNA 1HKBA 4OGCA 1VQ4N 1PKUA 1YJ9N 3NCRA 5DZ6A 3HVAA 3T69A 1XMBA 2LU2A 3BR9A 2CDRB 4TLQA 2H5JB 1O5JA 3OA9A 2XMWA 3ULHA 2XS7A 4Z0UA 4FJ9A 4IBNA 3P5BP 4JI4K 4JRPA 3ENQA 2V52B 2B4OA 1Q82O 3A5NC 1SKWA 2E9TA 2CZVC 1ASUA 4CBUA 4FJ8A 1J2VA 5EWGA 4G6VB 4FXWA 1ELOA 3ENBA 3VQ7A 2BOAA 2BH1A 3J7AP 1F5CA 1VK0A 3CMQA 2AV5A 1MU2B 4FVCA 5KFPA 2P1JA 4RWXA 4CEEA 2ILZA 4FWNA 2FF6A 3BEXA 3KHGA 3CPWM 1WC3A 3IN5A 2EWSA 4E2FB 3J7A1 3THYB 3I31A 3CCQS 4JKDA 4USUA 4WU3A 3R7BB 2N4DA 4ES1A 1S6QB 3QNNA 3BZKA 3OLAA 2LQJA 4WJBA 4CQ1A 5C25A 1JWWA 1LXNA 1HWKA 1RDAA 1HW8A 3BGOP 3RTVA 3FZFA 5D4PA 3OL7A 1FESA 1X9JA 2FBYA 3TP2A 1OQ3A 4QQBA 4JKGA 1XR7A 3RU0A 4ZLLA 2R7OA 4ZPBA 1JLCA 2X1GA 2NLXA 2HK3A 1NGHA 1DZ5A 3DCAA 2B43A 3C14B 1F1BB 2YPZA 4K4YA 3K9KA 4YY3F 4LMZA 1OMSA 1HHTP 2CQDA 3LQVA 2PO4A 1MNEA 5DM6Q 3M32A 2YKNB 1X1PA 2HVHA 5K14A 2D3O1 1PC4A 4OPJA 3C6TA 1L3KA 2A5XA 3PYDA 4A46A 3CSKA 1C4CA 6AT1B 3G10A 4YEAA 3JS6A 2HB5A 2BQUA 1QVFR 3QGHA 2PT0A 5KG5A 2KHOA 4DV5J 3O44A 2R2SA 2MGZA 5AQIA 2YNFA 1CJTB 3LO3A 3U27A 2W2PP 3MD1A 1YZ7A 4H0VB 1B92A 1U26A 1U0HB 2DR7A 1FX4A 4FJGA 4NLGA 2O8FA 4UQGA 1VQSA 2V50A 5LSLA 5DDRC 2YH0A 2H3EB 1IBMJ 1N5VA 3KJVA 2MHEA 1R0BG 1WF1A 3NAEA 1G2EA 5A2QY 2ZH1A 1EQYA 4FYXB 4BREA 4OLAA 4P2MA 4DCPB 4DQIA 4GV6A 2DH8A 2HF3A 1QJHA 2ZM6K 1CXUA 4GKKF 3EJMA 4FWKA 4J9RA 3OUYB 2AEMA 3KMQA 4ZCLA 2FD2A 1B99A 1RKIA 5AQVA 3MPUB 4DV6J 3MM6A 4QYZK 2KLAA 5CCLA 4ANCA 4M7XA 3M5RA 1BHLA 1XMQF 4UY8O 4FLXA 1U1MA 1CBKA 2QWNA 2D1KA 2RU9A 3NEKA 1Q9XA 2APOA 1YIJN 3MMCA 3RBZA 3UD4P 2HQ3A 4PUOB 4H0OA 4E98A 3PX6A 2L9DA 4NA2A 4LJMA 1VQLS 4LH4A 1TP7A 3GYNA 1BLUA 3GQCA 8ATCB 4DL5A 5BYRA 4CLUA 3HPHA 4URGA 4QOZB 5DM7Q 5M1KA 3Q7CA 3QBCA 2HNZB 2ERRA 2ZZMA 2VG5B 3AQOA 3G6YA 3HRGA 1YKWA 2DFEA 1W26A 4JEPA 1HBOA 4JD2B 2HFVA 4FZXC 1KQFB 3EVOA 3Q22A 3D67A 2QW9A 5LMNK 1NUEA 2PEHA 4DXLA 2VOPA 4IFEA 3MM7B 3BSOA 2DNKA 3NF9A 3J8AA 1WTFA 1VQ4S 3ETMA 3CXCM 3K2PA 2YHWA 1RDWX 1BE4A 3HOTA 3NNAA 2VFVA 2JVRA 2CGKA 4FLTA 1YLXA 3D1OA 2W9BB 3JSYA 3QDKA 2KXHA 1NLVA 3J7YU 1B64A 1T11A 4BC9A 1J5OB 1QY7A 1X4CA 4JI3K 1TQLA 1HKCA 3D7EO 3KKSA 4ZITA 2RB7A 2CXEA 5B0FA 4I6WA 1YUWA 3W2VA 2P9EA 2XI3A 5J1NA 2BVZA 1T3OA 1HARA 3K58A 1R0AA 4JI2J 4PL7A 3AVIA 2ZVSA 3C0BA 1NH8A 3Q89A 1NJIO 1ZS6A 1KVBA 5GAGU 3EE9A 3M30A 1N0UA 5AQGA 4J9NA 1CC8A 4DZDA 2CNOB 1LWFB 4YHHK 3U9DA 3AD8C 1BIZA 3FRYA 3RB6A 1B9FA 2E2PA 1KLMB 3JSRA 1U2FA 2F4VF 4P2FA 5FROA 1N6QB 5L38A 1S9EB 1FRMA 1YX2A 5DETA 2MZ1A 3T41A 3N4PA 3CPEA 3DXMA 3PZPA 5HAOA 4F4WA 3UDEA 3EICA 2CPHA 3T1AA 1TV6B 4FPBA 5F3ZA 2O8EA 2YWFA 4DV7K 2J76E 4RBUA 4RNNA 2VD3A 1XNQF 3H20A 4JV5J 1FDAA 3VOVA 2BABA 5C2FA 2K3KA 2FC9A 2DO4A 3DFEA 4LF2A 3B6PA 5EGYA 1IKXB 3P5TL 3TZYA 3PW4A 2VBXA 2VPZB 2E1AA 1D3WA 5KFDA 1OY6A 3CJ5A 7FD1A 1EIYB 4JHDA 2YHBA 2BTFA 1DHMA 5CYMA 5B0BA 1NMDA 1X5TA 1YI2N 3L3VA 3EDRB 1ZPVA 1PBUA 5ETSA 2MHNA 3P49B 2VQEJ 4DFKA 3R7NB 3IDHA 3OBIA 4CEFA 3DRPA 2Q3SA 1QAIA 3NH0A 4PG7A 4OHVA 5G4DA 3G96A 3EWGA 5LOQA 2C2ZB 1DAXA 4CZKA 2ZKUA 2R2TA 1OYEA 4RW7B 2UXCJ 1NPKA 4BQLA 1D4XA 3UN3A 1RHRB 2XMVA 1MROA 2BGGA 4OHXA 1K73T 3LM9A 4K0KK 3FCHA 1WEZA 3A5OC 1J5EF 3LAKA 4DTJA 1H0HB 1Y4ZB 2F4FA 1NJYA 2I6WA 1VCTA 5KFWA 4DUZJ 4S0MA 1NB2A 1N56A 4NLQA 2IFXA 2YXLA 2ZBRA 5C2CA 1CLQA 3R3TA 2L41A 1K1QA 5B0DA 3GV8B 2EK1A 3VA3A 1YIJS 4EK2A 5GMEA 4FN5A 4A4JA 2FF3B 3SSQA 4JYAJ 4LBHA 2NUUG 3GLJA 4HLBA 3AA4A 1VHFA 4IFYA 3OL9A 3PSFA 1H2VZ 2ZJPQ 4DQRA 2XI2A 2EW9A 4GV3A 3B8HA 4K25A 4ILLA 2FJWA 2AGPA 4M3WA 3K5PA 2AKWB 2L48A 2KT2A 3CCLN 5L9NA 1WKKA 2MKYA 3NS6A 4C0OC 2KFZA 3PX0A 2H3GX 2W42A 4N77A 1IWGA 3OR1B 2P5VA 3B78A 4P75A 5GIPA 5DM6L 4H0PA 4J2EA 4NXMF 5HQ8A 3D1QA 4P6QA 2P9GA 1LW0B 3PRBA 4U95A 1XNRF 5DDQC 2KTQA 3EE8A 1CZBA 1UETA 3N4QA 1K0VA 2ZBCA 2GAHC 1NHVA 4QW8A 2UXDF 3NGSA 1S1WB 2C22A 3OYIA 5E3AA 4Q0BA 2ZH4A 5HJYA 1KBRA 4L72B 5B0EA 3BJYA 3MTKA 3MPWA 4DR2K 1PYOB 2O67A 4DR4F 3M6UA 5E7OB 3O80A 3ZTQA 5ITHA 1S57A 3NS7B 1NK7A 5M1NA 2DO0A 2HRUA 4OI3A 1S22A 1S10A 3D0PA 3NP5A 2P9KB 4LIWA 3FBEA 2KG0A 4DR3J 2U2FA 1SJQA 1HNIB 4IJNA 3TEGA 3D3BJ 3RBDA 4CGHA 4KHUA 3RRGA 3W9HA 1Q8LA 1IKVB 2E1CA 2BE9B 2BW7A 1J27A 2D41A 1VSKA 3KUHA 2DB1A 4FWQA 2VL1A 4NCBA 1U24A 2VGNA 3SQGA 1U7LA 1XQIA 2N82B 3UI3A 1FNMA 4X64K 3P6YC 5LL6d 3AVBA 4YOXA 2G8KA 2LQ8A 2IBKA 3VCDA 4IG0A 5LXYA 3C65A 5TKYA 1S0VA 3I5AA 4EMDA 3UPFA 4JLHA 3QFUA 1SIZA 3ILLA 3H5YA 3KYLA 5J1EB 2GFFA 3RR8A 3G6XA 3QGPA 2CJXB 3C15A 4OFZA 1S1TB 2QL9B 4X65J 2HGNA 3RW7A 4LF5F 1MG7A 2H5IB 3GIRA 4FZVA 3WT0A 1GEHA 4KRFA 4P71A 1IKYB 5AQYA 1TL1B 5DM7L 2BE7D 1X5SA 1JK9B 3ENHA 3O1BA 2FDNA 5HQLA 3TRGA 3LUYA 1JLGA 1AA1B 3FFIA 3EXCX 2Y8YA 3AVHA 2VCPA 3B82A 3R8EA 3T1HK 2NYHA 1HMVA 4RTFD 5HMZA 3M8PA 2LLZA 4Y1DA 4FNIA 2F65A 1WC0A 1YI2S 5H9FK 2FVPA 4NLRA 3W61A 2CQHA 3DM2B 2J8SA 2B9EA 3DI6B 3JAMO 3SMPA 2HS3A 1QDUB 4FJLA 5I42B 1HNWJ 1RTJB 4WK1A 4AQYJ 3SCJE 4NLXA 2JRSA 5C42B 2KW4A 2MQOA 1PC5A 1M90T 1OJ4A 1RHMB 4CERA 3NMAA 4CLTA 1IH7A 3VQ9A 3GSIA 3CJTA 3J81O 1NK9A 3VAFA 1D5AA 4KE5A 4HACA 1HRHA 2R7RA 3NVMA 1VFJA 1RT1A 3QO9B 2NZCA 2QEXN 3CHWA 2KH9A 2E6LA 4H5WA 3CQXA 3I0SB 5F8MA 2DNOA 1IG8A 3P5JA 4FJ5A 2JOQA 3UNYA 4J9SA 4FK4A 4RW8A 2Z0GA 1Q8BA 1QVFM 2HSEB 3WZ0A 3Q7BA 1W7WA 2OPRB 4ZVQB 4DHVA 5KFHA 3DOMB 3O6WA 1IBKK 2RH3A 4USKA 1BHNA 3MDFA 2YNIA 2YH1A 4ZCKA 3I0RB 5AXLA 1T03B 4C8OA 4E1JA 4FPRA 3TTCA 3WQUA 4KBOA 2XZTB 4M94A 2HBZB 2M7SA 3SJHA 2C2OB 4K4ZA 1WLJA 1KC8T 1EARA 2FHMA 2RQ4A 3WX8A 1X9SA 4ED8A 4UT4A 1GAOA 4KGZB 1RT4B 3QZ8A 3BGFA 1ZM4A 3CCLS 1WF2A 3O5TB 1FHTA 2GQQA 1VSJA 3VQDA 1VSHA 4ZIVA 3QERA 3R5GA 2V69A 3QSIA 3AAQA 4L8RB 4ITSA 4Y6IA 1JL2A 4L73A 4KRWA 2HHXA 1DQ9A 3MMAA 1BUXA 2AP6A 2E5HA 2OEMA 4HVJA 1J53A 4TXSA 2V7ZA 3EGWB 4GO7X 1U2VB 2DNLA 2ROGA 3IRWP 5KFCA 4WQ5A 3KLHB 1Z4UA 5LJVA 2HLTA 4PG6A 3O4NA 1NMNA 2XHCA 1Q7YO 2YTCA 1IUJA 3JSMB 4IQXA 4KHPK 2A1SA 2GS8A 3DU5A 3LWMA 4IJAA 4DV5F 3O8MA 2OEJA 3AO3A 4ISFA 2RE2A 3V4MA 1CJKA 1KHVA 2WB4A 2GNKA 4C9DA 1QZ6A 2ACYA 2VQFK 2OKQA 3PHEA 2E4LA 1GMWA 4DR5J 3RSEA 2BV3A 2B4VA 3P31A 2J7WA 2DBBA 3CIZA 4LSZB 1D8YA 2IC3A 3Q2TC 5BPMA 4EBCA 2B4JA 5DS7A 4USMA 3DLGA 4WQ4C 4YB6A 4FCYA 2IJNA 2WW4A 4MO4A 2IM1A 4B9QA 5AQFA 1F21A 3E9OA 5HMYA 4WFNQ 1X4BA 4XTTA 4OI6A 1T9TA 2BE2A 2GO9A 3DRYA 3DLHA 3MEEB 1BY9A 1LW2B 4QPXA 5KFUA 4WIQA 4EI2A 1RLCL 3LPYA 3BQ1A 4Z4IA 2ZHBA 3H4BA 1SC4B 3MWBA 2QTWA 3AD7C 3MXJA 4K4WA 1K9MO 5D78A 4IEIA 2EKNA 5BRHA 3HVTA 5KRTA 4X66K 5KFKA 2E5LK 1NBEB 2NRXA 4ZIWA 3HHLC 4H0XB 4ZVRB 1TUYA 1JKHB 3ATVA 1XN9A 1V4TA 3IRXB 3SFUA 1PILA 1WHVA 2P9IB 3HSGA 2R7QA 1AYEA 5CD4A 1WOPA 4LH5A 1KTVA 2ZUAA 1X4GA 2RJZA 1HNVA 4IXCA 3OFFA 3L4IA 4DUYF 1R31A 2ZE2B 2O8DB 2K2PA 4GW6A 4UQTA 3MWPA 4DPOA 4QYRA 5E26A 2C2EA 4I7FB 2YX4A 1T9WA 4I1TA 2QV6A 4JI1K 4CECA 3WXLA 1N34K 3HXMA 3W7BA 5HVFA 1FDBA 3W5XA 1HR0K 3N5BA 5AXKA 1JLQB 5ETVA 5A6WA 4OZJA 1TUWA 3NBPB 1ZETA 2MQNA 2NRZA 2NRTA 3HX9A 2QYGA 5K9FA 3KNGA 1UVKA 4OL8A 4A61A 3QB0A 3Q86A 5HJXA 4AM7A 2H4WB 3OJSA 1XTZA 2QEXS 3PFEA 2IDLA 1EETA 4C8LA 3D6HB 1FXXA 1UWAA 5C2DA 2RT3A 3HYFA 1T02A 2P9PA 1SBRA 2OAUA 2O5DA 2XEXA 1DLOB 1ICEB 4DL3A 4DSKA 4IOAL 3THXA 3LA0A 2VASA 4JI6J 3S3OA 1IKWA 1ZM2A 3R1XA 1LOTB 2DNZA 3RBEA 2DEJA 4LFBJ 1IG9A 4Q43A 2R8KA 5KOXA 3OS0A 4JI2F 4QWDA 3QZ7A 2MYFA 1HBUA 1DT9A 3MM5A 2J6TA 1R59O 4ECTA 1BUPA 5C15A 4FYWB 1S1UA 4PXCA 4C8KA 2W2OP 1VC6A 2RNEA 2A40A 1RGIA 3HM9A 3W0LA 3E51A 4CZMA 3ICLA 2FGCA 2RILA 3AOAA 2A6MA 2UXBK 3EZOA 1S77D 1O51A 3KJNB 2UUAF 3PEHA 3CJ3A 1AUSL 1NU0A 3D0IE 5J2MB 2VG6A 3ULDA 3ZT2A 4JV5F 2EG2A 1EAYC 2MKSA 3RRKA 4BY9C 1RDUA 4URQU 4U67Q 2NLWA 4OKJA 4CJRA 4KFBA 3B4DA 3UE2A 1DEJA 1RDCA 5DG7A 3I55N 2B9YA 1RP5A 5AFUH 1RT6B 4NZ0A 3OYGA 3M05A 4ZPDA 4KB1A 1EP4A 5T14A 3PKMA 2D0BA 1M0SA 3RMCA 4TY8A 4K8RA 3HFKA 4DX8H 1Q78A 3I82A 4PPDA 3PSIA 3PRDA 4CJ4A 4P2XA 4FO0A 2GGPB 2OSRA 2W6LA 4Q2MA 2WSEC 3RG6A 1V4SA 3OHAA 3I6PA 1S4FA 3H6EA 3CQYA 4DR7F 3TJAA 2FHOB 3LP1A 2PE8A 4CF0A 3WIVA 3NRBA 3BKUA 1FFWB 4TKTA 4YUDA 1GK8A 3NOCA 3KLIB 3R1LA 2D9PA 3FCVA 2NNWA 3CCSN 4OLBA 5KFOA 4IOBA 3HZGA 2Q0UA 2HWTA 1CULA 3KK7A 4XH1A 4I0WA 4IH5A 2HHHJ 4FF1A 3Q8QB 1E6YB 3CO9A 1BC6A 1CEZA 3I33A 2IYIA 3O8WA 4WXOA 4FLYA 4DUZF 3HO1A 3P83D 4UY85 1RU1A 1HQ2A 2ZH3A 1QSYA 2J0QD 4UZBA 4Y65A 2ZJRQ 1KEKA 4PYDA 1TKZB 4OZ5A 2LDYA 4KHSA 1G6BA 3MXIA 1K8AO 4LF4K 1HHSA 4CJKA 4BR5A 1BD6A 5LMUJ 1S7IA 4G1PA 4ZJQA 2WVFA 1NPRA 4LVOP 2BDPA 2QA4N 3KK3A 5HSPA 3MN5A 1MN7A 2BZ2A 4MDBA 7FDRA 5K8MA 4O3RA 4EO8A 2GHVC 2EC2A 2C3YA 1N5YB 3M2VB 5KT2A 5A8KA 5HL7L 4BR4A 4G1IA 2QM1A 3WDOA 2YNHB 3DRRA 3OYKA 2BBEA 3H25A 1Y5LB 4M5JA 3E3XA 2RMLA 3IGNA 2HYIB 2CVEA 3P3DA 2MLXA 2OFHX 4M41A 2B3TB 2HBQB 4O3NA 5D4OA 4WFXA 2ZDOA 2O8CB 4AL7A 1WTBA 3OTDA 2HLUA 4CD3A 3IC1A 5KFMA 4YORA 3S7RA 5GAEI 2NXJA 2YKMB 2CWXA 2UUCK 3Q8YA 4OI4A 3MECB 2LDIA 3NGIA 1UMJA 4HYKA 1BL3A 1DURA 4B1XB 3OTOJ 2O8BB 3AXMA 3N6MA 3OL8A 1N5SA 4RNOA 4UF4A 2OPSB 1QQMA 1JJHA 2G0CA 4FWOA 1GT8A 4DBQA 5AR0A 2H4YB 3FR0A 1S9GB 2FVCA 4LF9J 2ATCB 3BGRB 2CNKB 1NSAA 2OD6A 3UE5A 1U6ZA 2QXFA 3ZSYA 2N7CA 1KCFA 2MDAA 5GAHI 4NXNJ 3A5LC 3MM9B 3V4IB 4ZVTB 1YRXA 3GTYX 4WFNL 4IRDA 3MN9A 5EVZA 5HN0A 5M2RA 4CJFA 5IT9O 3AGRA 4C97A 2ADCA 1FRHA 4JI7J 1WBBA 5GMKa 3N01A 1Y0HA 5CE3A 5GMDA 3SV3A 1IBMK 1Q8KA 1VC0A 2E66A 4B3OB 1LV5A 4KTQA 1FXLA 1HUXA 1H7WA 3CGIA 3NGTA 4DQPA 1M1KT 2FY8A 2AWZA 4UOGA 1Q1KA 5AJ3F 1BQNB 2B8PA 2VHGA 1DARA 2WW8A 4JI0J 4IG3B 3WQTA 1Q86O 2XMMA 3W5ZA 3SUQA 2WTUA 5IT4A 4PHTX 1VJQA 1C0UA 4I6AA 4FJMA 3I5BA 2BKOA 2VIHA 1RACB 4OHYA 4DV6K 4YDXA 4FDFA 4JI5F 1FWLA 4AHCA 2PMZD 1C6VA 3NXZA 4KB7A 1UCNA 2HMIA 3R27A 2IM3A 4NB4A 3I55S 4CJUA 1RWPB 1X7VA 4DTSA 3ZXWA 3AARA 5KG0A 4O44B 1HPZA 3GFHA 2QWMA 4ED4A 2QYCA 5KI6A 2NRRA 3TAGA 2HVDA 1RBUA 3BZCA 3ZX0A 1TUGB 4RW9B 3UKRA 3BR8A 4IYQA 2E7VA 3HZEA 1RT7A 4OYZA 4FKXA 1HNWF 1NJXA 1S1VB 4HTJA 3TNVA 2KRBA 3ZSWA 5D0GA 5JJBA 1RWWB 3FZHA 4LT6A 5DZ7A 3CMEN 1HNZJ 3MI7X 4O5FA 4EP4A 5A8RB 2BM1A 3EKUA 4DCHA 1FO1A 4FXDA 2M52A 3DGPA 3UFCX 1RGVA 4ED5A 4B1YB 2UP1A 2IIHA 4DV0K 3CJ7A 3CCSS 1U1OA 1HJRA 4KYZA 4E8UA 3TQ1A 3G82A 1NHUA 1WKJA 4QCLA 1CVJA 1WG4A 2DH9A 1WSIA 4ILRA 1FCAA 1RAOA 5DQGA 3LZIA 2MZQA 2DPIA 2R3VA 4NA3A 5LM7E 3KHHA 2P9UB 3GFYA 3TAMB 4JKAA 4O3OA 5IV4A 3SCIE 3K17A 5HP1B 5KAKA 3DLRA 5CHIA 5AQTA 1D8ZA 3L2QA 2W25A 1FE0A 2CADA 4DR1F 5KT6A 3OFHA 5KPRA 2QA4S 4A5AA 4DR6J 5BR8F 1VRTA 4X62J 5DG9A 4QOTA 2VA2A 1DGKN 5G0RB 2YJEA 5A2QO 5AZIA 2P9LB 3MDQA 2Z1GA 3ZT0A 1Y00A 4NLVA 5F3TA 2EX3A 3GL1A 4FF4A 1OH5A 2CH6A 3TR8A 3OLBA 4CHPA 2OPPA 1BDGA 2V2ZA 3W2WA 3C16A 2N3OA 2J9DA 3BBCA 5LY3A 2Q97A 5IM0A 3CJ1A 2FTRA 3O9RA 5AT1B 5EN1A 1KOHA 3CERA 4BS2A 1X4DA 1Q81T 3J80U 3KDNA 4XIUA 1SPBP 3L95X 2XLIA 3LP0A 1WC1A 3VEXA 1JLEB 3OS2A 3QT8A 4CIFA 4DV1K 4LFAF 2BKPA 3A8JA 4NLYA 2E2QA 2PYLA 5C0YA 3PDNA 3QIPB 3B54A 2QLXA 4E1NA 1ZZNA 2OP5A 1C0TB 1RHUB 4J91A 4RWWA 4IH6A 3GG1A 1BWFO 4QBUA 3FMBA 4B3MJ 4RW4A 5IWAJ 4WE1A 1V9OA 3BEGB 1WC4A 3MXHP 2HFUA 1WSFA 2XC9A 3MMJA 4BRHA 4XH4A 4AE5A 3D66A 4C8NA 1SKSA 3KK1B 1G99A 2DT9A 2R7VA 3O9UA 4K4SA 3KWGA 4LSNB 2Z1HA 2GEMA 3VQBA 3RUBL 2ZKTA 5HVGA 1UPPA 4H0TB 3M2UB 3W8GA 3CETA 1SH3A 3RAQA 2A41A 3NKYA 3BBBA 2UXCK 5HBMA 3AO4A 1GLEG 2PMHA 3SAHA 3R6LB 3KD5E 2ATLA 2PMWA 4P7VA 3D2FB 4QPTA 3DXKA 1NK0A 2HNDB 1XC9A 3DDKA 4MK9A 1KONA 2XGQA 4NZ6A 2F8SA 4IR9A 5KFIA 5A0YB 2B4UA 2U1AA 1LAWA 4OJHA 2XMKA 4JV1A 3M8YA 4QR2A 3EO3A 1BCOA 4ZHRB 4LSLA 3IR5B 2WHOA 4DV2F 4NLOA 4ZN3A 2IGIA 4C7QA 3MAQA 4NMLA 3ISZA 2O01C 3K57A 2QN6B 4QS8A 3H1QA 4F3OA 4HHHA 1NGCA 3KLFA 4B1VA 1DBDA 1RBOB 1RXOB 4M5DA 4EFHA 1D9AA 4H4MB 5BPNA 3ENOA 5F9NA 4CGGA 2ASDA 2P51A 1PAEX 4PG5A 1B0TA 3L3CA 2B7BB 3J7Z5 3TI0A 3QIOA 2DXDA 4CWBA 1TL5A 1T8EA 2NRHA 1HBMA 1AXQA 1H72C 1JXVA 2HW3A 3D1HA 3CMES 2ZZTA 4E7IA 3MCMA 4CM0A 3ZTOA 2ZH7A 2WVDA 4ED2A 2W2NP 4CFDA 5HRNA 1QTMA 2QL5B 1G3OA 1AUDA 3AA9A 2UUBF 4OQJA 5AQSA 1T9VA 1HJOA 2A0FB 3THWA 4AF1A 4CBXA 3BQ0A 2GUIA 4X4UA 4CFAA 4LFCF 4OX6A 4OX9K 4YS2A 3LOUA 1OPZA 1VHIA 2VC1A 2DXEA 2RRBA 3VR1A 4Y0FA 1XIQA 2RE1A 1R6YA 2DGTA 3T6JA 2Q6BA 3CO0P 5FLXO 4OZ1A 2Q6CA 4FYVB 2Q66A 3KXDA 5KT4A 1K0TA 4LFBF 1S0OA 1X3NA 4ZP8A 5IFMA 3CD6N 2CJBA 3U8XA 4CHQA 2CQ2A 1W9HA 1FKPA 2NZ4A 1G1XA 4DR3K 3ZZOA 4KBIA 5J2PA 3H7HB 4JBCA 3H3OB 1RQ0A 1WOOA 2ACMA 3EVMA 1KVIA 1HKAA 2MSTA 1DKGD 3SAFA 4FK0A 2V8VA 3OTCA 3AFGA 1ZXOA 4PXEA 1J9AA 3BN7A 4M5LA 2WVCA 3TU5A 2XBPA 3GCXP 3S6EA 3IWLA 4LF7K 2P9SA 2J8AA 2V68A 5AQLA 5EDWA 1WDTA 2BANA 1NGAA 1SL0A 5CZVA 2W01A 2O1PA 3PRVA 4MIWA 3MOJB 1DTTB 2WK4A 1WNSA 2LECA 3TX0A 2GIFA 3L09A 4X4PA 4H03B 1YTAA 4ED1A 2OPQB 1WHXA 3SMSA 1GOBA 4X65K 2UUCF 4BRAA 1C4AA 4FW2A 1C0MA 1YHQN 5BXIA 3NH1A 5AE3A 2FHJD 5HI7A 4F36A 2AJ4A 2FSKA 2ZBQA 4MIAA 1K47A 4WBFA 1QQNA 4DQ8A 3HHDA 3MEGA 2HBRB 5ETLA 3QESA 3RMDA 1RT3B 4LF8K 3ITHA 1KR4A 4Y2MA 5M1FA 1AROP 4ELUA 4EZ6A 4FJIA 3OS1A 4ZDNA 2W7PA 1PIEA 3J7ZT 2M3DA 4IRKA 4ISGA 4NI2A 5DQHA 2YNGB 4N56A 1YF5L 3C6AA 3NWRA 3L7UA 2W9CB 1I94K 3FGUA 3PEJA 2VA3A 4I2QA 4C98A 2Z8QA 4OPHA 1XK8A 4PG4A 2ZBPA 1FRLA 4I68A 3T5LA 2QLJB 1GMVA 1BO5O 5GAEU 2HQIA 3T5JA 1ILYA 4AQYK 5AZJB 4GVEA 1C1CB 4DSEA 5T7LB 1K73O 1KVAA 1SL2A 1LWEB 4KREA 1NDPA 4KH6A 2FPHX 3VGTA 3G0ZA 5AE2A 1W2BR 1RT3A 5ETMA 4UTGA 1VQKN 3CULA 2V8DA 3KK2A 4X4SA 2X78A 3V9ZA 3CCRN 2XMTA 2K8GA 2AGOA 4H4OB 2XNRA 4N8NA 3RVCA 4J9PA 2QSWA 4OYIA 2ZOFA 4KV8A 1RSCA 3KG1A 3K8VA 2JL9A 4HHUA 1T0TV 3HHNB 2FBXA 1V6HA 5E3RA 1WG1A 1IBCB 3NAIA 5GAHU 4WP3A 4UW2A 3EY1A 4JK7A 1NGBA 3SJJA 2YX7A 3O9QA 4CT8A 4PXDA 3MUTP 5AQRA 1EWQA 3FZ2A 5KFAA 2FLOA 5LJWA 5B08A 1N32J 3EMTA 3CDEA 1UVIA 1OYDA 3AA3A 4A8MP 2DHXA 2ZH8A 1GFWB 2F9WA 1SCJB 2KXFA 4CLFA 2CQIA 3Q83A 3T1YJ 3LDNA 3MUMP 3BPSP 2KFNA 3HI9A 3IO1A 4YY3J 1YRUA 3UD3P 1WSVA 1M5HA 2R7XA 5HROB 2E9RX 2WSFC 2HHWA 2HPUA 3SPZA 4LF1A 2ZD1A 1CJVA 2RF2B 3D9BA 3M6GA 3WEEA 2VFRA 4WXWA 1TKTB 4J2BA 3C2PA 3ULEA 4DV0F 4DLGA 4PQUB 4PPZA 5D0EA 3F0NA 1AFJA 2D4WA 2YKOA 3SBMA 2DHHA 4BR0A 2MKHA 3S41A 2EI5A 3RWUA 4HL9A 2CPZA 2WAQD 4IRCA 2Z1IA 4LF9F 1MMDA 2XLKA 4ILJA 3AVCA 3NMUA 1QE1B 4OHWA 1WN7A 1RU2A 2OZSA 4OV6A 5HRRA 3VGSA 1R8HA 4KHMA 2DCUB 4MIBA 1MWKA 3CD6S 1MN9A 1TELA 5KFQA 2VPYB 3A3NB 2HFZA 4CW7B 5HOOA 1XHZA 4JI7F 5ADXH 3FK4A 3LANA 2W4DA 1FXRA 4PQUA 1B9DA 3HSZA 4CIGA 4IDKA 1RWKB 2I8EA 4ZA1A 5GIOA 4QWAA 3DOLA 4DR5K 1UAXA 3U7JA 1R89A 1YTYA 4USVA 4EEYA 1XMQJ 5KFLA 2E8AA 1X5OA 1JMTA 5E84A 1CPZA 2G8WA 4XO0A 3C6UA 2NXCA 4ZVGA 3HT3A 3M8QB 3IG1A 1TYQA 2O4IA 2QT7A 2Y0SD 4WP8A 4BC7A 3TUIC 4RPFA 5D8HB 4CEBA 2K1RB 3ALYA 1QAXA 5JVHQ 2YQ1A 4HTIA 4OLPA 1VK8A 1S48A 1YHQS 4F3MA 3P4IA 3W1YC 1UVMA 5J2NB 3MR3A 5E5NA 1L5UA 2GVZB 4DV1F 4J9OA 4F4KA 2XRIA 1EO1A 2XNQA 4IO8A 4BC2A 4MYTA 1C2PA 3M8SA 4Y2KA 4C11A 3GONA 4I6YA 2F1FA 4K50A 3AAPA 1F3VA 1LK7A 3QFHA 3HP6A 4BRQA 1AZSA 2YX6A 1R6VA 1RWOB 2NXEA 3ZLJA 3NGDA 4OYXA 1E4FT 3WNEA 3TA0A 1M90O 3O3HA 2QKBA 4O5BA 4CZIA 2XMAA 3DYAB 3J80Y 4RKUC 1NK6A 2EFNA 4ZPTR 2VWJA 2P9NA 1HWLA 3KG4A 4AM6A 3OR2B 2NPIA 4LF6J 1PCAA 3C95A 3A12A 4DFMA 3VMFB 3OYFA 2RUSA 4EUVA 3M3ZA 1U09A 1UL3A 3GFZA 3CJ2A 3DMJB 2HBYB 1RBAA 1VQKS 1RZMA 1O0PA 4LQ9A 3IBFB 2RKIA 2DTUA 4CHOA 3K8WA 5IQ6A 4EHUA 3G8SA 3CCRS 2ZJQQ 3AJ1A 3QEXA 4DHYA 3US5A 4X4OA 4RW6A 5HQMA 3CJBA 2HHTA 3SNNA 2LMIA 2FSJA 4D3GA 2GVDA 3O5BA 1L3UA 2YHYA 3HCXA 3BGLA 1CJUA 1B7YB 2C1EB 3KLVA 3TANA 5BJRA 4NO7A 2W8KA 1KC8O 2DNRA 3CIMA 4MAKA 3UKUB 4TSXA 4I2PB 4KQZA 5KG7A 1RKJA 2OEKA 3SSRA 2UU9F 4JI6K 1JQGA 1W25A 2F4VJ 4DU7A 1HBNB 3RZAA 3OR2A 2LFVA 3K0JA 1TKXB 2R7UA 1FRIA 3M8ZA 1SV5A 4CEOA 1FKOB 2KXNB 2HFOA 1TKDA 3EL2A 4I67A 4IR1A 5FDLA 4DSFA 1NB7A 1K8KA 5BN9A 2HRTA 3SAGA 1XNQJ 4JB8B 2A18A 3R7SB 1X60A 4CD1A 3JYTA 4TVAB 4YDUA 1SZ2A 4WQ4A 2AZ1A 1JNZB 3M6VA 4DTXA 3IXQA 4QWCA 1T44A 2FJDB 2ZH5A 1EKRA 1YT3A 1EXQA 3QPIA 3KTQA 3CDAA 3MXMA 2QZ8A 3CMAN 3SK3A 1SAZA 5HANA 2XYHB 1TL7A 3UCUP 2ZVIA 4BE2A 2RD5C 1D9FA 4OX9F 2OUGA 2HQFA 5C10A 3HBTA 2QKKA 2WONA 3NGRA 3AVLA 4K4VA 1S72N 3GIKA 4PABA 1IXKA 5KG6A 2B9WA 5I4MA 3HHLA 3ZEUB 1E6VB 3VPZA 2IRXA 4R79A 1HQUA 1QD1A 1PBAA 4GKJK 3C7NB 1LAVA 2MEWA 4N41A 5B8HA 4P52A 2IY5B 4ZPCA 4M8LA 1REVA 4IO9Q 1XBWA 6FDRA 4LRFA 2NPFA 4XPEA 3VF6A 4FJ7A 2LP4A 1RTIB 4TY9A 1J5EJ 3HLUA 4B3SJ 4U7UK 1LK5A 2WOMB 3DRSA 2F8TA 5FPDA 2RPIA 2BUNA 4R8UB 4BWMA 5A8WB 2Z56B 5DK5A 4CF8A 2OMOA 2XWYA 4LF7F 2B4PA 1U49A 5LT5A 4ZLNA 4Y3CA 2D3UA 2CG4A 3J81U 1WSJA 2GMLA 1RTDA 5H1SQ 2CQ1A 3A4TA 4BQZA 3LDPA 1F2HA 4OJRA 3U1NA 1Y10A 4CRJA 2HHHK 1DJ0A 3V9SA 1VRQC 2J6SA 3ZSRA 4OZLA 5B0GA 4NA1A 3CYMA 5C24A 4BC4A 5EX0A 4OPKA 4ZMMA 1RT5A 4G1QB 3KLGB 2KYZA 2GX8A 3DLKB 2Y1RI 2LSNA 3FBFA 5DMRA 5M2UA 3PR4A 3AH6A 3V1QA 4LF8F 2JHEA 3IAM9 3TO8A 4NXMJ 2CPXA 5LMUK 1SUQB 4OJ3A 4QIWD 4IUFA 1EWRA 2X1BA 4YB7A 4DQSA 4FOIA 2DHAA 2IMWP 3CCUN 4PQAA 4A8OA 2UXDJ 3V6DA 4PCQA 2Y1IA 4OYAA 2IBOA 1UWBA 2B6AA 1EX8A 1V3RA 4C6AA 2JX2A 1U2RA 2G9OA 2M5YA 3DXBA 2BJ8A 1I51B 3BSAA 1LWCA 1S0MA 1F9EB 4DR4J 3QLHA 1FEHA 1IR1A 4A47A 1RFQA 1GLJO 1JNRB 3TYTA 3DLKA 3KVGA 2XCPA 3F73A 1G4CA 4AHUA 4A59A 4IH7A 3WXKA 4E7JA 4CESA 4DG1A