3QO9A

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with tsao-t, a non-nucleoside rt inhibitor (nnrti)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
553
structure length
553
Chain Sequence
b'VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAISQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ ribonuclease H
publication title Crystal Structure of tert-Butyldimethylsilyl-spiroaminooxathioledioxide-thymine (TSAO-T) in Complex with HIV-1 Reverse Transcriptase (RT) Redefines the Elastic Limits of the Non-nucleoside Inhibitor-Binding Pocket.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase, hydrolase/inhibitor
total genus 139
structure length 553
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3qo9A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qo9A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qo9A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qo9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3qo9A05
4DL3A 3AO1A 1ZETA 2HNDA 4U7CA 1IKVA 1EETA 1T94A 4CHNA 3EPGA 1S0MA 3CJ4A 4KHYA 3AA4A 2ILZA 3I0SA 3OYKA 3L3UA 2YNIA 3KLIB 1WAJA 2JGUA 3HVAA 1D5AA 2G8IA 4MK7A 1VSHA 4FJHA 1HYZA 3M9NB 5HROA 1RT4B 3VA3A 1TKXB 4FLVA 3DLGB 1BQMB 4B3OA 3MF5A 4DQPA 4ID1A 2FJXA 2R7YA 4FJJA 3H5UA 4IBNA 5F9NA 3OVNA 4KTQA 1C0UB 3IRXB 1XR6A 5D3GA 1VSDA 3JSMA 2HNYB 4LSNB 4OVLA 1SKWA 3QERA 4CJQA 4MKBA 4OGEA 1QSSA 1TGOA 5DK5A 3S3OA 1I6JA 2XRIA 4KTZA 3CIZA 4KHMA 3OYEA 3AVKA 5SWMA 3AVBA 2RDJA 1S9EA 3KLGB 1C1CA 3K2PA 4GC6A 2XY5A 4EP5A 3EY1A 1JLFB 2ATQA 4IR1A 4OLBA 1U45A 3GILA 2IOCA 4JUZA 2PYLA 3MR5A 3L2RA 4LH5A 4DSKA 4CHPA 3VQ4A 4PQUA 5KG7A 4HCCA 5J1EA 3DRPB 4Q8EA 2I1RA 4KHNA 3QYYA 3BSCA 2WOMB 4NLOA 1ZTTA 4CF9A 2VG5B 4Y2AA 3V1QA 2YKNA 1BCOA 5KG5A 3HO1A 4CIEA 2FC0A 1ZBIA 4M41A 3K58A 2A1SA 1VSFA 3OJUA 1TL1B 1K6YA 2JEJA 2W7OA 2E9RX 1HNVA 2RKIA 1X9SA 1LW2A 1A5WA 1QE1B 3K5LA 4Q0BA 4AHUA 4AHTA 3SNNA 4E1NA 4DG1A 3VQSA 1KVBA 3TANA 5HRRA 4W5TA 3DRSB 5HP1A 2VWJA 3OYFA 3KD1E 2FLNA 3MECB 4ELTA 1LW0A 2GIQA 3KK1A 4RW9A 5HBMB 4M95A 4NLXA 5DLFA 2W9BB 1J9AA 1SV5A 3PW7A 3MR2A 1XWLA 2IDOA 1JLAB 3TARA 3NF6A 1R0AA 2C2DA 2FBYA 3AVHA 3LWMA 3M8QA 1JIHA 4IRKA 4TXSA 2IS3A 4FS2A 3S9HA 2F8SA 1JKHA 3PJWA 4I2QA 1RILA 3CFRA 4ID5B 3Q8RB 4URQU 3SCXA 2O4GA 4JS4A 3CM6A 4DFKA 4FM2A 4YMEA 4ED2A 1SH0A 4TY9A 2FVRA 1SKSA 2IM3A 2OYQA 1VSJA 3NBPA 3DLKB 4O55A 3H40A 2GIRA 1NJYA 2ZD1B 4N56A 5F8LA 2R8IA 2OZMA 3O4NA 1KCFA 1UOCA 1D9FA 1TL3B 3HKWA 2AX1A 4BDPA 3CFOA 3ZSXA 1RNHA 1WSEA 1EX4A 4DTSA 1S97A 4CFDA 4E7IA 1HYSB 5JS2A 3VQ5A 1OS5A 3VQPA 4EO6A 2XY6A 3FFIA 4ZHRA 3L2QA 4IDKA 3BR9A 4O4RA 3ZT4A 3I0RA 4KB1A 5KFOA 4IH6A 5KT3A 4AH9A 3HJFA 4LSLB 3QNNA 4KO0A 4O5BA 2XWYA 3O4QA 3KIOA 4N76A 1A5VA 4NYFA 4HCBA 1Z26A 4ED3A 4Q44A 3T5LA 3OYGA 2VA3A 4FJGA 1NK8A 2O4IA 3RAQA 3DRRB 4MIBA 1IKYB 3NAEA 1NNDA 1NKEA 4F4YA 3NF7A 1RT6A 1U48A 4CJTA 2B4JA 3M9MB 3BSNA 4KHRA 4IH7A 2G8HA 1T8EA 2A1RA 1GX5A 5KG6A 3B6OA 5F8NA 1QAJA 1RBRA 5KI6A 1FKPA 4NLQA 2HWIA 4Z4HA 2V0NA 2W9CA 2F8TA 2ATLA 4J9SA 1JLQA 1RT1B 4PWDA 4MK8A 5KGWA 3ZSOA 4MFBB 3OYIA 3O3FA 4FLZA 1VRTA 2G8UA 1IKWA 3SUPA 1VRUA 4OKKA 4EZ6A 1ZBUA 1S6QB 1J5OA 2UVRA 2ASDA 1B9FA 1HQEA 4DTJA 1WNEA 4DL5A 4R5PB 4PY5A 1YVUA 4OPKA 1I39A 3RMCA 1KVCA 1NJZA 3T5KA 1Y97A 3DLBA 4FZXC 3KMQA 1VSMA 1SKRA 2FLLA 2X6SA 3K5MA 3UR0A 3MFHA 2UUWA 4QWCA 5KFJA 2W8LA 3SJJA 4DSLA 2VG7B 2C2EA 2HAIA 3OY9A 4FM1A 5KFPA 1GOAA 4DQSA 4FLTA 3DI6A 1I3AA 1RTHB 1S1XB 3SZ2A 4ZP7A 1JX4A 3BGRB 3V9WA 1EP4A 4B9TA 3ALYA 3ZSRA 4JV0A 3VA0A 1RA6A 4NLWA 2Y1IA 2DY4A 1DTTA 3PR5B 1QQCA 1C0TA 1RTJB 1TKZB 4OPJA 1RTIA 3V9XA 4PUOA 4CEQA 3OYNA 3LP2A 5HRPA 3ISND 5DQHA 5E41A 4I2PA 2CKWA 1S1UA 1IG9A 3K57A 4KTWA 1XI1A 3RMDA 1JLBB 1T03A 4NLYA 3HL8A 4DSEA 4CJWA 4DQQA 1W9HA 3KK3A 4W5QA 2IBKA 3RMAA 4KI4A 4CK1A 2R8GA 1T05B 1GX6A 5FRNA 2RF2B 2R2SA 2W8KA 1ITGA 4QAGA 3IGVA 1C1BB 4Y2CA 2YKMB 3EYZA 4AHRA 4NLVA 4DTPA 3RMBA 4CJFA 4N47A 3V9SA 4KI6A 1N48A 1HJRA 1NKCA 2BGGA 2B6AA 3G6VA 3G10A 3NFAA 1TK5A 4Z4IA 5EU7A 1SUQA 4M94A 4RW7B 5C25A 4TY8A 1LWCA 3NCIA 5KFBA 5SZTA 3Q8SB 1VSEA 1KHWA 1CSJA 2BQUA 1RT3A 1HYVA 4ECYA 4IG0A 5KFGA 2W7PA 3SI6A 4HVJA 3M8PA 1KLMB 1SL2A 4IKFA 2HNZA 4CK2A 1ZBFA 3DM2B 2BR0A 4EBCA 1VSIA 4EZ9A 2XO7A 4KV8A 1IKXB 3C6TB 2XGPA 4E7LA 3CDWA 1IH7A 4TSXA 3JYTB 4RZRA 3MEEA 5DG8A 4HUGA 2AGPA 3LZJA 3G6YA 1KHVA 4XPEA 3ZCMA 4FLXA 4RW6B 4GMJB 1TV6A 5FDLA 3H59A 3I5CA 1BISA 4M3RA 4ECTA 4J2AA 1DLOA 3AVNA 3CQ8A 4JV1A 3CJ5A 4CFCA 1D8YA 2IGIA 4K4SA 4F2RA 2DFFA 1HMVA 4KAIA 4FBTA 2JEFA 3AVJA 3PX0A 3V6DB 4CEOA 1X1PA 2OPQB 4Y3CA 1NKBA 4K4VA 1RDBA 2AX0A 2EC0A 2V4RA 5K14A 5J2NA 2QK9A 4FW1A 3BDPA 1JLGB 4KB0A 3RBEA 3H08A 3SYZA 2G8WA 2HHQA 4G1QA 3D0PA 1TAUA 3IGNA 1WAFA 2B43A 3OL6A 3H5YA 1ZYQA 1U47A 1N6QB 3QZ7A 5KG0A 4ICLB 3RWUA 2QKKA 4KREA 1RBUA 4O44B 1LWFA 4JLHA 3KK2A 4KPYA 3NE6A 2VWKA 3QGIA 4CK3A 4O0IA 4EYHB 4CESA 3GIKA 2IM2A 1RYSA 3L2UA 4BDZA 5I42A 3HPGA 3RB4A 5F8GA 3KLEB 1S5JA 2YV0X 3DLEB 4K8ZA 3TAFA 3NGZA 4RW4B 3KHRA 2YNFB 2BE2B 3BQ0A 3UIQA 1JLEA 4NLGA 1YTAA 3FDSA 3QGGA 3LP0A 1N56A 4N5SA 5HLFB 2E9ZA 2GV9A 3MFIA 5FRMA 4H4MB 3C6UA 3V81B 4Y34A 4ED0A 2X74A 1X9WA 1JXBA 1ASVA 5EWGA 1TKTA 3OYDA 1KRPA 3DOKB 4RW8A 1BCMA 1XR5A 3RRGA 4ECWA 1WSIA 1UAXA 1BI4A 3MXIA 1Q8IA 5DQIA 4L8RB 2C28A 3QIOA 3QEXA 1VK0A 3ITHA 2HHVA 2XY8A 4CCHA 1HARA 1SL0A 2HVIA 4KHQA 3TAMA 4ED8A 3I5BA 4ZTJA 2IJNA 4BE2A 2HB5A 2IJFA 3VQCA 2ZE2A 5JS1A 3QNOA 3Q8QB 1S9FA 4FBUA 1HRHA 1S9GB 2XC9A 1VSKA 5KG4A 5HRSA 5L9XA 3LWLA 5KT4A 3OLBA 5D3GB 4YQWA 4ED7A 3KLIA 2KFZA 5EUHA 3PR4A 4E7KA 4O3PA 4DTRA 1RT4A 1TKXA 2HW3A 1D0EA 2ZKUA 1J54A 3HYFA 1C1AA 3DLGA 4TQSA 1FKOA 3PV8A 3HSTB 2UUTA 3TAGA 3KLHB 2O5DA 1RAJA 3DYAB 2FVPA 4NLUA 3OYHA 3RRHA 5I3UB 1C0UA 5KFRA 3U6FA 3OYMA 2DFHA 4ZP9A 4ECVA 2VA2A 4RNMA 4MKAA 3V9ZA 1HQUB 2HNYA 4LSNA 3MXMA 4F8RA 4YR2A 4DS4A 3LALA 4FJ9A 3VN5A 2E9TA 3GYNA 4CIFA 2XCPA 5CYMB 4J2EA 4DFMA 4PQUB 1RT7B 1CXQA 4CEFA 4NZ0A 2I5JB 4HTUA 3KLGA 3NH2A 4ED6A 1JLFA 3TVKA 3SQ2A 4Q43A 4ZMMA 1S1VA 2GBZA 4GVMA 2KZZA 4CEZA 1IM4A 1DTQA 2DFEA 2XY7A 2R8HA 3DRPA 4M3ZA 4DTNA 1BL3A 4ZVFA 1K1SA 2FJWA 4K4XA 3WNFA 2OPPB 2HHTA 2WOMA 4EO8A 5KFYA 2B5JA 1D1UA 3VQDA 2VG5A 4CEAA 3TQ1A 4BACA 3DLHA 5KFHA 2R8KA 4YR0A 1JLCB 2ALZA 1BIZA 3SQ4A 3L2WA 3H5SA 1REVB 1TL1A 3OHBA 3K5OA 1QE1A 4I7FB 4CHQA 3NKYA 1WSJA 4CJ3A 2WHOA 3MEDB 3KJVA 4HUFA 1JXEA 1T7PA 3DOLB 3PX6A 3NF9A 4QW9A 3IS9B 3SI8A 2RPIA 2QKBA 1C2PA 4F4XA 4CGGA 1NK5A 3G6XA 3DRSA 3C94A 3SUOA 1T3NA 1MMLA 3TWHA 1S4FA 4FZYA 5EDWA 2YNGB 3MECA 2OPRB 2PYJA 3HHKA 3P83D 2W9BA 3H5XA 3LAKA 2BQ3A 4KKOB 1L5UA 1NK7A 2ASJA 1JLAA 4CECA 4KFBB 3NBPB 2FVCA 4DSJA 4CE9A 4EP4A 4CJUA 5KFKA 3AV9A 3RTVA 2R2TA 5DLGA 4B9VA 5KFIA 4CEBA 1BHLA 4ID5A 3C95A 2ETJA 3V6HA 3KOAA 1QSLA 2XCAA 2BANB 4ZPCA 2YNHA 2WRMA 4URGA 4KAZA 4DU1A 4FK2A 3DLKA 3ULDA 4FJ8A 2ZD1A 1L3VA 4K4UA 2UVUA 2DTUA 4YP3A 3QIPB 4IFYB 4ECSA 1TL3A 1XHZA 4ZHRB 3LANA 1C6VA 1U49A 4RU9A 1Q9XA 4BE1A 4J9MA 3KLVA 2AU0A 1RDAA 4OL8A 4EBDA 1HYSA 3K5NA 4TQRA 4FS1A 1YTUA 3F73A 1FK9B 3PW0A 5KFDA 2AGOA 4MH8A 4RNHA 4QWAA 5J2MB 4R8UB 2JEGA 3IAYA 3PHEA 4KHWA 3BREA 4ECRA 2HHSA 2D5RA 1SH3A 2FVSA 2YHBA 3MEGB 3RBDA 3NHGA 4LSLA 4I9LA 3OL8A 4DTUA 3ZT3A 3LP3A 1TQLA 5KG2A 3NH0A 1UWBB 1HPZB 2RDIA 1U04A 3KNAA 3HVTB 2W9CB 4BDYA 1ASUA 4RG8A 4M3UA 4WE1B 4RNNA 3DRRA 4B08A 4FJXA 1IKYA 4Z4EA 3FRZA 2X78A 3VQQA 1QUVA 1CZ9A 2D0BA 1SL1A 3DDKA 1LAVA 2ZQBA 3KKRA 3F9KA 4E89A 1QHTA 4IRCA 2IA6A 5KT7A 3GV7B 2F96A 1B9DA 3OL7A 4FK0A 4MFBA 4I9QA 4FJLA 4NYZA 4YFUA 2AWZA 4O0JA 4ZPBA 3OSPA 4O3OA 4CEEA 1YVFA 2OPSB 3HVWA 1S6QA 2D0AA 3S3MA 4B9LA 4R5PA 1KFDA 3IG1B 1BQNB 1EP4B 2PZSA 1L3TA 2FBTA 2Z1HA 4DSFA 3QESA 4OGCA 1N4LA 5T7BA 4IFVB 3OS1A 4M3TA 2AJQA 3OJSA 4M45A 4ZVGA 4PUOB 2VG7A 3LAMA 3RR7A 2EHGA 4FLWA 5KFXA 4IR9A 2G8FA 2BRLA 1RTHA 3AVFA 3QGHA 1S1XA 2HVHA 4CEDA 3BGRA 4DLEA 4ELUA 4BE0A 4F4KA 2WB4A 3KK3B 1RTJA 3G0ZA 1TKZA 4NCGA 3EZUA 4E7JA 4NLRA 4W5OA 4KSEB 3RB0A 5J2QA 4OKJA 5KT5A 3VQ6A 4JV2A 5KT6A 4URSA 2FBVA 2OH2A 4FVMA 2IC3B 1JLBA 2CJQA 3FQKA 3NAIA 4XO0A 5KG3A 3THVA 5KFTA 1T05A 4Q45A 3HT3A 2RF2A 3KKSA 3CG7A 4Y1DA 4DQRA 3GQCA 4DU4A 1C1BA 2YKMA 3LDSA 4FJMA 1A5XA 4DU3A 4EEYA 1ZBHA 2P5OA 1RT2B 5C24B 5EWFA 3U3YA 3TABA 5C42B 3AVAA 3CM5A 3SPZA 4RW7A 4JRPA 4J9NA 3KLFB 3SUNA 2AGQA 4ZPAA 2HMIB 3LP1B 1TKDA 3VQEA 4W5NA 4CGHA 1XC9A 3QO9B 2FJVA 1RT5B 4ECZA 3SPYA 1S6PB 4O3RA 1HNIB 3E01A 1KTQA 3O3HA 3HPHA 4IG3B 3DM2A 1DLOB 2VG6A 3V4IB 3C6TA 2R2UA 2XI2A 3AO2A 3JYTA 1NK4A 3N6LA 3DMJB 3ZSWA 1L3UA 3M8SA 5F8IA 4MIAA 5KFVA 1RTDB 4RW6A 4Z4GA 1Z25A 3OHAA 3OYLA 2BQRA 3AA2A 5KGXA 4EBEA 1TK8A 1S49A 5CZ1A 4ED1A 5J2PB 5CYQB 4DF4A 4FK4A 5JXSA 3MR3A 2QV6A 4N41A 3V6DA 4OLAA 4DTXA 2OPQA 4O4GB 3SFUA 4CFAA 1LWEA 1N5YA 3QEIA 3KD5E 4CF1A 4M42A 2WCXA 5JUMA 1TVRB 2IAJB 3K59A 3PUFA 3PW4A 4LH4A 3L2VA 2XI3A 5CZ2A 1YT3A 4CJPA 1JLGA 1TK0A 3KMSA 4DTOA 3H98A 1S10A 4Z4FA 3VQBA 1RBVA 4QWDA 1F21A 1D9DA 4WXWA 5KFUA 1S1WB 4WZMA 3PO4A 5DG7A 4CJSA 3GV8B 4CHZA 4HYKA 4O44A 5L1IA 3AA5X 1JLEB 3NMAA 1KVAA 3QLHB 3CFPA 3N6MA 3ZSYA 1S1TB 3SUQA 1KLNA 2WONA 4X2BA 2P5GA 3KLEA 3BSAA 4B8CA 5F9LA 3DLEA 1MU2B 4H4OB 4NRUA 4FJNA 1TKTB 4RW4A 1NHVA 1RDCA 1GOBA 2KFNA 2YNFA 2D0CA 4RW8B 2DPIA 2BE2A 3LPUA 4ECQA 4CJEA 5KFWA 1QTMA 1CZBA 4KB7A 4NRTA 3ZT0A 5HLFA 2HNDB 1IKVB 1EETB 3S3NA 4E19A 3M9OB 3V81A 3I0SB 4CJKA 1WN7A 3OS0A 2YNIB 2Z1GA 3AO4A 3GIMA 3DOKA 4WZQA 2Y1JA 4FLUA 5KFNA 5HROB 3AO5A 2HWHA 4B3OB 4QWEA 2YHAA 4O3SA 5KRTA 4QWBA 2WK4A 2J6TA 5KFFA 3RR8A 4QW8A 4K4YA 4U6PA 4CFBA 3UDLA 3JSMB 4G3IA 1RYRA 4ECUA 4ZPDA 3QINA 1WLJA 2W42A 3BQ1A 3HXMA 3AVGA 2WTFA 3PX4A 1FKOB 1BQMA 4CHYA 3MTKA 3ZSVA 1S9EB 1K1QA 1S9GA 1C1CB 1JL2A 2ITGA 3CDUA 3VQ9A 3IRXA 4JS5A 4B9NA 4CGDA 3RB3A 1EXQA 1BIUA 4C8KA 3MAQA 4OJRA 1WSHA 3V6KA 4C8LA 3HPOA 1LV5A 3ZT2A 2Z1JA 3CO9A 5J1EB 3KLHA 3PO5A 3T5HA 4TN2A 2FLPA 3NGYA 3DYAA 5I3UA 3T3FA 5L1KA 5KTQA 1HQUA 1S1VB 1JXLA 4LQ9A 1RBTA 1UA1A 5KG1A 4NLSA 2YKNB 2DPJA 5CYMA 4Z4CA 4E3SA 4F4ZA 1DTQB 2RN2A 1RT7A 2I5JA 3NAHA 3P5JA 4KE5A 4WXOA 4E7HA 3H4BA 3OYCA 1HNVB 4MQ3A 4IH5A 2RKIB 4ZVEA 1LW2B 2D7SA 2B5JB 4Q0BB 4NLDA 1ZBLA 2V9WA 3OLAA 5DMRA 4CF8A 4DG1B 5L1LA 4CJLA 3UQSA 5F8JA 1NJXA 3OYJA 5HP1B 3SV4A 2OPPA 1S48A 3V9UA 1LW0B 4F2SA 3KK1B 3KJVB 4RW9B 3NH1A 4PA1A 3VQ7A 1JLCA 1SV5B 3VQAA 3I5AA 2FBXA 2W9AA 2BDPA 4J2DA 4CF2A 1REVA 2OZSA 4Y1CA 4F50A 3NL0A 1R0AB 4NYNA 4KHSA 2Z1IA 4DLGA 3M8QB 4GC7A 4I7FA 3BJYA 1B92A 3AA3A 1XHXA 1RDDA 1JKHB 1BGXT 3MEDA 4I2QB 1Z4UA 5HBMA 2HHUA 3CJ3A 3DOLA 1RDRA 3MR6A 4RNFA 3IS9A 1TAQA 4J9PA 1CLQA 4WYLA 2HHXA 2JC1A 3EZ5A 1WSFA 2V4QA 1KFSA 5FROA 4FW2A 4J9LA 2KQ2A 1W0HA 2YNGA 5F8HA 4J9KA 2OPRA 3KHLA 4XPCA 4FZZA 1X9MA 3CVKA 3N6NA 4HHTA 3PW2A 4M3YA 4KKOA 1C0MA 4B9MA 2YNHB 4R0EA 3D5MA 4KFBA 4Q5VA 1CXUA 4HKQA 3B6PA 3NDKA 3EPIA 2QXFA 4DTMA 2C2RA 1S0NA 4CIGA 3D45A 4FLYA 4ELVA 3FFIB 4LQ3A 4KHUA 3V1RA 4IDKB 3PY8A 3E51A 3SQ0A 3D28A 3I0RB 2BANA 4OKEA 3RB6A 3GIJA 4KO0B 2Q3SA 4C8OA 1RBSA 4E1MA 4JRQA 4DFPA 4Z0UA 2X6NA 4H54A 3QIPA 4IFYA 4DEZA 1NOYA 3O3GA 4DL6A 3ISNC 1SH2A 4AHCA 2XHBA 5C5JA 3OYBA 4YNQA 1XR7A 2XGQA 1RT6B 3Q8PB 3IN5A 3ICLA 3QIDA 3HVRA 3UPFA 2C22A 1FKPB 1FK9A 2J6SA 3V1OA 4WFXA 4DMNA 3VQ8A 3ZT1A 5J2MA 1JLQB 4R8UA 4PWDB 4AILC 3MEGA 3A2FA 1VRTB 1IKWB 1VRUB 4FXDA 5KFAA 1UA0A 1UWBA 3OYAA 1HPZA 3T5JA 1WNSA 4J2BA 2QE5A 1J5OB 4RNOA 2LSNA 3HVTA 2D3ZA 1HQEB 3ZSZA 5KFMA 4K4TA 2HHWA 1O1WA 1RT1A 4WE1A 3QETA 3L3VA 3U3GA 3LZIA 4DFJA 4DL4A 4BWJA 4DL2A 3AVMA 4BWMA 4NLPA 3CWJA 3WNEA 3RAXA 1WSGA 4AHSA 2R8JA 2ILYA 4CJRA 3DI6B 1KSPA 3QEWA 1LAWA 5KFZA 3BSOA 3AO3A 4C8NA 4QOZB 3KTQA 1QSYA 4E0DA 3CJ0A 1DTTB 3PVXA 1C0TB 3FSIA 2G8KA 1RTIB 4F4WA 2IM0A 1TP7A 4WYWA 1Q9YA 2OPSA 3LP2B 3M8RA 4I2PB 3ZSQA 4CJ5A 5DQGA 4J9RA 1S1UB 1W25A 3MXJA 3KHGA 4TYAA 3NGIA 3IG1A 1BQNA 4NCAA 5KFSA 1GOCA 3TI0A 5DGAA 5KRSA 2KW4A 1T03B 4CERA 1VSLA 1QAIA 2JEIA 3HK2A 4IFVA 4NCGB 3OSNA 4K4WA 1IO2A 3OL9A 2J6UA 4DS5A 5J2QB 3TAPA 4M3XA 2P51A 2JC0A 4B9SA 3WNGA 4H8KA 3OS2A 4RUCA 1J53A 2ASLA 4CJVA 4CGFA 2G8VA 2B6AB 1G15A 2GC8A 2GUIA 4IOBA 5CY4A 1SUQB 2KTQA 5C25B 1S0OA 4DF8A 4TY8B 4K50A 1LWCB 4F3OA 5F8MA 4ZVHA 3NGDA 4CJ4A 3HP6A 1L3SA 3QZ8A 1RT3B 4W5RA 1U4BA 3PJXA 4IG0B 3V6JA 2IC3A 4DSIA 3M8PB 3SV3A 3QEVA 1NK9A 1NHUA 4KBIA 1NJWA 2HNZB 4B8AB 4NLTA 3H4DA 3PZPA 5L1JA 4ZTFA 4KV8B 4WFYA 4QPXA 4FJKA 3TAQA 3MEEB 3PW5A 4IKAA 2F8EX 3AVLA 3DLRA 1RT2A 1NK0A 1NK6A 5C24A 3E01B 1ZTWA 1KLMA 5C42A 3HP9A 5KT2A 4QCLA 1TV6B 5FDLB 1FXXA 4FYDA 4DL7A 3KLFA 3AVIA 1QS4A 2VG6B 1IKXA 5EWEA 2HMIA 4M3WA 3LP1A 5KFEA 1RCHA 4IQXA 3CYMA 3QO9A 1U09A 2P1JA 4RUAA 1HMVB 1RT5A 4NCBA 5T14A 2EX3A 3ASMA 1S6PA 1HNIA 2NUBA 3TAEA 4IG3A 3KHHA 4CHOA 4CGJA 3V4IA 3BQ2A 2JLEA 5K14B 5J2NB 4FJ5A 4C8MA 2UVWA 3FQLA 4TYBA 4FM0A 3DMJA 1JL1A 4UQGA 2PY5A 4FJ7A 4G1QB 4F3TA 1RTDA 5KFCA 1LWEB 1N5YB 4ECXA 3I8DA 4O3NA 3WNHA 2R2RA 4J9OA 1LWFB 2IMWP 3KK2B 5KFLA 4HUEA 3T1AA 5J2PA 3TR8A 5CYQA 3GIIA 3P1GA 4LD0A 4DWIA 5I42B 4EYIB 2E6MA 4TLRA 5DG9A 3T19A 4O4GA 4CF0A 4O3QA 1N6QA 3NF8A 3AVCA 4ICLA 3H2LA 4XIUA 5DGBA 1TVRA 2IAJA 1EKEA 3QEPA 4FJIA 3GV5B 4B9UA 3HM9A 2IM1A 4DQIA 3LP0B 4WFZA 4KRFA 3CJ2A 2AQ4A 4YR3A 2WONB 4K8XA 3C6UB 1S1WA 4GW6A 4Q8FA 5HRNA 4ZP8A 2D41A 4AHVA 4J9QA 4K4ZA 4IRDA 5KFQA 1NOZA 4MK9A 2E6LA 1BI4B 2FVQA 2UVVA 3QLHA 2D3UA 3CDEA 4CGIA 4LY7A 3ITHB 3G86A 1RA7A 1S1TA 4H4MA 2OA8A 3L8BA 2KZMA 1ASWA 1MU2A 4H4OA 3TAMB 3LPTA 2BRKA 2E4LA 4ZP6A 4FCYA 3SFGA 3SQ1A 2ZE2B
chains in the Genus database with same CATH superfamily
5IT4A 4WYBA 5AQMA 2HNDA 1SJ3P 2AEMA 4I6AA 1IKVA 1EETA 1BWVA 4CHNA 2QSFA 5LMNK 3HX9A 2DNMA 3ZX0A 4KHYA 3AA4A 2N4DA 1PKUA 2FIUA 1C0FA 3KLIB 4GVEA 4P7TA 3DLLQ 5IXUA 3DN9A 1D5AA 2G8IA 4AD6A 5HROA 1RT4B 1CQNA 1IVZA 2MSSA 1HHQA 2RSQA 4B3OA 2R7YA 2VQEF 1X5TA 5JVHL 4J91A 2DO0A 1TFWA 3EEQA 3A8KA 2YHYA 3BY5A 2HFOA 2KHCA 4CJQA 4MKBA 1K8KB 3HZEA 3D0HE 3S3OA 1I6JA 4DI6A 1Y11A 3CIZA 4CBUA 5LMUK 1GQEA 2IY5B 2XY5A 4USTA 1GLJO 3DXBA 1JLFB 2ATCB 1U45A 1U1LA 1UTAA 2PAVA 2N7CA 3MR5A 3O5TB 4FF1A 1UW9A 1LFWA 1B7FA 1C4CA 1GXTA 5J1EA 3DRPB 3EM1A 2JDJA 4DKWA 4Q8EA 2I1RA 3BSCA 2WOMB 2N7YA 4NLOA 4BS2A 1G99A 2VG5B 4Y2AA 1BCOA 4CZLA 3HO1A 5B0FA 3CJBA 1SJ1A 2POKA 2EKYA 4JI5F 2A1SA 5HI7A 4ZITA 5L46A 2JEJA 1M5KC 2HFZA 3G87A 2VF3A 4FF3A 1JCGA 1X9SA 4M5KA 3BZKA 4QJVA 2JHEA 2MGZA 4DG1A 2C3PA 3DXMB 2AZ3A 4YDXA 1FTCA 1M1KO 5AQRA 2F5GA 1FJGK 5HP1A 3CC2S 2DRBA 5HSPA 3WXJA 3KD1E 2V8HA 5AQHA 4ELTA 1RSCA 4RW9A 1N8RT 4M95A 1GEHA 4LBHA 2NCKL 4F36A 1XWLA 1JLAB 1CC7A 2JLFA 3G71S 3MMVA 3G9CA 2LYVA 1S72N 4AUKA 3KJNB 3PJWA 4LVNP 2GA7A 1VLOA 5G0RA 3GPAA 4URQU 3TW0A 4DR1J 5ETSA 4FM2A 2FVRA 1WKKA 2GCFA 2ZH5A 4QU7A 1XUPO 3HTVA 2ZJQL 3DLKB 4O55A 1H1VA 4BC3A 3CC4N 1RAHB 4OZ1A 4X4OA 1KCFA 1D9FA 2JFDA 4WFNL 4NXNK 5ETOA 3ZXWA 4BDPA 3SBGA 5AXNA 2QWMA 4ZVUB 2WBMA 1S97A 4CFDA 4LF8J 2QA2A 1HYSB 4EO6A 1BUPA 4JKDA 1D4XA 3NNAA 3H1VX 3ZZUA 5H1SV 2EFOA 2CA9A 1WF1A 4H5RA 4KB1A 5KFOA 2V63A 3LH2S 4LF5J 3H90A 2HF3A 1VIXA 3AT1B 3O4QA 1BA0A 3KIOA 4M5MA 4NYFA 4HCBA 5A6WA 2VA3A 1CS4A 1APSA 3Q89A 4FJGA 1E3MA 3MOZA 3RAQA 5DS7A 2AJ4A 3NAEA 2XYGB 3J7AP 3FZ2A 1RT6A 2MQPA 3BSNA 2WB1D 2YHWA 4IH7A 1T8EA 2A1RA 1IQTA 1Y0HA 3WC2A 5F8NA 2XO6A 3ZZOA 1RBRA 2ZF5O 1FKPA 5ADZA 2V0NA 4MO4A 4J9SA 2HS3A 4PWDA 3OVSA 2JWNA 3OYIA 4MFBB 2G8UA 3NS6A 1VRUA 4OJ3A 3E8OA 2MZTA 2EK6A 2Q3PA 2E5JA 1J5OA 4C3MA 2ASDA 1HQEA 1FJGF 4DTJA 4R5PB 3NS7B 1YVUA 1S3XA 3N4PA 4OPKA 3C16A 2KG0A 3GJRB 1NJZA 3I9ZA 1FDAA 1SKRA 3TX0A 3FVYA 2W8LA 2E2OA 3OUYA 4USVA 4O8KA 3FZFA 4DQSA 4IO1A 4A8YA 4RWTA 3BGRB 1EP4A 2ZBPA 1ZM4A 3ALYA 3ZSRA 3R3LA 4NLWA 5E3PA 4IOCQ 1HD1A 2RMLA 5JMVA 3OYNA 5IWAK 3KNGA 5C7PA 2CKWA 2ZBQA 5KPRA 4GV9A 4GVLA 1IG9A 1RWVB 3Q8VA 4UOFA 2QL7B 3TP2A 1RWUA 2B9YA 4KI4A 5LJVA 3JXOA 2D4WA 4AHRA 2B0GA 4DTPA 4WBFA 3C8YA 4C98A 4CO0A 4OHYA 2IVNA 1HJRA 1VQ5N 1V3ZA 3CGIA 1OMSA 1WOOA 4N8NA 5GAHU 4DX6A 1SUQA 4RW7B 1LWCA 1VYAA 2LP4A 1GMWD 3Q8SB 2YJFA 4ZN3A 1HYVA 3GG0A 4IG0A 2W7PA 3SI6A 3M8PA 2KL8A 1SL2A 2M7SA 2YPYA 4FWPA 4CK2A 3PIPL 4EBCA 1VSIA 2XO7A 2NZTA 3C6TB 4B3SK 4E7LA 3CDWA 1IH7A 1ZZNA 3UN5A 5DG8A 2OKQA 2N4CA 3I56S 4CI6A 3TYTA 3ZCMA 3UKRA 2HHPA 1DQ8A 3C14B 4ECTA 3S41A 1QAXA 2CPZA 4RL1A 3SDEA 4M8LA 2DPNA 2M5YA 2KXNB 3MN5A 5JVHQ 2V8PA 1HMVA 1U0SA 2HG4A 2WW4A 4KAIA 2UXDJ 1SQGA 2JEFA 3N4QA 4B3MJ 3AVJA 3PX0A 3V6DB 2HOEA 2RU9A 1X1PA 1VOMA 2OPQB 3LPEA 4CBWA 3FEXB 2OEKA 3MPUB 1J5EK 3MN9A 5GMKa 5K14A 2P9PA 5J2NA 3EE9A 1ZAXA 2QK9A 4FW1A 1NM1A 1RU2A 4KB0A 2JZ5A 3H08A 2AW0A 4G1QA 3SMSA 1KVKA 2KT5A 3OL6A 2U2FA 5TKWA 1N6QB 3FRYA 2Y9HA 1N0VC 2QKKA 2DH7A 4CT9A 2QA4S 4KREA 4LF9K 1N36F 3NE6A 1IQZA 3QFUA 4EYHB 2VC0A 3GIKA 2MLYA 4MKVA 4BDZA 3HPGA 3B82A 2XG8A 1YJUA 4LR8A 1H73A 1X4AA 4K8ZA 2MY8A 2QL9B 2W25A 2RJZA 3G2XA 2CPIA 3BQ0A 4B17A 3UIQA 1JLEA 1YWXA 4IO8A 1U1NA 3FDSA 2V8DA 1UFKA 3LP0A 1N56A 2GV9A 2UU9J 3MFIA 2CG4A 4DPXA 1JXBA 3WDOA 1TKTA 3D6FB 4ZVOB 2QLWA 3SLCA 3PEJA 3SBTA 4RW8A 1BCMA 1WUAA 3CT9A 1Z6RA 3TZWA 1Q8IA 2QG9B 2O8BA 4DPYA 2RH3A 5A8WB 3CCMS 2GW8A 3EN9A 5F1XA 3ZZYA 5DM6L 1SL0A 5IC6B 2KYXA 3RW6A 4OX9F 2AJ0A 3F9MA 1IBKK 4ZTJA 2V8GA 2HB5A 4EFHA 3M7VA 3CJTA 2GAGC 2YKAA 1S9FA 3DRYA 4WU3A 4FBUA 1URRA 2XC9A 5HRSA 1URNA 2XMJA 5AQXA 4BRIA 2VBWA 1NHKL 1NPRA 4RO0A 2HW3A 4DR2J 1D0EA 2BM0A 1H72C 2DEJA 4TQSA 3I33A 1FKOA 3HSTB 2UUTA 5GAGP 3TAGA 3L7PA 4WFAL 5I3UB 1M1HA 1WEXA 4ZP9A 4ECVA 1WKJA 1SJQA 1KDNA 4LSNA 3DHXA 4YR2A 3MM9A 3D6TB 4C8ZA 3AY0A 1U25A 2PMZD 5CYMB 1J5EF 2RB7A 4DFMA 3MCNA 3HOSA 2I5JB 3WXIA 4CM2A 4HTUA 3KLGA 3MPVA 5ETNA 3ILIA 3NH2A 4ED6A 3TVKA 1R27B 4Q43A 4ZMMA 3HHLC 4FVCA 2A6OA 5AQQA 5HL7L 2CQPA 4L3NA 3UCZP 2KZZA 4C4WA 1IM4A 1IUJA 3CDBA 5AZJA 2R8HA 4X62K 5TKYA 4EFAC 2NREA 2OPPB 2JWLA 2J8AA 8RUCA 1U2VB 3DLHA 4BACA 5DM7L 3IAS9 4DR4J 2F9DA 2R8KA 3CCLN 5HK4A 5AE1A 3AQOA 3H5SA 4CWBA 1W2IA 4I6MA 1V9OA 4J37A 3CO0P 1GLFO 5DETA 4RBUA 5H9FJ 4X84A 4DU8A 4JI7J 3C19A 4BR4A 3CCJN 3W1YC 1CULB 4Z2XA 1OQ3A 2WHOA 3CETA 3SCIE 1T7PA 3PX6A 4NLBA 4F4XA 4B1ZA 4CGGA 3DLJA 4Q7AA 3DRSA 3RBXA 2O8EA 2I2YA 1OY8A 1ZM9A 3TWHA 5EDWA 4DUZF 3KXDA 2H5EA 1N33K 3W60A 2B56A 3KJQB 3P83D 3IBWA 5AXMA 5A6PA 4XEIA 2BQ3A 3SK3A 3W65A 1NK7A 2ASJA 3BH6B 4CECA 4OZJA 3LF0A 2FVCA 3ATUA 4CE9A 4CJUA 2QFJA 3T1YJ 1WF0A 3AV9A 3PSFA 1UL3A 4JV5J 1PJ6A 3M32B 3CJ7A 1HI0P 4ID5A 3C95A 2ETJA 3V6HA 3KOAA 1QSLA 2CGLA 2BANB 3BR8A 2WRMA 3FKBA 4DR3F 4Z37A 4PXBA 3OBWA 1TL4A 4ZPWR 2UVUA 2NRVA 3M2RA 4JKGB 4UY8O 2RHQB 3DRXA 1BHNA 2Q6BA 4ZHRB 1NU4A 1X0PA 4A8SA 1QVGR 3IMXA 1OH8A 3M6UA 1FWPA 1C6VA 2F4VF 4OYXA 1U49A 3OPKA 4OL8A 1FESA 4PR6A 4TQRA 1Z2LA 1RWXB 4FS1A 4IEIA 1FK9B 4JP8A 3WC0A 4USMA 2AGOA 4RNHA 4QWAA 3IAYA 3G71N 2FVSA 2YHBA 2NSCA 4A8MP 2YWWA 2XHWA 2CDRB 3OL8A 4R79A 1HQ2A 5KG2A 1UWBB 2ASYA 3SQOP 4M5GA 9ATCB 2W9CB 4TNOA 1VQLN 4M3UA 4WIIA 1OIAA 3I55S 1OQ6A 4W92B 4AL6A 2ASPA 4NLCA 3VQQA 2D3OR 1CZ9A 1WB9A 1ZM2A 1E6VA 1WF2A 4JI0J 2CVIA 3QBCA 4HR2A 1SJFA 2BJ9A 1SS6A 3T1HF 2IA6A 3GV7B 3DAWA 3GFYA 1MWZA 5H1SQ 2OTLS 4FJLA 3LGNA 3VTHA 4YFUA 5JLFA 4O0JA 1HPMA 1HI1A 4CEEA 2DR9A 3VEOA 4LF6J 3HDSA 1VK3A 4LF4K 1KFDA 4QYRA 2ROGA 2PZSA 1CJTB 1HFEL 1N33F 1KXPA 4DSFA 2EVZA 4IFVB 2QRRA 3CCUN 4PUOB 4DR7J 3B8HA 3W62A 2ZDPA 2QW9A 1F6TA 3AVFA 3VCDA 4M7YA 3R6LB 2AYBA 2LU1A 4DLEA 1TZ0A 4ELUA 3HJVA 1JNZB 2H1YA 4WPAA 4OKJA 4OQJA 4JV2A 2NNWA 2QXLA 4QR0A 3EZWA 2CQHA 3O9UA 3GYGA 4BRDA 1TELA 3FQKA 4WJBA 4JI6J 2G1DA 4OYBA 2HFVA 4Q45A 3MCMA 2RF2A 4DQRA 3GQCA 2QZ8A 2YKMA 1HKBA 2I38A 4ANCA 1ZBHA 4LFCK 3D6RA 2FB0A 4QIEA 5C24B 2CPXA 2MB0B 3AARA 4ILGB 3MM8A 3NVMA 3QAEA 3UKUB 2FZKB 4K0KK 3BBCA 3PFEA 2VPZB 2HMIB 2D9PA 4OI4A 3VALA 1JB0C 3UDEA 1TKDA 3VPZA 3VQEA 2F7VA 4W5NA 4CGHA 3X1LB 4CLTA 1RT5B 3GJQB 4ECZA 1P9QC 1XIQA 4O3RA 1HNIB 5D4LA 1KTQA 1HNWJ 3O3HA 4R25A 3LO3A 1MN7A 3QJLA 4YHHJ 2XI2A 1QVFM 3ZZTA 3H2VE 4KGXB 3GSIA 3PYDA 2FXUA 1RB0A 2ZNYA 1SBRA 4CT8A 3QQCD 5JICA 4YOYA 4AXIA 1Z25A 3QNWB 4OIXA 3OYLA 2E88A 3AA2A 2QJ3A 3E1YA 4C3LA 2AJ2A 4WTOB 5CYQB 3ZETB 3A3NB 1IBLK 4DF4A 1H2VZ 4ZK7M 4TU9A 2IBOA 1XNRK 3U9DA 5THWA 1E4GT 4EMDA 4A47A 2Z30B 4V19S 1FI4A 1MW7A 1TVRB 2GVDA 3MMBB 3PW4A 4DV2F 2ZEJA 1YT3A 3H0PA 4D3GA 3KMSA 2FF3B 3CMAS 2RRNA 1RBVA 4OI2A 1F60B 2DK2A 4Z94A 4WXWA 5HL7Q 2OEMA 1FDBA 5DG7A 5JLHA 3GV8B 4DU7A 4CHZA 4IJAA 2K7JA 2MQMA 2N3OA 1KVAA 1KOHA 4KH0B 3CFPA 1UVKA 3ZSYA 3M8WA 4F04B 1UPMB 3DGVA 1HJOA 3IP0A 1DEJA 4LRCA 2IPOB 2DPIA 3LPUA 4CJEA 2GIFA 3CJKB 3MZIA 3ZT0A 4PHTX 2Y8YA 5GAHP 2ZJPL 1UVJA 3BDEA 3V81A 4CJKA 1WN7A 1OO0B 2V4JB 1UVLA 3OS0A 2YNIB 4WP9A 1RAEB 4RPFA 2ACMA 4PKDB 3AB4B 5KFNA 1AZSA 3D1HA 3FZKA 2GTDA 2XZDB 1NDKA 2DR5A 4A2BA 2QA4N 1ILYA 2ADBA 5GINA 5KRTA 4L3QA 4K4YA 2VQEJ 3DFEA 3UDLA 3JSMB 1RYRA 5F0UA 1HHSA 3A8IA 3ZSVA 2OSQA 4Z7YA 3QB0A 1K1QA 3IXQA 1YZ6A 3CDUA 1N5VA 3VQ9A 3ZLJA 3TZYA 3EDRB 3QRRA 2KHDA 3CDAA 2F4FA 3W8GA 1WSHA 1VQON 1VHFA 3HPOA 3A3PB 4EWTA 4PL7A 1MNEA 3VGMA 3MMCB 3KLHA 3T5HA 3WQUA 1UZDA 3GR1A 2B3TB 4CZJA 2LA4A 2XMMA 2AEJA 2KM8B 1LK7A 2AIRB 5KTQA 1HQUA 1JXLA 4QYZJ 2R7RA 3K9KA 4ITSA 2WTUA 1T3OA 2DPJA 3HSCA 4Z4CA 3F56A 5HQLA 1VCTA 1RT7A 3SSRA 4YEAA 4Y0FA 2V67A 3P5JA 1AW0A 4E7HA 4JI5J 4MQ3A 4ZPVR 2RKIB 2Q6CA 4ZVEA 1LW2B 1FJ7A 2B5JB 1ZBLA 3H46O 1WOQA 3OLAA 4HHHA 5DMRA 5M2PA 1UJ5A 4U7UD 1HA1A 2RS2A 1YZ7A 2CAJA 2UUAK 2EWHA 1DY3A 1YHQS 3HLUA 3V9UA 1FRXA 4F2SA 3FR0A 3KJVB 4MYUA 3OXFA 3MHYA 3VQ7A 4EU0A 1JLCA 3QGPA 3I5AA 1EQMA 1Q79A 2F40A 2W9AA 4ATNA 2GZOA 4F50A 5M1QA 4QZVB 3QT7A 2KDOA 4KHSA 5B0GA 2Z1IA 3D6MB 4DLGA 3M8QB 4GC7A 2ERRA 4I7FA 5B0BA 1JKHB 3MEDA 4I2QB 4DV0F 3MR6A 4RNFA 4JOUA 2BW2A 4A8OA 2LEBA 5LMNJ 1WSFA 2V4QA 5FROA 4ZJLA 1FRLA 4FW2A 2MYFA 4ISEA 4L76A 2YNGA 2P9SA 1FE4A 4FPIA 5F8HA 2OPRA 1VQPN 3KHLA 1Q4RA 3CVKA 3PW2A 2E1MC 4Y28C 5HMWA 4HI2A 4B9MA 2BV3A 1YJ7A 3OA9A 2VC1A 3I4PA 4Q2LA 3W9JA 3SSQA 3P5BP 2GEMA 2CIMA 4HKQA 1S5ZA 3BB5A 3ZTQA 3H45C 1S0NA 3O5BA 4ELVA 4IDKB 2L48A 2YH0A 3I0RB 3R1XA 2CQ0A 2Q3SA 1RBSA 2DNKA 2UXBK 5CR4A 4JRQA 1U2CA 3FZMA 2DR7A 3DU6A 3C46A 1YXQA 5AQPA 3QIPA 4IFYA 4C11A 3GYXB 5E5NA 5BRDA 3O3GA 3ENBA 3ZNUA 3ISNC 2MQLA 3GG1A 2DRDA 2XHBA 2QT7A 1WWHA 3D0GE 1XR7A 4YY3K 4JI3K 5ETTA 1MROB 1RWPB 3CD5A 3M30A 5A8KB 5HJYA 3LDNA 1TL7B 2P9KB 3L4QA 2W24A 1HW9A 2H5IB 1Q86O 3TTCA 4WFXA 1F5AA 2NPFA 4OX8A 3UNYA 4C0HA 6FD1A 4D3HA 4CIOA 1AROP 3D54A 4MDAA 3T5JA 2EWSA 2QE5A 3JXUA 3LTOA 4M63A 2ASMA 2L9DA 5HANA 4K7QA 5KFMA 1ZOTA 4K4TA 4JBCA 1O1WA 4GKKK 2KVIA 1HBMB 1FJGJ 3QETA 3U3GA 4FWLA 4YB7A 3HSJA 4DL2A 3AVMA 3POTB 3R7SB 3WX8A 3RG6A 1QQOA 3DI6B 1KSPA 2JWKA 1Y64A 4J7CA 1VJWA 3UCUP 3PVXA 4F4WA 2MXYA 5AQIA 1DFDA 4NI2B 2OPSA 1AXQA 3R8YA 1X4DA 4I2PB 2B7CB 5DQGA 1S1UB 4J9RA 5L39A 3HD1A 4TYAA 1NG9A 3IG1A 1BQNA 2DNZA 5KRSA 1T03B 3NCQA 4CERA 1VSLA 1QAIA 2JEIA 1FT8A 3HK2A 1VC0A 2ZVIA 4FWNA 2MQQA 4FWSA 4N7TA 1KS2A 3MEKA 4NCGB 5JVGL 4JN4A 4JB8B 1IO2A 2J6UA 3OHRA 2HYIB 1IJEB 3BZCA 4M3XA 2V7YA 1O6XA 2OSRA 3QMQA 3IBFB 2P51A 2JC0A 3WNGA 2HSTA 3OS2A 3ZZZA 4KIAA 3Q7CA 4G65A 1QVGM 2XHCA 2B6AB 3R6MA 1BDGA 2UUCK 3MM7A 3AXKA 3P8BB 4IDHA 2DITA 2KTQA 4DF8A 4K50A 4TY8B 3L7UA 1U0HB 4EHTA 3HP6A 1L3SA 1U4BA 2PN6A 4C6AA 3SIPB 3PJXA 4CZIA 1VQ9N 4CO4A 2UXBF 1FHTA 1NHUA 4KBIA 1NJWA 2DXFA 4C9DA 4DR6K 1K9MO 3D68A 5L1JA 4KV8B 3C65A 3NGSA 4U7BA 4JI3F 4WQ4A 3MEEB 1XEZA 4IKAA 2HFNA 1RT2A 4E1JA 1NK0A 1NK6A 3E01B 5C42A 1HBUB 3MPWA 5FDLB 1ZH5A 3P49B 2IVYA 3R5JB 2Z57B 1FXXA 1V6HA 2VGMA 4FYDA 1QS4A 4HH1A 5EWEA 2O8FA 4M3WA 3IUCA 1M1GA 3LP1A 3OVAA 4WWSA 1SQKA 4DV3K 1RCHA 3I32A 4USJC 1V4TA 1U09A 4IJNA 5T14A 4ILMA 4KR0B 1S6PA 2NUBA 3FNNA 5KOWA 3TAEA 4GY2B 3W9IA 3C14A 5IV4A 4K41A 1E6YA 1F5BA 4B02A 3KZBA 2QWOA 1SKUB 2HIQA 3C15B 2IRUA 2RIJA 3VZIA 2UVWA 3FQLA 3DMJA 2HHHK 2H65B 1VQMS 2V8VA 1UAWA 2ZHBA 1LWEB 1N5YB 2KXFA 3H20A 3ILOA 2R2RA 1LWFB 2IMWP 5KFLA 4HUEA 3SJHA 1N36J 3C6AA 3EVOA 4W4MA 3CJ1A 4DWIA 4F4AA 4TLRA 4CP5A 1N6QA 4H4KA 5D6GA 2IRYA 3GR0A 5DGBA 2M8DB 5L38A 4AQYK 2QMWA 4X4PA 1CJUA 3GV5B 4B9UA 1NU0A 2XYPB 4F3QA 1NBWA 3R5BA 2BJ7A 2ZH6A 4DQIA 4PABA 2HEKA 1HUXA 1I5OB 2Z4PA 1GMVA 3CJ2A 1TYQB 2HQIA 3C6UB 2U1AA 2DHSA 1PYOB 4OZ3A 3BGUA 5EHHA 3PDNA 3FEYB 2UUCF 4MK9A 2DYAA 5F0WA 3THXB 2UVVA 2D3UA 4CGIA 1P1LA 3ITHB 1S1TA 3VF4A 2OA8A 1ASWA 1R6YA 3M3ZA 3TAMB 1VRQC 2FPHX 2E4LA 4A4JA 4ZP6A 3SFGA 5BR8F 3VEVA 1GXUA 4OX9J 5A8RA 5LJ3Y 4DR6F 3CD0A 4DL3A 3AO1A 1ZETA 2P9UA 4J9VA 1S0MA 2V94A 3I0SA 3AJDA 3L3UA 1HW8A 4CZKA 3W2WA 3DCAA 1PYSB 3QT6A 1VSHA 3M9NB 3IR6B 2VOOA 3PYEA 2XNQA 1R8CA 3OR2A 1NMEB 2FJXA 3HRGA 3H5UA 3OVNA 3THYA 4KTQA 3QFPA 1U2RA 1IM6A 4FYXB 2F8HA 1WDDA 1SC4B 1VSDA 2A6AA 5B09A 3QERA 2UV8G 2IVPA 3THPA 5AR0A 1YIJS 3TSPA 5GADI 1N5TA 2RDJA 1S9EA 1J5EJ 2Q0RA 3J8AA 1C1CA 1EZZB 4GC6A 5IQQA 3BBBA 4EP5A 4OLBA 1SQFA 4IXCA 5I3QA 3GILA 2IOCA 4JUZA 2A5XA 3NXZA 2VJVA 1HNXF 3PFOA 2AP1A 4CHPA 5KG7A 2H4WB 2OD4A 2DR6A 4KHNA 5GIOA 1OVQA 2KRRA 5D0HA 1RCOB 4CF9A 4CD3A 2ZC4A 2PEHA 4DCOB 4B3TK 4PXEA 4HH0A 4CIEA 3VEWA 5DO2A 2MHEA 3H25A 1TL1B 1K6YA 1QM9A 1NB2A 1HNVA 2OGUA 2VPWB 2GWKA 1NGDA 2QLBB 3A5NC 3K5LA 1QE1B 3GJTB 1UEUA 5EY4A 4AHUA 3CC7S 1RKJA 3VQSA 1KVBA 3TANA 5HRRA 1LK5A 2KU7A 1WOSA 3MECB 4K5SA 1RWNB 1LW0A 2VOPA 3KK1A 4P2XA 2ZH1A 1AA1B 2HQDA 4C0OC 3TZZA 2F9WA 3VETA 2W9BB 1SV5A 3CMES 1YJWN 2VFTA 1EAYC 5IT9O 1ZM3A 1R0AA 1WORA 5LY3A 2C2DA 1RWWB 2GV1A 2FBYA 3AVHA 3LWMA 4H0TB 1JIHA 5DDRC 4DV6K 4IRKA 2V51B 1U1KA 1IJJA 3S9HA 4C7QA 3IR7B 4JS4A 1Y3JA 2RDDA 3EVMA 2QWLA 1YI2S 3PLAA 1R59O 4ZPTR 4DCHA 2WUSA 1W2BR 3IFEA 4N56A 2I7NA 2OTJS 5DJBA 2R8IA 2OZMA 2I9SA 3O4NA 1EIYB 1Z1ZA 4JI1K 3PHTA 3MCPA 3QWPA 3CFOA 1H0HB 4PEOA 3FC9A 3VEZA 1X8DA 1FW6A 3O08A 2ALYB 3ZTRA 4A2AA 4QIGA 2F4VJ 5JS2A 4IOAQ 2QGFB 1OS5A 3ADAC 3FMWA 3OTCA 1O0PA 3US5A 3KUEA 2GVZA 1YJ9N 4DHVA 4YB5A 3FFIA 4ZHRA 3BR9A 4LFBK 4YOUA 4IH6A 3HJFA 4LSLB 1AFJA 2RHSB 4C23A 2FSJA 1A5VA 1Z26A 4ED3A 3T5LA 3OYGA 4X66K 1H2TZ 1Q7LB 2BUNA 5GMEA 3B6BA 1NKEA 4F4YA 3MAAB 2B4JA 4ED5A 5MAOA 3JS6A 2G8HA 1GX5A 3B6OA 2FJEB 1V3RA 1U6FA 2W9CA 3UVJB 1KOOA 1T0TV 3T41A 1RT1B 3NGUA 4MK8A 3F5TA 3ZSOA 3OD2A 1OJ4A 3T1HJ 4FLZA 4BC9A 1VRTA 3TA0A 3G82A 1UJ4A 4OKKA 4EZ6A 4F7VA 4S0MA 1GMUA 1XQIA 3PTWA 1B7YB 2HVDA 4CRJA 1JWWA 1WNEA 1VC6A 3T9ZA 1I39A 2GO9A 2ZZTA 3DLBA 4X4NA 3TX8A 5FPNA 3MFHA 4QWCA 3CQYA 1N33J 4DSLA 4LIWA 2C2EA 5CXTA 2R4FA 2EG2A 4LMZA 1KC8O 1WBDA 1GOAA 1S1XB 4ZP7A 1CBKA 5T7LB 1ZPWX 1RA6A 4DV6F 3LUYA 2Y1IA 1PC4A 1DTTA 1RTJB 1TKZB 4OPJA 1NH8A 1RTIA 3V9XA 5KOXA 4PUOA 5DQHA 2ROPA 3AOAA 2A2CA 1FRJA 3MM5B 4KTWA 2R7XA 3RMDA 1JLBB 4UOCA 3J80O 3HL8A 3CCQS 2LLZA 2QMXA 2IBKA 3RMAA 4CK1A 2KLAA 1T05B 1GX6A 2GHVC 2MQ8A 3CXCR 2R2SA 2W8KA 1VGYA 2UZAA 5ETQA 4WCEQ 5L9NA 5AQOA 4NLVA 5J1NA 1A9NB 3OTDA 1NDCA 2YCHA 1NGGA 5GADU 1S57A 3V9SA 4U96A 3OXGA 4BVPA 1N48A 4K43A 2BGGA 5BYRA 2Y0BB 2DNLA 4M94A 2LQ8A 1NJIT 5C25A 5LSLA 4JI2K 3NCIA 5KFBA 3SMZA 4LFBF 1VSEA 1KHWA 2BQUA 1RT3A 3M1VA 5RUBA 1BLUA 4BLGA 4BRCA 1QAYA 2HNZA 4B1XB 1UMJA 3KHYA 4X66F 3DM2B 2BR0A 4YOXA 1OH6A 4EZ9A 1R43A 3MWTA 2ZH4A 3Q83A 2XGPA 3TVYA 3CD6S 4TSXA 3RBZA 3UFCX 1U1RA 1LWXA 3JYTB 4RZRA 2JH3A 2C1EB 1G7CB 4F0KA 2V2KA 2COLA 4CZCA 5A76A 1VQ6N 2RVJA 2XQCA 4RW6B 4GMJB 3H59A 4M3RA 4BVOA 4WFBQ 4M5DB 3OV7A 3TSUA 3CQ8A 4CFCA 4DUTA 1YRTA 1P1TA 2E5HA 3ZO7A 2DD8S 2WVFA 4CLSA 2DFFA 1TUWA 4FBTA 3IM9A 5FPMA 4LBPA 4CEOA 2EW9A 4FPRA 2QYCA 4K4VA 4YOWA 1U24A 4OHWA 5ETLA 1NPPA 2KT3A 2GAHC 4ZCIA 4K5RA 4OI3A 5AQJA 4DV2J 1O8BA 3D0PA 1XERA 2W2MP 4M5LA 1ZYQA 5B0CA 5KG0A 3RWUA 2X1BA 4M63C 3PCOB 2CQ3A 4O44B 2PO4A 4KYZA 3ENWA 5DDPC 2VWKA 4P72A 3EJMA 4F3MA 4CESA 1M90T 1PAUB 1RYSA 1B3TA 2R9LA 3W0LA 2AZ1A 1VQKN 2LKZA 3RB4A 4UF4A 3KLEB 1S5JA 2ZBIA 2YV0X 3DLEB 4EAHD 3NGZA 4PG5A 4RW4B 3J81Y 3QT5A 1NSQA 2GWJA 5B7WA 4KBOA 2BE2B 2VL1A 4KC5A 3QGGA 4EK2A 5HLFB 5AJ3K 4PL8A 1RK8A 1OPZA 1X9JA 5C10A 3L4BC 4ED0A 3WQPA 1YTYA 2X74A 1X9WA 1ASVA 3PG9A 3FZLA 3OYDA 1KRPA 2M2BA 1XR5A 3RRGA 1WSIA 3MXIA 4JI2F 5DQIA 4L8RB 2C28A 2XS2A 3QEXA 1VK0A 2FYXA 2DKOB 1FEEA 4A8QA 4K0KJ 4PKHA 1XC3A 4CCHA 2DGVA 1FCAA 4XDDA 1WKLA 2B8QA 3I5BA 2V2QA 1OYEA 1X4CA 3C7NA 4IOXA 1WG1A 2IJNA 4ZLLA 3QFHA 2ZE2A 2C2OB 3HSDA 1ZC6A 3QNOA 1S7IA 3Q8QB 5MLCQ 2NXCA 5AZIA 1MDUB 1KBRA 3EO3A 1S9GB 3LWLA 3BO3A 2I0XA 4CH1A 2NRZA 4TLQA 5EUHA 3PR4A 5F41A 2MEWA 1PCAA 2FC9A 1RADB 4CH0S 1HI8A 1TKXA 2ZKUA 1J54A 3HYFA 3DLGA 4QU6A 3PV8A 3HMJG 1R0CB 1RAJA 3DYAB 3OYHA 3RRHA 1ACMB 1C0UA 2E5LK 1HWKA 1YLXA 2VA2A 1H7XA 3NOCA 1XNQF 4WQ4C 3KWMA 2HNYA 2MKYA 4F8RA 3MXMA 4FJ9A 3ZFVA 4DV7F 1VBZA 2E9TA 2HGNA 2ZOGA 3I8BA 2ZNZA 3TEGA 3WX4A 3NEKA 4PQUB 2LQBA 3T6JA 1ICEB 5DRKA 2KG1A 3SQ2A 5HAOA 3CCVS 3G6EN 1FX4A 1VS3A 4WP8A 2GBZA 3M1FA 4YB6A 4H0VB 3BKTA 2XBPA 1BMQB 1S6OA 1SZ2A 5CZVA 2W41A 1J27A 4M3ZA 2RRBA 1BWEA 3GWCA 4ZVFA 1K1SA 3M4XA 2FJWA 2KVQE 5KFYA 2B5JA 1D1UA 2NYIA 3H3OB 3VQDA 4CEAA 5ETRA 4YR0A 1EB0A 2CGJA 2G2YA 2ALZA 1FE0A 3VGKA 4DR4F 2Z8QA 3A13A 4LFAF 2OEJA 4GKJF 4USKA 3PRDA 3KJVA 4LF1A 4HUFA 1JXEA 4PQAA 3DOLB 3NF9A 3JSYA 4QW9A 2QKBA 4BRHA 4DV0J 4A5BA 3R3TA 4H4KC 1S4FA 3I9V9 2ZHOA 3O1WA 4PKIA 3R5GA 1X7VA 1TMMA 3H5XA 3VZHA 3DLLL 1L5UA 3IWLA 3GU0A 3TVZA 3NBPB 4B9QA 4DSJA 5A0YA 2FSNA 4EP4A 3IWXA 2OJ3A 3W66A 1V4SA 4B9VA 4L6V3 5KFIA 2VONA 2GJ2A 5CZXA 1QQNA 3VMFB 1NNEA 4LR7A 4FKYA 2E1ZA 5GAEU 1W26A 3ZTSA 3U8XA 4KAZA 4DU1A 2OMLA 4FK2A 5JJBA 1FTRA 3PACA 2ZD1A 3HI0A 2HF4A 4K4UA 3VAFA 2DTUA 3W2VA 4ECSA 1TL3A 3HI9A 2E5LF 4OYOA 3VAKA 1QTNB 1XBWA 3DXKA 4BE1A 4J9MA 2AU0A 3P31A 2MQNA 4NXMK 2BYCA 4EBDA 4KGMA 4QR1A 2ZJRQ 4JYAF 3AAQA 5LOQA 2R3VA 3PW0A 3UD4P 5KFDA 1IR1A 3CCRS 5J2MB 4R8UB 1YJNS 5D77A 3TA2A 4BQLA 3DWLA 1D3WA 3Q8UA 5K8MA 3ZEUA 3ZT3A 2WVDA 1HPZB 1TL7A 3OFEA 2P9KA 3KNAA 4ILHA 3HVTB 3DGPB 1ZA1B 1XMOK 4WE1B 1NLKL 2V50A 3ULHA 4RNNA 3DRRA 4B08A 4IWVA 1IKYA 3FRZA 1CEZA 1RDWX 1SL1A 1UJ6A 3OBYA 4I68A 1LAVA 1Q81T 3KKRA 3F9KA 2DGWA 1IBMK 4USHA 4QS7A 2VQFK 3FEZA 3WHIA 3AD8C 2F96A 3OL7A 1XMQK 3L4IA 4MAKA 4I9QA 3X3UA 5IM0A 4FWKA 2NXJA 4OYPA 3U4LA 1TUUA 5BPNA 4CZFA 1S6QA 2VKZG 2DH8A 3KG4A 4AE5A 4EHUA 3HFKA 4B9LA 2YPZA 1IWGA 2V9KA 5LXYA 3OW2R 1L3TA 3ID8A 4M3TA 2O8CA 4M45A 4G1IA 2EG1A 2VG7A 4NI2A 3LAMA 3RR7A 1W2BM 4M1KA 3I96A 1RTHA 4JKHA 3FLCO 2XSJB 2QMUB 3WIUA 4BE0A 2WB4A 4AXJA 2E1CA 1RISA 1K73O 4NCGA 2MHNA 3EZUA 2JL9A 2AMCB 2XULA 3RB0A 2CJAA 4H5NA 5KT5A 1N32K 4WTYA 2CUYA 1PBUA 5G4DA 4A8WA 1ITPA 1WEZA 4WKRA 2QFIA 4BRGA 2IC3B 2CJQA 2HBJA 4PZVA 2E1YA 2EI5A 2HVEA 1KQSR 2UXBJ 4ZVSB 2YWGA 4QS8A 4Y1DA 4DU4A 1C1BA 1U0HA 3LDSA 4FJMA 3UE5A 2BMBA 4DU3A 5HQMA 4EEYA 4JI6F 3K2YA 4YY3J 3QWUA 4JI3J 5EX3A 3U3YA 3TABA 2HQCA 4BRAA 3AVAA 3CM5A 2QM1A 5HJXA 4I64A 1FDNA 3SUNA 2ABYA 3A0IX 1F3FA 2QEXS 4ZPAA 4NEYA 2Z2ZA 2EC2A 3NNHA 4HI1A 5F0XA 2YJEA 2HLTA 1XC9A 3QO9B 2FJVA 5DZ7A 2EPIA 3O6WA 3E01A 1NJIO 1YRUA 1ZBTA 2VICA 4DR5F 2YY3A 1XMOF 1DLOB 1R0BG 3UB5A 5F3TA 3RVCA 1BXNA 1RGVA 4J90A 3V4IB 2R2UA 4KQZA 1RBOB 4KJIA 1NK4A 3N6LA 2D1CA 3HHLA 4MMOA 3OQ2A 2M52A 3ZSWA 5F8IA 4DN0A 1RTDB 4Z4GA 5CH7B 2P9LA 2DHHA 4BGAA 4CZMA 2IDEA 3PKYA 1XMQF 2XMAA 3GE9A 1TK8A 1S49A 4ZS6A 3AY9A 3ZTOA 4E98A 5J2PB 1CJVA 5EN1A 1T9XA 4BR2A 4X64F 4FK4A 4N41A 2KO1A 4FOIA 4DTXA 5AQSA 1T44A 1N5SA 5BPMA 1LWEA 1N5YA 3QEIA 4QIWD 2CQDA 2IAJB 2VCPA 4LH4A 1JLGA 4CD1A 1TK0A 3P5TL 2W01A 1TUVA 3VQBA 3MXHP 4KT0C 4QWDA 4P52A 3L3CA 4CJSA 3MI7X 1AUSL 4HYKA 4CO5A 1PIEA 1VQSA 1I94F 1KAXA 4F0HA 1Q82T 2MZRA 2ZH2A 4A8FA 2O8DA 2UUCJ 2XZWA 1UEVA 3SUQA 4DV5K 1TYQA 1PILA 2HLUA 2B8PA 1YUWA 4YDUA 2VFVA 4NRUA 4FJNA 1NHVA 2YNFA 2D0CA 5BN8A 1XQSC 4PYDA 2Q31A 1CZBA 1NGFA 1WEYA 3DXSX 2ZITA 4NRTA 3RYLA 3HZ6A 3VEYA 1VQ8S 5BR8J 2HNDB 3Q2TC 1IKVB 1EETB 4DR6J 3FUYA 4E19A 3QDKA 2E2PA 3IR5B 4ZCLA 2PI5A 3AO4A 5I3PA 3DOKA 4B1VA 5EX0A 2Y1JA 5HROB 3NVKA 2HWHA 2W4CA 4UW2A 4B3OB 4ILJA 4DR1K 3UNGC 4FXVA 4O3SA 2CJKA 4QWBA 2DNNA 2J6TA 4CFBA 3HHDA 2IIRA 4ZPDA 3QINA 3SMPA 2DNHA 5BYQA 1B0TA 3HXMA 3AVGA 3AJ1A 3MMAA 1Q78A 1ATSA 4J5OA 1VJQA 1JL2A 1Y10A 5ELZA 1MMNA 1O51A 2YWHA 3CE8A 3U7JA 1WTBA 3RJMB 4JS5A 4CGDA 1EXQA 1BIUA 4C8KA 4OJRA 5K5MA 3DDIA 2QSWA 1LV5A 3EVWA 1X3NA 5J1EB 3OBIA 3GMGA 3PO5A 5E3RA 2DIUA 2NPIA 5GAHI 1HNXJ 2K3IA 2ZZNA 4LF5K 1S1VB 1RBTA 2VFUA 3FGUA 4NLSA 2B4UA 1DTQB 2QN6B 1VQNS 3P4IA 3NAHA 3ET6B 2DH9A 3H4BA 3J7AN 4DX5A 4FPBA 4JK9A 4IH5A 2H5JB 2Q1LA 3GIRA 2V9WA 2MGZB 1X3MA 4DG1B 5L1LA 4CJLA 2LEPA 2LFVA 4I1TA 1U1QA 3EWGA 2AA4A 1RI7A 1KD1T 3BGOP 5HP1B 2CPFA 3SV4A 2YWFA 3SAHA 2FQQB 4RW9B 3MOJB 4OYWA 4DV5F 1VIOA 3E66A 4PA1A 5HO4A 2UXCK 1ELOA 1PAEX 2BDPA 4KHPK 4J2DA 1REVA 3W63A 2J7UA 4Y1CA 2YXLA 1F2GA 1B92A 1XHXA 2HHUA 1N52B 3CJ3A 5G0RB 1RDRA 1RU1A 3IS9A 4J9PA 1U1PA 2Z56B 2HHXA 2JC1A 2FHJD 3JAMY 2LXIA 2FTRA 4RU2A 5CE3A 2NLXA 3AGKA 2X1FA 6FDRA 1ULRA 1VQ4S 3FSXA 1ROFA 3FJ2A 4BRFA 5LMNF 4HHTA 4CO2A 2HRTA 3VF6A 3UWTA 4KKOA 1C0MA 3IAM9 2WC9A 3D5MA 4KFBA 3H7HB 2PIIA 5E2QA 2J7KA 2ZC3A 4Q5VA 1CXUA 1QQMA 3B6PA 3EPIA 4DTMA 3QATA 2C2RA 2YQ3A 3WXKA 1IR2A 3TRGA 2OFGX 3SQ0A 3G4SS 3RB6A 5AXKA 5HATA 3VAMA 4UUXA 2DGUA 2DGTA 2B4VA 3S6EA 3L95X 5LMUF 5IQ6A 3NLCA 3JAMU 2X6NA 4H54A 1CS4B 1U6ZA 3HCXA 5CD4A 3MURP 1R89A 3HT0A 1RT6B 3W5ZA 2JLGA 5L8RC 3IN5A 3QIDA 3HVRA 1EARA 3UPFA 1FKPB 2J6SA 2FJAB 4TVAB 4PWDB 4CNZA 2XMVA 4AILC 2ZBRA 3MEGA 2GHWA 1VRUB 3KWGA 2L9WA 5C0YA 4RX6A 8AT1B 3A5OC 1J5OB 2H4YB 4RNOA 3J7ZT 1BO5O 1HIYA 1HQEB 2FZGB 4JHDA 3C16B 1RT1A 3CD7A 1VQ7S 2IRXA 5ETVA 2UXDK 3LZIA 4B3MK 2CQ1A 4I67A 2DNPA 3F41A 2C2KB 2KM8C 3CWJA 1LFPA 4BBYA 3OUYB 1ZS6A 3RAXA 1WSGA 3M6GA 4KHPF 2BJ1A 4ANDA 5I4MA 3LOUA 5IT9Y 1F9EB 2K06A 2G13A 3R1LA 3HULA 1RLDA 4NYPA 4KGVB 4NB4A 2CJXB 4DV6J 1KQKA 2UUBK 4JD2A 5AQVA 2AV5A 2L08A 3KHGA 4Y0WA 3NGIA 4FL9A 4NCAA 1GOCA 1X31C 5T7LA 4GVBA 2ZGZA 4BR0A 2R7UA 2E44A 2FHMA 3O8WA 3EDQB 4DS5A 3TAPA 2PI4A 1X60A 3KUHA 5KAKA 2ASLA 4C2MA 1U8SA 2O1PA 3CCEN 2HBMA 4V1Ak 2XMTA 1G15A 2GC8A 5GAEP 1GXLA 2UU9K 1SUQB 3U27A 3C3LA 4F3OA 1LWCB 3DDNA 4NXNF 2YQ1A 2AJ1A 4IQMA 3NGDA 2W1BA 4NA3A 4CJ4A 3QZ8A 5H9EJ 4BGBA 4L73A 4IG0B 4LFBJ 3M8PB 1TR0A 3SV3A 3PYFA 3QEVA 2UP1A 3R5CA 2W2QP 4NLTA 2DGSA 4GV3A 4DPOA 3NMUA 3IWNC 2F63A 4FJKA 4X66J 3W5XA 2O66A 2ZWOA 2F8EX 3DLRA 2BKNA 1QY7A 3M2VA 3UKRB 1ZTWA 3MD1A 2VWBA 4QCLA 4PWWA 3BV8A 3KLFA 3SDEB 3K8VA 2W40A 3BS9A 3PRVA 1M5SA 5KFEA 2V68A 2X7IA 3UD3P 1HMVB 1RCXB 4KRWA 5FPEA 4DR2K 4BRQA 1RZMA 1H6KX 1YBUA 4OJHA 4IG3A 2E8AA 1NMDA 5CQGA 4NX9A 4WF9Q 4CHOA 4CGJA 5K14B 5J2NB 1RHKB 2P9IA 2PA3A 3SXLA 2CWXA 4H5VA 4FM0A 1JL1A 1FX2A 2PFDA 4G1QB 4F3TA 3CCSS 3OW2M 1P8ZA 2FJBB 2GGPA 4O3NA 4X4SA 3BF3A 1LXJA 3K17A 4K42A 1GNKA 3BUZB 3VTIA 5J1PA 5C12A 1FD2A 4TKTA 3GIIA 4HDGA 2R7TA 4X4UA 1GK8A 3NCPA 3CI5A 1VHXA 4EYIB 5DG9A 3T19A 4O4GA 1D09B 5LXRA 1FVSA 3NF8A 1BUXA 4LT6A 3G8QA 1WELA 3MX5A 3GTYX 3MGJA 4OX6A 3HM9A 2IM1A 2V6AA 5B0AA 1X4HA 2EBGA 3LP0B 4WP3A 1FO1A 5IWAF 3OR1A 1EWRA 4KRFA 4OFZA 1T6DA 5BYSA 3RSEA 2E7WA 4PG6A 5KQ8A 1S1WA 1KQSM 4GW6A 5EXWA 5H9FK 5KFQA 2E66A 4BRMA 1K0VA 1HWJA 4NWBA 2GMHA 1ZAVA 3QLHA 4A59A 3CDEA 4LY7A 1RA7A 3CTRA 4PG7A 2CYYA 4JI2J 1REGX 1GH8A 4Z7CA 1MU2A 4H4OA 1HHTP 3OVBA 3LPTA 3G25A 2BRKA 2CH5A 1Q82O 4KPCA 5LSRA 2CVEA 4PCQA 1NSAA 3R5DA 3WEEA 3JQKA 2GMJA 4JNEA 4U7CA 4NA1A 1G3OA 2W2NP 3I87A 3HHEA 3CJ4A 2ILZA 3QJJA 2J5AA 3OYKA 5LM7E 3HVAA 4KGZB 4QIFA 3G96A 3HOTA 3T1YK 3DJCA 4JV5K 4U9RA 1HYZA 1F9FA 5T41A 1XTZA 3VA3A 4FLVA 4FO0A 3NWRA 4DQPA 4B3SF 4ID1A 1GLEG 3ETMA 3M8YA 4FJJA 4IBNA 5F9NA 4NZ7A 3GFHA 3IRXB 4KGKA 4LSNB 4NEZA 4OVLA 3OFFA 1F9HA 5DK5A 2P9NB 2NS1B 1XNQJ 1R8HA 2DR8A 1EX8A 3O9SA 2LXUA 4DV7J 1WUUA 3AVKA 2K1RA 3AVBA 3OTBA 3KLGB 3K2PA 3F44A 1S76D 3O9RA 2DCLA 3EY1A 1V5VA 3UDVA 1DKGD 3FSYA 1YITN 1HNZK 1FXDA 4CQ1A 2PYLA 5B8HA 1S72S 3GL1A 3L2RA 4DSKA 4LH5A 3VQ4A 4PQUA 5AZJB 4HCCA 3P3DA 4RBVA 2NYHA 4OI0A 1M1KT 2AEFA 4DPUA 5K8NA 3ENOA 2YKNA 3E9LA 5KG5A 1DAXA 2FC0A 3VAGA 4LF9F 3KVGA 5C15A 4I6MB 1TTHB 2E9RX 3MUVP 2DIVA 2Q36A 3BYPA 1A5WA 4Q0BA 2M88A 5E3AA 2M0GB 1VBKA 4LFAJ 3SNNA 4GKJJ 4DOZA 3ZX2A 4W5TA 3DRSB 2CQGA 2NRXA 2O8EB 3OYFA 2FLNA 2O67A 2G0JA 3N9UC 4USIA 4CDIA 4LF6K 2MLZA 4ISGA 1J9AA 4ES2A 4K25A 3PW7A 5IOLA 3HFZB 1WC4A 4B1UB 2NXUA 1U26A 3TARA 2VBYA 3F2KA 3NF6A 2P9EA 2EFNA 2W7AA 4TXSA 3IRWP 4DR7K 4FS2A 2F8SA 3O8MA 4P10A 1TMJA 1BU6O 2GHPA 3CFRA 4ID5B 2QA4G 3CM6A 3HSGA 4YMEA 3GP9A 4ED2A 1SH0A 3CPWR 1IBKF 4TY9A 3B4DA 1SKSA 5BN9A 3MN7A 4AL7A 3FCHA 3TJAA 4YDUC 3NBPA 4ZCKA 2GIRA 1N8RO 3QBXA 5A2QY 2CADA 2QL5B 4DXLA 5HMXA 3M2RB 2NXEA 2J0WA 3HKWA 1NM2A 3R97A 2QA1A 3ZSXA 1LQ9A 4IO9L 1HWLA 3DOMA 2E5LJ 3BPDA 3KG1A 3G8SA 1EX4A 5KPTA 4DMZA 2LXFA 1X5PA 1WG5A 1MSWD 1Q8BA 3CC2N 4JYAJ 4UOHA 4FYYB 2FD2A 4O4RA 4ENOA 3VQTA 4AH9A 3CF5Q 1HNZF 3QNNA 4KO0A 2MPUA 3D1QA 1UVIA 2OUGA 1FWKA 2XWYA 2LDIA 4LRBA 2OO4A 2PFUA 1NGJA 5AFUA 3TJ9A 3TTFA 4N76A 1HL6A 3E9OA 3AD7C 1RHRB 2C3UA 4MKYA 4BRNA 4HT5A 2HZCA 1NK8A 2O4IA 2EK1A 2K8GA 1NNDA 4CJTA 3M9MB 1VI7A 2HRUA 1E6VB 4KHRA 5BPLA 1HNWK 5KG6A 1YVNA 3VF0B 5KI6A 4Z4HA 2HWIA 4X62F 4YHHK 2F8TA 1JLQA 1LEOA 4RUBA 2AYMA 1MLAA 2VD3A 1IKWA 3SUPA 3SQGA 3N01A 3EICA 3ENVA 3E3XA 4BRPA 1VQ5S 3M2UA 3CMQA 2YH1A 2BJ8A 1JCFA 2YHXA 4HDHA 1B9FA 4G1PA 4DL5A 4PY5A 2VB6A 1HBNA 3D2FB 2KJWA 4FZXC 5E7OB 1U7LA 2JFKA 3K5MA 4GMKA 3UR0A 3A1YG 2UUWA 3J7ZO 2W4PA 1ZZFA 4FM1A 5KFPA 2LDYA 1NZAA 5FLXY 1FRIA 5E84A 1T02A 1I3AA 4CNYA 2A2DA 1Y5IB 2XS7A 4I69A 3SBMA 1JX4A 2EFGA 2BJ3A 4B9TA 3V9WA 2HQ3A 3AOCA 1BC6A 2E7XA 4JV0A 3VA0A 1SIWB 2DY4A 2YWKA 3PR5B 2DHAA 1C0TA 4HACA 4OZ5A 2VH7A 1QZ6A 3CCZA 4CEQA 3MUMP 3LP2A 2BOAA 5E41A 1FRHA 4Q2MA 1M0SA 2QWNA 1FD8A 1R8BA 2OLWA 1JXVA 1XI1A 5C2GA 1PYTA 4NLYA 3TPQA 1S6UA 5FJ4A 4DSEA 4F9OA 4CJWA 4DQQA 4W5QA 2MJUA 2RF2B 1ITGA 3H42A 1WHVA 2YKMB 2HGLA 3EYZA 3RMBA 4CJFA 4N47A 4KI6A 2GJFA 1VBXA 1TUYA 2JNJA 1TK5A 3A12A 3NG8A 3MM8B 4EI2A 4Z4IA 5EU7A 4NXMJ 1RXOB 4H0YB 2IMOA 2DVIA 3MD3A 3AHPA 4F0MA 5BJRA 2AP6A 2Z2MA 2V34A 4KH6A 2BKOA 4ECYA 4UQTA 1WG4A 1HKCA 2ZFHA 4LIRA 1KLMB 3GFZA 2BUPA 3B54A 1OPIA 4IKFA 5IS2A 2BX6A 1ZBFA 2FY1A 4IEEA 1T9UA 4OI6A 2KXHA 2Z0GA 4DR5J 4BR5A 1XMOJ 4A62A 2VQEK 3CJ8A 3K8WA 4HUGA 2AGPA 3G6YA 3P6YC 3ZZRA 3JB9k 4FLXA 4R0JA 4LC9B 4O8UA 1TV6A 1BISA 1FNOA 4J2AA 4DPWA 1DLOA 2ZOMA 1ATNA 1L3KA 2IGIA 1FA0A 4K4SA 3H8YA 2WZ1A 4U95A 3L9ZA 1XMQJ 1LOTB 2HKEA 3FZBA 3ILJA 4Y3CA 1NKBA 4CZHA 1HLUA 1NXIA 4X64J 2C2NA 4LVOP 2V4RA 1CJKA 2RE1A 4C48A 4QBUA 4KH5A 2GVDB 2E1PA 2MZSA 2VDIA 3BDPA 1G4CA 2HVZA 4C97A 1I1GA 3RBEA 5B08A 2G8WA 4BREA 2O3DA 2EFVA 3L09A 3VGSA 2CQCA 1WAFA 2B43A 3H5YA 1YX2A 4LF4F 1U47A 3QZ7A 2LCWA 3NNCA 4ICLB 2J8SA 1P8GA 2M4MA 3KK2A 3QGIA 4O0IA 4CK3A 3O1LA 3T69A 3ZYYX 3WT0A 4W90B 3L2UA 3CNQP 1D8ZA 5I42A 4NMXA 1I94J 1Q5VA 3VVTA 5F8GA 2C2MB 1KP6A 4O5FA 5FIIA 3TAFA 3WXLA 1T95A 3I56N 3KHRA 2E20A 4LBIA 5CA5A 3D66A 2XS5A 4LJMA 4NLGA 1YTAA 1VC5A 4N5SA 5FRMA 4H0XB 1YJRA 3V81B 4ZJQA 4C0BA 1YBTA 2CJ9A 4ZJOA 1YK9A 3MM6B 5D15A 2GS8A 1AZSB 4ECWA 1U6BA 4DV4K 1UAXA 2VPXB 1BI4A 4P74A 4IUFA 3QIOA 1CQMA 1H38A 5C2CA 4JI4K 2CPJA 4LFCF 3ULEA 3BZQA 1HR0K 1UVNA 2CFXA 1HBOA 4OZ2A 4KHQA 3MCSA 4ED8A 4BC4A 3M5RA 1RUSA 2F8MA 2IJFA 4K0KF 1SVDA 5E3CA 4RWXA 3CCLS 1VSKA 5L9XA 1WC0A 5D3GB 4YQWA 5HMYA 3KLIA 4EGLA 4E7KA 4OJ1A 4O3PA 4ETZA 5E26A 1RT4A 1EKRA 2QLFB 3TUIC 1T3VA 3CCJS 1C1AA 1PC5A 1IJFB 3Q86A 4P73A 3KLHB 2AT1B 2O5DA 3Q23A 4NLUA 2P9GA 4RNMA 4MKAA 3V9ZA 3NGRA 1HQUB 2UYTA 4IO9Q 5B0DA 4DS4A 3EMTA 1K8KA 3VN5A 1JJHA 5AQZA 2XCPA 4CIFA 1H7WA 2DHXA 4J2EA 2GX8A 1RT7B 1CXQA 4OMFG 4NZ0A 2BA9A 2MLXA 1EKSA 1PBAA 2MKCA 1IBLF 1JLFA 4H03B 4FNIA 1S1VA 1NDLA 1XNRF 4FWMA 3CCMN 2N3LA 3PNIA 2HURA 1DTQA 4IZ9A 3DRPA 3FCWA 4DTNA 2ZH8A 3ET6A 2NZCA 1NDPA 3WNFA 2WOMA 2DGOA 2VG5A 3TQ1A 1RLCL 2M3DA 2ZKTA 1UZHA 1ZPVA 3MAHA 2J0QD 1JLCB 3AH6A 4B3RK 4PWUA 3L6QA 2Z2YB 1BIZA 4DV5J 3L2WA 2RNEA 2HS4A 3ILLA 2MQOA 4L75A 3VGUA 4FWQA 4I7FB 4FKXA 3R2CJ 3MEDB 3O2IA 5IV3A 2BBEA 2MDAA 4PYAA 2YKQA 3SI8A 2RPIA 1C2PA 1Q0NA 3DXMA 1NK5A 3VR1A 2KYZA 3D2WA 2CQ2A 4DN9A 1MMLA 4FZYA 4DV4F 2QYGA 2YNGB 2P9SB 1SQEA 2OPRB 3J7YI 1FXLA 4XDCA 2PYJA 1XN9A 4JI4F 1HR0F 3LAKA 4UY8T 3A8EA 3FZHA 2I7PA 1VQLS 1JLAA 4F25A 5EGYA 3BF4A 3H3NO 4HWIA 1MWYA 5KFKA 5CD4H 3RTVA 2R2TA 2NZ4A 1RHUB 3AA8A 4CEBA 1OKJA 2XCAA 3O80A 2OD6A 4ZPCA 1FERA 4URGA 3DLKA 3ULDA 4FJ8A 2PMHA 4XH4A 3BF1A 1L3VA 2J0SD 4ZDNA 1EO1A 3QIPB 4IFYB 4C11B 4U67L 5LMUJ 2CPEA 5D4NA 1SC6A 3LANA 3KJFB 1WI8A 2F65A 3M30B 1IV0A 1RDAA 1HYSA 1TL5A 4FYWB 1YTUA 2SXLA 3F73A 1P90A 4H0PA 3CCUS 7AT1B 4MH8A 2JEGA 2RUSA 2RHKA 4KHWA 4UT4A 5K20B 3MR7A 1F5CA 4ECRA 1SH3A 2DNRA 2RQCA 3RBDA 3NHGA 4I9LA 4LF7K 2HFSA 5AQLA 3JSBA 3W3SA 3THWB 2YBVA 3JSRA 3V4MA 4I6WA 3DU5A 2RDIA 1U04A 2XMUA 2MKSA 2V52B 4BDYA 4M5IA 2CJYB 4GRSA 2X1GA 4Z4EA 2H51B 3P96A 2X78A 4HL9A 2D0BA 4PKGA 5U47A 1AT1B 2F9JA 4B3RF 3VVUA 3DDKA 1QVFR 2UUAF 4IRCA 1RBLA 1SCJB 3MWPA 2L41A 2UXCJ 7FDRA 3U1LA 4RKUC 3UDCA 3EE3A 4MFBA 4KHPJ 4CLKA 4K2XA 4NYZA 4K8RA 2AWZA 4ZPBA 3OSPA 4AM7A 3R27A 3ELHA 4M5JA 2OPSB 3EKUA 5LT5A 1GAOA 1YQHA 4R5PA 3IG1B 1BQNB 2HFUA 4BQZA 2OIHA 3KKFA 3G8TA 2KT2A 3CPWM 1N36K 3VEXA 3CERA 4OGCA 1N4LA 5T7BA 3OS1A 2VHGA 2NUHA 2AJQA 3OJSA 4ZVGA 2IIHA 4TU7A 2EHGA 4OX7A 1RWMB 2BRLA 3QGHA 3OXLA 2HVHA 2C3YA 2C3OA 3IFRA 4CEDA 2V7ZA 1Q95G 3BGRA 2WFBA 5AQNA 1BE4A 2RQ4A 1P9YA 3BH7B 3W3DA 3KK3B 3MM7B 1Y3KA 3G0ZA 2J9EA 2IVOA 4NLRA 2J9CA 4L72B 1T9TA 1SJ4P 3VQ6A 5KT6A 4URSA 3I55N 1R6VA 1YAGA 3LGMA 2OH2A 4NXNJ 1WI6A 5ETPA 4HHJA 4P75A 4AL5A 4IOAL 1B0VA 3NAIA 1RP5A 4XO0A 2RU3A 5KFTA 3VGLA 3KKSA 3CG7A 1U02A 3S8SA 1OH5A 3JQMA 2OTLN 1A5XA 1RT2B 2CNLB 3M6XA 2MZJA 5EWFA 4OX9K 5C42B 4MLHA 3ID6A 3SPZA 1M5VC 1O5JA 2HS0A 4QIVA 2R7OA 4RW7A 4JRPA 4V19X 2O8FB 2RAQA 3LP1B 5HVGA 1OSCA 4YY3F 4OV6A 4K59A </