3QO9A

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with tsao-t, a non-nucleoside rt inhibitor (nnrti)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
553
structure length
553
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAISQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of tert-Butyldimethylsilyl-spiroaminooxathioledioxide-thymine (TSAO-T) in Complex with HIV-1 Reverse Transcriptase (RT) Redefines the Elastic Limits of the Non-nucleoside Inhibitor-Binding Pocket.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase, hydrolase/inhibitor
molecule keywords Reverse transcriptase/ ribonuclease H
total genus 139
structure length 553
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3qo9A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qo9A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qo9A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qo9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3qo9A05
4IG3B 3I5CA 1VSJA 2YHAA 4Q0BA 4J9SA 3PZPA 3QLHA 4I2PB 2FBXA 1N48A 4UQGA 4DQSA 1FKOB 2VA3A 2X74A 3L8BA 5J1EB 3NMAA 4PQUB 4HVJA 3THVA 3NF8A 3O3HA 3B6PA 4B9NA 1TV6B 1U04A 4ECUA 5KFBA 3VN5A 1TAQA 3RRHA 2UUWA 4LH5A 4JV0A 1S97A 2P5GA 1RT7B 1ZBUA 2Z1GA 4E89A 2OPRB 1NK6A 1S49A 1L3SA 4KHSA 3CIZA 2G8KA 4I2QB 1YVFA 4E3SA 4CCHA 3C95A 4M95A 4RW7B 1C0TB 5SZTA 2FJXA 4FJJA 4B9SA 3LP0B 3A2FA 4HCCA 3VQ9A 2W9CB 2IOCA 4CGJA 1SUQA 1FXXA 2IC3A 2AJQA 3I0SA 4AHSA 4CJWA 1GX5A 2AWZA 1EETA 2OZMA 4C8KA 3TABA 4KTQA 3SV3A 5J2NB 4O4GB 1ZBLA 2CJQA 1WSHA 3ISNC 4DSJA 2WONA 3ISND 4AHRA 5KT7A 1IKXA 3U3YA 4CEEA 3H4DA 5EUHA 1RBRA 3TAQA 5DQHA 3TWHA 4FJHA 1C0TA 1RCHA 3KHLA 3PX4A 3BGRA 3KLIA 3H2LA 3M9MB 1VSLA 4CJPA 1KHVA 3RMCA 1TK8A 5L1KA 3LWLA 1KVBA 1JXLA 4WXOA 4URQU 1RT4B 1U45A 2FVPA 3QEXA 5KT5A 1VSFA 4J2BA 4CJQA 1UA0A 4F3TA 4DSIA 1S0NA 4J2AA 3RB3A 2I5JB 3SCXA 3ITHB 3VQEA 5J2MA 3OL9A 3M8RA 3K5MA 1HRHA 4H4OB 4ECTA 1WAFA 4DSFA 1JLFB 1ZTTA 4Y1CA 3DDKA 3FFIB 2P1JA 1JLAB 1UWBB 2W9BA 3G6XA 4N47A 4DMNA 1IKXB 1RTIA 1RTDB 1TVRA 2ZQBA 4IG0B 3SQ4A 3SPZA 3FQLA 3MAQA 3V1OA 5KFPA 3D28A 4GMJB 4EBCA 4ID5A 4QWBA 1J53A 4ECRA 4IKFA 4NLXA 3N6LA 2J6TA 1WSFA 4MFBA 3CDEA 3HJFA 5DLFA 2EHGA 3LP2B 3FQKA 4RU9A 3D5MA 1C1BB 1RDBA 2Z1IA 1L3UA 1I3AA 4F4ZA 4MH8A 3QEWA 2YKMB 3JYTB 3KK2B 3AO3A 3N6MA 2IM2A 1S4FA 1FKOA 4ED7A 1WSEA 2XY8A 3S9HA 3DYAA 2R8JA 2DPIA 5EDWA 3NGIA 2E9ZA 4Z4CA 3VQSA 4AHVA 2FBTA 3FFIA 4FJMA 4EO8A 4DSEA 4C8OA 2VWKA 2F8TA 5J2PA 2HNDB 2E4LA 2RN2A 1N4LA 2ASJA 2IBKA 4FJGA 4FZZA 2B5JA 3OYIA 4KPYA 1EX4A 2AU0A 1GOAA 3DM2B 4KO0A 1ZBHA 3L2QA 4O0IA 1C1CB 4ZTFA 1HYVA 2OH2A 2QV6A 4OJRA 4HTUA 1QAJA 4NLRA 1WAJA 2VA2A 3SQ0A 1IKVA 2XGPA 4M41A 5F8IA 5DGAA 3PUFA 4H4MB 5KFIA 1S1WA 4FBUA 2PYJA 2IJNA 4QAGA 4R0EA 5I3UA 3V9SA 3AO5A 1XR6A 3M8PA 3V9ZA 3HHKA 3HVRA 3BREA 4KHMA 1S1VB 1L3VA 4O3OA 2JEFA 4KTZA 4QW8A 4AHUA 3RMDA 3OYFA 4CHZA 4H4OA 3NF7A 3DI6B 4ZP6A 3G10A 2V0NA 3QZ8A 1W9HA 3LPTA 1JLQA 2C2RA 4G3IA 5E41A 4OKEA 4FJLA 3S3MA 5FRNA 2ATQA 2RKIB 4DFKA 1HPZA 1N6QB 4TY8B 3IG1B 1C1BA 4CJSA 4Q5VA 3PW0A 3SUQA 4MQ3A 4E7JA 1WLJA 4KTWA 5KFHA 1R0AB 1BI4A 3SJJA 4WE1A 2RF2B 1CXUA 4WXWA 3HPHA 5KG0A 1RTJA 3PO5A 1TAUA 1HNIA 4DTNA 5EWEA 1WSIA 4DF4A 3MECA 4ZVEA 1TV6A 4CF9A 1U48A 3D0PA 1NJXA 2XY5A 1N5YB 4I9QA 1HMVA 1KHWA 1KTQA 3PJWA 4E1NA 2YHBA 4I7FB 3V6JA 1N6QA 2YNGB 4E0DA 3GYNA 2HHXA 4DL7A 3OVNA 3VQ7A 3KTQA 3I0SB 1UOCA 2G8VA 4DFJA 3QETA 3HPGA 2D3UA 2IGIA 4O44A 1I6JA 3OJUA 2WRMA 4O4GA 3OS2A 1JL2A 3O3FA 3VQ4A 2BQRA 4M3XA 3PHEA 4FJIA 5HRNA 1TK0A 4QOZB 3HP6A 5I3UB 1S9GA 1IO2A 2FC0A 2KTQA 1KFSA 3TAEA 3CM6A 4FXDA 4EBEA 2KZZA 4JV2A 3CFRA 1RDDA 3QIDA 2QK9A 2QKKA 4OGCA 4DLEA 3JYTA 4KKOA 3C6TB 4AILC 1RT2B 1F21A 5EU7A 1NK8A 4O3QA 1KSPA 4FJ7A 3ZT0A 3KKSA 4IRCA 4MK9A 1KCFA 3QIOA 4HUFA 5F8HA 1HYZA 4F2RA 3LZIA 4NRTA 2WTFA 3V9UA 2IM0A 5KG1A 5F8GA 3LP0A 4HYKA 3AVIA 5HRRA 2Y1JA 4GW6A 1ITGA 4PWDB 3AVJA 4CGGA 3TQ1A 2KFNA 3M9NB 1T03A 3QEIA 4DU4A 4CGDA 4N41A 3TAMA 3NE6A 2XY7A 4Y3CA 3DLGA 3DOLA 4YR0A 3V6KA 4O55A 3NH1A 1S1UB 3LP1A 1HQUB 4CF1A 1RTHA 4CGFA 1VRUB 2F8SA 2IJFA 4BE0A 4FLUA 3AO4A 5HLFB 4CEFA 3NAEA 4ZPDA 4Y2AA 1DTTB 1DTQB 5F8MA 3QINA 2XO7A 1C0UA 1QE1A 3PR5B 3OYNA 2G8FA 5KG4A 2R2SA 1RTIB 1RTDA 4RNOA 2BRKA 2I1RA 3QZ7A 2P5OA 3AVBA 4TY9A 3MTKA 5HBMA 4J9LA 3RB0A 1SKSA 5KT2A 1J5OB 4FW1A 4ED3A 4NLOA 1VRUA 4KKOB 5KFDA 3RTVA 5KFFA 4Q44A 3IAYA 3BQ0A 1BISA 3F9KA 3TAPA 3OYDA 2R7YA 4Z4HA 3DRPA 2UVRA 4RUCA 3KLHA 3T5KA 4K8ZA 5K14A 1I39A 4CESA 2B4JA 4KSEB 2R2TA 1S6PB 2HNZB 2HHWA 4ICLB 5FRMA 4CHOA 4FYDA 4Q45A 2OA8A 4BDYA 3TARA 4JRQA 3AA4A 5KT3A 5KFAA 4IR1A 3DLBA 3CJ3A 3BSCA 3WNFA 4K8XA 3KLGB 1MU2B 4B08A 3KK3A 1X9WA 3KD5E 1HYSB 4GC6A 2FBVA 3IGNA 5KRSA 5KI6A 2J6UA 3KHHA 1ASUA 4XPCA 1LWCB 3M9OB 3DRRB 4KV8A 2UVUA 3RB6A 2UVWA 3OYMA 4O44B 1RBSA 4RW8B 4FLYA 5L1JA 4LH4A 3VA0A 2XRIA 2O5DA 1RT1A 1CZ9A 4CJRA 4M3UA 4K4TA 4J9MA 5HROA 1RDRA 5L9XA 4CHYA 4ZMMA 1Z26A 1IKYA 3QEVA 1JIHA 4DS5A 5KFNA 1S1VA 5KFCA 2EX3A 5KG6A 1JLEA 5K14B 2I5JA 1C0UB 1XHZA 1QSLA 3ASMA 4DTRA 5C25A 3T5JA 3ZSOA 3MEDB 3OS1A 2BE2B 4FBTA 1EETB 1TKZA 1RT5B 4DQRA 3M8PB 4IFYA 1EXQA 1ZTWA 4RW9A 4I9LA 1JLCB 4ECWA 2FLNA 3ZSQA 1T7PA 4CIFA 1LWEB 2F96A 1U49A 5JS1A 4KB1A 4KI4A 2ATLA 3U3GA 3IS9A 5HBMB 2FLPA 1Y97A 3MEGB 2OPPA 1J5OA 1JLQB 1D9DA 3MR6A 3HO1A 3CJ4A 1XHXA 3BQ1A 1T8EA 2HMIA 1SL2A 3FSIA 5J2QB 3AO2A 3NF6A 3WNGA 3T1AA 3UPFA 2KQ2A 4IKAA 3NH2A 1RT5A 2OPSA 3PJXA 4Q43A 4OPKA 5KFUA 3SNNA 3CDWA 4OPJA 1LW0B 4CFDA 1LWEA 1TP7A 4YR2A 2BANB 2OPQB 4CJLA 3PX0A 2R2UA 4CJUA 4F4KA 4IH6A 2VG5A 4ZVHA 2E9RX 3PV8A 4NLVA 1K1SA 4IFVB 2HWIA 4DLGA 3EPGA 1C6VA 1C0MA 1TVRB 5KRTA 1T94A 1Z25A 4TYBA 1QQCA 4BE2A 3C6UA 3K5OA 3TVKA 4NLSA 2AQ4A 1T05A 4KE5A 5J1EA 2Q3SA 3ZSYA 1N56A 3LP1B 1VSDA 4IH5A 3MEDA 4EP4A 3L3UA 2AGPA 4G1QA 4ECYA 3NGDA 4FS2A 1S0MA 3I5BA 1LW2A 4ZHRB 4F50A 3LP3A 3ZSZA 4J9PA 4DL2A 5KFQA 3KK1B 4DTOA 3FDSA 1S9FA 1NKEA 4W5TA 2HVIA 5C25B 4RW9B 4KB0A 3SV4A 5L1LA 4DTPA 4URSA 4C8NA 3EZUA 3DRSA 3ZSRA 1RT4A 2VG7A 2HHUA 1SUQB 4NYFA 2R8KA 3G86A 1D0EA 1IKWA 5KFLA 2PY5A 3E01B 1NK7A 3ZT1A 4URGA 3CWJA 3ZT2A 2W7OA 3G0ZA 2GV9A 1J9AA 4DTMA 5J2NA 2ITGA 3BGRB 3KLIB 4J2EA 5J2QA 1CXQA 3OLAA 3V81B 4KB7A 4LD0A 5FDLB 3OL6A 1U47A 4NLUA 4N5SA 4RW4B 2GIRA 2ZKUA 4EP5A 1Q9XA 2F8EX 4JUZA 1SH3A 4FJNA 3VQ5A 4MIAA 1S6QA 1RTJB 2QXFA 5T7BA 2RKIA 1Z4UA 4ZPAA 1WN7A 3OSNA 1KRPA 3VQPA 1IM4A 2ILYA 2FVCA 4NLPA 2OPRA 3CDUA 3TANA 3NGYA 4CGIA 2R8IA 3DM2A 2WB4A 3LZJA 4NZ0A 2HW3A 1NJZA 4KI6A 3PO4A 3RBEA 2FLLA 3KMSA 3OS0A 1KVCA 3V6DA 2W42A 5DMRA 3AVMA 4B8AB 4Z4FA 2IC3B 3IRXB 3OHAA 3HL8A 3UQSA 2JLEA 4JV1A 2UVVA 4O4RA 5KFGA 3UIQA 4O3SA 4M94A 3MXIA 4PY5A 4DQQA 1T05B 5DQGA 3GIJA 3OYAA 4CJ4A 1RT6B 4IH7A 4ZPBA 5C42A 4KV8B 3OL8A 1XI1A 4NLQA 2GBZA 3L2UA 1JXBA 1S0OA 5F8LA 4CECA 3CFPA 3AVCA 3P1GA 1WSGA 2YNHA 1REVB 4X2BA 3KJVB 3QERA 3OJSA 5J2PB 4CJ3A 5I42B 2JEIA 3NGZA 1BQNB 4G1QB 4E19A 2X6NA 4CK1A 1LV5A 3WNEA 2KFZA 4PQUA 4GC7A 3DRSB 4H54A 2BANA 3NL0A 3AVFA 3SZ2A 3MEEA 1TKTB 3V1QA 4IG0A 1CSJA 2W9AA 2PYLA 3LAKA 1VRTA 5KT4A 4ED1A 1LW0A 5DQIA 3PY8A 3HXMA 4KHRA 1NJWA 3O3GA 4RUAA 2D0AA 4YNQA 3AA5X 3HK2A 3NDKA 2BGGA 4DTXA 5KFTA 5KFKA 4ZPCA 4KRFA 4NLTA 1S48A 4ZP9A 4M3TA 2AGOA 1QHTA 3D45A 3V6DB 1HJRA 5SWMA 3DYAB 1HARA 4OVLA 4CK2A 1TKTA 4OLAA 3QNNA 4CHQA 1DTTA 1DTQA 4YFUA 1SL0A 1NHUA 3PW2A 1X1PA 4KREA 3BR9A 3SQ1A 4CJFA 5JS2A 5I42A 1LAVA 2JEGA 4IRDA 4QWEA 4K4UA 3QNOA 2CKWA 4TXSA 4DWIA 4QPXA 3LP2A 2B43A 3G6VA 3RR7A 4E1MA 1RT6A 1NJYA 4MK7A 2J6SA 3QEPA 1YTUA 4KAZA 2IAJB 3DLHA 4C8MA 3RB4A 3C6TA 3HP9A 1JLBB 4OKJA 1S10A 3QESA 4QWCA 4CF8A 5C24A 4WFYA 1VSEA 2FVRA 4M45A 3KLEA 2IM3A 3CJ5A 4DL5A 3DLGB 3DOLB 4ECVA 3GILA 1FK9A 4EYHB 5DLGA 4YQWA 4C8LA 3KKRA 3GIKA 4W5QA 4ECZA 4B9LA 1DLOB 2BR0A 3MECB 2FVSA 3KHGA 3V4IA 5J2MB 1J54A 3ULDA 5KFWA 1BQMA 5DGBA 4DU1A 4F2SA 1HMVB 4CEZA 5CYMB 1MU2A 4DQIA 5KFOA 4NCAA 4FK4A 4H8KA 2Y1IA 3RRGA 1RT1B 5F8NA 3VQAA 1EKEA 2WOMB 3SI8A 3QO9A 4B9VA 2VWJA 4F8RA 3OYEA 1C2PA 3NF9A 2XC9A 1S9EA 4FJ5A 4OGEA 4CF2A 4TY8A 4PA1A 4RNHA 3AVAA 3V4IB 4CEDA 5KFYA 3Q8SB 1TL1B 2JEJA 1D5AA 1TGOA 2XWYA 1VSKA 1RDCA 4Z4EA 3UR0A 2AGQA 2WHOA 4ID1A 3O4QA 2R8HA 5CYQA 4IRKA 3VQDA 1L3TA 3L2WA 4ZVGA 4L8RB 4I7FA 2XI3A 3S3NA 4M42A 1HYSA 2IDOA 2PZSA 1N5YA 4NYNA 1LW2B 3DRPB 4W5OA 5C5JA 3TAGA 3RR8A 2VG6A 2DY4A 1YVUA 1EP4B 4ECXA 3EY1A 3V9XA 5KFXA 4R8UB 1T03B 2HNDA 4FLXA 1Q9YA 4R5PA 5HP1A 3OSPA 3E01A 4WYLA 4XIUA 4CJ5A 1VSMA 3NHGA 4M3ZA 2V4RA 4ELTA 2D0CA 4I2PA 5D3GB 4FLWA 1GOCA 4K4SA 3F73A 1NK4A 1DLOA 4ED2A 3AO1A 1X9MA 3MEGA 2B6AA 1IKWB 1HNVB 2OPQA 4NLDA 5KFJA 2RDIA 2RPIA 4KBIA 2UUTA 5KFEA 3RWUA 2DFHA 3T19A 3I8DA 3TAMB 1K1QA 3HVTB 1TL1A 4J9KA 1JL1A 1D9FA 1LAWA 3AA3A 3K59A 1UA1A 4F3OA 2D7SA 3C94A 2E6MA 3PX6A 4BACA 1S1TB 2YNFA 4DG1B 3ZSWA 2Z1JA 4B9MA 2IA6A 1BQNA 1RT2A 3QO9B 5JXSA 4CEQA 1QTMA 5KFRA 4TYAA 4NRUA 2C2DA 1VSHA 5CZ1A 4CEBA 3SFUA 1RYSA 3GQCA 4ECSA 4CFAA 1BCMA 1CZBA 3I0RB 4JS4A 3QIPB 2HB5A 3AVGA 4B3OA 2WONB 2HHQA 5KGWA 5HRPA 2YKNB 2BQ3A 4WE1B 4CERA 2HAIA 3M8QA 2BDPA 3DMJB 3NCIA 5CYQB 4FJKA 1LWFA 1TKXB 2HMIB 5KG2A 3Q8RB 1W0HA 3ALYA 5KFMA 3ZT4A 1YT3A 1ZYQA 4CJKA 5DG8A 1RA7A 1ZBFA 1JLGA 4JRPA 3KK1A 3MFIA 2BQUA 4KAIA 2D0BA 2XCAA 1QSSA 2V9WA 4ED8A 4TQRA 4N76A 4TN2A 1B9FA 2JC0A 1JLCA 3AV9A 3HVAA 4RW4A 3PVXA 2WOMA 3N6NA 3SUNA 4B9TA 4K4ZA 3U6FA 4W5NA 4M3YA 2JGUA 2XY6A 4CF0A 2V4QA 4FZYA 2GUIA 1RAJA 2D41A 4QWDA 1BIZA 4IBNA 3OLBA 2WCXA 4Y34A 2AX1A 5FDLA 3Q8QB 4RNFA 1HNIB 3DI6A 3IG1A 1K6YA 3TI0A 2ASLA 3K57A 4K4VA 3VQ8A 4Z4IA 3RMBA 1JLBA 4LQ9A 4FJ9A 3VQQA 1KFDA 3ITHA 2C22A 1RYRA 1QUVA 3AVNA 3EYZA 4KHYA 3HSTB 3HPOA 3H08A 2QKBA 1U09A 1NK5A 1X9SA 3HM9A 4LSLA 3KNAA 1D8YA 1NHVA 3CVKA 4MKBA 3ZT3A 3P5JA 3QGHA 4CEOA 1NOZA 4PWDA 2DFFA 4B3OB 1S1UA 4JLHA 3QIPA 4F4YA 5D3GA 2JC1A 4DFMA 1ASVA 1A5XA 2XCPA 4H4MA 2ZD1B 3CJ0A 1S1XA 1FKPA 4MFBB 2RDJA 3SYZA 3T5HA 4TLRA 2OPSB 4IG3A 1D1UA 4FM2A 2DTUA 4NCGA 1RA6A 3RAXA 1HQEA 4FCYA 3SUOA 1VRTB 1UAXA 5CZ2A 3IN5A 1YTAA 4WFZA 2W9CA 1Q8IA 3VQ6A 4ZTJA 5HLFA 5F9NA 4CGHA 2Z1HA 2ZE2B 2DPJA 1TK5A 2HHTA 5EWGA 1C1CA 1REVA 1XWLA 2E6LA 1XR7A 4CIEA 4LQ3A 4YP3A 1RTHB 3LAMA 1S1TA 1EP4A 3JSMA 2AX0A 3CO9A 3L2VA 3MEEB 3IRXA 2R2RA 4ED0A 4RW7A 2YNIB 3LPUA 5KG5A 1RNHA 4ECQA 4FLVA 3BSNA 3CQ8A 4R8UA 4ZP7A 3SFGA 4DFPA 1B92A 4W5RA 4JS5A 1S5JA 4IOBA 4AHCA 2ALZA 2W8LA 4NCGB 1JX4A 1L5UA 3MR5A 4ID5B 2HHVA 3OYJA 4HHTA 1VK0A 3I5AA 4FLZA 4KFBA 1VSIA 1RT3A 1JKHB 3NBPA 5CY4A 2KZMA 3OYLA 3K2PA 1TKDA 4EZ6A 3ZCMA 4U7CA 4E7KA 4AH9A 4LSNA 3KOAA 5KG3A 4IR9A 1B9DA 3H5SA 3FRZA 3HVTA 4J9NA 3KLGA 3NAHA 1LWCA 4DTJA 4NLGA 4DTSA 3BSOA 2OYQA 4Y2CA 1HPZB 2HNYB 4O3PA 3H5YA 4FK2A 2YNGA 3O4NA 3BQ2A 1KLMA 3RAQA 2A1RA 4F4WA 4K4WA 2YV0X 1S9GB 3TAFA 4MIBA 4DSLA 3K5NA 3AVLA 1SV5B 1U4BA 3GV7B 4IQXA 1ASWA 2X6SA 4Z0UA 1IKYB 4F4XA 4O3RA 3BSAA 3M8SA 4Q8EA 1S1XB 2C2EA 4M3RA 2G8WA 2XI2A 1MMLA 2P51A 4BWJA 5HP1B 4HUEA 2HNYA 2YNHB 2IS3A 5DK5A 1S6QB 3OYGA 4Y1DA 3CFOA 1TQLA 4DQPA 2A1SA 4QCLA 3HVWA 4OLBA 4CEAA 2FBYA 3ZSXA 1NKBA 3MF5A 3KLFA 4DEZA 1JLGB 3QLHB 3M8QB 2RF2A 3GIIA 3AA2A 3TR8A 2HHSA 2FJVA 4QWAA 3KK3B 3NKYA 3NAIA 1WNSA 2YKNA 3MR2A 2W7PA 4RG8A 4I2QA 2VG7B 1BL3A 3CG7A 1CLQA 2B5JB 2IAJA 1A5VA 4RW6B 3DMJA 3KLEB 3HT3A 3PR4A 1LWFB 1SH2A 4FLTA 3DRRA 5JUMA 5T14A 2EC0A 3LDSA 4BDPA 1TL3A 4KHWA 3RMAA 4MK8A 4U6PA 1S1WB 4PUOA 1RBUA 3ICLA 1BQMB 4K4YA 1WSJA 4CJEA 2C28A 4FM1A 4KFBB 3HKWA 4FM0A 3L3VA 1JKHA 4WZQA 1BIUA 4Z4GA 4Q0BB 4OL8A 2YKMA 4Q8FA 2FVQA 5KGXA 3BDPA 4WFXA 3E51A 2OZSA 3P83D 1SV5A 4E7LA 3IS9B 2W8KA 4J9QA 5C42B 5HRSA 2VG6B 1BCOA 2O4IA 4DL6A 3QYYA 4J9RA 3LWMA 1S6PA 1XC9A 2D3ZA 3CYMA 4NLYA 2XHBA 3K58A 5EWFA 3QGGA 4KHNA 1O1WA 1G15A 3CM5A 3H5XA 4NYZA 1T3NA 3RBDA 4ELUA 5KG7A 4O5BA 4DS4A 4YR3A 3ZSVA 1JXEA 3DLRA 1A5WA 4E7IA 3QGIA 2IM1A 3IGVA 4DTUA 5L1IA 4NLWA 4KHUA 4J9OA 3H59A 3OYHA 4CHNA 4LSNB 3G6YA 4RNNA 2KW4A 1SL1A 3KHRA 3KLFB 4O3NA 2E9TA 3KD1E 1C1AA 4TSXA 1GX6A 4M3WA 3OYBA 5FROA 4O0JA 1HQEB 1RBTA 4RZRA 4DSKA 3PW7A 4FZXC 3NH0A 3MFHA 3B6OA 1R0AA 3MXJA 1QSYA 4NCBA 3AVKA 4IDKA 4XO0A 3DLEB 4DL3A 4K4XA 3GV8B 5KTQA 4BDZA 4J2DA 3PW5A 1BGXT 3T5LA 3EPIA 2BE2A 3BJYA 2G8UA 4FS1A 3OL7A 2ZD1A 2ZE2A 1SKWA 3NFAA 4PUOB 1IG9A 4FK0A 5KFVA 3S3OA 1XR5A 5CYMA 4CIGA 1S9EB 3OHBA 5F8JA 3KK2A 4E7HA 3CJ2A 3GV5B 1NNDA 2WK4A 5C24B 3Q8PB 4CK3A 4MKAA 4TQSA 4EEYA 4YMEA 4N56A 3OY9A 4FJ8A 4CE9A 1FKPB 4XPEA 4BE1A 3OYKA 1ZBIA 1NOYA 3VA3A 3SUPA 2GIQA 4ELVA 3VQCA 3PW4A 3V1RA 2O4GA 3I0RA 1KVAA 1OS5A 1W25A 5HROB 3V81A 4FW2A 3DOKA 5KFZA 4QW9A 3HYFA 2GC8A 1JLFA 4K50A 4CFBA 1SH0A 4EZ9A 4DF8A 4ZVFA 1BI4B 3H4BA 4RW6A 4FJXA 2HWHA 3L2RA 4DU3A 2W9BB 2D5RA 1JLAA 1UWBA 4IFYB 1QAIA 2BRLA 4EBDA 1QS4A 1BHLA 4HCBA 2FJWA 2NUBA 2ILZA 5DG9A 4CJTA 3SPYA 4WYWA 4WZMA 4ICLA 3T3FA 5DG7A 1NK9A 3GIMA 4FVMA 4DL4A 4HUGA 1ZETA 4EO6A 4LY7A 3KMQA 5F9LA 1JLEB 3EZ5A 1FK9B 2QE5A 1WNEA 4RW8A 4IDKB 1TKXA 4GVMA 3SQ2A 4B8CA 2HNZA 3H5UA 1RBVA 4HKQA 3OYCA 3H98A 1NKCA 3MR3A 3WNHA 4ZP8A 1NK0A 3DLEA 4EYIB 1RILA 3AVHA 2ASDA 3LANA 1HQUA 3KIOA 3MXMA 1RDAA 2HVHA 3DLKA 4ED6A 2YNFB 4DG1A 4CHPA 1RT3B 3NBPB 4OKKA 3DOKB 3K5LA 1IKVB 4BWMA 4CJVA 1GOBA 4ZHRA 3UDLA 2X78A 1SKRA 4R5PB 3C6UB 2G8IA 4KO0B 3V6HA 1QE1B 2G8HA 3V9WA 1KLNA 2DFEA 5KFSA 3VQBA 1KLMB 4RNMA 2IMWP 4CFCA 2VG5B 4AHTA 4B9UA 1TKZB 2R8GA 2YNIA 3KLHB 2ETJA 3DLKB 2XGQA 4IFVA 1RT7A 3JSMB 3H40A 5KT6A 3KLVA 2B6AB 1TL3B 1HNVA 2LSNA 3LALA 1IH7A 4KHQA 3SI6A 4LSLB 2OPPB 3KJVA
chains in the Genus database with same CATH superfamily
3QAUA 1VSJA 2YHAA 3N01A 3QLHA 2FBXA 1N48A 2EFOA 3J80U 5ETNA 5AQHA 1FKOB 2VA3A 4EWTA 2GFFA 1ATRA 4PQUB 2HF4A 1QTNB 2DGSA 1QVFM 1TV6B 3VN5A 4QQBA 3U1LA 4H5RA 3KUGA 4PPZA 3ZZOA 2YVSA 4WFNQ 4U7UK 2GGPA 2P5GA 3RU0A 3GMGA 3L9ZA 4OZJA 3O9TA 4KHSA 3F9MA 4KGKA 2UXCF 2NXUA 3CCVN 5BRDA 4MT1A 4CCHA 3C95A 4JYAJ 1T02A 1K8AT 4QJVA 5THWA 3D3CJ 3KJFB 5SZTA 1HL6A 1FRKA 3A2FA 3PTWA 1B4SA 1SAZA 4V19J 1V3ZA 5EXWA 3C6HA 1GX5A 3SV3A 2C1EB 4LUBA 4BRDA 3IO1A 1T9TA 4ES2A 4DU7A 4GRSA 1R59O 3T1YJ 4AHRA 3VAMA 2GIFA 4DDFA 1IKXA 3M2VA 3CPWM 1RBRA 2BJ7A 2QM1A 4DKWA 5CZVA 1RCHA 3KHLA 3KLIA 2BA9A 3M9MB 3FCWA 1NSPA 4WXOA 3HD2A 2IYGA 3WBZA 1RT4B 1B0VA 1U45A 1VIXA 2FVPA 1NMEB 2HPUA 3CIMA 4USIA 5KT5A 4MLHA 4IO9L 4J2BA 4JI6F 1NRKA 4UOFA 1KNZA 4X4TA 4J2AA 4FPBA 4HACB 2I5JB 4GKKJ 2BH1A 5J2MA 2P9IA 4Z2XA 3O9QA 3HKZD 4ECTA 1WAFA 2FZGB 3CCSS 6FDRA 1ILYA 1YDLA 1ZTTA 3N79A 1N5SA 4K0KK 3G6XA 5BR8K 1K47A 4DMNA 2BKNA 2X51A 1RTDB 3FGVA 2ZQBA 2ZWOA 1S77D 3SQ4A 4USVA 4J9VA 3MAQA 1X5OA 3V1OA 5AQOA 4FF2A 4AXJA 4DR4J 4JI0J 1RDUA 4OLPA 4NLXA 2QLXA 3N6LA 2J6TA 3J7YP 3CDEA 3LP2B 4RU9A 2GVZA 1VRQC 3QPIA 4JI4F 1L3UA 1I3AA 4F4ZA 4R79A 4QS9A 3KK2B 3EWGA 2IM2A 3UVJB 5L46A 4B17A 3S9HA 2VBWA 3NMUA 3NGIA 4NLCA 3T1HJ 3VQSA 2VWKA 2NR0A 1WOQA 3U9DA 5J2PA 1K0TA 4BRHA 1N4LA 2DK2A 2ASJA 4FZZA 4ID8A 4KPYA 3OYIA 1EX4A 1WOOA 4CZJA 1GOAA 3MAHA 3DM2B 5AQGA 4KO0A 4KH6A 1RJJA 2XZTB 4HDHA 2QV6A 4NLRA 1K8KA 2VA2A 4DV6F 2XGPA 2LMIA 5DGAA 3PUFA 4H4MB 3MX5A 2K8GA 5KFIA 1BO5O 2PYJA 2IJNA 3MMBA 3AO5A 3HVRA 3BREA 4KHMA 1S1VB 3MUVP 2Y0SD 1U0HB 1NWKA 1X3NA 4BREA 3H7HB 3AAPA 4OZ2A 2KM8B 3LF0A 5M1QA 1FW6A 3R5AA 4LBPA 2BMBA 4Q5VA 3TJ8A 3SUQA 2RQMA 5GINA 3D2WA 4E7JA 1GLCG 4KTWA 1WJ9A 4YB5A 3SJJA 2RF2B 4DV3K 3HPHA 2D3OR 3PO5A 1JK9B 1AXQA 3FC9A 2Z30B 1FEEA 2Z57B 1UPMB 2E7VA 2BZ2A 1H2TZ 4KH4A 1KTQA 3PJWA 1PJ5A 2CYYA 2YHBA 5AQKA 2BM0A 3N4QA 1U0HA 1XMOK 1W7AA 3OVNA 2DYAA 5IT9O 2RILA 4K7QA 3OJUA 3PIOL 1WELA 3AB4B 3O3FA 3PHEA 4JI2K 4OI2A 1S79A 1TK0A 5H9FK 4AQYF 1S9GA 3A13A 1T9VA 1GLJO 5E7OB 3K0SA 2KTQA 1KFSA 4YOTA 5E0OA 3TZWA 2F65A 2P9NB 5IT9U 4KKOA 4KHPK 5A2QO 5EU7A 1HWUA 2O8FA 3ZT0A 4JKEA 3PDNA 4HUFA 1HYZA 2FZCB 3LZIA 2P9KB 3R6MA 3IFEA 1WEZA 2L41A 3GCXP 4P10A 5FLXO 3M05A 4H4KA 3B8AX 3TEHB 2N82B 3CCLS 2KFNA 1Q5VA 3W9IA 4N41A 3DLGA 3QT7A 3M30A 1RLDA 1S1UB 3LP1A 4DCJB 3FNNA 4CGFA 4P73A 2CQBA 3CCWA 2D1CA 4CEFA 1RWOB 4FO0A 1U6FA 2RD5C 1N8RT 1DTTB 3PRBA 4DV2F 1RHQB 2QWRA 4OJ1A 4ZOSA 4OZ5A 3GTYX 5KG4A 2AYGA 1RTDA 2YXLA 4RNOA 2BRKA 2UXDF 2CQ4A 4CQ1A 4F36A 2I1RA 3WXJA 3AVBA 2DB1A 4TY9A 4LIWA 4DCPB 1EQ0A 3RB0A 3THPA 2AD9A 4CZHA 1Y5LB 4GVEA 2CPIA 3SAHA 3KDNA 5EHHA 2XHCA 1IBMK 3BS9A 2HQDA 4C98A 3RTVA 1GMWA 3OTOJ 3P5BP 2NRZA 3R2DJ 1IBKK 3UN2A 3BQ0A 2AIRB 3OYDA 1N36F 4DV1K 3BV8A 3PYFA 1PO6A 3KLHA 1RWKB 1QAXA 5K14A 4OO1J 2KU7A 1GMUA 4I68A 1U25A 1JMTA 3LM2A 2OSQA 3KZBA 1X3MA 4ICLB 1FX4A 4CHOA 1UZHA 4BDYA 2H9ZA 1NUEA 5A8KA 4IR1A 4K8XA 2JH3A 3HDSA 5H9FJ 4DR4F 2HEKA 1SC3B 3KK3A 3ID6A 1E6YA 2BABA 2Y1RI 2UUBJ 3IDHA 2KL8A 2FBVA 2XHWA 4WTYA 4EFAC 3IGNA 2OTLS 3X3UA 1KQKA 2MGZB 5KI6A 1LWCB 4K2JA 3DRRB 4KV8A 1ESVA 2XBPA 3RB6A 4C3LA 3J8AA 2FZKB 3VA0A 3EGNA 1XK8A 1SQEA 3WZ0A 5AXNA 1JIHA 3BEGB 4DS5A 2XM3A 1S1VA 5KFCA 5K14B 1N36J 1ACMB 4WYBA 3C16B 1MLAA 4DTRA 4DV4F 3ZSOA 2BE2B 4OI4A 1RHMB 5HMYA 3M8PB 4IFYA 5DDRC 2ZC4A 1JLCB 4ECWA 2FLNA 2IBOA 1T7PA 2O8BA 3IAM9 1PC4A 2FHKA 4KB1A 3U3GA 5HBMB 2HZAA 3D1QA 3MEGB 2FC8A 5D8HB 2VFVA 2M8DB 2PN6A 5K8NA 4WP9A 3WIUA 1D9DA 5F3TA 1NH8A 2R7TA 2C42A 4MLEA 5J2QB 2VPXB 2HBQB 1H72C 2DRBA 1YITS 4DR7F 3P45B 3NF6A 3MM7B 2UUAJ 4IKAA 2A2DA 4OPKA 1R0CB 2XULA 3CDWA 1HUXA 4OPJA 1N52B 3AT1B 4BQZA 5E84A 3D1HA 5ADXA 5CE3A 2H1YA 3T6BA 2DNGA 2OPQB 1VQ7S 1CJVB 2CQIA 3UB5A 5JVGQ 1ROFA 2YKPA 2EKNA 2P6TA 3GR1A 3BR8A 2R2UA 3GLJA 4IH6A 2VG5A 2LDYA 3ATVA 3BBFA 3BZKA 3CCVS 3PXGa 2QN6B 1K1SA 3CUNA 2BYCA 1C0MA 1ZS6A 3ZZ0A 1T94A 2XSFA 2O8FB 4TYBA 4DV3J 1QQCA 2Q6BA 4ZCLA 3TVKA 2QFJA 3A8JA 2Q3SA 3ZSYA 3LP1B 4BRFA 3CCZA 3MEDA 4IH5A 4EP4A 4RWXA 1PJ7A 3NGDA 1VQPS 2Q3PA 1S0MA 4BHQA 2DHXA 1LW2A 4F50A 2ZH2A 2GCFA 4JHDB 3LPEA 2QGFB 1RU2A 2G13A 4PR6A 3NWRA 2L08A 3NWGA 5C25B 1X7VA 5L1LA 1ITPA 1NHKL 2CNOB 2HHUA 1RT4A 1SUQB 1D0EA 2B0GA 2A0FB 4HHUA 4URGA 1UEKA 4XK8C 1Y64A 3CWJA 3G0ZA 2GV9A 1J9AA 2YPYA 4WQ5A 2ITGA 3KLIB 1Q8LA 2ACYA 2AJ2A 1X4CA 2L9NA 3FFKB 3GIRA 3DU6A 4KB7A 3CC2S 4WIIA 5FDLB 3DDIA 5F3ZA 4X64F 2GIRA 2V34A 3DXKA 4DX8H 3EXCX 4JUZA 1SH3A 2DGVA 3VQ5A 5GAHI 2E1CA 2NSCA 2E29A 4GKJK 4QS7A 1RTJB 2FC9A 2IRYA 1T0TV 3M5RA 4NI2B 1WN7A 3VQPA 1QZ5A 1IM4A 2D69A 2FVCA 2JZ5A 1G99A 3CDUA 3TANA 4CGIA 2R8IA 3CCUN 2WB4A 1I94F 3VTIA 4NZ0A 2HW3A 3IXQA 1NJZA 1CC8A 2FLLA 3KMSA 2DGTA 2ZFHA 3AVMA 4NA2A 3QFWA 4C3KA 1GLFO 3W7BA 2Q36A 3HL8A 1NJIO 1N0VC 1OMSA 4JV1A 1YTYA 2UVVA 2QFIA 3O44A 3UIQA 2FJDB 4O3SA 4M94A 1NBEB 1YGYA 1RK8A 4FOIA 1V3SA 2PO4A 2DVIA 1NGFA 4RBUA 4MTPA 4YDDB 4FYVB 2VFRA 2CQPA 1VIOA 4KV8B 2QL5B 1P6TA 5LXRA 1V5IB 4CECA 1WSGA 2YNHA 2EWHA 3WX4A 1E6YB 3NGZA 1XERA 4YY3K 1BQNB 4G1QB 4KT0C 2V8HA 1NG9A 1XEZA 3BH7B 3HSZA 1J5EJ 4XH5A 4PQUA 2E7XA 3V1QA 2ZF5O 2DY1A 3ZO7A 4MJKA 4ED1A 4J91A 3PY8A 1LFPA 3HXMA 2NRXA 1U02A 3KG1A 4B1WB 4BS2A 1X5PA 3HK2A 4PG7A 3NDKA 4DTXA 2FHJD 4X4QA 4KRFA 4NLTA 2XLKA 1F5BA 1Q95G 3CJ8A 1UEVA 3RW7A 3V6DB 1OPIA 2B8QA 2IDLA 3PEHA 4LT6A 4CK2A 4ZCIA 5AE1A 1JCEA 2QMWA 2K3KA 1NHUA 4BR5A 3BR9A 3SQ1A 5AXLA 2CH6A 4QWEA 5LMUJ 3QNOA 4OV6A 3CCRS 4BVPA 2NYHA 3T1YK 1UVNA 3G6VA 4E1MA 1RT6A 5CHCB 3OTCA 4H03B 1RI7A 3QEPA 1NDCA 1YTUA 3MM5B 2LQ9A 3HP9A 1U1OA 4QIGA 3SJHA 4OKJA 3QESA 4CF8A 2FVRA 4CTAA 2FF6A 3KLEA 4DL5A 2RB7A 1FFGB 3DLGB 2XMUA 3BN4A 2RQCA 1M1GA 3UR3C 3GIKA 2N3LA 4U7UD 1DLOB 2BR0A 3TUIC 2FVSA 3V4IA 1J54A 3ULDA 5KFWA 4CM2A 2JWLA 4DU1A 4F2SA 1HMVB 3AHPA 3NXZA 4MO5A 2JVRA 1MWMA 1MU2A 4DQIA 2XYPB 3DNCA 1M5OC 4H8KA 2Y1IA 4XDDA 3NS5A 5MAOA 1TUYA 1UVLA 3QO9A 2GV1A 1YJUA 4RL1A 1E6VB 3G8TA 2ZOFA 4J90A 2RRNA 2DXDA 1YJNN 1S9EA 3C3LA 4FJ5A 4OGEA 4CF2A 3DRXA 2VYPA 4PA1A 4PPDA 2MZRA 3AVAA 3OTOK 5BR8F 3QATA 2VPZB 1O13A 5JVHL 1TGOA 3ET6A 3M2RB 1RDCA 2ERRA 2L3MA 3K9KA 2Z2YB 2XS2A 4KC5A 2WTUA 5C7PA 3L2WA 2K3IA 3W65A 4ZN3A 5IWAF 4L8RB 2HOEA 1HYSA 5IT4A 2DGOA 2JWNA 4M5KA 1RU1A 5M1OA 3OTBA 4LF2A 3TAGA 3KWIA 4CT9A 2DY4A 5B0AA 3LW5C 3CC2N 2WVFA 4ECXA 3V9XA 2VZ9A 1OQ3A 3D0HE 4M1KA 3R8YA 4K42A 2OTJS 3THYB 2RAQA 2MKKA 2BE9B 3NHGA 1FCAA 4Z37A 4OX8A 2HGMA 4BG9A 1GLDG 4FLWA 1XNRJ 3CJAA 1GOCA 4OZ1A 1FVQA 2Z0GA 2H65B 2LXUA 2ZBIA 3AO1A 2QWPA 3AD9C 4YS2A 3AOAA 1HHQA 4NLDA 5IOLA 1HR0J 2RDIA 1RWVB 3MMBB 2RPIA 1B70B 3R3TA 1FXLA 3PKMA 3ZZTA 3C14A 5KFEA 3RWUA 3TAMB 1JXVA 1K1QA 3OR1B 3AA3A 3K59A 3CJQA 2PI5A 1YXQA 3EVWA 4F3OA 4WWSA 3HI0A 1TTHB 3PX6A 3QT5A 2YNFA 1F9EB 2GEMA 1NPKA 3NGTA 1RT2A 4CEQA 5D0RA 1OO0B 4TYAA 2QYCA 2C2DA 2F4VJ 2V8DA 1LWXA 3VF4A 5CZ1A 2QA1A 4CEBA 3SFUA 1RYSA 3GQCA 4JI1J 3ENVA 3CE8A 3F0NA 1CZBA 3I0RB 2KXNB 3FRYA 3QIPB 3KVGA 4DPWA 4C0OC 2HLUA 1M5PC 4ZLNA 4K41A 3IBCB 4FPRA 3MCAB 2HHQA 4NWBA 4H5VA 5KGWA 2BQ3A 5A8WA 4ZLLA 1FX2A 2HAIA 2BDPA 4X4VA 1XUPO 3NCIA 4DX6A 2NREA 4FJKA 1RB0A 1VQON 3SSSA 5H1SQ 4C4WA 3Q7BA 2M7SA 4ILGB 3ALYA 2MLXA 4DV0K 4OHXA 1ZXOA 2V67A 1JLGA 3MFIA 4FWNA 2XCAA 4ED8A 3MR7A 4JKCA 3F5TA 4TQRA 2HS4A 4TN2A 2JC0A 2J0XA 3AV9A 2DNLA 4Y65A 3AB2B 2CQHA 3N6NA 3IMQJ 7AT1B 4B9TA 4FVUA 4K4ZA 4MAKA 1TYQA 2JFDA 2GHPA 2GUIA 3P5TL 4QWDA 3MM5A 2IVYA 1BIZA 4FWMA 3U1NA 4CO2A 3WIVA 2AX1A 4X65J 2JFKA 4HACA 4CZIA 2AT1B 3VAFA 5F0WA 2C3YA 1I51B 2MKCA 1SJQA 4LF4J 2HBYB 1KFDA 2KVIA 3MI7X 3ZZPA 4KHYA 3QBCA 3VAGA 3HPOA 4KHPF 1U09A 5ETVA 3HM9A 4C48A 3UI3A 3KNAA 3CB4A 3ZT3A 3EM1A 2FY1A 1FVSA 3QGHA 3OQ2A 4CEOA 5F0XA 4ZCMA 4G1IA 2HQ3A 4OYMA 3MCNA 3PM9A 2ZOMA 1WDTA 2W2PP 3BGUA 4CD3A 2ZD1B 2YWHA 3C65A 4DR6J 2OPSB 2UV8G 4ZIWA 4IJAA 1D1UA 2QZ8A 4FM2A 2DTUA 3M7VA 4H0XB 4AD6A 2H48B 4FCYA 2W6KA 2HVDA 2B7CB 2CADA 3IN5A 4WFZA 3NVMA 2W9CA 3VQ6A 2IY5B 4GKKF 2Z1HA 2ZE2B 4JI7K 5G0RB 2Y8WA 1F2GA 3P4IA 3UW1A 3VENA 1REVA 3ATUA 4H0PA 5IM0A 3TTDA 1KQSR 1J6ZA 2HURA 2RUGA 2HFVA 3C16A 4DV1F 3BBCA 2CQ1A 2R2RA 3H20A 4RW7A 5E2QA 3LA0A 2D4WA 3LPUA 3FJ2A 4Y2KA 2VU5A 4FLVA 4AL7A 2AP1A 2BACA 2LFVA 2LKZA 4DV4K 2VKRA 3OVBA 5BYSA 4JS5A 4G65A 3THYA 4IOBA 4AHCA 2ALZA 4QR0A 5AQJA 3SDEA 5ETTA 2V8PA 4ZVQB 4JI4J 3OXGA 3TUPA 1VK0A 3I5AA 1VSIA 3NBPA 3K2PA 5HL7L 2ZKTA 5GMKa 3A5NC 3CC4S 4C0HA 2O8DA 5AQIA 2LP4A 1RFQA 4DTJA 3BYRA 4Y2CA 1EIYB 4O3PA 3H5YA 1FJCA 1U1KA 4F4WA 5DDPC 4MDBA 4BY9C 7FD1A 2OKQA 1SV5B 3AY9A 2BOPA 1OSDA 4W4MA 1U4BA 3GV7B 4IQXA 1VR6A 3ZTSA 4O3RA 2RHQB 3CMES 2D0OA 1VQ5S 1ZZNA 2DR5A 2C2EA 4QS8A 4DV3F 2P6SA 2VFTA 4QIEA 4JKHA 1WB9A 5HP1B 2QTWA 3N4WA 2B51A 1VQ9N 5DDOC 1S6QB 4Y1DA 3CFOA 3RBXA 1T3OA 4CEAA 4H0TB 3ZSXA 1ZBSA 3Q8YA 4LFCK 3KLFA 1NGHA 3GIIA 2HHSA 2FJVA 1T6DA 2ROEA 3NAIA 3MR2A 2VG7B 1CLQA 2WFBA 1VBXA 2D74B 4IQMA 4CO4A 1A5VA 4OQJA 4JI1K 3JXOA 3HHEA 3BO2A 1ATNA 5AXMA 3S01A 4BDPA 4DR6K 2DNYA 1EAYC 4YOWA 4ZA1A 1S57A 4IEEA 4DUYF 3H1QA 3AQOA 1BHNA 2XLJA 3VTHA 1U1QA 3QFHA 1S1WB 1RBUA 2OAUA 1RAAB 3DU5A 4MKYA 4CJEA 4DX7A 3MK6A 3HKWA 4FM1A 4FM0A 1S5ZA 2HK2A 3V5RA 2YKMA 4HR2A 2FVQA 3BDPA 3VMFB 2E5JA 4GNIA 4JD2B 3E51A 1YK9A 3P83D 5LOQA 4RUHA 3JS9A 5BPNA 4E7LA 3IS9B 4FWSA 3VGKA 5C42B 3MAAA 2KN4A 1R8HA 4B3TF 2F4VK 4J9RA 1XC9A 3CYMA 1CQNA 2CZ9A 2XHBA 5EWFA 3IM8A 1YG0A 2O01C 1N33K 3O9SA 1O1WA 1WEXA 1HWKA 4NYZA 1T3NA 4F0MA 3NGKA 2XS5A 4Y00A 1IR0A 1JXEA 3DLRA 3EXYA 1M5HA 3QGIA 2AMCB 3QMLA 5ETKA 1YJ9N 4CHNA 4LSNB 4O5FA 3MN6A 1EO1A 2MQQA 3OYBA 5FROA 2PAVA 4CNYA 4DCHA 4ENOA 1DFDA 2N7YA 4WKRA 1NPRA 4C1NK 5LM7E 3MWTA 4FZXC 1Q1KA 4LC9B 2J5AA 3HOTA 5E3AA 4YEAA 3MFHA 4FWOA 2QA4N 1U24A 1HWJA 1ZPVA 4K25A 4DL3A 2LEBA 4K4XA 3GV8B 1GAOA 3E9LA 3L3CA 3D6FB 4JN4A 3GJQB 1G7CB 3M1VA 3DOMB 4FXWA 1SKWA 4CZCA 1HBOA 4FK0A 4FYYB 5LJ3Y 3IR6B 2EPIA 2P9GA 1S9EB 4E7HA 3CJ2A 4ZJQA 3I55N 1VQNN 2KYXA 3BEXA 2WK4A 1RBLA 1UJ5A 3Q8PB 2G0JA 2D9OA 4EEYA 4DMZA 3OY9A 4FJ8A 3FEXB 2J9EA 1GMWD 1NOYA 1ZBIA 2GIQA 4ELVA 2E2OA 3H2VE 2X1GA 1OS5A 3W1YC 4B3SF 5HROB 3GE1A 4E8UA 4TNOA 3DOKA 2PA8D 1D09B 2CJKA 1TMJA 1N36K 5AQXA 1UWBA 3LPYA 2NRTA 2ILZA 1A9NB 2AHOB 2J76E 4WP8A 5DG7A 5K5MA 2KT5A 3GFYA 3GIMA 3EZOA 4FVMA 4EO6A 4LY7A 1PIEA 1JJ2R 5F9LA 3KMQA 1WNEA 4IDKB 2VB6A 2XWXA 1F9FA 3CULA 2GTDA 2HNZA 3H5UA 5A8WB 1NKCA 2ZH6A 4ZP8A 1NK0A 4IOCL 2KH9A 3O80A 3LANA 4F7VA 2BUNA 3DLKA 2CFXA 3ZEUA 2Q2RA 2MKYA 4OKKA 3DOKB 2A3JA 2P9LB 2U2FA 5GIOA 4RJVA 1Y4ZB 1MN9A 2X78A 4DQ8A 4R5PB 1J5EF 5HSPA 5AQVA 2G8IA 4YHHJ 4AE5A 1QE1B 2G8HA 5KFSA 3VQBA 1Q81T 3SEOA 2G1DA 1KLMB 3G82B 2L9WA 2NNWA 1RXOB 4RNMA 2OLWA 4BLGA 4N8OA 2YNIA 3THTA 2OI2A 3FMWA 3DLKB 2H4YB 2J7WA 3HI9A 4NYPA 1RT7A 3JSMB 3TX0A 3H40A 4WF9L 1K8AO 2OMOA 4WTOB 1UPPA 4C23A 4EUVA 4C11A 4ER8A 4MYTA 1NSAA 5CHIA 4KGVB 2A6OA 2DBBA 2BVZA 2OPPB 4QYZK 3PZPA 2YI1A 3DXMA 2P2CB 4OPAA 5DRKA 3THXB 3L8BA 5J1EB 3NMAA 4HVJA 1EB0A 2E1RA 2FSJA 3Q0AA 4B9NA 1U04A 1TAQA 2MHNA 2GMJA 3ENOA 1XNRF 4DUZK 1S97A 4FKYA 4JI8F 1ZBUA 4J37A 2Z1GA 1X4BA 2KT2A 1LEOA 3CCJN 3D7SB 3CIZA 1R31A 2CQ2A 3G71S 3DWLA 1UETA 2BJ9A 1QLNA 1YVFA 3TPQA 2CNNB 4M95A 1UAWA 4R0JA 3LP0B 4JK7A 3VQ9A 2W9CB 2Z2ZA 3FCHA 4XH4A 1R8PA 2AA4A 3MDFA 1SUQA 1FXXA 2IC3A 4L3NA 2KRRA 4CJWA 4JI5K 3R27A 4NEYA 2LEAA 4L3KA 2P9CA 3TABA 4BRPA 5J2NB 2P5VA 1ZBLA 2CJQA 4DSJA 3ILIA 3CCEN 4UUXA 3ZX0A 3U3YA 4CEEA 1GTHA 3H4DA 5EUHA 3UCUP 1E6VA 5DQHA 1U26A 2KHCA 1C0TA 1AA1B 3QSIA 4JAXA 3DAWA 2WVEA 3T1HK 1K73T 4LFAF 1KHVA 1TK8A 4OX6A 3W64A 3JXUA 1KVBA 1JXLA 2GMHA 4FNHA 1WOSA 4MDAA 3OR2A 2XMTA 1QQMA 3A4TA 2G2OA 3QEXA 2HRYA 4K43A 3FZFA 4DSIA 2WVCA 1HI0P 1WHXA 3CMAN 1TL7A 5LT5A 3RB3A 3SCXA 1Y3JA 3ITHB 2ACMA 2ZDOA 1HRHA 4DSFA 1VQLS 2XZWA 4DPYA 4Y1CA 3WT0A 3W60A 5HMWA 3L95X 5KOWA 3O1WA 3FFIB 3IWLA 2P1JA 2W9BA 1S6UA 1RTIA 1HKBA 3CCMS 4KIAA 4IG0B 1RQ0A 3FQLA 3CGIA 4EBCA 5AQUA 1J53A 4JBCA 2O8EA 1P8ZA 4ECRA 1ZH5A 3PYGA 4AQYJ 4LFAJ 4F0HA 1Y10A 3HJFA 5DLFA 4OX9F 5KPRA 4R25A 2HBKA 3MM9B 1WSVA 4JOUA 4JI3F 1KQGB 2YKQA 3JYTB 2MKHA 1BOTO 3N6MA 4ED7A 2OEMA 3T9ZA 4YUDA 3DYAA 2DPIA 3VGMA 3MM8A 3AXKA 2DHSA 4AHVA 3FFIA 4FJMA 4DUYK 3VGSA 3HHLB 4I1TA 4OZ0A 2E4LA 2FPHX 4NXMJ 4OJGA 2IBKA 1PYTA 1U2VB 2B7BB 3L2QA 5DETA 2G2YA 2OH2A 5K8MA 2MQOA 4OJRA 3GR0A 1IKVA 3QSYB 1BWFO 2LQ8A 2HFOA 4UTGA 4TU7A 4HDGA 4EIAA 3MMJA 1S1WA 3ZTRA 4R0EA 5LY3A 4N7TA 2JEFA 4C3MA 1YX2A 4OYPA 4AHUA 5HJXA 4CO1A 3GFZA 2ZNYA 1OY9A 3NF7A 2WW8A 3AAQA 3FBEA 1W9HA 3LPTA 1QY7A 4DR5F 4XAKA 1VQNS 1RAFB 4FJLA 3F41A 5FRNA 2ATQA 2VUGA 2F9WA 4DFKA 2HRTA 2YWFA 4PHTX 1N6QB 3IG1B 1C1BA 4CJSA 3OFEA 2E7WA 4Q2MA 2F3JA 3CD0A 4HTLA 2V2KA 5GIPA 5KFHA 1R0AB 1BI4A 2JHEA 1N32J 4WE1A 1WF2A 4RLEA 3HFVA 1HR0K 1MA9B 3R5DA 1X0FA 1WSIA 3MECA 2KHOA 4ZVEA 3BUZB 2VD3A 9ATCB 1X5TA 3KG4A 1N5YB 4L74A 2NRWA 4I9QA 1KHWA 3ET6B 3U9ZA 4WFNL 1R8AA 3TTFA 1N6QA 1PCAA 1TUWA 4H4KC 4LRDA 2W41A 2YNGB 3GYNA 1VQPN 1KAZA 4OHZA 2KO1A 3VQ7A 4Z7CA 3DGVA 1UOCA 1R43A 2G8VA 3QETA 1LK5A 2D3UA 2IGIA 4DPOA 2VH7A 1KWMA 2P9PA 3IWNC 4FJIA 3K89A 2QWOA 5HRNA 4JB8B 4CJ7A 4QOZB 1WF1A 4DV7F 4B3RK 2DHHA 3IKMA 3DGPA 3KXDA 1P9YA 2Q79A 3A3OB 2H4WB 4KR0B 3TAEA 3QRQA 4FXDA 5B0EA 4JV2A 3CFRA 2YWKA 4LVOP 2HBLA 2K1RA 2O8CB 3IUCA 4DLEA 3JYTA 3C6TB 4DV0J 4G9ZA 2YQ3A 1F21A 3AARA 2V68A 5IZHA 4X4SA 3KKSA 1KCFA 2A6MA 4NRTA 2MZSA 4ZVRB 2P9SA 3JB9k 4RU2A 3H0PA 3C8YA 3AVIA 1C4CA 1ITGA 4PWDB 3ZLJA 4CGGA 2KJWA 3DLLL 1N54B 2MHEA 3NE6A 1RSCA 3DOLA 4IOAL 4CBWA 3V6KA 1X5SA 4O55A 5E3CA 2E2PA 3NH1A 2GMLA 5I3QA 1Q79A 3VESA 1EKRA 1RTHA 2Y8YA 3ZFVA 2EG1A 3R5CA 2MLZA 2HG4A 2VOPA 1NB2A 4ZPDA 2FLOA 1AROP 4USMA 2XO7A 5F8MA 3I55S 2BXJA 4PKGA 4ATNA 3PR5B 3TUZC 3OYNA 4RWWA 4CD1A 3FMBA 4JI3K 3ZZRA 2CGJA 2DJWA 1BD6A 3G82A 2J0QD 2ASMA 1QD1A 2VFUA 5L39A 4A8XA 1CQMA 3MTKA 5HBMA 1FA0A 2ZUAA 4J9LA 1RCXB 1J5OB 4FW1A 3D66A 2V9KA 4NLOA 3M6XA 1VRUA 4KKOB 3A8IA 5KFDA 3KFWX 1YUWA 2PMHA 4OYXA 5KFFA 3G6EN 3IAYA 1BISA 3F9KA 3I9ZA 1FERA 4CDIA 1BG3A 3OXLA 2UVRA 4RUCA 2GVDB 4K8ZA 5HQ8A 2IVPA 1SC4B 4KSEB 4QIFA 3UKUA 5AZJB 1S6PB 3LGMA 1NO8A 5HQLA 5FRMA 4Q45A 1OH6A 1IV0A 2UV8A 5KFAA 3W8PA 3R9LA 1T6CA 1LNQA 5DJBA 5AT1B 1MU2B 3QJJA 3LDQA 5C12A 1M1KO 3ETMA 1H98A 3ZZUA 4FWRA 4M5MA 3MWBA 4GC6A 2KRBA 3W66A 3G71N 3D2FA 3KHHA 1ASUA 2XG8A 3C7NB 4IZ9A 3MXHP 3N9UC 4ZVTB 4OZ3A 2UVWA 1RBSA 4LF5F 4X66J 4FLYA 2HFUA 1DURA 4LH4A 3RYLA 2XRIA 2O5DA 4BRMA 1CZ9A 1H7XA 2F5GA 1RDRA 5L9XA 3AXMA 3TVYA 3J81O 2EX3A 1YJRA 1QSLA 4LF9J 5T7LA 3ZZZA 4Y0WA 3ONQA 3R5GA 3MGJA 3UKRA 2B56A 4USTA 4DUYJ 1FJGJ 1XC3A 5IV3A 1OSCA 4WCEQ 1ZTWA 4RW9A 1RABB 2KG0A 4I9LA 2CXEA 4BRGA 4CIFA 3Q8VA 5CD4H 5JS1A 2CQGA 2ATLA 2XEXA 3IS9A 1IM6A 3ETOA 4KRWA 4NOHA 1AUDA 4YDUC 3POTA 1CJTB 3Q89A 1N34F 2HGLA 3HO1A 1ZC6A 2HMIA 1SL2A 1Q7YT 2J8AA 3A3NB 3WNGA 2AJFE 2QEXN 3NOGA 3D6RA 3UE2A 4DV7K 4B1ZA 4JI5F 3SNNA 1AT1B 1CJKB 2G4BA 4B3SJ 3S41A 4BGAA 2R7OA 3TVZA 4OPHA 2GAHC 3GYXB 4X84A 2BANB 4GVLA 1NSQA 4LR7A 4CJUA 4F4KA 3OVSA 2NRVA 2E9RX 2H54B 2W2MP 1VQLN 4NLVA 1BMQB 4IFVB 2ZJRQ 4IO8A 1YQHA 5F1XA 5KRTA 3MPUB 5DO2A 2H3GX 1U2RA 1Z25A 3SQOP 3K5OA 1S6OA 5CCMA 4UT4A 5CQGA 2AQ4A 1NZAA 5TKYA 4DPTA 3W2VB 3VZIA 2WZ1A 1VSDA 3ZX2A 4DR1F 1WG5A 3BDEA 4G1QA 5L9NA 4ZHRB 4DR1K 3LP3A 4J9PA 4DL2A 3KK1B 2CPYA 3FDSA 3S6EA 4M5GA 1RKIA 3W5YA 2OGUA 2E5IA 4BRCA 2DR7A 2IJRA 3EZUA 4DV6K 4NYFA 2HFNA 1IKWA 1HBMB 3E01B 1NK7A 2BJ3A 2A40A 3ZT1A 4UW2A 3ZT2A 3I87A 2COLA 2O3DA 4JKGB 1HI1A 4J2EA 1WBDA 1W7WA 2M8HA 2VICA 3V81B 4NXMK 4IDHA 5IS2A 2DCUB 4CI6A 3OL6A 3R7SB 4NLUA 4RW4B 3FZBA 2DNMA 2YH1A 1Q9XA 3CHWA 5AFUA 5C2DA 3HHDA 2J8SA 2AEJA 2RKIA 1KKHA 1Z4UA 3R6GB 1KRPA 2KFYA 3NGYA 5AQTA 4IUFA 1SS6A 4L3QA 2H3EB 2QMUB 2OTJN 4IWVA 3P3DA 3PO4A 1SJ4P 4BC4A 2YX7A 1UVIA 5HOOA 2AEFA 2YWWA 2VODA 3OS0A 3EJMA 1KVCA 2KI2A 4FWPA 5AZJA 3FVYA 4B3RJ 5DMRA 3OUYA 3VAKA 2JLFA 1GH8A 3IRXB 1HI8A 2A6AA 1U1RA 2C2KB 5BYQA 4W90B 4CTAB 2XSJA 2ASYA 3CI5A 1DQAA 1F6TA 2PDAA 1NGIA 2GAGC 1E4GT 5C2GA 4USUA 2MY7A 2Q31A 3NS6A 4CJ4A 3JAMO 1S4EA 2GBZA 3L2UA 3I32A 1JXBA 3P1GA 1REVB 2QYGA 2N3OA 4X2BA 3KJVB 3QERA 3OJSA 4CJ3A 5I42B 1NU4A 2JEIA 3GYGA 3ZNJ1 4CK1A 3NGSA 4BRAA 5FD1A 3DRSB 4H54A 1E3MA 3SZ2A 3FZHA 1TKTB 4C8YA 2H5IB 1GK8A 3GB0A 4A8KA 3R6LB 4PZVA 4DHYA 4KHRA 2C3OA 2GUPA 1AW0A 4RUAA 4XDCA 2HLTA 2IIHA 3UKRB 1SIWB 5F41A 4JV5F 2BGGA 4LJMA 5KFTA 3ILLA 5KFKA 3W62A 1S48A 4EHTA 2AGOA 3D45A 4WP3A 2GX8A 2VGMA 5SWMA 5KQDA 4OVLA 3QWPA 3DC2A 1HR0F 5A0YA 3MUTP 1DTTA 1SL0A 5J1PA 1WHVA 1X1PA 3R1HA 4CJFA 5JS2A 1CJTA 2JEGA 3B82A 4NEZA 2CKWA 4JI8J 3TSUA 4TXSA 4DWIA 4ZJOA 3PRVA 2WVDA 3LTOA 3DXSX 4MK7A 4JI3J 2CH5A 3S1TA 2IAJB 3DLHA 3RB4A 1T11A 1JLBB 1S10A 1JJHA 4LF9F 4WFYA 2Y9HA 1VSEA 4ILRA 2X1AA 4M45A 4L76A 4X64J 1P90A 4USJC 4ECVA 3GILA 1WHYA 4C8LA 1S72N 4W5QA 4B9LA 4LRCA 3DLJA 3KHGA 1Q81O 1BA1A 2CGLA 3W9HA 2BOAA 4I0WA 1BQMA 4CEZA 3CC7S 5CYMB 3M2UB 1RZMA 4QIWD 5KFOA 4LR9A 4FK4A 4DL0C 4GY2B 2NS1B 3A8KA 3THWB 4ZVOB 5IQ6A 2QWMA 5KPZA 1VQOS 3OR2B 1JCGA 2WOMB 2MKJA 2IHR1 1UVJA 3N28A 2B4OA 3NOCA 3OYEA 4OJHA 1C2PA 2XC9A 2V52B 2RHSB 3GL1A 4E98A 1KD1O 1CEZA 4CEDA 5KFYA 4C1NI 1WC4A 2YWEA 4DV5J 3E3XA 3W5XA 3CMEN 4Z4EA 3UR0A 2GWJA 1B0PA 4IRKA 1QM9A 1L3TA 4FL9A 2A1BA 1PAUB 1RAOA 1Q0NA 4I7FA 1EZZB 2X1FA 4DBQA 3S3NA 4M42A 4TKTA 5HVFA 3K5PA 1BE4A 2KKHA 4PWUA 4NYNA 1LW2B 1QVGM 5KPTA 4QR1A 3M8YA 3M6UA 4ZJLA 5KFXA 3O5TB 4R8UB 4FLXA 4R5PA 1GT8A 3MEKA 1N33J 4DR5J 4C11B 4OX9J 3P31A 2P9KA 2CGKA 1YIJN 3VHQA 2D0CA 4I2PA 5D3GB 1UZDA 1X0PA 2W40A 3F73A 4MYUA 2EFNA 1YZ7A 4ED2A 1H3DA 3T1YF 1X9MA 3MEGA 4XEIA 5CH7B 2V7ZA 2UXCJ 2VQEF 3MD1A 3LDNA 5GADI 1KVIA 4UOHA 1IN0A 1VC5A 1CS4B 1HA1A 4DV7J 3AD7C 3H46O 2YKOA 4IFEA 5FPNA 3PSFA 5LJ5Y 3HVTB 1UA1A 2D7SA 4PG8A 5T7LB 4BACA 1S1TB 5EVZA 3FR0A 1VBZA 4V19X 2IA6A 1Q4RA 2ZEJA 3QO9B 1AYEA 1QTMA 5FPMA 3MPVA 1Q18A 4FKXA 3DRYA 1R27B 1S76D 2F7VA 2DNQA 1RHUB 4HHJA 1OH5A 1V4SA 5HRPA 1I3OB 4NMLA 2J9CA 1VQ9S 4LF6J 3M8QA 5CYQB 1LWFA 4JI0F 1WC5A 1N88A 5KG2A 2X1BA 1W0HA 2OELA 4I6WA 5KFMA 3ZT4A 1YT3A 4CIOA 1ZYQA 3AOBA 1RA7A 1TFYA 4JRPA 2VFSA 3NNCA 1UFWA 2V9WA 4N76A 1SC1B 5HN0A 3WXLA 1N32F 3CF5Q 3HVAA 2PMWA 2OD6A 3HD1A 4UY8O 5AQLA 2FB0A 3SUNA 1A0OB 4W5NA 1ZAVA 4USKA 2FGOA 4J5OA 5ETPA 3B54A 2V4QA 2P9PB 1OIAA 1NGDA 4FZYA 4EMDA 4LRAA 3ENBA 1NM2A 1BWEA 4IBNA 2Y1LB 3OLBA 4WQ4C 1X60A 2DISA 4Y34A 1UJ6A 5CABA 4HT5A 1SPBP 2CG4A 3TI0A 4NXNF 5GAHU 3UNGC 2I6WA 3CJCA 3D2EB 3ENAA 4KH5A 2YWGA 4BC2A 1MROB 2U1AA 2IMOA 2X3DA 3HSTB 1NMNA 1NK5A 1JNZB 1D8YA 3CVKA 4PABA 2A42A 2ZC3A 4MKBA 2W2OP 2FQQB 1WC3A 4PWDA 2DGWA 2ZWPA 2DFFA 3BF3A 4JLHA 4F3MA 5D3GA 3CCQS 4BQLA 4ISEA 4BRLA 2B4UA 1FKPA 3BKUA 3T5HA 2F9DA 1WC6A 4IG3A 3SAGA 3BPSP 1RA6A 2F1FA 3RAXA 3MDQA 2JL9A 2E44A 1APSA 1HQEA 2QRRA 3SUOA 3JTPA 2IVMA 1UAXA 4NLBA 1Y5IB 4GV9A 4CT8A 4IOXA 4ZTJA 1VMBA 1HNWK 1T3VA 2QWLA 2HHHJ 4OHWA 5DZ7A 2HHTA 3F2KA 4JHDA 4D3GA 5HVGA 1XR7A 4LQ3A 4QYZJ 5B0GA 1VQ4S 1S1TA 3VEWA 3PFOA 3JSMA 2AX0A 3GSIA 1N5QA 3QWUA 3VETA 3IRXA 2NUHA 2YNIB 3W2WA 2FJBB 1VDHA 1RNHA 4ECQA 4EGLA 1HNZF 5DM7Q 3TZXA 1XQSC 3BSNA 4FF3A 1VQKS 3CQ8A 2W7AA 5KOXA 4R8UA 2LLZA 4ZP7A 4DFPA 3VOVA 1WSRA 3O6QA 3E66A 2W8LA 1FXDA 4B1VA 4DR5K 3RSEA 3NG8A 5HL7Q 3OYJA 4L73A 4B9QA 4KBOA 2KZMA 3G4SS 4ITSA 5AE3A 4GKKK 4IR9A 3H5SA 2AF6A 3HVTA 3NAHA 4DUZJ 4NLGA 4DTSA 4FF4A 3LOUA 3OTOF 2CPHA 2YV0X 4UF4A 4JKAA 8AT1B 2V8VA 5AQWA 1KEKA 2MJUA 4M5NA 2UU9K 4NPOA 1ASWA 4Z0UA 1VQMS 2QA2A 1UFKA 4JI0K 3QT8A 2E1PA 1AB8A 1U6BA 3M8SA 3V2UC 3ZX3A 1UFLA 5IV4A 3H6EA 4Q8EA 1TUVA 2XI2A 2B3TB 3R7NB 4O8KA 2V63A 5DZ6A 4WFAQ 3K0JA 1FO1A 4BWJA 2YHWA 3B6BA 1IVZA 2NXEA 1GXLA 3T41A 3QFUA 3PCOB 4ZLPA 4HUEA 2HNYA 2YNHB 3CCLN 5DK5A 2KB2A 3EZWA 3O8WA 4DQPA 1RWPB 4OLBA 1TZ0A 4A46A 2FBYA 3I82A 3MF5A 1YRXA 4M8LA 5K9FA 3PIOQ 5BN9A 5K8PA 1SQFA 2R7QA 3AA2A 3TR8A 4QWAA 3D3BJ 4BR4A 4ZDNA 2ZBPA 3KK3B 1WNSA 2HQCA 3G2XA 2W7PA 4RG8A 4I2QA 3CG7A 4Q7AA 5A8KB 2IAJA 1LWFB 3H8YA 3DRRA 2DO0A 1Q82O 3LDSA 2QL7B 3WEEB 2GW8A 4A5AA 2J0WA 3UFCX 1S22A 2XNQA 2DTJA 4PUOA 4MMOA 4NX9A 2ZJQL 2ZZNA 1JJCB 4KFBB 1JKHA 4WZQA 2AP6A 4AM7A 4OL8A 4Q8FA 3JSYA 4WFXA 1PYSB 4OX7A 2OZSA 3G9CA 1RAIB 2W8KA 4B3MF 5LL6Z 5HRSA 2Q43A 1BCOA 2PE8A 3QBWA 3SCJE 3QYYA 4C97A 3TWZA 4NLYA 2DXEA 3K58A 1KQSM 1CULB 1UKUA 1G15A 4FDFA 3BBBA 1O6XA 3FBCA 1NEEA 1RWWB 4PKDB 4DS4A 2YHXA 4YR3A 3ZSVA 1D8ZA 2MB0B 2ZH1A 4DTUA 2RS8A 2ZBQA 3G6YA 2WSCC 4AL5A 3CO0P 4X4UA 1A6LA 1SL1A 3KD1E 1C1AA 2ZWHA 4TSXA 1GX6A 5DM6Q 3G4SN 1JJ2M 1IQZA 3CJKA 3B4MA 3HM8A 3FZMA 3NH0A 2G0CA 3VAIA 2VONA 3B6OA 4QU7A 5E3PA 3AODA 4LBIA 4NCBA 4ETXA 2J7UA 1NGAA 3HTVA 4XO0A 2BJ8A 1R0BG 3PHTA 2MZ1A 3CJSA 4BDZA 2GHWA 2AJ0A 1BGXT 1TU0B 1CJVA 3BJYA 2R4FA 3OL7A 2ZD1A 3NCRA 5KFVA 3KKFA 1XR5A 5CYMA 3M2UA 4CIGA 3SIPB 2VQFJ 5F8JA 3L4QA 3TTCA 3GSDA 3LO3A 2HRUA 1IJFB 1LFWA 3SSRA 4MKAA 1CJUA 3D0IE 4TQSA 4YMEA 3O08A 1Q7YO 4N56A 4PKHA 4CE9A 2I7PA 4XPEA 1TYQB 3C15A 3SQGA 2NSBA 2XS7A 4OHVA 1FD8A 5C10A 3PW4A 1B64A 2ZHBA 2O4GA 4CYUB 5AQQA 2L48A 2E20A 4DCOB 4FW2A 3HOSA 2FF3B 2EK6A 5KFZA 3KUEA 1SBRA 4J9UE 4QW9A 3PKYA 2GC8A 1JLFA 4YDUA 4EZ9A 2CWKA 4DF8A 4ZVFA 1BI4B 3H4BA 3W8GA 3VV2B 4FJXA 2HWHA 4RBVA 3VGLA 2QMXA 1JLAA 1QAIA 3K9JA 3V4MA 3FZ2A 2NUBA 5DG9A 4CJTA 2PD1A 4WZMA 4L75A 1WC1A 1NK9A 4LF6K 3FZKA 1LCUA 3LGHA 1HPMA 2RH3A 2QE5A 4CLWA 4RW8A 1T44A 1D9AA 1IWGA 4GVMA 3WDOA 2XMWA 1OQ6A 1RBVA 4YB1P 4OYOA 1QZ6A 3OYCA 1UVMA 2O8DB 2CDQA 4PG4A 1Y9OA 1RILA 4A4JA 2R7WA 4QR2A 2LECA 1Z6RA 3O1LA 2HVHA 2YNFB 2D1KA 4X66F 3NBPB 3CJTA 4DPUA 4BWMA 4CJVA 2B9WA 2PC6A 3BN7A 1GOBA 5BJRA 4F04B 1SKRA 4DOZA 1BC6A 2RNEA 4KO0B 3V6HA 4ED4A 3UWTA 3V9WA 5AQRA 3J81U 1K8KB 3H3OB 1RGVA 3O9RA 2YX6A 5GAGU 4B9UA 1TKZB 2GX9A 4M63C 4CLYA 4U7BA 2R8GA 3KLHB 1IBLF 4CLSA 3IRWP 3IP0A 4U67Q 2V94A 2DXFA 4IFVA 1YF5L 1T9WA 3AH6A 1DHMA 3E2EA 5JMNA 1SI9A 2B6AB 3WXMB 3RG6A 4IOCQ 4K0KJ 1HNVA 4DN9A 2IIRA 2LSNA 3LALA 3VPZA 2KG1A 5A2QY 5AQMA 3C14B 4IG3B 2R3VA 3CMAS 4Q0BA 4J9SA 2LU2A 3TU5A 4UQGA 2X74A 4QU6A 1DQ9A 3THVA 1QHAA 5FLXY 3NF8A 3O3HA 3B6PA 4M5DB 3RRHA 2UUWA 3TA2A 3CJ9A 5K8OA 2OP5A 4M5IA 1HD1A 1C0FA 5SUHA 2QLJB 2OPRB 1NK6A 5E5NA 3CERA 1NGGA 1L3SA 3H42A 3ULHA 4LFCF 1IR1A 1P1LA 2CRLA 1ULRA 1ZBTA 1RTZA 1NGCA 2FJXA 1HNXF 3CJRA 4OI0A 4HCCA 5AR0A 5CR4A 3GG1A 3VZHA 4LSZB 3I0SA 2AWZA 1EETA 2OZMA 1WHWA 4KTQA 3QNWB 4CBXA 2OJ3A 3SMZA 3C66A 2IPOB 2WONA 3SBGA 3DDNA 3ISND 3C2PA 5KT7A 3SK3A 1CLFA 5LMNF 3Q2SC 2VQEJ 2BV3A 2Q97A 4BBYA 3PX4A 5LMNK 3BGRA 1VSLA 2FD2A 2HF3A 2R42A 1DZ5A 2HIQA 3RMCA 2M5YA 5L1KA 3M3ZA 2BE7D 3D6MB 4URQU 4DR6F 1HBNB 2YHYA 1SC6A 3U4LA 3QMQA 5DS7A 1K9MT 2OD4A 5AQZA 1N0UA 4F3TA 1RBAA 2W6LA 2VQFK 1S0NA 1R8CA 5DM6L 2WSEC 4EU0A 4LRFA 3TJAA 1FRIA 2CJXB 3M8RA 3HSGA 2F8MA 1JLFB 1OY8A 1ELOA 2ROPA 2XLIA 2KJVA 2A2CA 4LF4K 1VLOA 4YHHF 1JLAB 4DV1J 4N47A 1IKXB 3OT9A 5TKWA 1TVRA 2Q1NA 3MMVA 1XNRK 1PG5B 2PI4A 4GMJB 4I69A 4LMZA 4RR5A 3PLAA 2LDIA 3R97A 3VVTA 1WSFA 1Q82T 3TP2A 3D5MA 1C1BB 1RDBA 5FIIA 4BRNA 2K06A 2MKIA 1UW9A 2DNHA 1FNOA 1J2VA 2OEJA 3QEWA 4ZVPB 5D0EA 2YKMB 2K7KA 2R7SA 2I7NA 1HLWA 4H5WA 1WWHA 1XMQF 3AO3A 1FKOA 3MZIA 2Q1LA 2XY8A 4ZK7M 2X7IA 1XMQK 1P8GA 3OFHA 3IMXA 2OFGX 5EDWA 3AJ1A 4B1XB 2E9ZA 5AE2A 3VEXA 4WFBL 4OLOA 1YJTA 1IBKF 2DR6A 4C8OA 4GVBA 4UQTA 3QICA 2HNDB 1FWPA 4FJGA 1M5KC 2B5JA 1UP1A 2AU0A 2IVFB 5EX0A 1QQOA 2M88A 4O0IA 3L09A 1N32K 4HI1A 4LF8F 4QPTA 1NLKL 4NI2A 4PXDA 1QAJA 4JI7F 1WAJA 1FNMA 1B7YB 3W63A 4M41A 4DI6A 1XR6A 3DGPB 3HHKA 5M1KA 1CG2A 4UOCA 2RU9A 4O3OA 4QYRA 2W01A 1S72S 2LA6A 4QW8A 1YAGA 3OYFA 4H4OA 1F3FA 4FVCA 4I4BA 3DI6B 4ZP6A 3NMRA 1NXIA 4W98A 3R5JB 1JLQA 1RWUA 4G3IA 5E41A 1R3NA 2AZ1A 4IO9Q 3OBIA 2RKIB 3TO8A 1U1LA 4TY8B 4M5LA 2Z2MA 3EUNA 2MQPA 3PW0A 1X31C 3A8EA 1DQ8A 2V7YA 4MQ3A 4X4PA 5D4OA 2HBJA 3R8EA 4WXWA 4K59A 5B0FA 5KG0A 3ENQA 1TAUA 1OVQA 1M90O 1HNIA 4DTNA 2V2VA 5EWEA 3ULEB 3PSIA 1TV6A 1NJXA 3D0PA 3PIPQ 2XY5A 4P74A 2GS8A 3L0QA 2OO4A 1HMVA 1GLBG 3ZTOA 1YHQN 3P96A 4X65F 3R7BB 4I7FB 3V6JA 2MSTA 4C8ZA 2XTJP 2MPUA 3HHLA 4LFBF 4DL7A 3I0SB 2XMKA 3HPGA 4KY3A 1I6JA 1MWYA 4ANCA 3X1LB 3OS2A 3VQ4A 1FT8A 2DCLA 4M3XA 3ZXWA 5DDQC 4PXEA 5D77A 5I3UB 4GMKA 1IO2A 4Z7YA 2RSQA 5G4DA 2PMZD 4OGCA 3VWSA 4WFBQ 1RT2B 2QA4S 1UCNA 1U1MA 1KSPA 4O3QA 4FJ7A 3CEDA 1NU0A 4JI6K 4MK9A 3W2WB 1UTAA 1QVGR 3L4BC 3QIOA 5F8HA 4F2RA 2WTFA 4DV5F 4CZLA 2VJVA 5KG1A 3LP0A 4B1UB 5HRRA 4GW6A 5EGYA 3AVJA 4BR9A 4Y2IA 3TQ1A 1T03A 4PXCA 2CPEA 2GELA 2J4RA 4WKYA 4CGDA 4X62K 2XY7A 4YR0A 3RAMA 5C2CA 4OI6A 4PRFA 1HQUB 4CF1A 2UXBF 3TUJC 5D78A 3PFEA 2KT3A 1HNWJ 2E5LF 4FLUA 3AO4A 1VQYA 5HLFB 3NAEA 3VGTA 4Y2AA 1DTQB 1RE1B 5JLHA 1C0UA 1YSJA 1FF2A 2DNPA 2R2SA 3K7RA 2ZITA 3FCVA 3QZ7A 3D4JA 1SIZA 2P5OA 3JS6A 3LL3A 1FJGK 2FGCA 3C0BA 3MX2A 1SKSA 1FEHA 4J8FA 4ED3A 5BPLA 3BPDA 2ZZMA 1EKSA 2WAQD 2W2QP 1WG1A 1LKZA 4Q44A 4ERDA 3TSPA 2EWSA 3TAPA 2R7YA 2YQ0A 4Z4HA 4KGZB 5GAHP 1KOOA 3AA8A 1I39A 3HSJA 4CESA 2B4JA 2F9JA 3CPEA 3ZETB 2HNZB 3FK4A 2HHWA 1UMJA 2R9LA 3TARA 4JRQA 3AA4A 5ETOA 5BN8A 1K9MO 3CJ3A 3BSCA 5HAOA 3KLGB 4BC9A 2A5XA 3FBBA 4B08A 2MQMA 2OANA 3B4DA 2HK3A 1YJ7A 1X9WA 1HYSB 1NZ8A 2A41A 5KRSA 2J6UA 4XPCA 3M9OB 2A3ZA 3UE5A 6FD1A 5ETLA 1HW8A 4RW8B 3PG9A 1XMOF 1RCOB 5L1JA 1RT1A 3N5FA 4M3UA 5M2RA 4K4TA 4J9MA 5HROA 3SCLE 4CHYA 4FWQA 1Z26A 1RUSA 1RISA 2IRXA 5KFNA 1KN6A 3ENHA 2JSXA 1XHZA 4Z94A 1YBUA 4P2SA 4ETZA 1F9HA 3T5JA 3OS1A 1KAYA 4FBTA 1CC7A 2W2NP 4ED5A 1EETB 1TKZA 4B3SK 1RT5B 5IXUA 4DQRA 2B9XA 1EXQA 4H0OA 3NY0A 5AJ3F 3MTJA 3ZNUA 3JQMA 2F96A 2PEBA 1JCFA 4DR1J 3LQVA 1Y97A 2HHPA 3SDEB 5KQ8A 1J5OA 4KGXB 3NEKA 4KQZA 5LSOA 5EX5A 1XHXA 4HTJA 3FSIA 1D4XA 1XMOJ 3AO2A 2V51B 2KQ2A 3E8OA 2D3O1 1ZM2A 2KXFA 1RT5A 1IQTA 3AAWB 2OPSA 1EWQA 4Q43A 2IVOA 3GJSB 1D3WA 4CZGA 1TL5A 3ZEUB 3H45C 4CFDA 5A8RA 1ZAWA 2AW0A 4F25A 2XMVA 3KWGA 4X62F 2ZH9A 1UVKA 4CH0S 4TLQA 5B8HA 2UXCK 3OBWA 3MCSA 2B9YA 1XMBA 1JWWA 4ZVHA 1AUSL 3VCDA 1VC6A 3CCSN 3JTNA 4C2MA 5B08A 3CTRA 4DLGA 1C6VA 3H2UB 2GA7A 1AZSB 3EN9A 1TVRB 2CPJA 3I9V9 3C6UA 2BKOA 2UUCK 1T05A 2HHHF 4KE5A 1GNKA 4YOEA 5J1EA 2MSSA 4BCAA 1VK8A 1RP5A 3L3UA 4FS2A 4F3QA 3I5BA 2I8EA 2Q6CA 5KFQA 3HMJG 4DTOA 1MWQA 3EICA 1NKEA 3HRGA 1PBUA 4RW9B 3MOZA 3OA9A 4DTPA 4C8NA 3DRSA 1OYDA 2VG7A 3TR5A 3E9PA 2PY5A 1FTRA 5LSRA 4MIWA 1PBAA 2W7OA 2E88A 3P6YC 4M5HA 5J2NA 3BGRB 1CXQA 5M2UA 3OLAA 2C3UA 5FPDA 1WACA 3HJVA 1U6ZA 4LD0A 2ZKUA 2RRAA 4FJNA 2RVJA 4H5TA 4JV5K 4YB7A 4FYWB 2YBVA 3LDOA 2WBMA 3HHLC 1F2HA 1FNXH 1HFEL 4PXBA 4K0KF 3MWPA 5AZIA 2ILYA 2QLWA 4NLPA 2OPRA 1S99A 2LU1A 3DM2A 2RS2A 4J7CA 2J9DA 4LBHA 4KYZA 5EY4A 4ILLA 3I33A 2W42A 3NRBA 1MW7A 6AT1B 3TSQA 4B8AB 3CQYA 4Z4FA 1MROA 2HSEB 4B3TJ 3OHAA 2JLEA 5KFGA 3J7ZO 1VGYA 2QX0A 5D4LA 1M0SA 3SBTA 2EFVA 5DQGA 3GIJA 2GWKA 1RAEB 1SCJB 1N34J 1OJ4A 4LFAK 1IXKA 5HATA 4IH7A 4ZPBA 2M4MA 2B8PA 1XI1A 3OL8A 2LXIA 4CI0B 5F8LA 3RZAA 3AVCA 1X4HA 1GXUA 5J2PB 2CJYB 4E19A 2X6NA 4NZ6A 1HBMA 5E3QA 4GC7A 2LEPA 3AVFA 1EHWA 2M9KA 3MEEA 4X65K 3O4WA 4IG0A 1CSJA 4NZ7A 2W9AA 3LAKA 1VRTA 5KT4A 1LW0A 5DQIA 2E5HA 1NJWA 3VF0B 3M32B 2D0AA 4YNQA 3O3GA 3EMTA 5ELZA 3UD3P 1DAXA 3J7A1 2ZHAA 3D7EO 1UJ4A 4B1YB 4LRBA 3VGVA 4HVZA 4ZPCA 3EDRB 4DR3J 2YJEA 4ZP9A 5EOYA 1QHTA 2AYBA 4G1PA 3CIPA 1HJRA 1CPZA 3DYAB 1O51A 3UN3A 1HARA 1FTCA 2CDRB 1B0TA 3QNNA 4YFUA 3TZYA 1SB6A 3PW2A 3CW2C 1BLUA 4P2FA 2YPZA 3Q23A 4WCEL 1LAVA 4IRDA 3CJKB 4K4UA 1HD0A 4RO0A 2P9NA 1DJ0A 3BYPA 3LP2A 1G6BA 2AV5A 2GO8A 2E1ZA 2CQCA 2OTLN 4C8MA 1QAYA 2DGUA 3A1YG 2NZTA 4RX6A 3J7Z5 1TUUA 1X4DA 4YOUA 4QWCA 2BTFA 2WBRA 2UU9F 2IM3A 3CJ5A 1SJFA 1RLCL 3KG0A 3C15B 4HL9A 1M1HA 3SQGB 4EYHB 5DLGA 4YQWA 4DPXA 4P2XA 4FPAA 4DR3F 2HZCA 1CJUB 2NPIA 1QJHA 2FDNA 4JV5J 3NNHA 5J2MB 3Q24A 1TFWA 5DGBA 1G1XA 5LMNJ 8ATCB 3MHYA 3W0LA 2FIUA 1H1VA 4BR7A 4A8MP 4NCAA 5MLCQ 4HEA9 3EL2A 1GXTA 4U9RA 1DKGD 2YTCA 1EKEA 2ZHOA 4OFZA 2O67A 3SI8A 4E1JA 1IBKJ 3CF5L 4DR7J 1E4FT 3NF9A 2ZJPL 4CLUA 4LF9K 3LUYA 3V4IB 1URNA 1TL1B 2JEJA 2YX1A 2MMYA 3ZETA 2OSRA 3M6WA 4M63A 2AGQA 2WHOA 4F4AA 1FKAF 3SXLA 3J80Y 5CYQA 2N7CA 2HIYA 4ZVGA 1FDNA 3ZTPA 3BGFA 2XI3A 2IDOA 4CBUA 2ABYA 1RHKB 1N5YA 1HKCA 4LIRA 5C5JA 1FDBA 2VG6A 2HFZA