3QO9A

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with tsao-t, a non-nucleoside rt inhibitor (nnrti)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
553
structure length
553
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAISQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of tert-Butyldimethylsilyl-spiroaminooxathioledioxide-thymine (TSAO-T) in Complex with HIV-1 Reverse Transcriptase (RT) Redefines the Elastic Limits of the Non-nucleoside Inhibitor-Binding Pocket.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase, hydrolase/inhibitor
molecule keywords Reverse transcriptase/ ribonuclease H
total genus 139
structure length 553
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3qo9A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qo9A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qo9A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qo9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3qo9A05
1ASWA 3I5AA 4TY8A 3DLKA 2V4RA 4JV1A 3HVWA 4URSA 2KFZA 4H4MB 3PO5A 1S9GA 4C8LA 2F8SA 3H08A 3ISND 2BQRA 1S1TA 3I0SB 3RR7A 2E4LA 3AO5A 3DOLB 5C42B 4I7FA 5KT2A 2QE5A 2BDPA 1UAXA 3TAPA 3OS1A 3C95A 4IH6A 4Q5VA 4DFJA 3RB4A 1ZBUA 2V0NA 2YHAA 1BGXT 3NF8A 4M95A 4RNHA 2AGOA 2Z1GA 4LQ3A 2ASLA 3BQ2A 3E51A 4F8RA 4PQUA 3RRHA 1LWCB 3HO1A 2A1SA 1Q9YA 2HNYA 4N41A 2J6TA 4M42A 4PUOA 3PX0A 1TL1B 2VG7A 1HRHA 2F8EX 3FQLA 3UQSA 1O1WA 3BGRB 4IFVA 4IH5A 2B4JA 1HQUA 2WB4A 4J9KA 2WONA 4WE1A 2X6NA 4JS4A 4CIFA 4AHRA 4RZRA 3NF7A 2DTUA 2R2TA 4OL8A 3S3OA 1N6QA 4JLHA 3T19A 3HP6A 4JV0A 4DSEA 3M9OB 2PYLA 4J9MA 3H2LA 2HNZB 3OHBA 3O3HA 4RW4A 4Z4GA 4FJ8A 3KLGA 5HRNA 4J9NA 3LANA 5J2NA 4EEYA 1R0AB 2ZD1A 1BIUA 4CGDA 2WHOA 1C1CA 3RBEA 1FKPB 3RMBA 4OLBA 4F2RA 4ICLA 3MECA 4CIGA 3LDSA 5JS2A 3V9XA 1JIHA 3M8RA 1KSPA 3L3VA 3LZIA 4U6PA 1S1XB 3AVJA 1VSIA 4MIAA 4CEZA 5JUMA 2XI3A 2W9AA 3ZSXA 3ISNC 4BE1A 3BQ1A 5DQIA 4IR9A 1BI4A 4J9PA 3SUQA 4ZVHA 3C6UB 3SI8A 4B9NA 3PW0A 4NLDA 3EPIA 2B5JA 3CQ8A 4Z4CA 1C0TA 5HLFB 2E6MA 2RDIA 3QEVA 1FK9A 3HPGA 4DWIA 3AVMA 5DLGA 1JL2A 2PZSA 2YKMB 4LSNB 3SPZA 4Z4EA 3V81A 1IKXB 4CEAA 3Q8SB 3OL9A 1LW0B 3MECB 4ICLB 5KFCA 2HVHA 1B9DA 3IG1B 1QQCA 1RBUA 1I3AA 1RT5B 1JX4A 1CXUA 1F21A 4K8XA 3PX6A 1S10A 2G8WA 2YNIB 4WXOA 1HNIA 3SFGA 3S3NA 2OA8A 3OJSA 1QHTA 2ZKUA 3GV5B 4NYNA 3BSNA 1LWFB 1EXQA 4HTUA 1X9MA 1RT7A 3UIQA 4DSJA 5KFLA 3ITHA 1WN7A 1GX5A 3IS9A 3QNNA 5C25A 2GV9A 1WSGA 4DG1B 3V4IA 4O4GB 1ITGA 5KFNA 2DFEA 4BE0A 1WNSA 3TQ1A 3M8QB 1YTAA 4JRQA 1UWBB 2A1RA 1RT3A 4RU9A 5KFBA 1JLEA 4PUOB 4B8AB 3NBPA 3AVAA 3CG7A 2RPIA 3CFPA 3H98A 1DTTB 1QAIA 4AHVA 3K5MA 4DSLA 3AV9A 1CXQA 4AHCA 2QK9A 5KFRA 4J9QA 4K4YA 4DL6A 5C25B 3QNOA 2C28A 2D5RA 1C1BA 4LQ9A 4E0DA 5L9XA 1KFSA 1YT3A 1BQNB 2RKIA 3L2RA 3O3GA 3C6TB 4DFPA 3OJUA 4MIBA 4MK7A 3GIJA 3SQ2A 4M45A 4NLQA 4WFYA 4J9LA 1RT5A 1GOAA 1QSYA 4OGEA 2I5JA 2HAIA 2IGIA 2DFHA 5FDLA 1S0NA 3HYFA 1REVB 4QW8A 4U7CA 3TAEA 2JEJA 3THVA 4KHMA 3OSPA 4ZMMA 1S1XA 2B6AA 4B9SA 3GQCA 5L1IA 1WAJA 4FCYA 2O4IA 1QS4A 3JSMB 1VSEA 4O5BA 4FZZA 1TAQA 4CK3A 4H4MA 1SKWA 4BDYA 1T03A 5KT5A 3IG1A 4MK9A 4ECQA 3NGYA 5K14B 1TV6B 3H4BA 5J2MB 4DLEA 4Y3CA 4KE5A 2FJVA 4H8KA 5KFVA 5KFGA 1BQMA 4EBEA 1A5VA 3ZSYA 1RCHA 2EX3A 2YHBA 3G6VA 3KK1A 4CF0A 3OLBA 3H59A 2IC3B 2YV0X 3LWLA 4MKBA 4BACA 4NCGB 1Z26A 4OPKA 4EBCA 1BHLA 1FKPA 3AO4A 4DU3A 1DLOA 3ZSQA 1IM4A 3QEWA 1XR6A 3RTVA 2IJNA 3SQ1A 1NK0A 1T8EA 4FS1A 3PUFA 2Y1IA 4NLWA 3N6LA 4CEDA 4K4UA 5J2NB 1TV6A 3KLEB 4XPEA 1S6PA 3LP1B 1RYRA 3MF5A 5L1KA 4TYAA 3CVKA 2JEFA 4IFYB 2ILYA 4AHSA 3AVNA 2KTQA 3QGHA 4EO8A 1XI1A 1QE1A 5I3UA 3GV7B 4CHZA 5EU7A 3KLIB 4N47A 4AILC 4W5RA 1NHUA 3MR3A 3VA0A 4CEFA 5KFOA 4OKJA 4RW9A 4FJ9A 1HMVA 4QOZB 4CJPA 1NKBA 2UUWA 4KHRA 1DTTA 2OZSA 2IBKA 3KKSA 4R8UB 3NH0A 5DQHA 2HNDB 2X74A 2ETJA 5CYMA 4B3OA 2Y1JA 5KG7A 1Y97A 1BCMA 3QYYA 5KFSA 2V9WA 1YVUA 4KI4A 1QAJA 3BSOA 1D5AA 5DGAA 1SH0A 4IKFA 4YNQA 1RNHA 4YMEA 4KTWA 3Q8QB 4IR1A 1NHVA 5D3GA 3H5YA 5F9NA 3ITHB 4NCAA 4KHSA 1SH3A 4E1NA 2WCXA 4KV8B 2HHTA 1Q8IA 4RW7A 1LAWA 2AU0A 3ZSZA 4KI6A 4ECWA 3H4DA 3BSCA 2HMIB 4CERA 3NGDA 4XPCA 1Z25A 3V4IB 4K4SA 3EZUA 3V9WA 1BISA 3TI0A 1L3UA 4KFBA 4KO0A 2EHGA 2FVPA 3F9KA 3KD5E 1NKEA 3DRSB 2Q3SA 1TKDA 2BRKA 2IA6A 1C2PA 3BQ0A 1RT4A 3OYHA 3KJVB 4KRFA 3HXMA 3QIDA 4E7KA 4J2EA 2DFFA 5HP1A 4ZPDA 4KB0A 3M8PA 1C0TB 2E6LA 3L2QA 3SV3A 2JC1A 3LP0A 3VN5A 1XR7A 4URQU 5F8JA 1RBRA 4IDKA 4TQRA 3CDUA 3DMJA 4DTPA 5KG3A 4Z4HA 3ZT0A 3NAHA 3AVLA 4GC6A 3QEIA 2ASJA 3IGVA 4CJQA 3SCXA 4ID5B 4DS5A 5KG5A 5KFMA 2FLLA 2B6AB 1IKWA 3LP1A 4DQQA 5KT6A 2G8UA 2R7YA 4M41A 3OVNA 4DL4A 4I9LA 2FBVA 4CJFA 5HRSA 4O0JA 3CJ5A 1WSIA 1NJXA 2D3ZA 3KTQA 4NCBA 1T03B 2D41A 3D5MA 1JLCA 5FRMA 3HPOA 2VG5A 1TGOA 3QO9A 1S97A 4CGJA 4ECUA 1D9FA 4HUFA 2DPIA 4WZQA 2IMWP 3K2PA 1RT2B 1UA0A 2BQUA 3TAQA 3C6UA 3DDKA 4KO0B 5JXSA 3DI6B 3NFAA 1C0MA 4DMNA 5F8GA 2YNHB 5J2MA 4EBDA 2R8GA 2XHBA 2QKKA 4DFMA 5T14A 3OS2A 2BQ3A 4O44A 2AX1A 2BE2A 3VQEA 2RN2A 4M94A 1JLEB 1D1UA 5CZ1A 2AGQA 1JLAA 3UDLA 1ZBIA 3L3UA 3MXIA 1T3NA 3IRXB 2JLEA 1VSFA 5I42B 5D3GB 4KFBB 4H4OA 2O4GA 1S1TB 1FXXA 1S1WA 5SWMA 1TK5A 4DG1A 4JUZA 4M3YA 4ID1A 5F9LA 3CO9A 1VSKA 2HMIA 4CGHA 1MMLA 5C5JA 3NGIA 4KHQA 4ZVFA 3UPFA 3CFOA 2W9CB 3HJFA 2WK4A 4DQIA 1Q9XA 3H40A 2C2EA 4DTJA 4CF2A 3PVXA 5HRPA 5KRSA 4DU4A 5KFQA 4FM2A 3SFUA 3I0SA 1TL3A 3N6NA 1JLFB 3PO4A 5KG0A 1T05B 3VQAA 5KT4A 2VA2A 1X1PA 4FYDA 5DG7A 4YR0A 1LWFA 2GC8A 5FROA 5F8LA 1ZTWA 3NH2A 3PJXA 1X9SA 4J2BA 4F4XA 4Q44A 1D9DA 1NK8A 1C1BB 1HARA 3ICLA 1VSJA 3D45A 4HYKA 3KKRA 1TKXA 4QWBA 1W0HA 1TKTA 1XHXA 2HVIA 1XHZA 2O5DA 3ZCMA 1NJWA 4KTZA 3PR4A 2Z1HA 4MK8A 5HBMA 4O3OA 1RT1A 4B9UA 5KT7A 3BR9A 4KB7A 2OPRB 1WSFA 4LSLA 4KSEB 1S0MA 1DTQA 3SQ4A 3SQ0A 2HHVA 1U04A 4ELTA 1S9EA 1BIZA 3MR2A 5J2QA 1UWBA 4WZMA 2GUIA 3LWMA 5KFHA 1S6PB 1HPZB 3PW4A 2ZD1B 1HYSB 3CFRA 4IQXA 2XWYA 1JL1A 2JEIA 3KLGB 4RW6A 3TWHA 4B9MA 4CJRA 2DPJA 1IKWB 4CJVA 3VQ8A 4EP5A 3O3FA 4E7LA 2YNGA 5E41A 1HQEA 3S3MA 1DLOB 4MKAA 3AVBA 2WOMB 5KFPA 4FXDA 3I0RA 3PW5A 1L5UA 1C1CB 4DQRA 2W8KA 4RUCA 4NLGA 4O3SA 3QIPB 1JLBB 4MQ3A 1SH2A 3KHRA 1YTUA 2RF2A 4J2DA 4DF4A 2W7PA 2G8IA 1RTHB 1IH7A 2OZMA 5J2PA 4OKKA 1TL3B 1QSSA 3T5HA 4HVJA 4YR2A 3LAKA 3ULDA 3QEPA 3V6DA 3OL7A 1YVFA 2NUBA 2D7SA 3HM9A 4PWDB 1VSMA 3E01B 1LWCA 4FLVA 4I2QA 1HNVB 1RTDA 4O3RA 4PY5A 3QINA 3TAMB 4DQSA 1UA1A 2HHQA 2BRLA 4CJUA 4CF8A 2R8KA 4FW1A 2ZE2A 4FLWA 2W42A 1U47A 1IKYA 3OYBA 4JV2A 2Z1IA 1S1UB 5DG9A 5KFIA 4CF1A 2XO7A 3TAGA 3AVGA 3IAYA 5KFAA 2HNYB 1QSLA 1VSHA 5CY4A 4NLTA 3U6FA 5FRNA 5EWFA 4DTMA 2WOMA 5DQGA 5J2PB 4IRCA 4F4ZA 3RB3A 3VQ7A 3OYNA 4IFVB 2PYJA 1KFDA 4AHTA 3D28A 4WXWA 4FJGA 3LPUA 4CGFA 1S1WB 1CZ9A 4FM0A 3G10A 5DGBA 4I2PB 2RKIB 4WYLA 4RNOA 3BREA 4FLUA 3IRXA 2E9ZA 4B9TA 1L3SA 3KLIA 4K4TA 4M3RA 1EX4A 4FJKA 4NLVA 3H5XA 1DTQB 4ZTJA 2B43A 3AA3A 1RBTA 1T7PA 3ALYA 2J6SA 3RAXA 2IDOA 5KI6A 2ATLA 2W9BA 4ECXA 4W5QA 3LZJA 4ELVA 3NAIA 5J1EA 4IG3B 3KNAA 2HB5A 1C6VA 3NF6A 2FLNA 3VQ6A 2XGPA 5F8NA 1JLQB 1KCFA 1EETB 4FZXC 4ZP9A 4CJSA 2D0CA 4UQGA 4DSFA 3LAMA 3K58A 1SUQB 1RT6B 5KGWA 4CHOA 3OLAA 4CEEA 3CDWA 3GYNA 3FRZA 2OPQB 1IO2A 3VQCA 3I0RB 4Z4FA 4QPXA 1CLQA 3MFHA 4OVLA 3KHLA 4IG0B 2R8JA 1RDCA 3V9UA 4BDZA 1NOZA 4CEBA 1SKSA 3ZSOA 3SYZA 1CZBA 4YQWA 4JS5A 4IKAA 1K1SA 1IKVB 2E9TA 4Q0BA 4M3ZA 2AWZA 4CF9A 2HWIA 4ZPAA 3OYMA 3RMDA 3PX4A 5HP1B 4E89A 3PJWA 3B6OA 1SUQA 3KHHA 1BQNA 4KAIA 4FJ5A 2KW4A 4C8NA 3SI6A 4RW8B 4ECSA 4O44B 4KBIA 5HBMB 3PR5B 2OH2A 1RTDB 2OPPB 3MFIA 2J6UA 1TK8A 4CESA 4XIUA 4ECRA 3DLGA 1N6QB 3V6DB 3H5SA 3N6MA 3OSNA 2EC0A 4O55A 5SZTA 3OYDA 3EYZA 4O0IA 3K5NA 4TY9A 1U49A 3BGRA 4O4GA 4F2SA 1ASUA 4YR3A 1T94A 2R8IA 1KRPA 3LPTA 3CM6A 2AGPA 4EO6A 2FVSA 3KK3A 3TANA 2AQ4A 1OS5A 2RDJA 1RBVA 3VQ5A 4C8OA 3OYAA 3MEGB 3QGIA 2XC9A 3WNGA 3L8BA 4F4WA 4RNFA 5HROA 2YNFB 1SL2A 1K1QA 1LW0A 2HHUA 1HNVA 1JXBA 4RW9B 1IKXA 4URGA 2IM0A 3FFIB 1W25A 2HWHA 2OPSA 1WLJA 3QLHA 2E9RX 3TVKA 4R0EA 1S1VA 3RWUA 3KLFB 4G1QB 1A5XA 2C22A 5C42A 2FBXA 4Y1CA 2WRMA 3HVTA 3QO9B 3A2FA 3BDPA 2UVVA 1HQEB 3DLEB 1LW2B 4GVMA 2FVRA 2G8KA 1NK9A 4TY8B 1FK9B 3GIKA 4YP3A 1RTJA 3KLEA 1SL0A 2GBZA 4FVMA 4CFCA 1EP4A 3DLRA 3V1RA 3V1OA 4M3TA 5HLFA 2YNHA 4ED1A 3U3GA 5EWGA 2I5JB 2B5JB 1TKZB 4I7FB 3LP0B 1N56A 4Y2AA 4CJKA 3ZT1A 1TAUA 4KHWA 1RA6A 5HRRA 2R2SA 4FS2A 3CDEA 2D3UA 1D0EA 5L1JA 1N5YB 2VWJA 4F3OA 2HHWA 2ASDA 1LW2A 1RDBA 4KHYA 3Q8RB 4OKEA 2BGGA 1JLFA 3RAQA 1R0AA 3ZT4A 4CJ3A 3K5OA 1KHWA 1HPZA 4EZ9A 4AHUA 3DLBA 2XY8A 3C94A 1U45A 2R2UA 4Y2CA 3T5KA 4DL5A 2FVCA 3KLHB 4IG3A 3MEEB 3M8PB 3QGGA 3GILA 4Q8FA 3V9ZA 5KG1A 4CHPA 5CYMB 2ITGA 3OS0A 3I5CA 4DL7A 4C8MA 3B6PA 1ZETA 3JYTA 3KK3B 1NK4A 3MEDB 1HYZA 4LD0A 3QERA 2VWKA 1QUVA 1J5OA 4NLPA 4WFZA 1ZBHA 4FK0A 2QXFA 1ZTTA 4F3TA 4HHTA 5F8MA 4CGIA 3KK2B 3NBPB 3TABA 1SL1A 4ZP7A 4RW7B 3PHEA 5KFJA 1S1UA 4B3OB 3AVHA 3DLGB 4K50A 1U09A 3M8QA 1S4FA 2BE2B 4M3XA 3AA5X 4I9QA 3FSIA 4WYWA 4DTNA 4FJMA 4CEQA 2P5OA 4I2QB 4PA1A 4Z4IA 3SNNA 4MFBA 3G0ZA 4LY7A 3PW7A 2FC0A 4RNNA 4KHUA 1RDAA 4KREA 2FBYA 5KT3A 4KAZA 3VQBA 1RA7A 4NYZA 3PW2A 4KV8A 4ED2A 1ASVA 1HNIB 1ZBFA 3TAFA 3LP2B 1JLCB 3QIOA 4OGCA 2R8HA 3QEXA 3NGZA 3RR8A 3SZ2A 2QKBA 4Z0UA 5KFUA 1WNEA 1TP7A 3Q8PB 4FM1A 3OYEA 4N56A 5C24A 2XCPA 4B9LA 4J2AA 2V4QA 3ZSWA 2ZQBA 3HVRA 4L8RB 2GIQA 4TXSA 4K4VA 4E3SA 4QWEA 4DTUA 5KGXA 1WSJA 5L1LA 1WSEA 4W5TA 1WSHA 2G8VA 4DEZA 2BANB 3O4QA 1HMVB 3F73A 2KZZA 4LSNA 4H4OB 4O3PA 4RNMA 3DRPB 1N5YA 4FW2A 4CJEA 4NLUA 3TARA 4KB1A 1GOBA 3C6TA 4BE2A 3HKWA 3IGNA 4KPYA 4HKQA 4HUGA 3MR6A 3KIOA 4NRUA 4OPJA 3QESA 5C24B 1A5WA 3AO1A 5KG2A 3RMAA 3V1QA 2P1JA 2HW3A 3CJ3A 4B8CA 1RDDA 3OYGA 3I8DA 4ECYA 3ZSVA 3AA4A 4K4WA 4TLRA 4IBNA 4BWJA 3JSMA 1XC9A 1JXEA 4FLTA 2JEGA 2FBTA 1JLGA 4DTRA 3DM2A 3KHGA 4ED3A 4ZPBA 1VRUB 4J9RA 1KVAA 1B92A 4NLSA 3AO2A 3MAQA 1NJZA 5K14A 4MH8A 3OYKA 1TKTB 1GOCA 2C2DA 1VRTA 3OYLA 4GC7A 4ZHRA 3MEDA 4CK2A 3TR8A 4CHYA 5KFKA 1WAFA 4I2PA 4RG8A 3KJVA 3VQ4A 4LH4A 3AO3A 2IM2A 3VA3A 4DF8A 1NNDA 4Q0BB 2G8HA 4DTOA 4K4XA 3DMJB 4ED0A 2VG6A 1LV5A 4NLXA 1REVA 4DTSA 4EYHB 3T3FA 3HL8A 4DU1A 1KLMA 4CEOA 4CFBA 3LALA 1S9FA 4DL2A 2R2RA 4EZ6A 5KRTA 2AX0A 1KHVA 3HK2A 1N48A 4FK4A 3M9NB 4O4RA 2W9CA 3NL0A 2YKNA 4ZP8A 4FBTA 3SJJA 2YNIA 3KK2A 3RBDA 4B08A 5KG6A 3PZPA 3MXMA 1VRTB 3KMSA 3TAMA 4GW6A 3DRRB 4ZVEA 3IS9B 4PWDA 3RB0A 1EKEA 5EUHA 3NMAA 4F4YA 4KHNA 2F96A 4B9VA 3OL8A 5DK5A 1S6QB 2XY6A 1NJYA 3QIPA 4FLZA 3MEEA 4E1MA 3T5LA 3KOAA 3VQSA 3P83D 4DSIA 2X6SA 1FKOB 2CKWA 1IKVA 1RBSA 1S1VB 3CM5A 1KLMB 2RF2B 4F50A 3DYAA 4FLXA 4QW9A 3G6YA 4ECTA 4QCLA 2W7OA 4DQPA 3KLVA 1JLBA 5F8IA 2BANA 2ATQA 4IG0A 4ZPCA 5KFWA 4QWCA 3DM2B 1RT2A 3KMQA 4K8ZA 1JLAB 1NK5A 3GV8B 2HNZA 3V6JA 3H5UA 1KTQA 1NK6A 3NAEA 4Q45A 4CJ5A 3S9HA 4KTQA 4KKOB 4E19A 1HYSA 4FJXA 1S49A 1XWLA 4W5NA 2AJQA 3NCIA 4CCHA 3DLEA 2WTFA 4ED8A 1GX6A 1NKCA 3HP9A 4NCGA 2Z1JA 4DLGA 2VG5B 1UOCA 1RT4B 4NLOA 4LSLB 1BL3A 3L2UA 2UVUA 5F8HA 3FDSA 1L3TA 3CYMA 2XI2A 4MFBB 4PQUB 3MR5A 1G15A 3T5JA 2QV6A 3MXJA 5T7BA 2G8FA 3OYIA 4FJ7A 1MU2A 3I5BA 4J9OA 4Y1DA 3ZT3A 4BDPA 4R5PA 3CIZA 3MEGA 4G3IA 3CJ0A 2VA3A 4ZP6A 3LP2A 4RW4B 3ZSRA 3EZ5A 4G1QA 1QTMA 3DRPA 1VSDA 1U4BA 2D0AA 3DOLA 3L2WA 4AH9A 4O3QA 2DY4A 1I39A 2IS3A 1C1AA 4YFUA 4IDKB 5KFZA 1S9GB 2FJWA 4J9SA 3GIMA 4CGGA 1LWEA 1RDRA 4M3WA 4TSXA 3OYCA 3JYTB 4N76A 1C0UB 1SKRA 4CE9A 2I1RA 2HNDA 5I42A 4QAGA 1TK0A 1IG9A 1LWEB 2IM1A 3WNFA 5DMRA 4OLAA 4CFDA 3OL6A 4CHQA 1RTHA 2YNGB 2UUTA 3O4NA 1VRUA 4Q8EA 3K57A 1ZBLA 1VSLA 5JS1A 5KFEA 4FJLA 2W8LA 3NHGA 3QETA 3V6HA 4DL3A 3OYFA 5KTQA 3E01A 3SUPA 4R8UA 1KLNA 3LP3A 3DOKA 4IRDA 4R5PB 1TKZA 5J2QB 2HHXA 1RTIA 4FJJA 3CJ2A 4HCCA 2VG6B 4FZYA 3VQQA 1RTJB 2FJXA 1L3VA 2OPRA 3V6KA 3DLKB 1X9WA 3PY8A 2OYQA 3VQDA 4X2BA 3SV4A 2FVQA 5CYQB 3CWJA 1W9HA 4NZ0A 3AVCA 4KKOA 5I3UB 2IJFA 4IH7A 3HPHA 3AA2A 3KLHA 2IM3A 4FJHA 4IFYA 4NRTA 2D0BA 2IAJB 1S9EB 3FQKA 3QZ7A 3KD1E 4BWMA 4GMJB 1BI4B 1KVCA 3BJYA 1SV5A 4M3UA 1N4LA 4CECA 3OY9A 3SUOA 2XY5A 4IRKA 1Z4UA 1JLGB 2PY5A 4ID5A 1QE1B 1RYSA 4CK1A 5KFXA 2IAJA 3VQ9A 4JRPA 2IC3A 4F4KA 3NH1A 5KG4A 4CJ4A 1VK0A 2ALZA 4ED7A 2XRIA 3V9SA 4ECVA 3SPYA 3FFIA 1EP4B 3V81B 5FDLB 2C2RA 4O3NA 1FKOA 5HROB 3NDKA 4K4ZA 1EETA 1KVBA 3HVTB 2X78A 4ZVGA 2KFNA 2UVWA 3UR0A 3L2VA 1RTIB 4CFAA 4EP4A 2BR0A 3G86A 2F8TA 3QZ8A 1JKHA 2IOCA 4FJNA 3HSTB 3M8SA 2OPPA 2YKNB 4CJWA 3VQPA 2KZMA 1J53A 2JGUA 2XCAA 3OYJA 4E7HA 3RMCA 3G6XA 1C0UA 1IKYB 4Y34A 1HQUB 1TVRB 1B9FA 2XY7A 3M9MB 4RW8A 1T05A 4E7JA 4OJRA 1MU2B 4TYBA 5DLFA 4HUEA 2HHSA 2ILZA 3T1AA 2VG7B 3NF9A 5CZ2A 4WFXA 5KFYA 3NE6A 1NOYA 3DI6A 3P1GA 1RAJA 1I6JA 3GIIA 1JKHB 2OPSB 4DS4A 3OHAA 4Q43A 1CSJA 4WE1B 3WNEA 4NLRA 2JC0A 2ZE2B 3EPGA 2YNFA 2UVRA 4CJTA 3WNHA 3P5JA 4FJIA 1TVRA 4ED6A 2P51A 1RT7B 4EYIB 5EWEA 1K6YA 3K59A 4FK2A 4FLYA 4H54A 1TQLA 2XGQA 1S5JA 3CJ4A 2OPQA 4ZHRB 2KQ2A 1S0OA 3HT3A 1J54A 4LH5A 3DLHA 4CJLA 3SUNA 2WONB 4NLYA 1RT6A 5CYQA 3D0PA 4C8KA 3ZT2A 4QWAA 1D8YA 1JXLA 4RW6B 2CJQA 4TQSA 4DTXA 3U3YA 2GIRA 1SV5B 5DG8A 1TL1A 4ECZA 1RT3B 1NK7A 1J9AA 5J1EB 4NYFA 3HHKA 5KFFA 1XR5A 4E7IA 4ELUA 3AVFA 2W9BB 3RB6A 1RILA 1S6QA 1J5OB 4QWDA 2FLPA 3ASMA 3RRGA 1U48A 4N5SA 2YKMA 4FBUA 4CIEA 3KK1B 5KFTA 3K5LA 3PV8A 4W5OA 3AVKA 1BCOA 1BQMB 1RT1B 4ZTFA 4TN2A 1JLQA 3DYAB 3HVAA 3DRRA 1LAVA 1S48A 1ZYQA 1TKXB 3IN5A 4CHNA 1HJRA 4HCBA 3EY1A 3KLFA 4DSKA 3DOKB 4RUAA 5EDWA 1HYVA 5KFDA 3QLHB 2LSNA 2P5GA 3MTKA 4XO0A 4DFKA 3AVIA 3NKYA 3BSAA 4IOBA 3DRSA
chains in the Genus database with same CATH superfamily
2GAHC 5GAEU 2PFDA 5GAEI 4JKBA 4LR7A 3JTOA 2XYGB 5D4LA 3ISND 4Q2MA 4A8KA 3I0SB 1IWGA 3RR7A 2E4LA 3AO5A 3DOLB 2DEJA 4PKDB 3VEZA 5U47A 4Q5VA 4MO4A 1WWHA 4DFJA 2P6SA 2UUAK 2YHAA 3UE2A 3NF8A 3FZMA 2AGOA 1HNZF 1FCAA 2ASLA 1UPMB 3E51A 2ZBRA 3RRHA 2Z2ZA 4WFBQ 3HO1A 5DM7L 3CMAS 1NPRA 3I56S 4DPYA 3F0NA 3SLCA 3H1VX 1SJ4P 1LXJA 4ED4A 4JI8F 4YDUA 4V1Ak 2QWOA 3FQLA 1EARA 1SC3B 1SZ2A 5ETMA 2X6NA 4JS4A 4DR7K 1AB8A 3BGLA 3B4MA 4LF2A 2QMXA 3MM6A 3S3OA 2F4VF 2XMMA 1U0HB 3T19A 4DSEA 2HSEB 1HBOA 2AW0A 2YPYA 3O3HA 1FRKA 2YKAA 3W0LA 2XHWA 4YHHK 3R5CA 2PA3A 3ZTRA 2Y1LB 2UU9F 5J2NA 3S01A 1Y00A 3NS6A 2ZD1A 1WHXA 2A18A 4PG4A 5LMNF 4F2RA 3MECA 4ANCA 2VD3A 1KSPA 2GJ2A 5AQFA 4CEZA 5JUMA 1Q1KA 5AZIA 1JXVA 4CZFA 1ZM2A 5DQIA 4IR9A 4DR6F 1SC6A 1SIWB 3SI8A 4OYIA 5AXLA 4L76A 1TMJA 1FE4A 2AKWB 3EPIA 3DGVA 2YHXA 4AL5A 4AUKA 2DGVA 1NU4A 3HPGA 3VV2B 4F0HA 4DWIA 3FK4A 1L3KA 2PZSA 4I6MA 2Y1RI 3LL3A 4JYAJ 4Z4EA 3V81A 3Q8VA 2MKKA 2VYPA 3CCZA 3Q8SB 1UFKA 3OL9A 3MECB 2B4VA 1B9DA 3IG1B 1QQCA 4H5NA 3HSGA 1JX4A 3ZYYX 4K8XA 1F21A 1CULA 2G8WA 3GYGA 3W63A 3S3NA 1HNIA 2AJ4A 1QHTA 4JI5K 2YHYA 3VOVA 3D0HE 2A40A 3GV5B 4XDCA 2ZNZA 1EXQA 1X9MA 1RT7A 3UIQA 4FYVB 3IS9A 4JHDB 4OPAA 3D1QA 2GV9A 1WSGA 3LW5C 5KPRA 2WFBA 3GDQA 4BE0A 1WNSA 5DRKA 2C3YA 1FWLA 4JRQA 3I9V9 5M1KA 4JI2F 4JK7A 3EJMA 5KFBA 4B8AB 3AVAA 1RAEB 3CG7A 4Y28C 1RBLA 2BH1A 4DDFA 1QAIA 2MGZB 5GADP 2CG8A 1CXQA 4AHCA 2QK9A 5KFRA 2ASPA 4J9QA 4DL6A 2J8AA 3OBIA 2OGUA 1MROB 1C1BA 2XSJA 3D2EB 3O3GA 4DFPA 2QX0A 5CCLA 3EXCX 4WFYA 1RT5A 4K2JA 4LF4K 4ID8A 1GOAA 3FBFA 2IGIA 1S0NA 1Q95G 2KG0A 2ATCB 1Q78A 5AQGA 3TAEA 4NXMJ 2JEJA 3BB5A 1N33K 2HGLA 4ZMMA 4OYPA 2QJ3A 4MJKA 4LBHA 3RW6A 8AT1B 2QFIA 3OBWA 3U1LA 4FCYA 3J7AP 2O4IA 2DNMA 2DR7A 2ACMA 4JI8K 2AJ0A 4CH1A 3FSYA 3RZAA 3EO3A 2ZJPL 3NGYA 4YOXA 4ILRA 1HW9A 3JXUA 4DLEA 3PHTA 1YI2N 4KE5A 1S7IA 3CF5L 4H8KA 3ZETA 5KFVA 5KFGA 4EBEA 1VQ4N 3SMPA 1RCHA 2EEYA 1EKSA 3ZEUB 3KK1A 3OLBA 3H59A 2YV0X 4MKBA 3VZIA 1N32J 1SJFA 4A59A 2C3UA 1BHLA 2QI2A 5HMWA 3L7UA 2J0QD 1XR6A 1T9VA 1MROA 3SQ1A 2FC8A 4FS1A 3HI9A 2VDHA 1RWWB 4LFCF 4CEDA 3KLEB 3J80O 2WBRA 3LP1B 3MF5A 1PAUB 2D0PA 1UKUA 4IFYB 1P9QC 5AQJA 3AVNA 4EO8A 3DXBA 1WELA 2HFUA 2CG4A 4B3TJ 1UFLA 2BABA 2FZKB 1U25A 2EFOA 2DNQA 4LFBF 5AQHA 2FZGB 1TU0B 4AILC 5HJYA 2HG4A 1WHYA 1IQZA 3U9DA 3ZETB 2G0CA 4EAHD 4CEFA 3VA0A 1WSRA 4QJVA 3FNNA 2ALYB 3TJ9A 1HMVA 2IBKA 2NR0A 2HNDB 2GJIA 5HMXA 3M4XA 3K17A 1TUWA 5M1OA 4EHUA 1K9MO 1S7HA 1O13A 4K41A 2V9WA 2RVJA 1AFIA 4KI4A 3R8YA 4RBTA 3MCPA 1QAJA 4A48A 3BSOA 2FUG9 1D5AA 1SH0A 3O44A 1N0VC 4IO1A 1PSDA 1VQOS 3UB5A 4IKFA 3NVMA 4H03B 3ITHB 3MN5A 2BE9B 4KHSA 2A0FB 2WCXA 4KV8B 4RW7A 3HBTA 2EI5A 1LAWA 4U7BA 4KHPJ 2CDRB 4PXDA 3BSCA 1FDAA 5F41A 3NCPA 1RISA 1Z25A 1Z2ZA 1HLWA 2GVZA 4K4SA 5CXTA 4L6V3 4WBFA 3SSSA 4FWMA 3F9KA 2FVPA 4X4VA 2BRKA 2GA7A 4CM2A 2IA6A 1KBRA 3BQ0A 1RT4A 2QA4N 3OYHA 4DR7F 4E7KA 1Q5YA 2MY7A 2HZVA 4WF9L 4A57A 1UJ6A 2E5JA 2JC1A 3LP0A 3FZBA 4P7TA 1K8KA 2ZBQA 4AT1B 4IDKA 2YH1A 5ETTA 1FDNA 3MCAB 1FFWB 3TUJC 3QEIA 4EFHA 1S77D 2DY1A 2ASJA 4CJQA 1MWMA 2RH3A 3ILOA 3H7HB 4I56A 1S12A 1N0UA 3AXKA 4HLBA 2FLLA 3VAFA 5AQLA 2G8UA 2NUHA 3CJAA 3CPWM 2I8EA 1YX2A 4O0JA 1WSIA 2DISA 3IR7B 3KTQA 4DZ6A 4ILMA 4PL7A 2KN4A 1PO6A 4CLSA 4NXMK 4CGJA 3QPIA 3WXKA 3FZFA 4WZQA 4P75A 2AD9A 2OKQA 2QA4G 2BQUA 3VF4A 3MCSA 1QVFR 3SAHA 4DMNA 5F8GA 4JYAF 5J2MA 2R8GA 1YJ7A 4ZJLA 2XM3A 2WBNA 4O44A 4OZLA 2AX1A 4GO5X 4LVNP 4QIEA 1GLJO 3HI0A 1SPBP 4A62A 4DV0K 5ETQA 4PG8A 1JLAA 1WEXA 5C15A 3FBBA 1X31C 3UDLA 4X66J 3FGUA 1ZBIA 3IRXB 1N8RT 5I42B 5D3GB 3CJ7A 4KFBB 1E4GT 4L72B 4RPFA 2UP1A 1R8AA 2HVEA 2J7WA 1Z6RA 1A6LA 2MGZA 3HD1A 2HMIA 4FXVA 2B7BB 1ZZFA 2VQEJ 1MMLA 5C5JA 2DGUA 3CCSN 3NGIA 3THPA 1Y3KA 3UPFA 3HJFA 2FSJA 5L8RC 2Q3PA 4DQIA 1YITS 2O8BA 4OI6A 4K5RA 3I55S 3H40A 4YDUC 4DTJA 5HRPA 2KRBA 5RUBA 3I0SA 3N6NA 1CS4B 2HBYB 4RX6A 2Z4PA 1RKIA 2UUBF 1NMNA 4CI6A 4QS7A 2XB2D 2GC8A 1F9FA 1P1LA 1ZTWA 3NH2A 2CUYA 2RD5C 3PJXA 1X9SA 4M7XA 2AYEA 4Q44A 2VF3A 2G2OA 3D45A 3KKRA 4ZOSA 1TKTA 1W0HA 4EUVA 1P9YA 2MYFA 3ZCMA 3KG1A 2Z1HA 1OH8A 3Q8UA 4BR7A 1RT1A 2UZAA 5KT7A 1XIQA 2V2QA 2OPRB 4KB7A 4LSLA 2F9JA 3SQ4A 2QSWA 3H90A 1Q8BA 2HHPA 1RCXB 3PKMA 2ZJPQ 1UWBA 4NYOA 1FI4A 2YX1A 4WZMA 2KHCA 1OJ4A 5KFHA 3O9RA 5MLCQ 1J27A 1VBKA 3BH7B 2G2ZA 3HM8A 5AZIB 3GU0A 2OEMA 4B9MA 3VVTA 4CJRA 2JX2A 2ZVSA 1VQON 1HQEA 2E5LF 3S3MA 4MKAA 2V4JB 3IC1A 4BHQA 4RKUC 3A8YA 5GIPA 5DDPC 1XMQJ 3HJVA 2KFYA 5E7OB 1C1CB 1YSJA 2VHGA 4DQRA 4XH5A 2YY3A 4O3SA 1UVNA 3QIPB 1JLBB 4PZVA 3QSYB 3KHRA 2AJ2A 5AE2A 2FHKA 3OTBA 2L3MA 5C7PA 2MXYA 1Q5VA 2H51B 2LXFA 4N77A 2G8IA 1R43A 4S0MA 3SCLE 2OZMA 4DR6K 3PRDA 2LA6A 2VODA 5J2PA 3SIPB 4HVJA 1CJTB 5HVHA 5HQMA 3LAKA 1YVFA 4PWDB 3TYTA 1BQXA 4Y2MA 1RWUA 1JNZB 3CGIA 3D3BJ 3M05A 4PXBA 2H65B 4OX9K 1QY7A 2POKA 3AGRA 3QFHA 1HNWK 3D9BA 3DGPB 2XLIA 4DI6A 2XO7A 3AVGA 5KFAA 4X84A 1QSLA 1RI7A 3U6FA 1YLXA 2LQ5A 5FLXO 1T9TA 2WOMA 4CRJA 2G4BA 3IAM9 3RB3A 4HACB 4FYWB 4IFVB 5LJ5Y 2PYJA 1W2BM 1FRIA 1KFDA 4LF8K 3CJQA 5FPMA 4IO9L 1TTHB 4FJGA 5EHHA 3G10A 5DGBA 4RNOA 2RKIB 4JI4F 3CCRS 4ALZA 4FLUA 4LF7F 2E9ZA 1U26A 4FJKA 4NLVA 3ZXWA 3MAHA 4DR5F 1LFPA 1RBTA 1HKAA 2DD8S 2MHEA 3ALYA 9ATCB 3RAXA 4QYRA 2NRVA 1XNRJ 5KI6A 2FSNA 1IJJA 3HD2A 4JI5F 2ZC3A 2IVOA 3EKSA 4IG3B 3KNAA 3FCVA 1IBMK 2GELA 3VAIA 5AR0A 2FLNA 3VQ6A 2XGPA 2V5HG 3NRBA 1DKGD 2AEJA 4DR7J 3QDKA 5LXYA 3VAHA 1SUQB 1KDNA 4OX6A 3H0PA 5MLCV 5ELZA 1HLUA 4AF1A 1HFEL 2AJ1A 1KEKA 2ZITA 3VALA 2OPQB 4J9UE 3AXMA 2NYIA 1IG8A 1F9HA 3LUYA 1YITN 4QPXA 2JJ4D 5B0GA 5CR4A 4OVLA 4ZLJA 3N5BA 3KHLA 4IG0B 2Y0SD 2DT9A 3T1HJ 5E26A 4BDZA 2AJFE 3ZTPA 2YX4A 3LGHA 4FZVA 1CZBA 4JS5A 4IKAA 3QT7A 1AZSB 1JB0C 1IKVB 3O08A 5HSPA 2K3IA 3J7Z5 5ETRA 4ZJQA 5B8HA 2AWZA 2R7VA 2YI1A 3OYMA 2HFSA 2HBZB 1SUQA 1A0OB 2QA2A 4FJ5A 2UUBK 4B3RF 3JSRA 3EUNA 5FD1A 4RW8B 4ECSA 3E3XA 4UUWA 2BKOA 3HFKA 2GVDA 4KBIA 3PR5B 2OH2A 1F60B 2OTJS 1RTDB 4BRKA 2J7UA 3KVGA 2OPPB 4LF7J 4C11A 1CJUA 2XMJA 4ECRA 1N6QB 3HFVA 3H5SA 3OSNA 4O55A 5HI7A 5SZTA 3AODA 4TY9A 2DO4A 4O4GA 4F2SA 2LXIA 1T94A 2R8IA 1WF0A 2L48A 2YTCA 1KRPA 3D1OA 3CM6A 2NZTA 1CQMA 2NXNA 2WVFA 4EO6A 2CAJA 1ZXOA 2FVSA 3ZTOA 1NBWA 3TANA 4C11B 5ADZA 2QA1A 3RUBL 1CJTA 3RAMA 1OYEA 1S79A 2XC9A 1TL7A 2BBEA 1HR0K 4UOHA 4RNFA 2CA9A 4OX9J 4OZ5A 2YNFB 1SL2A 1K1QA 3K0JA 2F4VJ 1JXBA 4RW9B 3T1HF 3O5TB 2IM0A 3QLHA 3I6PA 3RWUA 4WQ5C 2BJ3A 3WXMB 4G1QB 4NMLA 7FDRA 3MM9A 1IJEB 2WRMA 1HR0J 3A2FA 2HZAA 4LJMA 5H9EK 2AV5A 3PM9A 4K0KK 1NK9A 3N0VA 3NS5A 3V4MA 2YNHA 5EWGA 2I5JB 3HHEA 4I7FB 2P9GA 2GQCA 1QVGR 3TJ8A 4KC5A 4CZGA 3M6UA 2DYAA 2R2SA 4NMXA 4ZCLA 1ILYA 4Y6IA 2ACYA 1T44A 1LW2A 3Q8RB 4OKEA 4PAAA 4CJ7A 1JLFA 3I33A 3KJQB 4U67L 1U45A 3C94A 2MMYA 3CJ9A 3HDSA 1RWPB 3OTEA 4MDBA 3EICA 2HWTA 3I9ZA 1RAOA 5KG1A 4CHPA 1B3TA 3PYEA 3CC7S 3OS0A 5LSOA 2P9IA 3M2VA 4C8MA 2B8QA 1ZETA 2EFQA 2ZBIA 2E8AA 1QUVA 2F40A 2UUCJ 2C3OA 4NLPA 3EVWA 1ZBHA 2QXFA 2XYHB 4CGIA 3NBPB 3TABA 1RP5A 2EBGA 5I3PA 4LF5J 1UETA 3BF4A 3PHEA 2ROPA 5KFJA 3PSFA 4DCOB 3PLAA 4UZBA 2MJUA 4B3OB 3DLGB 4K50A 1U09A 2Q0UA 2VOOA 2O3DA 1XNQK 4RJVA 4WYWA 1G2EA 4FJMA 2P5OA 2VFUA 4Z4IA 4GO7X 4WIIA 4DR2J 4CZCA 2E5LK 4P2FA 4EGLA 3PW7A 3AHPA 4KHUA 1RDAA 3TA2A 3IBFB 1NGBA 5F1XA 4KAZA 1H0HB 3VQBA 4ZVTB 3PW2A 1ASVA 3QIOA 2R8HA 2H5EA 5IWAJ 3NGZA 2DVIA 4JKGA 2W4CA 1WNEA 3DXKA 2BJDA 2RHQB 1NSQA 5A8KB 3OYEA 2ZWHA 2XCPA 3MM5B 4B9LA 3UW1A 3UCGA 1QAYA 2ZQBA 1M0SA 3HVRA 1FTRA 2CVIA 1FNMA 2GIQA 4TXSA 4K4VA 1DBDA 3L9ZA 4E3SA 1WSJA 5EX5A 3UNGC 4W5TA 2G8VA 1WD6A 4X4TA 4QOTA 1WC4A 2BANB 2JOQA 4A8WA 4LSNA 4OJHA 3UVJB 4NLUA 1TUGB 3HZGA 1LWXA 1SBRA 4KB1A 2DNOA 2HS0A 1PCAA 5EXWA 4HKQA 4HUGA 3KIOA 2NSCA 4NRUA 4DJBA 5C24B 3C6HA 4OIXA 1OMSA 3AO1A 4DR4K 4JI1K 4FVUA 2F1FA 3NMRA 4B8CA 2FJBB 9RUBA 1NZAA 3I8DA 2DJWA 2ZOGA 3Q89A 2MY8A 2VJVA 1YGYA 2JEGA 2FBTA 2F63A 4FO0A 3CIMA 4BRPA 4DTRA 2XLKA 1U7LA 2AYGA 3IRWP 1VRUB 5BR8F 3VPZA 3MN7A 4NLSA 4BC2A 1AUDA 3NGRA 5AXMA 1TKTB 4QR2A 4OHXA 3FZKA 1VRTA 4GC7A 4ZHRA 3MEDA 3TR8A 1WAFA 2VASA 2AYBA 2XEXA 4RG8A 4NI2B 2ITMA 2IM2A 3OW2M 3GTYX 4P10A 3VA3A 3THXA 2HSTA 4LIWA 4I0WA 4CYUA 2C42A 3FVYA 2VG6A 1REVA 2DR8A 4CFBA 4EZ6A 4JI6F 2NRWA 5M2PA 4JI2K 4BRFA 3BYPA 2VFVA 3D0GE 1RHQB 1KHVA 3C15A 5JVGL 3WC0A 2J0WA 3EXYA 3B82A 4DXLA 2ZJQQ 3UE5A 4H0PA 2V68A 1VFJA 3CJ1A 3KMSA 4CZLA 1GK8A 3DLJA 3CPWR 3CCES 4OZ2A 4CYUB 3JXOA 3O1BA 3IS9B 4JHDA 3MOZA 5EUHA 3NMAA 5D4PA 4F4YA 4DV3K 2QYGA 1YJUA 5DK5A 2HBKA 2DNZA 2HIQA 3JAMY 4ZKAA 1S6QB 2XY6A 1ELOA 3MEEA 1OY8A 3TRGA 3KDNA 3MPVA 3VQSA 2IDLA 1S1VB 1KLMB 3OFGA 1H2TZ 2DO0A 3EDRB 5GAHI 1YK9A 3DYAA 4FLXA 4QW9A 1ZAVA 2W7OA 2AP1A 2DNYA 5LOQA 2UXDJ 3HFZB 5LJVA 1NH8A 5KFWA 3QAUA 1IR2A 4B3TF 3SQGA 3RVCA 3H5UA 3CD5A 1LK7A 4DU8A 3NAEA 4BBYA 4A8QA 2ADBA 1N5SA 4KKOB 5LJWA 3NG8A 3Q0AA 1S49A 4PPZA 1JWWA 4CCHA 4WFNL 3J7A1 1GX6A 1RE1B 2P9UB 3THYB 3ETOA 4DLGA 1QQOA 2FZCB 2VQFF 3O8MA 2H3EB 4O5FA 3L2UA 2FDNA 2G0JA 2XI2A 4MFBB 3PYFA 3CCEN 4BC4A 1G15A 4OJ1A 3GE1A 3TPQA 1GQEA 2QV6A 3MXJA 2G8FA 3OYIA 1MU2A 2CVEA 3MEGA 2QEXS 2PC6A 1UEUA 3LP2A 4AM7A 4ZA1A 1NLKL 3CCJS 4JI4J 2D9OA 3EZ5A 2DKOB 3KG4A 3DRPA 1VSDA 1PC5A 5CD4H 2ABYA 3UKUB 2HFVA 1U1KA 2D0AA 2XULA 3DOLA 4AH9A 3L4QA 4Y65A 3DU6A 2DY4A 2IS3A 5KFZA 3L7PA 1S3XA 4YB7A 3NGTA 1YWXA 3OYCA 3JYTB 4N76A 3C8YA 1AYEA 2FF3B 1ROFA 2E1MC 2APOA 4CLPA 2JLFA 5HO4A 1LFWA 3GJTB 5BPLA 2D4WA 1BG3A 5I42A 4QR1A 4WP8A 1VQ9N 1TK0A 4A5BA 1LWEB 3WNFA 4CFDA 1FEEA 1IBMF 4YB1P 4WKRA 4P71A 1VRUA 1RWOB 5JS1A 4FJLA 2XQCA 2W8LA 4FNHA 3VEYA 1ITPA 3R7BB 3QETA 3V6HA 1KQKA 3OYFA 4YY3K 3IWLA 3LP3A 4I6YA 4GRSA 4R5PB 4GVEA 2HHXA 1AXQA 1T9XA 1RACB 4HCCA 1FFSB 2BZ2A 3VQQA 2WB1D 3FUYA 5JMNA 2BUPA 1L3VA 1X8DA 2UXDF 2VPYB 2KHDA 4DV4F 1NSKL 3SV4A 2FVQA 4NZ0A 3AVCA 1SS6A 3K2YA 3QQCD 5I3UB 5J1PA 2IJFA 1ULRA 1HWJA 4IH7A 4PG6A 3AA2A 1H73A 2IM3A 4FJHA 3CXCM 3U1MA 4LF4F 2UUAJ 3W61A 3FQKA 1KVCA 4GMJB 4CH7A 5JICA 4M3UA 1LKZA 4KH0B 2NRHA 1N4LA 4CECA 3SUOA 1O5JA 1B99A 4NA1A 4FVCA 1JLGB 4DR5J 2PY5A 2MQ8A 4PWUA 4ID5A 3SSQA 1QE1B 1RYSA 4CK1A 4ZPTR 2YKPA 4JRPA 5D0HA 4GNIA 1S0VA 1VQ9S 2KH9A 1VS3A 4CJ4A 2ALZA 4ECVA 1D09B 4OQJA 2QN6B 3V81B 5FDLB 1CJKA 2YWGA 3LPYA 3X1LB 4C1NI 4Y2KA 1YIJS 2EFNA 5HROB 3DXMA 5EVZA 3NDKA 5EOYA 3CTRA 1UW4A 1KVBA 4JKFA 4CT9A 4ZVGA 4J37A 3G86A 1FHTA 3QZ8A 2WZ1A 4NA3A 4FJNA 2Y3YA 2HQGA 1J53A 3UO0A 4ZCIA 4E7HA 1HNZK 2HAFA 4XAKA 3ZZ0A 4Y34A 1HQUB 1V5VA 4RW8A 2X1AA 4E7JA 4RUBA 4OJRA 5DLFA 4HUEA 3KHYA 2GZOA 4U96A 2ZZMA 3J7YI 1U1OA 2VG7B 3M2RB 4CLFA 4OI2A 1NOYA 1OYDA 4MDAA 1I6JA 1IWAA 4YOUA 3MMBA 3GIIA 3R3TA 5GMKa 2OPSB 4Q43A 4HT7A 4X4UA 2JFDA 4F67A 1MWQA 2UVRA 1VGYA 1T11A 3P5JA 4ED6A 1U8SA 2B9XA 3VGKA 1EWRA 1K0TA 4KBOA 3R5AA 5EWEA 1K44A 2CPJA 3CMQA 2XGQA 1S5JA 2OPQA 1Y10A 2KQ2A 5E5NA 3U8XA 4LH5A 3GFHA 4WCEL 4CJLA 1RT6A 3D0PA 2DY9A 4C8KA 3HKZD 2CQHA 5LJ3Y 4QWAA 1Q86T 1JXLA 2YQ1A 4IOAL 2G9OA 3A5NC 5DG8A 1TL1A 2BJ7A 2F5GA 4FYYB 2HMPA 4HHJA 1J9AA 1QDUB 1VQ6N 2K7KA 3BS9A 2JWLA 4OFZA 3AVFA 3HT0A 3AAQA 1HKGA 1V3SA 1S6QA 1J5OB 3RRGA 2OEJA 1CPZA 1NPPA 3M32A 4FBUA 3KK1B 4DHVA 2ZM6K 3K5LA 3BO2A 2AA4A 2C2OB 1Q16B 1KVJA 5DDRC 4A8FA 2JWKA 2IA0A 3MUVP 3HSJA 5K8PA 3DRRA 1LAVA 5E3AA 1XC3A 2J9DA 2P9KB 4JI6J 3K89A 4M5GA 3DOKB 4GV3A 1HYVA 1URRA 3QLHB 1GEHA 4EIAA 3L09A 2P5GA 4DHYA 4C9DA 3I96A 3DRSA 3I5AA 4TY8A 3DLKA 4JV1A 3HVWA 4URSA 2NZCA 2F8SA 2RDDA 4DV0F 1HIYA 2P9LA 2BQRA 1V3RA 4USMA 2WVCA 4I7FA 1N34J 3I87A 1R0BG 5KT2A 2BDPA 3KUEA 1DQ9A 2B56A 2ZJRL 2MQOA 4X4PA 5BYRA 5ADXH 4M95A 1N33J 4LFAK 4LRFA 3OTCA 2K1RB 3HCXA 1CC7A 1NEEA 4CO4A 1WKJA 4JI8J 1N36K 2VBZA 1YZ7A 4FKYA 2YPZA 1HRHA 2F8EX 4DV6J 5AT1B 1O1WA 3UKRB 3BGRB 4CO5A 2B4JA 2OCEA 2KRRA 4P2MA 4CIFA 3MCOA 4AHRA 3NF7A 4OL8A 4HI2A 1I5OB 4EU0A 1N6QA 4JLHA 4DR2K 4CBXA 4J9MA 4B1WB 3OVAA 3OHBA 5FPDA 4RW4A 1D8ZA 1RLDA 2HBMA 3IR5B 1GLEG 1U1RA 3UKRA 3LANA 5IWAK 4EEYA 1KD1O 4D3HA 4NEYA 4DV7K 1T02A 4CGDA 3BZKA 3NGUA 2WHOA 4ZPVR 4UY8O 3RBEA 1FKPB 3RMBA 3MUTP 5K8NA 1OVQA 4FWNA 3UWTA 5HMYA 2P9PA 3V9XA 2CPIA 1GLCG 3LZIA 1S1XB 2CGLA 3OV7A 2GS8A 2W9AA 3ZSXA 1XMOK 4BE1A 3U4LA 4PABA 3BQ1A 2ZJRQ 1BI4A 2V52B 4G1IA 4J9PA 3SUQA 4ZVHA 3CJSA 1I3OB 3C6UB 2XZDB 1X7VA 5ETPA 3UD3P 3LH2S 2PMHA 2P9LB 1CEZA 5B0EA 2YQ0A 1FK9A 1NNEA 3G9CA 4BS2A 5A8KA 2YKMB 4JAXA 4DR1J 4ICLB 1I94J 2ZFHA 2RIJA 3P49B 3LDNA 1I3AA 5E3QA 4NASA 4PCQA 1S10A 1GMUA 1VJQA 2P6TA 4KHPK 3MHYA 4X62K 3RGIA 1QHAA 1J5EF 1HNXJ 2FYXA 1RWKB 3HX9A 1LWFB 4HTUA 2ASOA 4KH5A 3BV8A 1BA1A 3R2CJ 2BW7A 2HBJA 3CCMS 3QNNA 5IZHA 1I94K 4DG1B 5B0FA 3DXKB 2N7YA 1DJ0A 2J9CA 2KVQE 3TZXA 2XTJP 2KVIA 5EGYA 2D69A 3CE8A 3G4SN 1WUUA 3J81U 4NI2A 3CMAN 2M52A 2RPIA 4JI1J 3H98A 3K5MA 5AQXA 4FPRA 4DSLA 5H9EJ 3O5BA 4ZJOA 1R7IA 4DV5K 2KXHA 1FERA 1EIYB 2GWJA 4CO2A 4ZN1A 4E0DA 1KFSA 1WOSA 1BQNB 2RKIA 2RE2A 3EZOA 1V4SA 1Y9OA 5GAGP 4C8YA 3UN5A 2CFXA 3E8OA 3WXIA 1U1PA 3IMXA 4DN0A 2HEKA 4OX8A 2I5JA 2DFHA 1REVB 3LDPA 2IYGA 3J80U 4FOIA 4WP3A 1A7GE 2DGSA 2KYXA 3OSPA 4ATNA 1KQSM 4B9SA 2HLUA 4JK8A 1S72N 2QW9A 2HS4A 1UZHA 1VSEA 4O5BA 4CK3A 4F25A 4H4MA 3EMTA 2RQ4A 3IG1A 2V6AA 3O8WA 2HGMA 3TQEA 3BKUA 2M7SA 4DPOA 3CCSS 2I2YA 5THWA 3BBBA 1BQMA 3ZSYA 3AD8C 2EX3A 3BM7A 2U1AA 4J91A 3OR1A 3L95X 3LWLA 3D0IE 4NCGB 1Z26A 4OPKA 3HSZA 3AO4A 3DU5A 2IJNA 1NK0A 4IOCQ 5EN1A 3HHLC 3W5YA 4CTAB 4FKXA 3LO3A 2GW8A 5DDOC 7AT1B 5L1KA 4TYAA 3CVKA 3PDNA 2JEFA 2B9YA 4X64K 1HBMB 3RW7A 2HF4A 1QE1A 3AOCA 5EU7A 1K73O 4W5RA 2Q36A 1ATNA 1OSDA 2VONA 2L9WA 2H48B 3W2WA 4OKJA 3THWA 2MQMA 3J7YU 4FJ9A 4CJPA 1M90O 4P6QA 4PKGA 3IM8A 2Q66A 4EFAC 3PYDA 3NH0A 2IFXA 3DHWC 2ETJA 2Y1JA 1PBUA 5KG7A 2PEHA 1Y97A 1CJUB 3KZBA 2CIMA 4LF9K 4IJAA 1NLVA 5JVHL 2OSRA 2FGOA 1VQNN 3MOJB 4DV6F 4KTWA 3Q8QB 4IR1A 1HI0P 3MURP 2CQGA 2RS2A 2MLYA 3GPAA 3M6VA 3OXGA 1NGDA 4E1NA 4FWRA 1Q8IA 2M3DA 3P4IA 3ATUA 2A2DA 2AU0A 3CCVS 3VENA 3H4DA 4DBQA 4CERA 3UCUP 3OXFA 5IV4A 3NGDA 5D77A 3V4IB 3D68A 3K8VA 2DBBA 3BKTA 4I67A 3V9WA 3A13A 2O8DA 3TI0A 1L3UA 5KQ8A 1AT1B 1HD0A 1NKEA 1KTVA 2Q3SA 4NEZA 2XBPA 2E5HA 1V9OA 3MAAA 3KJVB 1GMWD 2GX9A 4FXWA 3SCKE 3JSYA 3ZEUA 3A8JA 2ZWOA 2JNJA 3ELHA 4WPAA 4URQU 1RBRA 1VQMS 3UCZP 2EVZA 1NXIA 1QVGM 3N79A 3AQPA 3BF3A 4M5MA 1Q7LB 4Z4HA 3NAHA 2DXFA 3Q7CA 4JI3J 2A42A 2YVSA 3EVMA 2LU2A 4WTOB 4JKEA 2W2PP 2FY1A 1N88A 5KFMA 4AQYJ 3A3OB 2MQQA 1NSAA 3LP1A 5KT6A 4I9LA 4U8VA 4CJFA 3MPWA 5A2QY 3CJ5A 1DQAA 1NJXA 4CD1A 1T03B 3TZZA 4YOYA 4LIRA 3D5MA 1Y11A 4DUYF 1FO1A 2VG5A 3HPOA 3QO9A 1F3FA 1S97A 4AL6A 3M2UB 3B78A 4HUFA 2YKOA 2DPIA 2RMLA 5IT9Y 5E0OA 3K2PA 1RT2B 4JKCA 3C6UA 4LF5F 5JXSA 1SCJB 3DI6B 1C0MA 2YNHB 1MNEA 2F65A 3JTPA 1RAGB 1RBOB 5H9FJ 2QKKA 5T14A 1RWXB 1M90T 3OS2A 4QYZJ 3BZCA 3VQEA 5CZ1A 3G6EN 1WKKA 2J76E 3CDAA 2VQEK 1ZPVA 3PIPQ 1P90A 1VSFA 2RS8A 4H4OA 1W7WA 2O4GA 3W60A 1FXXA 5SWMA 1SXLA 4M3YA 1QQMA 1T95A 2KLAA 4DUTA 3A5OC 5IWAF 2IY5B 5L38A 1NB2A 1I1GA 4KHQA 1CG2A 4E8UA 4XK8C 2WK4A 1BD6A 4Q7AA 1CULB 1RAIB 1OPIA 3D7SB 3JAMU 3SBMA 4HHHA 3HOSA 3PVXA 4FM2A 2CZ4A 2GWKA 4K25A 3AH6A 1Y4ZB 3GSDA 1LOTB 1VISA 3VQAA 3FBEA 1EJ7L 1FEHA 3AQOA 5IQQA 3BUZB 4FSVA 3N4QA 4F4XA 4DPXA 4WFAL 3GG4A 2DNKA 1PC4A 5TKWA 1FXDA 1WDTA 2VQEF 3OVBA 4QR0A 2LECA 4QWBA 1LEOA 1XHZA 5CHCB 4F3QA 3KJNB 5BYSA 2KM8C 2EWHA 3CCWA 3CXCR 1X4AA 3IR6B 1BOTO 4O3OA 2GAGC 3BO3A 4BVPA 2A10A 3ENAA 1RSCA 1TELA 2CWKA 4JEPA 1S0MA 1DTQA 1EHWA 4L3KA 3MGJA 3AJ2A 1S9EA 4IXCA 3AOAA 1KXPA 1BIZA 2PFUA 4Y0FA 3MR2A 2QXLA 5J2QA 2GTDA 3UN2A 2GUIA 2W24A 1J5EK 1JCEA 2AZ3A 1S6PB 1QQNA 1HYSB 4JI7K 1HHQA 3D2FB 2YBVA 3CFRA 2KL8A 2XWYA 3B4DA 4RW6A 3TWHA 2XLJA 2JLGA 1IKWB 1H7WA 5E41A 1M5PC 1E6VA 3VGLA 3AVBA 1GFWB 4FXDA 3I0RA 2UV8G 3PW5A 1EQ0A 4BRIA 3NNHA 3BP8A 2YX7A 3P5TL 1UPPA 4RUCA 1U1LA 3EEQA 4OHWA 4CO0A 3DOMB 4BY9C 4J2DA 1KS2A 4WTYA 2O8EB 3FKBA 2MZ1A 3CUNA 1T3VA 2VFSA 2HURA 3E01B 3NGSA 5B0DA 4I2QA 1VC0A 5CZXA 4CJUA 4CF8A 1QUPA 3FR0A 1DY3A 1U2VB 4PR6A 5HMZA 4LF9F 4FW1A 2B0GA 4DV7F 1U47A 1YJWN 1IKYA 1CS4A 2IVFB 1DQ8A 1UZDA 4ETZA 5KFIA 4YUDA 1XERA 3KNGA 3TAGA 5DS7A 1NRKA 4R79A 2I7PA 5EWFA 2HRUA 3MK6A 4C23A 3UDCA 1VIXA 5DQGA 5J2PB 3VQ7A 3OYNA 2FTRA 2ZH1A 5JJBA 3G82B 2VDIA 4LFAF 3EE8A 3ZNUA 4WXWA 3M8YA 3M7VA 5A6WA 4YEAA 4YY3J 3IKMA 4FM0A 1FF2A 4WYLA 3EL2A 5IT4A 3X3UA 4ITSA 4H5VA 1W26A 2BACA 2C2KB 3SCIE 4B9TA 4BRQA 3OA9A 3KLIA 5HANA 2NCKL 4M3RA 1KC8O 3H5XA 1DTQB 4ZTJA 4LR9A 1XNRF 3VAKA 2B43A 1VCTA 1T7PA 3AA3A 1VQMN 2DGTA 4QIGA 4YDDB 1N5VA 2J6SA 4FWQA 4WKYA 3LF0A 3TTFA 2ATLA 2W9BA 3C6AA 1SQKA 3LZJA 4F4AA 4FF1A 2KXFA 2IVYA 3WHIA 2P9NA 2HB5A 5FIIA 2ZH2A 2CJ9A 5LSRA 1KCFA 4USHA 4FZXC 4ZP9A 2DNGA 3W62A 3J7YP 3WQPA 5KAKA 3R5DA 1X0PA 3OLAA 5E3CA 4OX7A 2GO8A 5A8WA 2VGNA 3HHLD 2EFVA 2QLBB 2P8IA 4AFFA 4Z4FA 4OI0A 3D6FB 4M63A 1VHIA 2HYIB 2R8JA 3G82A 1RDCA 5CABA 4BREA 1NOZA 4DV7J 4CEBA 3G71N 1GTHA 1U2CA 1H98A 1NDKA 4OJGA 3MD3A 1K1SA 4CNYA 2E9TA 2KU7A 1VLYA 5CZVA 2G13A 4CF9A 4JBCA 2V8PA 2O8FA 4E89A 1OY9A 1BQNA 2LXUA 4GY2B 2J8SA 3SI6A 4JKGB 1SJRA 1UVIA 2XS7A 5AQRA 2QFJA 2ZDPA 2VJUA 2MZJA 3M8ZA 2P9NB 2DR6A 4Z2XA 3OUYB 3MFIA 2J6UA 1TK8A 3UDEA 4CESA 3THXB 5LXRA 3V6DB 3RU0A 5HVGA 2PDAA 3SAFA 1OY6A 4GVBB 3OYDA 3N5FA 3CCUN 4HEA9 3VR1A 1U24A 3K8WA 3VMFB 3TA1A 5C2GA 2GNKA 1ASUA 4ETXA 3UKUA 4DV3F 2ZJQL 2Q1NA 2AQ4A 2OAUA 3CCQN 2IPOB 2AEFA 1BY9A 1BMQB 1GTEA 4C0HA 3MEGB 2G2YA 1VQ5N 4LRDA 3V2UC 3MMAB 5IM0A 3DJCA 2Q1LA 4URGA 3W8GA 4JI0F 1TFYA 3Q8YA 3CETA 2E9RX 2V9KA 4R0EA 1S1VA 4P9SA 2W40A 3W1YC 1GLDG 3VERA 1NG9A 3ENOA 3HVTA 2ZM6J 3BDPA 1LW2B 1PGZA 1W97L 4GVMA 2FVRA 1VRQC 1U8WA 3QAEA 3GIKA 1FK9B 4TU8A 3KLEA 3BEXA 2RQKA 1EP4A 3V1RA 4ED1A 3U3GA 3L4IA 2B5JB 3WQTA 1TKZB 3QWUA 3G8QA 2OTLN 2AZ1A 2FHOB 1H2UX 3RG6A 1O0PA 4ZCMA 1RA6A 3AY0A 4FS2A 2D3UA 1D0EA 4U8YA 5L1JA 1N5YB 2VWJA 2ASDA 2Z0GA 1H38A 5AQVA 3K5PA 2BGGA 4GKJJ 4X65J 1R0AA 4JI2J 2UXCK 4AHUA 4JI0J 3MM9B 1NM1A 3CHWA 1JCFA 3MEEB 2DGOA 2YX6A 3SDEA 3V9ZA 4X64J 5CYMB 1B7FA 4O0NA 2E1PA 2KT3A 1GLAG 2GMJA 3U1NA 1SQFA 1HYZA 3QERA 2UXCJ 2VWKA 4K7QA 3BPSP 3MEKA 4DV3J 3NLCA 1FJGJ 3THWB 2OFHX 1FTCA 4HHTA 5F8MA 4M5LA 1SL1A 2NNWA 1FA0A 1YQHA 3P31A 4HH0A 2V7YA 1WB9A 4ISGA 5G0RA 3PYGA 3AVHA 2LLZA 3M8QA 1S4FA 2HKEA 4IEEA 1VMBA 1VR6A 1RQ0A 3AA5X 1GMVA 3P39A 3MUMP 5F3TA 2CH6A 3T1HK 4LY7A 4C4WA 4LRBA 3ULHA 2NSBA 2Y8YA 1VBZA 3N28A 5EX0A 2BVZA 2A3JA 3CIPA 2PO4A 4ED2A 1WHVA 3TAFA 1OKJA 3LP2B 1RHRB 1HBNA 3UDVA 3RR8A 1F5AA 3DDNA 2BTFA 4P7VA 1KN6A 5LL6Z 2WUSA 4FM1A 1M5KC 3NMUA 3K9KA 2VBXA 4WYBA 2QEXN 1VQLN 4L8RB 3EDQB 4U9RA 1U1QA 4ZIWA 5KGXA 4RWXA 5L1LA 1YBTA 1O6XA 2HBLA 1KC8T 4FPIA 1H1VA 3P38A 1HMVB 3F73A 2KZZA 1NH7A 2MEWA 4J5OA 5D0GA 3A0IX 4CZEA 4H4OB 3BPDA 2OUGA 4RNMA 3VAMA 4B3SF 5H1SQ 4H0TB 3DRPB 1N5YA 4CJEA 3WQUA 3TARA 2R7RA 3C6TA 3LDLA 2XSFA 3IGNA 1DZ5A 1VQ7N 4ZK7M 1NHKL 2B7CB 3QESA 2Z56B 2J7KA 3GZ7A 2W41A 4U95A 4EMDA 4DR4F 1TYQA 2DNLA 1KQGB 1RDDA 4KRWA 4ECYA 3ZSVA 3AA4A 4IBNA 3O9QA 3JSMA 4OMFG 2M8DB 4M5HA 1QLNA 2KB2A 1CVJA 3DM2A 4QQBA 1KKHA 4ED3A 3VAGA 1W2IA 2ZEJA 4ZIVA 4J9RA 4HTIA 1B64A 5DZ7A 2MQLA 3ULEB 1NCLA 1R6YA 1VOMA 4LF4J 1NJZA 4USWA 1GOCA 2C2DA 3QATA 5AE1A 4M5DA 1X0FA 4PRFA 4I2PA 2EW9A 3BGOP 3KJVA 4LH4A 4DR3K 3EN9A 3WUHA 3CCRN 1N36F 4OI3A 3VGVA 1LCUA 3J81O 1BLUA 1F1BB 1RU1A 1NNDA 2Q6CA 5F2RA 2DHHA 1LV5A 4DTSA 1F2HA 4EYHB 4RWWA 3T3FA 1MA9B 3HL8A 2FD2A 2VKRA 1KLMA 4DL2A 2C2ZB 1Q81O 1X4HA 3J80Y 4NXNF 2LVWA 2R7TA 2W9CA 1NGEA 3NL0A 2DHSA 3SJJA 3HTVA 5AJ3F 1WEZA 1TYQB 4H5TA 1FXLA 5GADU 4ZVEA 2EXUA 3R9LA 1R8PA 2MKJA 3OL8A 4GKKK 1JJHA 3I55N 5LY3A 4ZLNA 1Y64A 4E1MA 3QRRA 4JKAA 4I68A 3KOAA 4DSIA 2FXUA 4FWPA 4HTJA 2F7TA 3CM5A 4BRNA 2OHDA 2RF2B 1YRXA 2NRZA 4HWIA 4DV1K 3TP2A 2MLXA 3WDOA 4ECTA 4QCLA 1JLBA 3D54A 3R6MA 4FDFA 4B3SJ 1OWXA 2ATQA 4ZPCA 2QTDA 3DM2B 5F0UA 1E6YA 4CVNE 1RGIA 3R1LA 4K8ZA 1JLAB 1VLOA 3VEVA 2VFRA 4UTGA 3V6JA 1NM2A 3ZTQA 4CJ5A 4B3RK 5H1SV 3S9HA 3W66A 5I9EB 2UXDK 2ZH9A 4CP5A 4JI7J 1XWLA 4MYUA 3NCIA 3HHDA 4PQAA 2UXBJ 4ED8A 2GX8A 1NKCA 3CC2S 4KJIA 4IOXA 5AQNA 2P9PB 2P9CA 3IWXA 3D6HB 2Z1JA 1HQ2A 3I31A 4J7CA 4AXIA 2E5GA 1Q7YO 5F8HA 2I0XA 2A41A 3OHRA 1L3TA 2KXNB 1G99A 3FCWA 4PQUB 4FNIA 1BU6O 1RGVA 4Y1DA 5HAOA 4J9OA 2WVEA 4R5PA 4OYMA 2YWKA 2QIFA 3SCJE 2V2VA 1RXOB 1J5EJ 4DV2K 3L2WA 4A8OA 3CDBA 4O3QA 1PYTA 4X4RA 2NRXA 2CPZA 4YFUA 1S9GB 3GIMA 5AQQA 5LMNJ 4BC5A 2M9KA 2X3GA 2OI2A 5K8MA 4BGAA 4QIFA 4WP9A 2VPWB 3CCLN 2YKQA 3E1YA 2HNDA 4NLBA 4QAGA 4XEIA 1IG9A 3OTOJ 3C0BA 1BC6A 5DMRA 2VC1A 2JVOA 2CQIA 4CHQA 4DR6J 5FPEA 5IC4B 4RTFD 2DCLA 3W5ZA 4CLLA 4OLPA 4USJC 6FDRA 3K57A 3CC2N 4H5WA 3T69A 3M2VB 3D7EO 4X65F 1N33F 3E01A 3SUPA 2LEPA 5J2QB 2HRYA 4FJJA 1DEJA 4PG7A 2OP5A 5HQLA 4FZYA 2VKZG 2GVDB 3DNCA 4B17A 2CQ2A 3V6KA 1M1KO 3PY8A 3S8SA 3QBWA 3VQDA 2R42A 2CPFA 1FDBA 4JOUA 2PBDA 1ZBTA 4KKOA 2QWLA 4PEOA 3I82A 3KLHA 1VBYA 2I7NA 3CCVN 2V8GA 1JCGA 3HRGA 2IAJB 3KD1E 1BI4B 2H9ZA 2YWHA 3SQGB 3CC7N 3CMEN 1OH6A 1ICEB 1UJ5A 2W4PA 2XY5A 1UVMA 1E3MA 2DNPA 5FPNA 5AZJB 5GAEP 4KGXB 4N7TA 5KFXA 3TWZA 4QU6A 3BR8A 3BDEA 3F41A 3TSPA 1LOUA 2MQPA 4ED7A 1KWMA 1UFWA 3FFIA 1EP4B 2FY8A 1D3WA 3FCHA 4K2XA 1F0XA 1K8KB 4CO3A 3EE9A 3JTNA 2ZBCA 1FKOA 1EETA 3Q86A 4DPUA 3HVTB 2QWPA 1NJIO 3L2VA 4CFAA 2QWRA 5DM6L 2F8TA 1JKHA 2IOCA 3M8SA 3ID6A 1IBLJ 4LC9B 1KR4A 2JGUA 2XCAA 2ZH4A 3LTOA 2K2PA 3LA0A 2CGJA 3RMCA 3G6XA 2MQNA 3MCMA 3R9PA 2XY7A 2VB6A 2VCPA 4DCHA 2VGMA 4DUZK 3T1AA 3EWGA 5E3RA 4TU9A 4WFXA 1GNKA 5KFYA 3TR5A 4X4QA 2DGWA 2OMOA 5IV3A 2E1ZA 1JKHB 4CLYA 4R0JA 3OHAA 2EKNA 3DKDA 4UT4A 1DARA 1MWKA 4WE1B 4I6AA 1KVIA 2JC0A 4JI3F 2ZE2B 2VOPA 5CE3A 2YNFA 2IVMA 3C16B 3WNHA 4NB4A 4DUZJ 4FJIA 1TVRA 5MAOA 4FWLA 2P51A 3M1VB 4Z37A 1RT7B 4JV5J 3G6ES 4DMZA 2GUPA 1CQNA 2QLJB 2ZUAA 4H54A 4ES3A 1XK8A 5KOXA 2W01A 3W9HA 5K5MA 3G25A 4IYQA 5A8WB 4ZHRB 2IJRA 4UOGA 5LMUJ 2UUBJ 2VQFK 1J54A 2YJFA 2WONB 5BR9A 3GP9A 3QT8A 4NA2A 3GOIA 4JV5K 1D8YA 1OH5A 1R8BA 3PNIA 2CJQA 4TQSA 1RHJB 1H3DA 1X4DA 1NK7A 3VGUA 2H5IB 2H1YA 1WKLA 1F5CA 5J1EB 3AAPA 5KFFA 2AIRB 1ESVA 4ELUA 3RB6A 2K1RA 1RILA 3ASMA 4HTLA 2XYPB 2IRUA 1BCOA 1BQMB 2G0IA 1R59O 1RT1B 2VV5A 1HNWJ 3BKFA 1S48A 4HCBA 4DSKA 4RUAA 2GV1A 2X1FA 5KFDA 3AAWB 4LF6F 3S41A 4DFKA 2UUAF 4UOFA 2ZH7A 3BSAA 4IOBA 3OTDA 1XJWB 1JK9B 3O80A 2DXDA 3PO5A 3TX8A 4DPTA 4C8LA 2DRAA 1N34F 5AQKA 2PAVA 1S1TA 3RSEA 2DHXA 4LFAJ 4C2MA 4CBWA 3VQTA 3DWLA 3IFEA 2AMCB 3TAPA 3MM6B 3C95A 4IH6A 1G7CB 2ERRA 3W64A 2XZWA 1ZBUA 2MSTA 3C65A 4RNHA 4M7YA 4OLOA 1AA1B 1JJ4A 1Q9YA 2HNYA 2J6TA 4M42A 4PUOA 3PX0A 3GB0A 1TL1B 2VG7A 3M2RA 2OD4A 1BXNA 1T9WA 3I4HX 2Q0RA 4GKJK 1Z1ZA 2GCFA 3ILLA 2QMUB 1UVJA 1K47A 1HQUA 3OT9A 3DRXA 2WB4A 4WU3A 3IWNC 1YJ9N 3GONA 5BPMA 3HP6A 1GH8A 3M9OB 5AQOA 1FT8A 1OSCA 2C3PA 2MJNA 3MI7X 4C7QA 2HNZB 4F04B 1GLLO 2UUCK 4HL9A 5T7LA 4FJ8A 3KLGA 4DV4J 4J9NA 4F7VA 4OYZA 4OJ3A 5CAAA 3ILJA 4ZVQB 4B1XB 3MN9A 2ZHAA 3NY0A 1BIUA 2RHKA 4OHZA 4B3TK 1P8GA 2JSXA 2CNKB 3MMBB 1WG1A 4YB5A 2DEIA 4ILLA 1C1CA 1KVKA 4OLBA 1MMNA 4CIGA 3LDSA 1QM9A 2V8VA 2DH8A 1JIHA 3R2DJ 3M8RA 4CW7B 3P96A 3L3VA 1KD1T 1GAOA 3AVJA 1NDCA 5ETVA 1U2RA 2Z2LA 3ISNC 4I69A 2CPDA 4PKHA 4Y00A 1OH7A 2XNQA 2WSEC 2CQDA 1SQGA 3IXQA 3PW0A 4NLDA 2VUGA 2FIUA 1C0TA 4OI4A 5HLFB 5JLHA 1BWVA 1RK8A 2R9LA 2E6MA 1S76D 2RDIA 5DO2A 3AVMA 5M1PA 2KDOA 3R1XA 3KDOA 3M32B 1VC5A 3SPZA 4K43A 1I51B 1IKXB 4CEAA 2QWQA 2HQIA 5KFCA 1FWKA 1YJ9S 3OFEA 1RT5B 1CXUA 3PX6A 3O9UA 2YNIB 3SFGA 1ZM3A 2OA8A 3OJSA 4AD6A 5G0RB 4NYNA 3ITHA 1WN7A 1BWFO 1EKRA 2N7CA 1M5VC 4O4GB 2NLXA 1ITGA 5KFNA 2DFEA 4USTA 3TQ1A 2EFPA 3M8QB 4WK3A 1YTAA 1EB0A 1UWBB 2A1RA 3O9TA 1RT3A 2K8GA 3POTA 2FQQB 1VHFA 3PIOQ 1ZPWX 3CD7A 3T1YK 4KGVB 3WBZA 3CPEA 5BR8K 4AHVA 3DRYA 2RRBA 4FF3A 4K4YA 2OO4A 2E1RA 2CQ0A 2C28A 1KP6A 3LPEA 1FW6A 3MPYA 2D5RA 1AW0A 4CT8A 5L9XA 1YT3A 3L2RA 4MIBA 4XDDA 3DN9A 4MK7A 3GIJA 2J9DE 4M45A 3TVZA 3R97A 5A0YB 1XQIA 1IJFB 2F9DA 4OGEA 1S4EA 1KAXA 3EM1A 4XTTA 1X4FA 5AFUA 4KHMA 5AE3A 4X65K 1S1XA 2B6AA 1H74A 3AFGA 1WAJA 4KH4A 3SMZA 1G1XA 3J7ZO 2RJZA 2Y9HA 4FZZA 4BGBA 1SKWA 4JD2A 1FRXA 4BDYA 4OZ1A 3CCTA 4MK9A 4ECQA 1TV6B 3M3ZA 4YOWA 1SI9A 4Y3CA 2FJVA 4DV5F 3I56N 3AJ1A 3G6VA 3VEXA 2IC3B 2FPHX 3SMSA 4FN5A 3E66A 4OZ3A 1DLOA 4HVZA 4JK9A 3NVKA 3F56A 5AFUH 3F2KA 4ZLPA 3PUFA 2BKPA 3K7RA 3N6LA 1TZ0A 5J2NB 3DDIA 4K4UA 1TV6A 4XPEA 1S6PA 3MMAA 4BRAA 4IZ9A 3MWTA 4I1TA 2ILYA 4GVLA 2KTQA 1T3OA 5I3UA 3GV7B 4HDHA 4RLEA 2QL5B 2CQ3A 1NHUA 2I9SA 2YJEA 3MR3A 1FJGK 4GMKA 4CZKA 1X60A 1YJNS 2HRTA 4WCEQ 2BE7D 1N5TA 3D4JA 2E5IA 4KHRA 3QFWA 2OZSA 4BVOA 3U9ZA 2GHWA 2H54B 5DQHA 1QD1A 1X5OA 1BCMA 2GJFA 3QYYA 5KFSA 1YVUA 3CERA 1R27B 3E9LA 4MKVA 1WOQA 5DGAA 2XMUA 1XNQF 4WQ4A 3VGSA 3I8BA 5LT5A 4YMEA 2HGNA 1NHVA 5F9NA 2NZ4A 3HZ6A 4NCAA 5LMNK 4BROA 1UEVA 2CQ4A 2PMWA 1SH3A 1ZAXA 1FVSA 2HHTA 3OQ2A 5KPZA 3AARA 4I6WA 3ZSZA 3KWGA 3BF1A 4LFCJ 1PILA 2XSJB 2Z2YB 4DU7A 4ANDA 3EZUA 3NWRA 1BISA 2EHGA 4UY8T 1OVYA 4GKKF 4OHVA 1TKDA 4G6VB 1C2PA 3BGUA 2XMKA 3C2PA 3RRKA 3QIDA 1SAZA 2DFFA 4J2EA 4ZPDA 3M8PA 4LFBK 1C0TB 2OMLA 1KOOA 1RU2A 3SV3A 2XMVA 1R3NA 4K0KF 1YJTA 2XMAA 3DHXA 3T1YJ 1V6HA 2ZNYA 4TQRA 3WXJA 4OHYA 5KG3A 3MMVA 2EWSA 1HJOA 2KO1A 3PEHA 4GC6A 4G1PA 3L6QA 1WUAA 2DR9A 4DV5J 2F7VA 3IGVA 1R31A 3SCXA 3GR1A 4NXMF 4DS5A 5KG5A 3G8TA 4V19S 1V3ZA 2JVRA 2R7YA 3MZIA 4M41A 3OVNA 3NWGA 4ILJA 3O3LA 3FLCO 1HWLA 3PJ9A 5FRMA 2D1KA 1DHMA 1LK5A 1D9FA 3UVJA 2IMWP 3ENVA 1UA0A 1UL3A 3TAQA 2JRSA 5AXNA 4KO0B 3SBTA 3P5BP 2F9WA 2DPNA 3TEHB 2MKYA 2BJ8A 3K9JA 2XHBA 2DTJA 3TZYA 3KXDA 4DFMA 4LF8F 2BQ3A 2BE2A 4HR2A 4M94A 1JLEB 3EE3A 1PIEA 1OQ3A 3IFRA 1VK8A 4CLKA 3O4WA 5KQDA 3L3UA 3MXIA 1T3NA 1HBOB 2V51B 3CEDA 2HBQB 2RQCA 3TJAA 1S22A 3WEEA 5IXUA 1S1TB 1S1WA 4DG1A 4JUZA 4UF4A 1SKUB 5F9LA 3CO9A 1FE0A 1HNWF 4CGHA 3N9UC 2DGXA 3CFOA 4B3SK 3GE9A 2N4CA 2XS2A 5D8HB 1QJHA 3ZZZA 4EHTA 1IBKK 3CQXA 3AGKA 2E44A 5KRSA 4DU4A 3U27A 3Q83A 5KFQA 3SFUA 1TL3A 1JLFB 5GMDA 1UJ4A 1T05B 3PFEA 2CH5A 2IYIA 5KT4A 4GKKJ 3NP5A 3PFOA 4FYDA 2IRXA 2XZTB 2Z2MA 3B54A 4J2BA 5FLXY 1NK8A 1WDDA 2UYTA 1C1BB 1HARA 4HYKA 5KPTA 2F9TA 1XHXA 2HVIA 2O5DA 3KUGA 3VF2A 4NE9C 3TTCA 1NJWA 4KTZA 4UW2A 3CC4N 1NPKA 3BYRA 5FJ4A 2ZWPA 1VQPN 7FD1A 2Q6BA 5F0XA 3BN7A 3BR9A 1WSFA 1C0GA 2P9IB 1RKJA 2E20A 3SQ0A 4DUZF 4ELTA 2ZOMA 1LXNA 3FMWA 1ZBSA 3LWMA 1HPZB 1AUSL 2VU5A 3W2VB 4LFCK 1NAQA 2BX6A 4IQXA 2E2PA 1JL1A 2A6OA 4K8RA 2NS1B 2DPJA 4CJVA 1B4SA 3VQ8A 4EP5A 3O3FA 4E7LA 2YNGA 3I4PA 2WOMB 1VQKS 1RDUA 1P8ZA 5A76A 4KY3A 4NLGA 1OIAA 2BW2A 1NB7A 4MQ3A 3D6RA 1VQNS 3SQOP 4CZMA 2RF2A 2ZZNA 3W3SA 3A8IA 3QGPA 2HF3A 1RTHB 1IH7A 4OKKA 2GQQA 2H4WB 3T5HA 3H45C 2V34A 3OL7A 1N8RO 1FNOA 3HM9A 3N4WA 1IBKF 1WF2A 1DFDA 1LWCA 1U1NA 2KT2A 1RTDA 4O3RA 4PY5A 3TAMB 4DQSA 1Y7PA 2HHQA 2BRLA 3O2IA 4LF1A 2R8KA 2ZE2A 4FLWA 2RE1A 2W42A 5A6PA 3OYBA 2X7IA 4ER8A 2BOAA 3AY9A 4LF8J 2CQCA 4F0KA 3BBCA 4DX6A 2DRBA 2HNYB 2OTLS 4H5RA 5FRNA 1WBBA 4DTMA 3ZX3A 4F4ZA 4QPTA 2ASYA 1FKAF 2NXCA 3GCXP 3BGFA 5L46A 3LPUA 4QYZK 4I2PB 2V2ZA 3J7AN 3ENHA 4DV0J 1ACMB 3THTA 4HDGA 2CPEA 2A5XA 1L3SA 2X51A 3DLLL 3GWCA 3EGWB 1KAZA 2LMIA 1E6VB 1F3VA 2HBRB 3CJKB 4K42A 5IFMA 1SJ1A 2MZSA 2C1EB 3WXLA 3D2FA 5E3PA 4ECXA 4W5QA 1M5HA 1TMMA 2IIHA 4IJNA 3NF6A 3NNCA 4ES2A 5F8NA 1IBKJ 1JLQB 1URNA 1EETB 3IDHA 2D0CA 1HBUB 4DSFA 4DR5K 1Q7YT 4OZJA 5F3ZA 1RT6B 5KGWA 4CHOA 3TVYA 2KYZA 1VQ8S 3DLLQ 4MO5A 3FRZA 3QWPA 1IO2A 3VQCA 2M70A 3I0RB 4LR8A 1JJ2R 4LF6K 5HL7Q 3MFHA 3H1QA 8RUCA 2HOEA 1WC0A 1YVNA 3ZSOA 3D66A 4FF2A 1FRLA 4FYXB 1Z05A 4Y2IA 3UD5A 1WOPA 4M3ZA 3QRQA 1MSWD 2RRAA 5HP1B 1DURA 3B6OA 2UU9K 3F9MA 2RT3A 3JS6A 3MWPA 4O44B 5A2QU 1FX4A 5HBMB 3CC4S 3A1YG 2K7JA 4BRCA 2X1BA 3FEYB 1WHWA 2PT0A 5IT9U 3DLGA 1JNRB 2VBYA 3N6MA 5GADI 5B0CA 5BRFA 2EC0A 4CH0S 4KGZB 2VH7A 3Q2SC 3R5JB 4JYAK 2ZZTA 1UVLA 3EYZA 4WQ4C 2EK6A 2RILA 2MPUA 1QZ6A 3BGRA 1CJKB 4O23A 5CHIA 3US5A 5C2FA 4CTAA 4X62J 3FC9A 3KK3A 4AXJA 1OS5A 1BUXA 1UAWA 1RBVA 3MPUB 3VQ5A 5HOOA 1XTZA 5JVHQ 3OYAA 3GMGA 4DCPB 2BKNA 4DR4J 3M1VA 3L8BA 3QGIA 4U67Q 1HHSA 1HX1A 1RWMB 1IKXA 1FRJA 3FFIB 1W25A 2HWHA 1TUUA 2O8CB 3TVKA 2C22A 5C42A 4BRDA 4Y1CA 1U6FA 1ZS6A 4C6AA 2FJEB 1HQEB 2UVVA 4TY8B 2DK2A