3QO9A

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with tsao-t, a non-nucleoside rt inhibitor (nnrti)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
553
structure length
553
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAISQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, hydrolase/inhibitor
molecule keywords Reverse transcriptase/ ribonuclease H
publication title Crystal Structure of tert-Butyldimethylsilyl-spiroaminooxathioledioxide-thymine (TSAO-T) in Complex with HIV-1 Reverse Transcriptase (RT) Redefines the Elastic Limits of the Non-nucleoside Inhibitor-Binding Pocket.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 139
structure length 553
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3qo9A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qo9A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qo9A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qo9A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3qo9A05
5DGBA 3SQ0A 4NLWA 4NLTA 4E19A 3OY9A 2PY5A 1QUVA 3V81A 3VQQA 1BQNB 2WOMA 4QPXA 3C6UB 3ZSXA 4X2BA 2VA3A 5JUMA 3HPHA 2W9BB 2W42A 3TAFA 3ZSZA 2XCAA 2G8WA 4CECA 4F2RA 3H59A 3OL7A 1L3VA 1Q9YA 2KQ2A 4CIFA 1VSEA 3AA5X 4KHUA 4TYBA 4ZPCA 2VG7A 1T3NA 5DMRA 4KHNA 4AHRA 3OL9A 1MU2B 3PUFA 4AHCA 3SV4A 3PY8A 4F4WA 2OPSB 2Z1HA 1BIUA 4HVJA 3BREA 2ZE2B 1NK9A 4LSLA 2RN2A 2D41A 2B43A 4K4TA 3KD1E 4W5QA 3IGVA 4IKAA 3QIPB 5KFCA 2E6LA 2UVWA 5KFJA 3M8QB 1W0HA 4OKEA 5F8JA 3UQSA 1FXXA 3KK1B 1XC9A 1S0MA 2IM2A 4EO6A 3NDKA 4DLGA 3CJ5A 4DTNA 4I2PB 4HCBA 5KT5A 1X1PA 4C8MA 1XR5A 3EYZA 4BE0A 3ZCMA 2FBTA 4DU4A 1XR7A 4ID5B 3QEWA 1C0TA 3QLHB 3N6NA 1TL3B 4FVMA 1NK7A 3ULDA 3PJWA 2JEJA 2YNHA 1S6PA 3DRSA 5KG1A 3CJ4A 4DQSA 4WFZA 3HVRA 2HW3A 4O0IA 2C2EA 4CF9A 3KLVA 5C25A 3DMJB 5EDWA 1BHLA 4CF0A 2ILYA 3NKYA 4Y3CA 3U3YA 3VQ5A 1RT6A 1QAJA 3TR8A 3CWJA 1QQCA 1W25A 1UA1A 4ZP8A 5HRRA 3M8PB 1HQUA 2XRIA 3DOKA 4Q5VA 4IFVB 4TSXA 3L2RA 2R2RA 4F4XA 3ZSYA 2BGGA 3DOLA 3H5UA 3SZ2A 4OKKA 4GMJB 1WLJA 4G3IA 3NE6A 4H4MB 4B9NA 3IAYA 4QWAA 4ZVEA 3RB4A 2IS3A 3G6YA 4EO8A 3DLHA 2C2DA 4I2QB 4CJUA 3VQ6A 3F9KA 1RDRA 4DS4A 4O3SA 4EEYA 1UAXA 1SH0A 1WSFA 1JL1A 2UVVA 2BRKA 2HMIB 1SH2A 2BQ3A 5F8NA 1KSPA 4GW6A 4KSEB 4H54A 4QCLA 4JLHA 3OS0A 1HMVA 3NAEA 1KFSA 1KRPA 3K5NA 4KO0B 3SUPA 1D9DA 3OYEA 5EUHA 5F8MA 4WE1A 3KIOA 4FLXA 3V6DB 4CFBA 4C8KA 4ID1A 1IKWB 5J2MA 2V4RA 2QKBA 3NH2A 4CEDA 3PZPA 4M3RA 4ZVFA 2VWJA 3H2LA 3PW0A 3L2VA 3DM2A 4N41A 2DY4A 3QINA 4CHPA 4M41A 3PW5A 4JRPA 3DYAA 2PYLA 4CHOA 1WSIA 2FLNA 2XI3A 3WNEA 4ICLA 3KJVB 2G8VA 3GV7B 3BDPA 4IG3A 5FDLA 4HUEA 1S9FA 5KFGA 4DTRA 1BL3A 4J2AA 2IBKA 2YNGA 3CFRA 1N5YB 4PQUA 2W7OA 2XI2A 3VQ9A 4Y2AA 2I5JA 3DRPB 1LWFB 3RMAA 2QKKA 2R7YA 3QGIA 2FBVA 4CJRA 4FJMA 5J2PA 4E0DA 4KAIA 1N4LA 4IRDA 4CERA 3IS9A 4FLVA 4MKBA 3P1GA 3NBPB 4Y34A 4E7IA 2YKNB 3QETA 1XHZA 4M3UA 1JXLA 5CY4A 3LPTA 4URGA 3FFIA 3LALA 3QO9A 3OHBA 4J9SA 1VRTA 1L5UA 4GC6A 3OYNA 2OPPB 1LAWA 4KB1A 2HNDA 1RTJA 3QNNA 2QE5A 5I3UA 2J6TA 1S5JA 4RNOA 1Q8IA 4PY5A 3KLFA 3VQSA 1RT3A 3TI0A 4KTQA 2O5DA 1S4FA 2BQRA 3HPGA 3KHHA 1RA6A 3QGGA 1QS4A 3OL8A 4HCCA 1C1BB 1QE1B 3K2PA 1C1CB 1U09A 1S1VA 2R8IA 4O4GA 5K14A 2RF2B 4CHQA 4KV8A 1EP4A 4ELTA 2WONA 1NHVA 4FYDA 3WNHA 3M9OB 4CHZA 2QXFA 2IOCA 4KFBB 3ISND 3OYKA 4EBDA 3KK2B 4DSKA 3UPFA 3OS1A 5J2NB 4Y1DA 3MXJA 5J1EB 1JLEB 4CEBA 3MAQA 4M94A 1NK4A 1TKTB 4PUOB 3I0RB 4E7HA 3TVKA 3AVNA 2DFFA 2ZKUA 3O4QA 4CGDA 3GYNA 1LV5A 2A1RA 3AO2A 4I7FB 4OL8A 1KHVA 3RB6A 3KK3A 1LAVA 5D3GA 4CJEA 4DMNA 4CEQA 3EPGA 4N56A 4NLQA 3UR0A 1XWLA 4J9MA 3HK2A 3HPOA 5KFTA 1BIZA 3ZSQA 1ZYQA 4B9VA 4NLSA 2C22A 2X6SA 4FM0A 1A5XA 2AJQA 1J5OA 4FLWA 3GV5B 2YNIB 3OYJA 1U04A 1S1WB 1ZETA 3U6FA 4IG0B 4Z4EA 2IAJA 4DFJA 1KLMA 4WFXA 3ITHA 3D0PA 2Z1GA 2OZMA 5L1JA 4IR9A 1J53A 4KRFA 3OLBA 2GBZA 3V9SA 4CGIA 5CYMA 3H98A 3L8BA 2E9RX 4BWMA 1HPZA 4FLTA 4WYWA 3LDSA 5KFPA 2F96A 1KCFA 4G1QA 5C24A 2XY8A 2OPRB 4NCGA 2R8HA 1BCMA 3NH1A 3LAMA 3SFGA 3DLKA 4K4YA 3OYMA 4CJWA 1IKVB 1N48A 4C8LA 4QWDA 3G10A 3BGRA 4B9LA 4E7LA 4Q45A 5EWFA 3LWMA 5JS2A 1DLOB 3MFIA 2WRMA 1IKXB 1L3SA 2HVIA 3AVKA 4FK4A 3V9XA 4IKFA 4C8OA 1K1SA 1HQEA 1K6YA 5L9XA 1S1UB 5J2QA 3HVTA 3AO3A 4ECRA 3NGZA 1LW2A 4ED2A 3BSOA 3M9MB 3VA0A 1DTTB 4ZVGA 4CJFA 4ZTFA 3SPZA 2V4QA 1NHUA 1ZBFA 3VQPA 5KFFA 1U4BA 4IQXA 3LP1A 1FKPA 2B6AA 1NK0A 4K50A 3UDLA 2P5OA 2CKWA 2QK9A 3QNOA 5JS1A 3PX4A 1O1WA 2BQUA 4XIUA 2FC0A 1LWEB 3ISNC 4RW9A 1T7PA 4CJVA 1GOCA 3EZ5A 5SWMA 2G8HA 1D0EA 3CFOA 3QYYA 4DG1B 1TQLA 2GIRA 2HHWA 1NK6A 4F4YA 1RAJA 1JLBA 2RDIA 5HRPA 3TANA 2BE2B 3MXMA 4Y1CA 3L2WA 2HHUA 1WSJA 2KTQA 5FRNA 2F8SA 2R2SA 4CF8A 1EETB 1RT2A 5HP1A 3BQ1A 4DQQA 4F3TA 3TWHA 1NK5A 4DTSA 4FZXC 4DSFA 1S1XA 2GV9A 2ASJA 4AHUA 3LANA 3V4IA 4OKJA 4CJSA 4FS1A 2R2TA 3MEEA 2Z1IA 1SUQB 2YNFB 5T14A 5L1IA 4FJNA 2G8FA 4HHTA 1JL2A 1VSIA 3K5LA 1RBUA 3F73A 1HNVA 4TY8A 3OL6A 3NF6A 4LSNB 2IDOA 1SL2A 1S9GA 1D5AA 3ZT2A 2IJNA 4E1NA 3IG1A 5L1KA 4YR0A 3U3GA 4M3WA 1S6QA 1WNSA 3CQ8A 3H08A 3AVGA 3KKSA 3ZSRA 3DDKA 5KG0A 4IFYA 2E9ZA 4ECXA 3WNGA 4F8RA 3NHGA 1S48A 1CXUA 1T03A 1D8YA 4CF1A 1C0UB 3JSMB 4CIEA 3V6JA 3I5CA 4B3OA 3MR6A 4FW1A 3TARA 4FM1A 1NKBA 2XHBA 5KFHA 4DTPA 3LAKA 1KTQA 3CYMA 4IRKA 1DTQB 3AVAA 1TL1B 4FCYA 1C0TB 3DLGB 3GV8B 1VK0A 3CIZA 3HL8A 1RDDA 3KHRA 5DQIA 5HLFB 1S10A 3OYAA 3M8SA 2FLLA 3DRSB 1JLGA 1CLQA 3HO1A 3HHKA 4TQRA 4ED6A 4YMEA 1NJXA 1TKZB 4O44B 4IBNA 1RILA 2OPQB 5C25B 1TKXB 4K4ZA 4CEFA 2JEFA 3NCIA 2W9AA 1ZBIA 1JLCA 4DWIA 4RW4A 4TQSA 3E51A 2ASLA 1YTAA 4CHYA 4FJJA 4FZYA 4JRQA 1VSFA 3BSNA 2EX3A 5T7BA 1JXBA 4I9LA 5KFEA 3CVKA 4E7KA 1FK9B 3HYFA 3FQKA 1D9FA 2ILZA 4F3OA 1HYZA 1QSYA 4KKOA 4LD0A 1N56A 2FBYA 1REVB 4CJQA 2VG5A 3T19A 3PVXA 1L3TA 4NLYA 1VRUA 1VSMA 3TABA 1ZBLA 2DFEA 5KFSA 3KMSA 3KLHB 4DFPA 2HHQA 4DSEA 3P83D 1Y97A 2RKIA 5CYQA 2V9WA 5C42A 5JXSA 2XC9A 1SKRA 4QAGA 3AA3A 2IM3A 1HMVB 2OYQA 3KLGB 2KZMA 3AV9A 4ZPDA 2C28A 1NKEA 3Q8RB 4Z4HA 3KHLA 1CZBA 3SQ1A 2Z1JA 3T5KA 4DSLA 3OYIA 5KGWA 2W8KA 4HTUA 3RB0A 3ZT3A 2NUBA 4OLAA 2W9BA 2J6UA 3P5JA 2WK4A 3GQCA 4WXWA 4ECWA 4B8CA 5KFVA 3NF9A 4FZZA 3IRXB 4FJLA 4Y2CA 4O3OA 4ZPBA 1OS5A 1LWCA 4Q0BB 4W5OA 4RW7A 1R0AB 4O0JA 1TVRB 1RT1A 3DYAB 4AILC 3NF7A 3AA4A 5FROA 1WSEA 1U49A 1MU2A 4ICLB 3KLIB 4IDKB 2JEIA 4RW6B 4K4UA 4KHQA 4DEZA 4XPEA 3L2QA 2ZE2A 5HRNA 1N6QB 3CDEA 4OGCA 2VG6B 4KHYA 4J9OA 2I5JB 2HNYA 4MFBB 4YFUA 4EP5A 3KK1A 4CEAA 4PWDA 3B6OA 5KFMA 2E9TA 3VA3A 3OYLA 1JKHB 4KI4A 3T5JA 3LP0B 4I2PA 3H5SA 5KFNA 2O4IA 1VSDA 3RBEA 5KGXA 4BE1A 4ID5A 3QLHA 2X74A 4FK2A 3QO9B 5KG4A 3E01B 4N76A 4IH5A 5KFBA 4MQ3A 3MEDB 3KLEA 4CFAA 4E1MA 2FVRA 3AVLA 3T1AA 3DLBA 4ELUA 4ECYA 3JYTA 3SFUA 4W5NA 3DMJA 4QW9A 1S1TB 2B4JA 2HNZB 4K4VA 2IC3B 2HAIA 2I1RA 5KT7A 3RMCA 4RNFA 3M8PA 1S0OA 3RRHA 4ZP6A 3PV8A 4OPJA 4DF8A 4IFVA 1BGXT 3NF8A 5EWGA 4H4MA 3MR5A 3PR5B 2ZD1B 4DTXA 3V1OA 1RT5B 4Q8EA 4CJTA 2P5GA 3K5OA 1ASWA 4YQWA 4KREA 3HP6A 1KVCA 4I2QA 2W9CB 1RT4B 4LH4A 1SL0A 2B5JB 3NMAA 3KK3B 4QWCA 4ZHRA 3CJ2A 4E3SA 1TKDA 2D7SA 1K1QA 1I39A 1GOBA 4B9TA 2HMIA 3SI8A 3I8DA 3RR7A 3BSAA 2P1JA 3OHAA 4KO0A 1JLAA 4O3NA 4AHSA 3PR4A 4MKAA 3PX6A 4HYKA 3V9WA 1YT3A 3V6DA 4FM2A 1VSHA 1BQMB 1IKWA 5KFWA 3C6TB 1BCOA 3SQ4A 4IH6A 3ITHB 4M3TA 2XCPA 2BANA 3QERA 2D0AA 1HNIB 1U48A 4YR2A 3SV3A 4E7JA 4JV1A 3LP3A 4F4ZA 1C2PA 1GOAA 2VWKA 3NFAA 4ECVA 3I5AA 4NCGB 2CJQA 2PYJA 4R5PA 4I9QA 4FBTA 2ASDA 3DRPA 1ASUA 2GC8A 3DI6B 3MECB 4JS5A 1LWFA 4FJGA 4H4OA 1T94A 3SI6A 1S9EA 5KFXA 4CCHA 3S9HA 1ITGA 1ZTTA 4EYIB 3SPYA 5C5JA 3NBPA 1QSSA 1X9WA 3PO4A 4CIGA 2XY7A 4Q44A 3TAMB 4FLUA 2YKNA 4CJPA 3MR2A 3HJFA 4WZMA 2WTFA 4DQIA 5KT4A 1JXEA 1QTMA 3AO4A 4J9LA 3NAIA 3OJSA 1RTDA 4LH5A 1TV6B 4U7CA 3VQDA 4CK2A 4NLGA 3CFPA 2R2UA 3QZ8A 4CF2A 2FVCA 2RDJA 3PJXA 4WYLA 1WSGA 3AA2A 3TQ1A 1C1BA 4K8ZA 1QE1A 3LP1B 1GX5A 2D3ZA 1FKPB 3ZT1A 2QV6A 3OYDA 1KVAA 4M3ZA 4IOBA 2R8GA 3ASMA 4B9MA 3AVFA 4YP3A 2ATLA 2RF2A 4KTZA 1SH3A 2FBXA 4DL4A 1SKWA 3DRRB 2XGQA 2A1SA 4RW9B 4LQ9A 1YVUA 3S3MA 4M3XA 4KFBA 2P51A 1TK0A 3KK2A 3BJYA 2AU0A 3LP2B 5J2NA 3VN5A 4JUZA 2FJWA 3VQ4A 5J1EA 1JLEA 4O5BA 3K58A 4DU3A 4CJKA 4R8UA 4ED1A 1TKTA 1FKOB 3I0RA 1D1UA 1HYSB 4NLPA 3V1QA 4DF4A 3QIOA 1CXQA 2V0NA 4I7FA 2DPIA 1KVBA 1SV5B 1WAFA 5CZ1A 4B9SA 5HROB 5DG7A 4ED0A 1WAJA 4CE9A 4RG8A 4XPCA 5E41A 3S3NA 4QW8A 2D3UA 4ELVA 1X9SA 3NH0A 3MEEB 3QGHA 1RT7B 2FLPA 5HBMB 2HB5A 3V6KA 3RTVA 4UQGA 4DL6A 1BI4A 5KRSA 1B9DA 3NAHA 4CK1A 3TAGA 1WNEA 3RRGA 1BISA 4K4SA 5FRMA 4DTOA 3S3OA 4RW8B 5KFYA 2IM0A 3GIKA 1S1WA 1JLQB 1W9HA 2ATQA 2C2RA 1RNHA 4FXDA 5KG5A 1IO2A 1TK8A 3I0SB 3DLEB 1T03B 1RTHB 3BR9A 2Q3SA 1TK5A 3RB3A 1LW0B 3LZJA 1NOZA 3QEIA 2JC0A 2HVHA 1G15A 4FLYA 3QEVA 4MK9A 1T05B 3MF5A 2OPRA 3N6MA 4KHRA 2Y1JA 1ZBUA 3K59A 3V81B 4B9UA 3Q8SB 1MMLA 4ED8A 3V6HA 5KFRA 3HVAA 3MFHA 2WCXA 3H40A 1IKVA 2WOMB 4BDPA 3SUOA 2VA2A 2J6SA 1QHTA 3G86A 2IJFA 4U6PA 1TGOA 4J9KA 5KG7A 1IKXA 1RYRA 4CHNA 5DQHA 3KOAA 2BDPA 4JV2A 1GX6A 4NLOA 4TYAA 3MXIA 2VG7B 1S1UA 1JLCB 2YKMA 5KG3A 1UA0A 1NOYA 1RDCA 4GC7A 4DTUA 4DSJA 1UWBA 1DTTA 4LSLB 3VQBA 1S49A 3HT3A 4N5SA 3HXMA 1U47A 1WSHA 1IH7A 4JS4A 5KFZA 2XO7A 2R8JA 3AVJA 4L8RB 3D5MA 3FQLA 4ZPAA 3OJUA 2O4GA 2D0CA 3RMBA 3CDWA 3BQ0A 2OA8A 3B6PA 2JC1A 1A5VA 4CEZA 1TAQA 2UVRA 4IH7A 3H5XA 5DLGA 3OYHA 3RBDA 3LWLA 5EU7A 2RKIB 1XHXA 2YNHB 4CJ4A 1RDAA 1S6PB 4DG1A 2F8EX 4NYZA 1YTUA 1Z25A 3L2UA 1YVFA 3RAXA 3AVHA 4DLEA 2UUWA 4ZTJA 5KT6A 2BE2A 4FK0A 2X78A 4EBEA 4ECQA 4DQRA 3QESA 1RTIA 4BDZA 1EETA 4NCBA 4WFYA 2IGIA 4K8XA 4M42A 4OPKA 1RT6B 4NYFA 1JLFA 5HRSA 3TAPA 3A2FA 3T5LA 4WXOA 1SUQA 2YNFA 1IM4A 5DG9A 4FJ7A 1HQUB 1LWCB 4RW7B 3DOKB 2FVPA 5I42A 3GIJA 3DOLB 1RT1B 1XR6A 4ED7A 4LSNA 4FJKA 3EY1A 4Q8FA 4HKQA 3M8RA 1Z26A 4FJ8A 3QEPA 4KTWA 1S97A 4KB0A 5SZTA 4EZ9A 3AVBA 3BQ2A 4TXSA 2HNYB 4NRUA 3MEGA 3VQEA 4LY7A 2GIQA 4PWDB 4EBCA 1C0UA 3JSMA 3C95A 2WHOA 2RPIA 4FLZA 4Z4GA 3UIQA 2KZZA 1IKYA 4XO0A 2ITGA 3D45A 4QWBA 3OLAA 2G8UA 1DTQA 3DLRA 1TL1A 4MIAA 3DLGA 4KE5A 4F50A 1QAIA 4WE1B 1BQNA 2E4LA 3C6UA 3G0ZA 1EXQA 5HLFA 3CJ3A 4J9QA 3OYCA 5J2MB 4M95A 3K5MA 1KHWA 3KLEB 3PHEA 3DM2B 1TKZA 4O44A 3JYTB 2OPQA 3KD5E 1TKXA 3NGDA 2R8KA 5KFUA 4KAZA 3RAQA 3EPIA 5DK5A 4DQPA 2GUIA 4IG3B 3ZSWA 2OPSA 5FDLB 1VSJA 4M45A 2UVUA 1CSJA 1QSLA 4N47A 2YNGB 5F8LA 4PQUB 1HARA 4CJLA 4RU9A 3QIPA 1FK9A 1ASVA 3M8QA 2AX0A 3ZSVA 1J9AA 5J2PB 3IS9B 3ZT4A 1REVA 3RMDA 1SL1A 2AX1A 1X9MA 2IA6A 5KG6A 4ECTA 4FJXA 1C0MA 4FW2A 4RNMA 3BSCA 2ZQBA 3KLHA 4B08A 2E6MA 2HWIA 1TL3A 3FFIB 4KPYA 1IG9A 4ZHRB 5KFIA 1F21A 4KHWA 4ED3A 1VRTB 3OYBA 2IM1A 4DL2A 2HNDB 3O3GA 1RTJB 4W5RA 3KNAA 5I3UB 4Z0UA 1RBSA 3KLFB 1RT3B 3KLGA 4IR1A 5KG2A 3VQ7A 1JLAB 3CO9A 3SUNA 4DFKA 3HP9A 3PW4A 4Q43A 3AVMA 2PZSA 1S1VB 4MIBA 5F8IA 4O4GB 4C8NA 3SYZA 5K14B 3CM6A 1I6JA 2BANB 4NRTA 3IRXA 3GIMA 4KV8B 1EP4B 2WONB 4Q0BA 5F8HA 1R0AA 3TAQA 4O55A 4M3YA 3ICLA 4ZP7A 4DS5A 1TVRA 4ZMMA 1SKSA 3HM9A 4NCAA 2YHBA 2HHXA 4Z4FA 2Y1IA 2G8KA 3KLIA 4IDKA 4RW6A 4CK3A 1RBVA 4EP4A 4OVLA 1C1AA 3M9NB 4DTJA 4RZRA 3CJ0A 4R5PB 4AHTA 1N6QA 2VG6A 3T3FA 4K4WA 3H4DA 3LPUA 4H4OB 4MFBA 1S9EB 4J2DA 5D3GB 4BWJA 3K57A 4H8KA 1JKHA 3HVWA 4AHVA 3LP0A 4BE2A 2AGPA 1U45A 4DL7A 3RWUA 2G8IA 3HSTB 1ZBHA 1J5OB 3E01A 2HHSA 1RTDB 3PX0A 2IAJB 3MEDA 5EWEA 1RBTA 3CG7A 1KLMB 4CFCA 3LZIA 2AGOA 3CDUA 3G6XA 1C6VA 4URQU 4TY9A 4BDYA 4QWEA 4DL3A 5CYMB 4URSA 4DL5A 1S1TA 3IN5A 1HPZB 1XI1A 2HNZA 4W5TA 3EZUA 3SCXA 3L3UA 3KJVA 4OLBA 2JLEA 4NLUA 1B92A 2IC3A 4G1QB 1Z4UA 2F8TA 5C24B 2KW4A 3ZT0A 3THVA 2FVQA 1HYVA 3FRZA 1N5YA 3DLKB 3QEXA 1NJZA 2FJXA 1RDBA 3I5BA 3AO5A 5KI6A 3ZSOA 5KT3A 5CZ2A 1L3UA 4CGJA 3BGRB 1RYSA 3PW2A 2ZD1A 4CGHA 1RT5A 4FJIA 2FJVA 5KFQA 4Z4CA 4R8UB 4HUFA 4YNQA 3GIIA 4HUGA 3OSNA 2W9CA 4FJ9A 1RT4A 1HQEB 5J2QB 3HVTB 2B5JA 4J9RA 2ETJA 4WZQA 4J2EA 2W8LA 1LW2B 1CZ9A 4QOZB 2LSNA 3SJJA 2OPPA 4NYNA 5DGAA 4O3PA 2HWHA 3OVNA 1BI4B 1NNDA 2UUTA 4FBUA 3OS2A 4NLDA 1C1CA 2IMWP 2B6AB 5F9LA 2KFZA 4CJ3A 4E89A 1BQMA 1UOCA 3C6TA 3FDSA 3SNNA 3MR3A 4F2SA 3KHGA 1NJYA 3N6LA 2OH2A 3WNFA 3H5YA 2D5RA 1HNIA 5KFKA 4TN2A 4RUAA 5KFAA 2HHVA 4ZP9A 3MTKA 3AVIA 3KKRA 3SUQA 3D28A 4CJ5A 3VQAA 3O4NA 1JLBB 4B8AB 2XY6A 1HRHA 3G6VA 3O3FA 3AVCA 4PUOA 1I3AA 3NGYA 4CGGA 1RT2B 5HP1B 4ECSA 3O3HA 1EX4A 3NL0A 5KTQA 4OJRA 1VSLA 3DI6A 4EYHB 4FJHA 3MECA 4TLRA 1S1XB 2JEGA 2HHTA 5DQGA 3V4IB 4IRCA 4KB7A 4F4KA 4KHSA 3FSIA 4CFDA 2JGUA 5KFLA 4J9NA 2BRLA 3TAMA 3NGIA 2XY5A 1HNVB 4TY8B 5KT2A 2AQ4A 2YKMB 3RR8A 4LQ3A 4GVMA 2AGQA 1S9GB 3L3VA 3PW7A 3GILA 4ECZA 3VQ8A 1Q9XA 1ZTWA 2YNIA 3ALYA 1UWBB 1S0NA 3IG1B 4NLXA 4IG0A 1TV6A 1A5WA 4KI6A 1S6QB 1VSKA 4J9PA 4DU1A 4MH8A 3KMQA 4O3QA 5F9NA 2WB4A 4Z4IA 4IFYB 2XGPA 4J2BA 4FS2A 4CGFA 4RNNA 1JX4A 1TAUA 4NZ0A 4B3OB 1RCHA 3HKWA 2KFNA 4BACA 4ECUA 4EZ6A 2XWYA 1NK8A 5KFDA 3DRRA 1HJRA 2ALZA 4CEOA 1J54A 3LP2A 1KFDA 2DPJA 1JLGB 3QIDA 2FVSA 1DLOA 3KTQA 3Q8QB 2YHAA 1FKOA 5KFOA 1KLNA 1HYSA 3OYFA 1RTIB 2EHGA 3T5HA 3OSPA 3VQCA 3V1RA 4JV0A 4CEEA 1SV5A 5HROA 4RW4B 3AO1A 1JLFB 1TP7A 4DSIA 1NKCA 4CESA 4NLRA 4K4XA 1RT7A 2YV0X 3V9UA 4PA1A 5DG8A 5HBMA 2W7PA 5DLFA 4YR3A 4MK8A 5I42B 5L1LA 2BR0A 1JIHA 4KKOB 3TAEA 4R0EA 4DTMA 2D0BA 3OYGA 4DFMA 4RW8A 1RBRA 4O4RA 3H4BA 3Q8PB 4OGEA 4NLVA 1NJWA 5KRTA 1JLQA 2VG5B 4RUCA 4O3RA 4MK7A 1VRUB 3SQ2A 3C94A 3IGNA 4AH9A 1LWEA 3MEGB 3PO5A 3V9ZA 3QZ7A 3I0SA 5F8GA 3DLEA 4KHMA 1RTHA 5CYQB 4RNHA 4ZVHA 2DTUA 5C42B 1LW0A 3CM5A 2X6NA 2AWZA 1B9FA 1WN7A 4FJ5A 1IKYB 2DFHA 1T8EA 2EC0A 4KBIA 1EKEA 2OZSA 1T05A 1RA7A
chains in the Genus database with same CATH superfamily
4I6MB 3V81A 4HL9A 4WFAQ 3VQQA 1BQNB 5F3TA 3LPYA 4I6YA 2GMHA 3TTDA 2VA3A 5JUMA 3HFKA 3HPHA 2W42A 3TAFA 1WOQA 3K7RA 4F2RA 1XMOF 3H59A 1D4XA 1NBEB 3OL7A 1BQXA 2QA4G 1BO5O 3AA5X 4BS2A 4TYBA 3BO3A 4RWWA 1U26A 5D77A 2DPNA 3CCZA 2ITMA 5DMRA 5K8MA 3SV4A 1U1LA 3HF5A 2OPSB 2Z1HA 1BIUA 4EHUA 3VQTA 2F3JA 3MM5A 1UJ4A 4JV5K 3AHPA 5KFJA 2SXLA 1W0HA 1UTAA 2CZVC 2VONA 5F8JA 2WZ1A 2WBMA 4N8NA 1RWXB 1S0MA 4DLGA 4ZVPB 1K9MO 4HCBA 2QEXS 4OX7A 4OX9J 3EYZA 1VHFA 4BE0A 1G7CB 2C3OA 4F0MA 1XR7A 3H25A 2HQGA 2QL7B 3LM2A 2GEMA 3IWLA 2B8PA 1RKJA 4FWLA 3PJWA 1RHMB 5BR8J 3UCGA 3K89A 2C2EA 4K0KK 1VJWA 4GNIA 1BHLA 3D9BA 3BEGB 2ILYA 1WUAA 2GGPB 2CGJA 2IYGA 4MLEA 4GKKK 1QAJA 1R8AA 1W25A 2Q36A 5HRRA 2C42A 2FGCA 3IKMA 2BGGA 2R2RA 3Q2SC 1BWEA 1JWWA 4OKKA 3SK3A 4H4MB 1KVKA 3W7BA 4C0HA 4DV5F 1ZAWA 3J7YU 1RHKB 2MLXA 3CIMA 2G2YA 4X64F 3U1LA 1HIYA 2DNQA 3WEEA 1HNWJ 4RUBA 2UZAA 3NLCA 2UXBK 3G71N 1RDRA 2OEKA 3BN4A 4B3TJ 3UKUB 4EEYA 3CC2N 2LU2A 1SH0A 1RADB 1NH7A 3BKFA 5F8NA 3WZ0A 4HR2A 4A47A 3JAMU 2PA8D 1V3SA 1S12A 2E1MC 3Q8YA 3RW6A 3I56S 1TU0B 3OYEA 1IBCB 3R6GB 1RB0A 2LDIA 2CPHA 3KIOA 2OI2A 2AW0A 4FWKA 3O80A 4GV3A 4JI8F 1H72C 4LJMA 4M3RA 4OYAA 3L2VA 3DM2A 5LXYA 4U7UK 1HR0F 4CHPA 3VOVA 4OZNA 4LFAF 3MMVA 2CQ4A 2GWJA 1PAEX 1X3MA 2PYLA 1WSIA 3VGVA 2XI3A 3WNEA 3MMAA 3BDPA 5KFGA 2FC9A 2IBKA 2VWBA 3IWXA 4Y2AA 1VI7A 2I5JA 3ETOA 5DETA 2QKKA 3QGIA 3RW7A 2VGMA 4W98A 4FJMA 7AT1B 4IRDA 1U8SA 2Q2RA 1XEZA 5BJRA 4RWTA 1Z1ZA 1H2UX 2HQFA 3ZO7A 1NSQA 2P9CA 2MKKA 1XHZA 1JXLA 4NLCA 1NMDA 4E2FB 2CWKA 4KGXB 3NWRA 4J9SA 3CCES 1LAWA 4ISEA 4DHVA 2BW2A 2QE5A 5I3UA 3H8YA 1S5JA 4PY5A 1FFSB 1RT3A 4Q2MA 4OX9K 3HPGA 4QBUA 1RA6A 1NG9A 1PC5A 3OA9A 1UW4A 2HFOA 4WP8A 3W2WB 2R8IA 3AARA 3UNGC 2CPYA 2MGZA 4JI6K 1XQIA 4CHQA 4KV8A 1EP4A 4ELTA 4XH4A 2QXLA 2LMIA 4CHZA 3Q2TC 2IOCA 3MMCB 4ZJOA 2ZJQL 1IN0A 4EBDA 1CJTA 4BVOA 2NS1B 4LRAA 2VHGA 3FZLA 5M1QA 1JLEB 2X1GA 5D4LA 1CQNA 2ZVSA 4OHYA 2P2CB 4E7HA 4BRHA 2DFFA 3N9UC 2A1RA 3BH6B 2O01C 2MDAA 1RWPB 2JNJA 4DUTA 3IM9A 2DO4A 5CH7B 1XWLA 1S6UA 1NGEA 4PG7A 3HK2A 2HRUA 4OI2A 3MCNA 1BIZA 3ZSQA 3SSQA 2EXUA 4QIWD 2C22A 4FM0A 1A5XA 4QQBA 1AB8A 3U7JA 3GV5B 2GUPA 2YTCA 1U04A 1LEOA 1S1WB 1ZETA 4IG0B 4BRNA 3QB0A 4ZPTR 2VPWB 4WFXA 1X4BA 2OZMA 1VQNN 1WF1A 1GXUA 4IR9A 4CYUB 1Y4ZB 3A8JA 5DZ7A 3H98A 5FLXU 3L8BA 1K8KA 1HPZA 1AW0A 5A2QU 1TZ0A 2QLJB 2HBJA 2D3OR 2OPRB 3LAMA 3J80U 3G10A 4LR7A 2IA0A 1R8HA 1FRIA 4B9LA 2QTDA 1N5TA 4DI6A 1YI2N 2VKRA 1DLOB 3CDBA 2JOQA 1XTZA 2WRMA 2BOPA 4HHUA 2MQOA 2HVIA 3AVKA 4AL6A 3I31A 3QNWB 5L9XA 2XMMA 2GNKA 4PYDA 3AO3A 4YDUA 3THYB 1CJUA 5ETNA 3R1HA 1LW2A 3CPEA 3CSKA 2O8EB 1R59O 1YIJN 1DTTB 3ZZPA 1URNA 2V4QA 1F2HA 2JLGA 1IWAA 1NBWA 3CCUN 5DM6Q 4B3RF 3B4DA 3L0QA 5KFFA 2O66A 3AD9C 1U4BA 2B6AA 1NK0A 1VBXA 1NEEA 4XTTA 4X4UA 5AQUA 4UUWA 2YKOA 2FC0A 4RW9A 1T7PA 1GOCA 1N34F 3EZ5A 4E8UA 3BZKA 1D0EA 5G0RB 1TQLA 2HHWA 4AQYK 4FXVA 2CAJA 4LIRA 3PYFA 4V19X 3MXMA 4Y1CA 3L2WA 1RHUB 3P5TL 2HHUA 4FXWA 5FRNA 3ZFVA 2HOEA 1EETB 3DXBA 1JJ4A 3BQ1A 4DQQA 3TWHA 5E3QA 4AXIA 3THWB 1HWIA 3V4IA 1IJEB 1P1LA 2MQPA 3WXMB 4WCEQ 2NRHA 2Q1NA 1SUQB 2YNFB 3RZAA 2CJ9A 2OP5A 2QSFA 5AQHA 1RBUA 1OIAA 4NEYA 4X65K 4CH7A 3DXSX 2DGOA 1J6ZA 4DX6A 1BLUA 4KIAA 3LDNA 4E1NA 3VF4A 3C2PA 3IMQJ 2XHCA 1BE4A 3U3GA 1Q95G 2NXNA 1VC6A 4LF7J 1CBKA 3KYLA 2WVEA 1FW6A 3AVGA 5KG0A 3D68A 5BRFA 4ECXA 3NHGA 3NGUA 2RSQA 1T03A 1D8YA 2HPUA 1WTBA 3IUCA 2AJ4A 2HQDA 3V6JA 1WC4A 3TARA 1NKBA 2ZZMA 4FM1A 2N7YA 2XHBA 1FXRA 5KFHA 2P6TA 3LAKA 1FRLA 3AVAA 2RHQB 1C0TB 2P9UB 1Q53A 5DQIA 2W01A 5BPNA 3OYAA 3CCJS 2H4WB 4DZDA 3NEKA 3HO1A 4ED6A 4QOTA 5HMWA 1MNEA 1RGVA 5M1FA 5C25B 4K4ZA 4CEFA 3NCIA 2W9AA 4JHDA 3GBTA 4JI7K 4DWIA 2CQPA 2HFNA 2Q97A 2ASLA 2LCWA 5J1PA 2DISA 2PT0A 3E3XA 4PG4A 3M7VA 5T7BA 1JXBA 3OTBA 2XLJA 5FPEA 2VQFJ 5AQXA 4KYZA 1Q18A 2H54B 2NZ4A 3HYFA 4DX5A 2IDLA 3J81j 1KR4A 3GOIA 2DXFA 3TZWA 3D1QA 3LDOA 3R97A 1YZ6A 3WIVA 4NLYA 4KGMA 1EARA 1ZBLA 1T02A 3CCVS 2DJWA 3KLHB 2BJDA 2ZH8A 4F7VA 4M63A 2B3TB 3MMBB 3OFHA 2P6SA 2XC9A 1M0SA 1UPMB 1RWOB 1RSCA 4QAGA 3CMQA 3AA3A 3KLGB 4ILHA 4ZPDA 1R0BG 1NKEA 1LOUA 2ZBCA 2DR7A 1CZBA 3SQ1A 3T5KA 5AQGA 2W8KA 2HLTA 2DBBA 3ZT3A 5F41A 2MQLA 2OFHX 2NUBA 4OLAA 2W9BA 3P5JA 3NF9A 4FJLA 3F5TA 4Y2CA 1LWCA 4A46A 3ID8A 1TVRB 3DYAB 1REGX 3NF7A 5FROA 5A8KB 3L4QA 2CZ4A 1XMQF 4XK8C 2JEIA 4ID8A 4XPEA 2CQHA 5AE2A 2ABYA 1VQ5S 4KHYA 3FGVA 4LRBA 5LL6d 4J9OA 3BGOP 1GXLA 3CQYA 1EAYC 3BKTA 4FPIA 2XEXA 5KFMA 3M2VB 4KI4A 4QIVA 3T5JA 2O8FA 1S99A 5KFNA 5AQZA 2F8MA 4IOAQ 3CUNA 3HHNB 5KGXA 2HF3A 1HNXK 3JAMO 2X74A 4FK2A 2V6AA 2W4PA 3C46A 2VFTA 1RLDA 2YX7A 4IH5A 5KFBA 3K2YA 3ILJA 3KLEA 4E1MA 3AVLA 1GMVA 1KDNA 2WBNA 5HN0A 4USIA 2C2OB 3JYTA 4W5NA 3DMJA 1Q82T 4QW9A 4HVZA 2JL9A 3PKMA 1YJ9N 4FYXB 1WHXA 4NLBA 2ZZTA 5KQ8A 1IBKF 2FGOA 3PV8A 1N88A 4DF8A 2QC3A 4KJIA 4KHPK 2ZVIA 3B8HA 4CO1A 1X4AA 3V1OA 5HJXA 1RT5B 2VQEK 3K5OA 4UQTA 4KREA 3HP6A 4ES1A 2RS8A 1R3NA 3VEVA 1Y0HA 3FMWA 1Q5VA 2JWKA 5KAKA 3KK3B 4QWCA 4QJVA 4ZHRA 1GOBA 3P8BB 1PKUA 2HMIA 3I8DA 4B3MJ 1FNXH 1E6VB 4KO0A 1JLAA 2HRYA 1U0SA 4O3NA 4JKDA 3MX2A 2N3OA 1NAQA 3MCOA 2A0FB 4K8RA 4AUKA 2QT7A 3BBBA 2VYPA 4BC4A 3CJCA 3SQ4A 5FJ4A 3ITHB 1R8BA 2CADA 2GAHC 4GKJF 2XCPA 3QERA 3I87A 2PA3A 1K73O 1FDBA 3D66A 1HNIB 4AL7A 4YR2A 4TLQA 1MROB 4RLEA 1DEJA 3HM8A 4KH6A 2XULA 2VWKA 4A8WA 1RWVB 3OTOK 5B0DA 4NCGB 3AQOA 1UEUA 2IIHA 4DR1J 3SMPA 2UUBK 2ASDA 3HI0A 2EVZA 2Q3PA 5HMYA 4FJGA 1SXLA 5KFXA 3LW5C 4DR7J 1DAXA 3K0SA 3NBPA 2QTWA 1QSSA 1NM1A 3PO4A 4CIGA 4Q44A 1ZM3A 4GVLA 3MR2A 4WU2A 3VEZA 5BYRA 3EX7B 2ZJPQ 2PIIA 2XSJB 1JXEA 4A57A 1QTMA 3AO4A 1J27A 1KD1O 4I56A 4LH5A 4U7CA 2E44A 2R2UA 3GTYX 3PJXA 3BN7A 2RDJA 4A61A 2N82B 2MJUA 2RVJA 3AA2A 4F0KA 1WELA 1C1BA 4B1WB 1NWKA 4BRIA 3A3OB 5FLXO 1RWNB 3AVFA 4YP3A 2FBXA 2O8CB 5B0BA 4EK2A 2XGQA 3QQCD 4C1NI 4OO1J 1RAEB 3T69A 3S3MA 2K7JA 2E1CA 5GMEA 3BJYA 3VQ4A 2G13A 1RKIA 2BZ2A 2FZCB 4ED1A 1GMWD 1FKOB 3I0RA 4TNOA 5CCMA 4DV7K 2DPIA 1VQ8N 4UOCA 2DR6A 4B9SA 1R43A 1WAFA 5CZ1A 5DG7A 3TTCA 4ED0A 2J4RA 4RG8A 4XPCA 2Z58B 1BA0A 1RCOB 3U4LA 1HUXA 4AYBD 2X3DA 1UKUA 3MEEB 1HBNB 3M30B 3D2EA 3UKRB 5HBMB 3CE8A 2HB5A 3W62A 2DGQA 1U2RA 3FUYA 3NAHA 3TAGA 6FDRA 1BISA 4K4SA 1M1KO 1XC3A 2GO9A 3VAHA 3E1YA 1JLQB 1VQLS 3CJKA 1H38A 3VVUA 4YOEA 1O6XA 3ENOA 2E5LK 1YJNS 1AYEA 4MO5A 2KRRA 1BUXA 2MQMA 1TK8A 1TK5A 5A8WA 3RBXA 3RB3A 3N0VA 2BM0A 3VZIA 1X0PA 1ATRA 5D4PA 3ZEUA 3EVWA 5U47A 2R7QA 3N6MA 4KHRA 4NXMK 2Y1JA 2IIRA 3K59A 3V81B 1MMLA 3V6HA 3HVAA 3MFHA 3H40A 4FWRA 2MZ1A 3SUOA 1ITPA 1QHTA 1UFWA 2IJFA 4DZ6A 5A8RA 4J9KA 2VPZB 5CZVA 4K7QA 4U7BA 1IKXA 3UD5A 3T1YF 4CHNA 4MKVA 2BDPA 3FRYA 1VQ7N 4BRGA 1NUEA 3QICA 4BC3A 4BQLA 1JXVA 1GX6A 4NLOA 3A13A 2XYPB 4X66J 2OCEA 2GQCA 2FY1A 4DR3K 1SAZA 4GC7A 4DSJA 3G9CA 4F9OA 4EUVA 5HL7L 4FF2A 3MM5B 3LGHA 3GMGA 2YX4A 3MPYA 3HT3A 2LVWA 3CCLS 3NRBA 3C7NA 1W2BM 1DY3A 4DV3J 4L8RB 3D5MA 3RYLA 3FQLA 4ZPAA 3TOQA 3BQ0A 1N52B 1QZ5A 2OTLS 1FRHA 4IH7A 5FPDA 1NDKA 3GB0A 2GTDA 1FDNA 2GW8A 1GLEG 1XHXA 2HBYB 3DKDA 1RDAA 3FFKB 1YTUA 2FHOB 1Z25A 2EKNA 2BE2A 1PILA 5JVHL 5HJYA 1U0HB 3EE8A 2H51B 1U1MA 4WFYA 2IGIA 2DTJA 4M42A 4F3MA 3PSFA 1YITN 2C2KB 4NYFA 4M5DA 5HRSA 3TAPA 3A2FA 3F41A 4WXOA 3OTEA 4DV2K 3DN9A 4JI4J 2D4WA 4LSNA 2R4FA 3Q8UA 2BABA 4CLPA 1JJCB 4CRJA 3J7YI 3WEEB 5DO2A 4KB0A 2NRXA 3FR0A 3I4PA 5SZTA 1U24A 2BMBA 5BN9A 2I0XA 4USUA 3H42A 3VQEA 4LY7A 4RR5A 2GIQA 1FD2A 2CQ2A 4EBCA 3HZGA 1VHXA 1V9OA 2KI2A 4FLZA 4Z4GA 3ZZRA 3UVJA 3TX8A 5KQDA 2ZUGA 5E2QA 5BREA 4JOUA 3OLAA 5IT0A 3R5DA 1DTQA 3DLRA 1MWYA 4L73A 4KE5A 3GZ7A 1QAIA 4Y2MA 2F1FA 5HLFA 4M95A 3JS9A 4CZHA 4WFBL 2DITA 2NSBA 3DM2B 1TKZA 1FFWB 4FNIA 5H9EK 1GLAG 3TPQA 1TKXA 3ILOA 5GAEP 5KOXA 3CCSS 1BUPA 1PIEA 2VFVA 3D2FA 3D0IE 2R8KA 1Q7YT 1KAXA 5FIIA 2P5VA 2GJ2A 3MMAB 3RAQA 1M5VC 5DK5A 3BB5A 4DQPA 2R7TA 3VEOA 1Q7LB 4M45A 1QSLA 3ZETA 1Z05A 3EGNA 4Z2XA 1DT9A 3AAPA 3CJBA 2QMUB 4YOYA 1ASVA 1KS2A 3M8QA 1DJ0A 4PWWA 4QYZK 2R7SA 2HBRB 2ZJQQ 4P6QA 1N36J 3SBTA 4JI3J 1SL1A 4JI2J 3CJQA 2RQCA 1IQZA 3TUZC 2IA6A 5KG6A 2OMOA 4FW2A 4QYRA 3JQKA 5JVGL 3H20A 3HZ6A 2E6MA 4M5IA 4KPYA 2ZH1A 4KHWA 4ED3A 4DV3K 5B0AA 3OFFA 2IM1A 3O1WA 4FYVB 3O3GA 1IR1A 4I4BA 5I3UB 4Z0UA 1RT3B 2B9XA 4IR1A 4DPUA 3FZHA 3PKYA 4G1IA 4IJNA 2E2PA 1ZM4A 3L7PA 3AVMA 5KOWA 4MKYA 1NGJA 4K25A 5F8IA 4MIBA 1U1PA 2HFSA 3CJ8A 3SYZA 3S01A 4BG9A 2A3JA 1GTHA 3CM6A 5ETKA 4U8YA 1ZM2A 4NRTA 4KV8B 1EP4B 2XS2A 2GELA 4HLBA 3JB9k 4NCAA 1CJTB 1GAOA 4B1YB 1IBMK 3M8WA 3IDHA 4IDKA 2M4MA 2BE9B 1RBVA 2H48B 4OVLA 1VAZA 3G25A 1CEZA 4ZCKA 4CD3A 2OD4A 3KFWX 2E8AA 1Q8LA 4H4OB 3ZZUA 4R25A 4J2DA 4JD2A 3OFEA 3K57A 4OZ0A 2PI5A 1PBAA 3BPSP 2E2QA 2DRAA 2NXCA 4HI2A 2ZGZA 1U45A 1ZS6A 3A8IA 3EICA 2N4CA 1X5TA 3HSTB 2E29A 3UCUP 1RBAA 2L9WA 2EFOA 3MM6A 4J7CA 1SQKA 2EKYA 3PHTA 1F0XA 2ZH9A 3CG7A 2F4VJ 5GIOA 2DHHA 4TY9A 2HIYA 3UE5A 4QWEA 2WVFA 1FI4A 1S1TA 3HHEA 4ZVRB 4LF8K 4Z7YA 1HPZB 1XI1A 4YN3B 2HNZA 4W5TA 3EZUA 4OLBA 3KJVA 1KQFB 1V5VA 1B92A 1Z4UA 2EBGA 1PSDA 2W40A 5K20B 3IMXA 2HHHJ 2W2MP 3TSQA 1H7XA 4CLLA 1N5YA 1XBWA 1Y5LB 1RDBA 5KT3A 3LDLA 2F65A 4Y65A 2ZD1A 2V9KA 2FJVA 5KFQA 4Z4CA 4PXBA 2HZVA 4FJ9A 2IVYA 1S7HA 2W9CA 1RT4A 4FPRA 2E7XA 4JI5K 2WUSA 2B5JA 1I1GA 1CJUB 1HNZK 2W8LA 1LW2B 1CZ9A 2P9PA 2ZH4A 2OPPA 3T6BA 4O3PA 2HWHA 1QQNA 3OVNA 1WOOA 4DV1J 1BI4B 4FBUA 2HBMA 3GFHA 3UD4P 4KRWA 4FWNA 2HMPA 3R5AA 4CO4A 3W1YC 1YHQS 2B6AB 2C2MB 4CJ3A 4HDGA 1Y10A 2VIHA 1GLLO 2ZWHA 4CLSA 2D5RA 4RUAA 2HHVA 4ZP9A 3MTKA 3ZYYX 3T41A 1BWFO 4AXJA 3VQAA 4B8AB 4WQ5A 3G6VA 3AVCA 4PUOA 3NGYA 3D6FB 4UOFA 4A8OA 2GHVC 1RJJA 3PYEA 4ECSA 4WQ5C 3L6QA 1GLBG 3UE2A 3DI6A 3DGPA 4EYHB 1W7WA 2P9LB 5DQGA 3V4IB 2XHWA 3K5PA 4KB7A 4IRCA 4DDFA 4DV6F 5AQRA 4GV9A 2JFDA 5KFLA 1I94F 2HSTA 3TAMA 1PYTA 3CHWA 3NGIA 2XY5A 2E7WA 3MPDA 1HA1A 2YKMB 2BTFA 3EGZA 5LMUK 3L3VA 2LA4A 3PW7A 3GILA 1YJWS 1Q9XA 4DUYK 3BS9A 3HULA 1UWBB 4CO5A 1NH8A 4XEIA 1TV6A 5AXNA 4ZS6A 1Y64A 4UT4A 1WC1A 4WQ4A 4DU1A 2M70A 4LF4F 4LF5F 2JZ5A 4Z4IA 2CPFA 3O3LA 3BYPA 2UU9J 2VODA 4WQ4C 1FJ7A 2QLBB 1JX4A 1UW9A 4NZ0A 2KFNA 4JYAK 3FLCO 4PXDA 4RWXA 3MD3A 5C7PA 3DDNA 2F4VK 4LF6K 2QW9A 2DHAA 1KN6A 2QO3A 2P9KB 2MQQA 1J54A 4ZJQA 4DR5F 5EY4A 2AEJA 2DPJA 1NRKA 3NS6A 1F6TA 2ZOGA 4USWA 1SQGA 3OYFA 1RTIB 2OTJN 2A2CA 4PQAA 4JHDB 1S59A 5HROA 5CHIA 2RDDA 3TJ8A 3FEXB 1RT7A 3CF5L 2DD8S 1VGYA 1VQOS 2YV0X 1E3MA 2W7PA 2NREA 5IV3A 4MK8A 2YI1A 4B1XB 2W6LA 3M1FA 1W2BR 4R0EA 4PXCA 3TNVA 2D0BA 3GCXP 2H3GX 5C10A 4KH0B 3AB2B 3NXZA 1ZAXA 4RUCA 2B4OA 4N77A 4O3RA 5EXWA 4CT8A 1VS3A 1LWEA 3W2VA 3L95X 1DZ5A 1SJQA 1HBOA 3I0SA 4HDHA 3DLEA 4USJC 1RTHA 2X6NA 4CZEA 4FJ5A 1CLFA 3QSYB 1XK8A 1EKRA 2OGUA 4M5KA 5DGBA 4ANDA 4MYUA 2QL9B 1NGCA 3HBTA 2IJRA 3TUJC 3S6EA 2V8PA 4X2BA 4WK3A 3J7Z5 1RAOA 2MZQA 1JMTA 2KJWA 2W9BB 5FPMA 2CIMA 2XCAA 3KJNB 3IR7B 1RAGB 1Q9YA 1VK3A 4JI1J 4CIFA 1U2VB 4C0OC 2DHXA 3I55S 3VGLA 4CZLA 3RU0A 3E8OA 3PCOB 4AHRA 4H0TB 4BC9A 4AHCA 1SJ4P 1FRXA 3BREA 5MAOA 2EFGA 4JI0J 1NK9A 2Z2MA 3SCIE 2B43A 2Y1LB 3IGVA 4IKAA 3QIPB 1JNRB 2E6LA 4X4PA 2UVWA 3AT1B 4LRCA 4B3SJ 1FXXA 4LF1A 3NVKA 3NDKA 4CI0B 3VAMA 3CJ5A 5KT5A 1X1PA 2CQDA 3ZCMA 2QLXA 3BGUA 2FBTA 4DV0J 3N6NA 1TL3B 4ZPWR 2BBEA 1N5VA 1FVSA 1APSA 1S6PA 3DRSA 5KG1A 3AGRA 5KPRA 3O8MA 4O0IA 5AQTA 1EB0A 4J8FA 3DMJB 4RJVA 4YORA 4IO1A 1YTYA 4ZVOB 1J2VA 2CG4A 4LRDA 5IWAJ 3RG6A 3TR8A 1QQCA 1UA1A 4LBHA 4B9QA 2ACMA 3J7YP 2FHJA 3L9ZA 3OXLA 3LOUA 3L2RA 1D8ZA 3ZSYA 3DOLA 3EN9A 2V63A 4GMJB 3NE6A 4G3IA 4LF9K 1NU4A 1KTVA 3IAYA 2E88A 3BZQA 4QWAA 4BHQA 3RB4A 3G6YA 4EO8A 2L48A 2C2DA 4CJUA 3P4IA 1OMSA 4Q7AA 3QBWA 1U2CA 4K5SA 1WSFA 1F2GA 2VBZA 3O1LA 2ZWOA 1FWLA 2BRKA 5C2FA 4NASA 2HMIB 1KSPA 4KSEB 1ZBSA 3G8QA 1KFSA 4KO0B 3NY0A 1RABB 3SUPA 1D9DA 2A6OA 2GVDA 5F8MA 3O8WA 3NGKA 2AJFE 1FTCA 4PKHA 3PZPA 3Q86A 1JQGA 4ZVFA 3PW0A 4N41A 2LU1A 2DY4A 3QINA 3PW5A 4HTLA 3EJMA 5M1NA 2QWPA 4DR4J 4DCOB 4ICLA 3MCPA 2G8VA 3NGSA 3U1MA 3GV7B 5FDLA 1S9FA 4DTRA 5IQQA 1YG0A 4USVA 3M2UA 3T7ZA 3CFRA 2XI2A 3VQ9A 2V68A 4DR6J 4IO9L 1PJ5A 2R7YA 4E0DA 1N4LA 4CERA 1OQ3A 3IS9A 4FLVA 3NBPB 3CERA 1CC7A 3RAMA 1LKZA 3IBCB 4JI0K 4E7IA 3QETA 4JNEA 1C4AA 4M3UA 4LREA 2UYTA 1ZPWX 3LPTA 4I0WA 3FFIA 3LALA 4TU8A 3OHBA 4ZJLA 5HQ8A 2QWOA 1HNWF 5LMNJ 1SS6A 3CMAN 4JKEA 4OYZA 4RNOA 1X7VA 2ROPA 3TI0A 5ELZA 3HHDA 2GA7A 3L3CA 1QJHA 4B3TF 4YOUA 1QS4A 2XWXA 2LLZA 1C1BB 4FP9A 3K2PA 4DR2K 2F9WA 1S1VA 3QPIA 5K14A 4KGZB 3PACA 4MIWA 5M1PA 3QMQA 2JRSA 2AYMA 3WNHA 4F25A 4HHJA 1QAXA 2GQ2A 8RUCA 4Y1DA 2B7CB 3I4HX 4KR0B 3CC7S 1XNRK 3T1HK 3I0RB 5AZIA 4ZN1A 2ZKUA 4BRDA 4LMZA 3AO2A 4OL8A 3KJQB 1KHVA 2N3LA 5D3GA 1AFIA 1YKWA 4CJEA 3VMFB 4CEQA 5HAOA 5BRHA 1WDTA 4N56A 3UR0A 3IFEA 3D2EB 4OI6A 4C8YA 3L09A 3BUZB 4H0PA 4NLSA 2X6SA 1NSKL 3UFCX 4FLWA 4OQJA 4HH1A 2XLKA 5LJ3Y 3D0HE 2DCUB 4Z4EA 3CJKB 5LJ5Y 1KLMA 4B17A 1CVJA 2M8HA 5L39A 1VCTA 5HL7Q 3BGFA 5B0GA 2GBZA 4BWMA 4NZ6A 2RE2A 1CJVB 1XNQK 3LDSA 2F96A 1KCFA 1Q86O 3ZEUB 3OR2A 4DV4K 3JQJA 1VQ5N 3CO0P 1HJOA 4DU7A 2R8HA 3DLKA 3OYMA 4CJWA 1VQPS 4X62K 4EGLA 4QWDA 3FZFA 3H3NO 2KDOA 5JS2A 3FSXA 2QL5B 3MFIA 1HW9A 1L3SA 1IKXB 1FE4A 3JQMA 2F9JA 4FK4A 1Y5NB 4C8OA 1K1SA 1K6YA 5JVHQ 5J2QA 4CLKA 4ECRA 4P72A 9RUBA 1GEHA 3H1VX 2MY8A 4U9RA 3BSOA 2BJ9A 3HRGA 2AD9A 1VQ9S 3VA0A 4DUZK 2MYFA 4WTYA 3SPZA 2RMLA 1IV0A 1EZZB 1Z2ZA 5HOOA 1ZBFA 3H3OB 4CZCA 1UFKA 1M1HA 5L38A 3C7NB 3VQPA 4IQXA 2M2BA 1FKPA 2B0GA 5LOQA 4K50A 1U1QA 1K47A 2CKWA 1AUSL 2QK9A 2J0XA 5IT9Y 1O1WA 2BQUA 1NPKA 4XIUA 4QS9A 4CJVA 4P2MA 5SWMA 1CS4A 2K3IA 3QYYA 4A8XA 1N8RO 1JLBA 2RDIA 2BE2B 5K8NA 5LT5A 4PYAA 2E20A 4OV6A 2F8SA 1YUWA 2R2SA 2NXEA 2DXEA 3QAUA 4LFCK 4F3TA 4BGBA 4DTSA 3ET6B 4L75A 4OZ5A 4DSFA 4AHUA 4M5DB 4CJSA 3QT6A 1KOOA 4A59A 2BYCA 5ETLA 4FS1A 1OVYA 2R2TA 3OBWA 4YS2A 4YY3J 3VHQA 2WVDA 3FBCA 2MB0B 4QZVB 3EE3A 3GG1A 2IVNA 2UXDJ 4LSNB 2IDOA 3VCDA 3VGUA 2JDJA 1S9GA 1Q5YA 2IJNA 3HSJA 3KWGA 4A4JA 2ZHBA 5L1KA 3MHYA 1S6QA 3MCAB 2JJ4D 3CQ8A 3LM9A 2J9EA 5T7LB 2KKHA 3H08A 3DDKA 2E9ZA 2VCPA 3GL1A 1CXUA 1YWXA 4CZIA 3KK7A 4OI0A 3MM9A 2LQBA 3I5CA 4B3OA 5K8PA 3POTB 3MR6A 5ETTA 3UVJB 2D9OA 4DTPA 2YY3A 1DTQB 1AZSB 4FCYA 3GV8B 3M05A 1VK0A 1DRZA 1OH5A 3CIZA 4MYTA 3KHRA 5JVGQ 5HLFB 1B99A 3M8SA 3QJLA 1WEZA 4TQRA 3A0IX 3X3UA 3QSIA 4YMEA 2HLUA 1NGGA 1NJXA 3PIOQ 1TKZB 4FOIA 2C3UA 1RILA 1TKXB 4BC7A 2OSQA 1R31A 5A0YA 1ZBIA 1RTZA 1XQSC 1JLCA 4ZLNA 4RW4A 1YTAA 4FJJA 4FZYA 1SC3B 4L76A 3O6WA 5DM6L 2M9KA 3U02A 1IWGA 4PKIA 4E7KA 2UUAJ 1X9JA 4CW7B 1QSYA 1N56A 1R89A 2GHWA 4P2XA 1EWQA 4LT6A 4CJQA 4UTGA 2VG5A 1FJGK 3QFPA 5KFSA 3KMSA 4DFPA 1HW8A 4DSEA 3TZYA 1OYEA 1Y97A 5CYQA 2DNYA 3HHLC 3KDOA 1KP6A 1NCLA 1DHMA 3ZTPA 1HMVB 4LF7F 1T0TV 5JMVA 2ZBQA 2XNQA 3OUYA 2C28A 1XMOK 2OIHA 4M5NA 2Z1JA 4DSLA 4WCEL 1G1XA 2M88A 2DNMA 4FKYA 3THPA 3CXCM 3GQCA 4B8CA 4FZZA 4OJ1A 2DNPA 2DVIA 4ZPBA 5GMDA 4W5OA 2O8DB 5AQLA 3C19A 1OY8A 2DRDA 2IY5B 4C3KA 1MU2A 3N4WA 4IDKB 2PMWA 2R3VA 3W9JA 1HD1A 3TUPA 4K4UA 2UUCJ 2ZE2A 4FKXA 3DJCA 5HRNA 3PNIA 5D78A 4YFUA 1X4EA 4JD2B 2KXHA 2D0OA 3GU0A 3KK1A 4M1KA 4PWDA 3KG0A 3B6OA 3B8AX 2VQFF 1C0FA 3RUBL 4OI1A 4IEIA 5EVZA 4CZMA 2W41A 5ADZA 3AA8A 3QO9B 4F0HA 3JSBA 5E3AA 4N76A 3MM6B 2YKAA 2NPIA 2RRAA 1K8AO 4CFAA 4JP8A 4GO7X 2AEMA 4ELUA 4ECYA 2NRTA 5AQYA 1S1TB 3ZX3A 2EWSA 3SCLE 1NSAA 4HT5A 2LXFA 3L4IA 2HNZB 2CG8A 3VTHA 4K4VA 4DV5K 1O0PA 5AZJB 3RMCA 4X64K 3M1VA 2V67A 3M8PA 3RRHA 1S0OA 4OIXA 3FK4A 2P9IA 4U7UD 1FHTA 2V8VA 4FWQA 4K2XA 3H2UB 3CD6S 2ZD1B 4BR9A 4YQWA 3PFOA 2OEMA 4LFBJ 1KVCA 2W9CB 1RT4B 4RTFD 1RXOB 1P6TA 3C6AA 2B5JB 1R8CA 1J5EJ 3CJ2A 4E3SA 2P9PB 1WBDA 2V2QA 4IWVA 2HYIB 2JSXA 1RUSA 2A1BA 2Y0BB 4RL1A 4JI8K 3BSAA 3M2RA 3OHAA 3QBXA 1N54B 3PR4A 2BW7A 3PX6A 4HYKA 1HR0K 4LFAK 3V6DA 2UP1A 5C0YA 1OH7A 1VSHA 2H5EA 3VAIA 5GIPA 2KVQE 4IH6A 4M3TA 2BANA 4OMFG 2NLWA 4ISGA 4DCHA 1B64A 1VK8A 3E2EA 1UJ5A 3SV3A 3CB4A 1TUVA 1C2PA 1N32J 1GOAA 1BWVA 3NFAA 2PYJA 1MA9B 4R5PA 4I9QA 3B6BA 2HHPA 1G4CA 4J37A 3DRPA 1OVQA 2A6MA 5D8HB 3DI6B 4A5BA 1LWFA 4UUXA 2V7YA 4CCHA 3S9HA 2BKPA 2J7UA 2BUNA 5C5JA 1X9WA 3M5RA 2CNNB 3TAMB 4X62F 2HFZA 2UXCJ 2RD5C 2HEKA 4DQIA 4M5JA 3E66A 1N34J 2QFJA 2ZITA 2G9OA 1RI7A 3R7SB 3NAIA 3OJSA 1Q0NA 4HTJA 1TV6B 3VQDA 4CK2A 1B7FA 4NLGA 3Q89A 3CFPA 2FVCA 4WYLA 3HTVA 5E26A 3CF5Q 5D15A 1FTRA 3MUTP 4K8ZA 1QE1A 5AXLA 3LP1B 2D3ZA 3ZT1A 4M3ZA 2F63A 3CETA 3ASMA 2NPFA 3W66A 2A1SA 4LQ9A 1BDGA 4C0BA 3W8PA 1YVUA 2JVOA 4KFBA 2CXEA 3KK2A 5J2NA 3D4JA 3VN5A 4JUZA 1OPZA 5J1EA 2MLYA 4DU3A 4CJKA 4FNHA 1NSPA 1TKTA 1OY9A 1D1UA 4OHZA 1OH8A 2YWEA 3V1QA 4DF4A 3QIOA 3BBCA 4I7FA 4ZIWA 2AA4A 1KVBA 5HROB 3DOMA 1VQ4S 3KUEA 3BF3A 1E4GT 1KC8T 4QW8A 4GVBA 3J7ZO 1X9SA 3NH0A 4BRQA 1RT7B 2FLPA 4JV5J 3MDQA 3DHXA 4YUDA 5IT4A 2Z0GA 4B02A 3OV7A 4DL6A 1N33F 4CTAB 4CK1A 3RRGA 1WNEA 4OX6A 3QT8A 2LQ9A 2R9LA 4DTOA 3D6MB 2ATQA 3K9KA 2C2RA 1KXPA 1RNHA 3MAHA 4LVNP 3QRQA 3W2VB 1HBOB 3I0SB 3DLEB 4JKGB 1RTHB 1P90A 1AFJA 4JK8A 2HVDA 2QLFB 3QEVA 4MK9A 4BG8A 4JK7A 4K0KJ 1WC0A 5EX3A 2J0WA 1DBDA 1IKVA 5B0EA 1GH8A 2XG8A 2NRZA 2VA2A 1U6ZA 1NZAA 4NO7A 1F5AA 3OTDA 4H5RA 2ZJPL 5LL6Z 4JV2A 2FSKA 4FZVA 1S1UA 4B3RK 1NOYA 4ZVUB 4UOGA 2Q6BA 4CWBA 4OI3A 1OPIA 2UXBJ 1NDCA 4NE9C 2A2DA 3HCXA 1XERA 5J1NA 2XB2D 4N5SA 1CG2A 3H1QA 4UY8T 5I4MA 1WSHA 1Q81O 5DDPC 1IH7A 5KFZA 2XO7A 2XZTB 4H0XB 3OJUA 3RMBA 2QSWA 4RPFA 1WC5A 3KUGA 3B6PA 2JC1A 4CEZA 4H4KA 1TL5A 2ASMA 1HLWA 3D6HB 2O1PA 3OYHA 3T9ZA 4LRFA 4H4KC 5AQMA 2RKIB 3NS5A 1ELOA 2WVCA 2BEFA 3VV2B 1OSCA 3MM7A 5HK4A 1S6PB 4DG1A 2B4UA 2DNKA 2XSFA 3L2UA 5H9FK 1YVFA 1NLKL 4KPCA 2VFUA 2UUWA 3Q8VA 5KT6A 4FK0A 2X78A 5BYQA 4DQRA 1AT1B 3QESA 4NI2A 1YK9A 3NOCA 2CQ3A 1VLOA 3DGVA 3MXHP 4OPKA 1LWXA 1JLFA 2X3GA 2J5AA 3T5LA 3TZXA 1WHYA 1IM4A 3WXIA 4RW7B 3H7HB 4MLHA 4C2MA 3GIJA 1HBUA 3IA0A 3DOLB 1RT1B 1XR6A 3JSYA 4BCAA 3N79A 3IXQA 1YVNA 3D1HA 1Z26A 3DRXA 4FJ8A 4FDFA 2YX6A 2PC6A 1S5ZA 2KU7A 2EFNA 4X66F 4TXSA 2HNYB 1NXIA 3UWTA 2DHGA 3CCQN 3W3SA 2VPYB 5FPNA 4EI2A 4IO9Q 2ATCB 2KZZA 1IKYA 4XO0A 2LEAA 3CT9A 3AH6A 2CQGA 1B4SA 2NZCA 3DWLA 4WK1A 2MXYA 3P3DA 2GVDB 4F50A 1BQNA 5BXIA 2E4LA 2DB1A 2CPZA 2HBLA 3IR6B 3CJ3A 3OYCA 2MJNA 4K5RA 5GADU 2W7AA 3K5MA 3SXLA 3CXCR 1A7GE 4JI6J 4CLFA 2NUUG 3VAJA 4O44A 3KD5E 2DR8A 1VQNS 4JKAA 4Z94A 1SCJB 3EGWB 4ZDNA 4C9DA 1EHWA 5EHHA 3OW2M 2GUIA 2EFQA 2OPSA 5FDLB 3CD5A 3CULA 1VSJA 1HI0P 2AF6A 3M2UB 4BY9C 4OYBA 5SUHA 1HD0A 1HARA 3M32B 1RAIB 1HX1A 4OHXA 3QJJA 2E5GA 2AX0A 1BG3A 3BM7A 1J9AA 3R27A 4I68A 4HTIA 3IS9B 4OJ3A 1REVA 4KH4A 4H0VB 2ADBA 1GLCG 4RNMA 1K9MT 5BPLA 1U6FA 4V19J 2ZQBA 4B08A 2YKQA 3FFIB 4WF9Q 2ZHOA 3EO3A 2Q43A 2P9GA 2BA9A 3VGMA 1KBRA 3TVZA 1GK8A 1YIJS 4EHTA 3CO9A 2FY8A 2BJ8A 3MPUB 2CUYA 1GMUA 1I3OB 3R5GA 3CCUS 1KQKA 3UNYA 1S1VB 4C8NA 3ULEB 5K14B 1XMQK 2DHSA 3FC9A 1I6JA 3EL2A 2WW8A 3IRXA 1CULA 2XS7A 1VFJA 2HGMA 2ZBPA 2LFVA 4Q0BA 5F8HA 2EPIA 1R0AA 4C8ZA 3TAQA 3ICLA 4ZP7A 2KO1A 3HM9A 2HHXA 4YB6A 4DCPB 2Y1IA 4DOZA 4JN4A 4RW6A 4CK3A 1HKCA 1C1AA 5C15A 4RZRA 4AHTA 1N6QA 3JTPA 5AZIB 5AQWA 1S4EA 3NS7B 5K9FA 5AT1B 4CDIA 4JKHA 3LPUA 4MFBA 2XMAA 3UKUA 1S9EB 2MQ8A 5D3GB 4Y00A 1FRKA 3UN2A 3HVWA 4AHVA 2A10A 4C11A 2X1FA 2MLZA 4WBFA 3RWUA 5F0UA 1V4TA 4OJHA 5LSRA 2YX1A 1ULRA 1N36F 2IHR1 3LL3A 2HHSA 4JI3F 3AOBA 1RTDB 1VIXA 3B54A 5M2RA 5EWEA 2IDEA 1RBTA 4XH5A 3GFYA 1KLMB 3LZIA 5AQFA 2AGOA 1IBKK 3MD1A 3G6XA 1C6VA 5ADXH 3G4SS 3I55N 3Q83A 4BDYA 4PXEA 4JK9A 4URSA 3JTNA 3QWUA 3GJSB 3IN5A 2DNNA 4AQYJ 4PAAA 3QJPA 2IC3A 3OR2B 2FF3B 2W24A 1WD6A 3ZT0A 4BLGA 3FRZA 3DLKB 2P9SA 3F56A 4ZLJA 3QEXA 2X7IA 3AODA 2FJXA 3I5BA 3AQPA 5KI6A 3ZSOA 5CZ2A 3QRPA 4CGJA 1U1RA 2BOAA 4J9VA 2LQ8A 4OLOA 3M6WA 4FJIA 4R8UB 3FBBA 1TFYA 3RGIA 4YNQA 4HT7A 1FEEA 3GIIA 5DZ6A 2VASA 3ZXWA 3DXKA 3HSCA 4X65J 5J2QB 2VDIA 4WZQA 3P38A 1JCEA 1TYQB 2MSTA 2XMJA 5EX5A 2A41A 3R5CA 4NYNA 2FQQB 2F4FA 2POKA 3SQGB 1FERA 3M6GA 5LM7E 4GKJK 1TELA 3WX4A 3B78A 1NNDA 1T9VA 1B3TA 3PRBA 4FWOA 4JKCA 3U9DA 1FJCA 2IMWP 3TX0A 2KFZA 2LXUA 4E89A 2CQ0A 3FDSA 2DK2A 3O9RA 4BR5A 3WBZA 3BYRA 1VR6A 1X5OA 1YDLA 4NOHA 2GIFA 4ZOSA 2OH2A 3M4XA 1HKGA 1PYSB 2ERRA 2RT3A 4TN2A 1CS4B 4PKGA 3KKRA 2I38A 2IVFB 2DEJA 4N7TA 4CJ5A 3GPAA 1JLBB 2XY6A 3O3FA 3NVMA 2CVEA 1I3AA 4G1PA 3RSEA 1T95A 5HI7A 4OJRA 3EXCX 4JI7J 2V7ZA 3MECA 2J8SA 4NMLA 3ATVA 2JEGA 4MMOA 3FZMA 4CFDA 2JGUA 3JS6A 5AR0A 2PDAA 2HHHF 4J9NA 4P9SA 1RHJB 2MZRA 4P10A 3RVCA 1PC4A 5B7WA 2AGQA 1S77D 1S9GB 2RUSA 1NLVA 4U96A 4ECZA 3CGIA 4YDUC 1M90O 1RDWX 4FYWB 2ZM6K 4P74A 1R7IA 4IG0A 1URRA 1A5WA 4KI6A 1S6QB 1VSKA 1NDLA 4MH8A 3C14A 3R6MA 4O3QA 3VESA 3AD8C 5F9NA 4FO0A 3ZZZA 4CYUA 4DPXA 1LCUA 4RNNA 4CLTA 3I82A 1PJ7A 3OR1A 1C0GA 3MM9B 4B3OB 2VOOA 4ZN3A 2YJFA 1QUPA 2RU9A 2XWYA 1IBLF 2QYGA 4O8UA 2KM8C 4DV1F 3F9MA 5HATA 2B4VA 3WC0A 4CEOA 2CGKA 3MEKA 1G99A 2LDYA 1QHAA 1DLOA 3KTQA 3PDNA 1KLNA 2X1BA 2V50A 1HYSA 3T5HA 3OSPA 2LXIA 3V1RA 2Z2ZA 4JV0A 5TKWA 3THYA 4RW4B 1WB9A 1V5IB 3PG9A 2RJZA 3AO1A 1TP7A 5BRDA 3I96A 2H5JB 1U1NA 3W5ZA 5HQMA 5DG8A 3T6JA 5DLFA 4YR3A 2WC9A 3RBZA 5I42B 4CM2A 3W65A 1YJUA 4DTMA 1EQYA 4DFMA 3OYGA 4A8MP 4RW8A 4ZPVR 3U8XA 3MMJA 3R8EA 3H4BA 3TQEA 1NJWA 3LGNA 2VG5B 1FDDA 2KJVA 1HNXJ 3IGNA 3HHLB 4YHHK 3MEGB 3QZ7A 3O1BA 2H4YB 5CYQB 4ZVHA 1LW0A 2RRNA 2AWZA 2ZH7A 1B9FA 3CC7N 1F9EB 2DFHA 1T8EA 5A6PA 3EDQB 4FF1A 1EKEA 3UW1A 3SQ0A 4NLWA 4NLTA 4E19A 3OY9A 2PY5A 3T1YK 2W6KA 2X1AA 2L9DA 2UU9F 4M5HA 4J90A 3C6UB 8ATCB 2DGWA 2WSEC 5B0FA 2ZBIA 3PYGA 3ZSZA 2MZSA 2G8WA 1ZPVA 4PZVA 1FE0A 2XLIA 4DN9A 4KHPJ 4ZPCA 2DEIA 4LBIA 2VG7A 1T3NA 2M52A 3U1NA 3OL9A 1MU2B 5GVQA 3PY8A 2VQEJ 4F4WA 4WJBA 2ZE2B 3J7AP 3O08A 4BRLA 4K4TA 3KD1E 5JLHA 1MWZA 3GP9A 2M8DB 3UQSA 3KK1B 1XC9A 2IM2A 2CVIA 4O0NA 4EO6A 3NCRA 1VISA 2M5YA 1XR5A 2YH0A 1ZZNA 4FN5A 2XQCA 3SMSA 3QEWA 1C0TA 2LQ5A 2ZDPA 1NM2A 4FVMA 1NK7A 3P96A 3DLLQ 2JEJA 2YNHA 5ETQA 4W92B 2IBOA 3TW0A 3W8GA 4M63C 3NP5A 3VF6A 3HVRA 2KB2A 4TU7A 3KLVA 5C25A 2BXJA 2HZCA 2ADCA 1R27B 4Y3CA 5CA5A 1LK5A 3OW2R 1VQ9N 3DFEA 1RT6A 1B0PA 3I32A 3OTOJ 5GAEU 4ZP8A 1W2IA 2CPJA 3M1VB 2VBXA 3M8PB 1GNKA 1HQUA 2UUBJ 2P9IB 3TA1A 3DOKA 4TU9A 2MKJA 3D3BJ 2YQ0A 2GX8A 3H5UA 3VF2A 5M1KA 3SZ2A 3HSGA 2HFUA 4D3HA 4F3QA 4B9NA 2R7RA 2PBDA 4QS7A 3WC2A 1NJIO 3MOJB 3EEQA 4ZVEA 2CQBA 3BGLA 2HK2A 1UVJA 4JI1F 3P4UB 3VQ6A 3F9KA 1WG1A 3OBIA 3E9PA 1ZM9A 2HVZA 1RQ0A 4O3SA 2PD1A 1Z6RA 2OMLA 4A2BA 3AY9A 2R7OA 3MI7X 2UVVA 1X5SA 4GW6A 2Y0SD 3HJVA 4H54A 4QCLA 2DYAA 3M2RB 3TSPA 2D69A 3K5NA 3LH2S 2NRRA 4PEOA 3CNQP 4B3SF 1XMBA 4HI1A 4FLXA 3V6DB 3R2DJ 3SBGA 4C8KA 2ZZNA 5J2MA 4RBTA 2V4RA 2QKBA 1NHKL 3NH2A 2VH7A 2JHEA 3H2LA 3HD2A 5F1XA 2OFGX 3C15A 3MM8A 1UZDA 4DV0F 5IS2A 4M41A 5CD4H 3C16B 3DYAA 2CJBA 3CCRN 2OEJA 3MAAB 1YZ7A 5LSLA 3O9SA 2AV5A 4IG3A 3W9HA 2A3ZA 2RH3A 4C98A 2DGTA 4DV7J 1QQOA 2YNGA 3GG0A 4B1VA 4PQUA 1SJRA 3DRPB 2RRBA 1LWFB 1X3NA 3RMAA 2K2PA 4CJRA 5J2PA 5IWAF 4KAIA 4PG5A 1VQ6S 1AA1B 4PHTX 4PCQA 2VFSA 4AM6A 1YLXA 1EO1A 3V2UC 4WKRA 1KAZA 5G4DA 5CY4A 1VQ7S 2YQ3A 2ZDOA 3D54A 3NNAA 4NXNK 1F1BB 3A5OC 1VRTA 1LFWA 3UO0A 3QT7A 3WQPA 4ZLLA 4GC6A 4KB1A 2HNDA 4ZCLA 1RTJA 4JKFA 4OZLA 2OD6A 3E9LA 1Q8IA 2E5LJ 3KLFA 2VBYA 3CCWA 3VQSA 1S4FA 3ISZA 4ILJA 3QGGA 1S3XA 1ESVA 5HSPA 1FXDA 1QE1B 1C1CB 1DURA 4O4GA 1JB0C 1GQEA 2YHXA 4NXMJ 2Y8WA 3ZNJ1 2BKNA 2WONA 1H98A 2ZGYA 3SQOP 1NHVA 4ES3A 4FYDA 3M9OB 2QXFA 4KFBB 1W97L 4KGKA 3OYKA 3KK2B 4DSKA 3OS1A 2RU3A 3UN5A 4AL5A 2JH3A 3KNGA 5J2NB 4ANCA 3CJAA 5J1EB 4YDDB 4UZCA 3A8EA 3MAQA 1NK4A 5D4OA 1TKTB 3ENQA 3TVKA 3AVNA 1LFPA 1LV5A 1M1GA 4I7FB 3P6YC 3DOMB 4ZVTB 3ZZ0A 2MKYA 3QT5A 2R7UA 3OXFA 1LAVA 3KK3A 4MT1A 4DR4F 4DR3J 1T44A 4DMNA 4GVBB 1SIZA 1BMQB 3EPGA 1PGZA 4NLQA 4J9MA 3HPOA 1D3WA 2VJVA 3J8AA 1UVLA 5KFTA 1ZYQA 5AFUH 1VQKN 4DR6F 2AJQA 2FJAB 4ILLA 4HWIA 4C48A 3THXA 3FE1A 2DR5A 1TMJA 3OQ2A 1A6LA 4BVPA 2YNIB 3OYJA 3VPZA 1KVIA 2L9NA 4A8SA 2IAJA 2GS8A 3ITHA 1NU0A 3D0PA 2Z1GA 3HFZB 1QVFM 5E3PA 4CNZA 3OVAA 1J53A 3OLBA 4BREA 1X4GA 4DMZA 3V9SA 2E9RX 2ZM6F 4WYWA 1K73T 1HPMA 5LMNF 3HSZA 5C24A 4NCGA 2C2NA 3RRKA 1N0UA 2V4JA 1BCMA 3NH1A 1NPRA 3SFGA 5EN1A 1WOPA 3FEZA 1IKVB 4C8LA 2IYIA 1DGKN 1WSRA 3BGRA 1HBMA 1HWJA 1U2FA 2NLXA 1HKBA 2EBEA 4E7LA 3WXKA 4Q45A 2JX2A 3V4MA 5DDOC 4N8OA 2RHKA 2KVIA 2ZNZA 4DV2J 2YWGA 4IKFA 3E9OA 1S1UB 2DNHA 3ENWA 5CAAA 4C3MA 2XSJA 3G96A 1H1VA 3W5XA 4USKA 1B0VA 2E7VA 5AJ3K 4ZVGA 4CJFA 3ZX0A 3K0JA 4TVAB 1KD1T 1K0VA 1NO8A 2DO0A 1E4FT 3VERA 3BKUA 4ISFA 4ERDA 1ROFA 3NG8A 4JKBA 5L8RC 3QNOA 2EFPA 4DPOA 4X4RA 4IZ9A 5D0EA 3ISNC 1X4CA 4I69A 4CQ1A 2U1AA 2HGNA 3MM7B 4DG1B 3HHLD 1HWLA 4BR2A 3AXKA 2NZTA 4UF4A 5HRPA 3SCJE 4DV6K 5H9EJ 1I94K 4YHHF 2KTQA 1WSJA 3X1LB 1AROP 2I7NA 4CF8A 4NI2B 1TUUA 2YJEA 2O3DA 1WDDA 1NK5A 3ZLJA 4BGAA 1L3KA 5C12A 3MPVA 4Y0FA 2ASJA 3DCAA 4ZK7M 1K44A 4OKJA 1QTNB 1VMBA 1HFEL 3MEEA 1HBNA 2Z1IA 5AQOA 5T14A 4FJNA 4ILGB 3F2KA 3H6EA 3K5LA 3UDCA 3PRVA 1HBUB 4QYZJ 1JL2A 4LF4K 4TY8A 3NGTA 4LF5K 2V94A 1SL2A 4KQZA 3HD1A 1MG7A 3IG1A 2YPYA 4U67L 2FZGB 4M5MA 4M3WA 1G3OA 4X4OA 1WNSA 1DFDA 3JSRA 1M1KT 2NNWA 3Q23A 3KKSA 2BACA 2MKCA 1O5JA 5DS7A 1S48A 3ULHA 4FVCA 2ZHAA 4CF1A 5LXRA 2ZOFA 5H1SV 9ATCB 2D74B 3HZEA 4FW1A 4DR5K 2LEPA 4AFFA 1KTQA 4IRKA 5IC4B 2M0GB 1VRQC 2AKWB 1RDDA 3MX5A 4USTA 3M6XA 3VAKA 1JLGA 1CLQA 5GADI 4CLYA 3JTOA 2JWLA 1SPBP 4A62A 4O44B 4IBNA 5M1OA 1WKKA 2JEFA 4QIEA 3MWTA 1IBMJ 4GV6A 4TQSA 3E51A 2VUGA 3G82A 1RAHB 4CHYA 4EFHA 5TKYA 1Z2LA 5F0WA 4JRQA 1VSFA 3BSNA 3CD0A 2EX3A 4GMKA 2VU5A 3R2CJ 3MCSA 4JAXA 4I9LA 3KZBA 5KFEA 3C66A 3NMRA 1D9FA 2ILZA 4F3OA 3SJHA 1HYZA 2QZ8A 4KKOA 4BRFA 2FIUA 1REVB 2W4CA 4YY3F 4FVUA 3PVXA 3PLAA 1VSMA 3TABA 2KH9A 1SJFA 3SCKE 2UXDF 1OYDA 4JB8B 2VL1A 3T9NA 2V9WA 3ILIA 1B7YB 2W4DA 5C42A 4OZ2A 5JXSA 2XO6A 3QWPA 2OYQA 2KZMA 4F02A 3AV9A 1VQ4N 4Z4HA 4DN0A 1MDUB 2QA4S 1X8DA 1U0HA 4LF8J 2XZDB 5DM7L 3OYIA 4USMA 5KGWA 4HTUA 3DLJA 3FZ2A 4WPAA 3RB0A 1PG5B 1BOTO 4EU0A 5CHCB 2J6UA 2AJ0A 2B51A 4Y0WA 4ECWA 3MN6A 5KFVA 3IRXB 1CULB 2RUGA 2E5IA 4Q0BB 4DPWA 1R0AB 4O0JA 3VENA 4AILC 3AA4A 4RW6B 1RZMA 4KHQA 2KHDA 1N6QB 4JI5J 2IVMA 1NGDA 2I5JB 4IEEA 1V6HA 4L74A 1HNZJ 4MFBB 5CQGA 4K2JA 2A18A 4FL9A 2VB6A 1UEKA 2QLWA 1EIYB 5AXKA 4I2PA 2HZAA 4C11B 2QG9B 1Y3KA 2O4IA 4KBOA 1X31C 1VSDA 3P5BP 1S72S 2UUAF 3TTFA 3VETA 4BE1A 4ID5A 2QM1A 3QLHA 1FCAA 3GJRB 2AJ2A 3BV8A 3ETMA 1UAWA 4OZ1A 4MQ3A 3PIOL 3QBCA 1VBKA 2FVRA 3DLBA 3UDEA 3SFUA 1SJ3P 5JJBA 3F0NA 2DY1A 4CD1A 4NXNF 3LO3A 2J7KA 2B4JA 3IP0A 2CQCA 2IC3B 2MGZB 2HAIA 4RNFA 4OHVA 2P9SB 2K06A 4IFVA 3CW2C 1BGXT 4X4VA 4J5OA 5EWGA 5C2CA 3IAS9 3QAEA 4QR2A 3MR5A 2YWFA 3PR5B 6AT1B 3WXJA 4CJTA 2P5GA 5IQ6A 2G2OA 4I2QA 1Q1KA 1YX2A 2AZ1A 4LH4A 5AQQA 2J8AA 1G6BA 1SL0A 5RUBA 3DXKB 1JK9B 2OTJS 5LMUJ 3NMAA 1FDAA 2E1YA 3EXYA 1TKDA 3G8SA 4DUYJ 2D7SA 3M6VA 3QDKA 1K1QA 4PR6A 1I39A 2UUCF 1BA1A 2ROEA 1YGYA 2CNLB 4B9TA 1QD1A 3RR7A 3AGKA 1NB7A 2P1JA 5IM0A 2CH5A 3H45C 4AHSA 1HLUA 4MKAA 1O51A 4Y2KA 5HANA 3V9WA 5E33A 4FM2A 4JYAJ 1P8GA 1IKWA 5BR8K 1CPZA 1BCOA 1UZHA 5BPMA 2DH9A 2XMVA 4LF6J 3TA2A 1N5QA 2CQIA 1K8KB 1VC0A 3LP3A 4F4ZA 7FD1A 2QN6B 1PAUB 2K1RA 3THTA 2EFVA 2CJQA 4YOTA 5IT9U 3RSEB 5IZHA 5LJWA 1FWPA 1LK7A 2GC8A 1LOTB 1SBRA 3MECB 4H4OA 2DNGA 2QWRA 3M6UA 2QEXN 1MWMA 3AD7C 2U2FA 2XY7A 1HNWK 4FLUA 2YKNA 4CJPA 2CPXA 3HJFA 4WZMA 2HBQB 2WTFA 2RQ4A 5GAHU 1VQMS 3VEYA 3P31A 1UVNA 4DJBA 4B3TK 5KT4A 3WUHA 3OD2A 4LVOP 4O23A 2R7WA 4J9LA 3HKZD 2QGFB 4LFBF 3QZ8A 4CF2A 3C14B 3ZZYA 2VD3A 1GTEA 3LDPA 1QVFR 4CP5A 1VDHA 2G0CA 1SJ1A 1WSGA 2I6WA 1J5EF 2M3DA 3A5MC 3K8WA 3IRWP 2GMLA 3OR1B 5IC6B 2QV6A 3ENHA 1KVAA 5AJ3F 2H9ZA 4YOWA 2KM8B 4OV1A 2RF2A 2ATLA 2AHOB 1SH3A 2DRBA 2GJIA 4DL4A 4IOCQ 1KVJA 2R42A 1SKWA 4RW9B 2P51A 1NDPA 1TK0A 2NRWA 2Y3YA 2AU0A 1H73A 3BPDA 3W9IA 1XN9A 5THWA 3K58A 3J81U 5E5NA 3GYGA 1HYSB 2PE8A 4NLPA 2OUGA 2V0NA 1YF5L 4CE9A 5E41A 1N32F 3S3NA 3ID6A 2D3UA 4ELVA 3SSSA 3CCMS 4M8LA 3QGHA 1H0HB 4C6AA 2G1DA 1T9WA 3I56N 3V6KA 1SVDA 4UQGA 1BI4A 1WF2A 3GLJA 4IDHA 1GLFO 4DPTA 3N01A 4CT9A 2DH8A 3S3OA 4RW8B 3C3LA 3VEXA 5KFYA 1DQ9A 2EC2A 3D67A 2MTLA 2LEBA 4HH0A 2UXCF 4FXDA 2CNKB 4QS8A 1WBBA 1T03B 3BR9A 4CLZA 2YWKA 3I9ZA 1F9HA 3CC4S 1LW0B