3AVLA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/inhibitor
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avlA00
4IG0A 1YT3A 3ULDA 1D9DA 3MXMA 4Z4HA 4W5QA 3V1QA 1IG9A 4CGFA 1YVUA 3OS0A 3SI6A 1NJWA 4IFVA 4CGIA 3H08A 1SL0A 4KHQA 4R5PA 2E6MA 3ZT1A 3DOKA 3HT3A 3TWHA 2PYJA 5J2MA 5KTQA 2HMIA 4M3ZA 1ZBFA 3AO2A 2KZMA 4LD0A 1G15A 1HQEA 3NDKA 4HUEA 1U48A 3TANA 3LAKA 4CHZA 1XI1A 4C8LA 3T1AA 3T3FA 1S5JA 2Z1HA 4Z4GA 4N56A 4HHTA 1VK0A 1NJZA 2G8UA 4DTSA 4J2AA 3SZ2A 3DLRA 3LP3A 4FM0A 1GOAA 3HO1A 2D5RA 4E7LA 5KI6A 1RTDA 1QTMA 4W5RA 3V81A 4NYNA 4RW6A 3OYNA 3LAMA 3OYAA 3NF9A 2DTUA 2A1SA 2G8FA 3ZSYA 1HNIA 2YKNA 3ZCMA 3AVIA 4CECA 3SUPA 1TKDA 1NKEA 4CEEA 4RW7A 1FXXA 3LPTA 3WNEA 3RTVA 4CF1A 3PO5A 4CFBA 4M3WA 1NK9A 1Z25A 3AA5X 4I9QA 3KIOA 3C95A 1RTJA 5K14A 3NAEA 1NKBA 3TAFA 3ASMA 2GBZA 2YV0X 4AHRA 5CYMA 3RR8A 1Y97A 3LP0A 3HPHA 1S1VA 1IKXA 2ZQBA 3O3HA 1RILA 1FK9A 3QESA 3NH0A 2OPPA 4W5TA 3SQ2A 3RMDA 2D0CA 1K6YA 4CJLA 2HW3A 3ZSRA 1BQNA 1RDAA 3K5OA 4MQ3A 5T7BA 3NCIA 1L5UA 3IS9A 2X6SA 4I7FA 3WNHA 3V9ZA 4CJWA 2OA8A 3TABA 3RMBA 3L2QA 4OLBA 1IKVA 4QAGA 4CHQA 3DM2A 4FJHA 3K59A 2P5OA 4DTOA 1RT1A 3G0ZA 3O3GA 4KREA 3I0SA 3DRRA 4KB1A 2IGIA 1YTUA 4CGJA 3QEWA 4DTPA 1SKSA 1WSGA 1VSMA 4FLTA 1VSJA 1VRUA 3AVAA 4DMNA 1BISA 4C8NA 3OYBA 4GMJB 3S9HA 1JKHA 1NK4A 4OKJA 1IKWA 5FDLA 5KRTA 1CXQA 2Z1JA 4KRFA 4CEAA 1WSJA 3HJFA 4DSJA 3M8QA 4KTZA 3KKSA 4KHYA 4W5NA 4DFKA 3PX0A 4Z0UA 4E7KA 5I42A 3V1RA 3HPOA 1CZ9A 5FROA 1WN7A 2G8HA 1NJXA 3SV4A 5HLFA 1JLAA 4E7HA 1LW2A 1RT6A 3SJJA 3V9UA 3U3GA 5HBMA 1VSLA 4XIUA 2HHUA 1N6QA 4ELTA 3OYMA 4FJNA 1TGOA 3SQ1A 1LAWA 3AVLA 1U4BA 4H8KA 3G10A 2FBVA 4DQSA 2VWJA 4Y1CA 3U6FA 3OYHA 1JXBA 2Z1IA 2Z1GA 2KFZA 3DYAA 3CFRA 1MU2A 1RBTA 5CZ1A 1RDDA 2DFEA 4O44A 4I9LA 3VQEA 3V1OA 2ETJA 4AHUA 3NGZA 2KZZA 4BDYA 3LALA 1VSFA 4FLUA 4FJMA 4WE1A 4FM1A 3TAQA 3SV3A 3ZSOA 5KGXA 5J2QA 4B9UA 1UOCA 3K2PA 3OS2A 3NF7A 1TK8A 4DQIA 3VQPA 3CYMA 1ASVA 4OJRA 2I5JA 3OYIA 3AVGA 4IDKA 4JRPA 1RT3A 1YTAA 2OZSA 1KLMA 4QOZB 4O0IA 4GW6A 2A1RA 2XY8A 4OPJA 4IBNA 4FVMA 3VQQA 1TK0A 1W0HA 2HNYA 3ZSVA 2IDOA 3DOLA 1GOBA 2Y1IA 4FJIA 1S1TA 3SUNA 4FW1A 4ZHRA 3AVMA 4DFPA 4DU3A 4G1QA 2JGUA 3PX6A 2HHTA 3ZT4A 4AILC 4CHOA 3VQ9A 3OJSA 2OYQA 1BCMA 2OPRA 4C8OA 2IOCA 3V9XA 3SPZA 4HCBA 1NK5A 1QS4A 4NYFA 3AO5A 4CJPA 1XHZA 3VQ4A 4CK3A 1EP4A 3VQAA 3DRPA 4DU4A 4Z4IA 4KPYA 1VSEA 4BE0A 5HRSA 1U47A 3ZT3A 4E7IA 4ELUA 1SV5A 4CJEA 5KRSA 3OS1A 4BWJA 3O3FA 3HVRA 3SQ0A 3MECA 4BWMA 3VQ6A 4CGDA 3L2VA 3AVFA 4JS4A 3LP2A 3QIOA 1TK5A 1TAQA 1JLEA 3P1GA 4CJQA 3D45A 1WNSA 3TAMA 4N41A 4KHUA 3PUFA 3VQBA 1KCFA 4ID1A 4HCCA 1T03A 4NCBA 1NJYA 1S1UA 3KKRA 1L3TA 3LANA 3RMCA 2P5GA 4QCLA 2LSNA 3OYFA 4B9VA 4FLXA 5CY4A 1KSPA 1WSIA 4F4KA 1QE1A 2IC3A 3OYKA 3QIPA 4KHSA 3AVBA 3DLEA 3QEPA 2XO7A 1RTHA 1LWFA 1TVRA 3VA0A 4K8XA 3MEDA 5JS2A 1U04A 4HVJA 1RBRA 1NK0A 4E19A 3QEVA 1J9AA 4L8RB 4ICLA 3L2WA 4DSIA 4B9LA 3L8BA 4TSXA 2VG6A 2E6LA 3U3YA 4MFBA 4KTQA 3NF8A 1DTTA 3K58A 1QSYA 4HUFA 1KFSA 1ITGA 4DTRA 4O4GA 3ZSQA 4DSEA 4FJJA 1I3AA 3KLFA 3NBPA 4Z4FA 1RBSA 1X9WA 4OLAA 2FC0A 4FJ7A 4DF4A 3QLHA 1RCHA 4CFCA 2RN2A 5SZTA 2OPQA 4HTUA 3AA2A 4E3SA 3LZIA 1EETA 1RBUA 3QO9A 5EU7A 2PY5A 1C1AA 1ASWA 4IFYA 3V6DA 3DLHA 1ZBIA 2VG5A 3I0RA 4JLHA 4I2QA 4FLZA 2IS3A 2GV9A 4DSFA 5HROA 5HRRA 4C8MA 4DWIA 1JLFA 2F8TA 4DTNA 3RR7A 1VSKA 4B9MA 4N76A 4E89A 3IG1A 3AO4A 1RT5A 4CJFA 2FBXA 4NCGA 3DRSA 2HNZA 3KLEA 4CGHA 1HMVA 3PX4A 4LH5A 4RW9A 4ZTFA 1QSLA 3OYEA 3PO4A 4F3OA 4RG8A 4CERA 4BACA 4DQQA 4M45A 4DS4A 4DS5A 4K8ZA 4B9SA 1C1BA 4KTWA 1S6PA 3CQ8A 4OVLA 4EP5A 1HJRA 2YHAA 3VQDA 1U45A 4JRQA 3V9SA 3HL8A 3VQ5A 1Q9XA 4IG3A 4YFUA 4CIGA 2X74A 3EYZA 4OGCA 1C0MA 3AV9A 1WSHA 1VSHA 4LY7A 3K57A 3SUOA 1S1XA 2GUIA 3TAEA 1X9SA 3DLBA 4FJ5A 3NHGA 5HP1A 1TAUA 4CF0A 1J53A 1LWCA 3OJUA 4CE9A 3V4IA 3PV8A 3AVNA 4M3YA 1TKTA 4FK0A 3QINA 2HHXA 3TAPA 4FCYA 3NF6A 1Q9YA 4DSLA 3KK1A 2YNHA 4FJ9A 1EKEA 2HHSA 4CJ4A 1S6QA 3D0PA 3SPYA 4DSKA 1RDCA 4OGEA 1NK6A 4FYDA 3HP9A 2YNFA 4M3RA 3QNNA 1T7PA 1KVBA 2HHWA 2X78A 5HRPA 4ID5A 4CK2A 4B9TA 1RT7A 5KGWA 4EZ9A 2XY7A 4F8RA 2W42A 1JL2A 4BDPA 4ZTJA 3BGRA 3ZSZA 1L3UA 3SCXA 2KW4A 1T05A 2G8WA 4FM2A 3KLIA 5CZ2A 2HHVA 3VQ7A 3M8RA 1BQMA 4OPKA 4JS5A 1R0AA 4CJUA 3OY9A 3OYJA 2O4IA 2BE2A 3KLGA 4LSNA 2B6AA 3QEXA 4B9NA 3VQ8A 3CM6A 4CK1A 2G8IA 1HYSA 3P5JA 2EHGA 4KB0A 2B4JA 2D0AA 1JLQA 4DTXA 2HVHA 1O1WA 1WSFA 1RDBA 3LZJA 4BE1A 3KK3A 4E1NA 3KJVA 4DU1A 3DLKA 1BGXT 4E0DA 1RTIA 2AJQA 1IH7A 4FZZA 3AA4A 3PY8A 4LSLA 3SNNA 3UIQA 3AO1A 3LPUA 4Y1DA 1C1CA 4DQRA 4M41A 4O5BA 1WLJA 1D9FA 3ZSXA 3VQCA 1RBVA 3OYDA 4PA1A 3CFPA 1QQCA 3RMAA 1IO2A 4F2SA 1B9DA 4AHSA 4N47A 1IKYA 3S3OA 4N5SA 5J1EA 3CFOA 3WNFA 1S9GA 2QKBA 1VSIA 3LWMA 1WAFA 3F73A 2ZE2A 2G8KA 3NGIA 1A5XA 2FBYA 3KD5E 3MAQA 2DY4A 1QSSA 4YNQA 4FLVA 4FZYA 1FKPA 2QK9A 3T19A 2IAJA 4IKFA 4DLEA 4FK2A 2P51A 1JLCA 5J2PA 4FK4A 1RT4A 4CJ5A 3QERA 1ASUA 1A5VA 3ALYA 4CEZA 2D0BA 1J54A 3MEEA 4I2PA 4CHYA 1Q8IA 3KD1E 4AHTA 3LDSA 4CEDA 1REVA 4CEBA 3SYZA 1C6VA 4CESA 2R7YA 2O4GA 4DTJA 4DFMA 1N5YA 4Q5VA 4KAZA 1TL3A 2HHQA 3ZT0A 4KFBA 3V9WA 4CHNA 1LWEA 1J5OA 3AA3A 4DLGA 3A2FA 3C94A 3KTQA 4EP4A 3RWUA 2ITGA 3EY1A 4M3TA 4C8KA 4PWDA 4H4MA 1D5AA 4M3UA 1LW0A 3I8DA 3NGYA 4PY5A 1BI4A 3O4QA 4FJKA 1C0TA 3B6PA 3CG7A 5J2NA 2XHBA 3SUQA 4W5OA 3DMJA 4CHPA 2WOMA 4NCAA 3ISNC 3C6UA 1UA1A 3OYLA 3TAGA 4CFAA 2OPSA 5HRNA 5D3GA 4O0JA 3AVCA 2KFNA 1JL1A 2NUBA 3MXIA 4UQGA 1ZBHA 4FJLA 2YNIA 1HYZA 2KQ2A 1QHTA 4KHNA 4FJGA 2PZSA 5I3UA 2QXFA 3TR8A 5DMRA 4CJRA 4BE2A 2F96A 4KO0A 3OYGA 2X6NA 1BIZA 1TKZA 3HYFA 4FLWA 1SKWA 3S3MA 4KI4A 3NH1A 3HVTA 3ZSWA 2B5JA 1UA0A 1WSEA 4KI6A 4CGGA 3THVA 3BDPA 4DTUA 5FRNA 4B3OA 4GVMA 2BGGA 1BL3A 1U49A 1ZBUA 1HQUA 5CYQA 4CF2A 3HXMA 4F2RA 1KTQA 3L2RA 3NFAA 1SL2A 4CF8A 2PYLA 3KK2A 3NE6A 1D8YA 2EX3A 1ZBLA 1XHXA 4CJTA 4B8AB 1NOYA 1KFDA 4DQPA 4AHCA 4ELVA 3M8SA 3AVHA 4F3TA 5E41A 1Z26A 3L3UA 5DK5A 1S9EA 4CJSA 4CJVA 4Q0BA 4B08A 1HNVA 1DLOA 4FW2A 3WNGA 4LH4A 4CEOA 3KLHA 3LWLA 1SUQA 3K5NA 1VRTA 3E01A 3P83D 5C24A 3HK2A 1RT2A 3QNOA 4AH9A 1BCOA 1ZYQA 2OZMA 4OKKA 5FRMA 2QKKA 2FBTA 4BDZA 1RNHA 2VG7A 4CFDA 1JLGA 1BHLA 3CM5A 1KVAA 1T8EA 1JXEA 2BDPA 2YKMA 4RW8A 4PUOA 4O55A 2JLEA 3TARA 4FJXA 4DG1A 1HRHA 1EXQA 4CJKA 3O4NA 1X1PA 2P1JA 5SWMA 4B8CA 4CIFA 3DI6A 2HVIA 4CIEA 3JYTA 1NK8A 1GOCA 1XC9A 3K5LA 1NKCA 3LP1A 1LV5A 3F9KA 4EZ6A 1KVCA 3L2UA 1CLQA 2KTQA 1TL1A 1TV6A 4J2DA 3RRGA 1FKOA 1S1WA 1I39A 1L3SA 4KHWA 1JLBA 1BI4B 2E4LA 1UAXA 2VWKA 2ATQA 4HUGA 4DFJA 3B6OA 3K5MA 2G8VA 3VN5A 4H4OA 2HNDA 2Q3SA 4E1MA 1SL1A 1DTQA 1L3VA 4CEQA 4Z4CA 4KV8A 3SQ4A 3AVJA 3OVNA 3IAYA 4CEFA 3JSMA 4DTMA 4FZXC 3HP6A 3QEIA 3QETA 1B92A 2DFHA 2XRIA 2XY6A 4M3XA 1X9MA 4Z4EA 3AVKA 1B9FA 3DLGA 2XY5A 3EZ5A 3S3NA 4FJ8A 4FLYA 3HSTB 4AHVA 3RRHA 1LAVA 2ZD1A 2Y1JA 1VSDA 1HYVA 4J2BA 1KRPA 2F8SA 2YNGA 4RW4A 3NH2A 4M42A 4CCHA 3ITHA 4OKEA 1NK7A 1WAJA 1CZBA 5C25A 1UWBA 3HPGA 3ZT2A 4CF9A 3VA3A 1C0UA 4E7JA 4DF8A 3M8PA 3TI0A 2DFFA 3IRXA 1A5WA 3FFIA 1KLNA 4PQUA 1XWLA 2RKIA 1EX4A 2WONA 3HM9A 3MEGA 4FXDA 2YHBA 3MXJA 1F21A 2RPIA 1HPZA 4KKOA 1NOZA 1CXUA 2HB5A 3OYCA 1SKRA 3L3VA 2RF2A 5JS1A 4CJ3A 4J2EA 2BANA 1BIUA 3AO3A 5C42A 1TKXA 1W9HA 3C6TA
chains in the Genus database with same CATH superfamily
3ULDA 2WBNA 4Z4HA 2QWPA 4DR6K 3SI6A 3H08A 1SL0A 3BF1A 2A42A 4EHTA 3DOKA 3HT3A 3TWHA 2KZMA 5J2MA 5KTQA 2HMIA 4M3ZA 1ZBFA 3AO2A 4HUEA 1GLLO 2NZTA 1HUXA 3TANA 4C8LA 1N36K 2HF3A 3T1AA 4DB3A 3T3FA 4DR5K 4LF4K 2ZJRL 4M63C 3P39A 3FZKA 2D5RA 1RTDA 4LFBK 1QTMA 3V81A 4NYNA 4RW6A 3OYAA 2DTUA 4FPBA 1S72N 1NKEA 3MN5A 4RW7A 3LDPA 3LPTA 3TTDA 3WXIA 3WQTA 2UU9K 1NK9A 2P9PB 1GLFO 3JAMO 1MWMA 3ASMA 4DV5K 5CYMA 5AQYA 4FPAA 4BR0A 4CJLA 3P4IA 5T7BA 2GEMA 5AZJB 3H46O 3IS9A 2X6SA 2BUPA 4BR9A 4WQ5A 2HSTA 4JD2B 4FOIA 1ZXOA 3D6RA 4DTPA 1SKSA 4B1WB 4MO5A 3C65A 3ID6A 3A8YA 2P9NB 3H3NO 2F9WA 1NK4A 5KRTA 1CXQA 1QHAA 2E2NA 3R3LA 4KTZA 4W5NA 3PX0A 4E7KA 1WN7A 3THYB 2QI2A 1VQ4N 3V9UA 3CCLN 3THWA 5HBMA 1YITN 5M1FA 4BRDA 1TGOA 2GWKA 4BRFA 4H8KA 3G10A 2PAVA 1Z05A 1JXBA 2Z1GA 2KFZA 5BREA 3CFRA 3CC4N 3MX2A 3VEWA 2A40A 3NGZA 2YJEA 4FJMA 3TAQA 5BR8K 3HI0A 5J2QA 3K2PA 1KQSM 3E9OA 4DQIA 4OJRA 3D7EO 4JRPA 2HBLA 1RT3A 1YTAA 5TKYA 3HOTA 2WTUA 2P9IB 4O0IA 4FVMA 2IDOA 3DOLA 2Y1IA 3EKUA 1HNWK 2QA4N 2I7NA 3O4WA 2HHTA 3OJSA 1BCMA 2W6LA 3DWLA 4NYFA 2NRWA 4CK3A 1NG9A 4AF1A 4Z4IA 1FJGK 4A57A 4BE0A 5AQQA 3O3FA 1IV0A 4BWMA 2NLXA 4IEIA 4PKHA 3L2VA 5AQTA 3QIOA 5HL7L 5AQUA 3F2KA 1WNSA 4KHUA 4NCBA 1L3TA 4QCLA 3LANA 2LSNA 3AGRA 4F4KA 4CZKA 1TVRA 3VA0A 3MEDA 4I6MA 3CQXA 5JS2A 1P8ZA 3THWB 4HVJA 3ZETA 1J9AA 4ICLA 3L2WA 1YIJN 2JWKA 2BH1A 4B9LA 4JEPA 2VG6A 4CW7B 1Y64A 3NF8A 4EAHD 3K58A 1QSYA 3TTCA 3IUCA 4FJJA 4GV3A 5AQKA 3K9KA 1X9WA 4OLAA 2FC0A 1RCHA 3UKUB 2WFBA 4CFCA 5SZTA 3O1BA 4LF8K 3G25A 1ASWA 3V6DA 3DLHA 3O9SA 5HROA 1HKGA 3I55N 5HRRA 1JLFA 3VESA 4NXMK 3CCSN 4CZJA 1G99A 2FBXA 4H0VB 3PX4A 4LH5A 4RW9A 4F3OA 4B1YB 4CERA 4B9SA 1C1BA 1QZ5A 2QEXN 3GOIA 3VQDA 1E4FT 3MMVA 4JRQA 3HL8A 3VQ5A 4YFUA 3EYZA 3K57A 2O8CB 3AV9A 1VSHA 3MN9A 4LY7A 2GUIA 1TAUA 1Z6RA 3E1YA 3NHGA 2VGNA 3OJUA 3AVNA 5KPTA 3M6GA 1M1KO 1TKTA 1MDUB 4GNIA 4CD3A 2HHXA 5E26A 3NF6A 2YNHA 5AZIA 3QFPA 4CJ4A 3CC2N 3D0PA 3SPYA 4DSKA 4FYDA 4OGEA 1NK6A 2QWQA 4DCHA 3HRGA 3W3DA 3ZSZA 4MLEA 2G8WA 5CZ2A 1HKBA 2D1KA 4OPKA 4CJUA 5AR0A 5GADP 4WFBL 3BP8A 1OH7A 4B9NA 1NLVA 3S41A 3T69A 4CK1A 1O1WA 2D0PA 3SQ1A 5KPZA 4BE1A 3KK3A 4E1NA 3KJVA 3ENBA 3DLKA 1BGXT 4E0DA 1IH7A 3WXJA 3AA4A 2F4VK 3OBYA 4LSLA 1GLEG 3UIQA 4Y1DA 4DQRA 5JMVA 1WLJA 1VQ5N 3VERA 1B9DA 4JI7K 3VEVA 4RCHA 1IBMK 1WAFA 3F73A 2VYPA 2G8KA 1A5XA 2RHKA 3KD5E 1ZBSA 1W97L 4IKFA 3L0QA 4XH5A 1JLCA 1RT4A 1ASUA 1MWKA 3T1YK 4I2PA 3SK3A 4AHTA 3LDSA 4YOUA 4JI3K 4WQ4C 4CEBA 4CESA 2HHQA 2O4GA 2RE2A 4DR4K 4BGBA 2OANA 3R8EA 4CHNA 2YHWA 1J5OA 1QQMA 3F9MA 3GBTA 3TTFA 4C1NI 4M3UA 2V52B 4PY5A 3MWPA 3CG7A 5J2NA 3TSPA 5KQDA 4W5OA 3DMJA 4CHPA 3ISNC 3OYLA 4H5NA 2KFNA 1JL1A 1KXPA 3JS6A 3MXIA 1ZBHA 4NLBA 2YNIA 1QHTA 4FJGA 5I3UA 1NM1A 2F96A 3SAHA 1BIZA 1TKZA 3O9UA 1SKWA 1VQLN 1W2BM 3MX5A 5C10A 1UA0A 3PLAA 2NRRA 3THVA 4DTUA 5FRNA 1BL3A 1U49A 2UXBK 1SL2A 3CJBA 3CHWA 3HSCA 3NE6A 4CVNE 1ZBLA 5KQ8A 4ELVA 1KFDA 1VHXA 3M8SA 3LWLA 4DR7K 2NNWA 3SAGA 3EE8A 1BCOA 2OZMA 4IOCL 2FBTA 1RNHA 1JLGA 3VF2A 3A5LC 4RW8A 4PUOA 2JLEA 3TARA 3KWIA 1NGHA 4BG8A 3JYTA 1NK8A 1CLQA 5AJ3K 2ZJQL 1VQNN 2Q2RA 4KHWA 4DFJA 2HF4A 1SAZA 3J8AA 4BRHA 1SL1A 1P90A 3QBXA 4E1MA 5GINA 2NRZA 3SQ4A 4FWKA 3AVJA 4CEFA 4FZXC 3HP6A 3QETA 1X9MA 5AQLA 2Q0RA 1B9FA 3CERA 3DLGA 3S3NA 1DGKN 4AHVA 3RRHA 1WBDA 2GUPA 2YNGA 4RW4A 4M42A 2ASOA 1NK7A 3HPGA 4CF9A 3ZX0A 4DF8A 4H5WA 1J6ZA 3IRXA 1KLNA 3PSFA 4PQUA 1XWLA 3HM9A 4FXDA 1NGGA 2YHBA 1N32K 2GWJA 1NOZA 3O8MA 1SKRA 3L3VA 4IWVA 4CJ3A 4ISEA 3AO3A 5C42A 3A0IX 4KI4A 1YT3A 3U9ZA 1YI2N 1D9DA 1VQON 3KVGA 3DXMA 1IG9A 1YVUA 3OS0A 4JN4A 1NJWA 4CGIA 4KHQA 2E6MA 3ZT1A 4YOXA 3EE9A 3NDKA 5FPNA 3LAKA 4CHZA 1XI1A 1S5JA 3BZKA 4Z4GA 4J2AA 3SZ2A 1J5EK 3DLRA 4K0KK 3M3ZA 4E7LA 1ATRA 1YVNA 3LAMA 2J4RA 2G8FA 1EWRA 2YKNA 3AVIA 1YXQA 3U8XA 4YOWA 3PO5A 4CFBA 1Z25A 1NGAA 3AA5X 4I9QA 5DM6L 3LDOA 4JKDA 5JVHL 2A6AA 4FWQA 2GBZA 1Y97A 1IKXA 3SQ2A 4V19S 3UB5A 2OPPA 3NH0A 1JCGA 2GELA 4JHDA 2D0CA 1WB9A 4K42A 3CCRN 1TYQA 3ZSRA 1BQNA 3KHYA 3K5OA 5AQRA 2YX6A 3V9ZA 4CJWA 3HM8A 3TABA 3RMBA 3L2QA 4OLBA 4Z94A 4QAGA 3DM2A 4FJHA 4A61A 3K59A 4DTOA 1RT1A 4KREA 4KB1A 2P9KB 4CGJA 4JI5K 1VSMA 4DUZK 5LJVA 1TUYA 4FLTA 1VSJA 1VRUA 3AVAA 4DMNA 1BISA 2CGJA 4KRFA 1SS6A 2IVPA 4CEAA 4JKBA 4DSJA 3RSEB 3M8QA 4JI0K 4H0TB 2AA4A 3DXMB 3KKSA 5GAGP 1NGIA 4KHYA 5I42A 5FROA 2G8HA 4A2BA 5BR9A 1NJXA 3SV4A 5HLFA 1LW2A 3R9PA 3CIPA 2P9PA 4BRAA 3O80A 4B1ZA 3ZX3A 2FBVA 2VWJA 5HOOA 2KKZA 2Z1IA 3H1QA 1RDDA 3MCPA 2YI1A 4WE1A 4CZFA 5KGXA 4MLHA 1UOCA 3MN7A 5F0XA 3VQPA 3MK6A 2PBDA 5JICA 4EIAA 2QWRA 4FWPA 3CCVN 5FLXO 3VQQA 1W0HA 1YF5L 3A5MC 4JHDB 3O9RA 3PIOL 1XQSC 1TYQB 2P9NA 4H0OA 1K73O 2E88A 2JGUA 3M5RA 3V9XA 1EO1A 3GL1A 3DRPA 3ULEB 3THYA 1SV5A 3SQ0A 3FZHA 5KRSA 4BWJA 3HVRA 3MECA 1TK5A 1TAQA 4ILJA 3P1GA 3D45A 4N41A 3PUFA 3WT0A 1T03A 5DM7L 1HR0K 4CZHA 3P38A 5CY4A 1QE1A 1FW6A 3THXA 3AVBA 1XMQK 3CI5A 3DLEA 3QEPA 1RTHA 1LWFA 1Q81O 3F5TA 2ZJPL 4BC4A 4BRLA 4RTFD 4K41A 1NK0A 1N33K 3QEVA 4DSIA 4NO7A 4UY8O 4TSXA 4KTQA 4BRGA 4MFBA 4ISFA 4J8FA 3AGKA 3GE1A 2P9IA 4HUFA 1KFSA 1ATNA 4DTRA 2QWOA 3ZSQA 4DSEA 3KLFA 4KH4A 1BA1A 1WOQA 5BN8A 3DAWA 5AQFA 2OPQA 5CR4A 4O8KA 1M90O 4IFYA 1ZBIA 1OH6A 4FVUA 2VG5A 4JLHA 4I2QA 4FLZA 4C8MA 4IEEA 3RR7A 1VSKA 4PL7A 3TU5A 3AO4A 4O5FA 4NCGA 4CGHA 1HMVA 4BACA 4DS4A 4DS5A 4IDHA 4JKGB 1U45A 5C0YA 1LOTB 1Q9XA 1RGIA 4QOZB 1WSHA 4X65K 5M1KA 3TAEA 1X9SA 4FJ5A 1J53A 1IBKK 2FXUA 3FZMA 2HHSA 3CCJN 4OO1J 1S6QA 1KC8O 3B8AX 4JKAA 1T7PA 1Q86O 1YJWN 5HRPA 4CK2A 4EZ9A 1RT7A 5AQVA 1JL2A 2E2OA 4ZTJA 3QMLA 1L3UA 5GIOA 1T05A 4FM2A 3THXB 1NGBA 4JS5A 3UKUA 2O4IA 3KLGA 2B6AA 3QEXA 1DT9A 2UYTA 2G8IA 1HYSA 3ATUA 4WFNL 3P5JA 4WFAL 2D0AA 4K25A 4CI6A 2ITMA 1BWFO 4BVPA 3GDQA 3O1WA 1HNXK 4IJAA 4FZZA 2KHOA 3SNNA 3AO1A 3LPUA 4LFAK 4O5BA 3ZSXA 3VQCA 3G4SN 4DHYA 2O8CA 3OBWA 4OPAA 1S9GA 1VSIA 4NLCA 1YUWA 3Q7BA 2DY4A 1QSSA 4YNQA 1FKPA 5BRHA 3WXLA 4DLEA 1GLJO 3H3OB 3OA9A 5J2PA 2YHYA 3SJHA 4WQ4A 5JVGL 5CE3A 3ALYA 3RVCA 2P9SB 1X3MA 3MEEA 4CHYA 5AQGA 1Q8IA 3CCUN 3U9DA 4CEDA 4CZGA 4KAZA 2R7YA 4LFCK 4DFMA 4Q5VA 4KFBA 4A5BA 2FLOA 3C94A 3NVMA 3WQUA 4CBUA 1D5AA 3I8DA 3O4QA 1T6CA 1C0TA 3B6PA 3SUQA 3C6UA 1UA1A 4O8UA 4BY9C 4FJLA 1HYZA 4JI6K 4MDBA 1ZC6A 2PZSA 3VEYA 2QXFA 4CJRA 4KO0A 4LF7K 2X6NA 3S3MA 5LL6Z 3QB0A 2B5JA 4FWNA 3BDPA 4B3OA 4CF2A 4F2RA 1QQOA 4FOEA 3FZFA 3NFAA 4CF8A 3BF3A 2EX3A 4CJTA 4DQPA 4AHCA 4YHHK 2NRHA 3CJ7A 4F3TA 1Z26A 5DK5A 4CJSA 4CEOA 3K5NA 1R59O 4OPHA 3P83D 5C24A 4AH9A 4DR1K 2D0OA 2QTDA 4JI4K 1QVGM 3CM5A 1KVAA 1T8EA 1SQKA 4O55A 4DV4K 3WEEB 1HRHA 1O13A 3WXMB 3QICA 2V7ZA 5BPNA 1XC3A 4H0XB 4CJKA 5SWMA 2O8BA 3VTHA 4CIFA 1LCUA 3DI6A 3UKRB 1GOCA 3CD6N 3I8BA 4EZ6A 3LP1A 5AFUA 1KVCA 3L2UA 5AQNA 4CZIA 2KTQA 3C7NA 3RRGA 1VQ6N 2AP1A 1JLBA 3CPEA 2E4LA 1UAXA 2ATQA 4HUGA 3K5MA 3VN5A 4JK7A 2QWNA 4H4OA 2HNDA 1DTQA 4Z4CA 5F2RA 1ESVA 2A5XA 1B92A 3AAPA 3CF5L 4CBWA 2ASMA 3EZ5A 4K43A 4BRMA 3QBWA 2Y1JA 4LF6K 1VSDA 2F8SA 5TKWA 4XH4A 3ITHA 4CCHA 1N8RO 5C25A 2DPNA 1NU0A 2IVOA 1ATSA 3FR0A 1F21A 2RPIA 1HPZA 1TUUA 1CXUA 5I9EB 3OYCA 2CH5A 2BANA 1BIUA 1TKXA 1W9HA 4BROA 5AFUH 4JI8K 4BR7A 4CGFA 3DJCA 4IFVA 4ISGA 4R5PA 4FK4A 2PYJA 2QXLA 4LD0A 1U48A 4JV5K 4QS9A 5CHIA 1WUAA 4EFHA 4HHTA 1NJZA 1VK0A 1C0FA 4DTSA 2O8BB 3HO1A 5KI6A 5EX5A 4X66K 3OYNA 2A1SA 4IOAL 3ZSYA 3BZCA 1HX1A 1IJJA 4DUYK 4X64K 3C7NB 2P9UA 3WNEA 2QWLA 4CF1A 3KIOA 3C95A 3TAFA 2NRXA 3LP0A 3HPHA 1NGEA 4A59A 3QESA 1RILA 3VETA 4WYBA 2Q36A 1RDAA 3L4QA 4MQ3A 4H5TA 3D2EB 4I7FA 4FJNA 4G9ZA 3BUZB 1IKVA 2ZWHA 2UXDK 3O08A 4BQZA 3H45C 4CHQA 1YJ9N 3I0SA 3DRRA 3KZBA 2IGIA 1YTUA 3K9JA 3ENOA 1HKCA 5BRDA 1HPMA 1S3XA 3EN9A 3S9HA 1JKHA 5E84A 4B3SK 4KH5A 1QQNA 4KH6A 4DFKA 4PL8A 3V1RA 3HPOA 4DV2K 1JLAA 4E7HA 3U3GA 2EWSA 1VSLA 4XIUA 4ELTA 1EQYA 4GKJK 2W6KA 2VQFK 1LAWA 2ZGZA 3AVLA 5FPDA 2UUAK 2E20A 4DQSA 3U6FA 1OH5A 3OYHA 2A41A 3DYAA 3J7AP 4GVEA 1MU2A 1RBTA 5CZ1A 2DFEA 4O44A 3V1OA 1VSFA 1JJ2M 4FM1A 3SV3A 2P9UB 4B9UA 3LDNA 3OS2A 1ASVA 3J81O 3OYIA 3AVGA 4IDKA 3VOVA 3FFKB 1VAZA 1KLMA 2A1RA 4GW6A 5BRFA 4OPJA 4IBNA 2P9KA 3CMAN 1TK0A 3DXKA 3ZSVA 4DV3K 4FJIA 1S1TA 2F7TA 3SUNA 4FW1A 3R1XA 3NMUA 3AVMA 4DFPA 1NGJA 3FZLA 3VF6A 5GAEP 4CHOA 4C8OA 2OYQA 2OPRA 2FF3B 3RSEA 2IOCA 4HCBA 1QS4A 4CJPA 1XHZA 1Q7YO 3VQ4A 4LF9K 4GV9A 1E4GT 1EP4A 1NBWA 3VQAA 4DU4A 4YOTA 3E9PA 1VSEA 4MDAA 3J7YP 1U47A 4HTLA 3ZT3A 4E7IA 3DLLL 4ELUA 4CJEA 3AARA 4FO0A 4JS4A 3VQ6A 4CGDA 3AVFA 3UE5A 4FWRA 1JLEA 4H03B 4IJNA 3VQBA 1KCFA 4ID1A 4HCCA 2W40A 3OTOK 4FLXA 1WSIA 2IC3A 4KHSA 5AQIA 2JWLA 4K8XA 1C0GA 3EKSA 1VQKN 4CD1A 2CGKA 1RBRA 2HOEA 4E19A 2WC9A 3SMSA 2YHXA 2E6LA 1DTTA 4E1JA 4Z4FA 5C12A 4FJ7A 1VQ9N 4DF4A 3QLHA 3ZEUA 3K0SA 2RN2A 4ILHA 3AA2A 4E3SA 1NGFA 3LZIA 4XH1A 5EU7A 1C1AA 5M1OA 1D4XA 1OVQA 3I0RA 4JKEA 2IS3A 4DSFA 4JAXA 2F8TA 2E8AA 2OCEA 4L3QA 4JYAK 1VQ8N 4B9MA 4N76A 4E89A 3FGUA 3ULEA 1RT5A 4CJFA 3DRSA 3KLEA 1KAXA 3DXKB 3VTIA 2UUCK 4RG8A 1T6DA 4M45A 1V4TA 5AQHA 4KTWA 4OVLA 4EP5A 2Q1NA 1HJRA 1BUPA 4EHUA 2YHAA 1SZ2A 3V9SA 4IG3A 4CIGA 4JNEA 4OGCA 1JCEA 1S1XA 5M1PA 3DLBA 1ILYA 3WUHA 3IDHA 4CE9A 3N4PA 2E2PA 3I33A 5EVZA 2I7PA 5ELZA 2ZGYA 1EKEA 3HP9A 2YNFA 4M3RA 1U2VB 5M1QA 4ID5A 4B9TA 5KGWA 4F8RA 2XY7A 5FPEA 4DV0K 2KW4A 2HHVA 3VQ7A 3M8RA 1R0AA 1XUPO 2BE2A 2HBJA 4LSNA 3CM6A 2EHGA 4B1UB 5GIPA 2HVHA 1JLQA 4DTXA 1WSFA 3LZJA 4DU1A 4F9OA 2AJQA 1RTIA 4BRQA 5AQMA 4HWIA 2O8DA 1C1CA 1K8KA 4JKCA 3ZEUB 4DQ8A 1X3NA 3H6EA 1RBVA 4JKGA 4PA1A 1QQCA 2WUSA 4ILGB 4DR3K 3RMAA 4F2SA 5M1NA 4N47A 2UXCK 2GTDA 1IKYA 2VCPA 3ZYYX 5J1EA 3WNFA 2PFUA 2QKBA 3LWMA 2ZE2A 3NGIA 2FBYA 3MAQA 3LL3A 4FZYA 3T19A 2V7YA 2IAJA 2P9LB 3TPQA 3J80O 1A5VA 3SLCA 3VEXA 1HNZK 4C23A 4BC2A 2VGMA 3CCMN 4A2AA 1N5YA 3ZT0A 3V9WA 1LWEA 3AA3A 3LM9A 3KTQA 1YHQN 3EY1A 5LMUK 4CJ7A 1LW0A 3ATVA 3NGYA 4BRCA 2XHBA 5LJWA 2WOMA 4OX9K 3TAGA 1BG3A 4CFAA 5D3GA 2ZM6K 3AVCA 4DV7K 2NUBA 2KQ2A 4YOVA 4KHNA 3VENA 3OYGA 4BE2A 4KBOA 3NH1A 3ZSWA 4X62K 1OH8A 2UUBK 5EOYA 4GVMA 4DV6K 2BGGA 2O8DB 5CYQA 1K8KB 1KTQA 2PYLA 3KK2A 1D8YA 2P9SA 4B9QA 3E66A 5E41A 2O8EB 3L3UA 1S9EA 1HNVA 1DLOA 4FW2A 4LH4A 1SUQA 1VRTA 3E01A 3HK2A 3C6HA 1MA9B 3SMPA 1ZYQA 4OKKA 5LMNK 5FRMA 2YCHA 2QKKA 4BDZA 1BHLA 2BDPA 2YKMA 4BR5A 4FWLA 3CCQN 4XEIA 4FJXA 4DG1A 2O8FB 3FLCO 2P1JA 2NRTA 3O4NA 4B8CA 4CIEA 5EY4A 1NNEA 1NGDA 1TV6A 1DEJA 4J2DA 1I39A 1L3SA 1OVYA 2CH6A 5GAHP 2VWKA 3SAFA 3B6OA 2G8VA 5BN9A 3C0BA 1L3VA 1BU6O 1XNQK 3HTVA 2Q97A 3OVNA 3D2FA 1CZAN 4M3XA 3VMFB 3QEIA 2XRIA 2DFHA 3VGKA 2XY6A 3AY9A 4FJ8A 1LAVA 2ZD1A 3QDKA 1HYVA 4J2BA 3O5BA 3NH2A 4OKEA 2CGLA 1CZBA 4E7JA 3ZT2A 1C0UA 4R79A 4BRPA 3M8PA 2DFFA 5AQZA 1A5WA 2RKIA 1EX4A 4QS7A 3VPZA 1NWKA 4CBXA 3MXJA 4KKOA 2HB5A 3IMXA 5JS1A 1W7AA 3WEEA 4IG0A 1BO5O 3MXMA 4W5QA 3CJ1A 3V1QA 3UKRA 3CC7N 4C1NK 1JCFA 1G15A 1HQEA 4H5RA 5AQOA 1E3MA 4WCEL 2Z1HA 4IZ9A 4N56A 2G8UA 1YJNN 1RFQA 2ZF5O 3LP3A 4FM0A 2IIRA 1GOAA 3OW2M 2OTJN 4W5RA 3VGMA 1XNRK 3NF9A 1HNIA 2VWBA 3ZCMA 4CECA 3SUPA 1TKDA 1BDGA 4BRKA 4JKFA 4CEEA 5BPMA 1FXXA 3RTVA 4M3WA 1RTJA 5K14A 3NAEA 3W0LA 1NKBA 3SBGA 1QVFM 2YV0X 4AHRA 3RR8A 1S1VA 2ZQBA 3O3HA 1FK9A 3D2FB 2Q31A 4W5TA 3RMDA 1K6YA 2HW3A 4BREA 4GY2B 2NRVA 3NCIA 1L5UA 1OKJA 4KHPK 3WNHA 2OA8A 1T3VA 5JLHA 2P5OA 4M7XA 3G0ZA 3O3GA 4WQ5C 3QEWA 1WSGA 4AM7A 1H1VA 4C8NA 5BPLA 4GMJB 3OYBA 4MO4A 4OKJA 5AQJA 1IKWA 5FDLA 2Z1JA 5C2FA 1WSJA 3HJFA 3CQYA 3EEQA 4AM6A 4Z0UA 3FE1A 2E2QA 1CZ9A 4CZMA 1NMDA 4B1XB 4BR4A 1RT6A 4BRNA 3SJJA 4JK8A 2HHUA 4DR2K 1N6QA 3VEOA 2V51B 3OYMA 3T1HK 1K9MO 4H0PA 2FSNA 1U4BA 4B3MK 4Y1CA 3LM2A 4YDUA 1YAGA 4A62A 3CJCA 4I9LA 3VQEA 4AHUA 2ETJA 4I6MB 2KZZA 1NMNA 4BDYA 3LALA 4FLUA 3D2EA 3ZSOA 3ZETB 3CJAA 3NF7A 1TK8A 4A5AA 4PKIA 3CYMA 2I5JA 2F9TA 3HOSA 2OZSA 2XY8A 3PIPL 5C2DA 2HNYA 3IFRA 1GOBA 4ZHRA 1HJOA 2BTFA 4BQLA 4B3RK 4DU3A 4G1QA 3PX6A 3ZT4A 4AILC 3VQ9A 4U7BA 3SPZA 1NK5A 3AO5A 4JI2K 2W41A 3VF4A 3HZ6A 3P31A 4KPYA 4BVOA 3IKMA 4JKHA 5HRSA 4BC5A 3OS1A 4BGAA 1IBLK 4BG9A 3LP2A 2H3GX 2E1ZA 4CJQA 3TAMA 3U4LA 2HBKA 5LY3A 2QW9A 1NJYA 1S1UA 3KKRA 2E5LK 2P5GA 5AQSA 3RMCA 1EWQA 3OYFA 4B9VA 1KSPA 4LC9B 3OYKA 3QIPA 2D4WA 2XO7A 2FSKA 1VQMN 3M1FA 3NVKA 1U04A 5AZIB 4L8RB 3L8BA 3H1VX 3U3YA 4DV1K 2FSJA 3LDQA 1ITGA 4O4GA 4H5VA 1I3AA 3NBPA 1RBSA 3HBTA 4HTUA 1K8AO 1EETA 4QS8A 1RBUA 3QO9A 3GG4A 2PY5A 4FSVA 3VEZA 2GV9A 4DWIA 1IG8A 4DTNA 1Q82O 1V4SA 3IG1A 2HNZA 1QSLA 3VGLA 4ZTFA 3PO4A 3OYEA 4DQQA 4K8ZA 3WXKA 4M7YA 1VQPN 1S6PA 3CQ8A 2OTLN 3L4IA 5F1XA 2X74A 1C0MA 2HMPA 3SUOA 3QFUA 5HP1A 4CZEA 4CF0A 1LWCA 3PV8A 4M3YA 3JXUA 3V4IA 1X9JA 5JLFA 4FK0A 1NGCA 3MN6A 3QINA 3TAPA 4FCYA 1Q9YA 4DSLA 4GKKK 3KK1A 4FJ9A 3CJ9A 1RDCA 4FWOA 3QNNA 1RDWX 1KVBA 2HHWA 2X78A 4BC3A 2W42A 4BDPA 3BGRA 1GLDG 3SCXA 1U6ZA 3A5NC 3KLIA 4YORA 1BQMA 4FL9A 3OY9A 3OYJA 2GX9A 1DKGD 4YDUC 3VQ8A 3CXCM 2FF6A 4KB0A 3EL2A 4AQYK 2B4JA 1RDUA 1RDBA 4FWMA 2HHHK 3PY8A 4PKGA 1BOTO 4M41A 1D9FA 3LDLA 3OYDA 4CZLA 3CFPA 4B3TK 1IO2A 4AHSA 2VQEK 4B1VA 3S3OA 4N5SA 2QWMA 3CFOA 3N4QA 3R6MA 3ID8A 3G6EN 4FLVA 2QK9A 4FK2A 3L6QA 4WF9L 2P51A 3BY5A 1T44A 3MWTA 1XMOK 2ASPA 4CJ5A 3QERA 1U2VA 4CEZA 4YY3K 2D0BA 1J54A 1GLAG 3KK7A 3KD1E 3ZLJA 1REVA 5C15A 3SYZA 4DTJA 1C6VA 1TL3A 3G71N 5H1SQ 5MLCQ 3A2FA 4DLGA 4YOYA 3RWUA 4EP4A 2ITGA 4M3TA 3T7ZA 4C8KA 4PWDA 2E1YA 4H4MA 1BI4A 4FJKA 1VQ7N 4NCAA 3AAQA 3MCAB 2OPSA 5HRNA 3Q7CA 1GLCG 4O0JA 3I56N 5EXWA 4UQGA 2HBMA 1Q18A 3O6WA 1I94K 1HLUA 5AQXA 3EZWA 3TR8A 4RWTA 5DMRA 1KD1O 3HYFA 4FLWA 4U67L 3HVTA 2QM1A 4IFEA 1WSEA 4KI6A 4CGGA 3E9LA 1ZBUA 1HQUA 2P9LA 3HXMA 5B8HA 2YJFA 3L2RA 5FPMA 1S22A 5IWAK 1XHXA 4B8AB 1NOYA 2A3ZA 3AVHA 3ENHA 4CJVA 4LF5K 4B08A 3WNGA 3KLHA 4Q0BA 3CCEN 4IO8A 4BRIA 1RT2A 3QNOA 4BR2A 5ADXA 2VG7A 4CFDA 1JXEA 3EO3A 3TSUA 3MDQA 1QZ6A 3CPWM 3TSQA 1EXQA 1X1PA 4IXCA 3SBTA 5AQPA 3C6AA 2HVIA 1XC9A 3K5LA 1NKCA 1LV5A 3CMEN 3F9KA 1N34K 4PHTX 1TL1A 2Q0UA 4IO9L 5IT9O 1FKOA 1S1WA 4Y0WA 3O9QA 1BI4B 3BEXA 5KPRA 1KAZA 4JI1K 2Q3SA 4CEQA 4KV8A 3IAYA 3JSMA 4DTMA 4IOXA 3OHRA 2KLAA 3KWGA 3A5OC 3O9TA 1GLBG 4Z4EA 3AVKA 4DKWA 2XY5A 4FWSA 5AZJA 4FLYA 5A2QO 3HSTB 5AQWA 3PSIA 2O8EA 1KRPA 3ZX2A 4H0YB 1WAJA 4JK9A 3VA3A 1UWBA 4JD2A 5ADXH 4GV6A 3TI0A 2IVNA 4NB4A 3FFIA 2WONA 3MEGA 1BA0A 1NJIO 2RF2A 3CETA 1KAYA 4J2EA 1WBBA 4NXNK 3J7ZO 2O8FA 3C6TA
chains in the Genus database with same CATH topology
4IG0A 1YT3A 3ULDA 1D9DA 3MXMA 4Z4HA 4W5QA 3V1QA 1IG9A 4CGFA 1YVUA 3OS0A 3SI6A 1NJWA 4IFVA 4CGIA 3H08A 1SL0A 4KHQA 4R5PA 2E6MA 3ZT1A 3DOKA 3HT3A 3TWHA 2PYJA 5J2MA 5KTQA 2HMIA 4M3ZA 1ZBFA 3AO2A 2KZMA 4LD0A 1G15A 1HQEA 3NDKA 4HUEA 1U48A 3TANA 3LAKA 4CHZA 1XI1A 4C8LA 3T1AA 3T3FA 1S5JA 2Z1HA 4Z4GA 4N56A 4HHTA 1VK0A 1NJZA 2G8UA 4DTSA 4J2AA 3SZ2A 3DLRA 3LP3A 4FM0A 1GOAA 3HO1A 2D5RA 4E7LA 5KI6A 1RTDA 1QTMA 4W5RA 3V81A 4NYNA 4RW6A 3OYNA 3LAMA 3OYAA 3NF9A 2DTUA 2A1SA 2G8FA 3ZSYA 1HNIA 2YKNA 3ZCMA 3AVIA 4CECA 3SUPA 1TKDA 1NKEA 4CEEA 4RW7A 1FXXA 3LPTA 3WNEA 3RTVA 4CF1A 3PO5A 4CFBA 4M3WA 1NK9A 1Z25A 3AA5X 4I9QA 3KIOA 3C95A 1RTJA 5K14A 3NAEA 1NKBA 3TAFA 3ASMA 2GBZA 2YV0X 4AHRA 5CYMA 3RR8A 1Y97A 3LP0A 3HPHA 1S1VA 1IKXA 2ZQBA 3O3HA 1RILA 1FK9A 3QESA 3NH0A 2OPPA 4W5TA 3SQ2A 3RMDA 2D0CA 1K6YA 4CJLA 2HW3A 3ZSRA 1BQNA 1RDAA 3K5OA 4MQ3A 5T7BA 3NCIA 1L5UA 3IS9A 2X6SA 4I7FA 3WNHA 3V9ZA 4CJWA 2OA8A 3TABA 3RMBA 3L2QA 4OLBA 1IKVA 4QAGA 4CHQA 3DM2A 4FJHA 3K59A 2P5OA 4DTOA 1RT1A 3G0ZA 3O3GA 4KREA 3I0SA 3DRRA 4KB1A 2IGIA 1YTUA 4CGJA 3QEWA 4DTPA 1SKSA 1WSGA 1VSMA 4FLTA 1VSJA 1VRUA 3AVAA 4DMNA 1BISA 4C8NA 3OYBA 4GMJB 3S9HA 1JKHA 1NK4A 4OKJA 1IKWA 5FDLA 5KRTA 1CXQA 2Z1JA 4KRFA 4CEAA 1WSJA 3HJFA 4DSJA 3M8QA 4KTZA 3KKSA 4KHYA 4W5NA 4DFKA 3PX0A 4Z0UA 4E7KA 5I42A 3V1RA 3HPOA 1CZ9A 5FROA 1WN7A 2G8HA 1NJXA 3SV4A 5HLFA 1JLAA 4E7HA 1LW2A 1RT6A 3SJJA 3V9UA 3U3GA 5HBMA 1VSLA 4XIUA 2HHUA 1N6QA 4ELTA 3OYMA 4FJNA 1TGOA 3SQ1A 1LAWA 3AVLA 1U4BA 4H8KA 3G10A 2FBVA 4DQSA 2VWJA 4Y1CA 3U6FA 3OYHA 1JXBA 2Z1IA 2Z1GA 2KFZA 3DYAA 3CFRA 1MU2A 1RBTA 5CZ1A 1RDDA 2DFEA 4O44A 4I9LA 3VQEA 3V1OA 2ETJA 4AHUA 3NGZA 2KZZA 4BDYA 3LALA 1VSFA 4FLUA 4FJMA 4WE1A 4FM1A 3TAQA 3SV3A 3ZSOA 5KGXA 5J2QA 4B9UA 1UOCA 3K2PA 3OS2A 3NF7A 1TK8A 4DQIA 3VQPA 3CYMA 1ASVA 4OJRA 2I5JA 3OYIA 3AVGA 4IDKA 4JRPA 1RT3A 1YTAA 2OZSA 1KLMA 4QOZB 4O0IA 4GW6A 2A1RA 2XY8A 4OPJA 4IBNA 4FVMA 3VQQA 1TK0A 1W0HA 2HNYA 3ZSVA 2IDOA 3DOLA 1GOBA 2Y1IA 4FJIA 1S1TA 3SUNA 4FW1A 4ZHRA 3AVMA 4DFPA 4DU3A 4G1QA 2JGUA 3PX6A 2HHTA 3ZT4A 4AILC 4CHOA 3VQ9A 3OJSA 2OYQA 1BCMA 2OPRA 4C8OA 2IOCA 3V9XA 3SPZA 4HCBA 1NK5A 1QS4A 4NYFA 3AO5A 4CJPA 1XHZA 3VQ4A 4CK3A 1EP4A 3VQAA 3DRPA 4DU4A 4Z4IA 4KPYA 1VSEA 4BE0A 5HRSA 1U47A 3ZT3A 4E7IA 4ELUA 1SV5A 4CJEA 5KRSA 3OS1A 4BWJA 3O3FA 3HVRA 3SQ0A 3MECA 4BWMA 3VQ6A 4CGDA 3L2VA 3AVFA 4JS4A 3LP2A 3QIOA 1TK5A 1TAQA 1JLEA 3P1GA 4CJQA 3D45A 1WNSA 3TAMA 4N41A 4KHUA 3PUFA 3VQBA 1KCFA 4ID1A 4HCCA 1T03A 4NCBA 1NJYA 1S1UA 3KKRA 1L3TA 3LANA 3RMCA 2P5GA 4QCLA 2LSNA 3OYFA 4B9VA 4FLXA 5CY4A 1KSPA 1WSIA 4F4KA 1QE1A 2IC3A 3OYKA 3QIPA 4KHSA 3AVBA 3DLEA 3QEPA 2XO7A 1RTHA 1LWFA 1TVRA 3VA0A 4K8XA 3MEDA 5JS2A 1U04A 4HVJA 1RBRA 1NK0A 4E19A 3QEVA 1J9AA 4L8RB 4ICLA 3L2WA 4DSIA 4B9LA 3L8BA 4TSXA 2VG6A 2E6LA 3U3YA 4MFBA 4KTQA 3NF8A 1DTTA 3K58A 1QSYA 4HUFA 1KFSA 1ITGA 4DTRA 4O4GA 3ZSQA 4DSEA 4FJJA 1I3AA 3KLFA 3NBPA 4Z4FA 1RBSA 1X9WA 4OLAA 2FC0A 4FJ7A 4DF4A 3QLHA 1RCHA 4CFCA 2RN2A 5SZTA 2OPQA 4HTUA 3AA2A 4E3SA 3LZIA 1EETA 1RBUA 3QO9A 5EU7A 2PY5A 1C1AA 1ASWA 4IFYA 3V6DA 3DLHA 1ZBIA 2VG5A 3I0RA 4JLHA 4I2QA 4FLZA 2IS3A 2GV9A 4DSFA 5HROA 5HRRA 4C8MA 4DWIA 1JLFA 2F8TA 4DTNA 3RR7A 1VSKA 4B9MA 4N76A 4E89A 3IG1A 3AO4A 1RT5A 4CJFA 2FBXA 4NCGA 3DRSA 2HNZA 3KLEA 4CGHA 1HMVA 3PX4A 4LH5A 4RW9A 4ZTFA 1QSLA 3OYEA 3PO4A 4F3OA 4RG8A 4CERA 4BACA 4DQQA 4M45A 4DS4A 4DS5A 4K8ZA 4B9SA 1C1BA 4KTWA 1S6PA 3CQ8A 4OVLA 4EP5A 1HJRA 2YHAA 3VQDA 1U45A 4JRQA 3V9SA 3HL8A 3VQ5A 1Q9XA 4IG3A 4YFUA 4CIGA 2X74A 3EYZA 4OGCA 1C0MA 3AV9A 1WSHA 1VSHA 4LY7A 3K57A 3SUOA 1S1XA 2GUIA 3TAEA 1X9SA 3DLBA 4FJ5A 3NHGA 5HP1A 1TAUA 4CF0A 1J53A 1LWCA 3OJUA 4CE9A 3V4IA 3PV8A 3AVNA 4M3YA 1TKTA 4FK0A 3QINA 2HHXA 3TAPA 4FCYA 3NF6A 1Q9YA 4DSLA 3KK1A 2YNHA 4FJ9A 1EKEA 2HHSA 4CJ4A 1S6QA 3D0PA 3SPYA 4DSKA 1RDCA 4OGEA 1NK6A 4FYDA 3HP9A 2YNFA 4M3RA 3QNNA 1T7PA 1KVBA 2HHWA 2X78A 5HRPA 4ID5A 4CK2A 4B9TA 1RT7A 5KGWA 4EZ9A 2XY7A 4F8RA 2W42A 1JL2A 4BDPA 4ZTJA 3BGRA 3ZSZA 1L3UA 3SCXA 2KW4A 1T05A 2G8WA 4FM2A 3KLIA 5CZ2A 2HHVA 3VQ7A 3M8RA 1BQMA 4OPKA 4JS5A 1R0AA 4CJUA 3OY9A 3OYJA 2O4IA 2BE2A 3KLGA 4LSNA 2B6AA 3QEXA 4B9NA 3VQ8A 3CM6A 4CK1A 2G8IA 1HYSA 3P5JA 2EHGA 4KB0A 2B4JA 2D0AA 1JLQA 4DTXA 2HVHA 1O1WA 1WSFA 1RDBA 3LZJA 4BE1A 3KK3A 4E1NA 3KJVA 4DU1A 3DLKA 1BGXT 4E0DA 1RTIA 2AJQA 1IH7A 4FZZA 3AA4A 3PY8A 4LSLA 3SNNA 3UIQA 3AO1A 3LPUA 4Y1DA 1C1CA 4DQRA 4M41A 4O5BA 1WLJA 1D9FA 3ZSXA 3VQCA 1RBVA 3OYDA 4PA1A 3CFPA 1QQCA 3RMAA 1IO2A 4F2SA 1B9DA 4AHSA 4N47A 1IKYA 3S3OA 4N5SA 5J1EA 3CFOA 3WNFA 1S9GA 2QKBA 1VSIA 3LWMA 1WAFA 3F73A 2ZE2A 2G8KA 3NGIA 1A5XA 2FBYA 3KD5E 3MAQA 2DY4A 1QSSA 4YNQA 4FLVA 4FZYA 1FKPA 2QK9A 3T19A 2IAJA 4IKFA 4DLEA 4FK2A 2P51A 1JLCA 5J2PA 4FK4A 1RT4A 4CJ5A 3QERA 1ASUA 1A5VA 3ALYA 4CEZA 2D0BA 1J54A 3MEEA 4I2PA 4CHYA 1Q8IA 3KD1E 4AHTA 3LDSA 4CEDA 1REVA 4CEBA 3SYZA 1C6VA 4CESA 2R7YA 2O4GA 4DTJA 4DFMA 1N5YA 4Q5VA 4KAZA 1TL3A 2HHQA 3ZT0A 4KFBA 3V9WA 4CHNA 1LWEA 1J5OA 3AA3A 4DLGA 3A2FA 3C94A 3KTQA 4EP4A 3RWUA 2ITGA 3EY1A 4M3TA 4C8KA 4PWDA 4H4MA 1D5AA 4M3UA 1LW0A 3I8DA 3NGYA 4PY5A 1BI4A 3O4QA 4FJKA 1C0TA 3B6PA 3CG7A 5J2NA 2XHBA 3SUQA 4W5OA 3DMJA 4CHPA 2WOMA 4NCAA 3ISNC 3C6UA 1UA1A 3OYLA 3TAGA 4CFAA 2OPSA 5HRNA 5D3GA 4O0JA 3AVCA 2KFNA 1JL1A 2NUBA 3MXIA 4UQGA 1ZBHA 4FJLA 2YNIA 1HYZA 2KQ2A 1QHTA 4KHNA 4FJGA 2PZSA 5I3UA 2QXFA 3TR8A 5DMRA 4CJRA 4BE2A 2F96A 4KO0A 3OYGA 2X6NA 1BIZA 1TKZA 3HYFA 4FLWA 1SKWA 3S3MA 4KI4A 3NH1A 3HVTA 3ZSWA 2B5JA 1UA0A 1WSEA 4KI6A 4CGGA 3THVA 3BDPA 4DTUA 5FRNA 4B3OA 4GVMA 2BGGA 1BL3A 1U49A 1ZBUA 1HQUA 5CYQA 4CF2A 3HXMA 4F2RA 1KTQA 3L2RA 3NFAA 1SL2A 4CF8A 2PYLA 3KK2A 3NE6A 1D8YA 2EX3A 1ZBLA 1XHXA 4CJTA 4B8AB 1NOYA 1KFDA 4DQPA 4AHCA 4ELVA 3M8SA 3AVHA 4F3TA 5E41A 1Z26A 3L3UA 5DK5A 1S9EA 4CJSA 4CJVA 4Q0BA 4B08A 1HNVA 1DLOA 4FW2A 3WNGA 4LH4A 4CEOA 3KLHA 3LWLA 1SUQA 3K5NA 1VRTA 3E01A 3P83D 5C24A 3HK2A 1RT2A 3QNOA 4AH9A 1BCOA 1ZYQA 2OZMA 4OKKA 5FRMA 2QKKA 2FBTA 4BDZA 1RNHA 2VG7A 4CFDA 1JLGA 1BHLA 3CM5A 1KVAA 1T8EA 1JXEA 2BDPA 2YKMA 4RW8A 4PUOA 4O55A 2JLEA 3TARA 4FJXA 4DG1A 1HRHA 1EXQA 4CJKA 3O4NA 1X1PA 2P1JA 5SWMA 4B8CA 4CIFA 3DI6A 2HVIA 4CIEA 3JYTA 1NK8A 1GOCA 1XC9A 3K5LA 1NKCA 3LP1A 1LV5A 3F9KA 4EZ6A 1KVCA 3L2UA 1CLQA 2KTQA 1TL1A 1TV6A 4J2DA 3RRGA 1FKOA 1S1WA 1I39A 1L3SA 4KHWA 1JLBA 1BI4B 2E4LA 1UAXA 2VWKA 2ATQA 4HUGA 4DFJA 3B6OA 3K5MA 2G8VA 3VN5A 4H4OA 2HNDA 2Q3SA 4E1MA 1SL1A 1DTQA 1L3VA 4CEQA 4Z4CA 4KV8A 3SQ4A 3AVJA 3OVNA 3IAYA 4CEFA 3JSMA 4DTMA 4FZXC 3HP6A 3QEIA 3QETA 1B92A 2DFHA 2XRIA 2XY6A 4M3XA 1X9MA 4Z4EA 3AVKA 1B9FA 3DLGA 2XY5A 3EZ5A 3S3NA 4FJ8A 4FLYA 3HSTB 4AHVA 3RRHA 1LAVA 2ZD1A 2Y1JA 1VSDA 1HYVA 4J2BA 1KRPA 2F8SA 2YNGA 4RW4A 3NH2A 4M42A 4CCHA 3ITHA 4OKEA 1NK7A 1WAJA 1CZBA 5C25A 1UWBA 3HPGA 3ZT2A 4CF9A 3VA3A 1C0UA 4E7JA 4DF8A 3M8PA 3TI0A 2DFFA 3IRXA 1A5WA 3FFIA 1KLNA 4PQUA 1XWLA 2RKIA 1EX4A 2WONA 3HM9A 3MEGA 4FXDA 2YHBA 3MXJA 1F21A 2RPIA 1HPZA 4KKOA 1NOZA 1CXUA 2HB5A 3OYCA 1SKRA 3L3VA 2RF2A 5JS1A 4CJ3A 4J2EA 2BANA 1BIUA 3AO3A 5C42A 1TKXA 1W9HA 3C6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IG0 A;  1YT3 A;  3ULD A;  1D9D A;  3MXM A;  4Z4H A;  4W5Q A;  3V1Q A;  1IG9 A;  4CGF A;  1YVU A;  3OS0 A;  3SI6 A;  1NJW A;  4IFV A;  4CGI A;  3H08 A;  1SL0 A;  4KHQ A;  4R5P A;  2E6M A;  3ZT1 A;  3DOK A;  3HT3 A;  3TWH A;  2PYJ A;  5J2M A;  5KTQ A;  2HMI A;  4M3Z A;  1ZBF A;  3AO2 A;  2KZM A;  4LD0 A;  1G15 A;  1HQE A;  3NDK A;  4HUE A;  1U48 A;  3TAN A;  3LAK A;  4CHZ A;  1XI1 A;  4C8L A;  3T1A A;  3T3F A;  1S5J A;  2Z1H A;  4Z4G A;  4N56 A;  4HHT A;  1VK0 A;  1NJZ A;  2G8U A;  4DTS A;  4J2A A;  3SZ2 A;  3DLR A;  3LP3 A;  4FM0 A;  1GOA A;  3HO1 A;  2D5R A;  4E7L A;  5KI6 A;  1RTD A;  1QTM A;  4W5R A;  3V81 A;  4NYN A;  4RW6 A;  3OYN A;  3LAM A;  3OYA A;  3NF9 A;  2DTU A;  2A1S A;  2G8F A;  3ZSY A;  1HNI A;  2YKN A;  3ZCM A;  3AVI A;  4CEC A;  3SUP A;  1TKD A;  1NKE A;  4CEE A;  4RW7 A;  1FXX A;  3LPT A;  3WNE A;  3RTV A;  4CF1 A;  3PO5 A;  4CFB A;  4M3W A;  1NK9 A;  1Z25 A;  3AA5 X;  4I9Q A;  3KIO A;  3C95 A;  1RTJ A;  5K14 A;  3NAE A;  1NKB A;  3TAF A;  3ASM A;  2GBZ A;  2YV0 X;  4AHR A;  5CYM A;  3RR8 A;  1Y97 A;  3LP0 A;  3HPH A;  1S1V A;  1IKX A;  2ZQB A;  3O3H A;  1RIL A;  1FK9 A;  3QES A;  3NH0 A;  2OPP A;  4W5T A;  3SQ2 A;  3RMD A;  2D0C A;  1K6Y A;  4CJL A;  2HW3 A;  3ZSR A;  1BQN A;  1RDA A;  3K5O A;  4MQ3 A;  5T7B A;  3NCI A;  1L5U A;  3IS9 A;  2X6S A;  4I7F A;  3WNH A;  3V9Z A;  4CJW A;  2OA8 A;  3TAB A;  3RMB A;  3L2Q A;  4OLB A;  1IKV A;  4QAG A;  4CHQ A;  3DM2 A;  4FJH A;  3K59 A;  2P5O A;  4DTO A;  1RT1 A;  3G0Z A;  3O3G A;  4KRE A;  3I0S A;  3DRR A;  4KB1 A;  2IGI A;  1YTU A;  4CGJ A;  3QEW A;  4DTP A;  1SKS A;  1WSG A;  1VSM A;  4FLT A;  1VSJ A;  1VRU A;  3AVA A;  4DMN A;  1BIS A;  4C8N A;  3OYB A;  4GMJ B;  3S9H A;  1JKH A;  1NK4 A;  4OKJ A;  1IKW A;  5FDL A;  5KRT A;  1CXQ A;  2Z1J A;  4KRF A;  4CEA A;  1WSJ A;  3HJF A;  4DSJ A;  3M8Q A;  4KTZ A;  3KKS A;  4KHY A;  4W5N A;  4DFK A;  3PX0 A;  4Z0U A;  4E7K A;  5I42 A;  3V1R A;  3HPO A;  1CZ9 A;  5FRO A;  1WN7 A;  2G8H A;  1NJX A;  3SV4 A;  5HLF A;  1JLA A;  4E7H A;  1LW2 A;  1RT6 A;  3SJJ A;  3V9U A;  3U3G A;  5HBM A;  1VSL A;  4XIU A;  2HHU A;  1N6Q A;  4ELT A;  3OYM A;  4FJN A;  1TGO A;  3SQ1 A;  1LAW A;  3AVL A;  1U4B A;  4H8K A;  3G10 A;  2FBV A;  4DQS A;  2VWJ A;  4Y1C A;  3U6F A;  3OYH A;  1JXB A;  2Z1I A;  2Z1G A;  2KFZ A;  3DYA A;  3CFR A;  1MU2 A;  1RBT A;  5CZ1 A;  1RDD A;  2DFE A;  4O44 A;  4I9L A;  3VQE A;  3V1O A;  2ETJ A;  4AHU A;  3NGZ A;  2KZZ A;  4BDY A;  3LAL A;  1VSF A;  4FLU A;  4FJM A;  4WE1 A;  4FM1 A;  3TAQ A;  3SV3 A;  3ZSO A;  5KGX A;  5J2Q A;  4B9U A;  1UOC A;  3K2P A;  3OS2 A;  3NF7 A;  1TK8 A;  4DQI A;  3VQP A;  3CYM A;  1ASV A;  4OJR A;  2I5J A;  3OYI A;  3AVG A;  4IDK A;  4JRP A;  1RT3 A;  1YTA A;  2OZS A;  1KLM A;  4QOZ B;  4O0I A;  4GW6 A;  2A1R A;  2XY8 A;  4OPJ A;  4IBN A;  4FVM A;  3VQQ A;  1TK0 A;  1W0H A;  2HNY A;  3ZSV A;  2IDO A;  3DOL A;  1GOB A;  2Y1I A;  4FJI A;  1S1T A;  3SUN A;  4FW1 A;  4ZHR A;  3AVM A;  4DFP A;  4DU3 A;  4G1Q A;  2JGU A;  3PX6 A;  2HHT A;  3ZT4 A;  4AIL C;  4CHO A;  3VQ9 A;  3OJS A;  2OYQ A;  1BCM A;  2OPR A;  4C8O A;  2IOC A;  3V9X A;  3SPZ A;  4HCB A;  1NK5 A;  1QS4 A;  4NYF A;  3AO5 A;  4CJP A;  1XHZ A;  3VQ4 A;  4CK3 A;  1EP4 A;  3VQA A;  3DRP A;  4DU4 A;  4Z4I A;  4KPY A;  1VSE A;  4BE0 A;  5HRS A;  1U47 A;  3ZT3 A;  4E7I A;  4ELU A;  1SV5 A;  4CJE A;  5KRS A;  3OS1 A;  4BWJ A;  3O3F A;  3HVR A;  3SQ0 A;  3MEC A;  4BWM A;  3VQ6 A;  4CGD A;  3L2V A;  3AVF A;  4JS4 A;  3LP2 A;  3QIO A;  1TK5 A;  1TAQ A;  1JLE A;  3P1G A;  4CJQ A;  3D45 A;  1WNS A;  3TAM A;  4N41 A;  4KHU A;  3PUF A;  3VQB A;  1KCF A;  4ID1 A;  4HCC A;  1T03 A;  4NCB A;  1NJY A;  1S1U A;  3KKR A;  1L3T A;  3LAN A;  3RMC A;  2P5G A;  4QCL A;  2LSN A;  3OYF A;  4B9V A;  4FLX A;  5CY4 A;  1KSP A;  1WSI A;  4F4K A;  1QE1 A;  2IC3 A;  3OYK A;  3QIP A;  4KHS A;  3AVB A;  3DLE A;  3QEP A;  2XO7 A;  1RTH A;  1LWF A;  1TVR A;  3VA0 A;  4K8X A;  3MED A;  5JS2 A;  1U04 A;  4HVJ A;  1RBR A;  1NK0 A;  4E19 A;  3QEV A;  1J9A A;  4L8R B;  4ICL A;  3L2W A;  4DSI A;  4B9L A;  3L8B A;  4TSX A;  2VG6 A;  2E6L A;  3U3Y A;  4MFB A;  4KTQ A;  3NF8 A;  1DTT A;  3K58 A;  1QSY A;  4HUF A;  1KFS A;  1ITG A;  4DTR A;  4O4G A;  3ZSQ A;  4DSE A;  4FJJ A;  1I3A A;  3KLF A;  3NBP A;  4Z4F A;  1RBS A;  1X9W A;  4OLA A;  2FC0 A;  4FJ7 A;  4DF4 A;  3QLH A;  1RCH A;  4CFC A;  2RN2 A;  5SZT A;  2OPQ A;  4HTU A;  3AA2 A;  4E3S A;  3LZI A;  1EET A;  1RBU A;  3QO9 A;  5EU7 A;  2PY5 A;  1C1A A;  1ASW A;  4IFY A;  3V6D A;  3DLH A;  1ZBI A;  2VG5 A;  3I0R A;  4JLH A;  4I2Q A;  4FLZ A;  2IS3 A;  2GV9 A;  4DSF A;  5HRO A;  5HRR A;  4C8M A;  4DWI A;  1JLF A;  2F8T A;  4DTN A;  3RR7 A;  1VSK A;  4B9M A;  4N76 A;  4E89 A;  3IG1 A;  3AO4 A;  1RT5 A;  4CJF A;  2FBX A;  4NCG A;  3DRS A;  2HNZ A;  3KLE A;  4CGH A;  1HMV A;  3PX4 A;  4LH5 A;  4RW9 A;  4ZTF A;  1QSL A;  3OYE A;  3PO4 A;  4F3O A;  4RG8 A;  4CER A;  4BAC A;  4DQQ A;  4M45 A;  4DS4 A;  4DS5 A;  4K8Z A;  4B9S A;  1C1B A;  4KTW A;  1S6P A;  3CQ8 A;  4OVL A;  4EP5 A;  1HJR A;  2YHA A;  3VQD A;  1U45 A;  4JRQ A;  3V9S A;  3HL8 A;  3VQ5 A;  1Q9X A;  4IG3 A;  4YFU A;  4CIG A;  2X74 A;  3EYZ A;  4OGC A;  1C0M A;  3AV9 A;  1WSH A;  1VSH A;  4LY7 A;  3K57 A;  3SUO A;  1S1X A;  2GUI A;  3TAE A;  1X9S A;  3DLB A;  4FJ5 A;  3NHG A;  5HP1 A;  1TAU A;  4CF0 A;  1J53 A;  1LWC A;  3OJU A;  4CE9 A;  3V4I A;  3PV8 A;  3AVN A;  4M3Y A;  1TKT A;  4FK0 A;  3QIN A;  2HHX A;  3TAP A;  4FCY A;  3NF6 A;  1Q9Y A;  4DSL A;  3KK1 A;  2YNH A;  4FJ9 A;  1EKE A;  2HHS A;  4CJ4 A;  1S6Q A;  3D0P A;  3SPY A;  4DSK A;  1RDC A;  4OGE A;  1NK6 A;  4FYD A;  3HP9 A;  2YNF A;  4M3R A;  3QNN A;  1T7P A;  1KVB A;  2HHW A;  2X78 A;  5HRP A;  4ID5 A;  4CK2 A;  4B9T A;  1RT7 A;  5KGW A;  4EZ9 A;  2XY7 A;  4F8R A;  2W42 A;  1JL2 A;  4BDP A;  4ZTJ A;  3BGR A;  3ZSZ A;  1L3U A;  3SCX A;  2KW4 A;  1T05 A;  2G8W A;  4FM2 A;  3KLI A;  5CZ2 A;  2HHV A;  3VQ7 A;  3M8R A;  1BQM A;  4OPK A;  4JS5 A;  1R0A A;  4CJU A;  3OY9 A;  3OYJ A;  2O4I A;  2BE2 A;  3KLG A;  4LSN A;  2B6A A;  3QEX A;  4B9N A;  3VQ8 A;  3CM6 A;  4CK1 A;  2G8I A;  1HYS A;  3P5J A;  2EHG A;  4KB0 A;  2B4J A;  2D0A A;  1JLQ A;  4DTX A;  2HVH A;  1O1W A;  1WSF A;  1RDB A;  3LZJ A;  4BE1 A;  3KK3 A;  4E1N A;  3KJV A;  4DU1 A;  3DLK A;  1BGX T;  4E0D A;  1RTI A;  2AJQ A;  1IH7 A;  4FZZ A;  3AA4 A;  3PY8 A;  4LSL A;  3SNN A;  3UIQ A;  3AO1 A;  3LPU A;  4Y1D A;  1C1C A;  4DQR A;  4M41 A;  4O5B A;  1WLJ A;  1D9F A;  3ZSX A;  3VQC A;  1RBV A;  3OYD A;  4PA1 A;  3CFP A;  1QQC A;  3RMA A;  1IO2 A;  4F2S A;  1B9D A;  4AHS A;  4N47 A;  1IKY A;  3S3O A;  4N5S A;  5J1E A;  3CFO A;  3WNF A;  1S9G A;  2QKB A;  1VSI A;  3LWM A;  1WAF A;  3F73 A;  2ZE2 A;  2G8K A;  3NGI A;  1A5X A;  2FBY A;  3KD5 E;  3MAQ A;  2DY4 A;  1QSS A;  4YNQ A;  4FLV A;  4FZY A;  1FKP A;  2QK9 A;  3T19 A;  2IAJ A;  4IKF A;  4DLE A;  4FK2 A;  2P51 A;  1JLC A;  5J2P A;  4FK4 A;  1RT4 A;  4CJ5 A;  3QER A;  1ASU A;  1A5V A;  3ALY A;  4CEZ A;  2D0B A;  1J54 A;  3MEE A;  4I2P A;  4CHY A;  1Q8I A;  3KD1 E;  4AHT A;  3LDS A;  4CED A;  1REV A;  4CEB A;  3SYZ A;  1C6V A;  4CES A;  2R7Y A;  2O4G A;  4DTJ A;  4DFM A;  1N5Y A;  4Q5V A;  4KAZ A;  1TL3 A;  2HHQ A;  3ZT0 A;  4KFB A;  3V9W A;  4CHN A;  1LWE A;  1J5O A;  3AA3 A;  4DLG A;  3A2F A;  3C94 A;  3KTQ A;  4EP4 A;  3RWU A;  2ITG A;  3EY1 A;  4M3T A;  4C8K A;  4PWD A;  4H4M A;  1D5A A;  4M3U A;  1LW0 A;  3I8D A;  3NGY A;  4PY5 A;  1BI4 A;  3O4Q A;  4FJK A;  1C0T A;  3B6P A;  3CG7 A;  5J2N A;  2XHB A;  3SUQ A;  4W5O A;  3DMJ A;  4CHP A;  2WOM A;  4NCA A;  3ISN C;  3C6U A;  1UA1 A;  3OYL A;  3TAG A;  4CFA A;  2OPS A;  5HRN A;  5D3G A;  4O0J A;  3AVC A;  2KFN A;  1JL1 A;  2NUB A;  3MXI A;  4UQG A;  1ZBH A;  4FJL A;  2YNI A;  1HYZ A;  2KQ2 A;  1QHT A;  4KHN A;  4FJG A;  2PZS A;  5I3U A;  2QXF A;  3TR8 A;  5DMR A;  4CJR A;  4BE2 A;  2F96 A;  4KO0 A;  3OYG A;  2X6N A;  1BIZ A;  1TKZ A;  3HYF A;  4FLW A;  1SKW A;  3S3M A;  4KI4 A;  3NH1 A;  3HVT A;  3ZSW A;  2B5J A;  1UA0 A;  1WSE A;  4KI6 A;  4CGG A;  3THV A;  3BDP A;  4DTU A;  5FRN A;  4B3O A;  4GVM A;  2BGG A;  1BL3 A;  1U49 A;  1ZBU A;  1HQU A;  5CYQ A;  4CF2 A;  3HXM A;  4F2R A;  1KTQ A;  3L2R A;  3NFA A;  1SL2 A;  4CF8 A;  2PYL A;  3KK2 A;  3NE6 A;  1D8Y A;  2EX3 A;  1ZBL A;  1XHX A;  4CJT A;  4B8A B;  1NOY A;  1KFD A;  4DQP A;  4AHC A;  4ELV A;  3M8S A;  3AVH A;  4F3T A;  5E41 A;  1Z26 A;  3L3U A;  5DK5 A;  1S9E A;  4CJS A;  4CJV A;  4Q0B A;  4B08 A;  1HNV A;  1DLO A;  4FW2 A;  3WNG A;  4LH4 A;  4CEO A;  3KLH A;  3LWL A;  1SUQ A;  3K5N A;  1VRT A;  3E01 A;  3P83 D;  5C24 A;  3HK2 A;  1RT2 A;  3QNO A;  4AH9 A;  1BCO A;  1ZYQ A;  2OZM A;  4OKK A;  5FRM A;  2QKK A;  2FBT A;  4BDZ A;  1RNH A;  2VG7 A;  4CFD A;  1JLG A;  1BHL A;  3CM5 A;  1KVA A;  1T8E A;  1JXE A;  2BDP A;  2YKM A;  4RW8 A;  4PUO A;  4O55 A;  2JLE A;  3TAR A;  4FJX A;  4DG1 A;  1HRH A;  1EXQ A;  4CJK A;  3O4N A;  1X1P A;  2P1J A;  5SWM A;  4B8C A;  4CIF A;  3DI6 A;  2HVI A;  4CIE A;  3JYT A;  1NK8 A;  1GOC A;  1XC9 A;  3K5L A;  1NKC A;  3LP1 A;  1LV5 A;  3F9K A;  4EZ6 A;  1KVC A;  3L2U A;  1CLQ A;  2KTQ A;  1TL1 A;  1TV6 A;  4J2D A;  3RRG A;  1FKO A;  1S1W A;  1I39 A;  1L3S A;  4KHW A;  1JLB A;  1BI4 B;  2E4L A;  1UAX A;  2VWK A;  2ATQ A;  4HUG A;  4DFJ A;  3B6O A;  3K5M A;  2G8V A;  3VN5 A;  4H4O A;  2HND A;  2Q3S A;  4E1M A;  1SL1 A;  1DTQ A;  1L3V A;  4CEQ A;  4Z4C A;  4KV8 A;  3SQ4 A;  3AVJ A;  3OVN A;  3IAY A;  4CEF A;  3JSM A;  4DTM A;  4FZX C;  3HP6 A;  3QEI A;  3QET A;  1B92 A;  2DFH A;  2XRI A;  2XY6 A;  4M3X A;  1X9M A;  4Z4E A;  3AVK A;  1B9F A;  3DLG A;  2XY5 A;  3EZ5 A;  3S3N A;  4FJ8 A;  4FLY A;  3HST B;  4AHV A;  3RRH A;  1LAV A;  2ZD1 A;  2Y1J A;  1VSD A;  1HYV A;  4J2B A;  1KRP A;  2F8S A;  2YNG A;  4RW4 A;  3NH2 A;  4M42 A;  4CCH A;  3ITH A;  4OKE A;  1NK7 A;  1WAJ A;  1CZB A;  5C25 A;  1UWB A;  3HPG A;  3ZT2 A;  4CF9 A;  3VA3 A;  1C0U A;  4E7J A;  4DF8 A;  3M8P A;  3TI0 A;  2DFF A;  3IRX A;  1A5W A;  3FFI A;  1KLN A;  4PQU A;  1XWL A;  2RKI A;  1EX4 A;  2WON A;  3HM9 A;  3MEG A;  4FXD A;  2YHB A;  3MXJ A;  1F21 A;  2RPI A;  1HPZ A;  4KKO A;  1NOZ A;  1CXU A;  2HB5 A;  3OYC A;  1SKR A;  3L3V A;  2RF2 A;  5JS1 A;  4CJ3 A;  4J2E A;  2BAN A;  1BIU A;  3AO3 A;  5C42 A;  1TKX A;  1W9H A;  3C6T A; 
#chains in the Genus database with same CATH topology
 3ULD A;  2WBN A;  4Z4H A;  2QWP A;  4DR6 K;  3SI6 A;  3H08 A;  1SL0 A;  3BF1 A;  2A42 A;  4EHT A;  3DOK A;  3HT3 A;  3TWH A;  2KZM A;  5J2M A;  5KTQ A;  2HMI A;  4M3Z A;  1ZBF A;  3AO2 A;  4HUE A;  1GLL O;  2NZT A;  1HUX A;  3TAN A;  4C8L A;  1N36 K;  2HF3 A;  3T1A A;  4DB3 A;  3T3F A;  4DR5 K;  4LF4 K;  2ZJR L;  4M63 C;  3P39 A;  3FZK A;  2D5R A;  1RTD A;  4LFB K;  1QTM A;  3V81 A;  4NYN A;  4RW6 A;  3OYA A;  2DTU A;  4FPB A;  1S72 N;  1NKE A;  3MN5 A;  4RW7 A;  3LDP A;  3LPT A;  3TTD A;  3WXI A;  3WQT A;  2UU9 K;  1NK9 A;  2P9P B;  1GLF O;  3JAM O;  1MWM A;  3ASM A;  4DV5 K;  5CYM A;  5AQY A;  4FPA A;  4BR0 A;  4CJL A;  3P4I A;  5T7B A;  2GEM A;  5AZJ B;  3H46 O;  3IS9 A;  2X6S A;  2BUP A;  4BR9 A;  4WQ5 A;  2HST A;  4JD2 B;  4FOI A;  1ZXO A;  3D6R A;  4DTP A;  1SKS A;  4B1W B;  4MO5 A;  3C65 A;  3ID6 A;  3A8Y A;  2P9N B;  3H3N O;  2F9W A;  1NK4 A;  5KRT A;  1CXQ A;  1QHA A;  2E2N A;  3R3L A;  4KTZ A;  4W5N A;  3PX0 A;  4E7K A;  1WN7 A;  3THY B;  2QI2 A;  1VQ4 N;  3V9U A;  3CCL N;  3THW A;  5HBM A;  1YIT N;  5M1F A;  4BRD A;  1TGO A;  2GWK A;  4BRF A;  4H8K A;  3G10 A;  2PAV A;  1Z05 A;  1JXB A;  2Z1G A;  2KFZ A;  5BRE A;  3CFR A;  3CC4 N;  3MX2 A;  3VEW A;  2A40 A;  3NGZ A;  2YJE A;  4FJM A;  3TAQ A;  5BR8 K;  3HI0 A;  5J2Q A;  3K2P A;  1KQS M;  3E9O A;  4DQI A;  4OJR A;  3D7E O;  4JRP A;  2HBL A;  1RT3 A;  1YTA A;  5TKY A;  3HOT A;  2WTU A;  2P9I B;  4O0I A;  4FVM A;  2IDO A;  3DOL A;  2Y1I A;  3EKU A;  1HNW K;  2QA4 N;  2I7N A;  3O4W A;  2HHT A;  3OJS A;  1BCM A;  2W6L A;  3DWL A;  4NYF A;  2NRW A;  4CK3 A;  1NG9 A;  4AF1 A;  4Z4I A;  1FJG K;  4A57 A;  4BE0 A;  5AQQ A;  3O3F A;  1IV0 A;  4BWM A;  2NLX A;  4IEI A;  4PKH A;  3L2V A;  5AQT A;  3QIO A;  5HL7 L;  5AQU A;  3F2K A;  1WNS A;  4KHU A;  4NCB A;  1L3T A;  4QCL A;  3LAN A;  2LSN A;  3AGR A;  4F4K A;  4CZK A;  1TVR A;  3VA0 A;  3MED A;  4I6M A;  3CQX A;  5JS2 A;  1P8Z A;  3THW B;  4HVJ A;  3ZET A;  1J9A A;  4ICL A;  3L2W A;  1YIJ N;  2JWK A;  2BH1 A;  4B9L A;  4JEP A;  2VG6 A;  4CW7 B;  1Y64 A;  3NF8 A;  4EAH D;  3K58 A;  1QSY A;  3TTC A;  3IUC A;  4FJJ A;  4GV3 A;  5AQK A;  3K9K A;  1X9W A;  4OLA A;  2FC0 A;  1RCH A;  3UKU B;  2WFB A;  4CFC A;  5SZT A;  3O1B A;  4LF8 K;  3G25 A;  1ASW A;  3V6D A;  3DLH A;  3O9S A;  5HRO A;  1HKG A;  3I55 N;  5HRR A;  1JLF A;  3VES A;  4NXM K;  3CCS N;  4CZJ A;  1G99 A;  2FBX A;  4H0V B;  3PX4 A;  4LH5 A;  4RW9 A;  4F3O A;  4B1Y B;  4CER A;  4B9S A;  1C1B A;  1QZ5 A;  2QEX N;  3GOI A;  3VQD A;  1E4F T;  3MMV A;  4JRQ A;  3HL8 A;  3VQ5 A;  4YFU A;  3EYZ A;  3K57 A;  2O8C B;  3AV9 A;  1VSH A;  3MN9 A;  4LY7 A;  2GUI A;  1TAU A;  1Z6R A;  3E1Y A;  3NHG A;  2VGN A;  3OJU A;  3AVN A;  5KPT A;  3M6G A;  1M1K O;  1TKT A;  1MDU B;  4GNI A;  4CD3 A;  2HHX A;  5E26 A;  3NF6 A;  2YNH A;  5AZI A;  3QFP A;  4CJ4 A;  3CC2 N;  3D0P A;  3SPY A;  4DSK A;  4FYD A;  4OGE A;  1NK6 A;  2QWQ A;  4DCH A;  3HRG A;  3W3D A;  3ZSZ A;  4MLE A;  2G8W A;  5CZ2 A;  1HKB A;  2D1K A;  4OPK A;  4CJU A;  5AR0 A;  5GAD P;  4WFB L;  3BP8 A;  1OH7 A;  4B9N A;  1NLV A;  3S41 A;  3T69 A;  4CK1 A;  1O1W A;  2D0P A;  3SQ1 A;  5KPZ A;  4BE1 A;  3KK3 A;  4E1N A;  3KJV A;  3ENB A;  3DLK A;  1BGX T;  4E0D A;  1IH7 A;  3WXJ A;  3AA4 A;  2F4V K;  3OBY A;  4LSL A;  1GLE G;  3UIQ A;  4Y1D A;  4DQR A;  5JMV A;  1WLJ A;  1VQ5 N;  3VER A;  1B9D A;  4JI7 K;  3VEV A;  4RCH A;  1IBM K;  1WAF A;  3F73 A;  2VYP A;  2G8K A;  1A5X A;  2RHK A;  3KD5 E;  1ZBS A;  1W97 L;  4IKF A;  3L0Q A;  4XH5 A;  1JLC A;  1RT4 A;  1ASU A;  1MWK A;  3T1Y K;  4I2P A;  3SK3 A;  4AHT A;  3LDS A;  4YOU A;  4JI3 K;  4WQ4 C;  4CEB A;  4CES A;  2HHQ A;  2O4G A;  2RE2 A;  4DR4 K;  4BGB A;  2OAN A;  3R8E A;  4CHN A;  2YHW A;  1J5O A;  1QQM A;  3F9M A;  3GBT A;  3TTF A;  4C1N I;  4M3U A;  2V52 B;  4PY5 A;  3MWP A;  3CG7 A;  5J2N A;  3TSP A;  5KQD A;  4W5O A;  3DMJ A;  4CHP A;  3ISN C;  3OYL A;  4H5N A;  2KFN A;  1JL1 A;  1KXP A;  3JS6 A;  3MXI A;  1ZBH A;  4NLB A;  2YNI A;  1QHT A;  4FJG A;  5I3U A;  1NM1 A;  2F96 A;  3SAH A;  1BIZ A;  1TKZ A;  3O9U A;  1SKW A;  1VQL N;  1W2B M;  3MX5 A;  5C10 A;  1UA0 A;  3PLA A;  2NRR A;  3THV A;  4DTU A;  5FRN A;  1BL3 A;  1U49 A;  2UXB K;  1SL2 A;  3CJB A;  3CHW A;  3HSC A;  3NE6 A;  4CVN E;  1ZBL A;  5KQ8 A;  4ELV A;  1KFD A;  1VHX A;  3M8S A;  3LWL A;  4DR7 K;  2NNW A;  3SAG A;  3EE8 A;  1BCO A;  2OZM A;  4IOC L;  2FBT A;  1RNH A;  1JLG A;  3VF2 A;  3A5L C;  4RW8 A;  4PUO A;  2JLE A;  3TAR A;  3KWI A;  1NGH A;  4BG8 A;  3JYT A;  1NK8 A;  1CLQ A;  5AJ3 K;  2ZJQ L;  1VQN N;  2Q2R A;  4KHW A;  4DFJ A;  2HF4 A;  1SAZ A;  3J8A A;  4BRH A;  1SL1 A;  1P90 A;  3QBX A;  4E1M A;  5GIN A;  2NRZ A;  3SQ4 A;  4FWK A;  3AVJ A;  4CEF A;  4FZX C;  3HP6 A;  3QET A;  1X9M A;  5AQL A;  2Q0R A;  1B9F A;  3CER A;  3DLG A;  3S3N A;  1DGK N;  4AHV A;  3RRH A;  1WBD A;  2GUP A;  2YNG A;  4RW4 A;  4M42 A;  2ASO A;  1NK7 A;  3HPG A;  4CF9 A;  3ZX0 A;  4DF8 A;  4H5W A;  1J6Z A;  3IRX A;  1KLN A;  3PSF A;  4PQU A;  1XWL A;  3HM9 A;  4FXD A;  1NGG A;  2YHB A;  1N32 K;  2GWJ A;  1NOZ A;  3O8M A;  1SKR A;  3L3V A;  4IWV A;  4CJ3 A;  4ISE A;  3AO3 A;  5C42 A;  3A0I X;  4KI4 A;  1YT3 A;  3U9Z A;  1YI2 N;  1D9D A;  1VQO N;  3KVG A;  3DXM A;  1IG9 A;  1YVU A;  3OS0 A;  4JN4 A;  1NJW A;  4CGI A;  4KHQ A;  2E6M A;  3ZT1 A;  4YOX A;  3EE9 A;  3NDK A;  5FPN A;  3LAK A;  4CHZ A;  1XI1 A;  1S5J A;  3BZK A;  4Z4G A;  4J2A A;  3SZ2 A;  1J5E K;  3DLR A;  4K0K K;  3M3Z A;  4E7L A;  1ATR A;  1YVN A;  3LAM A;  2J4R A;  2G8F A;  1EWR A;  2YKN A;  3AVI A;  1YXQ A;  3U8X A;  4YOW A;  3PO5 A;  4CFB A;  1Z25 A;  1NGA A;  3AA5 X;  4I9Q A;  5DM6 L;  3LDO A;  4JKD A;  5JVH L;  2A6A A;  4FWQ A;  2GBZ A;  1Y97 A;  1IKX A;  3SQ2 A;  4V19 S;  3UB5 A;  2OPP A;  3NH0 A;  1JCG A;  2GEL A;  4JHD A;  2D0C A;  1WB9 A;  4K42 A;  3CCR N;  1TYQ A;  3ZSR A;  1BQN A;  3KHY A;  3K5O A;  5AQR A;  2YX6 A;  3V9Z A;  4CJW A;  3HM8 A;  3TAB A;  3RMB A;  3L2Q A;  4OLB A;  4Z94 A;  4QAG A;  3DM2 A;  4FJH A;  4A61 A;  3K59 A;  4DTO A;  1RT1 A;  4KRE A;  4KB1 A;  2P9K B;  4CGJ A;  4JI5 K;  1VSM A;  4DUZ K;  5LJV A;  1TUY A;  4FLT A;  1VSJ A;  1VRU A;  3AVA A;  4DMN A;  1BIS A;  2CGJ A;  4KRF A;  1SS6 A;  2IVP A;  4CEA A;  4JKB A;  4DSJ A;  3RSE B;  3M8Q A;  4JI0 K;  4H0T B;  2AA4 A;  3DXM B;  3KKS A;  5GAG P;  1NGI A;  4KHY A;  5I42 A;  5FRO A;  2G8H A;  4A2B A;  5BR9 A;  1NJX A;  3SV4 A;  5HLF A;  1LW2 A;  3R9P A;  3CIP A;  2P9P A;  4BRA A;  3O80 A;  4B1Z A;  3ZX3 A;  2FBV A;  2VWJ A;  5HOO A;  2KKZ A;  2Z1I A;  3H1Q A;  1RDD A;  3MCP A;  2YI1 A;  4WE1 A;  4CZF A;  5KGX A;  4MLH A;  1UOC A;  3MN7 A;  5F0X A;  3VQP A;  3MK6 A;  2PBD A;  5JIC A;  4EIA A;  2QWR A;  4FWP A;  3CCV N;  5FLX O;  3VQQ A;  1W0H A;  1YF5 L;  3A5M C;  4JHD B;  3O9R A;  3PIO L;  1XQS C;  1TYQ B;  2P9N A;  4H0O A;  1K73 O;  2E88 A;  2JGU A;  3M5R A;  3V9X A;  1EO1 A;  3GL1 A;  3DRP A;  3ULE B;  3THY A;  1SV5 A;  3SQ0 A;  3FZH A;  5KRS A;  4BWJ A;  3HVR A;  3MEC A;  1TK5 A;  1TAQ A;  4ILJ A;  3P1G A;  3D45 A;  4N41 A;  3PUF A;  3WT0 A;  1T03 A;  5DM7 L;  1HR0 K;  4CZH A;  3P38 A;  5CY4 A;  1QE1 A;  1FW6 A;  3THX A;  3AVB A;  1XMQ K;  3CI5 A;  3DLE A;  3QEP A;  1RTH A;  1LWF A;  1Q81 O;  3F5T A;  2ZJP L;  4BC4 A;  4BRL A;  4RTF D;  4K41 A;  1NK0 A;  1N33 K;  3QEV A;  4DSI A;  4NO7 A;  4UY8 O;  4TSX A;  4KTQ A;  4BRG A;  4MFB A;  4ISF A;  4J8F A;  3AGK A;  3GE1 A;  2P9I A;  4HUF A;  1KFS A;  1ATN A;  4DTR A;  2QWO A;  3ZSQ A;  4DSE A;  3KLF A;  4KH4 A;  1BA1 A;  1WOQ A;  5BN8 A;  3DAW A;  5AQF A;  2OPQ A;  5CR4 A;  4O8K A;  1M90 O;  4IFY A;  1ZBI A;  1OH6 A;  4FVU A;  2VG5 A;  4JLH A;  4I2Q A;  4FLZ A;  4C8M A;  4IEE A;  3RR7 A;  1VSK A;  4PL7 A;  3TU5 A;  3AO4 A;  4O5F A;  4NCG A;  4CGH A;  1HMV A;  4BAC A;  4DS4 A;  4DS5 A;  4IDH A;  4JKG B;  1U45 A;  5C0Y A;  1LOT B;  1Q9X A;  1RGI A;  4QOZ B;  1WSH A;  4X65 K;  5M1K A;  3TAE A;  1X9S A;  4FJ5 A;  1J53 A;  1IBK K;  2FXU A;  3FZM A;  2HHS A;  3CCJ N;  4OO1 J;  1S6Q A;  1KC8 O;  3B8A X;  4JKA A;  1T7P A;  1Q86 O;  1YJW N;  5HRP A;  4CK2 A;  4EZ9 A;  1RT7 A;  5AQV A;  1JL2 A;  2E2O A;  4ZTJ A;  3QML A;  1L3U A;  5GIO A;  1T05 A;  4FM2 A;  3THX B;  1NGB A;  4JS5 A;  3UKU A;  2O4I A;  3KLG A;  2B6A A;  3QEX A;  1DT9 A;  2UYT A;  2G8I A;  1HYS A;  3ATU A;  4WFN L;  3P5J A;  4WFA L;  2D0A A;  4K25 A;  4CI6 A;  2ITM A;  1BWF O;  4BVP A;  3GDQ A;  3O1W A;  1HNX K;  4IJA A;  4FZZ A;  2KHO A;  3SNN A;  3AO1 A;  3LPU A;  4LFA K;  4O5B A;  3ZSX A;  3VQC A;  3G4S N;  4DHY A;  2O8C A;  3OBW A;  4OPA A;  1S9G A;  1VSI A;  4NLC A;  1YUW A;  3Q7B A;  2DY4 A;  1QSS A;  4YNQ A;  1FKP A;  5BRH A;  3WXL A;  4DLE A;  1GLJ O;  3H3O B;  3OA9 A;  5J2P A;  2YHY A;  3SJH A;  4WQ4 A;  5JVG L;  5CE3 A;  3ALY A;  3RVC A;  2P9S B;  1X3M A;  3MEE A;  4CHY A;  5AQG A;  1Q8I A;  3CCU N;  3U9D A;  4CED A;  4CZG A;  4KAZ A;  2R7Y A;  4LFC K;  4DFM A;  4Q5V A;  4KFB A;  4A5B A;  2FLO A;  3C94 A;  3NVM A;  3WQU A;  4CBU A;  1D5A A;  3I8D A;  3O4Q A;  1T6C A;  1C0T A;  3B6P A;  3SUQ A;  3C6U A;  1UA1 A;  4O8U A;  4BY9 C;  4FJL A;  1HYZ A;  4JI6 K;  4MDB A;  1ZC6 A;  2PZS A;  3VEY A;  2QXF A;  4CJR A;  4KO0 A;  4LF7 K;  2X6N A;  3S3M A;  5LL6 Z;  3QB0 A;  2B5J A;  4FWN A;  3BDP A;  4B3O A;  4CF2 A;  4F2R A;  1QQO A;  4FOE A;  3FZF A;  3NFA A;  4CF8 A;  3BF3 A;  2EX3 A;  4CJT A;  4DQP A;  4AHC A;  4YHH K;  2NRH A;  3CJ7 A;  4F3T A;  1Z26 A;  5DK5 A;  4CJS A;  4CEO A;  3K5N A;  1R59 O;  4OPH A;  3P83 D;  5C24 A;  4AH9 A;  4DR1 K;  2D0O A;  2QTD A;  4JI4 K;  1QVG M;  3CM5 A;  1KVA A;  1T8E A;  1SQK A;  4O55 A;  4DV4 K;  3WEE B;  1HRH A;  1O13 A;  3WXM B;  3QIC A;  2V7Z A;  5BPN A;  1XC3 A;  4H0X B;  4CJK A;  5SWM A;  2O8B A;  3VTH A;  4CIF A;  1LCU A;  3DI6 A;  3UKR B;  1GOC A;  3CD6 N;  3I8B A;  4EZ6 A;  3LP1 A;  5AFU A;  1KVC A;  3L2U A;  5AQN A;  4CZI A;  2KTQ A;  3C7N A;  3RRG A;  1VQ6 N;  2AP1 A;  1JLB A;  3CPE A;  2E4L A;  1UAX A;  2ATQ A;  4HUG A;  3K5M A;  3VN5 A;  4JK7 A;  2QWN A;  4H4O A;  2HND A;  1DTQ A;  4Z4C A;  5F2R A;  1ESV A;  2A5X A;  1B92 A;  3AAP A;  3CF5 L;  4CBW A;  2ASM A;  3EZ5 A;  4K43 A;  4BRM A;  3QBW A;  2Y1J A;  4LF6 K;  1VSD A;  2F8S A;  5TKW A;  4XH4 A;  3ITH A;  4CCH A;  1N8R O;  5C25 A;  2DPN A;  1NU0 A;  2IVO A;  1ATS A;  3FR0 A;  1F21 A;  2RPI A;  1HPZ A;  1TUU A;  1CXU A;  5I9E B;  3OYC A;  2CH5 A;  2BAN A;  1BIU A;  1TKX A;  1W9H A;  4BRO A;  5AFU H;  4JI8 K;  4BR7 A;  4CGF A;  3DJC A;  4IFV A;  4ISG A;  4R5P A;  4FK4 A;  2PYJ A;  2QXL A;  4LD0 A;  1U48 A;  4JV5 K;  4QS9 A;  5CHI A;  1WUA A;  4EFH A;  4HHT A;  1NJZ A;  1VK0 A;  1C0F A;  4DTS A;  2O8B B;  3HO1 A;  5KI6 A;  5EX5 A;  4X66 K;  3OYN A;  2A1S A;  4IOA L;  3ZSY A;  3BZC A;  1HX1 A;  1IJJ A;  4DUY K;  4X64 K;  3C7N B;  2P9U A;  3WNE A;  2QWL A;  4CF1 A;  3KIO A;  3C95 A;  3TAF A;  2NRX A;  3LP0 A;  3HPH A;  1NGE A;  4A59 A;  3QES A;  1RIL A;  3VET A;  4WYB A;  2Q36 A;  1RDA A;  3L4Q A;  4MQ3 A;  4H5T A;  3D2E B;  4I7F A;  4FJN A;  4G9Z A;  3BUZ B;  1IKV A;  2ZWH A;  2UXD K;  3O08 A;  4BQZ A;  3H45 C;  4CHQ A;  1YJ9 N;  3I0S A;  3DRR A;  3KZB A;  2IGI A;  1YTU A;  3K9J A;  3ENO A;  1HKC A;  5BRD A;  1HPM A;  1S3X A;  3EN9 A;  3S9H A;  1JKH A;  5E84 A;  4B3S K;  4KH5 A;  1QQN A;  4KH6 A;  4DFK A;  4PL8 A;  3V1R A;  3HPO A;  4DV2 K;  1JLA A;  4E7H A;  3U3G A;  2EWS A;  1VSL A;  4XIU A;  4ELT A;  1EQY A;  4GKJ K;  2W6K A;  2VQF K;  1LAW A;  2ZGZ A;  3AVL A;  5FPD A;  2UUA K;  2E20 A;  4DQS A;  3U6F A;  1OH5 A;  3OYH A;  2A41 A;  3DYA A;  3J7A P;  4GVE A;  1MU2 A;  1RBT A;  5CZ1 A;  2DFE A;  4O44 A;  3V1O A;  1VSF A;  1JJ2 M;  4FM1 A;  3SV3 A;  2P9U B;  4B9U A;  3LDN A;  3OS2 A;  1ASV A;  3J81 O;  3OYI A;  3AVG A;  4IDK A;  3VOV A;  3FFK B;  1VAZ A;  1KLM A;  2A1R A;  4GW6 A;  5BRF A;  4OPJ A;  4IBN A;  2P9K A;  3CMA N;  1TK0 A;  3DXK A;  3ZSV A;  4DV3 K;  4FJI A;  1S1T A;  2F7T A;  3SUN A;  4FW1 A;  3R1X A;  3NMU A;  3AVM A;  4DFP A;  1NGJ A;  3FZL A;  3VF6 A;  5GAE P;  4CHO A;  4C8O A;  2OYQ A;  2OPR A;  2FF3 B;  3RSE A;  2IOC A;  4HCB A;  1QS4 A;  4CJP A;  1XHZ A;  1Q7Y O;  3VQ4 A;  4LF9 K;  4GV9 A;  1E4G T;  1EP4 A;  1NBW A;  3VQA A;  4DU4 A;  4YOT A;  3E9P A;  1VSE A;  4MDA A;  3J7Y P;  1U47 A;  4HTL A;  3ZT3 A;  4E7I A;  3DLL L;  4ELU A;  4CJE A;  3AAR A;  4FO0 A;  4JS4 A;  3VQ6 A;  4CGD A;  3AVF A;  3UE5 A;  4FWR A;  1JLE A;  4H03 B;  4IJN A;  3VQB A;  1KCF A;  4ID1 A;  4HCC A;  2W40 A;  3OTO K;  4FLX A;  1WSI A;  2IC3 A;  4KHS A;  5AQI A;  2JWL A;  4K8X A;  1C0G A;  3EKS A;  1VQK N;  4CD1 A;  2CGK A;  1RBR A;  2HOE A;  4E19 A;  2WC9 A;  3SMS A;  2YHX A;  2E6L A;  1DTT A;  4E1J A;  4Z4F A;  5C12 A;  4FJ7 A;  1VQ9 N;  4DF4 A;  3QLH A;  3ZEU A;  3K0S A;  2RN2 A;  4ILH A;  3AA2 A;  4E3S A;  1NGF A;  3LZI A;  4XH1 A;  5EU7 A;  1C1A A;  5M1O A;  1D4X A;  1OVQ A;  3I0R A;  4JKE A;  2IS3 A;  4DSF A;  4JAX A;  2F8T A;  2E8A A;  2OCE A;  4L3Q A;  4JYA K;  1VQ8 N;  4B9M A;  4N76 A;  4E89 A;  3FGU A;  3ULE A;  1RT5 A;  4CJF A;  3DRS A;  3KLE A;  1KAX A;  3DXK B;  3VTI A;  2UUC K;  4RG8 A;  1T6D A;  4M45 A;  1V4T A;  5AQH A;  4KTW A;  4OVL A;  4EP5 A;  2Q1N A;  1HJR A;  1BUP A;  4EHU A;  2YHA A;  1SZ2 A;  3V9S A;  4IG3 A;  4CIG A;  4JNE A;  4OGC A;  1JCE A;  1S1X A;  5M1P A;  3DLB A;  1ILY A;  3WUH A;  3IDH A;  4CE9 A;  3N4P A;  2E2P A;  3I33 A;  5EVZ A;  2I7P A;  5ELZ A;  2ZGY A;  1EKE A;  3HP9 A;  2YNF A;  4M3R A;  1U2V B;  5M1Q A;  4ID5 A;  4B9T A;  5KGW A;  4F8R A;  2XY7 A;  5FPE A;  4DV0 K;  2KW4 A;  2HHV A;  3VQ7 A;  3M8R A;  1R0A A;  1XUP O;  2BE2 A;  2HBJ A;  4LSN A;  3CM6 A;  2EHG A;  4B1U B;  5GIP A;  2HVH A;  1JLQ A;  4DTX A;  1WSF A;  3LZJ A;  4DU1 A;  4F9O A;  2AJQ A;  1RTI A;  4BRQ A;  5AQM A;  4HWI A;  2O8D A;  1C1C A;  1K8K A;  4JKC A;  3ZEU B;  4DQ8 A;  1X3N A;  3H6E A;  1RBV A;  4JKG A;  4PA1 A;  1QQC A;  2WUS A;  4ILG B;  4DR3 K;  3RMA A;  4F2S A;  5M1N A;  4N47 A;  2UXC K;  2GTD A;  1IKY A;  2VCP A;  3ZYY X;  5J1E A;  3WNF A;  2PFU A;  2QKB A;  3LWM A;  2ZE2 A;  3NGI A;  2FBY A;  3MAQ A;  3LL3 A;  4FZY A;  3T19 A;  2V7Y A;  2IAJ A;  2P9L B;  3TPQ A;  3J80 O;  1A5V A;  3SLC A;  3VEX A;  1HNZ K;  4C23 A;  4BC2 A;  2VGM A;  3CCM N;  4A2A A;  1N5Y A;  3ZT0 A;  3V9W A;  1LWE A;  3AA3 A;  3LM9 A;  3KTQ A;  1YHQ N;  3EY1 A;  5LMU K;  4CJ7 A;  1LW0 A;  3ATV A;  3NGY A;  4BRC A;  2XHB A;  5LJW A;  2WOM A;  4OX9 K;  3TAG A;  1BG3 A;  4CFA A;  5D3G A;  2ZM6 K;  3AVC A;  4DV7 K;  2NUB A;  2KQ2 A;  4YOV A;  4KHN A;  3VEN A;  3OYG A;  4BE2 A;  4KBO A;  3NH1 A;  3ZSW A;  4X62 K;  1OH8 A;  2UUB K;  5EOY A;  4GVM A;  4DV6 K;  2BGG A;  2O8D B;  5CYQ A;  1K8K B;  1KTQ A;  2PYL A;  3KK2 A;  1D8Y A;  2P9S A;  4B9Q A;  3E66 A;  5E41 A;  2O8E B;  3L3U A;  1S9E A;  1HNV A;  1DLO A;  4FW2 A;  4LH4 A;  1SUQ A;  1VRT A;  3E01 A;  3HK2 A;  3C6H A;  1MA9 B;  3SMP A;  1ZYQ A;  4OKK A;  5LMN K;  5FRM A;  2YCH A;  2QKK A;  4BDZ A;  1BHL A;  2BDP A;  2YKM A;  4BR5 A;  4FWL A;  3CCQ N;  4XEI A;  4FJX A;  4DG1 A;  2O8F B;  3FLC O;  2P1J A;  2NRT A;  3O4N A;  4B8C A;  4CIE A;  5EY4 A;  1NNE A;  1NGD A;  1TV6 A;  1DEJ A;  4J2D A;  1I39 A;  1L3S A;  1OVY A;  2CH6 A;  5GAH P;  2VWK A;  3SAF A;  3B6O A;  2G8V A;  5BN9 A;  3C0B A;  1L3V A;  1BU6 O;  1XNQ K;  3HTV A;  2Q97 A;  3OVN A;  3D2F A;  1CZA N;  4M3X A;  3VMF B;  3QEI A;  2XRI A;  2DFH A;  3VGK A;  2XY6 A;  3AY9 A;  4FJ8 A;  1LAV A;  2ZD1 A;  3QDK A;  1HYV A;  4J2B A;  3O5B A;  3NH2 A;  4OKE A;  2CGL A;  1CZB A;  4E7J A;  3ZT2 A;  1C0U A;  4R79 A;  4BRP A;  3M8P A;  2DFF A;  5AQZ A;  1A5W A;  2RKI A;  1EX4 A;  4QS7 A;  3VPZ A;  1NWK A;  4CBX A;  3MXJ A;  4KKO A;  2HB5 A;  3IMX A;  5JS1 A;  1W7A A;  3WEE A;  4IG0 A;  1BO5 O;  3MXM A;  4W5Q A;  3CJ1 A;  3V1Q A;  3UKR A;  3CC7 N;  4C1N K;  1JCF A;  1G15 A;  1HQE A;  4H5R A;  5AQO A;  1E3M A;  4WCE L;  2Z1H A;  4IZ9 A;  4N56 A;  2G8U A;  1YJN N;  1RFQ A;  2ZF5 O;  3LP3 A;  4FM0 A;  2IIR A;  1GOA A;  3OW2 M;  2OTJ N;  4W5R A;  3VGM A;  1XNR K;  3NF9 A;  1HNI A;  2VWB A;  3ZCM A;  4CEC A;  3SUP A;  1TKD A;  1BDG A;  4BRK A;  4JKF A;  4CEE A;  5BPM A;  1FXX A;  3RTV A;  4M3W A;  1RTJ A;  5K14 A;  3NAE A;  3W0L A;  1NKB A;  3SBG A;  1QVF M;  2YV0 X;  4AHR A;  3RR8 A;  1S1V A;  2ZQB A;  3O3H A;  1FK9 A;  3D2F B;  2Q31 A;  4W5T A;  3RMD A;  1K6Y A;  2HW3 A;  4BRE A;  4GY2 B;  2NRV A;  3NCI A;  1L5U A;  1OKJ A;  4KHP K;  3WNH A;  2OA8 A;  1T3V A;  5JLH A;  2P5O A;  4M7X A;  3G0Z A;  3O3G A;  4WQ5 C;  3QEW A;  1WSG A;  4AM7 A;  1H1V A;  4C8N A;  5BPL A;  4GMJ B;  3OYB A;  4MO4 A;  4OKJ A;  5AQJ A;  1IKW A;  5FDL A;  2Z1J A;  5C2F A;  1WSJ A;  3HJF A;  3CQY A;  3EEQ A;  4AM6 A;  4Z0U A;  3FE1 A;  2E2Q A;  1CZ9 A;  4CZM A;  1NMD A;  4B1X B;  4BR4 A;  1RT6 A;  4BRN A;  3SJJ A;  4JK8 A;  2HHU A;  4DR2 K;  1N6Q A;  3VEO A;  2V51 B;  3OYM A;  3T1H K;  1K9M O;  4H0P A;  2FSN A;  1U4B A;  4B3M K;  4Y1C A;  3LM2 A;  4YDU A;  1YAG A;  4A62 A;  3CJC A;  4I9L A;  3VQE A;  4AHU A;  2ETJ A;  4I6M B;  2KZZ A;  1NMN A;  4BDY A;  3LAL A;  4FLU A;  3D2E A;  3ZSO A;  3ZET B;  3CJA A;  3NF7 A;  1TK8 A;  4A5A A;  4PKI A;  3CYM A;  2I5J A;  2F9T A;  3HOS A;  2OZS A;  2XY8 A;  3PIP L;  5C2D A;  2HNY A;  3IFR A;  1GOB A;  4ZHR A;  1HJO A;  2BTF A;  4BQL A;  4B3R K;  4DU3 A;  4G1Q A;  3PX6 A;  3ZT4 A;  4AIL C;  3VQ9 A;  4U7B A;  3SPZ A;  1NK5 A;  3AO5 A;  4JI2 K;  2W41 A;  3VF4 A;  3HZ6 A;  3P31 A;  4KPY A;  4BVO A;  3IKM A;  4JKH A;  5HRS A;  4BC5 A;  3OS1 A;  4BGA A;  1IBL K;  4BG9 A;  3LP2 A;  2H3G X;  2E1Z A;  4CJQ A;  3TAM A;  3U4L A;  2HBK A;  5LY3 A;  2QW9 A;  1NJY A;  1S1U A;  3KKR A;  2E5L K;  2P5G A;  5AQS A;  3RMC A;  1EWQ A;  3OYF A;  4B9V A;  1KSP A;  4LC9 B;  3OYK A;  3QIP A;  2D4W A;  2XO7 A;  2FSK A;  1VQM N;  3M1F A;  3NVK A;  1U04 A;  5AZI B;  4L8R B;  3L8B A;  3H1V X;  3U3Y A;  4DV1 K;  2FSJ A;  3LDQ A;  1ITG A;  4O4G A;  4H5V A;  1I3A A;  3NBP A;  1RBS A;  3HBT A;  4HTU A;  1K8A O;  1EET A;  4QS8 A;  1RBU A;  3QO9 A;  3GG4 A;  2PY5 A;  4FSV A;  3VEZ A;  2GV9 A;  4DWI A;  1IG8 A;  4DTN A;  1Q82 O;  1V4S A;  3IG1 A;  2HNZ A;  1QSL A;  3VGL A;  4ZTF A;  3PO4 A;  3OYE A;  4DQQ A;  4K8Z A;  3WXK A;  4M7Y A;  1VQP N;  1S6P A;  3CQ8 A;  2OTL N;  3L4I A;  5F1X A;  2X74 A;  1C0M A;  2HMP A;  3SUO A;  3QFU A;  5HP1 A;  4CZE A;  4CF0 A;  1LWC A;  3PV8 A;  4M3Y A;  3JXU A;  3V4I A;  1X9J A;  5JLF A;  4FK0 A;  1NGC A;  3MN6 A;  3QIN A;  3TAP A;  4FCY A;  1Q9Y A;  4DSL A;  4GKK K;  3KK1 A;  4FJ9 A;  3CJ9 A;  1RDC A;  4FWO A;  3QNN A;  1RDW X;  1KVB A;  2HHW A;  2X78 A;  4BC3 A;  2W42 A;  4BDP A;  3BGR A;  1GLD G;  3SCX A;  1U6Z A;  3A5N C;  3KLI A;  4YOR A;  1BQM A;  4FL9 A;  3OY9 A;  3OYJ A;  2GX9 A;  1DKG D;  4YDU C;  3VQ8 A;  3CXC M;  2FF6 A;  4KB0 A;  3EL2 A;  4AQY K;  2B4J A;  1RDU A;  1RDB A;  4FWM A;  2HHH K;  3PY8 A;  4PKG A;  1BOT O;  4M41 A;  1D9F A;  3LDL A;  3OYD A;  4CZL A;  3CFP A;  4B3T K;  1IO2 A;  4AHS A;  2VQE K;  4B1V A;  3S3O A;  4N5S A;  2QWM A;  3CFO A;  3N4Q A;  3R6M A;  3ID8 A;  3G6E N;  4FLV A;  2QK9 A;  4FK2 A;  3L6Q A;  4WF9 L;  2P51 A;  3BY5 A;  1T44 A;  3MWT A;  1XMO K;  2ASP A;  4CJ5 A;  3QER A;  1U2V A;  4CEZ A;  4YY3 K;  2D0B A;  1J54 A;  1GLA G;  3KK7 A;  3KD1 E;  3ZLJ A;  1REV A;  5C15 A;  3SYZ A;  4DTJ A;  1C6V A;  1TL3 A;  3G71 N;  5H1S Q;  5MLC Q;  3A2F A;  4DLG A;  4YOY A;  3RWU A;  4EP4 A;  2ITG A;  4M3T A;  3T7Z A;  4C8K A;  4PWD A;  2E1Y A;  4H4M A;  1BI4 A;  4FJK A;  1VQ7 N;  4NCA A;  3AAQ A;  3MCA B;  2OPS A;  5HRN A;  3Q7C A;  1GLC G;  4O0J A;  3I56 N;  5EXW A;  4UQG A;  2HBM A;  1Q18 A;  3O6W A;  1I94 K;  1HLU A;  5AQX A;  3EZW A;  3TR8 A;  4RWT A;  5DMR A;  1KD1 O;  3HYF A;  4FLW A;  4U67 L;  3HVT A;  2QM1 A;  4IFE A;  1WSE A;  4KI6 A;  4CGG A;  3E9L A;  1ZBU A;  1HQU A;  2P9L A;  3HXM A;  5B8H A;  2YJF A;  3L2R A;  5FPM A;  1S22 A;  5IWA K;  1XHX A;  4B8A B;  1NOY A;  2A3Z A;  3AVH A;  3ENH A;  4CJV A;  4LF5 K;  4B08 A;  3WNG A;  3KLH A;  4Q0B A;  3CCE N;  4IO8 A;  4BRI A;  1RT2 A;  3QNO A;  4BR2 A;  5ADX A;  2VG7 A;  4CFD A;  1JXE A;  3EO3 A;  3TSU A;  3MDQ A;  1QZ6 A;  3CPW M;  3TSQ A;  1EXQ A;  1X1P A;  4IXC A;  3SBT A;  5AQP A;  3C6A A;  2HVI A;  1XC9 A;  3K5L A;  1NKC A;  1LV5 A;  3CME N;  3F9K A;  1N34 K;  4PHT X;  1TL1 A;  2Q0U A;  4IO9 L;  5IT9 O;  1FKO A;  1S1W A;  4Y0W A;  3O9Q A;  1BI4 B;  3BEX A;  5KPR A;  1KAZ A;  4JI1 K;  2Q3S A;  4CEQ A;  4KV8 A;  3IAY A;  3JSM A;  4DTM A;  4IOX A;  3OHR A;  2KLA A;  3KWG A;  3A5O C;  3O9T A;  1GLB G;  4Z4E A;  3AVK A;  4DKW A;  2XY5 A;  4FWS A;  5AZJ A;  4FLY A;  5A2Q O;  3HST B;  5AQW A;  3PSI A;  2O8E A;  1KRP A;  3ZX2 A;  4H0Y B;  1WAJ A;  4JK9 A;  3VA3 A;  1UWB A;  4JD2 A;  5ADX H;  4GV6 A;  3TI0 A;  2IVN A;  4NB4 A;  3FFI A;  2WON A;  3MEG A;  1BA0 A;  1NJI O;  2RF2 A;  3CET A;  1KAY A;  4J2E A;  1WBB A;  4NXN K;  3J7Z O;  2O8F A;  3C6T A; 
#chains in the Genus database with same CATH homology
 4IG0 A;  1YT3 A;  3ULD A;  1D9D A;  3MXM A;  4Z4H A;  4W5Q A;  3V1Q A;  1IG9 A;  4CGF A;  1YVU A;  3OS0 A;  3SI6 A;  1NJW A;  4IFV A;  4CGI A;  3H08 A;  1SL0 A;  4KHQ A;  4R5P A;  2E6M A;  3ZT1 A;  3DOK A;  3HT3 A;  3TWH A;  2PYJ A;  5J2M A;  5KTQ A;  2HMI A;  4M3Z A;  1ZBF A;  3AO2 A;  2KZM A;  4LD0 A;  1G15 A;  1HQE A;  3NDK A;  4HUE A;  1U48 A;  3TAN A;  3LAK A;  4CHZ A;  1XI1 A;  4C8L A;  3T1A A;  3T3F A;  1S5J A;  2Z1H A;  4Z4G A;  4N56 A;  4HHT A;  1VK0 A;  1NJZ A;  2G8U A;  4DTS A;  4J2A A;  3SZ2 A;  3DLR A;  3LP3 A;  4FM0 A;  1GOA A;  3HO1 A;  2D5R A;  4E7L A;  5KI6 A;  1RTD A;  1QTM A;  4W5R A;  3V81 A;  4NYN A;  4RW6 A;  3OYN A;  3LAM A;  3OYA A;  3NF9 A;  2DTU A;  2A1S A;  2G8F A;  3ZSY A;  1HNI A;  2YKN A;  3ZCM A;  3AVI A;  4CEC A;  3SUP A;  1TKD A;  1NKE A;  4CEE A;  4RW7 A;  1FXX A;  3LPT A;  3WNE A;  3RTV A;  4CF1 A;  3PO5 A;  4CFB A;  4M3W A;  1NK9 A;  1Z25 A;  3AA5 X;  4I9Q A;  3KIO A;  3C95 A;  1RTJ A;  5K14 A;  3NAE A;  1NKB A;  3TAF A;  3ASM A;  2GBZ A;  2YV0 X;  4AHR A;  5CYM A;  3RR8 A;  1Y97 A;  3LP0 A;  3HPH A;  1S1V A;  1IKX A;  2ZQB A;  3O3H A;  1RIL A;  1FK9 A;  3QES A;  3NH0 A;  2OPP A;  4W5T A;  3SQ2 A;  3RMD A;  2D0C A;  1K6Y A;  4CJL A;  2HW3 A;  3ZSR A;  1BQN A;  1RDA A;  3K5O A;  4MQ3 A;  5T7B A;  3NCI A;  1L5U A;  3IS9 A;  2X6S A;  4I7F A;  3WNH A;  3V9Z A;  4CJW A;  2OA8 A;  3TAB A;  3RMB A;  3L2Q A;  4OLB A;  1IKV A;  4QAG A;  4CHQ A;  3DM2 A;  4FJH A;  3K59 A;  2P5O A;  4DTO A;  1RT1 A;  3G0Z A;  3O3G A;  4KRE A;  3I0S A;  3DRR A;  4KB1 A;  2IGI A;  1YTU A;  4CGJ A;  3QEW A;  4DTP A;  1SKS A;  1WSG A;  1VSM A;  4FLT A;  1VSJ A;  1VRU A;  3AVA A;  4DMN A;  1BIS A;  4C8N A;  3OYB A;  4GMJ B;  3S9H A;  1JKH A;  1NK4 A;  4OKJ A;  1IKW A;  5FDL A;  5KRT A;  1CXQ A;  2Z1J A;  4KRF A;  4CEA A;  1WSJ A;  3HJF A;  4DSJ A;  3M8Q A;  4KTZ A;  3KKS A;  4KHY A;  4W5N A;  4DFK A;  3PX0 A;  4Z0U A;  4E7K A;  5I42 A;  3V1R A;  3HPO A;  1CZ9 A;  5FRO A;  1WN7 A;  2G8H A;  1NJX A;  3SV4 A;  5HLF A;  1JLA A;  4E7H A;  1LW2 A;  1RT6 A;  3SJJ A;  3V9U A;  3U3G A;  5HBM A;  1VSL A;  4XIU A;  2HHU A;  1N6Q A;  4ELT A;  3OYM A;  4FJN A;  1TGO A;  3SQ1 A;  1LAW A;  3AVL A;  1U4B A;  4H8K A;  3G10 A;  2FBV A;  4DQS A;  2VWJ A;  4Y1C A;  3U6F A;  3OYH A;  1JXB A;  2Z1I A;  2Z1G A;  2KFZ A;  3DYA A;  3CFR A;  1MU2 A;  1RBT A;  5CZ1 A;  1RDD A;  2DFE A;  4O44 A;  4I9L A;  3VQE A;  3V1O A;  2ETJ A;  4AHU A;  3NGZ A;  2KZZ A;  4BDY A;  3LAL A;  1VSF A;  4FLU A;  4FJM A;  4WE1 A;  4FM1 A;  3TAQ A;  3SV3 A;  3ZSO A;  5KGX A;  5J2Q A;  4B9U A;  1UOC A;  3K2P A;  3OS2 A;  3NF7 A;  1TK8 A;  4DQI A;  3VQP A;  3CYM A;  1ASV A;  4OJR A;  2I5J A;  3OYI A;  3AVG A;  4IDK A;  4JRP A;  1RT3 A;  1YTA A;  2OZS A;  1KLM A;  4QOZ B;  4O0I A;  4GW6 A;  2A1R A;  2XY8 A;  4OPJ A;  4IBN A;  4FVM A;  3VQQ A;  1TK0 A;  1W0H A;  2HNY A;  3ZSV A;  2IDO A;  3DOL A;  1GOB A;  2Y1I A;  4FJI A;  1S1T A;  3SUN A;  4FW1 A;  4ZHR A;  3AVM A;  4DFP A;  4DU3 A;  4G1Q A;  2JGU A;  3PX6 A;  2HHT A;  3ZT4 A;  4AIL C;  4CHO A;  3VQ9 A;  3OJS A;  2OYQ A;  1BCM A;  2OPR A;  4C8O A;  2IOC A;  3V9X A;  3SPZ A;  4HCB A;  1NK5 A;  1QS4 A;  4NYF A;  3AO5 A;  4CJP A;  1XHZ A;  3VQ4 A;  4CK3 A;  1EP4 A;  3VQA A;  3DRP A;  4DU4 A;  4Z4I A;  4KPY A;  1VSE A;  4BE0 A;  5HRS A;  1U47 A;  3ZT3 A;  4E7I A;  4ELU A;  1SV5 A;  4CJE A;  5KRS A;  3OS1 A;  4BWJ A;  3O3F A;  3HVR A;  3SQ0 A;  3MEC A;  4BWM A;  3VQ6 A;  4CGD A;  3L2V A;  3AVF A;  4JS4 A;  3LP2 A;  3QIO A;  1TK5 A;  1TAQ A;  1JLE A;  3P1G A;  4CJQ A;  3D45 A;  1WNS A;  3TAM A;  4N41 A;  4KHU A;  3PUF A;  3VQB A;  1KCF A;  4ID1 A;  4HCC A;  1T03 A;  4NCB A;  1NJY A;  1S1U A;  3KKR A;  1L3T A;  3LAN A;  3RMC A;  2P5G A;  4QCL A;  2LSN A;  3OYF A;  4B9V A;  4FLX A;  5CY4 A;  1KSP A;  1WSI A;  4F4K A;  1QE1 A;  2IC3 A;  3OYK A;  3QIP A;  4KHS A;  3AVB A;  3DLE A;  3QEP A;  2XO7 A;  1RTH A;  1LWF A;  1TVR A;  3VA0 A;  4K8X A;  3MED A;  5JS2 A;  1U04 A;  4HVJ A;  1RBR A;  1NK0 A;  4E19 A;  3QEV A;  1J9A A;  4L8R B;  4ICL A;  3L2W A;  4DSI A;  4B9L A;  3L8B A;  4TSX A;  2VG6 A;  2E6L A;  3U3Y A;  4MFB A;  4KTQ A;  3NF8 A;  1DTT A;  3K58 A;  1QSY A;  4HUF A;  1KFS A;  1ITG A;  4DTR A;  4O4G A;  3ZSQ A;  4DSE A;  4FJJ A;  1I3A A;  3KLF A;  3NBP A;  4Z4F A;  1RBS A;  1X9W A;  4OLA A;  2FC0 A;  4FJ7 A;  4DF4 A;  3QLH A;  1RCH A;  4CFC A;  2RN2 A;  5SZT A;  2OPQ A;  4HTU A;  3AA2 A;  4E3S A;  3LZI A;  1EET A;  1RBU A;  3QO9 A;  5EU7 A;  2PY5 A;  1C1A A;  1ASW A;  4IFY A;  3V6D A;  3DLH A;  1ZBI A;  2VG5 A;  3I0R A;  4JLH A;  4I2Q A;  4FLZ A;  2IS3 A;  2GV9 A;  4DSF A;  5HRO A;  5HRR A;  4C8M A;  4DWI A;  1JLF A;  2F8T A;  4DTN A;  3RR7 A;  1VSK A;  4B9M A;  4N76 A;  4E89 A;  3IG1 A;  3AO4 A;  1RT5 A;  4CJF A;  2FBX A;  4NCG A;  3DRS A;  2HNZ A;  3KLE A;  4CGH A;  1HMV A;  3PX4 A;  4LH5 A;  4RW9 A;  4ZTF A;  1QSL A;  3OYE A;  3PO4 A;  4F3O A;  4RG8 A;  4CER A;  4BAC A;  4DQQ A;  4M45 A;  4DS4 A;  4DS5 A;  4K8Z A;  4B9S A;  1C1B A;  4KTW A;  1S6P A;  3CQ8 A;  4OVL A;  4EP5 A;  1HJR A;  2YHA A;  3VQD A;  1U45 A;  4JRQ A;  3V9S A;  3HL8 A;  3VQ5 A;  1Q9X A;  4IG3 A;  4YFU A;  4CIG A;  2X74 A;  3EYZ A;  4OGC A;  1C0M A;  3AV9 A;  1WSH A;  1VSH A;  4LY7 A;  3K57 A;  3SUO A;  1S1X A;  2GUI A;  3TAE A;  1X9S A;  3DLB A;  4FJ5 A;  3NHG A;  5HP1 A;  1TAU A;  4CF0 A;  1J53 A;  1LWC A;  3OJU A;  4CE9 A;  3V4I A;  3PV8 A;  3AVN A;  4M3Y A;  1TKT A;  4FK0 A;  3QIN A;  2HHX A;  3TAP A;  4FCY A;  3NF6 A;  1Q9Y A;  4DSL A;  3KK1 A;  2YNH A;  4FJ9 A;  1EKE A;  2HHS A;  4CJ4 A;  1S6Q A;  3D0P A;  3SPY A;  4DSK A;  1RDC A;  4OGE A;  1NK6 A;  4FYD A;  3HP9 A;  2YNF A;  4M3R A;  3QNN A;  1T7P A;  1KVB A;  2HHW A;  2X78 A;  5HRP A;  4ID5 A;  4CK2 A;  4B9T A;  1RT7 A;  5KGW A;  4EZ9 A;  2XY7 A;  4F8R A;  2W42 A;  1JL2 A;  4BDP A;  4ZTJ A;  3BGR A;  3ZSZ A;  1L3U A;  3SCX A;  2KW4 A;  1T05 A;  2G8W A;  4FM2 A;  3KLI A;  5CZ2 A;  2HHV A;  3VQ7 A;  3M8R A;  1BQM A;  4OPK A;  4JS5 A;  1R0A A;  4CJU A;  3OY9 A;  3OYJ A;  2O4I A;  2BE2 A;  3KLG A;  4LSN A;  2B6A A;  3QEX A;  4B9N A;  3VQ8 A;  3CM6 A;  4CK1 A;  2G8I A;  1HYS A;  3P5J A;  2EHG A;  4KB0 A;  2B4J A;  2D0A A;  1JLQ A;  4DTX A;  2HVH A;  1O1W A;  1WSF A;  1RDB A;  3LZJ A;  4BE1 A;  3KK3 A;  4E1N A;  3KJV A;  4DU1 A;  3DLK A;  1BGX T;  4E0D A;  1RTI A;  2AJQ A;  1IH7 A;  4FZZ A;  3AA4 A;  3PY8 A;  4LSL A;  3SNN A;  3UIQ A;  3AO1 A;  3LPU A;  4Y1D A;  1C1C A;  4DQR A;  4M41 A;  4O5B A;  1WLJ A;  1D9F A;  3ZSX A;  3VQC A;  1RBV A;  3OYD A;  4PA1 A;  3CFP A;  1QQC A;  3RMA A;  1IO2 A;  4F2S A;  1B9D A;  4AHS A;  4N47 A;  1IKY A;  3S3O A;  4N5S A;  5J1E A;  3CFO A;  3WNF A;  1S9G A;  2QKB A;  1VSI A;  3LWM A;  1WAF A;  3F73 A;  2ZE2 A;  2G8K A;  3NGI A;  1A5X A;  2FBY A;  3KD5 E;  3MAQ A;  2DY4 A;  1QSS A;  4YNQ A;  4FLV A;  4FZY A;  1FKP A;  2QK9 A;  3T19 A;  2IAJ A;  4IKF A;  4DLE A;  4FK2 A;  2P51 A;  1JLC A;  5J2P A;  4FK4 A;  1RT4 A;  4CJ5 A;  3QER A;  1ASU A;  1A5V A;  3ALY A;  4CEZ A;  2D0B A;  1J54 A;  3MEE A;  4I2P A;  4CHY A;  1Q8I A;  3KD1 E;  4AHT A;  3LDS A;  4CED A;  1REV A;  4CEB A;  3SYZ A;  1C6V A;  4CES A;  2R7Y A;  2O4G A;  4DTJ A;  4DFM A;  1N5Y A;  4Q5V A;  4KAZ A;  1TL3 A;  2HHQ A;  3ZT0 A;  4KFB A;  3V9W A;  4CHN A;  1LWE A;  1J5O A;  3AA3 A;  4DLG A;  3A2F A;  3C94 A;  3KTQ A;  4EP4 A;  3RWU A;  2ITG A;  3EY1 A;  4M3T A;  4C8K A;  4PWD A;  4H4M A;  1D5A A;  4M3U A;  1LW0 A;  3I8D A;  3NGY A;  4PY5 A;  1BI4 A;  3O4Q A;  4FJK A;  1C0T A;  3B6P A;  3CG7 A;  5J2N A;  2XHB A;  3SUQ A;  4W5O A;  3DMJ A;  4CHP A;  2WOM A;  4NCA A;  3ISN C;  3C6U A;  1UA1 A;  3OYL A;  3TAG A;  4CFA A;  2OPS A;  5HRN A;  5D3G A;  4O0J A;  3AVC A;  2KFN A;  1JL1 A;  2NUB A;  3MXI A;  4UQG A;  1ZBH A;  4FJL A;  2YNI A;  1HYZ A;  2KQ2 A;  1QHT A;  4KHN A;  4FJG A;  2PZS A;  5I3U A;  2QXF A;  3TR8 A;  5DMR A;  4CJR A;  4BE2 A;  2F96 A;  4KO0 A;  3OYG A;  2X6N A;  1BIZ A;  1TKZ A;  3HYF A;  4FLW A;  1SKW A;  3S3M A;  4KI4 A;  3NH1 A;  3HVT A;  3ZSW A;  2B5J A;  1UA0 A;  1WSE A;  4KI6 A;  4CGG A;  3THV A;  3BDP A;  4DTU A;  5FRN A;  4B3O A;  4GVM A;  2BGG A;  1BL3 A;  1U49 A;  1ZBU A;  1HQU A;  5CYQ A;  4CF2 A;  3HXM A;  4F2R A;  1KTQ A;  3L2R A;  3NFA A;  1SL2 A;  4CF8 A;  2PYL A;  3KK2 A;  3NE6 A;  1D8Y A;  2EX3 A;  1ZBL A;  1XHX A;  4CJT A;  4B8A B;  1NOY A;  1KFD A;  4DQP A;  4AHC A;  4ELV A;  3M8S A;  3AVH A;  4F3T A;  5E41 A;  1Z26 A;  3L3U A;  5DK5 A;  1S9E A;  4CJS A;  4CJV A;  4Q0B A;  4B08 A;  1HNV A;  1DLO A;  4FW2 A;  3WNG A;  4LH4 A;  4CEO A;  3KLH A;  3LWL A;  1SUQ A;  3K5N A;  1VRT A;  3E01 A;  3P83 D;  5C24 A;  3HK2 A;  1RT2 A;  3QNO A;  4AH9 A;  1BCO A;  1ZYQ A;  2OZM A;  4OKK A;  5FRM A;  2QKK A;  2FBT A;  4BDZ A;  1RNH A;  2VG7 A;  4CFD A;  1JLG A;  1BHL A;  3CM5 A;  1KVA A;  1T8E A;  1JXE A;  2BDP A;  2YKM A;  4RW8 A;  4PUO A;  4O55 A;  2JLE A;  3TAR A;  4FJX A;  4DG1 A;  1HRH A;  1EXQ A;  4CJK A;  3O4N A;  1X1P A;  2P1J A;  5SWM A;  4B8C A;  4CIF A;  3DI6 A;  2HVI A;  4CIE A;  3JYT A;  1NK8 A;  1GOC A;  1XC9 A;  3K5L A;  1NKC A;  3LP1 A;  1LV5 A;  3F9K A;  4EZ6 A;  1KVC A;  3L2U A;  1CLQ A;  2KTQ A;  1TL1 A;  1TV6 A;  4J2D A;  3RRG A;  1FKO A;  1S1W A;  1I39 A;  1L3S A;  4KHW A;  1JLB A;  1BI4 B;  2E4L A;  1UAX A;  2VWK A;  2ATQ A;  4HUG A;  4DFJ A;  3B6O A;  3K5M A;  2G8V A;  3VN5 A;  4H4O A;  2HND A;  2Q3S A;  4E1M A;  1SL1 A;  1DTQ A;  1L3V A;  4CEQ A;  4Z4C A;  4KV8 A;  3SQ4 A;  3AVJ A;  3OVN A;  3IAY A;  4CEF A;  3JSM A;  4DTM A;  4FZX C;  3HP6 A;  3QEI A;  3QET A;  1B92 A;  2DFH A;  2XRI A;  2XY6 A;  4M3X A;  1X9M A;  4Z4E A;  3AVK A;  1B9F A;  3DLG A;  2XY5 A;  3EZ5 A;  3S3N A;  4FJ8 A;  4FLY A;  3HST B;  4AHV A;  3RRH A;  1LAV A;  2ZD1 A;  2Y1J A;  1VSD A;  1HYV A;  4J2B A;  1KRP A;  2F8S A;  2YNG A;  4RW4 A;  3NH2 A;  4M42 A;  4CCH A;  3ITH A;  4OKE A;  1NK7 A;  1WAJ A;  1CZB A;  5C25 A;  1UWB A;  3HPG A;  3ZT2 A;  4CF9 A;  3VA3 A;  1C0U A;  4E7J A;  4DF8 A;  3M8P A;  3TI0 A;  2DFF A;  3IRX A;  1A5W A;  3FFI A;  1KLN A;  4PQU A;  1XWL A;  2RKI A;  1EX4 A;  2WON A;  3HM9 A;  3MEG A;  4FXD A;  2YHB A;  3MXJ A;  1F21 A;  2RPI A;  1HPZ A;  4KKO A;  1NOZ A;  1CXU A;  2HB5 A;  3OYC A;  1SKR A;  3L3V A;  2RF2 A;  5JS1 A;  4CJ3 A;  4J2E A;  2BAN A;  1BIU A;  3AO3 A;  5C42 A;  1TKX A;  1W9H A;  3C6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...