3AVLA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avlA00
3C6TA 3TAEA 3AVKA 3THVA 3HYFA 4CF1A 3MXIA 3V81A 4EZ9A 4KHWA 5J1EA 1S9EA 4M41A 2OA8A 1KLNA 3TI0A 3ZT3A 4DU3A 3OYCA 3VN5A 4M45A 1NJWA 3RMBA 4DSKA 1A5XA 1JLCA 3KLIA 3M8SA 4FW1A 3LWMA 5FRNA 1JL1A 1G15A 1IH7A 4Z4IA 2IAJA 4OJRA 3OS2A 3IAYA 4OLBA 3LPUA 2F8TA 3AVLA 3OYFA 4L8RB 3NF8A 2XRIA 1W9HA 3MEEA 1SL2A 3VQ9A 3K5NA 3V1RA 3VQCA 4KFBA 4H8KA 4YFUA 3QEIA 2KW4A 4CEOA 2A1RA 4BE0A 3CFPA 2HHWA 1JXEA 2D5RA 4RW8A 1RDBA 3T1AA 3K57A 3OVNA 4RG8A 1UOCA 1C1CA 4FZYA 1HYZA 3VA3A 4DFMA 4FM0A 2YNGA 1BIZA 2OYQA 1O1WA 3MECA 1U45A 3DLBA 4CK1A 3LDSA 1L3VA 1ZBUA 3DOLA 2P51A 3SQ2A 4H4MA 4J2DA 4C8NA 3O3FA 1X9SA 3NGZA 4KHQA 4CGFA 3PX4A 2D0AA 2X6NA 2G8HA 3M8RA 1I3AA 1GOCA 2D0BA 4CGJA 3V9XA 1Z26A 2HHTA 4E7LA 4BE2A 3HSTB 4DQQA 3PO4A 4E7KA 4MQ3A 4DSFA 3VQDA 1T7PA 2YNIA 3EY1A 3TAFA 3SCXA 2PZSA 3F9KA 3MEGA 3VQ8A 3PO5A 3HK2A 2IC3A 1NK6A 2HW3A 3AVCA 4B8AB 4OLAA 3P5JA 4F3OA 3QNNA 4FK0A 1NK7A 4QOZB 1BGXT 1JLGA 3IRXA 4B8CA 4CHOA 4HTUA 3SV3A 2QXFA 3C95A 1TK0A 4J2BA 2W42A 1RT5A 3OYHA 2E4LA 1NOZA 4FM1A 3OY9A 3OJSA 1Z25A 4Y1DA 4N47A 3HPHA 3CG7A 3RWUA 1HMVA 4KTQA 1RDAA 4N56A 1RT7A 4HUGA 2BE2A 4DTSA 1WSIA 3G10A 1RDCA 3OYNA 4OGEA 1SUQA 5T7BA 2ZE2A 4CHNA 1NJXA 1TV6A 1ASUA 4Y1CA 4BE1A 4FCYA 1BHLA 3JSMA 3KD1E 1CZ9A 4KHYA 1SL0A 1NKCA 3KKRA 4RW7A 2HHXA 1S1TA 4FZZA 1YT3A 3O4NA 1GOAA 2OPQA 3DRSA 3AO2A 2P1JA 3SNNA 1RT2A 1J5OA 4CGDA 3H08A 1DLOA 4IG0A 1UA0A 3ZSZA 4OVLA 3L2WA 4O0IA 3CFRA 3QEWA 1TKXA 2A1SA 3LAMA 4CF8A 5KGXA 4DLGA 2Y1JA 3AV9A 2HHSA 1W0HA 4FJXA 1U49A 5HROA 1TGOA 3QIOA 1RBUA 5JS2A 1HNIA 1RBSA 2PY5A 2FBVA 2DFEA 3KLEA 5FRMA 1RCHA 2IGIA 1LV5A 4O55A 3KLGA 3DOKA 4CE9A 3OS1A 3RMAA 1JL2A 4KHUA 1KVAA 4AHCA 1JLFA 4M42A 2RN2A 3WNEA 1JLQA 1RT3A 4Z4CA 5J2QA 4B3OA 2HMIA 3QEPA 3VQ5A 3AO5A 3S3NA 4KB0A 3HPGA 4E7JA 1YTUA 2E6LA 4DTRA 2ETJA 3T19A 3HP6A 3SUNA 4I9LA 2X74A 1L3SA 2DTUA 4C8KA 4JS5A 3V1OA 4E89A 1VSHA 3SQ0A 4K8ZA 1XI1A 5FDLA 5J2PA 3ZSYA 4J2EA 3HPOA 4DFPA 1GOBA 1VSFA 3WNFA 3QESA 4GW6A 3V1QA 1XHXA 4CK2A 4ELUA 3OYGA 4F2SA 3CFOA 1LAWA 5DMRA 4CJKA 1X9MA 4C8OA 4ID5A 2FBXA 4W5OA 4CFCA 3ZT1A 2YKNA 4CJRA 4CERA 3MXJA 2VG5A 3AA3A 4DFKA 3RMDA 1ZYQA 1C0TA 2DY4A 1DTQA 1WAJA 3ZSQA 2VWKA 4NYFA 4HUFA 4AHSA 1L3TA 3NGIA 1KVCA 3K2PA 3VQ6A 3CQ8A 4FJ5A 1Q8IA 4CIFA 2XY6A 4DSJA 4DTNA 2OPSA 4FJIA 1HPZA 5KRTA 3B6OA 2P5GA 3OYAA 1KSPA 2XHBA 3EYZA 1U47A 1WSEA 4O44A 4J2AA 3NHGA 3MAQA 5C25A 1EX4A 1Y97A 1QTMA 3VQAA 1BCMA 3ZSRA 4CHQA 3ZT4A 2G8UA 1LWCA 4DU1A 4KI6A 4KI4A 3ASMA 3V4IA 3LANA 4FW2A 4LD0A 2I5JA 3VQ4A 3RRHA 4EZ6A 3VQPA 4EP5A 3DI6A 4ICLA 3QERA 3ZT2A 3AO1A 3DYAA 4DS4A 4FLXA 1JKHA 2X6SA 3OJUA 4E7IA 4PQUA 4ZHRA 4KHNA 3U3YA 3S9HA 4RW6A 4CEEA 5KI6A 4B08A 4XIUA 4E19A 2OZSA 4DS5A 4AH9A 1S9GA 1VSKA 4DU4A 4CGHA 1SV5A 1QSYA 3ZSVA 3HO1A 1RTIA 4KRFA 4FJ8A 4I2QA 3DLKA 4DLEA 4DTUA 4DF8A 4FZXC 4ZTFA 2BDPA 1VK0A 4O5BA 3ZSOA 4OGCA 1RBTA 4PUOA 3WNGA 1HYVA 4Z4EA 4Z4HA 4DFJA 4FJJA 4E7HA 4CESA 2HHVA 1SL1A 4KPYA 2XY5A 4ID1A 2YHBA 5I42A 4CJ5A 1T03A 1SKWA 4PA1A 3QETA 4Q5VA 1SKSA 4E0DA 4N5SA 3KIOA 3SUQA 1TVRA 1S5JA 1WSHA 2VG7A 3KK3A 3SUOA 1WN7A 1S1XA 4FK2A 3AA2A 3DLEA 1VSMA 4IG3A 4KKOA 4CFAA 2P5OA 3OYLA 2XO7A 3AVIA 3SYZA 1VSJA 4W5QA 4KV8A 2ZQBA 3LP3A 1S6PA 1ZBFA 4AHUA 1CXQA 4CJUA 3PX0A 2WOMA 1QSLA 4CJTA 3RMCA 2RKIA 1C0UA 5CYMA 1HYSA 4W5TA 2BANA 1KVBA 4JS4A 2HNYA 4DTPA 4NCBA 3L2RA 3HM9A 3AO4A 3O3GA 1KFSA 4FXDA 3E01A 4BACA 2R7YA 1C0MA 3V9WA 4OKJA 4CJ3A 3K58A 4IBNA 3VQ7A 1ZBLA 4KO0A 4OPJA 4B9NA 2LSNA 4CJEA 3IG1A 4NCGA 1ZBIA 4I7FA 2EX3A 3SJJA 2HVIA 4PY5A 5KTQA 1D8YA 3UIQA 4CHZA 3AVMA 3G0ZA 4LSLA 4LSNA 4CJPA 2X78A 1IKYA 1R0AA 3DLHA 3QEVA 2IDOA 1Q9XA 4DQPA 3SZ2A 2HHUA 3RR8A 3D45A 5SZTA 1FKOA 1IKWA 5K14A 2ITGA 1U4BA 4Z0UA 3TAGA 2F8SA 2Y1IA 1NK4A 1IKXA 3PUFA 1F21A 2FC0A 3BGRA 1UAXA 3DRPA 1T8EA 1N5YA 1KRPA 1FXXA 1BCOA 3ISNC 4QAGA 4CJLA 5J2NA 3SUPA 2HVHA 4CFDA 3SPZA 4FLUA 1A5WA 2Z1HA 3RR7A 3ZSWA 4OKEA 1TK5A 1ASVA 2HNDA 1LWEA 4Q0BA 3OYBA 1CZBA 3LP2A 3AVGA 2RF2A 1NKEA 3HJFA 4DG1A 4HCCA 4C8LA 4KTWA 1BIUA 3KK2A 3P1GA 1IG9A 2BGGA 1L3UA 1NK5A 1MU2A 4CF2A 4B9SA 1ITGA 2JLEA 1NK0A 1LW0A 2XY8A 3F73A 3ULDA 3AVJA 4DTOA 2PYJA 2JGUA 4DF4A 3QNOA 3BDPA 4CJSA 2EHGA 3OYIA 3L2QA 4CJWA 4CEDA 3WNHA 3S3MA 4LH4A 3QEXA 3NF9A 3HVTA 1WSFA 1NOYA 1ASWA 1NJZA 2GV9A 4Z4GA 4BWMA 2KFNA 3V9ZA 4FJHA 4DQRA 3SV4A 4RW4A 4TSXA 3RRGA 1RTJA 4FJKA 3LZIA 5CYQA 4N76A 3OS0A 1I39A 3OYKA 1QS4A 2FBTA 2OPRA 1VSEA 5DK5A 4B9TA 4BDZA 4M3YA 2YHAA 4YNQA 4M3WA 1TAQA 4EP4A 4BDYA 3K5LA 3TARA 3NF6A 1VSIA 3EZ5A 4IKFA 3NE6A 1JLEA 3A2FA 3TABA 4AHVA 4HHTA 1S1VA 4AHTA 1LWFA 4HVJA 1HRHA 3CM5A 2Z1IA 4IFVA 5HRRA 3VA0A 2O4GA 3KK1A 4ZTJA 3NCIA 3K5OA 4FJLA 1HNVA 4R5PA 4FLVA 3OYMA 1QHTA 1U48A 5HLFA 1C1AA 4NYNA 4MFBA 4B9LA 3SQ1A 1HQEA 4W5RA 1RBVA 3KTQA 3HT3A 1SKRA 3SI6A 1B92A 4B9VA 5C42A 1D5AA 5KGWA 4B9MA 3HL8A 1CLQA 1EP4A 3QINA 1NK8A 3NH1A 3SPYA 3NH0A 4AHRA 2ATQA 4CEAA 4HUEA 1C1BA 3C6UA 4I2PA 3ZSXA 4QCLA 1LAVA 3VQEA 3L8BA 4DQIA 5KRSA 1VSDA 1LW2A 4F8RA 5HBMA 3DM2A 1FK9A 3PV8A 1BQMA 1IO2A 2E6MA 2DFHA 4O0JA 2B4JA 2YNHA 1B9FA 1VSLA 1NJYA 4K8XA 3QLHA 4CEBA 3PX6A 3NDKA 4KHSA 1JXBA 1KTQA 2GUIA 4CJ4A 4FLZA 2VG6A 3ITHA 5SWMA 1EETA 1BI4B 1RBRA 3HP9A 5FROA 1X9WA 4WE1A 1TK8A 4DSIA 4M3TA 4W5NA 3U3GA 1RT1A 2KZZA 3PY8A 2AJQA 2RPIA 1VRTA 1QQCA 4FVMA 4DSEA 3TANA 1RTDA 4DTMA 4O4GA 3AVAA 2YKMA 3LALA 3D0PA 1Q9YA 3ALYA 3L3UA 1WAFA 3ZCMA 4E1MA 3KLHA 4CECA 1WSGA 4FJMA 1YTAA 1S1WA 1C6VA 3AVNA 1RT4A 1BISA 3TR8A 5HP1A 3M8QA 4RW9A 4DQSA 1XC9A 4FJNA 5CZ2A 3L3VA 2YNFA 3L2VA 3NAEA 3NGYA 2QKBA 4CEQA 3K5MA 1DTTA 3DLRA 3U6FA 4FLYA 1QSSA 4CIEA 2WONA 3S3OA 4F2RA 2KQ2A 1IKVA 3MXMA 3LP1A 1BQNA 1HQUA 3DMJA 5EU7A 3P83D 1TAUA 1RILA 3JYTA 1J53A 4I9QA 2DFFA 1NKBA 4FJ7A 3I8DA 3CM6A 3NH2A 2IOCA 1U04A 4F4KA 4FM2A 4LY7A 1S1UA 1HJRA 3KLFA 3AVHA 1UWBA 1L5UA 2G8IA 1TL3A 2Q3SA 5HRNA 4CGGA 2G8FA 3HXMA 4ELVA 2QK9A 4BWJA 3I0SA 2XY7A 4HCBA 3SQ4A 4G1QA 4CF0A 3LAKA 3VQQA 4AILC 2G8KA 3QIPA 1REVA 2KFZA 4CJVA 2PYLA 3OYEA 5JS1A 4GVMA 4IDKA 2G8VA 2G8WA 2NUBA 1BI4A 2HB5A 3AA5X 3L2UA 4KREA 4CHPA 4F3TA 3OYDA 4FJ9A 1A5VA 3OYJA 4CHYA 4CGIA 4LH5A 5CZ1A 2HNZA 3O4QA 3TAPA 3MEDA 3TWHA 1KLMA 3I0RA 2QKKA 4CEZA 2KZMA 4CFBA 3B6PA 4DWIA 4NCAA 3K59A 1WLJA 1D9DA 3LZJA 4OKKA 3O3HA 4FK4A 2B6AA 1X1PA 4KTZA 4C8MA 4DMNA 2VWJA 4JRPA 1KCFA 1RDDA 4DTJA 1JLBA 5C24A 1NK9A 4FJGA 4FYDA 1EXQA 1XWLA 3NF7A 3KKSA 1T05A 3AA4A 4KAZA 2GBZA 3FFIA 4E1NA 1XHZA 3DRRA 2ZD1A 3C94A 3V6DA 3CYMA 3QO9A 3M8PA 1WNSA 1RTHA 2YV0X 3NBPA 4CK3A 5HRSA 1QE1A 3AO3A 5J2MA 1B9DA 4Z4FA 1TKDA 4E3SA 4DSLA 1JLAA 4CJFA 3RTVA 4M3RA 2F96A 3LP0A 1YVUA 4KB1A 3KD5E 1J54A 1D9FA 4UQGA 5E41A 1J9AA 2O4IA 2Z1GA 4CIGA 1FKPA 3AVFA 3LPTA 3VQBA 2IS3A 4JRQA 4M3XA 3V9SA 4GMJB 1TKTA 1N6QA 1CXUA 4H4OA 3KJVA 2Z1JA 1VRUA 1KFDA 2D0CA 4CJQA 4OPKA 3V9UA 1RT6A 5HRPA 3TAMA 1ZBHA 4PWDA 4B9UA 5I3UA 1BL3A 4CF9A 2OZMA 3IS9A 5D3GA 3AVBA 3HVRA 1S6QA 5CY4A 4FLWA 4FLTA 3NFAA 4CCHA 2B5JA 4JLHA 3ZT0A 4ELTA 2KTQA 3T3FA 3TAQA 4DTXA 1RNHA 2OPPA 1UA1A 2FBYA 4M3UA 1TL1A 4BDPA 3LWLA 4M3ZA 1WSJA 2HHQA 1TKZA 1EKEA 1K6YA 4IFYA 4CEFA 4N41A 3DLGA
chains in the Genus database with same CATH superfamily
3THVA 1NGAA 1FW6A 1NGDA 4KHWA 2FF3B 3MCPA 3ID6A 4XH4A 3UE5A 4FWMA 1A5XA 1JLCA 3M8SA 4FW1A 1VQMN 2A42A 3O9UA 2HBJA 4Z4IA 4OJRA 4A5AA 4U67L 2XRIA 1SL2A 3K5NA 3VQCA 2HHWA 4H5WA 1JXEA 2D5RA 4BC2A 1M90O 4RG8A 1C1CA 1HYZA 5DM7L 4DFMA 1BIZA 3ZEUA 1O1WA 4CZKA 4DV2K 1U45A 1L3VA 5AQYA 4YOXA 4NO7A 4U7BA 1X9SA 3KHYA 4CGFA 3PX4A 1V4SA 2F7TA 2FXUA 2V7ZA 4H0VB 5AQGA 1GOCA 1Z26A 4BE2A 3HSTB 1GLLO 1T7PA 2YNIA 5M1OA 3F9KA 3AVCA 3J7ZO 5LMNK 4OLAA 4FK0A 2NLXA 4QOZB 1BGXT 4HTUA 3EN9A 4B8CA 4A61A 3C95A 4IJAA 2W42A 3CCUN 1VQKN 3OYHA 3CCMN 4A59A 2E4LA 1Z25A 1HMVA 1RT7A 4HUGA 5AQSA 3VENA 4NB4A 1NMNA 4OGEA 3MK6A 5T7BA 1NJXA 1ASUA 3I55N 1DKGD 4LFBK 5EXWA 3JSMA 4IEEA 3ZETA 2E2NA 4KHYA 5JLHA 1HR0K 2IIRA 4FWRA 4FZZA 1TUYA 1GLCG 2E1ZA 1YT3A 3O4NA 3AO2A 1J5OA 1UA0A 4OVLA 4O0IA 1TKXA 4BG8A 2P9NA 3AV9A 1E3MA 1X3MA 1WBBA 4DV7K 3KLEA 3H46O 5C2DA 2IGIA 3KLGA 3QFUA 1JL2A 2RN2A 2QWNA 1P8ZA 1ATNA 4FWSA 2E6LA 3SAHA 3VEZA 2W41A 3ATVA 1R59O 4J2EA 3WXJA 5HOOA 4CZJA 4B1YB 5BN8A 4GW6A 3V1QA 4CK2A 3ENHA 1MWKA 4ID5A 3ZT1A 2YKNA 4CJRA 4BG9A 2DY4A 1KXPA 1WAJA 4WYBA 1XMOK 3CCEN 3JS6A 4FPBA 1Q8IA 2OPSA 4B1VA 3WXLA 2PFUA 3B6OA 2P5GA 3OYAA 1K73O 3SBGA 2XHBA 3EKSA 3FE1A 3Q7BA 5C25A 1EX4A 1Y97A 3VQAA 1BCMA 3ZSRA 3ZT4A 4KI6A 3V4IA 4EZ6A 4O5FA 3VQPA 2VGNA 3DI6A 3DYAA 2IVPA 1JKHA 4H03B 4E7IA 5AZIA 3U3YA 4XEIA 1YITN 1SS6A 4KBOA 4FWKA 3PIOL 3W3DA 3FZMA 4DU4A 3HO1A 1RTIA 4KRFA 3O9QA 4I2QA 4DF8A 4ZTFA 4CBUA 1HNWK 3HRGA 5AQWA 2F4VK 2D1KA 4AF1A 2HHVA 1SL1A 5GAEP 5I42A 1SKWA 3QETA 1SKSA 3J7YP 1BUPA 2OCEA 4BR9A 3SUOA 2D4WA 1S1XA 3CC7N 3AA2A 4JKBA 3FR0A 2ZQBA 5I9EB 3E9LA 3O80A 1RGIA 4CJUA 1QSLA 4CJTA 2NRWA 1Y64A 3RMCA 4JS4A 1KVBA 3O3GA 3HM8A 4JN4A 1C0MA 3K58A 4JEPA 1WOQA 2EX3A 1D8YA 1X9JA 3A5NC 2GWKA 5M1PA 1Q9XA 4DQPA 2YHYA 3D2EB 3WQUA 4MLHA 5K14A 1YJNN 1QQOA 3PUFA 1F21A 2FC0A 1T8EA 1QHAA 4XH5A 4QAGA 3VEVA 3O9SA 3RR7A 1U6ZA 2E2OA 1NJIO 4OKEA 4Q0BA 1U2VA 3LP2A 4HCCA 4C8LA 1IG9A 2BGGA 1NK5A 3CMEN 1ITGA 1NK0A 5AQPA 3F73A 3AVJA 1JCFA 2YHXA 3ENBA 3E9OA 3CHWA 2NZTA 4CJWA 3WNHA 1NOYA 4RTFD 4B1WB 1WSFA 1NGJA 3CCVN 2KFNA 1KQSM 3LZIA 1YUWA 5CYQA 1I39A 4M3YA 4B9TA 4YNQA 3M5RA 4EP4A 5GINA 3K5LA 3EZ5A 1VSIA 5GADP 1NG9A 3A2FA 4AHVA 3IUCA 1T6CA 4AHTA 4BR0A 1LWFA 4HVJA 3GG4A 4ZTJA 3NCIA 4R5PA 3HZ6A 2GUPA 4GV3A 2WBNA 1C1AA 4B9LA 3SQ1A 2P9UB 1SKRA 2P9KA 1EP4A 3SPYA 2AA4A 3CF5L 4I2PA 1LAVA 3VQEA 3J8AA 5HBMA 3DM2A 3LDPA 4ILGB 3PV8A 3J80O 4O0JA 5BPLA 1VSLA 3VF2A 3C7NB 1FJGK 4CJ4A 3VGLA 1BI4B 4DB3A 5FROA 1TK8A 4MLEA 4W5NA 3DXMA 5IWAK 2KZZA 2RPIA 3TANA 4DSEA 2YCHA 2YKMA 2FSKA 1Q9YA 2Q36A 1XNQK 3TSQA 3KLHA 4CECA 1WSGA 1S1WA 4WFAL 1JCEA 2YNFA 1HPMA 3D2FB 3NGYA 2QKBA 4CEQA 2O8EB 3U6FA 3CETA 3CJ7A 4F2RA 2HF4A 1NNEA 1BQNA 2V51B 3P83D 4BRIA 3JYTA 1W7AA 5EOYA 4I6MB 2DFFA 3THXA 3I8DA 4FM2A 1HJRA 1L5UA 3AVHA 1UWBA 2G8IA 3BF3A 5HRNA 4CGGA 3HXMA 4BWJA 3GE1A 3I0SA 2XY7A 3H3OB 5JMVA 2G8KA 2J4RA 1GLFO 4AILC 2KFZA 3MWPA 3O9TA 4H0YB 4IDKA 2NUBA 2NRTA 4F3TA 4FJ9A 3A5OC 3OYJA 4LF4K 3R8EA 2NRHA 3TAPA 5BRHA 5TKWA 2KZMA 3LZJA 1HKBA 4C8MA 4KTZA 4DMNA 2VWJA 4JRPA 1KCFA 4FJGA 1JLBA 5C24A 1OVYA 1T05A 3AA4A 1XHZA 2FLOA 2ZD1A 3T1YK 3V6DA 3CYMA 2IVOA 1WNSA 2P9SA 3GOIA 3AO3A 1JLAA 3OTOK 2YJFA 1J54A 4B3SK 2O4IA 4CIGA 4BVOA 3LPTA 1HNZK 1VRUA 2Z1JA 2D0CA 1RT6A 4JHDA 2VWBA 3AY9A 1TYQA 4L3QA 4CF9A 4ISFA 4FWOA 5CY4A 4FLWA 3NFAA 4FLTA 4CCHA 5KQ8A 1Z05A 4FL9A 4ELTA 2KTQA 4BC3A 4IOAL 2O8CB 2FBYA 3QB0A 3LWLA 1WSJA 3FZKA 3C6TA 4XH1A 5BPNA 3MX5A 5J1EA 4CBXA 3B8AX 3AAPA 3HTVA 3OYCA 4WQ4C 3RMBA 4DSKA 4YORA 2NRXA 2HF3A 1IH7A 2IAJA 1EWQA 4OLBA 3LPUA 4L8RB 1W9HA 1RDWX 2UXDK 4KFBA 2KW4A 4CEOA 2A1RA 3H6EA 2ZJRL 1NGGA 1UOCA 3VOVA 3VA3A 2OANA 3LDSA 1ZBUA 3J7AP 2W40A 1XMQK 2D0AA 2G8HA 3M8RA 3ZX3A 4EIAA 4CGJA 3CCLN 1YXQA 4MQ3A 2DPNA 3VQDA 4B1XB 3EY1A 2GELA 4CD1A 3SCXA 2PZSA 3PO5A 4AM7A 2UXCK 1IG8A 1YVNA 2ZGZA 4FM1A 3OY9A 3EEQA 5JLFA 3WEEB 4Z94A 1Q82O 3HPHA 5C15A 2BE2A 5ADXA 3T7ZA 1WSIA 3OYNA 1HJOA 5AFUA 1SUQA 3THYB 1TV6A 4Y1CA 2UXBK 3KD1E 1NKCA 3LDNA 4JNEA 3DRSA 3SNNA 5AQMA 3H08A 1NBWA 3ZSZA 2G8WA 3CFRA 4FPAA 3UB5A 3QIOA 1RBSA 3ZYYX 2FBVA 3FZLA 1LV5A 4O55A 3DOKA 1VQON 4X65K 3VF6A 2GWJA 5FLXO 4AHCA 3WNEA 4Z4CA 1RT3A 5J2QA 3QEPA 4KB0A 2QWRA 3HPGA 2ZF5O 3D7EO 1WUAA 2ETJA 5BRDA 1L3SA 1BOTO 4E89A 2ZWHA 1VSHA 3PLAA 2D0PA 3KWIA 4BRFA 3UKRB 1VAZA 4PKIA 3WNFA 5LY3A 4GKJK 4ELUA 1GLAG 3OYGA 1NGIA 1BWFO 3FZHA 3N4PA 3VMFB 2FBXA 1O13A 4CFCA 4JI0K 4GKKK 2CGKA 4CERA 3MXJA 1Q7YO 3VETA 4DFKA 3RMDA 1XUPO 3G4SN 4IO8A 1L3TA 3NGIA 1KVCA 3K2PA 4FJIA 1HKGA 2FF6A 4IO9L 1KSPA 2P9LB 5ELZA 1U47A 3NHGA 3CPWM 3CJ1A 4FWNA 3R9PA 3NVKA 4R79A 4CHQA 4DU1A 3ASMA 3LANA 3RRHA 4WCEL 4EP5A 4BGAA 3LL3A 4FLXA 3EKUA 4CW7B 4JKGB 4MO4A 3ULEA 4RW6A 4K0KK 5KI6A 4B08A 1S9GA 4BRNA 1RDUA 4CGHA 1Q86O 3DLKA 4OGCA 1RFQA 3E9PA 1HYVA 4Z4EA 4Z4HA 4FJJA 5AZJA 4E7HA 1N36K 1OH8A 3K0SA 2A3ZA 2QWQA 3KIOA 1TVRA 1WSHA 3SUQA 1WN7A 2P5OA 4LF5K 3KK7A 1IBLK 1S6PA 1ZBFA 1CXQA 3PX0A 1EQYA 1HYSA 1C0UA 3CJCA 2BANA 3C65A 3HM9A 3E01A 2ASOA 3V9WA 3EE9A 4WQ5C 1ZBLA 4KO0A 1ATSA 4JI4K 4PY5A 3P39A 3AVMA 2CH5A 5BREA 4LSNA 4CJPA 1R0AA 3DLHA 5M1QA 2HHUA 1IKWA 5CHIA 2EWSA 3TAGA 1NK4A 4YOYA 1N5YA 1FXXA 1T3VA 4CJLA 2HVHA 3DLLL 4FLUA 3BF1A 4A2BA 3DXKB 3NVMA 4NXMK 1VQ8N 1LWEA 3VEOA 1CZBA 4GV9A 2VGMA 4KTWA 1BIUA 4YDUC 5EX5A 3QMLA 4JKFA 1MU2A 4CF2A 5DM6L 4QS9A 4DHYA 2JGUA 4V19S 3CCSN 3BDPA 4CJSA 5BRFA 2EHGA 3S3MA 3HVTA 3LDLA 1NJZA 3PSFA 2YHWA 5JVHL 3SAFA 4N76A 3OS0A 1QS4A 4CZEA 1VSEA 2YHAA 4JD2A 4BRGA 1QZ5A 3TABA 4JK9A 2JWKA 3VTIA 1S1VA 3EZWA 4FJLA 3H45C 3P38A 3VEYA 1QHTA 2GTDA 1U48A 1BA0A 5HLFA 4MFBA 1Q18A 1HLUA 1HQEA 4W5RA 1RBVA 3CQYA 3ENOA 1GLBG 4B9MA 3HL8A 1CLQA 1NK8A 1K8KA 3C6UA 5AQXA 3ZSXA 3FGUA 4F8RA 2YJEA 1FK9A 3UKUA 3TPQA 1BQMA 2E6MA 2B4JA 2YNHA 3HOTA 4K8XA 5M1FA 4M63C 4KHSA 1KTQA 4FLZA 2ASMA 1QZ6A 2VG6A 3ITHA 5SWMA 1EETA 3HP9A 1RBRA 5H1SQ 4DR6K 4K41A 1QQCA 1J6ZA 3DWLA 4DTMA 3AVAA 3D0PA 3N4QA 5JICA 3THWB 4BGBA 1RT4A 3U8XA 5AQJA 1BO5O 5CZ2A 5ADXH 3ZX2A 5AFUH 3K5MA 3DLRA 2ZJPL 2KQ2A 3CCQN 4KH4A 3MXMA 1HQUA 3CD6N 2GX9A 1J53A 4I9QA 4BRPA 3L6QA 4FJ7A 3NH2A 1U04A 4F4KA 1S1UA 3KVGA 2Q3SA 4B3MK 2G8FA 2QK9A 1WBDA 3LAKA 4X66K 5JS1A 1ILYA 1REVA 3F9MA 2PYLA 5BR8K 2O8FA 5AQIA 4KREA 1QQNA 4JKDA 3OYDA 3O5BA 4CGIA 4LH5A 2D0OA 5JVGL 3OBWA 3CQXA 3VESA 3K59A 4OKKA 5FPMA 5AQOA 1X1PA 4DTJA 3BZCA 2GEMA 3NF7A 3KKSA 1NGFA 4KAZA 3FFIA 1SQKA 3DRRA 3C94A 3BZKA 4WQ4A 1RTHA 3NBPA 4CK3A 4Z4FA 5J2MA 1QE1A 2QXLA 4DSLA 4CJFA 4M3RA 4KB1A 3LP0A 1YVUA 4A57A 1J9AA 2KKZA 1HNXK 3AVFA 3VQBA 2IS3A 3M6GA 4H4OA 4DR1K 1KFDA 1N8RO 4BQLA 4PWDA 4B9UA 3G25A 4JI7K 3P31A 4JI1K 3VTHA 2VQEK 3IS9A 4YOVA 4JK7A 3ZEUB 5LJVA 3QICA 1OH7A 4CJ7A 5AQQA 1ZXOA 4IZ9A 4DTXA 1ATRA 4K43A 4LFCK 1TL1A 4BDPA 3RSEA 4M3ZA 2HHQA 2ZM6K 1X9MA 1K6YA 4CEFA 3ATUA 1OVQA 3DLGA 4N41A 3TAEA 2E8AA 3AVKA 3M1FA 2IVNA 3HYFA 4CF1A 3MXIA 4EZ9A 1S9EA 4M41A 2OA8A 1NJWA 1VQNN 4IXCA 3KLIA 1HUXA 4FWQA 3LWMA 2OTJN 1G15A 1VQ7N 3OS2A 1LOTB 3OHRA 2F8TA 3AVLA 4QS8A 3VQ9A 3TU5A 4H8KA 4BE0A 3CFPA 3I33A 3K57A 3T1AA 4M7YA 1BDGA 3JXUA 2YNGA 3SJHA 3A0IX 5GAGP 1T6DA 3A5LC 3SQ2A 3TTFA 3NGZA 4KHQA 4JAXA 3VGKA 3TSPA 1DT9A 3V9XA 2OTLN 2HHTA 4DQQA 3PO4A 4E7KA 3ZX0A 3MEGA 3VQ8A 1SAZA 5AR0A 1NLVA 1NK6A 3IFRA 3W0LA 1JLGA 4CHOA 3IRXA 3SV3A 3EO3A 4FOIA 2RHKA 3CERA 4Y1DA 4CZIA 3RWUA 4DCHA 4K42A 4DTSA 1RDCA 4CZMA 1T44A 2UUBK 1GLDG 1N34K 4OO1J 1CZ9A 3EE8A 3CJ9A 4DR5K 1SL0A 3KKRA 5E84A 4KHPK 1S1TA 4H5VA 1GOAA 3VGMA 1IJJA 2P1JA 3TTCA 1RT2A 4CGDA 1DLOA 4IG0A 3L2WA 4F3OA 5AQNA 2Y1JA 3LAMA 4FO0A 1W0HA 4DUZK 1U49A 4FJXA 1TGOA 5AQLA 1HNIA 1RCHA 5AQRA 2E20A 4CE9A 2Q0UA 5C0YA 1JLFA 2UUCK 4M42A 3VF4A 1JLQA 2O8DB 3S3NA 3T19A 4I9LA 2DTUA 3V1OA 4DR4K 3R1XA 4K25A 5FDLA 5KQDA 3HPOA 5AQHA 1VSFA 4YY3K 1W97L 1XHXA 4F2SA 3CFOA 1LAWA 3WXKA 3U4LA 3QFPA 2F9TA 3GBTA 4LF9K 5KPRA 1ZYQA 4PKHA 1I94K 1ZBSA 5IT9O 1NGCA 2QWPA 5CE3A 4NYFA 4HUFA 4CZFA 3CQ8A 5M1NA 4CIFA 2XY6A 1HPZA 2Q2RA 5KRTA 3MDQA 3WQTA 3EYZA 1LWCA 2QTDA 4ILHA 2BH1A 4ICLA 3QERA 3IKMA 4WQ5A 4KHNA 3HSCA 3F2KA 3S9HA 4CEEA 2OZSA 3FFKB 4DS5A 4AH9A 4ISGA 3PIPL 3HOSA 1QSYA 2E1YA 3ZSVA 4DTUA 4DLEA 4FZXC 4LFAK 1OKJA 2WTUA 2BDPA 4AM6A 1RBTA 4PUOA 3RVCA 3WNGA 4DR2K 3J81O 4DFJA 4CESA 4KPYA 2XY5A 4CJ5A 4PA1A 1V4TA 4Q5VA 4E0DA 1S5JA 3H1VX 3K9JA 5C10A 4KKOA 1VSMA 4IG3A 4YDUA 1U2VB 4B3RK 3LDQA 3LP3A 2E5LK 1WB9A 4PL7A 2WOMA 4UY8O 4X62K 2RKIA 5CYMA 3LM2A 4NCBA 3O6WA 4CBWA 2KHOA 3L2RA 1KFSA 3AGKA 4BACA 1QVGM 2R7YA 4OKJA 4CJ3A 4IBNA 4JK8A 4B9NA 4OPJA 2LSNA 3TSUA 1ZBIA 4I7FA 1BU6O 3UIQA 4GV6A 3G0ZA 3HI0A 3QEVA 2IDOA 3BY5A 3SZ2A 5HL7L 3D45A 5SZTA 3I56N 1U4BA 2F8SA 2Y1IA 3BGRA 1UAXA 1VQ5N 1KRPA 4A62A 5BPMA 4DR7K 1YF5L 3CJBA 1TK5A 4O8KA 2O8BB 1NKEA 3AVGA 2RF2A 4DG1A 3DJCA 3KK2A 3R6MA 1L3UA 2P9KB 1KAYA 3AARA 2JLEA 5AQVA 1LW0A 2PYJA 3QNOA 2I7NA 3MN5A 3OW2M 3OYIA 3BEXA 4CEDA 4C1NI 1ASWA 3IDHA 4Z4GA 4BWMA 3V9ZA 1K8AO 4FJHA 1KC8O 4RW4A 4TSXA 4MDBA 2WFBA 1OH5A 3OYKA 1SZ2A 2OPRA 5DK5A 4M3WA 1TAQA 3O8MA 3D2EA 3DXMB 4BDYA 3NF6A 3NE6A 1JLEA 4HHTA 2W6LA 3QDKA 4KH5A 1P90A 4C23A 3CM5A 2Z1IA 4IFVA 2O4GA 3K5OA 2V7YA 5AQZA 1QVFM 5C12A 5FPEA 3KTQA 4H5NA 1S3XA 4EHUA 3SI6A 1VQ4N 3QINA 5AQKA 3NH1A 3NH0A 4AHRA 4BRMA 3THXB 4LF6K 3L8BA 3L4QA 4DQIA 5KRSA 1VSDA 4H5RA 1IO2A 1DEJA 3CCJN 3CPEA 1B9FA 2Q31A 1NJYA 1JCGA 3QLHA 3PX6A 3NDKA 2GUIA 1X9WA 1NU0A 4JKEA 3HBTA 4WE1A 4LF7K 4M3TA 3U3GA 2UYTA 1YJWN 3AAQA 3O9RA 1RTDA 2Q1NA 4FJMA 2HOEA 3AVNA 1C6VA 3TR8A 1OH6A 4FJNA 3M8QA 5AQTA 1E4FT 3L3VA 3L2VA 4ILJA 4EFHA 4IEIA 3E66A 4BR2A 1BG3A 1QSSA 4CIEA 3S3OA 4DKWA 1IKVA 2P9UA 1VHXA 5KPTA 4BRQA 1TUUA 1XC3A 2P9SB 2HBMA 3DMJA 5EU7A 1TAUA 1RILA 1E4GT 3FZFA 3O08A 1NKBA 2ITMA 2IOCA 4LY7A 5F1XA 4DV4K 1TL3A 4PKGA 4ELVA 3U9DA 3SMPA 4HTLA 3L0QA 4G1QA 3VQQA 3C7NA 4CF0A 3SQ4A 3QIPA 4CJVA 4CVNE 3OYEA 4JKAA 3ID8A 3MCAB 1BI4A 2HB5A 4CHPA 3DAWA 1C0GA 4JHDB 3BP8A 4BREA 2H3GX 1VQ9N 1TYQB 1IBMK 2HNZA 2VQFK 5GIOA 3MEDA 3TWHA 1KLMA 3CIPA 1NWKA 3B6PA 4GNIA 3G71N 2B6AA 3SUNA 4DV5K 1NK9A 1RDDA 3VEXA 4FYDA 3D2FA 2O8EA 3A5MC 1YHQN 5GAHP 2UUAK 3KZBA 3QO9A 3M8PA 3MN7A 4JV5K 5M1KA 5HRSA 4I6MA 3RTVA 4BC5A 1M1KO 2F96A 4BRCA 3KD5E 1D9FA 4UQGA 3WXIA 1FKPA 3K9KA 4M3XA 4GMJB 1TKTA 3U9ZA 2QA4N 3BUZB 4BQZA 1YJ9N 4OPKA 3G6EN 5I3UA 3HVRA 4BROA 1YAGA 2QM1A 2B5JA 4JLHA 3NMUA 4BRDA 4DR3K 4B1ZA 1RNHA 4WF9L 4EHTA 4G9ZA 1H1VA 5AJ3K 3OVNA 1TKZA 4IFYA 3O4WA 3T69A 5FPDA 3V81A 1KLNA 3TI0A 4OPHA 3ZT3A 4DU3A 3VN5A 4M45A 1G99A 2P9PB 5FRNA 2JWLA 1JL1A 2O8DA 3IAYA 2PBDA 4CZLA 4DQ8A 3OYFA 3NF8A 3MEEA 3V1RA 2YX6A 4YFUA 3QEIA 2I7PA 4J8FA 2BUPA 4RW8A 1RDBA 2A5XA 4FZYA 4FM0A 4H0XB 2OYQA 3MECA 3DLBA 2QWOA 4CK1A 4BR7A 3DOLA 2P51A 4H4MA 4J2DA 4C8NA 3O3FA 5F0XA 2O8CA 1GLEG 2X6NA 1I3AA 2D0BA 4E7LA 2FSNA 1HX1A 4GVEA 4DSFA 1Q81O 3TAFA 4B3TK 5BN9A 4FWLA 2P9IB 2RE2A 2HHSA 3HK2A 2HSTA 2HW3A 2IC3A 4B8AB 4JKHA 3P5JA 3QNNA 1NK7A 4J2BA 1TK0A 2QXFA 1RT5A 2V52B 1NOZA 1C0FA 3QBXA 3OJSA 4N47A 3CG7A 4KTQA 1RDAA 3EL2A 4N56A 3CMAN 3G10A 4LC9B 3SLCA 4BRLA 2ZE2A 4CHNA 4BE1A 3GDQA 4FCYA 1BHLA 4RWTA 4M7XA 3MWTA 4H5TA 4RW7A 2HHXA 2A6AA 2OPQA 3E1YA 3QEWA 2A1SA 4CF8A 5KGXA 4DLGA 4BRHA 5HROA 2UU9K 5JS2A 1RBUA 2PY5A 1YI2N 2DFEA 5FRMA 4JI5K 5EY4A 5TKYA 3OS1A 4MO5A 1QQMA 4BRKA 3RMAA 4KHUA 1KVAA 5AQUA 4B3OA 4X64K 2HMIA 3VQ5A 3AO5A 1YTUA 4E7JA 4DTRA 3HP6A 1CZAN 1MDUB 2X74A 3WEEA 4C8KA 4JS5A 4H0PA 1VQPN 2VYPA 3SQ0A 4K8ZA 2A40A 1XI1A 4WFBL 5CR4A 3Q7CA 3ULEB 3ZSYA 5J2PA 4DFPA 2Q97A 1GOBA 3THYA 2HMPA 3QESA 4JI3K 3M3ZA 5DMRA 4CJKA 4C8OA 3CXCM 4W5OA 4IJNA 3WXMB 2W6KA 2VG5A 3AA3A 1C0TA 2E88A 1DTQA 3ZSQA 2Q0RA 2VWKA 3S41A 5AZJB 4IDHA 4AHSA 3VQ6A 4FJ5A 3CJAA 4DSJA 4DTNA 1N32K 3F5TA 1WSEA 4O44A 4J2AA 3MAQA 5E26A 4H0TB 3CCRN 1QTMA 2G8UA 4FVUA 4KI4A 4JI6K 2O8BA 4FW2A 4FSVA 4LD0A 2I5JA 3VQ4A 3ZT2A 3AO1A 4FOEA 4DS4A 1EO1A 4IOXA 1YIJN 3VEWA 2X6SA 3OJUA 4PQUA 4ZHRA 3WUHA 4AQYK 3O1WA 5FPNA 3UKRA 4BR5A 3CC4N 3D6RA 4CZGA 4XIUA 4E19A 3ZETB 1VSKA 1SV5A 4FJ8A 2CGLA 1VK0A 4O5BA 3ZSOA 2CH6A 1LCUA 4F9OA 2ZJQL 2P9NB 4ID1A 2YHBA 4YHHK 1T03A 3VERA 1KAXA 3GL1A 4NXNK 3PSIA 2F9WA 5EVZA 1W2BM 4N5SA 2VG7A 3KK3A 4DV3K 3H1QA 2P9LA 3MX2A 4FK2A 3DLEA 4CFAA 4IFEA 4E1JA 3OYLA 2XO7A 3AVIA 3SYZA 1VSJA 4W5QA 4YOWA 2QWLA 4KV8A 1IBKK 4IWVA 2KLAA 4AHUA 3SAGA 4W5TA 2E2PA 2HNYA 4DTPA 3AO4A 3LDOA 4FXDA 4B1UB 4JKGA 1VQ6N 3VQ7A 4ISEA 3L4IA 4CJEA 3IG1A 4H0OA 4NCGA 2HVIA 3SJJA 5KTQA 2ASPA 2QW9A 4CHZA 3MMVA 4LSLA 3H3NO 2X78A 1IKYA 1MA9B 4JKCA 3RR8A 4JD2B 1FKOA 4IOCL 2ITGA 4Z0UA 4A5BA 1IKXA 4BC4A 2NRZA 3DRPA 4Y0WA 4BY9C 1BCOA 3ISNC 3LM9A 5J2NA 3SUPA 4CFDA 3SPZA 1KD1O 1A5WA 2Z1HA 3QBWA 2NNWA 3ZLJA 3ZSWA 1ASVA 2HNDA 3OYBA 3CC2N 3HJFA 1GLJO 3P1GA 3SMSA 5LL6Z 4B9SA 2PAVA 3JAMO 2XY8A 5GIPA 3ULDA 5AZIB 4DTOA 1K8KB 4DF4A 4CI6A 4A2AA 3L2QA 4LH4A 3QEXA 3NF9A 3UKUB 5KPZA 2GV9A 2BTFA 5LJWA 4DQRA 3SV4A 3RRGA 1RTJA 4FJKA 2ZGYA 4NLBA 2FBTA 4KH6A 5F2RA 4BDZA 2HBLA 3OA9A 3TARA 4OX9K 1NGHA 4IKFA 3MN9A 2NRRA 2VCPA 1JJ2M 1ZC6A 4BVPA 1HRHA 5HRRA 4HWIA 3VA0A 4RCHA 3KK1A 4DUYK 2FSJA 4MDAA 4YOUA 1HNVA 4FLVA 3DXKA 3OYMA 4NLCA 4NYNA 3A8YA 3P4IA 3HT3A 1B92A 4B9VA 5C42A 1D5AA 5KGWA 5A2QO 4FWPA 4JI8K 2QWMA 2ATQA 4CEAA 4HUEA 1C1BA 4QCLA 4DV1K 1ESVA 4OPAA 1LW2A 3C6AA 4BRAA 2DFHA 4CEBA 1JXBA 2O8FB 4LF8K 4DSIA 4DV0K 2YI1A 1RT1A 3I8BA 3T1HK 1VQLN 3PY8A 2AJQA 4C1NK 1VRTA 4FVMA 3KWGA 4O4GA 3LALA 3ALYA 3L3UA 1WAFA 3SBTA 3ZCMA 3AGRA 4E1MA 1K9MO 1MWMA 1S72N 1YTAA 3OBYA 1BISA 5B8HA 4RW9A 5HP1A 4DQSA 1XC9A 3NAEA 1XQSC 2QI2A 1DTTA 4JI2K 4FLYA 5LMUK 2WONA 4GY2B 3LP1A 4O8UA 1Z6RA 1N33K 3CI5A 5AQFA 2HHHK 3CM6A 1NGBA 1NGEA 2QEXN 3KLFA 1X3NA 2P9PA 4QS7A 4HCBA 2WC9A 4CZHA 1IV0A 4GVMA 2G8VA 1XNRK 3AA5X 3L2UA 1A5VA 4CHYA 3FLCO 5MLCQ 5CZ1A 3O4QA 3VPZA 4PL8A 1J5EK 5C2FA 3I0RA 2QKKA 2NRVA 4CEZA 4WFNL 4CFBA 4DWIA 4NCAA 3THWA 1WLJA 1D9DA 3O3HA 2A41A 4FK4A 3RSEB 3C0BA 4PHTX 1EXQA 3C6HA 2WUSA 4EAHD 1XWLA 2AP1A 3R3LA 2GBZA 4E1NA 3IMXA 1NMDA 2YV0X 1B9DA 1D4XA 1TKDA 4E3SA 2P9IA 3SK3A 4BR4A 5E41A 1S22A 2Z1GA 4YOTA 4JRQA 3O1BA 3V9SA 2HBKA 1N6QA 1CXUA 4B9QA 3KJVA 5BR9A 3V9UA 4CJQA 1HKCA 1EWRA 5HRPA 1BA1A 1KAZA 3TAMA 1ZBHA 2E2QA 4JYAK 1BL3A 2OZMA 4CD3A 5D3GA 3AVBA 1S6QA 3TTDA 3MN6A 1NM1A 3ZT0A 3T3FA 3WT0A 3TAQA 2OPPA 1UA1A 4M3UA 2CGJA 1DGKN 4DV6K 1EKEA
chains in the Genus database with same CATH topology
3C6TA 3TAEA 3AVKA 3THVA 3HYFA 4CF1A 3MXIA 3V81A 4EZ9A 4KHWA 5J1EA 1S9EA 4M41A 2OA8A 1KLNA 3TI0A 3ZT3A 4DU3A 3OYCA 3VN5A 4M45A 1NJWA 3RMBA 4DSKA 1A5XA 1JLCA 3KLIA 3M8SA 4FW1A 3LWMA 5FRNA 1JL1A 1G15A 1IH7A 4Z4IA 2IAJA 4OJRA 3OS2A 3IAYA 4OLBA 3LPUA 2F8TA 3AVLA 3OYFA 4L8RB 3NF8A 2XRIA 1W9HA 3MEEA 1SL2A 3VQ9A 3K5NA 3V1RA 3VQCA 4KFBA 4H8KA 4YFUA 3QEIA 2KW4A 4CEOA 2A1RA 4BE0A 3CFPA 2HHWA 1JXEA 2D5RA 4RW8A 1RDBA 3T1AA 3K57A 3OVNA 4RG8A 1UOCA 1C1CA 4FZYA 1HYZA 3VA3A 4DFMA 4FM0A 2YNGA 1BIZA 2OYQA 1O1WA 3MECA 1U45A 3DLBA 4CK1A 3LDSA 1L3VA 1ZBUA 3DOLA 2P51A 3SQ2A 4H4MA 4J2DA 4C8NA 3O3FA 1X9SA 3NGZA 4KHQA 4CGFA 3PX4A 2D0AA 2X6NA 2G8HA 3M8RA 1I3AA 1GOCA 2D0BA 4CGJA 3V9XA 1Z26A 2HHTA 4E7LA 4BE2A 3HSTB 4DQQA 3PO4A 4E7KA 4MQ3A 4DSFA 3VQDA 1T7PA 2YNIA 3EY1A 3TAFA 3SCXA 2PZSA 3F9KA 3MEGA 3VQ8A 3PO5A 3HK2A 2IC3A 1NK6A 2HW3A 3AVCA 4B8AB 4OLAA 3P5JA 4F3OA 3QNNA 4FK0A 1NK7A 4QOZB 1BGXT 1JLGA 3IRXA 4B8CA 4CHOA 4HTUA 3SV3A 2QXFA 3C95A 1TK0A 4J2BA 2W42A 1RT5A 3OYHA 2E4LA 1NOZA 4FM1A 3OY9A 3OJSA 1Z25A 4Y1DA 4N47A 3HPHA 3CG7A 3RWUA 1HMVA 4KTQA 1RDAA 4N56A 1RT7A 4HUGA 2BE2A 4DTSA 1WSIA 3G10A 1RDCA 3OYNA 4OGEA 1SUQA 5T7BA 2ZE2A 4CHNA 1NJXA 1TV6A 1ASUA 4Y1CA 4BE1A 4FCYA 1BHLA 3JSMA 3KD1E 1CZ9A 4KHYA 1SL0A 1NKCA 3KKRA 4RW7A 2HHXA 1S1TA 4FZZA 1YT3A 3O4NA 1GOAA 2OPQA 3DRSA 3AO2A 2P1JA 3SNNA 1RT2A 1J5OA 4CGDA 3H08A 1DLOA 4IG0A 1UA0A 3ZSZA 4OVLA 3L2WA 4O0IA 3CFRA 3QEWA 1TKXA 2A1SA 3LAMA 4CF8A 5KGXA 4DLGA 2Y1JA 3AV9A 2HHSA 1W0HA 4FJXA 1U49A 5HROA 1TGOA 3QIOA 1RBUA 5JS2A 1HNIA 1RBSA 2PY5A 2FBVA 2DFEA 3KLEA 5FRMA 1RCHA 2IGIA 1LV5A 4O55A 3KLGA 3DOKA 4CE9A 3OS1A 3RMAA 1JL2A 4KHUA 1KVAA 4AHCA 1JLFA 4M42A 2RN2A 3WNEA 1JLQA 1RT3A 4Z4CA 5J2QA 4B3OA 2HMIA 3QEPA 3VQ5A 3AO5A 3S3NA 4KB0A 3HPGA 4E7JA 1YTUA 2E6LA 4DTRA 2ETJA 3T19A 3HP6A 3SUNA 4I9LA 2X74A 1L3SA 2DTUA 4C8KA 4JS5A 3V1OA 4E89A 1VSHA 3SQ0A 4K8ZA 1XI1A 5FDLA 5J2PA 3ZSYA 4J2EA 3HPOA 4DFPA 1GOBA 1VSFA 3WNFA 3QESA 4GW6A 3V1QA 1XHXA 4CK2A 4ELUA 3OYGA 4F2SA 3CFOA 1LAWA 5DMRA 4CJKA 1X9MA 4C8OA 4ID5A 2FBXA 4W5OA 4CFCA 3ZT1A 2YKNA 4CJRA 4CERA 3MXJA 2VG5A 3AA3A 4DFKA 3RMDA 1ZYQA 1C0TA 2DY4A 1DTQA 1WAJA 3ZSQA 2VWKA 4NYFA 4HUFA 4AHSA 1L3TA 3NGIA 1KVCA 3K2PA 3VQ6A 3CQ8A 4FJ5A 1Q8IA 4CIFA 2XY6A 4DSJA 4DTNA 2OPSA 4FJIA 1HPZA 5KRTA 3B6OA 2P5GA 3OYAA 1KSPA 2XHBA 3EYZA 1U47A 1WSEA 4O44A 4J2AA 3NHGA 3MAQA 5C25A 1EX4A 1Y97A 1QTMA 3VQAA 1BCMA 3ZSRA 4CHQA 3ZT4A 2G8UA 1LWCA 4DU1A 4KI6A 4KI4A 3ASMA 3V4IA 3LANA 4FW2A 4LD0A 2I5JA 3VQ4A 3RRHA 4EZ6A 3VQPA 4EP5A 3DI6A 4ICLA 3QERA 3ZT2A 3AO1A 3DYAA 4DS4A 4FLXA 1JKHA 2X6SA 3OJUA 4E7IA 4PQUA 4ZHRA 4KHNA 3U3YA 3S9HA 4RW6A 4CEEA 5KI6A 4B08A 4XIUA 4E19A 2OZSA 4DS5A 4AH9A 1S9GA 1VSKA 4DU4A 4CGHA 1SV5A 1QSYA 3ZSVA 3HO1A 1RTIA 4KRFA 4FJ8A 4I2QA 3DLKA 4DLEA 4DTUA 4DF8A 4FZXC 4ZTFA 2BDPA 1VK0A 4O5BA 3ZSOA 4OGCA 1RBTA 4PUOA 3WNGA 1HYVA 4Z4EA 4Z4HA 4DFJA 4FJJA 4E7HA 4CESA 2HHVA 1SL1A 4KPYA 2XY5A 4ID1A 2YHBA 5I42A 4CJ5A 1T03A 1SKWA 4PA1A 3QETA 4Q5VA 1SKSA 4E0DA 4N5SA 3KIOA 3SUQA 1TVRA 1S5JA 1WSHA 2VG7A 3KK3A 3SUOA 1WN7A 1S1XA 4FK2A 3AA2A 3DLEA 1VSMA 4IG3A 4KKOA 4CFAA 2P5OA 3OYLA 2XO7A 3AVIA 3SYZA 1VSJA 4W5QA 4KV8A 2ZQBA 3LP3A 1S6PA 1ZBFA 4AHUA 1CXQA 4CJUA 3PX0A 2WOMA 1QSLA 4CJTA 3RMCA 2RKIA 1C0UA 5CYMA 1HYSA 4W5TA 2BANA 1KVBA 4JS4A 2HNYA 4DTPA 4NCBA 3L2RA 3HM9A 3AO4A 3O3GA 1KFSA 4FXDA 3E01A 4BACA 2R7YA 1C0MA 3V9WA 4OKJA 4CJ3A 3K58A 4IBNA 3VQ7A 1ZBLA 4KO0A 4OPJA 4B9NA 2LSNA 4CJEA 3IG1A 4NCGA 1ZBIA 4I7FA 2EX3A 3SJJA 2HVIA 4PY5A 5KTQA 1D8YA 3UIQA 4CHZA 3AVMA 3G0ZA 4LSLA 4LSNA 4CJPA 2X78A 1IKYA 1R0AA 3DLHA 3QEVA 2IDOA 1Q9XA 4DQPA 3SZ2A 2HHUA 3RR8A 3D45A 5SZTA 1FKOA 1IKWA 5K14A 2ITGA 1U4BA 4Z0UA 3TAGA 2F8SA 2Y1IA 1NK4A 1IKXA 3PUFA 1F21A 2FC0A 3BGRA 1UAXA 3DRPA 1T8EA 1N5YA 1KRPA 1FXXA 1BCOA 3ISNC 4QAGA 4CJLA 5J2NA 3SUPA 2HVHA 4CFDA 3SPZA 4FLUA 1A5WA 2Z1HA 3RR7A 3ZSWA 4OKEA 1TK5A 1ASVA 2HNDA 1LWEA 4Q0BA 3OYBA 1CZBA 3LP2A 3AVGA 2RF2A 1NKEA 3HJFA 4DG1A 4HCCA 4C8LA 4KTWA 1BIUA 3KK2A 3P1GA 1IG9A 2BGGA 1L3UA 1NK5A 1MU2A 4CF2A 4B9SA 1ITGA 2JLEA 1NK0A 1LW0A 2XY8A 3F73A 3ULDA 3AVJA 4DTOA 2PYJA 2JGUA 4DF4A 3QNOA 3BDPA 4CJSA 2EHGA 3OYIA 3L2QA 4CJWA 4CEDA 3WNHA 3S3MA 4LH4A 3QEXA 3NF9A 3HVTA 1WSFA 1NOYA 1ASWA 1NJZA 2GV9A 4Z4GA 4BWMA 2KFNA 3V9ZA 4FJHA 4DQRA 3SV4A 4RW4A 4TSXA 3RRGA 1RTJA 4FJKA 3LZIA 5CYQA 4N76A 3OS0A 1I39A 3OYKA 1QS4A 2FBTA 2OPRA 1VSEA 5DK5A 4B9TA 4BDZA 4M3YA 2YHAA 4YNQA 4M3WA 1TAQA 4EP4A 4BDYA 3K5LA 3TARA 3NF6A 1VSIA 3EZ5A 4IKFA 3NE6A 1JLEA 3A2FA 3TABA 4AHVA 4HHTA 1S1VA 4AHTA 1LWFA 4HVJA 1HRHA 3CM5A 2Z1IA 4IFVA 5HRRA 3VA0A 2O4GA 3KK1A 4ZTJA 3NCIA 3K5OA 4FJLA 1HNVA 4R5PA 4FLVA 3OYMA 1QHTA 1U48A 5HLFA 1C1AA 4NYNA 4MFBA 4B9LA 3SQ1A 1HQEA 4W5RA 1RBVA 3KTQA 3HT3A 1SKRA 3SI6A 1B92A 4B9VA 5C42A 1D5AA 5KGWA 4B9MA 3HL8A 1CLQA 1EP4A 3QINA 1NK8A 3NH1A 3SPYA 3NH0A 4AHRA 2ATQA 4CEAA 4HUEA 1C1BA 3C6UA 4I2PA 3ZSXA 4QCLA 1LAVA 3VQEA 3L8BA 4DQIA 5KRSA 1VSDA 1LW2A 4F8RA 5HBMA 3DM2A 1FK9A 3PV8A 1BQMA 1IO2A 2E6MA 2DFHA 4O0JA 2B4JA 2YNHA 1B9FA 1VSLA 1NJYA 4K8XA 3QLHA 4CEBA 3PX6A 3NDKA 4KHSA 1JXBA 1KTQA 2GUIA 4CJ4A 4FLZA 2VG6A 3ITHA 5SWMA 1EETA 1BI4B 1RBRA 3HP9A 5FROA 1X9WA 4WE1A 1TK8A 4DSIA 4M3TA 4W5NA 3U3GA 1RT1A 2KZZA 3PY8A 2AJQA 2RPIA 1VRTA 1QQCA 4FVMA 4DSEA 3TANA 1RTDA 4DTMA 4O4GA 3AVAA 2YKMA 3LALA 3D0PA 1Q9YA 3ALYA 3L3UA 1WAFA 3ZCMA 4E1MA 3KLHA 4CECA 1WSGA 4FJMA 1YTAA 1S1WA 1C6VA 3AVNA 1RT4A 1BISA 3TR8A 5HP1A 3M8QA 4RW9A 4DQSA 1XC9A 4FJNA 5CZ2A 3L3VA 2YNFA 3L2VA 3NAEA 3NGYA 2QKBA 4CEQA 3K5MA 1DTTA 3DLRA 3U6FA 4FLYA 1QSSA 4CIEA 2WONA 3S3OA 4F2RA 2KQ2A 1IKVA 3MXMA 3LP1A 1BQNA 1HQUA 3DMJA 5EU7A 3P83D 1TAUA 1RILA 3JYTA 1J53A 4I9QA 2DFFA 1NKBA 4FJ7A 3I8DA 3CM6A 3NH2A 2IOCA 1U04A 4F4KA 4FM2A 4LY7A 1S1UA 1HJRA 3KLFA 3AVHA 1UWBA 1L5UA 2G8IA 1TL3A 2Q3SA 5HRNA 4CGGA 2G8FA 3HXMA 4ELVA 2QK9A 4BWJA 3I0SA 2XY7A 4HCBA 3SQ4A 4G1QA 4CF0A 3LAKA 3VQQA 4AILC 2G8KA 3QIPA 1REVA 2KFZA 4CJVA 2PYLA 3OYEA 5JS1A 4GVMA 4IDKA 2G8VA 2G8WA 2NUBA 1BI4A 2HB5A 3AA5X 3L2UA 4KREA 4CHPA 4F3TA 3OYDA 4FJ9A 1A5VA 3OYJA 4CHYA 4CGIA 4LH5A 5CZ1A 2HNZA 3O4QA 3TAPA 3MEDA 3TWHA 1KLMA 3I0RA 2QKKA 4CEZA 2KZMA 4CFBA 3B6PA 4DWIA 4NCAA 3K59A 1WLJA 1D9DA 3LZJA 4OKKA 3O3HA 4FK4A 2B6AA 1X1PA 4KTZA 4C8MA 4DMNA 2VWJA 4JRPA 1KCFA 1RDDA 4DTJA 1JLBA 5C24A 1NK9A 4FJGA 4FYDA 1EXQA 1XWLA 3NF7A 3KKSA 1T05A 3AA4A 4KAZA 2GBZA 3FFIA 4E1NA 1XHZA 3DRRA 2ZD1A 3C94A 3V6DA 3CYMA 3QO9A 3M8PA 1WNSA 1RTHA 2YV0X 3NBPA 4CK3A 5HRSA 1QE1A 3AO3A 5J2MA 1B9DA 4Z4FA 1TKDA 4E3SA 4DSLA 1JLAA 4CJFA 3RTVA 4M3RA 2F96A 3LP0A 1YVUA 4KB1A 3KD5E 1J54A 1D9FA 4UQGA 5E41A 1J9AA 2O4IA 2Z1GA 4CIGA 1FKPA 3AVFA 3LPTA 3VQBA 2IS3A 4JRQA 4M3XA 3V9SA 4GMJB 1TKTA 1N6QA 1CXUA 4H4OA 3KJVA 2Z1JA 1VRUA 1KFDA 2D0CA 4CJQA 4OPKA 3V9UA 1RT6A 5HRPA 3TAMA 1ZBHA 4PWDA 4B9UA 5I3UA 1BL3A 4CF9A 2OZMA 3IS9A 5D3GA 3AVBA 3HVRA 1S6QA 5CY4A 4FLWA 4FLTA 3NFAA 4CCHA 2B5JA 4JLHA 3ZT0A 4ELTA 2KTQA 3T3FA 3TAQA 4DTXA 1RNHA 2OPPA 1UA1A 2FBYA 4M3UA 1TL1A 4BDPA 3LWLA 4M3ZA 1WSJA 2HHQA 1TKZA 1EKEA 1K6YA 4IFYA 4CEFA 4N41A 3DLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C6T A;  3TAE A;  3AVK A;  3THV A;  3HYF A;  4CF1 A;  3MXI A;  3V81 A;  4EZ9 A;  4KHW A;  5J1E A;  1S9E A;  4M41 A;  2OA8 A;  1KLN A;  3TI0 A;  3ZT3 A;  4DU3 A;  3OYC A;  3VN5 A;  4M45 A;  1NJW A;  3RMB A;  4DSK A;  1A5X A;  1JLC A;  3KLI A;  3M8S A;  4FW1 A;  3LWM A;  5FRN A;  1JL1 A;  1G15 A;  1IH7 A;  4Z4I A;  2IAJ A;  4OJR A;  3OS2 A;  3IAY A;  4OLB A;  3LPU A;  2F8T A;  3AVL A;  3OYF A;  4L8R B;  3NF8 A;  2XRI A;  1W9H A;  3MEE A;  1SL2 A;  3VQ9 A;  3K5N A;  3V1R A;  3VQC A;  4KFB A;  4H8K A;  4YFU A;  3QEI A;  2KW4 A;  4CEO A;  2A1R A;  4BE0 A;  3CFP A;  2HHW A;  1JXE A;  2D5R A;  4RW8 A;  1RDB A;  3T1A A;  3K57 A;  3OVN A;  4RG8 A;  1UOC A;  1C1C A;  4FZY A;  1HYZ A;  3VA3 A;  4DFM A;  4FM0 A;  2YNG A;  1BIZ A;  2OYQ A;  1O1W A;  3MEC A;  1U45 A;  3DLB A;  4CK1 A;  3LDS A;  1L3V A;  1ZBU A;  3DOL A;  2P51 A;  3SQ2 A;  4H4M A;  4J2D A;  4C8N A;  3O3F A;  1X9S A;  3NGZ A;  4KHQ A;  4CGF A;  3PX4 A;  2D0A A;  2X6N A;  2G8H A;  3M8R A;  1I3A A;  1GOC A;  2D0B A;  4CGJ A;  3V9X A;  1Z26 A;  2HHT A;  4E7L A;  4BE2 A;  3HST B;  4DQQ A;  3PO4 A;  4E7K A;  4MQ3 A;  4DSF A;  3VQD A;  1T7P A;  2YNI A;  3EY1 A;  3TAF A;  3SCX A;  2PZS A;  3F9K A;  3MEG A;  3VQ8 A;  3PO5 A;  3HK2 A;  2IC3 A;  1NK6 A;  2HW3 A;  3AVC A;  4B8A B;  4OLA A;  3P5J A;  4F3O A;  3QNN A;  4FK0 A;  1NK7 A;  4QOZ B;  1BGX T;  1JLG A;  3IRX A;  4B8C A;  4CHO A;  4HTU A;  3SV3 A;  2QXF A;  3C95 A;  1TK0 A;  4J2B A;  2W42 A;  1RT5 A;  3OYH A;  2E4L A;  1NOZ A;  4FM1 A;  3OY9 A;  3OJS A;  1Z25 A;  4Y1D A;  4N47 A;  3HPH A;  3CG7 A;  3RWU A;  1HMV A;  4KTQ A;  1RDA A;  4N56 A;  1RT7 A;  4HUG A;  2BE2 A;  4DTS A;  1WSI A;  3G10 A;  1RDC A;  3OYN A;  4OGE A;  1SUQ A;  5T7B A;  2ZE2 A;  4CHN A;  1NJX A;  1TV6 A;  1ASU A;  4Y1C A;  4BE1 A;  4FCY A;  1BHL A;  3JSM A;  3KD1 E;  1CZ9 A;  4KHY A;  1SL0 A;  1NKC A;  3KKR A;  4RW7 A;  2HHX A;  1S1T A;  4FZZ A;  1YT3 A;  3O4N A;  1GOA A;  2OPQ A;  3DRS A;  3AO2 A;  2P1J A;  3SNN A;  1RT2 A;  1J5O A;  4CGD A;  3H08 A;  1DLO A;  4IG0 A;  1UA0 A;  3ZSZ A;  4OVL A;  3L2W A;  4O0I A;  3CFR A;  3QEW A;  1TKX A;  2A1S A;  3LAM A;  4CF8 A;  5KGX A;  4DLG A;  2Y1J A;  3AV9 A;  2HHS A;  1W0H A;  4FJX A;  1U49 A;  5HRO A;  1TGO A;  3QIO A;  1RBU A;  5JS2 A;  1HNI A;  1RBS A;  2PY5 A;  2FBV A;  2DFE A;  3KLE A;  5FRM A;  1RCH A;  2IGI A;  1LV5 A;  4O55 A;  3KLG A;  3DOK A;  4CE9 A;  3OS1 A;  3RMA A;  1JL2 A;  4KHU A;  1KVA A;  4AHC A;  1JLF A;  4M42 A;  2RN2 A;  3WNE A;  1JLQ A;  1RT3 A;  4Z4C A;  5J2Q A;  4B3O A;  2HMI A;  3QEP A;  3VQ5 A;  3AO5 A;  3S3N A;  4KB0 A;  3HPG A;  4E7J A;  1YTU A;  2E6L A;  4DTR A;  2ETJ A;  3T19 A;  3HP6 A;  3SUN A;  4I9L A;  2X74 A;  1L3S A;  2DTU A;  4C8K A;  4JS5 A;  3V1O A;  4E89 A;  1VSH A;  3SQ0 A;  4K8Z A;  1XI1 A;  5FDL A;  5J2P A;  3ZSY A;  4J2E A;  3HPO A;  4DFP A;  1GOB A;  1VSF A;  3WNF A;  3QES A;  4GW6 A;  3V1Q A;  1XHX A;  4CK2 A;  4ELU A;  3OYG A;  4F2S A;  3CFO A;  1LAW A;  5DMR A;  4CJK A;  1X9M A;  4C8O A;  4ID5 A;  2FBX A;  4W5O A;  4CFC A;  3ZT1 A;  2YKN A;  4CJR A;  4CER A;  3MXJ A;  2VG5 A;  3AA3 A;  4DFK A;  3RMD A;  1ZYQ A;  1C0T A;  2DY4 A;  1DTQ A;  1WAJ A;  3ZSQ A;  2VWK A;  4NYF A;  4HUF A;  4AHS A;  1L3T A;  3NGI A;  1KVC A;  3K2P A;  3VQ6 A;  3CQ8 A;  4FJ5 A;  1Q8I A;  4CIF A;  2XY6 A;  4DSJ A;  4DTN A;  2OPS A;  4FJI A;  1HPZ A;  5KRT A;  3B6O A;  2P5G A;  3OYA A;  1KSP A;  2XHB A;  3EYZ A;  1U47 A;  1WSE A;  4O44 A;  4J2A A;  3NHG A;  3MAQ A;  5C25 A;  1EX4 A;  1Y97 A;  1QTM A;  3VQA A;  1BCM A;  3ZSR A;  4CHQ A;  3ZT4 A;  2G8U A;  1LWC A;  4DU1 A;  4KI6 A;  4KI4 A;  3ASM A;  3V4I A;  3LAN A;  4FW2 A;  4LD0 A;  2I5J A;  3VQ4 A;  3RRH A;  4EZ6 A;  3VQP A;  4EP5 A;  3DI6 A;  4ICL A;  3QER A;  3ZT2 A;  3AO1 A;  3DYA A;  4DS4 A;  4FLX A;  1JKH A;  2X6S A;  3OJU A;  4E7I A;  4PQU A;  4ZHR A;  4KHN A;  3U3Y A;  3S9H A;  4RW6 A;  4CEE A;  5KI6 A;  4B08 A;  4XIU A;  4E19 A;  2OZS A;  4DS5 A;  4AH9 A;  1S9G A;  1VSK A;  4DU4 A;  4CGH A;  1SV5 A;  1QSY A;  3ZSV A;  3HO1 A;  1RTI A;  4KRF A;  4FJ8 A;  4I2Q A;  3DLK A;  4DLE A;  4DTU A;  4DF8 A;  4FZX C;  4ZTF A;  2BDP A;  1VK0 A;  4O5B A;  3ZSO A;  4OGC A;  1RBT A;  4PUO A;  3WNG A;  1HYV A;  4Z4E A;  4Z4H A;  4DFJ A;  4FJJ A;  4E7H A;  4CES A;  2HHV A;  1SL1 A;  4KPY A;  2XY5 A;  4ID1 A;  2YHB A;  5I42 A;  4CJ5 A;  1T03 A;  1SKW A;  4PA1 A;  3QET A;  4Q5V A;  1SKS A;  4E0D A;  4N5S A;  3KIO A;  3SUQ A;  1TVR A;  1S5J A;  1WSH A;  2VG7 A;  3KK3 A;  3SUO A;  1WN7 A;  1S1X A;  4FK2 A;  3AA2 A;  3DLE A;  1VSM A;  4IG3 A;  4KKO A;  4CFA A;  2P5O A;  3OYL A;  2XO7 A;  3AVI A;  3SYZ A;  1VSJ A;  4W5Q A;  4KV8 A;  2ZQB A;  3LP3 A;  1S6P A;  1ZBF A;  4AHU A;  1CXQ A;  4CJU A;  3PX0 A;  2WOM A;  1QSL A;  4CJT A;  3RMC A;  2RKI A;  1C0U A;  5CYM A;  1HYS A;  4W5T A;  2BAN A;  1KVB A;  4JS4 A;  2HNY A;  4DTP A;  4NCB A;  3L2R A;  3HM9 A;  3AO4 A;  3O3G A;  1KFS A;  4FXD A;  3E01 A;  4BAC A;  2R7Y A;  1C0M A;  3V9W A;  4OKJ A;  4CJ3 A;  3K58 A;  4IBN A;  3VQ7 A;  1ZBL A;  4KO0 A;  4OPJ A;  4B9N A;  2LSN A;  4CJE A;  3IG1 A;  4NCG A;  1ZBI A;  4I7F A;  2EX3 A;  3SJJ A;  2HVI A;  4PY5 A;  5KTQ A;  1D8Y A;  3UIQ A;  4CHZ A;  3AVM A;  3G0Z A;  4LSL A;  4LSN A;  4CJP A;  2X78 A;  1IKY A;  1R0A A;  3DLH A;  3QEV A;  2IDO A;  1Q9X A;  4DQP A;  3SZ2 A;  2HHU A;  3RR8 A;  3D45 A;  5SZT A;  1FKO A;  1IKW A;  5K14 A;  2ITG A;  1U4B A;  4Z0U A;  3TAG A;  2F8S A;  2Y1I A;  1NK4 A;  1IKX A;  3PUF A;  1F21 A;  2FC0 A;  3BGR A;  1UAX A;  3DRP A;  1T8E A;  1N5Y A;  1KRP A;  1FXX A;  1BCO A;  3ISN C;  4QAG A;  4CJL A;  5J2N A;  3SUP A;  2HVH A;  4CFD A;  3SPZ A;  4FLU A;  1A5W A;  2Z1H A;  3RR7 A;  3ZSW A;  4OKE A;  1TK5 A;  1ASV A;  2HND A;  1LWE A;  4Q0B A;  3OYB A;  1CZB A;  3LP2 A;  3AVG A;  2RF2 A;  1NKE A;  3HJF A;  4DG1 A;  4HCC A;  4C8L A;  4KTW A;  1BIU A;  3KK2 A;  3P1G A;  1IG9 A;  2BGG A;  1L3U A;  1NK5 A;  1MU2 A;  4CF2 A;  4B9S A;  1ITG A;  2JLE A;  1NK0 A;  1LW0 A;  2XY8 A;  3F73 A;  3ULD A;  3AVJ A;  4DTO A;  2PYJ A;  2JGU A;  4DF4 A;  3QNO A;  3BDP A;  4CJS A;  2EHG A;  3OYI A;  3L2Q A;  4CJW A;  4CED A;  3WNH A;  3S3M A;  4LH4 A;  3QEX A;  3NF9 A;  3HVT A;  1WSF A;  1NOY A;  1ASW A;  1NJZ A;  2GV9 A;  4Z4G A;  4BWM A;  2KFN A;  3V9Z A;  4FJH A;  4DQR A;  3SV4 A;  4RW4 A;  4TSX A;  3RRG A;  1RTJ A;  4FJK A;  3LZI A;  5CYQ A;  4N76 A;  3OS0 A;  1I39 A;  3OYK A;  1QS4 A;  2FBT A;  2OPR A;  1VSE A;  5DK5 A;  4B9T A;  4BDZ A;  4M3Y A;  2YHA A;  4YNQ A;  4M3W A;  1TAQ A;  4EP4 A;  4BDY A;  3K5L A;  3TAR A;  3NF6 A;  1VSI A;  3EZ5 A;  4IKF A;  3NE6 A;  1JLE A;  3A2F A;  3TAB A;  4AHV A;  4HHT A;  1S1V A;  4AHT A;  1LWF A;  4HVJ A;  1HRH A;  3CM5 A;  2Z1I A;  4IFV A;  5HRR A;  3VA0 A;  2O4G A;  3KK1 A;  4ZTJ A;  3NCI A;  3K5O A;  4FJL A;  1HNV A;  4R5P A;  4FLV A;  3OYM A;  1QHT A;  1U48 A;  5HLF A;  1C1A A;  4NYN A;  4MFB A;  4B9L A;  3SQ1 A;  1HQE A;  4W5R A;  1RBV A;  3KTQ A;  3HT3 A;  1SKR A;  3SI6 A;  1B92 A;  4B9V A;  5C42 A;  1D5A A;  5KGW A;  4B9M A;  3HL8 A;  1CLQ A;  1EP4 A;  3QIN A;  1NK8 A;  3NH1 A;  3SPY A;  3NH0 A;  4AHR A;  2ATQ A;  4CEA A;  4HUE A;  1C1B A;  3C6U A;  4I2P A;  3ZSX A;  4QCL A;  1LAV A;  3VQE A;  3L8B A;  4DQI A;  5KRS A;  1VSD A;  1LW2 A;  4F8R A;  5HBM A;  3DM2 A;  1FK9 A;  3PV8 A;  1BQM A;  1IO2 A;  2E6M A;  2DFH A;  4O0J A;  2B4J A;  2YNH A;  1B9F A;  1VSL A;  1NJY A;  4K8X A;  3QLH A;  4CEB A;  3PX6 A;  3NDK A;  4KHS A;  1JXB A;  1KTQ A;  2GUI A;  4CJ4 A;  4FLZ A;  2VG6 A;  3ITH A;  5SWM A;  1EET A;  1BI4 B;  1RBR A;  3HP9 A;  5FRO A;  1X9W A;  4WE1 A;  1TK8 A;  4DSI A;  4M3T A;  4W5N A;  3U3G A;  1RT1 A;  2KZZ A;  3PY8 A;  2AJQ A;  2RPI A;  1VRT A;  1QQC A;  4FVM A;  4DSE A;  3TAN A;  1RTD A;  4DTM A;  4O4G A;  3AVA A;  2YKM A;  3LAL A;  3D0P A;  1Q9Y A;  3ALY A;  3L3U A;  1WAF A;  3ZCM A;  4E1M A;  3KLH A;  4CEC A;  1WSG A;  4FJM A;  1YTA A;  1S1W A;  1C6V A;  3AVN A;  1RT4 A;  1BIS A;  3TR8 A;  5HP1 A;  3M8Q A;  4RW9 A;  4DQS A;  1XC9 A;  4FJN A;  5CZ2 A;  3L3V A;  2YNF A;  3L2V A;  3NAE A;  3NGY A;  2QKB A;  4CEQ A;  3K5M A;  1DTT A;  3DLR A;  3U6F A;  4FLY A;  1QSS A;  4CIE A;  2WON A;  3S3O A;  4F2R A;  2KQ2 A;  1IKV A;  3MXM A;  3LP1 A;  1BQN A;  1HQU A;  3DMJ A;  5EU7 A;  3P83 D;  1TAU A;  1RIL A;  3JYT A;  1J53 A;  4I9Q A;  2DFF A;  1NKB A;  4FJ7 A;  3I8D A;  3CM6 A;  3NH2 A;  2IOC A;  1U04 A;  4F4K A;  4FM2 A;  4LY7 A;  1S1U A;  1HJR A;  3KLF A;  3AVH A;  1UWB A;  1L5U A;  2G8I A;  1TL3 A;  2Q3S A;  5HRN A;  4CGG A;  2G8F A;  3HXM A;  4ELV A;  2QK9 A;  4BWJ A;  3I0S A;  2XY7 A;  4HCB A;  3SQ4 A;  4G1Q A;  4CF0 A;  3LAK A;  3VQQ A;  4AIL C;  2G8K A;  3QIP A;  1REV A;  2KFZ A;  4CJV A;  2PYL A;  3OYE A;  5JS1 A;  4GVM A;  4IDK A;  2G8V A;  2G8W A;  2NUB A;  1BI4 A;  2HB5 A;  3AA5 X;  3L2U A;  4KRE A;  4CHP A;  4F3T A;  3OYD A;  4FJ9 A;  1A5V A;  3OYJ A;  4CHY A;  4CGI A;  4LH5 A;  5CZ1 A;  2HNZ A;  3O4Q A;  3TAP A;  3MED A;  3TWH A;  1KLM A;  3I0R A;  2QKK A;  4CEZ A;  2KZM A;  4CFB A;  3B6P A;  4DWI A;  4NCA A;  3K59 A;  1WLJ A;  1D9D A;  3LZJ A;  4OKK A;  3O3H A;  4FK4 A;  2B6A A;  1X1P A;  4KTZ A;  4C8M A;  4DMN A;  2VWJ A;  4JRP A;  1KCF A;  1RDD A;  4DTJ A;  1JLB A;  5C24 A;  1NK9 A;  4FJG A;  4FYD A;  1EXQ A;  1XWL A;  3NF7 A;  3KKS A;  1T05 A;  3AA4 A;  4KAZ A;  2GBZ A;  3FFI A;  4E1N A;  1XHZ A;  3DRR A;  2ZD1 A;  3C94 A;  3V6D A;  3CYM A;  3QO9 A;  3M8P A;  1WNS A;  1RTH A;  2YV0 X;  3NBP A;  4CK3 A;  5HRS A;  1QE1 A;  3AO3 A;  5J2M A;  1B9D A;  4Z4F A;  1TKD A;  4E3S A;  4DSL A;  1JLA A;  4CJF A;  3RTV A;  4M3R A;  2F96 A;  3LP0 A;  1YVU A;  4KB1 A;  3KD5 E;  1J54 A;  1D9F A;  4UQG A;  5E41 A;  1J9A A;  2O4I A;  2Z1G A;  4CIG A;  1FKP A;  3AVF A;  3LPT A;  3VQB A;  2IS3 A;  4JRQ A;  4M3X A;  3V9S A;  4GMJ B;  1TKT A;  1N6Q A;  1CXU A;  4H4O A;  3KJV A;  2Z1J A;  1VRU A;  1KFD A;  2D0C A;  4CJQ A;  4OPK A;  3V9U A;  1RT6 A;  5HRP A;  3TAM A;  1ZBH A;  4PWD A;  4B9U A;  5I3U A;  1BL3 A;  4CF9 A;  2OZM A;  3IS9 A;  5D3G A;  3AVB A;  3HVR A;  1S6Q A;  5CY4 A;  4FLW A;  4FLT A;  3NFA A;  4CCH A;  2B5J A;  4JLH A;  3ZT0 A;  4ELT A;  2KTQ A;  3T3F A;  3TAQ A;  4DTX A;  1RNH A;  2OPP A;  1UA1 A;  2FBY A;  4M3U A;  1TL1 A;  4BDP A;  3LWL A;  4M3Z A;  1WSJ A;  2HHQ A;  1TKZ A;  1EKE A;  1K6Y A;  4IFY A;  4CEF A;  4N41 A;  3DLG A; 
#chains in the Genus database with same CATH topology
 3THV A;  1NGA A;  1FW6 A;  1NGD A;  4KHW A;  2FF3 B;  3MCP A;  3ID6 A;  4XH4 A;  3UE5 A;  4FWM A;  1A5X A;  1JLC A;  3M8S A;  4FW1 A;  1VQM N;  2A42 A;  3O9U A;  2HBJ A;  4Z4I A;  4OJR A;  4A5A A;  4U67 L;  2XRI A;  1SL2 A;  3K5N A;  3VQC A;  2HHW A;  4H5W A;  1JXE A;  2D5R A;  4BC2 A;  1M90 O;  4RG8 A;  1C1C A;  1HYZ A;  5DM7 L;  4DFM A;  1BIZ A;  3ZEU A;  1O1W A;  4CZK A;  4DV2 K;  1U45 A;  1L3V A;  5AQY A;  4YOX A;  4NO7 A;  4U7B A;  1X9S A;  3KHY A;  4CGF A;  3PX4 A;  1V4S A;  2F7T A;  2FXU A;  2V7Z A;  4H0V B;  5AQG A;  1GOC A;  1Z26 A;  4BE2 A;  3HST B;  1GLL O;  1T7P A;  2YNI A;  5M1O A;  3F9K A;  3AVC A;  3J7Z O;  5LMN K;  4OLA A;  4FK0 A;  2NLX A;  4QOZ B;  1BGX T;  4HTU A;  3EN9 A;  4B8C A;  4A61 A;  3C95 A;  4IJA A;  2W42 A;  3CCU N;  1VQK N;  3OYH A;  3CCM N;  4A59 A;  2E4L A;  1Z25 A;  1HMV A;  1RT7 A;  4HUG A;  5AQS A;  3VEN A;  4NB4 A;  1NMN A;  4OGE A;  3MK6 A;  5T7B A;  1NJX A;  1ASU A;  3I55 N;  1DKG D;  4LFB K;  5EXW A;  3JSM A;  4IEE A;  3ZET A;  2E2N A;  4KHY A;  5JLH A;  1HR0 K;  2IIR A;  4FWR A;  4FZZ A;  1TUY A;  1GLC G;  2E1Z A;  1YT3 A;  3O4N A;  3AO2 A;  1J5O A;  1UA0 A;  4OVL A;  4O0I A;  1TKX A;  4BG8 A;  2P9N A;  3AV9 A;  1E3M A;  1X3M A;  1WBB A;  4DV7 K;  3KLE A;  3H46 O;  5C2D A;  2IGI A;  3KLG A;  3QFU A;  1JL2 A;  2RN2 A;  2QWN A;  1P8Z A;  1ATN A;  4FWS A;  2E6L A;  3SAH A;  3VEZ A;  2W41 A;  3ATV A;  1R59 O;  4J2E A;  3WXJ A;  5HOO A;  4CZJ A;  4B1Y B;  5BN8 A;  4GW6 A;  3V1Q A;  4CK2 A;  3ENH A;  1MWK A;  4ID5 A;  3ZT1 A;  2YKN A;  4CJR A;  4BG9 A;  2DY4 A;  1KXP A;  1WAJ A;  4WYB A;  1XMO K;  3CCE N;  3JS6 A;  4FPB A;  1Q8I A;  2OPS A;  4B1V A;  3WXL A;  2PFU A;  3B6O A;  2P5G A;  3OYA A;  1K73 O;  3SBG A;  2XHB A;  3EKS A;  3FE1 A;  3Q7B A;  5C25 A;  1EX4 A;  1Y97 A;  3VQA A;  1BCM A;  3ZSR A;  3ZT4 A;  4KI6 A;  3V4I A;  4EZ6 A;  4O5F A;  3VQP A;  2VGN A;  3DI6 A;  3DYA A;  2IVP A;  1JKH A;  4H03 B;  4E7I A;  5AZI A;  3U3Y A;  4XEI A;  1YIT N;  1SS6 A;  4KBO A;  4FWK A;  3PIO L;  3W3D A;  3FZM A;  4DU4 A;  3HO1 A;  1RTI A;  4KRF A;  3O9Q A;  4I2Q A;  4DF8 A;  4ZTF A;  4CBU A;  1HNW K;  3HRG A;  5AQW A;  2F4V K;  2D1K A;  4AF1 A;  2HHV A;  1SL1 A;  5GAE P;  5I42 A;  1SKW A;  3QET A;  1SKS A;  3J7Y P;  1BUP A;  2OCE A;  4BR9 A;  3SUO A;  2D4W A;  1S1X A;  3CC7 N;  3AA2 A;  4JKB A;  3FR0 A;  2ZQB A;  5I9E B;  3E9L A;  3O80 A;  1RGI A;  4CJU A;  1QSL A;  4CJT A;  2NRW A;  1Y64 A;  3RMC A;  4JS4 A;  1KVB A;  3O3G A;  3HM8 A;  4JN4 A;  1C0M A;  3K58 A;  4JEP A;  1WOQ A;  2EX3 A;  1D8Y A;  1X9J A;  3A5N C;  2GWK A;  5M1P A;  1Q9X A;  4DQP A;  2YHY A;  3D2E B;  3WQU A;  4MLH A;  5K14 A;  1YJN N;  1QQO A;  3PUF A;  1F21 A;  2FC0 A;  1T8E A;  1QHA A;  4XH5 A;  4QAG A;  3VEV A;  3O9S A;  3RR7 A;  1U6Z A;  2E2O A;  1NJI O;  4OKE A;  4Q0B A;  1U2V A;  3LP2 A;  4HCC A;  4C8L A;  1IG9 A;  2BGG A;  1NK5 A;  3CME N;  1ITG A;  1NK0 A;  5AQP A;  3F73 A;  3AVJ A;  1JCF A;  2YHX A;  3ENB A;  3E9O A;  3CHW A;  2NZT A;  4CJW A;  3WNH A;  1NOY A;  4RTF D;  4B1W B;  1WSF A;  1NGJ A;  3CCV N;  2KFN A;  1KQS M;  3LZI A;  1YUW A;  5CYQ A;  1I39 A;  4M3Y A;  4B9T A;  4YNQ A;  3M5R A;  4EP4 A;  5GIN A;  3K5L A;  3EZ5 A;  1VSI A;  5GAD P;  1NG9 A;  3A2F A;  4AHV A;  3IUC A;  1T6C A;  4AHT A;  4BR0 A;  1LWF A;  4HVJ A;  3GG4 A;  4ZTJ A;  3NCI A;  4R5P A;  3HZ6 A;  2GUP A;  4GV3 A;  2WBN A;  1C1A A;  4B9L A;  3SQ1 A;  2P9U B;  1SKR A;  2P9K A;  1EP4 A;  3SPY A;  2AA4 A;  3CF5 L;  4I2P A;  1LAV A;  3VQE A;  3J8A A;  5HBM A;  3DM2 A;  3LDP A;  4ILG B;  3PV8 A;  3J80 O;  4O0J A;  5BPL A;  1VSL A;  3VF2 A;  3C7N B;  1FJG K;  4CJ4 A;  3VGL A;  1BI4 B;  4DB3 A;  5FRO A;  1TK8 A;  4MLE A;  4W5N A;  3DXM A;  5IWA K;  2KZZ A;  2RPI A;  3TAN A;  4DSE A;  2YCH A;  2YKM A;  2FSK A;  1Q9Y A;  2Q36 A;  1XNQ K;  3TSQ A;  3KLH A;  4CEC A;  1WSG A;  1S1W A;  4WFA L;  1JCE A;  2YNF A;  1HPM A;  3D2F B;  3NGY A;  2QKB A;  4CEQ A;  2O8E B;  3U6F A;  3CET A;  3CJ7 A;  4F2R A;  2HF4 A;  1NNE A;  1BQN A;  2V51 B;  3P83 D;  4BRI A;  3JYT A;  1W7A A;  5EOY A;  4I6M B;  2DFF A;  3THX A;  3I8D A;  4FM2 A;  1HJR A;  1L5U A;  3AVH A;  1UWB A;  2G8I A;  3BF3 A;  5HRN A;  4CGG A;  3HXM A;  4BWJ A;  3GE1 A;  3I0S A;  2XY7 A;  3H3O B;  5JMV A;  2G8K A;  2J4R A;  1GLF O;  4AIL C;  2KFZ A;  3MWP A;  3O9T A;  4H0Y B;  4IDK A;  2NUB A;  2NRT A;  4F3T A;  4FJ9 A;  3A5O C;  3OYJ A;  4LF4 K;  3R8E A;  2NRH A;  3TAP A;  5BRH A;  5TKW A;  2KZM A;  3LZJ A;  1HKB A;  4C8M A;  4KTZ A;  4DMN A;  2VWJ A;  4JRP A;  1KCF A;  4FJG A;  1JLB A;  5C24 A;  1OVY A;  1T05 A;  3AA4 A;  1XHZ A;  2FLO A;  2ZD1 A;  3T1Y K;  3V6D A;  3CYM A;  2IVO A;  1WNS A;  2P9S A;  3GOI A;  3AO3 A;  1JLA A;  3OTO K;  2YJF A;  1J54 A;  4B3S K;  2O4I A;  4CIG A;  4BVO A;  3LPT A;  1HNZ K;  1VRU A;  2Z1J A;  2D0C A;  1RT6 A;  4JHD A;  2VWB A;  3AY9 A;  1TYQ A;  4L3Q A;  4CF9 A;  4ISF A;  4FWO A;  5CY4 A;  4FLW A;  3NFA A;  4FLT A;  4CCH A;  5KQ8 A;  1Z05 A;  4FL9 A;  4ELT A;  2KTQ A;  4BC3 A;  4IOA L;  2O8C B;  2FBY A;  3QB0 A;  3LWL A;  1WSJ A;  3FZK A;  3C6T A;  4XH1 A;  5BPN A;  3MX5 A;  5J1E A;  4CBX A;  3B8A X;  3AAP A;  3HTV A;  3OYC A;  4WQ4 C;  3RMB A;  4DSK A;  4YOR A;  2NRX A;  2HF3 A;  1IH7 A;  2IAJ A;  1EWQ A;  4OLB A;  3LPU A;  4L8R B;  1W9H A;  1RDW X;  2UXD K;  4KFB A;  2KW4 A;  4CEO A;  2A1R A;  3H6E A;  2ZJR L;  1NGG A;  1UOC A;  3VOV A;  3VA3 A;  2OAN A;  3LDS A;  1ZBU A;  3J7A P;  2W40 A;  1XMQ K;  2D0A A;  2G8H A;  3M8R A;  3ZX3 A;  4EIA A;  4CGJ A;  3CCL N;  1YXQ A;  4MQ3 A;  2DPN A;  3VQD A;  4B1X B;  3EY1 A;  2GEL A;  4CD1 A;  3SCX A;  2PZS A;  3PO5 A;  4AM7 A;  2UXC K;  1IG8 A;  1YVN A;  2ZGZ A;  4FM1 A;  3OY9 A;  3EEQ A;  5JLF A;  3WEE B;  4Z94 A;  1Q82 O;  3HPH A;  5C15 A;  2BE2 A;  5ADX A;  3T7Z A;  1WSI A;  3OYN A;  1HJO A;  5AFU A;  1SUQ A;  3THY B;  1TV6 A;  4Y1C A;  2UXB K;  3KD1 E;  1NKC A;  3LDN A;  4JNE A;  3DRS A;  3SNN A;  5AQM A;  3H08 A;  1NBW A;  3ZSZ A;  2G8W A;  3CFR A;  4FPA A;  3UB5 A;  3QIO A;  1RBS A;  3ZYY X;  2FBV A;  3FZL A;  1LV5 A;  4O55 A;  3DOK A;  1VQO N;  4X65 K;  3VF6 A;  2GWJ A;  5FLX O;  4AHC A;  3WNE A;  4Z4C A;  1RT3 A;  5J2Q A;  3QEP A;  4KB0 A;  2QWR A;  3HPG A;  2ZF5 O;  3D7E O;  1WUA A;  2ETJ A;  5BRD A;  1L3S A;  1BOT O;  4E89 A;  2ZWH A;  1VSH A;  3PLA A;  2D0P A;  3KWI A;  4BRF A;  3UKR B;  1VAZ A;  4PKI A;  3WNF A;  5LY3 A;  4GKJ K;  4ELU A;  1GLA G;  3OYG A;  1NGI A;  1BWF O;  3FZH A;  3N4P A;  3VMF B;  2FBX A;  1O13 A;  4CFC A;  4JI0 K;  4GKK K;  2CGK A;  4CER A;  3MXJ A;  1Q7Y O;  3VET A;  4DFK A;  3RMD A;  1XUP O;  3G4S N;  4IO8 A;  1L3T A;  3NGI A;  1KVC A;  3K2P A;  4FJI A;  1HKG A;  2FF6 A;  4IO9 L;  1KSP A;  2P9L B;  5ELZ A;  1U47 A;  3NHG A;  3CPW M;  3CJ1 A;  4FWN A;  3R9P A;  3NVK A;  4R79 A;  4CHQ A;  4DU1 A;  3ASM A;  3LAN A;  3RRH A;  4WCE L;  4EP5 A;  4BGA A;  3LL3 A;  4FLX A;  3EKU A;  4CW7 B;  4JKG B;  4MO4 A;  3ULE A;  4RW6 A;  4K0K K;  5KI6 A;  4B08 A;  1S9G A;  4BRN A;  1RDU A;  4CGH A;  1Q86 O;  3DLK A;  4OGC A;  1RFQ A;  3E9P A;  1HYV A;  4Z4E A;  4Z4H A;  4FJJ A;  5AZJ A;  4E7H A;  1N36 K;  1OH8 A;  3K0S A;  2A3Z A;  2QWQ A;  3KIO A;  1TVR A;  1WSH A;  3SUQ A;  1WN7 A;  2P5O A;  4LF5 K;  3KK7 A;  1IBL K;  1S6P A;  1ZBF A;  1CXQ A;  3PX0 A;  1EQY A;  1HYS A;  1C0U A;  3CJC A;  2BAN A;  3C65 A;  3HM9 A;  3E01 A;  2ASO A;  3V9W A;  3EE9 A;  4WQ5 C;  1ZBL A;  4KO0 A;  1ATS A;  4JI4 K;  4PY5 A;  3P39 A;  3AVM A;  2CH5 A;  5BRE A;  4LSN A;  4CJP A;  1R0A A;  3DLH A;  5M1Q A;  2HHU A;  1IKW A;  5CHI A;  2EWS A;  3TAG A;  1NK4 A;  4YOY A;  1N5Y A;  1FXX A;  1T3V A;  4CJL A;  2HVH A;  3DLL L;  4FLU A;  3BF1 A;  4A2B A;  3DXK B;  3NVM A;  4NXM K;  1VQ8 N;  1LWE A;  3VEO A;  1CZB A;  4GV9 A;  2VGM A;  4KTW A;  1BIU A;  4YDU C;  5EX5 A;  3QML A;  4JKF A;  1MU2 A;  4CF2 A;  5DM6 L;  4QS9 A;  4DHY A;  2JGU A;  4V19 S;  3CCS N;  3BDP A;  4CJS A;  5BRF A;  2EHG A;  3S3M A;  3HVT A;  3LDL A;  1NJZ A;  3PSF A;  2YHW A;  5JVH L;  3SAF A;  4N76 A;  3OS0 A;  1QS4 A;  4CZE A;  1VSE A;  2YHA A;  4JD2 A;  4BRG A;  1QZ5 A;  3TAB A;  4JK9 A;  2JWK A;  3VTI A;  1S1V A;  3EZW A;  4FJL A;  3H45 C;  3P38 A;  3VEY A;  1QHT A;  2GTD A;  1U48 A;  1BA0 A;  5HLF A;  4MFB A;  1Q18 A;  1HLU A;  1HQE A;  4W5R A;  1RBV A;  3CQY A;  3ENO A;  1GLB G;  4B9M A;  3HL8 A;  1CLQ A;  1NK8 A;  1K8K A;  3C6U A;  5AQX A;  3ZSX A;  3FGU A;  4F8R A;  2YJE A;  1FK9 A;  3UKU A;  3TPQ A;  1BQM A;  2E6M A;  2B4J A;  2YNH A;  3HOT A;  4K8X A;  5M1F A;  4M63 C;  4KHS A;  1KTQ A;  4FLZ A;  2ASM A;  1QZ6 A;  2VG6 A;  3ITH A;  5SWM A;  1EET A;  3HP9 A;  1RBR A;  5H1S Q;  4DR6 K;  4K41 A;  1QQC A;  1J6Z A;  3DWL A;  4DTM A;  3AVA A;  3D0P A;  3N4Q A;  5JIC A;  3THW B;  4BGB A;  1RT4 A;  3U8X A;  5AQJ A;  1BO5 O;  5CZ2 A;  5ADX H;  3ZX2 A;  5AFU H;  3K5M A;  3DLR A;  2ZJP L;  2KQ2 A;  3CCQ N;  4KH4 A;  3MXM A;  1HQU A;  3CD6 N;  2GX9 A;  1J53 A;  4I9Q A;  4BRP A;  3L6Q A;  4FJ7 A;  3NH2 A;  1U04 A;  4F4K A;  1S1U A;  3KVG A;  2Q3S A;  4B3M K;  2G8F A;  2QK9 A;  1WBD A;  3LAK A;  4X66 K;  5JS1 A;  1ILY A;  1REV A;  3F9M A;  2PYL A;  5BR8 K;  2O8F A;  5AQI A;  4KRE A;  1QQN A;  4JKD A;  3OYD A;  3O5B A;  4CGI A;  4LH5 A;  2D0O A;  5JVG L;  3OBW A;  3CQX A;  3VES A;  3K59 A;  4OKK A;  5FPM A;  5AQO A;  1X1P A;  4DTJ A;  3BZC A;  2GEM A;  3NF7 A;  3KKS A;  1NGF A;  4KAZ A;  3FFI A;  1SQK A;  3DRR A;  3C94 A;  3BZK A;  4WQ4 A;  1RTH A;  3NBP A;  4CK3 A;  4Z4F A;  5J2M A;  1QE1 A;  2QXL A;  4DSL A;  4CJF A;  4M3R A;  4KB1 A;  3LP0 A;  1YVU A;  4A57 A;  1J9A A;  2KKZ A;  1HNX K;  3AVF A;  3VQB A;  2IS3 A;  3M6G A;  4H4O A;  4DR1 K;  1KFD A;  1N8R O;  4BQL A;  4PWD A;  4B9U A;  3G25 A;  4JI7 K;  3P31 A;  4JI1 K;  3VTH A;  2VQE K;  3IS9 A;  4YOV A;  4JK7 A;  3ZEU B;  5LJV A;  3QIC A;  1OH7 A;  4CJ7 A;  5AQQ A;  1ZXO A;  4IZ9 A;  4DTX A;  1ATR A;  4K43 A;  4LFC K;  1TL1 A;  4BDP A;  3RSE A;  4M3Z A;  2HHQ A;  2ZM6 K;  1X9M A;  1K6Y A;  4CEF A;  3ATU A;  1OVQ A;  3DLG A;  4N41 A;  3TAE A;  2E8A A;  3AVK A;  3M1F A;  2IVN A;  3HYF A;  4CF1 A;  3MXI A;  4EZ9 A;  1S9E A;  4M41 A;  2OA8 A;  1NJW A;  1VQN N;  4IXC A;  3KLI A;  1HUX A;  4FWQ A;  3LWM A;  2OTJ N;  1G15 A;  1VQ7 N;  3OS2 A;  1LOT B;  3OHR A;  2F8T A;  3AVL A;  4QS8 A;  3VQ9 A;  3TU5 A;  4H8K A;  4BE0 A;  3CFP A;  3I33 A;  3K57 A;  3T1A A;  4M7Y A;  1BDG A;  3JXU A;  2YNG A;  3SJH A;  3A0I X;  5GAG P;  1T6D A;  3A5L C;  3SQ2 A;  3TTF A;  3NGZ A;  4KHQ A;  4JAX A;  3VGK A;  3TSP A;  1DT9 A;  3V9X A;  2OTL N;  2HHT A;  4DQQ A;  3PO4 A;  4E7K A;  3ZX0 A;  3MEG A;  3VQ8 A;  1SAZ A;  5AR0 A;  1NLV A;  1NK6 A;  3IFR A;  3W0L A;  1JLG A;  4CHO A;  3IRX A;  3SV3 A;  3EO3 A;  4FOI A;  2RHK A;  3CER A;  4Y1D A;  4CZI A;  3RWU A;  4DCH A;  4K42 A;  4DTS A;  1RDC A;  4CZM A;  1T44 A;  2UUB K;  1GLD G;  1N34 K;  4OO1 J;  1CZ9 A;  3EE8 A;  3CJ9 A;  4DR5 K;  1SL0 A;  3KKR A;  5E84 A;  4KHP K;  1S1T A;  4H5V A;  1GOA A;  3VGM A;  1IJJ A;  2P1J A;  3TTC A;  1RT2 A;  4CGD A;  1DLO A;  4IG0 A;  3L2W A;  4F3O A;  5AQN A;  2Y1J A;  3LAM A;  4FO0 A;  1W0H A;  4DUZ K;  1U49 A;  4FJX A;  1TGO A;  5AQL A;  1HNI A;  1RCH A;  5AQR A;  2E20 A;  4CE9 A;  2Q0U A;  5C0Y A;  1JLF A;  2UUC K;  4M42 A;  3VF4 A;  1JLQ A;  2O8D B;  3S3N A;  3T19 A;  4I9L A;  2DTU A;  3V1O A;  4DR4 K;  3R1X A;  4K25 A;  5FDL A;  5KQD A;  3HPO A;  5AQH A;  1VSF A;  4YY3 K;  1W97 L;  1XHX A;  4F2S A;  3CFO A;  1LAW A;  3WXK A;  3U4L A;  3QFP A;  2F9T A;  3GBT A;  4LF9 K;  5KPR A;  1ZYQ A;  4PKH A;  1I94 K;  1ZBS A;  5IT9 O;  1NGC A;  2QWP A;  5CE3 A;  4NYF A;  4HUF A;  4CZF A;  3CQ8 A;  5M1N A;  4CIF A;  2XY6 A;  1HPZ A;  2Q2R A;  5KRT A;  3MDQ A;  3WQT A;  3EYZ A;  1LWC A;  2QTD A;  4ILH A;  2BH1 A;  4ICL A;  3QER A;  3IKM A;  4WQ5 A;  4KHN A;  3HSC A;  3F2K A;  3S9H A;  4CEE A;  2OZS A;  3FFK B;  4DS5 A;  4AH9 A;  4ISG A;  3PIP L;  3HOS A;  1QSY A;  2E1Y A;  3ZSV A;  4DTU A;  4DLE A;  4FZX C;  4LFA K;  1OKJ A;  2WTU A;  2BDP A;  4AM6 A;  1RBT A;  4PUO A;  3RVC A;  3WNG A;  4DR2 K;  3J81 O;  4DFJ A;  4CES A;  4KPY A;  2XY5 A;  4CJ5 A;  4PA1 A;  1V4T A;  4Q5V A;  4E0D A;  1S5J A;  3H1V X;  3K9J A;  5C10 A;  4KKO A;  1VSM A;  4IG3 A;  4YDU A;  1U2V B;  4B3R K;  3LDQ A;  3LP3 A;  2E5L K;  1WB9 A;  4PL7 A;  2WOM A;  4UY8 O;  4X62 K;  2RKI A;  5CYM A;  3LM2 A;  4NCB A;  3O6W A;  4CBW A;  2KHO A;  3L2R A;  1KFS A;  3AGK A;  4BAC A;  1QVG M;  2R7Y A;  4OKJ A;  4CJ3 A;  4IBN A;  4JK8 A;  4B9N A;  4OPJ A;  2LSN A;  3TSU A;  1ZBI A;  4I7F A;  1BU6 O;  3UIQ A;  4GV6 A;  3G0Z A;  3HI0 A;  3QEV A;  2IDO A;  3BY5 A;  3SZ2 A;  5HL7 L;  3D45 A;  5SZT A;  3I56 N;  1U4B A;  2F8S A;  2Y1I A;  3BGR A;  1UAX A;  1VQ5 N;  1KRP A;  4A62 A;  5BPM A;  4DR7 K;  1YF5 L;  3CJB A;  1TK5 A;  4O8K A;  2O8B B;  1NKE A;  3AVG A;  2RF2 A;  4DG1 A;  3DJC A;  3KK2 A;  3R6M A;  1L3U A;  2P9K B;  1KAY A;  3AAR A;  2JLE A;  5AQV A;  1LW0 A;  2PYJ A;  3QNO A;  2I7N A;  3MN5 A;  3OW2 M;  3OYI A;  3BEX A;  4CED A;  4C1N I;  1ASW A;  3IDH A;  4Z4G A;  4BWM A;  3V9Z A;  1K8A O;  4FJH A;  1KC8 O;  4RW4 A;  4TSX A;  4MDB A;  2WFB A;  1OH5 A;  3OYK A;  1SZ2 A;  2OPR A;  5DK5 A;  4M3W A;  1TAQ A;  3O8M A;  3D2E A;  3DXM B;  4BDY A;  3NF6 A;  3NE6 A;  1JLE A;  4HHT A;  2W6L A;  3QDK A;  4KH5 A;  1P90 A;  4C23 A;  3CM5 A;  2Z1I A;  4IFV A;  2O4G A;  3K5O A;  2V7Y A;  5AQZ A;  1QVF M;  5C12 A;  5FPE A;  3KTQ A;  4H5N A;  1S3X A;  4EHU A;  3SI6 A;  1VQ4 N;  3QIN A;  5AQK A;  3NH1 A;  3NH0 A;  4AHR A;  4BRM A;  3THX B;  4LF6 K;  3L8B A;  3L4Q A;  4DQI A;  5KRS A;  1VSD A;  4H5R A;  1IO2 A;  1DEJ A;  3CCJ N;  3CPE A;  1B9F A;  2Q31 A;  1NJY A;  1JCG A;  3QLH A;  3PX6 A;  3NDK A;  2GUI A;  1X9W A;  1NU0 A;  4JKE A;  3HBT A;  4WE1 A;  4LF7 K;  4M3T A;  3U3G A;  2UYT A;  1YJW N;  3AAQ A;  3O9R A;  1RTD A;  2Q1N A;  4FJM A;  2HOE A;  3AVN A;  1C6V A;  3TR8 A;  1OH6 A;  4FJN A;  3M8Q A;  5AQT A;  1E4F T;  3L3V A;  3L2V A;  4ILJ A;  4EFH A;  4IEI A;  3E66 A;  4BR2 A;  1BG3 A;  1QSS A;  4CIE A;  3S3O A;  4DKW A;  1IKV A;  2P9U A;  1VHX A;  5KPT A;  4BRQ A;  1TUU A;  1XC3 A;  2P9S B;  2HBM A;  3DMJ A;  5EU7 A;  1TAU A;  1RIL A;  1E4G T;  3FZF A;  3O08 A;  1NKB A;  2ITM A;  2IOC A;  4LY7 A;  5F1X A;  4DV4 K;  1TL3 A;  4PKG A;  4ELV A;  3U9D A;  3SMP A;  4HTL A;  3L0Q A;  4G1Q A;  3VQQ A;  3C7N A;  4CF0 A;  3SQ4 A;  3QIP A;  4CJV A;  4CVN E;  3OYE A;  4JKA A;  3ID8 A;  3MCA B;  1BI4 A;  2HB5 A;  4CHP A;  3DAW A;  1C0G A;  4JHD B;  3BP8 A;  4BRE A;  2H3G X;  1VQ9 N;  1TYQ B;  1IBM K;  2HNZ A;  2VQF K;  5GIO A;  3MED A;  3TWH A;  1KLM A;  3CIP A;  1NWK A;  3B6P A;  4GNI A;  3G71 N;  2B6A A;  3SUN A;  4DV5 K;  1NK9 A;  1RDD A;  3VEX A;  4FYD A;  3D2F A;  2O8E A;  3A5M C;  1YHQ N;  5GAH P;  2UUA K;  3KZB A;  3QO9 A;  3M8P A;  3MN7 A;  4JV5 K;  5M1K A;  5HRS A;  4I6M A;  3RTV A;  4BC5 A;  1M1K O;  2F96 A;  4BRC A;  3KD5 E;  1D9F A;  4UQG A;  3WXI A;  1FKP A;  3K9K A;  4M3X A;  4GMJ B;  1TKT A;  3U9Z A;  2QA4 N;  3BUZ B;  4BQZ A;  1YJ9 N;  4OPK A;  3G6E N;  5I3U A;  3HVR A;  4BRO A;  1YAG A;  2QM1 A;  2B5J A;  4JLH A;  3NMU A;  4BRD A;  4DR3 K;  4B1Z A;  1RNH A;  4WF9 L;  4EHT A;  4G9Z A;  1H1V A;  5AJ3 K;  3OVN A;  1TKZ A;  4IFY A;  3O4W A;  3T69 A;  5FPD A;  3V81 A;  1KLN A;  3TI0 A;  4OPH A;  3ZT3 A;  4DU3 A;  3VN5 A;  4M45 A;  1G99 A;  2P9P B;  5FRN A;  2JWL A;  1JL1 A;  2O8D A;  3IAY A;  2PBD A;  4CZL A;  4DQ8 A;  3OYF A;  3NF8 A;  3MEE A;  3V1R A;  2YX6 A;  4YFU A;  3QEI A;  2I7P A;  4J8F A;  2BUP A;  4RW8 A;  1RDB A;  2A5X A;  4FZY A;  4FM0 A;  4H0X B;  2OYQ A;  3MEC A;  3DLB A;  2QWO A;  4CK1 A;  4BR7 A;  3DOL A;  2P51 A;  4H4M A;  4J2D A;  4C8N A;  3O3F A;  5F0X A;  2O8C A;  1GLE G;  2X6N A;  1I3A A;  2D0B A;  4E7L A;  2FSN A;  1HX1 A;  4GVE A;  4DSF A;  1Q81 O;  3TAF A;  4B3T K;  5BN9 A;  4FWL A;  2P9I B;  2RE2 A;  2HHS A;  3HK2 A;  2HST A;  2HW3 A;  2IC3 A;  4B8A B;  4JKH A;  3P5J A;  3QNN A;  1NK7 A;  4J2B A;  1TK0 A;  2QXF A;  1RT5 A;  2V52 B;  1NOZ A;  1C0F A;  3QBX A;  3OJS A;  4N47 A;  3CG7 A;  4KTQ A;  1RDA A;  3EL2 A;  4N56 A;  3CMA N;  3G10 A;  4LC9 B;  3SLC A;  4BRL A;  2ZE2 A;  4CHN A;  4BE1 A;  3GDQ A;  4FCY A;  1BHL A;  4RWT A;  4M7X A;  3MWT A;  4H5T A;  4RW7 A;  2HHX A;  2A6A A;  2OPQ A;  3E1Y A;  3QEW A;  2A1S A;  4CF8 A;  5KGX A;  4DLG A;  4BRH A;  5HRO A;  2UU9 K;  5JS2 A;  1RBU A;  2PY5 A;  1YI2 N;  2DFE A;  5FRM A;  4JI5 K;  5EY4 A;  5TKY A;  3OS1 A;  4MO5 A;  1QQM A;  4BRK A;  3RMA A;  4KHU A;  1KVA A;  5AQU A;  4B3O A;  4X64 K;  2HMI A;  3VQ5 A;  3AO5 A;  1YTU A;  4E7J A;  4DTR A;  3HP6 A;  1CZA N;  1MDU B;  2X74 A;  3WEE A;  4C8K A;  4JS5 A;  4H0P A;  1VQP N;  2VYP A;  3SQ0 A;  4K8Z A;  2A40 A;  1XI1 A;  4WFB L;  5CR4 A;  3Q7C A;  3ULE B;  3ZSY A;  5J2P A;  4DFP A;  2Q97 A;  1GOB A;  3THY A;  2HMP A;  3QES A;  4JI3 K;  3M3Z A;  5DMR A;  4CJK A;  4C8O A;  3CXC M;  4W5O A;  4IJN A;  3WXM B;  2W6K A;  2VG5 A;  3AA3 A;  1C0T A;  2E88 A;  1DTQ A;  3ZSQ A;  2Q0R A;  2VWK A;  3S41 A;  5AZJ B;  4IDH A;  4AHS A;  3VQ6 A;  4FJ5 A;  3CJA A;  4DSJ A;  4DTN A;  1N32 K;  3F5T A;  1WSE A;  4O44 A;  4J2A A;  3MAQ A;  5E26 A;  4H0T B;  3CCR N;  1QTM A;  2G8U A;  4FVU A;  4KI4 A;  4JI6 K;  2O8B A;  4FW2 A;  4FSV A;  4LD0 A;  2I5J A;  3VQ4 A;  3ZT2 A;  3AO1 A;  4FOE A;  4DS4 A;  1EO1 A;  4IOX A;  1YIJ N;  3VEW A;  2X6S A;  3OJU A;  4PQU A;  4ZHR A;  3WUH A;  4AQY K;  3O1W A;  5FPN A;  3UKR A;  4BR5 A;  3CC4 N;  3D6R A;  4CZG A;  4XIU A;  4E19 A;  3ZET B;  1VSK A;  1SV5 A;  4FJ8 A;  2CGL A;  1VK0 A;  4O5B A;  3ZSO A;  2CH6 A;  1LCU A;  4F9O A;  2ZJQ L;  2P9N B;  4ID1 A;  2YHB A;  4YHH K;  1T03 A;  3VER A;  1KAX A;  3GL1 A;  4NXN K;  3PSI A;  2F9W A;  5EVZ A;  1W2B M;  4N5S A;  2VG7 A;  3KK3 A;  4DV3 K;  3H1Q A;  2P9L A;  3MX2 A;  4FK2 A;  3DLE A;  4CFA A;  4IFE A;  4E1J A;  3OYL A;  2XO7 A;  3AVI A;  3SYZ A;  1VSJ A;  4W5Q A;  4YOW A;  2QWL A;  4KV8 A;  1IBK K;  4IWV A;  2KLA A;  4AHU A;  3SAG A;  4W5T A;  2E2P A;  2HNY A;  4DTP A;  3AO4 A;  3LDO A;  4FXD A;  4B1U B;  4JKG A;  1VQ6 N;  3VQ7 A;  4ISE A;  3L4I A;  4CJE A;  3IG1 A;  4H0O A;  4NCG A;  2HVI A;  3SJJ A;  5KTQ A;  2ASP A;  2QW9 A;  4CHZ A;  3MMV A;  4LSL A;  3H3N O;  2X78 A;  1IKY A;  1MA9 B;  4JKC A;  3RR8 A;  4JD2 B;  1FKO A;  4IOC L;  2ITG A;  4Z0U A;  4A5B A;  1IKX A;  4BC4 A;  2NRZ A;  3DRP A;  4Y0W A;  4BY9 C;  1BCO A;  3ISN C;  3LM9 A;  5J2N A;  3SUP A;  4CFD A;  3SPZ A;  1KD1 O;  1A5W A;  2Z1H A;  3QBW A;  2NNW A;  3ZLJ A;  3ZSW A;  1ASV A;  2HND A;  3OYB A;  3CC2 N;  3HJF A;  1GLJ O;  3P1G A;  3SMS A;  5LL6 Z;  4B9S A;  2PAV A;  3JAM O;  2XY8 A;  5GIP A;  3ULD A;  5AZI B;  4DTO A;  1K8K B;  4DF4 A;  4CI6 A;  4A2A A;  3L2Q A;  4LH4 A;  3QEX A;  3NF9 A;  3UKU B;  5KPZ A;  2GV9 A;  2BTF A;  5LJW A;  4DQR A;  3SV4 A;  3RRG A;  1RTJ A;  4FJK A;  2ZGY A;  4NLB A;  2FBT A;  4KH6 A;  5F2R A;  4BDZ A;  2HBL A;  3OA9 A;  3TAR A;  4OX9 K;  1NGH A;  4IKF A;  3MN9 A;  2NRR A;  2VCP A;  1JJ2 M;  1ZC6 A;  4BVP A;  1HRH A;  5HRR A;  4HWI A;  3VA0 A;  4RCH A;  3KK1 A;  4DUY K;  2FSJ A;  4MDA A;  4YOU A;  1HNV A;  4FLV A;  3DXK A;  3OYM A;  4NLC A;  4NYN A;  3A8Y A;  3P4I A;  3HT3 A;  1B92 A;  4B9V A;  5C42 A;  1D5A A;  5KGW A;  5A2Q O;  4FWP A;  4JI8 K;  2QWM A;  2ATQ A;  4CEA A;  4HUE A;  1C1B A;  4QCL A;  4DV1 K;  1ESV A;  4OPA A;  1LW2 A;  3C6A A;  4BRA A;  2DFH A;  4CEB A;  1JXB A;  2O8F B;  4LF8 K;  4DSI A;  4DV0 K;  2YI1 A;  1RT1 A;  3I8B A;  3T1H K;  1VQL N;  3PY8 A;  2AJQ A;  4C1N K;  1VRT A;  4FVM A;  3KWG A;  4O4G A;  3LAL A;  3ALY A;  3L3U A;  1WAF A;  3SBT A;  3ZCM A;  3AGR A;  4E1M A;  1K9M O;  1MWM A;  1S72 N;  1YTA A;  3OBY A;  1BIS A;  5B8H A;  4RW9 A;  5HP1 A;  4DQS A;  1XC9 A;  3NAE A;  1XQS C;  2QI2 A;  1DTT A;  4JI2 K;  4FLY A;  5LMU K;  2WON A;  4GY2 B;  3LP1 A;  4O8U A;  1Z6R A;  1N33 K;  3CI5 A;  5AQF A;  2HHH K;  3CM6 A;  1NGB A;  1NGE A;  2QEX N;  3KLF A;  1X3N A;  2P9P A;  4QS7 A;  4HCB A;  2WC9 A;  4CZH A;  1IV0 A;  4GVM A;  2G8V A;  1XNR K;  3AA5 X;  3L2U A;  1A5V A;  4CHY A;  3FLC O;  5MLC Q;  5CZ1 A;  3O4Q A;  3VPZ A;  4PL8 A;  1J5E K;  5C2F A;  3I0R A;  2QKK A;  2NRV A;  4CEZ A;  4WFN L;  4CFB A;  4DWI A;  4NCA A;  3THW A;  1WLJ A;  1D9D A;  3O3H A;  2A41 A;  4FK4 A;  3RSE B;  3C0B A;  4PHT X;  1EXQ A;  3C6H A;  2WUS A;  4EAH D;  1XWL A;  2AP1 A;  3R3L A;  2GBZ A;  4E1N A;  3IMX A;  1NMD A;  2YV0 X;  1B9D A;  1D4X A;  1TKD A;  4E3S A;  2P9I A;  3SK3 A;  4BR4 A;  5E41 A;  1S22 A;  2Z1G A;  4YOT A;  4JRQ A;  3O1B A;  3V9S A;  2HBK A;  1N6Q A;  1CXU A;  4B9Q A;  3KJV A;  5BR9 A;  3V9U A;  4CJQ A;  1HKC A;  1EWR A;  5HRP A;  1BA1 A;  1KAZ A;  3TAM A;  1ZBH A;  2E2Q A;  4JYA K;  1BL3 A;  2OZM A;  4CD3 A;  5D3G A;  3AVB A;  1S6Q A;  3TTD A;  3MN6 A;  1NM1 A;  3ZT0 A;  3T3F A;  3WT0 A;  3TAQ A;  2OPP A;  1UA1 A;  4M3U A;  2CGJ A;  1DGK N;  4DV6 K;  1EKE A; 
#chains in the Genus database with same CATH homology
 3C6T A;  3TAE A;  3AVK A;  3THV A;  3HYF A;  4CF1 A;  3MXI A;  3V81 A;  4EZ9 A;  4KHW A;  5J1E A;  1S9E A;  4M41 A;  2OA8 A;  1KLN A;  3TI0 A;  3ZT3 A;  4DU3 A;  3OYC A;  3VN5 A;  4M45 A;  1NJW A;  3RMB A;  4DSK A;  1A5X A;  1JLC A;  3KLI A;  3M8S A;  4FW1 A;  3LWM A;  5FRN A;  1JL1 A;  1G15 A;  1IH7 A;  4Z4I A;  2IAJ A;  4OJR A;  3OS2 A;  3IAY A;  4OLB A;  3LPU A;  2F8T A;  3AVL A;  3OYF A;  4L8R B;  3NF8 A;  2XRI A;  1W9H A;  3MEE A;  1SL2 A;  3VQ9 A;  3K5N A;  3V1R A;  3VQC A;  4KFB A;  4H8K A;  4YFU A;  3QEI A;  2KW4 A;  4CEO A;  2A1R A;  4BE0 A;  3CFP A;  2HHW A;  1JXE A;  2D5R A;  4RW8 A;  1RDB A;  3T1A A;  3K57 A;  3OVN A;  4RG8 A;  1UOC A;  1C1C A;  4FZY A;  1HYZ A;  3VA3 A;  4DFM A;  4FM0 A;  2YNG A;  1BIZ A;  2OYQ A;  1O1W A;  3MEC A;  1U45 A;  3DLB A;  4CK1 A;  3LDS A;  1L3V A;  1ZBU A;  3DOL A;  2P51 A;  3SQ2 A;  4H4M A;  4J2D A;  4C8N A;  3O3F A;  1X9S A;  3NGZ A;  4KHQ A;  4CGF A;  3PX4 A;  2D0A A;  2X6N A;  2G8H A;  3M8R A;  1I3A A;  1GOC A;  2D0B A;  4CGJ A;  3V9X A;  1Z26 A;  2HHT A;  4E7L A;  4BE2 A;  3HST B;  4DQQ A;  3PO4 A;  4E7K A;  4MQ3 A;  4DSF A;  3VQD A;  1T7P A;  2YNI A;  3EY1 A;  3TAF A;  3SCX A;  2PZS A;  3F9K A;  3MEG A;  3VQ8 A;  3PO5 A;  3HK2 A;  2IC3 A;  1NK6 A;  2HW3 A;  3AVC A;  4B8A B;  4OLA A;  3P5J A;  4F3O A;  3QNN A;  4FK0 A;  1NK7 A;  4QOZ B;  1BGX T;  1JLG A;  3IRX A;  4B8C A;  4CHO A;  4HTU A;  3SV3 A;  2QXF A;  3C95 A;  1TK0 A;  4J2B A;  2W42 A;  1RT5 A;  3OYH A;  2E4L A;  1NOZ A;  4FM1 A;  3OY9 A;  3OJS A;  1Z25 A;  4Y1D A;  4N47 A;  3HPH A;  3CG7 A;  3RWU A;  1HMV A;  4KTQ A;  1RDA A;  4N56 A;  1RT7 A;  4HUG A;  2BE2 A;  4DTS A;  1WSI A;  3G10 A;  1RDC A;  3OYN A;  4OGE A;  1SUQ A;  5T7B A;  2ZE2 A;  4CHN A;  1NJX A;  1TV6 A;  1ASU A;  4Y1C A;  4BE1 A;  4FCY A;  1BHL A;  3JSM A;  3KD1 E;  1CZ9 A;  4KHY A;  1SL0 A;  1NKC A;  3KKR A;  4RW7 A;  2HHX A;  1S1T A;  4FZZ A;  1YT3 A;  3O4N A;  1GOA A;  2OPQ A;  3DRS A;  3AO2 A;  2P1J A;  3SNN A;  1RT2 A;  1J5O A;  4CGD A;  3H08 A;  1DLO A;  4IG0 A;  1UA0 A;  3ZSZ A;  4OVL A;  3L2W A;  4O0I A;  3CFR A;  3QEW A;  1TKX A;  2A1S A;  3LAM A;  4CF8 A;  5KGX A;  4DLG A;  2Y1J A;  3AV9 A;  2HHS A;  1W0H A;  4FJX A;  1U49 A;  5HRO A;  1TGO A;  3QIO A;  1RBU A;  5JS2 A;  1HNI A;  1RBS A;  2PY5 A;  2FBV A;  2DFE A;  3KLE A;  5FRM A;  1RCH A;  2IGI A;  1LV5 A;  4O55 A;  3KLG A;  3DOK A;  4CE9 A;  3OS1 A;  3RMA A;  1JL2 A;  4KHU A;  1KVA A;  4AHC A;  1JLF A;  4M42 A;  2RN2 A;  3WNE A;  1JLQ A;  1RT3 A;  4Z4C A;  5J2Q A;  4B3O A;  2HMI A;  3QEP A;  3VQ5 A;  3AO5 A;  3S3N A;  4KB0 A;  3HPG A;  4E7J A;  1YTU A;  2E6L A;  4DTR A;  2ETJ A;  3T19 A;  3HP6 A;  3SUN A;  4I9L A;  2X74 A;  1L3S A;  2DTU A;  4C8K A;  4JS5 A;  3V1O A;  4E89 A;  1VSH A;  3SQ0 A;  4K8Z A;  1XI1 A;  5FDL A;  5J2P A;  3ZSY A;  4J2E A;  3HPO A;  4DFP A;  1GOB A;  1VSF A;  3WNF A;  3QES A;  4GW6 A;  3V1Q A;  1XHX A;  4CK2 A;  4ELU A;  3OYG A;  4F2S A;  3CFO A;  1LAW A;  5DMR A;  4CJK A;  1X9M A;  4C8O A;  4ID5 A;  2FBX A;  4W5O A;  4CFC A;  3ZT1 A;  2YKN A;  4CJR A;  4CER A;  3MXJ A;  2VG5 A;  3AA3 A;  4DFK A;  3RMD A;  1ZYQ A;  1C0T A;  2DY4 A;  1DTQ A;  1WAJ A;  3ZSQ A;  2VWK A;  4NYF A;  4HUF A;  4AHS A;  1L3T A;  3NGI A;  1KVC A;  3K2P A;  3VQ6 A;  3CQ8 A;  4FJ5 A;  1Q8I A;  4CIF A;  2XY6 A;  4DSJ A;  4DTN A;  2OPS A;  4FJI A;  1HPZ A;  5KRT A;  3B6O A;  2P5G A;  3OYA A;  1KSP A;  2XHB A;  3EYZ A;  1U47 A;  1WSE A;  4O44 A;  4J2A A;  3NHG A;  3MAQ A;  5C25 A;  1EX4 A;  1Y97 A;  1QTM A;  3VQA A;  1BCM A;  3ZSR A;  4CHQ A;  3ZT4 A;  2G8U A;  1LWC A;  4DU1 A;  4KI6 A;  4KI4 A;  3ASM A;  3V4I A;  3LAN A;  4FW2 A;  4LD0 A;  2I5J A;  3VQ4 A;  3RRH A;  4EZ6 A;  3VQP A;  4EP5 A;  3DI6 A;  4ICL A;  3QER A;  3ZT2 A;  3AO1 A;  3DYA A;  4DS4 A;  4FLX A;  1JKH A;  2X6S A;  3OJU A;  4E7I A;  4PQU A;  4ZHR A;  4KHN A;  3U3Y A;  3S9H A;  4RW6 A;  4CEE A;  5KI6 A;  4B08 A;  4XIU A;  4E19 A;  2OZS A;  4DS5 A;  4AH9 A;  1S9G A;  1VSK A;  4DU4 A;  4CGH A;  1SV5 A;  1QSY A;  3ZSV A;  3HO1 A;  1RTI A;  4KRF A;  4FJ8 A;  4I2Q A;  3DLK A;  4DLE A;  4DTU A;  4DF8 A;  4FZX C;  4ZTF A;  2BDP A;  1VK0 A;  4O5B A;  3ZSO A;  4OGC A;  1RBT A;  4PUO A;  3WNG A;  1HYV A;  4Z4E A;  4Z4H A;  4DFJ A;  4FJJ A;  4E7H A;  4CES A;  2HHV A;  1SL1 A;  4KPY A;  2XY5 A;  4ID1 A;  2YHB A;  5I42 A;  4CJ5 A;  1T03 A;  1SKW A;  4PA1 A;  3QET A;  4Q5V A;  1SKS A;  4E0D A;  4N5S A;  3KIO A;  3SUQ A;  1TVR A;  1S5J A;  1WSH A;  2VG7 A;  3KK3 A;  3SUO A;  1WN7 A;  1S1X A;  4FK2 A;  3AA2 A;  3DLE A;  1VSM A;  4IG3 A;  4KKO A;  4CFA A;  2P5O A;  3OYL A;  2XO7 A;  3AVI A;  3SYZ A;  1VSJ A;  4W5Q A;  4KV8 A;  2ZQB A;  3LP3 A;  1S6P A;  1ZBF A;  4AHU A;  1CXQ A;  4CJU A;  3PX0 A;  2WOM A;  1QSL A;  4CJT A;  3RMC A;  2RKI A;  1C0U A;  5CYM A;  1HYS A;  4W5T A;  2BAN A;  1KVB A;  4JS4 A;  2HNY A;  4DTP A;  4NCB A;  3L2R A;  3HM9 A;  3AO4 A;  3O3G A;  1KFS A;  4FXD A;  3E01 A;  4BAC A;  2R7Y A;  1C0M A;  3V9W A;  4OKJ A;  4CJ3 A;  3K58 A;  4IBN A;  3VQ7 A;  1ZBL A;  4KO0 A;  4OPJ A;  4B9N A;  2LSN A;  4CJE A;  3IG1 A;  4NCG A;  1ZBI A;  4I7F A;  2EX3 A;  3SJJ A;  2HVI A;  4PY5 A;  5KTQ A;  1D8Y A;  3UIQ A;  4CHZ A;  3AVM A;  3G0Z A;  4LSL A;  4LSN A;  4CJP A;  2X78 A;  1IKY A;  1R0A A;  3DLH A;  3QEV A;  2IDO A;  1Q9X A;  4DQP A;  3SZ2 A;  2HHU A;  3RR8 A;  3D45 A;  5SZT A;  1FKO A;  1IKW A;  5K14 A;  2ITG A;  1U4B A;  4Z0U A;  3TAG A;  2F8S A;  2Y1I A;  1NK4 A;  1IKX A;  3PUF A;  1F21 A;  2FC0 A;  3BGR A;  1UAX A;  3DRP A;  1T8E A;  1N5Y A;  1KRP A;  1FXX A;  1BCO A;  3ISN C;  4QAG A;  4CJL A;  5J2N A;  3SUP A;  2HVH A;  4CFD A;  3SPZ A;  4FLU A;  1A5W A;  2Z1H A;  3RR7 A;  3ZSW A;  4OKE A;  1TK5 A;  1ASV A;  2HND A;  1LWE A;  4Q0B A;  3OYB A;  1CZB A;  3LP2 A;  3AVG A;  2RF2 A;  1NKE A;  3HJF A;  4DG1 A;  4HCC A;  4C8L A;  4KTW A;  1BIU A;  3KK2 A;  3P1G A;  1IG9 A;  2BGG A;  1L3U A;  1NK5 A;  1MU2 A;  4CF2 A;  4B9S A;  1ITG A;  2JLE A;  1NK0 A;  1LW0 A;  2XY8 A;  3F73 A;  3ULD A;  3AVJ A;  4DTO A;  2PYJ A;  2JGU A;  4DF4 A;  3QNO A;  3BDP A;  4CJS A;  2EHG A;  3OYI A;  3L2Q A;  4CJW A;  4CED A;  3WNH A;  3S3M A;  4LH4 A;  3QEX A;  3NF9 A;  3HVT A;  1WSF A;  1NOY A;  1ASW A;  1NJZ A;  2GV9 A;  4Z4G A;  4BWM A;  2KFN A;  3V9Z A;  4FJH A;  4DQR A;  3SV4 A;  4RW4 A;  4TSX A;  3RRG A;  1RTJ A;  4FJK A;  3LZI A;  5CYQ A;  4N76 A;  3OS0 A;  1I39 A;  3OYK A;  1QS4 A;  2FBT A;  2OPR A;  1VSE A;  5DK5 A;  4B9T A;  4BDZ A;  4M3Y A;  2YHA A;  4YNQ A;  4M3W A;  1TAQ A;  4EP4 A;  4BDY A;  3K5L A;  3TAR A;  3NF6 A;  1VSI A;  3EZ5 A;  4IKF A;  3NE6 A;  1JLE A;  3A2F A;  3TAB A;  4AHV A;  4HHT A;  1S1V A;  4AHT A;  1LWF A;  4HVJ A;  1HRH A;  3CM5 A;  2Z1I A;  4IFV A;  5HRR A;  3VA0 A;  2O4G A;  3KK1 A;  4ZTJ A;  3NCI A;  3K5O A;  4FJL A;  1HNV A;  4R5P A;  4FLV A;  3OYM A;  1QHT A;  1U48 A;  5HLF A;  1C1A A;  4NYN A;  4MFB A;  4B9L A;  3SQ1 A;  1HQE A;  4W5R A;  1RBV A;  3KTQ A;  3HT3 A;  1SKR A;  3SI6 A;  1B92 A;  4B9V A;  5C42 A;  1D5A A;  5KGW A;  4B9M A;  3HL8 A;  1CLQ A;  1EP4 A;  3QIN A;  1NK8 A;  3NH1 A;  3SPY A;  3NH0 A;  4AHR A;  2ATQ A;  4CEA A;  4HUE A;  1C1B A;  3C6U A;  4I2P A;  3ZSX A;  4QCL A;  1LAV A;  3VQE A;  3L8B A;  4DQI A;  5KRS A;  1VSD A;  1LW2 A;  4F8R A;  5HBM A;  3DM2 A;  1FK9 A;  3PV8 A;  1BQM A;  1IO2 A;  2E6M A;  2DFH A;  4O0J A;  2B4J A;  2YNH A;  1B9F A;  1VSL A;  1NJY A;  4K8X A;  3QLH A;  4CEB A;  3PX6 A;  3NDK A;  4KHS A;  1JXB A;  1KTQ A;  2GUI A;  4CJ4 A;  4FLZ A;  2VG6 A;  3ITH A;  5SWM A;  1EET A;  1BI4 B;  1RBR A;  3HP9 A;  5FRO A;  1X9W A;  4WE1 A;  1TK8 A;  4DSI A;  4M3T A;  4W5N A;  3U3G A;  1RT1 A;  2KZZ A;  3PY8 A;  2AJQ A;  2RPI A;  1VRT A;  1QQC A;  4FVM A;  4DSE A;  3TAN A;  1RTD A;  4DTM A;  4O4G A;  3AVA A;  2YKM A;  3LAL A;  3D0P A;  1Q9Y A;  3ALY A;  3L3U A;  1WAF A;  3ZCM A;  4E1M A;  3KLH A;  4CEC A;  1WSG A;  4FJM A;  1YTA A;  1S1W A;  1C6V A;  3AVN A;  1RT4 A;  1BIS A;  3TR8 A;  5HP1 A;  3M8Q A;  4RW9 A;  4DQS A;  1XC9 A;  4FJN A;  5CZ2 A;  3L3V A;  2YNF A;  3L2V A;  3NAE A;  3NGY A;  2QKB A;  4CEQ A;  3K5M A;  1DTT A;  3DLR A;  3U6F A;  4FLY A;  1QSS A;  4CIE A;  2WON A;  3S3O A;  4F2R A;  2KQ2 A;  1IKV A;  3MXM A;  3LP1 A;  1BQN A;  1HQU A;  3DMJ A;  5EU7 A;  3P83 D;  1TAU A;  1RIL A;  3JYT A;  1J53 A;  4I9Q A;  2DFF A;  1NKB A;  4FJ7 A;  3I8D A;  3CM6 A;  3NH2 A;  2IOC A;  1U04 A;  4F4K A;  4FM2 A;  4LY7 A;  1S1U A;  1HJR A;  3KLF A;  3AVH A;  1UWB A;  1L5U A;  2G8I A;  1TL3 A;  2Q3S A;  5HRN A;  4CGG A;  2G8F A;  3HXM A;  4ELV A;  2QK9 A;  4BWJ A;  3I0S A;  2XY7 A;  4HCB A;  3SQ4 A;  4G1Q A;  4CF0 A;  3LAK A;  3VQQ A;  4AIL C;  2G8K A;  3QIP A;  1REV A;  2KFZ A;  4CJV A;  2PYL A;  3OYE A;  5JS1 A;  4GVM A;  4IDK A;  2G8V A;  2G8W A;  2NUB A;  1BI4 A;  2HB5 A;  3AA5 X;  3L2U A;  4KRE A;  4CHP A;  4F3T A;  3OYD A;  4FJ9 A;  1A5V A;  3OYJ A;  4CHY A;  4CGI A;  4LH5 A;  5CZ1 A;  2HNZ A;  3O4Q A;  3TAP A;  3MED A;  3TWH A;  1KLM A;  3I0R A;  2QKK A;  4CEZ A;  2KZM A;  4CFB A;  3B6P A;  4DWI A;  4NCA A;  3K59 A;  1WLJ A;  1D9D A;  3LZJ A;  4OKK A;  3O3H A;  4FK4 A;  2B6A A;  1X1P A;  4KTZ A;  4C8M A;  4DMN A;  2VWJ A;  4JRP A;  1KCF A;  1RDD A;  4DTJ A;  1JLB A;  5C24 A;  1NK9 A;  4FJG A;  4FYD A;  1EXQ A;  1XWL A;  3NF7 A;  3KKS A;  1T05 A;  3AA4 A;  4KAZ A;  2GBZ A;  3FFI A;  4E1N A;  1XHZ A;  3DRR A;  2ZD1 A;  3C94 A;  3V6D A;  3CYM A;  3QO9 A;  3M8P A;  1WNS A;  1RTH A;  2YV0 X;  3NBP A;  4CK3 A;  5HRS A;  1QE1 A;  3AO3 A;  5J2M A;  1B9D A;  4Z4F A;  1TKD A;  4E3S A;  4DSL A;  1JLA A;  4CJF A;  3RTV A;  4M3R A;  2F96 A;  3LP0 A;  1YVU A;  4KB1 A;  3KD5 E;  1J54 A;  1D9F A;  4UQG A;  5E41 A;  1J9A A;  2O4I A;  2Z1G A;  4CIG A;  1FKP A;  3AVF A;  3LPT A;  3VQB A;  2IS3 A;  4JRQ A;  4M3X A;  3V9S A;  4GMJ B;  1TKT A;  1N6Q A;  1CXU A;  4H4O A;  3KJV A;  2Z1J A;  1VRU A;  1KFD A;  2D0C A;  4CJQ A;  4OPK A;  3V9U A;  1RT6 A;  5HRP A;  3TAM A;  1ZBH A;  4PWD A;  4B9U A;  5I3U A;  1BL3 A;  4CF9 A;  2OZM A;  3IS9 A;  5D3G A;  3AVB A;  3HVR A;  1S6Q A;  5CY4 A;  4FLW A;  4FLT A;  3NFA A;  4CCH A;  2B5J A;  4JLH A;  3ZT0 A;  4ELT A;  2KTQ A;  3T3F A;  3TAQ A;  4DTX A;  1RNH A;  2OPP A;  1UA1 A;  2FBY A;  4M3U A;  1TL1 A;  4BDP A;  3LWL A;  4M3Z A;  1WSJ A;  2HHQ A;  1TKZ A;  1EKE A;  1K6Y A;  4IFY A;  4CEF A;  4N41 A;  3DLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...