3AVLA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
molecule tags Recombination/inhibitor
source organism Human immunodeficiency virus type 1
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avlA00
3AO1A 3OS1A 1RTIA 5FROA 4AHCA 4DTUA 1KVBA 1TAQA 3QNNA 3CM5A 4Z4CA 3DRRA 3DM2A 4TSXA 4CK3A 3ALYA 4KTZA 3OYDA 4B3OA 3ULDA 1LWCA 3TR8A 3ZSRA 1BI4A 1D5AA 4HVJA 3QEIA 1T7PA 2OZMA 1K6YA 1U04A 1RDBA 4L8RB 1IO2A 2ETJA 3NH1A 3LP2A 3L2WA 4B9LA 3WNFA 1X9WA 1FKOA 2ZE2A 2QKBA 4FJIA 3K5OA 4Z0UA 1L3SA 4DTRA 3VA0A 4FJNA 3MAQA 4LD0A 3HPOA 2YKMA 4CK2A 1O1WA 4KO0A 3MEDA 2OYQA 3LAKA 4HUFA 4DTSA 4DSLA 1Y97A 1TL3A 4CCHA 4E7LA 3NGIA 3AA5X 4GMJB 4M3TA 1EP4A 4E0DA 3C95A 5KGWA 3OYLA 2HHTA 2DTUA 1REVA 3NGZA 4JS4A 1B9FA 2XY5A 2YV0X 2OPQA 3BGRA 4H4OA 1XHZA 1SL1A 4KTQA 1WSHA 4KHNA 2OZSA 3SUQA 4CFDA 5HLFA 4C8NA 2YNIA 3VQAA 4OGEA 2HHWA 3ITHA 4I9QA 4FJMA 1HNIA 1JXEA 3AVIA 1ZBLA 3S3OA 4E1NA 3ZT2A 3K57A 1R0AA 4RG8A 3JYTA 3OY9A 4E3SA 1SKSA 3AO5A 4OKEA 3RR7A 1JL2A 3DOKA 1VSMA 4FW2A 1RT4A 2YKNA 4CEFA 4DFMA 1TK5A 2HW3A 3K5LA 4DU3A 5FRMA 2HHSA 1VSEA 5EU7A 1T05A 5DMRA 1RT6A 1C0TA 1WSJA 3QINA 3QLHA 3TAMA 4DQQA 1CLQA 2W42A 3ZSQA 3PX4A 3U3YA 3P5JA 4ICLA 3KLEA 3SQ4A 4FZXC 4K8ZA 4RW7A 4H8KA 2G8VA 1UAXA 4FM1A 3U6FA 5HRRA 4CGHA 3KK3A 4B9UA 4FK0A 4J2AA 3KLFA 4OPKA 4YNQA 4FVMA 4GW6A 4MFBA 4CJEA 3LZJA 4FCYA 1BCMA 4CEBA 1X9MA 3KD5E 4KREA 1NJXA 5J2MA 1HRHA 3VQ4A 4KHYA 3ZT0A 2HHVA 4CF1A 2D5RA 4CGDA 1L3TA 2KFNA 3ZSZA 3TABA 3CM6A 4MQ3A 1CXQA 4FZZA 4DFJA 3I0RA 1HQUA 4CECA 1SL0A 2KZZA 4FLUA 4M3ZA 1KCFA 4CEDA 3L2RA 3NDKA 4AILC 1B92A 2DFHA 1HYVA 3HP9A 2G8UA 3DLBA 4KTWA 1ZBUA 4KHSA 1JLQA 4FZYA 1RDCA 1RT1A 1W0HA 1ZBFA 5J1EA 4PUOA 1SKWA 2XRIA 1QSSA 2P1JA 2EX3A 4C8KA 1RBUA 1RTJA 1XHXA 5KTQA 1HYZA 1RBVA 3IAYA 2VG6A 4B9VA 3I8DA 4KRFA 3L3VA 3CFPA 2F8SA 4FXDA 3K58A 3ZSVA 1S1XA 2E6LA 2OPPA 4CHQA 2RPIA 2WONA 2Z1JA 3V9XA 1NK4A 3V1OA 1KRPA 4FW1A 3PY8A 2P5GA 3MXJA 4I2PA 4Y1CA 5K14A 5CYMA 4JS5A 1NJZA 1DTQA 1TK8A 1UA1A 1QSLA 3BDPA 3SNNA 1JKHA 4NCBA 4NYFA 1RNHA 3QIOA 4NCGA 2WOMA 3L8BA 3V9SA 4F3TA 3KK2A 4RW6A 2GV9A 3VA3A 2ITGA 5JS2A 3QESA 4BDPA 4C8OA 1S9EA 4IKFA 4CJ4A 3RTVA 3OS2A 4FYDA 3M8SA 4Y1DA 3L2VA 4BDZA 2KTQA 1HQEA 4RW9A 1SV5A 2XY7A 3PX0A 4CJLA 1JLBA 4B9NA 2DFFA 4AHTA 4LH4A 1CZ9A 1X9SA 4M3YA 1LWEA 2E6MA 3FFIA 3MEGA 1NK9A 4OKJA 3T1AA 3RWUA 1KVAA 3HL8A 1ZBIA 4FK2A 1QQCA 1YVUA 2YHAA 4QOZB 1F21A 3NE6A 1TVRA 4W5QA 3L3UA 3DLKA 3DOLA 4M45A 4HCBA 1Q9XA 2A1RA 4CFCA 2O4GA 4WE1A 3EY1A 4M3UA 1VSLA 4ZTJA 3KIOA 2YNGA 1LW2A 1IH7A 4EP5A 4PY5A 4CFBA 3PUFA 1SKRA 1N5YA 4FJ9A 4DQIA 5E41A 2BE2A 3AVJA 1BIZA 3B6PA 4FJKA 1XWLA 3SUOA 4F4KA 4M42A 3NF8A 4CJPA 1UA0A 3S9HA 3H08A 4KV8A 4CHOA 1S6PA 4E89A 3VQPA 1S1UA 1U48A 4CEAA 4N41A 1IG9A 3VQQA 4CIGA 3THVA 2FBVA 3UIQA 1VSHA 1QHTA 2QKKA 4DSIA 1TKTA 1RCHA 4DFPA 4ZHRA 3KLHA 5CZ1A 4FJ8A 1EX4A 1A5VA 1IKWA 1RT2A 3E01A 4R5PA 4CJVA 2BDPA 4M3RA 4DSJA 4KPYA 3LPTA 1D8YA 1W9HA 1YT3A 3QO9A 4AHSA 4CK1A 1BIUA 2FBTA 3NGYA 2Y1IA 3KLGA 4OLAA 4DS5A 3K59A 3VQEA 2HHQA 2NUBA 2AJQA 4HHTA 4HUGA 3B6OA 3OYKA 4FLYA 3V4IA 2HHUA 3AA3A 1NJWA 2ZD1A 3WNEA 4FJHA 1Q9YA 1RT7A 3SZ2A 3S3MA 3QEPA 4F2SA 3KKRA 3AVKA 4EZ6A 3TWHA 2XHBA 3LALA 3NF7A 5HBMA 1NK8A 4KI4A 1HYSA 2D0AA 2B5JA 4J2DA 4I2QA 1S9GA 2RN2A 4O0JA 3QEVA 3RMAA 3AVHA 3TAGA 4CJUA 3OYCA 5KGXA 4EP4A 3M8RA 4KHWA 2FBXA 4CERA 4DU1A 4F2RA 4OPJA 2JLEA 1TKXA 3P1GA 1C1CA 4NYNA 3SQ0A 4O44A 3IS9A 3ZSYA 1EKEA 1HPZA 5KRSA 4FJ7A 1EXQA 3LAMA 3C6TA 4DTMA 4DTPA 4DWIA 1GOAA 1BQMA 1WSGA 3AO4A 4CF2A 4PWDA 2RF2A 3KTQA 1VSKA 1C1BA 4FM2A 1KTQA 3PX6A 3CQ8A 4CJRA 3OYFA 3QEWA 1IKYA 3TAFA 1WLJA 1HNVA 3OYAA 1KFSA 3NFAA 2IOCA 1JLEA 4DU4A 4EZ9A 3ISNC 3OS0A 1S1TA 4E7HA 3HYFA 2E4LA 3M8PA 3SQ2A 4BE0A 1BL3A 3K5MA 4BE1A 2X74A 1ASVA 1RBRA 3LDSA 4CJ5A 1ASWA 4CHPA 4FLWA 2GUIA 3WNHA 4DQPA 4CE9A 4IFYA 4BWMA 1J5OA 1A5WA 3O3FA 2OA8A 2P5OA 5FRNA 5CY4A 1Z25A 4CJWA 4LY7A 4PA1A 4FLZA 1S6QA 4Z4GA 2QK9A 1LWFA 3RR8A 4CEOA 2Z1HA 1J9AA 3F9KA 4Q5VA 3QIPA 4DFKA 3M8QA 4G1QA 5HP1A 4CGFA 1ASUA 4CGIA 4O0IA 4W5TA 2ZQBA 3NF9A 4OLBA 4CFAA 4CJSA 1SUQA 1WSIA 4FLTA 1BISA 5C42A 4O4GA 4OGCA 4DQRA 5I3UA 4B9MA 4DSKA 1WN7A 4DMNA 5J2PA 2HMIA 3SV4A 1UOCA 4OJRA 3OYJA 4F3OA 1GOBA 3SUPA 3QEXA 1S5JA 3D45A 4E7JA 3VQBA 1KLNA 2FBYA 1KVCA 5HROA 1S1WA 4CHYA 1NK7A 3ZSOA 1U49A 3HJFA 3AVNA 3DLGA 2IGIA 1ZYQA 4FJGA 1C6VA 3LP1A 1QS4A 2X6NA 3V1QA 5SWMA 4CEQA 4H4MA 4DLGA 1S1VA 4E7IA 1LAWA 1T03A 3DLEA 1IKXA 2QXFA 1KFDA 3DI6A 2B4JA 2XY8A 1WSEA 2G8WA 3V6DA 2ATQA 1U45A 1RTDA 1KSPA 5T7BA 3SYZA 4AHUA 4DSEA 4DTNA 3HK2A 4E1MA 2FC0A 1TKDA 1JXBA 3CFOA 4GVMA 2OPSA 1B9DA 3HSTB 5HRPA 4CEZA 3T3FA 3HPGA 2HHXA 1RTHA 1VSJA 3K2PA 3OVNA 2GBZA 4CIFA 2D0CA 4LH5A 2HVIA 1NOYA 3JSMA 4IG0A 3TAEA 2IC3A 5SZTA 1T8EA 3C6UA 2R7YA 1C0MA 1JLAA 3AA2A 3VQ9A 3SI6A 3NCIA 4E19A 4DTXA 5HRNA 1GOCA 3CG7A 1VRTA 3KLIA 1JL1A 3NF6A 4B8AB 4ID1A 4W5NA 1TAUA 2A1SA 4LSLA 4CJFA 3SUNA 4CJQA 4BE2A 4BDYA 3LWLA 2I5JA 1WSFA 1Z26A 3ZSWA 3P83D 4HUEA 1BGXT 4XIUA 3AVCA 2HNDA 4CF9A 4DF8A 5J2QA 1WAJA 4HCCA 3HPHA 3DYAA 1RBSA 5C25A 1LW0A 3SPZA 2X78A 3V1RA 3F73A 4JRQA 1QSYA 3RMDA 4AHVA 2HNYA 4JLHA 4ELTA 1WNSA 4Z4IA 1SL2A 3RRHA 1ITGA 2G8HA 4O5BA 3OYIA 3NAEA 2BANA 4JRPA 2G8IA 4CF8A 1TKZA 2LSNA 3VQ8A 1FK9A 4CF0A 2G8FA 4F8RA 4FLVA 3HP6A 2IS3A 4FJLA 2PYJA 2VG5A 4KFBA 4KHUA 1DLOA 3WNGA 3DRPA 1FXXA 4FJ5A 2VWJA 3DLRA 4B8CA 2JGUA 3TI0A 4YFUA 1NK6A 1VRUA 4W5RA 3G0ZA 4RW4A 3OJUA 3U3GA 3D0PA 3LANA 1KLMA 4CJ3A 3KJVA 4DF4A 4I7FA 2XY6A 3PV8A 3AVLA 1A5XA 1L3UA 4B9TA 2DFEA 1NKBA 2KZMA 1LAVA 3AVFA 5D3GA 3VQDA 3SCXA 3PO5A 4W5OA 4DTJA 3O4QA 4IDKA 2VG7A 1Q8IA 4O55A 3HVRA 1C0UA 4FK4A 1RT5A 3EZ5A 3QETA 3AVBA 4M41A 2YHBA 3V9ZA 1X1PA 4CIEA 1WAFA 3O3HA 3L2UA 4N56A 4FM0A 3DLHA 3OYGA 4C8LA 5JS1A 1RILA 4FLXA 4DSFA 3LPUA 3K5NA 3NHGA 1RBTA 5FDLA 4DLEA 3TANA 1U47A 1JLGA 4PQUA 2KW4A 3A2FA 3ZT1A 1NKCA 3RRGA 4B9SA 4J2BA 4FJXA 4BACA 4CHZA 4HTUA 3CFRA 4BWJA 3AVAA 3OYEA 2HNZA 2P51A 2YNHA 4B08A 5CYQA 1HMVA 3CYMA 4CJTA 1NK5A 2D0BA 2B6AA 2F96A 1UWBA 5J2NA 4NCAA 4KHQA 2F8TA 1D9DA 3L2QA 1CXUA 1U4BA 4KI6A 4N5SA 1ZBHA 1CZBA 3VQ7A 3HM9A 3EYZA 3QERA 3LP3A 4Z4EA 4OKKA 3AO2A 4CHNA 1TL1A 3RMCA 3S3NA 2EHGA 3PO4A 2O4IA 2Z1IA 2IDOA 4CJKA 3KD1E 4AHRA 1VK0A 3MXMA 2RKIA 3HO1A 1YTUA 3AV9A 1VSDA 1N6QA 5C24A 2PYLA 3AVGA 3HXMA 4DS4A 3LP0A 3OYBA 3AVMA 3OYHA 2IAJA 3I0SA 1D9FA 3V9UA 3V9WA 4ELUA 3OYNA 2Z1GA 3DMJA 3IG1A 3QNOA 4IBNA 4DTOA 3SJJA 4KB1A 4N76A 4CESA 1C1AA 4J2EA 1NOZA 4ZTFA 1L5UA 3NH2A 1RDAA 4IG3A 5CZ2A 4KKOA 3MXIA 1QTMA 3SV3A 1QE1A 4CGJA 3ZT3A 3ASMA 1FKPA 3LZIA 3ZCMA 4K8XA 4Z4FA 3VN5A 4Q0BA 4N47A 3V81A 2G8KA 1DTTA 4I9LA 2PZSA 1I39A 3VQ5A 3ZT4A 3LWMA 4QAGA 3RMBA 4M3XA 4QCLA 3OJSA 2Q3SA 2KQ2A 4KAZA 3SPYA 1J53A 3HVTA 5I42A 4E7KA 3KKSA 4M3WA 1VSIA 3C94A 1RT3A 3DRSA 3IRXA 3SQ1A 1L3VA 5DK5A 1TK0A 2VWKA 3AO3A 4RW8A 4AH9A 4Z4HA 3VQCA 2BGGA 3O3GA 1XC9A 4CEEA 4LSNA 4DQSA 2OPRA 1LV5A 4DG1A 5KRTA 1HJRA 3TARA 2KFZA 3NH0A 1YTAA 5HRSA 3G10A 1XI1A 1IKVA 2HB5A 3O4NA 2Y1JA 3NBPA 3KK1A 2X6SA 2YNFA 1JLFA 5KI6A 1EETA 1VSFA 4C8MA 2XO7A 2DY4A 1MU2A 3TAPA 1NKEA 1TGOA 4OVLA 4CGGA 4ID5A 1JLCA 3VQ6A 1BQNA 2HVHA 3MECA 2PY5A 4UQGA 1NK0A 1TV6A 4IFVA 3OYMA 3HT3A 1I3AA 1BI4B 1BCOA 1G15A 3MEEA 3ZSXA 1RDDA 1BHLA 4KB0A 1J54A 3AA4A 3TAQA 3T19A 4FJJA 1NJYA 4ELVA
chains in the Genus database with same CATH superfamily
5BREA 5FROA 4DTUA 2QWNA 2Q97A 4Z4CA 4ILJA 3CCRN 3DM2A 1NGCA 3KHYA 3ALYA 1JCGA 3ZSRA 1BI4A 3BUZB 1K6YA 1NGIA 4IXCA 1IO2A 3LP2A 4B9LA 3WNFA 2ZE2A 3F9MA 4B1ZA 2W40A 5AR0A 4Z0UA 3W0LA 1OH7A 4JKAA 3LM9A 3GG4A 3HTVA 3LAKA 4FWMA 4DTSA 3D2FA 4CCHA 4J8FA 2QI2A 5H1SQ 3NGIA 4GMJB 4EHTA 1EP4A 4MDAA 4E7LA 4E0DA 4NO7A 4H4OA 3KZBA 3SUQA 1KAZA 4K43A 3SAFA 2HHWA 1VQLN 4FJMA 1JXEA 1ZBLA 3K57A 4RG8A 5AQNA 4E3SA 1JL2A 2QXLA 3RSEB 1TYQB 2YKNA 1T44A 3CF5L 4CW7B 4JI1K 1RT6A 3QINA 3QB0A 3ZETA 1N34K 3P5JA 5C2FA 3QICA 4FZXC 1DGKN 3HOTA 4FM1A 4JKFA 5HRRA 4CGHA 4OPKA 4B3MK 1BCMA 1X9MA 3LDPA 3ATVA 3P4IA 2KFNA 1CXQA 4FZZA 1HQUA 4CECA 1SL0A 4FLUA 3A5NC 3O5BA 3HP9A 1ZBUA 3CMEN 1JLQA 1RDCA 1W0HA 4WFBL 4PUOA 1SKWA 1QSSA 1M1KO 4C8KA 3I8DA 5AFUH 2E8AA 3IKMA 1NK4A 1T6CA 1NGAA 4FWRA 2HBKA 4H5TA 4PKIA 4I2PA 5AZJB 1TK8A 1DTQA 3BDPA 4CD1A 4QS9A 4WQ4A 4NCBA 4NYFA 3L8BA 2WOMA 2OCEA 2GV9A 4GNIA 1V4TA 2ITGA 3LDOA 5EY4A 3HOSA 3VOVA 4CJ4A 4KH6A 1E4GT 3L2VA 1YJNN 4RW9A 1JLBA 5C2DA 3VMFB 1X9SA 2E2QA 3MEGA 2P9NB 3RSEA 1ZBIA 4FK2A 3Q7CA 1TVRA 3DOLA 2H3GX 1Q9XA 2RE2A 2A1RA 4M3UA 3MCPA 3KIOA 4U7BA 1LW2A 2NLXA 1N5YA 2ZJRL 3VERA 3AVJA 1FW6A 3M1FA 1XWLA 1V4SA 3MN5A 4OO1J 3NF8A 1UA0A 2P9LB 1S6PA 1ZXOA 3VQPA 4LF7K 3FE1A 3VTHA 3C7NA 3VQQA 4A57A 4CIGA 2FBVA 3KVGA 3HZ6A 4DUZK 2A42A 3KLHA 4CVNE 4FJ8A 1EX4A 3VGMA 4QS7A 1LCUA 1D8YA 3QO9A 4AHSA 5IWAK 4RTFD 4GV9A 3ULEB 3KLGA 4FPBA 4DS5A 3K59A 3VQEA 1BWFO 2HBMA 4HHTA 3UKUA 4FLYA 3U9ZA 4G9ZA 1Q9YA 1RT7A 3QEPA 3H3NO 2NRVA 2D0AA 5TKYA 1YI2N 5JMVA 4M7XA 5KGXA 4KHWA 4CERA 4JHDB 1BU6O 4DU1A 4JD2A 1GLDG 2JLEA 3P1GA 4BVOA 5CHIA 4DV4K 3IS9A 4JEPA 5JVGL 1HPZA 5KRSA 1GOAA 1WSGA 2RF2A 3CCUN 3PX6A 1DT9A 2VQEK 3IUCA 3M5RA 3OYAA 1KFSA 4DR5K 4WFAL 2E4LA 3ENBA 1ATSA 2D1KA 2X74A 3UKUB 1ASVA 4CJ5A 4DV2K 4FLWA 2EWSA 3WNHA 5AZIA 4IFYA 2OA8A 5FRNA 2PBDA 3WXIA 3THXB 4PA1A 4YOXA 4JI7K 1LWFA 2Z1HA 3QIPA 3CCLN 3M8QA 4G1QA 3WXLA 5HP1A 2VYPA 3O6WA 3THWA 5C42A 4O4GA 3CJAA 3VTIA 4GV6A 1KXPA 3AY9A 4DMNA 3GOIA 3OYJA 1VQPN 2F4VK 2D0PA 3CCEN 3VQBA 1KLNA 2FBYA 1XUPO 5HROA 3A8YA 3MWTA 3ZSOA 1ZYQA 1C6VA 5BPNA 2X6NA 5SWMA 4KH4A 1LAWA 3DLEA 1IKXA 2UUAK 3SYZA 4AHUA 4JYAK 4DTNA 3HK2A 4E1MA 5AQMA 1TKDA 4H0VB 1B9DA 3HSTB 5AQKA 2GWJA 5HRPA 5AQLA 2HHXA 1C0GA 1RTHA 4GY2B 2GBZA 4CIFA 4LH5A 3JS6A 2HVIA 4IG0A 2I7PA 1NM1A 1T8EA 2UXCK 2R7YA 3VQ9A 4IZ9A 3CG7A 1VRTA 4W5NA 4YOWA 3SUNA 4BE2A 2I5JA 1K9MO 4EHUA 4HUEA 1BGXT 3AVCA 4BG9A 5JLHA 1HX1A 3T7ZA 5J2QA 2OTLN 4HCCA 1RBSA 4JRQA 3CC7N 4BR7A 1J6ZA 5AQOA 1NGHA 1QQOA 1U6ZA 4O5BA 3D2EA 3VEXA 3WXJA 4OX9K 2G8IA 4CF0A 2HBJA 4CZMA 2VG5A 4KFBA 2VWJA 4NLCA 4B8CA 2JGUA 1VRUA 3ATUA 3OJUA 3N4PA 3U3GA 1NG9A 4IOCL 1YITN 4DF4A 5BR9A 1NJIO 4BQLA 1LAVA 3AVFA 2A6AA 5CE3A 3VQDA 4RCHA 1Q18A 2VG7A 5AZIB 1WBDA 3OTOK 3EKSA 4M41A 3V9ZA 3OBWA 3G4SN 4CIEA 5JS1A 3C7NB 3L2UA 2QWMA 3EO3A 3NHGA 3IMXA 3TANA 4FWQA 1JLGA 4PQUA 3L4IA 4J2BA 4IEIA 4CHZA 3CFRA 3OA9A 3OYEA 2P51A 2YNHA 3CQYA 1D9DA 4JN4A 1U4BA 3TTCA 4Z4EA 4OKKA 3AO2A 3K0SA 3PO4A 2P9KB 2BTFA 4QS8A 2Z1IA 2IDOA 4BROA 1VK0A 4JHDA 3HO1A 1YTUA 2PYLA 1N6QA 1OKJA 3AVGA 5FPMA 3V9UA 3HI0A 3OYNA 2Z1GA 3DMJA 2PAVA 3QNOA 4IBNA 4DTOA 3SJJA 4N76A 4CESA 1C1AA 1L5UA 3NH2A 1RDAA 1GLFO 2VGMA 4K8XA 4N47A 3V81A 4WQ5A 1DTTA 3I8BA 4JAXA 3ZT4A 3RMBA 4M3XA 1YVNA 4QCLA 1QQMA 2Q3SA 2V7YA 3D7EO 3CCQN 4GVEA 3KKSA 4E7KA 1VSIA 3SQ1A 4WQ4C 3SMSA 5DK5A 2BGGA 4Z4HA 4AH9A 3O3GA 1NLVA 3D6RA 4DCHA 2E2NA 1XC9A 1LV5A 4IOAL 3TARA 2KFZA 4DQ8A 1YTAA 2Y1JA 3EEQA 1JLFA 4C8MA 1NKEA 1TGOA 2QWPA 5ADXH 3LDQA 2UYTA 4NCAA 4KB0A 1BCOA 1G15A 3BP8A 1NMNA 5IT9O 2V7ZA 4LC9B 4FJJA 4BY9C 4ELVA 4AHCA 3H1VX 1KVBA 1TAQA 4XH1A 3QNNA 1VQ7N 5EVZA 3DRRA 2IVPA 4TSXA 4B3OA 3EZWA 1LWCA 3TR8A 4HVJA 1T7PA 1D5AA 1QVFM 4L8RB 2O8EB 1U04A 2ETJA 3L2WA 4EFHA 1L3SA 4JK8A 4LD0A 5DM6L 5LMNK 4A62A 3MEDA 1G99A 4DSLA 3G6EN 4M3TA 3ZX3A 4ILHA 5KGWA 1D4XA 2DTUA 2XY5A 1OVYA 3MN7A 1MA9B 4HTLA 3WT0A 3PIPL 4BC5A 3O4WA 4AQYK 1SKSA 4EAHD 1YHQN 4RWTA 3DOKA 1NGBA 3O08A 4FW2A 4E1JA 4CEFA 2ITMA 4LF4K 3K5LA 3FZMA 2HHSA 5M1OA 1VSEA 1T05A 2E88A 5B8HA 2W42A 4H5VA 3U3YA 4ICLA 4Y0WA 4RW7A 4FWOA 4YDUC 5BN8A 4H8KA 3U6FA 3KK3A 4B9UA 4FVMA 3TSQA 1I94K 4FCYA 4CEBA 1EWQA 1EQYA 5J2MA 1HRHA 2OTJN 4CI6A 2D5RA 2J4RA 3EL2A 4CGDA 1VQKN 3ZSZA 3I0RA 5AQGA 3H45C 2WFBA 4M3ZA 4A5AA 2P9PA 3L2RA 3NDKA 2YCHA 4C1NI 1BUPA 3DLBA 3H3OB 3ENHA 5MLCQ 4FZYA 2EX3A 1RTJA 2QWOA 4PHTX 3IAYA 4JKEA 1RBVA 2D0OA 4B9VA 4DV6K 4JK9A 3WXKA 4KRFA 4FXDA 3V9XA 1S1XA 3L4QA 1KRPA 2RPIA 2WONA 5A2QO 4CZGA 5GAGP 4Y1CA 5CYMA 4H5RA 1NJZA 1UA1A 2P9UB 3SNNA 1JKHA 4KH5A 3QIOA 3V9SA 4RW6A 5KPZA 2QWRA 3VA3A 1NBWA 5JS2A 3O1WA 4Z94A 3QESA 4BDPA 4C8OA 3H1QA 5ADXA 4FYDA 3M8SA 2O8CB 4BDZA 1HQEA 4DKWA 1N36K 2DFFA 4LH4A 1CZ9A 3CQXA 3M3ZA 3FFIA 4CJ7A 1HKBA 1XMQK 3RWUA 4HWIA 4QOZB 1F21A 3NE6A 4W5QA 3DLKA 3EY1A 2O4GA 1VSLA 4ZTJA 3A0IX 1SKRA 2BE2A 4FWLA 4O8KA 3MMVA 5BRDA 3SUOA 1HJOA 4CJPA 4YDUA 4M42A 3H08A 2HOEA 4CHOA 4BRNA 3WQTA 1S1UA 1U48A 3L6QA 4FWKA 3THVA 1VSHA 2WC9A 4ZHRA 5CZ1A 3U9DA 5F0XA 1A5VA 1IKWA 3E01A 2BDPA 4DSJA 4CJVA 4M3RA 3LPTA 2O8BB 4YOUA 1YT3A 3SK3A 3ZYYX 3V4IA 4NXNK 3AA3A 4FJHA 2JWLA 3SZ2A 3TWHA 3NF7A 1NK8A 5BPLA 4L3QA 1BA0A 5M1PA 4B9QA 4J2DA 4I2QA 2RN2A 1LOTB 3HM8A 5AQTA 2F7TA 3SQ0A 5E26A 3ZSYA 1EKEA 4H5NA 4DTMA 4YORA 4A59A 4DWIA 3C65A 3AO4A 4CF2A 4H0TB 1C1BA 5M1FA 1KTQA 4CJRA 3OYFA 3QEWA 2W41A 3F5TA 3O80A 3ISNC 4E7HA 3VETA 3HYFA 4AM7A 3SQ2A 3AAPA 2Q0UA 1RBRA 3LDSA 3CD6N 1XNQK 3J7ZO 3O3FA 3HBTA 4V19S 1Z25A 1Z05A 3VEOA 3CCSN 4CEOA 1J9AA 2ZGYA 4ISFA 4Q5VA 4DFKA 5LL6Z 4CGFA 4O0IA 3DXKA 4GV3A 3E9LA 4IFEA 4CFAA 4CJSA 1WSIA 5KPTA 1HUXA 3H46O 1BISA 4BR0A 2AA4A 1FJGK 5J2PA 3SV4A 4OJRA 2NRWA 5LJVA 4U67L 3D45A 5EXWA 4E7JA 2KHOA 3WUHA 4NB4A 4JI8K 3AVNA 4FJGA 2IGIA 3LP1A 1QS4A 4H4MA 4E7IA 5LY3A 4H0PA 2YI1A 2B4JA 2XY8A 2G8WA 2ATQA 3P39A 1KAXA 4DSEA 3CETA 5CR4A 3CFOA 2OPSA 1JCFA 3CERA 3FZLA 4BR4A 4A2BA 1C0MA 1JLAA 3SI6A 5AQHA 3NCIA 4DV7K 5HRNA 3CC4N 3TSUA 1HNXK 3ULEA 4ID1A 4LSLA 1VQ5N 4BDYA 5TKWA 1Z26A 1T3VA 4XIUA 1ESVA 4X62K 2HNDA 3T1HK 3HPHA 4LF8K 1LW0A 3DXKB 3SPZA 2YJFA 3KWIA 1QSYA 2HNYA 1WB9A 3AARA 3RRHA 1ITGA 3CMAN 3NAEA 1TUUA 3AGRA 5KQ8A 4CF8A 1S22A 2LSNA 3VQ8A 1FK9A 4F8RA 2Q0RA 4FLVA 3WNGA 3DRPA 3HRGA 4FJ5A 3GL1A 3TI0A 4YFUA 1HPMA 3ZEUB 3A5OC 4H0OA 2NRRA 3D0PA 4CJ3A 3KJVA 2XY6A 4I7FA 4DSKA 3AVLA 1A5XA 2DFEA 1NKBA 5D3GA 4W5OA 4M63C 3MN9A 4IDKA 1Q8IA 2IVOA 4H0YB 3O9TA 4IDHA 4BC2A 4BRHA 4YHHK 4JKHA 1RT5A 3EZ5A 2WTUA 3AVBA 4N56A 4FM0A 3TTDA 3OYGA 2NRXA 3G71N 3K5NA 1SAZA 3RVCA 5FDLA 2P9IA 4B9SA 3A2FA 5AQVA 3ZT1A 3RRGA 1YIJN 4HTUA 5LMUK 4B08A 5FLXO 4FOEA 4CJTA 2QWLA 2B6AA 4KHQA 1CXUA 5AQFA 4KI6A 4N5SA 2KLAA 3HM9A 3LP3A 4B1VA 1RDUA 1K73O 3ZLJA 2O4IA 4BREA 1WUAA 4AHRA 1VSDA 4DS4A 3HXMA 3OYBA 3AVMA 5FPEA 4NXMK 1KC8O 1U2VA 2UUCK 4IO9L 3VENA 4JNEA 5BN9A 4X65K 3ASMA 3LZIA 3ZCMA 4Z4FA 4Q0BA 5GADP 2Q1NA 2PZSA 1I39A 4I6MB 4DR1K 1SS6A 3VPZA 5GAEP 5AQXA 3O9SA 1X9JA 5I42A 1GLAG 3CCJN 4BRLA 2VWKA 4KHPK 4RW8A 3CPEA 3P38A 3UKRA 1IV0A 1YJ9N 2CGJA 3G10A 2VCPA 1EETA 4WYBA 1XC3A 1NNEA 1MU2A 2NZTA 5C10A 3WEEB 2CH5A 4OVLA 4ID5A 1OVQA 1BQNA 5JLFA 1KAYA 2GX9A 1NK0A 3MEEA 1RDDA 4XEIA 2V52B 4CBWA 3AO1A 3OS1A 4BGAA 3CM5A 3WQUA 2Q31A 3D2FB 4LF5K 2P9SB 2IVNA 2OZMA 3U8XA 3QEIA 5AQUA 3L0QA 4PKGA 1MDUB 1FKOA 4FJIA 4F9OA 4DTRA 3VA0A 4DR2K 4H0XB 3MAQA 4CK2A 4KO0A 4BRCA 3LM2A 2YX6A 5ELZA 4K25A 1TL3A 2GTDA 3I56N 1J5EK 1W2BM 3NGZA 4JS4A 1B9FA 3BGRA 1WSHA 4BC4A 4CFDA 2YNIA 2O8DA 4OGEA 5AQZA 4I9QA 2PFUA 1HNIA 5AQJA 3S3OA 4E1NA 4B3RK 3DJCA 3ZT2A 3O8MA 3RR7A 4BRQA 1RT4A 1TK5A 4DU3A 5FRMA 2ZJPL 5DMRA 1HR0K 4JI5K 1WSJA 4DQQA 1CLQA 1R59O 3PX4A 4BRDA 3KLEA 3SQ4A 4K8ZA 5M1KA 2G8VA 3BF1A 1UAXA 3S41A 3KLFA 3VGLA 4GW6A 4MFBA 4CJEA 4B3SK 3LZJA 4KREA 3KD5E 4JKBA 2ASOA 4KHYA 3ZT0A 4CF1A 4IJAA 3TABA 3LDLA 3VGKA 5AQSA 1IBKK 2KZZA 2CGLA 1KQSM 3CJ7A 3WEEA 1KCFA 4BR2A 4CEDA 2VQFK 4AILC 1HYVA 3O1BA 1GLBG 5J1EA 1N33K 2XRIA 3SAGA 1XHXA 5KTQA 2VG6A 2I7NA 3L3VA 2F8SA 1P90A 3ZSVA 2E6LA 2OPPA 4CHQA 3BZKA 2Z1JA 2P5GA 3QBXA 3MX2A 5F2RA 5K14A 4BR9A 2QW9A 1QSLA 4JK7A 4DB3A 1X3MA 4F3TA 1VQ6N 4CZIA 3KK2A 3EKUA 4BRPA 4IKFA 3FFKB 4PL7A 3J7AP 3RTVA 2A41A 4Y1DA 2KTQA 1SV5A 1U2VB 2XY7A 3PX0A 4CJLA 4B9NA 3CCMN 4LF6K 3O9RA 1LWEA 2ZWHA 1KVAA 3HL8A 1QQCA 1S72N 3L3UA 4HCBA 1Q86O 4LF9K 2YNGA 4EP5A 4PY5A 3PUFA 3VEYA 4FJ9A 2O8DB 2FXUA 4DR6K 4CBUA 3THYB 3LDNA 3MWPA 1WBBA 4CEAA 4N41A 4B1YB 3UIQA 2GELA 2HBLA 4JI4K 3VEVA 4DSIA 1TKTA 4DFPA 3VF4A 4R5PA 4CZLA 1GLEG 4KPYA 2FF6A 1W9HA 2ZJQL 3CJCA 4CK1A 1BIUA 2FBTA 3NGYA 2Y1IA 3DXMA 2P9KA 2NUBA 2AJQA 3KK7A 3OYKA 4B1UB 3NVMA 4WF9L 2Q36A 3S3MA 3E66A 4F2SA 3KKRA 4EZ6A 2XHBA 3LALA 1HYSA 1YXQA 2F9WA 3QEVA 2QEXN 3AVHA 3M8RA 3OYCA 3JAMO 2FBXA 1TKXA 4NYNA 1C1CA 4O44A 3O9UA 4LFAK 1EXQA 3LAMA 3C6TA 3QFPA 4DTPA 1BQMA 3UKRB 4PWDA 1BG3A 1BO5O 4IOXA 4FVUA 1K8KA 5GINA 3TU5A 4FWSA 1WLJA 1HNVA 5GIOA 4EZ9A 3NFAA 1JLEA 2IOCA 4DU4A 3OS0A 3FLCO 5KQDA 3M8PA 4BE0A 1BL3A 3K5MA 5C12A 4BE1A 3PSFA 1ASWA 4CHPA 1XNRK 1NGDA 4CZHA 1J5OA 1A5WA 4O8UA 4FLZA 1RDWX 4Z4GA 2QK9A 4FSVA 4X66K 2O8FA 4NLBA 3PIOL 2YHWA 1ASUA 4CGIA 4W5TA 4GKJK 2ZQBA 2NRTA 4OLBA 3PSIA 1SUQA 5AQRA 1XMOK 4DQRA 5I3UA 3SJHA 4BGBA 1SQKA 1HNWK 1WN7A 5GAHP 2HF4A 1GOBA 3AAQA 3QEXA 2P9IB 4YOTA 1Y64A 1MWKA 1HNZK 3QFUA 1QZ6A 1S1WA 4CHYA 2FLOA 4DR4K 4DLGA 1RGIA 1S1VA 2QXFA 2O8FB 3CPWM 3DI6A 5HL7L 2HHHK 1WSEA 1U45A 5T7BA 1JXBA 4GVMA 5AQYA 3GDQA 4B1XB 1E3MA 3K2PA 3OVNA 1VQNN 3CIPA 2HSTA 1S3XA 1NOYA 1E4FT 3JSMA 3TAEA 5SZTA 2UXDK 3C6UA 3VF6A 3AA2A 5AQPA 4DTXA 1JL1A 3NF6A 2YJEA 4A61A 4B8AB 1Q7YO 2A1SA 3ID6A 3LWLA 4K0KK 1YUWA 3BF3A 1WAJA 2E1ZA 3GBTA 3V1RA 4IWVA 4JLHA 1WNSA 4B3TK 2BANA 1P8ZA 2O8CA 2QTDA 3R3LA 3DWLA 2PYJA 4KHUA 1DLOA 1FXXA 1IJJA 1NK6A 3G0ZA 1W97L 2E20A 1NMDA 3C6AA 2KZMA 3PO5A 4DTJA 3O4QA 1C0UA 1VQ4N 2W6KA 3QETA 4AF1A 1VHXA 4YOYA 2YHBA 1X1PA 2F9TA 3SBTA 1YJWN 4FLXA 3LPUA 1U47A 2KW4A 1NKCA 2JWKA 1OH8A 4BACA 1BOTO 4OPAA 1K8KB 5E84A 4C23A 2HNZA 4DHYA 3O9QA 4CZJA 2D4WA 1HMVA 3CYMA 2D0BA 2F96A 5J2NA 1UWBA 1ZBHA 3VQ7A 3EYZA 3QERA 4MO5A 5LJWA 5AFUA 4CHNA 3RMCA 3S3NA 2EHGA 1T6DA 3MXMA 1NGEA 2RKIA 3AV9A 5C24A 3LP0A 1VAZA 3OYHA 2IAJA 3MCAB 3V9WA 4ELUA 5AQQA 3IG1A 1NGFA 2E2PA 4BRIA 3N4QA 4J2EA 5KPRA 1NOZA 5BPMA 4ZTFA 2P9SA 5CZ2A 3SV3A 3I55N 4CGJA 1TUYA 3DAWA 1BDGA 1FKPA 1NGGA 2FSKA 3FZKA 3C6HA 4K42A 3R8EA 2P9LA 3VQ5A 3LWMA 3OJSA 2KQ2A 4KAZA 1J53A 1GLLO 3HVTA 3C94A 1RT3A 3IRXA 1RFQA 3TTFA 4JKDA 3AO3A 3VF2A 2ZM6K 3VQCA 1YAGA 3KWGA 3VESA 1N32K 2OPRA 1HJRA 5DM7L 3NH0A 1EWRA 3QBWA 2P9NA 3NBPA 1Q81O 4R79A 2X6SA 3KK1A 2YNFA 2XO7A 2DY4A 2CH6A 1QHAA 1YF5L 4CGGA 3VQ6A 3MECA 4UQGA 2O8EA 2A40A 1VQMN 1J54A 3T19A 1NJYA 1CZAN 3UB5A 1RTIA 5BR8K 3QMLA 2OANA 2QM1A 4CZFA 4JKGB 4CK3A 4KTZA 3OYDA 4JI0K 1QVGM 3ULDA 1O13A 2AP1A 4IO8A 1RDBA 1Z6RA 3NH1A 2O8BA 2FF3B 1X9WA 2QKBA 4FWNA 3K5OA 4FJNA 2E1YA 2YKMA 3FZFA 4MO4A 3HPOA 4BRFA 1O1WA 2E2OA 2OYQA 4HUFA 4JKGA 1Y97A 3AA5X 2E5LK 3C95A 1JJ2M 3K9JA 3OYLA 2HHTA 1REVA 1XHZA 1SL1A 2YV0X 2OPQA 4KTQA 2A5XA 4KHNA 4A2AA 2OZSA 3IDHA 5HLFA 4C8NA 3VQAA 4H03B 3A5MC 3ITHA 3AVIA 3R6MA 1ILYA 1R0AA 3JYTA 3OY9A 3AO5A 4OKEA 3EN9A 2ZGZA 1VSMA 4OPHA 3CCVN 4DFMA 2HW3A 3E9OA 5EU7A 3ZETB 1C0TA 1XQSC 3QLHA 4FWPA 3TAMA 3SAHA 3ZSQA 5GIPA 2HF3A 1HLUA 1TYQA 4DV5K 3CHWA 4FK0A 4J2AA 4GKKK 4EIAA 4YNQA 3EE8A 2P9UA 1H1VA 1NJXA 3VQ4A 4DR3K 1EO1A 2HHVA 1L3TA 2FSJA 3CM6A 3LL3A 4MQ3A 5M1NA 3WXMB 3HSCA 4DFJA 5F1XA 2G8UA 1B92A 3W3DA 2DFHA 3Q7BA 3P31A 4KTWA 4KHSA 2Q2RA 1RT1A 1ZBFA 2BUPA 2P1JA 5AQWA 1RBUA 3CXCM 3T69A 1HYZA 4FPAA 1C0FA 3MN6A 4ILGB 3CFPA 3K58A 5I9EB 3PY8A 3V1OA 5C0YA 4FW1A 3MXJA 1WOQA 4DR7K 3VEWA 2UUBK 4JS5A 2ASPA 5JICA 1RNHA 4NCGA 4ISGA 3F2KA 1ATNA 1VQ8N 1S9EA 3OS2A 3M6GA 3SBGA 4XH4A 2HMPA 3CJ1A 4CD3A 4AHTA 4BRGA 4M3YA 1ATRA 4X64K 2E6MA 3GE1A 3ZX0A 1NK9A 4OKJA 3T1AA 3VEZA 3BZCA 3BY5A 1IG8A 2YHAA 1YVUA 4M45A 5EOYA 4CFCA 4WE1A 1OH5A 1HKCA 1IH7A 4CFBA 2VWBA 4FO0A 1DEJA 4DQIA 5E41A 3B6PA 1BIZA 4BVPA 4FJKA 1NGJA 3T1YK 1W7AA 1N8RO 4F4KA 5AQIA 3S9HA 4KV8A 4CZEA 3H6EA 4B1WB 4E89A 4KBOA 1IG9A 3E9PA 1QHTA 2QKKA 2BH1A 4JI6K 3CC2N 1RCHA 4O5FA 3ZX2A 1IBMK 2UXBK 3NMUA 3ID8A 3CJ9A 1RT2A 3TPQA 4BR5A 1QQNA 3AGKA 3MX5A 2IIRA 4BRAA 4I6MA 4OLAA 2HHQA 4BG8A 4HUGA 3A5LC 3B6OA 2HHUA 1NJWA 2ZD1A 3WNEA 2KKZA 3AVKA 4PKHA 2CGKA 5HBMA 4KI4A 3CJBA 2W6LA 2B5JA 1HKGA 1S9GA 4O0JA 3RMAA 3IFRA 3TAGA 4CJUA 4EP4A 1BA1A 4F2RA 4OPJA 1VQ9N 1SZ2A 3E1YA 4FJ7A 4JI2K 3SMPA 2NRZA 3KTQA 1VSKA 1K8AO 4FM2A 4K41A 3CQ8A 1IKYA 3TAFA 1S1TA 4M7YA 3J81O 3MDQA 3R1XA 2GUIA 4DQPA 4CE9A 4BWMA 2P5OA 5CY4A 4ISEA 4CJWA 4LY7A 5BRHA 1S6QA 3J80O 3RR8A 3F9KA 3FGUA 4DV1K 4PL8A 5C15A 3NF9A 3ZEUA 4JD2B 4FLTA 4OGCA 4B9MA 4YY3K 4IJNA 2HMIA 1UOCA 4F3OA 3U4LA 3SUPA 1S5JA 3QDKA 1KVCA 2WUSA 1NK7A 1NU0A 4WCEL 1U49A 3HJFA 3DLGA 3V1QA 4CEQA 1T03A 3BEXA 1KFDA 2QWQA 4BRKA 3K9KA 2DPNA 3V6DA 1RTDA 1KSPA 3SLCA 2FC0A 1NWKA 2YHYA 3J8AA 3B8AX 3T3FA 4CEZA 3HPGA 4MLHA 4XH5A 1VSJA 3R9PA 4BRMA 4CBXA 2D0CA 2WBNA 2IC3A 3OBYA 4A5BA 3DXMB 4E19A 1GOCA 3KLIA 1ZBSA 5M1QA 1TAUA 4CJFA 4CJQA 3UE5A 3D2EB 5FPDA 5AJ3K 1WSFA 3ZSWA 3P83D 4WFNL 4CF9A 4DF8A 3DYAA 4JKCA 5C25A 1ZC6A 2X78A 2YHXA 4MLEA 3F73A 3RMDA 4AHVA 4ELTA 4Z4IA 1SL2A 5EX5A 1OH6A 2G8HA 3OYIA 2P9PB 4LFBK 4JRPA 3G25A 1X3NA 3THYA 2NRHA 4C1NK 1TKZA 1KD1O 2GEMA 2G8FA 3HP6A 2IS3A 4FJLA 4IEEA 2QA4N 3I33A 3DLRA 3TSPA 3NVKA 4BC3A 3ENOA 4JI3K 4W5RA 1DKGD 4RW4A 3CI5A 3LANA 1KLMA 2A3ZA 3PV8A 3DLLL 4B9TA 1L3UA 2UU9K 3SCXA 3C0BA 1GLCG 3FR0A 4WQ5C 2NNWA 4O55A 3HVRA 4FK4A 3PLAA 4H5WA 1WAFA 3O3HA 4C8LA 3DLHA 1RILA 4DSFA 1RBTA 4DLEA 4BQZA 2FSNA 2GUPA 4FJXA 4BWJA 3AVAA 5CYQA 1NK5A 2F8TA 3L2QA 1GLJO 1CZBA 1IBLK 3THWB 3EE9A 1TL1A 2V51B 4UY8O 4DV0K 4CJKA 3KD1E 1Q82O 3OW2M 3THXA 4FL9A 3I0SA 1D9FA 4KB1A 4IG3A 4KKOA 3MXIA 1QTMA 2GWKA 5HOOA 1QE1A 2ZF5O 3ZT3A 1JCEA 2VGNA 1M90O 3VN5A 2G8KA 4I9LA 4DUYK 4QAGA 5AZJA 3SPYA 1VQON 5FPNA 3J7YP 4M3WA 1QZ5A 3DRSA 1L3VA 4JV5K 4FOIA 1TK0A 2ASMA 4CEEA 4LSNA 4DQSA 3JXUA 4DG1A 5KRTA 5HRSA 1XI1A 4LFCK 1IKVA 2HB5A 3O4NA 3FZHA 5KI6A 4MDBA 1VSFA 4CZKA 4DV3K 5BRFA 3TAPA 2HVHA 1JLCA 2RHKA 3OHRA 4YOVA 2PY5A 1MWMA 1TV6A 4IFVA 3OYMA 4AM6A 1I3AA 1BI4B 3HT3A 3ZSXA 5JVHL 1BHLA 3AA4A 3TAQA 3MK6A
chains in the Genus database with same CATH topology
3AO1A 3OS1A 1RTIA 5FROA 4AHCA 4DTUA 1KVBA 1TAQA 3QNNA 3CM5A 4Z4CA 3DRRA 3DM2A 4TSXA 4CK3A 3ALYA 4KTZA 3OYDA 4B3OA 3ULDA 1LWCA 3TR8A 3ZSRA 1BI4A 1D5AA 4HVJA 3QEIA 1T7PA 2OZMA 1K6YA 1U04A 1RDBA 4L8RB 1IO2A 2ETJA 3NH1A 3LP2A 3L2WA 4B9LA 3WNFA 1X9WA 1FKOA 2ZE2A 2QKBA 4FJIA 3K5OA 4Z0UA 1L3SA 4DTRA 3VA0A 4FJNA 3MAQA 4LD0A 3HPOA 2YKMA 4CK2A 1O1WA 4KO0A 3MEDA 2OYQA 3LAKA 4HUFA 4DTSA 4DSLA 1Y97A 1TL3A 4CCHA 4E7LA 3NGIA 3AA5X 4GMJB 4M3TA 1EP4A 4E0DA 3C95A 5KGWA 3OYLA 2HHTA 2DTUA 1REVA 3NGZA 4JS4A 1B9FA 2XY5A 2YV0X 2OPQA 3BGRA 4H4OA 1XHZA 1SL1A 4KTQA 1WSHA 4KHNA 2OZSA 3SUQA 4CFDA 5HLFA 4C8NA 2YNIA 3VQAA 4OGEA 2HHWA 3ITHA 4I9QA 4FJMA 1HNIA 1JXEA 3AVIA 1ZBLA 3S3OA 4E1NA 3ZT2A 3K57A 1R0AA 4RG8A 3JYTA 3OY9A 4E3SA 1SKSA 3AO5A 4OKEA 3RR7A 1JL2A 3DOKA 1VSMA 4FW2A 1RT4A 2YKNA 4CEFA 4DFMA 1TK5A 2HW3A 3K5LA 4DU3A 5FRMA 2HHSA 1VSEA 5EU7A 1T05A 5DMRA 1RT6A 1C0TA 1WSJA 3QINA 3QLHA 3TAMA 4DQQA 1CLQA 2W42A 3ZSQA 3PX4A 3U3YA 3P5JA 4ICLA 3KLEA 3SQ4A 4FZXC 4K8ZA 4RW7A 4H8KA 2G8VA 1UAXA 4FM1A 3U6FA 5HRRA 4CGHA 3KK3A 4B9UA 4FK0A 4J2AA 3KLFA 4OPKA 4YNQA 4FVMA 4GW6A 4MFBA 4CJEA 3LZJA 4FCYA 1BCMA 4CEBA 1X9MA 3KD5E 4KREA 1NJXA 5J2MA 1HRHA 3VQ4A 4KHYA 3ZT0A 2HHVA 4CF1A 2D5RA 4CGDA 1L3TA 2KFNA 3ZSZA 3TABA 3CM6A 4MQ3A 1CXQA 4FZZA 4DFJA 3I0RA 1HQUA 4CECA 1SL0A 2KZZA 4FLUA 4M3ZA 1KCFA 4CEDA 3L2RA 3NDKA 4AILC 1B92A 2DFHA 1HYVA 3HP9A 2G8UA 3DLBA 4KTWA 1ZBUA 4KHSA 1JLQA 4FZYA 1RDCA 1RT1A 1W0HA 1ZBFA 5J1EA 4PUOA 1SKWA 2XRIA 1QSSA 2P1JA 2EX3A 4C8KA 1RBUA 1RTJA 1XHXA 5KTQA 1HYZA 1RBVA 3IAYA 2VG6A 4B9VA 3I8DA 4KRFA 3L3VA 3CFPA 2F8SA 4FXDA 3K58A 3ZSVA 1S1XA 2E6LA 2OPPA 4CHQA 2RPIA 2WONA 2Z1JA 3V9XA 1NK4A 3V1OA 1KRPA 4FW1A 3PY8A 2P5GA 3MXJA 4I2PA 4Y1CA 5K14A 5CYMA 4JS5A 1NJZA 1DTQA 1TK8A 1UA1A 1QSLA 3BDPA 3SNNA 1JKHA 4NCBA 4NYFA 1RNHA 3QIOA 4NCGA 2WOMA 3L8BA 3V9SA 4F3TA 3KK2A 4RW6A 2GV9A 3VA3A 2ITGA 5JS2A 3QESA 4BDPA 4C8OA 1S9EA 4IKFA 4CJ4A 3RTVA 3OS2A 4FYDA 3M8SA 4Y1DA 3L2VA 4BDZA 2KTQA 1HQEA 4RW9A 1SV5A 2XY7A 3PX0A 4CJLA 1JLBA 4B9NA 2DFFA 4AHTA 4LH4A 1CZ9A 1X9SA 4M3YA 1LWEA 2E6MA 3FFIA 3MEGA 1NK9A 4OKJA 3T1AA 3RWUA 1KVAA 3HL8A 1ZBIA 4FK2A 1QQCA 1YVUA 2YHAA 4QOZB 1F21A 3NE6A 1TVRA 4W5QA 3L3UA 3DLKA 3DOLA 4M45A 4HCBA 1Q9XA 2A1RA 4CFCA 2O4GA 4WE1A 3EY1A 4M3UA 1VSLA 4ZTJA 3KIOA 2YNGA 1LW2A 1IH7A 4EP5A 4PY5A 4CFBA 3PUFA 1SKRA 1N5YA 4FJ9A 4DQIA 5E41A 2BE2A 3AVJA 1BIZA 3B6PA 4FJKA 1XWLA 3SUOA 4F4KA 4M42A 3NF8A 4CJPA 1UA0A 3S9HA 3H08A 4KV8A 4CHOA 1S6PA 4E89A 3VQPA 1S1UA 1U48A 4CEAA 4N41A 1IG9A 3VQQA 4CIGA 3THVA 2FBVA 3UIQA 1VSHA 1QHTA 2QKKA 4DSIA 1TKTA 1RCHA 4DFPA 4ZHRA 3KLHA 5CZ1A 4FJ8A 1EX4A 1A5VA 1IKWA 1RT2A 3E01A 4R5PA 4CJVA 2BDPA 4M3RA 4DSJA 4KPYA 3LPTA 1D8YA 1W9HA 1YT3A 3QO9A 4AHSA 4CK1A 1BIUA 2FBTA 3NGYA 2Y1IA 3KLGA 4OLAA 4DS5A 3K59A 3VQEA 2HHQA 2NUBA 2AJQA 4HHTA 4HUGA 3B6OA 3OYKA 4FLYA 3V4IA 2HHUA 3AA3A 1NJWA 2ZD1A 3WNEA 4FJHA 1Q9YA 1RT7A 3SZ2A 3S3MA 3QEPA 4F2SA 3KKRA 3AVKA 4EZ6A 3TWHA 2XHBA 3LALA 3NF7A 5HBMA 1NK8A 4KI4A 1HYSA 2D0AA 2B5JA 4J2DA 4I2QA 1S9GA 2RN2A 4O0JA 3QEVA 3RMAA 3AVHA 3TAGA 4CJUA 3OYCA 5KGXA 4EP4A 3M8RA 4KHWA 2FBXA 4CERA 4DU1A 4F2RA 4OPJA 2JLEA 1TKXA 3P1GA 1C1CA 4NYNA 3SQ0A 4O44A 3IS9A 3ZSYA 1EKEA 1HPZA 5KRSA 4FJ7A 1EXQA 3LAMA 3C6TA 4DTMA 4DTPA 4DWIA 1GOAA 1BQMA 1WSGA 3AO4A 4CF2A 4PWDA 2RF2A 3KTQA 1VSKA 1C1BA 4FM2A 1KTQA 3PX6A 3CQ8A 4CJRA 3OYFA 3QEWA 1IKYA 3TAFA 1WLJA 1HNVA 3OYAA 1KFSA 3NFAA 2IOCA 1JLEA 4DU4A 4EZ9A 3ISNC 3OS0A 1S1TA 4E7HA 3HYFA 2E4LA 3M8PA 3SQ2A 4BE0A 1BL3A 3K5MA 4BE1A 2X74A 1ASVA 1RBRA 3LDSA 4CJ5A 1ASWA 4CHPA 4FLWA 2GUIA 3WNHA 4DQPA 4CE9A 4IFYA 4BWMA 1J5OA 1A5WA 3O3FA 2OA8A 2P5OA 5FRNA 5CY4A 1Z25A 4CJWA 4LY7A 4PA1A 4FLZA 1S6QA 4Z4GA 2QK9A 1LWFA 3RR8A 4CEOA 2Z1HA 1J9AA 3F9KA 4Q5VA 3QIPA 4DFKA 3M8QA 4G1QA 5HP1A 4CGFA 1ASUA 4CGIA 4O0IA 4W5TA 2ZQBA 3NF9A 4OLBA 4CFAA 4CJSA 1SUQA 1WSIA 4FLTA 1BISA 5C42A 4O4GA 4OGCA 4DQRA 5I3UA 4B9MA 4DSKA 1WN7A 4DMNA 5J2PA 2HMIA 3SV4A 1UOCA 4OJRA 3OYJA 4F3OA 1GOBA 3SUPA 3QEXA 1S5JA 3D45A 4E7JA 3VQBA 1KLNA 2FBYA 1KVCA 5HROA 1S1WA 4CHYA 1NK7A 3ZSOA 1U49A 3HJFA 3AVNA 3DLGA 2IGIA 1ZYQA 4FJGA 1C6VA 3LP1A 1QS4A 2X6NA 3V1QA 5SWMA 4CEQA 4H4MA 4DLGA 1S1VA 4E7IA 1LAWA 1T03A 3DLEA 1IKXA 2QXFA 1KFDA 3DI6A 2B4JA 2XY8A 1WSEA 2G8WA 3V6DA 2ATQA 1U45A 1RTDA 1KSPA 5T7BA 3SYZA 4AHUA 4DSEA 4DTNA 3HK2A 4E1MA 2FC0A 1TKDA 1JXBA 3CFOA 4GVMA 2OPSA 1B9DA 3HSTB 5HRPA 4CEZA 3T3FA 3HPGA 2HHXA 1RTHA 1VSJA 3K2PA 3OVNA 2GBZA 4CIFA 2D0CA 4LH5A 2HVIA 1NOYA 3JSMA 4IG0A 3TAEA 2IC3A 5SZTA 1T8EA 3C6UA 2R7YA 1C0MA 1JLAA 3AA2A 3VQ9A 3SI6A 3NCIA 4E19A 4DTXA 5HRNA 1GOCA 3CG7A 1VRTA 3KLIA 1JL1A 3NF6A 4B8AB 4ID1A 4W5NA 1TAUA 2A1SA 4LSLA 4CJFA 3SUNA 4CJQA 4BE2A 4BDYA 3LWLA 2I5JA 1WSFA 1Z26A 3ZSWA 3P83D 4HUEA 1BGXT 4XIUA 3AVCA 2HNDA 4CF9A 4DF8A 5J2QA 1WAJA 4HCCA 3HPHA 3DYAA 1RBSA 5C25A 1LW0A 3SPZA 2X78A 3V1RA 3F73A 4JRQA 1QSYA 3RMDA 4AHVA 2HNYA 4JLHA 4ELTA 1WNSA 4Z4IA 1SL2A 3RRHA 1ITGA 2G8HA 4O5BA 3OYIA 3NAEA 2BANA 4JRPA 2G8IA 4CF8A 1TKZA 2LSNA 3VQ8A 1FK9A 4CF0A 2G8FA 4F8RA 4FLVA 3HP6A 2IS3A 4FJLA 2PYJA 2VG5A 4KFBA 4KHUA 1DLOA 3WNGA 3DRPA 1FXXA 4FJ5A 2VWJA 3DLRA 4B8CA 2JGUA 3TI0A 4YFUA 1NK6A 1VRUA 4W5RA 3G0ZA 4RW4A 3OJUA 3U3GA 3D0PA 3LANA 1KLMA 4CJ3A 3KJVA 4DF4A 4I7FA 2XY6A 3PV8A 3AVLA 1A5XA 1L3UA 4B9TA 2DFEA 1NKBA 2KZMA 1LAVA 3AVFA 5D3GA 3VQDA 3SCXA 3PO5A 4W5OA 4DTJA 3O4QA 4IDKA 2VG7A 1Q8IA 4O55A 3HVRA 1C0UA 4FK4A 1RT5A 3EZ5A 3QETA 3AVBA 4M41A 2YHBA 3V9ZA 1X1PA 4CIEA 1WAFA 3O3HA 3L2UA 4N56A 4FM0A 3DLHA 3OYGA 4C8LA 5JS1A 1RILA 4FLXA 4DSFA 3LPUA 3K5NA 3NHGA 1RBTA 5FDLA 4DLEA 3TANA 1U47A 1JLGA 4PQUA 2KW4A 3A2FA 3ZT1A 1NKCA 3RRGA 4B9SA 4J2BA 4FJXA 4BACA 4CHZA 4HTUA 3CFRA 4BWJA 3AVAA 3OYEA 2HNZA 2P51A 2YNHA 4B08A 5CYQA 1HMVA 3CYMA 4CJTA 1NK5A 2D0BA 2B6AA 2F96A 1UWBA 5J2NA 4NCAA 4KHQA 2F8TA 1D9DA 3L2QA 1CXUA 1U4BA 4KI6A 4N5SA 1ZBHA 1CZBA 3VQ7A 3HM9A 3EYZA 3QERA 3LP3A 4Z4EA 4OKKA 3AO2A 4CHNA 1TL1A 3RMCA 3S3NA 2EHGA 3PO4A 2O4IA 2Z1IA 2IDOA 4CJKA 3KD1E 4AHRA 1VK0A 3MXMA 2RKIA 3HO1A 1YTUA 3AV9A 1VSDA 1N6QA 5C24A 2PYLA 3AVGA 3HXMA 4DS4A 3LP0A 3OYBA 3AVMA 3OYHA 2IAJA 3I0SA 1D9FA 3V9UA 3V9WA 4ELUA 3OYNA 2Z1GA 3DMJA 3IG1A 3QNOA 4IBNA 4DTOA 3SJJA 4KB1A 4N76A 4CESA 1C1AA 4J2EA 1NOZA 4ZTFA 1L5UA 3NH2A 1RDAA 4IG3A 5CZ2A 4KKOA 3MXIA 1QTMA 3SV3A 1QE1A 4CGJA 3ZT3A 3ASMA 1FKPA 3LZIA 3ZCMA 4K8XA 4Z4FA 3VN5A 4Q0BA 4N47A 3V81A 2G8KA 1DTTA 4I9LA 2PZSA 1I39A 3VQ5A 3ZT4A 3LWMA 4QAGA 3RMBA 4M3XA 4QCLA 3OJSA 2Q3SA 2KQ2A 4KAZA 3SPYA 1J53A 3HVTA 5I42A 4E7KA 3KKSA 4M3WA 1VSIA 3C94A 1RT3A 3DRSA 3IRXA 3SQ1A 1L3VA 5DK5A 1TK0A 2VWKA 3AO3A 4RW8A 4AH9A 4Z4HA 3VQCA 2BGGA 3O3GA 1XC9A 4CEEA 4LSNA 4DQSA 2OPRA 1LV5A 4DG1A 5KRTA 1HJRA 3TARA 2KFZA 3NH0A 1YTAA 5HRSA 3G10A 1XI1A 1IKVA 2HB5A 3O4NA 2Y1JA 3NBPA 3KK1A 2X6SA 2YNFA 1JLFA 5KI6A 1EETA 1VSFA 4C8MA 2XO7A 2DY4A 1MU2A 3TAPA 1NKEA 1TGOA 4OVLA 4CGGA 4ID5A 1JLCA 3VQ6A 1BQNA 2HVHA 3MECA 2PY5A 4UQGA 1NK0A 1TV6A 4IFVA 3OYMA 3HT3A 1I3AA 1BI4B 1BCOA 1G15A 3MEEA 3ZSXA 1RDDA 1BHLA 4KB0A 1J54A 3AA4A 3TAQA 3T19A 4FJJA 1NJYA 4ELVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AO1 A;  3OS1 A;  1RTI A;  5FRO A;  4AHC A;  4DTU A;  1KVB A;  1TAQ A;  3QNN A;  3CM5 A;  4Z4C A;  3DRR A;  3DM2 A;  4TSX A;  4CK3 A;  3ALY A;  4KTZ A;  3OYD A;  4B3O A;  3ULD A;  1LWC A;  3TR8 A;  3ZSR A;  1BI4 A;  1D5A A;  4HVJ A;  3QEI A;  1T7P A;  2OZM A;  1K6Y A;  1U04 A;  1RDB A;  4L8R B;  1IO2 A;  2ETJ A;  3NH1 A;  3LP2 A;  3L2W A;  4B9L A;  3WNF A;  1X9W A;  1FKO A;  2ZE2 A;  2QKB A;  4FJI A;  3K5O A;  4Z0U A;  1L3S A;  4DTR A;  3VA0 A;  4FJN A;  3MAQ A;  4LD0 A;  3HPO A;  2YKM A;  4CK2 A;  1O1W A;  4KO0 A;  3MED A;  2OYQ A;  3LAK A;  4HUF A;  4DTS A;  4DSL A;  1Y97 A;  1TL3 A;  4CCH A;  4E7L A;  3NGI A;  3AA5 X;  4GMJ B;  4M3T A;  1EP4 A;  4E0D A;  3C95 A;  5KGW A;  3OYL A;  2HHT A;  2DTU A;  1REV A;  3NGZ A;  4JS4 A;  1B9F A;  2XY5 A;  2YV0 X;  2OPQ A;  3BGR A;  4H4O A;  1XHZ A;  1SL1 A;  4KTQ A;  1WSH A;  4KHN A;  2OZS A;  3SUQ A;  4CFD A;  5HLF A;  4C8N A;  2YNI A;  3VQA A;  4OGE A;  2HHW A;  3ITH A;  4I9Q A;  4FJM A;  1HNI A;  1JXE A;  3AVI A;  1ZBL A;  3S3O A;  4E1N A;  3ZT2 A;  3K57 A;  1R0A A;  4RG8 A;  3JYT A;  3OY9 A;  4E3S A;  1SKS A;  3AO5 A;  4OKE A;  3RR7 A;  1JL2 A;  3DOK A;  1VSM A;  4FW2 A;  1RT4 A;  2YKN A;  4CEF A;  4DFM A;  1TK5 A;  2HW3 A;  3K5L A;  4DU3 A;  5FRM A;  2HHS A;  1VSE A;  5EU7 A;  1T05 A;  5DMR A;  1RT6 A;  1C0T A;  1WSJ A;  3QIN A;  3QLH A;  3TAM A;  4DQQ A;  1CLQ A;  2W42 A;  3ZSQ A;  3PX4 A;  3U3Y A;  3P5J A;  4ICL A;  3KLE A;  3SQ4 A;  4FZX C;  4K8Z A;  4RW7 A;  4H8K A;  2G8V A;  1UAX A;  4FM1 A;  3U6F A;  5HRR A;  4CGH A;  3KK3 A;  4B9U A;  4FK0 A;  4J2A A;  3KLF A;  4OPK A;  4YNQ A;  4FVM A;  4GW6 A;  4MFB A;  4CJE A;  3LZJ A;  4FCY A;  1BCM A;  4CEB A;  1X9M A;  3KD5 E;  4KRE A;  1NJX A;  5J2M A;  1HRH A;  3VQ4 A;  4KHY A;  3ZT0 A;  2HHV A;  4CF1 A;  2D5R A;  4CGD A;  1L3T A;  2KFN A;  3ZSZ A;  3TAB A;  3CM6 A;  4MQ3 A;  1CXQ A;  4FZZ A;  4DFJ A;  3I0R A;  1HQU A;  4CEC A;  1SL0 A;  2KZZ A;  4FLU A;  4M3Z A;  1KCF A;  4CED A;  3L2R A;  3NDK A;  4AIL C;  1B92 A;  2DFH A;  1HYV A;  3HP9 A;  2G8U A;  3DLB A;  4KTW A;  1ZBU A;  4KHS A;  1JLQ A;  4FZY A;  1RDC A;  1RT1 A;  1W0H A;  1ZBF A;  5J1E A;  4PUO A;  1SKW A;  2XRI A;  1QSS A;  2P1J A;  2EX3 A;  4C8K A;  1RBU A;  1RTJ A;  1XHX A;  5KTQ A;  1HYZ A;  1RBV A;  3IAY A;  2VG6 A;  4B9V A;  3I8D A;  4KRF A;  3L3V A;  3CFP A;  2F8S A;  4FXD A;  3K58 A;  3ZSV A;  1S1X A;  2E6L A;  2OPP A;  4CHQ A;  2RPI A;  2WON A;  2Z1J A;  3V9X A;  1NK4 A;  3V1O A;  1KRP A;  4FW1 A;  3PY8 A;  2P5G A;  3MXJ A;  4I2P A;  4Y1C A;  5K14 A;  5CYM A;  4JS5 A;  1NJZ A;  1DTQ A;  1TK8 A;  1UA1 A;  1QSL A;  3BDP A;  3SNN A;  1JKH A;  4NCB A;  4NYF A;  1RNH A;  3QIO A;  4NCG A;  2WOM A;  3L8B A;  3V9S A;  4F3T A;  3KK2 A;  4RW6 A;  2GV9 A;  3VA3 A;  2ITG A;  5JS2 A;  3QES A;  4BDP A;  4C8O A;  1S9E A;  4IKF A;  4CJ4 A;  3RTV A;  3OS2 A;  4FYD A;  3M8S A;  4Y1D A;  3L2V A;  4BDZ A;  2KTQ A;  1HQE A;  4RW9 A;  1SV5 A;  2XY7 A;  3PX0 A;  4CJL A;  1JLB A;  4B9N A;  2DFF A;  4AHT A;  4LH4 A;  1CZ9 A;  1X9S A;  4M3Y A;  1LWE A;  2E6M A;  3FFI A;  3MEG A;  1NK9 A;  4OKJ A;  3T1A A;  3RWU A;  1KVA A;  3HL8 A;  1ZBI A;  4FK2 A;  1QQC A;  1YVU A;  2YHA A;  4QOZ B;  1F21 A;  3NE6 A;  1TVR A;  4W5Q A;  3L3U A;  3DLK A;  3DOL A;  4M45 A;  4HCB A;  1Q9X A;  2A1R A;  4CFC A;  2O4G A;  4WE1 A;  3EY1 A;  4M3U A;  1VSL A;  4ZTJ A;  3KIO A;  2YNG A;  1LW2 A;  1IH7 A;  4EP5 A;  4PY5 A;  4CFB A;  3PUF A;  1SKR A;  1N5Y A;  4FJ9 A;  4DQI A;  5E41 A;  2BE2 A;  3AVJ A;  1BIZ A;  3B6P A;  4FJK A;  1XWL A;  3SUO A;  4F4K A;  4M42 A;  3NF8 A;  4CJP A;  1UA0 A;  3S9H A;  3H08 A;  4KV8 A;  4CHO A;  1S6P A;  4E89 A;  3VQP A;  1S1U A;  1U48 A;  4CEA A;  4N41 A;  1IG9 A;  3VQQ A;  4CIG A;  3THV A;  2FBV A;  3UIQ A;  1VSH A;  1QHT A;  2QKK A;  4DSI A;  1TKT A;  1RCH A;  4DFP A;  4ZHR A;  3KLH A;  5CZ1 A;  4FJ8 A;  1EX4 A;  1A5V A;  1IKW A;  1RT2 A;  3E01 A;  4R5P A;  4CJV A;  2BDP A;  4M3R A;  4DSJ A;  4KPY A;  3LPT A;  1D8Y A;  1W9H A;  1YT3 A;  3QO9 A;  4AHS A;  4CK1 A;  1BIU A;  2FBT A;  3NGY A;  2Y1I A;  3KLG A;  4OLA A;  4DS5 A;  3K59 A;  3VQE A;  2HHQ A;  2NUB A;  2AJQ A;  4HHT A;  4HUG A;  3B6O A;  3OYK A;  4FLY A;  3V4I A;  2HHU A;  3AA3 A;  1NJW A;  2ZD1 A;  3WNE A;  4FJH A;  1Q9Y A;  1RT7 A;  3SZ2 A;  3S3M A;  3QEP A;  4F2S A;  3KKR A;  3AVK A;  4EZ6 A;  3TWH A;  2XHB A;  3LAL A;  3NF7 A;  5HBM A;  1NK8 A;  4KI4 A;  1HYS A;  2D0A A;  2B5J A;  4J2D A;  4I2Q A;  1S9G A;  2RN2 A;  4O0J A;  3QEV A;  3RMA A;  3AVH A;  3TAG A;  4CJU A;  3OYC A;  5KGX A;  4EP4 A;  3M8R A;  4KHW A;  2FBX A;  4CER A;  4DU1 A;  4F2R A;  4OPJ A;  2JLE A;  1TKX A;  3P1G A;  1C1C A;  4NYN A;  3SQ0 A;  4O44 A;  3IS9 A;  3ZSY A;  1EKE A;  1HPZ A;  5KRS A;  4FJ7 A;  1EXQ A;  3LAM A;  3C6T A;  4DTM A;  4DTP A;  4DWI A;  1GOA A;  1BQM A;  1WSG A;  3AO4 A;  4CF2 A;  4PWD A;  2RF2 A;  3KTQ A;  1VSK A;  1C1B A;  4FM2 A;  1KTQ A;  3PX6 A;  3CQ8 A;  4CJR A;  3OYF A;  3QEW A;  1IKY A;  3TAF A;  1WLJ A;  1HNV A;  3OYA A;  1KFS A;  3NFA A;  2IOC A;  1JLE A;  4DU4 A;  4EZ9 A;  3ISN C;  3OS0 A;  1S1T A;  4E7H A;  3HYF A;  2E4L A;  3M8P A;  3SQ2 A;  4BE0 A;  1BL3 A;  3K5M A;  4BE1 A;  2X74 A;  1ASV A;  1RBR A;  3LDS A;  4CJ5 A;  1ASW A;  4CHP A;  4FLW A;  2GUI A;  3WNH A;  4DQP A;  4CE9 A;  4IFY A;  4BWM A;  1J5O A;  1A5W A;  3O3F A;  2OA8 A;  2P5O A;  5FRN A;  5CY4 A;  1Z25 A;  4CJW A;  4LY7 A;  4PA1 A;  4FLZ A;  1S6Q A;  4Z4G A;  2QK9 A;  1LWF A;  3RR8 A;  4CEO A;  2Z1H A;  1J9A A;  3F9K A;  4Q5V A;  3QIP A;  4DFK A;  3M8Q A;  4G1Q A;  5HP1 A;  4CGF A;  1ASU A;  4CGI A;  4O0I A;  4W5T A;  2ZQB A;  3NF9 A;  4OLB A;  4CFA A;  4CJS A;  1SUQ A;  1WSI A;  4FLT A;  1BIS A;  5C42 A;  4O4G A;  4OGC A;  4DQR A;  5I3U A;  4B9M A;  4DSK A;  1WN7 A;  4DMN A;  5J2P A;  2HMI A;  3SV4 A;  1UOC A;  4OJR A;  3OYJ A;  4F3O A;  1GOB A;  3SUP A;  3QEX A;  1S5J A;  3D45 A;  4E7J A;  3VQB A;  1KLN A;  2FBY A;  1KVC A;  5HRO A;  1S1W A;  4CHY A;  1NK7 A;  3ZSO A;  1U49 A;  3HJF A;  3AVN A;  3DLG A;  2IGI A;  1ZYQ A;  4FJG A;  1C6V A;  3LP1 A;  1QS4 A;  2X6N A;  3V1Q A;  5SWM A;  4CEQ A;  4H4M A;  4DLG A;  1S1V A;  4E7I A;  1LAW A;  1T03 A;  3DLE A;  1IKX A;  2QXF A;  1KFD A;  3DI6 A;  2B4J A;  2XY8 A;  1WSE A;  2G8W A;  3V6D A;  2ATQ A;  1U45 A;  1RTD A;  1KSP A;  5T7B A;  3SYZ A;  4AHU A;  4DSE A;  4DTN A;  3HK2 A;  4E1M A;  2FC0 A;  1TKD A;  1JXB A;  3CFO A;  4GVM A;  2OPS A;  1B9D A;  3HST B;  5HRP A;  4CEZ A;  3T3F A;  3HPG A;  2HHX A;  1RTH A;  1VSJ A;  3K2P A;  3OVN A;  2GBZ A;  4CIF A;  2D0C A;  4LH5 A;  2HVI A;  1NOY A;  3JSM A;  4IG0 A;  3TAE A;  2IC3 A;  5SZT A;  1T8E A;  3C6U A;  2R7Y A;  1C0M A;  1JLA A;  3AA2 A;  3VQ9 A;  3SI6 A;  3NCI A;  4E19 A;  4DTX A;  5HRN A;  1GOC A;  3CG7 A;  1VRT A;  3KLI A;  1JL1 A;  3NF6 A;  4B8A B;  4ID1 A;  4W5N A;  1TAU A;  2A1S A;  4LSL A;  4CJF A;  3SUN A;  4CJQ A;  4BE2 A;  4BDY A;  3LWL A;  2I5J A;  1WSF A;  1Z26 A;  3ZSW A;  3P83 D;  4HUE A;  1BGX T;  4XIU A;  3AVC A;  2HND A;  4CF9 A;  4DF8 A;  5J2Q A;  1WAJ A;  4HCC A;  3HPH A;  3DYA A;  1RBS A;  5C25 A;  1LW0 A;  3SPZ A;  2X78 A;  3V1R A;  3F73 A;  4JRQ A;  1QSY A;  3RMD A;  4AHV A;  2HNY A;  4JLH A;  4ELT A;  1WNS A;  4Z4I A;  1SL2 A;  3RRH A;  1ITG A;  2G8H A;  4O5B A;  3OYI A;  3NAE A;  2BAN A;  4JRP A;  2G8I A;  4CF8 A;  1TKZ A;  2LSN A;  3VQ8 A;  1FK9 A;  4CF0 A;  2G8F A;  4F8R A;  4FLV A;  3HP6 A;  2IS3 A;  4FJL A;  2PYJ A;  2VG5 A;  4KFB A;  4KHU A;  1DLO A;  3WNG A;  3DRP A;  1FXX A;  4FJ5 A;  2VWJ A;  3DLR A;  4B8C A;  2JGU A;  3TI0 A;  4YFU A;  1NK6 A;  1VRU A;  4W5R A;  3G0Z A;  4RW4 A;  3OJU A;  3U3G A;  3D0P A;  3LAN A;  1KLM A;  4CJ3 A;  3KJV A;  4DF4 A;  4I7F A;  2XY6 A;  3PV8 A;  3AVL A;  1A5X A;  1L3U A;  4B9T A;  2DFE A;  1NKB A;  2KZM A;  1LAV A;  3AVF A;  5D3G A;  3VQD A;  3SCX A;  3PO5 A;  4W5O A;  4DTJ A;  3O4Q A;  4IDK A;  2VG7 A;  1Q8I A;  4O55 A;  3HVR A;  1C0U A;  4FK4 A;  1RT5 A;  3EZ5 A;  3QET A;  3AVB A;  4M41 A;  2YHB A;  3V9Z A;  1X1P A;  4CIE A;  1WAF A;  3O3H A;  3L2U A;  4N56 A;  4FM0 A;  3DLH A;  3OYG A;  4C8L A;  5JS1 A;  1RIL A;  4FLX A;  4DSF A;  3LPU A;  3K5N A;  3NHG A;  1RBT A;  5FDL A;  4DLE A;  3TAN A;  1U47 A;  1JLG A;  4PQU A;  2KW4 A;  3A2F A;  3ZT1 A;  1NKC A;  3RRG A;  4B9S A;  4J2B A;  4FJX A;  4BAC A;  4CHZ A;  4HTU A;  3CFR A;  4BWJ A;  3AVA A;  3OYE A;  2HNZ A;  2P51 A;  2YNH A;  4B08 A;  5CYQ A;  1HMV A;  3CYM A;  4CJT A;  1NK5 A;  2D0B A;  2B6A A;  2F96 A;  1UWB A;  5J2N A;  4NCA A;  4KHQ A;  2F8T A;  1D9D A;  3L2Q A;  1CXU A;  1U4B A;  4KI6 A;  4N5S A;  1ZBH A;  1CZB A;  3VQ7 A;  3HM9 A;  3EYZ A;  3QER A;  3LP3 A;  4Z4E A;  4OKK A;  3AO2 A;  4CHN A;  1TL1 A;  3RMC A;  3S3N A;  2EHG A;  3PO4 A;  2O4I A;  2Z1I A;  2IDO A;  4CJK A;  3KD1 E;  4AHR A;  1VK0 A;  3MXM A;  2RKI A;  3HO1 A;  1YTU A;  3AV9 A;  1VSD A;  1N6Q A;  5C24 A;  2PYL A;  3AVG A;  3HXM A;  4DS4 A;  3LP0 A;  3OYB A;  3AVM A;  3OYH A;  2IAJ A;  3I0S A;  1D9F A;  3V9U A;  3V9W A;  4ELU A;  3OYN A;  2Z1G A;  3DMJ A;  3IG1 A;  3QNO A;  4IBN A;  4DTO A;  3SJJ A;  4KB1 A;  4N76 A;  4CES A;  1C1A A;  4J2E A;  1NOZ A;  4ZTF A;  1L5U A;  3NH2 A;  1RDA A;  4IG3 A;  5CZ2 A;  4KKO A;  3MXI A;  1QTM A;  3SV3 A;  1QE1 A;  4CGJ A;  3ZT3 A;  3ASM A;  1FKP A;  3LZI A;  3ZCM A;  4K8X A;  4Z4F A;  3VN5 A;  4Q0B A;  4N47 A;  3V81 A;  2G8K A;  1DTT A;  4I9L A;  2PZS A;  1I39 A;  3VQ5 A;  3ZT4 A;  3LWM A;  4QAG A;  3RMB A;  4M3X A;  4QCL A;  3OJS A;  2Q3S A;  2KQ2 A;  4KAZ A;  3SPY A;  1J53 A;  3HVT A;  5I42 A;  4E7K A;  3KKS A;  4M3W A;  1VSI A;  3C94 A;  1RT3 A;  3DRS A;  3IRX A;  3SQ1 A;  1L3V A;  5DK5 A;  1TK0 A;  2VWK A;  3AO3 A;  4RW8 A;  4AH9 A;  4Z4H A;  3VQC A;  2BGG A;  3O3G A;  1XC9 A;  4CEE A;  4LSN A;  4DQS A;  2OPR A;  1LV5 A;  4DG1 A;  5KRT A;  1HJR A;  3TAR A;  2KFZ A;  3NH0 A;  1YTA A;  5HRS A;  3G10 A;  1XI1 A;  1IKV A;  2HB5 A;  3O4N A;  2Y1J A;  3NBP A;  3KK1 A;  2X6S A;  2YNF A;  1JLF A;  5KI6 A;  1EET A;  1VSF A;  4C8M A;  2XO7 A;  2DY4 A;  1MU2 A;  3TAP A;  1NKE A;  1TGO A;  4OVL A;  4CGG A;  4ID5 A;  1JLC A;  3VQ6 A;  1BQN A;  2HVH A;  3MEC A;  2PY5 A;  4UQG A;  1NK0 A;  1TV6 A;  4IFV A;  3OYM A;  3HT3 A;  1I3A A;  1BI4 B;  1BCO A;  1G15 A;  3MEE A;  3ZSX A;  1RDD A;  1BHL A;  4KB0 A;  1J54 A;  3AA4 A;  3TAQ A;  3T19 A;  4FJJ A;  1NJY A;  4ELV A; 
#chains in the Genus database with same CATH topology
 5BRE A;  5FRO A;  4DTU A;  2QWN A;  2Q97 A;  4Z4C A;  4ILJ A;  3CCR N;  3DM2 A;  1NGC A;  3KHY A;  3ALY A;  1JCG A;  3ZSR A;  1BI4 A;  3BUZ B;  1K6Y A;  1NGI A;  4IXC A;  1IO2 A;  3LP2 A;  4B9L A;  3WNF A;  2ZE2 A;  3F9M A;  4B1Z A;  2W40 A;  5AR0 A;  4Z0U A;  3W0L A;  1OH7 A;  4JKA A;  3LM9 A;  3GG4 A;  3HTV A;  3LAK A;  4FWM A;  4DTS A;  3D2F A;  4CCH A;  4J8F A;  2QI2 A;  5H1S Q;  3NGI A;  4GMJ B;  4EHT A;  1EP4 A;  4MDA A;  4E7L A;  4E0D A;  4NO7 A;  4H4O A;  3KZB A;  3SUQ A;  1KAZ A;  4K43 A;  3SAF A;  2HHW A;  1VQL N;  4FJM A;  1JXE A;  1ZBL A;  3K57 A;  4RG8 A;  5AQN A;  4E3S A;  1JL2 A;  2QXL A;  3RSE B;  1TYQ B;  2YKN A;  1T44 A;  3CF5 L;  4CW7 B;  4JI1 K;  1RT6 A;  3QIN A;  3QB0 A;  3ZET A;  1N34 K;  3P5J A;  5C2F A;  3QIC A;  4FZX C;  1DGK N;  3HOT A;  4FM1 A;  4JKF A;  5HRR A;  4CGH A;  4OPK A;  4B3M K;  1BCM A;  1X9M A;  3LDP A;  3ATV A;  3P4I A;  2KFN A;  1CXQ A;  4FZZ A;  1HQU A;  4CEC A;  1SL0 A;  4FLU A;  3A5N C;  3O5B A;  3HP9 A;  1ZBU A;  3CME N;  1JLQ A;  1RDC A;  1W0H A;  4WFB L;  4PUO A;  1SKW A;  1QSS A;  1M1K O;  4C8K A;  3I8D A;  5AFU H;  2E8A A;  3IKM A;  1NK4 A;  1T6C A;  1NGA A;  4FWR A;  2HBK A;  4H5T A;  4PKI A;  4I2P A;  5AZJ B;  1TK8 A;  1DTQ A;  3BDP A;  4CD1 A;  4QS9 A;  4WQ4 A;  4NCB A;  4NYF A;  3L8B A;  2WOM A;  2OCE A;  2GV9 A;  4GNI A;  1V4T A;  2ITG A;  3LDO A;  5EY4 A;  3HOS A;  3VOV A;  4CJ4 A;  4KH6 A;  1E4G T;  3L2V A;  1YJN N;  4RW9 A;  1JLB A;  5C2D A;  3VMF B;  1X9S A;  2E2Q A;  3MEG A;  2P9N B;  3RSE A;  1ZBI A;  4FK2 A;  3Q7C A;  1TVR A;  3DOL A;  2H3G X;  1Q9X A;  2RE2 A;  2A1R A;  4M3U A;  3MCP A;  3KIO A;  4U7B A;  1LW2 A;  2NLX A;  1N5Y A;  2ZJR L;  3VER A;  3AVJ A;  1FW6 A;  3M1F A;  1XWL A;  1V4S A;  3MN5 A;  4OO1 J;  3NF8 A;  1UA0 A;  2P9L B;  1S6P A;  1ZXO A;  3VQP A;  4LF7 K;  3FE1 A;  3VTH A;  3C7N A;  3VQQ A;  4A57 A;  4CIG A;  2FBV A;  3KVG A;  3HZ6 A;  4DUZ K;  2A42 A;  3KLH A;  4CVN E;  4FJ8 A;  1EX4 A;  3VGM A;  4QS7 A;  1LCU A;  1D8Y A;  3QO9 A;  4AHS A;  5IWA K;  4RTF D;  4GV9 A;  3ULE B;  3KLG A;  4FPB A;  4DS5 A;  3K59 A;  3VQE A;  1BWF O;  2HBM A;  4HHT A;  3UKU A;  4FLY A;  3U9Z A;  4G9Z A;  1Q9Y A;  1RT7 A;  3QEP A;  3H3N O;  2NRV A;  2D0A A;  5TKY A;  1YI2 N;  5JMV A;  4M7X A;  5KGX A;  4KHW A;  4CER A;  4JHD B;  1BU6 O;  4DU1 A;  4JD2 A;  1GLD G;  2JLE A;  3P1G A;  4BVO A;  5CHI A;  4DV4 K;  3IS9 A;  4JEP A;  5JVG L;  1HPZ A;  5KRS A;  1GOA A;  1WSG A;  2RF2 A;  3CCU N;  3PX6 A;  1DT9 A;  2VQE K;  3IUC A;  3M5R A;  3OYA A;  1KFS A;  4DR5 K;  4WFA L;  2E4L A;  3ENB A;  1ATS A;  2D1K A;  2X74 A;  3UKU B;  1ASV A;  4CJ5 A;  4DV2 K;  4FLW A;  2EWS A;  3WNH A;  5AZI A;  4IFY A;  2OA8 A;  5FRN A;  2PBD A;  3WXI A;  3THX B;  4PA1 A;  4YOX A;  4JI7 K;  1LWF A;  2Z1H A;  3QIP A;  3CCL N;  3M8Q A;  4G1Q A;  3WXL A;  5HP1 A;  2VYP A;  3O6W A;  3THW A;  5C42 A;  4O4G A;  3CJA A;  3VTI A;  4GV6 A;  1KXP A;  3AY9 A;  4DMN A;  3GOI A;  3OYJ A;  1VQP N;  2F4V K;  2D0P A;  3CCE N;  3VQB A;  1KLN A;  2FBY A;  1XUP O;  5HRO A;  3A8Y A;  3MWT A;  3ZSO A;  1ZYQ A;  1C6V A;  5BPN A;  2X6N A;  5SWM A;  4KH4 A;  1LAW A;  3DLE A;  1IKX A;  2UUA K;  3SYZ A;  4AHU A;  4JYA K;  4DTN A;  3HK2 A;  4E1M A;  5AQM A;  1TKD A;  4H0V B;  1B9D A;  3HST B;  5AQK A;  2GWJ A;  5HRP A;  5AQL A;  2HHX A;  1C0G A;  1RTH A;  4GY2 B;  2GBZ A;  4CIF A;  4LH5 A;  3JS6 A;  2HVI A;  4IG0 A;  2I7P A;  1NM1 A;  1T8E A;  2UXC K;  2R7Y A;  3VQ9 A;  4IZ9 A;  3CG7 A;  1VRT A;  4W5N A;  4YOW A;  3SUN A;  4BE2 A;  2I5J A;  1K9M O;  4EHU A;  4HUE A;  1BGX T;  3AVC A;  4BG9 A;  5JLH A;  1HX1 A;  3T7Z A;  5J2Q A;  2OTL N;  4HCC A;  1RBS A;  4JRQ A;  3CC7 N;  4BR7 A;  1J6Z A;  5AQO A;  1NGH A;  1QQO A;  1U6Z A;  4O5B A;  3D2E A;  3VEX A;  3WXJ A;  4OX9 K;  2G8I A;  4CF0 A;  2HBJ A;  4CZM A;  2VG5 A;  4KFB A;  2VWJ A;  4NLC A;  4B8C A;  2JGU A;  1VRU A;  3ATU A;  3OJU A;  3N4P A;  3U3G A;  1NG9 A;  4IOC L;  1YIT N;  4DF4 A;  5BR9 A;  1NJI O;  4BQL A;  1LAV A;  3AVF A;  2A6A A;  5CE3 A;  3VQD A;  4RCH A;  1Q18 A;  2VG7 A;  5AZI B;  1WBD A;  3OTO K;  3EKS A;  4M41 A;  3V9Z A;  3OBW A;  3G4S N;  4CIE A;  5JS1 A;  3C7N B;  3L2U A;  2QWM A;  3EO3 A;  3NHG A;  3IMX A;  3TAN A;  4FWQ A;  1JLG A;  4PQU A;  3L4I A;  4J2B A;  4IEI A;  4CHZ A;  3CFR A;  3OA9 A;  3OYE A;  2P51 A;  2YNH A;  3CQY A;  1D9D A;  4JN4 A;  1U4B A;  3TTC A;  4Z4E A;  4OKK A;  3AO2 A;  3K0S A;  3PO4 A;  2P9K B;  2BTF A;  4QS8 A;  2Z1I A;  2IDO A;  4BRO A;  1VK0 A;  4JHD A;  3HO1 A;  1YTU A;  2PYL A;  1N6Q A;  1OKJ A;  3AVG A;  5FPM A;  3V9U A;  3HI0 A;  3OYN A;  2Z1G A;  3DMJ A;  2PAV A;  3QNO A;  4IBN A;  4DTO A;  3SJJ A;  4N76 A;  4CES A;  1C1A A;  1L5U A;  3NH2 A;  1RDA A;  1GLF O;  2VGM A;  4K8X A;  4N47 A;  3V81 A;  4WQ5 A;  1DTT A;  3I8B A;  4JAX A;  3ZT4 A;  3RMB A;  4M3X A;  1YVN A;  4QCL A;  1QQM A;  2Q3S A;  2V7Y A;  3D7E O;  3CCQ N;  4GVE A;  3KKS A;  4E7K A;  1VSI A;  3SQ1 A;  4WQ4 C;  3SMS A;  5DK5 A;  2BGG A;  4Z4H A;  4AH9 A;  3O3G A;  1NLV A;  3D6R A;  4DCH A;  2E2N A;  1XC9 A;  1LV5 A;  4IOA L;  3TAR A;  2KFZ A;  4DQ8 A;  1YTA A;  2Y1J A;  3EEQ A;  1JLF A;  4C8M A;  1NKE A;  1TGO A;  2QWP A;  5ADX H;  3LDQ A;  2UYT A;  4NCA A;  4KB0 A;  1BCO A;  1G15 A;  3BP8 A;  1NMN A;  5IT9 O;  2V7Z A;  4LC9 B;  4FJJ A;  4BY9 C;  4ELV A;  4AHC A;  3H1V X;  1KVB A;  1TAQ A;  4XH1 A;  3QNN A;  1VQ7 N;  5EVZ A;  3DRR A;  2IVP A;  4TSX A;  4B3O A;  3EZW A;  1LWC A;  3TR8 A;  4HVJ A;  1T7P A;  1D5A A;  1QVF M;  4L8R B;  2O8E B;  1U04 A;  2ETJ A;  3L2W A;  4EFH A;  1L3S A;  4JK8 A;  4LD0 A;  5DM6 L;  5LMN K;  4A62 A;  3MED A;  1G99 A;  4DSL A;  3G6E N;  4M3T A;  3ZX3 A;  4ILH A;  5KGW A;  1D4X A;  2DTU A;  2XY5 A;  1OVY A;  3MN7 A;  1MA9 B;  4HTL A;  3WT0 A;  3PIP L;  4BC5 A;  3O4W A;  4AQY K;  1SKS A;  4EAH D;  1YHQ N;  4RWT A;  3DOK A;  1NGB A;  3O08 A;  4FW2 A;  4E1J A;  4CEF A;  2ITM A;  4LF4 K;  3K5L A;  3FZM A;  2HHS A;  5M1O A;  1VSE A;  1T05 A;  2E88 A;  5B8H A;  2W42 A;  4H5V A;  3U3Y A;  4ICL A;  4Y0W A;  4RW7 A;  4FWO A;  4YDU C;  5BN8 A;  4H8K A;  3U6F A;  3KK3 A;  4B9U A;  4FVM A;  3TSQ A;  1I94 K;  4FCY A;  4CEB A;  1EWQ A;  1EQY A;  5J2M A;  1HRH A;  2OTJ N;  4CI6 A;  2D5R A;  2J4R A;  3EL2 A;  4CGD A;  1VQK N;  3ZSZ A;  3I0R A;  5AQG A;  3H45 C;  2WFB A;  4M3Z A;  4A5A A;  2P9P A;  3L2R A;  3NDK A;  2YCH A;  4C1N I;  1BUP A;  3DLB A;  3H3O B;  3ENH A;  5MLC Q;  4FZY A;  2EX3 A;  1RTJ A;  2QWO A;  4PHT X;  3IAY A;  4JKE A;  1RBV A;  2D0O A;  4B9V A;  4DV6 K;  4JK9 A;  3WXK A;  4KRF A;  4FXD A;  3V9X A;  1S1X A;  3L4Q A;  1KRP A;  2RPI A;  2WON A;  5A2Q O;  4CZG A;  5GAG P;  4Y1C A;  5CYM A;  4H5R A;  1NJZ A;  1UA1 A;  2P9U B;  3SNN A;  1JKH A;  4KH5 A;  3QIO A;  3V9S A;  4RW6 A;  5KPZ A;  2QWR A;  3VA3 A;  1NBW A;  5JS2 A;  3O1W A;  4Z94 A;  3QES A;  4BDP A;  4C8O A;  3H1Q A;  5ADX A;  4FYD A;  3M8S A;  2O8C B;  4BDZ A;  1HQE A;  4DKW A;  1N36 K;  2DFF A;  4LH4 A;  1CZ9 A;  3CQX A;  3M3Z A;  3FFI A;  4CJ7 A;  1HKB A;  1XMQ K;  3RWU A;  4HWI A;  4QOZ B;  1F21 A;  3NE6 A;  4W5Q A;  3DLK A;  3EY1 A;  2O4G A;  1VSL A;  4ZTJ A;  3A0I X;  1SKR A;  2BE2 A;  4FWL A;  4O8K A;  3MMV A;  5BRD A;  3SUO A;  1HJO A;  4CJP A;  4YDU A;  4M42 A;  3H08 A;  2HOE A;  4CHO A;  4BRN A;  3WQT A;  1S1U A;  1U48 A;  3L6Q A;  4FWK A;  3THV A;  1VSH A;  2WC9 A;  4ZHR A;  5CZ1 A;  3U9D A;  5F0X A;  1A5V A;  1IKW A;  3E01 A;  2BDP A;  4DSJ A;  4CJV A;  4M3R A;  3LPT A;  2O8B B;  4YOU A;  1YT3 A;  3SK3 A;  3ZYY X;  3V4I A;  4NXN K;  3AA3 A;  4FJH A;  2JWL A;  3SZ2 A;  3TWH A;  3NF7 A;  1NK8 A;  5BPL A;  4L3Q A;  1BA0 A;  5M1P A;  4B9Q A;  4J2D A;  4I2Q A;  2RN2 A;  1LOT B;  3HM8 A;  5AQT A;  2F7T A;  3SQ0 A;  5E26 A;  3ZSY A;  1EKE A;  4H5N A;  4DTM A;  4YOR A;  4A59 A;  4DWI A;  3C65 A;  3AO4 A;  4CF2 A;  4H0T B;  1C1B A;  5M1F A;  1KTQ A;  4CJR A;  3OYF A;  3QEW A;  2W41 A;  3F5T A;  3O80 A;  3ISN C;  4E7H A;  3VET A;  3HYF A;  4AM7 A;  3SQ2 A;  3AAP A;  2Q0U A;  1RBR A;  3LDS A;  3CD6 N;  1XNQ K;  3J7Z O;  3O3F A;  3HBT A;  4V19 S;  1Z25 A;  1Z05 A;  3VEO A;  3CCS N;  4CEO A;  1J9A A;  2ZGY A;  4ISF A;  4Q5V A;  4DFK A;  5LL6 Z;  4CGF A;  4O0I A;  3DXK A;  4GV3 A;  3E9L A;  4IFE A;  4CFA A;  4CJS A;  1WSI A;  5KPT A;  1HUX A;  3H46 O;  1BIS A;  4BR0 A;  2AA4 A;  1FJG K;  5J2P A;  3SV4 A;  4OJR A;  2NRW A;  5LJV A;  4U67 L;  3D45 A;  5EXW A;  4E7J A;  2KHO A;  3WUH A;  4NB4 A;  4JI8 K;  3AVN A;  4FJG A;  2IGI A;  3LP1 A;  1QS4 A;  4H4M A;  4E7I A;  5LY3 A;  4H0P A;  2YI1 A;  2B4J A;  2XY8 A;  2G8W A;  2ATQ A;  3P39 A;  1KAX A;  4DSE A;  3CET A;  5CR4 A;  3CFO A;  2OPS A;  1JCF A;  3CER A;  3FZL A;  4BR4 A;  4A2B A;  1C0M A;  1JLA A;  3SI6 A;  5AQH A;  3NCI A;  4DV7 K;  5HRN A;  3CC4 N;  3TSU A;  1HNX K;  3ULE A;  4ID1 A;  4LSL A;  1VQ5 N;  4BDY A;  5TKW A;  1Z26 A;  1T3V A;  4XIU A;  1ESV A;  4X62 K;  2HND A;  3T1H K;  3HPH A;  4LF8 K;  1LW0 A;  3DXK B;  3SPZ A;  2YJF A;  3KWI A;  1QSY A;  2HNY A;  1WB9 A;  3AAR A;  3RRH A;  1ITG A;  3CMA N;  3NAE A;  1TUU A;  3AGR A;  5KQ8 A;  4CF8 A;  1S22 A;  2LSN A;  3VQ8 A;  1FK9 A;  4F8R A;  2Q0R A;  4FLV A;  3WNG A;  3DRP A;  3HRG A;  4FJ5 A;  3GL1 A;  3TI0 A;  4YFU A;  1HPM A;  3ZEU B;  3A5O C;  4H0O A;  2NRR A;  3D0P A;  4CJ3 A;  3KJV A;  2XY6 A;  4I7F A;  4DSK A;  3AVL A;  1A5X A;  2DFE A;  1NKB A;  5D3G A;  4W5O A;  4M63 C;  3MN9 A;  4IDK A;  1Q8I A;  2IVO A;  4H0Y B;  3O9T A;  4IDH A;  4BC2 A;  4BRH A;  4YHH K;  4JKH A;  1RT5 A;  3EZ5 A;  2WTU A;  3AVB A;  4N56 A;  4FM0 A;  3TTD A;  3OYG A;  2NRX A;  3G71 N;  3K5N A;  1SAZ A;  3RVC A;  5FDL A;  2P9I A;  4B9S A;  3A2F A;  5AQV A;  3ZT1 A;  3RRG A;  1YIJ N;  4HTU A;  5LMU K;  4B08 A;  5FLX O;  4FOE A;  4CJT A;  2QWL A;  2B6A A;  4KHQ A;  1CXU A;  5AQF A;  4KI6 A;  4N5S A;  2KLA A;  3HM9 A;  3LP3 A;  4B1V A;  1RDU A;  1K73 O;  3ZLJ A;  2O4I A;  4BRE A;  1WUA A;  4AHR A;  1VSD A;  4DS4 A;  3HXM A;  3OYB A;  3AVM A;  5FPE A;  4NXM K;  1KC8 O;  1U2V A;  2UUC K;  4IO9 L;  3VEN A;  4JNE A;  5BN9 A;  4X65 K;  3ASM A;  3LZI A;  3ZCM A;  4Z4F A;  4Q0B A;  5GAD P;  2Q1N A;  2PZS A;  1I39 A;  4I6M B;  4DR1 K;  1SS6 A;  3VPZ A;  5GAE P;  5AQX A;  3O9S A;  1X9J A;  5I42 A;  1GLA G;  3CCJ N;  4BRL A;  2VWK A;  4KHP K;  4RW8 A;  3CPE A;  3P38 A;  3UKR A;  1IV0 A;  1YJ9 N;  2CGJ A;  3G10 A;  2VCP A;  1EET A;  4WYB A;  1XC3 A;  1NNE A;  1MU2 A;  2NZT A;  5C10 A;  3WEE B;  2CH5 A;  4OVL A;  4ID5 A;  1OVQ A;  1BQN A;  5JLF A;  1KAY A;  2GX9 A;  1NK0 A;  3MEE A;  1RDD A;  4XEI A;  2V52 B;  4CBW A;  3AO1 A;  3OS1 A;  4BGA A;  3CM5 A;  3WQU A;  2Q31 A;  3D2F B;  4LF5 K;  2P9S B;  2IVN A;  2OZM A;  3U8X A;  3QEI A;  5AQU A;  3L0Q A;  4PKG A;  1MDU B;  1FKO A;  4FJI A;  4F9O A;  4DTR A;  3VA0 A;  4DR2 K;  4H0X B;  3MAQ A;  4CK2 A;  4KO0 A;  4BRC A;  3LM2 A;  2YX6 A;  5ELZ A;  4K25 A;  1TL3 A;  2GTD A;  3I56 N;  1J5E K;  1W2B M;  3NGZ A;  4JS4 A;  1B9F A;  3BGR A;  1WSH A;  4BC4 A;  4CFD A;  2YNI A;  2O8D A;  4OGE A;  5AQZ A;  4I9Q A;  2PFU A;  1HNI A;  5AQJ A;  3S3O A;  4E1N A;  4B3R K;  3DJC A;  3ZT2 A;  3O8M A;  3RR7 A;  4BRQ A;  1RT4 A;  1TK5 A;  4DU3 A;  5FRM A;  2ZJP L;  5DMR A;  1HR0 K;  4JI5 K;  1WSJ A;  4DQQ A;  1CLQ A;  1R59 O;  3PX4 A;  4BRD A;  3KLE A;  3SQ4 A;  4K8Z A;  5M1K A;  2G8V A;  3BF1 A;  1UAX A;  3S41 A;  3KLF A;  3VGL A;  4GW6 A;  4MFB A;  4CJE A;  4B3S K;  3LZJ A;  4KRE A;  3KD5 E;  4JKB A;  2ASO A;  4KHY A;  3ZT0 A;  4CF1 A;  4IJA A;  3TAB A;  3LDL A;  3VGK A;  5AQS A;  1IBK K;  2KZZ A;  2CGL A;  1KQS M;  3CJ7 A;  3WEE A;  1KCF A;  4BR2 A;  4CED A;  2VQF K;  4AIL C;  1HYV A;  3O1B A;  1GLB G;  5J1E A;  1N33 K;  2XRI A;  3SAG A;  1XHX A;  5KTQ A;  2VG6 A;  2I7N A;  3L3V A;  2F8S A;  1P90 A;  3ZSV A;  2E6L A;  2OPP A;  4CHQ A;  3BZK A;  2Z1J A;  2P5G A;  3QBX A;  3MX2 A;  5F2R A;  5K14 A;  4BR9 A;  2QW9 A;  1QSL A;  4JK7 A;  4DB3 A;  1X3M A;  4F3T A;  1VQ6 N;  4CZI A;  3KK2 A;  3EKU A;  4BRP A;  4IKF A;  3FFK B;  4PL7 A;  3J7A P;  3RTV A;  2A41 A;  4Y1D A;  2KTQ A;  1SV5 A;  1U2V B;  2XY7 A;  3PX0 A;  4CJL A;  4B9N A;  3CCM N;  4LF6 K;  3O9R A;  1LWE A;  2ZWH A;  1KVA A;  3HL8 A;  1QQC A;  1S72 N;  3L3U A;  4HCB A;  1Q86 O;  4LF9 K;  2YNG A;  4EP5 A;  4PY5 A;  3PUF A;  3VEY A;  4FJ9 A;  2O8D B;  2FXU A;  4DR6 K;  4CBU A;  3THY B;  3LDN A;  3MWP A;  1WBB A;  4CEA A;  4N41 A;  4B1Y B;  3UIQ A;  2GEL A;  2HBL A;  4JI4 K;  3VEV A;  4DSI A;  1TKT A;  4DFP A;  3VF4 A;  4R5P A;  4CZL A;  1GLE G;  4KPY A;  2FF6 A;  1W9H A;  2ZJQ L;  3CJC A;  4CK1 A;  1BIU A;  2FBT A;  3NGY A;  2Y1I A;  3DXM A;  2P9K A;  2NUB A;  2AJQ A;  3KK7 A;  3OYK A;  4B1U B;  3NVM A;  4WF9 L;  2Q36 A;  3S3M A;  3E66 A;  4F2S A;  3KKR A;  4EZ6 A;  2XHB A;  3LAL A;  1HYS A;  1YXQ A;  2F9W A;  3QEV A;  2QEX N;  3AVH A;  3M8R A;  3OYC A;  3JAM O;  2FBX A;  1TKX A;  4NYN A;  1C1C A;  4O44 A;  3O9U A;  4LFA K;  1EXQ A;  3LAM A;  3C6T A;  3QFP A;  4DTP A;  1BQM A;  3UKR B;  4PWD A;  1BG3 A;  1BO5 O;  4IOX A;  4FVU A;  1K8K A;  5GIN A;  3TU5 A;  4FWS A;  1WLJ A;  1HNV A;  5GIO A;  4EZ9 A;  3NFA A;  1JLE A;  2IOC A;  4DU4 A;  3OS0 A;  3FLC O;  5KQD A;  3M8P A;  4BE0 A;  1BL3 A;  3K5M A;  5C12 A;  4BE1 A;  3PSF A;  1ASW A;  4CHP A;  1XNR K;  1NGD A;  4CZH A;  1J5O A;  1A5W A;  4O8U A;  4FLZ A;  1RDW X;  4Z4G A;  2QK9 A;  4FSV A;  4X66 K;  2O8F A;  4NLB A;  3PIO L;  2YHW A;  1ASU A;  4CGI A;  4W5T A;  4GKJ K;  2ZQB A;  2NRT A;  4OLB A;  3PSI A;  1SUQ A;  5AQR A;  1XMO K;  4DQR A;  5I3U A;  3SJH A;  4BGB A;  1SQK A;  1HNW K;  1WN7 A;  5GAH P;  2HF4 A;  1GOB A;  3AAQ A;  3QEX A;  2P9I B;  4YOT A;  1Y64 A;  1MWK A;  1HNZ K;  3QFU A;  1QZ6 A;  1S1W A;  4CHY A;  2FLO A;  4DR4 K;  4DLG A;  1RGI A;  1S1V A;  2QXF A;  2O8F B;  3CPW M;  3DI6 A;  5HL7 L;  2HHH K;  1WSE A;  1U45 A;  5T7B A;  1JXB A;  4GVM A;  5AQY A;  3GDQ A;  4B1X B;  1E3M A;  3K2P A;  3OVN A;  1VQN N;  3CIP A;  2HST A;  1S3X A;  1NOY A;  1E4F T;  3JSM A;  3TAE A;  5SZT A;  2UXD K;  3C6U A;  3VF6 A;  3AA2 A;  5AQP A;  4DTX A;  1JL1 A;  3NF6 A;  2YJE A;  4A61 A;  4B8A B;  1Q7Y O;  2A1S A;  3ID6 A;  3LWL A;  4K0K K;  1YUW A;  3BF3 A;  1WAJ A;  2E1Z A;  3GBT A;  3V1R A;  4IWV A;  4JLH A;  1WNS A;  4B3T K;  2BAN A;  1P8Z A;  2O8C A;  2QTD A;  3R3L A;  3DWL A;  2PYJ A;  4KHU A;  1DLO A;  1FXX A;  1IJJ A;  1NK6 A;  3G0Z A;  1W97 L;  2E20 A;  1NMD A;  3C6A A;  2KZM A;  3PO5 A;  4DTJ A;  3O4Q A;  1C0U A;  1VQ4 N;  2W6K A;  3QET A;  4AF1 A;  1VHX A;  4YOY A;  2YHB A;  1X1P A;  2F9T A;  3SBT A;  1YJW N;  4FLX A;  3LPU A;  1U47 A;  2KW4 A;  1NKC A;  2JWK A;  1OH8 A;  4BAC A;  1BOT O;  4OPA A;  1K8K B;  5E84 A;  4C23 A;  2HNZ A;  4DHY A;  3O9Q A;  4CZJ A;  2D4W A;  1HMV A;  3CYM A;  2D0B A;  2F96 A;  5J2N A;  1UWB A;  1ZBH A;  3VQ7 A;  3EYZ A;  3QER A;  4MO5 A;  5LJW A;  5AFU A;  4CHN A;  3RMC A;  3S3N A;  2EHG A;  1T6D A;  3MXM A;  1NGE A;  2RKI A;  3AV9 A;  5C24 A;  3LP0 A;  1VAZ A;  3OYH A;  2IAJ A;  3MCA B;  3V9W A;  4ELU A;  5AQQ A;  3IG1 A;  1NGF A;  2E2P A;  4BRI A;  3N4Q A;  4J2E A;  5KPR A;  1NOZ A;  5BPM A;  4ZTF A;  2P9S A;  5CZ2 A;  3SV3 A;  3I55 N;  4CGJ A;  1TUY A;  3DAW A;  1BDG A;  1FKP A;  1NGG A;  2FSK A;  3FZK A;  3C6H A;  4K42 A;  3R8E A;  2P9L A;  3VQ5 A;  3LWM A;  3OJS A;  2KQ2 A;  4KAZ A;  1J53 A;  1GLL O;  3HVT A;  3C94 A;  1RT3 A;  3IRX A;  1RFQ A;  3TTF A;  4JKD A;  3AO3 A;  3VF2 A;  2ZM6 K;  3VQC A;  1YAG A;  3KWG A;  3VES A;  1N32 K;  2OPR A;  1HJR A;  5DM7 L;  3NH0 A;  1EWR A;  3QBW A;  2P9N A;  3NBP A;  1Q81 O;  4R79 A;  2X6S A;  3KK1 A;  2YNF A;  2XO7 A;  2DY4 A;  2CH6 A;  1QHA A;  1YF5 L;  4CGG A;  3VQ6 A;  3MEC A;  4UQG A;  2O8E A;  2A40 A;  1VQM N;  1J54 A;  3T19 A;  1NJY A;  1CZA N;  3UB5 A;  1RTI A;  5BR8 K;  3QML A;  2OAN A;  2QM1 A;  4CZF A;  4JKG B;  4CK3 A;  4KTZ A;  3OYD A;  4JI0 K;  1QVG M;  3ULD A;  1O13 A;  2AP1 A;  4IO8 A;  1RDB A;  1Z6R A;  3NH1 A;  2O8B A;  2FF3 B;  1X9W A;  2QKB A;  4FWN A;  3K5O A;  4FJN A;  2E1Y A;  2YKM A;  3FZF A;  4MO4 A;  3HPO A;  4BRF A;  1O1W A;  2E2O A;  2OYQ A;  4HUF A;  4JKG A;  1Y97 A;  3AA5 X;  2E5L K;  3C95 A;  1JJ2 M;  3K9J A;  3OYL A;  2HHT A;  1REV A;  1XHZ A;  1SL1 A;  2YV0 X;  2OPQ A;  4KTQ A;  2A5X A;  4KHN A;  4A2A A;  2OZS A;  3IDH A;  5HLF A;  4C8N A;  3VQA A;  4H03 B;  3A5M C;  3ITH A;  3AVI A;  3R6M A;  1ILY A;  1R0A A;  3JYT A;  3OY9 A;  3AO5 A;  4OKE A;  3EN9 A;  2ZGZ A;  1VSM A;  4OPH A;  3CCV N;  4DFM A;  2HW3 A;  3E9O A;  5EU7 A;  3ZET B;  1C0T A;  1XQS C;  3QLH A;  4FWP A;  3TAM A;  3SAH A;  3ZSQ A;  5GIP A;  2HF3 A;  1HLU A;  1TYQ A;  4DV5 K;  3CHW A;  4FK0 A;  4J2A A;  4GKK K;  4EIA A;  4YNQ A;  3EE8 A;  2P9U A;  1H1V A;  1NJX A;  3VQ4 A;  4DR3 K;  1EO1 A;  2HHV A;  1L3T A;  2FSJ A;  3CM6 A;  3LL3 A;  4MQ3 A;  5M1N A;  3WXM B;  3HSC A;  4DFJ A;  5F1X A;  2G8U A;  1B92 A;  3W3D A;  2DFH A;  3Q7B A;  3P31 A;  4KTW A;  4KHS A;  2Q2R A;  1RT1 A;  1ZBF A;  2BUP A;  2P1J A;  5AQW A;  1RBU A;  3CXC M;  3T69 A;  1HYZ A;  4FPA A;  1C0F A;  3MN6 A;  4ILG B;  3CFP A;  3K58 A;  5I9E B;  3PY8 A;  3V1O A;  5C0Y A;  4FW1 A;  3MXJ A;  1WOQ A;  4DR7 K;  3VEW A;  2UUB K;  4JS5 A;  2ASP A;  5JIC A;  1RNH A;  4NCG A;  4ISG A;  3F2K A;  1ATN A;  1VQ8 N;  1S9E A;  3OS2 A;  3M6G A;  3SBG A;  4XH4 A;  2HMP A;  3CJ1 A;  4CD3 A;  4AHT A;  4BRG A;  4M3Y A;  1ATR A;  4X64 K;  2E6M A;  3GE1 A;  3ZX0 A;  1NK9 A;  4OKJ A;  3T1A A;  3VEZ A;  3BZC A;  3BY5 A;  1IG8 A;  2YHA A;  1YVU A;  4M45 A;  5EOY A;  4CFC A;  4WE1 A;  1OH5 A;  1HKC A;  1IH7 A;  4CFB A;  2VWB A;  4FO0 A;  1DEJ A;  4DQI A;  5E41 A;  3B6P A;  1BIZ A;  4BVP A;  4FJK A;  1NGJ A;  3T1Y K;  1W7A A;  1N8R O;  4F4K A;  5AQI A;  3S9H A;  4KV8 A;  4CZE A;  3H6E A;  4B1W B;  4E89 A;  4KBO A;  1IG9 A;  3E9P A;  1QHT A;  2QKK A;  2BH1 A;  4JI6 K;  3CC2 N;  1RCH A;  4O5F A;  3ZX2 A;  1IBM K;  2UXB K;  3NMU A;  3ID8 A;  3CJ9 A;  1RT2 A;  3TPQ A;  4BR5 A;  1QQN A;  3AGK A;  3MX5 A;  2IIR A;  4BRA A;  4I6M A;  4OLA A;  2HHQ A;  4BG8 A;  4HUG A;  3A5L C;  3B6O A;  2HHU A;  1NJW A;  2ZD1 A;  3WNE A;  2KKZ A;  3AVK A;  4PKH A;  2CGK A;  5HBM A;  4KI4 A;  3CJB A;  2W6L A;  2B5J A;  1HKG A;  1S9G A;  4O0J A;  3RMA A;  3IFR A;  3TAG A;  4CJU A;  4EP4 A;  1BA1 A;  4F2R A;  4OPJ A;  1VQ9 N;  1SZ2 A;  3E1Y A;  4FJ7 A;  4JI2 K;  3SMP A;  2NRZ A;  3KTQ A;  1VSK A;  1K8A O;  4FM2 A;  4K41 A;  3CQ8 A;  1IKY A;  3TAF A;  1S1T A;  4M7Y A;  3J81 O;  3MDQ A;  3R1X A;  2GUI A;  4DQP A;  4CE9 A;  4BWM A;  2P5O A;  5CY4 A;  4ISE A;  4CJW A;  4LY7 A;  5BRH A;  1S6Q A;  3J80 O;  3RR8 A;  3F9K A;  3FGU A;  4DV1 K;  4PL8 A;  5C15 A;  3NF9 A;  3ZEU A;  4JD2 B;  4FLT A;  4OGC A;  4B9M A;  4YY3 K;  4IJN A;  2HMI A;  1UOC A;  4F3O A;  3U4L A;  3SUP A;  1S5J A;  3QDK A;  1KVC A;  2WUS A;  1NK7 A;  1NU0 A;  4WCE L;  1U49 A;  3HJF A;  3DLG A;  3V1Q A;  4CEQ A;  1T03 A;  3BEX A;  1KFD A;  2QWQ A;  4BRK A;  3K9K A;  2DPN A;  3V6D A;  1RTD A;  1KSP A;  3SLC A;  2FC0 A;  1NWK A;  2YHY A;  3J8A A;  3B8A X;  3T3F A;  4CEZ A;  3HPG A;  4MLH A;  4XH5 A;  1VSJ A;  3R9P A;  4BRM A;  4CBX A;  2D0C A;  2WBN A;  2IC3 A;  3OBY A;  4A5B A;  3DXM B;  4E19 A;  1GOC A;  3KLI A;  1ZBS A;  5M1Q A;  1TAU A;  4CJF A;  4CJQ A;  3UE5 A;  3D2E B;  5FPD A;  5AJ3 K;  1WSF A;  3ZSW A;  3P83 D;  4WFN L;  4CF9 A;  4DF8 A;  3DYA A;  4JKC A;  5C25 A;  1ZC6 A;  2X78 A;  2YHX A;  4MLE A;  3F73 A;  3RMD A;  4AHV A;  4ELT A;  4Z4I A;  1SL2 A;  5EX5 A;  1OH6 A;  2G8H A;  3OYI A;  2P9P B;  4LFB K;  4JRP A;  3G25 A;  1X3N A;  3THY A;  2NRH A;  4C1N K;  1TKZ A;  1KD1 O;  2GEM A;  2G8F A;  3HP6 A;  2IS3 A;  4FJL A;  4IEE A;  2QA4 N;  3I33 A;  3DLR A;  3TSP A;  3NVK A;  4BC3 A;  3ENO A;  4JI3 K;  4W5R A;  1DKG D;  4RW4 A;  3CI5 A;  3LAN A;  1KLM A;  2A3Z A;  3PV8 A;  3DLL L;  4B9T A;  1L3U A;  2UU9 K;  3SCX A;  3C0B A;  1GLC G;  3FR0 A;  4WQ5 C;  2NNW A;  4O55 A;  3HVR A;  4FK4 A;  3PLA A;  4H5W A;  1WAF A;  3O3H A;  4C8L A;  3DLH A;  1RIL A;  4DSF A;  1RBT A;  4DLE A;  4BQZ A;  2FSN A;  2GUP A;  4FJX A;  4BWJ A;  3AVA A;  5CYQ A;  1NK5 A;  2F8T A;  3L2Q A;  1GLJ O;  1CZB A;  1IBL K;  3THW B;  3EE9 A;  1TL1 A;  2V51 B;  4UY8 O;  4DV0 K;  4CJK A;  3KD1 E;  1Q82 O;  3OW2 M;  3THX A;  4FL9 A;  3I0S A;  1D9F A;  4KB1 A;  4IG3 A;  4KKO A;  3MXI A;  1QTM A;  2GWK A;  5HOO A;  1QE1 A;  2ZF5 O;  3ZT3 A;  1JCE A;  2VGN A;  1M90 O;  3VN5 A;  2G8K A;  4I9L A;  4DUY K;  4QAG A;  5AZJ A;  3SPY A;  1VQO N;  5FPN A;  3J7Y P;  4M3W A;  1QZ5 A;  3DRS A;  1L3V A;  4JV5 K;  4FOI A;  1TK0 A;  2ASM A;  4CEE A;  4LSN A;  4DQS A;  3JXU A;  4DG1 A;  5KRT A;  5HRS A;  1XI1 A;  4LFC K;  1IKV A;  2HB5 A;  3O4N A;  3FZH A;  5KI6 A;  4MDB A;  1VSF A;  4CZK A;  4DV3 K;  5BRF A;  3TAP A;  2HVH A;  1JLC A;  2RHK A;  3OHR A;  4YOV A;  2PY5 A;  1MWM A;  1TV6 A;  4IFV A;  3OYM A;  4AM6 A;  1I3A A;  1BI4 B;  3HT3 A;  3ZSX A;  5JVH L;  1BHL A;  3AA4 A;  3TAQ A;  3MK6 A; 
#chains in the Genus database with same CATH homology
 3AO1 A;  3OS1 A;  1RTI A;  5FRO A;  4AHC A;  4DTU A;  1KVB A;  1TAQ A;  3QNN A;  3CM5 A;  4Z4C A;  3DRR A;  3DM2 A;  4TSX A;  4CK3 A;  3ALY A;  4KTZ A;  3OYD A;  4B3O A;  3ULD A;  1LWC A;  3TR8 A;  3ZSR A;  1BI4 A;  1D5A A;  4HVJ A;  3QEI A;  1T7P A;  2OZM A;  1K6Y A;  1U04 A;  1RDB A;  4L8R B;  1IO2 A;  2ETJ A;  3NH1 A;  3LP2 A;  3L2W A;  4B9L A;  3WNF A;  1X9W A;  1FKO A;  2ZE2 A;  2QKB A;  4FJI A;  3K5O A;  4Z0U A;  1L3S A;  4DTR A;  3VA0 A;  4FJN A;  3MAQ A;  4LD0 A;  3HPO A;  2YKM A;  4CK2 A;  1O1W A;  4KO0 A;  3MED A;  2OYQ A;  3LAK A;  4HUF A;  4DTS A;  4DSL A;  1Y97 A;  1TL3 A;  4CCH A;  4E7L A;  3NGI A;  3AA5 X;  4GMJ B;  4M3T A;  1EP4 A;  4E0D A;  3C95 A;  5KGW A;  3OYL A;  2HHT A;  2DTU A;  1REV A;  3NGZ A;  4JS4 A;  1B9F A;  2XY5 A;  2YV0 X;  2OPQ A;  3BGR A;  4H4O A;  1XHZ A;  1SL1 A;  4KTQ A;  1WSH A;  4KHN A;  2OZS A;  3SUQ A;  4CFD A;  5HLF A;  4C8N A;  2YNI A;  3VQA A;  4OGE A;  2HHW A;  3ITH A;  4I9Q A;  4FJM A;  1HNI A;  1JXE A;  3AVI A;  1ZBL A;  3S3O A;  4E1N A;  3ZT2 A;  3K57 A;  1R0A A;  4RG8 A;  3JYT A;  3OY9 A;  4E3S A;  1SKS A;  3AO5 A;  4OKE A;  3RR7 A;  1JL2 A;  3DOK A;  1VSM A;  4FW2 A;  1RT4 A;  2YKN A;  4CEF A;  4DFM A;  1TK5 A;  2HW3 A;  3K5L A;  4DU3 A;  5FRM A;  2HHS A;  1VSE A;  5EU7 A;  1T05 A;  5DMR A;  1RT6 A;  1C0T A;  1WSJ A;  3QIN A;  3QLH A;  3TAM A;  4DQQ A;  1CLQ A;  2W42 A;  3ZSQ A;  3PX4 A;  3U3Y A;  3P5J A;  4ICL A;  3KLE A;  3SQ4 A;  4FZX C;  4K8Z A;  4RW7 A;  4H8K A;  2G8V A;  1UAX A;  4FM1 A;  3U6F A;  5HRR A;  4CGH A;  3KK3 A;  4B9U A;  4FK0 A;  4J2A A;  3KLF A;  4OPK A;  4YNQ A;  4FVM A;  4GW6 A;  4MFB A;  4CJE A;  3LZJ A;  4FCY A;  1BCM A;  4CEB A;  1X9M A;  3KD5 E;  4KRE A;  1NJX A;  5J2M A;  1HRH A;  3VQ4 A;  4KHY A;  3ZT0 A;  2HHV A;  4CF1 A;  2D5R A;  4CGD A;  1L3T A;  2KFN A;  3ZSZ A;  3TAB A;  3CM6 A;  4MQ3 A;  1CXQ A;  4FZZ A;  4DFJ A;  3I0R A;  1HQU A;  4CEC A;  1SL0 A;  2KZZ A;  4FLU A;  4M3Z A;  1KCF A;  4CED A;  3L2R A;  3NDK A;  4AIL C;  1B92 A;  2DFH A;  1HYV A;  3HP9 A;  2G8U A;  3DLB A;  4KTW A;  1ZBU A;  4KHS A;  1JLQ A;  4FZY A;  1RDC A;  1RT1 A;  1W0H A;  1ZBF A;  5J1E A;  4PUO A;  1SKW A;  2XRI A;  1QSS A;  2P1J A;  2EX3 A;  4C8K A;  1RBU A;  1RTJ A;  1XHX A;  5KTQ A;  1HYZ A;  1RBV A;  3IAY A;  2VG6 A;  4B9V A;  3I8D A;  4KRF A;  3L3V A;  3CFP A;  2F8S A;  4FXD A;  3K58 A;  3ZSV A;  1S1X A;  2E6L A;  2OPP A;  4CHQ A;  2RPI A;  2WON A;  2Z1J A;  3V9X A;  1NK4 A;  3V1O A;  1KRP A;  4FW1 A;  3PY8 A;  2P5G A;  3MXJ A;  4I2P A;  4Y1C A;  5K14 A;  5CYM A;  4JS5 A;  1NJZ A;  1DTQ A;  1TK8 A;  1UA1 A;  1QSL A;  3BDP A;  3SNN A;  1JKH A;  4NCB A;  4NYF A;  1RNH A;  3QIO A;  4NCG A;  2WOM A;  3L8B A;  3V9S A;  4F3T A;  3KK2 A;  4RW6 A;  2GV9 A;  3VA3 A;  2ITG A;  5JS2 A;  3QES A;  4BDP A;  4C8O A;  1S9E A;  4IKF A;  4CJ4 A;  3RTV A;  3OS2 A;  4FYD A;  3M8S A;  4Y1D A;  3L2V A;  4BDZ A;  2KTQ A;  1HQE A;  4RW9 A;  1SV5 A;  2XY7 A;  3PX0 A;  4CJL A;  1JLB A;  4B9N A;  2DFF A;  4AHT A;  4LH4 A;  1CZ9 A;  1X9S A;  4M3Y A;  1LWE A;  2E6M A;  3FFI A;  3MEG A;  1NK9 A;  4OKJ A;  3T1A A;  3RWU A;  1KVA A;  3HL8 A;  1ZBI A;  4FK2 A;  1QQC A;  1YVU A;  2YHA A;  4QOZ B;  1F21 A;  3NE6 A;  1TVR A;  4W5Q A;  3L3U A;  3DLK A;  3DOL A;  4M45 A;  4HCB A;  1Q9X A;  2A1R A;  4CFC A;  2O4G A;  4WE1 A;  3EY1 A;  4M3U A;  1VSL A;  4ZTJ A;  3KIO A;  2YNG A;  1LW2 A;  1IH7 A;  4EP5 A;  4PY5 A;  4CFB A;  3PUF A;  1SKR A;  1N5Y A;  4FJ9 A;  4DQI A;  5E41 A;  2BE2 A;  3AVJ A;  1BIZ A;  3B6P A;  4FJK A;  1XWL A;  3SUO A;  4F4K A;  4M42 A;  3NF8 A;  4CJP A;  1UA0 A;  3S9H A;  3H08 A;  4KV8 A;  4CHO A;  1S6P A;  4E89 A;  3VQP A;  1S1U A;  1U48 A;  4CEA A;  4N41 A;  1IG9 A;  3VQQ A;  4CIG A;  3THV A;  2FBV A;  3UIQ A;  1VSH A;  1QHT A;  2QKK A;  4DSI A;  1TKT A;  1RCH A;  4DFP A;  4ZHR A;  3KLH A;  5CZ1 A;  4FJ8 A;  1EX4 A;  1A5V A;  1IKW A;  1RT2 A;  3E01 A;  4R5P A;  4CJV A;  2BDP A;  4M3R A;  4DSJ A;  4KPY A;  3LPT A;  1D8Y A;  1W9H A;  1YT3 A;  3QO9 A;  4AHS A;  4CK1 A;  1BIU A;  2FBT A;  3NGY A;  2Y1I A;  3KLG A;  4OLA A;  4DS5 A;  3K59 A;  3VQE A;  2HHQ A;  2NUB A;  2AJQ A;  4HHT A;  4HUG A;  3B6O A;  3OYK A;  4FLY A;  3V4I A;  2HHU A;  3AA3 A;  1NJW A;  2ZD1 A;  3WNE A;  4FJH A;  1Q9Y A;  1RT7 A;  3SZ2 A;  3S3M A;  3QEP A;  4F2S A;  3KKR A;  3AVK A;  4EZ6 A;  3TWH A;  2XHB A;  3LAL A;  3NF7 A;  5HBM A;  1NK8 A;  4KI4 A;  1HYS A;  2D0A A;  2B5J A;  4J2D A;  4I2Q A;  1S9G A;  2RN2 A;  4O0J A;  3QEV A;  3RMA A;  3AVH A;  3TAG A;  4CJU A;  3OYC A;  5KGX A;  4EP4 A;  3M8R A;  4KHW A;  2FBX A;  4CER A;  4DU1 A;  4F2R A;  4OPJ A;  2JLE A;  1TKX A;  3P1G A;  1C1C A;  4NYN A;  3SQ0 A;  4O44 A;  3IS9 A;  3ZSY A;  1EKE A;  1HPZ A;  5KRS A;  4FJ7 A;  1EXQ A;  3LAM A;  3C6T A;  4DTM A;  4DTP A;  4DWI A;  1GOA A;  1BQM A;  1WSG A;  3AO4 A;  4CF2 A;  4PWD A;  2RF2 A;  3KTQ A;  1VSK A;  1C1B A;  4FM2 A;  1KTQ A;  3PX6 A;  3CQ8 A;  4CJR A;  3OYF A;  3QEW A;  1IKY A;  3TAF A;  1WLJ A;  1HNV A;  3OYA A;  1KFS A;  3NFA A;  2IOC A;  1JLE A;  4DU4 A;  4EZ9 A;  3ISN C;  3OS0 A;  1S1T A;  4E7H A;  3HYF A;  2E4L A;  3M8P A;  3SQ2 A;  4BE0 A;  1BL3 A;  3K5M A;  4BE1 A;  2X74 A;  1ASV A;  1RBR A;  3LDS A;  4CJ5 A;  1ASW A;  4CHP A;  4FLW A;  2GUI A;  3WNH A;  4DQP A;  4CE9 A;  4IFY A;  4BWM A;  1J5O A;  1A5W A;  3O3F A;  2OA8 A;  2P5O A;  5FRN A;  5CY4 A;  1Z25 A;  4CJW A;  4LY7 A;  4PA1 A;  4FLZ A;  1S6Q A;  4Z4G A;  2QK9 A;  1LWF A;  3RR8 A;  4CEO A;  2Z1H A;  1J9A A;  3F9K A;  4Q5V A;  3QIP A;  4DFK A;  3M8Q A;  4G1Q A;  5HP1 A;  4CGF A;  1ASU A;  4CGI A;  4O0I A;  4W5T A;  2ZQB A;  3NF9 A;  4OLB A;  4CFA A;  4CJS A;  1SUQ A;  1WSI A;  4FLT A;  1BIS A;  5C42 A;  4O4G A;  4OGC A;  4DQR A;  5I3U A;  4B9M A;  4DSK A;  1WN7 A;  4DMN A;  5J2P A;  2HMI A;  3SV4 A;  1UOC A;  4OJR A;  3OYJ A;  4F3O A;  1GOB A;  3SUP A;  3QEX A;  1S5J A;  3D45 A;  4E7J A;  3VQB A;  1KLN A;  2FBY A;  1KVC A;  5HRO A;  1S1W A;  4CHY A;  1NK7 A;  3ZSO A;  1U49 A;  3HJF A;  3AVN A;  3DLG A;  2IGI A;  1ZYQ A;  4FJG A;  1C6V A;  3LP1 A;  1QS4 A;  2X6N A;  3V1Q A;  5SWM A;  4CEQ A;  4H4M A;  4DLG A;  1S1V A;  4E7I A;  1LAW A;  1T03 A;  3DLE A;  1IKX A;  2QXF A;  1KFD A;  3DI6 A;  2B4J A;  2XY8 A;  1WSE A;  2G8W A;  3V6D A;  2ATQ A;  1U45 A;  1RTD A;  1KSP A;  5T7B A;  3SYZ A;  4AHU A;  4DSE A;  4DTN A;  3HK2 A;  4E1M A;  2FC0 A;  1TKD A;  1JXB A;  3CFO A;  4GVM A;  2OPS A;  1B9D A;  3HST B;  5HRP A;  4CEZ A;  3T3F A;  3HPG A;  2HHX A;  1RTH A;  1VSJ A;  3K2P A;  3OVN A;  2GBZ A;  4CIF A;  2D0C A;  4LH5 A;  2HVI A;  1NOY A;  3JSM A;  4IG0 A;  3TAE A;  2IC3 A;  5SZT A;  1T8E A;  3C6U A;  2R7Y A;  1C0M A;  1JLA A;  3AA2 A;  3VQ9 A;  3SI6 A;  3NCI A;  4E19 A;  4DTX A;  5HRN A;  1GOC A;  3CG7 A;  1VRT A;  3KLI A;  1JL1 A;  3NF6 A;  4B8A B;  4ID1 A;  4W5N A;  1TAU A;  2A1S A;  4LSL A;  4CJF A;  3SUN A;  4CJQ A;  4BE2 A;  4BDY A;  3LWL A;  2I5J A;  1WSF A;  1Z26 A;  3ZSW A;  3P83 D;  4HUE A;  1BGX T;  4XIU A;  3AVC A;  2HND A;  4CF9 A;  4DF8 A;  5J2Q A;  1WAJ A;  4HCC A;  3HPH A;  3DYA A;  1RBS A;  5C25 A;  1LW0 A;  3SPZ A;  2X78 A;  3V1R A;  3F73 A;  4JRQ A;  1QSY A;  3RMD A;  4AHV A;  2HNY A;  4JLH A;  4ELT A;  1WNS A;  4Z4I A;  1SL2 A;  3RRH A;  1ITG A;  2G8H A;  4O5B A;  3OYI A;  3NAE A;  2BAN A;  4JRP A;  2G8I A;  4CF8 A;  1TKZ A;  2LSN A;  3VQ8 A;  1FK9 A;  4CF0 A;  2G8F A;  4F8R A;  4FLV A;  3HP6 A;  2IS3 A;  4FJL A;  2PYJ A;  2VG5 A;  4KFB A;  4KHU A;  1DLO A;  3WNG A;  3DRP A;  1FXX A;  4FJ5 A;  2VWJ A;  3DLR A;  4B8C A;  2JGU A;  3TI0 A;  4YFU A;  1NK6 A;  1VRU A;  4W5R A;  3G0Z A;  4RW4 A;  3OJU A;  3U3G A;  3D0P A;  3LAN A;  1KLM A;  4CJ3 A;  3KJV A;  4DF4 A;  4I7F A;  2XY6 A;  3PV8 A;  3AVL A;  1A5X A;  1L3U A;  4B9T A;  2DFE A;  1NKB A;  2KZM A;  1LAV A;  3AVF A;  5D3G A;  3VQD A;  3SCX A;  3PO5 A;  4W5O A;  4DTJ A;  3O4Q A;  4IDK A;  2VG7 A;  1Q8I A;  4O55 A;  3HVR A;  1C0U A;  4FK4 A;  1RT5 A;  3EZ5 A;  3QET A;  3AVB A;  4M41 A;  2YHB A;  3V9Z A;  1X1P A;  4CIE A;  1WAF A;  3O3H A;  3L2U A;  4N56 A;  4FM0 A;  3DLH A;  3OYG A;  4C8L A;  5JS1 A;  1RIL A;  4FLX A;  4DSF A;  3LPU A;  3K5N A;  3NHG A;  1RBT A;  5FDL A;  4DLE A;  3TAN A;  1U47 A;  1JLG A;  4PQU A;  2KW4 A;  3A2F A;  3ZT1 A;  1NKC A;  3RRG A;  4B9S A;  4J2B A;  4FJX A;  4BAC A;  4CHZ A;  4HTU A;  3CFR A;  4BWJ A;  3AVA A;  3OYE A;  2HNZ A;  2P51 A;  2YNH A;  4B08 A;  5CYQ A;  1HMV A;  3CYM A;  4CJT A;  1NK5 A;  2D0B A;  2B6A A;  2F96 A;  1UWB A;  5J2N A;  4NCA A;  4KHQ A;  2F8T A;  1D9D A;  3L2Q A;  1CXU A;  1U4B A;  4KI6 A;  4N5S A;  1ZBH A;  1CZB A;  3VQ7 A;  3HM9 A;  3EYZ A;  3QER A;  3LP3 A;  4Z4E A;  4OKK A;  3AO2 A;  4CHN A;  1TL1 A;  3RMC A;  3S3N A;  2EHG A;  3PO4 A;  2O4I A;  2Z1I A;  2IDO A;  4CJK A;  3KD1 E;  4AHR A;  1VK0 A;  3MXM A;  2RKI A;  3HO1 A;  1YTU A;  3AV9 A;  1VSD A;  1N6Q A;  5C24 A;  2PYL A;  3AVG A;  3HXM A;  4DS4 A;  3LP0 A;  3OYB A;  3AVM A;  3OYH A;  2IAJ A;  3I0S A;  1D9F A;  3V9U A;  3V9W A;  4ELU A;  3OYN A;  2Z1G A;  3DMJ A;  3IG1 A;  3QNO A;  4IBN A;  4DTO A;  3SJJ A;  4KB1 A;  4N76 A;  4CES A;  1C1A A;  4J2E A;  1NOZ A;  4ZTF A;  1L5U A;  3NH2 A;  1RDA A;  4IG3 A;  5CZ2 A;  4KKO A;  3MXI A;  1QTM A;  3SV3 A;  1QE1 A;  4CGJ A;  3ZT3 A;  3ASM A;  1FKP A;  3LZI A;  3ZCM A;  4K8X A;  4Z4F A;  3VN5 A;  4Q0B A;  4N47 A;  3V81 A;  2G8K A;  1DTT A;  4I9L A;  2PZS A;  1I39 A;  3VQ5 A;  3ZT4 A;  3LWM A;  4QAG A;  3RMB A;  4M3X A;  4QCL A;  3OJS A;  2Q3S A;  2KQ2 A;  4KAZ A;  3SPY A;  1J53 A;  3HVT A;  5I42 A;  4E7K A;  3KKS A;  4M3W A;  1VSI A;  3C94 A;  1RT3 A;  3DRS A;  3IRX A;  3SQ1 A;  1L3V A;  5DK5 A;  1TK0 A;  2VWK A;  3AO3 A;  4RW8 A;  4AH9 A;  4Z4H A;  3VQC A;  2BGG A;  3O3G A;  1XC9 A;  4CEE A;  4LSN A;  4DQS A;  2OPR A;  1LV5 A;  4DG1 A;  5KRT A;  1HJR A;  3TAR A;  2KFZ A;  3NH0 A;  1YTA A;  5HRS A;  3G10 A;  1XI1 A;  1IKV A;  2HB5 A;  3O4N A;  2Y1J A;  3NBP A;  3KK1 A;  2X6S A;  2YNF A;  1JLF A;  5KI6 A;  1EET A;  1VSF A;  4C8M A;  2XO7 A;  2DY4 A;  1MU2 A;  3TAP A;  1NKE A;  1TGO A;  4OVL A;  4CGG A;  4ID5 A;  1JLC A;  3VQ6 A;  1BQN A;  2HVH A;  3MEC A;  2PY5 A;  4UQG A;  1NK0 A;  1TV6 A;  4IFV A;  3OYM A;  3HT3 A;  1I3A A;  1BI4 B;  1BCO A;  1G15 A;  3MEE A;  3ZSX A;  1RDD A;  1BHL A;  4KB0 A;  1J54 A;  3AA4 A;  3TAQ A;  3T19 A;  4FJJ A;  1NJY A;  4ELV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...