1WSJA

Crystal structure of e.coli rnase hi active site mutant (k87a/h124a)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKARGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGAAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
source organism Escherichia coli
molecule tags Hydrolase
total genus 50
structure length 155
sequence length 155
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2004-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1wsjA00
3OYLA 1NJYA 3OJUA 3V9SA 1RTHA 3L2VA 2DFFA 3AVMA 4EP5A 1TAUA 4GMJB 3VQ6A 5J1EA 4PUOA 1Q8IA 3O3HA 4FJHA 1RILA 4CFBA 4KTQA 4C8NA 3PX0A 1NJZA 1D9FA 2DY4A 4KI4A 4O4GA 2DTUA 1C0UA 1WSHA 1NKEA 3BDPA 3VQEA 4ELVA 4PY5A 4M41A 4DTOA 1TV6A 3AA3A 3ZSQA 4EP4A 1RTIA 4BDPA 4CGGA 3NHGA 4JLHA 1IKVA 3NBPA 3C94A 3RR8A 3VQ4A 4FM1A 4E0DA 3EZ5A 1XHXA 4B9TA 5D3GA 1RDBA 4FVMA 1BI4B 1CXQA 4DQRA 2OPSA 1K6YA 1KVCA 4WE1A 4GW6A 2ZD1A 4FJLA 4EZ9A 4CFAA 2IC3A 1WNSA 2VG7A 4I2QA 3V9ZA 2HNZA 3E01A 3SQ2A 1XC9A 4NCGA 4DU3A 4Z4FA 3PX4A 2PY5A 4NYFA 4F3TA 3QEXA 1G15A 3O3GA 2Z1HA 2B4JA 4RW9A 4YNQA 1RT7A 4Z4IA 3I0SA 4KTWA 1Y97A 4B8CA 3L8BA 4JS4A 3MAQA 1ZYQA 1NK0A 3CFOA 2JLEA 1ZBIA 3MEEA 2OPPA 5KI6A 4FJJA 5DK5A 3SUOA 5HBMA 4CF9A 2Y1JA 3K5LA 1T03A 4B9LA 2ETJA 5KGWA 4H8KA 1JLFA 2FBTA 5JS2A 4FW1A 4FM2A 4DSFA 3OYMA 3V81A 4DSKA 4W5TA 3KD1E 4F2SA 1R0AA 3HL8A 4FK2A 3JYTA 4J2EA 1DTTA 4IDKA 3F9KA 1KFSA 4FJKA 1D8YA 1U49A 1LAWA 3QO9A 4E89A 4AH9A 4J2DA 3OS1A 4RW6A 3KLEA 3M8RA 3TABA 1NK9A 2QKKA 1HMVA 1TKTA 1ZBUA 4FLYA 4K8XA 4ZTJA 1S1WA 3CYMA 3LDSA 4KRFA 3OYJA 1WSJA 1J54A 4CEDA 4CJ4A 1I3AA 3C6TA 3VQCA 3ZT4A 4FJ5A 1S6PA 1S1TA 3AA4A 2XY7A 4CJKA 2XY8A 5I3UA 3PY8A 4M3YA 4IG0A 3M8SA 3AVNA 4W5NA 1RT2A 3ZT1A 5CYMA 3LWLA 4BE0A 3SNNA 4Z4HA 2G8FA 2A1RA 4KHQA 4XIUA 1CLQA 2HHSA 4B9NA 4C8MA 1NJWA 2HHWA 1S1VA 2DFHA 3AV9A 1S9EA 3VQQA 5T7BA 3I8DA 1BQNA 1HJRA 1LWEA 1VRTA 3PO5A 4CIFA 1SL2A 3ISNC 2G8KA 1RBVA 1BCOA 1JL2A 1I39A 1VSLA 5J2QA 1RBUA 4M3RA 3QNOA 4O5BA 3H08A 4CF2A 3ZSYA 5J2NA 1JLEA 1XHZA 1BL3A 1RT3A 1TL1A 3V1RA 1TAQA 4B3OA 4B9SA 4J2BA 2G8VA 2HVIA 1SKWA 3VQ5A 1CZBA 3U6FA 3D45A 4FXDA 2F96A 2YNIA 3AVIA 2YNFA 1VRUA 4CJLA 2D0BA 2I5JA 3RR7A 3QEWA 3OS0A 2YKMA 3LPUA 1IKXA 4DQIA 4CK3A 2YKNA 4CJSA 3HT3A 4DTMA 4I9LA 4DQQA 1KVAA 1U04A 1D9DA 3LP3A 4CFDA 1A5VA 1GOAA 4CJUA 3AVLA 4FLUA 3NCIA 3V9WA 4FJIA 1TL3A 5FRNA 4HCCA 2D0AA 3CG7A 1IH7A 1J53A 3O4NA 3VQ8A 3KLIA 4CHQA 3D0PA 3SQ0A 1SUQA 2YHAA 4FW2A 4ID1A 1KCFA 1XI1A 4CF1A 3TAEA 4B9VA 4F3OA 4OJRA 1NK5A 3HVRA 1X9SA 1Q9YA 1C6VA 3S3NA 2KTQA 5HRRA 1TK5A 1DLOA 3OYHA 4OLAA 4CFCA 2G8HA 1EX4A 4DQSA 4I7FA 5J2MA 3WNHA 1U45A 4KTZA 5JS1A 2VWKA 4DQPA 3HJFA 1NK6A 4FZZA 2X78A 3ULDA 1Z26A 2O4IA 4KFBA 1NOYA 1HYSA 3SJJA 4ID5A 2XHBA 4RG8A 1RDAA 2JGUA 4O0IA 4CGDA 3VN5A 1IG9A 4DG1A 3TAMA 1S9GA 3S9HA 2RPIA 1QE1A 4DSIA 1ZBHA 4DS5A 1EP4A 1EXQA 3SQ4A 4KHSA 3SV4A 1J5OA 4Z0UA 1CXUA 2XRIA 4KKOA 4LD0A 3V9XA 1HQUA 5E41A 1NKBA 2HB5A 1CZ9A 3ZSRA 2Z1JA 3LZJA 2X6NA 1LV5A 4ZHRA 2D0CA 2VWJA 2PYJA 4AHUA 2HHXA 4PWDA 2ATQA 3HVTA 1RBTA 3QEVA 3LP2A 4HHTA 3AVKA 4E7JA 4F4KA 2EX3A 1JLBA 5KRSA 1B9FA 1VSMA 2IS3A 1NK8A 2KFNA 2D5RA 4CEQA 1L3UA 4FJ7A 4E7IA 1VSDA 4R5PA 3AVAA 4AHCA 1JLQA 1ZBFA 3QLHA 5K14A 3ZCMA 3OYNA 3OYGA 1S6QA 1UA0A 1O1WA 3HYFA 4E1NA 3LPTA 4DLGA 4N56A 4C8LA 4IBNA 3U3GA 2VG6A 1A5XA 3EYZA 1LW2A 4FK0A 2B5JA 3THVA 4M3WA 1F21A 4FLTA 2X74A 3SZ2A 4BACA 4DTUA 2O4GA 1C1CA 1WLJA 3NAEA 3QEIA 2OPQA 5FRMA 4OKKA 4OKJA 1YT3A 4DSLA 4W5QA 2XY6A 2Z1GA 3TAQA 3WNEA 3V9UA 3AVFA 5SWMA 1RCHA 3KKRA 1WSIA 3MEGA 2XO7A 1TKDA 3KLGA 1YVUA 3DLKA 4B08A 2KZZA 4DTSA 4M3TA 3C6UA 2HMIA 3TWHA 1U4BA 2E6MA 5CYQA 3NF8A 2QKBA 3V1OA 3QESA 3UIQA 2FBXA 4CJWA 3V4IA 1HNVA 2P51A 3P1GA 3DLRA 4MQ3A 4DSEA 4H4MA 1HRHA 2YNGA 3ITHA 3NF7A 4CESA 1KSPA 3V1QA 1A5WA 4B9UA 4CF0A 2GV9A 1SL0A 2OZSA 4H4OA 4KV8A 1TK0A 1W0HA 4MFBA 1IKWA 4CJVA 3QETA 3MXIA 3LALA 1RTJA 4CHOA 3RRGA 5KRTA 4IKFA 1KFDA 1RT5A 1TKXA 1JXEA 3NGYA 3QIPA 1KVBA 4GVMA 3JSMA 3CFPA 4DF8A 1T8EA 1T05A 2PYLA 2OZMA 4CF8A 4CJEA 3SQ1A 4QOZB 5C24A 3L2UA 2ZE2A 4DU1A 5I42A 3TARA 1RT4A 3P5JA 3RMDA 3TAGA 4IFVA 4LY7A 1NJXA 2W42A 3TI0A 1BHLA 3AO2A 3NH2A 3OY9A 4HTUA 1FK9A 4FLVA 3KLHA 4CE9A 4E7HA 1UA1A 2HNYA 4CIEA 3HO1A 1S1UA 2GBZA 3VQBA 4B8AB 4CEBA 3MECA 4ZTFA 1L3VA 3CFRA 2KW4A 1NOZA 2RF2A 1SV5A 4CEFA 1KTQA 2G8WA 4CEZA 4FJNA 4CGFA 4CJQA 4OVLA 1HQEA 4KHUA 3QERA 3O4QA 4CJ3A 3L3VA 3O3FA 5EU7A 3HP9A 4F8RA 3QNNA 2P5GA 3OYIA 4CJPA 1T7PA 4Q0BA 3ALYA 4DFMA 1UWBA 4KB1A 2F8TA 1REVA 3TAFA 1VSHA 3G10A 4QAGA 4AHRA 2PZSA 1TVRA 4DSJA 3HXMA 2BANA 2ZQBA 3DLGA 2HW3A 1ASWA 3ZSOA 3WNFA 3LAMA 1FXXA 2HNDA 4OKEA 3AO5A 3S3MA 2FBYA 1RBSA 4KAZA 1BI4A 3MXJA 4OGCA 4M45A 5KGXA 1LWFA 1X9MA 3B6PA 4O44A 1WN7A 3L2WA 4CGJA 3F73A 3K5NA 4JRPA 3SYZA 4JRQA 3DRSA 5HROA 2AJQA 3PUFA 2BGGA 3ZT3A 4Q5VA 3SCXA 4C8KA 3CM5A 4Y1DA 4HCBA 4K8ZA 4CEEA 2IAJA 4RW4A 2G8IA 3NH0A 3AVBA 4FJXA 3LWMA 3IAYA 1MU2A 3NFAA 3T1AA 4KHYA 3VQ7A 4CEAA 3DOLA 3NGZA 2LSNA 4HUFA 1N6QA 4I2PA 4CJTA 3VA0A 2BDPA 4EZ6A 1NKCA 4QCLA 3AVJA 2XY5A 3PX6A 3AVGA 2NUBA 3VQDA 3L2RA 3EY1A 2HVHA 1Q9XA 1JLAA 2WONA 2EHGA 4BWMA 4CIGA 4CJRA 4BE1A 3I0RA 1QHTA 4KB0A 2WOMA 3HPGA 1EKEA 4N5SA 4DFKA 3TR8A 1RDDA 1KLMA 1IO2A 4O0JA 5SZTA 3L2QA 3ASMA 1RT6A 3P83D 3K5MA 1QQCA 1WAFA 1N5YA 3M8QA 4J2AA 4CK2A 1YTAA 3HP6A 1KRPA 4BE2A 4Z4EA 2B6AA 4G1QA 5HRNA 3CQ8A 3ZSWA 3VQ9A 3AA2A 4E3SA 1ASUA 2E4LA 3BGRA 3OJSA 4DF4A 4B9MA 4FJ9A 3KJVA 4PA1A 3OVNA 1BISA 1BIUA 1S1XA 4LSLA 3A2FA 2Z1IA 1HPZA 2OPRA 3AVCA 3B6OA 3ZSZA 4KO0A 4Z4CA 5KTQA 4DS4A 4KI6A 4DU4A 4CGIA 4KREA 1C1BA 3NF9A 4FLXA 1TK8A 3KK3A 2YHBA 1ASVA 3IG1A 3RRHA 4LH5A 1X9WA 3ZSXA 3AVHA 3OYDA 1JXBA 2IGIA 3K5OA 4OPKA 1BCMA 1C0TA 5FDLA 3LZIA 3LANA 4DFJA 3OYBA 3HPHA 3SUPA 1D5AA 4DTXA 4AILC 1C1AA 2X6SA 3WNGA 3MXMA 3G0ZA 4CJ5A 4HUEA 4HUGA 3DLHA 2HHTA 5CY4A 2BE2A 5C42A 1S5JA 1KLNA 4FJMA 1VSJA 2GUIA 1U48A 5C25A 4IG3A 4NCAA 1W9HA 4CK1A 3K57A 4L8RB 2IOCA 2FBVA 2Y1IA 4CEOA 4LH4A 4OGEA 1QSLA 2QXFA 3FFIA 4IFYA 1BGXT 3U3YA 4Y1CA 3SI6A 1RDCA 4FYDA 1VSIA 1QS4A 1XWLA 3HSTB 4ICLA 4O55A 3DLBA 4DTRA 4CERA 4M42A 1YTUA 1UOCA 3AO3A 4BDZA 2YV0X 4AHTA 1UAXA 4FJGA 3L3UA 4N41A 4N76A 4DWIA 4CHNA 3QEPA 4NCBA 4DTPA 2YNHA 3DRRA 1SL1A 2ITGA 3NH1A 1B9DA 3VQPA 1TGOA 2R7YA 1EETA 3RWUA 3OYAA 3LP1A 3SUNA 4CJFA 3IRXA 5CZ1A 1L5UA 3SPYA 1GOBA 1HYZA 3KIOA 3NE6A 4ELTA 1RBRA 3AA5X 3KD5E 4DFPA 2P1JA 4LSNA 4FK4A 1BIZA 1SKRA 1TKZA 4CHPA 4FM0A 1JLCA 4FZXC 2KZMA 3S3OA 3NDKA 3DI6A 2HHUA 5HRSA 2HHVA 3QINA 1J9AA 1LAVA 2RKIA 1RNHA 1VSFA 1U47A 3AO4A 3DYAA 3SUQA 1ZBLA 3KK2A 4OLBA 5HLFA 5HRPA 4TSXA 4AHVA 4I9QA 1RT1A 3OYFA 4W5OA 3LAKA 4KHWA 1HNIA 2HHQA 4E1MA 3OYCA 4BWJA 1NK7A 2DFEA 2OYQA 1RTDA 3ZT0A 4FCYA 3DRPA 1HYVA 4W5RA 5CZ2A 3VQAA 3K58A 3TAPA 3LP0A 1QTMA 2G8UA 3OS2A 4RW7A 4KPYA 1VSEA 1LWCA 3K59A 3PV8A 2RN2A 4CGHA 1WAJA 1B92A 1FKPA 4CCHA 4E7KA 1NK4A 1QSYA 3ZT2A 5HP1A 3CM6A 4PQUA 3RMCA 3OYKA 4E7LA 3AO1A 3SPZA 1IKYA 4CHYA 4N47A 3KKSA 3SV3A 1BQMA 3RMAA 5FROA 3KTQA 1WSEA 4M3XA 3DMJA 4FLWA 2KFZA 1X1PA 4HVJA 1JKHA 3NGIA 4E19A 4M3UA 3DM2A 5DMRA 4ELUA 1VSKA 3HM9A 4C8OA 1WSGA 4M3ZA 4KHNA 4FJ8A 1ITGA 3OYEA 4CECA 4RW8A 3HK2A 3RTVA 2Q3SA 2KQ2A 4F2RA 4DTJA 1L3SA 1GOCA 3VA3A 3IS9A 2P5OA 1DTQA 1LW0A 2VG5A 3KLFA 4DTNA 4UQGA 1SKSA 3DOKA 4CHZA 4FZYA 3HPOA 1Z25A 4NYNA 4FLZA 1WSFA 3C95A 4DLEA 3RMBA 1FKOA 1VK0A 3TANA 2F8SA 3QIOA 3T19A 1JLGA 2OA8A 1L3TA 4Z4GA 3KK1A 4DMNA 3M8PA 3MEDA 3ZSVA 4AHSA 3V6DA 1JL1A 4YFUA 5J2PA 3K2PA 1C0MA 4JS5A 4BDYA 3DLEA 3NF6A 2FC0A 3PO4A 1QSSA 2E6LA 2QK9A 2IDOA 2A1SA 4OPJA 3T3FA
chains in the Genus database with same CATH superfamily
2HOEA 3L2VA 3G71N 3AVMA 4EP5A 3VQ6A 5J1EA 4PUOA 3O3HA 3SBTA 4CFBA 4H0OA 1N36K 1Z05A 4C8NA 1D9FA 3CCJN 4O4GA 3BDPA 4PY5A 3AA3A 3CMAN 1RTIA 3OHRA 1XNQK 1HJOA 4DV2K 5F0XA 4GKJK 3RR8A 3EZ5A 1XHXA 2OPSA 4WE1A 4FJLA 1WNSA 3V9ZA 4JI2K 1XC9A 3C0BA 4Z4FA 2HBMA 2OCEA 1G15A 3O3GA 2NRRA 4Z4IA 4YNQA 3S41A 3I0SA 4KTWA 4JS4A 1NK0A 3VEOA 3MAQA 2FSJA 1JJ2M 3ZETB 4CF9A 3K5LA 4FM2A 1N32K 3OYMA 1ZC6A 2UXDK 1NMDA 4H5NA 3UKUA 3WEEA 4J2DA 3OS1A 3KLEA 3M8RA 1NK9A 2Q31A 4K8XA 2P9IA 1S1WA 3LDSA 4KRFA 4LFBK 2NRWA 4CEDA 3O5BA 3ZT4A 4FJ5A 1S6PA 3PY8A 3ZEUB 5GINA 1RT2A 4KHQA 5AQFA 4A5BA 1HLUA 1S1VA 2WFBA 3CJ1A 3PO5A 4CIFA 4JEPA 3Q7BA 3ENOA 2G8KA 5J2QA 1VSLA 1JL2A 4CF2A 1OKJA 2YHWA 3ZSYA 4YDUC 3V1RA 1SKWA 3LDOA 3E9PA 1CZBA 4IXCA 2YNIA 3AVIA 2D0BA 4A62A 3RR7A 4CZGA 1GLAG 5AJ3K 4IOAL 1U04A 3LP3A 4CFDA 4CJUA 3NCIA 4HCCA 3CG7A 1IH7A 3O4NA 4M7YA 3WXLA 4DV1K 4FW2A 1KCFA 1BU6O 1XI1A 4F3OA 1JCFA 3C7NB 1X9SA 1Q9YA 1WUAA 1TK5A 2G8HA 4YOTA 1NK6A 4FZZA 2X78A 3ULDA 1YITN 3DLLL 1HYSA 4RG8A 4CGDA 3VMFB 1Q18A 2P9KB 3PSIA 2UUBK 1N33K 1EP4A 2YHYA 2NRVA 3SQ4A 4Z0UA 4ISGA 1CXUA 4LD0A 1HQUA 5E41A 1U2VA 2HB5A 1CZ9A 1LV5A 2X6NA 2PYJA 3ULEB 4JD2A 4RTFD 4AHUA 3QEVA 3LP2A 3H1VX 2IVNA 4BQLA 4A2BA 2IS3A 1NK8A 3D6RA 3HZ6A 4CEQA 1MDUB 1L3UA 4FJ7A 4R5PA 4FVUA 4BRHA 3OYNA 1O1WA 4GNIA 3IUCA 4E1NA 5B8HA 3LPTA 2P9SB 3U3GA 1A5XA 5ADXH 3VEWA 3SZ2A 1HNZK 2F4VK 2Z1GA 3TAQA 3WNEA 4BRKA 3KLGA 2JWKA 3DLKA 5BRHA 2HMIA 3SAFA 5CYQA 1HUXA 3DWLA 1ESVA 3QESA 3UIQA 3V4IA 1XUPO 1HNVA 3CIPA 1EO1A 3DLRA 4FO0A 4JK8A 2YNGA 4DV7K 1Q7YO 1MWMA 3BZKA 5AQGA 3GOIA 1SL0A 1ILYA 1RTJA 2NRHA 4PKIA 3CFPA 1KVBA 2Q2RA 3WT0A 3AY9A 3T7ZA 2ZE2A 5AQTA 1DEJA 4LY7A 4PHTX 1BHLA 3VEVA 2GWKA 1S1UA 2GBZA 3VQBA 4CEBA 4H5RA 3MECA 4ZTFA 4B1UB 3CFRA 1IBLK 1NOZA 2RF2A 2G8WA 4FJNA 2NRTA 2GUPA 4CJ3A 3L3VA 4WF9L 4CJPA 2F8TA 1REVA 1VSHA 3I33A 1TVRA 5TKWA 3HXMA 2BANA 3DLGA 3LAMA 1FXXA 3AO5A 2Q0RA 4YOWA 4KAZA 3MXJA 4M63C 4CGJA 3K5NA 4JRPA 2AJQA 3DRSA 4HCBA 3SCXA 2KZMA 4Y1DA 3ENBA 4CEEA 2IAJA 4RW4A 4DUZK 4LF7K 3NH0A 3AVBA 4FJXA 1YJWN 3THXA 4CEAA 4HUFA 3UKUB 3WEEB 3PX6A 2NUBA 3L2RA 3EY1A 1Q9XA 2P9IB 2WONA 4BWMA 3L4IA 4CIGA 4KH6A 3N4PA 5AQVA 4U67L 2ZJRL 1IO2A 5SZTA 3ASMA 3QBXA 2A6AA 1WAFA 1DKGD 3N4QA 3HP6A 3HSCA 4FSVA 4C1NK 4Z4EA 4R79A 3VQ9A 5AFUH 4BC3A 4DF4A 4FJ9A 3H45C 3FR0A 1BISA 3AARA 3OVNA 1S1XA 4LSLA 4BRQA 4KO0A 4Z4CA 3MCPA 4KREA 4FLXA 2UUAK 3MX2A 5KPRA 3KK3A 5LJVA 3RRHA 1W2BM 5E84A 3AVHA 3QMLA 3J7YP 1JXBA 3K5OA 3TPQA 1C0TA 4GV6A 2D0PA 3D2FA 1DT9A 4DTXA 4AILC 4QS8A 5AQHA 3TSUA 2X6SA 3WNGA 3G0ZA 4HUEA 1BA0A 3SLCA 3WQTA 4FJMA 3TTFA 4IG3A 4FWMA 4KH4A 1VQKN 3TSPA 2E20A 2P9UA 4LH4A 5BN9A 3CJAA 3U3YA 1EQYA 3UB5A 1QZ6A 1XWLA 5AQPA 4CERA 1YTUA 1NGBA 2YV0X 4AHTA 3UE5A 4DWIA 3W0LA 3GDQA 1IG8A 3CJCA 5IWAK 3DRRA 1GLCG 2ITGA 1B9DA 3VENA 3RWUA 4EHUA 3SPYA 2W40A 1GOBA 1HPMA 1VAZA 5JLFA 3NE6A 3AA5X 4B1ZA 4CBWA 1U2VB 4E1JA 4FZXC 2A40A 3S3OA 1NGHA 4JD2B 5HRSA 1J9AA 2RKIA 3CPWM 5BN8A 3KK2A 4OLBA 2NNWA 5AZIA 5HRPA 4TSXA 1OVQA 2QTDA 4BROA 3LAKA 3VESA 3OBWA 3CERA 1GLJO 2HHQA 4JYAK 1YIJN 4LC9B 2A3ZA 3SJHA 3T69A 1JCEA 4CZLA 3FZHA 1VSEA 5M1NA 1EWQA 1QSYA 3ZT2A 4MDBA 3CM6A 1KC8O 3R3LA 2CH5A 4CHYA 3SPZA 3KKSA 4CZHA 3SV3A 3RMAA 3KTQA 1K8AO 4IOXA 4HVJA 4IEIA 4E19A 3DM2A 4H5VA 4M7XA 2E2PA 4C8OA 3OYEA 2Q3SA 5AQWA 3K9JA 3DXMB 4DTNA 2UUCK 4UQGA 3DOKA 4FZYA 3HPOA 4YDUA 1Z25A 2F8SA 1VK0A 4BR2A 3GL1A 1JLGA 4WFAL 3M8PA 4YFUA 4CZJA 1NNEA 3DLEA 1QSSA 2GELA 2FSKA 4DQ8A 3O4WA 1WB9A 4LFAK 3MN6A 3OYLA 1NJYA 3GE1A 1X3MA 3OJUA 4LF5K 1RTHA 3CJ9A 3MWTA 3MK6A 2E2NA 1RILA 2CGLA 4BR7A 5JVHL 3E66A 1NJZA 4IFEA 3THYA 1WSHA 1IBMK 2KLAA 3QB0A 4BDPA 4JKFA 1KXPA 4CGGA 3NHGA 2Q1NA 4EFHA 3NBPA 3C94A 3VQ4A 4FVMA 2HBKA 1KVCA 5AQKA 2VCPA 5TKYA 4GW6A 2ZD1A 3SK3A 4CFAA 2IC3A 3SQ2A 2HNZA 4BRPA 3EL2A 1BUPA 1C0FA 3PX4A 3R8EA 4BRDA 3VF6A 2Z1HA 2B4JA 3THXB 1W7AA 1Y97A 1HX1A 1ZYQA 2JLEA 5M1KA 1P90A 3MEEA 4FJJA 3SUOA 2Y1JA 1C0GA 5BR8K 1JLFA 2FBTA 5JS2A 4DSFA 2UU9K 3KD1E 3V81A 2Q36A 3HL8A 3JYTA 4J2EA 1DTTA 4IDKA 3F9KA 1D8YA 4E89A 2CH6A 5C0YA 1QZ5A 2QKKA 3QICA 4FLYA 3CYMA 1WSJA 1H1VA 3WXKA 1S1TA 2XY7A 5I3UA 4B3SK 4IG0A 1DGKN 4ILHA 3J8AA 1MWKA 4H0VB 3VGKA 2G8FA 4XIUA 2WBNA 2HHSA 2YJEA 4C8MA 2NZTA 3AV9A 4ILGB 5T7BA 2A42A 1BQNA 3P4IA 2D0OA 4G9ZA 1I39A 1M1KO 1RBUA 4O5BA 3SMPA 3D2FB 1XHZA 1JLEA 1BL3A 4IO8A 2YX6A 1RT3A 4B9SA 2NLXA 3O1WA 2HBLA 3D45A 2F96A 3ZYYX 3DXKA 1VRUA 3J7ZO 3MX5A 2P9UB 1IKXA 4DQIA 4IWVA 2ITMA 1A5VA 3AVLA 4FLUA 3V9WA 4FJIA 1IV0A 1TL3A 2D0AA 4DV5K 1YHQN 3AAPA 2YI1A 4AF1A 3TAEA 3TU5A 3HVRA 1C6VA 2KTQA 4DR5K 2E5LK 4LF6K 1SAZA 3WXJA 4BG9A 4Y0WA 1EX4A 4Z94A 4DQSA 5J2MA 1U45A 5AZJB 4KTZA 2YJFA 3H3OB 4DQPA 4L3QA 4LF9K 3HJFA 3ZX3A 1RDAA 4O0IA 3VN5A 1IG9A 4DG1A 4BR9A 1S9GA 2RPIA 2VYPA 2PBDA 4X65K 1OH6A 3SV4A 3PLAA 2XRIA 3V9XA 1NKBA 4BRNA 5BRDA 2W41A 4FWNA 5AZIB 3CCRN 3BZCA 1GLDG 3TTDA 4PWDA 3A5MC 4CI6A 4HHTA 1LCUA 2UYTA 5KRSA 2V7YA 2RHKA 1JLQA 3QLHA 3OYGA 1RDUA 1ATSA 5M1QA 3K0SA 4DLGA 4N56A 3THVA 4M3WA 4DTUA 2VWBA 2X74A 5FRMA 5AQOA 4DSLA 5HL7L 1NGFA 3EN9A 1WSIA 1TKDA 4LF8K 5FLXO 2JWLA 5BPNA 4JKBA 2IVPA 2E6MA 4FWLA 4CBUA 3NF8A 1U4BA 1NGAA 3V1OA 2VGNA 4CJWA 3P1GA 4WCEL 4DSEA 4H4MA 3NF7A 3ENHA 4JKDA 3V1QA 1A5WA 4B9UA 5MLCQ 3GG4A 4H4OA 1TK0A 3NMUA 1W0HA 4BR5A 1IKWA 3LDQA 3LALA 4BY9C 4IKFA 4IZ9A 3NGYA 3QIPA 4GVMA 3JSMA 1T05A 2OZMA 4ISFA 4QOZB 2PYLA 4V19S 4CF8A 4CJEA 5C24A 5I9EB 4DU1A 3P5JA 3RMDA 3E1YA 4IFVA 1NJXA 3TI0A 3AO2A 3NH2A 2QI2A 4B8AB 3THYB 1L3VA 2KW4A 3MN7A 5LJWA 1KTQA 2BUPA 1HQEA 5BPMA 2E1YA 4KHUA 4BRAA 4EHTA 2F9WA 3QNNA 2P5GA 3CC7N 4KB1A 4JKEA 2UXCK 3G10A 4AHRA 1XMOK 3ZSOA 4OKEA 3J7AP 3KWIA 1RBSA 1YF5L 5AQMA 1BI4A 2CGJA 4OGCA 4O44A 1WN7A 3F73A 4CD3A 2O8EA 3P31A 3ZT3A 3LL3A 1MA9B 5GAGP 4DR6K 2WTUA 5AQLA 5F1XA 4BGBA 1M90O 3NFAA 1KAYA 2LSNA 4I2PA 2BDPA 1NKCA 2XY5A 5GAHP 2HVHA 5F2RA 2EHGA 3I0RA 3HOSA 3R1XA 2WOMA 3O6WA 1EKEA 4N5SA 3TR8A 1RDDA 2I7PA 4JHDA 3NVMA 3P83D 1N5YA 3ID6A 3M8QA 4F9OA 3A5LC 4CK2A 3R6MA 3PSFA 3CPEA 5KPZA 3D7EO 1BO5O 3KJVA 4PA1A 1BIUA 3E9OA 5AQUA 4XH4A 4IEEA 2YHBA 3HM8A 2V7ZA 3IG1A 4O5FA 4WFBL 3PIOL 5BRFA 3DXKB 3LANA 4DFJA 3HPHA 1J6ZA 3HRGA 1D5AA 1WOQA 3MXMA 3K9KA 3DLHA 4JK7A 4MO4A 3VEYA 3K57A 4L8RB 2IOCA 4A57A 2Y1IA 2Q97A 2QXFA 3FFIA 3F2KA 5AQSA 3SI6A 1RDCA 1VQPN 2GTDA 3Q7CA 5GADP 2ZWHA 2UXBK 4DR2K 3HSTB 1QS4A 4ICLA 2NRXA 4M42A 4FWOA 4K41A 4BC5A 1UOCA 1XMQK 3MMVA 1UAXA 4N76A 4CHNA 3QEPA 3BUZB 4FWSA 4K43A 3VQPA 1TGOA 4NXNK 4BRGA 3LP1A 2OANA 4B1YB 2FSNA 4CHPA 4JI3K 4MO5A 4FM0A 2HHUA 2HHVA 1O13A 1JCGA 4JKGA 1NU0A 3B8AX 3AO4A 1YXQA 3L0QA 4CZKA 2AP1A 4I9QA 3CCSN 1RT1A 3OYFA 4W5OA 3PIPL 1HNIA 1TYQA 4E1MA 3OYCA 4BWJA 4H5TA 3ZT0A 3KVGA 3DRPA 1HYVA 2ZGYA 1NLVA 3TAPA 4RW7A 1TUUA 2E1ZA 1LWCA 3PV8A 1WAJA 3VTHA 5LY3A 4CCHA 1NK4A 4LF4K 3OYKA 4E7LA 2FXUA 3AO1A 1VQ5N 3O08A 5AQXA 2KFZA 1JKHA 4ELUA 3CCQN 3HM9A 4M3ZA 1WSGA 4FJ8A 1I94K 2KQ2A 5GIOA 3O1BA 1DTQA 1LW0A 3KLFA 4NLCA 1OH5A 1SKSA 2QWMA 4NYNA 3HI0A 3CCUN 1QVGM 3KK1A 2HF4A 4K42A 4AHSA 3ZSVA 3V6DA 5J2PA 1TUYA 1E3MA 3BF1A 1NGIA 2QK9A 2IDOA 4OPJA 3T3FA 1XC3A 3V9SA 3H1QA 1HNXK 5M1FA 3CHWA 4H0YB 4GMJB 1TAUA 3VERA 5EVZA 4FJHA 1VQ8N 4IOCL 4YOYA 2DY4A 4KI4A 1C0UA 4M41A 4DTOA 1TV6A 1IKVA 4YHHK 4U7BA 4E0DA 1RDBA 1BI4B 2E2OA 1CXQA 5C12A 3A5OC 2VG7A 4I2QA 3E01A 1NGGA 4A2AA 4DB3A 4NYFA 4F3TA 4A59A 1Q81O 1NBWA 4RW9A 1RT7A 3L8BA 3CFOA 5KI6A 5HBMA 1T03A 4B9LA 2ETJA 2WUSA 4XH1A 5KGWA 4FW1A 4F2SA 2J4RA 3CJBA 5CHIA 1NGEA 1R0AA 4FK2A 1NGJA 4FJKA 1U49A 1LAWA 4JHDB 4FWPA 2Q0UA 3H46O 3HBTA 1ZBUA 3LM9A 4FWQA 2VQFK 3U8XA 4CJ4A 1I3AA 3VQCA 4M3YA 2PFUA 3AVNA 4WQ5A 3WXMB 5CYMA 3KK7A 1E4GT 3LWLA 4BE0A 4Z4HA 4GKKK 2DPNA 1V4TA 5IT9O 1CLQA 4B9NA 3ATUA 2HHWA 3I8DA 3VQQA 1HJRA 1VRTA 1RBVA 1BCOA 1T7PA 4M3RA 5ELZA 2HHHK 2QEXN 3H08A 3P39A 4HWIA 1TAQA 4B3OA 2G8VA 1VHXA 4CZFA 3U6FA 4FXDA 1QQOA 4FOIA 3O9QA 2YNFA 4CJLA 1CZAN 2I5JA 5H1SQ 4AM6A 3OS0A 2YKMA 5CE3A 3LPUA 2HSTA 4CK3A 4BRFA 4CJSA 1X3NA 4DTMA 4I9LA 4DQQA 3OTOK 3QFPA 1D9DA 1GOAA 4GVEA 5FRNA 3LDLA 3SQ0A 2YHAA 4ID1A 4CF1A 4WQ4A 4OJRA 2A5XA 5M1OA 5FPMA 1QQMA 1GLLO 3S3NA 3SAGA 5HRRA 1DLOA 4OLAA 4CFCA 2BH1A 3WNHA 3ZETA 2VWKA 4FL9A 4JK9A 4KFBA 1NGCA 3SJJA 4YY3K 2XHBA 2GX9A 3M6GA 1HNWK 2HF3A 4BG8A 3S9HA 3G6EN 1QE1A 3O9UA 4AQYK 4DSIA 1ZBHA 1VQON 1VQMN 1HKGA 4JKGB 4KHSA 1J5OA 3HTVA 4KKOA 3ZSRA 2Z1JA 4ZHRA 3F9MA 1TYQB 1RBTA 3L4QA 1SS6A 3AVKA 4E7JA 4DV6K 4DKWA 2KFNA 4AHCA 1ZBFA 5K14A 5M1PA 1UA0A 1XNRK 3HYFA 3CI5A 5LMUK 4FK0A 2B5JA 4FLTA 4BACA 3ATVA 3KWGA 3QEIA 2OPQA 5FPNA 4OKKA 4OKJA 4W5QA 3T1YK 3AVFA 2XO7A 3KKRA 2KZZA 4DTSA 3O9SA 4M3TA 3C6UA 3TWHA 1RGIA 3FE1A 2QKBA 4BQZA 2P51A 2CGKA 2P9NA 2FLOA 1KSPA 4CF0A 3UKRA 1X9JA 4KV8A 3QETA 4CJVA 3MXIA 3RRGA 4BC4A 4PKHA 1KFDA 4H0PA 1JXEA 4CZIA 2FF3B 3LDPA 3SQ1A 5I42A 2W42A 4HTUA 1UA1A 3HO1A 1FK9A 3E9LA 4CE9A 3KLHA 4DCHA 1EWRA 4B3TK 4JKHA 2ZGZA 4B1XB 3EE9A 3O9RA 3EKSA 1SV5A 1RDWX 5AQYA 4CGFA 4CJQA 3QERA 3O4QA 3O3FA 5EU7A 3D2EA 3CMEN 1P8ZA 4B3MK 3OYIA 2QW9A 3ALYA 4DFMA 4A5AA 3RVCA 3SMSA 3WNFA 3VF2A 2F9TA 2RE2A 2FBYA 3TSQA 4JNEA 4M45A 3I55N 3B6PA 3SYZA 3I8BA 4JRQA 1T3VA 3PUFA 4Q5VA 4C8KA 4WFNL 1N8RO 1Z6RA 1NM1A 3VGLA 3VOVA 3LWMA 1MU2A 1QHAA 5AQJA 4KHYA 3VQ7A 3NGZA 3VPZA 1VQ9N 1GLBG 3EEQA 3MDQA 3VQDA 4CJRA 4BE1A 4JI1K 1FJGK 1KQSM 5KQDA 4DFKA 1KLMA 3FFKB 4O0JA 3L2QA 4BVPA 1BWFO 1RT6A 4B1WB 3K5MA 1QQCA 3CQXA 3CCEN 3CF5L 4J2AA 1YTAA 5JICA 1KRPA 4BE2A 3ZLJA 5HRNA 3CQ8A 3ZSWA 4B9MA 3AA2A 5EY4A 3BGRA 2E4LA 3JAMO 1N34K 3O9TA 2Z1IA 3AVCA 2OPRA 3B6OA 5KTQA 5ADXA 3NF9A 2O8CA 3U9ZA 4ISEA 1BOTO 3WXIA 3ZSXA 3OYDA 2IGIA 3LZIA 4JI5K 5FDLA 4O8KA 3OYBA 3IMXA 4WQ5C 4IO9L 1NG9A 5C15A 4CJ5A 2HHTA 3VEXA 5CY4A 5C42A 1S5JA 4NB4A 4BRLA 1VSJA 2GUIA 1T44A 4ILJA 3G25A 4I6MA 4CK1A 1E4FT 3CETA 2FBVA 4CEOA 2ASMA 4BRCA 3CC4N 4JI0K 2ZF5O 4JI6K 3NVKA 2P9PA 1BGXT 4Y1CA 3FGUA 1VSIA 3BEXA 5C2DA 3DLBA 4DTRA 5AQQA 4BDZA 4FJGA 4N41A 1K8KA 4DTPA 1SL1A 1HKCA 3NH1A 5EXWA 4IJNA 1EETA 3OYAA 1KAXA 3IRXA 5CZ1A 3EE8A 3ZX0A 3KIOA 4RWTA 2H3GX 4WQ4C 1WBBA 2P1JA 2ZJQL 1TKZA 4IDHA 3NDKA 3DI6A 3QINA 5FPEA 3FZFA 4DV0K 4C1NI 3DYAA 3VTIA 2KKZA 1U47A 2F7TA 1ZBLA 1QQNA 2WC9A 1NK7A 4FCYA 2HBJA 4W5RA 3EO3A 3MN9A 3VQAA 2G8UA 5CR4A 4KPYA 4JKCA 2FF6A 3K59A 4CGHA 1B92A 3J80O 1U6ZA 4PQUA 4M3XA 4FWRA 1WSEA 3DMJA 4FLWA 4FPAA 4GV9A 4B3RK 5DMRA 1VQNN 1VSKA 3ZX2A 4KHNA 3C65A 4RW8A 1NGDA 2P9NB 4F2RA 4JN4A 1L3SA 1GOCA 2P5OA 3C6HA 5AFUA 1YI2N 2VG5A 5DM7L 2O8FA 1NWKA 3UKRB 4B1VA 3C95A 4DLEA 4FLZA 1YUWA 3T19A 1L3TA 4Z4GA 3TTCA 5C2FA 1BA1A 1YAGA 1JL1A 3WUHA 3K2PA 1IBKK 4JS5A 2FC0A 1S22A 3PO4A 5JVGL 4FK4A 4BGAA 5LMNK 2DFFA 5KPTA 3O8MA 2E2QA 1Q8IA 4KHPK 2IIRA 3CCLN 4KTQA 1WBDA 4DUYK 3D2EB 1ZXOA 3PX0A 3RSEA 2DTUA 1NKEA 3VQEA 4ELVA 1J5EK 4BR0A 3ZSQA 4EP4A 2ASPA 2QA4N 4JLHA 1VQ4N 4FM1A 5D3GA 4B9TA 1VQ7N 4DQRA 1K6YA 3FZMA 4EZ9A 4CBXA 2OTLN 4NCGA 4CD1A 4DU3A 2PY5A 3QBWA 3QEXA 3H6EA 2QXLA 4B8CA 1ZBIA 4EAHD 2OPPA 5DK5A 4JI7K 5EX5A 4H8KA 4RCHA 4DSKA 4W5TA 1KFSA 3QO9A 4AH9A 4RW6A 3TABA 1HMVA 1TKTA 4NLBA 4ZTJA 4X62K 3OYJA 4H0TB 1J54A 5DM6L 3C6TA 4YORA 3DXMA 4OX9K 3AA4A 4CJKA 2XY8A 2D1KA 3M8SA 4W5NA 3ZT1A 3T1HK 3SNNA 2A1RA 4PKGA 2O8CB 1NJWA 2DFHA 1S9EA 3A5NC 4BRMA 1LWEA 1SL2A 3ISNC 4YOUA 4QS7A 4CZEA 3QNOA 2W6KA 5J2NA 3SAHA 1TL1A 4UY8O 3C6AA 4J2BA 2HVIA 1T6CA 3THWA 3VQ5A 4WYBA 4OO1J 1KAZA 5BR9A 4I6MB 4X64K 3P38A 4J8FA 3QEWA 3HT3A 2YKNA 1KVAA 2P9PB 5AR0A 1J53A 3VQ8A 4CHQA 3KLIA 3D0PA 2HMPA 1SUQA 3CXCM 4B9VA 2KHOA 1NK5A 1K8KB 4NXMK 3M1FA 3A0IX 3OYHA 3VGMA 2O8DA 4I7FA 3LDNA 3MCAB 5JS1A 1IJJA 1Z26A 2O4IA 3J81O 1NOYA 4ID5A 3DAWA 2JGUA 3OA9A 3TAMA 4HTLA 2VGMA 4H03B 4DS5A 1Q82O 2A41A 1EXQA 3A8YA 1OH7A 4DHYA 2YHXA 3LZJA 2OTJN 1RFQA 2D0CA 2VWJA 2HHXA 5LL6Z 2ATQA 3HVTA 1HKBA 4F4KA 2EX3A 4A61A 1JLBA 1B9FA 1VSMA 2QWPA 4XH5A 2D5RA 4CW7B 1VQLN 2O8EB 4E7IA 1VSDA 3AVAA 3ZCMA 1S6QA 3IDHA 1HR0K 1NMNA 4C8LA 4IBNA 2VG6A 3EYZA 1LW2A 5EOYA 2D4WA 1F21A 3CCMN 2O4GA 1C1CA 1WLJA 3NAEA 5GIPA 2P9LA 4DV4K 4DR3K 1YT3A 2XY6A 3OBYA 3G4SN 3V9UA 5AQIA 5SWMA 1RCHA 3MEGA 2O8BA 1KD1O 1YVUA 4B08A 1K73O 4CZMA 5JMVA 4X66K 2O8FB 3FZKA 2FBXA 4MQ3A 4FOEA 1HRHA 3ITHA 4CESA 2BTFA 2GV9A 4MDAA 2OZSA 4MFBA 4CHOA 5KRTA 3KZBA 3EKUA 1RT5A 1TKXA 4DF8A 5AZJA 3L2UA 1T8EA 3TARA 2ZJPL 1RT4A 3TAGA 3DJCA 4NO7A 1YJNN 3OY9A 4FLVA 4E7HA 2HNYA 3RSEB 2QWOA 4CIEA 2YCHA 4DR7K 4KBOA 3CC2N 4EIAA 2QWLA 4YOVA 4CEFA 4CEZA 4OVLA 3HP9A 4F8RA 2VQEK 1GLEG 1OVYA 4Q0BA 3M3ZA 2QM1A 1ZBSA 1UWBA 5C10A 2EWSA 4QAGA 3TAFA 2PZSA 5FPDA 4DSJA 2ZQBA 2PAVA 2GWJA 3VEZA 2HW3A 1ASWA 1SZ2A 4DV3K 4YOXA 2HNDA 3S3MA 3IKMA 1VQ6N 1X9MA 5KGXA 1LWFA 1BG3A 3L2WA 5AQRA 4B9QA 5HROA 2BGGA 2IVOA 5E26A 4K8ZA 3CM5A 3CD6N 1ATNA 3CCVN 4H0XB 2G8IA 4O8UA 1XQSC 3IAYA 3JS6A 3T1AA 1QVFM 3DOLA 2E8AA 1N6QA 4CJTA 3VA0A 4QCLA 4EZ6A 1BDGA 3AVJA 3AVGA 4C23A 4OPAA 1JLAA 1QHTA 5BPLA 4KB0A 5A2QO 3U4LA 3HPGA 2ZM6K 2V51B 1OH8A 3GBTA 2B6AA 4G1QA 5AQZA 1D4XA 1GLFO 2I7NA 4E3SA 3ZEUA 1ASUA 1YVNA 4PL7A 3OJSA 3CQYA 4FPBA 3BF3A 1NJIO 1W97L 3A2FA 1HPZA 3ZSZA 4KI6A 1T6DA 4DS4A 4DU4A 4CGIA 2V52B 1C1BA 1TK8A 4JI8K 3WQUA 1ASVA 4H5WA 4DR1K 4LH5A 3THWB 1X9WA 4OPKA 1BCMA 3FLCO 3QDKA 3SUPA 3O80A 1C1AA 4HUGA 4LFCK 2BE2A 3H3NO 1KLNA 3BY5A 5GAEP 5C25A 1U48A 5BREA 4NCAA 1W9HA 4DR4K 1V4SA 4OGEA 4BRIA 2W6LA 1QSLA 4IFYA 4FYDA 4O55A 3F5TA 4OPHA 1R59O 2AA4A 2O8DB 3ID8A 3AO3A 2QWQA 3L3UA 3C7NA 4NCBA 3EZWA 2YNHA 5HOOA 3HOTA 3JXUA 2R7YA 4AM7A 3SUNA 4CJFA 4MLHA 1L5UA 1HYZA 4ELTA 1RBRA 4JKAA 1Q86O 2QWRA 3KD5E 4DFPA 4LSNA 2ASOA 1BIZA 4K0KK 1SKRA 4FWKA 2P9KA 1JLCA 1FW6A 5JLHA 3I56N 3AGKA 3U9DA 4PL8A 2GEMA 4BREA 1LAVA 1RNHA 1VSFA 3SUQA 4GY2B 5HLFA 4K25A 4AHVA 3L6QA 2QWNA 3BP8A 4JI4K 3ULEA 4KHWA 5KQ8A 3CJ7A 2DFEA 2OYQA 1RTDA 4JAXA 1S72N 5CZ2A 3K58A 3LP0A 1S3XA 1QTMA 3OS2A 3VETA 3VF4A 3R9PA 2P9LB 3AAQA 3QFUA 1SQKA 2RN2A 1FKPA 4E7KA 5HP1A 3OW2M 1K9MO 3FZLA 2NRZA 2P9SA 3RMCA 1LOTB 4IJAA 2O8BB 1IKYA 4N47A 1BQMA 4QS9A 5FROA 2E88A 3W3DA 1X1PA 3NGIA 4M3UA 4XEIA 3MWPA 4JV5K 1ITGA 1Y64A 3AGRA 4CECA 4CVNE 3HK2A 3RTVA 4DTJA 3VA3A 3IS9A 3IFRA 3M5RA 4MLEA 4BC2A 4BVOA 4GV3A 4CHZA 4BR4A 1G99A 1WSFA 3MN5A 3RMBA 3TANA 1FKOA 3QIOA 3LM2A 3SBGA 2OA8A 4KH5A 3KHYA 4DMNA 3MEDA 1C0MA 4BDYA 3NF6A 4CJ7A 1ATRA 1YJ9N 2E6LA 2A1SA 5AQNA
chains in the Genus database with same CATH topology
3OYLA 1NJYA 3OJUA 3V9SA 1RTHA 3L2VA 2DFFA 3AVMA 4EP5A 1TAUA 4GMJB 3VQ6A 5J1EA 4PUOA 1Q8IA 3O3HA 4FJHA 1RILA 4CFBA 4KTQA 4C8NA 3PX0A 1NJZA 1D9FA 2DY4A 4KI4A 4O4GA 2DTUA 1C0UA 1WSHA 1NKEA 3BDPA 3VQEA 4ELVA 4PY5A 4M41A 4DTOA 1TV6A 3AA3A 3ZSQA 4EP4A 1RTIA 4BDPA 4CGGA 3NHGA 4JLHA 1IKVA 3NBPA 3C94A 3RR8A 3VQ4A 4FM1A 4E0DA 3EZ5A 1XHXA 4B9TA 5D3GA 1RDBA 4FVMA 1BI4B 1CXQA 4DQRA 2OPSA 1K6YA 1KVCA 4WE1A 4GW6A 2ZD1A 4FJLA 4EZ9A 4CFAA 2IC3A 1WNSA 2VG7A 4I2QA 3V9ZA 2HNZA 3E01A 3SQ2A 1XC9A 4NCGA 4DU3A 4Z4FA 3PX4A 2PY5A 4NYFA 4F3TA 3QEXA 1G15A 3O3GA 2Z1HA 2B4JA 4RW9A 4YNQA 1RT7A 4Z4IA 3I0SA 4KTWA 1Y97A 4B8CA 3L8BA 4JS4A 3MAQA 1ZYQA 1NK0A 3CFOA 2JLEA 1ZBIA 3MEEA 2OPPA 5KI6A 4FJJA 5DK5A 3SUOA 5HBMA 4CF9A 2Y1JA 3K5LA 1T03A 4B9LA 2ETJA 5KGWA 4H8KA 1JLFA 2FBTA 5JS2A 4FW1A 4FM2A 4DSFA 3OYMA 3V81A 4DSKA 4W5TA 3KD1E 4F2SA 1R0AA 3HL8A 4FK2A 3JYTA 4J2EA 1DTTA 4IDKA 3F9KA 1KFSA 4FJKA 1D8YA 1U49A 1LAWA 3QO9A 4E89A 4AH9A 4J2DA 3OS1A 4RW6A 3KLEA 3M8RA 3TABA 1NK9A 2QKKA 1HMVA 1TKTA 1ZBUA 4FLYA 4K8XA 4ZTJA 1S1WA 3CYMA 3LDSA 4KRFA 3OYJA 1WSJA 1J54A 4CEDA 4CJ4A 1I3AA 3C6TA 3VQCA 3ZT4A 4FJ5A 1S6PA 1S1TA 3AA4A 2XY7A 4CJKA 2XY8A 5I3UA 3PY8A 4M3YA 4IG0A 3M8SA 3AVNA 4W5NA 1RT2A 3ZT1A 5CYMA 3LWLA 4BE0A 3SNNA 4Z4HA 2G8FA 2A1RA 4KHQA 4XIUA 1CLQA 2HHSA 4B9NA 4C8MA 1NJWA 2HHWA 1S1VA 2DFHA 3AV9A 1S9EA 3VQQA 5T7BA 3I8DA 1BQNA 1HJRA 1LWEA 1VRTA 3PO5A 4CIFA 1SL2A 3ISNC 2G8KA 1RBVA 1BCOA 1JL2A 1I39A 1VSLA 5J2QA 1RBUA 4M3RA 3QNOA 4O5BA 3H08A 4CF2A 3ZSYA 5J2NA 1JLEA 1XHZA 1BL3A 1RT3A 1TL1A 3V1RA 1TAQA 4B3OA 4B9SA 4J2BA 2G8VA 2HVIA 1SKWA 3VQ5A 1CZBA 3U6FA 3D45A 4FXDA 2F96A 2YNIA 3AVIA 2YNFA 1VRUA 4CJLA 2D0BA 2I5JA 3RR7A 3QEWA 3OS0A 2YKMA 3LPUA 1IKXA 4DQIA 4CK3A 2YKNA 4CJSA 3HT3A 4DTMA 4I9LA 4DQQA 1KVAA 1U04A 1D9DA 3LP3A 4CFDA 1A5VA 1GOAA 4CJUA 3AVLA 4FLUA 3NCIA 3V9WA 4FJIA 1TL3A 5FRNA 4HCCA 2D0AA 3CG7A 1IH7A 1J53A 3O4NA 3VQ8A 3KLIA 4CHQA 3D0PA 3SQ0A 1SUQA 2YHAA 4FW2A 4ID1A 1KCFA 1XI1A 4CF1A 3TAEA 4B9VA 4F3OA 4OJRA 1NK5A 3HVRA 1X9SA 1Q9YA 1C6VA 3S3NA 2KTQA 5HRRA 1TK5A 1DLOA 3OYHA 4OLAA 4CFCA 2G8HA 1EX4A 4DQSA 4I7FA 5J2MA 3WNHA 1U45A 4KTZA 5JS1A 2VWKA 4DQPA 3HJFA 1NK6A 4FZZA 2X78A 3ULDA 1Z26A 2O4IA 4KFBA 1NOYA 1HYSA 3SJJA 4ID5A 2XHBA 4RG8A 1RDAA 2JGUA 4O0IA 4CGDA 3VN5A 1IG9A 4DG1A 3TAMA 1S9GA 3S9HA 2RPIA 1QE1A 4DSIA 1ZBHA 4DS5A 1EP4A 1EXQA 3SQ4A 4KHSA 3SV4A 1J5OA 4Z0UA 1CXUA 2XRIA 4KKOA 4LD0A 3V9XA 1HQUA 5E41A 1NKBA 2HB5A 1CZ9A 3ZSRA 2Z1JA 3LZJA 2X6NA 1LV5A 4ZHRA 2D0CA 2VWJA 2PYJA 4AHUA 2HHXA 4PWDA 2ATQA 3HVTA 1RBTA 3QEVA 3LP2A 4HHTA 3AVKA 4E7JA 4F4KA 2EX3A 1JLBA 5KRSA 1B9FA 1VSMA 2IS3A 1NK8A 2KFNA 2D5RA 4CEQA 1L3UA 4FJ7A 4E7IA 1VSDA 4R5PA 3AVAA 4AHCA 1JLQA 1ZBFA 3QLHA 5K14A 3ZCMA 3OYNA 3OYGA 1S6QA 1UA0A 1O1WA 3HYFA 4E1NA 3LPTA 4DLGA 4N56A 4C8LA 4IBNA 3U3GA 2VG6A 1A5XA 3EYZA 1LW2A 4FK0A 2B5JA 3THVA 4M3WA 1F21A 4FLTA 2X74A 3SZ2A 4BACA 4DTUA 2O4GA 1C1CA 1WLJA 3NAEA 3QEIA 2OPQA 5FRMA 4OKKA 4OKJA 1YT3A 4DSLA 4W5QA 2XY6A 2Z1GA 3TAQA 3WNEA 3V9UA 3AVFA 5SWMA 1RCHA 3KKRA 1WSIA 3MEGA 2XO7A 1TKDA 3KLGA 1YVUA 3DLKA 4B08A 2KZZA 4DTSA 4M3TA 3C6UA 2HMIA 3TWHA 1U4BA 2E6MA 5CYQA 3NF8A 2QKBA 3V1OA 3QESA 3UIQA 2FBXA 4CJWA 3V4IA 1HNVA 2P51A 3P1GA 3DLRA 4MQ3A 4DSEA 4H4MA 1HRHA 2YNGA 3ITHA 3NF7A 4CESA 1KSPA 3V1QA 1A5WA 4B9UA 4CF0A 2GV9A 1SL0A 2OZSA 4H4OA 4KV8A 1TK0A 1W0HA 4MFBA 1IKWA 4CJVA 3QETA 3MXIA 3LALA 1RTJA 4CHOA 3RRGA 5KRTA 4IKFA 1KFDA 1RT5A 1TKXA 1JXEA 3NGYA 3QIPA 1KVBA 4GVMA 3JSMA 3CFPA 4DF8A 1T8EA 1T05A 2PYLA 2OZMA 4CF8A 4CJEA 3SQ1A 4QOZB 5C24A 3L2UA 2ZE2A 4DU1A 5I42A 3TARA 1RT4A 3P5JA 3RMDA 3TAGA 4IFVA 4LY7A 1NJXA 2W42A 3TI0A 1BHLA 3AO2A 3NH2A 3OY9A 4HTUA 1FK9A 4FLVA 3KLHA 4CE9A 4E7HA 1UA1A 2HNYA 4CIEA 3HO1A 1S1UA 2GBZA 3VQBA 4B8AB 4CEBA 3MECA 4ZTFA 1L3VA 3CFRA 2KW4A 1NOZA 2RF2A 1SV5A 4CEFA 1KTQA 2G8WA 4CEZA 4FJNA 4CGFA 4CJQA 4OVLA 1HQEA 4KHUA 3QERA 3O4QA 4CJ3A 3L3VA 3O3FA 5EU7A 3HP9A 4F8RA 3QNNA 2P5GA 3OYIA 4CJPA 1T7PA 4Q0BA 3ALYA 4DFMA 1UWBA 4KB1A 2F8TA 1REVA 3TAFA 1VSHA 3G10A 4QAGA 4AHRA 2PZSA 1TVRA 4DSJA 3HXMA 2BANA 2ZQBA 3DLGA 2HW3A 1ASWA 3ZSOA 3WNFA 3LAMA 1FXXA 2HNDA 4OKEA 3AO5A 3S3MA 2FBYA 1RBSA 4KAZA 1BI4A 3MXJA 4OGCA 4M45A 5KGXA 1LWFA 1X9MA 3B6PA 4O44A 1WN7A 3L2WA 4CGJA 3F73A 3K5NA 4JRPA 3SYZA 4JRQA 3DRSA 5HROA 2AJQA 3PUFA 2BGGA 3ZT3A 4Q5VA 3SCXA 4C8KA 3CM5A 4Y1DA 4HCBA 4K8ZA 4CEEA 2IAJA 4RW4A 2G8IA 3NH0A 3AVBA 4FJXA 3LWMA 3IAYA 1MU2A 3NFAA 3T1AA 4KHYA 3VQ7A 4CEAA 3DOLA 3NGZA 2LSNA 4HUFA 1N6QA 4I2PA 4CJTA 3VA0A 2BDPA 4EZ6A 1NKCA 4QCLA 3AVJA 2XY5A 3PX6A 3AVGA 2NUBA 3VQDA 3L2RA 3EY1A 2HVHA 1Q9XA 1JLAA 2WONA 2EHGA 4BWMA 4CIGA 4CJRA 4BE1A 3I0RA 1QHTA 4KB0A 2WOMA 3HPGA 1EKEA 4N5SA 4DFKA 3TR8A 1RDDA 1KLMA 1IO2A 4O0JA 5SZTA 3L2QA 3ASMA 1RT6A 3P83D 3K5MA 1QQCA 1WAFA 1N5YA 3M8QA 4J2AA 4CK2A 1YTAA 3HP6A 1KRPA 4BE2A 4Z4EA 2B6AA 4G1QA 5HRNA 3CQ8A 3ZSWA 3VQ9A 3AA2A 4E3SA 1ASUA 2E4LA 3BGRA 3OJSA 4DF4A 4B9MA 4FJ9A 3KJVA 4PA1A 3OVNA 1BISA 1BIUA 1S1XA 4LSLA 3A2FA 2Z1IA 1HPZA 2OPRA 3AVCA 3B6OA 3ZSZA 4KO0A 4Z4CA 5KTQA 4DS4A 4KI6A 4DU4A 4CGIA 4KREA 1C1BA 3NF9A 4FLXA 1TK8A 3KK3A 2YHBA 1ASVA 3IG1A 3RRHA 4LH5A 1X9WA 3ZSXA 3AVHA 3OYDA 1JXBA 2IGIA 3K5OA 4OPKA 1BCMA 1C0TA 5FDLA 3LZIA 3LANA 4DFJA 3OYBA 3HPHA 3SUPA 1D5AA 4DTXA 4AILC 1C1AA 2X6SA 3WNGA 3MXMA 3G0ZA 4CJ5A 4HUEA 4HUGA 3DLHA 2HHTA 5CY4A 2BE2A 5C42A 1S5JA 1KLNA 4FJMA 1VSJA 2GUIA 1U48A 5C25A 4IG3A 4NCAA 1W9HA 4CK1A 3K57A 4L8RB 2IOCA 2FBVA 2Y1IA 4CEOA 4LH4A 4OGEA 1QSLA 2QXFA 3FFIA 4IFYA 1BGXT 3U3YA 4Y1CA 3SI6A 1RDCA 4FYDA 1VSIA 1QS4A 1XWLA 3HSTB 4ICLA 4O55A 3DLBA 4DTRA 4CERA 4M42A 1YTUA 1UOCA 3AO3A 4BDZA 2YV0X 4AHTA 1UAXA 4FJGA 3L3UA 4N41A 4N76A 4DWIA 4CHNA 3QEPA 4NCBA 4DTPA 2YNHA 3DRRA 1SL1A 2ITGA 3NH1A 1B9DA 3VQPA 1TGOA 2R7YA 1EETA 3RWUA 3OYAA 3LP1A 3SUNA 4CJFA 3IRXA 5CZ1A 1L5UA 3SPYA 1GOBA 1HYZA 3KIOA 3NE6A 4ELTA 1RBRA 3AA5X 3KD5E 4DFPA 2P1JA 4LSNA 4FK4A 1BIZA 1SKRA 1TKZA 4CHPA 4FM0A 1JLCA 4FZXC 2KZMA 3S3OA 3NDKA 3DI6A 2HHUA 5HRSA 2HHVA 3QINA 1J9AA 1LAVA 2RKIA 1RNHA 1VSFA 1U47A 3AO4A 3DYAA 3SUQA 1ZBLA 3KK2A 4OLBA 5HLFA 5HRPA 4TSXA 4AHVA 4I9QA 1RT1A 3OYFA 4W5OA 3LAKA 4KHWA 1HNIA 2HHQA 4E1MA 3OYCA 4BWJA 1NK7A 2DFEA 2OYQA 1RTDA 3ZT0A 4FCYA 3DRPA 1HYVA 4W5RA 5CZ2A 3VQAA 3K58A 3TAPA 3LP0A 1QTMA 2G8UA 3OS2A 4RW7A 4KPYA 1VSEA 1LWCA 3K59A 3PV8A 2RN2A 4CGHA 1WAJA 1B92A 1FKPA 4CCHA 4E7KA 1NK4A 1QSYA 3ZT2A 5HP1A 3CM6A 4PQUA 3RMCA 3OYKA 4E7LA 3AO1A 3SPZA 1IKYA 4CHYA 4N47A 3KKSA 3SV3A 1BQMA 3RMAA 5FROA 3KTQA 1WSEA 4M3XA 3DMJA 4FLWA 2KFZA 1X1PA 4HVJA 1JKHA 3NGIA 4E19A 4M3UA 3DM2A 5DMRA 4ELUA 1VSKA 3HM9A 4C8OA 1WSGA 4M3ZA 4KHNA 4FJ8A 1ITGA 3OYEA 4CECA 4RW8A 3HK2A 3RTVA 2Q3SA 2KQ2A 4F2RA 4DTJA 1L3SA 1GOCA 3VA3A 3IS9A 2P5OA 1DTQA 1LW0A 2VG5A 3KLFA 4DTNA 4UQGA 1SKSA 3DOKA 4CHZA 4FZYA 3HPOA 1Z25A 4NYNA 4FLZA 1WSFA 3C95A 4DLEA 3RMBA 1FKOA 1VK0A 3TANA 2F8SA 3QIOA 3T19A 1JLGA 2OA8A 1L3TA 4Z4GA 3KK1A 4DMNA 3M8PA 3MEDA 3ZSVA 4AHSA 3V6DA 1JL1A 4YFUA 5J2PA 3K2PA 1C0MA 4JS5A 4BDYA 3DLEA 3NF6A 2FC0A 3PO4A 1QSSA 2E6LA 2QK9A 2IDOA 2A1SA 4OPJA 3T3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYL A;  1NJY A;  3OJU A;  3V9S A;  1RTH A;  3L2V A;  2DFF A;  3AVM A;  4EP5 A;  1TAU A;  4GMJ B;  3VQ6 A;  5J1E A;  4PUO A;  1Q8I A;  3O3H A;  4FJH A;  1RIL A;  4CFB A;  4KTQ A;  4C8N A;  3PX0 A;  1NJZ A;  1D9F A;  2DY4 A;  4KI4 A;  4O4G A;  2DTU A;  1C0U A;  1WSH A;  1NKE A;  3BDP A;  3VQE A;  4ELV A;  4PY5 A;  4M41 A;  4DTO A;  1TV6 A;  3AA3 A;  3ZSQ A;  4EP4 A;  1RTI A;  4BDP A;  4CGG A;  3NHG A;  4JLH A;  1IKV A;  3NBP A;  3C94 A;  3RR8 A;  3VQ4 A;  4FM1 A;  4E0D A;  3EZ5 A;  1XHX A;  4B9T A;  5D3G A;  1RDB A;  4FVM A;  1BI4 B;  1CXQ A;  4DQR A;  2OPS A;  1K6Y A;  1KVC A;  4WE1 A;  4GW6 A;  2ZD1 A;  4FJL A;  4EZ9 A;  4CFA A;  2IC3 A;  1WNS A;  2VG7 A;  4I2Q A;  3V9Z A;  2HNZ A;  3E01 A;  3SQ2 A;  1XC9 A;  4NCG A;  4DU3 A;  4Z4F A;  3PX4 A;  2PY5 A;  4NYF A;  4F3T A;  3QEX A;  1G15 A;  3O3G A;  2Z1H A;  2B4J A;  4RW9 A;  4YNQ A;  1RT7 A;  4Z4I A;  3I0S A;  4KTW A;  1Y97 A;  4B8C A;  3L8B A;  4JS4 A;  3MAQ A;  1ZYQ A;  1NK0 A;  3CFO A;  2JLE A;  1ZBI A;  3MEE A;  2OPP A;  5KI6 A;  4FJJ A;  5DK5 A;  3SUO A;  5HBM A;  4CF9 A;  2Y1J A;  3K5L A;  1T03 A;  4B9L A;  2ETJ A;  5KGW A;  4H8K A;  1JLF A;  2FBT A;  5JS2 A;  4FW1 A;  4FM2 A;  4DSF A;  3OYM A;  3V81 A;  4DSK A;  4W5T A;  3KD1 E;  4F2S A;  1R0A A;  3HL8 A;  4FK2 A;  3JYT A;  4J2E A;  1DTT A;  4IDK A;  3F9K A;  1KFS A;  4FJK A;  1D8Y A;  1U49 A;  1LAW A;  3QO9 A;  4E89 A;  4AH9 A;  4J2D A;  3OS1 A;  4RW6 A;  3KLE A;  3M8R A;  3TAB A;  1NK9 A;  2QKK A;  1HMV A;  1TKT A;  1ZBU A;  4FLY A;  4K8X A;  4ZTJ A;  1S1W A;  3CYM A;  3LDS A;  4KRF A;  3OYJ A;  1WSJ A;  1J54 A;  4CED A;  4CJ4 A;  1I3A A;  3C6T A;  3VQC A;  3ZT4 A;  4FJ5 A;  1S6P A;  1S1T A;  3AA4 A;  2XY7 A;  4CJK A;  2XY8 A;  5I3U A;  3PY8 A;  4M3Y A;  4IG0 A;  3M8S A;  3AVN A;  4W5N A;  1RT2 A;  3ZT1 A;  5CYM A;  3LWL A;  4BE0 A;  3SNN A;  4Z4H A;  2G8F A;  2A1R A;  4KHQ A;  4XIU A;  1CLQ A;  2HHS A;  4B9N A;  4C8M A;  1NJW A;  2HHW A;  1S1V A;  2DFH A;  3AV9 A;  1S9E A;  3VQQ A;  5T7B A;  3I8D A;  1BQN A;  1HJR A;  1LWE A;  1VRT A;  3PO5 A;  4CIF A;  1SL2 A;  3ISN C;  2G8K A;  1RBV A;  1BCO A;  1JL2 A;  1I39 A;  1VSL A;  5J2Q A;  1RBU A;  4M3R A;  3QNO A;  4O5B A;  3H08 A;  4CF2 A;  3ZSY A;  5J2N A;  1JLE A;  1XHZ A;  1BL3 A;  1RT3 A;  1TL1 A;  3V1R A;  1TAQ A;  4B3O A;  4B9S A;  4J2B A;  2G8V A;  2HVI A;  1SKW A;  3VQ5 A;  1CZB A;  3U6F A;  3D45 A;  4FXD A;  2F96 A;  2YNI A;  3AVI A;  2YNF A;  1VRU A;  4CJL A;  2D0B A;  2I5J A;  3RR7 A;  3QEW A;  3OS0 A;  2YKM A;  3LPU A;  1IKX A;  4DQI A;  4CK3 A;  2YKN A;  4CJS A;  3HT3 A;  4DTM A;  4I9L A;  4DQQ A;  1KVA A;  1U04 A;  1D9D A;  3LP3 A;  4CFD A;  1A5V A;  1GOA A;  4CJU A;  3AVL A;  4FLU A;  3NCI A;  3V9W A;  4FJI A;  1TL3 A;  5FRN A;  4HCC A;  2D0A A;  3CG7 A;  1IH7 A;  1J53 A;  3O4N A;  3VQ8 A;  3KLI A;  4CHQ A;  3D0P A;  3SQ0 A;  1SUQ A;  2YHA A;  4FW2 A;  4ID1 A;  1KCF A;  1XI1 A;  4CF1 A;  3TAE A;  4B9V A;  4F3O A;  4OJR A;  1NK5 A;  3HVR A;  1X9S A;  1Q9Y A;  1C6V A;  3S3N A;  2KTQ A;  5HRR A;  1TK5 A;  1DLO A;  3OYH A;  4OLA A;  4CFC A;  2G8H A;  1EX4 A;  4DQS A;  4I7F A;  5J2M A;  3WNH A;  1U45 A;  4KTZ A;  5JS1 A;  2VWK A;  4DQP A;  3HJF A;  1NK6 A;  4FZZ A;  2X78 A;  3ULD A;  1Z26 A;  2O4I A;  4KFB A;  1NOY A;  1HYS A;  3SJJ A;  4ID5 A;  2XHB A;  4RG8 A;  1RDA A;  2JGU A;  4O0I A;  4CGD A;  3VN5 A;  1IG9 A;  4DG1 A;  3TAM A;  1S9G A;  3S9H A;  2RPI A;  1QE1 A;  4DSI A;  1ZBH A;  4DS5 A;  1EP4 A;  1EXQ A;  3SQ4 A;  4KHS A;  3SV4 A;  1J5O A;  4Z0U A;  1CXU A;  2XRI A;  4KKO A;  4LD0 A;  3V9X A;  1HQU A;  5E41 A;  1NKB A;  2HB5 A;  1CZ9 A;  3ZSR A;  2Z1J A;  3LZJ A;  2X6N A;  1LV5 A;  4ZHR A;  2D0C A;  2VWJ A;  2PYJ A;  4AHU A;  2HHX A;  4PWD A;  2ATQ A;  3HVT A;  1RBT A;  3QEV A;  3LP2 A;  4HHT A;  3AVK A;  4E7J A;  4F4K A;  2EX3 A;  1JLB A;  5KRS A;  1B9F A;  1VSM A;  2IS3 A;  1NK8 A;  2KFN A;  2D5R A;  4CEQ A;  1L3U A;  4FJ7 A;  4E7I A;  1VSD A;  4R5P A;  3AVA A;  4AHC A;  1JLQ A;  1ZBF A;  3QLH A;  5K14 A;  3ZCM A;  3OYN A;  3OYG A;  1S6Q A;  1UA0 A;  1O1W A;  3HYF A;  4E1N A;  3LPT A;  4DLG A;  4N56 A;  4C8L A;  4IBN A;  3U3G A;  2VG6 A;  1A5X A;  3EYZ A;  1LW2 A;  4FK0 A;  2B5J A;  3THV A;  4M3W A;  1F21 A;  4FLT A;  2X74 A;  3SZ2 A;  4BAC A;  4DTU A;  2O4G A;  1C1C A;  1WLJ A;  3NAE A;  3QEI A;  2OPQ A;  5FRM A;  4OKK A;  4OKJ A;  1YT3 A;  4DSL A;  4W5Q A;  2XY6 A;  2Z1G A;  3TAQ A;  3WNE A;  3V9U A;  3AVF A;  5SWM A;  1RCH A;  3KKR A;  1WSI A;  3MEG A;  2XO7 A;  1TKD A;  3KLG A;  1YVU A;  3DLK A;  4B08 A;  2KZZ A;  4DTS A;  4M3T A;  3C6U A;  2HMI A;  3TWH A;  1U4B A;  2E6M A;  5CYQ A;  3NF8 A;  2QKB A;  3V1O A;  3QES A;  3UIQ A;  2FBX A;  4CJW A;  3V4I A;  1HNV A;  2P51 A;  3P1G A;  3DLR A;  4MQ3 A;  4DSE A;  4H4M A;  1HRH A;  2YNG A;  3ITH A;  3NF7 A;  4CES A;  1KSP A;  3V1Q A;  1A5W A;  4B9U A;  4CF0 A;  2GV9 A;  1SL0 A;  2OZS A;  4H4O A;  4KV8 A;  1TK0 A;  1W0H A;  4MFB A;  1IKW A;  4CJV A;  3QET A;  3MXI A;  3LAL A;  1RTJ A;  4CHO A;  3RRG A;  5KRT A;  4IKF A;  1KFD A;  1RT5 A;  1TKX A;  1JXE A;  3NGY A;  3QIP A;  1KVB A;  4GVM A;  3JSM A;  3CFP A;  4DF8 A;  1T8E A;  1T05 A;  2PYL A;  2OZM A;  4CF8 A;  4CJE A;  3SQ1 A;  4QOZ B;  5C24 A;  3L2U A;  2ZE2 A;  4DU1 A;  5I42 A;  3TAR A;  1RT4 A;  3P5J A;  3RMD A;  3TAG A;  4IFV A;  4LY7 A;  1NJX A;  2W42 A;  3TI0 A;  1BHL A;  3AO2 A;  3NH2 A;  3OY9 A;  4HTU A;  1FK9 A;  4FLV A;  3KLH A;  4CE9 A;  4E7H A;  1UA1 A;  2HNY A;  4CIE A;  3HO1 A;  1S1U A;  2GBZ A;  3VQB A;  4B8A B;  4CEB A;  3MEC A;  4ZTF A;  1L3V A;  3CFR A;  2KW4 A;  1NOZ A;  2RF2 A;  1SV5 A;  4CEF A;  1KTQ A;  2G8W A;  4CEZ A;  4FJN A;  4CGF A;  4CJQ A;  4OVL A;  1HQE A;  4KHU A;  3QER A;  3O4Q A;  4CJ3 A;  3L3V A;  3O3F A;  5EU7 A;  3HP9 A;  4F8R A;  3QNN A;  2P5G A;  3OYI A;  4CJP A;  1T7P A;  4Q0B A;  3ALY A;  4DFM A;  1UWB A;  4KB1 A;  2F8T A;  1REV A;  3TAF A;  1VSH A;  3G10 A;  4QAG A;  4AHR A;  2PZS A;  1TVR A;  4DSJ A;  3HXM A;  2BAN A;  2ZQB A;  3DLG A;  2HW3 A;  1ASW A;  3ZSO A;  3WNF A;  3LAM A;  1FXX A;  2HND A;  4OKE A;  3AO5 A;  3S3M A;  2FBY A;  1RBS A;  4KAZ A;  1BI4 A;  3MXJ A;  4OGC A;  4M45 A;  5KGX A;  1LWF A;  1X9M A;  3B6P A;  4O44 A;  1WN7 A;  3L2W A;  4CGJ A;  3F73 A;  3K5N A;  4JRP A;  3SYZ A;  4JRQ A;  3DRS A;  5HRO A;  2AJQ A;  3PUF A;  2BGG A;  3ZT3 A;  4Q5V A;  3SCX A;  4C8K A;  3CM5 A;  4Y1D A;  4HCB A;  4K8Z A;  4CEE A;  2IAJ A;  4RW4 A;  2G8I A;  3NH0 A;  3AVB A;  4FJX A;  3LWM A;  3IAY A;  1MU2 A;  3NFA A;  3T1A A;  4KHY A;  3VQ7 A;  4CEA A;  3DOL A;  3NGZ A;  2LSN A;  4HUF A;  1N6Q A;  4I2P A;  4CJT A;  3VA0 A;  2BDP A;  4EZ6 A;  1NKC A;  4QCL A;  3AVJ A;  2XY5 A;  3PX6 A;  3AVG A;  2NUB A;  3VQD A;  3L2R A;  3EY1 A;  2HVH A;  1Q9X A;  1JLA A;  2WON A;  2EHG A;  4BWM A;  4CIG A;  4CJR A;  4BE1 A;  3I0R A;  1QHT A;  4KB0 A;  2WOM A;  3HPG A;  1EKE A;  4N5S A;  4DFK A;  3TR8 A;  1RDD A;  1KLM A;  1IO2 A;  4O0J A;  5SZT A;  3L2Q A;  3ASM A;  1RT6 A;  3P83 D;  3K5M A;  1QQC A;  1WAF A;  1N5Y A;  3M8Q A;  4J2A A;  4CK2 A;  1YTA A;  3HP6 A;  1KRP A;  4BE2 A;  4Z4E A;  2B6A A;  4G1Q A;  5HRN A;  3CQ8 A;  3ZSW A;  3VQ9 A;  3AA2 A;  4E3S A;  1ASU A;  2E4L A;  3BGR A;  3OJS A;  4DF4 A;  4B9M A;  4FJ9 A;  3KJV A;  4PA1 A;  3OVN A;  1BIS A;  1BIU A;  1S1X A;  4LSL A;  3A2F A;  2Z1I A;  1HPZ A;  2OPR A;  3AVC A;  3B6O A;  3ZSZ A;  4KO0 A;  4Z4C A;  5KTQ A;  4DS4 A;  4KI6 A;  4DU4 A;  4CGI A;  4KRE A;  1C1B A;  3NF9 A;  4FLX A;  1TK8 A;  3KK3 A;  2YHB A;  1ASV A;  3IG1 A;  3RRH A;  4LH5 A;  1X9W A;  3ZSX A;  3AVH A;  3OYD A;  1JXB A;  2IGI A;  3K5O A;  4OPK A;  1BCM A;  1C0T A;  5FDL A;  3LZI A;  3LAN A;  4DFJ A;  3OYB A;  3HPH A;  3SUP A;  1D5A A;  4DTX A;  4AIL C;  1C1A A;  2X6S A;  3WNG A;  3MXM A;  3G0Z A;  4CJ5 A;  4HUE A;  4HUG A;  3DLH A;  2HHT A;  5CY4 A;  2BE2 A;  5C42 A;  1S5J A;  1KLN A;  4FJM A;  1VSJ A;  2GUI A;  1U48 A;  5C25 A;  4IG3 A;  4NCA A;  1W9H A;  4CK1 A;  3K57 A;  4L8R B;  2IOC A;  2FBV A;  2Y1I A;  4CEO A;  4LH4 A;  4OGE A;  1QSL A;  2QXF A;  3FFI A;  4IFY A;  1BGX T;  3U3Y A;  4Y1C A;  3SI6 A;  1RDC A;  4FYD A;  1VSI A;  1QS4 A;  1XWL A;  3HST B;  4ICL A;  4O55 A;  3DLB A;  4DTR A;  4CER A;  4M42 A;  1YTU A;  1UOC A;  3AO3 A;  4BDZ A;  2YV0 X;  4AHT A;  1UAX A;  4FJG A;  3L3U A;  4N41 A;  4N76 A;  4DWI A;  4CHN A;  3QEP A;  4NCB A;  4DTP A;  2YNH A;  3DRR A;  1SL1 A;  2ITG A;  3NH1 A;  1B9D A;  3VQP A;  1TGO A;  2R7Y A;  1EET A;  3RWU A;  3OYA A;  3LP1 A;  3SUN A;  4CJF A;  3IRX A;  5CZ1 A;  1L5U A;  3SPY A;  1GOB A;  1HYZ A;  3KIO A;  3NE6 A;  4ELT A;  1RBR A;  3AA5 X;  3KD5 E;  4DFP A;  2P1J A;  4LSN A;  4FK4 A;  1BIZ A;  1SKR A;  1TKZ A;  4CHP A;  4FM0 A;  1JLC A;  4FZX C;  2KZM A;  3S3O A;  3NDK A;  3DI6 A;  2HHU A;  5HRS A;  2HHV A;  3QIN A;  1J9A A;  1LAV A;  2RKI A;  1RNH A;  1VSF A;  1U47 A;  3AO4 A;  3DYA A;  3SUQ A;  1ZBL A;  3KK2 A;  4OLB A;  5HLF A;  5HRP A;  4TSX A;  4AHV A;  4I9Q A;  1RT1 A;  3OYF A;  4W5O A;  3LAK A;  4KHW A;  1HNI A;  2HHQ A;  4E1M A;  3OYC A;  4BWJ A;  1NK7 A;  2DFE A;  2OYQ A;  1RTD A;  3ZT0 A;  4FCY A;  3DRP A;  1HYV A;  4W5R A;  5CZ2 A;  3VQA A;  3K58 A;  3TAP A;  3LP0 A;  1QTM A;  2G8U A;  3OS2 A;  4RW7 A;  4KPY A;  1VSE A;  1LWC A;  3K59 A;  3PV8 A;  2RN2 A;  4CGH A;  1WAJ A;  1B92 A;  1FKP A;  4CCH A;  4E7K A;  1NK4 A;  1QSY A;  3ZT2 A;  5HP1 A;  3CM6 A;  4PQU A;  3RMC A;  3OYK A;  4E7L A;  3AO1 A;  3SPZ A;  1IKY A;  4CHY A;  4N47 A;  3KKS A;  3SV3 A;  1BQM A;  3RMA A;  5FRO A;  3KTQ A;  1WSE A;  4M3X A;  3DMJ A;  4FLW A;  2KFZ A;  1X1P A;  4HVJ A;  1JKH A;  3NGI A;  4E19 A;  4M3U A;  3DM2 A;  5DMR A;  4ELU A;  1VSK A;  3HM9 A;  4C8O A;  1WSG A;  4M3Z A;  4KHN A;  4FJ8 A;  1ITG A;  3OYE A;  4CEC A;  4RW8 A;  3HK2 A;  3RTV A;  2Q3S A;  2KQ2 A;  4F2R A;  4DTJ A;  1L3S A;  1GOC A;  3VA3 A;  3IS9 A;  2P5O A;  1DTQ A;  1LW0 A;  2VG5 A;  3KLF A;  4DTN A;  4UQG A;  1SKS A;  3DOK A;  4CHZ A;  4FZY A;  3HPO A;  1Z25 A;  4NYN A;  4FLZ A;  1WSF A;  3C95 A;  4DLE A;  3RMB A;  1FKO A;  1VK0 A;  3TAN A;  2F8S A;  3QIO A;  3T19 A;  1JLG A;  2OA8 A;  1L3T A;  4Z4G A;  3KK1 A;  4DMN A;  3M8P A;  3MED A;  3ZSV A;  4AHS A;  3V6D A;  1JL1 A;  4YFU A;  5J2P A;  3K2P A;  1C0M A;  4JS5 A;  4BDY A;  3DLE A;  3NF6 A;  2FC0 A;  3PO4 A;  1QSS A;  2E6L A;  2QK9 A;  2IDO A;  2A1S A;  4OPJ A;  3T3F A; 
#chains in the Genus database with same CATH topology
 2HOE A;  3L2V A;  3G71 N;  3AVM A;  4EP5 A;  3VQ6 A;  5J1E A;  4PUO A;  3O3H A;  3SBT A;  4CFB A;  4H0O A;  1N36 K;  1Z05 A;  4C8N A;  1D9F A;  3CCJ N;  4O4G A;  3BDP A;  4PY5 A;  3AA3 A;  3CMA N;  1RTI A;  3OHR A;  1XNQ K;  1HJO A;  4DV2 K;  5F0X A;  4GKJ K;  3RR8 A;  3EZ5 A;  1XHX A;  2OPS A;  4WE1 A;  4FJL A;  1WNS A;  3V9Z A;  4JI2 K;  1XC9 A;  3C0B A;  4Z4F A;  2HBM A;  2OCE A;  1G15 A;  3O3G A;  2NRR A;  4Z4I A;  4YNQ A;  3S41 A;  3I0S A;  4KTW A;  4JS4 A;  1NK0 A;  3VEO A;  3MAQ A;  2FSJ A;  1JJ2 M;  3ZET B;  4CF9 A;  3K5L A;  4FM2 A;  1N32 K;  3OYM A;  1ZC6 A;  2UXD K;  1NMD A;  4H5N A;  3UKU A;  3WEE A;  4J2D A;  3OS1 A;  3KLE A;  3M8R A;  1NK9 A;  2Q31 A;  4K8X A;  2P9I A;  1S1W A;  3LDS A;  4KRF A;  4LFB K;  2NRW A;  4CED A;  3O5B A;  3ZT4 A;  4FJ5 A;  1S6P A;  3PY8 A;  3ZEU B;  5GIN A;  1RT2 A;  4KHQ A;  5AQF A;  4A5B A;  1HLU A;  1S1V A;  2WFB A;  3CJ1 A;  3PO5 A;  4CIF A;  4JEP A;  3Q7B A;  3ENO A;  2G8K A;  5J2Q A;  1VSL A;  1JL2 A;  4CF2 A;  1OKJ A;  2YHW A;  3ZSY A;  4YDU C;  3V1R A;  1SKW A;  3LDO A;  3E9P A;  1CZB A;  4IXC A;  2YNI A;  3AVI A;  2D0B A;  4A62 A;  3RR7 A;  4CZG A;  1GLA G;  5AJ3 K;  4IOA L;  1U04 A;  3LP3 A;  4CFD A;  4CJU A;  3NCI A;  4HCC A;  3CG7 A;  1IH7 A;  3O4N A;  4M7Y A;  3WXL A;  4DV1 K;  4FW2 A;  1KCF A;  1BU6 O;  1XI1 A;  4F3O A;  1JCF A;  3C7N B;  1X9S A;  1Q9Y A;  1WUA A;  1TK5 A;  2G8H A;  4YOT A;  1NK6 A;  4FZZ A;  2X78 A;  3ULD A;  1YIT N;  3DLL L;  1HYS A;  4RG8 A;  4CGD A;  3VMF B;  1Q18 A;  2P9K B;  3PSI A;  2UUB K;  1N33 K;  1EP4 A;  2YHY A;  2NRV A;  3SQ4 A;  4Z0U A;  4ISG A;  1CXU A;  4LD0 A;  1HQU A;  5E41 A;  1U2V A;  2HB5 A;  1CZ9 A;  1LV5 A;  2X6N A;  2PYJ A;  3ULE B;  4JD2 A;  4RTF D;  4AHU A;  3QEV A;  3LP2 A;  3H1V X;  2IVN A;  4BQL A;  4A2B A;  2IS3 A;  1NK8 A;  3D6R A;  3HZ6 A;  4CEQ A;  1MDU B;  1L3U A;  4FJ7 A;  4R5P A;  4FVU A;  4BRH A;  3OYN A;  1O1W A;  4GNI A;  3IUC A;  4E1N A;  5B8H A;  3LPT A;  2P9S B;  3U3G A;  1A5X A;  5ADX H;  3VEW A;  3SZ2 A;  1HNZ K;  2F4V K;  2Z1G A;  3TAQ A;  3WNE A;  4BRK A;  3KLG A;  2JWK A;  3DLK A;  5BRH A;  2HMI A;  3SAF A;  5CYQ A;  1HUX A;  3DWL A;  1ESV A;  3QES A;  3UIQ A;  3V4I A;  1XUP O;  1HNV A;  3CIP A;  1EO1 A;  3DLR A;  4FO0 A;  4JK8 A;  2YNG A;  4DV7 K;  1Q7Y O;  1MWM A;  3BZK A;  5AQG A;  3GOI A;  1SL0 A;  1ILY A;  1RTJ A;  2NRH A;  4PKI A;  3CFP A;  1KVB A;  2Q2R A;  3WT0 A;  3AY9 A;  3T7Z A;  2ZE2 A;  5AQT A;  1DEJ A;  4LY7 A;  4PHT X;  1BHL A;  3VEV A;  2GWK A;  1S1U A;  2GBZ A;  3VQB A;  4CEB A;  4H5R A;  3MEC A;  4ZTF A;  4B1U B;  3CFR A;  1IBL K;  1NOZ A;  2RF2 A;  2G8W A;  4FJN A;  2NRT A;  2GUP A;  4CJ3 A;  3L3V A;  4WF9 L;  4CJP A;  2F8T A;  1REV A;  1VSH A;  3I33 A;  1TVR A;  5TKW A;  3HXM A;  2BAN A;  3DLG A;  3LAM A;  1FXX A;  3AO5 A;  2Q0R A;  4YOW A;  4KAZ A;  3MXJ A;  4M63 C;  4CGJ A;  3K5N A;  4JRP A;  2AJQ A;  3DRS A;  4HCB A;  3SCX A;  2KZM A;  4Y1D A;  3ENB A;  4CEE A;  2IAJ A;  4RW4 A;  4DUZ K;  4LF7 K;  3NH0 A;  3AVB A;  4FJX A;  1YJW N;  3THX A;  4CEA A;  4HUF A;  3UKU B;  3WEE B;  3PX6 A;  2NUB A;  3L2R A;  3EY1 A;  1Q9X A;  2P9I B;  2WON A;  4BWM A;  3L4I A;  4CIG A;  4KH6 A;  3N4P A;  5AQV A;  4U67 L;  2ZJR L;  1IO2 A;  5SZT A;  3ASM A;  3QBX A;  2A6A A;  1WAF A;  1DKG D;  3N4Q A;  3HP6 A;  3HSC A;  4FSV A;  4C1N K;  4Z4E A;  4R79 A;  3VQ9 A;  5AFU H;  4BC3 A;  4DF4 A;  4FJ9 A;  3H45 C;  3FR0 A;  1BIS A;  3AAR A;  3OVN A;  1S1X A;  4LSL A;  4BRQ A;  4KO0 A;  4Z4C A;  3MCP A;  4KRE A;  4FLX A;  2UUA K;  3MX2 A;  5KPR A;  3KK3 A;  5LJV A;  3RRH A;  1W2B M;  5E84 A;  3AVH A;  3QML A;  3J7Y P;  1JXB A;  3K5O A;  3TPQ A;  1C0T A;  4GV6 A;  2D0P A;  3D2F A;  1DT9 A;  4DTX A;  4AIL C;  4QS8 A;  5AQH A;  3TSU A;  2X6S A;  3WNG A;  3G0Z A;  4HUE A;  1BA0 A;  3SLC A;  3WQT A;  4FJM A;  3TTF A;  4IG3 A;  4FWM A;  4KH4 A;  1VQK N;  3TSP A;  2E20 A;  2P9U A;  4LH4 A;  5BN9 A;  3CJA A;  3U3Y A;  1EQY A;  3UB5 A;  1QZ6 A;  1XWL A;  5AQP A;  4CER A;  1YTU A;  1NGB A;  2YV0 X;  4AHT A;  3UE5 A;  4DWI A;  3W0L A;  3GDQ A;  1IG8 A;  3CJC A;  5IWA K;  3DRR A;  1GLC G;  2ITG A;  1B9D A;  3VEN A;  3RWU A;  4EHU A;  3SPY A;  2W40 A;  1GOB A;  1HPM A;  1VAZ A;  5JLF A;  3NE6 A;  3AA5 X;  4B1Z A;  4CBW A;  1U2V B;  4E1J A;  4FZX C;  2A40 A;  3S3O A;  1NGH A;  4JD2 B;  5HRS A;  1J9A A;  2RKI A;  3CPW M;  5BN8 A;  3KK2 A;  4OLB A;  2NNW A;  5AZI A;  5HRP A;  4TSX A;  1OVQ A;  2QTD A;  4BRO A;  3LAK A;  3VES A;  3OBW A;  3CER A;  1GLJ O;  2HHQ A;  4JYA K;  1YIJ N;  4LC9 B;  2A3Z A;  3SJH A;  3T69 A;  1JCE A;  4CZL A;  3FZH A;  1VSE A;  5M1N A;  1EWQ A;  1QSY A;  3ZT2 A;  4MDB A;  3CM6 A;  1KC8 O;  3R3L A;  2CH5 A;  4CHY A;  3SPZ A;  3KKS A;  4CZH A;  3SV3 A;  3RMA A;  3KTQ A;  1K8A O;  4IOX A;  4HVJ A;  4IEI A;  4E19 A;  3DM2 A;  4H5V A;  4M7X A;  2E2P A;  4C8O A;  3OYE A;  2Q3S A;  5AQW A;  3K9J A;  3DXM B;  4DTN A;  2UUC K;  4UQG A;  3DOK A;  4FZY A;  3HPO A;  4YDU A;  1Z25 A;  2F8S A;  1VK0 A;  4BR2 A;  3GL1 A;  1JLG A;  4WFA L;  3M8P A;  4YFU A;  4CZJ A;  1NNE A;  3DLE A;  1QSS A;  2GEL A;  2FSK A;  4DQ8 A;  3O4W A;  1WB9 A;  4LFA K;  3MN6 A;  3OYL A;  1NJY A;  3GE1 A;  1X3M A;  3OJU A;  4LF5 K;  1RTH A;  3CJ9 A;  3MWT A;  3MK6 A;  2E2N A;  1RIL A;  2CGL A;  4BR7 A;  5JVH L;  3E66 A;  1NJZ A;  4IFE A;  3THY A;  1WSH A;  1IBM K;  2KLA A;  3QB0 A;  4BDP A;  4JKF A;  1KXP A;  4CGG A;  3NHG A;  2Q1N A;  4EFH A;  3NBP A;  3C94 A;  3VQ4 A;  4FVM A;  2HBK A;  1KVC A;  5AQK A;  2VCP A;  5TKY A;  4GW6 A;  2ZD1 A;  3SK3 A;  4CFA A;  2IC3 A;  3SQ2 A;  2HNZ A;  4BRP A;  3EL2 A;  1BUP A;  1C0F A;  3PX4 A;  3R8E A;  4BRD A;  3VF6 A;  2Z1H A;  2B4J A;  3THX B;  1W7A A;  1Y97 A;  1HX1 A;  1ZYQ A;  2JLE A;  5M1K A;  1P90 A;  3MEE A;  4FJJ A;  3SUO A;  2Y1J A;  1C0G A;  5BR8 K;  1JLF A;  2FBT A;  5JS2 A;  4DSF A;  2UU9 K;  3KD1 E;  3V81 A;  2Q36 A;  3HL8 A;  3JYT A;  4J2E A;  1DTT A;  4IDK A;  3F9K A;  1D8Y A;  4E89 A;  2CH6 A;  5C0Y A;  1QZ5 A;  2QKK A;  3QIC A;  4FLY A;  3CYM A;  1WSJ A;  1H1V A;  3WXK A;  1S1T A;  2XY7 A;  5I3U A;  4B3S K;  4IG0 A;  1DGK N;  4ILH A;  3J8A A;  1MWK A;  4H0V B;  3VGK A;  2G8F A;  4XIU A;  2WBN A;  2HHS A;  2YJE A;  4C8M A;  2NZT A;  3AV9 A;  4ILG B;  5T7B A;  2A42 A;  1BQN A;  3P4I A;  2D0O A;  4G9Z A;  1I39 A;  1M1K O;  1RBU A;  4O5B A;  3SMP A;  3D2F B;  1XHZ A;  1JLE A;  1BL3 A;  4IO8 A;  2YX6 A;  1RT3 A;  4B9S A;  2NLX A;  3O1W A;  2HBL A;  3D45 A;  2F96 A;  3ZYY X;  3DXK A;  1VRU A;  3J7Z O;  3MX5 A;  2P9U B;  1IKX A;  4DQI A;  4IWV A;  2ITM A;  1A5V A;  3AVL A;  4FLU A;  3V9W A;  4FJI A;  1IV0 A;  1TL3 A;  2D0A A;  4DV5 K;  1YHQ N;  3AAP A;  2YI1 A;  4AF1 A;  3TAE A;  3TU5 A;  3HVR A;  1C6V A;  2KTQ A;  4DR5 K;  2E5L K;  4LF6 K;  1SAZ A;  3WXJ A;  4BG9 A;  4Y0W A;  1EX4 A;  4Z94 A;  4DQS A;  5J2M A;  1U45 A;  5AZJ B;  4KTZ A;  2YJF A;  3H3O B;  4DQP A;  4L3Q A;  4LF9 K;  3HJF A;  3ZX3 A;  1RDA A;  4O0I A;  3VN5 A;  1IG9 A;  4DG1 A;  4BR9 A;  1S9G A;  2RPI A;  2VYP A;  2PBD A;  4X65 K;  1OH6 A;  3SV4 A;  3PLA A;  2XRI A;  3V9X A;  1NKB A;  4BRN A;  5BRD A;  2W41 A;  4FWN A;  5AZI B;  3CCR N;  3BZC A;  1GLD G;  3TTD A;  4PWD A;  3A5M C;  4CI6 A;  4HHT A;  1LCU A;  2UYT A;  5KRS A;  2V7Y A;  2RHK A;  1JLQ A;  3QLH A;  3OYG A;  1RDU A;  1ATS A;  5M1Q A;  3K0S A;  4DLG A;  4N56 A;  3THV A;  4M3W A;  4DTU A;  2VWB A;  2X74 A;  5FRM A;  5AQO A;  4DSL A;  5HL7 L;  1NGF A;  3EN9 A;  1WSI A;  1TKD A;  4LF8 K;  5FLX O;  2JWL A;  5BPN A;  4JKB A;  2IVP A;  2E6M A;  4FWL A;  4CBU A;  3NF8 A;  1U4B A;  1NGA A;  3V1O A;  2VGN A;  4CJW A;  3P1G A;  4WCE L;  4DSE A;  4H4M A;  3NF7 A;  3ENH A;  4JKD A;  3V1Q A;  1A5W A;  4B9U A;  5MLC Q;  3GG4 A;  4H4O A;  1TK0 A;  3NMU A;  1W0H A;  4BR5 A;  1IKW A;  3LDQ A;  3LAL A;  4BY9 C;  4IKF A;  4IZ9 A;  3NGY A;  3QIP A;  4GVM A;  3JSM A;  1T05 A;  2OZM A;  4ISF A;  4QOZ B;  2PYL A;  4V19 S;  4CF8 A;  4CJE A;  5C24 A;  5I9E B;  4DU1 A;  3P5J A;  3RMD A;  3E1Y A;  4IFV A;  1NJX A;  3TI0 A;  3AO2 A;  3NH2 A;  2QI2 A;  4B8A B;  3THY B;  1L3V A;  2KW4 A;  3MN7 A;  5LJW A;  1KTQ A;  2BUP A;  1HQE A;  5BPM A;  2E1Y A;  4KHU A;  4BRA A;  4EHT A;  2F9W A;  3QNN A;  2P5G A;  3CC7 N;  4KB1 A;  4JKE A;  2UXC K;  3G10 A;  4AHR A;  1XMO K;  3ZSO A;  4OKE A;  3J7A P;  3KWI A;  1RBS A;  1YF5 L;  5AQM A;  1BI4 A;  2CGJ A;  4OGC A;  4O44 A;  1WN7 A;  3F73 A;  4CD3 A;  2O8E A;  3P31 A;  3ZT3 A;  3LL3 A;  1MA9 B;  5GAG P;  4DR6 K;  2WTU A;  5AQL A;  5F1X A;  4BGB A;  1M90 O;  3NFA A;  1KAY A;  2LSN A;  4I2P A;  2BDP A;  1NKC A;  2XY5 A;  5GAH P;  2HVH A;  5F2R A;  2EHG A;  3I0R A;  3HOS A;  3R1X A;  2WOM A;  3O6W A;  1EKE A;  4N5S A;  3TR8 A;  1RDD A;  2I7P A;  4JHD A;  3NVM A;  3P83 D;  1N5Y A;  3ID6 A;  3M8Q A;  4F9O A;  3A5L C;  4CK2 A;  3R6M A;  3PSF A;  3CPE A;  5KPZ A;  3D7E O;  1BO5 O;  3KJV A;  4PA1 A;  1BIU A;  3E9O A;  5AQU A;  4XH4 A;  4IEE A;  2YHB A;  3HM8 A;  2V7Z A;  3IG1 A;  4O5F A;  4WFB L;  3PIO L;  5BRF A;  3DXK B;  3LAN A;  4DFJ A;  3HPH A;  1J6Z A;  3HRG A;  1D5A A;  1WOQ A;  3MXM A;  3K9K A;  3DLH A;  4JK7 A;  4MO4 A;  3VEY A;  3K57 A;  4L8R B;  2IOC A;  4A57 A;  2Y1I A;  2Q97 A;  2QXF A;  3FFI A;  3F2K A;  5AQS A;  3SI6 A;  1RDC A;  1VQP N;  2GTD A;  3Q7C A;  5GAD P;  2ZWH A;  2UXB K;  4DR2 K;  3HST B;  1QS4 A;  4ICL A;  2NRX A;  4M42 A;  4FWO A;  4K41 A;  4BC5 A;  1UOC A;  1XMQ K;  3MMV A;  1UAX A;  4N76 A;  4CHN A;  3QEP A;  3BUZ B;  4FWS A;  4K43 A;  3VQP A;  1TGO A;  4NXN K;  4BRG A;  3LP1 A;  2OAN A;  4B1Y B;  2FSN A;  4CHP A;  4JI3 K;  4MO5 A;  4FM0 A;  2HHU A;  2HHV A;  1O13 A;  1JCG A;  4JKG A;  1NU0 A;  3B8A X;  3AO4 A;  1YXQ A;  3L0Q A;  4CZK A;  2AP1 A;  4I9Q A;  3CCS N;  1RT1 A;  3OYF A;  4W5O A;  3PIP L;  1HNI A;  1TYQ A;  4E1M A;  3OYC A;  4BWJ A;  4H5T A;  3ZT0 A;  3KVG A;  3DRP A;  1HYV A;  2ZGY A;  1NLV A;  3TAP A;  4RW7 A;  1TUU A;  2E1Z A;  1LWC A;  3PV8 A;  1WAJ A;  3VTH A;  5LY3 A;  4CCH A;  1NK4 A;  4LF4 K;  3OYK A;  4E7L A;  2FXU A;  3AO1 A;  1VQ5 N;  3O08 A;  5AQX A;  2KFZ A;  1JKH A;  4ELU A;  3CCQ N;  3HM9 A;  4M3Z A;  1WSG A;  4FJ8 A;  1I94 K;  2KQ2 A;  5GIO A;  3O1B A;  1DTQ A;  1LW0 A;  3KLF A;  4NLC A;  1OH5 A;  1SKS A;  2QWM A;  4NYN A;  3HI0 A;  3CCU N;  1QVG M;  3KK1 A;  2HF4 A;  4K42 A;  4AHS A;  3ZSV A;  3V6D A;  5J2P A;  1TUY A;  1E3M A;  3BF1 A;  1NGI A;  2QK9 A;  2IDO A;  4OPJ A;  3T3F A;  1XC3 A;  3V9S A;  3H1Q A;  1HNX K;  5M1F A;  3CHW A;  4H0Y B;  4GMJ B;  1TAU A;  3VER A;  5EVZ A;  4FJH A;  1VQ8 N;  4IOC L;  4YOY A;  2DY4 A;  4KI4 A;  1C0U A;  4M41 A;  4DTO A;  1TV6 A;  1IKV A;  4YHH K;  4U7B A;  4E0D A;  1RDB A;  1BI4 B;  2E2O A;  1CXQ A;  5C12 A;  3A5O C;  2VG7 A;  4I2Q A;  3E01 A;  1NGG A;  4A2A A;  4DB3 A;  4NYF A;  4F3T A;  4A59 A;  1Q81 O;  1NBW A;  4RW9 A;  1RT7 A;  3L8B A;  3CFO A;  5KI6 A;  5HBM A;  1T03 A;  4B9L A;  2ETJ A;  2WUS A;  4XH1 A;  5KGW A;  4FW1 A;  4F2S A;  2J4R A;  3CJB A;  5CHI A;  1NGE A;  1R0A A;  4FK2 A;  1NGJ A;  4FJK A;  1U49 A;  1LAW A;  4JHD B;  4FWP A;  2Q0U A;  3H46 O;  3HBT A;  1ZBU A;  3LM9 A;  4FWQ A;  2VQF K;  3U8X A;  4CJ4 A;  1I3A A;  3VQC A;  4M3Y A;  2PFU A;  3AVN A;  4WQ5 A;  3WXM B;  5CYM A;  3KK7 A;  1E4G T;  3LWL A;  4BE0 A;  4Z4H A;  4GKK K;  2DPN A;  1V4T A;  5IT9 O;  1CLQ A;  4B9N A;  3ATU A;  2HHW A;  3I8D A;  3VQQ A;  1HJR A;  1VRT A;  1RBV A;  1BCO A;  1T7P A;  4M3R A;  5ELZ A;  2HHH K;  2QEX N;  3H08 A;  3P39 A;  4HWI A;  1TAQ A;  4B3O A;  2G8V A;  1VHX A;  4CZF A;  3U6F A;  4FXD A;  1QQO A;  4FOI A;  3O9Q A;  2YNF A;  4CJL A;  1CZA N;  2I5J A;  5H1S Q;  4AM6 A;  3OS0 A;  2YKM A;  5CE3 A;  3LPU A;  2HST A;  4CK3 A;  4BRF A;  4CJS A;  1X3N A;  4DTM A;  4I9L A;  4DQQ A;  3OTO K;  3QFP A;  1D9D A;  1GOA A;  4GVE A;  5FRN A;  3LDL A;  3SQ0 A;  2YHA A;  4ID1 A;  4CF1 A;  4WQ4 A;  4OJR A;  2A5X A;  5M1O A;  5FPM A;  1QQM A;  1GLL O;  3S3N A;  3SAG A;  5HRR A;  1DLO A;  4OLA A;  4CFC A;  2BH1 A;  3WNH A;  3ZET A;  2VWK A;  4FL9 A;  4JK9 A;  4KFB A;  1NGC A;  3SJJ A;  4YY3 K;  2XHB A;  2GX9 A;  3M6G A;  1HNW K;  2HF3 A;  4BG8 A;  3S9H A;  3G6E N;  1QE1 A;  3O9U A;  4AQY K;  4DSI A;  1ZBH A;  1VQO N;  1VQM N;  1HKG A;  4JKG B;  4KHS A;  1J5O A;  3HTV A;  4KKO A;  3ZSR A;  2Z1J A;  4ZHR A;  3F9M A;  1TYQ B;  1RBT A;  3L4Q A;  1SS6 A;  3AVK A;  4E7J A;  4DV6 K;  4DKW A;  2KFN A;  4AHC A;  1ZBF A;  5K14 A;  5M1P A;  1UA0 A;  1XNR K;  3HYF A;  3CI5 A;  5LMU K;  4FK0 A;  2B5J A;  4FLT A;  4BAC A;  3ATV A;  3KWG A;  3QEI A;  2OPQ A;  5FPN A;  4OKK A;  4OKJ A;  4W5Q A;  3T1Y K;  3AVF A;  2XO7 A;  3KKR A;  2KZZ A;  4DTS A;  3O9S A;  4M3T A;  3C6U A;  3TWH A;  1RGI A;  3FE1 A;  2QKB A;  4BQZ A;  2P51 A;  2CGK A;  2P9N A;  2FLO A;  1KSP A;  4CF0 A;  3UKR A;  1X9J A;  4KV8 A;  3QET A;  4CJV A;  3MXI A;  3RRG A;  4BC4 A;  4PKH A;  1KFD A;  4H0P A;  1JXE A;  4CZI A;  2FF3 B;  3LDP A;  3SQ1 A;  5I42 A;  2W42 A;  4HTU A;  1UA1 A;  3HO1 A;  1FK9 A;  3E9L A;  4CE9 A;  3KLH A;  4DCH A;  1EWR A;  4B3T K;  4JKH A;  2ZGZ A;  4B1X B;  3EE9 A;  3O9R A;  3EKS A;  1SV5 A;  1RDW X;  5AQY A;  4CGF A;  4CJQ A;  3QER A;  3O4Q A;  3O3F A;  5EU7 A;  3D2E A;  3CME N;  1P8Z A;  4B3M K;  3OYI A;  2QW9 A;  3ALY A;  4DFM A;  4A5A A;  3RVC A;  3SMS A;  3WNF A;  3VF2 A;  2F9T A;  2RE2 A;  2FBY A;  3TSQ A;  4JNE A;  4M45 A;  3I55 N;  3B6P A;  3SYZ A;  3I8B A;  4JRQ A;  1T3V A;  3PUF A;  4Q5V A;  4C8K A;  4WFN L;  1N8R O;  1Z6R A;  1NM1 A;  3VGL A;  3VOV A;  3LWM A;  1MU2 A;  1QHA A;  5AQJ A;  4KHY A;  3VQ7 A;  3NGZ A;  3VPZ A;  1VQ9 N;  1GLB G;  3EEQ A;  3MDQ A;  3VQD A;  4CJR A;  4BE1 A;  4JI1 K;  1FJG K;  1KQS M;  5KQD A;  4DFK A;  1KLM A;  3FFK B;  4O0J A;  3L2Q A;  4BVP A;  1BWF O;  1RT6 A;  4B1W B;  3K5M A;  1QQC A;  3CQX A;  3CCE N;  3CF5 L;  4J2A A;  1YTA A;  5JIC A;  1KRP A;  4BE2 A;  3ZLJ A;  5HRN A;  3CQ8 A;  3ZSW A;  4B9M A;  3AA2 A;  5EY4 A;  3BGR A;  2E4L A;  3JAM O;  1N34 K;  3O9T A;  2Z1I A;  3AVC A;  2OPR A;  3B6O A;  5KTQ A;  5ADX A;  3NF9 A;  2O8C A;  3U9Z A;  4ISE A;  1BOT O;  3WXI A;  3ZSX A;  3OYD A;  2IGI A;  3LZI A;  4JI5 K;  5FDL A;  4O8K A;  3OYB A;  3IMX A;  4WQ5 C;  4IO9 L;  1NG9 A;  5C15 A;  4CJ5 A;  2HHT A;  3VEX A;  5CY4 A;  5C42 A;  1S5J A;  4NB4 A;  4BRL A;  1VSJ A;  2GUI A;  1T44 A;  4ILJ A;  3G25 A;  4I6M A;  4CK1 A;  1E4F T;  3CET A;  2FBV A;  4CEO A;  2ASM A;  4BRC A;  3CC4 N;  4JI0 K;  2ZF5 O;  4JI6 K;  3NVK A;  2P9P A;  1BGX T;  4Y1C A;  3FGU A;  1VSI A;  3BEX A;  5C2D A;  3DLB A;  4DTR A;  5AQQ A;  4BDZ A;  4FJG A;  4N41 A;  1K8K A;  4DTP A;  1SL1 A;  1HKC A;  3NH1 A;  5EXW A;  4IJN A;  1EET A;  3OYA A;  1KAX A;  3IRX A;  5CZ1 A;  3EE8 A;  3ZX0 A;  3KIO A;  4RWT A;  2H3G X;  4WQ4 C;  1WBB A;  2P1J A;  2ZJQ L;  1TKZ A;  4IDH A;  3NDK A;  3DI6 A;  3QIN A;  5FPE A;  3FZF A;  4DV0 K;  4C1N I;  3DYA A;  3VTI A;  2KKZ A;  1U47 A;  2F7T A;  1ZBL A;  1QQN A;  2WC9 A;  1NK7 A;  4FCY A;  2HBJ A;  4W5R A;  3EO3 A;  3MN9 A;  3VQA A;  2G8U A;  5CR4 A;  4KPY A;  4JKC A;  2FF6 A;  3K59 A;  4CGH A;  1B92 A;  3J80 O;  1U6Z A;  4PQU A;  4M3X A;  4FWR A;  1WSE A;  3DMJ A;  4FLW A;  4FPA A;  4GV9 A;  4B3R K;  5DMR A;  1VQN N;  1VSK A;  3ZX2 A;  4KHN A;  3C65 A;  4RW8 A;  1NGD A;  2P9N B;  4F2R A;  4JN4 A;  1L3S A;  1GOC A;  2P5O A;  3C6H A;  5AFU A;  1YI2 N;  2VG5 A;  5DM7 L;  2O8F A;  1NWK A;  3UKR B;  4B1V A;  3C95 A;  4DLE A;  4FLZ A;  1YUW A;  3T19 A;  1L3T A;  4Z4G A;  3TTC A;  5C2F A;  1BA1 A;  1YAG A;  1JL1 A;  3WUH A;  3K2P A;  1IBK K;  4JS5 A;  2FC0 A;  1S22 A;  3PO4 A;  5JVG L;  4FK4 A;  4BGA A;  5LMN K;  2DFF A;  5KPT A;  3O8M A;  2E2Q A;  1Q8I A;  4KHP K;  2IIR A;  3CCL N;  4KTQ A;  1WBD A;  4DUY K;  3D2E B;  1ZXO A;  3PX0 A;  3RSE A;  2DTU A;  1NKE A;  3VQE A;  4ELV A;  1J5E K;  4BR0 A;  3ZSQ A;  4EP4 A;  2ASP A;  2QA4 N;  4JLH A;  1VQ4 N;  4FM1 A;  5D3G A;  4B9T A;  1VQ7 N;  4DQR A;  1K6Y A;  3FZM A;  4EZ9 A;  4CBX A;  2OTL N;  4NCG A;  4CD1 A;  4DU3 A;  2PY5 A;  3QBW A;  3QEX A;  3H6E A;  2QXL A;  4B8C A;  1ZBI A;  4EAH D;  2OPP A;  5DK5 A;  4JI7 K;  5EX5 A;  4H8K A;  4RCH A;  4DSK A;  4W5T A;  1KFS A;  3QO9 A;  4AH9 A;  4RW6 A;  3TAB A;  1HMV A;  1TKT A;  4NLB A;  4ZTJ A;  4X62 K;  3OYJ A;  4H0T B;  1J54 A;  5DM6 L;  3C6T A;  4YOR A;  3DXM A;  4OX9 K;  3AA4 A;  4CJK A;  2XY8 A;  2D1K A;  3M8S A;  4W5N A;  3ZT1 A;  3T1H K;  3SNN A;  2A1R A;  4PKG A;  2O8C B;  1NJW A;  2DFH A;  1S9E A;  3A5N C;  4BRM A;  1LWE A;  1SL2 A;  3ISN C;  4YOU A;  4QS7 A;  4CZE A;  3QNO A;  2W6K A;  5J2N A;  3SAH A;  1TL1 A;  4UY8 O;  3C6A A;  4J2B A;  2HVI A;  1T6C A;  3THW A;  3VQ5 A;  4WYB A;  4OO1 J;  1KAZ A;  5BR9 A;  4I6M B;  4X64 K;  3P38 A;  4J8F A;  3QEW A;  3HT3 A;  2YKN A;  1KVA A;  2P9P B;  5AR0 A;  1J53 A;  3VQ8 A;  4CHQ A;  3KLI A;  3D0P A;  2HMP A;  1SUQ A;  3CXC M;  4B9V A;  2KHO A;  1NK5 A;  1K8K B;  4NXM K;  3M1F A;  3A0I X;  3OYH A;  3VGM A;  2O8D A;  4I7F A;  3LDN A;  3MCA B;  5JS1 A;  1IJJ A;  1Z26 A;  2O4I A;  3J81 O;  1NOY A;  4ID5 A;  3DAW A;  2JGU A;  3OA9 A;  3TAM A;  4HTL A;  2VGM A;  4H03 B;  4DS5 A;  1Q82 O;  2A41 A;  1EXQ A;  3A8Y A;  1OH7 A;  4DHY A;  2YHX A;  3LZJ A;  2OTJ N;  1RFQ A;  2D0C A;  2VWJ A;  2HHX A;  5LL6 Z;  2ATQ A;  3HVT A;  1HKB A;  4F4K A;  2EX3 A;  4A61 A;  1JLB A;  1B9F A;  1VSM A;  2QWP A;  4XH5 A;  2D5R A;  4CW7 B;  1VQL N;  2O8E B;  4E7I A;  1VSD A;  3AVA A;  3ZCM A;  1S6Q A;  3IDH A;  1HR0 K;  1NMN A;  4C8L A;  4IBN A;  2VG6 A;  3EYZ A;  1LW2 A;  5EOY A;  2D4W A;  1F21 A;  3CCM N;  2O4G A;  1C1C A;  1WLJ A;  3NAE A;  5GIP A;  2P9L A;  4DV4 K;  4DR3 K;  1YT3 A;  2XY6 A;  3OBY A;  3G4S N;  3V9U A;  5AQI A;  5SWM A;  1RCH A;  3MEG A;  2O8B A;  1KD1 O;  1YVU A;  4B08 A;  1K73 O;  4CZM A;  5JMV A;  4X66 K;  2O8F B;  3FZK A;  2FBX A;  4MQ3 A;  4FOE A;  1HRH A;  3ITH A;  4CES A;  2BTF A;  2GV9 A;  4MDA A;  2OZS A;  4MFB A;  4CHO A;  5KRT A;  3KZB A;  3EKU A;  1RT5 A;  1TKX A;  4DF8 A;  5AZJ A;  3L2U A;  1T8E A;  3TAR A;  2ZJP L;  1RT4 A;  3TAG A;  3DJC A;  4NO7 A;  1YJN N;  3OY9 A;  4FLV A;  4E7H A;  2HNY A;  3RSE B;  2QWO A;  4CIE A;  2YCH A;  4DR7 K;  4KBO A;  3CC2 N;  4EIA A;  2QWL A;  4YOV A;  4CEF A;  4CEZ A;  4OVL A;  3HP9 A;  4F8R A;  2VQE K;  1GLE G;  1OVY A;  4Q0B A;  3M3Z A;  2QM1 A;  1ZBS A;  1UWB A;  5C10 A;  2EWS A;  4QAG A;  3TAF A;  2PZS A;  5FPD A;  4DSJ A;  2ZQB A;  2PAV A;  2GWJ A;  3VEZ A;  2HW3 A;  1ASW A;  1SZ2 A;  4DV3 K;  4YOX A;  2HND A;  3S3M A;  3IKM A;  1VQ6 N;  1X9M A;  5KGX A;  1LWF A;  1BG3 A;  3L2W A;  5AQR A;  4B9Q A;  5HRO A;  2BGG A;  2IVO A;  5E26 A;  4K8Z A;  3CM5 A;  3CD6 N;  1ATN A;  3CCV N;  4H0X B;  2G8I A;  4O8U A;  1XQS C;  3IAY A;  3JS6 A;  3T1A A;  1QVF M;  3DOL A;  2E8A A;  1N6Q A;  4CJT A;  3VA0 A;  4QCL A;  4EZ6 A;  1BDG A;  3AVJ A;  3AVG A;  4C23 A;  4OPA A;  1JLA A;  1QHT A;  5BPL A;  4KB0 A;  5A2Q O;  3U4L A;  3HPG A;  2ZM6 K;  2V51 B;  1OH8 A;  3GBT A;  2B6A A;  4G1Q A;  5AQZ A;  1D4X A;  1GLF O;  2I7N A;  4E3S A;  3ZEU A;  1ASU A;  1YVN A;  4PL7 A;  3OJS A;  3CQY A;  4FPB A;  3BF3 A;  1NJI O;  1W97 L;  3A2F A;  1HPZ A;  3ZSZ A;  4KI6 A;  1T6D A;  4DS4 A;  4DU4 A;  4CGI A;  2V52 B;  1C1B A;  1TK8 A;  4JI8 K;  3WQU A;  1ASV A;  4H5W A;  4DR1 K;  4LH5 A;  3THW B;  1X9W A;  4OPK A;  1BCM A;  3FLC O;  3QDK A;  3SUP A;  3O80 A;  1C1A A;  4HUG A;  4LFC K;  2BE2 A;  3H3N O;  1KLN A;  3BY5 A;  5GAE P;  5C25 A;  1U48 A;  5BRE A;  4NCA A;  1W9H A;  4DR4 K;  1V4S A;  4OGE A;  4BRI A;  2W6L A;  1QSL A;  4IFY A;  4FYD A;  4O55 A;  3F5T A;  4OPH A;  1R59 O;  2AA4 A;  2O8D B;  3ID8 A;  3AO3 A;  2QWQ A;  3L3U A;  3C7N A;  4NCB A;  3EZW A;  2YNH A;  5HOO A;  3HOT A;  3JXU A;  2R7Y A;  4AM7 A;  3SUN A;  4CJF A;  4MLH A;  1L5U A;  1HYZ A;  4ELT A;  1RBR A;  4JKA A;  1Q86 O;  2QWR A;  3KD5 E;  4DFP A;  4LSN A;  2ASO A;  1BIZ A;  4K0K K;  1SKR A;  4FWK A;  2P9K A;  1JLC A;  1FW6 A;  5JLH A;  3I56 N;  3AGK A;  3U9D A;  4PL8 A;  2GEM A;  4BRE A;  1LAV A;  1RNH A;  1VSF A;  3SUQ A;  4GY2 B;  5HLF A;  4K25 A;  4AHV A;  3L6Q A;  2QWN A;  3BP8 A;  4JI4 K;  3ULE A;  4KHW A;  5KQ8 A;  3CJ7 A;  2DFE A;  2OYQ A;  1RTD A;  4JAX A;  1S72 N;  5CZ2 A;  3K58 A;  3LP0 A;  1S3X A;  1QTM A;  3OS2 A;  3VET A;  3VF4 A;  3R9P A;  2P9L B;  3AAQ A;  3QFU A;  1SQK A;  2RN2 A;  1FKP A;  4E7K A;  5HP1 A;  3OW2 M;  1K9M O;  3FZL A;  2NRZ A;  2P9S A;  3RMC A;  1LOT B;  4IJA A;  2O8B B;  1IKY A;  4N47 A;  1BQM A;  4QS9 A;  5FRO A;  2E88 A;  3W3D A;  1X1P A;  3NGI A;  4M3U A;  4XEI A;  3MWP A;  4JV5 K;  1ITG A;  1Y64 A;  3AGR A;  4CEC A;  4CVN E;  3HK2 A;  3RTV A;  4DTJ A;  3VA3 A;  3IS9 A;  3IFR A;  3M5R A;  4MLE A;  4BC2 A;  4BVO A;  4GV3 A;  4CHZ A;  4BR4 A;  1G99 A;  1WSF A;  3MN5 A;  3RMB A;  3TAN A;  1FKO A;  3QIO A;  3LM2 A;  3SBG A;  2OA8 A;  4KH5 A;  3KHY A;  4DMN A;  3MED A;  1C0M A;  4BDY A;  3NF6 A;  4CJ7 A;  1ATR A;  1YJ9 N;  2E6L A;  2A1S A;  5AQN A; 
#chains in the Genus database with same CATH homology
 3OYL A;  1NJY A;  3OJU A;  3V9S A;  1RTH A;  3L2V A;  2DFF A;  3AVM A;  4EP5 A;  1TAU A;  4GMJ B;  3VQ6 A;  5J1E A;  4PUO A;  1Q8I A;  3O3H A;  4FJH A;  1RIL A;  4CFB A;  4KTQ A;  4C8N A;  3PX0 A;  1NJZ A;  1D9F A;  2DY4 A;  4KI4 A;  4O4G A;  2DTU A;  1C0U A;  1WSH A;  1NKE A;  3BDP A;  3VQE A;  4ELV A;  4PY5 A;  4M41 A;  4DTO A;  1TV6 A;  3AA3 A;  3ZSQ A;  4EP4 A;  1RTI A;  4BDP A;  4CGG A;  3NHG A;  4JLH A;  1IKV A;  3NBP A;  3C94 A;  3RR8 A;  3VQ4 A;  4FM1 A;  4E0D A;  3EZ5 A;  1XHX A;  4B9T A;  5D3G A;  1RDB A;  4FVM A;  1BI4 B;  1CXQ A;  4DQR A;  2OPS A;  1K6Y A;  1KVC A;  4WE1 A;  4GW6 A;  2ZD1 A;  4FJL A;  4EZ9 A;  4CFA A;  2IC3 A;  1WNS A;  2VG7 A;  4I2Q A;  3V9Z A;  2HNZ A;  3E01 A;  3SQ2 A;  1XC9 A;  4NCG A;  4DU3 A;  4Z4F A;  3PX4 A;  2PY5 A;  4NYF A;  4F3T A;  3QEX A;  1G15 A;  3O3G A;  2Z1H A;  2B4J A;  4RW9 A;  4YNQ A;  1RT7 A;  4Z4I A;  3I0S A;  4KTW A;  1Y97 A;  4B8C A;  3L8B A;  4JS4 A;  3MAQ A;  1ZYQ A;  1NK0 A;  3CFO A;  2JLE A;  1ZBI A;  3MEE A;  2OPP A;  5KI6 A;  4FJJ A;  5DK5 A;  3SUO A;  5HBM A;  4CF9 A;  2Y1J A;  3K5L A;  1T03 A;  4B9L A;  2ETJ A;  5KGW A;  4H8K A;  1JLF A;  2FBT A;  5JS2 A;  4FW1 A;  4FM2 A;  4DSF A;  3OYM A;  3V81 A;  4DSK A;  4W5T A;  3KD1 E;  4F2S A;  1R0A A;  3HL8 A;  4FK2 A;  3JYT A;  4J2E A;  1DTT A;  4IDK A;  3F9K A;  1KFS A;  4FJK A;  1D8Y A;  1U49 A;  1LAW A;  3QO9 A;  4E89 A;  4AH9 A;  4J2D A;  3OS1 A;  4RW6 A;  3KLE A;  3M8R A;  3TAB A;  1NK9 A;  2QKK A;  1HMV A;  1TKT A;  1ZBU A;  4FLY A;  4K8X A;  4ZTJ A;  1S1W A;  3CYM A;  3LDS A;  4KRF A;  3OYJ A;  1WSJ A;  1J54 A;  4CED A;  4CJ4 A;  1I3A A;  3C6T A;  3VQC A;  3ZT4 A;  4FJ5 A;  1S6P A;  1S1T A;  3AA4 A;  2XY7 A;  4CJK A;  2XY8 A;  5I3U A;  3PY8 A;  4M3Y A;  4IG0 A;  3M8S A;  3AVN A;  4W5N A;  1RT2 A;  3ZT1 A;  5CYM A;  3LWL A;  4BE0 A;  3SNN A;  4Z4H A;  2G8F A;  2A1R A;  4KHQ A;  4XIU A;  1CLQ A;  2HHS A;  4B9N A;  4C8M A;  1NJW A;  2HHW A;  1S1V A;  2DFH A;  3AV9 A;  1S9E A;  3VQQ A;  5T7B A;  3I8D A;  1BQN A;  1HJR A;  1LWE A;  1VRT A;  3PO5 A;  4CIF A;  1SL2 A;  3ISN C;  2G8K A;  1RBV A;  1BCO A;  1JL2 A;  1I39 A;  1VSL A;  5J2Q A;  1RBU A;  4M3R A;  3QNO A;  4O5B A;  3H08 A;  4CF2 A;  3ZSY A;  5J2N A;  1JLE A;  1XHZ A;  1BL3 A;  1RT3 A;  1TL1 A;  3V1R A;  1TAQ A;  4B3O A;  4B9S A;  4J2B A;  2G8V A;  2HVI A;  1SKW A;  3VQ5 A;  1CZB A;  3U6F A;  3D45 A;  4FXD A;  2F96 A;  2YNI A;  3AVI A;  2YNF A;  1VRU A;  4CJL A;  2D0B A;  2I5J A;  3RR7 A;  3QEW A;  3OS0 A;  2YKM A;  3LPU A;  1IKX A;  4DQI A;  4CK3 A;  2YKN A;  4CJS A;  3HT3 A;  4DTM A;  4I9L A;  4DQQ A;  1KVA A;  1U04 A;  1D9D A;  3LP3 A;  4CFD A;  1A5V A;  1GOA A;  4CJU A;  3AVL A;  4FLU A;  3NCI A;  3V9W A;  4FJI A;  1TL3 A;  5FRN A;  4HCC A;  2D0A A;  3CG7 A;  1IH7 A;  1J53 A;  3O4N A;  3VQ8 A;  3KLI A;  4CHQ A;  3D0P A;  3SQ0 A;  1SUQ A;  2YHA A;  4FW2 A;  4ID1 A;  1KCF A;  1XI1 A;  4CF1 A;  3TAE A;  4B9V A;  4F3O A;  4OJR A;  1NK5 A;  3HVR A;  1X9S A;  1Q9Y A;  1C6V A;  3S3N A;  2KTQ A;  5HRR A;  1TK5 A;  1DLO A;  3OYH A;  4OLA A;  4CFC A;  2G8H A;  1EX4 A;  4DQS A;  4I7F A;  5J2M A;  3WNH A;  1U45 A;  4KTZ A;  5JS1 A;  2VWK A;  4DQP A;  3HJF A;  1NK6 A;  4FZZ A;  2X78 A;  3ULD A;  1Z26 A;  2O4I A;  4KFB A;  1NOY A;  1HYS A;  3SJJ A;  4ID5 A;  2XHB A;  4RG8 A;  1RDA A;  2JGU A;  4O0I A;  4CGD A;  3VN5 A;  1IG9 A;  4DG1 A;  3TAM A;  1S9G A;  3S9H A;  2RPI A;  1QE1 A;  4DSI A;  1ZBH A;  4DS5 A;  1EP4 A;  1EXQ A;  3SQ4 A;  4KHS A;  3SV4 A;  1J5O A;  4Z0U A;  1CXU A;  2XRI A;  4KKO A;  4LD0 A;  3V9X A;  1HQU A;  5E41 A;  1NKB A;  2HB5 A;  1CZ9 A;  3ZSR A;  2Z1J A;  3LZJ A;  2X6N A;  1LV5 A;  4ZHR A;  2D0C A;  2VWJ A;  2PYJ A;  4AHU A;  2HHX A;  4PWD A;  2ATQ A;  3HVT A;  1RBT A;  3QEV A;  3LP2 A;  4HHT A;  3AVK A;  4E7J A;  4F4K A;  2EX3 A;  1JLB A;  5KRS A;  1B9F A;  1VSM A;  2IS3 A;  1NK8 A;  2KFN A;  2D5R A;  4CEQ A;  1L3U A;  4FJ7 A;  4E7I A;  1VSD A;  4R5P A;  3AVA A;  4AHC A;  1JLQ A;  1ZBF A;  3QLH A;  5K14 A;  3ZCM A;  3OYN A;  3OYG A;  1S6Q A;  1UA0 A;  1O1W A;  3HYF A;  4E1N A;  3LPT A;  4DLG A;  4N56 A;  4C8L A;  4IBN A;  3U3G A;  2VG6 A;  1A5X A;  3EYZ A;  1LW2 A;  4FK0 A;  2B5J A;  3THV A;  4M3W A;  1F21 A;  4FLT A;  2X74 A;  3SZ2 A;  4BAC A;  4DTU A;  2O4G A;  1C1C A;  1WLJ A;  3NAE A;  3QEI A;  2OPQ A;  5FRM A;  4OKK A;  4OKJ A;  1YT3 A;  4DSL A;  4W5Q A;  2XY6 A;  2Z1G A;  3TAQ A;  3WNE A;  3V9U A;  3AVF A;  5SWM A;  1RCH A;  3KKR A;  1WSI A;  3MEG A;  2XO7 A;  1TKD A;  3KLG A;  1YVU A;  3DLK A;  4B08 A;  2KZZ A;  4DTS A;  4M3T A;  3C6U A;  2HMI A;  3TWH A;  1U4B A;  2E6M A;  5CYQ A;  3NF8 A;  2QKB A;  3V1O A;  3QES A;  3UIQ A;  2FBX A;  4CJW A;  3V4I A;  1HNV A;  2P51 A;  3P1G A;  3DLR A;  4MQ3 A;  4DSE A;  4H4M A;  1HRH A;  2YNG A;  3ITH A;  3NF7 A;  4CES A;  1KSP A;  3V1Q A;  1A5W A;  4B9U A;  4CF0 A;  2GV9 A;  1SL0 A;  2OZS A;  4H4O A;  4KV8 A;  1TK0 A;  1W0H A;  4MFB A;  1IKW A;  4CJV A;  3QET A;  3MXI A;  3LAL A;  1RTJ A;  4CHO A;  3RRG A;  5KRT A;  4IKF A;  1KFD A;  1RT5 A;  1TKX A;  1JXE A;  3NGY A;  3QIP A;  1KVB A;  4GVM A;  3JSM A;  3CFP A;  4DF8 A;  1T8E A;  1T05 A;  2PYL A;  2OZM A;  4CF8 A;  4CJE A;  3SQ1 A;  4QOZ B;  5C24 A;  3L2U A;  2ZE2 A;  4DU1 A;  5I42 A;  3TAR A;  1RT4 A;  3P5J A;  3RMD A;  3TAG A;  4IFV A;  4LY7 A;  1NJX A;  2W42 A;  3TI0 A;  1BHL A;  3AO2 A;  3NH2 A;  3OY9 A;  4HTU A;  1FK9 A;  4FLV A;  3KLH A;  4CE9 A;  4E7H A;  1UA1 A;  2HNY A;  4CIE A;  3HO1 A;  1S1U A;  2GBZ A;  3VQB A;  4B8A B;  4CEB A;  3MEC A;  4ZTF A;  1L3V A;  3CFR A;  2KW4 A;  1NOZ A;  2RF2 A;  1SV5 A;  4CEF A;  1KTQ A;  2G8W A;  4CEZ A;  4FJN A;  4CGF A;  4CJQ A;  4OVL A;  1HQE A;  4KHU A;  3QER A;  3O4Q A;  4CJ3 A;  3L3V A;  3O3F A;  5EU7 A;  3HP9 A;  4F8R A;  3QNN A;  2P5G A;  3OYI A;  4CJP A;  1T7P A;  4Q0B A;  3ALY A;  4DFM A;  1UWB A;  4KB1 A;  2F8T A;  1REV A;  3TAF A;  1VSH A;  3G10 A;  4QAG A;  4AHR A;  2PZS A;  1TVR A;  4DSJ A;  3HXM A;  2BAN A;  2ZQB A;  3DLG A;  2HW3 A;  1ASW A;  3ZSO A;  3WNF A;  3LAM A;  1FXX A;  2HND A;  4OKE A;  3AO5 A;  3S3M A;  2FBY A;  1RBS A;  4KAZ A;  1BI4 A;  3MXJ A;  4OGC A;  4M45 A;  5KGX A;  1LWF A;  1X9M A;  3B6P A;  4O44 A;  1WN7 A;  3L2W A;  4CGJ A;  3F73 A;  3K5N A;  4JRP A;  3SYZ A;  4JRQ A;  3DRS A;  5HRO A;  2AJQ A;  3PUF A;  2BGG A;  3ZT3 A;  4Q5V A;  3SCX A;  4C8K A;  3CM5 A;  4Y1D A;  4HCB A;  4K8Z A;  4CEE A;  2IAJ A;  4RW4 A;  2G8I A;  3NH0 A;  3AVB A;  4FJX A;  3LWM A;  3IAY A;  1MU2 A;  3NFA A;  3T1A A;  4KHY A;  3VQ7 A;  4CEA A;  3DOL A;  3NGZ A;  2LSN A;  4HUF A;  1N6Q A;  4I2P A;  4CJT A;  3VA0 A;  2BDP A;  4EZ6 A;  1NKC A;  4QCL A;  3AVJ A;  2XY5 A;  3PX6 A;  3AVG A;  2NUB A;  3VQD A;  3L2R A;  3EY1 A;  2HVH A;  1Q9X A;  1JLA A;  2WON A;  2EHG A;  4BWM A;  4CIG A;  4CJR A;  4BE1 A;  3I0R A;  1QHT A;  4KB0 A;  2WOM A;  3HPG A;  1EKE A;  4N5S A;  4DFK A;  3TR8 A;  1RDD A;  1KLM A;  1IO2 A;  4O0J A;  5SZT A;  3L2Q A;  3ASM A;  1RT6 A;  3P83 D;  3K5M A;  1QQC A;  1WAF A;  1N5Y A;  3M8Q A;  4J2A A;  4CK2 A;  1YTA A;  3HP6 A;  1KRP A;  4BE2 A;  4Z4E A;  2B6A A;  4G1Q A;  5HRN A;  3CQ8 A;  3ZSW A;  3VQ9 A;  3AA2 A;  4E3S A;  1ASU A;  2E4L A;  3BGR A;  3OJS A;  4DF4 A;  4B9M A;  4FJ9 A;  3KJV A;  4PA1 A;  3OVN A;  1BIS A;  1BIU A;  1S1X A;  4LSL A;  3A2F A;  2Z1I A;  1HPZ A;  2OPR A;  3AVC A;  3B6O A;  3ZSZ A;  4KO0 A;  4Z4C A;  5KTQ A;  4DS4 A;  4KI6 A;  4DU4 A;  4CGI A;  4KRE A;  1C1B A;  3NF9 A;  4FLX A;  1TK8 A;  3KK3 A;  2YHB A;  1ASV A;  3IG1 A;  3RRH A;  4LH5 A;  1X9W A;  3ZSX A;  3AVH A;  3OYD A;  1JXB A;  2IGI A;  3K5O A;  4OPK A;  1BCM A;  1C0T A;  5FDL A;  3LZI A;  3LAN A;  4DFJ A;  3OYB A;  3HPH A;  3SUP A;  1D5A A;  4DTX A;  4AIL C;  1C1A A;  2X6S A;  3WNG A;  3MXM A;  3G0Z A;  4CJ5 A;  4HUE A;  4HUG A;  3DLH A;  2HHT A;  5CY4 A;  2BE2 A;  5C42 A;  1S5J A;  1KLN A;  4FJM A;  1VSJ A;  2GUI A;  1U48 A;  5C25 A;  4IG3 A;  4NCA A;  1W9H A;  4CK1 A;  3K57 A;  4L8R B;  2IOC A;  2FBV A;  2Y1I A;  4CEO A;  4LH4 A;  4OGE A;  1QSL A;  2QXF A;  3FFI A;  4IFY A;  1BGX T;  3U3Y A;  4Y1C A;  3SI6 A;  1RDC A;  4FYD A;  1VSI A;  1QS4 A;  1XWL A;  3HST B;  4ICL A;  4O55 A;  3DLB A;  4DTR A;  4CER A;  4M42 A;  1YTU A;  1UOC A;  3AO3 A;  4BDZ A;  2YV0 X;  4AHT A;  1UAX A;  4FJG A;  3L3U A;  4N41 A;  4N76 A;  4DWI A;  4CHN A;  3QEP A;  4NCB A;  4DTP A;  2YNH A;  3DRR A;  1SL1 A;  2ITG A;  3NH1 A;  1B9D A;  3VQP A;  1TGO A;  2R7Y A;  1EET A;  3RWU A;  3OYA A;  3LP1 A;  3SUN A;  4CJF A;  3IRX A;  5CZ1 A;  1L5U A;  3SPY A;  1GOB A;  1HYZ A;  3KIO A;  3NE6 A;  4ELT A;  1RBR A;  3AA5 X;  3KD5 E;  4DFP A;  2P1J A;  4LSN A;  4FK4 A;  1BIZ A;  1SKR A;  1TKZ A;  4CHP A;  4FM0 A;  1JLC A;  4FZX C;  2KZM A;  3S3O A;  3NDK A;  3DI6 A;  2HHU A;  5HRS A;  2HHV A;  3QIN A;  1J9A A;  1LAV A;  2RKI A;  1RNH A;  1VSF A;  1U47 A;  3AO4 A;  3DYA A;  3SUQ A;  1ZBL A;  3KK2 A;  4OLB A;  5HLF A;  5HRP A;  4TSX A;  4AHV A;  4I9Q A;  1RT1 A;  3OYF A;  4W5O A;  3LAK A;  4KHW A;  1HNI A;  2HHQ A;  4E1M A;  3OYC A;  4BWJ A;  1NK7 A;  2DFE A;  2OYQ A;  1RTD A;  3ZT0 A;  4FCY A;  3DRP A;  1HYV A;  4W5R A;  5CZ2 A;  3VQA A;  3K58 A;  3TAP A;  3LP0 A;  1QTM A;  2G8U A;  3OS2 A;  4RW7 A;  4KPY A;  1VSE A;  1LWC A;  3K59 A;  3PV8 A;  2RN2 A;  4CGH A;  1WAJ A;  1B92 A;  1FKP A;  4CCH A;  4E7K A;  1NK4 A;  1QSY A;  3ZT2 A;  5HP1 A;  3CM6 A;  4PQU A;  3RMC A;  3OYK A;  4E7L A;  3AO1 A;  3SPZ A;  1IKY A;  4CHY A;  4N47 A;  3KKS A;  3SV3 A;  1BQM A;  3RMA A;  5FRO A;  3KTQ A;  1WSE A;  4M3X A;  3DMJ A;  4FLW A;  2KFZ A;  1X1P A;  4HVJ A;  1JKH A;  3NGI A;  4E19 A;  4M3U A;  3DM2 A;  5DMR A;  4ELU A;  1VSK A;  3HM9 A;  4C8O A;  1WSG A;  4M3Z A;  4KHN A;  4FJ8 A;  1ITG A;  3OYE A;  4CEC A;  4RW8 A;  3HK2 A;  3RTV A;  2Q3S A;  2KQ2 A;  4F2R A;  4DTJ A;  1L3S A;  1GOC A;  3VA3 A;  3IS9 A;  2P5O A;  1DTQ A;  1LW0 A;  2VG5 A;  3KLF A;  4DTN A;  4UQG A;  1SKS A;  3DOK A;  4CHZ A;  4FZY A;  3HPO A;  1Z25 A;  4NYN A;  4FLZ A;  1WSF A;  3C95 A;  4DLE A;  3RMB A;  1FKO A;  1VK0 A;  3TAN A;  2F8S A;  3QIO A;  3T19 A;  1JLG A;  2OA8 A;  1L3T A;  4Z4G A;  3KK1 A;  4DMN A;  3M8P A;  3MED A;  3ZSV A;  4AHS A;  3V6D A;  1JL1 A;  4YFU A;  5J2P A;  3K2P A;  1C0M A;  4JS5 A;  4BDY A;  3DLE A;  3NF6 A;  2FC0 A;  3PO4 A;  1QSS A;  2E6L A;  2QK9 A;  2IDO A;  2A1S A;  4OPJ A;  3T3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...