1WSJA

Crystal structure of e.coli rnase hi active site mutant (k87a/h124a)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKARGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGAAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease HI
source organism Escherichia coli
total genus 50
structure length 155
sequence length 155
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2004-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1wsjA00
1TKTA 4DFJA 2PZSA 2OZSA 5J2PA 3HT3A 3KKSA 1UOCA 3HPGA 5K14A 1NJZA 1ZBLA 1C1CA 2DFEA 5E41A 4B9TA 4B9LA 3VQCA 4AHTA 1KVCA 1YVUA 3VQ5A 3LWMA 4DQPA 4CFCA 3ZT2A 4CGDA 2NUBA 4EP5A 2KTQA 2FBXA 2G8HA 4FJGA 3WNGA 3MEEA 3JYTA 1NK4A 4ELTA 4E7HA 3CFPA 3DRSA 2G8UA 1TVRA 1ZYQA 5HLFA 4M45A 3C6UA 2YV0X 4NCGA 1S1TA 1RBRA 1GOCA 3G10A 4AHSA 4Z4IA 1J5OA 1L3VA 4DQRA 3P83D 4R5PA 4BE2A 1NK6A 2YNGA 3DI6A 4XIUA 3VQDA 4CCHA 4IG3A 5KGXA 2DY4A 1KFDA 4DTXA 4J2BA 2RPIA 3V9XA 3TAQA 3DRRA 1J53A 2ZD1A 1ASUA 1HQUA 3TAFA 5JS1A 3QIOA 4KHNA 4I9LA 1BGXT 4GMJB 3G0ZA 4CF2A 2HMIA 3AA4A 4OKJA 4AHUA 1VSKA 3ZT4A 3KLIA 3LP0A 3ZSVA 2HNDA 3KD1E 2HHSA 1JLEA 4TSXA 4RW8A 3S3OA 1X1PA 3HSTB 3DLBA 4L8RB 4PA1A 3I8DA 4CEZA 3LWLA 3VQ6A 3F73A 2O4GA 4JS4A 5J2NA 4Z4FA 1REVA 3HL8A 3QIPA 2D0CA 4E1NA 5KTQA 2HVIA 3QEIA 3VQ9A 4B9MA 1U48A 1C0UA 3T1AA 4CK2A 4CJWA 3LZIA 3AVCA 3I0SA 3VQQA 2YNHA 4ICLA 5SWMA 4BWJA 1VSMA 2X6NA 4FM0A 3THVA 4M3RA 4DWIA 4Z4CA 4PUOA 5CYQA 4NCBA 4CJTA 2F8SA 4CF9A 3O3HA 3VA0A 4DF8A 2F8TA 1VSJA 2DFHA 5KRTA 4LSNA 3K57A 2VG6A 4I9QA 3NGYA 4FJMA 1YTUA 1HPZA 1Z25A 2E6MA 4OGCA 3TANA 3AVLA 3DOLA 4KKOA 3KLHA 3PV8A 2I5JA 4RW4A 4BWMA 3WNHA 4CGJA 1D8YA 4KFBA 2R7YA 2Z1GA 4CJKA 4CHNA 3LAMA 3MEGA 1A5WA 4KV8A 1TKXA 1J9AA 1SUQA 1TGOA 3V9ZA 1C1AA 5CYMA 1DTQA 2G8VA 3EY1A 2Q3SA 1R0AA 4BDZA 1HYVA 1TL1A 4CHQA 1NJXA 1NOYA 1RDAA 3OYLA 3RRGA 2QKBA 4DSEA 3AA3A 5C42A 3HYFA 1JLCA 3L8BA 1L3SA 3LAKA 1BIUA 5C25A 3IAYA 4E1MA 5DMRA 4N47A 2B6AA 4E7KA 2KW4A 4HHTA 4KHSA 3ZT0A 4CERA 3CYMA 3SV3A 4M42A 1RT4A 3ALYA 1UA1A 3ZCMA 1XWLA 2PYLA 4C8OA 3PX4A 3S3NA 4FJHA 3RWUA 4K8XA 4MQ3A 4CIFA 2Z1JA 1NK9A 1JLGA 3QETA 4KI4A 4M3XA 5J2QA 1VK0A 3KK2A 4FLUA 2OPQA 3S3MA 3OJUA 1X9SA 2OYQA 1IG9A 2HHWA 2W42A 1YT3A 3QNOA 1RCHA 2OPPA 4KHYA 1RT6A 4FW1A 2HHXA 3OYFA 4FM1A 1N6QA 1C0TA 1WLJA 3RMAA 2KQ2A 3NH0A 4CGFA 3LPUA 3L2RA 3U3GA 4CJQA 1UWBA 1WSHA 5CY4A 3OYAA 3OYMA 3KLEA 3PO4A 1RNHA 4OLBA 1C0MA 4Z0UA 3OYCA 5HRNA 1T05A 4ID5A 4KREA 1TV6A 1S6QA 3AA2A 4M3YA 4FCYA 2FC0A 4FLTA 1RBVA 3NGIA 3HM9A 3JSMA 3SV4A 1BISA 3QERA 3U3YA 4DFPA 2RF2A 4CEAA 2PYJA 3BDPA 3KTQA 4M3WA 1RTIA 1VRTA 3MECA 4DTSA 3NF7A 4B8CA 4ID1A 1BCMA 3SQ1A 1RDBA 4RW6A 2BE2A 4O0JA 3O4QA 3AO3A 1RDCA 1RT2A 4DG1A 3QEVA 1SKWA 4OJRA 1WSEA 3MEDA 1U45A 1O1WA 1LW2A 4DS4A 1NKEA 1JLFA 3F9KA 3NH2A 2O4IA 1QS4A 1T7PA 4ELVA 4GVMA 2XY5A 5FRMA 3K58A 4N76A 2P1JA 3D45A 4CJLA 1KVBA 4F2RA 4M3TA 1W0HA 4RW9A 4CF8A 2BDPA 1S5JA 4OGEA 2G8KA 4CIGA 3SYZA 4Z4GA 4O5BA 2D5RA 4FZZA 1I39A 4DQIA 1JKHA 4CEEA 3ISNC 3DOKA 2YNIA 2HHVA 4Z4HA 1C6VA 3NBPA 1NOZA 1SL1A 1L3UA 2G8FA 1RBSA 1RTJA 4CK1A 3QLHA 3VQ8A 4BDPA 1VSLA 3AVAA 1JXEA 4E89A 3OS1A 1Q8IA 2HHUA 1FKPA 4CJ3A 4CIEA 1Q9YA 5FRNA 3ZSXA 2X6SA 1D9DA 3P5JA 3OYDA 1BI4A 1CZ9A 1L3TA 1XHZA 3RMDA 3NF9A 3T19A 4G1QA 4CJ5A 3SQ0A 3ASMA 1ZBFA 4CEFA 2AJQA 1TL3A 3AO4A 2IDOA 4CESA 3HP6A 3AVBA 3DM2A 3TR8A 2YHAA 3ZT1A 3NHGA 3FFIA 3C95A 4N5SA 3TAGA 4DTUA 3SPZA 4QOZB 4E7IA 1ZBHA 1NJYA 3OVNA 4B9VA 1VSDA 2ZE2A 3V6DA 4CJFA 1LWFA 3AVMA 1RT1A 3CFOA 3DMJA 4KTWA 5FDLA 3ZSRA 4CJVA 4CFBA 4YFUA 5HRRA 4DSIA 3OYKA 4DSKA 3ZT3A 2YNFA 4CJ4A 4DTJA 4EZ9A 4FZXC 4HUGA 4CGGA 1WSFA 2JLEA 3LANA 4NYNA 1QSLA 1RDDA 4C8NA 5KI6A 2KFNA 1RTHA 4HCBA 4E7JA 4Q5VA 3AVIA 4YNQA 3LDSA 3MXIA 1J54A 4HVJA 4F4KA 1CLQA 1CXQA 4CGIA 2B5JA 5JS2A 4AHCA 4CJEA 4CJPA 2IOCA 3OYHA 4FLXA 1ITGA 1T03A 2ATQA 2IS3A 4FJIA 3HO1A 1EX4A 4I2PA 3L2VA 4FJ7A 4Y1DA 2VWJA 4KHUA 4FK4A 1BIZA 3CM5A 1BCOA 4CK3A 4WE1A 3SUQA 3H08A 1NJWA 3VQAA 4CE9A 1SL0A 1SL2A 3OYGA 1XI1A 3CQ8A 3MXMA 4C8LA 4FJJA 1KRPA 2BANA 3VQBA 3VN5A 2RKIA 2E4LA 4LD0A 1FXXA 3U6FA 3LP3A 3LP1A 4DU3A 1C1BA 4FJXA 4PY5A 4FJ9A 1SKRA 5EU7A 4DS5A 5CZ1A 1BQNA 4NCAA 4CEDA 1NK5A 3C94A 3LP2A 3SQ4A 1JXBA 2QXFA 3ZSOA 1LV5A 3E01A 3KLFA 3AVGA 2GV9A 3VQ4A 4KRFA 2DTUA 4ZHRA 1IH7A 1U4BA 2KZZA 3IRXA 4B9UA 2ZQBA 3V9SA 2OZMA 4KAZA 2PY5A 1S9GA 1A5VA 1HRHA 1MU2A 4LY7A 2E6LA 4OVLA 4CFAA 4JRQA 4DQSA 1K6YA 2LSNA 4OKKA 3NCIA 1I3AA 2GUIA 3NFAA 3AO2A 4CJRA 4DTMA 4CF0A 4BE1A 4CEQA 3L2WA 4IKFA 4M3ZA 4KB1A 4FK0A 3TWHA 1IKXA 3TAMA 4DU1A 4KI6A 1RT5A 2KFZA 3V9WA 4GW6A 3M8PA 1RT3A 1KLNA 1KSPA 1XHXA 2OPSA 4J2EA 1TAQA 2Z1IA 3QINA 4HUEA 4EZ6A 1SV5A 3DLKA 3WNFA 3NDKA 4E0DA 1T8EA 2VG7A 1LAWA 4DTRA 5SZTA 3SUPA 2QK9A 1RILA 4DTPA 3VQ7A 1BQMA 1F21A 4FYDA 1NK7A 4JS5A 1KTQA 3PX6A 4M3UA 1ZBIA 1DLOA 2HHTA 3SJJA 4CECA 1HNIA 3K5OA 3OYNA 1WSIA 3UIQA 2GBZA 4H4OA 3O3FA 4CFDA 3VQEA 1QSSA 1W9HA 1LAVA 1VSEA 2VWKA 3TAEA 3HVRA 1UA0A 4O44A 4QAGA 4FJ5A 4K8ZA 4DSJA 3ULDA 4PQUA 3KLGA 1LW0A 1IKVA 3CFRA 4DSFA 4FLVA 4FM2A 3TI0A 1CZBA 1ASVA 1ASWA 1TKZA 1RBUA 1S1XA 4JRPA 3EZ5A 1B9FA 4E7LA 1BHLA 1JLQA 1HJRA 3M8RA 1NK8A 3DYAA 3V1RA 4I2QA 1HYSA 1JL1A 4CJSA 4UQGA 4F3TA 4DTNA 1S6PA 3HJFA 4E19A 4KTZA 2YKNA 3RRHA 1TK5A 1EKEA 3KJVA 2RN2A 5FROA 2A1RA 4I7FA 2ETJA 4C8KA 1FK9A 4DMNA 3SQ2A 3OS2A 2Y1JA 2EHGA 2KZMA 4H4MA 1VRUA 3I0RA 2X74A 1N5YA 1QE1A 4KPYA 1U04A 2XY7A 1SKSA 3PY8A 3VQPA 4CHOA 2Y1IA 2HNYA 3B6OA 3V81A 4FVMA 1KVAA 4NYFA 3HK2A 4LSLA 3K5NA 1B92A 3CM6A 3SCXA 4W5NA 3OS0A 3PO5A 4CGHA 3DLRA 1WSGA 4IDKA 4DU4A 4KB0A 4FJNA 1X9MA 3L3UA 1WAFA 2WONA 3AVFA 3L3VA 4AHVA 2XO7A 2XY6A 2QKKA 1QQCA 1HYZA 3KD5E 3ITHA 4M41A 2G8WA 3SNNA 1WAJA 1JLAA 1VSFA 4B08A 4BE0A 3T3FA 5C24A 3OYIA 2OA8A 1S1UA 4BDYA 4EP4A 1Q9XA 5J1EA 1X9WA 4B3OA 4CEBA 3C6TA 2HW3A 3QNNA 1TAUA 4JLHA 3M8SA 2ITGA 1RBTA 3V1QA 3OYEA 4DFMA 3SZ2A 4RW7A 3AVHA 4OKEA 1L5UA 4IFYA 3CG7A 3KKRA 3QEPA 1A5XA 3TABA 1U49A 3ZSQA 4Q0BA 1RT7A 3NE6A 5J2MA 1G15A 2FBVA 4LH4A 4CEOA 3K5LA 1NKBA 3MAQA 2YKMA 4KTQA 4IFVA 3AO1A 4KHWA 2FBTA 3L2QA 2JGUA 5I3UA 4F2SA 4J2AA 2A1SA 2IGIA 3K2PA 3LPTA 3B6PA 3HPHA 3QO9A 3NAEA 2FBYA 4FLYA 3NGZA 4CHZA 4OPJA 4DSLA 1IO2A 2D0BA 2HHQA 3NH1A 3KK3A 4FJ8A 1LWEA 4FZYA 4DLGA 3ZSWA 4ELUA 4B9SA 3SI6A 4ZTJA 1U47A 4BACA 3LZJA 1WSJA 4DQQA 1GOAA 3MXJA 4N56A 4F8RA 4Z4EA 3AV9A 1KFSA 2P51A 4B8AB 1B9DA 4FXDA 3BGRA 5HROA 4PWDA 3RR7A 3DLGA 4FJKA 1HNVA 4LH5A 4F3OA 2HB5A 3HXMA 3AVKA 2P5OA 3DRPA 4O0IA 1NK0A 4ZTFA 2G8IA 4OLAA 4W5OA 1WNSA 4QCLA 3DLEA 4KO0A 3SUNA 5I42A 1TK8A 5DK5A 2YHBA 3OYBA 2XHBA 3K5MA 2VG5A 1D9FA 2F96A 1D5AA 1NKCA 4Y1CA 1TKDA 3RMCA 1KLMA 3QEWA 4CJUA 3V1OA 1S9EA 2WOMA 3OJSA 2HNZA 4IG0A 1VSHA 1XC9A 4W5RA 3RTVA 4AH9A 3TAPA 1JL2A 3A2FA 3AO5A 4C8MA 4FLWA 1QTMA 1EP4A 3HVTA 3IG1A 1FKOA 4O55A 3RR8A 1HQEA 3PUFA 3AVJA 1UAXA 3WNEA 5HBMA 2D0AA 1KCFA 2EX3A 5CZ2A 1IKYA 4W5QA 1WN7A 3EYZA 3S9HA 4HTUA 1Y97A 2XRIA 3HPOA 2HVHA 3HP9A 2IAJA 2XY8A 1VSIA 3KK1A 3L2UA 3AA5X 4E3SA 3AVNA 1S1VA 4AILC 3V4IA 3SPYA 4KHQA 1Z26A 4HCCA 3O4NA 3VA3A 1BI4B 3O3GA 4N41A 3ZSZA 4B9NA 1CXUA 3ZSYA 3IS9A 3RMBA 1S1WA 3M8QA 1ZBUA 4FK2A 5KRSA 1BL3A 4CHPA 1LWCA 1IKWA 1EETA 3V9UA 1RTDA 5T7BA 2B4JA 4IBNA 3P1GA 3LALA 3D0PA 3TARA 3K59A 1YTAA 2OPRA 4O4GA 4AHRA 4DLEA 3KIOA 2IC3A 2X78A 4H8KA 3OY9A 1DTTA 1EXQA 1JLBA 2BGGA 3OYJA 2P5GA 4RG8A 4CHYA 3NF6A 4DF4A 4DTOA 2Z1HA 4FW2A 2DFFA 5KGWA 3NF8A 3QESA 4DFKA 4W5TA 5HRPA 3PX0A 5D3GA 4MFBA 3QEXA 4FJLA 4OPKA 5HP1A 4HUFA 1HMVA 4J2DA 1GOBA 1QHTA 3SUOA 1TK0A 1QSYA 4CF1A 4FLZA 3DLHA 5HRSA
chains in the Genus database with same CATH superfamily
4NLBA 2D0PA 3HT3A 3KKSA 1UOCA 1VAZA 1ZBLA 4B9TA 2DFEA 1OH5A 4AHTA 4H0OA 4DQPA 4EP5A 2FBXA 4FJGA 3MEEA 3JYTA 1NK4A 2E5LK 4E7HA 5AQRA 5HLFA 4M45A 3GDQA 3QBXA 3VERA 1YJWN 4NCGA 4CD1A 1RBRA 4CZGA 3QICA 4Z4IA 1NK6A 2QWPA 3GG4A 4DUZK 4BE2A 4ISFA 2DY4A 4DTXA 4J2BA 2RPIA 2I7PA 3R1XA 4EHUA 4JAXA 2ZD1A 5GIPA 1TUUA 1NMNA 1D4XA 3P31A 3ZT4A 3KLIA 4X64K 2HNDA 3CETA 3DAWA 3HSTB 5AFUA 4L8RB 1REVA 4E1NA 5KTQA 2HVIA 5AQLA 4B9MA 5ADXH 4JKGB 3VETA 3AVCA 3I0SA 5M1NA 3MN6A 3VTHA 3CCJN 2VGNA 4DWIA 4CJTA 2DFHA 1K9MO 3T69A 4FJMA 2E6MA 2UYTA 4OGCA 3TANA 3BZKA 3DOLA 2VCPA 4WF9L 2I5JA 3VMFB 3WNHA 4CGJA 4WYBA 3HOSA 4CHNA 3MEGA 3CIPA 4JI8K 5KPRA 1C1AA 1R0AA 4IXCA 4BDZA 2UUBK 1Q7YO 4DSEA 3AA3A 5C42A 1BIUA 1LCUA 3IAYA 4N47A 4BRQA 4E7KA 3D7EO 1HPMA 1X9JA 2UUAK 3ALYA 3MX5A 2PYLA 3R9PA 3EL2A 4K8XA 2Z1JA 4M3XA 3T1HK 1VK0A 3CJ9A 4XH4A 1MWKA 2OPQA 3ID6A 2O8EA 1Z05A 4WFBL 1IG9A 2OPPA 4FW1A 4RCHA 4QS8A 4FVUA 3NH0A 1K8KB 1QQMA 3KLEA 3PO4A 5AZJA 1S6QA 2J4RA 3B8AX 4MDAA 4FCYA 2W6LA 4JD2A 1RBVA 3HM9A 2GEMA 3G4SN 4CEAA 3KTQA 4BRFA 2D1KA 3BEXA 2PBDA 4I6MB 5AR0A 4L3QA 3ZLJA 3VEOA 2O8CA 3MEDA 4YORA 4WQ4C 1NKEA 1QVFM 3FZLA 1T7PA 2XY5A 2P1JA 3D45A 1RDUA 2ZJRL 1S5JA 1NGCA 4O5BA 2P9UB 3DOKA 2HHVA 4Z4HA 1BWFO 4C1NK 2QA4N 1SL1A 5AQKA 3QLHA 2FXUA 3VF4A 4BDPA 1JXEA 3ZEUA 2UU9K 3A8YA 4O8KA 1P8ZA 3P5JA 4K41A 4DR6K 1L3TA 1XHZA 4G1QA 1U2VA 2YJFA 3CCUN 1TL3A 2IDOA 3TR8A 3DM2A 2Q0UA 3ZETA 3CJ7A 4E7IA 3E9OA 4LF4K 1N32K 1VSDA 4H0TB 4CJFA 1LWFA 4KTWA 4YFUA 5FDLA 3NVMA 3IDHA 3CJBA 4EZ9A 4FZXC 4BRHA 4K43A 3BF3A 4C8NA 3O9TA 4FWMA 4HCBA 3AVIA 1RDWX 3KVGA 4YNQA 1YVNA 5AZIB 3MXIA 1J54A 2E2QA 1CLQA 4CGIA 3FGUA 4AHCA 3I33A 4CJPA 4FLXA 1ITGA 1EX4A 2QWRA 3L2VA 4Y1DA 2VWJA 1BIZA 3CM5A 2Q36A 3A5NC 3THXB 4CE9A 4FOIA 1SL0A 3BY5A 3H1VX 3CQ8A 3SAGA 4C8LA 4JI3K 2WFBA 1KRPA 5BR9A 2BANA 1IBLK 4X62K 5AQTA 3VN5A 3IKMA 1NLVA 3GL1A 4FJ9A 2HBMA 2ZJQL 1BQNA 3VEWA 4CEDA 3LP2A 3SQ4A 3WXMB 1LV5A 3AVGA 2ZGYA 3IRXA 2ZQBA 3V9SA 1G99A 1KAXA 4CFAA 1MU2A 5BRFA 3T1YK 3PIOL 3UE5A 2P9PB 1K6YA 5FLXO 4FWLA 1I3AA 3NFAA 3AO2A 3QBWA 4B3RK 4AF1A 4CEQA 3L2WA 5BN8A 4KB1A 3TAMA 4KI6A 4BGAA 2IVPA 4GW6A 1KLNA 1RT3A 1KSPA 4KH4A 3QINA 2VWBA 1HKGA 4EZ6A 3CC7N 3LM2A 4R79A 4DTPA 4DHYA 1NK7A 3F9MA 4JS5A 3PX6A 3A5MC 1QSSA 1W9HA 1NG9A 4FWPA 1IV0A 4K8ZA 1NGIA 1IKVA 3UKUB 4FLVA 5AQOA 3TI0A 2VQEK 2O8FB 4E7LA 5EVZA 1B9FA 4H5TA 1JLQA 4BRAA 3O6WA 1YIJN 1NK8A 1QZ5A 4CBXA 1JL1A 4CZLA 2YX6A 2CGJA 1EKEA 3KJVA 4WCEL 2GTDA 2RN2A 3OBWA 4I7FA 2O8DB 4HTLA 5BRDA 4C8KA 1FK9A 4JI6K 3OTOK 4WQ4A 5FPNA 3EE9A 4KPYA 2Y1IA 5BN9A 3B6OA 3BP8A 1KVAA 4NYFA 3CMAN 3K5NA 3W3DA 1B92A 5LMNK 1K8KA 3OS0A 3M5RA 4DU4A 4FJNA 3L3UA 2XO7A 2QKKA 1BDGA 4FWNA 3ITHA 5E26A 2G8WA 3CI5A 3K9KA 4JK9A 3CXCM 4H5WA 2E8AA 3L0QA 5C24A 1JCFA 1S1UA 1NGAA 4EP4A 4BDYA 2OA8A 5J1EA 3C6TA 1VQPN 2CGKA 3J7YP 4JLHA 2ITGA 1RBTA 5EOYA 2YHYA 1L5UA 4I6MA 3CG7A 3KHYA 3WUHA 1U49A 1RT7A 4E1JA 3NE6A 2FBVA 1NKBA 5LY3A 4B3SK 2FBTA 3L2QA 5I3UA 2A1SA 2IGIA 3FZHA 3P4IA 1VHXA 3K2PA 3QO9A 3NAEA 2FBYA 4CHZA 1IO2A 3KK3A 5F0XA 4FJ8A 4FZYA 4NB4A 5F2RA 4B9SA 1T44A 2ASPA 2KKZA 1WSJA 2BH1A 4DQQA 4H0YB 2P51A 1YITN 4FXDA 3BGRA 4PWDA 1WOQA 4FJKA 3RVCA 1T6DA 1K8AO 3CCVN 1WNSA 5EXWA 5M1KA 4FWOA 4KO0A 4H5VA 3K5MA 4JI1K 1D5AA 1IG8A 5JLHA 4FL9A 4CJUA 3J81O 2WOMA 1K73O 1FJGK 2RE2A 1QTMA 1DEJA 4O55A 3J80O 1W2BM 3AVJA 5AZIA 5CZ2A 4W5QA 1VQ8N 3EYZA 1Y97A 4H0XB 3CCEN 2IAJA 1VSIA 3SPYA 4CZMA 1M90O 4HCCA 3O4NA 2F4VK 3THXA 4BRNA 4B9NA 4LF6K 2P9LB 4A2AA 1IKWA 4YOTA 4IBNA 1GLCG 1KD1O 4FSVA 3KIOA 5CE3A 4RG8A 4LF8K 4DTOA 1S22A 4FW2A 3TTCA 1M1KO 3QESA 4DFKA 4MFBA 5HP1A 3VPZA 1QHTA 3ATUA 1CZAN 3DLHA 1TKTA 1JJ2M 2OZSA 1NJZA 5K14A 4NXMK 3VQ5A 5DM7L 1HKCA 4B1XB 2WTUA 1BOTO 3WNGA 4ELTA 3QFPA 4IWVA 3CFPA 3DRSA 1W97L 2QW9A 1ATNA 3VGMA 1VQ4N 4DR4K 3PSIA 4O5FA 3AY9A 1WBBA 1JCGA 2NRWA 3DI6A 4XIUA 4BRCA 1KFDA 2HOEA 3DRRA 2V7YA 2HBKA 4XH5A 4I9LA 1J5EK 4CF2A 2HMIA 3AA4A 2CGLA 2E2PA 1HUXA 1TYQB 4TSXA 3S3OA 1X1PA 3UKUA 2QWMA 5J2NA 3LWLA 4CEZA 3RSEB 4JS4A 3T7ZA 3HL8A 3QIPA 5AQSA 3T1AA 4CJWA 1GLAG 3VQQA 1XC3A 4BWJA 4PL7A 3THVA 4PUOA 2F8SA 2O8DA 4CF9A 2F8TA 4DB3A 4DF8A 1VSJA 5AZJB 4CZHA 2VG6A 5AQVA 4JD2B 4C23A 1YTUA 1NWKA 1HPZA 4BVPA 3PV8A 4IDHA 4RW4A 1D8YA 4ILJA 3HTVA 4KV8A 4BRMA 1SUQA 1TGOA 4MLEA 3V9ZA 1DTQA 2QM1A 3CCQN 4X65K 1HYVA 3CMEN 2QWQA 3ULEB 2QKBA 1QHAA 4KBOA 1L3SA 5C25A 4E1MA 2B6AA 2KW4A 4HHTA 4KHSA 1RT4A 1UA1A 3U9DA 4FJHA 3PX4A 3RWUA 4JK8A 4CW7B 4CIFA 1RGIA 1NK9A 1JLGA 1HNWK 3TSUA 3KK2A 3R6MA 3M3ZA 3E9LA 5C2DA 3QNOA 3O1BA 4KHYA 2FSKA 3OYFA 1N6QA 5JMVA 4CGFA 4JNEA 4A62A 1WSHA 3G71N 4Z0UA 4CVNE 1T05A 3CCSN 4MDBA 1TV6A 3AA2A 3ZYYX 4M3YA 2FC0A 3SK3A 4FLTA 4FPBA 1KC8O 4YOYA 3QERA 1E4GT 4DFPA 3BDPA 5B8HA 3MECA 1IBKK 4B8CA 4O0JA 3GE1A 3I8BA 2NRZA 1U45A 1O1WA 4ILHA 2O4IA 3NH2A 5AFUH 1C0FA 4CJLA 3VF6A 2A40A 4LFAK 4FZZA 4DQIA 3O08A 3J8AA 2FSJA 3NBPA 2G8FA 1RTJA 5AQNA 1N8RO 3VQ8A 1GLJO 4E89A 1Q8IA 3LDLA 1FKPA 3PLAA 1Q9YA 5FRNA 1O13A 1HKBA 3O9UA 3OYDA 3UKRA 4IOXA 3RMDA 3QFUA 3NF9A 2QEXN 1ZBFA 3ASMA 2AJQA 2P9LA 2YHAA 2FLOA 1NGDA 1OKJA 3TAGA 4QOZB 4JKEA 3OVNA 4B9VA 1YI2N 2ZE2A 3AVMA 3CFOA 3ZSRA 3VEXA 2F9WA 2PAVA 5MLCQ 4CJ4A 1WBDA 4CGGA 1QSLA 4NYNA 2KFNA 4B1VA 4A5AA 3K0SA 3MWPA 1CXQA 5LMUK 3THWA 5JS2A 2IOCA 4DV1K 2IS3A 4CZEA 4A59A 4K25A 3FZMA 2NRVA 1NJWA 2YI1A 3SUQA 3VQAA 4AQYK 3OYGA 1NM1A 3MXMA 2RKIA 1FXXA 4PY5A 3LP1A 5CZ1A 4GV9A 1E4FT 3C94A 5AQZA 1Q82O 4Z94A 3KLFA 2GV9A 3HZ6A 3VQ4A 4KRFA 4DV2K 2DTUA 4ZHRA 1IH7A 1U4BA 4B9UA 3WEEB 5TKWA 2PY5A 4JKAA 4OVLA 1A5VA 1TYQA 4BG8A 4JRQA 2LSNA 3NCIA 3RSEA 4CF0A 4CZIA 1N34K 3V9WA 3M8PA 1YF5L 3VGLA 4DV4K 2A3ZA 3NDKA 4E0DA 1T8EA 2VG7A 2WUSA 4WQ5C 4LFCK 4BGBA 3VQ7A 2YHXA 3SJJA 3S41A 3K5OA 3CJAA 2HF4A 3OA9A 4CFDA 3FZFA 2VWKA 5AQUA 1RFQA 3HVRA 3CC4N 1LW0A 3CFRA 4IOCL 4O8UA 3W0LA 3ULEA 1ASVA 1TKZA 3JAMO 1S1XA 1BHLA 1HJRA 1QQOA 3M8RA 3DYAA 4I2QA 4F3TA 3HJFA 3SMPA 4M7XA 4E19A 5DM6L 2ETJA 3SQ2A 2P9NB 1DGKN 2EHGA 2X74A 5I9EB 1N5YA 1QE1A 1U04A 2D0OA 2XY7A 3PY8A 3VQPA 4CHOA 2OTJN 2HNYA 4FVMA 3HK2A 4LSLA 3MK6A 1OH7A 4HWIA 4DR1K 5EY4A 1X9MA 2WONA 3L3VA 1VQON 1QQCA 1HYZA 3SNNA 3FZKA 3CC2N 1JCEA 1WAJA 3FFKB 2HHHK 4FO0A 1S3XA 1VSFA 3HM8A 3T3FA 4BRLA 2BTFA 1Q9XA 4B3OA 3A5LC 4ISEA 2ZGZA 3V1QA 4DFMA 1XQSC 3MCPA 3AVHA 4OKEA 3NVKA 4JI0K 2AP1A 4JN4A 2QXLA 4Y0WA 5GAHP 1G15A 3K5LA 2YKMA 5ELZA 4KHWA 4BR4A 4J2AA 1X3MA 2D0BA 3NH1A 4MLHA 4BR7A 4ELUA 3SI6A 4FPAA 2JWKA 4BACA 1BUPA 4F8RA 4B8AB 4JI2K 4B1WB 5EX5A 3G6EN 5HROA 4GY2B 4RTFD 4F3OA 3AVKA 4O0IA 4OLAA 2W41A 4QCLA 4A2BA 3SUNA 1TK8A 2NRHA 4AM7A 2XHBA 2VG5A 4KHPK 3OHRA 2F96A 1NKCA 4AM6A 3FR0A 1KLMA 4IJAA 3V1OA 1GLDG 1VSHA 1Q81O 1JL2A 4BG9A 3SAHA 4FLWA 4H5RA 4H03B 3IG1A 4JK7A 3CJ1A 3RR8A 3PUFA 3WNEA 1UAXA 3OW2M 1KCFA 3BZCA 2XY8A 3KK1A 3VA3A 4JKCA 4N41A 4IOAL 3IS9A 4B3MK 3M8QA 1ZBUA 4WQ5A 2A6AA 1BL3A 5T7BA 2B4JA 3TARA 3P38A 3K59A 1YTAA 2OPRA 4AHRA 2IC3A 3D2FA 1EXQA 4YY3K 2Z1HA 3NF8A 2F9TA 3PIPL 3VEVA 4JKBA 4V19S 5D3GA 4LC9B 4J2DA 2CH6A 1HMVA 5JVGL 3WEEA 1XMOK 1GOBA 1TK0A 3PSFA 4CF1A 2E88A 4FLZA 3H6EA 4DFJA 1KXPA 4BR2A 2PZSA 4XEIA 1KVCA 1YVUA 1ZC6A 2BUPA 3LWMA 3THYA 4CFCA 3ZT2A 4CGDA 2NUBA 4EIAA 2G8HA 1TVRA 5AQHA 4K0KK 2NRXA 2YV0X 4JKDA 4A61A 1GOCA 3G10A 5AQJA 1J5OA 4DQRA 3CD6N 4CCHA 3VQDA 4IG3A 1VQ6N 1GLBG 2QI2A 4BREA 3V9XA 3TAQA 1HQUA 3HBTA 4KHNA 4ILGB 1BGXT 4GMJB 4OKJA 4AHUA 3ZSVA 2HHSA 5AQIA 1YJNN 3DLBA 2CH5A 4PA1A 3I8DA 4Z4FA 5KPTA 2VQFK 2D0CA 5GAEP 1TUYA 4DCHA 3QEIA 1U48A 1C0UA 1MDUB 2YNHA 4ICLA 1VSMA 1EWRA 4FM0A 4M3RA 4Z4CA 4BRPA 4NCBA 2V52B 2OTLN 3UB5A 5KRTA 3K57A 2P9NA 4LSNA 3SLCA 1SS6A 4I9QA 2I7NA 4MO5A 3AVLA 1VQ7N 4KKOA 4BR5A 2R7YA 2Z1GA 3LAMA 1A5WA 1TKXA 1J9AA 2A41A 5CYMA 3BF1A 1NOYA 1RDAA 3OYLA 3RRGA 3L8BA 1BU6O 1JLCA 3AGRA 5DMRA 3ZT0A 3CYMA 3SV3A 4M42A 3E66A 4B1ZA 4C8OA 3H3OB 5CR4A 4MQ3A 3CCRN 4KI4A 3TTDA 5J2QA 3WXIA 5FPEA 3DJCA 3U4LA 5GADP 3OJUA 1X9SA 1YT3A 5E84A 1RCHA 2HHXA 3UKRB 1WLJA 3VEZA 3LPUA 3U3GA 4CJQA 3OYAA 3TU5A 4OLBA 1C0MA 5HRNA 5GAGP 1T6CA 3NGIA 3JSMA 3G25A 5M1QA 4DQ8A 2PYJA 1VRTA 4DTSA 1BCMA 3SQ1A 1KQSM 3IFRA 2BE2A 3O4QA 4DR5K 3NMUA 3AO3A 1RDCA 1NGEA 1RT2A 3QEVA 1SKWA 3HI0A 1WSEA 3THWB 3AAQA 4IO9L 3A0IX 4CBWA 4DS4A 1W7AA 3F9KA 1QS4A 4GVMA 4N76A 4IO8A 4JKFA 4M3TA 4F9OA 4OGEA 1WUAA 2YJEA 1I39A 1JKHA 2YNIA 5KPZA 1L3UA 4IFEA 3LDOA 4CD3A 4CK1A 1VSLA 3OS1A 4CJ3A 3MX2A 3ZSXA 1DT9A 3SMSA 1CZ9A 2GX9A 2NZTA 4CJ5A 3SAFA 3SQ0A 1YAGA 4GV3A 3AO4A 3VTIA 3J7ZO 3AVBA 3NHGA 3ZT1A 4BRKA 3C95A 3KK7A 1ZBHA 1NJYA 2E1YA 1NU0A 3DMJA 4CFBA 3Q7BA 3IUCA 4FWRA 5HRRA 3HSCA 1SAZA 3OYKA 2YNFA 4PHTX 1WSFA 3EZWA 4X66K 1RDDA 2P9IB 5KI6A 4E7JA 4Q5VA 3I55N 3WQTA 3LDSA 3O8MA 4IEEA 4HVJA 4F4KA 2B5JA 1T03A 4LF7K 3OYHA 4FJIA 3HO1A 4IZ9A 3O9RA 4FK4A 1YUWA 3CQYA 4CK3A 4WE1A 3H08A 4KH6A 1SL2A 1XI1A 3MDQA 3VQBA 4LD0A 2V51B 5C0YA 3M6GA 3U6FA 3LP3A 4DU3A 1C1BA 4FJXA 5HL7L 1SKRA 1XNRK 3N4PA 5EU7A 4DS5A 2GELA 4NCAA 2ASOA 1DKGD 5C15A 2O8BB 3ZSOA 3KZBA 5AQPA 2KZZA 4KAZA 5AQXA 5IT9O 2E6LA 3WQUA 4DQSA 4OKKA 4DTMA 4CJRA 4IKFA 3LDQA 4J2EA 2OPSA 2P9SA 4HUEA 1SV5A 3DLKA 1LAWA 4DTRA 5SZTA 2QK9A 1RILA 1F21A 4M3UA 1ZBIA 1DLOA 2HHTA 4PL8A 2UXBK 1HNIA 3OYNA 3UIQA 3O3FA 3MCAB 3CCLN 4LFBK 2ZM6K 2ZF5O 1UA0A 4O44A 4FJ5A 3HRGA 4YDUC 4EAHD 2FF6A 3KLGA 1YJ9N 4DSFA 4FM2A 2AA4A 3A5OC 1ASWA 4JRPA 1VQLN 2KHOA 3CERA 4XH1A 3CCMN 5M1FA 4FOEA 4CJSA 4DTNA 1S6PA 4DV7K 1TK5A 1J6ZA 5FROA 4QS7A 4JI5K 4DMNA 3OS2A 2Y1JA 1VQ9N 4H4MA 1GLLO 1VRUA 1Y64A 3I0RA 2YCHA 3MWTA 4CZJA 3JS6A 3EKSA 4WFNL 3V81A 4BVOA 4JKHA 3F5TA 3CM6A 3SJHA 3SCXA 3DLRA 1WSGA 5C12A 3ENHA 2XY6A 1WAFA 1LOTB 1NBWA 2HBJA 4M41A 2HF3A 1JLAA 4BE0A 4OPAA 1X9WA 2HW3A 3MN7A 3TSPA 3O80A 3QNNA 1TAUA 3M8SA 2P9KB 1QQNA 3O9QA 4A57A 4IFYA 3KKRA 3QEPA 4Q0BA 3EKUA 5BRHA 1IBMK 4CEOA 3C6HA 3MAQA 4KTQA 2PFUA 4IFVA 3AGKA 3WXJA 3LPTA 3HPHA 1HNXK 4YOXA 4DSLA 4OPJA 5LJWA 2EWSA 1XMQK 4PKIA 1HJOA 1U6ZA 2E1ZA 3ZSWA 2UXDK 5BREA 4JI4K 3MXJA 4Z4EA 1Z6RA 3D2FB 1B9DA 3TSQA 1Q18A 3DLGA 1MWMA 1NMDA 2HB5A 2P5OA 4ZTFA 2G8IA 3C7NA 3R8EA 3ATVA 5I42A 1T3VA 4DR3K 1NGHA 1D9FA 2HMPA 5ADXA 4Y1CA 3RMCA 3WT0A 2VGMA 1S9EA 1ATRA 3OJSA 3THYB 1OVYA 4IG0A 3H3NO 2GUPA 4JI7K 4AH9A 1NJIO 4B1YB 3TAPA 5HOOA 3A2FA 3AO5A 3LL3A 2P9IA 3K9JA 1EO1A 5A2QO 1HQEA 4J8FA 2E2OA 2D0AA 1WN7A 4H5NA 3S9HA 4HTUA 3QDKA 2XRIA 3HPOA 2HVHA 3HP9A 1C0GA 4B1UB 3L2UA 3AA5X 4KHQA 2Q31A 1EQYA 1BI4B 2IVNA 3O3GA 4FK2A 3LM9A 1BG3A 4CHPA 3D2EA 3MN5A 3V9UA 1RTDA 4CBUA 1N36K 4O4GA 3SBTA 4QS9A 3DXKA 3OY9A 2GWKA 3OYJA 2Q0RA 3NF6A 2O8BA 2DFFA 1HLUA 5KGWA 3SBGA 5IWAK 4YDUA 5HRPA 3PX0A 4FJLA 3TTFA 4JEPA 5HRSA 4YOVA 5J2PA 2HHWA 3HPGA 4B9LA 1C1CA 4H0PA 5E41A 3VQCA 2KTQA 4BRIA 1VQ5N 2G8UA 1ZYQA 3C6UA 2UXCK 5AJ3K 1S1TA 4AHSA 1L3VA 3P83D 4R5PA 1E3MA 2YNGA 5KGXA 2W40A 4UY8O 1YHQN 1J53A 1ASUA 3TAFA 5JS1A 3QIOA 3G0ZA 1SZ2A 3EO3A 1VSKA 4GNIA 3QMLA 3LP0A 3KD1E 1JLEA 4RW8A 3H1QA 2DPNA 4DKWA 1QVGM 4LF9K 3VQ6A 3F73A 2O4GA 5CHIA 3M1FA 4DV5K 2FSNA 3VQ9A 1GLEG 2Q97A 4EHTA 4CK2A 3LZIA 5SWMA 2HBLA 2X6NA 3DLLL 2A5XA 5CYQA 3O3HA 3VA0A 3O4WA 5AQWA 2NRRA 5FPMA 4DV0K 3NGYA 3DWLA 1Z25A 4PKHA 4DR2K 1X3NA 3KLHA 4BWMA 1ILYA 4KFBA 2NLXA 4CJKA 1GLFO 4DV3K 3D6RA 3VESA 2G8VA 3EY1A 2Q3SA 3L4IA 1SQKA 1TL1A 4CHQA 1NJXA 1NGBA 2WBNA 5FPDA 3HYFA 3LAKA 4GKKK 4BQZA 5JVHL 4EFHA 4CERA 5M1PA 3ZCMA 3ZX2A 1XWLA 2P9KA 4YHHK 3S3NA 4BROA 3QETA 3EE8A 1HX1A 4FLUA 1NGGA 3FLCO 5KQ8A 3S3MA 4BR0A 2OYQA 1ZBSA 2W42A 4YOWA 1RT6A 4FM1A 1C0TA 3RMAA 5F1XA 2KQ2A 3R3LA 4JKGA 3CPWM 4BC4A 3L2RA 1KAYA 1UWBA 5CY4A 3OYMA 4U67L 1RNHA 3EN9A 3HOTA 3OYCA 4ID5A 4KREA 2ZJPL 3TPQA 4NO7A 3SV4A 1BISA 3U3YA 4H0VB 5LL6Z 2RF2A 4NXNK 4M3WA 1RTIA 3NF7A 4ID1A 3O5BA 1RDBA 4RW6A 4B3TK 2Q1NA 5C10A 4DG1A 4OJRA 3ZX0A 1P90A 3QB0A 1LW2A 1JLFA 4K42A 4ELVA 5FRMA 1XNQK 3K58A 3VEYA 4F2RA 1KVBA 1XUPO 3H45C 1W0HA 4RW9A 4CF8A 2BDPA 1VQNN 2G8KA 3U8XA 4CIGA 3SYZA 4Z4GA 2D5RA 4CEEA 3ISNC 2NNWA 1C6VA 3VGKA 1NOZA 1RBSA 3CHWA 1WB9A 3JXUA 2Q2RA 3AVAA 1BO5O 2HHUA 4CIEA 2X6SA 5AQYA 1D9DA 3AAPA 1BA0A 1BI4A 1H1VA 4BC5A 3GBTA 3T19A 4CEFA 4U7BA 3HP6A 4CESA 5BPMA 3VOVA 3FFIA 4N5SA 4DTUA 3SPZA 2VYPA 5TKYA 3V6DA 4GV6A 4CJVA 1RT1A 1KAZA 3P39A 2HSTA 2D4WA 4DSKA 4DSIA 3ZT3A 4DTJA 2P9SB 1YXQA 4HUGA 2JLEA 3LANA 1RTHA 3WXLA 3FE1A 4RWTA 1OH8A 2WC9A 4CJEA 2ATQA 5BPLA 3ENOA 4I2PA 4FJ7A 4KHUA 3Q7CA 3N4QA 1BCOA 2YHWA 4JHDB 4DUYK 2H3GX 2P9UA 4FJJA 3LDPA 4CZFA 4OO1J 2E4LA 5JICA 3GOIA 3U9ZA 3KWIA 1ZXOA 1OH6A 1NK5A 3DXMB 1JXBA 2QXFA 3E01A 4BQLA 4KH5A 1VQMN 2OZMA 1S9GA 1HRHA 4LY7A 1I94K 1HR0K 2GUIA 2RHKA 3C65A 1Q86O 4BE1A 4M3ZA 5KQDA 4FK0A 3ZX3A 3TWHA 1IKXA 3F2KA 4DU1A 1IJJA 1RT5A 2KFZA 4M63C 1XHXA 1TAQA 2Z1IA 3C6AA 4FWQA 3WNFA 3SUPA 3IMXA 1BQMA 4FYDA 1KTQA 3AARA 2IIRA 4CECA 1ATSA 1WSIA 4JV5K 2GBZA 4H4OA 1V4SA 4CJ7A 3VQEA 3O9SA 1LAVA 1VSEA 4IJNA 3E1YA 5AQFA 3TAEA 5AQGA 4PQUA 2NRTA 4NLCA 4QAGA 5H1SQ 3ULDA 4DSJA 3J7AP 2F7TA 1CZBA 4PKGA 1RBUA 3EZ5A 4BRDA 3V1RA 3ENBA 2QWOA 1HYSA 1V4TA 4UQGA 2UUCK 2OCEA 3RRHA 4KTZA 2YKNA 5BPNA 4B9QA 4FWKA 4BRGA 2A1RA 1S72N 2KZMA 2P9PA 4GKJK 3O1WA 4CI6A 1SKSA 4OPHA 1OVQA 4WFAL 4GVEA 2GWJA 4W5NA 1BA1A 4KB0A 3C7NB 4CGHA 4IDKA 3PO5A 4DV6K 3AVFA 4AHVA 2JWLA 2W6KA 3KD5E 1HNZK 2IVOA 4FWSA 4ISGA 2V7ZA 5JLFA 3I56N 5LJVA 3C0BA 3E9PA 4B08A 1R59O 4LF5K 3OYIA 2E20A 3MN9A 4CEBA 3OYEA 3LDNA 3SZ2A 4BY9C 3CQXA 4RW7A 1A5XA 3TABA 3ZSQA 5GIOA 5J2MA 2O8EB 4LH4A 2O8FA 4BC2A 3BUZB 3AO1A 2JGUA 5AQMA 1VQKN 1FW6A 4F2SA 3B6PA 3VF2A 3H46O 4FLYA 3L6QA 3NGZA 2HHQA 3D2EB 1LWEA 4DLGA 1N33K 2QWNA 4MO4A 4ZTJA 1U47A 3LZJA 3OBYA 4JYAK 1GOAA 4N56A 3AV9A 1KFSA 3DXKB 3CJCA 2ITMA 3RR7A 2FF3B 1HNVA 4LH5A 4G9ZA 5AQQA 3HXMA 3DRPA 1NGFA 1NK0A 4OX9K 4BR9A 4W5OA 3KWGA 1QZ6A 3DLEA 4M7YA 5M1OA 1NGJA 3L4QA 2YHBA 5DK5A 2QTDA 4C1NI 3OYBA 2O8CB 1MA9B 1TKDA 3QEWA 3EEQA 1EWQA 2HNZA 1XC9A 2QWLA 4W5RA 3RTVA 2OANA 3WXKA 3VENA 4C8MA 4DR7K 1EP4A 3HVTA 4YOUA 4BC3A 1FKOA 3CPEA 2ASMA 5GINA 5HBMA 2EX3A 1IKYA 2A42A 3ZEUB 3V4IA 4E3SA 4AILC 3AVNA 1S1VA 2KLAA 5BR8K 4A5BA 1Z26A 2E2NA 5C2FA 3ZSZA 1CXUA 3ZSYA 3RMBA 1S1WA 1U2VB 4JHDA 5KRSA 4IEIA 1LWCA 1EETA 2ZWHA 3ID8A 3CF5L 3P1GA 3LALA 3ZETB 3D0PA 1NNEA 4DLEA 2X78A 4H8KA 4CZKA 1DTTA 1JLBA 2BGGA 2P5GA 4CHYA 4DF4A 3DXMA 4W5TA 3QEXA 1ESVA 4OPKA 4HUFA 3SUOA 1QSYA 3MMVA
chains in the Genus database with same CATH topology
1TKTA 4DFJA 2PZSA 2OZSA 5J2PA 3HT3A 3KKSA 1UOCA 3HPGA 5K14A 1NJZA 1ZBLA 1C1CA 2DFEA 5E41A 4B9TA 4B9LA 3VQCA 4AHTA 1KVCA 1YVUA 3VQ5A 3LWMA 4DQPA 4CFCA 3ZT2A 4CGDA 2NUBA 4EP5A 2KTQA 2FBXA 2G8HA 4FJGA 3WNGA 3MEEA 3JYTA 1NK4A 4ELTA 4E7HA 3CFPA 3DRSA 2G8UA 1TVRA 1ZYQA 5HLFA 4M45A 3C6UA 2YV0X 4NCGA 1S1TA 1RBRA 1GOCA 3G10A 4AHSA 4Z4IA 1J5OA 1L3VA 4DQRA 3P83D 4R5PA 4BE2A 1NK6A 2YNGA 3DI6A 4XIUA 3VQDA 4CCHA 4IG3A 5KGXA 2DY4A 1KFDA 4DTXA 4J2BA 2RPIA 3V9XA 3TAQA 3DRRA 1J53A 2ZD1A 1ASUA 1HQUA 3TAFA 5JS1A 3QIOA 4KHNA 4I9LA 1BGXT 4GMJB 3G0ZA 4CF2A 2HMIA 3AA4A 4OKJA 4AHUA 1VSKA 3ZT4A 3KLIA 3LP0A 3ZSVA 2HNDA 3KD1E 2HHSA 1JLEA 4TSXA 4RW8A 3S3OA 1X1PA 3HSTB 3DLBA 4L8RB 4PA1A 3I8DA 4CEZA 3LWLA 3VQ6A 3F73A 2O4GA 4JS4A 5J2NA 4Z4FA 1REVA 3HL8A 3QIPA 2D0CA 4E1NA 5KTQA 2HVIA 3QEIA 3VQ9A 4B9MA 1U48A 1C0UA 3T1AA 4CK2A 4CJWA 3LZIA 3AVCA 3I0SA 3VQQA 2YNHA 4ICLA 5SWMA 4BWJA 1VSMA 2X6NA 4FM0A 3THVA 4M3RA 4DWIA 4Z4CA 4PUOA 5CYQA 4NCBA 4CJTA 2F8SA 4CF9A 3O3HA 3VA0A 4DF8A 2F8TA 1VSJA 2DFHA 5KRTA 4LSNA 3K57A 2VG6A 4I9QA 3NGYA 4FJMA 1YTUA 1HPZA 1Z25A 2E6MA 4OGCA 3TANA 3AVLA 3DOLA 4KKOA 3KLHA 3PV8A 2I5JA 4RW4A 4BWMA 3WNHA 4CGJA 1D8YA 4KFBA 2R7YA 2Z1GA 4CJKA 4CHNA 3LAMA 3MEGA 1A5WA 4KV8A 1TKXA 1J9AA 1SUQA 1TGOA 3V9ZA 1C1AA 5CYMA 1DTQA 2G8VA 3EY1A 2Q3SA 1R0AA 4BDZA 1HYVA 1TL1A 4CHQA 1NJXA 1NOYA 1RDAA 3OYLA 3RRGA 2QKBA 4DSEA 3AA3A 5C42A 3HYFA 1JLCA 3L8BA 1L3SA 3LAKA 1BIUA 5C25A 3IAYA 4E1MA 5DMRA 4N47A 2B6AA 4E7KA 2KW4A 4HHTA 4KHSA 3ZT0A 4CERA 3CYMA 3SV3A 4M42A 1RT4A 3ALYA 1UA1A 3ZCMA 1XWLA 2PYLA 4C8OA 3PX4A 3S3NA 4FJHA 3RWUA 4K8XA 4MQ3A 4CIFA 2Z1JA 1NK9A 1JLGA 3QETA 4KI4A 4M3XA 5J2QA 1VK0A 3KK2A 4FLUA 2OPQA 3S3MA 3OJUA 1X9SA 2OYQA 1IG9A 2HHWA 2W42A 1YT3A 3QNOA 1RCHA 2OPPA 4KHYA 1RT6A 4FW1A 2HHXA 3OYFA 4FM1A 1N6QA 1C0TA 1WLJA 3RMAA 2KQ2A 3NH0A 4CGFA 3LPUA 3L2RA 3U3GA 4CJQA 1UWBA 1WSHA 5CY4A 3OYAA 3OYMA 3KLEA 3PO4A 1RNHA 4OLBA 1C0MA 4Z0UA 3OYCA 5HRNA 1T05A 4ID5A 4KREA 1TV6A 1S6QA 3AA2A 4M3YA 4FCYA 2FC0A 4FLTA 1RBVA 3NGIA 3HM9A 3JSMA 3SV4A 1BISA 3QERA 3U3YA 4DFPA 2RF2A 4CEAA 2PYJA 3BDPA 3KTQA 4M3WA 1RTIA 1VRTA 3MECA 4DTSA 3NF7A 4B8CA 4ID1A 1BCMA 3SQ1A 1RDBA 4RW6A 2BE2A 4O0JA 3O4QA 3AO3A 1RDCA 1RT2A 4DG1A 3QEVA 1SKWA 4OJRA 1WSEA 3MEDA 1U45A 1O1WA 1LW2A 4DS4A 1NKEA 1JLFA 3F9KA 3NH2A 2O4IA 1QS4A 1T7PA 4ELVA 4GVMA 2XY5A 5FRMA 3K58A 4N76A 2P1JA 3D45A 4CJLA 1KVBA 4F2RA 4M3TA 1W0HA 4RW9A 4CF8A 2BDPA 1S5JA 4OGEA 2G8KA 4CIGA 3SYZA 4Z4GA 4O5BA 2D5RA 4FZZA 1I39A 4DQIA 1JKHA 4CEEA 3ISNC 3DOKA 2YNIA 2HHVA 4Z4HA 1C6VA 3NBPA 1NOZA 1SL1A 1L3UA 2G8FA 1RBSA 1RTJA 4CK1A 3QLHA 3VQ8A 4BDPA 1VSLA 3AVAA 1JXEA 4E89A 3OS1A 1Q8IA 2HHUA 1FKPA 4CJ3A 4CIEA 1Q9YA 5FRNA 3ZSXA 2X6SA 1D9DA 3P5JA 3OYDA 1BI4A 1CZ9A 1L3TA 1XHZA 3RMDA 3NF9A 3T19A 4G1QA 4CJ5A 3SQ0A 3ASMA 1ZBFA 4CEFA 2AJQA 1TL3A 3AO4A 2IDOA 4CESA 3HP6A 3AVBA 3DM2A 3TR8A 2YHAA 3ZT1A 3NHGA 3FFIA 3C95A 4N5SA 3TAGA 4DTUA 3SPZA 4QOZB 4E7IA 1ZBHA 1NJYA 3OVNA 4B9VA 1VSDA 2ZE2A 3V6DA 4CJFA 1LWFA 3AVMA 1RT1A 3CFOA 3DMJA 4KTWA 5FDLA 3ZSRA 4CJVA 4CFBA 4YFUA 5HRRA 4DSIA 3OYKA 4DSKA 3ZT3A 2YNFA 4CJ4A 4DTJA 4EZ9A 4FZXC 4HUGA 4CGGA 1WSFA 2JLEA 3LANA 4NYNA 1QSLA 1RDDA 4C8NA 5KI6A 2KFNA 1RTHA 4HCBA 4E7JA 4Q5VA 3AVIA 4YNQA 3LDSA 3MXIA 1J54A 4HVJA 4F4KA 1CLQA 1CXQA 4CGIA 2B5JA 5JS2A 4AHCA 4CJEA 4CJPA 2IOCA 3OYHA 4FLXA 1ITGA 1T03A 2ATQA 2IS3A 4FJIA 3HO1A 1EX4A 4I2PA 3L2VA 4FJ7A 4Y1DA 2VWJA 4KHUA 4FK4A 1BIZA 3CM5A 1BCOA 4CK3A 4WE1A 3SUQA 3H08A 1NJWA 3VQAA 4CE9A 1SL0A 1SL2A 3OYGA 1XI1A 3CQ8A 3MXMA 4C8LA 4FJJA 1KRPA 2BANA 3VQBA 3VN5A 2RKIA 2E4LA 4LD0A 1FXXA 3U6FA 3LP3A 3LP1A 4DU3A 1C1BA 4FJXA 4PY5A 4FJ9A 1SKRA 5EU7A 4DS5A 5CZ1A 1BQNA 4NCAA 4CEDA 1NK5A 3C94A 3LP2A 3SQ4A 1JXBA 2QXFA 3ZSOA 1LV5A 3E01A 3KLFA 3AVGA 2GV9A 3VQ4A 4KRFA 2DTUA 4ZHRA 1IH7A 1U4BA 2KZZA 3IRXA 4B9UA 2ZQBA 3V9SA 2OZMA 4KAZA 2PY5A 1S9GA 1A5VA 1HRHA 1MU2A 4LY7A 2E6LA 4OVLA 4CFAA 4JRQA 4DQSA 1K6YA 2LSNA 4OKKA 3NCIA 1I3AA 2GUIA 3NFAA 3AO2A 4CJRA 4DTMA 4CF0A 4BE1A 4CEQA 3L2WA 4IKFA 4M3ZA 4KB1A 4FK0A 3TWHA 1IKXA 3TAMA 4DU1A 4KI6A 1RT5A 2KFZA 3V9WA 4GW6A 3M8PA 1RT3A 1KLNA 1KSPA 1XHXA 2OPSA 4J2EA 1TAQA 2Z1IA 3QINA 4HUEA 4EZ6A 1SV5A 3DLKA 3WNFA 3NDKA 4E0DA 1T8EA 2VG7A 1LAWA 4DTRA 5SZTA 3SUPA 2QK9A 1RILA 4DTPA 3VQ7A 1BQMA 1F21A 4FYDA 1NK7A 4JS5A 1KTQA 3PX6A 4M3UA 1ZBIA 1DLOA 2HHTA 3SJJA 4CECA 1HNIA 3K5OA 3OYNA 1WSIA 3UIQA 2GBZA 4H4OA 3O3FA 4CFDA 3VQEA 1QSSA 1W9HA 1LAVA 1VSEA 2VWKA 3TAEA 3HVRA 1UA0A 4O44A 4QAGA 4FJ5A 4K8ZA 4DSJA 3ULDA 4PQUA 3KLGA 1LW0A 1IKVA 3CFRA 4DSFA 4FLVA 4FM2A 3TI0A 1CZBA 1ASVA 1ASWA 1TKZA 1RBUA 1S1XA 4JRPA 3EZ5A 1B9FA 4E7LA 1BHLA 1JLQA 1HJRA 3M8RA 1NK8A 3DYAA 3V1RA 4I2QA 1HYSA 1JL1A 4CJSA 4UQGA 4F3TA 4DTNA 1S6PA 3HJFA 4E19A 4KTZA 2YKNA 3RRHA 1TK5A 1EKEA 3KJVA 2RN2A 5FROA 2A1RA 4I7FA 2ETJA 4C8KA 1FK9A 4DMNA 3SQ2A 3OS2A 2Y1JA 2EHGA 2KZMA 4H4MA 1VRUA 3I0RA 2X74A 1N5YA 1QE1A 4KPYA 1U04A 2XY7A 1SKSA 3PY8A 3VQPA 4CHOA 2Y1IA 2HNYA 3B6OA 3V81A 4FVMA 1KVAA 4NYFA 3HK2A 4LSLA 3K5NA 1B92A 3CM6A 3SCXA 4W5NA 3OS0A 3PO5A 4CGHA 3DLRA 1WSGA 4IDKA 4DU4A 4KB0A 4FJNA 1X9MA 3L3UA 1WAFA 2WONA 3AVFA 3L3VA 4AHVA 2XO7A 2XY6A 2QKKA 1QQCA 1HYZA 3KD5E 3ITHA 4M41A 2G8WA 3SNNA 1WAJA 1JLAA 1VSFA 4B08A 4BE0A 3T3FA 5C24A 3OYIA 2OA8A 1S1UA 4BDYA 4EP4A 1Q9XA 5J1EA 1X9WA 4B3OA 4CEBA 3C6TA 2HW3A 3QNNA 1TAUA 4JLHA 3M8SA 2ITGA 1RBTA 3V1QA 3OYEA 4DFMA 3SZ2A 4RW7A 3AVHA 4OKEA 1L5UA 4IFYA 3CG7A 3KKRA 3QEPA 1A5XA 3TABA 1U49A 3ZSQA 4Q0BA 1RT7A 3NE6A 5J2MA 1G15A 2FBVA 4LH4A 4CEOA 3K5LA 1NKBA 3MAQA 2YKMA 4KTQA 4IFVA 3AO1A 4KHWA 2FBTA 3L2QA 2JGUA 5I3UA 4F2SA 4J2AA 2A1SA 2IGIA 3K2PA 3LPTA 3B6PA 3HPHA 3QO9A 3NAEA 2FBYA 4FLYA 3NGZA 4CHZA 4OPJA 4DSLA 1IO2A 2D0BA 2HHQA 3NH1A 3KK3A 4FJ8A 1LWEA 4FZYA 4DLGA 3ZSWA 4ELUA 4B9SA 3SI6A 4ZTJA 1U47A 4BACA 3LZJA 1WSJA 4DQQA 1GOAA 3MXJA 4N56A 4F8RA 4Z4EA 3AV9A 1KFSA 2P51A 4B8AB 1B9DA 4FXDA 3BGRA 5HROA 4PWDA 3RR7A 3DLGA 4FJKA 1HNVA 4LH5A 4F3OA 2HB5A 3HXMA 3AVKA 2P5OA 3DRPA 4O0IA 1NK0A 4ZTFA 2G8IA 4OLAA 4W5OA 1WNSA 4QCLA 3DLEA 4KO0A 3SUNA 5I42A 1TK8A 5DK5A 2YHBA 3OYBA 2XHBA 3K5MA 2VG5A 1D9FA 2F96A 1D5AA 1NKCA 4Y1CA 1TKDA 3RMCA 1KLMA 3QEWA 4CJUA 3V1OA 1S9EA 2WOMA 3OJSA 2HNZA 4IG0A 1VSHA 1XC9A 4W5RA 3RTVA 4AH9A 3TAPA 1JL2A 3A2FA 3AO5A 4C8MA 4FLWA 1QTMA 1EP4A 3HVTA 3IG1A 1FKOA 4O55A 3RR8A 1HQEA 3PUFA 3AVJA 1UAXA 3WNEA 5HBMA 2D0AA 1KCFA 2EX3A 5CZ2A 1IKYA 4W5QA 1WN7A 3EYZA 3S9HA 4HTUA 1Y97A 2XRIA 3HPOA 2HVHA 3HP9A 2IAJA 2XY8A 1VSIA 3KK1A 3L2UA 3AA5X 4E3SA 3AVNA 1S1VA 4AILC 3V4IA 3SPYA 4KHQA 1Z26A 4HCCA 3O4NA 3VA3A 1BI4B 3O3GA 4N41A 3ZSZA 4B9NA 1CXUA 3ZSYA 3IS9A 3RMBA 1S1WA 3M8QA 1ZBUA 4FK2A 5KRSA 1BL3A 4CHPA 1LWCA 1IKWA 1EETA 3V9UA 1RTDA 5T7BA 2B4JA 4IBNA 3P1GA 3LALA 3D0PA 3TARA 3K59A 1YTAA 2OPRA 4O4GA 4AHRA 4DLEA 3KIOA 2IC3A 2X78A 4H8KA 3OY9A 1DTTA 1EXQA 1JLBA 2BGGA 3OYJA 2P5GA 4RG8A 4CHYA 3NF6A 4DF4A 4DTOA 2Z1HA 4FW2A 2DFFA 5KGWA 3NF8A 3QESA 4DFKA 4W5TA 5HRPA 3PX0A 5D3GA 4MFBA 3QEXA 4FJLA 4OPKA 5HP1A 4HUFA 1HMVA 4J2DA 1GOBA 1QHTA 3SUOA 1TK0A 1QSYA 4CF1A 4FLZA 3DLHA 5HRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKT A;  4DFJ A;  2PZS A;  2OZS A;  5J2P A;  3HT3 A;  3KKS A;  1UOC A;  3HPG A;  5K14 A;  1NJZ A;  1ZBL A;  1C1C A;  2DFE A;  5E41 A;  4B9T A;  4B9L A;  3VQC A;  4AHT A;  1KVC A;  1YVU A;  3VQ5 A;  3LWM A;  4DQP A;  4CFC A;  3ZT2 A;  4CGD A;  2NUB A;  4EP5 A;  2KTQ A;  2FBX A;  2G8H A;  4FJG A;  3WNG A;  3MEE A;  3JYT A;  1NK4 A;  4ELT A;  4E7H A;  3CFP A;  3DRS A;  2G8U A;  1TVR A;  1ZYQ A;  5HLF A;  4M45 A;  3C6U A;  2YV0 X;  4NCG A;  1S1T A;  1RBR A;  1GOC A;  3G10 A;  4AHS A;  4Z4I A;  1J5O A;  1L3V A;  4DQR A;  3P83 D;  4R5P A;  4BE2 A;  1NK6 A;  2YNG A;  3DI6 A;  4XIU A;  3VQD A;  4CCH A;  4IG3 A;  5KGX A;  2DY4 A;  1KFD A;  4DTX A;  4J2B A;  2RPI A;  3V9X A;  3TAQ A;  3DRR A;  1J53 A;  2ZD1 A;  1ASU A;  1HQU A;  3TAF A;  5JS1 A;  3QIO A;  4KHN A;  4I9L A;  1BGX T;  4GMJ B;  3G0Z A;  4CF2 A;  2HMI A;  3AA4 A;  4OKJ A;  4AHU A;  1VSK A;  3ZT4 A;  3KLI A;  3LP0 A;  3ZSV A;  2HND A;  3KD1 E;  2HHS A;  1JLE A;  4TSX A;  4RW8 A;  3S3O A;  1X1P A;  3HST B;  3DLB A;  4L8R B;  4PA1 A;  3I8D A;  4CEZ A;  3LWL A;  3VQ6 A;  3F73 A;  2O4G A;  4JS4 A;  5J2N A;  4Z4F A;  1REV A;  3HL8 A;  3QIP A;  2D0C A;  4E1N A;  5KTQ A;  2HVI A;  3QEI A;  3VQ9 A;  4B9M A;  1U48 A;  1C0U A;  3T1A A;  4CK2 A;  4CJW A;  3LZI A;  3AVC A;  3I0S A;  3VQQ A;  2YNH A;  4ICL A;  5SWM A;  4BWJ A;  1VSM A;  2X6N A;  4FM0 A;  3THV A;  4M3R A;  4DWI A;  4Z4C A;  4PUO A;  5CYQ A;  4NCB A;  4CJT A;  2F8S A;  4CF9 A;  3O3H A;  3VA0 A;  4DF8 A;  2F8T A;  1VSJ A;  2DFH A;  5KRT A;  4LSN A;  3K57 A;  2VG6 A;  4I9Q A;  3NGY A;  4FJM A;  1YTU A;  1HPZ A;  1Z25 A;  2E6M A;  4OGC A;  3TAN A;  3AVL A;  3DOL A;  4KKO A;  3KLH A;  3PV8 A;  2I5J A;  4RW4 A;  4BWM A;  3WNH A;  4CGJ A;  1D8Y A;  4KFB A;  2R7Y A;  2Z1G A;  4CJK A;  4CHN A;  3LAM A;  3MEG A;  1A5W A;  4KV8 A;  1TKX A;  1J9A A;  1SUQ A;  1TGO A;  3V9Z A;  1C1A A;  5CYM A;  1DTQ A;  2G8V A;  3EY1 A;  2Q3S A;  1R0A A;  4BDZ A;  1HYV A;  1TL1 A;  4CHQ A;  1NJX A;  1NOY A;  1RDA A;  3OYL A;  3RRG A;  2QKB A;  4DSE A;  3AA3 A;  5C42 A;  3HYF A;  1JLC A;  3L8B A;  1L3S A;  3LAK A;  1BIU A;  5C25 A;  3IAY A;  4E1M A;  5DMR A;  4N47 A;  2B6A A;  4E7K A;  2KW4 A;  4HHT A;  4KHS A;  3ZT0 A;  4CER A;  3CYM A;  3SV3 A;  4M42 A;  1RT4 A;  3ALY A;  1UA1 A;  3ZCM A;  1XWL A;  2PYL A;  4C8O A;  3PX4 A;  3S3N A;  4FJH A;  3RWU A;  4K8X A;  4MQ3 A;  4CIF A;  2Z1J A;  1NK9 A;  1JLG A;  3QET A;  4KI4 A;  4M3X A;  5J2Q A;  1VK0 A;  3KK2 A;  4FLU A;  2OPQ A;  3S3M A;  3OJU A;  1X9S A;  2OYQ A;  1IG9 A;  2HHW A;  2W42 A;  1YT3 A;  3QNO A;  1RCH A;  2OPP A;  4KHY A;  1RT6 A;  4FW1 A;  2HHX A;  3OYF A;  4FM1 A;  1N6Q A;  1C0T A;  1WLJ A;  3RMA A;  2KQ2 A;  3NH0 A;  4CGF A;  3LPU A;  3L2R A;  3U3G A;  4CJQ A;  1UWB A;  1WSH A;  5CY4 A;  3OYA A;  3OYM A;  3KLE A;  3PO4 A;  1RNH A;  4OLB A;  1C0M A;  4Z0U A;  3OYC A;  5HRN A;  1T05 A;  4ID5 A;  4KRE A;  1TV6 A;  1S6Q A;  3AA2 A;  4M3Y A;  4FCY A;  2FC0 A;  4FLT A;  1RBV A;  3NGI A;  3HM9 A;  3JSM A;  3SV4 A;  1BIS A;  3QER A;  3U3Y A;  4DFP A;  2RF2 A;  4CEA A;  2PYJ A;  3BDP A;  3KTQ A;  4M3W A;  1RTI A;  1VRT A;  3MEC A;  4DTS A;  3NF7 A;  4B8C A;  4ID1 A;  1BCM A;  3SQ1 A;  1RDB A;  4RW6 A;  2BE2 A;  4O0J A;  3O4Q A;  3AO3 A;  1RDC A;  1RT2 A;  4DG1 A;  3QEV A;  1SKW A;  4OJR A;  1WSE A;  3MED A;  1U45 A;  1O1W A;  1LW2 A;  4DS4 A;  1NKE A;  1JLF A;  3F9K A;  3NH2 A;  2O4I A;  1QS4 A;  1T7P A;  4ELV A;  4GVM A;  2XY5 A;  5FRM A;  3K58 A;  4N76 A;  2P1J A;  3D45 A;  4CJL A;  1KVB A;  4F2R A;  4M3T A;  1W0H A;  4RW9 A;  4CF8 A;  2BDP A;  1S5J A;  4OGE A;  2G8K A;  4CIG A;  3SYZ A;  4Z4G A;  4O5B A;  2D5R A;  4FZZ A;  1I39 A;  4DQI A;  1JKH A;  4CEE A;  3ISN C;  3DOK A;  2YNI A;  2HHV A;  4Z4H A;  1C6V A;  3NBP A;  1NOZ A;  1SL1 A;  1L3U A;  2G8F A;  1RBS A;  1RTJ A;  4CK1 A;  3QLH A;  3VQ8 A;  4BDP A;  1VSL A;  3AVA A;  1JXE A;  4E89 A;  3OS1 A;  1Q8I A;  2HHU A;  1FKP A;  4CJ3 A;  4CIE A;  1Q9Y A;  5FRN A;  3ZSX A;  2X6S A;  1D9D A;  3P5J A;  3OYD A;  1BI4 A;  1CZ9 A;  1L3T A;  1XHZ A;  3RMD A;  3NF9 A;  3T19 A;  4G1Q A;  4CJ5 A;  3SQ0 A;  3ASM A;  1ZBF A;  4CEF A;  2AJQ A;  1TL3 A;  3AO4 A;  2IDO A;  4CES A;  3HP6 A;  3AVB A;  3DM2 A;  3TR8 A;  2YHA A;  3ZT1 A;  3NHG A;  3FFI A;  3C95 A;  4N5S A;  3TAG A;  4DTU A;  3SPZ A;  4QOZ B;  4E7I A;  1ZBH A;  1NJY A;  3OVN A;  4B9V A;  1VSD A;  2ZE2 A;  3V6D A;  4CJF A;  1LWF A;  3AVM A;  1RT1 A;  3CFO A;  3DMJ A;  4KTW A;  5FDL A;  3ZSR A;  4CJV A;  4CFB A;  4YFU A;  5HRR A;  4DSI A;  3OYK A;  4DSK A;  3ZT3 A;  2YNF A;  4CJ4 A;  4DTJ A;  4EZ9 A;  4FZX C;  4HUG A;  4CGG A;  1WSF A;  2JLE A;  3LAN A;  4NYN A;  1QSL A;  1RDD A;  4C8N A;  5KI6 A;  2KFN A;  1RTH A;  4HCB A;  4E7J A;  4Q5V A;  3AVI A;  4YNQ A;  3LDS A;  3MXI A;  1J54 A;  4HVJ A;  4F4K A;  1CLQ A;  1CXQ A;  4CGI A;  2B5J A;  5JS2 A;  4AHC A;  4CJE A;  4CJP A;  2IOC A;  3OYH A;  4FLX A;  1ITG A;  1T03 A;  2ATQ A;  2IS3 A;  4FJI A;  3HO1 A;  1EX4 A;  4I2P A;  3L2V A;  4FJ7 A;  4Y1D A;  2VWJ A;  4KHU A;  4FK4 A;  1BIZ A;  3CM5 A;  1BCO A;  4CK3 A;  4WE1 A;  3SUQ A;  3H08 A;  1NJW A;  3VQA A;  4CE9 A;  1SL0 A;  1SL2 A;  3OYG A;  1XI1 A;  3CQ8 A;  3MXM A;  4C8L A;  4FJJ A;  1KRP A;  2BAN A;  3VQB A;  3VN5 A;  2RKI A;  2E4L A;  4LD0 A;  1FXX A;  3U6F A;  3LP3 A;  3LP1 A;  4DU3 A;  1C1B A;  4FJX A;  4PY5 A;  4FJ9 A;  1SKR A;  5EU7 A;  4DS5 A;  5CZ1 A;  1BQN A;  4NCA A;  4CED A;  1NK5 A;  3C94 A;  3LP2 A;  3SQ4 A;  1JXB A;  2QXF A;  3ZSO A;  1LV5 A;  3E01 A;  3KLF A;  3AVG A;  2GV9 A;  3VQ4 A;  4KRF A;  2DTU A;  4ZHR A;  1IH7 A;  1U4B A;  2KZZ A;  3IRX A;  4B9U A;  2ZQB A;  3V9S A;  2OZM A;  4KAZ A;  2PY5 A;  1S9G A;  1A5V A;  1HRH A;  1MU2 A;  4LY7 A;  2E6L A;  4OVL A;  4CFA A;  4JRQ A;  4DQS A;  1K6Y A;  2LSN A;  4OKK A;  3NCI A;  1I3A A;  2GUI A;  3NFA A;  3AO2 A;  4CJR A;  4DTM A;  4CF0 A;  4BE1 A;  4CEQ A;  3L2W A;  4IKF A;  4M3Z A;  4KB1 A;  4FK0 A;  3TWH A;  1IKX A;  3TAM A;  4DU1 A;  4KI6 A;  1RT5 A;  2KFZ A;  3V9W A;  4GW6 A;  3M8P A;  1RT3 A;  1KLN A;  1KSP A;  1XHX A;  2OPS A;  4J2E A;  1TAQ A;  2Z1I A;  3QIN A;  4HUE A;  4EZ6 A;  1SV5 A;  3DLK A;  3WNF A;  3NDK A;  4E0D A;  1T8E A;  2VG7 A;  1LAW A;  4DTR A;  5SZT A;  3SUP A;  2QK9 A;  1RIL A;  4DTP A;  3VQ7 A;  1BQM A;  1F21 A;  4FYD A;  1NK7 A;  4JS5 A;  1KTQ A;  3PX6 A;  4M3U A;  1ZBI A;  1DLO A;  2HHT A;  3SJJ A;  4CEC A;  1HNI A;  3K5O A;  3OYN A;  1WSI A;  3UIQ A;  2GBZ A;  4H4O A;  3O3F A;  4CFD A;  3VQE A;  1QSS A;  1W9H A;  1LAV A;  1VSE A;  2VWK A;  3TAE A;  3HVR A;  1UA0 A;  4O44 A;  4QAG A;  4FJ5 A;  4K8Z A;  4DSJ A;  3ULD A;  4PQU A;  3KLG A;  1LW0 A;  1IKV A;  3CFR A;  4DSF A;  4FLV A;  4FM2 A;  3TI0 A;  1CZB A;  1ASV A;  1ASW A;  1TKZ A;  1RBU A;  1S1X A;  4JRP A;  3EZ5 A;  1B9F A;  4E7L A;  1BHL A;  1JLQ A;  1HJR A;  3M8R A;  1NK8 A;  3DYA A;  3V1R A;  4I2Q A;  1HYS A;  1JL1 A;  4CJS A;  4UQG A;  4F3T A;  4DTN A;  1S6P A;  3HJF A;  4E19 A;  4KTZ A;  2YKN A;  3RRH A;  1TK5 A;  1EKE A;  3KJV A;  2RN2 A;  5FRO A;  2A1R A;  4I7F A;  2ETJ A;  4C8K A;  1FK9 A;  4DMN A;  3SQ2 A;  3OS2 A;  2Y1J A;  2EHG A;  2KZM A;  4H4M A;  1VRU A;  3I0R A;  2X74 A;  1N5Y A;  1QE1 A;  4KPY A;  1U04 A;  2XY7 A;  1SKS A;  3PY8 A;  3VQP A;  4CHO A;  2Y1I A;  2HNY A;  3B6O A;  3V81 A;  4FVM A;  1KVA A;  4NYF A;  3HK2 A;  4LSL A;  3K5N A;  1B92 A;  3CM6 A;  3SCX A;  4W5N A;  3OS0 A;  3PO5 A;  4CGH A;  3DLR A;  1WSG A;  4IDK A;  4DU4 A;  4KB0 A;  4FJN A;  1X9M A;  3L3U A;  1WAF A;  2WON A;  3AVF A;  3L3V A;  4AHV A;  2XO7 A;  2XY6 A;  2QKK A;  1QQC A;  1HYZ A;  3KD5 E;  3ITH A;  4M41 A;  2G8W A;  3SNN A;  1WAJ A;  1JLA A;  1VSF A;  4B08 A;  4BE0 A;  3T3F A;  5C24 A;  3OYI A;  2OA8 A;  1S1U A;  4BDY A;  4EP4 A;  1Q9X A;  5J1E A;  1X9W A;  4B3O A;  4CEB A;  3C6T A;  2HW3 A;  3QNN A;  1TAU A;  4JLH A;  3M8S A;  2ITG A;  1RBT A;  3V1Q A;  3OYE A;  4DFM A;  3SZ2 A;  4RW7 A;  3AVH A;  4OKE A;  1L5U A;  4IFY A;  3CG7 A;  3KKR A;  3QEP A;  1A5X A;  3TAB A;  1U49 A;  3ZSQ A;  4Q0B A;  1RT7 A;  3NE6 A;  5J2M A;  1G15 A;  2FBV A;  4LH4 A;  4CEO A;  3K5L A;  1NKB A;  3MAQ A;  2YKM A;  4KTQ A;  4IFV A;  3AO1 A;  4KHW A;  2FBT A;  3L2Q A;  2JGU A;  5I3U A;  4F2S A;  4J2A A;  2A1S A;  2IGI A;  3K2P A;  3LPT A;  3B6P A;  3HPH A;  3QO9 A;  3NAE A;  2FBY A;  4FLY A;  3NGZ A;  4CHZ A;  4OPJ A;  4DSL A;  1IO2 A;  2D0B A;  2HHQ A;  3NH1 A;  3KK3 A;  4FJ8 A;  1LWE A;  4FZY A;  4DLG A;  3ZSW A;  4ELU A;  4B9S A;  3SI6 A;  4ZTJ A;  1U47 A;  4BAC A;  3LZJ A;  1WSJ A;  4DQQ A;  1GOA A;  3MXJ A;  4N56 A;  4F8R A;  4Z4E A;  3AV9 A;  1KFS A;  2P51 A;  4B8A B;  1B9D A;  4FXD A;  3BGR A;  5HRO A;  4PWD A;  3RR7 A;  3DLG A;  4FJK A;  1HNV A;  4LH5 A;  4F3O A;  2HB5 A;  3HXM A;  3AVK A;  2P5O A;  3DRP A;  4O0I A;  1NK0 A;  4ZTF A;  2G8I A;  4OLA A;  4W5O A;  1WNS A;  4QCL A;  3DLE A;  4KO0 A;  3SUN A;  5I42 A;  1TK8 A;  5DK5 A;  2YHB A;  3OYB A;  2XHB A;  3K5M A;  2VG5 A;  1D9F A;  2F96 A;  1D5A A;  1NKC A;  4Y1C A;  1TKD A;  3RMC A;  1KLM A;  3QEW A;  4CJU A;  3V1O A;  1S9E A;  2WOM A;  3OJS A;  2HNZ A;  4IG0 A;  1VSH A;  1XC9 A;  4W5R A;  3RTV A;  4AH9 A;  3TAP A;  1JL2 A;  3A2F A;  3AO5 A;  4C8M A;  4FLW A;  1QTM A;  1EP4 A;  3HVT A;  3IG1 A;  1FKO A;  4O55 A;  3RR8 A;  1HQE A;  3PUF A;  3AVJ A;  1UAX A;  3WNE A;  5HBM A;  2D0A A;  1KCF A;  2EX3 A;  5CZ2 A;  1IKY A;  4W5Q A;  1WN7 A;  3EYZ A;  3S9H A;  4HTU A;  1Y97 A;  2XRI A;  3HPO A;  2HVH A;  3HP9 A;  2IAJ A;  2XY8 A;  1VSI A;  3KK1 A;  3L2U A;  3AA5 X;  4E3S A;  3AVN A;  1S1V A;  4AIL C;  3V4I A;  3SPY A;  4KHQ A;  1Z26 A;  4HCC A;  3O4N A;  3VA3 A;  1BI4 B;  3O3G A;  4N41 A;  3ZSZ A;  4B9N A;  1CXU A;  3ZSY A;  3IS9 A;  3RMB A;  1S1W A;  3M8Q A;  1ZBU A;  4FK2 A;  5KRS A;  1BL3 A;  4CHP A;  1LWC A;  1IKW A;  1EET A;  3V9U A;  1RTD A;  5T7B A;  2B4J A;  4IBN A;  3P1G A;  3LAL A;  3D0P A;  3TAR A;  3K59 A;  1YTA A;  2OPR A;  4O4G A;  4AHR A;  4DLE A;  3KIO A;  2IC3 A;  2X78 A;  4H8K A;  3OY9 A;  1DTT A;  1EXQ A;  1JLB A;  2BGG A;  3OYJ A;  2P5G A;  4RG8 A;  4CHY A;  3NF6 A;  4DF4 A;  4DTO A;  2Z1H A;  4FW2 A;  2DFF A;  5KGW A;  3NF8 A;  3QES A;  4DFK A;  4W5T A;  5HRP A;  3PX0 A;  5D3G A;  4MFB A;  3QEX A;  4FJL A;  4OPK A;  5HP1 A;  4HUF A;  1HMV A;  4J2D A;  1GOB A;  1QHT A;  3SUO A;  1TK0 A;  1QSY A;  4CF1 A;  4FLZ A;  3DLH A;  5HRS A; 
#chains in the Genus database with same CATH topology
 4NLB A;  2D0P A;  3HT3 A;  3KKS A;  1UOC A;  1VAZ A;  1ZBL A;  4B9T A;  2DFE A;  1OH5 A;  4AHT A;  4H0O A;  4DQP A;  4EP5 A;  2FBX A;  4FJG A;  3MEE A;  3JYT A;  1NK4 A;  2E5L K;  4E7H A;  5AQR A;  5HLF A;  4M45 A;  3GDQ A;  3QBX A;  3VER A;  1YJW N;  4NCG A;  4CD1 A;  1RBR A;  4CZG A;  3QIC A;  4Z4I A;  1NK6 A;  2QWP A;  3GG4 A;  4DUZ K;  4BE2 A;  4ISF A;  2DY4 A;  4DTX A;  4J2B A;  2RPI A;  2I7P A;  3R1X A;  4EHU A;  4JAX A;  2ZD1 A;  5GIP A;  1TUU A;  1NMN A;  1D4X A;  3P31 A;  3ZT4 A;  3KLI A;  4X64 K;  2HND A;  3CET A;  3DAW A;  3HST B;  5AFU A;  4L8R B;  1REV A;  4E1N A;  5KTQ A;  2HVI A;  5AQL A;  4B9M A;  5ADX H;  4JKG B;  3VET A;  3AVC A;  3I0S A;  5M1N A;  3MN6 A;  3VTH A;  3CCJ N;  2VGN A;  4DWI A;  4CJT A;  2DFH A;  1K9M O;  3T69 A;  4FJM A;  2E6M A;  2UYT A;  4OGC A;  3TAN A;  3BZK A;  3DOL A;  2VCP A;  4WF9 L;  2I5J A;  3VMF B;  3WNH A;  4CGJ A;  4WYB A;  3HOS A;  4CHN A;  3MEG A;  3CIP A;  4JI8 K;  5KPR A;  1C1A A;  1R0A A;  4IXC A;  4BDZ A;  2UUB K;  1Q7Y O;  4DSE A;  3AA3 A;  5C42 A;  1BIU A;  1LCU A;  3IAY A;  4N47 A;  4BRQ A;  4E7K A;  3D7E O;  1HPM A;  1X9J A;  2UUA K;  3ALY A;  3MX5 A;  2PYL A;  3R9P A;  3EL2 A;  4K8X A;  2Z1J A;  4M3X A;  3T1H K;  1VK0 A;  3CJ9 A;  4XH4 A;  1MWK A;  2OPQ A;  3ID6 A;  2O8E A;  1Z05 A;  4WFB L;  1IG9 A;  2OPP A;  4FW1 A;  4RCH A;  4QS8 A;  4FVU A;  3NH0 A;  1K8K B;  1QQM A;  3KLE A;  3PO4 A;  5AZJ A;  1S6Q A;  2J4R A;  3B8A X;  4MDA A;  4FCY A;  2W6L A;  4JD2 A;  1RBV A;  3HM9 A;  2GEM A;  3G4S N;  4CEA A;  3KTQ A;  4BRF A;  2D1K A;  3BEX A;  2PBD A;  4I6M B;  5AR0 A;  4L3Q A;  3ZLJ A;  3VEO A;  2O8C A;  3MED A;  4YOR A;  4WQ4 C;  1NKE A;  1QVF M;  3FZL A;  1T7P A;  2XY5 A;  2P1J A;  3D45 A;  1RDU A;  2ZJR L;  1S5J A;  1NGC A;  4O5B A;  2P9U B;  3DOK A;  2HHV A;  4Z4H A;  1BWF O;  4C1N K;  2QA4 N;  1SL1 A;  5AQK A;  3QLH A;  2FXU A;  3VF4 A;  4BDP A;  1JXE A;  3ZEU A;  2UU9 K;  3A8Y A;  4O8K A;  1P8Z A;  3P5J A;  4K41 A;  4DR6 K;  1L3T A;  1XHZ A;  4G1Q A;  1U2V A;  2YJF A;  3CCU N;  1TL3 A;  2IDO A;  3TR8 A;  3DM2 A;  2Q0U A;  3ZET A;  3CJ7 A;  4E7I A;  3E9O A;  4LF4 K;  1N32 K;  1VSD A;  4H0T B;  4CJF A;  1LWF A;  4KTW A;  4YFU A;  5FDL A;  3NVM A;  3IDH A;  3CJB A;  4EZ9 A;  4FZX C;  4BRH A;  4K43 A;  3BF3 A;  4C8N A;  3O9T A;  4FWM A;  4HCB A;  3AVI A;  1RDW X;  3KVG A;  4YNQ A;  1YVN A;  5AZI B;  3MXI A;  1J54 A;  2E2Q A;  1CLQ A;  4CGI A;  3FGU A;  4AHC A;  3I33 A;  4CJP A;  4FLX A;  1ITG A;  1EX4 A;  2QWR A;  3L2V A;  4Y1D A;  2VWJ A;  1BIZ A;  3CM5 A;  2Q36 A;  3A5N C;  3THX B;  4CE9 A;  4FOI A;  1SL0 A;  3BY5 A;  3H1V X;  3CQ8 A;  3SAG A;  4C8L A;  4JI3 K;  2WFB A;  1KRP A;  5BR9 A;  2BAN A;  1IBL K;  4X62 K;  5AQT A;  3VN5 A;  3IKM A;  1NLV A;  3GL1 A;  4FJ9 A;  2HBM A;  2ZJQ L;  1BQN A;  3VEW A;  4CED A;  3LP2 A;  3SQ4 A;  3WXM B;  1LV5 A;  3AVG A;  2ZGY A;  3IRX A;  2ZQB A;  3V9S A;  1G99 A;  1KAX A;  4CFA A;  1MU2 A;  5BRF A;  3T1Y K;  3PIO L;  3UE5 A;  2P9P B;  1K6Y A;  5FLX O;  4FWL A;  1I3A A;  3NFA A;  3AO2 A;  3QBW A;  4B3R K;  4AF1 A;  4CEQ A;  3L2W A;  5BN8 A;  4KB1 A;  3TAM A;  4KI6 A;  4BGA A;  2IVP A;  4GW6 A;  1KLN A;  1RT3 A;  1KSP A;  4KH4 A;  3QIN A;  2VWB A;  1HKG A;  4EZ6 A;  3CC7 N;  3LM2 A;  4R79 A;  4DTP A;  4DHY A;  1NK7 A;  3F9M A;  4JS5 A;  3PX6 A;  3A5M C;  1QSS A;  1W9H A;  1NG9 A;  4FWP A;  1IV0 A;  4K8Z A;  1NGI A;  1IKV A;  3UKU B;  4FLV A;  5AQO A;  3TI0 A;  2VQE K;  2O8F B;  4E7L A;  5EVZ A;  1B9F A;  4H5T A;  1JLQ A;  4BRA A;  3O6W A;  1YIJ N;  1NK8 A;  1QZ5 A;  4CBX A;  1JL1 A;  4CZL A;  2YX6 A;  2CGJ A;  1EKE A;  3KJV A;  4WCE L;  2GTD A;  2RN2 A;  3OBW A;  4I7F A;  2O8D B;  4HTL A;  5BRD A;  4C8K A;  1FK9 A;  4JI6 K;  3OTO K;  4WQ4 A;  5FPN A;  3EE9 A;  4KPY A;  2Y1I A;  5BN9 A;  3B6O A;  3BP8 A;  1KVA A;  4NYF A;  3CMA N;  3K5N A;  3W3D A;  1B92 A;  5LMN K;  1K8K A;  3OS0 A;  3M5R A;  4DU4 A;  4FJN A;  3L3U A;  2XO7 A;  2QKK A;  1BDG A;  4FWN A;  3ITH A;  5E26 A;  2G8W A;  3CI5 A;  3K9K A;  4JK9 A;  3CXC M;  4H5W A;  2E8A A;  3L0Q A;  5C24 A;  1JCF A;  1S1U A;  1NGA A;  4EP4 A;  4BDY A;  2OA8 A;  5J1E A;  3C6T A;  1VQP N;  2CGK A;  3J7Y P;  4JLH A;  2ITG A;  1RBT A;  5EOY A;  2YHY A;  1L5U A;  4I6M A;  3CG7 A;  3KHY A;  3WUH A;  1U49 A;  1RT7 A;  4E1J A;  3NE6 A;  2FBV A;  1NKB A;  5LY3 A;  4B3S K;  2FBT A;  3L2Q A;  5I3U A;  2A1S A;  2IGI A;  3FZH A;  3P4I A;  1VHX A;  3K2P A;  3QO9 A;  3NAE A;  2FBY A;  4CHZ A;  1IO2 A;  3KK3 A;  5F0X A;  4FJ8 A;  4FZY A;  4NB4 A;  5F2R A;  4B9S A;  1T44 A;  2ASP A;  2KKZ A;  1WSJ A;  2BH1 A;  4DQQ A;  4H0Y B;  2P51 A;  1YIT N;  4FXD A;  3BGR A;  4PWD A;  1WOQ A;  4FJK A;  3RVC A;  1T6D A;  1K8A O;  3CCV N;  1WNS A;  5EXW A;  5M1K A;  4FWO A;  4KO0 A;  4H5V A;  3K5M A;  4JI1 K;  1D5A A;  1IG8 A;  5JLH A;  4FL9 A;  4CJU A;  3J81 O;  2WOM A;  1K73 O;  1FJG K;  2RE2 A;  1QTM A;  1DEJ A;  4O55 A;  3J80 O;  1W2B M;  3AVJ A;  5AZI A;  5CZ2 A;  4W5Q A;  1VQ8 N;  3EYZ A;  1Y97 A;  4H0X B;  3CCE N;  2IAJ A;  1VSI A;  3SPY A;  4CZM A;  1M90 O;  4HCC A;  3O4N A;  2F4V K;  3THX A;  4BRN A;  4B9N A;  4LF6 K;  2P9L B;  4A2A A;  1IKW A;  4YOT A;  4IBN A;  1GLC G;  1KD1 O;  4FSV A;  3KIO A;  5CE3 A;  4RG8 A;  4LF8 K;  4DTO A;  1S22 A;  4FW2 A;  3TTC A;  1M1K O;  3QES A;  4DFK A;  4MFB A;  5HP1 A;  3VPZ A;  1QHT A;  3ATU A;  1CZA N;  3DLH A;  1TKT A;  1JJ2 M;  2OZS A;  1NJZ A;  5K14 A;  4NXM K;  3VQ5 A;  5DM7 L;  1HKC A;  4B1X B;  2WTU A;  1BOT O;  3WNG A;  4ELT A;  3QFP A;  4IWV A;  3CFP A;  3DRS A;  1W97 L;  2QW9 A;  1ATN A;  3VGM A;  1VQ4 N;  4DR4 K;  3PSI A;  4O5F A;  3AY9 A;  1WBB A;  1JCG A;  2NRW A;  3DI6 A;  4XIU A;  4BRC A;  1KFD A;  2HOE A;  3DRR A;  2V7Y A;  2HBK A;  4XH5 A;  4I9L A;  1J5E K;  4CF2 A;  2HMI A;  3AA4 A;  2CGL A;  2E2P A;  1HUX A;  1TYQ B;  4TSX A;  3S3O A;  1X1P A;  3UKU A;  2QWM A;  5J2N A;  3LWL A;  4CEZ A;  3RSE B;  4JS4 A;  3T7Z A;  3HL8 A;  3QIP A;  5AQS A;  3T1A A;  4CJW A;  1GLA G;  3VQQ A;  1XC3 A;  4BWJ A;  4PL7 A;  3THV A;  4PUO A;  2F8S A;  2O8D A;  4CF9 A;  2F8T A;  4DB3 A;  4DF8 A;  1VSJ A;  5AZJ B;  4CZH A;  2VG6 A;  5AQV A;  4JD2 B;  4C23 A;  1YTU A;  1NWK A;  1HPZ A;  4BVP A;  3PV8 A;  4IDH A;  4RW4 A;  1D8Y A;  4ILJ A;  3HTV A;  4KV8 A;  4BRM A;  1SUQ A;  1TGO A;  4MLE A;  3V9Z A;  1DTQ A;  2QM1 A;  3CCQ N;  4X65 K;  1HYV A;  3CME N;  2QWQ A;  3ULE B;  2QKB A;  1QHA A;  4KBO A;  1L3S A;  5C25 A;  4E1M A;  2B6A A;  2KW4 A;  4HHT A;  4KHS A;  1RT4 A;  1UA1 A;  3U9D A;  4FJH A;  3PX4 A;  3RWU A;  4JK8 A;  4CW7 B;  4CIF A;  1RGI A;  1NK9 A;  1JLG A;  1HNW K;  3TSU A;  3KK2 A;  3R6M A;  3M3Z A;  3E9L A;  5C2D A;  3QNO A;  3O1B A;  4KHY A;  2FSK A;  3OYF A;  1N6Q A;  5JMV A;  4CGF A;  4JNE A;  4A62 A;  1WSH A;  3G71 N;  4Z0U A;  4CVN E;  1T05 A;  3CCS N;  4MDB A;  1TV6 A;  3AA2 A;  3ZYY X;  4M3Y A;  2FC0 A;  3SK3 A;  4FLT A;  4FPB A;  1KC8 O;  4YOY A;  3QER A;  1E4G T;  4DFP A;  3BDP A;  5B8H A;  3MEC A;  1IBK K;  4B8C A;  4O0J A;  3GE1 A;  3I8B A;  2NRZ A;  1U45 A;  1O1W A;  4ILH A;  2O4I A;  3NH2 A;  5AFU H;  1C0F A;  4CJL A;  3VF6 A;  2A40 A;  4LFA K;  4FZZ A;  4DQI A;  3O08 A;  3J8A A;  2FSJ A;  3NBP A;  2G8F A;  1RTJ A;  5AQN A;  1N8R O;  3VQ8 A;  1GLJ O;  4E89 A;  1Q8I A;  3LDL A;  1FKP A;  3PLA A;  1Q9Y A;  5FRN A;  1O13 A;  1HKB A;  3O9U A;  3OYD A;  3UKR A;  4IOX A;  3RMD A;  3QFU A;  3NF9 A;  2QEX N;  1ZBF A;  3ASM A;  2AJQ A;  2P9L A;  2YHA A;  2FLO A;  1NGD A;  1OKJ A;  3TAG A;  4QOZ B;  4JKE A;  3OVN A;  4B9V A;  1YI2 N;  2ZE2 A;  3AVM A;  3CFO A;  3ZSR A;  3VEX A;  2F9W A;  2PAV A;  5MLC Q;  4CJ4 A;  1WBD A;  4CGG A;  1QSL A;  4NYN A;  2KFN A;  4B1V A;  4A5A A;  3K0S A;  3MWP A;  1CXQ A;  5LMU K;  3THW A;  5JS2 A;  2IOC A;  4DV1 K;  2IS3 A;  4CZE A;  4A59 A;  4K25 A;  3FZM A;  2NRV A;  1NJW A;  2YI1 A;  3SUQ A;  3VQA A;  4AQY K;  3OYG A;  1NM1 A;  3MXM A;  2RKI A;  1FXX A;  4PY5 A;  3LP1 A;  5CZ1 A;  4GV9 A;  1E4F T;  3C94 A;  5AQZ A;  1Q82 O;  4Z94 A;  3KLF A;  2GV9 A;  3HZ6 A;  3VQ4 A;  4KRF A;  4DV2 K;  2DTU A;  4ZHR A;  1IH7 A;  1U4B A;  4B9U A;  3WEE B;  5TKW A;  2PY5 A;  4JKA A;  4OVL A;  1A5V A;  1TYQ A;  4BG8 A;  4JRQ A;  2LSN A;  3NCI A;  3RSE A;  4CF0 A;  4CZI A;  1N34 K;  3V9W A;  3M8P A;  1YF5 L;  3VGL A;  4DV4 K;  2A3Z A;  3NDK A;  4E0D A;  1T8E A;  2VG7 A;  2WUS A;  4WQ5 C;  4LFC K;  4BGB A;  3VQ7 A;  2YHX A;  3SJJ A;  3S41 A;  3K5O A;  3CJA A;  2HF4 A;  3OA9 A;  4CFD A;  3FZF A;  2VWK A;  5AQU A;  1RFQ A;  3HVR A;  3CC4 N;  1LW0 A;  3CFR A;  4IOC L;  4O8U A;  3W0L A;  3ULE A;  1ASV A;  1TKZ A;  3JAM O;  1S1X A;  1BHL A;  1HJR A;  1QQO A;  3M8R A;  3DYA A;  4I2Q A;  4F3T A;  3HJF A;  3SMP A;  4M7X A;  4E19 A;  5DM6 L;  2ETJ A;  3SQ2 A;  2P9N B;  1DGK N;  2EHG A;  2X74 A;  5I9E B;  1N5Y A;  1QE1 A;  1U04 A;  2D0O A;  2XY7 A;  3PY8 A;  3VQP A;  4CHO A;  2OTJ N;  2HNY A;  4FVM A;  3HK2 A;  4LSL A;  3MK6 A;  1OH7 A;  4HWI A;  4DR1 K;  5EY4 A;  1X9M A;  2WON A;  3L3V A;  1VQO N;  1QQC A;  1HYZ A;  3SNN A;  3FZK A;  3CC2 N;  1JCE A;  1WAJ A;  3FFK B;  2HHH K;  4FO0 A;  1S3X A;  1VSF A;  3HM8 A;  3T3F A;  4BRL A;  2BTF A;  1Q9X A;  4B3O A;  3A5L C;  4ISE A;  2ZGZ A;  3V1Q A;  4DFM A;  1XQS C;  3MCP A;  3AVH A;  4OKE A;  3NVK A;  4JI0 K;  2AP1 A;  4JN4 A;  2QXL A;  4Y0W A;  5GAH P;  1G15 A;  3K5L A;  2YKM A;  5ELZ A;  4KHW A;  4BR4 A;  4J2A A;  1X3M A;  2D0B A;  3NH1 A;  4MLH A;  4BR7 A;  4ELU A;  3SI6 A;  4FPA A;  2JWK A;  4BAC A;  1BUP A;  4F8R A;  4B8A B;  4JI2 K;  4B1W B;  5EX5 A;  3G6E N;  5HRO A;  4GY2 B;  4RTF D;  4F3O A;  3AVK A;  4O0I A;  4OLA A;  2W41 A;  4QCL A;  4A2B A;  3SUN A;  1TK8 A;  2NRH A;  4AM7 A;  2XHB A;  2VG5 A;  4KHP K;  3OHR A;  2F96 A;  1NKC A;  4AM6 A;  3FR0 A;  1KLM A;  4IJA A;  3V1O A;  1GLD G;  1VSH A;  1Q81 O;  1JL2 A;  4BG9 A;  3SAH A;  4FLW A;  4H5R A;  4H03 B;  3IG1 A;  4JK7 A;  3CJ1 A;  3RR8 A;  3PUF A;  3WNE A;  1UAX A;  3OW2 M;  1KCF A;  3BZC A;  2XY8 A;  3KK1 A;  3VA3 A;  4JKC A;  4N41 A;  4IOA L;  3IS9 A;  4B3M K;  3M8Q A;  1ZBU A;  4WQ5 A;  2A6A A;  1BL3 A;  5T7B A;  2B4J A;  3TAR A;  3P38 A;  3K59 A;  1YTA A;  2OPR A;  4AHR A;  2IC3 A;  3D2F A;  1EXQ A;  4YY3 K;  2Z1H A;  3NF8 A;  2F9T A;  3PIP L;  3VEV A;  4JKB A;  4V19 S;  5D3G A;  4LC9 B;  4J2D A;  2CH6 A;  1HMV A;  5JVG L;  3WEE A;  1XMO K;  1GOB A;  1TK0 A;  3PSF A;  4CF1 A;  2E88 A;  4FLZ A;  3H6E A;  4DFJ A;  1KXP A;  4BR2 A;  2PZS A;  4XEI A;  1KVC A;  1YVU A;  1ZC6 A;  2BUP A;  3LWM A;  3THY A;  4CFC A;  3ZT2 A;  4CGD A;  2NUB A;  4EIA A;  2G8H A;  1TVR A;  5AQH A;  4K0K K;  2NRX A;  2YV0 X;  4JKD A;  4A61 A;  1GOC A;  3G10 A;  5AQJ A;  1J5O A;  4DQR A;  3CD6 N;  4CCH A;  3VQD A;  4IG3 A;  1VQ6 N;  1GLB G;  2QI2 A;  4BRE A;  3V9X A;  3TAQ A;  1HQU A;  3HBT A;  4KHN A;  4ILG B;  1BGX T;  4GMJ B;  4OKJ A;  4AHU A;  3ZSV A;  2HHS A;  5AQI A;  1YJN N;  3DLB A;  2CH5 A;  4PA1 A;  3I8D A;  4Z4F A;  5KPT A;  2VQF K;  2D0C A;  5GAE P;  1TUY A;  4DCH A;  3QEI A;  1U48 A;  1C0U A;  1MDU B;  2YNH A;  4ICL A;  1VSM A;  1EWR A;  4FM0 A;  4M3R A;  4Z4C A;  4BRP A;  4NCB A;  2V52 B;  2OTL N;  3UB5 A;  5KRT A;  3K57 A;  2P9N A;  4LSN A;  3SLC A;  1SS6 A;  4I9Q A;  2I7N A;  4MO5 A;  3AVL A;  1VQ7 N;  4KKO A;  4BR5 A;  2R7Y A;  2Z1G A;  3LAM A;  1A5W A;  1TKX A;  1J9A A;  2A41 A;  5CYM A;  3BF1 A;  1NOY A;  1RDA A;  3OYL A;  3RRG A;  3L8B A;  1BU6 O;  1JLC A;  3AGR A;  5DMR A;  3ZT0 A;  3CYM A;  3SV3 A;  4M42 A;  3E66 A;  4B1Z A;  4C8O A;  3H3O B;  5CR4 A;  4MQ3 A;  3CCR N;  4KI4 A;  3TTD A;  5J2Q A;  3WXI A;  5FPE A;  3DJC A;  3U4L A;  5GAD P;  3OJU A;  1X9S A;  1YT3 A;  5E84 A;  1RCH A;  2HHX A;  3UKR B;  1WLJ A;  3VEZ A;  3LPU A;  3U3G A;  4CJQ A;  3OYA A;  3TU5 A;  4OLB A;  1C0M A;  5HRN A;  5GAG P;  1T6C A;  3NGI A;  3JSM A;  3G25 A;  5M1Q A;  4DQ8 A;  2PYJ A;  1VRT A;  4DTS A;  1BCM A;  3SQ1 A;  1KQS M;  3IFR A;  2BE2 A;  3O4Q A;  4DR5 K;  3NMU A;  3AO3 A;  1RDC A;  1NGE A;  1RT2 A;  3QEV A;  1SKW A;  3HI0 A;  1WSE A;  3THW B;  3AAQ A;  4IO9 L;  3A0I X;  4CBW A;  4DS4 A;  1W7A A;  3F9K A;  1QS4 A;  4GVM A;  4N76 A;  4IO8 A;  4JKF A;  4M3T A;  4F9O A;  4OGE A;  1WUA A;  2YJE A;  1I39 A;  1JKH A;  2YNI A;  5KPZ A;  1L3U A;  4IFE A;  3LDO A;  4CD3 A;  4CK1 A;  1VSL A;  3OS1 A;  4CJ3 A;  3MX2 A;  3ZSX A;  1DT9 A;  3SMS A;  1CZ9 A;  2GX9 A;  2NZT A;  4CJ5 A;  3SAF A;  3SQ0 A;  1YAG A;  4GV3 A;  3AO4 A;  3VTI A;  3J7Z O;  3AVB A;  3NHG A;  3ZT1 A;  4BRK A;  3C95 A;  3KK7 A;  1ZBH A;  1NJY A;  2E1Y A;  1NU0 A;  3DMJ A;  4CFB A;  3Q7B A;  3IUC A;  4FWR A;  5HRR A;  3HSC A;  1SAZ A;  3OYK A;  2YNF A;  4PHT X;  1WSF A;  3EZW A;  4X66 K;  1RDD A;  2P9I B;  5KI6 A;  4E7J A;  4Q5V A;  3I55 N;  3WQT A;  3LDS A;  3O8M A;  4IEE A;  4HVJ A;  4F4K A;  2B5J A;  1T03 A;  4LF7 K;  3OYH A;  4FJI A;  3HO1 A;  4IZ9 A;  3O9R A;  4FK4 A;  1YUW A;  3CQY A;  4CK3 A;  4WE1 A;  3H08 A;  4KH6 A;  1SL2 A;  1XI1 A;  3MDQ A;  3VQB A;  4LD0 A;  2V51 B;  5C0Y A;  3M6G A;  3U6F A;  3LP3 A;  4DU3 A;  1C1B A;  4FJX A;  5HL7 L;  1SKR A;  1XNR K;  3N4P A;  5EU7 A;  4DS5 A;  2GEL A;  4NCA A;  2ASO A;  1DKG D;  5C15 A;  2O8B B;  3ZSO A;  3KZB A;  5AQP A;  2KZZ A;  4KAZ A;  5AQX A;  5IT9 O;  2E6L A;  3WQU A;  4DQS A;  4OKK A;  4DTM A;  4CJR A;  4IKF A;  3LDQ A;  4J2E A;  2OPS A;  2P9S A;  4HUE A;  1SV5 A;  3DLK A;  1LAW A;  4DTR A;  5SZT A;  2QK9 A;  1RIL A;  1F21 A;  4M3U A;  1ZBI A;  1DLO A;  2HHT A;  4PL8 A;  2UXB K;  1HNI A;  3OYN A;  3UIQ A;  3O3F A;  3MCA B;  3CCL N;  4LFB K;  2ZM6 K;  2ZF5 O;  1UA0 A;  4O44 A;  4FJ5 A;  3HRG A;  4YDU C;  4EAH D;  2FF6 A;  3KLG A;  1YJ9 N;  4DSF A;  4FM2 A;  2AA4 A;  3A5O C;  1ASW A;  4JRP A;  1VQL N;  2KHO A;  3CER A;  4XH1 A;  3CCM N;  5M1F A;  4FOE A;  4CJS A;  4DTN A;  1S6P A;  4DV7 K;  1TK5 A;  1J6Z A;  5FRO A;  4QS7 A;  4JI5 K;  4DMN A;  3OS2 A;  2Y1J A;  1VQ9 N;  4H4M A;  1GLL O;  1VRU A;  1Y64 A;  3I0R A;  2YCH A;  3MWT A;  4CZJ A;  3JS6 A;  3EKS A;  4WFN L;  3V81 A;  4BVO A;  4JKH A;  3F5T A;  3CM6 A;  3SJH A;  3SCX A;  3DLR A;  1WSG A;  5C12 A;  3ENH A;  2XY6 A;  1WAF A;  1LOT B;  1NBW A;  2HBJ A;  4M41 A;  2HF3 A;  1JLA A;  4BE0 A;  4OPA A;  1X9W A;  2HW3 A;  3MN7 A;  3TSP A;  3O80 A;  3QNN A;  1TAU A;  3M8S A;  2P9K B;  1QQN A;  3O9Q A;  4A57 A;  4IFY A;  3KKR A;  3QEP A;  4Q0B A;  3EKU A;  5BRH A;  1IBM K;  4CEO A;  3C6H A;  3MAQ A;  4KTQ A;  2PFU A;  4IFV A;  3AGK A;  3WXJ A;  3LPT A;  3HPH A;  1HNX K;  4YOX A;  4DSL A;  4OPJ A;  5LJW A;  2EWS A;  1XMQ K;  4PKI A;  1HJO A;  1U6Z A;  2E1Z A;  3ZSW A;  2UXD K;  5BRE A;  4JI4 K;  3MXJ A;  4Z4E A;  1Z6R A;  3D2F B;  1B9D A;  3TSQ A;  1Q18 A;  3DLG A;  1MWM A;  1NMD A;  2HB5 A;  2P5O A;  4ZTF A;  2G8I A;  3C7N A;  3R8E A;  3ATV A;  5I42 A;  1T3V A;  4DR3 K;  1NGH A;  1D9F A;  2HMP A;  5ADX A;  4Y1C A;  3RMC A;  3WT0 A;  2VGM A;  1S9E A;  1ATR A;  3OJS A;  3THY B;  1OVY A;  4IG0 A;  3H3N O;  2GUP A;  4JI7 K;  4AH9 A;  1NJI O;  4B1Y B;  3TAP A;  5HOO A;  3A2F A;  3AO5 A;  3LL3 A;  2P9I A;  3K9J A;  1EO1 A;  5A2Q O;  1HQE A;  4J8F A;  2E2O A;  2D0A A;  1WN7 A;  4H5N A;  3S9H A;  4HTU A;  3QDK A;  2XRI A;  3HPO A;  2HVH A;  3HP9 A;  1C0G A;  4B1U B;  3L2U A;  3AA5 X;  4KHQ A;  2Q31 A;  1EQY A;  1BI4 B;  2IVN A;  3O3G A;  4FK2 A;  3LM9 A;  1BG3 A;  4CHP A;  3D2E A;  3MN5 A;  3V9U A;  1RTD A;  4CBU A;  1N36 K;  4O4G A;  3SBT A;  4QS9 A;  3DXK A;  3OY9 A;  2GWK A;  3OYJ A;  2Q0R A;  3NF6 A;  2O8B A;  2DFF A;  1HLU A;  5KGW A;  3SBG A;  5IWA K;  4YDU A;  5HRP A;  3PX0 A;  4FJL A;  3TTF A;  4JEP A;  5HRS A;  4YOV A;  5J2P A;  2HHW A;  3HPG A;  4B9L A;  1C1C A;  4H0P A;  5E41 A;  3VQC A;  2KTQ A;  4BRI A;  1VQ5 N;  2G8U A;  1ZYQ A;  3C6U A;  2UXC K;  5AJ3 K;  1S1T A;  4AHS A;  1L3V A;  3P83 D;  4R5P A;  1E3M A;  2YNG A;  5KGX A;  2W40 A;  4UY8 O;  1YHQ N;  1J53 A;  1ASU A;  3TAF A;  5JS1 A;  3QIO A;  3G0Z A;  1SZ2 A;  3EO3 A;  1VSK A;  4GNI A;  3QML A;  3LP0 A;  3KD1 E;  1JLE A;  4RW8 A;  3H1Q A;  2DPN A;  4DKW A;  1QVG M;  4LF9 K;  3VQ6 A;  3F73 A;  2O4G A;  5CHI A;  3M1F A;  4DV5 K;  2FSN A;  3VQ9 A;  1GLE G;  2Q97 A;  4EHT A;  4CK2 A;  3LZI A;  5SWM A;  2HBL A;  2X6N A;  3DLL L;  2A5X A;  5CYQ A;  3O3H A;  3VA0 A;  3O4W A;  5AQW A;  2NRR A;  5FPM A;  4DV0 K;  3NGY A;  3DWL A;  1Z25 A;  4PKH A;  4DR2 K;  1X3N A;  3KLH A;  4BWM A;  1ILY A;  4KFB A;  2NLX A;  4CJK A;  1GLF O;  4DV3 K;  3D6R A;  3VES A;  2G8V A;  3EY1 A;  2Q3S A;  3L4I A;  1SQK A;  1TL1 A;  4CHQ A;  1NJX A;  1NGB A;  2WBN A;  5FPD A;  3HYF A;  3LAK A;  4GKK K;  4BQZ A;  5JVH L;  4EFH A;  4CER A;  5M1P A;  3ZCM A;  3ZX2 A;  1XWL A;  2P9K A;  4YHH K;  3S3N A;  4BRO A;  3QET A;  3EE8 A;  1HX1 A;  4FLU A;  1NGG A;  3FLC O;  5KQ8 A;  3S3M A;  4BR0 A;  2OYQ A;  1ZBS A;  2W42 A;  4YOW A;  1RT6 A;  4FM1 A;  1C0T A;  3RMA A;  5F1X A;  2KQ2 A;  3R3L A;  4JKG A;  3CPW M;  4BC4 A;  3L2R A;  1KAY A;  1UWB A;  5CY4 A;  3OYM A;  4U67 L;  1RNH A;  3EN9 A;  3HOT A;  3OYC A;  4ID5 A;  4KRE A;  2ZJP L;  3TPQ A;  4NO7 A;  3SV4 A;  1BIS A;  3U3Y A;  4H0V B;  5LL6 Z;  2RF2 A;  4NXN K;  4M3W A;  1RTI A;  3NF7 A;  4ID1 A;  3O5B A;  1RDB A;  4RW6 A;  4B3T K;  2Q1N A;  5C10 A;  4DG1 A;  4OJR A;  3ZX0 A;  1P90 A;  3QB0 A;  1LW2 A;  1JLF A;  4K42 A;  4ELV A;  5FRM A;  1XNQ K;  3K58 A;  3VEY A;  4F2R A;  1KVB A;  1XUP O;  3H45 C;  1W0H A;  4RW9 A;  4CF8 A;  2BDP A;  1VQN N;  2G8K A;  3U8X A;  4CIG A;  3SYZ A;  4Z4G A;  2D5R A;  4CEE A;  3ISN C;  2NNW A;  1C6V A;  3VGK A;  1NOZ A;  1RBS A;  3CHW A;  1WB9 A;  3JXU A;  2Q2R A;  3AVA A;  1BO5 O;  2HHU A;  4CIE A;  2X6S A;  5AQY A;  1D9D A;  3AAP A;  1BA0 A;  1BI4 A;  1H1V A;  4BC5 A;  3GBT A;  3T19 A;  4CEF A;  4U7B A;  3HP6 A;  4CES A;  5BPM A;  3VOV A;  3FFI A;  4N5S A;  4DTU A;  3SPZ A;  2VYP A;  5TKY A;  3V6D A;  4GV6 A;  4CJV A;  1RT1 A;  1KAZ A;  3P39 A;  2HST A;  2D4W A;  4DSK A;  4DSI A;  3ZT3 A;  4DTJ A;  2P9S B;  1YXQ A;  4HUG A;  2JLE A;  3LAN A;  1RTH A;  3WXL A;  3FE1 A;  4RWT A;  1OH8 A;  2WC9 A;  4CJE A;  2ATQ A;  5BPL A;  3ENO A;  4I2P A;  4FJ7 A;  4KHU A;  3Q7C A;  3N4Q A;  1BCO A;  2YHW A;  4JHD B;  4DUY K;  2H3G X;  2P9U A;  4FJJ A;  3LDP A;  4CZF A;  4OO1 J;  2E4L A;  5JIC A;  3GOI A;  3U9Z A;  3KWI A;  1ZXO A;  1OH6 A;  1NK5 A;  3DXM B;  1JXB A;  2QXF A;  3E01 A;  4BQL A;  4KH5 A;  1VQM N;  2OZM A;  1S9G A;  1HRH A;  4LY7 A;  1I94 K;  1HR0 K;  2GUI A;  2RHK A;  3C65 A;  1Q86 O;  4BE1 A;  4M3Z A;  5KQD A;  4FK0 A;  3ZX3 A;  3TWH A;  1IKX A;  3F2K A;  4DU1 A;  1IJJ A;  1RT5 A;  2KFZ A;  4M63 C;  1XHX A;  1TAQ A;  2Z1I A;  3C6A A;  4FWQ A;  3WNF A;  3SUP A;  3IMX A;  1BQM A;  4FYD A;  1KTQ A;  3AAR A;  2IIR A;  4CEC A;  1ATS A;  1WSI A;  4JV5 K;  2GBZ A;  4H4O A;  1V4S A;  4CJ7 A;  3VQE A;  3O9S A;  1LAV A;  1VSE A;  4IJN A;  3E1Y A;  5AQF A;  3TAE A;  5AQG A;  4PQU A;  2NRT A;  4NLC A;  4QAG A;  5H1S Q;  3ULD A;  4DSJ A;  3J7A P;  2F7T A;  1CZB A;  4PKG A;  1RBU A;  3EZ5 A;  4BRD A;  3V1R A;  3ENB A;  2QWO A;  1HYS A;  1V4T A;  4UQG A;  2UUC K;  2OCE A;  3RRH A;  4KTZ A;  2YKN A;  5BPN A;  4B9Q A;  4FWK A;  4BRG A;  2A1R A;  1S72 N;  2KZM A;  2P9P A;  4GKJ K;  3O1W A;  4CI6 A;  1SKS A;  4OPH A;  1OVQ A;  4WFA L;  4GVE A;  2GWJ A;  4W5N A;  1BA1 A;  4KB0 A;  3C7N B;  4CGH A;  4IDK A;  3PO5 A;  4DV6 K;  3AVF A;  4AHV A;  2JWL A;  2W6K A;  3KD5 E;  1HNZ K;  2IVO A;  4FWS A;  4ISG A;  2V7Z A;  5JLF A;  3I56 N;  5LJV A;  3C0B A;  3E9P A;  4B08 A;  1R59 O;  4LF5 K;  3OYI A;  2E20 A;  3MN9 A;  4CEB A;  3OYE A;  3LDN A;  3SZ2 A;  4BY9 C;  3CQX A;  4RW7 A;  1A5X A;  3TAB A;  3ZSQ A;  5GIO A;  5J2M A;  2O8E B;  4LH4 A;  2O8F A;  4BC2 A;  3BUZ B;  3AO1 A;  2JGU A;  5AQM A;  1VQK N;  1FW6 A;  4F2S A;  3B6P A;  3VF2 A;  3H46 O;  4FLY A;  3L6Q A;  3NGZ A;  2HHQ A;  3D2E B;  1LWE A;  4DLG A;  1N33 K;  2QWN A;  4MO4 A;  4ZTJ A;  1U47 A;  3LZJ A;  3OBY A;  4JYA K;  1GOA A;  4N56 A;  3AV9 A;  1KFS A;  3DXK B;  3CJC A;  2ITM A;  3RR7 A;  2FF3 B;  1HNV A;  4LH5 A;  4G9Z A;  5AQQ A;  3HXM A;  3DRP A;  1NGF A;  1NK0 A;  4OX9 K;  4BR9 A;  4W5O A;  3KWG A;  1QZ6 A;  3DLE A;  4M7Y A;  5M1O A;  1NGJ A;  3L4Q A;  2YHB A;  5DK5 A;  2QTD A;  4C1N I;  3OYB A;  2O8C B;  1MA9 B;  1TKD A;  3QEW A;  3EEQ A;  1EWQ A;  2HNZ A;  1XC9 A;  2QWL A;  4W5R A;  3RTV A;  2OAN A;  3WXK A;  3VEN A;  4C8M A;  4DR7 K;  1EP4 A;  3HVT A;  4YOU A;  4BC3 A;  1FKO A;  3CPE A;  2ASM A;  5GIN A;  5HBM A;  2EX3 A;  1IKY A;  2A42 A;  3ZEU B;  3V4I A;  4E3S A;  4AIL C;  3AVN A;  1S1V A;  2KLA A;  5BR8 K;  4A5B A;  1Z26 A;  2E2N A;  5C2F A;  3ZSZ A;  1CXU A;  3ZSY A;  3RMB A;  1S1W A;  1U2V B;  4JHD A;  5KRS A;  4IEI A;  1LWC A;  1EET A;  2ZWH A;  3ID8 A;  3CF5 L;  3P1G A;  3LAL A;  3ZET B;  3D0P A;  1NNE A;  4DLE A;  2X78 A;  4H8K A;  4CZK A;  1DTT A;  1JLB A;  2BGG A;  2P5G A;  4CHY A;  4DF4 A;  3DXM A;  4W5T A;  3QEX A;  1ESV A;  4OPK A;  4HUF A;  3SUO A;  1QSY A;  3MMV A; 
#chains in the Genus database with same CATH homology
 1TKT A;  4DFJ A;  2PZS A;  2OZS A;  5J2P A;  3HT3 A;  3KKS A;  1UOC A;  3HPG A;  5K14 A;  1NJZ A;  1ZBL A;  1C1C A;  2DFE A;  5E41 A;  4B9T A;  4B9L A;  3VQC A;  4AHT A;  1KVC A;  1YVU A;  3VQ5 A;  3LWM A;  4DQP A;  4CFC A;  3ZT2 A;  4CGD A;  2NUB A;  4EP5 A;  2KTQ A;  2FBX A;  2G8H A;  4FJG A;  3WNG A;  3MEE A;  3JYT A;  1NK4 A;  4ELT A;  4E7H A;  3CFP A;  3DRS A;  2G8U A;  1TVR A;  1ZYQ A;  5HLF A;  4M45 A;  3C6U A;  2YV0 X;  4NCG A;  1S1T A;  1RBR A;  1GOC A;  3G10 A;  4AHS A;  4Z4I A;  1J5O A;  1L3V A;  4DQR A;  3P83 D;  4R5P A;  4BE2 A;  1NK6 A;  2YNG A;  3DI6 A;  4XIU A;  3VQD A;  4CCH A;  4IG3 A;  5KGX A;  2DY4 A;  1KFD A;  4DTX A;  4J2B A;  2RPI A;  3V9X A;  3TAQ A;  3DRR A;  1J53 A;  2ZD1 A;  1ASU A;  1HQU A;  3TAF A;  5JS1 A;  3QIO A;  4KHN A;  4I9L A;  1BGX T;  4GMJ B;  3G0Z A;  4CF2 A;  2HMI A;  3AA4 A;  4OKJ A;  4AHU A;  1VSK A;  3ZT4 A;  3KLI A;  3LP0 A;  3ZSV A;  2HND A;  3KD1 E;  2HHS A;  1JLE A;  4TSX A;  4RW8 A;  3S3O A;  1X1P A;  3HST B;  3DLB A;  4L8R B;  4PA1 A;  3I8D A;  4CEZ A;  3LWL A;  3VQ6 A;  3F73 A;  2O4G A;  4JS4 A;  5J2N A;  4Z4F A;  1REV A;  3HL8 A;  3QIP A;  2D0C A;  4E1N A;  5KTQ A;  2HVI A;  3QEI A;  3VQ9 A;  4B9M A;  1U48 A;  1C0U A;  3T1A A;  4CK2 A;  4CJW A;  3LZI A;  3AVC A;  3I0S A;  3VQQ A;  2YNH A;  4ICL A;  5SWM A;  4BWJ A;  1VSM A;  2X6N A;  4FM0 A;  3THV A;  4M3R A;  4DWI A;  4Z4C A;  4PUO A;  5CYQ A;  4NCB A;  4CJT A;  2F8S A;  4CF9 A;  3O3H A;  3VA0 A;  4DF8 A;  2F8T A;  1VSJ A;  2DFH A;  5KRT A;  4LSN A;  3K57 A;  2VG6 A;  4I9Q A;  3NGY A;  4FJM A;  1YTU A;  1HPZ A;  1Z25 A;  2E6M A;  4OGC A;  3TAN A;  3AVL A;  3DOL A;  4KKO A;  3KLH A;  3PV8 A;  2I5J A;  4RW4 A;  4BWM A;  3WNH A;  4CGJ A;  1D8Y A;  4KFB A;  2R7Y A;  2Z1G A;  4CJK A;  4CHN A;  3LAM A;  3MEG A;  1A5W A;  4KV8 A;  1TKX A;  1J9A A;  1SUQ A;  1TGO A;  3V9Z A;  1C1A A;  5CYM A;  1DTQ A;  2G8V A;  3EY1 A;  2Q3S A;  1R0A A;  4BDZ A;  1HYV A;  1TL1 A;  4CHQ A;  1NJX A;  1NOY A;  1RDA A;  3OYL A;  3RRG A;  2QKB A;  4DSE A;  3AA3 A;  5C42 A;  3HYF A;  1JLC A;  3L8B A;  1L3S A;  3LAK A;  1BIU A;  5C25 A;  3IAY A;  4E1M A;  5DMR A;  4N47 A;  2B6A A;  4E7K A;  2KW4 A;  4HHT A;  4KHS A;  3ZT0 A;  4CER A;  3CYM A;  3SV3 A;  4M42 A;  1RT4 A;  3ALY A;  1UA1 A;  3ZCM A;  1XWL A;  2PYL A;  4C8O A;  3PX4 A;  3S3N A;  4FJH A;  3RWU A;  4K8X A;  4MQ3 A;  4CIF A;  2Z1J A;  1NK9 A;  1JLG A;  3QET A;  4KI4 A;  4M3X A;  5J2Q A;  1VK0 A;  3KK2 A;  4FLU A;  2OPQ A;  3S3M A;  3OJU A;  1X9S A;  2OYQ A;  1IG9 A;  2HHW A;  2W42 A;  1YT3 A;  3QNO A;  1RCH A;  2OPP A;  4KHY A;  1RT6 A;  4FW1 A;  2HHX A;  3OYF A;  4FM1 A;  1N6Q A;  1C0T A;  1WLJ A;  3RMA A;  2KQ2 A;  3NH0 A;  4CGF A;  3LPU A;  3L2R A;  3U3G A;  4CJQ A;  1UWB A;  1WSH A;  5CY4 A;  3OYA A;  3OYM A;  3KLE A;  3PO4 A;  1RNH A;  4OLB A;  1C0M A;  4Z0U A;  3OYC A;  5HRN A;  1T05 A;  4ID5 A;  4KRE A;  1TV6 A;  1S6Q A;  3AA2 A;  4M3Y A;  4FCY A;  2FC0 A;  4FLT A;  1RBV A;  3NGI A;  3HM9 A;  3JSM A;  3SV4 A;  1BIS A;  3QER A;  3U3Y A;  4DFP A;  2RF2 A;  4CEA A;  2PYJ A;  3BDP A;  3KTQ A;  4M3W A;  1RTI A;  1VRT A;  3MEC A;  4DTS A;  3NF7 A;  4B8C A;  4ID1 A;  1BCM A;  3SQ1 A;  1RDB A;  4RW6 A;  2BE2 A;  4O0J A;  3O4Q A;  3AO3 A;  1RDC A;  1RT2 A;  4DG1 A;  3QEV A;  1SKW A;  4OJR A;  1WSE A;  3MED A;  1U45 A;  1O1W A;  1LW2 A;  4DS4 A;  1NKE A;  1JLF A;  3F9K A;  3NH2 A;  2O4I A;  1QS4 A;  1T7P A;  4ELV A;  4GVM A;  2XY5 A;  5FRM A;  3K58 A;  4N76 A;  2P1J A;  3D45 A;  4CJL A;  1KVB A;  4F2R A;  4M3T A;  1W0H A;  4RW9 A;  4CF8 A;  2BDP A;  1S5J A;  4OGE A;  2G8K A;  4CIG A;  3SYZ A;  4Z4G A;  4O5B A;  2D5R A;  4FZZ A;  1I39 A;  4DQI A;  1JKH A;  4CEE A;  3ISN C;  3DOK A;  2YNI A;  2HHV A;  4Z4H A;  1C6V A;  3NBP A;  1NOZ A;  1SL1 A;  1L3U A;  2G8F A;  1RBS A;  1RTJ A;  4CK1 A;  3QLH A;  3VQ8 A;  4BDP A;  1VSL A;  3AVA A;  1JXE A;  4E89 A;  3OS1 A;  1Q8I A;  2HHU A;  1FKP A;  4CJ3 A;  4CIE A;  1Q9Y A;  5FRN A;  3ZSX A;  2X6S A;  1D9D A;  3P5J A;  3OYD A;  1BI4 A;  1CZ9 A;  1L3T A;  1XHZ A;  3RMD A;  3NF9 A;  3T19 A;  4G1Q A;  4CJ5 A;  3SQ0 A;  3ASM A;  1ZBF A;  4CEF A;  2AJQ A;  1TL3 A;  3AO4 A;  2IDO A;  4CES A;  3HP6 A;  3AVB A;  3DM2 A;  3TR8 A;  2YHA A;  3ZT1 A;  3NHG A;  3FFI A;  3C95 A;  4N5S A;  3TAG A;  4DTU A;  3SPZ A;  4QOZ B;  4E7I A;  1ZBH A;  1NJY A;  3OVN A;  4B9V A;  1VSD A;  2ZE2 A;  3V6D A;  4CJF A;  1LWF A;  3AVM A;  1RT1 A;  3CFO A;  3DMJ A;  4KTW A;  5FDL A;  3ZSR A;  4CJV A;  4CFB A;  4YFU A;  5HRR A;  4DSI A;  3OYK A;  4DSK A;  3ZT3 A;  2YNF A;  4CJ4 A;  4DTJ A;  4EZ9 A;  4FZX C;  4HUG A;  4CGG A;  1WSF A;  2JLE A;  3LAN A;  4NYN A;  1QSL A;  1RDD A;  4C8N A;  5KI6 A;  2KFN A;  1RTH A;  4HCB A;  4E7J A;  4Q5V A;  3AVI A;  4YNQ A;  3LDS A;  3MXI A;  1J54 A;  4HVJ A;  4F4K A;  1CLQ A;  1CXQ A;  4CGI A;  2B5J A;  5JS2 A;  4AHC A;  4CJE A;  4CJP A;  2IOC A;  3OYH A;  4FLX A;  1ITG A;  1T03 A;  2ATQ A;  2IS3 A;  4FJI A;  3HO1 A;  1EX4 A;  4I2P A;  3L2V A;  4FJ7 A;  4Y1D A;  2VWJ A;  4KHU A;  4FK4 A;  1BIZ A;  3CM5 A;  1BCO A;  4CK3 A;  4WE1 A;  3SUQ A;  3H08 A;  1NJW A;  3VQA A;  4CE9 A;  1SL0 A;  1SL2 A;  3OYG A;  1XI1 A;  3CQ8 A;  3MXM A;  4C8L A;  4FJJ A;  1KRP A;  2BAN A;  3VQB A;  3VN5 A;  2RKI A;  2E4L A;  4LD0 A;  1FXX A;  3U6F A;  3LP3 A;  3LP1 A;  4DU3 A;  1C1B A;  4FJX A;  4PY5 A;  4FJ9 A;  1SKR A;  5EU7 A;  4DS5 A;  5CZ1 A;  1BQN A;  4NCA A;  4CED A;  1NK5 A;  3C94 A;  3LP2 A;  3SQ4 A;  1JXB A;  2QXF A;  3ZSO A;  1LV5 A;  3E01 A;  3KLF A;  3AVG A;  2GV9 A;  3VQ4 A;  4KRF A;  2DTU A;  4ZHR A;  1IH7 A;  1U4B A;  2KZZ A;  3IRX A;  4B9U A;  2ZQB A;  3V9S A;  2OZM A;  4KAZ A;  2PY5 A;  1S9G A;  1A5V A;  1HRH A;  1MU2 A;  4LY7 A;  2E6L A;  4OVL A;  4CFA A;  4JRQ A;  4DQS A;  1K6Y A;  2LSN A;  4OKK A;  3NCI A;  1I3A A;  2GUI A;  3NFA A;  3AO2 A;  4CJR A;  4DTM A;  4CF0 A;  4BE1 A;  4CEQ A;  3L2W A;  4IKF A;  4M3Z A;  4KB1 A;  4FK0 A;  3TWH A;  1IKX A;  3TAM A;  4DU1 A;  4KI6 A;  1RT5 A;  2KFZ A;  3V9W A;  4GW6 A;  3M8P A;  1RT3 A;  1KLN A;  1KSP A;  1XHX A;  2OPS A;  4J2E A;  1TAQ A;  2Z1I A;  3QIN A;  4HUE A;  4EZ6 A;  1SV5 A;  3DLK A;  3WNF A;  3NDK A;  4E0D A;  1T8E A;  2VG7 A;  1LAW A;  4DTR A;  5SZT A;  3SUP A;  2QK9 A;  1RIL A;  4DTP A;  3VQ7 A;  1BQM A;  1F21 A;  4FYD A;  1NK7 A;  4JS5 A;  1KTQ A;  3PX6 A;  4M3U A;  1ZBI A;  1DLO A;  2HHT A;  3SJJ A;  4CEC A;  1HNI A;  3K5O A;  3OYN A;  1WSI A;  3UIQ A;  2GBZ A;  4H4O A;  3O3F A;  4CFD A;  3VQE A;  1QSS A;  1W9H A;  1LAV A;  1VSE A;  2VWK A;  3TAE A;  3HVR A;  1UA0 A;  4O44 A;  4QAG A;  4FJ5 A;  4K8Z A;  4DSJ A;  3ULD A;  4PQU A;  3KLG A;  1LW0 A;  1IKV A;  3CFR A;  4DSF A;  4FLV A;  4FM2 A;  3TI0 A;  1CZB A;  1ASV A;  1ASW A;  1TKZ A;  1RBU A;  1S1X A;  4JRP A;  3EZ5 A;  1B9F A;  4E7L A;  1BHL A;  1JLQ A;  1HJR A;  3M8R A;  1NK8 A;  3DYA A;  3V1R A;  4I2Q A;  1HYS A;  1JL1 A;  4CJS A;  4UQG A;  4F3T A;  4DTN A;  1S6P A;  3HJF A;  4E19 A;  4KTZ A;  2YKN A;  3RRH A;  1TK5 A;  1EKE A;  3KJV A;  2RN2 A;  5FRO A;  2A1R A;  4I7F A;  2ETJ A;  4C8K A;  1FK9 A;  4DMN A;  3SQ2 A;  3OS2 A;  2Y1J A;  2EHG A;  2KZM A;  4H4M A;  1VRU A;  3I0R A;  2X74 A;  1N5Y A;  1QE1 A;  4KPY A;  1U04 A;  2XY7 A;  1SKS A;  3PY8 A;  3VQP A;  4CHO A;  2Y1I A;  2HNY A;  3B6O A;  3V81 A;  4FVM A;  1KVA A;  4NYF A;  3HK2 A;  4LSL A;  3K5N A;  1B92 A;  3CM6 A;  3SCX A;  4W5N A;  3OS0 A;  3PO5 A;  4CGH A;  3DLR A;  1WSG A;  4IDK A;  4DU4 A;  4KB0 A;  4FJN A;  1X9M A;  3L3U A;  1WAF A;  2WON A;  3AVF A;  3L3V A;  4AHV A;  2XO7 A;  2XY6 A;  2QKK A;  1QQC A;  1HYZ A;  3KD5 E;  3ITH A;  4M41 A;  2G8W A;  3SNN A;  1WAJ A;  1JLA A;  1VSF A;  4B08 A;  4BE0 A;  3T3F A;  5C24 A;  3OYI A;  2OA8 A;  1S1U A;  4BDY A;  4EP4 A;  1Q9X A;  5J1E A;  1X9W A;  4B3O A;  4CEB A;  3C6T A;  2HW3 A;  3QNN A;  1TAU A;  4JLH A;  3M8S A;  2ITG A;  1RBT A;  3V1Q A;  3OYE A;  4DFM A;  3SZ2 A;  4RW7 A;  3AVH A;  4OKE A;  1L5U A;  4IFY A;  3CG7 A;  3KKR A;  3QEP A;  1A5X A;  3TAB A;  1U49 A;  3ZSQ A;  4Q0B A;  1RT7 A;  3NE6 A;  5J2M A;  1G15 A;  2FBV A;  4LH4 A;  4CEO A;  3K5L A;  1NKB A;  3MAQ A;  2YKM A;  4KTQ A;  4IFV A;  3AO1 A;  4KHW A;  2FBT A;  3L2Q A;  2JGU A;  5I3U A;  4F2S A;  4J2A A;  2A1S A;  2IGI A;  3K2P A;  3LPT A;  3B6P A;  3HPH A;  3QO9 A;  3NAE A;  2FBY A;  4FLY A;  3NGZ A;  4CHZ A;  4OPJ A;  4DSL A;  1IO2 A;  2D0B A;  2HHQ A;  3NH1 A;  3KK3 A;  4FJ8 A;  1LWE A;  4FZY A;  4DLG A;  3ZSW A;  4ELU A;  4B9S A;  3SI6 A;  4ZTJ A;  1U47 A;  4BAC A;  3LZJ A;  1WSJ A;  4DQQ A;  1GOA A;  3MXJ A;  4N56 A;  4F8R A;  4Z4E A;  3AV9 A;  1KFS A;  2P51 A;  4B8A B;  1B9D A;  4FXD A;  3BGR A;  5HRO A;  4PWD A;  3RR7 A;  3DLG A;  4FJK A;  1HNV A;  4LH5 A;  4F3O A;  2HB5 A;  3HXM A;  3AVK A;  2P5O A;  3DRP A;  4O0I A;  1NK0 A;  4ZTF A;  2G8I A;  4OLA A;  4W5O A;  1WNS A;  4QCL A;  3DLE A;  4KO0 A;  3SUN A;  5I42 A;  1TK8 A;  5DK5 A;  2YHB A;  3OYB A;  2XHB A;  3K5M A;  2VG5 A;  1D9F A;  2F96 A;  1D5A A;  1NKC A;  4Y1C A;  1TKD A;  3RMC A;  1KLM A;  3QEW A;  4CJU A;  3V1O A;  1S9E A;  2WOM A;  3OJS A;  2HNZ A;  4IG0 A;  1VSH A;  1XC9 A;  4W5R A;  3RTV A;  4AH9 A;  3TAP A;  1JL2 A;  3A2F A;  3AO5 A;  4C8M A;  4FLW A;  1QTM A;  1EP4 A;  3HVT A;  3IG1 A;  1FKO A;  4O55 A;  3RR8 A;  1HQE A;  3PUF A;  3AVJ A;  1UAX A;  3WNE A;  5HBM A;  2D0A A;  1KCF A;  2EX3 A;  5CZ2 A;  1IKY A;  4W5Q A;  1WN7 A;  3EYZ A;  3S9H A;  4HTU A;  1Y97 A;  2XRI A;  3HPO A;  2HVH A;  3HP9 A;  2IAJ A;  2XY8 A;  1VSI A;  3KK1 A;  3L2U A;  3AA5 X;  4E3S A;  3AVN A;  1S1V A;  4AIL C;  3V4I A;  3SPY A;  4KHQ A;  1Z26 A;  4HCC A;  3O4N A;  3VA3 A;  1BI4 B;  3O3G A;  4N41 A;  3ZSZ A;  4B9N A;  1CXU A;  3ZSY A;  3IS9 A;  3RMB A;  1S1W A;  3M8Q A;  1ZBU A;  4FK2 A;  5KRS A;  1BL3 A;  4CHP A;  1LWC A;  1IKW A;  1EET A;  3V9U A;  1RTD A;  5T7B A;  2B4J A;  4IBN A;  3P1G A;  3LAL A;  3D0P A;  3TAR A;  3K59 A;  1YTA A;  2OPR A;  4O4G A;  4AHR A;  4DLE A;  3KIO A;  2IC3 A;  2X78 A;  4H8K A;  3OY9 A;  1DTT A;  1EXQ A;  1JLB A;  2BGG A;  3OYJ A;  2P5G A;  4RG8 A;  4CHY A;  3NF6 A;  4DF4 A;  4DTO A;  2Z1H A;  4FW2 A;  2DFF A;  5KGW A;  3NF8 A;  3QES A;  4DFK A;  4W5T A;  5HRP A;  3PX0 A;  5D3G A;  4MFB A;  3QEX A;  4FJL A;  4OPK A;  5HP1 A;  4HUF A;  1HMV A;  4J2D A;  1GOB A;  1QHT A;  3SUO A;  1TK0 A;  1QSY A;  4CF1 A;  4FLZ A;  3DLH A;  5HRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...