4OKKA

Crystal structure of rnase as from m tuberculosis in complex with ump
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
160
structure length
160
Chain Sequence
VRYFYDTEFIEDGHTIELISIGVVAEDGREYYAVSTEFDPERAGSWVRTHVLPKLPPPASQLWRSRQQIRLDLEEFLRIDGTDSIELWAWVGAYDHVALCQLWGPMTALPPTVPRFTRELRQLWEDRGCPRMPPRPRDVHDALVDARDQLRRFRLITSTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3'-5' exoribonuclease Rv2179c/MT2234.1
publication title Structure and Function of RNase AS, a Polyadenylate-Specific Exoribonuclease Affecting Mycobacterial Virulence In Vivo
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 52
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2014-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4okkA00
2OPSA 2YNIA 4CF9A 4N41A 1S9GA 5HRRA 3LZJA 1RT7A 3OYDA 2KW4A 2XY8A 4OLBA 3OS2A 4CJ5A 1BQNA 3UIQA 3L2WA 1HYVA 2OPRA 2G8KA 1NK0A 4B9SA 4KAZA 4M3WA 4QCLA 5HP1A 4DTSA 3DMJA 4CJRA 2KFZA 2HHQA 1B92A 4BE2A 1S1XA 1X1PA 2FBTA 4IDKA 4CF2A 4NYNA 5FROA 2OPQA 1L3SA 5SZTA 2DTUA 3AO3A 1C0UA 1JL1A 1A5VA 4B8AB 5HRPA 1BISA 3MECA 1HPZA 4KREA 3ZSRA 2ITGA 3K5LA 3RRHA 2FBYA 5KRSA 4W5OA 4C8KA 1KLMA 3O4NA 4O44A 2QKBA 5FRMA 1GOBA 5J2MA 3VQ9A 4QAGA 3QETA 3ZSWA 3RR8A 4M3ZA 2D0AA 1Z25A 2IAJA 3U3GA 3CM6A 5CY4A 3T1AA 2IOCA 3HSTB 4DQQA 3TI0A 3KK2A 4QOZB 4JRPA 2B5JA 1RBRA 4FLVA 4FJXA 3OS1A 4XIUA 4O55A 3KLFA 3TABA 2F8SA 3LP1A 3QESA 5HROA 1HQUA 4I2PA 3OYKA 2FBXA 4HUFA 2BGGA 3KK3A 1Y97A 3SUOA 2HHXA 3PX4A 1NK5A 1RTJA 2KZMA 2BANA 3NGIA 1KRPA 3C6TA 4WE1A 1IH7A 1U45A 4EZ6A 4DG1A 5KRTA 2IGIA 1WSIA 2YV0X 1S1UA 4C8MA 3VQBA 3SV3A 1TK5A 1NK6A 1YTUA 3KTQA 1N6QA 3HO1A 3TAMA 3RMAA 1J9AA 3D45A 1S6QA 2R7YA 1SL1A 1NKCA 4ELTA 4OGCA 5KGXA 4FJ5A 4CFAA 4Z4EA 3P83D 4CJTA 1BIZA 4DWIA 2HHUA 4DLEA 1T8EA 3ZSQA 2P1JA 3LWLA 1XI1A 4HHTA 1C6VA 1JLBA 1Q8IA 1L3TA 3QEXA 4OKKA 4FK2A 4M3TA 3HJFA 4E0DA 1J5OA 3ASMA 1W9HA 4CECA 1B9DA 5J2PA 2F8TA 2D0CA 3C94A 4F2RA 4PA1A 2KZZA 3OVNA 4CGFA 4FJ8A 1LWEA 1DLOA 1S6PA 4RG8A 3V9UA 4YNQA 1UA1A 3M8QA 2JGUA 2P5GA 1FK9A 4FW2A 4M3YA 1EX4A 4MFBA 1WSEA 4CEZA 3SNNA 2FC0A 4O5BA 3NH2A 4JS5A 4OGEA 2B4JA 4CK2A 3E01A 1SKRA 3OJUA 1RDCA 3QIOA 3V1QA 3SUQA 1BHLA 3AVJA 4CGIA 4CEFA 4CJQA 3OYJA 3AVHA 2HHSA 3IS9A 1D5AA 1TAQA 3CM5A 3LP0A 4EP5A 3S3NA 1WSJA 2HHWA 3OYLA 3RWUA 4BWMA 3EYZA 1KTQA 3HL8A 1D9FA 4OKJA 1HNVA 1FXXA 1I3AA 3AVNA 4CJEA 4HCCA 3DLGA 3ZSVA 4KI6A 1TKXA 2O4GA 4H4MA 4E3SA 4KHQA 1CLQA 2X74A 3G0ZA 4I2QA 3NF8A 2GBZA 3BDPA 3VQ7A 3HK2A 4ICLA 4DTNA 3PX6A 4ZTFA 1LWCA 3TR8A 4AHRA 3NH1A 3AVIA 4CIFA 4CJKA 4FLYA 2B6AA 2JLEA 3OYHA 1EXQA 2Q3SA 4O0IA 4W5TA 4E7IA 1Q9YA 1QSYA 1TV6A 2PYJA 3KD5E 3RTVA 5J1EA 4KFBA 1LW2A 2FBVA 4I9LA 3P1GA 4KHNA 3AA5X 3AVBA 4DS4A 1KFDA 2OPPA 1ITGA 1BGXT 1LW0A 2DFFA 4NCAA 1XHXA 3QNOA 4CIGA 4DLGA 2VG7A 3T19A 3OYNA 4Q5VA 2XY7A 5CZ2A 3CFPA 1TK8A 2ZE2A 1TL1A 3AA4A 3LP3A 4EP4A 3OYIA 4N47A 3WNGA 3LALA 1JXBA 4IG0A 1IKWA 2Z1HA 3RR7A 4CGGA 3ULDA 1SKWA 4DTJA 2RF2A 4IFYA 3V81A 4B9LA 4Y1CA 3AVCA 4KTQA 1RBTA 1RT2A 1SUQA 1HJRA 3QIPA 3L2RA 4KHYA 1LAVA 3HM9A 4Y1DA 4H8KA 4AH9A 4F4KA 4FJHA 1WN7A 2WOMA 2ZQBA 3KLEA 2XY6A 4FJJA 4ID5A 1RBVA 5I3UA 4BACA 3NF9A 1NK4A 4CIEA 1L3UA 3B6PA 4K8XA 4FJ7A 4DSEA 2VG5A 1QE1A 4FZZA 3O3FA 1ZYQA 1EKEA 4BDYA 4ZTJA 3HVTA 3VQ8A 4M41A 3EZ5A 4IFVA 4CJ3A 4CJPA 3DRRA 4FJKA 3MAQA 4J2DA 3SQ0A 1IKVA 2Z1IA 1QSSA 3RRGA 3M8PA 4ELUA 2F96A 3QERA 4CEBA 3L2VA 4J2EA 1ASVA 5CZ1A 4CK3A 3NAEA 3HPHA 1EP4A 4IKFA 3OYAA 4MQ3A 4FLUA 1U49A 3AVAA 3KKSA 3FFIA 3SI6A 1WAFA 1NKEA 4B9TA 1KSPA 2RN2A 4FYDA 1J53A 2G8FA 3AO4A 1S1VA 3B6OA 1L3VA 4DQIA 1LV5A 4KV8A 3PV8A 1D8YA 4BDZA 2DFEA 1TKZA 3DRPA 1B9FA 3F9KA 3K5OA 4O0JA 3AA3A 4DTPA 1S5JA 4DQRA 4CJVA 2ZD1A 4LY7A 1UWBA 1RNHA 1RT6A 3NCIA 3NGYA 1JLCA 5C42A 4F8RA 4PQUA 1TL3A 3PY8A 4CF1A 3IAYA 4F2SA 3D0PA 1BI4B 4E7JA 3NF7A 1NOYA 3K57A 3V9XA 1GOCA 1C0MA 3HPGA 1SV5A 2Z1GA 5J2NA 4K8ZA 1VSEA 2P51A 5CYQA 3NF6A 1ASUA 5HLFA 3SCXA 4NYFA 4E7LA 2Y1IA 1VSMA 2DFHA 1RCHA 3DYAA 1QHTA 4ID1A 3ZSYA 4CHQA 1NJXA 2YNGA 4CCHA 1JXEA 3ZT4A 3AO1A 1ASWA 3O4QA 4N5SA 4DF4A 3CYMA 3PUFA 5JS2A 4CHYA 4ELVA 4HUEA 3WNHA 4KHSA 3KIOA 3HYFA 4FZXC 1NKBA 2YHAA 2Z1JA 4F3OA 4LSNA 3OYGA 2QKKA 4NCBA 3IRXA 4FLXA 1BCOA 3TAPA 4DMNA 2XY5A 4B9NA 4FJGA 4DU1A 4Z0UA 2XRIA 4BE0A 3KJVA 1KFSA 4IBNA 4Z4HA 5DMRA 3V9ZA 1D9DA 1WLJA 4J2AA 4GW6A 4PWDA 4AILC 5EU7A 3SJJA 4KB1A 5I42A 4CGDA 4KPYA 2VWKA 3PX0A 5KTQA 4FVMA 4M3UA 1NK7A 1Q9XA 4HTUA 3TAEA 4Z4GA 3KLGA 4DSIA 4FZYA 3TWHA 3HP6A 4C8OA 2LSNA 2NUBA 2YHBA 3CFOA 4CGHA 3QEVA 3OYCA 1VRTA 4J2BA 2G8IA 4DQSA 4W5RA 1HMVA 3HT3A 4DU3A 4CHOA 3AVLA 2E6LA 3SV4A 3VQCA 3KLIA 3L2UA 4EZ9A 3AVGA 4CEAA 1XHZA 1VSJA 3SQ1A 1KLNA 4DSLA 3VA0A 3TAGA 3MXMA 1C1BA 1WSFA 4B3OA 2DY4A 4E1NA 3S9HA 4Z4FA 1T03A 1G15A 1HRHA 3VQ6A 1T7PA 3QNNA 1JLEA 4DU4A 1RTDA 2QXFA 5HRSA 2PZSA 4B08A 1NJWA 3DOLA 4FJIA 4E1MA 1RT4A 3V9WA 4AHCA 1SKSA 2A1SA 2G8VA 4E19A 2RKIA 2X6NA 1RTHA 4YFUA 3NH0A 4DS5A 4FCYA 4KRFA 3DLBA 2HW3A 3MEEA 3VA3A 1W0HA 4ZHRA 1TKDA 1HYSA 5C24A 3PO5A 3V6DA 1U47A 4CK1A 1YVUA 2EX3A 1YT3A 3NFAA 3CFRA 4FJNA 1SL2A 1FKOA 1Z26A 2BDPA 1WSGA 1MU2A 4CERA 2X6SA 2X78A 1NJZA 4W5NA 1BQMA 1K6YA 4CF0A 4W5QA 1QS4A 4KKOA 4FXDA 4RW7A 4FLZA 2WONA 4FW1A 5D3GA 3O3HA 4DTMA 4CJ4A 5FDLA 2GUIA 4O4GA 1TKTA 3DI6A 4OKEA 1DTTA 1RT5A 2OZSA 3QO9A 2HHTA 1TAUA 1JLGA 1VSIA 3OYBA 1RBSA 3JYTA 4DFPA 3ISNC 2YNFA 1HQEA 1A5WA 1BIUA 1RILA 2HNYA 2G8UA 4KB0A 2KFNA 3BGRA 3LDSA 3ZCMA 3F73A 3SYZA 2VG6A 4DTRA 4OPJA 3DLHA 4B9UA 1VSHA 3HXMA 2D0BA 2KQ2A 1VK0A 4CHNA 1RT1A 2D5RA 2RPIA 3VQQA 2Y1JA 2ETJA 1IKYA 3LANA 2XO7A 2YNHA 2PYLA 4BE1A 4DSJA 3WNFA 3LZIA 1RBUA 3IG1A 4DFKA 2HVHA 1QSLA 1NK9A 4LH4A 1X9WA 1L5UA 1IO2A 4B9MA 3OYFA 3SQ2A 4HCBA 1JLAA 1C1AA 5KI6A 4UQGA 2W42A 3DLEA 3DRSA 4B8CA 1QQCA 1CXUA 3K2PA 3KK1A 4HVJA 4FM2A 3SPZA 4DSKA 2QK9A 2BE2A 3K5MA 5HRNA 3QEIA 3VQEA 1BI4A 3L3VA 3ZT2A 4CE9A 3HVRA 1ZBFA 4CEQA 2YKMA 3QEPA 1WSHA 1BCMA 3ZT0A 1SL0A 1C1CA 1RTIA 1XWLA 4DQPA 3DLKA 3ZT1A 1EETA 4I7FA 1ZBUA 3TAQA 2G8HA 1TVRA 1WAJA 5DK5A 1VSDA 4C8NA 4KO0A 3SUPA 3NDKA 3MXJA 1QTMA 4KTWA 1HNIA 1I39A 3NBPA 4AHVA 3AO2A 4CFDA 4CFCA 3NGZA 4E7HA 3VN5A 3M8RA 4BWJA 3NE6A 1VSKA 4R5PA 3RMDA 1X9SA 3L8BA 4IG3A 1GOAA 3QINA 3AV9A 1RDBA 2P5OA 4DTXA 3AA2A 3V1RA 4LH5A 1ZBLA 4OLAA 2HB5A 3VQAA 4AHSA 4OPKA 3AO5A 3AVKA 3AVMA 3K58A 1NK8A 4M3XA 1FKPA 3ZSOA 3AVFA 1UOCA 1YTAA 1R0AA 3LPUA 4RW9A 3SZ2A 3MXIA 4CJUA 1TK0A 4N76A 1NOZA 1CXQA 3OYMA 3H08A 4DTUA 1VSFA 4RW8A 3KKRA 1VSLA 1REVA 3G10A 4CJWA 2VWJA 3DLRA 3K5NA 1ZBHA 1XC9A 1KVAA 1UAXA 3KD1E 4DFMA 1U04A 4B9VA 3MEDA 5J2QA 2A1RA 5SWMA 3I0RA 4FK4A 3ZSXA 5K14A 1U4BA 4JRQA 1LWFA 2E6MA 3SUNA 1IG9A 3TANA 2HHVA 4HUGA 3OY9A 3PO4A 1JKHA 1A5XA 1X9MA 1UA0A 3RMCA 3V4IA 1JLFA 1RDAA 4GMJB 3VQ5A 4CFBA 1S1TA 4E89A 3U6FA 4BDPA 1U48A 4RW4A 3JSMA 3K59A 4FLTA 2HVIA 4DTOA 4FM1A 4FJLA 3VQ4A 4RW6A 2IDOA 3DOKA 1DTQA 2YKNA 4CJFA 2GV9A 3I8DA 3KLHA 4NCGA 3OJSA 2G8WA 2OA8A 3ITHA 4CHPA 4JLHA 1CZ9A 2OYQA 4Z4CA 1T05A 1S1WA 3C6UA 4LSLA 4FJ9A 1ZBIA 3ALYA 4FLWA 4M45A 3WNEA 4CESA 4CJLA 4L8RB 3HP9A 4OVLA 4DFJA 1LAWA 4PY5A 3V9SA 1C0TA 4CJSA 1KVCA 4KI4A 2IC3A 2O4IA 3A2FA 3QLHA 4TSXA 4CEOA 4AHUA 2XHBA 4C8LA 2AJQA 3RMBA 4H4OA 4DSFA 3OYEA 2OZMA 3V1OA 1RT3A 4KHUA 1KVBA 1RDDA 3LAKA 3VQDA 4JS4A 4FM0A 5KGWA 5FRNA 4F3TA 3L3UA 3DM2A 4G1QA 3CG7A 3P5JA 1IKXA 4KTZA 5CYMA 4FK0A 1TGOA 3C95A 3I0SA 5JS1A 4OJRA 2EHGA 3ZSZA 3S3OA 3TAFA 4CHZA 3NHGA 3L2QA 5T7BA 4E7KA 3SPYA 4CEDA 3HPOA 3M8SA 5C25A 3S3MA 2E4LA 2I5JA 1JL2A 1F21A 4M3RA 3VQPA 1KCFA 2KTQA 2ATQA 2HNDA 3U3YA 4I9QA 1O1WA 4GVMA 4CGJA 3CQ8A 3THVA 3O3GA 4CF8A 1J54A 4LD0A 3LP2A 4CEEA 5E41A 1WNSA 3ZT3A 3MEGA 2HNZA 1NJYA 3LPTA 3LWMA 2HMIA 4Z4IA 3OS0A 1HYZA 1S9EA 1JLQA 1N5YA 3LAMA 2PY5A 3T3FA 1BL3A 1CZBA 2IS3A 3QEWA 4FJMA 3EY1A 4PUOA 4M42A 4Q0BA 4N56A 4DF8A 3SQ4A 4AHTA 4KHWA 1VRUA 5HBMA 3TARA
chains in the Genus database with same CATH superfamily
1P90A 1S9GA 1QQNA 4WCEL 2AP1A 4LFAK 4KAZA 2P9LA 1GLFO 4CJRA 2KFZA 1X1PA 3H3OB 1TUYA 3O9TA 4NYNA 4O8KA 4BVOA 3AO3A 3ZX2A 1C0UA 1JL1A 4I6MA 5B8HA 3TSPA 2ITMA 1HPZA 1H1VA 3RVCA 3K5LA 3RRHA 2P9NB 2QKBA 5J2MA 3FE1A 3ZSWA 4A62A 5AQSA 1HKGA 3PIPL 1YHQN 2D0PA 4FLVA 4FJXA 1QVFM 1M1KO 3OS1A 4O55A 2OCEA 5HROA 4I2PA 4EFHA 5BN9A 3KK3A 1Y97A 2HHXA 4LF8K 1NK5A 2KZMA 1RTJA 2O8DB 3NGIA 2I7NA 3C6TA 1XC3A 4WQ4C 1U45A 3M3ZA 1WSIA 3CCJN 1S1UA 4XH1A 3HO1A 1N6QA 3D45A 4YHHK 4CZJA 5KGXA 4Z4EA 4DLEA 3LWLA 4FK2A 3HJFA 4CZMA 1W9HA 3C94A 3NVMA 4PA1A 3OVNA 1LWEA 1DLOA 4BRKA 4YNQA 2O8FB 4K0KK 1T6CA 4U67L 4CZLA 1OVQA 3E01A 1SKRA 3OJUA 4IJNA 3CHWA 2ZJRL 3CJ7A 3V1QA 1GLBG 3OYJA 1XUPO 1NGHA 4RCHA 2QA4N 2HHWA 4ISGA 5M1NA 1YF5L 3MX5A 4V19S 1ATRA 1BU6O 3JXUA 3ZX0A 5KPRA 3C6AA 4F9OA 3VQ7A 3HK2A 2VGNA 4ICLA 2A5XA 3AVIA 3THWA 2DTUA 1NGAA 1QSYA 4EHUA 3RTVA 4I9LA 2IVPA 3P1GA 3AA5X 2QI2A 5FPMA 4BC4A 4DS4A 2OPPA 1BGXT 1WUAA 2DFFA 2GEMA 3IUCA 3QNOA 4CIGA 1TK8A 2VCPA 3AA4A 3WNGA 3LALA 1JXBA 4K43A 5FPEA 3I33A 2Z1HA 1VQON 3K9JA 1VQLN 1X3NA 3L4IA 4IZ9A 4IFYA 5EXWA 3AVCA 1RBTA 3OA9A 3QIPA 4JNEA 4EIAA 1LAVA 4F4KA 4FJHA 2WOMA 4ID5A 1L3UA 4K8XA 4FJ7A 2VG5A 3KVGA 3EKUA 4FZZA 2P9NA 3VQ8A 2FLOA 3MAQA 4J2DA 3QERA 4CEBA 2F4VK 3NAEA 3FZHA 1EP4A 3Q7CA 4A59A 4BGBA 1U49A 1N32K 3AVAA 4FYDA 1KSPA 2G8FA 1MWKA 2O8DA 4H0TB 4KV8A 4WFNL 4BDZA 4DTPA 3AA3A 4DQRA 1RNHA 3NGYA 1JLCA 1XNRK 3PY8A 2F9TA 4E7JA 4AQYK 1GOCA 5AQNA 3CMAN 3J81O 3BP8A 1ASUA 4GKJK 3SCXA 4IJAA 4NYFA 4BR7A 4Y0WA 4A5AA 4H5TA 3AO1A 5JS2A 4HUEA 4KHSA 2E2QA 3HYFA 4YOUA 4UY8O 2YHAA 2Z1JA 4FLXA 3T1YK 2E5LK 4FJGA 5E84A 3KJVA 1R59O 1D9DA 4PWDA 3CETA 3CJBA 3OHRA 4JK9A 4AILC 4KB1A 2VWKA 3PX0A 1I94K 3H1QA 3TAEA 3AGRA 3KLGA 4FZYA 3VETA 4EAHD 4C8OA 4WYBA 3VGLA 3QEVA 3OYCA 4LFCK 1VRTA 4DQSA 4RTFD 5AZJB 3OBYA 3SV4A 2BH1A 4EZ9A 3H3NO 1ILYA 1VSJA 4OPHA 1C1BA 3D7EO 3AAPA 3QFPA 4B3OA 3S9HA 5BPLA 5GAHP 4DU4A 3WQUA 3U4LA 5GADP 4HTLA 1HX1A 1OH5A 2YHXA 1RDUA 4B3SK 3CERA 2G8VA 2QWRA 1VQKN 2X6NA 3NH0A 1T3VA 4DS5A 1HR0K 4FCYA 3VA3A 4WQ4A 5C24A 3V6DA 1U47A 2EX3A 3NFAA 4IO9L 1E3MA 1SL2A 3WEEB 2OTLN 2X78A 1BQMA 1K6YA 4CF0A 1QS4A 5EVZA 2QTDA 4DKWA 1KQSM 5C12A 4O4GA 1TKTA 2OZSA 3QO9A 4PL7A 2E1ZA 4ILGB 1JLGA 1YITN 1RBSA 2KFNA 3UKRB 2GUPA 1HQEA 2YNFA 2G8UA 3LDSA 3F73A 3CXCM 1IBKK 1RT1A 2FSJA 2P9SB 2RPIA 1IKYA 1S22A 3N4PA 4H5RA 3VEVA 1X9WA 1L5UA 1IO2A 3BEXA 4CI6A 1C1AA 4M7XA 3DRSA 4B8CA 1CXUA 3CIPA 4DB3A 3OTOK 1XNQK 4ILHA 4FWQA 2RE2A 1Q82O 2NRZA 1WSHA 3M6GA 1SL0A 1C1CA 1RTIA 1NNEA 5ELZA 3FGUA 3O9UA 1TUUA 3NDKA 4BRAA 4AHVA 3NBPA 4CFCA 1YJWN 3ZLJA 2WC9A 5AFUH 2NRVA 3RMDA 3L8BA 3F9MA 3AV9A 4DTXA 1ZBLA 2HB5A 3K58A 1NK8A 1FKPA 3AVFA 3J7ZO 3MXIA 3GOIA 2GTDA 1E4GT 4PHTX 3VTIA 3KD1E 1UAXA 4DFMA 4B9VA 2HF3A 2A1RA 5J2QA 1K73O 3K9KA 5SWMA 1U4BA 1LWFA 1MDUB 4HUGA 5AZJA 3PO4A 1DEJA 3V4IA 3U6FA 2GWJA 4FLTA 4IOAL 3CCQN 1NU0A 4JKDA 4KH6A 3I8DA 2Q97A 3ITHA 5ADXA 1BG3A 3C6UA 2H3GX 3PSFA 4FLWA 1YJNN 3WNEA 4CZIA 4CJLA 4L8RB 2V51B 1LAWA 1C0TA 1KVCA 3A2FA 4JKCA 4NB4A 2UU9K 1JJ2M 3VQDA 2UYTA 1IBLK 3L3UA 4MLHA 1NGEA 3WEEA 4BRNA 5JS1A 4OJRA 3ZSZA 4DR5K 4CHZA 3NHGA 5T7BA 2UUAK 3M8SA 1KCFA 2ATQA 1O1WA 4CGJA 1Q18A 5E41A 4JYAK 1WNSA 4GNIA 3MEGA 2HNZA 4BR2A 3LPTA 4K42A 3LWMA 4Z4IA 1HYZA 3UKRA 4X65K 1S9EA 1JLQA 3BZKA 4FWMA 1N5YA 2PY5A 3QEWA 2P9SA 3EY1A 4K41A 4N56A 4DTSA 4CF9A 1RT7A 3OYDA 2D0OA 2KW4A 4OLBA 3OS2A 4BR5A 1BQNA 3L2WA 4QCLA 2G8KA 1NK0A 4QS8A 3GBTA 4PL8A 1VQNN 3D6RA 3VEOA 2D1KA 2QWOA 3A5OC 4FWSA 3WT0A 3SMSA 2OPQA 3BY5A 3HZ6A 4IFEA 2A6AA 5HRPA 2YCHA 5C0YA 1YJ9N 5CHIA 5KRSA 4C8KA 1DT9A 4O44A 1GOBA 4OPAA 3VQ9A 3QMLA 4FSVA 5ADXH 4M3ZA 1Z25A 3CM6A 3T1AA 3TI0A 4JRPA 2B5JA 2O8EA 2QWPA 4XIUA 3IFRA 2F8SA 4HUFA 3ULEA 3SUOA 2GWKA 2BANA 5DM7L 2QW9A 3I56N 4WE1A 4H0XB 4J8FA 1NGBA 4EZ6A 3R8EA 3EO3A 1TK5A 3TAMA 2E8AA 4FVUA 1SL1A 4ELTA 2ZGZA 4FJ5A 4CFAA 3P83D 5TKYA 4CJTA 1BIZA 3ZEUB 4DWIA 3ENOA 2HHUA 1XI1A 2ZGYA 1Q8IA 4HHTA 3DJCA 3HBTA 1BDGA 3L6QA 4YY3K 4CECA 4QS9A 5J2PA 4FJ8A 1X3MA 4RG8A 1S6PA 3V9UA 1FK9A 5A2QO 3NVKA 4JD2B 4O5BA 2W6KA 2B4JA 4CK2A 3HI0A 1RDCA 1WB9A 1BHLA 3AVJA 4L3QA 3SAHA 3CM5A 5AR0A 1NMDA 1K8KB 3OYLA 1W97L 1EQYA 1HNWK 2FF3B 2EWSA 3DLGA 3ZSVA 1TKXA 3THXB 4H4MA 3EL2A 3TU5A 4KHQA 4IEEA 4CD3A 4I2QA 3VMFB 3HSCA 2W6LA 4A2AA 4AHRA 3NH1A 4CIFA 4CJKA 4BY9C 3OYHA 4E7IA 1TV6A 3MX2A 4KFBA 4H0OA 5LJVA 4KHNA 3QICA 3AVBA 1ITGA 4DLGA 2VG7A 4JKAA 2Q0UA 2XY7A 3O08A 3CFPA 2ZE2A 4KBOA 3LP3A 4EP4A 5AQFA 3OW2M 4IG0A 4CGGA 1SKWA 2RF2A 2KHOA 1SUQA 4KHYA 2ASOA 3HM9A 3J7AP 4FPBA 1VQ4N 1KAYA 3FR0A 2XY6A 3DAWA 1RBVA 1NK4A 3B6PA 3SK3A 4BDYA 4JN4A 4ZTJA 4FJKA 4YOYA 4IFVA 3DRRA 3MCPA 1IKVA 5CE3A 3M8PA 4J2EA 5CZ1A 4CK3A 3O1WA 1XMQK 3E9LA 4IKFA 4MQ3A 5AQUA 4BG9A 1NKEA 4BRPA 3SI6A 4B9TA 1J53A 2V7YA 1S1VA 4IO8A 1D8YA 4JI0K 1TKZA 3K5OA 1S5JA 3QB0A 4LY7A 1RT6A 3NCIA 3C6HA 3ID8A 1TL3A 3ATUA 3D0PA 1Z05A 2NRRA 1C0MA 3ZEUA 3KWIA 2P9IB 2Z1GA 5J2NA 1VSEA 4JKFA 3QFUA 5CYQA 1NG9A 4JKGB 3DYAA 1NJXA 1QHTA 4ID1A 3ZT4A 3O4QA 4ELVA 4DF4A 3CYMA 4CZKA 4CHYA 4JD2A 4BRIA 3WNHA 4FZXC 3OYGA 2YI1A 1U6ZA 1BCOA 4JI7K 4BGAA 2XY5A 3ID6A 4BE0A 1BUPA 3U8XA 3EE9A 5DMRA 4A5BA 3V9ZA 1J5EK 3TTDA 4J2AA 1K8KA 3SJJA 5EU7A 4FOEA 4DV1K 1KAZA 4CGDA 5KTQA 4FVMA 4CBUA 1FJGK 2LSNA 2YHBA 3CFOA 3THXA 4LF9K 3SBGA 3HRGA 5AQMA 5I9EB 4JI2K 5AQPA 3GDQA 5BR8K 4B1VA 4CHOA 3E9OA 3KLIA 4XH5A 4DSLA 3MXMA 1WSFA 2HSTA 4Z4FA 1T03A 4DV3K 4WQ5C 3QNNA 1RTDA 1NMNA 3IMXA 2PZSA 1NJWA 3GL1A 5AQJA 4AHCA 4ISFA 2P9PB 2YHWA 1NWKA 3CJAA 1VQ5N 3DLBA 4OX9K 4KH5A 3T1HK 4JI6K 3PO5A 4DR3K 1ESVA 3CFRA 5HL7L 2JWLA 3H46O 4CERA 1MU2A 1NJZA 4W5QA 4RW7A 2HF4A 3TTCA 1E4FT 5KQDA 3O3HA 4CJ4A 4B1XB 3DI6A 4OKEA 3DWLA 3O9RA 2HHTA 3CCVN 3OBWA 1VSIA 4MO4A 1A5WA 1BIUA 1RILA 2VG6A 4O5FA 3HXMA 1VK0A 2ETJA 2XO7A 1OH6A 3HOTA 3TSQA 2PYLA 3LDPA 4DFKA 2HVHA 2CH6A 4LH4A 3OYFA 5KI6A 4JAXA 2J4RA 5AQTA 3DLEA 4B3MK 2QK9A 3P31A 3K5MA 3K0SA 3VQEA 3ZT2A 5AQVA 3U9ZA 5BRHA 1IV0A 2P9IA 3DXMB 3LDOA 4DQPA 4XEIA 3MWTA 1YVNA 4C8NA 3MK6A 4KTWA 2FF6A 4CFDA 4FOIA 4JKGA 1S3XA 4E7HA 3NE6A 2E20A 3CJCA 3P39A 1RDBA 4IDHA 3UB5A 3MN9A 4BRFA 3LDQA 2O8FA 3AVKA 1OKJA 4M3XA 5GAEP 4RW9A 4BQLA 4N76A 1NOZA 2Q1NA 1NGDA 3H08A 3TTFA 2HBJA 1VSFA 5IT9O 5KPTA 4H0VB 3G10A 2E88A 4GV6A 4H03B 5LY3A 4KH4A 1N34K 1BO5O 1U04A 3I0RA 1IG9A 2E6MA 2A40A 3SUNA 3TANA 2QM1A 4MDAA 2HHVA 2OZMA 3RMCA 4CFBA 4GMJB 4KB0A 4E89A 1U48A 3K59A 3JSMA 1VQPN 4DHYA 4FJLA 3VQ4A 2IDOA 2Q31A 4KPYA 1V4SA 4CJFA 2GV9A 4C1NK 3KLHA 2OA8A 2G8WA 5BRFA 1CZ9A 3CI5A 2OYQA 4H0YB 2IVNA 4LSLA 1ZBIA 1GLEG 3ALYA 4CBWA 1NJIO 3SMPA 2HHHK 4H5NA 2GX9A 4PY5A 3V9SA 2P9PA 2AJQA 2O4IA 2XHBA 3F2KA 2NRXA 3RMBA 4IWVA 4DSFA 3OYEA 4KHUA 3G6EN 1NLVA 2WFBA 3CQXA 4JI4K 2IVOA 4FM0A 3A0IX 4G1QA 3CG7A 3MCAB 3I0SA 3O6WA 2EHGA 3O5BA 3SPYA 4AM7A 2E4LA 2I5JA 1F21A 3VQPA 1C0FA 1QZ5A 3MWPA 2HNDA 3HM8A 3CQ8A 5JMVA 4LD0A 4IEIA 3ZT3A 1NJYA 4JI1K 3Q7BA 1W7AA 3DXKB 4WF9L 4NLBA 3R3LA 3LAMA 4B1WB 4Q0BA 1CZBA 4M42A 2UUCK 4DF8A 3SQ4A 1VRUA 2OPSA 2YNIA 5HRRA 2P9KB 2WBNA 4BQZA 3ENHA 3KHYA 5F2RA 4CJ5A 3UIQA 1SS6A 4BR9A 4M3WA 4BRHA 5LMUK 2HHQA 1S1XA 2FBTA 4Z94A 4IDKA 4CF2A 2QWMA 4JV5K 5FROA 3DXMA 1L3SA 5SZTA 3T69A 1BISA 3MECA 4KREA 2ITGA 2FBYA 4W5OA 3O4NA 5FRMA 4QAGA 3IDHA 3U3GA 2IAJA 4DQ8A 4IOXA 4AF1A 4DQQA 2NRWA 3CCSN 1QQOA 3KLFA 3TABA 3QESA 1DGKN 3OYKA 4FPAA 4WQ5A 5AQOA 2E1YA 3PX4A 3FZFA 1KRPA 3A8YA 1IH7A 4DG1A 2F7TA 1YTUA 1JCGA 3VQBA 1J9AA 2R7YA 3WUHA 4CVNE 4LF6K 5FLXO 2E2NA 2FSNA 4YDUC 4OGCA 2F9WA 2O8CB 4U7BA 1T8EA 1FW6A 4JI8K 2ZJQL 2P1JA 1C6VA 2PAVA 3QEXA 4M3TA 3G25A 4E0DA 1J5OA 3ASMA 1NGJA 2YX6A 2D0CA 5JVHL 4F2RA 2KZZA 2NLXA 1UA1A 2QWNA 3U9DA 4B3TK 4A2BA 4M3YA 3BUZB 1EX4A 4MFBA 3WXMB 4CEZA 3SNNA 2FC0A 4NO7A 5AJ3K 4WFAL 1GLDG 1K9MO 4CGIA 4CJQA 3AVHA 2HHSA 3CD6N 3IS9A 5BRDA 3LP0A 2NRTA 3S3NA 4BR4A 1W2BM 3E9PA 1OVYA 1HPMA 5H1SQ 1D9FA 4JK8A 1HNVA 1FXXA 1I3AA 4CJEA 4HCCA 4FO0A 3JS6A 5FPDA 2O4GA 4E3SA 1QZ6A 1CLQA 4BVPA 3G0ZA 3NF8A 5KQ8A 4H5VA 3BDPA 1LWCA 4B1ZA 5M1OA 2JLEA 3EN9A 1EXQA 4O0IA 4W5TA 2Q0RA 2FBVA 1KFDA 4YOWA 4BC2A 4B1YB 5AQXA 3T19A 5CZ2A 3W0LA 3ZETB 1JCEA 1IKWA 3LDLA 3RR7A 2P9KA 1O13A 4DTJA 2IIRA 2W40A 2W41A 3AARA 3L2RA 2KKZA 3VF2A 5M1PA 4XH4A 4Y1DA 4AH9A 5EX5A 1WN7A 4YORA 2ZQBA 3CJ1A 3KLEA 4FJJA 5I3UA 5AQYA 4BACA 2V7ZA 1QE1A 1ZYQA 3H45C 4EHTA 1RFQA 3CPEA 3HVTA 3EZ5A 4CJ3A 3SAFA 4JK7A 3CC7N 1QSSA 4A57A 3L2VA 1ASVA 1TYQB 3HOSA 3HPHA 3OYAA 3FFIA 1WAFA 4NXMK 1VQ8N 2RN2A 4DQIA 4GY2B 1Q7YO 2DFEA 4O0JA 4M63C 4BRCA 4CJVA 2CH5A 2ZD1A 1UWBA 5C42A 4PQUA 3MN6A 4CF1A 3IAYA 4F2SA 4CZGA 4BC3A 2HOEA 1NOYA 3V9XA 3H6EA 1N8RO 2O8CA 3HPGA 3FLCO 2Q2RA 4K8ZA 4DUYK 2P51A 1SAZA 3D2EB 5MLCQ 2HMPA 5HLFA 4E7LA 4DV0K 1RCHA 3ZSYA 5JLFA 2VQFK 4CCHA 1WOQA 1ASWA 2Q36A 4N5SA 3PUFA 3ZYYX 4FWNA 3KIOA 2CGJA 4C23A 3UKUB 4F3OA 3P4IA 5AZIB 4H0PA 4LSNA 2QKKA 4NCBA 3IRXA 4DMNA 5EOYA 1BWFO 4DU1A 2XRIA 3C7NB 1QVGM 1KFSA 1WLJA 2O8BB 4M3UA 3SLCA 3VOVA 4HTUA 4Z4GA 5M1KA 4CGHA 5AQQA 4J2BA 2G8IA 4FWOA 4W5RA 3HTVA 3E66A 5BPNA 4DU3A 3AVLA 2E6LA 3L2UA 4CEAA 1XHZA 3AY9A 1VAZA 2UUBK 1KLNA 3RSEB 3TAGA 2DY4A 3CCEN 1G15A 1HRHA 1T7PA 2QXFA 3O9QA 3O9SA 5HRSA 3DOLA 4FJIA 3V9WA 3I8BA 3VEXA 1SKSA 3ZETA 4CW7B 2WTUA 2RKIA 2HBMA 1RTHA 4YFUA 4KRFA 3LDNA 2ASPA 1TKDA 4ZHRA 1ZBSA 3MN5A 4CK1A 1YVUA 4FJNA 3CMEN 1Z26A 3L0QA 5KPZA 2BDPA 4DR4K 1VQ7N 2X6SA 4W5NA 3J80O 3THWB 4KKOA 3LM9A 3GE1A 4YDUA 2GELA 1RGIA 5IWAK 5D3GA 4DTMA 5FDLA 2GUIA 4PKIA 1DTTA 1RT5A 1TAUA 2I7PA 3OYBA 3JYTA 4DFPA 3GG4A 1TYQA 3ZCMA 4JI5K 4DTRA 4DV7K 1ZXOA 4CHNA 4JKEA 2D5RA 3VQQA 2YNHA 4BE1A 3CC4N 4YOTA 1SZ2A 3WNFA 3LZIA 3IG1A 1QSLA 1NK9A 1JLAA 2W42A 3SPZA 4FXDA 3KK1A 2A42A 4HVJA 3QEIA 5HRNA 3HVRA 3L3VA 3MN7A 1ZBFA 4CEQA 3QEPA 1BCMA 3ZT0A 1XWLA 3DLKA 3CPWM 1ZBUA 3TAQA 2G8HA 3D2EA 4LF4K 3MXJA 1HNIA 1I39A 3THYB 3AO2A 4B3RK 3B8AX 3NGZA 3VN5A 3M8RA 4BWJA 1VSKA 1CZAN 2YJFA 1GOAA 5AQRA 3VEZA 4OLAA 3UKUA 4AHSA 4OPKA 5AZIA 3FZLA 1MWMA 1UOCA 1YTAA 3LPUA 4FWLA 2OANA 1R0AA 1TK0A 3OYMA 3C7NA 1MA9B 3KKRA 1VSLA 4MDBA 4CJWA 5JICA 2RHKA 2O8BA 1XC9A 3CC2N 3VGMA 4CD1A 5E26A 4BRQA 2QWQA 3EEQA 5FPNA 5HOOA 4CZEA 1J6ZA 3OY9A 1JKHA 1A5XA 1UA0A 1JLFA 4IOCL 1KD1O 4FM1A 2FSKA 1NBWA 4RW6A 3RSEA 3TSUA 2YKNA 4NCGA 4AM6A 3QBWA 4CHPA 4JLHA 1BA1A 4Z4CA 1T05A 1S1WA 4FJ9A 2ZF5O 3O4WA 4CESA 1WBDA 1GLLO 1D4XA 3ZX3A 4GV3A 1NGCA 4DFJA 4KI4A 3QLHA 5JLHA 3CCRN 4AHUA 3SAGA 3V1OA 1KVBA 1RDDA 4DV5K 3LAKA 4JS4A 5KGWA 5FRNA 3IKMA 1T44A 3P5JA 4KTZA 2UXDK 3MDQA 3TAFA 1VHXA 3L2QA 4X66K 4CEDA 3HPOA 1JL2A 4M3RA 3WXKA 3VERA 1HNZK 3J8AA 4GVMA 3J7YP 3THVA 3O3GA 2ZJPL 1VQ9N 1GLAG 4DR1K 2HMIA 3OS0A 2FXUA 1ATNA 1BL3A 2IS3A 4FJMA 4PUOA 4AHTA 4KHWA 5HBMA 3VENA 4N41A 3LZJA 5LL6Z 2XY8A 1IBMK 4B9SA 1HYVA 2OPRA 3WXLA 5HP1A 3DMJA 4CZFA 2E2PA 1B92A 4BE2A 3VEYA 4CBXA 3M5RA 1Z6RA 3FZMA 1A5VA 4B8AB 3QBXA 3ZSRA 4YOXA 1KLMA 3THYA 5DM6L 4X62K 3QETA 3RR8A 2D0AA 4QS7A 5CY4A 1Q81O 2IOCA 3HSTB 5AQLA 3KK2A 4QOZB 1EWRA 4FL9A 1RBRA 3UE5A 1EO1A 3LP1A 1ATSA 1HQUA 2FBXA 2BGGA 1HJOA 2ASMA 3KK7A 5BR9A 5KRTA 2IGIA 2YV0X 3O8MA 4C8MA 2A41A 4BROA 3SV3A 1Q86O 1NK6A 2VYPA 3KTQA 3RMAA 1KAXA 1S6QA 2UXBK 1NKCA 4DR6K 4O8UA 4M7YA 4NLCA 1M90O 4FWPA 4JHDB 3ZSQA 1L3TA 1JLBA 4OKKA 1B9DA 2F8TA 4BG8A 2HBLA 1KXPA 4CGFA 4BRGA 3PSIA 2QEXN 3M8QA 2JGUA 2P5GA 4FW2A 1WSEA 3TPQA 3NH2A 3DLLL 1LCUA 2NNWA 4JS5A 4OGEA 2AA4A 3QDKA 3QIOA 3SUQA 4CEFA 1TAQA 1D5AA 4H5WA 4EP5A 3EKSA 5LMNK 3JAMO 1WSJA 4DR2K 3RWUA 4BWMA 3EYZA 1KTQA 1XQSC 3HL8A 3S41A 4OKJA 3AVNA 4MO5A 3AGKA 4KI6A 4BR0A 4GV9A 2X74A 2V52B 2GBZA 4DR7K 5M1FA 2P9UB 4DTNA 3PX6A 1GLJO 4ZTFA 3TR8A 3C65A 4FLYA 2B6AA 2Q3SA 1Q9YA 2PYJA 3KD5E 5AFUA 5J1EA 1LW2A 5BN8A 2OTJN 4X64K 4JI3K 1U2VB 2PFUA 3VGKA 1LW0A 4NCAA 1XHXA 3OYNA 4Q5VA 1HNXK 1TL1A 3OYIA 4ILJA 3CJ9A 4N47A 5M1QA 1NM1A 3ULDA 3VPZA 3V81A 4B9LA 4RWTA 4Y1CA 4KTQA 1RT2A 1HJRA 3FZKA 4H8KA 2HBKA 3O1BA 3NF9A 4CIEA 4DSEA 3O3FA 1EKEA 4LFBK 4M41A 3VEWA 4CJPA 3BZCA 3SQ0A 1YI2N 4DCHA 2Z1IA 3RRGA 4ELUA 2F96A 1G99A 1IG8A 1C0GA 4JKHA 3MMVA 4FLUA 3KKSA 2A3ZA 1N33K 2JWKA 5JVGL 3CCLN 3AO4A 3B6OA 1L3VA 1LV5A 2UXCK 3PV8A 3DRPA 1B9FA 3F9KA 3G71N 4KHPK 4F8RA 4C1NI 5GAGP 5BPMA 3EZWA 1BI4B 1SQKA 3NF7A 3K57A 3T7ZA 2ZWHA 1YAGA 1SV5A 4JHDA 3VF6A 1KC8O 4B1UB 4DV2K 3D2FB 3NF6A 3FFKB 2Y1IA 2O8EB 1VSMA 2DFHA 1OH7A 4CHQA 2YNGA 1JXEA 4LF5K 4CJ7A 5C2DA 3ULEB 4GVEA 4JKBA 4BREA 1YIJN 1NKBA 4LF7K 5TKWA 3TAPA 4B9NA 3R1XA 1BA0A 4Z0UA 2WUSA 4FWKA 4IBNA 4Z4HA 4A61A 4GW6A 2VQEK 2NRHA 2BTFA 5I42A 3L4QA 4YOVA 4PKHA 1NK7A 1Q9XA 4LC9B 4DSIA 3TWHA 3SBTA 3HP6A 4WFBL 1N36K 1EWQA 2NUBA 3SJHA 1NGGA 2ZM6K 1GLCG 1YXQA 1HMVA 5F0XA 3HT3A 1P8ZA 5GINA 2P9UA 3VQCA 2BUPA 3AVGA 3H1VX 4BRLA 3G4SN 3SQ1A 3VA0A 2QXLA 3R9PA 4E1NA 3VESA 3VQ6A 1U2VA 1JLEA 1JCFA 1IJJA 4B08A 3CF5L 4E1MA 1RT4A 3DXKA 3E1YA 2A1SA 1WBBA 4E19A 1VQ6N 3N4QA 1QHAA 3I55N 3C0BA 2HW3A 3ATVA 3MEEA 4PKGA 1W0HA 1HYSA 3M1FA 2CGKA 1YT3A 2CGLA 1FKOA 3F5TA 1WSGA 1LOTB 1NGFA 4NXNK 3A5MC 4FLZA 2WONA 4FW1A 4DV4K 2D4WA 1YUWA 3P38A 3VTHA 5C2FA 3KWGA 3ISNC 1T6DA 2HNYA 4ISEA 5GIOA 3BGRA 3SYZA 4OPJA 3DLHA 4B9UA 1VQMN 1VSHA 3WQTA 2D0BA 2KQ2A 4E1JA 2Y1JA 4DSJA 3LANA 1HKBA 1RBUA 3A5LC 5AQHA 3KZBA 4B9MA 5GIPA 3SQ2A 4HCBA 4UQGA 1X9JA 4DSKA 1QQCA 3K2PA 3LL3A 4FM2A 2P9LB 3NMUA 2BE2A 1RDWX 3ENBA 1BI4A 4CE9A 2YKMA 4HWIA 4MLEA 3ZT1A 1EETA 1HKCA 4FWRA 4I6MB 4I7FA 1TVRA 1WAJA 5DK5A 1VSDA 3D2FA 3LM2A 4KO0A 3SUPA 1QTMA 5LJWA 2QWLA 3VF4A 2VGMA 4R5PA 2DPNA 1X9SA 4BRDA 4IG3A 1ZC6A 3QINA 2YHYA 2P5OA 3AA2A 3V1RA 4LH5A 3VQAA 3AO5A 3AVMA 3CQYA 3ZSOA 2NZTA 5AQGA 3SZ2A 4CJUA 1CXQA 1QQMA 4DTUA 1XMOK 4RW8A 2E2OA 1REVA 2VWJA 3DLRA 3K5NA 1ZBHA 1KVAA 3PIOL 3MEDA 2YJEA 1HLUA 4FK4A 3ZSXA 5F1XA 2KLAA 5K14A 5C10A 3W3DA 4JRQA 2VWBA 5AQZA 4DUZK 3EE8A 1X9MA 1RDAA 3VQ5A 4F3TA 1S1TA 3PLAA 4BDPA 4RW4A 1OH8A 4K25A 2HVIA 3R6MA 4DTOA 3BF3A 5BREA 1K8AO 4IXCA 3DOKA 1DTQA 5C15A 1S72N 3OJSA 3AAQA 2PBDA 4M45A 4GKKK 3HP9A 4OVLA 3O80A 5CR4A 5AQKA 4CJSA 2IC3A 4CEOA 4TSXA 5AQWA 4C8LA 4H4OA 1RT3A 1V4TA 4B9QA 3WXJA 4JEPA 3CCUN 3DM2A 4CZHA 1IKXA 5CYMA 4FK0A 1TGOA 3C95A 5EY4A 3S3OA 4E7KA 3A5NC 1BOTO 5C25A 3S3MA 1DKGD 4BRMA 4BC5A 4R79A 4G9ZA 3CCMN 2KTQA 3U3YA 4I9QA 1HUXA 1J54A 4CF8A 3LP2A 4CEEA 1Y64A 4DV6K 1NGIA 3T3FA 3WXIA 3BF1A 4OO1J 5AQIA 3TARA
chains in the Genus database with same CATH topology
2OPSA 2YNIA 4CF9A 4N41A 1S9GA 5HRRA 3LZJA 1RT7A 3OYDA 2KW4A 2XY8A 4OLBA 3OS2A 4CJ5A 1BQNA 3UIQA 3L2WA 1HYVA 2OPRA 2G8KA 1NK0A 4B9SA 4KAZA 4M3WA 4QCLA 5HP1A 4DTSA 3DMJA 4CJRA 2KFZA 2HHQA 1B92A 4BE2A 1S1XA 1X1PA 2FBTA 4IDKA 4CF2A 4NYNA 5FROA 2OPQA 1L3SA 5SZTA 2DTUA 3AO3A 1C0UA 1JL1A 1A5VA 4B8AB 5HRPA 1BISA 3MECA 1HPZA 4KREA 3ZSRA 2ITGA 3K5LA 3RRHA 2FBYA 5KRSA 4W5OA 4C8KA 1KLMA 3O4NA 4O44A 2QKBA 5FRMA 1GOBA 5J2MA 3VQ9A 4QAGA 3QETA 3ZSWA 3RR8A 4M3ZA 2D0AA 1Z25A 2IAJA 3U3GA 3CM6A 5CY4A 3T1AA 2IOCA 3HSTB 4DQQA 3TI0A 3KK2A 4QOZB 4JRPA 2B5JA 1RBRA 4FLVA 4FJXA 3OS1A 4XIUA 4O55A 3KLFA 3TABA 2F8SA 3LP1A 3QESA 5HROA 1HQUA 4I2PA 3OYKA 2FBXA 4HUFA 2BGGA 3KK3A 1Y97A 3SUOA 2HHXA 3PX4A 1NK5A 1RTJA 2KZMA 2BANA 3NGIA 1KRPA 3C6TA 4WE1A 1IH7A 1U45A 4EZ6A 4DG1A 5KRTA 2IGIA 1WSIA 2YV0X 1S1UA 4C8MA 3VQBA 3SV3A 1TK5A 1NK6A 1YTUA 3KTQA 1N6QA 3HO1A 3TAMA 3RMAA 1J9AA 3D45A 1S6QA 2R7YA 1SL1A 1NKCA 4ELTA 4OGCA 5KGXA 4FJ5A 4CFAA 4Z4EA 3P83D 4CJTA 1BIZA 4DWIA 2HHUA 4DLEA 1T8EA 3ZSQA 2P1JA 3LWLA 1XI1A 4HHTA 1C6VA 1JLBA 1Q8IA 1L3TA 3QEXA 4OKKA 4FK2A 4M3TA 3HJFA 4E0DA 1J5OA 3ASMA 1W9HA 4CECA 1B9DA 5J2PA 2F8TA 2D0CA 3C94A 4F2RA 4PA1A 2KZZA 3OVNA 4CGFA 4FJ8A 1LWEA 1DLOA 1S6PA 4RG8A 3V9UA 4YNQA 1UA1A 3M8QA 2JGUA 2P5GA 1FK9A 4FW2A 4M3YA 1EX4A 4MFBA 1WSEA 4CEZA 3SNNA 2FC0A 4O5BA 3NH2A 4JS5A 4OGEA 2B4JA 4CK2A 3E01A 1SKRA 3OJUA 1RDCA 3QIOA 3V1QA 3SUQA 1BHLA 3AVJA 4CGIA 4CEFA 4CJQA 3OYJA 3AVHA 2HHSA 3IS9A 1D5AA 1TAQA 3CM5A 3LP0A 4EP5A 3S3NA 1WSJA 2HHWA 3OYLA 3RWUA 4BWMA 3EYZA 1KTQA 3HL8A 1D9FA 4OKJA 1HNVA 1FXXA 1I3AA 3AVNA 4CJEA 4HCCA 3DLGA 3ZSVA 4KI6A 1TKXA 2O4GA 4H4MA 4E3SA 4KHQA 1CLQA 2X74A 3G0ZA 4I2QA 3NF8A 2GBZA 3BDPA 3VQ7A 3HK2A 4ICLA 4DTNA 3PX6A 4ZTFA 1LWCA 3TR8A 4AHRA 3NH1A 3AVIA 4CIFA 4CJKA 4FLYA 2B6AA 2JLEA 3OYHA 1EXQA 2Q3SA 4O0IA 4W5TA 4E7IA 1Q9YA 1QSYA 1TV6A 2PYJA 3KD5E 3RTVA 5J1EA 4KFBA 1LW2A 2FBVA 4I9LA 3P1GA 4KHNA 3AA5X 3AVBA 4DS4A 1KFDA 2OPPA 1ITGA 1BGXT 1LW0A 2DFFA 4NCAA 1XHXA 3QNOA 4CIGA 4DLGA 2VG7A 3T19A 3OYNA 4Q5VA 2XY7A 5CZ2A 3CFPA 1TK8A 2ZE2A 1TL1A 3AA4A 3LP3A 4EP4A 3OYIA 4N47A 3WNGA 3LALA 1JXBA 4IG0A 1IKWA 2Z1HA 3RR7A 4CGGA 3ULDA 1SKWA 4DTJA 2RF2A 4IFYA 3V81A 4B9LA 4Y1CA 3AVCA 4KTQA 1RBTA 1RT2A 1SUQA 1HJRA 3QIPA 3L2RA 4KHYA 1LAVA 3HM9A 4Y1DA 4H8KA 4AH9A 4F4KA 4FJHA 1WN7A 2WOMA 2ZQBA 3KLEA 2XY6A 4FJJA 4ID5A 1RBVA 5I3UA 4BACA 3NF9A 1NK4A 4CIEA 1L3UA 3B6PA 4K8XA 4FJ7A 4DSEA 2VG5A 1QE1A 4FZZA 3O3FA 1ZYQA 1EKEA 4BDYA 4ZTJA 3HVTA 3VQ8A 4M41A 3EZ5A 4IFVA 4CJ3A 4CJPA 3DRRA 4FJKA 3MAQA 4J2DA 3SQ0A 1IKVA 2Z1IA 1QSSA 3RRGA 3M8PA 4ELUA 2F96A 3QERA 4CEBA 3L2VA 4J2EA 1ASVA 5CZ1A 4CK3A 3NAEA 3HPHA 1EP4A 4IKFA 3OYAA 4MQ3A 4FLUA 1U49A 3AVAA 3KKSA 3FFIA 3SI6A 1WAFA 1NKEA 4B9TA 1KSPA 2RN2A 4FYDA 1J53A 2G8FA 3AO4A 1S1VA 3B6OA 1L3VA 4DQIA 1LV5A 4KV8A 3PV8A 1D8YA 4BDZA 2DFEA 1TKZA 3DRPA 1B9FA 3F9KA 3K5OA 4O0JA 3AA3A 4DTPA 1S5JA 4DQRA 4CJVA 2ZD1A 4LY7A 1UWBA 1RNHA 1RT6A 3NCIA 3NGYA 1JLCA 5C42A 4F8RA 4PQUA 1TL3A 3PY8A 4CF1A 3IAYA 4F2SA 3D0PA 1BI4B 4E7JA 3NF7A 1NOYA 3K57A 3V9XA 1GOCA 1C0MA 3HPGA 1SV5A 2Z1GA 5J2NA 4K8ZA 1VSEA 2P51A 5CYQA 3NF6A 1ASUA 5HLFA 3SCXA 4NYFA 4E7LA 2Y1IA 1VSMA 2DFHA 1RCHA 3DYAA 1QHTA 4ID1A 3ZSYA 4CHQA 1NJXA 2YNGA 4CCHA 1JXEA 3ZT4A 3AO1A 1ASWA 3O4QA 4N5SA 4DF4A 3CYMA 3PUFA 5JS2A 4CHYA 4ELVA 4HUEA 3WNHA 4KHSA 3KIOA 3HYFA 4FZXC 1NKBA 2YHAA 2Z1JA 4F3OA 4LSNA 3OYGA 2QKKA 4NCBA 3IRXA 4FLXA 1BCOA 3TAPA 4DMNA 2XY5A 4B9NA 4FJGA 4DU1A 4Z0UA 2XRIA 4BE0A 3KJVA 1KFSA 4IBNA 4Z4HA 5DMRA 3V9ZA 1D9DA 1WLJA 4J2AA 4GW6A 4PWDA 4AILC 5EU7A 3SJJA 4KB1A 5I42A 4CGDA 4KPYA 2VWKA 3PX0A 5KTQA 4FVMA 4M3UA 1NK7A 1Q9XA 4HTUA 3TAEA 4Z4GA 3KLGA 4DSIA 4FZYA 3TWHA 3HP6A 4C8OA 2LSNA 2NUBA 2YHBA 3CFOA 4CGHA 3QEVA 3OYCA 1VRTA 4J2BA 2G8IA 4DQSA 4W5RA 1HMVA 3HT3A 4DU3A 4CHOA 3AVLA 2E6LA 3SV4A 3VQCA 3KLIA 3L2UA 4EZ9A 3AVGA 4CEAA 1XHZA 1VSJA 3SQ1A 1KLNA 4DSLA 3VA0A 3TAGA 3MXMA 1C1BA 1WSFA 4B3OA 2DY4A 4E1NA 3S9HA 4Z4FA 1T03A 1G15A 1HRHA 3VQ6A 1T7PA 3QNNA 1JLEA 4DU4A 1RTDA 2QXFA 5HRSA 2PZSA 4B08A 1NJWA 3DOLA 4FJIA 4E1MA 1RT4A 3V9WA 4AHCA 1SKSA 2A1SA 2G8VA 4E19A 2RKIA 2X6NA 1RTHA 4YFUA 3NH0A 4DS5A 4FCYA 4KRFA 3DLBA 2HW3A 3MEEA 3VA3A 1W0HA 4ZHRA 1TKDA 1HYSA 5C24A 3PO5A 3V6DA 1U47A 4CK1A 1YVUA 2EX3A 1YT3A 3NFAA 3CFRA 4FJNA 1SL2A 1FKOA 1Z26A 2BDPA 1WSGA 1MU2A 4CERA 2X6SA 2X78A 1NJZA 4W5NA 1BQMA 1K6YA 4CF0A 4W5QA 1QS4A 4KKOA 4FXDA 4RW7A 4FLZA 2WONA 4FW1A 5D3GA 3O3HA 4DTMA 4CJ4A 5FDLA 2GUIA 4O4GA 1TKTA 3DI6A 4OKEA 1DTTA 1RT5A 2OZSA 3QO9A 2HHTA 1TAUA 1JLGA 1VSIA 3OYBA 1RBSA 3JYTA 4DFPA 3ISNC 2YNFA 1HQEA 1A5WA 1BIUA 1RILA 2HNYA 2G8UA 4KB0A 2KFNA 3BGRA 3LDSA 3ZCMA 3F73A 3SYZA 2VG6A 4DTRA 4OPJA 3DLHA 4B9UA 1VSHA 3HXMA 2D0BA 2KQ2A 1VK0A 4CHNA 1RT1A 2D5RA 2RPIA 3VQQA 2Y1JA 2ETJA 1IKYA 3LANA 2XO7A 2YNHA 2PYLA 4BE1A 4DSJA 3WNFA 3LZIA 1RBUA 3IG1A 4DFKA 2HVHA 1QSLA 1NK9A 4LH4A 1X9WA 1L5UA 1IO2A 4B9MA 3OYFA 3SQ2A 4HCBA 1JLAA 1C1AA 5KI6A 4UQGA 2W42A 3DLEA 3DRSA 4B8CA 1QQCA 1CXUA 3K2PA 3KK1A 4HVJA 4FM2A 3SPZA 4DSKA 2QK9A 2BE2A 3K5MA 5HRNA 3QEIA 3VQEA 1BI4A 3L3VA 3ZT2A 4CE9A 3HVRA 1ZBFA 4CEQA 2YKMA 3QEPA 1WSHA 1BCMA 3ZT0A 1SL0A 1C1CA 1RTIA 1XWLA 4DQPA 3DLKA 3ZT1A 1EETA 4I7FA 1ZBUA 3TAQA 2G8HA 1TVRA 1WAJA 5DK5A 1VSDA 4C8NA 4KO0A 3SUPA 3NDKA 3MXJA 1QTMA 4KTWA 1HNIA 1I39A 3NBPA 4AHVA 3AO2A 4CFDA 4CFCA 3NGZA 4E7HA 3VN5A 3M8RA 4BWJA 3NE6A 1VSKA 4R5PA 3RMDA 1X9SA 3L8BA 4IG3A 1GOAA 3QINA 3AV9A 1RDBA 2P5OA 4DTXA 3AA2A 3V1RA 4LH5A 1ZBLA 4OLAA 2HB5A 3VQAA 4AHSA 4OPKA 3AO5A 3AVKA 3AVMA 3K58A 1NK8A 4M3XA 1FKPA 3ZSOA 3AVFA 1UOCA 1YTAA 1R0AA 3LPUA 4RW9A 3SZ2A 3MXIA 4CJUA 1TK0A 4N76A 1NOZA 1CXQA 3OYMA 3H08A 4DTUA 1VSFA 4RW8A 3KKRA 1VSLA 1REVA 3G10A 4CJWA 2VWJA 3DLRA 3K5NA 1ZBHA 1XC9A 1KVAA 1UAXA 3KD1E 4DFMA 1U04A 4B9VA 3MEDA 5J2QA 2A1RA 5SWMA 3I0RA 4FK4A 3ZSXA 5K14A 1U4BA 4JRQA 1LWFA 2E6MA 3SUNA 1IG9A 3TANA 2HHVA 4HUGA 3OY9A 3PO4A 1JKHA 1A5XA 1X9MA 1UA0A 3RMCA 3V4IA 1JLFA 1RDAA 4GMJB 3VQ5A 4CFBA 1S1TA 4E89A 3U6FA 4BDPA 1U48A 4RW4A 3JSMA 3K59A 4FLTA 2HVIA 4DTOA 4FM1A 4FJLA 3VQ4A 4RW6A 2IDOA 3DOKA 1DTQA 2YKNA 4CJFA 2GV9A 3I8DA 3KLHA 4NCGA 3OJSA 2G8WA 2OA8A 3ITHA 4CHPA 4JLHA 1CZ9A 2OYQA 4Z4CA 1T05A 1S1WA 3C6UA 4LSLA 4FJ9A 1ZBIA 3ALYA 4FLWA 4M45A 3WNEA 4CESA 4CJLA 4L8RB 3HP9A 4OVLA 4DFJA 1LAWA 4PY5A 3V9SA 1C0TA 4CJSA 1KVCA 4KI4A 2IC3A 2O4IA 3A2FA 3QLHA 4TSXA 4CEOA 4AHUA 2XHBA 4C8LA 2AJQA 3RMBA 4H4OA 4DSFA 3OYEA 2OZMA 3V1OA 1RT3A 4KHUA 1KVBA 1RDDA 3LAKA 3VQDA 4JS4A 4FM0A 5KGWA 5FRNA 4F3TA 3L3UA 3DM2A 4G1QA 3CG7A 3P5JA 1IKXA 4KTZA 5CYMA 4FK0A 1TGOA 3C95A 3I0SA 5JS1A 4OJRA 2EHGA 3ZSZA 3S3OA 3TAFA 4CHZA 3NHGA 3L2QA 5T7BA 4E7KA 3SPYA 4CEDA 3HPOA 3M8SA 5C25A 3S3MA 2E4LA 2I5JA 1JL2A 1F21A 4M3RA 3VQPA 1KCFA 2KTQA 2ATQA 2HNDA 3U3YA 4I9QA 1O1WA 4GVMA 4CGJA 3CQ8A 3THVA 3O3GA 4CF8A 1J54A 4LD0A 3LP2A 4CEEA 5E41A 1WNSA 3ZT3A 3MEGA 2HNZA 1NJYA 3LPTA 3LWMA 2HMIA 4Z4IA 3OS0A 1HYZA 1S9EA 1JLQA 1N5YA 3LAMA 2PY5A 3T3FA 1BL3A 1CZBA 2IS3A 3QEWA 4FJMA 3EY1A 4PUOA 4M42A 4Q0BA 4N56A 4DF8A 3SQ4A 4AHTA 4KHWA 1VRUA 5HBMA 3TARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPS A;  2YNI A;  4CF9 A;  4N41 A;  1S9G A;  5HRR A;  3LZJ A;  1RT7 A;  3OYD A;  2KW4 A;  2XY8 A;  4OLB A;  3OS2 A;  4CJ5 A;  1BQN A;  3UIQ A;  3L2W A;  1HYV A;  2OPR A;  2G8K A;  1NK0 A;  4B9S A;  4KAZ A;  4M3W A;  4QCL A;  5HP1 A;  4DTS A;  3DMJ A;  4CJR A;  2KFZ A;  2HHQ A;  1B92 A;  4BE2 A;  1S1X A;  1X1P A;  2FBT A;  4IDK A;  4CF2 A;  4NYN A;  5FRO A;  2OPQ A;  1L3S A;  5SZT A;  2DTU A;  3AO3 A;  1C0U A;  1JL1 A;  1A5V A;  4B8A B;  5HRP A;  1BIS A;  3MEC A;  1HPZ A;  4KRE A;  3ZSR A;  2ITG A;  3K5L A;  3RRH A;  2FBY A;  5KRS A;  4W5O A;  4C8K A;  1KLM A;  3O4N A;  4O44 A;  2QKB A;  5FRM A;  1GOB A;  5J2M A;  3VQ9 A;  4QAG A;  3QET A;  3ZSW A;  3RR8 A;  4M3Z A;  2D0A A;  1Z25 A;  2IAJ A;  3U3G A;  3CM6 A;  5CY4 A;  3T1A A;  2IOC A;  3HST B;  4DQQ A;  3TI0 A;  3KK2 A;  4QOZ B;  4JRP A;  2B5J A;  1RBR A;  4FLV A;  4FJX A;  3OS1 A;  4XIU A;  4O55 A;  3KLF A;  3TAB A;  2F8S A;  3LP1 A;  3QES A;  5HRO A;  1HQU A;  4I2P A;  3OYK A;  2FBX A;  4HUF A;  2BGG A;  3KK3 A;  1Y97 A;  3SUO A;  2HHX A;  3PX4 A;  1NK5 A;  1RTJ A;  2KZM A;  2BAN A;  3NGI A;  1KRP A;  3C6T A;  4WE1 A;  1IH7 A;  1U45 A;  4EZ6 A;  4DG1 A;  5KRT A;  2IGI A;  1WSI A;  2YV0 X;  1S1U A;  4C8M A;  3VQB A;  3SV3 A;  1TK5 A;  1NK6 A;  1YTU A;  3KTQ A;  1N6Q A;  3HO1 A;  3TAM A;  3RMA A;  1J9A A;  3D45 A;  1S6Q A;  2R7Y A;  1SL1 A;  1NKC A;  4ELT A;  4OGC A;  5KGX A;  4FJ5 A;  4CFA A;  4Z4E A;  3P83 D;  4CJT A;  1BIZ A;  4DWI A;  2HHU A;  4DLE A;  1T8E A;  3ZSQ A;  2P1J A;  3LWL A;  1XI1 A;  4HHT A;  1C6V A;  1JLB A;  1Q8I A;  1L3T A;  3QEX A;  4OKK A;  4FK2 A;  4M3T A;  3HJF A;  4E0D A;  1J5O A;  3ASM A;  1W9H A;  4CEC A;  1B9D A;  5J2P A;  2F8T A;  2D0C A;  3C94 A;  4F2R A;  4PA1 A;  2KZZ A;  3OVN A;  4CGF A;  4FJ8 A;  1LWE A;  1DLO A;  1S6P A;  4RG8 A;  3V9U A;  4YNQ A;  1UA1 A;  3M8Q A;  2JGU A;  2P5G A;  1FK9 A;  4FW2 A;  4M3Y A;  1EX4 A;  4MFB A;  1WSE A;  4CEZ A;  3SNN A;  2FC0 A;  4O5B A;  3NH2 A;  4JS5 A;  4OGE A;  2B4J A;  4CK2 A;  3E01 A;  1SKR A;  3OJU A;  1RDC A;  3QIO A;  3V1Q A;  3SUQ A;  1BHL A;  3AVJ A;  4CGI A;  4CEF A;  4CJQ A;  3OYJ A;  3AVH A;  2HHS A;  3IS9 A;  1D5A A;  1TAQ A;  3CM5 A;  3LP0 A;  4EP5 A;  3S3N A;  1WSJ A;  2HHW A;  3OYL A;  3RWU A;  4BWM A;  3EYZ A;  1KTQ A;  3HL8 A;  1D9F A;  4OKJ A;  1HNV A;  1FXX A;  1I3A A;  3AVN A;  4CJE A;  4HCC A;  3DLG A;  3ZSV A;  4KI6 A;  1TKX A;  2O4G A;  4H4M A;  4E3S A;  4KHQ A;  1CLQ A;  2X74 A;  3G0Z A;  4I2Q A;  3NF8 A;  2GBZ A;  3BDP A;  3VQ7 A;  3HK2 A;  4ICL A;  4DTN A;  3PX6 A;  4ZTF A;  1LWC A;  3TR8 A;  4AHR A;  3NH1 A;  3AVI A;  4CIF A;  4CJK A;  4FLY A;  2B6A A;  2JLE A;  3OYH A;  1EXQ A;  2Q3S A;  4O0I A;  4W5T A;  4E7I A;  1Q9Y A;  1QSY A;  1TV6 A;  2PYJ A;  3KD5 E;  3RTV A;  5J1E A;  4KFB A;  1LW2 A;  2FBV A;  4I9L A;  3P1G A;  4KHN A;  3AA5 X;  3AVB A;  4DS4 A;  1KFD A;  2OPP A;  1ITG A;  1BGX T;  1LW0 A;  2DFF A;  4NCA A;  1XHX A;  3QNO A;  4CIG A;  4DLG A;  2VG7 A;  3T19 A;  3OYN A;  4Q5V A;  2XY7 A;  5CZ2 A;  3CFP A;  1TK8 A;  2ZE2 A;  1TL1 A;  3AA4 A;  3LP3 A;  4EP4 A;  3OYI A;  4N47 A;  3WNG A;  3LAL A;  1JXB A;  4IG0 A;  1IKW A;  2Z1H A;  3RR7 A;  4CGG A;  3ULD A;  1SKW A;  4DTJ A;  2RF2 A;  4IFY A;  3V81 A;  4B9L A;  4Y1C A;  3AVC A;  4KTQ A;  1RBT A;  1RT2 A;  1SUQ A;  1HJR A;  3QIP A;  3L2R A;  4KHY A;  1LAV A;  3HM9 A;  4Y1D A;  4H8K A;  4AH9 A;  4F4K A;  4FJH A;  1WN7 A;  2WOM A;  2ZQB A;  3KLE A;  2XY6 A;  4FJJ A;  4ID5 A;  1RBV A;  5I3U A;  4BAC A;  3NF9 A;  1NK4 A;  4CIE A;  1L3U A;  3B6P A;  4K8X A;  4FJ7 A;  4DSE A;  2VG5 A;  1QE1 A;  4FZZ A;  3O3F A;  1ZYQ A;  1EKE A;  4BDY A;  4ZTJ A;  3HVT A;  3VQ8 A;  4M41 A;  3EZ5 A;  4IFV A;  4CJ3 A;  4CJP A;  3DRR A;  4FJK A;  3MAQ A;  4J2D A;  3SQ0 A;  1IKV A;  2Z1I A;  1QSS A;  3RRG A;  3M8P A;  4ELU A;  2F96 A;  3QER A;  4CEB A;  3L2V A;  4J2E A;  1ASV A;  5CZ1 A;  4CK3 A;  3NAE A;  3HPH A;  1EP4 A;  4IKF A;  3OYA A;  4MQ3 A;  4FLU A;  1U49 A;  3AVA A;  3KKS A;  3FFI A;  3SI6 A;  1WAF A;  1NKE A;  4B9T A;  1KSP A;  2RN2 A;  4FYD A;  1J53 A;  2G8F A;  3AO4 A;  1S1V A;  3B6O A;  1L3V A;  4DQI A;  1LV5 A;  4KV8 A;  3PV8 A;  1D8Y A;  4BDZ A;  2DFE A;  1TKZ A;  3DRP A;  1B9F A;  3F9K A;  3K5O A;  4O0J A;  3AA3 A;  4DTP A;  1S5J A;  4DQR A;  4CJV A;  2ZD1 A;  4LY7 A;  1UWB A;  1RNH A;  1RT6 A;  3NCI A;  3NGY A;  1JLC A;  5C42 A;  4F8R A;  4PQU A;  1TL3 A;  3PY8 A;  4CF1 A;  3IAY A;  4F2S A;  3D0P A;  1BI4 B;  4E7J A;  3NF7 A;  1NOY A;  3K57 A;  3V9X A;  1GOC A;  1C0M A;  3HPG A;  1SV5 A;  2Z1G A;  5J2N A;  4K8Z A;  1VSE A;  2P51 A;  5CYQ A;  3NF6 A;  1ASU A;  5HLF A;  3SCX A;  4NYF A;  4E7L A;  2Y1I A;  1VSM A;  2DFH A;  1RCH A;  3DYA A;  1QHT A;  4ID1 A;  3ZSY A;  4CHQ A;  1NJX A;  2YNG A;  4CCH A;  1JXE A;  3ZT4 A;  3AO1 A;  1ASW A;  3O4Q A;  4N5S A;  4DF4 A;  3CYM A;  3PUF A;  5JS2 A;  4CHY A;  4ELV A;  4HUE A;  3WNH A;  4KHS A;  3KIO A;  3HYF A;  4FZX C;  1NKB A;  2YHA A;  2Z1J A;  4F3O A;  4LSN A;  3OYG A;  2QKK A;  4NCB A;  3IRX A;  4FLX A;  1BCO A;  3TAP A;  4DMN A;  2XY5 A;  4B9N A;  4FJG A;  4DU1 A;  4Z0U A;  2XRI A;  4BE0 A;  3KJV A;  1KFS A;  4IBN A;  4Z4H A;  5DMR A;  3V9Z A;  1D9D A;  1WLJ A;  4J2A A;  4GW6 A;  4PWD A;  4AIL C;  5EU7 A;  3SJJ A;  4KB1 A;  5I42 A;  4CGD A;  4KPY A;  2VWK A;  3PX0 A;  5KTQ A;  4FVM A;  4M3U A;  1NK7 A;  1Q9X A;  4HTU A;  3TAE A;  4Z4G A;  3KLG A;  4DSI A;  4FZY A;  3TWH A;  3HP6 A;  4C8O A;  2LSN A;  2NUB A;  2YHB A;  3CFO A;  4CGH A;  3QEV A;  3OYC A;  1VRT A;  4J2B A;  2G8I A;  4DQS A;  4W5R A;  1HMV A;  3HT3 A;  4DU3 A;  4CHO A;  3AVL A;  2E6L A;  3SV4 A;  3VQC A;  3KLI A;  3L2U A;  4EZ9 A;  3AVG A;  4CEA A;  1XHZ A;  1VSJ A;  3SQ1 A;  1KLN A;  4DSL A;  3VA0 A;  3TAG A;  3MXM A;  1C1B A;  1WSF A;  4B3O A;  2DY4 A;  4E1N A;  3S9H A;  4Z4F A;  1T03 A;  1G15 A;  1HRH A;  3VQ6 A;  1T7P A;  3QNN A;  1JLE A;  4DU4 A;  1RTD A;  2QXF A;  5HRS A;  2PZS A;  4B08 A;  1NJW A;  3DOL A;  4FJI A;  4E1M A;  1RT4 A;  3V9W A;  4AHC A;  1SKS A;  2A1S A;  2G8V A;  4E19 A;  2RKI A;  2X6N A;  1RTH A;  4YFU A;  3NH0 A;  4DS5 A;  4FCY A;  4KRF A;  3DLB A;  2HW3 A;  3MEE A;  3VA3 A;  1W0H A;  4ZHR A;  1TKD A;  1HYS A;  5C24 A;  3PO5 A;  3V6D A;  1U47 A;  4CK1 A;  1YVU A;  2EX3 A;  1YT3 A;  3NFA A;  3CFR A;  4FJN A;  1SL2 A;  1FKO A;  1Z26 A;  2BDP A;  1WSG A;  1MU2 A;  4CER A;  2X6S A;  2X78 A;  1NJZ A;  4W5N A;  1BQM A;  1K6Y A;  4CF0 A;  4W5Q A;  1QS4 A;  4KKO A;  4FXD A;  4RW7 A;  4FLZ A;  2WON A;  4FW1 A;  5D3G A;  3O3H A;  4DTM A;  4CJ4 A;  5FDL A;  2GUI A;  4O4G A;  1TKT A;  3DI6 A;  4OKE A;  1DTT A;  1RT5 A;  2OZS A;  3QO9 A;  2HHT A;  1TAU A;  1JLG A;  1VSI A;  3OYB A;  1RBS A;  3JYT A;  4DFP A;  3ISN C;  2YNF A;  1HQE A;  1A5W A;  1BIU A;  1RIL A;  2HNY A;  2G8U A;  4KB0 A;  2KFN A;  3BGR A;  3LDS A;  3ZCM A;  3F73 A;  3SYZ A;  2VG6 A;  4DTR A;  4OPJ A;  3DLH A;  4B9U A;  1VSH A;  3HXM A;  2D0B A;  2KQ2 A;  1VK0 A;  4CHN A;  1RT1 A;  2D5R A;  2RPI A;  3VQQ A;  2Y1J A;  2ETJ A;  1IKY A;  3LAN A;  2XO7 A;  2YNH A;  2PYL A;  4BE1 A;  4DSJ A;  3WNF A;  3LZI A;  1RBU A;  3IG1 A;  4DFK A;  2HVH A;  1QSL A;  1NK9 A;  4LH4 A;  1X9W A;  1L5U A;  1IO2 A;  4B9M A;  3OYF A;  3SQ2 A;  4HCB A;  1JLA A;  1C1A A;  5KI6 A;  4UQG A;  2W42 A;  3DLE A;  3DRS A;  4B8C A;  1QQC A;  1CXU A;  3K2P A;  3KK1 A;  4HVJ A;  4FM2 A;  3SPZ A;  4DSK A;  2QK9 A;  2BE2 A;  3K5M A;  5HRN A;  3QEI A;  3VQE A;  1BI4 A;  3L3V A;  3ZT2 A;  4CE9 A;  3HVR A;  1ZBF A;  4CEQ A;  2YKM A;  3QEP A;  1WSH A;  1BCM A;  3ZT0 A;  1SL0 A;  1C1C A;  1RTI A;  1XWL A;  4DQP A;  3DLK A;  3ZT1 A;  1EET A;  4I7F A;  1ZBU A;  3TAQ A;  2G8H A;  1TVR A;  1WAJ A;  5DK5 A;  1VSD A;  4C8N A;  4KO0 A;  3SUP A;  3NDK A;  3MXJ A;  1QTM A;  4KTW A;  1HNI A;  1I39 A;  3NBP A;  4AHV A;  3AO2 A;  4CFD A;  4CFC A;  3NGZ A;  4E7H A;  3VN5 A;  3M8R A;  4BWJ A;  3NE6 A;  1VSK A;  4R5P A;  3RMD A;  1X9S A;  3L8B A;  4IG3 A;  1GOA A;  3QIN A;  3AV9 A;  1RDB A;  2P5O A;  4DTX A;  3AA2 A;  3V1R A;  4LH5 A;  1ZBL A;  4OLA A;  2HB5 A;  3VQA A;  4AHS A;  4OPK A;  3AO5 A;  3AVK A;  3AVM A;  3K58 A;  1NK8 A;  4M3X A;  1FKP A;  3ZSO A;  3AVF A;  1UOC A;  1YTA A;  1R0A A;  3LPU A;  4RW9 A;  3SZ2 A;  3MXI A;  4CJU A;  1TK0 A;  4N76 A;  1NOZ A;  1CXQ A;  3OYM A;  3H08 A;  4DTU A;  1VSF A;  4RW8 A;  3KKR A;  1VSL A;  1REV A;  3G10 A;  4CJW A;  2VWJ A;  3DLR A;  3K5N A;  1ZBH A;  1XC9 A;  1KVA A;  1UAX A;  3KD1 E;  4DFM A;  1U04 A;  4B9V A;  3MED A;  5J2Q A;  2A1R A;  5SWM A;  3I0R A;  4FK4 A;  3ZSX A;  5K14 A;  1U4B A;  4JRQ A;  1LWF A;  2E6M A;  3SUN A;  1IG9 A;  3TAN A;  2HHV A;  4HUG A;  3OY9 A;  3PO4 A;  1JKH A;  1A5X A;  1X9M A;  1UA0 A;  3RMC A;  3V4I A;  1JLF A;  1RDA A;  4GMJ B;  3VQ5 A;  4CFB A;  1S1T A;  4E89 A;  3U6F A;  4BDP A;  1U48 A;  4RW4 A;  3JSM A;  3K59 A;  4FLT A;  2HVI A;  4DTO A;  4FM1 A;  4FJL A;  3VQ4 A;  4RW6 A;  2IDO A;  3DOK A;  1DTQ A;  2YKN A;  4CJF A;  2GV9 A;  3I8D A;  3KLH A;  4NCG A;  3OJS A;  2G8W A;  2OA8 A;  3ITH A;  4CHP A;  4JLH A;  1CZ9 A;  2OYQ A;  4Z4C A;  1T05 A;  1S1W A;  3C6U A;  4LSL A;  4FJ9 A;  1ZBI A;  3ALY A;  4FLW A;  4M45 A;  3WNE A;  4CES A;  4CJL A;  4L8R B;  3HP9 A;  4OVL A;  4DFJ A;  1LAW A;  4PY5 A;  3V9S A;  1C0T A;  4CJS A;  1KVC A;  4KI4 A;  2IC3 A;  2O4I A;  3A2F A;  3QLH A;  4TSX A;  4CEO A;  4AHU A;  2XHB A;  4C8L A;  2AJQ A;  3RMB A;  4H4O A;  4DSF A;  3OYE A;  2OZM A;  3V1O A;  1RT3 A;  4KHU A;  1KVB A;  1RDD A;  3LAK A;  3VQD A;  4JS4 A;  4FM0 A;  5KGW A;  5FRN A;  4F3T A;  3L3U A;  3DM2 A;  4G1Q A;  3CG7 A;  3P5J A;  1IKX A;  4KTZ A;  5CYM A;  4FK0 A;  1TGO A;  3C95 A;  3I0S A;  5JS1 A;  4OJR A;  2EHG A;  3ZSZ A;  3S3O A;  3TAF A;  4CHZ A;  3NHG A;  3L2Q A;  5T7B A;  4E7K A;  3SPY A;  4CED A;  3HPO A;  3M8S A;  5C25 A;  3S3M A;  2E4L A;  2I5J A;  1JL2 A;  1F21 A;  4M3R A;  3VQP A;  1KCF A;  2KTQ A;  2ATQ A;  2HND A;  3U3Y A;  4I9Q A;  1O1W A;  4GVM A;  4CGJ A;  3CQ8 A;  3THV A;  3O3G A;  4CF8 A;  1J54 A;  4LD0 A;  3LP2 A;  4CEE A;  5E41 A;  1WNS A;  3ZT3 A;  3MEG A;  2HNZ A;  1NJY A;  3LPT A;  3LWM A;  2HMI A;  4Z4I A;  3OS0 A;  1HYZ A;  1S9E A;  1JLQ A;  1N5Y A;  3LAM A;  2PY5 A;  3T3F A;  1BL3 A;  1CZB A;  2IS3 A;  3QEW A;  4FJM A;  3EY1 A;  4PUO A;  4M42 A;  4Q0B A;  4N56 A;  4DF8 A;  3SQ4 A;  4AHT A;  4KHW A;  1VRU A;  5HBM A;  3TAR A; 
#chains in the Genus database with same CATH topology
 1P90 A;  1S9G A;  1QQN A;  4WCE L;  2AP1 A;  4LFA K;  4KAZ A;  2P9L A;  1GLF O;  4CJR A;  2KFZ A;  1X1P A;  3H3O B;  1TUY A;  3O9T A;  4NYN A;  4O8K A;  4BVO A;  3AO3 A;  3ZX2 A;  1C0U A;  1JL1 A;  4I6M A;  5B8H A;  3TSP A;  2ITM A;  1HPZ A;  1H1V A;  3RVC A;  3K5L A;  3RRH A;  2P9N B;  2QKB A;  5J2M A;  3FE1 A;  3ZSW A;  4A62 A;  5AQS A;  1HKG A;  3PIP L;  1YHQ N;  2D0P A;  4FLV A;  4FJX A;  1QVF M;  1M1K O;  3OS1 A;  4O55 A;  2OCE A;  5HRO A;  4I2P A;  4EFH A;  5BN9 A;  3KK3 A;  1Y97 A;  2HHX A;  4LF8 K;  1NK5 A;  2KZM A;  1RTJ A;  2O8D B;  3NGI A;  2I7N A;  3C6T A;  1XC3 A;  4WQ4 C;  1U45 A;  3M3Z A;  1WSI A;  3CCJ N;  1S1U A;  4XH1 A;  3HO1 A;  1N6Q A;  3D45 A;  4YHH K;  4CZJ A;  5KGX A;  4Z4E A;  4DLE A;  3LWL A;  4FK2 A;  3HJF A;  4CZM A;  1W9H A;  3C94 A;  3NVM A;  4PA1 A;  3OVN A;  1LWE A;  1DLO A;  4BRK A;  4YNQ A;  2O8F B;  4K0K K;  1T6C A;  4U67 L;  4CZL A;  1OVQ A;  3E01 A;  1SKR A;  3OJU A;  4IJN A;  3CHW A;  2ZJR L;  3CJ7 A;  3V1Q A;  1GLB G;  3OYJ A;  1XUP O;  1NGH A;  4RCH A;  2QA4 N;  2HHW A;  4ISG A;  5M1N A;  1YF5 L;  3MX5 A;  4V19 S;  1ATR A;  1BU6 O;  3JXU A;  3ZX0 A;  5KPR A;  3C6A A;  4F9O A;  3VQ7 A;  3HK2 A;  2VGN A;  4ICL A;  2A5X A;  3AVI A;  3THW A;  2DTU A;  1NGA A;  1QSY A;  4EHU A;  3RTV A;  4I9L A;  2IVP A;  3P1G A;  3AA5 X;  2QI2 A;  5FPM A;  4BC4 A;  4DS4 A;  2OPP A;  1BGX T;  1WUA A;  2DFF A;  2GEM A;  3IUC A;  3QNO A;  4CIG A;  1TK8 A;  2VCP A;  3AA4 A;  3WNG A;  3LAL A;  1JXB A;  4K43 A;  5FPE A;  3I33 A;  2Z1H A;  1VQO N;  3K9J A;  1VQL N;  1X3N A;  3L4I A;  4IZ9 A;  4IFY A;  5EXW A;  3AVC A;  1RBT A;  3OA9 A;  3QIP A;  4JNE A;  4EIA A;  1LAV A;  4F4K A;  4FJH A;  2WOM A;  4ID5 A;  1L3U A;  4K8X A;  4FJ7 A;  2VG5 A;  3KVG A;  3EKU A;  4FZZ A;  2P9N A;  3VQ8 A;  2FLO A;  3MAQ A;  4J2D A;  3QER A;  4CEB A;  2F4V K;  3NAE A;  3FZH A;  1EP4 A;  3Q7C A;  4A59 A;  4BGB A;  1U49 A;  1N32 K;  3AVA A;  4FYD A;  1KSP A;  2G8F A;  1MWK A;  2O8D A;  4H0T B;  4KV8 A;  4WFN L;  4BDZ A;  4DTP A;  3AA3 A;  4DQR A;  1RNH A;  3NGY A;  1JLC A;  1XNR K;  3PY8 A;  2F9T A;  4E7J A;  4AQY K;  1GOC A;  5AQN A;  3CMA N;  3J81 O;  3BP8 A;  1ASU A;  4GKJ K;  3SCX A;  4IJA A;  4NYF A;  4BR7 A;  4Y0W A;  4A5A A;  4H5T A;  3AO1 A;  5JS2 A;  4HUE A;  4KHS A;  2E2Q A;  3HYF A;  4YOU A;  4UY8 O;  2YHA A;  2Z1J A;  4FLX A;  3T1Y K;  2E5L K;  4FJG A;  5E84 A;  3KJV A;  1R59 O;  1D9D A;  4PWD A;  3CET A;  3CJB A;  3OHR A;  4JK9 A;  4AIL C;  4KB1 A;  2VWK A;  3PX0 A;  1I94 K;  3H1Q A;  3TAE A;  3AGR A;  3KLG A;  4FZY A;  3VET A;  4EAH D;  4C8O A;  4WYB A;  3VGL A;  3QEV A;  3OYC A;  4LFC K;  1VRT A;  4DQS A;  4RTF D;  5AZJ B;  3OBY A;  3SV4 A;  2BH1 A;  4EZ9 A;  3H3N O;  1ILY A;  1VSJ A;  4OPH A;  1C1B A;  3D7E O;  3AAP A;  3QFP A;  4B3O A;  3S9H A;  5BPL A;  5GAH P;  4DU4 A;  3WQU A;  3U4L A;  5GAD P;  4HTL A;  1HX1 A;  1OH5 A;  2YHX A;  1RDU A;  4B3S K;  3CER A;  2G8V A;  2QWR A;  1VQK N;  2X6N A;  3NH0 A;  1T3V A;  4DS5 A;  1HR0 K;  4FCY A;  3VA3 A;  4WQ4 A;  5C24 A;  3V6D A;  1U47 A;  2EX3 A;  3NFA A;  4IO9 L;  1E3M A;  1SL2 A;  3WEE B;  2OTL N;  2X78 A;  1BQM A;  1K6Y A;  4CF0 A;  1QS4 A;  5EVZ A;  2QTD A;  4DKW A;  1KQS M;  5C12 A;  4O4G A;  1TKT A;  2OZS A;  3QO9 A;  4PL7 A;  2E1Z A;  4ILG B;  1JLG A;  1YIT N;  1RBS A;  2KFN A;  3UKR B;  2GUP A;  1HQE A;  2YNF A;  2G8U A;  3LDS A;  3F73 A;  3CXC M;  1IBK K;  1RT1 A;  2FSJ A;  2P9S B;  2RPI A;  1IKY A;  1S22 A;  3N4P A;  4H5R A;  3VEV A;  1X9W A;  1L5U A;  1IO2 A;  3BEX A;  4CI6 A;  1C1A A;  4M7X A;  3DRS A;  4B8C A;  1CXU A;  3CIP A;  4DB3 A;  3OTO K;  1XNQ K;  4ILH A;  4FWQ A;  2RE2 A;  1Q82 O;  2NRZ A;  1WSH A;  3M6G A;  1SL0 A;  1C1C A;  1RTI A;  1NNE A;  5ELZ A;  3FGU A;  3O9U A;  1TUU A;  3NDK A;  4BRA A;  4AHV A;  3NBP A;  4CFC A;  1YJW N;  3ZLJ A;  2WC9 A;  5AFU H;  2NRV A;  3RMD A;  3L8B A;  3F9M A;  3AV9 A;  4DTX A;  1ZBL A;  2HB5 A;  3K58 A;  1NK8 A;  1FKP A;  3AVF A;  3J7Z O;  3MXI A;  3GOI A;  2GTD A;  1E4G T;  4PHT X;  3VTI A;  3KD1 E;  1UAX A;  4DFM A;  4B9V A;  2HF3 A;  2A1R A;  5J2Q A;  1K73 O;  3K9K A;  5SWM A;  1U4B A;  1LWF A;  1MDU B;  4HUG A;  5AZJ A;  3PO4 A;  1DEJ A;  3V4I A;  3U6F A;  2GWJ A;  4FLT A;  4IOA L;  3CCQ N;  1NU0 A;  4JKD A;  4KH6 A;  3I8D A;  2Q97 A;  3ITH A;  5ADX A;  1BG3 A;  3C6U A;  2H3G X;  3PSF A;  4FLW A;  1YJN N;  3WNE A;  4CZI A;  4CJL A;  4L8R B;  2V51 B;  1LAW A;  1C0T A;  1KVC A;  3A2F A;  4JKC A;  4NB4 A;  2UU9 K;  1JJ2 M;  3VQD A;  2UYT A;  1IBL K;  3L3U A;  4MLH A;  1NGE A;  3WEE A;  4BRN A;  5JS1 A;  4OJR A;  3ZSZ A;  4DR5 K;  4CHZ A;  3NHG A;  5T7B A;  2UUA K;  3M8S A;  1KCF A;  2ATQ A;  1O1W A;  4CGJ A;  1Q18 A;  5E41 A;  4JYA K;  1WNS A;  4GNI A;  3MEG A;  2HNZ A;  4BR2 A;  3LPT A;  4K42 A;  3LWM A;  4Z4I A;  1HYZ A;  3UKR A;  4X65 K;  1S9E A;  1JLQ A;  3BZK A;  4FWM A;  1N5Y A;  2PY5 A;  3QEW A;  2P9S A;  3EY1 A;  4K41 A;  4N56 A;  4DTS A;  4CF9 A;  1RT7 A;  3OYD A;  2D0O A;  2KW4 A;  4OLB A;  3OS2 A;  4BR5 A;  1BQN A;  3L2W A;  4QCL A;  2G8K A;  1NK0 A;  4QS8 A;  3GBT A;  4PL8 A;  1VQN N;  3D6R A;  3VEO A;  2D1K A;  2QWO A;  3A5O C;  4FWS A;  3WT0 A;  3SMS A;  2OPQ A;  3BY5 A;  3HZ6 A;  4IFE A;  2A6A A;  5HRP A;  2YCH A;  5C0Y A;  1YJ9 N;  5CHI A;  5KRS A;  4C8K A;  1DT9 A;  4O44 A;  1GOB A;  4OPA A;  3VQ9 A;  3QML A;  4FSV A;  5ADX H;  4M3Z A;  1Z25 A;  3CM6 A;  3T1A A;  3TI0 A;  4JRP A;  2B5J A;  2O8E A;  2QWP A;  4XIU A;  3IFR A;  2F8S A;  4HUF A;  3ULE A;  3SUO A;  2GWK A;  2BAN A;  5DM7 L;  2QW9 A;  3I56 N;  4WE1 A;  4H0X B;  4J8F A;  1NGB A;  4EZ6 A;  3R8E A;  3EO3 A;  1TK5 A;  3TAM A;  2E8A A;  4FVU A;  1SL1 A;  4ELT A;  2ZGZ A;  4FJ5 A;  4CFA A;  3P83 D;  5TKY A;  4CJT A;  1BIZ A;  3ZEU B;  4DWI A;  3ENO A;  2HHU A;  1XI1 A;  2ZGY A;  1Q8I A;  4HHT A;  3DJC A;  3HBT A;  1BDG A;  3L6Q A;  4YY3 K;  4CEC A;  4QS9 A;  5J2P A;  4FJ8 A;  1X3M A;  4RG8 A;  1S6P A;  3V9U A;  1FK9 A;  5A2Q O;  3NVK A;  4JD2 B;  4O5B A;  2W6K A;  2B4J A;  4CK2 A;  3HI0 A;  1RDC A;  1WB9 A;  1BHL A;  3AVJ A;  4L3Q A;  3SAH A;  3CM5 A;  5AR0 A;  1NMD A;  1K8K B;  3OYL A;  1W97 L;  1EQY A;  1HNW K;  2FF3 B;  2EWS A;  3DLG A;  3ZSV A;  1TKX A;  3THX B;  4H4M A;  3EL2 A;  3TU5 A;  4KHQ A;  4IEE A;  4CD3 A;  4I2Q A;  3VMF B;  3HSC A;  2W6L A;  4A2A A;  4AHR A;  3NH1 A;  4CIF A;  4CJK A;  4BY9 C;  3OYH A;  4E7I A;  1TV6 A;  3MX2 A;  4KFB A;  4H0O A;  5LJV A;  4KHN A;  3QIC A;  3AVB A;  1ITG A;  4DLG A;  2VG7 A;  4JKA A;  2Q0U A;  2XY7 A;  3O08 A;  3CFP A;  2ZE2 A;  4KBO A;  3LP3 A;  4EP4 A;  5AQF A;  3OW2 M;  4IG0 A;  4CGG A;  1SKW A;  2RF2 A;  2KHO A;  1SUQ A;  4KHY A;  2ASO A;  3HM9 A;  3J7A P;  4FPB A;  1VQ4 N;  1KAY A;  3FR0 A;  2XY6 A;  3DAW A;  1RBV A;  1NK4 A;  3B6P A;  3SK3 A;  4BDY A;  4JN4 A;  4ZTJ A;  4FJK A;  4YOY A;  4IFV A;  3DRR A;  3MCP A;  1IKV A;  5CE3 A;  3M8P A;  4J2E A;  5CZ1 A;  4CK3 A;  3O1W A;  1XMQ K;  3E9L A;  4IKF A;  4MQ3 A;  5AQU A;  4BG9 A;  1NKE A;  4BRP A;  3SI6 A;  4B9T A;  1J53 A;  2V7Y A;  1S1V A;  4IO8 A;  1D8Y A;  4JI0 K;  1TKZ A;  3K5O A;  1S5J A;  3QB0 A;  4LY7 A;  1RT6 A;  3NCI A;  3C6H A;  3ID8 A;  1TL3 A;  3ATU A;  3D0P A;  1Z05 A;  2NRR A;  1C0M A;  3ZEU A;  3KWI A;  2P9I B;  2Z1G A;  5J2N A;  1VSE A;  4JKF A;  3QFU A;  5CYQ A;  1NG9 A;  4JKG B;  3DYA A;  1NJX A;  1QHT A;  4ID1 A;  3ZT4 A;  3O4Q A;  4ELV A;  4DF4 A;  3CYM A;  4CZK A;  4CHY A;  4JD2 A;  4BRI A;  3WNH A;  4FZX C;  3OYG A;  2YI1 A;  1U6Z A;  1BCO A;  4JI7 K;  4BGA A;  2XY5 A;  3ID6 A;  4BE0 A;  1BUP A;  3U8X A;  3EE9 A;  5DMR A;  4A5B A;  3V9Z A;  1J5E K;  3TTD A;  4J2A A;  1K8K A;  3SJJ A;  5EU7 A;  4FOE A;  4DV1 K;  1KAZ A;  4CGD A;  5KTQ A;  4FVM A;  4CBU A;  1FJG K;  2LSN A;  2YHB A;  3CFO A;  3THX A;  4LF9 K;  3SBG A;  3HRG A;  5AQM A;  5I9E B;  4JI2 K;  5AQP A;  3GDQ A;  5BR8 K;  4B1V A;  4CHO A;  3E9O A;  3KLI A;  4XH5 A;  4DSL A;  3MXM A;  1WSF A;  2HST A;  4Z4F A;  1T03 A;  4DV3 K;  4WQ5 C;  3QNN A;  1RTD A;  1NMN A;  3IMX A;  2PZS A;  1NJW A;  3GL1 A;  5AQJ A;  4AHC A;  4ISF A;  2P9P B;  2YHW A;  1NWK A;  3CJA A;  1VQ5 N;  3DLB A;  4OX9 K;  4KH5 A;  3T1H K;  4JI6 K;  3PO5 A;  4DR3 K;  1ESV A;  3CFR A;  5HL7 L;  2JWL A;  3H46 O;  4CER A;  1MU2 A;  1NJZ A;  4W5Q A;  4RW7 A;  2HF4 A;  3TTC A;  1E4F T;  5KQD A;  3O3H A;  4CJ4 A;  4B1X B;  3DI6 A;  4OKE A;  3DWL A;  3O9R A;  2HHT A;  3CCV N;  3OBW A;  1VSI A;  4MO4 A;  1A5W A;  1BIU A;  1RIL A;  2VG6 A;  4O5F A;  3HXM A;  1VK0 A;  2ETJ A;  2XO7 A;  1OH6 A;  3HOT A;  3TSQ A;  2PYL A;  3LDP A;  4DFK A;  2HVH A;  2CH6 A;  4LH4 A;  3OYF A;  5KI6 A;  4JAX A;  2J4R A;  5AQT A;  3DLE A;  4B3M K;  2QK9 A;  3P31 A;  3K5M A;  3K0S A;  3VQE A;  3ZT2 A;  5AQV A;  3U9Z A;  5BRH A;  1IV0 A;  2P9I A;  3DXM B;  3LDO A;  4DQP A;  4XEI A;  3MWT A;  1YVN A;  4C8N A;  3MK6 A;  4KTW A;  2FF6 A;  4CFD A;  4FOI A;  4JKG A;  1S3X A;  4E7H A;  3NE6 A;  2E20 A;  3CJC A;  3P39 A;  1RDB A;  4IDH A;  3UB5 A;  3MN9 A;  4BRF A;  3LDQ A;  2O8F A;  3AVK A;  1OKJ A;  4M3X A;  5GAE P;  4RW9 A;  4BQL A;  4N76 A;  1NOZ A;  2Q1N A;  1NGD A;  3H08 A;  3TTF A;  2HBJ A;  1VSF A;  5IT9 O;  5KPT A;  4H0V B;  3G10 A;  2E88 A;  4GV6 A;  4H03 B;  5LY3 A;  4KH4 A;  1N34 K;  1BO5 O;  1U04 A;  3I0R A;  1IG9 A;  2E6M A;  2A40 A;  3SUN A;  3TAN A;  2QM1 A;  4MDA A;  2HHV A;  2OZM A;  3RMC A;  4CFB A;  4GMJ B;  4KB0 A;  4E89 A;  1U48 A;  3K59 A;  3JSM A;  1VQP N;  4DHY A;  4FJL A;  3VQ4 A;  2IDO A;  2Q31 A;  4KPY A;  1V4S A;  4CJF A;  2GV9 A;  4C1N K;  3KLH A;  2OA8 A;  2G8W A;  5BRF A;  1CZ9 A;  3CI5 A;  2OYQ A;  4H0Y B;  2IVN A;  4LSL A;  1ZBI A;  1GLE G;  3ALY A;  4CBW A;  1NJI O;  3SMP A;  2HHH K;  4H5N A;  2GX9 A;  4PY5 A;  3V9S A;  2P9P A;  2AJQ A;  2O4I A;  2XHB A;  3F2K A;  2NRX A;  3RMB A;  4IWV A;  4DSF A;  3OYE A;  4KHU A;  3G6E N;  1NLV A;  2WFB A;  3CQX A;  4JI4 K;  2IVO A;  4FM0 A;  3A0I X;  4G1Q A;  3CG7 A;  3MCA B;  3I0S A;  3O6W A;  2EHG A;  3O5B A;  3SPY A;  4AM7 A;  2E4L A;  2I5J A;  1F21 A;  3VQP A;  1C0F A;  1QZ5 A;  3MWP A;  2HND A;  3HM8 A;  3CQ8 A;  5JMV A;  4LD0 A;  4IEI A;  3ZT3 A;  1NJY A;  4JI1 K;  3Q7B A;  1W7A A;  3DXK B;  4WF9 L;  4NLB A;  3R3L A;  3LAM A;  4B1W B;  4Q0B A;  1CZB A;  4M42 A;  2UUC K;  4DF8 A;  3SQ4 A;  1VRU A;  2OPS A;  2YNI A;  5HRR A;  2P9K B;  2WBN A;  4BQZ A;  3ENH A;  3KHY A;  5F2R A;  4CJ5 A;  3UIQ A;  1SS6 A;  4BR9 A;  4M3W A;  4BRH A;  5LMU K;  2HHQ A;  1S1X A;  2FBT A;  4Z94 A;  4IDK A;  4CF2 A;  2QWM A;  4JV5 K;  5FRO A;  3DXM A;  1L3S A;  5SZT A;  3T69 A;  1BIS A;  3MEC A;  4KRE A;  2ITG A;  2FBY A;  4W5O A;  3O4N A;  5FRM A;  4QAG A;  3IDH A;  3U3G A;  2IAJ A;  4DQ8 A;  4IOX A;  4AF1 A;  4DQQ A;  2NRW A;  3CCS N;  1QQO A;  3KLF A;  3TAB A;  3QES A;  1DGK N;  3OYK A;  4FPA A;  4WQ5 A;  5AQO A;  2E1Y A;  3PX4 A;  3FZF A;  1KRP A;  3A8Y A;  1IH7 A;  4DG1 A;  2F7T A;  1YTU A;  1JCG A;  3VQB A;  1J9A A;  2R7Y A;  3WUH A;  4CVN E;  4LF6 K;  5FLX O;  2E2N A;  2FSN A;  4YDU C;  4OGC A;  2F9W A;  2O8C B;  4U7B A;  1T8E A;  1FW6 A;  4JI8 K;  2ZJQ L;  2P1J A;  1C6V A;  2PAV A;  3QEX A;  4M3T A;  3G25 A;  4E0D A;  1J5O A;  3ASM A;  1NGJ A;  2YX6 A;  2D0C A;  5JVH L;  4F2R A;  2KZZ A;  2NLX A;  1UA1 A;  2QWN A;  3U9D A;  4B3T K;  4A2B A;  4M3Y A;  3BUZ B;  1EX4 A;  4MFB A;  3WXM B;  4CEZ A;  3SNN A;  2FC0 A;  4NO7 A;  5AJ3 K;  4WFA L;  1GLD G;  1K9M O;  4CGI A;  4CJQ A;  3AVH A;  2HHS A;  3CD6 N;  3IS9 A;  5BRD A;  3LP0 A;  2NRT A;  3S3N A;  4BR4 A;  1W2B M;  3E9P A;  1OVY A;  1HPM A;  5H1S Q;  1D9F A;  4JK8 A;  1HNV A;  1FXX A;  1I3A A;  4CJE A;  4HCC A;  4FO0 A;  3JS6 A;  5FPD A;  2O4G A;  4E3S A;  1QZ6 A;  1CLQ A;  4BVP A;  3G0Z A;  3NF8 A;  5KQ8 A;  4H5V A;  3BDP A;  1LWC A;  4B1Z A;  5M1O A;  2JLE A;  3EN9 A;  1EXQ A;  4O0I A;  4W5T A;  2Q0R A;  2FBV A;  1KFD A;  4YOW A;  4BC2 A;  4B1Y B;  5AQX A;  3T19 A;  5CZ2 A;  3W0L A;  3ZET B;  1JCE A;  1IKW A;  3LDL A;  3RR7 A;  2P9K A;  1O13 A;  4DTJ A;  2IIR A;  2W40 A;  2W41 A;  3AAR A;  3L2R A;  2KKZ A;  3VF2 A;  5M1P A;  4XH4 A;  4Y1D A;  4AH9 A;  5EX5 A;  1WN7 A;  4YOR A;  2ZQB A;  3CJ1 A;  3KLE A;  4FJJ A;  5I3U A;  5AQY A;  4BAC A;  2V7Z A;  1QE1 A;  1ZYQ A;  3H45 C;  4EHT A;  1RFQ A;  3CPE A;  3HVT A;  3EZ5 A;  4CJ3 A;  3SAF A;  4JK7 A;  3CC7 N;  1QSS A;  4A57 A;  3L2V A;  1ASV A;  1TYQ B;  3HOS A;  3HPH A;  3OYA A;  3FFI A;  1WAF A;  4NXM K;  1VQ8 N;  2RN2 A;  4DQI A;  4GY2 B;  1Q7Y O;  2DFE A;  4O0J A;  4M63 C;  4BRC A;  4CJV A;  2CH5 A;  2ZD1 A;  1UWB A;  5C42 A;  4PQU A;  3MN6 A;  4CF1 A;  3IAY A;  4F2S A;  4CZG A;  4BC3 A;  2HOE A;  1NOY A;  3V9X A;  3H6E A;  1N8R O;  2O8C A;  3HPG A;  3FLC O;  2Q2R A;  4K8Z A;  4DUY K;  2P51 A;  1SAZ A;  3D2E B;  5MLC Q;  2HMP A;  5HLF A;  4E7L A;  4DV0 K;  1RCH A;  3ZSY A;  5JLF A;  2VQF K;  4CCH A;  1WOQ A;  1ASW A;  2Q36 A;  4N5S A;  3PUF A;  3ZYY X;  4FWN A;  3KIO A;  2CGJ A;  4C23 A;  3UKU B;  4F3O A;  3P4I A;  5AZI B;  4H0P A;  4LSN A;  2QKK A;  4NCB A;  3IRX A;  4DMN A;  5EOY A;  1BWF O;  4DU1 A;  2XRI A;  3C7N B;  1QVG M;  1KFS A;  1WLJ A;  2O8B B;  4M3U A;  3SLC A;  3VOV A;  4HTU A;  4Z4G A;  5M1K A;  4CGH A;  5AQQ A;  4J2B A;  2G8I A;  4FWO A;  4W5R A;  3HTV A;  3E66 A;  5BPN A;  4DU3 A;  3AVL A;  2E6L A;  3L2U A;  4CEA A;  1XHZ A;  3AY9 A;  1VAZ A;  2UUB K;  1KLN A;  3RSE B;  3TAG A;  2DY4 A;  3CCE N;  1G15 A;  1HRH A;  1T7P A;  2QXF A;  3O9Q A;  3O9S A;  5HRS A;  3DOL A;  4FJI A;  3V9W A;  3I8B A;  3VEX A;  1SKS A;  3ZET A;  4CW7 B;  2WTU A;  2RKI A;  2HBM A;  1RTH A;  4YFU A;  4KRF A;  3LDN A;  2ASP A;  1TKD A;  4ZHR A;  1ZBS A;  3MN5 A;  4CK1 A;  1YVU A;  4FJN A;  3CME N;  1Z26 A;  3L0Q A;  5KPZ A;  2BDP A;  4DR4 K;  1VQ7 N;  2X6S A;  4W5N A;  3J80 O;  3THW B;  4KKO A;  3LM9 A;  3GE1 A;  4YDU A;  2GEL A;  1RGI A;  5IWA K;  5D3G A;  4DTM A;  5FDL A;  2GUI A;  4PKI A;  1DTT A;  1RT5 A;  1TAU A;  2I7P A;  3OYB A;  3JYT A;  4DFP A;  3GG4 A;  1TYQ A;  3ZCM A;  4JI5 K;  4DTR A;  4DV7 K;  1ZXO A;  4CHN A;  4JKE A;  2D5R A;  3VQQ A;  2YNH A;  4BE1 A;  3CC4 N;  4YOT A;  1SZ2 A;  3WNF A;  3LZI A;  3IG1 A;  1QSL A;  1NK9 A;  1JLA A;  2W42 A;  3SPZ A;  4FXD A;  3KK1 A;  2A42 A;  4HVJ A;  3QEI A;  5HRN A;  3HVR A;  3L3V A;  3MN7 A;  1ZBF A;  4CEQ A;  3QEP A;  1BCM A;  3ZT0 A;  1XWL A;  3DLK A;  3CPW M;  1ZBU A;  3TAQ A;  2G8H A;  3D2E A;  4LF4 K;  3MXJ A;  1HNI A;  1I39 A;  3THY B;  3AO2 A;  4B3R K;  3B8A X;  3NGZ A;  3VN5 A;  3M8R A;  4BWJ A;  1VSK A;  1CZA N;  2YJF A;  1GOA A;  5AQR A;  3VEZ A;  4OLA A;  3UKU A;  4AHS A;  4OPK A;  5AZI A;  3FZL A;  1MWM A;  1UOC A;  1YTA A;  3LPU A;  4FWL A;  2OAN A;  1R0A A;  1TK0 A;  3OYM A;  3C7N A;  1MA9 B;  3KKR A;  1VSL A;  4MDB A;  4CJW A;  5JIC A;  2RHK A;  2O8B A;  1XC9 A;  3CC2 N;  3VGM A;  4CD1 A;  5E26 A;  4BRQ A;  2QWQ A;  3EEQ A;  5FPN A;  5HOO A;  4CZE A;  1J6Z A;  3OY9 A;  1JKH A;  1A5X A;  1UA0 A;  1JLF A;  4IOC L;  1KD1 O;  4FM1 A;  2FSK A;  1NBW A;  4RW6 A;  3RSE A;  3TSU A;  2YKN A;  4NCG A;  4AM6 A;  3QBW A;  4CHP A;  4JLH A;  1BA1 A;  4Z4C A;  1T05 A;  1S1W A;  4FJ9 A;  2ZF5 O;  3O4W A;  4CES A;  1WBD A;  1GLL O;  1D4X A;  3ZX3 A;  4GV3 A;  1NGC A;  4DFJ A;  4KI4 A;  3QLH A;  5JLH A;  3CCR N;  4AHU A;  3SAG A;  3V1O A;  1KVB A;  1RDD A;  4DV5 K;  3LAK A;  4JS4 A;  5KGW A;  5FRN A;  3IKM A;  1T44 A;  3P5J A;  4KTZ A;  2UXD K;  3MDQ A;  3TAF A;  1VHX A;  3L2Q A;  4X66 K;  4CED A;  3HPO A;  1JL2 A;  4M3R A;  3WXK A;  3VER A;  1HNZ K;  3J8A A;  4GVM A;  3J7Y P;  3THV A;  3O3G A;  2ZJP L;  1VQ9 N;  1GLA G;  4DR1 K;  2HMI A;  3OS0 A;  2FXU A;  1ATN A;  1BL3 A;  2IS3 A;  4FJM A;  4PUO A;  4AHT A;  4KHW A;  5HBM A;  3VEN A;  4N41 A;  3LZJ A;  5LL6 Z;  2XY8 A;  1IBM K;  4B9S A;  1HYV A;  2OPR A;  3WXL A;  5HP1 A;  3DMJ A;  4CZF A;  2E2P A;  1B92 A;  4BE2 A;  3VEY A;  4CBX A;  3M5R A;  1Z6R A;  3FZM A;  1A5V A;  4B8A B;  3QBX A;  3ZSR A;  4YOX A;  1KLM A;  3THY A;  5DM6 L;  4X62 K;  3QET A;  3RR8 A;  2D0A A;  4QS7 A;  5CY4 A;  1Q81 O;  2IOC A;  3HST B;  5AQL A;  3KK2 A;  4QOZ B;  1EWR A;  4FL9 A;  1RBR A;  3UE5 A;  1EO1 A;  3LP1 A;  1ATS A;  1HQU A;  2FBX A;  2BGG A;  1HJO A;  2ASM A;  3KK7 A;  5BR9 A;  5KRT A;  2IGI A;  2YV0 X;  3O8M A;  4C8M A;  2A41 A;  4BRO A;  3SV3 A;  1Q86 O;  1NK6 A;  2VYP A;  3KTQ A;  3RMA A;  1KAX A;  1S6Q A;  2UXB K;  1NKC A;  4DR6 K;  4O8U A;  4M7Y A;  4NLC A;  1M90 O;  4FWP A;  4JHD B;  3ZSQ A;  1L3T A;  1JLB A;  4OKK A;  1B9D A;  2F8T A;  4BG8 A;  2HBL A;  1KXP A;  4CGF A;  4BRG A;  3PSI A;  2QEX N;  3M8Q A;  2JGU A;  2P5G A;  4FW2 A;  1WSE A;  3TPQ A;  3NH2 A;  3DLL L;  1LCU A;  2NNW A;  4JS5 A;  4OGE A;  2AA4 A;  3QDK A;  3QIO A;  3SUQ A;  4CEF A;  1TAQ A;  1D5A A;  4H5W A;  4EP5 A;  3EKS A;  5LMN K;  3JAM O;  1WSJ A;  4DR2 K;  3RWU A;  4BWM A;  3EYZ A;  1KTQ A;  1XQS C;  3HL8 A;  3S41 A;  4OKJ A;  3AVN A;  4MO5 A;  3AGK A;  4KI6 A;  4BR0 A;  4GV9 A;  2X74 A;  2V52 B;  2GBZ A;  4DR7 K;  5M1F A;  2P9U B;  4DTN A;  3PX6 A;  1GLJ O;  4ZTF A;  3TR8 A;  3C65 A;  4FLY A;  2B6A A;  2Q3S A;  1Q9Y A;  2PYJ A;  3KD5 E;  5AFU A;  5J1E A;  1LW2 A;  5BN8 A;  2OTJ N;  4X64 K;  4JI3 K;  1U2V B;  2PFU A;  3VGK A;  1LW0 A;  4NCA A;  1XHX A;  3OYN A;  4Q5V A;  1HNX K;  1TL1 A;  3OYI A;  4ILJ A;  3CJ9 A;  4N47 A;  5M1Q A;  1NM1 A;  3ULD A;  3VPZ A;  3V81 A;  4B9L A;  4RWT A;  4Y1C A;  4KTQ A;  1RT2 A;  1HJR A;  3FZK A;  4H8K A;  2HBK A;  3O1B A;  3NF9 A;  4CIE A;  4DSE A;  3O3F A;  1EKE A;  4LFB K;  4M41 A;  3VEW A;  4CJP A;  3BZC A;  3SQ0 A;  1YI2 N;  4DCH A;  2Z1I A;  3RRG A;  4ELU A;  2F96 A;  1G99 A;  1IG8 A;  1C0G A;  4JKH A;  3MMV A;  4FLU A;  3KKS A;  2A3Z A;  1N33 K;  2JWK A;  5JVG L;  3CCL N;  3AO4 A;  3B6O A;  1L3V A;  1LV5 A;  2UXC K;  3PV8 A;  3DRP A;  1B9F A;  3F9K A;  3G71 N;  4KHP K;  4F8R A;  4C1N I;  5GAG P;  5BPM A;  3EZW A;  1BI4 B;  1SQK A;  3NF7 A;  3K57 A;  3T7Z A;  2ZWH A;  1YAG A;  1SV5 A;  4JHD A;  3VF6 A;  1KC8 O;  4B1U B;  4DV2 K;  3D2F B;  3NF6 A;  3FFK B;  2Y1I A;  2O8E B;  1VSM A;  2DFH A;  1OH7 A;  4CHQ A;  2YNG A;  1JXE A;  4LF5 K;  4CJ7 A;  5C2D A;  3ULE B;  4GVE A;  4JKB A;  4BRE A;  1YIJ N;  1NKB A;  4LF7 K;  5TKW A;  3TAP A;  4B9N A;  3R1X A;  1BA0 A;  4Z0U A;  2WUS A;  4FWK A;  4IBN A;  4Z4H A;  4A61 A;  4GW6 A;  2VQE K;  2NRH A;  2BTF A;  5I42 A;  3L4Q A;  4YOV A;  4PKH A;  1NK7 A;  1Q9X A;  4LC9 B;  4DSI A;  3TWH A;  3SBT A;  3HP6 A;  4WFB L;  1N36 K;  1EWQ A;  2NUB A;  3SJH A;  1NGG A;  2ZM6 K;  1GLC G;  1YXQ A;  1HMV A;  5F0X A;  3HT3 A;  1P8Z A;  5GIN A;  2P9U A;  3VQC A;  2BUP A;  3AVG A;  3H1V X;  4BRL A;  3G4S N;  3SQ1 A;  3VA0 A;  2QXL A;  3R9P A;  4E1N A;  3VES A;  3VQ6 A;  1U2V A;  1JLE A;  1JCF A;  1IJJ A;  4B08 A;  3CF5 L;  4E1M A;  1RT4 A;  3DXK A;  3E1Y A;  2A1S A;  1WBB A;  4E19 A;  1VQ6 N;  3N4Q A;  1QHA A;  3I55 N;  3C0B A;  2HW3 A;  3ATV A;  3MEE A;  4PKG A;  1W0H A;  1HYS A;  3M1F A;  2CGK A;  1YT3 A;  2CGL A;  1FKO A;  3F5T A;  1WSG A;  1LOT B;  1NGF A;  4NXN K;  3A5M C;  4FLZ A;  2WON A;  4FW1 A;  4DV4 K;  2D4W A;  1YUW A;  3P38 A;  3VTH A;  5C2F A;  3KWG A;  3ISN C;  1T6D A;  2HNY A;  4ISE A;  5GIO A;  3BGR A;  3SYZ A;  4OPJ A;  3DLH A;  4B9U A;  1VQM N;  1VSH A;  3WQT A;  2D0B A;  2KQ2 A;  4E1J A;  2Y1J A;  4DSJ A;  3LAN A;  1HKB A;  1RBU A;  3A5L C;  5AQH A;  3KZB A;  4B9M A;  5GIP A;  3SQ2 A;  4HCB A;  4UQG A;  1X9J A;  4DSK A;  1QQC A;  3K2P A;  3LL3 A;  4FM2 A;  2P9L B;  3NMU A;  2BE2 A;  1RDW X;  3ENB A;  1BI4 A;  4CE9 A;  2YKM A;  4HWI A;  4MLE A;  3ZT1 A;  1EET A;  1HKC A;  4FWR A;  4I6M B;  4I7F A;  1TVR A;  1WAJ A;  5DK5 A;  1VSD A;  3D2F A;  3LM2 A;  4KO0 A;  3SUP A;  1QTM A;  5LJW A;  2QWL A;  3VF4 A;  2VGM A;  4R5P A;  2DPN A;  1X9S A;  4BRD A;  4IG3 A;  1ZC6 A;  3QIN A;  2YHY A;  2P5O A;  3AA2 A;  3V1R A;  4LH5 A;  3VQA A;  3AO5 A;  3AVM A;  3CQY A;  3ZSO A;  2NZT A;  5AQG A;  3SZ2 A;  4CJU A;  1CXQ A;  1QQM A;  4DTU A;  1XMO K;  4RW8 A;  2E2O A;  1REV A;  2VWJ A;  3DLR A;  3K5N A;  1ZBH A;  1KVA A;  3PIO L;  3MED A;  2YJE A;  1HLU A;  4FK4 A;  3ZSX A;  5F1X A;  2KLA A;  5K14 A;  5C10 A;  3W3D A;  4JRQ A;  2VWB A;  5AQZ A;  4DUZ K;  3EE8 A;  1X9M A;  1RDA A;  3VQ5 A;  4F3T A;  1S1T A;  3PLA A;  4BDP A;  4RW4 A;  1OH8 A;  4K25 A;  2HVI A;  3R6M A;  4DTO A;  3BF3 A;  5BRE A;  1K8A O;  4IXC A;  3DOK A;  1DTQ A;  5C15 A;  1S72 N;  3OJS A;  3AAQ A;  2PBD A;  4M45 A;  4GKK K;  3HP9 A;  4OVL A;  3O80 A;  5CR4 A;  5AQK A;  4CJS A;  2IC3 A;  4CEO A;  4TSX A;  5AQW A;  4C8L A;  4H4O A;  1RT3 A;  1V4T A;  4B9Q A;  3WXJ A;  4JEP A;  3CCU N;  3DM2 A;  4CZH A;  1IKX A;  5CYM A;  4FK0 A;  1TGO A;  3C95 A;  5EY4 A;  3S3O A;  4E7K A;  3A5N C;  1BOT O;  5C25 A;  3S3M A;  1DKG D;  4BRM A;  4BC5 A;  4R79 A;  4G9Z A;  3CCM N;  2KTQ A;  3U3Y A;  4I9Q A;  1HUX A;  1J54 A;  4CF8 A;  3LP2 A;  4CEE A;  1Y64 A;  4DV6 K;  1NGI A;  3T3F A;  3WXI A;  3BF1 A;  4OO1 J;  5AQI A;  3TAR A; 
#chains in the Genus database with same CATH homology
 2OPS A;  2YNI A;  4CF9 A;  4N41 A;  1S9G A;  5HRR A;  3LZJ A;  1RT7 A;  3OYD A;  2KW4 A;  2XY8 A;  4OLB A;  3OS2 A;  4CJ5 A;  1BQN A;  3UIQ A;  3L2W A;  1HYV A;  2OPR A;  2G8K A;  1NK0 A;  4B9S A;  4KAZ A;  4M3W A;  4QCL A;  5HP1 A;  4DTS A;  3DMJ A;  4CJR A;  2KFZ A;  2HHQ A;  1B92 A;  4BE2 A;  1S1X A;  1X1P A;  2FBT A;  4IDK A;  4CF2 A;  4NYN A;  5FRO A;  2OPQ A;  1L3S A;  5SZT A;  2DTU A;  3AO3 A;  1C0U A;  1JL1 A;  1A5V A;  4B8A B;  5HRP A;  1BIS A;  3MEC A;  1HPZ A;  4KRE A;  3ZSR A;  2ITG A;  3K5L A;  3RRH A;  2FBY A;  5KRS A;  4W5O A;  4C8K A;  1KLM A;  3O4N A;  4O44 A;  2QKB A;  5FRM A;  1GOB A;  5J2M A;  3VQ9 A;  4QAG A;  3QET A;  3ZSW A;  3RR8 A;  4M3Z A;  2D0A A;  1Z25 A;  2IAJ A;  3U3G A;  3CM6 A;  5CY4 A;  3T1A A;  2IOC A;  3HST B;  4DQQ A;  3TI0 A;  3KK2 A;  4QOZ B;  4JRP A;  2B5J A;  1RBR A;  4FLV A;  4FJX A;  3OS1 A;  4XIU A;  4O55 A;  3KLF A;  3TAB A;  2F8S A;  3LP1 A;  3QES A;  5HRO A;  1HQU A;  4I2P A;  3OYK A;  2FBX A;  4HUF A;  2BGG A;  3KK3 A;  1Y97 A;  3SUO A;  2HHX A;  3PX4 A;  1NK5 A;  1RTJ A;  2KZM A;  2BAN A;  3NGI A;  1KRP A;  3C6T A;  4WE1 A;  1IH7 A;  1U45 A;  4EZ6 A;  4DG1 A;  5KRT A;  2IGI A;  1WSI A;  2YV0 X;  1S1U A;  4C8M A;  3VQB A;  3SV3 A;  1TK5 A;  1NK6 A;  1YTU A;  3KTQ A;  1N6Q A;  3HO1 A;  3TAM A;  3RMA A;  1J9A A;  3D45 A;  1S6Q A;  2R7Y A;  1SL1 A;  1NKC A;  4ELT A;  4OGC A;  5KGX A;  4FJ5 A;  4CFA A;  4Z4E A;  3P83 D;  4CJT A;  1BIZ A;  4DWI A;  2HHU A;  4DLE A;  1T8E A;  3ZSQ A;  2P1J A;  3LWL A;  1XI1 A;  4HHT A;  1C6V A;  1JLB A;  1Q8I A;  1L3T A;  3QEX A;  4OKK A;  4FK2 A;  4M3T A;  3HJF A;  4E0D A;  1J5O A;  3ASM A;  1W9H A;  4CEC A;  1B9D A;  5J2P A;  2F8T A;  2D0C A;  3C94 A;  4F2R A;  4PA1 A;  2KZZ A;  3OVN A;  4CGF A;  4FJ8 A;  1LWE A;  1DLO A;  1S6P A;  4RG8 A;  3V9U A;  4YNQ A;  1UA1 A;  3M8Q A;  2JGU A;  2P5G A;  1FK9 A;  4FW2 A;  4M3Y A;  1EX4 A;  4MFB A;  1WSE A;  4CEZ A;  3SNN A;  2FC0 A;  4O5B A;  3NH2 A;  4JS5 A;  4OGE A;  2B4J A;  4CK2 A;  3E01 A;  1SKR A;  3OJU A;  1RDC A;  3QIO A;  3V1Q A;  3SUQ A;  1BHL A;  3AVJ A;  4CGI A;  4CEF A;  4CJQ A;  3OYJ A;  3AVH A;  2HHS A;  3IS9 A;  1D5A A;  1TAQ A;  3CM5 A;  3LP0 A;  4EP5 A;  3S3N A;  1WSJ A;  2HHW A;  3OYL A;  3RWU A;  4BWM A;  3EYZ A;  1KTQ A;  3HL8 A;  1D9F A;  4OKJ A;  1HNV A;  1FXX A;  1I3A A;  3AVN A;  4CJE A;  4HCC A;  3DLG A;  3ZSV A;  4KI6 A;  1TKX A;  2O4G A;  4H4M A;  4E3S A;  4KHQ A;  1CLQ A;  2X74 A;  3G0Z A;  4I2Q A;  3NF8 A;  2GBZ A;  3BDP A;  3VQ7 A;  3HK2 A;  4ICL A;  4DTN A;  3PX6 A;  4ZTF A;  1LWC A;  3TR8 A;  4AHR A;  3NH1 A;  3AVI A;  4CIF A;  4CJK A;  4FLY A;  2B6A A;  2JLE A;  3OYH A;  1EXQ A;  2Q3S A;  4O0I A;  4W5T A;  4E7I A;  1Q9Y A;  1QSY A;  1TV6 A;  2PYJ A;  3KD5 E;  3RTV A;  5J1E A;  4KFB A;  1LW2 A;  2FBV A;  4I9L A;  3P1G A;  4KHN A;  3AA5 X;  3AVB A;  4DS4 A;  1KFD A;  2OPP A;  1ITG A;  1BGX T;  1LW0 A;  2DFF A;  4NCA A;  1XHX A;  3QNO A;  4CIG A;  4DLG A;  2VG7 A;  3T19 A;  3OYN A;  4Q5V A;  2XY7 A;  5CZ2 A;  3CFP A;  1TK8 A;  2ZE2 A;  1TL1 A;  3AA4 A;  3LP3 A;  4EP4 A;  3OYI A;  4N47 A;  3WNG A;  3LAL A;  1JXB A;  4IG0 A;  1IKW A;  2Z1H A;  3RR7 A;  4CGG A;  3ULD A;  1SKW A;  4DTJ A;  2RF2 A;  4IFY A;  3V81 A;  4B9L A;  4Y1C A;  3AVC A;  4KTQ A;  1RBT A;  1RT2 A;  1SUQ A;  1HJR A;  3QIP A;  3L2R A;  4KHY A;  1LAV A;  3HM9 A;  4Y1D A;  4H8K A;  4AH9 A;  4F4K A;  4FJH A;  1WN7 A;  2WOM A;  2ZQB A;  3KLE A;  2XY6 A;  4FJJ A;  4ID5 A;  1RBV A;  5I3U A;  4BAC A;  3NF9 A;  1NK4 A;  4CIE A;  1L3U A;  3B6P A;  4K8X A;  4FJ7 A;  4DSE A;  2VG5 A;  1QE1 A;  4FZZ A;  3O3F A;  1ZYQ A;  1EKE A;  4BDY A;  4ZTJ A;  3HVT A;  3VQ8 A;  4M41 A;  3EZ5 A;  4IFV A;  4CJ3 A;  4CJP A;  3DRR A;  4FJK A;  3MAQ A;  4J2D A;  3SQ0 A;  1IKV A;  2Z1I A;  1QSS A;  3RRG A;  3M8P A;  4ELU A;  2F96 A;  3QER A;  4CEB A;  3L2V A;  4J2E A;  1ASV A;  5CZ1 A;  4CK3 A;  3NAE A;  3HPH A;  1EP4 A;  4IKF A;  3OYA A;  4MQ3 A;  4FLU A;  1U49 A;  3AVA A;  3KKS A;  3FFI A;  3SI6 A;  1WAF A;  1NKE A;  4B9T A;  1KSP A;  2RN2 A;  4FYD A;  1J53 A;  2G8F A;  3AO4 A;  1S1V A;  3B6O A;  1L3V A;  4DQI A;  1LV5 A;  4KV8 A;  3PV8 A;  1D8Y A;  4BDZ A;  2DFE A;  1TKZ A;  3DRP A;  1B9F A;  3F9K A;  3K5O A;  4O0J A;  3AA3 A;  4DTP A;  1S5J A;  4DQR A;  4CJV A;  2ZD1 A;  4LY7 A;  1UWB A;  1RNH A;  1RT6 A;  3NCI A;  3NGY A;  1JLC A;  5C42 A;  4F8R A;  4PQU A;  1TL3 A;  3PY8 A;  4CF1 A;  3IAY A;  4F2S A;  3D0P A;  1BI4 B;  4E7J A;  3NF7 A;  1NOY A;  3K57 A;  3V9X A;  1GOC A;  1C0M A;  3HPG A;  1SV5 A;  2Z1G A;  5J2N A;  4K8Z A;  1VSE A;  2P51 A;  5CYQ A;  3NF6 A;  1ASU A;  5HLF A;  3SCX A;  4NYF A;  4E7L A;  2Y1I A;  1VSM A;  2DFH A;  1RCH A;  3DYA A;  1QHT A;  4ID1 A;  3ZSY A;  4CHQ A;  1NJX A;  2YNG A;  4CCH A;  1JXE A;  3ZT4 A;  3AO1 A;  1ASW A;  3O4Q A;  4N5S A;  4DF4 A;  3CYM A;  3PUF A;  5JS2 A;  4CHY A;  4ELV A;  4HUE A;  3WNH A;  4KHS A;  3KIO A;  3HYF A;  4FZX C;  1NKB A;  2YHA A;  2Z1J A;  4F3O A;  4LSN A;  3OYG A;  2QKK A;  4NCB A;  3IRX A;  4FLX A;  1BCO A;  3TAP A;  4DMN A;  2XY5 A;  4B9N A;  4FJG A;  4DU1 A;  4Z0U A;  2XRI A;  4BE0 A;  3KJV A;  1KFS A;  4IBN A;  4Z4H A;  5DMR A;  3V9Z A;  1D9D A;  1WLJ A;  4J2A A;  4GW6 A;  4PWD A;  4AIL C;  5EU7 A;  3SJJ A;  4KB1 A;  5I42 A;  4CGD A;  4KPY A;  2VWK A;  3PX0 A;  5KTQ A;  4FVM A;  4M3U A;  1NK7 A;  1Q9X A;  4HTU A;  3TAE A;  4Z4G A;  3KLG A;  4DSI A;  4FZY A;  3TWH A;  3HP6 A;  4C8O A;  2LSN A;  2NUB A;  2YHB A;  3CFO A;  4CGH A;  3QEV A;  3OYC A;  1VRT A;  4J2B A;  2G8I A;  4DQS A;  4W5R A;  1HMV A;  3HT3 A;  4DU3 A;  4CHO A;  3AVL A;  2E6L A;  3SV4 A;  3VQC A;  3KLI A;  3L2U A;  4EZ9 A;  3AVG A;  4CEA A;  1XHZ A;  1VSJ A;  3SQ1 A;  1KLN A;  4DSL A;  3VA0 A;  3TAG A;  3MXM A;  1C1B A;  1WSF A;  4B3O A;  2DY4 A;  4E1N A;  3S9H A;  4Z4F A;  1T03 A;  1G15 A;  1HRH A;  3VQ6 A;  1T7P A;  3QNN A;  1JLE A;  4DU4 A;  1RTD A;  2QXF A;  5HRS A;  2PZS A;  4B08 A;  1NJW A;  3DOL A;  4FJI A;  4E1M A;  1RT4 A;  3V9W A;  4AHC A;  1SKS A;  2A1S A;  2G8V A;  4E19 A;  2RKI A;  2X6N A;  1RTH A;  4YFU A;  3NH0 A;  4DS5 A;  4FCY A;  4KRF A;  3DLB A;  2HW3 A;  3MEE A;  3VA3 A;  1W0H A;  4ZHR A;  1TKD A;  1HYS A;  5C24 A;  3PO5 A;  3V6D A;  1U47 A;  4CK1 A;  1YVU A;  2EX3 A;  1YT3 A;  3NFA A;  3CFR A;  4FJN A;  1SL2 A;  1FKO A;  1Z26 A;  2BDP A;  1WSG A;  1MU2 A;  4CER A;  2X6S A;  2X78 A;  1NJZ A;  4W5N A;  1BQM A;  1K6Y A;  4CF0 A;  4W5Q A;  1QS4 A;  4KKO A;  4FXD A;  4RW7 A;  4FLZ A;  2WON A;  4FW1 A;  5D3G A;  3O3H A;  4DTM A;  4CJ4 A;  5FDL A;  2GUI A;  4O4G A;  1TKT A;  3DI6 A;  4OKE A;  1DTT A;  1RT5 A;  2OZS A;  3QO9 A;  2HHT A;  1TAU A;  1JLG A;  1VSI A;  3OYB A;  1RBS A;  3JYT A;  4DFP A;  3ISN C;  2YNF A;  1HQE A;  1A5W A;  1BIU A;  1RIL A;  2HNY A;  2G8U A;  4KB0 A;  2KFN A;  3BGR A;  3LDS A;  3ZCM A;  3F73 A;  3SYZ A;  2VG6 A;  4DTR A;  4OPJ A;  3DLH A;  4B9U A;  1VSH A;  3HXM A;  2D0B A;  2KQ2 A;  1VK0 A;  4CHN A;  1RT1 A;  2D5R A;  2RPI A;  3VQQ A;  2Y1J A;  2ETJ A;  1IKY A;  3LAN A;  2XO7 A;  2YNH A;  2PYL A;  4BE1 A;  4DSJ A;  3WNF A;  3LZI A;  1RBU A;  3IG1 A;  4DFK A;  2HVH A;  1QSL A;  1NK9 A;  4LH4 A;  1X9W A;  1L5U A;  1IO2 A;  4B9M A;  3OYF A;  3SQ2 A;  4HCB A;  1JLA A;  1C1A A;  5KI6 A;  4UQG A;  2W42 A;  3DLE A;  3DRS A;  4B8C A;  1QQC A;  1CXU A;  3K2P A;  3KK1 A;  4HVJ A;  4FM2 A;  3SPZ A;  4DSK A;  2QK9 A;  2BE2 A;  3K5M A;  5HRN A;  3QEI A;  3VQE A;  1BI4 A;  3L3V A;  3ZT2 A;  4CE9 A;  3HVR A;  1ZBF A;  4CEQ A;  2YKM A;  3QEP A;  1WSH A;  1BCM A;  3ZT0 A;  1SL0 A;  1C1C A;  1RTI A;  1XWL A;  4DQP A;  3DLK A;  3ZT1 A;  1EET A;  4I7F A;  1ZBU A;  3TAQ A;  2G8H A;  1TVR A;  1WAJ A;  5DK5 A;  1VSD A;  4C8N A;  4KO0 A;  3SUP A;  3NDK A;  3MXJ A;  1QTM A;  4KTW A;  1HNI A;  1I39 A;  3NBP A;  4AHV A;  3AO2 A;  4CFD A;  4CFC A;  3NGZ A;  4E7H A;  3VN5 A;  3M8R A;  4BWJ A;  3NE6 A;  1VSK A;  4R5P A;  3RMD A;  1X9S A;  3L8B A;  4IG3 A;  1GOA A;  3QIN A;  3AV9 A;  1RDB A;  2P5O A;  4DTX A;  3AA2 A;  3V1R A;  4LH5 A;  1ZBL A;  4OLA A;  2HB5 A;  3VQA A;  4AHS A;  4OPK A;  3AO5 A;  3AVK A;  3AVM A;  3K58 A;  1NK8 A;  4M3X A;  1FKP A;  3ZSO A;  3AVF A;  1UOC A;  1YTA A;  1R0A A;  3LPU A;  4RW9 A;  3SZ2 A;  3MXI A;  4CJU A;  1TK0 A;  4N76 A;  1NOZ A;  1CXQ A;  3OYM A;  3H08 A;  4DTU A;  1VSF A;  4RW8 A;  3KKR A;  1VSL A;  1REV A;  3G10 A;  4CJW A;  2VWJ A;  3DLR A;  3K5N A;  1ZBH A;  1XC9 A;  1KVA A;  1UAX A;  3KD1 E;  4DFM A;  1U04 A;  4B9V A;  3MED A;  5J2Q A;  2A1R A;  5SWM A;  3I0R A;  4FK4 A;  3ZSX A;  5K14 A;  1U4B A;  4JRQ A;  1LWF A;  2E6M A;  3SUN A;  1IG9 A;  3TAN A;  2HHV A;  4HUG A;  3OY9 A;  3PO4 A;  1JKH A;  1A5X A;  1X9M A;  1UA0 A;  3RMC A;  3V4I A;  1JLF A;  1RDA A;  4GMJ B;  3VQ5 A;  4CFB A;  1S1T A;  4E89 A;  3U6F A;  4BDP A;  1U48 A;  4RW4 A;  3JSM A;  3K59 A;  4FLT A;  2HVI A;  4DTO A;  4FM1 A;  4FJL A;  3VQ4 A;  4RW6 A;  2IDO A;  3DOK A;  1DTQ A;  2YKN A;  4CJF A;  2GV9 A;  3I8D A;  3KLH A;  4NCG A;  3OJS A;  2G8W A;  2OA8 A;  3ITH A;  4CHP A;  4JLH A;  1CZ9 A;  2OYQ A;  4Z4C A;  1T05 A;  1S1W A;  3C6U A;  4LSL A;  4FJ9 A;  1ZBI A;  3ALY A;  4FLW A;  4M45 A;  3WNE A;  4CES A;  4CJL A;  4L8R B;  3HP9 A;  4OVL A;  4DFJ A;  1LAW A;  4PY5 A;  3V9S A;  1C0T A;  4CJS A;  1KVC A;  4KI4 A;  2IC3 A;  2O4I A;  3A2F A;  3QLH A;  4TSX A;  4CEO A;  4AHU A;  2XHB A;  4C8L A;  2AJQ A;  3RMB A;  4H4O A;  4DSF A;  3OYE A;  2OZM A;  3V1O A;  1RT3 A;  4KHU A;  1KVB A;  1RDD A;  3LAK A;  3VQD A;  4JS4 A;  4FM0 A;  5KGW A;  5FRN A;  4F3T A;  3L3U A;  3DM2 A;  4G1Q A;  3CG7 A;  3P5J A;  1IKX A;  4KTZ A;  5CYM A;  4FK0 A;  1TGO A;  3C95 A;  3I0S A;  5JS1 A;  4OJR A;  2EHG A;  3ZSZ A;  3S3O A;  3TAF A;  4CHZ A;  3NHG A;  3L2Q A;  5T7B A;  4E7K A;  3SPY A;  4CED A;  3HPO A;  3M8S A;  5C25 A;  3S3M A;  2E4L A;  2I5J A;  1JL2 A;  1F21 A;  4M3R A;  3VQP A;  1KCF A;  2KTQ A;  2ATQ A;  2HND A;  3U3Y A;  4I9Q A;  1O1W A;  4GVM A;  4CGJ A;  3CQ8 A;  3THV A;  3O3G A;  4CF8 A;  1J54 A;  4LD0 A;  3LP2 A;  4CEE A;  5E41 A;  1WNS A;  3ZT3 A;  3MEG A;  2HNZ A;  1NJY A;  3LPT A;  3LWM A;  2HMI A;  4Z4I A;  3OS0 A;  1HYZ A;  1S9E A;  1JLQ A;  1N5Y A;  3LAM A;  2PY5 A;  3T3F A;  1BL3 A;  1CZB A;  2IS3 A;  3QEW A;  4FJM A;  3EY1 A;  4PUO A;  4M42 A;  4Q0B A;  4N56 A;  4DF8 A;  3SQ4 A;  4AHT A;  4KHW A;  1VRU A;  5HBM A;  3TAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...