4OKKA

Crystal structure of rnase as from m tuberculosis in complex with ump
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
160
structure length
160
Chain Sequence
VRYFYDTEFIEDGHTIELISIGVVAEDGREYYAVSTEFDPERAGSWVRTHVLPKLPPPASQLWRSRQQIRLDLEEFLRIDGTDSIELWAWVGAYDHVALCQLWGPMTALPPTVPRFTRELRQLWEDRGCPRMPPRPRDVHDALVDARDQLRRFRLITSTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3'-5' exoribonuclease Rv2179c/MT2234.1
publication title Structure and Function of RNase AS, a Polyadenylate-Specific Exoribonuclease Affecting Mycobacterial Virulence In Vivo
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 52
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2014-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4okkA00
4CFBA 1RDAA 3QIOA 4FZYA 1BISA 1BQNA 4CEAA 2YHAA 2P1JA 3CG7A 4RW9A 4FM2A 1NJZA 1WAJA 4LD0A 3KKSA 4DQRA 3QERA 5FRNA 1VRTA 4DTSA 3L8BA 5HLFA 1WAFA 1IKXA 1Q9XA 3KJVA 3L2RA 3NGIA 4B9LA 4Z4GA 4CF8A 3HL8A 4BDZA 3DRRA 2HW3A 4KTZA 4KRFA 1RTJA 4FLXA 3THVA 1T05A 4KHUA 1TKTA 1TKXA 1UOCA 4Y1CA 3ALYA 3NF6A 5CZ1A 3VQPA 3SUQA 4PWDA 4GW6A 1FXXA 2Z1GA 3QETA 4I2PA 3KLHA 3VQEA 3QESA 2X6NA 3AO5A 3ZSYA 4CGFA 4DSLA 4E7KA 1XWLA 4O0IA 3SQ0A 1KVAA 1REVA 1VSHA 4IG0A 1WSIA 3T3FA 1A5VA 1EX4A 3AVFA 3SZ2A 4IFYA 3AA3A 5KRSA 4F2RA 3RMAA 4O0JA 1VSKA 3LPTA 4G1QA 5EU7A 4DSFA 3V4IA 2XY6A 1C0MA 3VQBA 1DTQA 3HPOA 4CJUA 2KTQA 4CHNA 3DLHA 3TAFA 3AVJA 2BGGA 1BI4B 1TKZA 1RTDA 2OZSA 3OS0A 1JLFA 1GOBA 1W0HA 1NKBA 3SQ4A 1U49A 1B9FA 5CYMA 4PUOA 1IH7A 3VQQA 1KTQA 3AVLA 1S5JA 3NE6A 3RRGA 1EXQA 4J2DA 1S1XA 3DLEA 1J53A 4HCBA 3AA5X 2Z1IA 4FXDA 3QNOA 4CHZA 3HT3A 1Q9YA 3LDSA 2PY5A 3DOLA 4FM1A 2IOCA 1C1CA 4QAGA 3PX4A 4E7HA 2VG7A 3OYHA 4BE2A 3AO1A 3HP6A 3VQDA 3CFOA 4BACA 4XIUA 3O3FA 1L3UA 3VQ5A 4Z4CA 3EZ5A 4DTXA 1RDDA 2OPPA 2WONA 3HPGA 3JSMA 1J5OA 2ZQBA 4FM0A 4B9SA 1BHLA 1KFSA 1ZYQA 2IAJA 1NK9A 3LPUA 5HBMA 5SWMA 4ELVA 1KRPA 1RBTA 4OJRA 2RN2A 3V9ZA 3PO4A 4FJIA 4QCLA 4Z0UA 4DTNA 3SNNA 4CCHA 3CYMA 2GV9A 3G0ZA 3O4QA 1ASWA 2RPIA 3UIQA 4NCAA 2X78A 3L3UA 3HPHA 4CJSA 3TAMA 3ULDA 3NFAA 3NH2A 3U3YA 4FJLA 1BQMA 4FJ7A 3SPYA 1YTUA 3DRSA 2D0BA 3NHGA 3LAKA 4ICLA 4CEFA 3AVCA 3SV4A 1SKSA 4Z4IA 4Z4HA 1T7PA 3QINA 3V9WA 3RR7A 4HHTA 4RW6A 3AO3A 4FYDA 2JLEA 1BCOA 3DLRA 1KVBA 4CIGA 1NJWA 3QLHA 4F3OA 2F8SA 4ELUA 4CJVA 3LP0A 4BE1A 4RW8A 2E4LA 3DYAA 4M45A 3E01A 3B6PA 3ZT2A 3U6FA 4Q0BA 1S1UA 1BI4A 3MXMA 3ITHA 4K8ZA 4Y1DA 2P5GA 1C1BA 1Y97A 3KLIA 3K58A 3KKRA 3AVMA 4HUGA 4DQPA 4CEZA 3RWUA 2HVIA 1JXBA 2FBXA 3OYJA 1RT6A 1TL3A 1B9DA 3DRPA 4OKEA 4PA1A 4I9LA 2PYJA 3L2VA 5I42A 4DU3A 4HUFA 4ZTJA 1ASVA 3OYDA 3OYCA 1N6QA 3AA2A 4DTPA 1JLBA 3KD5E 3NH0A 3QIPA 2DY4A 4FLWA 3RMCA 3HVRA 3MEDA 3HYFA 3TAEA 1I3AA 4C8KA 1W9HA 3M8RA 3M8SA 4OGCA 4AILC 4B9VA 2QKKA 1KLNA 3MXJA 3VQ6A 4CGJA 4CJTA 2YKMA 1NK6A 4KB0A 4KPYA 1I39A 4EP4A 1S6QA 1UAXA 3TWHA 2ATQA 1NK4A 3PUFA 4AHCA 3F73A 2IDOA 4F2SA 3PY8A 4KREA 3VQCA 3V9SA 4CJ3A 4CHQA 1JLQA 4OGEA 1UA1A 4DU4A 4CF2A 4FJJA 1N5YA 4Z4FA 2ITGA 4W5NA 3DLKA 3L2UA 2G8FA 1ITGA 2YV0X 3CFPA 4OPJA 4JRPA 4FK4A 1O1WA 4O4GA 2O4IA 5FDLA 3VA3A 1VSEA 3V9UA 5HRNA 4J2EA 1G15A 3V1RA 4CF9A 1NK5A 2XRIA 3K5LA 1CZ9A 4N41A 3OYKA 3TABA 1SKRA 1VSMA 3NAEA 2BE2A 3OJUA 3DLBA 2YNHA 3NBPA 1KLMA 3ZT1A 3LP1A 1QSLA 4LSNA 1S1VA 3ZCMA 3EYZA 3OYLA 3NGZA 4CK2A 2A1RA 1CXUA 4FLTA 2QK9A 5C25A 4JS5A 4OVLA 4FLYA 4FZZA 2FC0A 1NOYA 1IKWA 1NKCA 3P5JA 3WNHA 1HQEA 4W5QA 4FK2A 3SJJA 3EY1A 1HPZA 3M8QA 2P5OA 4DMNA 5J2NA 1LV5A 3SQ2A 1X9MA 3KTQA 2GBZA 3C6TA 1WSGA 4FJ5A 2G8WA 3IRXA 2XHBA 4B8CA 1L5UA 4CK3A 2HNDA 1B92A 4LH5A 2IC3A 1HNVA 2ETJA 4MQ3A 3RRHA 4I9QA 1ZBLA 1TVRA 1YVUA 3KK1A 4M41A 1WSJA 4W5OA 3K5MA 3CM5A 4FLZA 1UWBA 1U04A 3ZSQA 1QSYA 2ZD1A 4IG3A 3S9HA 4CFCA 3OYIA 4CJ5A 5K14A 2BDPA 2DTUA 1QTMA 4H4MA 3L2WA 1QQCA 2YNGA 3S3OA 4Q5VA 4GVMA 4KHNA 3KK2A 1WLJA 2D0CA 2DFFA 2WOMA 4FJHA 3BGRA 3I0RA 5KRTA 1U47A 5HRRA 3V9XA 3C6UA 2LSNA 1WSFA 2D5RA 1XC9A 3C95A 4TSXA 3ZSRA 3SI6A 1KSPA 4FJNA 3OS1A 5HRPA 4EZ6A 1C0UA 4FJ8A 4M3ZA 3DMJA 4DSKA 2XY5A 2FBVA 1LAVA 5KGXA 4CJFA 4B3OA 2OPQA 2HHQA 3CQ8A 5HP1A 4Z4EA 4ELTA 1RT7A 2G8KA 2NUBA 3AV9A 4E7LA 4DTOA 3RMBA 2VG6A 4J2AA 1S9EA 3H08A 2HHTA 3RR8A 2E6LA 1TV6A 4F4KA 4CGGA 3SCXA 2PYLA 4FLVA 1NKEA 1RCHA 4FK0A 2Y1IA 3DOKA 3VQ9A 4CEOA 1D9FA 3RMDA 3SYZA 1YTAA 1JL2A 3FFIA 4K8XA 4E3SA 1R0AA 1RT1A 5SZTA 5DK5A 4KB1A 4J2BA 3AO4A 5J2PA 3SQ1A 1LAWA 3ZSZA 1F21A 4KO0A 2OYQA 4B08A 3KLEA 3DM2A 3QO9A 1TK0A 2Z1JA 3QEIA 3K5OA 3V1QA 2XY8A 3LANA 4O5BA 5C24A 1L3TA 1JL1A 3DLGA 1Z25A 1QS4A 4OKJA 4B9MA 1S9GA 2B5JA 3K5NA 4GMJB 3OYAA 1DLOA 3TAGA 3OYNA 1WNSA 3OYBA 1GOAA 2XY7A 1ASUA 3A2FA 3VQAA 4NCGA 1EKEA 5J2MA 1SKWA 3K59A 4E7IA 3CM6A 3BDPA 4RW7A 3VQ4A 3LALA 4KHSA 1JKHA 1A5WA 3AVBA 3NCIA 1X9SA 2KZMA 2HMIA 1IO2A 4JLHA 3LZIA 4CJEA 4KI4A 4M3WA 3VQ8A 3T19A 2OZMA 1JLGA 3VN5A 4L8RB 1U45A 4CF0A 4B9TA 5JS2A 2HNYA 1XHZA 4CK1A 4I7FA 4CF1A 4IFVA 4DSIA 2IGIA 2R7YA 4I2QA 1VSFA 3ZSOA 4CJQA 4KTQA 1NJXA 4M3TA 1RNHA 3ZSXA 1QSSA 4YNQA 3C94A 2I5JA 1LW0A 4CGIA 4DFKA 1UA0A 1RDCA 1RBSA 4CEBA 1Z26A 3MEGA 4DTRA 1RDBA 3NGYA 3OVNA 1TAUA 4AHRA 1D9DA 3IAYA 3NF8A 3LAMA 3LP2A 5DMRA 1U4BA 1D8YA 1RTIA 1NK7A 3AVHA 1HYZA 3V6DA 1SL0A 4CJPA 4DTMA 2OA8A 1RILA 2JGUA 4N56A 4N5SA 4HCCA 5FRMA 3OYEA 2QXFA 1NK8A 3PV8A 1TKDA 4KAZA 4KI6A 5J2QA 1L3VA 1VSDA 1RT3A 1YT3A 3M8PA 4NYFA 4CGDA 4CJKA 3L2QA 4DG1A 4FW2A 1Q8IA 3B6OA 4DS5A 2G8VA 1S6PA 4M3RA 2YKNA 3ZSWA 4OPKA 1VSLA 4AHTA 3NH1A 2G8HA 1VK0A 3DI6A 2HHWA 1SL2A 3HXMA 3G10A 3VA0A 5CZ2A 5J1EA 3SV3A 4CESA 4FJMA 4WE1A 4PQUA 3AVNA 4E0DA 1QE1A 1RT2A 3QEXA 2P51A 2YHBA 1C6VA 4MFBA 3ISNC 3S3MA 1ZBIA 1KCFA 1MU2A 2DFEA 5T7BA 3PX0A 4FVMA 3P1GA 4E1NA 2RF2A 4CEDA 4DF8A 1KFDA 1RBRA 1S1TA 3ZT4A 4CJLA 3LWMA 4F3TA 4CERA 2A1SA 4OLBA 3TARA 3TAPA 3HO1A 1LWCA 5HROA 1C1AA 1NOZA 1QHTA 3HSTB 2DFHA 4OLAA 1JXEA 4LH4A 4O44A 4FJKA 3D45A 1BCMA 2KW4A 2KFNA 1LWEA 1TGOA 2O4GA 3OYFA 3LZJA 1CLQA 4AH9A 4B8AB 4B9NA 4DWIA 1S1WA 2OPSA 5KGWA 3T1AA 2HHXA 3AVGA 1WN7A 4YFUA 3ZT0A 4AHSA 4CEEA 5I3UA 4FJ9A 2XO7A 3KK3A 3AO2A 1WSHA 1JLAA 4E7JA 4E19A 1X1PA 1FK9A 4CFAA 5C42A 3TANA 4PY5A 4DSJA 3NF7A 4W5TA 3QEWA 4ZHRA 3SUOA 3O4NA 3HP9A 4KTWA 3KLFA 4N47A 5FROA 3PO5A 4LSLA 3HK2A 3OYGA 4M3YA 1NK0A 2W42A 4H8KA 3P83D 5CY4A 4DLEA 4KHWA 1HNIA 1T8EA 4EZ9A 4KKOA 5JS1A 2HVHA 4DSEA 5KI6A 1BGXT 2AJQA 3WNGA 4UQGA 1RBVA 1BL3A 3AVAA 3QEPA 1L3SA 2G8IA 2G8UA 2KFZA 1VSJA 2KZZA 4IDKA 2HB5A 3V1OA 1J9AA 1VSIA 4BE0A 4DFJA 1HJRA 4CECA 1TK5A 1BIUA 2VWJA 4N76A 2F8TA 4M42A 1RBUA 4W5RA 4DQQA 2FBTA 1TL1A 3L3VA 4CHYA 1TAQA 1RTHA 1LW2A 2VWKA 2B4JA 1ZBFA 2VG5A 3F9KA 1ZBUA 1SUQA 1A5XA 2GUIA 4ID5A 4CJRA 1RT5A 3AVKA 4CJWA 3PX6A 3OS2A 4M3UA 4DS4A 3HM9A 1HYSA 2BANA 4O55A 2X74A 2HHSA 1KVCA 4CE9A 4CHOA 1X9WA 2IS3A 1HQUA 4KHYA 2OPRA 4KFBA 4RW4A 1VRUA 4C8OA 1BIZA 2HNZA 2RKIA 3U3GA 4H4OA 4E89A 3MAQA 4C8NA 3VQ7A 4FJGA 2X6SA 3HJFA 3AA4A 2EX3A 4JS4A 3IG1A 4DU1A 4M3XA 3KIOA 3TR8A 4C8LA 3D0PA 4E1MA 4DTUA 4DFPA 2D0AA 4CEQA 3OYMA 1HYVA 3WNFA 4ID1A 4OKKA 3ZT3A 3I8DA 4CGHA 3HVTA 4F8RA 1J54A 4DF4A 3QNNA 1CXQA 1NJYA 4FZXC 4QOZB 3WNEA 4HVJA 2Z1HA 2YNFA 3MEEA 4ZTFA 2B6AA 4CJ4A 4R5PA 3MXIA 4DQIA 1FKOA 3ZSVA 1U48A 4DFMA 4KV8A 4DQSA 4DTJA 3S3NA 2F96A 1TK8A 3V81A 1GOCA 1HRHA 4HTUA 5HRSA 4IBNA 3NF9A 2YNIA 4KHQA 3MECA 3O3GA 4BWJA 4FCYA 4CFDA 4FJXA 4CHPA 4FLUA 1JLEA 1CZBA 2Y1JA 1SV5A 1RT4A 4BDPA 2EHGA 4NYNA 4EP5A 3OY9A 2HHUA 4NCBA 4AHVA 1ZBHA 2QKBA 3ASMA 1XI1A 3TI0A 4LY7A 1EP4A 1T03A 1EETA 1DTTA 1WSEA 3K57A 3SUNA 1FKPA 3SUPA 1HMVA 4BDYA 3O3HA 3JYTA 3TAQA 4RG8A 3SPZA 1C0TA 5CYQA 4JRQA 5E41A 2Q3SA 3LWLA 2KQ2A 3OJSA 1SL1A 4CIFA 4CIEA 5KTQA 3CFRA 1D5AA 4HUEA 3KD1E 1IG9A 3K2PA 5D3GA 4C8MA 3AVIA 1JLCA 1IKYA 3KLGA 1K6YA 4FW1A 4AHUA 3LP3A 2FBYA 1LWFA 3IS9A 4BWMA 2E6MA 2PZSA 4IKFA 4DLGA 3RTVA 2ZE2A 4B9UA 3I0SA 2HHVA 3QEVA 1XHXA 3NDKA 1IKVA
chains in the Genus database with same CATH superfamily
3QIOA 3PLAA 4CEAA 2YHAA 3ATUA 3E1YA 1NJZA 1N36K 3E66A 4DTSA 5EVZA 1Q9XA 4Z4GA 1IKXA 4IZ9A 3NGIA 4PL7A 3VGLA 3HL8A 4DV3K 2P9PA 3TTCA 4OPHA 5GIOA 3OA9A 1TKXA 4BVPA 4H5VA 4CBXA 3SUQA 3O9QA 2O8CA 4BREA 1NGJA 4DSLA 2VQEK 1REVA 2P9SB 3LL3A 4DV4K 1K8AO 5KRSA 4H03B 4H5TA 3V4IA 5AZJB 1C0MA 3A5OC 3MN7A 1W97L 4FWQA 2KTQA 3PSFA 4CHNA 4CD3A 3DLHA 1TKZA 2QI2A 1NGBA 3EL2A 1NKBA 1B9FA 3AVLA 4WQ4A 1S1XA 3AY9A 3VEYA 1HKGA 2P9IA 2Z1IA 3QNOA 4B1ZA 3DOLA 4FM1A 2IOCA 4QAGA 4LF9K 4E7HA 1OH8A 1NGHA 1XQSC 2VG7A 1BG3A 3AO1A 3HP6A 3VQDA 3CFOA 3S41A 4WQ5A 5B8HA 3EZ5A 3HPGA 1C0FA 2ZQBA 2UXCK 4FM0A 4IXCA 4BC5A 5SWMA 3O9TA 4H5NA 4DTNA 4M7YA 3TAMA 3U3YA 4FJLA 2QWMA 3SPYA 1VHXA 2D0BA 4CEFA 1GLCG 4NLBA 4H0XB 2BH1A 5AJ3K 3CCQN 4FYDA 1K73O 3DLRA 3VOVA 2FF6A 3U8XA 3UE5A 4CJVA 5AQYA 4RW8A 3DYAA 4M45A 3ZT2A 3MXMA 2GELA 5AFUH 2KKZA 1C1BA 3KKRA 2F7TA 4HUGA 4B3MK 3OW2M 2E2QA 3RWUA 5TKWA 1JXBA 3CCUN 1TL3A 2JWKA 1G99A 4OKEA 2PYJA 4ZTJA 5I42A 4DU3A 3NH0A 3QIPA 3O80A 3RMCA 1YJ9N 3TAEA 3M8SA 2ASOA 3MXJA 1WB9A 3F73A 1GLJO 4KREA 4LFBK 3VQCA 4DU4A 4CF2A 1N5YA 3CJCA 2ITGA 2YV0X 3CFPA 3IUCA 3AAPA 3OTOK 2YHYA 2KLAA 4IFEA 4X62K 3DLBA 2YNHA 1WUAA 3VEXA 1QZ5A 1BUPA 3EYZA 1S1VA 3OYLA 4YDUA 4A59A 3U4LA 3U9ZA 2QK9A 4FLYA 4FZZA 1NOYA 1NKCA 3WNHA 3SJJA 1X3MA 4DB3A 4DMNA 5AQQA 3CJAA 3KTQA 1VQNN 4HWIA 1NWKA 1DEJA 5M1PA 5CHIA 1HNVA 3J8AA 1NMDA 1TVRA 4FLZA 4FPAA 3CC7N 3OYIA 1QTMA 4H4MA 5C2DA 1QQCA 3CXCM 3OBWA 3BGRA 3I0RA 3K9KA 3UKRB 2LSNA 1WSFA 3IFRA 1XC9A 3SI6A 1KSPA 1LCUA 4FJNA 5HRPA 4EZ6A 1VQKN 5KGXA 2OPQA 4CZKA 1O13A 5HP1A 4Z4EA 2H3GX 3AV9A 4E7LA 4DTOA 2Q0RA 3TSUA 4DHYA 3C7NA 2E6LA 4CGGA 2PYLA 1RCHA 4CEOA 2W6KA 3RMDA 3SYZA 5ELZA 1R0AA 4JKDA 5SZTA 5ADXH 4CJ7A 4IDHA 3ZSZA 1F21A 4KO0A 4B08A 3QO9A 1TK0A 4YOTA 3D2EA 3LANA 1JL1A 1QS4A 4L3QA 4JEPA 2B5JA 3KZBA 5C2FA 3WXJA 1DLOA 3OYBA 1L3TA 4C8KA 5FPDA 5J2MA 2QKBA 3VQ4A 2EWSA 5LMNK 2WUSA 1JKHA 2GTDA 3AVBA 4YOUA 2HMIA 3MWPA 4JLHA 4KI4A 1NJIO 2YJEA 1U45A 4B9TA 3W3DA 4CK1A 4I7FA 4CF1A 4BROA 4CJQA 4BRHA 4M3TA 3ZSXA 1QSSA 3THWA 3C94A 4CGIA 4GY2B 4CEBA 1Z26A 3OVNA 4X66K 3NF8A 1GLDG 3D6RA 3FGUA 3LP2A 5DMRA 5AQJA 1KQSM 1RTIA 4IWVA 3VGKA 2P9UA 1SL0A 4BR4A 2JGUA 4JD2A 1TKDA 4MO4A 4DV7K 5AQWA 1L3VA 1VSDA 3M8PA 5KPZA 2P9KA 4OPKA 3ZSWA 1VSLA 2NRXA 4AHTA 2G8HA 2HHWA 4G9ZA 3G10A 2O8DB 3HOTA 4CESA 3QEXA 2YHBA 2F4VK 1C6VA 1ZBIA 4JHDA 4IJNA 3QMLA 4CBUA 3ZX0A 1S1TA 3DXKA 3T7ZA 4CERA 2Q0UA 3CD6N 4BC4A 1LWCA 1NOZA 1YAGA 1QHTA 4IOCL 4DR6K 3HSTB 3D7EO 4O44A 4DR7K 3D45A 5IT9O 1TGOA 2O4GA 3OYFA 3LZJA 4B8AB 3KWIA 4B9NA 3M6GA 3T1AA 3AVGA 4MDAA 4YFUA 3ZT0A 5I3UA 4CW7B 3AO2A 3F9MA 4E19A 1NGEA 4PY5A 4BQLA 5KPTA 2A41A 3VF2A 3OYGA 3G6EN 4KHWA 1IG8A 4EZ9A 5JS1A 4DSEA 3VMFB 4DKWA 3AVAA 1L3SA 4B9SA 4I9QA 4DFJA 1J9AA 3M5RA 1HJRA 3A0IX 4CECA 2VWJA 3EZWA 1TL1A 1TAQA 2VWKA 1ZBFA 2HF4A 2ASPA 1ZBUA 4CJRA 4OX9K 1RT5A 4CJWA 1E3MA 4M3UA 4DS4A 2HHSA 1KVCA 2IIRA 4RW4A 3WQUA 4C8OA 3UB5A 3ZETB 3HJFA 4JS4A 2P9LB 2WBNA 4A62A 3TR8A 4H0YB 3DXMA 4CEQA 3R6MA 3OYMA 4ID1A 4MDBA 2ZGYA 1ZC6A 1J54A 1H1VA 3MEEA 4BG9A 4ZTFA 2B6AA 4R5PA 4DQIA 1RDWX 3ZSVA 3PSIA 2VWBA 4DQSA 1VQMN 4JI8K 4HTUA 4IBNA 3NF9A 5C0YA 3VETA 4CFDA 1YJWN 4FLUA 4FJXA 4H0VB 2Y1JA 1SV5A 1RT4A 2HHUA 4NCBA 5JVHL 1XI1A 1T03A 3EO3A 1DKGD 1EETA 3C6HA 1MA9B 3K57A 1V4TA 1NU0A 1FKPA 3SUPA 1HMVA 3TAQA 4RG8A 1C0TA 3SJHA 2YJFA 5KTQA 3CFRA 1YUWA 4C8MA 1IKYA 3KLGA 4AHUA 1BU6O 1ATSA 3IS9A 1LWFA 2PZSA 3I0SA 2HHVA 5BR9A 1EQYA 2WTUA 4CFBA 1RDAA 1BISA 2HMPA 4RW9A 4LD0A 4LF7K 3L8BA 1KC8O 4NB4A 4B9LA 4CF8A 4BDZA 3IDHA 3THVA 3FLCO 4FLXA 4DR2K 3NVMA 3ALYA 5BN8A 1FXXA 1DT9A 4WQ5C 1VQ6N 4I2PA 1GLAG 3VQEA 3QESA 2X6NA 3AO5A 5GAGP 3ZSYA 5EOYA 4YOVA 1T6DA 4O0IA 4JNEA 4B1VA 5BN9A 3D2FB 5BPNA 1EX4A 4FWNA 3AVFA 3K0SA 4B1XB 4F2RA 3LPTA 4FWRA 1VQLN 1T44A 3TAFA 4C23A 1JLFA 1GOBA 1U49A 2VYPA 3ULEB 3NE6A 3RRGA 1EXQA 3DLEA 4H5RA 4HCBA 4WFAL 2E2PA 1Q9YA 3LDSA 4AM7A 3OYHA 4BE2A 3JXUA 3E9LA 4Z4CA 2A6AA 4DTXA 5JVGL 3JSMA 4ILGB 4EIAA 4A61A 1NK9A 1U6ZA 3CMEN 1KAXA 3BF3A 3V9ZA 4OJRA 4CCHA 3CYMA 2GV9A 2GWKA 3O4QA 2RPIA 2GWJA 2X78A 2W40A 1SS6A 3NFAA 3NH2A 1BQMA 4FJ7A 1YTUA 1Q81O 1QQNA 1CZAN 3AVCA 4KH6A 3SV4A 1SKSA 4Z4HA 5AQNA 3TPQA 3QINA 3RR7A 4CBWA 4HHTA 4RW6A 3R3LA 1K8KA 1U2VB 1BCOA 5AQOA 3IMXA 1XUPO 4ELUA 3E9PA 4BRPA 2ZJQL 3B6PA 2QWQA 4Q0BA 1BI4A 2QTDA 2QWRA 3B8AX 3HM8A 3SLCA 5AQVA 3KLIA 3K58A 5E26A 1VQPN 3HOSA 4J8FA 3MMVA 2HVIA 1RT6A 1B9DA 4YY3K 4NO7A 4PA1A 4EHUA 4HUFA 1ASVA 3TTDA 4CZIA 1N6QA 4YDUC 4DTPA 3KD5E 4K25A 3HVRA 1XNQK 4FJ5A 1W9HA 4OGCA 1KLNA 4CJTA 2YKMA 2FSJA 4YOYA 4KB0A 1I39A 2ATQA 4AHCA 2IDOA 5AR0A 4CJ3A 1UA1A 4OGEA 4IO8A 4FJJA 4Z4FA 3Q7BA 3DLKA 5E84A 4JRPA 4FK4A 1TYQA 4O4GA 2HOEA 3VA3A 3FFKB 5HRNA 3WXIA 5FPNA 2CGJA 3V1RA 4N41A 1CZ9A 3OYKA 1T6CA 1SKRA 3OJUA 3NBPA 1N32K 1KLMA 2NZTA 4LSNA 4A2BA 1J6ZA 4GNIA 1CXUA 3VTIA 4FLTA 4JS5A 4W5QA 3C0BA 3QDKA 1HPZA 5BPLA 2O8EB 3SQ2A 2GBZA 1WSGA 3IRXA 1L5UA 3EE9A 1B92A 4CZMA 4C1NI 1ZBLA 3KK1A 3K5MA 3H45C 3CM5A 3VEZA 4DR3K 2DTUA 2YNGA 3F5TA 4GVMA 4FPBA 3KK2A 5FLXO 3TTFA 1LOTB 5AQFA 3VGMA 3V9XA 3C6UA 4DQ8A 2D5RA 3C95A 3OS1A 4M3ZA 3DMJA 3CC2N 2FBVA 3M1FA 1LAVA 4JKGB 4B3OA 2ZM6K 3JAMO 1MWKA 1RT7A 4ELTA 2NUBA 3RMBA 4J2AA 1S9EA 2HHTA 2NRHA 3SCXA 4FLVA 1NKEA 3HZ6A 3MCAB 4Y0WA 3DOKA 1YTAA 2BUPA 4JKCA 1LAWA 3GE1A 5AZIB 2Z1JA 3H6EA 5AQPA 5KQ8A 4OKJA 2WC9A 4GVEA 2E2NA 3K5NA 3OYAA 3UKUB 1GOAA 1ASUA 3BDPA 3VF4A 3L6QA 3CM6A 4GV3A 2NRWA 3CCJN 2KZMA 1IO2A 3CERA 4CJEA 4M3WA 3MX2A 1JLGA 3RSEB 3VESA 4CF0A 5JS2A 4BRIA 5JLHA 2IGIA 5EX5A 3VEWA 1VSFA 3ZSOA 2QXLA 1RGIA 2HSTA 4YNQA 3ENHA 4DFKA 1LW0A 1KXPA 4AHRA 4FO0A 3V6DA 1WBDA 4LFAK 3FZLA 4CJPA 4DTMA 2OA8A 1RILA 4N56A 5FRMA 2D0PA 2QXFA 1NK8A 3KWGA 4CD1A 4NYFA 1ATNA 1HR0K 3I8BA 1Q8IA 1YXQA 2G8VA 4PUOA 1VK0A 3DI6A 1S72N 1VQ9N 3HXMA 5J1EA 4K43A 3SV3A 4FSVA 4PQUA 4E0DA 4Z94A 4BR5A 2FF3B 4MFBA 4BC2A 3ISNC 1MU2A 3PX0A 4FVMA 1BWFO 5AQZA 4DF8A 5HROA 3O5BA 4OLAA 4LH4A 3O8MA 3CPWM 5GAEP 2KFNA 1NGCA 4A57A 1ZXOA 3MK6A 5KGWA 4JN4A 2Q97A 2XO7A 4FJ9A 1WSHA 4UY8O 1T3VA 5C42A 4CFAA 3TANA 4W5TA 3THXB 3SUOA 3HP9A 4LSLA 1SZ2A 4M3YA 2A42A 3IKMA 4H8KA 5HL7L 3P83D 2GX9A 1NMNA 1T8EA 3O9UA 1BGXT 3ZEUA 5M1FA 4UQGA 2AJQA 4O8UA 1GLFO 3ID8A 2KFZA 1VSJA 4RCHA 3V1OA 4BE0A 5CR4A 4JI0K 1ZBSA 1XC3A 4H0PA 4CZLA 2FBTA 3L3VA 4CHYA 4LF4K 3J7AP 2ITMA 2IVPA 2V7YA 4FWMA 3F9KA 4ID5A 1SUQA 1A5XA 3QFUA 3GL1A 3HM9A 2BANA 1JCEA 4BVOA 4R79A 1HUXA 3CQXA 1Y64A 4CHOA 3P31A 1X9WA 4FOEA 4JI4K 3MAQA 4C8NA 2YHXA 1X9JA 3AA4A 4H0TB 4DU1A 4EFHA 4M3XA 1KAYA 4BRQA 3OHRA 4BRLA 1I94K 4OPAA 2P9PB 2D0AA 1HYVA 3WNFA 5AFUA 3ZT3A 1MWMA 2QA4N 4BRCA 2ZJRL 3F2KA 4CVNE 3HVTA 4KH4A 4F8RA 4DF4A 1NJYA 4FZXC 2V52B 4KRFA 1KRPA 1EWRA 3VPZA 1SQKA 4CJ4A 3CPEA 2O8CB 1FKOA 5C12A 4NXMK 4KV8A 3D2FA 3V81A 1HKCA 3LDOA 5AQXA 2OANA 4GKKK 2VCPA 5M1KA 1JLEA 1CZBA 3OY9A 2HBLA 4JI6K 3VTHA 4LY7A 1EP4A 4O5FA 3ULEA 3G4SN 4ISFA 5JMVA 2QWNA 3RVCA 5AQLA 1Q7YO 1NGAA 2QWOA 4XH1A 3KK7A 2Q3SA 5E41A 4JRQA 3OJSA 1SL1A 5F1XA 2ASMA 1BDGA 2P9IB 4HUEA 3KD1E 3K2PA 3QB0A 5D3GA 3AVIA 2FBYA 3G25A 3WEEA 1QVFM 2E6MA 2E5LK 4B9UA 3CF5L 2KHOA 4NYNA 1SKWA 3EEQA 4FZYA 3P4IA 1BQNA 3J81O 3CG7A 3HRGA 4FM2A 4BRGA 4DQRA 3QERA 2O8FA 5FRNA 5A2QO 3C6AA 1VRTA 3H1VX 3CJBA 1WAFA 5HLFA 3KJVA 1BA0A 2ZJPL 2F9TA 2I7NA 4DR4K 3THYA 1RTJA 1T05A 3SK3A 4KHUA 4AQYK 4BRDA 1UOCA 4Y1CA 5BREA 1IBLK 5CZ1A 4PWDA 2Z1GA 3QETA 1VQ5N 3KLHA 1S3XA 3H1QA 5C15A 1XWLA 3ID6A 1KVAA 5KQDA 3T3FA 2OCEA 3SZ2A 4IFYA 3AA3A 4WFBL 1D4XA 2WFBA 4G1QA 3KVGA 3HPOA 1DTQA 4IEIA 2P9NA 2RHKA 3ZYYX 3WUHA 3AVJA 1NGIA 5FPMA 4CZHA 1RTDA 2OZSA 1OVYA 1W0HA 1IH7A 1S5JA 2UXBK 5EXWA 1J53A 3PX4A 3N4PA 2QEXN 4BRMA 1EWQA 1X3NA 4FVUA 5ADXA 4JYAK 1IBKK 2A3ZA 2WONA 4BR9A 4HTLA 1BHLA 3WT0A 3R8EA 2IAJA 3MCPA 3QFPA 2CGLA 5HBMA 4FJIA 4XEIA 4IJAA 2Q36A 3SNNA 3TSQA 2PBDA 4NCAA 3ULDA 3HPHA 4CJSA 4JI2K 4FOIA 3DRSA 4BRAA 3MN6A 3LAKA 4BR7A 1N8RO 1T7PA 4DV6K 3EKUA 2P9SA 4NLCA 2JWLA 1KVBA 4CIGA 1NJWA 4F3OA 1HJOA 4LF6K 3LP0A 4BE1A 5AZJA 2E4LA 1S1UA 5TKYA 1HNZK 3BZKA 4M63C 4CZFA 1Y97A 4BQZA 4DQPA 4BR0A 3FZFA 2FBXA 3OYJA 4JI5K 3ENBA 4I9LA 3OYDA 3OYCA 4PHTX 1NBWA 1JLBA 2E88A 2DY4A 3N4QA 4FLWA 1I3AA 3M8RA 1XMQK 5BPMA 3VQ6A 3OBYA 4CGJA 4KPYA 3LM2A 4KH5A 1S6QA 1UAXA 5LJVA 3TWHA 1YJNN 1NK4A 2QWLA 3PY8A 1OVQA 1GLBG 1NNEA 3MWTA 2VGNA 4WQ4C 2ZF5O 3L2UA 3C7NB 2G8FA 5HOOA 4FWKA 1O1WA 2O4IA 4BC3A 5FDLA 2YX6A 1YF5L 4J2EA 1G15A 1NK5A 2XRIA 3HBTA 5GIPA 3TABA 5DM6L 1VSMA 4U67L 3SAFA 1FW6A 4X64K 3DJCA 1K9MO 4IOAL 3ZT1A 1OKJA 3LP1A 1QSLA 3ZCMA 5BRDA 1BOTO 3P39A 4E1JA 3NGZA 4CK2A 3H3OB 3SAHA 3D2EB 4JV5K 4OVLA 2FC0A 3P5JA 1HQEA 3M8QA 1RDUA 1LV5A 5J2NA 3BUZB 2W41A 2G8WA 3CC4N 1FJGK 2HNDA 4LH5A 3RRHA 2ETJA 4M41A 1WSJA 3T1YK 1UWBA 3ZSQA 2ZD1A 4IG3A 4LC9B 4CFCA 2BDPA 4CJ5A 5K14A 2HHHK 1C0GA 3PIPL 3S3OA 1NG9A 4Q5VA 4KHNA 2DFFA 3H3NO 3I33A 4CZJA 3THWB 4I6MB 4TSXA 3ZSRA 2RE2A 1C0UA 2XY5A 4RTFD 1HX1A 2P9UB 2G8KA 2VG6A 4JD2B 3CI5A 5FPEA 4U7BA 2UUBK 4B3TK 1JL2A 4CZGA 2P9KB 4E3SA 1RT1A 1VQ4N 3A5LC 4KB1A 4FWLA 4J2BA 3AO4A 3E9OA 1QVGM 4WF9L 4B1WB 2OYQA 2IVOA 3DM2A 3QEIA 3K5OA 3L4IA 4O5BA 3DLGA 4JHDB 4JKFA 1S9GA 3CJ7A 3BY5A 3QBWA 3TAGA 1MDUB 2XY7A 1CLQA 3A2FA 4E7IA 4RW7A 4B9QA 4ILJA 3VEOA 3LZIA 2AA4A 3VQ8A 5IWAK 3T19A 3VN5A 2HNYA 3CIPA 1VQON 1XHZA 4IFVA 2UU9K 3I56N 5JICA 3AAQA 3O9SA 4JKAA 1NJXA 3UKRA 1RNHA 1UA0A 1RBSA 4DTRA 3HSCA 3CCRN 5JLFA 1TAUA 1D9DA 3IAYA 5AQGA 1U4BA 1NK7A 3AVHA 3BP8A 1YVNA 4N5SA 3WXMB 2VGMA 1TUUA 1OH7A 1Z05A 5J2QA 1RT3A 5AQRA 4FW2A 1S6PA 3BEXA 2YKNA 3NH1A 3VA0A 2CH6A 4XH4A 3AVNA 1QE1A 1JJ2M 1VQ7N 3NMUA 2DFEA 4H0OA 2E20A 4E1NA 1KFDA 1RBRA 3LWMA 4CJLA 2NRRA 2A1SA 2W6LA 3DXMB 3DLLL 2DFHA 5AQHA 4FJKA 1BCMA 2KW4A 1LWEA 4K42A 3WXKA 4AH9A 1S1WA 3A5MC 1WN7A 4CEEA 1Q86O 2O8BB 3AARA 3KK3A 2GEMA 5LY3A 1X1PA 5F0XA 3CCMN 4DSJA 3QEWA 1BA1A 3CCVN 3O4NA 2OTLN 4N47A 5FROA 4LF5K 3HK2A 1ILYA 1IBMK 4DLEA 1HNIA 4BRFA 3FR0A 2HVHA 3A5NC 5KI6A 3WNGA 1WBBA 4FWOA 1BL3A 2KZZA 3SMSA 2G8IA 2G8UA 4EAHD 4IDKA 2HB5A 4YOWA 4N76A 2F8TA 4M42A 1RBUA 4DQQA 1RTHA 1NM1A 2B4JA 2VG5A 2O8DA 2GUIA 3AVKA 4GKJK 1W7AA 4CI6A 3Q7CA 1HYSA 4O55A 4CE9A 4C1NK 2IS3A 4KHYA 4DV0K 4MO5A 2RKIA 4A5BA 3U3GA 4H4OA 4E89A 1YITN 3SMPA 3VQ7A 2X6SA 1IJJA 4AM6A 2EX3A 3IG1A 2NRTA 3D0PA 4GV9A 1HNWK 4E1MA 4DTUA 2QM1A 3FZKA 3I8DA 1HKBA 3QNNA 4DR1K 4HVJA 3O08A 2YNFA 4DFMA 3VEVA 4DTJA 1TK8A 1GOCA 1HRHA 4F9OA 2YNIA 3MECA 2D1KA 3TSPA 4BDPA 4DR5K 2EHGA 4EP5A 3BF1A 4AHVA 4YOXA 5GINA 4AF1A 1WSEA 4BDYA 3O3HA 3JYTA 3SPZA 3ATVA 4M7XA 3P38A 4NXNK 4JK9A 4CIFA 4CIEA 1Q82O 3FZMA 1IG9A 2D4WA 5GADP 1JLCA 4LFCK 1W2BM 3LP3A 4BWMA 3T1HK 3RTVA 2ZE2A 3QEVA 1XHXA 3NDKA 4RWTA 5AQTA 4H5WA 2P1JA 4OO1J 1BO5O 4BRKA 1WAJA 3ZX3A 2GUPA 3KKSA 3ZETA 1NGFA 2V7ZA 2P9LA 3L2RA 3GBTA 3DRRA 2HW3A 5CE3A 4KTZA 1P8ZA 5I9EB 2UYTA 3K9JA 1TKTA 2NNWA 1IV0A 3NF6A 3VQPA 4GW6A 4MLHA 4A2AA 3J7YP 3H46O 3HTVA 4CGFA 4PKIA 4E7KA 5BRHA 4IG0A 3SQ0A 1VSHA 1WSIA 1A5VA 1K8KB 3CCLN 4JK7A 3SBTA 2HBJA 3RMAA 4O0JA 5LJWA 1VSKA 3SAGA 5EU7A 4DSFA 2XY6A 3VQBA 3LDQA 4CJUA 4FL9A 2BGGA 1BI4B 4B3RK 3LDLA 3OS0A 1N33K 3SQ4A 5KPRA 5CYMA 4EHTA 3VQQA 3J7ZO 1KTQA 4J2DA 3J80O 4JI3K 3AA5X 1QHAA 4WCEL 4FXDA 4CHZA 3HT3A 2PY5A 1EO1A 1C1CA 1V4SA 4QS7A 3DAWA 3W0LA 3CETA 1KAZA 2CGKA 5BRFA 4BACA 4XIUA 4BGAA 3O3FA 1L3UA 3VQ5A 2ZGZA 2E2OA 2A5XA 1RDDA 2OPPA 3L0QA 1J5OA 1YI2N 1KFSA 1ZYQA 3LPUA 4ELVA 1RBTA 3WXLA 2A40A 2RN2A 3PO4A 4QCLA 4Z0UA 3G0ZA 1ASWA 3UIQA 3L3UA 3BZCA 1TYQB 3R9PA 1GLEG 3NHGA 4ICLA 4Z4IA 3FE1A 3V9WA 3O9RA 4O8KA 3AO3A 2JLEA 2NRVA 1TUYA 3QLHA 2F8SA 1JCGA 2V51B 1P90A 2E1YA 3E01A 3U6FA 1RFQA 3ITHA 4K8ZA 2E8AA 4Y1DA 5C10A 2P5GA 3CHWA 3AVMA 4CEZA 3DRPA 3L2VA 4DV5K 5AQMA 3AA2A 5M1OA 2PFUA 3MEDA 5AQUA 3HYFA 4B9VA 1YIJN 4I6MA 4AILC 2QKKA 4JKBA 1NK6A 4EP4A 3PUFA 4B1UB 2HBMA 4F2SA 1XNRK 2NRZA 1QZ6A 3V9SA 4CHQA 1JLQA 4WYBA 1GLLO 4W5NA 1ITGA 4OPJA 1VSEA 3V9UA 3EN9A 4CF9A 3K5LA 3O4WA 3NAEA 2BE2A 2Q31A 4B1YB 4KHPK 2CH5A 1U2VA 2QW9A 2A1RA 5C25A 1E4FT 1IKWA 3DWLA 1ATRA 4FK2A 3EY1A 2P5OA 1X9MA 3C6TA 2XHBA 4B8CA 4CK3A 4X65K 2IC3A 4MQ3A 2VQFK 3SBGA 3A8YA 1YVUA 4W5OA 1QSYA 1U04A 3TU5A 3R1XA 1XMOK 3S9HA 4BRNA 3L2WA 4A5AA 1WLJA 2D0CA 2WOMA 4FJHA 4JAXA 5KRTA 1U47A 5HRRA 1M1KO 1VAZA 2FLOA 2YI1A 1ESVA 3O1BA 4FJ8A 4DSKA 3EE8A 4CJFA 2HHQA 2IVNA 3CQ8A 4K0KK 3H08A 3RR8A 1TV6A 5AQIA 5AQKA 4F4KA 3MN9A 4FK0A 2Y1IA 2FSKA 1D9FA 3VQ9A 2FXUA 3FFIA 5LMUK 4K8XA 1J5EK 3QICA 5DK5A 5J2PA 4JKEA 3SQ1A 3KLEA 4FWPA 3V1QA 2XY8A 5C24A 2DPNA 1Z25A 3O1WA 4B9MA 1R59O 3I55N 4DCHA 2O8EA 3LM9A 4GMJB 4PL8A 3OYNA 1WNSA 3VQAA 4NCGA 1EKEA 3K59A 1SAZA 1NGGA 5GAHP 4KHSA 3LALA 1A5WA 3VENA 3NCIA 1X9SA 5BR8K 1Q18A 2O8BA 2OZMA 4L8RB 5EY4A 3MN5A 4KBOA 3AGRA 4DSIA 2R7YA 4I2QA 3MDQA 3NVKA 4KTQA 4JKHA 2I5JA 1OH5A 1RDCA 3LDNA 5MLCQ 3MEGA 1RDBA 3NGYA 4DV2K 1HNXK 2OTJN 4JKGA 4V19S 3LAMA 1D8YA 4BGBA 4B3SK 1HYZA 2NLXA 3ZEUB 4CZEA 4HCCA 3OYEA 2PAVA 3PV8A 4KAZA 4KI6A 3CCEN 1Z6RA 1YT3A 4JI7K 4CJKA 4CGDA 3L2QA 4DG1A 4DS5A 3B6OA 3WQTA 2E1ZA 1S22A 4M3RA 1OH6A 1SL2A 3ENOA 2Q2RA 2BTFA 5CZ2A 4FJMA 4WE1A 3ZLJA 3KHYA 1RT2A 2HBKA 3MX5A 5AZIA 2P51A 3S3MA 1KCFA 5T7BA 3CCSN 3P1GA 2RF2A 3UKUA 4CEDA 3ZT4A 4F3TA 4DUYK 5M1QA 4OLBA 3TARA 2YCHA 3TAPA 3HO1A 1C1AA 4FWSA 1WOQA 3M3ZA 4YORA 1JXEA 3RSEA 1E4GT 4DWIA 1DGKN 4DV1K 2OPSA 2HHXA 2QWPA 4AHSA 4YHHK 1JLAA 4QS9A 4E7JA 1M90O 4GV6A 4PKHA 1FK9A 4JI1K 4MLEA 3C65A 3NF7A 5H1SQ 4ZHRA 2F9WA 3KLFA 4KTWA 3PO5A 3AGKA 2Q1NA 1NK0A 2W42A 1KD1O 2ZWHA 3HI0A 5CY4A 1NLVA 4KKOA 1VQ8N 4LF8K 1QQMA 3CJ1A 1YHQN 1RBVA 3QEPA 4ISEA 1VSIA 2D0OA 1TK5A 5DM7L 3VERA 1BIUA 4PKGA 3L4QA 4K41A 4W5RA 3CMAN 1LW2A 4ISGA 3PX6A 3JS6A 3OS2A 5F2RA 3WEEB 2I7PA 2X74A 3GOIA 2UUAK 2YHWA 1HQUA 2OPRA 4KFBA 1VRUA 4JK8A 1BIZA 2HNZA 2O8FB 4ILHA 4FJGA 3ZX2A 1NGDA 4WFNL 3KIOA 4C8LA 3O6WA 3DXKB 4DFPA 5AQSA 4IO9L 4OKKA 3THYB 4BY9C 4BG8A 3G71N 4CGHA 3LDPA 3U9DA 1CXQA 4QOZB 3WNEA 2Z1HA 4DUZK 3EKSA 3MXIA 1U48A 3CJ9A 1HLUA 3QBXA 5LL6Z 3S3NA 2F96A 5HRSA 3THXA 4KHQA 3O3GA 4BWJA 4FCYA 4BR2A 4CHPA 4IEEA 2AP1A 3PIOL 2HF3A 1N34K 1ZBHA 2P9NB 3ASMA 1QQOA 3VF6A 3T69A 3TI0A 1DTTA 4IOXA 4QS8A 2UXDK 3SUNA 3GDQA 3CQYA 2J4RA 3FZHA 4XH5A 5CYQA 3GG4A 3LWLA 2KQ2A 1D5AA 5M1NA 1K6YA 4FW1A 2FSNA 4IKFA 4DLGA 1JCFA 2UUCK 1IKVA 1HPMA
chains in the Genus database with same CATH topology
4CFBA 1RDAA 3QIOA 4FZYA 1BISA 1BQNA 4CEAA 2YHAA 2P1JA 3CG7A 4RW9A 4FM2A 1NJZA 1WAJA 4LD0A 3KKSA 4DQRA 3QERA 5FRNA 1VRTA 4DTSA 3L8BA 5HLFA 1WAFA 1IKXA 1Q9XA 3KJVA 3L2RA 3NGIA 4B9LA 4Z4GA 4CF8A 3HL8A 4BDZA 3DRRA 2HW3A 4KTZA 4KRFA 1RTJA 4FLXA 3THVA 1T05A 4KHUA 1TKTA 1TKXA 1UOCA 4Y1CA 3ALYA 3NF6A 5CZ1A 3VQPA 3SUQA 4PWDA 4GW6A 1FXXA 2Z1GA 3QETA 4I2PA 3KLHA 3VQEA 3QESA 2X6NA 3AO5A 3ZSYA 4CGFA 4DSLA 4E7KA 1XWLA 4O0IA 3SQ0A 1KVAA 1REVA 1VSHA 4IG0A 1WSIA 3T3FA 1A5VA 1EX4A 3AVFA 3SZ2A 4IFYA 3AA3A 5KRSA 4F2RA 3RMAA 4O0JA 1VSKA 3LPTA 4G1QA 5EU7A 4DSFA 3V4IA 2XY6A 1C0MA 3VQBA 1DTQA 3HPOA 4CJUA 2KTQA 4CHNA 3DLHA 3TAFA 3AVJA 2BGGA 1BI4B 1TKZA 1RTDA 2OZSA 3OS0A 1JLFA 1GOBA 1W0HA 1NKBA 3SQ4A 1U49A 1B9FA 5CYMA 4PUOA 1IH7A 3VQQA 1KTQA 3AVLA 1S5JA 3NE6A 3RRGA 1EXQA 4J2DA 1S1XA 3DLEA 1J53A 4HCBA 3AA5X 2Z1IA 4FXDA 3QNOA 4CHZA 3HT3A 1Q9YA 3LDSA 2PY5A 3DOLA 4FM1A 2IOCA 1C1CA 4QAGA 3PX4A 4E7HA 2VG7A 3OYHA 4BE2A 3AO1A 3HP6A 3VQDA 3CFOA 4BACA 4XIUA 3O3FA 1L3UA 3VQ5A 4Z4CA 3EZ5A 4DTXA 1RDDA 2OPPA 2WONA 3HPGA 3JSMA 1J5OA 2ZQBA 4FM0A 4B9SA 1BHLA 1KFSA 1ZYQA 2IAJA 1NK9A 3LPUA 5HBMA 5SWMA 4ELVA 1KRPA 1RBTA 4OJRA 2RN2A 3V9ZA 3PO4A 4FJIA 4QCLA 4Z0UA 4DTNA 3SNNA 4CCHA 3CYMA 2GV9A 3G0ZA 3O4QA 1ASWA 2RPIA 3UIQA 4NCAA 2X78A 3L3UA 3HPHA 4CJSA 3TAMA 3ULDA 3NFAA 3NH2A 3U3YA 4FJLA 1BQMA 4FJ7A 3SPYA 1YTUA 3DRSA 2D0BA 3NHGA 3LAKA 4ICLA 4CEFA 3AVCA 3SV4A 1SKSA 4Z4IA 4Z4HA 1T7PA 3QINA 3V9WA 3RR7A 4HHTA 4RW6A 3AO3A 4FYDA 2JLEA 1BCOA 3DLRA 1KVBA 4CIGA 1NJWA 3QLHA 4F3OA 2F8SA 4ELUA 4CJVA 3LP0A 4BE1A 4RW8A 2E4LA 3DYAA 4M45A 3E01A 3B6PA 3ZT2A 3U6FA 4Q0BA 1S1UA 1BI4A 3MXMA 3ITHA 4K8ZA 4Y1DA 2P5GA 1C1BA 1Y97A 3KLIA 3K58A 3KKRA 3AVMA 4HUGA 4DQPA 4CEZA 3RWUA 2HVIA 1JXBA 2FBXA 3OYJA 1RT6A 1TL3A 1B9DA 3DRPA 4OKEA 4PA1A 4I9LA 2PYJA 3L2VA 5I42A 4DU3A 4HUFA 4ZTJA 1ASVA 3OYDA 3OYCA 1N6QA 3AA2A 4DTPA 1JLBA 3KD5E 3NH0A 3QIPA 2DY4A 4FLWA 3RMCA 3HVRA 3MEDA 3HYFA 3TAEA 1I3AA 4C8KA 1W9HA 3M8RA 3M8SA 4OGCA 4AILC 4B9VA 2QKKA 1KLNA 3MXJA 3VQ6A 4CGJA 4CJTA 2YKMA 1NK6A 4KB0A 4KPYA 1I39A 4EP4A 1S6QA 1UAXA 3TWHA 2ATQA 1NK4A 3PUFA 4AHCA 3F73A 2IDOA 4F2SA 3PY8A 4KREA 3VQCA 3V9SA 4CJ3A 4CHQA 1JLQA 4OGEA 1UA1A 4DU4A 4CF2A 4FJJA 1N5YA 4Z4FA 2ITGA 4W5NA 3DLKA 3L2UA 2G8FA 1ITGA 2YV0X 3CFPA 4OPJA 4JRPA 4FK4A 1O1WA 4O4GA 2O4IA 5FDLA 3VA3A 1VSEA 3V9UA 5HRNA 4J2EA 1G15A 3V1RA 4CF9A 1NK5A 2XRIA 3K5LA 1CZ9A 4N41A 3OYKA 3TABA 1SKRA 1VSMA 3NAEA 2BE2A 3OJUA 3DLBA 2YNHA 3NBPA 1KLMA 3ZT1A 3LP1A 1QSLA 4LSNA 1S1VA 3ZCMA 3EYZA 3OYLA 3NGZA 4CK2A 2A1RA 1CXUA 4FLTA 2QK9A 5C25A 4JS5A 4OVLA 4FLYA 4FZZA 2FC0A 1NOYA 1IKWA 1NKCA 3P5JA 3WNHA 1HQEA 4W5QA 4FK2A 3SJJA 3EY1A 1HPZA 3M8QA 2P5OA 4DMNA 5J2NA 1LV5A 3SQ2A 1X9MA 3KTQA 2GBZA 3C6TA 1WSGA 4FJ5A 2G8WA 3IRXA 2XHBA 4B8CA 1L5UA 4CK3A 2HNDA 1B92A 4LH5A 2IC3A 1HNVA 2ETJA 4MQ3A 3RRHA 4I9QA 1ZBLA 1TVRA 1YVUA 3KK1A 4M41A 1WSJA 4W5OA 3K5MA 3CM5A 4FLZA 1UWBA 1U04A 3ZSQA 1QSYA 2ZD1A 4IG3A 3S9HA 4CFCA 3OYIA 4CJ5A 5K14A 2BDPA 2DTUA 1QTMA 4H4MA 3L2WA 1QQCA 2YNGA 3S3OA 4Q5VA 4GVMA 4KHNA 3KK2A 1WLJA 2D0CA 2DFFA 2WOMA 4FJHA 3BGRA 3I0RA 5KRTA 1U47A 5HRRA 3V9XA 3C6UA 2LSNA 1WSFA 2D5RA 1XC9A 3C95A 4TSXA 3ZSRA 3SI6A 1KSPA 4FJNA 3OS1A 5HRPA 4EZ6A 1C0UA 4FJ8A 4M3ZA 3DMJA 4DSKA 2XY5A 2FBVA 1LAVA 5KGXA 4CJFA 4B3OA 2OPQA 2HHQA 3CQ8A 5HP1A 4Z4EA 4ELTA 1RT7A 2G8KA 2NUBA 3AV9A 4E7LA 4DTOA 3RMBA 2VG6A 4J2AA 1S9EA 3H08A 2HHTA 3RR8A 2E6LA 1TV6A 4F4KA 4CGGA 3SCXA 2PYLA 4FLVA 1NKEA 1RCHA 4FK0A 2Y1IA 3DOKA 3VQ9A 4CEOA 1D9FA 3RMDA 3SYZA 1YTAA 1JL2A 3FFIA 4K8XA 4E3SA 1R0AA 1RT1A 5SZTA 5DK5A 4KB1A 4J2BA 3AO4A 5J2PA 3SQ1A 1LAWA 3ZSZA 1F21A 4KO0A 2OYQA 4B08A 3KLEA 3DM2A 3QO9A 1TK0A 2Z1JA 3QEIA 3K5OA 3V1QA 2XY8A 3LANA 4O5BA 5C24A 1L3TA 1JL1A 3DLGA 1Z25A 1QS4A 4OKJA 4B9MA 1S9GA 2B5JA 3K5NA 4GMJB 3OYAA 1DLOA 3TAGA 3OYNA 1WNSA 3OYBA 1GOAA 2XY7A 1ASUA 3A2FA 3VQAA 4NCGA 1EKEA 5J2MA 1SKWA 3K59A 4E7IA 3CM6A 3BDPA 4RW7A 3VQ4A 3LALA 4KHSA 1JKHA 1A5WA 3AVBA 3NCIA 1X9SA 2KZMA 2HMIA 1IO2A 4JLHA 3LZIA 4CJEA 4KI4A 4M3WA 3VQ8A 3T19A 2OZMA 1JLGA 3VN5A 4L8RB 1U45A 4CF0A 4B9TA 5JS2A 2HNYA 1XHZA 4CK1A 4I7FA 4CF1A 4IFVA 4DSIA 2IGIA 2R7YA 4I2QA 1VSFA 3ZSOA 4CJQA 4KTQA 1NJXA 4M3TA 1RNHA 3ZSXA 1QSSA 4YNQA 3C94A 2I5JA 1LW0A 4CGIA 4DFKA 1UA0A 1RDCA 1RBSA 4CEBA 1Z26A 3MEGA 4DTRA 1RDBA 3NGYA 3OVNA 1TAUA 4AHRA 1D9DA 3IAYA 3NF8A 3LAMA 3LP2A 5DMRA 1U4BA 1D8YA 1RTIA 1NK7A 3AVHA 1HYZA 3V6DA 1SL0A 4CJPA 4DTMA 2OA8A 1RILA 2JGUA 4N56A 4N5SA 4HCCA 5FRMA 3OYEA 2QXFA 1NK8A 3PV8A 1TKDA 4KAZA 4KI6A 5J2QA 1L3VA 1VSDA 1RT3A 1YT3A 3M8PA 4NYFA 4CGDA 4CJKA 3L2QA 4DG1A 4FW2A 1Q8IA 3B6OA 4DS5A 2G8VA 1S6PA 4M3RA 2YKNA 3ZSWA 4OPKA 1VSLA 4AHTA 3NH1A 2G8HA 1VK0A 3DI6A 2HHWA 1SL2A 3HXMA 3G10A 3VA0A 5CZ2A 5J1EA 3SV3A 4CESA 4FJMA 4WE1A 4PQUA 3AVNA 4E0DA 1QE1A 1RT2A 3QEXA 2P51A 2YHBA 1C6VA 4MFBA 3ISNC 3S3MA 1ZBIA 1KCFA 1MU2A 2DFEA 5T7BA 3PX0A 4FVMA 3P1GA 4E1NA 2RF2A 4CEDA 4DF8A 1KFDA 1RBRA 1S1TA 3ZT4A 4CJLA 3LWMA 4F3TA 4CERA 2A1SA 4OLBA 3TARA 3TAPA 3HO1A 1LWCA 5HROA 1C1AA 1NOZA 1QHTA 3HSTB 2DFHA 4OLAA 1JXEA 4LH4A 4O44A 4FJKA 3D45A 1BCMA 2KW4A 2KFNA 1LWEA 1TGOA 2O4GA 3OYFA 3LZJA 1CLQA 4AH9A 4B8AB 4B9NA 4DWIA 1S1WA 2OPSA 5KGWA 3T1AA 2HHXA 3AVGA 1WN7A 4YFUA 3ZT0A 4AHSA 4CEEA 5I3UA 4FJ9A 2XO7A 3KK3A 3AO2A 1WSHA 1JLAA 4E7JA 4E19A 1X1PA 1FK9A 4CFAA 5C42A 3TANA 4PY5A 4DSJA 3NF7A 4W5TA 3QEWA 4ZHRA 3SUOA 3O4NA 3HP9A 4KTWA 3KLFA 4N47A 5FROA 3PO5A 4LSLA 3HK2A 3OYGA 4M3YA 1NK0A 2W42A 4H8KA 3P83D 5CY4A 4DLEA 4KHWA 1HNIA 1T8EA 4EZ9A 4KKOA 5JS1A 2HVHA 4DSEA 5KI6A 1BGXT 2AJQA 3WNGA 4UQGA 1RBVA 1BL3A 3AVAA 3QEPA 1L3SA 2G8IA 2G8UA 2KFZA 1VSJA 2KZZA 4IDKA 2HB5A 3V1OA 1J9AA 1VSIA 4BE0A 4DFJA 1HJRA 4CECA 1TK5A 1BIUA 2VWJA 4N76A 2F8TA 4M42A 1RBUA 4W5RA 4DQQA 2FBTA 1TL1A 3L3VA 4CHYA 1TAQA 1RTHA 1LW2A 2VWKA 2B4JA 1ZBFA 2VG5A 3F9KA 1ZBUA 1SUQA 1A5XA 2GUIA 4ID5A 4CJRA 1RT5A 3AVKA 4CJWA 3PX6A 3OS2A 4M3UA 4DS4A 3HM9A 1HYSA 2BANA 4O55A 2X74A 2HHSA 1KVCA 4CE9A 4CHOA 1X9WA 2IS3A 1HQUA 4KHYA 2OPRA 4KFBA 4RW4A 1VRUA 4C8OA 1BIZA 2HNZA 2RKIA 3U3GA 4H4OA 4E89A 3MAQA 4C8NA 3VQ7A 4FJGA 2X6SA 3HJFA 3AA4A 2EX3A 4JS4A 3IG1A 4DU1A 4M3XA 3KIOA 3TR8A 4C8LA 3D0PA 4E1MA 4DTUA 4DFPA 2D0AA 4CEQA 3OYMA 1HYVA 3WNFA 4ID1A 4OKKA 3ZT3A 3I8DA 4CGHA 3HVTA 4F8RA 1J54A 4DF4A 3QNNA 1CXQA 1NJYA 4FZXC 4QOZB 3WNEA 4HVJA 2Z1HA 2YNFA 3MEEA 4ZTFA 2B6AA 4CJ4A 4R5PA 3MXIA 4DQIA 1FKOA 3ZSVA 1U48A 4DFMA 4KV8A 4DQSA 4DTJA 3S3NA 2F96A 1TK8A 3V81A 1GOCA 1HRHA 4HTUA 5HRSA 4IBNA 3NF9A 2YNIA 4KHQA 3MECA 3O3GA 4BWJA 4FCYA 4CFDA 4FJXA 4CHPA 4FLUA 1JLEA 1CZBA 2Y1JA 1SV5A 1RT4A 4BDPA 2EHGA 4NYNA 4EP5A 3OY9A 2HHUA 4NCBA 4AHVA 1ZBHA 2QKBA 3ASMA 1XI1A 3TI0A 4LY7A 1EP4A 1T03A 1EETA 1DTTA 1WSEA 3K57A 3SUNA 1FKPA 3SUPA 1HMVA 4BDYA 3O3HA 3JYTA 3TAQA 4RG8A 3SPZA 1C0TA 5CYQA 4JRQA 5E41A 2Q3SA 3LWLA 2KQ2A 3OJSA 1SL1A 4CIFA 4CIEA 5KTQA 3CFRA 1D5AA 4HUEA 3KD1E 1IG9A 3K2PA 5D3GA 4C8MA 3AVIA 1JLCA 1IKYA 3KLGA 1K6YA 4FW1A 4AHUA 3LP3A 2FBYA 1LWFA 3IS9A 4BWMA 2E6MA 2PZSA 4IKFA 4DLGA 3RTVA 2ZE2A 4B9UA 3I0SA 2HHVA 3QEVA 1XHXA 3NDKA 1IKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CFB A;  1RDA A;  3QIO A;  4FZY A;  1BIS A;  1BQN A;  4CEA A;  2YHA A;  2P1J A;  3CG7 A;  4RW9 A;  4FM2 A;  1NJZ A;  1WAJ A;  4LD0 A;  3KKS A;  4DQR A;  3QER A;  5FRN A;  1VRT A;  4DTS A;  3L8B A;  5HLF A;  1WAF A;  1IKX A;  1Q9X A;  3KJV A;  3L2R A;  3NGI A;  4B9L A;  4Z4G A;  4CF8 A;  3HL8 A;  4BDZ A;  3DRR A;  2HW3 A;  4KTZ A;  4KRF A;  1RTJ A;  4FLX A;  3THV A;  1T05 A;  4KHU A;  1TKT A;  1TKX A;  1UOC A;  4Y1C A;  3ALY A;  3NF6 A;  5CZ1 A;  3VQP A;  3SUQ A;  4PWD A;  4GW6 A;  1FXX A;  2Z1G A;  3QET A;  4I2P A;  3KLH A;  3VQE A;  3QES A;  2X6N A;  3AO5 A;  3ZSY A;  4CGF A;  4DSL A;  4E7K A;  1XWL A;  4O0I A;  3SQ0 A;  1KVA A;  1REV A;  1VSH A;  4IG0 A;  1WSI A;  3T3F A;  1A5V A;  1EX4 A;  3AVF A;  3SZ2 A;  4IFY A;  3AA3 A;  5KRS A;  4F2R A;  3RMA A;  4O0J A;  1VSK A;  3LPT A;  4G1Q A;  5EU7 A;  4DSF A;  3V4I A;  2XY6 A;  1C0M A;  3VQB A;  1DTQ A;  3HPO A;  4CJU A;  2KTQ A;  4CHN A;  3DLH A;  3TAF A;  3AVJ A;  2BGG A;  1BI4 B;  1TKZ A;  1RTD A;  2OZS A;  3OS0 A;  1JLF A;  1GOB A;  1W0H A;  1NKB A;  3SQ4 A;  1U49 A;  1B9F A;  5CYM A;  4PUO A;  1IH7 A;  3VQQ A;  1KTQ A;  3AVL A;  1S5J A;  3NE6 A;  3RRG A;  1EXQ A;  4J2D A;  1S1X A;  3DLE A;  1J53 A;  4HCB A;  3AA5 X;  2Z1I A;  4FXD A;  3QNO A;  4CHZ A;  3HT3 A;  1Q9Y A;  3LDS A;  2PY5 A;  3DOL A;  4FM1 A;  2IOC A;  1C1C A;  4QAG A;  3PX4 A;  4E7H A;  2VG7 A;  3OYH A;  4BE2 A;  3AO1 A;  3HP6 A;  3VQD A;  3CFO A;  4BAC A;  4XIU A;  3O3F A;  1L3U A;  3VQ5 A;  4Z4C A;  3EZ5 A;  4DTX A;  1RDD A;  2OPP A;  2WON A;  3HPG A;  3JSM A;  1J5O A;  2ZQB A;  4FM0 A;  4B9S A;  1BHL A;  1KFS A;  1ZYQ A;  2IAJ A;  1NK9 A;  3LPU A;  5HBM A;  5SWM A;  4ELV A;  1KRP A;  1RBT A;  4OJR A;  2RN2 A;  3V9Z A;  3PO4 A;  4FJI A;  4QCL A;  4Z0U A;  4DTN A;  3SNN A;  4CCH A;  3CYM A;  2GV9 A;  3G0Z A;  3O4Q A;  1ASW A;  2RPI A;  3UIQ A;  4NCA A;  2X78 A;  3L3U A;  3HPH A;  4CJS A;  3TAM A;  3ULD A;  3NFA A;  3NH2 A;  3U3Y A;  4FJL A;  1BQM A;  4FJ7 A;  3SPY A;  1YTU A;  3DRS A;  2D0B A;  3NHG A;  3LAK A;  4ICL A;  4CEF A;  3AVC A;  3SV4 A;  1SKS A;  4Z4I A;  4Z4H A;  1T7P A;  3QIN A;  3V9W A;  3RR7 A;  4HHT A;  4RW6 A;  3AO3 A;  4FYD A;  2JLE A;  1BCO A;  3DLR A;  1KVB A;  4CIG A;  1NJW A;  3QLH A;  4F3O A;  2F8S A;  4ELU A;  4CJV A;  3LP0 A;  4BE1 A;  4RW8 A;  2E4L A;  3DYA A;  4M45 A;  3E01 A;  3B6P A;  3ZT2 A;  3U6F A;  4Q0B A;  1S1U A;  1BI4 A;  3MXM A;  3ITH A;  4K8Z A;  4Y1D A;  2P5G A;  1C1B A;  1Y97 A;  3KLI A;  3K58 A;  3KKR A;  3AVM A;  4HUG A;  4DQP A;  4CEZ A;  3RWU A;  2HVI A;  1JXB A;  2FBX A;  3OYJ A;  1RT6 A;  1TL3 A;  1B9D A;  3DRP A;  4OKE A;  4PA1 A;  4I9L A;  2PYJ A;  3L2V A;  5I42 A;  4DU3 A;  4HUF A;  4ZTJ A;  1ASV A;  3OYD A;  3OYC A;  1N6Q A;  3AA2 A;  4DTP A;  1JLB A;  3KD5 E;  3NH0 A;  3QIP A;  2DY4 A;  4FLW A;  3RMC A;  3HVR A;  3MED A;  3HYF A;  3TAE A;  1I3A A;  4C8K A;  1W9H A;  3M8R A;  3M8S A;  4OGC A;  4AIL C;  4B9V A;  2QKK A;  1KLN A;  3MXJ A;  3VQ6 A;  4CGJ A;  4CJT A;  2YKM A;  1NK6 A;  4KB0 A;  4KPY A;  1I39 A;  4EP4 A;  1S6Q A;  1UAX A;  3TWH A;  2ATQ A;  1NK4 A;  3PUF A;  4AHC A;  3F73 A;  2IDO A;  4F2S A;  3PY8 A;  4KRE A;  3VQC A;  3V9S A;  4CJ3 A;  4CHQ A;  1JLQ A;  4OGE A;  1UA1 A;  4DU4 A;  4CF2 A;  4FJJ A;  1N5Y A;  4Z4F A;  2ITG A;  4W5N A;  3DLK A;  3L2U A;  2G8F A;  1ITG A;  2YV0 X;  3CFP A;  4OPJ A;  4JRP A;  4FK4 A;  1O1W A;  4O4G A;  2O4I A;  5FDL A;  3VA3 A;  1VSE A;  3V9U A;  5HRN A;  4J2E A;  1G15 A;  3V1R A;  4CF9 A;  1NK5 A;  2XRI A;  3K5L A;  1CZ9 A;  4N41 A;  3OYK A;  3TAB A;  1SKR A;  1VSM A;  3NAE A;  2BE2 A;  3OJU A;  3DLB A;  2YNH A;  3NBP A;  1KLM A;  3ZT1 A;  3LP1 A;  1QSL A;  4LSN A;  1S1V A;  3ZCM A;  3EYZ A;  3OYL A;  3NGZ A;  4CK2 A;  2A1R A;  1CXU A;  4FLT A;  2QK9 A;  5C25 A;  4JS5 A;  4OVL A;  4FLY A;  4FZZ A;  2FC0 A;  1NOY A;  1IKW A;  1NKC A;  3P5J A;  3WNH A;  1HQE A;  4W5Q A;  4FK2 A;  3SJJ A;  3EY1 A;  1HPZ A;  3M8Q A;  2P5O A;  4DMN A;  5J2N A;  1LV5 A;  3SQ2 A;  1X9M A;  3KTQ A;  2GBZ A;  3C6T A;  1WSG A;  4FJ5 A;  2G8W A;  3IRX A;  2XHB A;  4B8C A;  1L5U A;  4CK3 A;  2HND A;  1B92 A;  4LH5 A;  2IC3 A;  1HNV A;  2ETJ A;  4MQ3 A;  3RRH A;  4I9Q A;  1ZBL A;  1TVR A;  1YVU A;  3KK1 A;  4M41 A;  1WSJ A;  4W5O A;  3K5M A;  3CM5 A;  4FLZ A;  1UWB A;  1U04 A;  3ZSQ A;  1QSY A;  2ZD1 A;  4IG3 A;  3S9H A;  4CFC A;  3OYI A;  4CJ5 A;  5K14 A;  2BDP A;  2DTU A;  1QTM A;  4H4M A;  3L2W A;  1QQC A;  2YNG A;  3S3O A;  4Q5V A;  4GVM A;  4KHN A;  3KK2 A;  1WLJ A;  2D0C A;  2DFF A;  2WOM A;  4FJH A;  3BGR A;  3I0R A;  5KRT A;  1U47 A;  5HRR A;  3V9X A;  3C6U A;  2LSN A;  1WSF A;  2D5R A;  1XC9 A;  3C95 A;  4TSX A;  3ZSR A;  3SI6 A;  1KSP A;  4FJN A;  3OS1 A;  5HRP A;  4EZ6 A;  1C0U A;  4FJ8 A;  4M3Z A;  3DMJ A;  4DSK A;  2XY5 A;  2FBV A;  1LAV A;  5KGX A;  4CJF A;  4B3O A;  2OPQ A;  2HHQ A;  3CQ8 A;  5HP1 A;  4Z4E A;  4ELT A;  1RT7 A;  2G8K A;  2NUB A;  3AV9 A;  4E7L A;  4DTO A;  3RMB A;  2VG6 A;  4J2A A;  1S9E A;  3H08 A;  2HHT A;  3RR8 A;  2E6L A;  1TV6 A;  4F4K A;  4CGG A;  3SCX A;  2PYL A;  4FLV A;  1NKE A;  1RCH A;  4FK0 A;  2Y1I A;  3DOK A;  3VQ9 A;  4CEO A;  1D9F A;  3RMD A;  3SYZ A;  1YTA A;  1JL2 A;  3FFI A;  4K8X A;  4E3S A;  1R0A A;  1RT1 A;  5SZT A;  5DK5 A;  4KB1 A;  4J2B A;  3AO4 A;  5J2P A;  3SQ1 A;  1LAW A;  3ZSZ A;  1F21 A;  4KO0 A;  2OYQ A;  4B08 A;  3KLE A;  3DM2 A;  3QO9 A;  1TK0 A;  2Z1J A;  3QEI A;  3K5O A;  3V1Q A;  2XY8 A;  3LAN A;  4O5B A;  5C24 A;  1L3T A;  1JL1 A;  3DLG A;  1Z25 A;  1QS4 A;  4OKJ A;  4B9M A;  1S9G A;  2B5J A;  3K5N A;  4GMJ B;  3OYA A;  1DLO A;  3TAG A;  3OYN A;  1WNS A;  3OYB A;  1GOA A;  2XY7 A;  1ASU A;  3A2F A;  3VQA A;  4NCG A;  1EKE A;  5J2M A;  1SKW A;  3K59 A;  4E7I A;  3CM6 A;  3BDP A;  4RW7 A;  3VQ4 A;  3LAL A;  4KHS A;  1JKH A;  1A5W A;  3AVB A;  3NCI A;  1X9S A;  2KZM A;  2HMI A;  1IO2 A;  4JLH A;  3LZI A;  4CJE A;  4KI4 A;  4M3W A;  3VQ8 A;  3T19 A;  2OZM A;  1JLG A;  3VN5 A;  4L8R B;  1U45 A;  4CF0 A;  4B9T A;  5JS2 A;  2HNY A;  1XHZ A;  4CK1 A;  4I7F A;  4CF1 A;  4IFV A;  4DSI A;  2IGI A;  2R7Y A;  4I2Q A;  1VSF A;  3ZSO A;  4CJQ A;  4KTQ A;  1NJX A;  4M3T A;  1RNH A;  3ZSX A;  1QSS A;  4YNQ A;  3C94 A;  2I5J A;  1LW0 A;  4CGI A;  4DFK A;  1UA0 A;  1RDC A;  1RBS A;  4CEB A;  1Z26 A;  3MEG A;  4DTR A;  1RDB A;  3NGY A;  3OVN A;  1TAU A;  4AHR A;  1D9D A;  3IAY A;  3NF8 A;  3LAM A;  3LP2 A;  5DMR A;  1U4B A;  1D8Y A;  1RTI A;  1NK7 A;  3AVH A;  1HYZ A;  3V6D A;  1SL0 A;  4CJP A;  4DTM A;  2OA8 A;  1RIL A;  2JGU A;  4N56 A;  4N5S A;  4HCC A;  5FRM A;  3OYE A;  2QXF A;  1NK8 A;  3PV8 A;  1TKD A;  4KAZ A;  4KI6 A;  5J2Q A;  1L3V A;  1VSD A;  1RT3 A;  1YT3 A;  3M8P A;  4NYF A;  4CGD A;  4CJK A;  3L2Q A;  4DG1 A;  4FW2 A;  1Q8I A;  3B6O A;  4DS5 A;  2G8V A;  1S6P A;  4M3R A;  2YKN A;  3ZSW A;  4OPK A;  1VSL A;  4AHT A;  3NH1 A;  2G8H A;  1VK0 A;  3DI6 A;  2HHW A;  1SL2 A;  3HXM A;  3G10 A;  3VA0 A;  5CZ2 A;  5J1E A;  3SV3 A;  4CES A;  4FJM A;  4WE1 A;  4PQU A;  3AVN A;  4E0D A;  1QE1 A;  1RT2 A;  3QEX A;  2P51 A;  2YHB A;  1C6V A;  4MFB A;  3ISN C;  3S3M A;  1ZBI A;  1KCF A;  1MU2 A;  2DFE A;  5T7B A;  3PX0 A;  4FVM A;  3P1G A;  4E1N A;  2RF2 A;  4CED A;  4DF8 A;  1KFD A;  1RBR A;  1S1T A;  3ZT4 A;  4CJL A;  3LWM A;  4F3T A;  4CER A;  2A1S A;  4OLB A;  3TAR A;  3TAP A;  3HO1 A;  1LWC A;  5HRO A;  1C1A A;  1NOZ A;  1QHT A;  3HST B;  2DFH A;  4OLA A;  1JXE A;  4LH4 A;  4O44 A;  4FJK A;  3D45 A;  1BCM A;  2KW4 A;  2KFN A;  1LWE A;  1TGO A;  2O4G A;  3OYF A;  3LZJ A;  1CLQ A;  4AH9 A;  4B8A B;  4B9N A;  4DWI A;  1S1W A;  2OPS A;  5KGW A;  3T1A A;  2HHX A;  3AVG A;  1WN7 A;  4YFU A;  3ZT0 A;  4AHS A;  4CEE A;  5I3U A;  4FJ9 A;  2XO7 A;  3KK3 A;  3AO2 A;  1WSH A;  1JLA A;  4E7J A;  4E19 A;  1X1P A;  1FK9 A;  4CFA A;  5C42 A;  3TAN A;  4PY5 A;  4DSJ A;  3NF7 A;  4W5T A;  3QEW A;  4ZHR A;  3SUO A;  3O4N A;  3HP9 A;  4KTW A;  3KLF A;  4N47 A;  5FRO A;  3PO5 A;  4LSL A;  3HK2 A;  3OYG A;  4M3Y A;  1NK0 A;  2W42 A;  4H8K A;  3P83 D;  5CY4 A;  4DLE A;  4KHW A;  1HNI A;  1T8E A;  4EZ9 A;  4KKO A;  5JS1 A;  2HVH A;  4DSE A;  5KI6 A;  1BGX T;  2AJQ A;  3WNG A;  4UQG A;  1RBV A;  1BL3 A;  3AVA A;  3QEP A;  1L3S A;  2G8I A;  2G8U A;  2KFZ A;  1VSJ A;  2KZZ A;  4IDK A;  2HB5 A;  3V1O A;  1J9A A;  1VSI A;  4BE0 A;  4DFJ A;  1HJR A;  4CEC A;  1TK5 A;  1BIU A;  2VWJ A;  4N76 A;  2F8T A;  4M42 A;  1RBU A;  4W5R A;  4DQQ A;  2FBT A;  1TL1 A;  3L3V A;  4CHY A;  1TAQ A;  1RTH A;  1LW2 A;  2VWK A;  2B4J A;  1ZBF A;  2VG5 A;  3F9K A;  1ZBU A;  1SUQ A;  1A5X A;  2GUI A;  4ID5 A;  4CJR A;  1RT5 A;  3AVK A;  4CJW A;  3PX6 A;  3OS2 A;  4M3U A;  4DS4 A;  3HM9 A;  1HYS A;  2BAN A;  4O55 A;  2X74 A;  2HHS A;  1KVC A;  4CE9 A;  4CHO A;  1X9W A;  2IS3 A;  1HQU A;  4KHY A;  2OPR A;  4KFB A;  4RW4 A;  1VRU A;  4C8O A;  1BIZ A;  2HNZ A;  2RKI A;  3U3G A;  4H4O A;  4E89 A;  3MAQ A;  4C8N A;  3VQ7 A;  4FJG A;  2X6S A;  3HJF A;  3AA4 A;  2EX3 A;  4JS4 A;  3IG1 A;  4DU1 A;  4M3X A;  3KIO A;  3TR8 A;  4C8L A;  3D0P A;  4E1M A;  4DTU A;  4DFP A;  2D0A A;  4CEQ A;  3OYM A;  1HYV A;  3WNF A;  4ID1 A;  4OKK A;  3ZT3 A;  3I8D A;  4CGH A;  3HVT A;  4F8R A;  1J54 A;  4DF4 A;  3QNN A;  1CXQ A;  1NJY A;  4FZX C;  4QOZ B;  3WNE A;  4HVJ A;  2Z1H A;  2YNF A;  3MEE A;  4ZTF A;  2B6A A;  4CJ4 A;  4R5P A;  3MXI A;  4DQI A;  1FKO A;  3ZSV A;  1U48 A;  4DFM A;  4KV8 A;  4DQS A;  4DTJ A;  3S3N A;  2F96 A;  1TK8 A;  3V81 A;  1GOC A;  1HRH A;  4HTU A;  5HRS A;  4IBN A;  3NF9 A;  2YNI A;  4KHQ A;  3MEC A;  3O3G A;  4BWJ A;  4FCY A;  4CFD A;  4FJX A;  4CHP A;  4FLU A;  1JLE A;  1CZB A;  2Y1J A;  1SV5 A;  1RT4 A;  4BDP A;  2EHG A;  4NYN A;  4EP5 A;  3OY9 A;  2HHU A;  4NCB A;  4AHV A;  1ZBH A;  2QKB A;  3ASM A;  1XI1 A;  3TI0 A;  4LY7 A;  1EP4 A;  1T03 A;  1EET A;  1DTT A;  1WSE A;  3K57 A;  3SUN A;  1FKP A;  3SUP A;  1HMV A;  4BDY A;  3O3H A;  3JYT A;  3TAQ A;  4RG8 A;  3SPZ A;  1C0T A;  5CYQ A;  4JRQ A;  5E41 A;  2Q3S A;  3LWL A;  2KQ2 A;  3OJS A;  1SL1 A;  4CIF A;  4CIE A;  5KTQ A;  3CFR A;  1D5A A;  4HUE A;  3KD1 E;  1IG9 A;  3K2P A;  5D3G A;  4C8M A;  3AVI A;  1JLC A;  1IKY A;  3KLG A;  1K6Y A;  4FW1 A;  4AHU A;  3LP3 A;  2FBY A;  1LWF A;  3IS9 A;  4BWM A;  2E6M A;  2PZS A;  4IKF A;  4DLG A;  3RTV A;  2ZE2 A;  4B9U A;  3I0S A;  2HHV A;  3QEV A;  1XHX A;  3NDK A;  1IKV A; 
#chains in the Genus database with same CATH topology
 3QIO A;  3PLA A;  4CEA A;  2YHA A;  3ATU A;  3E1Y A;  1NJZ A;  1N36 K;  3E66 A;  4DTS A;  5EVZ A;  1Q9X A;  4Z4G A;  1IKX A;  4IZ9 A;  3NGI A;  4PL7 A;  3VGL A;  3HL8 A;  4DV3 K;  2P9P A;  3TTC A;  4OPH A;  5GIO A;  3OA9 A;  1TKX A;  4BVP A;  4H5V A;  4CBX A;  3SUQ A;  3O9Q A;  2O8C A;  4BRE A;  1NGJ A;  4DSL A;  2VQE K;  1REV A;  2P9S B;  3LL3 A;  4DV4 K;  1K8A O;  5KRS A;  4H03 B;  4H5T A;  3V4I A;  5AZJ B;  1C0M A;  3A5O C;  3MN7 A;  1W97 L;  4FWQ A;  2KTQ A;  3PSF A;  4CHN A;  4CD3 A;  3DLH A;  1TKZ A;  2QI2 A;  1NGB A;  3EL2 A;  1NKB A;  1B9F A;  3AVL A;  4WQ4 A;  1S1X A;  3AY9 A;  3VEY A;  1HKG A;  2P9I A;  2Z1I A;  3QNO A;  4B1Z A;  3DOL A;  4FM1 A;  2IOC A;  4QAG A;  4LF9 K;  4E7H A;  1OH8 A;  1NGH A;  1XQS C;  2VG7 A;  1BG3 A;  3AO1 A;  3HP6 A;  3VQD A;  3CFO A;  3S41 A;  4WQ5 A;  5B8H A;  3EZ5 A;  3HPG A;  1C0F A;  2ZQB A;  2UXC K;  4FM0 A;  4IXC A;  4BC5 A;  5SWM A;  3O9T A;  4H5N A;  4DTN A;  4M7Y A;  3TAM A;  3U3Y A;  4FJL A;  2QWM A;  3SPY A;  1VHX A;  2D0B A;  4CEF A;  1GLC G;  4NLB A;  4H0X B;  2BH1 A;  5AJ3 K;  3CCQ N;  4FYD A;  1K73 O;  3DLR A;  3VOV A;  2FF6 A;  3U8X A;  3UE5 A;  4CJV A;  5AQY A;  4RW8 A;  3DYA A;  4M45 A;  3ZT2 A;  3MXM A;  2GEL A;  5AFU H;  2KKZ A;  1C1B A;  3KKR A;  2F7T A;  4HUG A;  4B3M K;  3OW2 M;  2E2Q A;  3RWU A;  5TKW A;  1JXB A;  3CCU N;  1TL3 A;  2JWK A;  1G99 A;  4OKE A;  2PYJ A;  4ZTJ A;  5I42 A;  4DU3 A;  3NH0 A;  3QIP A;  3O80 A;  3RMC A;  1YJ9 N;  3TAE A;  3M8S A;  2ASO A;  3MXJ A;  1WB9 A;  3F73 A;  1GLJ O;  4KRE A;  4LFB K;  3VQC A;  4DU4 A;  4CF2 A;  1N5Y A;  3CJC A;  2ITG A;  2YV0 X;  3CFP A;  3IUC A;  3AAP A;  3OTO K;  2YHY A;  2KLA A;  4IFE A;  4X62 K;  3DLB A;  2YNH A;  1WUA A;  3VEX A;  1QZ5 A;  1BUP A;  3EYZ A;  1S1V A;  3OYL A;  4YDU A;  4A59 A;  3U4L A;  3U9Z A;  2QK9 A;  4FLY A;  4FZZ A;  1NOY A;  1NKC A;  3WNH A;  3SJJ A;  1X3M A;  4DB3 A;  4DMN A;  5AQQ A;  3CJA A;  3KTQ A;  1VQN N;  4HWI A;  1NWK A;  1DEJ A;  5M1P A;  5CHI A;  1HNV A;  3J8A A;  1NMD A;  1TVR A;  4FLZ A;  4FPA A;  3CC7 N;  3OYI A;  1QTM A;  4H4M A;  5C2D A;  1QQC A;  3CXC M;  3OBW A;  3BGR A;  3I0R A;  3K9K A;  3UKR B;  2LSN A;  1WSF A;  3IFR A;  1XC9 A;  3SI6 A;  1KSP A;  1LCU A;  4FJN A;  5HRP A;  4EZ6 A;  1VQK N;  5KGX A;  2OPQ A;  4CZK A;  1O13 A;  5HP1 A;  4Z4E A;  2H3G X;  3AV9 A;  4E7L A;  4DTO A;  2Q0R A;  3TSU A;  4DHY A;  3C7N A;  2E6L A;  4CGG A;  2PYL A;  1RCH A;  4CEO A;  2W6K A;  3RMD A;  3SYZ A;  5ELZ A;  1R0A A;  4JKD A;  5SZT A;  5ADX H;  4CJ7 A;  4IDH A;  3ZSZ A;  1F21 A;  4KO0 A;  4B08 A;  3QO9 A;  1TK0 A;  4YOT A;  3D2E A;  3LAN A;  1JL1 A;  1QS4 A;  4L3Q A;  4JEP A;  2B5J A;  3KZB A;  5C2F A;  3WXJ A;  1DLO A;  3OYB A;  1L3T A;  4C8K A;  5FPD A;  5J2M A;  2QKB A;  3VQ4 A;  2EWS A;  5LMN K;  2WUS A;  1JKH A;  2GTD A;  3AVB A;  4YOU A;  2HMI A;  3MWP A;  4JLH A;  4KI4 A;  1NJI O;  2YJE A;  1U45 A;  4B9T A;  3W3D A;  4CK1 A;  4I7F A;  4CF1 A;  4BRO A;  4CJQ A;  4BRH A;  4M3T A;  3ZSX A;  1QSS A;  3THW A;  3C94 A;  4CGI A;  4GY2 B;  4CEB A;  1Z26 A;  3OVN A;  4X66 K;  3NF8 A;  1GLD G;  3D6R A;  3FGU A;  3LP2 A;  5DMR A;  5AQJ A;  1KQS M;  1RTI A;  4IWV A;  3VGK A;  2P9U A;  1SL0 A;  4BR4 A;  2JGU A;  4JD2 A;  1TKD A;  4MO4 A;  4DV7 K;  5AQW A;  1L3V A;  1VSD A;  3M8P A;  5KPZ A;  2P9K A;  4OPK A;  3ZSW A;  1VSL A;  2NRX A;  4AHT A;  2G8H A;  2HHW A;  4G9Z A;  3G10 A;  2O8D B;  3HOT A;  4CES A;  3QEX A;  2YHB A;  2F4V K;  1C6V A;  1ZBI A;  4JHD A;  4IJN A;  3QML A;  4CBU A;  3ZX0 A;  1S1T A;  3DXK A;  3T7Z A;  4CER A;  2Q0U A;  3CD6 N;  4BC4 A;  1LWC A;  1NOZ A;  1YAG A;  1QHT A;  4IOC L;  4DR6 K;  3HST B;  3D7E O;  4O44 A;  4DR7 K;  3D45 A;  5IT9 O;  1TGO A;  2O4G A;  3OYF A;  3LZJ A;  4B8A B;  3KWI A;  4B9N A;  3M6G A;  3T1A A;  3AVG A;  4MDA A;  4YFU A;  3ZT0 A;  5I3U A;  4CW7 B;  3AO2 A;  3F9M A;  4E19 A;  1NGE A;  4PY5 A;  4BQL A;  5KPT A;  2A41 A;  3VF2 A;  3OYG A;  3G6E N;  4KHW A;  1IG8 A;  4EZ9 A;  5JS1 A;  4DSE A;  3VMF B;  4DKW A;  3AVA A;  1L3S A;  4B9S A;  4I9Q A;  4DFJ A;  1J9A A;  3M5R A;  1HJR A;  3A0I X;  4CEC A;  2VWJ A;  3EZW A;  1TL1 A;  1TAQ A;  2VWK A;  1ZBF A;  2HF4 A;  2ASP A;  1ZBU A;  4CJR A;  4OX9 K;  1RT5 A;  4CJW A;  1E3M A;  4M3U A;  4DS4 A;  2HHS A;  1KVC A;  2IIR A;  4RW4 A;  3WQU A;  4C8O A;  3UB5 A;  3ZET B;  3HJF A;  4JS4 A;  2P9L B;  2WBN A;  4A62 A;  3TR8 A;  4H0Y B;  3DXM A;  4CEQ A;  3R6M A;  3OYM A;  4ID1 A;  4MDB A;  2ZGY A;  1ZC6 A;  1J54 A;  1H1V A;  3MEE A;  4BG9 A;  4ZTF A;  2B6A A;  4R5P A;  4DQI A;  1RDW X;  3ZSV A;  3PSI A;  2VWB A;  4DQS A;  1VQM N;  4JI8 K;  4HTU A;  4IBN A;  3NF9 A;  5C0Y A;  3VET A;  4CFD A;  1YJW N;  4FLU A;  4FJX A;  4H0V B;  2Y1J A;  1SV5 A;  1RT4 A;  2HHU A;  4NCB A;  5JVH L;  1XI1 A;  1T03 A;  3EO3 A;  1DKG D;  1EET A;  3C6H A;  1MA9 B;  3K57 A;  1V4T A;  1NU0 A;  1FKP A;  3SUP A;  1HMV A;  3TAQ A;  4RG8 A;  1C0T A;  3SJH A;  2YJF A;  5KTQ A;  3CFR A;  1YUW A;  4C8M A;  1IKY A;  3KLG A;  4AHU A;  1BU6 O;  1ATS A;  3IS9 A;  1LWF A;  2PZS A;  3I0S A;  2HHV A;  5BR9 A;  1EQY A;  2WTU A;  4CFB A;  1RDA A;  1BIS A;  2HMP A;  4RW9 A;  4LD0 A;  4LF7 K;  3L8B A;  1KC8 O;  4NB4 A;  4B9L A;  4CF8 A;  4BDZ A;  3IDH A;  3THV A;  3FLC O;  4FLX A;  4DR2 K;  3NVM A;  3ALY A;  5BN8 A;  1FXX A;  1DT9 A;  4WQ5 C;  1VQ6 N;  4I2P A;  1GLA G;  3VQE A;  3QES A;  2X6N A;  3AO5 A;  5GAG P;  3ZSY A;  5EOY A;  4YOV A;  1T6D A;  4O0I A;  4JNE A;  4B1V A;  5BN9 A;  3D2F B;  5BPN A;  1EX4 A;  4FWN A;  3AVF A;  3K0S A;  4B1X B;  4F2R A;  3LPT A;  4FWR A;  1VQL N;  1T44 A;  3TAF A;  4C23 A;  1JLF A;  1GOB A;  1U49 A;  2VYP A;  3ULE B;  3NE6 A;  3RRG A;  1EXQ A;  3DLE A;  4H5R A;  4HCB A;  4WFA L;  2E2P A;  1Q9Y A;  3LDS A;  4AM7 A;  3OYH A;  4BE2 A;  3JXU A;  3E9L A;  4Z4C A;  2A6A A;  4DTX A;  5JVG L;  3JSM A;  4ILG B;  4EIA A;  4A61 A;  1NK9 A;  1U6Z A;  3CME N;  1KAX A;  3BF3 A;  3V9Z A;  4OJR A;  4CCH A;  3CYM A;  2GV9 A;  2GWK A;  3O4Q A;  2RPI A;  2GWJ A;  2X78 A;  2W40 A;  1SS6 A;  3NFA A;  3NH2 A;  1BQM A;  4FJ7 A;  1YTU A;  1Q81 O;  1QQN A;  1CZA N;  3AVC A;  4KH6 A;  3SV4 A;  1SKS A;  4Z4H A;  5AQN A;  3TPQ A;  3QIN A;  3RR7 A;  4CBW A;  4HHT A;  4RW6 A;  3R3L A;  1K8K A;  1U2V B;  1BCO A;  5AQO A;  3IMX A;  1XUP O;  4ELU A;  3E9P A;  4BRP A;  2ZJQ L;  3B6P A;  2QWQ A;  4Q0B A;  1BI4 A;  2QTD A;  2QWR A;  3B8A X;  3HM8 A;  3SLC A;  5AQV A;  3KLI A;  3K58 A;  5E26 A;  1VQP N;  3HOS A;  4J8F A;  3MMV A;  2HVI A;  1RT6 A;  1B9D A;  4YY3 K;  4NO7 A;  4PA1 A;  4EHU A;  4HUF A;  1ASV A;  3TTD A;  4CZI A;  1N6Q A;  4YDU C;  4DTP A;  3KD5 E;  4K25 A;  3HVR A;  1XNQ K;  4FJ5 A;  1W9H A;  4OGC A;  1KLN A;  4CJT A;  2YKM A;  2FSJ A;  4YOY A;  4KB0 A;  1I39 A;  2ATQ A;  4AHC A;  2IDO A;  5AR0 A;  4CJ3 A;  1UA1 A;  4OGE A;  4IO8 A;  4FJJ A;  4Z4F A;  3Q7B A;  3DLK A;  5E84 A;  4JRP A;  4FK4 A;  1TYQ A;  4O4G A;  2HOE A;  3VA3 A;  3FFK B;  5HRN A;  3WXI A;  5FPN A;  2CGJ A;  3V1R A;  4N41 A;  1CZ9 A;  3OYK A;  1T6C A;  1SKR A;  3OJU A;  3NBP A;  1N32 K;  1KLM A;  2NZT A;  4LSN A;  4A2B A;  1J6Z A;  4GNI A;  1CXU A;  3VTI A;  4FLT A;  4JS5 A;  4W5Q A;  3C0B A;  3QDK A;  1HPZ A;  5BPL A;  2O8E B;  3SQ2 A;  2GBZ A;  1WSG A;  3IRX A;  1L5U A;  3EE9 A;  1B92 A;  4CZM A;  4C1N I;  1ZBL A;  3KK1 A;  3K5M A;  3H45 C;  3CM5 A;  3VEZ A;  4DR3 K;  2DTU A;  2YNG A;  3F5T A;  4GVM A;  4FPB A;  3KK2 A;  5FLX O;  3TTF A;  1LOT B;  5AQF A;  3VGM A;  3V9X A;  3C6U A;  4DQ8 A;  2D5R A;  3C95 A;  3OS1 A;  4M3Z A;  3DMJ A;  3CC2 N;  2FBV A;  3M1F A;  1LAV A;  4JKG B;  4B3O A;  2ZM6 K;  3JAM O;  1MWK A;  1RT7 A;  4ELT A;  2NUB A;  3RMB A;  4J2A A;  1S9E A;  2HHT A;  2NRH A;  3SCX A;  4FLV A;  1NKE A;  3HZ6 A;  3MCA B;  4Y0W A;  3DOK A;  1YTA A;  2BUP A;  4JKC A;  1LAW A;  3GE1 A;  5AZI B;  2Z1J A;  3H6E A;  5AQP A;  5KQ8 A;  4OKJ A;  2WC9 A;  4GVE A;  2E2N A;  3K5N A;  3OYA A;  3UKU B;  1GOA A;  1ASU A;  3BDP A;  3VF4 A;  3L6Q A;  3CM6 A;  4GV3 A;  2NRW A;  3CCJ N;  2KZM A;  1IO2 A;  3CER A;  4CJE A;  4M3W A;  3MX2 A;  1JLG A;  3RSE B;  3VES A;  4CF0 A;  5JS2 A;  4BRI A;  5JLH A;  2IGI A;  5EX5 A;  3VEW A;  1VSF A;  3ZSO A;  2QXL A;  1RGI A;  2HST A;  4YNQ A;  3ENH A;  4DFK A;  1LW0 A;  1KXP A;  4AHR A;  4FO0 A;  3V6D A;  1WBD A;  4LFA K;  3FZL A;  4CJP A;  4DTM A;  2OA8 A;  1RIL A;  4N56 A;  5FRM A;  2D0P A;  2QXF A;  1NK8 A;  3KWG A;  4CD1 A;  4NYF A;  1ATN A;  1HR0 K;  3I8B A;  1Q8I A;  1YXQ A;  2G8V A;  4PUO A;  1VK0 A;  3DI6 A;  1S72 N;  1VQ9 N;  3HXM A;  5J1E A;  4K43 A;  3SV3 A;  4FSV A;  4PQU A;  4E0D A;  4Z94 A;  4BR5 A;  2FF3 B;  4MFB A;  4BC2 A;  3ISN C;  1MU2 A;  3PX0 A;  4FVM A;  1BWF O;  5AQZ A;  4DF8 A;  5HRO A;  3O5B A;  4OLA A;  4LH4 A;  3O8M A;  3CPW M;  5GAE P;  2KFN A;  1NGC A;  4A57 A;  1ZXO A;  3MK6 A;  5KGW A;  4JN4 A;  2Q97 A;  2XO7 A;  4FJ9 A;  1WSH A;  4UY8 O;  1T3V A;  5C42 A;  4CFA A;  3TAN A;  4W5T A;  3THX B;  3SUO A;  3HP9 A;  4LSL A;  1SZ2 A;  4M3Y A;  2A42 A;  3IKM A;  4H8K A;  5HL7 L;  3P83 D;  2GX9 A;  1NMN A;  1T8E A;  3O9U A;  1BGX T;  3ZEU A;  5M1F A;  4UQG A;  2AJQ A;  4O8U A;  1GLF O;  3ID8 A;  2KFZ A;  1VSJ A;  4RCH A;  3V1O A;  4BE0 A;  5CR4 A;  4JI0 K;  1ZBS A;  1XC3 A;  4H0P A;  4CZL A;  2FBT A;  3L3V A;  4CHY A;  4LF4 K;  3J7A P;  2ITM A;  2IVP A;  2V7Y A;  4FWM A;  3F9K A;  4ID5 A;  1SUQ A;  1A5X A;  3QFU A;  3GL1 A;  3HM9 A;  2BAN A;  1JCE A;  4BVO A;  4R79 A;  1HUX A;  3CQX A;  1Y64 A;  4CHO A;  3P31 A;  1X9W A;  4FOE A;  4JI4 K;  3MAQ A;  4C8N A;  2YHX A;  1X9J A;  3AA4 A;  4H0T B;  4DU1 A;  4EFH A;  4M3X A;  1KAY A;  4BRQ A;  3OHR A;  4BRL A;  1I94 K;  4OPA A;  2P9P B;  2D0A A;  1HYV A;  3WNF A;  5AFU A;  3ZT3 A;  1MWM A;  2QA4 N;  4BRC A;  2ZJR L;  3F2K A;  4CVN E;  3HVT A;  4KH4 A;  4F8R A;  4DF4 A;  1NJY A;  4FZX C;  2V52 B;  4KRF A;  1KRP A;  1EWR A;  3VPZ A;  1SQK A;  4CJ4 A;  3CPE A;  2O8C B;  1FKO A;  5C12 A;  4NXM K;  4KV8 A;  3D2F A;  3V81 A;  1HKC A;  3LDO A;  5AQX A;  2OAN A;  4GKK K;  2VCP A;  5M1K A;  1JLE A;  1CZB A;  3OY9 A;  2HBL A;  4JI6 K;  3VTH A;  4LY7 A;  1EP4 A;  4O5F A;  3ULE A;  3G4S N;  4ISF A;  5JMV A;  2QWN A;  3RVC A;  5AQL A;  1Q7Y O;  1NGA A;  2QWO A;  4XH1 A;  3KK7 A;  2Q3S A;  5E41 A;  4JRQ A;  3OJS A;  1SL1 A;  5F1X A;  2ASM A;  1BDG A;  2P9I B;  4HUE A;  3KD1 E;  3K2P A;  3QB0 A;  5D3G A;  3AVI A;  2FBY A;  3G25 A;  3WEE A;  1QVF M;  2E6M A;  2E5L K;  4B9U A;  3CF5 L;  2KHO A;  4NYN A;  1SKW A;  3EEQ A;  4FZY A;  3P4I A;  1BQN A;  3J81 O;  3CG7 A;  3HRG A;  4FM2 A;  4BRG A;  4DQR A;  3QER A;  2O8F A;  5FRN A;  5A2Q O;  3C6A A;  1VRT A;  3H1V X;  3CJB A;  1WAF A;  5HLF A;  3KJV A;  1BA0 A;  2ZJP L;  2F9T A;  2I7N A;  4DR4 K;  3THY A;  1RTJ A;  1T05 A;  3SK3 A;  4KHU A;  4AQY K;  4BRD A;  1UOC A;  4Y1C A;  5BRE A;  1IBL K;  5CZ1 A;  4PWD A;  2Z1G A;  3QET A;  1VQ5 N;  3KLH A;  1S3X A;  3H1Q A;  5C15 A;  1XWL A;  3ID6 A;  1KVA A;  5KQD A;  3T3F A;  2OCE A;  3SZ2 A;  4IFY A;  3AA3 A;  4WFB L;  1D4X A;  2WFB A;  4G1Q A;  3KVG A;  3HPO A;  1DTQ A;  4IEI A;  2P9N A;  2RHK A;  3ZYY X;  3WUH A;  3AVJ A;  1NGI A;  5FPM A;  4CZH A;  1RTD A;  2OZS A;  1OVY A;  1W0H A;  1IH7 A;  1S5J A;  2UXB K;  5EXW A;  1J53 A;  3PX4 A;  3N4P A;  2QEX N;  4BRM A;  1EWQ A;  1X3N A;  4FVU A;  5ADX A;  4JYA K;  1IBK K;  2A3Z A;  2WON A;  4BR9 A;  4HTL A;  1BHL A;  3WT0 A;  3R8E A;  2IAJ A;  3MCP A;  3QFP A;  2CGL A;  5HBM A;  4FJI A;  4XEI A;  4IJA A;  2Q36 A;  3SNN A;  3TSQ A;  2PBD A;  4NCA A;  3ULD A;  3HPH A;  4CJS A;  4JI2 K;  4FOI A;  3DRS A;  4BRA A;  3MN6 A;  3LAK A;  4BR7 A;  1N8R O;  1T7P A;  4DV6 K;  3EKU A;  2P9S A;  4NLC A;  2JWL A;  1KVB A;  4CIG A;  1NJW A;  4F3O A;  1HJO A;  4LF6 K;  3LP0 A;  4BE1 A;  5AZJ A;  2E4L A;  1S1U A;  5TKY A;  1HNZ K;  3BZK A;  4M63 C;  4CZF A;  1Y97 A;  4BQZ A;  4DQP A;  4BR0 A;  3FZF A;  2FBX A;  3OYJ A;  4JI5 K;  3ENB A;  4I9L A;  3OYD A;  3OYC A;  4PHT X;  1NBW A;  1JLB A;  2E88 A;  2DY4 A;  3N4Q A;  4FLW A;  1I3A A;  3M8R A;  1XMQ K;  5BPM A;  3VQ6 A;  3OBY A;  4CGJ A;  4KPY A;  3LM2 A;  4KH5 A;  1S6Q A;  1UAX A;  5LJV A;  3TWH A;  1YJN N;  1NK4 A;  2QWL A;  3PY8 A;  1OVQ A;  1GLB G;  1NNE A;  3MWT A;  2VGN A;  4WQ4 C;  2ZF5 O;  3L2U A;  3C7N B;  2G8F A;  5HOO A;  4FWK A;  1O1W A;  2O4I A;  4BC3 A;  5FDL A;  2YX6 A;  1YF5 L;  4J2E A;  1G15 A;  1NK5 A;  2XRI A;  3HBT A;  5GIP A;  3TAB A;  5DM6 L;  1VSM A;  4U67 L;  3SAF A;  1FW6 A;  4X64 K;  3DJC A;  1K9M O;  4IOA L;  3ZT1 A;  1OKJ A;  3LP1 A;  1QSL A;  3ZCM A;  5BRD A;  1BOT O;  3P39 A;  4E1J A;  3NGZ A;  4CK2 A;  3H3O B;  3SAH A;  3D2E B;  4JV5 K;  4OVL A;  2FC0 A;  3P5J A;  1HQE A;  3M8Q A;  1RDU A;  1LV5 A;  5J2N A;  3BUZ B;  2W41 A;  2G8W A;  3CC4 N;  1FJG K;  2HND A;  4LH5 A;  3RRH A;  2ETJ A;  4M41 A;  1WSJ A;  3T1Y K;  1UWB A;  3ZSQ A;  2ZD1 A;  4IG3 A;  4LC9 B;  4CFC A;  2BDP A;  4CJ5 A;  5K14 A;  2HHH K;  1C0G A;  3PIP L;  3S3O A;  1NG9 A;  4Q5V A;  4KHN A;  2DFF A;  3H3N O;  3I33 A;  4CZJ A;  3THW B;  4I6M B;  4TSX A;  3ZSR A;  2RE2 A;  1C0U A;  2XY5 A;  4RTF D;  1HX1 A;  2P9U B;  2G8K A;  2VG6 A;  4JD2 B;  3CI5 A;  5FPE A;  4U7B A;  2UUB K;  4B3T K;  1JL2 A;  4CZG A;  2P9K B;  4E3S A;  1RT1 A;  1VQ4 N;  3A5L C;  4KB1 A;  4FWL A;  4J2B A;  3AO4 A;  3E9O A;  1QVG M;  4WF9 L;  4B1W B;  2OYQ A;  2IVO A;  3DM2 A;  3QEI A;  3K5O A;  3L4I A;  4O5B A;  3DLG A;  4JHD B;  4JKF A;  1S9G A;  3CJ7 A;  3BY5 A;  3QBW A;  3TAG A;  1MDU B;  2XY7 A;  1CLQ A;  3A2F A;  4E7I A;  4RW7 A;  4B9Q A;  4ILJ A;  3VEO A;  3LZI A;  2AA4 A;  3VQ8 A;  5IWA K;  3T19 A;  3VN5 A;  2HNY A;  3CIP A;  1VQO N;  1XHZ A;  4IFV A;  2UU9 K;  3I56 N;  5JIC A;  3AAQ A;  3O9S A;  4JKA A;  1NJX A;  3UKR A;  1RNH A;  1UA0 A;  1RBS A;  4DTR A;  3HSC A;  3CCR N;  5JLF A;  1TAU A;  1D9D A;  3IAY A;  5AQG A;  1U4B A;  1NK7 A;  3AVH A;  3BP8 A;  1YVN A;  4N5S A;  3WXM B;  2VGM A;  1TUU A;  1OH7 A;  1Z05 A;  5J2Q A;  1RT3 A;  5AQR A;  4FW2 A;  1S6P A;  3BEX A;  2YKN A;  3NH1 A;  3VA0 A;  2CH6 A;  4XH4 A;  3AVN A;  1QE1 A;  1JJ2 M;  1VQ7 N;  3NMU A;  2DFE A;  4H0O A;  2E20 A;  4E1N A;  1KFD A;  1RBR A;  3LWM A;  4CJL A;  2NRR A;  2A1S A;  2W6L A;  3DXM B;  3DLL L;  2DFH A;  5AQH A;  4FJK A;  1BCM A;  2KW4 A;  1LWE A;  4K42 A;  3WXK A;  4AH9 A;  1S1W A;  3A5M C;  1WN7 A;  4CEE A;  1Q86 O;  2O8B B;  3AAR A;  3KK3 A;  2GEM A;  5LY3 A;  1X1P A;  5F0X A;  3CCM N;  4DSJ A;  3QEW A;  1BA1 A;  3CCV N;  3O4N A;  2OTL N;  4N47 A;  5FRO A;  4LF5 K;  3HK2 A;  1ILY A;  1IBM K;  4DLE A;  1HNI A;  4BRF A;  3FR0 A;  2HVH A;  3A5N C;  5KI6 A;  3WNG A;  1WBB A;  4FWO A;  1BL3 A;  2KZZ A;  3SMS A;  2G8I A;  2G8U A;  4EAH D;  4IDK A;  2HB5 A;  4YOW A;  4N76 A;  2F8T A;  4M42 A;  1RBU A;  4DQQ A;  1RTH A;  1NM1 A;  2B4J A;  2VG5 A;  2O8D A;  2GUI A;  3AVK A;  4GKJ K;  1W7A A;  4CI6 A;  3Q7C A;  1HYS A;  4O55 A;  4CE9 A;  4C1N K;  2IS3 A;  4KHY A;  4DV0 K;  4MO5 A;  2RKI A;  4A5B A;  3U3G A;  4H4O A;  4E89 A;  1YIT N;  3SMP A;  3VQ7 A;  2X6S A;  1IJJ A;  4AM6 A;  2EX3 A;  3IG1 A;  2NRT A;  3D0P A;  4GV9 A;  1HNW K;  4E1M A;  4DTU A;  2QM1 A;  3FZK A;  3I8D A;  1HKB A;  3QNN A;  4DR1 K;  4HVJ A;  3O08 A;  2YNF A;  4DFM A;  3VEV A;  4DTJ A;  1TK8 A;  1GOC A;  1HRH A;  4F9O A;  2YNI A;  3MEC A;  2D1K A;  3TSP A;  4BDP A;  4DR5 K;  2EHG A;  4EP5 A;  3BF1 A;  4AHV A;  4YOX A;  5GIN A;  4AF1 A;  1WSE A;  4BDY A;  3O3H A;  3JYT A;  3SPZ A;  3ATV A;  4M7X A;  3P38 A;  4NXN K;  4JK9 A;  4CIF A;  4CIE A;  1Q82 O;  3FZM A;  1IG9 A;  2D4W A;  5GAD P;  1JLC A;  4LFC K;  1W2B M;  3LP3 A;  4BWM A;  3T1H K;  3RTV A;  2ZE2 A;  3QEV A;  1XHX A;  3NDK A;  4RWT A;  5AQT A;  4H5W A;  2P1J A;  4OO1 J;  1BO5 O;  4BRK A;  1WAJ A;  3ZX3 A;  2GUP A;  3KKS A;  3ZET A;  1NGF A;  2V7Z A;  2P9L A;  3L2R A;  3GBT A;  3DRR A;  2HW3 A;  5CE3 A;  4KTZ A;  1P8Z A;  5I9E B;  2UYT A;  3K9J A;  1TKT A;  2NNW A;  1IV0 A;  3NF6 A;  3VQP A;  4GW6 A;  4MLH A;  4A2A A;  3J7Y P;  3H46 O;  3HTV A;  4CGF A;  4PKI A;  4E7K A;  5BRH A;  4IG0 A;  3SQ0 A;  1VSH A;  1WSI A;  1A5V A;  1K8K B;  3CCL N;  4JK7 A;  3SBT A;  2HBJ A;  3RMA A;  4O0J A;  5LJW A;  1VSK A;  3SAG A;  5EU7 A;  4DSF A;  2XY6 A;  3VQB A;  3LDQ A;  4CJU A;  4FL9 A;  2BGG A;  1BI4 B;  4B3R K;  3LDL A;  3OS0 A;  1N33 K;  3SQ4 A;  5KPR A;  5CYM A;  4EHT A;  3VQQ A;  3J7Z O;  1KTQ A;  4J2D A;  3J80 O;  4JI3 K;  3AA5 X;  1QHA A;  4WCE L;  4FXD A;  4CHZ A;  3HT3 A;  2PY5 A;  1EO1 A;  1C1C A;  1V4S A;  4QS7 A;  3DAW A;  3W0L A;  3CET A;  1KAZ A;  2CGK A;  5BRF A;  4BAC A;  4XIU A;  4BGA A;  3O3F A;  1L3U A;  3VQ5 A;  2ZGZ A;  2E2O A;  2A5X A;  1RDD A;  2OPP A;  3L0Q A;  1J5O A;  1YI2 N;  1KFS A;  1ZYQ A;  3LPU A;  4ELV A;  1RBT A;  3WXL A;  2A40 A;  2RN2 A;  3PO4 A;  4QCL A;  4Z0U A;  3G0Z A;  1ASW A;  3UIQ A;  3L3U A;  3BZC A;  1TYQ B;  3R9P A;  1GLE G;  3NHG A;  4ICL A;  4Z4I A;  3FE1 A;  3V9W A;  3O9R A;  4O8K A;  3AO3 A;  2JLE A;  2NRV A;  1TUY A;  3QLH A;  2F8S A;  1JCG A;  2V51 B;  1P90 A;  2E1Y A;  3E01 A;  3U6F A;  1RFQ A;  3ITH A;  4K8Z A;  2E8A A;  4Y1D A;  5C10 A;  2P5G A;  3CHW A;  3AVM A;  4CEZ A;  3DRP A;  3L2V A;  4DV5 K;  5AQM A;  3AA2 A;  5M1O A;  2PFU A;  3MED A;  5AQU A;  3HYF A;  4B9V A;  1YIJ N;  4I6M A;  4AIL C;  2QKK A;  4JKB A;  1NK6 A;  4EP4 A;  3PUF A;  4B1U B;  2HBM A;  4F2S A;  1XNR K;  2NRZ A;  1QZ6 A;  3V9S A;  4CHQ A;  1JLQ A;  4WYB A;  1GLL O;  4W5N A;  1ITG A;  4OPJ A;  1VSE A;  3V9U A;  3EN9 A;  4CF9 A;  3K5L A;  3O4W A;  3NAE A;  2BE2 A;  2Q31 A;  4B1Y B;  4KHP K;  2CH5 A;  1U2V A;  2QW9 A;  2A1R A;  5C25 A;  1E4F T;  1IKW A;  3DWL A;  1ATR A;  4FK2 A;  3EY1 A;  2P5O A;  1X9M A;  3C6T A;  2XHB A;  4B8C A;  4CK3 A;  4X65 K;  2IC3 A;  4MQ3 A;  2VQF K;  3SBG A;  3A8Y A;  1YVU A;  4W5O A;  1QSY A;  1U04 A;  3TU5 A;  3R1X A;  1XMO K;  3S9H A;  4BRN A;  3L2W A;  4A5A A;  1WLJ A;  2D0C A;  2WOM A;  4FJH A;  4JAX A;  5KRT A;  1U47 A;  5HRR A;  1M1K O;  1VAZ A;  2FLO A;  2YI1 A;  1ESV A;  3O1B A;  4FJ8 A;  4DSK A;  3EE8 A;  4CJF A;  2HHQ A;  2IVN A;  3CQ8 A;  4K0K K;  3H08 A;  3RR8 A;  1TV6 A;  5AQI A;  5AQK A;  4F4K A;  3MN9 A;  4FK0 A;  2Y1I A;  2FSK A;  1D9F A;  3VQ9 A;  2FXU A;  3FFI A;  5LMU K;  4K8X A;  1J5E K;  3QIC A;  5DK5 A;  5J2P A;  4JKE A;  3SQ1 A;  3KLE A;  4FWP A;  3V1Q A;  2XY8 A;  5C24 A;  2DPN A;  1Z25 A;  3O1W A;  4B9M A;  1R59 O;  3I55 N;  4DCH A;  2O8E A;  3LM9 A;  4GMJ B;  4PL8 A;  3OYN A;  1WNS A;  3VQA A;  4NCG A;  1EKE A;  3K59 A;  1SAZ A;  1NGG A;  5GAH P;  4KHS A;  3LAL A;  1A5W A;  3VEN A;  3NCI A;  1X9S A;  5BR8 K;  1Q18 A;  2O8B A;  2OZM A;  4L8R B;  5EY4 A;  3MN5 A;  4KBO A;  3AGR A;  4DSI A;  2R7Y A;  4I2Q A;  3MDQ A;  3NVK A;  4KTQ A;  4JKH A;  2I5J A;  1OH5 A;  1RDC A;  3LDN A;  5MLC Q;  3MEG A;  1RDB A;  3NGY A;  4DV2 K;  1HNX K;  2OTJ N;  4JKG A;  4V19 S;  3LAM A;  1D8Y A;  4BGB A;  4B3S K;  1HYZ A;  2NLX A;  3ZEU B;  4CZE A;  4HCC A;  3OYE A;  2PAV A;  3PV8 A;  4KAZ A;  4KI6 A;  3CCE N;  1Z6R A;  1YT3 A;  4JI7 K;  4CJK A;  4CGD A;  3L2Q A;  4DG1 A;  4DS5 A;  3B6O A;  3WQT A;  2E1Z A;  1S22 A;  4M3R A;  1OH6 A;  1SL2 A;  3ENO A;  2Q2R A;  2BTF A;  5CZ2 A;  4FJM A;  4WE1 A;  3ZLJ A;  3KHY A;  1RT2 A;  2HBK A;  3MX5 A;  5AZI A;  2P51 A;  3S3M A;  1KCF A;  5T7B A;  3CCS N;  3P1G A;  2RF2 A;  3UKU A;  4CED A;  3ZT4 A;  4F3T A;  4DUY K;  5M1Q A;  4OLB A;  3TAR A;  2YCH A;  3TAP A;  3HO1 A;  1C1A A;  4FWS A;  1WOQ A;  3M3Z A;  4YOR A;  1JXE A;  3RSE A;  1E4G T;  4DWI A;  1DGK N;  4DV1 K;  2OPS A;  2HHX A;  2QWP A;  4AHS A;  4YHH K;  1JLA A;  4QS9 A;  4E7J A;  1M90 O;  4GV6 A;  4PKH A;  1FK9 A;  4JI1 K;  4MLE A;  3C65 A;  3NF7 A;  5H1S Q;  4ZHR A;  2F9W A;  3KLF A;  4KTW A;  3PO5 A;  3AGK A;  2Q1N A;  1NK0 A;  2W42 A;  1KD1 O;  2ZWH A;  3HI0 A;  5CY4 A;  1NLV A;  4KKO A;  1VQ8 N;  4LF8 K;  1QQM A;  3CJ1 A;  1YHQ N;  1RBV A;  3QEP A;  4ISE A;  1VSI A;  2D0O A;  1TK5 A;  5DM7 L;  3VER A;  1BIU A;  4PKG A;  3L4Q A;  4K41 A;  4W5R A;  3CMA N;  1LW2 A;  4ISG A;  3PX6 A;  3JS6 A;  3OS2 A;  5F2R A;  3WEE B;  2I7P A;  2X74 A;  3GOI A;  2UUA K;  2YHW A;  1HQU A;  2OPR A;  4KFB A;  1VRU A;  4JK8 A;  1BIZ A;  2HNZ A;  2O8F B;  4ILH A;  4FJG A;  3ZX2 A;  1NGD A;  4WFN L;  3KIO A;  4C8L A;  3O6W A;  3DXK B;  4DFP A;  5AQS A;  4IO9 L;  4OKK A;  3THY B;  4BY9 C;  4BG8 A;  3G71 N;  4CGH A;  3LDP A;  3U9D A;  1CXQ A;  4QOZ B;  3WNE A;  2Z1H A;  4DUZ K;  3EKS A;  3MXI A;  1U48 A;  3CJ9 A;  1HLU A;  3QBX A;  5LL6 Z;  3S3N A;  2F96 A;  5HRS A;  3THX A;  4KHQ A;  3O3G A;  4BWJ A;  4FCY A;  4BR2 A;  4CHP A;  4IEE A;  2AP1 A;  3PIO L;  2HF3 A;  1N34 K;  1ZBH A;  2P9N B;  3ASM A;  1QQO A;  3VF6 A;  3T69 A;  3TI0 A;  1DTT A;  4IOX A;  4QS8 A;  2UXD K;  3SUN A;  3GDQ A;  3CQY A;  2J4R A;  3FZH A;  4XH5 A;  5CYQ A;  3GG4 A;  3LWL A;  2KQ2 A;  1D5A A;  5M1N A;  1K6Y A;  4FW1 A;  2FSN A;  4IKF A;  4DLG A;  1JCF A;  2UUC K;  1IKV A;  1HPM A; 
#chains in the Genus database with same CATH homology
 4CFB A;  1RDA A;  3QIO A;  4FZY A;  1BIS A;  1BQN A;  4CEA A;  2YHA A;  2P1J A;  3CG7 A;  4RW9 A;  4FM2 A;  1NJZ A;  1WAJ A;  4LD0 A;  3KKS A;  4DQR A;  3QER A;  5FRN A;  1VRT A;  4DTS A;  3L8B A;  5HLF A;  1WAF A;  1IKX A;  1Q9X A;  3KJV A;  3L2R A;  3NGI A;  4B9L A;  4Z4G A;  4CF8 A;  3HL8 A;  4BDZ A;  3DRR A;  2HW3 A;  4KTZ A;  4KRF A;  1RTJ A;  4FLX A;  3THV A;  1T05 A;  4KHU A;  1TKT A;  1TKX A;  1UOC A;  4Y1C A;  3ALY A;  3NF6 A;  5CZ1 A;  3VQP A;  3SUQ A;  4PWD A;  4GW6 A;  1FXX A;  2Z1G A;  3QET A;  4I2P A;  3KLH A;  3VQE A;  3QES A;  2X6N A;  3AO5 A;  3ZSY A;  4CGF A;  4DSL A;  4E7K A;  1XWL A;  4O0I A;  3SQ0 A;  1KVA A;  1REV A;  1VSH A;  4IG0 A;  1WSI A;  3T3F A;  1A5V A;  1EX4 A;  3AVF A;  3SZ2 A;  4IFY A;  3AA3 A;  5KRS A;  4F2R A;  3RMA A;  4O0J A;  1VSK A;  3LPT A;  4G1Q A;  5EU7 A;  4DSF A;  3V4I A;  2XY6 A;  1C0M A;  3VQB A;  1DTQ A;  3HPO A;  4CJU A;  2KTQ A;  4CHN A;  3DLH A;  3TAF A;  3AVJ A;  2BGG A;  1BI4 B;  1TKZ A;  1RTD A;  2OZS A;  3OS0 A;  1JLF A;  1GOB A;  1W0H A;  1NKB A;  3SQ4 A;  1U49 A;  1B9F A;  5CYM A;  4PUO A;  1IH7 A;  3VQQ A;  1KTQ A;  3AVL A;  1S5J A;  3NE6 A;  3RRG A;  1EXQ A;  4J2D A;  1S1X A;  3DLE A;  1J53 A;  4HCB A;  3AA5 X;  2Z1I A;  4FXD A;  3QNO A;  4CHZ A;  3HT3 A;  1Q9Y A;  3LDS A;  2PY5 A;  3DOL A;  4FM1 A;  2IOC A;  1C1C A;  4QAG A;  3PX4 A;  4E7H A;  2VG7 A;  3OYH A;  4BE2 A;  3AO1 A;  3HP6 A;  3VQD A;  3CFO A;  4BAC A;  4XIU A;  3O3F A;  1L3U A;  3VQ5 A;  4Z4C A;  3EZ5 A;  4DTX A;  1RDD A;  2OPP A;  2WON A;  3HPG A;  3JSM A;  1J5O A;  2ZQB A;  4FM0 A;  4B9S A;  1BHL A;  1KFS A;  1ZYQ A;  2IAJ A;  1NK9 A;  3LPU A;  5HBM A;  5SWM A;  4ELV A;  1KRP A;  1RBT A;  4OJR A;  2RN2 A;  3V9Z A;  3PO4 A;  4FJI A;  4QCL A;  4Z0U A;  4DTN A;  3SNN A;  4CCH A;  3CYM A;  2GV9 A;  3G0Z A;  3O4Q A;  1ASW A;  2RPI A;  3UIQ A;  4NCA A;  2X78 A;  3L3U A;  3HPH A;  4CJS A;  3TAM A;  3ULD A;  3NFA A;  3NH2 A;  3U3Y A;  4FJL A;  1BQM A;  4FJ7 A;  3SPY A;  1YTU A;  3DRS A;  2D0B A;  3NHG A;  3LAK A;  4ICL A;  4CEF A;  3AVC A;  3SV4 A;  1SKS A;  4Z4I A;  4Z4H A;  1T7P A;  3QIN A;  3V9W A;  3RR7 A;  4HHT A;  4RW6 A;  3AO3 A;  4FYD A;  2JLE A;  1BCO A;  3DLR A;  1KVB A;  4CIG A;  1NJW A;  3QLH A;  4F3O A;  2F8S A;  4ELU A;  4CJV A;  3LP0 A;  4BE1 A;  4RW8 A;  2E4L A;  3DYA A;  4M45 A;  3E01 A;  3B6P A;  3ZT2 A;  3U6F A;  4Q0B A;  1S1U A;  1BI4 A;  3MXM A;  3ITH A;  4K8Z A;  4Y1D A;  2P5G A;  1C1B A;  1Y97 A;  3KLI A;  3K58 A;  3KKR A;  3AVM A;  4HUG A;  4DQP A;  4CEZ A;  3RWU A;  2HVI A;  1JXB A;  2FBX A;  3OYJ A;  1RT6 A;  1TL3 A;  1B9D A;  3DRP A;  4OKE A;  4PA1 A;  4I9L A;  2PYJ A;  3L2V A;  5I42 A;  4DU3 A;  4HUF A;  4ZTJ A;  1ASV A;  3OYD A;  3OYC A;  1N6Q A;  3AA2 A;  4DTP A;  1JLB A;  3KD5 E;  3NH0 A;  3QIP A;  2DY4 A;  4FLW A;  3RMC A;  3HVR A;  3MED A;  3HYF A;  3TAE A;  1I3A A;  4C8K A;  1W9H A;  3M8R A;  3M8S A;  4OGC A;  4AIL C;  4B9V A;  2QKK A;  1KLN A;  3MXJ A;  3VQ6 A;  4CGJ A;  4CJT A;  2YKM A;  1NK6 A;  4KB0 A;  4KPY A;  1I39 A;  4EP4 A;  1S6Q A;  1UAX A;  3TWH A;  2ATQ A;  1NK4 A;  3PUF A;  4AHC A;  3F73 A;  2IDO A;  4F2S A;  3PY8 A;  4KRE A;  3VQC A;  3V9S A;  4CJ3 A;  4CHQ A;  1JLQ A;  4OGE A;  1UA1 A;  4DU4 A;  4CF2 A;  4FJJ A;  1N5Y A;  4Z4F A;  2ITG A;  4W5N A;  3DLK A;  3L2U A;  2G8F A;  1ITG A;  2YV0 X;  3CFP A;  4OPJ A;  4JRP A;  4FK4 A;  1O1W A;  4O4G A;  2O4I A;  5FDL A;  3VA3 A;  1VSE A;  3V9U A;  5HRN A;  4J2E A;  1G15 A;  3V1R A;  4CF9 A;  1NK5 A;  2XRI A;  3K5L A;  1CZ9 A;  4N41 A;  3OYK A;  3TAB A;  1SKR A;  1VSM A;  3NAE A;  2BE2 A;  3OJU A;  3DLB A;  2YNH A;  3NBP A;  1KLM A;  3ZT1 A;  3LP1 A;  1QSL A;  4LSN A;  1S1V A;  3ZCM A;  3EYZ A;  3OYL A;  3NGZ A;  4CK2 A;  2A1R A;  1CXU A;  4FLT A;  2QK9 A;  5C25 A;  4JS5 A;  4OVL A;  4FLY A;  4FZZ A;  2FC0 A;  1NOY A;  1IKW A;  1NKC A;  3P5J A;  3WNH A;  1HQE A;  4W5Q A;  4FK2 A;  3SJJ A;  3EY1 A;  1HPZ A;  3M8Q A;  2P5O A;  4DMN A;  5J2N A;  1LV5 A;  3SQ2 A;  1X9M A;  3KTQ A;  2GBZ A;  3C6T A;  1WSG A;  4FJ5 A;  2G8W A;  3IRX A;  2XHB A;  4B8C A;  1L5U A;  4CK3 A;  2HND A;  1B92 A;  4LH5 A;  2IC3 A;  1HNV A;  2ETJ A;  4MQ3 A;  3RRH A;  4I9Q A;  1ZBL A;  1TVR A;  1YVU A;  3KK1 A;  4M41 A;  1WSJ A;  4W5O A;  3K5M A;  3CM5 A;  4FLZ A;  1UWB A;  1U04 A;  3ZSQ A;  1QSY A;  2ZD1 A;  4IG3 A;  3S9H A;  4CFC A;  3OYI A;  4CJ5 A;  5K14 A;  2BDP A;  2DTU A;  1QTM A;  4H4M A;  3L2W A;  1QQC A;  2YNG A;  3S3O A;  4Q5V A;  4GVM A;  4KHN A;  3KK2 A;  1WLJ A;  2D0C A;  2DFF A;  2WOM A;  4FJH A;  3BGR A;  3I0R A;  5KRT A;  1U47 A;  5HRR A;  3V9X A;  3C6U A;  2LSN A;  1WSF A;  2D5R A;  1XC9 A;  3C95 A;  4TSX A;  3ZSR A;  3SI6 A;  1KSP A;  4FJN A;  3OS1 A;  5HRP A;  4EZ6 A;  1C0U A;  4FJ8 A;  4M3Z A;  3DMJ A;  4DSK A;  2XY5 A;  2FBV A;  1LAV A;  5KGX A;  4CJF A;  4B3O A;  2OPQ A;  2HHQ A;  3CQ8 A;  5HP1 A;  4Z4E A;  4ELT A;  1RT7 A;  2G8K A;  2NUB A;  3AV9 A;  4E7L A;  4DTO A;  3RMB A;  2VG6 A;  4J2A A;  1S9E A;  3H08 A;  2HHT A;  3RR8 A;  2E6L A;  1TV6 A;  4F4K A;  4CGG A;  3SCX A;  2PYL A;  4FLV A;  1NKE A;  1RCH A;  4FK0 A;  2Y1I A;  3DOK A;  3VQ9 A;  4CEO A;  1D9F A;  3RMD A;  3SYZ A;  1YTA A;  1JL2 A;  3FFI A;  4K8X A;  4E3S A;  1R0A A;  1RT1 A;  5SZT A;  5DK5 A;  4KB1 A;  4J2B A;  3AO4 A;  5J2P A;  3SQ1 A;  1LAW A;  3ZSZ A;  1F21 A;  4KO0 A;  2OYQ A;  4B08 A;  3KLE A;  3DM2 A;  3QO9 A;  1TK0 A;  2Z1J A;  3QEI A;  3K5O A;  3V1Q A;  2XY8 A;  3LAN A;  4O5B A;  5C24 A;  1L3T A;  1JL1 A;  3DLG A;  1Z25 A;  1QS4 A;  4OKJ A;  4B9M A;  1S9G A;  2B5J A;  3K5N A;  4GMJ B;  3OYA A;  1DLO A;  3TAG A;  3OYN A;  1WNS A;  3OYB A;  1GOA A;  2XY7 A;  1ASU A;  3A2F A;  3VQA A;  4NCG A;  1EKE A;  5J2M A;  1SKW A;  3K59 A;  4E7I A;  3CM6 A;  3BDP A;  4RW7 A;  3VQ4 A;  3LAL A;  4KHS A;  1JKH A;  1A5W A;  3AVB A;  3NCI A;  1X9S A;  2KZM A;  2HMI A;  1IO2 A;  4JLH A;  3LZI A;  4CJE A;  4KI4 A;  4M3W A;  3VQ8 A;  3T19 A;  2OZM A;  1JLG A;  3VN5 A;  4L8R B;  1U45 A;  4CF0 A;  4B9T A;  5JS2 A;  2HNY A;  1XHZ A;  4CK1 A;  4I7F A;  4CF1 A;  4IFV A;  4DSI A;  2IGI A;  2R7Y A;  4I2Q A;  1VSF A;  3ZSO A;  4CJQ A;  4KTQ A;  1NJX A;  4M3T A;  1RNH A;  3ZSX A;  1QSS A;  4YNQ A;  3C94 A;  2I5J A;  1LW0 A;  4CGI A;  4DFK A;  1UA0 A;  1RDC A;  1RBS A;  4CEB A;  1Z26 A;  3MEG A;  4DTR A;  1RDB A;  3NGY A;  3OVN A;  1TAU A;  4AHR A;  1D9D A;  3IAY A;  3NF8 A;  3LAM A;  3LP2 A;  5DMR A;  1U4B A;  1D8Y A;  1RTI A;  1NK7 A;  3AVH A;  1HYZ A;  3V6D A;  1SL0 A;  4CJP A;  4DTM A;  2OA8 A;  1RIL A;  2JGU A;  4N56 A;  4N5S A;  4HCC A;  5FRM A;  3OYE A;  2QXF A;  1NK8 A;  3PV8 A;  1TKD A;  4KAZ A;  4KI6 A;  5J2Q A;  1L3V A;  1VSD A;  1RT3 A;  1YT3 A;  3M8P A;  4NYF A;  4CGD A;  4CJK A;  3L2Q A;  4DG1 A;  4FW2 A;  1Q8I A;  3B6O A;  4DS5 A;  2G8V A;  1S6P A;  4M3R A;  2YKN A;  3ZSW A;  4OPK A;  1VSL A;  4AHT A;  3NH1 A;  2G8H A;  1VK0 A;  3DI6 A;  2HHW A;  1SL2 A;  3HXM A;  3G10 A;  3VA0 A;  5CZ2 A;  5J1E A;  3SV3 A;  4CES A;  4FJM A;  4WE1 A;  4PQU A;  3AVN A;  4E0D A;  1QE1 A;  1RT2 A;  3QEX A;  2P51 A;  2YHB A;  1C6V A;  4MFB A;  3ISN C;  3S3M A;  1ZBI A;  1KCF A;  1MU2 A;  2DFE A;  5T7B A;  3PX0 A;  4FVM A;  3P1G A;  4E1N A;  2RF2 A;  4CED A;  4DF8 A;  1KFD A;  1RBR A;  1S1T A;  3ZT4 A;  4CJL A;  3LWM A;  4F3T A;  4CER A;  2A1S A;  4OLB A;  3TAR A;  3TAP A;  3HO1 A;  1LWC A;  5HRO A;  1C1A A;  1NOZ A;  1QHT A;  3HST B;  2DFH A;  4OLA A;  1JXE A;  4LH4 A;  4O44 A;  4FJK A;  3D45 A;  1BCM A;  2KW4 A;  2KFN A;  1LWE A;  1TGO A;  2O4G A;  3OYF A;  3LZJ A;  1CLQ A;  4AH9 A;  4B8A B;  4B9N A;  4DWI A;  1S1W A;  2OPS A;  5KGW A;  3T1A A;  2HHX A;  3AVG A;  1WN7 A;  4YFU A;  3ZT0 A;  4AHS A;  4CEE A;  5I3U A;  4FJ9 A;  2XO7 A;  3KK3 A;  3AO2 A;  1WSH A;  1JLA A;  4E7J A;  4E19 A;  1X1P A;  1FK9 A;  4CFA A;  5C42 A;  3TAN A;  4PY5 A;  4DSJ A;  3NF7 A;  4W5T A;  3QEW A;  4ZHR A;  3SUO A;  3O4N A;  3HP9 A;  4KTW A;  3KLF A;  4N47 A;  5FRO A;  3PO5 A;  4LSL A;  3HK2 A;  3OYG A;  4M3Y A;  1NK0 A;  2W42 A;  4H8K A;  3P83 D;  5CY4 A;  4DLE A;  4KHW A;  1HNI A;  1T8E A;  4EZ9 A;  4KKO A;  5JS1 A;  2HVH A;  4DSE A;  5KI6 A;  1BGX T;  2AJQ A;  3WNG A;  4UQG A;  1RBV A;  1BL3 A;  3AVA A;  3QEP A;  1L3S A;  2G8I A;  2G8U A;  2KFZ A;  1VSJ A;  2KZZ A;  4IDK A;  2HB5 A;  3V1O A;  1J9A A;  1VSI A;  4BE0 A;  4DFJ A;  1HJR A;  4CEC A;  1TK5 A;  1BIU A;  2VWJ A;  4N76 A;  2F8T A;  4M42 A;  1RBU A;  4W5R A;  4DQQ A;  2FBT A;  1TL1 A;  3L3V A;  4CHY A;  1TAQ A;  1RTH A;  1LW2 A;  2VWK A;  2B4J A;  1ZBF A;  2VG5 A;  3F9K A;  1ZBU A;  1SUQ A;  1A5X A;  2GUI A;  4ID5 A;  4CJR A;  1RT5 A;  3AVK A;  4CJW A;  3PX6 A;  3OS2 A;  4M3U A;  4DS4 A;  3HM9 A;  1HYS A;  2BAN A;  4O55 A;  2X74 A;  2HHS A;  1KVC A;  4CE9 A;  4CHO A;  1X9W A;  2IS3 A;  1HQU A;  4KHY A;  2OPR A;  4KFB A;  4RW4 A;  1VRU A;  4C8O A;  1BIZ A;  2HNZ A;  2RKI A;  3U3G A;  4H4O A;  4E89 A;  3MAQ A;  4C8N A;  3VQ7 A;  4FJG A;  2X6S A;  3HJF A;  3AA4 A;  2EX3 A;  4JS4 A;  3IG1 A;  4DU1 A;  4M3X A;  3KIO A;  3TR8 A;  4C8L A;  3D0P A;  4E1M A;  4DTU A;  4DFP A;  2D0A A;  4CEQ A;  3OYM A;  1HYV A;  3WNF A;  4ID1 A;  4OKK A;  3ZT3 A;  3I8D A;  4CGH A;  3HVT A;  4F8R A;  1J54 A;  4DF4 A;  3QNN A;  1CXQ A;  1NJY A;  4FZX C;  4QOZ B;  3WNE A;  4HVJ A;  2Z1H A;  2YNF A;  3MEE A;  4ZTF A;  2B6A A;  4CJ4 A;  4R5P A;  3MXI A;  4DQI A;  1FKO A;  3ZSV A;  1U48 A;  4DFM A;  4KV8 A;  4DQS A;  4DTJ A;  3S3N A;  2F96 A;  1TK8 A;  3V81 A;  1GOC A;  1HRH A;  4HTU A;  5HRS A;  4IBN A;  3NF9 A;  2YNI A;  4KHQ A;  3MEC A;  3O3G A;  4BWJ A;  4FCY A;  4CFD A;  4FJX A;  4CHP A;  4FLU A;  1JLE A;  1CZB A;  2Y1J A;  1SV5 A;  1RT4 A;  4BDP A;  2EHG A;  4NYN A;  4EP5 A;  3OY9 A;  2HHU A;  4NCB A;  4AHV A;  1ZBH A;  2QKB A;  3ASM A;  1XI1 A;  3TI0 A;  4LY7 A;  1EP4 A;  1T03 A;  1EET A;  1DTT A;  1WSE A;  3K57 A;  3SUN A;  1FKP A;  3SUP A;  1HMV A;  4BDY A;  3O3H A;  3JYT A;  3TAQ A;  4RG8 A;  3SPZ A;  1C0T A;  5CYQ A;  4JRQ A;  5E41 A;  2Q3S A;  3LWL A;  2KQ2 A;  3OJS A;  1SL1 A;  4CIF A;  4CIE A;  5KTQ A;  3CFR A;  1D5A A;  4HUE A;  3KD1 E;  1IG9 A;  3K2P A;  5D3G A;  4C8M A;  3AVI A;  1JLC A;  1IKY A;  3KLG A;  1K6Y A;  4FW1 A;  4AHU A;  3LP3 A;  2FBY A;  1LWF A;  3IS9 A;  4BWM A;  2E6M A;  2PZS A;  4IKF A;  4DLG A;  3RTV A;  2ZE2 A;  4B9U A;  3I0S A;  2HHV A;  3QEV A;  1XHX A;  3NDK A;  1IKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...