3DLEA

Crystal structure of hiv-1 reverse transcriptase in complex with gf128590.
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
538
structure length
534
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 135
structure length 534
sequence length 538
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dleA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dleA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dleA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dleA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dleA05
5JS1A 1RNHA 1S9GB 3SQ1A 4FJ9A 4E7LA 2CKWA 5HRRA 3QIOA 5JS2A 3KHLA 1TKXA 3VQDA 2E9ZA 4IKFA 5KTQA 4N56A 1NK9A 4DWIA 2W9AA 4LSNA 4CJWA 3V9UA 1N6QA 1VSEA 2VWJA 5F8HA 1HNIB 1XR5A 2YNIB 2EX3A 4NCBA 3DLKB 2UVWA 3LAMA 4KKOA 1MU2A 4L8RB 2HHVA 4I2PB 3KLGA 4KRFA 3KLVA 4J9OA 1QSLA 1WSGA 4K8XA 4Y2CA 2IDOA 2ETJA 3PO4A 4Q45A 3RB0A 1C1BB 2J6UA 4O4RA 4KB1A 4DSJA 3IGVA 4RW4A 1VSFA 1LW2A 4Q0BA 2FVCA 3MXMA 4CF0A 3PW5A 1KRPA 2YKMB 1TKZA 3NDKA 3KMQA 4TYBA 1I3AA 1RBRA 2XRIA 2OPRB 4IFVA 2G8UA 3QINA 1IM4A 1ASVA 3KMSA 2W42A 4CF2A 2YV0X 4AHTA 2DTUA 1LW0B 3MEDA 3U3GA 2HMIA 5DQGA 4U7CA 3MEEA 3KLIB 5KT7A 5C42B 3KLGB 3OYDA 4GMJB 4ZP6A 1KVBA 4BDPA 2OPPB 3AO1A 3ISNC 3DRSB 3DRRA 1NNDA 4F4WA 3TARA 2W7OA 1L3UA 2AWZA 3BJYA 5F8GA 4DTRA 4B9UA 3E01A 3CJ4A 1RDAA 1YTUA 4NLGA 4O3QA 2C28A 4DTMA 4RU9A 2XC9A 3RB3A 2ASLA 3OJSA 4Z4GA 3BGRB 3A2FA 4J2DA 2OPPA 1EKEA 4NLYA 5K14A 1HPZA 3MR6A 2XHBA 4AILC 4KPYA 1ZBIA 4CJQA 3CDWA 4FLVA 4DLGA 3ZCMA 1TGOA 3RMAA 3QEXA 3LANA 4ELVA 1UAXA 5J2PA 1RAJA 2EC0A 4DSLA 4Q8FA 2IMWP 4AHUA 1TK8A 1JLEA 2ZD1B 4FS2A 4CJ3A 1TK0A 3KD5E 3L2RA 1S1XB 4DTSA 4W5NA 3RMCA 3NF8A 1IH7A 1MU2B 2F8TA 3V1RA 3QEPA 4FLZA 1RDDA 1QE1B 3T5KA 4ZVEA 2A1SA 3ZT2A 2WHOA 5FDLA 3GIKA 1YVUA 1JXBA 1A5XA 4J9KA 3OYEA 4KHRA 3VQ5A 2OPSB 1ZBHA 5CZ1A 1TKXB 3OYHA 3VQCA 3I8DA 4ED0A 4DF4A 4FM2A 2PYJA 3CIZA 2JEFA 1JL1A 2V4QA 1RT6B 4R5PA 4O3SA 3U6FA 2G8HA 4FJKA 3TANA 4ELTA 4KB7A 3CFPA 3LP1A 4DQIA 2FJXA 1RILA 4FJ7A 2IC3B 4CK2A 3QESA 4N47A 3MR2A 4C8NA 1UA1A 3H08A 2WOMB 3MECB 4O3RA 4CGFA 3NGYA 1WSHA 3SYZA 2WONA 4MFBA 4CEQA 1FK9B 2BQUA 1QTMA 4RZRA 2OPQB 3RR8A 4IH7A 4QPXA 4FVMA 2AGQA 1A5WA 4DL4A 3KJVA 2IJNA 2R8KA 1XC9A 1TAQA 1ZTTA 3KK2A 4EO8A 5J2PB 2ILZA 4MKBA 4DL5A 2WONB 1S1WA 1VSJA 3IRXA 2BANA 4J9MA 2VG6A 4J9LA 1NJXA 4F2RA 3HVWA 2O4GA 2WTFA 3AVLA 2X74A 1BQNA 4CFAA 1JLQA 2YHAA 4DTXA 4IBNA 4KHQA 3RRHA 1UA0A 4KV8A 1SUQA 4ZP7A 3NMAA 4RNFA 4ZTFA 1EXQA 1RT6A 5EU7A 3TAMB 1WSJA 1MMLA 5I42B 4RNMA 5D3GB 1X9WA 2WRMA 4KI4A 3HVTA 4YP3A 2RF2B 4OKKA 1SKWA 4E7IA 1S1TB 4F4KA 5EWGA 1S5JA 1NKEA 1VSDA 1LWFA 2BE2A 3IS9B 4YFUA 5DGBA 4ZVFA 4JRQA 2DPJA 1JLAB 3AVFA 1S9EA 3S9HA 2UUWA 1CXUA 4FZZA 5L9XA 1HYVA 3LWMA 3HT3A 4RW8A 4TY8B 3VN5A 3B6OA 3C94A 2ATQA 3C6UB 1NK0A 3I0RA 3DOLB 1RT5A 4NLXA 1SH2A 3H5UA 3KLHA 4FJ8A 2HNZA 5CZ2A 4ED2A 5KFYA 3HVTB 1EP4B 1IKVA 4F2SA 4YQWA 4TY9A 1RTDA 4TLRA 2KQ2A 3ZSWA 1TVRA 3TAMA 3L2QA 1TKDA 4TSXA 3JYTA 1RTJB 4RG8A 2ALZA 2FC0A 3QIPA 2EHGA 3CJ0A 1OS5A 1CZ9A 3HSTB 1WAJA 4DQSA 2FBXA 4HUGA 5KFRA 2OH2A 1DTTB 1BI4B 4HHTA 3LZJA 3PX6A 3MR3A 4Y3CA 4HTUA 5F9LA 4RNHA 3H40A 3EY1A 4C8LA 2BQRA 4W5OA 2RDIA 1IKWA 4NLTA 4KAIA 4H54A 1SL2A 4RUAA 4B9TA 4KE5A 5HRSA 2B5JB 1WLJA 1NK6A 4ECXA 2X6SA 4F4YA 1Q8IA 4XIUA 3ICLA 4K4ZA 3RB6A 1S1WB 1TQLA 3AO4A 1HQUA 2VWKA 4FJIA 1TK5A 5KFGA 2O5DA 4ZPBA 2V4RA 3OL9A 3KTQA 1S48A 1ZYQA 5KFQA 4DFPA 2JC0A 3IGNA 3AVJA 2IAJA 1BCMA 4KO0B 1B92A 2HB5A 1L3SA 1J9AA 2RKIA 4ZPAA 4EZ6A 4G1QA 3BR9A 2XO7A 3ISND 4IR9A 4O4GB 2RN2A 1ASUA 1VSHA 4ECSA 2LSNA 2ZD1A 2B43A 3AA4A 2D0CA 5JUMA 3SNNA 1RTIA 1C0TA 1Q9XA 4URGA 2W9CB 1JX4A 4MK7A 4CJTA 4FJ5A 3TAFA 5CYMB 4HYKA 2FVQA 3AA3A 2X78A 4TQRA 4ED8A 4QCLA 1NK7A 3V1QA 1LV5A 3PY8A 3LZIA 1KFSA 3QZ8A 3T1AA 3H2LA 4WFXA 2Z1JA 3FQKA 1HPZB 3FFIA 1TAUA 4DEZA 4RW9B 3G6YA 3S3MA 4CHPA 4CJKA 4FJJA 4LH5A 3NE6A 3QIPB 2BDPA 1JLGA 3D0PA 3KKRA 3PUFA 3IG1B 4FCYA 3MEGB 5HP1B 3KNAA 3TAPA 3SV3A 4EEYA 3MXJA 3HM9A 4EBDA 4RW7A 4B3OA 4FLWA 5KG2A 4PQUB 1RYSA 3DRPA 1NKBA 3M9NB 4M3TA 4OGEA 4OJRA 1I6JA 4B9MA 3Q8RB 2XY5A 4E0DA 3OJUA 4KV8B 4FK4A 4WXWA 3B6PA 2A1RA 1X9MA 1W9HA 4CEOA 1NK5A 4H4MB 4C8OA 3I0SA 2RPIA 1U45A 4ZPCA 3SZ2A 3OHBA 1S6QB 3C6TB 3AVCA 1RTHA 4DL2A 5KRSA 3RBEA 2P51A 1WSFA 3ZSRA 4CGHA 1QSYA 5I3UA 1LWCB 1S1TA 3DI6B 4HUEA 1NK8A 1LAWA 2W8KA 3OY9A 2XY7A 3V6DA 3M8PA 4W5QA 1REVB 2XI2A 1HJRA 3AVMA 1JLFA 4FM0A 4JLHA 1RTHB 4ZHRB 4JS5A 3KK1A 2FBVA 4Q8EA 4CESA 1VRTB 1LWEB 4E7KA 3CJ5A 5EDWA 2UVVA 2WOMA 2Q3SA 4N5SA 1T03B 4WE1B 4OPJA 5KFTA 3JYTB 2Z1GA 1D9DA 3IRXB 3DLBA 3TWHA 3V6JA 5DGAA 2FBTA 4DU4A 2QKKA 3T3FA 3LP1B 1FKOA 1D5AA 4GW6A 1S6PB 3PW0A 5KFIA 4CJ4A 1KCFA 3KKSA 4K4TA 3OYCA 1N48A 1RBSA 3I5AA 1NOZA 4H4MA 3JSMB 1NHVA 3PO5A 2V0NA 3UR0A 1WAFA 1HNIA 4JV2A 2VG5A 3SI6A 4OPKA 4LSLA 1N5YA 3ZSXA 1XHZA 4KTWA 4B8CA 1KVAA 2I1RA 5T7BA 2RF2A 2JLEA 3ALYA 3BQ1A 1S6PA 1CXQA 5KG5A 1JXEA 5KFXA 2UVRA 4C8KA 4LD0A 1U04A 1C0MA 2HAIA 1TKTA 3LP3A 3CJ3A 1WNSA 3LDSA 3RTVA 4DF8A 3G6XA 4F4XA 3OYBA 2VG7B 4KBIA 3MR5A 1UOCA 4HCCA 2HHXA 4KB0A 3NKYA 3BSOA 1N6QB 4K50A 3M8PB 4FK2A 2XCAA 2O4IA 3K5OA 2RDJA 5K14B 2FLNA 4FJGA 1GOBA 3TAEA 4Q44A 3DLRA 4ED3A 3GYNA 2BR0A 4CJPA 3NGZA 1IG9A 4DL6A 4N41A 4BWMA 4ICLA 5KG0A 4ECQA 3RRGA 3K2PA 3ITHA 5J2MB 3GQCA 3MFIA 4FK0A 3BDPA 4JS4A 1S0OA 3KOAA 4M3WA 4NRTA 3MF5A 4WE1A 4CJVA 1WN7A 2XY6A 5F8IA 4IH6A 4FJHA 3V9ZA 3PVXA 4AHRA 1SH0A 4BE2A 1XWLA 4O3NA 4DSEA 2FJWA 2YKNA 3BSNA 5DMRA 4JRPA 1D8YA 5J2NB 1SKSA 3CWJA 2AU0A 3HJFA 4ZPDA 4R5PB 5DG8A 1FXXA 3AO5A 1ZETA 4CIFA 4NLVA 2JC1A 3WNHA 3OSPA 3PW4A 3G10A 1SV5B 4IRKA 3HPHA 3E01B 3VQQA 3V9SA 2D41A 1RBUA 2FBYA 5HROA 1LAVA 3PJXA 5F8MA 3OLBA 3L2VA 1DTTA 4HUFA 3DYAB 1C0UA 1QS4A 1S1VB 3VQSA 1RDBA 3ASMA 3K59A 4CF1A 1TVRB 4CCHA 3M8RA 4IOBA 4DL3A 1BQMA 2YNHB 5L1KA 4DG1A 3EPIA 3KLHB 1WNEA 3KLEB 3HYFA 4IQXA 3Q8PB 4NLOA 5J1EB 2ATLA 2DFEA 2AJQA 4F8RA 1S1VA 4CHNA 1O1WA 5KFWA 3NF6A 2F8EX 3GIIA 4NCAA 2D0BA 3NGDA 2GV9A 4IDKA 2FJVA 4NZ0A 4DSFA 1JLCB 3O4QA 4NLRA 2HHUA 2DY4A 3HKWA 3I5CA 4ID1A 2HHQA 1EP4A 3O3FA 3PJWA 4PA1A 2W9CA 3KK3A 2WK4A 3OL6A 2D3ZA 4KI6A 3VQEA 2F8SA 3KK1B 3AO2A 2HNYA 3ZSYA 4IG0A 4H8KA 4E7HA 1IKXA 2X6NA 3H5XA 3GILA 1EETB 3TI0A 4EZ9A 1VSIA 1LWCA 3LALA 5EUHA 4QWBA 4Z4EA 4O55A 3E51A 3K57A 3QEVA 4EYIB 3IG1A 5I42A 4MH8A 4CJRA 1FKPA 5KFJA 3AVNA 4Q5VA 3RAXA 4IRDA 2KZMA 1JLQB 2ZE2A 5KFCA 2R2SA 3DRPB 1KVCA 1W25A 1NKCA 3RB4A 3KIOA 3EZ5A 5SZTA 2IC3A 4O44B 2QV6A 5DG7A 3KK3B 4DU1A 5HRPA 2HHWA 4GC6A 1SKRA 1J54A 3V6HA 4G3IA 1JLGB 5FRMA 2B6AB 1TL3B 3FDSA 3VA0A 3OS2A 3PHEA 2QXFA 3HP6A 1C1CB 3OYGA 3QERA 4CJFA 4LQ9A 2C2RA 1XR7A 4FLYA 3K5MA 5CYQB 1BHLA 5KFDA 4TN2A 3PX4A 2RKIB 1Y97A 4Z4HA 2W7PA 3OS0A 3HVRA 2KFNA 1C1AA 3NBPA 1C1CA 1IKYA 2D7SA 3EYZA 4I2PA 5DQHA 3NFAA 4DS5A 2FVSA 2E9RX 3SUNA 2OZMA 4WYLA 4NYZA 4GC7A 2V9WA 5FRNA 3DYAA 2KFZA 4WZMA 1WSIA 3CDEA 4FS1A 3RBDA 1RT1A 1S1UA 4O3OA 3ZT4A 1TL1B 5C24B 1C6VA 4FLTA 3OS1A 1LWEA 1KTQA 4FJMA 4WYWA 3IAYA 3RMDA 1HQEB 4ICLB 4CHOA 3V9XA 3CFOA 1KHVA 4IRCA 3TR8A 3CM6A 4E89A 5HBMB 4DFJA 2ITGA 3HK2A 2P5OA 2HWIA 3QEWA 3ZSVA 1JKHA 1TV6B 4J9RA 1XI1A 3NH0A 2R8JA 1EETA 2UUTA 4Y1DA 3SUOA 4Z4IA 4EBCA 2E6MA 4ELUA 3Q8SB 3KHRA 1SL0A 3I0SB 3H98A 3BQ2A 2JEGA 4XPCA 1YT3A 1DLOB 3KHGA 1QUVA 5DQIA 3VQBA 4MK8A 1RT4A 5C42A 4W5RA 5I3UB 3IN5A 4CEDA 1ZBFA 1NOYA 3RWUA 1JKHB 4NYFA 4KHYA 3MEGA 4CJLA 3UQSA 4IDKB 3DOLA 1RBTA 3AVBA 3MXIA 3O4NA 3F73A 2D5RA 1LW2B 4Q0BB 4ECUA 3NAIA 1B9DA 2R8GA 2FLPA 5L1JA 3HVAA 4PQUA 4CHQA 3ZT0A 3M9OB 3OYMA 2ZQBA 4M3XA 3T5LA 1VSKA 2YNHA 4KFBA 4ECYA 3I0RB 1BGXT 4B3OB 4O3PA 1B9FA 5SWMA 4M3ZA 2HHTA 4RW8B 3NH1A 4J2AA 1RT5B 1JL2A 3LPTA 3M8SA 3BREA 3AVKA 5KFBA 3OLAA 2GIQA 4KHMA 4KKOB 1HARA 4M3UA 2AX0A 3SI8A 4G1QB 5KT3A 1X9SA 1BL3A 3V81B 3QLHB 4XPEA 4K4UA 1YTAA 2G8VA 5F8JA 3KLEA 4PUOA 5KI6A 4CHZA 1S9GA 5F8NA 5KG4A 4Z0UA 2D3UA 1GOCA 2W9BB 1ZBUA 3DMJA 3HL8A 2DFFA 2OYQA 1S9FA 2B4JA 4M42A 1C0TB 3O3HA 3DLKA 5KFFA 3M9MB 4KTQA 1S49A 5KT6A 2R2TA 4CE9A 5HROB 4I7FB 5KFPA 2IA6A 4MFBB 4O44A 2FVRA 2AGOA 2G8IA 4WXOA 4ED6A 3VQ9A 2IM2A 1N56A 4R0EA 3KK2B 4FJXA 2BANB 3ZSQA 4FBTA 3DI6A 3AO3A 3V1OA 2P1JA 3QZ7A 4OKJA 4F4ZA 4DFKA 2DPIA 1K1SA 3SFUA 4CJUA 1Z4UA 5KFHA 3OYIA 3TAGA 5KT4A 1HQUB 2OPQA 3OYLA 4I9LA 1S6QA 4NLDA 3CFRA 2FVPA 4NRUA 4CECA 4DFMA 2YKMA 2W8LA 5KGWA 5F8LA 4PUOB 1S10A 4BWJA 3T5JA 1X1PA 3AA2A 4J2BA 3NCIA 2AQ4A 4OLBA 4AHCA 3H5YA 3G86A 4ECTA 2C22A 4DTJA 4EYHB 4O0JA 4AHSA 4E1NA 3H4BA 1GOAA 4CHYA 3KLIA 4K4VA 3PW2A 4M3RA 1T8EA 2XCPA 3DDKA 1L3TA 1U09A 1RDRA 4ED7A 1KLNA 3SFGA 3H5SA 4EP4A 1S0NA 4PWDB 4B8AB 1J5OA 1KFDA 5FDLB 1Z26A 3M8QA 4NCGA 5C25B 1IO2A 4IFVB 2XWYA 5FROA 4HVJA 3PZPA 1JLBB 3C6UA 2VA3A 2NUBA 4I9QA 1S97A 5HLFB 3FRZA 4DTUA 2DFHA 1RTJA 2F96A 1RT2B 2Y1IA 4CJ5A 3V4IB 2BE2B 3IS9A 5T14A 3THVA 3BGRA 2C2EA 3VQ7A 2XGPA 3V9WA 4CEZA 2HNZB 4IH5A 4QAGA 3DLEB 5DK5A 2G8KA 1RT7A 1A5VA 4QW9A 2IS3A 3DOKA 1RA6A 4DQQA 2XY8A 4Y2AA 1VSMA 3BQ0A 3DRSA 2IM0A 1C0UB 1N4LA 3NAEA 1VSLA 3HPOA 3FQLA 1TP7A 2IBKA 1FKPB 2JGUA 4BE1A 4F3OA 1JLFB 4M45A 2VG6B 5KFAA 3NF7A 3LP2B 3DLGA 5KFEA 2QKBA 4FW1A 4XO0A 3S3NA 4KREA 1S4FA 5KT2A 4Y34A 3QLHA 1BIZA 4CFDA 3RR7A 3NGIA 1GX5A 5EWFA 4ZTJA 4FBUA 5KG6A 3UDLA 3NHGA 3HXMA 1QQCA 4K8ZA 3KLFA 5J2QA 4CERA 3MTKA 4CEFA 1REVA 1LW0A 5C25A 1BISA 3L8BA 1RT7B 3MEEB 4K4WA 3PW7A 2IOCA 5HBMA 4FZXC 4M94A 3TQ1A 4KAZA 4IFYA 5F9NA 4OGCA 4QWDA 3GV7B 4FM1A 1T94A 4MK9A 1KLMB 2ASJA 2GBZA 4EBEA 1JLAA 4ED1A 1FK9A 5KFOA 5DLGA 1Q9YA 3L2WA 4QOZB 3V4IA 4M3YA 2GC8A 3VQPA 2J6SA 4URQU 3AVGA 2OPSA 4H4OB 3NF9A 1S1UB 5KFVA 4RW4B 3ULDA 4LSNB 3K58A 1SH3A 4J2EA 4PWDA 3N6NA 4RW7B 5KG1A 3M8QB 1BQMB 3QEIA 3SJJA 5CYMA 1RT4B 1RTIB 3SV4A 4NLPA 4BDYA 3GV8B 3PR5B 4E3SA 5KFKA 3TAQA 4IKAA 4KHNA 2QK9A 3NBPB 2HNDA 3CYMA 3VA3A 3SUQA 3QO9B 1TKTB 3BSAA 4KHSA 1BQNB 3OSNA 4E19A 4CFCA 1T7PA 1U4BA 2HHSA 3SPYA 4B9LA 4CGDA 1JIHA 2WB4A 2I5JB 3EZUA 5KFZA 3SQ4A 3UPFA 4LSLB 1N5YB 2VG5B 3V6KA 1S1XA 2ZE2B 2KTQA 4MQ3A 3DM2B 1R0AB 5CY4A 1TL3A 1HRHA 2FLLA 1VRUB 3OYAA 3AVIA 4QW8A 4OL8A 5C5JA 2UVUA 4MIAA 3TABA 2E4LA 3LP2A 2BRLA 4CEAA 1NJWA 3NAHA 4B9VA 3OYJA 1WSEA 4JV1A 2I5JA 2YNFB 1RBVA 1HYSB 4TYAA 3K5LA 5HRNA 1L3VA 2ILYA 2IAJB 4WZQA 3SPZA 4FLUA 1QAJA 2IJFA 3OL8A 3P1GA 3ZSZA 1Z25A 4E7JA 1ASWA 3DM2A 4MKAA 4DTPA 2WCXA 5KRTA 3LAKA 3MEDB 2J6TA 4DTOA 4KFBB 3SQ0A 2W9BA 4RUCA 4E1MA 3QIDA 3CQ8A 4H4OA 3DRRB 2IM3A 3L3UA 4CGIA 1BI4A 1IKXB 3LPUA 4CEBA 3C6TA 2XI3A 5CYQA 2R2RA 4CGGA 2Y1JA 1HNVB 4B9SA 2VG7A 4JUZA 3D45A 1T05A 1BCOA 5L1IA 4RNNA 1UWBA 3AV9A 3G0ZA 4IG3A 3JSMA 1NJYA 4TXSA 4KTZA 4QWAA 1DTQA 1RTDB 3P83D 4KHWA 3DOKB 2YNGA 4NLQA 3OVNA 4OVLA 4M41A 3H4DA 3NL0A 1JXLA 2JEIA 2HMIB 3VQ4A 1J53A 3KLFB 5J2QB 2OZSA 3OYKA 3VQ8A 1C2PA 2E9TA 1TKZB 4ZP9A 2YNIA 3TVKA 1RT2A 3ZT1A 5J1EA 3QGGA 2GUIA 3UIQA 4IR1A 3S3OA 3DLHA 1FKOB 4DSKA 3GV5B 2HWHA 3CDUA 4DLEA 3V6DB 4LY7A 1D0EA 3CO9A 1G15A 5D3GA 1U49A 1SL1A 2P5GA 1BIUA 1RA7A 2AGPA 4YR0A 4LH4A 1SUQB 4TY8A 3O3GA 5JXSA 4DQPA 1GX6A 4CJEA 1RCHA 1D9FA 2G8FA 1S9EB 2ZKUA 2HW3A 3GIJA 3HO1A 3T19A 5KG7A 1L5UA 4RW6A 5KFLA 2C2DA 1QAIA 4YNQA 5EWEA 4I7FA 3F9KA 1VRUA 4YR3A 4YMEA 3WNGA 1TV6A 2R8IA 3DLGB 4J9SA 2KW4A 3DLEA 4JV0A 1JLCA 5J2NA 4DSIA 1D1UA 1HQEA 2E6LA 2YHBA 3MFHA 1JLBA 4RW9A 5L1LA 2XGQA 4NCGB 4RW6B 5C24A 5DG9A 1C1BA 4QWCA 4DMNA 4K4YA 1HMVA 4C8MA 4URSA 3Q8QB 4BACA 3OHAA 4LQ3A 2PYLA 2HNDB 4NYNA 3KJVB 4B9NA 3OL7A 4R8UB 4WFYA 4NLSA 4NLUA 4ID5A 5HLFA 3LP0B 1T05B 2Z1HA 1S0MA 3HHKA 3D28A 4BDZA 4W5TA 3ZT3A 4DL7A 3MECA 1QE1A 4HKQA 5KG3A 3RAQA 1SV5A 3BSCA 4I2QB 4K4XA 1T3NA 4Y1CA 4ECRA 4U6PA 4FLXA 2GIRA 4WFZA 5KFMA 3N6MA 4GVMA 3D5MA 4ECWA 4DU3A 4CIGA 3AVAA 1RDCA 4IFYB 1KSPA 4FXDA 3SCXA 4DQRA 3SQ2A 1XR6A 4DTNA 2PZSA 3H59A 1DTQB 1HMVB 4ZVHA 3AA5X 1ZTWA 1HYZA 4KO0A 1T03A 1UWBB 2R2UA 4DS4A 3KHHA 2BRKA 3NH2A 3HPGA 3KD1E 5KFSA 4ECVA 2HNYB 2JEJA 3QNNA 4HCBA 1JLEB 3HP9A 4Z4CA 1R0AA 1RT3A 1RYRA 3QETA 1K1QA 4O5BA 2PY5A 3MAQA 4OLAA 3L3VA 1ZBLA 4J9PA 5E41A 1VRTA 2B5JA 2G8WA 3K5NA 1KHWA 4ECZA 4Z4FA 3V81A 4FYDA 1W0HA 1CLQA 2CJQA 4CJSA 2OA8A 1EX4A 2YNFA 4NLWA 1TL1A 1IKWB 3C95A 3VQ6A 3I5BA 3OYFA 3QYYA 1XHXA 3DMJB 3QGHA 1YVFA 2BQ3A 5KGXA 5DLFA 1RT3B 4AH9A 5KFUA 3GIMA 1IKVB 3N6LA 3CM5A 1U48A 4X2BA 1NK4A 3PX0A 4IG3B 4FJNA 4MIBA 2KZZA 4CF9A 4F50A 3FFIB 4UQGA 4AHVA 4J9QA 3WNEA 3ZSOA 3WNFA 4DG1B 3CVKA 1ITGA 4EO6A 3QNOA 2HVHA 1QSSA 3PR4A 3CJ2A 4CF8A 2YNGB 3P5JA 3SUPA 4Q43A 1CSJA 2OPRA 2R8HA 2IGIA 4CGJA 2ASDA 3U3YA 2YKNB 1IKYB 1DLOA 4BE0A 4I2QA 4ZHRA 1F21A 4K4SA 4O4GA 1LWFB 4YR2A 1HNVA 4KSEB 4B08A 4QWEA 1HYSA 4KHUA 1VK0A 4CK3A 3VQAA 1NHUA 2VA2A 1J5OB 4ZMMA 3QGIA 3CG7A 3AVHA 4O0IA 4R8UA 2Z1IA 3EPGA 5J2MA 1KLMA 3T5HA 3LP0A 4CEEA 4J9NA 4ID5B 4TQSA 2HVIA 3FSIA 4RNOA 3OYNA 3PV8A 4CK1A 1U47A 2B6AA 3G6VA 1K6YA 4CIEA 2BGGA 1RT1B 2D0AA 2IM1A 4EP5A 1QHTA 4FW2A 3L2UA 1CZBA 4M95A 4FZYA 4FJLA 2AX1A 3RMBA 5HP1A 4OKEA 4ZP8A 5KT5A 4IG0B 4ZVGA 4F3TA 4PY5A 3QO9A 4N76A 1NJZA 5KFNA 3ITHB 4CFBA 1I39A 2QE5A 2R7YA 3LWLA
chains in the Genus database with same CATH superfamily
1SVDA 4DUYJ 3F44A 2ROEA 4Z7CA 1F0XA 3LDPA 4OYIA 4N8OA 5B0EA 2E9ZA 3GONA 3PYGA 4IKFA 4N56A 1NK9A 4JV5J 4K5RA 4IO9Q 4NCBA 3LAMA 2O66A 3CIPA 5AT1B 1MU2A 5L9NA 3CXCR 4L8RB 3NMUA 5AQWA 2JLFA 4J9OA 2FZCB 2P9KA 1U2FA 3CF5Q 3MI7X 2VONA 2H9ZA 1VFJA 4AL6A 5H9EJ 2D1KA 2IDOA 4Q45A 1C1BB 1DZ5A 3Q22A 3AARA 1GFWB 1I51B 4KB1A 4DSJA 4LBHA 2FVCA 1RE1B 1CC8A 2KT5A 4B3SF 4HL9A 3S8SA 3UKRA 4OLOA 1WOPA 3DLLQ 3CERA 3KDOA 1U1OA 2MY7A 4A5BA 2IBOA 1LFPA 5F0UA 5HVFA 5IQQA 2RILA 1ASVA 3D66A 2NYHA 1SC1B 4FN5A 4M7YA 4X66K 3E9OA 3U3GA 2FJBB 3MM7B 4WP3A 2DNOA 3OYDA 3HFVA 2DR5A 1KVBA 3SBMA 2OPPB 2VUGA 2I38A 4JI3J 3GR0A 3J81Y 1HNWJ 3DXSX 3CCLS 4NL5A 2FIUA 2OP5A 3ENOA 1NB7A 2AWZA 5F8GA 2ZH3A 3E01A 3KXDA 3MDFA 5THWA 1YTUA 3BKFA 1NSPA 3A3OB 3ATVA 5AQXA 1X4CA 4CW7B 2BKOA 1PILA 1SQFA 4JI2J 1XN9A 3Q7BA 3TJAA 2DIUA 4NLYA 2BA9A 1Q86T 2P6TA 5E33A 3MDQA 4CJQA 2KI2A 4A47A 4XH1A 3RMAA 3QEXA 2EFVA 1UAXA 5IC4B 1RAJA 4DR1J 1HNXK 2EC0A 4JP8A 1FDDA 2XMTA 3THYB 2KYZA 3RSEB 2YY3A 4AHUA 3CPEA 4B1WB 1ZS6A 3GJRB 3VAMA 1H2UX 3NF8A 3EICA 4MYUA 2Q6CA 4TU8A 4K0KK 4K7QA 4IOCL 2F8TA 3QEPA 2BJ7A 3C46A 3OXLA 1QE1B 1H38A 1HBOA 4ES2A 4J9KA 1FO1A 2OPSB 4JI6J 3G2XA 3DHWC 3RU0A 1S59A 4FWQA 4P2MA 1JL1A 1XERA 2V4QA 2CDQA 2G8HA 4FJKA 3TANA 4KB7A 3LP1A 2P9PB 2Y0BB 2F40A 1YHQN 1N34F 2NRHA 3TUIC 3DCAA 1UA1A 2O8BB 3J7AN 3MECB 4O3RA 3NGYA 4NLCA 1WSHA 3SYZA 2WONA 4MFBA 3NGTA 1FK9B 4EIAA 2ZDOA 2OJ3A 4RL1A 2OPQB 4QR0A 3RR8A 3AJ1A 4IH7A 2BM1A 1HNXJ 1WELA 4LF6J 2RUGA 4DL4A 1QM9A 2V52B 2XYPB 2CPDA 3D2EB 1S1WA 2MY8A 4GMKA 4NMLA 2ZUGA 2YWWA 3C15B 2X74A 2QZ8A 3MURP 1BQNA 4FNHA 1JLQA 1QZ5A 5EOYA 2MQQA 1UA0A 1WDTA 5DM6Q 1EXQA 3FR0A 5M2UA 1P27B 4OYAA 2WW8A 2VL1A 2KL8A 5I42B 4OYPA 2CH5A 4H5WA 5D3GB 3WXJA 2NXNA 2WRMA 2RF2B 4OKKA 2YKPA 5CCMA 1IR0A 3HI0A 1NKEA 4I68A 1VSDA 1IBMJ 3TSQA 4YFUA 3N79A 3SMZA 3AVFA 3CW2C 3VOVA 4RW8A 3VPZA 3B6OA 3C94A 1GMWD 1ZZFA 2ATQA 1NK0A 3I0RA 1SH2A 1T3VA 5B0GA 3FJ2A 3G25A 3HVTB 4MT1A 5KPTA 4K41A 3R1LA 4YQWA 2ZBPA 5DDQC 3CJBA 3L2QA 1TKDA 2LYVA 1KVIA 4TSXA 5ITHA 3ATUA 3QIPA 4GV3A 3OUYB 1OS5A 2HS3A 1LXNA 1N34K 2VU5A 2MJUA 3UCZP 5KFRA 1BI4B 3ZEUA 2GUPA 2Q1NA 5F9LA 4HTUA 3GSIA 2C2OB 4KPCA 4DKWA 1UW9A 4WFAQ 2VGMA 3EY1A 4NWBA 1QVFR 2ZZMA 2HF3A 3S41A 4OZJA 2RDIA 2HZCA 1WEXA 4B9TA 4WCEL 1IJFB 3JAMU 2FSNA 3ETOA 4GO5X 4JKGA 3AXMA 2B5JB 3AQPA 4ECXA 5L39A 4F4YA 1Z1ZA 3DDNA 3TJ9A 4QJVA 3RB6A 3PM9A 4AL7A 2GQCA 1E6YB 1HQUA 1NU4A 2ZH8A 1NAQA 2VWKA 2EG2A 3THWA 2P6SA 3UNYA 3LL3A 2MDAA 5JVGQ 1NZ8A 3M6VA 1TK5A 5KFGA 2O5DA 2GX9A 4U7BA 1NZAA 1RTZA 5DDOC 3MCSA 2XM3A 5JVHQ 1IN0A 5D4LA 1RCOB 4LF5K 2ADCA 1SB6A 3ZX3A 3BH6B 1UEVA 3BR9A 1OPZA 2CJKA 3ISND 3S1TA 4Y28C 2GJFA 1VSHA 2FC9A 2LSNA 2DKOB 2ZD1A 2B43A 1ZPWX 3AA4A 2D0CA 5JUMA 1Q9XA 4MK7A 4KBOA 5BRFA 2NYIA 3TAFA 5CYMB 3NCRA 3AA3A 4TQRA 4ED8A 2MMYA 2CXEA 4QCLA 1JXVA 2YCHA 5E5NA 2BJEA 4YB5A 1QLNA 2E20A 3IAM9 2HGLA 5IT9Y 4AQYJ 3OT9A 2PIIA 2E66A 1RADB 5F3ZA 4FJJA 4LH5A 3MXHP 4ETXA 4K5SA 2MLYA 2OTLS 3MEGB 3G8QA 3TAPA 3LDQA 2GTDA 2P9GA 3SV3A 2V4JB 4FNIA 3UO0A 2GQ2A 1XEZA 4EBDA 1TL4A 3ZETA 1WI8A 1TUWA 3KFWX 1RYSA 1AXQA 2AJFE 4CIOA 3M9NB 1I6JA 2CGKA 1JMTA 1W2BM 4A8KA 4DV5K 1W9HA 2GV1A 1NXIA 3AB4B 4JKEA 1EQMA 1S6QB 3C6TB 4DL2A 3KHYA 1YBTA 2P51A 2DNYA 1QSYA 2B7CB 4BRDA 4I56A 3DI6B 2W01A 3PG9A 1NK8A 3RVCA 4OX9K 1LAWA 2CVEA 3OY9A 4TLQA 2CPIA 2CQ3A 2V63A 2JHEA 2CJXB 3TEGA 3RJMB 4FM0A 4JLHA 1Z2ZA 1RTHB 3ZEUB 4ZHRB 4WWSA 1ATNA 2LKZA 4E7KA 1LWEB 2YX1A 5EDWA 1JJ4A 4I6WA 3TTFA 4WE1B 1KKHA 4OPJA 3ID8A 4NASA 5H1SV 3DLBA 5DGAA 5IT0A 2QKKA 3EE3A 4OZ1A 1KCFA 3OYCA 2V7YA 1RBSA 5BRDA 3ZTQA 4U8VA 5AZJB 4CNYA 4NPOA 4H4MA 3JSMB 2V0NA 1HNIA 3Q2SC 2VG5A 3ZSXA 2HHPA 2BE9B 1FJCA 3OVAA 5T7BA 1VQKN 4LRCA 2UVRA 4OHXA 1O5JA 4FYWB 5MLCV 1TKTA 1T11A 3RTVA 1XTZA 4U9RA 3CSKA 4F4XA 3M3ZA 1NO8A 3OPKA 3EGVA 2DITA 1V5VA 1UOCA 1SJFA 2HHXA 2HLUA 4DZ6A 2OI2A 4PWUA 4YS2A 4DB3A 3VVUA 2RDJA 5K14B 4JOUA 3D7EO 3CF5L 3TAEA 3RZAA 3CO0P 3GYNA 3NGZA 4BWMA 3TZXA 2KM8C 3BKTA 2DD8S 4OZLA 2EG1A 3TR5A 3ITHA 4A48A 1HHQA 2GHVC 2JOQA 2A5XA 4JS4A 3IBFB 3UKUB 4C9DA 2E5IA 1OH6A 3NLCA 4CJVA 5HAOA 1RFQA 2VCPA 3MK6A 2XY6A 3W3SA 4FJHA 1JCEA 5BYSA 3PVXA 4YB6A 3ENQA 4AHRA 1SH0A 4O3NA 4NB4A 4FF4A 4HI1A 4JRPA 4DUZJ 1SKSA 1VQ7N 2W6KA 4ZIVA 5L38A 3W5XA 1FJGK 1T9YA 4ZPDA 2E1YA 5BPLA 4JI1J 2ZUAA 2EWSA 1ZETA 5CA5A 2LU1A 4MO5A 2E7VA 3WNHA 1FWLA 4ZS6A 1SV5B 1X7VA 2GS8A 3VQQA 5I3PA 5MLCQ 2D41A 1RBUA 2FBYA 3Q8VA 2HBLA 4DU7A 1G6BA 1LAVA 4JI8K 2FHKA 3OLBA 2RHKA 1DTTA 1YJ9S 4K42A 1QS4A 1S1VB 2EFOA 3K59A 1F9HA 2NLWA 2B3TB 4CCHA 5M1FA 5HN0A 3PRDA 3DKDA 3MHYA 2GJIA 4DG1A 2KU7A 4RU2A 3KLHB 3KLEB 3IO1A 3AQOA 2YKQA 4IQXA 1NGIA 4A46A 2B9WA 3GG1A 2HQGA 5AXKA 1O1WA 2F8EX 2J7UA 3GIIA 5BR8K 1XQIA 3NGDA 4N7TA 1RAIB 3J7YI 5HI7A 5D0HA 4LBIA 5GAHI 3CCES 4TU9A 4GKKK 3CCSN 5D78A 1XIQA 3WXLA 3TA1A 1BUXA 3I5CA 1VQLN 2HHQA 1EP4A 3O3FA 1OPIA 4F4AA 1F9FA 3HZEA 1QD1A 3R6GB 5B0CA 1A9NB 4HDGA 4NEYA 3OL6A 4DR7F 2D3ZA 1OMSA 4B3TJ 2F8SA 3MOZA 2NLXA 5J1PA 5F1XA 2Q6BA 3IAS9 4H8KA 4OHWA 4I6MB 3HI9A 3NP5A 1NGHA 2JWNA 3GILA 5ETTA 1Q7YT 3TVZA 4U8YA 2BX6A 3TI0A 4IFEA 1VSIA 1LWCA 3LALA 4O55A 1WTFA 5I42A 3HD2A 1UFWA 5B7WA 2EKNA 5HVGA 2F9WA 2HHHK 3UD5A 5HMZA 3RAXA 2HFVA 3H0PA 2KZMA 2ZE2A 5KFCA 4LMZA 2J4RA 4WQ4A 3DRPB 1NKCA 4B3RJ 1VC6A 3BP8A 3IFEA 3EZ5A 5SZTA 2IC3A 1EB0A 2E7WA 1X4BA 2Z2LA 4DU1A 2Q2RA 5HRPA 1UEKA 2GZOA 4GC6A 1J54A 3V6HA 3NS6A 5B0DA 5FRMA 4LVNP 2B6AB 1DQ8A 4M5MA 2AYGA 1YLXA 3SBTA 2QXFA 3ZZ0A 2ZBQA 1C1CB 4RLEA 3OYGA 4YORA 1DKGD 3P38A 2HF4A 4FLYA 2YJFA 2NNWA 2OFGX 5KFDA 1CZAN 1JJ2M 1BD6A 2J8SA 3C6HA 4W90B 3PX4A 4B17A 2J7WA 1XMBA 4A8MP 1Y97A 1WEYA 1KEKA 3HVRA 3QMQA 4C7QA 1C1AA 3U1MA 2IVPA 2ASPA 4K8RA 3NFAA 2E9RX 1GLAG 4GC7A 1CJUB 5E84A 4A8OA 3DYAA 4BC7A 5AQFA 3M30B 2WAQD 3CDEA 1WSIA 4ANEA 4OYBA 4FS1A 1UZHA 2W2OP 3RBDA 2O3DA 2JWKA 4A62A 4O3OA 3C16B 3UN5A 1X5PA 2FHJA 5E3AA 5AFUH 4YOYA 3CJRA 2XYGB 4USVA 1KQSR 4WYWA 3CXCM 3IAYA 5AQOA 5C2DA 2ZHBA 4JI7F 4HTIA 1KHVA 1YTYA 2HSTA 4E89A 2XMUA 4GKKF 3WXMB 4DFJA 3T1YK 4L3QA 2PMHA 3HK2A 4KYZA 4WPAA 1YZ7A 2Z4PA 2OAUA 2UUTA 2ZNYA 4Z4IA 2DGUA 5K8MA 2W25A 1XNRK 1Q8KA 4KGKA 3H45C 3KHRA 3ID6A 1HNZK 3FZ2A 2ZH7A 3H98A 1BU6O 2I9SA 2X7IA 3R2DJ 3NGSA 2FD2A 1R0CB 1YT3A 1N88A 1UL3A 3A5NC 1DLOB 3CPWR 3KHGA 2ZC3A 3U1NA 1DGKN 1RT4A 1KD1T 3WC2A 4BRMA 5DS7A 4W5RA 4CLFA 1RWWB 1ZBFA 1QQOA 4BGBA 5IXUA 1PJ7A 3ET6B 3CUNA 2GHWA 3BF1A 4IDKB 2FJEB 5EX5A 2XB2D 3FEYB 3LQVA 3CMES 3CQYA 1FX4A 4IUFA 4ECUA 3AA9A 3SQGB 4RWTA 1B9DA 4CLZA 1UVIA 3ZT0A 4CI6A 5FD1A 4JK9A 5JVGL 5A2QY 1PGZA 3OHRA 3F9MA 2QRRA 2YNHA 4KFBA 9RUBA 1AZSB 1GMWA 2QWMA 1B9FA 1ZA1B 5SWMA 4M3ZA 3NH1A 3MCOA 1K8AO 3LPTA 2V8HA 3BREA 3NOCA 5M2RA 3OLAA 4KHMA 2D1CA 2Q79A 4DPYA 1GK8A 4M3UA 3H46O 3FMWA 1BL3A 4DV1F 3VAFA 1U6ZA 4B3SJ 1YTAA 1Q18A 1V3RA 1WC1A 5KI6A 2HQFA 5F8NA 1SS6A 4Z0UA 1OH8A 2D3UA 1GOCA 3DXMA 2NZCA 1NPKA 2DEJA 2CQPA 2GAGC 5RUBA 3ZX0A 4CZKA 4C98A 4JI4F 1VYAA 1C0TB 5AZIB 3O3HA 3DLKA 1BO5O 3THYA 4HT7A 1S49A 5KT6A 1Y5LB 2P8IA 4A8FA 5HROB 3TP2A 4P6QA 3IKMA 4JI4J 2GX8A 2FVRA 2K3IA 4BQLA 4ED6A 1N8RT 2IM2A 1NNEA 1IBLK 3CTRA 1V4SA 3GL1A 5LMUK 1F6TA 3AO3A 3TO8A 1NCLA 3QZ7A 1NM1A 1CJUA 2DPIA 1K1SA 3T6JA 4CJUA 1Z4UA 3OYLA 1EQ0A 3UVJB 4NLDA 4EI2A 2F1FA 4NRUA 1CS4A 4LFBK 3OXFA 2DR9A 1MWQA 4K25A 5F8LA 3SJHA 4DV0K 4OLPA 1X1PA 4J2BA 1YRTA 1KP6A 3H5YA 2LFVA 1RWXB 3EVWA 2C22A 4ZDNA 1SBRA 5JMVA 4K4VA 5D0RA 2NXUA 2G4BA 3MM7A 4KH5A 2Q36A 2XCPA 4ZKAA 1L3TA 1U09A 2YWGA 4CZFA 2CQ1A 3QRRA 4F3MA 1S0NA 5HMYA 5FDLB 3JSRA 1KN6A 4IFVB 2XWYA 4B1UB 1HR0K 4JEPA 2BXJA 2AF6A 3FRZA 4E8UA 2F96A 3RG6A 1PYTA 3WBZA 3BEGB 3BGRA 2C2EA 1XNRF 5ELZA 3O1BA 3CDAA 2HNZB 4BR9A 4IH5A 4H5VA 4QAGA 1MROA 3AOCA 3S6EA 3DOKA 4DV5F 3TPQA 3IMXA 4ISEA 4L6V3 3LTOA 1U8SA 3D3BJ 3FQLA 3TOQA 2MEWA 1H2TZ 3HKZD 3QT7A 4CLPA 3NF7A 5KFEA 2LQ5A 2QKBA 1XK8A 1KOHA 3D2EA 4KT0C 4CT9A 2J7KA 3MD1A 1I94J 3QLHA 3M8YA 3DGPB 5EWFA 1R31A 4FWRA 4FBUA 5AFUA 3HXMA 1QQCA 2IY5B 5DETA 1BISA 3BM7A 2YQ0A 3PW7A 4B3MF 5HBMA 5B09A 4M94A 3TQ1A 3DLJA 3O4WA 1NRKA 3FMBA 1Q8LA 4FM1A 1M5KC 1HW9A 2LA6A 1ITPA 2UU9K 4X62K 4M3YA 1X4EA 4USUA 2OPSA 2AYEA 1S6OA 2F4FA 5KFVA 3T1HK 2DHAA 4LSNB 2DYAA 3MMAA 5FLXY 2DJWA 2PO4A 5I9EB 3M8QB 3WEEA 2MSTA 3QEIA 2H65B 3R8YA 3I56S 2P9KB 5KFKA 4XDDA 3TAQA 3QJPA 2HNDA 3VA3A 1YRUA 1U24A 3L9ZA 5LXYA 2DH7A 2FF6A 2EW9A 3SPYA 1FI4A 4B9LA 4A4JA 5KFZA 1EARA 4LSLB 1HUXA 1I94K 2VG5B 3MUVP 1UFKA 3V6KA 1R0AB 3PXGa 4LFAK 5CY4A 3UD4P 3MGJA 3J81U 4JI5J 3AVIA 5HK4A 1KDNA 2UVUA 4MIAA 4EMDA 1WG4A 2C3MA 3I31A 2DHGA 1KC8O 1RBVA 3K5LA 4IOCQ 3DU6A 1K47A 4F04B 1Q53A 3JTPA 4WZQA 3WT0A 3VGUA 3HHLD 3ZSZA 4DV4K 1Z25A 1YG0A 3WUHA 4DTPA 3DM2A 2FSJA 3M8ZA 2G9OA 2W9BA 4E1MA 1RWMB 2JX2A 3IBWA 4LF7K 1ZPVA 3FZMA 3LPUA 4CEBA 2FTRA 5CYQA 4J37A 2VG7A 1BCOA 2NSBA 4RNNA 2ZJQQ 3TQEA 4IG3A 3JSMA 2HBQB 4KTZA 4QWAA 4M63C 1XMOK 4H4KC 1ESVA 4NLQA 1T9VA 3OVNA 4OVLA 3DLLL 4M41A 2KH9A 3H4DA 4I69A 3NS5A 5D8HB 5J2QB 3TZWA 3DDIA 4U7UD 3BEXA 1RBLA 2G2ZA 3OBWA 1Q95G 4ZP9A 3OW2M 4DV0J 3C8YA 3GCWP 3WIUA 4BRAA 2B9YA 2BH1A 4Z7YA 4YDDB 1IG8A 2GUIA 1FX2A 2GW8A 3S3OA 2RJZA 1R43A 3K17A 1FKOB 1REGX 1Q5YA 4RJVA 1NHKL 2HWHA 1T9XA 4DLEA 1D0EA 2H51B 1VLOA 3HHLA 2NRZA 4UUWA 4CZMA 3BO2A 1SQGA 1R27B 5LMUJ 2K1RA 2P5GA 5G0RB 1BIUA 2AGPA 4YR0A 3L09A 4DQPA 2YPZA 4CJEA 1RCHA 1FTRA 1VQON 1GNKA 2LP4A 2IVMA 5KG7A 3SK3A 5GAGI 3SAHA 1L5UA 5KFLA 4ZVSB 4YR3A 2DTJA 2KYXA 3DLEA 3OR1A 1ZBTA 5E3CA 4JV0A 3J80Y 5J2NA 2VPWB 1UWAA 1E6VA 1O6XA 2U2FA 4USMA 2VFTA 4XDCA 3J7A1 4OPHA 3HULA 1JLBA 3LGHA 2W2QP 1RACB 2NS1B 4DV4J 4DMNA 2HYIB 2CZ4A 2HNDB 2B4PA 1HWJA 1YUWA 2VDHA 4UZBA 4B9NA 4RUBA 3CCRN 3BN7A 4DR3K 3G96A 3LA0A 3LP0B 2Z1HA 2UXBK 1S0MA 1IBKF 3D28A 4BDZA 1ZXOA 2O1PA 4YOVA 3ZT3A 5DO2A 4HKQA 4BCAA 3EE8A 4LFAJ 2WFBA 3AGKA 2AJ1A 4M8LA 5KFMA 3TJ8A 3W0LA 4GVMA 3D5MA 4PQAA 1XQSC 3MR7A 1K0VA 3AVAA 4DPXA 3QICA 1B7FA 4IWVA 4DTNA 2IYIA 3MOJB 5A8RA 1DTQB 3BYPA 5IV3A 2HIQA 3R6MA 3MN7A 4KO0A 1R8PA 2CPZA 1UETA 4DS4A 3BGLA 3Q0AA 3NH2A 2V8DA 3KD1E 3A4TA 2QG9B 2QFJA 2NSCA 4QYZJ 1RT3A 1RYRA 3RSEA 3UW1A 3CCRS 4FSVA 2N4DA 3L3VA 1U25A 3A5LC 4RR5A 2QX0A 5A6PA 1WC6A 2BUPA 2UV8A 4LF8J 1NGJA 4H0XB 1WWHA 3RGIA 3K5NA 5AE2A 3CIMA 4ECZA 4Z4FA 3PIPL 4FXVA 2W2PP 1CLQA 2Z2MA 1G2EA 3THXA 3ULEB 4NLWA 1TL1A 4RUHA 1IKWB 2AHOB 3C95A 2MGZB 2CZ9A 2R7TA 1XHXA 3QGHA 1YVFA 5KGXA 1DBDA 2FF3B 2DNPA 4DCHA 2GIFA 4HEA9 1NJIO 3K5PA 1GLFO 3N6LA 4MYTA 4IG3B 4FJNA 4LRAA 4MIBA 2JNJA 1DRZA 2G1DA 2N82B 4CF9A 3FFIB 3MWTA 4B9QA 4UQGA 3ZZTA 4AHVA 4J9QA 2X1GA 2HEKA 4HVZA 3WNFA 4HH1A 4DG1B 5DM7Q 4CDIA 3FBBA 3QNOA 2HVHA 1ULRA 4CF8A 2Q97A 4CGJA 1CSJA 2IGIA 2XMAA 1ZM4A 2NRRA 3MM5A 1DLOA 4BE0A 3MPDA 1F21A 2WW4A 2KKHA 1LWFB 2ABYA 2YVSA 3NG8A 4JI5K 2D9PA 4QWEA 2ZHAA 2WVCA 2YWKA 2H5IB 4CK3A 1Y10A 2QT7A 1J5OB 1TFWA 1R59O 3AVHA 3M2VA 2Z1IA 2C2KB 5CYJA 1KLMA 1HR0J 4G9ZA 4TQSA 2HVIA 2LEPA 2PGCA 4IQMA 1SCJB 3O8WA 3OYNA 4OX7A 4CK1A 4G1IA 1K6YA 1WHYA 4OIXA 4BVOA 2BGGA 2FC8A 4EP5A 1NBWA 2NUHA 5AXMA 1CZBA 4FJLA 5ETOA 5T7LB 5GAEP 1EO1A 3RMBA 5JVHL 2EXUA 5BPMA 3WHIA 3OR1B 4N76A 2KFYA 3ITHB 3FGUA 1U0HA 4K43A 3JS6A 4CFBA 1I39A 4BQZA 4DR2F 5BRHA 2KG0A 4GKKJ 2R3VA 3LM9A 5C12A 4FZVA 2JSXA 2ZKTA 4OZNA 5JS2A 1YBUA 2VQEK 3CMAN 3ZNJ1 5KTQA 4DWIA 2V2KA 4CJWA 3BF3A 3V9UA 1N6QA 4OYWA 2VWJA 1Q5VA 3H25A 5F8HA 1XR5A 4ILMA 3VESA 3JQMA 3DLKB 1TUYA 4KKOA 4JKFA 1YVNA 3OUYA 2KHCA 1UKUA 2HHVA 4KRFA 2ZOGA 5M1QA 1VQ6S 1WSGA 2B8QA 4K8XA 2FZKB 4Y2CA 3CCQN 3RB0A 2KJVA 4CO4A 3K0SA 4O4RA 1LW2A 3T9NA 5LMUF 4CF0A 4DV3K 1RHMB 1IBLF 2C2MB 4L72B 2YKMB 2QA1A 4GY2B 3NDKA 3A12A 4TYBA 1I3AA 3BB5A 2OTJN 2OPRB 3CCTA 4IFVA 3M05A 4P10A 4LR8A 1VBXA 3KMSA 1FJGJ 2W42A 4CF2A 4H0PA 2M0GB 4U7CA 3EEQA 2HQIA 3MEEA 4K2XA 5C42B 3KLGB 1JQGA 4GMJB 4ZVOB 3AO1A 1FW6A 2NQPA 5AQIA 2Q66A 3DRSB 5DDRC 3DRRA 1HBMB 1D09B 2V2VA 2W7OA 3C15A 1ZH5A 1L3UA 1TFYA 4WU3A 5FJ4A 4U95A 3AB2B 2C28A 1NLVA 1MMNA 4DV6J 5BR9A 2ASLA 3D54A 3BGRB 4J2DA 5K14A 4ER8A 1HPZA 2IIHA 3BF4A 1TUGB 8AT1B 4DLGA 2BZ2A 2JRSA 3CCJN 3KYLA 5DZ6A 3CJCA 3ISZA 1HI1A 2AJ0A 3LANA 1YDLA 4ELVA 4N77A 5TKWA 4Q8FA 2IMWP 4LF8F 1J6ZA 1JLEA 4CJ3A 1TK0A 5BPNA 1F9EB 3VVTA 3W2VA 4W5NA 1G3OA 1MU2B 3BH7B 3E66A 3QJJA 3EGWB 2RU3A 4ZVEA 1SIZA 1VISA 1NJIT 1A5XA 4MLHA 3OYEA 2P9IA 3VQ5A 2XWXA 2VD3A 2UUAK 3A8IA 5EHHA 3ZXWA 3CCMS 2XMVA 3IWNC 4ED0A 3W2WB 1IBLJ 3ADAC 4DHYA 3AD7C 2PYJA 4MJKA 1RT6B 1Y00A 3U6FA 2CQ2A 4DX7A 4FJ7A 1XMOJ 4LF9F 2YX7A 2ZWHA 2ZJQL 3MR2A 4DUTA 4GVEA 4CGFA 2Y1LB 2BQUA 1QTMA 4GV6A 4AT1B 4GVBB 3W2VB 4LF7J 3NY0A 4LRFA 2NPFA 2AGQA 4BG8A 3DGPA 2R7QA 1A5WA 5JICA 4WF9Q 2W4CA 2A1BA 3LOUA 2IJNA 4CWBA 3HFZB 2R8KA 3J80O 5IT9O 2KHDA 3KK2A 1K8KB 1LCUA 2ILZA 3MN9A 4MKBA 4DL5A 4BRPA 1H0HB 3IRXA 1X4FA 2CJBA 2VC1A 2BANA 3G6ES 2NREA 1SI9A 2AYMA 1SJQA 4CFAA 1XMQJ 3H8YA 4IDHA 4KV8A 4JKGB 4H5RA 3VEYA 4OQJA 4JKAA 1LXJA 1WSJA 1MMLA 4CBUA 3GJTB 3AOAA 4I4BA 5HMXA 3MCPA 1KAXA 4PRFA 2RDDA 3EZWA 4WQ5A 4E7IA 2VFVA 1S1TB 3O8MA 2HHHJ 2F63A 1S5JA 5LL6d 4AQYF 5M1OA 2ZJPQ 1JLAB 5AXNA 2FHMA 3PEHA 2L3MA 4HHJA 1RT5A 3I4PA 2V5HG 2X1FA 2HNZA 4BR2A 5CZ2A 5KFYA 1Z05A 1EP4B 4F2SA 3ILOA 2AP6A 2GVDA 4A57A 1RTDA 2KQ2A 3MMAB 3ZSWA 1RTJB 4RG8A 4M5LA 1UFLA 3CJ0A 4USWA 3HSTB 2VHGA 2ASMA 4LF9K 5D0GA 2K8GA 3A5OC 1FXDA 4HUGA 3T1YJ 4HHTA 3MPWA 3W5ZA 3PX6A 4YY3F 1FXLA 2XMWA 3GZ7A 3O1WA 1CS4B 2Y3YA 4C8LA 3ZFVA 4DPWA 4CH0S 4CLYA 4NLTA 1HD1A 4KAIA 4H54A 2FGOA 2EK1A 2U1AA 2QA4N 4X4UA 2CADA 1WLJA 3GB0A 2JLGA 1RAGB 4FWNA 2L9DA 4JI3F 2UXDJ 1IJJA 1S1WB 4GVLA 1WC4A 2W24A 1RQ0A 3VETA 3M4XA 2FSKA 4WK3A 3ZZRA 1HKGA 2KVIA 2LEAA 1KQSM 3R9LA 4NA1A 4J9UE 3OL9A 4OZ3A 3A13A 3AFGA 1AYEA 1ZYQA 5KFQA 3RUBL 4DFPA 1NDPA 1TMJA 3G8TA 4XK8C 5HQ8A 4JD2B 4KO0B 1FESA 3R9PA 4ZPAA 1WORA 1FE0A 5EVZA 1DT9A 4G1QA 4BRHA 1E3MA 2MZ1A 4DR6F 4IR9A 4N8NA 4OZ5A 4WFNL 1ASUA 4ECSA 4W4MA 1Y3JA 4BRNA 4JBCA 4IO9L 4XEIA 1HWUA 1WBBA 2FVQA 2J9DE 1WHWA 1NK7A 1BY9A 2QYCA 3V1QA 3D7SB 3QZ8A 3T1AA 3PEJA 1VAZA 1DQAA 4BGAA 2QMUB 5E3QA 2EFGA 1TAUA 3S3MA 4P2FA 2VQFF 4M7XA 4LFAF 1WUAA 4BR4A 3JQJA 7FDRA 3PUFA 5HP1B 3MMCB 3KNAA 3HM9A 4B3OA 2CJAA 4CZCA 1NKBA 2ZJRL 2O8CA 2HRTA 4KV8B 4FK4A 2LQ8A 1VJWA 2IRUA 2BOPA 4H4MB 1S72N 3VALA 3OHBA 3UVJA 2A3JA 3N4PA 3RBEA 4X4OA 1R8HA 4FO0A 4CGHA 2N7CA 3W65A 3T41A 1V9OA 2YJEA 1GTEA 2W8KA 2XY7A 4W5QA 3M8PA 2YX4A 1HLWA 2XI2A 1HJRA 2XS7A 2VV5A 4EFHA 3HZ6A 1WDDA 4JS5A 3KK1A 3DWLA 4PYAA 2FBVA 2QEXS 3M6UA 3CJ5A 1VQSA 2UVVA 5KPZA 2HURA 1TYQB 3THPA 4N5SA 2PMZD 2Q3SA 5EGYA 3CULA 1XC3A 4DHVA 3LP1B 2P9PA 1FKOA 1D5AA 4GW6A 4QU6A 4K4TA 1B64A 2BJDA 3B8HA 3I5AA 2VFRA 3MM8B 3BDEA 1T6CA 1NHVA 3UR0A 3DN9A 4KTWA 1HBOB 4M5JA 4CD1A 2I1RA 4OV1A 4DN0A 4F36A 3AY0A 4M5GA 4LD0A 1EWQA 1VMBA 1U0HB 1NGAA 4DJBA 1VQMN 2CQIA 2MB0B 3MR5A 4X65J 3EE9A 4GKJF 1SJ4P 3NKYA 4QBUA 1PCAA 4JI2K 3M8PB 5GIPA 2F7TA 1RABB 1LK5A 3BO3A 3QBXA 4FJGA 1GOBA 3VQTA 4Q44A 4CJPA 2JH3A 5KG0A 3RRGA 1B0TA 2EBGA 1OVQA 4P9SA 3Q23A 3K2PA 1PIEA 3N5BA 3QB0A 1MWYA 3GQCA 3BDPA 4TVAB 1WF2A 1F60B 4USKA 4WE1A 1HHSA 2FJAB 2CZVC 4ERDA 2HQCA 5F8IA 2NR0A 1PC5A 5CR4A 2BV3A 3EJMA 4BE2A 5CE3A 1XWLA 4AE5A 2FJWA 3MM5B 5J2NB 2KO1A 4YHHF 3CWJA 4DV4F 2E29A 4QYRA 1WOQA 3AO5A 4CLLA 2M3DA 2Q31A 1C0GA 3BBCA 3PW4A 2CGLA 4E2FB 3VGMA 3DJCA 2QXLA 3TTCA 3HPHA 1QVFM 2Q43A 3Q8UA 5TKYA 1XBWA 2UYTA 3W66A 4HUFA 3DYAB 3W61A 3GFHA 5H9EK 2CGJA 2BUNA 1CVJA 2MPUA 5L1KA 4JI2F 2V7ZA 1N52B 1FRHA 3HYFA 4NLOA 1ZOTA 2DFEA 3TRGA 3IP0A 3J7ZT 3HTVA 1S1VA 4CHNA 5KFWA 1RI7A 3ENHA 4OX9J 2MLZA 2D0BA 4AL5A 4LT6A 3QJLA 4IDKA 3ULHA 4DUYK 2F8HA 3OA9A 3O4QA 3C14A 1M90T 2HHUA 2DY4A 4CBXA 2DH8A 2MGZA 4DV5J 2FPHX 3VV2B 2OSQA 3JB9k 4ZLNA 3KK1B 3MX2A 5D4OA 4E7HA 3QAEA 5IWAJ 4JN4A 1VQLS 3KJFB 5LM7E 3T9ZA 3O44A 2X6NA 2LXFA 1E4FT 2EFQA 3DNCA 3BPDA 3MMVA 2C3PA 3O9SA 3TNVA 5EUHA 3H1VX 2ROPA 4Z4EA 4ZCKA 1RWOB 2V2ZA 3K57A 4MAKA 3P96A 1NPPA 1FKPA 1M1GA 4M5HA 1ELOA 1MW7A 2EK6A 4IRDA 3QT5A 4FPBA 1JLQB 2QSFA 3KG4A 3ONQA 4IJAA 4MMOA 4WKRA 3BKUA 4DR6J 3KIOA 3L95X 5DG7A 3KK3B 1OY9A 1T6DA 3SBGA 1BXNA 1JLGB 5ETLA 2MQ8A 3TVYA 3H6EA 1VQYA 1FRLA 4LF5J 4BC3A 5B0FA 4W98A 3L3CA 4OPAA 1XUPO 2RU9A 1URNA 4BC2A 3GFYA 1NB2A 4CJFA 4XTTA 3UCGA 3P8BB 2C2RA 5FPEA 1XR7A 4RX6A 1VQPN 2HK3A 4TN2A 2VOPA 3ZTSA 2W7PA 3FVYA 2YH0A 1PO6A 3EGZA 3E3XA 1ZBSA 2QL7B 1OKJA 4MLEA 1C1CA 3MCMA 1IKYA 4CZIA 4DS5A 2FVSA 4NYZA 2V9WA 3N9UC 3CDBA 5FRNA 4KHPK 3EL2A 1NMNA 1E6YA 3BBFA 2O01C 4YB7A 4LF1A 3MTJA 4DR4K 1TL1B 1FFSB 1YJNS 3OS1A 2LDIA 2HFZA 1LWEA 1KTQA 4M5IA 2RRAA 4FJMA 1D9AA 3RMDA 1HQEB 2H54B 4CHOA 3EGNA 3FEXB 1YKWA 3V9XA 4X4VA 3HRGA 3CCVS 3D6RA 3BBBA 5D15A 3CM6A 3CPWM 5HBMB 3PJ9A 4DMZA 2P5OA 4K0KJ 3I87A 1JKHA 1B0PA 1TV6B 2E1MC 1APSA 2E5LJ 3NH0A 1IWAA 4DUZK 1RCXB 4Y1DA 2AIRB 1BC6A 1VS3A 1YIJS 4ELUA 3Q8SB 5LT5A 1VQ4S 3BQ2A 4DV2K 4DR1K 5H9FJ 3OVSA 4OFZA 5GADU 3CMAS 3J8AA 5DQIA 2RQ4A 3IN5A 1YJ9N 4NYFA 4KHYA 3MEGA 2NRWA 4QR1A 3A1YG 4YEAA 4CJLA 3AVBA 2R7OA 2A18A 3TA0A 1KBRA 1LW2B 1TL5A 2HHHF 2DCUB 3NAIA 2FLPA 5L1JA 4CHQA 3GE1A 3OYMA 4X4NA 4NX9A 2ZQBA 4ZIWA 2KVQE 4ZOSA 4M3XA 1P1LA 3WC0A 4HACB 3M6XA 4ECYA 2BEFA 4NYOA 2D4WA 2HHTA 4BY9C 2KRRA 2HMPA 3DOMA 1VIOA 2LLZA 5JLHA 3F0NA 2BOAA 2F5GA 1YZ6A 1JL2A 3M8SA 4HTJA 4A8QA 2NXCA 2PN6A 1I5OB 2VPYB 3VTIA 4WFNQ 3QLHB 4K4UA 4HR2A 4ED5A 5F8JA 5H9FK 4DX5A 2E2NA 4LFCK 2CNLB 2KXNB 4L3KA 2I0XA 2ZM6J 2OYQA 1S9FA 2B4JA 2IMOA 4L3NA 3T1HF 4ILJA 2DNMA 4KTQA 4YDUC 2G2YA 2OEKA 3DXKA 2R2TA 1SZ2A 4X62F 3HZGA 5KFPA 4MFBB 4O44A 2G8IA 2CPFA 2CYYA 2MSSA 3VQ9A 1N56A 3EO3A 1Y64A 1S99A 4FJXA 4FBTA 5B08A 2BKNA 3DI6A 3V1OA 4YN3B 2P1JA 4FP9A 5EN1A 4OKJA 4F4ZA 1W97L 2GMLA 4BRGA 3WIVA 4OYZA 3SFUA 5KFHA 1HQUB 4KH6A 4CZJA 4D3GA 2XHCA 4CBWA 4L75A 1S6QA 3P4IA 1TU0B 1RHRB 1N0VC 2NCKL 1RAFB 3GIRA 2YKMA 3P5BP 2K7JA 2E2QA 3QFPA 4PUOB 3BY5A 4M5KA 1S10A 4YHHJ 4BWJA 3NCIA 4USTA 3ZETB 3E2EA 2PA8D 3CD5A 4ECTA 3GPAA 3QPIA 2CH6A 4E1NA 3H4BA 1GOAA 3PW2A 1DFDA 4M3RA 1T8EA 4PR6A 3SFGA 3H5SA 2LMIA 5HO4A 4O5FA 3UCUP 2G1HA 4CO1A 4B8AB 2DXFA 3P5TL 2OD4A 4P7TA 3CT9A 4WTYA 3PZPA 4FKYA 4BVPA 5ADXA 4DOZA 1HPMA 4UOHA 1HFEL 1RTJA 5CQGA 4CJ5A 5AR0A 3IMQJ 4CP5A 3SDEA 2BE2B 3IS9A 2KT3A 3THVA 3B78A 2V6AA 3VQ7A 2XGPA 1YQHA 4CEZA 1CJTA 1NDCA 1MN7A 1JNRB 3SMPA 4MDAA 2ZWOA 1M1HA 3W60A 2G8KA 1RT7A 2RS2A 1A5VA 5AXLA 4QW9A 2IS3A 1X3NA 5GAGP 4DR7J 4Y6IA 1RA6A 3BUZB 2RRNA 1VSMA 3DRSA 1C0UB 1OY6A 1N4LA 2BJ3A 2OLWA 2IVNA 4I6MA 3HPOA 4PYDA 1X5SA 1YJUA 3HHEA 1FKPB 1M5OC 4F3OA 2VG6B 4IO8A 4ILRA 1JJ2R 1VQ8S 4XO0A 3S3NA 2IVOA 1C4CA 2YWFA 1M5SA 2HRUA 3L4BC 1S4FA 3WZ0A 3KUHA 5KT2A 1UJ4A 2Y8YA 4CFDA 3V2UC 3NGIA 4FPRA 1RB0A 3D0IE 3UDLA 5I4MA 3VAHA 1FD2A 4WU2A 4K8ZA 2I6WA 3KLFA 2K1RB 3MTKA 4CEFA 1REVA 1VQ9N 3HHLC 3VR1A 2B4OA 2V68A 2ZH9A 1KOOA 2BW7A 1GXUA 1UJ6A 1YF5L 3CETA 3KVGA 1NGFA 4OGCA 4LRDA 2HBRB 4MK9A 5DM7L 4Q2LA 1GXLA 2HG4A 1JLAA 4G65A 2DNLA 1FK9A 2XULA 3V4IA 2GC8A 3VQPA 3C16A 1GAOA 1JJHA 3R5GA 4RW4B 2GCFA 3K58A 4J2EA 2YBVA 3N6NA 4BHQA 4RW7B 5KG1A 3SJJA 5CYMA 1BWFO 1RT4B 2E1PA 2D0PA 3GV8B 4DPOA 2BJ1A 2C1EB 3PR5B 3M5RA 3NBPB 2AT1B 2E5JA 5A8KA 3CYMA 3KZBA 4F3QA 4DV3F 2QWLA 4BG9A 4RWXA 3OSNA 4CFCA 4ZPVR 3E9PA 2OD6A 2M7SA 1HBNA 2A40A 1T9TA 3D9BA 2I5JB 3M32B 4WTOB 3EZUA 1N5YB 3UKUA 1HR0F 1YJRA 4MQ3A 3DM2B 1VCTA 2UXDF 3KKFA 2PFFB 2QL9B 2VFUA 2G0IA 2CG4A 2OTJS 4QW8A 1T9UA 3OTBA 2BW2A 3NAHA 3OYJA 3M8WA 1WSEA 2J76E 3ELHA 2YNFB 1WC0A 2QA4G 4TYAA 3ZTOA 4MIWA 2UUCF 2OANA 1RXOB 1QDUB 3SPZA 1CG2A 3GU0A 2N3LA 2FZGB 1BE4A 1ROFA 3M2VB 1ASWA 4MKAA 3MEDB 4KFBB 3SQ0A 3R5BA 4H4OA 2FYXA 3DRRB 1HBMA 2IM3A 3L3UA 1BI4A 2OUGA 2O8BA 3EX7B 1Q82O 1IKXB 3VGTA 2A42A 4CGGA 3U4LA 3M2RA 4GKJJ 2WBRA 2W4PA 1UWBA 3AV9A 3Q86A 3G0ZA 1NJYA 3GG0A 4TXSA 1RTDB 3ETMA 2X1AA 1CULA 2YNGA 1AZSA 3OFFA 1SQEA 2Z57B 4OMFG 3NL0A 1JXLA 2JEIA 2HMIB 3O9UA 2J0SD 4A2BA 3H20A 4KH1B 4F0KA 1UEUA 3UKRB 3VF0B 3TVKA 3UIQA 4IR1A 3KK7A 1WSRA 4DSKA 3ZZPA 5K5MA 3CDUA 1QAYA 5K20B 1LKZA 1G15A 4IJNA 5U47A 5ETPA 5D3GA 3ULEA 1U49A 5I3QA 4LH4A 3ILJA 1RK8A 4FL9A 4TY8A 3AAWB 3MCNA 4CZEA 1FRMA 2WBNA 5AQYA 2IDEA 1S9EB 3FBEA 3MMBB 1R8CA 1LK7A 2HW3A 3GIJA 3HO1A 2J0XA 4HT5A 3T19A 4F0MA 4EHTA 5AQHA 5EWEA 2ZZNA 5HL7Q 1IR1A 2BJ9A 2MKJA 2BJ8A 4OO1J 2DHSA 3HMJG 3FZFA 3HSCA 1S79A 4DSIA 4IOAQ 3OVBA 2YHBA 2OEMA 3D2FB 2PFDA 1ZZNA 5GAEI 5IM0A 2XGQA 4NCGB 1WSVA 1U0SA 1Y5NB 4NI2A 4YY3J 4RW6B 5C24A 5G4DA 1VQ7S 1HMVA 5D6GA 3CJ1A 1WOOA 4BACA 2XBPA 2HS0A 4H0OA 5M1KA 3TA2A 4WFYA 4OX8A 4KGVB 3ZZYA 4ID5A 5HQMA 4WFAL 3CQXA 4ZVTB 3HHKA 2PD1A 2FLOA 4DL7A 4QU7A 3ZZZA 2WZ1A 2Q1LA 4Y1CA 4BR0A 5IS2A 4WFZA 1HX1A 2AJ4A 3GFZA 4ECWA 4P74A 4BROA 4CIGA 2F4VJ 2HQDA 4MTPA 4HI2A 1RDCA 1P9QC 1KSPA 4FXDA 2P9UB 3SCXA 4DQRA 1Q86O 4ZLLA 4LF4F 4UY85 3H59A 2QWRA 1KVJA 1HMVB 3PFEA 2QI2A 4C2MA 1ZTWA 1VRQC 3KHHA 2BRKA 2DVIA 2ZVSA 4ECVA 2O8DA 2KN4A 4DDFA 3THWB 4FWMA 4NXNK 2KKZA 1R0AA 4O0NA 4QIVA 2RHQB 2XSFA 4LF5F 2HBJA 3HOSA 1EAYC 1ZBLA 2M2BA 2EPIA 5E41A 1VRTA 1Q78A 4B1XB 2B5JA 4Z94A 4AFFA 1S3XA 2HFSA 2CJQA 4PL8A 2OA8A 1EX4A 1P8ZA 4V19S 3CC4N 3DMJB 1FRXA 2CNKB 2GNKA 2YXLA 4G6VB 4IOXA 1RT3B 2AJ2A 1HNXF 4AH9A 4LF9J 5KFUA 2SXLA 3DC2A 1F3VA 3GIMA 5CD4H 3J80U 2QWOA 1Z2LA 1NK4A 2H5EA 3DU5A 3VZHA 5C15A 2WC9A 4DR6K 4ILHA 4OHVA 3R7NB 2AEFA 3WNEA 3I55N 2WB1D 3KUEA 3CVKA 3MPYA 1J5EK 3QWPA 1X60A 3PR4A 2R9LA 2QGFB 4HDHA 4JI6F 2HBMA 3SUPA 1TMMA 3UDCA 4BRKA 2ASDA 5EX0A 5LY3A 4L74A 3HCXA 5AQJA 4QPTA 3NGKA 4NXMK 1IKYB 2QTWA 4ZHRA 2QLWA 1DY3A 4RWWA 1GLBG 4X4TA 3JTOA 1HNVA 2EVZA 1NSAA 2P9SB 1MN9A 4DR5J 5A2QU 1NLKL 5A0YB 2HFNA 1NHUA 2A3ZA 2IRYA 4DV6F 2AKWB 4R8UA 4LFCF 5CH7B 3LP0A 4ID5B 3G82A 1ZAVA 4RNOA 4C11A 5LMNJ 1WC5A 3JXUA 1U47A 3EVMA 3G6VA 4CIEA 3R3LA 4ZVQB 1RT1B 4XAKA 1VDHA 2O8CB 1VBZA 3L2UA 4M95A 3WDOA 2MZJA 2AX1A 1U1RA 1YJ7A 5HP1A 3MMCA 4OKEA 3I56N 1RWVB 4QIEA 1A0OB 3H2VE 2R7YA 2QE5A 1N32F 3BN4A 3MZIA 5JS1A 1RNHA 1S9GB 2XMJA 3PSFA 2NZ4A 4FJ9A 2CKWA 2CVIA 1HHTP 3PSIA 2MQMA 2LQ9A 3QIOA 4C0BA 3KHLA 1FJGF 3VQDA 3MM6B 1SJ1A 5IZHA 4LSNA 2NPIA 1VSEA 4FOIA 2DH9A 2MZSA 3SSQA 3N4QA 2YNIB 2O8EA 4EGLA 3OW2R 4ILLA 2E1AA 4I2PB 4ZCMA 1D8ZA 3LPYA 2ETJA 3PO4A 2J6UA 2VPXB 3BGOP 1GQEA 4HACA 1U1MA 3EMTA 1PAUB 3IGVA 2VC0A 3CCZA 2J8AA 3MXMA 1RDUA 2V8GA 1KRPA 1R6YA 1Q81T 3KMQA 2QM1A 2XRIA 1WKJA 3AGRA 3PIOL 3HLUA 2G8UA 3J7YP 3QINA 4DCOB 4JYAF 4AHTA 3VF6A 2DTUA 2HMIA 3W8PA 3OTOK 3KLIB 1OJ4A 3EDQB 1PSDA 5L8RC 4U67Q 2FQQB 3ZC4A 2H48B 3GTYX 4KY3A 1UAWA 2VZ9A 4X4QA 3TTDA 4F4WA 1NGCA 3TARA 4JI5F 1YSJA 1ATRA 4X65K 3W64A 4WFBL 4DTRA 4B9UA 1RDAA 2B9EA 4O3QA 2CQHA 2CFXA 2VWBA 3RB3A 4YDXA 5AQSA 3CD7A 2VFSA 3QDKA 1EKEA 4AILC 4KPYA 2UXBF 1RJJA 1ZBIA 5HSPA 1YI2N 1PAEX 1TGOA 3CJQA 4FF1A 3M30A 1URRA 2PDAA 4NA2A 3S7RA 4IOAL 4DSLA 2N3OA 3EDRB 4C8ZA 5KOWA 1TK8A 3SDEB 1VHFA 2ZD1B 2JL9A 5T41A 3KD5E 2EBEA 3L2RA 4DTSA 1H6KX 5ETMA 1GLLO 4FLZA 1RWKB 3RBXA 2CIMA 3T5KA 4AD6A 3ZT2A 2WHOA 5FDLA 1YVUA 1JXBA 1VQ4N 2WUSA 1YAGA 3IR5B 1ZBHA 4FDFA 1TKXB 3VQCA 4BRQA 1AUSL 2COLA 4DF4A 1O13A 4RO0A 4CZLA 1JCFA 4FM2A 3CIZA 2DISA 5CCLA 4DV7F 2N4CA 4ELTA 3JXOA 3CFPA 4BC5A 4DQIA 2DXDA 4A5AA 3ENAA 4U96A 2MQOA 1OH5A 3CCVN 4N47A 1MG7A 4C8NA 2OHDA 3H08A 4I0WA 4CEQA 3H1QA 1YJTA 2D9OA 1P8GA 4RZRA 2EEYA 4QPXA 4FVMA 1ZAXA 1WI6A 2D69A 3KJVA 1F2GA 3PYFA 1U2VB 3SAGA 1XC9A 1TAQA 3G8SA 5BYQA 4C1NK 2OCEA 2DPNA 2GMHA 3MWPA 1YBAA 1N36K 2A10A 1VSJA 4UOCA 4DR2J 4J9MA 1JWWA 4J9LA 4F2RA 1AROP 3AVLA 1S12A 1UVLA 1R8AA 3VZIA 2YHAA 4DTXA 5AZIA 1W2IA 3RRHA 3RYLA 4RNFA 4ZTFA 1RT6A 5EU7A 2ZHOA 4UT4A 4Y65A 2IVFB 1VIXA 1OO0B 3AHPA 4RNMA 1X9WA 4YP3A 3PTWA 3KUGA 1SKWA 3FLCO 4F4KA 3QATA 1LWFA 2Z8QA 1FD8A 2OGUA 4H5NA 5DGBA 4JRQA 3S9HA 1S9EA 3MMBA 2UUWA 1VR6A 3T6BA 1CXUA 4PXDA 5L9XA 1EKRA 4F9OA 4DV7J 3C6UB 3DOLB 4NLXA 5AQNA 1H1VA 3KLHA 1U26A 4FWSA 3CEDA 1IKVA 1H7WA 4USHA 4TLRA 2DIVA 2Q0UA 5CXTA 8RUCA 1NDKA 1A6LA 2DHXA 2EHGA 2UXDK 2DY1A 2V34A 4OI2A 2DO0A 2V8VA 2ZZTA 4NXMF 1LOTB 5ETKA 4DQSA 3CGIA 4KHPF 2CG8A 1B99A 3LZJA 3GJQB 3LH2S 1B0VA 4QS7A 3M1VA 3SQOP 1WTBA 4JHDA 2BQRA 3QWUA 4W5OA 1IKWA 2ACYA 3MX5A 2JVRA 1SL2A 4RUAA 1GEHA 1NK6A 2X6SA 2DGSA 1Q8IA 4XIUA 3ICLA 1VBKA 2FXUA 1IXKA 4ZA1A 2VH7A 3D4JA 2AP1A 1NGBA 4PG5A 1TQLA 2ZH6A 3VGLA 3AO4A 1QQNA 2P5VA 4BC4A 1OYDA 1RP5A 1SC6A 3ZTPA 2BVZA 2JC0A 2GMJA 2J9EA 2KLAA 1HKBA 2IAJA 3EXYA 1B92A 4NA3A 2HB5A 1MWMA 2HOEA 3Q2TC 1L3SA 1GLJO 3KJNB 1J9AA 3L4QA 1SJRA 2MKHA 4EZ6A 2R7WA 3O6WA 1YITS 3B4DA 3H42A 1R7IA 3NEKA 2XO7A 2C2ZB 4O4GB 2RN2A 4OX6A 2J0WA 2F8MA 3KWMA 3C2PA 1RHJB 4EWTA 2YPYA 1ACMB 3SNNA 1RTIA 4I6AA 1C0TA 1S7HA 4URGA 2UXBJ 4CJTA 2NUUG 3IR7B 1YGYA 1HQ2A 5C2CA 1SC4B 5GADI 4S0MA 1LV5A 1IVZA 1KFSA 3BGUA 4FWOA 1IQTA 4WFXA 1XMQK 3FQKA 2P9LB 4LF2A 4BR5A 1HPZB 4DEZA 4RW9B 4OYMA 4CHPA 4CJKA 3FFKB 3PRBA 1PBUA 4FXWA 5IQ6A 2BDPA 1JLGA 3CCQS 3VGVA 3KKRA 3IG1B 4EEYA 1OH7A 2GO8A 2HPUA 1RHKB 5KG2A 1IQZA 5IWAF 4NZ6A 1Y4ZB 1RGIA 4OJRA 4B9MA 3Q8RB 2XY5A 2RSQA 3C7NB 3SCLE 3CJKA 4E0DA 1NH7A 3R27A 4Q2MA 4X4SA 4C8OA 4JYAJ 1PJ5A 2RPIA 5D0EA 2AV5A 1V4TA 3QSIA 3AVCA 5KRSA 4WBFA 1WSFA 1IJEB 1YHQS 1LWCB 3WQPA 4HUEA 3QBWA 3J7YU 1N32J 3V6DA 2UXCK 3CNQP 1FCAA 1REVB 2NRXA 3AVMA 1JLFA 4FPIA 3AD9C 2DNQA 3VAGA 1PYSB 1U1QA 3BGFA 2VODA 2FHJD 3HD1A 4CESA 4F26A 2ZVIA 4NXNJ 2WOMA 1T03B 4IEIA 2V4JA 5KFTA 3JYTB 1D9DA 3IRXB 4FYXB 3TWHA 3AJ2A 2FBTA 1RU1A 3MAHA 1EZZB 1S6PB 5KFIA 4CJ4A 3KKSA 1N48A 5IT4A 3C14B 3GFXA 3SQGA 1WAFA 4ALZA 4JV2A 3SI6A 1HA1A 1N5YA 5M1NA 4AXJA 3R5AA 2JLEA 3ALYA 3BQ1A 3ZTRA 1CXQA 2VF3A 5KG5A 1JXEA 3JSBA 3AAPA 4C8KA 1U04A 3G4SS 2IFXA 3I33A 4DV6K 3LP3A 3LDSA 1YIJN 1N33J 2CUYA 3MN5A 4DF8A 5HOOA 2VG7B 1YK9A 2C3UA 4LSZB 4HCCA 3FGVA 4PKGA 3HT0A 3BSOA 3OQ2A 2QA4S 2Z56B 3K5OA 2O4IA 5IM0B 1EWRA 2CPXA 5AJ3F 2FLNA 2O8FA 3QNWB 3DLRA 4JD2A 2APOA 2Q3PA 4ED3A 2BR0A 2C2NA 4YOWA 4N41A 3KJQB 2YI1A 4ECQA 4YY3K 3QAUA 1AA1B 4H4KA 1M5PC 2MQLA 4FK0A 1Q82T 2QA2A 1YI2S 3U7JA 1RDWX 1D4XA 1M1KO 4M3WA 4NRTA 3MF5A 2ZOMA 1QZ6A 1K0TA 3V9ZA 2R7VA 1T95A 2N7YA 1WUUA 3GE9A 3FNNA 4LR7A 5B0BA 3W9IA 2AU0A 2W40A 2GVZB 4R5PB 5DG8A 1FXXA 3MUTP 4K59A 4NLVA 3OSPA 3R1HA 1CPZA 4CO0A 2QFIA 3V9SA 5KQDA 2HQ3A 2DO4A 2B4VA 2QLXA 4GNIA 2HVEA 5A76A 2RNEA 3PJXA 2HGNA 3MD3A 3L2VA 4DR1F 1VQ5S 1C0UA 4DR5F 5HJXA 3NVMA 2M4MA 4IOBA 4DL3A 4LFBF 2YNHB 2BMBA 3EPIA 3J7AP 1LOUA 1WNEA 1H2VZ 2IJRA 3OTDA 2F4VF 1GLDG 5E0OA 2QLJB 3JTNA 3EXCX 1SAZA 2IRXA 4F8RA 2EKYA 1VK3A 3NF6A 5LJ5Y 3MWBA 5GVQA 4NYPA 2GV9A 1E6VB 5AQQA 2EC2A 3O9QA 4JKDA 3QRPA 1EIYB 4DSFA 1PYOB 4NLRA 2YQ3A 5CAAA 4ID1A 1KC8T 4AM7A 1S4EA 3UWTA 3SCIE 2W9CA 4QIWD 1O0PA 4ANDA 4KI6A 3VQEA 4PABA 1QUPA 3HSGA 3AO2A 3ZSYA 4LBPA 2A2DA 1MMDA 2VYPA 4ZPTR 4OYOA 4AUKA 2HGMA 2J0QD 2POKA 1BUPA 5A8RB 4C1NI 2M70A 4EZ9A 2DHHA 3N28A 3ZX2A 2OO4A 4QWBA 1ZM9A 3RW7A 2IYGA 3QEVA 2FGCA 3T7ZA 2UUAF 4KGZB 3AVNA 4Q5VA 1G7CB 3TX8A 3BS9A 1CJKA 3R7SB 2R2SA 1J27A 3M7VA 1KVCA 2H3GX 2W4DA 3RB4A 2CJ9A 2ZWPA 2QV6A 4PZVA 1X31C 2MKCA 1SKRA 2RRBA 3ZZUA 1N5TA 3MMJA 1TL3B 5BREA 3VA0A 5HJYA 3W2WA 3F56A 2QW9A 3PHEA 2LCWA 3CI5A 2E2OA 2B4UA 3QERA 4LF4J 3QFUA 1NM2A 3K5MA 5CYQB 2B9XA 3PKYA 5IWAK 4OHYA 2L48A 2RKIB 1H7XA 5A0YA 1X4DA 3SEOA 3OS0A 4B1VA 2QJ3A 2KFNA 2G0CA 1WBDA 2ZH2A 2CJYB 2EFPA 3D6HB 5DQHA 3IM9A 1F3FA 5HL7L 2DNRA 3SUNA 4WYLA 3DXBA 2KFZA 4WZMA 1H98A 1FE4A 4GO7X 1RT1A 1S1UA 2BBEA 4BRLA 1KQGB 3OFGA 1RGVA 4NEZA 1NDLA 3LGNA 4A2AA 3FK4A 4ZCLA 1IR2A 3FBCA 2XG8A 3CC4S 2GWKA 2ITGA 2KM8B 3O9TA 3MUMP 2ZBIA 3L6QA 1XI1A 2DB1A 2MQPA 1EETA 3CJSA 4A8YA 2MLXA 3AOBA 2PE8A 2E6MA 4B3TF 1ZC6A 5AQLA 1SL0A 3I0SB 2JEGA 1NSKL 1VQ8N 4B3SK 3SMSA 1QUVA 2E7XA 2ASOA 3LGMA 4MK8A 4DR3J 5C42A 1N54B 1WG5A 1NEEA 4JHDB 4CEDA 1JKHB 2GQQA 4HH0A 1KWMA 3BV8A 3OV7A 2PFUA 3O4NA 1YJWN 4NZ7A 2IPOB 1FXRA 2ZDPA 4YOUA 4O8UA 4WP9A 3IRWP 2R8GA 3W7BA 3HVAA 4PQUA 3VEXA 3DRXA 1TUUA 3M9OB 3OXGA 4DV1J 3O2IA 4DV0F 1VSKA 3JQKA 4M5DA 2YHYA 4RBTA 1BGXT 4B3OB 1DHMA 5KOXA 3D0HE 8ATCB 5CHIA 4RW8B 4FWLA 1RT5B 5ETVA 2ZITA 3TUJC 3PHTA 2GIQA 1Q16B 4P72A 4KKOB 2AX0A 5KT3A 3Q24A 1X9SA 3DRYA 3OBYA 3V81B 3BYRA 4XPEA 4UY8T 1N8RO 3HSJA 1MA9B 3FE1A 3VWSA 3Q83A 5KG4A 1ZBUA 2BYCA 3HL8A