3DLEA

Crystal structure of hiv-1 reverse transcriptase in complex with gf128590.
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
538
structure length
534
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 135
structure length 534
sequence length 538
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dleA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dleA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dleA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dleA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dleA05
3WNEA 1Y97A 1JXBA 4CESA 4DL7A 2FLNA 1U49A 1CZBA 1TK0A 1SUQA 4R0EA 1TKTB 4CFDA 1ASUA 3I5AA 1RT6B 4WZQA 3TI0A 2BDPA 4FK0A 4M3UA 2C2DA 3K5OA 3DLBA 1VSIA 1BHLA 3NKYA 3MAQA 4E7LA 1JLQB 3ASMA 4WFYA 3OJSA 3P1GA 3AO4A 3RBDA 3KLIA 4H4OB 1YTUA 2ILZA 4C8KA 4E1MA 3OYLA 1JKHB 3I5CA 1X9WA 2HHUA 3PHEA 4LY7A 4PY5A 1IKWA 3O4QA 3RRHA 1FKOA 1LV5A 2AGPA 2FC0A 4Y1DA 1D8YA 3BGRA 1HRHA 4KB1A 2O4IA 4RW4B 4IQXA 4N41A 3N6MA 3CDUA 3KK1A 4Y3CA 4WZMA 4KI6A 2KZMA 1D9FA 3AO3A 3DMJA 3LP1A 5HLFA 3G0ZA 4NRUA 4H54A 1HNVA 2Y1IA 4X2BA 3OYDA 4I2QB 5HBMB 1BCOA 1XHZA 3NHGA 4ECTA 1EETA 2W9BA 5SWMA 4KB7A 1NHVA 4H4MB 4NLXA 4DTMA 4CGFA 4BDZA 5KFXA 5KFUA 4KTQA 2G8WA 4OVLA 1FKPB 4IH7A 3UDLA 4QAGA 4FW1A 5FROA 1RTHB 3OJUA 3MF5A 3PY8A 5DK5A 2ZD1A 2HMIA 1WNSA 1VSFA 1RILA 2AGQA 2XCAA 4GMJB 4ELVA 1TL3B 4RW7A 1S9GB 1KLMA 3QNOA 3MEEA 4KI4A 4ZVHA 4IG0B 4OLBA 4O0JA 1TKZB 4Y34A 1VSHA 2ZQBA 2DY4A 4ECRA 4N56A 1QSLA 5KG1A 4KB0A 2OZMA 2E6MA 1JLFB 4DU3A 1RA6A 4DSIA 3G6YA 2B43A 3ZSXA 4J9OA 4O4GA 4F8RA 1UWBA 1TL1A 2HNDB 2R2UA 4EYIB 4EYHB 1XHXA 3D5MA 1BIZA 3ZSVA 5DG7A 1JLBA 4ID5A 4CJUA 3PZPA 4DSKA 2QE5A 2HWHA 4N47A 2AWZA 1SH0A 3VQ5A 3GIJA 2J6TA 4CEEA 4FLUA 4IH5A 5D3GB 5DG8A 5I3UA 3HJFA 3SPYA 3V9UA 5C42B 3HVTB 3U3YA 3KMSA 3EZUA 3AVAA 1R0AA 5J2PA 3CG7A 3DRPA 3PX4A 2G8IA 2C2EA 4JS5A 1C1BB 3TAEA 3JSMB 1L3TA 4EEYA 4IR1A 4KHSA 4LSNB 4F50A 5C5JA 3TAGA 1Q8IA 3CM6A 4KO0A 1EKEA 4J9LA 3EY1A 2GV9A 1HYSA 3KD1E 3VA0A 3OSNA 1IKYA 3TVKA 1RAJA 3NDKA 4FZYA 1VRUA 4OKKA 3ITHA 4DMNA 5F8MA 3LP0B 4ELTA 1NKEA 1C0UA 1T7PA 5KFLA 4F3OA 4QWDA 3C6TB 4CJWA 4FJNA 1GOAA 2E4LA 4QWBA 5KG2A 2XY8A 2VG7B 3ZT0A 1C1CA 1WLJA 3E51A 4MFBA 4IRCA 1C1AA 2WOMA 1XR6A 1D1UA 5EWEA 2HVHA 2JEJA 3VQBA 2XRIA 4ECSA 4E0DA 2G8HA 3Q8QB 1S1WB 2RPIA 3UPFA 4I2PA 3VQ8A 1D9DA 1L3UA 3K2PA 4MK7A 1RTJA 1XC9A 3RBEA 5J1EB 4CHYA 1RBTA 2JC0A 3GV5B 4K4XA 2FVPA 1EP4A 2VA3A 3NCIA 5CYMA 2PY5A 3K5LA 3I0RA 2BQRA 4MK9A 3ZSZA 4F4KA 1WSEA 3KHLA 4CJTA 4DTPA 2IJNA 3TABA 3H40A 1RT1B 2OH2A 3OYEA 4KFBB 2GC8A 5KT6A 4R8UB 4DU4A 2XC9A 3CFPA 5FDLA 4CHPA 2KW4A 1TAUA 3BSOA 3V6JA 4PQUA 2FLLA 4ZVEA 4IG3A 1RT5A 1WN7A 3FFIB 5C25A 3KLFB 1LWEB 4DTNA 2YNFA 2DFFA 4TQSA 4Q45A 2AX0A 2GBZA 3ISND 2EC0A 2ZE2A 1T05A 3KLGB 1TKXA 3RRGA 3NE6A 1ZYQA 4CEZA 4DSLA 3TARA 1JLEA 2YNGB 4CJRA 4DL4A 1B9FA 4ID1A 2JGUA 4E89A 1S9EB 1S0OA 2CJQA 3AO2A 3U3GA 2R2RA 4CJVA 2WB4A 4YR2A 3IRXA 2C22A 3ZCMA 4J2DA 1KTQA 3L2UA 3ZSYA 5KFIA 1C0TA 2BANB 3GV7B 2RN2A 1N6QA 2V4RA 3KK2A 3AVKA 1WSGA 5KFJA 4FK4A 5L9XA 4CHNA 1CZ9A 4WE1B 3PV8A 2R7YA 5EDWA 1D5AA 4OJRA 1N4LA 3QLHA 5J2NA 3OL7A 1EXQA 5JXSA 2FBVA 5DGAA 2A1RA 3LPUA 4O5BA 1TV6B 2C2RA 4O0IA 3V4IB 3S9HA 4BE0A 3VQSA 1LWFA 3EYZA 2OPSB 4F2RA 3AVHA 4FLXA 4DFPA 1RBSA 5L1JA 5EU7A 4DWIA 2YKMB 2AU0A 3NH1A 2W9CB 1TKDA 3OYFA 1YT3A 4M3TA 3O3FA 3RB6A 3AA5X 5C24B 3CDEA 4FVMA 2D7SA 3CJ5A 4K4TA 3SCXA 3FQKA 1A5WA 3QETA 2RDJA 3HT3A 4B9UA 4CJPA 1T03B 3F9KA 1DTTB 4YNQA 1HNIA 4EO8A 4MIAA 4M95A 4WFZA 2FJWA 4DL2A 2RKIA 1HMVB 3NH0A 4CF2A 2Z1GA 1T3NA 2D3ZA 4Z4FA 5K14A 4JV2A 5E41A 4PWDB 3QESA 4ECUA 3MR2A 1KRPA 3FDSA 1FK9A 2KFNA 4TYAA 3KTQA 3OYJA 3HYFA 2VA2A 4N76A 3L2VA 1JLAB 3V81B 3O3HA 3QO9B 2B5JA 3NH2A 1XI1A 3DOLA 4KSEB 1SH2A 4ZP7A 4C8NA 3ULDA 4E1NA 3GIIA 3WNHA 3KLHB 3HP6A 1RTIB 3M8QA 4JUZA 4CEDA 3CIZA 1RBUA 3MXJA 4KAIA 3DI6A 2G8FA 2BE2B 4Z0UA 4J9PA 4XO0A 5KFZA 1GOCA 2IJFA 3IG1A 4K8ZA 4K8XA 4NCGA 2R2TA 4NYNA 3T5HA 3H59A 2Z1IA 1QSSA 4HUEA 4YR0A 1SV5A 3TAMB 1DLOA 5KT5A 5HROA 3GQCA 1DTQB 1WAFA 5KFWA 1SKWA 3OYHA 1J5OA 4FBUA 1SKSA 4ECQA 4CK1A 4ZVGA 3DLHA 2IC3B 3CQ8A 5T7BA 3S3NA 3NBPB 1EX4A 3MEDB 4IFYB 3HP9A 3DLGA 4IKAA 4OKEA 3SQ2A 2W7OA 2JLEA 3G86A 4CIEA 3DDKA 1NK4A 3QYYA 2ATLA 2HHWA 1WSJA 5KFGA 4R5PB 4DSEA 2HNYB 5KFFA 2WTFA 4NLQA 4M3WA 3GYNA 4NRTA 3L3VA 1LW0B 4RNOA 1B92A 5F8NA 4FJKA 1O1WA 1TP7A 3HO1A 4KKOB 1REVB 3SFUA 3VQAA 4AH9A 4PUOB 4TQRA 1TVRB 3SFGA 2IM1A 2VG5A 3RMCA 3ZSRA 4M3YA 3T5LA 4DG1A 4NCAA 1Z25A 1NK8A 3OVNA 2D3UA 5F9NA 3QEWA 4TN2A 1JLGA 4ZHRB 3H5YA 2ASJA 4DTXA 4J9RA 3DLEB 1KVBA 2PYJA 3CO9A 4C8OA 1IO2A 1RTDB 4KHRA 2FLPA 1K1SA 4F4YA 3SQ0A 4E3SA 2QKKA 3RTVA 4DU1A 3M8SA 1MU2B 1TKTA 4PA1A 1RT6A 2XY7A 3WNGA 3M8RA 3ALYA 3IN5A 1LWCB 1KCFA 1JLQA 3KHRA 3KKRA 2ATQA 3HKWA 4QOZB 4DL5A 4H4OA 3PX0A 3DRRA 4URSA 2P5OA 3BQ0A 2IM3A 1JKHA 5KGWA 3NMAA 3IGNA 1IKXB 4LQ9A 4ED7A 4CJQA 3E01B 1HQUB 4RNFA 1RDAA 1SL2A 4CJFA 1L3SA 3SNNA 2HHVA 5CZ2A 3MR5A 3TQ1A 4RW4A 4DS5A 2R8KA 2WONB 2FVQA 2XWYA 3M9MB 5KFVA 3AVMA 3VQ9A 1HQEB 3TR8A 4I9QA 2BQUA 5KT3A 3BDPA 5HP1A 4I2QA 3MECB 5HBMA 1BQMA 1S0NA 1S49A 5DLFA 4Z4GA 2YHBA 4BDPA 4EP4A 4H4MA 4MK8A 3SPZA 2LSNA 2E9RX 3CYMA 1FKPA 4M94A 3D45A 2UVUA 3LPTA 1C2PA 4G1QB 3KLEB 1RTHA 4OPKA 5I42B 4AHUA 1XR7A 4O3NA 2IAJB 4Y2AA 3SZ2A 1T8EA 1RT7B 4OPJA 1UA0A 4FCYA 1TL3A 1S9GA 4FLYA 4HUGA 4AHVA 4RNMA 5KT2A 1BQNB 2EHGA 3KLVA 2JEFA 4RW8B 1ZETA 5KFDA 4HYKA 4EBDA 1HJRA 1RDBA 3NF6A 2W9BB 3VQ4A 4ECYA 1QTMA 3ZT4A 1VSLA 4ZTFA 2HHQA 3HXMA 3NGDA 4FJ5A 3D28A 1JLFA 4Q8FA 2IGIA 3AA2A 1S1XA 4GC7A 4O3RA 3ZSOA 2R8GA 1RT2B 3V6KA 3OYBA 1RBRA 3V1QA 2HNDA 4HTUA 4O3PA 3H4DA 3SI8A 2YNHB 1QAIA 4FZXC 2ETJA 3KHGA 1KFDA 1NJWA 1N56A 3KKSA 5D3GA 3HVWA 5C42A 4OLAA 1JX4A 3HVTA 4FS1A 4QWEA 3M8PB 4AHRA 2XO7A 1CSJA 5KFOA 5DMRA 2B6AB 4WFXA 2F96A 3IS9B 3OYKA 1WSIA 3AVIA 2G8KA 1C1BA 3SJJA 4L8RB 4DLEA 4ED8A 4CHZA 3L2QA 2XI2A 5J2QB 4E7IA 3IGVA 3F73A 4IBNA 4JV0A 3OHBA 3AVGA 4JLHA 1F21A 4NCBA 2DPJA 3U6FA 1S6PB 1NK6A 5KRTA 1BCMA 2OA8A 2HHTA 1YVUA 3LP0A 2HNZA 3BR9A 5KG3A 4CJ5A 4AHSA 4ED1A 3G10A 3CWJA 4FM0A 3C6TA 4F4XA 3KD5E 3AO1A 4CEAA 1IM4A 4IDKB 4DF4A 4IR9A 1L5UA 3CFRA 4JS4A 1NKBA 5FRMA 3M9OB 4K4SA 3RB0A 4NLRA 1KVAA 3QGGA 1S1WA 4CECA 1RNHA 2OZSA 1BIUA 3A2FA 1U47A 4J9QA 4ZPAA 2DFHA 2XGPA 1WSFA 2IBKA 4W5QA 5J1EA 3V6HA 4KTWA 1BL3A 3ZT3A 4CJEA 1OS5A 4CCHA 1BGXT 3QEVA 4CF8A 4B9VA 1IKVB 2W8KA 1TK5A 4DEZA 2GUIA 3L3UA 3OSPA 3TWHA 4FLTA 3V6DB 1VSDA 4CGGA 1TK8A 4DSFA 2I5JB 1ITGA 3ZSQA 2W7PA 2IA6A 1RT1A 2AJQA 4KFBA 4R8UA 3GV8B 1J54A 3ZT1A 3C6UB 2OPQB 1RTJB 2X78A 4FYDA 3VQDA 1SL0A 4IFVB 3KIOA 4Q44A 2VWKA 3EZ5A 4E7KA 4CGHA 3RMAA 4KHWA 2IDOA 3FFIA 3KLFA 4FM1A 1LWEA 4EBEA 5CYQB 3T5JA 2XY6A 3H98A 1VK0A 3KLGA 3KHHA 4DTJA 1WNEA 3QIDA 3HPGA 4DTOA 4Z4HA 4LD0A 1X9MA 3KJVA 1LW2B 4ECXA 4M45A 3THVA 2YNGA 5KG5A 3LP3A 1QS4A 3JYTB 3DLKB 1BISA 4BWJA 3QEIA 1S9EA 2OPRB 1HYZA 1KLNA 5JS1A 2Q3SA 3FSIA 4GC6A 4EZ6A 4K4YA 4DQRA 4E7HA 3P5JA 3CFOA 1W0HA 2BANA 4IRDA 4CK3A 2OYQA 3GILA 1S10A 3NF8A 1U09A 4Z4IA 4F4ZA 4O44B 1BI4B 1S97A 3OLAA 4KRFA 2ILYA 3MTKA 3UQSA 1UAXA 1CLQA 4B9MA 4WE1A 2WRMA 5F9LA 2R8HA 3PX6A 2YKNB 1NJZA 4J2AA 4DFJA 5EUHA 4ZPDA 2D0AA 4CJ4A 3RWUA 2RF2B 3DRSB 3PR5B 2PYLA 1JL2A 4ICLB 1TV6A 1LAVA 1JIHA 3V4IA 2ZKUA 4XPCA 3AVFA 1S0MA 2P5GA 4URGA 4ELUA 2OPSA 4DFMA 4MKBA 4BE1A 1QQCA 2YKMA 2Z1HA 4CFAA 4FJ7A 2W9CA 4U6PA 1RDCA 1N5YB 4NZ0A 1HPZB 5C24A 3NAIA 4OGEA 4CGDA 1QE1B 1XWLA 1J53A 3LANA 2VG6B 3K5MA 3LP2B 4Z4CA 4DQSA 1RA7A 3T3FA 1T03A 3TAPA 3OLBA 4OKJA 1DTTA 3L8BA 2AX1A 1NK7A 2HB5A 4CF9A 4DL3A 1HMVA 2FVSA 1FXXA 5KFKA 1S4FA 4Q43A 1IH7A 3OS2A 4QWCA 4CJKA 3MFHA 4WYWA 3AA4A 2WCXA 4QPXA 3N6NA 4TY8B 3RR8A 1ZBFA 4FS2A 1JLAA 3RR7A 1S6QB 3V81A 3NAEA 5HRSA 4KHYA 3QO9A 3OY9A 2E9ZA 1S1UB 1JLCB 1RDDA 4URQU 1T94A 1RCHA 3PJWA 3KLHA 2ASLA 4B9SA 2JC1A 1RTIA 4RW6B 4KHNA 3RMDA 4ZVFA 5J2MB 1A5VA 4NLTA 3DM2B 4B3OA 2FVRA 1JXEA 4CJ3A 4K4VA 3AVCA 2BE2A 3VQCA 3D0PA 1KVCA 1XR5A 3SQ4A 3SUNA 3BQ2A 3MEGB 2FJVA 3HVAA 4UQGA 4CFBA 4KHMA 4NLDA 1NHUA 2BRKA 2W42A 3UR0A 3NGYA 5KI6A 1S1VB 4E19A 4I7FB 4LSLB 3TAMA 3FRZA 1DTQA 1ZTWA 4ED2A 3AVLA 4RW9B 4LH4A 1J9AA 4NLGA 3QGIA 2WHOA 2ALZA 1RT3B 3KK3B 1JL1A 1G15A 2V9WA 4FXDA 4WYLA 3I0SB 2FVCA 2HHXA 2IC3A 3NBPA 1RT4B 3MEDA 4IFYA 4O4RA 4FBTA 4XIUA 1VSEA 3OYAA 1JXLA 2YNIB 4DS4A 3OYIA 1HARA 4RU9A 4R5PA 2HNYA 1S5JA 1S1TB 1I39A 1LW0A 4ECZA 2FBTA 5KFMA 4W5OA 2AGOA 5KFSA 4NLWA 4KKOA 1REVA 2UUWA 3DYAB 4PUOA 1NOYA 1TVRA 3ISNC 4C8MA 1NJYA 3QIPB 1RYRA 5KRSA 3ICLA 4KV8B 4KAZA 2DPIA 3K58A 1VRTB 3OS0A 4EZ9A 3LDSA 1LAWA 1QHTA 4ZHRA 3PW7A 3S3OA 2V4QA 3PUFA 3DLEA 3G6XA 5FRNA 4U7CA 1U48A 2KFZA 1GX6A 2HHSA 3H5XA 3RAXA 4BE2A 4CERA 4EBCA 3QGHA 4C8LA 3V1OA 1MU2A 4CF1A 4J2EA 2YHAA 3BSCA 1ZBUA 5KG7A 1W9HA 3K59A 1LWCA 1RYSA 4DQIA 4JRPA 2D41A 3SQ1A 4K4WA 1HYVA 5L1LA 2BR0A 5KFCA 4CEQA 4Q0BB 3ZSWA 2XI3A 5JS2A 3T19A 5KT7A 5CZ1A 4FLZA 1IKXA 3DOKB 3H08A 3BREA 2UUTA 3TAQA 2OPPB 3E01A 1HQUA 4CF0A 2O5DA 4MIBA 2GIRA 2G8VA 3SYZA 4K4UA 2WONA 1Z26A 3BQ1A 5KFHA 1SUQB 3QERA 4FJ8A 1HQEA 3QIOA 4KHUA 3HK2A 3B6OA 4CIGA 3MECA 4O3OA 2R8JA 1CXQA 4Y1CA 4M3ZA 4TY9A 4ZP6A 3DRRB 4FJIA 4DF8A 4NLPA 2KQ2A 3T5KA 3KLIB 2PZSA 3HPHA 3EPGA 4DQPA 3V9XA 2I1RA 1K6YA 1MMLA 4G1QA 3KLEA 5I42A 3PW4A 2IAJA 4F3TA 1IKWB 3CJ3A 3L2RA 2UVWA 1FKOB 3Q8SB 1RT7A 1NNDA 3BGRB 1NK5A 2KZZA 5HRRA 4FJJA 5F8LA 1BQNA 3C94A 3KK1B 3VQQA 5HP1B 4RW8A 3K5NA 3DMJB 1ZTTA 3LP1B 1KHVA 1BQMB 4QCLA 3PO4A 5L1IA 1S9FA 1UOCA 4DTUA 3QINA 5DQIA 5HLFB 1HNVB 4IG0A 4F4WA 5DLGA 4N5SA 4CGIA 1TKZA 2EX3A 4W5NA 1EETB 2IS3A 4NLSA 4HCBA 4ED0A 1SH3A 4QWAA 3SUPA 4LQ3A 2Z1JA 2V0NA 1N48A 4YQWA 3OL9A 3NAHA 1RT2A 3I5BA 4DTRA 4FJXA 2IM0A 3TAFA 3KOAA 5KTQA 3VQEA 3PW0A 4WXOA 4KHQA 2ZD1B 4CK2A 2HMIB 1YVFA 4B9TA 2CKWA 1VSJA 3NGIA 1I6JA 4RW7B 4NYZA 2YNHA 1KLMB 3MEEB 3FQLA 3MR3A 3RB3A 4HVJA 4DSJA 5L1KA 5SZTA 4OGCA 4FM2A 3OYCA 4O3QA 4ECWA 1S1XB 1ZBIA 1Z4UA 3BSAA 4IKFA 3M8PA 3AO5A 3OYGA 1SL1A 1X9SA 2B6AA 1NKCA 2J6SA 3HM9A 3IS9A 4HCCA 4ZP8A 1NK9A 1YTAA 1QUVA 4B8AB 4O4GB 5J2QA 3AVJA 2XCPA 1UWBB 1TL1B 3JSMA 3K57A 3Q8PB 3SUQA 1JLBB 3V9ZA 4ID5B 2P51A 4I9LA 4LSNA 4NLOA 5DG9A 4G3IA 1S6PA 4HHTA 4CGJA 4ZTJA 5T14A 4IRKA 2D5RA 3T1AA 2XY5A 5I3UB 3OL6A 2JEGA 1R0AB 4W5TA 2BGGA 4IDKA 4EO6A 2HW3A 5J2PB 3DRPB 1W25A 2R2SA 4B9NA 4B8CA 5KGXA 4KTZA 2DFEA 2VG7A 3NFAA 2JEIA 4DL6A 4CJSA 4BACA 4LH5A 4QW8A 3OL8A 4CIFA 4KO0B 4RNNA 2W8LA 4HKQA 5KFYA 1HYSB 3MFIA 4F2SA 1IKYB 2HNZB 3KMQA 2R8IA 1VRUB 3LZJA 3ITHB 1IKVA 5JUMA 1KHWA 1C0UB 3HSTB 3BSNA 3V9SA 4DTSA 5KFTA 3V6DA 2D0BA 2I5JA 4CEBA 1C1CB 1CXUA 1RBVA 4YR3A 4MFBB 5DQHA 2E9TA 4OL8A 3H5SA 2WOMB 1ZBLA 4NYFA 4J9NA 5HRNA 5DGBA 3C6UA 2OPQA 3H5UA 4I2PB 3CJ4A 4M42A 4IFVA 3AVNA 3PVXA 3L2WA 5CYQA 3LZIA 1EP4B 5CYMB 5F8IA 3UIQA 3HPOA 1K1QA 3CM5A 4Q5VA 1U4BA 3LAMA 3RAQA 3I0RB 3RMBA 2G8UA 3NGZA 4J9KA 1U45A 1LW2A 1KFSA 4KPYA 3JYTA 3DLKA 1ASVA 2OPRA 2QXFA 4BWMA 3MR6A 4QW9A 3OHAA 3NF7A 3ZT2A 3CJ0A 2FBXA 2X6SA 5FDLB 1RDRA 4ZMMA 4ED3A 3LAKA 4O44A 4PQUB 1BI4A 3S3MA 4IG3B 5KG0A 1RT5B 3OS1A 4HUFA 2DTUA 5C25B 2D0CA 4CEOA 1U04A 4AHTA 2YNFB 2YKNA 1WAJA 3B6PA 3QZ7A 3QNNA 2ZE2B 1T05B 3V1RA 2E6LA 3KJVB 1TKXB 4NLUA 1NJXA 2RF2A 3DRSA 4FJHA 4MH8A 3LWMA 4B9LA 4ICLA 2FBYA 4FK2A 5F8HA 3NF9A 5KFQA 4TSXA 1JLEB 3DLRA 4H8KA 4CHQA 2WK4A 5KFBA 1UA1A 2YV0X 3H2LA 4GVMA 4CJLA 4YFUA 3IRXB 1NK0A 3M9NB 1WSHA 4CEFA 3MXIA 4AILC 4MQ3A 1C0TB 1N6QB 3KK2B 1N5YA 2Y1JA 3OYMA 5F8JA 3PR4A 1HPZA 3HL8A 4CHOA 4TLRA 4FJLA 3PW5A 3IAYA 1TQLA 1QE1A 4E7JA 2O4GA 4ECVA 4FW2A 5KFEA 2VG6A 3LALA 4FLWA 3LP2A 3QLHB 5J2NB 1VSKA 3SV3A 5KG4A 1GOBA 3QEPA 1QSYA 5KFRA 1LWFB 1S48A 3EPIA 5CY4A 2F8EX 2QK9A 4TY8A 3TANA 3C95A 2X6NA 4PWDA 5DQGA 1S6QA 3N6LA 3PO5A 4Z4EA 4NLYA 4RNHA 1S1UA 1JLCA 1Q9YA 3QZ8A 3I8DA 2XHBA 2NUBA 2AQ4A 4RW6A 3O4NA 5J2MA 1QAJA 4RZRA 2BRLA 1GX5A 4CE9A 3VQPA 4ZP9A 4ZPCA 5KFPA 2UVVA 3Q8RB 3DM2A 1HNIB 2XGQA 2RKIB 3AVBA 3MEGA 4K50A 5HRPA 3O3GA 5K14B 3HVRA 2VWJA 4M3RA 1S1VA 4EP5A 4I7FA 4LSLA 2IMWP 1FK9B 3VQ7A 3RB4A 4MKAA 2KTQA 4O55A 4RW9A 3PJXA 3BJYA 1RT3A 2B5JB 3KK3A 5KT4A 4K4ZA 2IOCA 1ZBHA 4J2BA 3VA3A 3KNAA 4Y2CA 4CFCA 4YP3A 3I0SA 4FLVA 3DOLB 3VN5A 2GIQA 1A5XA 3NL0A 4B3OB 4JV1A 1X1PA 3M8QB 2QKBA 1RT4A 2C28A 3VQ6A 3DI6B 2YNIA 4TXSA 3WNFA 3GIMA 1B9DA 4WXWA 4Q8EA 4RUAA 3IG1B 2P1JA 3AA3A 4DQQA 3SUOA 1C6VA 4NCGB 2HWIA 2HVIA 1S1TA 2IM2A 5EWFA 2F8SA 2F8TA 2QV6A 1SV5B 4FZZA 2B4JA 1DLOB 4KREA 5HROB 3DYAA 4NLVA 4FJMA 4TYBA 3CJ2A 1C0MA 4IH6A 4RG8A 5KG6A 4ED6A 1NOZA 4W5RA 4IOBA 1D0EA 2BQ3A 3GIKA 3QIPA 2W9AA 1J5OB 4FJ9A 2ASDA 4KV8A 2HAIA 4KBIA 1VRTA 2J6UA 3OYNA 3CDWA 3CVKA 1ASWA 1TGOA 4DLGA 3G6VA 1Q9XA 2UVRA 3DLGB 5EWGA 4ZPBA 4DFKA 3LWLA 4FJGA 5KFAA 4B08A 4BDYA 4M3XA 4RUCA 3HHKA 1RTDA 4GW6A 4J9SA 1IG9A 3H4BA 4XPEA 3SI6A 3SV4A 4O3SA 3AV9A 2RDIA 4J9MA 1TAQA 3PW2A 1L3VA 5KFNA 2VG5B 1I3AA 4M41A 4Q0BA 4KE5A 3V9WA 4DG1B 5F8GA 3P83D 3QEXA 4YMEA 2A1SA 2ITGA 1VSMA 1JLGB 1SKRA 3DOKA 2FJXA 4JRQA 1KSPA 3MXMA 2OPPA 4AHCA 2X74A
chains in the Genus database with same CATH superfamily
3CD7A 3QBWA 2R7VA 4ZLJA 4HTIA 2Y1RI 3HKZD 3IM9A 3SEOA 2PT0A 4HT5A 4V19S 4AXJA 2BDPA 4FK0A 5KAKA 3ZZTA 2QWLA 4E7LA 4GKKK 2ASYA 3L7UA 3ASMA 2KYZA 3RBDA 2QX0A 1YTUA 2ILZA 2E1PA 2W2QP 4E1MA 3BF3A 2OCEA 4WKYA 4FF4A 3MMCA 1LV5A 2YWEA 1FDBA 2OFGX 4Y1DA 3BH7B 2JSXA 1HRHA 1VJQA 2JH3A 2OEKA 1FJEB 4O8UA 5GIPA 4WP8A 3CDUA 5ITHA 1R0BG 2KZMA 3DMJA 4LVNP 3PYEA 1H2TZ 5HLFA 4NRUA 2WSEC 1J6ZA 3OYDA 4CD1A 4I2QB 3MUVP 4ECTA 1GTEA 4H4MB 4NLXA 1GK8A 3FGUA 3DHXA 4IO9L 3OXLA 2ZM6J 1GMVA 2D9PA 3CIMA 1OY9A 3UDLA 4QAGA 1RTHB 1AROP 1WEZA 2F5GA 3OTOJ 1CJVB 2XCAA 2VONA 4GMJB 4ELVA 2WSFC 5G0RA 3UKUA 1NZAA 1KLMA 3FZ2A 3LL3A 1N33J 4OLBA 3CCJN 3UCZP 4Y34A 4LJMA 1R27B 3PIOQ 4N56A 2YBVA 3VF4A 3I96A 4K7QA 5ADXA 4ZJOA 4LFCJ 1NSPA 3QICA 1JLFB 4ITSA 2ZBPA 4DU3A 1RA6A 1X8DA 3GP9A 1U6BA 2ZZMA 2AT1B 4KH1B 1K8KA 1FXLA 1SJFA 1SIWB 4F8RA 4F02A 1TL1A 4EYHB 1XHXA 2VDIA 3MN5A 3HZ6A 2KM8B 4A8YA 4DSKA 2MZ1A 5IZHA 4X4PA 2HWHA 4N47A 1R8CA 2B4PA 1RHMB 5EVZA 3DU6A 4FOIA 4YOYA 5J1NA 4IH5A 2DCUB 4W4MA 3R1LA 3D7EO 5D3GB 3HJFA 4O8KA 4MO5A 3SPYA 3V9UA 2CVIA 2ZFHA 3HVTB 3U3YA 1FRIA 3E66A 5J2PA 4A2AA 2ABYA 3RW6A 2XZTB 3HZEA 4JS5A 1C1BB 3EJMA 2XB2D 3O44A 4QIEA 1GLLO 2V4JA 4LSNB 2N4CA 5C5JA 5ELZA 1Q8IA 3CM6A 3O1BA 3P39A 3J7ZT 4KO0A 8AT1B 3C2PA 3EY1A 4KHPK 2E5LK 3OSNA 3O1WA 3Q83A 2F3JA 4DV6J 4WWSA 4MDBA 3GWCA 3TVKA 2FY1A 1V5IB 2K3IA 2GJ2A 1A0OB 1UVMA 4DR6J 3WIUA 1C0UA 1T7PA 3MK6A 3M1VA 1UFKA 4J5OA 2QFJA 2KM8C 1GLEG 1BY9A 3CSKA 3QAUA 1O13A 3SIPB 4IOAQ 1NGFA 4JI7K 5D4NA 2WOMA 2HS0A 4ZIVA 2JEJA 1UVKA 4JP8A 2VU5A 1Q78A 2DNLA 3HHLA 3Q8QB 3ULHA 2ASMA 1RTJA 4CDIA 4CLPA 1RBTA 2HQ3A 4K4XA 1KOOA 2CA9A 1EP4A 3PTWA 4CO2A 4WP9A 3T1HF 3I0RA 2BQRA 4MK9A 2RS8A 3Q23A 1RAEB 3P8BB 2XS7A 3GZ7A 3AJ1A 4HI1A 2Z30B 2X1GA 3TABA 4DV2K 3H40A 2OH2A 1MROB 1LCUA 1I94F 2GC8A 5C0YA 2V50A 1M90T 5FDLA 1TAUA 3GBTA 1XNRF 4FPIA 1BLUA 1D9AA 1FF2A 4MMOA 2JFKA 2DFFA 4Q45A 5MLCV 4ZN1A 2ZE2A 1BG3A 4MYUA 1T9TA 4XH1A 3OXGA 3NE6A 3IMXA 4B3TJ 3NMUA 1JLEA 1UPPA 1DQ9A 4CJRA 2A2CA 2BZ2A 2CVEA 2CJQA 3AO2A 1VQ8S 4DR7F 2DR5A 5JICA 4ZIWA 1KTQA 5EX3A 1H2VZ 5DM6L 1N6QA 2RQKA 2CJYB 2FHKA 2IDEA 2U2FA 3AVKA 1WSGA 3FBEA 5KFJA 1CZ9A 3PRDA 4WYBA 4WE1B 5EDWA 3CCWA 4J91A 3TEHB 1ZZNA 4G65A 4DX6A 3R2CJ 4OZ3A 1GNKA 5JXSA 4ILMA 2A1RA 2PA3A 1WOOA 2FB0A 3GR0A 4O0IA 3LDLA 2MGZA 3G82A 4Z37A 3S9HA 4NXMF 2Z58B 2AEJA 3VQSA 4P7TA 1DFDA 2C3YA 3WQTA 1PC4A 1RBSA 3C14A 3QFWA 2AU0A 1UMJA 3NH1A 2J0WA 4H0PA 4JNEA 3R3LA 4LT6A 1W2IA 4ERDA 1OH6A 3HT3A 1VQON 2DO4A 3RU0A 1MWYA 4GKKJ 4B9UA 4CJPA 1T03B 2RU3A 4YNQA 5EX5A 5ETKA 1W2BM 3C19A 4DL2A 3M8YA 2GAHC 5CZXA 1C4CA 2GVZB 2NREA 2KT2A 1NLKL 5E41A 1F60B 4JBCA 4X4NA 4ECUA 5C2DA 1FK9A 3OR2B 4TYAA 1QAXA 1VC0A 5B0BA 3QMQA 4A8KA 1CJTA 4OYZA 4ZVPB 2HBJA 3MWTA 1TR0A 4YDUC 4H0OA 3NH2A 4IEEA 2KHOA 3VAHA 3NGUA 4C8NA 1SH2A 3GIIA 1U2RA 3KLHB 4USIA 3OUYB 2NRTA 1RTIB 3M8QA 1JQGA 4OYBA 4RUBA 5B09A 3JB9k 3SAGA 1WEYA 3HI9A 2O8BB 3MXJA 4KAIA 4IYQA 2G8FA 3K17A 2BE2B 4Z0UA 4J9PA 4H5WA 4JD2A 3EWGA 1GOCA 2IJFA 1MWQA 2RILA 5LM7E 2R3VA 4GVBA 4JI3F 4HUEA 4YR0A 4CZJA 2B0GA 1SV5A 2H5IB 3TAMB 1DLOA 3GQCA 1DTQB 1SKWA 3O2IA 1DAXA 2V69A 4CLKA 2AJFE 4DCOB 1UVJA 2E1CA 2IC3B 2YTCA 2LA4A 3CQ8A 3S3NA 2QIFA 1Y11A 3MEDB 1K44A 3C15A 1UEKA 2F9TA 2M4MA 1RHUB 4NB4A 3SQ2A 2JLEA 3G86A 3DDKA 4EFHA 2HHWA 1WSJA 1EB0A 4PWWA 3D3BJ 4PKDB 3VWSA 4DSEA 2CPIA 2UUCF 1X4AA 4L73A 2CQDA 2E1ZA 1AZSA 2FSJA 4KKOB 3EE8A 3SFUA 5ETLA 4AH9A 1XTZA 2IM1A 3ZSRA 1SBRA 4NCAA 2MZJA 3ZLJA 3C7NA 3SAFA 2HMPA 1UP1A 3UD5A 3BS9A 2PYJA 4QS7A 3CO9A 2WBNA 1BOTO 2C1EB 1IO2A 4CI0B 2E5JA 1WOSA 1KAZA 3FMWA 2QL7B 3EEQA 4PA1A 1RT6A 3WNGA 5AQKA 3GJQB 4R25A 2VWBA 5DM6Q 4NA1A 3ALYA 3IN5A 1LWCB 4KHPJ 2E5LJ 4OJ1A 5BN8A 5ETPA 1JLQA 4Y00A 1U0HA 3HM8A 4E1JA 1XMQF 5DDQC 3DRRA 1U6FA 1ZPWX 4EGLA 3KDNA 1ZM4A 1RKJA 1JKHA 3L95X 2P9NA 4BRHA 3NMAA 4JI4F 5K5MA 1IKXB 2DT9A 1NPKA 4USWA 2MKHA 2N7YA 2DPNA 3E01B 3SJHA 4PG8A 1PGZA 1L3SA 2HHVA 2B4UA 4JI7J 1IWAA 4QIGA 2LQBA 2FVQA 3VQ9A 4X4SA 3AOBA 4K8RA 5GAEI 4I9QA 5KT3A 3BF1A 4NPOA 5HP1A 2MY8A 3MECB 2DRDA 3GE9A 3CCQN 3CF5L 4Z4GA 3HSGA 4BDPA 3TEGA 4OHXA 1SC3B 4FKYA 4M94A 3HHEA 1URNA 2I2YA 4OZ5A 2IAJB 2HHHK 2H3GX 1T8EA 1VQ6N 1RT7B 4X4OA 2O8FB 1VQ5N 4DV2J 3CDBA 5GADI 5ADZA 3GDQA 4RNMA 2EHGA 2JEFA 2J8SA 4HYKA 4EBDA 4FWMA 3NF6A 2VFUA 4ECYA 3ZNJ1 2GWKA 3C46A 3UNGC 3BGOP 2HHQA 2E8AA 2BJEA 5AZIA 2VF3A 3IBWA 3F44A 4FJ5A 5K9FA 4U8YA 4O3RA 2R8GA 2FLOA 4UY8O 3AOAA 3V6KA 3MM9B 2HK3A 2W2NP 1GMWD 3QT7A 3SLCA 3VEZA 5H1SQ 3M6XA 2V8GA 3E9OA 1Q86T 2F63A 2F8MA 5K8NA 2YNHB 3KHGA 1KFDA 2YKAA 1NJWA 3DAWA 2KH9A 3CD6S 3BM7A 2YKOA 4DMZA 1N0VC 5C42A 3OBIA 4NX9A 3NS7B 2E1RA 4C8YA 4BR2A 4H0VB 3D0IE 2FJDB 1M5PC 1X7VA 5KFOA 1Q8KA 2F96A 3IS9B 3OYKA 3L2QA 4YEAA 2P5VA 2W40A 1HA1A 2HFSA 5DO2A 2XMUA 1WOPA 3ENOA 4MIWA 2I0XA 3NOCA 2DPJA 1RBOB 4NLBA 2KXHA 2PDAA 1YRTA 5A8WA 1GTHA 5KRTA 1BCMA 3TSPA 2M88A 3LP0A 2HNZA 3WDOA 4A8XA 3QMLA 1F5BA 3CWJA 4FM0A 1NBEB 1IM4A 2PEBA 4DU8A 1NKBA 5FRMA 4JKHA 4RBTA 1JK9B 4OYWA 1VQKS 2NQPA 3OFEA 1VYAA 4LFAF 4LF4F 1GFWB 3PEJA 2AYMA 1KVAA 2HWTA 4B1UB 4CECA 3H1QA 1G6BA 2IBKA 4W5QA 4KTWA 4CJEA 1BGXT 5E2QA 3H0PA 4DV3K 2AKWB 1OH7A 1T44A 2COLA 2KB2A 4B9VA 4PHTX 3K0SA 3MTJA 3VEXA 3C8YA 2W8KA 4KGMA 3PFEA 2IDLA 4A5BA 3OSPA 1URRA 3V6DB 4CGGA 2MQOA 4DSFA 3CC2S 2RRAA 2VPXB 2Q3PA 2L41A 5L9NA 1J27A 1MN9A 3GV8B 1HHTP 3SSSA 3EO3A 5C7PA 3M6GA 1IXKA 1OVQA 3EZ5A 2VWKA 3KIOA 1IQZA 1HX1A 4I1TA 3G8SA 1O5JA 1LWEA 2KU7A 3T5JA 2C2ZB 5HSPA 4OFZA 3KHHA 2LDYA 3CF5Q 1R0CB 4WK1A 3UW1A 4H5NA 6AT1B 3AGRA 2Q66A 4CZCA 1F2GA 1X9MA 4KGVB 2WTUA 3KJVA 4AYBD 2AEFA 3N0VA 5KG5A 5IM0B 1QS4A 3TSQA 4IXCA 2OPRB 4NEZA 1X5OA 2Q3SA 4BC2A 3FSIA 3NNCA 4E7HA 1W0HA 2AIRB 2BANA 4B9QA 2DNOA 3I33A 4Z4IA 2MJNA 3MTKA 3UQSA 1ZAVA 4CQ1A 3R9PA 3T69A 4B9MA 3MD1A 3VEWA 1WELA 1I51B 5EUHA 5D4OA 4ZPDA 1RWWB 4CJ4A 2RF2B 2VD3A 3E1YA 3PR5B 3N4PA 4I6MB 4OZ0A 4OO1J 4ICLB 1WKKA 2IFXA 3THWB 1S0MA 1EKSA 1Q95G 1H1VA 5ETQA 5HVFA 2D3OR 2W41A 2E88A 3GE1A 3H25A 3U02A 4BE1A 2J9EA 1PAUB 4U6PA 1RDCA 3H2VE 2BKPA 1I3OB 1HPZB 3NWRA 2P9GA 1WHWA 4BLGA 3CJAA 1XWLA 1VIOA 5AQGA 5A0YA 2PN6A 2VG6B 2MKYA 1NK7A 4M7YA 2V7YA 2MTLA 1K9MT 1HMVA 2ROGA 5KFKA 4Q43A 1IH7A 3OS2A 2QTWA 4CJKA 1N36K 3MFHA 3WXKA 4Y6IA 3AA4A 3DXKA 2YCHA 4QPXA 1NGJA 2ZC3A 1QDUB 1ZM3A 2OJ3A 3JXOA 1JLAA 5IQQA 3KG0A 3NAEA 5AQRA 1S1UB 1RDDA 1T94A 5CD4H 2DGVA 4BR9A 4RW6B 3KWGA 2CAJA 1A5VA 3W1YC 3H7HB 2FVRA 1JXEA 4CJ3A 4K4VA 3ZZZA 4M63C 3D0PA 2XNQA 1R8PA 4ILGB 3HVAA 4KHMA 4ZVRB 4RJVA 2HHHJ 3KXDA 5ETTA 4U7UK 1BU6O 3EE9A 4LRCA 2QLBB 4DX5A 4BC3A 1ZTWA 2XZWA 4DN0A 1FEHA 1KS2A 2BKNA 4ZLPA 4LH4A 1J9AA 4NLGA 2FC9A 2ALZA 1JL1A 2ZBIA 1N0UA 2V9WA 3MEKA 2ZNZA 1I5OB 2V2KA 2ZHBA 2DCLA 2J7KA 4DS4A 3JXUA 4RU9A 1NPRA 1LWXA 4USUA 3TJAA 5AQFA 3W2VA 4ZN3A 1I39A 1LW0A 2O66A 2HRUA 1DGKN 4KJIA 1REVA 5IOLA 2VC1A 1V9OA 4PUOA 3KFWX 1CG2A 1NGIA 3KVGA 3ICLA 3NGTA 4X66F 2DPIA 5B0DA 2GX9A 1QHTA 2N3LA 2DXDA 3PW7A 3US5A 2VICA 2NRXA 5FRNA 2ZNYA 3NY0A 1KQSR 3H5XA 4BE2A 1EQ0A 4ZA1A 4FP9A 4C8LA 3IFEA 5LXYA 1BC6A 2M3DA 2P9KB 4CF1A 1K47A 1RTZA 3CC7S 1Z2ZA 1OH8A 2HQDA 3H1VX 1WJ9A 5KG7A 1W9HA 4DQIA 4JRPA 3OW2M 1ICEB 1XMBA 3M32A 4K4WA 4JK7A 3Q8YA 2BR0A 4CEQA 4Q0BB 3ZSWA 2XI3A 5JS2A 1WACA 3PG9A 1YLXA 3RUBL 2P9IB 3DOKB 3H08A 4TVAB 1KAYA 2FJEB 1HQUA 4CF0A 2O5DA 2G8VA 5HK4A 1HKAA 2VASA 2WONA 2DNMA 2O8DA 5KFHA 4U7UD 3B6OA 4CIGA 4MKVA 2R8JA 4Y1CA 1RAOA 3T7ZA 2LFVA 4NLPA 5AQTA 3D67A 4DV3J 3CCES 1F3VA 3KLIB 2PZSA 3HPHA 2V5HG 4KC5A 2JLFA 1MMLA 3BN7A 3N4QA 1NDLA 3PW4A 2V7ZA 1IKWB 3CJ3A 5E5NA 1S72N 1NNDA 3BGRB 1NK5A 5AQOA 2MLXA 4RW8A 3MDQA 3K5NA 4X4UA 1EIYB 1DKGD 4H5VA 4V19J 1KAXA 5L1IA 3W5XA 1HNVB 2UUBF 4CGIA 4W5NA 3OPKA 1VBZA 4XH4A 4KH5A 1SH3A 2HVDA 2IVPA 2A6AA 5F2RA 1HBMA 4TU7A 1ELOA 4UW2A 4BRIA 2BYCA 1GLJO 1I94K 1RT2A 1VHXA 3V2UC 2IM0A 4HTLA 1A9NB 1NB7A 3KNGA 5KTQA 3PW0A 2HRYA 1ZS6A 2MEWA 3CPWM 2HMIB 1YVFA 2CKWA 1VSJA 1I6JA 4NYZA 3CW2C 5BR8F 3MR3A 2QWOA 1QQMA 3MPUB 1M0SA 1U1OA 2C2OB 1D4XA 3MM7A 1NDCA 4LRAA 1T6CA 3ZTPA 1ZAWA 3BSAA 4ER8A 1KD1T 1UW9A 5HQLA 3TTDA 3JS6A 2DJWA 1Z05A 3SAHA 1PG5B 2YH1A 5HOOA 2QL5B 1QUVA 4B8AB 4USVA 1F6TA 1YX2A 3MGJA 2DGTA 5J2QA 3AVJA 5IWAK 3QJPA 1YITS 1JLBB 3VGSA 4ID5B 4JKGB 1AA1B 4LSNA 2RNEA 4LR7A 3ID6A 4PWUA 4L3NA 4ATNA 5I3QA 4HHTA 4CGJA 2F4FA 1DQ8A 1NG9A 3T1AA 1YIJN 5KQDA 1BE4A 2QL9B 5AXLA 3OL6A 2JEGA 3RJMB 4L6V3 3MAAB 5T7LA 5FPNA 4NXMK 1R0AB 4QIWD 4IDKA 2PIIA 4EO6A 1GLFO 3MCSA 3DRPB 1W25A 2R2SA 3CMES 1X0PA 2DH9A 2DFEA 3A3NB 2HVEA 2L48A 3C65A 4CJSA 4BACA 2BACA 1N36J 3J80U 4OV6A 4LH5A 4CIFA 3SCIE 2W8LA 4C97A 2QI2A 5KFYA 1HYSB 1J5EK 2QM1A 2O8CB 2F40A 1VRUB 2GS8A 3LZJA 2ASPA 3OTEA 4DCJB 1IBLF 4Y2MA 3NMRA 4OJGA 1GAOA 2MQNA 4JI0F 2W24A 1X5SA 4ID8A 5F41A 1X3MA 3MWPA 2KYXA 4YR3A 5BREA 4M5KA 4MFBB 4PYDA 3DXMB 2GV1A 3V5RA 1R6VA 3EKSA 3CMQA 2Z57B 3PVXA 1UVNA 4JYAF 1D3WA 3CJKA 2XBPA 3AY0A 3LZIA 2HFOA 2OMLA 4IEIA 3THTA 3UIQA 1YBAA 2LQ8A 1K1QA 5CAAA 2D3O1 3CM5A 2OIHA 2MDAA 1U4BA 3H6EA 2JWLA 2G8UA 1U45A 1DURA 2DHAA 3DN9A 3VZHA 4LBPA 3JYTA 5CYJA 1ASVA 2QXFA 3OR1A 1WG4A 3MR6A 1AB8A 2G2OA 3NF7A 2ZHAA 2CADA 3ZZ0A 3MDFA 1KVJA 2LU2A 1AT1B 2ZBRA 4ED3A 4F9OA 3CNQP 5CXTA 4PQUB 5AQXA 4DV1K 4IG3B 4DUYF 3QT8A 3H8YA 5C25B 2NUHA 4CT9A 3DRYA 4AHTA 2YNFB 4M5DB 2FIUA 2YKNA 2NXEA 4OI2A 1VBKA 4NLUA 1HI8A 2GELA 5AQPA 4MH8A 4BREA 2AW0A 4QQBA 2MB0B 5GAGU 4KH6A 3NF9A 5FD1A 5MAOA 4BR0A 1YJRA 1APSA 1QVFR 1Y3KA 2WK4A 5KFBA 4LR8A 4OHWA 4NWBA 2WAQD 2YV0X 4GVMA 4CJLA 3IRXB 1FVSA 4FKXA 3MXIA 5HMXA 3NS6A 5DDPC 2A2DA 3KK2B 4LF7F 1O6XA 3WXMB 3M2RA 4R0JA 2OTJS 1P6TA 1A6LA 3AGKA 3QLHB 1AW0A 1VSKA 4DV0K 1YI2N 1IBMF 3HMJG 5KG4A 4EU0A 4DJBA 4CO4A 2VV5A 3H3NO 3ET6A 3HRGA 5LSRA 2LEAA 1M1HA 3MD3A 2YKPA 2KRBA 2QWQA 5CY4A 5B8HA 1WD6A 2HFUA 4QOTA 3TANA 4ENOA 3C95A 3NG8A 3A8IA 2BJ7A 1RHKB 1XMQK 5HANA 5FPDA 4JI4K 2X1AA 1MNEA 4MLEA 2QLWA 4H4KC 1QAJA 3EGVA 2BRLA 2L9WA 4ZP9A 4ZPCA 5KFPA 3KWMA 2HVZA 3A5MC 4CZMA 2Q31A 3J7AN 3GFXA 1KQKA 2RKIB 1VIXA 3AVBA 3PACA 3P96A 2V51B 5HMYA 5AQUA 4C1NK 4KBOA 4B1WB 3IBFB 3T6JA 2ASOA 3T6BA 1NCLA 3WC0A 1HNZF 5BPNA 3W64A 3VQ7A 2KTQA 4RW9A 2ZH1A 3BJYA 2XLKA 2OO4A 2FJBB 1KONA 3QJLA 2IOCA 2PBDA 3VA3A 1A5XA 4DHYA 1WDTA 5LMUK 1X1PA 2YPZA 4V19X 1OSCA 3BEXA 3VQ6A 4Q7AA 2YNIA 3ADAC 3HZGA 4OYPA 1I94J 1HUXA 4PQAA 4A48A 2P1JA 2I8EA 5AT1B 2ZUGA 4CLLA 4DCHA 4NCGB 2HWIA 1UZDA 5F0UA 4C3KA 4KREA 4TYBA 4IH6A 2OKQA 5KG6A 4NMXA 1QM9A 3QIPA 1J5OB 3HTVA 4KV8A 1VRTA 4M5NA 4CO3A 4F04B 3CVKA 1ASWA 1EARA 3G6VA 5HQMA 2UVRA 4DFKA 1U1PA 1VQ8N 1WHYA 3J7A1 1PIEA 4M3XA 3A5LC 2E7VA 1IBCB 2DRBA 5IWAJ 2KFYA 4BC7A 4OMFG 3VHQA 3H4BA 1RACB 3Q2TC 2EG1A 4O3SA 2XS5A 4JOUA 5CD4A 3PW2A 2P9EA 1LOTB 5KFNA 4HH0A 2AYGA 4GV3A 2MSTA 1I3AA 1OWXA 3V9WA 3P83D 1A7GE 3CT9A 1FFGB 3QEXA 1M5VC 1Q7YO 4UF4A 1VSMA 1JLGB 4NXMJ 1R43A 2FJXA 4JRQA 1FI4A 2BUNA 2OPPA 2VBXA 2ZH3A 5BYRA 2X74A 3CJCA 3WNEA 2Z2LA 3PSFA 5E3PA 2BBEA 2FLNA 1U49A 1CZBA 1TK0A 3FZFA 1SUQA 3P6YC 4R0EA 2DXFA 4UZCA 3F56A 1XERA 3TI0A 1IJFB 4A8FA 2LMIA 5D4PA 1BQXA 3K5OA 3QQCD 3D1OA 1VSIA 3OXFA 3NKYA 3TWZA 3ZX3A 4JKBA 4WFYA 3AO4A 2LP4A 5DS7A 4H4OB 4WFAL 1FDNA 1OH5A 1RWMB 4BS2A 2HHUA 1IJEB 4LF4K 4OI6A 2J9DE 2VDHA 3EGWB 3O4QA 3RRHA 5BPLA 2YWFA 2AGPA 2FC0A 4LF5K 2O4IA 3K7RA 4KB1A 3X1LB 4IQXA 3A1YG 1D9FA 3D0GE 3LP1A 3RGIA 3BF4A 3EX7B 4GY2B 3G0ZA 4H54A 1MLAA 4X2BA 1DZ5A 5HBMB 1XHZA 2YHWA 5A6PA 3NHGA 2CPHA 1Z1ZA 5A2QO 3A3PB 4M5HA 4KB7A 1NMDA 1IG8A 2XWXA 3LGNA 3VGMA 3M6UA 5IQ6A 1HJOA 4JEPA 1CPZA 1X4BA 2E2QA 4JKFA 2ZD1A 1RILA 2FZCB 1S9GB 3ZZPA 2CRLA 4IG0B 1R3NA 2ZWHA 4O0JA 3BR8A 1VSHA 2DNRA 4DV1J 4RWWA 1QSLA 5KG1A 1S7IA 4B1VA 3LW5C 3IUCA 2OZMA 2E6MA 4OYOA 5L38A 1U7LA 1UETA 4E98A 3G6YA 3DGPB 1ESVA 2AJ1A 5B0GA 2B43A 2ADCA 3TZYA 2UUCJ 5B7WA 2DGSA 4J9OA 4O4GA 3K5PA 1HQ2A 2ZDOA 2P9CA 3B78A 2HNDB 2R2UA 3HFZB 1FEEA 1PBUA 3BYRA 1NLVA 3D5MA 2DR7A 1H73A 5F3TA 3BGFA 3PZPA 4K0KF 2JNJA 2AWZA 2Y3YA 4FLUA 3CC4N 2R4FA 3NS5A 3B54A 1CQNA 2V8VA 1GT8A 1TMMA 3KMSA 5HAOA 2R7RA 4A8QA 2W4DA 3CG7A 1RJJA 1M5KC 5FPMA 3MUTP 1HL6A 5AE3A 4DV0J 4ZS6A 3TAEA 1L3KA 1VQYA 1SC6A 4EEYA 1DJ0A 4LF8F 4KHSA 1TFWA 3H20A 3TAGA 4RR5A 5GAHP 3C16A 1EKEA 2KHDA 3K9JA 5CCLA 2GV9A 4YOWA 3P4UB 1IKYA 2KT5A 3W5YA 3WT0A 3SDEB 1RAJA 2Z0GA 4E8UA 2QA4G 4OKKA 1XMQJ 3K9KA 2ZJRL 1YXQA 4ELTA 1NKEA 1N8RO 1HWIA 5KFLA 4F3OA 4QWDA 1PO6A 4JI4J 3CXCR 4FJNA 5AQVA 2V67A 4QWBA 5KG2A 2E4LA 3ZT0A 1C1CA 1WLJA 4CYUA 1CZAN 1UJ4A 2UXDK 1ROFA 3JTNA 1R8BA 3SQGB 1NGDA 2M8HA 2A6OA 1S1WB 4YOVA 2YY3A 1GLDG 3O9TA 2HGLA 3RBEA 5J1EB 4CHYA 3ENQA 3I9V9 4H0XB 1NHKL 1LEOA 8RUCA 3BDEA 2FVPA 3ILOA 3KHYA 4A62A 1UW4A 1UEUA 1N32K 4FSVA 2YX1A 2HEKA 4NA2A 1PKUA 2FZGB 5LMUJ 4WFAQ 2DXEA 1WSEA 3KHLA 4CJTA 4NXNF 1RT1B 4R8UB 4OYMA 2P9PA 4C0HA 4CHPA 3JSBA 3AH6A 5IT4A 1SC1B 3BSOA 5DZ6A 1HBOB 1RHRB 3KLFB 2GGPB 4DTNA 3D6HB 3TYTA 4LREA 4MKYA 1T05A 2DNKA 3KLGB 2MSSA 2A10A 1TUWA 3A8YA 1VLYA 1ZYQA 4DSLA 3QFUA 2YNGB 5JMNA 1S9EB 1ZM9A 1KEKA 4CJVA 1HFEL 2WB4A 3PXGa 1WTBA 2C22A 1SXLA 2F4VF 3SSRA 3L2UA 5KFIA 3EUNA 3CD6N 4C3MA 1I1GA 2V4RA 1TYQB 3IBCB 2GVDA 1U2VA 3THPA 3HX9A 2J76E 4M63A 2UXCK 2VGNA 4CHNA 4JK9A 2R7YA 4O0NA 3OQ2A 2XMAA 5JVHL 1N4LA 4JK8A 3OL7A 3FEZA 2FBVA 2RAQA 5F0WA 3V4IB 1ZOTA 2CNLB 2N3OA 3I82A 2OPSB 4CT8A 4RO0A 4WIIA 2WVDA 4F2RA 1YTYA 4FLXA 4DFPA 3CCVS 3GG0A 2IVOA 5EU7A 1JB0C 4DWIA 5AR0A 1IJJA 1VLOA 2DBBA 1LXJA 1YT3A 4M3TA 3O3FA 3RB6A 4CBXA 4OI3A 4K4TA 3DXSX 4DV7F 3SCXA 5HL7Q 4B1YB 3G96A 1H7WA 1VGYA 3F9KA 3L7OA 2DEJA 3NGRA 4MIAA 1M5OC 4WFZA 2FJWA 3KUEA 3NH0A 2Z1GA 5HJYA 4LF4J 2D3ZA 4Z4FA 1NGBA 5J1PA 4LIWA 4N8NA 1H7XA 2HURA 3QESA 1WC4A 4LF5J 3KTQA 3OYJA 2QWMA 4N76A 3DHWC 3L2VA 1U1KA 3V81B 1NRKA 4C0OC 2B5JA 4CNYA 3RSEB 3ATVA 1QVGR 3HP6A 2QW9A 1YJTA 3MMJA 4YHHF 3EZWA 5M1NA 3DI6A 2EEYA 2JVRA 3CXCM 2CDRB 4AE5A 4Z2XA 2VGMA 5KFZA 2RHQB 3IG1A 5LMNK 3FZBA 4JV5F 2V2QA 4Z7CA 2R2TA 3KYLA 4ZITA 5L46A 2QRRA 1FE4A 2HRTA 1NBWA 5C2FA 2HZCA 5E3RA 5HROA 4DX8H 1N5TA 1NGGA 3SXLA 5DZ7A 2HQGA 3D2EA 4XEIA 2L9DA 3OYHA 3J7ZO 3C0BA 1PAEX 2QN6B 4DUZF 1EX4A 4BGBA 3DLGA 3CI5A 2ZBQA 1FRHA 4ISFA 3N01A 3QPIA 3ZNUA 2ATLA 4P2SA 2RT3A 3TA0A 4R5PB 2DHGA 2HNYB 5KFFA 2O8EB 4C11A 2WTFA 4OV1A 1TUUA 3GYNA 5M2PA 4JKDA 1FVQA 3HO1A 4OQJA 2P9KA 3VQAA 1BD6A 3TRGA 4TQRA 2DGXA 2XHWA 3RMCA 5AQLA 3PHTA 3HD2A 4ANEA 2YVSA 5D77A 5F9NA 5GAHU 3UKRB 1HR0K 4ZHRB 4JB8B 5E3AA 2ASJA 2VCPA 4DTXA 1YDLA 1KVBA 1VQ4S 1HBUA 1K1SA 4F4YA 1SQGA 3RTVA 4AQYK 1NXIA 1MU2B 1TKTA 4FL9A 5AQJA 2XY7A 2ZF5O 3M8RA 3EGNA 3GTYX 1Q53A 3O9UA 2JRSA 3TNVA 2ADBA 1M90O 3DFEA 4B1XB 4CZHA 3QATA 3S41A 3KHRA 2ZC4A 2ATQA 4L3QA 4QOZB 2DB1A 4URSA 1VISA 3BQ0A 4FWSA 1Q79A 5IFMA 3VF0B 4LQ9A 1RAIB 1SL2A 2MXYA 2NLXA 3QRPA 5CZ2A 2UXDJ 3TQ1A 2F65A 4RW4A 3W2WB 1IWGA 4BC9A 3D2WA 2Q0UA 5FLXY 4HLBA 2XWYA 3M9MB 5KFVA 4C48A 4CZLA 4B3RK 2C2NA 1DEJA 1B7YB 2H54B 4LIRA 4JI0K 1S0NA 3QWPA 5B08A 1RAAB 5JLFA 4YB7A 5DLFA 2W4CA 4LBIA 4EP4A 5AJ3K 4QZVB 3SPZA 4BR7A 1N32J 1FKPA 2EWSA 4G1QB 3J7Z5 4OPKA 5I42B 2F8HA 4O3NA 3SZ2A 4JYAK 4YB6A 4P2MA 1TL3A 2F1FA 4AHVA 3BPSP 3MM8B 1YAGA 3KWIA 2W9BB 4M5MA 1ZBSA 3VQ4A 1J2VA 3ZEUA 1QTMA 1VSLA 1QZ5A 5IC6B 2FHMA 1DT9A 3OV7A 3HXMA 3X3UA 5LL6d 4RUHA 4Q8FA 4CLWA 4GC7A 3ZSOA 4LF2A 4NE9C 3LDNA 2K06A 3FCVA 1JCGA 1MWMA 1DY3A 5DM7L 5F3ZA 2HFZA 1RDUA 5B0CA 1GMUA 1QQOA 2DRAA 1HWKA 1QAIA 4FZXC 3MPVA 4IFEA 1N56A 2DHHA 2OI2A 2UXCJ 4C3LA 1JX4A 2ZEJA 2ZH8A 2NXUA 4QWEA 3M8PB 3GG1A 1HNWF 1CSJA 4FWQA 4BGAA 3AJ2A 1UCNA 2QMXA 1WSIA 4L8RB 2HBZB 2R7OA 3S7RA 5HN0A 4WFNL 4UT4A 1GXTA 2HSTA 4CHZA 3M8ZA 3CC7N 2CQBA 4PEOA 3F73A 3A12A 3LM9A 4YOEA 1Y5IB 1PJ6A 3AVGA 1VJWA 4JLHA 3D2FB 4NCBA 5ETMA 2B3TB 1NK6A 2OA8A 1YVUA 4LF1A 2P9SB 1IBMK 4AHSA 2XSJA 1QD1A 3G10A 3KJFB 3NVMA 1BUPA 3C6TA 4F4XA 4CEAA 3MR7A 2DNHA 2KI2A 3RBZA 1L5UA 4P71A 2V2ZA 2ZH2A 1LK5A 3M9OB 4K4SA 2BKOA 3O9SA 1RXOB 5A2QY 2UU9K 5BRFA 4YS2A 4G1IA 3RVCA 1TMJA 2DFHA 3M4XA 2XGPA 1PBAA 1U24A 3AXMA 3V6HA 1OS5A 3MMBB 3CCEN 4C2MA 2AJ4A 4IO1A 1IKVB 3VEVA 4BVPA 4DEZA 2GUIA 5LL6Z 3MMAA 1VSDA 4X4VA 1OIAA 2I5JB 1JJ4A 9RUBA 1N5SA 2IA6A 4K41A 1HNZK 2AJQA 4FXWA 3PLAA 4KFBA 3J7AP 2ZDPA 1VC5A 3DDNA 4ANCA 1G1XA 1J54A 5LMNJ 5TKYA 2OPQB 2QEXS 4FYDA 3FGVA 5BXIA 4IFVB 2L08A 4Q44A 3THXA 3RMAA 4CGHA 4KHWA 3FFIA 4FF3A 2K1RB 3OTDA 4X65F 4FPAA 3I56S 1GXUA 4JI8F 1FRLA 1WNEA 1RWKB 3P4IA 3NGKA 1X5TA 4Z4HA 4LD0A 2MKJA 5IT9O 3W9JA 4M45A 3HFKA 3MM6B 2J7UA 1NDKA 3DLKB 4BWJA 1FW6A 2NXJA 1HYZA 2V6AA 1S5ZA 2BV3A 5JS1A 2YQ0A 1PC5A 3UVJA 4EZ6A 3P5JA 1TU0B 3GFYA 4CK3A 1U09A 2PE8A 4F4ZA 1BI4B 1HWJA 4A8WA 3PKYA 1XNQF 4J2AA 2KKHA 3M30A 2Q43A 3RYLA 2D0AA 2ZGYA 1U25A 2MZTA 1TV6A 3QT5A 1HR0J 2ZKUA 3CD0A 4XPCA 3T41A 5DM7Q 2VODA 4OZNA 4RX6A 4AQYJ 2YKMA 2Z1HA 4FJ7A 2W9CA 1KC8T 3D66A 4NZ0A 4P10A 5C24A 2IPOB 2P9UA 4NYPA 3SCLE 4CGDA 2ZBCA 3K5MA 3LP2B 4Z4CA 3T3FA 3CMEN 1M1KT 4S0MA 1DTTA 3OLBA 3FUYA 3L8BA 1CJUB 1HBNA 2HB5A 4FYXB 4AFFA 1Y7PA 2MHEA 5LT5A 3FLCO 1ZH5A 2AA4A 4ZJQA 2FVSA 3CB4A 2XMTA 1S4FA 2JDJA 1NMEB 4PG7A 6FDRA 4WFNQ 4YB5A 4PXEA 5H1SV 3IO1A 3JSRA 1LFPA 4TY8B 3C6HA 3R5DA 5A8RB 3RR7A 1S6QB 5E84A 5HRSA 3QO9A 4B3RJ 1Q86O 1JLCB 4URQU 1RCHA 3R5GA 2CJKA 4I6WA 3PJWA 4B9SA 4JI0J 4KHNA 3RMDA 5GAEP 3M8WA 1E6VA 4KH0B 4BCAA 2YI1A 4NLTA 2NRVA 3DM2B 2CNNB 2Q97A 5AJ3J 2M9KA 4QYRA 2HPUA 2PO4A 2FJVA 1RE1B 4XAKA 2BRKA 3VAKA 2IIHA 2ZM6F 2H4WB 5KI6A 4E19A 4I7FB 1N34F 4JYAJ 4P9SA 4P2XA 3OTOF 4BG8A 4ED2A 2UYTA 5DDRC 3VTIA 4DX7A 2QMWA 4FYYB 1RT3B 1HLWA 5GADP 3KK3B 4DPXA 5L8RC 3I0SB 2FVCA 2HHXA 3NBPA 2NNWA 1YWXA 4K5RA 4IFYA 4O4RA 2POKA 5KQ8A 4LC9B 2D1CA 1VSEA 1BUXA 3BBFA 2CPJA 4LFCF 3KG1A 3GJSB 3CPEA 1XQIA 4CZGA 4W5OA 2ZHOA 4WU2A 4NLWA 2A18A 4DR2K 2OD6A 4DR4K 3DYAB 1Q18A 1NOYA 1TVRA 3VVTA 4DDFA 4G6VB 1RYRA 5KRSA 4PYAA 4EZ9A 2N4DA 2X3DA 2W25A 1JNZB 1RWPB 3IMQJ 1HKBA 2V4QA 3DLEA 5BN9A 1RGVA 1RGIA 3PSIA 2E2NA 2KT3A 2ZWPA 2FZKB 1U48A 2H4YB 2KFZA 5M1QA 5D0GA 5D0HA 4CERA 4F26A 1Y0HA 5RUBA 2DGOA 2RB7A 3CMAS 5AQYA 1WDDA 5AFUH 2Q1LA 4F3QA 2DEIA 3EDRB 4JHDA 1RYSA 4K59A 2OTJN 1T9XA 2B8QA 3WX4A 3ZTRA 2GFFA 3A5OC 5JJBA 2Z2YB 3ZETA 1IBMJ 3A8EA 1ZBTA 4DR6F 4LF8K 1CLFA 4FLZA 3T9NA 3BREA 3TAQA 1P90A 4F36A 2N7CA 3M6VA 2EKYA 2GEMA 1F9EB 1RK8A 2UU9J 2V52B 3QERA 4FJ8A 1YSJA 1HQEA 4BRCA 1T3VA 3QIOA 4KHUA 3UN5A 2QLXA 1Q82T 3POTB 3R5AA 3L3CA 3G9CA 4LFBK 1NNEA 3BV8A 4OLOA 3V9XA 4DV5K 1K6YA 3KLEA 2ATCB 2VB6A 4F3TA 1MMDA 3L2RA 3WHIA 1NMNA 3MMCB 2IRYA 3J8AA 2OTLN 1HNZJ 4FJJA 5F8LA 3MCMA 1BQNA 3VQQA 4CO0A 4CH0S 3DMJB 4QCLA 1BQMB 5IS2A 2B4OA 1UOCA 3KG4A 3PM9A 3QINA 3IP0A 5DQIA 5HLFB 4FZVA 2B9YA 4IG0A 4F4WA 1AFIA 4N5SA 4A5AA 3TP2A 1SB6A 4H03B 4JKEA 3W8GA 3TJ8A 3VAMA 4HCBA 2J0QD 2F7TA 4LQ3A 3UCUP 4NXNK 2HS3A 4BRPA 3I5BA 1HI1A 3AXKA 3ZX0A 2CG4A 3S8SA 3TAFA 2ROEA 3KOAA 3VQEA 3UI3A 2CYYA 4CK2A 1RQ0A 4B9TA 2NYHA 4B3TF 1K9MO 3AQPA 3NGIA 5G0RB 3NRBA 3UKUB 1KLMB 4PZVA 1UJ6A 3FQLA 3RB3A 4HVJA 2EKNA 3UN2A 1U2CA 3W0LA 1PYOB 4WU3A 4O3QA 4ECWA 1S1XB 3HJVA 1Z4UA 1HHQA 1K0VA 4IKFA 3I31A 3AO5A 1VDHA 1U1QA 4CLYA 3OYGA 4USKA 1X9SA 2B6AA 3VR1A 1VQMS 2XHCA 3QT6A 3GCXP 1HHSA 1SCJB 3GPAA 2B7BB 1NK9A 1K8KB 1OQ6A 1WC5A 2KL8A 2FYXA 3AJDA 1TL1B 4OZLA 5GAGI 1E6YA 3K57A 2V8HA 4J9VA 3PRBA 2KJVA 4K2XA 1S6PA 5GINA 3EXYA 4BG9A 1JJ2R 1YJ9S 3O8MA 3Q89A 1QUPA 4X62F 4IWVA 3QBXA 2GTDA 2Q1NA 3OT9A 3F0NA 5J2PB 1SI9A 5LXRA 3VEYA 5KGXA 1S6UA 4KTZA 3KK7A 1UTAA 3VENA 2DYAA 2V4JB 4QW8A 3OL8A 3VERA 5GAEU 2XMWA 4KO0B 1RKIA 2FY8A 4U7BA 3D6RA 3ATUA 3ULEA 3KMQA 3CCZA 4OZJA 1GQEA 3EVMA 2NSCA 1KHWA 4ZVUB 1C0UB 1VC6A 3TOQA 3M1VB 3BSNA 4KY3A 4DTSA 4NEYA 3W9HA 3IAS9 3RBXA 3W61A 1SVDA 3S6EA 1SS6A 5GADU 4AL7A 4JI6K 4PG6A 2WOMB 4NYFA 4UOGA 4J9NA 3EKUA 3C6UA 3HHLB 4CM2A 3A5NC 1OPZA 2XULA 3I9ZA 3J7YU 1VMBA 5CYQA 4YHHK 3H42A 1EP4B 3NCRA 1RLCL 3LAMA 2VPWB 3WBZA 3HD1A 2P9LA 3I0RB 4F0HA 5AQZA 1LW2A 1KFSA 4DR3F 4KGZB 3SK3A 1JCFA 2DNQA 5AE1A 3CJ0A 4JI5K 4DXLA 2FBXA 3L6QA 3NXZA 3PDNA 2WVFA 5FDLB 1RDRA 4OHVA 1B64A 3L9ZA 4Y28C 4O44A 2HYIB 4MLHA 1Q8BA 2JHEA 4DR4J 4DR2J 4CEOA 2EK1A 4FVCA 2ZE2B 2QC3A 2E6LA 4F0MA 3V1RA 2ZOGA 1NJXA 3AHPA 3DRSA 2E2PA 2RQ4A 3HHLC 4FF2A 4WFBL 1P9YA 1JLEB 5F0XA 3MUMP 3FNNA 1UA1A 2GWJA 4EFAC 3HI0A 3M9NB 3IKMA 2G1HA 4CEFA 4AILC 4MQ3A 1B0TA 1K8AT 3AB4B 1N6QB 1AXQA 3AAPA 2H5EA 1YJNN 1N5YA 1P1LA 4GMKA 5F8JA 3PR4A 1C0GA 3FEXB 4CHOA 1QZ6A 1QE1A 4FW2A 5KFEA 4FLWA 3AAWB 1Q1KA 3O9RA 2E5LF 2X1FA 3SV3A 2I7PA 3NLCA 2M5YA 2MGZB 3G82B 3LDQA 4LF8J 1QTNB 5KFRA 1S48A 1E4FT 3OFFA 4CRJA 2GIFA 2MZRA 3DLLL 4QIFA 4A46A 3GCWP 2X6NA 4CW7B 1VS3A 5DQGA 3C14B 4HACA 3HHNB 5LOQA 3UDCA 1Q9YA 3HHDA 4L72B 2AQ4A 2EW9A 2BE7D 4FNHA 2MKIA 5J2MA 4LFBJ 2UVVA 4ZVSB 1UWAA 4DV5J 2DO0A 1LQ9A 3MEGA 3GL1A 5LSOA 3E9PA 4K50A 2PI5A 1KD1O 2PAVA 3TQEA 4M3RA 1S1VA 4LSLA 2IMWP 1FK9B 5IT9Y 1ZM2A 4GVLA 4BRKA 1CJTB 1VQ6S 2HZVA 4DV2F 2ROPA 1RCXB 4K4ZA 1ZBHA 4J2BA 3P38A 4CFCA 4FLVA 5IV4A 4JV1A 3M8QB 1RT4A 2C28A 2Z4PA 3GJRB 4AM7A 2NXNA 3KUGA 4NXNJ 3WNFA 3GIMA 1B9DA 4JD2B 2AF6A 4WXWA 2UXBK 5K8PA 1S1TA 4GVBB 2OEJA 5EWFA 2A41A 4CBWA 2F8SA 4ZCLA 4DB3A 2F8TA 1HIYA 2QV6A 1SV5B 1DLOB 3SBTA 1H6KX 4NLVA 3CJ2A 4ED6A 2BH1A 3B8AX 2W9AA 3G8QA 2ASDA 2HAIA 4OHYA 2CJXB 1XBWA 2RSQA 2J6UA 3OYNA 3GSDA 4K25A 4DLGA 1TGOA 1YZ7A 3C15B 3VVUA 3LWLA 2CQCA 2V68A 2E1MC 2APOA 2WVBA 1VQNS 1Q5VA 3OFHA 4RUCA 3VOVA 2XS2A 1N5QA 3R5BA 2UZAA 2J7WA 4ZVTB 4RBVA 2JVOA 2BXJA 3DCAA 1AZSB 3SI6A 2E66A 3AOCA 2RDIA 4J9MA 2DR8A 3EN9A 2HLUA 2GZOA 2WZ1A 1HNWK 4GVEA 2WW8A 4KE5A 2JL9A 2VFVA 2A1SA 3C7NB 1RI7A 4WP3A 2J4RA 2DNZA 2R42A 3P5TL 1SKRA 1IQTA 2E7XA 4WFBQ 2EXUA 2ZITA 3R3TA 3AD7C 2A42A 3I4HX 1W26A 2E2OA 4CFDA 2X7IA 3I5AA 1CULA 1RT6B 4A57A 1YGYA 2C2DA 3VGVA 2LA6A 3DLBA 2IMOA 3N9UC 2QTDA 5LY3A 1ATSA 1JLQB 2LXFA 1JCEA 3ENVA 1U0HB 3UDEA 1CVJA 3P1GA 3L4IA 4C8KA 1CJKA 3OYLA 1JKHB 2P9NB 3I5CA 2H1YA 2Q6BA 1DARA 4LY7A 2NPIA 1FKOA 1WG5A 2OFHX 4FWRA 2ZZNA 2H51B 4BRGA 3TR5A 4JI6J 4N41A 4TU9A 3KK1A 2NPFA 4WZMA 2QT7A 4OYXA 3DLLQ 1MSWD 3AO3A 2IVFB 1IM6A 1H2UX 2YWGA 2CWXA 1HW9A 2Y1IA 4HDHA 3MM8A 5HO4A 4H0YB 1BCOA 1FRXA 4CH1A 1EETA 2W9BA 3QFHA 4YHHJ 2LQ9A 1NHVA 4DTMA 4BDZA 4USHA 1NH7A 1AFJA 1NU0A 5KFXA 1U1MA 2G8WA 4OVLA 2NUUG 4IH7A 3DRXA 4IJAA 3VF6A 5FROA 4FW1A 4PKIA 2LKZA 3MF5A 5K20B 1IBKK 3K89A 1WNSA 1NGEA 2AGQA 2KHCA 4JI5J 4RW7A 2X1BA 3Q7BA 4X65K 3QNOA 3MEEA 4KI4A 4ZVHA 1T9WA 2CQIA 5HVHA 2DVIA 1XN9A 3GB0A 1TKZB 2Y8WA 2GAGC 3MOJB 4XTTA 4ECRA 3JTOA 2QSFA 2A3ZA 3LOUA 2D9OA 1YZ6A 1SC4B 1U8SA 3SQOP 4DSIA 2C3PA 2HQCA 2EPIA 2EFPA 3ZSXA 2D1KA 3CEDA 4JKAA 1WC6A 3DC2A 3G71N 1UWBA 1WG1A 4EYIB 1SJRA 4V1Ak 2NR0A 1BIZA 1Y5LB 3ZSVA 5DG7A 2KN4A 5FIIA 2QE5A 1XNQK 1RWOB 3ENBA 4CD3A 1SJ1A 3I32A 3AAQA 3GIJA 2J6TA 4YY3F 2CGJA 8ATCB 1NUEA 5HMWA 3BZQA 4YORA 3AD8C 5I3UA 5C42B 4L3KA 2PMZD 4F25A 3EZUA 3AVAA 1VQ4N 2EFGA 4XDCA 4FVUA 1VQPN 4XH5A 3IA0A 2G8IA 1OO0B 3MN7A 1LOUA 3JSMB 4ZPVR 4IR1A 1GLBG 3TVYA 4F50A 1RZMA 2VH7A 2CQ4A 2CXEA 5CCMA 3MM5A 5A8WB 3NDKA 4OJ3A 3ITHA 4DMNA 5F8MA 3LP0B 1UEVA 4MT1A 4USJC 1FFSB 1MG7A 3VQTA 1QLNA 3M7VA 4LF9K 2VG7B 2AZ3A 2GHPA 3E51A 2C3MA 3T1YF 3BY5A 4IRCA 5EWEA 2B9XA 2O01C 3VQBA 2XRIA 4ECSA 4E0DA 3RG6A 1D9DA 3UPFA 4I2PA 2RPIA 3VQ8A 3FKBA 3K2PA 3VGLA 2KXNB 4DR1K 4U96A 2MLYA 2HHHF 2JC0A 2LLZA 5CYMA 4TNOA 4WCEL 2VQFK 4ZPWR 9ATCB 4DZ6A 2HGMA 4UOFA 2J9CA 2OANA 2D4WA 1VAZA 2NZTA 2VPZB 1K73T 3ENAA 4GRSA 3NCPA 3ZSZA 2UUAF 4HWIA 2DH8A 1TFYA 4DTPA 3RZAA 3UDVA 3CCLS 1N34K 2V34A 4ALZA 3PYFA 2UV8G 5KT6A 2XC9A 5GIOA 5AQWA 4P6QA 2UXBJ 3SMPA 2KW4A 3V6JA 3AA9A 1T9VA 5BYSA 5CA5A 2BM1A 1RT5A 2E29A 1WN7A 4PXCA 1LWEB 2K3KA 1T95A 2LQ5A 4TQSA 2AX0A 2EC0A 3JAMO 1TKXA 3RRGA 3E9LA 3F41A 3FCWA 2M70A 2K7JA 3TARA 2V9KA 1XJWB 4DL4A 1PYSB 2EFQA 1B9FA 4ID1A 4E89A 4OX9F 5ETRA 2ZVIA 2HBMA 1S0OA 4YR2A 1R89A 3ZSYA 3QNWB 1C0TA 4ILRA 2BANB 3GV7B 1RWUA 2IRUA 1Y64A 3WUHA 3ILJA 2VJVA 3CHWA 4FK4A 2KRRA 5AXNA 4Y0FA 3PV8A 4OIXA 4TKTA 1D5AA 3AT1B 2B56A 4FPRA 1HNWJ 4FWNA 5J2NA 1XMOF 1HKGA 1EXQA 4HI2A 3PYDA 2VHGA 5DGAA 3LPUA 2C2RA 4BE0A 4CI6A 4NMLA 2FSNA 4WTYA 3Q86A 2LYVA 1LWFA 2ZH9A 3N4WA 3EYZA 5FLXU 2HF3A 5A8KA 3AVHA 2M52A 5L1JA 4JI2F 2OELA 1RWVB 3AA5X 2BM0A 1YF5L 3CDEA 4ZPTR 3IR5B 2Q6CA 2D7SA 3HFVA 2HBKA 4P73A 3QETA 5A0YB 4C1NI 3R1XA 4U9RA 3UD4P 1HNIA 4PCQA 1Q7LB 3U1LA 3E8OA 1HMVB 3CJ7A 4CF2A 4DV3F 1T3NA 5AQIA 3ENHA 5K14A 4JV2A 3WEEA 2KFNA 3CCUS 2HFNA 3TPQA 1JLAB 3ZO7A 1S72S 4UTGA 4F0KA 3EZOA 4NI2A 1MMNA 3UO0A 1W7WA 3DOLA 2GW8A 3ULDA 3WNHA 4PXDA 5M1PA 4CEDA 1YUWA 3CIZA 3DOMA 3IAM9 1RBUA 1F9HA 1TL4A 4ANDA 2GCFA 4XK8C 4P52A 4CTAA 2HK2A 4XO0A 2RS2A 3QRQA 2QEXN 2QWRA 2X3GA 4CLSA 1YG0A 1X4CA 3N79A 1QSSA 1IBKJ 3CCSN 3IRWP 1FO1A 3IXQA 2GHVC 4AD6A 3TUZC 1E3MA 1OPIA 4X65J 2CQPA 1WAFA 5KFWA 1WSVA 3SBGA 4FBUA 3AODA 4LVOP 4ECQA 4CK1A 2H48B 4ZVGA 3DLHA 2W2PP 4WCEQ 5T7BA 3HP9A 3ETOA 4IKAA 1P1TA 2W7OA 1NK4A 3QYYA 4ETZA 2A6MA 3SCKE 5KFGA 5BRDA 3R97A 3W2VB 2A0FB 1V5VA 3CJSA 4NRTA 3L3VA 1LW0B 4CP5A 2XYGB 3DDIA 4RNOA 1REVB 4FOEA 4TLQA 1XNQJ 1WEXA 4PUOB 3A0IX 3SFGA 2VG5A 5LJWA 2OLWA 4M3YA 3T5LA 4DG1A 2VUGA 1NK8A 3OVNA 3QEWA 3MMVA 3H5YA 4PKGA 3MX2A 2Y0SD 4RLEA 5A2QU 4C8OA 3R27A 4J7CA 2WFBA 1RTDB 4KHRA 3LGHA 2FLPA 4CZEA 3SQ0A 4E3SA 2EG2A 2QKKA 4X62K 4CLTA 4FXVA 1N36F 1KCFA 1XEZA 3M32B 2QA4N 3POTA 2NZ4A 3HKWA 4NA3A 5M1FA 3R6MA 3Q24A 2P5OA 3W9IA 2IM3A 5KGWA 5EOYA 1P8GA 2ZVSA 3IGNA 4LF9J 4ED7A 3OHRA 1F5AA 3QB0A 1X0FA 1HQUB 1RDAA 3IC1A 4X4RA 2I9SA 3SNNA 4OZ2A 4DS5A 2WONB 4YB1P 2O8DB 3AVMA 2HQFA 2KG0A 3TR8A 2RVJA 2BQUA 1XUPO 4AUKA 4I2QA 4DR1J 1RCOB 1BQMA 3CGIA 1S49A 2LEPA 3CJBA 2GO9A 1NB2A 4H4MA 3U8XA 2VQFJ 4MK8A 3CYMA 1OYDA 3P5BP 1VR6A 1V3ZA 3D45A 2CUYA 3K8WA 2UVUA 4I67A 2NZCA 5M2UA 1C2PA 2E1YA 1RTHA 4KGXB 1XR7A 1YJUA 5E3QA 4Y2AA 1VHFA 4BRDA 4I64A 1CJVA 1N34J 4J37A 1RSCA 4FLYA 4HUGA 3T1HK 3FR0A 3KLVA 4RW8B 1ZETA 4KYZA 4ZOSA 4N77A 4C8ZA 4W90B 2DNNA 3ZT4A 5CABA 1UVLA 4DR3K 1T9YA 1VQLS 3R1HA 4ZTFA 4QR0A 3NGDA 1KVKA 1B0PA 2H3EB 1JLFA 1QHAA 1QQNA 2F9JA 3AA2A 3O5TB 1S1XA 1HBMB 1XK8A 3BKFA 3W63A 1H74A 1NU4A 3BB5A 1RT2B 2K7KA 2ZH6A 1XNRK 4I68A 1HKCA 2R7WA 5KOXA 3DU5A 4OI4A 1Q0NA 3M1FA 2CPYA 2HSEB 1WUAA 4J9UE 3H4DA 4OPHA 4AXIA 4CIOA 1LNQA 3SI8A 4M5IA 1SIZA 4RBUA 4P2FA 3PIPQ 2ETJA 3OD2A 2A40A 4JI1F 4Y2IA 3KKSA 5D3GA 1WKLA 1B7FA 3S01A 4OLAA 3MM7B 4DR7K 3HVTA 4FS1A 2QA2A 5C10A 5E33A 2YXLA 4AHRA 4OI1A 2XO7A 1KP6A 1W2BR 2G8KA 1C1BA 3CMAN 4DPOA 4DLEA 3CTRA 2D0OA 1BXNA 4BROA 1OQ3A 2ZZTA 2GMJA 5J2QB 1YI2S 1G7CB 4LR9A 5ETNA 3FMBA 2GMLA 4JV0A 4KR0B 4A59A 4D3HA 2EI5A 3L09A 3R8YA 3CJQA 3U6FA 1SKUB 2HHTA 1R31A 2H5JB 3BR9A 3U1NA 4CJ5A 4ED1A 4H5RA 2OUGA 5T7LB 3KD5E 1PCAA 5DRKA 1N54B 4W92B 4IDKB 4DF4A 5DETA 4IR9A 4IJNA 2YWWA 4BRNA 1RWXB 5JVGL 1KQSM 3TX8A 1U1LA 2P8IA 4QS9A 3ZTOA 3RB0A 4O23A 1Q16B 3GFHA 2RU9A 4X64F 1RNHA 4BC4A 3A2FA 4RL1A 1U47A 4J9QA 2HQIA 2NLWA 1WSFA 5AQQA 1BL3A 3ZT3A 2RUGA 4AL5A 1OSDA 4A8SA 4ZCMA 2C42A 1Y3JA 5B0EA 1WC3A 3TWHA 2MY7A 2BW7A 4KQZA 1ITGA 4QIVA 2W7PA 4C98A 1MROA 5D0RA 3ZT1A 1F0XA 3HULA 2KJWA 1V4TA 2FGCA 2YHYA 1ZXOA 2XYPB 2YJEA 4FM1A 2J0SD 1VBXA 3CJKB 4EBEA 3A4TA 3CJ1A 2XY6A 5AXKA 3W5ZA 4F7VA 3HPGA 4JI3K 1GLCG 4DTOA 3ILIA 2R7SA 4ECXA 3NP5A 3JYTB 3I4PA 3QEIA 4A8OA 3OR1B 1KLNA 4IO9Q 4P75A 4GC6A 4K4YA 3CFOA 2N82B 3BP8A 1G4CA 2BW2A 3GILA 1V6HA 5DJBA 2RJZA 1T6DA 1FWPA 2VBWA 1S97A 4KRFA 2ILYA 4LRFA 1CLQA 4WE1A 5IWAF 3R5JB 3KDOA 2DHXA 2R8HA 2YKNB 1NJZA 1FJGF 2UUCK 1Q5YA 3D0HE 1VQMN 2XLIA 1VRQC 2NXCA 2W4PA 1JL2A 4YDUA 1HWUA 1S76D 4P74A 4USTA 1XC3A 3AVFA 2VYPA 2P5GA 5C15A 4URGA 2HZAA 4ELUA 4DR5F 4Y65A 1AYEA 3BZKA 5F1XA 4WBFA 3VETA 4NL5A 1IR0A 1WHXA 1QQCA 3R8EA 3IM8A 4RWTA 1FWLA 1YJ9N 1D8ZA 3TA1A 2VQEF 2BA9A 4W98A 4X62J 2H65B 3M2RB 3NAIA 2V8PA 3FSXA 1YJVA 3K0JA 4M7XA 3LANA 2C3UA 1RA7A 1T03A 4OKJA 1YVNA 1KNZA 2MQLA 2XG8A 3OTBA 2B7CB 3QAEA 4FNIA 4ISEA 1J5EF 1NJIT 4DL3A 4DKWA 1FXXA 2B8PA 2UV8A 3ET6B 2V63A 1O8BA 2GVZA 1K0TA 3MXHP 2HF4A 1YHQS 3N6NA 3OR2A 3RR8A 2VBZA 2JLGA 5SUHA 4FS2A 4UOHA 1FESA 4QBUA 5LJ5Y 4KHYA 2M7SA 2XM3A 2UP1A 3OY9A 4NASA 2E9ZA 1VBYA 3W66A 4EWTA 1FFWB 3KLHA 2ASLA 1Q81T 3OUYA 1RTIA