3DLEA

Crystal structure of hiv-1 reverse transcriptase in complex with gf128590.
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
538
structure length
534
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 135
structure length 534
sequence length 538
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dleA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dleA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dleA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dleA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dleA05
3DM2B 4K4ZA 2FBXA 1NKEA 3DRPB 4B9SA 3FQKA 4RNOA 4Q5VA 2V4RA 3VQ8A 5KGWA 4Y34A 4ECUA 1T05A 3PX0A 1VSLA 4EO8A 3ZSWA 1U09A 3N6NA 3ZT1A 1VSDA 4NCGB 4ZP6A 4FZXC 1C0UA 1ZBHA 4J9OA 1DTQA 4HUGA 4WYLA 2ETJA 2A1SA 4W5RA 2QE5A 1C1AA 1RBSA 3H98A 3H4BA 4ID5B 1JXBA 3HPGA 1IM4A 1I3AA 1RILA 3VQCA 3BQ0A 3T5LA 5C24A 4RG8A 5KFIA 5KFXA 4E7LA 1CZBA 3V4IA 2AX1A 1GOBA 4NLXA 4KB7A 4DTUA 1WSJA 4CEZA 2HHQA 1J9AA 4DF8A 2BANB 3AVBA 3FDSA 3CYMA 1GOAA 4E1MA 4BE0A 3ISNC 4LH5A 3V9UA 1L3VA 3PY8A 4DL4A 5KRSA 4F4YA 4Y1DA 2AU0A 4RNHA 3S3NA 1CXQA 4WE1B 2IBKA 3M9MB 5DG7A 4MFBA 4TQSA 4Q8FA 4DQSA 3KOAA 2GBZA 4IR9A 3U6FA 3GIMA 2NUBA 4B9MA 3SNNA 3QEPA 4PY5A 1HYSB 3VQ6A 3PR4A 4QWBA 2D3ZA 3G86A 3HXMA 2KZMA 1CLQA 3LDSA 2HHSA 3B6OA 1JLCB 2D0AA 4CJFA 3SQ4A 3IN5A 3AA2A 4AHRA 1RTDA 5KG0A 1U48A 4ELTA 1RTHA 4JV2A 1LW0B 4NLDA 4CIFA 1S6QB 3MXIA 2W9BA 4FJMA 3SJJA 2B6AA 3H5UA 1C0TB 1TV6B 2VG6B 5KT6A 3RBEA 1WSIA 4CJEA 1S0OA 4CGFA 3PV8A 2IM1A 3MTKA 4KAIA 2W9CA 3RAXA 1KHWA 4CJPA 3LP1B 3DLEA 4O0IA 1K1QA 4NYNA 1ITGA 3OJUA 1RDCA 4TLRA 2ATLA 4PUOA 1NJYA 2D7SA 4NCGA 1KLMB 2OPPA 4AHUA 3FRZA 1HYZA 2JEJA 2F8SA 1S1WB 4FJXA 1QUVA 1Z4UA 1TP7A 4IBNA 4EYHB 4KO0B 1BL3A 1JXLA 4Q44A 1SKWA 3VQBA 1U45A 3NFAA 4H4MB 5KFEA 1MMLA 1K1SA 3K5OA 4RUCA 4CGJA 3L3VA 4NLGA 2PYLA 3T5JA 3H5XA 5DGBA 4C8OA 2HHUA 3NGIA 3VN5A 2ATQA 5J2NB 2R2UA 1IO2A 3I8DA 3BSOA 4CERA 3T3FA 3DRRA 3CM6A 2IM3A 1BIZA 1RTJB 3KK1A 3DLHA 3TAEA 4NCAA 4CHYA 2B4JA 2LSNA 2XRIA 3KMSA 4TQRA 1XHXA 3VQAA 4M3YA 2HNDA 3KLHA 2UUWA 1S1WA 2HHTA 1RTIB 4HHTA 3K5LA 2W8KA 3QERA 3PUFA 3FFIA 3AVJA 3RMCA 2DTUA 4FM2A 3PW4A 5J2MA 5EUHA 3P83D 1HNIB 3RWUA 4BACA 3NDKA 3BGRB 1RTJA 3K5MA 3C6UA 1HNVB 4M94A 3AVGA 1ZBFA 1LWCA 3L2VA 2WHOA 1HPZA 1S6PA 4KFBA 4F4WA 2ITGA 2ZKUA 4NRTA 4Y2AA 3OLBA 3LP0B 2YKMB 3TAFA 5DG9A 4XPCA 4UQGA 4DEZA 3L2UA 4KFBB 4RNMA 4F3OA 1EKEA 1VRUA 1RT4B 4O4GA 4CHZA 3V9ZA 3C6TA 3P5JA 4OLAA 3QETA 2X78A 1VK0A 4LSLA 4QWCA 4OKKA 3QZ8A 1KLMA 5C25A 4K4VA 3QIDA 3PJWA 4FS1A 5DGAA 1TL3A 2Q3SA 3CJ5A 2IC3B 1NK0A 1KRPA 5HRSA 3OL8A 4MKBA 1JL1A 2IC3A 3GIIA 4RW4B 3NL0A 2BRKA 3KK2A 4N5SA 2P5OA 3MECB 4DTPA 5KT4A 3ASMA 4DFPA 5KGXA 1BCMA 2IJFA 4QWEA 5HLFB 4DQPA 4WXWA 3MR3A 4J9PA 2Y1JA 1TKZB 4E19A 3LAMA 2FVQA 1Q8IA 4GVMA 2WOMA 3BJYA 4Q8EA 4BDYA 4W5NA 2E6MA 5KG2A 5L1KA 5T14A 2YHAA 5KFQA 1EXQA 2IAJA 4IG3A 2RDIA 4CJ5A 4RW7A 3SPYA 1EP4B 1JIHA 2EX3A 2XI2A 4J9SA 2AJQA 4C8KA 3G6VA 5EU7A 1NJXA 4DTXA 4ZP7A 2P1JA 1TVRA 3IS9B 3CVKA 3TQ1A 3AVKA 3KTQA 4M3UA 3IGVA 4OPJA 3D0PA 3NGZA 1ZTWA 3PZPA 1NNDA 1TL1B 3VQ7A 3GV8B 4KHYA 4B9LA 4KREA 4IKAA 1S9EA 3MR5A 2EC0A 2Z1IA 5F8NA 1JX4A 5KFNA 4CGIA 4DFMA 1OS5A 4H54A 2E6LA 5J2NA 5KFAA 4MK7A 2OH2A 4FCYA 1VRTB 4ECWA 3BQ1A 1T03A 1DTQB 1NHUA 4H4MA 1BGXT 2ILYA 1RT5B 3MEGA 4W5TA 1WNEA 4NLYA 3H59A 2I1RA 3M8SA 2FBTA 3U3YA 4N56A 2FVCA 2GIQA 5D3GB 4RW9A 4ED7A 1WLJA 4GW6A 3DOLB 3KHHA 3DOLA 1IKYB 1F21A 3SI8A 4PQUB 1VSIA 4HTUA 2I5JA 4DG1B 4DU1A 4QWAA 4FYDA 3TR8A 2AGOA 1SH0A 1J53A 3V6DA 2YNGB 2ASLA 1NKCA 3P1GA 4RNNA 1S1XB 4K4XA 3KJVB 4J2DA 1WSEA 4ED6A 3BR9A 3GIJA 3OYEA 4DTOA 3TI0A 1ZBLA 1FKPA 4FVMA 2O4IA 4DQIA 3AO3A 2RF2B 2IM2A 2WB4A 1WSGA 2UVWA 2XWYA 3QO9B 2PZSA 3QIOA 2HWHA 5J1EB 1RDRA 2YNIB 2D0CA 5KI6A 3VQPA 4YR2A 2F8EX 1Y97A 4E89A 2G8VA 1FK9B 1IKYA 3TVKA 5KG3A 4IRDA 5KT7A 5HROA 4NLTA 4DL6A 5DG8A 1D9DA 2YNHB 3DLEB 3CIZA 3CG7A 2Z1JA 3F73A 1RT3A 3QLHB 4FW2A 4ID1A 5KT2A 5C42A 4E3SA 1VSMA 4DL3A 1NK9A 4HYKA 4ED3A 4CJSA 1GX5A 4O4RA 3Q8SB 3CFRA 4CGGA 4FJIA 1K6YA 4KHSA 2RN2A 5KFWA 1S5JA 2ZE2B 2OPRA 5J2PA 3IG1A 2DPIA 2ALZA 1TAQA 3DYAB 4FLYA 3RBDA 3KKRA 4IH5A 3NE6A 4KRFA 5C24B 2C2DA 1Z25A 3JSMB 1T3NA 1UOCA 4TSXA 2QK9A 3RMAA 4IOBA 4M3RA 4Z4FA 2D5RA 2IS3A 5SZTA 1REVA 4OGCA 1TKDA 3TARA 1BIUA 4CJUA 4J9MA 1L3SA 1YT3A 3ITHA 3QLHA 2WRMA 3F9KA 1IKWB 3M8QA 2R2TA 3ZCMA 3KK3B 3FFIB 4CHQA 3V81A 2XO7A 2IAJB 3DM2A 1B9DA 4I2QB 2HNZB 4DTNA 1YTUA 4O3QA 3DLRA 3OS1A 4KKOA 2G8KA 3LP2B 2FVRA 4NLQA 3C6TB 1GX6A 4CGHA 5JUMA 3MFHA 1LV5A 3SI6A 1EETB 4JLHA 3QNNA 3PVXA 1JLEA 2UVVA 3VQQA 2BR0A 3AVIA 3KK2B 3OL9A 3KLEA 1RA7A 2YNGA 5DQGA 4W5OA 3O3HA 3QESA 3AO4A 4AHSA 3TAMA 4M45A 2PYJA 1RAJA 4OKJA 2VG5A 3O3GA 4DLGA 3CDEA 2OPSB 3L2QA 1YTAA 1RDAA 2G8WA 4M3TA 4R5PA 3LP3A 4O3NA 1NK7A 4ED0A 3D28A 4FJ9A 2GV9A 4PWDB 2P5GA 5KTQA 4DSFA 3OHAA 4DSLA 1QE1A 2D3UA 2HHWA 4I2PA 4ZVFA 4FJ7A 2DFEA 4OVLA 3HHKA 1QHTA 4ZPBA 4IFVA 5F8IA 3V4IB 4Q0BA 4G1QA 4ELUA 3JYTA 5HRNA 1ZBIA 5FDLB 1FKPB 2AGPA 4IFYA 3IG1B 4OPKA 4CJTA 3QEWA 2XY7A 3TAPA 3HYFA 5KG6A 4FJ8A 4R0EA 5HLFA 3C94A 1RBTA 3BGRA 4BDZA 5F8MA 1XR5A 3IGNA 2JEFA 4TY9A 1FKOA 1KLNA 3MXJA 1TK5A 4TN2A 4N76A 4KTWA 4FLTA 4IR1A 3MF5A 4F4ZA 3SUOA 3BSAA 1YVFA 1Z26A 4FLUA 2HNDB 4M3WA 2GIRA 1NKBA 1NJZA 5D3GA 5KFJA 1KSPA 3EZ5A 2AGQA 5EWFA 4NYZA 4HUFA 4NRUA 4LSLB 1HQEA 3DI6A 4J9QA 4YQWA 4CF0A 3CDWA 3OY9A 3K5NA 4WYWA 3ISND 1VSKA 1QSLA 3G0ZA 1RT2A 4OL8A 5KFSA 1WSFA 4NYFA 3OVNA 5HP1A 1WSHA 3T1AA 5EWGA 3HL8A 1D0EA 2W9CB 3GYNA 2JGUA 2BE2A 1N48A 1RDDA 3HT3A 2J6TA 1UWBB 4JV1A 4NLWA 2X74A 5L1LA 4MKAA 1S9FA 5FROA 4RW6B 3OJSA 1HARA 3NH2A 3SFUA 5I42B 5KFRA 4LH4A 3H40A 4ECTA 4CEFA 2FJWA 1SH2A 4W5QA 2HW3A 3OHBA 4CFBA 3TWHA 1XC9A 2FVPA 2EHGA 2X6SA 4FXDA 4KV8B 3HJFA 4ZPDA 1HYSA 3IRXB 3QIPA 1JXEA 4KHWA 3T19A 1HQEB 3U3GA 1S49A 3V1OA 3UR0A 1QTMA 3LANA 2F8TA 4E7JA 2JEGA 4I9LA 4TYBA 2HNYA 3QZ7A 2RDJA 4MQ3A 2KW4A 2J6SA 2FBYA 1S1TB 1DTTA 4O3RA 1C1CA 2OYQA 5J1EA 1D1UA 4F2SA 3QEVA 2BE2B 3MEDB 1T03B 5E41A 1JKHA 1T8EA 4ZPCA 1TKTA 1G15A 2X6NA 1TKTB 1EETA 1S6QA 3SPZA 3TANA 4K4SA 3MEDA 4B3OA 3EZUA 1TKXB 4LY7A 1JLAB 4DLEA 4ICLA 3I0SA 4FW1A 1HMVA 3H5YA 5DLGA 3K57A 2VWKA 4BWJA 3EPIA 3RR7A 3AVCA 1U04A 3PW2A 4FLWA 2J6UA 5KFZA 4HUEA 2BGGA 2AQ4A 5HBMA 3ZT2A 4MFBB 1BQNA 5KFTA 1RBRA 4CJ4A 1EP4A 3PR5B 4Q43A 3SZ2A 3RB3A 4Z4CA 3TAMB 3WNHA 4WFXA 5DQHA 1NK6A 1RTIA 4ZTJA 3V6HA 4K4TA 4DTJA 4DTMA 1A5VA 4R5PB 5DQIA 4KAZA 1RBVA 3HM9A 3G6YA 5T7BA 2YNFA 3MEEA 2R8HA 3AV9A 3CDUA 1C1BB 1RT6B 3DRRB 4J9LA 3Q8PB 3Q8QB 3KLVA 5KFDA 4Y2CA 4NLSA 2KFZA 2W9BB 4ZTFA 4IFVB 1L3UA 4IG0A 3VQSA 3E01B 3VQ5A 1W0HA 2XCPA 1BHLA 3OYIA 1U49A 2VG7A 5F8LA 4CJ3A 4F50A 4ZVEA 4C8LA 3QNOA 3LZJA 1J5OA 4CHPA 1QS4A 4KHUA 2JC1A 1T7PA 3N6LA 3NMAA 2WONA 5DMRA 4K8XA 4LSNA 3NAIA 3LWMA 2WTFA 3AO5A 4B9TA 2C28A 2OPSA 3T5KA 2IDOA 1SV5B 1IKXA 4E0DA 1CXUA 1BQMB 3GV5B 4NLOA 2WONB 3M8RA 4CJRA 2A1RA 3OL6A 3SUNA 2JLEA 2WCXA 3OL7A 4RNFA 3DLKB 4CEQA 3QO9A 3AVHA 1CSJA 4E7IA 4CJKA 4IKFA 4TY8B 5F8JA 5KFPA 2QXFA 3LP1A 4O3PA 2IOCA 1XWLA 3BDPA 4FJHA 1NK4A 4DFJA 3VQDA 4JRQA 3NHGA 3RMDA 1ASWA 5CZ1A 5EDWA 4F3TA 4MIAA 3UIQA 5KFBA 3SQ2A 3MEEB 5K14B 3ZT4A 4IRCA 1NK5A 4DL7A 3HVWA 1TGOA 2HNZA 1BI4B 2D0BA 2IM0A 3FQLA 1TVRB 3IS9A 4FBUA 2HMIA 4URGA 4RU9A 4CFAA 4URSA 3O3FA 3HP9A 3HSTB 3AA3A 4PQUA 2FJVA 4RW4A 1RT1B 3NGYA 2FJXA 4DS4A 1S1TA 4YMEA 4FZYA 4DSJA 1SH3A 2C2EA 1DLOB 4K8ZA 5J2QA 4I7FB 1S0NA 3NF9A 5J2QB 1S97A 4K50A 3SYZA 1LWFA 1WAFA 3PJXA 4HKQA 1HYVA 4ECSA 5KG5A 1O1WA 3OYDA 3KK1B 3NBPB 1D8YA 4FJ5A 1I39A 4CHNA 5KFKA 4DS5A 3GIKA 4BE2A 3I5BA 1YVUA 5CY4A 2JC0A 4M42A 2W9AA 3PW7A 3OYHA 1S1UA 3CJ3A 4WFZA 4OGEA 2G8UA 3MR6A 2IJNA 4FS2A 2KTQA 4KTQA 3OSPA 1L5UA 1QAJA 3BSNA 1VSHA 4NZ0A 5KFVA 1C6VA 1HNVA 1U47A 4CHOA 4EP4A 3DDKA 3PX6A 1HNIA 3DLGA 5C25B 4URQU 4KV8A 3ITHB 2OPPB 4IDKB 4E7HA 1BCOA 3LALA 3T5HA 1TAUA 2E9ZA 4JV0A 3TABA 1RT1A 1N5YA 4J9KA 4KSEB 4CCHA 1IKVB 4CEDA 2XGQA 3CQ8A 4Z0UA 1VRUB 3OYAA 3BQ2A 3AVAA 4LD0A 2R8GA 1NJWA 2R8JA 3WNFA 4G3IA 2R2RA 1TK0A 3HO1A 1NOYA 1MU2B 5K14A 4I9QA 2OPRB 4GC7A 4FBTA 1S1VA 3CJ4A 3NGDA 1LW0A 2YKMA 4R8UA 4TXSA 4CJWA 1MU2A 5HP1B 2FVSA 5I3UA 3D5MA 4CECA 1KTQA 3QEIA 4FJNA 1XR6A 2JEIA 1SKRA 3NKYA 2YNHA 3DI6B 1SUQA 2R8IA 4J9NA 3C95A 1ASUA 3L8BA 1ASVA 3O4NA 5F8HA 3K2PA 3LAKA 3V81B 2E4LA 1RYRA 2F96A 5KFGA 2HHVA 1C2PA 1S10A 3O4QA 1RT7A 3DMJA 3OLAA 3NH0A 1VRTA 1QAIA 3K59A 4R8UB 1VSJA 3NCIA 4EEYA 1W9HA 3JYTB 3ZSVA 1JLGA 5KFLA 5KFUA 1JLGB 1TKZA 2D41A 1JL2A 2ASJA 2XI3A 1S1XA 4ZHRA 1FXXA 4QW9A 1C0MA 4YR0A 4WZMA 1QE1B 4M41A 3BSCA 3PW0A 1HJRA 2QKBA 4TY8A 4U6PA 1NHVA 2ZD1B 4AHTA 4PWDA 3UDLA 4AH9A 4K4YA 2UVUA 4U7CA 3B6PA 4DSEA 1SV5A 4WE1A 4N47A 1X9SA 2DFFA 1UA0A 4KI6A 1N4LA 4FLZA 1IG9A 2FC0A 4LSNB 4KBIA 1IKWA 3M8QB 1RDBA 1S4FA 5SWMA 2XY6A 5CZ2A 1QSYA 4DSIA 5KG7A 4KB1A 3S9HA 1S9GA 1LW2B 4ZVGA 3ZSYA 4JRPA 4ZHRB 2OZSA 4RW6A 3PW5A 5KT3A 1QQCA 1JLCA 4N41A 4C8NA 4KHRA 1KFDA 2HVHA 3I5CA 2ZE2A 2GC8A 4G1QB 3SUPA 3CFPA 4KTZA 5JS2A 4KKOB 4CJVA 4ECYA 1RT2B 4ECQA 2QKKA 4O44B 4I2QA 5J2MB 3DLKA 5L9XA 2B5JB 4ED1A 3CM5A 4RW7B 3H08A 3RR8A 4AHVA 4GC6A 3HVRA 2ZD1A 4FK2A 1ZBUA 4FK4A 3UQSA 3KLGA 1NK8A 2RPIA 3NAHA 4F4KA 1RA6A 2DFHA 1FKOB 3CWJA 4O0JA 3V1RA 4ICLB 3M9OB 4F2RA 1Q9YA 2VWJA 4CJLA 5FRMA 1BISA 2E9RX 4KHNA 3MFIA 1A5WA 2OPQA 3RAQA 3FSIA 3ZSZA 1JKHB 3SUQA 3PO4A 4M3XA 1S1VB 4Y3CA 2YNFB 3KHRA 1DTTB 1C1CB 1KFSA 1JLFB 4FJJA 5CYQA 2HNYB 3DOKA 2HHXA 3NF6A 5F9LA 3S3MA 1B9FA 1W25A 5JS1A 4OKEA 4ECXA 4CF8A 5HBMB 3WNEA 3ZSXA 3BREA 1Q9XA 2ZQBA 4X2BA 2OA8A 1FK9A 3LWLA 4DL2A 2B5JA 5F8GA 3RRGA 4QCLA 4FJKA 4MIBA 1LAWA 3UPFA 2O5DA 2UVRA 2RKIB 4MK9A 1KHVA 5CYQB 4CFCA 4ECVA 3V9WA 3NH1A 1UA1A 3E01A 3AVFA 4FJGA 4EZ6A 4F4XA 4FK0A 1HQUA 1VSFA 3LP0A 4ZP8A 2YV0X 4YR3A 3HVAA 1KCFA 3H2LA 2HVIA 2WOMB 4CK1A 4B08A 4ELVA 2OPQB 4KPYA 3NF8A 4ID5A 3I0RB 1HQUB 4DTSA 4KO0A 1CZ9A 4CIEA 1RTHB 3C6UB 2Z1GA 1RTDB 5KFYA 1XHZA 4I2PB 4FM0A 4DQRA 3LP2A 4ZPAA 4XO0A 2W7OA 3CO9A 5KG4A 1X9MA 4QOZB 4OLBA 1XR7A 1JLQB 4BE1A 3IAYA 4PUOB 4IRKA 1U4BA 5CYMA 4B8AB 4O55A 4Z4GA 3SQ1A 3MEGB 1TL3B 4JUZA 2IMWP 5HRRA 3RTVA 4IH7A 2GUIA 5EWEA 3EPGA 4CK2A 3S3OA 3VA3A 4O3OA 4OJRA 5KFHA 3ZSQA 3AA5X 3QGHA 3ZSOA 4B9UA 3KLEB 1RT5A 2KZZA 1TV6A 1JLAA 2O4GA 2VG7B 1LWEB 3HVTB 3L3UA 2BQRA 4B3OB 4KE5A 3OSNA 2ASDA 3LPUA 3OYMA 3QGIA 1KVAA 3I0RA 1SL1A 4HCCA 1S9EB 3AVNA 1BI4A 3DRSA 4ZMMA 1R0AB 2ILZA 3VQ9A 4KI4A 3DYAA 4BDPA 3NBPA 4DWIA 4J2AA 4DQQA 4C8MA 4NLPA 4M95A 4YP3A 4DFKA 4E7KA 4ZP9A 2PY5A 4EP5A 1ZETA 1JLBB 4CGDA 3V6DB 3L2RA 3QEXA 3RB0A 1LWCB 3D45A 2BRLA 2DPJA 3MXMA 3TAQA 2W7PA 3KLGB 3I5AA 2V0NA 1T94A 5C42B 3AA4A 1BQMA 5HRPA 3SQ0A 5F9NA 1KVBA 3QYYA 5KFMA 1KVCA 4DSKA 4CE9A 3KMQA 3OS2A 4O5BA 4H4OA 2VG5B 4QPXA 1JLQA 3KLHB 4Z4IA 3KD1E 2C22A 1J5OB 1JLFA 4ECRA 2XY5A 3PHEA 2YNIA 2YHBA 3I0SB 1D9FA 4ED8A 2R2SA 1TKXA 4O3SA 1N6QB 3HK2A 1RNHA 4RW8A 2AX0A 3RRHA 2YKNB 3DRSB 4RW8B 1IH7A 4IFYB 3HPOA 1I6JA 3NF7A 3EYZA 3OYNA 1RT6A 4JS5A 1N6QA 3N6MA 3MECA 4DTRA 3ALYA 4LQ9A 2OZMA 1LWFB 2E9TA 2CKWA 3KHLA 3Q8RB 4ED2A 1HPZB 1S6PB 4EZ9A 1RBUA 3MAQA 3V1QA 3K58A 4TYAA 1WNSA 4CF2A 4H4OB 1DLOA 1SL2A 2IGIA 3KKSA 3EY1A 3THVA 1BQNB 4KHQA 5CYMB 4NCBA 3ZT0A 1QSSA 4RZRA 4XIUA 4IDKA 1L3TA 2BQUA 3ZT3A 2FLPA 1D5AA 3OYGA 2XCAA 4CJQA 4CESA 4DL5A 4KHMA 2VA3A 2XY8A 1RCHA 5I42A 4IG0B 3V6KA 3LPTA 3KLIB 4XPEA 4GMJB 1X1PA 3M8PA 4CEAA 5JXSA 3SCXA 4RUAA 2DY4A 4FLVA 5FDLA 5KG1A 1R0AA 5J2PB 1C1BA 2YKNA 1C0TA 1S48A 4NLRA 4EO6A 4IH6A 3OYJA 2FBVA 2BQ3A 4MH8A 3DMJB 3AO1A 4DU4A 4CK3A 1C0UB 4PA1A 2AWZA 5L1JA 1TK8A 2I5JB 4DG1A 1LAVA 4B9NA 3H5SA 4HVJA 4FLXA 1N56A 1IKXB 1SUQB 1UAXA 4QWDA 3PX4A 5HROB 5KT5A 4YFUA 4B9VA 3KHGA 1VSEA 3CJ2A 3OYBA 4Y1CA 3V9SA 3OS0A 2XC9A 2G8IA 2IA6A 3HKWA 3ZSRA 4KB0A 3KLFB 3V6JA 4IG3B 4J2BA 2R8KA 4BWMA 3L2WA 2R7YA 2KFNA 1A5XA 3LZIA 2Y1IA 4LQ3A 3SV3A 3RMBA 5DK5A 3VQEA 3GQCA 3V9XA 3H4DA 2RF2A 2WK4A 2BANA 5KFOA 2HB5A 3M9NB 3RB6A 4CFDA 4FM1A 5DLFA 2G8HA 2UUTA 2VG6A 3KIOA 1ZTTA 3RB4A 3M8PB 1SL0A 4EYIB 4Q0BB 1S0MA 3HPHA 3KJVA 3OYKA 3QGGA 4K4WA 1IKVA 2G8FA 4ZVHA 4MK8A 3OYFA 3NAEA 3WNGA 3KK3A 2V4QA 2BDPA 4H8KA 3IRXA 3QIPB 3KLFA 3MR2A 4JS4A 4HCBA 4AILC 4RW9B 3E51A 1GOCA 3AVLA 1REVB 3DLGB 2W8LA 3DOKB 2KQ2A 3GV7B 1JLBA 1XI1A 5KRTA 4Z4EA 4CEBA 1RT4A 4O4GB 2B6AB 1RYSA 2FLLA 3TAGA 3AVMA 4B8CA 3DLBA 1JLEB 2HAIA 2XHBA 4FZZA 5KFCA 4F8RA 5C5JA 4J2EA 1WAJA 4K4UA 2VA2A 4NLVA 3KNAA 3KD5E 3VQ4A 4AHCA 5KFFA 1SKSA 4Q45A 3PO5A 4L8RB 5FRNA 1EX4A 4J9RA 2C2RA 1WN7A 1NOZA 2V9WA 4QAGA 1TQLA 2W42A 1TL1A 3OYLA 2RKIA 5L1IA 3CJ0A 2Z1HA 1RT3B 3KLIA 3ICLA 3ULDA 4DU3A 4CF9A 1N5YB 4CIGA 4WFYA 3QINA 1RT7B 1ZYQA 3SV4A 4WXOA 3HP6A 4I7FA 2QV6A 4Z4HA 4EBDA 2HWIA 3CFOA 4QW8A 2FLNA 1HRHA 4NLUA 4O44A 4EBEA 4YNQA 4DF4A 4CEEA 4ECZA 3A2FA 1X9WA 3AO2A 3G10A 2HMIB 3DRPA 4WZQA 3JSMA 4DMNA 1UWBA 3G6XA 2B43A 1B92A 4E1NA 5I3UB 4CF1A 4FJLA 1HMVB 3VA0A 2CJQA 4IQXA 1S1UB 3GILA 2P51A 1LWEA 3HVTA 3OYCA 1S9GB 1LW2A 4EBCA 2XGPA 1J54A 3SFGA 4CEOA 1T05B 4M3ZA
chains in the Genus database with same CATH superfamily
2FBXA 3JTPA 4RNOA 4Q5VA 3VQ8A 4O0NA 1N32J 3T7ZA 5KGWA 2R7QA 4LRDA 4ECUA 4FDFA 3R3LA 4EO8A 3ATUA 1U09A 3V5RA 3C19A 3TR5A 4ZP6A 2FJBB 1NWKA 3P38A 3R8YA 1C0UA 3EKSA 2PMHA 1VCTA 3ETOA 2GQ2A 4XEIA 3DGPB 3EX7B 4PCQA 3BZCA 3J7A1 1JXBA 2E5GA 2DNZA 2ADCA 3D6HB 3VQCA 1UL3A 2C2ZB 2Y1RI 3E9OA 4E7LA 1CZBA 1NMEB 1IVZA 4QU6A 3GSDA 4NLXA 1J9AA 2QN6B 4M1KA 3FDSA 3MMAB 4YB1P 2YWEA 2XZDB 2PDAA 4CYUA 2XNRA 2FQQB 4A2AA 3GJSB 2QWLA 2DHGA 1GXLA 3BBFA 3FMWA 4RNHA 2MZJA 3S3NA 5DG7A 2LQJA 2IBOA 2NUBA 1W2BR 2UYTA 3N01A 3C65A 3DJCA 1DRZA 3PR4A 3HXMA 2KZMA 1HW9A 3LDSA 4UZCA 1A7GE 1RAOA 5LOQA 3IN5A 3I32A 1PAEX 1BU6O 1RTHA 4JV2A 3J7YP 1LW0B 4NLDA 3MXIA 3FVYA 4FJMA 1C0TB 1TV6B 2OTLS 3FJ2A 2JHEA 3PV8A 1QLNA 2IM1A 3CJ9A 2QLWA 3QPIA 2O67A 4W98A 2V67A 1KXPA 4ILHA 4CJPA 3NGUA 1QAXA 4NYNA 1ITGA 2VASA 4TLRA 1OMSA 3MUVP 1KAZA 2D7SA 3HSGA 3SCKE 2B3TB 1IR0A 5FLXY 3Q7CA 4EYHB 2WVBA 4Q44A 1SKWA 4DR7F 3NFAA 5CD4H 4RUBA 1HWIA 2OFHX 5E3CA 1FXLA 4ZJQA 1VQLS 3H5XA 2KJWA 4TU8A 3O6QA 2P9PB 4YOWA 2R2UA 2E7WA 2OKQA 2B9XA 1GLJO 4I6MB 1G3OA 1FRJA 1ZZFA 3THXA 4CERA 4BC2A 1ZZNA 2LECA 3BN7A 4OPAA 1HWUA 1RKIA 2XRIA 3VQAA 4JI2F 4M3YA 1T9WA 3K5LA 1WC1A 3L4QA 4Q2LA 2W8KA 3RMCA 4BLGA 5EUHA 3DDIA 2ZH5A 1HNIB 3RWUA 3SAGA 4BACA 4UOCA 1UCNA 3BGRB 3K5MA 1YRTA 3C6UA 5AQSA 4M94A 5FPDA 4H4KC 1ZBFA 1LWCA 2WHOA 1HPZA 1S6PA 1J2VA 4ILGB 2XS5A 4F4WA 1EB0A 2KRBA 3VEZA 4Y2AA 2XLIA 3R5GA 4PKIA 4UQGA 1HNXJ 4WYBA 2FHJD 1FRKA 1GMWA 2W40A 4KFBB 1Q16B 4RCHA 1EKEA 3UN5A 5BR8K 1BY9A 1S0VA 1NGJA 5A8KB 4DV5K 1RT4B 5HN0A 2ERRA 3VCDA 2LEBA 1VK0A 4LSLA 3QNWB 2BJ8A 3VV2B 2E88A 2AEFA 2C2OB 2DH8A 3DXMA 2ATCB 3QIDA 4FS1A 5DGAA 3G4SS 1K0VA 1TL3A 1XMQF 3M30B 1KRPA 2DRBA 5HRSA 4RUHA 1WDTA 1NU0A 1ZM3A 4RW4B 3NL0A 3KK2A 4N5SA 3A8YA 2VPYB 1G7CB 3D2EA 4QWEA 4WXWA 1RTZA 2DD8S 5DDPC 3CCQN 1NDPA 5GAEU 1BO5O 1UTAA 1H72C 3LAMA 2FVQA 2QZ8A 1RLDA 4GKJJ 1HKBA 2H5JB 1EXQA 3POTA 1Z1ZA 1LK5A 2IAJA 3DAWA 4JKFA 3QRQA 1FRHA 3SMPA 3A4TA 2RDIA 4FYYB 4CJ5A 4B17A 2PIIA 1QQMA 1JIHA 4J9SA 3WQTA 4NO7A 1UW4A 2XMKA 1MN9A 1YJWS 4M7XA 4L3KA 3IS9B 3CVKA 1XMBA 3SXLA 4KREA 2JWNA 3MR5A 2EC0A 4ZIWA 1SQEA 3BKTA 1WC0A 1WF1A 1TYQA 2QT7A 2E6LA 2VFUA 4ILLA 4OLOA 4ZLPA 1M5SA 1YBAA 3J80Y 1Q8KA 1RDUA 4FCYA 4ECWA 4OI3A 3W2WA 4H4MA 3F41A 2P9IA 1YJ7A 2ILYA 1RT5B 1MWZA 2QMWA 4W5TA 4NLYA 3H59A 3CMQA 3NY0A 3U3YA 2GIQA 1RZMA 3F5TA 2YWGA 3B4DA 5C2DA 4B3TJ 1W7WA 2B4PA 3KHHA 3DOLA 3RBXA 1F21A 3SI8A 4TVAB 2I5JA 4DG1B 5MAOA 3L3CA 2OO4A 1FJGF 3OFEA 3TPQA 2I2YA 2V2VA 1J53A 4CO2A 3WZ0A 1VQ4N 2ASLA 1NKCA 3CTRA 1S1XB 1Q7YT 2NRHA 3H3NO 1YIJS 1U25A 2J7KA 5ETKA 5LMNJ 1WOSA 4AD6A 2V94A 1G6BA 1FKPA 2O4IA 1NEEA 3R7SB 3CIMA 2VPXB 3TYTA 2IM2A 5H9EJ 5CHIA 2XWYA 3I55N 2LEAA 3QO9B 3VR1A 2O8CB 1RDRA 3MX2A 5KI6A 4M5IA 5LMUF 3VQPA 2F8EX 1T02A 4ES1A 4E89A 1IN0A 2ASYA 4X62J 4U8YA 3ZTSA 4JKEA 3NWRA 3FMBA 2KVQE 2FSJA 1RT3A 1GLEG 4FW2A 3D7SB 3DDNA 4DL3A 2FSKA 2J0SD 4ED3A 5IC6B 2XLJA 2OCEA 3M6WA 1GX5A 3CFRA 4CGGA 4HR2A 1GH8A 4BROA 4L76A 3VENA 2ZE2B 2XHCA 2OPRA 4DR7K 4LBHA 1PKUA 3DFEA 2GW8A 4IH5A 3E8OA 5C24B 4LFBF 1Z25A 1T11A 1M5PC 2KN4A 3JSMB 1T3NA 2QMXA 5IT4A 2QK9A 2RRAA 1OY8A 2IS3A 1REVA 1FRXA 1TKDA 3ENOA 3TARA 1NM2A 2MLXA 4CJUA 5C10A 1LQ9A 3QLHA 2GX9A 2CDRB 2RD5C 4CHQA 3V81A 4LF2A 2QEXS 2AJFE 2M7SA 2IAJB 4RL1A 2HNZB 2E7XA 4O3QA 2GQCA 1HKAA 1V6HA 2G8KA 2ZWPA 3LP2B 2MZRA 4LFAK 2FVRA 2MZQA 2CPIA 2EKNA 1GX6A 2E1AA 4HT7A 4JI1K 2MJUA 3PVXA 3QGPA 2UVVA 1VQMS 3AVIA 2CXEA 4PXEA 4ZCIA 4PG6A 4AHSA 3LDOA 3FR0A 1U24A 2HBYB 5HL7L 1T3OA 4DQ8A 4AL7A 3LP3A 3P6YC 1NK7A 3D28A 1HUXA 2GV9A 3R97A 2WW8A 4DSFA 3G4SN 3R2DJ 3OHAA 4X4OA 4DSLA 3ZTPA 1ZAVA 1S59A 5I3QA 1KAYA 3ZTQA 2NLWA 4ELUA 3K9JA 3QWUA 2CWKA 2MEWA 3CCQS 3IG1B 4H0PA 3QEWA 4OX7A 1CS4A 3DGPA 3TZYA 3C94A 2ASMA 1H2UX 4CH0S 3HBTA 4BDZA 1FE4A 1JJCB 2OTJN 3EE9A 3MMVA 1SQGA 1FKOA 4DR4J 3DXBA 5BRDA 1TK5A 2E5LK 4ZS6A 2E66A 4IOAQ 3SUOA 3GG1A 3BSAA 2QMUB 2O01C 2HNDB 1N5QA 1NJZA 4WKRA 5E5NA 3O1BA 1DQ9A 5IT9O 4NRUA 3N79A 1JCFA 3JAMU 1QSLA 1VSKA 3U4LA 3G0ZA 4CI6A 5KFSA 4WQ4A 5HJYA 1VQON 2ZBRA 2M0GB 4I6MA 5HP1A 4DR3J 2VICA 5KQDA 4U96A 1IBLJ 3HL8A 1D0EA 3GYNA 2LYVA 3MN6A 3U1LA 2PFDA 4OX6A 1WORA 4QR2A 2BE2A 3LF0A 3HT3A 1RDDA 3GCXP 2YX1A 4CLTA 4JV1A 2O8EB 3D3CJ 4CO0A 3IM9A 2MB0B 3NH2A 2C1EB 5D4PA 4DPUA 4ZKAA 2CFXA 3W8GA 3MPYA 1D9AA 3TWHA 2OHDA 4RLEA 1R8PA 2LEPA 4LFCK 3IRXB 3QIPA 2A41A 1JXEA 2JZ5A 3SSQA 3M6XA 2QM1A 3UR0A 1VQMN 1VGYA 5B0FA 2M8DB 2FBYA 1RCXB 3THYA 4O3RA 3PFEA 1APSA 2KH9A 3IA0A 1DQ8A 3KVGA 4PABA 1T03B 5E41A 1M90O 3OVAA 2HQ3A 1G15A 2B0GA 1EETA 1S57A 4L75A 1CJTB 3MEDA 3EZUA 2PO4A 1TKXB 4LREA 3DU5A 3UKRA 1HA1A 4HTIA 3H5YA 2RRNA 3K57A 4OHZA 2BKPA 3A5NC 5GMKa 3EKUA 2MLYA 3CCRN 2XMJA 2A6OA 2CAJA 4LVOP 4JI3K 3RR7A 2Y1LB 3AVCA 1ZH5A 1Y9OA 3T1YF 2BGGA 2OSRA 3IAS9 4E1JA 4WP3A 3ZT2A 4EK2A 1BQNA 5KFTA 1RBRA 4CJ4A 3AJ1A 3RB3A 4WFXA 4K4TA 3OTOF 4MO4A 3D68A 4EAHD 4KAZA 1RBVA 2WSFC 1FJ7A 2CYYA 3P31A 5T7BA 3AAWB 3HD2A 2YNFA 4CYUB 2NRWA 4DXLA 1KNZA 1FD8A 1C1BB 1XNQJ 1AFJA 3OTDA 1TZ0A 4D3HA 3Q8PB 3H2VE 4Y2CA 4NLSA 4RX6A 2W9BB 2CNLB 4ZTFA 4G1PA 3M8WA 1BHLA 3MN5A 3OYIA 2G13A 3SSRA 3H7HB 2VG7A 1U49A 4CJ3A 5KOXA 4C8LA 3IMQJ 2GHVC 4NX9A 1TL4A 2ASPA 4YY3F 4PXBA 2E1CA 4LRFA 3NMAA 2C2MB 4LF4K 4PYDA 3W0LA 2OPSA 4YOEA 3NGKA 3GV5B 2AYBA 5L8RC 4TLQA 2J4RA 4CJRA 3SUNA 1TMMA 2D3O1 2JLEA 2WCXA 3BO2A 4RNFA 2CG8A 1PBAA 1DARA 3D3BJ 3CJ1A 3DXKB 3AVHA 1CSJA 4E7IA 2HFOA 1B0VA 2GCFA 5F8JA 2QXFA 4O3PA 2F63A 4FJHA 2Z0GA 1FWLA 5T7LA 2XM3A 3NGRA 3NHGA 3RMDA 3FBCA 3MCPA 5CZ1A 4F3TA 3UIQA 3MGJA 3C8YA 5AQWA 5M1FA 4MAKA 4CBUA 1RU1A 4I68A 1ZM2A 4FBUA 4CFAA 4URSA 2NRXA 1JCGA 4ZCLA 5ITHA 4O8KA 2FJVA 3FNNA 2BEFA 4RW4A 1H2VZ 2FJXA 4DS4A 3AD9C 1DJ0A 3GYGA 5JVGQ 4IO9L 1DLOB 2FZCB 2OANA 3I55S 3EICA 4FXWA 1FJCA 3NF9A 2I7NA 3LGNA 1SBRA 1P9QC 4KGKA 1LWFA 5IV4A 2KJVA 2KM8B 1W97L 1M1KO 2C2KB 3GG0A 5KG5A 4YHHK 4B1UB 2YKOA 3KK1B 3GL1A 3W5ZA 4OX8A 4JI1J 3BZKA 1HFEL 4XH1A 4LFAF 4OGEA 5B08A 6AT1B 3MR6A 1S6UA 3ZZRA 4C0HA 3R5BA 3CCLS 4KTQA 4C4WA 1QAJA 1VSHA 3CD5A 2Q79A 1M90T 5HMXA 2IRYA 2IVYA 1C6VA 2CNNB 2OTJS 3RAMA 3UCUP 2U1AA 4MKYA 1HNIA 1UJ4A 2Z4PA 3QMQA 3DHXA 2HYIB 2OPPB 2EFGA 2BW7A 1BCOA 4DV4F 1XMOF 1IBLK 1RI7A 3TABA 1LFPA 4PQAA 4NXNJ 1N5YA 3T9ZA 4KSEB 5E84A 4QYRA 1OH5A 2W2PP 3BQ2A 2MJNA 4LD0A 2R8GA 2R8JA 4G3IA 2R2RA 1VR6A 3UB5A 3NNHA 3HI9A 2DKOB 1IM6A 1ROFA 3VF6A 5HVFA 1S1VA 1N54B 5F0XA 2DHXA 4O5FA 4R8UA 1Q82O 3EUNA 4WU2A 3MDQA 4IJNA 2JFKA 5HK4A 1MU2A 2E5LJ 2FVSA 3VERA 3ZZYA 3GJRB 3C46A 2X1GA 3O1LA 1KTQA 5K8NA 4FJNA 3N28A 3O1WA 4FPIA 2UUBJ 2NZTA 3GP9A 3R5JB 3L8BA 1ASVA 5F8HA 4FWPA 1RUSA 3ZXWA 3F56A 1FF2A 5KFGA 1S79A 2HHVA 1C2PA 1S10A 2BUNA 3RRKA 3DMJA 2O66A 1G1XA 3EVOA 1Q4RA 3NH0A 5AZJA 4BRFA 2CQ3A 2L9NA 1PIEA 1WC6A 4B3TK 1JLGA 1P1LA 1TKZA 7FDRA 4UT4A 1JL2A 2XI3A 4I1TA 2GVDB 4QW9A 4BC4A 3IWLA 5K8OA 1GLLO 2EEYA 3PW0A 3AHPA 3C3LA 3FGUA 3CC4S 3D6MB 3WUHA 4U6PA 1UKUA 4NWBA 1BMQB 2D0PA 3ZO7A 4H0XB 2ZBCA 5KQ8A 1N33K 1SB6A 2FY1A 4C8YA 4WCEL 3HFKA 3UDLA 3CMES 4AH9A 4DSEA 2AF6A 1CVJA 1SV5A 3IAM9 2DFFA 1F5AA 4KI6A 3W5XA 2OFGX 1XK8A 4I6WA 4LSNB 3ULEB 1U1KA 5CAAA 2XY6A 2HQFA 5AE3A 2DIUA 3TUJC 5LMUJ 1VQLN 2A2DA 2DNMA 4OZ0A 4ZVGA 4RKUC 3E2EA 2G1HA 4RW6A 3T1YJ 5KT3A 3P45B 3DCAA 4DN0A 1KWMA 4KHRA 1KFDA 4OJ1A 2HVHA 3O44A 2ZE2A 3KUHA 3SUPA 3CFPA 3F0NA 4WFNL 3AOCA 1P8GA 5E0OA 3THYB 2SXLA 1WG1A 4KKOB 2CQCA 4BS2A 2Q36A 3HSZA 4ECYA 1RT2B 2CG4A 3ILOA 4M63A 2VDHA 4I2QA 1AZSA 3BM7A 5ETLA 4DV2J 3M05A 3VTIA 4NZ7A 3RR8A 1RWNB 2F65A 3CSKA 4F3QA 2PI5A 4FK4A 4JI6J 1VBKA 3UQSA 3ZX0A 3SSSA 3NAHA 2CZVC 1OWXA 2DT9A 4O0JA 2V2QA 4E8UA 3BKUA 1YJ9N 4CJLA 4NASA 3TU5A 4RR5A 4DV2K 4USUA 1BISA 4NA2A 2E9RX 4WBFA 1GLBG 4JK7A 1ULRA 2DXFA 3MFIA 5AQYA 2OPQA 3CCTA 4PG4A 1U1PA 3AY0A 3CJQA 1CC8A 5IFMA 3ZSZA 1JKHB 3PO4A 3TTCA 3ET6B 2K7KA 4RJVA 3JTNA 2VKRA 1DTTB 4B3RJ 3FBBA 2GELA 4CWBA 3QT6A 5HAOA 2HAFA 2HHXA 2HNYB 2ZITA 3R7NB 3NF6A 3ZEUA 3QT5A 2ROEA 3EXYA 4CLYA 4OX9K 1JK9B 2IJRA 4LF7K 4LJMA 5HBMB 1HNWJ 1KVJA 1UZDA 3ZSXA 5AQVA 4QBUA 3LWLA 4DL2A 2A6MA 3U9DA 4FJKA 4W92B 3UPFA 4PPZA 5T41A 1KHVA 5CYQB 4CFCA 2AYGA 4F25A 3O9SA 1UA1A 3AVFA 2BV3A 4FJGA 2UV8A 4L73A 4BHQA 4F4XA 2MZSA 5ETQA 1BG3A 2H51B 1WG4A 3B82A 2KDOA 4YR3A 3HVAA 2DYAA 3AOAA 3D1OA 2LQ9A 1VBZA 4CK1A 2X3GA 3S6EA 2KT2A 3NF8A 2MQMA 1HQUB 3TQEA 4J9UE 5KFYA 1RADB 3IM8A 1N34K 1DFDA 2E8AA 5G0RB 1ZM4A 4CZKA 3VAKA 1X9MA 4QOZB 3L9ZA 2BH1A 4P71A 1U4BA 2P9SA 2FC8A 2LFVA 2AIRB 3RTVA 1HNWF 2PD1A 4JI4F 3S3OA 3VA3A 5AQJA 2X51A 2FZGB 2GIFA 1OYEA 2V6AA 3ZSQA 3ZSOA 4B9UA 2KZZA 1BHNA 3DNCA 1TYQB 2BUPA 4JI0K 4DR6K 2PEBA 4HEA9 5E7OB 2M8HA 3LPUA 3QGIA 4NMXA 1SL1A 3NNAA 1K73O 4PWWA 4N8OA 2ILZA 4DV5F 2QLXA 5L46A 4BDPA 3NBPA 4DWIA 4BR5A 1F3VA 1A6LA 3MPWA 2CQGA 2YWKA 4ZP9A 1F9HA 3RGIA 1JLBB 1MSWD 4CGDA 2ZWHA 1HBNA 2GHPA 3NGSA 3DXKA 4OYBA 4CNYA 3QEXA 3RB0A 2BRLA 2DPJA 3MXMA 8RUCA 3TAQA 2W7PA 2CQHA 2MKIA 4EU0A 5ETRA 5C42B 3AA4A 5E2QA 2AKWB 1BUPA 4M8LA 5F9NA 2EG1A 4R0JA 3N5BA 2H3GX 2A3ZA 1KVBA 2RQ4A 2B56A 3JXOA 4DSKA 1KVCA 4U7BA 2K06A 5B0GA 4H4OA 3OTCA 3OT9A 4LR8A 1FFSB 3KLHB 4Z4IA 5CH7B 1OQ3A 2C22A 4ECRA 4K2JA 3P39A 4MYUA 2XY5A 3ILIA 1QQOA 1P90A 1N6QB 2GVZA 1BWFO 4CLZA 2FHMA 2MKKA 1Y3KA 4RW8A 1QHAA 3R1XA 3ZNJ1 4RW8B 3HPOA 1RABB 1KOHA 4JS5A 1N6QA 2B7BB 3N6MA 4DTRA 2CJ9A 3M3ZA 3QJJA 2OZMA 2E9TA 1Q95G 4IZ9A 2ZWOA 1XC3A 2XYPB 3UDVA 4PR6A 4ED2A 1HPZB 1S6PB 4EZ9A 4LF9J 2EWSA 1G99A 3MAQA 3V1QA 3GWCA 1WNSA 4CF2A 4H4OB 4YS2A 3PRBA 5IC4B 2NREA 1BQNB 4AL6A 4P73A 5CYMB 4NCBA 3TSUA 2H9ZA 3D2FA 1FRLA 2UUAF 1KD1O 4FNHA 1GFWB 1XNRJ 3QFUA 3PSFA 1VRQC 2VA3A 2AD9A 2XY8A 2OGUA 3V6KA 4XPEA 2LLZA 1P1TA 4OYZA 4GRSA 4LF9K 5JXSA 4CIOA 4RUAA 2DY4A 4FLVA 2XS2A 5HMYA 1WD6A 2YKNA 3UD3P 4YB7A 4NLRA 4IH6A 3QICA 2FBVA 1N5VA 3AO1A 1XNQK 4CK3A 4IYQA 3OVBA 1TFWA 4JBCA 2AWZA 2IDLA 5AQFA 1FERA 3Q22A 2I5JB 4DG1A 4B9NA 4HVJA 1N56A 1IKXB 1FEEA 2P9SB 3M6GA 5HROB 5KT5A 3EVMA 3A3PB 4B9VA 1VSEA 5AFUH 4Y1CA 3WX8A 3V9SA 2XC9A 2Q0UA 2IA6A 3O9QA 3KLFB 2B51A 4J2BA 4EFAC 5EX5A 1B99A 5MLCQ 1VQKS 2KFNA 1A5XA 3QAEA 3SV3A 4FSVA 1W2BM 2IRXA 3MAAA 4ZVTB 4B3TF 4OV1A 2I8EA 3H4DA 1B64A 4F7VA 5KFOA 1I1GA 1LOUA 2YWWA 4ATNA 2E5LF 3M7VA 3FLCO 4P6QA 2UUTA 4CTAA 1T44A 2DNOA 3W2VB 1V9OA 4B3RF 1S0MA 2J9EA 3HPHA 4A4JA 5BPNA 4K4WA 2G8FA 2VH7A 2EW9A 5HVGA 4KH4A 1HR0J 2V4QA 3ZETB 1JXVA 5GAHP 4CBXA 3C2PA 5B0BA 2DCUB 1GOCA 2AZ1A 4DV1F 3DLGB 3UVJA 2W8LA 5C12A 1Y5NB 1JLBA 2H5IB 4A8KA 3BF4A 4C0BA 2CPEA 4ZLNA 1EAYC 1JCEA 2FLLA 2BJ3A 2WVDA 4JI7K 1OVYA 3ZZOA 3H1QA 2HBMA 2HAIA 4FZZA 5KFCA 3THPA 4ZVRB 4F8RA 4LIRA 1RHQB 3ENWA 2P9PA 2VA2A 1F5CA 2BJDA 1P27B 9RUBA 4Q45A 2Q6BA 5A8RA 4DZ6A 5FRNA 2VHGA 3JS9A 1TL1A 2GGPA 2RKIA 3GONA 3W1YC 3GCWP 2DNGA 1LK7A 2P9NA 3ULDA 2WB1D 3OTBA 3EXCX 4DU3A 4PXDA 3QINA 1F1BB 2WBNA 3HP6A 3PYDA 1GLFO 1YSJA 2V51B 3L6QA 4WPAA 1HRHA 4NLUA 4ES3A 4BC5A 2YVSA 5M1NA 4HTLA 1RAHB 4JD2A 2HMIB 3VZHA 4CLWA 4FWLA 3G6XA 1NB7A 1KVIA 1B92A 3IR5B 4FJLA 1HMVB 3WXLA 1U1MA 2ZJRQ 1S1UB 2DGTA 4R79A 9ATCB 2ZZTA 3SBGA 3GILA 3SMSA 5E3PA 2BM1A 1LWEA 5EGYA 3OYCA 3RVCA 1J54A 4DR2J 3BF1A 3T69A 2HGNA 4C2MA 2JWLA 4ZN1A 2ZGZA 4CM2A 4CLLA 3O4WA 1U7LA 4GMKA 2ROGA 1FXRA 2KM8C 3LL3A 2MQ8A 1T05A 4B3SJ 5F0WA 5JICA 4ZVSB 1VSDA 3J7AN 2W2MP 2A1SA 2ETJA 4FOEA 4USTA 1RBSA 2R7RA 1CJKB 4ID5B 1T9VA 1ZOTA 3K2YA 3FC9A 3L7OA 5LMUK 5IV3A 3BQ0A 3EGZA 3SDEA 3W3DA 5GMDA 1U0HB 4DV7K 4RG8A 2YJFA 4GVLA 1VFJA 2HHQA 4DF8A 2B8QA 2P9CA 4BE0A 5FLXO 4LH5A 1L3VA 1S72S 1RAFB 4QIWD 4Y1DA 2AU0A 4GVEA 2MKYA 1E6YB 3M9MB 4TQSA 3KOAA 1NMDA 4IR9A 3ZTRA 3W3SA 3GIMA 3SNNA 3QEPA 1R7IA 1SJ3P 5E3QA 3TZZA 4USVA 3C7NB 4JKDA 1HYSB 2Z2MA 2WVFA 4QU7A 1EKSA 1WOPA 1CLQA 5TKWA 4DKWA 5THWA 2VPZB 4ZIVA 4DHYA 3SQ4A 4QZVB 3AA2A 3DKDA 3WXIA 5KG0A 1Q53A 4AHRA 4MLHA 5IQQA 1ACMB 3VPZA 5IQ6A 2H48B 3SJJA 2B6AA 3H5UA 4OZNA 4ZOSA 2ZNYA 5T7LB 1V5IB 1HNXK 4OLPA 4OZ1A 1VBYA 2W9CA 1QZ5A 1V5VA 3WX4A 3T1YK 4O0IA 5CABA 3V2UC 2ZH6A 2J8SA 4YUDA 1KC8T 4NCGA 1KLMB 3PRDA 4ZVUB 2OPPA 3FRZA 2R3VA 2JEJA 4LF5F 2F8SA 1S1WB 3CCZA 3R6MA 3A12A 3I9ZA 2FXUA 1KONA 3UN3A 4KO0B 1JXLA 3VQBA 4JI7J 4H4MB 1X4GA 4A8MP 4FWOA 3PSIA 1R43A 3K5OA 2YPYA 1UETA 2VZ9A 2HVDA 1FKAF 1VLOA 5D0HA 2CVIA 4PKDB 2IMOA 1HBUA 3T5JA 2JFDA 5DGBA 2DISA 2K2PA 4C8OA 3VN5A 2J7UA 5J2NB 5C2GA 1IO2A 1VIOA 5IZHA 1RHUB 1WJ9A 2IM3A 2Z30B 3KK1A 3DLHA 2B4JA 2LSNA 2CZ9A 4TQRA 3HZGA 4TU9A 3UDCA 1F3FA 1S1WA 3C14B 5ADZA 3QERA 3PUFA 3FFIA 4IOXA 4NXMK 2DTUA 4FM2A 5J2MA 2P9GA 3P83D 3ZX2A 1RTJA 4GKJF 3S41A 1HNVB 1XMQK 3AVGA 4DR4F 1Q86T 1YG0A 1QVGM 4NRTA 3TAFA 1XBWA 5FPMA 4DV6F 5D15A 2Q0RA 3BGLA 4DX8H 1CPZA 3MM7B 5BR8F 1KBRA 4LF1A 2C3MA 4ZITA 4F3OA 4HTJA 3NOGA 4F36A 1YJWN 4YOVA 2O8FB 3CJSA 3V9ZA 1RWUA 3QETA 2X78A 4C3KA 4XH4A 4K4VA 4K0KK 3PJWA 2J9CA 4DR3K 3KJFB 3O9TA 2IC3B 1NK0A 1FX2A 4MKBA 2IC3A 2P5OA 1ILYA 3ASMA 4YDDB 4DFPA 4NI2A 4A8YA 3TSPA 2BABA 4OI4A 4DB3A 2DRDA 2F8MA 4USJC 1Y10A 4J9PA 4BR9A 2XYGB 2B9WA 3OUYB 3IRWP 4GVMA 1SJ4P 2NS1B 1U0HA 2D69A 2WOMA 4LC9B 3NP5A 5D8HB 4ALZA 3BJYA 3NWGA 4MMOA 4LSZB 4BDYA 4W5NA 2E6MA 5KG2A 5L1KA 1IG8A 2XMAA 5C15A 5GADP 4B1YB 1UVIA 3PYGA 2F4FA 4LBIA 4I6YA 2J5AA 2NUHA 4PKGA 2JOQA 2B4UA 3CD6S 2HURA 4CZJA 1X31C 1QVFM 1DGKN 3HD1A 2AJQA 1SS6A 2ZH3A 4C8KA 3GG4A 3D54A 3CCJN 5EU7A 4C11B 3AVKA 4DV7J 3TQ1A 4M3UA 4Y6IA 4M63C 1B70B 2LCWA 3NGZA 3VQ7A 2IDEA 5DM6Q 5AQHA 1XNRK 3KG0A 4M5NA 3GV8B 4P7TA 4H03B 2K1RB 5CZVA 3J81j 1YLXA 5IOLA 1F9EB 3IDHA 3BBBA 4B9LA 3TVZA 2OAUA 4ED4A 5K8PA 2G0JA 4IKAA 4HACB 4Q2MA 2Z1IA 3CW2C 5AZIB 1TU0B 4DR2K 4DFMA 4H54A 5J2NA 2ZUAA 1Q78A 2QSWA 1EARA 1VRTB 4WTYA 4L74A 1T03A 4X4PA 1DTQB 1NHUA 1FW6A 4K0KF 3MEGA 2FHOB 4JI8K 2FBTA 1O5JA 5D77A 1LEOA 5B7WA 3M5RA 3L4BC 4RW9A 3TJ9A 3H6EA 2CGKA 2D4WA 1RQ0A 2HF3A 2OEJA 4PQUB 1F0XA 2ZDPA 1HHTP 1VQ5S 4QWAA 3MPUB 3LPEA 1R8HA 3OFHA 1SH0A 4WQ4C 4C23A 2P6SA 3KJVB 1WSEA 3A5LC 1HBUB 2HZAA 3OYEA 2DITA 4DTOA 1N33J 1JJHA 1WSRA 4DQIA 2HRUA 1B4SA 1RAEB 4QQBA 2RF2B 4ANCA 4NXMF 4FWRA 2VDIA 2QEXN 2HWHA 4O8UA 1IXKA 4JEPA 5IT9Y 1DURA 1TL7B 3E3XA 2YNIB 2GX8A 1U1NA 2FD2A 2B4VA 4DL6A 1HR0K 1WOQA 1D9DA 4I69A 3CG7A 4OHVA 3F73A 1JMTA 3QLHB 3H42A 4E3SA 3NS7B 3R3TA 1P6TA 2YKAA 3CJBA 3LO3A 2XSFA 4OO1J 4DPWA 1PBUA 3Q8SB 3ZZPA 2JH3A 3PM9A 2WBMA 1D8ZA 2KT3A 4J7CA 1K6YA 4KHSA 5KFWA 7AT1B 2HBQB 1U2RA 2W1BA 1S5JA 4GO5X 5J2PA 3IG1A 2EPIA 2ALZA 4DBQA 3NE6A 4KRFA 3C7NA 4UQTA 4LF7F 4TSXA 4JI6K 4IOBA 4M5GA 2D5RA 5SZTA 1WKKA 1RHJB 2RS2A 2HHHK 1L3SA 4R25A 3ITHA 4DR4K 2WRMA 1IKWB 1R59O 3KK3B 3UNGC 3FGVA 3PHTA 4I2QB 1AZSB 1B9DA 2H5EA 1N34J 4OYMA 4ISGA 4DV2F 2P9UA 4C1NK 4KKOA 2D3OR 1U1RA 3L0QA 3C6TB 4GKKF 4EIAA 3LGHA 4K42A 4WCEQ 2QA1A 1E6VA 3V4MA 4JKBA 3QNNA 1HWLA 5AJ3J 4H5NA 1UVJA 2G2OA 3VEVA 1HI8A 3ENVA 3OFGA 1Y7PA 2UXCJ 3CCUS 2IY5B 2G0CA 3R1LA 3O3HA 3W7BA 1OH6A 2N4DA 3TAMA 4M45A 1VQOS 2OIHA 4OKJA 3O3GA 4DLGA 3CDEA 3JQKA 4O3NA 3D6TB 4RPFA 1ZS6A 4ED0A 2HBZB 4FZVA 5IT9U 4FJ9A 2P5GA 5KTQA 5A6PA 1XMQJ 4A5AA 3WHIA 4M5KA 4PZVA 1FDAA 3CDBA 1WBDA 4CH1A 2NLXA 2D3UA 5LJ3Y 4OVLA 2ZH4A 3O2IA 3VAGA 3H2UB 3D0GE 1T6DA 1AYEA 3KDOA 3C16B 2W6LA 2HK2A 3JYTA 3MPVA 3VF4A 5HRNA 2ZDOA 1TMJA 5D0EA 4USMA 3AD7C 4HDHA 1YF5L 5CA5A 1ZBIA 2C3OA 5D0RA 3BYPA 4JI5F 1NDCA 2GMLA 3HYFA 5KG6A 4FJ8A 4H0OA 5HLFA 2J9DA 1K8KB 1BD6A 1XR5A 3DLLQ 1VJWA 4JI8J 3MXJA 4TN2A 3GDQA 1WHYA 2VU5A 3MF5A 1YVFA 1NGEA 4FLUA 3J7YU 3VETA 1X8DA 2GIRA 4BRDA 4JI5J 2VOPA 4B1XB 4YDXA 3VGUA 2NXEA 1I94K 2WVCA 5A8RB 1IR2A 3K5NA 3OY9A 2O8CA 4CRJA 4OL8A 1X0FA 1RFQA 1WSFA 1PC4A 1ITPA 4XDCA 1I3OB 1HLWA 2R9LA 3BDEA 2RH3A 2F9JA 4DMZA 4A8FA 4KHPK 1BDGA 4I6AA 1EJ7L 1RKJA 3CD0A 1UWBB 2HBLA 2IFXA 1Z05A 4X62F 5FROA 4MKAA 1HARA 1LXNA 4LH4A 1I51B 3N4PA 1UW9A 3CDAA 4ISEA 3OHBA 1XC9A 1K73T 5C0YA 2HIYA 2CPHA 1HBMA 6FDRA 2Y3YA 4FXDA 4AFFA 3HJFA 3T19A 1HQEB 3UE2A 1S49A 3LANA 2MXYA 4WIQA 4E7JA 4Z37A 4OYPA 2RDJA 2AEJA 2MKHA 1S1TB 5EOYA 4CJ7A 5J1EA 1D1UA 4F2SA 3MM9A 1T8EA 1TKTA 3ID8A 1TKTB 2MTLA 4K4SA 1JLAB 4ICLA 4FW1A 4LFAJ 1I5OB 3T1HF 2YCHA 1HHQA 4DV1J 1Q86O 4U67Q 4BWJA 5RUBA 1UP1A 3ZFVA 1F5BA 4FLWA 4HUEA 4U95A 2VBXA 2EI5A 5HBMA 3HHLC 2CQ4A 2AP6A 4CQ1A 3PR5B 4Q43A 3SZ2A 1EQMA 1VQKN 4UY8T 4Z4CA 3TAMB 2L3MA 4FF4A 2DH9A 1MNEA 4KBOA 4DTJA 3UNYA 1T9UA 1A5VA 4R5PB 5DQIA 2KO1A 1GT8A 4HWIA 2G2ZA 3CJ7A 1NGBA 4GV3A 3MD1A 5AQGA 2O1PA 1CG2A 2FB0A 1HQ2A 2W01A 3KLVA 1VS3A 1YXQA 4IFVB 3VQSA 3CCRS 3E01B 1C0FA 2YI1A 4JKCA 4OX9J 3MAHA 4F50A 2NCKL 3ATVA 2LXFA 3D2EB 3QNOA 4LFBK 4CHPA 4C0OC 4KHUA 1T7PA 2GS8A 3N6LA 2WONA 3OR2B 2HGMA 5FLXU 4DR1F 4FWNA 2RQKA 1WC4A 2VBZA 5AXMA 4E0DA 2GWKA 1BQMB 1NSAA 1YRUA 1X5TA 3HULA 3CJ8A 2HVZA 4N7TA 5A8KA 4CJKA 4IKFA 4TY8B 3TUIC 1XWLA 1NZ8A 1YJRA 2V9KA 2A3JA 1NK4A 1S3XA 1NB2A 2V8DA 3HTVA 5JMVA 4UUXA 3CIPA 4JRQA 2GVZB 5EDWA 4RWTA 1SC6A 3I8BA 3MEEB 2IYIA 3CC7N 2ZZMA 5K14B 2I0XA 2DCLA 2F5GA 3HVWA 4GVBB 3IS9A 4URGA 2XMVA 4NYPA 3O3FA 1WACA 4ZVOB 3I4PA 1LXJA 2YWHA 2W4CA 4FZYA 1IBKK 4DR6J 1JJ2R 1MWKA 4FYXB 4UZBA 2HOEA 2EFVA 1S0NA 5J2QB 5KAKA 4A47A 4K50A 2ZVIA 3CC2S 2YH1A 4KR0B 3EDQB 1HYVA 2V7ZA 3OYDA 3NBPB 3A3NB 5G0RA 1OQ6A 3QB0A 4KHPJ 3G8SA 3Q24A 3GIKA 1YVUA 2ZC4A 1S7HA 5H9EK 1GXUA 4BBYA 2G8UA 2R7UA 2IJNA 1W7AA 4FS2A 2KTQA 3LDQA 3HZEA 3O9RA 1SKUB 1VK3A 3SQGB 1L5UA 2M52A 4NZ0A 1B0PA 3WT0A 4EFHA 4CHOA 4EP4A 2EWHA 2F9TA 4C9DA 3NS5A 4H0VB 2DJWA 2OMLA 3ITHB 2I9SA 4E7HA 3BN4A 5EN1A 2GFFA 1KR4A 1RWOB 1TAUA 4JV0A 3EEQA 4LRCA 4ZN3A 4USWA 1QVGR 1S22A 4CCHA 4CEDA 1SXLA 2EC2A 2XGQA 2JLGA 3LDPA 1OIAA 2NZCA 3O80A 3OYAA 5CHCB 2QLBB 1YZ6A 1MU2B 4DR7J 4JI0F 3NGDA 1LW0A 1P8ZA 2HQDA 3SDEB 4X4QA 5B0DA 1EIYB 1CULB 1FWKA 1WTFA 4TXSA 1TUUA 5HP1B 4FN5A 1OSDA 2Y8YA 4DPYA 4K5RA 1SC4B 5CZXA 2WTUA 3GTYX 2AHOB 4HDGA 1KQFB 2P9KA 4BRNA 3CCVN 2IVOA 2HGLA 1PC5A 4C7QA 3LAKA 2E4LA 2F96A 3CCUN 3EZOA 2W7AA 2P9KB 3L4IA 2H3EB 3OLAA 1S76D 2K3IA 1E4GT 3AAQA 1QAIA 2R7VA 2N7YA 2VFTA 1VSJA 3NCIA 4EEYA 1NSPA 3AGKA 5LMNF 3ZSVA 5KFUA 3KYLA 3SJHA 1JLGB 3I96A 2HVEA 2V5HG 2VQFJ 4YEAA 1Q79A 4ETXA 3Q8UA 3QT7A 5HQLA 4ZJOA 1U26A 2HSEB 2AYEA 4UY8O 1QE1B 4M41A 1M0SA 3BSCA 2QKBA 4TY8A 3NEKA 4OX9F 1VHXA 3AXMA 1DT9A 3NCPA 4B3MF 3TVYA 4AHTA 4Y00A 2X1BA 3SCIE 1HIYA 1KKHA 3ULEA 1X9JA 4OQJA 4K4YA 3KG4A 4N47A 4FPRA 2VQFK 4KBIA 5FJ4A 4BG9A 3UDEA 5CZ2A 2AW0A 2VC1A 2VFVA 3US5A 2DNHA 2OZSA 1NSQA 2BJ1A 2XULA 2CQBA 4J90A 3HHLD 3QATA 2OJ3A 2V4JB 2POKA 3LPYA 1S7IA 4C8NA 1GMWD 4HHUA 3ETMA 1N32F 5LL6d 4CO4A 1U2FA 3W63A 5B0EA 4ECQA 2UXDJ 4MT1A 2V63A 5J2MB 2CA9A 4V19X 2B5JB 1WEXA 4ED1A 1H38A 3H08A 4CNZA 2VOOA 3OV7A 1UPPA 4YDUC 4F9OA 4EMDA 3KLGA 2COLA 1T0TV 3RUBL 4CW7B 2RPIA 4IOAL 2XZTB 5EHHA 3CERA 1KC8O 3MCNA 4K0KJ 1Q9YA 2DK2A 2DNPA 4C8ZA 2F1FA 3IFRA 4AXJA 4LFBJ 4KHNA 1F60B 1HWKA 2BOAA 4OYOA 3WIUA 2DR7A 5CXTA 5DS7A 3SUQA 1KQKA 4NI2B 3QDKA 2XMTA 1S1VB 4C3LA 2YNFB 1UVLA 1KFSA 1VC5A 3CCWA 2KG1A 1YUWA 2E1RA 4LVNP 1RGIA 1U6ZA 4LT6A 5JS1A 4OKEA 4ECXA 2GMHA 1BWEA 3VMFB 4AQYF 3P3DA 4OYAA 3RRGA 4QCLA 4AUKA 3R1HA 2DR6A 1FT8A 2O5DA 1KAXA 1Y5IB 3E01A 2HK3A 1KQSM 3TUZC 4GV9A 2YV0X 4JKHA 1KCFA 3O5BA 2IRUA 3H2LA 3PEJA 1CZAN 2WOMB 4ELVA 4KPYA 3ILJA 2ZM6F 1DKGD 4DTSA 1Q8BA 4Y65A 4PXCA 3S01A 2PFFB 1RTDB 1SZ2A 1XHZA 4JI3J 4I2PB 2GNKA 4FM0A 1BQXA 4ZPAA 4XO0A 3CO9A 4E98A 5ETOA 3PYEA 2HBKA 3MEKA 4PUOB 3CCJS 4IRKA 5CYMA 4B8AB 2KG0A 2QWOA 3LUYA 1HJOA 3FCHA 5A6WA 5HRRA 4IH7A 2GUIA 3EPGA 2YJEA 4CK2A 2YKQA 3AA5X 3MD3A 1RT5A 2P9EA 5LSRA 2Y0BB 1JLAA 3TEGA 2VG7B 4KE5A 1G2EA 5JVHQ 3OSNA 1KVAA 2B4OA 1S9EB 3AVNA 1F2HA 4ZMMA 2IIRA 2QJ3A 3VQ9A 1PYTA 3DYAA 2V4JA 4DQQA 4C8MA 2WBRA 3BF3A 3VGLA 4KGZB 4E7KA 3HM8A 2CPYA 2XO6A 3MMJA 1R27B 3V6DB 4OZ5A 1MMNA 2UUCJ 3AB2B 4Y2KA 4F3MA 1YHQN 3UI3A 2V0NA 1NCLA 2IVPA 2CQPA 1L3KA 2ZKTA 3SQ0A 4OI6A 1BE4A 3BYRA 1RK8A 3QYYA 4CE9A 4OZ3A 4ZCKA 1SQFA 1JLQA 2CWXA 3GFHA 3KD1E 1WEZA 1J5OB 3PHEA 1Z2ZA 2DNNA 5ETMA 4JN4A 4ED8A 2R2SA 1TKXA 4O3SA 3GOIA 3W9JA 1WF2A 3HK2A 1Q18A 3ZC4A 1RNHA 1WHXA 1E6VB 2QO3A 3AA8A 5U47A 3NXZA 3EYZA 4JK9A 3W5YA 5CYJA 4USKA 3MECA 4LQ9A 3WXMB 2FGCA 3Q8RB 1N36F 4DHVA 1ZA1B 1XQIA 5K5MA 2PT0A 3UD5A 3OD2A 2XHWA 4DCJB 5GAHU 4TU7A 2YY3A 2IGIA 3EL2A 3KKSA 3Q23A 3ZT0A 5I4MA 4WFAQ 4RZRA 5AXKA 4IDKA 2QWPA 4HH0A 4F02A 4CESA 4DV7F 4DL5A 1IBLF 5GADU 2ZHBA 1KVKA 1SAZA 3UN2A 1UEKA 1U8WA 1K9MO 5AQNA 3ZZ0A 2XWXA 5JVGL 5J2PB 1C1BA 3BGUA 3J81Y 1SQKA 4BQZA 1UVKA 3A8EA 2VQFF 1S48A 1CULA 3OYJA 2BQ3A 5D0GA 4MH8A 4DU4A 2DEJA 4PA1A 3UWTA 4XK8C 4JK8A 2MHNA 5CCLA 1LAVA 4B3MK 4BRIA 3K5PA 4BY9C 1MROB 2YH0A 1UAXA 3BY5A 4QWDA 4YFUA 2MY8A 2L9DA 3KHGA 3CJ2A 5FPEA 4NE9C 3DN9A 1KTVA 3E9PA 4IG3B 4M5DA 3QFWA 1VQ5N 3NMUA 4P2XA 2R7YA 1RHRB 3LZIA 3U8XA 1BA0A 5DK5A 1CS4B 2WK4A 1F2GA 2CADA 3TP2A 4RWXA 3M2RB 3K89A 3BBCA 4FM1A 1YGYA 3FK4A 3CHWA 3FEZA 3RB4A 1SL0A 3KJVA 3QJPA 3QGGA 2P9UB 3M2RA 1GXTA 4CP5A 5DO2A 2J0WA 2OD6A 4ZVHA 4MK8A 3NAEA 3CD7A 3KK3A 2BDPA 4JI3F 4J5OA 4C98A 3IRXA 3QIPB 4E2FB 2BKNA 2YQ1A 1EZZB 1FNOA 3D9BA 2WUSA 3MR2A 4HCBA 4S0MA 4C48A 2WVEA 3SQGA 3U1MA 3FZ2A 4B3SK 4Z4EA 5GMEA 2EBEA 3D66A 2VJVA 2DXDA 4O4GB 2GAHC 1SCJB 2MQNA 4C97A 2I6WA 2CJKA 5ETNA 2U2FA 2XZWA 2XHBA 1RGVA 2RNEA 4K4UA 3A8KA 5BRHA 3J81O 4NLVA 4F0MA 5AZIA 4CD1A 4L72B 5KFFA 5HMZA 1UWAA 4L8RB 3GJQB 4J9RA 2ZF5O 2H1YA 1NOZA 2W6KA 4B1WB 3KJQB 4QAGA 2LXUA 1TQLA 3OYLA 2QA4G 4LFCF 4BVPA 2QWQA 3A5MC 1M1HA 1E4FT 4WFYA 1MROA 4BR7A 2LQBA 3SV4A 3K8WA 3M6UA 4WXOA 4LF6K 4I7FA 1OKJA 1Y11A 4Z4HA 3CC4N 3OTEA 2DH7A 2N3OA 4NEZA 4DZDA 4O44A 2MQQA 1BA1A 3AO2A 2P9IB 3DRPA 1UFWA 3D6RA 2XSJA 2VUGA 3JSMA 3GBTA 4DMNA 2GVDA 2NRRA 3Q89A 4K43A 2VODA 2C42A 1VQ8S 3GFZA 3VA0A 4IQXA 5ADXH 4PPDA 4H5TA 5LSLA 2CDQA 4N8NA 4WP8A 1ZPVA 1NRKA 2HSTA 2LXIA 5BXIA 1VQ7N 3CJTA 4EBCA 4X65F 3N4WA 4A8SA 4KT0C 2CQ0A 1IBKF 4CEOA 1CC7A 4M3ZA 2QWNA 4K4ZA 2Z2ZA 1NKEA 1WI6A 3D1HA 2V4RA 4CZGA 5HOOA 3GJTB 1PGZA 1R6YA 1NPRA 4Y34A 3D7EO 4IEEA 3N9UC 1VSLA 2C3YA 2JNJA 1K8AO 3ZSWA 3G82B 4G6VB 3MOZA 3ZT1A 3M32B 4W4MA 4FZXC 1SIWB 3ZZZA 1HHSA 4J9OA 1DTQA 2L48A 4IOCL 4W5RA 4Y2IA 2QE5A 4YOTA 4WK1A 1HR0F 4UUWA 2B8PA 4MKVA 3H4BA 1XQSC 3HPGA 1IM4A 1WDDA 2W25A 2R7OA 2APOA 1RILA 4DCHA 4CO1A 3RBZA 2K7JA 1O6XA 5C24A 1FNMA 4AL5A 5KFIA 5KFXA 3MDFA 3V4IA 3QT8A 2KHCA 1S5ZA 1Y3JA 2IYGA 1GOAA 4JP8A 4B3MJ 3TWZA 3PY8A 1TFYA 4DL4A 3CB4A 2EK1A 5KRSA 2QA2A 4F4YA 3ZTOA 3F9MA 1RP5A 4Z94A 4WE1B 1KP6A 4MFBA 1PCAA 4DQSA 3KUGA 4Q8FA 1QM9A 3U27A 3FZLA 4PY5A 2A10A 3EM1A 1GLAG 3J80O 2LU1A 4QWBA 3OBWA 3Q8YA 1T95A 3PIPL 3KWGA 4CJFA 3TA1A 3HSDA 1YBUA 3MXHP 1RTDA 3JAMY 1GEHA 3MWTA 2PGCA 3HSJA 1S6QB 1VOMA 3HFVA 1TELA 3P4IA 1R3NA 2VG6B 3BPDA 2PMZD 4DJBA 1WSIA 4CJEA 4U7UK 4X4NA 1S72N 1FI4A 2CNOB 5D78A 2HRYA 4KAIA 2F4VF 3RAXA 4LF6F 4V1Ak 1J5EF 4ER8A 1K1QA 3UO0A 1VQ8N 3OJUA 1U2CA 1RDCA 2ATLA 3KWIA 4PUOA 1NJYA 3K7RA 2N4CA 1AUDA 3EO3A 4AHUA 3T1HK 2HZVA 3DC2A 2Y9HA 1S12A 3P8BB 1QUPA 2RSQA 4FJXA 3PKMA 1Z4UA 1WI8A 3MOJB 2QL9B 5AJ3K 1RLCL 2CQ1A 1U45A 5KFEA 3DRYA 1OPIA 3MM7A 3CC7S 2UXCK 4CGJA 4JHDA 4DR6F 3L3VA 5EY4A 4P52A 2HHUA 4RWWA 2ATQA 1QVFR 1AXQA 2MMYA 8AT1B 4JI4K 3I8DA 3BSOA 5AFUA 1VQ9N 2AV5A 4HHHA 2V8PA 3DRRA 3CM6A 4M5MA 1BIZA 5DM6L 1RTJB 3TAEA 1HKCA 4NCAA 3KMSA 2VF3A 1Q1KA 2A0FB 3KLHA 2UUWA 3AOBA 3I31A 2HHTA 1RTIB 2BW2A 3VGMA 4HHTA 1N34F 2UXBJ 2K3KA 2V68A 4ITSA 3AVJA 1YDLA 1I94J 4LF8J 2RQMA 3VAFA 2GO8A 1Y0HA 1RAAB 3A1YG 4KFBA 3KHYA 2ZKUA 4WWSA 1KQGB 2E2QA 2V2KA 2DXEA 4W90B 4XPCA 3JQMA 1VAZA 2AJ0A 3L2UA 4DR5K 4ZVQB 4H0YB 4CO5A 4OHYA 3KFWX 1VRUA 1FRMA 2Q31A 4CZHA 4O4GA 4CHZA 2YX7A 3C6TA 4OLAA 4K8RA 1HNZF 2R42A 4OKKA 4X64F 3QZ8A 1NUEA 1KLMA 1U1OA 5C25A 3MMCA 2ZJRL 3HHEA 2PA3A 3CJ5A 2NXCA 3H3OB 3OL8A 1DHMA 4DV0F 1OYDA 4ZPWR 3SLCA 2BRKA 5KT4A 3CJRA 5AQTA 3FSXA 4QR1A 4FNIA 4IOCQ 1BCMA 1K44A 3CJKA 2X1FA 4L3QA 5HLFB 4DQPA 1MLAA 3MR3A 4OJ3A 5E33A 1TKZB 4E19A 3FZBA 2IVNA 1Q8IA 4DCOB 4AM6A 1HX1A 1PYSB 3DOMA 2Q3PA 1X4AA 4DX5A 5T14A 3AJ2A 5A8WB 3CCVS 4UW2A 1DEJA 2ZH8A 3OBIA 4X4TA 2ACMA 3NLCA 3AT1B 1J5EJ 3FKBA 3LTOA 4IG3A 1WOOA 1RE1B 1N36K 3SPYA 4IWVA 2EX3A 2VD3A 1VQ9S 3BPSP 3TX8A 4OI0A 2HMPA 3G6VA 2PBDA 1NJXA 3A13A 4ZP7A 3KTQA 3IGVA 4F67A 4OPJA 3D0PA 1ZTWA 1NNDA 1TL1B 1REGX 2UUCF 2O8EA 4DI6A 4QIVA 1N8RO 3CJAA 2EG2A 2MGZB 1OS5A 2OH2A 4MK7A 4K7QA 1CJKA 2ZEJA 4QIEA 5HL7Q 1F9FA 3EGVA 3RYLA 2BJEA 5LL6Z 2D1CA 1YJNS 2KYZA 1KD1T 2CGJA 2WC9A 1BGXT 5JLFA 1NSKL 2DNRA 4ED7A 4GW6A 3GR0A 1IKYB 3W8PA 1NH8A 2HKEA 3GYXB 1VSIA 4DR5F 3M4XA 3MUTP 2AGOA 2N3LA 2W4DA 4CDIA 4B1ZA 3HFZB 4FXVA 4KPCA 3P1GA 4IO8A 4RNNA 4K4XA 2J8AA 4J2DA 5HATA 3HRGA 4ED6A 3HMJG 3BR9A 3GIJA 4NXMJ 3LH2S 3TI0A 1ZBLA 4FVMA 3TRGA 2OSQA 5DRKA 5M2UA 3DWLA 2WB4A 1WSGA 2OMOA 1X5SA 1UJ6A 1A0OB 2ABYA 3QIOA 1HPMA 3TNVA 4WJBA 2OEMA 2D0CA 5HO4A 4YR2A 1IBKJ 1ZAWA 4UOGA 2G8VA 1XJWB 2Z58B 1IKYA 3ILLA 4IRDA 1BXNA 4C11A 2BXJA 2KL8A 5HROA 3UFCX 2DGXA 3CIZA 2VBWA 2QTWA 4P7VA 4KGXB 1ZBSA 2FHJA 3OR2A 5KT2A 2X7IA 3JS6A 4PHTX 1VSMA 3SQOP 3B6BA 3D67A 1NK9A 4HYKA 1E3MA 4CJSA 3S7RA 4O4RA 5EXWA 4FF1A 4GNIA 3HT0A 1N88A 2RN2A 3P4UB 4JI0J 5DZ7A 2DPIA 2YBVA 3OXGA 3DYAB 4FLYA 1YI2N 3RBDA 2LDYA 5EX0A 4AQYK 1ATRA 1M5OC 3EE8A 2J9DE 3MTJA 3AQPA 1UOCA 2A42A 4Z4FA 4YN3B 4LFCJ 3M6VA 4OGCA 1NMNA 4JI8F 1IWGA 1BIUA 4J9MA 2EBGA 3ZETA 3F9KA 3M8QA 2RUGA 1SI9A 3ZCMA 4IUFA 1RWKB 2A2CA 3N4QA 2VFSA 3GIRA 2XO7A 3DM2A 4Y0FA 4DTNA 4NOHA 3AAPA 1FVQA 3HKZD 1GAOA 7FD1A 2QL5B 3B4MA 1SJQA 3SI6A 1K8AT 2QRRA 1EQ0A 2VQEJ 1M5VC 1JLEA 2E5IA 4CI0B 2E7VA 1VC0A 4K41A 5LJVA 3KLEA 2ZBPA 2YNGA 4W5OA 3AO4A 3SMZA 1GTEA 2D9PA 2PYJA 1YTAA 2G8WA 4FKYA 4R5PA 1YITN 2JJ4D 1RDWX 3IXQA 5AJ3F 2H4YB 1WB9A 2HHWA 3PEHA 4PYAA 3HHKA 1H1VA 4WQ5A 4IFVA 5F8IA 3V4IB 3Q2TC 4Q0BA 4G1QA 1FXDA 4FF2A 5BRFA 2AEMA 1FKPB 2DPNA 4OPKA 1J5EK 4A8QA 1X5PA 2XY7A 3TAPA 3KZBA 1M1KT 1OH7A 1YHQS 4KH0B 3VHQA 5LY3A 4Y2MA 4TY9A 1KLNA 2UZAA 3G82A 2QWRA 3W61A 3UD4P 3QQCD 4KTWA 4F4ZA 1B0TA 3WQPA 2NPFA 1Z26A 4ILJA 4OJHA 4M3WA 1NKBA 4F0KA 3EZ5A 2PAVA 3WBZA 1X5OA 4HUFA 5BYSA 1HQEA 2BACA 2V2ZA 5CD4A 4CF0A 4WYWA 4DUZK 1WWHA 1WSHA 3T1AA 4A8OA 5EWGA 2W9CB 2HQIA 2JGUA 3A0IX 2VONA 4ID8A 3C16A 3VVTA 2HEKA 4ED5A 3J7AP 5L1LA 1S9FA 1JWWA 3SFUA 5KFRA 1N5SA 2CNKB 2HPUA 4CEFA 5DETA 4RO0A 2IA0A 3J7ZO 4CFBA 3BH6B 2FVPA 2EHGA 2X6SA 4KV8B 1VIXA 4AE5A 1AT1B 1HYSA 2ZBIA 2W24A 1Q7YO 4KHWA 1UPMB 2W2QP 3V1OA 2D1KA 4MQ3A 2KW4A 1EO1A 3LDLA 2OEKA 3MN7A 3QEVA 2LA6A 3MEDB 1RACB 1JKHA 3BZQA 4ZPCA 4BRQA 2X6NA 1VQYA 3JAMO 4AQYJ 3NVKA 1S6QA 3WC0A 2UUBF 2GJFA 1FDBA 2CUYA 1YX2A 3I0SA 2CQIA 1HBOA 4NL5A 1ESVA 4F0HA 4NEYA 2BJ7A 1X4DA 4WTOB 2V50A 1UAWA 4Z7YA 4JB8B 4WU3A 5DDOC 3I6PA 4UY85 4PG5A 5IXUA 3PW2A 2J6UA 5KFZA 2IVMA 1VQSA 4ANEA 3PG9A 2GAGC 4DUYJ 4MFBB 1VDHA 1EP4A 4LR7A 4YORA 5M1OA 4NYOA 3IO1A 4ES2A 1NK6A 4Q7AA 5ETVA 1K8KA 4DTMA 2QC3A 2HG4A 4X4SA 3HM9A 3G6YA 2CJYB 3NGTA 1NLKL 4FYVB 2HZCA 2QL7B 2R8HA 3CDUA 4FOIA 1RT6B 4J9LA 2FJDB 3Q8QB 2LDIA 4DUZF 2LMIA 1SC1B 1YJVA 4O23A 2KFZA 4MDAA 1WBBA 1FCAA 2ZH7A 1L3UA 4LIWA 3EDRB 1W0HA 2J76E 5F8LA 5DZ6A 4ZVEA 3BKFA 4K59A 5GAGU 2JC1A 3ZNUA 2UUBK 1LWXA 4K8XA 3D1QA 5GAGI 4LSNA 3K0JA 3R5DA 3QRRA 2WTFA 3AO5A 2C28A 2IDOA 5D4LA 3T5KA 4CLKA 4X66F 5GADI 2A1RA 3OL6A 2HS3A 1YVNA 2LP4A 3OL7A 3DLKB 5LJ5Y 3FZFA 2GHWA 5K9FA 5A8WA 2VB6A 3LP1A 2IOCA 3IKMA 3BDPA 2RU9A 4BRGA 2M4MA 4DFJA 3VQDA 4LF8K 1X4CA 1H7XA 1ASWA 4MIAA 5KFBA 3SQ2A 3DLJA 4Z7CA 1UEVA 1GMUA 3ZT4A 5IM0B 4FPBA 2ZBQA 4DL7A 3CJKB 1TGOA 1BI4B 3FQLA 3I82A 1TVRB 2RVJA 1LNQA 1VHIA 4RU9A 2W2OP 2YXLA 3HSTB 4A2BA 2QWMA 4PQUA 3UCZP 1IBMK 2JL9A 3K17A 4PG8A 1RT1B 4M5DB 3AGRA 4YMEA 5I9EB 1SH3A 2C2EA 2KKZA 1DQAA 2I38A 1JJ2M 1UFLA 1WHWA 5J2QA 4I7FB 2DIVA 1BUXA 4FVCA 2F3JA 1IV0A 1S97A 1N36J 2W2NP 4DV6J 1Y4ZB 8ATCB 4A57A 3SYZA 4GY2B 1T9XA 4HKQA 4XH5A 4ECSA 4A48A 1O1WA 2E1YA 1RXOB 3EGNA 4BC9A 4FJ5A 1W26A 2UV8G 3I5BA 2JC0A 2W9AA 1S1UA 3L95X 4GKKJ 4WFZA 3VGTA 4JV5F 2YHYA 3CCMN 3OSPA 2NRTA 3BSNA 4BQLA 1Q0NA 5HQMA 2QG9B 5KFVA 1RHMB 4USIA 3MAAB 1U47A 4KGMA 4URQU 3T9NA 4KV8A 3CC2N 1RCOB 3B54A 1XNRF 4IDKB 3LALA 3T5HA 1BC6A 2C3PA 2JDJA 2E9ZA 3ZZUA 1RT1A 4J9KA 3ID6A 5AQOA 2X1AA 5CR4A 3CQ8A 3H90A 5ETTA 3AVAA 3WNFA 2CH6A