3DLEA

Crystal structure of hiv-1 reverse transcriptase in complex with gf128590.
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
538
structure length
534
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 135
structure length 534
sequence length 538
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dleA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dleA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dleA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dleA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dleA05
1IKYB 2R2RA 3BDPA 2JC0A 2RF2B 5HLFB 2VWKA 4KPYA 3GV5B 1BGXT 2XCAA 3I0SB 3C95A 2XI3A 5FROA 1ZBHA 4R5PA 2HWHA 4Q8FA 4HYKA 2FVCA 4CHOA 4FLYA 4EO6A 1EETA 2WONB 1XHZA 1C0MA 4CIEA 3DYAA 3HVRA 2FBVA 4CGGA 4ZPDA 2FJVA 1IM4A 3LP0B 1JLBB 3FSIA 2HHSA 2Z1HA 3ZSQA 5J2QA 3VQ6A 1RDRA 4HKQA 2X6NA 2VG5A 3VQAA 4KHQA 2AWZA 4RNFA 4DF8A 5KT6A 2E6LA 3RRHA 5J2MB 5FDLB 4CGDA 4DFJA 4ELUA 1JLCA 4F4XA 1QQCA 4DQRA 4RW8B 2FBXA 3T5JA 4DTPA 4Z4IA 2JGUA 3MECA 4QWDA 3PUFA 1IKXB 4DEZA 5F9LA 3TAEA 3O3HA 2RKIA 3DRRB 4IKFA 1VRUB 3DLKB 4O3QA 4JS5A 4OKJA 4IFVA 3IRXB 5HRPA 2XI2A 2HHVA 5DQIA 4IRDA 1R0AA 2ASJA 1GOAA 3NKYA 4J9SA 1N6QA 1VSIA 3GILA 3MR5A 4RW6A 3OL9A 3OLBA 1BCMA 4IG0B 2ZE2A 3ZSVA 3HPOA 1TKXA 4PQUA 4DTUA 3DMJB 4CEOA 4BDZA 2YHBA 4B9VA 2P51A 3SFGA 4DG1A 3IN5A 1WN7A 2FVSA 4BE1A 2B43A 4NLRA 4DQIA 4CGHA 1EP4B 4ID5B 1SH2A 5C25B 4KB1A 4DSFA 4YNQA 1RT4B 4E0DA 2QKBA 3BSNA 1HQEB 3OS1A 4FJXA 2OZSA 3BGRB 1RDAA 2WHOA 3HK2A 2YKNB 3UR0A 3AVNA 4CJPA 2OPSA 1WSGA 3PO4A 4OPJA 3OYBA 3UIQA 3OYAA 5DLFA 2E4LA 1K1QA 3KHGA 3SUNA 3IG1B 3LP2A 4IKAA 4WZQA 2XWYA 3K5OA 3TI0A 4ED8A 2X74A 2YNFB 3LAKA 1RA7A 4ELVA 1I6JA 5KTQA 4KAIA 4ZP7A 2RN2A 3KNAA 4FJGA 3H59A 5I42A 4CF2A 1WSFA 3WNFA 2P1JA 3OYIA 3QO9A 4RG8A 4FCYA 3AO1A 1S10A 1NKEA 5HROB 2XY5A 3ZSOA 4CFBA 3KLGA 1LAWA 4E7IA 3NGZA 1FKPA 3O3GA 4FXDA 2E6MA 2WRMA 3JYTA 4NCGB 2IS3A 3B6OA 2BQUA 3ZT1A 4GC6A 4I9QA 1REVB 5KT4A 4E7KA 1KVBA 3LWLA 1BL3A 4ZTFA 4BDYA 1JLFB 5KGXA 3OLAA 1QAIA 5F9NA 4FZYA 4CFDA 5KG2A 5SWMA 3AVFA 3D0PA 3Q8PB 2OPPB 5I3UA 2HHXA 3QIPB 1JLEA 3O4QA 4KHUA 1TP7A 3PJWA 1WAFA 1S1TA 3EY1A 3TAGA 3VN5A 4NLSA 1L3SA 1QSLA 5K14A 1S1UB 3UQSA 3P1GA 1C1BB 3TVKA 3FFIA 3HPGA 4CEBA 3VQ9A 2VG7B 3SV3A 3T19A 4DLEA 4KAZA 4FK0A 5F8JA 4Q44A 2OPRB 2O4GA 4DU1A 2KW4A 4J9QA 4FM1A 1IKYA 4NLVA 2RF2A 5HLFA 3THVA 3I0SA 4DFPA 2GV9A 1HYZA 3OS2A 3P83D 2WONA 2E9TA 2XRIA 4KTZA 4DFKA 4H4MB 3N6MA 3VA0A 3AO2A 4OGEA 1T05A 5CYQB 1EKEA 1LWEB 3LP0A 2JLEA 1JLBA 1Z4UA 3U6FA 3KHLA 2WOMB 2V4QA 4KKOB 3NH1A 4LQ9A 4RNOA 5L1KA 4NLOA 4WZMA 1SUQB 1VSEA 3K58A 1K1SA 2Y1IA 5J2MA 3NF9A 4TSXA 5FDLA 3TWHA 3V6KA 4NLUA 3MEDB 3HXMA 4RW8A 4JV2A 2W8KA 3PJXA 4FLWA 1IKXA 4O4GA 4F4YA 3DRRA 1VRUA 3DLKA 2KZZA 1NHVA 3RMDA 4FLTA 2C2RA 3IRXA 3PV8A 2D0AA 3CDWA 3GV7B 4DF4A 3CM6A 3MR3A 4I2QB 3O4NA 5DG8A 2IJFA 2QV6A 3V6JA 1U48A 5D3GB 4ECXA 1VK0A 3ALYA 3H08A 4C8MA 4NZ0A 3M9NB 1ZBUA 3KLIB 1S97A 4RW4B 3PO5A 4O3PA 1I3AA 2Z1GA 1NKCA 3KLVA 3VQBA 1JIHA 3ZT4A 4C8OA 4ECTA 4JLHA 5KGWA 4CJ5A 4CHQA 2IC3B 2F8EX 4IG0A 1IH7A 1D1UA 4ZMMA 2D0BA 3P5JA 1BI4B 3PX6A 3DMJA 3ZT3A 3QESA 1BQNB 3LANA 1NK6A 4BE2A 3HYFA 4FJHA 3TAQA 3I0RB 3G6VA 4EBCA 3F73A 3DLHA 3I5BA 1R0AB 4FLVA 1EP4A 4ID5A 3CJ4A 4NLYA 3VQDA 5C25A 1UA1A 3T5LA 1U04A 1RT4A 1WSJA 4DQSA 1DTTB 3KLHB 1HQEA 2G8IA 3OS0A 5FRMA 3QLHB 2F96A 3BGRA 4O3SA 5KFKA 4O44B 2YKNA 3HVWA 4M94A 3PHEA 3IG1A 4DL6A 3OYHA 4CF9A 4DL3A 2YNFA 2D7SA 3WNGA 3CWJA 2KZMA 1S1XB 3RMAA 2HW3A 4I9LA 4W5NA 3ZSRA 4LY7A 2DTUA 1D0EA 4CF0A 4N56A 3IAYA 5J2PB 3AA3A 1X1PA 5HRRA 5C42B 4J9LA 5HROA 1KTQA 5CYMB 5DG7A 3OVNA 2W9AA 5JS1A 4QWBA 2W8LA 1QUVA 3OYNA 4CF1A 2R8GA 1T3NA 3V9SA 5T14A 2G8FA 3FRZA 1REVA 1QTMA 1S0MA 3TR8A 4CJSA 3EZUA 3PW5A 1RT7B 4AILC 2ASDA 3QEVA 3AA2A 4K4UA 1RA6A 3DLGB 4FJ8A 4E3SA 3ZSWA 4KTWA 3NH0A 5F8MA 3SZ2A 4PUOB 2WK4A 2OPPA 4ZP8A 2XGPA 4B08A 3QIPA 3G0ZA 4YMEA 3CG7A 4CJKA 1KRPA 3RRGA 4E7HA 1TKTB 3RB6A 4O3OA 2C28A 3KK3B 1S1UA 3T1AA 3LAMA 2EHGA 2LSNA 3QGIA 4IDKB 1C1BA 4W5TA 4OKEA 2HMIB 2VG7A 4ECSA 4ED2A 4I2PB 2OPRA 3M8QB 3V6HA 1UOCA 3NGYA 4XIUA 1NJXA 3QEIA 1YVUA 4CJ3A 2AQ4A 4JRQA 2IA6A 3CJ3A 3OL7A 1JL1A 3KLEB 4TY8B 3AVKA 3SQ2A 4ZVEA 1HARA 1FKOB 5KI6A 4ECRA 1GX5A 3CDEA 1D9DA 4DWIA 2IAJB 1NK7A 3SUOA 4R8UB 4H4MA 5HP1B 4J2DA 3M8SA 3CJ0A 1ZTTA 3HL8A 4DU3A 3PY8A 1BQMB 3MTKA 4NLPA 1S1WB 3NF7A 5CYQA 3M8RA 4F4KA 1LWEA 1GX6A 4B8CA 1RDDA 1ZBLA 1S9EB 4U7CA 1QSSA 3GIKA 2D3UA 1S9FA 2WOMA 4KFBB 4K4SA 4KKOA 1VSLA 1SUQA 3QNNA 2ALZA 3KJVB 2IM1A 4CK2A 4Q5VA 1TGOA 1RYSA 1YVFA 1NJWA 2D3ZA 4WYLA 1NK4A 1RT6B 3MEDA 4KO0B 3NDKA 3AVBA 4EBDA 5EWFA 4J2AA 2BRKA 2C22A 4J9OA 1W9HA 3CO9A 1W0HA 2ATQA 2FLPA 4QCLA 1T05B 4B3OB 2A1RA 3DRPB 4QW9A 1TK0A 1L3VA 3RBDA 4EZ9A 4I2QA 1LW0B 4XO0A 4F3TA 5D3GA 2Z1IA 1BISA 1NJYA 3SV4A 3VA3A 4NLQA 4KV8B 2YHAA 3DOKB 4J9PA 1HQUB 3KLIA 4RW4A 1FK9B 1N48A 5KFEA 3SJJA 1G15A 2IC3A 2FJXA 3K2PA 3ICLA 4O4GB 2IMWP 4FJ5A 4OLAA 1BI4A 3UPFA 2R8IA 3QETA 4MK9A 1BQNA 1NNDA 4ZPBA 4DSLA 1IKVB 3OJSA 4CGJA 3IGNA 4LQ3A 4ZP6A 2BDPA 3I0RA 3K5LA 4AHUA 3NGIA 4HHTA 3V9UA 2IJNA 1RT1B 4DQQA 1LAVA 1DTTA 3KLHA 1RTDB 3VQSA 3DI6B 3QIDA 3GV8B 3BSOA 3WNHA 4F8RA 3QLHA 3AVHA 4O44A 3EYZA 4ED6A 4GC7A 3HVAA 5KFBA 2PYJA 1EXQA 3GIMA 2WB4A 5L1JA 1I39A 3SUPA 3HT3A 1RBVA 1RDBA 1KHVA 3OSNA 3RB0A 3HHKA 4HVJA 2AX1A 3MXJA 1S1XA 2C2DA 1RT2B 5KT5A 3TAMB 3GQCA 4XPEA 4K4WA 3LP3A 4ICLB 4TQSA 4TYAA 1NK0A 5J2PA 3D5MA 1VSMA 3QNOA 5C42A 4HCBA 3U3GA 4FBTA 3NCIA 5CYMA 2ASLA 2O4IA 5KT3A 5DMRA 1X9SA 1QE1B 4KB7A 3A2FA 4TXSA 3KHRA 4IBNA 2XY8A 2AGOA 4Y34A 3MR2A 1U09A 4ELTA 4ZTJA 3OYLA 3C6TB 2FLNA 1SH3A 3LZJA 4RNMA 5KFGA 4EP4A 4ZHRB 4B9UA 4DL2A 1T03B 1TK5A 1JLAB 4N5SA 1WNSA 4WFXA 1TQLA 1RT7A 4F3OA 4MK7A 1ZBIA 4MK8A 3H5SA 4DSKA 3DLGA 3LWMA 1MU2B 5KFFA 3OYKA 1KSPA 3KIOA 1CXQA 4CJUA 4PUOA 4ZVFA 4KBIA 1N56A 3RMCA 3CJ2A 3N6LA 4DSEA 5FRNA 3NF6A 1EX4A 4DLGA 1D8YA 4QW8A 1DLOB 4KB0A 4FJKA 2AGQA 4DTSA 4TQRA 5KFNA 3ZSXA 4OJRA 1TKTA 2DY4A 2D41A 2O5DA 3PX4A 1J54A 4DSJA 2B5JB 4Z4CA 4E1MA 2XO7A 3KK3A 3S3MA 1DTQB 1XR5A 4CGFA 4IDKA 3OYJA 3Q8SB 2HMIA 1CZ9A 3QGGA 3AA4A 4MQ3A 4WYWA 2HB5A 4I2PA 4CJQA 3M8QA 2DFEA 3HM9A 4Y3CA 1X9WA 4FJJA 3VQ5A 4CIFA 1L5UA 3VQ8A 2BQ3A 3CFRA 3RAQA 1CSJA 2A1SA 3KLEA 4TY8A 4MFBB 2G8UA 1FKOA 2VA2A 3H5YA 4NLGA 4E19A 1TAUA 2HVHA 1MMLA 2IAJA 5J1EB 5KG4A 4R8UA 4AHSA 5HP1A 2J6TA 4ECQA 1RDCA 4ECVA 4QAGA 2HNZB 1BQMA 1S1WA 3M9MB 3L3VA 1VSDA 4LD0A 1KFSA 4H4OB 1F21A 1S9EA 3QGHA 4OKKA 1JXEA 1RILA 4K4YA 1TL1B 4CJTA 4KFBA 5KG5A 4JUZA 3VQEA 1SKWA 1QAJA 1JL2A 3ZSZA 4MKAA 1RYRA 3KJVA 4CF8A 4BWMA 2YNGB 4G1QB 4K4ZA 4CFAA 3AVAA 2ZKUA 3BR9A 1WSIA 1RT6A 4KO0A 3L2QA 3NAEA 3ASMA 4GVMA 4AH9A 2P5OA 5KFUA 4QWCA 3V1OA 3KK2B 5J2NB 4W5OA 1N4LA 4JV1A 4B3OA 2FC0A 3DRPA 2R8KA 4M3ZA 2AU0A 4ECYA 1Q9XA 5DQHA 1C1AA 3AO3A 1LW0A 1KHWA 4CJLA 4KI6A 1WSHA 4ZPAA 3DOLB 1C1CB 2X78A 4FM0A 4KV8A 3DOKA 3M8PB 1HQUA 3OYCA 1UAXA 2XGQA 1FK9A 3LPTA 3SFUA 5KG3A 1YTUA 5KG7A 5EDWA 1SH0A 4FBUA 4N76A 1BIUA 4OGCA 3HO1A 4EZ6A 4FLUA 4RZRA 2XY7A 3VQQA 4Y1CA 4M3YA 2G8KA 3AVMA 1IKVA 4PWDB 1A5XA 1RCHA 4J9MA 4OL8A 2GIQA 3ITHB 1RT1A 1UWBB 3V1QA 5EWGA 4FJLA 1HJRA 1SL2A 4DU4A 2GIRA 4O5BA 1RTDA 3L2RA 4URGA 2C2EA 3DI6A 1U49A 4F4WA 5F8GA 4AHRA 3E01B 4IRKA 1S5JA 2IOCA 3LP1B 3OSPA 3AVIA 4FW1A 4AHVA 4ZVGA 1L3TA 4DQPA 3SQ4A 4KHRA 4K50A 1UA0A 4FJNA 2FBYA 4KHWA 1S1VB 2JEJA 3ISNC 3NH2A 2IDOA 1HMVB 5F8NA 5KG0A 3SYZA 1S6QB 2R7YA 1VSKA 2HNDB 3L2WA 3DM2B 3DDKA 3KKSA 4M3XA 1RT2A 1VSFA 2HAIA 1D5AA 3TAMA 3NHGA 4CCHA 1JLQB 4ICLA 1LV5A 1CZBA 2ILZA 3F9KA 1TL3B 3AO4A 1T7PA 3EZ5A 4RW7B 4IOBA 1J53A 2PZSA 4RU9A 4CEAA 1QE1A 2EC0A 4O0JA 2UVVA 3OYFA 3VQ7A 3H5UA 4Z4EA 4CJ4A 4CEEA 4GMJB 5C24B 3D28A 4FM2A 3C6TA 1RTIB 4ZHRA 4B9NA 2G8HA 1ZBFA 1T03A 1JLAA 1S9GB 4ED1A 5CY4A 3HSTB 3QZ7A 4GW6A 5JXSA 3FDSA 1FXXA 3MR6A 4OLBA 1MU2A 4F4ZA 3S3OA 4FJ7A 2R8HA 4KHNA 1IO2A 1QHTA 3I5AA 1A5VA 3GYNA 2IBKA 1OS5A 5CZ2A 2B6AB 2HNYB 4DTOA 1K6YA 3OYEA 3MF5A 4M41A 3Q8QB 1N5YB 4ECUA 1DLOA 4L8RB 4DL7A 1LW2B 4CIGA 2I1RA 4M3RA 1ZETA 2E9ZA 3ZT0A 2B5JA 3ZSYA 4NRTA 1DTQA 5KFZA 4NYNA 3NGDA 2X6SA 4HCCA 3ZCMA 3DRSB 4N47A 3V1RA 4ECZA 3H40A 3MEGB 3NL0A 3JSMB 2I5JB 2R2UA 5F8HA 3GIIA 4OPKA 4O4RA 4DS5A 2XHBA 2JC1A 2UVRA 4EO8A 2ZQBA 4MFBA 2FVRA 3AVCA 3PX0A 4I7FB 4ZPCA 4IH6A 1KCFA 4M3TA 5KG1A 5J1EA 1C2PA 1GOBA 4MH8A 4B9TA 3CM5A 2OZMA 4C8LA 2HNZA 1T8EA 4CJFA 4Q0BB 2VG6B 4LH4A 1SV5B 3TAFA 4H4OA 1C0TB 4W5QA 1S6PB 1TL1A 1C6VA 3C94A 4Z4GA 1HNIB 2HWIA 1IKWB 3UDLA 1NOYA 4WXWA 4QPXA 1WSEA 4WE1B 4RUAA 1KLNA 3WNEA 2YNGA 4G1QA 4CJWA 3C6UB 1X9MA 5HBMB 4TLRA 4FW2A 4EBEA 5KFMA 4HUFA 1TK8A 4Z4FA 5KT2A 3KK2A 4FJIA 4M42A 2W9CB 2P5GA 5J2NA 4DTMA 1QSYA 4IR9A 4Q45A 4RNHA 3SUQA 4ED7A 1BIZA 4DL4A 1XHXA 4H8KA 3HP9A 1C0UB 3KMSA 4K4XA 4FVMA 3VQPA 4FS2A 3V9WA 2NUBA 1WNEA 3DLBA 4E1NA 4CESA 5KFPA 4YFUA 3SNNA 3DOLA 4E89A 3AVLA 1C1CA 3NF8A 4QWEA 3CFOA 5L1LA 3M8PA 3KLFB 3VQCA 4CJVA 3NFAA 3TANA 1HNVB 3T5KA 4O55A 2JEFA 4PY5A 4WXOA 1J9AA 3PR5B 4LSLB 4KTQA 2E9RX 3I5CA 1O1WA 2R8JA 2QXFA 4FJ9A 4PWDA 1U4BA 4LSNB 3DLEB 3RAXA 1TV6B 2G8VA 1CXUA 1NOZA 2ILYA 3ITHA 5DLGA 4RNNA 1UWBA 3SI8A 4DFMA 4EYIB 2IGIA 4F2SA 3E01A 1VRTB 3LP1A 2ZD1B 1ASWA 1ITGA 3LDSA 4IRCA 3SQ0A 3I8DA 1W25A 1ASUA 3SQ1A 5EWEA 2BQRA 1RT5B 2XCPA 2BANB 1S1VA 1ZTWA 4K4TA 3AA5X 1HMVA 4WFZA 1S6QA 4CEZA 5KRTA 3K5NA 2HHWA 2HNDA 5DGBA 3DM2A 1S49A 4CHNA 3PW4A 1JLGB 1RBRA 4J2BA 3L2UA 1JLQA 4ZVHA 3SPYA 1ASVA 2FVPA 1RTHB 4C8KA 1B9FA 1RBUA 1TL3A 3G6YA 3KK1B 3QYYA 4RW7A 2D5RA 4Q43A 1NJZA 3NBPB 4ECWA 2YNIB 2BR0A 1XC9A 3O3FA 2YKMB 4FLZA 3E51A 5KFLA 3MAQA 1HRHA 1NKBA 3V4IB 4URSA 4B9MA 3MXIA 5C24A 4K8XA 5KFJA 3V81B 3B6PA 1RTIA 2KFNA 3S9HA 1B92A 2HHTA 3OY9A 4MIBA 3G86A 1S9GA 4TN2A 4BE0A 3CDUA 4KE5A 4FS1A 4QWAA 3BREA 4IH7A 1NK8A 4RW9A 1TKZB 5KFWA 4YR2A 4OVLA 4O3NA 1LWCB 2F8SA 2OA8A 5KFSA 1JXBA 3NE6A 4NYFA 2CKWA 4FK2A 2FBTA 3QIOA 4R0EA 3QEWA 4FZXC 2W9BB 2OPQB 3KD1E 2B6AA 2HNYA 3HVTB 2JEIA 1S48A 4JS4A 4FLXA 3MFIA 2Q3SA 1L3UA 1N5YA 4XPCA 2RPIA 4B8AB 1LW2A 1RBSA 1Q9YA 4TYBA 5C5JA 1KLMB 3CJ5A 5T7BA 1TAQA 1T94A 5KFIA 3KHHA 4AHTA 5KFOA 5JS2A 1ZYQA 3DRSA 3K5MA 3G10A 4IH5A 1RNHA 3MEGA 3JSMA 2I5JA 5KFHA 5DQGA 3KTQA 4MIAA 2JEGA 4CEDA 4I7FA 3V6DB 5KFDA 4J9RA 4CEQA 4CEFA 4IFYB 5L9XA 3K59A 1RTJB 1J5OB 1KVCA 5L1IA 4CHZA 4Q0BA 1HYSB 2VG6A 4CJEA 4DMNA 1SV5A 3FQKA 1C0TA 3EPIA 2BE2B 3BJYA 4EYHB 4JRPA 3H5XA 1NHUA 1LWFB 3L3UA 1A5WA 1S6PA 1HNIA 1IKWA 1VSJA 1JX4A 3MEEB 4WE1A 3C6UA 5HBMA 2FVQA 4CK3A 3QERA 3ULDA 4MKBA 2G8WA 1JKHB 4O0IA 2IM3A 2J6SA 3S3NA 2YV0X 2RDIA 2OYQA 1RAJA 3RB4A 3KOAA 4J2EA 3TAPA 3SCXA 3OL6A 2W9CA 4CHPA 4F2RA 4UQGA 3RB3A 1XR6A 3PR4A 3HKWA 4C8NA 1C0UA 4IR1A 1HPZB 4HTUA 3M9OB 3G6XA 2J6UA 3KKRA 4B9LA 3AVJA 4QOZB 1D9FA 2W7OA 5EU7A 3RMBA 2EX3A 3NMAA 5CZ1A 3IS9B 5DG9A 1BHLA 3H4DA 3KLFA 5KFCA 2ITGA 3BQ2A 2BRLA 1HNVA 2UUWA 4G3IA 4KHMA 2Y1JA 5KFQA 4IG3B 5EUHA 3OHBA 3HJFA 1NK9A 3ISND 4LSLA 4KSEB 1SKRA 2V4RA 3KMQA 4KREA 2YNHB 4LSNA 3DLEA 2ETJA 2HHQA 2KTQA 3AVGA 3RR7A 4NYZA 1KFDA 1TV6A 4U6PA 1SL1A 2WCXA 4FJMA 1TVRB 2R2SA 2DPJA 4M3WA 3CIZA 2HVIA 1RT3B 1BCOA 3RR8A 1VRTA 2ZD1A 4E7LA 1IG9A 2IM0A 3H2LA 2W42A 4DTJA 3BSCA 3LALA 4CK1A 3U3YA 2DFHA 4R5PB 3OHAA 4IQXA 1RT5A 3BQ0A 3PZPA 2BANA 1EETB 1B9DA 5KFTA 3LZIA 2V0NA 5DGAA 3DYAB 2FLLA 4DS4A 4DTNA 4YR3A 5KFAA 2CJQA 2KFZA 3RTVA 2F8TA 1JLGA 4RUCA 3L8BA 4NCAA 5J2QB 2D0CA 3CYMA 3LPUA 2VG5B 4EEYA 3H4BA 1RTHA 2QKKA 4DTRA 2BGGA 3KK1A 3OL8A 3EPGA 3QEXA 3NBPA 2YNIA 3NAIA 2YKMA 1Z25A 1JLCB 3BSAA 2XC9A 3V4IA 4FYDA 3HP6A 4Z4HA 3MECB 1XI1A 1Z26A 3V81A 2RKIB 4NLTA 3PW2A 3V9ZA 2DFFA 1U45A 3GIJA 4WFYA 1S0NA 4CHYA 4M45A 3K57A 4IFVB 4YR0A 2R2TA 4YQWA 3T3FA 2QK9A 4DSIA 4DTXA 4KHSA 4TY9A 3TARA 1TKZA 1N6QB 1HYVA 1LWCA 5KG6A 4RW6B 4BDPA 1VSHA 4NLXA 2UVWA 4M95A 4KRFA 2UVUA 4JV0A 3SI6A 4CE9A 3CQ8A 3PW7A 2B4JA 4ID1A 2ZE2B 2OPQA 2W9BA 2PYLA 3HVTA 4KI4A 2VWJA 1TKXB 4PQUB 4EP5A 3D45A 2OH2A 1Y97A 3OYMA 1U47A 1KLMA 1WLJA 4DG1B 2GUIA 3FQLA 1QS4A 2AGPA 1XWLA 2W7PA 3KD5E 1SKSA 3QEPA 4RW9B 4N41A 4J9NA 4Y2CA 3Q8RB 3OYDA 4H54A 5KRSA 3SPZA 4ED3A 4F50A 4CFCA 4LH5A 4CJRA 5HRNA 3OJUA 4AHCA 3MFHA 4CERA 4NCBA 4FZZA 4E7JA 2OPSB 2RDJA 1S0OA 4ZP9A 3V6DA 4HUGA 4IFYA 5KFXA 1RTJA 1J5OA 4ED0A 3LP2B 2VA3A 4B9SA 3AO5A 3PW0A 4NLDA 2GC8A 1HYSA 5JUMA 3PVXA 3N6NA 4NCGA 3T5HA 3IGVA 5KFVA 2BE2A 4Q8EA 2XY6A 1TKDA 1LWFA 2AJQA 2IM2A 3L2VA 3NAHA 2Z1JA 4Y2AA 5I42B 3QO9B 4Y1DA 3MEEA 5HRSA 5F8IA 4O3RA 5KFRA 4J9KA 1XR7A 5E41A 4W5RA 4K8ZA 4CGIA 1JLFA 5SZTA 1JKHA 1GOCA 1CLQA 1YT3A 3BQ1A 3KLGB 5KFYA 3RBEA 4FK4A 1FKPB 2UUTA 1WAJA 4M3UA 2WTFA 2HHUA 3JYTB 4NRUA 4URQU 1Q8IA 4NLWA 5F8LA 1HPZA 4YP3A 2PY5A 3AV9A 2QE5A 4KHYA 3CFPA 1JXLA 2V9WA 5KT7A 4HUEA 1YTAA 4CECA 3CVKA 1SL0A 3DLRA 4Z0UA 2GBZA 1NK5A 3IS9A 2ATLA 3VQ4A 4K4VA 5I3UB 2AX0A 4BWJA 3QZ8A 4IG3A 4DL5A 3QINA 1JLEB 1RBTA 3MXMA 2YNHA 1S4FA 1KVAA 1S1TB 3ZT2A 3H98A 3TABA 3V9XA 4X2BA 5K14B 3OYGA 1TVRA 3FFIB 3HPHA 3TQ1A 3RWUA 4BACA 2DPIA 2FJWA 2KQ2A 5DK5A 1RT3A 4PA1A
chains in the Genus database with same CATH superfamily
1IKYB 4ZJOA 3ONQA 2CGJA 1MWZA 3MMVA 3I0SB 3ULEA 5AQTA 4R5PA 3VWSA 2HWHA 4CHOA 2QO3A 1U25A 3CJQA 5AXKA 2M52A 2FHJD 1XHZA 4CIEA 3N01A 4DV4F 3DYAA 3K2YA 3WUHA 2FBVA 1PJ7A 3R6GB 2NZTA 2PFFB 4A5AA 1JNZB 1CPZA 3IM8A 3ZSQA 3MOZA 5J2QA 3MMAB 3LTOA 2H4WB 3L3CA 1XC3A 4KHQA 2YWWA 4RNFA 4I67A 4OX6A 3ET6A 4DKWA 4Z2XA 2NRZA 5AXLA 2YWHA 5FDLB 2GHWA 5LMUJ 4DFJA 1JLCA 1Q78A 3AXMA 4PWUA 8ATCB 3QB0A 2FBXA 3T5JA 2DBBA 4M5LA 2O66A 4Z4IA 2Y3YA 4QWDA 4UY8T 2A6MA 3TAEA 2BUNA 4ZITA 2CA9A 2HRTA 4LR9A 4JS5A 5JVHL 1HWUA 3F5TA 5A2QO 4JKCA 5HRPA 4J7CA 2HHVA 5M1QA 1XIQA 3HMJG 2HG4A 1R0AA 2ASJA 1GOAA 1PYTA 4L3KA 3BN7A 1VSIA 3GILA 5M1OA 1NJIT 1E3MA 2DT9A 3OD2A 3ZSVA 1TKXA 3VERA 2AJ1A 4AL7A 4BDZA 1WN7A 2ALYB 2BOAA 3BEGB 3NGKA 2HHHK 4KR0B 2E8AA 2LU1A 3Q2TC 1Y7PA 1B70B 4DSFA 4PKGA 2PFDA 2PAVA 3MM7A 2QWRA 3OS1A 4FJXA 2CUYA 5CXTA 4CLTA 2H5JB 4OPJA 3UIQA 3HFKA 3Q23A 1Z2ZA 2DHSA 3FZBA 4LF2A 4JI0J 3LP2A 3TPQA 2X1BA 4IXCA 1RI7A 1DARA 2ZNZA 1WC4A 2XWYA 5BRDA 1YHQN 1FI4A 3BEXA 2MQPA 2X74A 2DGSA 1I6JA 1FFSB 3N5FA 3NXZA 2ZH7A 3B8HA 4ZP7A 2VDIA 2RN2A 3KNAA 3H59A 2BE7D 5I42A 3WNFA 2FD2A 3QO9A 3CF5Q 3PG9A 1S10A 1NKEA 4BC9A 2R7WA 2A40A 2MSTA 5CHIA 3JTPA 3MM5B 4CFBA 1GLCG 2CPXA 3CI5A 4LC9B 1XNRF 3CGIA 3O1LA 2WRMA 4KH0B 4LF4J 3SQGB 2GO8A 2IS3A 1V3RA 2BQUA 4MLHA 4P75A 3ZT1A 4RUHA 1FNOA 2HVZA 1TYQA 1SXLA 4ILHA 3C16A 1H7WA 2DRBA 1RADB 4AQYJ 2B7CB 3HX9A 1H38A 3VMFB 4PPDA 5KG2A 1J6ZA 2PD1A 3A5NC 3UE5A 2X3GA 5I3UA 4X4UA 5M2UA 3R5BA 4KHUA 2CZVC 1X5OA 3UE2A 1W2IA 4GKKF 2KT3A 2Q0RA 5B0BA 3TAGA 2KH9A 2GX9A 1XMQK 3MM6B 1QSLA 5K14A 3UB5A 2R7VA 3DOMB 3VQ9A 5EN1A 3T19A 2EC2A 3B78A 4KAZA 4ZVTB 1BC6A 1X9JA 2O4GA 4DU1A 1KXPA 4FM1A 1IKYA 4NLVA 3WT0A 3CD6N 3WDOA 2P9EA 1N36F 3I0SA 2X7IA 1RAOA 2MPUA 1XMOK 3OBWA 2QYGA 4H4MB 5AQGA 2GELA 3SMPA 3AO2A 4XAKA 3DNCA 3Q83A 2XMVA 1Z4UA 4A5BA 3U6FA 4KH1B 4DV5F 1X4AA 1HNXF 3MMAA 2IIRA 2WOMB 4PKIA 5L1KA 4LF9F 5BPMA 4M5JA 2HF4A 5A2QY 1X8DA 1NSPA 1EZZB 4B3TK 4N7TA 3BPDA 2DGQA 5D4PA 5FDLA 4NLUA 1P1TA 4BC4A 1NSKL 2W8KA 4FLWA 1WG1A 4FF1A 3CJRA 3L4IA 4O4GA 2DR7A 3R5DA 3W62A 1Y4ZB 3ZC4A 2KYZA 1YHQS 2KLAA 4P7VA 1PKUA 1J5EJ 2N4CA 2IRXA 3DJCA 3FZKA 4CO5A 1HPMA 2BM1A 2C2RA 4DUZK 2CJYB 2D0AA 3GV7B 2OSQA 5BYRA 3W3DA 4ECXA 3G2XA 3NP5A 3M9NB 2HZAA 3KDNA 1BD6A 5BN9A 1I3AA 1ZOTA 1JIHA 3A8KA 4JLHA 5KGWA 2JL9A 4CHQA 3W1YC 3OV7A 4X4PA 1BI4B 1NSQA 3PX6A 3R1XA 1BQNB 3LANA 1NK6A 4B3MJ 1R31A 2LXFA 4FJHA 3I0RB 2Q1LA 4EBCA 1UVIA 1XBWA 1FJGK 4I6WA 2IMOA 3Q22A 1WSJA 4DQSA 3KLHB 2NRTA 3HHDA 2VGNA 3OS0A 2DGVA 5FRMA 1RZMA 3B4DA 3BGFA 5HQLA 3HVWA 4KGVB 2ZJRL 3NNAA 1MWMA 3G96A 1M5VC 4FDFA 4M94A 1YRTA 3CCUN 5FPMA 3OYHA 1SPBP 4HLBA 4NLBA 3FRYA 4MAKA 2ZM6F 2EBEA 3ZSRA 4U95A 4M5IA 4N56A 2UXCJ 4CO0A 4A8XA 1QLNA 3CCVN 5HRRA 3CD6S 5C42B 4J9LA 3SSQA 5CYMB 3MM5A 3OVNA 2ZOFA 4NX9A 4JI5J 2YWEA 4HR2A 1JJ4A 4QWBA 4OX8A 2W8LA 4LF7J 3OYNA 4P9SA 1WUAA 3SQGA 2R8GA 1DZ5A 1FX2A 1EHWA 5TKWA 4H4KC 1RBOB 3UD5A 1R59O 4FF3A 2EFPA 2ASDA 1EX8A 1TUWA 2HFZA 1RA6A 3DLGB 4K4UA 3AA2A 3ZSWA 9ATCB 3U8XA 3Q7CA 3T6BA 3BP8A 5K5MA 1AYEA 2OTLN 1OYDA 4LRBA 2F1FA 2AJ4A 1RHKB 1R8BA 3S6EA 4PYDA 5HATA 2Q79A 3P45B 5LJ3Y 1HNZJ 3NVKA 3DWLA 3MZIA 4PG5A 2HAFA 3THWB 3MM6A 4LR8A 3RZAA 5D0HA 3KK3B 4MKVA 4W5TA 2LQBA 3DOMA 4ECSA 5AT1B 4ED2A 3RGIA 1OVQA 5F41A 2VPXB 1EIYB 2N3OA 4CJ3A 1YITN 3LOUA 4UF4A 1RWVB 4ZVEA 1IBMF 5KPTA 4A2BA 3Q2SC 4DV1F 3FBBA 2IAJB 1OSCA 3C8YA 1NK7A 4H4MA 2Z2MA 5CD4H 3VZIA 4J2DA 2HLTA 2PIIA 3UCZP 1F60B 1BQMB 3BZKA 4NLPA 4WP3A 1N52B 1GX6A 1RDDA 3GIKA 2WOMA 4KFBB 4K4SA 4WQ5C 4DPUA 4WFNL 2MDAA 3A8IA 3KJVB 2LDYA 5AQYA 2V2KA 1FWLA 1YVFA 2KB2A 1NJWA 2UUAJ 4LRFA 4DV3K 1FX4A 4EBDA 3AQOA 3CCUS 3TEHB 2C22A 1W9HA 2FLPA 4M5NA 1E4GT 2H4YB 3HSJA 1HFEL 4WFBQ 3DRPB 2QA4N 1PGZA 4XH4A 2V5HG 4JKDA 2PMWA 2HBQB 1TK0A 4JEPA 4F3TA 3CCVS 5RUBA 3SV4A 3TJ8A 2GX8A 5M2RA 3U1MA 3ULHA 2QG9B 1VS3A 4GV3A 4DR3K 4DOZA 2ZHOA 1DHMA 3MMCB 2P9SB 4OLAA 3US5A 5FJ4A 1BI4A 3M6XA 2R8IA 3FZ2A 3MWPA 3CMEN 3QETA 4MK9A 1BQNA 1QQNA 1Y11A 1DQAA 2UXDF 1TL7B 2XB2D 4WU2A 4L72B 4LQ3A 3I0RA 2AJ2A 4AHUA 2IJNA 4DQQA 2F9DA 5AQFA 2B9WA 3NGUA 4NMXA 3KLHA 2IHR1 4LF5J 5F0XA 4F8RA 4NXNK 1MROB 5ELZA 2OTLS 3GR1A 1Q86O 3OBIA 3HVAA 5KFBA 2PYJA 3DDIA 4ZVQB 3GIMA 3HT3A 5B7WA 3MD1A 1IWAA 4HACB 4DX7A 5TKYA 3KFWX 2RU9A 2BJ1A 5B0CA 2HSEB 1MN9A 3Q8YA 3GQCA 3LP3A 4FL9A 5AJ3J 1NK0A 4TYAA 4KH4A 5B08A 5C42A 2WBMA 4FBTA 1FJ7A 3G25A 5CYMA 4MYUA 2L41A 5KT3A 5DMRA 5E26A 2AGOA 5L9NA 3MR2A 4ZTJA 4CZLA 4G1PA 1SJ3P 3LZJA 5KFGA 2DGTA 4DL2A 4JB8B 3EMTA 1TK5A 4OJHA 3LDQA 2XSJB 4N5SA 1WNSA 2P9GA 3MPUB 3FGUA 1XQIA 1HW9A 3RYLA 4F3OA 2J9DA 4MK7A 3DLGA 3LWMA 3C6HA 3OYKA 2FGCA 5HANA 3QAUA 1NGEA 1AUSL 5FRNA 1F6TA 1D8YA 4YOTA 1DLOB 4A8SA 2AZ3A 2QA4S 3THWA 2Y0SD 4ZLLA 4DSJA 2B5JB 1HWKA 2GQQA 3KK3A 1XR5A 3OYJA 1Y64A 3Q8SB 2BZ2A 4H5NA 2RAQA 2F63A 4KRWA 2LEBA 2DFEA 3ENOA 4Y3CA 5JVHQ 3I31A 3VQ8A 1VC6A 3FEZA 3RAQA 2LA6A 2A1SA 1NRKA 4MFBB 1NGIA 2V67A 3CMES 1TAUA 3IMXA 2IAJA 2O1PA 4U8VA 1SZ2A 4YB1P 2V69A 2Y9HA 4ECQA 1RDCA 4QAGA 1BQMA 2P9CA 4LD0A 4KBOA 1KFSA 1B4SA 2K8GA 3NOCA 4GO7X 1WELA 3TW0A 1SJ4P 4USWA 2FQQB 1KQKA 4KFBA 3CDBA 1QUPA 1QAJA 3ZSZA 1KWMA 4XEIA 3KJVA 2Q6CA 4CFAA 1HIYA 1V5IB 1YF5L 3W9JA 3L2QA 4JK9A 1GMUA 3TUZC 5KFUA 4WP8A 2F5GA 2DEIA 5J2NB 2I0XA 3K0SA 4JV1A 5M1FA 5M1KA 3EVMA 1BOTO 3DRPA 2FY1A 2XO6A 1W7WA 1S59A 4ECYA 3PXGa 2NCKL 1KHWA 1UEVA 3UNYA 4WQ4A 2F65A 4YB6A 4JHDB 1W2BR 4AF1A 3DHXA 3M8PB 3O2IA 3SFUA 1YTUA 4PXBA 1OY9A 5KG7A 4DR4K 1Q5YA 3H3OB 3MMCA 2P9SA 4XK8C 4X64F 4IO8A 2FHKA 4M7YA 3NMUA 3BO2A 4M3YA 1SS6A 3HZ6A 4BLGA 3AVMA 1M0SA 1A5XA 2W40A 4USHA 3SSRA 1UFLA 1TL7A 5AQSA 1LFPA 1T9VA 4GO5X 1W2BM 4OPAA 2QN6B 3M4XA 4LVNP 2GIRA 3VAGA 3L2RA 1U49A 5F8GA 1N5TA 4A61A 1OKJA 1RDUA 1S5JA 3LP1B 4BRKA 4FW1A 4A62A 4DQPA 1S76D 3UWTA 1JXVA 1VQON 4FJNA 3FR0A 1BHNA 3RUBL 1YJNN 4DPYA 4HACA 5H9EK 5KG0A 3CCWA 3DDKA 3NGSA 3KKSA 4B3SJ 3OHRA 1JNRB 1VSFA 1BUXA 4I4BA 1Q7LB 4BROA 2F7VA 2YX6A 4HDHA 1T7PA 3PNIA 1XMQF 1VRQC 1VR6A 2EG1A 2QFJA 3MI7X 3JS6A 1NCLA 1FD8A 2OCEA 3H5UA 5IS2A 3QFWA 4CEEA 4GMJB 3D28A 4FM2A 1FE0A 2RRAA 3P6YC 5C2FA 4B9NA 3ZZOA 1ZBFA 1NGHA 3K5PA 2LYVA 1S9GB 4W4MA 2XSJA 2CRLA 3ILLA 2CZ9A 2XLKA 1H0HB 2R8HA 3ZFVA 5AQRA 1IO2A 5JLHA 1A5VA 3GYNA 4DPXA 1ZA1B 2HNYB 4YHHJ 1HLUA 1K6YA 4IOCL 3Q8QB 1T6CA 4ECUA 1DLOA 4WTOB 4X84A 2I1RA 3TOQA 2A18A 1VQ9N 4K8RA 2E9ZA 2B5JA 3ZSYA 3PYDA 4HT5A 5KFZA 3GBTA 2X6SA 3AD9C 1MMDA 4CO1A 1V5VA 1K8AT 5ETSA 1PC4A 4C3KA 4N47A 4ZVOB 3VQTA 3MEGB 3JSMB 2R2UA 2B56A 3W3SA 3GP9A 4O4RA 3AOAA 4MFBA 3BO3A 2IDLA 2VQFF 1TUUA 4I7FB 3SBTA 3MPVA 5KG1A 4DR2J 2FJAB 3UN2A 4CJFA 2DHGA 5FLXU 2VG6B 2G0JA 2UV8G 1C0TB 1MLAA 4J90A 1Y5LB 4W5QA 2GTDA 3O1BA 1XN9A 1IKWB 4GVBB 3UDLA 3TZYA 1S0VA 3VPZA 3IKMA 4WXWA 4QPXA 4F7VA 2LFVA 4P6QA 4OZJA 2AYGA 1BQXA 4FF2A 1HA1A 4FW2A 4TLRA 1XNQK 1VQOS 2YHXA 1YJNS 4E8UA 1TK8A 4Y28C 3LW5C 4Z4FA 5J2NA 1O13A 4Y65A 4Q45A 2DNQA 3I56S 2ZJRQ 4ED7A 2OAUA 2V34A 4CH7A 4DL4A 5JMVA 1TZ0A 3BPSP 1AW0A 3MN5A 3HBTA 5KFPA 3SNNA 3VAMA 4JHDA 4FYYB 2Q43A 2QTWA 1YG0A 4QWEA 5L1LA 2M9KA 3M8PA 4YY3K 2LP4A 2L08A 3PFOA 3KLFB 5F3ZA 3FMBA 1HNVB 2RE2A 2MY8A 4O55A 4B1YB 2JLFA 2GJIA 4DV6K 3TZWA 4CBUA 3IM9A 4LSNB 5I9EB 2VV5A 4DCJB 4P2FA 4EK2A 2X1GA 4IUFA 1M5PC 1CXUA 4ZKAA 4Z7CA 4RNNA 2IGIA 3WQTA 1J2VA 4JV5K 2VODA 3DFEA 3LP1A 1ITGA 3IDHA 3SQ0A 4ZLPA 3I8DA 2IA0A 1ASUA 3SQ1A 4UZCA 5EWEA 4A57A 2W2PP 2O8FB 2KKHA 1VQ9S 2CQCA 2YI1A 2KT5A 2E5IA 1HBOB 4CHNA 2Q2RA 1RBRA 4J2BA 1W7AA 4ZVHA 4JI1K 3PACA 1ASVA 3PKYA 3P8BB 3D68A 4OX9F 1RBUA 3G6YA 1W97L 2YNIB 1EQMA 3O3FA 2YKMB 5KFLA 1HRHA 2CQPA 1Q5VA 3ADAC 1FRLA 5L38A 3T1HK 3V81B 3D6MB 1U26A 1CJKB 1SJFA 1S9GA 4RWWA 4BE0A 4FS1A 3D0IE 4TU9A 4IH7A 4ZS6A 2C2MB 5AQXA 5IWAJ 4RW9A 1GMWA 1VFJA 5AXMA 4O3NA 4BC2A 2DCUB 2F8SA 5KFSA 4YN3B 1JXBA 4MO5A 3ZZZA 4NYFA 3QIOA 1QQOA 4UQTA 3KD1E 2HNYA 3OW2R 4JS4A 1NMEB 1XERA 5JMNA 1KLMB 4AM7A 4DV3F 1FO1A 5KFIA 1A7GE 4EUVA 5KFOA 4LF8J 5JS2A 4LFBK 1ZYQA 2G1DA 2XHWA 4IH5A 5I4MA 2XMKA 3MEGA 3JSMA 1PBUA 1RE1B 4FOEA 4I64A 3KTQA 2JEGA 1X3MA 5IT9U 4WCEL 5CABA 3WXKA 4I7FA 3V6DB 4CEFA 1X5TA 1GFWB 1YRUA 1U0SA 4CYUB 1RTJB 3K59A 4RWXA 1ZAXA 2R7QA 2WSEC 2D1KA 1TU0B 2VG6A 4DR3F 4CJEA 4LIRA 4QIWD 1C0TA 4YOEA 2BE2B 1LWFB 1A5WA 4IWVA 3EE8A 3GFYA 3G6EN 1IKWA 4GVBA 4CH0S 5F3TA 3O80A 4IO9L 1H98A 1AB8A 2ZWOA 4DV2K 4MKBA 3ULDA 2G8WA 1JKHB 4O0IA 2IM3A 2J6SA 2YV0X 1AA1B 2EFQA 3VAFA 5J1PA 1HKCA 2W4CA 3KUEA 1ZXOA 4BRQA 3OL6A 4F2RA 4BRIA 3FBCA 4NXNF 4AUKA 4IO1A 1R43A 3KKRA 4QOZB 1NWKA 4U7BA 5GAEU 2KG1A 1QVGM 2VBZA 3RMBA 3GZ7A 4BHQA 3PEHA 5CZ1A 2XLIA 3KLFA 4NA1A 1OH8A 3W7BA 1HNVA 2ASMA 2Y1JA 3W66A 2DNPA 3AODA 4KHMA 1NK9A 1OY6A 3LDOA 3WQUA 2V4RA 2IRYA 2MZQA 4E98A 1FERA 1NGFA 2YNHB 4LSNA 3P31A 3CCSN 3RR7A 1KFDA 1SL1A 2WCXA 4RWTA 4FJMA 5EHHA 2R2SA 2KO1A 1APSA 3CIZA 2NSCA 3VETA 2HVIA 1FDBA 3U4LA 3H2LA 3BSCA 2QSFA 1GLFO 1YWXA 3MUVP 5HMYA 2XHCA 4ANDA 3OQ2A 2YPZA 1CS4B 1WKJA 2O8FA 1B9DA 3LPEA 4FWMA 2V0NA 1CQNA 4CLWA 2CQ1A 2LLZA 2FLLA 1UJ5A 5A8WB 3H3NO 1HBOA 4CW7B 5FD1A 2CJQA 3MCNA 4RUCA 4U96A 1YBUA 3J81U 3O44A 5IZHA 1VQ8N 2QKKA 2FTRA 4L3QA 4K0KK 3OL8A 4X65J 2IY5B 2YNIA 2YKMA 4DJBA 4FYDA 1OPZA 2B3TB 4P7TA 3V2UC 4UOHA 2LMIA 3THXB 1RXOB 4CBWA 3AY9A 3QT5A 3V81A 3MCOA 4NA3A 1U45A 1S0NA 4CO2A 4FXVA 1CJKA 4OLPA 1VQNN 4J9VA 3G6ES 4J37A 3CC2N 4ANCA 2KJWA 4TY9A 1N6QB 2CVIA 2VH7A 3R7NB 5KG6A 4RW6B 4ZIVA 4KRFA 2O67A 4NL5A 1M90O 2GIFA 3CQ8A 2VCPA 3R3LA 2VWJA 2RQ4A 4NA2A 3CJ1A 2UXBJ 1Q79A 3PM9A 1U47A 1KLMA 1GLJO 4DG1B 2EK1A 1QS4A 1CEZA 5AR0A 2CFXA 3L4QA 3KD5E 1ZM2A 3QEPA 2CXEA 4N41A 4J9NA 5H1SV 3OYDA 4H54A 5KRSA 2EKYA 3SPZA 3Q89A 1N8RT 3QSYB 5AQUA 2RD5C 4LH5A 5AQZA 3OJUA 5LSLA 4FZZA 2FZKB 3M6WA 2WW4A 4E7JA 2OPSB 2MB0B 3LQVA 3V6DA 3D67A 3FKBA 4HUGA 5KFXA 2ZBCA 4CYUA 4CZEA 1RTJA 2VPWB 3SEOA 2VA3A 4QBUA 3CCSS 1G7CB 3UDCA 4YORA 4NLDA 4E2FB 1V3ZA 4DR4F 2EW9A 3VF0B 1TL5A 2PI4A 3N6NA 5BR8J 3T5HA 2CJBA 2BE2A 2YQ0A 2ROGA 3DXKB 1LWFA 3SK3A 1LFWA 2IM2A 3NAHA 1SC6A 3CCZA 4FPRA 3BYPA 2B9XA 5E41A 4J9KA 4CGIA 3CDAA 1JLFA 1FD2A 2ZOMA 5SZTA 1JKHA 2F7TA 1GOCA 1YT3A 1IBLK 4JI7K 5KFYA 4FK4A 3EKUA 3R8YA 4C8ZA 1RAIB 4F26A 4NRUA 1KAXA 2VKRA 1Q8IA 1BA1A 4C48A 3PLAA 3GG4A 3R3TA 3EEQA 4KHYA 3CFPA 4LRDA 2V9WA 4JI4J 3I6PA 1F3FA 2XMTA 1NM2A 2AEJA 3CVKA 1VQ8S 4Z0UA 2LEPA 2GBZA 1LK7A 2IVMA 2ATLA 2YQ3A 2QA4G 3BGUA 3BUZB 5D0RA 1O5JA 5LJVA 4BWJA 2HBYB 4DL5A 2DNZA 1Q4RA 3K8VA 1YXQA 3SLCA 2YQ1A 2YNHA 1N5VA 3NNCA 3P39A 1SB6A 1FRHA 1ROFA 1F5AA 2GAGC 3GONA 1VQNS 2Z58B 5ITHA 1X4EA 3CC2S 1IBKJ 3RWUA 3MCMA 2DPIA 1H74A 1FESA 3GG1A 2HK2A 2R42A 5DJBA 1TELA 1NEEA 1HLWA 4E1JA 2R2RA 5AQLA 2LU2A 2WBNA 5HLFB 3Q24A 1DURA 2H51B 2LQ8A 2F4VJ 1ZBHA 2XI3A 1WTBA 5FROA 2IVOA 4A47A 1CS4A 4FLYA 2WONB 1NGAA 1C0MA 1QY7A 5A8WA 4CGGA 4ZPDA 4ISEA 2L48A 4IOCQ 2VBXA 2Z0GA 1CJVB 3PCOB 2Z1HA 4JKBA 3M30B 2OEKA 1RDRA 4HKQA 2X6NA 2HRUA 2AWZA 2ZZMA 2MQOA 3FBEA 4ES2A 4CGDA 4ELUA 4F4XA 2B4UA 2NNWA 2R7OA 3QMQA 4DQRA 1RQ0A 3THTA 4DTPA 3THXA 1BO5O 2JGUA 1IKXB 1N88A 2M8DB 5MAOA 3EZOA 4TU7A 2FZCB 4OKJA 4LF6K 5EGYA 1UFWA 2IPOB 1S57A 1D8ZA 3ELHA 3R9PA 3VV2B 1N6QA 4C0BA 4DR1J 2K7KA 5GMEA 5A2QU 1DGKN 4RW6A 3OL9A 3MCSA 1BCMA 2HFUA 2CQBA 2CPFA 3HPOA 1S4EA 4DTUA 1B0TA 4B9VA 1RLCL 3SFGA 4TU8A 4DG1A 1QJHA 1RWMB 3EL2A 2ASYA 3G71N 2D74B 2B43A 3MTJA 1IXKA 2BYCA 4DQIA 2KU7A 4KYZA 3ID8A 5E3AA 1PG5B 1WF2A 2HOEA 4KB1A 3OR1B 3MM8B 3BSNA 2FYXA 1HQEB 1CBKA 2GAHC 4I68A 2OZSA 1R8AA 5AQWA 3HM8A 3IO1A 3T9ZA 3UR0A 3AVNA 2DH8A 2OPSA 1T9TA 3PO4A 1WSGA 4JKFA 1FKAF 3OYAA 5DLFA 2E4LA 1NB2A 4WQ4C 3VENA 3AD8C 3SUNA 3IG1B 4R0JA 1FVQA 4QU6A 2JZ5A 4IKAA 1Q86T 4DR6J 3K5OA 3TI0A 2V7YA 3I87A 1T44A 1NGCA 5KTQA 3DXKA 3K7RA 5M2PA 4DV6F 3PIPL 4CF2A 4AXJA 2UXCK 1VQ6N 1SKUB 2FF3B 2XY5A 3HHEA 5ADXA 1ULRA 5CZVA 1TUVA 1LAWA 3L7OA 5KOWA 4B02A 2UP1A 4QYZJ 1RAHB 5D4NA 1MWYA 4LF7K 1DRZA 4NCGB 1I1GA 1X31C 4I69A 1WOPA 5F1XA 2YX1A 2HQFA 3KJNB 4E7KA 1NHKL 4BDYA 3NMRA 3OLAA 1QAIA 4FZYA 4CFDA 5SWMA 2NRRA 2LKZA 3AVFA 3D0PA 3D1OA 2OPPB 1P90A 2HHXA 1VISA 8RUCA 2FSKA 1P9YA 2DR9A 4K7QA 1U7LA 4CI0B 1HNZK 3PYFA 3EY1A 4N77A 4NLSA 3M8YA 4CLYA 2ROPA 4YEAA 3OTBA 2Q1NA 3H0PA 4PYAA 1LQ9A 3P1GA 3H42A 4FN5A 3TVKA 2XMUA 5AQJA 4CEBA 4DLEA 3K17A 5F8JA 4J9QA 1WEYA 2VHGA 3RG6A 4PXDA 5HLFA 4P72A 4FYWB 3QRPA 4XDCA 2GV9A 2DY1A 3OS2A 1FA0A 2P9LB 3SBGA 2WONA 4DFKA 5DM7L 3G71S 3N6MA 4BR4A 2PGCA 3UCUP 1T05A 2K3IA 5CYQB 3K0JA 1LWEB 3QBWA 1CJVA 3M30A 4ZIWA 3S01A 1TTHB 3J80O 3EZWA 1VYAA 3NH1A 4RNOA 1ATNA 2E1CA 1SUQB 3ISZA 3NCPA 4J9UE 4TSXA 2HZVA 3MEDB 3HXMA 1YZ7A 3E2EA 4JV2A 3QQCD 4LFBF 2CQDA 2Q6BA 1IKXA 3KHYA 3A5OC 3WXLA 4AYBD 2Y8YA 3P5BP 2PA8D 2R3VA 2KZZA 1LK5A 1AZSB 4FLTA 3C15B 3PV8A 3E1YA 5HO4A 3CDWA 4RU2A 2DNOA 3O4NA 3G87A 2IJFA 3VAIA 1SIZA 2QV6A 1VQ6S 3B6BA 2QWOA 2JOQA 4C8MA 4FPIA 1S97A 3I9ZA 3PO5A 4O3PA 1HR0J 2Z1GA 1NKCA 3VQBA 3ZT4A 1SQGA 4ECTA 4CJ5A 4LBHA 1QM9A 1NGJA 2CJ9A 3CPWR 2VC0A 2ZKTA 1IH7A 4ZMMA 2ERRA 1Q0NA 1HWIA 3VVTA 1B64A 1N34J 4LT6A 5C7PA 4USVA 4DV2F 1U0HB 3UD4P 5SUHA 1N36J 1FEEA 2G1HA 4B3RK 3F73A 2AYEA 1VQYA 3KNGA 3L0QA 2MMYA 2ZBQA 3CJ4A 4NLYA 1IJFB 3OR1A 1U04A 2WTUA 1VQKN 3MM8A 2C2ZB 1HQEA 2G8IA 4LF5K 2AV5A 2VKZG 3ZO7A 3QLHB 3CPWM 3SCJE 2A0FB 4O44B 1HWJA 2VGMA 2A3JA 5AZJB 2KXNB 4JYAJ 3IG1A 3O5TB 3O4WA 4M5GA 5HMWA 2F9TA 4DL6A 1F3VA 3PYGA 5F0UA 2O3DA 3CWJA 5CQGA 2CPIA 3CE8A 2BW2A 3UKUB 4LY7A 2ZH1A 2BOPA 5AJ3K 2HEKA 3IAYA 3J7ZT 3TVZA 2RUGA 1PILA 1YRXA 2RHQB 1X1PA 1JWWA 3OFEA 3I9V9 1WJ9A 5CCMA 1T02A 2BABA 2AEMA 2EFNA 2W9AA 2FGOA 1QUVA 3CB4A 2QLWA 3CJSA 2CH6A 3QFUA 1T3NA 5T14A 2G8FA 1G1XA 1S0MA 4CJSA 4FP9A 3PW5A 1HKBA 1RT7B 1LCUA 4JNEA 3B4MA 2ZEJA 3QEVA 4DDFA 2FJBB 1SC3B 4KTWA 4H5RA 5F8MA 2RQCA 4QQBA 4PUOB 2WK4A 2OPPA 4ZP8A 2E1RA 5EX0A 4JI3J 1FWPA 4ZJQA 2XGPA 4B08A 2QLXA 4YMEA 2ZUGA 4DN0A 2ZNYA 3RRGA 3VEOA 3RB6A 1GT8A 2W2QP 3T1AA 2A2DA 1MNEA 4AL6A 1GLEG 3GSIA 5A6WA 4CQ1A 4I2PB 1H6KX 1X0PA 2V68A 1GMVA 3WHIA 1OH6A 1PYOB 1VIOA 3CMQA 2ZM6J 3IR7B 2IA6A 2LQ5A 1JL1A 3RBZA 2WVBA 3AVKA 2VQEJ 4WIQA 2P9LA 2JDJA 1D9DA 2OHDA 4DWIA 2KVIA 5IT4A 1IJJA 4R8UB 3B82A 4K2JA 1ZTTA 3HL8A 3PY8A 3FJ2A 3M8RA 5CYQA 5LXRA 1LWEA 4ZVSB 1FF2A 4HI1A 1VQKS 3U1LA 1S9FA 5LY3A 4CT8A 1SUQA 1V9OA 5AXNA 2R7RA 3QNNA 4DU8A 2MTLA 4CK2A 2P8IA 5BN8A 1K73O 1ICEB 4WYLA 1NK4A 3MEDA 4KO0B 3NDKA 5H9FJ 4N8OA 4DV7J 2PC6A 3KG4A 2BRKA 2IVYA 4L73A 2D0OA 1W0HA 2X1FA 4P52A 4QCLA 2UUBJ 5CR4A 4X4OA 1C4CA 1TUYA 5M1PA 3WXJA 1AZSA 1BU6O 3C15A 1AUDA 1L3VA 2BBEA 4NEZA 3M2UB 2D69A 4F67A 4JI0F 1NJYA 2J7UA 1KP6A 4J9PA 2CNOB 3A8EA 5KFEA 2FJXA 2ZVIA 3AJ1A 3TRGA 3UPFA 3VGLA 1NNDA 3OJSA 4CGJA 1U0HA 2MQ8A 5C15A 2KXFA 1FFWB 3K5LA 3NGIA 2IRUA 2B4OA 3F0NA 3SMSA 2MZJA 1LAVA 4OHXA 1RTDB 3D7SB 2EI5A 3VQSA 3DI6B 3QIDA 3GV8B 3VGSA 3QLHA 2K7JA 3QWUA 4O44A 4ED6A 4GKKK 5AZJA 1YBTA 1EXQA 2VFUA 1UVMA 2VOPA 3EWGA 4A48A 2XTJP 1OIAA 2KM8B 5L1JA 3SUPA 2JNJA 2G0CA 3SCIE 1KN6A 2HQDA 2XWXA 3HHKA 4HVJA 2AX1A 3ZTPA 1ACMB 5BRFA 2GHPA 3I82A 4P2SA 4B3SK 4O0NA 5KT5A 3TAMB 1U6FA 3UKUA 2W01A 4TQSA 5AZIB 3D5MA 2KG0A 2RSQA 1VSMA 1YIJN 1FRKA 3K8WA 3U3GA 3ZTRA 4X66K 3NCIA 2O4IA 4LVOP 4BR0A 3PRVA 4KB7A 3A2FA 3KHRA 2DRDA 2OTJN 2XY8A 3C14B 4C1NK 4Y34A 4ELTA 3OYLA 4QR1A 2FLNA 3C6TB 2ZDOA 1BA0A 4ZHRB 1BY9A 1URRA 2VFVA 5FLXY 1Q81O 5JICA 2VYPA 1JLAB 2UUCJ 4FNIA 4PHTX 1RT7A 2OMLA 4B9QA 3U7JA 2UXDJ 2EPIA 4DSKA 2W24A 5KFFA 5K8PA 2MZ1A 2C42A 3KIOA 3RBXA 3CQYA 4CJUA 4PUOA 4ZVFA 2VB6A 4MT1A 2QIFA 3RMCA 2UU9J 5ETVA 1KC8O 2R7TA 4U7UD 1BLUA 4DLGA 3CSKA 4QW8A 2GHVC 4KB0A 1LXJA 2AGQA 4DTSA 4TQRA 4CZCA 3ZSXA 2HQIA 2D41A 2O5DA 4FYXB 3S3MA 3CD0A 2E1PA 5BRHA 3L6QA 4QYRA 2KJVA 4MQ3A 4I2PA 3HM9A 1X9WA 3VQ5A 4CIFA 1L5UA 1URNA 5EXWA 4PR6A 3MX5A 2BQ3A 4LF6F 3UVJB 3CFRA 2J8AA 1YX2A 4Y2IA 2G8UA 2VA2A 3P3DA 2G13A 4E19A 5KG4A 2QA1A 3AD7C 4R8UA 4AHSA 3WC0A 4LRCA 4DR2K 3DC2A 2Q0UA 5IV3A 3M9MB 1T6DA 1VSDA 3LDPA 4CZKA 3MUTP 2RS8A 3LGHA 3T1YJ 3PKMA 3JSRA 1KBRA 3PJ9A 4JUZA 4JKGB 1JL2A 3MPDA 4B3MF 3NS7B 3EN9A 3CW2C 2ZUAA 5HK4A 1WSIA 4KO0A 3QGPA 3LGNA 3NAEA 4AH9A 2P5OA 1QDUB 5DRKA 2QMWA 1ATRA 4BGAA 1GLLO 4U67L 2ZOGA 3GDQA 4W5OA 5B0DA 2HFSA 1E6VB 3DAWA 3K9KA 4M3ZA 2GQCA 1KQSR 3M2UA 1C1AA 1H2TZ 4HH0A 3V5RA 4KI6A 4ZPAA 3DOLB 1HD0A 1C1CB 4CZJA 3W60A 4Y2KA 3CCRN 1YIJS 4ID8A 4USIA 4AXIA 3LPTA 5D78A 1R0CB 5EDWA 4N76A 1RWUA 2NXCA 2OTJS 1WEZA 1Y3JA 4FLUA 4RZRA 2UXCF 5I3PA 3BS9A 3VQQA 5GINA 2CDRB 3H1VX 4OL8A 2AW0A 3AA9A 1O8BA 3ITHB 4RLEA 1Z05A 3VF6A 4OX7A 5EWGA 3V1QA 4DU4A 4C11B 4O5BA 1RTDA 4XH1A 1Y10A 1FRMA 4PG6A 4LF7F 2C2EA 3DI6A 4F4WA 5IT0A 2PFUA 3E01B 4IRKA 1RWKB 2KT2A 1OH7A 3AVIA 1SIWB 4BY9C 4RCHA 3TYTA 1PJ6A 2NR0A 3SQ4A 3QMLA 1FJEB 3VHQA 2Q66A 2HHHJ 1S1VB 3ISNC 3NH2A 1HMVB 3D6RA 5F8NA 3HFZB 3L2WA 2ADBA 3DM2B 4YDUA 2MZRA 3TAMA 4CCHA 1JLQB 3KJFB 3DLLQ 1LV5A 3IFEA 2W2MP 1HNZF 5AZIA 3F9KA 2VOOA 1TL3B 1U6BA 3AO4A 4PG4A 4IOBA 4DV1K 1X4HA 4RU9A 3CJKB 5IT9Y 4O0JA 2EC0A 3BO4A 2W41A 3C46A 3VQ7A 3BH6B 3C14A 5C24B 1HX1A 3EVOA 1KR4A 3C6TA 3UCGA 4OYAA 4ZHRA 2G8HA 4F25A 2A41A 1JLAA 3TO8A 5CY4A 4JP8A 4DR5J 4OMFG 3FDSA 4ED4A 1FXXA 4OLBA 4USKA 4S0MA 1IQTA 1QHTA 3J8AA 1VCTA 3PEJA 3LDNA 3LO3A 1DT9A 4DCHA 1GMWD 5CZ2A 4OV1A 1WHXA 4DTOA 3MF5A 4X4SA 4CIOA 4L8RB 4WFBL 4DL7A 1LW2B 4CIGA 3K9JA 5D8HB 1M90T 2E29A 2UUAF 2R9LA 4L75A 5HI7A 2RB7A 2N7CA 4NRTA 1MN7A 1SJQA 1XEZA 2DR5A 3AAPA 5AFUA 5B09A 4PWWA 3CCRS 1X5PA 3V1RA 3H40A 5IM0B 1Q1KA 4I0WA 4OPKA 3UVJA 3SIPB 4DS5A 4FZVA 5AQMA 2NRVA 2DJWA 4OZ1A 4M3TA 4U9RA 5EY4A 1C2PA 1XMQJ 2Z2LA 3CD5A 1BG3A 3CM5A 4W90B 4B1ZA 4LH4A 1SV5B 2QGFB 2FF6A 1R8HA 4YB7A 3GE1A 3HHNB 3BH7B 2ZH9A 2HWIA 2G9OA 1GLDG 1NOYA 3W8GA 4WE1B 5HMXA 2C3UA 2E1ZA 3EGNA 5GMDA 3TEGA 5A76A 2CG4A 1XMOJ 5KFMA 2VONA 2NXNA 2VFRA 4HUFA 4QZVB 4M42A 4ISFA 2W9CB 4LF5F 1MMNA 1WSVA 3CCTA 1BIZA 4ALZA 3VEYA 1E6VA 2YJEA 3VQPA 4GVEA 2VC1A 5HMZA 2NXJA 4CESA 4B3TJ 3DOLA 3PSIA 1WBBA 1KAYA 1C1CA 2XEXA 3NF8A 4F9OA 3VEXA 1RK8A 3VZHA 3VQCA 3VCDA 3D1HA 4CJVA 1K9MT 3NFAA 1BWEA 3T5KA 1H73A 1BXNA 2JEFA 5AJ3F 1J9AA 3PR5B 1PYSB 1RU2A 3I5CA 2Q97A 4ILJA 2R8JA 2QXFA 4FJ9A 1VJWA 4DUZJ 4WF9L 3PSFA 3JQKA 2CADA 3RAXA 3GOIA 1TV6B 4IDHA 3CJTA 2ILYA 3ITHA 4C11A 2RHKA 1R0BG 4F2SA 1WC1A 2HIQA 4FWKA 4HT7A 3E01A 1ASWA 4DX6A 4PEOA 3HI0A 1I94K 4CNZA 3CJ9A 1W25A 2V7ZA 5IQQA 5GAHP 2J8SA 1VK3A 3BF3A 1S1VA 5E5NA 4K4TA 1TMMA 1HMVA 1FJGJ 4CEZA 5KRTA 2HHWA 3ZXWA 2NSBA 3DM2A 3FCHA 1JLGB 3OR2B 4PABA 3TZZA 1JLQA 1X7VA 1VDHA 2FVPA 2GA7A 3PFEA 1B9FA 4HWIA 3A1YG 1TL3A 3KK1B 3MMBB 2D5RA 1NJZA 4X65K 2BR0A 3HZGA 3CJKA 2DR8A 3V4IB 3TU5A 5IC6B 4URSA 4B9MA 5HQMA 2HQCA 2AZ1A 2M4MA 1PAUB 5C24A 2WVCA 5L39A 4QS9A 1FRXA 1VLOA 5GAHI 2KFNA 1Q82T 5BXIA 1HNWJ 2HHTA 1RISA 3OY9A 4MIBA 3N79A 3S41A 3BYRA 4WWSA 2IYIA 4KE5A 4QWAA 1A0OB 3HOSA 3F9MA 4A46A 5KFWA 4YR2A 2OA8A 5AQPA 3NE6A 2CNNB 4FK2A 2FBTA 1SJ1A 4R0EA 1U2VB 4JI2J 3HVTB 3MFIA 3EM1A 2Q3SA 2RPIA 1LW2A 1Q9YA 3JSYA 3CJ5A 1UEUA 5T7BA 4I6YA 3R1LA 3W5XA 5D15A 1NDLA 1ZBTA 1DBDA 3K5MA 2C3MA 3G10A 4EGLA 5IM0A 1R89A 1QZ6A 1RNHA 4X64K 2DO0A 3BBBA 5LOQA 2HPUA 3NY0A 3UO0A 1S22A 2O8CA 2COLA 3UDVA 3CT9A 3GWCA 5KFDA 1ZA2B 1U6ZA 1KVIA 2W25A 3SCKE 4OZ3A 4XH5A 4CHZA 4JI8J 3G8TA 1S72N 1HYSB 5F0WA 1SV5A 3FQKA 1NLVA 5BR8K 3EPIA 1C4AA 3AJDA 4EYHB 4JRPA 3H5XA 3FBFA 2XSFA 3GCXP 3P5TL 4Q2LA 1VSJA 4WJBA 4OHWA 4WE1A 4RBVA 1MSWD 1NO8A 3UN5A 3P38A 1HW8A 3R2DJ 1GEHA 1PO6A 2B0GA 4K42A 3MX2A 2RDIA 1RAJA 3ETMA 4F4AA 1T11A 3RB4A 3KOAA 1B7FA 3SCXA 2W9CA 4CHPA 3LPYA 4OI0A 4BRFA 3IAM9 1UFKA 1KAZA 4C8NA 4HTUA 2E5GA 2IJRA 4BC3A 3G6XA 3BDEA 4X4QA 2VIHA 1B0VA 1D9FA 2AT1B 1AFJA 3W0LA 2VWBA 4B17A 3NOGA 4OZ2A 3VTHA 3NMAA 5BYQA 3NG8A 3H4DA 2DYAA 2CWKA 4B3SF 2A1BA 4KHPK 2J0QD 4G3IA 5GAHU 3BKTA 1UPPA 3ISND 2IDEA 4PAAA 4KSEB 5HL7L 2AD9A 2WW8A 5D4OA 3D66A 4OLOA 3X3UA 3HFVA 2ETJA 2CPYA 3UNGC 3AVGA 4X66F 4NYZA 2YKQA 1TV6A 2PMHA 3JXUA 1TVRB 1HKGA 1F9HA 2MGZB 4OI4A 4M3WA 3MOJB 3R5CA 2EWHA 1RT3B 2CQIA 3U9DA 4DCPB 4E7LA 2HIYA 2NXEA 2EEYA 1VBXA 2W42A 5KAKA 4P2XA 1U1OA 3RJMB 2ZH3A 1ELOA 4CK1A 2VJVA 2F4VK 4P73A 5KPRA 2X3DA 4IQXA 3PZPA 2MSSA 3OTOJ 4EHTA 4PL8A 2W6LA 4DS4A 3W2WB 4C7QA 4V19J 5KFAA 3RTVA 4PXEA 1JLGA 3OR2A 4YHHF 3LPUA 2VG5B 1P6TA 4EEYA 4A8YA 2CQ2A 2MKSA 2BGGA 3KK1A 3MMBA 3LM2A 3TJ9A 2VQFK 3WX8A 2XULA 1NUEA 1Z25A 2B8QA 5BR9A 3UW1A 1RAGB 4Y2MA 2XC9A 3V4IA 3HP6A 3AJ2A 3QFPA 4KJIA 3MECB 1XI1A 1Z26A 1S72S 2RKIB 4NLTA 3PW2A 1T9YA 2DFFA 3GIJA 3WIVA 4WFYA 3CJCA 4KGKA 1QAYA 1YI2N 1S77D 4MDBA 4IFVB 4YR0A 5C2DA 1CQMA 2R2TA 4YQWA 1NU0A 4X62J 5B0FA 4DR2F 4DSIA 1WI8A 1WD6A 4KHSA 4MIWA 3TARA 1HYVA 5C2CA 2V94A 1HD1A 4BDPA 2JWNA 2U2FA 4BVOA 4M95A 1U2VA 1R7IA 1YJTA 3H90A 2ZE2B 2PYLA 3HVTA 2E66A 1Y97A 3P49B 1RKJA 3UD3P 1WLJA 3EGWB 4CZHA 3RVCA 2GGPB 4JI6J 4U67Q 1BE4A 3MDFA 5ETTA 3CCLN 2D9PA 2CPEA 3M6GA 4C1NI 4H5WA 3WXIA 4CJRA 4YOWA 4A59A 4NCBA 1LXNA 1E4FT 1NPRA 1E6YB 3GG0A 5CH7B 4ZP9A 4OJ3A 4CRJA 3ZETB 4GKJK 2XS2A 2GC8A 3GL1A 2YKOA 1HYSA 5JUMA 5KFVA 2AJQA 2NUHA 2NXUA 5K8OA 1KEKA 3OTCA 1QHAA 5HRSA 1GK8A 5KFRA 2MZSA 4W5RA 1HI1A 1QAXA 3KG1A 2CNLB 3ILJA 4UOGA 2EBGA 3VF4A 4DBQA 4ILGB 3KLGB 1ZPWX 2ZH4A 4ATNA 1FKPB 2UUTA 4QYZK 4PG8A 1WAJA 4BR7A 3ENHA 3C66A 2HS3A 5ETNA 3QRQA 5EOYA 4LF1A 2P9NB 4OX9K 4QOTA 2QE5A 3IR6B 3HDSA 3N28A 2ZDPA 1RHJB 1X3NA 1YQHA 2E1YA 4FWLA 1NDPA 2VZ9A 3VQ4A 3J7Z5 1Y5NB 4OZNA 2QWPA 2B4VA 3K89A 4WP9A 3TUIC 3QINA 3CC4N 1RBTA 2GO9A 3MXMA 3J7YP 1Q8KA 3V4MA 3ZT2A 2RU3A 1KVAA 1S1TB 5CHCB 1YI2S 3M6UA 3OFFA 3OYGA 1H7XA 1TVRA 1GXLA 3ILOA 3SQOP 2MGZA 3FFIB 3M2VB 3TQ1A 3RRKA 2AYMA 2SXLA 4AD6A 3D7EO 2VU5A 1RT3A 4PA1A 4CO3A 2JC0A 2RF2B 3CJ8A 2J0WA 2XCAA 3BV8A 1IWGA 5DZ7A 3C95A 4Y0FA 4Q8FA 4F36A 3VEVA 3FC9A 4EO6A 2CG8A 1M1GA 3CXCM 2D4WA 3W2WA 3J7YI 4YDDB 1IM4A 1JLBB 3CCLS 2V8GA 4X4VA 2VG5A 3N0VA 3N4PA 1V4SA 1FEHA 2I8EA 1FXLA 5KT6A 1Q8LA 4WU3A 4U7UK 4YUDA 2E6LA 2ZJQL 4H4KA 5J2MB 1UL3A 3OT9A 5K9FA 4RW8B 3UI3A 4LF8F 2MLXA 2M7SA 3MECA 3PUFA 4DEZA 5F9LA 7FD1A 3W64A 1P8GA 3MM9B 2RKIA 2O8EB 3Q7BA 1VRUB 3DLKB 4O3QA 4CLFA 4HL9A 4IFVA 3IRXB 4YOYA 2XI2A 2G2YA 1HKAA 3X1LB 1XJWB 5DQIA 4OI1A 4IOAL 4IRDA 4HHJA 2YH1A 3UR3C 3NKYA 5GAGP 2QFIA 4KGZB 3DCAA 1TR0A 3MR5A 2X51A 1HR0K 1AT1B 4MLEA 1RGIA 5HVFA 3OLBA 4I6AA 3CCJN 4IG0B 2ZE2A 2HHPA 2QWNA 5AQOA 3QNWB 2VDHA 2YHBA 1FWKA 3WBZA 3IN5A 3T6JA 2FVSA 3M1FA 3I8BA 4NLRA 2XMMA 1NPPA 2GGPA 4ID5B 4DPOA 1U1KA 5C25B 3QJPA 4YNQA 4E0DA 1NPKA 2DGOA 4BG9A 2CZ4A 4ZPTR 2IBOA 4JKEA 3PIOL 4CBXA 1WDDA 3HK2A 2YKNB 4D3GA 4CJPA 5A8RB 2CPZA 5GAGI 3OYBA 4WQ5A 2PSZA 1E6YA 1X4DA 1PJ5A 4TVAB 3CC4S 1K1QA 2HBLA 1AXQA 1WUUA 3MDQA 3ZETA 3KDOA 3LM9A 3NGTA 1SAZA 3O1WA 4MO4A 3LAKA 1RA7A 2C3PA 4ELVA 3R5AA 1F2HA 4K25A 4WF9Q 1SJRA 3IA0A 4K5SA 2RJZA 2Q36A 3MN6A 1N33K 1EO1A 3JAMO 2P1JA 4ZVPB 3OYIA 5ADXH 4RG8A 2DH7A 5HROB 3KLGA 2C3OA 3H2VE 2FY8A 2PMZD 3J7YU 1FKPA 3O3GA 3MXHP 1G3OA 4FVUA 4FXDA 3N4QA 3B6OA 1I94F 2P9NA 3AY0A 4B1UB 4GRSA 2HBRB 4KQZA 1YTYA 4GC6A 3KKFA 3QT6A 2V6AA 1KVBA 1KVKA 3LWLA 1BL3A 3C7NB 4ZTFA 2F9JA 1XNQJ 5KGXA 2W7AA 3VGVA 1EB0A 1Q81T 2QC3A 4JI3K 2EKNA 3J7A1 2RQKA 2VPZB 2BEFA 1F1BB 4KC5A 3O4QA 1ZH5A 2VFSA 3PJWA 1WAFA 4MYTA 1S1TA 2JWKA 4X65F 3VN5A 2O8BB 1S79A 1L3SA 1VK8A 1S1UB 5JJBA 4UZBA 1C1BB 3FFIA 2YPYA 3M2VA 2DNNA 4H0OA 4YY3J 2VG7B 3HJVA 3O6WA 2IVPA 4CZGA 2OPRB 2KW4A 4KGMA 2XG8A 4O8UA 1HI0P 4FO0A 2RF2A 3CCJS 3THVA 3JTOA 2BJ7A 3FLCO 5ADZA 2VQEK 2E2OA 2XZWA 2ZHBA 1WF1A 2LQJA 2H5IB 3P83D 2V2QA 4QU7A 2XRIA 4OGEA 3D54A 3FZLA 2MKCA 3QFHA 1PAEX 4EHUA 1EKEA 1JLBA 4JV5J 2UXBF 4YS2A 5LMNJ 1WG5A 5GAGU 3I33A 3L7PA 2B51A 4NLOA 4WZMA 2Z2YB 1T9UA 2CNKB 3K58A 1MWQA 1Q8BA 1K1SA 2VL1A 5J2MA 3NF9A 2AMCB 4OHYA 3J80U 1PSDA 5E3PA 4RW8A 1OPIA 1WC6A 5H9FK 3R97A 3PJXA 3C0BA 5GIPA 2A10A 1TFWA 3G4SN 3MM9A 4DX8H 2O8EA 3QT7A 1VRUA 3D1QA 3DLKA 3M2RB 4KIAA 4JI1J 2HF3A 5L46A 3IRXA 2NPFA 3N4WA 4I2QB 2NYHA 4HHHA 5DG8A 3MR3A 3V6JA 2OP5A 2IYGA 1U1RA 6AT1B 3ALYA 3H08A 1GXUA 1VGYA 1UJ4A 4NZ0A 5LJ5Y 3S8SA 5AQKA 1EARA 2Z56B 2AYBA 3HRGA 4DZDA 3KLVA 5BR8F 4IZ9A 3T1HJ 2IC3B 1MROA 2F8EX 4IG0A 4LFAJ 1RJJA 1D1UA 4OHVA 3P5JA 1XK8A 4ZN3A 3QESA 3JS9A 1I3OB 2CJXB 2PBDA 4NI2B 2RE1A 1R0AB 4FLVA 4OI6A 3I56N 4ID5A 1RBLA 4XDDA 4NXMJ 3A4TA 2FXUA 1UA1A 5C25A 4QJVA 3T5LA 2HK3A 3HHLB 3DXMB 2HQGA 4DR7K 4EFAC 1U1LA 2D1CA 1WACA 2F96A 4ZPVR 4O3SA 2YKNA 1T95A 2J7KA 5A8RA 4A2AA 4LFCJ 3E9LA 3PHEA 1KDNA 1OO0B 5HVGA 4DL3A 4LR7A 3WNGA 2D7SA 4KHPF 5HL7Q 4PPZA 1CG2A 4W5NA 3TX0A 2DTUA 3DGVA 3AHPA 4CJ7A 5J2PB 1F5BA 1XUPO 1ZZFA 5HROA 2WVFA 2ITMA 2JRSA 2GMHA 2V2VA 1FXDA 2KYXA 3S7RA 5JS1A 3AA8A 1QVFM 2QEXN 4BRAA 2OSRA 4CF1A 4FSVA 3HKZD 3T9NA 5MLCV 3GSDA 2F4VF 3VF2A 3FRZA 2GWJA 2UUCK 3TR8A 3EZUA 1NNEA 5A0YB 1IG8A 3C7NA 3EO3A 3O6QA 3AGKA 4B1VA 3LDLA 3NH0A 4NPOA 1F5CA 3SZ2A 1HWLA 3ILIA 3SSSA 2UU9K 4CVNE 5IFMA 3FCVA 4QPTA 3ID6A 2ZBPA 2GW8A 3G4SS 2H3EB 3MWTA 2V8DA 2O8BA 1ZZNA 1G99A 2KHOA 2KHDA 4FWQA 1S1UA 3OVAA 2LSNA 3W2VB 1C1BA 4OKEA 1FRJA 2PT0A 2L3MA 2VG7A 2E7WA 2OPRA 3PTWA 3FE1A 1U24A 5AQQA 1UOCA 2E7XA 3AFGA 4XIUA 3VGKA 3QEIA 3OL7A 3HLUA 3CETA 4ECRA 4DU7A 3CDEA 2DNYA 4BRCA 2OKQA 4DR1F 5AQNA 5HP1B 3GJRB 3D0HE 3HCXA 4WBFA 3M8SA 2RMLA 3POTB 3MTKA 3D6HB 3NF7A 2ZWHA 3VALA 3F44A 8AT1B 4B8CA 1ZBLA 1NZAA 2MLYA 2V4JB 3T1YK 4U7CA 2D3UA 2YHWA 1VSLA 4DX5A 2MZTA 3CEDA 2ALZA 2IM1A 2O01C 2PA3A 2QJ3A 1TGOA 2EWSA 2FLOA 1WOOA 2EXUA 1RT6B 2H48B 4BVPA 3AVBA 1U8SA 4OV6A 5EWFA 2CGKA 4J9OA 3CO9A 2P6TA 3ZX0A 2XNRA 2GZOA 3PYEA 4B3OB 1IM6A 4H0PA 3DGPB 3M2RA 4QW9A 4PXCA 2V50A 2FSJA 2LEAA 2LVWA 3RBDA 4I2QA 4K0KJ 1LW0B 4XO0A 4DUYJ 2Z1IA 1BISA 1WC5A 4ILMA 4GKJF 2BKNA 2A5XA 4DR6F 3VA3A 2M3DA 1FNMA 4BRLA 2XBPA 1F2GA 3I96A 1N48A 1NH7A 4ZCKA 3NEKA 5MLCQ 2IC3A 1V4TA 3OPKA 3K2PA 2FHOB 4O4GB 2IMWP 3H25A 2QEXS 3AT1B 1YJUA 1JJCB 2BM0A 1FTCA 3C3LA 1IKVB 3GYGA 2BA9A 3IGNA 2CDQA 4ZP6A 3MR7A 4QIGA 3O9UA 1K0TA 4NI2A 4M1KA 5BYSA 3QWPA 1IVZA 3KZBA 4HI2A 3HHLA 3WZ0A 2DNRA 3DXMA 3BSOA 1LOUA 1OMSA 2B7BB 1HI8A 4RO0A 2AP6A 2XMWA 3SAHA 3H8YA 4C0OC 1I39A 2MHEA 5E3RA 2EFOA 1RDBA 2P2CB 1U2FA 3HULA 3MMJA 3OSNA 4M5KA 4LMZA 3MXJA 1BWFO 1PCAA 2D3O1 4XPEA 3TR5A 1HUXA 5J2PA 2GMLA 1D4XA 3QNOA 1N32J 4CM0A 2M2BA 4YDXA 2MJUA 1EQYA 1X9SA 4TXSA 3AXKA 3CNQP 5DETA 1RHRB 4HTJA 4PKDB 1SH3A 4EP4A 2JVOA 4B9UA 2ZH8A 3GJSB 2YJFA 3R6MA 4BRHA 4BR2A 1TQLA 4UY85 4NZ7A 4M5MA 4DR5K 5A0YA 1DFDA 3OTEA 2XM3A 2HS4A 1ZBIA 3WX4A 4MK8A 3H5SA 1MU2B 1KSPA 1IBLJ 4JI7J 3CCEN 2V63A 3JQJA 4A8QA 3TTDA 4DSEA 3NF6A 4ZK7M 1EX4A 2ZJQQ 2M8HA 4OJRA 2DY4A 4W98A 3PX4A 1J54A 1A9NB 4E1MA 2XO7A 3CMAN 2E44A 4DZ6A 3W2VA 2YXLA 1GNKA 3FZMA 1X5SA 1HHQA 1O0PA 5B8HA 4P74A 2HB5A 3ZZPA 2K2PA 3FMWA 1FW6A 4IOAQ 1QVGR 1KOOA 3A3NB 1HL6A 3JQMA 2HVHA 5J1EB 3DU5A 5HP1A 2D3OR 1EJ7L 2W4PA 1HR0F 2QWQA 4ECVA 3POTA 2FC8A 1IUJA 2OMOA 3L3VA 2HFOA 4H4OB 1F21A 4OYMA 2V4JA 1WORA 1TL1B 3ENWA 1SKWA 3VQEA 1N34F 4C97A 4H0TB 1RYRA 3HSDA 4CF8A 2YNGB 4G1QB 5HJYA 4FF4A 2YX7A 2JLGA 4OQJA 3AVAA 2QL9B 5DO2A 4OPHA 2DPNA 1RT6A 1U1PA 2NZ4A 3ASMA 3PIOQ 4QWCA 4F02A 4CWBA 4WTYA 2V51B 2HKEA 2AJ0A 1N4LA 2VJUA 2EK6A 4B3OA 3DGPA 2R8KA 2JX2A 2AU0A 4XTTA 4LIWA 1Q9XA 1FT8A 1RHQB 5DQHA 5LJWA 4JYAF 2QW9A 2RRBA 3AO3A 1UPMB 1LW0A 4CJLA 3OUYB 4FM0A 2HSTA 1YLXA 1UAXA 2XGQA 4L76A 5KG3A 1NMDA 2HBJA 5CCLA 2ZZNA 1N33F 4OGCA 3HO1A 2XY7A 5BPNA 3W65A 4LF6J 1IKVA 1UZHA 4G1IA 3RW6A 1RCHA 1KOHA 2GIQA 2QM1A 4O23A 1HJRA 3KWMA 2OD4A 3SBMA 4URGA 4C4WA 3A8JA 3CCES 2J9EA 2JFDA 4AHRA 2R7SA 2IOCA 1O6XA 3O9SA 3QSIA 2NPIA 3FFKB 4ZVGA 3IWLA 4L6V3 1JMTA 5JVGL 3ZEUB 1RAFB 5CAAA 2FBYA 5LMUK 3EX7B 1X4GA 2FUG9 3EE3A 3G9CA 3SJHA 1N8RO 2IDOA 2XYHB 3CMAS 4JI3F 2GS8A 2ABYA 2E1MC 3L09A 4M3XA 2APOA 4WKYA 4WK3A 1D5AA 2WC9A 2ILZA 3TA0A 5AQIA 3EZ5A 1GAOA 2OGUA 2FSNA 2LQ9A 2PZSA 2CQ4A 1S6UA 2UVVA 1SQFA 2GMJA 2FZGB 3D2FB 4WFAL 2ZBIA 1HNWK 1JCFA 2VQEF 3DXSX 3HSTB 3QZ7A 3TP2A 4GW6A 3VAKA 2E7VA 3MR6A 5IV4A 4P2MA 1MU2A 4F4ZA 3S3OA 2KDOA 5ETOA 4F0HA 2ZF5O 4JI2K 1WDTA 3OYEA 1CZAN 7AT1B 1YAGA 1N5YB 3WEEB 1VIXA 4ZLJA 4M3RA 1ZETA 5AFUH 4JI0K 2GVDB 5AE3A 2I9SA 3QT8A 4NYNA 5LL6Z 2DISA 4DV7F 5DDPC 3SDEB 4HCCA 3DRSB 1YK9A