3DLEA

Crystal structure of hiv-1 reverse transcriptase in complex with gf128590.
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
538
structure length
534
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 135
structure length 534
sequence length 538
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dleA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dleA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dleA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dleA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dleA05
2OPPA 3NFAA 3KD5E 4NLSA 3UQSA 1JKHB 5JUMA 1UWBB 4ELUA 4WZMA 4F4WA 4AHUA 2ETJA 1GX6A 5SZTA 2OZMA 4EZ6A 3IN5A 1ZBHA 4J9LA 3V6DB 1NJWA 3T5KA 1S1XB 3E01B 1U04A 4Y2AA 4MKAA 4KBIA 2IAJB 2BRLA 4LH4A 1RT5A 3I5AA 3O4QA 5KFPA 3DYAA 3AVCA 4CGJA 3RR7A 3Q8SB 3LWLA 5L1LA 1S1TA 1QUVA 1JLFA 3H5SA 5KFHA 4NRUA 1RT1B 4R8UB 1S9FA 4WFZA 4ZP9A 4MKBA 4JUZA 4J9KA 1KTQA 3MXJA 3H59A 3LPTA 1RDCA 4PUOB 4YP3A 1QE1B 3KK2B 1D9FA 5KFZA 4Y3CA 4N56A 3DLGA 4I2PA 3L2RA 2ZQBA 2HVIA 5KFEA 2R2RA 1U45A 5KFNA 1NK8A 2IA6A 4DSLA 1S9GA 4DMNA 4I7FA 2HWHA 1K6YA 5KTQA 3KIOA 3VQ5A 2XY6A 5KFUA 4K4UA 4Z4CA 4I9LA 4MQ3A 3TR8A 4CHOA 3MR2A 3RBDA 2FBVA 4GVMA 2IJNA 3IGNA 5EDWA 2XI2A 4KI4A 1RDDA 2QV6A 3GILA 3WNHA 3CQ8A 1RTDB 4F3OA 4YR2A 3AV9A 4OLAA 4URGA 3ZT2A 1HARA 4NCGA 4WYWA 2JC0A 1NJXA 5DG9A 2F8SA 3QLHB 2ZE2A 2W8KA 1WSIA 3S3OA 1CXQA 4QWAA 4KSEB 1CXUA 5EWGA 4YNQA 5KFIA 4DSFA 4C8LA 4FXDA 2PYLA 3K5NA 4CJPA 4ICLA 4J9SA 4EBDA 3K58A 4DQQA 5DMRA 4FJNA 1IKVA 3OYKA 3G6YA 1RT7A 4K50A 3N6MA 1J53A 1HYSA 3K57A 2JC1A 4CCHA 4CEQA 1HQEB 4YFUA 4KHUA 3K59A 2WONB 5KFAA 5KRSA 3PX0A 2W9CB 2YKMA 1NHVA 5KT4A 2WRMA 4DTUA 3OSPA 4OPKA 3BQ1A 3NGDA 3ZSZA 4ZP7A 2R8KA 2D5RA 3O3HA 2HHQA 4R5PA 1ZBUA 5CYQB 1HMVB 3L2QA 1A5WA 3S9HA 4K4SA 4FLZA 4B9MA 3B6OA 4PY5A 4KKOB 1VK0A 3V1OA 5DG7A 2X6NA 1B9FA 1JLBA 4M3ZA 1TGOA 3QZ8A 4M42A 3ZSVA 4NYNA 1C1AA 1TKTA 5FROA 3D0PA 3DOKA 3OSNA 4CJTA 4Q0BB 4MK8A 1KVBA 3FDSA 4PWDA 4CK1A 4BWMA 1NJYA 1JLAB 2B6AB 1JL1A 3GIJA 1VSKA 4J2AA 3VQ6A 4CJEA 4H8KA 1BISA 4QWEA 1T94A 4AHSA 5KG7A 1S6QA 1YTAA 3KK1B 4BE0A 3SPZA 1HJRA 3F73A 1ZBIA 4DLGA 2I5JB 4MIAA 3PZPA 1BCMA 4B3OA 2ASDA 2OZSA 3V4IA 2GUIA 5DG8A 3GV5B 4TQSA 1ZBFA 5I3UB 3CDUA 3V9UA 4HTUA 1UOCA 4G1QA 5I42A 1TVRB 1K1QA 3H2LA 4URQU 3LP1A 4CECA 3TARA 3DLKB 3I0RB 4HHTA 3OHBA 4IRKA 4KI6A 1QSSA 1JLQB 1N56A 3HP9A 3PR4A 3M8SA 5KFFA 3AO3A 5KG5A 4H4MB 4IFYB 4Y2CA 2EHGA 3I0SB 3PW4A 4KB7A 4YMEA 1BQMA 2OA8A 2VA2A 3SV4A 2HNDB 2G8VA 1NOZA 3OYFA 3U3YA 2HHTA 1VSJA 1QSLA 4DL3A 4OKEA 1TKZB 3GIKA 2E9RX 4O3RA 3OJUA 1S1UB 4HUEA 1W0HA 2XCAA 1TKXA 2OPRB 4LSNA 1VSDA 1SV5B 1J5OB 4DFMA 1C2PA 3PJXA 1KCFA 2G8HA 2WOMB 3QNNA 3VQDA 4Q8FA 4ED3A 4KTZA 5F9NA 1VRUA 4B9UA 1KFSA 4O44A 3DOLB 1C1BB 4KO0A 2P51A 4DTOA 3HVAA 4O4GB 5J2NA 2Q3SA 4K4VA 1FKOA 3MXMA 3KD1E 3RR8A 4LQ9A 4F2SA 1WAJA 1Q9XA 2YNFA 4FVMA 4K8ZA 3QEVA 3M9MB 4EO8A 1T03A 4RZRA 4O0IA 2XO7A 4ECQA 1YVUA 3MECB 1SUQA 1LW2A 4M41A 1RT4B 4NLWA 1XR5A 4JV0A 3LPUA 4CJLA 4BDZA 4CFBA 5F8JA 4FBTA 3NGIA 1L3UA 5C24A 1BQNB 3MFIA 2UUWA 5L1IA 4KHQA 3HHKA 2V4RA 5DK5A 4CERA 5L1KA 4DU3A 1W9HA 1SH2A 4KAIA 1JLEA 4AILC 1RT6B 3KLHB 4E7KA 3RMBA 5HRSA 2RKIB 2YNIB 4CHYA 3ZSXA 5HRPA 3LZIA 5KFDA 5F8IA 4B9SA 4TN2A 3AVJA 1TAUA 4FJ5A 4IDKA 3BSAA 4RNFA 3QO9A 2P5GA 1NK0A 4CHQA 1RYRA 3RB3A 4PQUB 5F8GA 3KNAA 1SL2A 3KK3A 4CJFA 3QEIA 2C22A 2QE5A 1IKYA 4I2QB 2HVHA 4E0DA 3LANA 3TAQA 4LH5A 1JXLA 5KRTA 1RTIB 3HP6A 5K14A 4KHWA 4W5OA 1Z4UA 3QERA 3PW2A 4M3WA 1NK9A 1WNEA 2ATQA 3FFIB 4JS5A 1X9MA 4HUFA 4ECYA 1IO2A 2YHBA 3K5OA 3D28A 2CJQA 5KFXA 1IKWA 4RW7B 1RBSA 2OPSB 3NAEA 1KVCA 3JSMA 3BSOA 3THVA 4LSLA 3OL9A 1BIZA 3DLBA 4LD0A 3OYHA 3RAQA 4NZ0A 1JXBA 1KRPA 2E9ZA 3HM9A 4EYHB 3Q8RB 3E51A 1FK9B 2HWIA 1BI4B 1WSHA 3H5UA 2AX1A 2C28A 4ELVA 4FM1A 2X78A 4JRPA 3CWJA 1HNIA 1A5VA 2IOCA 5F9LA 4HCBA 2IC3B 3PVXA 1RBRA 2IS3A 3CJ0A 2QXFA 2BRKA 2AGOA 1JLCB 1JL2A 4W5RA 4ZTFA 4OGEA 3BGRB 4EP5A 3AO5A 1HQUB 2VWJA 2FJVA 4FM2A 3WNEA 4Q45A 4QPXA 4ZPBA 3BQ2A 4FYDA 4O3OA 3NBPB 4BDYA 3MTKA 2IDOA 3CVKA 1QAJA 1NK5A 4MFBB 4TY8B 5KFRA 1EP4A 1RYSA 1LV5A 3OL7A 1BCOA 2FJWA 3CFPA 4DQSA 1LWCB 3SFGA 4DFJA 3ITHA 5J1EB 1U48A 1RCHA 3KLFA 4J2DA 1S1VA 2KFNA 4OGCA 3MEEA 4RW6B 1LAWA 2A1RA 1RTJB 2XCPA 4CJ4A 1IKXA 3ZSYA 3DI6A 2YNGB 1EKEA 4KFBB 5CY4A 5J2PA 4J9QA 4J2BA 4KV8A 1BHLA 4ID1A 3KOAA 3MF5A 2P5OA 4ED0A 3LDSA 1N5YB 4TLRA 2DPJA 1N48A 2PY5A 2W7PA 2I1RA 4RU9A 1D8YA 1NK4A 1J9AA 2B4JA 5J2QB 2IM2A 3PUFA 4IFVB 2YNHA 5KT5A 3OS0A 3PX4A 3CJ2A 4ED7A 3HPHA 3DRRB 4B08A 3OY9A 3OYMA 2FVSA 1RT3B 4O0JA 5FDLA 2BQUA 3RTVA 4IG3B 2E6LA 3KLIB 4DSEA 4Z4HA 3SNNA 2W7OA 4ZP8A 4AHRA 2A1SA 3IG1B 1LWFB 2FVPA 3SJJA 1TK5A 3B6PA 3G0ZA 3OYAA 1T7PA 4KHSA 1LWEB 5FRNA 2AJQA 1VSIA 4CFAA 2VG7B 3CFRA 4TQRA 3C6UB 3AO4A 3PW5A 1CLQA 4O55A 1S1WA 1ASUA 3GV7B 3AVLA 5DQGA 3O3FA 3HXMA 1UWBA 1WAFA 2UVWA 4QWDA 3FRZA 3T5LA 4CFCA 5DLFA 3LP0A 4WE1B 3NF7A 3AO1A 4KB0A 4ECUA 3TAFA 2FBXA 4H4OB 2VG5B 5HROA 3V6DA 1JLGA 4IRCA 1T05B 1I3AA 3RB6A 3G10A 1NK7A 1NNDA 2DY4A 5EWFA 1FXXA 3HPGA 2ZD1B 1JXEA 4CGHA 2B43A 3OL6A 1DTTB 4M95A 1RDBA 4WYLA 3Q8PB 4ZHRA 3CM6A 1TK8A 1C0TB 3TQ1A 4RW8A 5KFKA 3V1QA 3SFUA 4FS2A 3PY8A 5J2MA 2BR0A 3QNOA 3NGYA 1RT5B 2D3ZA 2RN2A 2BQ3A 1RTHA 3DYAB 3PJWA 4FJ8A 4AHVA 2AU0A 1S1TB 4FZZA 1GX5A 2ILZA 4TSXA 4DTSA 1LW0A 1JLFB 4IG0A 2HNYA 4IOBA 2J6SA 4QOZB 2KTQA 5KFYA 3KLEB 4FLTA 1WSEA 1KLMA 1EETA 3V6HA 3AVMA 3WNFA 4Z0UA 3BSCA 2P1JA 3DLGB 4I2PB 3SUQA 1S0NA 3C95A 4RUCA 4CESA 4QCLA 1S9GB 1XI1A 3MR3A 3O4NA 1S0OA 3ZSRA 4FJHA 4EBCA 2JEJA 1FKPA 5L9XA 3KMSA 3HVWA 5HBMA 4CEDA 5CZ2A 1RBUA 2WB4A 3S3NA 5C42B 1N6QA 3V9ZA 3VQ7A 3H5XA 3ZCMA 2WHOA 3BQ0A 2Z1IA 4LY7A 2WCXA 4MK9A 4KTQA 4IR9A 2KQ2A 4FK0A 4NCGB 1D5AA 2ZE2B 4E7LA 2W9CA 4BE2A 2F8TA 4CJKA 3K2PA 1NKCA 3OYGA 5KT2A 4ICLB 3SUOA 1HNVB 4Q43A 2HHWA 4IRDA 3CDEA 1IKVB 1RT7B 4CIFA 1VSHA 3SPYA 4B9TA 2D0CA 4DTRA 1D0EA 1HYSB 1ZETA 3VQSA 4RW9B 4FCYA 3HK2A 4TYBA 3L2UA 1QQCA 1RDRA 2YKMB 4DTNA 2DTUA 2E9TA 2F96A 4H54A 5DGAA 3D45A 4BDPA 1XHXA 1S6PB 1JLAA 4NRTA 3NMAA 4R5PB 3KLGB 3C6TB 3OHAA 2HMIB 3U3GA 3BJYA 1Q8IA 2CKWA 4CJ5A 3KJVA 1D9DA 2HHVA 3DRPB 3VQQA 2R7YA 1IH7A 3VN5A 1JLBB 2RDIA 3RRGA 1L3SA 5CYMA 5KG4A 4G3IA 3NCIA 3M8QA 4OLBA 1RBVA 3PW7A 4ZPDA 2UUTA 1TK0A 4TY9A 1TQLA 2QK9A 4OPJA 5I3UA 4PWDB 4F4KA 2IM3A 3QETA 4XPCA 2ASLA 3ZT3A 4HKQA 3QINA 3IRXB 3DLKA 4DQPA 3BDPA 1RT2A 2Y1IA 1S6QB 3OS1A 1T3NA 4F2RA 3O3GA 1U09A 2JEFA 5SWMA 4WXWA 3H98A 3DM2B 1DLOA 4B3OB 1GOCA 1SKWA 3V4IB 3MAQA 4CEFA 3MXIA 5DQHA 4FJIA 4YR0A 3VQPA 1BGXT 4CEOA 2OPRA 1RAJA 2O5DA 4G1QB 5I42B 1J5OA 2B5JB 3LP1B 1S97A 1CZBA 2HW3A 2WOMA 3H08A 4KE5A 1NKEA 3L8BA 2IBKA 3SQ2A 1MU2A 3DDKA 1U49A 2Z1JA 2C2RA 3TI0A 3LAMA 3QGIA 1BQMB 4CHPA 3NF8A 2Z1GA 5KT6A 4ZVFA 4O4GA 4ECXA 3SI6A 2GC8A 1U47A 2DPIA 4DTXA 4DG1A 4JS4A 4ZVHA 3AVNA 3CJ4A 1ZTTA 3CJ5A 4FJXA 1NOYA 3DRSA 1C1CB 3MFHA 3RAXA 5HRRA 1VRUB 2W9AA 1SH0A 4DFKA 4ZP6A 3MECA 1VSLA 4AHTA 4KO0B 4AH9A 4E7HA 5J2NB 4NLPA 1U4BA 5DLGA 4ZVEA 4RNOA 1FKOB 1XR7A 3QEWA 1REVA 4DL5A 3NKYA 2ZKUA 3V6KA 4GMJB 2YNFB 2XI3A 4CJQA 1RT6A 2VG6B 2GIQA 2RKIA 3QIPA 2XGQA 1SUQB 1LW2B 1I6JA 5F8MA 1NKBA 2BANA 1S9EA 5HLFA 4FS1A 4IR1A 2XY8A 5KT3A 4C8KA 2OH2A 3LP3A 3SZ2A 3OL8A 4N76A 4OVLA 4PQUA 1VRTA 3HJFA 4M94A 2V4QA 4K4WA 1RDAA 1JLEB 4X2BA 4E7IA 2ALZA 2EC0A 1IG9A 4HVJA 1RA6A 1EXQA 4IKAA 1ZBLA 3HKWA 2X74A 3QGGA 2FJXA 5JS1A 3MEDB 1HRHA 4J9RA 3QO9B 3VA0A 4TYAA 3PR5B 4FM0A 1DTQA 1KHVA 3LP2B 3V81B 5C5JA 3QEXA 4RW7A 3I5CA 1O1WA 3SYZA 3EZUA 3CYMA 4W5NA 4KB1A 4U6PA 4DL7A 4DF4A 2W9BB 4NLUA 4ZPCA 1IKYB 4F50A 1ZTWA 2G8IA 5HRNA 3SUPA 4OL8A 4YR3A 5K14B 5KFBA 5EU7A 3MEGA 3K5LA 3ICLA 2UVRA 4DWIA 2RDJA 2OYQA 2X6SA 3TAMA 1SL1A 4DSKA 2AGPA 3NAHA 5KFQA 3BREA 5KFLA 4ED8A 3JSMB 4LSLB 3AVFA 1JLCA 2Z1HA 2OPQB 3QGHA 3M9OB 4Y34A 1HQUA 2ITGA 4OKKA 3N6LA 3OYJA 4E19A 2R2UA 4Z4IA 3HVTB 5D3GA 3F9KA 1YT3A 4L8RB 5KG3A 1TV6A 2C2DA 3IS9A 4TY8A 4OKJA 4F4YA 1HNIB 4PA1A 3HO1A 4CGIA 5HP1A 4IQXA 3EZ5A 2G8UA 1BL3A 3P83D 3GYNA 4ELTA 4I9QA 1LWCA 3ISND 1S0MA 4CJVA 2RPIA 2EX3A 4BE1A 4NLGA 2VA3A 3AVGA 1ASWA 4E89A 3ALYA 5C25A 3M8PA 4RNMA 3NF6A 3UIQA 4O4RA 1S48A 4JRQA 3DMJA 3AVHA 3JYTB 3PW0A 4J2EA 1XHZA 2R8GA 2YKNA 1EP4B 3TVKA 2FC0A 4RW4A 4FJ9A 1R0AA 3T5HA 4XIUA 4DQIA 4CJ3A 3NDKA 3AA3A 3IAYA 3ITHB 4HUGA 4ZTJA 3KLFB 2C2EA 5F8HA 3ISNC 3VQAA 1S1VB 2O4IA 2D0BA 4FW1A 2FLPA 1W25A 3MEEB 1HPZA 4IG3A 4RG8A 3QYYA 3EY1A 3KLIA 3DLEA 3DI6B 2YV0X 1QHTA 4FLUA 5J2PB 1KSPA 4B9LA 5KFOA 1GOAA 1TL1A 4N47A 1KFDA 3DLHA 4DSJA 4EBEA 2XHBA 3HPOA 2VWKA 1JIHA 2IJFA 2UVUA 2RF2A 4ZMMA 4CF0A 3OYDA 3A2FA 5KGXA 3PO5A 4ID5A 3G6XA 4F4ZA 4NLOA 3L2VA 3C6UA 4CJRA 3L3VA 3OYBA 1SKSA 1C0UB 4DLEA 2KW4A 5FDLB 1JKHA 1N4LA 4RNHA 1L3VA 2FVQA 3AVIA 4CIEA 1XC9A 4O5BA 4QW9A 4QWBA 4XO0A 2AX0A 1S1XA 3E01A 2HNZB 4Q5VA 1TL3B 2G8FA 2HHSA 4EYIB 2IAJA 2BE2B 4U7CA 4HYKA 2GV9A 3D5MA 1S1WB 3M9NB 2ZD1A 4URSA 2OPPB 1Z26A 1DTTA 5JS2A 4GC6A 5KG1A 4GW6A 4CJUA 3G86A 3LP0B 1RT1A 1TAQA 4B9NA 4R8UA 4DL2A 3EPGA 1IM4A 4C8MA 1C0TA 5HROB 2AQ4A 4PUOA 3PX6A 4KRFA 1QE1A 4WFYA 1JLGB 4FZYA 3OYEA 3KK2A 4ED1A 3OLBA 4YQWA 1B92A 2FVCA 5EWEA 3TAEA 3QIOA 4W5QA 3TAGA 3NE6A 4WFXA 3SUNA 1YTUA 1S49A 5KFJA 1X9WA 4J9NA 4FLVA 1C0MA 3OLAA 5L1JA 2ILYA 4ZHRB 3KLEA 3LZJA 3CFOA 4F4XA 4RW8B 2HAIA 5DQIA 3QESA 5J2MB 4Y1DA 4FK2A 1S4FA 1ITGA 1RTHB 3TABA 2IM1A 4CJSA 1RTDA 3P1GA 3N6NA 4E3SA 3GIIA 1QAIA 1BIUA 1LW0B 4XPEA 2LSNA 4IG0B 4I7FB 2R2TA 4ECRA 2HNYB 3QLHA 4DU4A 3AVKA 4KPYA 4CEZA 2WTFA 4FJMA 3HL8A 4B8AB 3NGZA 5KG0A 3VQBA 4E7JA 4IH6A 3RRHA 1KLMB 1EETB 5C42A 1NHUA 3HT3A 1GOBA 1WN7A 4B8CA 5KFMA 2BDPA 3RWUA 4Y1CA 3OJSA 4DF8A 4TXSA 4NLDA 3EYZA 2JLEA 4Q44A 1S10A 4CGDA 2HB5A 4FJ7A 4CE9A 4KHMA 3AVAA 1KLNA 1I39A 1HQEA 3SQ0A 1QSYA 4B9VA 2WONA 1L3TA 2PYJA 2G8KA 1Q9YA 4NYZA 1FKPB 1LAVA 1WSJA 5HBMB 2GIRA 2XRIA 3M8RA 4QW8A 5DGBA 1HNVA 3I8DA 5KG2A 1N6QB 2JEGA 4J9MA 1VSMA 5CYQA 2FLLA 3BR9A 4O3PA 4M45A 1HMVA 1ASVA 1JX4A 4CIGA 4KKOA 3ZSQA 4RW9A 4NLVA 1B9DA 3T1AA 3NAIA 3P5JA 4CHNA 2DFFA 4C8NA 3G6VA 3H4BA 3GV8B 1S6PA 4Q0BA 2IM0A 4FJJA 5KFWA 3KLGA 3KHRA 3RMDA 3TWHA 2W8LA 3C6TA 5KFCA 2B6AA 2HMIA 4KHYA 4FLWA 1QS4A 4W5TA 3OVNA 3LALA 4DL6A 3DRPA 2R2SA 3KK1A 3MR6A 2XGPA 4E1MA 2XC9A 4K4TA 4JLHA 4NCBA 2I5JA 3ULDA 4R0EA 2E6MA 4CJWA 1TKTB 2BGGA 3DOKB 1K1SA 3TANA 5FRMA 3U6FA 3FSIA 3QIDA 4CK2A 3IRXA 2ATLA 1WSGA 1YVFA 4KHNA 2YHAA 1TVRA 4ZPAA 4M3XA 3KJVB 3VA3A 3H4DA 3CO9A 3I0RA 3OYNA 3SCXA 4BWJA 4QWCA 4FJGA 4IKFA 1D1UA 4ECZA 4DTMA 1JLQA 5CYMB 3T19A 4M3UA 4C8OA 4H4MA 4CGFA 3M8QB 4IFYA 3DM2A 5KI6A 3I0SA 3HVRA 1VSFA 4Z4GA 2W42A 2HNDA 4M3YA 1HYZA 3ZT4A 4K4ZA 4O3SA 2KZMA 1UA0A 1TKZA 2B5JA 4ECTA 1S1UA 3ASMA 3AVBA 1SV5A 2V0NA 5KFSA 1NK6A 1RT2B 3V9XA 4FZXC 2FVRA 4FJKA 4O3NA 3EPIA 3VQCA 3GIMA 3CG7A 3AA4A 3RMAA 2QKKA 3DOLA 3UR0A 1DLOB 3QEPA 1C1BA 4BACA 4NLXA 3CIZA 3RB0A 5F8NA 4CF1A 1NJZA 2JEIA 2V9WA 3TAPA 1SKRA 3T5JA 1TKXB 4LSNB 4DEZA 1C1CA 3KLVA 1MU2B 4FK4A 1Y97A 4NLQA 4CGGA 1HYVA 4NYFA 4DQRA 4O44B 4F3TA 5JXSA 1RT4A 4Z4EA 3BSNA 4DG1B 4HCCA 4CF2A 1BQNA 4M3RA 1RNHA 2R8IA 3H5YA 4DU1A 3DRSB 2JGUA 2VG6A 1CSJA 3QZ7A 3KKSA 3SQ4A 3RBEA 1T03B 2GBZA 3KLHA 1F21A 4GC7A 2YNIA 2D41A 4QAGA 1WLJA 2R8JA 2FBTA 3Q8QB 2AGQA 3V9SA 3NF9A 4ED6A 1REVB 2R8HA 4CEBA 1L5UA 5C24B 3OYCA 4DTPA 2UVVA 1EX4A 3VQEA 4RUAA 5F8LA 3GQCA 2BQRA 1RA7A 2D7SA 4Q8EA 2IGIA 3QIPB 3KMQA 4ECSA 2G8WA 1J54A 4OJRA 4FW2A 3V1RA 4J9OA 4CFDA 4UQGA 4EEYA 2BANB 4I2QA 4IH7A 4CEAA 1S9EB 3MEDA 5HLFB 3ZSOA 4DS5A 4K8XA 4CHZA 3HYFA 5KG6A 4DFPA 1T8EA 2D0AA 1RTIA 3AA5X 4CF9A 4AHCA 4IDKB 3FFIA 4O3QA 3LP2A 3V81A 4JV2A 4IBNA 4N41A 4N5SA 1C6VA 1VRTB 4DTJA 1ZYQA 3K5MA 3FQKA 2OPSA 2W9BA 3ZSWA 3KK3B 4EP4A 3NHGA 3KHHA 1X9SA 3RMCA 4CK3A 4DL4A 3DLRA 2XY7A 2Y1JA 3SI8A 4FLXA 3T3FA 5KFVA 5T7BA 1RILA 1FK9A 1Z25A 1DTQB 2F8EX 1BI4A 1IKWB 2IC3A 4MH8A 3PHEA 4EZ9A 3H40A 3OYIA 2QKBA 5EUHA 2OPQA 4LQ3A 4ECVA 3L3UA 2FLNA 3MEGB 3V9WA 2AWZA 4RNNA 3HSTB 4FLYA 3BGRA 3NH2A 3TAMB 2DFEA 3LAKA 3I5BA 3HVTA 3MR5A 4Z4FA 2O4GA 3AO2A 3NBPA 3C94A 4MK7A 4MFBA 3AA2A 3VQ4A 5KT7A 5J1EA 1OS5A 2XY5A 3S3MA 1QTMA 3CM5A 4MIBA 4WXOA 1WNSA 2KZZA 3UDLA 3LWMA 4WZQA 4RW6A 1RTJA 3WNGA 2XWYA 4ECWA 5D3GB 1RBTA 1VSEA 2FBYA 1G15A 3JYTA 1TV6B 3IS9B 2YNGA 4KFBA 4KTWA 5HP1B 2PZSA 4ED2A 3L2WA 3OS2A 4F8RA 1N5YA 4NLYA 2NUBA 3NL0A 2HHXA 1MMLA 4NLRA 2WK4A 2IMWP 5J2QA 4NCAA 3ZT1A 3CDWA 4IFVA 1TKDA 3DRRA 5C25B 3M8PB 1UAXA 3PO4A 4KAZA 4K4XA 4CF8A 3KKRA 1RT3A 4JV1A 2D3UA 3DMJB 1SH3A 1IKXB 2HHUA 4CEEA 3UPFA 3SQ1A 4KV8B 3OYLA 1WSFA 4KHRA 3IG1A 2YKNB 4DS4A 1LWFA 4RW4B 3PV8A 1R0AB 2DFHA 1A5XA 1LWEA 4E1NA 4J9PA 3FQLA 2ASJA 2VG7A 5KFGA 3KTQA 5KGWA 1C0UA 3NH1A 4DSIA 2YNHB 4IH5A 1KHWA 4M3TA 1HPZB 1S5JA 1SL0A 2E4LA 1UA1A 3DLEB 5T14A 4FJLA 3KHGA 4EO6A 3SV3A 4WE1A 4FBUA 2J6UA 1TL1B 4NLTA 1CZ9A 4H4OA 3KHLA 2VG5A 5KFTA 3NH0A 2RF2B 5CZ1A 1TP7A 1XWLA 4ID5B 2HNZA 1TL3A 1XR6A 3V6JA 5E41A 2KFZA 1T05A 2BE2A 1X1PA 2J6TA 3VQ9A 4K4YA 3ZT0A 3CJ3A 4ZVGA 3RB4A 4KREA 3IGVA 3VQ8A 1KVAA
chains in the Genus database with same CATH superfamily
3DXBA 3NFAA 4LF8K 4OPAA 2J7UA 3NGUA 1RQ0A 2P9GA 1O8BA 1WTBA 2XULA 3VEYA 5SZTA 4I69A 2OZMA 3X1LB 2OEMA 4J9LA 4UUXA 5HATA 2HS3A 3RW6A 4D3HA 3T5KA 1S1XB 3U4LA 4Y2AA 1B99A 1RT5A 3TR5A 2B3TB 1CJKB 5KFPA 4DZ6A 2G0JA 3AVCA 4UZCA 3LWLA 3D0GE 3AODA 4DR1K 3GIRA 1FEHA 2VQEJ 3L95X 5HMXA 2OGUA 4R8UB 1EIYB 4ZIVA 4CT8A 4ZP9A 3PYDA 4MKBA 4TNOA 3H59A 4PUOB 4YP3A 3GYXB 2C3MA 5KFZA 5AFUH 4Y3CA 4I67A 2Q36A 3AQPA 1U45A 2HEKA 1NK8A 3FZFA 4FWQA 2HWHA 1AB8A 3VQ5A 1WUUA 2XY6A 4K4UA 2ZNZA 1UJ4A 1FNOA 3TR8A 4CHOA 4CT9A 4XDDA 1JXVA 1GXLA 3RBDA 2FBVA 3HHNB 4GVMA 2CQBA 5CD4H 1Z05A 2QV6A 2HGLA 4F3OA 3B6BA 4YR2A 4A8QA 4OLAA 4URGA 4EI2A 3M3ZA 2H3GX 2F4FA 4A47A 3PRDA 1NJXA 2GEMA 2GHPA 4M63A 3IWLA 2NRTA 1JQGA 1CXQA 3S3OA 4JKCA 1CXUA 1XMOK 1ATRA 3Q23A 3HHLD 4YNQA 5HMYA 4FXDA 2PYLA 4JI0F 4ICLA 5HO4A 3HSGA 5DMRA 4FJNA 1W2BR 2ROPA 2VBWA 4CLUA 4K50A 2LXIA 1VCTA 4WK1A 1RTZA 2M7SA 4I1TA 3K57A 3GJSB 4CEQA 4JKAA 1HQEB 2QTWA 3K59A 3R3LA 2FZKB 2WONB 5KFAA 2J8AA 4B17A 2CQHA 5IV4A 3MUVP 1W2BM 2ZZNA 3J7AP 4YOEA 1HMVB 4FLZA 3OTCA 1OVQA 3B6OA 4B3TK 3QSIA 2X6NA 1JLBA 1HWIA 3QZ8A 1BWEA 3VGMA 4NYNA 2YX1A 5D4NA 3OSNA 1X5OA 4RJVA 4YY3J 2MZQA 4ZJOA 1NMNA 1NJYA 1LFWA 1RI7A 1S77D 4K5SA 2QA4S 4B9QA 4F9OA 4QWEA 1T94A 1SJ3P 4AHSA 2F40A 3FBBA 5D0RA 4G1IA 4M5JA 1YTAA 4FF4A 4BE0A 3SPZA 3F73A 2V5HG 2I5JB 1VGYA 3PZPA 4B3OA 1CS4B 2ASDA 3V4IA 1SQGA 2J76E 5DG8A 2GUIA 1YITS 3GV5B 2HRYA 5I3UB 3V9UA 1FJ7A 4PAAA 3CCEN 4ETXA 3H2LA 5I42A 1TVRB 2VFSA 2LVWA 4I4BA 3WIUA 1V3ZA 2B9EA 3OHBA 5JJBA 1QSSA 1N56A 2AZ1A 3HP9A 3AO3A 5KG5A 4IFYB 2IHR1 1HNZK 4LF5J 4ZCIA 3SV4A 2HNDB 3U9DA 2G8VA 1T3VA 3D1HA 1KAYA 1VSJA 2L3MA 2R7TA 4DL3A 2LEAA 4M8LA 2AIRB 2FZCB 5KPTA 1JCFA 2XYPB 1NJIO 3WBZA 1SV5B 2UU9F 3KVGA 5DO2A 3M2RA 3OUYA 2G8HA 2WOMB 3BPSP 4PWWA 4DV4F 4RR5A 1YJTA 1ZZFA 4HHUA 3IXQA 3MCMA 4CQ1A 2OP5A 3IWXA 2Q97A 2P51A 3HVAA 4O4GB 1FFSB 1NLVA 2Y1RI 2O01C 2F9WA 5AR0A 4RUBA 1RWNB 2L9NA 3MXMA 1S12A 1WF0A 3RR8A 4EFHA 4LQ9A 3DLJA 5K8OA 1Q9XA 3C6HA 3QEVA 2HFOA 5L9NA 1T03A 5C2GA 4DUZF 5AQLA 4HI2A 2XO7A 3MOZA 4DR3J 1SUQA 3E9LA 4M41A 2J9DE 3AJ2A 4KH1B 4NLWA 5ADXA 4DCOB 4LUBA 2HFVA 2FLOA 1U1NA 1MNEA 2CQGA 3MFIA 4RUHA 1Y3KA 4R79A 2MQOA 2P9PB 2GA7A 4ILGB 4CERA 1W9HA 1SH2A 1WBBA 2AP6A 4E7KA 2DNZA 1CJVA 2QI2A 5HRSA 4P2MA 5HRPA 3THYA 2XYHB 4LRCA 5C0YA 3HULA 3BSAA 4RNFA 5HVHA 1NK0A 4GV6A 1RWWB 1KNZA 3DXMB 2X51A 2DNMA 3AXKA 2DKOB 4HT7A 3CC4S 2BKPA 1RYRA 4PQUB 2I38A 4Y2IA 3DDNA 3GSDA 3O80A 4I2QB 4GO5X 1WI8A 2HK3A 2CZ4A 2NPFA 2D4WA 3J81Y 5AFUA 1Z4UA 3AGRA 3PW2A 3FFIB 3AAWB 1X9MA 2MDAA 5DRKA 4DR4K 2CJQA 2HRUA 2GJ2A 2AKWB 1RBSA 3JSMA 1CQNA 5JMVA 4LSLA 4NZ0A 1H73A 2MKSA 1KC8T 1KRPA 2E9ZA 2VD3A 3JTNA 2IIHA 1IBLJ 4FSVA 3OR1A 3Q8RB 4EYHB 5CD4A 3SEOA 2G4BA 1PYOB 2O8EA 2H9ZA 2HWIA 4MT1A 3H5UA 2O8BB 3JB9k 3CWJA 4UZBA 2Z2MA 4HCBA 2QT7A 1RBRA 4RO0A 4B3SJ 2QXFA 1JLCB 1NPKA 2YKQA 1Y5IB 3N79A 3T1YF 5ETLA 4IEIA 2P9LB 4ZTFA 2BM1A 4OGEA 2ZM6F 4C0OC 1RWOB 4DV5J 4GVBA 2VWJA 3ID8A 1RLCL 1RAEB 4B1VA 2MHNA 1FESA 2V9KA 5TKYA 3ETOA 4UT4A 2GIFA 1S3XA 2HBQB 2BJ3A 5KFRA 4LF7K 4C0HA 4OPHA 4IQMA 3WDOA 1XQSC 3CD0A 4DFJA 3ITHA 5J1EB 3JXOA 2DNNA 1RCHA 2KFNA 2CPYA 3MEEA 3PXGa 4O5FA 2MTLA 2A1RA 2DHXA 2XCPA 1L3KA 1NGCA 4USUA 3IWNC 1IKXA 3DI6A 2YNGB 2Q3PA 5CY4A 3T7ZA 5J2PA 2XSJA 4J2BA 4W92B 4ID1A 1SBRA 4DV3J 4BC9A 2XB2D 1N48A 3NY0A 4X65J 5DS7A 4FP9A 1D8YA 4DJBA 2DNLA 1J9AA 5J2QB 3PUFA 5C15A 1HBOB 3UN3A 3HPHA 4MLHA 2K7JA 2FVSA 3CETA 5FDLA 2BQUA 4IG3B 1NGHA 1SC4B 3ZETA 2R7OA 3VCDA 1N8RT 2FVPA 3B6PA 4XTTA 2HYIB 1YRUA 4B02A 2R7XA 2RE1A 1P90A 4ILJA 4KHSA 4IO1A 3MMVA 3P45B 4PG6A 2IDLA 2VG7B 1Q0NA 5B0AA 3Q8YA 5GAGU 3AO4A 3P96A 1CLQA 2C1EB 2GMHA 3KFWX 3K5PA 1JMTA 3AVLA 3FBEA 1HBNB 2JX2A 2PC6A 3QJJA 5KAKA 4CFCA 3E66A 3AAPA 2QMUB 1FE4A 4H4OB 4W4MA 3VF2A 3J81j 4CZMA 4DX5A 1NGIA 3O9SA 1I3AA 4UOHA 1EB0A 4BS2A 1SS6A 2B4PA 1NK7A 2Q2RA 4M63C 3G8QA 3CC2N 2O1PA 3SK3A 5GVQA 1VQPN 2IVOA 3DJCA 4DCHA 1C0TB 4K43A 1X5PA 4CM0A 1YJNN 4CTAA 2BQ3A 1RUSA 4DV7F 4B1YB 2PSZA 2AU0A 2ILZA 1MG7A 4DTSA 1LW0A 4ED5A 2GV1A 4BGBA 2HNYA 3N01A 2P9UA 2KTQA 1W7WA 3KLEB 4DV4K 4OMFG 3WNFA 2G0CA 5GAHI 2YJFA 3MEKA 3PYEA 3BSCA 2P1JA 3QFPA 2QL7B 2ZKTA 1RAIB 4BY9C 1YJ9N 2A2DA 1XI1A 3F44A 1S0OA 4UTGA 1KWMA 3ZSRA 2OAUA 4EBCA 4FPBA 3CPEA 4DXLA 4ISGA 3KMSA 3ADAC 3EMTA 5HBMA 4CEDA 2HBLA 2WB4A 3S3NA 1X4CA 2XZWA 4ANEA 3WZ0A 4JOUA 1KVJA 3BQ0A 5LMUJ 2Z1IA 1TMMA 4MK9A 2E5GA 3IR7B 4JI2F 4DR7F 2KQ2A 4FK0A 4NCGB 2JZ5A 2KB2A 1B0PA 4BE2A 1CZAN 3W64A 1UPPA 3H25A 2ZUGA 1ITPA 1XNRF 1W97L 3AGKA 4LF6J 2GNKA 1NKCA 5KT2A 1FF2A 2N3LA 4IRDA 3CDEA 1RT7B 4BRAA 2YWWA 2BUNA 3SPYA 3SAFA 3CMAN 4DTRA 3AD7C 3DOMB 4BRQA 4FCYA 2IVNA 5IOLA 1K44A 5ETSA 2FPHX 1SI9A 3NGRA 2QLWA 1AUDA 2E9TA 3RBZA 2F96A 4H54A 2HBRB 5DGAA 3VAHA 1ZBTA 3VGUA 2HHHF 1NDPA 1S6PB 2RHKA 3D7SB 4USIA 1KONA 2D69A 4WP3A 1M5VC 3O8WA 4P73A 3A5LC 4CJ5A 1UVLA 1IH7A 4YOVA 1XMBA 5KG4A 1VIXA 3PSFA 1FD8A 3PW7A 4ZPDA 3NMRA 2UUTA 1HWKA 3BEXA 1TK0A 2QK9A 3C15B 2CQ1A 5I3UA 4F4KA 2IM3A 4X4PA 3ZT3A 2VOPA 1LOTB 1VJQA 1Q5VA 4H0OA 4DUYJ 4F2RA 3OS1A 1T3NA 2V67A 2AJ4A 4NXNJ 2ZH5A 2RDDA 3EN9A 5T7LB 3DM2B 3W9IA 3MAQA 1DAXA 2MXYA 4CEFA 1VBKA 2FC9A 4FJIA 4J9VA 5D8HB 1T9TA 1BGXT 1HKBA 3IBWA 4QJVA 2A2CA 2V8GA 1CZBA 4DU7A 3D2WA 2WOMA 3MMAB 3H6EA 3T1YK 3VGKA 4ITSA 2HBYB 3KHYA 2VPZB 2C2RA 2ZM6K 3IC1A 1DY3A 3QGIA 2WC9A 2KI2A 3MM8B 4CD1A 2UXCJ 4UY8T 4ZVFA 2EBEA 4O4GA 1AZSB 1F3VA 2OSQA 2GC8A 2DPIA 1C0GA 4OZ3A 4JS4A 5HI7A 2PMZD 3V2UC 2V2QA 4NI2B 2ZGYA 1PYTA 4FJXA 4AXIA 1NOYA 2OJ3A 4PL8A 2UUCK 5HRRA 1VRUB 1SH0A 2NRRA 4AH9A 4P10A 1H38A 5J2NB 3DXSX 1BU6O 2XS2A 3CCRN 5DLGA 1REGX 4LFAJ 2HBKA 3C8YA 1UWAA 3QEWA 2P9PA 3G9CA 1TU0B 3NKYA 1DFDA 3MM7B 5JVHL 4NA3A 3V6KA 4GMJB 2HPUA 3BBCA 2GIQA 5E3PA 2PT0A 3Q8UA 2QEXS 2LQJA 4LT6A 2BANA 3I9ZA 1S9EA 2VZ9A 1T9WA 4IR1A 3SBTA 5DM7L 2XY8A 3DXMA 2W2QP 4C8KA 5LSOA 5BRHA 4WCEQ 1DARA 3BGLA 4B3MF 4N76A 3DCAA 4PQUA 3LPYA 1JLEB 1NWKA 2IA0A 4BBYA 1KVKA 5IZHA 4K0KF 1ZBLA 2IRUA 3HKWA 5BRDA 1S22A 3QGGA 5JS1A 2FZGB 4KT0C 4LFBF 1HRHA 2GVDA 4UQTA 3QO9B 4GKJF 2N4CA 3K8WA 3ET6B 3PR5B 1JWWA 3W66A 3MXHP 2PFDA 1IQTA 5C5JA 3QEXA 4JI3J 2DNKA 4RCHA 4HH1A 3E1YA 4KB1A 2HF3A 1VQ4S 3TZZA 1R8HA 1ZTWA 3SUPA 2PBDA 4YB7A 1HPMA 5K14B 1GFWB 4ZVSB 2LA4A 2E1CA 3GR0A 2OYQA 3SAHA 3TAMA 1R27B 3IP0A 4LFCK 3GG1A 1S59A 5MAOA 1NZAA 2AGPA 4DV7K 3Q24A 3D2FB 4ED8A 1G7CB 3IAM9 1KDNA 1BA0A 1JLCA 1EARA 3G6EN 1M5SA 3TRGA 1OMSA 3QGHA 2AJ2A 2P9LA 3TNVA 8ATCB 2Z58B 5E3RA 4RPFA 2CGLA 3HVTB 3F9KA 1YT3A 4JI6J 3IS9A 3UI3A 3EZ5A 4LF9J 1YZ7A 2G8UA 5A8WA 2VPXB 1QZ6A 3P83D 2CFXA 3NXZA 4ELTA 3L4BC 4PABA 1WHVA 4OIXA 4OHVA 2CJXB 4TU9A 3TX0A 3NS7B 1TFWA 1ASWA 3QAUA 2ZC3A 2ZFHA 5C25A 4DPTA 4G1PA 4RNMA 2DHAA 4O4RA 4JRQA 5LT5A 3PW0A 1XHZA 3Q8VA 2R8GA 2YKNA 1ZA2B 1SKUB 4HUGA 4H0XB 4CO5A 3ILOA 4HT5A 1XNRK 3VQAA 3CJ7A 1W25A 1CG2A 1HPZA 1SC3B 2K3KA 4IG3A 2CNKB 1DZ5A 2KH9A 4FNIA 3NEKA 3DGPB 1S72S 5KFOA 3UD3P 5DM6Q 1GOAA 3DLHA 3Q0AA 3UFCX 2ZWHA 2IJFA 2RF2A 3EDRB 4X4SA 3ZZ0A 3OYDA 5E33A 3PO5A 3L7UA 1ZZNA 4CNZA 2OTJS 3L2VA 1MMNA 1NLKL 3L3VA 2BABA 2F7VA 1C0UB 1MROA 2AYEA 2LP4A 1N34F 2N7YA 4RNHA 2MGZA 1L3VA 3AVIA 3NMUA 1RABB 4J37A 3FCWA 4F4AA 2AX0A 1IR2A 1MWYA 1JNRB 2GV9A 1F6TA 1S1WB 2MKIA 3GFZA 1HNXJ 1P9QC 2VBZA 5JVGQ 1XC3A 3AJ1A 2CPEA 4CJUA 2C3YA 4K42A 3KWIA 4B9NA 2JH3A 3S6EA 3IA0A 3EPGA 3S41A 1IM4A 1C0TA 5HROB 3AOAA 2UUBF 4KRFA 2A41A 1VQNN 1WG1A 3OYEA 3KK2A 1TELA 1OH5A 1U2CA 4GY2B 4YQWA 1GLLO 4W5QA 3TA0A 3TAGA 4WFXA 4M5DA 3ZZPA 1Y9OA 3D68A 3MAHA 2VKRA 4FXVA 2MQMA 4J9NA 4PG4A 4B1UB 5L1JA 3KLEA 2UXDF 3LZJA 5GAEP 2B7BB 3CFOA 4WFAQ 3FK4A 1EAYC 2HAIA 3MD3A 1RWMB 3DU6A 5DQIA 3UD4P 4OI0A 1T9YA 2O8DB 3QESA 3J80Y 4Y1DA 2YKPA 2AF6A 1ITGA 2CG8A 4QU6A 3VHQA 1RTDA 5B0FA 3CCVS 3HFVA 1HNWK 3KG0A 1BIUA 1GLCG 2ZJRL 4IG0B 2R2TA 4HDHA 1BQXA 4P2XA 3W60A 2ZJPQ 3MK6A 4IWVA 4NL5A 4CEZA 3HL8A 4B8AB 4ZN3A 1YHQS 1EETB 1WORA 3HT3A 1GOBA 4OYOA 5KFMA 3FMWA 1Q8KA 3G87A 1FDAA 2HURA 1RCXB 4TXSA 2ZBIA 4BRMA 2JLEA 1S10A 3TOQA 4FJ7A 5AQTA 1KLNA 4OFZA 2R9LA 5BRFA 4B9VA 1H2VZ 2JOQA 1FRIA 3SSRA 4CH0S 2YQ3A 1Q9YA 3VAFA 4JI0J 4F02A 5IT9O 2GIRA 2XRIA 3M8RA 5KG2A 1N6QB 4J9MA 2KHDA 3G25A 1U1MA 5CYQA 2FLLA 1Q86T 5IC6B 1G3OA 1HR0F 4CIGA 1NHKL 2IYIA 4CIOA 2WSFC 2VBXA 3T1AA 3NAIA 3P5JA 4C8NA 5CR4A 1NB2A 4CLWA 1S6PA 1VQYA 4FJJA 4EUVA 2GTDA 2B6AA 3M8ZA 5LL6d 5AZIB 1FT8A 1HD1A 4DL6A 3O4WA 3J7Z5 4FWKA 4L76A 2V68A 1QZ5A 3KZBA 5LMNK 1O51A 3MR6A 4GKJK 4NXMJ 2GMJA 4E1MA 2XC9A 4K4TA 4JLHA 4A8KA 2DNGA 3ULDA 2E6MA 1W26A 1LK5A 1U6BA 4C8ZA 4JEPA 2IVYA 4ER8A 3R7SB 3CD6S 2YHAA 4ZPAA 3KJVB 4PPZA 1UVJA 3W5YA 5A2QY 4IKFA 4DTMA 3P49B 3SMZA 3SSQA 3DM2A 1VSFA 2CH6A 2AT1B 2APOA 2EK6A 3ZT4A 4HHJA 4WTOB 5B0CA 3J81U 2C2MB 1VQ9S 2KZMA 1UA0A 2N4DA 1TKZA 1S6UA 5KFSA 5FLXY 3MMAA 4FZXC 4LF4J 2A1BA 2MQPA 3MM8A 1Y7PA 1UKUA 2CPFA 3QEPA 2KM8B 4MJKA 4F3QA 2YQ0A 2H54B 2OANA 3RB0A 4NEZA 2DCUB 3R9LA 2UU9J 2PE8A 2FSJA 3MUMP 4J8FA 1TKXB 4LSNB 2ACMA 4KGXB 1YITN 2IDEA 3WHIA 4DEZA 1ZS6A 3K7RA 4ISFA 2DRDA 4NLQA 2P9NB 5C2FA 2KHOA 1HYVA 4DQRA 4DV0K 2HFUA 4F3TA 1RT4A 1S57A 3ZTOA 1U8WA 2E1PA 1UEVA 4FYVB 3O6QA 1Q81O 4DPXA 1ZAVA 1RNHA 4EWTA 2R8IA 4DU1A 3BKUA 3DRSB 4KY3A 3CMEN 4DUZJ 1WTFA 3RBEA 1WF1A 1TUWA 3KLHA 3GLJA 1YJWS 2FSNA 2KN4A 2YNIA 2PI5A 2V51B 4RBTA 1KQSR 2D41A 1T9XA 3GOIA 4NYOA 1WLJA 4DMZA 2CQPA 2RE2A 3Q8QB 3V9SA 2O66A 3NF9A 1U1OA 2UVVA 3IBFB 3T41A 3F41A 3GE1A 3GQCA 1S7HA 2Q43A 3K0SA 3Q2TC 1KQSM 3QIPB 1FW6A 2G8WA 3Q7CA 4OJRA 3R97A 4FW2A 4JYAF 4CFDA 4UQGA 3AJDA 4HTLA 4IH7A 1TL5A 5HLFB 1SJ4P 2F7TA 4DFPA 2ZUAA 4CF9A 4AHCA 4IDKB 2V2VA 2MZJA 1SC6A 3TWZA 2HQCA 3MI7X 2UP1A 3HI9A 4N41A 5AQRA 4N5SA 1C6VA 4DTJA 2P9KA 5AXNA 4NOHA 1RWKB 3K5MA 2QA2A 3R5CA 2XM3A 3VVTA 1AYEA 3KK3B 2Z0GA 1X3MA 3WQUA 1Q1KA 2RSQA 5FIIA 3CJ1A 1S0VA 3RMCA 3EGWB 4CK3A 4PG7A 3SI8A 3TEGA 3T3FA 4FLXA 2UUBK 1FK9A 3A8EA 3EGVA 1ATNA 5HJYA 3WQTA 5I3PA 5T41A 3C16B 2P9IB 2IC3A 4MH8A 1CQMA 3PHEA 2VYPA 2FHKA 2OHDA 2QKBA 3CC4N 2KYZA 3LGHA 4LQ3A 2VBYA 3BBFA 2YJEA 1VQ6N 2AWZA 3HRGA 1F5BA 4RNNA 3KUGA 4FLYA 3BGRA 3H0PA 5DZ6A 3R5GA 3LAKA 3HVTA 2AW0A 2FF6A 3MM9B 3JSYA 3DFEA 2O4GA 3JS9A 5M2PA 4C11A 3AD8C 3NBPA 4MK7A 1NBEB 4MFBA 2N82B 1CC7A 4M5GA 4GNIA 2QLFB 2DO4A 5KT7A 2P9EA 3TW0A 2VASA 2EW9A 2J0SD 3S3MA 2P9SB 5H9EJ 1QTMA 5B8HA 4WXOA 3A1YG 4DHYA 2KZZA 2RH3A 3LWMA 3WNGA 1F9HA 5D3GB 4ECWA 2ZH1A 1M90T 2HRTA 4LJMA 5HP1B 3VAGA 3L2WA 4F8RA 2FY1A 3O3LA 4BR2A 2W01A 3CO0P 1NPRA 5HN0A 4XH4A 1KOHA 3ZT1A 2ZWOA 1HHSA 4ED4A 1TKDA 4YOTA 3QFUA 2P5VA 1FJGK 1DJ0A 4FYXB 4BQZA 4CF8A 3DGPA 1UCNA 2FQQB 1PJ5A 1H0HB 2VGMA 3MM6B 1CBKA 1HR0K 4CZJA 3OYLA 1WSFA 3IG1A 5KOXA 5M1PA 3PV8A 4KR0B 1WKKA 3PCOB 1LWEA 4Z37A 2ASJA 2QWNA 5B09A 3BPDA 5KFGA 1C0UA 3IAS9 4C3MA 4DSIA 2YNHB 4M3TA 3LM9A 5AQOA 4P7TA 3P31A 1RHQB 1UA1A 3BM7A 5LJ3Y 3DLEB 1WKLA 4C1NI 2CQIA 1QUPA 1PC4A 4DX7A 4NLTA 1CZ9A 2GUPA 1I1GA 3NLCA 5CZ1A 2CVEA 1MWQA 1X1PA 3ZT0A 3OR2B 1N33F 4OJ3A 1T9UA 3NCQA 2NRWA 1UWBB 4Y0FA 4WZMA 5EHHA 4F4WA 2AD9A 3WXKA 3TSPA 1VLOA 3JXUA 1ZBHA 1U0HA 3E01B 3ZTQA 1U04A 4KBIA 2BRLA 4DV6J 8RUCA 2JWLA 2E2PA 3DYAA 2Z4PA 4CGJA 3RR7A 5A0YB 5D6GA 1S1TA 5ETOA 5F41A 1CJUA 4CZGA 5IWAF 7FDRA 1IJEB 4ZVOB 4F7VA 2DR8A 1JLFA 3O9TA 1K8KA 2VDHA 5KFHA 1RT1B 1I5OB 4WFZA 5AQVA 1F5CA 1D4XA 1KTQA 1NDKA 1FE0A 1VMBA 3LPTA 1RDCA 5M2UA 3VWSA 2WBNA 1D9FA 4CVNE 3C14B 1J5EJ 1MWKA 3DLGA 4I2PA 3L2RA 5KFEA 1NSQA 5KFNA 2YHXA 1S9GA 4HACB 2B9WA 4UOCA 4U96A 1SQFA 4I9LA 4MQ3A 1HLWA 1X4BA 2UXBJ 2DITA 4WFBQ 2J9DA 6AT1B 2IJNA 3IGNA 3FRYA 2CPIA 3MZIA 5BYRA 1RDDA 1SB6A 2RU3A 3WNHA 3CQ8A 4OV1A 3AV9A 5JVGL 1P1LA 5DG9A 5EN1A 1DQAA 3I32A 1ATSA 4DR2F 4USKA 1WSIA 2DNQA 4J5OA 2G2ZA 4JB8B 2XMKA 5EWGA 5EVZA 3TUPA 5KFIA 3EE3A 2YCHA 2V2KA 4JV5F 4A5AA 4JI2J 4DR7J 2JFKA 3N6MA 2QWLA 1RGVA 1J53A 1HYSA 1CEZA 4FL9A 2JC1A 4A8FA 3IFRA 3PX0A 5KRSA 1NHVA 2V4JB 2IJRA 2WRMA 5HOOA 4DTUA 2FYXA 2D9PA 4NX9A 3M2VB 4WPAA 4KQZA 3FGUA 4IO8A 3CF5Q 1BG3A 4QIGA 1GLAG 4R5PA 2QWMA 4A61A 3L2QA 4K4SA 2XTJP 3BZCA 2LEBA 4JYAK 2EKNA 2FHMA 4YHHF 3C65A 4RLEA 3M1VB 5B0DA 1RGIA 1SIWB 1B9FA 4Q2LA 1TGOA 4OX8A 5SUHA 4LR9A 2E2QA 2HHHJ 1VHFA 2MPUA 1B7YB 3EX7B 4Q0BB 1KVBA 3QB0A 2XS5A 4WP8A 1UW9A 3VAIA 4DV1K 1JL1A 2BKNA 1BISA 1GMWD 4YUDA 1VIOA 3HBTA 2W2MP 3FNNA 1M0SA 3MN5A 2BOAA 1YJUA 1HBUB 2V2ZA 1ZBIA 4ZLLA 3CCQN 1V9OA 3OTOK 1BCMA 4KIAA 4Y2MA 2V7ZA 3QBWA 2CQ3A 4OI1A 3RYLA 1UOCA 1K1QA 3Q83A 3LP1A 3I0RB 1BWFO 3NCRA 1JLQB 5E26A 5KFFA 2M52A 4JBCA 1BWVA 4P74A 2EHGA 3I0SB 1J27A 3ULHA 4KB7A 4YMEA 2OIHA 1BQMA 4U95A 2E20A 1V3RA 3FR0A 3M32A 5AQZA 2RMLA 2ZH9A 2NYIA 5E3CA 2HHTA 2GHWA 5IC4B 2W4PA 1NJIT 3M2UA 3DNCA 1E3MA 3RBXA 5AJ3J 1S1UB 2IRXA 1TKXA 4LSNA 4C2MA 1VSDA 2ZH8A 1J5OB 2L9WA 1C2PA 2UUAK 3QSYB 2A6AA 4DX6A 3VQDA 4Q8FA 5HL7L 1XMQK 2KFYA 3MWTA 4B9UA 4NO7A 5G0RB 5J1NA 1FKAF 3Q7BA 2SXLA 1SQEA 2G1DA 5HQMA 4WK3A 1R3NA 3ZZTA 2VQFK 3IO1A 4K4VA 2DYAA 2YNFA 4FVMA 4K8ZA 2YY3A 4DN9A 4EO8A 1RAAB 3THXB 2RRNA 3JQMA 1FDBA 1KBRA 2CGKA 3LPUA 4JV0A 3IM9A 4OYBA 1TUVA 4AL6A 1AFIA 2B4OA 2UUWA 1ZAWA 4JI5K 3CCSN 4KHQA 2V4RA 5DK5A 3DKDA 4DU3A 2YI1A 4KAIA 4AILC 3B82A 2DGQA 2VFTA 1RT6B 3BKFA 2RKIB 4B3RF 4BRLA 3DGVA 4CHYA 2VFUA 3R5BA 3ZSXA 3LZIA 4JN4A 5KFDA 1JB0C 4J90A 3AVJA 1TAUA 4FJ5A 4IDKA 2NR0A 2P5GA 5HAOA 1N54B 1AT1B 4B3MJ 3CQYA 4AE5A 3PNIA 4BRCA 1ZH5A 2F9DA 2K1RB 1B7FA 3I6PA 5F8GA 3GPAA 4IO9L 3THWB 3J7AN 3KK3A 4K0KJ 2QWRA 2C22A 1IKYA 2M5YA 4LFBJ 4E0DA 3TAQA 3LH2S 4LH5A 1WEXA 3HP6A 1RTIB 5KRTA 4BG9A 5CZXA 2LXUA 4ECYA 1RBOB 4C9DA 3C16A 1RISA 3ENVA 2P9IA 2CPDA 2OPSB 2ASPA 4A5BA 1KVCA 4BREA 5IWAK 1E6YB 3OL9A 4JKDA 2AEFA 3DLBA 3OYHA 2E5JA 3RAQA 1XERA 3SMPA 3WXLA 4ZPTR 3HM9A 3ZEUB 1S79A 1OWXA 3EO3A 2ZOMA 4PWUA 4MO5A 4FM1A 2X78A 2RQ4A 2V8DA 4JRPA 1C0FA 4BRGA 1OH8A 2GX8A 1PILA 4L73A 3CJ0A 2XO6A 3PFOA 4DV2F 4EGLA 2A6OA 3O9RA 3MGJA 3WXJA 2AGOA 1SJQA 2P9SA 3I55S 1JL2A 1Q78A 2AJ0A 3A13A 3EKUA 1HQUB 4JHDB 4OZJA 1I94J 4FM2A 5C10A 3PDNA 2XNRA 2YBVA 1VFJA 3WXMB 4AD6A 3LF0A 5H9FJ 3ZO7A 2ZVSA 4J9UE 4F0HA 4QZVB 2MSTA 3B8HA 1RHKB 1LWCB 1IBKK 2XMTA 2E7WA 1U48A 3IUCA 2XWXA 1S1VA 4BRFA 1ILYA 3BO4A 4RW6B 2DD8S 4CJ4A 3SCLE 3CCUN 3D2EA 4J9QA 1FWKA 1EWQA 1BHLA 3KOAA 2LXFA 3UCUP 4A8SA 2HBMA 3ZNUA 2W7PA 4WFNQ 1DQ8A 1NK4A 2XMUA 3N4PA 4USJC 2YNHA 5KT5A 2QN6B 3PX4A 3H46O 3P4IA 4JD2A 3DRRB 1D09B 5F0UA 4B08A 1KD1O 3ONQA 1U6FA 3CCTA 1RT3B 3EL2A 1YWXA 2QA1A 2PGCA 4DSEA 4LRDA 3BYRA 1K0VA 1YKWA 4ZP8A 3M6GA 4YHHK 2P6TA 2A1SA 1XNQJ 4IDHA 2Q66A 2GFFA 3OYAA 1VQPS 3EICA 5FRNA 4ZCKA 3OR2A 1VSIA 1LXJA 4CFAA 3MM5B 4C3KA 3PW5A 1N34J 1ASUA 4PKDB 3O3FA 1UWBA 4GKKJ 4ILLA 2UVWA 3FRZA 2HMPA 5DLFA 3LP0A 4WE1B 2R7QA 3TAFA 2VG5B 2WVCA 3U1LA 1G99A 4ANDA 3BN7A 5CCMA 5CA5A 1OVYA 4USWA 1FVQA 5A0YA 2DH7A 3G10A 3H42A 5AQUA 1NNDA 1VQMS 2G0IA 2OKQA 2FXUA 3KXDA 1DTTB 4M95A 2OTJN 1RDBA 4PXCA 3US5A 4WYLA 1YJ9S 3FJ2A 3CM6A 4KHPJ 1TK8A 4JI8J 3G82A 1U26A 4CBXA 3BEGB 5LL6Z 4IOCL 3BF4A 4HI1A 5GADI 4AM6A 3MMCB 4FS2A 1UZHA 3PJ9A 5J2MA 3QNOA 3NGYA 1RT5B 5GMDA 1HHQA 2NXJA 1YK9A 3D7EO 1RTHA 4AHVA 3CJKB 5A2QU 3SLCA 3WQPA 5LSRA 5BREA 3EDQB 2UXDJ 2H51B 1WSEA 4DR5K 1KLMA 3V6HA 3AVMA 3M30A 3LDOA 3O1BA 1N88A 3C95A 1HWJA 3R9PA 3T1HK 4AQYF 2GGPA 1GK8A 3ATUA 4FJHA 3HLUA 5IS2A 3CMAS 3TVZA 2F8MA 3HVWA 1Y4ZB 5C42B 5IQQA 3V9ZA 3ZXWA 5IT0A 3ZCMA 2CJKA 4HTJA 2DGXA 2BKOA 2DXDA 2WHOA 2XMMA 4LY7A 3RAMA 4OHYA 4KTQA 2PMHA 4DN0A 2RILA 1D5AA 1VHXA 3PIOQ 2K8GA 2NZTA 3CMQA 2V4JA 4FWMA 3ZTSA 2CDRB 1PBUA 4NWBA 3OYGA 4ICLB 3FZHA 2NREA 1HNVB 3OFEA 2O8FB 1VQ8S 3BUZB 5GINA 2HFSA 4B3RK 3CT9A 1VSHA 3NNHA 3HZEA 1ZPWX 1Q79A 2MQLA 3M1VA 1YHQN 1ZETA 1KVIA 4RW9B 2Z30B 1N32F 2ZH4A 2BJEA 3X3UA 3HK2A 2DVIA 3L2UA 1D9AA 1RWPB 4OX9F 2HZAA 4USTA 1DKGD 3A12A 4DTNA 3BB5A 2QWPA 3PEHA 1VQ5S 1NH8A 4CLLA 3GDQA 3KLGB 3PTWA 3C6TB 1F9EB 2GVZA 3ZNJ1 1R0BG 2HSTA 3HDSA 2R7YA 1HBUA 1JLBB 2RDIA 2W2PP 3RRGA 2I6WA 1HHTP 2BW7A 3G2XA 3G4SN 5BN8A 3THPA 4IEEA 1KN6A 3RZAA 2OSRA 4ZVPB 5AQHA 1WI6A 3NGSA 1YSJA 4CLZA 3Q2SC 4HKQA 3QINA 1G6BA 3OBIA 3SIPB 1VLYA 3O1WA 4A8YA 3DN9A 2MB0B 2WAQD 2ZDOA 5JLHA 3VGVA 4KH0B 1YI2N 2GMLA 4B3OB 1GOCA 3V4IB 4DR1F 3MXIA 4TKTA 1RWXB 3GG4A 2DCLA 4USVA 4JI1K 2FGOA 2Q6BA 4IJAA 3D6TB 3VQPA 4CEOA 4ENOA 5I42B 4DV2K 4QR0A 1J5OA 1WSVA 2BV3A 2F4VJ 2HW3A 3AH6A 1V3SA 3CCRS 3L8BA 2IBKA 3SQ2A 5FPEA 3T69A 1O6XA 2A3JA 4CHPA 3NF8A 1GLDG 4DL0C 4FPAA 3KUEA 3ENOA 1U47A 3CJCA 3B78A 4DG1A 4ES3A 1Q8BA 1QAYA 2NUUG 4ZVHA 1U1PA 5L39A 3CJ5A 5CQGA 3OUYB 2M3DA 5ELZA 3AAQA 3OXFA 1C1CB 1VQ9N 1WBDA 4ZP6A 4AHTA 5GADU 4E7HA 2KT3A 2PN6A 2IY5B 1FRKA 1REVA 2ZH2A 4DL5A 2ZEJA 3LUYA 4MIWA 1FRXA 2XI3A 3D0IE 1GTEA 4H5WA 5BR8F 1RT6A 4BCAA 2RKIA 5ETPA 2RVJA 3ZZUA 2JL9A 1SUQB 1Y5NB 3KNGA 2ZOGA 2BUPA 5DDPC 3QICA 1GLBG 1ESVA 2MKHA 2K1RA 1UMJA 3P6YC 4OYPA 2WVFA 1NH7A 1VRTA 3HJFA 2V4QA 2HBJA 3ELHA 2RHQB 1RDAA 2HBZB 2ALZA 2Y0SD 1CJVB 1S5ZA 1N5TA 4M5MA 1IG9A 3NWRA 3THYB 2FJXA 1BMQB 2Z56B 4DKWA 2HQIA 2NZCA 5L46A 3JS6A 3FSXA 3PACA 2FD2A 4TYAA 2E2NA 4ZPWR 3I31A 1M5HA 5E84A 4LF2A 1A0OB 4QPTA 4K5RA 3G6ES 1DTQA 1KHVA 3V81B 4FKYA 4FXWA 1WC4A 3EZUA 3CYMA 3ILLA 3PLAA 4KGKA 1U1QA 4NLUA 3LOUA 2E5LJ 2BJ1A 2G8IA 2QWQA 5HRNA 2CIMA 4U7UK 4BC3A 1GLEG 2LYVA 3VTHA 1U0SA 1HD0A 2VICA 2UVRA 1IJFB 2AV5A 3IBCB 4BRHA 1JJHA 2DPNA 2HKEA 1RLDA 4MYUA 3NAHA 2HS4A 1QLNA 5M1NA 5KFLA 3JSMB 1TTHB 4LSLB 3FZLA 2NSCA 3PIPQ 2NS1B 2B51A 3OR1B 1HQUA 2DGWA 4Y34A 1VQOS 3CI5A 1VBZA 4L3NA 4OKKA 2O8EB 3SQGB 4O8KA 3RGIA 4E19A 2R2UA 2MSSA 4Z4IA 3EM1A 2CPJA 4OKJA 2VJUA 4PA1A 2K06A 2DNOA 1T95A 4C97A 4I9QA 1LWCA 1QY7A 1EJ7L 3ISND 1S0MA 1T11A 4BE1A 4NLGA 2VA3A 1YGYA 2MY7A 1XIQA 4GVBB 4MDAA 4JI7J 3D1QA 5HVFA 3HJVA 3AVHA 4NLCA 4V19S 1QVFR 4RW4A 2RQMA 3IR5B 1R0AA 2MHEA 3AA9A 1VQKS 3BY5A 3QBXA 3ITHB 5HK4A 4ZTJA 4CO3A 2L41A 3UB5A 2CA9A 4U7UD 5F8HA 4FPIA 4PL7A 2D0BA 4MKVA 3MEEB 4ZCLA 2G1HA 4RG8A 3EY1A 4DCPB 3ENQA 2LU2A 3DI6B 4FLUA 5J2PB 4RU2A 1KSPA 2DTJA 1RDUA 1KFDA 4EBEA 3HPOA 2VWKA 2UVUA 4LRFA 4ID5A 3G6XA 1N36J 2Q6CA 3UE5A 3CJBA 3N4WA 2I9SA 4CJRA 1OY6A 2PA8D 2GWJA 4DLEA 3VPZA 4QYRA 4AXJA 5FDLB 1JKHA 1SXLA 2ZJQL 4DPUA 2BMBA 3ZTRA 4X4TA 3ZETB 3NOCA 3TUJC 1HKAA 4QWBA 4MO4A 5E0OA 1YAGA 3G96A 1N33J 4OI2A 2HNZB 2HHSA 2R7WA 4EYIB 2IAJA 4ZOSA 2BE2B 2VF3A 4U7CA 4HYKA 5H1SV 5FPNA 4JKEA 1QJHA 4WTYA 3S8SA 4URSA 2OPPB 1DTTA 4GC6A 4GW6A 3VEZA 3G86A 3TJ9A 1FRLA 2VQEF 4ZA1A 2J0QD 4CO1A 3MX2A 3D1OA 2RUSA 5F1XA 5A2QO 3VAKA 1IBMK 1NGBA 1QE1A 2J5AA 3MMCA 2DJWA 4H0PA 2CQ0A 3WEEB 3OLBA 1B92A 4DR4F 5EWEA 3SCIE 4DR6J 3UO0A 3CJKA 3ENWA 3SUNA 2H4WB 5K5MA 2AYBA 2XMWA 2LECA 1C4CA 2ADBA 1BXNA 3OLAA 4OLPA 4O23A 3K0JA 3AY9A 1RP5A 4BROA 4I0WA 1YLXA 2ZBPA 3I8BA 1R8PA 4F4XA 4CTAB 3EKSA 4FK2A 2X3DA 3K8VA 4C3LA 4DOZA 4CJSA 1OQ6A 3N6NA 2CJ9A 1BUXA 1LW0B 2LSNA 4I7FB 2HNYB 4FVCA 3AB2B 2HGNA 3QLHA 2P9UB 2AYGA 4DU4A 4KPYA 4FJMA 3NGZA 3UKRA 3A8YA 3VQBA 1WOSA 3PEJA 4XH5A 5AQSA 3SDEA 3GYGA 5C42A 1WN7A 4B8CA 1FRHA 1QVGR 3NNCA 3MPUB 2CQDA 1MLAA 3OJSA 3MCNA 1Y64A 5KPRA 3EYZA 1ZM9A 4Q44A 2A10A 4LF7F 2GCFA 4DR2J 2VU5A 1QSYA 4IOAQ 2CNOB 1L3TA 4ZPVR 4X64J 1QVGM 2KU7A 2H65B 2ROEA 4CLTA 5HBMB 1WHYA 5GMEA 1HNVA 2O8FA 4JV5J 3L3CA 5BR8K 3I8DA 1RXOB 1PG5B 2MMYA 1CLFA 1ASVA 5D15A 1NMEB 2FGCA 4WU3A 4KKOA 4RW9A 3GCXP 4P2FA 2VPYB 5D78A 3CSKA 1B9DA 2HQ3A 2DEJA 1BE4A 2V69A 3G6VA 1Y3JA 3C7NA 2MZRA 3FE1A 3KLGA 2ITMA 3C6TA 4YY3F 1QS4A 1E6VB 4I6MB 3OVNA 3LALA 4CZEA 4ZLNA 3VEOA 1KQKA 1H1VA 3KK1A 3CXCR 5K8NA 1QQOA 1P27B 3OXGA 3EVOA 4KH5A 1UEKA 5AE2A 1JJ4A 2BGGA 3DOKB 4FO0A 3FSIA 3QIDA 3U1NA 2MKCA 2P2CB 4CK2A 4NEYA 2IYGA 1T6DA 1WSGA 2OELA 1YVFA 2KO1A 3CXCM 3R1LA 3VA3A 1SC1B 2V34A 4ECZA 1P8GA 4K2XA 4M3UA 4H4MA 4CGFA 4Y6IA 1YRTA 3ILJA 2ZH7A 5KI6A 3HVRA 2BJDA 3LL3A 2F1FA 2W42A 1HYZA 2XMJA 4MLEA 4E1JA 5AZJA 2E1MC 2YH0A 3WC2A 3ASMA 2QL9B 3R8EA 3HHLA 1AFJA 2WTUA 3R5JB 2FVRA 1R0CB 5L8RC 2HWTA 2QKKA 1UVKA 3VZIA 3DOLA 3UR0A 1C1BA 2MZTA 2DXFA 4X4RA 3CMES 1WWHA 1UW4A 2F3JA 3CIZA 3POTB 4PKHA 2FHJD 2V9WA 1SKRA 4XAKA 2R4FA 4CI0B 4WF9L 1C1CA 3JTOA 3OTEA 2LFVA 4FK4A 4N8NA 3S01A 4NYFA 1RHJB 5G4DA 3M6WA 2CPHA 1DT9A 2E7XA 5JXSA 1TYQA 2BA9A 4WYBA 3BSNA 2CDQA 1Q81T 4BR4A 4DR3F 4RBVA 3TO8A 4OV6A 1BQNA 4M3RA 1X3NA 3H5YA 3C46A 5E3QA 2JGUA 1CSJA 3P5TL 3KKSA 2O8CA 2RIJA 2JFDA 4GC7A 4K41A 4FWNA 4X4VA 1HFEL 5AQMA 2HVEA 3B8AX 3HF5A 1KTVA 1FX2A 2FBTA 3O5BA 2AMCB 3EGNA 5D77A 4CEBA 3BF1A 5CE3A 1SZ2A 5C24B 4ZK7M 3T6JA 1KKHA 1EO1A 1X4GA 3VQEA 2D7SA 1G4CA 3THTA 3PSIA 4ECSA 4ERDA 3CDBA 3OBYA 3GMGA 3ZC4A 4OZ2A 2BANB 4CEAA 1S9EB 3ZSOA 2ZF5O 3EGZA 4U67Q 2QO3A 3CE8A 2B7CB 1T8EA 3CB4A 1NUEA 3CJQA 2D0AA 1YBTA 3NRBA 3V81A 1MN9A 2C2ZB 4BRNA 4IBNA 2PO4A 1MW7A 1VQ6S 3FQKA 1RB0A 1K47A 4O0NA 4DX8H 1X0PA 4PKIA 5GIPA 1X9SA 2XHCA 2VQEK 3UN5A 4Z7CA 3DLLL 2GVDB 4CZCA 4EHUA 1S99A 3HD1A 4RL1A 1RILA 1HLUA 1Z25A 5K20B 2F8EX 1BI4A 1RJJA 2J7WA 2V8PA 1IKWB 3LPEA 2Z57B 4TU8A 4HR2A 2JWNA 4M5IA 5EUHA 1H74A 4KGVB 3L3UA 4F04B 2FLNA 3A0IX 4NASA 3HSTB 4G9ZA 3SQGA 3TAMB 4GV9A 3WX8A 2LQ8A 4OLOA 5F0WA 3AO2A 3C94A 2IIRA 4A57A 4WP9A 3MN9A 4PG8A 3VQ4A 3R6LB 4DCJB 2ZBRA 1TUGB 3PRVA 1Y10A 2LCWA 3CJTA 5I4MA 1OS5A 1KQGB 1YJRA 3CM5A 4MIBA 3NCPA 3FVYA 1WNSA 2DK2A 4YN3B 4H0YB 1RTJA 2KT2A 1RBTA 3B4DA 2W6LA 1G15A 3K9JA 3IS9B 4KFBA 5E5NA 2FJEB 2PZSA 4FN5A 3TZWA 5A8WB 2IFXA 1N5YA 2D0OA 1ICEB 2Q79A 4J91A 3NL0A 2GO9A 2HHXA 2UV8G 2D3O1 2RQKA 1NAQA 3WUHA 5EX0A 4X65F 2UUCF 4NCAA 2VDIA 4IFVA 2NXNA 1QDUB 2VODA 5C25B 4PXDA 1UAXA 4CWBA 4K4XA 1VK8A 3I55N 2YWHA 2DEIA 2QMXA 3D6MB 5HMZA 1C4AA 3N4QA 4KV8B 1OQ3A 2GJIA 4KHRA 4OZNA 4BHQA 1X31C 2YKNB 3VAJA 1LWFA 4DS4A 3ZX2A 5IQ6A 2YX7A 2B4UA 3UD5A 3RUBL 2DFHA 3I87A 1A5XA 4HLBA 4BQLA 1A9NB 2CNNB 1PSDA 4HHHA 3VF4A 2HSEB 4F25A 3KTQA 1DQ9A 4I6WA 3IMQJ 1NSPA 4IH5A 1HPZB 1S5JA 1UL3A 3JSBA 4RTFD 4YY3K 2D1KA 3IRWP 4EO6A 2MZSA 2ZDPA 2V94A 1P6TA 3NH0A 2RF2B 2HNZA 1FNXH 2E5IA 1T05A 2BE2A 2J6TA 4K4YA 4ZVGA 5HJXA 3RB4A 1FX4A 5HMWA 1W7AA 4KREA 3IGVA 3NWGA 3QQCD 1T9VA 1KVAA 2OPPA 1MROB 3HX9A 2OI2A 4NLSA 2X3GA 5ADZA 3CCZA 2KXHA 5JUMA 2QSWA 4ELUA 2NZ4A 2QG9B 2OD4A 2MGZB 1Y11A 2C42A 4AHUA 1Z2LA 1GX6A 1UFWA 5A76A 3IN5A 3MMBA 1TMJA 2H4YB 3V6DB 3WEEA 2PI4A 4CZHA 2EC2A 1WG5A 4MKAA 4YS2A 3E8OA 4LH4A 1UEUA 3I5AA 1RBAA 1UETA 2I0XA 3Q8SB 4I68A 4WIQA 5L1LA 3BGFA 3TTFA 1QUVA 1YIJS 4LF5K 1YUWA 2NQPA 2VONA 1S9FA 2B8PA 4LFCF 4QS7A 1FXDA 3KK2B 4X4UA 2L48A 3VERA 4N56A 4JI4J 5KQ8A 2ZQBA 2HVIA 4MYTA 1R6VA 5B0BA 1QAXA 4M5DB 4DMNA 4I7FA 2VIHA 4Z4CA 3HSCA 2PIIA 1O13A 5M2RA 4CI6A 4LRAA 1VQMN 3UCZP 5AE3A 2Y8YA 5EDWA 3P3DA 2VC1A 1OY8A 1RTDB 3L4IA 4AQYJ 4NA1A 1IVZA 1JCEA 3ZZYA 2W7AA 3QRQA 3P8BB 4IYQA 1U25A 4HTIA 3ZT2A 3FZKA 3MAAA 4DB3A 2JC0A 5M1KA 4DR3K 1WEYA 2F8SA 1PIEA 1RACB 2ZE2A 3EJMA 2W8KA 3UKUB 3V5RA 3W2WB 4DSFA 2Q0UA 2KG1A 4J9SA 5GAGP 3L7PA 2W2NP 3K58A 4DQQA 5IV3A 1XUPO 4LF6F 1IKVA 3OYKA 1NU0A 3CCLN 3G6YA 4V1Ak 2B9YA 3D66A 4QYZJ 4PR6A 3M6VA 2EWSA 3FEYB 2W9CB 2D0PA 2Q0RA 2YKMA 4OPKA 3BQ1A 3NGDA 2R8KA 2D5RA 2JSXA 3O3HA 2BW2A 2HHQA 3HHLC 1ZBUA 1E6VA 4I6MA 5CYQB 2HS0A 3CCQS 4YDUA 1MN7A 1A5WA 1BD6A 4B9MA 1RBLA 3IM8A 4PY5A 1VK0A 4XDCA 1N32J 2KKZA 4K8RA 4OX9J 4M3ZA 3O9QA 4MAKA 4W98A 3M6XA 2EI5A 2H3EB 3TVYA 5FROA 3DOKA 4CJTA 1YRXA 1ZM3A 4QS8A 3W2VA 3FDSA 4PWDA 4X62J 4CK1A 1LXNA 4BWMA 1JLAB 2B6AB 1VSKA 3VQ6A 4H8KA 3OFGA 4HH0A 2D74B 2WUSA 5KG7A 1S6QA 2QMWA 2I8EA 3BP8A 1VQ8N 2E29A 4DUYF 4BR5A 1JJ2R 5C2DA 2JJ4D 4MIAA 4LF8J 1IBLK 4ZVTB 1FVSA 3KKFA 5BN9A 5FJ4A 1VYAA 1QM9A 1QQMA 1GQEA 2OZSA 2UZAA 4NXNF 4TQSA 2BOPA 1X4HA 2E8AA 3DC2A 3MMJA 2X1AA 3I56S 3L6QA 4D3GA 3H2VE 3EEQA 4G1QA 3TARA 3SXLA 2EFGA 3DLKB 1VQ5N 2EWHA 4KI6A 2G13A 1HI0P 4B3SK 1URRA 3M8SA 3R7NB 3A4TA 3ZX0A 1FRJA 3EWGA 5BPNA 4FDFA 4DR1J 3VGTA 2OA8A 2VA2A 1NOZA 3OYFA 4DV5K 5H1SQ 3U3YA 3POTA 1QSLA 3G71N 2UYTA 1UVIA 2UXCF 2KJVA 4OKEA 4QIVA 2OEKA 3AHPA 1TKZB 3OJUA 2E9RX 4O3RA 1W0HA 2OPRB 5C12A 4DFMA 3PJXA 3CUNA 3CTRA 3QNNA 1M5KC 3AQOA 2BTFA 4ED3A 4KTZA 2DNYA 1KFSA 2KVQE 3UDEA 3CCSS 4KO0A 1HNWF 1X9JA 2MKYA 1RHRB 4IXCA 1F1BB 2N7CA 1FKOA 9RUBA 2O67A 3KD1E 4DV3K 3SCKE 2QIFA 4F2SA 1WAJA 3OQ2A 4X65K 5IT9Y 2XZTB 1AA1B 1BUPA 3M9MB 5EOYA 1FXRA 4RZRA 2EFNA 4O0IA 2NLXA 3O1LA 1LW2A 1RT4B 4Y2KA 2G2OA 1XR5A 4JKBA 4CJLA 1HI1A 4BDZA 4CFBA 1EKSA 1XMOJ 1UVNA 3NGIA 5I3QA 3PHTA 1L3UA 5C24A 2WW4A 4Z7YA 2LDIA 3W8PA 1IUJA 1CVJA 5EX3A 3HHKA 4BRDA 5L1KA 1VC6A 3EXCX 2WVDA 3KLHB 1Q7YO 5GAHU 3RMBA 3N5BA 2YNIB 3NGKA 1LKZA 3AFGA 2DIUA 1GTHA 2OMLA 2CRLA 3A8IA 2R3VA 5AQQA 5F8IA 4B9SA 4TN2A 2J9EA 1VOMA 5JICA 5AXKA 2HG4A 3N9UC 1B0TA 3TU5A 3H3OB 2CADA 3RB3A 3D54A 3O5TB 4B3TJ 5D4OA 2ADCA 2QE5A 4JI3F 2HVHA 3LANA 1BDGA 5LMNF 4PYAA 1JXLA 2ZBCA 4RWXA 3JQKA 5FPMA 4W5OA 5E2QA 3KK7A 3QERA 4M3WA 1WNEA 2ATQA 2ERRA 4JS5A 4HUFA 2E1RA 3EUNA 5LJ5Y 1IO2A 2P9KB 2YHBA 2EFOA 3D28A 1EQYA 3JAMY 5KFXA 1IKWA 4RW7B 3NAEA 1BIZA 2PEHA 1NPPA 4P72A 2HQGA 1SQKA 3A3OB 3ATVA 3VTIA 1AROP 3DDIA 2RJZA 5K8PA 3E51A 1FK9B 7FD1A 3KDOA 2AX1A 3UDCA 2C28A 1HNIA 1A5VA 1R8AA 2IOCA 2IC3B 3PVXA 3C6AA 3ZX3A 4JI6F 2XLKA 4LR8A 3CCUS 3QGPA 2QX0A 4E98A 3EVWA 1HNZJ 3UNYA 4C4WA 4W5RA 3UDVA 3BGRB 2FHOB 2RQCA 4EP5A 2I7PA 2FJVA 4OZLA 4C11B 2FJBB 4O3OA 3NBPB 1LNQA 4BDYA 3MTKA 2IDOA 2AP1A 4MFBB 4TY8B 3DXKA 1Z2ZA 1F9FA 3FC9A 3BGUA 1EP4A 5LMUK 4DZDA 4DQSA 3BYPA 3SFGA 1DBDA 3Q22A 3KLFA 2CH5A 2BZ2A 1H7WA 4OX6A 3HM8A 4OGCA 1IQZA 4DV0F 1LAWA 2R7VA 1FCAA 1WACA 2DRBA 1KXPA 4LF6K 3FBCA 2CPZA 4CLFA 4KV8A 1GLJO 3ENBA 1VQON 3MF5A 4ED0A 3LDSA 4FWLA 4WKYA 2DPJA 2PY5A 4DUTA 4U7BA 3RJMB 4RU9A 4FWSA 3GFXA 4KGZB 3CERA 3WXIA 1KD1T 2B4JA 3PKMA 2IM2A 4DBQA 2QYGA 1LWXA 3EE8A 3CJ2A 4ED7A 3PRBA 1Q82O 3OYMA 2ZHOA 3F56A 3HFZB 4O0JA 3RTVA 2E6LA 4Z4HA 4FWOA 3SNNA 2W7OA 2CUYA 1YTYA 3IG1B 1TK5A 3SJJA 3G0ZA 3CD7A 3KJFB 1U2VB 1T7PA 3N0VA 1LWEB 3W9JA 3MR7A 3L0QA 2H1YA 1PO6A 1PJ6A 1VISA 4O55A 2GQCA 2GELA 2VJVA 3GV7B 5DQGA 3LGMA 3HXMA 1VQKN 4QWDA 1HNXF 3T5LA 2Z8QA 3D6FB 4KB0A 1F2HA 3V6DA 2YTCA 3D67A 1JLGA 4IRCA 4DUYK 4ATNA 5BXIA 4H5VA 4NXNK 5EWFA 2G2YA 4PHTX 1FXXA 3HPGA 1JXEA 4CGHA 2B43A 5HSPA 3Q8PB 3UCGA 4ZHRA 1TUYA 1NNEA 1U0HB 1DRZA 4DR4J 4RWWA 4RW8A 2MKJA 1SVDA 3SFUA 3VGSA 3PY8A 2BR0A 4UOFA 3R8YA 3QJLA 3DYAB 4FJ8A 1U1LA 1S1TB 1CJUB 1HW8A 4TSXA 1JLFB 3N28A 2UXCK 1K8KB 3GB0A 4LSZB 4P75A 4IOBA 3CCJN 2J6SA 4QOZB 2DGTA 3BN4A 3BH6B 4GRSA 2GAGC 5KFYA 4CYUB 4YDUC 1OSDA 3MHYA 4EMDA 4KGMA 3HHEA 1B70B 2XSFA 4Z0UA 3DLGB 4I2PB 3SUQA 2XQCA 1S0NA 4V19X 4RUCA 1S9GB 3MR3A 3O4NA 4C0BA 2RT3A 3NS6A 3W65A 2QA4G 3UKUA 3QFHA 1MSWD 1YDLA 1FKPA 3W2WA 4LFAK 1SJFA 5L9XA 4IZ9A 5CZ2A 4H0VB 2XMVA 4PRFA 3VQ7A 3H5XA 4LF7J 3MUTP 2AJFE 1F0XA 2MEWA 3ILIA 4K2JA 4E7LA 3HSZA 2W9CA 2VFRA 2F8TA 4CH7A 2GAHC 4CJKA 5M1FA 1FJGF 1KQFB 3SUOA 3G4SS 1MMDA 4CLKA 2VHGA 1EHWA 2CXEA 1URNA 1D0EA 1HYSB 1HBMA 2GW8A 1U1KA 3H90A 3UWTA 4TYBA 1H3DA 1NEEA 3GSIA 3BKTA 4NMXA 1KAXA 4NXMF 4NMLA 3FZBA 2MQNA 3D45A 1TZ0A 4BDPA 1HQ2A 3GU0A 1JLAA 4LBHA 4NRTA 3NMAA 4R5PB 4JKHA 2KRRA 1YI2S 1E4GT 3W3DA 3U3GA 3O8MA 3OTDA 4JI3K 1D9DA 4TU7A 4S0MA 3DRPB 4EIAA 1IWAA 2C3OA 5CYMA 3CJSA 3NCIA 2BM0A 3M8QA 4OLBA 1RBVA 3QNWB 4TY9A 1TQLA 3SSSA 3UN2A 4A62A 3QETA 3FSYA 4XPCA 2ASLA 2WZ1A 3EVMA 1U2RA 4QS9A 3OA9A 3IRXB 3DLKA 2FUG9 4X66F 4DQPA 1Q16B 2LKZA 1RT2A 2Y1IA 2VC0A 2MJUA 5JVHQ 1FRMA 4WXWA 1NO8A 3H98A 4LF4F 2FSKA 1DLOA 3W1YC 1SKWA 4DDFA 2DHGA 1RAGB 2OPRA 4JI6K 5DM7Q 3NGTA 2B5JB 3LP1B 4LF9K 1S97A 5D4LA 1LOUA 3H08A 1N52B 5ETRA 1NKEA 4I56A 1RAHB 3GR1A 1MU2A 3DDKA 1U49A 3M1FA 3TI0A 1CULA 1BQMB 2W41A 5KT6A 3HHDA 3M32B 4ID8A 3SI6A 2DGOA 3M2UB 1ZBSA 4DTXA 4F67A 1FA0A 4DV4J 1QQNA 1ZTTA 1R43A 4PXEA 5GAGI 2QXLA 1V5IB 2P9CA 1KR4A 2W9AA 4DFKA 1A6LA 4NLPA 5LXYA 2ABYA 2CNLB 5C7PA 4DPWA 4ZVEA 4RNOA 1XR7A 1RK8A 4PYDA 2Y0BB 1FFGB 3KDNA 3TX8A 2W4DA 4OX7A 3A8JA 2YNFB 4CJQA 2Q31A 1AUSL 2M8DB 2DY9A 4BC2A 5F8MA 1NKBA 4AL7A 3HOSA 4FS1A 1U7LA 2YHWA 5DJBA 3SBMA 2OH2A 4HDGA 3OL8A 1FWPA 4BVOA 4DQ8A 2BACA 4IFEA 4OVLA 4M94A 4K4WA 5ETTA 3QWPA 4E7IA 1IG8A 4O8UA 3TTCA 5D0GA 3J7ZO 1RA6A 3W61A 1HNXK 2X74A 1E4FT 3MTJA 4MMOA 2YPYA 4EAHD 2RD5C 4UW2A 2AEJA 2WSEC 2M8HA 3VA0A