3DLEA

Crystal structure of hiv-1 reverse transcriptase in complex with gf128590.
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
538
structure length
534
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 135
structure length 534
sequence length 538
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dleA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dleA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dleA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dleA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dleA05
3M9NB 1T3NA 1I6JA 2R2TA 3OYAA 1HJRA 3TAMA 2E4LA 3QERA 4PUOA 1U47A 1YTAA 4RNOA 4FBTA 2I1RA 2IGIA 3JSMB 3DYAA 4K4YA 1C2PA 4KHQA 1QSSA 5JXSA 1LWFB 1NK0A 2G8WA 1TV6B 4TLRA 3HPOA 3RBDA 4QWDA 5EU7A 4DTMA 1JLBA 2XY6A 4DTRA 3OYNA 4RW4A 5T14A 3KK2B 3SFUA 5CYQA 2G8UA 4NCAA 4ZP9A 3HPHA 3LPTA 5KFKA 4QPXA 2HMIB 1KLMA 1J5OA 3V4IB 4WFYA 3AVGA 3FDSA 3H5SA 2C22A 4DU3A 3LP1B 1SL1A 1RNHA 4CGDA 4W5OA 4FZXC 4BE0A 2IDOA 4MKBA 3T5KA 4EP5A 4J9RA 3BR9A 4WE1A 1DLOA 3QIOA 3V1QA 4FBUA 4HKQA 3VQAA 2O4IA 4YP3A 4C8NA 2VG7B 5JS2A 2DFEA 1RT7B 4K4TA 2XI3A 5L1LA 2J6TA 1TAQA 4U6PA 2OPQB 4ECSA 1HPZB 5CYMB 4DQPA 3M8PA 3ITHB 5C24A 2J6UA 3QNNA 2FVSA 3HT3A 4CJSA 3LPUA 3AA5X 1JKHB 5KFOA 4DTXA 2IMWP 2R2UA 1UOCA 1CZBA 2OPRA 2JC0A 2DPIA 3TAFA 5KFSA 3BQ2A 2C2DA 4O44B 3NH1A 5KT5A 3KNAA 3UR0A 2VG5A 4MFBA 2AX0A 4OKEA 2QV6A 4J9KA 3PW4A 4TQSA 4OPKA 1OS5A 2GIQA 3CM6A 4CIGA 2VA2A 4FLYA 1RTDB 1KCFA 4MH8A 1S1VB 2FBYA 3MXJA 3SFGA 1ZTTA 2PZSA 5I42B 1JX4A 2AJQA 1NOZA 4LD0A 2R8IA 1WSGA 3IG1B 3DOLA 2W7OA 4HUFA 4NLQA 3OYMA 4DL2A 4CJEA 5HP1B 5I3UA 1IO2A 3KLVA 2AQ4A 3ZSVA 3OJSA 2W9BA 4EZ9A 3HPGA 3G6VA 4ICLA 3QEPA 3T5LA 3KHLA 2C2RA 3IRXA 2RKIB 4R8UA 4IQXA 2ATQA 1S6PA 4CEFA 3KLGB 3H4DA 2XI2A 1LWCB 4Z4CA 5L1IA 1BHLA 3TAQA 1NHUA 4W5QA 4FJGA 3C6UB 3RB0A 5F8HA 3FFIA 4CGGA 2DFHA 4YR0A 1WN7A 4Z4HA 5HLFB 4NLTA 2YKMA 1ZBLA 5DG9A 3VQDA 4ELVA 3OYEA 2OZMA 1TK0A 4IFYB 3I8DA 2IJNA 4FK0A 4ECYA 3IS9B 3HXMA 5D3GA 3O3FA 4DG1A 3S3NA 4IFVB 4OL8A 2B6AB 4CHPA 5F8GA 4F8RA 5K14A 3IN5A 3CO9A 1NJYA 4EBDA 1NJXA 4LSNB 1S1WB 4PY5A 4YR2A 4O3NA 3ULDA 3KTQA 3TQ1A 1QAJA 2YNHA 3QZ8A 4DQQA 2WHOA 4FVMA 4MK8A 5KFAA 1Q8IA 5DQHA 1UAXA 3QESA 4XPCA 3OYIA 1EKEA 2R8HA 3EYZA 4G1QB 4H4MB 3G0ZA 3V81B 2HWHA 4ZTFA 4M42A 4F3TA 5DGBA 3HP9A 2AGQA 1WNEA 3OYDA 4OKJA 2B4JA 4FLXA 3TAMB 4JLHA 4PUOB 4N41A 1VK0A 4E89A 3KLHB 4BDZA 4DF4A 4RW9A 3RMCA 3DYAB 1RTHB 2BANB 4CJKA 3AVNA 1S9EB 4ZHRA 4B9SA 4YMEA 1C0TA 1BL3A 4EBEA 2D0AA 4RW7A 3GIKA 4RW4B 2P5GA 4W5TA 1BCMA 4EEYA 3NF7A 2HB5A 1JLGB 4DSFA 4K4VA 2ASLA 3EZUA 1WAJA 3AA2A 2VG6A 1KLMB 2IOCA 3AO1A 1J5OB 4Z4GA 4IRDA 3HKWA 3E51A 3KMSA 4NRUA 4TN2A 3LDSA 4FJMA 1TQLA 5HRRA 4KHNA 3QZ7A 2HWIA 1CLQA 5KFXA 4WE1B 4BDPA 3DLGA 4ECRA 1BCOA 1FK9A 3OYFA 3F9KA 3NF9A 3RWUA 5J2QA 4NLPA 2FLLA 1TL3A 4QWBA 3PHEA 4WYLA 4IBNA 4NLDA 5J2PA 2OPRB 1YVFA 2YNFB 4KHMA 1GX5A 4RZRA 1HQUB 1X9MA 4M3ZA 4DTNA 4JRQA 3OYGA 1TL1A 2ZE2B 5HBMA 3QLHA 2IC3B 2XGQA 2VG5B 4MFBB 2IA6A 4CK3A 3C95A 4KRFA 3OYBA 3ICLA 3H5XA 4QOZB 1VSEA 5L9XA 4DTOA 1C1AA 3GILA 1JLFA 3MEGA 1QHTA 1LW2B 2ASDA 1G15A 3UPFA 3THVA 2O4GA 2XCAA 4TY9A 2UUWA 3SUNA 3DOLB 1RDRA 2YHBA 4ED3A 3MECA 2BRKA 3OLAA 4AH9A 1RT6A 5I3UB 4CJPA 2QKBA 3VQSA 2W9BB 4F4ZA 2RF2A 1GOAA 2WOMB 4O3OA 4WYWA 2D5RA 1NKCA 4F3OA 3BSCA 2D3UA 1FXXA 4CESA 4HCCA 4R8UB 4OKKA 1Z26A 3V9UA 4FM0A 4ELUA 3RMAA 3PUFA 3VQ5A 4CJVA 3EZ5A 2FLPA 3K5MA 3OHAA 2WONA 4CEAA 1IKWA 2AU0A 3PW5A 4CCHA 4PWDA 1HNVA 1VSDA 1JLCA 2UUTA 4NLXA 4OJRA 1I39A 2YKMB 1IKVB 4H54A 4YQWA 1IKXA 4FLVA 2Z1GA 2G8HA 1RT1A 4DG1B 1R0AA 2HNYA 1LAVA 1HYSA 2Z1IA 2XWYA 1JLEA 2BE2A 4Q8FA 3SUQA 4J2EA 2JC1A 5K14B 2FBXA 4B9TA 1UWBB 2IJFA 4AHSA 3SV3A 1FKOA 2PYJA 2P5OA 2W8LA 2QXFA 3TVKA 1ZBFA 3GV7B 4DFKA 3DLKA 1EETB 1NK9A 1S0OA 3AVAA 3G10A 4XO0A 4NYFA 3ZSWA 4Q5VA 3PO5A 5FRNA 3T5HA 1GOCA 4U7CA 4YR3A 4J9NA 5E41A 2LSNA 3V6DB 3GV8B 1S1XA 2FJXA 3FQKA 3WNHA 5KFFA 3I5AA 4RNNA 1JLQA 4DSEA 2OPPA 3TANA 3DLEB 4FXDA 5J2NA 4RW9B 2EHGA 2B5JA 4DL4A 4LSLA 4E7KA 4WZQA 4CFBA 4DSIA 4B8AB 1C0TB 5F9NA 1TGOA 1MMLA 1SUQA 1JL2A 3ISNC 2KW4A 4CJ4A 4ZP6A 4DSLA 2BRLA 5KFRA 3RBEA 1TK8A 4K4XA 3NBPB 3ZSZA 3VQ8A 1U04A 4DMNA 4KPYA 3NGDA 2F8SA 4ZTJA 5KFLA 4M41A 4CERA 4RNHA 3CWJA 4O4GA 4Y3CA 4TSXA 1K1SA 4FJKA 3Q8RB 4IDKA 3CDUA 1TK5A 5KFWA 3AVIA 3SNNA 1KVBA 1KHWA 3KMQA 1ZBUA 4HHTA 3CG7A 3DLGB 3BDPA 2AX1A 4F4XA 4DQRA 3OYLA 4F4WA 4K8ZA 1FK9B 5KG5A 4KREA 2D0CA 5KFCA 3ZCMA 3U6FA 3SPYA 5J2QB 1C0UB 1BIUA 2YV0X 1CXUA 2V9WA 1KVAA 4B08A 2B43A 1CSJA 2BQUA 2PYLA 4B8CA 2V4QA 2D3ZA 1S5JA 5KT3A 1QE1A 3IAYA 4E7JA 4OLAA 4H4OA 3T1AA 3C94A 2GIRA 5KFYA 4CGHA 4B3OA 1LW0A 4CEDA 3S9HA 1HMVA 3BSAA 3HL8A 3ZSXA 4OVLA 3QLHB 4TXSA 4NLSA 2IAJA 5EWEA 1D9FA 3TWHA 3DDKA 2XGPA 3OS2A 1RT2A 3H59A 3LP2A 4JS4A 3DI6A 1U45A 3I5BA 1F21A 4AILC 4Z0UA 3KLEA 4JRPA 1JLFB 1MU2A 1JXEA 2IM3A 4GC7A 4PA1A 2V0NA 4F4YA 3KJVB 5KG4A 3OYJA 1UA1A 3TARA 2FC0A 3OS1A 1TKZA 2HHWA 5C42B 4EZ6A 5KG2A 3RRHA 1RBUA 4KTZA 5F8JA 1EX4A 3AO2A 2BDPA 1JL1A 3SZ2A 1B92A 4FS1A 4R5PA 2PY5A 2HVIA 4DEZA 4E1NA 3ZT4A 4DQSA 3ZSRA 4O0IA 4CE9A 2Y1IA 4IR1A 2C28A 5C25B 3HP6A 3KLFA 3MTKA 3RB3A 3D5MA 5KG0A 4TY8B 5CZ1A 5KT6A 3HK2A 3PX0A 2FBTA 3ZT0A 5KT4A 2R2RA 3BJYA 1JLAB 3O3HA 3H5UA 4PWDB 4NZ0A 4RG8A 1NK7A 1HNVB 2DTUA 1JLCB 3LP0A 4DLGA 4QW9A 3QIPA 1SH2A 1XR7A 2OPSA 4RNFA 3EPGA 1XHZA 2Y1JA 3RR8A 2WB4A 1WSFA 4KHYA 1RT1B 4ZMMA 4IG3B 1S1UA 2HNZA 4QAGA 4FJHA 1R0AB 3OL9A 3AA4A 3AVJA 1HYSB 1RAJA 1JLEB 1VRUA 3LP3A 3MEEB 2FJWA 2E9ZA 3MFIA 3F73A 1LWEA 4KTWA 3QNOA 5EUHA 3V1OA 3NL0A 3DLKB 1T05A 1X9SA 3OYCA 4ZPCA 3CFRA 2Z1HA 1C1CA 2D0BA 4O55A 4K8XA 2A1SA 3GYNA 3U3YA 4KI4A 2F96A 4RUCA 1NNDA 1NKEA 3AO5A 3SPZA 4CJRA 3M9OB 1VRTB 2IBKA 3P5JA 2BGGA 3G6XA 4CHQA 3DRRB 3RTVA 1VSJA 4UQGA 3V9ZA 2FVRA 1S9GA 4J2AA 3OSNA 3OLBA 3LWLA 3PJXA 4WXWA 2B5JB 2W8KA 4KHUA 5L1JA 3A2FA 4EYIB 4C8KA 3SYZA 1ZTWA 4TYBA 1T8EA 1L3UA 1VSLA 1DTQA 4KB0A 5DGAA 1XHXA 4IG0A 3H5YA 1EP4A 3OVNA 5J1EB 4AHRA 3DMJA 3KK1A 4DQIA 3VQPA 3I0RB 2F8EX 1ZETA 4N56A 4F2RA 4M3WA 4PQUA 1ASVA 3DRPA 4LH5A 3ZSQA 3S3OA 3CDEA 4E7IA 3M8QA 3OHBA 3VQ7A 3AA3A 1RDAA 3RAXA 3K5OA 4LQ3A 3VQ6A 4C8OA 4FK4A 4E3SA 3CIZA 2JEGA 3KHHA 1RTJB 4HUGA 5KFUA 2HHVA 5KFVA 3AVLA 3N6NA 1SKWA 4BE2A 4IDKB 3S3MA 3DM2B 5FRMA 3IGVA 4DL5A 5KFMA 3V1RA 2Z1JA 1RT3B 4KV8B 1VSFA 4C8LA 4CF2A 1IKYA 3KK3A 4J9OA 3G86A 4CJWA 4FJ7A 5KFEA 3C6TA 4YNQA 4Y1DA 2JEJA 1N5YA 3CJ4A 1KTQA 1L5UA 3TABA 3NAHA 2RN2A 4ZVHA 1UA0A 1FKPA 1RTIA 4O3PA 3O3GA 3KOAA 4JUZA 2P1JA 2G8IA 1TAUA 2YKNA 3CYMA 2J6SA 4AHTA 5HROA 3H4BA 1JLBB 1HMVB 3RB4A 4KFBA 3OYKA 1TKXA 4M3TA 5CYQB 4DU1A 3QGHA 1W9HA 2XC9A 1Y97A 4ECUA 4MK7A 3RMDA 3DI6B 2ATLA 1XWLA 1SV5A 4CHZA 1NJWA 3L2WA 3QGIA 4Z4FA 3LAMA 1S1TA 1BISA 3KLEB 1MU2B 4CGJA 4URSA 4F50A 1DLOB 4G3IA 2OA8A 4CJUA 2GBZA 4ID5A 1REVA 3ZT1A 1HYZA 1T7PA 2ILZA 5EDWA 3LWMA 3L8BA 4OGCA 4Q43A 1WNSA 4L8RB 3PR4A 2EC0A 1WAFA 3M8PB 5C24B 1S97A 5KT2A 3H40A 3BQ0A 1YT3A 3NH0A 4MIBA 1N48A 1SH3A 3ZT3A 1IM4A 1DTTA 3L3VA 3AVCA 4DFPA 3NGIA 1S4FA 4FW2A 2W42A 4NLRA 5KFNA 3SI6A 4CIFA 4GC6A 4N47A 5KFTA 4DFMA 4FM1A 1HQEA 3O4QA 4O5BA 1SL0A 3SQ0A 4J9MA 1A5XA 3QIPB 3DRSA 4B9VA 3BREA 4IH7A 2XRIA 4DWIA 1VSIA 2C2EA 1TV6A 1I3AA 4ELTA 5KFQA 4FLWA 3CVKA 4FLTA 1S1UB 2HNZB 2ITGA 2BQ3A 4BACA 4H8KA 2RDJA 3KK2A 4DL7A 1VRUB 3KD1E 3B6OA 2DPJA 4HVJA 1LWEB 1SKSA 3V9SA 3DOKA 3QINA 3VQBA 3SJJA 1T05B 4FS2A 4IH6A 4CJFA 4QWCA 1C1CB 3RMBA 5KG7A 5KG3A 3VN5A 4Y1CA 4ICLB 4ZVGA 1Z4UA 3QEXA 5DK5A 2KQ2A 3PR5B 3IRXB 4ED6A 4ZVFA 1S6PB 4DL6A 2HNDA 1L3TA 2AWZA 1RT7A 3EY1A 1XI1A 5KRSA 3GV5B 3VQ9A 3AO3A 5SWMA 3FFIB 2KFZA 2XCPA 3CM5A 3ITHA 2HHXA 4I7FA 1S9GB 3HSTB 5DQGA 3CDWA 4IRCA 3UDLA 1U49A 1JKHA 2JEFA 3WNGA 4J2DA 2KZZA 3KLIA 5KFPA 1S10A 4B9NA 2GV9A 3E01A 1NK6A 4IKFA 3HM9A 4DTUA 1DTQB 4FJ8A 4ZPDA 5D3GB 4NLOA 4IG0B 5KFJA 3QO9A 2HVHA 3DMJB 3KK1B 3LAKA 3V9WA 1RDCA 4PQUB 4ED7A 2VWKA 3PV8A 1BQNA 3PX4A 2WCXA 4RNMA 2DY4A 2YNHB 4KB1A 4M3XA 2E9RX 4I2QA 4IR9A 4BE1A 4FZZA 2FVPA 1D1UA 5I42A 3DLRA 4CIEA 2DFFA 1RT5A 1QTMA 5J2MA 1IKYB 2KZMA 3KK3B 4FJ9A 4B9UA 5HRSA 4M94A 3D28A 4RW8A 3QEVA 1Q9XA 1N5YB 4LQ9A 4NLVA 5HP1A 2UVWA 3CJ0A 2GC8A 2YNIA 3AV9A 1FKPB 4O3QA 4M95A 3DLBA 4AHVA 4FJIA 4XPEA 2YKNB 3NGYA 3KLGA 3HVRA 5KFBA 4ZHRB 1C0MA 2YNGA 4F4KA 5HROB 4WFZA 4J2BA 3C6UA 2XY5A 4RW7B 4NLUA 1B9FA 3SUOA 4KFBB 4WZMA 1RT4A 1ASWA 4Y2CA 3T3FA 2WTFA 5HLFA 4CK2A 4KB7A 1NKBA 4MIAA 5KFDA 1T03A 2VG6B 2G8FA 4IFYA 3PO4A 1SV5B 2R8KA 5KG1A 4E19A 3IS9A 4NRTA 2RDIA 2BQRA 3BGRA 2FVQA 4M3YA 4CGIA 1RILA 4CJ3A 3L2VA 4KI6A 1C1BA 3G6YA 4EP4A 4ZPAA 3SCXA 4FJLA 5DG8A 3MR6A 4O0JA 4OPJA 4LSNA 1S1WA 4KHWA 1QSYA 3RR7A 4KE5A 2V4RA 2FJVA 1REVB 5F8NA 3HO1A 1RBTA 1W25A 1QS4A 4TYAA 4FCYA 3DLHA 1RBSA 5JS1A 1N6QA 4WXOA 2HW3A 4G1QA 1TL3B 4H4MA 1D5AA 3V81A 1QAIA 4Q45A 5C5JA 3N6LA 5L1KA 3B6PA 1DTTB 4FLUA 5J2PB 3K58A 1BGXT 1K6YA 1HYVA 3MXMA 5KRTA 2R8JA 4NYNA 3KLHA 4ED2A 4ECWA 5F8MA 4QWEA 1TL1B 5HBMB 3QEIA 4AHUA 2IM2A 1HQEB 1RTHA 4CF0A 1A5WA 1N56A 3QEWA 2BANA 3DRSB 1S9EA 4I9QA 1BI4A 4JV0A 3V9XA 2HAIA 2OH2A 1XR6A 1L3VA 1QSLA 2XY8A 3MEGB 4OGEA 2HHUA 4KKOA 1LV5A 4O4RA 1JLGA 4MK9A 2X78A 4OLBA 3PW2A 4CJLA 3DOKB 4K50A 3Q8PB 3SQ1A 3MECB 4CJQA 1RT6B 1TP7A 2XO7A 1JXBA 2RF2B 2ZD1A 3MEDA 4EO6A 3H2LA 4DF8A 2CJQA 2VWJA 3K2PA 4ZVEA 2W9AA 3NH2A 2HNDB 1W0HA 4ED8A 3HVTA 4MQ3A 4E7LA 2WONB 4CHYA 1JXLA 1IKWB 4GW6A 4I7FB 1ASUA 1WSJA 4HUEA 3AO4A 2X74A 5HRNA 3KLIB 5FDLA 4URGA 1KRPA 1NOYA 4M45A 3E01B 3ASMA 4I9LA 4Y2AA 4Q0BA 2YNFA 1IKXB 2UVRA 4JS5A 3L2UA 2X6NA 1HQUA 1ITGA 1J54A 2HNYB 3K59A 3QO9B 4B9LA 2BE2B 2ZE2A 1NK5A 2IC3A 4FLZA 2A1RA 2ETJA 4IH5A 1WSHA 1FKOB 3KKSA 4IKAA 4DFJA 1BQNB 2D7SA 3MR2A 4KAIA 1YTUA 3AVBA 1BQMA 5SZTA 3JYTA 3QIDA 3ISND 4GVMA 4I2QB 1LW2A 1JIHA 1GX6A 5KT7A 1TKTA 1RT5B 1HRHA 3H08A 1RBVA 5J2MB 5KFHA 2ALZA 5KGWA 4RW8B 1RCHA 1S1XB 4KTQA 1Q9YA 4NLYA 1KSPA 1TVRA 2YNIB 1WLJA 1JLQB 3NCIA 1IH7A 2WOMA 4ZPBA 2OPPB 3MAQA 3M8RA 1RA7A 4JV2A 4RU9A 5J2NB 1CXQA 4M3UA 4N5SA 1WSIA 4LSLB 4KAZA 4Z4IA 4CFAA 4K4WA 2YNGB 1GOBA 4MKAA 1SH0A 2O5DA 3WNEA 3KHGA 2OYQA 1S6QA 4RW6A 4J9PA 5DQIA 1RT4B 4Y34A 1O1WA 1SUQB 5EWGA 2EX3A 4E1MA 3UIQA 3KIOA 1ZBIA 1XC9A 4NCGA 1T03B 1QUVA 1IKVA 4CK1A 3Q8QB 2OZSA 3M9MB 1D9DA 1SL2A 3OL8A 2E6MA 4O4GB 1SKRA 4ECQA 1S0NA 5DLGA 5CY4A 2BR0A 3BGRB 3TAEA 2G8VA 1UWBA 1C1BB 4URQU 4Z4EA 2I5JA 1S49A 3BSOA 1S48A 4CECA 1EETA 3TAGA 4ECVA 4CF9A 2ZQBA 2GUIA 2CKWA 2JGUA 4KHSA 1EXQA 1N6QB 1YVUA 3V6HA 4K4ZA 1T94A 4KHRA 2W9CA 4BWMA 1QE1B 3GIMA 2ASJA 4H4OB 1S9FA 4CHNA 3V6DA 2XY7A 4CEOA 3GIIA 1N4LA 4B3OB 1LW0B 3MFHA 3I0SA 2AGOA 3DLEA 3N6MA 3LANA 4LH4A 4NLWA 3Q8SB 2IAJB 1ZYQA 1D8YA 3GIJA 1RT2B 3NE6A 3AVHA 3M8SA 1BI4B 3LP2B 2AGPA 1KVCA 1L3SA 5JUMA 4DTJA 1CZ9A 3ZSOA 1U48A 4Q44A 3OY9A 4KKOB 4DSKA 1QQCA 4ECXA 5KFGA 5HRPA 4ID1A 2P51A 1Z25A 1TKZB 2NUBA 3PJWA 4HTUA 2IS3A 2QE5A 1X9WA 3PVXA 3FQLA 4CHOA 3NBPA 3VQEA 3V6JA 2RPIA 3FRZA 4HYKA 4AHCA 3RRGA 4FK2A 3LZIA 4K4UA 4R5PB 4I2PA 2HHSA 1NHVA 2ZD1B 3MEDB 5CZ2A 4FW1A 3NAEA 3SUPA 4DSJA 4QWAA 5T7BA 4CEZA 1HNIA 4RUAA 2XHBA 4KO0A 2HHTA 3KLFB 3VA0A 4C8MA 5EWFA 2W7PA 3HVTB 1BIZA 1LAWA 3K57A 3T19A 3VQ4A 1C0UA 3MF5A 3K5NA 3PZPA 2R2SA 4EBCA 4IOBA 4BDYA 3JSMA 3LP0B 4W5RA 5FDLB 2OPSB 1HARA 1LWFA 3V6KA 4WFXA 4Q0BB 4CF8A 2KTQA 2UVVA 3MR5A 2WRMA 1C6VA 3AVFA 5F8LA 3CJ2A 1VSMA 3OS0A 3TI0A 4EO8A 1NK8A 3I5CA 3NGZA 3RB6A 3TAPA 3HVAA 4DS4A 4F2SA 5DLFA 2HMIA 2FBVA 4FYDA 4ED0A 3V4IA 4CFCA 1BQMB 4FM2A 3H98A 3LP1A 4DTSA 1RYSA 3BQ1A 3JYTB 3ALYA 3AVMA 1KLNA 4ZP7A 2WK4A 4FJJA 3KJVA 1RBRA 3BSNA 1TKTB 4ED1A 3IGNA 2FLNA 5C42A 1D0EA 3CJ3A 2R8GA 2JLEA 3SV4A 2KFNA 4DS5A 3HYFA 2VG7A 4BWJA 4N76A 3O4NA 3PX6A 4O3SA 5KGXA 4EYHB 1TVRB 2OPQA 3QETA 1HPZA 5CYMA 1U09A 2ZKUA 2IM0A 3WNFA 4CJTA 5C25A 4J9LA 2X6SA 2E6LA 4NLGA 1IG9A 1VSHA 4X2BA 3OYHA 3CQ8A 4W5NA 4TY8A 4FJ5A 3NKYA 3CJ5A 4DU4A 2R7YA 4TQRA 3KD5E 1S6QB 3PW7A 5FROA 1JLAA 4RW6B 4K4SA 1ZBHA 4KSEB 1EP4B 1K1QA 4O44A 2D41A 4ZP8A 3QGGA 1U4BA 3DRPB 4JV1A 4NCGB 4Q8EA 3M8QB 3FSIA 4CJ5A 4IG3A 4NYZA 1RTDA 4QCLA 3SQ2A 1RDDA 4J9QA 3D0PA 1S1VA 3OJUA 5KI6A 2VA3A 1KFSA 2F8TA 3MXIA 3MEEA 5DG7A 4FJNA 3OSPA 3VQQA 4ECZA 2I5JB 3ZSYA 1NJZA 3KHRA 1J53A 3IG1A 3T5JA 3RAQA 2YHAA 1KHVA 2HHQA 3C6TB 3HHKA 5KFIA 3PY8A 4DL3A 3SI8A 4GMJB 3GQCA 2IM1A 4XIUA 3U3GA 3PW0A 4M3RA 2G8KA 1RTIB 2ILYA 4CGFA 3NHGA 1RDBA 2W9CB 3HVWA 5F9LA 2RKIA 3OL6A 3L3UA 4KBIA 2QK9A 1J9AA 1VSKA 1VRTA 1WSEA 5F8IA 1LWCA 1XR5A 4E0DA 4IRKA 3DRRA 3UQSA 1KFDA 4CEBA 3HJFA 3P83D 3I0SB 3NF8A 5DMRA 3QYYA 3CFPA 3TR8A 4ECTA 4YFUA 1TKXB 4J9SA 1NK4A 5KG6A 4DLEA 1RA6A 3NDKA 1RYRA 3CFOA 4O3RA 2JEIA 3L2RA 3SQ4A 3VQCA 1S1TB 3LALA 4CEQA 3NFAA 5J1EA 4IFVA 2UVUA 4CF1A 3I0RA 3NF6A 2FVCA 2B6AA 4FZYA 3EPIA 1B9DA 3P1GA 2Q3SA 4CEEA 5KFZA 2E9TA 4E7HA 3ZT2A 4R0EA 4ID5B 3OL7A 5KTQA 3LZJA 4CFDA 1RTJA 4B9MA 1A5VA 3VA3A 2QKKA 4I2PB 1TKDA 1S0MA 3L2QA 3DM2A 3MR3A 3NMAA 4HCBA 3NAIA 1RT3A 4KV8A 1HNIB 4QW8A 4KO0B 3KKRA 3AVKA 1X1PA 3D45A 4FJXA 4NCBA 4LY7A 4DTPA 3K5LA
chains in the Genus database with same CATH superfamily
1T3NA 2E5IA 1UMJA 3CMQA 4P2XA 3EX7B 1YTAA 3EXYA 1VHXA 2I1RA 1DEJA 2DGVA 3JSMB 3HSZA 4K4YA 2Q43A 4IZ9A 3DOMB 2E2QA 4TKTA 3SCLE 1QSSA 2OD6A 1M5HA 3G9CA 1KXPA 4DX8H 4NXNJ 1TV6B 5GIOA 5EU7A 2ZBRA 4WU3A 3U27A 2DYAA 2V4JA 2FZCB 1XNRK 3GJRB 5CYQA 2I0XA 1KTVA 5DJBA 4IO9Q 2UV8G 3SMSA 3LP1B 2EW9A 2P9KB 3OW2M 2A42A 1RFQA 2D0OA 3G6ES 1UJ6A 2P9CA 4C98A 3CJ1A 3QIOA 4FYVB 4BC2A 2QMWA 4GVEA 2RQCA 5JS2A 2VG7B 4DR5K 2DFEA 1RT7B 4OZ3A 4X62F 4K4TA 3O4WA 3NMUA 2CNLB 1EWQA 4LBIA 2CADA 5AQGA 5CR4A 1FVQA 5C24A 1FFSB 3HT3A 1SQFA 3MCAB 1JKHB 5KFOA 2PMZD 1SB6A 2R2UA 5HMYA 2NQPA 1UOCA 6AT1B 1CZBA 1VQ6N 5BRFA 2P2CB 1NWKA 3KWGA 1UAWA 3VESA 4WFAQ 3AJ1A 2Y8WA 4IEIA 3T1YK 2LCWA 4O44B 3NH1A 1U1NA 5KT5A 3KNAA 5HMZA 4WIQA 2B51A 2YHWA 4OKEA 2BYCA 2QV6A 4TQSA 5D77A 4PHTX 4OJ3A 4DX7A 3BUZB 3CM6A 4CIGA 1B99A 2FD2A 2J4RA 3OUYB 2OI2A 2YHXA 2PZSA 5I42B 1NOZA 3CNQP 3M1FA 3DOLA 3OYMA 4DL2A 2G2OA 5HP1B 3SLCA 4MT1A 4EZ9A 3ZTPA 2C3OA 3T5LA 2RKIB 4R8UA 3EKUA 1S6PA 3KLGB 4ZVRB 2CJKA 3TAQA 4UUXA 1NHUA 3T9ZA 4FJGA 2Z4PA 4A8MP 4CGGA 4JI5K 3I4PA 2GGPA 1ZBTA 4A5AA 1ZBLA 2E2OA 3VQDA 4K59A 4IFYB 4ZCIA 1YVNA 4FK0A 1YHQN 3M32A 3HXMA 5D3GA 3K2YA 4JKAA 2KLAA 2EKNA 4IOAQ 4FPAA 2B6AB 2FJDB 4F8RA 1NJXA 3M1VB 2BUPA 1DGKN 1W7AA 3ULDA 2YH0A 3H7HB 1QAJA 3VQTA 3QZ8A 5LJ3Y 3I56S 4QR0A 3OYIA 4ILLA 4UOHA 2GCFA 2I7PA 1N8RO 2JOQA 4C3KA 5DGBA 3LM9A 3MM6A 2ASMA 2FHOB 2VBWA 5CZXA 5AXLA 4DHVA 2A5XA 3CJKB 1P1LA 1TU0B 4B3SK 4RBTA 4DF4A 2DHGA 4RW9A 2Q79A 4Z7CA 2AYGA 1YJ9N 2BANB 3AVNA 3K8WA 4ZHRA 2F7TA 5JVHL 1GNKA 2HS0A 3JSRA 1VBXA 1BL3A 1ZXOA 4EBEA 2CQ3A 3W1YC 1KAZA 3JS6A 3CMAS 2XMVA 3GIKA 4HTIA 2ZITA 4W5TA 4A57A 4EFAC 4QS9A 1QY7A 1HBMA 4W90B 2POKA 4W92B 1UFKA 1PC5A 2L48A 2VPXB 1IJEB 1WAJA 4CD1A 1Q16B 1J5OB 2MKKA 1K8KA 3VEOA 1YJWS 4QZVB 4NRUA 4TN2A 3LDSA 2D74B 1AROP 2VUGA 5BYSA 1VGYA 2ZBPA 4MYUA 1FESA 1OY8A 3D1OA 4KH0B 3J80O 1BY9A 1U2CA 1NDPA 3WQPA 2P8IA 5DM7Q 3RWUA 3FGVA 1H1VA 4NEYA 2VFVA 3W8GA 4MJKA 2QTWA 4FL9A 2F4FA 5EXWA 3MMBB 4IBNA 3UO0A 3CD0A 1YVFA 2YNFB 5D78A 1UVKA 3KXDA 5DZ6A 1K0TA 1VQON 1DQ8A 1X9MA 4F7VA 4CO1A 2IYIA 3DXKB 3L6QA 5IQQA 2WAQD 3MCMA 2UXCJ 3Q2SC 4MFBB 2ZM6J 1WOQA 3C95A 3I32A 4P73A 3ICLA 1RI7A 4AYBD 1XNQJ 1EZZB 5I4MA 1C1AA 3D2WA 2NRRA 3MN7A 4FYYB 1VIXA 1RHRB 2VONA 1G15A 3WT0A 2DH7A 2QWQA 3THWA 4KGXB 1K73T 3FZBA 4HT5A 3MM8A 1S7HA 3DWLA 3QNWB 2VQFJ 3VHQA 1VQ6S 1UPPA 3F56A 4ZIWA 4AUKA 3VQSA 2W9BB 3TX0A 1NKCA 5GAEU 4F3OA 2F4VF 4C3LA 1KQKA 4B3MF 4HCCA 2X1GA 2M4MA 1DFDA 1WC3A 2FSJA 4WIIA 3OTOK 5HO4A 3PUFA 3HD2A 4LRAA 3MPUB 3EZ5A 2OTLN 4ILMA 2WONA 3C14A 5IT9U 2Z2MA 1Z2ZA 4CCHA 1HNVA 4CYUA 1ROFA 1JLCA 1E4FT 4OZLA 2UUTA 2GJ2A 1NLKL 4DXLA 5ETVA 5DDRC 2FF6A 1IKVB 4YQWA 4FLVA 5U47A 2MDAA 1R8HA 4PZVA 2KM8B 2F8MA 4RPFA 2BJ9A 3L0QA 4FWPA 2DR5A 1HYSA 4JV5F 2X3GA 2JC1A 5K14B 4OZ5A 5DRKA 2QXFA 4WPAA 3MM5A 5HL7L 1NK9A 3OFGA 1S0OA 3IDHA 1WOOA 5GAGI 2I9SA 3PFEA 2Y0SD 3AT1B 2NSBA 1NGIA 5FRNA 2RHSB 4J9NA 1N36K 5LMNK 1HNZF 2V8HA 3FZKA 4HI2A 4FPIA 4CVNE 1NGAA 1R0CB 3WXJA 2YWFA 1YHQS 2O8DA 1CJTA 5L38A 2CJ9A 3TQEA 3TANA 5GAEP 2B5JA 3MMJA 5LJVA 3R27A 1TGOA 1HI8A 4F36A 3FCVA 1UETA 2LEPA 2NZCA 1HWIA 1JL2A 2GUPA 4ZP6A 5FD1A 4JI5F 2IVOA 3RBEA 2HQDA 4USHA 1BE4A 4L3NA 3NGDA 4RBVA 4M41A 2P9UB 3CWJA 2XS7A 4O4GA 1K1SA 4FJKA 2KB2A 2AEMA 3Q8RB 1TK5A 3MX5A 3SNNA 1KVBA 1KHWA 1RAAB 3CMES 1HBNA 1RGIA 1QVFM 4DQRA 1YJ9S 2NRWA 5KG5A 1K44A 4JI6K 5KFCA 4HR2A 3ZCMA 4RWXA 3KYLA 3CC2S 3TVYA 4GKKK 3SPYA 1F5CA 2FGOA 1C0UB 1BIUA 2CG4A 5BRHA 4B8CA 2ZDOA 4FWRA 3CW2C 1S5JA 1QE1A 2QL5B 5EX0A 1C4CA 4A47A 5AQOA 4J5OA 1Y5NB 5KFYA 4CEDA 1NSQA 1RHQB 3C6AA 2C3UA 1B0TA 2JDJA 4LFCJ 2MTLA 3BSAA 3E66A 2RS2A 3QLHB 2CPYA 1TFYA 2HOEA 3TX8A 3H59A 2QA2A 1F21A 4IEEA 3HHLB 2VPYB 1MROB 1X4AA 1S7IA 1X4GA 4XH5A 3GL1A 2CGKA 1W2BR 1R27B 3OYJA 4OHYA 2OTJS 2QI2A 2KRBA 4EZ6A 2AA4A 4L74A 3O8MA 3IC1A 4KTZA 2HFZA 3JTOA 4HT7A 1X5TA 2YX1A 2HBZB 1X0FA 2RUSA 1S76D 3B8AX 3ZT4A 4O0IA 4CE9A 2VQEK 3GCWP 2KH9A 3HP6A 4ILHA 5F41A 2PC6A 5CZ1A 4I6AA 4DV6J 3ZT0A 1E4GT 2E1PA 3GU0A 2R2RA 3BJYA 3O3HA 4RG8A 2ZZMA 1ILYA 1ZM2A 5A8RB 2DTUA 2VKRA 4DLGA 4QW9A 3A5LC 2OPSA 3BO2A 3PJ9A 3OW2R 2C1EB 3A8EA 2UYTA 1WSFA 4QAGA 4M5KA 2ZEJA 5DS7A 3R6GB 3KNGA 1NSKL 3OXGA 3L7OA 2HSTA 3DXMA 2ZJPQ 4WFNL 3NL0A 1AB8A 1U1OA 3DLKB 3PIOL 1X9SA 3O44A 3OYCA 1RWXB 3CFRA 1OO0B 2DT9A 1C1CA 2O1PA 2D0BA 2EVZA 2PSZA 1F6TA 4RUCA 2F96A 3AAQA 1NNDA 3AO5A 1BA1A 3R7BB 3VGKA 3IM9A 2MQ8A 3LGNA 3RG6A 1B7FA 3T6JA 1UVNA 1IBLK 3DXBA 1U1PA 3VAGA 1S9GA 3OSNA 3WQUA 3UDVA 2OEMA 3A2FA 3SYZA 2JFKA 5AXKA 3R6MA 2QC3A 4CBUA 1VOMA 4TYBA 1T8EA 4WK1A 1ZOTA 2BABA 3OTOF 3OVNA 1RBLA 2F8EX 3D68A 5AZJA 4F2RA 3FBEA 2KDOA 2M5YA 3CDEA 1DRZA 3OHBA 2IDLA 1RDAA 2LEAA 4LQ3A 1YBAA 2O3DA 4FK4A 3SJHA 5E3AA 2P9SB 3MWBA 2HGLA 4HUGA 2UXBJ 5KFVA 3AVLA 1SKWA 2VFRA 4IDKB 2JFDA 3DM2B 1EARA 3PHTA 1RT3B 2OAUA 4USJC 1IKYA 2NLXA 4A8KA 4CJWA 4ID8A 1N5YA 3CJ4A 1KTQA 3TABA 3NAHA 2NLWA 3VGLA 3QPIA 4JUZA 2G8IA 1Y0HA 3HMJG 1Q95G 5EN1A 1NXIA 2KN4A 4K41A 2ZHBA 4AHTA 2R3VA 1B0VA 3FZLA 4JKBA 3SCKE 3GFYA 1VQKN 3MPYA 5LMNF 3M2VA 3RB4A 4KFBA 5JICA 2F4VJ 2M3DA 1A9NB 4B3MJ 4M3TA 5FPNA 2YKAA 3E2EA 1Y97A 4ECUA 3GJSB 1M1GA 2QIFA 3DI6B 2ATLA 4CHZA 3QGIA 2FF3B 8ATCB 1BISA 3R2CJ 2WTUA 4JI1K 4P72A 2APOA 1MU2B 4CGJA 2DNNA 4C11A 3TSPA 4LF9K 4F50A 3AJDA 1DLOB 4U7UK 4G3IA 1EWRA 5AQJA 1NPRA 1S99A 3WBZA 2GBZA 3K0JA 3DCAA 2YY3A 4Q43A 4HWIA 4JV5J 3PR4A 2Q0UA 1KP6A 1BDGA 1S97A 4A8YA 3NH0A 4MIBA 2BJ1A 5B0GA 1GXTA 3BGFA 2BKPA 1KVIA 1IM4A 2XMKA 1OQ3A 3AVCA 1ACMB 4DFPA 1SXLA 1P90A 2XB2D 2IVNA 3G71S 4NLRA 3ZZYA 4F67A 2RJZA 2HBYB 5EHHA 5KFNA 4JI6F 4CIFA 1DQAA 4N47A 4DFMA 3G82A 4FM1A 4RCHA 4J9MA 1A5XA 3QIPB 1HNZJ 4IH7A 2LDIA 4FLWA 3EVMA 3CVKA 1S1UB 4DUZK 4CLLA 3L9ZA 2BQ3A 4KH6A 4MIWA 4BACA 5H1SQ 1IBKF 4DV7F 1VRUB 1DKGD 3QFUA 1KWMA 1VJWA 2DPJA 1LWEB 4L73A 3S8SA 4M8LA 3QINA 1Y64A 4FS2A 1YLXA 4QU7A 4NYPA 1XJWB 8RUCA 3IR5B 3G8TA 1Q8BA 3BPDA 1RKJA 1V9OA 3RMBA 4J9VA 5DM6Q 3SCJE 5KG3A 4ED4A 1Z4UA 2Z56B 2QFJA 2KQ2A 4BRCA 4OIXA 4ZVFA 1T9XA 3LGMA 2AYMA 1L3TA 3GV5B 2AD9A 2Z2ZA 3C15B 3J7YI 3FFIB 3BYPA 5HI7A 2F63A 2HHXA 2NRXA 3C16B 3CDWA 2VFTA 4J2DA 3KLIA 1S10A 3A3NB 3NCQA 1NK6A 5HMXA 1CJVB 3HM9A 1DTQB 4FJ8A 4ZPDA 1VQYA 2R7UA 4OJGA 2PA3A 5KFJA 3KK1B 3TOQA 5ETTA 1X3NA 3PV8A 5A8WA 1EX8A 1O13A 3PDNA 4UF4A 4RNMA 2DY4A 2E9RX 2GA7A 4JP8A 2X1FA 1NCLA 1PBUA 1MWKA 2DCUB 4L75A 2X7IA 2QWRA 2DFFA 2ZH1A 1RT5A 2MMYA 4A5BA 1KBRA 3GLJA 4I6MB 1VISA 4Y0WA 2EFNA 3D28A 5EX5A 1SC4B 4FXVA 1CJUB 1TL4A 3QEVA 1Q9XA 4IUFA 2LQBA 1KQFB 1FKPB 2DHHA 4O3QA 4M95A 3DLBA 1NZAA 4A62A 2DGUA 3CERA 3ENOA 2ZBCA 1EO1A 5HROB 4YHHK 4J2BA 3C6UA 1CBKA 2O8BB 3CCSS 4LC9B 1FNXH 1B9FA 1ASWA 2CPZA 1IBLF 2WTFA 2DHSA 5HLFA 1UEKA 3PACA 4MIAA 3M6WA 3W9HA 1T03A 1NKBA 1R59O 2ZH8A 2VG6B 1WBDA 3PO4A 2ABYA 1D9AA 1TUYA 3VCDA 3ZZPA 4E19A 3IS9A 3M30A 1EQMA 4NRTA 4LR8A 3VEXA 2FVQA 4M3YA 1PYSB 4RWTA 4MAKA 2CDRB 1VI7A 2KI2A 4KHWA 2ZZNA 4QYRA 2FJVA 1REVB 2V4RA 5F8NA 2R4FA 2WSFC 1W25A 1QS4A 1RBTA 2BTFA 5AFUH 1ZAWA 3DLHA 3U9ZA 4G1QA 1ZM3A 3PIPL 1FDDA 5AQWA 1D5AA 2EXUA 1PKUA 3V81A 1Q78A 3EL2A 2ZJQQ 2J0SD 5AR0A 4BVOA 2FHMA 2IVYA 5C5JA 3N6LA 4DJBA 4UY85 3BN4A 3OR2A 2VU5A 4JKEA 3MXMA 2MQMA 2R8JA 4NYNA 4ED2A 5M1NA 3QEIA 1R7IA 4CM0A 1HQEB 4CF0A 3CJAA 4JV0A 1H3DA 1T9WA 2CZ4A 2HAIA 1QSLA 1NDCA 3MEGB 1QVFR 1WORA 2CQIA 1HLUA 2NRVA 4O4RA 1FNOA 2QLJB 3DLLQ 1IBMK 3QBCA 3UWTA 3PW2A 1PJ5A 1HI0P 1RWPB 2QMUB 5IV3A 1X4FA 3DOKB 1WKLA 1U2RA 1PCAA 3MECB 4CJQA 2KYZA 1RT6B 7FDRA 1YF5L 3MEDA 4EO6A 1ELOA 3PLAA 2I7NA 3K2PA 4JI1F 1UZDA 1YSJA 2BZ2A 4TU7A 3BR8A 5IQ6A 1J6ZA 4L72B 1T0TV 2EFVA 3WEEB 5BYQA 4GW6A 1WSJA 5L46A 2IFXA 1SI9A 2NYHA 4URGA 1EQ0A 2QYGA 1QZ5A 3MMAA 2UVRA 4JS5A 7FD1A 4BROA 3QICA 4FKYA 1ITGA 3AY9A 3IUCA 2BE2B 1QAXA 5IV4A 4CD3A 2XZWA 2A1RA 2ETJA 1WSHA 1FKOB 1IJJA 2RHKA 2UUBK 3QBXA 1YTUA 2M88A 5LMNJ 2Y0BB 2GJFA 1WJ9A 2MZSA 2ITMA 2QX0A 4QYZJ 1JIHA 5D4PA 5KT7A 2ALZA 1VR6A 3O5TB 1UW9A 1S1XB 1O0PA 3S1TA 4KTQA 1KSPA 1N8RT 2YNIB 3NCIA 2WOMA 1JQGA 2HPUA 4C97A 3M8RA 1U6ZA 1RA7A 4CDIA 4DR2J 3BZCA 3EKSA 4BRDA 4KAZA 3LPEA 3GWCA 4Z4IA 2DY1A 2Z57B 3C3LA 4DCPB 1SH0A 3MPVA 4RW6A 1WF1A 4M1KA 2V63A 1OY9A 3MN5A 4E1MA 1JCFA 3KIOA 3CD5A 2KU7A 1HW8A 2EPIA 4F4AA 1F3VA 1QUVA 2VC0A 3H1VX 3HSGA 5AQXA 4P7TA 2GVDA 3U1MA 2VHGA 1QTNB 3DN9A 2ZJRL 5D0HA 2E6MA 2P9PB 5DLGA 2AJ2A 2DJWA 1C1BB 4Z4EA 3Q7CA 2HQCA 2ZDPA 3CCQN 2QJ3A 3J81O 3W5ZA 1EETA 3TAGA 3IWNC 5JLFA 1N6QB 1IBKJ 4DV7J 3ADAC 5T7LA 3MWTA 2ZC4A 1UWAA 3CCEN 2DGSA 4BWMA 4LF7K 3I8BA 3A8JA 3HFVA 3V6DA 4I6WA 2WW4A 1GLEG 5JVGL 3TA2A 2CQ0A 1N4LA 4B3OB 5FLXY 3M5RA 2ZWHA 1O5JA 5A76A 2MKYA 3OR1A 4LH4A 3QRRA 3QRQA 5AXMA 2A0FB 2IIHA 1D8YA 2L9DA 4Y65A 3AVHA 3LP2B 4DR3K 5JUMA 3O08A 2BVZA 3LUYA 1FD2A 1RWNB 2NUBA 2IS3A 2QE5A 5AZIA 2OJ3A 3FQLA 4JI2J 3NBPA 4F3QA 3V6JA 3MMCA 3FRZA 2HGMA 2XTJP 3RRGA 3VEWA 5EOYA 3D67A 4CRJA 4BRNA 3AOBA 2EWHA 2DD8S 2Q6CA 3CIPA 4FWNA 1Q82O 3KLFB 4C8MA 3DHXA 3RW7A 2W7PA 1P8ZA 1SKUB 3K57A 3VEVA 3T19A 1TFWA 1GAOA 1EJ7L 2P9IB 5GMDA 5GADI 5ETMA 3JSMA 3GMGA 1RAHB 3DOMA 4Y00A 3UD4P 4BR5A 3EVOA 4AFFA 4M5MA 4Q0BB 1A0OB 1MWQA 5BREA 1RU2A 1Y3JA 1CEZA 2A3ZA 3HI0A 1ESVA 5AE1A 3PEJA 1VBYA 1HA1A 2WRMA 4ZPWR 4FPRA 2FHKA 2P9EA 5M2PA 3N0VA 1FFWB 1C6VA 5F8LA 3OS0A 1Q18A 3KK7A 3GE1A 3I5CA 4DS4A 2N7YA 2NUUG 4F26A 4FYDA 3NGSA 4MMOA 4FM2A 3H98A 2ZGYA 3LP1A 3BQ1A 3JYTB 1GLAG 2P9KA 3UI3A 1KLNA 1NB7A 2AIRB 1X4BA 1RBRA 3OTCA 3CPWM 2VOPA 4OPHA 5C42A 3AY0A 2KFNA 4FF4A 1MA9B 1IBMF 2VG7A 3PX6A 5KGXA 4LIRA 5K8MA 3CQXA 1TVRB 3MOZA 4OZ2A 4RR5A 2YWWA 2X6SA 3PSIA 2W1BA 3GE9A 3A5MC 1IG9A 2GX8A 1VSHA 3C6HA 4LR9A 3OYHA 2Q66A 1LK5A 4X66K 3B4MA 1IUJA 2R7YA 1S6QB 3PW7A 3H8YA 1ZBHA 4KSEB 1Q5VA 4O44A 3J80U 1GXLA 2M8HA 1U4BA 1MWZA 2FGCA 4K42A 3C7NA 2FSNA 5BN9A 4M5NA 4DQ8A 1WBBA 2GHVC 3T6BA 3FSIA 4CJ5A 2DY9A 4QCLA 3SQ2A 1RDDA 3OUYA 2J8SA 3OJUA 4WQ5A 2NRHA 2Z8QA 4DUYK 1I1GA 3OV7A 3OSPA 1CG2A 2HRYA 2CXEA 4OI0A 1PJ7A 2UUBF 2HHQA 3C6TB 5KFIA 3PY8A 4GVBA 3SI8A 1GEHA 4GMJB 3WX4A 1XMOK 3OBWA 2IM1A 2CGJA 4USTA 3PW0A 1RTIB 2XM3A 1HI1A 5JLHA 1T02A 2PDAA 1HNWF 3HVWA 2RKIA 3OL6A 2QK9A 3JAMO 3M2RA 4E0DA 4FWMA 1U6FA 3NF8A 4CM2A 1WI8A 1X3MA 1BQXA 1S3XA 4YFUA 1TKXB 1GTHA 2B9XA 2FJEB 2V50A 4EIAA 2V6AA 3IFEA 4LRFA 3CFOA 2FXUA 4LREA 1VQNN 3AQOA 3NFAA 5J1EA 3S7RA 1Q1KA 3FBFA 2B6AA 2B9YA 3P1GA 2Q3SA 3FMWA 3M1VA 4E7HA 3ZT2A 1C4AA 4ID5B 1HNXK 3OL7A 1JB0C 2A10A 3BF1A 3LZJA 1VS3A 3JB9k 3OFFA 5B0AA 4OX9F 5FIIA 5EVZA 4P2FA 3NMAA 1NEEA 1ZC6A 1HNIB 4KO0B 1HKAA 2FJBB 3AVKA 3CJSA 1WSRA 2G4BA 1X1PA 3D45A 4FJXA 3MUVP 1VBKA 4N7TA 4DR6K 2OP5A 3F2KA 3M9NB 1KC8O 2R2TA 4LF5K 3CJKA 2E4LA 1HWLA 4RNOA 2RT3A 4RUHA 1OYDA 3SQGB 1Q0NA 4UZCA 2XQCA 4KHQA 3T7ZA 4B1YB 4NYOA 4OQJA 5JXSA 2G8WA 5F3ZA 4TLRA 3CCUN 3HPOA 5MLCQ 4LF7F 1JLBA 3TSUA 4DTRA 1HIYA 2OHDA 2KO1A 3P8BB 5E5NA 1H7WA 3D1QA 3SFUA 1FERA 2LQ9A 4NZ7A 3HPHA 2HMIB 1J5OA 4WFYA 3AVGA 3FDSA 4MKVA 2OKQA 1SL1A 1RNHA 5E84A 1U2FA 4DR3F 1TTHB 2PE8A 2D1CA 1VQ5N 4K0KK 2O4IA 3WC2A 4YP3A 3M7VA 3CF5L 3W65A 5L1LA 2J6TA 4KH5A 1Q7YO 4U6PA 1Y9OA 3U9DA 2R7QA 5HVFA 2OPQB 2L3MA 3M8PA 3ITHB 3VOVA 2FVSA 5ETSA 2DRBA 2NUHA 4JD2A 1RWWB 4JKFA 1OPIA 2DNHA 4DTXA 3MMBA 3WXLA 2RVJA 9RUBA 2JC0A 4A8OA 2HFSA 1RHKB 3D2FB 2VODA 2NYIA 3NGKA 2DPIA 5EX3A 1R0BG 4FWLA 3DXKA 3BQ2A 2C2DA 3PTWA 2DO4A 3CC4N 1S79A 1AA1B 4MFBA 3CDAA 2VGNA 2AW0A 3PW4A 3N9UC 5IT9Y 3T1HK 2GO8A 3DDIA 4IOCQ 4CLTA 3MGJA 3AB2B 2B7BB 3BKTA 4DR7K 1JX4A 1P1TA 1AYEA 4YDXA 4LD0A 1XTZA 3LOUA 4RWWA 5AE3A 2CWXA 2R9LA 4HUFA 4CZFA 3E9LA 2C2NA 3KLVA 2W9BA 3HPGA 4ICLA 4QIWD 2HF4A 5CABA 2BOPA 2C2RA 2D3O1 4RO0A 3IRXA 3KVGA 3JSBA 3LA0A 3KUGA 1I94F 3H4DA 2XI2A 1LWCB 3G96A 3A13A 2HEKA 2WW8A 4YR0A 3H3OB 4Z4HA 1G99A 1N33K 3VGVA 4CLKA 5DG9A 1TK0A 2W2PP 3OFHA 2MQNA 1CQNA 1YUWA 1WC5A 4JI3K 4ANEA 2QSFA 1VCTA 4PWWA 4CHPA 5F8GA 5K14A 4EBDA 2GHPA 5KPTA 1QUPA 5H9EJ 2MLYA 1SCJB 4DQQA 4MK8A 3F5TA 1ZS6A 2PMHA 4K25A 4XPCA 2HRUA 5H9FK 2F3JA 2DNMA 1V4TA 4H4MB 2HURA 3D0HE 1F9HA 4ZTFA 2KM8C 3ID6A 2HBJA 3HP9A 2AGQA 3OYDA 4OKJA 2B4JA 3TAMB 1WC4A 3KLHB 3GR0A 4BDZA 2FY1A 2DIVA 4NL5A 3DYAB 4XH4A 1M0SA 2CVIA 5CAAA 4IWVA 3GOIA 4UOCA 1IBMJ 2PD1A 1S9EB 4B02A 4B9SA 2H51B 5L8RC 4RW7A 3TEGA 2RU3A 2FPHX 1O51A 5F0XA 1FT8A 3NF7A 2HB5A 2P6TA 1JLGB 1T95A 4DSFA 1WHXA 4WF9L 3EZUA 3ZNJ1 3AA2A 2RRAA 3I9ZA 3D7EO 3HKWA 3UKRA 1BMQB 2P9UA 3KMSA 1VMBA 3UN2A 4FJMA 4BC5A 5GAHU 5HRRA 4DV4F 4DU8A 3QZ7A 2HWIA 2F9DA 3OD2A 4WE1B 1R8PA 5AQPA 4BDPA 3BPSP 4JI0F 3RUBL 4QJVA 3FKBA 1KVKA 3MCPA 3Q24A 3AA8A 4ECRA 4I67A 3F9KA 3NF9A 3O9UA 1UVIA 2FLLA 2CPXA 4QWBA 2IVFB 3PHEA 2CNOB 5FPMA 3R9LA 1NGBA 2OPRB 1ZPVA 4B1XB 3FMBA 5D0GA 4KHMA 1GX5A 4UZBA 4M3ZA 4B1WB 1HBOB 2EI5A 4DR6F 2ZE2B 5HBMA 2RRBA 4OI3A 4LF5F 3QLHA 1HNWJ 4CK3A 2PI5A 2N3LA 2ZH6A 3R7SB 4ZVQB 2XS2A 2AT1B 5B0FA 1MROA 2UUCJ 2ATCB 3O1WA 2P9LB 1LW2B 4LJMA 3F0NA 2GMJA 3OFEA 1TUUA 4CT9A 1KQSM 3THVA 2UP1A 3LF0A 5H1SV 1Q81O 5DDQC 1ZAVA 3TW0A 3U1LA 2J5AA 1RDRA 2YHBA 4ED3A 2BRKA 5I3UB 1Q86O 5C2DA 1ZPWX 1MLAA 2UV8A 1E3MA 5GAHP 3AODA 3HHLC 3BSCA 1SJQA 3MAHA 3CC4S 4P75A 3EMTA 4OKKA 4OJHA 4H0TB 3PG9A 1BXNA 3RMAA 2BW2A 1YJTA 3JSYA 4CJVA 2FLPA 3IAS9 4OX9J 1VYAA 1IKWA 4GKJJ 2WUSA 5A8RA 2GNKA 4YOWA 1WKJA 1I39A 1H6KX 3CD6N 3W63A 2Z2YB 3ID8A 2XG8A 1WOSA 3CPWR 2HNYA 3A3PB 2XWYA 4Q8FA 3C19A 4CLWA 2ZUAA 4J2EA 1UWBB 2PYJA 1Z05A 3KJFB 1DBDA 4W4MA 3TVKA 1SC6A 1ZBFA 3GV7B 5B0EA 4DFKA 4PRFA 1IBCB 3DLKA 4LF7J 3MTJA 2Z2LA 2JL9A 4Y6IA 3HZGA 3T1HF 4XO0A 3BH7B 1D3WA 2CQ4A 1RU1A 2HLTA 1XQIA 2EFOA 2KHOA 4CBXA 9ATCB 3N5BA 3BO4A 4DR7F 4BG8A 3GV8B 2ZBIA 3M8WA 4WP9A 4DR3J 2Q31A 4AL7A 4BVPA 2MZQA 2OPPA 2HZAA 2EHGA 3CJ8A 4LSLA 3V2UC 4E7KA 5KPZA 4WZQA 1G3OA 1C0TB 1S22A 2HG4A 5F9NA 1U0HB 2YJEA 2PEBA 4NASA 5M1QA 4NB4A 1MMLA 2HHHF 2J7KA 4KR0B 4DSLA 1U2VA 2GELA 5KFRA 3PXGa 1V3RA 4K4XA 2QA4S 2P9SA 4CERA 4RNHA 3QDKA 3HOTA 3CC7N 2MSTA 2CPEA 3HCXA 4DV0J 4IDKA 1N5VA 5KFWA 3AVIA 4DBQA 3L4BC 4CLPA 3E9PA 3UVJB 3KMQA 4HHTA 4JI3F 2YHYA 2UXDF 2IMOA 4F4WA 2QXLA 1FK9B 2L08A 3U6FA 2VGMA 3FZHA 1OVQA 1FXDA 2V9WA 1MW7A 2O01C 2B43A 3D6MB 2BQUA 2KVIA 2PYLA 3DAWA 3IAYA 4E7JA 1M5VC 2HS3A 3OA9A 3GBTA 3QJJA 1LW0A 2ZGZA 2DNPA 2PFUA 2ROEA 3HL8A 4U67L 3MDFA 3NCRA 4OVLA 3CCVN 2Q6BA 3O9TA 3TWHA 3DDKA 2XGPA 1RT2A 1I94J 4DHYA 4A8FA 4JS4A 2YX6A 3DI6A 5LSRA 1U45A 1RLCL 4NPOA 4JRPA 1JLFB 1CULA 5A8KB 1MU2A 3CCLN 3BS9A 1T11A 1QHAA 3KJVB 5KG4A 4ETZA 3TARA 5K20B 1QD1A 4F04B 2YQ0A 2ROPA 5KG2A 2BOAA 4FPBA 5B0BA 5F8JA 4EMDA 1AXQA 2B3TB 1NLVA 1JL1A 5JJBA 2ZH7A 5ETRA 2PY5A 4FS1A 2IBOA 1NSAA 2CRLA 2ZUGA 1IJFB 4DEZA 4E1NA 4X4NA 3ZSRA 2Y1IA 1S72S 5C25B 2E88A 3CD7A 4ZS6A 3FSYA 3NMRA 4OHXA 4LR7A 4V19J 5KT6A 3KG0A 3HK2A 3JTNA 2FBTA 1PIEA 3D6HB 3M3ZA 4NE9C 1JLAB 4PWDB 1Z1ZA 2LQ5A 3F9MA 3NEKA 3QIPA 1XR7A 2OUGA 1YIJN 2Y1JA 4WWSA 2QWPA 3SK3A 2ZVIA 4ZMMA 4ZVUB 1S1UA 2LA4A 2FZKB 3H3NO 3CJ7A 3CHWA 1VRUA 2OLWA 3GYXB 2DGTA 2YQ3A 3PKYA 3B6BA 1YJ7A 1LWEA 1UJ5A 5EUHA 1JNZB 4X4QA 4WJBA 4H0YB 4YDUA 2B7CB 2UXCK 4OMFG 3LM2A 4K8XA 2HQ3A 2ZM6K 2LKZA 3ZXWA 3GYNA 4KI4A 2XMUA 4U8YA 2OSRA 5CHCB 2W40A 3PRDA 1D09B 2NSCA 3CCJN 2XEXA 3C15A 4HACA 1VSJA 5I9EB 4DV4J 2F5GA 3POTB 1HHSA 3O8WA 3M6GA 4JI0J 2W41A 3OLBA 1FRMA 3TR5A 2VQFK 5L1JA 4NMLA 2HAFA 3HRGA 4C8KA 1ZTWA 3U4LA 1WC6A 1CJVA 2DB1A 1VSLA 1DTQA 4PL8A 4KB0A 1LFPA 3E1YA 1XHXA 2C2MB 4FN5A 3KK1A 4DQIA 3UD5A 3I0RB 4B3TJ 4M3WA 1WEXA 1TL7B 4M5GA 4LH5A 1X9JA 1KDNA 3H25A 1YJUA 3M8QA 2HWTA 3VQ7A 4C8OA 2MHNA 3CIZA 3P96A 2JEGA 3VGMA 1VDHA 2YI1A 1X0PA 3THXA 1YWXA 5KFUA 2E1RA 4H5VA 4LF5J 3IGVA 4ZITA 3V1RA 2DR6A 1BO5O 1IQTA 2V68A 4KV8B 2H5JB 4MLEA 4FF2A 4I6MA 2AZ3A 1Y4ZB 3G86A 2JVRA 3DKDA 4KPCA 1V3SA 5KFEA 1G2EA 1JNRB 4LRDA 1RWMB 2JEJA 1L5UA 1V5IB 1Q82T 1UA0A 1FKPA 3W0LA 4O3PA 3O3GA 1VQ8S 3KOAA 2BH1A 2JLGA 3CYMA 4KIAA 2CQ2A 1UCNA 1NHKL 3BGOP 5HROA 3NWGA 2C2KB 2WVBA 5E3RA 1URRA 4FVCA 4CTAB 1DY3A 3OYKA 5CYQB 2XC9A 3RMDA 2MKHA 1XWLA 4Z4FA 3VF2A 1FDNA 3KLEB 1E6YB 4URSA 4X64J 1VFJA 2VJVA 5FPEA 3FRYA 5SUHA 1PG5B 5GAGU 5AQTA 4CJUA 1REVA 3AD9C 1X4CA 5F1XA 1T7PA 2PIIA 4L8RB 1WAFA 1RJJA 2XMAA 5C24B 1FVSA 2WVEA 4P6QA 3H40A 1YT3A 2P9NA 3CCVS 2K3IA 3IMQJ 3ZT3A 3L3VA 1RAGB 2YPYA 3NGIA 3THYA 1S4FA 2E7VA 4FW2A 3T1HJ 4JKDA 3G6EN 4U9RA 1R89A 2EWSA 3FEYB 2V2ZA 3HKZD 2YPZA 4ZLLA 1HQEA 1SL0A 3O4QA 2C3PA 4B9VA 4DR7J 3J81U 2PMWA 4RLEA 3A4TA 1T6CA 4FLTA 2ITGA 2EKYA 3KK2A 1F60B 3GR1A 4WTYA 3B6OA 2EFQA 1MN9A 3MPWA 3O9SA 3VGSA 3NXZA 3CQYA 4BBYA 3DOKA 1T05B 4LFCK 4DU7A 4IH6A 4OX7A 4A48A 4H5RA 4QWCA 4KH4A 4CI6A 3TJ9A 5KG7A 1H38A 4OHVA 4Y1CA 2HHHJ 3QEXA 5DK5A 2DR9A 3R5BA 3PR5B 1S6PB 4EU0A 4DL6A 5GAGP 3KWIA 2MB0B 1YIJS 2IHR1 1XI1A 4WP3A 5KRSA 4FXWA 3VQ9A 3WEEA 3A12A 2XCPA 4C1NK 3HSTB 5DQGA 4IRCA 3ZZUA 1U49A 1X4EA 2GGPB 2JEFA 4C6AA 2UXDJ 2QL7B 2CNNB 4HLBA 1J2VA 2FYXA 2RHQB 1KQSR 3TUPA 3HX9A 3M32B 5D3GB 4NLOA 3I9V9 4IG0B 4UY8O 2JRSA 3DMJB 4M5IA 5AT1B 3LAKA 4O23A 3V9WA 2R7XA 4CZIA 2JH3A 5IWAJ 3GYGA 2GX9A 4DV6K 1OH5A 2IRUA 2HFUA 1HKGA 4KB1A 4M3XA 2M70A 3OVSA 3CCJS 4ILRA 2WBNA 1EKRA 3QFWA 4I64A 4BE1A 4FZZA 1KR4A 1R3NA 3KK3B 4B9UA 2J0WA 1FA0A 3QJLA 2YNIA 4M7XA 2DGQA 3AV9A 3QWPA 5C15A 3KJNB 4K2XA 2UXCF 1AFIA 5BYRA 4AHVA 4PCQA 2ZM6F 3KUEA 1EB0A 3R6LB 5KOWA 3SMPA 4JI4K 1KC8T 2MY7A 3I87A 3I56N 2VH7A 4ZHRB 2OEKA 1C0MA 4WFZA 3BB5A 2YKQA 2XY5A 4WBFA 1FJ7A 3ILLA 4WZMA 4X4RA 4Y2CA 1FEHA 3NOCA 1W2IA 3OTDA 1HBMB 3E8OA 4H5WA 3A8KA 4OZ0A 3RZAA 2VQFF 1K8KB 4OLPA 1B64A 2NRTA 2Q97A 2P9PA 3TTDA 4Q7AA 2NCKL 1C1BA 2HVDA 3AXMA 1QVGM 4FYWB 4IJNA 1WF2A 4LSNA 1S1WA 2PEHA 2LP4A 3DXSX 3RR7A 3HO1A 1XUPO 2LECA 3CMAN 1TMMA 1N6QA 2HW3A 4H0OA 2OD4A 4NMXA 3KKFA 3R5GA 1QAIA 1VC5A 3ZC4A 2DBBA 1R8BA 2E5LJ 1ICEB 3B6PA 3O6QA 1YJWN 2UXBK 1Q7YT 2XULA 1BGXT 2XMWA 3HHLD 1HYVA 4HL9A 1B4SA 4ECWA 4QWEA 1NBEB 4AHUA 2IM2A 2AHOB 2J9DA 3BP8A 1RTHA 3SXLA 2CJXB 2OELA 2KT3A 5C2FA 4A61A 1FNMA 2P5VA 3NGRA 4KGVB 2HHUA 5MLCV 2C2ZB 2LFVA 1IWAA 4MK9A 3PRBA 2X78A 3JAMU 1T44A 3MCSA 2RE2A 4JKHA 3GG0A 4Z37A 4K50A 4ZJOA 2F4VK 1TP7A 4B3MK 4DB3A 3UN5A 2E66A 2X1AA 2VWJA 3W3DA 4X65F 3R1LA 4G9ZA 4JN4A 2W9AA 4MO5A 2HNDB 4H4KC 1QDUB 5HK4A 4JI8K 3N28A 3NS6A 2WONB 4OZNA 3SMZA 4WFBL 3AA9A 4I7FB 2P9IA 1ASUA 1Q4RA 3B4DA 1M5KC 2X74A 4ZPTR 4CZJA 3UE2A 2FUG9 2EG1A 5HRNA 4WCEL 2M7SA 1NOYA 4M45A 2E8AA 4KQZA 4B9QA 4I9LA 4Q0BA 4JV5K 3EXCX 3M8ZA 1HQUA 1XBWA 2WC9A 2GEMA 3TUJC 1C0GA 2IC3A 3BGLA 4BLGA 4DFJA 1BQNB 4G1PA 3MM5B 3RU0A 1T9VA 4X4PA 3J80Y 4K43A 4ALZA 4OYZA 5SZTA 1OH6A 3JYTA 4ZJQA 5LL6d 2DO0A 4XK8C 3RAMA 3I96A 1R8CA 1HNZK 4QIGA 1V3ZA 4YOXA 1WHYA 3H08A 1RBVA 5J2MB 2UUAJ 2KJVA 2OFHX 2KG1A 3W66A 4TU9A 3KG1A 4V19S 2A6MA 4NLYA 4ZVSB 2O8DB 1TVRA 4LFCF 3MAQA 4JV2A 1ZBSA 4KHPJ 5AQQA 2NPFA 2LEBA 4M3UA 2XYPB 4ANDA 4CFAA 3EGZA 4K4WA 4CI0B 2YNGB 5HAOA 4M63A 3VAKA 2OYQA 1S6QA 1GLLO 1UPMB 1L3KA 5AQRA 4Y34A 2EX3A 3UIQA 2RQKA 1ZBIA 3BEXA 4G1IA 4H5NA 1H7XA 4PG8A 2W4PA 1N0VC 2MXYA 5ADZA 4O4GB 1AZSA 1OWXA 5CY4A 3K0SA 4DL0C 2HZVA 4M63C 2DXDA 2XZTB 1HBNB 2EBGA 1WUAA 1S48A 4CECA 3BF3A 5BRDA 2HFNA 3AFGA 1FX2A 4PAAA 3AJ2A 4CF9A 4DV6F 2ZQBA 3HZEA 4TVAB 1GQEA 3WX8A 1EXQA 1U1MA 1XMQJ 3QT8A 5AQUA 4F25A 4ZKAA 2DH8A 1T94A 4KHRA 3I4HX 1FF2A 2Y1RI 2YWHA 1SBRA 1QE1B 2ASJA 5AQLA 1M5SA 1S9FA 2XY7A 1WTBA 1K47A 3GIIA 3MDQA 4TU8A 2D3OR 4P74A 4LBPA 1GXUA 3DLEA 3N6MA 3CMEN 1WSVA 2VZ9A 4DDFA 1ZYQA 4FF1A 4ISFA 2O8EB 1U26A 3CC2N 3FC9A 2NS1B 2AKWB 3IWXA 1L3SA 4DTJA 4HDHA 4JI4F 2ZNZA 1CZ9A 1KEKA 4EI2A 1YJVA 2QMXA 2DRDA 4F0MA 4B1VA 2DRAA 2QSWA 4ECXA 5KFGA 1GK8A 4FWSA 3PVXA 1UL3A 3KJQB 4AHCA 5AQVA 2KVQE 1VQMS 3LZIA 2XSFA 3ZLJA 3UE5A 2HHSA 1Q81T 2ZD1B 5CZ2A 1DAXA 2N4DA 3NAEA 1HNIA 2XHBA 4KO0A 2AJFE 3D4JA 1N54B 3VA0A 3EDRB 5EWFA 5LXRA 3HVTB 2Q1NA 1Q86T 1YX2A 4F0KA 2QT7A 5EGYA 3MF5A 2Z0GA 5B08A 3K5NA 4EBCA 2OTJN 4HI1A 3TWZA 2KL8A 4W5RA 5FDLB 2OPSB 1HARA 3UCUP 3J7YP 4WFXA 2AZ1A 3C65A 4UOGA 1R6YA 1W97L 4NLCA 5B8HA 3AARA 2UVVA 2UXBF 2KFYA 2QRRA 2HQFA 3PYFA 1B3TA 3ILIA 3AVFA 2CZ9A 2EFPA 3TI0A 3TTFA 1WOPA 2HBRB 1NK8A 5D8HB 4C4WA 3SIPB 2HMIA 3CXCM 1N88A 2R7RA 2KYXA 4CFCA 3UN3A 1BQMB 1QQOA 4LVNP 4DTSA 1RYSA 3AVMA 2ERRA 5JVHQ 1LCUA 4PG4A 2PT0A 3BSNA 1TKTB 3LTOA 4ED1A 2VL1A 3IGNA 4D3HA 1SJ1A 2JLEA 1HWJA 3HYFA 3O4NA 5C10A 4USKA 2DR7A 1JWWA 3TZXA 2EFGA 2HBLA 4K2JA 2OPQA 1OSCA 2WBMA 3WNFA 1WTFA 1OJ4A 4G6VB 4BGAA 3D9BA 3CIMA 3MM7B 2OEJA 4TY8A 3MWPA 4FJ5A 3RGIA 1X5SA 3D2FA 3CJ5A 3DFEA 4DU4A 2CQHA 4DV3J 2ZWPA 3QRPA 4JI8F 4LFBJ 4ILJA 1CC8A 5AZJB 4ZVTB 3GSDA 4JV1A 4KT0C 4B1UB 4D3GA 1U8SA 3L7PA 2L41A 4DV2F 4IG3A 4ZK7M 1U1LA 3CTRA 1RKIA 1Z2LA 2DGXA 2VA3A 2Q0RA 3MEEA 5DG7A 4FJNA 2QEXN 3RW6A 3VQQA 5B0DA 2P9GA 1J53A 3O9QA 1WDDA 3RAQA 3K9KA 1KHVA 2DGWA 3HHKA 4BR9A 3HDSA 5CCMA 4XIUA 2G8KA 2ILYA 2W9CB 5F9LA 1ATNA 4KBIA 2NRZA 2D0PA 2DITA 1VSKA 1VRTA 5F8IA 2MGZB 1LWCA 4CH7A 1XR5A 4QYZK 1ATSA 3DRRA 1KFDA 3AD8C 4MKYA 3HJFA 3VTIA 3M2VB 2XO6A 3P83D 3I0SB 4ECTA 4X65J 1H2UX 2LU2A 3IP0A 4FDFA 1RA6A 1RYRA 3HLUA 3L2RA 1OYEA 2UZAA 3VQCA 3LALA 4CLSA 5HVHA 4PABA 4DR2K 4OYIA 2G1DA 1WC0A 1Y7PA 4CF1A 3GB0A 4FZYA 4C11B 4Y0FA 3M6XA 3HOSA 2E1YA 5KFZA 2E9TA 1W26A 2RAQA 2NR0A 5IM0B 1FJEB 4R0EA 4J37A 3L3CA 1RTJA 5L9NA 3DC2A 2MEWA 4B9MA 5HN0A 2QKKA 4I2PB 1TKDA 4BC7A 3MR3A 4HCBA 3OBIA 3P3DA 1NGDA 5ELZA 3VAFA 4NCBA 2QTDA 1D8ZA 4DTPA 1OH8A 2V52B 2W01A 3OYAA 1I6JA 1HJRA 2PI4A 3TAMA 1U47A 2BE7D 4BG9A 1HQ2A 5HL7Q 2HFVA 2CPDA 1BWEA 3G82B 3DYAA 1PGZA 1LWFB 2E44A 4FWQA 2K1RB 2XZDB 3ET6B 1LOTB 1IBKK 4DV7K 3RBDA 4QWDA 2XY6A 1QVGR 5T14A 1TYQB 3ETOA 1KNZA 2GVZA 3CI5A 2DNRA 1AUSL 4CZCA 4CZKA 4NCAA 4EHUA 3LPTA 4QPXA 4UOFA 3G71N 4DPTA 1WB9A 2C22A 2H1YA 1WHVA 1FWPA 4CGDA 4FZXC 4BE0A 5ADXH 2IDOA 4MKBA 4J9RA 3BR9A 4WE1A 1Y00A 3R8YA 4PQAA 1OVYA 1U0SA 4DR4F 3V1QA 4FBUA 4HKQA 4PPZA 3NNHA 2QLBB 4C8NA 3GZ7A 1UTAA 4A8QA 3FZMA 2XI3A 3RSEA 3PEHA 5IS2A 4QS8A 4ECSA 1HPZB 3ONQA 4DQPA 3U7JA 4KYZA 2J6UA 4JI2K 4CJSA 2NREA 1EAYC 2IMWP 3ENVA 4CT8A 3R5JB 2OPRA 2QA1A 3GP9A 3FJ2A 3O6WA 5GVQA 1I51B 5KFSA 1HBOA 4F3MA 3UR0A 2AX0A 4YOUA 4J9KA 1GTEA 1OS5A 2GIQA 4BGBA 3F41A 2VA2A 1RTDB 4MTPA 1KCFA 3NVKA 5D15A 4ZCLA 1S1VB 1WG4A 2CQDA 2GMLA 2P9LA 2F9WA 1RCOB 2MJNA 2V7ZA 3HTVA 5C0YA 3R9PA 3FNNA 2NNWA 2AJQA 2IY5B 2YTCA 2R8IA 4K5SA 3CPEA 1WSGA 3IG1B 2W7OA 2GS8A 2IVMA 4DR1K 4NLQA 4JI4J 3JQMA 3MUTP 5I3UA 1IO2A 3ZSVA 2NXJA 3MX2A 1FRHA 5D4NA 2FHJD 1BOTO 3R3LA 1URNA 3A0IX 1DARA 1BC6A 5GADU 4CEFA 1KQGB 2GIFA 4BCAA 1BHLA 3W5XA 1FDAA 4PKHA 3FBCA 2X1BA 4W5QA 1XN9A 3C6UB 4QIFA 1FRJA 3I33A 3UKUA 2BMBA 3ULEA 4P52A 4JB8B 1DT9A 5HLFB 4NLTA 3OT9A 2QEXS 1U02A 3OYEA 2OZMA 1H98A 3P45B 2IJNA 5AQHA 4ECYA 3G2XA 1YBUA 3IS9B 2N82B 5CYJA 3S3NA 4IFVB 2WVFA 2CPIA 2BA9A 3VVTA 1V4SA 3NNAA 4B3RK 3IN5A 2F1FA 3CO9A 2ZVSA 4FYXB 4YR2A 4O3NA 3KTQA 4PY5A 2H4YB 3UR3C 2E2PA 5TKYA 2YNHA 4PG5A 1FW6A 3CCSN 1YITN 1Q8IA 5DQHA 1Y3KA 3QESA 4O5FA 1LFWA 3FK4A 1EKEA 2R8HA 2DNZA 2V7YA 4G1QB 2E1AA 3G0ZA 3V81B 3VGUA 4FWKA 2B8QA 2HWHA 4M42A 1PAUB 3GDQA 5CE3A 3MUMP 4WFNQ 3M6UA 4LVOP 4PUOB 4N41A 1VK0A 2KXFA 3PIOQ 5F3TA 2E1MC 2JJ4D 3HSJA 2LQ8A 4BRKA 1Y11A 3DU5A 4CJKA 2BBEA 2JNJA 3IM8A 5GADP 2G1HA 1D4XA 3WXKA 1C0TA 3NWRA 2BUNA 3DNCA 1U0HA 1HBUB 2D0AA 3AAWB 4RW4B 1F1BB 2ZWOA 2ZH5A 1BCMA 3W62A 4EEYA 3RRKA 5D4OA 4OI6A 3H0PA 4U7UD 3PKMA 3MD3A 1APSA 1KLMB 4IRDA 1UVJA 2O8CA 2A2CA 4I56A 4OX6A 3E51A 2CG8A 1NGCA 2QYCA 2HIQA 4C8YA 4ISGA 4JI8J 1F2HA 3LO3A 3EE9A 4DR2F 3H46O 3HJVA 1WC1A 4CIOA 4QR1A 1NGGA 4CW7B 4YORA 1FK9A 1FTCA 4DV2J 3HF5A 2GAGC 4NLPA 2DNLA 3PRVA 2CZVC 5AQZA 1TL3A 4QOTA 3I55S 1YRUA 3EEQA 4OYWA 3J7Z5 4YB5A 4M7YA 4NLDA 5J2PA 3G8SA 4BRLA 3TO8A 4JEPA 3MMAB 2B4PA 2DIUA 4O8KA 1VJQA 4DTNA 2VOOA 4JRQA 4C2MA 3OYGA 3MCNA 2ROGA 1TL1A 3CUNA 4DZDA 2VG5B 3CCTA 1RE1B 4KRFA 3MZIA 1WF0A 3P31A 3H5XA 4UY8T 3A5OC 5L9XA 4DTOA 1R8AA 2M52A 1JLFA 4GRSA 4ZN1A 1QHTA 3NS5A 2ASDA 4V19X 3CJRA 1MSWD 2XCAA 1CVJA 4TY9A 3SUNA 4FVUA 4XTTA 4AH9A 4CJPA 2RF2A 3ZETB 1GOAA 2WOMB 2D5RA 2H5EA 3TSQA 1FXXA 2ZZTA 1Z26A 4FM0A 1YJNN 2KJWA 2ZH2A 3OHAA 2R7VA 2HRTA 4XH1A 3GJTB 4R0JA 2FDNA 4PWDA 5J1NA 3CXCR 1CJKB 1SJFA 2VPWB 4U8VA 4NLXA 4OJRA 2YKMB 3IWLA 1EKSA 4C7QA 4JI2F 4H54A 4HEA9 1IKXA 2Z1GA 3QB0A 4JOUA 3ZX0A 3CB4A 4Y2MA 4DG1B 2P6SA 2Z1IA 2N7CA 3BO3A 2KRRA 3J8AA 2FBXA 3SV3A 4AHSA 4J90A 3K9JA 4LFAJ 2AP1A 1H73A 2E5JA 1HFEL 5D4LA 4ZA1A 1EETB 2JWNA 3M05A 4IDHA 4NX9A 4NYFA 3U8XA 5G4DA 3ZSWA 2EG2A 5T7LB 4YY3F 2XYGB 4GV9A 3LDQA 5EY4A 5AJ3F 3D54A 1X60A 2HQIA 5K8PA 3FBBA 3NGUA 3V6DB 2V94A 3FQKA 3WNHA 4DCOB 4CO4A 2DCLA 1JLQA 3POTA 3HD1A 1NMEB 4DR1F 3OR1B 3PFOA 4FXDA 5J2NA 4IO9L 4YOEA 4DR4J 4DL4A 2CQBA 2Q36A 2AJ0A 2A1BA 4CFBA 4CWBA 4DSIA 1LXJA 4MDAA 4OX8A 3PNIA 4L3KA 1YITS 5K9FA 3PSFA 1SUQA 2KW4A 4CJ4A 2CJAA 2BJ3A 3Q23A 2BRLA 4CO0A 4X4UA 1TK8A 3NBPB 4KPYA 2F8SA 2J9EA 2F8HA 4ZTJA 1XK8A 4Y3CA 3EGVA 3PYDA 3NLCA 3DLGB 2AX1A 3OYLA 4WFAL 4B3RF 2D0CA 4AD6A 1JMTA 5J2QB 2ZKTA 5BPMA 2CPFA 2YV0X 1KVAA 4B08A 1N0UA 4BR7A 1WI6A 2OFGX 5AFUA 4K5RA 5H9EK 1ZZNA 1TR0A 1KONA 4OLAA 4H4OA 3T1AA 3C94A 3D2EB 2GIRA 2Y9HA 2QWMA 3S9HA 3UCGA 3O1BA 4BRGA 4CTAA 2CAJA 2QLFB 2ZOMA 4NLSA 3QMQA 3CETA 2IAJA 5EWEA 2V8VA 3OS2A 2CQGA 3WXIA 2GW8A 3HBTA 4OLOA 2R42A 3I5BA 4ITSA 1REGX 1GT8A 2H5IB 3KLEA 1E6YA 3J81Y 1JXEA 1C0FA 2FJAB 4GC7A 3D66A 4PA1A 2V0NA 4F4YA 3CJQA 5LSLA 1UA1A 4W98A 2NZ4A 5E3PA 1TKZA 2Y8YA 2HHWA 5JMNA 5C42B 4QR2A 4OPAA 2Z30B 1RBUA 1YZ7A 1PYOB 4DKWA 1ZM4A 1ZM9A 3VWSA 3OTBA 3SZ2A 5K8OA 1NDLA 4R5PA 5HQ8A 2HVIA 2VWBA 4XEIA 3BZQA 4DQSA 1RTZA 3EE3A 2VF3A 3ZYYX 4IR1A 4EFHA 3IR6B 3MTKA 4OV1A 5KG0A 2GZOA 3P5TL 4IOAL 2QL9B 3G8QA 5A6WA 3VZHA 2R7TA 5F0WA 5KT4A 5IZHA 1NK7A 3CO0P 2IIRA 3R5DA 5HVGA 2J0QD 3LP0A 1AW0A 5RUBA 5THWA 4USVA 1XHZA 3EPGA 1SIWB 3PIPQ 1UKUA 1SJ4P 3C7NB 2K7KA 2VFSA 3EGWB 2WB4A 2H9ZA 3AOAA 3G4SN 1RT1B 4EGLA 4KHYA 1U8WA 2W2QP 3MM9B 1J5EK 2QN6B 1PBAA 1R0AB 2BJ7A 5A2QO 3OXLA 3AA4A 1JLEB 1VQ7S 4RX6A 3ZTSA 2FJWA 1YXQA 2Y1LB 3MFIA 3F73A 5HSPA 3QNOA 1JCGA 1S77D 3V1OA 2VJUA 3VPZA 1OMSA 3R5CA 2DKOB 1T05A 4DV5J 1YJNS 2Z1HA 1SQEA 2H48B 2V69A 2Y3YA 1HNWK 3NOGA 4GVBB 5CZVA 4O55A 4BR0A 4LSZB 1YI2S 3L7UA 5HATA 5LSOA 1NKEA 3SPZA 2UUCK 3M2RB 1PYTA 1Q79A 2IBKA 2GWKA 2J76E 1W7WA 3R1XA 1OIAA 3RTVA 4R79A 2MZJA 1UW4A 8AT1B 4C0OC 4M5LA 2OGUA 4WXWA 3IRWP 4L6V3 1JJCB 2OO4A 4V1Ak 4P7VA 4EYIB 3O3LA 4OYMA 4DN9A 2DXEA 3WIUA 5HOOA 1VQ4N 1NU0A 3KDOA 3AQPA 4IG0A 4J7CA 1EP4A 5J1EB 4AHRA 3DMJA 4Q2LA 2V67A 2EK1A 1ZETA 4N56A 4CJ7A 5DM7L 3DRPA 3ZSQA 1X5PA 3KZBA 3S3OA 4OX9K 4BQLA 3AA3A 3RAXA 3K5OA 3VQ6A 4E3SA 3EZWA 3KHHA 4GKJK 4JKGB 3N6NA 2XLKA 4GMKA 3JS9A 1R43A 5KFMA 4C8LA 1PAEX 2GFFA 1FTRA 4PEOA 3KK3A 4DOZA 4J9OA 1RDUA 4E98A 3Q8VA 4YNQA 4QS7A 4Y1DA 1RB0A 1RZMA 2RH3A 2RUGA 2H65B 2RN2A 2OMLA 2MYFA 4JHDB 3MD1A 4GV3A 2J6SA 2BKOA 3WDOA 4FZVA 2HYIB 1JLBB 1F3FA 1HMVB 4BR2A 3GJQB 3ZTQA 4OFZA 3W61A 1VHFA 3QGHA 1W9HA 4LF1A 3ZNUA 1GMUA 1NJWA 3L2WA 1X31C 2E7WA 1S1TA 4ES3A 2QO3A 3CCMN 3QGPA 3N01A 4JAXA 2KG0A 3UFCX 5CA5A 2XMMA 1M90O 2W4CA 3TPQA 3ZT1A 1NJIT 3W64A 3JAMY 5EDWA 4OGCA 1RAIB 5A0YB 2MQLA 2ZJRQ 3M8PB 1MDUB 5KT2A 4JD2B 3QWUA 1N48A 2DEIA 1SH3A 4LMZA 4C0HA 5BR8J 3IBWA 1GLJO 4DV0K 3DGPB 4DMZA 2W42A 2DGOA 4ZPVR 1YRTA 3SI6A 4GC6A 1KVJA 4OYXA 4YY3J 5KFTA 2CNKB 1KD1O 5AJ3J 4O5BA 4ANCA 3BREA 3CJTA 4DWIA 2XRIA 1VSIA 1TV6A 1I3AA 3TZWA 2OANA 5KFQA 1ITPA 2HNZB 1S12A 1RISA 2XHWA 5JVGQ 4DR1J 1VK3A 4DX5A 1FJCA 7AT1B 4DL7A 3KD1E 3MCOA 3GFXA 1P9QC 4HVJA 1FJGK 1JXVA 1SKSA 1XNRF 3V9SA 1Q53A 3VQBA 4BY9C 4KC5A 1JK9B 4PYDA 4PPDA 4CJFA 2QLWA 3KHYA 2U2FA 1HJOA 2DNQA 4I68A 4LF8K 1I3OB 3EZOA 4ICLB 4ZVGA 3THPA 1I94K 2CH6A 1IR2A 1VLOA 3ENQA 2RSQA 3IRXB 2WFBA 3N79A 2HNDA 1RT7A 4ZVPB 4UW2A 3AO3A 3G4SS 3BKUA 4DR5F 3CM5A 4I7FA 2Z58B 5LMUK 3VF6A 5B09A 2XNRA 1JKHA 2KZZA 2ZHAA 4B3RJ 2HMPA 4BRHA 4IKFA 1UVMA 2RILA 2V5HG 2FC8A 3QFPA 1RDCA 2CYYA 2XNQA 4PQUB 5LT5A 2VWKA 3T1YF 1BQNA 3O5BA 3LQVA 3PX4A 4XAKA 4FKXA 5AXNA 1QQMA 5AQSA 2DHXA 2WZ1A 4UTGA 1EQYA 3C0BA 1OSDA 3FEXB 1J5EF 1D1UA 2AYBA 5I42A 3DLRA 4CLUA 1QTMA 5J2MA 1RLDA 4FJ9A 3B82A 4OJ1A 5C2GA 1IR1A 2QWNA 4LQ9A </