3I0SA

Crystal structure of hiv reverse transcriptase in complex with inhibitor 7
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
558
structure length
558
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substituted tetrahydroquinolines as potent allosteric inhibitors of reverse transcriptase and its key mutants.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 160
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3i0sA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0sA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0sA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0sA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3i0sA05
3OYKA 2VG5A 1SH0A 2BRLA 2G8HA 3AVGA 3RMBA 4DLEA 2W9AA 5CYQB 4IDKA 5JS2A 4BACA 4M3UA 3K59A 4WFXA 2ILYA 3AVNA 5F8LA 1HNIB 5KFNA 3THVA 4NCBA 1S0NA 4CJLA 3DOKA 4YR3A 4F3TA 1C1BB 2OPPA 4IKAA 2RF2A 4KE5A 4H4MA 4I7FA 4BE1A 4FJ9A 3F73A 4K4VA 3CQ8A 4Y1CA 5KG3A 1VRUA 1D9DA 3GILA 3C94A 2BQUA 1I6JA 4ZMMA 4I2PA 5KFWA 2HNYB 1LWEB 1X9WA 1RT4B 5EUHA 4IG3A 4MFBB 4OGCA 1HPZA 4KPYA 4FLTA 1Z26A 3KK2B 4NLXA 1C0TB 1UAXA 4IFYB 4ED1A 5C24B 3LAKA 2FVCA 3CDWA 4NLUA 3CJ3A 4L8RB 2F96A 4XO0A 4FLVA 4PWDB 3KLGB 4CK1A 4FLYA 1JLCA 3KD5E 5I3UA 4NLQA 2F8EX 4CEAA 4FM2A 2RF2B 4K4WA 4CFCA 3AVMA 1NJZA 1EETA 1Q8IA 1LWCB 1BISA 1KRPA 5K14B 1TK0A 4F4YA 3IN5A 3ZT2A 1RTJB 3FFIB 3KKRA 1S1WB 2AJQA 3L8BA 2W8KA 4IFVB 3DLGA 3PV8A 4ZTJA 3OL7A 3OS0A 2FLPA 3IS9A 1U09A 3PW7A 2BDPA 3OL9A 3BR9A 4N41A 4CJ5A 3WNHA 3HVWA 4E19A 2I5JB 1FK9B 3RB4A 1QUVA 5F8MA 3HT3A 3VQ5A 4CFBA 3JSMA 5FROA 4CEOA 4RW4A 4DTRA 3ZSQA 4CHYA 1TV6A 1QSYA 2P5GA 3QIDA 4CIGA 4LSLB 2RN2A 1SL2A 3MF5A 3H5YA 4GC7A 2R8HA 3VQ7A 3SI6A 2VWJA 3TWHA 4MKAA 3GIIA 3TABA 4Q44A 4I7FB 1QS4A 4AH9A 2W9CB 4U7CA 1RTDB 5KFCA 3IRXB 3PX0A 3P1GA 3KMQA 4CJ3A 1TVRB 1RDCA 4ELVA 1RT5B 1RDAA 3DRSA 3PR4A 1HQUB 1NKBA 1RT4A 4YR2A 3KKSA 4WYLA 4K4ZA 4FW2A 4ZP6A 3P83D 3ITHA 2IAJA 1KVBA 4ECYA 1ASUA 1C1CA 2W42A 2DFEA 3LP2B 3RMAA 3UPFA 3JYTA 1NOYA 1NJYA 1HYSB 1JLQB 3OYLA 3SUNA 3H5UA 2ETJA 4AILC 3AVFA 1JLAB 3SV3A 4FJNA 4KAIA 2WONA 3HHKA 3FDSA 5JUMA 4OJRA 3TAFA 3DM2B 4EP5A 3Q8SB 1EP4B 1CXQA 4CK3A 2D3ZA 4MK9A 4K50A 4O44A 4CE9A 1NHVA 3QEVA 1CZBA 1RBVA 1OS5A 4KBIA 3MFIA 2VG6B 2X6SA 3QIPA 3NF8A 3M9OB 4J9LA 1S48A 2OPSB 3PR5B 4KV8A 3I5BA 3T5LA 4FBTA 5F8HA 4OPKA 4TY8A 5KFYA 4IQXA 1TAUA 4B9VA 2UVVA 2XC9A 4M95A 3JYTB 4DG1B 1N5YB 1HNVB 2B5JA 4FM0A 1D9FA 4KHUA 3D28A 2ZE2B 5KT2A 1HYZA 1ZBLA 1JXBA 1N56A 3ZSXA 3EPGA 3AA5X 3KJVA 1RYRA 1KFDA 3V81B 3KK3A 4FJLA 3NBPA 4RUAA 2EHGA 1JX4A 3DM2A 5DQHA 2R2TA 2IM0A 4U6PA 1SKRA 4Y1DA 3LAMA 3V9ZA 2D5RA 4MIBA 1FKPA 4CGGA 2IM2A 2W9CA 1S6PA 1RDRA 1XR5A 1RTIB 3IRXA 4DL3A 1JKHA 5HP1B 3SUQA 4AHVA 4TYAA 4CJTA 1RT5A 3U6FA 3HVTA 2HHWA 1S4FA 2CJQA 2B6AA 1BCOA 4MQ3A 3NAIA 3NH0A 4KI4A 5JXSA 5L1LA 4E7JA 5KFRA 5KGXA 1MU2B 4DS4A 1BQMA 1TL3A 1A5WA 4K4XA 1KHWA 2AU0A 1TKTB 4CJPA 4W5QA 2AGPA 3F9KA 3HK2A 1C1AA 4O55A 2P5OA 1RILA 2V4QA 2XY6A 1EXQA 3OL6A 3CG7A 4B9UA 4IG0A 3SQ4A 2IJNA 2O5DA 4NLVA 5HLFB 4JUZA 5EWGA 3RMCA 4AHTA 4Q5VA 2JEGA 4E7LA 1VSMA 4O4GA 1NJWA 4K4YA 1FXXA 2R8JA 1HQEB 3HPOA 2IBKA 4HUFA 1D1UA 1NK5A 1KCFA 4IRCA 4NLTA 3QLHB 3RAQA 4DS5A 4AHRA 4TSXA 2C2DA 1UOCA 4EZ9A 4M94A 1TL3B 3H08A 4B9MA 4DFMA 3LP1B 3KHLA 1RT6A 4B8CA 4DQIA 2KZMA 3G10A 3E51A 4RNMA 3I0SA 2P51A 3AVBA 1VRTB 3CJ4A 4ID5B 1J5OB 2E6LA 4ED6A 2E4LA 3MAQA 3DMJA 2O4IA 5SZTA 3V1OA 3BQ2A 3AVLA 2UVWA 4CESA 3ICLA 4YR0A 3B6OA 3D0PA 1J9AA 3KHHA 1Z4UA 1JLEA 1WSGA 1IKYA 4EYHB 3CDUA 2E9RX 5KG7A 2OPRB 4W5NA 3HO1A 1JXEA 2VG5B 4Z4GA 4CJ4A 3NH2A 2GBZA 4O3OA 3KD1E 2JLEA 1IKWA 4ECXA 1T7PA 3QEXA 2UVRA 1WSIA 1BHLA 1U45A 3VQ4A 1W0HA 4R5PA 3HVRA 4M41A 4E1MA 3BDPA 3G86A 3RB3A 1SV5B 4ZHRB 1JL1A 1S1XA 4CECA 1K1QA 2IC3A 1TP7A 3QGHA 2W9BB 4R8UA 1XWLA 3TAGA 3L3VA 1LAVA 3KK2A 5DG9A 3M8RA 4WXWA 3ZSRA 1WSFA 3AA2A 1GX5A 3QESA 1Y97A 1QAJA 4I2QA 2AQ4A 2IOCA 1JLBB 2VG7A 3DOLB 3AVHA 1U04A 3D45A 1K1SA 3VA0A 2HMIB 2WK4A 5F8IA 2JEIA 3M8PA 3RAXA 2YNGA 4NLRA 3L2QA 4FK0A 4DTMA 4O3NA 1RCHA 4Q43A 1QSSA 4G1QA 4ZP8A 3DI6B 4XPCA 4DL5A 3DLGB 4DF4A 2ILZA 4CEFA 2BANB 3EYZA 3IAYA 1IKWB 4WFZA 3NF6A 4O3PA 2OPQB 4QW9A 4KI6A 3BSOA 1WAJA 1ASWA 1S9EA 4LQ9A 4FJ8A 3H2LA 4DSJA 4IR1A 1XI1A 4M3XA 2W7OA 1S97A 4CHPA 1RT2A 2W8LA 3DLEA 1RTHB 2VG7B 1S1UB 2RKIB 4X2BA 3RR8A 2XCAA 3FFIA 3PW2A 4FZZA 1KSPA 4FM1A 4DFPA 2G8IA 5KFDA 1RDBA 4ECSA 2D3UA 4RUCA 3PO4A 1JLGA 3CDEA 4NRUA 4LSNA 5KFLA 2FBTA 2C2EA 1KLNA 1D0EA 1HQUA 1WSHA 3QGGA 3KLHB 4IFYA 2AGQA 4CJUA 3NF9A 1RTIA 2D41A 1JL2A 4KV8B 3CFRA 5FDLA 3NFAA 3HP9A 1QSLA 4DEZA 4WZQA 1FKOB 2KTQA 1W25A 2ATLA 1QE1B 2QKKA 3C95A 1F21A 3NL0A 1J5OA 5L1JA 3VQ6A 3KOAA 3CJ5A 4CGHA 4FLUA 3AVAA 5K14A 3BQ0A 5HRPA 4MK8A 1TKXA 1EP4A 2HHVA 4EP4A 4KTWA 4HTUA 2R2RA 3PHEA 1JLFB 1VSEA 5KI6A 3QETA 3RRGA 3OYCA 4O4RA 1VSJA 1KVCA 4KSEB 4OGEA 1C1CB 4DFKA 5KFZA 4J2DA 1UWBA 4IDKB 4URQU 5J2PB 5SWMA 1ZBUA 1U49A 3CM5A 4O4GB 2RDJA 4EBEA 2OPSA 1DLOA 2W9BA 1KTQA 3O3GA 2B43A 2KW4A 4NCGA 4K4UA 1EKEA 3V9SA 1DTTA 2BE2A 3HP6A 4KTZA 4FLWA 2CKWA 4EZ6A 4FS1A 4NRTA 3T3FA 4CF9A 2FJVA 3I5AA 2F8SA 1SKWA 1TKXB 4DSLA 4DSFA 2D0AA 4AHSA 4YQWA 1MMLA 5FRNA 4K8XA 3H4DA 1U4BA 3V6JA 5KRTA 3LZJA 2KFNA 2G8KA 5DLFA 3SJJA 4DTPA 5KFQA 3CJ0A 5KFSA 3ZSZA 4CHQA 2IM1A 4RW6A 4TLRA 5KFBA 2ASLA 4QWEA 2NUBA 4OL8A 2XGQA 2FLLA 2C22A 1GOBA 5KGWA 4W5OA 3H98A 3NKYA 3HKWA 2QXFA 4BWJA 3SQ0A 3BSNA 4PQUB 3BSCA 1S6QB 2AGOA 5FRMA 1L3SA 4PUOA 5CY4A 4J9QA 1B9FA 1RT1B 2A1RA 1JLAA 3OJUA 2BQRA 3OSPA 2DY4A 1JLGB 2XI2A 2FVSA 2HWIA 2FVRA 2OZMA 2G8VA 4O0JA 4DL2A 4MIAA 1U47A 5CYMA 1RT3A 3NH1A 5HLFA 2R2UA 2HHQA 3ASMA 3L2WA 3VQSA 2FVPA 4FJMA 3SUPA 4ZP9A 4I2QB 4NLPA 3PUFA 5DGAA 1WAFA 3SV4A 3AVIA 3RWUA 5DG8A 3OLAA 4RW6B 1K6YA 4FCYA 4E1NA 4MKBA 4KO0A 3KTQA 1ASVA 3DRRA 2YKNB 2KQ2A 2A1SA 1YT3A 2WTFA 4O5BA 2AX0A 1BGXT 3CYMA 4CHNA 3OS1A 4J2BA 4NYZA 5DG7A 3VQAA 3C6UB 4CGIA 3WNFA 2G8WA 1L3UA 2OPQA 1REVB 3TANA 2RDIA 1S0OA 3SQ1A 4J2EA 1LW2A 2C28A 1VSIA 5J2NA 3TAMB 1HYVA 3PJXA 5KT7A 5KFHA 3HPHA 3CFPA 4FYDA 4NLSA 3DOLA 2YNHB 5J2QA 1SH2A 4QPXA 5KG5A 4ECQA 3V6DB 3GIKA 2GC8A 1CLQA 1MU2A 1S5JA 4CJKA 1NKCA 4EO8A 3ZSVA 3Q8QB 3QEPA 3K5OA 1TKTA 2LSNA 5KT3A 4RNHA 4CEQA 4DF8A 4NLGA 4ZVEA 4ZP7A 4JV1A 4E7KA 4Z4EA 5C5JA 3V9WA 4FJHA 2YNIB 2YHAA 4G3IA 4ELUA 3C6TA 1JLBA 3OLBA 1RBTA 1HRHA 1GX6A 4H4OA 1IH7A 1G15A 4DSEA 5KFIA 4KB0A 4WYWA 4JRPA 1IKYB 1LAWA 4UQGA 3L2VA 4YP3A 1HMVA 4RNFA 4RW9B 4Y2AA 3OL8A 1S9FA 3PX6A 5J2MB 2Z1HA 1CSJA 2HB5A 3V6DA 4ZVHA 1J54A 5L1KA 4LSLA 1D5AA 2JC1A 1WSEA 3CWJA 4O44B 3QNOA 2HHXA 3N6NA 4LH5A 4DTSA 3AO1A 1BI4A 2QKBA 1S9EB 5KFOA 4FLXA 2OA8A 3UR0A 4EEYA 2B5JB 1RYSA 3AO4A 1SH3A 4O3QA 4DSKA 2BRKA 1JLFA 3KMSA 2FVQA 4E7IA 1HJRA 3TARA 3QIOA 4H4MB 3KLEA 4MK7A 3DMJB 3DLEB 2ATQA 1RTHA 4OKEA 4CGFA 4IRKA 2HMIA 3QINA 3M8SA 3QERA 2YKNA 3T1AA 4ECUA 5F8JA 1TKZB 3KLVA 3I0RB 1HMVB 4JLHA 1JLEB 4FBUA 4WE1B 3Q8PB 2XHBA 1T03A 3DYAA 4OKJA 3UQSA 3NF7A 4KO0B 2R2SA 3TR8A 5KT4A 4KAZA 3O3HA 4BDYA 3VN5A 1I3AA 4Y2CA 3HVAA 3PW4A 2WONB 4QWCA 1BI4B 3PZPA 3T5HA 5J1EA 2R8IA 2B4JA 4H8KA 4CJWA 2HNZA 2E9ZA 2G8FA 3S3OA 3TAMA 5KFKA 1SUQA 4F4XA 4B08A 3VQDA 5HBMB 4RZRA 5J2PA 5KG4A 3V6HA 4CHZA 2YHBA 2RKIA 3K2PA 3G6YA 3PY8A 2DTUA 4CEEA 4DQSA 3PW5A 1FKOA 5EDWA 2RPIA 1RTJA 3NGYA 3MR5A 1BIZA 5F9NA 3OYMA 3O3FA 1ZETA 3LWMA 2QV6A 2YNHA 3RTVA 4DG1A 3MR3A 1YTUA 2PYJA 1R0AA 1LWEA 4XIUA 4PA1A 3EZ5A 4HYKA 4IG3B 3QLHA 5KFMA 2E6MA 1YVUA 3RB6A 1LW0A 1J53A 4DU4A 3DDKA 5KFVA 1NHUA 2XY8A 2JGUA 5DQGA 3NGDA 3HPGA 4ICLA 3FQKA 4KHMA 4FJ7A 1JXLA 5KFXA 3ALYA 5KT5A 3DRPB 1DTTB 4ID5A 3SI8A 5C24A 4ZPBA 4H4OB 4CIFA 4E0DA 3LP3A 2HNDA 3RMDA 1TQLA 2R8KA 2JC0A 1QHTA 2R8GA 1TL1A 5E41A 4NLDA 3IGVA 1BQMB 3SQ2A 4J2AA 3U3YA 2BGGA 3RB0A 4ECZA 4DTXA 4C8MA 2I1RA 3GV7B 3IGNA 3MXIA 4IOBA 2FBYA 1LW0B 3OS2A 3VQ9A 5JS1A 4RG8A 3S3MA 1ZYQA 3NE6A 2FJXA 3DRSB 4ICLB 4NCGB 3MXMA 4PWDA 5DLGA 3PO5A 1S0MA 3TAEA 1CZ9A 4FJXA 4CHOA 4PQUA 3AO2A 4KB7A 3BREA 3OHAA 4W5TA 4DTJA 4CFDA 5KFTA 1T3NA 4JV0A 2HAIA 3ZT1A 1X9SA 3ZT0A 3OYHA 2Y1IA 1RT7A 3I5CA 3KLFB 2XO7A 1N48A 4IH5A 4C8NA 3I0RA 4ZPDA 3V6KA 3ZCMA 1RNHA 4F2SA 1N4LA 1W9HA 2UUWA 5KG6A 1IO2A 3V81A 2AWZA 4LH4A 4R0EA 2ASDA 1RT3B 3MECB 3NHGA 4B9TA 4QOZB 4B9NA 3DOKB 4CF8A 3ITHB 3M9NB 4TQSA 3OVNA 3H4BA 3T19A 1T05A 2X6NA 4F4ZA 4TXSA 3ZSOA 3AV9A 4ECTA 4LD0A 3EY1A 1IKVB 1QTMA 4PUOB 1B92A 2WOMB 4HCBA 1VSFA 3OYGA 5C25A 2VWKA 4FZXC 4Q8EA 4KTQA 4JRQA 1WLJA 3AO5A 3GQCA 3G6XA 4HHTA 5KFJA 3KK3B 3NBPB 1GOAA 2BR0A 5KFAA 4NLOA 4OLAA 3SZ2A 4EBCA 2XCPA 4KRFA 1EX4A 4DL6A 4ECRA 3TVKA 3KHGA 1NK9A 2ZQBA 3V4IA 3DLBA 2QE5A 4I9LA 4BE2A 1B9DA 5D3GB 3GIMA 3MR6A 3VA3A 3OHBA 2XY5A 3H59A 2YKMB 3DRRB 4ED0A 4N5SA 4TY8B 4AHCA 3VQEA 4IR9A 1RA6A 4WXOA 4RU9A 3MEGB 4ECVA 4TY9A 2BQ3A 2VG6A 3L2UA 3C6UA 5I42B 4QWBA 5EU7A 1QE1A 5KFPA 4B9LA 4NLWA 1T03B 1HQEA 2FBXA 2XI3A 3AO3A 2YNGB 1RAJA 2EC0A 4GC6A 1I39A 3K58A 4IRDA 3CM6A 4KHYA 3TQ1A 3K5LA 4ED3A 4HVJA 2HWHA 4FVMA 2O4GA 4M45A 3IG1A 4ZTFA 2J6TA 3OY9A 3DLRA 1VSKA 4FXDA 4Y34A 3K5MA 3A2FA 3SNNA 1NJXA 4TN2A 5CYMB 3RBEA 3ZT3A 1SUQB 4DU3A 3KLIB 4RNNA 1Q9YA 4I2PB 2F8TA 5HBMA 3KJVB 4J9PA 2Y1JA 5D3GA 1ZTWA 4RW4B 4DSIA 4RW7B 2HVIA 3CJ2A 3HVTB 3Q8RB 1S6PB 4F8RA 4LY7A 1RT2B 3LWLA 3RR7A 1UWBB 3LALA 4K4SA 3DLHA 5F9LA 1KFSA 3FQLA 4N76A 5J2MA 3MEDA 4NYNA 1R0AB 3LP0A 1DTQB 5HROA 2X78A 1C0MA 4DTOA 2XWYA 4PY5A 4CJEA 4R5PB 3MR2A 1C2PA 4B9SA 2Z1JA 3V1RA 3QEIA 3ZSYA 1NK6A 4LSNB 3NCIA 4NZ0A 2HW3A 2ASJA 3LPTA 3GV8B 1S1WA 1C0UB 2WHOA 4CEDA 3OYAA 5KFFA 4DQRA 2FBVA 3MEEB 1S9GB 1U48A 1NK8A 4BE0A 2Z1IA 4Q45A 4ED2A 2E9TA 4QW8A 4CIEA 4WE1A 2V4RA 1SKSA 3H5SA 4KFBB 4YMEA 1JIHA 1HYSA 4OLBA 3NAEA 2V9WA 1C6VA 2W7PA 2C2RA 4RW8B 1NOZA 1KLMB 4KKOA 1T05B 5EWEA 4QWDA 2IS3A 1XHZA 1IKVA 2YNFB 2IC3B 4IH6A 3S3NA 4R8UB 1VK0A 3O4NA 3VQPA 4C8KA 2J6UA 4C8LA 3ZT4A 3KLEB 3K5NA 4E7HA 1TK8A 4Z4IA 4GVMA 4F50A 3DLKB 2HNZB 3JSMB 3FRZA 2D7SA 3B6PA 4HUEA 1RT6B 3KNAA 2ITGA 1C0UA 4QAGA 4FK2A 3QO9A 5KFEA 3RRHA 4M3ZA 1ZBIA 2OPPB 3MEEA 4NLYA 1A5VA 4KHWA 3K57A 5EWFA 4FW1A 4M42A 3AA4A 2OPRA 4HKQA 2DFHA 3VQQA 4B8AB 3KLFA 2D0CA 4EYIB 1ZBHA 2GV9A 2ZD1B 4ZPAA 4DWIA 2PYLA 1KLMA 4KKOB 2JEJA 1S1TB 5I42A 3AA3A 3D5MA 4B3OA 3QNNA 4ELTA 4NYFA 1SV5A 4ZHRA 1GOCA 2Q3SA 2GIQA 4CJFA 3HXMA 4YNQA 3AVKA 1XC9A 4KREA 1VRTA 2G8UA 1SL1A 1UA1A 3PX4A 3ISNC 4ZVFA 3S9HA 5T7BA 4KHQA 4TQRA 3G0ZA 4J9NA 4FJ5A 4Z4CA 3SYZA 1HARA 3KLIA 1TK5A 1JLCB 3G6VA 1NKEA 1HNIA 2HHTA 1RDDA 3M9MB 1KVAA 5C42B 3OYIA 4M3TA 5DGBA 1TL1B 3DI6A 4J9SA 4W5RA 2DPJA 3KIOA 3L2RA 2XY7A 3HL8A 3M8PB 3GYNA 2ZD1A 3LANA 4KB1A 4RW8A 1NK0A 3VQCA 1ITGA 4DTNA 1BL3A 4FJIA 3PJWA 1S49A 3OYFA 3AVJA 1NK7A 4ID1A 4CGJA 3T5KA 3E01A 3NMAA 2KZZA 1QQCA 4URSA 2FLNA 3HJFA 3V1QA 1HNVA 1RT7B 1BQNB 2IJFA 4IKFA 1Z25A 4Z0UA 4NCAA 1ZTTA 5KFGA 1JKHB 5HP1A 3LDSA 2BE2B 3SFGA 4BWMA 3N6LA 2X74A 4AHUA 4XPEA 5T14A 1S1UA 2YNFA 3LZIA 3IG1B 5DMRA 3FSIA 2FC0A 1L3VA 3OYJA 2WB4A 1RBSA 5HRSA 2ZKUA 3P5JA 3MFHA 2J6SA 3HSTB 1VSHA 4TYBA 1ZBFA 1VSDA 1WSJA 5HRRA 3M8QB 3T5JA 4DMNA 4O3SA 3MECA 4RW7A 5I3UB 2IAJB 4FJJA 1FK9A 4K4TA 4DLGA 1BIUA 4WZMA 3DLKA 1EETB 2UUTA 1DLOB 3LP2A 4CJVA 4JS4A 5J2QB 4DQQA 1VSLA 4N56A 4ECWA 3L3UA 4I9QA 3NGZA 1LWFB 3TI0A 3OYNA 4ZVGA 2GUIA 4IFVA 4H54A 4Z4HA 3KK1A 3MTKA 3WNEA 1S1TA 4CFAA 4DFJA 2HHSA 5C42A 4ED8A 2IA6A 1A5XA 4F2RA 2WCXA 3GIJA 3HM9A 4WFYA 2AX1A 3KLHA 3VQ8A 3IS9B 1LV5A 1TKZA 5J1EB 1S1VA 4ZPCA 2YNIA 3BGRB 4CJQA 2DFFA 4GW6A 3MEGA 2KFZA 4KHSA 3ULDA 3SPYA 3U3GA 1S6QA 3CO9A 1XHXA 1IKXA 4FLZA 2YKMA 4C8OA 4URGA 5KG0A 3KLGA 1TAQA 5KRSA 3CIZA 3QEWA 3TAQA 3UIQA 3HYFA 3H5XA 4O0IA 4E89A 1TV6B 2XRIA 1DTQA 1NNDA 5HROB 2HHUA 2R7YA 5KFUA 1RTDA 4YFUA 4O3RA 5KTQA 3SPZA 2ALZA 4MFBA 5HRNA 4M3YA 3N6MA 1NK4A 4OKKA 3NAHA 1TKDA 1LW2B 5CZ2A 1Q9XA 2PY5A 3ISND 1WN7A 4JV2A 4Q0BA 1SL0A 5KG1A 1N6QB 4M3RA 3E01B 3QO9B 1O1WA 3ZSWA 1S1XB 2HVHA 3QYYA 1CXUA 4M3WA 1RBRA 3UDLA 4Z4FA 1L5UA 4FS2A 2VA2A 3TAPA 5DK5A 3LP0B 1IG9A 2GIRA 3WNGA 4HUGA 4HCCA 3OYBA 4E3SA 4OPJA 3DYAB 3VQBA 5F8NA 1UA0A 1IM4A 3MEDB 4IH7A 3CFOA 1D8YA 4JS5A 5F8GA 3EZUA 3EPIA 5L9XA 2ZE2A 1LWFA 1T94A 4ED7A 2WRMA 2IM3A 3QIPB 5CYQA 1T8EA 3V9UA 4CCHA 1X1PA 3GV5B 4J9MA 1KHVA 1YVFA 4CF1A 2FJWA 2UVUA 3QGIA 4DTUA 4K8ZA 1WNSA 1S10A 1N6QA 1RBUA 3OSNA 4G1QB 3OYEA 3NDKA 5DQIA 4CEZA 3M8QA 5KG2A 4CF0A 4J9RA 2P1JA 1RT1A 3PW0A 4F3OA 4KHNA 4DU1A 1JLQA 2IMWP 3KK1B 3O4QA 4F4WA 4N47A 1REVA 4B3OB 2IGIA 4CF2A 2HNYA 2PZSA 4FK4A 4RNOA 1HPZB 3BQ1A 3QZ7A 1FKPB 1QAIA 3I0SB 4CJSA 2OH2A 2DPIA 1TVRA 4GMJB 2EX3A 1C0TA 5L1IA 3QZ8A 3CVKA 4RW9A 4FJKA 3C6TB 3RBDA 4KFBA 4DL4A 3SFUA 1LWCA 4MH8A 1VRUB 4DL7A 2B6AB 3DRPA 3BSAA 1L3TA 1X9MA 1S1VB 4Q0BB 3BGRA 3KHRA 2OYQA 4BDZA 4IBNA 1IKXB 1TGOA 2HNDB 2WOMA 4BDPA 4FJGA 3OYDA 1XR7A 4Y3CA 2Z1GA 2QK9A 4QCLA 2I5JA 4EBDA 3OJSA 3AVCA 3MXJA 4IG0B 2XGPA 5FDLB 5J2NB 2IDOA 3SUOA 2V0NA 4CJRA 3BJYA 3LP1A 4EO6A 4J9OA 4KHRA 5C25B 4LQ3A 3V9XA 4FZYA 1C1BA 1S9GA 4QWAA 2YV0X 3H40A 1WNEA 4CGDA 2D0BA 3PVXA 1XR6A 1BQNA 3LPUA 4CERA 3I8DA 4OVLA 2OZSA 5KT6A 5CZ1A 4CK2A 2VA3A 4Q8FA 3V4IB 1BCMA 4J9KA 4DQPA 1RA7A 1YTAA 4CEBA 1N5YA 3NGIA 3SCXA 4F4KA 2BANA 2JEFA
chains in the Genus database with same CATH superfamily
1PO6A 5CCLA 4A8FA 4ZJOA 2V9KA 1MG7A 5CYQB 4DPUA 4ED4A 3BGUA 3M5RA 4CLSA 4P2FA 4WFXA 3MOZA 1BU6O 1HNWJ 3OW2M 3CD7A 5H9EJ 5LXYA 3P31A 4P73A 5E26A 4ILMA 2IIHA 2YX6A 3CMEN 3H42A 4H4MA 4I7FA 2EG1A 2NYHA 4FJ9A 4K4VA 5IT9U 4E2FB 3CQ8A 4DV0K 1H72C 2ZM6J 4M63C 3QQCD 3GILA 3C94A 4AM7A 2BQUA 1VJWA 1I6JA 4JKGA 4NWBA 2ZH5A 2F40A 2HNYB 4G9ZA 5EUHA 4IG3A 4QS9A 1GAOA 1MNEA 2QG9B 4ZLNA 3MWPA 3TUZC 1Z26A 5L46A 3KK2B 3W0LA 3UKRA 1KAYA 4ED1A 5A2QO 5EGYA 5C24B 2VFRA 2P9UA 4DV2K 2NRWA 3I6PA 2CPXA 1TUWA 3G82B 3DXMA 1ZZFA 4AFFA 4CO2A 1WG5A 1EETA 1Q8IA 1LWCB 4BRQA 1WHYA 1NMNA 1J6ZA 1RCOB 4F0MA 3L8BA 2I8EA 3M2VB 3DLGA 3PV8A 2PAVA 4C4WA 3OL7A 1H1VA 4TU8A 3PW7A 2DGTA 2RUGA 3CJCA 1VAZA 4CT8A 3MOJB 4H0YB 1E6YA 1VQ4N 2PI5A 4OZ3A 2QWMA 2VZ9A 4UUXA 1R59O 5A8RB 2CJBA 1VGYA 2RN2A 3R8YA 3MF5A 3P5BP 7AT1B 2R8HA 1QLNA 3SI6A 4MKAA 3GIIA 2E88A 3TQEA 5AQSA 1RTDB 2GEMA 3OVBA 3IRXB 1NGFA 3P1GA 1TVRB 3DFEA 2QTDA 2XMTA 4ELVA 1FE4A 1IR1A 3DRSA 3QAEA 3R1XA 4M5NA 2DH7A 3KKSA 4ZP6A 3RRKA 4ZCMA 4OZ0A 4V1Ak 3ITHA 4ECYA 4TNOA 3CMAN 3EKSA 3UPFA 3GCXP 4CJ7A 1JLQB 2MZSA 3OYLA 2VIHA 2VB6A 5DDQC 4OI0A 4PWUA 4U7UK 3SV3A 3OUYA 4FJNA 2WONA 3HHKA 5JUMA 3RYLA 2M5YA 4OHZA 3R5CA 3DM2B 4MK9A 4L74A 3E2EA 3OFGA 3I55S 5B0EA 4CE9A 3PRVA 4C23A 4CI6A 3QEVA 1CZBA 1EWQA 2K7JA 2VG6B 2X6SA 4B3TF 3NF8A 3M8WA 3CETA 4KV8A 2VC1A 3P3DA 4TY8A 5LY3A 5C10A 1WSRA 1R8CA 5L9NA 5GAHI 4I6WA 4B9VA 2WVDA 4DPXA 2FB0A 2W6KA 5LJ5Y 4B3SF 3MCPA 2HFNA 5AE2A 5B0AA 1HNVB 3CC7S 4KHUA 4NXNK 3D28A 1HYZA 1Q0NA 2QGFB 1N56A 3EPGA 3K89A 1PJ7A 1J27A 3NGSA 1KFDA 4WIQA 1YBAA 3M30B 3EM1A 1JX4A 2R2TA 1H74A 4U6PA 4JKBA 1SKRA 3VTHA 3LAMA 3V9ZA 2D5RA 4MIBA 2B9EA 4CGGA 3HI9A 3W61A 5D0GA 1NWKA 1IR2A 1KONA 2G13A 2W9CA 1X4BA 1XR5A 2IVMA 3GU0A 4YOVA 3W65A 4AHVA 1VQMN 3CGIA 3P96A 5D4NA 4CJTA 1ZAVA 3LH2S 2HHWA 1XQIA 3VEVA 1BCOA 5AQYA 3AH6A 3L7UA 4DOZA 3C8YA 1IWGA 3G71N 4DS4A 1A5WA 1PJ5A 2G9OA 1S12A 2FYXA 3WX4A 4CJPA 4JV5K 7FDRA 2AGPA 1CZAN 2Q31A 2L9NA 2DYAA 4MTPA 4A47A 2APOA 2E29A 5SUHA 2V4QA 2K3KA 1EXQA 3CG7A 2RRNA 1YHQN 5K5MA 1N8RO 3A5MC 2I6WA 1KVJA 4F36A 2KN4A 5EWGA 2Y0BB 4AHTA 1YIJN 2JEGA 5BPNA 4DQ8A 3OTEA 5BR8K 4OV1A 3VZHA 1IBKJ 1VSMA 2B7CB 1RSCA 3F9MA 2R8JA 1SS6A 2B3TB 4NLTA 5F3ZA 3PYGA 3I33A 2ZJQL 4DI6A 3SQOP 3NCQA 2XMVA 3AQOA 4EZ9A 2VFTA 4DV5F 4M94A 1FNXH 1RWNB 4DV1F 4ISEA 4B9MA 2M7SA 2K8GA 3ZLJA 3LP1B 3R27A 4DQIA 5IQ6A 1ITPA 3O4WA 3G10A 2HIQA 3I0SA 1SKUB 4C3KA 1VRTB 4JHDA 2HFOA 1J5OB 1VBYA 3EVMA 3ZEUB 1NDCA 4RO0A 5IC4B 2CRLA 4F3QA 3DMJA 4IXCA 1W26A 2Z56B 3MEKA 2UU9K 3AVLA 2N7YA 3GZ7A 3ICLA 1ZAXA 3KHHA 3I96A 4DR4F 5AQFA 4EYHB 5L39A 4DUZF 1LXNA 1V3ZA 4O3OA 4ZN1A 4OX9J 4A48A 4JI4K 3VQ4A 3W63A 3HVRA 2R3VA 2W4CA 3GIRA 4M41A 3BDPA 3G86A 2YXLA 2P9LA 1FCAA 3IWLA 1JL1A 3MUMP 2W9BB 3L3VA 1S0VA 4JYAJ 4WXWA 1WSFA 3CJ8A 1QAJA 4I2QA 2IOCA 3N01A 1JLBB 2VG7A 3IUCA 3DOLB 5LM7E 1CULB 3VA0A 2X3DA 2HMIB 4BY9C 3M8PA 4NLCA 4BR0A 3ZZYA 4DTMA 3KJQB 1RCHA 4B1ZA 2YKAA 2YH0A 1QSSA 2VYPA 2UXBF 4XPCA 2NLWA 4DL5A 1NSKL 4CEFA 4DJBA 3IAYA 1N54B 2LXFA 1ZS6A 4K25A 4C0OC 3D2FB 2JLFA 3A8KA 1TU0B 1ASWA 4TKTA 1YZ7A 4YHHF 3PCOB 1D09B 3SCIE 2WSFC 2C42A 4FJ8A 3H2LA 2KYXA 3K8VA 4A8MP 3TPQA 2VWBA 2W7OA 4CHPA 2W8LA 4X62K 2QLBB 3D6MB 1S1UB 1FX4A 2P2CB 2VFSA 3M6UA 2XCAA 4IOXA 2PO4A 4DFPA 4FWQA 1XK8A 2ADBA 1S77D 3PO4A 5KFLA 2FSKA 1KLNA 1D0EA 1HQUA 1E4GT 4GV6A 2V68A 2AGQA 1JL2A 4HHJA 3CFRA 5FDLA 3NFAA 2I0XA 2X7IA 3HBTA 3NL0A 1X8DA 4ZITA 1V5VA 5L1JA 2H3EB 3KOAA 4CGHA 4CZEA 1RWOB 1SQKA 3GG4A 4BG9A 5A0YB 1NXIA 1J5EF 2O8DB 5HRPA 2XNQA 4DV5J 3CW2C 1M5OC 4KTWA 4P2MA 4HTUA 2R2RA 2GHPA 4JI8F 1R0BG 3AJDA 1M90O 1HUXA 5L38A 1QUPA 1KVCA 3RW6A 4DFKA 3O8MA 5KFZA 4JYAF 4IDKB 1ZBUA 2RDJA 3NEKA 3B8AX 2ZBRA 1KTQA 1BC6A 3OPKA 5GMDA 1EKEA 1VQ9S 4WFBQ 4AYBD 1NMDA 3MAHA 4LF7F 4WK3A 4NRTA 2BZ2A 3T3FA 3I5AA 5G0RA 4UT4A 4CW7B 4DSFA 2CQ2A 5C7PA 4ANCA 2IRXA 1T9YA 4AHSA 3MMCA 4YQWA 4BC9A 4HH1A 1CBKA 5FRNA 1H38A 4BR7A 4JB8B 1NMEB 4USKA 3F0NA 1CS4B 2FZCB 1MLAA 5KRTA 1VIXA 2G8KA 2D69A 3ZSZA 3C2PA 5KFBA 1WHVA 1YJRA 4WQ4C 3D2EA 2HQ3A 3I4HX 3TVZA 2XGQA 2FLLA 2C22A 1AA1B 3IBFB 3NKYA 3BSNA 5HQMA 2AGOA 4C3MA 1B9FA 3AAWB 4IO1A 1CEZA 3OUYB 1BA1A 2DY4A 3QMQA 3O6QA 2QA4S 4A8KA 4JI3K 4U95A 2OZMA 4O0JA 3ZYYX 4MIAA 1U47A 5H1SQ 2NYIA 1RT3A 1GXLA 2KRRA 2FY1A 3NH1A 2H54B 1X5OA 4CZKA 4USWA 2C3OA 5B0DA 3L2WA 2FVPA 1Q81O 3BH7B 4NLPA 2BE9B 2VOOA 1NGHA 1S79A 1LWXA 5E3PA 2FHJD 3RWUA 3OLAA 1IBLF 4ZK7M 1ASVA 2YKNB 4EGLA 2KQ2A 2P9NA 5DDPC 4DR1F 2AX0A 2QEXS 4J2BA 4J5OA 3Q0AA 3C6UB 3X1LB 1Q18A 1G99A 2BUPA 3CF5Q 1VFJA 5ETVA 3DXKB 4C11B 1L3UA 1REVB 1A6LA 2UUBF 4FWMA 3B4DA 3MMBB 1WG4A 2C28A 1VSIA 2B0GA 3TAMB 2CZ9A 3PJXA 1SIZA 4PG7A 4HLBA 4FPAA 2LA4A 1TFYA 4FYDA 1Y11A 1S3XA 2KJVA 5J2QA 3UKUA 2Y8YA 4ECQA 3ZZRA 2IY5B 2F8HA 3GIKA 2WBMA 2VL1A 4FWLA 4S0MA 4I56A 4ZVRB 1MU2A 3MHYA 3HZ6A 2LSNA 2CPHA 2AT1B 2MKCA 2QWQA 4CYUA 4NLGA 4M7XA 4ZP7A 4JV1A 2OMOA 4WWSA 3C6TA 3OLBA 1HWUA 1GX6A 1Q16B 2V7ZA 1IH7A 4DSEA 2CPZA 3IAS9 3E3XA 4JRPA 2EK6A 1LAWA 2XMWA 4YP3A 4RNFA 4RW9B 3Q83A 2GW8A 1IBMK 2Z1HA 1WWHA 1X7VA 2Y9HA 1HI0P 2HF4A 3IFRA 3V6DA 3UR3C 1J54A 4LSLA 2VPXB 1D5AA 4DX6A 3QNOA 4MKYA 3TRGA 2P9SB 4LH5A 4DTSA 2P9LB 3AO1A 1BI4A 3T1YK 2OA8A 3UR0A 1XNQK 1E4FT 2GGPA 3ZTQA 4PPDA 2BRKA 1ZC6A 3L6QA 3VGMA 2CPDA 2FVQA 4OYZA 3QIOA 3DLEB 1F2HA 4OKEA 2HMIA 2FZGB 3VALA 5AQRA 3G6ES 3QERA 1LFWA 1ATRA 3CJ9A 1HR0F 3KLVA 5F8JA 1O8BA 3ZZ0A 1BG3A 2H1YA 1RK8A 4WE1B 3Q8PB 1F5AA 1Q53A 3D54A 4OKJA 4YOUA 4PKIA 1UP1A 3UQSA 5HMWA 2XMJA 2ZM6F 3ZZTA 3RJMB 5D4LA 3TR8A 4KAZA 3O3HA 4BDYA 1I3AA 3PW4A 2DHAA 3DXSX 1BI4B 5J1EA 4D3HA 2XS5A 3S3OA 2MY7A 4U8VA 4F4XA 3BR8A 4B08A 5HBMB 4RZRA 5J2PA 3V6HA 1U2VB 1X4GA 3K2PA 4ZJQA 1HNWF 1EARA 2IJRA 3U1MA 1WD6A 2HAFA 1FWKA 2E1CA 4DR5J 5ETLA 2QYCA 4BR2A 1Q7YT 3R7NB 1ZETA 3LWMA 2YNHA 2CJAA 2V50A 1R0AA 3NOCA 1WEXA 2QW9A 1YHQS 2DR6A 2XZDB 5FJ4A 4LF9J 1J53A 3NXZA 4DU4A 3D4JA 4LFAF 3MPYA 5KFVA 4K43A 2JGUA 4DZ6A 1KKHA 1JXLA 4A4JA 5KFXA 2OI2A 1RAHB 4P9SA 3THYB 1RGIA 3FZFA 4UF4A 1E6VA 3HZGA 2JL9A 1YZ6A 1FF2A 9ATCB 2DRDA 3HHLB 1NGEA 3RMDA 5LSOA 2R8KA 2JC0A 3MZIA 2EXUA 3IXQA 1CVJA 1S5ZA 5E41A 3SQ2A 3MAAA 3FMWA 2Y8WA 3QB0A 5J1NA 3U3YA 2BGGA 5IS2A 2JOQA 2R9LA 1HBOB 2GS8A 3VWSA 3RB0A 4C8MA 3MXIA 2EFVA 1LW0B 3J7ZO 2R7RA 5JS1A 3S3MA 2CJYB 5HOOA 4CO4A 5AQNA 3DRSB 1DURA 5ETNA 4ICLB 4NCGB 1FDAA 3PO5A 1D9AA 1S0MA 2ZC4A 3O44A 3MMJA 2ZHOA 3AO2A 4KB7A 2UZAA 3BREA 3LW5C 5KFTA 4AQYF 1Q86O 2RHKA 1U2VA 3U02A 4UY85 4QOTA 3OYHA 4DR5K 3R9PA 2B9YA 1OSCA 2ZBPA 4BS2A 3MM9A 2VFVA 2FJEB 4ZPDA 1XBWA 1RNHA 2CXEA 2LEPA 1YRTA 5KG6A 2GMJA 2NUUG 2YPYA 4WFAQ 1SZ2A 3M3ZA 2VKZG 1SCJB 2ZH8A 3P49B 4V19J 2QMWA 3W8PA 1PJ6A 1MSWD 1VISA 4WBFA 3DOKB 4DR2F 2I7NA 2XHCA 4B1XB 1I5OB 2E5JA 3G87A 1G4CA 3H4BA 3PEHA 3GFZA 4F4ZA 4LD0A 4UY8O 1B70B 4IQMA 3T9NA 4FZXC 3GQCA 3KK3B 2BR0A 5KFAA 1WI8A 2QN6B 1KQKA 3DXKA 1NK9A 3T1HF 4A2BA 2IMOA 2ZQBA 3DLBA 1NPKA 3GIMA 4OJHA 4C2MA 3VA3A 3OHBA 4ZVUB 5D78A 3BZCA 1URNA 1PCAA 2H5IB 4AHCA 3C0BA 2XYPB 1N32K 2IIRA 5D4OA 3A8IA 1QHAA 3C6UA 2F9DA 5KFPA 3DGVA 3NCPA 3IWXA 2L41A 3EJMA 2YNGB 2R7VA 4CNYA 3K2YA 3K58A 1U7LA 3CM6A 2DTJA 3NG8A 4ED3A 4HVJA 2HWHA 4M45A 4ZTFA 3CD5A 2NRHA 3CCLN 3A2FA 1WORA 3KHYA 4NYPA 2LFVA 4ER8A 4YOTA 2F8TA 2VQEK 2K7KA 4FVUA 2OAUA 1VOMA 4CO1A 5D3GA 1ZTWA 2M52A 1OVYA 4W92B 3EXCX 4RW7B 1AXQA 3ZXWA 2WVFA 2FGOA 1S6PB 3Q23A 3RR7A 3HRGA 3O5TB 1SJRA 2AEJA 5F9LA 3OTOJ 5J2MA 3M6VA 2HHHK 5HROA 3TTFA 3D0GE 4ILHA 4R5PB 1IN0A 2QFIA 8RUCA 1R0CB 4P74A 1JJ4A 3NCIA 2HW3A 1ZH5A 2VODA 5LT5A 3A4TA 3VF4A 2X1BA 5E3AA 2WHOA 2YVSA 2G1DA 4DV3F 2BBEA 4BE0A 4Q45A 4ED2A 1Y4ZB 1SJ1A 4CIEA 2GWKA 4C0HA 4F67A 4CLFA 2ZZMA 2V9WA 2C2RA 3KJFB 4RW8B 2MY8A 3SXLA 1Q78A 2POKA 3ENHA 4PYAA 3THWB 4I67A 3GONA 1U2FA 4IH6A 5AXLA 8AT1B 5HAOA 3JTNA 3VQPA 4C8KA 4M5DB 4JEPA 4FPIA 3KLEB 2O8BA 1OYDA 3AXKA 3S1TA 1TK8A 2BJ8A 1YJWN 4Z4IA 2HNZB 3FRZA 2MKJA 4HUEA 1TR0A 3T41A 1N33F 3KNAA 4YB5A 3QO9A 3H6EA 5AQUA 4RTFD 3MEEA 4NLYA 4KHWA 2ZNYA 5EWFA 4FW1A 1QJHA 2P9PB 1QVGR 2PA3A 2DFHA 4C3LA 2MGZB 2GHVC 1KNZA 1WC4A 1VLYA 4EYIB 3CCMN 2ZD1B 4JI5K 2PYLA 2JEJA 1NGGA 1S1TB 2QJ3A 5AQIA 3GCWP 4NYFA 4P75A 4F3MA 1OPZA 3O80A 2ZKTA 3AVKA 3GR0A 4USJC 5DS7A 4X66J 4CNZA 5A2QU 2DGOA 1SL1A 2P6TA 3NVKA 1VK8A 4GV3A 2UUAJ 2W40A 2AJ4A 1AT1B 4TQRA 4U96A 3SAGA 3P5TL 1DHMA 1VHXA 3E9PA 2UU9J 1KVAA 4USMA 5C42B 3OYIA 1EQMA 5AJ3F 3GG0A 1ZM9A 2GQ2A 5AQKA 5I4MA 4WP3A 2MJUA 1YJVA 3M8PB 4OHYA 1HD1A 3SSRA 4YDUC 4H4KC 1H7WA 3EGWB 2UXCK 1GLAG 4OX7A 2OCEA 1RTZA 3CCSN 3ULEB 2XQCA 5DRKA 4ZVSB 1VQ9N 3EDRB 2W2OP 4KH5A 3VEZA 2YBVA 1T9VA 4IKFA 1Z25A 4NCAA 3RSEB 4DV4K 1TUYA 4X65K 4AHUA 4CO0A 2W41A 1HL6A 1N34J 1RAFB 3NY0A 1UW4A 3PDNA 3OYJA 5HRSA 3J81Y 4IOAQ 3MFHA 3CC4S 3HSTB 1VSHA 3UCUP 3L9ZA 1VSDA 2QWLA 3HJVA 1CG2A 1WOOA 2UUCJ 4WU2A 2DH8A 3BB5A 2JNJA 4O3SA 2GQCA 3L4IA 4OLOA 3QFPA 1FK9A 1BIUA 4WZMA 3DLKA 1F60B 4JS4A 4OZ2A 3BBBA 1T95A 3F44A 3H25A 1VQ5S 3SMZA 3ZZPA 3AODA 4I9QA 2FDNA 2ZNZA 1LXJA 4YB7A 4DN9A 1UVKA 3MTKA 4DFJA 5LMNK 1A5XA 2CQ3A 2MZQA 4EWTA 2DR8A 3KLHA 3VQ8A 4YY3K 5DDRC 3L09A 5AQQA 5J1EB 1S1VA 2CVEA 2DFFA 4DPYA 1JNRB 2U2FA 4CH7A 3DHWC 3PSIA 1N33J 2LP4A 1TAQA 2YWKA 5KRSA 4P7TA 2QLXA 2FQQB 2CQIA 2JFDA 4DR1J 3UIQA 1GEHA 3H5XA 1ZPWX 4O0IA 1WBDA 1TV6B 2XRIA 5KFUA 2IBOA 1H3DA 2HQDA 3QGPA 3MDQA 4PXBA 3N6MA 4DV6K 3CF5L 5CZ2A 5AXMA 4OI6A 5KG1A 3KDOA 2FC9A 2R7OA 3VCDA 1N6QB 4EFAC 2ZFHA 4LT6A 1O1WA 3ZSWA 1S1XB 3CCZA 4M3WA 4Z4FA 2HMPA 4CIOA 2HEKA 2OELA 3ENVA 3OYBA 2NPIA 2J5AA 2UUCK 1FJGJ 3QWUA 2GWJA 5F8NA 2N7CA 4DV1K 4LF4K 2ZH2A 3RSEA 4MYTA 2CDRB 1CJTA 5F8GA 3QFUA 2DNHA 1IR0A 3QT8A 2E2QA 3C3LA 3BV8A 4CCHA 1BOTO 3GV5B 4J9MA 5A76A 4L75A 5LJWA 2UXDJ 2A5XA 3FBBA 3EVOA 3OSNA 1T6DA 4G1QB 4CEZA 4QPTA 4WTOB 4J9VA 4CF0A 1ESVA 4JI3J 1RT1A 2N3LA 3PW0A 5AQGA 1JLQA 5ETRA 3MM8A 3O4QA 4YOXA 4N47A 1REVA 2KT3A 3G6EN 4DB3A 4GKKJ 5HVGA 5HMYA 3VPZA 1TVRA 2OEMA 1F3FA 5AJ3J 4DV7J 1S7HA 4QYRA 3BF4A 1LWCA 4CP5A 4Y0WA 4DV2J 2BKPA 2COLA 3BSAA 2CAJA 1U2RA 3J80Y 2DEJA 2QL9B 3O1WA 3R2CJ 3KHRA 3HD1A 2Y1LB 4J9UE 5MAOA 2HNDB 3N4QA 2W2NP 2HBJA 4C98A 2BOPA 2W24A 1HKBA 1S7IA 3WC0A 3P45B 2BW2A 4USIA 1YTYA 2XGPA 5J2NB 4C6AA 4CJRA 3OR2B 2EFQA 3BJYA 1NSQA 3BKFA 4KHRA 4DN0A 4QU6A 4V19S 4L3QA 4RX6A 3LPYA 3RGIA 4B02A 5RUBA 2YV0X 2GAGC 4FWPA 2UXDK 2QI2A 3ENAA 2D0BA 3TJ9A 3BZKA 2BKNA 4DUTA 1WJ9A 3I8DA 4LBPA 1VDHA 1K0TA 2LU2A 1I94J 1OY8A 4Q8FA 3TSQA 4J9KA 1VQNS 3GOIA 2BANA 2E1RA 4DL0C 2VG5A 1SH0A 4FWRA 2BRLA 1MWYA 2YPZA 4XH1A 3RMBA 1K73T 3DJCA 2XLKA 2C3YA 4M3UA 1JJHA 3K59A 5LL6d 2QLWA 3M6GA 3BO2A 4I1TA 4HI2A 3D9BA 2XMMA 4UOCA 3DOKA 3WX8A 1KAZA 2OTLS 2OO4A 5F0XA 4BE1A 1UPPA 1RKIA 2Q43A 2PC6A 2W7AA 2W2PP 2XB2D 4W90B 3UE5A 1D9DA 1B64A 4OPAA 2BM1A 4I2PA 2EFPA 2BJ3A 3MPVA 1KDNA 2DNMA 1LWEB 3A8EA 1X9WA 1RT4B 4PR6A 4OGCA 2ZH4A 3JTPA 5KPRA 2ASPA 2FGCA 1ZA2B 1UAXA 1KOHA 1NO8A 1KVKA 2P9GA 2QM1A 3LAKA 1JJ2M 1CJUB 4BRKA 4QS7A 4OFZA 4XO0A 1OMSA 4PWDB 3TVYA 2GNKA 4FLYA 4LFBK 2H65B 3O08A 4OX9F 1JB0C 4FM2A 1GMUA 3VZIA 4K4WA 3BF3A 1VMBA 1NJZA 2DY1A 3AVMA 4YDUA 3OW2R 3M8ZA 3LL3A 4XK8C 2IDEA 2P9IB 3FFIB 3KZBA 4N8NA 2NZ4A 1S1WB 3CCLS 2AJQA 1U6BA 2W8KA 4P6QA 3OS0A 2FLPA 1CPZA 1U09A 4ZJLA 1UVNA 4LIRA 3O9SA 4CJ5A 1FK9B 1TUUA 1QUVA 4DV0J 2V94A 3FC9A 2FF3B 2PI4A 4WFAL 3VQ5A 4CFBA 5FROA 4BRMA 4JI8J 3D6FB 4RBVA 4CHYA 1TV6A 5B0BA 1QSYA 2P5GA 4CIGA 1GXTA 3AAQA 2V2KA 3EKUA 3JS6A 1R27B 3V2UC 4GC7A 1HWIA 2A3ZA 3TABA 2CA9A 4Q44A 4DR6F 1QS4A 4OZNA 3L4QA 4AH9A 1NB7A 4FPBA 4KC5A 4YDXA 1PYOB 3DU5A 4CJ3A 1RDCA 4I4BA 4ETXA 3KFWX 1RDAA 2YCHA 3H1VX 1ICEB 2XO6A 5ETOA 1R8HA 4WYLA 1ZM3A 4DCJB 4BRPA 3LM9A 2IAJA 4XTTA 4A46A 3K17A 1XN9A 2DFEA 3BEXA 3RMAA 1IBCB 4EFHA 2QMXA 2H51B 3DRYA 4X65J 4KT0C 3H5UA 1QVFR 1FDNA 2JHEA 3AVFA 1JLAB 2I7PA 5IT9O 4KAIA 4GKJJ 3FDSA 1QQOA 3IDHA 4FO0A 3TAFA 3IWNC 4LC9B 4CK3A 3Q8SB 2D3ZA 4K50A 2OGUA 2B9WA 1UZHA 5C2FA 2F3JA 1NHVA 1RBVA 4KBIA 4IDHA 2ZDOA 1V4TA 3M9OB 1S48A 2OPSB 3PR5B 3FZLA 3I5BA 2WVCA 3DC2A 4OPKA 1HNXJ 1BUPA 4NOHA 1M1GA 5B08A 4ZLLA 3ZZUA 4CZIA 3KJNB 2XC9A 4DG1B 2HPUA 1LEOA 1YJUA 2B5JA 4ES3A 1D9FA 4JKFA 4FZVA 2ZE2B 1JXBA 2O8EB 4JD2A 3AA5X 3CCES 3KJVA 3V81B 1MN9A 4FJLA 3NBPA 2UV8A 2BX6A 5GMEA 2O8CB 1Q8KA 2DNGA 5GAHU 4B3TJ 2DNZA 2JWLA 1GLEG 3TU5A 4GVLA 2J7KA 1YJ9S 2O3DA 2J8SA 1WF0A 4TYAA 1RAGB 4LIWA 3PYFA 2YJEA 5M1FA 3U6FA 3SDEB 1S4FA 2QL5B 4Q7AA 4MQ3A 4Z2XA 4CT9A 2ALYB 2VFUA 2E5LK 2MQNA 4DR7J 5L1LA 2V51B 1BQMA 3C14B 4NA2A 4K4XA 1T02A 3B4MA 1N34K 1MDUB 1IJJA 4W5QA 3F9KA 4DMZA 4NE9C 1C1AA 1W2BR 1RILA 1NGAA 4X64K 2C3MA 3CD0A 2GX8A 2XY6A 3J7AN 5D0EA 4IG0A 3SQ4A 4NLVA 4JUZA 3OXLA 3P4UB 4PKDB 4B3RK 4O4GA 4K4YA 5MLCV 3VV2B 4ZDNA 2JLGA 3BYPA 1Q1KA 1KCFA 3TO8A 4B3MJ 2PN6A 3RAQA 4AHRA 1TZ0A 2ZM6K 2C2DA 2P9IA 1VQPS 1TL3B 2VPWB 3TR5A 2WSEC 3H08A 1Q4RA 4M5KA 1PIEA 3AT1B 2QYGA 3KHLA 1VC5A 1R3NA 1TL7A 3HFKA 3E51A 4RNMA 1B0PA 3D67A 3AVBA 3BDEA 4NYOA 2EWHA 2F8MA 1IBKF 2E6LA 2OANA 1VYAA 1CS4A 2ASOA 4ED6A 2VQFJ 4DUYK 2O4IA 3V1OA 3EWGA 3BQ2A 1VQLS 3JAMY 2Z2MA 4BQZA 4NO7A 2M2BA 1J9AA 1Z4UA 1B3TA 1KN6A 3CDUA 3SCJE 3R5AA 4ZKAA 1WOQA 3T69A 2E5LJ 3HO1A 1XTZA 2R7XA 3NH2A 1IKWA 2A6OA 5F0WA 3QEXA 1U45A 3SCKE 2V8VA 3RB3A 5KOWA 3RU0A 1SV5B 4ZHRB 4M63A 2E5HA 1O51A 3N9UC 2NRRA 3R6GB 1K1QA 3QGHA 3MPUB 3H46O 5BYRA 1XWLA 3CCVN 3N4PA 3KK2A 2QA4N 3QESA 1Y97A 2Q1NA 3NOGA 1VQ7N 1U04A 1SVDA 5HANA 5F8IA 5K8OA 3RAXA 2G2OA 4NLRA 3L2QA 4FK0A 4O3NA 1NRKA 4G1QA 4ZP8A 2C3UA 2LVWA 2ILZA 3ZTRA 2BANB 1DQ8A 2HS0A 4M5IA 1IQZA 1X4CA 3NF6A 4C7QA 1VJQA 3DDNA 2OPQB 2FLOA 2IVFB 4CLZA 2ZH6A 4QW9A 2KL8A 2R7SA 4L73A 1WAJA 3IBCB 2GVDB 1DFDA 2P5VA 1OH7A 1CC8A 3IMXA 2F1FA 2WTUA 4HEA9 1S99A 2V6AA 4JI1J 2HZVA 1HNXK 4IOAL 1S97A 1TTHB 1RT2A 5H9FK 1RTHB 2P9PA 1TELA 1WG1A 2FD2A 3FFIA 5A8RA 2YX1A 4FZZA 4FM1A 3Q24A 1Y0HA 2G8IA 2CPEA 3SBMA 2QIFA 1RDBA 1ACMB 2D3UA 1NG9A 2CDQA 4RR5A 2VJUA 3O9RA 2B4UA 4WYBA 4CQ1A 2A3JA 4OHVA 2DR9A 3HMJG 1WTFA 1RTIA 4KV8B 1WC1A 1XMOK 2FIUA 4DR2K 4NXMJ 2AW0A 3O1BA 1B99A 3C95A 1UJ5A 1X3NA 3VENA 3SAFA 1HNZF 3VQ6A 4MAKA 4A59A 2V63A 5JLHA 5K14A 2PSZA 1P1LA 5EXWA 3BQ0A 5C0YA 1EP4A 1Y5IB 2KVQE 2YKOA 2GELA 4X66K 4L76A 4B3MF 4EP4A 2HQCA 3OTDA 1YJNN 5K8PA 1JLFB 3VHQA 5KI6A 2EBGA 3QETA 1JCEA 4ZVPB 3OYCA 4UW2A 4OGEA 4J2DA 1BWEA 3CM5A 1RI7A 1DLOA 2B43A 1VRQC 3R6LB 4U67L 4BREA 1DY3A 2BE2A 4JI2K 1NGJA 2HQFA 1Q82T 5C15A 2RD5C 4EZ6A 2HGMA 2CNOB 4P52A 2FJVA 1VQ8N 2F8SA 4DXLA 3U9DA 4G1IA 3GPAA 3H8YA 4DU7A 1CJTB 2DITA 3V6JA 2OEJA 3LZJA 3GSDA 1UEUA 5DLFA 1RWWB 4DTPA 1HQ2A 5KFQA 1AFIA 4KGXB 3A8JA 2IM1A 4RW6A 4KQZA 4FYYB 1X4AA 4OL8A 2CH6A 4DCHA 4CBWA 4W5OA 3H98A 4BRIA 4BWJA 2QXFA 3SQ0A 4MLHA 3BSCA 3BF1A 1UAWA 3SAHA 4KRWA 1WKLA 5BN9A 1RT1B 4JNEA 2BQRA 2XS7A 4L3NA 2XI2A 1KD1O 2HWIA 4WCEL 2G8VA 3NGRA 3GE1A 4XDDA 2UYTA 1VC0A 3LOUA 3R5DA 3Q7CA 3C6AA 4MIWA 4A5BA 1WDTA 1NU4A 3VQTA 3TA0A 4I2QB 4GRSA 1YX2A 4KY3A 3PUFA 1WAFA 2MPUA 3SV4A 3MI7X 4NXMF 3GSIA 2QT7A 3FLCO 4RW6B 4GV9A 2XM3A 4KO0A 3DRRA 4YOYA 2PMZD 1JK9B 2BV3A 3BN4A 2WTFA 4O5BA 4MDBA 1Y00A 3VEOA 3CCQN 1BGXT 3OS1A 2A42A 5DG7A 4MKVA 2O67A 2DR7A 2K3IA 2FHKA 2OPQA 3TANA 2B8PA 3SQ1A 4JI0K 1EIYB 4J2EA 3J81U 4LF7K 1YK9A 2IVYA 4A62A 4OMFG 4LFCK 4IOCL 4OZ5A 4M5HA 4LBIA 2YNHB 5IXUA 5KG5A 1GFWB 2VGMA 2CH5A 4OPHA 1CLQA 3A13A 1DGKN 3WDOA 4CJKA 1NKCA 1ATSA 1M5KC 1RDUA 3K5OA 1Y3KA 2OMLA 4PKGA 4RNHA 4CEQA 1QZ6A 1Y5LB 5AQJA 1IWAA 4Z4EA 2ZJPL 3V9WA 3GWCA 2PD1A 3ZTOA 4G3IA 1WSVA 1JLBA 1HRHA 2MLYA 3IR7B 1CJVB 4F0KA 2QEXN 2LDYA 1FJ7A 1IKYB 1HMVA 5D15A 3TA1A 4Y2AA 3OL8A 4PG5A 9RUBA 5LMUK 4DHVA 2FZKB 3R9LA 1CULA 2CQPA 3TZYA 2HB5A 5L1KA 1A0OB 1SC3B 3ET6A 3N6NA 4FL9A 2QKBA 5KFOA 1N36J 2YHYA 1X31C 4EEYA 1SH3A 2HZAA 4HACA 3RBZA 2HRUA 4LF7J 1VHFA 5KAKA 1UW9A 2XLIA 2LQBA 2J9DA 4MK7A 1BA0A 3DMJB 3KNGA 1MROB 1CQMA 4IRKA 3HFVA 2GCFA 3NWRA 3Q86A 4RBTA 1YF5L 1TKZB 3I0RB 3TOQA 1OJ4A 2XHBA 3M30A 1T03A 3DYAA 1MMNA 3GJSB 2DR5A 2HS3A 3VAJA 2M70A 2HVZA 1QVGM 3IA0A 4Y2CA 5E5NA 4LF8J 3LDLA 2WONB 3AJ2A 2B4JA 1H0HB 2NRXA 2VU5A 4N7TA 4H8KA 4CJWA 2HNZA 2VONA 3ZX2A 1RAAB 4KH4A 2AKWB 2GGPB 5B7WA 2A6MA 3TAMA 3NP5A 2QTWA 4FPRA 3HHLC 3UNYA 3VQDA 4LF6K 4KPCA 3HKZD 2OJ3A 5ETMA 2RKIA 2YHBA 3PY8A 4X4TA 3PW5A 1FKOA 3HSCA 1Z05A 2VPYB 1BIZA 3MD1A 3OYMA 4CO5A 4NB4A 2QV6A 3JXOA 1YTUA 5G0RB 4XIUA 1LWEA 5BXIA 4PA1A 3EZ5A 2F4VJ 3CMAS 4FXWA 5ITHA 3CJKA 2E6MA 4QR0A 2OD6A 3TEHB 5AZJB 1RWVB 2BW7A 4DUZJ 4PG6A 2P9SA 2WW8A 4UY8T 4FJ7A 2DKOB 1RBAA 1X5SA 4ID5A 1RHQB 2HOEA 3B8HA 3SI8A 2CJXB 2Z2ZA 1VLOA 3W3DA 3VGVA 2BYCA 5BREA 3ZTSA 3LP3A 2RMLA 3MCMA 1QHTA 1TL7B 4FDFA 2YY3A 2RB7A 2WVEA 4ITSA 3OXGA 1RZMA 3EE9A 1UEKA 2I1RA 3IGNA 2FBYA 3UN5A 1VBXA 2FJXA 4K59A 5F0UA 2DRAA 1NBEB 4PL7A 4PWWA 4EHTA 3OFHA 2UXBJ 1BXNA 4P72A 3W9JA 5DLGA 2VBXA 3TAEA 3W62A 3DDIA 1DQAA 5AXNA 1GTHA 4CFDA 2MKIA 1WELA 4JV0A 4K8RA 2QO3A 1RWXB 5DZ7A 2ROEA 2NS1B 4OYXA 4FWOA 4IZ9A 3I5CA 2GJFA 3THXB 2XO7A 1N48A 2HBYB 3I0RA 4B1WB 3V6KA 4GKJF 2V4JA 4WFNQ 1W9HA 2UUWA 2DHHA 3KDNA 3G8TA 4LFAJ 4KHPK 1IO2A 2AWZA 1SBRA 1ZBTA 2OHDA 3OFEA 4B9TA 3L95X 2HHPA 2DNRA 1K8KA 3H7HB 2BMBA 2C2KB 5D77A 4TQSA 3OVNA 4LFAK 1T05A 2X6NA 3ZSOA 4B9QA 1FX2A 3AV9A 4ECTA 3EY1A 1H73A 3ULHA 4PUOB 2WOMB 1VSFA 5M1KA 3OYGA 3BM7A 3ISZA 1K8AT 4A8QA 2MKKA 1RKJA 2K1RB 3SZ2A 2HIYA 2C3PA 2QFJA 4KJIA 2ZZNA 2HHHJ 5HMZA 3KHGA 2CPYA 4E8UA 3LGMA 4Y2KA 4BBYA 4I9LA 4BE2A 1G2EA 5D3GB 1M90T 3MR6A 2E44A 1RBOB 3PTWA 2AF6A 1F5BA 3VAFA 3EICA 4ED0A 1XNRK 4HHUA 2DNQA 3VQEA 3D1OA 2BQ3A 3AXMA 3GFYA 5EU7A 4B9LA 3H2UB 1EQ0A 1NGDA 2FBXA 3LDPA 2EC0A 2HLTA 1I39A 3NS7B 1EJ7L 4OYOA 4FVMA 2O4GA 4JI3F 5IT4A 1VSKA 3M2RB 3K5MA 5IWAK 4TN2A 5CYMB 3CC2N 3ZT3A 3M7VA 1SUQB 3KLIB 4RNNA 3EDQB 3MDFA 1PKUA 5HBMA 4QYZJ 2B4OA 3S8SA 5A6PA 3QAUA 4RW4B 2NXJA 5CH7B 1QDUB 3HVTB 3MUTP 3Q8RB 4F8RA 3GTYX 1WF1A 2PBDA 2RHSB 2XMUA 3DLHA 1ZM2A 2AJ1A 3JSBA 1KFSA 4N76A 2MQPA 2LYVA 1H7XA 1W7WA 3GYXB 4DTOA 2UUBK 2JWKA 4CJEA 4PY5A 1C2PA 3ULEA 4OIXA 1YVNA 2Z1JA 3V1RA 1V5IB 3LM2A 3EL2A 4WF9Q 2ASJA 2AZ3A 1D4XA 4WK1A 2GMLA 3GV8B 3U1NA 1C0UB 5HMXA 4LF2A 3OYAA 1MW7A 4LF8F 2FBVA 2ZHBA 2E9TA 4QW8A 2V4RA 3R1LA 1F5CA 4KFBB 2CQDA 3OT9A 5HATA 1JIHA 2DGSA 2Z2YB 3NAEA 4JI7J 4GVEA 1Q8LA 4KKOA 1XHZA 1HD0A 1IKVA 2YNFB 2FC8A 1NJIO 3O4NA 2XG8A 3TZXA 1I94F 3ZT4A 4YORA 3K5NA 4QR2A 4NEYA 4K2XA 4GVMA 4F50A 3DLKB 3NNAA 1DBDA 3T6JA 2ITGA 4QAGA 4FK2A 4CLPA 4JI2J 2CQCA 2A0FB 1ZBSA 2OPPB 1A5VA 1OPIA 1R8AA 2Q97A 2QWPA 2ZUAA 1O5JA 1HA1A 5J1PA 2CPIA 3VQQA 3U27A 4LR8A 1HBUB 3ZO7A 1ZBHA 4ZPAA 4DWIA 2EEYA 4KKOB 4YUDA 5I42A 1OY6A 5IV3A 3H2VE 3QNNA 3IM9A 2Q3SA 2GIQA 4MO5A 4KREA 1VRTA 3O3LA 2B56A 2QWNA 3CCUS 1UVJA 2F9TA 5T7BA 4H0OA 4KHQA 4B17A 4FJ5A 4Z4CA 3T1HJ 5BRHA 2F5GA 3HFZB 1TK5A 1JLCB 4BC7A 4HL9A 2RT3A 4IUFA 4DKWA 3H1QA 4CLWA 3DI6A 4PKHA 3OR1A 3CUNA 3BGLA 3GFXA 3GYNA 3LANA 2DD8S 4C9DA 3LDNA 2P9CA 1UFLA 1RWUA 1U8WA 2AYMA 1MWQA 2HFUA 1RLCL 2O8EA 4CYUB 2QWRA 1WC0A 4B3RJ 5C12A 1NK7A 4G65A 3IBWA 2V2QA 4FP9A 1QQMA 1GTEA 3E9OA 1DARA 2NXNA 2KZZA 2LU1A 3GDQA 1HNVA 4HVZA 5KFGA 1RJJA 4ILRA 2Q0RA 4RBUA 1JKHB 3SFGA 4TU7A 2CZVC 3FBFA 2DGUA 4JKCA 5FLXU 3N6LA 4ZLPA 2X74A 2O8FA 3ATUA 4XPEA 2FJBB 4F4AA 5DMRA 4QQBA 2FC0A 2XSFA 1A9NB 1VQ6N 5CHIA 1ZM4A 3WXMB 4LVOP 3MM6B 4RWWA 4TYBA 1Q7LB 5KQ8A 1S22A 1ZBFA 2N4DA 2VQEJ 3VEYA 1TYQA 1WSJA 3M8QB 3T5JA 3D6HB 1QAXA 4DMNA 2YQ1A 3MECA 4RW7A 4PAAA 4EIAA 3HF5A 2IAJB 1REGX 1WTBA 1DLOB 1F3VA 1GLBG 5J2QB 4HDHA 3UKUB 5KOXA 4DQQA 1FRLA 4BQLA 4QIVA 5JVHQ 3I9ZA 3I56N 1FFGB 1LWFB 1YDLA 3TI0A 4ZVGA 4DV0F 3M2VA 4H54A 3AD7C 2RQ4A 2XNRA 1N36K 4CFAA 5C42A 1UKUA 2IA6A 4MT1A 1X5TA 4Z37A 5IM0B 3UD5A 4DBQA 7FD1A 4PQAA 4OI1A 1BDGA 3IS9B 4ZPCA 2VCPA 4DV5K 1LK7A 3HT0A 4GW6A 1U0HB 4YN3B 2J9CA 1UPMB 2DXFA 2F65A 3SPYA 5AQVA 1XHXA 1IKXA 1HLUA 1OQ6A 4URGA 3LGHA 4GKKK 3CIZA 1T9XA 2U1AA 1N52B 2DJWA 3TAQA 3Q22A 3HHLD 4DR3F 5HROB 4EHUA 1RTDA 1FXRA 3J7Z5 5JJBA 2Z58B 5BYQA 2A18A 2DHGA 1RCXB 2WSCC 3J7YI 4X4SA 2WUSA 4M3YA 5GAGI 4A61A 3NAHA 3FFKB 1RFQA 2ZVSA 4CM0A 1Q9XA 3IRWP 4BVPA 2PY5A 1WN7A 4JV2A 5I9EB 4Q0BA 3UNGC 3DAWA 4M3RA 1AW0A 3E01B 3ZZZA 1J2VA 2HVHA 1RBRA 2DIUA 1XUPO 2DNOA 3TAPA 5DK5A 3ENBA 4IOCQ 1IG9A 6FD1A 2GIRA 3L7OA 3WNGA 4HUGA 3THTA 4E3SA 4OPJA 3OTOK 1UA0A 4ANEA 1LK5A 2DCUB 4IH7A 3THPA 1D8YA 4JS5A 1V6HA 5L9XA 5H9EK 3FZMA 2B7BB 3AOCA 4ED7A 1FEEA 2WRMA 2RRBA 4WU3A 1T8EA 3V9UA 1DZ5A 2MEWA 3CJAA 3DLLQ 5HL7Q 1KHVA 3AB2B 5B8HA 5GAEU 3OYEA 2F4VF 3DOMA 2KI2A 5A0YA 5ADZA 3R8EA 3I82A 1KP6A 2YHWA 3MMVA 4F3OA 1IM6A 2G2ZA 4KHNA 3HSJA 4B3OB 2IGIA 3C16B 4CF2A 2HNYA 1TMMA 5ADXA 1FHTA 4RNOA 4JI8K 5CQGA 3QZ7A 2SXLA 1RWKB 1R8PA 5L1IA 1QZ5A 3CVKA 5HJYA 1HR0K 3RBDA 2LEAA 4IO9L 3DNCA 2OTJS 4DL7A 1HPMA 4JK9A 2A2DA 4Q0BB 3TEGA 3GE9A 1U0HA 2OYQA 2RU9A 3NGKA 2J9EA 1XR7A 2ZVIA 1FERA 4QCLA 4DHYA 3EN9A 4ILJA 4JP8A 3AVCA 4IG0B 1H2UX 5FDLB 1U6ZA 4H0PA 2GX9A 3PJ9A 4PXEA 3LP1A 1FD2A 3OFFA 4FZYA 1NSPA 1C1BA 1JXVA 3AB4B 1S9GA 1K0VA 1OH8A 3D3CJ 1XIQA 4DR7F 4ZCLA 3O5BA 1PSDA 5HJXA 4OVLA 3AD8C 2E1YA 2V34A 2CNNB 1YAGA 1YUWA 4DU8A 1BCMA 2DEIA 4CM2A 4CEBA 2ZOFA 1N5YA 3NGIA 3CCSS 3EVWA 2JEFA 2R7UA 1OO0B 1KC8O 2BJEA 3MM6A 3GR1A 2RVJA 1Q7YO 3HULA 2VD3A 2C2ZB 4WJBA 1VQ8S 3ZEUA 4ZS6A 5EX5A 5T7LB 4IDKA 4FF4A 4CLUA 4BACA 3WQPA 3VAMA 1HWLA 2ILYA 5M1QA 3AVNA 3T1YJ 1U1LA 5F8LA 1HFEL 1S0NA 2ZDPA 2Y1RI 1URRA 3OHRA 4J7CA 4YR3A 3AQPA 1EAYC 2RF2A 5CA5A 5BR8F 2LDIA 1VK3A 4DV2F 3WXIA 3F73A 2VUGA 4Y1CA 3OXFA 5KG3A 1VRUA 1Q8BA 3S6EA 4ZMMA 1FJCA 2MZ1A 3OA9A 1OQ3A 4ALZA 3BPSP 1HPZA 3UN3A 3MURP 4KPYA 2XZWA 4FLTA 4DV6J 4NLXA 4IFYB 3RBXA 1HI8A 2PMWA 3CDWA 4NLUA 5AQZA 3VGSA 2ITMA 2ABYA 4FLVA 1DQ9A 2CYYA 3HHEA 1JLCA 3V4MA 4NLQA 3P38A 3PYEA 4CEAA 4HH0A 2RF2B 2HFVA 3MAAB 4J91A 1ILYA 1KRPA 2HRTA 1TK0A 2P8IA 4RL1A 2UXDF 3LF0A 1RTJB 3KKRA 5HO4A 2LECA 4PXDA 4IFVB 3I32A 3VEWA 1SAZA 3OL9A 2AV5A 2CIMA 2ZWHA 4B1UB 3OD2A 4E19A 3RB4A 1HBMA 4CBUA 3HT3A 4QIFA 4Y6IA 3AGRA 4HDGA 3JSMA 1VQKS 4EI2A 4DTRA 3OTCA 3QIDA 3WQTA 4ZIWA 4LF5K 2GJIA 2ZBIA 1SL2A 1QD1A 2HBLA 1U1RA 3VQ7A 2VWJA 1VI7A 1YRXA 2UUAF 4Y65A 2W9CB 2K1RA 4U7CA 4PPZA 5KFCA 1FRKA 3ILIA 3JSYA 3KMQA 4CLTA 3LO3A 1HQUB 1NKBA 1RT4A 2D0PA 4P7VA 5CAAA 4FW2A 2XLJA 2EKYA 4NXMK 2CGKA 1KVBA 1ASUA 1S76D 1C1CA 1T0TV 2W42A 3J7A1 4ES2A 3SMSA 1G1XA 2E7VA 1HYSB 3FMBA 1YXQA 2DGXA 3G71S 3SUNA 1PBAA 2ETJA 4WTYA 4AILC 5ELZA 4PG4A 4WIIA 2HURA 2KKZA 4QS8A 4IFEA 4JI0F 2EFGA 3CIMA 5LMNF 4EP5A 1CXQA 2MTLA 4JI1K 1IBLJ 1JQGA 4IO9Q 4NA1A 1N5VA 2V52B 2CNLB 5H9FJ 3MMCB 1OS5A 2LKZA 3MFIA 3ID6A 4IJAA 3QIPA 4P2SA 2KXNB 1V4SA 3CJ7A 1EKSA 3IR5B 5KFYA 4Z7CA 1OIAA 3HCXA 1HHSA 1X9JA 5L8RC 1KQSM 2V67A 2RNEA 1N5YB 3W64A 5AFUA 3GFHA 4B3SJ 1FRMA 1P9YA 5KT2A 4C11A 2DNNA 3AOAA 2OP5A 2XYHB 4LRDA 2EVZA 2GUPA 4HWIA 1RYRA 2IYGA 3C16A 3KK3A 5AQOA 4X4PA 4DV3K 2EHGA 3DM2A 4Y1DA 4FXVA 1FKPA 2IM2A 1RTIB 3IRXA 4H0TB 4IJNA 1NPPA 5HP1B 3HOSA 3DOMB 1X5PA 3FBCA 3AY9A 4Z7YA 1OKJA 3ILJA 1NH7A 4JYAK 1MMDA 3HVTA 2CJQA 2B6AA 3NAIA 1MWMA 4UZBA 5D4PA 4KI4A 1YJWS 1U1OA 5JXSA 4E7JA 5KFRA 2NZTA 1MU2B 4AF1A 4AUKA 4CZHA 1SXLA 2AYGA 1KHWA 4AXJA 2AU0A 2C2NA 3AFGA 5JMNA 3CD6S 3H3OB 2PEBA 3FCWA 2RE2A 2ZUGA 3OL6A 5EOYA 3QMLA 2MLZA 2IJNA 2O5DA 1FJGK 3RG6A 3BGOP 1BWFO 5D0RA 5DZ6A 2OFGX 4LF1A 1NJWA 5HK4A 1FXXA 3CCRN 5KQDA 2VGNA 3PKYA 3HPOA 2IBKA 2UU9F 1NK5A 3HSGA 3CCUN 3CCEN 4HI1A 1HW8A 3QLHB 2GVDA 4DS5A 5IFMA 4WP9A 1UOCA 2QA2A 1MWZA 1Z2ZA 5HSPA 5K20B 1SC6A 4B8CA 3F2KA 4OYPA 4RUHA 2P51A 1HWJA 4KGKA 4ID5B 4LF6F 4EUVA 2E4LA 3CCTA 5BPMA 4M5LA 3HD2A 4A57A 4NPOA 2UVWA 4YB6A 4CESA 3IMQJ 3ZX0A 4X4VA 4MMOA 2DVIA 4QYZK 4BRLA 1NGIA 1GXUA 5KG7A 1KQGB 5CHCB 4W5NA 3QFWA 2VG5B 3NRBA 2GBZA 4FWNA 4ECXA 5FPMA 2UVRA 1HBOA 1WSIA 4RUBA 1BHLA 1W0HA 4R5PA 4EK2A 4A8SA 2AEFA 4E1MA 3R6MA 4AQYK 2JSXA 3W1YC 3PSFA 3R2DJ 1D8ZA 1JNZB 2O8CA 4DR5F 4CECA 5IM0A 1DJ0A 2IC3A 2BJ9A 4LMZA 4QIWD 2VQFF 4R8UA 3TAGA 1SQFA 1LAVA 3ZSRA 3MCNA 4YHHK 3TJAA 1ZA1B 3FZ2A 3TW0A 3DLJA 4CBXA 3E66A 1K1SA 2AHOB 4JI4F 2JEIA 3E8OA 1Y10A 2KXFA 4OYWA 3B54A 3DLGB 1JCFA 3CE8A 2LQ5A 4WFZA 4Q2LA 4O3PA 1YRUA 2LEBA 3CJKB 1TL5A 4KI6A 3BSOA 1S9EA 3IAM9 5GADI 2VQEF 1P1TA 4O23A 1GNKA 3Q8VA 3FEYB 2YI1A 3MX5A 3PIOL 1Q82O 3WQUA 5AR0A 1RISA 1F0XA 2AP6A 4MYUA 4LFBJ 2GO9A 5ADXH 1UVMA 3VF6A 4DR3J 3PKMA 2QL7B 4JI0J 1NM1A 3DLEA 2D1KA 4KR0B 2RKIB 2E1PA 1SJ4P 3RR8A 4KH1B 2YHXA 1KSPA 2EKNA 2YQ3A 2H4WB 4F26A 4LF9F 2FXUA 2ZWPA 4GKJK 1XERA 3DU6A 3CDEA 5DM7L 4LSNA 2CJKA 5JVHL 2V2VA 1WB9A 3JTOA 2FBTA 1WSHA 1HBNB 3QGGA 4NMLA 3VR1A 6FDRA 1QSLA 3HP9A 3AJ1A 2D1CA 5A2QY 1FKOB 2ATLA 1QE1B 3GMGA 4J8FA 3BH6B 3MM7B 1J5OA 3PXGa 3ADAC 4C1NI 3FZBA 2WW4A 3AVAA 1U6FA 3C14A 3M6WA 4OZ1A 4MK8A 4V19X 2NLXA 2JZ5A 3QBWA 2M8DB 3TJ8A 1XMQK 1Y9OA 5LMUJ 2KFYA 2Q6BA 2BJ1A 5EN1A 1I1GA 4FWKA 2CG8A 2HHHF 4K0KK 2KRBA 3RRGA 5IV4A 1JMTA 1YJNS 3H90A 1VSJA 1C1CB 3CC7N 4URQU 4C97A 5J2PB 4IYQA 5SWMA 1MROA 2A2CA 1RHJB 2DO4A 3NCRA 4O4GB 4JKAA 5CD4A 2OPSA 2W9BA 2KW4A 5FD1A 1J5EK 4NCGA 4UTGA 3V9SA 3TX8A 4EMDA 4KGVB 3HP6A 1NAQA 4M8LA 3C7NB 2CKWA 2G0CA 3WZ0A 4FS1A 2NQPA 3CC2S 2GVZA 3MN6A 1SQGA 3U1LA 2J9DE 2WZ1A 2OIHA 1GH8A 1TKXB 3DXBA 4K5RA 2D3OR 3MX2A 4UOGA 2D0AA 1MMLA 1EQYA 4K8XA 5JVGL 3H4DA 1K9MT 1BD6A 1KS2A 4QU7A 2CPFA 4NI2B 4CHQA 1P8GA 4FWSA 4TLRA 4M5DA 4I6YA 3SDEA 1HBNA 1Z2LA 2ASLA 4QWEA 2NUBA 2RQMA 1PC4A 4LF6J 3ZETA 3HKWA 4PQUB 4A8XA 1D3WA 2ZF5O 2ACMA 3FE1A 1L3SA 4PUOA 5CY4A 4ISFA 1JLAA 1RQ0A 4BVOA 4PZVA 3MUVP 2FVRA 1N5QA 1F6TA 4DL2A 5CYMA 1C0GA 5BR8J 5HLFA 5CABA 1BMQB 2HHQA 1QAYA 3ASMA 1BHNA 1UEVA 3VQSA 3IM8A 4QZVB 2RS2A 4C0BA 3SUPA 4ZP9A 2HSTA 2FJAB 5DGAA 2WC9A 3AVIA 5DG8A 4FCYA 4YS2A 1L3KA 2MGZA 3D0HE 1KBRA 6AT1B 3KTQA 4MKBA 2YX4A 1IJFB 4ZVTB 4QR1A 2A1SA 3M2UA 4H5NA 3K0JA 5ETKA 3FUYA 2PDAA 4KH6A 1WOPA 1UJ6A 4CGIA 3A3NB 3WNFA 2G8WA 3SBTA 2RDIA 5C2GA 2RSQA 2MMYA 3BP8A 1BLUA 1FVQA 2W1BA 2HQIA 5J2NA 3N5BA 4Q2MA 2MHNA 1UETA 2R42A 1VBKA 3QRPA 5KFHA 3TZWA 3L4BC 3HPHA 3CFPA 1TUVA 2B4VA 3DCAA 3DOLA 4ATNA 4LVNP 4HR2A 2MZRA 2KXHA 4QPXA 2YJFA 4X62J 2E20A 5A8KA 3NMRA 3Q8YA 2AA4A 3Q2SC 2IVOA 3HHNB 4ISGA 1T44A 3CCVS 5GADP 1JJ2R 4EO8A 2QA4G 3ZSVA 3JQJA 3WHIA 2OFHX 2VPZB 1TKTA 2MZTA 1F2GA 4B1YB 2NZCA 1X0FA 4G1PA 4DV3J 4JV5J 3RVCA 4DF8A 3POTB 4E7KA 3T1HK 5C5JA 1S6OA 4FJHA 2YNIB 1RB0A 4GY2B 2MKSA 3T1YF 3MPWA 3UVJA 3MD3A 2W01A 1G15A 3G8QA 3CCQS 5KFIA 2GQQA 4KB0A 1HBMB 4UQGA 4H03B 2V8GA 1O6XA 1N5SA 1X4FA 3UDVA 4FYVB 1YLXA 4YEAA 3CDBA 1N32F 2UV8G 1VCTA 2QLFB 1PAUB 1GLFO 1IVZA 2KHCA 4ZVHA 2JC1A 1WSEA 3CWJA 4O44B 4H0VB 2Z2LA 4A8WA 2JH3A 1S9EB 2ZJQQ 4FLXA 1R89A 4RWXA 2B5JB 2EW9A 3KUEA 1RYSA 3AO4A 3Q7BA 1FXDA 2ACYA 3PRBA 4NLBA 3QFHA 4IEEA 5ETSA 2GA7A 2NUHA 3HI0A 1HJRA 3QWPA 3MCAB 3O2IA 4H4MB 3KLEA 4DUYF 4MJKA 3R1HA 2ATQA 4F0HA 4WQ5C 1ROFA 4OX8A 4NXNF 1R6VA 3FEXB 3QATA 2YKNA 3T1AA 4ECUA 1F1BB 2P9NB 2YWHA 3MM9B 1JLEB 4FBUA 3U8XA 3AY0A 2JVRA 2PGCA 1U1QA 4KO0B 5D0HA 2R2SA 5KT4A 1HHTP 4ZLJA 4JKGB 5AXKA 3VN5A 4DR6J 5B0FA 1FD8A 4QWCA 2OD4A 1FE0A 1KVIA 4GNIA 1K8AO 2NNWA 2G8FA 3CNQP 3TYTA 1QM9A 1SUQA 4L6V3 5LJ3Y 2KG0A 1RXOB 1OWXA 5KG4A 1B0VA 2W2MP 2Q1LA 1RP5A 2IRUA 4DQSA 2AJFE 2J7UA 5EDWA 2RPIA 3CJSA 1KQFB 2Z30B 3NGYA 3MR5A 4USTA 3TUIC 3CD6N 2WFBA 1UZDA 2PYJA 3MTJA 2YKQA 4IG3B 2MQOA 3QLHA 3OQ2A 1EX8A 5KFMA 3DN9A 1RDWX 1YVUA 3KUGA 3WXLA 1LW0A 3BY5A 4E98A 3DDKA 4GVBB 3EXYA 1K47A 1TFWA 3HPGA 4NMXA 3FQKA 2A10A 3J7YP 4A8OA 3OBWA 1NZAA 1DTTB 1N33K 1YITN 2BH1A 4CDIA 3G96A 4DX8H 1I3OB 2E1MC 3I31A 2KG1A 1APSA 4H4OB 2HNDA 4G6VB 1TQLA 2NR0A 2C1EB 1F9HA 3FCVA 2R8GA 1WHWA 4ILGB 1TL1A 5K9FA 2G2YA 2L9WA 3TNVA 2EFNA 1GMWD 4JV5F 2DPNA 3GV7B 3HM8A 2O8BB 3BS9A 3O8WA 4IOBA 3OS2A 4DR4K 4RG8A 3NE6A 1WUAA 1U1KA 1CJKB 4PWDA 1PILA 3ILLA 1IBLK 2Q79A 4CHOA 2VBZA 3ELHA 3EX7B 3OHAA 1SC1B 4W5TA 4DTJA 4CZLA 3EEQA 2KVIA 1T3NA 2HAIA 3ZT1A 4H5RA 2D9PA 5AQPA 1NGBA 5BN8A 2DHSA 4IH5A 2IFXA 1I51B 4C8NA 4F2SA 1TUGB 1KTVA 1UWAA 1X4HA 3EZWA 2W25A 5CR4A 3Q89A 1BQXA 1YJ9N 1TYQB 3V81A 4LH4A 5E84A 1U0SA 2G1HA 4DPTA 2ASDA 3MN5A 3NHGA 1VQLN 4B9NA 2O66A 2B8QA 4ES1A 2E5LF 4CF8A 4MO4A 3M9NB 3PNIA 5BRDA 4P71A 4TXSA