3I0SA

Crystal structure of hiv reverse transcriptase in complex with inhibitor 7
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
558
structure length
558
Chain Sequence
b'SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Substituted tetrahydroquinolines as potent allosteric inhibitors of reverse transcriptase and its key mutants.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 160
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3i0sA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0sA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0sA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0sA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3i0sA05
1TQLA 3EZUA 3IRXA 4J2BA 4E7IA 3OYCA 1S6QA 3M8SA 5L1KA 3NBPA 5KFYA 3P5JA 3IRXB 3HXMA 4DQQA 4ECXA 2IOCA 1ASUA 1S6QB 4MK8A 3KHGA 2YNIA 1VK0A 3QZ7A 4Q8EA 4DTMA 3NBPB 4RU9A 3PUFA 3ZT0A 2XGQA 3KIOA 4CF1A 1JLGA 3MXJA 2YNIB 1W0HA 3OJUA 4KE5A 2AGOA 1HNIA 4W5QA 4CF8A 3O4NA 3HVRA 5DG8A 1VSFA 4YR2A 1JLGB 5EWGA 1ZBHA 3ALYA 1S10A 1HNIB 3KJVB 2BRKA 2JC1A 3AVAA 3V1OA 3OL9A 1WSJA 3H5XA 2LSNA 2XI2A 3AVIA 1VSLA 3H08A 3QEPA 1S1TA 4FLUA 2F8SA 4DMNA 3IG1A 5DG7A 1BHLA 1XHZA 1SKRA 4DSJA 2Z1HA 5T14A 4F3OA 1S1TB 3NL0A 4BWJA 2IBKA 4KTZA 3IAYA 4CCHA 3IG1B 1KFSA 4M3XA 5KRSA 3T5JA 3DRSA 1HQUA 1S1VA 1B9FA 2OH2A 3QNOA 4FK2A 1IKYA 3RB6A 4E7JA 4DL7A 3DRSB 3MR5A 3AA4A 1HQUB 1S1VB 4DFJA 1IKYB 1IKWA 1ZBUA 1IH7A 5F9NA 3H4BA 5F8JA 4YR3A 1JLEB 4J9LA 3C95A 4J2DA 1DLOA 3B6PA 2IDOA 4IG0A 2HNDA 5HRNA 4KI6A 4K4ZA 3PJXA 1IKWB 5KFNA 1RBSA 1NJXA 3OYLA 3K5LA 1DLOB 5JUMA 3FFIA 4IG0B 2R2TA 1GX5A 1QTMA 2HNDB 1QAIA 5JS2A 4RUAA 3N6LA 3OYDA 4ZHRB 3RMAA 3FFIB 2HMIA 2R2RA 1BGXT 3I5BA 1C0MA 3DI6A 3MEGA 4KB7A 4CF2A 2IM3A 2G8UA 3ZSOA 2HMIB 2FVQA 1DTQA 1RT5A 3DI6B 5DGBA 5L9XA 3GIMA 3MEGB 3I0RA 3NH2A 1NK5A 5HROA 4LSNA 3QEXA 4GC6A 3CJ3A 3CDUA 1DTQB 4ZPCA 2IGIA 3H2LA 4HUEA 4CJ5A 1T8EA 3I0RB 4FJ9A 3OSNA 5HROB 4EEYA 2JGUA 3O3FA 4Z0UA 3K5NA 5KGWA 1WNEA 5KFBA 4NLOA 1HYVA 4YFUA 4ED6A 1S48A 5F8IA 3AVNA 2HNZA 5KFRA 1QAJA 3BSNA 1Q9XA 4DTSA 4KHWA 2R8HA 2EX3A 2C2RA 4F4YA 2HNZB 3V9WA 4H4OA 2FVRA 1RBRA 1ITGA 4M3ZA 5HP1B 1S1WA 2KZZA 4IQXA 3HKWA 3DYAA 3OVNA 1QHTA 4H4OB 1TKZA 4KHNA 5KFGA 1NKBA 4OL8A 3RRHA 3CWJA 1S1WB 1BI4A 3KK1A 3BQ0A 3DYAB 1UA1A 3LP1B 4I9LA 4IFYA 4F4ZA 1TKZB 4EO8A 1SV5A 4HKQA 4ZVEA 1BI4B 3EZ5A 3RR8A 4IFYB 1RTIA 3M9NB 1SV5B 4DEZA 1U45A 5KT2A 1C2PA 3KLFB 1RAJA 3VQSA 4F8RA 4O4GA 3AVCA 5EUHA 1X9MA 3T19A 3SV3A 1SUQA 3IS9A 4IDKA 1SH2A 4O4GB 5HRRA 4EZ9A 1LWCA 3QGHA 3IS9B 4IDKB 3PW5A 2HVHA 4E7KA 3SNNA 1FKOA 3LAKA 1LWCB 4ZVHA 5KFEA 3SQ4A 5EWEA 4KPYA 1TV6A 4RW9A 1IKVB 1FKOB 1JXBA 3KOAA 3LANA 2G8WA 4GMJB 2W7PA 3NKYA 4TYBA 1TV6B 4RW9B 4NRUA 2BQRA 4LH4A 1NHVA 3HP6A 1RT6A 2PYJA 4DLGA 4DSKA 4K8ZA 3VQ9A 2YHAA 4NZ0A 2IC3A 4OKKA 4MQ3A 1XC9A 4DL2A 2HWIA 3V9UA 1RT6B 2UVUA 4R8UA 2HHSA 3O4QA 2CKWA 4DSFA 3FRZA 2IC3B 4KHMA 4FBUA 3M8RA 4RUCA 5DQHA 1YTAA 5KFIA 4R8UB 3KLHA 5C24A 3RBDA 1QQCA 3QZ8A 3OS0A 4FJLA 5F8NA 3VQ5A 4DF8A 1CZBA 3KLHB 5C24B 2W9BA 3KTQA 4LQ9A 1BQMA 4PUOB 2VA2A 2UUWA 4K50A 1NNDA 4Q45A 5KFCA 2W9BB 3PW7A 1BQMB 4DSEA 1RDDA 3HVAA 3H5UA 4NLUA 2I5JA 3KD1E 4M3WA 3TABA 4FVMA 1KFDA 2FBTA 4FK4A 2YNHA 2G8IA 4BWMA 2IJNA 2I5JB 3QESA 1KVBA 3BQ1A 1UAXA 1VRTA 4E3SA 4DQSA 2YNHB 4W5TA 3BDPA 1D9FA 4BACA 4JV1A 1VRTB 3CJ0A 2PYLA 3OJSA 3VQPA 2J6TA 4DFPA 1TK8A 2AX0A 3HHKA 2E9ZA 3CFPA 1NK0A 4N56A 4UQGA 4OLBA 2FJWA 1JL1A 3K58A 4K4TA 1REVA 1R0AA 2IMWP 4WFYA 4ZMMA 1MU2A 1EP4A 4ECUA 2HAIA 1NKEA 1REVB 1R0AB 4OKEA 3CFRA 4ED1A 2F8TA 3JSMB 3T3FA 1MU2B 3SUPA 4O3PA 1JLBA 3V9XA 5FROA 4GVMA 5DK5A 4DTJA 1A5XA 3GIKA 3SI6A 4M3RA 4B08A 2FVPA 1JLBB 1ZBFA 3DLEA 3ISNC 1Z4UA 4J9PA 2XY5A 2ASJA 2JLEA 4Q0BB 3QEWA 1CZ9A 4N76A 5EWFA 3D45A 3WNGA 3DLEB 3K59A 4O3QA 4M3TA 1TK5A 2QE5A 4FJ7A 5C25A 1HYZA 3QEIA 2P5GA 3LPUA 4ZVFA 5C25B 1L3VA 4IH5A 4B9MA 4TXSA 1YVUA 5HRPA 2O4GA 3CG7A 1JXEA 5KG3A 4NYNA 4CJSA 4B8CA 2ILZA 4DLEA 2YV0X 1S0OA 3DMJA 3G86A 3HPHA 4DFMA 1XI1A 2VG7A 4HUFA 4OGCA 3T5LA 4MKBA 4Y2AA 3PW2A 4FM0A 3DMJB 2VG7B 3MTKA 4URGA 2AGQA 1S5JA 3KMSA 4X2BA 4NCAA 4MKAA 1RBVA 4ZP6A 4DS4A 3CJ2A 4MFBA 1S9GA 5K14A 2EC0A 1LW2A 4ECSA 3KKSA 1S97A 4WZMA 1VSKA 4MFBB 2ZQBA 4C8MA 3LWMA 1S9GB 5K14B 1SH3A 1VRUA 1LW2B 2BANA 2FLPA 3LP2A 4IBNA 3Q8RB 1VRUB 4ZTFA 2BANB 3TAQA 3AVHA 3LP2B 4QW8A 1VSIA 5KFQA 1JLAA 1HNVA 3AA3A 3HVTA 4XPEA 3OYKA 1GX6A 4CEQA 3BSOA 4JV2A 2VWKA 1JLAB 1HNVB 3HVTB 2D0BA 3QERA 3DLHA 3QINA 4E19A 3AO3A 3V81A 3DRRA 3OS2A 3S3MA 3AO5A 1GOBA 3AVKA 4ED8A 3U6FA 4QWEA 4URQU 5KFFA 3D0PA 3NAIA 4J9SA 3V81B 3DRRB 4FJJA 4WXWA 2DFFA 4ECWA 1B9DA 1RT1A 3DM2A 3OYJA 4EBEA 2FBYA 4EP5A 4B9SA 2Z1IA 5J2QA 3DM2B 1RT1B 3C6UA 4B8AB 4NLXA 4KAZA 4WE1A 2ZKUA 1QUVA 3OL8A 4FW1A 4CEAA 1KLMB 3AVFA 5SZTA 5J2QB 4ZPAA 3C6UB 4K4WA 4FZYA 2RF2A 5KFVA 3PR4A 4OJRA 4CJUA 4WE1B 1G15A 2O4IA 4KHYA 3GIJA 4IRKA 3ZSWA 2RF2B 3Q8SB 4CJTA 4JLHA 1X9SA 4B3OA 1TL3A 4C8KA 3OYBA 2HHUA 4RG8A 4KBIA 3DLKA 2HHWA 2YKMA 4B3OB 1TL3B 4PQUA 4NLDA 3VQ7A 3WNHA 4K8XA 4NLSA 2HWHA 1F21A 4NLRA 4F2SA 3DLKB 1KHVA 3RMCA 1EXQA 4Z4FA 4KI4A 2YKMB 4PQUB 3SUNA 3M8QA 2F96A 2F8EX 4CEBA 5KFZA 4H8KA 4MK7A 1QS4A 4IH7A 1RT7A 3KJVA 3WNEA 2O5DA 3M8QB 4RNMA 1A5WA 3QEVA 2IAJB 3L3UA 2Y1IA 1RT7B 1J9AA 3TAEA 3FQLA 4FK0A 1QSYA 4TYAA 1XR6A 4KKOA 4CHOA 3KNAA 3RWUA 3RAXA 1TAUA 3V6JA 2JEFA 5I3UA 2BE2A 4DL4A 3ZT1A 5J2MA 4KKOB 3TAFA 4FLTA 3IN5A 3T5KA 1SL2A 5E41A 1RT3A 4KB1A 3L8BA 5I3UB 2BE2B 5J2MB 2V4RA 1I3AA 1RT3B 1XHXA 1RDAA 4GW6A 4W5RA 4YP3A 4RNOA 2UUTA 2DTUA 3GILA 1SL1A 1OS5A 2KQ2A 4F50A 2HHTA 1JLEA 4B9UA 3VQ8A 4WFZA 5J2PA 3NGIA 3LAMA 4QWCA 4AH9A 2GUIA 3PO4A 2J6SA 4FM1A 4CJWA 3SUQA 5J2PB 2XCAA 1SH0A 4GC7A 1J5OA 4KSEB 3FSIA 3OHAA 4ZHRA 3TANA 3CM6A 1J5OB 1BCOA 1WNSA 1TKXA 4Q5VA 4FS2A 4JV0A 4RZRA 2P1JA 2D5RA 2X6SA 1C6VA 5KFKA 4QW9A 4OPKA 1U4BA 3HVWA 4K4SA 4ID1A 3O3GA 1TKXB 3SI8A 3MFHA 4PY5A 3VQAA 1NKCA 3NH0A 4Q44A 3NGZA 4CHYA 4G3IA 2GBZA 4DU1A 1NJYA 3K5OA 4FZZA 1ZYQA 3L2QA 4DTPA 3AO4A 4CEOA 2UVVA 2AQ4A 2R8KA 1J53A 5KFSA 4HHTA 2P5OA 3UR0A 2XRIA 3BGRA 4U6PA 3EPGA 2OZMA 1A5VA 2HHQA 5HP1A 4O3NA 3FDSA 1L3SA 3HPOA 1CXUA 3BGRB 4IFVA 3NGDA 3ASMA 4W5OA 2JEGA 3AV9A 1YTUA 2GC8A 5KT7A 3LWLA 2FLLA 4FLWA 1ZBLA 4IFVB 1BIUA 3LP1A 4FCYA 4NRTA 2OPSA 4TQSA 4K4UA 5KFDA 4QPXA 2BQ3A 4J9MA 4FJXA 2V9WA 1KCFA 3ZSXA 4DQIA 2OPSB 4F2RA 3OLBA 4BE1A 3KLGA 2HVIA 3KLFA 3BR9A 5KFWA 5KFTA 3V9SA 4EO6A 4E0DA 3V1QA 3THVA 2FBVA 3KLGB 2NUBA 2V0NA 2PZSA 2FVCA 1I39A 3OYMA 3OYFA 4FJIA 5DLFA 4RNFA 3V6DA 1RTJA 4BDZA 2R8GA 4C8NA 1VSJA 2IJFA 3BQ2A 3TARA 3AVLA 1KHWA 3ZT4A 3V6DB 1RTJB 5C42A 1RDRA 1VSDA 1IKVA 4LD0A 5KG1A 1NK4A 1BCMA 3KLEB 3G6XA 4KB0A 3HJFA 3NFAA 5C42B 4M3UA 2E6MA 4HTUA 4M3YA 4RW8A 4DSLA 4AHUA 3TI0A 1W25A 2XGPA 2B5JA 4J2AA 4RW8B 3HK2A 2W7OA 4QCLA 3I0SA 3GYNA 1RBTA 1TAQA 3NE6A 4DG1A 2B5JB 3CJ5A 3NHGA 4FJNA 4NLPA 1LV5A 3KKRA 1C1BA 3I0SB 4MIAA 1ASVA 4DG1B 2OPQA 4QAGA 4PUOA 1TK0A 1C1BB 3SQ2A 3VQ6A 1D9DA 5JXSA 4KFBA 3OYEA 2OPQB 4LY7A 5KGXA 3SQ0A 4CHQA 3RB0A 4CHPA 2GIQA 1S1UA 4KFBB 3V9ZA 4C8LA 3PHEA 3HL8A 3U3GA 1LWFA 5KG5A 3TAPA 2CJQA 1S1UB 2Z1GA 2G8HA 3ZT2A 4BE2A 4CGFA 2IM1A 4ZP9A 2KFNA 3BSCA 1UA0A 1LWFB 4CJQA 5CY4A 1U09A 2XI3A 4KTWA 3RAQA 3OYAA 2D3UA 4ZP8A 2DPJA 3GIIA 3H40A 4ECYA 2EHGA 1Q8IA 3K57A 1TKDA 1L3UA 4AHTA 5KTQA 2B6AA 4PA1A 4JRPA 4FM2A 2ATQA 4J9NA 3PX6A 3VQDA 1C0TA 2B6AB 4ED3A 2J6UA 4EBCA 3KHLA 3S9HA 3TAMA 4CGDA 5CYMA 4PWDB 1C0TB 3PVXA 2JC0A 4CF0A 2ATLA 3D28A 4O3SA 3JSMA 4M95A 3V6KA 3BJYA 3TAMB 3P1GA 3UIQA 3SYZA 5CYMB 4N5SA 5F8MA 2VG5B 1RA7A 5KG6A 2FBXA 2BRLA 4K4XA 4J9OA 1KVAA 2WTFA 3KHHA 4B9LA 4WZQA 4RW4A 3K2PA 1YT3A 4AILC 4DU3A 2ZE2A 4Q0BA 4RW4B 1X1PA 4K4VA 3S3NA 2ZE2B 2BR0A 4DU4A 4CJFA 4LQ3A 4CJVA 2HHVA 1WN7A 4TLRA 4YQWA 4O3RA 3CO9A 1WSGA 2KTQA 5EDWA 4O55A 4C8OA 2E9TA 4RNNA 2BDPA 1HYSA 4Q43A 1WSFA 1S4FA 3H5SA 3LZJA 3H59A 2A1RA 1HYSB 4KHSA 1IM4A 4J9KA 5C5JA 1Z26A 4DTUA 1QSLA 5KT4A 1FK9A 2Y1JA 3AVBA 3OL7A 4CGJA 1XR7A 2D41A 3E51A 3NF8A 2BQUA 2OA8A 1FK9B 1WSHA 4ID5A 4Y1DA 2HW3A 3SV4A 4DS5A 3VQEA 5KFHA 1T03A 4KREA 2GV9A 1CLQA 4Y34A 5FDLB 3IGVA 1RBUA 4I7FA 4ID5B 2DPIA 4ECQA 4CEEA 5KFAA 1LW0A 1T03B 4ED0A 5KG7A 2RKIA 4I7FB 4FJ8A 3VQQA 2WRMA 4M94A 1LW0B 2IM0A 4CF9A 5KG0A 3CM5A 3PW4A 1O1WA 3VQ4A 3KK2A 3GQCA 2RKIB 4LH5A 1RT4A 4J9QA 1HJRA 3C6TA 2D0CA 3SQ1A 3CJ4A 1HARA 2E9RX 2A1SA 5KFXA 3KK2B 1NK8A 1RT4B 1BISA 1JLFA 3C6TB 4DL6A 3VA3A 3MR2A 3V6HA 3KLVA 4E1MA 5HBMA 4F3TA 4DQRA 4Y2CA 4ECTA 4ELVA 2IA6A 3CFOA 3Q8PB 1JLFB 3RMDA 2WOMB 3PV8A 3QNNA 3MXMA 2OPPA 3PJWA 2RPIA 1BQNA 5HBMB 5HRSA 1TGOA 3KLIA 4FLVA 3EYZA 4J9RA 4DQPA 3QGIA 4AHCA 1ASWA 2OPPB 4CJ4A 5SWMA 3CYMA 1BQNB 1VSHA 3H4DA 3PR5B 2DFEA 3KLIB 2R2UA 4NLGA 5J1EA 4CK3A 3QO9A 4CK1A 4FZXC 1KLNA 4F4KA 4ECZA 4WYWA 4TN2A 5D3GA 3SPYA 5J1EB 2VG6A 1KLMA 4NLYA 3QO9B 3QGGA 4YNQA 1T05B 2OYQA 4DTNA 4CGIA 2WK4A 5D3GB 2VG6B 3GV7B 4CGHA 3NGYA 2WCXA 3EPIA 2QKKA 3ZT3A 3RTVA 4KAIA 4E7HA 4OKJA 3DDKA 3AVMA 3MAQA 2RN2A 4I2QA 1Q9YA 1K6YA 2G8FA 5DG9A 3SFUA 4IRCA 2OZSA 4I2QB 4MIBA 3KHRA 3Q8QB 4O0IA 4B9TA 4JUZA 1K1QA 1WSEA 3G6VA 2OPRA 1NK9A 3L2UA 4KV8B 5L1JA 2OPRB 4CJ3A 3WNFA 4FJMA 2IAJA 4ZP7A 3ZSZA 1KVCA 1NK7A 4FLXA 3OL6A 3ZCMA 1N56A 2WONA 4ED2A 4JS4A 1U48A 1XWLA 2WONB 4CJRA 3AA2A 2G8VA 3SJJA 2XO7A 2KW4A 5KFUA 4HYKA 1C0UA 3QIDA 1N4LA 1JLQA 2QKBA 1WAFA 3L3VA 1Y97A 1C0UB 2W9CA 2Q3SA 1BL3A 2ETJA 1JLQB 2KZMA 4NLWA 3U3YA 4ICLA 1KRPA 4EYHB 3HYFA 2W9CB 3VA0A 2RDJA 4CERA 2FLNA 1N5YA 1HPZA 3OYIA 4DSIA 4ICLB 2GIRA 4L8RB 2X74A 3I5AA 3N6MA 4ECVA 4B9VA 1ZETA 2AGPA 4BDYA 5FRNA 4I9QA 4IR9A 1N5YB 1HPZB 1S1XA 3O3HA 3I8DA 3HP9A 2XHBA 3KMQA 4O5BA 4DTXA 4Z4HA 1D0EA 4K4YA 1U49A 1RYRA 1S1XB 4CHZA 1NOYA 1HRHA 2DFHA 1ZTWA 1JKHA 1SKWA 4FLZA 5KFOA 3LDSA 1WAJA 2XY6A 1BIZA 3T1AA 4J2EA 2BGGA 1JKHB 4HVJA 3DLRA 4NLQA 2FJXA 1RDCA 4E1NA 3RMBA 5F8GA 4CE9A 1N6QA 3OHBA 3NF7A 5KFLA 1LWEA 1JLCA 4RW7A 1N6QB 4DL5A 4IRDA 1CXQA 1LWEB 1Z25A 1RILA 1JLCB 3T5HA 1VSMA 3QLHA 3CDEA 4RW7B 3MFIA 3QETA 1SKSA 2D3ZA 2DY4A 3QLHB 1RT5B 3DLGA 3JYTA 1I6JA 4N41A 4Y3CA 3LP3A 4LSNB 3F73A 4Z4GA 3ZSRA 4WXOA 4FW2A 1L3TA 2AWZA 4KTQA 3DLGB 3JYTB 4ZPDA 3MXIA 4M41A 3LALA 4URSA 4KO0A 1WLJA 5KI6A 1QE1A 3SZ2A 2FC0A 2D0AA 4IOBA 4KO0B 4WFXA 5JS1A 2ILYA 4OVLA 3CQ8A 3DOLA 2XY8A 4FJGA 1S6PA 1QE1B 1J54A 4OGEA 5I42A 3PZPA 3DOLB 1CSJA 4CFAA 3H5YA 3NAEA 1S6PB 4Z4EA 3AVGA 3RB3A 5I42B 3G0ZA 1NJZA 3KK1B 3VN5A 3ULDA 3PX0A 3HPGA 2E6LA 1KSPA 3KLEA 3CVKA 1HQEA 5FRMA 1U04A 2X78A 4FBTA 1DTTA 3OLAA 4CFBA 5L1IA 1RTIB 2XWYA 3TWHA 1NJWA 2RDIA 1MMLA 1FXXA 1HQEB 2B4JA 4XIUA 3SPZA 1DTTB 4DTOA 2I1RA 2UVWA 3HSTB 3VQCA 2C2DA 2QV6A 4N47A 1HMVA 1SUQB 4E89A 5KFPA 1SL0A 4IH6A 4CEDA 4CJKA 4RNHA 1HMVB 3NAHA 4CFDA 3NF9A 4OLAA 3DRPA 4EYIB 4FJHA 4CJEA 5F8HA 2R8JA 4CGGA 4CK2A 2W8LA 5L1LA 3HM9A 3PX4A 1RCHA 2E4LA 3DLBA 3RB4A 3DRPB 4AHRA 3MEDA 3M9MB 4F4WA 1N48A 2YKNA 3ISND 4FJKA 4E7LA 1LAVA 3UQSA 4JS5A 2W42A 3MEDB 5T7BA 4O4RA 5F8LA 2Z1JA 4ZTJA 5KG2A 2YKNB 4DTRA 3FQKA 4QOZB 4AHSA 3BSAA 4QWAA 1D1UA 3M9OB 4IG3A 1ZTTA 3AO2A 3K5MA 3C94A 5J2NA 3OYHA 1B92A 2ASLA 4NCGA 3TQ1A 1RT2A 5KFJA 4CIFA 2G8KA 1T94A 4IG3B 4R5PA 4XPCA 5J2NB 4NCGB 4TSXA 4ZVGA 3I5CA 5KT6A 1VSEA 2FJVA 2WHOA 1C1AA 4ELTA 1RT2B 3QIPA 1IKXA 2VA3A 4R5PB 2W8KA 3AVJA 3S3OA 3PY8A 1UOCA 2YHBA 3KD5E 3QYYA 3MR3A 4PWDA 1JXLA 3F9KA 3GV5B 3QIPB 1IKXB 3MF5A 1LAWA 2ASDA 4M45A 4DWIA 5EU7A 1RA6A 2C22A 3M8PA 1IO2A 2QK9A 4FXDA 3LP0A 2ALZA 4NCBA 5HLFA 1K1SA 1S49A 5F9LA 2VG5A 1YVFA 1S0NA 3OSPA 1GOAA 4KHQA 3M8PB 3LP0B 5HLFB 4O0JA 1TVRA 4MK9A 4KHUA 4DFKA 5CZ1A 2IS3A 4IR1A 2HNYA 1RTHA 4YR0A 4I2PA 2V4QA 4QWBA 1X9WA 4H4MA 5CYQA 1TVRB 3OY9A 3RBEA 1T3NA 3ZSYA 3SCXA 4KRFA 2AJQA 2HNYB 1JL2A 1RTHB 2QXFA 3MEEA 4I2PB 2WB4A 4Q8FA 1TKTA 4H4MB 4YMEA 3G6YA 5CYQB 4U7CA 3A2FA 2ITGA 4IKAA 5KRTA 4EZ6A 3QIOA 2W9AA 3MEEB 1EP4B 1TKTB 1D8YA 3RRGA 3H98A 1TP7A 1TL1A 4M42A 5CZ2A 3G10A 2XY7A 4HCBA 4R0EA 4B9NA 4CJLA 4MH8A 4O3OA 5DLGA 1TL1B 4DL3A 3TR8A 2IM2A 1NK6A 2D7SA 1RNHA 3ZSQA 3RR7A 1RDBA 3OS1A 2AU0A 3V1RA 2XCPA 5DMRA 3SUOA 4HUGA 4F4XA 2JEJA 2HB5A 3DOKA 3D5MA 4IKFA 1ZBIA 3ICLA 4EP4A 4CESA 2JEIA 2UVRA 3DOKB 5FDLA 1S9FA 3ZSVA 2XC9A 4FLYA 3CDWA 4Z4IA 3HT3A 3GV8B 1QSSA 3B6OA 4ECRA 2HHXA 5KG4A 4FS1A 3N6NA 3UPFA 5DQGA 4CEZA 1UWBA 4CFCA 5DGAA 4O44A 4RW6A 2R7YA 4ELUA 4ZPBA 3NMAA 4CIEA 3LZIA 3NDKA 4LSLA 3KK3A 3V4IA 1XR5A 1UWBB 3LPTA 4HCCA 1W9HA 4CECA 4O44B 4RW6B 3UDLA 1FKPA 4NLVA 3AA5X 4LSLB 3KK3B 3V4IB 3AO1A 3L2VA 5KFMA 4KHRA 1WSIA 4W5NA 1GOCA 2FVSA 4QWDA 1FKPB 1JIHA 2PY5A 2WOMA 3TVKA 2R2SA 3IGNA 1RYSA 2YNGA 3OYNA 4AHVA 3NF6A 2AX1A 4OPJA 2VWJA 1EX4A 3PO5A 2YNGB 2KFZA 1EETA 2C28A 4TQRA 1L5UA 2X6NA 4G1QA 4WYLA 3MECA 4Z4CA 4CIGA 3MR6A 3TAGA 1EKEA 1S0MA 1T7PA 1EETB 4CHNA 4G1QB 1KTQA 4BDPA 3MECB 5KT5A 1NHUA 3CIZA 1T05A 4NYZA 2C2EA 4FJ5A 2YNFA 4H54A 3ITHA 3L2RA 2R8IA 3PW0A 5DQIA 2ZD1A 4XO0A 2YNFB 3ITHB 2P51A 3L2WA 2ZD1B 4ED7A 4DF4A 1RTDA 3BREA 4BE0A 1C1CA 3HO1A 3VQBA 3OYGA 4TY9A 1RTDB 4TY8A 1C1CB 1JX4A 1D5AA 1IG9A 1S9EA 5KT3A 1U47A 3NH1A 4NLTA 4NYFA 3NCIA 4JRQA 4TY8B 4CJPA 4KV8A 3E01A 1NOZA 4Y1CA 4CEFA 1S9EB 3SFGA 2B43A 4FYDA 3EY1A 4EBDA 3P83D 3E01B
chains in the Genus database with same CATH superfamily
1TQLA 2V68A 3EZUA 2XYPB 4J2BA 2YBVA 2DNNA 3P5JA 3WXLA 3IRXB 4LF4F 2IOCA 1A0OB 1ASUA 3M8YA 2YNIA 1VK0A 3QZ7A 1KVKA 2E7VA 3GMGA 2ACYA 2W2OP 3PUFA 3BBFA 2XGQA 3ZT0A 5JICA 2H4WB 1JLGA 3MXJA 3CERA 3H20A 2AGOA 3O3LA 4CF8A 3SCJE 3O4NA 4FXWA 4LFBF 4Y65A 1FJEB 1R8CA 1ZBHA 1GLFO 4PG4A 1TL7B 1WSJA 4R25A 3H5XA 4PXCA 2FY8A 2XI2A 3AVIA 1TUWA 4OZ2A 2OSRA 4FLUA 5DG7A 1BHLA 1XHZA 1U02A 5B0BA 2Z1HA 1YVNA 3ULEB 2KN4A 4BY9C 4BWJA 4OV1A 1VJWA 1KFSA 4M3XA 1FE4A 5KRSA 3ILLA 3SMZA 1FD8A 3P4UB 1HQUA 1S1VA 2NXJA 4DUYK 3QNOA 4FK2A 1IKYA 3RB6A 3TSPA 4ISFA 1KAZA 2VFTA 3I56S 1NB2A 3DRSB 3MR5A 5TKWA 1CLFA 2OTLS 5H9FJ 5F8JA 1G4CA 1VQ9N 2CVEA 2G9OA 2MZTA 4C4WA 3RGIA 4KI6A 3PJXA 4OHVA 2E7XA 3OYLA 4YY3J 3G9CA 4YHHK 1DLOB 5JUMA 3MM6B 4YDDB 3UB5A 4R79A 5JS2A 2GNKA 3J7AN 3LDOA 3DLLQ 2RU9A 3MD1A 5DM7Q 2J9DA 5I3PA 1NEEA 4QZVB 1C4AA 4KB7A 3IFEA 2FHJD 4JI4K 3MM5B 3ZSOA 2HMIB 3G4SS 2FVQA 3HLUA 1HW8A 1VC6A 5DGBA 5L9XA 4NOHA 4LRAA 1NK5A 4WIQA 2ZH1A 3QEXA 1DQ9A 1KD1O 1DTQB 5H9EK 2FJAB 1T8EA 1Y64A 2DT9A 2KVIA 3K5NA 3R2DJ 4JI3F 2YQ3A 4JI5K 2EEYA 2CVIA 1U26A 1V6HA 3PIPQ 5HVFA 1AA1B 2KKHA 4DTSA 2ZC3A 2R8HA 5AQFA 1JCEA 2CPZA 1Q86T 2HNZB 2Y1LB 2FVRA 1SKUB 5GAHI 4HHJA 3D66A 5BPLA 1FRMA 1EHWA 2B9WA 4H4OB 1V3SA 3ZTRA 2FZCB 4LIWA 4OL8A 3RRHA 1HHQA 4YOTA 3DYAB 1YBUA 2BH1A 4IFYA 4EO8A 2VQFF 3EZ5A 4FF4A 4ZOSA 3EICA 3NEKA 2KH9A 4WK3A 3TTDA 4DEZA 1U45A 3ETMA 1M1KO 2XHCA 3AH6A 3OVAA 1RAJA 3VQSA 4O4GA 1YIJS 2VFSA 4WFAQ 3M7VA 2XHWA 3D68A 3B78A 3SJHA 1VFJA 3CPWR 2B56A 3QQCD 3DGPB 5HRRA 2O8EB 4DX7A 3KDNA 3NS7B 2R7UA 2Q36A 3C8YA 5D4LA 4UUXA 2FC8A 4IDKB 2UUAF 4E7KA 3SNNA 1FKOA 3LAKA 4H0VB 2XSFA 3OBWA 2F4VJ 2PFDA 1WBBA 3CF5Q 3SQ4A 1TV6A 4RW9A 2RS2A 1XMOF 4OYXA 2P9IA 3H7HB 3LANA 2Y0SD 1CQMA 2F7VA 2EFPA 4DPUA 3EUNA 2W7PA 3NKYA 2LXUA 4NRUA 3ZX2A 4LH4A 1Q5YA 4DSKA 2YHAA 4OKKA 1SJ4P 3ENAA 3GP9A 1HNXK 2UVUA 4R8UA 3X3UA 3C66A 5IV4A 2G0CA 5BYRA 4U67Q 2UXCF 3MCMA 5DQHA 3TYTA 3EN9A 4LF8F 4BC4A 3KLHA 2XM3A 5A8KA 3RBDA 2DNPA 3M6VA 3LM2A 4UUWA 3MHYA 2VV5A 3QZ8A 2KLAA 4DF8A 1Q95G 4TNOA 4H0OA 2W9BA 4PUOB 3OTOF 4P2MA 1NU0A 2YHWA 5GAGP 4Q45A 4X66F 5KFCA 2ZH5A 4HWIA 3D0HE 5HATA 1RAEB 3RAMA 5LOQA 4GKJF 4AYBD 1OVQA 2W6LA 1KAYA 2FBTA 1XMQJ 4FK4A 4F3MA 2YNHA 1RABB 2ZVIA 4BWMA 1HR0J 4JI7F 2IJNA 1UAXA 3BQ1A 4LT6A 1IBKK 3CDAA 4LFAJ 1D9FA 1VRTB 1DFDA 3OJSA 4WK1A 4BRFA 3E8OA 1TK8A 3F41A 3PJ9A 2E9ZA 3HHKA 5GVQA 2UUCF 4Z7YA 1XJWB 4OLBA 1QD1A 3I8BA 2KVQE 3IMQJ 2V34A 1KD1T 4ZMMA 4DR3F 4NL5A 1EP4A 4ECUA 1NKEA 1REVB 1TUVA 4ED1A 4KBOA 2F8TA 3QFWA 3SMSA 3EJMA 1MU2B 2LDIA 3TU5A 4FPIA 3ZZRA 4JHDB 2LEAA 2M2BA 3UDEA 2E20A 2MZRA 2YH1A 3KVGA 3S01A 3SI6A 4M3RA 4LVNP 1PGZA 3DLEA 1Z4UA 1ZPWX 4L6V3 4P9SA 1PBUA 2XY5A 3EVWA 4DKWA 3AB2B 3C14A 1PILA 2Z2MA 1CZ9A 3CCUS 4M3TA 1TK5A 4PG6A 2MGZB 3M2UA 2AEJA 4B9MA 4FO0A 2H1YA 1JXEA 2IFXA 4B8CA 1M1KT 3VR1A 2ILZA 4QYZJ 3J7A1 1N5VA 3OUYB 3HPHA 1R6YA 3J81j 4YN3B 3I56N 2V4JB 3VF6A 4FM0A 2OTLN 3JAMY 3VVUA 2VG7B 3TUPA 3EEQA 1U1MA 1NSKL 4P2SA 4X84A 4KIAA 3PCOB 3G8QA 2JFDA 2AJ1A 4MFBA 5K14A 2E1RA 2F4FA 2ZH3A 3H42A 1S97A 2GCFA 4WZMA 4B3TK 1X3MA 3RW7A 4C6AA 2DHAA 4X4QA 1VRUA 2QLJB 2V6AA 3UN5A 3WEEB 2BANA 5B0EA 1NGJA 1GQEA 1K8KA 3KYLA 3LP2A 1J27A 4IBNA 2ZNYA 1TFWA 3G4SN 4QW8A 2OEJA 4D3GA 1JLAA 1HNVA 2CJYB 1YRUA 1DARA 3AD8C 3FRYA 4JV2A 5AQRA 1BY9A 3R6MA 3HVTB 3B4DA 2QLFB 1GMWD 4RBTA 1X4EA 3DLHA 3W2WB 2D0BA 1W7AA 2IMOA 4YS2A 2DNRA 2A40A 2M70A 2EC2A 3AO3A 3C19A 2GJ2A 1QZ6A 3AO5A 1M5PC 4QWEA 2UXBJ 4Z2XA 3ZZZA 3D0PA 3MCOA 3Q89A 1S0VA 3V81B 3DRRB 3MCNA 4LC9B 4WXWA 3RBZA 1PIEA 3CC2S 2H5IB 2AYGA 4FYXB 1MMNA 1M5OC 1QUPA 3P3DA 2GFFA 1B70B 2J8AA 2AJFE 1Y00A 2MKIA 4DU8A 3DM2B 1RT1B 5HL7L 2LEPA 2FUG9 1NO8A 4NLXA 3KWIA 4FW1A 5J2QB 3PIPL 3POTA 2JVRA 2OKQA 3C6UB 4FZYA 3R5CA 2O4IA 4NB4A 2XMVA 3GIJA 1DRZA 2E5LF 4IRKA 3ZSWA 4PL8A 5D4OA 5HMXA 1YIJN 2VQEJ 4B3OA 1TL3A 3T7ZA 3DLKA 2HHWA 3H90A 2C42A 2YKMA 5K9FA 1F21A 3JQMA 2HMPA 4P6QA 1EXQA 4MDAA 4IZ9A 4PQUB 2CRLA 4OX7A 2V67A 3VGKA 2PBDA 5KFZA 2M5YA 4MK7A 3QEVA 3D3BJ 3EX7B 4L73A 3TAEA 1KXPA 3Q7BA 5AR0A 4NXMK 1X0PA 4CHOA 5E2QA 2N7YA 1TAUA 2BE2A 2MQMA 3SSSA 3ULEA 2BMBA 5I9EB 3TAFA 5GADU 3SK3A 4KB1A 1RT3A 3G82A 3EVOA 2O3DA 3O9UA 5J2MB 1PO6A 2DHSA 1I3AA 1XHXA 4PXBA 5C2FA 1OS5A 3LGNA 2O67A 3UFCX 3OBIA 4Y2IA 2MHEA 3VQ8A 5J2PA 3NGIA 3THYB 4AH9A 2RMLA 3IBFB 3OHRA 4BRMA 4U67L 3W2VA 4FM1A 2RQMA 3SUQA 1NUEA 5CCMA 4DR6F 3HJVA 3CJKA 1CG2A 1FO1A 4KSEB 3OHAA 3TANA 4K2JA 2LA4A 2PAVA 2UU9J 3EGNA 1RTZA 1WNSA 4MLEA 3ULHA 4I1TA 5F41A 1U7LA 4OPKA 3HVWA 3O3GA 4PY5A 2LKZA 4TU7A 1M1GA 4BHQA 4OJ3A 3CT9A 4UOHA 2KXFA 3AO4A 5KFSA 5AZIB 3BGRA 3HD1A 3EPGA 3HBTA 1A5VA 3K89A 3HPOA 1OH5A 4W5OA 2JEGA 2WC9A 4DV0F 5HSPA 2GC8A 2YHXA 2NYIA 3R5DA 3LWLA 2P9KA 4LF6F 4OZJA 4O23A 2L08A 1I94K 3CCUN 4ZDNA 1NLKL 5HK4A 2AYBA 1A9NB 4I69A 2QTDA 2ITMA 3ZSXA 2B8QA 3OLBA 1FHTA 4X62K 2Z56B 2IDLA 5E3PA 2MJUA 2FBVA 2V0NA 4B3RJ 3D1OA 2FVCA 4MO4A 2JJ4D 1AXQA 3H1VX 2KHOA 1RWKB 5DLFA 1CS4A 3GJQB 2EKNA 4USJC 5KQ8A 1RTJA 1HW9A 4B1WB 4HEA9 1KHWA 3ZT4A 3CXCR 3J81O 3TEHB 3V6DB 2P9EA 4UY8O 1VSDA 1SC4B 4LD0A 1XN9A 2KRBA 4M3UA 2HSTA 3GB0A 1UVMA 3VEXA 4RW8A 1IR2A 2DNGA 3IM8A 1NGGA 3EM1A 4NPOA 2O8FA 2PO4A 3MX5A 4BRAA 2BTFA 3ETOA 4LFCJ 2B5JB 4USKA 4FJNA 2HSEB 4NLPA 3CJTA 3O5TB 3ZO7A 1C1BA 1PJ5A 5BR8J 4LF9F 4LF5F 3M32A 2OPQA 3CJRA 4PUOA 2DGSA 3SQ2A 4DV2F 5JXSA 2R42A 3FK4A 1HX1A 4M5NA 3SQ0A 1N8RO 1U1LA 4BG9A 3NMRA 4KFBB 3V9ZA 4C8LA 3CJ9A 3CC2N 2VFVA 3HKZD 5D6GA 2GQQA 3C15A 1ZPVA 2N3OA 2CJQA 5KPZA 2Z1GA 2G8HA 4CLPA 4C9DA 4CGFA 4LRBA 4NXNF 1DKGD 1U09A 2XI3A 3RAQA 2RHKA 4ZP8A 1IR0A 4AHTA 2B6AA 1XBWA 2YX4A 1F6TA 4PA1A 2ATQA 4AE5A 1BA1A 1KOOA 3NGSA 2HFUA 1C0TA 4ZLPA 5MLCV 2QG9B 3VHQA 3TAMA 2NRRA 2XMWA 4PWUA 4OZNA 4UF4A 2HBLA 4AQYJ 3BJYA 1JXVA 2R7SA 2RHSB 5CYMB 1M0SA 1QQMA 2V5HG 3AJDA 5KG6A 5F3ZA 2BRLA 5M2UA 3MK6A 2CG4A 2MSSA 2XULA 4OZ3A 2WTFA 3KHHA 3DOMB 4IWVA 1YF5L 4RW4A 2HZVA 3EKSA 2P9NA 3OFGA 3RG6A 2Q66A 5GAHU 1RAFB 4C48A 3Q23A 4K4VA 4X64K 2ZE2B 3P5TL 1NU4A 3MAAA 4DPWA 3AGRA 4HVZA 3HHLC 3UNYA 4EUVA 3EVMA 3QSYB 1WSGA 4ALZA 3D2EA 1WG4A 1CC7A 1IBLK 1WDDA 3R27A 1S4FA 2M0GB 1Z2LA 4CLSA 4BBYA 1RCXB 4JB8B 3HSJA 1FF2A 3DN9A 1IM4A 5C5JA 3HHNB 1FD2A 3VV2B 4KYZA 2D3O1 1H73A 1HWIA 2Y1JA 2BKOA 4EU0A 2YWEA 1XR7A 4OMFG 1CPZA 3C3LA 3CCQS 2X51A 1FK9B 4Y0FA 1FJ7A 4G6VB 4NI2B 4Y1DA 2Q2RA 3SV4A 2JSXA 2VGMA 4MKYA 2NS1B 2KHDA 1CLQA 4UY8T 1RBUA 4I7FA 2WBRA 1FJCA 5C12A 3M6UA 5KFAA 4M8LA 4AD6A 5KG7A 2RKIA 2BUNA 3K7RA 2UUBK 2YVSA 2OI2A 2Q31A 1LW0B 2A18A 4DOZA 5KG0A 3VQ4A 4DB3A 2DKOB 2G0JA 4WU3A 3GE1A 2E9RX 3N4QA 5KFXA 3KK7A 1GXLA 4EFHA 2EK6A 1N52B 3QMQA 2DVIA 3W2WA 3MR2A 3V6HA 4Y2CA 3ZETA 1VQNS 4ECTA 1JLFB 2KHCA 1SC6A 3T1YJ 2OPPA 4LMZA 4CLFA 2BKNA 1Z6RA 2XBPA 3KLIA 4ZVRB 2ASPA 4FLVA 4MLHA 2FC9A 4DQPA 1AFJA 2KU7A 4AHCA 1HKGA 3MM7B 3CYMA 1N8RT 1VSHA 4H03B 4L76A 1UFWA 2AYEA 1F5BA 2J76E 4F4KA 4TN2A 2C3UA 4BC9A 5J1EB 2VG6A 2PD1A 2ROPA 2BV3A 1LOTB 4YNQA 1T05B 3DU6A 1OH6A 1NH7A 5D3GB 3B82A 4A8OA 3LDQA 2IY5B 3WZ0A 1I1GA 1PSDA 3A4TA 4KAIA 3R5BA 4OKJA 1UCNA 3MAQA 2BJ3A 4I2QA 4BR4A 2YJEA 4HHUA 4K25A 1HNWK 2QWNA 4M5KA 1V9OA 2NZ4A 1Y9OA 4MIBA 5IT9Y 2G13A 4AF1A 4JUZA 1K1QA 1N32K 3N5FA 3G6VA 4N77A 5T7LB 2FHMA 1WKLA 1KR4A 1NK9A 1P8ZA 4CDIA 3HZEA 3UWTA 1JB0C 3F0NA 4PG8A 3QB0A 4DV3F 7FDRA 4FLXA 3OL6A 3M2RB 4ZK7M 5K8PA 4ED2A 3LH2S 2GW8A 2ASMA 1U48A 4JS4A 1XWLA 2Q6CA 3IWXA 2QWOA 3AA2A 1ICEB 2F4VF 2V2ZA 1PJ7A 3AXKA 3AAWB 1ACMB 4HYKA 1C0UA 3QIDA 4OI4A 1N4LA 4NMXA 4JI2K 1Y97A 3T1HK 5A2QU 1BL3A 2MTLA 3DXKB 3AXMA 4NLWA 4ICLA 5LM7E 1KRPA 4WKYA 4EYHB 3FVYA 2HLTA 3HYFA 2NCKL 3U7JA 3G96A 2GIRA 2QWPA 4L8RB 3OXFA 3I5AA 3GFXA 3N6MA 2CQGA 4KGZB 4IR9A 1WACA 1HPZB 4K5SA 1LNQA 4OZ1A 1O13A 1D0EA 3V2UC 4K4YA 1VQPS 4E98A 2DGVA 3LDSA 4M63C 1VLYA 1BIZA 4J2EA 3IM9A 1FKAF 2DH7A 5C15A 1H2UX 1XMQF 5C0YA 1Q7YO 4LFBK 1DURA 4WTYA 3W66A 3TX0A 4E1NA 1WORA 1YJVA 2W6KA 3NGTA 4LFAF 3BPSP 1T3VA 2HQ3A 2VFRA 2DNOA 1N6QB 3D54A 2NREA 4HTLA 1X7VA 1WOOA 3NCRA 1LWEB 2AIRB 3CDEA 1G7CB 4RW7B 4ZIWA 5IM0B 2D3ZA 3PYGA 2EW9A 3QLHB 1RT5B 3NGKA 3SAHA 2HF4A 1GEHA 4O8UA 1UJ5A 4CLKA 5ELZA 1SCJB 3DLGB 4FDFA 4URSA 2DY1A 1NSQA 3PACA 3AAQA 2M88A 5LMNJ 3ET6A 3MR7A 1OPIA 2FC0A 2D0AA 3K9KA 2DH9A 3MUVP 3DOLA 4ILRA 2XY8A 4A61A 1H3DA 1HHSA 1QE1B 2AJ0A 2KG0A 1J54A 4CZLA 2PC6A 1RFQA 4DV1J 5I42A 3PZPA 3NAEA 1S6PB 1KDNA 4ERDA 3PEJA 3CCQN 2AP6A 1NJZA 3BP8A 4UY85 3VN5A 1VQ7S 2NUHA 1XTZA 2QXLA 1HQEA 1Q4RA 2D0PA 1CBKA 5KOXA 2WVEA 2NXNA 4CFBA 3D6RA 2QA1A 1RTIB 2XWYA 2J0SD 1NJWA 2RDIA 1MMLA 3R2CJ 1FXXA 4RTFD 3SPZA 4TU9A 1DTTB 5CH7B 2D3OR 2I1RA 3TSQA 2Y3YA 3HSTB 4DV5J 3ZTQA 4JI3K 4N47A 1NZ8A 2QWRA 1SUQB 3W5YA 4E89A 3W8GA 1SL0A 4IH6A 2M52A 4CEDA 4CJKA 4IOAQ 1HMVB 2ZWPA 3NAHA 2XWXA 4OLAA 2E29A 4M5IA 3HM9A 3GR1A 2KXHA 2YI1A 1S77D 1G6BA 1VQNN 1SC1B 2OD4A 5GAGI 1XEZA 4WYBA 1X60A 5I3QA 3TA1A 3WC2A 3ISND 4FJKA 4E7LA 2VQFK 2YWWA 3AD9C 8RUCA 5LMUF 2ZHBA 2YKNB 1XNRF 1ATSA 3Q8UA 2NRZA 4DTRA 3OW2M 2CGKA 1XMBA 2HOEA 3P39A 2GMLA 3UD4P 3H0PA 1KOHA 1B64A 3K0SA 2PFFB 3THWA 3AO2A 1FWKA 2UXBF 4F25A 3C94A 5J2NA 1B92A 2HYIB 1LK7A 1P9QC 3JXOA 3MDFA 3GG0A 1RT2A 2K7JA 1T94A 4IG3B 2Q97A 5GINA 4TSXA 4ZVGA 5KT6A 2FJVA 1C1AA 3OT9A 1S6UA 2UUAK 3GL1A 4PYDA 3FEXB 1U8SA 3PY8A 3OR1B 4P10A 3MR3A 1JXLA 3GV5B 1Q7YT 4DV7J 1IKXB 3AY0A 2ZJQQ 1XMOK 3BBBA 5DDRC 4C98A 5EU7A 1RA6A 2MLXA 4CM0A 1WTBA 1VBZA 2DGQA 2LMIA 4B02A 3LP0A 3ZXWA 4CTAB 1YVFA 3NVKA 1H7WA 1GOAA 2HBMA 2J5AA 1HNZK 4ILJA 2DGTA 2VQEF 4O0JA 1BUXA 3ZZYA 2GJFA 2UXCK 1X9WA 4H4MA 1WC0A 3NNAA 4LF8K 3OY9A 4KRFA 3SCXA 2HBQB 2DHHA 2CXEA 1U1NA 2HNYB 1JL2A 4JK7A 4YOYA 4L3NA 1YKWA 2B4VA 2ITGA 2MZJA 1GT8A 1F9EB 2W9AA 1TKTB 1NLVA 4X66K 2DO4A 2XY7A 2DHXA 1JJ2M 4B9NA 1NMNA 4MH8A 1BWVA 4O3OA 4GKJK 1XK8A 4DL3A 2IM2A 1YZ7A 5DM6Q 2D7SA 5DDOC 1RNHA 1RDBA 3OS1A 3L95X 2RH3A 1R8HA 4M5GA 4RO0A 1CJKB 4LUBA 2JEJA 1OO0B 2J9EA 3D5MA 4BQZA 1ZBIA 3RJMB 4EP4A 4JV5K 5EGYA 1HIYA 3DOKB 2PDAA 4CH7A 3ZSVA 2XC9A 1FEEA 2ZH7A 3PRVA 4PZVA 2FY1A 3GZ7A 4PG7A 3NNHA 4HL9A 1QSSA 3B6OA 3GTYX 3C65A 4WFBQ 1VQPN 5KG4A 4FS1A 4DR3K 3N6NA 4NYPA 3UPFA 3HRGA 3E9LA 4CEZA 4OHYA 2HS0A 2FXUA 4CFCA 1X4DA 4O44A 3UDVA 3G2XA 4RW6A 1PAEX 2G2OA 4CIEA 5BPMA 4CJ7A 5RUBA 4V19X 2DGWA 4QS7A 4HI1A 3W65A 3BO4A 2NRWA 2HVZA 2UU9F 4KR0B 4FKYA 1GOCA 3BGOP 1JIHA 5F0WA 2VU5A 5HMZA 1G2EA 3VEVA 3OYNA 1Q8LA 4AHVA 3D2FA 1KNZA 3PO5A 1EETA 4JKGA 4I0WA 4G1QA 1GMWA 3MECA 1WI8A 4QIFA 3MR6A 2OIHA 3TAGA 2KKZA 5FPDA 1T7PA 1WC3A 3HSCA 2K2PA 3FCHA 4M5LA 1T05A 1OIAA 3I96A 4D3HA 4IXCA 4K2XA 4FJ5A 3LDNA 3ITHA 2QL7B 4UOGA 3TEGA 4U7BA 1RWNB 2ZD1A 4AM7A 2ZH4A 2J0QD 4NZ6A 1WHVA 2H5EA 2MY8A 2VDIA 4DJBA 2LFVA 1J5EJ 5B7WA 3R3LA 1RTDA 5EHHA 3BREA 1C1CA 2C2KB 4RUBA 2RE1A 3AT1B 4CZJA 2U2FA 1DEJA 5HAOA 1YG0A 2XS2A 3AJ1A 1YLXA 5T7LA 2GVDB 1D5AA 5KT3A 4NLTA 4JRQA 4CJPA 1VQ7N 3E01A 1VRQC 2NUUG 2G1DA 1P6TA 4E7IA 3W62A 3BO2A 3D3CJ 4U7UD 3R9PA 2O8CB 4RJVA 3WT0A 3HXMA 2CPIA 1S6QB 2MKJA 4MK8A 2CJ9A 3KHGA 4DR2J 3QICA 1KVIA 3NBPB 1ATNA 2O1PA 2APOA 3FZ2A 2NR0A 3OJUA 1W0HA 2QA4S 2CDQA 1HNIA 3O2IA 4W5QA 3HVRA 1VSFA 4OJ1A 2JC1A 5E26A 2DNLA 3V1OA 1SJ3P 3RU0A 3Q0AA 2VONA 1RBOB 2QW9A 4M5DA 3E2EA 4BGAA 4WFNQ 1WHYA 1RHRB 2FSNA 2VPXB 4LFCF 1V5VA 4DMNA 3IG1A 4IOAL 1SKRA 3SIPB 3W9IA 5T14A 5BR8F 1NCLA 2QYGA 1S1TB 2IVFB 2IBKA 4CCHA 4IO1A 2ZKTA 2DGXA 3T5JA 3CC4S 1LOUA 3DHXA 1T9YA 4NMLA 1B9FA 3MM9B 3C0BA 4WQ4C 1K9MO 1B99A 1IKWA 3PG9A 3IRWP 1IH7A 5F9NA 3C95A 5L8RC 4MYUA 2R7XA 4C3MA 2HNDA 3K5PA 2HFNA 5HVHA 1NJXA 3HI0A 5AQYA 4USUA 3TSUA 4IG0B 1QTMA 1GX5A 4XH1A 4RUAA 3KJQB 4OIXA 3RMAA 3FFIB 2R2RA 1BGXT 2E7WA 3KG0A 1C0MA 4CF2A 2IM3A 4WP8A 2E2OA 2YX1A 1NDCA 4FPRA 1RT5A 3DI6B 4GVEA 3GIMA 3MEGB 5TKYA 2ZJQL 3I0RA 4AQYF 3NH2A 3D1QA 5HROA 3WC0A 3R6LB 3FBCA 4ZIVA 3VOVA 1E3MA 4FJ9A 3OSNA 1IWGA 3WUHA 3CSKA 4GY2B 1WNEA 4OYOA 4YFUA 4X4PA 5F8IA 3IC1A 4MIWA 1QAJA 3EE9A 3BSNA 5M1OA 3B54A 4OYZA 2A1BA 2QLWA 1KQSR 1T3OA 1ZXOA 5CD4A 2LQBA 2P9GA 2Z30B 1DQ8A 2EFNA 1RBRA 4DR6K 1ITGA 5HP1B 4LRFA 2C3PA 3LL3A 3M6XA 2KZZA 1BU6O 1QHTA 2HRYA 1CJUB 4RR5A 1RHJB 4KHNA 1NRKA 1S1WB 3SQOP 2HBKA 3BQ0A 1HBMA 1UA1A 1TKZB 2ALYB 2VH7A 2VZ9A 2NPFA 1BI4B 5LL6d 2Y9HA 1EQMA 5B0GA 3RR8A 4XDDA 4ITSA 3OVBA 4X4VA 4DUYJ 1RTIA 3VZIA 2X1GA 1SV5B 4ANEA 2VBXA 3VPZA 3BN7A 3MDQA 1C2PA 3HD2A 3AVCA 3TUZC 4V1Ak 5L46A 3R7NB 2A3JA 3SV3A 2QX0A 1SUQA 2W24A 3LTOA 2MHNA 3QGHA 4OX6A 1MSWD 3IS9B 4K7QA 3PW5A 3TVZA 1GTHA 1LWCB 5KFEA 2K1RB 2ADBA 3VF2A 4DV0K 3VAMA 4DHVA 1IKVB 4WFBL 2VKZG 4JI4J 3KOAA 2G8WA 3IWNC 4LF6K 4GMJB 4JI6K 1K44A 1E4FT 1RT6A 4DLGA 1QVFM 1OVYA 3PIOQ 3AHPA 4CLYA 4BVPA 1EZZB 2VDHA 2NZCA 3EWGA 5AJ3J 2HHSA 4DSFA 3ENOA 2V94A 3CI5A 4DI6A 2IC3B 3M8RA 4ZPWR 3SDEA 1WBDA 4JI5J 1YTAA 5KFIA 3T1YF 5BRHA 4XDCA 5C24A 3LGMA 3G71S 1BD6A 2WSFC 4OPAA 3MN6A 4KH4A 5F8NA 2XNRA 5IS2A 1XNQF 2PE8A 4JEPA 1NH8A 4B1VA 2CPYA 3W3DA 4C0HA 4ES3A 1BQMA 3NXZA 2VA2A 2UUWA 1K9MT 2V8DA 3QFPA 4DSEA 3CCLS 1RDDA 5D4NA 3TZXA 2I5JA 2WVCA 4OJGA 4O8KA 3KD1E 4M3WA 3R6GB 3NCPA 1QAYA 3MMBA 3UI3A 2G8IA 2A10A 2VFUA 4F9OA 4ZITA 1UVKA 3OR2A 5DZ7A 2GMHA 2L3MA 4U95A 4S0MA 2GV1A 2VBZA 4DUTA 4IYQA 3ZEUA 4RPFA 4H0XB 1SQKA 3VQPA 3FFKB 5ETVA 2Q1NA 2FB0A 3SAGA 4N56A 3MMAB 1NGIA 4CO2A 2FJWA 3K58A 3FZBA 4LF9K 4LF5K 3RUBL 1HBUA 3VZHA 4YB6A 2OO4A 1R0AB 4OKEA 2EXUA 2CG8A 3TQEA 3M2VA 3JSMB 3GJRB 3SUPA 5D15A 4UTGA 1H1VA 1UJ4A 1RUSA 2QA4N 4AXIA 2HK3A 4O3PA 3WQPA 1JLBA 2CFXA 1VK3A 2FJDB 1A5XA 3GIKA 4JI0J 4B08A 2FVPA 2MPUA 1WELA 3BH7B 4KY3A 3CQYA 2ASJA 2VIHA 1VQOS 4Q0BB 4NXNK 4N76A 3CCMS 5EWFA 3WNGA 3K59A 5C25A 2F5GA 1JJCB 2P5GA 1CJTA 3K17A 4OJHA 5KAKA 3LPUA 3KWMA 4ZVFA 3QMLA 1YVUA 3P4IA 5HRPA 4RUHA 2GVZA 2O4GA 3CG7A 1KKHA 4CJSA 4C7QA 4FP9A 2R7VA 3CC4N 2VICA 2NLXA 1S0OA 2FTRA 3WQTA 2V63A 3DMJA 3G86A 5LT5A 4WFNL 1N0UA 4HUFA 4OGCA 2POKA 1U1QA 4B9QA 1OQ3A 4YB7A 2JZ5A 3PW2A 3M4XA 5D77A 4CLTA 3MTKA 2AGQA 4NCAA 4MKAA 2W25A 4ZP6A 1IBKJ 1Y5LB 4LBHA 4QS9A 3SCLE 1S9GA 4CBWA 2NRTA 5MLCQ 3BBCA 2LU2A 3KJFB 4ECSA 3ILOA 2MYFA 3LO3A 2M8DB 2P5VA 4LREA 3FKBA 2ZQBA 3LWMA 8AT1B 4CZCA 1LW2B 4ZPTR 2CQDA 1Z05A 2V8HA 4ISEA 5GAGU 4W90B 2MZ1A 1WHXA 4ZTFA 1WC6A 2PMZD 1QY7A 3TAQA 2CA9A 1J2VA 1L3KA 4Y00A 3AVHA 5KFQA 1YBTA 2DJWA 4XPEA 3KUHA 1GX6A 2PN6A 2BE7D 1N36J 1N34J 4JKCA 3FMWA 5JMVA 1FVQA 3I9ZA 3QINA 1RBAA 4LR7A 1SI9A 5AQJA 2D69A 1T6CA 4DX8H 4KH5A 4ECWA 1B9DA 4EHUA 3OYJA 2DXDA 2QMXA 3JAMO 3CJQA 4B9SA 2L9WA 1FCAA 4H5VA 1FDAA 4BR7A 2MQNA 5H9FK 3KFWX 5LMNF 3FUYA 1QUVA 2WBNA 1MROA 2EG1A 3AVFA 3TJ9A 1E6VA 2O8DB 3DGVA 1W2BR 5KFVA 4CLZA 5IT4A 2QWMA 4CBXA 5CABA 2KFYA 4WE1B 4RBUA 1EWRA 5HQ8A 4DV1F 2RF2B 3UDCA 1W7WA 3CD7A 4IOXA 2AT1B 3SQGB 2RQ4A 1X9SA 2SXLA 3DCAA 4DZDA 4M7YA 1WC1A 3QFHA 1MWYA 4F67A 3VQ7A 2QN6B 3WNHA 5SUHA 3M1VA 3RMCA 4KI4A 3SUNA 4DCOB 3M8QA 2IRXA 2F96A 3L7PA 1RT7A 2O5DA 4DV5F 4ZJQA 4RNMA 4IOCQ 4BC2A 1J9AA 4IJNA 3FQLA 2CQIA 3M6GA 1PC5A 1H0HB 4KKOA 5KPRA 4CO1A 2DIVA 3RAXA 3T9NA 3V6JA 5I3UA 1B7YB 1RI7A 1WI6A 3VEOA 1KBRA 1RQ0A 3JS9A 3IN5A 4KH0B 2OHDA 2P9UB 4NLBA 2M9KA 1JK9B 2V4RA 5CXTA 4RCHA 3G71N 1S72S 4C2MA 4W5RA 4YP3A 1NAQA 2UUTA 2DTUA 4ISGA 1SL1A 5AFUA 4F50A 2ZGZA 2FJBB 2QRRA 2ZFHA 3LAMA 4QWCA 3W5ZA 2ZGYA 4CLWA 2GX8A 2JWLA 3PO4A 3CCLN 2J6SA 2IRYA 5AZJA 4DV3K 2XCAA 4LJMA 4GC7A 1J5OA 3IA0A 3FGVA 3FSIA 2CUYA 3AARA 3BF3A 1KAXA 5D0EA 1BCOA 1TKXA 2HVDA 1GFWB 4QR0A 2P1JA 2F4VK 2D5RA 2X6SA 1B0PA 4ANDA 4ID1A 4DV7F 2BJ7A 3VQAA 4Q44A 4CHYA 4C11A 4OYBA 3QT7A 1QAXA 3ATUA 5C2GA 4DU1A 3NWGA 5JMNA 4IQMA 4K0KJ 1TTHB 1ZYQA 3KDOA 5DS7A 3QRPA 2F9TA 3L2QA 4O0NA 5JJBA 5AQGA 4ZCLA 3ENWA 5AQLA 2ZJRQ 2UVVA 4CEOA 3MM8B 4HHTA 4KHPK 2P5OA 3VVTA 3UR0A 3U8XA 1DAXA 3BH6B 4ZVPB 3AQPA 4JI1J 2HQFA 3SCIE 5HP1A 4O3NA 3SSQA 3NGDA 3GSDA 1YTUA 5KT7A 3WBZA 4I6AA 4IFVB 2AD9A 1VQON 2BJDA 3CCMN 4B1XB 4N8OA 3S1TA 4NA1A 4K4UA 4OI6A 1PJ6A 4FJXA 2OPSB 1ATRA 4ZJLA 3Q22A 1XMQK 5IZHA 1OJ4A 2HVIA 3EDQB 3SEOA 2AV5A 1U0HA 3HHDA 3V9SA 2CWXA 1X31C 2MKYA 1HHTP 3QPIA 3V1QA 1N5QA 4LFAK 1V5IB 3KLGB 3TZYA 2NUBA 1CULB 3PYFA 3OYMA 3OYFA 4FJIA 3IUCA 5D0RA 2UZAA 4F7VA 1IN0A 2HHHF 4C8NA 1OSCA 1GTEA 3TP2A 1LXNA 1RE1B 1EKSA 4FF3A 1X8DA 1CEZA 3DWLA 1IKVA 5KG1A 2IVMA 3KLEB 4FWSA 2Z58B 3G6XA 3NFAA 4OO1J 5C42B 4GVBB 5GAEP 4F4AA 1Q82O 1S6OA 2E6MA 1UL3A 1M5HA 2AZ1A 3AY9A 4DSLA 5ITHA 3UKUB 2EK1A 1JNRB 1HBOB 7FD1A 3P96A 2NXEA 4WQ5A 1Q79A 3HK2A 3J80Y 2W7OA 1RBTA 3PRBA 1TAQA 5U47A 3NE6A 4DG1A 2FPHX 4NWBA 4UQTA 1URNA 2KM8C 2JDJA 4DV4J 1LV5A 3UE5A 4CO3A 3I0SB 3WXKA 4MIAA 3CJSA 2AEFA 1OYEA 3GWCA 4QAGA 2MKCA 1VQ4S 3JTNA 3VQ6A 1EARA 2CQHA 4V19S 3WX4A 1IM6A 3HFVA 1F5CA 3DDNA 5BYSA 2GIQA 2MSTA 1FFGB 4HACB 1I94J 3HL8A 2ZWOA 5F0UA 5KG5A 3TAPA 4BR9A 1RHUB 3ONQA 1S1UB 4UT4A 4I6MA 3V4MA 4BE2A 4ZP9A 1LWFB 1F2HA 3E9OA 4IO9L 4QIGA 2EFVA 4PXEA 4GKKK 2QL5B 1J5EF 5LXRA 4KTWA 1U25A 3QAEA 2ZJPQ 4ECYA 2EHGA 1Q8IA 1L3UA 3QWUA 2YWFA 3C16B 1NPRA 3VQDA 2A6MA 5IWAK 2ZH6A 1LFPA 3F2KA 3L09A 4ED3A 4EBCA 4C8YA 1YAGA 2BXJA 5JVGQ 1M90O 3KHLA 4JYAK 5CE3A 4PWDB 2KT5A 2R7QA 3JSMA 3P1GA 3UIQA 3AB4B 3SYZA 2YHYA 1NGCA 4N5SA 2Z2LA 5F8MA 1H2TZ 1ZM3A 2FBXA 5LMUK 3BEGB 3TJ8A 1XNRK 1KVAA 2E5GA 1BHNA 2JVOA 1RB0A 1YJ7A 3Q8VA 1RXOB 3QT6A 1YT3A 1T9UA 5A8RB 4DR2F 4Q0BA 2YX6A 2UXBK 3QRRA 1X1PA 2ZDPA 1RKIA 2BR0A 1NSPA 4CJFA 2KYZA 4YQWA 3LM9A 2CJBA 4CO4A 1U2CA 4K41A 5EDWA 2ADCA 1RAIB 4RNNA 2BDPA 3K0JA 1KN6A 2GX9A 3ZTPA 4H5RA 3BZCA 3BGUA 4Q7AA 3LZJA 4LF7J 5AE2A 2E88A 2A1RA 4P7TA 1S72N 1HYSB 1RLCL 2A3ZA 4J9KA 4DTUA 1ZZFA 1S76D 3K8WA 3UCGA 2IA0A 2MQLA 5AQMA 2BOPA 3Q8YA 1U2VB 2BQUA 4BRPA 4ZKAA 3LUYA 2Q79A 3DXMB 2ZM6K 2RB7A 2VQEK 2OMLA 1WSHA 1QDUB 4JD2A 3PEHA 5A0YA 4DQ8A 4DS5A 4XH4A 1UPMB 5L39A 4ID5B 2DPIA 4ECQA 3FNNA 4OI2A 1T03B 3U1MA 4ED5A 1DT9A 1Q82T 4DN0A 1DJ0A 3VQQA 2L9NA 2P6SA 2IM0A 4CF9A 1O1WA 5H1SV 3GQCA 4LH5A 4QJVA 3AQOA 3C6TA 2D0CA 3ID6A 5LL6Z 3MXHP 3CJ4A 1HARA 5EVZA 2A1SA 3KK2B 1RT4B 2ZH2A 1TYQB 2FSKA 4W98A 1GH8A 2GA7A 4DL6A 1HFEL 3GCWP 1Q16B 3KLVA 2JH3A 2P2CB 1ZM9A 3UKRB 5HBMA 4F3TA 5EX0A 4ELVA 3Q8PB 3FEYB 2IBOA 3RMDA 3PV8A 5ETNA 4A2AA 3MXMA 2P9PA 3PJWA 2RPIA 1BQNA 2JWNA 2Q6BA 5HRSA 4A2BA 1TGOA 3A3PB 4JKDA 4H5WA 3QRQA 3C46A 4CZIA 3FZHA 3U02A 4CJ4A 5SWMA 1HD0A 4X64J 3VESA 1NB7A 2DFEA 4NLGA 3CMAS 3FE1A 4CK3A 2QIFA 5F1XA 1V3RA 3QO9A 3L6QA 3LPEA 1KLNA 4WYWA 4OX8A 2RRAA 3T9ZA 2W4CA 2Z2YB 4L74A 4NEZA 3W60A 4DTNA 3ENVA 4CGHA 1BQXA 2G2ZA 3QT8A 4USWA 2HVEA 3DDKA 3AVMA 4IO8A 2UU9K 1Q9YA 4HR2A 1RWXB 4DR1F 5AE3A 2VL1A 2G8FA 1AYEA 2VB6A 3WXIA 1M90T 2HGMA 3RSEB 4N7TA 3Q8QB 1YJWS 4O0IA 1UFKA 5LJ5Y 4CI0B 4DV6J 2OPRA 5AQTA 2WW4A 3ZZTA 4CLLA 4PPDA 5E3RA 2XS5A 5L9NA 4KV8B 3RW6A 1Q8KA 4FJMA 3ZSZA 3HCXA 1N56A 2WONA 1T11A 2NYHA 2G8VA 5ETLA 3R1XA 1ZS6A 4LBPA 5DZ6A 2C2OB 2CPEA 1P9YA 5HN0A 4J9UE 2GAHC 3L3CA 4B3SJ 2E1PA 3Q7CA 4AXJA 2W9CA 2CNKB 2ETJA 2UXDF 1LK5A 4CZKA 1JLQB 1VQ4N 3THXB 3L9ZA 3U3YA 4FYYB 2ERRA 3A5LC 5AJ3F 3H2VE 1TUUA 1KTVA 4CO5A 3FCWA 5IT9O 2M3DA 4PCQA 1FFSB 4B9VA 1HBNB 2BUPA 2OAUA 2E2NA 4RBVA 5FRNA 3DNCA 1N5YB 1VK8A 1S1XA 3HI9A 3UVJA 3HP9A 2HFSA 2HS3A 2P8IA 3BO3A 4DTXA 3R5AA 4CHZA 3CC7S 3PHTA 3C7NB 2XYHB 1YJTA 2ZDOA 3M6WA 3VF0B 4BR0A 1JKHB 2YY3A 1JMTA 2GQ2A 2DGUA 4NLQA 5EY4A 2FJXA 1N32J 1MNEA 2KXNB 1HI8A 3U1LA 3MUTP 2FQQB 2MLYA 3OFEA 1E6YA 3TRGA 1VMBA 1RLDA 4CT9A 5BPNA 1CXQA 2EFOA 1GLLO 2KT3A 4WP3A 1TUYA 4USHA 3KG4A 1JLCB 1NPPA 5BR8K 1RADB 2GGPA 4A8SA 3C6HA 2BYCA 4FOIA 2LXFA 3PXGa 4BQLA 3UN2A 3IXQA 1I6JA 1YJNS 4N41A 4P2XA 1BMQB 1X5PA 3CJ1A 4Y28C 3NCQA 1L3TA 2AWZA 4KTQA 3JYTB 4HTJA 4ZPDA 3MXIA 3ZZOA 4JI2J 3T1HJ 4PXDA 3M8WA 4JI0F 2K7KA 3SZ2A 3WHIA 5EN1A 4KO0B 4OVLA 1UEKA 2HFZA 4AUKA 2RRNA 3BKFA 4FJGA 4IUFA 4KC5A 2L41A 2NRVA 1HKAA 4CFAA 1APSA 2ZZMA 5HANA 4Z4EA 2LQ5A 4KGXB 3KK1B 2QA2A 4BREA 3ULDA 4A8QA 2BM0A 3KLEA 4LSZB 1MG7A 4I67A 2O66A 1U04A 4FBTA 5BREA 5L1IA 3TWHA 3DLJA 3Q86A 2AMCB 1NGHA 1UETA 2B4JA 5AQXA 2XZTB 1F5AA 3FSYA 4DTOA 1WHWA 1JJ4A 2I6WA 2QV6A 2QI2A 3R1HA 5KFPA 2B4OA 4LR9A 1AZSA 5E5NA 1NGDA 1IBCB 3DRPA 4DHYA 5F8HA 2PMWA 3MMCA 3ZTSA 2DNZA 3PX4A 3DLBA 4MTPA 4AHRA 1NDKA 2GZOA 2XSJA 1R8BA 2YKOA 3B8HA 4X4RA 4A62A 3AGKA 2DR6A 1O5JA 4BC7A 3MEDB 5T7BA 3B8AX 2OMOA 1N34F 1N36F 3SBGA 5KG2A 3HHLB 3HSZA 4M5MA 2NPIA 3CMAN 1GXTA 4C1NK 4QWAA 4DUZJ 3M30B 1Y4ZB 4WF9Q 1MWQA 3K5MA 3FJ2A 1MN7A 4CLUA 2XZWA 2W2QP 3TQ1A 5KFJA 2G8KA 1IVZA 4R5PA 3J7YP 4NCGB 1N54B 4U8VA 3EMTA 3MPVA 1OMSA 3QIPA 2LQ8A 2VA3A 4YOUA 2B3TB 1FXDA 1ZC6A 2MKSA 2O8BA 3QYYA 5HI7A 5MAOA 4PWDA 2MJNA 4ZVOB 3MF5A 1ZM2A 4M45A 2RHQB 1TMMA 1G3OA 2C22A 1YJWN 5HVGA 2C2NA 2X3DA 3M8PA 2E5JA 2CJAA 1IO2A 2QK9A 4ETXA 4GNIA 4ZVQB 1VQMS 1S0NA 2VOPA 1K0TA 4NLCA 3O9SA 5FD1A 1N0VC 4BRIA 5HLFB 4X4SA 1TVRA 5CR4A 4MK9A 3CJAA 1GNKA 4IR1A 4YR0A 3CIMA 4I2PA 3QSIA 4NASA 5EOYA 5CYQA 1DZ5A 3T1YK 2OFHX 3RBEA 1YWXA 1T3NA 2GWKA 3ZSYA 3EZOA 1T02A 1RTHB 1CJVB 2WB4A 4G65A 3G6YA 2VPWB 1XNQK 2LP4A 3A2FA 4IKAA 4W92B 5KRTA 3MEEB 3O9QA 3N28A 1D8YA 2HPUA 4XH5A 3PRDA 5IOLA 4NYOA 1TL1A 4M42A 1U1KA 2VQFJ 1NG9A 1FT8A 3ZSQA 3RR7A 1BE4A 2AU0A 2XCPA 5DMRA 4HUGA 4F4XA 4NX9A 1EX8A 2RSQA 2BKPA 3CQXA 4IKFA 2IVNA 3CMQA 4X4OA 3U27A 2JEIA 5D0GA 3CCZA 2GUPA 1S9FA 1JQGA 3CDWA 3HT3A 1WOSA 2Y0BB 3VGUA 1FNOA 3GV8B 4K43A 2YWGA 1M5SA 3CC7N 2E1MC 3GJTB 1UWBA 4H4KC 2WVFA 2VGNA 2R7YA 4ZPBA 1VC5A 3M5RA 1MMDA 1XMOJ 3LZIA 2F9JA 3KK3A 3V4IA 1XR5A 3LPTA 4J90A 4HCCA 4CECA 4MO5A 3UDLA 1U1PA 4LSLB 2XO6A 1RWVB 5KFMA 1HNZJ 1RWUA 4OLPA 2G1HA 4QWDA 1FKPB 3FGUA 2PY5A 1O8BA 3NGRA 3TVKA 3IGNA 1RGIA 1Z1ZA 2UXCJ 4PKHA 3AFGA 2WW8A 3OVSA 4LF8J 4UW2A 2Q43A 2VWJA 2Z57B 1Y10A 2YNGB 1ZA1B 4TQRA 4K0KF 2VC0A 4Z4CA 2I9SA 3ZZ0A 1YJNN 3BGLA 4CHNA 5B09A 3DLLL 3CIZA 4FWMA 5DM7L 2C2EA 2V2VA 4H54A 4X65J 4ER8A 4JI1F 1HD1A 3DRXA 3FZLA 2YNFB 2ZVSA 4IFEA 3HZ6A 1X5OA 2FD2A 3L2WA 2V7ZA 4X4NA 2KYXA 4OYPA 3J7AP 4BE0A 2DRDA 5K8OA 3HO1A 2L48A 5G0RB 3OYGA 4JV5J 3MAHA 4TY8A 1HA1A 2QSFA 4PKIA 1IG9A 3HFKA 1S9EA 2YKAA 1K0VA 3NH1A 4NYFA 5BJRA 4KV8A 4ZVSB 4FSVA 1IUJA 3S7RA 2AEMA 4BGBA 3IRXA 5AQZA 4FWLA 3MN9A 2WB1D 2YWKA 1OY9A 5C2CA 5KFYA 1GMUA 4DQQA 2GEMA 4ECXA 5CAAA 3DC2A 4M5JA 3L7UA 4DTMA 1S3XA 4OX9J 1P8GA 3OV7A 3HOTA 2DR8A 3GJSB 4QBUA 3KIOA 4CF1A 4QR1A 2YNIB 4KE5A 1Q1KA 2V2QA 1X4HA 4MKVA 5EX5A 2HRTA 3D4JA 1TL7A 2ATCB 3NG8A 4WFAL 1QVGM 1JLGB 5EWGA 4C23A 3ALYA 4F36A 3BDEA 3AVAA 4MT1A 3A1YG 2IPOB 5LMNK 2LSNA 1VSLA 4ZN1A 3VGSA 3QEPA 5D4PA 2F8SA 4DV4F 3BY5A 2E1YA 4DSJA 3CF5L 4F3OA 4DR7J 1S59A 5ADZA 4DV1K 1X9JA 3IAYA 3JAMU 3F9MA 4CT8A 5JVHQ 1S7HA 3DRSA 2GHWA 1RDWX 5AQWA 4FWRA 3QAUA 4E7JA 5EX3A 1FEHA 4DL7A 1RP5A 2CZVC 1FESA 1MW7A 5L38A 3AA4A 1HQUB 1S1VB 1FRHA 1IKYB 1FXRA 1ZBUA 3R7BB 3H4BA 1F9HA 1I51B 3LQVA 2JHEA 4YR3A 2VJUA 1JLEB 4A59A 2OELA 2QC3A 4J2DA 1DLOA 4HTIA 3B6PA 3MM6A 1SIZA 5HRNA 3I87A 1RBSA 5KFNA 1KVJA 4DV5K 3BN4A 3WIUA 2A2DA 2HAFA 1QAIA 2DH8A 4DR4J 1VQMN 3OYDA 1ITPA 3MM5A 2HMIA 2KG1A 4FPAA 4Q2LA 4PHTX 3MD3A 2GQCA 4HLBA 2G8UA 3JQKA 2MKHA 1DTQA 2ROGA 5LJ3Y 5M1FA 2NXUA 3EGZA 3EE3A 2CQ1A 4GC6A 4CRJA 3CJ3A 2DO0A 4HUEA 3MPDA 4Z0UA 4A8XA 5KGWA 1ULRA 2IIRA 3JS6A 5KFBA 2XMJA 3EKUA 4NLOA 1HYVA 1JCFA 2IYIA 1S48A 2H9ZA 3DKDA 2HNZA 5KFRA 1Q9XA 2IJRA 2EVZA 3NWRA 2C2RA 4H4OA 3U1NA 2J8SA 2Q0RA 4IQXA 2KJWA 2AKWB 3DYAA 3OVNA 3HSDA 1WOPA 1NKBA 1X0FA 4BC3A 3CWJA 1TZ0A 2HQCA 3KK1A 1MWMA 4I9LA 3NOGA 3MI7X 4HKQA 4LF7F 4ZVEA 4DV7K 5HJXA 1FX4A 4IFYB 1RHQB 3TZZA 4C0BA 3M9NB 5HQLA 4A8WA 5GAEI 4Y2KA 4DPXA 5KT2A 2MZSA 4X4TA 2V8GA 3DGPA 2O8EA 5EUHA 1X9MA 4J37A 2JNJA 3ENBA 2GS8A 3MCPA 4IDKA 1SH2A 4O4GB 3BV8A 3P49B 3PDNA 2HVHA 3VAKA 1VQYA 4JBCA 4ZVHA 5F3TA 2XS7A 2GTDA 3G87A 5EWEA 4I6WA 1FKOB 5E7OB 1T44A 3OD2A 1OYDA 4LRCA 4NZ7A 3AOCA 4TYBA 3OFFA 3UCUP 1TV6B 4RW9B 3HP6A 1RWPB 1N33F 2P9IB 3MURP 2ZBQA 4K8ZA 4NZ0A 2QM1A 3RVCA 1KS2A 4DL2A 2HWIA 2WVBA 5AXKA 4UZBA 2CQ4A 2V69A 1NGFA 4KHMA 1RACB 4R8UB 1QQCA 1S7IA 2H65B 1LFWA 2N4CA 3EXYA 3OS0A 4FJLA 1CZBA 3KLHB 5A8KB 4DR6J 2OFGX 2HHHK 4BCAA 3CCRS 1NNDA 4P2FA 1S22A 1WKKA 2W9BB 2LECA 3PW7A 2YWHA 2OD6A 3D0GE 1FERA 3H5UA 4FVMA 2HURA 1KFDA 3DU5A 1R59O 4BRHA 4JI8J 2MY7A 1VRTA 1KQGB 1Y11A 2XLJA 3S41A 1CQNA 4DQSA 4CZMA 4E3SA 2YNHB 1BO5O 4W5TA 3BDPA 4QQBA 2Z2ZA 4JV1A 2PYLA 2GHPA 1R8AA 2J6TA 2RE2A 2AX0A 3UD3P 3NVMA 1NK0A 2BEFA 5CCLA 4OI3A 3AA8A 1JL1A 1N5TA 4K4TA 2ZWHA 1REVA 4WTOB 4DV6F 2IMWP 1RU2A 2ABYA 2CIMA 1MU2A 1CC8A 4QU6A 2FGOA 3TO8A 5FPMA 3QNWB 3W7BA 4JHDA 3F56A 4LRDA 3FCVA 3CFRA 1VQLS 4XEIA 2C3MA 4YEAA 2NZTA 3T3FA 3W61A 4WQ5C 3EZWA 4JI6J 4GVMA 5DK5A 4IEEA 3MN5A 3D67A 4CD1A 1ZBFA 1AT1B 1UVIA 3ISNC 4J9PA 2MGZA 2B9YA 1NHKL 1NGAA 3JB9k 1TELA 3D45A 3DLEB 1J5EK 4O3QA 4WU2A 2QE5A 1NBEB 1HYZA 4I56A 4J91A 4QYRA 5G4DA 4H5TA 3C14B 4B3SF 2E2PA 3CCWA 5CHCB 1C4CA 1L3VA 4IH5A 5AQKA 2QO3A 4B17A 1FDBA 3OUYA 3TA2A 4BRKA 2DR5A 4NYNA 2OLWA 2K3KA 2V4JA 4DLEA 2LYVA 3M2UB 4DFMA 3EGWB 2VG7A 3N4WA 1CVJA 1T0TV 4USMA 3CMES 4MKBA 4Y2AA 1Q5VA 4MDBA 3JTOA 1KP6A 1PC4A 1WWHA 1S5JA 4X2BA 3MMVA 1RBVA 3N4PA 2ZOMA 3NY0A 3MOJB 4DCHA 4DR2K 3WEEA 3KKSA 2ZHAA 4JN4A 2MQOA 2HRUA 2VBYA 4NO7A 4MFBB 3JSBA 3U4LA 5K14B 1SH3A 2C1EB 3O80A 2CNLB 9ATCB 4LBIA 1D3WA 2AJ2A 3N5BA 2FLPA 4YY3F 3Q8RB 1VRUB 2BANB 2BJ1A 1K8KB 2HZCA 3LP2B 2C2ZB 3HVTA 1HWUA 3N0VA 3GG1A 4CEQA 2K3IA 3BSOA 3O6WA 2DTJA 1Y5NB 2VWKA 1JLAB 1HNVB 3I32A 1GLJO 3MTJA 3S6EA 1OSDA 2J9CA 1U1RA 4E19A 5AQOA 3V81A 3DRRA 2VYPA 3OS2A 3S3MA 1WEXA 3THPA 5F0XA 1WG1A 3OBYA 1FW6A 3KXDA 4URQU 5KFFA 3NAIA 3C6AA 4FJJA 2R7WA 1B4SA 4L3KA 4A46A 2WUSA 4DR5J 2CPXA 1RT1A 3DM2A 4CM2A 3GPAA 3GCXP 4EBEA 4EP5A 2OANA 5J2QA 2IHR1 3T1HF 3C6UA 1N88A 3H25A 3QGPA 4ZCMA 2ZKUA 1KLMB 1UWAA 4M63A 4ZPAA 4FN5A 3VETA 4K4WA 4OJRA 2QMWA 2COLA 1G15A 1IQZA 3POTB 1WC4A 1NDLA 2YQ1A 1RAGB 3HFZB 3Q8SB 4CJTA 3RRKA 4HI2A 4PYAA 3H6EA 3R1LA 4JLHA 3BF1A 4C8KA 5AQUA 1H7XA 4KBIA 3A13A 1HI1A 1KC8O 2JWKA 4B3OB 1TL3B 4BRCA 4PQUA 4NLDA 3BB5A 4CD3A 4K8XA 2A0FB 4NLSA 2HWHA 2W4DA 4OLOA 4F2SA 3DLKB 2JLFA 2QFJA 1Y3KA 1BA0A 2YKMB 5H1SQ 2BA9A 4JKBA 4H8KA 1QS4A 4IH7A 3NOCA 3TOQA 4MAKA 2BBEA 1GLBG 3ID8A 4Y2MA 2IAJB 5IQQA 3L3UA 4RU2A 3NP5A 1NPKA 4CZEA 4FK0A 2OSQA 4TYAA 1XR6A 4NA2A 3VF4A 3MCSA 4ED4A 3MOZA 3VALA 2JEFA 2F9DA 4PR6A 3ZT1A 4A5BA 5E3AA 5J2MA 4FLTA 1BOTO 1QJHA 5E41A 2AJ4A 2EKYA 2BE2B 3WXMB 4DR1K 3LA0A 1RT3B 3G82B 4GW6A 1KWMA 4RNOA 5ETPA 4KH6A 1G99A 1Q81O 3SBMA 3IBWA 1GLCG 3THYA 2KQ2A 2GJIA 5CHIA 3CCRN 2HHTA 1JLEA 2RDDA 4ZLNA 1X4GA 4WFZA 4DUZF 1PYOB 4U8YA 3OW2R 5J2PB 4CBUA 4RL1A 1SH0A 5CYJA 4PKGA 2E2QA 4CH0S 4LF4K 3W2VB 5DJBA 3CJKB 2KT2A 4Q5VA 3CHWA 4FF1A 3BZQA 1PBAA 5F2RA 4ZN3A 4RZRA 1F3VA 1C6VA 4QW9A 1HR0F 2HBZB 3A3NB 3NH0A 3NGZA 4G3IA 4OYMA 2XEXA 2GBZA 2V50A 1NJYA 2ZH8A 2UXDK 2FHJA 2QT7A 4FZZA 1GMVA 5AZIA 4B1UB 1WC5A 5AJ3K 1VQLN 3K9JA 4HHHA 2R8KA 5GMEA 5HL7Q 2JFKA 1SPBP 5CA5A 2Y8YA 2XRIA 3DJCA 3CD6S 2HHQA 2OZMA 1MWKA 3BGRB 3AD7C 4ZA1A 3ASMA 3AV9A 4BG8A 2P9CA 3A8JA 2FLLA 3W0LA 1UJ6A 1ZBLA 4OPHA 2QMUB 1MDUB 4XTTA 1PAUB 1HLWA 3A5OC 2P9KB 2HBJA 1NNEA 4J9MA 5IT9U 2FHKA 4J5OA 2RQCA 2U1AA 4F2RA 5AXLA 1JJ2R 4BE1A 1HKCA 4HH1A 5KFWA 3R3TA 2X1FA 1QQOA 4E0DA 3KUGA 4WIIA 1I39A 3IMXA 3CMEN 4DV3J 1KC8T 4RNFA 3V6DA 4BRNA 2CQBA 1U6BA 3AOAA 3BQ2A 3H3OB 2OGUA 3VMFB 2CQPA 1CS4B 3ISZA 1RTJB 1RDRA 2HGLA 3JSYA 4ENOA 1NK4A 3D9BA 4KB0A 1D9AA 3HJFA 1VBYA 4M3YA 4AHUA 5K8MA 3D7EO 1SVDA 1W25A 2R3VA 4DBQA 2XGPA 2B5JA 5E3CA 3TUJC 4ES1A 8ATCB 4JI0K 4ZCKA 4RW8B 4FVCA 1HNZF 3SSRA 4QCLA 4ILMA 2YJFA 3MWPA 4USVA 2O8FB 4KRWA 3KKRA 4KHPJ 1FJGJ 3O1BA 3H1QA 2B4PA 2ZBCA 3PFOA 1E4GT 3J7YI 1C1BB 1FRIA 3MPWA 1D9DA 1Q81T 2JLGA 4KFBA 3M32B 3OYEA 2OPQB 4OFZA 5KGXA 2CJXB 2W2NP 4CHPA 4KGKA 3SXLA 4X65F 1O0PA 3KWGA 3X1LB 3LPYA 3ZT2A 3R8YA 2MEWA 2IM1A 2KFNA 3C15B 3BSCA 1UA0A 4CJQA 2C2MB 5CY4A 2YH0A 1AB8A 5HJYA 3CCTA 2FDNA 2D3UA 1EO1A 1TKDA 4F26A 5KTQA 2RILA 3R7SB 4JRPA 1TL5A 4DXLA 1R6VA 4J9NA 2HKEA 4JV5F 4ILGB 2DNHA 2K8GA 2OJ3A 2B6AB 3S9HA 2CH6A 5CYMA 3J80O 1C0TB 3EO3A 1XC3A 5JLHA 4CF0A 2ATLA 4BRLA 3D28A 3TAMB 3FC9A 4CH1A 3DOMA 1FI4A 1N36K 1N34K 2B7CB 4J9OA 4B9LA 1LWXA 4WZQA 3K2PA 3D0IE 2FJEB 2BVZA 4DU3A 1K8AO 2ZE2A 3QWPA 4CYUB </