3I0SA

Crystal structure of hiv reverse transcriptase in complex with inhibitor 7
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
558
structure length
558
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Substituted tetrahydroquinolines as potent allosteric inhibitors of reverse transcriptase and its key mutants.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 160
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3i0sA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0sA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0sA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0sA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3i0sA05
4MK7A 3NGIA 2CKWA 4MK8A 3PVXA 3LP2A 4TYBA 3O4NA 3K5LA 5KT3A 2RDIA 2O4GA 4N76A 1N5YB 2AGOA 1IM4A 2AX1A 4ECWA 2PZSA 4O3SA 4ECVA 4K4WA 1SKRA 2BR0A 3HP6A 3CQ8A 3AO2A 4Y3CA 2KZMA 2OZSA 4KHWA 1MMLA 4I2QB 3OYJA 2F8EX 3MF5A 3FQLA 3OSPA 1IKXA 1KVBA 1KLMA 3AA4A 4KHSA 3I0RA 3HYFA 2AQ4A 1TL1A 5CYMB 3CDEA 1S1WA 2JEFA 4B8AB 3KK3B 1A5XA 1D9FA 4E0DA 2ILZA 3VN5A 3QEVA 1RTDA 3PW4A 3DLEA 2IC3A 3RMCA 4IFYA 4DTNA 2HNDB 4O3NA 2FVQA 1VSFA 3UPFA 5CYQA 3RMBA 4KI6A 5F8JA 1RTHA 1CZBA 4RZRA 4K4ZA 1RT1B 3V4IA 5F8NA 4HTUA 3GIJA 4AILC 1KSPA 2Z1HA 3IG1B 1BQMA 4PUOB 3QGGA 5KFHA 4J2AA 3SUOA 3DDKA 1YT3A 1C1CA 3ISNC 4CJQA 3SQ2A 3SUNA 1YTAA 4CGIA 1HARA 2IAJB 1N6QB 4B3OA 3DM2B 1S5JA 3AVFA 3PX4A 4ECYA 3K2PA 4URSA 1BL3A 3GYNA 2VG6A 4WYWA 2KTQA 4F8RA 4DQSA 4M3XA 1Z4UA 4CEDA 5C24B 1TVRA 2JGUA 3TAQA 4Y34A 1IO2A 2J6TA 5KFGA 1RAJA 4LSNA 4WYLA 4DU3A 4ECTA 1CZ9A 4CHNA 4FK4A 2P1JA 4OKKA 2BQ3A 2HNYB 3M8QB 4DG1A 3LPTA 3OYLA 1TKDA 3K5NA 3NF9A 3MEDB 3OYIA 5JS2A 3HVAA 3CJ4A 4GC7A 4OJRA 4CJVA 2HNZB 4K4TA 4CK3A 1U04A 4FJKA 4NCGB 3SNNA 1TKTA 1RT3A 1R0AA 1NJXA 2DTUA 4M3UA 2XY5A 4M3ZA 2WK4A 4EYIB 3WNGA 4FLTA 1LW0A 4XPEA 2WTFA 4EZ9A 4XPCA 3RB4A 1S97A 4WE1B 4FM1A 1WSFA 1B9DA 3Q8PB 4MFBB 3VQCA 3Q8SB 2ASJA 4DL3A 4CJRA 5C42B 3DMJA 4DTOA 3H5SA 3E01B 2PY5A 5E41A 4I2QA 1KTQA 5KFKA 3NF7A 1JLCA 4RW4A 5KTQA 1S1TB 4IFVB 1T03B 4RW9B 3SV4A 3IS9A 2OH2A 4DFMA 2QV6A 3AV9A 4DS5A 4M45A 3KLFA 4BE2A 4C8NA 1QSSA 4QCLA 4YR0A 3V6KA 2I5JB 3RB6A 2QK9A 4H4MA 1JX4A 4ECSA 1HNIA 3OHBA 1LV5A 1L3TA 2KFNA 1SKWA 3UIQA 3DRRB 1XI1A 3KHGA 1W0HA 4PWDB 2WRMA 2D0AA 2ZE2B 4B08A 1VSIA 3SFUA 4ZTJA 3KHHA 1RT1A 4YQWA 5F8GA 2AJQA 3T5HA 2AWZA 4Q8FA 3E51A 2VG5A 4RW7A 4KB7A 3BQ0A 4FJ5A 3HK2A 4PUOA 3B6OA 1BIZA 3SI6A 4IKFA 3NH1A 1ZBIA 2WONA 3AVIA 3QGHA 2Z1GA 4ICLA 2YKNA 2G8FA 4KE5A 5K14B 1JLQB 4IH5A 1RT4A 3HO1A 4DL5A 1Q9YA 2Y1JA 1TGOA 4B9SA 1C0UB 3TR8A 1NJWA 4F4KA 3VA0A 3RR7A 1RNHA 1N4LA 4DQPA 2KW4A 4RW6A 3H4DA 4KI4A 3AO3A 4N56A 4FCYA 1DLOB 4CHQA 4M41A 2FBTA 1S0OA 3K59A 1LWCA 2X74A 4O4GB 1RT6B 1GOCA 5F9LA 2UUTA 4EO6A 4CF9A 5KT2A 1ZBUA 3EPIA 2HNYA 4NYZA 1N48A 3AO4A 1TL3A 3H4BA 2HWIA 4K4VA 4MIAA 2XI3A 3HT3A 3KJVB 1RBSA 4DS4A 3I0SB 2HNZA 3DOLB 3LP0B 3ZCMA 4AHSA 3KHRA 2B5JB 3AA5X 2W9AA 4E1MA 4CESA 4QPXA 1RTIA 1NK6A 1JL1A 4HVJA 1NK8A 4W5OA 1RTJB 4KTQA 2YNFB 3QERA 4DEZA 4BWJA 4MFBA 4IG3A 4KHYA 2P5GA 3OYBA 2YNGB 5KFOA 5HROB 1GOAA 4ZVEA 3NAEA 5KG7A 1UWBA 1QAJA 4IG0A 3NHGA 5SWMA 3SUPA 1T05B 1FKOB 4IKAA 2FVRA 1NNDA 4DTUA 5J2NB 4IFVA 4CJEA 4O44B 2IOCA 4WFZA 5HBMA 3HXMA 4ECQA 1WSJA 2ILYA 3OS0A 3FSIA 4JUZA 2JEIA 4DL4A 3NCIA 5CZ2A 3K57A 4KV8A 4IRCA 3OYNA 4QAGA 5DGBA 2W9CA 3RAXA 3CWJA 3AA3A 3DOKB 1N56A 4ZMMA 3MEEB 3IN5A 1HJRA 1YVUA 1EP4A 4FJIA 4E7HA 3G10A 1U48A 1J5OB 3NF8A 3ZSVA 4NZ0A 4NLYA 5DG7A 3CFRA 3PW2A 4JV0A 4KB0A 1VSEA 3LP2B 4M94A 1QUVA 3BR9A 2ATLA 4FS1A 2GUIA 3QEXA 4EP5A 1HNVA 4KSEB 4CF0A 1HQEA 3TQ1A 3CYMA 2JC0A 4ED2A 1FK9B 4TN2A 5HLFA 3L2RA 4O3OA 2D3ZA 4CF1A 4FLXA 4Q43A 5EUHA 3M9MB 3OYKA 1T3NA 3HPHA 5KT7A 1IKXB 2NUBA 1KLMB 3ZT2A 4MKBA 4ECUA 3I0RB 3QINA 2AGPA 4NYFA 1S1WB 3G86A 4CEBA 1D0EA 3G6XA 3OL6A 3MEGA 3RBDA 3PUFA 2W42A 3P1GA 4Z4FA 3AVLA 3EYZA 1RTDB 1S1VA 3DLEB 5EWEA 2IC3B 5KG4A 4IR9A 5KFSA 4ED0A 1U4BA 2HHTA 5CYQB 4WFXA 4ID1A 5KFDA 4NLQA 3NMAA 3CFPA 4CIGA 4IQXA 4FXDA 3NL0A 3QEWA 4W5QA 1ITGA 3V4IB 5HP1A 2HVHA 4CIFA 2P5OA 3O4QA 4TSXA 2XWYA 3I5CA 1BQMB 4CECA 1BISA 4NLTA 4Q44A 3DLKB 1F21A 1JLAA 4B9MA 1C1CB 1QQCA 3T19A 4RNFA 4Y1DA 3SFGA 3BJYA 5HRRA 3KTQA 3LANA 1U49A 4B3OB 3M9NB 2V9WA 2QKKA 1D5AA 5KG6A 2XY7A 2C22A 2B6AB 3CM6A 4U6PA 1EXQA 4FJHA 2VA2A 4IRKA 3VQ6A 5KI6A 1WNSA 4O44A 1TVRB 2JC1A 1TKXA 4YNQA 2G8IA 4CFBA 4ELTA 4DTJA 4QWAA 5KG3A 1XWLA 3LPUA 4GW6A 4LSNB 2VWJA 4AHVA 1WSGA 5L1IA 1S4FA 3HPOA 4EP4A 5KFAA 3SPYA 4DG1B 1DTTA 3NGYA 5D3GA 1O1WA 3IGVA 4TQRA 4CEOA 3OJSA 1HQUA 4IR1A 4J9KA 3H5YA 3GV5B 1TKTB 1RT3B 1R0AB 1KVAA 2RF2A 5EDWA 4M42A 4EEYA 4Y2AA 1LW0B 4PY5A 3OYEA 1B9FA 4KAIA 1WSHA 1J9AA 4JRPA 4F4WA 1NK7A 1FK9A 1BGXT 4DTSA 3U6FA 1VSHA 2HHUA 3U3GA 4F3OA 3DMJB 1OS5A 3TABA 4AH9A 1DTQA 1QAIA 1KFSA 2R2UA 4URGA 4CFCA 1JLCB 4RW4B 2WB4A 2XC9A 4FJNA 3H5UA 1XHZA 1L5UA 4YR2A 5I3UA 3H08A 3IS9B 1FKPB 3QIDA 2ZKUA 1KHWA 3AVBA 5F8LA 3MR5A 4ZPBA 3KLFB 5KFMA 4FM2A 3PW5A 1L3UA 2IA6A 3RWUA 4FJJA 4H4MB 4KRFA 4RNMA 4BACA 1HNIB 3TWHA 2QXFA 2HMIA 1NJYA 4NLUA 2AU0A 4DTXA 4ED8A 2GV9A 1A5VA 2DPIA 1RA6A 5KGXA 3LZJA 4RNNA 3H40A 1WAFA 4IDKB 5DK5A 3L2QA 4G1QA 3VQDA 3RRHA 3DRSA 2VG5B 4RW7B 4CF8A 3CM5A 4B8CA 2OPRB 3ZT1A 3DLKA 3NKYA 4Z4IA 1S9EA 5FROA 1JIHA 5DQGA 3HHKA 3QZ7A 2WONB 3VQBA 1SL0A 4ICLB 2YKNB 1RT4B 1HMVA 2C28A 3ISND 2CJQA 1RBVA 1KRPA 1JLBB 4OL8A 4TY8A 2B6AA 2A1RA 3KLGA 3HVTA 4QW9A 3MR3A 2OPPA 3DI6A 4RW6B 5F8HA 1BIUA 4ZHRB 4R0EA 2IM1A 4KO0A 2FBXA 1B92A 4O3RA 2ASDA 1K1SA 1KVCA 1LWCB 3BQ2A 1NKEA 5I42A 1VRTB 1A5WA 5L1KA 4FW1A 1C1AA 4CGJA 4HUGA 4C8LA 1BI4A 4YR3A 4DQRA 4OKEA 3NBPA 2QE5A 1TL3B 2JEGA 1NOYA 4ZP9A 1CXUA 1CXQA 4E1NA 3GV7B 1EX4A 1WSIA 4TQSA 2C2RA 2FJWA 1C2PA 3HL8A 1WNEA 1ZBLA 4J9LA 3CJ5A 4ZVGA 3CJ3A 3RAQA 2PYJA 4DSLA 3PX0A 2OPQA 2HHXA 5FRNA 2VA3A 3WNHA 4CEEA 2OPSB 1RTIB 3K58A 3H98A 3RR8A 4FM0A 2D5RA 3QGIA 2HAIA 4IG3B 3EPGA 4CEQA 4U7CA 1UA0A 4FLWA 1S6PB 5JUMA 1UWBB 3NFAA 5HRSA 4O5BA 3HJFA 4IG0B 3BSOA 3T5LA 1BQNA 2FBYA 2ATQA 4CJWA 3AVAA 4BDYA 1S9FA 1QE1A 5DLFA 3EY1A 2VG7A 4J9OA 5HBMB 1C6VA 4DFPA 1FKPA 1IKVA 4K4SA 3V1OA 2IM3A 4DQQA 4KV8B 3TAMA 4CGDA 4C8OA 2UVRA 2V4QA 4EBDA 2W9CB 1Q9XA 1S1XA 4NCAA 3QIPA 4JRQA 4QWEA 3V9SA 4DL2A 4BE0A 4JS5A 4RNHA 3V6HA 3D5MA 3AVMA 2XY8A 1EP4B 4E7LA 2IMWP 1HYSA 4IH6A 1Z25A 5KRTA 1JL2A 3CFOA 3N6LA 1VSJA 3P83D 5HRNA 4FLUA 4F50A 4IDKA 4CJ5A 4RG8A 4M3TA 3UDLA 3PR5B 3M8RA 4K8ZA 4ED1A 3PX6A 3C94A 2PYLA 2J6UA 4JV2A 4CHZA 4J2BA 3OL7A 3OVNA 5T7BA 4XIUA 3KLVA 3QNNA 2OPRA 2R8IA 2D0CA 5FDLA 3ITHA 4EYHB 3THVA 1HNVB 1HQEB 3UR0A 1I39A 1RYRA 3NAHA 1SUQA 4ED3A 3SUQA 4K4YA 3MAQA 1ZBHA 5HLFB 2YNHA 1TV6A 3V9XA 4BDZA 2A1SA 3ZSRA 5F8IA 3KLIA 1JLBA 3QEIA 3KK2A 3OS1A 2OA8A 1CLQA 2FVPA 4ZVHA 1QHTA 3VQ9A 3TAPA 1FXXA 5KT5A 2XRIA 2KZZA 4ZHRA 2X6SA 1TKZA 4DF8A 1RDCA 3KIOA 4CJPA 3SPZA 4YFUA 1SV5A 3FDSA 3VQ7A 3MEGB 4OGCA 4DFJA 1VRTA 4J9QA 4M95A 4TXSA 4DL7A 2B4JA 4DF4A 1S1VB 4EBEA 3OLBA 2XO7A 2W9BA 5DGAA 3VQPA 1NK0A 5KT6A 3CJ0A 4K4XA 3D0PA 3SYZA 4J9RA 1KFDA 1LWEA 2DPJA 4W5NA 4DLGA 3AVCA 5HP1B 2UVUA 4ELUA 3EZ5A 2BDPA 1RT7A 1NK5A 4KKOA 4GC6A 3ZSXA 2D3UA 3CDUA 2OPSA 1QS4A 1JLAB 2ITGA 1T7PA 4CJTA 3LAMA 4Z4CA 4FZYA 2W8LA 4I7FB 4KTZA 3V1RA 2IM2A 2XCAA 3OY9A 4R8UA 1S49A 5J1EA 2XCPA 1S6PA 4RW8A 1JLFA 5DQHA 3OS2A 3QESA 5KGWA 2KFZA 4NLSA 4KAZA 4LSLA 1IKWB 1S0MA 4QW8A 1TKXB 3OLAA 3MXMA 4FBTA 4BE1A 1JXEA 3BSAA 3QO9A 2YNIA 2WCXA 2LSNA 2DY4A 3H59A 5KFJA 3AVNA 4FJLA 2D0BA 3WNFA 1TAQA 4KHNA 2FLNA 4K50A 1DTTB 3KKRA 3JYTA 4CGFA 5D3GB 3RB0A 2HHVA 1HQUB 3VQEA 1EKEA 2ZD1A 2G8UA 1J53A 4LH4A 1YVFA 5C25A 2BQUA 4RU9A 3ZSWA 4KREA 3ZSYA 4EZ6A 2RF2B 3QEPA 2WOMA 1K1QA 2HWHA 3KD5E 5KFIA 3L3UA 4GVMA 1LWFB 3QIOA 5KFLA 4Y2CA 4H54A 4DSEA 2FVCA 3WNEA 2E4LA 2P51A 4AHUA 5J2MA 2GIQA 3QLHA 3PZPA 1NHUA 4JS4A 1JLGA 5L9XA 4I2PA 4FK0A 4BWMA 4F3TA 1K6YA 3G6YA 3DLGA 4QOZB 3PJXA 4Q8EA 2J6SA 5EWFA 1DTQB 3VQSA 1U45A 1EETA 4FLZA 1QSLA 4PQUB 1C1BA 3M8SA 2RN2A 3S9HA 5KFNA 4OPKA 1KHVA 5I3UB 2G8WA 2IM0A 2QKBA 3V81A 3HPGA 4UQGA 3RTVA 3NH0A 4KHUA 2JLEA 1D8YA 3PW7A 4J9NA 3KLEA 3DYAA 2FBVA 3I5AA 4CGGA 2DFFA 3VQ4A 4CHPA 2HMIB 2V0NA 5KG2A 2BGGA 5KFWA 4CFDA 5F8MA 3OJUA 4O3PA 4FYDA 2G8KA 3KMSA 3NAIA 3LAKA 2UUWA 3H2LA 3BSNA 4N47A 1Q8IA 4K8XA 1RDAA 3D45A 4G1QB 3DRSB 3G6VA 4DSIA 3KNAA 4AHTA 4HCCA 4XO0A 2X78A 2R8JA 1S9EB 3IRXB 4N41A 1QSYA 4H8KA 5KFBA 4ECXA 3S3OA 1HMVB 1RCHA 4I7FA 3KKSA 3L2UA 4ECZA 2BANA 5L1JA 1S9GA 4DU4A 4TY8B 3ZSQA 3KLGB 3HVTB 5KFXA 1C0TA 1NK4A 2FLLA 2OPPB 3DI6B 4Z0UA 4QWCA 3V9WA 5J2PA 1CSJA 1XC9A 5EU7A 3OYGA 5J2QA 1IKWA 3N6NA 4KO0B 2AX0A 3FFIA 4JLHA 3AO5A 5FRMA 2IJNA 5I42B 4O55A 4N5SA 2ETJA 3Q8RB 2R7YA 4KPYA 4ID5A 3GILA 1HYVA 1RILA 4DU1A 2EC0A 1IG9A 1GX6A 1BI4B 3K5MA 4O4RA 3NBPB 5CY4A 2FC0A 5HRPA 4F4YA 1TQLA 3CDWA 4QWDA 3PY8A 5KFVA 3SCXA 5KT4A 4CE9A 1S1UA 4DL6A 2RKIA 3ZT0A 4IBNA 4F4XA 3U3YA 2F8TA 4CHOA 2OPQB 4R5PA 3AO1A 3VQ5A 4FZXC 5KFTA 3KMQA 3MR2A 3NF6A 4Q0BA 4DSJA 2VWKA 2C2DA 1LWFA 3ZSZA 3HSTB 3TAFA 4RNOA 2ALZA 4J9PA 4DTMA 2UVVA 3SQ1A 5KRSA 2Y1IA 4CEFA 3PV8A 4KB1A 1RDBA 1LAVA 3SQ0A 4AHCA 2KQ2A 1GX5A 3DRPA 2E9TA 5CZ1A 3DLHA 1BQNB 4PQUA 1NK9A 5KFUA 1QE1B 3PHEA 5KG0A 2VG7B 2YHAA 4LD0A 3KK1B 1IKVB 3T1AA 4CFAA 4CJLA 2R2TA 1NKBA 3P5JA 3B6PA 1RDRA 3TAMB 1ASWA 3ALYA 4F2SA 3RBEA 3L2VA 1S1XB 3QIPB 4KBIA 2R8GA 3ASMA 2IBKA 4F4ZA 1S6QB 2ZQBA 2EX3A 1ZETA 2F96A 1HYSB 4WFYA 5DLGA 1JLEA 4LQ3A 3SI8A 4H4OA 4ZPCA 3ZT3A 3JSMA 3NE6A 1UAXA 1XR6A 4ELVA 4C8MA 1REVA 2E6LA 1IKYA 4DQIA 5FDLB 3ITHB 3IRXA 4L8RB 4I9LA 4Z4HA 3C6UA 4FJ8A 1SUQB 1KCFA 4QWBA 4ZPAA 2YNHB 1TV6B 4DTRA 2AGQA 3C95A 3KLIB 3H5XA 3KK2B 1LW2B 1ZBFA 4NLDA 2UVWA 2XHBA 4AHRA 1VRUA 3M9OB 3O3FA 3V6DA 4J2EA 1WN7A 4CJFA 4J9MA 2XI2A 1TKZB 1JXBA 3CG7A 1XHXA 4O0IA 3RRGA 4HHTA 2E9RX 1SV5B 5KG1A 3ZT4A 2XGPA 3LP1A 4E19A 3FQKA 3BDPA 1NHVA 1X1PA 5L1LA 1ASUA 2W7OA 1VK0A 2X6NA 1WLJA 4NCBA 4W5RA 2W9BB 1SH2A 4ECRA 2BQRA 4HUFA 3KLHA 5KFZA 3AVGA 3C6TA 4CEAA 1LWEB 4IRDA 4KHMA 3OL9A 1JKHA 1RT7B 4KKOB 3OYHA 4FLYA 4E7IA 5JXSA 2Z1IA 3L3VA 2BE2A 2BRLA 3PW0A 1RT2A 4EBCA 3NGDA 3SZ2A 4WZQA 4NYNA 3KD1E 4MH8A 3OYDA 3BGRA 3HM9A 4CK1A 2YKMA 4OGEA 2OYQA 4IOBA 1L3SA 2XGQA 3LP3A 4R8UB 1S10A 3RMAA 5J1EB 4RW8B 1JLFB 3OL8A 4CJKA 4Z4GA 2GC8A 3MFIA 4NLWA 4HYKA 1VSLA 3CJ2A 4CEZA 3NGZA 2FJVA 4O3QA 3LALA 3QNOA 1N5YA 2IS3A 1NKCA 2O5DA 4EO8A 4LSLB 1BCOA 2R8HA 2G8HA 3KK1A 3QO9B 2YNIB 4E3SA 4FK2A 4FLVA 3MR6A 3KHLA 4TLRA 1SH3A 4X2BA 3MXJA 4NLRA 3JYTB 3GIMA 4HCBA 1TAUA 2W7PA 1C0MA 1S6QA 3V9UA 2HW3A 1VSKA 5CYMA 4ZTFA 4ED7A 4Z4EA 3KOAA 2ZD1B 4HKQA 3OYFA 3AVHA 5C25B 4ZPDA 3KK3A 3VQAA 2G8VA 1U47A 2WOMB 4E7JA 2FLPA 4LY7A 4ZP8A 1ZTWA 3HP9A 2HNDA 4PA1A 4YP3A 3MECB 3IAYA 3TVKA 2XY6A 5J2MB 3T5JA 3QLHB 3ZSOA 1JLGB 4FJ9A 4I2PB 3Q8QB 4B9VA 3MTKA 1RBRA 3DLGB 5KFEA 5T14A 4DLEA 1RBTA 3IG1A 1EETB 1LW2A 3M8PB 4TYAA 3OYCA 4DSKA 4J2DA 4NRUA 1C1BB 3AVKA 4CERA 1ASVA 3O3GA 3SQ4A 2IAJA 1N6QA 1HPZB 4NRTA 5KFCA 4MIBA 1ZYQA 3DM2A 3PO4A 3V81B 2ASLA 4WXOA 1RT5B 4YMEA 3SJJA 4RUAA 3VA3A 3KLEB 3DYAB 5DG9A 2IDOA 2HVIA 5C24A 1SL2A 2O4IA 4DFKA 4FS2A 2Q3SA 2D7SA 4CGHA 2JEJA 1W9HA 3NDKA 2GBZA 4CF2A 4KFBB 4M3YA 3CVKA 1I3AA 3F9KA 4K4UA 1UOCA 1TK5A 4CCHA 4J9SA 3M8QA 1L3VA 3GQCA 1D1UA 4O0JA 1QTMA 2W8KA 3MEDA 1RA7A 5KFQA 1VSDA 4NLGA 3ULDA 4B9UA 2YV0X 4LH5A 3TANA 3N6MA 4NCGA 4RUCA 1WAJA 3GV8B 3PO5A 4B9TA 1NJZA 4FJXA 4NLPA 4Q45A 3ICLA 4FBUA 4FJMA 2BANB 1ZTTA 3L2WA 1S9GB 4CIEA 4NLXA 1C0TB 3LDSA 5J2PB 2E6MA 4HUEA 4ZVFA 1T94A 4WE1A 4DMNA 4GMJB 5J2QB 5C5JA 4ED6A 3HVWA 4G3IA 3AA2A 4BDPA 4MK9A 4I9QA 3FFIB 5C42A 3E01A 3PJWA 2DFHA 2YHBA 1Z26A 5KFPA 2DFEA 3DLRA 3VQQA 2B43A 3G0ZA 4CJSA 3DLBA 4E7KA 4ID5B 4OKJA 4MKAA 3GIIA 3QZ8A 4FW2A 3S3NA 5KFYA 4CJ3A 5KFRA 1S1TA 2GIRA 3QYYA 1BHLA 1JXLA 4KHQA 3EZUA 2I1RA 1T03A 4RW9A 2OZMA 3L8BA 1HYZA 3RMDA 2V4RA 3LWLA 1S1UB 1X9MA 2RKIB 4MQ3A 2I5JA 3O3HA 4KHRA 4KTWA 4R5PB 1T8EA 5JS1A 1D9DA 5EWGA 3MFHA 4Q0BB 3TAGA 3PR4A 4IH7A 1MU2B 4CJUA 3I8DA 3DRRA 3MECA 4PWDA 3V9ZA 3TI0A 5KFFA 1GOBA 3K5OA 4W5TA 1WSEA 3RB3A 1SKSA 4E89A 2F8SA 4FZZA 2ZE2A 3A2FA 3FRZA 2E9ZA 1YTUA 1XR5A 3UQSA 2C2EA 1J54A 3DRPB 3M8PA 4FVMA 5F9NA 4URQU 1HPZA 2D41A 3D28A 4NLVA 5K14A 1JLQA 3AVJA 3BQ1A 5KG5A 2WHOA 4B9LA 1BCMA 4M3WA 3HVRA 1RT5A 1C0UA 2FJXA 3GIKA 1S48A 1LAWA 4M3RA 1UA1A 3V1QA 1RYSA 1TP7A 5DMRA 3TARA 1DLOA 1TK0A 1TL1B 3CO9A 4WXWA 3LWMA 3LZIA 1JLEB 3TAEA 4O4GA 1RT6A 3OHAA 5DG8A 4H4OB 3V6JA 4KFBA 3JSMB 4B9NA 2HHQA 4DTPA 1I6JA 3QETA 4IFYB 4WZMA 4TY9A 1REVB 1IKYB 4ZP7A 4FJGA 1RTHB 3KJVA 3OSNA 3C6UB 3I0SA 3F73A 4Y1CA 4OVLA 3DOLA 1X9SA 3LP0A 3I5BA 1HRHA 2B5JA 4OLBA 1Y97A 1SL1A 3S3MA 2FVSA 3NH2A 5DQIA 4Q5VA 1SH0A 1RTJA 1VRUB 1NOZA 2YNFA 3V6DB 3CIZA 4DWIA 3T3FA 1G15A 4ZP6A 2YNGA 5HROA 1IH7A 2HHSA 1S0NA 4CJ4A 2HHWA 1RDDA 3OYAA 4C8KA 3LP1B 1T05A 2VG6B 1FKOA 1KLNA 2IJFA 4OLAA 4NLOA 3OYMA 4DSFA 2BRKA 5J2NA 3MXIA 2RDJA 5SZTA 3KLHB 3T5KA 3VQ8A 3C6TB 4F2RA 4JV1A 4CHYA 4OPJA 1TK8A 2EHGA 1JKHB 3HKWA 4FJ7A 1RBUA 2Z1JA 2RPIA 3DOKA 1W25A 1MU2A 2BE2B 3MEEA 2R8KA 2IGIA 1U09A 1RT2B 3BREA 1X9WA 1XR7A 4CK2A 3BSCA 2HB5A 2R2RA 2R2SA 3IGNA 3BGRB 1J5OA 4LQ9A 2YKMB 1VSMA 3SV3A
chains in the Genus database with same CATH superfamily
1EB0A 2DNYA 2VQEJ 2HSTA 1IBLK 2DB1A 4MK8A 2W6KA 3P39A 3O4NA 2ZH2A 4C0OC 5BN8A 2MQLA 1ROFA 2O4GA 2GCFA 4HACA 1VC6A 2AX1A 1HWUA 2M7SA 4O3SA 4ECVA 2WC9A 4LVNP 4OZLA 3HP6A 2BR0A 5EVZA 2ZZMA 3AO2A 3GDQA 1Y3JA 2KZMA 4I2QB 1T6DA 3AH6A 2F8EX 3MF5A 3OPKA 4AL6A 1FRJA 1IKXA 2DNRA 2X1BA 3C19A 3I0RA 1T9UA 2YHXA 1TL1A 4BGAA 5CYMB 3C3LA 3O4WA 1BLUA 4PG8A 3OXGA 4PPZA 2JEFA 1GXTA 3AHPA 1D9FA 2E7VA 1XN9A 1RTDA 3PW4A 2B3TB 4IFYA 2E1CA 4DTNA 2E44A 2K3IA 1CULA 1E6VB 2PN6A 5G0RA 5CYJA 1SJFA 5MAOA 5BYRA 2Q3PA 4HTUA 2E1AA 5DZ7A 1RI7A 1T02A 1BQMA 4J2AA 2P9UA 3SUOA 3D2EA 4LMZA 3WEEA 1OO0B 5KQDA 3ISNC 4HHHA 3SUNA 1H7WA 4F02A 1UEKA 3AVFA 3BGOP 1WKLA 2CNLB 2RDDA 4KJIA 2HBMA 5HATA 3KJFB 2NRVA 2VG6A 4IO8A 5DETA 4C48A 2BE7D 2LEAA 2RHSB 2XSFA 2JGUA 2CZ9A 2DGSA 1DEJA 3QRRA 5I3QA 1H72C 2DNPA 4X66J 4ECTA 3RVCA 2P1JA 3CCES 2BQ3A 4ZCLA 4JKHA 3K5NA 3NF9A 4YN3B 2R7TA 1YJRA 3MEDB 3DRXA 3OYIA 5JS2A 3HVAA 4CK3A 1U04A 4JKDA 3CERA 1RT3A 1NJXA 4YY3K 2XS2A 2DTUA 3WNGA 4CQ1A 4FLTA 5AQFA 1LW0A 1PYTA 4XPEA 2WTFA 4FM1A 1B9DA 5K9FA 4CLZA 4MDBA 4DL3A 2QLBB 3O9TA 3HF5A 5A0YB 3DMJA 3H5SA 2PY5A 3TRGA 5E41A 3D7SB 3EMTA 5KFKA 4DR6F 1WC5A 4YB5A 3D6RA 1VBXA 3IS9A 4X65J 2OH2A 2HLUA 3LDOA 4DS5A 5GINA 3RW6A 1N5SA 2GV1A 4C8NA 4WYBA 4QCLA 3QFUA 2YWEA 4KH4A 4IEIA 4DV2F 4WKYA 2ZH7A 4K42A 1VR6A 2UXCK 4C1NK 2L9WA 1HNIA 1GFWB 4OV6A 4FF2A 1VQ5S 3UIQA 4CI0B 4RWXA 2XM3A 2EXUA 3EKSA 2UXBK 1KC8O 3WIUA 2CQCA 1VSIA 4UUXA 5D4PA 4ZTJA 3KHHA 2FHKA 4OYMA 4YQWA 3WZ0A 4BRMA 1KONA 3GCWP 3CD6N 3OFEA 4DQ8A 4PUOA 5D78A 4BR7A 1BIZA 3EE9A 4GRSA 1G4CA 1NM1A 3E1YA 3CCVN 2WONA 3AVIA 3QGHA 1A7GE 1X31C 2ZEJA 3AJ1A 2NRZA 3KVGA 5GAHP 2AW0A 5GAHU 5K14B 4DPYA 5IWAF 3HO1A 4DL5A 1Q9YA 2M88A 2A3JA 4DUZF 2HYIB 1N4LA 2W2OP 4RW6A 1G1XA 4KI4A 3AO3A 1YI2N 4N56A 4FCYA 2MHEA 3FSXA 1VK3A 1QY7A 4TNOA 4M41A 2CRLA 4XH4A 2NREA 3QWUA 4MO4A 4O4GB 1CQNA 1RISA 4EO6A 1Z2ZA 3QJPA 1VQ8N 5KT2A 3EPIA 4U67L 2DNMA 2HNYA 2UV8A 3W62A 3IAS9 4MIAA 2V8PA 1OYDA 1VYAA 2EK6A 3IRWP 5F3TA 1VI7A 2UUCJ 3DOLB 4DCOB 2YX1A 3KHRA 5HMXA 1RTIA 4IOXA 4KRWA 2FZCB 3D6FB 3NVKA 3GJQB 1NK8A 4W5OA 2H5EA 4Y2KA 4KTQA 2YNFB 3AOCA 2KM8C 3QERA 5D0RA 3MM8B 4M5KA 4KHYA 2CQ0A 3OYBA 1D09B 2P5GA 1HLUA 1GOAA 1UWBA 3VAGA 2WAQD 5BPMA 1Y4ZB 3SMSA 4IG0A 1T05B 4MLEA 1V4SA 2VQFF 3CD5A 4IKAA 2FVRA 2VBZA 1RKJA 3BKUA 3Q83A 4V19X 2Q1LA 3RRKA 5J1PA 3A5OC 3K17A 4YHHF 4YOWA 3WXKA 4JUZA 3WDOA 3K57A 4LF8J 5AQQA 4IRCA 5M1OA 1Q78A 1U2FA 1CVJA 2JNJA 3CWJA 5B7WA 3AA3A 2XZDB 3LQVA 1JCEA 2ZNZA 5D0GA 3C66A 4ZMMA 1HJRA 4K41A 1WHYA 4B3SJ 2GFFA 3Q22A 3D2FA 4DZ6A 4E7HA 3MMBB 1EARA 1U48A 5D77A 3CJ7A 3NF8A 4NLYA 3M32A 4DV6K 2H48B 1K9MO 3R6LB 4M94A 1QUVA 3BR9A 5L9NA 2GUIA 3QEXA 3DCAA 3GJSB 4PXDA 3PYEA 3SSQA 3N01A 5HVFA 5IFMA 5I4MA 3CYMA 5HLFA 2G1DA 1YIJS 3M7VA 2D3ZA 2OSQA 3BEXA 2YX7A 4RBUA 4I6AA 1T3NA 3HPHA 4IO9L 2D0PA 1UTAA 4LFBK 1KLMB 2E5HA 3VCDA 1J5EF 4G1PA 4WK1A 1S72N 1U1OA 2P9IB 2H5IB 1S1WB 2XMWA 3MEGA 2W42A 4DV3F 4B1YB 3PSFA 1PGZA 5KG4A 2CQHA 5KFSA 4XDCA 2DHSA 5CYQB 3I4PA 2H4YB 4NLQA 5BN9A 4CIGA 3ZETB 4IQXA 2BW2A 1ITGA 1FF2A 5C2FA 3MCSA 3CJAA 3I5CA 4CECA 4Q44A 2CWKA 4B9MA 2HBYB 4P52A 5A8RA 3KTQA 1U49A 3PKYA 4B3OB 4B3TF 3M9NB 3GP9A 2V9WA 4I0WA 2C22A 3Q8UA 4FJHA 1YZ7A 1B64A 1YJ7A 2FJDB 4EI2A 4O44A 4I4BA 1TVRB 5ETLA 2IY5B 1F0XA 2E5GA 2ZH4A 4ELTA 2JWKA 5C2CA 1GLEG 4JAXA 5L1IA 1S4FA 3HPOA 5HOOA 1XBWA 3H3NO 3NGYA 1HNWK 3AXKA 4WWSA 4CWBA 1O1WA 3PCOB 4CEOA 3OJSA 3M8YA 1VLOA 2I6WA 2ABYA 3I96A 4JI1F 4GVBA 1XMOF 4BRHA 1RWXB 4U96A 2E5LK 3C14B 4PY5A 3OTOK 3OYEA 4GV6A 1ZAVA 1SQFA 3D1HA 1FK9A 1BGXT 3U6FA 4F3OA 1YHQN 1OS5A 3RBZA 5DM6Q 4AH9A 1FESA 2R2UA 1VAZA 4DR6J 3M2UA 1JLCB 4FJNA 3VF6A 1NGFA 4WTOB 3HFVA 3H08A 3G6ES 1Q82O 3KG0A 1KHWA 3AVBA 4X4OA 4FWPA 3NMRA 1FWLA 2IA6A 3TJAA 3RWUA 4H4MB 5D6GA 1FJ7A 3MMVA 4X4TA 2DGVA 1ZM4A 3DAWA 2DPIA 1TL5A 1H2VZ 1YJNN 1WF2A 4USJC 1C0FA 4G1QA 3VQDA 1QTNB 4NYPA 3SSSA 4B8CA 3DLKA 2JFDA 5FROA 1SL0A 1ZPWX 1WBBA 2V8VA 3EGZA 4M5MA 2CJQA 4F36A 4FPIA 1GH8A 2NSCA 4OYZA 3M4XA 4ILRA 2PO4A 1UKUA 2A1RA 3EE3A 3HVTA 1TUWA 2OPPA 3DI6A 4P2SA 1T9TA 2DD8S 3LPEA 4QU6A 1FFSB 2CPJA 3DN9A 4R0EA 4HWIA 5DDRC 5LMUF 3RU0A 4UOFA 4WP9A 4DV4K 4N77A 3J81Y 3O9QA 4K0KK 2P9LB 3ZZYA 3VEYA 1FA0A 1C1AA 1HI0P 2YX4A 4CGJA 4C8LA 3DKDA 4YR3A 2DGTA 1SQKA 2OEKA 1TL3B 1YAGA 2XMAA 1B7YB 2A18A 4DHYA 5GAEP 1PAUB 1EX4A 4OZ2A 2J4RA 2FJWA 3BM7A 1WNEA 1ZBLA 2V8DA 4WKRA 3CJ5A 3SBTA 4DV0J 1FJEB 4AM6A 4DSLA 5H1SV 3U9DA 5KPZA 3I6PA 2OJ3A 2OPSB 3T1HF 1XUPO 3K58A 3H98A 2VU5A 2P9SA 3QGIA 2ATCB 2MDAA 2PIIA 4IG3B 4D3HA 4U7CA 4AQYF 1N36K 1MWMA 2KT2A 1S6PB 1H6KX 5HRSA 1SCJB 2W01A 4RX6A 4IEEA 4H4KC 3D9BA 3BO2A 3R9PA 2VQFJ 2AYGA 3AXMA 1GLBG 2VG7A 3EVOA 4J9OA 4QYZK 1C6VA 1FKPA 2NRRA 2UZAA 4PZVA 2KKZA 1P1TA 2HHHJ 2MKHA 1SS6A 2QM1A 2O8BB 2F9DA 3KUEA 2IM3A 4KV8B 5AJ3K 2UVRA 2ZJRL 5FLXY 3V9SA 4CZMA 4IWVA 2Y8WA 3TZZA 4JS5A 4LFAF 4PEOA 2ACYA 1HYSA 4CLLA 1Z25A 2NZ4A 4J8FA 3CFOA 4CBWA 2MZSA 5AZJA 4CP5A 3BF3A 4F50A 4IDKA 2FHMA 1R8CA 3BKTA 4M3TA 3UDLA 1UP1A 1IXKA 2FC8A 4BR5A 4ED1A 3C94A 4QZVB 2PYLA 4B1UB 5CHCB 3OL7A 5T7BA 4AXJA 2R8IA 3THVA 1M90T 1WI6A 1HQEB 3NAHA 3P4UB 4BQZA 5LSOA 4ED3A 1IBLJ 1T95A 1VJWA 2BA9A 1N52B 5ETKA 2VPZB 2AMCB 3ZSRA 3O9SA 3KLIA 3NNCA 2WTUA 3QEIA 2CJBA 1MSWD 2FVPA 4H0YB 3H1QA 2WZ1A 1SC1B 3VHQA 4M5HA 3VGKA 3B4MA 3PNIA 4DCJB 4DR5K 1G99A 3P5TL 5B0DA 1FXXA 4DPUA 1J5EJ 2W2QP 2XRIA 2CZ4A 1RDCA 2IA0A 3L6QA 3FDSA 3PM9A 3NMUA 2O67A 4DL7A 2A6OA 3VAKA 1MG7A 4DV3J 2B4JA 1S1VB 5F2RA 3ZZRA 5IT4A 1NK0A 5KT6A 3D0PA 1LWEA 1WORA 1DQ8A 5HP1B 3A8KA 4ELUA 3EZ5A 3L09A 4OZ3A 1N33K 4L72B 2D3UA 4PG4A 1KC8T 3OR2A 2L3MA 2Z4PA 4ED5A 3Q0AA 4Z4CA 4FZYA 2GMJA 2GX8A 2LKZA 4MYTA 4JI4F 4I7FB 3D0HE 2XCAA 3OY9A 2XCPA 3W64A 4A2BA 3QESA 4ETXA 5KGWA 4KGVB 1S0VA 2HGNA 4DR4F 4DV1K 4P2XA 2PSZA 1U6FA 4ZDNA 5B0AA 3FR0A 3OUYB 4FBTA 4C3LA 3BSAA 3QMQA 4DU8A 5KFJA 2P5VA 4FJLA 1FDAA 3WNFA 4X64K 3FBEA 4HL9A 1DTTB 3KKRA 4CGFA 3JSBA 2RT3A 3BH6B 1KAXA 1NGIA 4WCEL 4RU9A 3ZSWA 3ZSYA 1CC8A 1YQHA 2RF2B 2WOMA 3Q2SC 3CCLS 4X62K 2HWHA 3KD5E 5KFIA 4Y2CA 3R8YA 3J7AN 1DGKN 2DKOB 1BWFO 5J2MA 3QLHA 4YUDA 1JLGA 2ZM6K 1Q7LB 2DRDA 3RZAA 4YOXA 4ZITA 4ZVQB 1U1NA 2VCPA 1M5PC 1UAWA 3PJXA 2DGXA 1TYQA 1Z05A 5T7LA 4ZLLA 1C1BA 2RSQA 3MAHA 3WUHA 3TA0A 2FY8A 5KFNA 4F0HA 4OPKA 3TW0A 4NA1A 2CVIA 2IM0A 3JTOA 2VDIA 4KHUA 3R7NB 2G0JA 4YEAA 2QA4N 4JHDA 3I5AA 3K8VA 3PKMA 5GAHI 2BM1A 5F8MA 3OJUA 1PBUA 3CULA 2UP1A 3S1TA 3PSIA 1X5SA 2G8KA 2RJZA 3CJ9A 2UUWA 3H2LA 4JI8F 4FPBA 1Q8IA 1DKGD 1SIZA 3H2VE 1W2BM 2MMYA 3DRSB 1FO1A 4DSIA 5C0YA 1XNRK 2OTJN 1NZ8A 5B09A 3IRXB 3MM9B 1REGX 3G8TA 1U8SA 1TL4A 2KO1A 3S3OA 3T1YK 1HMVB 1RCHA 4C6AA 2VFVA 3CCJN 1HFEL 3HHLB 3KDOA 1S9GA 4TY8B 1FXRA 4GKKK 3H2UB 5C7PA 2AEMA 4Z0UA 3M6GA 1I5OB 1TL7B 2IRXA 2E5JA 4LREA 2DNHA 3OYGA 3ET6A 3MUTP 5JICA 3MHYA 3FK4A 1FD8A 4CD1A 2C3PA 4JLHA 2H5JB 5FRMA 1GT8A 3R6GB 3TJ9A 2V50A 3R2CJ 4WP3A 3C6AA 3MPVA 2WFBA 4PXEA 2ZBRA 3NBPB 5CY4A 2FQQB 2W2NP 1TQLA 3CB4A 5BYQA 2BXJA 2HK3A 1UFLA 3MWTA 4QIEA 2P6TA 2J0XA 2HZVA 4KY3A 4MAKA 4R5PA 1K0VA 5AQRA 3VQ5A 4FZXC 3KMQA 2Z0GA 1LWFA 1QZ5A 3PTWA 3T1HJ 1E6YA 4DTMA 4OZNA 2UVVA 3THXA 3MCAB 1VQOS 2M5YA 2VFSA 3JAMY 5KRSA 2GEMA 3CO0P 4CEFA 2BVZA 3PV8A 4KB1A 3MMAB 4P9SA 4AHCA 4OZ0A 2LECA 4F26A 3DRPA 2E9TA 4CM0A 1NB2A 1BQNB 1WSVA 1Z1ZA 3DLHA 5CZ1A 4FN5A 4QR0A 1WOPA 2KYXA 1KQSM 1U1MA 1PSDA 3DU6A 1RAFB 4N8NA 3W1YC 2Q43A 2Q66A 4LD0A 2GGPA 3X3UA 5GADP 4CFAA 4ZCIA 4CJLA 5H1SQ 2OHDA 3BZKA 3B6PA 1RDRA 3TAMB 4LJMA 4F2SA 1N5VA 1NRKA 2ZJQQ 1YITN 1RSCA 1N0UA 1GLFO 1S6QB 4MJKA 2ZQBA 3FZLA 2F96A 3LM2A 1N32K 2HRYA 5C15A 1N0VC 4K8RA 3JSYA 3Q7CA 1YLXA 3SI8A 3C16A 4H4OA 1LNQA 2FTRA 2J0WA 3ZT3A 3M1VB 1NH7A 3MCMA 2QWQA 3U9ZA 5ADXH 1PG5B 2A10A 4C8MA 1IKYA 4CRJA 4F3MA 2AJ0A 5FPDA 2FHJA 4FJ8A 4FYVB 2YNHB 4DTRA 3BY5A 3KK2B 1HBNA 3CPWR 2WBMA 5HANA 3HZGA 1VQ9S 3CCQN 3QT8A 3MMCA 1VQMN 1VRUA 4CJFA 3QT5A 2XI2A 4L74A 1JXBA 1SV5B 1MMNA 4LFBJ 1GLCG 3ZT4A 4YOUA 3CJCA 2RE1A 1SZ2A 2P8IA 1NHVA 4XAKA 1VQYA 4HTIA 2X6NA 4W5RA 4JYAF 2H3EB 4WU3A 4CEAA 2YH1A 1DARA 3AD9C 4FOEA 2KHOA 3I9V9 3VVUA 4DR3J 4AFFA 3MM6B 3HULA 4FLYA 1NJIO 2EKNA 2CJYB 2IJRA 2BE2A 4HLBA 2FGOA 3HHLD 4BROA 4EBCA 3SZ2A 4WZQA 1DHMA 3WQTA 3AY0A 3HM9A 2CH5A 4OGEA 1L3SA 4WQ4A 3RMAA 3M2VB 3W61A 5HO4A 2HGLA 3OL8A 3PYDA 4Z4GA 2F8HA 1VSLA 4H5NA 3VZIA 2DNLA 3GOIA 3QNOA 2IS3A 3OW2R 4YDDB 1RB0A 3NCRA 4PL8A 2R8HA 3B8HA 3L95X 2G8HA 7AT1B 3KK1A 3QO9B 2VOPA 2D9OA 4ZS6A 1H98A 4I68A 5AQZA 3T6BA 4TLRA 3ZZZA 2MXYA 4NLRA 3CD0A 1X0FA 2R7OA 1OH6A 2R4FA 2B7CB 1C0MA 1FNOA 5CYMA 2L9NA 3IR7B 3GFHA 2V2QA 5C25B 4KPCA 1URNA 4NEYA 1HNWJ 2G8VA 3IDHA 2FLPA 3HP9A 1EAYC 5M2RA 2E88A 3IAYA 1N54B 1E6VA 2L08A 2RVJA 4OJ1A 2XEXA 3ZSOA 1RLDA 3LUYA 1FI4A 1H2TZ 3ZZ0A 2F9TA 1AROP 4CZJA 3UCGA 2E5LJ 1RBRA 3FZKA 3DLGB 1CQMA 5KFEA 1T0TV 4X84A 1EETB 4JI5F 4TYAA 3ETOA 3BDEA 1WC0A 4NMXA 4CZKA 1Q5YA 5A2QO 3PO4A 2ASLA 3R2DJ 4NLCA 4B9QA 1WJ9A 4K5SA 4RUAA 1YJWN 5DG9A 4BRAA 3EE8A 2G13A 2IDOA 4M7YA 4LR8A 2CIMA 1X8DA 1LFPA 3FCHA 1QAXA 5RUBA 2Q3SA 3DLLQ 3CETA 3FGUA 4J7CA 2E1PA 1WACA 3MOZA 1X4EA 4MLHA 3FSYA 4CF2A 4JI8J 4TU9A 5CXTA 4M3YA 3U1MA 3WIVA 3F9KA 3LDQA 3OTCA 2KH9A 5EXWA 1JCFA 4J9SA 1GMWD 4FKXA 3C7NB 3GQCA 1CJKB 1GAOA 4JP8A 4HI2A 2VASA 4LBHA 4CO4A 1NGAA 5IS2A 2VJUA 3MEDA 3IWLA 1VSDA 4B9UA 3ULDA 4RUCA 3PO5A 1NJZA 1HNXK 4NLPA 5B0CA 4FBUA 1PJ7A 1WC4A 5IT9O 2XS5A 1AZSB 2LFVA 2GAGC 4DR7F 2IDLA 4ZVFA 4HUEA 2KRBA 4GMJB 3K5PA 4QR1A 4BDPA 2F4VK 5ETTA 1HI8A 4HH0A 3FFIB 4JK8A 5A0YA 2MZRA 3PJWA 1Z26A 3J7YU 1WELA 2CJXB 1EO1A 3GIIA 3S3NA 4FW2A 4DV4J 4AUKA 2J7KA 4ZK7M 4KHQA 3WQUA 1JXLA 2I1RA 1BWVA 3AA8A 4CZHA 2R7VA 3P5BP 2YJFA 3FBCA 2RKIB 1R6YA 1U0HB 2HFUA 5HJYA 4KHRA 4KTWA 1RWVB 1S12A 4LR7A 4Q0BB 3PR4A 3J80Y 4CJUA 4USWA 3MECA 4ZIWA 3KFWX 2JVOA 3R1HA 3V9ZA 4RL1A 3PYFA 1SKSA 2OCEA 3A2FA 1YTUA 3W9JA 1GMUA 1K73O 1XTZA 4DR2K 3HX9A 3A4TA 5BREA 4GO5X 2V4JA 1HWIA 4K2JA 2GMHA 4FVMA 5JVGQ 4A8QA 4FL9A 1O8BA 3WXMB 4LC9B 4HACB 2P9PB 3GWCA 1WKJA 2D41A 5K14A 3ENAA 3MWPA 5KG5A 5CE3A 4BRCA 4M3WA 3AQPA 4JI0J 1GNKA 2FJXA 3GIKA 4Y6IA 3KXDA 3UB5A 2DRBA 4M3RA 4DMZA 3TARA 4CO0A 1TK0A 1TL1B 4W90B 2JDJA 5AJ3J 1VK8A 3LWMA 4O4GA 4GKJK 3V6JA 4AT1B 2YTCA 4IFYB 4WZMA 4RJVA 4OX8A 3NNAA 1LK7A 1YZ6A 7FD1A 2W6LA 3OSNA 3CJRA 3F73A 2F40A 4NMLA 5LXRA 3DOLA 2GW8A 4PYAA 3M5RA 1X9SA 3S3MA 2C3OA 5HQ8A 2ZZNA 2VPXB 3LH2S 3WEEB 3A3PB 5BJRA 2KDOA 1NOZA 2YNFA 4DX7A 3CMAN 3ZLJA 3MM8A 1S6UA 4DV7F 4CBXA 2GQQA 2HHSA 1S0NA 2QT7A 3LP1B 4A8FA 1T05A 2VG6B 4NLOA 2M9KA 2QWNA 3KYLA 2O01C 2MB0B 3DHWC 2RDJA 3N4WA 1GEHA 2DK2A 4F2RA 4JV1A 2J0QD 1NM2A 3IA0A 1OWXA 8AT1B 3VAFA 2LQJA 5L38A 1RBUA 1BOTO 2RPIA 2HFZA 1W25A 2IGIA 2R8KA 1IJJA 5AQGA 1T9XA 3BREA 5I3PA 1XR7A 2R2RA 2R2SA 4OMFG 4PXCA 1N33J 3MMBA 4H5WA 3BGRB 1VSMA 3P96A 1M5OC 5D4LA 3NGIA 3VALA 2XMUA 4JOUA 2CKWA 3BN4A 2LQ5A 5EX5A 2RDIA 4BC9A 3W2WB 4IOCL 4C23A 4HT7A 2UUBK 4KH1B 4K4WA 1ZZFA 1SKRA 3VEOA 5LM7E 4QIWD 2G9OA 3D68A 4OI2A 1IBKF 4KHWA 3LDPA 1KLMA 3KJNB 2OEJA 3AA4A 2UUAF 2P9IA 2J8AA 3CDEA 3BO4A 2EWSA 4CBUA 1S1WA 1WOQA 1XQSC 4X64J 3ZO7A 2UXCF 1I94K 3AB2B 2CGLA 2A40A 3A5NC 4FVUA 4U8YA 5BRDA 5C10A 2UU9F 4A5BA 4K43A 4OLOA 3UPFA 5CYQA 3PXGa 3T9ZA 3RMBA 2WBRA 5EHHA 3SMZA 1NMDA 1CC7A 4LF9F 3ZETA 2BKPA 3CD6S 4K4ZA 4WFBL 3P6YC 1HW8A 4AILC 1KSPA 4PUOB 3R1LA 2ZM6J 4ZVSB 4EHUA 4CJQA 3SQ2A 1YTAA 4O0NA 4CVNE 2CDQA 4B3OA 2QWPA 1S5JA 4O8UA 2VH7A 5DS7A 2M52A 1BUPA 2RUSA 3UKRB 1YI2S 3KKFA 4ECYA 4URSA 2FJBB 1IBMF 1BL3A 1F60B 3NWRA 2VIHA 1TVRA 3NVMA 2EPIA 4OZ1A 2A5XA 1UW9A 3ZNUA 1RAJA 5JMVA 4DX6A 4FK4A 4ILMA 4OKKA 2HNYB 2A2DA 1FDBA 2EFVA 5BXIA 3NLCA 3UI3A 4UY8T 1NO8A 4M63C 1CJVA 4FJKA 1FERA 2QTDA 2BOPA 3TX0A 4DXLA 1RADB 2F7VA 2XY5A 4M3ZA 4EYIB 5GAGP 1Y3KA 4EU0A 1FJGJ 2Z30B 3C14A 3T1YJ 4CM2A 3KWMA 4CLYA 3PG9A 3GFXA 3VQCA 4W4MA 4LBPA 1E4GT 1ZAXA 2DGUA 4GKKJ 2CJAA 3Q86A 1M5SA 4CJRA 2P9CA 1XMQK 3FLCO 3R5CA 4A62A 2D9PA 2D3O1 1U1RA 4C9DA 4FWMA 2VBXA 4C98A 3O6QA 3NF7A 1JLCA 4OPHA 4LRBA 1UEUA 3D4JA 2DHAA 2NXNA 4RW9B 3AV9A 2QFJA 4BRLA 4DI6A 4OI6A 1GLLO 3O08A 2QA2A 2HF4A 4IO1A 1ZPVA 1ZBTA 2QK9A 4R25A 4FWQA 2CAJA 4H4MA 1JX4A 1QVGM 5GMEA 1KVIA 1LV5A 4ZJOA 1L3TA 3I82A 3MDQA 1XI1A 2VGMA 1W0HA 4M7XA 3GMGA 2KXNB 2WRMA 2DR6A 2D0AA 2A2CA 2V7ZA 2RRBA 4B08A 1B99A 1M1HA 1TUYA 5HMYA 5F8GA 2AJQA 3PYGA 3UCUP 4Q8FA 3HK2A 3F5TA 2NPFA 3B6OA 3SCKE 2M4MA 5A8WA 4B3MJ 4Z37A 1FX2A 2A1BA 1PYOB 1X4FA 1S4EA 3B54A 3W5YA 1C0UB 4B9SA 3ENOA 3VA0A 2MZ1A 4P10A 2R9LA 3BBBA 2HAFA 4QIGA 2MKIA 3W0LA 1JQGA 2J7WA 3BN7A 2FBTA 3ZTQA 1PCAA 2P9LA 1GOCA 3TX8A 3VQTA 3QGPA 1N32J 4O8KA 3C8YA 3AGRA 3VTHA 3AO4A 1ZH5A 1TL3A 2HWIA 4K4VA 4F04B 1RBSA 3TZXA 4Y2IA 2HNZA 1SJ4P 1SQGA 2FSJA 1FEHA 2BBEA 5LL6Z 2W9AA 2CNNB 4E1MA 1R59O 3FEZA 2YJEA 4JI2K 3FUYA 2VQEK 3PIOQ 1RTJB 3G82B 1VQNN 4UZCA 1E4FT 4MFBA 4MDAA 3ZEUA 4IG3A 2FSKA 1ULRA 3EWGA 2YNGB 5KFOA 4ZVEA 1U1PA 2LLZA 2V52B 1WD6A 5CAAA 4IYQA 1YJUA 5F0WA 2LQ9A 3NHGA 3SUPA 4ZVTB 3MCPA 2IMOA 4EUVA 5J2NB 4IFVA 4O44B 4CO3A 5CCMA 4ECQA 1WSJA 2ILYA 2QMXA 3TUZC 4Q7AA 3HM8A 2DR9A 2O8BA 2JEIA 3QSIA 5CZ2A 4PCQA 1KNZA 2XWXA 4KV8A 5LMNK 1DQ9A 4CYUB 4LF7F 3DOKB 4EK2A 4X4UA 1KQFB 4NYOA 1YVUA 3EGWB 2RHQB 1B3TA 3UDEA 4M5DB 5DG7A 2NNWA 2EFPA 3C6HA 3PW2A 2WVCA 2GTDA 1UPPA 1KS2A 4LR9A 3LP2B 1VSEA 2ATLA 1U2VB 3E2EA 4JB8B 4EP5A 2PAVA 5SUHA 4I6MB 1HQEA 3TQ1A 4U67Q 2I0XA 2F9WA 2K1RB 1FK9B 4O3OA 4FLXA 1KQGB 3K0JA 5EUHA 1HNZF 3QAEA 1WDDA 1WHWA 2QLWA 1HKGA 3OXLA 3CCRN 2DIUA 4Z7CA 3Q8YA 2NUUG 2MPUA 2Y3YA 3US5A 4XEIA 2AGPA 2MSSA 2KG0A 1NEEA 4CEBA 4YOTA 3OL6A 5M1QA 3JB9k 5B08A 3PUFA 3P1GA 2HIQA 4Z4FA 2DXEA 3CCTA 3EYZA 1S1VA 3DLEB 4KIAA 2IC3B 1YJNS 1U4BA 4X66K 4DR1F 4WFXA 2V2KA 2YWWA 5KFDA 3CFPA 3N5FA 1LXJA 3TNVA 3NL0A 1U2CA 3QEWA 3V4IB 5HP1A 1RWWB 5AXKA 4A47A 2XWYA 1IV0A 1RCOB 2KI2A 1BISA 5EX0A 3DLKB 5A6WA 1T3OA 3T19A 4RNFA 1T6CA 4DBQA 1XC3A 3SFGA 2P9GA 2XZTB 1WKKA 1K73T 1O5JA 2CG4A 3RBXA 1SKUB 2A42A 4C97A 2Q6CA 2B7BB 1KAYA 2AKWB 3QWPA 1VQ7N 1IWGA 1YJ9N 2XMMA 5C12A 4IRKA 1NBWA 3VQ6A 4LF5K 3CDBA 2E2PA 1HBMB 3QRQA 3VF0B 1V5VA 3MZIA 3CC2S 3QBWA 1FFWB 4KGZB 4QWAA 4GW6A 4LSNB 4PWUA 2UV8G 2RE2A 5E2QA 1JJCB 2HS0A 4EP4A 4JI7F 4DG1B 1DTTA 2EFNA 1KTVA 1Y9OA 2JHEA 3IGVA 2ZOGA 2XYHB 4IO9Q 4HDHA 1JXVA 3J7YI 2N7YA 2FSNA 3H5YA 2RF2A 5EDWA 4M42A 1UW4A 1B9FA 5GMKa 3VOVA 2OUGA 4P7TA 4FXWA 3RSEB 3J81O 4KAIA 2QMUB 2QEXN 1J9AA 1XQIA 4C3KA 2MTLA 3O8MA 1FDDA 3NS7B 4YOVA 4KC5A 1UWAA 1YBTA 5ELZA 3K9JA 1KFSA 2W25A 4CFCA 1NSAA 1VHXA 1T9VA 2OFHX 1L5UA 4YR2A 1ATRA 1FKPB 3QIDA 4LUBA 5J1NA 5KFMA 3NS5A 1L3UA 4FJJA 3GLJA 5HN0A 4BACA 3CF5L 3TWHA 3AY9A 4NLUA 1BUXA 2C2KB 2KG1A 2PA3A 4NOHA 5KPRA 5KGXA 4RNNA 1RCXB 3THWB 2FB0A 5C2GA 3VAJA 4OX9J 4LIWA 4FXVA 4IDKB 1NGJA 1YJTA 4A8WA 3L2QA 5ETOA 2ZUAA 3DRSA 2VG5B 2UUCK 3V4MA 3ETMA 3I87A 2EG1A 3NKYA 4Z4IA 3HHKA 3QZ7A 3VQBA 3MM9A 5LXYA 4DR2J 4ICLB 4ANEA 1HMVA 2C28A 4FWRA 3O8WA 1RBVA 1K44A 1KRPA 4U9RA 1N34K 4DR5F 1EQ0A 5FLXO 4TY8A 3MR3A 3TYTA 4JI3F 1UJ6A 3FEXB 1TL7A 3VGVA 1BIUA 4CIOA 2IM1A 1S6OA 1Q16B 2HLTA 2IYGA 3HDSA 3F9MA 4ZVPB 5L8RC 4O3RA 2QWLA 2B56A 2FF3B 1KVCA 1NKEA 1RAIB 1LCUA 2J76E 3O9UA 2C42A 1TUVA 2LVWA 1NU4A 5DJBA 1I3OB 2ZJPL 1SC4B 2H65B 3NBPA 1XJWB 1NHKL 4GKJJ 5D0EA 2O8EB 3HI0A 4B17A 1WSIA 3R6MA 4TQSA 3HL8A 2YWHA 2ITMA 4ZVGA 4B3SK 2PYJA 1RWPB 2HHXA 5FRNA 2VA3A 4LRCA 7FDRA 1YTYA 2HEKA 3WX8A 5LJ5Y 2Q0RA 3I8BA 2HAIA 4PG5A 1J6ZA 4WPAA 4WQ5C 4FLWA 5JUMA 3ENBA 2KYZA 2RS2A 4O5BA 3HMJG 3CJQA 5AQIA 1YDLA 3BSOA 3T5LA 1BQNA 5FJ4A 2ZBCA 2FBYA 2GO8A 1CBKA 1VJQA 2VPWB 5DLFA 3EY1A 4DFPA 1UZHA 4NX9A 4LF6F 4DCPB 4ZPTR 1RTZA 3V1OA 3TAMA 2V7YA 1P6TA 2RMLA 5TKWA 1U6BA 4BE0A 4LF7J 3V6HA 1W97L 3SAGA 1R27B 5KRTA 1JL2A 3T41A 1FX4A 3P83D 4C7QA 2HPUA 3M8RA 1P27B 1MWZA 4JV2A 4CHZA 2DNZA 4XIUA 3DWLA 1WC1A 2RQMA 1HNVB 2WVEA 3UR0A 1RYRA 1NDLA 3MAQA 3EN9A 2YNHA 4BDZA 5F8IA 1F9HA 1JLBA 3KK2A 1JNRB 2OA8A 4CLPA 4R0JA 2N4CA 3DXBA 1RBAA 1WSRA 1RAAB 2UUBJ 3OTEA 2ZITA 3ELHA 1FE4A 4ZVHA 5EY4A 4HTJA 2PGCA 4BRIA 1F6TA 1MROB 5KT5A 3WXJA 2KZZA 4ZHRA 1WG4A 4XDDA 3AT1B 3DGPB 1SV5A 3GB0A 3VQ7A 2WW4A 4DFJA 1VRTA 2ZDPA 5THWA 4TXSA 3VGMA 5L46A 2HBRB 5DGAA 1GMVA 2E1ZA 1KP6A 3CJ0A 3SYZA 2JX2A 1KFDA 3CCEN 2RD5C 5ETQA 2Q2RA 3AVCA 2UVUA 3H90A 3OXFA 5AFUH 3MM6A 2Z2LA 2E5IA 3C2PA 2I7PA 1T9WA 3AODA 1JLAB 2ITGA 4CJTA 3LAMA 3IO1A 2C2OB 2F65A 5H9FJ 4KTZA 3GG4A 3M2VA 4C2MA 4ZJLA 3OS2A 4RLEA 2IIRA 2ZWHA 4U7BA 4NLSA 3EX7B 3DXKB 4FPRA 3W9HA 2DHXA 1WF1A 4DR6K 4QW8A 1TKXB 1Q8LA 5H9EK 3QO9A 1RWMB 3IKMA 4OX6A 3QJLA 3R5DA 2D0BA 4KHNA 4BBYA 4F67A 1FTCA 4Y65A 1ZC6A 2KB2A 1U1LA 3JTPA 1FKAF 4DV2K 2C3UA 2HHVA 1YSJA 1UFWA 2HZCA 1EKEA 3PEJA 2AHOB 1J53A 4YDUC 4LH4A 5C25A 3A8YA 1VQ5N 3OV7A 1NPKA 4KREA 4PG7A 1A6LA 2P9KB 2BX6A 1LWFB 3U4LA 4LF4F 1E6YB 2G2YA 4OHVA 3LM9A 3WNEA 2DH9A 2CG8A 2GIQA 3PZPA 3WXIA 2CZVC 2WB1D 3DLGA 4QOZB 4Q8EA 4ES3A 3VQSA 3MN7A 5IWAK 1EETA 4FLZA 1IR0A 4C4WA 3CJTA 4OHXA 3M8SA 1VQ6N 2RN2A 4ZOSA 4DUZK 2FGCA 3TZYA 5I3UB 4JKBA 1RQ0A 2QKBA 2ZFHA 2JLEA 1D8YA 1AYEA 4CGGA 2DFFA 4B1WB 2V0NA 1EX8A 3TA1A 1KR4A 3HLUA 2CGKA 4FYDA 3JAMO 1TELA 3KMSA 4FSVA 3LAKA 3ULHA 3LGNA 2G4BA 2VICA 3MAAB 3FC9A 3G6VA 3R7BB 4NXNF 2V2VA 3KNAA 4AHTA 4RUBA 2X78A 2YKAA 1HKBA 3C7NA 4DV0K 1CJKA 2WW8A 3M30B 1NGDA 5E3PA 1BU6O 1H38A 3O1WA 1UEVA 3KKSA 4ENOA 2GQ2A 1VQMS 1SIWB 3OD2A 3UD3P 3IMXA 4FNIA 1F9FA 4TKTA 3G8SA 1AZSA 1H0HB 3DFEA 4WFNL 4OZ5A 1NK4A 4WCEQ 1IG8A 2C2ZB 3CTRA 3MMCB 4F4AA 1XC9A 2KXFA 1IKWA 1YJVA 3N6NA 4LF2A 3P3DA 4UW2A 1YRUA 2VQFK 2AX0A 1Q5VA 3IAM9 3FFIA 2IJNA 5I42B 1NDCA 4N5SA 2HHHK 2ETJA 3GILA 1HYVA 1HBUB 1RILA 4DU1A 2EC0A 4CW7B 2V51B 4F4YA 4I69A 3TA2A 3NCPA 4QWDA 3PY8A 5KFVA 3HRGA 3ENQA 2U1AA 4DL6A 2RKIA 1S77D 1U0HA 3U3YA 2F8TA 4CHOA 4ISFA 1BE4A 3AO1A 3GFYA 3NF6A 4Q0BA 2ACMA 2MY7A 3A5LC 3ZSZA 5GVQA 2ALZA 3GJRB 4ZVOB 4YOEA 3ZZOA 5D8HB 4JI2J 1RDBA 5AQHA 1LAVA 3SQ0A 3CCWA 3DXMB 3W7BA 4PQUA 2G2OA 3PRDA 2ZH9A 1YIJN 2P9PA 1QE1B 3D66A 3KK1B 5DDOC 1IKVB 4LF6J 1J5EK 1Y5LB 1VC0A 3IWXA 1ASWA 4LSZB 3ALYA 3RBEA 3L7PA 1H1VA 1S1XB 1X5TA 2JZ5A 2DGOA 1W2BR 2R8GA 2IBKA 1X3NA 4M5LA 4DV3K 2EX3A 1NGBA 4WFYA 5LMNJ 3CCMS 3VEXA 4LFCF 4ZPCA 4RKUC 2P6SA 3TUIC 3FZHA 3NE6A 2CPDA 4QU7A 1F5AA 1IUJA 1NAQA 2GAHC 2E6LA 4CLTA 4DQIA 5FDLB 3ITHB 4L8RB 3DU5A 4FP9A 4I9LA 1SUQB 1KCFA 1ELOA 1TV6B 3N79A 4NB4A 1CJTB 1YG0A 3BGUA 3H5XA 2GJFA 1S59A 4B3TK 3AQOA 2JLFA 2CA9A 4BCAA 4NLDA 2X1FA 3DJCA 2UVWA 4NL5A 3AGKA 3E9LA 5LSRA 1WN7A 3FGVA 1TKZB 2NSBA 4O0IA 1YJWS 2KM8B 5FD1A 1NSKL 3FMWA 2MY8A 3FMBA 1W26A 3LP1A 4E19A 2DVIA 5L1LA 2V5HG 3DXSX 2QLJB 3UVJA 4OI4A 4ECRA 4HUFA 3AVGA 3ENHA 4JV5F 3HOTA 1NGEA 2QWMA 4IRDA 4KHMA 4BREA 2FHJD 1RT7B 4KKOB 2APOA 3NOGA 4E7IA 4DN9A 3ZTRA 1N88A 4JI1K 3L3VA 2YX6A 4WJBA 1HR0F 4UOHA 3PW0A 2YKQA 1O51A 1DURA 3NGDA 4J90A 5A8KA 1M90O 1HNXF 3KD1E 3OYDA 3BGRA 2W4DA 1U1KA 2XGQA 3LP3A 1S10A 1HHSA 4OI3A 2CPEA 5J1EB 1JLFB 4H5TA 4CO5A 4CEZA 3NGZA 2RU9A 2DEJA 1BO5O 5BPNA 2FJVA 3GONA 4ER8A 1V9OA 2BE9B 3W2WA 1HUXA 1BCOA 5EN1A 2OO4A 4KGMA 2YNIB 4E3SA 1WEYA 1D8ZA 2DNOA 4CZEA 1SB6A 3OR1A 4LF5J 3IM8A 3KHLA 5AXMA 4PKGA 3TUJC 3AOAA 3GIMA 3NGSA 2HW3A 1VBZA 4ED7A 4Z4EA 5A2QU 2N3OA 4NXMF 2ZD1B 2HRUA 2MKCA 2ZH5A 4HKQA 3I9ZA 2E29A 4QS8A 4MKVA 3VQAA 5AQNA 2WVFA 4GVEA 4E7JA 4H5RA 4LY7A 2R7SA 4ZP8A 1CEZA 1BHNA 5IM0B 4YP3A 5KQ8A 3MECB 3ZX3A 1X4HA 4FKYA 3T5JA 5DO2A 3F56A 2CNOB 5T14A 4DLEA 2MGZB 2V4JB 1IM6A 2W24A 1RBTA 1HLWA 3VERA 3MM5A 1SC3B 4NRUA 3JQKA 3TVZA 1FE0A 3SQ4A 4G9ZA 1G2EA 1NXIA 2VHGA 4O23A 2Q1NA 4UQTA 3V81B 3ZX0A 2FUG9 3UKRA 5JLHA 2F7TA 2E7WA 5IT9U 3SJJA 2LP4A 3VA3A 1RHMB 3DYAB 3J80O 3BKFA 2CYYA 5ETSA 3W60A 1FXDA 4DFKA 2O8CA 1MLAA 1YBAA 2D7SA 2JEJA 2N4DA 1W9HA 3NDKA 4BR9A 1RHKB 3CVKA 1I3AA 3G87A 3BYRA 1AUSL 1L3VA 1ZS6A 1D1UA 4O0JA 3HZ6A 1H2UX 4HR2A 5AE1A 1NH8A 2XNQA 4NLGA 1SC6A 3T1HK 2J7UA 4LH5A 3ATVA 1CJUB 1TUGB 4B1ZA 2BANB 2V69A 2LEBA 3CMAS 1VOMA 1GLDG 3FRYA 4NLXA 4AQYK 3LDSA 3SBMA 1UZDA 1CS4A 1N34J 2ASMA 4MK9A 2DJWA 2DCLA 2V34A 3AB4B 2E20A 4L73A 3OVAA 2DFHA 4CJSA 2VL1A 3DLBA 4E7KA 1QAYA 4XK8C 3QZ8A 1WI8A 3VAIA 5KFRA 3QYYA 5D4NA 3CC7S 4RW9A 3O5BA 2OZMA 3W5ZA 1RAOA 4OO1J 2UXDF 1QD1A 1AB8A 5T41A 4AE5A 3DOMB 2MKSA 1NSQA 2PFUA 3HT0A 4A46A 5HSPA 4C8YA 3HD2A 4MTPA 5GIOA 1D9DA 4NI2A 4IH7A 2CH6A 2EKYA 2MKYA 3QRPA 4RTFD 1YXQA 1SXLA 3TI0A 1NNEA 4W5TA 2YY3A 3UWTA 4E89A 3FRZA 2E9ZA 3UQSA 1N8RT 3TTCA 3NGRA 3HZEA 2AA4A 1RHRB 3M8PA 2RRNA 2ADBA 1HWJA 4CLSA 4URQU 5JLFA 4PHTX 1R6VA 1HPZA 2HKEA 2CQ1A 4DV5F 2WHOA 1JJ2M 4EMDA 2HURA 3M8WA 3GG1A 1RT5A 1C0UA 1ZZNA 1S48A 3D3CJ 5AQJA 3MXHP 1RWUA 2R7XA 1NBEB 1TP7A 4E8UA 4GV3A 5CQGA 4WXWA 2Z56B 3CC4N 1JLEB 5DG8A 3PEHA 3JSMB 1I6JA 1XNQF 1IVZA 2VGNA 2DHGA 4DR3K 5HI7A 2ZKTA 3BBFA 4HEA9 1ZBSA 4MKYA 3NCQA 1IBCB 2F9JA 3C6UB 4IQMA 1HHQA 2ZJQL 4Y1CA 3IP0A 5KOXA 5EX3A 1SL1A 4JI4K 6AT1B 3RGIA 5DQIA 5E84A 4Q5VA 5IT0A 4J5OA 1RDUA 1RTJA 3G82A 4BVOA 2Y1RI 4DR4K 3CPWM 4WIQA 2YNGA 3MX2A 2D1KA 3W5XA 4OX7A 4OLAA 4DSFA 3G96A 2KXHA 1T44A 2ROPA 4YB7A 5J2NA 4KHPF 2MQMA 3MXIA 1GTEA 3KLHB 3T5KA 3HCXA 3C6TB 1X9JA 2ZGYA 4JV5J 2GVDB 1TK8A 1I51B 3EICA 1JKHB 1HKAA 4FJ7A 3UNGC 4KYZA 2VOOA 4CYUA 4FNHA 3DOKA 2CFXA 4X4QA 2WBNA 3MTJA 1OY8A 1X9WA 1HR0J 1WB9A 3MPWA 3FE1A 4CK2A 3BSCA 1CJVB 1HL6A 1ZA2B 1SBRA 4BS2A 3LL3A 1P8ZA 1R31A 2FF6A 4M5DA 1Y00A 1NDKA 3PVXA 3LP2A 3C15B 2I9SA 1U2VA 3K5LA 1PC4A 3SK3A 1N5YB 3BZCA 3T69A 2XZWA 1IM4A 3JQJA 4ECWA 4I6MA 2PZSA 3HKZD 4OIXA 2YBVA 2E66A 1Q1KA 2KU7A 2K1RA 4QS9A 2I8EA 5BRFA 2QLFB 1RXOB 2D3OR 4JKCA 1MMLA 2O3DA 2R3VA 2X1GA 3OW2M 3FQLA 1KVBA 1RBLA 1OKJA 3HBTA 4KHSA 3BPDA 5H9EJ 3M8ZA 4RCHA 3POTB 3RUBL 2CXEA 4QBUA 3G4SN 2VFTA 3KK3B 2ZVSA 3QEVA 4DV2J 3DLEA 2IC3A 4JI8K 4O3NA 2FVQA 1RAHB 3KHYA 3SQOP 2KFYA 4KI6A 1RTHA 2WVBA 1CZBA 2ROEA 3V4IA 2B4OA 5F8NA 1AFJA 3E9OA 1X4GA 2I38A 3IG1B 3JTNA 3QGGA 5KFHA 3DDKA 1TR0A 5A8WB 2PFDA 1HARA 2IAJB 3MM7B 4BRGA 3FVYA 3N0VA 2I2YA 4USTA 2PC6A 1FWPA 3DM2B 5IWAJ 2P9EA 4P75A 2D0OA 1WTBA 2DY1A 4DUZJ 3J7ZT 3I56S 3D3BJ 3QFHA 4XH1A 2KTQA 3QATA 4F8RA 4DQSA 3WC2A 4GVLA 4K2XA 4M3XA 4CEDA 1HBMA 4JBCA 1Y64A 2QSWA 3L9ZA 4P74A 1APSA 2RRAA 5F0UA 3PHTA 4LSNA 4FWNA 2R7RA 3HFKA 4CHNA 3M8QB 4DG1A 5JJBA 1TKDA 2MKKA 2QXLA 2VYPA 2C3MA 1UVNA 5GAEU 1X0PA 4GC7A 4CJVA 1K8KB 2HNZB 3EKUA 2AJ2A 5IV3A 4ZLPA 4PL7A 3G9CA 1VQNS 2IIHA 2YXLA 4M5JA 1VQPS 1VQON 3DLLL 2V63A 4EZ9A 3SBGA 4XPCA 1S97A 3RSEA 1WSFA 3Q8PB 4MFBB 3ZEUB 3Q8SB 2AJ1A 1C4CA 5C42B 4CNZA 4DTOA 2QSFA 3E01B 1KTQA 5AFUA 3D0IE 1LOTB 4WFBQ 3A8IA 3G71S 4JI0K 2D1CA 1S1TB 4IFVB 3KUGA 2FPHX 3UN3A 3SV4A 4DFMA 1G3OA 4PR6A 4JKFA 4M45A 4YHHJ 5HMZA 4DL0C 3V6KA 2QJ3A 2I5JB 3RB6A 5M1NA 4MT1A 4ECSA 4OI0A 2KFNA 2HBLA 2NPIA 2ZH3A 2B9EA 1FRKA 3THWA 3SFUA 1RT1A 4D3GA 3T5HA 2AWZA 2ZBQA 2VG5A 3W3SA 4PG6A 2ASYA 5BPLA 3TVYA 4CJ7A 2YKOA 3SI6A 4GNIA 3NH1A 1ZBIA 3EVMA 2Z1GA 4KH0B 4ICLA 5E26A 4KE5A 1JLQB 3OFHA 3CMQA 3GYXB 4DV5J 4KQZA 3CCRS 4USMA 2Y1JA 2BW7A 3TR8A 4F4KA 3MPUB 2RILA 4DZDA 2KW4A 2K06A 3KDNA 1UJ4A 1DLOB 2HQFA 4CHQA 4RUHA 4DJBA 3K59A 2X74A 4JYAK 2HQCA 5F9LA 1WF0A 4CF9A 1QQMA 2BUNA 1ZBUA 4YORA 3TPQA 4NYZA 3PFEA 3H4BA 2XI3A 2O8EA 1KDNA 3VESA 4DS4A 2ZHAA 3TEGA 3I0SB 3O6WA 2LEPA 2QLXA 3A3NB 1D3WA 4UOCA 1KD1O 4OZJA 2EK1A 4G6VB 4FWOA 4F7VA 4BR4A 3VZHA 4QPXA 4FYWB 1WBDA 4HVJA 3B4DA 2VUGA 3BH7B 2HFOA 5K5MA 2ZHOA 4LRAA 4DEZA 4BWJA 3B8AX 4RBVA 3CMEN 2V6AA 4B3TJ 4IFEA 2BJ3A 5HROB 2PT0A 4U95A 2MQQA 2H4WB 1VS3A 3SXLA 3I55S 4CH1A 2JSXA 2VONA 1FKOB 1NNDA 4BC7A 2DHHA 1VMBA 3PRVA 2BJDA 2IOCA 4X65F 3TJ8A 1VQLS 2C2NA 2GA7A 1Q0NA 3U7JA 4DUYF 3OS0A 3FSIA 2Z58B 3NCIA 5A2QY 5CD4A 4QAGA 5F1XA 3HFZB 3RAXA 3AJDA 4A8XA 3O1BA 5M2UA 3IN5A 2AD9A 4Z2XA 4FJIA 2CPHA 3G10A 3ZSVA 3ILIA 4FPAA 4NZ0A 4JI1J 1XMOJ 2W7AA 3W63A 1GLAG 4FS1A 2PFFB 1HBOB 1HNVA 2XBPA 4H5VA 4KSEB 1UVLA 1IJEB 4H0PA 4OLPA 4XTTA 1NDPA 4CF1A 2AJFE 4Q43A 4JKGB 2NRHA 3ZT2A 2HBZB 4QQBA 4ECUA 1MROA 3QINA 3BYPA 3G86A 3DGPA 1D0EA 2W2MP 3RBDA 3M2RB 1HWLA 1X7VA 2M70A 2DNGA 2ZC4A 4IR9A 1F5BA 4ED0A 2OANA 4ID1A 1LXNA 2QWRA 3NMAA 1ZOTA 2DBBA 1X5PA 2EFGA 2HVDA 4ANCA 3E8OA 4FXDA 2HVHA 3GIRA 1SJRA 4CIFA 2O8FB 1WDTA 2ROGA 3P8BB 4NLTA 1JLAA 3R3TA 1C1CB 3GTYX 1QQCA 5AQSA 1Q81T 4Y1DA 2Z2YB 3BJYA 3LANA 1FJGK 2VFUA 2QKKA 2VBYA 1T9YA 3DDIA 2HVZA 1NU0A 2XY7A 3BBCA 1B0PA 1FNMA 3CCZA 1OVYA 2ZBPA 2DY9A 3CM6A 3PRBA 1U6ZA 4U6PA 1F1BB 4EIAA 3R5JB 3DXKA 4FF1A 1D9AA 3M6XA 3J81U 2ERRA 1DAXA 1TKXA 5LT5A 5LMUJ 4OHWA 4YNQA 5BR8F 2XHCA 4DTJA 3EM1A 4I56A 5KG3A 2A6AA 4LF8F 3R27A 1KVJA 3NG8A 2W40A 5LSLA 2OAUA 2CJ9A 2MZQA 2W4PA 3SPYA 1JWWA 4USIA 2XQCA 2CGJA 4I67A 1OPZA 4IR1A 2FXUA 2SXLA 2VD3A 4LVOP 1NG9A 2XNRA 4BG9A 4CZCA 1EKSA 2FYXA 1B0TA 3GV5B 1TKTB 2KJWA 1R0AB 4B3RF 3L4QA 2P9KA 4EEYA 1TUUA 4Y2AA 3ILLA 3A8EA 4L76A 1PBAA 3IM9A 1YGYA 4P73A 2ZH6A 4PXBA 3PIPL 4AQYJ 3BUZB 4DTSA 1NMEB 3U3GA 4B3MK 5FIIA 2DTJA 3O1LA 2B8PA 2RU3A 4URGA 1Q18A 1H73A 4RW4B 3ZTSA 2WB4A 2E2OA 1XHZA 5I3UA 2KT3A 1JNZB 2ZKUA 2B4UA 3MR5A 4ZPBA 3KLFB 5B8HA 5GADU 2MLYA 4FM2A 3PW5A 5FLXU 5AR0A 3E9PA 4KRFA 2QXFA 1NJYA 1PKUA 5ETVA 1RA6A 1CG2A 2C2MB 1DY3A 1WG1A 4LFAJ 3H40A 4UY8O 2BZ2A 3FZFA 2NXJA 2RNEA 4E98A 3MAAA 3RRHA 5LJVA 4RW7B 3MR7A 4AM7A 1RU2A 3THTA 5K8NA 1NLKL 3ZT1A 1JIHA 5DQGA 3U02A 3M30A 3CSKA 3FZMA 2IVOA 2YKNB 1RT4B 3MMJA 2KL8A 1VFJA 2VBWA 1JLBB 3ZC4A 2B6AA 2RIJA 4DV7K 3UN2A 4OJ3A 2G2ZA 4P71A 2AZ1A 1RHQB 5F8HA 1RWNB 1K8AT 4ZHRB 3BGLA 2MQOA 2CQDA 3CJ1A 9ATCB 1K1SA 1LWCB 5I42A 1VRTB 1A5WA 1NCLA 2AV5A 5L1KA 4J9VA 4HT5A 4BRQA 3ZYYX 3LF0A 1HBUA 2V68A 1ITPA 3CHWA 2DNNA 2QE5A 2QW9A 5DDPC 4L75A 1NOYA 4KGKA 1P9QC 3GV7B 4YS2A 3DC2A 1C2PA 1Y7PA 2YWKA 1TU0B 2CQIA 5DRKA 1QVFM 3EJMA 4CEEA 3WNHA 3D2WA 3E3XA 4DOZA 4ZIVA 3RR8A 4HDGA 5F3ZA 2PMZD 1HQ2A 3CF5Q 1WEXA 4CEQA 4JI4J 4BC2A 2CPIA 4JD2B 1S22A 3VGLA 2FJEB 2AYBA 3HJFA 1QHAA 1NLVA 3DXMA 3OFFA 2ATQA 4DR4J 1IBKK 4BDYA 1QE1A 3SEOA 2PEBA 4FWKA 4PKHA 2Z2MA 1C4AA 5HBMB 4GV9A 1KN6A 2MYFA 1T11A 1IKVA 4K4SA 2UUAK 4DUYJ 4AD6A 2EEYA 4DQQA 5DM7L 5M1FA 4NWBA 3PIOL 2YPZA 3SJHA 3AA9A 2W9CB 1R89A 2B9YA 1S1XA 5B0EA 3UR3C 1Q9XA 3A5MC 4QWEA 5IC6B 4DL2A 5IV4A 2V8GA 3D5MA 4ITSA 1UJ5A 2XY8A 1EP4B 2UU9K 2IMWP 4A8YA 4WQ4C 1NSPA 3N6LA 2Y0BB 3RJMB 4RG8A 3TTDA 4LF9K 3PR5B 4K8ZA 2BM0A 2J6UA 4J2BA 3QMLA 3OVNA 3F2KA 3LTOA 1YBUA 2OPRA 2D0CA 5FDLA 1L3KA 3ITHA 4EYHB 3D1QA 1I39A 2IVFB 2XB2D 1FWKA 1SUQA 3GU0A 3EXYA 2ZJPQ 2KRRA 4K4YA 1TV6A 4FWLA 1CJTA 1VQ6S 1N5TA 3OS1A 2OLWA 1DJ0A 1CLQA 3J81j 3BV8A 2W41A 2LDIA 1P8GA 3VQ9A 3TAPA 2GIFA 1IBMK 4LRFA 1TKZA 3SPZA 2XMKA 1UETA 3UE2A 4IJAA 3ENWA 1YKWA 4ZPWR 4CI6A 1VQSA 1Q8BA 2R42A 4M95A 3FEYB 4ANDA 4DF4A 4EBEA 4NEZA 3MI7X 4MYUA 3OBYA 2RAQA 4DCHA 2MKJA 3VQPA 4K4XA 4J9RA 2R7QA 1R8PA 2D69A 4W5NA 2IPOB 3MK6A 4DV0F 3FJ2A 1RT7A 1NK5A 4KKOA 1FCAA 4GC6A 3ZSXA 2DH8A 3CDUA 3A3OB 1T7PA 3E66A 4A48A 3H6EA 5AQYA 3W9IA 2W8LA 1M5VC 3V1RA 3OA9A 5J1EA 1JLFA 2HFNA 4MIWA 1EHWA 3BF1A 2FLOA 3HSCA 2KFZA 5GAEI 5M1PA 5ETRA 3PACA 5AXLA 1NWKA 3TTFA 2GNKA 5JVHQ 4OHYA 1NGGA 3CIMA 4Y0FA 1IKWB 3MXMA 2CJKA 3V2UC 2HHHF 1F9EB 2YNIA 2WCXA 3ADAC 5BR8J 2LSNA 2DY4A 2E1YA 3QFWA 5A6PA 3AVNA 3SQGB 1QDUB 2EG2A 1GXUA 1OY6A 3H8YA 4RU2A 5D3GB 2DEIA 1M1KO 2J8SA 3RB0A 1HQUB 3CNQP 2ZD1A 4L3QA 4A4JA 4BR2A 2ZGZA 3B82A 1Q8KA 1YVFA 2AJ4A 4C11B 1H74A 3LW5C 4USUA 2MLZA 4OYAA 3VGTA 3QEPA 4EFHA 4JI6F 4OX9K 1X4AA 1R0CB 4B3RJ 3H42A 5IM0A 4GVMA 1K0TA 4DSEA 3JAMU 1P1LA 2P51A 2HS3A 1NHUA 3KK7A 1IBLF 3MOJB 4FK0A 1KD1T 1EJ7L 2NLXA 1FTRA 3CI5A 4F3TA 5LOQA 4YB6A 4M5IA 1U26A 2MGZA 1NPRA 5EWFA 2PEHA 2J6SA 1DTQB 5U47A 2QFIA 2Z8QA 3EEQA 4PQUB 3HJVA 2LMIA 2B9XA 2EWHA 2ZOFA 3S9HA 2NXEA 1ZM2A 3DLJA 4ID8A 4QIFA 4BLGA 1KHVA 4TLQA 3MN9A 1SJQA 3MD1A 3V81A 2P9NB 4UQGA 2HQDA 1VDHA 3BEGB 2FD2A 2OKQA 3PW7A 2HG4A 3UDVA 4EFAC 4J9NA 4U8VA 4S0MA 3DYAA 2AEFA 3KWGA 5LL6d 3ZXWA 1ZM3A 3VQ4A 4CHPA 2HMIB 5KG2A 4WF9Q 4UTGA 5KFWA 4CFDA 3MX5A 2F3JA 4O3PA 2AP1A 2FY1A 4X4VA 1DFDA 3GBTA 3NXZA 5CA5A 3FZBA 3TZWA 4E2FB 3TSPA 5CZXA 4N47A 2QL5B 4HCCA 4CD3A 2R8JA 1FT8A 1AXQA 1WEZA 3O5TB 1S9EB 2HGMA 1BA1A 4TVAB 2O8DB