3I0SA

Crystal structure of hiv reverse transcriptase in complex with inhibitor 7
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
558
structure length
558
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substituted tetrahydroquinolines as potent allosteric inhibitors of reverse transcriptase and its key mutants.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 160
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3i0sA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0sA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0sA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0sA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3i0sA05
1TKTA 2BR0A 2HVIA 2W9CB 1I6JA 4ECQA 5I42B 1N4LA 4DSKA 3MFIA 2HHQA 4RW7B 5CYMB 1UWBB 3T1AA 4K4XA 4CJ5A 2ZD1B 4YNQA 4DTNA 5DQHA 1QAIA 4CJEA 3DRRB 3OYKA 5KFSA 3VA3A 2GV9A 4DS5A 2QV6A 2JGUA 1TK8A 4M3TA 3V1QA 5KRSA 4B8AB 4E1MA 3FFIB 5HRPA 4I2QB 3SFUA 3UQSA 1QSSA 3Q8PB 3TQ1A 3LZIA 1HPZA 1QSYA 1BI4B 3D5MA 4CHPA 3UIQA 2C2EA 4KI4A 4YP3A 3T5HA 3T5KA 1GX6A 3NMAA 5DG8A 3I5AA 4IH6A 3DOKA 3MR2A 1RBUA 4RW8B 1RBTA 5KT7A 5KFXA 4NYFA 4I7FA 4WZMA 4CHQA 3AVMA 3OYGA 3TVKA 3PW2A 4RW4A 1I3AA 3BQ0A 3H98A 3SUQA 2ITGA 3TR8A 3L3VA 3RWUA 4IG3A 3V6JA 2B5JA 4KV8A 2JC1A 2R2SA 5DK5A 2P5GA 3CO9A 1JX4A 2D5RA 1TK0A 2YNFA 3SPZA 4B9MA 3Q8SB 1CXQA 1SKSA 1NJXA 2VG7B 3JSMA 2EX3A 4DTJA 1S10A 1S1UB 3DRSA 1NK7A 4FLVA 1DTQA 4YR3A 4CERA 4BWJA 2XO7A 4DWIA 3ZT4A 3KHLA 1U49A 2E9ZA 2PZSA 3T5JA 1XR7A 5J2PA 1LV5A 2AGOA 1RBVA 2E4LA 3GILA 1HNVB 3LP2A 1C6VA 1RNHA 1RT1A 2HHSA 2EC0A 4JLHA 3K59A 4F4ZA 1XC9A 3NF7A 2BQUA 3PO5A 3VQDA 5C24A 1W9HA 4BE1A 3SQ2A 3EPIA 4KB7A 2FBXA 3TARA 4F4YA 1ASUA 3RB6A 3G0ZA 5HLFA 2VA3A 3OYFA 3SYZA 2IM1A 3I0SB 2BRKA 3UR0A 3AVGA 4QOZB 1X9MA 4KHMA 5EWEA 4B9LA 4JV0A 2OH2A 2VG5B 4W5RA 1S5JA 4FVMA 1JLGA 3SQ1A 4AILC 3H2LA 4BDYA 4F3TA 4ECZA 4YR0A 2HHTA 3IN5A 3CM5A 1JLEA 1LAVA 1C0UA 4NLXA 4FS1A 3CVKA 3SUPA 2IM2A 4OJRA 3OJUA 4CJ4A 1KHVA 3LAKA 3U6FA 1D9FA 4KHRA 3GIKA 4RW4B 3M8PA 1RDDA 3V9UA 3MEGB 1JLCA 5F9NA 4IR1A 4DQIA 1BCMA 4CFCA 2ZE2B 1TK5A 4EBDA 3WNFA 1RT1B 4ZPDA 2KFZA 5KFUA 2FLLA 3H4DA 1HPZB 3GV5B 1N6QB 4ICLB 3HXMA 2HHUA 2Q3SA 1UWBA 4KRFA 5KG7A 3L2WA 3CDWA 4KHWA 4U6PA 3HJFA 3ZSZA 3KLVA 1FKOB 4IFVB 3RR7A 1QHTA 1SV5B 4TQSA 1S97A 1HNIA 4K4ZA 4DLGA 2Z1HA 1IKWA 3QLHB 1NKCA 5KFJA 4Z4HA 4H4OA 1REVA 3GV7B 5KT6A 3N6LA 1QUVA 4ECRA 5DG9A 2UVRA 1SL0A 1BI4A 4IG3B 4O3NA 1XHXA 4Y2CA 3KLFA 3DOLB 3MR6A 4O5BA 3K5NA 3QEPA 3ZCMA 3ZSQA 4JV1A 4CGGA 2CJQA 3V1OA 2Z1JA 4CHNA 3OYHA 2KQ2A 2HWIA 3DLRA 3S3MA 1HMVB 4IKFA 3G6XA 3G6VA 3CG7A 3ISND 3OYJA 5KFPA 1HQEA 2F8EX 4Q8FA 3EYZA 5DLFA 2XCAA 4FZZA 1XR6A 1SH0A 5KG4A 2W9CA 1BGXT 1RCHA 3SJJA 1JLBB 4FJHA 4CHZA 3H5YA 3CWJA 3DLKA 3HKWA 2FLNA 2OPPB 4FJNA 3MECA 2XCPA 3KTQA 4RW6B 1GX5A 1SH2A 2A1SA 4ECYA 5E41A 2IM3A 4I2PB 3NAHA 3NH0A 4R0EA 3A2FA 4N47A 2XHBA 4ED0A 3K57A 3HPHA 4WXWA 1YTUA 3CJ5A 3VQQA 1J5OB 4PQUA 5C25B 1VRUA 2JLEA 4BACA 3KLIB 4FM2A 4AHVA 3F9KA 2C28A 1B9FA 1T3NA 2WONA 4FJLA 4KI6A 3RTVA 1S1XB 3EY1A 5K14B 1QTMA 2YNHA 3DLEA 3H5SA 1JKHB 2UVVA 3HYFA 3MXJA 1VSMA 5CYQB 1JXLA 3KLGB 4LD0A 3L8BA 1S0OA 4KREA 2P1JA 1A5WA 4O0JA 2P5OA 1HNIB 2A1RA 1ZBLA 4KHUA 4IKAA 1JLAA 4FLUA 5DGBA 3L2QA 2B6AA 3SUNA 4EP5A 1RT4B 2HW3A 4ZMMA 1JLGB 1BCOA 2X6SA 1KTQA 2IJNA 1S9GA 5L1KA 4OL8A 2W8KA 3MEEB 3KJVB 4Q45A 4GC7A 4N41A 2IDOA 4EYIB 1ZTTA 3AVNA 3TWHA 4FYDA 3E01A 4PWDB 1RTHA 3CDUA 2HNZB 1GOAA 4FJGA 1S1UA 1N5YB 3SQ0A 3DYAB 1KCFA 3QO9B 5F8HA 4WE1B 2F96A 4MQ3A 1IKYA 5DQGA 2YNGA 3QIDA 4ECWA 2J6TA 1T05A 1NK4A 3IGVA 2VWJA 2UVWA 1TKDA 4M42A 3HL8A 5HRNA 2IGIA 3CDEA 3OJSA 4DF8A 3K58A 4CJPA 1HYSA 4DTUA 4E89A 4KAZA 4W5TA 3OL6A 2D0AA 3DDKA 4NLSA 4DFKA 4NCAA 1D8YA 3VQ5A 3OYIA 4FM0A 4NZ0A 1FK9A 4ELTA 1J5OA 4ZVFA 2B6AB 3H5UA 4O0IA 1NKEA 4C8NA 3KOAA 4DL6A 1KVAA 3OSPA 1LAWA 5KG1A 3OYDA 4QWDA 3KLIA 3QGIA 4F4XA 5C42B 4ECVA 1OS5A 3SNNA 3SZ2A 3AVFA 1XHZA 4TLRA 4XPCA 3FQKA 4OGCA 5HROA 3AO4A 2AGQA 1Z4UA 3LP3A 3OS0A 1T8EA 4J9MA 4KTWA 3C6TA 3CM6A 3AVCA 3IG1A 2R8IA 5L1JA 3JSMB 2DFFA 1DLOB 3HVTA 4Q44A 2XY5A 3I8DA 1WAFA 3Q8QB 4R5PB 4DFPA 1S6PA 1JL2A 3SUOA 3O3GA 4KFBA 5T7BA 1LW2B 4FLYA 3T3FA 2O4GA 4O44B 3ZSVA 3K2PA 1LWFA 1CXUA 3FDSA 4CGJA 1ZBIA 3D45A 1VSDA 4CJQA 4XPEA 1HYSB 2AX1A 3TAPA 1NK8A 3E01B 4G1QA 1JLQB 4J2DA 3FRZA 5KFHA 5K14A 2BGGA 3VQBA 4ZHRB 3N6MA 4IRCA 2C2DA 2F8SA 4F50A 4N76A 2YNGB 3BSOA 3M9NB 3ITHA 4JUZA 3MEEA 1NJYA 3VQ4A 4Y34A 4NLWA 1S9EA 1IKVA 1W25A 3OHAA 4ED7A 1KFDA 4IRDA 3NE6A 1LWCA 2VG5A 4CF0A 5KG6A 4K4UA 4CK3A 2ZQBA 4E7IA 2FVRA 4FLXA 2ILZA 4NLDA 2AJQA 3KLFB 2XWYA 5HLFB 4WE1A 3SPYA 1JLEB 4CEAA 2HWHA 3MTKA 4RNMA 3IAYA 1MMLA 4E7KA 3G6YA 4DSEA 4IOBA 4WZQA 3IRXA 4CJFA 4B3OA 2V9WA 4OLAA 2I5JA 1LWEA 2AQ4A 4RNHA 3M8QB 4FJ5A 1KHWA 3DLHA 2F8TA 3MEDA 4FLZA 4F8RA 4CJ3A 2OPQA 1C0UB 4ZTJA 4CJKA 2O5DA 1S1TB 1R0AB 2B43A 2WOMB 2OPPA 2V4QA 4ID5A 3PR4A 3DYAA 4HHTA 3V4IB 3BSAA 2BANB 5DQIA 2C22A 3KLEB 3RRHA 5L1IA 3ZSWA 1RDAA 4HCBA 4MIAA 1D0EA 3C6UB 3OS2A 5L1LA 3KK1B 3I0RB 1O1WA 1NKBA 4O3OA 2C2RA 3L2RA 1NHUA 4IFYA 3RB4A 4F4KA 4ZPAA 2PY5A 4HVJA 4CF9A 4YR2A 3MAQA 5F9LA 4JS4A 5KGXA 1TL1B 5KFGA 4IH7A 3S3OA 4Y1DA 1VSIA 4K50A 4FJKA 4ECTA 4CJUA 4JV2A 4IG0B 3BQ2A 1BIUA 1MU2A 4QW9A 4RW8A 3M8RA 2FVCA 3QNNA 4FJXA 4OPKA 1TQLA 2W42A 3OHBA 4DTOA 1Q9YA 3OYMA 3GIMA 3PZPA 4YFUA 4H54A 3BSNA 4I2QA 3AA4A 4ELVA 4NLPA 2IM0A 2HVHA 2G8HA 1TL3B 4CEFA 2D3UA 2B5JB 4ZP7A 4W5OA 1Q8IA 2B4JA 1ZETA 5FROA 1TKXB 3KD5E 3ZT2A 3OYLA 5KG2A 2D3ZA 2AWZA 5KFLA 1RT5A 2WB4A 1DTTB 4RU9A 5F8GA 5KFFA 4X2BA 3V81A 4M3ZA 3NH1A 4E7LA 4BWMA 2RKIB 4J2BA 4QW8A 4KV8B 1RT3A 4GC6A 5JS1A 4CEQA 4CK1A 1T05B 2OPQB 3DLGA 1TVRB 3CJ3A 4GW6A 4K4SA 2HNDB 4EBCA 4KTQA 3RMDA 4RW6A 1WAJA 1S49A 1Q9XA 2XY8A 5FRMA 4IRKA 3AVKA 1L3UA 2WRMA 2WHOA 4AHCA 3DMJB 4C8MA 3AA3A 3T5LA 4B08A 1BHLA 2QK9A 3BQ1A 3FQLA 4NLGA 3DRPB 3VN5A 1U4BA 3C6UA 5J2NB 3CQ8A 3KK1A 4FK0A 2D0CA 1UAXA 2FVPA 4TY9A 4CGDA 4DQQA 1RT6B 4DU3A 4BE2A 5J1EB 1A5VA 2KZZA 4FCYA 4B8CA 3EZ5A 3RRGA 4DSJA 4K4VA 5EUHA 4KHYA 3VQCA 3KLEA 5D3GA 4EO6A 4PY5A 4AHRA 3QYYA 4QAGA 2DFEA 2OPRA 2E9RX 2PYJA 4K4TA 5KT4A 2D0BA 3V4IA 5DG7A 3QO9A 4HCCA 4DU1A 3E51A 3NBPB 3QNOA 3K5LA 4Z4FA 1S0NA 3C94A 4ZP9A 5C24B 5HBMB 3AVHA 4H4MB 2XC9A 1SH3A 2HAIA 1KVBA 1S1VA 4B9TA 4DG1A 2NUBA 4FS2A 4DTRA 1WNSA 1N5YA 1C1AA 4ECUA 2WK4A 4CGHA 2WOMA 1DTQB 4CEZA 3QEIA 3KD1E 2BQRA 3S3NA 2BANA 4KKOA 4QWEA 5SZTA 1EKEA 4FW2A 1T7PA 2AX0A 1KVCA 4NLVA 4CEBA 4EP4A 4DTSA 4O44A 1ASWA 3P5JA 4MKBA 3PO4A 2YNIA 4EBEA 4CHOA 1EP4A 4Q0BB 4CEOA 1TP7A 3KMSA 3LANA 3ZT3A 3TAFA 5FDLB 2I1RA 1WSGA 3VQ7A 2E9TA 3SQ4A 3HK2A 3KK2A 1Z25A 5FRNA 4IR9A 1S0MA 2OYQA 4NYZA 4DQPA 2ASJA 4ZVHA 4TY8A 2FJVA 1RBSA 4JRQA 4OKKA 4WYLA 2YHAA 1BQMB 4IDKA 4CIFA 3HVRA 4TYBA 5KFTA 2G8VA 2GIRA 1LWCB 4LQ3A 3OL9A 3QEWA 1X9SA 3DOLA 2DTUA 1S1WA 1RILA 1LWFB 1HQEB 2GC8A 3KK3A 3VQ8A 3V9ZA 4DG1B 1HJRA 4ECSA 4QPXA 4FJMA 2Z1IA 3DLKB 4LY7A 2DPIA 3QEVA 4CE9A 3OLBA 3PX6A 4W5NA 3MXMA 1YVUA 4ED2A 1LW2A 3NDKA 4CK2A 1SKWA 3RB3A 3KKSA 4JS5A 1TKZB 3NHGA 3PUFA 3V9SA 1RT3B 2IC3B 4AHUA 3QZ8A 1C0TB 3TI0A 1IH7A 4FK4A 3WNHA 4Z4IA 4PUOB 1CLQA 4EO8A 5KFAA 2XRIA 3CJ2A 1QS4A 3DMJA 4O4GA 2UUWA 4NRUA 2JEIA 4MH8A 3BJYA 5KG3A 2R2RA 3NGYA 1HMVA 5KFYA 2BE2A 2IMWP 1VRTA 2RF2A 3T19A 3SFGA 2HMIB 4KHNA 5CY4A 4Y2AA 4DL2A 3QETA 4Q0BA 1TGOA 3RAXA 4J2AA 3D28A 4J2EA 4CJRA 4WFZA 3NGDA 3P83D 2YKNB 3NAEA 1U47A 4M3RA 3MF5A 4URSA 1IG9A 1HQUA 4IG0A 3LP0A 4DLEA 4E3SA 3DOKB 5KFWA 1TAUA 2FVQA 3ZSRA 5EWFA 3L3UA 1RYSA 3OL8A 3RBEA 1X1PA 1UA1A 3NCIA 5J2MA 4IDKB 4OGEA 3GYNA 2Y1IA 1D1UA 3EZUA 3HO1A 2HB5A 4KKOB 1KFSA 1S48A 4WFXA 3DLBA 3VQEA 1S9GB 4LSNA 4ED6A 1TL3A 3HVWA 2FJXA 4CECA 2OPSB 3I5BA 3Q8RB 3AVAA 2YNIB 4NLUA 2ZE2A 1QSLA 4MK8A 1TKXA 1J53A 3AVJA 4AHSA 3LPTA 4PWDA 1L5UA 1TL1A 4Q5VA 3VQ6A 4HUGA 2VWKA 1UA0A 5KG5A 1IKXA 1VSEA 3PX4A 1RDRA 2BDPA 3QESA 4KPYA 4TY8B 1L3VA 3RBDA 1JLCB 3H40A 5DLGA 2AU0A 4I9LA 3LP2B 4PQUB 3H4BA 1NK6A 2R7YA 3O4QA 5KFNA 2OZSA 3F73A 4J9QA 4RW9B 1TVRA 1RDCA 4ZVEA 1XI1A 1WSFA 4F2SA 3V6DA 3TAEA 4CIGA 1A5XA 5HP1A 3G86A 3OS1A 3QIPA 2ILYA 1BISA 1RTHB 4EZ6A 2FBTA 3QEXA 1RA6A 4IH5A 1I39A 1F21A 3MXIA 4BE0A 1GOCA 3C95A 5D3GB 4CGIA 1LW0B 4QWCA 3VQAA 1WN7A 2LSNA 2VG6A 4AH9A 2V0NA 3V9WA 3SV4A 2ASLA 3SV3A 3S9HA 2YKNA 4GVMA 4CJVA 3THVA 3NF6A 2RKIA 3OYCA 3MR3A 2RPIA 1IO2A 3AO2A 4MKAA 4EEYA 4TQRA 4DL4A 1EXQA 1UOCA 3ZSYA 3U3GA 4Y3CA 2IS3A 5DGAA 3CJ4A 1ZBHA 5KFIA 4E1NA 3BDPA 2G8UA 1CSJA 5KT2A 4DMNA 3GQCA 3DRRA 3ZSOA 5EU7A 4J9RA 4KBIA 4FZYA 3DRPA 1TKZA 3NGIA 3PV8A 2BQ3A 4FJ9A 3SCXA 4Y1CA 4GMJB 5JS2A 3LALA 3UPFA 3WNGA 2Y1JA 4KHSA 4J9SA 4MIBA 3IG1B 3NFAA 1U09A 1QE1B 4L8RB 3RMCA 2QKKA 1K1SA 3AO5A 1RA7A 4RZRA 2WCXA 4XO0A 4N56A 3D0PA 2HNYB 2HHWA 5I3UA 1D9DA 3ASMA 4CEDA 1RT6A 4M3YA 2FBYA 4CESA 3V1RA 1JLFB 5C42A 5KTQA 3NBPA 4MK7A 4RW7A 4G1QB 1SUQB 2R2UA 5F8IA 4CEEA 3P1GA 1S1XA 2ZD1A 5HRRA 4BDPA 4ID1A 3KK3B 4PA1A 3QLHA 5C5JA 4Q8EA 3HSTB 2XGQA 5CZ2A 4BDZA 4ID5B 2XY6A 2VG6B 4FBUA 1IKXB 2KW4A 5KFKA 4CJLA 2CKWA 5KFVA 2R8GA 3V6DB 4LSNB 1RT4A 3PW4A 3WNEA 4FJIA 5J2QB 4KO0B 4CFBA 1WSEA 1WNEA 1IKYB 4O3PA 3K5OA 3IS9A 3KJVA 1EP4B 3QERA 3KLHA 1BQNA 2D7SA 5CZ1A 3O3FA 3OSNA 2DFHA 2J6UA 3IGNA 4FJ8A 3AA2A 4FM1A 2HNZA 2ETJA 3M8PB 4DL5A 3CFOA 3QZ7A 4OKEA 4ZHRA 2ATLA 1T94A 4LSLB 1C2PA 3OYEA 1RBRA 5F8LA 3GIJA 4TXSA 3M8SA 2KTQA 5J2PB 1J9AA 4DTMA 4URGA 4AHTA 4MK9A 3KMQA 2E6LA 4R8UB 2VG7A 1HYZA 3BGRA 2YHBA 3RMAA 4DU4A 4I2PA 2X78A 4M95A 3RMBA 3DRSB 4K8XA 4NCBA 1L3TA 5KFDA 3O3HA 3CJ0A 5KFMA 1WLJA 1VSLA 1ZBFA 2XI2A 1EETB 3HHKA 4NCGA 3RAQA 4FJ7A 3KNAA 4DFMA 3LP1B 2G8WA 1HARA 2BRLA 2UUTA 1DLOA 3KIOA 1T03A 4NLYA 3GIIA 1C1CB 1HNVA 1KLMB 1C1BA 4KO0A 4M3WA 1K6YA 1JLFA 2RN2A 3AVIA 4B9VA 3N6NA 3VQ9A 1RTJA 2UVUA 3ICLA 4DSLA 4F2RA 1S6QA 1B92A 1G15A 4Q43A 1U04A 1C0TA 3BSCA 3NF9A 2WTFA 3ALYA 3LP0B 1X9WA 2HNYA 4O3SA 4TYAA 1VSHA 2PYLA 1U48A 4DQSA 4DF4A 3HVTB 1KSPA 5J2MB 4NLOA 2JEJA 4E19A 3H08A 4EYHB 1YTAA 4HTUA 4RG8A 1JLQA 1Z26A 5KFBA 4KSEB 3PW0A 1CZ9A 1Y97A 4KFBB 3TAGA 4FXDA 3I5CA 1N56A 3O4NA 3MFHA 1CZBA 5SWMA 1VRTB 4CCHA 3L2VA 4RNFA 1IKWB 2YV0X 4B9UA 1FKPA 2ATQA 3PJWA 3LWLA 2JEGA 1BQNB 1VSKA 1JLBA 2HNDA 5I42A 4QWBA 1SUQA 3ISNC 3VQPA 4XIUA 4WXOA 3TAQA 5KFQA 5HRSA 1HQUB 2RDIA 1JXEA 1MU2B 4CF8A 2RF2B 4CFDA 1SV5A 1EX4A 3PY8A 3JYTA 2FJWA 1RTDA 3HP9A 2AGPA 2OA8A 4H4OB 4C8OA 3DLGB 2XI3A 4CIEA 4F4WA 4DL3A 3FFIA 3CYMA 2W9BA 3ZSXA 1S6QB 1N6QA 2I5JB 4Z4CA 5DMRA 3VA0A 2DPJA 4H4MA 1N48A 5KI6A 2W7OA 1ITGA 4YQWA 2IBKA 1KRPA 1W0HA 4FJJA 3B6OA 5CYQA 3PX0A 4DEZA 2O4IA 4FLWA 1JXBA 4DS4A 2FC0A 4KAIA 5JUMA 2GIQA 5KFCA 1HYVA 3B6PA 2OPRB 3QGGA 1NOZA 3H5XA 4ZP6A 4B3OB 1BL3A 4E7JA 4DQRA 4R8UA 3PVXA 4OVLA 5J2QA 1ASVA 3KHHA 4DTPA 4KE5A 2JC0A 1SL1A 2OZMA 4J9KA 2YKMB 3SI8A 4JRPA 3LDSA 4RNOA 3RB0A 4ZTFA 4CHYA 1RAJA 4ELUA 3GV8B 1S4FA 4NCGB 3KK2B 2YNFB 4DL7A 4DTXA 3UDLA 3BGRB 3PR5B 1RT7B 3M9OB 3QIPB 4ED1A 4ED3A 2DY4A 5F8NA 1RTIA 3DM2A 4NLQA 1KLMA 1JKHA 3CFRA 4O3QA 3V6KA 3NF8A 4B9SA 1KLNA 3L2UA 2D41A 3LZJA 4URQU 3NGZA 1JLAB 3M9MB 3AVBA 5HBMA 3H59A 3OYNA 4RW9A 5FDLA 2W7PA 1RDBA 3HPGA 1NJZA 3QGHA 2FLPA 4N5SA 1VRUB 4WYWA 2IOCA 2XGPA 1VSJA 3HP6A 2X74A 2X6NA 3MECB 1J54A 1YVFA 4H8KA 3BREA 4CJTA 3V6HA 1JIHA 3CIZA 1WSIA 4I9QA 1S9EB 3IRXB 4K4YA 4DSIA 1NOYA 4K4WA 3I0SA 1RT5B 3ZT1A 1VSFA 1B9DA 4M3XA 4NLRA 4ZP8A 4WFYA 2W9BB 4NLTA 3AVLA 4YMEA 4KTZA 2YKMA 1RYRA 3DI6A 1QQCA 3LWMA 2IAJB 2KZMA 2E6MA 3TAMB 3IS9B 3KLGA 3JYTB 3KLHB 4J9LA 5KRTA 1RT7A 4I7FB 3OYBA 2G8FA 1QE1A 1WSHA 5T14A 4UQGA 3VQSA 1NK0A 1XWLA 4ZPBA 1S6PB 3NL0A 2HHXA 3K5MA 3NKYA 4Z0UA 1RTDB 4CF1A 1HRHA 4FK2A 4PUOA 4OKJA 4ZVGA 2G8KA 2ASDA 2QKBA 4HUFA 3PHEA 4O4GB 5HROB 3HM9A 4C8LA 1XR5A 4CGFA 4HYKA 5I3UB 1RTIB 3DM2B 2EHGA 2BE2B 1U45A 2HMIA 4DSFA 3KHRA 1VK0A 1BIZA 3ULDA 3AA5X 3HT3A 4IFYB 1BQMA 1C0MA 2IC3A 1FK9B 1TKTB 3LP1A 4R5PA 3ZT0A 3V9XA 4FLTA 1TV6A 2Z1GA 2QXFA 5CYMA 3FSIA 1REVB 2IAJA 1S1WB 5KT5A 4J9NA 2QE5A 1NK5A 4LH5A 2VA2A 4M41A 2ALZA 2R8KA 4O4RA 4RNNA 4IFVA 1FKOA 1TAQA 3C6TB 1DTTA 4E7HA 4HKQA 4F3OA 1FXXA 2G8IA 3AO1A 4K8ZA 3RR8A 1T03B 1ZBUA 5KT3A 1C1BB 2XY7A 1NHVA 4KB0A 3OYAA 5EDWA 3CFPA 4MFBB 4EZ9A 4M3UA 2V4RA 2JEFA 5KFOA 5EWGA 4B9NA 3EPGA 4QCLA 1SL2A 5HP1B 5KGWA 4O55A 2W8LA 4IBNA 4OPJA 1NJWA 2HHVA 1ZTWA 3LAMA 5F8MA 3V81B 1K1QA 3AV9A 2FVSA 4CJWA 1RT2B 3MEGA 1QAJA 5L9XA 2W9AA 4LSLA 3NH2A 5F8JA 3QIOA 1LW0A 1L3SA 5J2NA 4ZPCA 1GOBA 3LPUA 4E0DA 1ZYQA 3DI6B 1D5AA 4C8KA 4QWAA 3I0RA 3OL7A 3ITHB 1IM4A 4ECXA 4LQ9A 4ICLA 1LWEB 3G10A 4G3IA 4RUCA 4OLBA 3OVNA 2IA6A 2WONB 3BR9A 3OLAA 4NYNA 1NNDA 4DFJA 5JXSA 4FBTA 2ZKUA 4NRTA 2J6SA 1EETA 3PW5A 3TAMA 2R8JA 4U7CA 1S1TA 1R0AA 4HUEA 1NK9A 4FZXC 2IJFA 1C1CA 3U3YA 4IQXA 5KFRA 5J1EA 1S9FA 5C25A 3SI6A 4TN2A 4Z4EA 1IKVB 3OY9A 1SKRA 4M45A 3TABA 4KB1A 4ED8A 4RUAA 3QINA 1RTJB 3HVAA 1YT3A 4M94A 4TSXA 1TV6B 4W5QA 3TANA 4MFBA 3MEDB 3NAIA 4FW1A 2OPSA 1WSJA 5KFZA 3M8QA 1JL1A 1S1VB 2YNHB 3DLEB 1FKPB 4KHQA 3MR5A 4LH4A 3PJXA 3HPOA 3PW7A 4J9OA 2P51A 1RT2A 2GUIA 5KFEA 2R2TA 4O3RA 5KG0A 3KHGA 4J9PA 4CJSA 3AO3A 2GBZA 4CF2A 2R8HA 2FBVA 2RDJA 4Z4GA 4CFAA 2KFNA 3KKRA
chains in the Genus database with same CATH superfamily
1FNOA 3W2WB 1N4LA 4DSKA 4DV1K 3MFIA 2CPXA 1U0SA 4ANDA 4YNQA 1EWQA 5DQHA 1FRXA 1QAIA 2GUPA 4CJEA 3KUGA 4GO7X 1KC8T 4HTIA 2NZ4A 5KRSA 3FZHA 4B8AB 4FPBA 3I87A 3S7RA 4D3HA 4JKAA 3FMBA 1QSSA 3UI3A 2A1BA 4WQ5C 3LZIA 1HPZA 3JSBA 3Q8YA 3D5MA 4JI6F 3UCUP 4BREA 3T5HA 3T5KA 2NYIA 1U24A 2VFTA 3DOKA 3MR2A 3GPAA 1RBUA 2MEWA 5BR8K 5KFXA 3VEVA 2CPHA 5G0RB 3PW2A 2QLWA 2Q6BA 3E9PA 1U2RA 3BGLA 4PRFA 4RL1A 5C0YA 4WFBL 3BQ0A 3H98A 2RU9A 1N5QA 3ZX0A 1SXLA 2B5JA 2JC1A 2L08A 1JX4A 5IM0B 1TK0A 2YNFA 3SPZA 1X5SA 2LU2A 2OEMA 2VG7B 3WX8A 2SXLA 1PC5A 4DTJA 3RGIA 4B1YB 5T7LB 1V5IB 2XM3A 4RBVA 1S10A 1S1UB 4JD2B 4YR3A 2XO7A 3TUPA 1FDDA 1KBRA 4YORA 2A40A 3H45C 1U49A 2PZSA 2E4LA 2O8CA 2OTLS 4WBFA 1C6VA 3AHPA 3PKMA 1RNHA 3P38A 1RB0A 3OTEA 4JLHA 4F4ZA 4IDHA 2BQUA 3PO5A 2LQ9A 4GV3A 1W9HA 4PG7A 3N0VA 4MIWA 3FCWA 3TSQA 4I6WA 3DXKB 3OYFA 3SYZA 3I0SB 3UR0A 4ITSA 3W7BA 2RNEA 3M30B 1X9MA 5DDQC 1NGCA 4B9LA 1AZSA 4JV0A 1JK9B 4GY2B 2OEJA 2ZBQA 1NSQA 3SQ1A 2Z2YB 4AILC 1W2BR 3BYPA 4BDYA 2HHTA 1RWPB 1N36F 1LAVA 4J90A 4QS9A 2CG8A 5RUBA 4OJRA 1UJ6A 3CCUN 3FBBA 3C66A 3MD3A 3GIKA 4RW4B 4DV3F 3M8PA 1YRUA 5LMUK 3TA0A 1JLCA 2KKHA 3V2UC 5F9NA 4Z94A 4IR1A 4DZ6A 1I94K 3WNFA 2MKYA 3HHLC 1ZC6A 1R8CA 2EFVA 4BGBA 3HXMA 1VK3A 3A5OC 2ZC4A 3WBZA 4KRFA 2FGOA 1NNEA 3QSIA 2RT3A 2BACA 4U6PA 3OTOJ 2ZITA 5JMNA 3ZSZA 4LRFA 4IFVB 2L41A 1XQIA 2NS1B 1QHTA 1SV5B 1S97A 4HHHA 4J37A 4DLGA 5IQQA 1IKWA 3QLHB 2IJRA 4ES3A 4BRPA 5DDPC 2AD9A 1QUVA 3HLUA 4U96A 2FHMA 4ZOSA 2COLA 2H54B 1ITPA 3D6FB 2D3OR 3TQEA 4CRJA 3KLFA 3E3XA 3DOLB 2CJYB 4IQMA 4M5HA 4OZ2A 4P74A 4KJIA 1RP5A 1VQ7S 4DR2K 1FI4A 4IZ9A 2WVFA 1QAYA 4LF8F 4USWA 2O8BB 3E1YA 2QWRA 2CJQA 3V1OA 3CCWA 4GMKA 2LEPA 2OGUA 4J9VA 1AW0A 2HWIA 1M5KC 3QRRA 3PRVA 4DV5F 4DCJB 2ZNYA 4A2BA 1Q16B 1ROFA 1UZDA 3PFOA 2D1KA 1SH0A 1BGXT 1OPZA 3BGFA 1WOPA 5E0OA 3HKWA 4EIAA 2FLNA 1R59O 3VF4A 4ECYA 2IM3A 2O01C 1MROA 1TL4A 3NAHA 4FVCA 3UVJA 2XWXA 1J5OB 3TZZA 4A8OA 4C0HA 1HR0F 5J1PA 2MHEA 1VRUA 4BACA 1SJ4P 3KLIB 2NRWA 3F9KA 1M1KT 2CPJA 1HL6A 1T3NA 3IKMA 4B3SK 4XEIA 3RTVA 1S1XB 3NLCA 5LMNK 3BF4A 1LK5A 2M8DB 3DLEA 2GJ2A 3MXJA 4LD0A 1JXLA 3L8BA 1S0OA 1VJWA 2P1JA 1NB7A 4QPTA 2I8EA 2P5OA 4KHUA 1JLAA 5A2QY 3U02A 2B6AA 4NXMF 3SUNA 5DDRC 2YJFA 1LOTB 2HW3A 1NHKL 1WORA 2X6SA 1PJ7A 3TOQA 5U47A 2BUNA 3AVNA 3TWHA 4A61A 2V34A 4PWDB 2FHKA 3BKFA 3QSYB 3MMBA 4Y2KA 2HG4A 1IBCB 2ROGA 5F8HA 3H2UB 1MMNA 1SIWB 3UO0A 2F96A 4KBOA 1IKYA 2DB1A 5DQGA 2YNGA 4JI5F 3UE5A 2J6TA 2K7KA 1WC4A 2VWJA 4YN3B 2DBBA 3HL8A 2IGIA 1SQGA 5AQQA 5BN9A 4CJPA 1HYSA 3R5AA 4LRAA 2WC9A 4E89A 4HL9A 1YAGA 3GG0A 2D0AA 4NLSA 2HBMA 4DFKA 3VQ5A 1CS4B 3UVJB 1ZAWA 1KQGB 1T02A 2B6AB 3BH7B 5IXUA 4C8NA 1KVAA 5FPEA 3OYDA 5LY3A 4CH0S 3ZETB 2FHOB 3W2VA 4KYZA 2W7AA 3AVFA 1JCGA 4OGCA 4QOTA 4P7VA 5HROA 2MQMA 7AT1B 2ZF5O 2AGQA 3G8QA 1T8EA 2FGCA 3LP3A 1YBUA 1FRLA 4KTWA 4PG4A 4JI2F 2CDQA 3MWTA 2M4MA 2R8IA 4HR2A 4K5SA 2P9NB 3HVTA 1SPBP 1XMQJ 3O5TB 4E2FB 3O3GA 2O1PA 5T7BA 1H2UX 4O44B 2ZH1A 4UOCA 3BO3A 3FDSA 4WKRA 3HFZB 1BWFO 3CMAN 2QX0A 3UN3A 1KVIA 2X1BA 1HYSB 2Y8YA 2HSTA 3CCMS 3FRZA 2WW4A 5K14A 4OI2A 1HWUA 2F8SA 4N76A 4UUWA 1ZM4A 2YNGB 5L46A 3M9NB 3ITHA 4FVUA 5AQMA 4BRFA 3MWPA 4JI0J 3ZFVA 3NE6A 1LWCA 4CK3A 3T1HK 2ZQBA 4ED4A 1ACMB 2AYMA 4OYPA 1T3VA 4NO7A 4FLXA 2ILZA 4NLDA 3KLFB 5HLFB 5AQIA 2ZJRL 4JV5K 4E7KA 3ID6A 3EGWB 5IQ6A 2ZGZA 1GAOA 2OFHX 4ZPVR 5L9NA 1HBUB 3IBCB 2BTFA 4OLAA 1HPMA 3DFEA 1XN9A 4RNHA 4PYAA 3M8QB 2F8TA 4ZVSB 5DZ7A 1RI7A 1SJ1A 1NJIT 2H5EA 3EJMA 3ZZRA 4BRHA 1UW4A 3MPVA 4OPAA 4A8KA 2NUUG 2CQHA 2YX6A 2WOMB 1U1LA 3PR4A 3DYAA 4OZNA 4X66J 3V4IB 3B82A 3NNAA 1YJ9N 5DQIA 4LVOP 1RDAA 4HCBA 4MIAA 1OVQA 3C6UB 2V63A 3OS2A 5AXLA 4X66K 4O3OA 2C2RA 1VK8A 1SS6A 1NHUA 4FWKA 3RB4A 1C4CA 3HOSA 3MMCA 5KGXA 5KFGA 5CR4A 3HHLA 4BQZA 4ILLA 4Y1DA 4K50A 4UY85 4CJUA 3R97A 3UD5A 4IXCA 3GJSB 4QIFA 1X5TA 1FNMA 2FVCA 2ASYA 4FJXA 5CA5A 3CXCR 2W42A 4GV6A 1E6YA 3MAAA 4V19X 4DTOA 1Q9YA 3OYMA 3PZPA 2YBVA 2IY5B 4YFUA 4H54A 2KL8A 2VZ9A 1A9NB 2CPZA 2V51B 2G8HA 4CEFA 4OX9F 4EAHD 2R42A 2FDNA 1ZETA 1FJGK 4USUA 3CMES 1FFSB 4P2SA 5F3ZA 1NZ8A 2Q1LA 3J80U 3PM9A 1QLNA 1HNWF 1JJ2M 3BKUA 2CQIA 4X2BA 1TFWA 3V81A 4OLPA 4M3ZA 1NAQA 3M6VA 3MM6B 1VQ4N 1TELA 4FNIA 4QW8A 3SMZA 2CIMA 4KV8B 5B09A 5JS1A 2OHDA 5DO2A 2OPQB 3DLGA 1R6YA 2HNDB 2RD5C 2W4PA 2F9TA 2H65B 3AVKA 2RQCA 1M90T 3DMJB 3AA3A 3NMUA 1BHLA 2XS2A 2B8PA 3CJKB 3CQ8A 3KK1A 1UAXA 4DU3A 4NA1A 4Q7AA 1A5VA 2QWQA 4FCYA 1YI2S 4JI4J 4I6YA 1VHIA 5AR0A 3K0SA 1HW9A 3LDQA 4BRCA 2RB7A 1FJGJ 5GMKa 1HWIA 1QVFM 4QAGA 2H1YA 3R6LB 2E9RX 2PYJA 4TU8A 3HTVA 4M5MA 2ZBPA 3D0HE 3QO9A 4HCCA 3Q86A 2XEXA 3E51A 1VQ8N 5D0HA 2B7CB 3T1HF 5C24B 3AVHA 2XC9A 1UVJA 4FZVA 2OKQA 3D9BA 1S1VA 4TKTA 5LXRA 4B9TA 2VCPA 4LR8A 3SEOA 2EBEA 2QN6B 1RQ0A 3CB4A 4P75A 5HL7Q 1N5YA 3W62A 3VF0B 1U1QA 4CGHA 2WOMA 1DTQB 5LMNF 1MWQA 3S3NA 4DPUA 2MGZA 1P90A 1EKEA 1G3OA 4CEBA 4O44A 2HBJA 3AGRA 3ETOA 3I9ZA 1PAUB 3HF5A 4B1WB 4CEOA 5C10A 1TP7A 3KMSA 3LANA 3TAFA 3V4MA 2N3OA 1WSGA 4RJVA 2E9TA 1TUWA 3FBEA 1J27A 4RR5A 4U95A 5FRNA 5AZJA 1DFDA 4IR9A 3RSEA 3PSIA 2DVIA 2FJVA 4JRQA 2HQFA 4CH1A 3GTYX 4IUFA 2X1FA 3CT9A 3SQOP 4DX8H 1HNZK 4PWWA 2GIRA 3OL9A 4DV5K 5LJ3Y 2ZUAA 2P5VA 2VODA 3WXIA 1RKJA 1SAZA 2BJ9A 3V9ZA 4BRDA 4DV0F 2C2OB 4ECSA 4QPXA 5CQGA 3OTCA 1TUVA 2ZOFA 3BP8A 2QT7A 2WAQD 2QC3A 3PX6A 3MXMA 3W9JA 4U7UK 1YVUA 4M63A 1N5VA 5AXMA 3EEQA 3B4MA 4CJ7A 4DHVA 2JJ4D 3FBFA 3OW2R 1RHUB 3IUCA 3V9SA 2JDJA 1YITS 4AHUA 3QZ8A 1C0TB 4JHDA 2IA0A 3B8AX 3FSXA 4Z4IA 2AZ3A 3ZXWA 1ATRA 3CETA 4J9UE 3CJ2A 2MSTA 3AJDA 2BM0A 1AUDA 2JEIA 5GAEP 4MH8A 4ZJQA 1HMVA 5KFYA 1RWWB 1VRTA 2XS7A 3SFGA 2B3TB 1U2VB 4X4PA 3GYGA 1UCNA 2ZH2A 1TGOA 4J2AA 2FTRA 3D28A 2VJUA 4J2EA 3VEYA 4WFZA 2KI2A 3P83D 2YKNB 5HAOA 4NEZA 1HQUA 4DLEA 4E3SA 1EWRA 2OMLA 2RQMA 2VDIA 2KO1A 4UTGA 2NQPA 5EWFA 5E33A 3EM1A 3ENQA 2XLKA 3L3UA 4M7YA 1UA1A 2GFFA 5J2MA 3NCIA 3EE9A 1WEXA 3HZGA 3GYNA 4OGEA 1UJ4A 5M1QA 3EZUA 4M5DA 4KKOB 5EX5A 4WFXA 2MQPA 3DLBA 3CJ1A 1GMWD 2DY9A 4P52A 4USKA 2OPSB 4RO0A 4ERDA 3AVAA 3RSEB 4GKJK 3LA0A 1QSLA 1FT8A 1ATNA 2L9DA 3AVJA 2OJ3A 1HHSA 2GGPA 1KD1O 3AY9A 1UA0A 5KG5A 3ENBA 4B3MF 2N7YA 1RDRA 5D8HB 1L3VA 1NDPA 2HQCA 2MZSA 4W98A 5DLGA 2AU0A 4PQUB 5HJXA 2HBQB 2YKAA 4DR4K 1F3VA 1RDCA 4ZVEA 3TAEA 5JMVA 2J76E 4OYOA 2FC8A 3OS1A 2XBPA 2FBTA 4JI1K 3QEXA 4FWMA 4BE0A 4CZFA 3W5ZA 1OYEA 3OUYA 4KHPJ 5DDOC 4QWCA 1DJ0A 2V67A 3L0QA 2VG6A 4BCAA 4DV7K 1UVNA 1YHQN 4K0KF 1MWYA 4M5NA 3L7OA 2RKIA 3S8SA 3OYCA 3F41A 2MZ1A 4AFFA 1IO2A 4JKDA 3K8WA 1NB2A 2AJ1A 2VD3A 2DKOB 3HFVA 3KJFB 2XMKA 3ZSYA 2JX2A 5FIIA 2NLXA 1K8KA 1Q79A 4E1NA 3GE9A 3NS5A 3ZSOA 3BV8A 1RJJA 2EVZA 2EFNA 4J9RA 4KBIA 3DRPA 1S12A 3B8HA 2KXNB 4DBQA 3PV8A 3M8WA 3SCXA 4M5IA 4JI3F 2H51B 5JS2A 2LVWA 2O67A 5HMZA 4JI4K 4JI8F 5AQTA 4MIBA 2V2QA 1DHMA 4CO4A 2HVEA 4CI0B 4NLCA 2B9YA 2HYIB 5AFUA 2QKKA 3BY5A 1UVKA 3TTFA 3CC7N 3PHTA 3CC4S 3M05A 3OR1A 3SSQA 3G87A 5CH7B 1SQEA 4XO0A 2QA1A 2HNYB 4B3TJ 4JOUA 3VEXA 2G0CA 3KDOA 4CEDA 1RT6A 4NYOA 3TUZC 2FSJA 5LMUJ 1HI8A 5BJRA 4DR5K 3VAGA 4EMDA 4G1QB 2GQ2A 4CEEA 2H4WB 5CCMA 2GA7A 2CNNB 1UFWA 1OY8A 3R7BB 4Q8EA 3DC2A 2C2MB 3HSTB 2OP5A 4CBUA 3HZ6A 2VFVA 5CZ2A 2VG6B 1RHJB 4PL8A 2KW4A 3KVGA 1XJWB 2PMWA 2HRTA 5AQRA 1VBZA 3IR5B 1RT4A 1SC4B 3WNEA 5J2QB 4WJBA 3H6EA 1HNZJ 4WK1A 5ADXA 3KLHA 1TUUA 1BQNA 2D7SA 3OSNA 5M2RA 4OZ0A 4JD2A 2J6UA 4JI7K 4LF5J 1TFYA 5LL6Z 3D66A 2MLXA 2P9UA 3QZ7A 2OFGX 4MO5A 2UXBK 2UXDK 1JNZB 4YOVA 3NOCA 5F8LA 1SJRA 4C2MA 4YY3K 4R0JA 1QVGM 4URGA 1H73A 1KN6A 3MMCB 3O8WA 1HYZA 3NOGA 3MCNA 4DU4A 2DNRA 3O80A 3PIPQ 4J91A 4K8XA 4MAKA 5KFDA 2F9JA 4JBCA 1N5TA 4NCGA 4FJ7A 2BRLA 2KYXA 1DLOA 1LNQA 2AJ2A 1MW7A 1T0TV 1CJTA 4YHHK 4BVPA 4U7UD 4M3WA 5IT9U 1AFJA 2FF6A 4R79A 4CNYA 2A0FB 3VQ9A 1RTJA 4DSLA 3Q83A 2AMCB 1X4FA 2L9WA 1G15A 1C0TA 2CJBA 4JHDB 3LP0B 2GVDA 1X9WA 1OY9A 2VBZA 2ZDPA 3DN9A 3IWXA 3S41A 1U48A 1YTYA 4Y0FA 3VV2B 5IT4A 2I0XA 5AQZA 1KSPA 4NLOA 1IJFB 4EYHB 1YTAA 4RG8A 2ROEA 5LOQA 4KSEB 3I5CA 4ZJLA 1N56A 1QY7A 4DV4J 2E2QA 2CPIA 1JCFA 2HSEB 3NCQA 4AM7A 3BM7A 2O8DA 2CJAA 2JEGA 1VSKA 5FLXO 3AXMA 1Y5IB 1IBLF 4A8WA 1S57A 3ISNC 3VQPA 3TAQA 3M1VA 5HRSA 1K8AT 1MU2B 3KG0A 3HULA 3TW0A 4NZ7A 3G9CA 4JI3J 1IVZA 2P9SB 1Q86O 3O6QA 4JKGA 1RTDA 4USHA 3U1MA 4U8VA 4DUZF 2EKYA 4H4OB 4C8OA 3D2EA 2IVPA 5JICA 2EBGA 3TZYA 3HHNB 2DPJA 5KI6A 4YQWA 1P27B 3CDBA 2QL5B 3KXDA 4NL5A 1W0HA 3D2FA 1T9WA 2NXNA 4DEZA 2O4IA 2NXCA 4LF8K 4PPZA 5F0UA 2MDAA 3PVXA 1HI0P 1ASVA 3KHHA 3TEHB 3P49B 3RU0A 4KHPF 3HSZA 3LDSA 2OO4A 4AYBD 4DCPB 3CC7S 4PKIA 2RMLA 4ED3A 4DX7A 2Q43A 3V6KA 2ZH7A 1KLNA 1M5OC 3UDEA 3NGZA 4JI6K 1OH7A 3K9KA 3OYNA 1U0HA 1R31A 2GWJA 3HPGA 3QGHA 2QG9B 2KHDA 4MLHA 5HO4A 2ZH9A 1HLUA 2XGPA 3ATVA 1NMDA 4B3RJ 2V7ZA 2VV5A 1SKUB 1J54A 2BJ3A 1R8HA 2VJVA 5JLHA 2ZZTA 4I9QA 4U67Q 5D4PA 4IJNA 4DV3J 3JAMO 3HI0A 2XMTA 2M52A 1RT5B 3ET6A 4IO9Q 2ZBCA 2LP4A 2UYTA 2FF3B 3VOVA 4WFYA 3ZZZA 1BWEA 4YMEA 3H1VX 3LF0A 2O8EB 3LWMA 3LL3A 2IAJB 3AJ2A 4BG8A 4U7BA 4C23A 3KLHB 3VMFB 2N3LA 1QE1A 2ZHAA 2CZ4A 2W6KA 3P8BB 1NK0A 1XWLA 2HWTA 4JN4A 4DUYF 3BDEA 1NGDA 2HHXA 3K5MA 5ETKA 3THXA 3CO0P 4CYUB 3NKYA 2DEIA 2HBLA 1HKCA 3K17A 3GR1A 4C11A 2C3MA 3THYA 3U27A 4ZVGA 1T9XA 3LQVA 5GAHU 2QKBA 3QNWB 2EKNA 3VENA 3DGPB 3M7VA 3U8XA 5I3UB 3DM2B 2HMIA 2KH9A 1VK0A 3AA5X 3HT3A 1TKTB 3LP1A 5H9EJ 4CI6A 4FLTA 1DZ5A 3FSIA 2GHVC 2K1RB 5HQ8A 2Q0UA 3W9IA 3M6XA 4J9NA 3CCSS 4LH5A 2VA2A 2ALZA 2R8KA 4OX6A 4X4NA 1T6DA 4HKQA 5D0RA 4E98A 1XMOK 1WOSA 2G8IA 3AO1A 3RR8A 3GJTB 1B99A 4LFBF 1ZBUA 2DNQA 4WYBA 2QLXA 2XY7A 4KB0A 2CJ9A 3G25A 2KXHA 4DN0A 1UFKA 2CH6A 1Q7LB 2P9PA 3CFPA 4EZ9A 3ZNUA 2DCUB 4IO1A 2GMLA 2VB6A 2HGLA 1AYEA 2N82B 3CC2S 4A8XA 2FVSA 3N4WA 2J9EA 1QAJA 2W9AA 4LSLA 2AYEA 5F8JA 2V7YA 3AT1B 1GLFO 1ZYQA 1D5AA 3OL7A 4UT4A 3R27A 3J80O 2OD6A 5LMNJ 4KC5A 1S6UA 4FWPA 4RUCA 2IA6A 1TYQA 2WONB 3BR9A 1H72C 4DFJA 3HZEA 4JI7F 3K9JA 3PW5A 1R0AA 1P9QC 3DXMB 1XTZA 3RBZA 1NK9A 2P9SA 1UWAA 2IJFA 1C1CA 1S9FA 4A8QA 4FSVA 3OY9A 3TABA 1AXQA 2DR5A 4U9RA 3HVAA 1HNXJ 3KK7A 4KIAA 4FO0A 1Q8BA 2BKOA 3SLCA 3I31A 3SMSA 1LWXA 3NVMA 3MI7X 2YNHB 5JVGL 4OHVA 1OWXA 1VCTA 4KHQA 3MR5A 1RAGB 2DNPA 3HPOA 3PJXA 3QBWA 2FY1A 1NGEA 2ZHBA 1UJ5A 3C6AA 4EU0A 3J81O 4J9PA 1UKUA 2QM1A 3AO3A 3QB0A 2F8HA 3CCRS 1RBOB 2VH7A 4CFAA 3KKRA 1VQ6S 1TKTA 2NR0A 4DR5F 1I6JA 2KHOA 2PI4A 1X3MA 2J5AA 1EO1A 2HVDA 2DXDA 3T1AA 4CJ5A 1IUJA 3J7ZO 2PT0A 2LDYA 2E2NA 3DRRB 4EFHA 5KFSA 2GX9A 2QLFB 2QV6A 1BMQB 2JGUA 3HD2A 4I69A 1TK8A 4M3TA 1HKBA 1F3FA 2GHPA 2OD4A 4LF6K 1KAXA 3FFIB 4YDUC 3Q8PB 4LFCK 1E3MA 3TQ1A 1U26A 2XSJA 1CJKB 4CZGA 1BI4B 4CHPA 3J81j 3UIQA 3L7UA 4I67A 4YP3A 1GX6A 1S72N 3I5AA 4RW8B 1RBTA 2JH3A 3OFHA 2I6WA 2BUPA 4NYFA 3ZTPA 3PJ9A 4RW4A 3IAS9 1I3AA 2X3GA 3SUQA 2ITGA 3TR8A 3L3VA 1GLCG 4IG3A 1M5VC 4OYAA 4DV6K 4KV8A 5DK5A 4ZKAA 3MX2A 3UD3P 2D5RA 4PR6A 5AE1A 3R6GB 3Q8SB 4M5LA 3W8PA 1NJXA 2PIIA 4C6AA 4OJ1A 4OI1A 3U9DA 2FD2A 3DRSA 4JV5F 2AF6A 3ZT4A 2QGFB 1XBWA 1XNRJ 3M1FA 3NRBA 2UUCK 3QPIA 4HVZA 5DZ6A 4DV2F 4X64F 4USTA 3OBYA 3AH6A 3WHIA 1FX2A 3A0IX 1HNVB 4HT7A 1DKGD 4BC9A 3UN2A 3HSDA 3L4BC 2EWSA 3K59A 4MYUA 3VQDA 5M1FA 3EPIA 2R7SA 2FSKA 4KB7A 5JVHL 3VCDA 1CVJA 3G0ZA 2VA3A 2NUHA 1HUXA 2WSFC 4P2XA 3CIPA 4F0KA 3AA9A 1KVJA 4ZLJA 2VG5B 4IFEA 3O9QA 1S5JA 1CJTB 3FZLA 3EKUA 3W0LA 1LFPA 4FVMA 1QQMA 2VU5A 2DNGA 1VQYA 3H2LA 3KWGA 1VQKS 1VQPS 4YR0A 1PYOB 1LK7A 3IA0A 4TU9A 3HHEA 2F63A 2IM2A 2P9IA 3BO4A 1PBAA 5BPNA 3M1VB 2BE7D 2RVJA 3U6FA 2ZJRQ 4UW2A 4FXVA 4CO5A 1VHXA 1R8PA 3TX0A 3ZZYA 4H0YB 4EBDA 2I9SA 1RT1B 1RHQB 2CNOB 2K3KA 2FLLA 2HF3A 2Y8WA 3H0PA 2XSJB 3GV5B 2HHUA 4P6QA 1IN0A 2N4CA 4WQ4A 1BO5O 4R25A 3L2WA 4KHWA 3CSKA 3HJFA 2UXCJ 1YJWN 1RFQA 2QMXA 4WQ5A 2CQ4A 5ADZA 1HNIA 1BA1A 4ZCLA 2E1CA 2DYAA 2ZBRA 3VERA 4KR0B 1KDNA 4Y28C 1REVA 2GJFA 3GV7B 4ECRA 5DG9A 4DU7A 2C2NA 3THWA 2JL9A 1K44A 4K0KK 2JWKA 2DXEA 3MR6A 4O5BA 3CD5A 4BG9A 5GAEU 4JV1A 4CGGA 4CH7A 4KH1B 3O9TA 4GKKJ 4CHNA 3OYHA 5EN1A 1U6BA 4KGKA 4F0MA 3G6XA 1ZA1B 4X4UA 3G6VA 3U7JA 3MOJB 4F9OA 4K5RA 1VBKA 3L6QA 4HT5A 4DR7K 5KG4A 3DLLL 4DI6A 3LDNA 1JLBB 4FJHA 3CWJA 3DLKA 3PACA 3MECA 5GINA 1GX5A 1NGJA 5EX0A 1ZH5A 2FJBB 3QQCD 3NH0A 4R0EA 3K57A 4FKXA 4WXWA 2A6OA 4QIVA 1YTUA 3CJ5A 1Q95G 3PIOQ 3GONA 4QYZJ 1PIEA 4BR0A 2CQDA 3TEGA 4G1IA 1B9FA 5E84A 2DIUA 2CQ2A 3EY1A 2LKZA 1Y00A 1FVSA 2F4VJ 4PKDB 1JKHB 1WC0A 1VSMA 3MWBA 4KREA 3E66A 1A5WA 4FOIA 4F02A 1HNIB 2W4DA 3IMXA 1AZSB 4C3MA 2R7TA 3MM8A 2V94A 2Z58B 3R7SB 4LSZB 4FKYA 1YJWS 1B7YB 2OSRA 4NMLA 1VQON 1SB6A 2IJNA 3OTBA 4CTAA 2V2VA 2B7BB 1TL7A 4C3KA 2GGPB 2LLZA 3P45B 2OELA 3X3UA 2DRAA 2GS8A 3CEDA 4FYDA 1Q86T 1Y3JA 2UP1A 4YOWA 2CFXA 4BR2A 1GOAA 3HCXA 3L09A 2G0IA 4FJGA 1N5YB 1NCLA 2FUG9 2DJWA 3QIDA 2I7NA 1QDUB 2QA4N 3IGVA 4RUBA 2UVWA 4H5TA 3PIPL 3CJ7A 2E5IA 4M42A 4KH6A 3WDOA 2IYIA 5HRNA 3CDEA 2APOA 3LDPA 1SCJB 1ZAXA 4K2JA 3MCSA 2QIFA 1PSDA 1QQNA 1YBAA 3WT0A 3OR1B 2VYPA 4W5TA 2FZKB 1GLJO 2C3OA 3D6MB 3OYIA 1F6TA 2EFGA 2MMYA 4OI6A 5A8RB 4FM0A 4NZ0A 1FK9A 3VGKA 1OQ3A 2CZVC 4ELTA 4ZVFA 3H5UA 2JZ5A 4YB7A 3ZTSA 3CUNA 3T1HJ 4DPWA 3KOAA 2NXUA 4S0MA 5KG1A 3KLIA 4TLRA 2VFRA 4XPCA 1PGZA 3FQKA 1D8ZA 3KNGA 3AO4A 4DCOB 4J9MA 3CE8A 4DPXA 1KOOA 3C6TA 4IYQA 3CM6A 1FD2A 1KQFB 5L1JA 3JSMB 2DFFA 1N52B 4HACB 2YWEA 2JWLA 3QBXA 4Q44A 4ZLPA 3UE2A 1TU0B 4CM2A 1QHAA 1WAFA 1S6PA 3K5PA 3HI9A 3VR1A 1NH7A 2MSSA 2XMJA 3J81U 2O4GA 1LWFA 1CXUA 2LQ8A 5IC4B 2BE9B 1VMBA 2RHKA 3D45A 3OBWA 1WI6A 1VSDA 2PBDA 4CJQA 1VQLS 3TNVA 1H3DA 4G1QA 2RH3A 3GSDA 5KFHA 4H5NA 2HFOA 1PBUA 3RVCA 1WD6A 3NS6A 2W2OP 4ZHRB 4ZJOA 5EX3A 4Y65A 1RAAB 1NJYA 2LA6A 4OHXA 2VOOA 1S9EA 2A10A 2AP1A 1IKVA 2V9KA 2UXBJ 4B17A 4U8YA 2Q1NA 1V3ZA 4OYIA 3VEWA 4E7IA 2LXFA 2J7WA 4K8RA 4CEAA 1VIOA 1WC6A 2XYGB 4QQBA 1MMLA 5AQOA 1BD6A 3ETMA 3RAMA 5FPMA 4B3OA 1FNXH 2ZZNA 1FRIA 2V9WA 3CERA 4JKHA 3CPWR 2HQDA 1UEVA 4D3GA 1PO6A 2UUAJ 2AQ4A 3O9SA 1VQ9N 1SQKA 1QAXA 1KHWA 4CJ3A 4OMFG 2OPQA 4ZTJA 1RSCA 3SDEB 2O5DA 4CNZA 1R0AB 1GFWB 3G4SS 1NGBA 2Y0BB 2VHGA 4JB8B 4P2MA 2V4QA 4ID5A 3EXCX 1XMQF 3KLEB 3RRHA 2DTJA 2CH5A 5MAOA 4DV0K 3TPQA 2DD8S 2RHQB 1NKBA 4FYXB 2PAVA 4V19S 4IEIA 3FMWA 4F4KA 1ZM3A 4ZPTR 4C9DA 2PY5A 4HVJA 3C14A 4CF9A 5HK4A 4K25A 4DZDA 1ESVA 2ZH8A 3S3OA 1RADB 3GU0A 5LXYA 4FJKA 4IG0B 3DGPA 1U02A 2HHHK 1CBKA 2CQBA 1BIUA 4IOAL 3ZZUA 4RW8A 3HDSA 3AB2B 3QNNA 1Q4RA 1TQLA 1Y64A 2IYGA 3GIMA 2R4FA 1FXRA 1DEJA 3WXJA 1WG1A 3POTA 3BSNA 4AQYJ 1VQOS 3FRYA 2CGKA 3AA4A 2B4PA 4CZCA 2HVHA 2HGMA 2B9WA 2D3UA 3BUZB 1WF0A 4USJC 1RAOA 3FZMA 4CZMA 5IT0A 3KD5E 1FESA 2XMAA 2FHJD 4ZVUB 1Y9OA 3OYLA 5TKWA 4M63C 3RYLA 4YOUA 1YF5L 2WB4A 5IOLA 2RIJA 4RU9A 3M8YA 3CW2C 2XTJP 1RACB 3CULA 1OIAA 4CYUA 3AA8A 3NH1A 5CE3A 2R7UA 4JNEA 1RBLA 3KYLA 1WHYA 3R9PA 3EXYA 5F41A 4GC6A 4CEQA 4CK1A 1S77D 4DV0J 2CPDA 1KAZA 4X65J 2VQFJ 1TVRB 3CJ3A 4K4SA 4EBCA 4KTQA 3ZC4A 4C0BA 2D69A 2XY8A 2QEXS 1MG7A 1Z2LA 4LF6J 4AHCA 3FFKB 3WQUA 3T5LA 4B08A 2VBWA 3R1XA 1CPZA 4X4TA 2DGUA 5H9FJ 2E29A 2D0CA 3WEEB 5BREA 4CGDA 1IWGA 2LECA 4DQQA 4DUTA 4BE2A 4BR5A 3BS9A 2DRDA 4WP8A 2V8GA 3RRGA 4Z37A 2RQKA 4K4VA 3KJNB 4KHYA 1YLXA 2CPYA 4QZVB 1UP1A 5MLCV 3KLEA 2HMPA 4AHRA 3SAFA 3QYYA 4H0TB 3MM8B 2BZ2A 2J8SA 2OPRA 5IS2A 2WFBA 4BR4A 2YXLA 5DG7A 3FKBA 4Z7CA 3GFHA 5B0BA 3K5LA 1N0UA 1VHFA 3ILOA 4ZP9A 4H4MB 1H0HB 4RBUA 3FBCA 2QFJA 1SH3A 1R0BG 3SDEA 3M2UB 3AQPA 3O6WA 3HSJA 2XB2D 1MWMA 1BE4A 1HNWK 4DTRA 2IDLA 1C1AA 3JQMA 2MQQA 4ECUA 3G71N 3CCVS 5EOYA 1VC0A 3EE3A 1T7PA 4PABA 2D0OA 1HLWA 3D0GE 4YOYA 4NLVA 4DV4K 4PAAA 1FJGF 1ASWA 1KQSR 3PO4A 2YNIA 3FGVA 5GIOA 4FF4A 1EP4A 3UB5A 3M32A 4DU8A 1YVNA 2HIQA 3MR7A 4NMXA 1Z25A 4B3SJ 4OYMA 1S0MA 2E5JA 4NYZA 1NG9A 2OLWA 4ZVHA 2O8BA 1RBSA 3CCUS 2ACMA 4CT8A 2YHAA 1BQMB 2DR7A 2WZ1A 1HIYA 5A76A 5JVGQ 2PEBA 1LWCB 4M5GA 4LVNP 3P6YC 2MZRA 1YZ6A 3CMQA 1RILA 1LWFB 3AGKA 2BJEA 3KK3A 4I6MB 3VQ8A 3WZ0A 1HJRA 2KXFA 4EHUA 3QFHA 1HKGA 1W2BM 3QEVA 4CE9A 2YKPA 5ELZA 3VGVA 4K41A 4LRCA 4ED2A 3NDKA 5D0GA 4QIWD 2HK3A 3RB3A 3DNCA 1TKZB 3ZZ0A 3B54A 4L76A 3NG8A 1UTAA 1FRJA 3FCVA 4LF7J 4A2AA 5AQVA 4BRIA 1VGYA 4NB4A 3OQ2A 4EO8A 4NASA 4O4GA 1UPMB 3TU5A 2QJ3A 4NRUA 5CHIA 5HI7A 4GVBA 1Y7PA 3HHDA 2BE2A 2IMWP 3PCOB 3T19A 2AEJA 4LF4K 1WF2A 2QMWA 4X4OA 3VF6A 3VZHA 4DL2A 3MUMP 4L73A 4Q0BA 3IP0A 4CJRA 2WBRA 3NAEA 4USVA 4M3RA 2NNWA 3M2VA 2DY1A 4G1PA 4KPCA 1Y5LB 3DOKB 3NGTA 2E88A 1M1KO 2DR6A 2O66A 2UXDJ 4CM0A 1NBWA 3OL8A 1X1PA 5M1NA 5BPLA 4IDKB 3WXLA 1D1UA 3QT6A 4UOGA 1KFSA 3MN9A 1XNRK 3D3BJ 2DRBA 1VI7A 2FJXA 1OJ4A 4CECA 1NM2A 2AZ1A 3U4LA 3D67A 4MLEA 1J53A 1DY3A 2QEXN 1X3NA 4X62F 1TL1A 1HBMA 3MMBB 4N7TA 1UVMA 4HUGA 4O8KA 4DOZA 5DETA 4IOCQ 2VWKA 4FWRA 1RLCL 4RUHA 3DWLA 2CZ9A 3QESA 5T41A 3T69A 3RBDA 3HM8A 3C14B 3MUVP 3BYRA 1WSFA 4CIGA 3QFUA 1A5XA 5HP1A 2OTLN 1O0PA 1RA6A 2E2PA 2J0QD 4DKWA 3MXIA 3GG1A 3TVYA 1FKAF 4CGIA 1N36J 4PG6A 3Q0AA 4IO9L 2Y1LB 1GT8A 2G2ZA 4BLGA 2AIRB 3A8YA 3BZKA 2KT2A 4QS7A 3U1LA 1IV0A 3UCZP 3J7YP 3SV3A 2ASLA 1IR1A 3S9HA 1J5EJ 3GDQA 4CJVA 3THVA 2GEMA 4WWSA 1IQTA 3NF6A 3MR3A 2RPIA 3AD9C 3F9MA 2HS3A 4PKHA 4BC2A 2J9CA 2H9ZA 1WSRA 3AQOA 2DR8A 2DNYA 1YZ7A 5ETRA 4Y3CA 5IFMA 2IS3A 5DGAA 3CJ4A 4WFAL 5ITHA 5G0RA 5KFIA 3BDPA 1IBMK 3Q2SC 5KT2A 3C15B 4DMNA 5E3RA 4OZ1A 3OTOK 2X51A 4QR0A 4FZYA 5CHCB 1TKZA 2E7XA 2ASMA 2BQ3A 3CJKA 1N32F 1FF2A 2B9XA 2GMJA 5CD4H 1Y11A 2Y1JA 4KHSA 3M6UA 1I94F 3IG1B 4LFCF 1U09A 5A6WA 2RUSA 4L8RB 3RMCA 1FTRA 1F5BA 3MXHP 1RA7A 4RZRA 1OH6A 3TO8A 2ADCA 2HHWA 5I3UA 2ADBA 3EZOA 1A6LA 1TMMA 1O51A 3CD7A 3SCJE 2POKA 1XK8A 4P71A 4C11B 2MQOA 4CESA 3V1RA 1KAYA 5C42A 2VQEK 4OZJA 1Y0HA 4ETXA 4NI2B 2ZZMA 3QT5A 5E5NA 2ZD1A 4BDPA 5HRRA 2YJEA 4H0PA 1RAFB 3R5GA 2E5LK 5I9EB 1ZPVA 4NA3A 1T9YA 4A8FA 1ZAVA 2RE1A 1CC7A 5GAGI 4BDZA 4DQ8A 1IKXB 1HD1A 4B1UB 2CKWA 5KFVA 2PMHA 1YX2A 1Q0NA 4ZIVA 5E3QA 2VPYB 4LF5K 3KJVA 3QERA 1IBKJ 2R7WA 3EGNA 2QMUB 1K9MT 3QT8A 3VGSA 1T3OA 2HNZA 3O5BA 1W2IA 3HMJG 4OKEA 2ZWPA 1T94A 2MJNA 3UNYA 5AXKA 4LSLB 1RBRA 2DHGA 2VF3A 2OAUA 3O9RA 1CS4A 3M8SA 2ZBIA 4DTMA 4AHTA 3O2IA 1UVIA 3LDLA 5ETPA 2VG7A 1EB0A 2YHBA 4YEAA 2X78A 4M95A 3DRSB 2F1FA 3WX4A 2E1ZA 1HR0J 3BF1A 3DXKA 3CJ0A 1WLJA 5B0DA 4AXJA 2XI2A 1F9HA 3OHRA 1YJNN 4DFMA 1G99A 1K73O 2G8WA 3CCZA 3TWZA 5A8WA 2GX8A 2UUTA 2D1CA 1T03A 4NLYA 3ULEB 3ONQA 2FY8A 5GADP 1K6YA 1RU2A 2CADA 2RN2A 5AQNA 2V50A 1NGHA 1VBXA 3NF9A 2ZWOA 4O3SA 4TYAA 3E9OA 5B8HA 1S76D 5GAEI 4LFBK 4WTYA 2ZM6K 4DR3F 2HQ3A 2NRHA 4YDDB 4HTUA 1U1OA 1JLQA 1Z26A 3PRDA 2MQNA 1Y97A 1CZ9A 5AT1B 3O4NA 4NI2A 4LF8J 3A8JA 4CCHA 2PEHA 3C0BA 2MKIA 1URNA 1NMEB 3IFRA 4DV1J 2W40A 2YX7A 1NU0A 2H4YB 5E3PA 5CD4A 1Q7YO 1MWZA 3NMRA 1HA1A 1WHXA 5KFQA 3BF3A 4HEA9 1X9JA 2A2CA 4CF8A 2RF2B 1TUGB 1SV5A 5GADI 3PY8A 3CCES 3N9UC 3B6BA 4YUDA 2OA8A 3E8OA 4F4WA 1M5PC 2W9BA 2QTWA 4G6VB 2BMBA 4B3MJ 5L39A 3BZQA 1SBRA 5JVHQ 4FYWB 4FJJA 2ZJPQ 2V8DA 3NVKA 4AQYF 2GQQA 3SMPA 4B3MK 4DCHA 3WXKA 1YK9A 3B78A 4DS4A 4KAIA 3IWNC 2GW8A 5KFCA 1AT1B 3QGGA 3H5XA 4ZP6A 1BL3A 4OYXA 4OVLA 5J2QA 4FL9A 3TRGA 2VQEF 3THWB 4LFAF 4KE5A 4LFCJ 2OZMA 1EJ7L 5C2GA 3K0JA 1KS2A 5I4MA 2KHCA 4XAKA 4CHYA 4ELUA 2PA3A 2B51A 1F1BB 3KK2B 3BGRB 1RT7B 1RWUA 3HHLB 2DY4A 5F8NA 5D4NA 4MJKA 3DM2A 5F2RA 4NLQA 3PYGA 5M1PA 3MEKA 3CFRA 2ZHOA 2AJ0A 5C15A 4B9SA 3NF8A 5IV3A 3IXQA 1GXLA 3L3CA 1R89A 2IRUA 3AVBA 2W7PA 1RDBA 3P31A 1JMTA 3C16A 2CJKA 2KJWA 2IOCA 2GAHC 1VSJA 1J5EF 2NRTA 2X6NA 3MECB 4RKUC 1YVFA 2AW0A 2YH1A 2OTJS 1WC3A 3CJSA 4QR2A 2IVYA 1S9EB 3TVZA 1B0TA 2W2MP 3I0SA 3ZT1A 3O3LA 3GMGA 4N8NA 4NLRA 4ZP8A 5HVFA 4KT0C 4NLTA 3AVLA 2E7WA 3I6PA 3O9UA 3QWPA 3DI6A 1WTBA 1SZ2A 2KZMA 2LDIA 1VFJA 4CLFA 2E7VA 3TAMB 1NM1A 3JYTB 5EHHA 4J9LA 1WJ9A 1RT7A 3ID8A 4I7FB 3OYBA 4ILHA 4W90B 1WSHA 5LSRA 5T14A 3H90A 3F44A 4ZPBA 2WSCC 5BN8A 1ICEB 1HBNA 2GELA 3GJQB 5AQUA 2UUBF 4Z0UA 1FEHA 2AEMA 1RTDB 1DARA 3IMQJ 4GO5X 4FK2A 4Q2MA 2G8KA 2DIVA 2JVOA 2OI2A 1UAWA 2A3JA 4HWIA 3AAQA 2G13A 3HM9A 4C8LA 2A2DA 4YOTA 5H9EK 1U45A 5CXTA 1DURA 4DSFA 4JK9A 8RUCA 1BIZA 3ULDA 3C6HA 1F9FA 1XEZA 3SCKE 3MDFA 1BQMA 2MZTA 1C0MA 1FERA 1TZ0A 4A59A 4CD3A 1FK9B 4N77A 4R5PA 3H2VE 3T1YJ 3WEEA 3ZT0A 4C48A 2CPFA 2Z1GA 2QXFA 2Q2RA 4M5JA 2I7PA 4M41A 3TUIC 1Q1KA 1BUPA 2UUCJ 2B4UA 2GAGC 4IFVA 4ER8A 1TAQA 4PEOA 4MYTA 4E7HA 5B0CA 4F3OA 2HEKA 3DGVA 1VS3A 1U1MA 1F60B 2BYCA 4RWWA 1UVLA 3D1QA 1NHVA 1XMOJ 2QI2A 2KM8B 4HDHA 5EDWA 4M3UA 4MFBB 2V2ZA 4F26A 1CJVB 4ED5A 3CCQN 4FN5A 1H6KX 2XHWA 4O55A 4EWTA 4IBNA 3ILIA 1ZTWA 1F0XA 2HOEA 3W65A 5F8MA 3V81B 1K1QA 1RT2B 1FCAA 4HI2A 4GNIA 4NYPA 1UW9A 2D9PA 1N33J 1LW0A 3D6TB 4ILMA 2EK1A 4H0VB 3BEGB 4C8KA 4ZVQB 4QWAA 5HVHA 3MGJA 2HVZA 3ITHB 4CBWA 2NZCA 1OVYA 3QJJA 1EARA 2YPYA 4JI1J 3TYTA 3G10A 4G3IA 1S6OA 4FWQA 4W4MA 1NGAA 2RDDA 1FE4A 5IZHA 4NYNA 1ZBSA 2ZM6J 4ILJA 5JXSA 2NPIA 1RKIA 2R8JA 4U7CA 4HUEA 2GO8A 4Y00A 1R8AA 1GH8A 4WFNL 4DR1J 4FZXC 3W1YC 1JQGA 3IDHA 1X0PA 3R1HA 3FZFA 3TJAA 5J1EA 3VALA 1M90O 4ID8A 2P9KA 4Z4EA 1SKRA 4M45A 3SJHA 1RTJB 4MFBA 1MA9B 4FW1A 3UKUB 2OPSA 4WU3A 5KFZA 1JL1A 1E4GT 1MSWD 1NU4A 5E3CA 4XTTA 3CD0A 2RE2A 4LH4A 4Y2MA 3VEOA 3PW7A 2ACYA 2VBXA 3FE1A 1VAZA 4OV6A 1XUPO 3NS7B 1S5ZA 4OX9J 5KG0A 4WK3A 3KHGA 1YGYA 5KPZA 4DX6A 4CF2A 2R8HA 2FBVA 2E1YA 3F5TA 2CJXB 2BR0A 3JXOA 4ECQA 1WOOA 3QFPA 5I42B 2F4FA 4QS8A 2HHQA 4RW7B 9ATCB 5CYMB 1FE0A 3S1TA 1UWBB 1VDHA 4K4XA 3Q89A 4IOXA 4DTNA 1GNKA 3VZIA 4DV7J 2HRYA 3BBFA 4E1MA 4NLBA 5HRPA 3CIMA 1RAIB 1KONA 4BRAA 3UQSA 3TX8A 3EUNA 4YHHJ 3T6JA 1R8BA 1K9MO 4X66F 3GCWP 3FUYA 3R3TA 1FD8A 3WQTA 2F3JA 3NMAA 2DT9A 2HS4A 4CDIA 4IH6A 1PYSB 1GEHA 3AFGA 4RCHA 3CC4N 4I7FA 4CHQA 3AVMA 3JTOA 3TVKA 2YI1A 3OTDA 2UUAK 1HD0A 4TNOA 2BV3A 3M5RA 3V6JA 2M9KA 1JJHA 2R2SA 2DEJA 4DR6K 4H03B 4X65F 2HBRB 3DXMA 1CXQA 1RISA 3JSMA 4LF9J 1A7GE 3JAMU 1NK7A 1DTQA 4BWJA 4DWIA 3P5TL 2VC0A 2DNKA 2V4JA 4X4VA 3KDNA 3T5JA 1XR7A 4O0NA 1LV5A 3DOMB 3CI5A 1RAHB 3AOCA 3LP2A 1RT1A 1DAXA 1W26A 2W24A 3MMAA 1B7FA 2E1RA 1XC9A 3NF7A 4IOAQ 3I55N 2FBXA 2J0WA 4CWBA 2HRUA 4F4YA 1ASUA 3RB6A 5EXWA 1WKJA 1N34J 2KJVA 3ENWA 1YHQS 3DXSX 1PG5B 2X1AA 3D1OA 3R5CA 4W5RA 3FEXB 1IXKA 2JVRA 1JLGA 2OCEA 4NXNK 3ULHA 4I1TA 1VJQA 4GKJF 4ECZA 4A46A 1Z1ZA 3IN5A 3JTPA 2ZUGA 4CZJA 2VGMA 3O4WA 3OJUA 2GHWA 4CJ4A 4LF9F 1YJ9S 3LAKA 4FYYB 1N88A 2MKCA 3ZX3A 3CCLN 2FC9A 4E8UA 1RDDA 4JV5J 3V9UA 4GKJJ 4LFAJ 3TR5A 1BCMA 4CFCA 2ZE2B 2W01A 4YOEA 4ZPDA 2KFZA 2C42A 1HBMB 4WF9L 5HMXA 2DNNA 3H4DA 2UU9F 1HPZB 3Q22A 1N6QB 4ICLB 5F0XA 2FZCB 1E6VA 4ZVPB 1TYQB 3QDKA 1FKOB 3RR7A 1V3RA 3SCLE 2VKRA 4JEPA 4TQSA 2HF4A 4K4ZA 1OSCA 1QUPA 1VRQC 5KFJA 1EKSA 4Z4HA 3A3PB 3NGUA 4C1NK 3RG6A 1I1GA 2AHOB 3KWMA 1UEUA 5AQFA 3CJCA 1GLLO 4IG3B 1IR2A 1XHXA 3UCGA 3P96A 4Y2CA 3CJAA 3QEPA 4DV7F 3FZBA 3ZCMA 2UXBF 1REGX 1RE1B 3WUHA 3ZSQA 3EKSA 1Q5VA 3SQGA 2A6AA 1IJEB 4I64A 2KQ2A 1G7CB 3DLRA 3ZETA 3CCJS 3AXKA 2G9OA 2CQ1A 3FZ2A 2YX1A 3R5DA 1D4XA 5KFPA 4ZCKA 2F8EX 3PSFA 5DLFA 1XR6A 1TL7B 3SJJA 3QGPA 1M1GA 1NDLA 4CHZA 1K0TA 4FJNA 2XCPA 3KTQA 1SH2A 2A1SA 5E41A 4I2PB 3CHWA 3A2FA 4N47A 4BR9A 5F3TA 5K9FA 1NSKL 5K20B 3VQQA 1KKHA 4HTJA 4PQUA 2P2CB 3JSYA 5C25B 4BC4A 4G65A 2CQCA 3O1LA 2R7OA 4F36A 3CJ9A 1LXJA 2C28A 2GVZA 4I56A 2WONA 1T6CA 1HNXF 5GAHP 3MOZA 5HMWA 5K14B 5BRFA 2XNRA 1NDKA 4OYZA 3BPSP 3HYFA 5CYQB 3KLGB 3VPZA 3VTHA 2ZM6F 4O0JA 3MM5B 3MM7B 3HFKA 2A1RA 1ZBLA 4IKAA 2OIHA 3FJ2A 4CO3A 5HSPA 4FLUA 4OX7A 1V3SA 4AF1A 2HFSA 4DJBA 1RT4B 1Y10A 1JLGB 4M5DB 1BCOA 1KTQA 1S9GA 5L1KA 3BEXA 4OL8A 2W8KA 2BOPA 1Q5YA 2WBMA 4GC7A 5AQHA 1ZTTA 3AAPA 4YB6A 4LF4F 3LM2A 3E01A 1RTHA 2K3IA 2VL1A 1S1UA 4KH5A 1D9AA 2ZOGA 3J7YU 3TSPA 2Q36A 2J7KA 3DYAB 1KCFA 3QO9B 3GB0A 4EFAC 5K8OA 1NMNA 2IFXA 2B4OA 2HFVA 2DPNA 1T05A 1NK4A 3KJQB 2HLTA 4CVNE 3QATA 1IM6A 1MN7A 3OJSA 1QQOA 4DF8A 3K58A 1FRHA 4DTUA 4KAZA 1FWLA 4UY8T 1XMBA 3ZEUB 9RUBA 5M1OA 1D8YA 4RU2A 4JI1F 1J5OA 4O0IA 1NKEA 4RLEA 1BUXA 1FA0A 3CTRA 4DL6A 4ATNA 3OSPA 1LXNA 1LAWA 1OS5A 2JRSA 3SNNA 1XHZA 2HGNA 1OY6A 4OJHA 1Z4UA 3OS0A 1WACA 1WC5A 4J5OA 2FPHX 4LBPA 1UFLA 3TUJC 3H20A 3I8DA 4R5PB 2A6MA 4DFPA 1JL2A 2RU3A 2UXCF 2F65A 2QWNA 4OX9K 1TL5A 2K1RA 3ZSVA 2BJ8A 3K2PA 2IBOA 3M6GA 1B70B 5B0AA 3LM9A 3VTIA 4KRWA 2O8DB 1WEYA 2W2NP 1ZBIA 3N01A 5LJVA 5GAGU 4XPEA 1NK8A 3UKRB 2MYFA 3E01B 4PKGA 5AZJB 2HFUA 1ZM2A 3T9ZA 4CLYA 2BGGA 1C0FA 1Z6RA 3VQBA 4IRCA 3PLAA 1P1LA 4F50A 4WPAA 3BSOA 2DK2A 4BRLA 4L3KA 1NPRA 4JUZA 3D0IE 4Y34A 4NLWA 1Z2ZA 2CNLB 1W25A 4NZ6A 1HBOB 3MMAB 1FHTA 3OHAA 4ED7A 4IRDA 1C0GA 4CF0A 2VG5A 1WDDA 4K4UA 4LIWA 4PG5A 3EZWA 1X31C 4CW7B 5IWAK 2FVRA 4CLLA 2AJQA 2ZVSA 2QYGA 1HFEL 1GLDG 4LMZA 1UEKA 2D0PA 3MTKA 3OXFA 3IAYA 3MM9B 3G6YA 2DGOA 4DSEA 5AQYA 1U2VA 4CLWA 4H5RA 2MY7A 2PE8A 4H0OA 3CD6N 3P4UB 2EG1A 1OQ6A 3P39A 3TA1A 4MMOA 1LWEA 3UKUA 3ILLA 1GMUA 2UUBJ 3VGMA 3DLHA 4FLZA 5HN0A 2F9WA 2P9LA 4F8RA 2XQCA 1ZM9A 5GVQA 4X4RA 4L72B 3BN4A 3MN6A 2PD1A 1O13A 2MLYA 4HHTA 2KT3A 3I9V9 5L1IA 3HT0A 2MPUA 1VLYA 5K8NA 3KK1B 3I0RB 1O1WA 1IJJA 3OR2A 3L2RA 3CJBA 3FGUA 2ZWHA 1FJEB 5G4DA 4YR2A 3N4PA 3TSUA 3IRWP 2WSEC 1V9OA 1TL1B 4L6V3 5A2QO 4GV9A 1EIYB 4Y6IA 3KFWX 2J9DA 4JV2A 2ROPA 3WIVA 1CG2A 5ETOA 3BQ2A 3DDIA 2ALYB 4CLSA 3M8RA 3V5RA 4OPKA 1S7HA 1HNXK 2KRRA 1X4HA 3SK3A 5HVGA 3KKFA 1CLFA 1VLOA 1RDWX 4I2QA 2FXUA 4ELVA 3CCRN 3C7NA 1U25A 3PEHA 2IVOA 2P9EA 1RK8A 2LMIA 1TUYA 1RHMB 3IBWA 2J0SD 1TKXB 5KG2A 5BRHA 5F1XA 5KFLA 5BR9A 3R1LA 2R7XA 2AEFA 4PZVA 1Q82T 1VOMA 4BS2A 3EICA 1OO0B 3ZZTA 5KFFA 3R3LA 2L9NA 3G82A 4DPOA 4QYZK 6AT1B 3DDNA 3SSRA 2DO0A 1UPPA 2RKIB 4J2BA 1RT3A 4YDUA 2FB0A 5GADU 4XH1A 1WUAA 1XERA 4RW6A 4Q2LA 1WAJA 1S49A 1Q9XA 2M8HA 2C2KB 2H5JB 4IRKA 5FRMA 1L3UA 5C2DA 2WHOA 4C8MA 2QK9A 1CEZA 3FQLA 3R8YA 2HKEA 4NLGA 1U4BA 5J2NB 2G1DA 2NXEA 2FVPA 3LPEA 2KG0A 3SAGA 1RT6B 4JI5J 1X4BA 4LREA 3I4HX 1CJUB 5HQLA 4FPIA 2KZZA 4B8CA 1DQAA 3EZ5A 3OBIA 2NLWA 4DSJA 3VQCA 4F3QA 2W41A 2CNKB 4EO6A 4PY5A 1DGKN 1PKUA 5J1NA 1E6YB 3MAAB 2QLJB 1V6HA 5HL7L 3LGNA 2D0BA 3V4IA 3TZXA 5D0EA 3R2DJ 1HWJA 3NBPB 3QNOA 5BRDA 3CPWM 4TVAB 1S0NA 2BA9A 3Q8UA 1U2CA 5HBMB 3LPYA 3DLJA 1S59A 5IT9O 4LF6F 5LMUF 4DG1A 4FWLA 2NUBA 2ZEJA 5IWAJ 3MDQA 4CEZA 2DGXA 1IBKF 4KKOA 4QWEA 3OXGA 4FW2A 4WU2A 1KVCA 4EP4A 5HANA 4DTSA 3C19A 3SAHA 2O8FA 4MKBA 1RTZA 2FJDB 2RQ4A 4CO2A 4Q0BB 3PXGa 3AD7C 5DM7L 3HK2A 2RRNA 4CT9A 3KK2A 3R7NB 1XNQF 4A5AA 1X4GA 3OVSA 3K8VA 2P9UB 2OYQA 1XIQA 1T44A 4HHJA 1Q8KA 1H2TZ 1M5HA 4NX9A 4TY8A 1FFWB 2HHHF 2LA4A 4A4JA 1WF1A 4CO0A 4C1NI 2YWFA 2EI5A 4IWVA 4CIFA 1S99A 3B4DA 2BBEA 4TYBA 1CJUA 4K7QA 1X9SA 1EZZB 4PXBA 4BGAA 2DTUA 2DHHA 1HQEB 1CJKA 2GC8A 2I38A 3HSGA 1YJUA 3GYXB 2E1AA 1PAEX 3GCXP 3THYB 2Z1IA 2YX4A 3DLKB 2DPIA 4YS2A 1I94J 1LW2A 4BRKA 3VAFA 4CK2A 1N32J 3KKSA 3NHGA 4OI3A 3PUFA 1RT3B 2IC3B 3OFEA 5H9FK 5BPMA 1BC6A 2IIHA 4FK4A 3CCSN 4ZVRB 4PUOB 4DDFA 1H7XA 2B0GA 1EHWA 1QS4A 3DMJA 3PTWA 4P73A 2UUWA 2V8PA 1AA1B 4LFBJ 3BJYA 5KG3A 4OQJA 3NGYA 2RF2A 4KHNA 1Q8LA 3D1HA 2EPIA 3QETA 3H25A 4JYAJ 2YHWA 4F67A 3RAXA 1NDCA 3LUYA 3RJMB 3NGDA 3BB5A 2JWNA 1U47A 1H7WA 4URSA 5KFWA 1TAUA 2QO3A 3ZSRA 4DV3K 4GVLA 2IPOB 1OPIA 1RYSA 4WP3A 2P9GA 3J7ZT 3M30A 4J7CA 1JXVA 4NE9C 5ETNA 2Y1IA 3VQEA 2UV8A 1S9GB 4LSNA 1AFIA 3HVWA 2HAFA 4KGXB 3I5BA 3Q8RB 1YRTA 5CZXA 3EVWA 3EDQB 1PC4A 2UXCK 4P9SA 2YH0A 1EKRA 1L5UA 1GLEG 3MZIA 2PFUA 3US5A 3VQ6A 4B3RK 4C7QA 4KQZA 2ZJPL 2Q31A 3ILJA 3PX4A 2MGZB 2DHSA 4EK2A 5AZIA 4TY8B 3LGHA 2HIYA 3NGRA 5E3AA 3ZO7A 5ETSA 4J9QA 1U0HB 1TVRA 4MTPA 3V6DA 3FR0A 2FJEB 4TLQA 3G86A 2MY8A 2ILYA 1BISA 2GJIA 4H4KC 2XZWA 1I39A 1F21A 4BR7A 4V1Ak 4NOHA 3D68A 5D3GB 1YUWA 3BKTA 1LW0B 5SUHA 1WUUA 1C4AA 2J9DE 1CQMA 1RBAA 1U6ZA 2CWXA 2IMOA 3V9WA 4JK7A 3SV4A 1XC3A 2DCLA 4OJ3A 3A12A 4PG8A 4GVMA 1NSPA 1FDNA 1FWKA 2W2QP 1YJVA 4MKAA 4EEYA 4TQRA 3I55S 2Q79A 3UKRA 3U3GA 3GSIA 2EXUA 1OKJA 3T9NA 1CSJA 2QL7B 3ENOA 3DRRA 3GWCA 2M3DA 3W2VB 2CVIA 3THPA 3H42A 2UU9K 1NSAA 4FJ9A 4GMJB 4X84A 1J6ZA 4FPRA 3FNNA 2A41A 1FO1A 3NFAA 3M2RB 4HACA 2CGLA 3J7AP 1M5SA 1K1SA 4N8OA 4F3MA 1YJNS 4JKCA 2J8AA 4I6AA 3OPKA 4N56A 3D0PA 1VQ5N 3W8GA 2ZKTA 4CZLA 5D15A 3G2XA 1D9DA 4YY3J 3ASMA 1URRA 2A42A