3I0SA

Crystal structure of hiv reverse transcriptase in complex with inhibitor 7
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
558
structure length
558
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Substituted tetrahydroquinolines as potent allosteric inhibitors of reverse transcriptase and its key mutants.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 160
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3i0sA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0sA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0sA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i0sA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3i0sA05
3KLIA 3KD1E 5K14B 2A1RA 3OHBA 1C1BB 4DU1A 2HNZA 3BR9A 1UA0A 3WNGA 4FW2A 4J2DA 1IKWB 1TQLA 3HVAA 3VQ4A 4B9MA 3M8PA 4CEQA 3ZSOA 4EO8A 4R5PB 4KBIA 4N76A 4ED6A 4I9QA 3SZ2A 2R2RA 1ITGA 3NE6A 3DRSA 1RT6B 4ZP8A 1BGXT 4DTNA 1L3UA 2QK9A 4DTOA 5F8IA 2AU0A 1HYSB 3OLAA 3ASMA 3LWLA 5F9NA 4CK3A 1SL1A 4N41A 3ZCMA 4PQUA 3QNNA 4MK7A 4RZRA 4I9LA 3DLKB 3G6XA 4IG3B 4NLSA 5DLFA 4PUOA 3MEGA 1QE1B 2OA8A 4WYWA 4O3NA 3DM2A 1LWEA 3HHKA 4IFYB 3NMAA 1RDAA 3GIIA 1TV6B 5KFGA 3HO1A 1RDCA 4M3RA 4IH7A 1RT3B 5KT4A 2KW4A 3V6DB 1N56A 2RKIA 3QYYA 3BQ1A 3TAGA 1KSPA 3IN5A 4HHTA 5F8HA 2YNIB 2YNFB 4CJ5A 4M95A 3HYFA 2AGPA 1S9FA 1CZ9A 3O4NA 4Z4HA 4J2EA 4OLAA 4YFUA 2B5JB 2PY5A 2HNYA 3PY8A 3VQCA 2IAJA 4Y3CA 4CERA 3BSNA 1BCMA 3QEPA 1JLBB 3MXJA 3MXMA 5J2PA 1RTIB 2ILYA 4KREA 5KFFA 3G6YA 1IKVB 2GV9A 1XWLA 2RN2A 4CJSA 2EC0A 3NGDA 4LH4A 5DGAA 4FJIA 4WE1B 3DOKA 4Z4CA 3DYAA 4ED2A 3DMJA 4FLYA 4NLDA 1N4LA 4TSXA 4Z4FA 1D8YA 2IDOA 3FFIB 3PR5B 2AQ4A 3OL6A 4KFBB 1S6QB 4WYLA 3ITHB 5KG6A 1S4FA 3OYLA 1DTTA 4NCBA 3CJ0A 3KK3B 1KHWA 4FVMA 1W0HA 2YKNB 4ID5B 1BCOA 5DQHA 2G8KA 3BSAA 2KTQA 3OL9A 2R2SA 2D0AA 5EDWA 4F4ZA 3QETA 2XO7A 3KLEA 2VA3A 3IRXB 1RTHB 3ZSRA 4ZMMA 3UQSA 2FJXA 2XWYA 3SPZA 2J6UA 3S3MA 3HPOA 1NHUA 4IG0A 1F21A 4LQ9A 1D5AA 1LAVA 3VQAA 1RT7A 5KFMA 3M9OB 1SH0A 3M8SA 3CJ4A 3AA4A 4M3ZA 4QPXA 1C0UA 4PWDB 3ALYA 2D0CA 4K4UA 1RBUA 5KFVA 5F8LA 4J9NA 1KFDA 2VWKA 3OYAA 4K8ZA 5KG7A 2QKBA 5DMRA 4N5SA 2D5RA 4KHWA 4M3WA 2IC3A 2D3UA 1TK5A 1WSJA 4ZHRA 3HVTB 3RB4A 3P1GA 3HM9A 3KLHB 1T03B 2C28A 1VSDA 4O4GA 2GBZA 4NZ0A 1ZTTA 1JLAA 2JGUA 1X9SA 4O3SA 1NK6A 5I3UA 1S9GA 4ELVA 4O55A 3WNHA 3EPGA 4NCGB 1RA6A 4LSNA 4Y1CA 2QKKA 4KI4A 3OS1A 3SV4A 3L3VA 3CQ8A 4AILC 4FW1A 5HBMB 2BANA 2WONA 3F73A 2IOCA 3QGHA 4CF1A 3PW0A 4CEOA 3F9KA 4FZYA 3I0RB 2ZE2B 3RRHA 4WXOA 1IKXA 3ZSYA 4FJXA 3VQ7A 3DI6B 3MR6A 3PJXA 1QSLA 3KHGA 1S9EB 3H5UA 1IO2A 4RW8A 3ULDA 1YTUA 3M8RA 2RF2A 4DSJA 1RT2B 4CHQA 2BQ3A 4C8MA 4ZVHA 1CLQA 2OPQA 3KOAA 3THVA 4CE9A 4H4MB 2OH2A 3PVXA 4NLXA 5KI6A 4FS1A 1HQEB 4DTSA 4TY8B 4DF4A 3JYTA 3MECA 4DFJA 2G8FA 1HPZA 4ECVA 2XHBA 4F3OA 3S9HA 4IKAA 3BQ0A 3M9NB 3KK1B 2IA6A 4J9SA 4Q0BB 2FVQA 1D0EA 4MIAA 2C2RA 4KKOA 4CEEA 4U6PA 3LANA 1Q9XA 2BRLA 3AO3A 1S0OA 3BJYA 1TL3A 1SKWA 2OPRB 1IKYA 5CYMA 5KFQA 4R0EA 2X74A 2XC9A 1JKHB 4U7CA 4MFBB 4ZPAA 3ISNC 4R8UA 2YKMB 1NKEA 3CO9A 3MR2A 2W7PA 4CGDA 3JSMB 4HTUA 5J2NB 5C25A 4FZXC 2HHUA 2IJNA 5L1KA 2JEIA 4CHZA 4YR2A 4GC6A 4MQ3A 5KG4A 3AVMA 5L1IA 2JLEA 2HNZB 3V6HA 1EX4A 4ZTFA 1NJXA 3HL8A 1JLFB 2CJQA 4FZZA 3NAIA 4WFYA 3L8BA 2HWIA 4CEFA 2YNGA 4DL5A 4Q43A 4FJLA 3M8PB 5KTQA 3IS9B 3SJJA 1BI4A 3S3OA 3G86A 2VG7B 1T05A 3KKSA 3SUQA 4NLWA 2C2DA 3E51A 4KHSA 5T14A 2IBKA 1N5YA 4TY9A 4TLRA 3QEXA 3ZT2A 2ILZA 4FYDA 4LSLA 5DG8A 1KVAA 4GW6A 4Q44A 2HVIA 4E1NA 4PQUB 4JS4A 1BQMA 1HMVB 2I5JA 4PUOB 1QSYA 4Q8EA 2WOMA 1S1WA 4CGFA 3QNOA 4DSFA 1S1UB 3DM2B 1T7PA 1LWEB 1K1QA 4ZPDA 4WZMA 2WB4A 3KNAA 3TWHA 2HHWA 1EP4B 4H54A 3HJFA 4DSLA 2W8KA 5HROB 3RAXA 1ZBUA 4EO6A 2AJQA 4GMJB 1JLEA 2IM2A 3TAFA 3QEIA 4O5BA 5JS2A 3G0ZA 4CJWA 2RKIB 4KTQA 4KAIA 3C6UB 4TQRA 4YR3A 3K57A 4KHYA 4FCYA 1NKCA 3KHRA 4I7FA 3WNFA 4RW9A 1SV5A 3OYDA 4XIUA 2V4QA 1VRUB 2EX3A 3NH2A 2LSNA 3K58A 2YHAA 3OYGA 5J2PB 5C5JA 5HRNA 4FLZA 1J53A 3B6OA 1VSHA 4CEDA 5F8GA 4DTMA 1RCHA 3HVRA 4ZP6A 4KV8A 3DYAB 2GIRA 4OPJA 1TKZA 2FJVA 1FKOA 4DSIA 5L1JA 1HRHA 3RTVA 2KZMA 1UWBA 4ZVEA 4CF9A 4M3YA 1R0AA 2JC0A 1IH7A 4XO0A 4O0JA 1S6PA 1JLCB 2IMWP 3H5YA 4J9MA 1TKDA 4CFDA 1KLMA 4QWAA 4CIGA 3SPYA 3RWUA 3PZPA 4JV0A 3Q8QB 1I39A 3CG7A 5I42B 4MIBA 4OVLA 4DU3A 1MMLA 3MFIA 3HXMA 1RA7A 3SFUA 4M94A 5KRTA 3AVLA 4FLTA 5DG9A 1NK7A 2E9TA 3VQ8A 3IGVA 3KJVB 4YQWA 3Q8RB 2O4IA 1VK0A 1TL1A 1RT7B 3MEEA 2Z1GA 2KZZA 1KVCA 1SUQA 1WNSA 3NF9A 2OPSA 2HNDA 4MKBA 4FJGA 3HVWA 2FC0A 3AV9A 1MU2B 1REVA 2R8HA 1Q9YA 4GC7A 4FM2A 4B9VA 4B8AB 3RMAA 4AHVA 4NCAA 4WXWA 3GV7B 2B6AA 3TR8A 1JXEA 3HK2A 3DLGA 1U4BA 2WCXA 3V1OA 3L2WA 4O0IA 4ZHRB 5KFYA 3LPUA 4KSEB 4ECWA 4DWIA 3KK2A 4Z4EA 3H08A 3SYZA 5KT2A 2VG5B 4M3TA 4W5TA 3IAYA 3CFOA 1U04A 3LP1A 1JLAB 3PHEA 3RR7A 4FJ8A 3QIDA 5KFSA 4QAGA 4FJ5A 4LH5A 2C2EA 5D3GA 1U47A 2W9CA 3SQ2A 4LSNB 4NLOA 3LALA 1N6QA 4X2BA 4NYZA 3SI8A 1ZYQA 4B3OA 5CYQA 1L5UA 3GYNA 3QESA 3LWMA 3BREA 4O44A 3GIJA 2C22A 5KFKA 1I3AA 3DLEA 3KLGA 1KVBA 1S0MA 2Q3SA 3LAMA 2F8TA 1J5OB 4EZ9A 2O4GA 5KFLA 2RF2B 4E7JA 2ATLA 1RT4B 3NFAA 3IG1A 1HYVA 2OPQB 4QOZB 4K4VA 3RB0A 5J2QA 3AVGA 3RRGA 3UPFA 5T7BA 4DFPA 1HPZB 4EYIB 4RU9A 1HNVB 4KB0A 2WK4A 4FBTA 3D28A 2JEFA 2AX1A 4K4ZA 4ZPCA 1ASWA 2D3ZA 1A5XA 3L2QA 5CY4A 3DOLA 1JIHA 3OYIA 1IM4A 4WZQA 3HPGA 2E4LA 1GOBA 5CYMB 3HKWA 3G10A 2IS3A 3V6KA 1TKXB 4RUCA 3MXIA 1QHTA 4R8UB 2RDJA 1JLGA 4KRFA 5C25B 3VQ9A 3NH1A 4DS5A 1VRTB 3PX6A 3TAQA 1VSLA 2DFFA 3DRPA 1VSEA 3GV5B 3AA5X 3PO5A 4ICLA 2ATQA 3K5OA 4RNNA 4BE0A 4RUAA 1SL0A 4KHQA 3NKYA 1VSMA 3MR5A 4QCLA 4ID1A 2YNGB 4KO0A 1C0TA 2Y1IA 4RW7A 5J1EA 1RBTA 4CJTA 1EKEA 3U6FA 1XR5A 3FRZA 1C1CA 1BI4B 1Y97A 5CZ2A 4G1QA 3O3FA 3V4IA 2J6TA 3MAQA 4Z0UA 4ED1A 3ZSWA 1TKTA 3TAMA 3BDPA 2QE5A 1BQNA 4KB1A 1FXXA 1RT5B 4URSA 4IQXA 2HMIB 4FJJA 3AVKA 4CJFA 3H5SA 3VN5A 2I5JB 4CEZA 2WOMB 3V9WA 3V81A 4HVJA 4IRDA 1KTQA 5CZ1A 3MTKA 5KFCA 4ZP9A 1J9AA 1QS4A 3QO9B 1JLEB 4JUZA 3CJ5A 1CZBA 1SKRA 5HP1A 2G8WA 2HW3A 3D5MA 3HPHA 1N48A 1Z25A 3QLHA 3OYBA 5FDLA 4K4TA 3OY9A 2B43A 3N6MA 3NL0A 1J54A 1CXUA 5HRPA 4J9RA 1HARA 4I7FB 3RMDA 1S49A 4I2PA 1SV5B 1BL3A 3SFGA 3I5BA 2HHTA 1LAWA 4E89A 1WNEA 1RTDA 3LPTA 1EETA 1C0MA 3NBPA 1ZETA 2GC8A 3SQ4A 3CJ2A 3QZ7A 1HQUA 1IG9A 4Q8FA 3BSOA 3MR3A 2YNHA 3PW4A 4FXDA 4Y2AA 3VA3A 4CEBA 4JV1A 4B9TA 3T5KA 4C8LA 2FBVA 1FKOB 2YHBA 1UWBB 2VWJA 5KFWA 3AVBA 3KHHA 1S6PB 3SQ1A 3BGRB 3NH0A 4J9PA 3QEWA 1KLMB 4OPKA 3N6NA 3MEDB 1QSSA 4EEYA 4L8RB 3AVCA 2ZD1B 3RR8A 5C42B 4DLGA 4EBEA 1S10A 4PY5A 3OSPA 3LDSA 4BWMA 3ZT1A 3OHAA 4ZP7A 1FKPA 2HB5A 3S3NA 5DQGA 3MFHA 3H98A 3CDUA 1S1VA 1SUQB 1I6JA 4DG1A 4QW9A 2HNDB 1REVB 3H59A 2OPPB 4NYNA 4MH8A 1RYRA 4ZVFA 4TQSA 3AO1A 4KHMA 4B9SA 2B6AB 4CK2A 3DLGB 4DU4A 4N56A 3TARA 3AVFA 1S1TA 4ED8A 4ZVGA 5EWGA 4ELUA 4IDKB 1NK4A 2KFNA 4W5NA 3SCXA 3C94A 4RNFA 3UIQA 4RW4A 4B08A 5F8NA 4J2BA 4KHRA 4OKJA 3SNNA 4Y1DA 4NRUA 4CGHA 4CJ4A 5KFEA 1N6QB 1U48A 4HYKA 4FK2A 5KG2A 4B3OB 1S0NA 3EPIA 3DRRB 5CYQB 4CEAA 3V9XA 1VSJA 3VQ5A 1JL1A 1YVUA 3V9UA 5KG3A 2O5DA 3DLEB 3KLGB 1JX4A 4YMEA 3V9SA 2XCAA 4RW6B 4XPCA 5DQIA 4CHYA 4J9KA 4K50A 4IOBA 2UVUA 1ZTWA 4K4XA 2B4JA 2PYJA 2D7SA 4JLHA 3ICLA 4NLQA 1RAJA 4H4OA 3KLIB 3GILA 2P5OA 2BQRA 2OZSA 4EP5A 4Y34A 2OYQA 3O4QA 3VA0A 3DLKA 2BE2A 2VG6A 1WSIA 2IM0A 3OSNA 4ECZA 3PW5A 4IFVA 4FJ9A 2WRMA 1B9DA 4DL6A 1NJZA 3GIKA 3RMCA 3DDKA 1T94A 3UR0A 1HYZA 3DRSB 2HHQA 3V6DA 4M41A 4DTUA 3P83D 4OKKA 3CDEA 4FM0A 3AVAA 2YNFA 3AO2A 3OYJA 3OJUA 3VQDA 1S97A 2B5JA 2E9ZA 4FS2A 4DQPA 1JLGB 3MEGB 3QIPA 1K1SA 4DQSA 1RDRA 4CHOA 4O3PA 4C8KA 2FLNA 1RTIA 4KTZA 4AH9A 1IKVA 1G15A 5SZTA 3L2UA 5HRSA 3DRPB 2DFHA 5KT7A 4WE1A 5HRRA 4ICLB 3FQKA 4BE1A 4ZPBA 3KIOA 4DSKA 2UUWA 4CHPA 3LP0A 3FFIA 4AHSA 4JRPA 2G8IA 5J1EB 1RTJA 4RG8A 4FJKA 4O3OA 1C1CB 4KFBA 3PUFA 1S6QA 3H5XA 4YP3A 3ITHA 3K59A 4G1QB 2JEJA 4CESA 2Z1HA 2HNYB 2IAJB 4UQGA 3FDSA 5F9LA 3OJSA 3B6PA 4Q5VA 4ID5A 3OYHA 2XI3A 5KG5A 1NJYA 4E7KA 3I8DA 1RTHA 4BDZA 3DOKB 1GX5A 3DMJB 2RPIA 3P5JA 3HP9A 4CFAA 1EXQA 5JXSA 4CJ3A 2XRIA 2DY4A 4CIEA 4FLWA 3V81B 1W9HA 1WAFA 3LP2A 4IH5A 1LWCA 4DL7A 3A2FA 1DTTB 4DEZA 4YNQA 2X6NA 4Z4GA 4E7HA 5C24A 3LP3A 2X6SA 2X78A 4ECUA 3QLHB 4F2RA 5JS1A 1JXBA 4LQ3A 2QXFA 4NLVA 3KLEB 3TAEA 1CXQA 4I2PB 4HUGA 2FVCA 3KLHA 4Z4IA 1T03A 2F8SA 3NHGA 4URQU 4IG0B 2GUIA 4AHUA 3DLHA 1ASVA 1EETB 1QAJA 1BHLA 4K4YA 4DQQA 2HHXA 1C0UB 4QWDA 1ASUA 4CHNA 1HQUB 4NCGA 1RBRA 3NCIA 1K6YA 4QW8A 1RBVA 4B9NA 3CJ3A 2UVWA 2IJFA 2IC3B 3G6VA 1LWFA 1KHVA 1C1AA 1D1UA 2KQ2A 1S9EA 1LV5A 4O4GB 3CIZA 2FLLA 3ZSXA 3H4DA 5KFIA 2IGIA 2JC1A 2V0NA 3RB6A 5KFRA 2UUTA 1LW0A 5I3UB 1S9GB 2PZSA 3EZ5A 3C6TA 4DS4A 1RYSA 3EY1A 3GQCA 3AVJA 4HKQA 1QTMA 4H4MA 4DL2A 3NAEA 3QEVA 4BACA 1U09A 1NJWA 2YV0X 1TAUA 1HQEA 2BANB 2ASJA 2WONB 5KG1A 1YT3A 1FKPB 1S5JA 4DTRA 3U3YA 3PX4A 2XY7A 4DLEA 1IKXB 2DTUA 4DG1B 4NLUA 4CCHA 4DFMA 1WSGA 4JRQA 2ITGA 2PYLA 3T5JA 1D9DA 3QZ8A 4RW8B 1ZBHA 1DLOA 1JLQA 3RB3A 4M3XA 4QWEA 3VQEA 3MF5A 4WFZA 2OPRA 3KTQA 4TYBA 4CK1A 4PA1A 2RDIA 1NNDA 1YTAA 4CF2A 1RILA 2YKMA 1TK0A 1Z4UA 4CGJA 3JYTB 4BWJA 1NOYA 3MECB 2DPIA 3M8QA 2D0BA 3NGIA 3NF7A 2E9RX 1NK0A 4BDPA 2F96A 5KRSA 2W9AA 4RW4B 1NHVA 2E6MA 1Z26A 1JLFA 3E01A 1GOAA 4O3RA 4KKOB 3AVHA 3T3FA 1W25A 3L3UA 3VQBA 2HVHA 5DGBA 3WNEA 4OGCA 3GV8B 3IS9A 2XI2A 1TL3B 3I5CA 4E1MA 1IKYB 2HWHA 1C6VA 2VG7A 1A5WA 3PV8A 4C8NA 4ECRA 3M9MB 4QWBA 5EU7A 4DL4A 3OVNA 2FLPA 2ZQBA 5J2MA 4EBCA 4H4OB 4IR9A 2ALZA 4J9LA 4EZ6A 4WFXA 3RBDA 3TI0A 5KFNA 3VQQA 1TVRA 2EHGA 2BE2B 1HMVA 2VG6B 5F8MA 4HUEA 4H8KA 4Y2CA 3TVKA 4IFVB 4IR1A 4NLRA 4JS5A 1S1UA 2FVPA 1KLNA 4KHNA 1EP4A 2W8LA 1BIUA 1T05B 2XGPA 5HROA 4KE5A 4K4SA 3TABA 4CJLA 3OLBA 1NK9A 4MKAA 3CM6A 1Q8IA 1N5YB 4ECQA 1NK8A 3PO4A 1O1WA 1RDBA 2F8EX 3C6UA 4LSLB 4NLGA 2AX0A 2GIQA 4CJVA 3Q8PB 2XY6A 1BQMB 1VRUA 2HAIA 3LZIA 3QIPB 1S1WB 5DG7A 4TYAA 3C95A 3CWJA 4CJUA 1X9WA 4FJNA 4CFBA 2DPJA 1BIZA 3QGGA 1XR6A 2W9BA 2BRKA 3KLFA 3HP6A 3NGYA 2AGOA 2V9WA 1TGOA 4M42A 5EUHA 3LP0B 4E7IA 4TN2A 4FJ7A 3QIOA 1JXLA 1TK8A 3NAHA 3NF8A 5KFOA 3HSTB 4ECXA 2Z1IA 1RTJB 4DQIA 3OYCA 4C8OA 4CF0A 5HLFA 1SL2A 4RW9B 2J6SA 1JLCA 4E3SA 4CFCA 3EZUA 1S1XA 1XR7A 4N47A 2I1RA 3IGNA 4F50A 2P51A 4B8CA 3FQLA 3ZT4A 1QUVA 4CGIA 3I0SA 2VA2A 3SUPA 2D41A 4M3UA 1KRPA 5I42A 4ED0A 3KKRA 4KV8B 4AHRA 1HJRA 4ZTJA 4CJQA 3KJVA 2A1SA 1TKZB 4RNHA 1FK9A 4FLVA 1R0AB 3PW7A 2FVRA 1WSEA 4DTPA 1WAJA 4E19A 5KT6A 3LP2B 5DLGA 1LWCB 5KFHA 2R8JA 3OYMA 1MU2A 3NF6A 3BSCA 3SUNA 3OS2A 4E7LA 5C24B 1LW2A 1OS5A 3D0PA 4KHUA 2R8IA 3AO4A 3RBEA 4NRTA 2G8HA 5JUMA 1RT1A 2AWZA 5KFJA 4AHCA 4DTJA 2VG5A 4F3TA 1BISA 1CSJA 4DTXA 1TL1B 1L3TA 4CECA 3MEEB 3AVIA 4DF8A 4W5OA 3KLVA 1RDDA 1L3VA 2OPSB 2CKWA 4AHTA 4I2QA 1NKBA 4DFKA 1DTQA 3ZSQA 1WN7A 4NLYA 3KMQA 4EP4A 1SH3A 3SQ0A 2E6LA 1X1PA 1RNHA 1LWFB 4J9OA 3LZJA 1HNIA 3AA3A 3KK2B 2UVVA 4F4YA 3QINA 1UA1A 1ZBIA 4Q45A 5L1LA 1J5OA 3LP1B 2WTFA 3T1AA 4IRCA 3D45A 1LW0B 3ISND 5K14A 1RT4A 5D3GB 1C1BA 3C6TB 2V4RA 2W9CB 4K8XA 1TP7A 3SI6A 3AO5A 1XHXA 1IKWA 4CJEA 3OL8A 3K2PA 3VQPA 5KFBA 4OL8A 4O44B 1HNVA 4R5PA 2ASLA 4CJKA 1WSFA 1UOCA 2BDPA 3H4BA 1RT6A 1DLOB 1JLQB 4LD0A 2R7YA 1HYSA 1XI1A 4XPEA 4HCCA 3KD5E 1QAIA 2R8KA 3KHLA 3IG1B 3UDLA 4ELTA 5DK5A 4F4KA 1TKXA 3OYFA 1T3NA 2P5GA 2Y1JA 3EYZA 4IG3A 2JEGA 1QE1A 5J2QB 1TAQA 5EWFA 2KFZA 3M8QB 3V9ZA 1VRTA 4IFYA 4OKEA 3CFPA 5KFAA 2XGQA 4GVMA 3QGIA 1TV6A 4W5RA 3NDKA 4JV2A 3E01B 4DL3A 1RT3A 3DOLB 4CJPA 3DLRA 1VSIA 2ETJA 4ED3A 5E41A 4OJRA 1XHZA 2YNIA 4IH6A 4O3QA 1UAXA 3L2RA 3QERA 4NYFA 4F4XA 4RNOA 3CM5A 2R2UA 5FROA 3ZSZA 4KI6A 2ASDA 3O3GA 3PJWA 1JLBA 2R2TA 4KB7A 1B9FA 5J2MB 5KFDA 4IRKA 1RT5A 3OYNA 5KFZA 1TVRB 4FM1A 2HMIA 2XCPA 1L3SA 5KGXA 1T8EA 4KO0B 3CVKA 1C0TB 3K5LA 4RW7B 4MK9A 4FLUA 4CF8A 5KFTA 2P1JA 3V4IB 3U3GA 4DMNA 3QO9A 3OYEA 3T19A 4J2AA 1YVFA 4OGEA 3CFRA 2QV6A 3KK3A 4RNMA 3PR4A 2YKNA 1TKTB 1XC9A 3TAMB 5KG0A 1BQNB 3CYMA 3OL7A 3TQ1A 3OS0A 3NGZA 3IRXA 4FBUA 3V6JA 4M45A 4QWCA 5F8JA 4NLTA 4KAZA 3K5NA 5KFPA 2FBYA 3FSIA 1ZBLA 1QQCA 3BQ2A 5SWMA 3I5AA 4PWDA 4YR0A 4G3IA 3K5MA 3PW2A 4CJRA 2W9BB 3T5LA 3KLFB 2IM3A 1JL2A 2FBTA 4IKFA 4F4WA 1B92A 5HP1B 2FBXA 4BDYA 3T5HA 1U49A 1SH2A 4DQRA 1KFSA 5FDLB 1WSHA 2FJWA 5KT3A 3ZT3A 1C2PA 2G8VA 5HLFB 3ZSVA 3HVTA 1D9FA 2XY5A 3BGRA 1S1XB 3N6LA 4F2SA 4FJHA 4FJMA 4OLBA 4EYHB 4EBDA 3HT3A 2NUBA 3MEDA 1RTDB 4W5QA 3L2VA 2AGQA 2HHVA 1GOCA 3RMBA 2ZD1A 5C42A 2ZKUA 3I0SB 3NBPB 5KT5A 2FVSA 1KCFA 3SV3A 2XY8A 5FRMA 2YNHB 3VQSA 4HCBA 4E0DA 4KPYA 2IM1A 5FRNA 1S48A 5HBMA 2BQUA 2HHSA 4HUFA 1VSFA 2DFEA 3VQ6A 1FK9B 3I0RA 2ZE2A 2OZMA 1U45A 4TXSA 3TAPA 4FLXA 3DI6A 5EWEA 3AA2A 2R8GA 2BGGA 3GIMA 2OPPA 3H2LA 4KTWA 3TANA 4BE2A 2BR0A 3H40A 5KFXA 1LW2B 4ECYA 4J9QA 4CGGA 4ECSA 5KFUA 2G8UA 1RT2A 1NK5A 4F8RA 1RBSA 1RT1B 4FK0A 1A5VA 1NOZA 3ZT0A 4IDKA 4TY8A 4LY7A 3CDWA 1GX6A 1SKSA 2Z1JA 3SUOA 4B9LA 1S1VB 3LAKA 4MK8A 3KK1A 3V1RA 2W42A 4Q0BA 4FK4A 4I2QB 1VSKA 3KMSA 1DTQB 4ED7A 4K4WA 4ECTA 3DRRA 2UVRA 4IBNA 4URGA 3Q8SB 3AVNA 4CIFA 3PX0A 1S1TB 2WHOA 4NLPA 4DSEA 1HNIB 1JKHA 4MFBA 5L9XA 4RW6A 2W7OA 1ZBFA 1WLJA 3JSMA 3V1QA 5J2NA 3O3HA 3OYKA 3RAQA 4B9UA 5KGWA 1X9MA 3DLBA 4O4RA
chains in the Genus database with same CATH superfamily
3KLIA 2PSZA 3MM6A 3OHBA 4EMDA 2NXNA 3J81Y 2L3MA 1N5SA 4FW2A 5K9FA 4OFZA 3VQ4A 2LP4A 2V51B 4HACB 3UE5A 5AXLA 1ZBSA 2L9WA 2NPIA 4ETZA 4N76A 3BF3A 5C0YA 4DCJB 4ZVUB 2QN6B 1BGXT 3I82A 4PWUA 4DTOA 1UKUA 4I6MB 3VEOA 3ASMA 1OH5A 1JQGA 2M5YA 4CK3A 3ZCMA 4PQUA 2CIMA 2NR0A 1YJ9N 5LSRA 3G6XA 5HATA 4C4WA 1F6TA 4IG3B 4NLSA 5DLFA 2VOOA 2IIRA 4PUOA 3MEGA 1QE1B 3QJLA 4B3SF 3ILLA 2BOPA 1NEEA 3LM9A 1RDAA 2NCKL 1S5ZA 2QZ8A 4BBYA 2DKOB 3GSIA 4XH1A 4HDHA 4M3RA 4IH7A 1DURA 3V6DB 1KQKA 3TAGA 1KSPA 1YJWS 4HHTA 2YNIB 3AY0A 2B4OA 2MZJA 1XQIA 4J2EA 4OLAA 2PDAA 2PY5A 1WF0A 4Y3CA 1K47A 1KWMA 3BSNA 4JP8A 1JLBB 3OFFA 4DQ8A 3FZKA 3QBXA 1RTIB 2CNNB 2GV9A 1XWLA 1VQOS 4MDAA 1SJRA 4LH4A 3DOKA 4NLDA 1N4LA 1YJTA 4LF7J 2IDOA 4LFAK 4Z94A 2NNWA 4JK9A 1BWVA 4KFBB 4YUDA 3O9UA 2CH6A 1NGDA 5KG6A 2YJFA 1S4FA 2QYGA 1R31A 1FJEB 3FGVA 3KK3B 4R0JA 3KXDA 4FVMA 1W0HA 4ID5B 4OHYA 2BABA 5DDRC 5EDWA 3O9SA 4HDGA 3MOZA 2RT3A 4CLWA 1CJVA 4ZMMA 1NBWA 2FJXA 1DARA 3FSYA 1Q5VA 1IR1A 2ROPA 1F21A 5T7LB 1RT7A 5IV3A 3M9OB 5FJ4A 3BH6B 2KJVA 5U47A 3PKMA 5AJ3J 3ALYA 4CO1A 2D0CA 3TEHB 1RHRB 2L9NA 1RBUA 4CZGA 2EFNA 2HBKA 3NCPA 3MCPA 4A5BA 4CZEA 2BE9B 2QJ3A 3VOVA 1EQYA 4RUHA 2VFVA 1SQEA 3C7NB 1RHQB 1T03B 4WQ5C 2LA4A 3HD1A 2FQQB 3GG1A 4NZ0A 1ZTTA 3CJSA 5IFMA 2JGUA 2VC1A 1YIJS 3D2EA 1S9GA 2UUCF 3WNHA 1FVSA 3PLAA 1H6KX 2LU1A 3ZTOA 2BVZA 3CQ8A 3WT0A 4FW1A 3F73A 4UOCA 5LY3A 2H4YB 4MTPA 3I0RB 3F44A 1X0FA 3ZSYA 1IKXA 1QSLA 4FPAA 4HL9A 4CW7B 2IYGA 2FD2A 3GR0A 3BF4A 5LL6d 2WB1D 2ZGYA 2ZJQL 4ZPTR 5BPLA 1BQXA 2DNPA 4CHQA 3J81U 1CLQA 3CXCR 2Z4PA 4F7VA 4H4MB 3DOMB 3Q7BA 4DTSA 4TY8B 1OH6A 2VQEF 4LFAJ 4AE5A 1HPZA 4Y2KA 2XHBA 4IKAA 3GJSB 4YB6A 2DISA 2IA6A 4Q0BB 1N8RT 3W8GA 3D0GE 3J80O 4WPAA 2VICA 3W5XA 2DH7A 3FBBA 2DH8A 3LDPA 1EQMA 2XMAA 1QVFM 4CT8A 3P39A 4R0EA 2X74A 4WQ4C 2XC9A 4EAHD 4A8XA 2HVDA 4R8UA 3EJMA 1N0VC 4CGDA 2HHUA 5AQSA 3J7ZT 2DIVA 1N33K 1GK8A 3MM6B 3PYEA 2O8FA 5KG4A 4OYMA 4DR2F 4FDFA 2MDAA 3MURP 3V6HA 1JLFB 2CQ1A 3ADAC 2VKRA 2XYPB 4FZZA 4PWWA 4C48A 3HOSA 5D4PA 5C2FA 5AFUA 4DL5A 1OKJA 4C1NK 1S72S 3HFKA 1R0BG 1NSAA 1N88A 1IN0A 3BBBA 4I56A 3J7YP 1YUWA 2C2DA 4KHSA 4NEYA 5T14A 2BUPA 1SKUB 3L7OA 4NE9C 4TLRA 4NXMK 4HHUA 3ZT2A 2QFJA 4E1NA 4PQUB 2A3ZA 4JS4A 5SUHA 1NU0A 3EICA 2W2NP 2I5JA 4PUOB 2HZAA 5B7WA 4JI7F 4CGFA 3OFHA 2CZVC 1T7PA 2KRBA 2HHHK 3SBGA 1EP4B 1SC6A 4H54A 3M8YA 3GZ7A 2FDNA 2V4JA 4NPOA 4DSLA 3RAXA 4EO6A 2V2ZA 2NRXA 4DR4K 1CJKB 3DXKB 3SSSA 4Y00A 2P9IA 3G0ZA 4UOHA 3VF0B 8RUCA 3VGLA 4CDIA 1V3SA 3TNVA 4FCYA 1YKWA 1SV5A 2V4QA 1VRUB 1AUDA 3QT5A 1AXQA 3ZZ0A 2YHAA 3OYGA 3SIPB 5HRNA 2JWNA 4FLZA 1FO1A 1J53A 5HJXA 3FEYB 3PIPQ 1HLWA 4CEDA 2MKCA 4JI3K 2LYVA 1KN6A 2X51A 4PAAA 2GIRA 3CCRS 4Y0FA 3QSYB 5GADU 2CPYA 1HRHA 3TQEA 2KZMA 4CF9A 4BR2A 1R0AA 3HSCA 1RKJA 2ZWOA 1U1NA 2DTJA 2ABYA 2IMWP 4B17A 3H5YA 4J9MA 1Q8KA 2OMOA 1KLMA 4LF9J 2QWOA 2DK2A 3PZPA 4JV0A 2DGQA 1N33J 5GAEU 3OTEA 4BC3A 4F0MA 2YQ3A 1CPZA 3MFIA 3SFUA 3W63A 2EG1A 1NK7A 7AT1B 1ZM9A 3VQ8A 4YQWA 4NASA 2O4IA 4JI6K 1RT7B 1SZ2A 4LF1A 3BY5A 3DXBA 3DAWA 4FJGA 3HVWA 2FC0A 3TEGA 3MDFA 4GC7A 3RMAA 2V2VA 4AHVA 3BZQA 2MEWA 4NXMJ 2QX0A 3DLGA 1X4EA 1OQ6A 1ZZFA 3MUTP 3LPUA 4NA2A 3NNAA 1X5PA 3KK2A 2BM0A 4DHYA 5EXWA 1XC3A 3D68A 2VG5B 2IVMA 1DBDA 4C3LA 2E5IA 1F1BB 1GMWA 3IAYA 2GMHA 4QU7A 2GEMA 3PHEA 4FJ8A 4OYAA 2UUBF 3QIDA 4QAGA 3D2EB 3TO8A 3BN4A 1U6FA 3VAJA 4TVAB 1U47A 3S8SA 2RHQB 4DR4J 1ROFA 4NYZA 2KVQE 2LLZA 1W2BM 3E2EA 1OWXA 5C2DA 1GT8A 3S01A 1IR2A 2NS1B 3M7VA 2J9EA 3BREA 4O44A 5KFKA 4IO9L 4DR6J 1EWRA 1I3AA 3T9ZA 2DY1A 1KVBA 1IUJA 5IC6B 2F8TA 5A8RA 2O4GA 3AXKA 5BR8K 4ISFA 2ATLA 2QSFA 4JI3J 4EFHA 5B0CA 4QOZB 3WQUA 4QZVB 3R5JB 4BR4A 5J2QA 3A0IX 3RRGA 1HPZB 4RU9A 1O51A 1AZSA 2Q1LA 2JEFA 2F9TA 3DGPA 1RGVA 1HW8A 2C2MB 4KH0B 3L2QA 2F9DA 3CCUS 3CD6S 2J8AA 2E88A 2YH0A 3EXCX 4YOYA 1S7HA 2VHGA 4R8UB 4WFNL 3SBMA 2FY1A 4JI6J 3NH1A 5HVGA 1VRTB 4F26A 1E6YA 1VSLA 2O8FB 1CJUB 1OIAA 2EFQA 2EBEA 3GV5B 4FF3A 3AA5X 3PO5A 4RNNA 4M5LA 5BXIA 3IO1A 3NKYA 4X4RA 4ID1A 4KO0A 3L09A 5E3RA 1P8GA 4B3TK 1TMMA 4CJTA 3U6FA 4I4BA 4RUBA 4O8UA 5KPZA 4H0XB 1KR4A 1ZXOA 5CZ2A 4G1QA 3V4IA 3W62A 4OX8A 2J6TA 2J9DE 1ACMB 2KJWA 2DNNA 3CMAS 9ATCB 4HWIA 2DNGA 3TAMA 1RAOA 2QE5A 1BQNA 3ETMA 4KB1A 4FYXB 2HVEA 4IQXA 1K73T 3JSBA 2HMIB 1DQ9A 5AQFA 4PPZA 1VK3A 3AVKA 3AB4B 2C3YA 2I5JB 2OIHA 2YPYA 2HQ3A 1WKLA 2BJDA 3R3LA 3O3LA 1SCJB 4HVJA 1OH8A 4KR0B 2HQGA 5HL7Q 3TTDA 5KFCA 2V4JB 2P5VA 4AL6A 1OY8A 3OTDA 5IOLA 3JAMY 1CZBA 1B64A 2P9IB 2HW3A 2AZ3A 4YB1P 4PG8A 3THPA 5BR8J 1FNOA 3TUZC 4GMKA 2GA7A 3GSDA 1SV5B 4RR5A 3SMZA 4CLUA 1KONA 2GUPA 3F41A 1KVJA 1B0PA 3M5RA 5F0WA 3UW1A 1JB0C 2GMJA 3NBPA 5I9EB 3BSOA 2RUSA 3RYLA 1CLFA 2DH9A 3PW4A 4CEBA 5JMVA 3NNCA 2P9LA 4B9TA 2V8HA 4ISEA 4YHHK 2YHBA 2RU3A 1YVNA 2L08A 1F60B 2OJ3A 1IBKK 1KLMB 2YPZA 4CM2A 1QZ6A 3AVCA 2ZD1B 1X4FA 4ZN1A 2KXFA 5C42B 4OX9K 1QZ5A 4EBEA 4PY5A 4GRSA 4H0VB 4E2FB 3SAGA 4FF1A 4S0MA 3LDSA 3VESA 2RQCA 2RQ4A 4GKKF 5CXTA 1S22A 5D0GA 4B3TJ 2G1DA 2MZSA 1YHQS 3IMXA 4KH6A 4W98A 1QM9A 3CDUA 4QW9A 2E2NA 3LPEA 3CMES 2OPPB 4F36A 3POTA 1J5EJ 4LF6F 3T6JA 3D67A 5M2RA 3AY9A 1IBLK 4M63C 3I4HX 3DLGB 4N56A 1WC6A 2W24A 3TARA 4DR7K 4O0NA 2RNEA 3PSFA 3L0QA 1R8BA 4WWSA 4C8ZA 3SCXA 3UIQA 3S6EA 2B56A 2HFUA 3SNNA 4A5AA 5E3CA 4CJ4A 1URNA 3FLCO 4ES2A 3W65A 4HYKA 4FK2A 3VQ5A 3KWGA 4JI8K 1JL1A 3V9UA 2O5DA 2MSTA 1Q5YA 1H38A 1FFSB 1RHUB 4YMEA 2VBXA 2ZBRA 2HSEB 1VR6A 1N36F 3GCXP 2ZUGA 5A8RB 2PYJA 2JLGA 3ICLA 1RAJA 3I55N 2K3IA 2OZSA 1VS3A 1YJNN 4Y34A 1U2VA 3DWLA 1IR0A 2VFTA 2IM0A 4ECZA 2V2KA 2D3OR 1Q4RA 4OMFG 2YWKA 3FBCA 1B9DA 1AZSB 4O23A 5AQPA 8ATCB 3DGVA 1VQ6N 3BN7A 3Q0AA 3RMCA 3DGPB 4JOUA 1D09B 1XBWA 4GKJK 3B4MA 1YDLA 4M41A 4DTUA 3A5LC 3P83D 2E7VA 3AVAA 3TPQA 2YNFA 3AO2A 2ZH5A 3MM5B 3VQDA 2FHKA 2NXEA 4X4NA 2B5JA 5A8WA 2OTJN 2VV5A 5B0DA 4A8OA 2Z56B 1RDRA 4LMZA 2R7OA 1KOOA 2B9EA 1MWYA 3ZTSA 4CYUB 4CO5A 3FQKA 4BE1A 4PEOA 1HA1A 3FBFA 4OI2A 2DJWA 1R89A 1RDUA 4AHSA 5AZJB 2G8IA 3VR1A 2GWKA 4DR7J 1CBKA 3GMGA 4DUYK 3MD3A 3ITHA 4G1QB 2Z1HA 2ZZNA 2HNYB 2WTUA 2IAJB 1YJ7A 3D3CJ 4UQTA 4A46A 1ATNA 1H72C 5F9LA 4Q5VA 1IBCB 2OTLS 2E7WA 2XI3A 1XNRJ 4X66F 2J0QD 4YOUA 1HD0A 2LU2A 1T6DA 2HFNA 1ZM4A 4X65J 4CIOA 3HP9A 4CFAA 5JXSA 2YQ0A 4CJ3A 2MTLA 4BC5A 5M1NA 3H20A 3ZC4A 1W9HA 4JI8J 4PL8A 3VEXA 1NWKA 5FPEA 3A2FA 1DTTB 2X6NA 2GX8A 4RL1A 5JLFA 4ZJQA 2E5JA 1GH8A 5C24A 5BN9A 1PAEX 1EWQA 1WKJA 5DDPC 3EMTA 1JMTA 3PACA 3MD1A 3QMLA 4C11A 4NXNF 3KLEB 4FWOA 4FWNA 3VGUA 4NMLA 4Z4IA 3KDNA 4I1TA 3KZBA 4URQU 4IG0B 1OSCA 1U0SA 5JVHQ 2XB2D 1ASVA 1X4DA 1QAJA 3TUPA 1Z2LA 4NCGA 3NCIA 3M6GA 4GKJJ 2P9LB 2WW4A 1Q81T 4XDDA 2MB0B 3OTOF 1LK7A 1AT1B 4B3RF 2DNLA 5IT9Y 1C1AA 2K06A 3ENQA 4ETXA 5FPNA 4O4GB 3HSDA 3H4DA 5CABA 4QBUA 1RWKB 2V0NA 4A48A 3RB6A 5KFRA 2UUTA 1LW0A 5I3UB 4DS4A 1QAYA 4HKQA 2AIRB 3QEVA 1U09A 1TAUA 1HQEA 1S5JA 4AFFA 2XY7A 3CJ7A 4M1KA 4DUYJ 3UN2A 3IWXA 4DFMA 2APOA 3DRXA 4JRQA 1DLOA 1JLQA 4CZMA 3RB3A 2CJ9A 3MF5A 5E7OB 2HZCA 2OSQA 4DV2K 1RHMB 5GMKa 3WXIA 2XLIA 4PA1A 3PIPL 2RDIA 1NNDA 5GAGU 1TK0A 3W5ZA 4BWJA 1RAFB 1Q16B 2DPIA 3VETA 2D0BA 2M70A 1KQSM 3ZZUA 2Z8QA 4BDPA 3GYXB 2W9AA 2E6MA 1AB8A 1Z26A 1GOAA 1Y3KA 3CCQS 3S41A 4O3RA 4KKOB 3AVHA 3KNGA 4QR0A 2P9CA 4ATNA 3V2UC 3IS9A 2XI2A 1TL3B 2M3DA 3CC4S 3PM9A 2BM1A 1TL4A 1C6VA 2WBRA 2VG7A 1YAGA 2WVEA 4Z7CA 1KS2A 3MWPA 2H48B 1HBMA 4NWBA 4DL4A 3OVNA 2FLPA 1NPPA 1M90O 5J2MA 4IR9A 3VTHA 5FLXY 2LDYA 4EZ6A 3RBDA 1JJ4A 2I0XA 2NXUA 3L4BC 1VBZA 3VF6A 4H8KA 3ZYYX 2XHWA 2HF3A 4Y2CA 2FZCB 4JS5A 1UETA 4X62F 5I3QA 2W8LA 1T05B 3AJ2A 3W2WA 2XGPA 4BC2A 1V4TA 4DV7F 1NO8A 3TABA 2ZH9A 4WQ4A 3NGUA 2NRHA 1LFPA 2YCHA 2WC9A 3M32B 2RIJA 3C6AA 1VOMA 2R7UA 4ECQA 1NK8A 2FYXA 3P96A 3C6UA 4LSLB 5K8PA 3P8BB 2VFSA 2GIQA 3TA0A 4CJVA 3Q8PB 4C0HA 3VEZA 3AD8C 1SXLA 4MLHA 2KT3A 5E0OA 1PKUA 3VGTA 3H3NO 2LA6A 2ZEJA 3CWJA 3SQGA 3R5AA 1F2GA 2V7ZA 1YJWN 3BO2A 3PEHA 3ULEA 5D77A 3CCTA 4U8YA 2JX2A 4PYDA 1JXLA 1TK8A 3HSTB 2Z1IA 3RGIA 3ZZZA 2UXBJ 4DV2J 1UZDA 4CQ1A 1SL2A 4PG7A 2B4PA 3FMBA 5ETKA 1VQON 2JWLA 3D7EO 2FJEB 3EZUA 5LL6Z 4UTGA 2R42A 4ZPVR 1Q78A 2I1RA 2P51A 2M7SA 1EIYB 1HUXA 1T0TV 4CGIA 1X4BA 2VA2A 4LVNP 2VBWA 1F2HA 4P73A 3S1TA 3Q2TC 2UU9K 4CJQA 2MKHA 1TKZB 4AL5A 3KG0A 4OJ1A 3IKMA 4FLVA 2KH9A 3C6HA 1WOSA 3M2VA 1WAJA 3PRVA 1XIQA 5DLGA 4BY9C 3OYMA 1FE4A 2EK6A 3H45C 3NF6A 2AMCB 3Q24A 3BSCA 5B0EA 3AJDA 2Y1RI 3HHLC 3CCLS 3BGUA 1U1RA 4QS8A 5C24B 1OS5A 3QRPA 4C11B 2VWBA 3CHWA 1RAGB 2WVFA 1NDCA 4JV5F 1RT1A 3H46O 2CA9A 2DXDA 1MNEA 5KFJA 4DTJA 2EWHA 3MWTA 1NDPA 4DTXA 1L3TA 5LMNF 4DV5F 4DF8A 2O8BA 1L3VA 1U2CA 3CJRA 1OMSA 2CKWA 4AHTA 4OI0A 2UXCF 4I2QA 1I1GA 1NKBA 3LGNA 1DTQA 2V6AA 4U96A 3SQ0A 1LNQA 1G99A 1HNZK 1CULA 3AFGA 3M8ZA 1WD6A 3R5CA 3PEJA 1YIJN 2IPOB 3QT8A 1V3ZA 4J9OA 5DRKA 1UA1A 5D6GA 4DX6A 4JN4A 3H2VE 2ZM6J 1PBUA 5IT0A 5L1LA 3LP1B 1VQLS 2DCUB 1LW0B 1RT4A 2X1AA 2V4RA 2W9CB 5HL7L 4K8XA 2Q0RA 3SI6A 3ZLJA 2ZF5O 4XDCA 3K2PA 2OELA 4UZCA 4BGBA 4MYUA 4BVPA 1HNVA 4R5PA 2AYEA 1FTRA 3H4BA 1XMOF 5LOQA 2RU9A 1JXVA 1RT6A 2QXLA 1DLOB 1JLQB 2R7YA 2JJ4D 1HYSA 5HQLA 3M30A 4HR2A 3FEXB 4DV0K 1IQZA 5ITHA 2GHVC 5FLXU 3IG1B 1WF1A 2Y1JA 3UR3C 3EYZA 2UU9J 2B4VA 3M2UA 4PQAA 5ETRA 1TUGB 4CLZA 2FF6A 2QM1A 1RCXB 4GVMA 4NOHA 1TV6A 4W5RA 4CH0S 4JV2A 4ALZA 1H0HB 2V8VA 2FZGB 3DOLB 4XK8C 2VZ9A 2HG4A 4ED3A 1WC3A 1IXKA 2IDLA 5E41A 3ZETB 3H7HB 4IH6A 3CPWM 1UAXA 3L2RA 5IQQA 4F4XA 5FROA 1UFKA 2GWJA 2DNZA 5KQDA 2R2TA 4MO4A 2VASA 3PYDA 1GLLO 2QA4G 5J2MB 2GHPA 2Z2LA 1DFDA 2ZH4A 4IRKA 1RT5A 3L4QA 4G1IA 1S72N 4BRHA 3W64A 4FM1A 4ZDNA 2DRAA 4KH5A 5I3PA 1UVIA 1L3SA 5KGXA 4WFAQ 2W4PA 3DU5A 1HNZJ 3VMFB 4BRNA 4DXLA 4MK9A 3W2WB 4X4PA 4DMNA 3CCZA 2QLBB 2IRXA 4J2AA 4OZNA 1YVFA 2J4RA 4ZS6A 3U7JA 2QGFB 4RNMA 3CQYA 4PABA 1TKTB 1XC9A 2E2OA 1RQ0A 4UUXA 1WJ9A 4KHPF 3W7BA 3IRXA 4CZLA 4FOIA 4YDDB 4DV1J 4M5DA 5JLHA 2VPWB 4NLTA 2XULA 4LIWA 5KFPA 1T3VA 3LGHA 1ZBLA 1CG2A 4BRGA 3M6XA 3SQGB 4WIQA 3I5AA 4BG9A 3AD7C 5A2QY 5CCMA 3ENWA 4G3IA 1UVNA 2MQMA 4F4WA 1B92A 3TTFA 1BU6O 2G0JA 1ATRA 5HP1B 2FGOA 3QWUA 1SH2A 2BX6A 4DV0J 3IWNC 2FJWA 5KT3A 4A8MP 1IJEB 2CNOB 2G8VA 2W2PP 2RE2A 3ZSVA 3HVTA 2DHGA 3BGRA 3N6LA 1ZAWA 3H90A 2HBLA 2GHWA 3F0NA 1CC8A 3R7NB 2AGQA 3CCRN 1GOCA 2RJZA 1W7WA 1Y5IB 4ZVSB 2ZKUA 3KG1A 4HTJA 3E1YA 2E1PA 3O4WA 3AAPA 1IQTA 2XY8A 3NWGA 5FRMA 2YNHB 3VQSA 1X60A 4GY2B 2O01C 4KPYA 4AYBD 2IM1A 5AE1A 4ANDA 2BQUA 4ED5A 1VCTA 2DFEA 3VQ6A 4OO1J 4UZBA 2ZE2A 3LL3A 3M2VB 4P10A 3OW2M 4U7UK 5F1XA 3G4SS 2A40A 4KTWA 3C65A 5KFXA 4CGGA 3Q8YA 2ZOGA 1BE4A 2G8UA 1APSA 1RT2A 1NK5A 3ZTPA 4F8RA 1RBSA 1RT1B 1B3TA 2V52B 2M2BA 1NOZA 2M52A 2AW0A 3VAMA 1WBBA 2CJAA 3L4IA 4ZLJA 3EVWA 2O8BB 4YOEA 1S1VB 3PIOQ 4MK8A 3KK1A 2MKIA 2VODA 4I2QB 4MYTA 1PGZA 1DTQB 4LF6K 2DR6A 4ED7A 4WP9A 3RAMA 5EGYA 1PJ7A 2CZ4A 1DQAA 5ADZA 4URGA 3AVNA 5CD4H 3PX0A 1KNZA 1S1TB 2EWSA 3CQXA 4DSEA 2YKQA 4MFBA 5L9XA 2W7OA 3UKRA 3VGMA 1WLJA 3JSMA 2HAFA 1OVYA 3O3HA 5KGWA 1X9MA 2Z0GA 3UI3A 3KD1E 2HZVA 1YG0A 2H5IB 2A1RA 1AFIA 5IWAK 5THWA 2VQFF 3BR9A 2GVZA 3HVAA 3TJAA 2A10A 2X3DA 4JD2A 1KOHA 2Q31A 2IVOA 1FJGF 2K3KA 3A1YG 4R5PB 4ED6A 5IZHA 4I9QA 3SZ2A 2QWLA 4L3QA 2CYYA 3A8KA 3NE6A 3DRSA 1RT6B 2QK9A 3ZZYA 5F8IA 3IMQJ 1HYSB 3CCVS 3OLAA 3DRYA 2MQ8A 3ZEUA 4MJKA 5IT4A 5JVHL 5F9NA 2XMWA 4N41A 3QNNA 3DLKB 2EXUA 4J8FA 3M2UB 4O8KA 2OA8A 4JK7A 2V8PA 4MIWA 3CD6N 4P2FA 1GXTA 3GIIA 1TV6B 1RDCA 2QMUB 5C2CA 2MQPA 1WKKA 1F9HA 1N56A 2RKIA 3BQ1A 3GL1A 4BRLA 2A6OA 4N8OA 3LF0A 3HYFA 3O4NA 4LIRA 3GWCA 3VQCA 1DGKN 1UEUA 4GVBA 2BH1A 2MLZA 1NXIA 1HNWF 4BC4A 3NGKA 3UD4P 3VENA 4KREA 3G6YA 2EC0A 3J8AA 5FIIA 5A2QU 1P90A 2KKHA 3ZX2A 4WE1B 3P4UB 3WC2A 3J7YU 2ZVIA 3CW2C 3D0IE 3DMJA 4FLYA 4TSXA 2MLYA 3WQTA 2B4UA 2E2QA 3FFIB 3U1MA 5DDOC 1O13A 4EI2A 2ZH8A 4WFBQ 5ETLA 5DZ7A 1ATSA 1V3RA 4QIEA 1FRXA 3UCGA 2RAQA 2W7AA 1V6HA 1BCOA 3FMWA 4J90A 4JI2K 4X66K 2D0AA 1OPZA 3QETA 2GS8A 5IWAJ 3IRXB 1RTHB 2IVPA 2V69A 3UQSA 2FC8A 1NU4A 1EKRA 3GCWP 3D6FB 4LQ9A 2ZJRQ 2ZDOA 5A0YB 1G7CB 3T1HK 2HFOA 5GVQA 3AA4A 1O8BA 1M90T 4K4UA 2CQHA 4V19S 1FDAA 1KXPA 1KFDA 2A2DA 1S57A 4K8ZA 3TWZA 2MY7A 4F67A 3ZX0A 4CH1A 1N32J 4F9OA 2B9XA 3NCRA 2IC3A 2D3UA 4DKWA 5A8KA 1WSJA 1NMNA 3HVTB 3DLLQ 3P1GA 4H5WA 1H98A 5HMWA 1VSDA 2ZZMA 1RADB 3ILIA 5KAKA 1X9SA 4O3SA 4WK3A 1NK6A 4CLTA 3EPGA 2CG4A 1UW4A 4KI4A 4K59A 3CC7S 3OS1A 3SV4A 2O8DA 2WONA 2IOCA 4CF1A 3PW0A 4CEOA 4RWWA 3G6EN 2R7TA 2I9SA 4U9RA 2ZE2B 1X7VA 4IOAQ 4RLEA 2GJFA 3KHGA 3EDQB 2FHOB 1EB0A 1S9EB 4LF7F 3W8PA 1A6LA 1YTUA 1X3NA 2I38A 3EE3A 3M8RA 1N34J 1RT2B 2BQ3A 1B4SA 2XBPA 2DNOA 2BV3A 4ZVHA 4DBQA 2QO3A 4NLXA 3SDEA 5KI6A 2H54B 3TVYA 5HQMA 3CMEN 4DF4A 3JYTA 3MECA 1FEEA 3R2DJ 5F3ZA 3KJNB 4OZ0A 2P6TA 4XEIA 4B1WB 3M9NB 3KK1B 2DO4A 2QTWA 2FVQA 1RJJA 4ZOSA 7FD1A 2ZNYA 4PCQA 2CNKB 1RLDA 1Q9XA 1T9YA 4JI2J 4CM0A 1S0OA 1SKWA 4CVNE 1IKYA 4CD1A 2HLTA 5CYMA 3FSXA 5AJ3F 2EFOA 5LJ5Y 2X3GA 1B0TA 1VQMN 1JJ2M 2BJ9A 4MFBB 3ISNC 2YKMB 3CO9A 2W7PA 3JSMB 4HTUA 4MKVA 1U1PA 4FZXC 3VCDA 5L1KA 2JEIA 3T1HJ 3UO0A 3MCSA 3SBTA 3QJJA 5IM0B 3D6HB 4ZTFA 4A62A 1DJ0A 3EWGA 1CS4A 2HS3A 3L8BA 1VQ5N 4LF2A 2H9ZA 2ZC4A 4BR5A 3AGRA 2OP5A 4N8NA 1Q1KA 3P38A 4CEFA 2PGCA 3C15A 4NL5A 4Q43A 4CLLA 4FJLA 2O8EA 2GGPA 2OFGX 1SIZA 1DQ8A 3MWBA 1ICEB 4WU2A 5J1NA 2P8IA 1N5YA 1HI1A 1S99A 3QEXA 3O1LA 4FYDA 2ILZA 1VQPS 4GW6A 2ZH6A 1Q82O 2HVIA 1ELOA 1PG5B 4ZCKA 1A0OB 2PMZD 1FXRA 1BQMA 1HMVB 1AA1B 2XHCA 4Q8EA 2WOMA 5LJ3Y 3NGSA 3QNOA 1S1UB 2CG8A 2DNHA 4X62K 4WZMA 2KFYA 3ELHA 5CCLA 3HJFA 3W66A 1ZBUA 3SQOP 2AJQA 2AV5A 1JWWA 2RRBA 4IFEA 3BO4A 2RKIB 4HH0A 4IOCQ 4LFAF 3LH2S 4TQRA 2G0CA 2F7VA 4PG5A 3A5MC 3CC2S 4BRKA 1HLUA 4XIUA 3IFEA 2DR7A 2HBZB 3LDQA 1R27B 3EVOA 2CQBA 3SK3A 1M5SA 5D4LA 4USMA 2GJIA 1VQ9S 3B6OA 4DR5K 4USKA 4A8QA 2Y3YA 1VSHA 1FRIA 4DTMA 5LMUJ 1NSKL 4ZP6A 4KV8A 5F2RA 4LJMA 4Z2XA 3AGKA 2MQNA 2NZCA 2DR5A 2KYXA 1UJ6A 4DSIA 3NMUA 1UWBA 3EX7B 2K8GA 4M3YA 1IH7A 5AQWA 2VC0A 1BA0A 1X4HA 4J5OA 4N7TA 3HSGA 4JI5J 4CFDA 4QWAA 4CIGA 3NXZA 2OHDA 4C0OC 3GIRA 5D15A 2NRVA 3Q8QB 1PYSB 2NYHA 2P6SA 3A3OB 3CG7A 5I42B 1RK8A 4ZLLA 4DU3A 4LRBA 1RA7A 3V4MA 4FLTA 5DG9A 4NI2B 4NMXA 1H1VA 1TL1A 4NEZA 4KH1B 4F4AA 5HQ8A 1MW7A 2W01A 2HNDA 1U6ZA 3AV9A 2P9SB 3GFYA 2R8HA 2PAVA 1Q9YA 2HFSA 2XLKA 3O6WA 4B9VA 2CPFA 4NCAA 4JI1K 1AYEA 3TR8A 2F4FA 2QL7B 5GAHI 3Q83A 1ZH5A 3TZYA 2D9PA 2WCXA 3ATUA 5A8KB 4O0IA 3TA2A 4DWIA 1HBOB 1GFWB 1ZPWX 3U1NA 2Q3PA 4W5TA 1U04A 4WFAL 4DV5K 4FJ5A 1FNXH 2HQCA 2CDRB 5MLCV 4CT9A 3I87A 3ZFVA 3CI5A 3MX5A 3TX8A 3CCES 4X2BA 2BUNA 3B78A 1SJ3P 2O8DB 3N01A 4DV6J 1L5UA 3QESA 3LWMA 5HAOA 3RJMB 5EVZA 2EEYA 2C22A 3NRBA 4WP8A 3VVUA 3BS9A 2WZ1A 3US5A 4CZJA 1E6VB 4OHXA 2M88A 1ZBTA 5KPTA 4DR5J 1E4GT 3BV8A 1HHQA 1VHFA 1XNQK 1FJ7A 4DDFA 3IM9A 4DV4K 4K4VA 3RB0A 4GNIA 1HKBA 4LF9F 3OFGA 3UPFA 3TUIC 4DFPA 2VONA 5T7BA 1YQHA 4Y6IA 4EYIB 1N33F 4BRIA 2VBZA 1U02A 4AM7A 1GMUA 3THTA 4A8KA 4K4ZA 4ZPCA 1XMOK 4CLFA 1ASWA 2D3ZA 4CO0A 2QWRA 1IM4A 2QSWA 5H9FJ 4B1VA 4IWVA 3C16A 3J80Y 5CYMB 3HKWA 2QFIA 4DU8A 3J7AP 2IS3A 3V6KA 3MXIA 5C15A 5HVHA 4Z7YA 2VD3A 3CCSS 4NXMF 1NM1A 2OLWA 3PX6A 1G3OA 2J8SA 3PSIA 4ICLA 2ATQA 3CC4N 4BE0A 4KGKA 5A6PA 1CS4B 2LQ8A 2Y1LB 4QCLA 4JI1J 3C15B 2Y1IA 1NGEA 4LR8A 1YSJA 4RW7A 1OSDA 1EKEA 3AOAA 3FRZA 3F2KA 2GGPB 4H0TB 1F3VA 4GV6A 4DR4F 4Z0UA 2PFUA 4H5NA 3ZSWA 2JFKA 4QIWD 1IG8A 3BDPA 4EIAA 5L38A 4DR6F 3PIOL 3MXHP 1RDWX 4UW2A 3VN5A 5B0AA 4CEZA 2WOMB 1IBMK 1ZPVA 3K7RA 4LBHA 1KTQA 4PR6A 3OV7A 5CZ1A 3D1QA 2VH7A 1T02A 4JI3F 3QO9B 3O80A 2CGJA 3PDNA 4C98A 2A6MA 4FNIA 5E3AA 1PYOB 2Q6CA 4NX9A 5A76A 3OYBA 4K4TA 3OY9A 3NL0A 1CJTA 1CXUA 3R27A 1HARA 3RMDA 1YBAA 1XNQJ 1S49A 5HJYA 4DV4J 2XMUA 2HHTA 4E89A 2AYMA 1WNEA 2LXFA 4LF5K 1C0MA 3GTYX 1ZETA 3SQ4A 3QFPA 4FXDA 3VA3A 3EE8A 4M5HA 4JI0J 1K8AT 3CD5A 4L76A 1UW9A 2HBYB 4JI6F 1U1QA 1UWBB 3DDIA 1RSCA 2GTDA 5KFWA 3BH7B 4LBIA 4RTFD 3MPVA 3Q22A 2YXLA 3LDNA 1HBUA 1TTHB 4OHZA 2A2CA 3GLJA 1NJIO 3N6NA 3MEDB 3RR8A 2VDHA 4DLGA 4K43A 2VJUA 2Y0BB 1YI2N 3OSPA 4ILLA 2NSBA 3UKUA 3PCOB 3ZT1A 2J0SD 3OHAA 1XQSC 1FKPA 1I3OB 3CCLN 3VEVA 3S3NA 1UMJA 3H98A 2Z57B 2HNDB 3B4DA 3FZLA 2DHSA 2EI5A 3IR6B 4KHMA 1TUWA 5G4DA 2CNLB 4OI1A 4DU4A 5CQGA 1R0CB 2FZKB 3WDOA 1VQ8N 4ELUA 1BUPA 2GQ2A 4IYQA 3M2RA 3MTJA 1NK4A 2KFNA 4A59A 4W5NA 1IBMJ 3WIVA 3IRWP 5AQZA 2KXNB 4UUWA 4PZVA 5BR8F 4Z37A 4KBOA 4J2BA 4OKJA 2Q0UA 4OZ2A 4NRUA 4WFBL 1U1LA 1KAXA 2C3MA 4IQMA 3ZTRA 5KG2A 4HEA9 1NM2A 3DRRB 2O67A 1J2VA 3UCZP 3V9XA 1VSJA 1J27A 2HQFA 2HQIA 4ILRA 2RQKA 1B7YB 3J80U 5MAOA 3ENOA 5CAAA 2Q6BA 3I33A 2XCAA 5DQIA 2UVUA 2KT5A 2PMHA 4W90B 1F5AA 1T95A 2D7SA 1YZ7A 2Q66A 4NLQA 4I6MA 4LF5J 2ZJRL 3HX9A 4HT7A 4IJAA 2QMXA 2BQRA 2SXLA 1WB9A 4ZITA 3R5DA 2OYQA 3O4QA 2OAUA 4ZPWR 1U2RA 1V4SA 3PW5A 3H3OB 2MZQA 3DFEA 2E5LJ 2WRMA 4QYZK 1H2VZ 5L9NA 4DL6A 3SSRA 3U1LA 3DLLL 1DY3A 1HYZA 1DT9A 3V6DA 4CO2A 4B3TF 5GMDA 3OJUA 3G8SA 4OYOA 1S97A 2H4WB 3OBYA 4DQPA 1BOTO 4C1NI 1J5EF 2V67A 1K1SA 2DBBA 2B7CB 2IDEA 2FLNA 1RTIA 2RVJA 2KHCA 4AH9A 5SZTA 3L2UA 5HRSA 2DFHA 1WDDA 3O9TA 4RJVA 4IOAL 5HRRA 4ICLB 3W0LA 3THWA 4ZK7M 1SJQA 4ZPBA 3KIOA 2QWQA 3FCVA 4JRPA 4KFBA 2CVIA 2BJ1A 3K59A 4CESA 2OGUA 1RE1B 1FD8A 3R6LB 3OJSA 3AAQA 3B6PA 4ID5A 2N7YA 3CE8A 3OYHA 2GFFA 4FP9A 4BDZA 1GX5A 2PFFB 4QIFA 3VGKA 1V9OA 4G6VB 2M8DB 3QMQA 4CIEA 1JK9B 3KUHA 4FLWA 3SJHA 1XN9A 1WAFA 3MUMP 3LP2A 4IH5A 1LWCA 1HD1A 5GIPA 3R2CJ 2O1PA 5GAHP 4M8LA 3OUYA 1I51B 5ETTA 2FJAB 3LP3A 4CBWA 1RHJB 2D9OA 4NLVA 3C14A 3TAEA 2CQ4A 1IM6A 2HK2A 1VQKN 1T03A 2QC3A 4KY3A 3RBZA 4OYWA 4PL7A 2GUIA 4AHUA 2Q1NA 4K4YA 4DQQA 1C0UB 1S4EA 1RBRA 2G1HA 4LR9A 4UY85 3VEWA 1PYTA 1FHTA 4B02A 3I56S 4YN3B 3QFUA 3IBWA 1HIYA 3C3LA 1NUEA 2MZRA 3G71N 3SMPA 4ZCLA 3CIZA 3HBTA 2FLLA 2E66A 3ZZOA 2IGIA 4WU3A 1M1KO 2PZSA 1SC3B 4DR7F 2F9WA 2QLJB 2QRRA 4H4MA 3DOMA 1HHTP 3NAEA 3FUYA 1UL3A 1NJWA 2IBOA 2BANB 1YT3A 2O66A 3RSEA 1FKPB 4FWPA 5HI7A 4IOCL 3PX4A 4DTRA 1XNRF 4NLUA 1WSGA 2L48A 2YWWA 2BXJA 1WUUA 4X65F 4LF7K 1D9DA 3FJ2A 4RW8B 3QZ8A 3MK6A 5H1SV 3P6YC 1SQGA 1NH7A 4JAXA 4IZ9A 1Q79A 3FRYA 1IJFB 3H1VX 3KTQA 4TYBA 4JI8F 5IS2A 2LEPA 1RILA 3EGVA 1Z4UA 2AJFE 3GJQB 3M8QA 4DCOB 1FNMA 5HN0A 2ZHAA 5HMZA 3HDSA 2E9RX 2F96A 1NHVA 3N4WA 4OV6A 5AXNA 1JLFA 3E01A 2YHYA 1NCLA 2A5XA 3L3UA 2XO6A 2HVHA 2QTDA 3GFXA 2GELA 1HWUA 1MWQA 5AJ3K 4DI6A 4LRDA 4XTTA 1Q7YO 2HWHA 5DJBA 3PV8A 3M1FA 4OI6A 2EVZA 1IV0A 2F8MA 4WKYA 1KC8O 4GKJF 1UPPA 2C42A 5K8NA 2HQDA 3TI0A 1LK5A 2EHGA 5LSLA 3J7Z5 3SAHA 3JSYA 2VPYB 1ZA1B 4B3MK 1EP4A 5AQJA 2YJEA 5BYRA 1VHIA 4KE5A 4K4SA 4CJLA 2GW8A 1CJKA 1QTNB 3DXKA 3CM6A 3QFWA 3TA1A 1Q8IA 3PO4A 2F8EX 3CNQP 2QEXS 1Q0NA 1YRUA 4DUYF 4WCEQ 5AQGA 1BDGA 1VRUA 2PA8D 4KH4A 2BACA 3FCHA 1S1WB 4CO4A 1SS6A 1X9WA 2PI5A 4X4OA 2DPJA 2R3VA 4L72B 4BROA 2NUUG 3P5BP 4WF9Q 2IMOA 2W9BA 3THWB 5E26A 2YX1A 2ZVSA 3L6QA 3R3TA 4BC9A 2EKNA 3QIOA 4BRMA 5IC4B 3NF8A 4ECXA 4D3GA 4X64J 4FOEA 2ZOFA 4DQIA 4CBUA 3OYCA 4C8OA 1Q86T 5HLFA 4RW9B 2CJYB 1Y5LB 4E3SA 4CFCA 2Z2YB 2EFGA 1RI7A 4DR3J 4F50A 3GFZA 1AROP 1U6BA 5M1FA 3SUPA 1UVJA 3C66A 4M3UA 4ED0A 2YBVA 5H9EK 4B1UB 3BYPA 4JHDA 1FRMA 5K5MA 4ZTJA 2A1SA 4V1Ak 4EFAC 3PW7A 5HMXA 2FVRA 4DTPA 1D9AA 5KT6A 2WUSA 3M3ZA 4LF4K 3LP2B 5KFHA 1LWCB 4DOZA 3OUYB 2AF6A 3AODA 3OS2A 4E7LA 3IUCA 1LW2A 4ILMA 2J5AA 2R8IA 2YHWA 3AO4A 2OD6A 1YBTA 3C14B 2G8HA 5ETQA 2QW9A 2ACYA 2VG5A 4F3TA 6FD1A 1BISA 3WHIA 1FFGB 1UJ4A 1XUPO 1RKIA 3MEEB 4B3MJ 4W5OA 2OPSB 4ZJOA 3D0HE 3W1YC 4K41A 1BA1A 2E6LA 1H2UX 2XMTA 1UEKA 3A8IA 3NLCA 1HNIA 2ZC3A 4ZIWA 3U9ZA 3QINA 2NZTA 4Q45A 2RRNA 3CC7N 4BHQA 4IRCA 2IVNA 2C3PA 4OPHA 5K14A 2WVCA 3ISZA 5D3GB 1C1BA 4DV2F 2UXBF 4E1JA 1TP7A 4WBFA 1XHXA 4I67A 2DNYA 1NHKL 3MX2A 3RSEB 2DVIA 1EHWA 3G8QA 5CZVA 2ASLA 3T6BA 1WSFA 2O3DA 2BDPA 2W6LA 5M1KA 3BEXA 2UUAK 3CIMA 3BYRA 5EOYA 1F9EB 3ET6A 3JTPA 3KDOA 2POKA 5BR9A 3H6EA 2IRYA 4NA1A 1X4GA 4XPEA 5H9EJ 4F3MA 2DYAA 1H7WA 3D1OA 3UDLA 4DL0C 2R7VA 4F4KA 4H5RA 5ETOA 2EKYA 1GXLA 2RHSB 2AD9A 3ZNUA 4K0KK 4LF9K 2KFZA 2QT7A 3M8QB 1WELA 1VRTA 5HSPA 4IFYA 5KFAA 1CJUA 4LF4J 2HS4A 1HI8A 2LQ9A 3E01B 4CJPA 1MMNA 5E33A 1FJCA 1FESA 8AT1B 4CTAB 3RZAA 2HBQB 4NYFA 2NQPA 3NOGA 2R2UA 4NLBA 2NRZA 1FKAF 2ASDA 3O3GA 3N79A 3WXMB 2IIHA 5MLCQ 2HMIA 4ANCA 3FNNA 3CF5Q 1HW9A 2C3UA 2DRBA 1T8EA 3JQKA 2ZM6F 1C0TB 4USVA 3K5LA 1FRHA 5KFTA 1NPKA 1BO5O 3B8HA 2QG9B 1VQPN 2LDIA 2BOAA 2YKNA 1HKAA 2U1AA 2W2OP 3OL7A 3TQ1A 2W40A 3OS0A 4DR6K 5TKYA 1J6ZA 1WEYA 4Y2IA 4B1YB 3CDAA 3V6JA 3CD0A 4QWCA 3UN5A 3CULA 4A8WA 1QQCA 1QDUB 2OSRA 1YJUA 3BQ2A 4PWDA 4YR0A 3K5MA 3PTWA 2W9BB 2CXEA 2GMLA 1JL2A 2FBTA 3A13A 2ZWHA 3PNIA 4NA3A 2DIUA 2UUAJ 1CVJA 2HBJA 2BEFA 2UU9F 3T5HA 4USWA 4FWLA 5FDLB 1GTEA 1G6BA 1WSHA 2JOQA 1P1LA 1C2PA 5HLFB 1VQ9N 3FKBA 1D9FA 2CWXA 4FJMA 4FJHA 4OLBA 1WC4A 4EYHB 4QR1A 3BBCA 4K0KJ 1RTDB 4W5QA 2HHVA 2ZD1A 5C42A 4RBVA 3LO3A 2D74B 1W7AA 2FVSA 3B8AX 4NYOA 1SJ4P 3E9PA 2P9UA 5ETNA 4JHDB 2R7QA 4C97A 2F4VK 2RD5C 5HBMA 2HHSA 3BP8A 4TXSA 3THYB 3TAPA 2Q36A 1R43A 3AA2A 2R8GA 1TFWA 1F3FA 2CQCA 3GIMA 4ZIVA 1L3KA 2OPPA 1UWAA 3TANA 1NMEB 3BGOP 3FZMA 3EL2A 4P7TA 1LW2B 1U24A 1K8KB 4J9QA 2FJDB 4ECSA 2V9KA 1HNZF 2V8GA 3E3XA 3CETA 2CFXA 1KD1T 1A5VA 5CHIA 2DR8A 3CSKA 4CD3A 4A2BA 2GX9A 3NCQA 2Z1JA 4QS9A 3MN6A 4ZJLA 4B9LA 1DHMA 5K8MA 1R3NA 3V1RA 4LFBK 3O9RA 1XTZA 2AKWB 5AQTA 2IRUA 4DV1F 2B8QA 1HNXJ 4QOTA 3W9IA 1GLAG 2UVRA 4PKHA 3MM7A 4CIFA 2WHOA 3WUHA 4NLPA 1NLVA 1HNIB 2ZBQA 4O5FA 2DNRA 2ZNZA 3CCEN 3V1QA 1U1KA 3EN9A 1FX2A 1QLNA 3OYKA 1Q8BA 2CQ3A 2CRLA 4DV0F 5K14B 1C1BB 4HTIA 2HNZA 4DU1A 1UA0A 3WNGA 4YORA 3MR7A 1TQLA 2CGLA 1X31C 3K5PA 3AH6A 4B9MA 3M8PA 4AUKA 3ZSOA 4DN9A 3H0PA 3DKDA 2YVSA 4C8YA 2BBEA 1ITGA 4UY8O 4C2MA 4DTNA 4JI4J 1OH7A 4ZLNA 3ET6B 1RP5A 2AU0A 3LWLA 3GOIA 2MQQA 4CZFA 1SL1A 4BREA 2VPXB 2YX4A 3MM5A 2Y9HA 4XAKA 1WI6A 4RZRA 5AQMA 1X3MA 2F4VJ 1WEXA 2KVIA 3VZHA 1FI4A 3CJTA 1FX4A 3CDBA 4WYWA 1T6CA 3DM2A 2E1ZA 1LWEA 4IFYB 3NMAA 3GR1A 3W3SA 1GQEA 3GE9A 5KFGA 3EEQA 4CYUA 2QWMA 3HO1A 3A5OC 3VAGA 2KI2A 5B09A 5KT4A 4F0HA 3QYYA 1RCOB 4B1ZA 3IN5A 4BRAA 5AZJA 2KT2A 2JVRA 2KHOA 2AGPA 1S9FA 3T1YJ 4Z4HA 3CCSN 1YRXA 2HNYA 2IAJA 2H5EA 1U2FA 3SEOA 4CERA 1J5EK 1BCMA 3QEPA 5J2PA 1CZAN 5KFFA 1IKVB 2RN2A 4CJSA 2GQQA 4CI0B 4TU8A 2HGMA 5DGAA 4FJIA 4LFBJ 3BF1A 1S3XA 4ED2A 1UEVA 2MYFA 3RW7A 1Q18A 1D8YA 3D3BJ 3OL6A 4OX6A 1N54B 4DPTA 1S6QB 4WYLA 4QQBA 2AA4A 4I6WA 2N4CA 4QS7A 1C0FA 2AZ1A 3QSIA 3D7SB 1DTTA 2D0OA 3CJ0A 4Y65A 2YKNB 3IWLA 3BSAA 2P9PA 3OL9A 1XERA 4F4ZA 4PHTX 2XO7A 3KLEA 2VA3A 2MSSA 5L46A 2UV8G 1T9VA 1Q7YT 4J91A 3HPOA 1NHUA 3TX0A 4IG0A 1D5AA 1LAVA 1JCEA 1SH0A 1KC8T 3M8SA 3CJ4A 4M3ZA 2HF4A 4QPXA 3O5BA 4PWDB 3I9V9 1AW0A 4J9NA 2VWKA 3OYAA 4YOVA 3W5YA 2IYIA 5KG7A 2XS5A 3J7ZO 2HVZA 5DMRA 2DO0A 1ZS6A 4FXWA 4GO7X 2ZHBA 2D5RA 4KHWA 4M3WA 4FVCA 1TK5A 4ZHRA 3OA9A 3CXCM 2OKQA 4YY3K 3KLHB 2GAGC 4CJ7A 1OJ4A 2C28A 1VGYA 1S12A 4O4GA 2GBZA 4M5JA 1JLAA 2FY8A 3PRDA 3OT9A 5I3UA 4ELVA 4O55A 4LSNA 2QKKA 3MMCA 5GAGP 2VIHA 4FO0A 2P9UB 4BR0A 4AILC 3ULHA 5HBMB 1TL5A 2ATCB 3I96A 3QGHA 4BRPA 3FFKB 3UE2A 1M5VC 4RU2A 3VQ7A 4H0YB 4KIAA 3IAM9 5B08A 3MR6A 1KEKA 2E7XA 2MJNA 4WCEL 1IO2A 3ULDA 2RF2A 4DSJA 4IO1A 1O5JA 1BD6A 1DKGD 5C2GA 4C8MA 2OPQA 4WF9L 3KOAA 3THVA 4CE9A 2NUHA 2OH2A 3PVXA 2R7SA 1Y3JA 4FSVA 1TFYA 3W2VA 4DFJA 1XMQK 2G8FA 1VQ4N 3SSQA 2G2YA 1XNRK 1YJNS 4M5GA 2DXEA 3ZZPA 2I7NA 3THXA 4OZJA 5IWAF 1UCNA 1IVZA 1D0EA 4MIAA 1Y11A 4X65K 4KKOA 4CEEA 2LQJA 4FVUA 3LANA 2BRLA 3OD2A 1TL3A 3EVMA 2OPRB 2P9KB 3MM7B 5AQXA 4JB8B 5KFQA 3FZBA 2R7WA 3CJAA 1S0VA 2E1RA 4DV3K 4NYPA 1OY9A 2IJNA 2AJ0A 4CHZA 1N32F 2X1FA 4YR2A 2G2ZA 1UFLA 1FDNA 2K1RA 2WW8A 2OTJS 3K17A 4MQ3A 3T69A 2JLEA 2HNZB 3HZEA 1TU0B 1FWLA 2E1MC 4UT4A 3HL8A 2CJQA 2X1GA 5DM7Q 4WFYA 1RACB 2FXUA 3DCAA 4NZ7A 2YNGA 3M8PB 3BUZB 4OJGA 3ZTQA 3SJJA 1BI4A 4LF8J 1VI7A 3CJCA 1FDDA 2CPDA 3QB0A 3S3OA 3G86A 3KKSA 1T05A 2Z2MA 4YY3J 1RLCL 1WF2A 4NLWA 3SUQA 3E51A 2IBKA 3M32A 3QT7A 4FXVA 4USHA 4LSLA 2R4FA 5DG8A 2W2MP 2OO4A 1KVAA 1HKCA 1QVFR 2GVDB 1B99A 2AHOB 5LSOA 3KKFA 3CT9A 4BR9A 3OTCA 2O8CB 2ADBA 1QSYA 2DNKA 3DM2B 1LWEB 1K1QA 4ZPDA 1QD1A 3F56A 3TWHA 2HHWA 1N34F 2WSEC 3QRRA 5IV4A 2ZH7A 5HROB 3QWPA 2FLOA 2IM2A 3TAFA 5JS2A 1YBUA 1VQ7N 4CJWA 3DXSX 2YH1A 1FT8A 4ERDA 2VFRA 4BQZA 5H1SQ 2MKYA 3K57A 4K2JA 1K9MO 3KHRA 3WNFA 3E9OA 1I94K 3H25A 1R59O 4JKGA 3OYDA 3BKFA 3CCWA 3C19A 3NH2A 1CQNA 3BGFA 1RBOB 3KG4A 1XMQJ 5J2PB 1GTHA 1NAQA 5C5JA 4DMZA 4JI2F 2XS2A 2J76E 5F8GA 4FL9A 1NDKA 1HI0P 1VIXA 1KQFB 2AT1B 2MZ1A 4KC5A 1TKZA 1WC5A 2RUGA 5L1JA 3O5TB 1P8ZA 1R7IA 2VL1A 3T1HF 2ZITA 4BCAA 3MCNA 1JLCB 3KHYA 1JJHA 4FKYA 5AFUH 4DV3J 2NXCA 3VGSA 2DR9A 3SPYA 2VDIA 1ITPA 2CZ9A 1NGHA 2P9PB 2KM8B 1WC1A 5AE3A 1WWHA 4M94A 1HQ2A 1NH8A 5KRTA 3AVLA 2RS8A 4M7YA 2WFBA 3IGVA 3KJVB 2IFXA 1VK0A 4EWTA 2BA9A 2Z1GA 2ZWPA 2KZZA 1Y64A 1KVCA 2QWNA 1PJ5A 1ZA2B 2I7PA 2BJEA 1BWFO 1Q7LB 1SUQA 1WNSA 2W6KA 3NF9A 1PJ6A 2ALYB 2BYCA 3TZXA 4LC9B 1MU2B 3G82A 4A57A 4FM2A 3GV7B 1FRJA 3RUBL 1H2TZ 1OPIA 1RISA 2X7IA 4BRQA 2C1EB 4MO5A 3AJ1A 3Q86A 3V1OA 3L2WA 4ZHRB 5KFYA 4KSEB 2FHJD 4ECWA 4Z4EA 1YJVA 3NGRA 5KT2A 1KAZA 3CF5L 4M3TA 4EGLA 3CFOA 3LP1A 4QU6A 3NVMA 2LFVA 1JLAB 5K8OA 3CPEA 1EQ0A 3DN9A 3LOUA 2C2EA 3I56N 2W9CA 3SQ2A 4LSNB 4NLOA 3MMCB 3LALA 1N6QA 2MPUA 3R5GA 3QNWB 4DPUA 1RWNB 1ZYQA 3E9LA 5CYQA 4AM6A 1D3WA 1K73O 3GIJA 3DLEA 3KLGA 1I94J 2PI4A 5LMUF 2GJ2A 2V2QA 5AXMA 1LOUA 3P3DA 3QQCD 4JK8A 1J5OB 2Q2RA 4EZ9A 3VAHA 3IAS9 1VLOA 2FIUA 2RF2B 4E7JA 2E44A 1AUSL 2UXBK 3IG1A 2OPQB 2H51B 5JMNA 4JI5F 1FFWB 3W2VB 3AVGA 2PIIA 1Z05A 4BG8A 2RHKA 3B82A 1HFEL 2YKOA 3THXB 4FBTA 3D28A 4RO0A 2MHNA 2YWHA 4P74A 1YRTA 1WBDA 1QQOA 3DXMB 5CY4A 3DOLA 1JIHA 1H3DA 5A6WA 1UFWA 4I69A 1W2BR 4WZQA 1NGBA 1FERA 3ZETA 1PILA 2E4LA 2LEBA 1TKXB 1QHTA 4KYZA 2MKJA 1RBLA 2RDJA 5E5NA 1M5HA 3VQ9A 4DS5A 3EUNA 3TAQA 2K1RB 4RX6A 1VSEA 3R6MA 3VPZA 4HH1A 2I8EA 3M6UA 4KHQA 2FPHX 3EGNA 1VSMA 2CPHA 2YNGB 2G4BA 2F5GA 5J1EA 1RBTA 1XR5A 1F9FA 1C1CA 5M2PA 1BI4B 1Y97A 4ILGB 5LJVA 5BREA 3O3FA 4DX7A 2KO1A 1X4AA 4DR1K 3HD2A 2NLWA 1DZ5A 1GXUA 1AFJA 2DGVA 1BMQB 1NG9A 2EFVA 3LQVA 3I6PA 1TKTA 3OXLA 4DV6F 4PPDA 1VC6A 2B9YA 2PEBA 2DNQA 3LDLA 3V5RA 1UZHA 4DUZJ 3BZKA 4FJJA 2A0FB 4CJFA 3MZIA 3WZ0A 3H5SA 4KPCA 2RILA 2ZM6K 4PKIA 3CJBA 2DNMA 2ROEA 1R8CA 3V9WA 2VBYA 4IRDA 4DR5F 2QEXN 4JKBA 1WOQA 1J9AA 4JUZA 5ETSA 1SKRA 5HP1A 2G8WA 5TKWA 3ZXWA 1WOPA 3HPHA 1RWVB 1EX8A 3MMBA 2PN6A 2KU7A 2B43A 2VPZB 2QLFB 5HRPA 2W41A 3E8OA 1WG4A 3CGIA 3HHLD 1MMDA 1WHVA 4JKGB 1BL3A 3EDRB 2CJKA 2JSXA 3NY0A 2VYPA 3D2FB 4UY8T 1ILYA 3LPTA 1ZM3A 4H0PA 1EETA 3KWMA 5K20B 4DPXA 5LXYA 2PBDA 2F9JA 1HQUA 3QZ7A 2DD8S 1IG9A 4Q8FA 3QICA 3M1VB 2YNHA 2KKZA 4JV1A 3VEYA 2VWJA 4WK1A 4RBUA 3X1LB 3Q89A 3SQ1A 3QDKA 3EGZA 4QR2A 3QEWA 2HS0A 1FA0A 3ZZTA 4OPKA 4L8RB 4JI1F 4OPAA 1QAXA 4H5VA 1QHAA 1S10A 5GAHU 4DB3A 1FWPA 2RRAA 2C2NA 2HB5A 1X5SA 3MFHA 1VC5A 1S1VA 1SUQB 1I6JA 4DG1A 5ETPA 4DR1J 3G82B 2NXJA 4IOXA 1RYRA 4ZVFA 4TQSA 3C8YA 2MXYA 4QJVA 4B9SA 4CK2A 3R1LA 3G87A 3HHNB 3AVFA 1S1TA 2CPXA 1RUSA 1RB0A 1U0HA 3GB0A 1G4CA 1ESVA 1UVLA 4DX8H 1N52B 3WXLA 3TJ8A 4YS2A 3PFOA 1RWPB 4QIVA 2ZJPQ 4IDKB 2AEMA 1HX1A 3B54A 4RWTA 3D6RA 4RNFA 1Y10A 2W4DA 4AXIA 4RW4A 4B08A 1PCAA 1U8WA 4YOXA 4KHRA 2EK1A 4Y1DA 1YGYA 1XNQF 1JNRB 1N6QB 4X4VA 4DV4F 2UXDK 4DV1K 3MPDA 2HEKA 1S0NA 5CYQB 4CEAA 3K9JA 1QQNA 1HBNA 2U2FA 4ES3A 1E4FT 1YVUA 5KG3A 3DLEB 3KLGB 1MA9B 1JX4A 7FDRA 3V9SA 4RW6B 2V50A 3N4QA 4J9KA 3EZWA 1ZTWA 4JI0F 1RAAB 1RU1A 3W60A 5M1PA 3KLIB 3TR5A 2P5OA 4FWRA 3BB5A 4EP5A 2MKKA 2K7JA 4E8UA 4PXBA 1NGJA 3VA0A 3DLKA 1NB2A 3BEGB 3K8WA 2RS2A 1WSIA 1VYAA 3OPKA 4IFVA 4FJ9A 1SIWB 2QA2A 5AQOA 1TMJA 4KJIA 1YK9A 3DDKA 1T94A 2H65B 3WEEA 2CADA 4FF2A 2JL9A 5AQNA 5EY4A 4OKKA 3OYJA 4OYZA 2E9ZA 1Q81O 3MEGB 1N5VA 4DQSA 2QA1A 1P6TA 4R25A 4O3PA 4RPFA 3WXKA 1G15A 4C6AA 2AJ1A 2VB6A 2FF3B 4FF4A 4WE1A 3H1QA 4V19J 3UDVA 3A8EA 3ENAA 4DSKA 4X4UA 2IJRA 3FFIA 1IBMF 5J1EB 1RTJA 4FJKA 4B9QA 4OV1A 1C1CB 4OZ5A 3GONA 3PUFA 3H5XA 2R7XA 2JEJA 2CPJA 2GV1A 3TZZA 4A8SA 2XMKA 4BC7A 5ADXA 1X9JA 4UQGA