3Q7CA

Exonuclease domain of lassa virus nucleoprotein bound to manganese
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
210
structure length
209
Chain Sequence
GFTAGLTYSQLMTLKDAMLQLDPNAKTWMDIEGRPEDPVEIALYQPSSGCYIHFFREPTDLKQFKQDAKYSHGIDVTDLFATQPGLTSAVIDALPRNMVITCQGSDDIRKLLESQGRKDIKLIDIALSKTDSRKYENAVWDQYKDLCHMHTGVVVEKKKRGGKEEITPHCALMDCIMFDAAVSGGLNTVLRAVLPRDMVFRTSTPRVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Nucleoprotein
publication title Structure of the Lassa virus nucleoprotein reveals a dsRNA-specific 3' to 5' exonuclease activity essential for immune suppression.
pubmed doi rcsb
source organism Lassa virus
total genus 60
structure length 209
sequence length 210
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17290 Arena_ncap_C Arenavirus nucleocapsid C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.410 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3q7cA01
3Q7BA 3MWPA 4GV6A 4G9ZA 4GVEA 3R3LA 4GV3A 4FVUA 4GV9A 3MX2A 3Q7CA 3MWTA 3MX5A
chains in the Genus database with same CATH superfamily
1BQNA 3M5RA 3NF6A 4BWMA 2IDOA 3BF1A 2QWLA 3HBTA 3E66A 4KPYA 3G25A 4N47A 3TAMA 3LZIA 4N56A 4HCBA 1TV6A 4BRLA 3TPQA 2O8CB 4FJKA 4BRFA 4BDZA 2XY5A 2NLXA 4LF9K 3QFUA 4YY3K 1ZBSA 3TU5A 5EVZA 4B9UA 3CG7A 3CCLN 3EN9A 5KTQA 4FM1A 2HBMA 1KAZA 1XNRK 3HTVA 3DXMA 4CF0A 5TKWA 3D2EA 1KSPA 4FJ7A 4F8RA 3AA3A 2Y1JA 4F2RA 2A6AA 1OH7A 3HT3A 3V4IA 2G8VA 3KKRA 3QEIA 5CHIA 2E2PA 3TSPA 3WT0A 3VQ5A 1NM1A 1L3UA 3TAPA 3SJJA 3HPOA 1J5EK 4H4OA 5AZIA 3KVGA 4BQLA 4ID1A 4UY8O 3AVFA 4H8KA 3M1FA 3LDSA 1SZ2A 4X65K 5E84A 4JK7A 5AQYA 3UIQA 4JHDB 4BRKA 2B6AA 1TL1A 3L4QA 3C6UA 4KHPK 1KCFA 3V9ZA 1IKYA 3TARA 2YCHA 1DTTA 3CCJN 4H0OA 4C8KA 1VSFA 3MX5A 2QWRA 2IVNA 2WONA 5H1SQ 1VSJA 1Q9YA 2YNGA 3AARA 1BUPA 3LDNA 3OBYA 3T7ZA 3OS0A 1S1TA 5BPNA 5AQKA 2GTDA 4CGIA 2AA4A 2XY8A 1FW6A 4ZTJA 4M3UA 4OGCA 1DT9A 1K73O 1HYZA 3RWUA 4JV5K 2KFNA 1VQ8N 3JAMO 3CIPA 3THVA 3SQ4A 2P9NB 4JNEA 4RW6A 3VERA 3B6OA 5C0YA 4FJMA 4A2BA 3O80A 1KVAA 3W0LA 4CGHA 3NCIA 3VQ6A 4BRHA 4H5NA 2KQ2A 2WC9A 4RCHA 3KLFA 3OA9A 4Y1CA 3MK6A 3UE5A 2GBZA 4DFPA 2ITGA 1HNWK 1QQCA 2HW3A 4DWIA 2NRVA 1BQMA 3RTVA 1ATSA 3EZWA 3AVJA 1N33K 2PY5A 3O4NA 1NU0A 2E1YA 4DR6K 1ATNA 3KLIA 1J5OA 4FW2A 3WXMB 5SWMA 3VTIA 4RG8A 2ZJRL 4CBUA 2CH6A 4H5WA 1HNVA 4CIFA 3M6GA 3AV9A 4JKGB 5ADXA 3DLRA 1IKWA 1WLJA 4YOWA 2ZJQL 3P39A 3FGUA 3BUZB 1ATRA 3DLLL 4DQPA 2KLAA 1RTJA 4NO7A 3IMXA 3K9KA 4PKGA 5AQVA 1HNIA 3LPUA 1D9DA 3S3NA 1BHLA 3UKRB 3JS6A 5GAGP 2O8BB 3NE6A 3H1QA 4B8CA 1YI2N 4CJ7A 4FJNA 5AQLA 4ISFA 4BACA 5AQGA 2P9SA 3K57A 2HBJA 1NWKA 4WQ4A 4DTMA 2HHSA 3HOSA 2QEXN 3KK1A 2PYLA 3H1VX 4JKFA 5J2MA 3S41A 2EHGA 3H45C 1XQSC 2ASMA 4B3TK 4M42A 3ALYA 3MN6A 5AQTA 1SL1A 3NMUA 3AAQA 4CK2A 3MN7A 4JS4A 1QVGM 3C7NB 4FCYA 1XI1A 4EZ9A 4X66K 3L6QA 3DXKB 3AVKA 3J8AA 1RDCA 2O4GA 3SMSA 4LSLA 1T44A 2CGJA 4M7YA 2D0CA 1M1KO 3QINA 4E3SA 3AGRA 2B4JA 3PO4A 4RW7A 2P51A 1NMDA 3DXKA 3IFRA 1YXQA 4H0VB 5FPDA 1OVQA 3OYHA 1WN7A 4FW1A 1S9EA 1KQSM 4FO0A 3QNNA 2D0AA 1IKXA 2ZWHA 5HLFA 2E2OA 3L2RA 4UQGA 1YIJN 3P83D 3DLGA 3ZSOA 3NHGA 3TAGA 3PX0A 3L3UA 3K9JA 1C0GA 4XH4A 4BE0A 1JXBA 3MEDA 4U67L 3O4WA 3CD6N 3LM2A 4B9MA 3I8DA 3SLCA 3WXJA 4NXMK 2PZSA 3I0SA 3CMEN 3OYFA 3RMCA 3P5JA 2UXBK 4B9TA 5C42A 1S1XA 4KHWA 5AZJB 1LW0A 2YNHA 3KZBA 1D8YA 4M3YA 4BC4A 2Q36A 3FE1A 5LMNK 3DAWA 4DTRA 1SL0A 1C1BA 3KK3A 4K0KK 3G6EN 4B9QA 1IG8A 1BDGA 1YF5L 5B8HA 3CHWA 1GOAA 3SQ1A 2P5GA 2Q2RA 3KD1E 4G1QA 1WBBA 4FK0A 2JGUA 4K8XA 3O9QA 1BU6O 2VG5A 4I6MB 5M1PA 3ATUA 3S3OA 1RTDA 2DPNA 2FBVA 3CCVN 3O6WA 4AHVA 2E4LA 3CCUN 1W9HA 3ZYYX 4YHHK 4HTLA 4BE2A 4E7IA 1ASWA 4I6MA 2QA4N 4M3TA 3RMBA 4FOIA 2G8KA 5AQWA 4EIAA 2P1JA 3V9UA 3FZMA 2HNZA 2YNFA 4DTSA 3LAKA 1YAGA 4QS7A 1QSLA 2A42A 4OPKA 4BROA 1S5JA 3RR8A 4FJ5A 4OKJA 4W5QA 1DTQA 4N76A 3VF4A 3ZSXA 4B08A 3MXIA 3ZEUB 4MDBA 4I2PA 2D4WA 5C2FA 3E9OA 4A5AA 4FOEA 2QKKA 3QEVA 3B6PA 5FLXO 1T03A 1TAUA 3VTHA 1TKDA 4OPJA 4F9OA 4CZHA 4Y0WA 3U3GA 4DR1K 4K41A 4W5NA 1BWFO 5C12A 5KPZA 1GOBA 4JK9A 3VQDA 1BOTO 4CGGA 4LY7A 2XY6A 5FPNA 3PX4A 3ZX2A 4F4KA 4CZEA 4ICLA 4JI7K 1OH5A 3IRXA 5J2QA 4BG8A 4HHTA 4OPHA 3M8SA 4DV2K 1YHQN 4KI4A 4KI6A 4PL7A 4MO5A 5HRSA 1L3VA 4DTNA 2FXUA 3MCPA 1DLOA 3O8MA 4CHNA 3CJ7A 5GIOA 3ZX3A 3R9PA 1HKBA 3SAHA 2NUBA 1V4SA 1SV5A 3ZT2A 3A5OC 1IBLK 3MDQA 4NCGA 3CQ8A 3DM2A 2UXCK 3KWGA 3G71N 4AHSA 1Q18A 5FROA 3A0IX 1CZAN 3C95A 3I33A 1NGFA 5KRTA 3CYMA 3L2VA 1C1AA 4C1NI 5J2PA 4JKCA 2PFUA 4JD2B 5AQFA 4JKDA 1RT7A 3S3MA 5AQZA 3LAMA 2P9PA 4Z4HA 3SPZA 3WUHA 3A5MC 4DR7K 1NJWA 1FJGK 1VSIA 1GLEG 1YJNN 4JD2A 3AVAA 1UA1A 4GY2B 3VA0A 1QQNA 1U45A 2FSKA 3F2KA 1WB9A 3HYFA 1QE1A 1YVNA 2HSTA 2VG7A 4Z4EA 1KLNA 3SUQA 4W5OA 1RDAA 2P9LA 2O8EB 2W42A 4FPAA 3C0BA 3ENHA 3TAEA 5EX5A 1RBRA 1BGXT 4KAZA 1CZBA 1A5XA 2IS3A 3CJ9A 4FJ9A 4DR5K 1W7AA 4FJHA 3SBTA 3ZSQA 3DOKA 1U04A 3T19A 4ILGB 3VQCA 3PLAA 4JI8K 4I9QA 3HK2A 1D4XA 4KTWA 1DEJA 2ZQBA 4AHUA 3A8YA 1RBVA 3CFPA 4CD3A 4AILC 2VG6A 1NGDA 1NGCA 4C8OA 3CJCA 4EFHA 1F21A 5M1KA 3K5OA 3R1XA 2ZF5O 3V1QA 4M63C 2NZTA 2GELA 3EY1A 2EWSA 1YJ9N 3WNFA 3DMJA 1ZC6A 3TTFA 2HNDA 1JLAA 4DU4A 4IG3A 4H5TA 4CFBA 1Z25A 4KRFA 3O9SA 3MAQA 2DFHA 3LDPA 1TAQA 2X6SA 3ZSZA 4DS4A 1EWQA 4KHSA 3DI6A 4B3RK 2ZM6K 2KZZA 1S6QA 2NRHA 4KB0A 3T3FA 1M90O 4YFUA 4DU3A 4F3TA 2HF3A 2P9KB 3CC4N 2BTFA 4PUOA 2QW9A 4CE9A 3THYB 2V52B 4IWVA 1U2VA 4C8LA 3P31A 4KHUA 4DCHA 4HUGA 1K9MO 4Z4FA 2JWKA 2KTQA 3NVKA 2P9KA 1LW2A 2UU9K 2I7NA 2A1SA 1BI4B 1RFQA 5C25A 4IO8A 5CR4A 1Q7YO 4EP5A 3M3ZA 3OYIA 4FWMA 1MU2A 2E20A 1MA9B 4EAHD 4O8KA 3LANA 1YVUA 1JL1A 3AVNA 1E3MA 3SJHA 4OLBA 4CF2A 1X9JA 5AQQA 2BANA 3WXIA 3NF7A 1MDUB 4H0YB 4OO1J 4LF6K 1KTQA 3C6TA 4FWLA 4DR4K 1C0UA 3SQ2A 5C10A 1TKXA 3R6MA 4BR5A 3FLCO 3IDHA 1DGKN 2HMPA 4LF7K 4O0JA 1VRUA 1HKGA 1WSFA 1N8RO 1WSEA 1XWLA 5J1EA 3HOTA 3NBPA 4IDKA 3AVHA 4PL8A 1EP4A 4FWSA 3OTOK 1NK7A 1ZBHA 1J53A 2XHBA 4BE1A 5GAEP 3O08A 2O8CA 1C0MA 4CEEA 5HOOA 2UUCK 4HUEA 3PX6A 2X6NA 3N4PA 3LP3A 1ZYQA 2Z1JA 3D6RA 4EHTA 2HF4A 1YITN 4Z4CA 4F2SA 3L8BA 4K25A 2CGKA 1QQOA 4DFKA 3CC7N 4NLCA 4W5RA 3OYJA 4PKHA 5AFUH 4DMNA 2GEMA 5EXWA 2YJEA 1FKPA 4OLAA 4CJTA 4JI0K 4DHYA 1Q82O 4FLXA 3BY5A 1W2BM 2VYPA 3ZT0A 2YI1A 4AHCA 4DV4K 3FZHA 4IXCA 3QDKA 3DJCA 3MMVA 1Y64A 4DS5A 3QESA 1NOZA 4KTZA 1JJ2M 4Y1DA 1XMOK 3CETA 1S1VA 4DQIA 4B1UB 4KHQA 1R59O 3H46O 4JHDA 2WFBA 4DSFA 1VQON 4GVMA 3O9UA 3O4QA 4FWKA 3VESA 1MWMA 3ID8A 4IKFA 5GIPA 1ZXOA 3D2FB 3T69A 3NDKA 3HJFA 1R0AA 4FSVA 4AF1A 1VQMN 4NLBA 2X74A 4CJWA 1NK5A 3AVIA 4HCCA 4BC2A 4CJSA 4CFDA 2W6KA 1X3MA 3FFIA 3HVTA 3CCSN 1HR0K 1JCEA 4DLEA 3EEQA 1VQ7N 3NGYA 4DR3K 3BZKA 3PIPL 3A5LC 3ZT4A 1CLQA 4CI6A 5AQMA 4DSEA 5JLFA 4CF8A 5KGXA 4IJNA 4XEIA 2PBDA 1TK8A 2P5OA 1B92A 5JICA 2P9IB 1X1PA 2AJQA 4DV7K 1RT4A 3S9HA 1HX1A 1VQLN 2P9NA 3O3FA 2QWQA 5CYMA 4OKEA 2ZJPL 1D5AA 1N36K 3SUOA 4YOVA 1REVA 3U4LA 4DTJA 3BDPA 4LH5A 1BL3A 3VQEA 2HHHK 4CEAA 4DQ8A 4CJKA 4LF8K 4JLHA 3THWB 4XH1A 3WNHA 2WBNA 3OVNA 3FZLA 1WNSA 1KVCA 2UUAK 3CF5L 2HOEA 1KXPA 3O3GA 3EYZA 1VQ6N 4GKJK 3IG1A 3TTDA 3CCEN 4CD1A 3MWTA 1HNXK 1NK9A 5AQOA 2Z1HA 3VMFB 5TKYA 2HHUA 4FLVA 1BA0A 1NNEA 5DMRA 5LJVA 1RTIA 4DV1K 4DV5K 3QIPA 2LSNA 2P9UB 1NOYA 3ENBA 1HLUA 4B8AB 4E7KA 4JKGA 4IEIA 4CJPA 4DFJA 4KB1A 1XUPO 4FZYA 5CZ2A 2KZMA 4CZJA 3D45A 3TAFA 2P9UA 3LP2A 1LCUA 1JLCA 4HUFA 1X9SA 3SNNA 3LDOA 3EE9A 2G8HA 4QS9A 4OKKA 3DLKA 2QWMA 3L4IA 4JKEA 3OYGA 1Q81O 1NGGA 3MN5A 3OY9A 1U4BA 2FSJA 4BRNA 1C1CA 3VGKA 2O8FB 1P90A 5BPMA 4JEPA 3G0ZA 3B8AX 3CPEA 3DLBA 3G10A 5BREA 3UKRA 1Y97A 4CHQA 1DKGD 2F8SA 2O8BA 1RT5A 1H1VA 4DV6K 5KI6A 4XH5A 2NRTA 4LD0A 3PV8A 1KC8O 3OYNA 4CFAA 1U48A 3VQPA 2W6LA 2VWKA 3AAPA 3OS1A 3TAQA 4WQ5C 5M1FA 1IBMK 2VWJA 4RWTA 4GW6A 2KFZA 4KREA 4B1VA 3QIOA 3P4IA 5F2RA 4H0TB 3C7NA 4KH6A 3WNEA 1NGEA 1BCOA 4CFCA 4JYAK 2ZD1A 1S72N 2FSNA 1NMNA 2IOCA 1NGBA 3H3NO 1OVYA 1LWEA 3KLHA 2I7PA 4TSXA 4E89A 4CIGA 3SYZA 3CCQN 4X64K 3MN9A 1FK9A 2Y1IA 3LWMA 3CI5A 1S1WA 4C8NA 4E1JA 1JCFA 2YKNA 2XY7A 4FWNA 1NGJA 4JAXA 1V4TA 3VEVA 2YNIA 1I94K 1KD1O 3SBGA 4CHYA 4CJLA 3U8XA 2D0OA 1KFSA 3OYKA 1HQEA 2OPRA 1NJIO 1WSIA 3DLEA 5I42A 3QO9A 1SAZA 2H3GX 4RW8A 1A5VA 3VEYA 4O8UA 4CF9A 3GL1A 4HWIA 4CHOA 4FLWA 3KTQA 1SS6A 3D0PA 4EZ6A 5AZJA 4KHYA 4K43A 1X3NA 2ZGZA 2CH5A 5KRSA 2RN2A 3TTCA 5D3GA 3AO2A 2AP1A 3NF9A 1WSGA 3ATVA 4DF4A 3R3LA 1EETA 4CZFA 4MQ3A 2IIRA 5CY4A 3ZX0A 3O3HA 2RKIA 3MXJA 4BR4A 1XNQK 2V7ZA 4Q0BA 3VN5A 2G8IA 4CJRA 1QHTA 3AGKA 1ASVA 2OYQA 3A5NC 4FPBA 1QQMA 4KO0A 5BR9A 1Q9XA 1BISA 4DF8A 3LM9A 3P1GA 1K8AO 3ULEB 3UKUB 2YJFA 1ZBUA 3QBXA 4BRCA 4O4GA 2WTUA 3QB0A 5LY3A 4CEFA 1VSHA 3K5LA 4FWOA 4BWJA 1TVRA 4NYNA 5BRFA 4BY9C 3CM6A 3MEGA 1TGOA 3ULEA 4ILJA 3I0RA 1N5YA 5AQIA 3CXCM 2V7YA 3AA4A 4FJXA 2A3ZA 2XRIA 2FLOA 4WFAL 3K0SA 3GBTA 3PSIA 4A59A 3CJ1A 1NGAA 4FWQA 4CJ3A 4DSIA 3Q7BA 1UOCA 4HTUA 4DSLA 4JI1K 3ZEUA 4WYBA 3AVBA 5LJWA 3VQAA 4EP4A 3HXMA 3DYAA 4KH4A 3FFKB 4LH4A 2E88A 4H4MA 1L3SA 5KPRA 3J80O 3AO5A 3C6AA 4CGJA 3I56N 4JRPA 3E9PA 5BN8A 4BDPA 3GDQA 3NGIA 2YHXA 3CJBA 1RBUA 4JKBA 3NF8A 2E2QA 2OA8A 3CMAN 3ENOA 1YT3A 4NB4A 2ZGYA 3T1HK 1IBKK 3SAGA 3JXUA 1RT6A 4H0XB 3C6HA 2FF6A 3EKUA 3ZETB 1IG9A 4CJ4A 3OS2A 1NKEA 1RBTA 2PAVA 3K2PA 4IOCL 2DFFA 3VGLA 4DQSA 4C1NK 3QERA 3KLEA 5M1OA 5HRRA 1S1UA 4MO4A 4IO9L 2QKBA 4DFMA 1JLGA 1QZ5A 4CJQA 4BR0A 1XC9A 4IZ9A 4IFYA 2HHQA 5E41A 3ISNC 2NRXA 1HYSA 4DLGA 2VCPA 4FLYA 1ITGA 2Q1NA 1ZBIA 2HMIA 3LPTA 4A2AA 1Z05A 2VQEK 3VOVA 4B9SA 1TUYA 2ETJA 2F9TA 4GNIA 3HVRA 1RT2A 4AHRA 3ZLJA 5C15A 5IT9O 4MDAA 3HPGA 4LSNA 4CEOA 3U3YA 2B5JA 1TYQB 3MX2A 2F4VK 3EO3A 4CZKA 4LFAK 3SCXA 1VSMA 3QETA 3DRSA 3SZ2A 3VQQA 5A2QO 4CHZA 1FXXA 4NCBA 4DG1A 1CZ9A 1TYQA 3VEWA 5KGWA 3FZFA 2O8EA 2OZSA 1D9FA 3C94A 4DUZK 4CJUA 4CJVA 5FRNA 4FL9A 4CVNE 4WQ5A 1JLQA 1IV0A 1VRTA 4B1WB 4O0IA 1SL2A 1IJJA 4IBNA 4NYFA 3VQBA 1S22A 1LWFA 2OPQA 3Q7CA 3VQ8A 2VGNA 3MCAB 2E6LA 2IVPA 1EX4A 1GLFO 4KHNA 4ZTFA 3TI0A 1VSKA 3ZSVA 4FWRA 2QXFA 3EL2A 5CE3A 3K58A 2HHXA 3L2UA 5F0XA 1S3XA 1RT3A 3SK3A 3WQTA 3U9DA 5BRDA 3ULDA 4OX9K 3VQ4A 3OYEA 4BRMA 2YHBA 3DWLA 3MWPA 2HNYA 3ZT1A 4QAGA 3SV4A 3RMAA 4ELUA 1NJZA 3I55N 4GKKK 1Q8IA 2WOMA 1ZBLA 1LWCA 3OW2M 4DQRA 3J7ZO 4CZGA 4B9NA 1G15A 4FJJA 4Q5VA 3K59A 5JVHL 3THYA 4FWPA 3RRGA 4E7LA 1NLVA 4M7XA 2CGLA 3KLGA 4FXDA 2HB5A 3H08A 1LAVA 1NGIA 2YHWA 1BI4A 3OBWA 5K14A 3V1RA 1NG9A 1TL3A 1Z6RA 2HVIA 4WFBL 3TR8A 4KTQA 3CM5A 1GLJO 1K8KB 3F9KA 1JKHA 4E19A 4IDHA 3AO4A 2A1RA 1HYVA 1BIUA 4WE1A 1KAYA 4FJIA 4A62A 3LDQA 1ASUA 1N6QA 1ZBFA 3I8BA 1W0HA 2NNWA 3EE8A 4RW4A 1GLLO 4QCLA 4CF1A 1Z26A 3L2WA 4I7FA 4ELVA 3V9WA 3SMPA 4CBXA 2IAJA 4DSJA 5JLHA 5DM6L 5HRPA 4R5PA 2D0BA 3BF3A 4QS8A 3DOLA 2BDPA 4E7HA 4CW7B 3J81O 3LALA 4DB3A 4BGAA 4J2EA 3CERA 1QVFM 5HROA 1QS4A 3OYBA 3PO5A 4B1XB 3FZKA 1CXQA 2OPSA 2Z1IA 2F8TA 3ZT3A 1TKTA 3SUPA 4DQQA 5FPEA 1QSSA 2QI2A 3P38A 3E1YA 5HRNA 2A5XA 1KLMA 1GLAG 4OGEA 1NK0A 4CJFA 4BR7A 2YX6A 4LFCK 1VSEA 2F96A 2E5LK 1I39A 3CPWM 3QFPA 2DTUA 3R8EA 3TWHA 3DXMB 2F9WA 3D2EB 4YOXA 4A5BA 1LAWA 3QEPA 5JVGL 4YORA 5KPTA 4B1YB 2ASPA 1C0TA 5DM7L 1N34K 5C24A 1GLBG 2Q97A 4I9LA 3TSUA 4CERA 3OYCA 4M3RA 2VQFK 3WXKA 2RHKA 3EKSA 1OH6A 4CGDA 5AZIB 4JRQA 1NGHA 4Z4IA 3BZCA 1VQ9N 1RCHA 2D0PA 2XO7A 4ISEA 1HPZA 3L3VA 2UUBK 1BO5O 3ZSRA 4FVMA 3LP0A 5EU7A 4DUYK 1QTMA 1N32K 1J54A 4MLEA 3KWIA 1U6ZA 5M1QA 1TK0A 3LZJA 2GUPA 2IC3A 3M8RA 2D5RA 4FJLA 2FBTA 2QWNA 3AO3A 2Q3SA 3HL8A 2Q0RA 3U9ZA 2GWJA 5GINA 2OTLN 3HI0A 4CCHA 3CCMN 1UAXA 2G8UA 3KK2A 4XIUA 3VQ9A 3D2FA 4FLTA 2QM1A 3O5BA 4FYDA 4KH5A 1WSJA 5ADXH 1OKJA 4K8ZA 1NK6A 3HO1A 3ID6A 4W5TA 4BRAA 2BUPA 1VK0A 2HHWA 1GLCG 2ATQA 3OYDA 4JI6K 3VETA 2FBYA 2QTDA 4M41A 3VEOA 3V1OA 3A2FA 3IAYA 4M3ZA 3HSCA 4FK4A 4O44A 3VENA 3V9SA 3ASMA 4BRPA 3LWLA 4LC9B 3PIOL 3HP6A 1WSHA 2P9IA 3O1WA 5AFUA 5KQ8A 4JS5A 4ID5A 4BREA 2VGMA 2ASOA 2V51B 2JWLA 1YTAA 3CFRA 1FKOA 1HJOA 3L2QA 5EY4A 4I2QA 2KW4A 3GG4A 1T8EA 2OZMA 1IO2A 4FVUA 3LL3A 3THWA 5JS1A 1GLDG 4OJRA 3J7AP 1U49A 3PUFA 1NKCA 4AQYK 2FC0A 1EQYA 3F9MA 3GE1A 4YNQA 5ELZA 2QWOA 4CGFA 3SV3A 1VQPN 1QZ6A 5AQPA 4DV3K 1HMVA 4B9LA 1T6CA 3JSMA 4LF5K 2VWBA 4A57A 3NVMA 5AQUA 4JI5K 3KKSA 4R79A 4Z4GA 3KK7A 1IH7A 2I5JA 4CEZA 1QSYA 2F7TA 1HKCA 4E1MA 3QNOA 4CHPA 4H03B 3WQUA 1I3AA 4CJ5A 5HBMA 1XHZA 2ITMA 4A61A 4FLUA 1O13A 2A41A 4ISGA 4B1ZA 2E8AA 4GMJB 2O8FA 1ESVA 2PYJA 3V81A 1VQ4N 2P9SB 4B9VA 2DY4A 5C2DA 4YOTA 5KQDA 4B3SK 3CC2N 3LP1A 2FBXA 4WF9L 3AVLA 3AA5X 3AO1A 1T6DA 4CEDA 4IOAL 4FZXC 4AHTA 1E4GT 3WEEB 3HSTB 2IGIA 3M8PA 1NK8A 4YOYA 2RPIA 1RDWX 4JKAA 3ZSYA 4CESA 3QMLA 4PWDA 2OCEA 5BPLA 2GX9A 3WEEA 1HNZK 4Z94A 2RF2A 1NK4A 1HJRA 4YOUA 4OPAA 3T1AA 1RT1A 5CZ1A 1SUQA 5M1NA 4BC5A 4M45A 3RSEB 3ZCMA 3IUCA 4DTPA 1JLFA 4E7JA 1KVBA 4AH9A 1LOTB 1NKBA 3J7YP 5AQXA 2HHVA 3MXMA 1RGIA 4DV0K 4B3OA 3RSEA 3VF6A 3CJAA 5I9EB 1B9FA 3H6EA 5FPMA 4DSKA 4MFBA 3E9LA 1JXEA 4J2AA 3DLHA 1K6YA 3AA2A 4J2BA 4FZZA 5FDLA 4RW9A 3NGZA 3NAEA 1T7PA 5AJ3K 3V9XA 4B3MK 5EOYA 4C23A 4M3XA 5JS2A 1WOQA 2HBKA 4GV9A 4KKOA 1XMQK 5BRHA 1TUUA 4IFVA 4GV3A 4LFBK 4IG0A 1B9DA 1CXUA 2E6MA 1VSDA 3BGRA 3SUNA 2YHAA 4PKIA 2W40A 4G9ZA 2EX3A 1J9AA 3K5MA 4PQUA 4J2DA 2KKZA 1RDBA 1SQKA 1VQNN 4BRIA 1VAZA 2Q31A 4CK1A 5AQHA 5AQSA 2X78A 2JLEA 3OHRA 3LDLA 4YDUC 4OVLA 3HPHA 1SKSA 3MECA 1SKRA 3QLHA 4BDYA 3BP8A 1BA1A 4FJGA 4GV6A 3IS9A 1QHAA 3RMDA 4N5SA 3WXLA 4IEEA 3UKUA 1S6PA 4PHTX 3RRHA 5JMVA 4U7BA 3KHYA 3ZSWA 5CYQA 4O55A 4JK8A 4X62K 4BRQA 2NRWA 2BE2A 3G4SN 3QICA 4ZHRA 4F3OA 2O4IA 1C6VA 3GOIA 3O9TA 2OANA 1WAFA 2BH1A 1NJYA 5F1XA 3AVGA 2YV0X 1J6ZA 1NBWA 1EWRA 1RDUA 1BCMA 3F5TA 1BIZA 3L0QA 3U6FA 3ITHA 4KFBA 3TSQA 3AY9A 4DKWA 2E2NA 5MLCQ 5T7BA 1RNHA 2Q0UA 3FR0A 4BRGA 4WCEL 1HUXA 4CECA 1RBSA 3OYLA 1KFDA 4BR2A 1E4FT 3HRGA 3UB5A 2GV9A 4FJ8A 2R7YA 2QXLA 4PY5A 5AQNA 2DFEA 3AVMA 3HM9A 4PA1A 3NH1A 5AQJA 3OYAA 3KJVA 1X9MA 3H3OB 4O5BA 1C0FA 1WBDA 3DRPA 1KAXA 3SI6A 1JL2A 3NFAA 2FF3B 4CEQA 3VF2A 3AVCA 3ZETA 1RTHA 1HPMA 1JCGA 2OPPA 4GVEA 1S9GA 4LF4K 3CQYA 2HBLA 4AM6A 3DRRA 1VQKN 4H5RA 1UWBA 4CZIA 5HP1A 3RR7A 1A5WA 3QEWA 1VQ5N 3HZ6A 3QBWA 1WUAA 2RE2A 5GAHP 1HQUA 4CJEA 4NCAA 3VQ7A 3C65A 2P9PB 4BG9A 4N41A 3V6DA 1SKWA 1YTUA 2WUSA 3VEXA 3MEEA 5DK5A 5BR8K 3TANA 1ILYA 3QEXA 5AR0A 1XC3A 4H5VA 1T05A 4H0PA 4CBWA 4L3QA 3HM8A 4BVOA 4JN4A 4CIEA 3KIOA 4BRDA 4L8RB 3OJUA 1IKVA 1UA0A 4CZLA 4MLHA 4CZMA 2KHOA 2NRZA 4BVPA 2P9LB 4ILHA 2E1ZA 4CK3A 4JKHA 5GADP 3D7EO 4JI3K 2A40A 3JYTA 2HHTA 3IKMA 3RVCA 2O8DB 3CCRN 4DTUA 2NRRA 1VHXA 1O1WA 5BN9A 3NH0A 3EZ5A 5J2NA 1X9WA 1VSLA 2ZE2A 4E1NA 3SQ0A 3O9RA 2QK9A 1OH8A 4Z0UA 2O8DA 1Q86O 2W41A 1RILA 4ELTA 1LV5A 4DU1A 1JLEA 4V19S 4KV8A 4K42A 1YJWN 3CQXA 4QOZB 4JI4K 3TABA 2UYTA 1W97L 4IJAA 4FM0A 4RTFD 4HVJA 1KRPA 5FRMA 4BQZA 1RDDA 3OJSA 3CFOA 4FLZA 4AM7A 4JI2K 1TK5A 4IFEA 2J4RA 4DTXA 1HRHA 5HL7L 1U47A 1EO1A 3SPYA 1WAJA 2D1KA 4BC3A 3PSFA 5I3UA 3T1YK 4FK2A 5IWAK 4FM2A 3SAFA 2UXDK 5LL6Z 4C8MA 1EKEA 3WNGA 4NXNK 1L5UA 4O5FA 3VEZA 1U2VB 2YHYA 1BG3A 4WQ4C 4WFNL 3BEXA 5E26A 4KBOA 3W3DA 2BGGA 1YUWA 4DR2K 5LMUK 3VA3A 3OYMA 2GWKA 5AQRA 1EXQA 4BR9A 2IVOA 2QWPA 4CEBA 1L3TA 4E0DA 4M3WA 3THXB 1P8ZA 3VPZA 2G8FA 1T3VA 4BGBA 2YKMA 2G8WA 3F73A 1TKZA 3O1BA 1K8KA 4EHUA 3E01A 4J8FA 3N4QA 1NJXA 2GUIA 3THXA 3KD5E 3PY8A 4YDUA 3NH2A 1MWKA 2Z1GA 4DTOA 1GOCA 3K5NA 3M8QA 3HP9A 3VGMA 2HVHA 2OTJN 1XHXA 4IOXA 1JLBA 5SZTA 1G99A
chains in the Genus database with same CATH topology
3M5RA 5AZJA 3BF1A 4GY2B 4K43A 1X3NA 2ZGZA 1QQNA 2QWLA 2CH5A 3HBTA 3E66A 2FSKA 3F2KA 3TTCA 1EQYA 3F9MA 3GE1A 2AP1A 5ELZA 3G25A 2QWOA 1YVNA 1VQPN 2HSTA 3ATVA 3R3LA 1QZ6A 4BRLA 4CZFA 5AQPA 2P9LA 3TPQA 2IIRA 1T6CA 3ZX0A 4BRFA 4FPAA 3C0BA 2NLXA 2VWBA 4A57A 3ENHA 4BR4A 3NVMA 2V7ZA 5AQUA 5EX5A 3QFUA 4R79A 3AGKA 1ZBSA 3A5NC 3TU5A 3KK7A 4FPBA 1QQMA 5EVZA 5BR9A 2F7TA 3CJ9A 3CCLN 3LM9A 1HKCA 1K8AO 3ULEB 3EN9A 3UKUB 2YJFA 4H03B 3SBTA 2HBMA 3QBXA 1KAZA 3WQUA 3HTVA 4BRCA 3DXMA 5TKWA 4ILGB 3D2EA 3PLAA 3QB0A 5LY3A 2ITMA 1D4XA 4FWOA 4A61A 1DEJA 1O13A 3A8YA 4CD3A 2A41A 5BRFA 4BY9C 4ISGA 2A6AA 4B1ZA 3ULEA 2E8AA 4ILJA 1NGDA 1NGCA 1ESVA 5AQIA 3CXCM 2V7YA 1VQ4N 2P9SB 5CHIA 2E2PA 3TSPA 3WT0A 1NM1A 2A3ZA 3CJCA 2FLOA 4YOTA 5C2DA 4WFAL 3GBTA 5KQDA 5AZIA 3CJ1A 4A59A 1NGAA 3KVGA 4FWQA 4EFHA 5M1KA 3CC2N 3Q7BA 4WF9L 3R1XA 2ZF5O 4BQLA 4UY8O 4M63C 3ZEUA 3M1FA 2NZTA 4WYBA 5LJWA 1T6DA 2GELA 1SZ2A 2EWSA 4IOAL 1YJ9N 5E84A 4JK7A 1ZC6A 5AQYA 4JHDB 4BRKA 1E4GT 3WEEB 3TTFA 4YOYA 4KH4A 3FFKB 3L4QA 4H5TA 1RDWX 4JKAA 3O9SA 2E88A 3LDPA 5KPRA 3QMLA 3C6AA 2GX9A 5BPLA 3WEEA 3I56N 4Z94A 2NRHA 2YCHA 4YOUA 4OPAA 3CCJN 4H0OA 3E9PA 5BN8A 3MX5A 1M90O 2QWRA 2IVNA 3GDQA 5H1SQ 2YHXA 2HF3A 2P9KB 3CJBA 2BTFA 4BC5A 5M1NA 3RSEB 4JKBA 3AARA 2QW9A 3IUCA 2E2QA 3CC4N 1BUPA 3LDNA 3OBYA 3T7ZA 3CMAN 3ENOA 5BPNA 5AQKA 2GTDA 1LOTB 2V52B 4IWVA 4NB4A 2AA4A 1U2VA 2ZGYA 3P31A 5AQXA 4DCHA 1K9MO 3SAGA 3JXUA 1RGIA 2JWKA 3NVKA 2P9KA 4H0XB 3C6HA 2FF6A 2I7NA 3EKUA 3RSEA 3VF6A 3ZETB 3CJAA 1DT9A 1K73O 1RFQA 5I9EB 3H6EA 2PAVA 4IO8A 5CR4A 5FPMA 4IOCL 1Q7YO 3M3ZA 3E9LA 3VGLA 4C1NK 1VQ8N 3CIPA 2P9NB 4FWMA 4JNEA 5M1OA 3VERA 5C0YA 4A2BA 3O80A 3W0LA 4MO4A 4IO9L 2E20A 1MA9B 4EAHD 1QZ5A 4O8KA 4BR0A 4BRHA 4H5NA 4IZ9A 5EOYA 2WC9A 4RCHA 4C23A 1WOQA 2NRXA 3SJHA 2HBKA 2VCPA 3OA9A 4GV9A 3MK6A 3UE5A 1X9JA 5AQQA 5BRHA 2Q1NA 1TUUA 3WXIA 4A2AA 4GV3A 4H0YB 1MDUB 4OO1J 1Z05A 2NRVA 3VOVA 1TUYA 1ATSA 3EZWA 4FWLA 2F9TA 4GNIA 4PKIA 5C10A 2W40A 3R6MA 5C15A 4G9ZA 4MDAA 4BR5A 3FLCO 2E1YA 3IDHA 1DGKN 1SQKA 1ATNA 2HMPA 2KKZA 1VQNN 4BRIA 3WXMB 1TYQB 1VAZA 3MX2A 1HKGA 2Q31A 3VTIA 1N8RO 3HOTA 4CBUA 2ZJRL 3EO3A 4PL8A 4CZKA 4FWSA 2CH6A 4H5WA 5AQHA 5AQSA 3M6GA 3OHRA 5GAEP 3LDLA 4JKGB 5ADXA 1TYQA 3VEWA 4YDUC 3FZFA 4YOWA 2ZJQL 3P39A 3O08A 3FGUA 3BUZB 1ATRA 5HOOA 3DLLL 3BP8A 3N4PA 2KLAA 1BA1A 3D6RA 4EHTA 4FL9A 4GV6A 2HF4A 4NO7A 1YITN 3IMXA 3K9KA 4WQ5A 1QHAA 4PKGA 5AQVA 4K25A 2CGKA 1QQOA 3WXLA 4IEEA 4B1WB 3CC7N 1IJJA 4NLCA 3UKUA 4PKHA 1S22A 5AFUH 4PHTX 2GEMA 5JMVA 5EXWA 4U7BA 2YJEA 3KHYA 3UKRB 3JS6A 4JK8A 4DHYA 4BRQA 5GAGP 2NRWA 1Q82O 3G4SN 3Q7CA 3QICA 3H1QA 2VGNA 1YI2N 3MCAB 4CJ7A 1W2BM 2VYPA 2IVPA 1GLFO 5AQLA 2YI1A 3GOIA 4ISFA 5AQGA 2P9SA 2OANA 3FZHA 3O9TA 2HBJA 3QDKA 3DJCA 3MMVA 1Y64A 3EL2A 4FWRA 4IXCA 1NWKA 5CE3A 5F0XA 2BH1A 4WQ4A 1S3XA 1JJ2M 3SK3A 5F1XA 3HOSA 3WQTA 2QEXN 3U9DA 5BRDA 3CETA 1J6ZA 3H1VX 4JKFA 1NBWA 3S41A 4B1UB 1RDUA 3F5TA 3H45C 1XQSC 2ASMA 1R59O 3H46O 3MN6A 2WFBA 4JHDA 4BRMA 5AQTA 3L0QA 3O9UA 1VQON 3NMUA 4FWKA 3VESA 1MWMA 3ID8A 3DWLA 3AAQA 3MN7A 5GIPA 1ZXOA 3MWPA 3D2FB 3TSQA 3AY9A 4DKWA 3T69A 2E2NA 1QVGM 3C7NB 4FSVA 4AF1A 5MLCQ 1VQMN 4NLBA 2Q0UA 3FR0A 4BRGA 3I55N 4WCEL 1HUXA 3DXKB 3L6QA 3J8AA 4BC2A 4BR2A 3SMSA 4HWIA 3OW2M 1T44A 2CGJA 4M7YA 1E4FT 3HRGA 3UB5A 1M1KO 1X3MA 3J7ZO 4CZGA 3CCSN 2QXLA 1JCEA 3AGRA 5AQNA 3DXKA 1NMDA 3IFRA 1YXQA 5JVHL 5AQJA 4H0VB 1VQ7N 5FPDA 4FWPA 3PIPL 3H3OB 3A5LC 1NLVA 1C0FA 1KAXA 4M7XA 4CI6A 2CGLA 5AQMA 2FF3B 3VF2A 5JLFA 3ZETA 1KQSM 1HPMA 1JCGA 1NGIA 2YHWA 4GVEA 2PBDA 4FO0A 4IJNA 4XEIA 3OBWA 3CQYA 2HBLA 2ZWHA 1Z6RA 5JICA 2P9IB 4AM6A 4WFBL 2E2OA 1GLJO 1K8KB 1YIJN 1VQKN 1HX1A 4H5RA 2P9NA 4IDHA 1VQLN 4CZIA 2QWQA 1VQ5N 3HZ6A 3K9JA 3QBWA 1C0GA 1WUAA 4XH4A 1KAYA 2RE2A 5GAHP 4U67L 3O4WA 4A62A 3LM2A 3LDQA 2ZJPL 3CD6N 3C65A 2P9PB 3SLCA 3I8BA 3WXJA 2NNWA 3EE8A 4YOVA 4BG9A 1GLLO 3U4LA 3CMEN 2WUSA 3VEXA 4DQ8A 3SMPA 4CBXA 5JLHA 1ILYA 4XH1A 5AR0A 5DM6L 5AZJB 1XC3A 2WBNA 3FZLA 4H5VA 3BF3A 3KZBA 4QS8A 4H0PA 3CF5L 4CBWA 2HOEA 1KXPA 1VQ6N 4L3QA 3HM8A 4BVOA 4BC4A 2Q36A 4JN4A 3FE1A 3TTDA 4DB3A 3CCEN 4BGAA 4CD1A 3MWTA 3DAWA 4BRDA 3CERA 5AQOA 1QVFM 4CZLA 4MLHA 4CZMA 3VMFB 2KHOA 2NRZA 5TKYA 4BVPA 4B1XB 1BA0A 2P9LB 4ILHA 4B9QA 3G6EN 5LJVA 3FZKA 1IG8A 1BDGA 1YF5L 5B8HA 3CHWA 2E1ZA 4JKHA 5GADP 2P9UB 3D7EO 2A40A 3ENBA 2Q2RA 5FPEA 2QI2A 3P38A 3E1YA 1HLUA 3O9QA 1BU6O 2A5XA 1GLAG 3IKMA 4I6MB 4JKGA 5M1PA 3ATUA 3RVCA 2NRRA 4IEIA 5BN9A 3CCRN 4BR7A 2YX6A 2DPNA 1XUPO 3CCVN 3O6WA 4CZJA 3CPWM 2P9UA 3QFPA 3CCUN 3R8EA 3O9RA 1LCUA 3ZYYX 3DXMB 4HTLA 2F9WA 3D2EB 3EE9A 3LDOA 4A5BA 4YOXA 4QS9A 4I6MA 1Q86O 2QA4N 2W41A 2QWMA 3L4IA 4FOIA 4JKEA 5JVGL 1Q81O 1NGGA 4YORA 3MN5A 5KPTA 5AQWA 2FSJA 4EIAA 4BRNA 4B1YB 3VGKA 3FZMA 2ASPA 4K42A 1YJWN 5DM7L 1GLBG 1P90A 2Q97A 4JEPA 5BPMA 1YAGA 3B8AX 3CPEA 3CQXA 4QS7A 3TSUA 2A42A 5BREA 3UKRA 3WXKA 2RHKA 3EKSA 4BROA 5AZIB 1DKGD 2UYTA 1NGHA 1H1VA 1W97L 3VF4A 1VQ9N 2D0PA 3ZEUB 4XH5A 4IJAA 4ISEA 4MDBA 4RTFD 2NRTA 2D4WA 1BO5O 5C2FA 3E9OA 4A5AA 4FOEA 1KC8O 4BQZA 4FVUA 4MLEA 3KWIA 1U6ZA 5M1QA 4AM7A 4IFEA 2J4RA 3AAPA 3VTHA 2GUPA 4WQ5C 5M1FA 4F9OA 5HL7L 1EO1A 4CZHA 4RWTA 4Y0WA 4K41A 2QWNA 3U9ZA 2Q0RA 2D1KA 4BC3A 2GWJA 1BWFO 5C12A 5KPZA 5GINA 2OTLN 3HI0A 4JK9A 4B1VA 3CCMN 1BOTO 3SAFA 3P4IA 3D2FA 4H0TB 5F2RA 5FPNA 2QM1A 3O5BA 4KH5A 5ADXH 3C7NA 4KH6A 3ZX2A 1OKJA 1NGEA 4CZEA 1S72N 4O5FA 2FSNA 3H3NO 1NGBA 3ID6A 3VEZA 1OVYA 1U2VB 2YHYA 4BG8A 2I7PA 4BRAA 2BUPA 4OPHA 1BG3A 1GLCG 3CCQN 4WQ4C 1YHQN 4WFNL 3BEXA 3MN9A 3VETA 5E26A 4PL7A 3CI5A 4KBOA 2QTDA 3W3DA 3VEOA 4E1JA 1YUWA 1JCFA 3HSCA 4MO5A 4FWNA 3VENA 2FXUA 2GWKA 3MCPA 3O8MA 5AQRA 4BRPA 3CJ7A 1NGJA 4LC9B 2IVOA 2QWPA 1V4TA 4JAXA 4BR9A 5GIOA 3ZX3A 3PIOL 3R9PA 1HKBA 3SAHA 3VEVA 1V4SA 3A5OC 1P8ZA 3VPZA 3MDQA 1T3VA 4BGBA 1KD1O 3KWGA 2P9IA 3O1WA 3G71N 3SBGA 3O1BA 5AFUA 1Q18A 5KQ8A 3A0IX 1K8KA 1CZAN 3I33A 4BREA 1NGFA 4EHUA 2VGMA 4J8FA 3N4QA 3U8XA 4C1NI 4JKCA 2D0OA 2ASOA 2PFUA 2V51B 1GLDG 4JD2B 2JWLA 4JKDA 4YDUA 5AQFA 1MWKA 1HJOA 5AQZA 1NJIO 2P9PA 5EY4A 1SAZA 3WUHA 3GG4A 3A5MC 2H3GX 1GLEG 3VGMA 1YJNN 4JD2A 3VEYA 4IOXA 4O8UA 2OTJN 3GL1A 1G99A 3LL3A 1SS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q7B A;  3MWP A;  4GV6 A;  4G9Z A;  4GVE A;  3R3L A;  4GV3 A;  4FVU A;  4GV9 A;  3MX2 A;  3Q7C A;  3MWT A;  3MX5 A; 
#chains in the Genus database with same CATH topology
 1BQN A;  3M5R A;  3NF6 A;  4BWM A;  2IDO A;  3BF1 A;  2QWL A;  3HBT A;  3E66 A;  4KPY A;  3G25 A;  4N47 A;  3TAM A;  3LZI A;  4N56 A;  4HCB A;  1TV6 A;  4BRL A;  3TPQ A;  2O8C B;  4FJK A;  4BRF A;  4BDZ A;  2XY5 A;  2NLX A;  4LF9 K;  3QFU A;  4YY3 K;  1ZBS A;  3TU5 A;  5EVZ A;  4B9U A;  3CG7 A;  3CCL N;  3EN9 A;  5KTQ A;  4FM1 A;  2HBM A;  1KAZ A;  1XNR K;  3HTV A;  3DXM A;  4CF0 A;  5TKW A;  3D2E A;  1KSP A;  4FJ7 A;  4F8R A;  3AA3 A;  2Y1J A;  4F2R A;  2A6A A;  1OH7 A;  3HT3 A;  3V4I A;  2G8V A;  3KKR A;  3QEI A;  5CHI A;  2E2P A;  3TSP A;  3WT0 A;  3VQ5 A;  1NM1 A;  1L3U A;  3TAP A;  3SJJ A;  3HPO A;  1J5E K;  4H4O A;  5AZI A;  3KVG A;  4BQL A;  4ID1 A;  4UY8 O;  3AVF A;  4H8K A;  3M1F A;  3LDS A;  1SZ2 A;  4X65 K;  5E84 A;  4JK7 A;  5AQY A;  3UIQ A;  4JHD B;  4BRK A;  2B6A A;  1TL1 A;  3L4Q A;  3C6U A;  4KHP K;  1KCF A;  3V9Z A;  1IKY A;  3TAR A;  2YCH A;  1DTT A;  3CCJ N;  4H0O A;  4C8K A;  1VSF A;  3MX5 A;  2QWR A;  2IVN A;  2WON A;  5H1S Q;  1VSJ A;  1Q9Y A;  2YNG A;  3AAR A;  1BUP A;  3LDN A;  3OBY A;  3T7Z A;  3OS0 A;  1S1T A;  5BPN A;  5AQK A;  2GTD A;  4CGI A;  2AA4 A;  2XY8 A;  1FW6 A;  4ZTJ A;  4M3U A;  4OGC A;  1DT9 A;  1K73 O;  1HYZ A;  3RWU A;  4JV5 K;  2KFN A;  1VQ8 N;  3JAM O;  3CIP A;  3THV A;  3SQ4 A;  2P9N B;  4JNE A;  4RW6 A;  3VER A;  3B6O A;  5C0Y A;  4FJM A;  4A2B A;  3O80 A;  1KVA A;  3W0L A;  4CGH A;  3NCI A;  3VQ6 A;  4BRH A;  4H5N A;  2KQ2 A;  2WC9 A;  4RCH A;  3KLF A;  3OA9 A;  4Y1C A;  3MK6 A;  3UE5 A;  2GBZ A;  4DFP A;  2ITG A;  1HNW K;  1QQC A;  2HW3 A;  4DWI A;  2NRV A;  1BQM A;  3RTV A;  1ATS A;  3EZW A;  3AVJ A;  1N33 K;  2PY5 A;  3O4N A;  1NU0 A;  2E1Y A;  4DR6 K;  1ATN A;  3KLI A;  1J5O A;  4FW2 A;  3WXM B;  5SWM A;  3VTI A;  4RG8 A;  2ZJR L;  4CBU A;  2CH6 A;  4H5W A;  1HNV A;  4CIF A;  3M6G A;  3AV9 A;  4JKG B;  5ADX A;  3DLR A;  1IKW A;  1WLJ A;  4YOW A;  2ZJQ L;  3P39 A;  3FGU A;  3BUZ B;  1ATR A;  3DLL L;  4DQP A;  2KLA A;  1RTJ A;  4NO7 A;  3IMX A;  3K9K A;  4PKG A;  5AQV A;  1HNI A;  3LPU A;  1D9D A;  3S3N A;  1BHL A;  3UKR B;  3JS6 A;  5GAG P;  2O8B B;  3NE6 A;  3H1Q A;  4B8C A;  1YI2 N;  4CJ7 A;  4FJN A;  5AQL A;  4ISF A;  4BAC A;  5AQG A;  2P9S A;  3K57 A;  2HBJ A;  1NWK A;  4WQ4 A;  4DTM A;  2HHS A;  3HOS A;  2QEX N;  3KK1 A;  2PYL A;  3H1V X;  4JKF A;  5J2M A;  3S41 A;  2EHG A;  3H45 C;  1XQS C;  2ASM A;  4B3T K;  4M42 A;  3ALY A;  3MN6 A;  5AQT A;  1SL1 A;  3NMU A;  3AAQ A;  4CK2 A;  3MN7 A;  4JS4 A;  1QVG M;  3C7N B;  4FCY A;  1XI1 A;  4EZ9 A;  4X66 K;  3L6Q A;  3DXK B;  3AVK A;  3J8A A;  1RDC A;  2O4G A;  3SMS A;  4LSL A;  1T44 A;  2CGJ A;  4M7Y A;  2D0C A;  1M1K O;  3QIN A;  4E3S A;  3AGR A;  2B4J A;  3PO4 A;  4RW7 A;  2P51 A;  1NMD A;  3DXK A;  3IFR A;  1YXQ A;  4H0V B;  5FPD A;  1OVQ A;  3OYH A;  1WN7 A;  4FW1 A;  1S9E A;  1KQS M;  4FO0 A;  3QNN A;  2D0A A;  1IKX A;  2ZWH A;  5HLF A;  2E2O A;  3L2R A;  4UQG A;  1YIJ N;  3P83 D;  3DLG A;  3ZSO A;  3NHG A;  3TAG A;  3PX0 A;  3L3U A;  3K9J A;  1C0G A;  4XH4 A;  4BE0 A;  1JXB A;  3MED A;  4U67 L;  3O4W A;  3CD6 N;  3LM2 A;  4B9M A;  3I8D A;  3SLC A;  3WXJ A;  4NXM K;  2PZS A;  3I0S A;  3CME N;  3OYF A;  3RMC A;  3P5J A;  2UXB K;  4B9T A;  5C42 A;  1S1X A;  4KHW A;  5AZJ B;  1LW0 A;  2YNH A;  3KZB A;  1D8Y A;  4M3Y A;  4BC4 A;  2Q36 A;  3FE1 A;  5LMN K;  3DAW A;  4DTR A;  1SL0 A;  1C1B A;  3KK3 A;  4K0K K;  3G6E N;  4B9Q A;  1IG8 A;  1BDG A;  1YF5 L;  5B8H A;  3CHW A;  1GOA A;  3SQ1 A;  2P5G A;  2Q2R A;  3KD1 E;  4G1Q A;  1WBB A;  4FK0 A;  2JGU A;  4K8X A;  3O9Q A;  1BU6 O;  2VG5 A;  4I6M B;  5M1P A;  3ATU A;  3S3O A;  1RTD A;  2DPN A;  2FBV A;  3CCV N;  3O6W A;  4AHV A;  2E4L A;  3CCU N;  1W9H A;  3ZYY X;  4YHH K;  4HTL A;  4BE2 A;  4E7I A;  1ASW A;  4I6M A;  2QA4 N;  4M3T A;  3RMB A;  4FOI A;  2G8K A;  5AQW A;  4EIA A;  2P1J A;  3V9U A;  3FZM A;  2HNZ A;  2YNF A;  4DTS A;  3LAK A;  1YAG A;  4QS7 A;  1QSL A;  2A42 A;  4OPK A;  4BRO A;  1S5J A;  3RR8 A;  4FJ5 A;  4OKJ A;  4W5Q A;  1DTQ A;  4N76 A;  3VF4 A;  3ZSX A;  4B08 A;  3MXI A;  3ZEU B;  4MDB A;  4I2P A;  2D4W A;  5C2F A;  3E9O A;  4A5A A;  4FOE A;  2QKK A;  3QEV A;  3B6P A;  5FLX O;  1T03 A;  1TAU A;  3VTH A;  1TKD A;  4OPJ A;  4F9O A;  4CZH A;  4Y0W A;  3U3G A;  4DR1 K;  4K41 A;  4W5N A;  1BWF O;  5C12 A;  5KPZ A;  1GOB A;  4JK9 A;  3VQD A;  1BOT O;  4CGG A;  4LY7 A;  2XY6 A;  5FPN A;  3PX4 A;  3ZX2 A;  4F4K A;  4CZE A;  4ICL A;  4JI7 K;  1OH5 A;  3IRX A;  5J2Q A;  4BG8 A;  4HHT A;  4OPH A;  3M8S A;  4DV2 K;  1YHQ N;  4KI4 A;  4KI6 A;  4PL7 A;  4MO5 A;  5HRS A;  1L3V A;  4DTN A;  2FXU A;  3MCP A;  1DLO A;  3O8M A;  4CHN A;  3CJ7 A;  5GIO A;  3ZX3 A;  3R9P A;  1HKB A;  3SAH A;  2NUB A;  1V4S A;  1SV5 A;  3ZT2 A;  3A5O C;  1IBL K;  3MDQ A;  4NCG A;  3CQ8 A;  3DM2 A;  2UXC K;  3KWG A;  3G71 N;  4AHS A;  1Q18 A;  5FRO A;  3A0I X;  1CZA N;  3C95 A;  3I33 A;  1NGF A;  5KRT A;  3CYM A;  3L2V A;  1C1A A;  4C1N I;  5J2P A;  4JKC A;  2PFU A;  4JD2 B;  5AQF A;  4JKD A;  1RT7 A;  3S3M A;  5AQZ A;  3LAM A;  2P9P A;  4Z4H A;  3SPZ A;  3WUH A;  3A5M C;  4DR7 K;  1NJW A;  1FJG K;  1VSI A;  1GLE G;  1YJN N;  4JD2 A;  3AVA A;  1UA1 A;  4GY2 B;  3VA0 A;  1QQN A;  1U45 A;  2FSK A;  3F2K A;  1WB9 A;  3HYF A;  1QE1 A;  1YVN A;  2HST A;  2VG7 A;  4Z4E A;  1KLN A;  3SUQ A;  4W5O A;  1RDA A;  2P9L A;  2O8E B;  2W42 A;  4FPA A;  3C0B A;  3ENH A;  3TAE A;  5EX5 A;  1RBR A;  1BGX T;  4KAZ A;  1CZB A;  1A5X A;  2IS3 A;  3CJ9 A;  4FJ9 A;  4DR5 K;  1W7A A;  4FJH A;  3SBT A;  3ZSQ A;  3DOK A;  1U04 A;  3T19 A;  4ILG B;  3VQC A;  3PLA A;  4JI8 K;  4I9Q A;  3HK2 A;  1D4X A;  4KTW A;  1DEJ A;  2ZQB A;  4AHU A;  3A8Y A;  1RBV A;  3CFP A;  4CD3 A;  4AIL C;  2VG6 A;  1NGD A;  1NGC A;  4C8O A;  3CJC A;  4EFH A;  1F21 A;  5M1K A;  3K5O A;  3R1X A;  2ZF5 O;  3V1Q A;  4M63 C;  2NZT A;  2GEL A;  3EY1 A;  2EWS A;  1YJ9 N;  3WNF A;  3DMJ A;  1ZC6 A;  3TTF A;  2HND A;  1JLA A;  4DU4 A;  4IG3 A;  4H5T A;  4CFB A;  1Z25 A;  4KRF A;  3O9S A;  3MAQ A;  2DFH A;  3LDP A;  1TAQ A;  2X6S A;  3ZSZ A;  4DS4 A;  1EWQ A;  4KHS A;  3DI6 A;  4B3R K;  2ZM6 K;  2KZZ A;  1S6Q A;  2NRH A;  4KB0 A;  3T3F A;  1M90 O;  4YFU A;  4DU3 A;  4F3T A;  2HF3 A;  2P9K B;  3CC4 N;  2BTF A;  4PUO A;  2QW9 A;  4CE9 A;  3THY B;  2V52 B;  4IWV A;  1U2V A;  4C8L A;  3P31 A;  4KHU A;  4DCH A;  4HUG A;  1K9M O;  4Z4F A;  2JWK A;  2KTQ A;  3NVK A;  2P9K A;  1LW2 A;  2UU9 K;  2I7N A;  2A1S A;  1BI4 B;  1RFQ A;  5C25 A;  4IO8 A;  5CR4 A;  1Q7Y O;  4EP5 A;  3M3Z A;  3OYI A;  4FWM A;  1MU2 A;  2E20 A;  1MA9 B;  4EAH D;  4O8K A;  3LAN A;  1YVU A;  1JL1 A;  3AVN A;  1E3M A;  3SJH A;  4OLB A;  4CF2 A;  1X9J A;  5AQQ A;  2BAN A;  3WXI A;  3NF7 A;  1MDU B;  4H0Y B;  4OO1 J;  4LF6 K;  1KTQ A;  3C6T A;  4FWL A;  4DR4 K;  1C0U A;  3SQ2 A;  5C10 A;  1TKX A;  3R6M A;  4BR5 A;  3FLC O;  3IDH A;  1DGK N;  2HMP A;  4LF7 K;  4O0J A;  1VRU A;  1HKG A;  1WSF A;  1N8R O;  1WSE A;  1XWL A;  5J1E A;  3HOT A;  3NBP A;  4IDK A;  3AVH A;  4PL8 A;  1EP4 A;  4FWS A;  3OTO K;  1NK7 A;  1ZBH A;  1J53 A;  2XHB A;  4BE1 A;  5GAE P;  3O08 A;  2O8C A;  1C0M A;  4CEE A;  5HOO A;  2UUC K;  4HUE A;  3PX6 A;  2X6N A;  3N4P A;  3LP3 A;  1ZYQ A;  2Z1J A;  3D6R A;  4EHT A;  2HF4 A;  1YIT N;  4Z4C A;  4F2S A;  3L8B A;  4K25 A;  2CGK A;  1QQO A;  4DFK A;  3CC7 N;  4NLC A;  4W5R A;  3OYJ A;  4PKH A;  5AFU H;  4DMN A;  2GEM A;  5EXW A;  2YJE A;  1FKP A;  4OLA A;  4CJT A;  4JI0 K;  4DHY A;  1Q82 O;  4FLX A;  3BY5 A;  1W2B M;  2VYP A;  3ZT0 A;  2YI1 A;  4AHC A;  4DV4 K;  3FZH A;  4IXC A;  3QDK A;  3DJC A;  3MMV A;  1Y64 A;  4DS5 A;  3QES A;  1NOZ A;  4KTZ A;  1JJ2 M;  4Y1D A;  1XMO K;  3CET A;  1S1V A;  4DQI A;  4B1U B;  4KHQ A;  1R59 O;  3H46 O;  4JHD A;  2WFB A;  4DSF A;  1VQO N;  4GVM A;  3O9U A;  3O4Q A;  4FWK A;  3VES A;  1MWM A;  3ID8 A;  4IKF A;  5GIP A;  1ZXO A;  3D2F B;  3T69 A;  3NDK A;  3HJF A;  1R0A A;  4FSV A;  4AF1 A;  1VQM N;  4NLB A;  2X74 A;  4CJW A;  1NK5 A;  3AVI A;  4HCC A;  4BC2 A;  4CJS A;  4CFD A;  2W6K A;  1X3M A;  3FFI A;  3HVT A;  3CCS N;  1HR0 K;  1JCE A;  4DLE A;  3EEQ A;  1VQ7 N;  3NGY A;  4DR3 K;  3BZK A;  3PIP L;  3A5L C;  3ZT4 A;  1CLQ A;  4CI6 A;  5AQM A;  4DSE A;  5JLF A;  4CF8 A;  5KGX A;  4IJN A;  4XEI A;  2PBD A;  1TK8 A;  2P5O A;  1B92 A;  5JIC A;  2P9I B;  1X1P A;  2AJQ A;  4DV7 K;  1RT4 A;  3S9H A;  1HX1 A;  1VQL N;  2P9N A;  3O3F A;  2QWQ A;  5CYM A;  4OKE A;  2ZJP L;  1D5A A;  1N36 K;  3SUO A;  4YOV A;  1REV A;  3U4L A;  4DTJ A;  3BDP A;  4LH5 A;  1BL3 A;  3VQE A;  2HHH K;  4CEA A;  4DQ8 A;  4CJK A;  4LF8 K;  4JLH A;  3THW B;  4XH1 A;  3WNH A;  2WBN A;  3OVN A;  3FZL A;  1WNS A;  1KVC A;  2UUA K;  3CF5 L;  2HOE A;  1KXP A;  3O3G A;  3EYZ A;  1VQ6 N;  4GKJ K;  3IG1 A;  3TTD A;  3CCE N;  4CD1 A;  3MWT A;  1HNX K;  1NK9 A;  5AQO A;  2Z1H A;  3VMF B;  5TKY A;  2HHU A;  4FLV A;  1BA0 A;  1NNE A;  5DMR A;  5LJV A;  1RTI A;  4DV1 K;  4DV5 K;  3QIP A;  2LSN A;  2P9U B;  1NOY A;  3ENB A;  1HLU A;  4B8A B;  4E7K A;  4JKG A;  4IEI A;  4CJP A;  4DFJ A;  4KB1 A;  1XUP O;  4FZY A;  5CZ2 A;  2KZM A;  4CZJ A;  3D45 A;  3TAF A;  2P9U A;  3LP2 A;  1LCU A;  1JLC A;  4HUF A;  1X9S A;  3SNN A;  3LDO A;  3EE9 A;  2G8H A;  4QS9 A;  4OKK A;  3DLK A;  2QWM A;  3L4I A;  4JKE A;  3OYG A;  1Q81 O;  1NGG A;  3MN5 A;  3OY9 A;  1U4B A;  2FSJ A;  4BRN A;  1C1C A;  3VGK A;  2O8F B;  1P90 A;  5BPM A;  4JEP A;  3G0Z A;  3B8A X;  3CPE A;  3DLB A;  3G10 A;  5BRE A;  3UKR A;  1Y97 A;  4CHQ A;  1DKG D;  2F8S A;  2O8B A;  1RT5 A;  1H1V A;  4DV6 K;  5KI6 A;  4XH5 A;  2NRT A;  4LD0 A;  3PV8 A;  1KC8 O;  3OYN A;  4CFA A;  1U48 A;  3VQP A;  2W6L A;  2VWK A;  3AAP A;  3OS1 A;  3TAQ A;  4WQ5 C;  5M1F A;  1IBM K;  2VWJ A;  4RWT A;  4GW6 A;  2KFZ A;  4KRE A;  4B1V A;  3QIO A;  3P4I A;  5F2R A;  4H0T B;  3C7N A;  4KH6 A;  3WNE A;  1NGE A;  1BCO A;  4CFC A;  4JYA K;  2ZD1 A;  1S72 N;  2FSN A;  1NMN A;  2IOC A;  1NGB A;  3H3N O;  1OVY A;  1LWE A;  3KLH A;  2I7P A;  4TSX A;  4E89 A;  4CIG A;  3SYZ A;  3CCQ N;  4X64 K;  3MN9 A;  1FK9 A;  2Y1I A;  3LWM A;  3CI5 A;  1S1W A;  4C8N A;  4E1J A;  1JCF A;  2YKN A;  2XY7 A;  4FWN A;  1NGJ A;  4JAX A;  1V4T A;  3VEV A;  2YNI A;  1I94 K;  1KD1 O;  3SBG A;  4CHY A;  4CJL A;  3U8X A;  2D0O A;  1KFS A;  3OYK A;  1HQE A;  2OPR A;  1NJI O;  1WSI A;  3DLE A;  5I42 A;  3QO9 A;  1SAZ A;  2H3G X;  4RW8 A;  1A5V A;  3VEY A;  4O8U A;  4CF9 A;  3GL1 A;  4HWI A;  4CHO A;  4FLW A;  3KTQ A;  1SS6 A;  3D0P A;  4EZ6 A;  5AZJ A;  4KHY A;  4K43 A;  1X3N A;  2ZGZ A;  2CH5 A;  5KRS A;  2RN2 A;  3TTC A;  5D3G A;  3AO2 A;  2AP1 A;  3NF9 A;  1WSG A;  3ATV A;  4DF4 A;  3R3L A;  1EET A;  4CZF A;  4MQ3 A;  2IIR A;  5CY4 A;  3ZX0 A;  3O3H A;  2RKI A;  3MXJ A;  4BR4 A;  1XNQ K;  2V7Z A;  4Q0B A;  3VN5 A;  2G8I A;  4CJR A;  1QHT A;  3AGK A;  1ASV A;  2OYQ A;  3A5N C;  4FPB A;  1QQM A;  4KO0 A;  5BR9 A;  1Q9X A;  1BIS A;  4DF8 A;  3LM9 A;  3P1G A;  1K8A O;  3ULE B;  3UKU B;  2YJF A;  1ZBU A;  3QBX A;  4BRC A;  4O4G A;  2WTU A;  3QB0 A;  5LY3 A;  4CEF A;  1VSH A;  3K5L A;  4FWO A;  4BWJ A;  1TVR A;  4NYN A;  5BRF A;  4BY9 C;  3CM6 A;  3MEG A;  1TGO A;  3ULE A;  4ILJ A;  3I0R A;  1N5Y A;  5AQI A;  3CXC M;  2V7Y A;  3AA4 A;  4FJX A;  2A3Z A;  2XRI A;  2FLO A;  4WFA L;  3K0S A;  3GBT A;  3PSI A;  4A59 A;  3CJ1 A;  1NGA A;  4FWQ A;  4CJ3 A;  4DSI A;  3Q7B A;  1UOC A;  4HTU A;  4DSL A;  4JI1 K;  3ZEU A;  4WYB A;  3AVB A;  5LJW A;  3VQA A;  4EP4 A;  3HXM A;  3DYA A;  4KH4 A;  3FFK B;  4LH4 A;  2E88 A;  4H4M A;  1L3S A;  5KPR A;  3J80 O;  3AO5 A;  3C6A A;  4CGJ A;  3I56 N;  4JRP A;  3E9P A;  5BN8 A;  4BDP A;  3GDQ A;  3NGI A;  2YHX A;  3CJB A;  1RBU A;  4JKB A;  3NF8 A;  2E2Q A;  2OA8 A;  3CMA N;  3ENO A;  1YT3 A;  4NB4 A;  2ZGY A;  3T1H K;  1IBK K;  3SAG A;  3JXU A;  1RT6 A;  4H0X B;  3C6H A;  2FF6 A;  3EKU A;  3ZET B;  1IG9 A;  4CJ4 A;  3OS2 A;  1NKE A;  1RBT A;  2PAV A;  3K2P A;  4IOC L;  2DFF A;  3VGL A;  4DQS A;  4C1N K;  3QER A;  3KLE A;  5M1O A;  5HRR A;  1S1U A;  4MO4 A;  4IO9 L;  2QKB A;  4DFM A;  1JLG A;  1QZ5 A;  4CJQ A;  4BR0 A;  1XC9 A;  4IZ9 A;  4IFY A;  2HHQ A;  5E41 A;  3ISN C;  2NRX A;  1HYS A;  4DLG A;  2VCP A;  4FLY A;  1ITG A;  2Q1N A;  1ZBI A;  2HMI A;  3LPT A;  4A2A A;  1Z05 A;  2VQE K;  3VOV A;  4B9S A;  1TUY A;  2ETJ A;  2F9T A;  4GNI A;  3HVR A;  1RT2 A;  4AHR A;  3ZLJ A;  5C15 A;  5IT9 O;  4MDA A;  3HPG A;  4LSN A;  4CEO A;  3U3Y A;  2B5J A;  1TYQ B;  3MX2 A;  2F4V K;  3EO3 A;  4CZK A;  4LFA K;  3SCX A;  1VSM A;  3QET A;  3DRS A;  3SZ2 A;  3VQQ A;  5A2Q O;  4CHZ A;  1FXX A;  4NCB A;  4DG1 A;  1CZ9 A;  1TYQ A;  3VEW A;  5KGW A;  3FZF A;  2O8E A;  2OZS A;  1D9F A;  3C94 A;  4DUZ K;  4CJU A;  4CJV A;  5FRN A;  4FL9 A;  4CVN E;  4WQ5 A;  1JLQ A;  1IV0 A;  1VRT A;  4B1W B;  4O0I A;  1SL2 A;  1IJJ A;  4IBN A;  4NYF A;  3VQB A;  1S22 A;  1LWF A;  2OPQ A;  3Q7C A;  3VQ8 A;  2VGN A;  3MCA B;  2E6L A;  2IVP A;  1EX4 A;  1GLF O;  4KHN A;  4ZTF A;  3TI0 A;  1VSK A;  3ZSV A;  4FWR A;  2QXF A;  3EL2 A;  5CE3 A;  3K58 A;  2HHX A;  3L2U A;  5F0X A;  1S3X A;  1RT3 A;  3SK3 A;  3WQT A;  3U9D A;  5BRD A;  3ULD A;  4OX9 K;  3VQ4 A;  3OYE A;  4BRM A;  2YHB A;  3DWL A;  3MWP A;  2HNY A;  3ZT1 A;  4QAG A;  3SV4 A;  3RMA A;  4ELU A;  1NJZ A;  3I55 N;  4GKK K;  1Q8I A;  2WOM A;  1ZBL A;  1LWC A;  3OW2 M;  4DQR A;  3J7Z O;  4CZG A;  4B9N A;  1G15 A;  4FJJ A;  4Q5V A;  3K59 A;  5JVH L;  3THY A;  4FWP A;  3RRG A;  4E7L A;  1NLV A;  4M7X A;  2CGL A;  3KLG A;  4FXD A;  2HB5 A;  3H08 A;  1LAV A;  1NGI A;  2YHW A;  1BI4 A;  3OBW A;  5K14 A;  3V1R A;  1NG9 A;  1TL3 A;  1Z6R A;  2HVI A;  4WFB L;  3TR8 A;  4KTQ A;  3CM5 A;  1GLJ O;  1K8K B;  3F9K A;  1JKH A;  4E19 A;  4IDH A;  3AO4 A;  2A1R A;  1HYV A;  1BIU A;  4WE1 A;  1KAY A;  4FJI A;  4A62 A;  3LDQ A;  1ASU A;  1N6Q A;  1ZBF A;  3I8B A;  1W0H A;  2NNW A;  3EE8 A;  4RW4 A;  1GLL O;  4QCL A;  4CF1 A;  1Z26 A;  3L2W A;  4I7F A;  4ELV A;  3V9W A;  3SMP A;  4CBX A;  2IAJ A;  4DSJ A;  5JLH A;  5DM6 L;  5HRP A;  4R5P A;  2D0B A;  3BF3 A;  4QS8 A;  3DOL A;  2BDP A;  4E7H A;  4CW7 B;  3J81 O;  3LAL A;  4DB3 A;  4BGA A;  4J2E A;  3CER A;  1QVF M;  5HRO A;  1QS4 A;  3OYB A;  3PO5 A;  4B1X B;  3FZK A;  1CXQ A;  2OPS A;  2Z1I A;  2F8T A;  3ZT3 A;  1TKT A;  3SUP A;  4DQQ A;  5FPE A;  1QSS A;  2QI2 A;  3P38 A;  3E1Y A;  5HRN A;  2A5X A;  1KLM A;  1GLA G;  4OGE A;  1NK0 A;  4CJF A;  4BR7 A;  2YX6 A;  4LFC K;  1VSE A;  2F96 A;  2E5L K;  1I39 A;  3CPW M;  3QFP A;  2DTU A;  3R8E A;  3TWH A;  3DXM B;  2F9W A;  3D2E B;  4YOX A;  4A5B A;  1LAW A;  3QEP A;  5JVG L;  4YOR A;  5KPT A;  4B1Y B;  2ASP A;  1C0T A;  5DM7 L;  1N34 K;  5C24 A;  1GLB G;  2Q97 A;  4I9L A;  3TSU A;  4CER A;  3OYC A;  4M3R A;  2VQF K;  3WXK A;  2RHK A;  3EKS A;  1OH6 A;  4CGD A;  5AZI B;  4JRQ A;  1NGH A;  4Z4I A;  3BZC A;  1VQ9 N;  1RCH A;  2D0P A;  2XO7 A;  4ISE A;  1HPZ A;  3L3V A;  2UUB K;  1BO5 O;  3ZSR A;  4FVM A;  3LP0 A;  5EU7 A;  4DUY K;  1QTM A;  1N32 K;  1J54 A;  4MLE A;  3KWI A;  1U6Z A;  5M1Q A;  1TK0 A;  3LZJ A;  2GUP A;  2IC3 A;  3M8R A;  2D5R A;  4FJL A;  2FBT A;  2QWN A;  3AO3 A;  2Q3S A;  3HL8 A;  2Q0R A;  3U9Z A;  2GWJ A;  5GIN A;  2OTL N;  3HI0 A;  4CCH A;  3CCM N;  1UAX A;  2G8U A;  3KK2 A;  4XIU A;  3VQ9 A;  3D2F A;  4FLT A;  2QM1 A;  3O5B A;  4FYD A;  4KH5 A;  1WSJ A;  5ADX H;  1OKJ A;  4K8Z A;  1NK6 A;  3HO1 A;  3ID6 A;  4W5T A;  4BRA A;  2BUP A;  1VK0 A;  2HHW A;  1GLC G;  2ATQ A;  3OYD A;  4JI6 K;  3VET A;  2FBY A;  2QTD A;  4M41 A;  3VEO A;  3V1O A;  3A2F A;  3IAY A;  4M3Z A;  3HSC A;  4FK4 A;  4O44 A;  3VEN A;  3V9S A;  3ASM A;  4BRP A;  3LWL A;  4LC9 B;  3PIO L;  3HP6 A;  1WSH A;  2P9I A;  3O1W A;  5AFU A;  5KQ8 A;  4JS5 A;  4ID5 A;  4BRE A;  2VGM A;  2ASO A;  2V51 B;  2JWL A;  1YTA A;  3CFR A;  1FKO A;  1HJO A;  3L2Q A;  5EY4 A;  4I2Q A;  2KW4 A;  3GG4 A;  1T8E A;  2OZM A;  1IO2 A;  4FVU A;  3LL3 A;  3THW A;  5JS1 A;  1GLD G;  4OJR A;  3J7A P;  1U49 A;  3PUF A;  1NKC A;  4AQY K;  2FC0 A;  1EQY A;  3F9M A;  3GE1 A;  4YNQ A;  5ELZ A;  2QWO A;  4CGF A;  3SV3 A;  1VQP N;  1QZ6 A;  5AQP A;  4DV3 K;  1HMV A;  4B9L A;  1T6C A;  3JSM A;  4LF5 K;  2VWB A;  4A57 A;  3NVM A;  5AQU A;  4JI5 K;  3KKS A;  4R79 A;  4Z4G A;  3KK7 A;  1IH7 A;  2I5J A;  4CEZ A;  1QSY A;  2F7T A;  1HKC A;  4E1M A;  3QNO A;  4CHP A;  4H03 B;  3WQU A;  1I3A A;  4CJ5 A;  5HBM A;  1XHZ A;  2ITM A;  4A61 A;  4FLU A;  1O13 A;  2A41 A;  4ISG A;  4B1Z A;  2E8A A;  4GMJ B;  2O8F A;  1ESV A;  2PYJ A;  3V81 A;  1VQ4 N;  2P9S B;  4B9V A;  2DY4 A;  5C2D A;  4YOT A;  5KQD A;  4B3S K;  3CC2 N;  3LP1 A;  2FBX A;  4WF9 L;  3AVL A;  3AA5 X;  3AO1 A;  1T6D A;  4CED A;  4IOA L;  4FZX C;  4AHT A;  1E4G T;  3WEE B;  3HST B;  2IGI A;  3M8P A;  1NK8 A;  4YOY A;  2RPI A;  1RDW X;  4JKA A;  3ZSY A;  4CES A;  3QML A;  4PWD A;  2OCE A;  5BPL A;  2GX9 A;  3WEE A;  1HNZ K;  4Z94 A;  2RF2 A;  1NK4 A;  1HJR A;  4YOU A;  4OPA A;  3T1A A;  1RT1 A;  5CZ1 A;  1SUQ A;  5M1N A;  4BC5 A;  4M45 A;  3RSE B;  3ZCM A;  3IUC A;  4DTP A;  1JLF A;  4E7J A;  1KVB A;  4AH9 A;  1LOT B;  1NKB A;  3J7Y P;  5AQX A;  2HHV A;  3MXM A;  1RGI A;  4DV0 K;  4B3O A;  3RSE A;  3VF6 A;  3CJA A;  5I9E B;  1B9F A;  3H6E A;  5FPM A;  4DSK A;  4MFB A;  3E9L A;  1JXE A;  4J2A A;  3DLH A;  1K6Y A;  3AA2 A;  4J2B A;  4FZZ A;  5FDL A;  4RW9 A;  3NGZ A;  3NAE A;  1T7P A;  5AJ3 K;  3V9X A;  4B3M K;  5EOY A;  4C23 A;  4M3X A;  5JS2 A;  1WOQ A;  2HBK A;  4GV9 A;  4KKO A;  1XMQ K;  5BRH A;  1TUU A;  4IFV A;  4GV3 A;  4LFB K;  4IG0 A;  1B9D A;  1CXU A;  2E6M A;  1VSD A;  3BGR A;  3SUN A;  2YHA A;  4PKI A;  2W40 A;  4G9Z A;  2EX3 A;  1J9A A;  3K5M A;  4PQU A;  4J2D A;  2KKZ A;  1RDB A;  1SQK A;  1VQN N;  4BRI A;  1VAZ A;  2Q31 A;  4CK1 A;  5AQH A;  5AQS A;  2X78 A;  2JLE A;  3OHR A;  3LDL A;  4YDU C;  4OVL A;  3HPH A;  1SKS A;  3MEC A;  1SKR A;  3QLH A;  4BDY A;  3BP8 A;  1BA1 A;  4FJG A;  4GV6 A;  3IS9 A;  1QHA A;  3RMD A;  4N5S A;  3WXL A;  4IEE A;  3UKU A;  1S6P A;  4PHT X;  3RRH A;  5JMV A;  4U7B A;  3KHY A;  3ZSW A;  5CYQ A;  4O55 A;  4JK8 A;  4X62 K;  4BRQ A;  2NRW A;  2BE2 A;  3G4S N;  3QIC A;  4ZHR A;  4F3O A;  2O4I A;  1C6V A;  3GOI A;  3O9T A;  2OAN A;  1WAF A;  2BH1 A;  1NJY A;  5F1X A;  3AVG A;  2YV0 X;  1J6Z A;  1NBW A;  1EWR A;  1RDU A;  1BCM A;  3F5T A;  1BIZ A;  3L0Q A;  3U6F A;  3ITH A;  4KFB A;  3TSQ A;  3AY9 A;  4DKW A;  2E2N A;  5MLC Q;  5T7B A;  1RNH A;  2Q0U A;  3FR0 A;  4BRG A;  4WCE L;  1HUX A;  4CEC A;  1RBS A;  3OYL A;  1KFD A;  4BR2 A;  1E4F T;  3HRG A;  3UB5 A;  2GV9 A;  4FJ8 A;  2R7Y A;  2QXL A;  4PY5 A;  5AQN A;  2DFE A;  3AVM A;  3HM9 A;  4PA1 A;  3NH1 A;  5AQJ A;  3OYA A;  3KJV A;  1X9M A;  3H3O B;  4O5B A;  1C0F A;  1WBD A;  3DRP A;  1KAX A;  3SI6 A;  1JL2 A;  3NFA A;  2FF3 B;  4CEQ A;  3VF2 A;  3AVC A;  3ZET A;  1RTH A;  1HPM A;  1JCG A;  2OPP A;  4GVE A;  1S9G A;  4LF4 K;  3CQY A;  2HBL A;  4AM6 A;  3DRR A;  1VQK N;  4H5R A;  1UWB A;  4CZI A;  5HP1 A;  3RR7 A;  1A5W A;  3QEW A;  1VQ5 N;  3HZ6 A;  3QBW A;  1WUA A;  2RE2 A;  5GAH P;  1HQU A;  4CJE A;  4NCA A;  3VQ7 A;  3C65 A;  2P9P B;  4BG9 A;  4N41 A;  3V6D A;  1SKW A;  1YTU A;  2WUS A;  3VEX A;  3MEE A;  5DK5 A;  5BR8 K;  3TAN A;  1ILY A;  3QEX A;  5AR0 A;  1XC3 A;  4H5V A;  1T05 A;  4H0P A;  4CBW A;  4L3Q A;  3HM8 A;  4BVO A;  4JN4 A;  4CIE A;  3KIO A;  4BRD A;  4L8R B;  3OJU A;  1IKV A;  1UA0 A;  4CZL A;  4MLH A;  4CZM A;  2KHO A;  2NRZ A;  4BVP A;  2P9L B;  4ILH A;  2E1Z A;  4CK3 A;  4JKH A;  5GAD P;  3D7E O;  4JI3 K;  2A40 A;  3JYT A;  2HHT A;  3IKM A;  3RVC A;  2O8D B;  3CCR N;  4DTU A;  2NRR A;  1VHX A;  1O1W A;  5BN9 A;  3NH0 A;  3EZ5 A;  5J2N A;  1X9W A;  1VSL A;  2ZE2 A;  4E1N A;  3SQ0 A;  3O9R A;  2QK9 A;  1OH8 A;  4Z0U A;  2O8D A;  1Q86 O;  2W41 A;  1RIL A;  4ELT A;  1LV5 A;  4DU1 A;  1JLE A;  4V19 S;  4KV8 A;  4K42 A;  1YJW N;  3CQX A;  4QOZ B;  4JI4 K;  3TAB A;  2UYT A;  1W97 L;  4IJA A;  4FM0 A;  4RTF D;  4HVJ A;  1KRP A;  5FRM A;  4BQZ A;  1RDD A;  3OJS A;  3CFO A;  4FLZ A;  4AM7 A;  4JI2 K;  1TK5 A;  4IFE A;  2J4R A;  4DTX A;  1HRH A;  5HL7 L;  1U47 A;  1EO1 A;  3SPY A;  1WAJ A;  2D1K A;  4BC3 A;  3PSF A;  5I3U A;  3T1Y K;  4FK2 A;  5IWA K;  4FM2 A;  3SAF A;  2UXD K;  5LL6 Z;  4C8M A;  1EKE A;  3WNG A;  4NXN K;  1L5U A;  4O5F A;  3VEZ A;  1U2V B;  2YHY A;  1BG3 A;  4WQ4 C;  4WFN L;  3BEX A;  5E26 A;  4KBO A;  3W3D A;  2BGG A;  1YUW A;  4DR2 K;  5LMU K;  3VA3 A;  3OYM A;  2GWK A;  5AQR A;  1EXQ A;  4BR9 A;  2IVO A;  2QWP A;  4CEB A;  1L3T A;  4E0D A;  4M3W A;  3THX B;  1P8Z A;  3VPZ A;  2G8F A;  1T3V A;  4BGB A;  2YKM A;  2G8W A;  3F73 A;  1TKZ A;  3O1B A;  1K8K A;  4EHU A;  3E01 A;  4J8F A;  3N4Q A;  1NJX A;  2GUI A;  3THX A;  3KD5 E;  3PY8 A;  4YDU A;  3NH2 A;  1MWK A;  2Z1G A;  4DTO A;  1GOC A;  3K5N A;  3M8Q A;  3HP9 A;  3VGM A;  2HVH A;  2OTJ N;  1XHX A;  4IOX A;  1JLB A;  5SZT A;  1G99 A; 
#chains in the Genus database with same CATH homology
 3M5R A;  5AZJ A;  3BF1 A;  4GY2 B;  4K43 A;  1X3N A;  2ZGZ A;  1QQN A;  2QWL A;  2CH5 A;  3HBT A;  3E66 A;  2FSK A;  3F2K A;  3TTC A;  1EQY A;  3F9M A;  3GE1 A;  2AP1 A;  5ELZ A;  3G25 A;  2QWO A;  1YVN A;  1VQP N;  2HST A;  3ATV A;  3R3L A;  1QZ6 A;  4BRL A;  4CZF A;  5AQP A;  2P9L A;  3TPQ A;  2IIR A;  1T6C A;  3ZX0 A;  4BRF A;  4FPA A;  3C0B A;  2NLX A;  2VWB A;  4A57 A;  3ENH A;  4BR4 A;  3NVM A;  2V7Z A;  5AQU A;  5EX5 A;  3QFU A;  4R79 A;  3AGK A;  1ZBS A;  3A5N C;  3TU5 A;  3KK7 A;  4FPB A;  1QQM A;  5EVZ A;  5BR9 A;  2F7T A;  3CJ9 A;  3CCL N;  3LM9 A;  1HKC A;  1K8A O;  3ULE B;  3EN9 A;  3UKU B;  2YJF A;  4H03 B;  3SBT A;  2HBM A;  3QBX A;  1KAZ A;  3WQU A;  3HTV A;  4BRC A;  3DXM A;  5TKW A;  4ILG B;  3D2E A;  3PLA A;  3QB0 A;  5LY3 A;  2ITM A;  1D4X A;  4FWO A;  4A61 A;  1DEJ A;  1O13 A;  3A8Y A;  4CD3 A;  2A41 A;  5BRF A;  4BY9 C;  4ISG A;  2A6A A;  4B1Z A;  3ULE A;  2E8A A;  4ILJ A;  1NGD A;  1NGC A;  1ESV A;  5AQI A;  3CXC M;  2V7Y A;  1VQ4 N;  2P9S B;  5CHI A;  2E2P A;  3TSP A;  3WT0 A;  1NM1 A;  2A3Z A;  3CJC A;  2FLO A;  4YOT A;  5C2D A;  4WFA L;  3GBT A;  5KQD A;  5AZI A;  3CJ1 A;  4A59 A;  1NGA A;  3KVG A;  4FWQ A;  4EFH A;  5M1K A;  3CC2 N;  3Q7B A;  4WF9 L;  3R1X A;  2ZF5 O;  4BQL A;  4UY8 O;  4M63 C;  3ZEU A;  3M1F A;  2NZT A;  4WYB A;  5LJW A;  1T6D A;  2GEL A;  1SZ2 A;  2EWS A;  4IOA L;  1YJ9 N;  5E84 A;  4JK7 A;  1ZC6 A;  5AQY A;  4JHD B;  4BRK A;  1E4G T;  3WEE B;  3TTF A;  4YOY A;  4KH4 A;  3FFK B;  3L4Q A;  4H5T A;  1RDW X;  4JKA A;  3O9S A;  2E88 A;  3LDP A;  5KPR A;  3QML A;  3C6A A;  2GX9 A;  5BPL A;  3WEE A;  3I56 N;  4Z94 A;  2NRH A;  2YCH A;  4YOU A;  4OPA A;  3CCJ N;  4H0O A;  3E9P A;  5BN8 A;  3MX5 A;  1M90 O;  2QWR A;  2IVN A;  3GDQ A;  5H1S Q;  2YHX A;  2HF3 A;  2P9K B;  3CJB A;  2BTF A;  4BC5 A;  5M1N A;  3RSE B;  4JKB A;  3AAR A;  2QW9 A;  3IUC A;  2E2Q A;  3CC4 N;  1BUP A;  3LDN A;  3OBY A;  3T7Z A;  3CMA N;  3ENO A;  5BPN A;  5AQK A;  2GTD A;  1LOT B;  2V52 B;  4IWV A;  4NB4 A;  2AA4 A;  1U2V A;  2ZGY A;  3P31 A;  5AQX A;  4DCH A;  1K9M O;  3SAG A;  3JXU A;  1RGI A;  2JWK A;  3NVK A;  2P9K A;  4H0X B;  3C6H A;  2FF6 A;  2I7N A;  3EKU A;  3RSE A;  3VF6 A;  3ZET B;  3CJA A;  1DT9 A;  1K73 O;  1RFQ A;  5I9E B;  3H6E A;  2PAV A;  4IO8 A;  5CR4 A;  5FPM A;  4IOC L;  1Q7Y O;  3M3Z A;  3E9L A;  3VGL A;  4C1N K;  1VQ8 N;  3CIP A;  2P9N B;  4FWM A;  4JNE A;  5M1O A;  3VER A;  5C0Y A;  4A2B A;  3O80 A;  3W0L A;  4MO4 A;  4IO9 L;  2E20 A;  1MA9 B;  4EAH D;  1QZ5 A;  4O8K A;  4BR0 A;  4BRH A;  4H5N A;  4IZ9 A;  5EOY A;  2WC9 A;  4RCH A;  4C23 A;  1WOQ A;  2NRX A;  3SJH A;  2HBK A;  2VCP A;  3OA9 A;  4GV9 A;  3MK6 A;  3UE5 A;  1X9J A;  5AQQ A;  5BRH A;  2Q1N A;  1TUU A;  3WXI A;  4A2A A;  4GV3 A;  4H0Y B;  1MDU B;  4OO1 J;  1Z05 A;  2NRV A;  3VOV A;  1TUY A;  1ATS A;  3EZW A;  4FWL A;  2F9T A;  4GNI A;  4PKI A;  5C10 A;  2W40 A;  3R6M A;  5C15 A;  4G9Z A;  4MDA A;  4BR5 A;  3FLC O;  2E1Y A;  3IDH A;  1DGK N;  1SQK A;  1ATN A;  2HMP A;  2KKZ A;  1VQN N;  4BRI A;  3WXM B;  1TYQ B;  1VAZ A;  3MX2 A;  1HKG A;  2Q31 A;  3VTI A;  1N8R O;  3HOT A;  4CBU A;  2ZJR L;  3EO3 A;  4PL8 A;  4CZK A;  4FWS A;  2CH6 A;  4H5W A;  5AQH A;  5AQS A;  3M6G A;  3OHR A;  5GAE P;  3LDL A;  4JKG B;  5ADX A;  1TYQ A;  3VEW A;  4YDU C;  3FZF A;  4YOW A;  2ZJQ L;  3P39 A;  3O08 A;  3FGU A;  3BUZ B;  1ATR A;  5HOO A;  3DLL L;  3BP8 A;  3N4P A;  2KLA A;  1BA1 A;  3D6R A;  4EHT A;  4FL9 A;  4GV6 A;  2HF4 A;  4NO7 A;  1YIT N;  3IMX A;  3K9K A;  4WQ5 A;  1QHA A;  4PKG A;  5AQV A;  4K25 A;  2CGK A;  1QQO A;  3WXL A;  4IEE A;  4B1W B;  3CC7 N;  1IJJ A;  4NLC A;  3UKU A;  4PKH A;  1S22 A;  5AFU H;  4PHT X;  2GEM A;  5JMV A;  5EXW A;  4U7B A;  2YJE A;  3KHY A;  3UKR B;  3JS6 A;  4JK8 A;  4DHY A;  4BRQ A;  5GAG P;  2NRW A;  1Q82 O;  3G4S N;  3Q7C A;  3QIC A;  3H1Q A;  2VGN A;  1YI2 N;  3MCA B;  4CJ7 A;  1W2B M;  2VYP A;  2IVP A;  1GLF O;  5AQL A;  2YI1 A;  3GOI A;  4ISF A;  5AQG A;  2P9S A;  2OAN A;  3FZH A;  3O9T A;  2HBJ A;  3QDK A;  3DJC A;  3MMV A;  1Y64 A;  3EL2 A;  4FWR A;  4IXC A;  1NWK A;  5CE3 A;  5F0X A;  2BH1 A;  4WQ4 A;  1S3X A;  1JJ2 M;  3SK3 A;  5F1X A;  3HOS A;  3WQT A;  2QEX N;  3U9D A;  5BRD A;  3CET A;  1J6Z A;  3H1V X;  4JKF A;  1NBW A;  3S41 A;  4B1U B;  1RDU A;  3F5T A;  3H45 C;  1XQS C;  2ASM A;  1R59 O;  3H46 O;  3MN6 A;  2WFB A;  4JHD A;  4BRM A;  5AQT A;  3L0Q A;  3O9U A;  1VQO N;  3NMU A;  4FWK A;  3VES A;  1MWM A;  3ID8 A;  3DWL A;  3AAQ A;  3MN7 A;  5GIP A;  1ZXO A;  3MWP A;  3D2F B;  3TSQ A;  3AY9 A;  4DKW A;  3T69 A;  2E2N A;  1QVG M;  3C7N B;  4FSV A;  4AF1 A;  5MLC Q;  1VQM N;  4NLB A;  2Q0U A;  3FR0 A;  4BRG A;  3I55 N;  4WCE L;  1HUX A;  3DXK B;  3L6Q A;  3J8A A;  4BC2 A;  4BR2 A;  3SMS A;  4HWI A;  3OW2 M;  1T44 A;  2CGJ A;  4M7Y A;  1E4F T;  3HRG A;  3UB5 A;  1M1K O;  1X3M A;  3J7Z O;  4CZG A;  3CCS N;  2QXL A;  1JCE A;  3AGR A;  5AQN A;  3DXK A;  1NMD A;  3IFR A;  1YXQ A;  5JVH L;  5AQJ A;  4H0V B;  1VQ7 N;  5FPD A;  4FWP A;  3PIP L;  3H3O B;  3A5L C;  1NLV A;  1C0F A;  1KAX A;  4M7X A;  4CI6 A;  2CGL A;  5AQM A;  2FF3 B;  3VF2 A;  5JLF A;  3ZET A;  1KQS M;  1HPM A;  1JCG A;  1NGI A;  2YHW A;  4GVE A;  2PBD A;  4FO0 A;  4IJN A;  4XEI A;  3OBW A;  3CQY A;  2HBL A;  2ZWH A;  1Z6R A;  5JIC A;  2P9I B;  4AM6 A;  4WFB L;  2E2O A;  1GLJ O;  1K8K B;  1YIJ N;  1VQK N;  1HX1 A;  4H5R A;  2P9N A;  4IDH A;  1VQL N;  4CZI A;  2QWQ A;  1VQ5 N;  3HZ6 A;  3K9J A;  3QBW A;  1C0G A;  1WUA A;  4XH4 A;  1KAY A;  2RE2 A;  5GAH P;  4U67 L;  3O4W A;  4A62 A;  3LM2 A;  3LDQ A;  2ZJP L;  3CD6 N;  3C65 A;  2P9P B;  3SLC A;  3I8B A;  3WXJ A;  2NNW A;  3EE8 A;  4YOV A;  4BG9 A;  1GLL O;  3U4L A;  3CME N;  2WUS A;  3VEX A;  4DQ8 A;  3SMP A;  4CBX A;  5JLH A;  1ILY A;  4XH1 A;  5AR0 A;  5DM6 L;  5AZJ B;  1XC3 A;  2WBN A;  3FZL A;  4H5V A;  3BF3 A;  3KZB A;  4QS8 A;  4H0P A;  3CF5 L;  4CBW A;  2HOE A;  1KXP A;  1VQ6 N;  4L3Q A;  3HM8 A;  4BVO A;  4BC4 A;  2Q36 A;  4JN4 A;  3FE1 A;  3TTD A;  4DB3 A;  3CCE N;  4BGA A;  4CD1 A;  3MWT A;  3DAW A;  4BRD A;  3CER A;  5AQO A;  1QVF M;  4CZL A;  4MLH A;  4CZM A;  3VMF B;  2KHO A;  2NRZ A;  5TKY A;  4BVP A;  4B1X B;  1BA0 A;  2P9L B;  4ILH A;  4B9Q A;  3G6E N;  5LJV A;  3FZK A;  1IG8 A;  1BDG A;  1YF5 L;  5B8H A;  3CHW A;  2E1Z A;  4JKH A;  5GAD P;  2P9U B;  3D7E O;  2A40 A;  3ENB A;  2Q2R A;  5FPE A;  2QI2 A;  3P38 A;  3E1Y A;  1HLU A;  3O9Q A;  1BU6 O;  2A5X A;  1GLA G;  3IKM A;  4I6M B;  4JKG A;  5M1P A;  3ATU A;  3RVC A;  2NRR A;  4IEI A;  5BN9 A;  3CCR N;  4BR7 A;  2YX6 A;  2DPN A;  1XUP O;  3CCV N;  3O6W A;  4CZJ A;  3CPW M;  2P9U A;  3QFP A;  3CCU N;  3R8E A;  3O9R A;  1LCU A;  3ZYY X;  3DXM B;  4HTL A;  2F9W A;  3D2E B;  3EE9 A;  3LDO A;  4A5B A;  4YOX A;  4QS9 A;  4I6M A;  1Q86 O;  2QA4 N;  2W41 A;  2QWM A;  3L4I A;  4FOI A;  4JKE A;  5JVG L;  1Q81 O;  1NGG A;  4YOR A;  3MN5 A;  5KPT A;  5AQW A;  2FSJ A;  4EIA A;  4BRN A;  4B1Y B;  3VGK A;  3FZM A;  2ASP A;  4K42 A;  1YJW N;  5DM7 L;  1GLB G;  1P90 A;  2Q97 A;  4JEP A;  5BPM A;  1YAG A;  3B8A X;  3CPE A;  3CQX A;  4QS7 A;  3TSU A;  2A42 A;  5BRE A;  3UKR A;  3WXK A;  2RHK A;  3EKS A;  4BRO A;  5AZI B;  1DKG D;  2UYT A;  1NGH A;  1H1V A;  1W97 L;  3VF4 A;  1VQ9 N;  2D0P A;  3ZEU B;  4XH5 A;  4IJA A;  4ISE A;  4MDB A;  4RTF D;  2NRT A;  2D4W A;  1BO5 O;  5C2F A;  3E9O A;  4A5A A;  4FOE A;  1KC8 O;  4BQZ A;  4FVU A;  4MLE A;  3KWI A;  1U6Z A;  5M1Q A;  4AM7 A;  4IFE A;  2J4R A;  3AAP A;  3VTH A;  2GUP A;  4WQ5 C;  5M1F A;  4F9O A;  5HL7 L;  1EO1 A;  4CZH A;  4RWT A;  4Y0W A;  4K41 A;  2QWN A;  3U9Z A;  2Q0R A;  2D1K A;  4BC3 A;  2GWJ A;  1BWF O;  5C12 A;  5KPZ A;  5GIN A;  2OTL N;  3HI0 A;  4JK9 A;  4B1V A;  3CCM N;  1BOT O;  3SAF A;  3P4I A;  3D2F A;  4H0T B;  5F2R A;  5FPN A;  2QM1 A;  3O5B A;  4KH5 A;  5ADX H;  3C7N A;  4KH6 A;  3ZX2 A;  1OKJ A;  1NGE A;  4CZE A;  1S72 N;  4O5F A;  2FSN A;  3H3N O;  1NGB A;  3ID6 A;  3VEZ A;  1OVY A;  1U2V B;  2YHY A;  4BG8 A;  2I7P A;  4BRA A;  2BUP A;  4OPH A;  1BG3 A;  1GLC G;  3CCQ N;  4WQ4 C;  1YHQ N;  4WFN L;  3BEX A;  3MN9 A;  3VET A;  5E26 A;  4PL7 A;  3CI5 A;  4KBO A;  2QTD A;  3W3D A;  3VEO A;  4E1J A;  1YUW A;  1JCF A;  3HSC A;  4MO5 A;  4FWN A;  3VEN A;  2FXU A;  2GWK A;  3MCP A;  3O8M A;  5AQR A;  4BRP A;  3CJ7 A;  1NGJ A;  4LC9 B;  2IVO A;  2QWP A;  1V4T A;  4JAX A;  4BR9 A;  5GIO A;  3ZX3 A;  3PIO L;  3R9P A;  1HKB A;  3SAH A;  3VEV A;  1V4S A;  3A5O C;  1P8Z A;  3VPZ A;  3MDQ A;  1T3V A;  4BGB A;  1KD1 O;  3KWG A;  2P9I A;  3O1W A;  3G71 N;  3SBG A;  3O1B A;  5AFU A;  1Q18 A;  5KQ8 A;  3A0I X;  1K8K A;  1CZA N;  3I33 A;  4BRE A;  1NGF A;  4EHU A;  2VGM A;  4J8F A;  3N4Q A;  3U8X A;  4C1N I;  4JKC A;  2D0O A;  2ASO A;  2PFU A;  2V51 B;  1GLD G;  4JD2 B;  2JWL A;  4JKD A;  4YDU A;  5AQF A;  1MWK A;  1HJO A;  5AQZ A;  1NJI O;  2P9P A;  5EY4 A;  1SAZ A;  3WUH A;  3GG4 A;  3A5M C;  2H3G X;  1GLE G;  3VGM A;  1YJN N;  4JD2 A;  3VEY A;  4IOX A;  4O8U A;  2OTJ N;  3GL1 A;  1G99 A;  3LL3 A;  1SS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...