3Q7CA

Exonuclease domain of lassa virus nucleoprotein bound to manganese
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
210
structure length
209
Chain Sequence
GFTAGLTYSQLMTLKDAMLQLDPNAKTWMDIEGRPEDPVEIALYQPSSGCYIHFFREPTDLKQFKQDAKYSHGIDVTDLFATQPGLTSAVIDALPRNMVITCQGSDDIRKLLESQGRKDIKLIDIALSKTDSRKYENAVWDQYKDLCHMHTGVVVEKKKRGGKEEITPHCALMDCIMFDAAVSGGLNTVLRAVLPRDMVFRTSTPRVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nucleoprotein
publication title Structure of the Lassa virus nucleoprotein reveals a dsRNA-specific 3' to 5' exonuclease activity essential for immune suppression.
pubmed doi rcsb
source organism Lassa virus
molecule tags Hydrolase
total genus 60
structure length 209
sequence length 210
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17290 Arena_ncap_C Arenavirus nucleocapsid C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.410 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3q7cA01
3MX5A 3R3LA 4GV3A 3MWPA 3Q7BA 4FVUA 4GVEA 4GV9A 3Q7CA 4G9ZA 3MX2A 4GV6A 3MWTA
chains in the Genus database with same CATH superfamily
3O1BA 4MLEA 4DQRA 2VG6A 5TKYA 3N4PA 2JWLA 4H5TA 3HP9A 2HHHK 3V9WA 4B9VA 4CECA 4M3UA 4BACA 2XY5A 3HPGA 4F4KA 4OPJA 3H3OB 3OTOK 1EP4A 4C8NA 1VQ7N 3DLKA 4CJSA 4FM0A 4BRNA 2QXLA 3GE1A 4IJNA 4Z4FA 3SUQA 1TKXA 4ZTJA 4BRDA 3IDHA 4CZGA 1WN7A 5K14A 1JLQA 2XY7A 1U04A 1BIUA 3J8AA 3TABA 3FFKB 3HSTB 3I0SA 4WYBA 3C6AA 2A1SA 4FWQA 2YV0X 4Z4GA 3M6GA 3ZSRA 1ATSA 1TL1A 3F9MA 3WXMB 1BDGA 4FM1A 1ZBLA 3MX5A 1NLVA 3RMDA 1EX4A 4IJAA 2CH6A 3L0QA 2PFUA 2IIRA 5AQVA 4FLTA 3H6EA 1ZBUA 2X6NA 3D2FB 4KHSA 2P9PA 1RDAA 3MWPA 5FDLA 3D2FA 3T1YK 4GVMA 3A5MC 3U8XA 1RDWX 4CHOA 4CJEA 3KVGA 2D0PA 5A2QO 3OYKA 3CCQN 4CHQA 4FJGA 1LV5A 5BPLA 1RT7A 3VEOA 3QEIA 1X3MA 1WSFA 4CZMA 3CMAN 2P9LB 1VRUA 4WF9L 2F4VK 1Z25A 4CW7B 5DMRA 3PO4A 3OYDA 4CK1A 3ZX3A 4FWRA 4I6MA 1TKZA 5E26A 4CIEA 1QZ5A 4B1ZA 4MDBA 4CHZA 1QE1A 4B9SA 1YVUA 1WB9A 2YKNA 1G15A 3PSFA 4O0IA 5AZJB 1TUUA 3MECA 1JKHA 1VHXA 3L4IA 4EHUA 3L3UA 1JCGA 3CJ7A 1LWFA 3TANA 1MU2A 2YCHA 2B5JA 1XI1A 3O9RA 1S72N 3UKRA 3VEXA 3C65A 3SAHA 5JVHL 1K9MO 1RDCA 4JV5K 2HBJA 3P39A 1LAVA 1T05A 3TWHA 3CC7N 4GV6A 3M3ZA 2A6AA 4GV3A 1XHXA 2A5XA 4CJVA 1QQOA 5M1KA 5AZIB 3HBTA 3H1QA 4B1UB 2OTJN 3DRSA 5AZIA 4M7XA 3ZT0A 4DR1K 4JI0K 2QK9A 2Z1GA 3OYAA 4W5QA 2HHTA 3UE5A 1D9FA 1P90A 3CI5A 3OA9A 4OPKA 3B8AX 1TK0A 3AVKA 2IVNA 4KTWA 2ZQBA 4YFUA 4CEZA 2P5GA 4DV6K 3KLHA 1REVA 1QHTA 3O3HA 3MN6A 4JN4A 1FKPA 1MWMA 3O80A 3VA3A 1IKVA 5BN9A 1NK5A 4ILHA 1VSIA 4LC9B 3MCAB 3VEWA 4BE2A 2QWOA 4JK7A 1B9DA 1MA9B 3OYJA 1CZBA 3OYHA 1NK0A 1K8AO 4XIUA 4LH4A 3QBXA 5SZTA 1WUAA 3ZETB 5KQ8A 3ZETA 4A61A 2FXUA 5FPMA 3PO5A 3V1QA 1VQ8N 2P9IB 1L3SA 4AHUA 4CJ5A 3NH2A 1NNEA 2GWJA 1U4BA 4HUEA 5SWMA 1BG3A 4B08A 3A8YA 1SV5A 4U7BA 2PYJA 1SUQA 3HPOA 1BI4A 4PKGA 3SUNA 1NJWA 3NH1A 4I2PA 3W3DA 4YDUA 4YORA 4DFKA 3CJ1A 2KLAA 2WUSA 4LY7A 2G8IA 4J2DA 2OPSA 1DTQA 3O9TA 1RGIA 3WXKA 4DSEA 3FZFA 1HYZA 1MDUB 4CEDA 4K25A 4N41A 5C10A 1YVNA 4X62K 4NCAA 3SQ4A 4FK4A 3VEZA 2OZSA 1WBBA 3UIQA 3ASMA 4A2AA 3L2WA 3U9DA 5GAGP 2Z1JA 2P5OA 1Y97A 5KQDA 3LWMA 3CCJN 4JK9A 5AQIA 2UYTA 2FBYA 3WQTA 3QIOA 4FSVA 4XH5A 5J1EA 3NCIA 3FFIA 1S1XA 3VQ6A 5CY4A 4JKAA 1RT2A 4HVJA 4DLGA 3AVBA 2Z1IA 3EL2A 4M45A 2Q2RA 2VGNA 2Q3SA 3E9OA 1VSEA 4B3MK 4EIAA 3KD1E 4X64K 2UUCK 3G4SN 3CMEN 5AQHA 3K5NA 1HQUA 4KHQA 1GLLO 4CF8A 3P38A 3O3GA 1C0UA 1TKTA 3RMAA 3AA5X 3OBYA 3VGLA 1X9JA 4A5AA 4GNIA 3VQPA 4BC5A 3TAFA 4PA1A 4J2EA 1NOZA 3CC4N 4PL7A 1RBUA 3QEVA 1NGDA 4BWMA 1WSGA 2D0CA 3U3YA 4IEEA 4LF5K 3AV9A 2QW9A 4H5RA 4FJNA 2Q36A 4C8MA 3QEPA 5HRRA 5FROA 2NRWA 4DV3K 5M1QA 3O8MA 1QS4A 1VK0A 4EZ9A 3M1FA 3WNFA 1KD1O 2W40A 3CCUN 3CQYA 4HTLA 2D0AA 3AVMA 3P31A 4XEIA 1ILYA 3QNOA 1FJGK 3TSQA 3HI0A 3I33A 2A3ZA 5M1FA 3THYB 1GLJO 3L6QA 3TTDA 1RBTA 1RILA 5KPRA 4BRPA 2WFBA 3THYA 2HMIA 3QO9A 3QESA 4CJ4A 2H3GX 3AA2A 1HQEA 2FSKA 4CZJA 4Z4CA 2O8EA 1ESVA 5AQTA 4DR3K 4CF0A 1DKGD 4K8ZA 4YY3K 1VAZA 3AVHA 3CM6A 4H0XB 2NZTA 4C23A 3NAEA 4ISFA 2VCPA 3OYBA 1LWCA 3FZHA 3EZ5A 4BREA 1JJ2M 2KTQA 3DJCA 2ITGA 2E1YA 4JNEA 3O1WA 3CJAA 1HNWK 4IFYA 4MO5A 2NRZA 1JXEA 4F2SA 2ITMA 1TV6A 1NOYA 1LAWA 3GL1A 4DV2K 4B9QA 3ZSWA 4BQLA 5B8HA 2NLXA 2HF4A 3QIPA 4MDAA 4DF4A 2JLEA 3MDQA 1RTDA 4CJWA 1QTMA 4IBNA 4WE1A 1X3NA 4HWIA 3E9PA 2VWJA 4E7JA 1TAQA 4ID1A 3SJHA 1XMOK 3QFPA 3TAEA 3EYZA 3NF7A 1S5JA 1C1BA 3LPUA 2E6MA 2E6LA 4GKJK 4JLHA 3I0RA 5JS1A 1BQNA 1C0MA 1NK7A 2F9WA 1C1AA 4DTRA 3L4QA 4IWVA 3CERA 2E2NA 3LAMA 5FPNA 1XC3A 1N6QA 2E20A 1J53A 4WCEL 3BY5A 1QVFM 4DSJA 1KAXA 3CFOA 2UU9K 3LZIA 3BDPA 3DI6A 5AQMA 1DTTA 4BWJA 2FBXA 3AVFA 2O8DA 4I9LA 4FLZA 4NO7A 3K59A 4AHCA 3VGMA 3PY8A 4DS4A 4M3WA 1X9SA 1VSMA 3KK2A 1HPZA 1VRTA 1QZ6A 3H1VX 2GUIA 3WXLA 4KI4A 4B9NA 3QMLA 2Q0UA 2YHBA 4CESA 3CQXA 4PL8A 4X66K 4E19A 2HBLA 3IAYA 3A0IX 3DYAA 5HOOA 3CIPA 2W6LA 3BGRA 4MLHA 4M42A 3KKRA 4IFEA 4CFCA 2NNWA 1K8KB 4AQYK 3QDKA 4IG3A 1K8KA 1Z6RA 2G8FA 4BRCA 2WOMA 4DMNA 3R9PA 3VQ9A 3SMPA 1WSJA 1LW0A 3MN9A 3FE1A 4O8KA 4KKOA 3I55N 3D6RA 1Q86O 5KTQA 4PKHA 4JRPA 3OYMA 3KLIA 2VWKA 4FJ5A 3KWGA 1JXBA 3PX0A 1HYSA 3ISNC 1FKOA 3IUCA 4FWKA 1NBWA 3C7NB 5GAEP 3C7NA 3ATUA 3AO2A 3CPWM 2ZWHA 3JAMO 4B3SK 4RW8A 1F21A 1GLEG 3W0LA 4ISEA 4DR7K 3U3GA 3V81A 1S1UA 4BDZA 4NCBA 3OY9A 3SYZA 3C95A 5FPEA 3O6WA 1HKCA 1N34K 1XUPO 4CEBA 2YX6A 4FZXC 5EVZA 3K58A 3HRGA 4KAZA 2FLOA 2A41A 4FOEA 3THXA 1ZBSA 4OX9K 3A5NC 3RVCA 4N5SA 4DSFA 3EE8A 3DLGA 3SQ2A 3J7ZO 2RHKA 3N4QA 4M3YA 3OS1A 3PUFA 3CETA 2P1JA 4BE0A 2HHQA 5BPMA 1DEJA 5HL7L 3AVAA 4B8AB 3FR0A 4F9OA 5TKWA 1ASVA 1NK9A 3R6MA 5D3GA 2FBVA 1ATNA 4DG1A 3S3NA 3LANA 3OHRA 1S1VA 4H4OA 1IBLK 1VQNN 4CVNE 4RW9A 3OYEA 3E66A 4CD3A 3P5JA 3ZSVA 4BRGA 2CH5A 2QWNA 3SCXA 1VQ5N 5AQPA 1L3VA 1BCOA 4XH1A 3DLLL 1OH7A 1YJ9N 3KTQA 2A40A 3GBTA 4E7LA 2KW4A 3RSEB 4K8XA 1ZC6A 1HKBA 1SKSA 3RSEA 2HNZA 1A5VA 1WAJA 2F8SA 3AO1A 4JHDB 2RF2A 1HPMA 1XMQK 1NGJA 3KHYA 4JHDA 4ELTA 3KIOA 4RW7A 1BISA 3M8QA 4BVOA 3LP0A 1OH5A 2YI1A 5EOYA 1J5OA 4HUFA 1QQNA 5GAHP 4JS5A 3EKUA 3O4WA 3O9SA 4HHTA 3PIPL 4F3OA 2I7PA 1NGFA 1ZYQA 3IMXA 4BROA 4OKKA 3L2RA 3MMVA 3RTVA 4FJKA 2GELA 4FJXA 1M90O 5LL6Z 5LY3A 1D5AA 3VETA 4V19S 1D4XA 4CK3A 4R5PA 1X9MA 4FXDA 2KKZA 5BPNA 2Q31A 1KLNA 1LOTB 3LWLA 2X78A 5GIPA 4LF8K 1OKJA 1NGAA 1S1WA 4CHNA 3ULDA 4ELUA 3ZT4A 2G8UA 2P9LA 1K73O 1GLCG 3ZT2A 2CGJA 4CF1A 1J54A 3LDQA 2QWPA 4FOIA 2AA4A 4CJ7A 4A57A 5KRTA 2HOEA 5GINA 5ELZA 4GKKK 3JSMA 4BRIA 3G10A 3GDQA 4H5VA 4WQ4A 1RT5A 3NF6A 2OZMA 3DMJA 2P9UB 4B9UA 4FLWA 4K0KK 2GUPA 2P9UA 1EWQA 3QINA 3VQBA 2WTUA 1Q82O 5AZJA 1QSLA 3B6OA 5H1SQ 2P9KB 5BR9A 1RT4A 1CLQA 2P9KA 4CGIA 5EY4A 3E9LA 3DRRA 5AQKA 1XC9A 2ZGYA 5KGWA 5C24A 3K5MA 3HVRA 4QAGA 3MXIA 3T3FA 5GADP 1L3UA 2VQFK 3KKSA 4YHHK 3T1AA 5C15A 3OBWA 3SQ1A 4Y1CA 1S9GA 3SUPA 1B9FA 4E7HA 3QEXA 4FW1A 4DR5K 2IOCA 1C0TA 1VQON 1ZBIA 3P4IA 1M1KO 1VQLN 5JS2A 3Q7CA 3NVKA 3FZLA 4JAXA 5IWAK 1X9WA 5C0YA 4RW4A 2NRRA 3TTFA 3AVIA 5C2FA 1EKEA 2YJFA 3PIOL 3SAFA 4BR2A 1RDDA 1UAXA 3NF8A 2ASOA 4KH6A 3H3NO 4IOXA 1KVAA 3HTVA 4CZEA 5CR4A 5FRNA 1SZ2A 4EFHA 4MO4A 3AO5A 1H1VA 4CEAA 4FCYA 1S6QA 4AHSA 3K2PA 4FJMA 2IVOA 3KK1A 1KSPA 5DM7L 1WAFA 2O8FB 2D5RA 1NKEA 1NWKA 2O8FA 4DSLA 3DLRA 4IG0A 2O8BB 3MEDA 4OJRA 3MXJA 3ZX2A 3OS2A 2O8BA 4YNQA 2QM1A 3V9XA 4L8RB 1RCHA 5AFUH 4FJJA 1JLBA 4FYDA 3I56N 3EN9A 3O08A 2P9IA 2FSNA 4CGJA 4DHYA 3HL8A 2EX3A 1LWEA 5AQYA 2P9NB 3RMBA 3T19A 1W97L 2ZE2A 3J80O 1T44A 3CCEN 4W5TA 1HNIA 3L3VA 4DQPA 3TARA 5J2NA 4DFJA 4B9MA 4H0VB 4OPAA 1T8EA 4BE1A 1T6DA 2J4RA 1VSKA 2GBZA 3MCPA 3HJFA 3IRXA 4H0YB 4AHTA 5M1PA 4BRFA 1TGOA 4KH5A 2OTLN 1U48A 2KFZA 1XNRK 1NG9A 4NB4A 4W5OA 3DXKB 4EP4A 2V51B 4E3SA 3SLCA 3DXKA 4NLCA 3T7ZA 3CG7A 2GX9A 2E2QA 3CM5A 5AQUA 3U4LA 2W42A 4MFBA 4Q0BA 3HOTA 3TR8A 2DTUA 3LDNA 4KRFA 3ZSYA 4AF1A 1B92A 3LP3A 4B9TA 4QS8A 2IC3A 2VYPA 5CHIA 5JLHA 4KPYA 3H08A 3HZ6A 2CGKA 2OPQA 4KB0A 4PQUA 1OVYA 1V4SA 3SJJA 2HVIA 4FLXA 3IKMA 4CF2A 1LCUA 3L2QA 2O4GA 2IAJA 4JI4K 3VQDA 3EO3A 4CZIA 4F8RA 1ZBFA 4CJUA 4N47A 1RNHA 4J2BA 3CFPA 3UB5A 1WNSA 2P51A 3WNEA 2KHOA 2DFEA 3O9UA 4CBWA 3SQ0A 2WBNA 2ASPA 1NJYA 1N5YA 4I9QA 4FPAA 2YHXA 5BRHA 1S9EA 4B8CA 3MX2A 3BZKA 4PUOA 3O5BA 4BR9A 2UXCK 1XNQK 1TK8A 4CF9A 1IKYA 4H8KA 4DQSA 4DU3A 3VQEA 4CK2A 4FWOA 1EQYA 4BG8A 4JYAK 4M3ZA 3VERA 5MLCQ 1TUYA 4CBXA 4BR0A 2GV9A 1UWBA 1J5EK 3AVGA 3OS0A 2QWLA 1BWFO 2D1KA 1BO5O 5C2DA 4K41A 3VF6A 4FJIA 2UXBK 1NGIA 1VSJA 3VTIA 1RDBA 4FPBA 1NMNA 4DU4A 5BRDA 1QQCA 4E7IA 4OO1J 4IDHA 1YJNN 3WNHA 4CJLA 4FVUA 3KJVA 1Q8IA 4BC3A 3TU5A 5FLXO 2ZGZA 4DB3A 4XH4A 3SI6A 3K5OA 3DLBA 1JLAA 4BY9C 5I42A 1CZ9A 5BR8K 3MN7A 3WT0A 1IBKK 2X6SA 2ATQA 1GLAG 2OANA 1BUPA 3FLCO 4B1WB 3VPZA 3EY1A 1Q18A 5CZ2A 4Z4IA 4OGCA 3HVTA 3LDPA 2KZZA 3FZMA 4KI6A 4PKIA 4C1NI 1JCFA 1QSYA 4WQ4C 4DS5A 1S6PA 4JKCA 2NRTA 3C6HA 1VQMN 3LALA 4JKDA 2HHSA 3TAMA 4J2AA 1OVQA 1RTJA 1O1WA 4UY8O 3CJCA 1GLDG 3CXCM 3ZT1A 4FJHA 3OJUA 4CJQA 1DLOA 3SUOA 3C94A 4IXCA 4A62A 1GLFO 4BR4A 3H45C 5AQFA 1C0GA 4CD1A 4E89A 3S9HA 2V7ZA 4CJ3A 1KFDA 1R59O 5E41A 4AILC 1IKXA 1S1TA 3KWIA 3NGZA 2YHWA 4KFBA 3ZSQA 4YOWA 4Z94A 1RBSA 5JMVA 2HW3A 4U67L 2QA4N 1EO1A 1XHZA 3VQ7A 1L5UA 4I2QA 2E5LK 4QS7A 3HXMA 1SKRA 5BREA 2IDOA 2G8KA 2E8AA 3NMUA 3QICA 4IO8A 4CEFA 4BVPA 3WQUA 4IDKA 4EAHD 4KHPK 4DQ8A 3V6DA 3ZSXA 1W7AA 4DTOA 1Q7YO 4NXMK 1R0AA 2D4WA 3SBGA 1KC8O 1EWRA 2DY4A 4KHYA 3BEXA 5CYMA 1SKWA 5JICA 1N32K 3ZEUB 1VSFA 3ZEUA 3CC2N 3MAQA 3TSUA 3QBWA 3T1HK 4BDYA 1J9AA 4CIFA 4GVEA 2HBKA 2FBTA 4GW6A 4CZHA 4CEEA 3U6FA 4C1NK 1JL2A 1E4FT 3CJBA 3ZT3A 1IG9A 3V4IA 1NKCA 2HHWA 3ID8A 5C42A 3VQCA 1YI2N 1DT9A 1SAZA 5KI6A 3THWB 2YNHA 4CEOA 3LDSA 4AH9A 5I9EB 2ETJA 4GMJB 1NJXA 3THWA 4FM2A 3MEEA 2OCEA 1KAZA 3BF3A 1NU0A 2ZF5O 1IG8A 4ILJA 3ITHA 3DXMB 4KBOA 4YOUA 3DXMA 3J7YP 1CXQA 4FWNA 1E4GT 1VQ4N 4H0OA 3CHWA 3GG4A 4Z4EA 3NFAA 4K43A 1KCFA 1Q81O 3CD6N 4N56A 1BHLA 2I7NA 4FO0A 3SPZA 1T6CA 3G71N 4FW2A 4G1QA 2O4IA 4JKGB 4KHUA 3MK6A 2B4JA 4DV0K 5M1OA 1UOCA 1JLCA 4JI8K 4J8FA 4WQ5A 3D2EB 3M5RA 2CGLA 1V4TA 3TPQA 2PY5A 3Q7BA 3PX4A 1UA1A 1L3TA 4PY5A 2Q0RA 3C0BA 4LSLA 3V1RA 5KGXA 2Y1JA 1TL3A 1JLFA 3CQ8A 1KLMA 1D8YA 1HR0K 5ADXH 1YIJN 4CFDA 3R3LA 5J2MA 2P9SB 5HLFA 3IS9A 3I8DA 2P9SA 3AARA 3JYTA 3LDLA 2UUAK 3ATVA 3SMSA 3LM2A 4OPHA 1XWLA 3J81O 3SPYA 4BRLA 1RT6A 4OVLA 2OPPA 3ZX0A 1P8ZA 3PX6A 2Q1NA 1VQKN 3AVJA 3AAQA 1U6ZA 2VWBA 4I7FA 3HT3A 3KLFA 5CE3A 3V9ZA 4DLEA 1WSHA 4NLBA 3WXJA 1HUXA 2JWKA 4F2RA 2AJQA 2FF6A 2QTDA 4LFAK 3ENOA 3QERA 4FJ9A 3T69A 2E2PA 4CEQA 3DLHA 1BGXT 5M1NA 3VA0A 4H0PA 4CBUA 1C6VA 3L2UA 1YHQN 3AO4A 3P83D 4RTFD 5AQLA 1TKDA 4Z4HA 3TAPA 1CXUA 5J2QA 5AQZA 4RWTA 1QSSA 1CZAN 3AAPA 3AVLA 1NKBA 2F96A 2VQEK 1BIZA 1HNXK 4DFMA 3I8BA 4ID5A 3LL3A 2HF3A 1IH7A 2PZSA 1WLJA 2QWMA 4CGHA 1U47A 3CCSN 2F9TA 2LSNA 4HTUA 4FJLA 2E1ZA 1T03A 4DR6K 5AQOA 1BOTO 4C8KA 4JKEA 4DUZK 2QI2A 3NGYA 1EETA 2QKKA 4OKEA 3DWLA 2P9PB 3OVNA 4NXNK 4O44A 4CE9A 4H4MA 2G8VA 1KTQA 4FWSA 3ULEB 3HOSA 1IV0A 3EZWA 3CFRA 1U45A 1IO2A 3VQ4A 2PYLA 4BQZA 3ULEA 3BP8A 2NUBA 3EKSA 3DRPA 3SZ2A 1NK8A 4B3RK 4CJKA 4Y1DA 4FK2A 1J6ZA 3EE9A 3G6EN 2GEMA 5HBMA 3QFUA 4M63C 5JVGL 3D7EO 3QEWA 4DSKA 4MQ3A 4E0DA 1RTIA 4OLAA 5FPDA 4I6MB 3AGRA 4BDPA 2HHUA 3NDKA 3CCMN 3DM2A 4DTMA 4CIGA 2E2OA 5C25A 1YITN 3OYNA 4H03B 3VESA 2QEXN 4Z0UA 4H5NA 4W5RA 1HJRA 4BC2A 3UKUB 3VENA 1BA0A 2NRVA 2GWKA 3UKUA 5HRSA 4KTZA 3OJSA 4H5WA 5AJ3K 3KK7A 2OPRA 4ZTFA 5HRPA 4CFBA 3H46O 2RKIA 4KHWA 1BQMA 3QETA 1SL2A 5F1XA 1FK9A 1WSEA 5F2RA 1RBVA 2HNYA 4X65K 3KD5E 5AQQA 1Q9YA 3OYCA 2BTFA 4HCCA 2UXDK 3ZYYX 2PBDA 1WSIA 4DR4K 3DOLA 3OYIA 3G25A 3UKRB 1GLBG 1X1PA 3CYMA 3U9ZA 5AQGA 3ZSZA 4B3TK 3NVMA 3VQ5A 2KFNA 3JS6A 3QLHA 5AQNA 2I5JA 4BRHA 1BU6O 3VOVA 3G0ZA 4HCBA 1I3AA 2QXFA 1TYQB 3ZCMA 1TYQA 4A59A 3M8RA 1YJWN 1N33K 4LF4K 3HP6A 4CI6A 1NJIO 2JGUA 4BRAA 1G99A 4NCGA 4KB1A 4DSIA 4M3RA 3L2VA 2XO7A 3HM8A 3L8BA 3WXIA 4BG9A 2ZJQL 1TAUA 4RG8A 5I3UA 3V9UA 3C6UA 3TI0A 2HMPA 2YJEA 4G9ZA 4CHPA 4ZHRA 4FWPA 1NMDA 1GOBA 2V7YA 4JK8A 3OYLA 4DTSA 3HM9A 4JEPA 5GIOA 4IOAL 1RT3A 2VG7A 1HKGA 3SV4A 4FZYA 3IG1A 4TSXA 3RMCA 3P1GA 1IKWA 4JRQA 1GOCA 4QOZB 4LF7K 2P9NA 4JKBA 1HRHA 4JI7K 4JI2K 3V1OA 4FLVA 1ZXOA 5EX5A 4CERA 4PWDA 1BL3A 4CJRA 2VG5A 5AFUA 1MWKA 5KPTA 3TTCA 4CZKA 1NGGA 4KHNA 4O55A 1YF5L 2PAVA 4UQGA 1HLUA 3RRGA 4DTUA 2XHBA 3HPHA 3E1YA 2XRIA 2DPNA 1BI4B 3AO3A 2ZJPL 4L3QA 1YUWA 2D0OA 4YOVA 3SBTA 2ZJRL 3VF2A 4ELVA 3KK3A 4DKWA 2E88A 4WQ5C 3TAQA 1N36K 2HHXA 2FF3B 3DOKA 4CZFA 4JD2B 4H0TB 4QS9A 3AVNA 4JD2A 4BR7A 1OH8A 4KV8A 4DTJA 5T7BA 1I94K 1VQ6N 1QHAA 4KH4A 4LFBK 1JCEA 4DUYK 3GOIA 4F3TA 4A2BA 1K6YA 1ASWA 1FW6A 1ITGA 3F5TA 4KO0A 1SQKA 4JKHA 4LH5A 2YHYA 5C12A 1A5WA 1C1CA 2YHAA 5AQWA 4FWMA 2A1RA 4CJPA 1JLGA 4IFVA 3SNNA 1VSHA 5FRMA 1NGCA 1SS6A 4JI3K 2BGGA 4ILGB 3JXUA 4B1YB 4CCHA 2IS3A 3S3OA 3AGKA 1UA0A 4KTQA 5CZ1A 4IEIA 3VEVA 2EWSA 3K5LA 3IFRA 4B1VA 4BGAA 2IVPA 5BRFA 4DU1A 1NJZA 3NE6A 1NK6A 4R79A 1KQSM 4B1XB 3VQ8A 3WEEB 1VSDA 1OH6A 2HHVA 3THVA 3LM9A 1W0HA 2AP1A 3WEEA 4LFCK 1S3XA 3R8EA 4AM7A 3MWTA 4C8LA 3SAGA 3PSIA 3CJ9A 3VN5A 4HUGA 3PLAA 3NBPA 4JKFA 1QVGM 3M8PA 3NF9A 4E1MA 1HNVA 5JLFA 3D0PA 4E7KA 1RBRA 3ENBA 5BN8A 3AY9A 1DGKN 1BCMA 3CPEA 2BDPA 5HRNA 1HX1A 1NGEA 3CCRN 4CZLA 1VQ9N 1BA1A 3CCLN 2B6AA 2DFHA 2YNFA 2G8WA 2IGIA 3S41A 4EHTA 4EP5A 2HBMA 2Z1HA 2W41A 1Q9XA 1WOQA 1WBDA 4JI1K 2YNGA 3BUZB 2ZD1A 4CJTA 1YTUA 2XY8A 2GTDA 3VF4A 3OW2M 4IOCL 2X74A 4JI5K 2RPIA 4QCLA 4K42A 5KRSA 4DV1K 2Y1IA 4DF8A 1FXXA 2BH1A 4DCHA 2XY6A 4AHVA 4AM6A 4DWIA 4KREA 2HSTA 1U49A 1KXPA 3K0SA 2O8EB 4BR5A 5F0XA 3M8SA 3MEGA 4DR2K 3ALYA 4RW6A 3NH0A 3V9SA 4B3OA 2WC9A 3HO1A 2NRXA 3LP1A 4RCHA 3QNNA 4FL9A 3K9KA 4FWLA 1YTAA 3F2KA 3BZCA 1YAGA 5HROA 2ASMA 3OYFA 2OYQA 2HVHA 2Q97A 3FZKA 2W6KA 3OYGA 3F73A 3ENHA 1EXQA 2G8HA 4WFNL 4DV4K 1JL1A 4IO9L 1HNZK 4B9LA 1NM1A 3EEQA 3F9KA 2RE2A 3TSPA 3VQAA 5E84A 2A42A 2ZM6K 4M3XA 1ASUA 2OA8A 4BRKA 3O9QA 4WFBL 4FLYA 3HK2A 2KZMA 3KLGA 5LMUK 3HYFA 3DAWA 4ISGA 3B6PA 4JS4A 5DM6L 1W2BM 3R1XA 4M7YA 3RRHA 2O8CB 4LD0A 2BANA 3LPTA 4E1JA 4BRMA 5HP1A 3HSCA 3A5OC 4JI6K 2O8CA 4M41A 3S3MA 3KZBA 4ICLA 1RT1A 2RN2A 4NYFA 3WNGA 1KAYA 3A5LC 4LF6K 1RTHA 1TK5A 3RR8A 2D0BA 2UUBK 3RWUA 3AVCA 2QWRA 3NGIA 1T3VA 4DV5K 1SL1A 3ZSOA 3VEYA 1Z26A 2BUPA 4OGEA 5LJWA 2WONA 3LZJA 3FGUA 4NYNA 1YXQA 5AQSA 1S22A 3NHGA 4OLBA 2YKMA 3RR7A 1HMVA 4E1NA 3LDOA 5CYQA 4GY2B 4O8UA 3DLEA 2O8DB 3VGKA 3PV8A 4N76A 3J7AP 1NK4A 1LW2A 4FVMA 3AA3A 1Y64A 3K9JA 1KRPA 3ZLJA 4BGBA 5IT9O 5LMNK 1TVRA 4CFAA 2HB5A 4YOYA 2FC0A 4YOXA 4O5BA 4DQIA 3E01A 5KPZA 5EU7A 3KLEA 4OKJA 4W5NA 4O4GA 5J2PA 4WFAL 1QQMA 3C6TA 5AQXA 2KQ2A 3O4NA 2DFFA 4LSNA 2HNDA 2F7TA 2BE2A 4IZ9A 2YNIA 4O5FA 1U2VB 2R7YA 3CF5L 4FJ8A 1U2VA 1VSLA 1XQSC 1T7PA 2EHGA 3MXMA 1SL0A 1IBMK 3D45A 4DTNA 5AQRA 3SK3A 4IKFA 3O4QA 4FJ7A 2QWQA 4O0JA 5LJVA 4DTXA 3LAKA 1N8RO 2E4LA 4A5BA 2F8TA 1VQPN 1GOAA 3VTHA 1E3MA 3ID6A 4JKGA 3AA4A 3SV3A 1JLEA 3VQQA 1ATRA 2QKBA 4YDUC 4PHTX 4CHYA 3D2EA 1YT3A 4DV7K 1HJOA 4M3TA 5EXWA 3BF1A 1KVBA 4BRQA 3WUHA 2V52B 2VGMA 2NRHA 4CGDA 3VMFB 4AHRA 4YOTA 1C0FA 3QB0A 4LF9K 3LP2A 1KFSA 4BC4A 5AQJA 3O3FA 4C8OA 1RFQA 1Z05A 3THXB 4CGFA 3CCVN 1RDUA 4EZ6A 4CGGA 2FSJA 1ZBHA 4FZZA 4Q5VA 4Y0WA 5ADXA 1A5XA 1NGHA 3TAGA 4GV9A 3MN5A 3A2FA 1NGBA 1O13A 1D9DA 1HYVA 5AR0A 4DTPA 1W9HA 1IJJA 4CJFA 4DFPA 1KVCA 4FLUA 4FK0A 3K57A 4DQQA 1I39A 5DK5A
chains in the Genus database with same CATH topology
4FPAA 4BRHA 1BU6O 3O1BA 4MLEA 5FPNA 1XC3A 3VOVA 2E20A 2YHXA 5TKYA 5BRHA 4WCEL 3MX2A 1TYQB 3N4PA 2JWLA 4H5TA 3O5BA 1QVFM 1TYQA 4BR9A 1KAXA 4A59A 1YJWN 4CI6A 1NJIO 5AQMA 3H3OB 4BRAA 1G99A 4FWOA 1EQYA 4BG8A 1VQ7N 3HM8A 3WXIA 4NO7A 4BRNA 2QXLA 3GE1A 3VERA 4BG9A 4IJNA 3VGMA 5MLCQ 2ZJQL 1TUYA 4CBXA 4BR0A 4BRDA 1QZ6A 3H1VX 3IDHA 4CZGA 2QWLA 1BWFO 2HMPA 3WXLA 2YJEA 4G9ZA 2D1KA 1BO5O 5C2DA 3QMLA 4K41A 2Q0UA 3VF6A 3J8AA 4FWPA 3CQXA 4PL8A 3FFKB 1NMDA 2V7YA 4JK8A 1NGIA 2HBLA 3VTIA 4WYBA 3A0IX 4FPBA 5HOOA 3CIPA 3C6AA 4FWQA 4MLHA 4JEPA 3M6GA 5BRDA 5GIOA 4IOAL 4OO1J 1ATSA 3F9MA 3WXMB 1BDGA 4IDHA 4IFEA 1YJNN 1HKGA 3MX5A 1NLVA 2NNWA 1K8KB 4FVUA 3QDKA 4IJAA 2CH6A 1K8KA 1Z6RA 2IIRA 2PFUA 3L0QA 5AQVA 3H6EA 3TU5A 2ZGZA 3D2FB 4BC3A 4BRCA 4DB3A 2P9PA 4XH4A 3MWPA 2P9NA 4JKBA 3D2FA 3R9PA 3SMPA 4BY9C 1ZXOA 5EX5A 3A5MC 3U8XA 1RDWX 3MN7A 3WT0A 3MN9A 3FE1A 3KVGA 1MWKA 2D0PA 4O8KA 5AFUA 3I55N 3D6RA 1Q86O 5KPTA 1GLAG 4PKHA 2OANA 3TTCA 4CZKA 1BUPA 1NGGA 3FLCO 3CCQN 3KWGA 4B1WB 5BPLA 1YF5L 3IUCA 4FWKA 3VPZA 2PAVA 1HLUA 1NBWA 1Q18A 3VEOA 3C7NB 1X3MA 4CZMA 3CMAN 2P9LB 4WF9L 5GAEP 3C7NA 3E1YA 3LDPA 2DPNA 3ATUA 2ZJPL 3FZMA 4L3QA 4PKIA 3ZX3A 1YUWA 4C1NI 2D0OA 3CPWM 2ZWHA 1JCFA 4FWRA 4I6MA 4YOVA 4WQ4C 3SBTA 5E26A 1GLEG 4JKCA 3W0LA 2NRTA 3C6HA 4ISEA 3VF2A 2ZJRL 1VQMN 4JKDA 1QZ5A 4DKWA 2E88A 4WQ5C 4B1ZA 4MDBA 5FPEA 2FF3B 4CZFA 4JD2B 3O6WA 4H0TB 1HKCA 4QS9A 4UY8O 3CJCA 1XUPO 1GLDG 4JD2A 3CXCM 2YX6A 4BR7A 5EVZA 4IXCA 5AZJB 1VQ6N 1QHAA 1GLFO 4A62A 4KH4A 4BR4A 1TUUA 3HRGA 1JCEA 3H45C 3GOIA 5AQFA 2FLOA 1C0GA 2A41A 3L4IA 4FOEA 4A2BA 4CD1A 1ZBSA 2V7ZA 3A5NC 3RVCA 4EHUA 3F5TA 1SQKA 4JKHA 1JCGA 3CJ7A 3EE8A 2YHYA 5C12A 1R59O 3J7ZO 2RHKA 3KWIA 3N4QA 2YCHA 2YHWA 5AQWA 4FWMA 4YOWA 4Z94A 5JMVA 4U67L 2QA4N 1EO1A 3O9RA 3CETA 1S72N 1NGCA 1SS6A 5BPMA 4ILGB 3JXUA 1DEJA 3UKRA 3VEXA 4B1YB 4QS7A 3C65A 5HL7L 3SAHA 5JVHL 5BREA 3FR0A 4F9OA 5TKWA 2E8AA 3NMUA 3AGKA 3QICA 1K9MO 4IO8A 3R6MA 4BVPA 2HBJA 3P39A 3WQUA 4GV6A 3CC7N 4IEIA 3VEVA 4EAHD 3M3ZA 2A6AA 1ATNA 2EWSA 4GV3A 2A5XA 3IFRA 4B1VA 3OHRA 4DQ8A 1QQOA 4BGAA 2IVPA 5BRFA 5M1KA 5AZIB 1Q7YO 3HBTA 3H1QA 4B1UB 1VQNN 2OTJN 5AZIA 2D4WA 4M7XA 3SBGA 3E66A 4CD3A 1KC8O 4BRGA 4R79A 2CH5A 2QWNA 1KQSM 4B1XB 3WEEB 1VQ5N 5AQPA 3LM9A 3BEXA 2AP1A 4XH1A 3WEEA 3DLLL 1S3XA 5JICA 3R8EA 3UE5A 1YJ9N 1P90A 2A40A 3CI5A 4AM7A 3GBTA 3MWTA 3OA9A 3RSEB 3SAGA 3ZEUB 3CJ9A 1ZC6A 1HKBA 3B8AX 3RSEA 2IVNA 3ZEUA 3CC2N 3PLAA 4JKFA 3QBWA 3TSUA 4JHDB 1HPMA 1QVGM 1NGJA 3MN6A 3KHYA 4JHDA 4GVEA 4JN4A 1MWMA 3O80A 2HBKA 5JLFA 5BN9A 4BVOA 4ILHA 5BN8A 3ENBA 2YI1A 4LC9B 3AY9A 1DGKN 3CPEA 4CZHA 3MCAB 5EOYA 3VEWA 4C1NK 1QQNA 2QWOA 5GAHP 1E4FT 3CJBA 4JK7A 1MA9B 3EKUA 3O4WA 3O9SA 3PIPL 1HX1A 1NGEA 2I7PA 3CCRN 1NGFA 4CZLA 3IMXA 4BROA 1VQ9N 1K8AO 3MMVA 1BA1A 3CCLN 3QBXA 3ID8A 2GELA 1M90O 5LY3A 1YI2N 1WUAA 1DT9A 1SAZA 3S41A 4EHTA 3ZETB 5KQ8A 3VETA 1D4XA 2HBMA 5I9EB 3ZETA 4A61A 2FXUA 2W41A 5FPMA 1WOQA 2KKZA 5BPNA 1VQ8N 1KAZA 2Q31A 3BF3A 3BUZB 2ZF5O 1LOTB 2P9IB 5GIPA 1IG8A 4ILJA 2GTDA 1OKJA 3DXMB 3VF4A 3OW2M 1NGAA 4IOCL 4KBOA 4YOUA 3DXMA 2GWJA 1BG3A 4K42A 2P9LA 1K73O 3A8YA 4U7BA 1GLCG 4FWNA 2BH1A 2CGJA 4DCHA 1E4GT 1VQ4N 4H0OA 3CHWA 3GG4A 4PKGA 4AM6A 3LDQA 2QWPA 2HSTA 4FOIA 2AA4A 4CJ7A 1KXPA 4A57A 4K43A 1Q81O 3CD6N 2HOEA 4BR5A 3W3DA 5GINA 5F0XA 4YDUA 4YORA 5ELZA 2I7NA 4FO0A 1T6CA 3G71N 3CJ1A 2KLAA 2WC9A 2WUSA 4BRIA 3GDQA 4H5VA 4WQ4A 2NRXA 4JKGB 3MK6A 4RCHA 3K9KA 4FL9A 5M1OA 3O9TA 4FWLA 3F2KA 1YAGA 2P9UB 1RGIA 4J8FA 4WQ5A 2ASMA 3WXKA 3D2EB 3M5RA 2GUPA 2CGLA 2P9UA 2Q97A 1V4TA 3FZFA 3TPQA 3FZKA 1MDUB 3Q7BA 1Q82O 2Q0RA 3ENHA 5AZJA 5H1SQ 3C0BA 4K25A 4WFNL 2P9KB 5BR9A 5C10A 4IO9L 1YVNA 2P9KA 1NM1A 5EY4A 3VEZA 2RE2A 3TSPA 5E84A 2A42A 3E9LA 4A2AA 3U9DA 5AQKA 5GAGP 4BRKA 2ZGYA 3O9QA 5ADXH 5KQDA 1YIJN 4WFBL 3CCJN 3R3LA 4JK9A 5AQIA 2P9SB 5GADP 3DAWA 4ISGA 2P9SA 3AARA 2UYTA 3LDLA 3WQTA 5DM6L 1W2BM 3R1XA 4M7YA 3ATVA 3SMSA 4E1JA 4FSVA 4BRMA 3LM2A 4OPHA 3HSCA 4XH5A 5C15A 3A5OC 3OBWA 4BRLA 3KZBA 4JKAA 3ZX0A 1P8ZA 1KAYA 3A5LC 3EL2A 2Q1NA 1VQKN 2Q2RA 1VQON 2VGNA 3E9OA 3P4IA 1M1KO 1VQLN 3AAQA 1U6ZA 2VWBA 2QWRA 3Q7CA 1T3VA 3NVKA 3FZLA 4EIAA 3VEYA 4JAXA 3G4SN 3CMEN 5AQHA 2BUPA 5LJWA 5C0YA 1GLLO 2NRRA 5CE3A 3P38A 3TTFA 3FGUA 4NLBA 1YXQA 3WXJA 5C2FA 3OBYA 5AQSA 2YJFA 1HUXA 2JWKA 1X9JA 3VGLA 3SAFA 3PIOL 2FF6A 2QTDA 4A5AA 4GNIA 1S22A 4BR2A 4BC5A 3ENOA 2ASOA 3T69A 4KH6A 3H3NO 2E2PA 4IOXA 3LDOA 3CC4N 4GY2B 5M1NA 4O8UA 4H0PA 4PL7A 4CBUA 1NGDA 3VGKA 3HTVA 4CZEA 5CR4A 4IEEA 1YHQN 1SZ2A 4RTFD 5AQLA 4EFHA 1Y64A 3K9JA 4MO4A 4BGBA 1H1VA 2QW9A 4H5RA 4YOYA 5AQZA 4YOXA 2Q36A 4RWTA 1CZAN 2IVOA 5KPZA 3AAPA 5DM7L 2NRWA 3I8BA 5M1QA 3O8MA 3LL3A 2HF3A 1NWKA 4WFAL 2QWMA 3M1FA 1QQMA 1KD1O 3CCSN 2F9TA 2W40A 5AQXA 3ZX2A 2E1ZA 3CQYA 3CCUN 4HTLA 2QM1A 5AQOA 1BOTO 3P31A 4XEIA 5AFUH 1ILYA 3I56N 3EN9A 4JKEA 3O08A 2F7TA 2QI2A 2P9IA 4IZ9A 3TSQA 2FSNA 3DWLA 2P9PB 4DHYA 4O5FA 1U2VB 3HI0A 3I33A 2P9NB 5AQYA 3CF5L 2A3ZA 5M1FA 1GLJO 3L6QA 1U2VA 4FWSA 1W97L 3TTDA 3ULEB 3HOSA 3EZWA 5KPRA 4BRPA 2WFBA 1T44A 1XQSC 3CCEN 4BQZA 3ULEA 3BP8A 3EKSA 2H3GX 4H0VB 5AQRA 2FSKA 4OPAA 3SK3A 4CZJA 1J6ZA 1T6DA 3EE9A 2J4RA 2QWQA 5LJVA 1ESVA 3MCPA 5AQTA 3G6EN 4H0YB 1N8RO 4A5BA 2GEMA 1DKGD 1VQPN 3VTHA 5M1PA 1VAZA 4BRFA 3QFUA 4H0XB 2NZTA 4M63C 4C23A 3ID6A 3D7EO 4ISFA 4KH5A 4JKGA 2VCPA 5JVGL 2OTLN 3FZHA 4BREA 1JJ2M 3DJCA 1ATRA 2E1YA 4JNEA 3O1WA 4YDUC 4PHTX 3CJAA 4I6MB 3AGRA 4NB4A 3D2EA 5FPDA 4MO5A 2NRZA 3CCMN 1HJOA 3DXKB 2V51B 3SLCA 2E2OA 3DXKA 4NLCA 3BF1A 5EXWA 3T7ZA 4BRQA 5AQUA 2GX9A 2E2QA 2V52B 3U4LA 2VGMA 2ITMA 3WUHA 2NRHA 1YITN 3VMFB 4YOTA 4H03B 3HOTA 3VESA 2QEXN 1C0FA 3GL1A 3QB0A 4H5NA 3LDNA 4B9QA 4BC4A 4AF1A 4BC2A 3UKUB 4QS8A 4BQLA 5AQJA 2VYPA 5B8HA 2NLXA 3VENA 5JLHA 5CHIA 1BA0A 2NRVA 2GWKA 2HF4A 3UKUA 4MDAA 3HZ6A 2CGKA 3MDQA 4H5WA 3KK7A 1RFQA 1Z05A 1OVYA 1V4SA 3H46O 3CCVN 1RDUA 3IKMA 2FSJA 1X3NA 1LCUA 4HWIA 3E9PA 5F1XA 5F2RA 3SJHA 4Y0WA 5ADXA 3QFPA 4CZIA 3EO3A 5AQQA 1NGHA 4GV9A 3MN5A 2BTFA 1NGBA 1O13A 5AR0A 3UB5A 3ZYYX 2PBDA 3G25A 1IJJA 1GLBG 2KHOA 3O9UA 3U9ZA 5AQGA 3UKRB 4CBWA 3NVMA 2F9WA 3JS6A 3L4QA 5AQNA 4IWVA 3CERA 2E2NA 2WBNA 2ASPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MX5 A;  3R3L A;  4GV3 A;  3MWP A;  3Q7B A;  4FVU A;  4GVE A;  4GV9 A;  3Q7C A;  4G9Z A;  3MX2 A;  4GV6 A;  3MWT A; 
#chains in the Genus database with same CATH topology
 3O1B A;  4MLE A;  4DQR A;  2VG6 A;  5TKY A;  3N4P A;  2JWL A;  4H5T A;  3HP9 A;  2HHH K;  3V9W A;  4B9V A;  4CEC A;  4M3U A;  4BAC A;  2XY5 A;  3HPG A;  4F4K A;  4OPJ A;  3H3O B;  3OTO K;  1EP4 A;  4C8N A;  1VQ7 N;  3DLK A;  4CJS A;  4FM0 A;  4BRN A;  2QXL A;  3GE1 A;  4IJN A;  4Z4F A;  3SUQ A;  1TKX A;  4ZTJ A;  4BRD A;  3IDH A;  4CZG A;  1WN7 A;  5K14 A;  1JLQ A;  2XY7 A;  1U04 A;  1BIU A;  3J8A A;  3TAB A;  3FFK B;  3HST B;  3I0S A;  4WYB A;  3C6A A;  2A1S A;  4FWQ A;  2YV0 X;  4Z4G A;  3M6G A;  3ZSR A;  1ATS A;  1TL1 A;  3F9M A;  3WXM B;  1BDG A;  4FM1 A;  1ZBL A;  3MX5 A;  1NLV A;  3RMD A;  1EX4 A;  4IJA A;  2CH6 A;  3L0Q A;  2PFU A;  2IIR A;  5AQV A;  4FLT A;  3H6E A;  1ZBU A;  2X6N A;  3D2F B;  4KHS A;  2P9P A;  1RDA A;  3MWP A;  5FDL A;  3D2F A;  3T1Y K;  4GVM A;  3A5M C;  3U8X A;  1RDW X;  4CHO A;  4CJE A;  3KVG A;  2D0P A;  5A2Q O;  3OYK A;  3CCQ N;  4CHQ A;  4FJG A;  1LV5 A;  5BPL A;  1RT7 A;  3VEO A;  3QEI A;  1X3M A;  1WSF A;  4CZM A;  3CMA N;  2P9L B;  1VRU A;  4WF9 L;  2F4V K;  1Z25 A;  4CW7 B;  5DMR A;  3PO4 A;  3OYD A;  4CK1 A;  3ZX3 A;  4FWR A;  4I6M A;  1TKZ A;  5E26 A;  4CIE A;  1QZ5 A;  4B1Z A;  4MDB A;  4CHZ A;  1QE1 A;  4B9S A;  1YVU A;  1WB9 A;  2YKN A;  1G15 A;  3PSF A;  4O0I A;  5AZJ B;  1TUU A;  3MEC A;  1JKH A;  1VHX A;  3L4I A;  4EHU A;  3L3U A;  1JCG A;  3CJ7 A;  1LWF A;  3TAN A;  1MU2 A;  2YCH A;  2B5J A;  1XI1 A;  3O9R A;  1S72 N;  3UKR A;  3VEX A;  3C65 A;  3SAH A;  5JVH L;  1K9M O;  1RDC A;  4JV5 K;  2HBJ A;  3P39 A;  1LAV A;  1T05 A;  3TWH A;  3CC7 N;  4GV6 A;  3M3Z A;  2A6A A;  4GV3 A;  1XHX A;  2A5X A;  4CJV A;  1QQO A;  5M1K A;  5AZI B;  3HBT A;  3H1Q A;  4B1U B;  2OTJ N;  3DRS A;  5AZI A;  4M7X A;  3ZT0 A;  4DR1 K;  4JI0 K;  2QK9 A;  2Z1G A;  3OYA A;  4W5Q A;  2HHT A;  3UE5 A;  1D9F A;  1P90 A;  3CI5 A;  3OA9 A;  4OPK A;  3B8A X;  1TK0 A;  3AVK A;  2IVN A;  4KTW A;  2ZQB A;  4YFU A;  4CEZ A;  2P5G A;  4DV6 K;  3KLH A;  1REV A;  1QHT A;  3O3H A;  3MN6 A;  4JN4 A;  1FKP A;  1MWM A;  3O80 A;  3VA3 A;  1IKV A;  5BN9 A;  1NK5 A;  4ILH A;  1VSI A;  4LC9 B;  3MCA B;  3VEW A;  4BE2 A;  2QWO A;  4JK7 A;  1B9D A;  1MA9 B;  3OYJ A;  1CZB A;  3OYH A;  1NK0 A;  1K8A O;  4XIU A;  4LH4 A;  3QBX A;  5SZT A;  1WUA A;  3ZET B;  5KQ8 A;  3ZET A;  4A61 A;  2FXU A;  5FPM A;  3PO5 A;  3V1Q A;  1VQ8 N;  2P9I B;  1L3S A;  4AHU A;  4CJ5 A;  3NH2 A;  1NNE A;  2GWJ A;  1U4B A;  4HUE A;  5SWM A;  1BG3 A;  4B08 A;  3A8Y A;  1SV5 A;  4U7B A;  2PYJ A;  1SUQ A;  3HPO A;  1BI4 A;  4PKG A;  3SUN A;  1NJW A;  3NH1 A;  4I2P A;  3W3D A;  4YDU A;  4YOR A;  4DFK A;  3CJ1 A;  2KLA A;  2WUS A;  4LY7 A;  2G8I A;  4J2D A;  2OPS A;  1DTQ A;  3O9T A;  1RGI A;  3WXK A;  4DSE A;  3FZF A;  1HYZ A;  1MDU B;  4CED A;  4K25 A;  4N41 A;  5C10 A;  1YVN A;  4X62 K;  4NCA A;  3SQ4 A;  4FK4 A;  3VEZ A;  2OZS A;  1WBB A;  3UIQ A;  3ASM A;  4A2A A;  3L2W A;  3U9D A;  5GAG P;  2Z1J A;  2P5O A;  1Y97 A;  5KQD A;  3LWM A;  3CCJ N;  4JK9 A;  5AQI A;  2UYT A;  2FBY A;  3WQT A;  3QIO A;  4FSV A;  4XH5 A;  5J1E A;  3NCI A;  3FFI A;  1S1X A;  3VQ6 A;  5CY4 A;  4JKA A;  1RT2 A;  4HVJ A;  4DLG A;  3AVB A;  2Z1I A;  3EL2 A;  4M45 A;  2Q2R A;  2VGN A;  2Q3S A;  3E9O A;  1VSE A;  4B3M K;  4EIA A;  3KD1 E;  4X64 K;  2UUC K;  3G4S N;  3CME N;  5AQH A;  3K5N A;  1HQU A;  4KHQ A;  1GLL O;  4CF8 A;  3P38 A;  3O3G A;  1C0U A;  1TKT A;  3RMA A;  3AA5 X;  3OBY A;  3VGL A;  1X9J A;  4A5A A;  4GNI A;  3VQP A;  4BC5 A;  3TAF A;  4PA1 A;  4J2E A;  1NOZ A;  3CC4 N;  4PL7 A;  1RBU A;  3QEV A;  1NGD A;  4BWM A;  1WSG A;  2D0C A;  3U3Y A;  4IEE A;  4LF5 K;  3AV9 A;  2QW9 A;  4H5R A;  4FJN A;  2Q36 A;  4C8M A;  3QEP A;  5HRR A;  5FRO A;  2NRW A;  4DV3 K;  5M1Q A;  3O8M A;  1QS4 A;  1VK0 A;  4EZ9 A;  3M1F A;  3WNF A;  1KD1 O;  2W40 A;  3CCU N;  3CQY A;  4HTL A;  2D0A A;  3AVM A;  3P31 A;  4XEI A;  1ILY A;  3QNO A;  1FJG K;  3TSQ A;  3HI0 A;  3I33 A;  2A3Z A;  5M1F A;  3THY B;  1GLJ O;  3L6Q A;  3TTD A;  1RBT A;  1RIL A;  5KPR A;  4BRP A;  2WFB A;  3THY A;  2HMI A;  3QO9 A;  3QES A;  4CJ4 A;  2H3G X;  3AA2 A;  1HQE A;  2FSK A;  4CZJ A;  4Z4C A;  2O8E A;  1ESV A;  5AQT A;  4DR3 K;  4CF0 A;  1DKG D;  4K8Z A;  4YY3 K;  1VAZ A;  3AVH A;  3CM6 A;  4H0X B;  2NZT A;  4C23 A;  3NAE A;  4ISF A;  2VCP A;  3OYB A;  1LWC A;  3FZH A;  3EZ5 A;  4BRE A;  1JJ2 M;  2KTQ A;  3DJC A;  2ITG A;  2E1Y A;  4JNE A;  3O1W A;  3CJA A;  1HNW K;  4IFY A;  4MO5 A;  2NRZ A;  1JXE A;  4F2S A;  2ITM A;  1TV6 A;  1NOY A;  1LAW A;  3GL1 A;  4DV2 K;  4B9Q A;  3ZSW A;  4BQL A;  5B8H A;  2NLX A;  2HF4 A;  3QIP A;  4MDA A;  4DF4 A;  2JLE A;  3MDQ A;  1RTD A;  4CJW A;  1QTM A;  4IBN A;  4WE1 A;  1X3N A;  4HWI A;  3E9P A;  2VWJ A;  4E7J A;  1TAQ A;  4ID1 A;  3SJH A;  1XMO K;  3QFP A;  3TAE A;  3EYZ A;  3NF7 A;  1S5J A;  1C1B A;  3LPU A;  2E6M A;  2E6L A;  4GKJ K;  4JLH A;  3I0R A;  5JS1 A;  1BQN A;  1C0M A;  1NK7 A;  2F9W A;  1C1A A;  4DTR A;  3L4Q A;  4IWV A;  3CER A;  2E2N A;  3LAM A;  5FPN A;  1XC3 A;  1N6Q A;  2E20 A;  1J53 A;  4WCE L;  3BY5 A;  1QVF M;  4DSJ A;  1KAX A;  3CFO A;  2UU9 K;  3LZI A;  3BDP A;  3DI6 A;  5AQM A;  1DTT A;  4BWJ A;  2FBX A;  3AVF A;  2O8D A;  4I9L A;  4FLZ A;  4NO7 A;  3K59 A;  4AHC A;  3VGM A;  3PY8 A;  4DS4 A;  4M3W A;  1X9S A;  1VSM A;  3KK2 A;  1HPZ A;  1VRT A;  1QZ6 A;  3H1V X;  2GUI A;  3WXL A;  4KI4 A;  4B9N A;  3QML A;  2Q0U A;  2YHB A;  4CES A;  3CQX A;  4PL8 A;  4X66 K;  4E19 A;  2HBL A;  3IAY A;  3A0I X;  3DYA A;  5HOO A;  3CIP A;  2W6L A;  3BGR A;  4MLH A;  4M42 A;  3KKR A;  4IFE A;  4CFC A;  2NNW A;  1K8K B;  4AQY K;  3QDK A;  4IG3 A;  1K8K A;  1Z6R A;  2G8F A;  4BRC A;  2WOM A;  4DMN A;  3R9P A;  3VQ9 A;  3SMP A;  1WSJ A;  1LW0 A;  3MN9 A;  3FE1 A;  4O8K A;  4KKO A;  3I55 N;  3D6R A;  1Q86 O;  5KTQ A;  4PKH A;  4JRP A;  3OYM A;  3KLI A;  2VWK A;  4FJ5 A;  3KWG A;  1JXB A;  3PX0 A;  1HYS A;  3ISN C;  1FKO A;  3IUC A;  4FWK A;  1NBW A;  3C7N B;  5GAE P;  3C7N A;  3ATU A;  3AO2 A;  3CPW M;  2ZWH A;  3JAM O;  4B3S K;  4RW8 A;  1F21 A;  1GLE G;  3W0L A;  4ISE A;  4DR7 K;  3U3G A;  3V81 A;  1S1U A;  4BDZ A;  4NCB A;  3OY9 A;  3SYZ A;  3C95 A;  5FPE A;  3O6W A;  1HKC A;  1N34 K;  1XUP O;  4CEB A;  2YX6 A;  4FZX C;  5EVZ A;  3K58 A;  3HRG A;  4KAZ A;  2FLO A;  2A41 A;  4FOE A;  3THX A;  1ZBS A;  4OX9 K;  3A5N C;  3RVC A;  4N5S A;  4DSF A;  3EE8 A;  3DLG A;  3SQ2 A;  3J7Z O;  2RHK A;  3N4Q A;  4M3Y A;  3OS1 A;  3PUF A;  3CET A;  2P1J A;  4BE0 A;  2HHQ A;  5BPM A;  1DEJ A;  5HL7 L;  3AVA A;  4B8A B;  3FR0 A;  4F9O A;  5TKW A;  1ASV A;  1NK9 A;  3R6M A;  5D3G A;  2FBV A;  1ATN A;  4DG1 A;  3S3N A;  3LAN A;  3OHR A;  1S1V A;  4H4O A;  1IBL K;  1VQN N;  4CVN E;  4RW9 A;  3OYE A;  3E66 A;  4CD3 A;  3P5J A;  3ZSV A;  4BRG A;  2CH5 A;  2QWN A;  3SCX A;  1VQ5 N;  5AQP A;  1L3V A;  1BCO A;  4XH1 A;  3DLL L;  1OH7 A;  1YJ9 N;  3KTQ A;  2A40 A;  3GBT A;  4E7L A;  2KW4 A;  3RSE B;  4K8X A;  1ZC6 A;  1HKB A;  1SKS A;  3RSE A;  2HNZ A;  1A5V A;  1WAJ A;  2F8S A;  3AO1 A;  4JHD B;  2RF2 A;  1HPM A;  1XMQ K;  1NGJ A;  3KHY A;  4JHD A;  4ELT A;  3KIO A;  4RW7 A;  1BIS A;  3M8Q A;  4BVO A;  3LP0 A;  1OH5 A;  2YI1 A;  5EOY A;  1J5O A;  4HUF A;  1QQN A;  5GAH P;  4JS5 A;  3EKU A;  3O4W A;  3O9S A;  4HHT A;  3PIP L;  4F3O A;  2I7P A;  1NGF A;  1ZYQ A;  3IMX A;  4BRO A;  4OKK A;  3L2R A;  3MMV A;  3RTV A;  4FJK A;  2GEL A;  4FJX A;  1M90 O;  5LL6 Z;  5LY3 A;  1D5A A;  3VET A;  4V19 S;  1D4X A;  4CK3 A;  4R5P A;  1X9M A;  4FXD A;  2KKZ A;  5BPN A;  2Q31 A;  1KLN A;  1LOT B;  3LWL A;  2X78 A;  5GIP A;  4LF8 K;  1OKJ A;  1NGA A;  1S1W A;  4CHN A;  3ULD A;  4ELU A;  3ZT4 A;  2G8U A;  2P9L A;  1K73 O;  1GLC G;  3ZT2 A;  2CGJ A;  4CF1 A;  1J54 A;  3LDQ A;  2QWP A;  4FOI A;  2AA4 A;  4CJ7 A;  4A57 A;  5KRT A;  2HOE A;  5GIN A;  5ELZ A;  4GKK K;  3JSM A;  4BRI A;  3G10 A;  3GDQ A;  4H5V A;  4WQ4 A;  1RT5 A;  3NF6 A;  2OZM A;  3DMJ A;  2P9U B;  4B9U A;  4FLW A;  4K0K K;  2GUP A;  2P9U A;  1EWQ A;  3QIN A;  3VQB A;  2WTU A;  1Q82 O;  5AZJ A;  1QSL A;  3B6O A;  5H1S Q;  2P9K B;  5BR9 A;  1RT4 A;  1CLQ A;  2P9K A;  4CGI A;  5EY4 A;  3E9L A;  3DRR A;  5AQK A;  1XC9 A;  2ZGY A;  5KGW A;  5C24 A;  3K5M A;  3HVR A;  4QAG A;  3MXI A;  3T3F A;  5GAD P;  1L3U A;  2VQF K;  3KKS A;  4YHH K;  3T1A A;  5C15 A;  3OBW A;  3SQ1 A;  4Y1C A;  1S9G A;  3SUP A;  1B9F A;  4E7H A;  3QEX A;  4FW1 A;  4DR5 K;  2IOC A;  1C0T A;  1VQO N;  1ZBI A;  3P4I A;  1M1K O;  1VQL N;  5JS2 A;  3Q7C A;  3NVK A;  3FZL A;  4JAX A;  5IWA K;  1X9W A;  5C0Y A;  4RW4 A;  2NRR A;  3TTF A;  3AVI A;  5C2F A;  1EKE A;  2YJF A;  3PIO L;  3SAF A;  4BR2 A;  1RDD A;  1UAX A;  3NF8 A;  2ASO A;  4KH6 A;  3H3N O;  4IOX A;  1KVA A;  3HTV A;  4CZE A;  5CR4 A;  5FRN A;  1SZ2 A;  4EFH A;  4MO4 A;  3AO5 A;  1H1V A;  4CEA A;  4FCY A;  1S6Q A;  4AHS A;  3K2P A;  4FJM A;  2IVO A;  3KK1 A;  1KSP A;  5DM7 L;  1WAF A;  2O8F B;  2D5R A;  1NKE A;  1NWK A;  2O8F A;  4DSL A;  3DLR A;  4IG0 A;  2O8B B;  3MED A;  4OJR A;  3MXJ A;  3ZX2 A;  3OS2 A;  2O8B A;  4YNQ A;  2QM1 A;  3V9X A;  4L8R B;  1RCH A;  5AFU H;  4FJJ A;  1JLB A;  4FYD A;  3I56 N;  3EN9 A;  3O08 A;  2P9I A;  2FSN A;  4CGJ A;  4DHY A;  3HL8 A;  2EX3 A;  1LWE A;  5AQY A;  2P9N B;  3RMB A;  3T19 A;  1W97 L;  2ZE2 A;  3J80 O;  1T44 A;  3CCE N;  4W5T A;  1HNI A;  3L3V A;  4DQP A;  3TAR A;  5J2N A;  4DFJ A;  4B9M A;  4H0V B;  4OPA A;  1T8E A;  4BE1 A;  1T6D A;  2J4R A;  1VSK A;  2GBZ A;  3MCP A;  3HJF A;  3IRX A;  4H0Y B;  4AHT A;  5M1P A;  4BRF A;  1TGO A;  4KH5 A;  2OTL N;  1U48 A;  2KFZ A;  1XNR K;  1NG9 A;  4NB4 A;  4W5O A;  3DXK B;  4EP4 A;  2V51 B;  4E3S A;  3SLC A;  3DXK A;  4NLC A;  3T7Z A;  3CG7 A;  2GX9 A;  2E2Q A;  3CM5 A;  5AQU A;  3U4L A;  2W42 A;  4MFB A;  4Q0B A;  3HOT A;  3TR8 A;  2DTU A;  3LDN A;  4KRF A;  3ZSY A;  4AF1 A;  1B92 A;  3LP3 A;  4B9T A;  4QS8 A;  2IC3 A;  2VYP A;  5CHI A;  5JLH A;  4KPY A;  3H08 A;  3HZ6 A;  2CGK A;  2OPQ A;  4KB0 A;  4PQU A;  1OVY A;  1V4S A;  3SJJ A;  2HVI A;  4FLX A;  3IKM A;  4CF2 A;  1LCU A;  3L2Q A;  2O4G A;  2IAJ A;  4JI4 K;  3VQD A;  3EO3 A;  4CZI A;  4F8R A;  1ZBF A;  4CJU A;  4N47 A;  1RNH A;  4J2B A;  3CFP A;  3UB5 A;  1WNS A;  2P51 A;  3WNE A;  2KHO A;  2DFE A;  3O9U A;  4CBW A;  3SQ0 A;  2WBN A;  2ASP A;  1NJY A;  1N5Y A;  4I9Q A;  4FPA A;  2YHX A;  5BRH A;  1S9E A;  4B8C A;  3MX2 A;  3BZK A;  4PUO A;  3O5B A;  4BR9 A;  2UXC K;  1XNQ K;  1TK8 A;  4CF9 A;  1IKY A;  4H8K A;  4DQS A;  4DU3 A;  3VQE A;  4CK2 A;  4FWO A;  1EQY A;  4BG8 A;  4JYA K;  4M3Z A;  3VER A;  5MLC Q;  1TUY A;  4CBX A;  4BR0 A;  2GV9 A;  1UWB A;  1J5E K;  3AVG A;  3OS0 A;  2QWL A;  1BWF O;  2D1K A;  1BO5 O;  5C2D A;  4K41 A;  3VF6 A;  4FJI A;  2UXB K;  1NGI A;  1VSJ A;  3VTI A;  1RDB A;  4FPB A;  1NMN A;  4DU4 A;  5BRD A;  1QQC A;  4E7I A;  4OO1 J;  4IDH A;  1YJN N;  3WNH A;  4CJL A;  4FVU A;  3KJV A;  1Q8I A;  4BC3 A;  3TU5 A;  5FLX O;  2ZGZ A;  4DB3 A;  4XH4 A;  3SI6 A;  3K5O A;  3DLB A;  1JLA A;  4BY9 C;  5I42 A;  1CZ9 A;  5BR8 K;  3MN7 A;  3WT0 A;  1IBK K;  2X6S A;  2ATQ A;  1GLA G;  2OAN A;  1BUP A;  3FLC O;  4B1W B;  3VPZ A;  3EY1 A;  1Q18 A;  5CZ2 A;  4Z4I A;  4OGC A;  3HVT A;  3LDP A;  2KZZ A;  3FZM A;  4KI6 A;  4PKI A;  4C1N I;  1JCF A;  1QSY A;  4WQ4 C;  4DS5 A;  1S6P A;  4JKC A;  2NRT A;  3C6H A;  1VQM N;  3LAL A;  4JKD A;  2HHS A;  3TAM A;  4J2A A;  1OVQ A;  1RTJ A;  1O1W A;  4UY8 O;  3CJC A;  1GLD G;  3CXC M;  3ZT1 A;  4FJH A;  3OJU A;  4CJQ A;  1DLO A;  3SUO A;  3C94 A;  4IXC A;  4A62 A;  1GLF O;  4BR4 A;  3H45 C;  5AQF A;  1C0G A;  4CD1 A;  4E89 A;  3S9H A;  2V7Z A;  4CJ3 A;  1KFD A;  1R59 O;  5E41 A;  4AIL C;  1IKX A;  1S1T A;  3KWI A;  3NGZ A;  2YHW A;  4KFB A;  3ZSQ A;  4YOW A;  4Z94 A;  1RBS A;  5JMV A;  2HW3 A;  4U67 L;  2QA4 N;  1EO1 A;  1XHZ A;  3VQ7 A;  1L5U A;  4I2Q A;  2E5L K;  4QS7 A;  3HXM A;  1SKR A;  5BRE A;  2IDO A;  2G8K A;  2E8A A;  3NMU A;  3QIC A;  4IO8 A;  4CEF A;  4BVP A;  3WQU A;  4IDK A;  4EAH D;  4KHP K;  4DQ8 A;  3V6D A;  3ZSX A;  1W7A A;  4DTO A;  1Q7Y O;  4NXM K;  1R0A A;  2D4W A;  3SBG A;  1KC8 O;  1EWR A;  2DY4 A;  4KHY A;  3BEX A;  5CYM A;  1SKW A;  5JIC A;  1N32 K;  3ZEU B;  1VSF A;  3ZEU A;  3CC2 N;  3MAQ A;  3TSU A;  3QBW A;  3T1H K;  4BDY A;  1J9A A;  4CIF A;  4GVE A;  2HBK A;  2FBT A;  4GW6 A;  4CZH A;  4CEE A;  3U6F A;  4C1N K;  1JL2 A;  1E4F T;  3CJB A;  3ZT3 A;  1IG9 A;  3V4I A;  1NKC A;  2HHW A;  3ID8 A;  5C42 A;  3VQC A;  1YI2 N;  1DT9 A;  1SAZ A;  5KI6 A;  3THW B;  2YNH A;  4CEO A;  3LDS A;  4AH9 A;  5I9E B;  2ETJ A;  4GMJ B;  1NJX A;  3THW A;  4FM2 A;  3MEE A;  2OCE A;  1KAZ A;  3BF3 A;  1NU0 A;  2ZF5 O;  1IG8 A;  4ILJ A;  3ITH A;  3DXM B;  4KBO A;  4YOU A;  3DXM A;  3J7Y P;  1CXQ A;  4FWN A;  1E4G T;  1VQ4 N;  4H0O A;  3CHW A;  3GG4 A;  4Z4E A;  3NFA A;  4K43 A;  1KCF A;  1Q81 O;  3CD6 N;  4N56 A;  1BHL A;  2I7N A;  4FO0 A;  3SPZ A;  1T6C A;  3G71 N;  4FW2 A;  4G1Q A;  2O4I A;  4JKG B;  4KHU A;  3MK6 A;  2B4J A;  4DV0 K;  5M1O A;  1UOC A;  1JLC A;  4JI8 K;  4J8F A;  4WQ5 A;  3D2E B;  3M5R A;  2CGL A;  1V4T A;  3TPQ A;  2PY5 A;  3Q7B A;  3PX4 A;  1UA1 A;  1L3T A;  4PY5 A;  2Q0R A;  3C0B A;  4LSL A;  3V1R A;  5KGX A;  2Y1J A;  1TL3 A;  1JLF A;  3CQ8 A;  1KLM A;  1D8Y A;  1HR0 K;  5ADX H;  1YIJ N;  4CFD A;  3R3L A;  5J2M A;  2P9S B;  5HLF A;  3IS9 A;  3I8D A;  2P9S A;  3AAR A;  3JYT A;  3LDL A;  2UUA K;  3ATV A;  3SMS A;  3LM2 A;  4OPH A;  1XWL A;  3J81 O;  3SPY A;  4BRL A;  1RT6 A;  4OVL A;  2OPP A;  3ZX0 A;  1P8Z A;  3PX6 A;  2Q1N A;  1VQK N;  3AVJ A;  3AAQ A;  1U6Z A;  2VWB A;  4I7F A;  3HT3 A;  3KLF A;  5CE3 A;  3V9Z A;  4DLE A;  1WSH A;  4NLB A;  3WXJ A;  1HUX A;  2JWK A;  4F2R A;  2AJQ A;  2FF6 A;  2QTD A;  4LFA K;  3ENO A;  3QER A;  4FJ9 A;  3T69 A;  2E2P A;  4CEQ A;  3DLH A;  1BGX T;  5M1N A;  3VA0 A;  4H0P A;  4CBU A;  1C6V A;  3L2U A;  1YHQ N;  3AO4 A;  3P83 D;  4RTF D;  5AQL A;  1TKD A;  4Z4H A;  3TAP A;  1CXU A;  5J2Q A;  5AQZ A;  4RWT A;  1QSS A;  1CZA N;  3AAP A;  3AVL A;  1NKB A;  2F96 A;  2VQE K;  1BIZ A;  1HNX K;  4DFM A;  3I8B A;  4ID5 A;  3LL3 A;  2HF3 A;  1IH7 A;  2PZS A;  1WLJ A;  2QWM A;  4CGH A;  1U47 A;  3CCS N;  2F9T A;  2LSN A;  4HTU A;  4FJL A;  2E1Z A;  1T03 A;  4DR6 K;  5AQO A;  1BOT O;  4C8K A;  4JKE A;  4DUZ K;  2QI2 A;  3NGY A;  1EET A;  2QKK A;  4OKE A;  3DWL A;  2P9P B;  3OVN A;  4NXN K;  4O44 A;  4CE9 A;  4H4M A;  2G8V A;  1KTQ A;  4FWS A;  3ULE B;  3HOS A;  1IV0 A;  3EZW A;  3CFR A;  1U45 A;  1IO2 A;  3VQ4 A;  2PYL A;  4BQZ A;  3ULE A;  3BP8 A;  2NUB A;  3EKS A;  3DRP A;  3SZ2 A;  1NK8 A;  4B3R K;  4CJK A;  4Y1D A;  4FK2 A;  1J6Z A;  3EE9 A;  3G6E N;  2GEM A;  5HBM A;  3QFU A;  4M63 C;  5JVG L;  3D7E O;  3QEW A;  4DSK A;  4MQ3 A;  4E0D A;  1RTI A;  4OLA A;  5FPD A;  4I6M B;  3AGR A;  4BDP A;  2HHU A;  3NDK A;  3CCM N;  3DM2 A;  4DTM A;  4CIG A;  2E2O A;  5C25 A;  1YIT N;  3OYN A;  4H03 B;  3VES A;  2QEX N;  4Z0U A;  4H5N A;  4W5R A;  1HJR A;  4BC2 A;  3UKU B;  3VEN A;  1BA0 A;  2NRV A;  2GWK A;  3UKU A;  5HRS A;  4KTZ A;  3OJS A;  4H5W A;  5AJ3 K;  3KK7 A;  2OPR A;  4ZTF A;  5HRP A;  4CFB A;  3H46 O;  2RKI A;  4KHW A;  1BQM A;  3QET A;  1SL2 A;  5F1X A;  1FK9 A;  1WSE A;  5F2R A;  1RBV A;  2HNY A;  4X65 K;  3KD5 E;  5AQQ A;  1Q9Y A;  3OYC A;  2BTF A;  4HCC A;  2UXD K;  3ZYY X;  2PBD A;  1WSI A;  4DR4 K;  3DOL A;  3OYI A;  3G25 A;  3UKR B;  1GLB G;  1X1P A;  3CYM A;  3U9Z A;  5AQG A;  3ZSZ A;  4B3T K;  3NVM A;  3VQ5 A;  2KFN A;  3JS6 A;  3QLH A;  5AQN A;  2I5J A;  4BRH A;  1BU6 O;  3VOV A;  3G0Z A;  4HCB A;  1I3A A;  2QXF A;  1TYQ B;  3ZCM A;  1TYQ A;  4A59 A;  3M8R A;  1YJW N;  1N33 K;  4LF4 K;  3HP6 A;  4CI6 A;  1NJI O;  2JGU A;  4BRA A;  1G99 A;  4NCG A;  4KB1 A;  4DSI A;  4M3R A;  3L2V A;  2XO7 A;  3HM8 A;  3L8B A;  3WXI A;  4BG9 A;  2ZJQ L;  1TAU A;  4RG8 A;  5I3U A;  3V9U A;  3C6U A;  3TI0 A;  2HMP A;  2YJE A;  4G9Z A;  4CHP A;  4ZHR A;  4FWP A;  1NMD A;  1GOB A;  2V7Y A;  4JK8 A;  3OYL A;  4DTS A;  3HM9 A;  4JEP A;  5GIO A;  4IOA L;  1RT3 A;  2VG7 A;  1HKG A;  3SV4 A;  4FZY A;  3IG1 A;  4TSX A;  3RMC A;  3P1G A;  1IKW A;  4JRQ A;  1GOC A;  4QOZ B;  4LF7 K;  2P9N A;  4JKB A;  1HRH A;  4JI7 K;  4JI2 K;  3V1O A;  4FLV A;  1ZXO A;  5EX5 A;  4CER A;  4PWD A;  1BL3 A;  4CJR A;  2VG5 A;  5AFU A;  1MWK A;  5KPT A;  3TTC A;  4CZK A;  1NGG A;  4KHN A;  4O55 A;  1YF5 L;  2PAV A;  4UQG A;  1HLU A;  3RRG A;  4DTU A;  2XHB A;  3HPH A;  3E1Y A;  2XRI A;  2DPN A;  1BI4 B;  3AO3 A;  2ZJP L;  4L3Q A;  1YUW A;  2D0O A;  4YOV A;  3SBT A;  2ZJR L;  3VF2 A;  4ELV A;  3KK3 A;  4DKW A;  2E88 A;  4WQ5 C;  3TAQ A;  1N36 K;  2HHX A;  2FF3 B;  3DOK A;  4CZF A;  4JD2 B;  4H0T B;  4QS9 A;  3AVN A;  4JD2 A;  4BR7 A;  1OH8 A;  4KV8 A;  4DTJ A;  5T7B A;  1I94 K;  1VQ6 N;  1QHA A;  4KH4 A;  4LFB K;  1JCE A;  4DUY K;  3GOI A;  4F3T A;  4A2B A;  1K6Y A;  1ASW A;  1FW6 A;  1ITG A;  3F5T A;  4KO0 A;  1SQK A;  4JKH A;  4LH5 A;  2YHY A;  5C12 A;  1A5W A;  1C1C A;  2YHA A;  5AQW A;  4FWM A;  2A1R A;  4CJP A;  1JLG A;  4IFV A;  3SNN A;  1VSH A;  5FRM A;  1NGC A;  1SS6 A;  4JI3 K;  2BGG A;  4ILG B;  3JXU A;  4B1Y B;  4CCH A;  2IS3 A;  3S3O A;  3AGK A;  1UA0 A;  4KTQ A;  5CZ1 A;  4IEI A;  3VEV A;  2EWS A;  3K5L A;  3IFR A;  4B1V A;  4BGA A;  2IVP A;  5BRF A;  4DU1 A;  1NJZ A;  3NE6 A;  1NK6 A;  4R79 A;  1KQS M;  4B1X B;  3VQ8 A;  3WEE B;  1VSD A;  1OH6 A;  2HHV A;  3THV A;  3LM9 A;  1W0H A;  2AP1 A;  3WEE A;  4LFC K;  1S3X A;  3R8E A;  4AM7 A;  3MWT A;  4C8L A;  3SAG A;  3PSI A;  3CJ9 A;  3VN5 A;  4HUG A;  3PLA A;  3NBP A;  4JKF A;  1QVG M;  3M8P A;  3NF9 A;  4E1M A;  1HNV A;  5JLF A;  3D0P A;  4E7K A;  1RBR A;  3ENB A;  5BN8 A;  3AY9 A;  1DGK N;  1BCM A;  3CPE A;  2BDP A;  5HRN A;  1HX1 A;  1NGE A;  3CCR N;  4CZL A;  1VQ9 N;  1BA1 A;  3CCL N;  2B6A A;  2DFH A;  2YNF A;  2G8W A;  2IGI A;  3S41 A;  4EHT A;  4EP5 A;  2HBM A;  2Z1H A;  2W41 A;  1Q9X A;  1WOQ A;  1WBD A;  4JI1 K;  2YNG A;  3BUZ B;  2ZD1 A;  4CJT A;  1YTU A;  2XY8 A;  2GTD A;  3VF4 A;  3OW2 M;  4IOC L;  2X74 A;  4JI5 K;  2RPI A;  4QCL A;  4K42 A;  5KRS A;  4DV1 K;  2Y1I A;  4DF8 A;  1FXX A;  2BH1 A;  4DCH A;  2XY6 A;  4AHV A;  4AM6 A;  4DWI A;  4KRE A;  2HST A;  1U49 A;  1KXP A;  3K0S A;  2O8E B;  4BR5 A;  5F0X A;  3M8S A;  3MEG A;  4DR2 K;  3ALY A;  4RW6 A;  3NH0 A;  3V9S A;  4B3O A;  2WC9 A;  3HO1 A;  2NRX A;  3LP1 A;  4RCH A;  3QNN A;  4FL9 A;  3K9K A;  4FWL A;  1YTA A;  3F2K A;  3BZC A;  1YAG A;  5HRO A;  2ASM A;  3OYF A;  2OYQ A;  2HVH A;  2Q97 A;  3FZK A;  2W6K A;  3OYG A;  3F73 A;  3ENH A;  1EXQ A;  2G8H A;  4WFN L;  4DV4 K;  1JL1 A;  4IO9 L;  1HNZ K;  4B9L A;  1NM1 A;  3EEQ A;  3F9K A;  2RE2 A;  3TSP A;  3VQA A;  5E84 A;  2A42 A;  2ZM6 K;  4M3X A;  1ASU A;  2OA8 A;  4BRK A;  3O9Q A;  4WFB L;  4FLY A;  3HK2 A;  2KZM A;  3KLG A;  5LMU K;  3HYF A;  3DAW A;  4ISG A;  3B6P A;  4JS4 A;  5DM6 L;  1W2B M;  3R1X A;  4M7Y A;  3RRH A;  2O8C B;  4LD0 A;  2BAN A;  3LPT A;  4E1J A;  4BRM A;  5HP1 A;  3HSC A;  3A5O C;  4JI6 K;  2O8C A;  4M41 A;  3S3M A;  3KZB A;  4ICL A;  1RT1 A;  2RN2 A;  4NYF A;  3WNG A;  1KAY A;  3A5L C;  4LF6 K;  1RTH A;  1TK5 A;  3RR8 A;  2D0B A;  2UUB K;  3RWU A;  3AVC A;  2QWR A;  3NGI A;  1T3V A;  4DV5 K;  1SL1 A;  3ZSO A;  3VEY A;  1Z26 A;  2BUP A;  4OGE A;  5LJW A;  2WON A;  3LZJ A;  3FGU A;  4NYN A;  1YXQ A;  5AQS A;  1S22 A;  3NHG A;  4OLB A;  2YKM A;  3RR7 A;  1HMV A;  4E1N A;  3LDO A;  5CYQ A;  4GY2 B;  4O8U A;  3DLE A;  2O8D B;  3VGK A;  3PV8 A;  4N76 A;  3J7A P;  1NK4 A;  1LW2 A;  4FVM A;  3AA3 A;  1Y64 A;  3K9J A;  1KRP A;  3ZLJ A;  4BGB A;  5IT9 O;  5LMN K;  1TVR A;  4CFA A;  2HB5 A;  4YOY A;  2FC0 A;  4YOX A;  4O5B A;  4DQI A;  3E01 A;  5KPZ A;  5EU7 A;  3KLE A;  4OKJ A;  4W5N A;  4O4G A;  5J2P A;  4WFA L;  1QQM A;  3C6T A;  5AQX A;  2KQ2 A;  3O4N A;  2DFF A;  4LSN A;  2HND A;  2F7T A;  2BE2 A;  4IZ9 A;  2YNI A;  4O5F A;  1U2V B;  2R7Y A;  3CF5 L;  4FJ8 A;  1U2V A;  1VSL A;  1XQS C;  1T7P A;  2EHG A;  3MXM A;  1SL0 A;  1IBM K;  3D45 A;  4DTN A;  5AQR A;  3SK3 A;  4IKF A;  3O4Q A;  4FJ7 A;  2QWQ A;  4O0J A;  5LJV A;  4DTX A;  3LAK A;  1N8R O;  2E4L A;  4A5B A;  2F8T A;  1VQP N;  1GOA A;  3VTH A;  1E3M A;  3ID6 A;  4JKG A;  3AA4 A;  3SV3 A;  1JLE A;  3VQQ A;  1ATR A;  2QKB A;  4YDU C;  4PHT X;  4CHY A;  3D2E A;  1YT3 A;  4DV7 K;  1HJO A;  4M3T A;  5EXW A;  3BF1 A;  1KVB A;  4BRQ A;  3WUH A;  2V52 B;  2VGM A;  2NRH A;  4CGD A;  3VMF B;  4AHR A;  4YOT A;  1C0F A;  3QB0 A;  4LF9 K;  3LP2 A;  1KFS A;  4BC4 A;  5AQJ A;  3O3F A;  4C8O A;  1RFQ A;  1Z05 A;  3THX B;  4CGF A;  3CCV N;  1RDU A;  4EZ6 A;  4CGG A;  2FSJ A;  1ZBH A;  4FZZ A;  4Q5V A;  4Y0W A;  5ADX A;  1A5X A;  1NGH A;  3TAG A;  4GV9 A;  3MN5 A;  3A2F A;  1NGB A;  1O13 A;  1D9D A;  1HYV A;  5AR0 A;  4DTP A;  1W9H A;  1IJJ A;  4CJF A;  4DFP A;  1KVC A;  4FLU A;  4FK0 A;  3K57 A;  4DQQ A;  1I39 A;  5DK5 A; 
#chains in the Genus database with same CATH homology
 4FPA A;  4BRH A;  1BU6 O;  3O1B A;  4MLE A;  5FPN A;  1XC3 A;  3VOV A;  2E20 A;  2YHX A;  5TKY A;  5BRH A;  4WCE L;  3MX2 A;  1TYQ B;  3N4P A;  2JWL A;  4H5T A;  3O5B A;  1QVF M;  1TYQ A;  4BR9 A;  1KAX A;  4A59 A;  1YJW N;  4CI6 A;  1NJI O;  5AQM A;  3H3O B;  4BRA A;  1G99 A;  4FWO A;  1EQY A;  4BG8 A;  1VQ7 N;  3HM8 A;  3WXI A;  4NO7 A;  4BRN A;  2QXL A;  3GE1 A;  3VER A;  4BG9 A;  4IJN A;  3VGM A;  5MLC Q;  2ZJQ L;  1TUY A;  4CBX A;  4BR0 A;  4BRD A;  1QZ6 A;  3H1V X;  3IDH A;  4CZG A;  2QWL A;  1BWF O;  2HMP A;  3WXL A;  2YJE A;  4G9Z A;  2D1K A;  1BO5 O;  5C2D A;  3QML A;  4K41 A;  2Q0U A;  3VF6 A;  3J8A A;  4FWP A;  3CQX A;  4PL8 A;  3FFK B;  1NMD A;  2V7Y A;  4JK8 A;  1NGI A;  2HBL A;  3VTI A;  4WYB A;  3A0I X;  4FPB A;  5HOO A;  3CIP A;  3C6A A;  4FWQ A;  4MLH A;  4JEP A;  3M6G A;  5BRD A;  5GIO A;  4IOA L;  4OO1 J;  1ATS A;  3F9M A;  3WXM B;  1BDG A;  4IDH A;  4IFE A;  1YJN N;  1HKG A;  3MX5 A;  1NLV A;  2NNW A;  1K8K B;  4FVU A;  3QDK A;  4IJA A;  2CH6 A;  1K8K A;  1Z6R A;  2IIR A;  2PFU A;  3L0Q A;  5AQV A;  3H6E A;  3TU5 A;  2ZGZ A;  3D2F B;  4BC3 A;  4BRC A;  4DB3 A;  2P9P A;  4XH4 A;  3MWP A;  2P9N A;  4JKB A;  3D2F A;  3R9P A;  3SMP A;  4BY9 C;  1ZXO A;  5EX5 A;  3A5M C;  3U8X A;  1RDW X;  3MN7 A;  3WT0 A;  3MN9 A;  3FE1 A;  3KVG A;  1MWK A;  2D0P A;  4O8K A;  5AFU A;  3I55 N;  3D6R A;  1Q86 O;  5KPT A;  1GLA G;  4PKH A;  2OAN A;  3TTC A;  4CZK A;  1BUP A;  1NGG A;  3FLC O;  3CCQ N;  3KWG A;  4B1W B;  5BPL A;  1YF5 L;  3IUC A;  4FWK A;  3VPZ A;  2PAV A;  1HLU A;  1NBW A;  1Q18 A;  3VEO A;  3C7N B;  1X3M A;  4CZM A;  3CMA N;  2P9L B;  4WF9 L;  5GAE P;  3C7N A;  3E1Y A;  3LDP A;  2DPN A;  3ATU A;  2ZJP L;  3FZM A;  4L3Q A;  4PKI A;  3ZX3 A;  1YUW A;  4C1N I;  2D0O A;  3CPW M;  2ZWH A;  1JCF A;  4FWR A;  4I6M A;  4YOV A;  4WQ4 C;  3SBT A;  5E26 A;  1GLE G;  4JKC A;  3W0L A;  2NRT A;  3C6H A;  4ISE A;  3VF2 A;  2ZJR L;  1VQM N;  4JKD A;  1QZ5 A;  4DKW A;  2E88 A;  4WQ5 C;  4B1Z A;  4MDB A;  5FPE A;  2FF3 B;  4CZF A;  4JD2 B;  3O6W A;  4H0T B;  1HKC A;  4QS9 A;  4UY8 O;  3CJC A;  1XUP O;  1GLD G;  4JD2 A;  3CXC M;  2YX6 A;  4BR7 A;  5EVZ A;  4IXC A;  5AZJ B;  1VQ6 N;  1QHA A;  1GLF O;  4A62 A;  4KH4 A;  4BR4 A;  1TUU A;  3HRG A;  1JCE A;  3H45 C;  3GOI A;  5AQF A;  2FLO A;  1C0G A;  2A41 A;  3L4I A;  4FOE A;  4A2B A;  4CD1 A;  1ZBS A;  2V7Z A;  3A5N C;  3RVC A;  4EHU A;  3F5T A;  1SQK A;  4JKH A;  1JCG A;  3CJ7 A;  3EE8 A;  2YHY A;  5C12 A;  1R59 O;  3J7Z O;  2RHK A;  3KWI A;  3N4Q A;  2YCH A;  2YHW A;  5AQW A;  4FWM A;  4YOW A;  4Z94 A;  5JMV A;  4U67 L;  2QA4 N;  1EO1 A;  3O9R A;  3CET A;  1S72 N;  1NGC A;  1SS6 A;  5BPM A;  4ILG B;  3JXU A;  1DEJ A;  3UKR A;  3VEX A;  4B1Y B;  4QS7 A;  3C65 A;  5HL7 L;  3SAH A;  5JVH L;  5BRE A;  3FR0 A;  4F9O A;  5TKW A;  2E8A A;  3NMU A;  3AGK A;  3QIC A;  1K9M O;  4IO8 A;  3R6M A;  4BVP A;  2HBJ A;  3P39 A;  3WQU A;  4GV6 A;  3CC7 N;  4IEI A;  3VEV A;  4EAH D;  3M3Z A;  2A6A A;  1ATN A;  2EWS A;  4GV3 A;  2A5X A;  3IFR A;  4B1V A;  3OHR A;  4DQ8 A;  1QQO A;  4BGA A;  2IVP A;  5BRF A;  5M1K A;  5AZI B;  1Q7Y O;  3HBT A;  3H1Q A;  4B1U B;  1VQN N;  2OTJ N;  5AZI A;  2D4W A;  4M7X A;  3SBG A;  3E66 A;  4CD3 A;  1KC8 O;  4BRG A;  4R79 A;  2CH5 A;  2QWN A;  1KQS M;  4B1X B;  3WEE B;  1VQ5 N;  5AQP A;  3LM9 A;  3BEX A;  2AP1 A;  4XH1 A;  3WEE A;  3DLL L;  1S3X A;  5JIC A;  3R8E A;  3UE5 A;  1YJ9 N;  1P90 A;  2A40 A;  3CI5 A;  4AM7 A;  3GBT A;  3MWT A;  3OA9 A;  3RSE B;  3SAG A;  3ZEU B;  3CJ9 A;  1ZC6 A;  1HKB A;  3B8A X;  3RSE A;  2IVN A;  3ZEU A;  3CC2 N;  3PLA A;  4JKF A;  3QBW A;  3TSU A;  4JHD B;  1HPM A;  1QVG M;  1NGJ A;  3MN6 A;  3KHY A;  4JHD A;  4GVE A;  4JN4 A;  1MWM A;  3O80 A;  2HBK A;  5JLF A;  5BN9 A;  4BVO A;  4ILH A;  5BN8 A;  3ENB A;  2YI1 A;  4LC9 B;  3AY9 A;  1DGK N;  3CPE A;  4CZH A;  3MCA B;  5EOY A;  3VEW A;  4C1N K;  1QQN A;  2QWO A;  5GAH P;  1E4F T;  3CJB A;  4JK7 A;  1MA9 B;  3EKU A;  3O4W A;  3O9S A;  3PIP L;  1HX1 A;  1NGE A;  2I7P A;  3CCR N;  1NGF A;  4CZL A;  3IMX A;  4BRO A;  1VQ9 N;  1K8A O;  3MMV A;  1BA1 A;  3CCL N;  3QBX A;  3ID8 A;  2GEL A;  1M90 O;  5LY3 A;  1YI2 N;  1WUA A;  1DT9 A;  1SAZ A;  3S41 A;  4EHT A;  3ZET B;  5KQ8 A;  3VET A;  1D4X A;  2HBM A;  5I9E B;  3ZET A;  4A61 A;  2FXU A;  2W41 A;  5FPM A;  1WOQ A;  2KKZ A;  5BPN A;  1VQ8 N;  1KAZ A;  2Q31 A;  3BF3 A;  3BUZ B;  2ZF5 O;  1LOT B;  2P9I B;  5GIP A;  1IG8 A;  4ILJ A;  2GTD A;  1OKJ A;  3DXM B;  3VF4 A;  3OW2 M;  1NGA A;  4IOC L;  4KBO A;  4YOU A;  3DXM A;  2GWJ A;  1BG3 A;  4K42 A;  2P9L A;  1K73 O;  3A8Y A;  4U7B A;  1GLC G;  4FWN A;  2BH1 A;  2CGJ A;  4DCH A;  1E4G T;  1VQ4 N;  4H0O A;  3CHW A;  3GG4 A;  4PKG A;  4AM6 A;  3LDQ A;  2QWP A;  2HST A;  4FOI A;  2AA4 A;  4CJ7 A;  1KXP A;  4A57 A;  4K43 A;  1Q81 O;  3CD6 N;  2HOE A;  4BR5 A;  3W3D A;  5GIN A;  5F0X A;  4YDU A;  4YOR A;  5ELZ A;  2I7N A;  4FO0 A;  1T6C A;  3G71 N;  3CJ1 A;  2KLA A;  2WC9 A;  2WUS A;  4BRI A;  3GDQ A;  4H5V A;  4WQ4 A;  2NRX A;  4JKG B;  3MK6 A;  4RCH A;  3K9K A;  4FL9 A;  5M1O A;  3O9T A;  4FWL A;  3F2K A;  1YAG A;  2P9U B;  1RGI A;  4J8F A;  4WQ5 A;  2ASM A;  3WXK A;  3D2E B;  3M5R A;  2GUP A;  2CGL A;  2P9U A;  2Q97 A;  1V4T A;  3FZF A;  3TPQ A;  3FZK A;  1MDU B;  3Q7B A;  1Q82 O;  2Q0R A;  3ENH A;  5AZJ A;  5H1S Q;  3C0B A;  4K25 A;  4WFN L;  2P9K B;  5BR9 A;  5C10 A;  4IO9 L;  1YVN A;  2P9K A;  1NM1 A;  5EY4 A;  3VEZ A;  2RE2 A;  3TSP A;  5E84 A;  2A42 A;  3E9L A;  4A2A A;  3U9D A;  5AQK A;  5GAG P;  4BRK A;  2ZGY A;  3O9Q A;  5ADX H;  5KQD A;  1YIJ N;  4WFB L;  3CCJ N;  3R3L A;  4JK9 A;  5AQI A;  2P9S B;  5GAD P;  3DAW A;  4ISG A;  2P9S A;  3AAR A;  2UYT A;  3LDL A;  3WQT A;  5DM6 L;  1W2B M;  3R1X A;  4M7Y A;  3ATV A;  3SMS A;  4E1J A;  4FSV A;  4BRM A;  3LM2 A;  4OPH A;  3HSC A;  4XH5 A;  5C15 A;  3A5O C;  3OBW A;  4BRL A;  3KZB A;  4JKA A;  3ZX0 A;  1P8Z A;  1KAY A;  3A5L C;  3EL2 A;  2Q1N A;  1VQK N;  2Q2R A;  1VQO N;  2VGN A;  3E9O A;  3P4I A;  1M1K O;  1VQL N;  3AAQ A;  1U6Z A;  2VWB A;  2QWR A;  3Q7C A;  1T3V A;  3NVK A;  3FZL A;  4EIA A;  3VEY A;  4JAX A;  3G4S N;  3CME N;  5AQH A;  2BUP A;  5LJW A;  5C0Y A;  1GLL O;  2NRR A;  5CE3 A;  3P38 A;  3TTF A;  3FGU A;  4NLB A;  1YXQ A;  3WXJ A;  5C2F A;  3OBY A;  5AQS A;  2YJF A;  1HUX A;  2JWK A;  1X9J A;  3VGL A;  3SAF A;  3PIO L;  2FF6 A;  2QTD A;  4A5A A;  4GNI A;  1S22 A;  4BR2 A;  4BC5 A;  3ENO A;  2ASO A;  3T69 A;  4KH6 A;  3H3N O;  2E2P A;  4IOX A;  3LDO A;  3CC4 N;  4GY2 B;  5M1N A;  4O8U A;  4H0P A;  4PL7 A;  4CBU A;  1NGD A;  3VGK A;  3HTV A;  4CZE A;  5CR4 A;  4IEE A;  1YHQ N;  1SZ2 A;  4RTF D;  5AQL A;  4EFH A;  1Y64 A;  3K9J A;  4MO4 A;  4BGB A;  1H1V A;  2QW9 A;  4H5R A;  4YOY A;  5AQZ A;  4YOX A;  2Q36 A;  4RWT A;  1CZA N;  2IVO A;  5KPZ A;  3AAP A;  5DM7 L;  2NRW A;  3I8B A;  5M1Q A;  3O8M A;  3LL3 A;  2HF3 A;  1NWK A;  4WFA L;  2QWM A;  3M1F A;  1QQM A;  1KD1 O;  3CCS N;  2F9T A;  2W40 A;  5AQX A;  3ZX2 A;  2E1Z A;  3CQY A;  3CCU N;  4HTL A;  2QM1 A;  5AQO A;  1BOT O;  3P31 A;  4XEI A;  5AFU H;  1ILY A;  3I56 N;  3EN9 A;  4JKE A;  3O08 A;  2F7T A;  2QI2 A;  2P9I A;  4IZ9 A;  3TSQ A;  2FSN A;  3DWL A;  2P9P B;  4DHY A;  4O5F A;  1U2V B;  3HI0 A;  3I33 A;  2P9N B;  5AQY A;  3CF5 L;  2A3Z A;  5M1F A;  1GLJ O;  3L6Q A;  1U2V A;  4FWS A;  1W97 L;  3TTD A;  3ULE B;  3HOS A;  3EZW A;  5KPR A;  4BRP A;  2WFB A;  1T44 A;  1XQS C;  3CCE N;  4BQZ A;  3ULE A;  3BP8 A;  3EKS A;  2H3G X;  4H0V B;  5AQR A;  2FSK A;  4OPA A;  3SK3 A;  4CZJ A;  1J6Z A;  1T6D A;  3EE9 A;  2J4R A;  2QWQ A;  5LJV A;  1ESV A;  3MCP A;  5AQT A;  3G6E N;  4H0Y B;  1N8R O;  4A5B A;  2GEM A;  1DKG D;  1VQP N;  3VTH A;  5M1P A;  1VAZ A;  4BRF A;  3QFU A;  4H0X B;  2NZT A;  4M63 C;  4C23 A;  3ID6 A;  3D7E O;  4ISF A;  4KH5 A;  4JKG A;  2VCP A;  5JVG L;  2OTL N;  3FZH A;  4BRE A;  1JJ2 M;  3DJC A;  1ATR A;  2E1Y A;  4JNE A;  3O1W A;  4YDU C;  4PHT X;  3CJA A;  4I6M B;  3AGR A;  4NB4 A;  3D2E A;  5FPD A;  4MO5 A;  2NRZ A;  3CCM N;  1HJO A;  3DXK B;  2V51 B;  3SLC A;  2E2O A;  3DXK A;  4NLC A;  3BF1 A;  5EXW A;  3T7Z A;  4BRQ A;  5AQU A;  2GX9 A;  2E2Q A;  2V52 B;  3U4L A;  2VGM A;  2ITM A;  3WUH A;  2NRH A;  1YIT N;  3VMF B;  4YOT A;  4H03 B;  3HOT A;  3VES A;  2QEX N;  1C0F A;  3GL1 A;  3QB0 A;  4H5N A;  3LDN A;  4B9Q A;  4BC4 A;  4AF1 A;  4BC2 A;  3UKU B;  4QS8 A;  4BQL A;  5AQJ A;  2VYP A;  5B8H A;  2NLX A;  3VEN A;  5JLH A;  5CHI A;  1BA0 A;  2NRV A;  2GWK A;  2HF4 A;  3UKU A;  4MDA A;  3HZ6 A;  2CGK A;  3MDQ A;  4H5W A;  3KK7 A;  1RFQ A;  1Z05 A;  1OVY A;  1V4S A;  3H46 O;  3CCV N;  1RDU A;  3IKM A;  2FSJ A;  1X3N A;  1LCU A;  4HWI A;  3E9P A;  5F1X A;  5F2R A;  3SJH A;  4Y0W A;  5ADX A;  3QFP A;  4CZI A;  3EO3 A;  5AQQ A;  1NGH A;  4GV9 A;  3MN5 A;  2BTF A;  1NGB A;  1O13 A;  5AR0 A;  3UB5 A;  3ZYY X;  2PBD A;  3G25 A;  1IJJ A;  1GLB G;  2KHO A;  3O9U A;  3U9Z A;  5AQG A;  3UKR B;  4CBW A;  3NVM A;  2F9W A;  3JS6 A;  3L4Q A;  5AQN A;  4IWV A;  3CER A;  2E2N A;  2WBN A;  2ASP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...