3QIPA

Structure of hiv-1 reverse transcriptase in complex with an rnase h inhibitor and nevirapine
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
556
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse HIV-1 reverse transcriptase p66
publication title Structural and Binding Analysis of Pyrimidinol Carboxylic Acid and N-Hydroxy Quinazolinedione HIV-1 RNase H Inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase/transferase inhibitor
total genus 164
structure length 554
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3qipA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3qipA05
1SKWA 3BREA 3M8QA 3SFGA 2VWKA 4DFKA 3KNAA 1ZTWA 4ZVFA 5DGAA 4ED0A 3ZSZA 2GUIA 3KHLA 4OPKA 2HW3A 1RTHB 1S0OA 3TAFA 2KFNA 3RMDA 1U47A 1N56A 3EZ5A 2KFZA 2IS3A 2JC0A 4J9MA 3TWHA 3NH1A 1RTIB 5HP1B 1QTMA 4CJFA 3U3GA 4DU3A 4GC6A 1DTTB 3KIOA 4W5RA 4ZVEA 1C0MA 3OYHA 3DYAB 1JLQA 2W8KA 4F4XA 1RYRA 3MXIA 3QESA 1ZBIA 2R2SA 4OKEA 4IFVA 3K5NA 2E9RX 1RT3A 4IR9A 4C8OA 2OPRA 3KLFA 2B43A 3VQBA 3LALA 4QWCA 5KFQA 4R8UA 4CJRA 3PW4A 1NK8A 4AHRA 4DSIA 4J9KA 5KTQA 3TQ1A 4M3XA 3LDSA 2IM1A 4CGFA 4Y2CA 3HPHA 1NOYA 5FDLB 4NYNA 2IAJB 2XY5A 3AO2A 4DTMA 4R5PA 4IRDA 4M94A 3NF6A 5D3GB 4DTPA 5FRNA 4LQ9A 1ZBUA 4Q44A 4OVLA 5F8HA 2OPPB 2HHTA 4B8AB 2IJNA 2D3ZA 3ITHA 3TAMB 4RNHA 3M9NB 3V81A 1TKXB 4I2QA 3ZT3A 2AWZA 2ASLA 1UWBA 5HLFA 4M42A 1C0UA 1WSFA 1T7PA 3TARA 4AHCA 4H4MA 3PV8A 4EYIB 2X78A 1IKVB 2XY7A 4O4GA 2W9CB 3OJUA 4RUCA 2HHWA 4CHOA 2WOMB 1OS5A 1VK0A 1QS4A 4ECXA 4KAZA 3BSNA 2UUTA 1RT5B 4FM0A 2VG5B 1NKCA 2XC9A 4NLTA 4FJ8A 3VQQA 4DL3A 3MFIA 3HXMA 3TAQA 1X9SA 4J9NA 1ZYQA 3PW5A 1KFSA 5C25B 3H5UA 3BQ2A 5HBMA 1TAUA 2JEGA 4O3OA 4CK1A 3OS1A 4OKJA 2WRMA 4URQU 2YHAA 1SUQA 5KFNA 5SZTA 2FVQA 4PWDA 4TSXA 4FS2A 5KRSA 1Z26A 2IC3A 1NHUA 3PX6A 3NHGA 3VN5A 4DTJA 4RW6A 2DY4A 1RDRA 4Q43A 1YT3A 1RTJB 4IR1A 4KAIA 3O3FA 3BGRA 4F2RA 1HYZA 3H4DA 3RMBA 3KLHB 1VRTB 1S9FA 4E7KA 4DU1A 3AA4A 3KLVA 4JUZA 2D5RA 4CJEA 1RA7A 3QO9A 3CFRA 1BI4B 2KZMA 4ZP9A 1XR6A 2OYQA 4CEZA 3DMJA 2E6MA 3UDLA 1NK0A 4KHYA 1TVRA 1KHVA 2WONA 2B5JA 5I3UB 4ZP6A 3I0SA 3RB0A 4QWDA 4KFBB 4CIEA 4RU9A 3OYDA 4Y3CA 2YNGB 4O3PA 1NK5A 5I42A 1JLEB 1RBRA 3KK2B 4DEZA 1ASVA 4AH9A 2G8HA 2OPQA 1U04A 3GV5B 2A1RA 2BANA 3OVNA 1JLBB 2AGQA 3KK1A 2C2DA 1RT6B 1C1CB 4CECA 1W9HA 3KKRA 1G15A 4FK4A 1JX4A 5J2NA 2FC0A 1R0AB 3OHBA 4URSA 1BIZA 1S1TB 4CHZA 3MEEA 4ED6A 4J2DA 3OYIA 3NGIA 5J1EA 3OY9A 5CYMA 4BE2A 1RBSA 2OZMA 4BACA 3DLGA 3DLKA 5CZ1A 3JYTA 1LWEA 1KSPA 3HP9A 5HROB 4YR2A 1QHTA 4ED2A 4WFYA 3THVA 1YTUA 3TABA 5KT5A 4EP4A 1GOBA 3RR7A 1QAIA 4MIAA 1DTQA 3Q8QB 1LAWA 3AO1A 4M3YA 3IRXA 5EWEA 3CQ8A 4DTXA 2F8EX 4NRTA 2GIRA 4IH5A 4KO0B 4NLUA 4H4OB 4JLHA 4IDKB 3T1AA 2IMWP 2QE5A 4CEQA 4CEEA 3PX4A 1RT2B 2OH2A 3QIPA 2C22A 2P51A 4IG3B 3GIKA 1CZBA 3D5MA 3LPTA 4KHSA 2X6NA 3VQCA 4FJ9A 3CDEA 4DTNA 1Q8IA 4IKAA 3BSAA 2XCPA 3MXJA 4J9OA 1FK9A 3VQPA 5DGBA 1KFDA 1VSDA 4E89A 3S9HA 4MIBA 1IM4A 5KFYA 1HRHA 1UOCA 3KKSA 4DTUA 2QXFA 3Q8SB 1QE1A 3MR2A 3SJJA 3M8QB 1S10A 1Z4UA 4CJWA 1K1QA 1GOCA 4NLYA 2QK9A 3PW2A 4QOZB 1L3TA 3L2QA 4CERA 1K1SA 3LP0B 4C8NA 2HNZA 3PW7A 1MMLA 4KV8A 4XPEA 2QKKA 2R8KA 2D0CA 1VSLA 1EX4A 1JLQB 2V9WA 3V6KA 2BQ3A 4MKBA 4IFVB 3V6HA 4OL8A 4O3RA 1RT3B 4C8KA 1ZETA 3K57A 2OPRB 1WSGA 3KLFB 3KHGA 4NCAA 3QEPA 1ITGA 4IFYA 3G0ZA 4R8UB 2D0BA 4YFUA 3HK2A 4NLPA 2RN2A 1QQCA 5F8GA 1ZTTA 2FJVA 1W0HA 4DF4A 1VRUA 3DM2A 4FJGA 4KPYA 2HHXA 4WFXA 3NMAA 3OL7A 1NHVA 1XC9A 3DI6A 3AVKA 1EKEA 4DSEA 1WAJA 3DRSA 2XO7A 2XWYA 3OYCA 4F4YA 3ITHB 1Y97A 3MF5A 3V81B 4F2SA 1KLMA 2UVVA 4DTRA 4ED8A 2YNHA 4HCCA 4I2QB 4DSJA 5C24A 4TYAA 3NFAA 4I9QA 5KT6A 1LWFA 1UWBB 5HLFB 1XR7A 4NYFA 1C0UB 1HARA 1HYVA 4H4MB 4YNQA 1D1UA 2RDIA 4O4GB 3SQ0A 3KLGA 5DQGA 3QYYA 2YNIA 4ECYA 5KFEA 3PJXA 4WXWA 4IQXA 3K2PA 3FQKA 2KTQA 3HL8A 3L2VA 2GIQA 2WCXA 4EBDA 1XI1A 3L3VA 4I9LA 5KFFA 5CYQA 3VQ8A 3WNFA 5K14A 3V1OA 3IGVA 4MK9A 3AA5X 4JRQA 5KG1A 2FVRA 5KFKA 1HQUA 1VSKA 4FM2A 1CXQA 5KFRA 5HBMB 4CHQA 3AVJA 1DLOA 4EO6A 4KSEB 1SUQB 4PWDB 4YR3A 3SPYA 2IC3B 2YNFA 2C28A 5EWGA 3F9KA 3HKWA 4G1QA 1TKZA 4CJTA 3HJFA 4E19A 2XI3A 4CGGA 3NAEA 2FBTA 3SI6A 2Z1HA 2XY6A 4RW6B 1BGXT 4PUOA 4HTUA 2KW4A 4N5SA 3TANA 1RBVA 4DU4A 1BQNA 1TL3A 4BDZA 1QAJA 4M3WA 4EZ9A 4W5OA 3SQ2A 3QO9B 4Q0BA 4CFAA 3CM5A 2ETJA 1RT1A 1ASWA 1RAJA 5DLGA 4K4WA 4E7HA 3DMJB 3ICLA 4KE5A 4CESA 1TVRB 2WONB 2B5JB 1T94A 3I0SB 1HMVA 4HUFA 1X9MA 1IO2A 5JXSA 5KFHA 3NAIA 4ECUA 5FRMA 5I42B 3EZUA 3FSIA 2D3UA 4B9SA 2IGIA 3IG1A 4K4YA 3S3MA 5JS1A 2OPQB 3KLEA 1U09A 4CJLA 3V1RA 2BANB 4QWBA 2AJQA 3TAGA 2R7YA 3P83D 3HHKA 1RT7A 2VA3A 2YKMA 3M8RA 5KT3A 5J2PA 5J2NB 2GV9A 3CWJA 3L2RA 4DLGA 3D28A 4EEYA 4URGA 3NH2A 1JLCA 4HUEA 3MEEB 4DL5A 2B4JA 1GX6A 4KRFA 1J53A 3VQSA 1S9EB 2RKIA 4FBUA 4CJUA 5CYMB 4O3QA 4JV0A 1C1AA 4O0JA 3L3UA 5HRNA 3DLGB 4N47A 4CHPA 1SH3A 4HHTA 3DLKB 3JYTB 3OSNA 1S0MA 1LWEB 5J2QA 4CJQA 4FLWA 2J6UA 4ECSA 3FFIA 4O0IA 2DPJA 3C94A 2E9TA 4FLZA 3TVKA 4F3TA 3G10A 3I0RA 2UVRA 1DTQB 3IRXB 4DFJA 1RNHA 4X2BA 5KFJA 4TXSA 3AVIA 1Q9XA 5J2MA 1VSHA 4B08A 2BE2A 3UPFA 4Y1CA 1TKTA 1JLAA 3QIPB 4MFBA 5KG4A 3T5HA 4RG8A 4F50A 4O4RA 3NGZA 4RW7A 2VWJA 4OGEA 1IKWA 3E01A 2HVIA 3DLHA 1SKRA 4FS1A 3CJ5A 4OPJA 3QZ7A 1S97A 5KG3A 5F9NA 4DL2A 1FK9B 4KHUA 4CEOA 1NKBA 1BHLA 3NE6A 4Z0UA 1S1VA 4TLRA 4M45A 3IS9A 3G6XA 5HRPA 1QE1B 4NYZA 1TK8A 2XY8A 2P1JA 4CGIA 1RILA 4RW4A 1RTDA 3MR5A 1LW2A 3GQCA 2F96A 4RNNA 4CJ3A 3PW0A 4WE1A 1D5AA 3SV4A 4N41A 1LWCA 3DOLA 4CGJA 5KFWA 1HPZA 4J2EA 3KLIA 4CK3A 5FROA 3K59A 2HNZB 4FM1A 3V9ZA 1XR5A 5KG0A 3HVRA 4KV8B 3TR8A 4DLEA 2Y1JA 3HPOA 1CXUA 2ASDA 4I2PA 3PO4A 3NGDA 4CEFA 3QEIA 3NF7A 3BQ1A 2DPIA 3FDSA 3OL9A 3VQDA 1MU2A 1HQEA 4JS5A 2VG7A 3RTVA 2Q3SA 4QW9A 1YVUA 1REVA 1XWLA 1HNIB 4LD0A 4IFYB 3BJYA 1Z25A 2FBXA 2GC8A 3HYFA 1C1BA 5C42A 4MKAA 4EYHB 2OPSA 4KI6A 2RF2A 2FBVA 1VSFA 2Z1GA 5HRRA 3V6DA 3CIZA 4CHYA 3GYNA 3ULDA 2ZQBA 4ZPAA 4ELUA 1VRUB 3DM2B 2J6TA 3VQ4A 3H2LA 4DQIA 4AHVA 4KHWA 1WN7A 3I8DA 4Z4IA 2ITGA 2HB5A 3DI6B 4QCLA 1YVFA 3DRSB 4NLGA 3LANA 4FJJA 4BDPA 2WHOA 4TYBA 1KLMB 2YNHB 4ECTA 4G3IA 2ZKUA 2ZD1A 5C24B 2D0AA 1N48A 1LWFB 3AVGA 1S1XA 4U7CA 3FRZA 2IM2A 3IAYA 1RDAA 3KLGB 4DTSA 4DQPA 4AHUA 4W5QA 3QNNA 3PO5A 4FJNA 4IH7A 3HVTA 4UQGA 4TQRA 4KREA 3G6YA 4M3RA 1IKXA 5DG9A 3AVFA 1RT4A 4FJMA 5SWMA 5T7BA 3OYKA 3SZ2A 1HJRA 5K14B 4K4XA 3C6UA 3CJ4A 3M8SA 2PYJA 1ZBLA 4FLTA 1DLOB 1RBTA 3C95A 1C0TA 4OLBA 3I5CA 2R8IA 3BR9A 1LAVA 3AVCA 3PR5B 4NCGA 2YNFB 4DS5A 3MEDA 4G1QB 4MH8A 4IH6A 1TKZB 3RR8A 4DSKA 1KCFA 3DOKA 4LSLA 1JIHA 4J9RA 5KFGA 4PUOB 4FBTA 2EX3A 4FZYA 2PZSA 2I5JA 4PA1A 1L5UA 1BQNB 1KVCA 3HT3A 2BR0A 1TL3B 1KLNA 4DSLA 3D0PA 4ECZA 3TAEA 4J2BA 2DFHA 4FJXA 4Q0BB 3NCIA 5DMRA 2E9ZA 1QUVA 1RT1B 2BRKA 3RB3A 1D9FA 3SUPA 3PX0A 3MFHA 1IKYA 2AGOA 4ID1A 4F4KA 4IRKA 3QERA 2D41A 1HMVB 4LSNA 2FVCA 4EZ6A 1B9FA 3ZSWA 3K5MA 4JV2A 3BQ0A 1ASUA 5JUMA 3DDKA 3IG1B 4QWEA 1T3NA 4W5NA 1FXXA 2HNDA 2ILZA 2R2TA 3AO3A 2YKNA 4M3ZA 4WYWA 4FJLA 1RT7B 2CKWA 4K4VA 2YKMB 4W5TA 1UA0A 1GOAA 4FLYA 1L3UA 5J2PB 3AVAA 5KFPA 1JLCB 1S4FA 3GIJA 3OLAA 4NLVA 3QEXA 3NF8A 2RKIB 3C6TA 4K4SA 2XI2A 3OSPA 2BRLA 4AHTA 4KHQA 4GW6A 4DL7A 1EP4A 3GV7B 3LP2A 3PY8A 2IM0A 2G8VA 4BWMA 4WFZA 3V9WA 4MK8A 5L1IA 4CF1A 3KD1E 4ID5A 5J2QB 4KHMA 1U48A 3KMQA 4DG1A 3FFIB 5KFSA 3NDKA 4O3NA 3U3YA 5KFUA 1I6JA 4DQQA 3OJSA 4DF8A 4O44A 4KB7A 3SFUA 4CGDA 1KRPA 4JRPA 5J2MB 1JXEA 2BE2B 3LZJA 3SYZA 4ZHRA 4I7FA 3HP6A 4KTQA 3ZSQA 4AHSA 1BISA 1TKTB 3RMAA 1JLAB 4MFBB 4GMJB 4Z4CA 4R5PB 4CJ4A 4HUGA 3CJ2A 4RW7B 3F73A 1IKWB 3QINA 3E01B 3AVLA 3B6PA 3WNGA 4M95A 3QGHA 3I5AA 3V6JA 2R2UA 5EDWA 1SKSA 3H5XA 4Z4FA 3NBPA 3NL0A 1S6PA 3CO9A 2UVWA 4K50A 3O4NA 4BE1A 4E7IA 4R0EA 3AVNA 3SQ4A 4CIFA 4IG0A 4Q8EA 4DFMA 4ZPBA 1S1VB 1BI4A 2HAIA 3ZSXA 3K5OA 3IS9B 1ZBFA 1FKPA 4TY8A 3Q8PB 4ELVA 2KQ2A 2G8UA 2FVPA 1WNSA 5KGXA 4RW4B 3S3OA 1RTDB 1LW2B 3DLEA 3S3NA 3ZT4A 2BDPA 4B9MA 4WE1B 3AO4A 1LWCB 3H08A 3DOLB 1S6QA 3Q8RB 2C2RA 1HPZB 1ZBHA 3UR0A 2JGUA 4Z4GA 3KLIB 3KJVA 4ED1A 1B92A 5DQIA 4O55A 3VQ6A 2R8GA 5HRSA 1JKHA 4FW2A 3RB4A 3I5BA 4NLDA 1SV5A 5KG7A 2BQUA 4U6PA 4ECRA 5KFMA 4J9QA 4DSFA 3QETA 3V9XA 1K6YA 4ZPDA 4K8ZA 4I2PB 1C1CA 3QIOA 1CZ9A 4ZPCA 1HQEB 5F8MA 3KK3A 3JSMA 2VG7B 3QEWA 4KTWA 4ZVGA 1REVB 2FLNA 5L1JA 5KRTA 2JC1A 1VSIA 1C1BB 4E0DA 4ECWA 2OPSB 5KFLA 1B9DA 3GV8B 4O3SA 3L2WA 2G8KA 1WNEA 2X74A 3QLHA 3V6DB 3RAXA 4HKQA 3BGRB 2JEFA 2FLLA 3VA3A 2UVUA 4OJRA 4B8CA 4DWIA 4C8LA 2HMIA 4KB1A 2VA2A 5KFIA 4FVMA 1T03A 4B9UA 3CM6A 5KFOA 3P1GA 1WSHA 4ECVA 1IH7A 5DG7A 3PHEA 1WSIA 2R2RA 3UIQA 2XRIA 5C5JA 2ZD1B 3BSOA 1TV6A 3EY1A 4DS4A 3DRRA 1TKDA 3ZT0A 3O4QA 3HPGA 1S1XB 5KGWA 4QWAA 4CIGA 1A5WA 3ZSYA 1N5YA 4CF2A 4BE0A 1D0EA 3HVTB 3H5SA 3KK1B 4NRUA 3WNHA 1BQMA 1XHZA 1HNVA 5EU7A 1IKXB 3EPGA 4DQSA 4Y2AA 4B3OA 1J54A 1RT4B 4ECQA 3NAHA 2EHGA 3C6UB 1KHWA 2C2EA 4HVJA 5J1EB 4FXDA 3MECA 3CG7A 4PY5A 4FJ7A 1JLFA 3RB6A 1C0TB 3SQ1A 1N6QA 4LY7A 4GC7A 4CGHA 4NCGB 1I39A 3KMSA 2V0NA 4JV1A 4TQSA 3OYGA 3MEDB 4KKOA 3B6OA 1TP7A 4ZP8A 1S1UA 1WSEA 3DOKB 3LP0A 3OYLA 4LSLB 3RWUA 3V9UA 3OL6A 3NF9A 4E1MA 1N4LA 2V4RA 4Q45A 2I5JB 1SL0A 3NGYA 1S1WA 5KFAA 4ICLA 1RDBA 1RYSA 2G8IA 1LW0A 1RBUA 3ASMA 3AVMA 4ZP7A 1F21A 1TQLA 2V4QA 3L2UA 2FJXA 2PY5A 2FVSA 4NLSA 1SL2A 2WTFA 2B6AA 3M8PA 4EBEA 2IA6A 1WSJA 1IKYB 1RDCA 4FLXA 2IJFA 4LSNB 1NKEA 4NZ0A 3VA0A 2F8SA 3AVHA 3RBEA 1J9AA 3QIDA 1T8EA 3ZSOA 3OHAA 3EPIA 3VQEA 3T5LA 4CHNA 2EC0A 4CF9A 1S49A 2HNDB 3AA3A 2YKNB 2UUWA 3D45A 2FBYA 2AU0A 1YTAA 2W9BA 3DRPA 4CK2A 1U4BA 3G6VA 3N6LA 3CJ3A 2HNYA 2ZE2A 2CJQA 4GVMA 3IN5A 3C6TB 2G8FA 1S9GA 4RNFA 3HVWA 4RW8A 2P5GA 3QGGA 4QAGA 1EP4B 1VSJA 3LP2B 1C2PA 1A5VA 4CE9A 1X1PA 4FJHA 1FKOA 4YP3A 3OYFA 4ID5B 5KFDA 2A1SA 2VG6A 4DG1B 1SL1A 4CFDA 1S5JA 4FZZA 2X6SA 3LP1A 4F8RA 3VQAA 4OKKA 2G8WA 3SV3A 4O44B 2ATQA 3RMCA 2DFEA 4NLWA 2RPIA 1KVAA 1NJZA 1HYSA 5DK5A 3CFOA 1TK5A 4ED3A 1O1WA 3LZIA 3SPZA 5CY4A 3V4IA 5L1LA 1S48A 4NLXA 4DMNA 4ZHRB 1GX5A 1TL1A 4I7FB 4DTOA 3MR6A 4IBNA 5KG2A 1T05A 1BL3A 1CSJA 3RAQA 2Z1JA 2FJWA 2HHSA 5KI6A 2PYLA 1I3AA 1RA6A 4TY9A 1QSSA 3H40A 1NK7A 3OYNA 4NLOA 3PR4A 1JLGA 4CFBA 2F8TA 4IOBA 5F8JA 3AVBA 1SH0A 4CCHA 1RCHA 3SNNA 2Z1IA 3NBPB 4F3OA 4FJKA 1S6PB 1JL1A 3PZPA 5CZ2A 2HWHA 3T5JA 1J5OA 4RW9A 3GIMA 4XPCA 4H8KA 1D9DA 2GBZA 4IG0B 1TK0A 3O3GA 3SCXA 4K4TA 3OL8A 1NK9A 1FKPB 4TY8B 4B9VA 5KFZA 3K5LA 3MEGA 4EBCA 3DLEB 2LSNA 2YNIB 3G86A 1S6QB 4CJSA 4PQUA 3T19A 1W25A 3OS2A 5L1KA 3KJVB 2QV6A 5F9LA 5KFVA 2ASJA 4J2AA 1CLQA 4KTZA 1UAXA 1JKHB 3M9OB 2O4IA 1IG9A 5CYQB 1SV5B 2O5DA 4E7JA 2YHBA 2OA8A 1EETA 1HQUB 1NK6A 1D8YA 3ISNC 2W9AA 4CJKA 4YR0A 4L8RB 4DL4A 4CF0A 5KT7A 3LP3A 5DQHA 4CJ5A 4LH5A 3LPUA 4ZTFA 4YQWA 4KHRA 4WYLA 4Y1DA 3CYMA 3KK3B 3JSMB 4DFPA 4LH4A 1BCOA 4E1NA 1RTHA 4J9PA 1KVBA 1S9EA 2D7SA 3H98A 3GIIA 3OYMA 1L3VA 2AX1A 4MK7A 3QLHB 1RTIA 5HP1A 2KZZA 3ZSVA 3CVKA 3FQLA 3QGIA 1DTTA 5KFXA 3DYAA 4O5BA 2XCAA 3HO1A 4EO8A 3MAQA 4TN2A 2HMIB 1BCMA 2HWIA 3KD5E 1T03B 1NJYA 1JL2A 4NLRA 2FLPA 4ED7A 4HYKA 5KT2A 4CF8A 4XO0A 1TGOA 4CJVA 2DFFA 2AX0A 3H59A 4ZMMA 1QSLA 1TV6B 2W7OA 3DRRB 3OYAA 4CEDA 5FDLA 4RNMA 2IAJA 1VSMA 3KLEB 1N5YB 3PJWA 5KFCA 4FLUA 3MTKA 2IM3A 4FYDA 2AQ4A 4Y34A 5KG5A 4JS4A 5D3GA 3LAKA 1BQMB 1HNVB 4IKFA 4RUAA 1X9WA 4OLAA 2OPPA 3ALYA 2XGPA 4B3OB 3P5JA 3TAMA 4ZVHA 2RDJA 3TI0A 3AA2A 3T5KA 2I1RA 1TKXA 2Y1IA 4M3UA 3U6FA 2QKBA 3AO5A 3MECB 3H4BA 2HHUA 4Q8FA 1JLFB 1EXQA 4F4ZA 4CFCA 4QPXA 1IKVA 3OYBA 2W9CA 1BIUA 3VQ9A 1N6QB 3IGNA 1Q9YA 4NCBA 3CJ0A 2WOMA 3CDUA 4YMEA 3L8BA 3H5YA 5EUHA 3LWMA 1RT5A 4J9LA 2VG5A 5KFBA 4KKOB 3V1QA 5DG8A 1S1UB 4F4WA 1C6VA 5KG6A 3ZT1A 3ZT2A 3SUOA 4BDYA 3I0RB 5F8LA 3VQ5A 4KI4A 1NNDA 5C25A 4FCYA 2WK4A 1S1WB 4ICLB 2W7PA 3BDPA 1LW0B 4B9NA 3ZSRA 3KHHA 5L9XA 2WB4A 4CEBA 4WZQA 4ZTJA 2W8LA 3OYEA 4H54A 1U49A 4BWJA 2B6AB 3M8PB 2ATLA 4FZXC 4OGCA 2XGQA 2NUBA 4FJIA 4B9LA 1LV5A 3LAMA 3OS0A 1UA1A 3PVXA 3M9MB 4IRCA 2J6SA 1HNIA 2YV0X 3N6MA 3KHRA 1KTQA 3N6NA 4E7LA 1VSEA 3T3FA 1TAQA 1RTJA 3AV9A 3NH0A 3ISND 1RDDA 4DQRA 3KLHA 1VRTA 3QNOA 2R8JA 4M3TA 4FW1A 2R8HA 5EWFA 3NKYA 4N76A 4LQ3A 4K8XA 3HSTB 1L3SA 2W9BB 3DRPB 2W42A 4FLVA 5I3UA 3KTQA 4FJ5A 2BGGA 3MXMA 2HNYB 2ZE2B 5DLFA 1A5XA 4Z4HA 4KFBA 3RBDA 2YNGA 2JEIA 4XIUA 2E4LA 3RRHA 4J9SA 3DLRA 1JLEA 4KB0A 3EYZA 1S9GB 3KK2A 4RW8B 3OYJA 4Q5VA 3HM9A 4MQ3A 4CEAA 1U45A 1NOZA 2HVHA 3GILA 4M41A 2BQRA 3A2FA 1JLBA 4K4ZA 1WLJA 1XHXA 1FKOB 5JS2A 3LWLA 2DTUA 4KHNA 3MR3A 1RT6A 4E3SA 4QW8A 2VG6B 5E41A 3SUQA 4WXOA 1MU2B 3LP1B 3BSCA 1R0AA 4C8MA 3PUFA 1S1TA 5KFTA 1JXBA 2JEJA 3HVAA 1NJXA 2IOCA 2JLEA 4EP5A 1HYSB 2OZSA 3SI8A 1JXLA 4RNOA 5C42B 4RZRA 3V4IB 2RF2B 3QZ8A 2O4GA 2AGPA 3E51A 3KOAA 3ZCMA 2IBKA 4FK2A 1TL1B 5KT4A 5F8NA 1T05B 4CJPA 3CFPA 5HROA 2HHVA 2IDOA 1JLGB 3VQ7A 4WZMA 4HCBA 4NLQA 3UQSA 3SUNA 1J5OB 4RW9B 2XHBA 4K4UA 2ALZA 4KO0A 4B9TA 4H4OA 4Z4EA 4IDKA 3WNEA 3CDWA 4KBIA 3DLBA 2ILYA 1RT2A 3MEGB 1QSYA 4IG3A 2P5OA 4FK0A 5F8IA 1S0NA 3V9SA 3K58A 3TAPA 4PQUB 3RRGA 3O3HA 4AILC 3OLBA 5T14A 2HHQA 4N56A 4ELTA 1WAFA 1NJWA 1SH2A 4DL6A 1NK4A 1EETB 3QEVA 2E6LA
chains in the Genus database with same CATH superfamily
2J9DA 2CPJA 1A6LA 3BZKA 3KNAA 5BJRA 2CPHA 3JQJA 2HZVA 2D9PA 1R8HA 3JQMA 3BN4A 1IBCB 4PHTX 2HW3A 1RTHB 4ANCA 3D0HE 2G0CA 1S0OA 2ZJPL 5ETLA 3TAFA 4JI1K 1EQYA 1NB7A 1BWVA 1E4GT 3H42A 3TWHA 3KJNB 3E9PA 3CXCM 1RTIB 2VASA 3FBFA 1JLQA 4J9UE 3W62A 3BYPA 4ED4A 4DR1F 2E9RX 1NDPA 2QZ8A 1RT3A 4C8OA 4HL9A 2OPRA 3D66A 1YBTA 2Y8YA 1PYSB 4QWCA 5KFQA 5GAEI 1EKRA 4R8UA 3G8SA 2BJEA 1NK8A 2LQ9A 3TQ1A 4DV0K 3LDSA 2IM1A 3DXKB 2QMXA 1XK8A 2E29A 1T0TV 2IAJB 3CW2C 3UD4P 4R5PA 2BJ1A 3R3LA 2Q6CA 4IRDA 4D3HA 4M94A 5FRNA 4LQ9A 5JMVA 2J0QD 2DGVA 2H5EA 4RNHA 5D0RA 3O8MA 1TKXB 1QUPA 2VFTA 1UMJA 2AWZA 1QTNB 2ASLA 1FA0A 1WSFA 3ONQA 3L7UA 3PV8A 3BO4A 1IKVB 4LR8A 3OJUA 4RUCA 2HHWA 2WOMB 1OS5A 2DH7A 4ECXA 5B08A 2DNYA 2QLXA 4OX9K 1NKCA 3IR7B 3EZOA 2XC9A 2FF6A 4NLTA 1P6TA 3VQQA 4DL3A 3VGLA 1B0PA 3J80U 1X9SA 2VHGA 3MWPA 4ZVUB 1ZYQA 4CQ1A 3I55N 1ZC6A 1NZ8A 1IBKK 2DPNA 5HBMA 1N32F 2JEGA 2DRDA 3SCKE 4CK1A 3OS1A 4URQU 5AXKA 1AFJA 3ZXWA 1RWXB 4QR2A 4TSXA 1Z26A 1YJ7A 3BGUA 1NHUA 5CZXA 4YOVA 1K8AO 2MB0B 4DTJA 2JL9A 3IM8A 1MWZA 1WF2A 1RDRA 3GJTB 1BHNA 1YT3A 4E1JA 3O3FA 3X1LB 1FRXA 1HNXK 1VQ6S 3BGRA 1TYQB 3RMBA 2KH9A 3HI0A 1NB2A 1ZA2B 1OO0B 3P3DA 1IJEB 1VOMA 4CI0B 2JDJA 3L6QA 3UDLA 1NK0A 1GH8A 1NGAA 4JI7F 2LDIA 2DGOA 1UVMA 1RWPB 4QWDA 3LGMA 4RU9A 2CH6A 1KD1O 3OYDA 4Y3CA 2YNGB 2HBKA 1JLEB 4ENOA 3KK2B 4DEZA 1X4DA 1WUUA 4YN3B 1IBLK 3VAJA 5U47A 3CIPA 1U2RA 1D8ZA 3GV5B 1FERA 2XZDB 4RWWA 1JJHA 4OZNA 3GR1A 4KH6A 2HIQA 4JKGB 5KPTA 4V19S 4YDUC 1RSCA 2DKOB 4PG6A 1BE4A 4C8YA 2FC0A 5K20B 1F9HA 3OHBA 2G1HA 2ZWHA 4J2DA 3G82B 3OBIA 5CAAA 5J1EA 3R3TA 3CXCR 5IC4B 4C48A 1OPIA 3M3ZA 1VJQA 5I4MA 4LF6J 4BACA 2GHPA 2UXBK 3RAMA 2AYMA 2BBEA 1LWEA 4MDAA 1QHTA 1EQMA 5KQDA 1YTUA 4B1UB 2BH1A 3EXYA 4X64J 4H4KC 5KT5A 2M2BA 3RR7A 4M5DA 4DR2F 3IRXA 1K0TA 5DDQC 2F8EX 5DETA 5AQGA 3SDEA 2VPXB 2V52B 3CC4N 4IG3B 1CZBA 3GYXB 1YJ9S 3D5MA 3MM5A 1WOQA 4KHSA 5IT4A 1U2CA 3PKYA 1VHIA 3SIPB 4I68A 3MEKA 5HVFA 2NRZA 4PKHA 1CJTB 1YIJN 1KAZA 3ZZ0A 1Q4RA 4FF1A 4LF7J 4E2FB 1KFDA 5DM6Q 2ZC3A 4E89A 4FWMA 1IM4A 1FTRA 3KKSA 4DTUA 3MTJA 5ETQA 3ENHA 1P27B 4CJWA 5G0RA 5A6PA 1YI2N 4NLYA 3CT9A 2BJ3A 1Q1KA 1NJIO 3MMJA 4CERA 4KGXB 4GV9A 2HHHJ 2OTLN 1K1SA 3LP0B 1WTBA 3GCXP 2KVIA 3PW7A 1MMDA 2NCKL 4KV8A 4HDHA 2D0CA 1VSLA 3FZLA 2V9WA 1N5VA 1OJ4A 3P96A 3NVMA 1SJ3P 4ZVRB 1ZETA 3KLFB 3KHGA 4KGZB 3CC2S 4DV2K 3CCES 4IOXA 1QVFM 3E9OA 5IQ6A 1KQFB 2CQBA 3NNHA 4DV6F 2LQ5A 3QJPA 2KXFA 2BE7D 3BKFA 1QQCA 1LCUA 5F8GA 1ZTTA 3M1VA 4DPOA 2OEMA 3R27A 1VRUA 3VZIA 2DGSA 4WFXA 3NMAA 3PYDA 2J7WA 2VF3A 3SBMA 1NHVA 4OI3A 2B9EA 3B4MA 1EKEA 2CUYA 3Q23A 5LJWA 4LBHA 2XS2A 4OJ1A 2CYYA 3VEZA 4EMDA 2UVVA 1E6YB 3W8PA 3DXBA 4DSJA 1DHMA 5C24A 2HQGA 4CDIA 1OPZA 5KT6A 1UWBB 5HLFB 4DR6F 1C0UB 1HARA 1FJEB 4DR3J 3J7YI 1VQYA 4Z2XA 2DGQA 3KLGA 5DQGA 3QYYA 2FTRA 1HNZK 3C66A 2UZAA 4IOAQ 1RWUA 1S22A 2KTQA 1FX2A 2DHXA 3EWGA 3L2VA 2VPZB 3U1LA 2QWMA 3WNFA 4H5WA 1HQUA 4FM2A 3BBFA 3TZWA 4OJGA 5KFRA 3FFKB 2IRYA 2C2ZB 4CHQA 1SQKA 1R7IA 2BJ9A 1FO1A 4KSEB 3EKSA 2JOQA 2CG8A 5FPNA 3SPYA 1IQTA 3BY5A 2CGKA 1M1KT 4U8VA 4FXWA 3NAEA 5AT1B 2Z1HA 4RW6B 2CNOB 2IDLA 4HTUA 4OI2A 3VCDA 4N5SA 2ZZTA 1SCJB 1WHWA 4L6V3 1UPPA 3FZHA 1QAJA 3N28A 2ZH3A 4EZ9A 1TU0B 2Z30B 2R3VA 4NZ6A 2Y0SD 3CM5A 1RT1A 1WD6A 5DM7Q 5DLGA 4K4WA 3DMJB 4KE5A 5IM0B 3FGVA 3D7EO 4BC2A 2CNLB 2RILA 1EWQA 4DV7F 5CHCB 1SJRA 3R97A 1X9MA 3QJJA 4LF2A 2DBBA 1HHSA 3NAIA 4CTAA 3HTVA 2W4CA 2Q31A 2D3UA 3VESA 4B9SA 4YOYA 5JS1A 3S3MA 2OPQB 1U09A 1RGIA 1FJGJ 4ZITA 2FLOA 1UW9A 5HK4A 4GNIA 1U1PA 1WSRA 3HHKA 3M8RA 1RLDA 2IVOA 4CZIA 2GV9A 3CWJA 1VQPN 4DLGA 2B8QA 2AYGA 3D28A 4CZJA 4DL5A 4HR2A 4KRFA 1HBNB 1S9EB 1H2VZ 4USTA 2NYHA 2N82B 1BWFO 4JK7A 1NH8A 2WW4A 1Q8LA 1S5ZA 2BXJA 5HQMA 3GFZA 4N47A 4HHTA 3J80O 3JYTB 2F65A 1YUWA 2BYCA 4CJQA 4FLWA 4ECSA 3FGUA 4FWQA 4O0IA 2DPJA 1FXRA 4A48A 1VISA 1QVFR 4F3TA 3MI7X 4CVNE 3I0RA 1DTQB 2ASOA 4DFJA 1M5PC 4QU6A 3OVSA 2BE2A 1R3NA 4Y2IA 2GEMA 1U2VB 4F50A 4O4RA 4DR7F 5M2RA 4ILRA 3O1BA 3JAMU 3DLLQ 2VWJA 4LFCF 3RVCA 1YRXA 3CJKB 1NDLA 4OPJA 4JI4F 2J0SD 3WDOA 4LRFA 3TJ8A 4NB4A 2E20A 3V2UC 1FK9B 2B3TB 2KT3A 4ILJA 4CEOA 1BHLA 2RQCA 3K5PA 3ULHA 2NRXA 2F4VF 5KOWA 1F3VA 2AP1A 3G6XA 5HRPA 1QE1B 4NYZA 2XY8A 1RWMB 2ZITA 5GAGP 2JFDA 3MR5A 3GQCA 3H1QA 2GVZA 2ZKTA 3PW0A 4WE1A 2NZCA 4N41A 1LWCA 3CCVN 5IWAF 3P4IA 3A13A 1S6UA 3ETMA 2KG1A 2BOPA 4FM1A 1Q81O 4LFBJ 3WC0A 1F3FA 4R25A 3TR8A 2Y1JA 3OD2A 4Y00A 1CULA 3WX4A 3Q7BA 2ZJRL 2ASDA 4I2PA 3VGMA 1PYOB 3PO4A 2NRWA 4MKVA 3NGDA 2P9UB 2QYGA 3IXQA 3BQ1A 2DPIA 2VQEJ 2WBRA 2G2ZA 2UV8G 2YTCA 1O13A 1RAIB 2XZTB 5C42A 2A41A 1VK8A 2OPSA 2A1BA 2Q3PA 2WZ1A 2FBVA 1VSFA 1VDHA 3CIZA 2R7UA 2QA1A 3ULDA 3IR5B 2AZ1A 2VCPA 1VFJA 2J6TA 1FHTA 4LF6K 3A5NC 2QN6B 3UDVA 4Z4IA 3SMZA 1VBKA 1DARA 3KDOA 4Z7CA 3A8KA 2VBZA 4QCLA 1HNWF 1RADB 2QWRA 1FCAA 1JB0C 1PGZA 5C12A 3MR7A 1I1GA 2CZ9A 4X64K 4CO5A 4ZLJA 1NG9A 2AT1B 1KLMB 2DB1A 4ECTA 2ZD1A 3AD7C 1Y64A 2YQ3A 1S1XA 4U7CA 3ZX0A 4YY3F 1I94F 5E26A 3PRVA 2W6LA 4DTSA 2J0XA 1NPKA 3HVTA 2MKYA 1S7IA 2DXFA 5G4DA 4YDDB 2ABYA 3PXGa 3CJCA 2A5XA 1BA0A 4FWRA 3AVFA 2VJUA 4B3SK 3R1LA 3H45C 3H0PA 1T6CA 5K14B 4PG8A 2GJFA 1VC6A 1DFDA 2ZGZA 1BXNA 5BREA 1IJFB 1D3WA 1WG5A 1R89A 2XB2D 1ZBLA 2RVJA 4LF7K 4OLBA 3I5CA 2QSFA 4HT7A 3EE3A 2Q0UA 4DUYJ 1MN9A 4C7QA 3PR5B 1FFSB 3QRPA 1HBMB 4DZDA 5AQYA 2AHOB 3MEDA 1ELOA 2XNRA 1TKZB 1OIAA 3IKMA 1KCFA 3DOKA 1H2UX 1JIHA 2A10A 4J9RA 5KFGA 4PUOB 3W64A 2I5JA 2HHHK 1L5UA 1BQNB 3BN7A 3GOIA 3BZCA 4DSLA 3D0PA 3TAEA 1HKBA 1Z2ZA 4ED5A 1Y00A 4DX5A 3RB3A 4FO0A 4WWSA 3PX0A 1VQ5S 1HKGA 1REGX 2J9EA 2PC6A 3QERA 2D41A 1HMVB 2CVEA 4LSNA 2PMHA 3J80Y 3CQXA 3NS6A 4EZ6A 1VJWA 4C1NI 1RJJA 4CLFA 2RU3A 3K5MA 5HQLA 2AMCB 1UPMB 3ZEUA 3UO0A 3WXIA 4HT5A 5A8WA 5AZIB 1RUSA 2EW9A 3HSDA 4CLKA 3BM7A 3QATA 4WFBQ 3CJBA 4ZOSA 4YOXA 1X7VA 2VKZG 4B1XB 3LQVA 4M1KA 2E5LJ 2YKMB 1WHXA 2DO0A 2QA4G 5F0UA 1S4FA 3DHWC 5HANA 1X5TA 4V19X 2MQ8A 4AHTA 2V34A 1NLVA 1QVGM 1O5JA 1HWUA 4DUZK 3ZZYA 4WFNL 4DR3K 3DGPB 4FXVA 4MK8A 1WACA 4ZJOA 1GLFO 4DG1A 3U3YA 2LVWA 3R7BB 1KEKA 4O44A 1WKJA 4CGDA 2OGUA 2DNZA 2A2DA 6FDRA 3SAGA 3G9CA 4LF9J 4UOHA 4OLOA 1KP6A 4I7FA 4KTQA 2ROGA 2ZM6F 4ZPWR 2UP1A 4AHSA 1BISA 4A8XA 3OVBA 3U1MA 4R5PB 4ETXA 4ZLNA 3B6PA 3AVLA 1SKSA 1X5OA 2LXFA 3H5XA 1KR4A 4I56A 1S6PA 2CQCA 2C2OB 2EFOA 4E7IA 1BDGA 2HEKA 4DFMA 4BGBA 3OA9A 2DH9A 1P9QC 1RABB 1Y5LB 2HAIA 3ZSXA 3IS9B 3M2VB 4TY8A 2YQ1A 4BROA 4ELVA 3IAM9 2DCUB 2G8UA 4NA2A 2FHMA 1RTDB 2A6MA 2BDPA 3H08A 5FLXU 2PAVA 4HTJA 1ZBHA 2D4WA 1UEVA 4Z4GA 3KJVA 4E8UA 2FQQB 3O4WA 2NUUG 3FCVA 4FW2A 4JI6F 1LWXA 3AODA 2DHAA 5A8RB 4DSFA 4L3NA 2NYIA 2IVPA 3K7RA 2MTLA 1K6YA 1FJGK 2QG9B 4YEAA 4DR1J 3TA2A 1I3OB 2LQJA 2GAGC 1HQEB 1VRQC 1R6YA 3N9UC 1KVJA 4ZVGA 3MPUB 1FJCA 3NMUA 3CMQA 5KFLA 4AM6A 2GVDA 1F1BB 2DYAA 3L2WA 4WK1A 2G8KA 3V6DB 3A5OC 4CO3A 3RAXA 4BC3A 3BGRB 3W5YA 3DKDA 2JEFA 3U9DA 2RHSB 2SXLA 2O8CA 4DWIA 3C19A 3OBYA 2AEJA 3EVMA 3HHEA 2HMIA 4RBUA 4KB1A 5KFIA 1T03A 3NS5A 2O8EA 2E2OA 3P1GA 1WSHA 4A8KA 4PL7A 2YJEA 5IFMA 5C5JA 3JAMO 1T3OA 3O4QA 2KO1A 3GFYA 2D1CA 4QWAA 1A5WA 4BRLA 3HT0A 4BG9A 2KDOA 1R6VA 4NX9A 2L48A 2DNQA 3H5SA 4K2XA 1WDTA 1TL4A 1J54A 1RT4B 1NDKA 4NO7A 3NAHA 2EKYA 4WQ5C 4MO5A 1QVGR 1N32J 3C6UB 4QIFA 2MLZA 5J1EB 3MECA 2IRXA 1JLFA 2V8DA 3W2WB 1C0TB 4I67A 3IBFB 1N6QA 1BA1A 2R7XA 4NCGB 1I39A 1ZBSA 2V0NA 2DHHA 4RU2A 4KKOA 2W40A 5H9FJ 2YKPA 2P9GA 2ACMA 3RWUA 3V9UA 4USVA 1FESA 1SL0A 3AA8A 3OXLA 3N0VA 3IP0A 2G8IA 1S57A 3T69A 4Q7AA 3AVMA 3KG0A 2V4QA 2FJXA 3H25A 1H2TZ 3M8PA 1EWRA 3T1HF 2IA6A 1WSJA 5BPMA 3G71S 2C2NA 2KT2A 2JLFA 2V5HG 1RDCA 2CJBA 2PFFB 4Y2KA 4LC9B 3VA0A 3ENWA 3T7ZA 4GVBA 4JP8A 2YH0A 1VYAA 3UD3P 1DGKN 2W24A 3HJVA 5KAKA 1K8KB 2DHGA 3W66A 2YKNB 3WIVA 2AU0A 5AQWA 2W9BA 2EFPA 5T7LB 3CGIA 3G6VA 2HNYA 1YSJA 3EVOA 4V1Ak 3IN5A 1RHMB 3THYA 1S9GA 5AQRA 4K0KK 3QGGA 1U6FA 4QAGA 4K41A 4IO9L 1A5VA 2MMYA 4L3QA 3G2XA 2XMVA 2RUSA 1F5AA 4A47A 1XMOJ 3OYFA 1UJ4A 1VGYA 1B7FA 1RDWX 4CFDA 1S0VA 2WSEC 4DR2J 3D68A 4CD1A 2JVRA 3U8XA 1QHAA 3RMCA 2DFEA 4NLWA 4PKDB 1Q82T 4ED3A 4U96A 2ZOMA 2IYGA 2K06A 5CY4A 3B54A 2I6WA 3JTPA 4NLXA 4YB7A 1TL1A 4JD2A 3MR6A 4IBNA 2WUSA 2ZWPA 2HHSA 2N7YA 4DUYK 2UXDF 4NLBA 2DY9A 1I3AA 2LMIA 1NK7A 4BREA 1Z1ZA 1JLGA 2RE1A 4CCHA 3C7NB 1CVJA 3SNNA 3ZTPA 2Z1IA 3NBPB 5CA5A 1JL1A 3PZPA 3GIMA 2HZCA 4H8KA 2GBZA 1FDNA 4IJNA 1RAGB 3SCXA 4K4TA 2M70A 1O0PA 1FKPB 4B9VA 2Z56B 2GW8A 7FD1A 3G4SS 3DLEB 2I0XA 4PQUA 5L1KA 2QV6A 4CZGA 5A8KB 4JEPA 2ASJA 2CPZA 3CMAS 1ZPWX 1DQ9A 1RU2A 3D2FA 1SV5B 4OI4A 2ZHBA 1CQNA 1HQUB 5AJ3J 4QZVB 4YR0A 4DL4A 3ENAA 4HACA 4Y1DA 1CS4A 4OLPA 3JAMY 3KK3B 3JSMB 1WOPA 1N8RT 4E1NA 5HMWA 4A57A 3FJ2A 1NU0A 2IJRA 2W7AA 4DV6J 5FPMA 3HLUA 2P9SA 2MQOA 3H98A 2HRTA 4R79A 3J7Z5 4NOHA 4H5VA 5HP1A 2ZBRA 3NNAA 1RU1A 4UY8O 1U1KA 3FQLA 2F9WA 3DYAA 2NPFA 4PYDA 4EO8A 2DXDA 1UFLA 4DV3J 2HWIA 3VEYA 2FLPA 4J37A 5L38A 3IWLA 3UCZP 4P6QA 1UTAA 5KT2A 4JKCA 4B3MF 3CPEA 4H5RA 4H03B 2UUCJ 2JWLA 1QSLA 3CUNA 1HX1A 2YPYA 5AZJB 2KRRA 3OPKA 5AE2A 5GVQA 5AQOA 4KC5A 5E3PA 3K0JA 3W5XA 5KFCA 2IM3A 4ZCIA 3NCQA 2LQBA 2EFGA 3FR0A 1XMBA 1JK9B 1Q7YT 2E1CA 1X9WA 3T1YJ 4H5TA 3WXMB 5LMUF 2DD8S 1J6ZA 1Q79A 1PYTA 1SC4B 1ZH5A 4ZVHA 1VQ7N 2VQFJ 1PBUA 3HHLB 3FVYA 2I1RA 2Y1IA 4BR9A 3GJRB 4QBUA 3AO5A 2KYZA 5FLXO 2P9IA 4F4ZA 4IQMA 4XAKA 4CFCA 3OYBA 1FI4A 4YMEA 2Q43A 5DG8A 1S1UB 3B6BA 1QZ5A 2LQ8A 4IWVA 3ZT1A 1RDUA 4BDYA 3UN5A 2E5JA 3LL3A 3I0RB 4JHDA 2HRUA 1UW4A 4FCYA 1S77D 4ICLB 1ESVA 3BDPA 2P9NB 1LW0B 5L9XA 1EIYB 4WZQA 1YZ7A 2DJWA 2XQCA 4GKJJ 1OMSA 4BWJA 4Y28C 2ATLA 4DR1K 1Q7LB 4OGCA 1Q0NA 3LAMA 2RH3A 1T02A 3W3DA 2J6SA 3IO1A 3MCMA 1E6VB 3CCSN 1KTQA 3N6MA 3N6NA 3CJ8A 3QNOA 2P2CB 1X3MA 2R8HA 5MLCV 2VOOA 1IBMF 4U67Q 4UQTA 5E3AA 4ZCMA 3US5A 5DDPC 1G4CA 3HSTB 3HHNB 1ZM3A 2MQNA 3MM7B 3M2UB 3D4JA 2CDQA 2HS3A 3KTQA 2V8GA 3ZTQA 2CGJA 3K0SA 4TKTA 5IZHA 2ZH4A 4WTOB 2E4LA 3DLRA 3QICA 4MQ3A 4DCPB 1LNQA 2FZKB 1SJFA 1U45A 3A2FA 2HK2A 3A3OB 3U27A 3A5MC 4HHUA 3MR3A 2ZBIA 1UVLA 2MDAA 3I4HX 2V2QA 2LP4A 4C8MA 3UE5A 2HKEA 3AD8C 1S1TA 1GT8A 1JXBA 1GTHA 1NJXA 3SI8A 4A4JA 5AE1A 1JXLA 3H7HB 3HMJG 5C42B 1URNA 3V4IB 2D3OR 1N32K 2VOPA 3ZCMA 2DGTA 1WOSA 5BYQA 4OQJA 2NSCA 1T05B 2ZDPA 2DRBA 4EHTA 1XC3A 4TU8A 4RO0A 3AARA 2HHVA 1FX4A 2IDOA 2C2MB 1N36J 2FGCA 4HCBA 1HI8A 3CCQS 5H9FK 2YWFA 3SUNA 3LA0A 5C7PA 1NPRA 4EIAA 1GXUA 4K4UA 3A0IX 4YB6A 3LDQA 4H4OA 3TSUA 3HOSA 4Z4EA 4C3MA 1D9AA 1RT2A 2P5OA 4OHXA 4EFAC 2XEXA 1GEHA 5IWAJ 3TAPA 2RB7A 4AILC 2ASMA 3BKTA 4BR4A 2DXEA 5D4LA 2HHQA 4ELTA 1SH2A 1OYDA 2EWHA 2E6LA 3O5TB 1Y10A 4DMZA 3BREA 4BY9C 1TUGB 2VWKA 4AM7A 5T41A 1M5KC 4OPKA 3T6JA 1BY9A 3TR5A 1X4HA 4DHVA 2KFNA 2Z57B 3RMDA 1XEZA 1VQLN 2P9KA 1SS6A 2KFZA 2IS3A 4J9MA 1QTMA 4CJFA 1TR0A 4YHHF 3W61A 3AAPA 4W5RA 3KIOA 4ZVEA 4LVNP 2W8KA 3MXIA 1OY8A 3QESA 3D1OA 4GKKF 3SXLA 4OKEA 2QO3A 1XMOK 2MSSA 5A76A 4P74A 5FLXY 4X62F 3UNYA 2B43A 3LALA 4DR2K 3U9ZA 4AHRA 4LF5F 4J9KA 2OTJS 4YY3J 1I94J 4DX6A 5FD1A 5JVGQ 4HI2A 1ATNA 1NOYA 5FDLB 2FD2A 1RBAA 2XY5A 2DH8A 3LPYA 1EKSA 2IBOA 2AJFE 3HHLD 4NXNF 4B1WB 3O9UA 4RL1A 2ZH8A 2VFRA 2VBXA 4JI0F 2GX9A 2OPPB 4B8AB 1JJ2M 3ITHA 3M9NB 3V81A 5CD4A 4FWPA 2NXUA 2E44A 3OR1A 3UDCA 2EBEA 4AL5A 4H4MA 2X78A 2XY7A 4O4GA 3OUYA 1QS4A 5BPLA 5AR0A 3BSNA 3PM9A 3LUYA 2GWKA 2GMLA 1SQGA 4J9NA 1HLWA 5TKWA 3TOQA 3IWXA 2QGFB 3M2RA 5CH7B 3PW5A 1KKHA 1FE0A 4C8ZA 3BQ2A 3CB4A 1TAUA 1RBOB 3ENVA 1NBEB 4O3OA 4OKJA 2W2NP 2YHAA 4CBWA 3I9ZA 4PWDA 4MMOA 1IJJA 2IC3A 3PX6A 3CJAA 2EK6A 3HI9A 3VN5A 1RLCL 4QPTA 5C2GA 4RWXA 2HBQB 3ETOA 3GONA 2DY4A 3ZLJA 5MAOA 1RTJB 4DV6K 5A0YA 4F2RA 3H4DA 1LQ9A 3JTOA 1MWYA 1YBUA 3OTDA 4JUZA 1VQON 3QO9A 2QT7A 2KZMA 2OYQA 2OTJN 5GADP 1WKLA 3QMLA 4IEIA 4DV3K 4KHYA 1KHVA 2WONA 3FKBA 1FRKA 2I7NA 2CNNB 3I0SA 3RB0A 2RD5C 3TU5A 4RLEA 4C11A 1VR6A 3HCXA 2K3IA 4P2XA 4MIWA 3CMEN 1ASVA 2G8HA 2UUCK 5D15A 3KNGA 1Q95G 1RXOB 3FBEA 3OVNA 2J9DE 1G99A 3C3LA 2XHCA 4CZKA 4OI1A 3CJRA 1RT6B 3KKRA 2ADCA 1G15A 4QJVA 1DT9A 1JX4A 4UZCA 5HAOA 4URSA 1BIZA 4CZLA 3AHPA 3OT9A 4CHZA 3MEEA 4ED6A 1L3KA 3OYIA 4Y6IA 3NGIA 1FVSA 2U2FA 5CYMA 5ETOA 2CH5A 2DEIA 1R8AA 2ZM6J 3DLGA 3CJ7A 1VQ4S 3DLKA 5CZ1A 2MZJA 4AL7A 3MX5A 5D0GA 4BVOA 4ED2A 3VOVA 3VTIA 3TABA 3ZZPA 5M1NA 3VVUA 2ZNZA 3I96A 4USHA 1IN0A 1QAIA 4MIAA 4UOCA 4K8RA 1XQSC 3SBGA 4M3YA 3RYLA 2Y0BB 4DTXA 3F41A 1U8WA 2O8FB 4KGMA 4P75A 5K8NA 4IH5A 3H20A 4M5NA 4NLUA 4IDKB 2E2QA 1YBAA 1DJ0A 3BP8A 1UWAA 4CEQA 2WW8A 4CEEA 3RBXA 3MAAB 2C22A 5IV3A 4RPFA 3O44A 1J5EF 1JJ2R 4ZKAA 4QS8A 3TP2A 4OJHA 4DV7K 2GTDA 3GB0A 2XCPA 3GPAA 4NMXA 2ZGYA 2L9WA 4JI6J 4YDUA 2XSJB 3D6HB 5DM6L 3EGZA 3PIPQ 2QW9A 1VSDA 1LEOA 5KFYA 1U1RA 3A8YA 2QWOA 3Q8SB 3M8QB 2C3OA 5CABA 1K1QA 1GOCA 1OVQA 3G8TA 4OYAA 1QY7A 3GCWP 2HG4A 1P8ZA 1EHWA 1PC4A 5D6GA 2H4YB 1U24A 3Q83A 4H4KA 2DR5A 3SAFA 2CIMA 3EE8A 4RCHA 2QKKA 2HFVA 2P9PB 3VALA 3IWNC 2HFUA 1SBRA 1V5VA 5ETSA 3DOMA 4C0OC 2E1MC 4IFVB 3M1FA 4PKGA 4BQLA 3D54A 4C8KA 2LFVA 4EUVA 4IOCQ 3K57A 3LPEA 3QEPA 3UCUP 3G0ZA 2D0BA 4FZVA 4YFUA 5IS2A 2OCEA 3HK2A 4NLPA 1RGVA 2RN2A 2DY1A 2GGPB 1U6BA 4X4OA 1W0HA 4XTTA 3GDQA 3DM2A 3MCNA 5E7OB 1U0HA 4JV5J 3OL7A 2AP6A 1QQNA 4OMFG 4WQ4A 1UFWA 1DEJA 1HR0J 1AW0A 4DSEA 2FZGB 3DRSA 2FIUA 2A3JA 2QEXN 3OYCA 3HSGA 1N36K 4JI4K 3VAKA 1Y97A 3MF5A 4L74A 3ENQA 2ZVIA 4HCCA 4I2QB 1Q5VA 4ZN3A 3KKFA 3QAUA 2F4VK 1LWFA 1XR7A 2B9WA 4CRJA 3R9PA 3CJQA 1HYVA 4HI1A 4IYQA 1D1UA 1X8DA 4BQZA 2GHWA 2QL7B 3SQ0A 3A3NB 5FIIA 4NA1A 1FEHA 4CLTA 4IOAL 3FSYA 2E7WA 1XMQJ 5KFEA 4WCEQ 1S76D 4X66F 4ILGB 3PJXA 4P2FA 3TO8A 3GFHA 2AEMA 1T44A 4AD6A 5IWAK 2R4FA 2JSXA 2V8HA 2WCXA 4USUA 4C0HA 3HL8A 5KFFA 5CYQA 3VQ8A 8RUCA 4FWOA 1KC8T 4KR0B 1S7HA 4JRQA 5KG1A 4O23A 5LL6d 3J7ZT 4NI2A 3AVJA 2RQKA 4EO6A 3BGFA 3CEDA 1SUQB 4KRWA 1OH8A 1ZM2A 2YNFA 2JNJA 2C28A 5F41A 4G1QA 1SIWB 4C1NK 4CJTA 2A0FB 3ATVA 4CBUA 2XI3A 3S6EA 2FBTA 3SI6A 4B9QA 4DB3A 4NYOA 2XY6A 2W41A 1BGXT 3VTHA 1M1KO 3J81j 5CCLA 1V3ZA 2DNKA 1TL3A 5AQLA 2A3ZA 4JK8A 4M3WA 1NXIA 4B1VA 4FPAA 1X4BA 4WFAQ 4CYUB 4Q0BA 5CHIA 1FNOA 1ASWA 2IVYA 2FB0A 1PCAA 1HNWK 1TVRB 5E3QA 2B5JB 2EC2A 2HBYB 4HUFA 1WORA 4JKFA 5JXSA 5KFHA 4ECUA 5DZ6A 2IVFB 5I42B 3EZUA 4JI3F 4BC5A 4I64A 2IGIA 2FY1A 4K4YA 4CJLA 4YY3K 3D2FB 1I94K 2BANB 4QWBA 3CCJS 2MQLA 2MHEA 2YBVA 1YJNN 2VA3A 1XN9A 1RB0A 4BR7A 1TUWA 2CRLA 5HJYA 4F0MA 5J2NB 4DDFA 2FF3B 3L2RA 2OAUA 3NH2A 1JLCA 4HUEA 4C98A 1LOUA 5DS7A 4USMA 3VQSA 3KZBA 4OHVA 2CQDA 3WBZA 1VQNN 4C0BA 4CHPA 1B64A 3HZGA 4EU0A 2UXDJ 2HRYA 1HW8A 3OSNA 2HFZA 5J2QA 2YI1A 5EHHA 2YCHA 2J6UA 1KQKA 2QFIA 2N3OA 2ATCB 3Q8YA 1WC1A 3HD2A 3MD1A 3TVKA 3EE9A 2GV1A 5GAGU 3G10A 4EK2A 9RUBA 4X2BA 1CQMA 2N4DA 5KFJA 1OYEA 1U1QA 3QNWB 4B3RF 2YWWA 2O3DA 2W2OP 4B08A 5LXRA 2UXCF 1NSPA 1JNZB 2ZDOA 5B0FA 1JLAA 3QIPB 4OI6A 3T5HA 1LOTB 4RG8A 1NGGA 1XNRF 1OY9A 4OGEA 4LF8F 1HI1A 3E01A 3T9NA 1FDBA 2W25A 2GQCA 3ZZOA 1TMMA 1ZAVA 2JZ5A 1SKRA 3BEGB 1M5VC 5F9NA 1VIXA 4KHUA 2G2OA 1NKBA 3D6TB 1ZZFA 3CC7S 4GV3A 3A8EA 3O08A 3NE6A 1A9NB 2BZ2A 4CJ7A 5DDOC 4FYWB 1TK8A 2E8AA 4DCOB 3JB9k 4ZPVR 4CGIA 2B7BB 2E2NA 1LW2A 4Y0FA 2F96A 1B3TA 2RSQA 4JI1J 3L95X 4RNNA 3TUIC 4CJ3A 3SV4A 3O9RA 5KFWA 1HPZA 1XBWA 4OHYA 3GL1A 1GLCG 4CK3A 5C10A 2HNZB 2A40A 5AQUA 4CH1A 5KG0A 3HVRA 5L39A 4DLEA 1OY6A 3IA0A 2WB1D 5E3RA 3BEXA 2BJ7A 4CEFA 4EFHA 3L3CA 3QAEA 3NF7A 4LREA 3FDSA 4WF9Q 3FEYB 1NGIA 4QW9A 4DHYA 2M8HA 1XWLA 3JS9A 4IFYB 3MMAA 1Z25A 3HYFA 1C1BA 1SC1B 4FKXA 1LFPA 4KI6A 5CE3A 4LRDA 2KM8B 1HHTP 2ZQBA 1VMBA 2AJ2A 2ZM6K 3W1YC 4KHWA 1KBRA 3DI6B 4BRAA 3ELHA 2HQCA 3LANA 4FJJA 3D6RA 3VGUA 3UKRA 2YNHB 4G3IA 2ZKUA 3ENBA 5RUBA 5AQXA 1N48A 3VQTA 3AVGA 3QSYB 3NWGA 3FRZA 3MMBB 2IM2A 3IAYA 3MM8B 4X4PA 3QFHA 4AHUA 4AQYJ 4W5QA 3QNNA 4Z37A 2MJUA 4UQGA 3H8YA 3CJ9A 1F9FA 4UTGA 3G6YA 2DNOA 1IKXA 5DG9A 2R7WA 5LY3A 1T9VA 3C15B 3I56S 2NRVA 4FJMA 3WQUA 4CIOA 5T7BA 1HKCA 3FCWA 3SZ2A 1FT8A 1ZS6A 4M5JA 1YHQN 2HMPA 1YTYA 4JI6K 3ZYYX 2FDNA 4DCJB 4PEOA 3LH2S 4FLTA 1DLOB 1RBTA 3AVCA 3SSRA 1SIZA 4DS5A 4OZ0A 1C0FA 3THXA 2NPIA 4MH8A 4CT8A 3MCPA 2I2YA 3BS9A 4LSLA 3MM6B 2PZSA 4PA1A 3UVJA 3DRXA 1KVCA 3HT3A 1KLNA 3RRKA 2LYVA 4TLQA 1XERA 4J2BA 2NXJA 2WC9A 5CZVA 3FEXB 5DMRA 4A5BA 4L73A 2BRKA 4K5SA 1NH7A 2Z2LA 3U1NA 2QMUB 5K9FA 3AXMA 3NGSA 5IT9O 2ROPA 1Y5IB 4A8YA 2FVCA 1IBLJ 1YG0A 1B9FA 3ZSWA 4C9DA 1UP1A 1MA9B 1UAWA 2M7SA 5JUMA 3DDKA 2A42A 3IG1B 3ZNJ1 4G9ZA 1T3NA 3P5TL 4OYIA 1Y3KA 4W5NA 1H74A 2HNDA 2R2TA 4UF4A 2P5VA 2ADBA 2VU5A 1NRKA 2MZTA 1RT7B 4K4VA 1GOAA 3CCMN 1VBYA 1L3UA 5J2PB 1KN6A 4OX9F 4ES3A 5KFPA 2N7CA 3UB5A 3J7A1 3NF8A 2RKIB 4WIIA 2UXBJ 4KHQA 4FWKA 3BO3A 4GW6A 4DL7A 1EP4A 2RIJA 1CJVA 2U1AA 3LP2A 3C8YA 3O2IA 2G8VA 4TVAB 4O8UA 3F2KA 4ID5A 2AF6A 1U48A 3KMQA 2FGOA 3FFIB 5ETNA 1JCEA 1I6JA 5IC6B 4RUHA 4DQQA 4C4WA 3OJSA 4DF8A 2CZ4A 2Y1RI 4JK9A 2J9CA 4U9RA 3LOUA 3ILLA 1FDDA 1FXDA 1GLEG 1AUDA 1YITS 2F8HA 1YVNA 5J2MB 1EAYC 5JJBA 2O8DB 2GIFA 3OVAA 3U4LA 1TKTB 2FJDB 5KPRA 3RMAA 4MFBB 3DDNA 6FD1A 3T1HK 4HUGA 3CJ2A 4RW7B 4CNZA 1IKWB 4FF3A 4M95A 3NOGA 3WT0A 3V6JA 2R2UA 2YVSA 4M5KA 2ZBPA 3VWSA 2XHWA 3NL0A 4K50A 4CNYA 1CPZA 4IG0A 1CJKA 1S1VB 1ZBFA 3RUBL 3Q8PB 2KQ2A 4OPAA 2FVPA 1WNSA 5KGXA 3PHTA 4I6MB 4RW4B 2FJBB 5EVZA 3S3NA 2FZCB 3U7JA 5AE3A 3DOLB 1S6QA 4Z7YA 2JGUA 3PSFA 4BRQA 3W60A 2KXHA 3KLIB 1VC5A 1B92A 4FP9A 4QS9A 2R8GA 4IZ9A 5HRSA 1JKHA 4C3KA 4NLDA 4YHHJ 4DCHA 4Z94A 5EOYA 1S99A 4USWA 3W2VA 2FSKA 2H65B 3QETA 3WXJA 5ITHA 3CCRS 4K8ZA 4ZPDA 3IC1A 4I6WA 5I3QA 2HBZB 1C1CA 4KGKA 1CZ9A 3RSEB 1MROA 4DV2J 4FYYB 3ID8A 1CG2A 2VG7B 1U02A 2IHR1 1REVB 3AJ2A 1JCFA 4NMLA 5LT5A 2V68A 2JC1A 4E0DA 1NGEA 4A62A 3LW5C 3UW1A 2XYHB 1CJUB 4OIXA 1X5SA 9ATCB 1C0GA 1N54B 3HSZA 1X60A 1T3VA 1SXLA 2QTWA 2CAJA 4D3GA 4OJRA 1CZAN 4B8CA 2DGUA 1K9MO 3CI5A 2IPOB 2UXDK 2MGZA 3FZ2A 5BR8F 4B9UA 3VR1A 3BF3A 1KXPA 4IFEA 4M8LA 1IH7A 3PHEA 2MZSA 3UIQA 2XRIA 5AQHA 1TV6A 1RCXB 3DRRA 3UE2A 3ZT0A 5HATA 1N0UA 4OZ5A 1ZAXA 1HNZJ 1N5YA 2YKAA 2CXEA 4BE0A 3H3NO 3EVWA 1XHZA 3ULEA 3HSJA 3D6FB 5IOLA 2KXNB 4DQSA 4Y2AA 4B3OA 4YB5A 1FRIA 3BDEA 6AT1B 2E88A 4I6AA 2EHGA 5EGYA 1FE4A 4FXDA 5HN0A 4KQZA 4FJ7A 2O8BA 3RB6A 4DUTA 5IT9Y 4AFFA 2NREA 1HFEL 1WB9A 1RTZA 4QIVA 2JJ4D 2LA4A 1J27A 3M32A 2RS2A 4TQSA 3OYGA 2A2CA 3B6OA 5H9EJ 3VETA 2MY7A 2QTDA 4H0VB 1AZSB 4LRAA 2D9OA 1C4CA 5EX3A 4JI8J 4X4VA 4G1IA 2VGNA 3NGYA 1WHVA 1ZAWA 3EDQB 1RDBA 2XMWA 1RBUA 1Q86T 2CPDA 1F21A 4C2MA 2PY5A 2FVSA 2IY5B 4PPDA 1S79A 3O1WA 2B6AA 1IR0A 5ETPA 2OMOA 5M1QA 1GLLO 4M5MA 1IKYB 1BUXA 3CDBA 4GO5X 4WP3A 4FLXA 2IJFA 4A8OA 1NKEA 3IMXA 4S0MA 1OSDA 4XDCA 1WBDA 3RBEA 3I9V9 3QIDA 3Q22A 2CFXA 4ZCLA 1VS3A 2OP5A 3POTA 2OFHX 4DR5F 3T5LA 3VF6A 1NMDA 2F5GA 2ZJQQ 2YWKA 2FHKA 2PFDA 1NGJA 3O8WA 4CF9A 3AA3A 3GE1A 3UR3C 4WQ5A 2XYPB 2FBYA 3H46O 3CCLN 1WEXA 4ZVTB 2G9OA 3DRPA 1U4BA 4YOUA 4RX6A 3AH6A 3DGVA 2VB6A 3N6LA 5LMUK 3CJ3A 2CJQA 3UN2A 1P90A 3C6TB 4R0JA 4X4RA 3HVWA 3NLCA 1X1PA 3QT6A 2DRAA 1X4EA 2MQQA 4PABA 1S72S 2GUPA 1FKOA 2H4WB 4WBFA 1R8CA 1YJRA 2ZJRQ 5LJ3Y 1H73A 4AQYK 1S5JA 3G25A 2OANA 5I3PA 2WSFC 3SV3A 3H2UB 2B4VA 2C3PA 2RPIA 4ISGA 1NJZA 3CFOA 2YX6A 1O1WA 5IXUA 2IA0A 1S4EA 2QLBB 2O1PA 3QFWA 1HBOA 1S59A 3D0IE 5L1LA 1Q82O 3MMCA 4ZHRB 4DTOA 3M05A 5BRHA 3EUNA 1BD6A 3GP9A 3JSBA 2Z1JA 2E2PA 1RA6A 1WTFA 3LGHA 3MN6A 7AT1B 1X4CA 3SMPA 5F8JA 3AVBA 1SH0A 3FUYA 4JKBA 2NS1B 2VFUA 3PG9A 1RCHA 1FD8A 4MAKA 4F3OA 3LDPA 2KB2A 3B4DA 5ETTA 3SK3A 1J5OA 5FPEA 4RW9A 4OHWA 3MWTA 2M3DA 4FYVB 2O66A 3QPIA 5F2RA 2YHXA 1TK0A 1TFYA 1JNRB 2MQPA 1QQOA 2HK3A 3QQCD 5KFZA 3LDNA 3VMFB 1ZM9A 3K5LA 2ZFHA 2LECA 4CZMA 2P9LB 4PXBA 1Y3JA 4LVOP 3VGKA 3OS2A 3EDRB 4J2AA 1CLQA 4CT9A 2Z4PA 2O4IA 3P4UB 5CYQB 2BJDA 2XS7A 2HQ3A 1EETA 3WUHA 5M1FA 1ATRA 5IT0A 4DR4F 4DPUA 2DGXA 1G3OA 4L8RB 3LP3A 4CJ5A 4OYMA 4WYLA 2ZOFA 1WEYA 2RQ4A 2BX6A 3P6YC 4FYXB 1NAQA 1RTHA 4BRCA 4N77A 4J9PA 3C0BA 2KU7A 3GIIA 1L3VA 3UI3A 3BBBA 4OO1J 2ZH5A 5C0YA 3QLHB 1RTIA 2KZZA 2CQ4A 1D09B 1NUEA 4OHZA 3O6QA 1V9OA 1OH5A 4OV6A 3MAQA 4TN2A 2DNMA 1BCMA 2AJ4A 1J2VA 4P71A 1YJVA 2WFBA 1JL2A 4NLRA 4ED7A 3D9BA 4B3TJ 2GA7A 4CF8A 4XO0A 3W3SA 1F2HA 5DRKA 3H59A 2HQFA 4MYUA 1URRA 3HFKA 4I0WA 2W7OA 4BR2A 4ES1A 3OYAA 1HWJA 5M1KA 4GV6A 4ZDNA 3DXKA 4PXEA 2IAJA 5CXTA 4IEEA 3VZHA 4OX8A 1VQ6N 1P9YA 2AQ4A 4HTLA 5LXYA 4B3SJ 1W26A 1BQMB 1QZ6A 1HNVB 4OLAA 3ALYA 1F0XA 1NBWA 2RDJA 1Q7YO 3T5KA 2D0OA 3C14B 1TKXA 1M5SA 1Q53A 2QKBA 4H0XB 2HHUA 1JXVA 1EXQA 1IKVA 3MXHP 2MLXA 3VQ9A 3NP5A 1Q9YA 2GNKA 3CJ0A 2WOMA 2HLUA 3EX7B 2ASPA 4OFZA 3Q86A 1N33J 3L8BA 1U25A 5F1XA 1TUUA 3SEOA 3J81U 4F4WA 2VPWB 5KG6A 2R42A 3SUOA 3Q0AA 3N4PA 4YDXA 2NRHA 5F8LA 3VQ5A 3EMTA 4P2SA 1NNDA 1GFWB 1S1WB 4YHHK 4B9NA 1H6KX 1NPPA 2XNQA 2WB4A 3JSRA 2IIRA 4LF4J 4CEBA 4ZTJA 1XUPO 4MT1A 3OYEA 2ZH2A 3THTA 4LF6F 1UL3A 2CDRB 3LDOA 4X4QA 4FZXC 4ZJQA 2NUBA 1N34F 1UA1A 1U8SA 1TL5A 3PEHA 2DR7A 4X62K 2AEFA 2A6OA 3S8SA 4X84A 4X64F 4LF5K 2EPIA 4Y65A 3NH0A 2VONA 1TYQA 4BRKA 4DQRA 1SAZA 1AROP 2RMLA 3I8BA 5GAGI 2JX2A 4MKYA 4M3TA 4FW1A 1OWXA 5AXNA 4NXNK 5HVGA 3QBWA 3TA0A 5EY4A 4B1YB 4K8XA 4FF2A 1ROFA 3B78A 4U7BA 5BPNA 4JI0K 3PYGA 1PG5B 4L76A 5HI7A 2ZE2B 4Z4HA 3KK7A 1YJ9N 2M4MA 2YNGA 1B7YB 1P1TA 4XIUA 1RWNB 4L3KA 4DUZJ 3RRHA 1JLEA 1KAYA 2WVFA 3KK2A 4RW8B 3HM9A 4Q5VA 3OYJA 4CEAA 2HVHA 3JS6A 3ZETB 1WLJA 1XHXA 4LF7F 3VEXA 2D69A 3RZAA 4UW2A 5JS2A 3LWLA 4JKGA 2VG6B 3G96A 1VQMS 3SUQA 3LP1B 4QQBA 5KFTA 3ZX2A 3HVAA 2JLEA 2CWKA 3G82A 1HYSB 2OZSA 4BR0A 4WKRA 4DX8H 4RZRA 3G6ES 3QZ8A 2O4GA 3F44A 3E51A 4GO7X 4FK2A 3ILIA 2XMKA 1GMWD 2AZ3A 5GINA 4F36A 4IJAA 2UUBJ 2ZH9A 2PI5A 4BRMA 3VQ7A 3WEEB 2HWTA 3DAWA 2V4JB 5H9EK 2XM3A 3UQSA 2MY8A 2PSZA 2IRUA 4JI8K 3BF1A 1ICEB 1VI7A 1GLJO 4FVUA 2IDEA 3CC2N 3CCEN 1RHKB 3CDWA 1YAGA 4W4MA 2LU2A 2QYCA 4O8KA 3QFPA 4ZN1A 3MEGB 1QSYA 4IG3A 3DU6A 2VICA 4P73A 5D78A 3BH7B 3K8VA 5HO4A 5D4PA 2F4FA 3D2EB 1CJTA 2V2ZA 4N56A 2ZVSA 4F25A 1WAFA 1NJWA 4F67A 2DITA 3NXZA 2GAHC 3I6PA 4ES2A 2Q6BA 2EFQA 3DLJA 1DRZA 2PMZD 4NASA 2CPIA 1ZTWA 4DR3F 1YQHA 3CD7A 2GUIA 3ZSZA 3OFGA 3WXLA 1GQEA 4Y0WA 4WK3A 3OR2B 2G2YA 3NRBA 1SZ2A 2P6TA 4AXJA 5DZ7A 1U47A 1N56A 1FFWB 4LBPA 1GLBG 4DZ6A 1YJWS 5MLCQ 4ILLA 4DV5F 1DTTB 3OYHA 1C0MA 1SJ1A 3RU0A 2FHJD 3EGVA 2MKJA 2NZTA 2BTFA 2YH1A 2NRRA 2EBGA 2Z2ZA 1WEZA 2YX1A 2ASYA 3KLFA 3A8IA 3VQBA 3AQPA 1RISA 2Q36A 1ITPA 1VQKS 1TL7A 4CJRA 3MZIA 5EXWA 4NEYA 5JVGL 1V5IB 3SCIE 4DSIA 4BRGA 3X3UA 2KN4A 4QS7A 4CGFA 4Y2CA 3HPHA 3FSXA 5ADXH 3J7AN 4LFAF 4DTMA 3TJ9A 2AJ1A 4JI5J 5B7WA 3CCUS 4BRHA 1EX8A 1SQEA 4BS2A 1KOHA 1FWPA 4BRFA 5D3GB 3DJCA 5HL7Q 5F8HA 3DDIA 3SQGB 2QLWA 3TAMB 3MN5A 3PCOB 1E6YA 3TTFA 1WF1A 2HQIA 3ZT3A 2HGMA 2KVQE 1UWBA 5HLFA 1C0UA 1WC3A 3LGNA 4MLEA 4LF1A 4JNEA 2W9CB 2V2KA 1VQ8S 2DIUA 2JHEA 3AJDA 1VK0A 1FJGF 2Z2YB 3NWRA 2CJYB 2E5GA 1RT5B 2VG5B 3VAHA 1HD1A 3RW7A 1CEZA 3HXMA 2CJAA 2MXYA 2E5IA 3HF5A 5GADU 1PAEX 4NPOA 2W1BA 2NR0A 3BYRA 1KFSA 5C25B 2VKRA 3MM9B 1PILA 2WRMA 2H3EB 5KFNA 2YX7A 2HF3A 4ITSA 5KRSA 4FS2A 2XS5A 2E1YA 2XLKA 4EHUA 2Z58B 3GR0A 4RW6A 5HMYA 4DX7A 3CCZA 3K9JA 1HYZA 4WPAA 3KLHB 1VRTB 1S9FA 4E7KA 3AA4A 3KLVA 4DPYA 4CJEA 3MPYA 1F6TA 3CFRA 2OLWA 1PO6A 1MWQA 3LTOA 4ZP9A 2K1RA 4CEZA 1KQGB 3DMJA 3IDHA 1NDCA 5IM0A 2GQQA 4F26A 4BRIA 1AXQA 5I3UB 4ZP6A 1YKWA 4K0KJ 4KFBB 4CIEA 4B3TK 4O3PA 2FYXA 1RBRA 2G4BA 2KI2A 3AY9A 2FJEB 2OPQA 1U04A 4K42A 4MDBA 1NMEB 1JLBB 2AGQA 4KHPF 3UKUB 3KK1A 3E3XA 2C2DA 3PACA 1C1CB 4CECA 4FK4A 4DV4J 2FJAB 1R0AB 4UZBA 3FBCA 1NGBA 1VQ8N 1HBNA 3QRQA 4QIGA 1VAZA 3CD6S 4BE2A 1RBSA 3WQPA 2OZMA 4CLYA 3J81O 4LFBF 2NLXA 2UUAF 3JYTA 2I9SA 2OUGA 1KSPA 3MGJA 3HP9A 5HROB 4YR2A 4QYRA 4BC7A 3SLCA 2PBDA 1OKJA 4WFYA 1N33K 4F3QA 3VEOA 2A18A 2X51A 2VQEF 3DXMB 1DTQA 1WDDA 3AO1A 1Y4ZB 5EWEA 2KJVA 1ZXOA 1FRLA 5HJXA 2DR8A 1V3RA 4NRTA 3HBTA 4KO0B 2EVZA 2HHPA 3IBWA 2M8DB 2IMWP 2QE5A 5LL6Z 1U2VA 3C16A 1DZ5A 2VH7A 2P51A 4CZCA 4LF4K 2XO6A 3VQCA 5LSRA 3CJKA 5EX5A 2KM8C 2VWBA 4FJ9A 5HVHA 3SAHA 4A46A 4HH0A 3TX8A 4IKAA 3BSAA 3MXJA 2EWSA 1FK9A 2FSJA 3VQPA 4JI3K 2V63A 1WBBA 4MIBA 1HRHA 2YKQA 1H7XA 2XSFA 1QE1A 3K9KA 4ISEA 3MR2A 3QB0A 4NE9C 1S10A 1Z4UA 2R7OA 3VVTA 1PAUB 3WHIA 3PW2A 4QOZB 3L2QA 3Q2TC 5ADZA 1MMLA 2JWKA 1FTCA 2HS0A 5B0AA 2R8KA 4USJC 3QJLA 4N7TA 4FL9A 1JLQB 1VC0A 2IFXA 2LEBA 4MKBA 4A8MP 2P9UA 5THWA 5BR8J 1GLAG 2C1EB 2MPUA 4IOCL 1WKKA 4OL8A 2QRRA 5BN9A 4O3RA 1RT3B 3L4IA 1PIEA 2OPRB 4NCAA 4DKWA 1ITGA 4R8UB 1U1NA 1NGFA 3EGNA 3OXGA 2NQPA 2UXCK 1WI6A 2W4PA 3AVKA 2HLTA 1XNRK 1XJWB 4LF8K 2UUBK 2XO7A 4OZLA 1IWAA 1WC6A 1G2EA 4F4YA 2J8AA 4F2SA 3BBCA 1VQ5N 1KLMA 4DTRA 2KLAA 4NXMF 1UVIA 3NEKA 3NFAA 4I9QA 3Q8UA 4NYFA 2ZHOA 4YNQA 2RDIA 3R2CJ 1FRHA 3P49B 3JQKA 4WCEL 2MHNA 3MHYA 2XLJA 3GSIA 3NY0A 1RHUB 1W2IA 1R8PA 2CVIA 4WXWA 2FXUA 1OH7A 2RJZA 2E5LF 3K2PA 2KYXA 2GIQA 4EBDA 1XI1A 3D6MB 3L3VA 1YJTA 3RBZA 5K14A 3IGVA 1X3NA 4PAAA 3N4QA 1NO8A 3NNCA 4PG7A 4QIEA 5KFKA 1YRTA 3THWA 3M6WA 5HBMB 1H98A 3PIOL 4TU9A 3DWLA 3L0QA 1KC8O 1KVKA 4YR3A 1HBMA 2VFVA 3AOCA 1TKZA 1RAFB 2QLFB 3HJFA 4E19A 1PC5A 3PYEA 4LRCA 4IO8A 3VAFA 1VLYA 4DN9A 4PUOA 3A3PB 3ISZA 3TANA 4DR5J 2VODA 1RBVA 4DU4A 1BQNA 4A2BA 4BDZA 3AJ1A 1EB0A 1TELA 4W5OA 2W01A 2OSRA 2QLJB 4LF9F 1MWMA 2ETJA 3ICLA 4J7CA 2XMJA 2ZOGA 2E7XA 3J81Y 1HMVA 4DPXA 3AY0A 2F40A 1DAXA 1M0SA 1K0VA 4C3LA 5FRMA 2H5IB 3PEJA 1RHJB 2HOEA 3ZX3A 3GG0A 5AZIA 3V1RA 2CG4A 2QL9B 2XULA 2BM0A 2AJQA 3TAGA 2VPYB 3P83D 4DV1F 1GNKA 4JI5K 2YKMA 3I55S 5KT3A 5D4OA 2LA6A 3R6GB 3FCHA 5GAHP 2B4JA 4GY2B 1J53A 3LM9A 3G8QA 5LOQA 1BQXA 3S7RA 4K2JA 3D1QA 4FBUA 3W5ZA 3GE9A 5CYJA 4LR9A 2GS8A 2X7IA 4O0JA 1PJ5A 3L3UA 4TU7A 5HRNA 2C42A 1S0MA 1LWEB 3DGPA 2Z0GA 1GTEA 2AD9A 5KQ8A 4ERDA 2AW0A 2E9TA 2OEKA 4M5DB 3MMVA 4PRFA 1B0TA 3IRXB 2XG8A 1EJ7L 1RNHA 4W92B 5M1PA 2NZ4A 2BV3A 4F0KA 1Q9XA 4PZVA 1VSHA 3SDEB 2HURA 3UPFA 4Q2LA 3UFCX 2HS4A 2L41A 4Y1CA 1YXQA 5KG4A 4JI7J 5LSOA 3ILOA 3MM5B 1Y9OA 2BM1A 4RTFD 3KDNA 3FZBA 4FS1A 5KG3A 4DL2A 3C6HA 2PT0A 1B99A 4KT0C 4DR4J 4OYZA 3QT8A 4Z0UA 3OTEA 1KTVA 4TLRA 3CDAA 2O01C 3IS9A 1S12A 4M45A 3M2VA 2V8VA 4HWIA 2P1JA 1UETA 4FVCA 5G0RB 1RTDA 3DN9A 2HBRB 3DFEA 4BCAA 3MPDA 2F9JA 4LRBA 4PCQA 4KV8B 3MK6A 3AT1B 2PEHA 3HPOA 5A8RA 1CXUA 4WF9L 1RACB 1XNQF 2BMBA 4PXDA 4JS5A 1HQEA 1MW7A 4P52A 2CA9A 1DQ8A 2GJ2A 3EN9A 3SMSA 4WU3A 4DV4K 3BJYA 2GC8A 4EYHB 4PL8A 3CC4S 3TVZA 4HHJA 4LT6A 1OQ3A 5HRRA 3S41A 3V6DA 1VLOA 3M1VB 3MN7A 4CHYA 1KS2A 3VEVA 1WOOA 1VRUB 3H2LA 4M63C 1LK7A 2MZQA 4DQIA 4AHVA 1Q8KA 1K73T 3HDSA 2VBYA 2ITGA 2M5YA 4MYTA 2J8SA 1YIJS 8ATCB 1YVFA 2X1FA 2QSWA 3GZ7A 4NLGA 5J1PA 2WHOA 5B0CA 4X65F 4RBTA 5FJ4A 3G71N 5C24B 2D0AA 1DQAA 1H72C 5HSPA 1YI2S 1F5CA 4B1ZA 1Q16B 3KLGB 4DQPA 2DHSA 3ZZUA 4FJNA 4IH7A 3V5RA 2OTLS 4ZVPB 3LF0A 2DNPA 4EAHD 4ZCKA 5AFUA 1HI0P 2JVOA 3AXKA 4M3RA 2XLIA 1M90T 2HF4A 4DPWA 1RT4A 3VGVA 1FWKA 1P8GA 4JOUA 1HJRA 4HVZA 2W2PP 3H90A 3C6UA 4YORA 3M8SA 1WG4A 1SPBP 2G0JA 3W2WA 1C0TA 2R8IA 2HVEA 2OJ3A 1DBDA 4NCGA 1N34J 3IRWP 2IVMA 2ERRA 5AQKA 4DSKA 1XMOF 2Q1LA 3B82A 2LU1A 4OZ1A 3FEZA 4FBTA 2EX3A 2BR0A 4BRNA 2NRTA 4FDFA 2EEYA 4ZA1A 2DFHA 4FJXA 3NCIA 3SQOP 2E9ZA 3P38A 1RT1B 1RZMA 1D9FA 2BW7A 5LMNF 3MFHA 2AGOA 5BR8K 4ID1A 4F4KA 4IRKA 4K43A 4CLZA 4XDDA 4BHQA 4DR6J 4QYZJ 4CTAB 3BQ0A 1EQ0A 1ASUA 5GAEP 4QWEA 4WQ4C 1KWMA 1K8KA 3ZC4A 1MLAA 5ETVA 1ACMB 1FVQA 2YKNA 3ZNUA 2A6AA 4WYWA 1D4XA 4PXCA 2CKWA 1F2GA 5T7LA 5B0EA 3NGUA 1X5PA 1NSAA 3AVAA 2P6SA 3GIJA 1T11A 3G4SN 3OLAA 3QEXA 4K4SA 2BRLA 3HHDA 3ZZZA 1F9EB 3GV7B 1RQ0A 4NZ7A 4BWMA 4WFZA 3CMAN 2NLWA 3V9WA 2MLYA 3KD1E 4KHMA 2V7ZA 1V3SA 5AJ3F 5KFSA 2EK1A 3L09A 5KFUA 1JCGA 2DEJA 4XK8C 3NGRA 4KB7A 5FPDA 3AD9C 2AIRB 1TL7B 4JRPA 2FC8A 3TQEA 1JXEA 4JKEA 3KJFB 1GAOA 2BE2B 3AQOA 3SYZA 2E1ZA 3N4WA 3HP6A 1HHQA 1KOOA 2QMWA 2FPHX 4GMJB 4CJ4A 4DV7J 3F73A 3QINA 1LXJA 3WNGA 5LJ5Y 1IM6A 4DV3F 3QGHA 1YWXA 2H48B 1ILYA 1RCOB 4FSVA 3C7NA 3CTRA 4Z4FA 3NBPA 3CO9A 4LBIA 3O4NA 4BE1A 4K59A 3Q24A 4DR5K 3AVNA 3SQ4A 4AF1A 4Q8EA 4ZPBA 4A59A 3VAMA 1BI4A 3K5OA 2UUCF 4U7UD 1FKPA 1VQPS 4WTYA 4ALZA 1X9JA 3S3OA 3S01A 3DLEA 2GVZB 1MDUB 4RUBA 2V8PA 4WE1B 4BC4A 1LWCB 4A8