3QIPA

Structure of hiv-1 reverse transcriptase in complex with an rnase h inhibitor and nevirapine
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
556
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Binding Analysis of Pyrimidinol Carboxylic Acid and N-Hydroxy Quinazolinedione HIV-1 RNase H Inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse HIV-1 reverse transcriptase p66
total genus 164
structure length 554
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3qipA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3qipA05
4IH6A 4N41A 3LPTA 2OPQA 5DK5A 3CYMA 2OZSA 3SNNA 4PY5A 4DTPA 2BANB 5KFPA 4FJNA 1J54A 3AVGA 2VG6B 3UIQA 1W25A 3TAQA 2YNFB 1NJWA 1TK5A 5J2QB 3AVJA 5HROA 3ZSZA 3DLGB 3QIPB 3KK3A 4DSFA 2W9AA 3K5NA 1UWBA 1BCOA 5KFHA 4ZPCA 3PX4A 2YNHB 3SPYA 5DGBA 3V4IB 4H4OB 3SFGA 4KTQA 4NLXA 4FJHA 5J2MA 3GV5B 4DTNA 4WE1A 5CYMA 1KCFA 3KOAA 4HTUA 3V81A 5F8IA 3KNAA 3M8QA 4F8RA 2QK9A 1S6QB 1TV6B 4AHSA 3L2QA 1NK6A 1XHXA 2GBZA 3QGGA 1BCMA 1S0NA 1N6QB 1NK9A 1REVB 4CF9A 1S49A 2ZD1B 4B3OB 1S9FA 4IFYA 2RKIA 4R8UA 2YNGA 1C1CA 4DMNA 1JLCB 4KKOB 3HVWA 5KFCA 1RYRA 1RBSA 3SUPA 1QHTA 1VSDA 1CZBA 3NF8A 3BSOA 4Y34A 5DLFA 2OPQB 2FVQA 4R5PA 2QKKA 3EZUA 2BGGA 3H2LA 1YT3A 4MQ3A 3TAEA 2WCXA 3PO5A 4FLUA 2YKMA 3SV3A 5J2PB 3KJVB 5KG5A 2A1RA 3KK3B 5HRRA 3BSNA 4Z4HA 5K14B 3ZT1A 4KHMA 1DTTB 3KMQA 2OPRA 3AA5X 1T05A 3DLGA 3ITHB 3OYKA 2FVCA 1RBTA 4HUFA 4RNOA 4RW9B 4K8XA 1HMVB 1X9MA 4I9LA 1FKOB 3ZSXA 1VSKA 5DG9A 3HP6A 2YNIA 4PQUB 3RAQA 3PX0A 4WE1B 3HP9A 1JLGB 1FKPA 1BQMB 1WAFA 4CK1A 1C0MA 3MEDA 4FJLA 4ED3A 5C25A 4NLGA 3N6NA 2WRMA 1KVBA 1HJRA 1RTHB 3AO3A 3KLFB 4DL2A 1VSMA 4F3TA 4ECXA 1C1CB 2HNYB 1REVA 2ASLA 3LALA 4EZ9A 4ECRA 4B3OA 4M95A 1IKWB 1KLMB 3RMDA 4DSLA 4DQQA 5CZ1A 3OYGA 1MU2A 1TKXB 5F8LA 2D0AA 1NK0A 4CJ5A 4J9RA 2R2TA 1Q8IA 4IG0A 4ZPBA 5FDLB 4UQGA 3H5SA 2P51A 4OGEA 3VQCA 4I7FB 1N5YA 4B9SA 3MFIA 3G0ZA 4CJPA 3A2FA 1DLOB 1KTQA 4IH5A 2UVWA 1HYSA 4NCGB 4Y2CA 2ZE2B 4CHNA 1T05B 5EUHA 4O44A 5HP1B 4KTZA 4QOZB 4WZMA 3RR8A 3FSIA 5DQGA 3LAKA 3N6LA 2R8HA 4U6PA 2ZKUA 1LWFA 3AVAA 3LZIA 4ZTFA 4AHTA 2WONB 4L8RB 3QEIA 4NLRA 3VA0A 2F96A 2CKWA 2D3ZA 3C6TB 3NAEA 4K50A 2R7YA 3P83D 5CZ2A 2FBTA 3OYIA 3RMCA 2PYLA 1RAJA 1XWLA 3V1QA 3I0SB 4RZRA 1ZBLA 1VSLA 1LAWA 2XRIA 1R0AB 3K57A 2FLLA 3KLHA 3H5YA 2XGPA 4KREA 4OVLA 3FDSA 2BRLA 3KK1A 4ED1A 1U04A 5D3GA 3QERA 4B08A 1VRUB 3UR0A 3L3UA 5DMRA 2FJXA 1HNIA 3QIOA 1MU2B 1TKTB 4RW4B 3RWUA 5KT5A 2PYJA 1LW2A 1JKHA 2W9CA 4J2BA 4E7HA 4N76A 3BGRB 1J5OA 4E89A 2E6MA 2KQ2A 4FJXA 3L3VA 3CDEA 3NCIA 4C8LA 1HQUB 3GQCA 3QIPA 4YP3A 2YNHA 3NGYA 3MAQA 1ZTWA 1K1SA 5JS1A 2B43A 4BWMA 4NLDA 1JLFB 4NCGA 1QAJA 4Z4CA 3AVMA 1N48A 2W7PA 4RW7A 4W5NA 4KB0A 3T19A 3V6JA 4DS5A 3CG7A 2V4RA 4J2EA 3AVBA 1TAQA 3ZSWA 4AHCA 1X9WA 3KD1E 4KB7A 4ECUA 3ZSVA 2GUIA 3JYTA 3LPUA 1HNVA 3VQSA 4CIGA 3FQKA 3RB4A 2WONA 1XHZA 3VQDA 3JSMA 3HVRA 4WXOA 1S9EA 3O3HA 4HKQA 1UWBB 4BACA 3NBPA 3AVNA 3AVLA 3VQQA 2ASDA 5C42B 1RBRA 1N6QA 2P5GA 1S6PA 4DG1A 1RT7A 5HRNA 4NLPA 1KFDA 1X1PA 4DS4A 1QE1B 5KG4A 4CJSA 3H40A 3OSPA 3OYEA 3V81B 2QV6A 1VSIA 3SZ2A 2BQ3A 1NKCA 4IFVA 1CXQA 4K4UA 3H98A 3MR2A 4FS1A 3OYCA 2PZSA 2HWHA 1VRUA 5KFIA 4FJJA 3U3GA 1SKSA 5HBMB 4U7CA 4LQ3A 3ISND 4O3PA 4FYDA 2YNGB 4CJUA 1TL3A 4OKJA 3ULDA 1RILA 3EZ5A 2ALZA 2F8TA 3DLRA 5KFKA 4RUAA 1BQNA 1ZBHA 2R2RA 1RTIB 1C0UA 3OYFA 2G8FA 1BIZA 2Z1HA 4H4MB 4M3XA 4BE2A 3CM5A 5FROA 1BHLA 4E1NA 2YNIB 3L8BA 4M3ZA 3MEDB 1KVAA 3OS1A 2WTFA 1A5WA 3O3FA 5EWGA 3PR4A 2WB4A 3SJJA 3D45A 3IG1A 4FZYA 4I2PB 4KHUA 4DQRA 2W8KA 1BI4A 4Y1CA 2KTQA 2OYQA 3GIJA 1NHUA 1LWCA 1IKVB 4E7KA 3AVCA 4NYNA 1JLQA 3GIMA 3CFOA 2KZMA 4M41A 1SKWA 4KHNA 3EYZA 2GIQA 4HUGA 5F8GA 3IS9A 3DI6A 1QE1A 2IOCA 3GV8B 4KPYA 3ICLA 3U3YA 2CJQA 3OS0A 4OLBA 4ZVGA 3BSCA 3BDPA 2AGOA 4IFVB 2C2DA 3BSAA 1GX5A 4ZVEA 4PA1A 4QAGA 4CEFA 4FLWA 4JV0A 3OYHA 1S0MA 2D3UA 2XY8A 3N6MA 4O0JA 1D8YA 1SH3A 1ZBFA 5F9LA 2KZZA 5F9NA 3C94A 3D28A 4O44B 4E19A 1LAVA 4RNHA 3FRZA 5E41A 4CJRA 2ZE2A 1BQNB 3OYNA 3DM2A 1S1UB 4JV1A 1KSPA 4ZP7A 2IS3A 3WNGA 1K1QA 1JLEB 5J2QA 4IOBA 4KAIA 5KRSA 3K58A 4NLVA 4J2DA 2AWZA 4NLQA 1JL1A 5KFGA 5KFXA 4CESA 1Z4UA 4CJQA 3G6VA 3QNOA 4RW6B 1S4FA 1BI4B 2G8HA 4G1QB 3NAHA 3UPFA 2EX3A 2ITGA 3DLHA 3KLHB 1IKXB 4Q0BB 4ELVA 4ELUA 4O3RA 4B9LA 5J2NA 4NLOA 2G8KA 3IS9B 4OPJA 1VRTB 3S3MA 3VN5A 2OA8A 4KRFA 3RBEA 1VK0A 1C2PA 3V9SA 3C95A 5CYQB 4F50A 1JKHB 3NH1A 3PR5B 3PX6A 1XR6A 1RTDA 3V6HA 3TWHA 4CF2A 3KD5E 1MMLA 3OSNA 2UVUA 2VG5A 3RTVA 3PW5A 1TK0A 3DLBA 1JLBA 2G8WA 5EDWA 3DOLB 2C28A 5DG7A 4DFMA 4OGCA 4O4RA 4RU9A 3B6PA 3MTKA 5J2NB 1TL1B 3QEVA 5KG1A 1LWEA 3KHRA 3WNEA 3L2UA 1XC9A 3QNNA 1VSFA 1U47A 1NK8A 4Y1DA 1NHVA 2UUTA 4YR3A 3QEPA 4G1QA 4BDYA 1QSYA 4B9MA 1U4BA 4PWDB 4TY8B 3DLKA 1A5VA 1JLFA 4IH7A 2HMIB 3SUQA 2D5RA 3T5KA 1EKEA 3V9UA 2IGIA 4LH4A 1IKWA 1KLMA 2PY5A 4LY7A 4DQIA 1RT6A 5KGWA 1RT5B 5L1LA 2YKNA 5KG0A 3BQ1A 4K4YA 3DOKB 4OPKA 4KHYA 2BANA 3OYMA 1C6VA 2FJWA 1RBUA 1SL1A 3PW2A 3S3NA 2AQ4A 2AGPA 1WSGA 4KO0A 4QPXA 4TN2A 4DL4A 3NGZA 3F9KA 3P5JA 1C1BA 3EPGA 3RB3A 4B8AB 4WFXA 4CF1A 4FM0A 3OLBA 4OL8A 4Z0UA 1TKDA 3NHGA 3CFPA 1C0UB 1EETA 2OPPA 2IAJB 5J1EA 2JEGA 1EP4A 3LWMA 1NK4A 4F2RA 2I1RA 1D1UA 1ASWA 3EPIA 4FLXA 1RT6B 5C24A 3C6TA 1VSEA 4IR1A 1TL3B 4B9TA 4AH9A 2V4QA 3PV8A 3TAPA 4JUZA 4TLRA 4IRKA 2FBYA 4K4ZA 1X9SA 4DFKA 5J2MB 3AV9A 4KO0B 4NZ0A 4ICLA 1JLCA 4OKKA 1IH7A 2B6AA 4CERA 1RDAA 3V1OA 3E51A 4ED8A 1CZ9A 5I42A 4CJTA 3V9XA 3ALYA 3OYLA 3RRGA 4TSXA 3S9HA 1HPZB 4QW8A 3AO2A 2DFFA 1RT5A 4QWAA 1T03A 4C8MA 2W9CB 5F8JA 2ETJA 2W8LA 2WOMB 4I2PA 3CJ0A 1KHVA 2DY4A 4EZ6A 4ECZA 3BQ2A 4KKOA 1S9GB 3KLGB 3ZT4A 4O55A 3ZCMA 3DMJB 4NLSA 3T3FA 4GVMA 4K8ZA 3KKSA 5KG2A 3KHGA 4K4WA 1CLQA 1D5AA 3KTQA 1C1BB 4Z4EA 4CGJA 4ZMMA 5D3GB 4K4TA 2BRKA 2Y1JA 4DL7A 3V9WA 1W0HA 3IGNA 4HYKA 4EBCA 4F4YA 3CQ8A 2W9BB 1HYVA 2XY6A 4GC6A 3WNFA 1DTTA 3HVTA 4I2QA 3LP3A 1JLGA 1RA7A 4Y2AA 4TQRA 3M9MB 1RTHA 4ID1A 2RF2B 4FJ8A 2O5DA 3KHLA 4Q5VA 1QQCA 3OYBA 1S1WA 4KV8B 1HMVA 2D7SA 5KG6A 4MIBA 3E01B 3IRXA 2R2SA 4DWIA 1D0EA 4Z4FA 3HXMA 3PHEA 1VSHA 1RNHA 3H08A 2RDJA 3MFHA 1YVFA 2BE2A 3VQ6A 4B9NA 1YTUA 2R8IA 1JX4A 4FCYA 4Z4IA 4FLVA 4ECTA 4FBTA 4MFBA 1IKXA 1S9EB 2GIRA 3NBPB 2W42A 1CSJA 3KLIB 5I3UB 4RW8B 1GOCA 3MECB 2RF2A 1K6YA 1RT4A 1S1TB 3TVKA 4DLGA 3VQ4A 3DOLA 4J9MA 2VA3A 1T3NA 3QGIA 2XI2A 4NCAA 2C2EA 4DFPA 5HP1A 4QWDA 2E4LA 3VQBA 4NLWA 2Z1GA 4DU1A 3VQAA 3CIZA 4JRPA 1LWEB 2IM0A 2JEIA 3I8DA 3ASMA 3KMSA 3NDKA 4WYWA 4MFBB 4CEQA 1HARA 2OPSB 4E7IA 3SI8A 3IG1B 3C6UA 1TP7A 1S1WB 4KV8A 1UA0A 3DLKB 3PZPA 3BR9A 4EBDA 4BE0A 1WSFA 4F4ZA 1U09A 4ED7A 2X6SA 2G8IA 1KLNA 1FK9B 4RW8A 5DQIA 1WAJA 2QE5A 2EC0A 2AU0A 5KFOA 4HVJA 3QO9B 4ED6A 4IR9A 1IG9A 2HHQA 3DOKA 3NGDA 3HYFA 2Y1IA 1NOZA 4FJGA 3OHBA 4TY8A 3NFAA 4QCLA 3VQ7A 3OYAA 4MH8A 1JL2A 4ZP9A 3K5OA 4RW4A 1HQEA 3V6DA 4PWDA 2E9TA 2J6SA 3MR5A 2P5OA 1RT4B 1VSJA 4E1MA 1T8EA 4YR0A 4CFAA 4EYIB 3L2VA 3LAMA 3VQ8A 3OJSA 2RN2A 4KBIA 5JUMA 3GILA 1WNEA 4GMJB 5KFZA 3PUFA 5F8NA 4C8NA 5KFQA 2X74A 4OLAA 1QAIA 5L9XA 1S1VA 4FW2A 3OL7A 3KIOA 5EWFA 1IKYA 2W7OA 1RT3B 4NRUA 3OS2A 1Q9XA 3JSMB 3TABA 4KI4A 4DF8A 2A1SA 5KFTA 2IAJA 4F3OA 4O0IA 3KK2A 3NH2A 3HSTB 3QYYA 1J9AA 3TI0A 1JXBA 2BQUA 3DDKA 4RW9A 3H5XA 3LP2A 4F4KA 1BQMA 2LSNA 4FZZA 4URSA 4O3SA 4WZQA 2FBXA 5KFNA 3G86A 1SUQB 4Q44A 1WNSA 1GOBA 2OZMA 5C24B 3LP0B 1IM4A 1L3TA 2KFNA 3MEEA 4YFUA 2J6UA 1HPZA 3K59A 2YV0X 4FM2A 4EP5A 1TKZB 4EYHB 5I42B 2XC9A 2FJVA 3MXMA 2B6AB 1XR7A 4XIUA 1YVUA 4DFJA 5HRSA 4CEOA 4DF4A 4N56A 5KFRA 1RYSA 1N56A 2IJNA 1UOCA 4URQU 4GC7A 1RT1A 2HAIA 3LP2B 2BDPA 2WOMA 2VG7B 1QSLA 5KFBA 2O4IA 1S9GA 1T03B 1NJXA 3DRSA 4QWCA 1D9DA 4ZHRB 3QZ7A 4CIFA 1RT3A 3I5AA 3HVTB 1JLAA 1I39A 3H5UA 4IG3A 2E9RX 1NNDA 4E7JA 1L3VA 1N4LA 1S97A 4QWBA 5HRPA 3MXIA 3T5HA 4I9QA 1XR5A 2GC8A 3TARA 4H4OA 1G15A 3MF5A 3OYDA 3D0PA 1LWFB 4ZVHA 2F8EX 4Q8EA 5DGAA 4ID5B 4J9NA 1RT1B 3DI6B 5EWEA 4KHWA 1RTJB 4ECQA 1WN7A 1HYSB 4CE9A 4R0EA 4JS4A 1TKZA 4ZPDA 2VWJA 3VA3A 1S1XA 3DYAB 5F8MA 2XCAA 1ZTTA 1R0AA 1SV5B 2OPRB 4MKAA 1ZYQA 3AVKA 4NLUA 2RDIA 1YTAA 3LWLA 5JXSA 2DPIA 2DPJA 4FS2A 4CK3A 4W5TA 4DTOA 3SQ1A 1SKRA 1J53A 3T1AA 1TKTA 2E6LA 3M9OB 3ZT0A 3KLEA 4M94A 3RAXA 5K14A 4K4XA 2Q3SA 3PO4A 4ECWA 3LZJA 1JLAB 5EU7A 3MEGA 2IM1A 4EO8A 4YR2A 3HKWA 4NLTA 4O4GB 1SL2A 1EX4A 3L2WA 1SL0A 4IBNA 2XCPA 4LSLA 2V0NA 2BQRA 2YHBA 4Q0BA 3EY1A 4ZP6A 4PQUA 4O3NA 1HNIB 3HJFA 3PW0A 3JYTB 4B8CA 2AX1A 3ZSQA 4GW6A 2XY7A 3AA2A 1TKXA 3NL0A 1ASUA 4J2AA 4JV2A 3OJUA 2J6TA 2UVRA 1CXUA 1WSJA 3PY8A 1B9DA 3KLFA 3KHHA 5KFEA 1FXXA 2E9ZA 1BL3A 5C42A 4FXDA 3FFIA 1LW0A 1VRTA 1HQEB 4KB1A 3B6OA 5KT7A 2WHOA 5KFSA 1NJYA 3HT3A 4FK0A 4C8OA 2HWIA 3CJ3A 1L3SA 4NRTA 2B5JA 1RTDB 1S0OA 5F8HA 4CEEA 3ISNC 4IKFA 2XWYA 3NAIA 3Q8PB 4I2QB 4NYZA 3TQ1A 3V6DB 2ILZA 1BISA 2HHTA 1TAUA 4O4GA 3BJYA 1A5XA 3WNHA 3MEGB 1LV5A 4F2SA 1D9FA 4J9SA 4OJRA 2KFZA 1LW0B 1ZETA 3DRRA 3OVNA 3CJ2A 3SV4A 1QSSA 1GOAA 2VA2A 3M8QB 4CHQA 2FBVA 4LQ9A 5KFJA 2JEFA 2VG6A 1SH0A 3O4NA 5CYMB 1I3AA 1ASVA 3RMBA 2B5JB 4DU3A 3G10A 1TQLA 2VWKA 2YKNB 1B92A 3KK2B 5DG8A 4IFYB 3QGHA 4IDKB 5SZTA 2AGQA 2FVSA 4HUEA 1IKVA 3PW4A 2I5JB 2RKIB 4R8UB 3HL8A 3Q8SB 4CFDA 4DTXA 3GIIA 5CY4A 3FFIB 4F4WA 1L3UA 5HLFA 4DTRA 4YQWA 3LP0A 2NUBA 4KFBA 4WFZA 2YHAA 2AJQA 4ZVFA 4MKBA 4ECVA 4M3TA 4K4SA 4PUOA 1JXEA 4NYFA 4R5PB 2DFEA 3RB6A 4DLEA 3K5MA 1LW2B 3S3OA 2XY5A 3CO9A 4N47A 4CGFA 3P1GA 3OYJA 3SPZA 2V9WA 5L1IA 4O5BA 4FZXC 4WFYA 2HVIA 4CFBA 4KHQA 3TAFA 3ITHA 2IA6A 4Y3CA 2R8GA 4TYBA 4XPEA 4DTUA 4W5RA 1S1UA 3G6YA 4E0DA 1U45A 4ED2A 2F8SA 1FK9A 3DRPB 4MK7A 3NF7A 4AHRA 5KFMA 4CJKA 4ICLB 3I0RA 2VG7A 1W9HA 4ID5A 3AVHA 1S10A 5T14A 3Q8RB 5L1KA 1NJZA 5KT6A 5DLGA 4FJ5A 2FVRA 2HHSA 4CGIA 4C8KA 3IGVA 2XI3A 1HNVB 3FQLA 3G6XA 3M8PB 4JLHA 4XPCA 3IAYA 4J9OA 1SV5A 1F21A 1RBVA 4DSKA 3O4QA 4H54A 1ZBIA 3CVKA 5HLFB 2O4GA 1RT7B 5KG7A 4ECYA 4FW1A 5L1JA 5KG3A 3AVFA 3DLEB 4FJKA 1RTIA 2IBKA 1U48A 1FKPB 1RDDA 5HBMA 2ZQBA 3CDUA 4X2BA 4Q8FA 3KLEB 4RW6A 4M3YA 3GYNA 4RUCA 4PUOB 3KLGA 4FK2A 1JLBB 1S5JA 1TVRB 3DMJA 1RDBA 3NF6A 2DTUA 2DFHA 4DSJA 2BR0A 2D0CA 4DL3A 3CFRA 1DLOA 1UA1A 1TL1A 3SUOA 1DTQB 5DQHA 3M8RA 3DRPA 4M45A 1C0TA 4LSNB 3BREA 4CEAA 4BE1A 1TK8A 3E01A 4ED0A 2R8JA 3OL9A 3L2RA 4QWEA 4KHSA 4IRCA 1QS4A 2FVPA 4JS5A 3V6KA 4J9LA 4O3QA 2HVHA 4DTJA 4AHVA 4CK2A 4FLTA 4DL5A 4FJIA 2Z1JA 3HPHA 3VQ5A 3AA3A 4MK8A 5KFYA 3D5MA 1QTMA 5KRTA 1NOYA 1OS5A 3V1RA 3M9NB 4CF8A 4KAZA 4Q45A 1LWCB 3DLEA 4IKAA 2OH2A 3SQ0A 4QW9A 5KFWA 1JLQB 1DTQA 1BIUA 2HNDB 3ZT3A 2IJFA 4HCBA 1KHWA 3HVAA 3ZSYA 5KFLA 2YKMB 3F73A 4RNMA 4OKEA 5FRNA 2FLPA 2Z1IA 3VQ9A 2HHWA 5I3UA 3QZ8A 4M3RA 4BDPA 1XI1A 1WLJA 4CEBA 1TVRA 4IG3B 4H8KA 1NKEA 2C22A 1Y97A 2OPSA 4RW7B 2QXFA 1I6JA 1EP4B 2EHGA 4N5SA 3CDWA 1EETB 2OPPB 3CJ5A 5SWMA 1HQUA 3H4DA 1KVCA 3OHAA 1ZBUA 4CECA 4MK9A 3HPGA 4BWJA 1J5OB 3H4BA 4B9UA 4NCBA 4CGHA 1SH2A 3OY9A 3HHKA 4CGGA 3ZSOA 2D41A 3C6UB 3DRRB 3KLVA 4DQPA 3SUNA 3DYAA 4EBEA 4LH5A 2D0BA 3HM9A 3BQ0A 1S6PB 3AO4A 2G8VA 1NK5A 2GV9A 2IMWP 3NE6A 2I5JA 4JRQA 2HNDA 4FJ9A 3RMAA 3QINA 2FC0A 4CJ3A 3GIKA 4ECSA 4CHZA 4FLZA 3QIDA 3ZT2A 5KFVA 2JC0A 2KW4A 3SYZA 3RR7A 2HB5A 2FLNA 4KFBB 4RG8A 2XGQA 5KT3A 4DSEA 1RDCA 2RPIA 3U6FA 4IRDA 1BGXT 4DL6A 3V4IA 3ZSRA 4CF0A 4CJVA 3RB0A 4YMEA 4CFCA 4W5OA 2W9BA 2HMIA 4DEZA 3LANA 1S1VB 3MR6A 4E7LA 2JGUA 1WSIA 4CEZA 2HHVA 2YNFA 1L5UA 2IM3A 4KHRA 4TQSA 4TY9A 2XHBA 3AVIA 2JLEA 4DTSA 3KKRA 4CJFA 1GX6A 4LSLB 4G3IA 1IO2A 1QUVA 2IM2A 3HK2A 3NMAA 1T7PA 4CJLA 1Z26A 3I0RB 4CEDA 4TYAA 2IC3A 4J9QA 4TXSA 3TANA 2UUWA 1WSEA 5KT4A 2B4JA 4FK4A 3TAMA 4J9PA 4KI6A 4KE5A 4FLYA 4Q43A 1TV6A 5J2PA 4YNQA 3UDLA 4WXWA 3MR3A 3BGRA 3M8PA 2QKBA 3OLAA 4CJ4A 2WK4A 4ZTJA 3CWJA 4FVMA 1UAXA 4DU4A 3TR8A 1RDRA 4ZPAA 2JC1A 4EO6A 4CCHA 4M42A 3RBDA 2ATQA 1C0TB 4LSNA 1JLEA 1RCHA 3DM2B 3DRSB 4ZHRA 3PW7A 5J1EB 1NK7A 4HCCA 4XO0A 3QEWA 3AA4A 4EP4A 3SQ2A 5FRMA 3KJVA 2ILYA 3SQ4A 2JEJA 3MECA 3PJWA 5KFDA 4IDKA 4B9VA 3TAGA 5KGXA 4KTWA 4EEYA 4CHOA 1FKOA 4M3WA 2ASJA 4CJWA 2HHXA 5KT2A 3K5LA 1C1AA 2X78A 2HNYA 1JXLA 4FJ7A 4E3SA 2ATLA 1RA6A 3QETA 4DQSA 3T5LA 4AILC 1EXQA 1Z25A 3QLHA 2IDOA 3CM6A 5C25B 3QO9A 1KRPA 2HNZA 3RRHA 1RT2B 3CJ4A 2IC3B 1Q9YA 2XO7A 2HW3A 3LP1B 2R8KA 3VQEA 3TAMB 3UQSA 5KI6A 4AHUA 1S1XB 5FDLA 3LDSA 1RTJA 4MIAA 1NKBA 4DG1B 4IG0B 3QEXA 5C5JA 2VG5B 3Q8QB 2UVVA 3T5JA 5CYQA 3MXJA 3HPOA 3OL6A 1HRHA 3SCXA 5JS2A 4RNNA 2R2UA 3NGIA 4H4MA 3I5CA 5T7BA 1S48A 2P1JA 3OL8A 5HROB 3SFUA 4HHTA 4DTMA 4NLYA 4ZP8A 4I7FA 1N5YB 4URGA 3NKYA 5KFFA 1RT2A 4IQXA 4M3UA 4LD0A 4ELTA 1HYZA 1B9FA 3THVA 1TGOA 4KSEB 3IN5A 3IRXB 1WSHA 1U49A 3GV7B 3VQPA 4Z4GA 2G8UA 4BDZA 4CHYA 5KFAA 3PVXA 3H59A 3QESA 1SUQA 2C2RA 3PJXA 1S1TA 3AO5A 4FBUA 4CIEA 1O1WA 5KTQA 2X6NA 4FM1A 3HO1A 4J9KA 4CGDA 4CHPA 3I5BA 3M8SA 3KK1B 2BE2B 3LP1A 1S6QA 4F4XA 3AO1A 2HHUA 3QLHB 1IKYB 3O3GA 4DSIA 2ZD1A 4CJEA 3NF9A 2HNZB 3MEEB 4FJMA 4K4VA 4W5QA 4O3OA 3SI6A 4RNFA 3NH0A 3V9ZA 3I0SA 1T94A 1KFSA 2AX0A 1JIHA 3K2PA 4WYLA 5KFUA 1ITGA 3KLIA
chains in the Genus database with same CATH superfamily
4TVAB 2OPQA 1SC3B 5DK5A 3VPZA 5ETMA 4KGXB 2DH8A 3CW2C 3ZZTA 4DPYA 2VG6B 1SKUB 3O5TB 5AQMA 4BRKA 4DR6F 5HROA 1NGGA 1XK8A 1OH8A 3CCJN 4V19J 3F2KA 2GELA 1GH8A 1BCOA 2O8FA 4ZPCA 2MZJA 3PX4A 3SPYA 3V4IB 1LEOA 4BR9A 3F0NA 2H1YA 5A6WA 2NSCA 2PEBA 2AJ2A 3KOAA 1NB2A 4HTUA 3V81A 2B56A 2QI2A 1S6QB 1T9YA 2FLOA 3KZBA 1XHXA 1BCMA 1VGYA 4CF9A 3J81Y 5FPEA 3SLCA 2ZD1B 4B3OB 2RKIA 1VHFA 5KPZA 3EVOA 1C1CA 4FPRA 4FPBA 4NE9C 1JLCB 3HVWA 5M2PA 5KFCA 1VQ6N 2HEKA 3SUPA 3OBYA 1CZBA 3NF8A 1KC8T 1FE0A 2CNKB 1E6YB 4LMZA 2AT1B 1DEJA 3EZUA 2BGGA 4MQ3A 2NRXA 4OYBA 2YKMA 3CCEN 3SV3A 5J2PB 4GVLA 1VIOA 3KJVB 1YWXA 3A4TA 2A1RA 1DTTB 3BH6B 2B4PA 3AA5X 1U1LA 3OYKA 2FVCA 4ZLLA 1Q4RA 2A2DA 4HUFA 3P5BP 2F4VF 2AW0A 2JH3A 1FKOB 2DNQA 4KJIA 2DPNA 5DG9A 1OO0B 2FB0A 3HP9A 3MX5A 4RLEA 3CJSA 2E1CA 4AE5A 4FJLA 3CCTA 3QRPA 4NLGA 5H9FJ 2HSEB 4OYZA 2BVZA 1FT8A 4LFCK 1HJRA 2P9PB 1RTHB 1N0VC 4M63C 4DL2A 1VSMA 3BPSP 5FIIA 3LALA 4I0WA 1D8ZA 1WTBA 4YN3B 1IKWB 3UCZP 3LDPA 3HFKA 1B0PA 4H5VA 3NMRA 3LGMA 1T6CA 3WQUA 4OI3A 4CJ5A 1Q8IA 4M8LA 4UQGA 2L9DA 1N5YA 3MM9A 3MFIA 3G0ZA 3A2FA 1KTQA 2UVWA 2RE2A 4NCGB 4PL8A 2ZE2B 4MLEA 4O44A 2OFHX 4QOZB 3FSIA 5LL6d 4U6PA 4ER8A 1KONA 1HKBA 3AVAA 3HHLA 3L7UA 1LXNA 2KXFA 4H5NA 4L8RB 3QEIA 3GDQA 3JS9A 3CCQN 2FC9A 3NAEA 3THYA 2L3MA 5CZ2A 4F4AA 5D77A 3OYIA 4DV4J 2PYLA 1TUVA 3MTJA 1S6OA 4X4VA 3POTB 2MKHA 4U8YA 3C16B 3DJCA 1VSLA 3SCIE 4M5IA 3KLHA 3H5YA 4YOWA 4Y0FA 2PSZA 2NREA 1IBLJ 4JV5J 4NYOA 1NUEA 4YDUA 1U04A 2XSFA 3QERA 4BC2A 1SJ3P 4PWUA 3ZTSA 1NXIA 3UR0A 4JKBA 4RWXA 2NSBA 1D3WA 2HG4A 1CEZA 3CMAS 2PYJA 2W9CA 3ETMA 4N76A 3BGRB 2KQ2A 4FJXA 1Q7YO 3CDEA 2E2PA 2G0IA 1FTRA 1F5AA 3JAMY 4QR0A 4LF8F 3E1YA 5ETRA 3E8OA 3MAQA 1ZTWA 3UE5A 4IOCL 1U6FA 1JLFB 2J9DA 1M5PC 1QAJA 4RW7A 1XMOK 2RH3A 4WIIA 1NSAA 3FMBA 3W3DA 3C14A 4B1WB 4J2EA 1B70B 3AVBA 4IOCQ 5CH7B 4KB7A 3ENOA 4CIGA 1HNZJ 3RB4A 2PDAA 2FPHX 4HKQA 4DV7J 2IHR1 4WQ4A 2ASDA 1GLFO 3MUTP 4JNEA 3W5YA 4DR3J 1RT7A 3QBXA 1VISA 4OZ0A 4CO5A 3CJAA 3W9JA 5KG4A 2KH9A 2AYMA 3D2FB 2VBYA 1RKIA 1FJGK 3V81B 1VSIA 1NKCA 1NGHA 3MR2A 4I69A 5D0HA 2PZSA 3L9ZA 2CQ0A 4QU6A 4FYDA 1DURA 3ULDA 1Y3KA 3EZ5A 2ALZA 3J7Z5 2VFRA 1XC3A 3DLRA 2HFSA 5JMVA 1AROP 4FNHA 1RTIB 3SSQA 4CZHA 3OYFA 1NM2A 3BKFA 4CT9A 4QZVB 1RBAA 1H38A 2EG1A 2Q6CA 2UUBK 2DH7A 2QRRA 3L8BA 3K2YA 1UMJA 1KVAA 2O8CB 1A5WA 2CQ3A 1OWXA 3PR4A 2WB4A 1KOHA 2N3OA 5IT9O 1P8GA 3A3PB 4NYPA 1VQMS 5E33A 3C19A 2OYQA 1YJNN 2P9SB 1JNRB 1LWCA 1IKVB 3CC2N 3VEWA 4NYNA 2NXNA 3GIMA 3T1YF 4KHNA 3L95X 5F8GA 2IOCA 3EZOA 1GT8A 3JQMA 3ICLA 3U3YA 2MDAA 3OS0A 1EAYC 1RFQA 2AGOA 2OI2A 2HQ3A 4PA1A 2ZNYA 1WEZA 1FDDA 4FLWA 4JV0A 1CS4A 2D3UA 4XAKA 4NOHA 4C98A 1SH3A 4P72A 6FD1A 5M2UA 5F9NA 3LH2S 2XB2D 5GAEP 4O44B 4MO5A 4HHJA 2OD6A 2FF6A 3FRZA 4L6V3 4CJRA 4J37A 2ZE2A 3ENQA 3NOGA 4ZCLA 2E7WA 2O66A 2UZAA 2PA8D 3VAHA 4YHHF 1K1QA 1JLEB 4ZCMA 3K58A 4KAIA 4NLVA 4IOAQ 5M1PA 2FQQB 4MTPA 2HHHK 5KFXA 2IVOA 4CJQA 3G6VA 1K0TA 3ZZOA 1BI4B 3MPWA 5LJVA 1U1NA 2POKA 1FNOA 3HSGA 2I8EA 3CJQA 3U7JA 5J2NA 1RU1A 4XEIA 4NLOA 2VOOA 1CQNA 4BR4A 4OPJA 2KXNB 3S3MA 3P8BB 3M5RA 3EX7B 4CZLA 1VK0A 1PBUA 3FUYA 1C2PA 5CYQB 3THYB 1VQLN 3J80U 1A7GE 4ID8A 4HACB 4WK1A 3V6HA 3CC4S 1CS4B 3IDHA 1MMLA 4ITSA 3OSNA 4DR4F 2VG5A 4FWMA 1WG5A 3RBXA 2G8WA 4W4MA 5DG7A 3C66A 3VGLA 4MLHA 3CB4A 2DGTA 3B6PA 5B0EA 3MTKA 1RBOB 2NPIA 1G2EA 3E66A 5J2NB 1OQ6A 3QEVA 5KG1A 2H51B 5HK4A 1HWKA 2H5IB 2O3DA 3QNNA 1U47A 1TFYA 4Y1DA 1NH8A 2IVNA 3LM2A 2UUTA 4JI1F 3AH6A 3QEPA 4EU0A 4BDYA 1YKWA 2RRNA 1QSYA 4B9MA 1YGYA 4P7VA 2E7VA 1A5VA 4KH5A 1JLFA 4KH1B 2MQQA 2HMIB 5A2QO 1EKEA 3TTCA 4WQ5C 4ZS6A 4DQIA 1RT6A 3I82A 4LF6F 2Y3YA 3CCSS 2BV3A 2XSJB 3BQ1A 4K4YA 2DHSA 4BGBA 3N4WA 2GCFA 5A6PA 4ZVUB 2UUCK 2XO6A 1H72C 4TN2A 1FDAA 3F9KA 3P5JA 5D15A 1E6VB 3OFGA 1X60A 4DZDA 4WFXA 4DBQA 5AQUA 1RHUB 3NGKA 3OLBA 1TKDA 4K2JA 4CZIA 3CFPA 3BB5A 1Y5NB 4GNIA 1ZAWA 2IAJB 1HBUB 5J1EA 2JEGA 1BWFO 4LFBK 5IWAF 3LWMA 1NK4A 1ASWA 2QWNA 3EPIA 4Q2LA 2Q31A 1RT6B 3EICA 2RJZA 4X4PA 2QTDA 4IR1A 3TW0A 1TL3B 2RS8A 2HZAA 2V4QA 3PV8A 2IVYA 4IRKA 4GVBB 2UXDF 4KQZA 1U0HA 1CBKA 4NZ0A 5FLXY 1JLCA 2CXEA 2B6AA 4CLPA 1UJ5A 3V5RA 3VGUA 3VGVA 2MTLA 3OXLA 5I42A 2HBZB 2CPFA 1DRZA 1OPZA 4C8YA 2QM1A 2U2FA 3RRGA 4TSXA 2X1FA 3B4MA 1HPZB 1HW9A 2DFFA 3NXZA 1M5HA 4QS8A 2UUBJ 2DRBA 3M2UA 4DX5A 2WOMB 2XMVA 1I5OB 2AEJA 5DRKA 3H0PA 3UD3P 4YHHJ 4ECZA 4BRFA 3BQ2A 4OV6A 3NGSA 3ZX0A 3DMJB 3T3FA 3KKSA 3A12A 4BG8A 4P7TA 4CGJA 4ZMMA 1H3DA 4K4TA 1Q82O 3VGSA 4QIFA 2D0PA 4CLTA 4HYKA 3TUZC 4F4YA 1OYEA 2JFKA 4OHVA 1DTTA 4I6YA 3VHQA 4UQTA 3H1VX 3B8HA 4WBFA 1RA7A 4U67Q 2RF2B 1JMTA 5BRDA 2O5DA 3KHLA 4Q5VA 1QQCA 1VK3A 1S1WA 4KV8B 2DRDA 5KG6A 4MIBA 3E01B 2DRAA 4DX6A 2KXHA 1ATRA 3IO1A 2M2BA 3HXMA 4PPZA 2B4UA 1RNHA 3MFHA 1YVFA 1RWWB 3VQ6A 3AQPA 2R8IA 2BKPA 2X1AA 2WBRA 1H0HB 2G1HA 5C0YA 2WW4A 5DDQC 1CSJA 2CGKA 4X65F 5GIOA 2Q6BA 2AIRB 2YWKA 1U24A 1VBKA 2V7ZA 4ZPTR 1VDHA 3W8PA 2RF2A 2BE7D 1K6YA 4KC5A 4CZEA 4BRCA 3IMQJ 4U7BA 4B1UB 3VQ4A 1H98A 4NWBA 4XTTA 3ZTRA 4PCQA 2C2EA 4NLWA 3CIPA 1K8KB 5K8MA 3I55N 2V2KA 3VEXA 1HI1A 2IM0A 3KMSA 3QAUA 3C8YA 5LJ5Y 3ZTPA 1HARA 1UWAA 3C6UA 4Z7CA 5I3QA 3DLKB 3PZPA 3EEQA 3JXOA 3QFPA 4JBCA 4EBDA 4BE0A 1HI0P 3HULA 4Y6IA 4ED7A 1U09A 1KLNA 1WAJA 2G2YA 3PEHA 2VD3A 3D7EO 4DUYJ 3L4BC 1HWLA 1KQFB 2VQEK 1NLVA 3FMWA 2HHQA 4U67L 5M1NA 4PG6A 1RWUA 2WZ1A 5ETKA 3A8EA 5KQ8A 3FCVA 3BV8A 1EKRA 4TLQA 3W5XA 2OTLS 4MH8A 3DN9A 1T9TA 4RW4A 1HQEA 3VVUA 1UEUA 4QU7A 1KOOA 3ILIA 1EIYB 1YK9A 5CZVA 1H6KX 3HHDA 1E6VA 3WT0A 4I6MB 2XHWA 1VC6A 2CJXB 3OJSA 3GG1A 4C11A 2DXDA 4LF8J 4UUXA 5KFZA 2AYGA 3M6XA 9RUBA 1S1VA 4OHWA 2FHKA 4B1ZA 3KIOA 4U96A 3D54A 1IKYA 2W7OA 1HKCA 3OS2A 4JV5F 3KUHA 4PZVA 3NH2A 3O9TA 1JXBA 4DX8H 2Y1RI 1F3VA 3H5XA 3ILLA 2E1ZA 1TR0A 2HF4A 4RCHA 3T1YK 4Q44A 1GOBA 4AXJA 3OTOK 1N52B 2R4FA 2HGMA 5AZIA 2DNHA 3LP0B 2FUG9 3PYFA 4HHUA 2R7TA 1HPZA 1FRXA 1RJJA 1VRQC 3K89A 1RAGB 5I42B 3EZWA 2XC9A 2FY8A 2V52B 3MXMA 2B6AB 4DFJA 4DUZJ 2J8AA 4ZN1A 4M5NA 1RYSA 4DR5F 1NGEA 1UOCA 3PKYA 2UUCJ 4URQU 4W98A 1M0SA 3LP2B 2BDPA 3T9NA 3CETA 3IFEA 5KFBA 3CJRA 2J0XA 2GHVC 4RBUA 2VGMA 3MM9B 5SUHA 1QM9A 3CCVS 4JI6F 5EX3A 3MURP 1VQ8S 4CIFA 4YHHK 3LUYA 3I5AA 2D9OA 2HGLA 2GTDA 3VZIA 2HFUA 1NNDA 5H9FK 1S97A 1N36F 3R8EA 3Q7CA 4DV0K 3TARA 3M05A 1G15A 4LFAJ 2NRHA 1S6UA 4Q8EA 3QT6A 2H5JB 1RT1B 4DOZA 3DI6B 2BJ7A 1C4AA 4QIEA 2LMIA 2KDOA 3NWGA 5AXMA 5DM7Q 5AT1B 2HBJA 1HNZK 2J0SD 2CIMA 2M3DA 2XCAA 3ZETB 2ZH2A 1OMSA 3HZGA 1FJ7A 2DNPA 1ZYQA 1HUXA 3C0BA 3GBTA 3OXFA 1R31A 3U8XA 1NZ8A 4I6AA 5JXSA 2F9TA 4O23A 2JVRA 4CK3A 4W5TA 1R27B 2RNEA 4HT5A 3PM9A 2YQ0A 2RIJA 2W4CA 1J53A 3T1AA 1TKTA 2QL7B 5K14A 4K4XA 4DQ8A 3FBEA 1ZZFA 4ECWA 4P52A 4EO8A 4BC3A 3H1QA 4NLTA 4CLWA 3LTOA 5C7PA 4PG5A 4IBNA 3BPDA 3NVKA 1N5VA 1K9MT 4AQYJ 2BKNA 3EY1A 4ZP6A 4O3NA 3EDQB 2ZH1A 3PW0A 3H7HB 2AX1A 4ANDA 3ULEB 1IBLK 2V8VA 2XY7A 3Q8YA 2MZQA 2Y9HA 2WVFA 4HACA 1K47A 4FPAA 4LF6K 3KLFA 3HT0A 2NRTA 1FXXA 3GCWP 2BEFA 3D2EB 3HZEA 2EFPA 1YBUA 5BYSA 5GAGI 4IO9Q 5KT7A 2WHOA 1YIJS 4B3SF 4JOUA 4NRTA 1RADB 1RTDB 1S0OA 3DWLA 2XMUA 1VQ5N 1K0VA 1PYOB 1HHQA 1DZ5A 1UL3A 5ETSA 1TUWA 3HSDA 3NAIA 4GV9A 4JAXA 3MMCB 5HAOA 2GHWA 4CNZA 3N5BA 3LM9A 2RQ4A 1A5XA 1Y64A 4YOXA 2W7AA 4F2SA 3T69A 1D9FA 5TKYA 1ZETA 4BRMA 3DRRA 2J9DE 3OVNA 3SV4A 3M8QB 1N5TA 4LF4K 2DD8S 1I3AA 2ASOA 4DR2J 4XK8C 1QQOA 3CJBA 2XS7A 5B7WA 1PCAA 1QTNB 1KVIA 3ADAC 1I3OB 3KK2B 5DG8A 1WWHA 3PFOA 3QGHA 5SZTA 4DV3F 3MDQA 4M63A 2YPYA 4HUEA 4M5JA 4E2FB 3Q8SB 4DTXA 1M5VC 5CY4A 4JKCA 1HWUA 4JHDB 4KGMA 3VF2A 3LP0A 4DV3J 2XTJP 1ESVA 4NPOA 4WFZA 4ZVFA 2MZTA 2A10A 2HVDA 2BH1A 3FR0A 2HHPA 1YZ6A 4R5PB 3K5MA 1LW2B 3S3OA 3UDVA 2XY5A 4DR2F 3P1GA 3OYJA 1X4CA 1VC0A 5AQRA 3SK3A 3WBZA 4RWTA 2K7JA 3ITHA 2W1BA 2RHQB 3SMPA 4XPEA 1X9JA 4W5RA 3R7BB 1X8DA 2DHHA 2ZF5O 3I56N 3H3NO 4I1TA 3G6YA 3P39A 4PKIA 2F8SA 3NF7A 3W1YC 4ZVOB 4NXNJ 4ICLB 3I0RA 2BYCA 2EFQA 2IRUA 5A8WA 1S10A 5KAKA 5L1KA 3B78A 5KT6A 3THXA 5DLGA 1DHMA 1FNXH 2FVRA 5GMDA 3FBFA 1HNVB 2C1EB 3FQLA 3R6LB 5F0WA 3PYGA 4J9OA 1F21A 1SQKA 5DM6L 2GVZB 4DR3K 4P75A 4FSVA 3WIVA 5E5NA 4QQBA 1ZBIA 4C0OC 4PXEA 3FZFA 3CVKA 3VTIA 2O4GA 5KG7A 3O4WA 1EQ0A 3OV7A 2AJFE 1AW0A 1DQ9A 5MAOA 1HNWK 3PYDA 6AT1B 3AJ2A 3D0IE 2ZJPL 3FVYA 1BXNA 2L41A 4KHPJ 2KHDA 4RUCA 4FK2A 1S5JA 1FF2A 2E1PA 2YKQA 2B9YA 2E66A 1RDBA 1GMVA 5K8PA 4DL3A 2YY3A 4OYPA 4NI2A 1R6YA 5DQHA 1LK5A 3DRPA 3Q24A 1IVZA 4M45A 2FZGB 4JI7F 4KYZA 2YKAA 2VWBA 4ED0A 4KHSA 2FVPA 4IWVA 4BCAA 4BRQA 4CK2A 2ASPA 1H1VA 2C2OB 4DR1F 2Z1JA 4C23A 2NRVA 3AA3A 1X3NA 3WXKA 1X4EA 2GX9A 1OS5A 4OJ1A 3AA8A 2YBVA 1O13A 4CF8A 4Q45A 2D9PA 1YUWA 4QW9A 2CQCA 4MAKA 1VQMN 3UNGC 5J1PA 2IJFA 1NBWA 2WW8A 1CJTA 2DBBA 4K42A 1O51A 1F2HA 3F73A 2Z1IA 3MWBA 4B3TJ 5F0UA 2HHWA 3UVJA 3ATVA 2BTFA 4CO3A 3QZ8A 4RPFA 4M3RA 5AQZA 5KQDA 3GPAA 1XI1A 2IJRA 3M4XA 4H8KA 1IN0A 4DV6J 4DR7J 3S41A 2Z8QA 1R7IA 4JKGA 2YWFA 1QVGR 5BRHA 2MZ1A 4N5SA 3CDWA 1K8KA 3DHWC 4U7UK 3O5BA 1EETB 2OPPB 4DMZA 1U2RA 2A40A 1YI2N 1URNA 5SWMA 5AQTA 3C3LA 1ZBUA 2UUAJ 2NLXA 3AXMA 4BWJA 1J5OB 4YOEA 3CCMN 5B0BA 3PCOB 4K2XA 1SS6A 1T44A 4IXCA 5G0RB 3JSRA 5MLCQ 3H25A 1U8WA 3SUNA 1HNWF 3DYAA 3SMSA 2CQPA 3AHPA 2D0BA 3HM9A 2Z2YB 1S6PB 1NK5A 3UD5A 4MJKA 5E3QA 4LVNP 2VHGA 4X65J 2F7TA 3RMAA 5LMUJ 1NEEA 1FI4A 2PO4A 4OHXA 3BF3A 1N88A 2O67A 2K3IA 3ZT2A 5KFVA 2KW4A 1UVKA 1IJFB 3A5NC 2XGQA 5KT3A 2XS2A 1JJHA 2RPIA 2BOAA 4DL6A 4HDGA 4JKHA 4A8SA 3ZSRA 4B3MF 1DARA 4CF0A 5DDOC 2YKOA 1Q81O 4B1YB 3GJSB 1YX2A 1JJ4A 3E9LA 3WX4A 1S1VB 4E7LA 4RUBA 1WSIA 1TL4A 2ZC3A 4P6QA 4UF4A 3QPIA 4OFZA 2V6AA 3CCWA 4DTSA 3S8SA 3EXYA 4LSLB 3M2RB 3M30B 3HHLC 4W92B 4OPAA 2P9EA 1QUVA 2IM2A 4OI6A 2HQFA 2W2NP 1T7PA 4CJLA 2VQEJ 2VV5A 3I0RB 4ALZA 4J9QA 5HANA 1DQAA 3TANA 4Y65A 2NYIA 3PRDA 4WP9A 3TAMA 2OP5A 2OEMA 2BUNA 2UXBJ 3IXQA 2GO9A 4FLYA 4OX8A 1TV6A 3VEVA 1YRXA 3LO3A 2YPZA 3TA1A 1Q7YT 2P9IB 2OMOA 1Y0HA 4ZTJA 1Y7PA 3UW1A 4NMXA 4I64A 2IA0A 5GIPA 1VBYA 1IR1A 1MWQA 1RDRA 1YJUA 3D2WA 2JC1A 3M7VA 4EO6A 5LMNK 2VQFF 5CQGA 1KVKA 5CCLA 5CAAA 4NMLA 1YLXA 1JLEA 1RCHA 2JWLA 1NDKA 2EFGA 4P2MA 4RUHA 4A8YA 2LEBA 4CBXA 2K06A 3SQ2A 3MMCA 2K3KA 1GLAG 4A8XA 2GA7A 2JEJA 3PJWA 1ITPA 2B9WA 1M5KC 5KGXA 3O8MA 1UW4A 2ASJA 4F26A 2HHXA 2X78A 5F3TA 2H4YB 4WFBQ 4C7QA 4QYZK 1W97L 1Z25A 3QRQA 2W40A 5FPMA 3L7PA 5L39A 2VZ9A 3UQSA 2IIHA 3JSYA 3G8SA 3B54A 4BC7A 1RTJA 3LDSA 1JJCB 4DUYK 2V2ZA 3CCRN 4IG0B 5FPNA 1ZC6A 5C5JA 3Q8QB 4R79A 1T0TV 3T5JA 3A5OC 1VQKN 5CYQA 3IA0A 3D3CJ 3G4SN 3I5CA 4IOAL 2P1JA 1S48A 3VEZA 5HROB 2CPIA 3UE2A 4URGA 4JK9A 4IQXA 3DXKA 1SXLA 1VQNN 2GMHA 4WP3A 3R1HA 4A8FA 2Z2LA 4IZ9A 1B7FA 1OVQA 4CLYA 4UUWA 2RQKA 2KM8C 3OXGA 1WSHA 4BC9A 2IYGA 3GV7B 1WOOA 3VQPA 2G9OA 5KFAA 5BPMA 2CUYA 2JHEA 2C2RA 3ULEA 3AO5A 4CIEA 3CC7S 4FM1A 3HO1A 1HBNA 4X62J 3W2WB 4J9KA 4CGDA 3I5BA 3UCGA 4ISEA 2RUSA 1GLBG 4CZKA 2HHUA 4M5GA 1IKYB 2ZD1A 4CJEA 1FWLA 3SSSA 2IRYA 3V9ZA 4LF8K 1T94A 2VF3A 2ZH3A 1JIHA 2YVSA 4GKKK 4WYLA 5KFUA 3KLIA 3WC0A 4IH6A 3GOIA 3J80O 4ISGA 1KDNA 4DTPA 3ZFVA 4M5DB 4J9VA 3R97A 1UFKA 2BX6A 3UIQA 1W25A 1NJWA 4WFNQ 2YQ3A 3AVJA 4A62A 2G0CA 2Z30B 3DLGB 4DV2F 3KK3A 3MM6B 1HW8A 2W9AA 1UWBA 1PIEA 1NSPA 4MKVA 1VQPS 2MKSA 4BRLA 2ITMA 2AEFA 3D6TB 2YNHB 1F5BA 3SFGA 2ZDPA 1FX4A 1VIXA 1NGAA 5J2MA 3GV5B 1RACB 1VQOS 4DTNA 4UOCA 1DFDA 1UZDA 1G1XA 2BUPA 3GYGA 3KNAA 2MLZA 1KD1O 3EE3A 1TV6B 2JL9A 1PAEX 4AHSA 3L2QA 1NK6A 2HWTA 5B8HA 2V2QA 2RU3A 3W5ZA 1W26A 2P6TA 4DU8A 1J5EK 2YNGA 4DI6A 2WAQD 4DMNA 4KKOB 2HKEA 1WORA 1RBSA 1HHTP 3VGMA 5M2RA 1VJQA 4Y34A 4R5PA 3OBIA 5BN9A 3J80Y 3H2LA 2I6WA 3M2UB 4OO1J 2A6MA 3TAEA 3PO5A 2ZDOA 3RAMA 4A8QA 5KOXA 4USVA 1WHXA 1MG7A 5K14B 3C6AA 2GJ2A 4FXVA 4OMFG 1TL7A 3KMQA 4F0KA 1QVFR 1VOMA 5A2QY 1FEEA 2LQBA 4RNOA 4RW9B 4UOGA 2RQCA 1NMEB 1KWMA 3HP6A 2YNIA 3HOSA 3SIPB 3RAQA 2GMLA 4BQLA 4WE1B 1JLGB 1XQIA 4CK1A 4FOEA 1NMNA 5C25A 4C3KA 4JI0K 2GUPA 4OYWA 2UV8G 1NWKA 3KLFB 4BS2A 3NMUA 1CC8A 2HNYB 3FSXA 3I87A 4CRJA 4OX9K 3FZ2A 4ECRA 2P9KA 2EG2A 2WTUA 2ATCB 2E5LK 4LFAK 4JN4A 4DQQA 3OYGA 4JB8B 1MU2A 1TKXB 2DHGA 2CQDA 5F8LA 2CNLB 8ATCB 3M1VB 2D0AA 1NK0A 2DNOA 3SDEA 3F5TA 2P51A 4OGEA 2FSJA 4I7FB 2V50A 4B9SA 5B09A 2NNWA 1FDNA 5CCMA 4FL9A 2BKOA 3GONA 2LEPA 5L8RC 1S0VA 4CHNA 3KYLA 4X64J 5IV3A 3RR8A 5DQGA 3N6LA 7FD1A 1FVQA 2QG9B 3FZHA 4ZTFA 3R5JB 3DLJA 2DR8A 2APOA 3J7YI 3SQGA 2WONB 2CKWA 2D3ZA 1RAJA 1JCFA 1ZBTA 3V1QA 3I0SB 2P5VA 3M1FA 1ZBLA 1CVJA 2FJEB 2NUUG 2XRIA 1R0AB 2FLLA 2WB1D 2XGPA 4PYDA 1IBCB 1HR0F 2J4RA 4KREA 4OVLA 2KYXA 1RTZA 1QZ6A 1T02A 3CPWR 3KK1A 3ET6A 4ED1A 3SBMA 5AQPA 1NU0A 2ZEJA 1FRIA 4AUKA 1HNIA 2DEIA 5IFMA 4BREA 5KT5A 3BBFA 3RSEB 1J5OA 4E89A 2E6MA 4J5OA 4Q7AA 4MYTA 4YP3A 2YNHA 1OVYA 2YX7A 4ZJLA 2B43A 4BWMA 2CA9A 4NLDA 4QS7A 3GZ7A 8AT1B 4A8MP 4UOHA 4G1IA 4NCGA 1XERA 1N48A 2W7PA 4ILHA 4EHTA 3J81j 3EM1A 3EL2A 4KB0A 4LF5K 2C2ZB 3ZSWA 5A8WB 3KD1E 3ZSVA 3OUYA 1PSDA 3JYTA 4I4BA 1HNVA 3VQSA 4CYUB 4F3MA 1WEYA 1XHZA 3G82B 4PL7A 2RSQA 2DNNA 1S9EA 3AJDA 3O3HA 1UWBB 4BACA 3VCDA 1N36J 1W2BM 1RBRA 4OZ5A 1N6QA 2KG0A 4JI0J 4OLOA 3WX8A 3HOTA 4DG1A 1KFDA 4NLPA 3BN7A 4K0KF 2CPYA 3CCES 4DR3F 3QSIA 2QV6A 1X0PA 2CPXA 1CXQA 3H98A 2R3VA 3D67A 3THXB 2HVEA 4V19X 3O1WA 1PILA 1M1KO 4G9ZA 3TUJC 3ISND 4O3PA 2YNGB 1RGIA 2HK2A 2UP1A 1EKSA 5KFKA 4RUAA 2B4VA 5D8HB 1HNWJ 1C0UA 4TKTA 4H4MB 2CJAA 3CTRA 3CD5A 4PKHA 2MJNA 3CM5A 2YNIB 4N7TA 2M8DB 3HSJA 3BF4A 2WTFA 4OPHA 1TMMA 3D45A 4IO9L 4FZYA 2ZH6A 2W8KA 1FX2A 2KTQA 4Y1CA 3GIJA 3BGUA 1NHUA 4F36A 2P9NB 1N34J 4BQZA 2KZMA 1EJ7L 1SKWA 3QNWB 3EYZA 3DI6A 4J90A 3N79A 3X1LB 2CJ9A 1VQ9S 4EHUA 3ETOA 4WQ5A 4YB1P 3BDPA 4IFVB 3AY0A 1ATNA 4ZVEA 2HRUA 4R25A 5EXWA 4ZLNA 4OHZA 2KHOA 3OYHA 1S0MA 1EWQA 1NM1A 2P9IA 4Z7YA 4O0JA 1UJ6A 1ZBFA 4H0OA 2KZZA 3ZZPA 2EI5A 4ZLJA 2CG8A 3C7NA 1LAVA 2LXUA 5E41A 4B3RF 1SAZA 3IUCA 3OBWA 4FXWA 2KO1A 1S1UB 2RHSB 5M1QA 3WNGA 4IOBA 4J2DA 2VASA 5KFGA 2PI4A 1WB9A 2P6SA 4JI7J 1MW7A 3UPFA 4X65K 2EX3A 2YWGA 3UKUB 3DLHA 1NGIA 4EFHA 1IKXB 2CGJA 3AFGA 3BP8A 3I4PA 4WP8A 4CLUA 1WC1A 3G9CA 2A18A 3G8QA 3BEGB 3IRWP 4X4UA 1HPMA 4HEA9 3H90A 3KJNB 2HQDA 3H20A 3V9SA 4WCEL 1JKHB 3PR5B 3PX6A 4XH1A 1OSDA 1XR6A 4NLBA 4CF2A 3CJ7A 3A8JA 4DN0A 3RTVA 3GG0A 3DLBA 2CDRB 3DOLB 5IS2A 2HGNA 2F4VK 2GMJA 4O4RA 4PPDA 3RYLA 3R3TA 5DZ6A 3P4IA 1U2CA 2F63A 3A3OB 4H0XB 3L2UA 1XC9A 4YOYA 1VSFA 3RSEA 3B6BA 1NK8A 3KG0A 4GKJK 4YR3A 3WQTA 1R6VA 5ETNA 4CLKA 4CYUA 3ENHA 5LY3A 3UR3C 4K25A 2VC1A 1PYTA 3EE8A 3W64A 3ZTOA 3O9RA 3SUQA 2R7VA 4LH4A 1IKWA 4K5RA 2Y8YA 4JYAJ 2HBLA 4CDIA 5KGWA 3TNVA 1BDGA 1FDBA 2YKNA 3CD0A 3GP9A 2QWPA 4AXIA 4ZOSA 2EFNA 5KG0A 3DOKB 4B3RK 4OPKA 3OYMA 2P9LB 1WI8A 3C6HA 1NMDA 3S3NA 2DK2A 1H7XA 3CJ1A 3O9SA 5HMWA 2HBRB 3EPGA 4B8AB 3CIMA 3LDLA 5TKWA 2DIVA 2Z58B 3U02A 1C4CA 3NHGA 1RKJA 1C0UB 4C3MA 4K43A 2WSEC 3ID6A 4YDUC 4F2RA 2I1RA 2Y0SD 2GFFA 3FJ2A 5C24A 3C6TA 1VSEA 1M90O 3ZYYX 2CNNB 1J27A 3VF0B 3P96A 4JUZA 2V2VA 5HI7A 1CJVB 1BWVA 5J2MB 4JK7A 1NDCA 2WVCA 3IM8A 1RHJB 2ZH9A 4ICLA 9ATCB 2MQMA 2BXJA 4AFFA 1RDAA 5E84A 4ED8A 1CZ9A 1N5QA 3ALYA 3OYLA 3S9HA 4X66J 3PFEA 4QW8A 1Q53A 4PABA 3W66A 4QWAA 1T03A 4ZIWA 2C2MB 3OTOF 2PMWA 2W9CB 5IT4A 3MOZA 2W8LA 3CJ0A 3TZZA 1KHVA 2DY4A 1EHWA 3J7A1 1XTZA 3ZT4A 4O55A 4NLSA 5A0YB 3Q2TC 2D69A 4K8ZA 1HL6A 3J7YP 1X31C 4X4RA 1CC7A 3KTQA 3AOAA 5D3GB 2BRKA 5BR8K 5K8OA 3IGNA 4EBCA 2GX8A 4LBPA 2W9BB 1HYVA 3A1YG 2XY6A 2WVEA 2VFVA 4UZCA 4GC6A 3MN5A 3HVTA 2HFVA 3LP3A 1WC0A 4FDFA 2D3O1 4OZLA 4TQRA 4NI2B 2AEMA 4ID1A 1NGCA 2EFVA 1HMVA 2RHKA 1NO8A 3LQVA 2O8DA 3D2FA 1LFPA 1VSHA 3CGIA 4B9NA 4YS2A 1JX4A 5AZJB 4ECTA 2NRRA 3W8GA 1IKXA 1S9EB 2DGUA 3FGVA 5LMUF 1AZSB 4C9DA 1IBMF 2P9PA 4OZ1A 3MECB 1RT4A 2DXEA 3QJPA 4NLCA 4WYBA 5EY4A 3A3NB 3DOLA 4J9MA 1T3NA 1BQXA 1Q16B 2KU7A 1IBKF 3SCLE 3CJCA 2Q2RA 4ILGB 3OT9A 3QWPA 2Z1GA 1UVLA 2JEIA 3C2PA 1EO1A 4C8ZA 1WEXA 4MFBB 1WC4A 3IG1B 5BYRA 3E9OA 2DYAA 1WSFA 2FHJD 1RI7A 4I56A 4A8KA 2X6SA 1FK9B 4RW8A 3R2CJ 3CULA 1YZ7A 2DNGA 2F65A 3OHRA 3FC9A 2VICA 5KFOA 4HVJA 3L0QA 3QO9B 5IV4A 4PG4A 1S79A 1FVSA 3DOKA 3BN4A 3HYFA 1NOZA 4FJGA 4ED5A 4DCOB 3RRKA 3OHBA 5LSRA 4X4OA 3P5TL 2E2NA 2BW2A 4QCLA 5AQNA 3EGZA 4USTA 2JRSA 1IBKJ 3JTNA 3K5OA 1I94J 2MMYA 3NCPA 5D0EA 4XH5A 1X4BA 2E9TA 5AXLA 1DQ8A 4CH1A 1RT4B 4E1MA 4ZLPA 2BM0A 4CFAA 3R5CA 4EYIB 2DEJA 3TP2A 5GINA 3VQ8A 4ZA1A 4OYXA 2FZKB 1AFJA 3TVZA 5JUMA 3S6EA 1HBMA 3GILA 2UU9J 4BRHA 3FNNA 1LQ9A 3PUFA 5I3PA 5F8NA 2X74A 2DCLA 1N5SA 2GV1A 4OLAA 5L9XA 3OL7A 5HMZA 2MZRA 2F4FA 3CHWA 1X5SA 3R2DJ 3PHTA 5EWFA 3DU5A 1RT3B 4DV3K 4WFBL 1Q9XA 3JSMB 4DF8A 3M2RA 2JSXA 4FVUA 2JX2A 2H9ZA 4A8WA 3CO0P 4F4KA 1U6ZA 1BQMA 2FD2A 2J5AA 2O1PA 4O3SA 4WZQA 3MN6A 3G86A 1SUQB 2RE1A 3QGPA 1WNSA 3TZYA 1FNMA 3O9UA 5C24B 3VAKA 2XLIA 2KFNA 4FYVB 2MKYA 4DUTA 3M30A 2ZJQQ 3R7SB 2AZ3A 4PRFA 3OVAA 4ES1A 1YHQN 4XIUA 3C65A 5A0YA 5E26A 3VETA 2J0QD 4X64F 5HRSA 4FWKA 3WUHA 1N56A 2MY7A 4FYWB 4WQ4C 2MY8A 2ZM6F 2VG7B 4HDHA 1QSLA 5LL6Z 2UYTA 3VGTA 3R5DA 1S9GA 1T03B 3LPYA 2IYIA 2V9KA 2X51A 4JI1K 1V9OA 1SC4B 1OYDA 4ZHRB 4X66F 3IKMA 2E20A 1RT3A 2GVDA 1I39A 2OTJS 4G1PA 2JLGA 2JZ5A 5IOLA 1L3VA 3A5MC 3OR1A 3TO8A 3MXIA 2CQIA 3TWZA 4B1VA 2L9NA 3F41A 2C2NA 1XR5A 3MF5A 4OZ3A 2W6LA 3OYDA 1LWFB 4OZ2A 1PC4A 2DH9A 3W2VB 2GEMA 4J9NA 2XYHB 2KJVA 4KHWA 3EGWB 1RTJB 3B8AX 4ECQA 1R3NA 3CQXA 4R0EA 1TKZA 2P9NA 3KWMA 3VA3A 1S1XA 3KFWX 3DYAB 5BPLA 1ZTTA 1Y00A 2EBEA 1WG1A 1D9AA 4D3GA 1U1QA 3MN7A 1R0AA 1SV5B 1FRHA 4MKAA 3M6GA 2ZH7A 5IQQA 3MMBA 3TVYA 4ZPVR 2DPJA 3CXCR 2DNZA 1TUYA 2XQCA 1QVFM 3VERA 2J8SA 5JVHQ 3R5AA 3JQJA 2OAUA 3RAXA 1G99A 1JLAB 4O0NA 3OVSA 2IM1A 3G6ES 2EWSA 4YR2A 2ZUGA 1U0HB 4Q0BA 5AQQA 4PQUA 1HNIB 2MLYA 3JYTB 4GW6A 4DPUA 3AA2A 4WF9L 4AF1A 3LL3A 2N7CA 4J2AA 3OJUA 2J6TA 3MHYA 1YBTA 2X3DA 3SSRA 4X64K 2DHXA 3K5PA 2MHEA 3KHHA 1U6BA 3G71S 3CERA 2NS1B 1BL3A 2V63A 1F3FA 4FXDA 3FFIA 1RAOA 1VRTA 4OIXA 1Q78A 3QFUA 1XMBA 2K1RB 1WHVA 1NJYA 2ZNZA 2G2OA 2YCHA 1N33K 2HWIA 2RDDA 1L3SA 5F8HA 2LQ8A 4IKFA 2XWYA 3Q8PB 4I2QB 3TQ1A 1RLCL 1BISA 2HHTA 2BE9B 1REGX 4O4GA 1TYQA 2EK1A 3MEGB 1IJJA 4AD6A 4J9SA 2KFZA 5EX5A 2DKOB 2UXBK 2QL5B 4ZIVA 4KIAA 3DXSX 2JWNA 4DL0C 2JEFA 1SH0A 1AXQA 1I51B 5CYMB 1UEKA 1RABB 2KN4A 1X4HA 5EOYA 4V19S 1ZH5A 3CJKB 4IDKB 2V94A 2AGQA 4D3HA 2CVEA 2I5JB 2RKIB 3OQ2A 1L3UA 2EXUA 4Z37A 5ADXA 4DTRA 1DBDA 3TA2A 3VMFB 1Y11A 2H3GX 1HD1A 1K44A 4MKBA 3OA9A 4M3TA 4LFCF 1R0CB 5A2QU 4PUOA 4NYFA 4DLEA 4KH6A 4JEPA 1NJIO 1N0UA 3IR5B 3SPZA 2W25A 1YSJA 4JYAF 4DV1F 1AFIA 4WFYA 1N8RO 4CFBA 4KHQA 3R5BA 2IA6A 3EVMA 4Y3CA 3VAFA 4TYBA 1WG4A 2VJUA 3SJHA 3WHIA 1YJ7A 2OANA 1SJ1A 4ILRA 2BMBA 4JKDA 5GAHP 4ED2A 4MK7A 4B3MJ 6FDRA 1X7VA 3AY9A 1I1GA 1FRMA 3W2VA 2GGPA 5GADI 2IPOB 2M4MA 4JI6J 3Q8RB 2C3OA 5AQJA 3PYEA 1KS2A 3PLAA 2FHOB 3MAHA 3NNHA 2IVMA 3IAYA 2V4JA 1SV5A 4LF4J 3X3UA 4DSKA 2A6AA 3O4QA 4H54A 4ATNA 2IBOA 1RT7B 4ECYA 5L1JA 5LMNF 3DLEB 3QWUA 3A0IX 3CCLN 4UT4A 1U48A 2DY1A 3GE1A 4Q2MA 1RDDA 3E3XA 5HBMA 2LLZA 3CDUA 2Q97A 4X2BA 3KLEB 4RW6A 4M3YA 5BYQA 2VFTA 2OHDA 1JLBB 5JJBA 2O8CA 2OEKA 2LVWA 2PE8A 2RRAA 2DTUA 4K5SA 2BR0A 2D0CA 1QVGM 3VVTA 1SIWB 4RJVA 1XMQJ 2O8FB 3CFRA 1DLOA 1UA1A 4JI5F 1FXRA 1DTQB 1FEHA 2JJ4D 1J5EJ 5F3ZA 3BREA 1TK8A 5AR0A 3MM7B 2QA4N 3IWLA 2XMAA 4IRCA 1GQEA 3V6KA 4J9LA 5HN0A 1F9FA 4DTJA 3TX8A 2HBKA 4GKJF 3HPHA 4C6AA 2HS4A 4MK8A 5ETQA 3D5MA 1ILYA 3MCAB 5KRTA 1NOYA 3TEGA 2CZVC 3HHLD 3M9NB 1HNXJ 3Q2SC 4OYMA 1WSRA 4HLBA 3DLEA 3M6UA 4IKAA 2ALYB 2OH2A 3SQ0A 5L38A 1DTQA 1BIUA 2HNDB 1H2TZ 4ES2A 4HCBA 1SJQA 1VQSA 3VENA 3DGVA 5GADP 5KFLA 2YKMB 1VAZA 2DNMA 3ILOA 1APSA 5AE3A 4OKEA 1HX1A 1Q8KA 5F2RA 5F0XA 5FRNA 3VQ9A 3NWRA 3BO2A 4NB4A 5I3UA 3O2IA 2RD5C 1EB0A 5C2FA 5AQGA 1X5TA 3UFCX 2CPEA 4CZJA 1VFJA 5A8RB 1Y5LB 4DUYF 1CJKB 1NKEA 3NLCA 4B17A 2OPSA 2B51A 4LJMA 1SQGA 2F8MA 1MWYA 3P31A 2AMCB 1YJ9N 1BE4A 2NRZA 1KVCA 4NZ7A 3HPGA 5IXUA 2YH0A 1UZHA 3WC2A 1NJIT 3MD1A 1AT1B 5I9EB 2QL9B 1UAWA 3C6UB 3KLVA 4F0HA 3ZETA 3A8YA 4EUVA 2QLBB 4LH5A 2XEXA 1AYEA 3BQ0A 2KJWA 2CGLA 3AO4A 2G8VA 3IR6B 3CPEA 1DY3A 3UO0A 4P2SA 2I5JA 2HNDA 1RZMA 2ZBQA 2I7PA 1IBMJ 3QINA 4CJ3A 3GIKA 5ETPA 2G4BA 2HRYA 2DR6A 3FEZA 1Q1KA 3R27A 4CHZA 4FLZA 1CJVA 3I56S 4PWWA 3QIDA 2NRWA 3NEKA 2JC0A 3SMZA 5HQMA 3BS9A 2HB5A 2GAHC 2FJDB 4DSEA 4P2XA 3U6FA 4ETZA 3V4IA 4CJVA 3RB0A 2ZBPA 4LF1A 4CFCA 4W5OA 2W9BA 2QMUB 5T7LA 3HDSA 1Z2LA 4DDFA 4F04B 3QDKA 2ABYA 3LANA 1QAXA 3PRBA 4C11B 2KG1A 2EWHA 5BR8F 3MUVP 3NS7B 1Z05A 4A4JA 2J7UA 4KHRA 4AM7A 1YJWS 3AVIA 2DHAA 1GXLA 3VR1A 5CHIA 1J6ZA 5CZXA 2KT3A 4KT0C 4NL5A 3F44A 4B3SK 4CEDA 1I94F 5LJWA 2A3JA 4TXSA 5JMNA 1Y3JA 2BBEA 1WF2A 4OI2A 3CMQA 2I2YA 4KI6A 2F5GA 5J2PA 4YNQA 3UDLA 3O1BA 4YEAA 3BGRA 4P9SA 4CJ4A 4JI5J 2OJ3A 5JVGQ 2WK4A 3CWJA 4PR6A 2F40A 1J5EF 1HBOB 4USIA 2E5GA 3TR8A 2YTCA 2V67A 4ZPAA 1E4FT 2DGSA 1KAYA 4A8OA 5LM7E 1P8ZA 2DNYA 4EAHD 3H46O 4LSNA 3DM2B 3G8TA 3PW7A 4BHQA 1KVJA 5HOOA 4HCCA 4XO0A 2IDLA 3KJFB 2UU9K 5FRMA 3KJVA 3AXKA 1XNQF 2PAVA 3IFRA 3MECA 5KFDA 3TAGA 3PSFA 4KTWA 3EE9A 4IYQA 4CHOA 3VF6A 1PJ5A 3CF5L 3VF4A 5KT2A 1U1OA 4QOTA 1T95A 2ATLA 1SIZA 2AP6A 2A0FB 3QETA 3HCXA 3HX9A 2LA6A 3OFHA 2HNZA 1J2VA 2IC3B 5CA5A 3HI9A 2HW3A 3LP1B 3VQEA 3TAMB 4NASA 3EVWA 4AHUA 1IWGA 1JQGA 4MIAA 5IM0B 2VJVA 3QBCA 1LOUA 4DG1B 5BREA 2QEXS 3J81U 3D68A 2VG5B 3TEHB 3TJAA 4NA3A 4DCJB 1QUPA 2HBYB 3OL6A 2P9GA 3SCXA 3EXCX 2E5LF 4RNNA 3NGIA 5T7BA 3OL8A 4RR5A 2AD9A 3C46A 2ERRA 3SFUA 4HHTA 1NH7A 4JI1J 2R7SA 3NKYA 3UN3A 5CE3A 2LXFA 5CD4H 4LF7J 4M3UA 1N32J 2XHCA 4CO0A 4ELTA 1HYZA 1I94K 5ETOA 3BY5A 2YX4A 1JB0C 1JNZB 3IN5A 5FD1A 4Z4GA 3MXHP 3PVXA 4HTLA 3QESA 1SUQA 2ZFHA 1S1TA 1Q7LB 4FBUA 4WFNL 1O1WA 1JJ2R 1WOSA 5AXKA 2H65B 3DRXA 4EGLA 2HAFA 2VH7A 3M8SA 4CQ1A 3DCAA 1RWOB 3FK4A 3DC2A 4GRSA 2QFJA 4F4XA 3AO1A 5C15A 3O3GA 1YI2S 4I6WA 4W5QA 1RCXB 4O3OA 3NH0A 3AD9C 3CJTA 4PG8A 3K2PA 2RILA 3A13A 4DV1K 5BRFA 3LPTA 2HRTA 3DOMA 4NA1A 3QFWA 1LFWA 2K7KA 3GWCA 1WUAA 2LU2A 4LF5F 3AODA 2BANB 3BEXA 4FJNA 1J54A 4OJGA 2JVOA 2F1FA 1TK5A 1Q18A 2ZM6K 1Q82T 3QIPB 3BO3A 3WXMB 1UPPA 4DSFA 3K5NA 4CBWA 2ZHAA 2VPWB 5KFHA 4OV1A 4UW2A 2QWLA 4B3SJ 4M5KA 2LYVA 5DGBA 4FJHA 3PACA 2Z2ZA 3IP0A 1GAOA 4WE1A 2N4DA 5CYMA 3TJ8A 4OJHA 3M8QA 2CWXA 1HKAA 2QLFB 2XLKA 1KNZA 3CMES 2QK9A 1WF0A 1T3VA 3SQOP 2GBZA 3QGGA 1UETA 3SCJE 3KHYA 1NK9A 1REVB 1S49A 1S9FA 4IFYA 2DR9A 5AQLA 2RRBA 1RYRA 5LJ3Y 1QHTA 4LF2A 1NGFA 1RU2A 3NNCA 5DLFA 1MNEA 1S59A 3IBFB 2QKKA 3MDFA 2H4WB 1X4FA 1HI8A 2WCXA 2JFDA 3GSIA 5HRRA 2YQ1A 3IAS9 2KT2A 5AFUA 3DLGA 3ITHB 1Z1ZA 4L3QA 2FY1A 1RBTA 4CTAA 4USUA 4U8VA 5HO4A 4AL5A 3ENVA 1VQ7S 2VONA 1X9MA 3ZSXA 2UV8A 4PQUB 3PX0A 1FKPA 1C0MA 1UVNA 3WQPA 1YDLA 3I9V9 3MEDA 4ED3A 4OX6A 3Q8VA 2WRMA 1KVBA 4A2AA 2CQGA 4CI0B 1VQKS 5K8NA 5GAHU 1C1CB 2QA4G 4I67A 5AQHA 2P9SA 4EZ9A 4EMDA 3BF1A 3W9IA 1KLMB 3RMDA 5E3AA 1F1BB 2M8HA 1WOQA 5CZ1A 4LRBA 4YY3J 1VQNS 4CH7A 3GIRA 5CYJA 4J9RA 1PJ6A 3D4JA 2F7VA 5FDLB 4DR5J 2ZOGA 1RWXB 3H5SA 3VZHA 3VQCA 2CNOB 3M32B 1DLOB 4C48A 4IH5A 3AAQA 4QIWD 4YOTA 4Y2CA 1T05B 5EUHA 5GAGU 4KTZA 3LAKA 4QR1A 1KEKA 3QICA 3H45C 1PC5A 1TL5A 4IJAA 1WOPA 1SB6A 3MI7X 3JB9k 3LZIA 1FTCA 3C14B 3B4DA 4GY2B 4P73A 4NLRA 2F96A 4JV5K 3C6TB 4K50A 2HYIB 2R7YA 4LR9A 3RMCA 1RB0A 1XWLA 1GTHA 4RZRA 3VAJA 3TUIC 2W4PA 5BPNA 3K57A 1BO5O 3EGVA 3T1YJ 1RWVB 3PIPL 2DGWA 1N34F 3DXBA 3HLUA 1Q5YA 3HD1A 2MGZA 3I32A 2CQHA 3W60A 3L3UA 2IRXA 2FJXA 1MU2B 1TKTB 1VQYA 4J2BA 4P2FA 1RDWX 4E7HA 3L3VA 2AJ4A 1U02A 2B7CB 4C8LA 3GE9A 3NRBA 4H4KA 3GQCA 2C42A 3QIPA 2Q1NA 1CJUB 1XMQK 3POTA 1K1SA 3PIOL 5JS1A 2NXEA 1QHAA 5AJ3K 1V3ZA 3AVMA 4GV3A 4OI1A 3HI0A 2HQCA 3G6EN 3CG7A 4L73A 3PIOQ 1TAQA 4N8NA 4WPAA 3ISZA 2MB0B 4DV5J 1HWJA 1T3OA 2KM8B 2Z4PA 1FJGF 1N8RT 3FQKA 1BG3A 2WONA 3VQDA 3JSMA 4HH1A 3OTOJ 2ZJRL 3NBPA 3AVNA 3P38A 2XSJA 4IQMA 2DGVA 2NXUA 1T6DA 4C1NI 2KKZA 2GAGC 4CJSA 3D2EA 3H40A 2FZCB 3OYEA 3SZ2A 1NHKL 2BQ3A 3EWGA 4IFVA 4K4UA 5HQ8A 4H4KC 3OYCA 2ZUAA 3HHEA 1VRUA 3HM8A 4FJJA 5HBMB 4U7CA 1V3RA 4PXDA 2CQ4A 4ANEA 1SQFA 1TL3A 1U26A 5M1OA 4YORA 4ZVPB 1RILA 3MWPA 5L46A 4K7QA 4A46A 2XLJA 1ZBHA 3M2VA 3NNAA 2G8FA 2CQ1A 2A5XA 1BIZA 2Z1HA 1DJ0A 2D1KA 4M3XA 2VPXB 4CW7B 4LR8A 5FROA 3AB4B 3DFEA 2B0GA 2WFBA 3MEDB 2B3TB 3O3FA 4JI8F 3OR1B 1D4XA 5HMXA 3IG1A 4ANCA 4I2PB 4DQRA 1BI4A 2BOPA 2VC0A 4ZVRB 1ZA1B 3IBWA 2KHCA 2OEJA 4E7KA 4FVCA 3AVCA 4F25A 3P4UB 3R9PA 3CFOA 1IBLF 3A8KA 4M41A 2DISA 4OYIA 3G87A 4FWSA 1QE1A 1Z6RA 4H0PA 3GV8B 4KPYA 1KTVA 4OLBA 3BSCA 1YVNA 3U1LA 1HIYA 2W2PP 1GX5A 4DV2K 3W3SA 4ERDA 1T9WA 1LOTB 3N6MA 2CPZA 5F9LA 1RAEB 2I0XA 3RBZA 4E19A 1GK8A 3OTCA 2ROEA 2IVPA 2J9CA 4YOUA 5JICA 2GVZA 4C3LA 3OYNA 1BQNB 5ETLA 4USKA 4B1XB 3DM2A 3UN5A 4JV1A 3CCJS 2DNRA 3EMTA 3MCMA 3AOCA 5GAEI 3LA0A 3P6YC 5KRSA 2AWZA 3SBGA 5HMYA 3L4QA 4J8FA 1FO1A 4Y2IA 1Z4UA 2RMLA 2R9LA 3QNOA 5LMUK 1S4FA 1IBMK 3NAHA 2HS0A 1VHIA 3TOQA 3KLHB 4Q0BB 2OSRA 3ZZZA 3C16A 2QWMA 3H3OB 4H5RA 4DV5K 2G8KA 4YB5A 3VN5A 2GZOA 2OA8A 4KRFA 3RBEA 1EWRA 3NVMA 2ZZNA 4R0JA 4EWTA 2MYFA 1RE1B 1RHMB 1VI7A 3TYTA 3CPWM 4M1KA 1RTDA 3ZZ0A 3TWHA 4P10A 1RK8A 1S4EA 2K8GA 1TK0A 4DU7A 3ILJA 3WEEB 1HKGA 5EDWA 2C28A 3CCVN 2DR7A 4RU9A 4L75A 2DR5A 3D1HA 1VQ8N 3OW2R 3FZMA 1TL1B 1NCLA 5T7LB 4WF9Q 1LWEA 3MUMP 3KHRA 4ZVTB 1RBLA 2AHOB 2QW9A 1NU4A 2XYGB 1UCNA 1NHVA 4NXNF 1LCUA 2KLAA 2OO4A 1ZM9A 3V4MA 1R8AA 2ZITA 4TY8B 1MROB 3DLKA 3LOUA 2D5RA 3T5KA 1U0SA 1XNRJ 3I9ZA 1SPBP 1A0OB 3J7ZO 4LY7A 3VOVA 2KKHA 1SVDA 5L1LA 2WVDA 4KHYA 2FJWA 3SDEB 1SL1A 3PW2A 2AQ4A 4BR0A 4DL4A 3NGZA 1YITS 3GMGA 1C1BA 3JTOA 3BR8A 2Q43A 2PD1A 4CF1A 4FM0A 1T11A 4OL8A 3AB2B 4Z0UA 2JNJA 1VS3A 4BRAA 1EETA 2OPPA 4JP8A 3WIUA 1ZM4A 1EP4A 1X0FA 2OIHA 3JTPA 4GKKJ 2ZJPQ 1RSCA 5JLFA 1OH6A 5AFUH 2BM1A 2AF6A 4TLRA 4K4ZA 1X9SA 1M5OC 1LWXA 4BBYA 3D6HB 3AV9A 1S12A 4OKKA 2I38A 2QFIA 4J91A 1IH7A 4N8OA 1Q5VA 3V1OA 2QX0A 1R0BG 3R6GB 2HURA 1RT5A 5F8JA 2ETJA 1YIJN 2PFFB 4I2PA 4EZ6A 1U7LA 2NYHA 2VKZG 4GVMA 1FCAA 5KG2A 2HFOA 3KHGA 1E6YA 1D5AA 4B3RJ 3JAMO 4Z4EA 3EUNA 4IEIA 4DL7A 5IT9Y 2LCWA 1W0HA 3V9WA 1FFWB 3G2XA 2LXIA 3CQ8A 5F1XA 4DXLA 4HR2A 3DNCA 3LDQA 2L08A 2IDEA 4I2QA 2B9XA 1VQ9N 1JLGA 8RUCA 4KH0B 4Y2AA 3M9MB 4X66K 1RTHA 4S0MA 2E5LJ 4AQYF 2PEHA 3RGIA 1RAIB 3R9LA 2R2SA 3OTDA 4PHTX 3FBCA 4FNIA 1KQKA 1BD6A 1OY9A 3VESA 4Z4FA 3GSDA 3PHEA 1FXLA 2RDJA 4AM6A 2BE2A 5E3PA 2E2OA 1YTUA 1NBEB 2MLXA 4FBTA 2A3ZA 2H54B 2BJDA 4X4TA 5AQKA 3NBPB 4LVOP 2OGUA 4ZKAA 2RU9A 2M70A 3GR1A 3ZTQA 1U1KA 1O5JA 4E1JA 1WHWA 3MWTA 1F60B 5HATA 1S1TB 2E1AA 3K9JA 2QA2A 3TVKA 4DLGA 1WJ9A 1VBXA 2SXLA 1YTYA 2CRLA 1SJ4P 3BGLA 5H9EJ 2Q66A 4LIRA 2XI2A 2KL8A 5HP1A 1GMWD 4QWDA 3VQBA 4X84A 1YBAA 4DU1A 1YAGA 1IV0A 3CIZA 4JRPA 1LWEB 3MAAA 3I8DA 3NDKA 4WYWA 2OPSB 4E7IA 1OY6A 3SI8A 3AGRA 4ES3A 4LF9K 1TP7A 1S1WB 4KV8A 4NZ6A 3BR9A 3QJLA 2MKJA 4TU8A 2G8IA 3HHNB 4CD3A 1B0VA 3T9ZA 3TU5A 5BN8A 2EC0A 4FOIA 1Q86O 2DO4A 2Q1LA 3M6WA 1IG9A 1YJNS 5JVGL 3NGDA 2Y1IA 2BJ3A 2ZM6J 5AZIB 3WXJA 3MZIA 4BGAA 4TY8A 4WIQA 1AUSL 2PC6A 5DDPC 5AZJA 5E3RA 2QO3A 1JL2A 3O6QA 2VQEF 1MROA 2I9SA 1FERA 3ZXWA 4YR0A 2NCKL 2R42A 2ZOMA 3NS5A 3RW6A 3LAMA 1QQNA 1U8SA 2EFOA 2RN2A 1ZOTA 4DCPB 3AAWB 1WNEA 5FLXO 5A8KB 1N33F 4JK8A 1F0XA 4CWBA 5DETA 2YHWA 2FTRA 4FW2A 3HKZD 1NGDA 2VKRA 3UNYA 3FZKA 2A2CA 4M7XA 3UKUA 3G82A 1Y4ZB 1S72N 2OELA 2C3PA 2A1SA 5KFTA 2IAJA 1HBUA 4F3OA 2FSNA 2CJBA 3KK2A 4QR2A 4B9QA 2QIFA 1UEVA 3TI0A 1BC6A 3LP2A 1VR6A 1P6TA 3MMAB 5JLHA 4FZZA 4URSA 2FBXA 1SJFA 3AARA 2OZMA 4UY85 5IC6B 1IM6A 2G1DA 5HSPA 1IM4A 2HHHJ 4A47A 3J81O 1M1KT 2H48B 2PA3A 1ZAVA 4ZVQB 3OD2A 4F7VA 3K59A 3R6MA 2YV0X 4EP5A 1ELOA 4OQJA 3AOBA 1Y5IB 5LOQA 1U25A 4BY9C 2CWKA 2FJVA 1VQLS 5AQFA 4JI6K 4I68A 2Y0BB 1YVUA 4I6MA 5KFRA 3NCQA 3AGKA 3M6VA 4OX7A 3L09A 1RT1A 2HAIA 3U4LA 3S1TA 3ZC4A 2HVZA 2WOMA 3FBBA 4QJVA 1IR0A 1NJXA 4C0BA 3MR7A 3CQYA 4JD2A 1KXPA 1D9DA 4NEYA 1KP6A 1DGKN 3H5UA 4PQAA 4NA2A 4IG3A 3KVGA 3OFFA 2LKZA 4P71A 1EQYA 3D7SB 2MQPA 2DGXA 5HRPA 2O8BA 4I9QA 3MMAA 4CZFA 2GC8A 2V7YA 4H4OA 3KWIA 1HNZF 4ZVHA 4F67A 4DV5F 5DGAA 4ID5B 5CABA 3SXLA 1CLFA 1RWKB 3AD8C 4XDDA 5EWEA 2FF3B 3SAFA <