3QIPA

Structure of hiv-1 reverse transcriptase in complex with an rnase h inhibitor and nevirapine
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
556
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse HIV-1 reverse transcriptase p66
publication title Structural and Binding Analysis of Pyrimidinol Carboxylic Acid and N-Hydroxy Quinazolinedione HIV-1 RNase H Inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 164
structure length 554
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3qipA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3qipA05
3NBPB 1F21A 4Z4GA 1S6PA 2F96A 1B92A 2KQ2A 1L3SA 1NK9A 1LAVA 4CEOA 3SUNA 1TQLA 4KAZA 5F8GA 2VG5A 1HNVB 3ITHB 2R8JA 2OH2A 1CXUA 2Z1JA 3SV4A 3V9ZA 1A5XA 4DTXA 3SUPA 4CGGA 5KFDA 4TY9A 1RDAA 1ZBHA 4KB0A 2OPQB 4QWBA 1YTUA 2XGPA 2F8EX 4YFUA 3L8BA 2XI3A 3BQ2A 2OPRA 1N6QA 1O1WA 1NKBA 5KG4A 4B9SA 2X6NA 1QQCA 3Q8RB 1WN7A 4E89A 4FJXA 3GILA 1TL3A 2KTQA 1S6PB 2D3UA 1LAWA 4O3OA 3TAMA 2VG5B 4EEYA 2VA2A 4OVLA 4HTUA 1C0MA 5HBMA 3UDLA 5DGAA 3CG7A 2IOCA 4CIEA 5F8NA 3K58A 3TAEA 3QETA 3RMAA 3QYYA 3RB0A 4CK1A 1RT6A 2OPRB 1N6QB 1WSHA 4FJ9A 1ZETA 3AVKA 4DL7A 3ZT4A 1RTJA 1HMVA 3AO5A 3BR9A 1TL3B 5DQGA 4XIUA 3V1RA 3HXMA 4CHQA 1CZBA 3TAMB 4LH4A 1HRHA 1KRPA 1D9DA 5HBMB 5J2MA 5I42A 2FBTA 1QTMA 4BE1A 3ZSOA 5KFXA 1SL2A 4Q44A 4DSIA 3AO1A 3KTQA 2R7YA 4DTNA 2ZKUA 1RT6B 2JLEA 3OYKA 1C1AA 2G8VA 1RTJB 1TK8A 1HMVB 5KFIA 4RNFA 3OS1A 4NZ0A 2C2RA 3NF7A 4RW8A 4Z4HA 4Z4EA 5KFHA 2DFEA 1KLNA 2R8KA 4FM0A 4CESA 4FVMA 1X9MA 3K5LA 5J2QA 4CGHA 5J2MB 5I42B 3HPHA 5HROA 2KFZA 1EETA 3SPYA 3UIQA 4FW1A 4ZPBA 4B9UA 1EP4A 1SKRA 1RT2A 2G8UA 4XPEA 4DL3A 2OYQA 3RAXA 2XY5A 4K8ZA 1HNIA 2PYLA 4F2RA 4GVMA 3RBDA 4RW8B 4CHZA 3O3GA 4J9MA 2AX0A 2KFNA 3QZ8A 2P51A 5J2QB 1N4LA 3C94A 4FLUA 5C25A 1QSYA 5HROB 1HYZA 1EETB 2O4IA 3OYCA 4QW9A 3CJ4A 5SWMA 4OL8A 4E1MA 4IH5A 2FVCA 1EP4B 1WSFA 1RT2B 5KFRA 2RDJA 3RMCA 1ZBIA 3Q8PB 4JS5A 1HNIB 4H54A 2KZMA 5KTQA 3TR8A 3VQPA 1KFSA 4TLRA 1BCMA 4I9QA 3NKYA 5KFLA 3HPOA 2E6MA 3SQ1A 2DY4A 4R8UA 1U47A 4KV8A 3AA4A 5C25B 3AA3A 1IG9A 1BGXT 1JLFA 4EP5A 5J2PA 1S0MA 4I7FA 3SQ4A 4J9QA 2D7SA 2G8KA 1GX6A 3OL6A 2RDIA 2HHXA 1J9AA 1VRUA 2P1JA 3CM5A 1RBUA 4C8OA 4HCBA 5JXSA 4F4WA 1RDCA 4IDKA 4RW4A 4NCAA 4G3IA 1NK5A 2VWKA 3IG1A 3OSPA 1EX4A 4R8UB 4ZP9A 4KV8B 3U3GA 4ICLA 5KFCA 1JLFB 5F9NA 4TSXA 5J2PB 4I7FB 1XR5A 4DSEA 4FLZA 4JS4A 4M3TA 4CFDA 3LWMA 3KJVA 3OLAA 1DLOA 2BRKA 4YNQA 1VRUB 3GV8B 4JRQA 4TY8A 3IN5A 1X9WA 4W5NA 2G8WA 3PUFA 1OS5A 4N76A 4IDKB 4RW4B 3OS2A 4CJSA 3NAIA 3IG1B 4J9PA 4E1NA 3LAKA 5DLGA 4DSKA 3ZSZA 5FRMA 1QAIA 1A5VA 1J53A 2ILYA 2ITGA 4ICLB 1K1SA 2XWYA 1RT1A 3HK2A 4FM1A 4IKAA 3OL7A 4E7HA 1EXQA 1S97A 5KG7A 3G6XA 3OYFA 2AX1A 4Q45A 3CDUA 4IKFA 1U4BA 4DFMA 2XGQA 3KJVB 1DLOB 2R8IA 2VA3A 4CK2A 3MECA 4TY8B 1T03A 2ZQBA 4ED2A 3ISNC 4B8CA 4AILC 4FJHA 5KFPA 5KFZA 1RBRA 2WB4A 4CF1A 3Q8QB 3PR5B 1IO2A 1ASWA 3KD5E 3EZUA 3CQ8A 5J1EA 4MK7A 2JEIA 3ZSVA 4WYWA 4QWEA 1RT1B 3CFOA 5KGWA 3OL8A 4B9LA 2V4QA 4CJPA 1NHUA 4ZMMA 3AVCA 4CEEA 5CZ2A 2AGQA 3MECB 3I0SA 4Y2AA 4JLHA 4UQGA 1S1VA 1T03B 3EYZA 1T94A 2AJQA 2HHUA 4M3YA 3O3HA 1JLGA 3PW0A 4EBDA 3PX4A 4K50A 3L3UA 3HJFA 4M3UA 4CERA 4NRTA 3LPUA 3MR5A 5J1EB 3MAQA 5JS2A 4ECSA 3SPZA 4RW6A 1XR6A 4LQ3A 4KHSA 3SFUA 2PZSA 3A2FA 3CFPA 3DM2A 2HHVA 4TQSA 4BDZA 1NK8A 3HKWA 3I0SB 1RA6A 5C42A 3F73A 4AHSA 4KHNA 3H5SA 4CJ4A 1IKVA 3KMQA 5EUHA 5JUMA 5L1JA 1KSPA 1JLGB 1UWBA 4CFBA 4KHWA 3NH2A 3LZIA 1VSEA 4NLSA 3S3OA 3QEPA 4AHVA 2DPJA 2QE5A 4ECZA 4F50A 1RNHA 5DQIA 1JKHA 4J2AA 3QEWA 4RW6B 2BR0A 2RF2A 1IKYA 4H4MA 3GV7B 3DM2B 3LALA 1IKWA 3KLHA 1NKCA 1SH2A 2YNFA 3O3FA 3QEXA 1TKTA 3T1AA 5C42B 1CSJA 2R2RA 4WE1A 1IKVB 4FXDA 3H4BA 3NF8A 4IFYA 2GUIA 3M8SA 1BL3A 4O3NA 1VSDA 1TAUA 3QNNA 1FK9A 3M8QA 3AVGA 1JLAA 4E0DA 1UWBB 3RB6A 4B3OA 2W7OA 2YNIA 3EPGA 3NL0A 4O3RA 2WRMA 3N6NA 2VG7A 3H5YA 3RB3A 3SQ2A 1TKZA 1JKHB 4FK4A 3KNAA 4ID1A 2RF2B 2D5RA 3QINA 1IKYB 4NRUA 4H4MB 4MK9A 3V6KA 1IKWB 4N56A 3KLHB 3QNOA 4CGJA 1RILA 3B6OA 4F8RA 5KT5A 2YNFB 3CYMA 4QPXA 4I9LA 4PQUA 2C2EA 1TKTB 1RDBA 1GOBA 1QSLA 2ZD1A 4WE1B 3VQBA 2UVWA 4IFYB 3CDEA 4WFXA 4DQQA 3BGRA 3SCXA 2HAIA 1FK9B 5CZ1A 3M8QB 1JLAB 2RN2A 3DLHA 4B3OB 4B9MA 2YNIB 2Z1HA 2ASDA 4ZP8A 2VG7B 1SL0A 1TKZB 1LW2A 3T5KA 4E3SA 4MK8A 3OYNA 1WSIA 4F3TA 4NLPA 4BWJA 2W9AA 1Z25A 3M9MB 4DQSA 5KFSA 3MR6A 4O5BA 3K57A 4PQUB 3KLVA 2D0BA 4OLAA 1WSGA 2ZD1B 4BWMA 4MKAA 3NAHA 4FJ7A 3DLRA 3BGRB 4B08A 3H2LA 3LP2A 2F8SA 4FLWA 4K8XA 4O0JA 2FJXA 4ECYA 4IRCA 1S9EA 4CJWA 1TGOA 4DFPA 3N6MA 4CHPA 2AQ4A 1LW2B 2FVSA 3AVJA 4FCYA 3BQ0A 5HRSA 3AVAA 2E9ZA 4OKJA 3U6FA 1SKWA 1RBSA 4FM2A 4ZVFA 2IGIA 4B8AB 3THVA 1HYVA 2YKNA 2IA6A 1QS4A 3QEIA 1TKDA 3LP2B 4H4OA 2JEGA 2WHOA 1S9EB 4QOZB 3CVKA 3BSCA 3OYAA 2BQRA 4YQWA 1YTAA 4W5TA 3KLGA 1ZTTA 2AGPA 3OYGA 3BQ1A 2R8HA 4EO8A 2DFHA 1MMLA 4JUZA 3HVWA 2JC0A 4YMEA 2JEJA 3TWHA 3FQLA 3K59A 3IAYA 1DTTA 4FZXC 1XHXA 4Z0UA 3LAMA 2AWZA 2D0AA 2YKNB 2J6UA 4FJMA 3NDKA 3VQ6A 3VQCA 4M94A 2PYJA 4H4OB 4M3ZA 4J2BA 3KLGB 2FLNA 1ITGA 3MXJA 4N41A 3AO3A 2UVVA 4W5QA 2HVIA 2WCXA 4AHRA 3RRHA 5KI6A 3G86A 2XO7A 1D9FA 1FXXA 1B9DA 3T5LA 1NKEA 3QIDA 3P83D 2DPIA 2VWJA 3FRZA 3IRXA 2HWIA 3MEGA 1S1WA 3CIZA 1DTTB 2YNGA 2BQUA 4F4ZA 3KLIA 4N5SA 5C24A 4DL6A 1A5WA 3PW4A 4K4VA 4FLYA 4N47A 4AH9A 2IBKA 3PY8A 3NGDA 3RWUA 4RW7A 3RRGA 2OZMA 2FLPA 1TK0A 3K2PA 3SV3A 3ALYA 5KRTA 4NYNA 4IG0A 4I2QA 4ECUA 3OYMA 4FJJA 1RT7A 3OHBA 3IRXB 4CJEA 3MEGB 1S1WB 2P5OA 4NCBA 5F8IA 4KHYA 2YNGB 4FK0A 5KFQA 3VN5A 4PUOA 3G6VA 1LWFA 3KLIB 2J6TA 1S48A 5C24B 4KPYA 3T19A 4CIFA 4CJVA 4BACA 4CJ3A 4J2DA 1LV5A 3V1QA 1WSEA 1JIHA 3VQ5A 3ZSQA 5CY4A 4RW7B 4J9OA 3VA0A 1JL2A 4HUFA 2A1SA 1IM4A 4FZYA 5KFWA 4IG0B 4I2QB 5KRSA 3RMDA 1Z4UA 3CWJA 3OJUA 1RT7B 4F4YA 4IRDA 2X74A 2D41A 3IGNA 2IDOA 3HL8A 3LP0A 4PUOB 1LWFB 4ECQA 1QAJA 4ZPDA 1JX4A 3DLKA 3V6DA 3WNFA 4XPCA 5EWEA 1TK5A 2FLLA 5F8LA 4OGEA 3K5OA 3LP1A 4B9TA 4LQ9A 4DLGA 5EWGA 4GMJB 4GC6A 1C0TA 1SV5A 3QESA 4RUAA 3LP3A 1W0HA 2X78A 4CJTA 4IQXA 3ZT1A 4Q5VA 2QKBA 5EU7A 1X9SA 5KT7A 3RR8A 1X1PA 1T7PA 3DOLA 4Q8EA 3OYLA 4DSJA 3L2QA 4DSLA 4CF0A 1S9FA 3ZSRA 2BQ3A 4E7JA 5KFOA 4O3QA 3PX6A 3OS0A 3LP0B 3QGIA 5KFFA 3I8DA 4DTJA 1JLEA 5KFNA 3KHLA 3L3VA 3DLKB 3V6DB 3AA5X 4DF8A 1S5JA 1N5YA 1UOCA 1ZBLA 4MH8A 4PA1A 4OKEA 4J2EA 1RTHA 4ZPAA 3O4QA 2FVPA 1HPZA 3LP1B 4C8KA 1U04A 4FZZA 2HHWA 1C0UA 1D0EA 5DG8A 3G10A 1C0TB 1SV5B 1KVCA 3SZ2A 1XR7A 4E7IA 4Y3CA 4M3XA 2HW3A 3DOLB 3B6PA 3V81A 4FYDA 3DMJA 1NK7A 2XY8A 1NK0A 4J9KA 4MIAA 5T7BA 3OYEA 2G8HA 3PX0A 5K14A 3O4NA 2V4RA 1JLEB 2IM0A 1BIZA 4NLVA 1ZBUA 4DLEA 4DTUA 4ZTFA 1N5YB 2ZE2A 1LW0A 1RTHB 1GOCA 1HPZB 4Z4IA 1J54A 2DTUA 1C0UB 4NLYA 2UVUA 3RB4A 5KG5A 2IAJA 4KB7A 4Q8FA 4KE5A 4W5OA 3GQCA 1QHTA 3V81B 5I3UA 1LWCA 3V1OA 4AHCA 3DMJB 4U7CA 4O55A 2HHSA 5F8JA 4JV1A 3OJSA 3CDWA 4HYKA 4QAGA 4CECA 5K14B 4J9LA 1L5UA 3KHGA 4HUGA 4QCLA 1S49A 3GIKA 3AO4A 2RKIA 1N56A 1JLQA 3AVFA 2ZE2B 3MF5A 4ED8A 1LW0B 1RT4A 4DL4A 3KLFA 4CJLA 3UQSA 4OJRA 2Z1IA 5L9XA 2IAJB 3NAEA 4W5RA 3OYIA 3EPIA 3SUOA 2IM2A 1LWCB 5I3UB 4FLTA 4CEAA 4H8KA 5KFVA 3UPFA 3LANA 2E6LA 3H4DA 2O5DA 2XY7A 1CXQA 3AA2A 4WXOA 3VQ8A 1FKPA 5HRRA 2R2UA 1RAJA 2RKIB 4DTOA 1JLQB 4U6PA 1XI1A 2HNYA 3OYJA 1TKXA 4TQRA 3NE6A 3U3YA 4DQRA 1RT4B 2RPIA 3BSNA 1KVAA 1BI4A 3OLBA 3KLFB 3NH1A 4MKBA 3RAQA 2J6SA 3LPTA 4TN2A 4PWDA 1S1TA 4EBEA 1W25A 5KGXA 1I3AA 4K4YA 4EYIB 4EBCA 4O3PA 3GIJA 4CK3A 1RTIA 1D5AA 3CO9A 4I2PA 1FKPB 3AO2A 1K1QA 1BCOA 2HNYB 4O4GA 2JC1A 1TKXB 2JEFA 2XI2A 1Q8IA 5F9LA 4K4WA 2AGOA 1BI4B 1EKEA 4ECWA 1D1UA 4Z4FA 4G1QA 4F2SA 1S1VB 4PWDB 2KW4A 1S1TB 1VSKA 1WLJA 4LD0A 3MFIA 4CFCA 4DG1A 1VSLA 1L3TA 3L2UA 4NLUA 4KRFA 3AVLA 4ED0A 4FK2A 1CZ9A 1S0OA 1RTIB 3OY9A 1NJZA 1XC9A 4I2PB 4IR9A 3AVIA 3VQ9A 4O4GB 5KT4A 3NF6A 3CJ3A 3DLBA 1L3UA 4DFKA 2BE2A 4CHYA 3TAGA 4ELTA 4O44A 4PY5A 2I1RA 3RMBA 4G1QB 3K5MA 3MXIA 2BGGA 3V9UA 1RYRA 4KTWA 4HHTA 2EC0A 4KAIA 4DG1B 3CJ5A 5L1KA 3QLHA 5DMRA 2QK9A 1JXLA 4NLWA 5KT2A 4IRKA 1T05A 1ZTWA 1J5OA 2ETJA 4DTPA 3TANA 3PR4A 2D3ZA 2AU0A 3GV5B 5KFBA 4ZVEA 3KKRA 3SI8A 4ELVA 1U48A 2LSNA 4BE2A 3HYFA 4B9VA 3DLEA 5FROA 2W8KA 1HQUA 4B9NA 1VSIA 1S6QA 1ASVA 1SH0A 2IM3A 2BE2B 1KVBA 5KFMA 4O44B 3ISND 4IH6A 4CJQA 3HM9A 3VQ7A 1QSSA 4O0IA 3AVHA 3QLHB 3BSOA 2HMIA 1UA0A 2WOMA 4ZVHA 1ZYQA 3DOKA 1T05B 1J5OB 1T8EA 4KHUA 2W9BA 4K4XA 4CIGA 5C5JA 4ECVA 3HP6A 2NUBA 2OPSA 3DLEB 1RTDA 4K4UA 4FLXA 3D5MA 1HQUB 1S6QB 4FJLA 1GOAA 1NOZA 1BHLA 1VRTA 1VSJA 2DFFA 1HQEA 4Y34A 2Y1JA 4EO6A 2Z1GA 4DF4A 3ASMA 3OL9A 4OKKA 2QXFA 1REVA 5HLFA 2HMIB 2WOMB 5FRNA 2I5JA 3DOKB 2IJNA 5J2NA 3PJXA 2OZSA 2IM1A 2W9BB 1L3VA 3TABA 4NLTA 3JYTA 2FJWA 5KFKA 4WZQA 4RNOA 1R0AA 4C8NA 4BDPA 4DEZA 4DQPA 3PVXA 4RG8A 5DLFA 1QUVA 2OPSB 1RTDB 1WSJA 3NGZA 4XO0A 3PO5A 4FS2A 4KREA 4NLOA 4CF9A 3SJJA 1VRTB 4DTSA 1IH7A 1HQEB 3TI0A 3ULDA 3MEDA 3I5CA 1REVB 2CKWA 5HLFB 3D0PA 2I5JB 4CHOA 4BE0A 5J2NB 1C6VA 2X6SA 3LWLA 2GIQA 1U45A 3JYTB 1R0AB 2W42A 2GV9A 2YV0X 3KIOA 4QWCA 1RBVA 3KHRA 3PJWA 4QWAA 3IS9A 4DMNA 3QZ7A 4CEFA 1VSFA 3PW5A 3TAQA 2BDPA 4AHTA 1S1UA 3MEDB 2C28A 1YVFA 3AV9A 5JS1A 4YR0A 2R2SA 1K6YA 4RU9A 3ZSWA 3WNGA 5DGBA 4M95A 1RDDA 3HP9A 4ZP7A 4AHUA 4DWIA 3V6HA 3HSTB 1RA7A 4K4ZA 4KTZA 3OSNA 1NK6A 3S9HA 1I6JA 1BIUA 3LDSA 4F4KA 4KKOA 4CJUA 2ILZA 3IS9B 3M8RA 4QWDA 3WNHA 3D28A 5KFYA 3KK3A 1S1UB 1FKOA 5KFTA 1BQNA 3OYDA 3RBEA 3RR7A 4K4TA 1IKXA 4DL5A 3V9XA 1C1BA 1S0NA 5HRPA 4LSNA 1D8YA 5KFJA 5EWFA 4KSEB 2E9RX 3D45A 2A1RA 2IJFA 4DS5A 3UR0A 2WK4A 1TP7A 2ALZA 4FJ5A 4FJKA 4YR2A 1JLBA 3VQ4A 2C2DA 1SH3A 4KI6A 4KKOB 3QGGA 4KHMA 2C22A 3OYHA 2IC3A 3EZ5A 1Q9YA 1XWLA 3DI6A 3KK3B 3S3MA 1NJYA 1QE1A 2R8GA 1VSMA 1FKOB 3DDKA 1BQNB 2XRIA 4ID5A 1IKXB 4HCCA 1TV6A 2KZZA 1C1BB 3KLEA 3WNEA 4LSNB 3OVNA 4DQIA 4DSFA 3PHEA 3N6LA 1UA1A 4CF2A 1JLBB 4QW8A 3V9WA 4LSLA 1I39A 4CHNA 2UVRA 1WNSA 2W7PA 2IC3B 4FJ8A 3DI6B 5KT6A 4OLBA 3BJYA 1QE1B 3FFIA 2ATQA 3TQ1A 2UUWA 4ECRA 3MXMA 2IMWP 4ZVGA 3VQAA 3KOAA 4ID5B 2XHBA 3LZJA 1TV6B 3MFHA 3KLEB 2B5JA 1ZBFA 4JV0A 1YT3A 3BSAA 2FJVA 4RUCA 4RNMA 4OPJA 4FJGA 3QIOA 3ICLA 3VQSA 1B9FA 3PW2A 4JV2A 3TAFA 4TYBA 2YHBA 4LSLB 3SYZA 5D3GA 4FS1A 4F4XA 3KK2A 3VA3A 5DG7A 4CF8A 4ZP6A 3AVMA 3TVKA 5L1LA 3FFIB 5KG1A 1XHZA 3SQ0A 1S1XA 4IR1A 2V0NA 1U09A 2B5JB 3PV8A 4TXSA 3V4IA 3SI6A 1KHWA 3FQKA 2B6AA 3TARA 3TAPA 3ZT0A 4MIBA 4NCGA 3KK1A 1S9GA 2PY5A 5F8MA 4M3RA 3GIIA 2XCAA 1VK0A 3MEEA 4WYLA 3ZSYA 4O3SA 4CEQA 1BQMA 3SFGA 3I5BA 3VQEA 4FJIA 3S3NA 4YP3A 3QIPA 4Q0BA 4C8LA 2FC0A 5D3GB 4R5PA 3H5UA 4KTQA 4RNNA 3KK2B 5KG6A 4Y2CA 1RT5A 1MU2A 3HPGA 2XY6A 1JL1A 2UUTA 1NOYA 3MTKA 3H40A 4DS4A 3E01A 4JRPA 4CJKA 1S1XB 3BDPA 3Q8SB 3NGYA 3NF9A 3L2WA 1SL1A 3V4IB 2R2TA 4M41A 3ZT3A 2B6AB 2CJQA 4NCGB 3KK1B 1S9GB 3DRPA 2FVRA 3MEEB 4RW9A 4M42A 4Y1DA 4NLGA 1BQMB 2XC9A 4DU1A 4DU3A 3QIPB 4Q0BB 3T5HA 2Y1IA 2HVHA 4OGCA 4R5PB 4M45A 3H59A 1RT5B 4WXWA 1UAXA 4LY7A 2ATLA 1MU2B 4KO0A 4ECTA 2D0CA 2YKMA 1DTQA 2BANA 3E01B 4CGDA 2G8FA 4KI4A 5KFEA 2BRLA 3T5JA 3QEVA 4ZHRA 4HUEA 4URGA 4CEDA 4ED3A 3ZT2A 4ELUA 4Q43A 3DRPB 5FDLA 4F3OA 4ED1A 5T14A 4RW9B 3KD1E 5HP1A 4KFBA 4CE9A 4DTRA 4RNHA 3RTVA 4MFBA 1KFDA 2EX3A 5SZTA 4CEBA 5CYMA 3NH0A 4KO0B 1G15A 3VQDA 2YKMB 3H98A 4IH7A 3EY1A 3T3FA 4ECXA 4NLDA 1DTQB 3G0ZA 4EYHB 1KLMA 4FJNA 2BANB 2HNDA 3CJ0A 1VSHA 2FBVA 3C6UA 3JSMA 4ZHRB 3SUQA 1RYSA 2W8LA 2E9TA 2JGUA 3ZSXA 4Y1CA 3F9KA 3DLGA 1KCFA 1SKSA 5KG0A 5FDLB 4E7LA 4Z4CA 1T3NA 4GW6A 3FDSA 2HNZA 5HP1B 3E51A 3CM6A 3HVTA 4KFBB 2YNHA 2FVQA 4MFBB 3OYBA 1RDRA 4M3WA 4WFZA 3ZCMA 4CJ5A 5CYMB 4EZ6A 3NHGA 4BDYA 1LWEA 1NJWA 2HB5A 4J9RA 2FBXA 4DTMA 2WTFA 1KLMB 3BREA 2HNDB 3CJ2A 3AVNA 4EZ9A 4IBNA 3SNNA 5KFGA 3C6UB 4FLVA 5L1IA 3JSMB 4E19A 1HYSA 3QGHA 3DYAA 5HRNA 1JLCA 2B4JA 4HVJA 3DLGB 2HWHA 4HKQA 1C2PA 3QERA 1HJRA 1JXEA 4MQ3A 2HHTA 1KHVA 2HNZB 1S4FA 3HVTB 4NYFA 2YNHB 5EDWA 3H5XA 2B43A 3HT3A 3NFAA 3NGIA 1HARA 4IOBA 4E7KA 2ASJA 4NLXA 3L2RA 1CLQA 3I5AA 1LWEB 4CGIA 4X2BA 3V9SA 3M8PA 3QO9A 2GC8A 4C8MA 4DU4A 4DFJA 3NMAA 4CGFA 3HVRA 3KMSA 4KHRA 4J9SA 4CJFA 1HYSB 2QV6A 3M9NB 4IFVA 4KB1A 3OHAA 3DYAB 3HVAA 4J9NA 4GC7A 1JLCB 2HHQA 3DRSA 4ED6A 1TVRA 5E41A 5DQHA 2VG6A 5KG2A 4ED7A 4ZTJA 1RBTA 3P1GA 2Q3SA 4KHQA 1KTQA 2F8TA 4URQU 4NLQA 2P5GA 4YR3A 3I0RA 2FBYA 1WNEA 3CFRA 3DRRA 3M8PB 3QO9B 1TAQA 4L8RB 5KFAA 4IG3A 1GX5A 4RZRA 2IS3A 3H08A 4NLRA 4IFVB 3KHHA 4WZMA 1RT3A 1ASUA 1U49A 1RCHA 3GYNA 3DRSB 1TVRB 4LH5A 1NHVA 2VG6B 3IGVA 2GIRA 2EHGA 1NNDA 1YVUA 1WAFA 4DL2A 3P5JA 1Q9XA 2O4GA 5KT3A 2QKKA 3C6TA 5CYQA 4CEZA 2YHAA 4CJRA 4ZPCA 1Y97A 3I0RB 1Z26A 3DRRB 3NCIA 4O4RA 1C1CA 1S10A 3L2VA 3HO1A 3GIMA 5KG3A 4R0EA 4IG3B 1JXBA 3MR3A 2OPPA 2WONA 1TL1A 5DK5A 3M9OB 1SUQA 1RT3B 2OA8A 3PW7A 4KBIA 4FW2A 4WFYA 2XCPA 2W9CA 4URSA 3KKSA 2G8IA 3K5NA 3G6YA 1W9HA 3NBPA 3PZPA 3FSIA 2GBZA 3V6JA 1NK4A 1NJXA 3C6TB 5CYQB 1HNVA 3HHKA 5KFUA 3ITHA 4EP4A 2E4LA 4CFAA 1N48A 5DG9A 1C1CB 4OPKA 3MR2A 4NYZA 1WAJA 2ASLA 4CCHA 2OPQA 4FBUA 2OPPB 1BISA 2WONB 4TYAA 5F8HA 1TL1B 3C95A 1SUQB 3PO4A 3VQQA 2V9WA 2W9CB 3AVBA 4FBTA 4K4SA
chains in the Genus database with same CATH superfamily
4CYUA 4BR5A 3CERA 1S6PA 3M8WA 2KQ2A 3NGKA 3QWPA 4JKGB 3X3UA 1NGAA 1U1MA 4LIRA 2YBVA 3MI7X 2OH2A 4ALZA 2VQEJ 3PLAA 2LCWA 2Z1JA 1AT1B 2CGLA 3DC2A 3VEWA 2HRUA 4F04B 4KB0A 1LFPA 2Z2LA 4USIA 3G4SS 3VF0B 4CDIA 1N6QA 1NKBA 5E84A 1FJGK 4E89A 5GADU 2EI5A 2QTDA 3H3NO 5A6PA 4EUVA 4WJBA 4O3OA 4A8XA 1B0TA 5J1PA 2VG5B 4OVLA 1HQ2A 3RBZA 3CPWR 3UDLA 3C14B 5DDQC 4U95A 2OI2A 4ZVSB 1I94J 3CG7A 3B78A 2B7BB 3PSIA 3QYYA 3RB0A 4CK1A 5F41A 4BVPA 1UFWA 2ZH2A 4USMA 4WF9Q 4DL7A 2GHVC 1RTJA 3F0NA 5DJBA 3RBXA 1HI1A 4KHPF 2BJ3A 3MAAB 4JI8K 3OFEA 4USUA 3TAMB 2MZSA 4LH4A 5H9FJ 2GGPB 4JKHA 1JMTA 2DT9A 2GAHC 4BE1A 3EE3A 1JNZB 5E3CA 4YDDB 3KTQA 1X4GA 3A3PB 2RS2A 3N28A 2XS7A 5D15A 1Q86T 1C1AA 1JK9B 2HK3A 3KJQB 1HMVB 4RNFA 2ACMA 4ZDNA 1PKUA 4Z4HA 2P9NB 2DFEA 2PT0A 2YKAA 1RUSA 3O2IA 1WUAA 2RHKA 4FVMA 1RXOB 2GA7A 3HPHA 3SPYA 3W2VA 1SB6A 1N54B 3F56A 4AFFA 4KRWA 2X1FA 2ZF5O 4WKRA 2MPUA 4B9UA 2X51A 1SKRA 5GIOA 3IAM9 5ADXH 2G8UA 4XPEA 4B1WB 3RAXA 1N33F 2VOPA 4F2RA 4RW8B 3NGUA 2OIHA 3O3GA 1IR1A 1IBCB 2CPYA 3BH7B 4J9MA 1N4LA 4USVA 5C25A 1QSYA 5HROB 2PFFB 4MLHA 3OYCA 4QW9A 5SWMA 3QBCA 2MKYA 2NLXA 2RUGA 4KIAA 2CH5A 3NOCA 3MMVA 3P6YC 1WSFA 5HI7A 1MWKA 5KFRA 2HGMA 1VLOA 2PE8A 2VQFJ 3HOTA 3LDNA 4IEEA 2JLFA 1HNIB 2HHHK 2ZJQL 2DNMA 2JDJA 1CPZA 5ETSA 5KFLA 2QWNA 1JXVA 2KM8C 3CF5Q 2JHEA 1ACMB 4KV8A 2B51A 1YI2S 1IG9A 2YHXA 1JLFA 1Q78A 2XZWA 1WTFA 1HX1A 3PXGa 1VQKS 2D7SA 3BO4A 2JNJA 2UXDK 2FJDB 4M5GA 4C8OA 1PAEX 4F4WA 3DU6A 2CGKA 2RNEA 1RDCA 1DFDA 5AZIB 2HYIB 3W5YA 4IUFA 1F0XA 2N7YA 3MMCA 3MTJA 1NK5A 2VWKA 3IG1A 3OSPA 1EX4A 2MKKA 3G9CA 4R8UB 4ZP9A 1DQ8A 2RHQB 1CVJA 3O9QA 4TSXA 1PAUB 2P9IA 5IWAK 2YX1A 3CD5A 1H7WA 4M3TA 2HS4A 2BJEA 1U26A 4NXMF 1VRUB 1GLFO 2CYYA 4TY8A 4QS8A 9RUBA 1Q81T 4W5NA 1F5CA 3LDLA 2SXLA 4ZVTB 1F6TA 1RAAB 2OUGA 4ZVQB 1NB7A 3ZX2A 2XMJA 1XMQJ 3ZSZA 2ILYA 2ITGA 4ICLB 4OV1A 2YVSA 2XWYA 3LM9A 3HK2A 5DM6L 2ROGA 4IKAA 4E7HA 4B3RJ 1S97A 2LEPA 4Q45A 1U4BA 4DFMA 2XGQA 3KJVB 4CJ7A 2VA3A 2D4WA 4DCPB 2B4OA 3G25A 3A5NC 4IJAA 1VQ7N 4BG8A 4ZOSA 1K8AT 1WDDA 2E1PA 5A2QY 1CJTA 1FESA 2WB4A 3PR5B 3D2EA 1ASWA 4NLCA 2W01A 4NMXA 1NJIT 3CJ1A 4X4UA 3CQ8A 1ZA1B 3T9ZA 4JKAA 3UKRB 2JEIA 3LO3A 3ZSVA 1RT1B 3CFOA 2H1YA 2V4QA 3PYDA 4ILHA 2FJBB 2MQPA 4OJHA 3KG4A 1FD2A 3GB0A 3NEKA 4YEAA 1T03B 2W4CA 5M1FA 1T94A 1LOUA 2AJQA 2F9DA 1BOTO 4M3YA 3POTB 2YJEA 1YF5L 2DCLA 3VAGA 4C1NK 1SBRA 5DDPC 3J7AP 4M3UA 2IYGA 3O9SA 3BEXA 4DR5K 4IYQA 3LPUA 4WIQA 2RS8A 3MAQA 2CPZA 4ECSA 3ZZPA 4KHSA 1HHQA 2PZSA 5DZ6A 5HVFA 4ZIVA 3CFPA 2ZOFA 5IQ6A 2VWBA 2W2MP 3HKWA 1JJ2M 2BJ9A 1IKVA 2KJVA 3P31A 1N52B 3A8JA 1KSPA 2E5LK 3SK3A 3GFZA 1YJWN 3LZIA 1Y9OA 4NLSA 3S3OA 3EKSA 3P8BB 2DPJA 2LVWA 2WBRA 5IT4A 5BRDA 3OTOF 4J2AA 2RF2A 3VAJA 2HQGA 4KH6A 1N36K 1QJHA 5IM0A 2YNFA 2CRLA 4JI7K 3TA0A 4J90A 1TKTA 2R2RA 3CCQN 4ZCIA 4QJVA 1GMUA 4O3NA 1TAUA 1VSDA 4E0DA 1UWBB 4Q2MA 4ZPVR 3RB6A 3LA0A 2W7OA 4PXDA 2VF3A 2HVDA 1V4SA 3B54A 3EPGA 3NL0A 4O3RA 3GPAA 3EJMA 3QT7A 3Q24A 1JKHB 6FDRA 4DPOA 1VHFA 1F2GA 3QINA 1IKYB 3ZZZA 2J4RA 3NCQA 4CGJA 1FRHA 4F8RA 4JI0F 1SC6A 4PQUA 3IDHA 3MCPA 4ZJQA 1NSPA 4WE1B 2V69A 4I1TA 2G1DA 3SCXA 4GKKK 3M8QB 1JLAB 4JYAJ 3SAGA 1F5AA 2DR9A 2YNIB 4C11B 3SBGA 3AFGA 1VMBA 2HHPA 3ATVA 5A0YA 3CC2N 3VAHA 1LW2A 2C3MA 3T5KA 2KRRA 3OYNA 1HWJA 1C4AA 4BWJA 2H9ZA 2R7VA 2NNWA 3M9MB 5KFSA 4WP8A 4PG7A 4RUBA 2D0BA 1WSGA 4GVBA 4MKAA 2I7NA 1PBAA 3G82B 4ZVPB 2FJXA 1TZ0A 4O0JA 3N9UC 2MLZA 1B0VA 1S9EA 1TL4A 3MM9A 3CCZA 2OEMA 3PJ9A 3N6MA 4MIWA 4WFNQ 4Y6IA 4USHA 1T0TV 1HBUB 2AQ4A 2VPXB 3OW2M 4DV0K 4BR9A 4FCYA 1XMBA 2YWHA 2E9ZA 1VBYA 3HMJG 1SKWA 4LT6A 2EWHA 4FM2A 3JB9k 4ZVFA 5A8KA 4B8AB 1HYVA 2IA6A 2U1AA 2VH7A 2V2ZA 3LP2B 2WSEC 4CM2A 1OSDA 2Y1LB 3TVYA 4H4OA 4JI3F 1OY8A 2DHXA 3CVKA 4QS9A 3OYAA 3MDFA 4K59A 2BQRA 1YTAA 4UZCA 1RBLA 2ASMA 4L6V3 5GVQA 2CWXA 3BQ1A 1GTHA 4QIEA 1K73T 1MDUB 3TTCA 3ZTSA 1Y5LB 2BJDA 1VJWA 3AJ1A 3UDVA 3TWHA 3FQLA 2DNNA 1FTCA 1DTTA 2XZDB 2B3TB 1U2VA 2Y8YA 1RU2A 2JX2A 5DRKA 4LF5K 3VQ6A 4A8FA 3MN6A 2YWWA 3HSGA 3OTBA 3G71S 3MPYA 2O66A 3ATUA 4M3ZA 2GQCA 3OFGA 4M5HA 2DJWA 1Q82O 1N34J 1ITGA 2FLNA 4N41A 3MXJA 4BQLA 2UVVA 2N7CA 3SDEA 2HVIA 4W5QA 4DR7K 3AB4B 3G86A 2XO7A 4FF1A 2KVIA 1NKEA 3QIDA 1ESVA 1D9AA 1RKJA 2DPIA 1BWFO 3DXMB 2HWIA 2YNGA 3PIOQ 1IBKF 4GKJK 3VEVA 1OH6A 3BKUA 4N5SA 5AXMA 4G9ZA 2Q2RA 4DL6A 1G4CA 1A5WA 3PW4A 3R8YA 5AQKA 4K4VA 2KO1A 4NE9C 1FRXA 2NXJA 4FLYA 4CQ1A 3GOIA 1B7FA 4AH9A 2M4MA 3H20A 3TZZA 3Q23A 2HK2A 3RRGA 2OZMA 3CW2C 4C6AA 4NA1A 3ALYA 4NYNA 4IG0A 3J7AN 4ZITA 2XS5A 1S1WB 4B3SK 2P5OA 4V19J 3IR7B 5EOYA 4FK0A 1GAOA 2YWFA 4PUOA 2NUUG 1AROP 2AEMA 5MLCV 2ERRA 1O13A 2V6AA 4CIFA 4YB1P 4JI2F 4EMDA 3IR6B 2HGNA 5IC4B 5CY4A 1IR0A 4J9OA 4P2XA 1VIOA 3KZBA 1U7LA 5AQPA 3RMDA 1OH5A 1Z05A 2MKSA 4F7VA 2B4UA 3LP0A 3A8YA 4ECQA 4CLKA 2DPNA 1JX4A 3GDQA 4NL5A 3WXIA 4F0HA 4XPCA 5EWEA 2QWRA 4BRHA 2ASYA 2AEFA 4PYDA 3D6TB 1BO5O 4DLGA 2CZVC 5EWGA 4GC6A 3LP3A 3U8XA 4AD6A 1BUXA 2ROPA 4IQXA 3ZT1A 3K9KA 3FUYA 2WTUA 5KT7A 3RR8A 1T7PA 1J5EJ 2QEXS 4LRBA 4CF0A 3ZSRA 4LFAF 1OY9A 1HNXK 4PKDB 3TA2A 3QNWB 1NO8A 2E44A 1BA0A 3AA5X 2MGZA 1GQEA 4JKBA 2R7TA 1S5JA 2UXBJ 1UOCA 4MH8A 4BY9C 4UW2A 3D68A 3O4QA 2FVPA 3HOSA 4C8KA 2OD6A 2OJ3A 1C0UA 5DG8A 1Q8BA 1C0TB 3I9V9 4E7IA 4PXCA 4LVNP 3DOLB 1RLDA 2P9PB 2XY8A 2V9KA 3QATA 4J9KA 4DR4F 3L6QA 4JP8A 2QA1A 4ZTFA 4B3TJ 1N5YB 2ZE2A 4G65A 3ZZ0A 1LW0A 4LFBK 5K8PA 1RTHB 2DVIA 1GOCA 4Z4IA 1J54A 3FEXB 4JAXA 4EHUA 4CZMA 4DQ8A 3RB4A 4YOVA 3AJ2A 2IAJA 1NGIA 5BREA 3R7NB 3AY9A 4KB7A 2YXLA 2OGUA 4W5OA 2P9CA 2B56A 4IFEA 3T1YJ 4JI0J 1Z6RA 5CHIA 4HHHA 1VQ9N 5AQWA 1S49A 3GIKA 5E7OB 2NRWA 3L4IA 3Q2TC 1ZZNA 1XEZA 3MF5A 1RT4A 1U1PA 2A6AA 2HIYA 4DL4A 4YS2A 4GV3A 2F9JA 3UQSA 3TUJC 5L9XA 1NWKA 4X62J 1XJWB 3OTCA 3SQGA 4W5RA 2N4CA 2Z58B 1HW8A 2ZM6F 5I3UB 4JD2A 5KFVA 1TFWA 2OELA 1TR0A 2CPDA 2P6SA 4DV6J 2VZ9A 4J8FA 5FPNA 2DNKA 2JOQA 3CCJS 2R2UA 5HRRA 3QFWA 1TKXA 4TQRA 2CQ3A 3U3YA 1QVGM 2A40A 5FD1A 1BI4A 3KLFB 3NH1A 3BBFA 1S1TA 4LFCJ 2X3GA 1W25A 2D0OA 3VEZA 1AFIA 2J0QD 5DDOC 4K4YA 3BKFA 3AOCA 3TZXA 3IA0A 4EBCA 2P9UA 4O3PA 4R25A 1RTIA 4OLOA 3CO9A 4AQYF 1FKPB 1K1QA 3WC2A 4O4GA 3WHIA 5F9LA 2P9GA 4C23A 4K4WA 1EKEA 4ECWA 2C2MB 1F9HA 4RCHA 2U2FA 1S1VB 4DV3F 2KW4A 3HJVA 2FZGB 1WLJA 4KR0B 4WU3A 4NLUA 2BVZA 3E9OA 2FY1A 5A76A 1MN7A 3IM8A 4DPUA 3OTEA 4FYWB 3KVGA 1F60B 3TRGA 2ZH5A 2FC9A 4JNEA 2KG0A 1L3UA 1HI8A 4CHYA 1FE0A 3R3TA 4KJIA 4G1QB 2VQEK 2BGGA 2W6LA 1RYRA 4KTWA 3FMWA 1UCNA 3CJ5A 5L1KA 3CCLS 3QLHA 4M5IA 3D54A 5DMRA 1JXLA 4IRKA 2P9EA 1J5OA 2NRVA 1FFGB 1MROB 3J7YP 3THWA 1WC5A 1T9VA 1FDAA 3TUZC 5KFBA 2UXCF 2JJ4D 4OYPA 3W66A 4ELVA 2IJRA 1P1LA 3SMZA 3SIPB 2W8KA 1VSIA 1S6QA 5CD4H 2IM3A 4N77A 1KVBA 4E1JA 4O44B 3QSYB 3D2WA 3RUBL 4DUYJ 3VQ7A 3IAS9 3TX8A 2HMIA 1SC3B 4ZVHA 1UVNA 3J81O 4UOFA 4K42A 5LMNF 5GAHP 3DOKA 5G0RB 2KFYA 4K4XA 1E4FT 5C5JA 2OPSA 3R5CA 3DLEB 3L7UA 3GG0A 4TU9A 1BHLA 2VIHA 2ABYA 5H9FK 1M5VC 2VBWA 3A5LC 2GFFA 4KH4A 3ASMA 2VV5A 2VONA 1REVA 3M2VB 3UNYA 5FRNA 2ZGYA 4NA2A 2HURA 3PJXA 1DARA 1L3VA 3TABA 4OZ0A 5KFKA 4DEZA 4FPIA 3PVXA 3MMAB 1TU0B 1DKGD 3MXHP 3T7ZA 2VJVA 1RTDB 1WSJA 3BY5A 2BYCA 4M7YA 3KXDA 4CF9A 3SJJA 1VRTB 4DTSA 2BJ7A 1HQEB 3ULDA 4ILMA 1HR0J 1X4AA 3MEDA 1YJTA 3GSIA 3RG6A 4A4JA 3D0PA 1Y3KA 2I5JB 3UR3C 3UDCA 4LFAJ 1UPMB 3OR1A 5J2NB 2BXJA 2WC9A 2X6SA 2OMLA 3LWLA 1R59O 1U45A 3JYTB 4AUKA 2FHJA 4MO4A 5AZJB 2YV0X 1YXQA 1NHKL 3EUNA 1UJ4A 3A3NB 4ZVUB 4QWAA 4CO1A 1RCXB 3CMQA 1ICEB 3TAQA 1YJ7A 1S1UA 2P2CB 1X60A 1TL7B 5E33A 5JS1A 2R2SA 3CNQP 5M1OA 4WTYA 1N32F 5D78A 1VK3A 3ZSWA 3WNGA 1KVKA 2EWSA 2AV5A 4K4ZA 2MY7A 3S9HA 3LDSA 2WW4A 3M30B 4KKOA 3LGHA 4UOCA 2KXNB 1H0HB 2PMHA 3THXB 1FX4A 1ZH5A 2HSEB 2W6KA 1DY3A 3RR7A 1ZOTA 2BX6A 4JEPA 1RB0A 4LSNA 4KSEB 2OEKA 2E9RX 2QFIA 3ZNJ1 2WK4A 2ALZA 4FJ5A 1IG8A 4LF4J 4GVLA 2F5GA 4U67Q 4JV5F 2C2DA 1SH3A 4LR9A 2VCPA 3QGGA 4KHMA 4NO7A 2IC3A 2GX8A 1B7YB 1XWLA 3DI6A 1HBOA 2QWQA 3KK3B 2LQ9A 3S3MA 1NPRA 1VSMA 2H5JB 4ID5A 1U2CA 2KZZA 1C1BB 3BGLA 3UN5A 5EVZA 5IV3A 4DSFA 1HL6A 1WI6A 2KXHA 1EX8A 4CF2A 1NGGA 2GO9A 1XMOF 4QW8A 3N01A 2HBYB 2KT3A 4PL8A 2FUG9 1XMQK 3GCWP 1NGDA 3BJYA 4OJGA 2XLKA 3MXMA 4B3RK 1RACB 1S12A 3LZJA 2PDAA 1TV6B 4K0KF 3CJAA 2M88A 4OZ5A 1E6YA 3IBFB 1YT3A 3NXZA 2P8IA 2LEAA 2NRHA 2GNKA 1NMDA 1K9MO 4FJGA 4DR3F 1SC1B 5AE1A 4YOUA 2LDYA 4CH0S 3FFKB 1EARA 2RAQA 4P6QA 3SCLE 2QRRA 3CJ8A 1P8GA 3B8AX 2MQ8A 2KLAA 4GMKA 3TVKA 4KH1B 4Q2LA 5KG1A 3SQ0A 5KPRA 3PDNA 1S1XA 5LXYA 1Y5NB 2V0NA 1HKCA 1U09A 5HK4A 3V4IA 4M1KA 3ZT0A 1MW7A 2XBPA 5E3RA 2VBZA 3GIIA 5GADP 5DETA 2HZVA 3MEEA 3ZSYA 4O3SA 3NGTA 1RAHB 4C3KA 3CJ7A 4Q0BA 2HQDA 3KK2B 4JHDB 5LSLA 4Y2CA 3ETMA 3O6WA 5BRHA 4DS4A 4X4PA 1SL1A 1VBXA 4DV4F 4NCGB 2CZ4A 5CQGA 3DOMA 2IVOA 3ULEA 1RHMB 3GBTA 2DNZA 4Y1DA 1BQMB 3KWIA 3AOAA 2HVHA 3AD7C 3VGKA 1RT5B 1UAXA 3H46O 2ATLA 2EKNA 1MU2B 1Y7PA 2D0CA 4E2FB 2IDLA 1BDGA 3E01B 3RYLA 2E2OA 5KFEA 2F3JA 3AODA 4BR4A 2UUAF 3QEVA 1W2BR 5U47A 4QR1A 3NVMA 2OO4A 1CS4A 4CEDA 3TVZA 5LM7E 3ZT2A 3CPEA 1OKJA 1S72N 4ED1A 5AQQA 5T14A 3VETA 3VF2A 4KFBA 2PFDA 1S4EA 1NGCA 3TSQA 2EX3A 1QZ6A 5A2QO 2A10A 3NH0A 3CHWA 4IH7A 3T3FA 3EY1A 4ECXA 1SS6A 3G0ZA 1DRZA 1U1OA 1FVQA 1KLMA 2BANB 5A8WA 1JJ4A 1B3TA 2HNDA 3CJ0A 3C6UA 1VQSA 3SUQA 3FE1A 1NRKA 1RYSA 2W8LA 3HZEA 3ZSXA 3DLGA 1KCFA 4O8UA 5KG0A 4Z4CA 4B1ZA 4Y0FA 2RQMA 5HP1B 3E51A 3HVTA 3EDRB 4JYAK 3OFFA 3DFEA 1E6VB 2ZH9A 4WFZA 3ZCMA 3UB5A 3GL1A 3NHGA 4FKXA 5JMNA 2HB5A 1XIQA 2V4JB 4A59A 1FJGF 2YKQA 3SNNA 4UT4A 2HPUA 3DYAA 3MK6A 2B4JA 4HVJA 2HWHA 1QQNA 3CPWM 1JXEA 3GJQB 2HHTA 2LA4A 2PI4A 4NYFA 2YNHB 4NA3A 3NFAA 3NGIA 2QYCA 3I55N 4C8ZA 3L2RA 3I5AA 1LWEB 1DGKN 2GC8A 2DIVA 2YWKA 3D7SB 2Q6CA 4NWBA 2CNOB 3NMAA 4CGFA 3HVRA 1N32J 1YJWS 4KHRA 1HYSB 3GU0A 5LY3A 4KB1A 4JI8F 1Q7YO 1JLCB 1VQYA 3PCOB 3UCUP 3R5BA 5KG2A 4ED7A 1F9EB 4ZTJA 1RBTA 3P1GA 1VLYA 4KHQA 2WUSA 2MSSA 1KTVA 1BA1A 4URQU 4NLQA 2LQ5A 3G8TA 3CCQS 4YR3A 3GR1A 1NM1A 5KFAA 4CH1A 3WEEB 1GX5A 2GZOA 1OH7A 4BRNA 4LRFA 4AE5A 4RZRA 2IS3A 3AH6A 3KHHA 3KKFA 3LPEA 4E98A 3GYNA 1RWVB 3DRSB 2D9PA 3FZ2A 1JCGA 5CE3A 2GIRA 1YVUA 1ZM2A 3AAPA 5EY4A 4DL2A 2NR0A 1X5PA 2E1MC 1E3MA 3MWBA 3FR0A 1R3NA 4BC4A 4ZLNA 4OHXA 2QKKA 3F41A 1N34K 4OLPA 5AFUA 5BYQA 2O8DA 3EE8A 1Y97A 3KWMA 5B0GA 4LF9J 3DRRB 4O4RA 1C1CA 2EFQA 3AHPA 2P9LA 1VQ4N 3GIRA 4PXBA 4IG3B 2WONA 2ZJPL 4MYTA 1XUPO 1SUQA 3CETA 2OA8A 3CC2S 4FW2A 3PEHA 2J0XA 1IJJA 1LXNA 2VL1A 3THPA 1XMOJ 5I3PA 3G6YA 4LF7J 3FSIA 3JSRA 2GBZA 1UFLA 5IT9U 3JAMU 4DOZA 2WSCC 3K0SA 1NMEB 5CYQB 3CI5A 3OUYA 2K1RB 2Q31A 1RDUA 3Q0AA 3OR2A 1N48A 3EZOA 1FA0A 3NGSA 2FD2A 2YY3A 1HKAA 1XNQJ 3RRKA 2ASLA 1AZSB 2XWXA 1GMWD 2HHHF 1HW9A 1LEOA 3C95A 3QFHA 4TU8A 3VQQA 1VQON 4RLEA 2LKZA 1LNQA 3UFCX 1QZ5A 4DX6A 3NBPB 1F21A 4Y2MA 4OPAA 4NI2B 1L3SA 1LAVA 4CEOA 1FFWB 1TQLA 3FC9A 1KAXA 1HNVB 3P45B 2UXDF 2E1AA 3SV4A 1R27B 3SUPA 5M1NA 2QX0A 3VGVA 4ZIWA 2M5YA 1T6CA 1RDAA 1ZBHA 1ZA2B 2OPQB 4QWBA 1YTUA 2IFXA 3UKUB 2XGPA 4YFUA 4OJ3A 1F1BB 1BC6A 1CZAN 1SQKA 5KG4A 4B9SA 1KQSM 4CLYA 4PEOA 3GILA 4J9UE 3D1HA 4CYUB 1TL3A 1S6PB 1FJEB 2D3UA 3BGUA 2VA2A 4HTUA 1UVMA 1GMWA 3O44A 1X31C 1J5EK 2CQ0A 1WHYA 3F44A 2IOCA 2FIUA 3UN3A 3VEOA 4DV4J 2EFVA 2ADBA 1N6QB 4I6MA 4JI1J 2DH7A 4FJ9A 4OX7A 3ZT4A 2MDAA 2KHOA 1BY9A 2UXBK 3BR9A 3LUYA 3CCES 3V1RA 3HXMA 1FI4A 1HRHA 2FGCA 4DV2J 2AW0A 2QM1A 2BZ2A 5J2MA 5KFXA 3E8OA 2N3OA 4DSIA 3RW6A 3O80A 5EX3A 3P4IA 3TTFA 3CC7N 2PIIA 4BC2A 1T9TA 1RTJB 4B3TK 3V2UC 2RD5C 4FVCA 3MM6A 2LECA 3U9ZA 4Z4EA 5KFHA 1KLNA 3CD6N 2R8KA 1X9MA 3K5LA 5J2QA 2YPZA 1PYSB 3Q2SC 4P71A 2BMBA 2NXNA 2V34A 4ZPBA 4I68A 3T1YK 4F3MA 1NSKL 3IR5B 2AZ1A 4JI0K 1EP4A 4DL3A 4DR5F 2OYQA 1VHXA 1FNMA 5DDRC 2HBKA 4CLLA 2PYLA 3RBDA 4UUWA 4U7UK 3MWTA 3LGMA 3ZNUA 4CHZA 2B9WA 1Q95G 2O01C 3UD3P 2KFNA 3QZ8A 2HBZB 2P51A 1YIJN 4X62K 4CLTA 1HYZA 4FPBA 3W2VB 1X5TA 3R9LA 4YY3J 4H0PA 4OL8A 3MMJA 1UJ5A 3W62A 1WSVA 2IIRA 2L3MA 4TVAB 2F7VA 3U9DA 2RDJA 3VALA 4DV6K 4JS5A 5FPDA 2WB1D 1BCMA 1N36F 4ANCA 3HPOA 3JSBA 2UU9J 4CZJA 2E6MA 3NY0A 2IHR1 5A8RA 1U47A 4JI7F 3ENHA 3AA4A 4AXIA 5C25B 4LFCK 4OZ2A 4EP5A 4JB8B 3CCMN 4JKCA 4I7FA 1ATSA 3SQ4A 1KD1T 1Q8KA 4IO9L 2RDDA 4EFAC 3OL6A 3NNHA 3GE9A 1NCLA 2KI2A 3CM5A 4HT7A 3O9UA 3EGWB 3CIMA 1YWXA 4RW4A 5IZHA 4AL7A 4CO4A 1S77D 5FLXY 3GE1A 4WKYA 4FXWA 2QIFA 4KGVB 4KV8B 2E1YA 1JLFB 5F9NA 4FWNA 3MURP 4KGZB 4GKKF 1XR5A 4IEIA 2G2OA 4FLZA 4OYBA 1UEVA 1DEJA 3ZTRA 2DNHA 2YHWA 4YNQA 3GV8B 4DX7A 1RAOA 1XTZA 4DDFA 2G8WA 1QY7A 3PUFA 4X66J 1DQ9A 4N76A 4GV9A 4EU0A 1SJ4P 3MMCB 3IG1B 4WFAQ 1VGYA 4E1NA 1VQ9S 3MX2A 4WF9L 1RGVA 5ETLA 1QAIA 1J53A 1BWEA 1K1SA 4L72B 1M1KO 1RQ0A 4FM1A 1EXQA 2P9IB 1OYDA 5KG7A 2ZH3A 4CWBA 3CDUA 4IKFA 3NCRA 4CK2A 2LXUA 4TY8B 2E5IA 2V8HA 2IDEA 3I31A 2ZQBA 2NPIA 4DV0F 4ED2A 4A62A 5KFPA 1RBRA 2YX7A 3Q8QB 2GUPA 2QTWA 4CP5A 1WC0A 1VAZA 3KD5E 3MPVA 3EZUA 4MK7A 4RWTA 1GFWB 2B9YA 4DUYK 4B9LA 5KGWA 2MKHA 1NHUA 4ZMMA 3C2PA 2MKCA 2K06A 3AAWB 4CEEA 3HFZB 2AGQA 4WP3A 4JLHA 1APSA 1S1VA 1RABB 4CTAA 3LDOA 3EYZA 1CJVA 1M1HA 1PSDA 3M1VB 3LL3A 3O3HA 3LOUA 4ETZA 1CJTB 3ZEUA 2ZHAA 3PX4A 2CIMA 3D2EB 4K50A 2W7AA 5ETMA 4P75A 4LMZA 1N0UA 1XN9A 5I4MA 1SKUB 4LF5F 4ZN3A 1SQEA 3SFUA 1RADB 3W63A 3DM2A 1YLXA 2HHVA 4TQSA 2HVZA 4BDZA 1RA6A 3H45C 2XTJP 5C42A 3F73A 5ETQA 4AHSA 1EAYC 2QL7B 4DR7F 4YB7A 2OKQA 4MO5A 5L1JA 4DV7J 4OI1A 1LOTB 2FSJA 4Y0WA 4KHWA 4YB6A 1GLBG 2IA0A 2FPHX 2O1PA 3K0JA 1YUWA 2GCFA 4GKJF 1RNHA 2VC0A 1HR0K 3QEWA 3MM5A 1PYTA 4GNIA 3OXFA 3MR7A 3CF5L 1IKWA 4LFAK 1NKCA 2HG4A 1VQ5N 3MAHA 3T1AA 1TFYA 1CSJA 3IFEA 1IKVB 4DPTA 3H4BA 1MSWD 2VASA 3HHLA 1BL3A 3OBYA 1FK9A 3AVGA 2LQ8A 4DHYA 2Q3PA 3N4WA 5HOOA 4B3OA 5MAOA 4B3SF 2Q1LA 5IC6B 2XMMA 3N6NA 4DPYA 3RJMB 2XYHB 3KNAA 2RF2B 3BBBA 3JQJA 5CH7B 1R0BG 5E26A 1RILA 1SVDA 5KT5A 5IM0B 2YNFB 4I9LA 1TKTB 3CXCR 2ZD1A 1TUWA 4W98A 5JICA 2BKPA 3W60A 5CZ1A 1I51B 2RN2A 3DLHA 2CH6A 3U27A 5H9EJ 3FZFA 2ASDA 1SL0A 2I2YA 4ISGA 1WSIA 2LP4A 5GAEU 4F3TA 2H3GX 2CVIA 3J81j 3DGVA 3QICA 4QU7A 2CNLB 2ZJRQ 3FGVA 1YKWA 3MR6A 4RBUA 4X64J 2DXFA 4PQUB 3KLVA 2PA8D 2LLZA 4OLAA 1ULRA 4KBOA 1F3VA 3HHEA 3JSYA 4FLWA 4K8XA 1S0VA 4LF4K 2ZJQQ 4CJWA 1TGOA 4CHPA 5A0YB 3UW1A 4FWKA 1G6BA 3CJTA 2O3DA 1HNXF 1LW2B 1HHSA 2FVSA 2K2PA 1T95A 3ZO7A 5HRSA 3BPSP 4C0BA 4NEYA 1PJ7A 3W2WA 4OKJA 4F9OA 3PSFA 4A47A 2YKNA 1RBAA 4GVBB 2HS0A 1Q7YT 3LQVA 2JEGA 4FWMA 2A3JA 1S9EB 4QOZB 3MM9B 5CYJA 4W5TA 2J5AA 3EDQB 3PHTA 4JI7J 1ZTTA 2AGPA 2F4VF 1M1GA 3OYGA 4X4TA 3BF1A 1KS2A 2DFHA 3GJRB 3JQMA 2OANA 1K47A 1RAFB 2JEJA 3IAYA 4LFBF 5A8KB 4Z0UA 3CQXA 5HANA 4NZ6A 3LM2A 1IUJA 1WC6A 2B8QA 2C1EB 1LFWA 4H4OB 3HLUA 1BXNA 2IPOB 3TJ8A 1Q7LB 2LU2A 2FZCB 1HWIA 4J2BA 3AO3A 3OD2A 4AHRA 1B9DA 2PFUA 1KQFB 1FRJA 2QLJB 1QQOA 3CIZA 2V52B 1DTTB 1U2VB 3EX7B 3KLIA 4QU6A 5C24A 2LDIA 2ZDOA 1LQ9A 4LC9B 5C2FA 1M0SA 3OXLA 3P39A 2XYGB 4B1XB 2IBKA 3PY8A 1P8ZA 4QYRA 3TA1A 1HLWA 2EG1A 2Z57B 2GMJA 3SDEB 1TK0A 3VTIA 2X3DA 4I2QA 1UPPA 3OYMA 3OHBA 5F8IA 3ZFVA 2YNGB 2R7RA 5K8OA 1LWFA 1HBNA 3VCDA 5BN8A 4ZA1A 2J6TA 1S48A 2VICA 3WC0A 4FL9A 2R7SA 5KOWA 4KPYA 1CJKA 4PPZA 1HUXA 3CMEN 1YJUA 5IQQA 2DRBA 4CJ3A 3V1QA 2ZBCA 5JMVA 3VQ5A 3ZSQA 4FP9A 5A6WA 2A1SA 4EK2A 3M2UA 1U25A 4IG0B 2BE9B 2GVDA 1JWWA 1H2UX 1Z4UA 3CWJA 3OJUA 2LQBA 1AUDA 2FHMA 3M8YA 3C0BA 3IGNA 2IDOA 1U8WA 4PUOB 3Q8UA 3AGRA 1GMVA 2LXFA 1QAJA 2KXFA 3UN2A 4ZPDA 4ITSA 1P90A 3DLKA 3V6DA 1RHUB 1TK5A 3FBFA 5F8LA 1K44A 3K5OA 3HI0A 4WQ4C 4WQ5A 1T3OA 4RUAA 1W0HA 2X78A 4Q5VA 5EU7A 1X9SA 1MWQA 1X1PA 3OYLA 3L2QA 4DSLA 5KFOA 4O3QA 4WFNL 3PX6A 3LP0B 4JHDA 3R6GB 4EIAA 1JLEA 1FT8A 2ZOGA 3D0HE 4ES1A 4M5MA 5K9FA 1NDKA 1TUYA 2WFBA 4ZN1A 2BABA 1MLAA 3AXKA 4OKEA 4ZPAA 3TPQA 4H4KC 5CABA 2B0GA 1M5KC 5EGYA 4A8SA 5E3QA 1D0EA 3G10A 2F9WA 1KVCA 2KYXA 4DZ6A 4UY85 2J7KA 4Y3CA 4M3XA 4HL9A 2KRBA 2I6WA 1S57A 2HW3A 3QJJA 2XSJA 2MYFA 2XNRA 3B6PA 3SBTA 3DMJA 2BM0A 2VU5A 1OJ4A 1S5ZA 2BTFA 4MIAA 2GTDA 3FJ2A 3VZHA 3MOZA 2ZH6A 4H0YB 4Z2XA 3ILLA 2IM0A 2MGZB 3M8ZA 1WF1A 4YOYA 4PG6A 5HN0A 2RQKA 2DRDA 2DISA 1YZ7A 3VGTA 2HGLA 1C0UB 5LL6d 3BBCA 3QRRA 2W4DA 3WXJA 5KG5A 2RU9A 4KE5A 1QHTA 2YH1A 2FSNA 4HVZA 4JBCA 4U7CA 3J7YI 2B7CB 3QGPA 3OJSA 3CDWA 4USJC 3M6VA 1HNWF 2GS8A 4CECA 5ADZA 2ZZTA 1TMMA 1BG3A 3WQUA 3AO4A 3T1HJ 2RKIA 5H1SQ 3AVFA 3HD1A 2R9LA 2ZE2B 3MM8A 1LW0B 3PIOL 3WZ0A 1IV0A 3BF4A 4OJRA 1AYEA 3BH6B 1S72S 2IAJB 3NAEA 3OYIA 5L38A 2IM2A 3CDBA 4FLTA 4CEAA 1YSJA 2UV8G 1GXUA 3IO1A 3MUVP 2L9DA 2E6LA 2Q6BA 2O5DA 2ASOA 3AA2A 3VQ8A 4NXNJ 4C3MA 2KL8A 1AUSL 2RB7A 1XI1A 2HNYA 3OYJA 2Y0BB 2VGMA 1RT4B 2A3ZA 2RPIA 1UVKA 3BSNA 1KVAA 3QWUA 4EFHA 3VF6A 5CXTA 4LF9K 3SQGB 4EBEA 2ZC4A 1D3WA 1RFQA 3JXOA 4OYMA 4JD2B 1G2EA 2D69A 3A4TA 2ASPA 2GMHA 4EYIB 1HBMA 3GIJA 4CK3A 3QRPA 2MQNA 4I2PA 5EN1A 1PJ5A 1VISA 1TKXB 3WQPA 4LF7K 2XI2A 2C2OB 2RHSB 1YBUA 1BI4B 4HEA9 2M70A 4FYVB 1D1UA 3GONA 2F4VJ 1WDTA 4F2SA 5AQTA 1S1TB 4LD0A 1N8RO 4QIGA 4YDUC 3SXLA 2Y0SD 1L3TA 1XNQK 3G8QA 3AVLA 4ED0A 4FK2A 3VQTA 1CZ9A 1R8CA 2P9UB 1WC4A 3I55S 1S0OA 1RTIB 1VC5A 4USKA 1XC9A 2GO8A 4IR9A 4A5BA 1H73A 2KT5A 4O4GB 2GIFA 5KT4A 4A8MP 3CJ3A 1Y64A 1URRA 2BE2A 3TAGA 4PY5A 2I1RA 4CLPA 2L41A 4ILRA 3K5MA 3MXIA 4EI2A 4LREA 4HHTA 1HNZJ 2R7WA 1NXIA 1SAZA 2P5VA 3E66A 2QK9A 4NLWA 5KT2A 1T05A 1JB0C 3TANA 3PR4A 1VS3A 1B64A 5L9NA 4NLBA 2AU0A 3GV5B 4LF8J 3KKRA 3A3OB 3HDSA 4BE2A 5ETNA 3O1BA 2CPJA 5FROA 2Q43A 3QT5A 3ZX3A 5BYSA 4D3GA 2DCUB 3R3LA 2J0WA 4CJQA 2MJUA 1VFJA 1RWNB 1QSSA 1V3ZA 3QLHB 2ZEJA 1S3XA 2WOMA 3D6MB 4KGMA 4OZLA 3PG9A 5EX0A 1J5OB 4DV4K 1XMQF 3THWB 4KHUA 4JI1K 2EVZA 2DR8A 2VDIA 2W2OP 1VQ4S 4N8OA 3FKBA 4ECVA 4XDDA 3PIPL 4B3RF 4JK7A 1S6QB 2OLWA 1NOZA 1CQNA 2QI2A 4XH4A 2ADCA 4XH1A 4DV2K 3CC4N 2JFDA 2AT1B 3A8EA 3AY0A 3KJFB 2Z2YB 4OMFG 5CCLA 4ZLPA 1R8BA 1Y00A 2HMIB 2BUNA 1S6OA 5F3ZA 4EAHD 3DOKB 2DHSA 2YX4A 5HMWA 2HMPA 4BDPA 2DKOB 2OFGX 2XULA 2B8PA 2DNPA 4MT1A 2OPSB 3NGZA 1UETA 1EQYA 2DXEA 1VQOS 3JS9A 3FEZA 1IH7A 3OHRA 3TI0A 5AQGA 2HIQA 4GV6A 1REVB 3ENBA 1RTZA 2BACA 2BW2A 4CHOA 2LFVA 4HT5A 4ED4A 4BE0A 1C6VA 1SJ1A 2GIQA 1C0FA 4CLFA 5LSOA 4RU2A 1HIYA 2RU3A 3K7RA 1VK8A 3UI3A 3DGPA 3TX0A 4DMNA 4DR6J 4ISEA 2FSKA 3MEDB 2C28A 4YY3K 1YVFA 4PWUA 3KJNB 4PPDA 3ID6A 5FPMA 3NS7B 1K6YA 3OR1B 5DGBA 3UE5A 4M95A 4LBPA 1NSQA 3TU5A 5GADI 4JI5J 4B1UB 4ZP7A 1VCTA 1UMJA 3M05A 4DWIA 4OYWA 3V6HA 4WK1A 4KTZA 2PMWA 4KH0B 3OSNA 1NK6A 1I6JA 2AJFE 4F4KA 4RUHA 4CJUA 3J7ZO 1W2BM 3C3LA 1YK9A 2IVNA 2UU9K 2IVYA 1PILA 2AMCB 4QWDA 2CA9A 3D28A 2A2DA 3UO0A 3ZETA 3FMBA 1S1UB 4JI6J 1FKOA 1BQNA 3OYDA 3RBEA 3DXBA 1OMSA 1CC7A 1HNWJ 1Q16B 4Y2IA 3EICA 2IJFA 3H6EA 5EHHA 3UR0A 3K17A 1P9QC 3CCVN 4IJNA 3VQ4A 4KI6A 4KKOB 3CC7S 3D2FA 5KAKA 3E9LA 3EZ5A 4AL6A 2CGJA 1WOPA 1QE1A 2R8GA 4WCEL 3DDKA 3BZKA 4ZCLA 4HCCA 4JYAF 3CD6S 3WNEA 4LSNB 4RL1A 4WP9A 4IWVA 3MN7A 3PHEA 2LU1A 4U9RA 3N6LA 4X66K 2RQ4A 4LSLA 3IP0A 4HTLA 2UVRA 2FC8A 4M8LA 1WF2A 4I69A 2MHEA 3ZLJA 3IRWP 2IC3B 3DI6B 1HBOB 4OLBA 2ZNYA 1J2VA 2ATQA 2GW8A 1HD1A 1KVIA 2IMWP 3NNCA 3VQAA 4ID5B 3MFHA 2QFJA 3GZ7A 2IMOA 2FJVA 4W92B 3FBCA 1YIJS 4RNMA 3NVKA 4BG9A 4OPJA 3QIOA 4GO5X 3BP8A 2YHBA 2VJUA 5C15A 3BKTA 4FS1A 3NWRA 4ZP6A 2PD1A 3WXLA 7FD1A 3AVMA 3NS5A 4F25A 5HMYA 1WG4A 4P2MA 1NPKA 1S6UA 1UTAA 2OHDA 1E6YB 3ZZRA 1KHWA 2B6AA 3TARA 2GX9A 1ZAVA 2PY5A 3GMGA 3CEDA 1VK0A 2QMWA 3CCMS 4FOEA 5AQYA 3QIPA 2IY5B 2FC0A 5B0AA 2E1ZA 4KTQA 1O5JA 4RNNA 1EJ7L 3NOGA 5JJBA 4YUDA 5FLXO 2F40A 4YB5A 2Y3YA 4HTJA 1WOOA 2XY6A 3OFHA 2HBQB 1RHJB 2XLJA 1NH7A 4JRPA 1S1XB 1HI0P 3BDPA 3ZTPA 4PYAA 3CJKA 1VC0A 4M63C 3VGMA 4KC5A 3V4IB 3NNAA 2R2TA 2HSTA 4K25A 3ZT3A 2CJQA 3I32A 1N34F 3GJTB 3X1LB 2XLIA 4DV5J 1KQSR 4Y2KA 1I5OB 1Q5YA 1FF2A 3MEEB 4RW9A 4M42A 4NLGA 2RT3A 4DV7K 2XC9A 5D4OA 4Q0BB 3T5HA 2NXCA 4OGCA 4M45A 4BRKA 3H59A 4AT1B 4LY7A 4KO0A 4P73A 1HPMA 1RWWB 4PKGA 4CGDA 1KONA 1WG5A 3PYGA 3W5ZA 5CZXA 2FXUA 4KI4A 2LMIA 3MM7A 4DR1J 2AJ1A 4ZHRA 4HUEA 3BO2A 2QWOA 1IBLJ 1WF0A 4ELUA 1NLKL 3DOMB 3ULEB 4CZKA 1UKUA 2QLFB 5GMDA 1P9YA 3EGZA 2MTLA 2NRZA 1KFDA 1W97L 5CYMA 3D7EO 1XQSC 4F4AA 3VQDA 4EYHB 5AQIA 4FJNA 4U67L 3M1VA 3R8EA 3HZ6A 1NDLA 3JSMA 2CJAA 4V19X 2JGUA 4WU2A 1CS4B 2WAQD 4RKUC 1NEEA 1H6KX 3CJSA 1SKSA 4CIOA 3I82A 1VOMA 1H98A 4GW6A 3DHWC 5GMKa 2NXUA 3CM6A 4KFBB 4PQAA 2FVQA 4UZBA 3MOJB 1XQIA 1FRLA 2BW7A 2EEYA 1NNEA 5H9EK 4CJ5A 1Z1ZA 3MZIA 1GLJO 4BDYA 5HMZA 2EKYA 4S0MA 4DTMA 2C2KB 1X7VA 1KLMB 1H2TZ 1YJVA 5A8WB 3O08A 2HNDB 1RK8A 3P38A 4M5KA 3P5TL 3C6UB 1NMNA 2C42A 4OHZA 1KAZA 2CDQA 3PRDA 4X64K 3GFHA 3KFWX 3DLGB 4HKQA 1C2PA 2KJWA 3MX5A 4Z7CA 4MQ3A 1S4FA 3HVTB 2DEJA 1J5EF 5EDWA 2B43A 3HT3A 1BU6O 3WXMB 1OPIA 4NLXA 1RU1A 5L39A 4CGIA 1HWLA 2DO4A 3M8PA 4C8MA 1UEUA 3ENQA 2UXBF 3BN4A 3DWLA 4W90B 4J9SA 3M9NB 3DYAB 3Q7BA 4PABA 4GC7A 1XNRF 4ED6A 3EWGA 4C0HA 3HZGA 1KTQA 2F8TA 1VQ5S 1GLCG 1VQ6S 2XG8A 3AJDA 2YI1A 3I0RA 2FBYA 3I6PA 4KQZA 3HI9A 1TAQA 4MTPA 5H1SV 4B3TF 3H08A 3DU5A 4I56A 1IBMJ 3CQYA 1RCHA 2BBEA 3NGRA 4LH5A 3MMBA 1X8DA 2RE1A 2OTJN 2V2QA 3IGVA 2EHGA 4ZCMA 3JQKA 2GWKA 4W4MA 3TSUA 1Q9XA 3T1YF 2H65B 5KT3A 2BA9A 3C6TA 4CEZA 4CJRA 4ZPCA 1Z26A 4CM0A 4CNYA 3HO1A 3GIMA 2E1RA 1PBUA 4LUBA 1JXBA 4V1Ak 3MR3A 3ZZUA 2PI5A 7AT1B 2H5EA 4L3NA 2DNQA 2M9KA 3A8IA 2A0FB 3D6RA 4URSA 4X62F 2ZH4A 3KKSA 3K5NA 2G8IA 1Q86O 4A8YA 1EKSA 3V6JA 3AQOA 2HZCA 4DV1J 2OCEA 2O8DB 3ITHA 4EP4A 1AFJA 4DV6F 1C1CB 1B0PA 1S79A 2HRTA 2P9LB 4GVEA 2UZAA 1WAJA 1R8HA 3MN5A 2A5XA 1F5BA 1BISA 1GLAG 2WONB 4TYAA 2V94A 3UD4P 3GYXB 1SUQB 3PO4A 4QR2A 3IBCB 5JVHQ 4LFCF 4K4SA 4IDHA 3M6WA 1PGZA 4Z4GA 2ZWOA 5IT9O 2CJKA 3JAMO 3PFEA 4I6YA 3OUYB 3MPUB 3OR2B 3V9ZA 2Y9HA 3SMSA 2YHYA 2HAFA 4DTXA 4CGGA 1Q18A 1SQFA 5KFDA 4TY9A 4P52A 4CZFA 1VR6A 2F8EX 2C3PA 3A5OC 3L8BA 1SPBP 4WK3A 2XI3A 4NX9A 3QPIA 2OPRA 5M2RA 3IC1A 1BUPA 1O1WA 1UJ6A 2X6NA 3CCRN 4FJXA 2YCHA 4BGBA 2AP1A 2OFHX 2YWGA 2KTQA 3TW0A 1Z2LA 4CW7B 1LAWA 2BEFA 1NDPA 4TNOA 4EEYA 2K7JA 2E7WA 3O1LA 2QL9B 2WSFC 3MWPA 1C0MA 5HBMA 1S59A 1C4CA 2XYPB 4RR5A 5T7LA 5GAGP 3THYA 4CIEA 5F8NA 1IN0A 3K58A 1C0GA 3TUPA 3TAEA 3RMAA 1RT6A 1VBKA 1MG7A 3B4MA 1ZETA 2LEBA 2MKIA 2AEJA 1X4HA 3TJAA 3AO5A 2HBRB 2P6TA 4ISFA 4DMZA 1TL3B 5DQGA 4XIUA 3D66A 1Q53A 3CCEN 3L09A 4CHQA 1CZBA 2FLOA 3U4LA 1M90O 1I1GA 2CQGA 1D9DA 3EVMA 5I42A 4DN0A 2FBTA 2W1BA 4RJVA 6FD1A 1EO1A 5M2PA 4DBQA 1SL2A 4Q44A 4FF3A 3BB5A 2CG8A 3AO1A 1T11A 4CBXA 4DTNA 2H54B 2GQQA 4I6MB 2VFTA 1NSAA 1UAWA 3QAEA 1TK8A 5KFIA 4DUYF 3OS1A 4NZ0A 2C2RA 4IOCQ 3NF7A 1Q81O 2Q79A 4HI1A 2NSCA 1KP6A 3HF5A 3EM1A 3FGUA 5B0EA 4CESA 5J2MB 3OQ2A 3CSKA 1WTBA 4CZHA 1EETA 5AQHA 3BYRA 5GAEP 1WSRA 3W1YC 3UIQA 3CMES 4MKYA 1MWMA 4FW1A 1NAQA 3MPDA 3R2CJ 1RT2A 2V68A 3I8BA 1N5VA 2XY5A 3T1HK 2Z56B 2CPEA 4K8ZA 2X1AA 2EK1A 3MM6B 2J9DE 2HQIA 3R5DA 1YQHA 1K8AO 4P10A 1WACA 2AX0A 5J2QB 1U8SA 3C94A 3S8SA 1IR2A 3CJ4A 1NJIO 1W26A 9ATCB 2ZH1A 4CZLA 4IH5A 2AYBA 2FVCA 2D3O1 1EP4B 1WUUA 4C98A 3N4PA 4DCHA 4NXNK 3Q8PB 1HR0F 1XC3A 4H54A 5KTQA 1KFSA 2E2NA 4I9QA 3ILJA 3HFVA 3VAMA 4BHQA 1JNRB 4H0VB 3I9ZA 4YOWA 3SSSA 5D0EA 1H7XA 2OSRA 5J2PA 4MDAA 1S0MA 1Q8LA 1O6XA 2MSTA 4J9QA 2F63A 1T9WA 2G0CA 2G8KA 1XNRJ 3PM9A 4ANDA 1UWAA 1RBUA 4HCBA 5JXSA 2Z2MA 5ETPA 4IDKA 4Y65A 4QOTA 4K43A 4CI0B 3J7YU 3B82A 2F4VK 5A8RB 3U3GA 2QL5B 3CXCM 1P27B 3CJQA 1A7GE 3Q83A 4WWSA 4I7FB 4DSEA 3VR1A 2DYAA 4JS4A 4DCOB 4CFDA 3LWMA 1PC4A 3OLAA 4LF6F 1DLOA 3HSDA 1PC5A 2BRKA 2J9EA 5CHCB 4IOAQ 3HKZD 2E5JA 3IN5A 1OS5A 4I64A 4RW4B 3OS2A 1FVSA 3NAIA 4HHUA 4ZJLA 4G1IA 2R42A 3LAKA 3K2YA 2MLXA 5FRMA 3CGIA 4M7XA 4Z7YA 1HNZK 3OL7A 4X65J 5AFUH 3OYFA 2GELA 4LF4F 3HHNB 2GJFA 1MN9A 2R8IA 3MECA 3N0VA 4JI4J 1SJ3P 2I9SA 4C4WA 3C6HA 4LF8K 5E3PA 4ZLJA 5CR4A 2R7UA 4NYOA 4AILC 2ZHBA 2QSFA 5KFZA 1R6VA 2GAGC 3ZZOA 2JZ5A 5J1EA 2AJ0A 1FWLA 2E8AA 2WVEA 3OL8A 4OX6A 4RO0A 1RSCA 3PYFA 4ZCKA 3I0SA 1RHRB 1YZ6A 5BR8J 2BJ1A 4LJMA 4B9QA 1VQLS 5ELZA 1JLGA 2J76E 1WWHA 1V6HA 4OX9K 1RWXB 3HJFA 3L3UA 2CQDA 4NRTA 4L3QA 3MR5A 1U6FA 3TEHB 4RWXA 4B3MJ 2DTJA 4RW6A 1HKGA 2KKHA 2HKEA 3A2FA 2RRBA 1BD6A 2JWLA 1NK8A 2L48A 2JRSA 3R9PA 4CTAB 3H5SA 4CJ4A 4DR2J 1CJVB 5EUHA 2W24A 3TYTA 2OMOA 2V63A 3NH2A 1SJQA 3ZEUB 3UCZP 4PCQA 5KQ8A 2DR7A 3QEPA 4AHVA 2QE5A 3M6GA 2AYMA 4ECZA 2RVJA 5DQIA 4BR2A 3PRVA 3QMQA 2W40A 4H4MA 1K73O 3DCAA 1DHMA 3DM2B 3KLHA 4BRLA 1GXTA 1SH2A 1AA1B 3N79A 3O3FA 3QEXA 4HHJA 5C42B 3FRYA 5ETTA 4DHVA 3HT0A 4K5SA 3C15A 4FXDA 1YAGA 3NF8A 4IFYA 3I96A 4E8UA 2GUIA 3M8SA 4ERDA 1RZMA 4ID8A 2EW9A 3C7NA 3GYGA 3QNNA 5HAOA 3R6LB 2PN6A 3P5BP 1UEKA 2VG7A 3H5YA 1TKZA 4DR6K 4ID1A 4NRUA 3MM5B 3RZAA 5HATA 3WDOA 3V6KA 1B4SA 1IKWB 3QNOA 1ZAXA 3B6OA 3CYMA 3U7JA 4DUTA 4QPXA 3W9HA 4JI5K 2C2EA 3C16A 3F2KA 1QSLA 3PRBA 3HCXA 4X84A 3CDEA 4DQQA 2K7KA 4WFXA 3J81Y 3BGRA 3HHLB 2HAIA 1FK9B 3KDOA 2FF3B 4B3OB 2MQOA 1IQZA 1VQMN 2CDRB 4FKYA 3SCKE 1Q79A 4MAKA 4JI6K 4E3SA 2HQ3A 4WFAL 4NLPA 3D4JA 1VQNN 3W3DA 3TUIC 3TSPA 4USTA 1HNWK 4DQSA 1Z25A 5HQLA 2MZJA 2RJZA 5ETVA 4O5BA 2G0JA 2ACYA 3CC4S 2DK2A 2KKZA 2ZD1B 5MLCQ 4FJ7A 3DLRA 4OO1J 2F8SA 1OQ3A 3IUCA 2NSBA 3AAQA 3P3DA 4AM6A 1ZBTA 4DFPA 4BC9A 2MXYA 5BRFA 2XMUA 4DX8H 3BQ0A 3AVAA 1CJUA 2GJIA 4DUZJ 2LA6A 4DCJB 2QZ8A 3U6FA 2K3KA 5AR0A 2O67A 1SC4B 4IO9Q 3P96A 1A9NB 3THVA 3QJPA 3CB4A 3T41A 3C46A 1TKDA 1U24A 1E4GT 2WHOA 2V8PA 3BSCA 1X0FA 4YQWA 3KLGA 3WUHA 4U8YA 2R8HA 4OV6A 3WIUA 3ETOA 3EMTA 3MEKA 1X3MA 3W2WB 4K5RA 3K59A 1FWPA 3CCUN 3CE8A 3A1YG 5AJ3J 4FZXC 1OWXA 2AWZA 5L8RC 2D0AA 2YKNB 2J6UA 4FJMA 2Q0UA 5AQLA 3VQCA 1IM6A 2MJNA 4LVOP 2PYJA 5AT1B 4OIXA 2YTCA 4WPAA 3C66A 3C65A 2H51B 3MD1A 3O5BA 5THWA 5KI6A 1FXXA 2FJAB 2P9SA 2CNKB 1QDUB 3T5LA 3P83D 2P9KA 2EXUA 2Q66A 2C3OA 3IRXA 3MEGA 4LF6J 4F4ZA 5LMUJ 1FW6A 1WC3A 5C10A 4OX8A 1WKKA 1VHIA 3D9BA 3VV2B 4L3KA 1AXQA 5ETKA 1H2VZ 2XHWA 4RTFD 3KNGA 4C9DA 3BEGB 1ILYA 4RW7A 1YHQN 2DRAA 3AGKA 2FLPA 2M3DA 3K2PA 3EXYA 2JVOA 3CCVS 5KRTA 1RHQB 2VHGA 3DXKA 1D09B 5DO2A 4NB4A 4BRFA 4ECUA 2FTRA 4FJJA 1RT7A 4CJEA 5B0CA 3IMQJ 4KHYA 3I4HX 3VN5A 1YITN 2ZNZA 4BVOA 3KLIB 4WBFA 4DV5K 3IWXA 5C24B 4LF9F 4KY3A 2DGWA 1WB9A 3RGIA 4J2DA 1LV5A 3DNCA 5K20B 1JIHA 4LR7A 3H8YA 1WSEA 4PKHA 3NMRA 4ILJA 4OFZA 1JL2A 4HUFA 1KKHA 1YGYA 2VPWB 2OAUA 4EHTA 4FZYA 4I2QB 4KH5A 4LF7F 1DT9A 3IMXA 4DR1K 1V5VA 2G9OA 1GT8A 4J5OA 3CTRA 4F4YA 2D41A 3HL8A 1IBLK 1LWFB 3C8YA 1HBNB 4ER8A 3PACA 1R0CB 2CQ2A 3WNFA 1T9XA 5TKWA 2FDNA 3G8SA 1CJKB 2ZJRL 4OGEA 1XNQF 3QSIA 3OA9A 2OTLN 3DHXA 2F4FA 3LP1A 2WBMA 2O8CA 3ZXWA 2NRTA 1SV5A 3QESA 2GV1A 4H5RA 4CJTA 3FZHA 1CG2A 1N88A 3M2UB 5DM7Q 3FCWA 2GVDB 4E7JA 2B9XA 1ITPA 3OS0A 3QGIA 4A2AA 5FLXU 3I8DA 3NP5A 4U7BA 2QWMA 4DTJA 2DHAA 3L3VA 3DLKB 3V6DB 4ILGB 3DDNA 3O1WA 1Q82T 5KOXA 3OVSA 4FWLA 4PA1A 1ZM9A 1KQGB 3LDQA 1HPZA 3M4XA 4FZZA 2HHWA 5B0BA 4NZ7A 1K0TA 1YVNA 3SZ2A 1XR7A 3UCGA 2NLWA 1QUPA 4F02A 2MZQA 3V81A 1M90T 1ATRA 2GHWA 3J8AA 5K14A 3O4NA 5LJWA 5LL6Z 3SLCA 5LJVA 1NB2A 1JLEB 4V19S 4DTUA 4NLVA 4OI4A 5FIIA 3ZTOA 3AXMA 4IQMA 1R31A 2Z4PA 4BBYA 2UVUA 4JI1F 1YJRA 4Q8FA 2VODA 3K8VA 2XSJB 1LWCA 3V1OA 4AHCA 3DMJB 4O55A 4ETXA 5F8JA 2ZVSA 4K41A 1N5SA 3Q89A 2L08A 4FO0A 4J9LA 1U2FA 4YN3B 2IIHA 3KHGA 4RBTA 4DV2F 4HUGA 4QCLA 1N56A 1JLQA 3L7OA 1URNA 3SCIE 3A8KA 4ED8A 4CH7A 4HR2A 2CPXA 4CBWA 2Z1IA 3JTOA 2RMLA 4H8KA 2LQJA 3LANA 1TL5A 1IBMK 4FPRA 7FDRA 4YHHJ 1M5HA 2XY7A 4WXOA 1KC8O 1RAJA 2RKIB 5HJYA 4DTOA 1XK8A 1Q4RA 3MM8B 1FJCA 3CJ9A 3NE6A 2E29A 2F1FA 3OLBA 4CZGA 2J6SA 4JKEA 4PWDA 1MMDA 4UUXA 2UUCJ 2FQQB 3SMPA 4H5NA 1I3AA 3K89A 1NLVA 1PG5B 3JTPA 3AO2A 5M1PA 2DNGA 3CMAN 3C19A 8RUCA 1R8AA 2HNYB 1BCOA 2JC1A 5FJ4A 4YY3F 2JEFA 1UZDA 2QLXA 4CLWA 2O8FA 4PKIA 4WFBQ 3M6XA 1V3SA 2DITA 2AGOA 3D3BJ 2NPFA 4DV1K 3KYLA 1VSKA 2FB0A 3AARA 3MFIA 3HM8A 4FF2A 1BMQB 5LJ3Y 3R1XA 4DG1A 3L2UA 2RIJA 1IQTA 3MHYA 4KRFA 4QR0A 4O23A 3G96A 1HBMB 5CZVA 2DBBA 5IV4A 2UU9F 2YKOA 4I2PB 3FVYA 3CD7A 2DHHA 3AVIA 3VQ9A 2VC1A 5AE2A 2DNYA 4ES2A 5RUBA 3ENWA 3M2RA 3RMBA 1NGHA 1YRUA 3V9UA 4H03B 3D67A 3VAKA 2NYHA 4L76A 2EC0A 4KGKA 4KAIA 1OH8A 4KHPJ 4H0TB 2KB2A 3HHDA 1ZTWA 4NASA 2ETJA 2ZWHA 1RAGB 2D3ZA 3CD0A 4OHWA 1P6TA 4YORA 3FSYA 5D4LA 2AYGA 2W2QP 3G2XA