3QIPA

Structure of hiv-1 reverse transcriptase in complex with an rnase h inhibitor and nevirapine
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
556
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Binding Analysis of Pyrimidinol Carboxylic Acid and N-Hydroxy Quinazolinedione HIV-1 RNase H Inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse HIV-1 reverse transcriptase p66
total genus 164
structure length 554
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3qipA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3qipA05
5HROA 4EYHB 3MXIA 4R8UA 4MFBA 3AVJA 4OKJA 5DMRA 2G8KA 3RMCA 4CF2A 3NGYA 4CJ3A 4FZXC 4IKAA 2HHQA 1HYSA 4C8OA 3NMAA 4LY7A 2G8VA 3V6DB 2RKIB 1D9FA 2ZD1A 1DTQA 3Q8QB 4MKBA 4O44B 2HWIA 3OSPA 3F73A 4LQ9A 4BE1A 4F8RA 3OYMA 1KLMA 5KFZA 4M3XA 3SV4A 1WSJA 4XPCA 4JRQA 3HPGA 3NAHA 1TKZA 3GIIA 5D3GB 3QEWA 1D9DA 5EWGA 1RT1B 4NLYA 4KTZA 4E1MA 3CFOA 4ID5A 3SPYA 4RW7A 4K4UA 1NHVA 3ALYA 5DGAA 3SQ4A 4BDPA 4KFBA 5J1EB 4W5OA 3P5JA 2ZQBA 3PVXA 3VQ9A 4CFAA 3TAPA 2HHUA 1LW2A 1CXQA 3L3VA 2QKKA 1KHWA 3RMBA 3IS9B 1JIHA 3LPUA 5KTQA 4FLTA 1GX6A 2A1SA 2G8IA 1TP7A 3SQ1A 3PJXA 2AX1A 4KO0B 4CJTA 4E7JA 3OS1A 4F3TA 4K4XA 3HHKA 5DGBA 3G0ZA 1TQLA 4R5PA 4N5SA 3O4NA 4HUFA 1YVFA 1S1VA 3PO4A 1BQMB 1BIUA 4ID5B 4HUEA 4EBDA 2E6MA 1ASVA 1FKPA 2OPRA 4AHUA 4CGDA 4J9MA 2R2SA 4HCCA 4KKOB 5D3GA 2E9ZA 2XI3A 3SZ2A 2JGUA 4FM0A 2VG6B 1BCOA 4KAIA 4CGJA 5KG2A 3IN5A 4E1NA 2YNIA 4DTXA 3NHGA 4NRTA 4PA1A 1RT7B 4FJLA 3G6YA 1JKHA 3KOAA 3CJ5A 3DI6B 2W7PA 3V1RA 2W9BB 1W25A 1SUQA 2HNDB 3ZT0A 4DU1A 4CJRA 4CCHA 3BR9A 1S0OA 1ZBLA 4MK7A 2Y1IA 1ITGA 1EETB 3IAYA 3LP0B 1JLCB 1A5VA 3KLEA 5KT6A 5KFKA 3AV9A 3AVKA 1FK9B 3RAQA 2ILYA 3M8QA 3HP6A 1RDBA 1TKXB 4Y1DA 1S48A 3OYIA 2DFEA 4CK2A 4PWDB 4BWMA 5I42B 4KPYA 2HVHA 5HP1B 4CHNA 4B9SA 4TY8B 4JV1A 5KG0A 1RDAA 3NE6A 2X74A 4YR2A 4OKKA 1LAWA 1JLBA 5L1LA 2GIQA 4M3ZA 3OYGA 2FLPA 1RTHA 2BE2B 3DRSA 2PYJA 1JLEB 2GC8A 5KFNA 4KE5A 4FJ5A 4I9LA 4XIUA 4BACA 2XY7A 3DRPB 4DQQA 4TQRA 3LP0A 2RKIA 1NK9A 4B9NA 2R7YA 1HYZA 1ZTTA 2FJXA 2O5DA 4NLSA 1QHTA 3KD5E 1HQUA 1HYVA 2J6TA 3ZT4A 1CSJA 3NBPB 1TL3B 3GYNA 3M8PA 2F8SA 4CJLA 4QWCA 4OGEA 1J9AA 3IRXB 2ASDA 4BDZA 1N56A 4QPXA 3KHRA 4CE9A 3MR6A 3SUQA 4CJFA 1S6QB 1W0HA 3VA3A 4QWAA 4RW6A 4Z4EA 3M9NB 1EP4B 1MU2A 3DLGA 1QAIA 4EBEA 2FLLA 1ASUA 2JLEA 4JLHA 1K6YA 4IDKB 3T5HA 3VN5A 1LAVA 1VSEA 3JSMA 4OJRA 2UUWA 3OL6A 4YQWA 1RILA 4EP4A 5KGXA 4I9QA 4PUOB 4H4MB 1HJRA 4K4YA 3CWJA 4LD0A 5FROA 5J2NB 4ECTA 3RBDA 3QEIA 3PW0A 4H4OA 1XR7A 2D3UA 1HARA 4AH9A 1D8YA 1HNIB 2LSNA 3N6MA 4E19A 3MTKA 2R2RA 3QGIA 1U49A 4HCBA 3IRXA 3U3GA 1XR5A 1QE1B 4CHZA 2UVVA 2AQ4A 4K50A 3RWUA 3ZSYA 4F4XA 4HUGA 1JL2A 1Z26A 3HVAA 4BWJA 1SKRA 4RW6B 4KV8B 3CDEA 5HROB 2FC0A 4K4VA 4J9OA 3DLKB 5C24B 1WSEA 2QXFA 3OLAA 1J5OA 4YP3A 4CHQA 2X6SA 1L5UA 3AO4A 3AO2A 4ECXA 2IS3A 3E01B 4WZQA 4WYLA 3RMAA 3KLEB 3OJUA 1LWCB 2KFZA 1SH3A 4KB7A 4DFPA 5DQIA 2AU0A 3MXJA 4KTQA 3DMJB 5KFLA 1R0AB 4CJ5A 1U4BA 1S49A 2JEIA 3RB4A 5F8MA 3ULDA 1ZETA 3K57A 2JC0A 3KJVA 1RA6A 4NLRA 1VSFA 1IKYA 3OS0A 3D45A 4CESA 1KHVA 4B9MA 4CJQA 4TQSA 1S1UA 3HVTA 3KLVA 1UAXA 5C25B 3TARA 4M42A 1X1PA 3ISND 1BIZA 3S3NA 4J9SA 1UOCA 4O3PA 3CM5A 4NLPA 1LW2B 4JV2A 2IM2A 3NGZA 5L1KA 1WAFA 1BL3A 2E9RX 3FDSA 3NH2A 3KHHA 3ZSRA 1HNVB 5F8HA 4HYKA 1TKTA 2W9AA 4CJSA 4FZYA 3FQKA 1RAJA 4M3TA 4FK0A 1HQEB 2UVRA 2R2TA 3TAGA 4UQGA 5HLFB 3H4DA 3OYBA 1A5WA 3DLBA 5J2QB 1T05A 4CK3A 3K5NA 3QETA 3H4BA 3BQ1A 5EWFA 4J2DA 4JS4A 5SZTA 3OYEA 1BISA 3CDUA 5KG4A 4J9RA 3V81A 1RT4B 4CEFA 1S1WB 4NCGB 3D0PA 4M95A 2YKMB 4LSLB 1VRTB 4K8XA 3LP1B 2XI2A 3N6NA 1CXUA 4AHSA 1S9GA 5KFWA 3DYAB 2OPRB 3GIJA 4IKFA 1JLQA 1VSDA 3NAIA 3NL0A 1JLFB 3EPIA 4ED8A 1QUVA 4Q8EA 2YNIB 4DSKA 1HRHA 5KRSA 3KK3B 3QEVA 4J9KA 1S10A 3AVFA 1N48A 3DI6A 2IOCA 1HPZA 2EC0A 2ILZA 3VQQA 3GILA 4IRCA 1EX4A 1TVRA 3QLHB 4LSLA 3RB6A 4MIAA 4H4MA 2ATQA 2EHGA 4DWIA 1TKTB 4QAGA 4ZP6A 4ZP9A 1EP4A 1MU2B 1VRUB 4ECZA 3U6FA 3KK1B 4C8LA 1D0EA 4PQUA 3UDLA 4DU4A 3FQLA 1RCHA 4R0EA 4FLWA 1NKCA 1SUQB 2XCAA 3TI0A 4ED3A 1NK8A 4DL5A 2WONA 3MAQA 3NGDA 3HXMA 2IJNA 5JXSA 2FVRA 3AVAA 5DLFA 4X2BA 1VSMA 4QWBA 3AVBA 4ZVGA 5J1EA 4FM1A 5FDLB 4OLBA 4IRKA 3TAMB 3ITHA 3SJJA 5CYQB 3PR4A 1RT6B 3V9ZA 2E4LA 4DSJA 1IKXB 3SUPA 1Z4UA 2XWYA 1BQMA 3LP2A 3CJ4A 4O4RA 3U3YA 2IAJA 3CIZA 1RT5B 3PV8A 4CHOA 4KHMA 2XY6A 5HRPA 3FRZA 3OS2A 2OZMA 4B9TA 2W8LA 2RF2B 4IG0A 4HKQA 1RNHA 1QS4A 2DPJA 1TV6A 2OPQB 3V9WA 3ICLA 2IDOA 3Q8RB 2YNFA 1Z25A 4NYFA 2OYQA 3M9OB 4NLVA 4QW8A 4DTUA 3BSAA 3EPGA 4Z4FA 3OYCA 2W9CA 4DLEA 3BREA 4KHUA 5KFEA 4OKEA 1NJWA 4MIBA 4EYIB 3V1QA 4TYBA 3DOLA 5KFUA 4ZVEA 2BQ3A 4KI6A 3ZSXA 4LH4A 4NLUA 3TAEA 5DQHA 4JUZA 2WTFA 3OSNA 4M3YA 4FJGA 4O3NA 3OL7A 2I1RA 3PX6A 4AHRA 4EZ6A 1T94A 4IH7A 3HPHA 3OYHA 2B5JB 3RB0A 4FJKA 5FRMA 3G6XA 4ZTFA 1VRTA 3HVWA 5KFYA 1JL1A 3QIPB 1RT5A 5J2QA 1GX5A 1JLCA 3VQSA 4CERA 3I0SB 3ZCMA 4WFYA 1RBVA 3AA2A 3PR5B 2XO7A 3K5OA 3PY8A 3M8QB 4WXWA 4FJ9A 4DG1A 4IOBA 1K1SA 3B6OA 5KG7A 3SPZA 1S1WA 4O4GB 3OYNA 2XHBA 2X6NA 3LZJA 1KRPA 4RNMA 3H40A 1NJYA 4BDYA 1FKOB 2I5JB 3DRRB 3MECB 2YNHB 3V1OA 5CYMB 2Z1GA 3AA4A 2BRLA 3HSTB 3VQ4A 1B9FA 1C0TB 3AO1A 2HB5A 1XR6A 5DG9A 3KLGB 5C24A 4URQU 1LW0B 4ECYA 3I8DA 1Q9XA 4DQSA 4FS2A 3MFIA 3DM2A 3WNHA 4G1QA 3G6VA 4F4YA 1B9DA 3ZT1A 1EXQA 1IG9A 4I7FB 1TL1A 1REVB 1KCFA 3HVTB 1JLAA 3I0RA 4RNNA 3DLGB 1RBRA 3ASMA 4CJVA 4C8KA 4E7LA 1FXXA 4CEEA 1U47A 3H98A 2QE5A 3KTQA 4NLWA 4CGGA 4F2RA 5L1IA 4M94A 1VK0A 4ED2A 3RAXA 1S9EB 4E7IA 3MECA 3A2FA 5KT7A 3QGHA 1HQUB 5JS1A 4I2QB 3OYLA 3CJ2A 1C1AA 4CF0A 5KG1A 2HNYA 4NYZA 1KTQA 3VQ5A 4CEBA 3WNEA 4O3SA 4CJUA 2Z1JA 3QYYA 3KLHB 1S0MA 4KSEB 4B8AB 2JEJA 5F9LA 4G1QB 4WZMA 1HMVA 4DTNA 3OYFA 4DFMA 4B8CA 3OHAA 2IJFA 5FRNA 4GC6A 3UPFA 1ZBIA 1UWBB 4FJNA 1JX4A 1RBUA 4H4OB 1S9FA 1VSLA 3QZ7A 1IKWB 1CZ9A 4IH5A 5HP1A 1WLJA 3IG1B 4CF1A 3DOLB 4IG3B 4JRPA 4YFUA 3AVHA 3KD1E 3Q8SB 3AVMA 1NKBA 5KFSA 4DLGA 1HNIA 3VQCA 2EX3A 3KLIA 4B3OA 1JLBB 2DTUA 4DFJA 3P83D 4CF9A 3C6UB 3DYAA 4KO0A 2BQRA 4DF8A 5F8GA 1RTHB 4Y2CA 4GMJB 1QE1A 1NK0A 1SV5A 4DSEA 4OPJA 1VSIA 4FW2A 1C0UB 5L9XA 4U6PA 2YNFB 3VQ8A 5HRSA 4W5TA 1NJZA 3BJYA 2OPSB 4PQUB 1NK5A 4NCBA 2HHWA 5C25A 3FSIA 3HL8A 3KKSA 1SH0A 2YV0X 4RG8A 1RBTA 4GC7A 5KG3A 2CKWA 3SUNA 4KB0A 4KKOA 1G15A 3QGGA 1BCMA 3BDPA 5DG7A 4MKAA 2CJQA 4CJWA 5DG8A 4KBIA 3VQ7A 3M9MB 1GOAA 1I3AA 3F9KA 2HMIB 4Q8FA 2IM0A 4EP5A 2XCPA 4RW9B 2JEGA 4OGCA 2YHAA 5KRTA 3QZ8A 3HM9A 4TN2A 1UA1A 3OJSA 4FVMA 4ICLA 2VG6A 1L3UA 4B9VA 3AVLA 4IBNA 3ZSWA 4YNQA 4FK4A 1DLOB 3C94A 3C6TA 3H2LA 1C0UA 4LH5A 1RDRA 3V9SA 4B9LA 2IAJB 4F2SA 2FJVA 5J2MA 1C1CA 5HRRA 3LDSA 4CGFA 4DQPA 2VG7B 3EYZA 4FJ8A 4ZP7A 5KFDA 2R8GA 2UVWA 3SV3A 1KFSA 3KHGA 2HAIA 1T05B 4W5RA 4CHYA 1TAQA 2W8KA 3AO5A 3H5SA 1LWFB 4CK1A 1LW0A 4ELUA 1TV6B 2D41A 4URSA 4NCAA 1RT7A 2WHOA 3LP2B 4DMNA 3PW2A 2HMIA 1MMLA 2AX0A 4YMEA 2KFNA 5HLFA 3GV7B 1RA7A 3MEDB 1C0TA 3KIOA 4MH8A 1S1XA 3PW5A 5I3UA 2V4RA 1QAJA 3BSNA 4KFBB 2GBZA 1C1BB 4EO6A 3V81B 3NFAA 4ZPAA 3T3FA 3SYZA 2F8EX 1DLOA 2IC3A 1KVCA 1BGXT 3HKWA 4NLXA 1RBSA 3AVNA 3IS9A 3V4IA 4EEYA 3SQ0A 3NDKA 1JLAB 1S0NA 3V9XA 3V6KA 4DS4A 4CHPA 3SFGA 3K58A 2P51A 1ZBFA 2WCXA 4C8MA 1JLGB 1TK8A 1S6PA 5EWEA 3M8PB 4K4SA 3NF9A 1VSHA 4DS5A 1QSSA 3DLHA 4RNFA 5KFRA 2BR0A 3MEGA 1TKDA 3S3MA 2KQ2A 2RN2A 3VQ6A 3I5AA 4KHYA 1S97A 2P1JA 4FJIA 3NBPA 2HW3A 2YKNB 3BSOA 3V9UA 1J54A 2VA3A 1REVA 2NUBA 4DG1B 5EDWA 2ASLA 1TVRB 4TYAA 4FLZA 3BQ2A 3IG1A 3JYTB 4DF4A 4M45A 2X78A 3SNNA 3K5MA 2B5JA 2KTQA 3CFRA 2VA2A 2V9WA 2FJWA 5T14A 3HYFA 1DTQB 1S5JA 5L1JA 5J2PA 5F8LA 3QIPA 3UR0A 3KLIB 2P5OA 1Q8IA 4NLTA 4JV0A 3GIMA 1NJXA 2G8HA 4NLQA 4Q0BB 4N56A 1TK0A 4R8UB 3VQBA 1X9MA 2WONB 4N41A 3QINA 4IG0B 1RT1A 2BDPA 1XWLA 4CIFA 4H8KA 1RT2B 2F8TA 5KT4A 2GV9A 1KVAA 3KK2B 4BE2A 1U48A 3H5UA 1TGOA 4RW7B 3HT3A 5KG6A 3LANA 1S9GB 3C95A 2QKBA 4KHWA 1N4LA 3LAMA 3DLKA 3AA5X 4FJHA 4DEZA 5KFOA 2ALZA 4TSXA 2BQUA 4DTPA 2J6SA 4TY8A 1NNDA 3LP3A 4ED0A 3NF8A 4Z4IA 4ZPBA 3SQ2A 1WSIA 2AGQA 1NK4A 2D0BA 2C2EA 1T3NA 1TKZB 2DY4A 4RW4B 3V6HA 3VQAA 2RF2A 2D5RA 1DTTA 4CJ4A 4E0DA 3KLHA 3OL8A 4ECQA 2Z1HA 2WK4A 3CJ0A 3MFHA 3RBEA 1QQCA 3OVNA 4ECWA 2YNGA 2XGPA 4LSNA 3CYMA 1JXEA 4HVJA 2RDJA 2VWJA 4FBTA 1R0AA 2KW4A 2Z1IA 4EO8A 4Y2AA 1S1TB 3LPTA 3M8SA 4I2PB 1CLQA 3G86A 3RRGA 2BANA 3EY1A 3DRPA 1Q9YA 3E01A 2D3ZA 5KFQA 1S1VB 4O0JA 5CZ2A 4FZZA 2HHSA 1VSKA 3ZSVA 4CFCA 2J6UA 2ETJA 3HPOA 3KHLA 2JC1A 5I3UB 1KSPA 3IGNA 3E51A 4E89A 2O4GA 5HRNA 1C6VA 2DPIA 5KFPA 3DLEA 4HTUA 1NOYA 3LZIA 2ATLA 2DFHA 1K1QA 3LWMA 2FVCA 3MR5A 4KI4A 1S6QA 3AVCA 1S1UB 4BE0A 2YNGB 4KB1A 4DTOA 5KFGA 3CDWA 4F4KA 4WFXA 4FW1A 4J9NA 4M3RA 4IFYA 2V0NA 1VSJA 4Z4HA 3I0RB 4CIEA 1RYRA 1WNSA 3N6LA 1DTTB 3JSMB 3O3HA 4L8RB 3KLFB 1FKOA 2I5JA 3DRRA 4DL2A 2B6AB 4ELTA 4CIGA 1YT3A 3H08A 2E9TA 3MEGB 3ZSQA 4ID1A 3ZSZA 4RW9A 1NK7A 3CJ3A 4KHSA 3IGVA 3RMDA 3P1GA 3QO9B 4EZ9A 1U09A 3OHBA 5F8JA 5SWMA 3DDKA 3EZ5A 3QESA 4DSFA 1WSHA 1N6QA 3SFUA 2FLNA 3QLHA 3LP1A 3H5YA 1HMVB 4EBCA 1IKVB 2IBKA 1S9EA 1RDCA 1N5YB 2PY5A 5KFMA 4FLVA 1L3TA 1HPZB 3EZUA 1RTJA 3H5XA 3L8BA 1L3SA 4ZHRB 1JLEA 4RZRA 5I42A 5KFVA 4NLDA 1IKWA 2PZSA 2DFFA 4ICLB 4DTSA 3RR8A 5KFIA 4Q0BA 1RDDA 4FLUA 4NYNA 4KHRA 4Q43A 3MEEB 2BRKA 4AHTA 5C42B 4FM2A 3KK1A 1QTMA 3K59A 4DL3A 4CGHA 5KFJA 3MXMA 3KK3A 2HVIA 4CJKA 2XY5A 1QSYA 2AGPA 4W5QA 1TL3A 4CEQA 3ZT2A 1IO2A 4K4WA 1SL0A 3OL9A 3VQDA 4AHVA 3T1AA 3FFIB 1OS5A 2FBYA 3AVGA 3RR7A 3PZPA 3WNFA 4TY9A 3O3FA 1SKWA 2HHXA 5CYQA 3PO5A 1ZYQA 3MR3A 1RYSA 2OA8A 5T7BA 2G8WA 4KTWA 2P5GA 5DLGA 2QK9A 2VG5A 4WXOA 4IFVB 3QIOA 1XC9A 4OPKA 3MEDA 4O44A 4ECRA 1QSLA 5KFCA 3SCXA 5FDLA 3CG7A 3L3UA 1BI4B 3C6UA 1S6PB 4I2PA 2WRMA 1CZBA 3TAMA 4Q44A 5KGWA 4IDKA 4ZPDA 1RT4A 3HP9A 2FBVA 1KVBA 4CJEA 4I7FA 4LSNB 3QNOA 4MK8A 2YKNA 1NOZA 2C28A 3RRHA 1X9SA 2W9BA 4ZHRA 4DFKA 4OVLA 2IM1A 1RT6A 4RU9A 5KFFA 4FCYA 3AA3A 3L2VA 4PUOA 4O3RA 4NCGA 4MK9A 2E6LA 4CEDA 5C42A 3KMSA 3O4QA 3I5BA 5DQGA 3BSCA 2IMWP 1IH7A 1XHZA 5J2PB 1YTUA 4DSIA 2OH2A 3MR2A 4N47A 4DSLA 5KFTA 4N76A 3UIQA 1JLFA 2QV6A 4R5PB 1BQNA 5K14B 2PYLA 2A1RA 2ZKUA 3C6TB 1J5OB 4WYWA 3T5LA 4KHNA 1TK5A 1W9HA 3TR8A 4FJJA 1SKSA 2VG5B 4WFZA 4Y34A 2GIRA 5J2MB 4IR1A 4RNHA 1U04A 4Y1CA 4CEOA 1S1XB 2FVPA 2VG7A 3D28A 3TVKA 3CVKA 4J2EA 3T19A 4F4ZA 1C1BA 3L2RA 1XI1A 3OYDA 3T5KA 1IKYB 4Z4GA 4ZP8A 2IC3B 2HWHA 2B43A 4MQ3A 3GQCA 2B6AA 4E7KA 1VRUA 5KT2A 1I6JA 1SL2A 1L3VA 4TXSA 1JXBA 1RT2A 4ZTJA 1T03A 4FXDA 4QWEA 5CY4A 1JKHB 4FLXA 4H54A 1YVUA 4RW4A 1RTIA 4ED1A 2WOMA 4G3IA 4CJPA 1C0MA 1WSGA 4JS5A 4ZMMA 4LQ3A 2D0AA 3TAFA 2ZE2B 3MEEA 3NCIA 1BQNB 5K14A 1N6QB 2O4IA 1GOCA 3V4IB 4ED7A 3DLRA 1KLMB 5EUHA 3QO9A 3T5JA 2G8UA 1I39A 1TL1B 2KZZA 1RTJB 3BQ0A 2XY8A 2OZSA 4J9PA 1ZBUA 1SH2A 3FFIA 4DQRA 1LWEB 1TAUA 4CF8A 1ZBHA 3PX4A 3DM2B 4C8NA 4ZVFA 1S4FA 1BHLA 4IH6A 1N5YA 1T7PA 2HHVA 4FJMA 2F96A 2C2RA 5JUMA 4IFVA 3GV8B 1T03B 4B9UA 4J9LA 4YR3A 3O3GA 3NF7A 5JS2A 3SUOA 4PWDA 4ED6A 2R2UA 4DL7A 4FK2A 2FBXA 3DRSB 4Q45A 5HBMA 4AILC 3QEXA 4FJXA 2HNZA 1SL1A 4ZVHA 1YTAA 3VQPA 1C1CB 5KFHA 3GIKA 4KV8A 2FVSA 1U45A 3KK2A 3L2WA 1ZTWA 3UQSA 5KG5A 4M41A 4RW8A 4WE1B 4B08A 3GV5B 1RT3B 3BGRA 3NKYA 1IM4A 3VQEA 3M8RA 3KLFA 1LWFA 5KT5A 1Y97A 1D1UA 2R8HA 1LWCA 4URGA 1GOBA 2Y1JA 4IQXA 4ELVA 1RTDB 4O3OA 3HJFA 1UWBA 2FVQA 2V4QA 2BE2A 2XC9A 4ZPCA 4IG3A 3CM6A 4RNOA 2C22A 4GW6A 1X9WA 1WSFA 1WNEA 1IKXA 4K4ZA 2HNZB 1J53A 3OLBA 2YHBA 3ISNC 3I0SA 2OPSA 3NH0A 2ZD1B 2WB4A 4K4TA 2IGIA 5J2NA 4O5BA 4YR0A 2AGOA 4CEZA 3ITHB 4Q5VA 4Z4CA 4O4GA 5KFXA 2OPPA 3SI6A 4RUAA 4TLRA 3L2UA 1HYSB 1NKEA 1EETA 3AVIA 4U7CA 1EKEA 4ECSA 4DTJA 4Y3CA 1IKVA 3NGIA 4DL6A 4O55A 4KREA 2R8IA 1TKXA 5F8NA 1O1WA 4E7HA 1XHXA 4RW8B 4WE1A 4CFDA 2HNDA 2FBTA 1S1TA 2WOMB 3CO9A 3NAEA 4ECVA 2XGQA 1WN7A 3DLEB 4KAZA 3MF5A 3RB3A 5KFBA 2ZE2A 3CQ8A 4ECUA 4FYDA 3PJWA 3QERA 2BGGA 3K2PA 3VA0A 5C5JA 3V6JA 4NRUA 5KFAA 4M3UA 4IR9A 3D5MA 4I2QA 5E41A 2R8JA 3K5LA 3OYAA 2W9CB 1RTDA 4IFYB 2D7SA 1LWEA 4NLOA 1WAJA 3DMJA 2BANB 4M3WA 1D5AA 3THVA 4NLGA 2G8FA 2XRIA 5F8IA 2KZMA 4NZ0A 2HHTA 3PUFA 4CFBA 3PW7A 2W7OA 4F3OA 4KHQA 4K8ZA 3KJVB 2Q3SA 3RTVA 4DL4A 2C2DA 4OL8A 2UVUA 4DQIA 1A5XA 2JEFA 1KLNA 4FJ7A 3L2QA 1F21A 5CZ1A 5DK5A 4QOZB 3OYKA 3G10A 1BI4A 4J2BA 2AWZA 3TABA 4CGIA 3PHEA 4QWDA 4J2AA 2UUTA 3LALA 4XO0A 4HHTA 3HVRA 2R8KA 4PY5A 3NH1A 3CFPA 3QEPA 3TWHA 2AJQA 3I5CA 5CYMA 3WNGA 4QW9A 2D0CA 4DTRA 1T8EA 1B92A 3OY9A 4MFBB 2RPIA 5EU7A 1RT3A 2GUIA 4DU3A 3BGRB 3DOKB 3KLGA 2IA6A 4OLAA 4AHCA 1SV5B 1HNVA 3Q8PB 3V6DA 3PX0A 3AO3A 2YNHA 3S9HA 3PW4A 4J9QA 2VWKA 3HO1A 4B3OB 4F4WA 4KRFA 1UA0A 4FLYA 4O0IA 1FKPB 3NF6A 3TAQA 1FK9A 3QIDA 4RUCA 3LAKA 3ZSOA 1NK6A 5HBMB 2ASJA 2RDIA 1ASWA 2ITGA 3SI8A 4CECA 3H59A 4CEAA 4IRDA 3TANA 5F9NA 1JXLA 1HQEA 1KFDA 3QNNA 4W5NA 4E3SA 3HK2A 3LWLA 3KMQA 3B6PA 2B4JA 4O3QA 1JLQB 1LV5A 1JLGA 4FS1A 5KT3A 3S3OA 5KI6A 1RTIB 3JYTA 2OPPB 4XPEA 3ZT3A 3DOKA 4DTMA 2IM3A 3OYJA 4QCLA 2YKMA 2OPQA 1NHUA 4Z0UA 4F50A 3KKRA 3KNAA 1C2PA 4GVMA 2HNYB 4FBUA 3TQ1A 2W42A
chains in the Genus database with same CATH superfamily
1FD8A 2VB6A 3MXIA 1DBDA 1ZAXA 5F41A 1B99A 4CF2A 3MX2A 4FYYB 3TOQA 4GV6A 4CI6A 4LY7A 4ZOSA 2RE1A 2ZD1A 2O3DA 4CLYA 3K2YA 4O44B 3IUCA 4Z2XA 3F73A 2M88A 3FZHA 4PG8A 2O67A 4PG7A 2M52A 3NAHA 3GIIA 3KG1A 1RBLA 1M5OC 2AJFE 2UXBJ 1D9DA 5EWGA 3OBYA 2KL8A 4NLYA 2X3DA 2PA3A 1DT9A 3VERA 4BDPA 2MZ1A 2B9XA 5J1EB 3J7ZO 3J81j 3PVXA 1UZDA 1VIOA 2AEFA 5T7LB 2HHUA 4RTFD 1CXQA 1SJRA 3TZYA 3IS9B 2E88A 3LPUA 5KTQA 2E2QA 1FD2A 1GX6A 1AZSA 3UW1A 1FCAA 1QZ5A 4F36A 3HHLC 2D9OA 3SQ1A 3O9UA 2AX1A 4KO0B 5GAGI 2BJEA 1YIJN 4OYPA 4U67L 3CCTA 2CADA 3U1NA 3OS1A 3TVYA 2J7UA 1YVFA 1S1VA 1RWUA 2QMWA 1SJQA 4DV2J 1GLDG 3E8OA 4KRWA 1R6VA 2DEIA 3QAEA 4EK2A 1MROA 5M1NA 2KXFA 4HUEA 4EBDA 2MZRA 1FRKA 2OPRA 2M7SA 3MURP 4HCCA 2XI3A 4CBUA 2JFKA 4FM0A 1TL7A 4ISEA 1BCOA 2EK6A 4KAIA 4JI1K 4LF6K 2GJ2A 2V2VA 1YWXA 3D7EO 1XERA 2E5HA 2YKOA 1ESVA 4FJLA 4CO0A 4CNZA 3G6YA 4NA2A 6FD1A 3CJ5A 1WEZA 3DI6B 2W7PA 4PKIA 1MW7A 2ZUAA 3V1RA 1OMSA 2L08A 2Y1IA 2V8VA 3MUTP 3IP0A 2EEYA 5U47A 5AQYA 1ZAVA 2PN6A 3VF6A 3IAYA 1H72C 1A5VA 3UD5A 3ZTSA 3ZZ0A 2IYGA 3OUYB 1HNWJ 3AVKA 1FK9B 1RDBA 2UXCF 4AYBD 4WFAQ 4CK2A 1V4SA 5H9FK 4BWMA 4KPYA 1WHWA 2JZ5A 1KKHA 2DH7A 4LVNP 2CQ1A 4QJVA 5ITHA 4F02A 3CCSS 2X74A 2BJ3A 4OKKA 3NNHA 2HYIB 4YOTA 2GGPB 1JJCB 2WC9A 4I4BA 3R8YA 5AQQA 5L1LA 3G71S 3OYGA 3DRSA 2FGCA 5DM6Q 3CCVN 1MNEA 2BW2A 4FJ5A 4P74A 1OH7A 2CPHA 3K9JA 3SMSA 1AFIA 2J9CA 5AQMA 1FJGJ 4TQRA 2RKIA 4U7UD 5EOYA 2R4FA 4U95A 1ZTTA 1QY7A 1HKAA 2VDIA 1CSJA 3NBPB 2MEWA 4HHHA 1TL3B 1RAGB 3GYNA 1RDUA 4AM6A 4CJLA 2MPUA 5C10A 3KHRA 1Q86O 1S6UA 2GJIA 4Z4EA 1UKUA 1EP4B 1BY9A 5A8WA 1MSWD 2BE7D 5C12A 4PUOB 2ZWOA 3G8TA 4K4YA 4LD0A 3RBDA 2XLIA 3THWB 2LSNA 2RU9A 5HVGA 3MTKA 4J91A 3GSDA 3IRXA 4CHZA 3QRQA 1Z6RA 5ETNA 4QZVB 3M8WA 4HUGA 5AQVA 4BHQA 3R5JB 1SKRA 2VQEF 3CDEA 2UZAA 5EXWA 1RAAB 3EL2A 7AT1B 3DLKB 4DR7J 1GNKA 4LSZB 5AE3A 2EG1A 1WSEA 1J5OA 1L5UA 5ETMA 3AO4A 3AO2A 2DHGA 4BG9A 1VBKA 4A48A 4WYLA 4RWTA 3KLEB 3RMAA 1WG5A 2QTWA 4XH1A 2CRLA 5DQIA 2HSTA 3NEKA 3TVZA 3R5BA 5G0RB 2VFUA 2D9PA 2EPIA 4MYUA 4YN3B 3JTOA 4UQTA 2FZCB 1EKRA 3EVMA 4CVNE 2O8EA 4NLRA 2OEJA 5JLHA 4CESA 2GTDA 4AUKA 4B9MA 4CJQA 3CJKB 1S1UA 3VALA 2GGPA 3HVTA 1UAXA 4M42A 4C23A 3K0JA 3ISND 1IR0A 3NGUA 4KH6A 2XZTB 3NGZA 5L1KA 1REGX 1PYSB 5G4DA 5FPEA 3R8EA 1S3XA 4FZYA 3FQKA 1RAJA 5CZVA 1HX1A 3D66A 4QOTA 2UVRA 2JLGA 3J7AP 5HLFB 1PC4A 4QU7A 3G8QA 2CZ9A 2D0OA 1T05A 1UCNA 3H4BA 4JS4A 5SZTA 3JQMA 2GAGC 2YWGA 5K8MA 2YQ1A 3UR3C 1KNZA 2PMHA 4JYAF 3CCUN 2QLXA 2XQCA 1KQSM 1U8WA 3I4PA 2L9DA 3L3CA 3D0PA 1E3MA 3CPWM 3FRYA 3QGPA 3KKFA 4K8XA 1PBUA 1RP5A 2XI2A 4DR4J 3N6NA 2ZBPA 4H0OA 3EO3A 4BRHA 2J9EA 3MHYA 4JKHA 4NMXA 4CZMA 2OPRB 4YDXA 1FWPA 1BDGA 2X51A 3MDQA 1JLFB 3D0GE 3QRPA 1QUVA 4FKXA 3UDEA 4DCHA 2LXFA 2CPXA 4X65F 4UOFA 3KK3B 3O5BA 3QEVA 3WEEB 1FERA 2MQMA 1D3WA 1JQGA 3AVFA 2IOCA 2ZWHA 3R1LA 2QW9A 2CG4A 3M1FA 3VEOA 1WWHA 5D15A 3QLHB 4PPZA 1KVIA 4RBTA 4LSLA 2ATQA 2NXNA 2EFNA 4PKHA 3U6FA 4C8LA 1VQ5S 1D0EA 4PWUA 1RCOB 2OJ3A 1RCHA 1NDLA 2HGNA 3W62A 2DBBA 3MOJB 3A3OB 3ETMA 1FHTA 4YOVA 5IT9Y 3TI0A 4ED3A 2ZH1A 5BPLA 2ZH3A 5E26A 3HXMA 4LT6A 2IJNA 4WP8A 5JXSA 3MN6A 3AVAA 5DLFA 1VRQC 4I6AA 1VSMA 2DNPA 2DT9A 3AVBA 4MLHA 2ASOA 1WBBA 1WTBA 5J1EA 5FDLB 4HI1A 3TAMB 3ITHA 4IRKA 5CYQB 1HWIA 4BC9A 3PR4A 2QA4G 3BYRA 4M5NA 3B6BA 1YSJA 3SUPA 2XWYA 3JSYA 1ZAWA 4O4RA 3OV7A 3U3YA 5KQDA 4F25A 5AQUA 3G82B 3CIZA 1RT5B 1BA0A 4QU6A 2FF3B 3A5OC 1JCGA 4NZ6A 3VGKA 1PG5B 3WXJA 3TR5A 1BMQB 4IG0A 5AJ3F 2LEBA 2DPJA 5SUHA 2UUCJ 4V1Ak 4RWWA 3UI3A 1H74A 1NB7A 1YG0A 3OBWA 5I4MA 5KAKA 3W3SA 4CDIA 2YNFA 4ILJA 2VOPA 4DTUA 2K7KA 3OA9A 3HHNB 2GVDB 1Q8BA 3Q8YA 2QLJB 3EPGA 2DHAA 4Z4FA 4I6MB 5CA5A 2F7TA 1NGFA 2W9CA 2GZOA 5KFEA 3J7YI 1NJWA 4MIBA 4EYIB 3UKRB 3DOLA 4LF7K 1HNXK 4ZVEA 2BQ3A 1EB0A 2F9WA 3TAEA 4LH4A 2KHDA 1PSDA 2LP4A 4JUZA 2WTFA 5A8KB 1RWNB 3TJAA 2PFDA 4M3YA 4FJGA 1NRKA 2FSNA 2I1RA 3PX6A 4LF9K 2YHYA 1RBOB 3MAAB 4DX8H 4NI2A 3OYHA 3CO0P 4FJKA 2V34A 5FRMA 2KYXA 4ZTFA 3GYXB 5KFYA 5JVHQ 3QIPB 1U2FA 2DTJA 3VQSA 2V52B 4CERA 1HLUA 1SC1B 1VISA 5EN1A 1V5IB 3MM7B 4WFYA 4X4PA 3CJAA 3EZWA 3K5OA 4ILRA 2EBEA 3M8QB 4WXWA 4FJ9A 2VUGA 2OLWA 1K1SA 3B6OA 2HS4A 1S1WA 3Q89A 1KQKA 4O4GB 3LZJA 2J0QD 2RU3A 2KT2A 1EKSA 5A2QU 1NJYA 3K7RA 5J1NA 1FKOB 4H5WA 4ZPTR 3H2UB 3MECB 3H8YA 5CYMB 3WQPA 2IIRA 4F3MA 3BF3A 3M2RA 3UVJB 1MN7A 2R7VA 5C24A 4K59A 3JTPA 2ASYA 2M8DB 4FS2A 4KH4A 3DM2A 1RE1B 3UKUA 4G1QA 2XLKA 4MDAA 2E44A 5FLXY 2IDEA 2ZVSA 2E5JA 3ZT1A 4I7FB 2NZTA 1KCFA 2V8PA 2QWLA 5IV3A 4IOAL 3ZZUA 2KO1A 3MR7A 3CIPA 1FXXA 1WHVA 4E8UA 4CEEA 3H98A 2P9KA 3KTQA 2B9YA 4DR1F 3ONQA 4LF4F 4E7IA 3MECA 4BC5A 3QGHA 2QLBB 4RWXA 2NSBA 1C1AA 5D0GA 1BLUA 2H5IB 2BM0A 3Q8UA 1LNQA 1KTQA 4CEBA 2XO6A 3DRXA 2BEFA 3HSZA 2FHMA 3QYYA 1V4TA 1R0BG 1S0MA 3VAIA 1XBWA 1KP6A 2YWEA 4C0HA 5F9LA 1X0PA 1HMVA 3BGLA 4DTNA 2G0JA 1NGBA 3W2VA 4DFMA 5IM0B 2NSCA 2YPZA 3OHAA 3HHDA 2MLYA 4OMFG 2PDAA 4AF1A 2QJ3A 2QA4N 3QZ7A 3ULEB 3L4BC 1CZ9A 3CCRN 3L7PA 4NYOA 3U1LA 1WLJA 3IG1B 5LMUK 2C42A 3DFEA 5GIOA 4B3TK 3O4WA 3AA8A 4YFUA 3Q8SB 1MWQA 3G2XA 4DLGA 1HNIA 4A57A 3H42A 4DR5J 1GLJO 4B3OA 4P72A 4DFJA 3DYAA 1EWQA 3P6YC 1QE1A 2E1MC 1VSIA 4FW2A 4C7QA 2P9NB 1N32F 2YNFB 2ZITA 5BJRA 1H0HB 3BJYA 4ATNA 4ZIWA 4NXNJ 1BWEA 4DKWA 4PQUB 4NCBA 4LFBF 2C3MA 3L7OA 4AT1B 3AA9A 2YV0X 1N5TA 5KG3A 2E1YA 4KKOA 2P9SB 3D6TB 2FC9A 3LM9A 3CCQS 3TU5A 1BE4A 2CJQA 4CJWA 4DN0A 1FFSB 3R5CA 3DCAA 1GOAA 1I3AA 3I96A 3VAMA 2XCPA 3EJMA 3HM9A 4TN2A 2V2KA 4YDDB 3OR1A 3O6QA 2CQDA 2H9ZA 2VG6A 3J7A1 3Q8VA 4B9VA 2QI2A 2CQHA 3MM8A 3C94A 3C6TA 3S7RA 4LUBA 4WQ4C 4B9LA 4OZ1A 2FJVA 3DGVA 3LDSA 3VENA 4CGFA 2XYHB 2DISA 4FJ8A 4BC3A 1KFSA 4XH5A 4NLCA 1H2TZ 4W92B 5IWAJ 4ETZA 3C6HA 3GL1A 1LW0A 1CG2A 2P9NA 1TV6B 2Q97A 2HMIA 1MMLA 2AX0A 3PCOB 2KFNA 1RA7A 2GO9A 3TWZA 4HT5A 2LXUA 4LF9J 1JB0C 2Q66A 4KFBB 3TPQA 2MKCA 1QLNA 1YXQA 3NFAA 1IBKF 4CT8A 3T3FA 3QQCD 2IC3A 3GSIA 1KVCA 1VMBA 1BGXT 1RBSA 3V4IA 4CBXA 5IQQA 5HOOA 1B70B 3RG6A 3D6RA 5HAOA 1KONA 1ZM9A 1RACB 3IO1A 3HLUA 3V5RA 2QWRA 4JKAA 1T6DA 2B56A 4B3MF 4MMOA 1TKDA 1AZSB 5FPNA 2FZKB 2OEKA 1S97A 2P1JA 2NCKL 4FJIA 4GVBB 2YKNB 1XQSC 4O5FA 1REVA 4DG1B 1KD1O 1PC5A 1VQOS 2HHPA 3FUYA 1UEVA 2YH0A 2Q79A 2UV8A 3IR5B 3JYTB 1OQ6A 3SAHA 1YZ6A 2QA2A 2X78A 3EX7B 2DGWA 5CYJA 4H4KA 2DEJA 2V9WA 1FJCA 5AZJA 1DTQB 1S5JA 5LMNJ 5L1JA 5F8LA 1N32J 3A12A 1N34K 4CLZA 1F0XA 1NJXA 1N36F 2RUGA 4JV5J 1LXNA 4N41A 1XWLA 1HNWK 2DYAA 3R6MA 1RT2B 3L7UA 2QFJA 1KVAA 2P9EA 4KIAA 4RW7B 4BC4A 1NB2A 1AROP 1SIWB 1VBYA 1YRUA 4CLWA 2QKBA 2GHVC 3LAMA 5AT1B 3E3XA 2XULA 5KFOA 1XC3A 4TSXA 4DTPA 3N79A 2ITMA 4JI7K 1H2UX 2FHKA 3Q24A 4HT7A 2C2EA 1TKZB 1OPIA 1WC0A 3V6HA 3VQAA 5LMUJ 2RF2A 4CJ4A 4HEA9 2VJUA 3KLHA 2Z1HA 2W24A 2WK4A 3THXA 4QR1A 1VDHA 1R59O 3CJ0A 1QQCA 4LSNA 2ZH8A 3CYMA 2R3VA 1EQ0A 2VWJA 1R0AA 3SDEB 1QVGM 2Z1IA 2UXBK 1S1TB 4OJGA 3NNAA 5GAHU 3M8SA 5K20B 5B0BA 3RRGA 3E01A 5KFQA 2BJ7A 3EE3A 3FMWA 1VBXA 3MN5A 2HHSA 1RI7A 3QMQA 4LFCK 4CFCA 3FZ2A 2J6UA 2ETJA 3TEGA 2F4VJ 1RUSA 2CUYA 5E3QA 3FCHA 2MJUA 3H1VX 5I3UB 1MROB 3IGNA 5HRNA 2KG0A 3WXMB 2UUAJ 5GAGP 3EGNA 3CTRA 3GE1A 1RKIA 1TUWA 3LZIA 3CC7N 2F5GA 5AXNA 1K1QA 3W2WB 2N7CA 3LWMA 1GH8A 4FPBA 1PILA 4C4WA 1YJNN 4DTOA 2F9DA 1U2RA 4J9NA 4M3RA 1JJ2M 3J81U 2M0GB 1ZA1B 2Q6CA 2EI5A 3WC2A 2I2YA 3I55S 3I0RB 3O1LA 1GLAG 4ZCMA 2IRUA 3N6LA 3IRWP 1K9MT 1VK3A 1MN9A 1YT3A 5K8PA 4UOHA 5D8HB 2LYVA 4ID1A 3D0IE 2YXLA 4FNHA 3LPEA 3RMDA 3P1GA 3OR2B 2W01A 1IBKK 5F8JA 3DDKA 3QESA 1APSA 5KPTA 2GQQA 4BVOA 2FLNA 4JK7A 3QLHA 3NLCA 1HMVB 4EBCA 2IBKA 1S9EA 3UN5A 2C3YA 3LDLA 1L3TA 4KGKA 4EIAA 1WI6A 1RTJA 4O0NA 2U1AA 4J90A 3QT6A 4BY9C 4DTSA 2YX7A 1Y5LB 5IXUA 1FRIA 2BRKA 4AHTA 4USMA 4FWMA 2CQGA 3MXMA 3KK3A 2HVIA 1ZBTA 2XY5A 4DR5F 4NXNK 4W5QA 5H9FJ 3VQDA 3DU6A 2XYGB 2F4VF 1HHTP 4USJC 3U4LA 5ETLA 2FBYA 2XMAA 3PZPA 4BRLA 3N01A 1X8DA 4TNOA 3O3FA 2L9WA 3HZEA 4JKDA 4WPAA 3MR3A 2ZBCA 5HL7L 1ZM2A 4KTWA 1IN0A 4M5KA 4P73A 1DQAA 2P5VA 2Y8WA 4WXOA 4EAHD 2BKPA 4DV1F 4NXNF 1VHXA 4IFVB 4DV2K 3CDAA 2ZH4A 4A8QA 4OPKA 4LRCA 3NCPA 2MY8A 1QSLA 3SCXA 4OHVA 3CG7A 3GP9A 2GQ2A 1T11A 2YWWA 4ID8A 4H0VB 1S6PB 4I2PA 2WRMA 2YVSA 1CZBA 1N34F 1U0HA 4QIVA 5KGWA 2HFSA 4IDKA 4ZPDA 3CCJN 1HIYA 2XHCA 2Q43A 4HHJA 4CJEA 3U8XA 2KH9A 2PC6A 3PFOA 1E6YB 4LF6J 2ZJQL 1WHYA 3MCSA 2VKRA 3QT7A 2C28A 2OSQA 4C98A 4OVLA 2IM1A 1RT6A 1CJVA 1NSAA 1F60B 3PSFA 3MM8B 2DGUA 1U25A 3BBFA 1SJ1A 2RAQA 5DQGA 3TUPA 5JVGQ 1HKGA 4DSIA 2GQCA 2CJYB 3TP2A 3L9ZA 5FIIA 5ETPA 4N76A 1S7IA 2AA4A 2PEHA 1VQ9N 2QV6A 4R5PB 3HHEA 4KT0C 1BQNA 1R0CB 1RSCA 1J5OB 4WYWA 1W9HA 3TR8A 4FJJA 3AHPA 2UXDK 2XS5A 5A8KA 2VG5B 3MDFA 2YTCA 1IBMF 3MM9B 1U04A 1TUVA 1CJUA 3TVKA 4HACA 3OR2A 2XS7A 3CVKA 3T19A 3OYDA 1ATNA 2PI4A 3GCXP 4A8YA 4MQ3A 3GQCA 2ROPA 3FK4A 1BHNA 3QFPA 2JWNA 4FLXA 4LREA 3G8SA 3RBXA 1RTIA 4ED1A 2HOEA 3IXQA 3I6PA 4QYZJ 1VQPN 4LBHA 1MLAA 5K14A 2PA8D 4KYZA 2QC3A 3IDHA 1KLMB 3QO9A 4IOCL 3FZKA 3GOIA 2ZBIA 2KZZA 1RTJB 2XY8A 3CB4A 1B0PA 3ATUA 5LOQA 3I87A 2D1CA 2HHVA 5CCMA 2DHHA 4FDFA 4WKRA 2F96A 4IFVA 2YCHA 3GV8B 5BR8J 4YR3A 3PYGA 3BO3A 3NF7A 3O3GA 3ELHA 3JAMU 4FWLA 2FF6A 3ADAC 1HNXJ 2B51A 2ADBA 3I33A 1RU1A 4U67Q 3J81O 3Q83A 1FE4A 2YKPA 3OFEA 2I6WA 2RT3A 5HBMA 1M1GA 3O9TA 3QEXA 1S12A 2CNNB 4ZVHA 3VQPA 3QJJA 1GLLO 1U45A 3CF5L 3UQSA 4DV5K 2ZBQA 3KNGA 2DGVA 3NKYA 1S22A 2IIHA 5BRHA 3NVMA 2KVQE 3BY5A 4LFAF 5AR0A 1B64A 1LWFA 2YKAA 1HJOA 1Y97A 2QRRA 3ULEA 2WW8A 5LJ5Y 3C66A 1YK9A 4LBPA 2C2MB 3I9V9 2L9NA 3HJFA 7FDRA 2V4QA 2GMHA 5LJ3Y 4OHYA 2MLZA 1UEUA 4RNOA 2C22A 4Y00A 4GW6A 2UU9F 2KLAA 3PFEA 1Q82T 3P3DA 4P6QA 2VH7A 2GEMA 2V50A 5J2NA 4O5BA 2BM1A 3C15B 2MHNA 2AGOA 2CQ0A 2M8HA 4CEZA 1KVJA 4Q5VA 3QT8A 4Z4CA 3SI6A 1H73A 3M30B 3NGKA 3MMCB 2V51B 4X4VA 1BO5O 1R3NA 2JL9A 2EWSA 2IBOA 1RWPB 4DL6A 4KREA 3M2RB 2R8IA 4LRFA 2HFUA 3D68A 3PHTA 1J2VA 1LFWA 3Q22A 2FBTA 2XGQA 4IO9L 2W2OP 2HVEA 5LSOA 2Q6BA 5DM6L 4G1IA 4UTGA 4FYDA 5ADXA 3PJWA 2MQNA 4LVOP 3J80O 2BGGA 3OXGA 5LSLA 3VA0A 4NRUA 3D5MA 3DXBA 1WG4A 4I2QA 4BRPA 3KWMA 2I8EA 4CLTA 4PL7A 3FJ2A 2IVYA 4AE5A 4M3WA 1ZPVA 4DV2F 2G8FA 4DQ8A 2NYIA 1O0PA 1QAYA 2HHTA 1NG9A 3PW7A 2CQBA 4CI0B 1R8BA 2E29A 2VQFF 3RTVA 4DL4A 3C3LA 2X1AA 4DQIA 2JEFA 1RK8A 1F21A 2JSXA 5DDRC 5CZ1A 1H3DA 3MMBB 4QOZB 3G10A 3T1YJ 1BI4A 4QWDA 1VQLS 1NMDA 1P90A 1RTZA 3NH1A 2F3JA 3DGPA 3JQKA 3VF4A 3SAGA 1AA1B 3U1MA 3DHXA 2QXLA 2D0CA 2KXHA 1HKCA 1HBOB 4RUBA 2PAVA 3WZ0A 3LPYA 4ALZA 4CW7B 4NEZA 3KJFB 3V4MA 4OLAA 4AHCA 3VTIA 5B0GA 1BWFO 3EE8A 3PX0A 4JI0K 2YNHA 4M5DA 5M1FA 2DIVA 1HPMA 1VQMS 2HQIA 2DH9A 1U2VA 2DR8A 4J9QA 2G2YA 1HBNB 4JKGA 4BRMA 2OTLS 5A6WA 1UA0A 3CMAN 4JHDB 3DKDA 4FLYA 1K9MO 4O0IA 4QIWD 3TAQA 4ENOA 4FOEA 3ZSOA 2CZ4A 2RDIA 4CECA 1H1VA 5F9NA 3J7ZT 1JXLA 1HQEA 2V7YA 4GRSA 4JB8B 4JI5K 4W5NA 8AT1B 3KUHA 5AZJB 3NGRA 2UU9J 5B08A 3LWLA 3B6PA 4O3QA 5KT3A 1FNXH 3KUGA 2OTJS 2HS3A 3OTBA 4USHA 1HR0K 4UZBA 1X4CA 4DTMA 4H0PA 4OYWA 5L39A 1SC3B 3W63A 5A8RA 4L76A 3AQPA 4GVMA 3T69A 3X1LB 2NLXA 3MCMA 3QSYB 4FBUA 2VFVA 1REVB 2E1CA 4F04B 2J76E 4XDDA 4N77A 3ZTOA 3BKTA 4R8UA 4MFBA 3AVJA 5B09A 4X64K 3NGYA 3OHRA 4FZXC 2WTUA 1HYSA 4C8OA 3NMAA 2RKIB 2LDYA 1UFWA 3Q8QB 4MKBA 3U9DA 1LK7A 4DPWA 4ISGA 4H5RA 4LQ9A 3B54A 1OSDA 2VBZA 4NXMK 1KLMA 4M3XA 3SV4A 4I68A 3G71N 4OZJA 3HPGA 4G9ZA 4U8VA 1PIEA 4ZITA 3QEWA 2ZH2A 4ISFA 2MQ8A 4OYXA 2GVZB 1HI8A 4ED5A 4KTZA 5AXKA 3QBWA 3CFOA 1KOOA 4ID5A 4HH1A 3C16B 2BTFA 3ALYA 3SQ4A 4KFBA 1JXVA 3M1VB 1LW2A 3CPWR 3L3VA 1KHWA 3RMBA 1Q82O 3HT0A 4YEAA 5GMDA 1G1XA 1QVGR 4ER8A 2VF3A 2FQQB 3CCMN 1A9NB 3HBTA 1F5BA 4CJTA 5IT9O 4RO0A 3HHKA 2UV8G 4OI4A 5DGBA 3UDCA 1TQLA 4R5PA 5AQPA 4A8MP 3O4NA 4HUFA 3EWGA 4JI6F 2W6LA 3PO4A 1BQMB 1KVKA 2XLJA 1VHFA 4LF1A 5D4PA 2VFTA 1BIUA 2V7ZA 1QD1A 4ID5B 2OAUA 3SK3A 3E2EA 3CJTA 4CZHA 2QMXA 4ZVQB 1U1LA 1ASVA 1T9XA 1YGYA 4KKOB 2E9ZA 2D3OR 2JGUA 2RSQA 2VG6B 2M5YA 5KG2A 2YNIA 1WOSA 4WK3A 4DTXA 4PA1A 1FI4A 3M8ZA 3EM1A 3KOAA 2PO4A 2HHHJ 1WI8A 1W25A 4P75A 1WKJA 2HNDB 5IWAF 2HKEA 1WOPA 1B3TA 1UPPA 4MK7A 4NL5A 5GMEA 3D9BA 3LP0B 3KLEA 5KT6A 1WACA 2O8DA 2DNHA 1K73O 1V5VA 2H5JB 3HP6A 3DU5A 3UD3P 3OYIA 1EHWA 4TU8A 4B9SA 4JV1A 4FYWB 1Q1KA 5KG0A 4YY3F 1RDAA 3D1QA 1M1KO 3NE6A 1ZZFA 3CD7A 1H2VZ 4UUWA 1YUWA 1IQTA 2P9CA 1LAWA 4Y28C 2LQ5A 3I56N 2HFNA 4UW2A 1IBMK 3V2UC 4M3ZA 1SJ4P 2ZVIA 3CC7S 2FLPA 1RTHA 3O9QA 2A6AA 1JLEB 4KE5A 1FJEB 3F0NA 4JI4F 4BACA 3QICA 3M05A 1OSCA 2NRTA 2LU1A 2O5DA 2ZC3A 1QHTA 3KD5E 1HQUA 2BYCA 1KBRA 2CQPA 1CS4B 1NSPA 2RQMA 4CLLA 3AOBA 3D1OA 3M8PA 4K5RA 5JJBA 4WQ5A 3R9PA 3MMCA 4OGEA 3DLLL 1J9AA 2OTLN 3EXCX 4MAKA 1N56A 4M5JA 4JI5J 1HWLA 4CE9A 3FEYB 2V2ZA 3MR6A 2UU9K 4PG6A 4WU3A 4BGAA 2EFQA 1AUSL 4KJIA 1FVSA 1QAIA 1HHSA 1DEJA 1U26A 3SCLE 4JLHA 3DN9A 1LAVA 5FLXO 2JNJA 2MYFA 3UKRA 4BQZA 2GW8A 4B3RF 1HJRA 1IWGA 3CCQN 5J2NB 2BZ2A 1XR7A 2D3UA 2NZCA 1HARA 2VPYB 2DNOA 2ZHAA 1MWZA 1KQFB 3N6MA 3WHIA 4E19A 4GKJK 3UB5A 5C7PA 1OY9A 2O8BA 2F8HA 5EGYA 1XR5A 2AP6A 4NB4A 2BACA 2AQ4A 4K50A 2RMLA 4YY3J 3W2VB 1N32K 4F4XA 3UCGA 2ZGZA 1TMMA 3HVAA 3AD8C 3G9CA 3AH6A 1UTAA 1Y3JA 3R27A 3ZZZA 4IEEA 2FC0A 2WVDA 4J9OA 1CULB 2BOPA 5BPMA 4C3MA 4M5HA 2HG4A 5L38A 3OLAA 4XTTA 3TJ9A 4CHQA 2X6SA 1LQ9A 4DU7A 4JI4J 3AODA 5BXIA 4WZQA 1OYDA 1UL3A 3US5A 2MKJA 2KFZA 1NHKL 2A3JA 4KB7A 4KTQA 1F2HA 5KFLA 1L3KA 2NREA 3TZWA 4X62F 3ULDA 3K57A 4WF9L 1VSFA 3OS0A 3G6ES 4BROA 4RJVA 2RHQB 4DUZF 2AEJA 3KLVA 3TARA 2QTDA 2QGFB 3OFGA 3VWSA 1BIZA 1OWXA 3JXUA 4J9SA 4WWSA 4FWPA 4O3PA 3CM5A 2ZOMA 4JV2A 5DRKA 2IM2A 4U7UK 4PZVA 1U0SA 4YDUC 2GMJA 3W66A 1BOTO 2GNKA 3L4QA 5F8HA 2ZC4A 1DARA 2FIUA 2H51B 1HQEB 5AQKA 3MN7A 1NLVA 3OYBA 3DLBA 3IR7B 3K5NA 1FNOA 5EWFA 1N34J 5AQWA 2RILA 4X64J 1Q53A 2A40A 3TSPA 1RADB 4NCGB 1Y5IB 1S79A 4M95A 4DR3K 2N3OA 4C9DA 1N33F 1VJQA 1VQ9S 3MM5B 4CO2A 1NGCA 3DYAB 1VQLN 3E9PA 4KH5A 3GIJA 1HI1A 4WQ4A 2D3O1 3CMEN 3PYEA 3OW2R 4EFAC 4B3SJ 2D1KA 3O1BA 5TKYA 5IFMA 5DDPC 1UP1A 1H7WA 3TJ8A 2W4DA 5CABA 4KH0B 2EC0A 1NO8A 4U9RA 2ILZA 2BABA 3GILA 1LEOA 3EGVA 4YOXA 1RHKB 3CCJS 1PYOB 5AQTA 4ZP9A 1MU2B 2NYHA 1F9HA 2X3GA 1V6HA 2H54B 3FQLA 2IMOA 4C11B 2OD4A 4IO8A 1YJWS 2K3IA 2BA9A 4ZDNA 4FLWA 2FSJA 3IWNC 1UFKA 3LF0A 3EVOA 4ZJOA 3CJ9A 1NK8A 1XEZA 2W41A 3WIUA 5F0WA 2FVRA 1Q95G 2N4DA 2RJZA 2MKIA 2UUCF 4X2BA 1X4DA 2DY1A 3J81Y 4QWBA 3PNIA 3FNNA 4ZVGA 3OTOK 4FM1A 4NA3A 4OX8A 3MPDA 1GLBG 1NEEA 4DSJA 1IKXB 1M5HA 1SKUB 4ILMA 2AJ0A 1Z4UA 3LP2A 3CJ4A 2M9KA 5LXYA 2NQPA 3PIOL 3PV8A 2FY8A 4KHMA 2XY6A 5HRPA 4FPIA 1IJEB 2A18A 4HKQA 1SQGA 1QS4A 4ZJLA 2OPQB 3V9WA 1QZ6A 4FSVA 3HX9A 2HF3A 4FPRA 1U1MA 1ZM4A 5L46A 2V8HA 3BSAA 2G9OA 4GVEA 4GV3A 4B1YB 3C14A 2K3KA 4FZVA 3PYDA 5DDQC 1PO6A 2VQFK 4BBYA 3G25A 3K8VA 4OPAA 3V1QA 4ZK7M 3LO3A 4TYBA 5ETRA 2G4BA 3MWBA 4KI6A 2LXIA 2EG2A 2WSEC 3AT1B 3CPEA 2FPHX 3CT9A 4USUA 5DQHA 3VMFB 2HBYB 3SJHA 2DXFA 4PL8A 3PKYA 3RGIA 4EZ6A 1X31C 4F0MA 1T94A 1NGJA 3C8YA 2U2FA 2G2ZA 1IXKA 3P96A 3RB0A 3KJQB 3G6XA 1ZZNA 2YBVA 2YJFA 4HWIA 3I0SB 4YB1P 3ZCMA 4B3SK 2G1DA 3PR5B 2HBRB 3PY8A 3KJNB 4DV3F 4DG1A 3ZNUA 3VAJA 5KG7A 2K2PA 3J80Y 3OYNA 2XHBA 1FESA 4JK8A 4BDYA 3DRRB 3LDOA 3P45B 1JJ2R 4PPDA 1RLCL 4JP8A 2Z1GA 3AA4A 1U2VB 1H6KX 3VQ4A 1B9FA 4CM2A 4X4OA 2HVDA 1C0TB 1VQPS 1XR6A 5DG9A 1WB9A 1VS3A 1YJWN 1ZH5A 3I8DA 4AXIA 4DQSA 3MFIA 2HBKA 3WNHA 1G2EA 2RNEA 1ULRA 1EXQA 1IG9A 2XEXA 3BO4A 1VC5A 1TL1A 2BXJA 2ZJRQ 3GG4A 1JLAA 2Y1LB 3G4SN 4RNNA 3VESA 3EDQB 4C8KA 4CJVA 4E7LA 4BVPA 5I9EB 4DV4F 2QM1A 5L1IA 4WQ5C 1VK0A 3RAXA 1KR4A 3DDNA 2XMJA 3CD5A 3CJ2A 4CF0A 5KG1A 2HNYA 4NYZA 3EDRB 1KQSR 3R2CJ 4E2FB 4NEYA 3GCWP 4DDFA 1V3ZA 1G7CB 4CJUA 5ADZA 3HMJG 3KLHB 3IM8A 4ZPVR 1IV0A 3OYFA 1GQEA 2IJFA 4M5MA 1ZBIA 1GLCG 5AQGA 4F7VA 3FBBA 3R6LB 3FZBA 1S9FA 3BZQA 1VSLA 3SMZA 1FNMA 3H1QA 2XWXA 1O5JA 4OO1J 2ABYA 3GB0A 4U8YA 4JRPA 3I56S 4YOEA 3AVHA 3KD1E 3AVMA 4ZJQA 2EX3A 3R5DA 3SXLA 2NRVA 2MTLA 1IQZA 3LL3A 2UYTA 3A5LC 3H46O 1JLBB 2DTUA 3AB4B 2GUPA 4CF9A 3PEHA 2BQRA 4X62J 4Y2CA 4GMJB 1SV5A 5B0DA 4OPJA 2H4WB 1HLWA 3BPSP 3MTJA 3FLCO 2LU2A 3VQ8A 5HRSA 1PJ7A 4FWQA 4QYZK 1U1QA 4JI3J 2MZJA 1NK5A 4JI8K 3PXGa 5C25A 3HL8A 4GKJF 3KKSA 1SH0A 2E2OA 2QMUB 4GKKK 1I51B 2R7QA 3CCEN 1RZMA 4GC7A 1NM1A 1NSKL 1I94F 4KB0A 1G15A 3QGGA 1BCMA 5DG7A 4MKAA 4LFCF 4KBIA 3VQ7A 3M9MB 2MQOA 2YWKA 3FZLA 1T9YA 2PFFB 4RW9B 4OGCA 1NAQA 2PD1A 3UO0A 5KRTA 3QZ8A 4AQYK 3VVTA 1UA1A 1LOTB 2FYXA 1CQNA 4OFZA 4FVMA 4HH0A 4DV6F 1M1KT 5GMKa 5IT9U 1RWMB 3AVLA 3ZTRA 2XMMA 1GLFO 4UOGA 1RDRA 3NGSA 3BO2A 3TA0A 4NXMJ 5T41A 3VR1A 4DV7F 1IJJA 3GFYA 5HRRA 5CR4A 3W8PA 4DQPA 2HSEB 2VG7B 3OUYA 4ZP7A 2LMIA 2UVWA 4ANCA 3FSYA 3IA0A 3KHGA 2HAIA 4W5RA 1TAQA 2XMTA 1VQKS 4ELUA 2WHOA 3LP2B 4YMEA 5EHHA 3GV7B 1OKJA 2ACMA 3MEDB 1OQ3A 2ZHBA 2APOA 3QWPA 4MH8A 5E3AA 2HK2A 4BRAA 1QAJA 3BSNA 2NUHA 1C1BB 2F63A 2D74B 3IM9A 4ZN1A 1Y00A 2W2PP 2F8EX 1DLOA 3SBTA 3I55N 3ENBA 4NLXA 4CZEA 1SIZA 2V5HG 1WKKA 4EEYA 1JLAB 4CD3A 3B8HA 3OTEA 2MKKA 1VQSA 3V6KA 4X4SA 2FY1A 3K58A 2L48A 5D4OA 2P51A 1NGGA 3TUJC 1TK8A 3ILLA 5EWEA 3M8PB 2VHGA 1VSHA 1YKWA 1QSSA 3DLHA 4RNFA 5KFRA 4CZKA 3MEGA 3WBZA 1VQ7S 3I5AA 3ZFVA 1GFWB 1FXLA 3E9LA 3SSQA 2HIYA 1I5OB 2NUBA 5EDWA 3TSQA 1YJRA 2HFOA 4TYAA 2VWBA 4LF8F 3C46A 1FJGF 1RAEB 4M45A 5M1KA 3SNNA 2B9EA 3CFRA 2ATCB 2VA2A 4YOWA 2CPIA 2FJWA 5ELZA 2LKZA 5J2PA 1RABB 1HD0A 1GMUA 1B4SA 2Q3PA 4DZDA 3UR0A 4DUZJ 2P5OA 1Q7YO 1Q8IA 4QYRA 4NLTA 4PEOA 4JV0A 1N0VC 4BG8A 4KBOA 1Q18A 4OHZA 2G8HA 2LEPA 4Q0BB 4IQMA 3K17A 4LFAK 3VQBA 2EVZA 4ED4A 2BDPA 3GIRA 1XMQJ 4H8KA 1N54B 2F8TA 1URRA 2GV9A 1F5CA 1TGOA 2C3OA 2OMLA 3LUYA 3S1TA 5HI7A 5M1PA 3EVWA 1S9GB 5HQLA 2ZJPQ 3I4HX 3MOZA 5AE1A 4BC7A 5K8OA 4CBWA 4OYMA 4TY8A 2Q1NA 2XTJP 3NF8A 2DIUA 2CDRB 1IBMJ 4Z4IA 3SQ2A 1F5AA 1WSIA 2AGQA 3F44A 4LF6F 3WEEA 2VASA 2DY4A 2P9SA 3D0HE 4Z37A 5B0EA 1GMWD 2D5RA 1DTTA 2IFXA 4DV0K 5F0XA 3SCJE 3W5XA 1EO1A 3RRKA 2YNGA 2XGPA 1SB6A 4MO5A 1VI7A 3C7NA 4HVJA 2KYZA 5H9EJ 1HWKA 4Y2AA 3M4XA 4X4UA 1K47A 1T9TA 4I2PB 1WC5A 5I3PA 2VKZG 4WFBL 1KC8T 2BANA 2XMUA 2M70A 4FZZA 4YOYA 1M5VC 2LQ8A 5D4LA 3M6VA 4C48A 1S72N 3KHLA 2AT1B 2LECA 2UXBF 5GAGU 2ZKTA 1KSPA 2CNOB 2VOOA 1DQ8A 3E51A 2I7NA 1C6VA 3A8IA 3DLEA 4JI8F 5C15A 2DFHA 2EKYA 3MR5A 4KI4A 1S6QA 1S1UB 2NXUA 1R27B 1ZOTA 5KFGA 3CDWA 3ZX0A 4WFXA 4FW1A 4K0KJ 2V0NA 1VSJA 1VFJA 1T3OA 4Z4HA 3HFVA 1TR0A 1WNSA 3PKMA 2L41A 3M8YA 3E9OA 4LJMA 4P10A 2ASPA 2QIFA 3DRRA 2DNMA 3CHWA 1YX2A 2X1FA 4ELTA 4CIGA 3H08A 2E9TA 3ZSQA 1VIXA 1CVJA 1NGHA 3W9IA 2A2DA 4QPTA 4RW9A 1WSRA 1WDDA 1NK7A 3D7SB 3IGVA 3H7HB 2CQCA 4EZ9A 2RQKA 4P2XA 3OHBA 2W7AA 4I6WA 4JAXA 5SWMA 3CW2C 3CQYA 3D3CJ 2LA4A 1DHMA 4X66J 3SFUA 1XMOJ 1QDUB 1FVQA 4LR7A 1Q78A 2K1RB 2UXCJ 4GY2B 2PY5A 5KFMA 2M2BA 2RHKA 3HDSA 3POTB 2IVFB 4RZRA 1FDDA 5I42A 2OFGX 4NLDA 1CS4A 2DFFA 3RR8A 3O8WA 4NYNA 2DRDA 4KHRA 3MEEB 4PKGA 2LDIA 2WSCC 3W2WA 1B7YB 4K2JA 3VZIA 4X65J 4CEQA 3AXKA 3OL9A 2O8FB 2JDJA 3FFIB 1E6VB 4FVCA 4W4MA 3EUNA 1OH8A 3X3UA 3K0SA 1CJTA 5JICA 4MKVA 5A8WB 5CYQA 3PO5A 1ZYQA 2BX6A 2IVPA 5T7BA 2W40A 2IVOA 3N4WA 1N8RO 2DPNA 3QIOA 4ECRA 3VGVA 4A61A 5FDLA 3NNCA 2B0GA 2XHWA 3F9MA 3FFKB 4CD1A 1BI4B 3FE1A 5H9EK 1R43A 4C2MA 3TAMA 4Q44A 2Y8YA 2R7UA 3TTDA 3HP9A 2QYGA 3W9JA 2FBVA 1W97L 4JEPA 1RKJA 3T1HF 4I7FA 4LSNB 4ZVUB 2YKNA 1GTHA 3BGFA 1KAXA 4CWBA 4ZHRA 3WIVA 1EIYB 1G6BA 3AA3A 4O3RA 4NCGA 2C3PA 4CEDA 4DUYJ 3GONA 1WUUA 3BSCA 2QA1A 1SJ3P 5CD4A 6FDRA 3MCOA 1YBUA 3LGHA 2UUAF 2O8BB 1JLFA 1HFEL 1RXOB 2DR5A 3GFXA 1WUAA 2ZKUA 1NPRA 1FW6A 2RUSA 2P9PA 4Y34A 5J2MB 4IR1A 5LT5A 4Y1CA 2IA0A 3IWLA 3D28A 4JKEA 1C0FA 4J2EA 4ZVPB 1C1BA 4XDCA 1XI1A 2VJVA 1YVNA 2HZAA 2GJFA 3NCQA 4M63C 4ZP8A 3T6BA 2B43A 4DR5K 2B6AA 2E5LJ 1VRUA 5KT2A 1I6JA 1SL2A 1L3VA 4X66F 1JXBA 3MK6A 1VQYA 4ZTJA 3NWRA 4BC2A 3QPIA 4QWEA 5CY4A 4ZCIA 3VETA 3DHWC 2GCFA 4DL0C 4J9VA 4LQ3A 4BRNA 2D0AA 9ATCB 4P2MA 1N6QB 3R6GB 3LDPA 1TELA 3GPAA 3DLRA 2J0WA 3T5JA 5GAHI 2BUNA 5CE3A 3BQ0A 2HURA 1ZBUA 3FFIA 3OTOF 3AFGA 4CF8A 3R5GA 1XJWB 3KWIA 4LF8J 2ZNYA 1BHLA 2DGTA 4IH6A 3CE8A 2GO8A 2HK3A 3P8BB 1QVFR 4ANEA 4ERDA 1FX4A 2PEBA 2C2RA 5JUMA 5JS2A 3SUOA 1A0OB 4DX7A 4KGZB 2VFSA 4ED6A 4LBIA 4CTAB 2JX2A 2R2UA 5EX5A 2FBXA 2HBZB 4Q45A 4ZVSB 2WUSA 3O80A 4AILC 2IHR1 4FJXA 1DJ0A 2KT3A 1YTAA 4USTA 5D0HA 1JK9B 4E98A 4OYAA 3UD4P 1W7WA 3L2WA 2NXEA 1N52B 2YHWA 3O44A 4WE1B 4B08A 3TUIC 3CC4N 3BGRA 1GTEA 1XMOK 3M8RA 2AJ4A 3VQEA 4B9QA 3RBZA 2XNQA 5KT5A 2NXCA 4B3RK 3HTVA 1LWCA 3H20A 1GOBA 1LK5A 4O3OA 3FMBA 1UWBA 4BRFA 2RHSB 2IYIA 4CO1A 3M6GA 3CM6A 1X9WA 2HNZB 3P38A 3O2IA 1J53A 1TMJA 3CJKA 2YHXA 3OLBA 2YHBA 4JI2J 2DVIA 2KRBA 2QFIA 3NH0A 2ZD1B 1FF2A 2OFHX 1S72S 2WB4A 3FCVA 1SS6A 2IGIA 4K4TA 1ITPA 4DBQA 4YR0A 2SXLA 3ITHB 2C3UA 4X4TA 5KFXA 2OPPA 3OVSA 1WBDA 3AAPA 3NGTA 3KG0A 1EETA 2PE8A 1EKEA 4MYTA 4Y3CA 4Y0WA 1S57A 4Y2KA 2BJ1A 1JNRB 4LF5F 4O55A 1U8SA 3VV2B 3ATVA 1WTFA 3A8YA 2Y1RI 5F8NA 4ILHA 1XHXA 1S0VA 2HFVA 4WE1A 2HNDA 4KGVB 1S1TA 2WZ1A 4ECVA 1OPZA 1WN7A 3RB3A 2ZE2A 3CQ8A 4G6VB 1C4AA 2L3MA 3GR1A 5C5JA 5KFAA 4IR9A 1JCFA 3HI0A 2JWKA 2R8JA 3K5LA 3FCWA 1NPKA 2W9CB 2KU7A 3NY0A 4MIWA 2D7SA 4NLOA 1WAJA 3DMJA 3C2PA 2ZF5O 3GJTB 4BREA 2V63A 1GK8A 3OR1B 4JI6J 2CDQA 4A5BA 1D5AA 2MB0B 2XRIA 3BB5A 1NDCA 4FWKA 3D3BJ 4NZ0A 2EFVA 3PUFA 2QYCA 2NRZA 3KJVB 5ETVA 1UW9A 4FOIA 2DGSA 4OL8A 1HQ2A 1IBLF 3CEDA 5C2CA 4IUFA 3L2QA 4PG4A 3O6WA 5BREA 3MCNA 4AM7A 3PIPL 3OYKA 1RDWX 1N88A 1Y9OA 4J2BA 3LDQA 2UUTA 1PAEX 1BU6O 1FXRA 3HVRA 4PYDA 4PY5A 1B7FA 2A1BA 1K8KA 3QEPA 3TWHA 1N5QA 3W5YA 1HA1A 4MFBB 2RPIA 1W2IA 5EU7A 1RT3A 2ZM6F 4FWOA 4DU3A 3BGRB 1BC6A 1TL7B 2IA6A 4JKBA 2BMBA 1X5TA 1SV5B 1HNVA 2JWLA 2ZH6A 3AO3A 3H25A 2Z30B 2VYPA 2HBMA 1K8AT 4OLPA 5DS7A 2VWKA 3G87A 3K8WA 2XMVA 3MCAB 4RBVA 1S6OA 4PCQA 5E2QA 4WTYA 3BEGB 3CNQP 2GFFA 4QQBA 4RUCA 3LAKA 1NK6A 4A2BA 5DO2A 3HOSA 3ZZYA 2C1EB 1ASWA 4X4RA 4ZCKA 3H59A 5L8RC 1KFDA 1N5SA 1RHQB 4ZVOB 3QNNA 4IEIA 1ZA2B 2P8IA 3UNYA 2DR6A 3FBEA 1ZBSA 3OQ2A 1JJ4A 4XAKA 1JLQB 1NNEA 2G2OA 4IYQA 1VQMN 1Q8KA 4FS1A 3DXMA 2F9JA 1RTIB 1WEXA 4XPEA 4IO1A 2DGOA 3JQJA 2YKMA 1NHUA 4UY85 4Z0UA 4F50A 3KKRA 2AV5A 1C2PA 2VC0A 3HSCA 2HNYB 4FPAA 3N9UC 3DGPB 2CQ3A 3J7YP 2W42A 2R7OA 4DR3F 4DR1J 4LF4J 1FX2A 4XK8C 2G8KA 3RMCA 4AD6A 4CJ3A 4NXMF 2HBQB 1V9OA 3HULA 3V6DB 1D9FA 2GWJA 3OSPA 3CCWA 3J80U 1X4AA 4F8RA 3NS5A 4Q2MA 3OYMA 5KFZA 5LJWA 1X4GA 2MGZA 1WSJA 4XPCA 4ZN3A 2V69A 4JV5F 2DRAA 2E8AA 2J8AA 5BRFA 1RJJA 4F0HA 4E1MA 3JB9k 4RW7A 4K4UA 5B7WA 2GX9A 5DGAA 3D2EB 4W5OA 3P5JA 2ZQBA 1FRXA 3GMGA 2HRYA 2HBJA 3EKUA 2QKKA 3VEXA 3CCLN 4PXBA 3QFUA 5THWA 3ISZA 1JIHA 4X4QA 4K43A 5AQJA 4FLTA 4DV4K 5E84A 4OX9J 1QQMA 1AYEA 2QN6B 2G8IA 1UJ4A 4B3TF 3BN7A 1FKAF 5GADI 3FR0A 3OVBA 3UCZP 3A8KA 1XNRF 2M4MA 2Y0SD 2ZM6J 4H5VA 3CSKA 4F9OA 3M2UA 1BA1A 4OPHA 2FSKA 3Q7CA 4IDHA 2O8DB 3CCUS 3VF2A 4CLKA 2E6MA 2UUBJ 3MPUB 1FKPA 4DPTA 5C2DA 4AHUA 4CGDA 3JAMO 1SXLA 3M1VA 4J9MA 2M3DA 2R2SA 4EI2A 3VPZA 2KVIA 3AY9A 1VQ6S 3FKBA 4LIWA 5F3ZA 5HSPA 3IN5A 4HLBA 4OJ1A 3CCZA 3NHGA 2JFDA 1RT7B 3MCPA 4DR7K 2VQFJ 4W98A 1UW4A 3TUZC 1SUQA 3U02A 5M1OA 4CCHA 4DU1A 1F3VA 1GLEG 3BR9A 5ETOA 1P6TA 4QIEA 5DM7L 3LW5C 4J37A 4GO5X 2RRBA 3GYGA 2OMOA 5KFKA 3AV9A 3RAQA 3M8QA 4Y1DA 4LR8A 1S48A 1Q5YA 4PWDB 4BCAA 2HVHA 5HP1B 1FFGB 4C3LA 4DV5J 3IC1A 1KTVA 2KDOA 3QNWB 1EJ7L 2BJDA 4C0BA 3FVYA 1JLBA 3FBFA 3CD6S 2ZEJA 3GG0A 1Q0NA 3LDNA 1RAFB 3NP5A 2PYJA 4BR2A 1SC4B 2GC8A 5KFNA 1PGZA 2WSFC 5JMVA 4I9LA 4XIUA 1PBAA 1KOHA 2XY7A 3DRPB 2WFBA 2OO4A 5FD1A 2DB1A 4LF2A 4B9NA 3N4QA 8ATCB 2Q0RA 2R7YA 4NLSA 2J6TA 3ZT4A 5GIPA 5K9FA 1NGEA 3NOGA 4OYBA 4B17A 2LQ9A 4EWTA 2F8SA 4QWCA 4A46A 2QSFA 3H3OB 3WQTA 2ASDA 4BDZA 4QPXA 4WK1A 3SUQA 2BJ8A 2X1GA 4EHTA 1W0HA 1PJ6A 3VA3A 4DR2F 1LFPA 4RW6A 4LF7F 3TX0A 5AQHA 2ZZNA 1MU2A 3D6HB 4OX9K 2FLLA 1FDNA 2FUG9 1ASUA 2JLEA 1K6YA 3T5HA 3VN5A 4GKJJ 4YORA 1VSEA 3JSMA 4EP4A 4YQWA 5IC6B 4NO7A 3GJRB 3R7NB 2HQFA 1R8AA 3CWJA 3OT9A 3QEIA 4H4OA 2KXNB 1D8YA 1HNIB 3BEXA 2CQ2A 3IMXA 4PABA 2XMWA 3ID8A 2MKSA 2K7JA 4HCBA 3R1HA 1VYAA 1NGIA 4WBFA 3PSIA 3RWUA 5TKWA 2ZH7A 4A47A 3THPA 1WSVA 4RW6B 5HVHA 2P9PB 3VZHA 4PHTX 4KV8B 5HROB 3VGUA 1RCXB 4LFAJ 4K4VA 1QQNA 3FGVA 2QXFA 4JYAK 3BYPA 4YP3A 5H1SQ 3UNGC 4ECXA 2IS3A 3G82A 5AFUA 3E01B 1IJFB 1RWKB 4DR4F 3S01A 1MMDA 4NASA 1LWCB 5DDOC 1SH3A 1M90O 1B0VA 4HDHA 2HGMA 2Z2YB 1R0AB 3SDEA 1U4BA 1SAZA 1S49A 4CJ5A 2JEIA 3CXCR 3RB4A 4YHHF 2AEMA 1ATSA 5F8MA 4B1WB 3K9KA 5JLFA 3PTWA 1WEYA 1ZETA 4JI3K 1RA6A 2J7WA 1DQ9A 1ELOA 3HHLA 3ZYYX 1CJUB 5C25B 1UZHA 2NR0A 3BH6B 1X1PA 2Q0UA 3S3NA 3NS7B 3WXKA 4DV7J 1LW2B 2A0FB 3M6UA 3CCVS 4RL1A 1WAFA 1BL3A 2E9RX 3KHHA 2JH3A 1GXLA 4HYKA 3P5TL 2W9AA 4CJSA 4HR2A 4UT4A 1IBCB 4M3TA 4FK0A 4CZCA 4EFHA 2RDDA 3TAGA 3H4DA 1A5WA 1F6TA 3W0LA 4N7TA 1M1HA 4CK3A 4FKYA 3BQ1A 3VEVA 3OYEA 2V9KA 1X5PA 3D6FB 3O9RA 1BISA 3CDUA 4DUZK 5KG4A 4DUTA 1NDKA 1RT4B 1S1WB 1SBRA 2FJEB 2JHEA 1VRTB 1UWAA 4TU7A 4LRBA 1CXUA 1AB8A 1JNZB 3RUBL 1S9GA 5KFWA 4IKFA 3M7VA 5A76A 4OZ5A 1AW0A 5M1QA 4ED8A 1YITS 4WFNL 4DSKA 1FJ7A 1EZZB 3Q23A 2UP1A 5FJ4A 4OJ3A 4J9KA 1S10A 1UVJA 2ZH9A 1N48A 3DI6A 4QS7A 2KB2A 1HPZA 3C19A 1W26A 2H3GX 4ETXA 1Y10A 2G1HA 3DOMA 4IRCA 1EX4A 3JSRA 1YJVA 2HEKA 1NH8A 3T41A 5BYSA 3THYB 3RB6A 2EHGA 4H4MA 1H7XA 2HZCA 4ECZA 3S8SA 5AE2A 4DU4A 3VOVA 3NXZA 2D0PA 4A2AA 5CHIA 4B1VA 5LY3A 2DCLA 4R0EA 4JI0J 2HS0A 3JSBA 2A10A 3UE2A 1SUQB 1Q86T 1Q16B 1KQGB 2HIQA 2XCAA 4EUVA 4WU2A 3NGDA 3DDIA 3THWA 2EWHA 3DLLQ 4CZJA 1G99A 5JVHL 1X5OA 4JHDA 3SQOP 1UMJA 3DLJA 2E1ZA 3I32A 2R7SA 2E4LA 4BR5A 3QJPA 2GIFA 1DFDA 1BQMA 3VGSA 2KN4A 4GV9A 4CRJA 2CJXB 2IAJA 5GAEI 4IOXA 5HJXA 4L75A 1RHUB 1KS2A 3HHLB 1MWYA 4PR6A 3ENVA 3OTOJ 1X4FA 1HR0J 2KHOA 3A8JA 1XQIA 2GHWA 4B9TA 3O5TB 1NH7A 2XBPA 2RF2B 3UCUP 3ICLA 3CCES 1UVKA 1Z25A 4NYFA 2OYQA 4QW8A 1VQ4N 3OYCA 5MLCQ 4DLEA 5F0UA 4H0YB 2HHHK 1VQ7N 2GWKA 2G0IA 4RLEA 5KFUA 2WBNA 3OVAA 1LCUA 4HTLA 2J7KA 3ZSXA 4NLUA 2I0XA 3F41A 3CD6N 3OSNA 4DV0J 2AMCB 1NGDA 4AHRA 4JI1F 1NSQA 4FL9A 3IBWA 3NG8A 5L9NA 3HPHA 4JBCA 4JI2K 2Z8QA 1Q7YT 1NWKA 1X5SA 3HVWA 1JL1A 1RT5A 5J2QA 2PGCA 1YTYA 3AA2A 3TNVA 2XO7A 3HFKA 4EU0A 2ROEA 1ROFA 3N5BA 2ZGYA 4Y65A 2JRSA 2ZJPL 2X6NA 3ENOA 1KRPA 4RNMA 2CJAA 2NXJA 4J7CA 3H40A 2E5GA 3SSSA 2GA7A 4PRFA 4MLEA 1X4EA 3W9HA 3W8GA 3UE5A 5GINA 4LRDA 2DGQA 2X7IA 2EW9A 3AO1A 4I6MA 3KLGB 3DXMB 2CQ4A 4OV6A 4URQU 3R1XA 4WJBA 3G6VA 2AZ3A 2CPZA 4F4YA 1B9DA 2MDAA 3HVTB 5HJYA 3DXKA 2O8CA 2BJ9A 1R31A 3DLGB 3ASMA 4A8KA 2W1BA 2AF6A 1U47A 2QE5A 1HUXA 1SCJB 4NI2B 2AHOB 4M94A 2RB7A 5DZ6A 2CPDA 1S9EB 1S4EA 3A2FA 5KT7A 5AQNA 3W3DA 1JWWA 1FA0A 3OYLA 2Z57B 3CERA 3M32B 3ZZTA 4FNIA 2F65A 1M90T 3VQ5A 3WNEA 1M5SA 4O3SA 5ETTA 4OI0A 2Z1JA 3B4DA 4B8AB 1KWMA 4F0KA 3A1YG 4G1QB 4WZMA 3ID6A 4B8CA 4C8YA 5FRNA 4GC6A 3UPFA 2Q31A 3MM5A 4DPXA 4DUYF 1RBUA 4FO0A 2YWFA 1IKWB 2CH6A 3OFHA 2CXEA 4IH5A 5CD4H 3HRGA 3A8EA 1E4FT 3DOLB 2QWQA 2ACYA 2DR9A 3OTCA 1NKBA 1SQKA 5KFSA 3PRDA 1M5KC 3KLIA 2BOAA 4K8RA 3L4IA 3OBIA 2O66A 5HO4A 1O13A 4KO0A 3EZOA 4B3MJ 1SVDA 1RTHB 1NK0A 4DSEA 3IAM9 1FRLA 4YB7A 3PM9A 2LA6A 1C0UB 4U6PA 4C1NI 1Q4RA 5IC4B 1WC6A 5HVFA 1NJZA 4IOAQ 1KC8O 2BBEA 4H5TA 3SBMA 3VGMA 3FSIA 1P8GA 1RBTA 2KJWA 1WF0A 2VDHA 3SUNA 3GDQA 3BDPA 2XNRA 2UUAK 2HZVA 3K5PA 5DG8A 2XSFA 3TZZA 2HMIB 4Q8FA 3F9KA 3QSIA 3SCIE 4EP5A 3THXB 4WP3A 2YHAA 1OH6A 5HANA 1VQ8N 9RUBA 1T6CA 4BRCA 4CH0S 1L3UA 2Z2ZA 4IBNA 3BUZB 5HMXA 3ZSWA 2DXDA 2MQQA 4CLFA 1C0UA 3IFRA 2HRUA 4CH7A 4DR6J 3V9SA 1FRJA 3CXCM 1KAYA 2IAJB 5J2MA 4AQYJ 1C1CA 3MPWA 2B8QA 4DR3J 3EYZA 4ZKAA 3G6EN 2B3TB 1K73T 5C0YA 2W8KA 3OXLA 2OI2A 3AO5A 3CJ7A 3VEZA 2QT7A 1LWFB 4CK1A 3VAFA 3WT0A 2DRBA 1RT7A 3PW2A 4RBUA 1UJ6A 1C0TA 3KIOA 2MHEA 3QT5A 1GXTA 4AFFA 1S1XA 5KPRA 1N5VA 3TTFA 1A6LA 4EO6A 2H3EB 4OX6A 3V81B 3SYZA 3CETA 3DOMB 2CPJA 4CIOA 3AVNA 1YRXA 2F9TA 2F4VK 3SQ0A 3NDKA 2DNZA 5ETQA 3GWCA 1HWUA 1S0NA 2A42A 3QBXA 5EX0A 1RU2A 1J5EJ 1V3RA 1ZBFA 2WCXA 3IKMA 1YZ7A 4K4SA 3NF9A 4LFBK 1VGYA 3J7YU 3MM6B 2J5AA 4M5IA 1VOMA 2OSRA 4PKDB 3QB0A 1AFJA 2KQ2A 2RN2A 3VQ6A 4BR4A 3CMAS 4B3TJ 5GADP 3HJVA 3PDNA 3BSOA 2VA3A 3MXHP 4V19S 4ZS6A 3HSJA <