3QIPA

Structure of hiv-1 reverse transcriptase in complex with an rnase h inhibitor and nevirapine
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
556
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse HIV-1 reverse transcriptase p66
publication title Structural and Binding Analysis of Pyrimidinol Carboxylic Acid and N-Hydroxy Quinazolinedione HIV-1 RNase H Inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase/transferase inhibitor
total genus 164
structure length 554
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3qipA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3qipA05
1JXBA 1VRTA 4TY8B 3HJFA 1T05B 4QWBA 4FLZA 3SJJA 4W5NA 2HVHA 4PY5A 4F4XA 4RW6A 4J9RA 3AVLA 3KHHA 3SUQA 3T5HA 3PX4A 5J1EB 5K14B 4NZ0A 3DOLA 4FJMA 3V81A 4EEYA 4JV2A 4DQQA 1RTDA 1DTQB 3M8RA 3G86A 2XY5A 3KJVB 1C2PA 1IKWA 1C1AA 3U6FA 4H4MB 2YHAA 3HVWA 1L3VA 1IKVB 2F96A 3CIZA 5DQGA 3NE6A 2VG5A 1U47A 3G6XA 3KKSA 2OPPA 1SUQB 4B08A 1S6PB 3KLEB 4YR2A 4R0EA 3I5BA 4KHRA 1VSLA 3AA3A 3H5UA 4XIUA 1T03A 3LWLA 1VRUA 1TL3B 3AO1A 4M3TA 2J6SA 1IKYA 5CYQA 4NLQA 1RT5B 3DI6B 3AVAA 4AHTA 5KFIA 4Y34A 4Y2AA 1RAJA 1C0UB 4BDPA 4NLUA 3C6TB 4J2AA 1IH7A 3SNNA 5J2QB 5DG7A 2ZD1A 3H08A 4J9MA 4KAIA 1KTQA 2HHQA 3VQ6A 4IG3B 4CFBA 4E7IA 2XCPA 4WYWA 4K4UA 4M3YA 3KD5E 4DTXA 1D0EA 1RBUA 4I7FA 5CZ1A 3O3GA 4ELVA 3O3HA 3S3OA 4DQSA 4CF9A 5T14A 4WFXA 3LZIA 3JYTA 2KQ2A 3G6VA 4DFKA 1HQEA 4CGFA 4CJUA 3QEXA 3M9NB 3NBPA 3T1AA 1D8YA 2R2SA 4NYNA 1NJXA 3SV3A 3TANA 1JLEB 3TAGA 4U6PA 3RRHA 4MK7A 4ZVEA 3FFIA 3A2FA 1ZBUA 1RCHA 3ZSOA 4CHPA 4NLTA 2Z1JA 3RMAA 2OPRB 2G8UA 5L1LA 4BE2A 4Y1DA 3L2WA 3SUNA 3MEEB 5CY4A 4F3OA 1K6YA 2FVSA 2DFFA 3OLAA 5KFVA 2JC1A 4ID5A 1S9EB 4KHYA 1S48A 2IMWP 4FM2A 2XRIA 4H4OB 1TL1A 2IM0A 3QGGA 5KFQA 5KG3A 4B9TA 1CXUA 5F8GA 5HRRA 3NHGA 4XPEA 2C28A 4ZP8A 2NUBA 2JEGA 4ED0A 4I7FB 4ED7A 3V6HA 4GMJB 3V1OA 4NLPA 4NCBA 4JUZA 3UIQA 2VG6A 1Z26A 5KFGA 4ED8A 2IS3A 3ULDA 3NH1A 1HQEB 4CGDA 1KVAA 3CQ8A 4HUEA 1CZ9A 1X9MA 4RW8A 1HQUA 3SV4A 3RAXA 4CJLA 3MECB 3N6NA 2HNYA 4LH5A 4O3OA 4ICLB 4M42A 4NCAA 1UA0A 4YFUA 1RT1A 3L8BA 3HK2A 1S1UA 3G10A 1NJYA 1BL3A 1C1CB 4MIAA 4DLGA 2IBKA 1TKXA 3HM9A 5KT4A 3OL6A 1JL1A 1ASVA 2A1RA 3KK3A 4AHSA 1NKBA 4B9SA 4KE5A 3LANA 4C8MA 3BR9A 4M3RA 3V6KA 2PZSA 4F2SA 5KFUA 2R2RA 1BISA 3NDKA 3G0ZA 4NCGA 2QE5A 4RUAA 3LP2A 3CM5A 3H2LA 4FLUA 1L3SA 4X2BA 2D3UA 4CEQA 3SFGA 3T5LA 4CHQA 2ALZA 1QHTA 1YT3A 4RW8B 1HQUB 2QV6A 3V9WA 2RPIA 2WOMB 2G8IA 2HNYB 5D3GA 4J9PA 1X1PA 3O4NA 1LWEB 1RTJA 2UUTA 1RT2A 4RUCA 1HMVA 2BANB 3V9UA 2F8SA 3ZT0A 3CYMA 1MU2A 4LD0A 1I3AA 1C1BA 4OVLA 5DG8A 1TKXB 1SH0A 2D0BA 4CJQA 1OS5A 3SQ4A 3SCXA 5L1JA 3D45A 5HBMB 4PWDA 4DSFA 2V9WA 4Q43A 3IN5A 4TQRA 3DMJA 3BGRB 2BQ3A 1RTIB 1Y97A 1VSEA 4ZHRA 4QW9A 3OLBA 3AVHA 4CJ3A 3LDSA 4H8KA 4TSXA 3RBDA 2VG7A 3THVA 1T8EA 3CJ0A 2B6AA 3LPTA 1KHWA 3P1GA 3H98A 1GOCA 1ZBHA 3SPZA 1HYSA 3AVJA 4NLDA 4EZ6A 2DFEA 3PO4A 1TK8A 1WSFA 1IG9A 2QKBA 3WNEA 4EP5A 3ZT4A 4U7CA 4ED6A 3OYMA 4RW7A 1O1WA 3KOAA 3RMCA 2FJXA 4AHVA 1LW0B 3IGNA 3MR6A 4DU3A 4R5PA 3DYAB 2P5OA 1FK9A 1KLMA 2XHBA 2O4GA 2HMIA 4MFBA 2XCAA 3OY9A 1JLQA 3I0SB 3B6PA 3IS9A 1SH2A 4FCYA 3B6OA 4MK8A 5KGXA 3C94A 3LZJA 3DLHA 3DMJB 1K1QA 3LP3A 4J2BA 4TQSA 4Q0BB 4M3UA 3GQCA 4G3IA 3HPGA 3M8PA 2FBYA 4E1NA 3VQ8A 4EO8A 3ITHA 3SUOA 4O3PA 4LSLB 5EWGA 2B6AB 3EYZA 1HYSB 4W5OA 2WONA 4B9MA 3VQBA 5HRSA 4RW9B 4BWMA 4Q45A 4WFYA 2EC0A 1D1UA 1RT4A 4B9LA 2AX1A 2HNDB 3NF9A 2A1SA 3VA0A 1GX5A 1MMLA 3ZSZA 3OYIA 4F8RA 3HVTA 2XY8A 1JL2A 3HPHA 1S1TA 1RA6A 4E7LA 2W8LA 2E6LA 2WTFA 3GV5B 2J6UA 2ASJA 3U3YA 4CEAA 4DG1B 4IKFA 1U45A 1FK9B 3K5MA 1FXXA 1LWFA 3LAMA 3UQSA 1BIUA 3DRRB 1NK8A 1KSPA 3BSAA 3QNNA 3IS9B 3VQCA 4HUGA 3H59A 3PVXA 5T7BA 4MQ3A 4O5BA 3VQPA 4CEBA 2IC3A 1TGOA 4W5TA 1C0MA 2GUIA 4IH7A 2YV0X 4KKOA 3KLVA 2HW3A 3M8PB 4DS5A 2RF2A 1RT3B 4ELTA 3NAIA 2IGIA 3L2UA 4NYZA 4OKEA 3H5XA 4NLGA 1NK9A 1RILA 4DF4A 4OLBA 4BDYA 2VA2A 5F8MA 1S9GA 2OZMA 5C42A 1J5OA 3OVNA 4FS1A 3OYKA 1EXQA 4JV0A 4DTUA 1D5AA 4M3WA 4KFBA 2WONB 4YR3A 5I42A 2Z1HA 4DL7A 4FLVA 3BQ1A 1RT4B 2HHUA 4C8KA 5HLFB 4KHQA 1ZBFA 3Q8PB 1ZETA 4FJKA 1S1WB 4B3OB 5KT3A 1S1TB 4MIBA 3DRPA 4OGCA 3KLHB 3S9HA 4Q8EA 2JC0A 3NL0A 1JKHA 1JLGA 3V6JA 4DQIA 2E9RX 4DQPA 1TAQA 2IM3A 1DLOB 4LSNA 1B9FA 4CF2A 4CFDA 5JS1A 4EP4A 1JXLA 3AO3A 2XGPA 3IAYA 2E9TA 1S1XB 4KKOB 2GBZA 4O0JA 4FJ5A 3DM2A 4CJVA 2QK9A 3OYJA 2ATQA 2XI2A 5KG2A 1WN7A 1UWBB 4HUFA 3WNFA 4ZPDA 2HB5A 2I5JB 4FZYA 3NF8A 1HNIA 4RW4A 2X6NA 2WCXA 3I0RA 4DTOA 3BQ0A 4ECWA 4FJ9A 2X78A 4O44A 1XR6A 1XC9A 3MXMA 3DLRA 3CFOA 4DMNA 2HHVA 4B9NA 1EETA 2W9CA 5J2NB 2DFHA 1VSMA 2YNIA 1RDDA 4BACA 5FDLB 4KTQA 4TXSA 4IR9A 2JLEA 3N6LA 1C6VA 1JLGB 5DQIA 3K5OA 3NMAA 2BQUA 4F4ZA 3PW2A 4Z4CA 4CHZA 4L8RB 2R8GA 3L2RA 1BQNA 3MR5A 2OPSB 4M94A 1S0MA 1RT6A 4URSA 3G6YA 4KSEB 1HPZB 3LP0B 3IG1B 1TV6A 4Y1CA 3V9ZA 2DY4A 3AVGA 1RDCA 2PY5A 3OSPA 3I0RB 4XO0A 3KLFA 4URQU 4EZ9A 2IAJA 2OH2A 3DLEB 3VQQA 4E7JA 2YNHA 3MR2A 1EETB 5F8HA 2W9CB 4K4ZA 2GC8A 5L1KA 3PY8A 3L3VA 4CK3A 4URGA 1KFDA 1S0NA 3QIOA 3H40A 3CVKA 1VRTB 3TR8A 2YKNA 5F8IA 3NAEA 3PHEA 1KFSA 4RW6B 2ZQBA 3OYLA 3ICLA 1RYSA 2UVRA 4Z0UA 4ZTFA 3KTQA 1RBRA 5CYMA 2V4RA 3N6MA 4KHSA 3DOLB 4WZMA 1BQNB 3V81B 4WE1A 1I6JA 1ZYQA 1RTDB 2D41A 2ETJA 3RB4A 2FVRA 4KREA 1IKWB 4QW8A 4IQXA 2P1JA 4DQRA 3TQ1A 3MFIA 1QAJA 1L3TA 4QCLA 3NGZA 4CK2A 4FJNA 1RT7A 4ECRA 2VG5B 1NNDA 3NH2A 2Y1JA 1Q9YA 2OPPB 4YR0A 3V1QA 1R0AA 5EWFA 4DTPA 3KLFB 4NLRA 4QAGA 3SI8A 4GC6A 5KI6A 3K59A 1T03B 3MEGA 1VRUB 2C2DA 4OLAA 1D9FA 2YNHB 1IKYB 5CYQB 3DLKA 2YKMA 2X6SA 3PW7A 4AHCA 2Z1GA 3RR8A 4J9NA 2P51A 2G8WA 3ZT3A 4DEZA 2ZD1B 1QUVA 1TKZA 4CEZA 5J2MA 1RA7A 4ED1A 1YTUA 3H5SA 3SQ1A 4IH5A 3CDUA 4EYIB 3PJXA 1Z25A 4BDZA 4I9QA 5KG7A 5KT7A 4Z4EA 1LW2A 5CYMB 4KRFA 1HYZA 1VSFA 1EP4A 4ID1A 1NK0A 4JS4A 5KFDA 1JLFA 3JYTB 3TAMA 4O55A 1J53A 3K5NA 1KHVA 3HKWA 4J2EA 3NAHA 3NBPB 4FM0A 1NK4A 2GIQA 3C6UA 1DTTA 3LP1A 3TAQA 4DL6A 5C25A 3DLGA 1Z4UA 3FFIB 4K4WA 4PQUA 3L2QA 3MEGB 5KFTA 3CM6A 3CJ3A 4ZPCA 4F4WA 2XY7A 1XR7A 2G8FA 3ZSQA 1U04A 4K4XA 3OSNA 5KGWA 2AGPA 3JSMA 4ID5B 3OJSA 4EBCA 1HARA 2YNGA 4E0DA 4CJ5A 2G8KA 1TL1B 5J2MB 1QSYA 1S97A 3M8QA 3GYNA 4CFAA 3D0PA 1J9AA 2W42A 4ZPAA 2HVIA 4IFYA 4LH4A 3TVKA 4NLWA 4LQ3A 1QSLA 2AQ4A 3MXJA 1ITGA 3TABA 1EP4B 1RBSA 3K58A 3CFRA 4FJ8A 5KG0A 2VG6B 1JLFB 2BRLA 1TQLA 1HNVA 4O3SA 1LWCA 3CG7A 2C22A 1BIZA 2XWYA 3HPOA 4E7HA 3C6UB 2UVWA 4ECZA 3NKYA 1BHLA 3H5YA 3TAFA 4WXWA 3M9OB 4HYKA 4IRDA 1W9HA 3RB3A 3KLIA 4PQUB 2G8HA 1SL0A 4Q44A 4FLWA 3DRSA 1RT1B 1EX4A 4WXOA 4E3SA 3KHGA 1W25A 3GIMA 3SZ2A 1FKOA 4Z4HA 1S1UB 3K2PA 1WSJA 5KFRA 3RR7A 5SWMA 4KHWA 3ZSVA 3OYGA 3ISNC 2QXFA 3SYZA 4FLYA 1BCOA 3ZT2A 4F4KA 3KK3B 3QGIA 1XHXA 1UA1A 4KO0A 3GILA 1TKTA 3M8QB 4DTJA 4KI6A 5F8NA 4QOZB 4IFYB 1L5UA 4K8ZA 4FJGA 5CZ2A 3EPIA 4PUOA 4W5QA 1NHVA 3SQ0A 3NGIA 3AVMA 3CDEA 4NCGB 3CJ5A 4ECQA 4QWAA 4J9LA 3LP2B 3NH0A 1RDAA 4JS5A 4Z4IA 3ZCMA 2PYJA 2ITGA 3FRZA 3QIPA 3AO2A 4I9LA 1WNEA 4NRTA 4FK2A 4R8UA 3OL9A 5F8JA 3IGVA 5D3GB 2AX0A 2OPQA 1VK0A 3D5MA 3OYDA 1RTJB 4FYDA 1X9WA 1RT2B 1XR5A 4CJKA 2O5DA 2AU0A 4FW1A 1HMVB 5KFFA 1VSIA 2XC9A 1FKOB 4CJPA 1WSHA 4IRCA 1SKRA 4ZVGA 1QS4A 1MU2B 5JUMA 4B8CA 1C1BB 3TAEA 4FJ7A 5KG5A 4KV8A 3TARA 4PWDB 1N56A 2IDOA 1RYRA 1C0TA 4IBNA 2ZE2A 4O3NA 4FZXC 4Z4FA 4RNHA 4O3RA 4ZHRB 1N4LA 3OYFA 3OHBA 4NLXA 3SQ2A 4M41A 4MKBA 4FLTA 2VG7B 3Q8SB 3O3FA 3KD1E 3PZPA 3AVFA 3GIKA 4O4RA 3BDPA 4OPKA 3F73A 3LPUA 4KHNA 2JGUA 4IG0A 4DFJA 4F2RA 2EX3A 4KB7A 1WSEA 2RKIA 4QPXA 3FQLA 4R8UB 4RW7B 4TY9A 4OL8A 4RZRA 1KLNA 4KAZA 4JV1A 4DSLA 3K5LA 2R8HA 4ECUA 4Q5VA 4R5PB 3OYAA 4DTNA 3QO9A 3MTKA 3QZ7A 5KFPA 3QLHA 1JXEA 1KLMB 1REVA 1S1VA 2HMIB 4MFBB 5HP1A 4CGGA 1JLQB 1A5XA 3ALYA 4KV8B 3T5JA 4CJSA 3WNHA 2PYLA 1XHZA 3SFUA 3KHLA 4IOBA 1SV5A 1VSKA 4DU4A 3PR5B 3OJUA 2OYQA 5FRMA 3V6DA 3QEWA 5KFWA 1WLJA 3PX0A 4UQGA 4HHTA 2FBTA 3ITHB 4M3XA 4OJRA 3KNAA 5KFHA 1CZBA 1KVBA 1HJRA 5HROA 4TLRA 4FXDA 3VQ5A 3AVKA 4IR1A 1WSIA 4JLHA 5KFLA 4N5SA 4CF8A 1NOZA 4MH8A 3TWHA 4E19A 2W7PA 2YNFA 4IKAA 3UR0A 1BQMA 1ZTTA 3OS2A 5KTQA 3NCIA 4I2QA 4AHRA 4FVMA 4N47A 1CLQA 2FVCA 3HVTB 4DSKA 4FK4A 5C24A 4CGJA 4O4GA 4OGEA 3MEDA 4NLOA 1SL2A 3F9KA 1CSJA 2W9BA 3NF6A 3QEVA 1NK7A 3QLHB 5KFAA 4Y2CA 1LWFB 1RTHA 1T3NA 1S1VB 1YVUA 4OPJA 3BQ2A 3OS1A 3DLBA 2IM2A 3QESA 4K4YA 3P83D 1SL1A 3E01A 4J9KA 4G1QA 2IC3B 3ZSYA 3SPYA 3KIOA 1ASWA 3I8DA 4FJHA 5F9LA 4RG8A 1SV5B 2BE2A 4GW6A 4FJIA 4TY8A 2RF2B 4DF8A 3HVAA 1QSSA 4Y3CA 3AO4A 4DL4A 1T05A 4E89A 3CJ4A 5KFSA 4YMEA 4FJJA 2DTUA 2R8KA 2OZSA 4ZP9A 3AVIA 4HVJA 2DPIA 5HROB 5J1EA 3VQEA 2ASDA 1S9GB 5K14A 5C42B 1J5OB 2FLNA 1WAJA 2XI3A 1DTQA 3CWJA 3AVCA 4KFBB 4F50A 5I42B 3KJVA 2YHBA 2BGGA 2YNFB 4F3TA 4NLVA 2UVVA 2B5JA 2BRKA 4C8NA 1ZBLA 4I2QB 1IKVA 1VSHA 2D5RA 3FSIA 2FBVA 3T5KA 1W0HA 1KVCA 3Q8RB 1S6PA 3KLEA 3DRPB 2W8KA 3ASMA 5KFKA 4O4GB 5SZTA 3MEDB 4QWEA 1HYVA 4ED2A 1JKHB 2B43A 3HO1A 3RB0A 1RTHB 5DG9A 4FK0A 1TL3A 1SKSA 4M3ZA 1RT5A 2R8IA 3GV7B 3KMSA 3DI6A 4DTSA 4N41A 4DL2A 4KTWA 3KLGA 4ELUA 4LSNB 2J6TA 5EUHA 3VQ4A 3S3NA 5DLGA 4IFVA 4AHUA 2FVPA 3C6TA 2JEIA 2BE2B 5J2QA 3IRXA 1L3UA 3DM2B 4DL3A 2XY6A 1Q9XA 3RAQA 4IG3A 3V4IA 4C8LA 2R7YA 2AGQA 1S0OA 1NOYA 1HNIB 4RW4B 3FQKA 4DSJA 3BJYA 4DU1A 3P5JA 5JS2A 2IJNA 4TN2A 3BSOA 2B5JB 4O44B 2ILYA 4AH9A 3QIDA 2AGOA 3PW0A 4FM1A 3KMQA 2YNIB 5KFOA 1JLEA 4N56A 4KHUA 3RTVA 5KT6A 1SH3A 3V9XA 2KW4A 4HKQA 5L1IA 3H4DA 4ZPBA 3H4BA 4NRUA 3V1RA 4FS2A 2ILZA 1S6QA 2OPRA 1S9FA 3MEEA 3OYEA 2ASLA 3KLGB 4PA1A 5KRSA 1A5VA 2W7OA 1UOCA 4IFVB 1S9EA 5KFBA 3NF7A 2FBXA 3IRXB 1JIHA 1RT6B 4H4OA 4J9QA 1QTMA 4FJLA 3CFPA 4FBTA 2FLLA 1JLBA 3V4IB 3QNOA 4OKJA 1TV6B 3BREA 1TK0A 3V9SA 4Q8FA 4KI4A 1BI4A 3BSNA 4J9OA 4ECYA 5E41A 5KFCA 4CJEA 2HHWA 1JLAA 4HCCA 3PUFA 2WHOA 4XPCA 2IAJB 4CJ4A 2F8EX 3RRGA 2HNZA 3CDWA 1NHUA 3BSCA 4CEOA 4FZZA 5FROA 3PW5A 1TAUA 1QE1A 3MECA 1G15A 4ZMMA 1XWLA 4I2PA 5L9XA 3EPGA 2Y1IA 4ICLA 4DL5A 4K4VA 2YKNB 4KPYA 5HRPA 3AVNA 4RNMA 1S6QB 3KK2A 2HAIA 4CEDA 2ZKUA 4BE1A 2FJVA 2HHSA 1QQCA 4CCHA 1C1CA 4CF1A 3OYCA 2UVUA 4EBDA 3I5CA 4WE1B 1RNHA 3OYNA 4OKKA 4KB1A 1XI1A 5J2PA 2D0CA 5KRTA 5KFNA 2DPJA 1JLBB 2IJFA 1TVRA 3ZSXA 1NJZA 1RBTA 1RT7B 2IA6A 3UPFA 4CJFA 2XGQA 1BI4B 4CJRA 4DTMA 1T94A 1R0AB 1JLAB 1S49A 4RNNA 1B92A 3HT3A 4CHYA 1GOBA 2VWJA 4ZVFA 1U09A 2R2UA 4HTUA 2JEJA 2HNZB 1F21A 1LAWA 4C8OA 3QGHA 1Q8IA 3L2VA 2KFNA 4CK1A 3DLKB 3MF5A 2YKMB 3NGDA 3SI6A 2HHTA 1QE1B 4EO6A 4CE9A 1ZTWA 2WOMA 3ISND 2JEFA 3KK1A 1YVFA 4DSIA 4QWCA 3VN5A 5HRNA 4I2PB 1QAIA 3OHAA 3HP6A 1TKZB 4DLEA 4JRPA 3HXMA 1LWEA 3E51A 3GIIA 3PJWA 1IKXA 2WRMA 3KK2B 3OS0A 4K4SA 2BANA 5KFZA 3VQSA 3EY1A 1T7PA 1LW2B 3ZSRA 2FJWA 5DGBA 2BDPA 3MR3A 4NLSA 2VWKA 5DQHA 4K8XA 1S10A 2ATLA 5HBMA 3QETA 2FLPA 3TAMB 5J2PB 1S4FA 3BGRA 1RTIA 2IOCA 3KHRA 4ZP7A 3QYYA 4IDKA 4ECXA 3EZ5A 1TVRB 4CHNA 1DTTB 5JXSA 2C2RA 3LP1B 1I39A 5C25B 3DLGB 1A5WA 2C2EA 3QEPA 4LY7A 5FRNA 4DFPA 3RMBA 2G8VA 2D0AA 3JSMB 2LSNA 1WSGA 5KG4A 2RDIA 3KK1B 4DWIA 4KHMA 2BR0A 2YNGB 1S5JA 4GVMA 1RDBA 1LW0A 1JX4A 1IKXB 1B9DA 3DYAA 3WNGA 4YQWA 3T3FA 1D9DA 4GC7A 5KG6A 3OL8A 3ZSWA 3GV8B 3PO5A 5EDWA 4Z4GA 3L3UA 2WK4A 3VQ9A 3I0SA 2OA8A 1FKPA 3HHKA 2KZZA 1NK6A 3HP9A 1EKEA 4DFMA 4CHOA 1WNSA 2UUWA 3DDKA 4Q0BA 3RWUA 5F8LA 1HNVB 1LWCB 4TYBA 1VSJA 1J54A 4K4TA 4IDKB 4MKAA 4B9UA 2O4IA 2QKKA 4CGIA 4RNFA 3S3MA 3Q8QB 3HYFA 3I5AA 4ED3A 5KFEA 2V0NA 4LSLA 3KLIB 3FDSA 1UAXA 2AJQA 1JLCA 1BCMA 3DRSB 4FW2A 3RBEA 3PW4A 4RW9A 2Z1IA 2GV9A 4N76A 1NKCA 4RNOA 4AILC 4TYAA 2E6MA 2HNDA 3D28A 3AA5X 4ZTJA 3HL8A 4CGHA 2R8JA 1GOAA 2KTQA 4KO0B 4ECSA 2CJQA 3OYHA 1TKTB 4DSEA 2EHGA 3TI0A 2W9AA 5KT5A 4F4YA 4DG1A 3T19A 3CJ2A 2GIRA 3RMDA 3DRRA 1TP7A 3PV8A 4PUOB 1U4BA 3UDLA 1FKPB 2VA3A 1BGXT 2WB4A 3M8SA 3OYBA 4CJWA 1LAVA 4DS4A 5C5JA 3HVRA 4J9SA 2I1RA 5KFJA 1RT3A 4ZP6A 1K1SA 3AVBA 4E1MA 3AA2A 1SKWA 2FVQA 3QIPB 1X9SA 4HCBA 2CKWA 1N5YA 3QZ8A 1JLCB 2OPQB 3AA4A 2FC0A 2E9ZA 4M45A 1LV5A 4CIEA 3LALA 4IRKA 2IM1A 5EU7A 5F9NA 5HLFA 1S1WA 4B3OA 5KFMA 2D3ZA 3MFHA 1IM4A 1RBVA 3AV9A 1C0TB 3MAQA 5I3UA 2F8TA 3PX6A 2ZE2B 3KLHA 3LWMA 4E7KA 4IH6A 3VA3A 1YTAA 3PR4A 4O3QA 4KBIA 1KCFA 4YNQA 1N6QA 1GX6A 5DGAA 4ZVHA 3DOKA 5KFXA 4EBEA 3AO5A 1DLOA 3QINA 3U3GA 3RB6A 5EWEA 3QERA 4B8AB 4QWDA 3QEIA 4WFZA 1S1XA 2KZMA 4W5RA 4IG0B 2R2TA 3C95A 2E4LA 2RKIB 1UWBA 5KG1A 4KB0A 1N5YB 5KFYA 1ZBIA 3O4QA 5DK5A 4CEFA 2I5JA 3HSTB 1U49A 1IO2A 1VSDA 4CJTA 3NGYA 4CESA 3LAKA 3QO9B 4WYLA 1KRPA 4WZQA 2KFZA 4CECA 1TKDA 5DMRA 1TK5A 1REVB 4FJXA 4BWJA 5HP1B 1N48A 4B9VA 5J2NA 4M95A 3EZUA 1NKEA 1NK5A 5I3UB 2HWHA 5FDLA 2HWIA 2RN2A 4DTRA 1NJWA 4CFCA 4J2DA 3V6DB 4NLYA 4CEEA 2P5GA 1N6QB 4KTZA 4CF0A 2XO7A 3MXIA 4H54A 3DOKB 1CXQA 4RU9A 4EYHB 2OPSA 1RDRA 4LQ9A 2BQRA 2X74A 4CIGA 3OL7A 2B4JA 1HRHA 4ECVA 1U48A 3KKRA 1BQMB 4NYFA 4H4MA 1HPZA 3LP0A 2AWZA 5KT2A 3IG1A 4CIFA 3TAPA 4K50A 2D7SA 4YP3A 1ASUA 4BE0A 3GIJA 1WAFA 2V4QA 5DLFA 1SUQA 4FLXA 5C24B 3CO9A 4FBUA 3VQ7A 3VQAA 2W9BB 2HHXA 4JRQA 3SUPA 2RDJA 3DLEA 3ZT1A 3K57A 2Q3SA 3VQDA 4MK9A 3M9MB 3E01B 4CERA 4G1QB 4ECTA 1C0UA 3NFAA 4O0IA
chains in the Genus database with same CATH superfamily
2CPZA 5GIOA 2DT9A 4U96A 1WHXA 4Y2KA 3ZNUA 4RW6A 3G96A 3VOVA 3MOJB 3HCXA 2W2MP 4NZ0A 4FJMA 1T95A 4JV2A 1U8WA 1BWEA 3VEOA 2O8EB 3UE5A 3Q8YA 4M5DA 4JK9A 3NLCA 3PXGa 2NRRA 2H4WB 3CIZA 5DQGA 4PL7A 2OD4A 3NE6A 3IWNC 4I6MA 4B08A 1S6PB 2BABA 3BBBA 3D6FB 2CNOB 2XZWA 5JICA 3AA3A 4KHRA 1K8AT 2BJDA 2V34A 3LWLA 1VRUA 3TVZA 3UR3C 4DV2F 2J6SA 1NDPA 1IKYA 1RBAA 3SQGA 3HRGA 4Y34A 1NSKL 1RAJA 2GVZB 1JCGA 1C0UB 3JSYA 4BDPA 1X4HA 3C6TB 4J2AA 2XS2A 2OFGX 5DG7A 2ZD1A 3H08A 4A8KA 1KTQA 3DJCA 4L75A 4DB3A 3GJQB 5F0XA 3KD5E 1D0EA 2W1BA 4ZVSB 4F3MA 3D1OA 3O3HA 3S3OA 3HHLC 3L7OA 2VBWA 3JYTA 2G4BA 3G6VA 1RACB 1ZPVA 1LQ9A 1U7LA 4CGFA 4CJUA 3M9NB 3T1AA 3DRXA 3N28A 3WBZA 5E5NA 3TANA 3SBTA 4NMXA 1I94F 4U6PA 3RRHA 3MUTP 1G4CA 1JCFA 5D6GA 2FPHX 2FHOB 3ZSOA 4LT6A 4CHPA 2Z1JA 1KC8O 1S59A 3K8WA 4Y1DA 3MEEB 3KDNA 4HR2A 2DFFA 3FEZA 4DV1K 2JC1A 1S48A 7FDRA 4H4OB 1TL1A 1RJJA 2YHXA 4BRCA 4JI6F 1NSAA 4FVCA 5KG3A 5KFQA 1CXUA 4YOVA 3NHGA 4OJGA 3NS5A 4ZP8A 1EHWA 2JEGA 5LMUJ 1NGJA 3V6HA 2ZUGA 2FGOA 1CQNA 3CCQS 1Z26A 4P71A 1U02A 2YKAA 1HBOA 2EBGA 2JL9A 4JI4F 3NH1A 2KM8C 2A3JA 1NBWA 1KVAA 3CQ8A 4RW8A 1HQUA 3G71S 3BEXA 1WHYA 3PSIA 5D4NA 2HNYA 4JI3F 3LM9A 2AYMA 2ZJPL 4OX9K 3M8ZA 3ULEB 3K5PA 4YFUA 2KXFA 1EQ0A 3H2UB 3HK2A 3JSRA 1BL3A 1P9YA 4MIAA 3ID8A 4LF7J 1HFEL 2A1RA 5GAGP 1YBAA 4BR4A 4KE5A 4P2SA 3WQPA 3HHLA 4JKDA 4K42A 4A8QA 2O67A 3QT8A 2PZSA 2WZ1A 4U95A 3RU0A 1ZA2B 2KH9A 4LF9K 5FPMA 2ZBPA 4RUAA 3LP2A 1YK9A 2MKSA 2A18A 4RW8B 1HQUB 2GMLA 3NXZA 3P8BB 2WOMB 2HNYB 4DZ6A 4EK2A 4ZN3A 4ZCIA 1U0SA 1FF2A 3QATA 1T9WA 2BANB 3JAMU 4FYYB 4JP8A 3TUZC 2B9WA 3BF4A 2AJ4A 4CJQA 3A3PB 5JVGQ 5L1JA 3EGZA 3D45A 3SEOA 4HL9A 4Q2LA 2EC2A 2F65A 2QIFA 2DHHA 2AJFE 3IN5A 3D2EB 3DMJA 1AT1B 1XERA 5AQFA 1BC6A 5GAGU 1VSEA 6AT1B 4ZHRA 3PIPL 4CJ3A 4H8KA 3KWGA 2UXDF 3THVA 5B0FA 3QFWA 3CJ0A 1VQSA 3IXQA 1VBYA 3P1GA 4C48A 3K89A 2RUGA 5ETLA 3CJ1A 2QKBA 2B4UA 3SMSA 2DNNA 4ED6A 1ZA1B 3CHWA 3L4QA 2C3OA 4XDCA 3HF5A 4GVEA 3TJ9A 4TVAB 3IGNA 2QXLA 2MQLA 3MUVP 1FXDA 4CM0A 2P5OA 3D2FB 1HL6A 2GTDA 3GP9A 1FK9A 3FBEA 2JRSA 4ILRA 3UI3A 5BRDA 4NO7A 1KLMA 1SJRA 2XHBA 3U4LA 4CI0B 4NMLA 3OY9A 4FCYA 3I0SB 1SH2A 1HD0A 2YWKA 3B6OA 4FP9A 4MK8A 2AEMA 3LZJA 3C94A 4DR5F 3DMJB 3LP3A 2C3MA 2J4RA 4F7VA 3HPGA 4E1NA 3JTNA 2DRBA 5A8WB 3GE1A 1OMSA 3GOIA 3MPVA 2AP6A 4EUVA 5AE1A 1RGVA 4DN0A 4LSLB 5EWGA 4H03B 2BJ7A 3ZZOA 3RUBL 2ABYA 3CMEN 4L74A 2GO8A 2IVFB 4WFNL 2MQMA 3VQBA 4CLSA 2EC0A 1XK8A 2HVDA 4OO1J 1LNQA 3VA0A 1MMLA 3OYIA 2CQHA 1HBMA 1RA6A 4E7LA 3Q83A 3GV5B 2XO6A 4CEAA 4BCAA 2UUCK 1FK9B 3K5MA 4HDHA 1BIUA 3DRRB 1NK8A 2JFDA 4DV7J 5EX5A 2C1EB 1U6FA 2W2NP 3PVXA 4MQ3A 3VQPA 2FSKA 4CEBA 2XZDB 3Q7BA 2YV0X 1U2RA 4N8NA 3C15B 2RF2A 4ELTA 3CCTA 3NAIA 3L2UA 3ADAC 2PAVA 4ILJA 2OUGA 5F8MA 3OYKA 2ZH7A 1TU0B 3CETA 3BQ1A 3Q2TC 4EI2A 1U1LA 3CCMS 5HLFB 3Q8PB 4B3OB 1NJIO 1IBKK 5KT3A 1B0TA 1RWUA 3DRPA 2ZOMA 4CD3A 3KNGA 3MPYA 2CDQA 1JKHA 3RGIA 3V6JA 4DQIA 4OI2A 1H6KX 1TAQA 2V8DA 2ATCB 1B9FA 4CF2A 2K8GA 2PFFB 5GAGI 1JXLA 3AO3A 4OPHA 2E5JA 2CQBA 3IAYA 1S1XB 4O0JA 1WELA 3DM2A 2AYGA 5BR8J 5M1QA 2PT0A 3OYJA 3D3CJ 1ATRA 1UWBB 3SXLA 4FF2A 2Y3YA 2WB1D 3B4DA 2PA3A 2DO4A 1FRLA 3MCSA 3QBXA 3I0RA 2CPIA 4DTOA 1IG8A 3BQ0A 4ECWA 4MAKA 1XC9A 3OVSA 1P6TA 4A8WA 3P39A 2HHVA 4B9NA 2V94A 2W9CA 1FNXH 4A4JA 2UU9K 4YY3J 1WOOA 5FDLB 4KTQA 2HKEA 4TXSA 4MLHA 5AQYA 2JLEA 5BR9A 3QPIA 3ENQA 4WJBA 1CULA 2CWKA 4Z4CA 4DR1K 2DR8A 2P9SB 4DR3K 1G6BA 3L2RA 4Z7YA 3EDQB 1CPZA 1E6VA 1RHKB 3ILOA 4JI7J 2OPSB 2CQ0A 4URSA 3TWZA 1HPZB 4K5RA 3MR7A 1P1TA 2F4VF 4KH0B 3GBTA 3IG1B 2DBBA 1TV6A 4Y1CA 1FXRA 3G8SA 1NNEA 2KFYA 3AVGA 4NXMK 1CZAN 3I0RB 2A6AA 1YJ9S 4PG7A 4WP3A 1X3MA 3VQQA 3MN5A 3O08A 2HRTA 4F9OA 2W9CB 1WC3A 1TZ0A 4DCPB 2QWRA 3PY8A 4A61A 4GNIA 1WI8A 4CZIA 5LJWA 2ACYA 5B7WA 2RD5C 4FWNA 1ZBTA 5F8IA 1KFSA 3B6BA 2F7TA 5LY3A 2VBXA 1RYSA 1RBRA 2YCHA 4B1XB 2V4RA 4HH1A 2VF3A 4JI8K 4WE1A 3FJ2A 4OHWA 2KJWA 2ETJA 2X7IA 3RB4A 3M8WA 1QAJA 5DDQC 4EGLA 3UNGC 4CK2A 1R8HA 5IT4A 4UW2A 1RT7A 3HFZB 1NNDA 1RSCA 1AXQA 2Y1JA 4NB4A 4XH4A 4GVBA 1R0AA 5EWFA 4Y2IA 4LRCA 2PSZA 4DTPA 3PLAA 3BDEA 1OH5A 3KVGA 3VGVA 4QAGA 3CCEN 4GC6A 1XMQF 3AJ1A 3ILLA 1DBDA 1HNXJ 4OLAA 2PA8D 1D9FA 2MPUA 3GONA 1S5ZA 2ZOGA 4YDUC 4CBXA 2LU1A 2J76E 4DXLA 2Z1GA 1FWPA 3M4XA 3ZZPA 2MZTA 4A8XA 5T7LA 4KGMA 4K0KF 2P51A 3ZT3A 1VQ7S 1QUVA 1TKZA 4CEZA 3M6UA 4KIAA 4ED1A 3SQ1A 2EBEA 3TR5A 3PJXA 5KG7A 3QICA 4P7TA 1KAZA 3U02A 4RL1A 3PCOB 4ID1A 2E1RA 4DR2F 2PI4A 2HK2A 4JS4A 2SXLA 4USVA 2H5IB 4FWRA 2ZDPA 3DGPB 3MTJA 3K5NA 1KHVA 2KXHA 1UWAA 3NBPB 3HSJA 4FM0A 1X0FA 4Y28C 1DTTA 1HD1A 2I2YA 5ETSA 2BE7D 4I4BA 2XNQA 1YI2N 3JB9k 4A59A 4PQUA 1F3VA 2BUNA 1Q4RA 3FRYA 3NRBA 3PIPQ 1H3DA 4ZPCA 2XMKA 3N0VA 1DEJA 1KAXA 1VQPS 3FSYA 1W7WA 2KVIA 1F6TA 1VBZA 2BJEA 4JI1F 4KRWA 1HARA 2YNGA 1N5TA 2YKQA 2M3DA 4O0NA 3E66A 2IYIA 4N7TA 4CFAA 2MZ1A 4ZPAA 4OYPA 2RRNA 4NLWA 1QSLA 4LQ3A 1YRUA 3I56N 3DGVA 3CFRA 2G2ZA 4FJ8A 2FZGB 5KG0A 3VZIA 2VG6B 1YJWS 1AB8A 4NZ6A 2QLXA 3PNIA 1RHQB 4O3SA 1U6ZA 3SCJE 2UVWA 4ECZA 3FK4A 3NKYA 1VQ4S 4JV5J 2DR6A 2HVZA 4WXWA 3ZZUA 4DR4K 4L3KA 3MOZA 1OY9A 4IRDA 2KDOA 4F67A 3RB3A 1WF2A 4PQUB 1JQGA 3AAPA 2HLUA 4CBWA 2MQ8A 2E5IA 3SZ2A 2KU7A 4KHWA 4KGKA 4M7XA 5HQLA 4FLYA 1BCOA 3KK3B 4KO0A 1TKTA 4EIAA 4WFNQ 1N52B 1FRKA 3UKRA 1B7YB 2MY8A 2CQ1A 2BOAA 4AF1A 5BRFA 1L5UA 3DU5A 3D68A 4FJGA 5CAAA 4LF6J 4UY8O 2BXJA 4OQJA 1ZM9A 3Q0AA 1NGHA 5B0DA 1RCXB 2LEAA 4DR6K 4JS5A 2LU2A 4Z4IA 4CLPA 2LEBA 4JKEA 5E3CA 3ATVA 3QIPA 2NYIA 1CG2A 3MCNA 4R8UA 4A2BA 2Q0RA 3OL9A 2HFZA 3IGVA 2PI5A 1RTJB 1X9WA 2DGXA 2E7WA 4CJPA 1GMVA 1NGBA 3LTOA 4IRCA 2Q2RA 4LF4J 5IFMA 4C4WA 3G87A 2ASPA 1C1BB 4G65A 5KG5A 3PEHA 2IRXA 4WWSA 2CZ9A 4PPDA 4PWDB 2IDEA 3FNNA 2VPXB 2GIFA 1HLUA 3G4SS 2ZE2A 1QUPA 3C8YA 2FJBB 4M5GA 5K8MA 2F63A 4O3RA 4DV1F 4J90A 3OHBA 3A8IA 1WKLA 2WW8A 4M41A 2AA4A 3QAEA 2VG7B 3O3FA 2E1ZA 4ZKAA 3U8XA 2JSXA 3J7ZT 4XH1A 1RAIB 4I1TA 3SDEB 1S7HA 3GR1A 2QA4G 3DFEA 1I1GA 3MM6A 4QPXA 4R8UB 3CF5L 4OL8A 1KLNA 1B64A 4KAZA 3GYGA 2XYGB 4JV1A 3K5LA 1Y7PA 5HMYA 2OO4A 4Q5VA 3OYAA 4AD6A 4WPAA 1UEUA 4OX9F 3ZETA 1REVA 1S1VA 2HMIB 1SS6A 4MFBB 5HP1A 4CGGA 2KL8A 1JLQB 3TYTA 4BG9A 3ALYA 2D0PA 3GPAA 2XLJA 2PYLA 2BOPA 5KQDA 3HSZA 4OYIA 1VSKA 4DU4A 2FSJA 3W3DA 2Q97A 3FGUA 4UQGA 3DOMA 4HHTA 2FBTA 4PRFA 3KKFA 4HT7A 5I3QA 2E1YA 1CZBA 2AIRB 5BN9A 3NEKA 3QBCA 1NMEB 4HACA 4FXDA 3RBXA 1GLFO 2M0GB 4USHA 4JLHA 5KFLA 2X1AA 4TU9A 2YHYA 4LF9F 1BQMA 3OS2A 4YUDA 3D0HE 5KTQA 4I2QA 4AHRA 3OTOK 4RX6A 4N47A 2FVCA 2MXYA 2CQ3A 1Q81O 3M2VB 4O4GA 1SL2A 4NLOA 3HOSA 5A8KB 1RTHA 4JI2J 3ZETB 1S1VB 3MEKA 2LYVA 3MAHA 3DLBA 3QESA 2DY9A 2O8CA 1C0GA 4J9KA 3ZSYA 3SPYA 1Y00A 3KIOA 5F9LA 4GW6A 1K0TA 4TY8A 4A47A 3HVAA 4Y3CA 3AO4A 1T05A 3IWXA 4E89A 2OZSA 3UCGA 3O1LA 4QYZJ 3CCSN 3NOGA 1JNRB 3M2UA 1S9GB 5K14A 4HACB 5C42B 1J5OB 2FLNA 2GELA 2XI3A 1DTQA 2BGGA 3MDFA 1EAYC 1VYAA 4LF7K 2B5JA 1ZBLA 4V19S 2O8FB 4I2QB 1VSHA 2D5RA 4DV0K 4USIA 3EUNA 3T5KA 1KVCA 2DHXA 5AQSA 4O4GB 4OJ3A 3MDQA 3M6XA 2ASMA 1KD1T 1RTHB 3BKUA 3GJSB 4FK0A 3I31A 2JJ4D 3GLJA 4M3ZA 3J7AN 3GV7B 4PAAA 3DI6A 3EMTA 1HWLA 5DLGA 3W62A 3ZX2A 2R7XA 3H3OB 4RLEA 1NH8A 1Q9XA 1ULRA 2YH1A 4HEA9 1SBRA 3RAQA 3R6LB 1H1VA 5K8PA 4B1UB 2WBRA 2NRHA 2ZC4A 1S0OA 1NOYA 1J5EK 3FQKA 2VDHA 4IWVA 4DUZK 5IT9U 3J81U 4EFHA 1FFGB 3ZLJA 5JS2A 2IJNA 1GXLA 4FWQA 2B5JB 2BW2A 2I9SA 1XNQJ 3CIPA 5AQGA 3KMQA 2YNIB 2QWPA 1JLEA 4N56A 4MYTA 1T9TA 3Q22A 1N36J 1P9QC 1OY8A 3FC9A 3H4BA 1RGIA 5HATA 1N34J 5GADP 2QYCA 4C0OC 1UVLA 3JXOA 5C7PA 4M63C 1BO5O 4I68A 3DXKA 1A5VA 4BRFA 1WC5A 4X4PA 3A12A 3BY5A 2UUCF 1S9EA 3KUHA 5KFBA 3E1YA 3AFGA 1QTMA 2A3ZA 3GJTB 4FBTA 2N4CA 1JLBA 3HZ6A 4CI6A 5ETKA 4HI2A 4CH1A 3QNOA 4OKJA 4Q8FA 4BRMA 3WDOA 3BSNA 4ECYA 3PSFA 5KFCA 2CZVC 5M1NA 3HSCA 3EVOA 5M2UA 2F8EX 1FX2A 3VALA 2JWLA 3HJVA 5ADXA 1DRZA 3BSCA 4CEOA 5FROA 1GK8A 3CCUN 2AD9A 4LRDA 3O9QA 3SAHA 3CE8A 4I2PA 3LO3A 1SJQA 1F2HA 4AE5A 3CJAA 3EX7B 1PILA 2ZBQA 4RNMA 3KK2A 1IBKF 3NNAA 3LM2A 2JDJA 2FJVA 1X4DA 5AQLA 5AQVA 3OYCA 5A2QU 5GADU 4BREA 5HAOA 1HIYA 4RR5A 1HKGA 3ZZZA 1XI1A 1TUVA 3ZTQA 2YQ1A 2H5JB 2D0CA 5KRTA 3OR2A 1VIOA 2WBMA 1NSQA 1JLBB 2PC6A 3BKTA 4ZCKA 3ZSXA 1Q79A 3I55N 2IA6A 3UPFA 1R27B 2XGQA 3VAJA 4DTMA 4FWSA 2DO0A 4RNNA 3E9OA 3OA9A 3MMBB 2VWJA 4ZVFA 4X62J 1U09A 3TVYA 2CQGA 4DV7K 2PMZD 3VAFA 1LAWA 4MO4A 5AJ3K 3QGHA 2XHCA 4LFAK 5LSLA 3MF5A 1WEYA 1RB0A 1RU1A 2R42A 4RCHA 2QMWA 1SQGA 3KK1A 3TUPA 2W40A 4I2PB 3HP6A 3OHAA 4GKJJ 4JRPA 1IKXA 2WRMA 4JK8A 3KK2B 2P9GA 2UU9F 3VQSA 3UDCA 3M3ZA 3PHTA 5DGBA 2BDPA 1S10A 4Y0FA 3F9MA 3LF0A 1S4FA 2GX8A 4DR1F 4USUA 3ILJA 2G1DA 4DZDA 1RTIA 3OV7A 4LBPA 4IDKA 4ECXA 4NXNK 2MKJA 4HI1A 5JXSA 4IYQA 4ZJQA 4N8OA 5C25B 3DLGB 5AQUA 3VETA 4WQ4A 1PJ5A 1SQEA 2XS7A 2NZ4A 3RMBA 4NXMF 4BQLA 2G8VA 2D0AA 2WVEA 3TSPA 3JSMB 1VHXA 2R7SA 1WSGA 4CZEA 3KK1B 3A3NB 2C2NA 4OHZA 3H42A 3QGPA 4GVMA 4PWWA 2DK2A 1LW0A 1S12A 1IKXB 3DYAA 2ZOFA 3NGKA 3FCWA 2B9XA 1QDUB 3IP0A 5MLCV 1IBLF 3CF5Q 3TTCA 2C2ZB 4LF2A 4DFMA 4CHOA 3BM7A 1G2EA 1Q0NA 1F5AA 2DR7A 4X4NA 4W4MA 5C2DA 1HNVB 2AEFA 4IDKB 1RWWB 5M1FA 2QKKA 1UJ4A 1NPPA 5D0GA 1QTNB 4YY3K 3S3MA 3HYFA 5LMNJ 2DXDA 3AD7C 3B4MA 3T1YJ 2V63A 4CQ1A 2NLWA 1BCMA 3DRSB 2HZVA 3PW4A 1H2UX 4RW9A 2GV9A 4ISGA 4N76A 1NKCA 4RNOA 2YJEA 3MM7A 4JI7K 3KZBA 5A6WA 2HNDA 2FHJA 3CCRN 4QPTA 2R8JA 5RUBA 1UW4A 3C16B 4MIWA 3TI0A 1ZBSA 2MKCA 3CIMA 2DIUA 3JQMA 2CJ9A 2GIRA 1U0HA 2KM8B 2EI5A 1XNRJ 4LRFA 4P7VA 2VA3A 1ZM4A 3G82A 2WB4A 3M8SA 2CRLA 4B1WB 1IJJA 1OSDA 4J9SA 3HTVA 4ZP6A 2HGLA 1B4SA 2HK3A 1X9SA 2GHPA 2CKWA 1MWMA 5AQHA 1T11A 1X0PA 1WF0A 2GAGC 2OPQB 4NE9C 4M45A 4CIEA 2AJ2A 1DURA 4IRKA 2JOQA 3I8BA 5EU7A 4BR2A 2D74B 2V2ZA 3A5OC 1Q7YO 2PDAA 5KFMA 3MFHA 1RBVA 4PG6A 3TZYA 3O5TB 2E1AA 1C0TB 4IQMA 4IH6A 3VA3A 4ES2A 2WAQD 1U0HB 4V19J 1XJWB 5DGAA 3CJRA 3LDOA 5KFXA 2DYAA 3PFOA 2CQIA 2HBKA 2MDAA 1CS4B 2DGQA 2YTCA 4QWDA 2VQFF 1IN0A 5DZ7A 3U9DA 4DL0C 2R2TA 2ZWOA 1XMOJ 3C95A 2OHDA 4KH5A 4OV1A 4O8KA 4KB0A 5KFYA 1ZBIA 1HKAA 3D2WA 5A8RA 4CEFA 3FZMA 1NSPA 4ZLJA 3NVKA 3TUJC 3QO9B 1KRPA 2VICA 4WZQA 5DMRA 4YS2A 4NYOA 4BWJA 3KXDA 2Z2ZA 5J2NA 3BN7A 3EZUA 1NKEA 1NK5A 5F41A 4JKGB 4DTRA 3R27A 2HOEA 5G4DA 5AXMA 4QR1A 4CFCA 3L09A 4J2DA 3V6DB 4NLYA 3MWPA 3HHNB 2P5GA 4IO1A 3MXIA 5KPZA 2BKNA 2E5HA 1VR6A 3TUIC 2QEXN 1GFWB 3IDHA 4FDFA 1T3VA 1CXQA 3CC4S 3V2UC 2PD1A 3D6HB 3VTHA 5E0OA 2UUAK 3NY0A 3W0LA 1Q86T 2PEHA 2HZCA 3TAPA 2ZVSA 4DR6F 2FTRA 5TKYA 3GIJA 2NXCA 3T9ZA 2QLWA 2GQ2A 1LFPA 4C11A 1WOPA 2RDJA 4WBFA 3R8EA 3ZT1A 2P9KB 1WC6A 5DDOC 1SJ4P 3M9MB 3E01B 4OLOA 4ECTA 3UNYA 2WC9A 2GJFA 3ENAA 2DKOB 1A9NB 1X5SA 5AZJB 3RSEB 1WDTA 4JV5K 2HIYA 3HJFA 2MLYA 4QWBA 3ZXWA 2CVEA 4CT9A 4Z94A 4GO5X 4RKUC 2HVHA 2CG4A 4PY5A 2BJ8A 2DGTA 2JX2A 2Z2LA 2ZH2A 3FFKB 2EWSA 1RAEB 2ZHOA 3W9IA 3V81A 2ZH5A 1TYQA 2J9EA 4DQQA 1R6YA 1RTDA 4Y2MA 2G2OA 4WCEL 3HHLD 2ZJQQ 2XY5A 3C65A 1C1AA 3U6FA 2W24A 2O8BA 3PYGA 3DXBA 3HVWA 5LJVA 4JI0K 1GLDG 4K25A 3H1VX 2R7WA 3V4MA 2F96A 2BKOA 2R7OA 2VG5A 1FD2A 3VGLA 2OPPA 1K8KA 3KLEB 2UUBJ 3HZGA 2IPOB 4C11B 2ZZMA 4NLCA 1VJWA 3U9ZA 1BQXA 4XEIA 2KG0A 3H5UA 1T03A 5CYQA 1RT5B 3AVAA 1Y9OA 5KFIA 3OFEA 4Y2AA 2U2FA 2DNOA 5J2QB 1NDLA 2HHQA 3W2VA 4BG8A 2NRTA 3A8YA 4E7IA 3TZZA 4WYWA 4AQYK 4M3YA 4DTXA 2F9TA 1FEHA 3HLUA 1NWKA 3HI0A 1TYQB 4ELVA 2F7VA 4MKYA 5E2QA 1HHSA 3L6QA 4CF9A 2ZM6K 2M5YA 2W4CA 5A0YA 4OHXA 2GEMA 2H65B 1HQEA 1E4GT 2R2SA 4NYNA 4GKKJ 3IMQJ 1K8KB 2MEWA 3TAGA 1UVMA 1R6VA 1GNKA 1LOUA 4MK7A 4ZVEA 1X3NA 1ZBUA 1W26A 1RCHA 5AQTA 2KB2A 3OTOF 1TR0A 3A0IX 4NLTA 5CD4H 1IR1A 3LPYA 4ED5A 1X7VA 2NRZA 5CY4A 5GAEP 1K6YA 1T9UA 5K8OA 1N0UA 2BM0A 2E66A 2KVQE 4FSVA 4B1VA 5KFVA 4ID5A 3CDBA 1N32J 4IOCL 4AL5A 2FC9A 2J7WA 3PRDA 4B9TA 3MHYA 5F8GA 2H9ZA 2C28A 2NUBA 5LSOA 3R9LA 3CUNA 4Z37A 4ED0A 4XH5A 3CCVN 4ED7A 1RE1B 4GMJB 1EZZB 3CCWA 4NCBA 4B1ZA 5KFGA 4ED8A 3AOBA 2AP1A 2CAJA 1HQEB 3H0PA 3LUYA 3ENWA 2P5VA 3KFWX 1CZ9A 3RAXA 3MECB 1BOTO 5D15A 3F2KA 4LF7F 4O3OA 3FMWA 2OTLN 3T1HJ 2DISA 4DV0F 3ZTSA 4DI6A 1RWXB 1S1UA 4PG8A 1VQ5S 3G10A 3NMUA 1C1CB 4DLGA 1TKXA 3OFGA 3HM9A 5KT4A 2P6TA 3NGRA 1YJRA 4ZN1A 5LJ3Y 1NKBA 1RWNB 4B9SA 5GAEU 2VFVA 5G0RA 8RUCA 4BC7A 4M3RA 1BWVA 3KWMA 3ZC4A 3CPEA 2EFNA 2MKIA 5KFUA 2DHAA 3OBIA 3NDKA 5GMEA 1Y5NB 3I4PA 2VJVA 4K8RA 4DU8A 5B8HA 1JJCB 5FJ4A 4EAHD 2QJ3A 5K9FA 4CEQA 2MGZA 1J5EF 4CHQA 2ALZA 1QHTA 2ROEA 1R7IA 2QGFB 2RPIA 2VODA 4AUKA 4FN5A 3QQCD 2RE1A 4FYWB 5HSPA 2CWXA 3O4NA 4BR0A 1LWEB 2QLFB 1RT2A 2A2DA 4QYZK 3NWGA 1M5VC 4M5HA 4LD0A 4L73A 2VC1A 1TKXB 1SH0A 1PBAA 2E2QA 4PG4A 4R0JA 2V9WA 5G0RB 1OO0B 1YF5L 3J8AA 2HMPA 4J91A 1KQKA 1JK9B 4B3TK 1IM6A 3LDSA 1WACA 2FF3B 3W66A 4DR7K 3RBDA 1GAOA 2R7QA 1T8EA 2MJNA 4UUWA 4ZLNA 2PBDA 3K8VA 3LPTA 3VEXA 3SPZA 3IR6B 1HYSA 3ELHA 5BN8A 1WBBA 3AVJA 2DFEA 1TK8A 1WSFA 1UVIA 1NH7A 4BGBA 3WNEA 4EP5A 2DXFA 1MDUB 5ADZA 4RW7A 2JFKA 1WG5A 2CPHA 4I6AA 2FJXA 3THTA 4AHVA 4DU3A 2FZCB 3N4WA 1CJVA 2FLOA 4NL5A 5B0AA 1M1HA 3SK3A 3AXMA 3IS9A 4X4VA 3E9PA 4ZPTR 4YB5A 3LPEA 4BC2A 1VQYA 4Q0BB 2WUSA 4MDAA 1PGZA 2VD3A 1QVFR 1MWYA 4I0WA 5ETMA 1N36K 1YZ7A 4CLTA 1TL7A 1FRJA 2JLFA 2VFUA 2A6OA 1KS2A 3EYZA 3CCES 1HYSB 2LCWA 2GO9A 2WONA 1W7AA 1T9XA 2BE9B 1VBKA 4BRQA 3ENVA 5AQRA 4WFYA 3AOAA 3MM8A 3SBGA 1RT4A 4DV7F 1N88A 3NF9A 2A1SA 1GX5A 5AJ3F 1KC8T 2VBZA 4X65J 3MPWA 3H45C 4PXCA 2WTFA 2ASJA 3UKUB 2ZDOA 1NGEA 1F9EB 1RLDA 1LWFA 4CZGA 5GAEI 3IS9B 1BG3A 3VQCA 4QR0A 4ZOSA 3H59A 2WVDA 4O5BA 4FNHA 5C10A 2IC3A 2G0CA 3P3DA 3FZBA 3FBCA 3GCWP 3N4PA 1RWMB 2GMJA 5M1PA 2GUIA 4KKOA 3KLVA 1OPIA 2HW3A 3W63A 3R5BA 3QDKA 4NLGA 4HDGA 3EWGA 1RILA 4B3MJ 4BDYA 4FS1A 4DTUA 2VASA 2H1YA 4M3WA 4KFBA 2WONB 1VK3A 4YR3A 5I42A 2Z1HA 4W98A 3ID6A 1RT4B 5AE3A 3H1QA 1ZETA 4FJKA 3J80O 2HBRB 3BO4A 4WCEQ 3O3LA 2P9UA 3OR1A 5BR8F 1LEOA 2E9RX 1OH7A 2HHPA 3R97A 2R7VA 2IM3A 4C98A 4LSNA 3JS6A 1VQLN 4EP4A 4U9RA 2KG1A 1O6XA 3BKFA 3EICA 4KKOB 4BS2A 3BPSP 1JMTA 1S72N 2ATQA 2XI2A 2GJIA 1PC5A 4GKJK 4ZPDA 3MM9B 2NPIA 2I5JB 4FZYA 3J7Z5 3CQYA 1HNIA 1E6YB 2VUGA 4RW4A 5ETVA 2WCXA 1ILYA 4YY3F 2GZOA 3KG1A 4LUBA 1ROFA 3D6RA 4FJ9A 4NA2A 1XR6A 3FKBA 2BTFA 3VGKA 4FOEA 2DFHA 1VSMA 1RDDA 4BACA 3AY0A 1SIWB 4JI7F 4IR9A 3N6LA 5BPLA 3AGRA 1C6VA 1N0VC 4FWLA 3OR1B 2QL5B 2M4MA 2AZ3A 2BQUA 2XMTA 1WD6A 1NZ8A 1E3MA 2ACMA 1BDGA 2AT1B 1R8BA 3MR5A 4UUXA 1I5OB 1QQMA 1FEEA 2G1HA 1H98A 2RHKA 2HQDA 2O66A 3LP0B 1EWQA 3FZ2A 4X4SA 1RAFB 1HBUA 4KGZB 2BJ1A 4WIIA 2NYHA 5IWAJ 5M1KA 2K06A 5AQOA 3THXB 4XO0A 4FPIA 4C8ZA 1VQ9S 1KQSR 4EZ9A 1U1RA 3MN6A 1VGYA 4QR2A 2YNHA 1M90T 3IAS9 1UFKA 4ANEA 3IBFB 3L3VA 2P8IA 3UD4P 4HTLA 3CVKA 1U2VB 1VRTB 2KLAA 3GIRA 3TR8A 2YKNA 1TELA 4FVUA 5LMNK 2CGJA 4CNYA 3A4TA 4DV2J 4KHPK 1XN9A 5IZHA 3T1YK 2WVFA 5IOLA 3R3TA 4V1Ak 3N6MA 3QSIA 3DOLB 4WZMA 1VQ6S 5EN1A 1I6JA 1ZYQA 1UEVA 1DT9A 2D41A 3L0QA 2FVRA 1HI8A 1TUUA 4KREA 1IKWB 3N9UC 4QW8A 2P1JA 3TQ1A 3AAWB 3TJAA 3GB0A 3MFIA 2L08A 1RADB 1IQZA 3VCDA 3M30A 1X5TA 4QCLA 3UCZP 2EG1A 2APOA 3O9RA 1HBUB 3NH2A 4YR0A 2KHOA 4FPAA 3V1QA 1BUPA 5DM6Q 5E3RA 2D1CA 1NU4A 1XNRK 2YNHB 3RVCA 4AHCA 2ZBRA 4F04B 3RR8A 3HX9A 4ZDNA 2QI2A 2NXNA 3PKMA 3AODA 2BH1A 4FWMA 3VQTA 5J2MA 2RS8A 3DAWA 3IUCA 2YHWA 4LR9A 2VB6A 4M5KA 3CDUA 3ET6A 5L9NA 4I9QA 1TMJA 1LOTB 4Z4EA 1LW2A 2N3OA 4P52A 1HYZA 1VSFA 1ZAWA 1EP4A 1PYTA 4FF3A 2ZWHA 3VENA 1PCAA 2NLXA 3T7ZA 3TAMA 4WP8A 1J53A 5B0BA 3HKWA 3NAHA 3R5JB 5JLFA 1NK4A 2GIQA 3C6UA 3OUYB 2L9DA 3LP1A 2GS8A 5H1SV 3BN4A 2UUAF 1UZDA 3FFIB 3FEXB 4K4WA 3SIPB 3L2QA 5FPDA 1NJIT 3CM6A 2PIIA 4LF1A 3ZNJ1 3MUMP 4ZK7M 2V2QA 2G8FA 2B4OA 3OSNA 2AGPA 5HMXA 4P72A 3OJSA 1UFWA 3OXLA 2ZITA 2MQOA 4CJ5A 5J2MB 5C0YA 3CULA 4M5IA 1U8SA 2D0OA 1NO8A 1EARA 2CZ4A 2QWNA 3W5ZA 3MM5B 2HVIA 4LH4A 4C1NI 3TVKA 5E26A 2AQ4A 3CCSS 1K0VA 1F60B 4UT4A 3TZXA 4JV5F 3TABA 1EP4B 3K58A 4IOXA 1QVGM 3SSRA 1VDHA 1NGCA 1RWVB 3MWBA 5U47A 3HD2A 2A1BA 3FZLA 5D0EA 2BRLA 1FJGK 1KN6A 1BIZA 3W61A 3QMLA 3C6UB 3EE3A 1BHLA 1WC1A 1F2GA 1WORA 4HYKA 1CBKA 2Y8YA 3KWIA 4C3LA 2MZSA 3G6EN 5AQJA 3KLIA 1VC6A 1U1KA 4AM7A 4JI0F 1MWKA 5IC4B 1SL0A 1RT1B 2C3UA 1XUPO 5IT0A 4E3SA 2RHQB 3KHGA 1W25A 3GIMA 1B99A 3LDPA 2VHGA 1XQSC 4OYZA 5KFRA 3A13A 1FXLA 1VOMA 3OYGA 1AUSL 3ZO7A 2QXFA 3TSQA 2D1KA 4C9DA 5BYSA 4F4KA 3GG4A 3QGIA 1H7XA 1UA1A 1R89A 4FYXB 4CVNE 4DTJA 4KH4A 5CHCB 3VF0B 5CZXA 2ADCA 1HHQA 2HIQA 5TKWA 2CNKB 2GQQA 4PUOA 3UB5A 3H7HB 2X1GA 3AVMA 3EJMA 4NCGB 3CJ5A 4ECQA 1IXKA 4OV6A 2A6MA 3OD2A 1CJTA 5DETA 5EHHA 2ITGA 3JQJA 2RIJA 4CM2A 4I9LA 1MG7A 3G9CA 3VF2A 5D3GB 4PKHA 3CI5A 2ADBA 2O5DA 3OFHA 4FW1A 1HMVB 5IM0B 1VSIA 2V4JA 3IBWA 1WSHA 4ZVGA 1MU2B 2IBOA 2BW7A 1YRTA 3P31A 2IRUA 1Z2ZA 1SB6A 2O8DB 3DC2A 5HVHA 1URRA 2Z4PA 3TARA 1NUEA 2Z2YB 1S6OA 4IBNA 4A8FA 5ETQA 1YHQN 1EIYB 2GGPB 3I9ZA 4I6WA 3U27A 5MLCQ 4NLXA 4NEZA 4USKA 3SQ2A 3TA1A 4MKBA 1KVIA 5THWA 3QJJA 3O4WA 4NX9A 3KD1E 4K2JA 1CJKA 3PZPA 5KQ8A 3HBTA 4ANCA 3R8YA 3BDPA 3LPUA 3NS7B 4HH0A 1FCAA 2XMWA 4F2RA 1O0PA 2RKIA 3VESA 2NUUG 1H38A 3FQLA 1IWGA 4TY9A 4ZITA 4RZRA 2R8HA 4OX7A 1VIXA 4A8OA 4XAKA 2EFQA 4R5PB 2B56A 4DTNA 3MCMA 3MTKA 3F44A 1JXEA 3EGNA 1VCTA 3D1QA 3R1XA 2CQ2A 3BUZB 3T5JA 4PQAA 5AXLA 2Q43A 4A46A 2GX9A 2AW0A 2J8AA 5BYQA 2ZBIA 3SFUA 3KHLA 3J80Y 3HZEA 4XDDA 3OJUA 2GFFA 4RBVA 2LP4A 5FRMA 1Q1KA 3MMCB 1T0TV 2AJ1A 1FESA 3ITHB 1Z05A 2DNGA 3KNAA 2XHWA 3HD1A 5KFHA 2Y1RI 3HKZD 3D67A 4BC9A 5H9EJ 2ASOA 2V68A 4CF8A 4JI5K 4MH8A 2YNFA 1N32K 4L76A 4JI2F 1T44A 3S1TA 4FVMA 3G71N 3HVTB 4DSKA 2NUHA 1WUUA 4OGEA 3MEDA 1Y0HA 4LIRA 3F9KA 4JOUA 4ZIVA 3OBWA 4Y2CA 1ZAXA 2IY5B 3BQ2A 3P83D 2C2MB 1D09B 4G1QA 4J5OA 1GEHA 4FJHA 4RG8A 1YKWA 1ZXOA 1VS3A 4FJIA 4DF8A 3ZZYA 1PAEX 3GFZA 4FJJA 2DTUA 2RH3A 1SC6A 3AVIA 4ETXA 4PL8A 4HVJA 2VGNA 4ITSA 3T1HK 2ASDA 1R59O 1WAJA 1F5BA 3DKDA 3G2XA 4FO0A 4G1IA 4DR7F 3VZHA 4LR8A 2YNFB 4F3TA 2UVVA 3S8SA 2HRUA 1UVNA 3BGLA 2BUPA 5ETRA 3FSIA 1GLAG 2W25A 1RWPB 4USJC 4W92B 1S6PA 3NVMA 3ASMA 3CCZA 3MEDB 5DDPC 1U2CA 4WFAL 4ED2A 5DG9A 1S77D 1N8RO 2XULA 3SMZA 2R8IA 4DTSA 3L7UA 1GXUA 4DL2A 3VAIA 2J6TA 3GR0A 5F2RA 1PJ7A 2FVPA 3C6TA 2CJBA 2DY1A 2ZFHA 2DRDA 2XYPB 2RAQA 2RVJA 3W2WB 2Q6CA 2P9PB 4NYPA 2LXUA 4C8LA 1HX1A 4B3SJ 3G8TA 2AGQA 4M5LA 2ZH1A 2VFSA 2CGLA 2I7NA 1Q53A 3CJKA 4DU1A 4LJMA 4QIFA 4E1JA 4DV5K 1N36F 4P6QA 4TN2A 1SJFA 1KOHA 5FLXO 2F4VJ 4O44B 3RW6A 4BC5A 4X64J 4ID8A 4FXVA 1JJ2M 4ZCLA 3CCRS 3GYXB 5KFOA 4KHUA 5E7OB 3H4DA 4CLZA 3ZFVA 2E5LJ 4NRUA 3CJ8A 2QX0A 3O2IA 1WBDA 1FWKA 3MEEA 2ASLA 4TLQA 2BVZA 1RKIA 4PA1A 2IMOA 5AXNA 3VERA 1CJUB 2W7OA 3VPZA 4USMA 2CPYA 4PABA 3NF7A 1FKAF 1JIHA 1U24A 1OQ6A 1RT6B 4H4OA 2Q79A 4FJLA 2YX7A 1S99A 4RBUA 4X66J 3AXKA 5KOWA 4LVNP 4CZKA 2IIRA 5CABA 2OANA 1MSWD 3BREA 2A41A 4KI4A 1V6HA 1QVFM 4NI2B 2E1CA 3CJKB 4CJEA 2IA0A 4HCCA 3MCPA 3OXGA 2OELA 4OYWA 2IAJB 3PRVA 2HNZA 3Q23A 1P90A 1NHUA 4FZZA 2DNZA 1KOOA 2MYFA 1G15A 2RJZA 2Y1IA 4DL5A 3ULEA 4K4VA 4KPYA 4CD1A 5EX0A 5HRPA 2M88A 3IM8A 5CH7B 2HHSA 5ADXH 1GLJO 4CCHA 2FHJD 2NRVA 2K3KA 1MA9B 4LFBJ 1RNHA 4JKAA 2JZ5A 4OKKA 5BPMA 2C2KB 4X62F 5J2PA 1B3TA 1JJ4A 2R7TA 2DPJA 3POTA 2BZ2A 2HAFA 1NJZA 3BGOP 1V4TA 4DR2J 4I6YA 4F0HA 1B92A 1R0BG 5T41A 1GOBA 2HVEA 2R2UA 2Y9HA 2CVIA 4GKJF 2HNZB 4C8OA 1F21A 1Q81T 3L2VA 2I6WA 4CK1A 3DLKB 3CTRA 2YKMB 5GVQA 1CC7A 3NGDA 3CCMN 2N82B 2NCKL 2W2QP 1NM1A 1ZTWA 2WOMA 3UE2A 1YVFA 3VN5A 1RAOA 4DX6A 2I7PA 4KYZA 3WX4A 4OYAA 3E51A 3GIIA 3PJWA 1PKUA 4B3MK 2BANA 1BA1A 3EY1A 1M1KT 2XSFA 1T7PA 3WXIA 1NZAA 4U7UK 2DITA 4CH7A 2VPYB 3D7EO 4YN3B 3NCQA 4RUBA 4BR7A 3QETA 3EL2A 2XMAA 2NNWA 1WI6A 3P45B 5J2PB 3D2EA 2VIHA 3OT9A 4ZP7A 3QYYA 4ZCMA 3POTB 4DX7A 1GLBG 2EFOA 3VR1A 2OCEA 4BRKA 1BA0A 3O8MA 1FE4A 1FRIA 3PACA 1X4BA 2WTUA 2V8HA 4NA1A 2DD8S 2QWMA 5FRNA 4H0YB 4DFPA 2Q1LA 1N5VA 2F3JA 3Q8UA 2VZ9A 4KHMA 1U1PA 1S5JA 1RDBA 2K1RB 4KPCA 2NREA 4OYMA 4YQWA 1RZMA 1SKUB 4UOCA 3D2FA 4GC7A 5KG6A 2RQMA 1WDDA 3OL8A 1EX8A 3I6PA 1BD6A 4LMZA 1X9JA 3PRBA 3I0SA 4WTOB 1FKPA 2ROPA 3HHKA 2W6KA 4CLLA 2KZZA 1NK6A 2CG8A 5LMNF 3HP9A 1EB0A 4KHPF 2J9DE 3T1YF 4QS8A 4ZPVR 3QWUA 4DOZA 1X31C 1HPMA 3DDKA 1KNZA 5F8LA 1LWCB 4K4TA 4MKAA 4B9UA 2O4IA 5D78A 4CW7B 3IWLA 5A8WA 4RNFA 2HGMA 4BRDA 2YX4A 3IA0A 4Q2MA 4LSLA 3R7BB 4ED4A 4CTAA 2LFVA 4OYBA 4H0XB 2DGUA 3RBEA 1YJ9N 1P8GA 2Z1IA 3O6QA 4HLBA 4YHHJ 2B7CB 1KQSM 2E6MA 1XNRF 3K0JA 4FZVA 3AA5X 1B0VA 5LT5A 3ATUA 2B8QA 3OYHA 4DSEA 3MPDA 3X3UA 2W9AA 4F4YA 4Y00A 1Q5YA 4UOGA 4A8YA 3DRRA 1TP7A 2EG2A 3KJNB 4PCQA 1OWXA 3UN5A 1FKPB 2B9YA 3DHXA 4JEPA 1BGXT 1YXQA 5B09A 3GZ7A 3UDEA 2M2BA 3GSIA 2YXLA 2I1RA 3C15A 5KFJA 2YWGA 1R8PA 1UAWA 4AXIA 3A8JA 1QHAA 3AA2A 4C3MA 3WXMB 2ZKTA 3WXLA 4BR5A 1HNWJ 1F3FA 4HCBA 4IFEA 2LECA 4CTAB 1RDUA 3AA4A 2FC0A 1R3NA 7AT1B 4ETZA 2HBJA 1HR0J 3VMFB 3T69A 1C4AA 3B78A 4H5VA 1YBTA 2NR0A 5HLFA 1Q8BA 1NCLA 4B3OA 4YOXA 4C0HA 2J9CA 3QNWB 5JMNA 3S01A 3MAQA 3A5LC 2MJUA 2F8TA 3L7PA 4BQZA 5CCMA 4M1KA 4OX9J 1KCFA 1S6UA 4YNQA 1XMOF 3CCVS 3CW2C 3OBYA 3U3GA 1NMNA 3RB6A 2RSQA 3QERA 1T6DA 3LL3A 4J9UE 3JTPA 4WFZA 2CPDA 1S1XA 3TSUA 2EKNA 2Y0BB 4OHVA 4JD2B 2QTDA 3TA2A 4D3HA 3A5NC 4IG0B 1HJOA 3U7JA 2EW9A 1M5HA 2E4LA 1UWBA 3WEEB 4U67Q 3O4QA 1FX4A 1FJGF 3HSTB 2HFSA 1VSDA 3NGYA 3TP2A 4WYLA 3W9HA 1QJHA 1K73T 1VQ8N 3LDNA 4CECA 1TK5A 1FDDA 4OZ3A 4B9VA 3VVUA 5HVGA 5FDLA 3EE8A 3C3LA 4ZPWR 2RN2A 4ANDA 4CLFA 4BC4A 1CQMA 2MSSA 4FWKA 1Q82T 2XO7A 1B0PA 2V7YA 2P9SA 4RU9A 4XTTA 1UFLA 2YKPA 2OPSA 4QIGA 2JH3A 5EVZA 1C0FA 2BQRA 1O13A 1NU0A 3OL7A 4ECVA 3C7NB 3KKRA 1HPZA 2AWZA 3IG1A 4YP3A 4BE0A 2V4QA 4DU7A 5DLFA 1SUQA 3M8YA 4L3QA 5C24B 1RQ0A 1YQHA 1WTFA 2W9BB 2HHXA 3SUPA 4WIQA 4EU0A 3VEWA 2R3VA 3VQDA 2VU5A 5FLXY 2G2YA 2HSEB 3WC0A 2GVDA 1V3SA 1GMUA 3NFAA 1Y5IB 2Z57B 2B7BB 3SJJA 5FPNA 4W5NA 4F4XA 9RUBA 4FPRA 4J9RA 2ZBCA 2MQPA 3S6EA 3AVLA 1VQKS 3KHHA 3PX4A 3O9SA 5J1EB 2EFGA 4EEYA 2FSNA 3BEGB 3M8RA 2DTJA 3G86A 3KJVB 2YWWA 2VFTA 2ZJRL 3M1VB 2BM1A 4WU3A 3HSDA 2YHAA 1JCEA 1IKVB 3C14B 3QJLA 2KHDA 2O01C 3ULHA 3KKSA 1SUQB 4PPZA 4YR2A 1SQKA 4R0EA 1LK7A 3I5BA 1VSLA 4XIUA 5E33A 1TL3B 4M3TA 4JAXA 3GL1A 3QRQA 2GAHC 4QZVB 2BJ9A 4HWIA 1NGGA 2A0FB 2GVDB 3Q7CA 3TO8A 3IAM9 3MX2A 3P4UB 3RJMB 1IBLK 3G4SN 2LXFA 4KAIA 4IG3B 4CFBA 1QAYA 5L39A 3OFFA 3EZWA 5GAHI 1SC1B 3GE9A 4EMDA 5CZ1A 4GKKF 3O3GA 2ZJPQ 3THYB 3R7SB 2R9LA 4C7QA 4DQSA 5T14A 4WFXA 2QWQA 3LZIA 4JB8B 2UYTA 2FQQB 4UF4A 4QOTA 3DGPA 4L72B 4DFKA 3QEXA 1I3OB 3NBPA 1D8YA 4MDBA 3R3LA 1NJXA 3T6BA 4X4TA 4OMFG 5J1PA 1K9MO 3D3BJ 4JI5F 2GWJA 2P9IB 4ISEA 4YOUA 3CPWR 2VBYA 1N32F 4H0VB 1Q7YT 2OPRB 4CZMA 3AARA 4F3OA 2GHVC 3OLAA 2A2CA 2KN4A 4KC5A 3CMAN 1H74A 3UD5A 4AL7A 2IM0A 3QGGA 3T6JA 3AY9A 2QRRA 2L9NA 4NZ7A 4OI4A 5HRRA 3GFHA 3BH7B 3P49B 1AW0A 1P8ZA 1VK8A 2ZZTA 4OLPA 5HVFA 4NLPA 4JUZA 3UIQA 1YRXA 1FDBA 2VG6A 2IS3A 5H9FK 3T1HF 4DCJB 1KWMA 4CGDA 1H7WA 1IWAA 3FGVA 3B8HA 3SV4A 4CJLA 3N6NA 1YWXA 1X4CA 4LH5A 3BR8A 4WF9L 4ICLB 4OFZA 4NCAA 1UA0A 2IDLA 2J8SA 3L8BA 5B0EA 4Y65A 3QJPA 3X1LB 2CH6A 2GUPA 1NJYA 4CWBA 2IBKA 3OL6A 1JL1A 2CXEA 3KK3A 4AHSA 4LFCJ 1B70B 5F1XA 4C8MA 3BR9A 4O5FA 1HW8A 1N5SA 2VQFK 3H20A 3TA0A 2E7VA 4BLGA 1DHMA 2BX6A 2R2RA 2RRAA 1BHNA 1Q86O 4DR1J 3FUYA 2YPZA 3R1HA 1L3SA 2H4YB 3CT9A 4DR3J 2D3UA 1RCOB 3SFGA 2DH7A 1YT3A 2QV6A 3V9WA 1SC4B 4DV5F 5KAKA 4BHQA 2IVOA 3I33A 3QFUA 2M8HA 5GMDA 1X1PA 4Z2XA 1RTJA 3CC2S 1SZ2A 2UUTA 4IEIA 3ZTOA 3V9UA 3CJBA 2KT5A 2X51A 4OZ1A 4DPUA 2F8SA 3ZT0A 1A0OB 1I3AA 1C1BA 5DG8A 1OS5A 3SQ4A 5HBMB 3WQUA 4PWDA 7FD1A 4DSFA 4Q43A 3EM1A 1YTYA 3BGRB 1Y97A 2D4WA 2FZKB 1LFWA 3P38A 5FD1A 4RPFA 4QW9A 3OLBA 3AVHA 4KBOA 4WTYA 3VVTA 4TSXA 4FWOA 2DNHA 2VG7A 2QA2A 3H98A 4EFAC 1FA0A 1GOCA 2HF3A 1F0XA 4JI8J 3PO4A 3SDEA 1VQNN 3H25A 5AXKA 3ZT4A 4U7CA 3AA9A 3GMGA 4DPYA 3OYMA 3SCIE 3PFEA 3RMCA 1S57A 1KVJA 3D6MB 3N4QA 2QSWA 4B3SK 2I8EA 2Z0GA 2V67A 4PYDA 1QAXA 5F0UA 4LF5J 1M5KC 4UOFA 1ITPA 2O4GA 2HMIA 4MFBA 2XCAA 1JLQA 3B6PA 2XBPA 1G1XA 2KT2A 4OI3A 2FY1A 2P9EA 1K1QA 4J2BA 4X64K 2QA1A 2Z56B 4TQSA 1N33J 4G3IA 3M8PA 2FBYA 4MO5A 2KKZA 3C0BA 1UVJA 4MTPA 2MMYA 4M5MA 4AFFA 2PMHA 5AFUA 2QWOA 3W60A 1X4AA 4W5OA 5HRSA 4JKCA 4Q45A 1FO1A 2FF6A 5EOYA 5AZIA 4X4QA 3IM9A 2QLJB 1R8CA 2FIUA 2XMVA 3NCRA 3ZEUA 2XY8A 4X66K 3M6WA 4WKYA 2W8LA 3M2VA 2E6LA 4H4KA 6FDRA 2DB1A 4CO5A 4DG1B 4IKFA 1U45A 1DKGD 5A8KA 1FXXA 3LAMA 1SC3B 2RHSB 2YVSA 3GFXA 3UQSA 3QNNA 5E3PA 5I3PA 1A7GE 2EKYA 2ZGZA 1R8AA 4OYXA 4B3MF 5A76A 1EWRA 4W5TA 1HI0P 3OPKA 3P6YC 4YOEA 4IH7A 3Q24A 3M8PB 4DS5A 1RT3B 2MZJA 2NSBA 1GXTA 4IUFA 3H5XA 1NK9A 1O51A 2HGNA 1S9GA 3IO1A 5C42A 1J5OA 2OKQA 3HULA 5K20B 4DL7A 1WOSA 5MAOA 3IFEA 4Y0WA 5AZIB 4C97A 1C4CA 4KHQA 2O8FA 1ZBFA 1S1WB 5CZVA 3ZEUB 1FTRA 2GA7A 3KUGA 1Y3JA 1MLAA 2HEKA 1YIJN 3KLHB 2JC0A 2ZJRQ 4DR4J 2HQ3A 5LMUK 3TOQA 1JLGA 2D9OA 2NXUA 2Z58B 4DPXA 1UJ6A 1DLOB 3E2EA 2KRRA 1GLEG 4CFDA 5JS1A 3FE1A 1H2TZ 2E9TA 2GBZA 4FJ5A 3WXJA 1AROP 2P9NB 2QK9A 4JKFA 2UV8G 2DGOA 1WSRA 5KG2A 1WN7A 3MAAB 2DNKA 3NF8A 2QT7A 3HHDA 4FF4A 1UCNA 1NPRA 4DMZA 4PKDB 2HFNA 2X78A 2FJDB 3MXMA 1MROB 4DMNA 4YOTA 1EETA 2YNIA 3T41A 2H5EA 2Q36A 3MK6A 2DEJA 4QIVA 4QBUA 5JMVA 1JLGB 2CIMA 2YWFA 2R7UA 1CVJA 3NMAA 3PW2A 4CHZA 3NG8A 5B0GA 1BQNA 5IWAF 2HBZB 4ILGB 3J81j 4M94A 4IDHA 3PYEA 3WZ0A 2QL7B 3SSSA 4ZLLA 3GFYA 1NMDA 4F26A 1WSVA 1T9YA 3V9ZA 2HF4A 3W8PA 1VHFA 1RDCA 3OSPA 3BYRA 2NRXA 2CQ4A 3R6GB 3BGFA 3CJ9A 2OH2A 2V52B 3DLEB 3NP5A 3Q89A 4GV3A 1PBUA 3R7NB 3MR2A 1SAZA 2DNQA 1EETB 4K4ZA 1KP6A 2GC8A 1UL3A 1X60A 2MQNA 2FUG9 3RYLA 4WQ5A 4URGA 3H40A 4CZFA 1YHQS 2YI1A 1D8ZA 3NAEA 3PHEA 4G1PA 1TL4A 4M5NA 4RW6B 3ICLA 5GIPA 5A6PA 2OD6A 3DLLL 4F4AA 1BQNB 1K44A 2V8VA 3D0GE 4WF9Q 4YHHK 2HZAA 4IQXA 4BRNA 2GHWA 5CD4A 3SBMA 2QN6B 1UKUA 4M5DB 5AQWA 3NGZA 2MZQA 3KG0A 4ECRA 1FFWB 1OYDA 1KQFB 4I6MB 2WSFC 1TL5A 3MMBA 8AT1B 4NLRA 3SI8A 3K59A 3MEGA 2IYGA 1VRUB 3CCLS 4A8SA 5E3AA 2PGCA 4HHUA 1IKYB 2HQCA 3SQGB 4LIWA 3UDVA 3PW7A 2X6SA 1Y11A 2IVNA 2FJEB 1IQTA 4WQ4C 1S76D 5IC6B 4J9NA 3P4IA 2G8WA 4DEZA 2ZD1B 3N5BA 4PYAA 3NS6A 3J80U 3OTOJ 1RA7A 1HNWK 3O9TA 1RXOB 3H5SA 3PG9A 4BDZA 2CJAA 5ITHA 2LMIA 3B82A 4KRFA 4FWPA 3L4BC 1HR0K 2JWKA 1NK0A 4UY85 4NLBA 5KFDA 1JLFA 3JYTB 4O55A 3VV2B 3E9LA 2M7SA 1DFDA 3O8WA 3O6WA 1X5PA 1BWFO 3TAQA 3RAMA 4DL6A 5C25A 3DLGA 3R6MA 1YZ6A 1Z4UA 3TNVA 4A48A 3AT1B 3MEGB 4M5JA 3CJ3A 1J2VA 4F4WA 2XY7A 1XR7A 3M1FA 3VGUA 3CD5A 4K4XA 3JSMA 2CPJA 2L9WA 3CMQA 2QA4S 3OHRA 4EBCA 2CPXA 3K9KA 2G8KA 1TL1B 2DCUB 4DV0J 4NPOA 1S97A 3M8QA 3GYNA 5ETTA 2ERRA 2Z2MA 2W42A 4BRHA 2XYHB 1ITGA 4S0MA 2DNRA 1TTHB 5B0CA 2C2OB 4CLWA 2OTJS 3CC4N 3QT6A 1JLFB 1HBOB 3OTDA 2RUSA 1TQLA 1HNVA 3GG1A 3TJ8A 3VAKA 2C22A 5CXTA 2XWYA 4E7HA 3PM9A 4FXWA 3H5YA 2GNKA 2XTJP 1YBUA 1RAGB 2BYCA 2G8HA 4Q44A 4FLWA 3DRSA 4MJKA 1M5SA 1J5EJ 4Z4HA 4DUZJ 2A42A 1HWUA 3RR7A 3ZSVA 3N01A 3SYZA 2GW8A 5BR8K 3ZT2A 2GCFA 2DR5A 3R2DJ 1XHXA 2J5AA 3C16A 4HHJA 3M8QB 3HHLB 5F8NA 4KI6A 4QOZB 1H2VZ 2WVCA 5M2PA 2H48B 4H0PA 4OI6A 4K8ZA 2K7JA 5CZ2A 4J7CA 3EPIA 4WKRA 1NHVA 2D69A 3CDEA 2E2PA 2B9EA 4QWAA 5D77A 3LP2B 1Z2LA 5HO4A 3BH6B 4U7UD 3QMQA 2X1BA 1AA1B 2IVPA 3AO2A 2G0IA 1WNEA 4FK2A 2HFUA 2GWKA 5F8JA 1DARA 4F25A 2OPQA 1VK0A 2XMJA 3OYDA 1AFJA 3C6AA 4FYDA 1M90O 2AYBA 1GMWA 2XC9A 5C12A 2DNMA 5JUMA 3TAEA 2Y8WA 4BRLA 2RNEA 4FJ7A 2KKHA 1S7IA 2DGSA 4KV8A 4C2MA 2XNRA 4GMKA 1TMMA 2LQJA 1C0TA 1J6ZA 4O3NA 1JWWA 4FZXC 3MI7X 4RNHA 4B17A 4ZHRB 1N4LA 1YJUA 2AF6A 5ETPA 2O1PA 1WG1A 1CS4A 4BRIA 2KO1A 3D1HA 4O4RA 4OPKA 3F73A 3FBBA 4DCOB 4RJVA 3SSQA 2XSJA 2G0JA 1WSEA 4JBCA 2RQKA 4WYBA 4DSLA 1M5OC 3C6HA 2OI2A 2X1FA 3QO9A 3CPWM 5LOQA 5KFPA 1Q5VA 1KLMB 4DV4J 4E8UA 1ZS6A 2EFVA 5AJ3J 4KV8B 4CJSA 3WNHA 2RQ4A 2V2KA 4LFAJ 4BR9A 1XHZA 2FYXA 1P1LA 4JKGA 4X4OA 3I9V9 3P5BP 2OYQA 1EO1A 3V6DA 3CJCA 5KFWA 3QEWA 2PE8A 1OQ3A 3NGTA 3W65A 4OJRA 1KVBA 2F9JA 1HJRA 1OVYA 3O80A 5HROA 1HNXK 3R1LA 3VQ5A 3AVKA 5GMKa 4CDIA 3EO3A 4N5SA 1Z1ZA 4E19A 2XSJB 4IKAA 1ZTTA 1PIEA 4H5NA 3BZQA 1QZ5A 1CLQA 2FB0A 1HBMB 4FK4A 4NXNJ 2LDYA 2V8PA 2Q66A 2ITMA 2NSCA 1FDNA 1ZZFA 4FYVB 4B1YB 3NF6A 3QEVA 5L8RC 3DLJA 5KFAA 1T3NA 2V8GA 2OMOA 2P9KA 1VQ5N 1YVUA 4I56A 3OS1A 4K4YA 1SL1A 2F8HA 3E01A 3NGSA 4OJ