4YHHK

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tigecycline
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
115
structure length
115
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structural characterization of an alternative mode of tigecycline binding to the bacterial ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4yhhK00
4DR5K 4LFCK 2E5LK 4LFAK 3JAMO 4YY3K 2UU9K 4B3SK 4KHPK 5A2QO 3J81O 4B3TK 1FJGK 1N32K 4CW7B 4DV2K 4K0KK 4DV0K 5LL6Z 5BR8K 2UXDK 1HR0K 3J7AP 2VQFK 3T1YK 5IWAK 4DR4K 1HNXK 1N34K 1XMQK 4DR2K 4NXNK 4B3RK 4NXMK 1I94K 4LFBK 4AQYK 4LF9K 4DV4K 3OTOK 1XNQK 5LMNK 4LF8K 4X62K 4JI2K 3T1HK 4X65K 1IBMK 4OX9K 4JI7K 4V19S 4JI3K 4DV1K 4JI4K 2UUCK 3J7YP 4B3MK 4DR7K 4DV6K 5LMUK 1J5EK 4DV3K 4DV5K 4JI6K 4LF6K 4JI1K 1XNRK 1IBKK 1HNZK 4JV5K 4DR6K 4DR1K 2F4VK 4JI5K 4GKKK 5IT9O 4LF7K 4YHHK 4DUZK 4JI0K 4X64K 4DR3K 2UUBK 2VQEK 2UUAK 4LF4K 2UXBK 4LF5K 4X66K 2UXCK 5FLXO 1N36K 2ZM6K 3J80O 4JI8K 4CVNE 2HHHK 4JYAK 1N33K 4GKJK 4DV7K 4DUYK 1HNWK 1IBLK 5AJ3K 1XMOK
chains in the Genus database with same CATH superfamily
2NZTA 2YHAA 4CFDA 1LAVA 1WN7A 5I42A 4M7YA 2KKZA 3O9RA 2NRTA 4FJXA 3HPGA 3IRXA 1W9HA 2DFEA 5DM6L 4C8OA 4OLBA 1SL2A 3CCEN 4FWSA 4FWNA 4FJ7A 3S3MA 1GOAA 4BC5A 3D2FB 3OW2M 3NAEA 4DG1A 2IC3A 2OPPA 3KKSA 2QW9A 4MFBA 5EU7A 2Z1GA 1N34K 2E20A 4N41A 4BR4A 5C24A 4HWIA 4ZTFA 4FJ9A 4FLXA 1NJWA 4AM7A 1NK5A 2VWJA 3CXCM 1KCFA 1TKZA 3NF7A 4HVJA 4JK8A 1ZXOA 4E7LA 2F96A 4X62K 5TKWA 5J1EA 1N5YA 3DOLA 3L3UA 4V19S 2WC9A 1TGOA 1NG9A 2BTFA 4OPJA 5CR4A 4Z4IA 3UKRA 1QSYA 5LMUK 4DV5K 4WQ4A 4JI6K 5FPDA 4GW6A 1U49A 3ZSYA 1BU6O 4PKHA 1EWQA 3EKUA 3AO3A 3CCSN 1U48A 1XHZA 4DSIA 4FWLA 4OKKA 3ZSRA 3MAQA 4L8RB 2OYQA 2PYJA 1Q18A 5GIPA 4HCBA 3VPZA 3ZLJA 3V4IA 2RN2A 5B8HA 4QS8A 3HVRA 4E1MA 4DR3K 5AQNA 4M3TA 3SCXA 1LCUA 3WXLA 1S72N 1P90A 3FE1A 2UUAK 1KAYA 3QEPA 4NYNA 1NGGA 4LH5A 3WXJA 2F8TA 5AFUA 2W42A 3MN6A 4WQ5A 3CM6A 1QTMA 3HL8A 1K6YA 1NGFA 3AVHA 1JLCA 3Q7CA 3V6DA 4IWVA 4CFCA 3ZT2A 5ADXA 4CHZA 4G1QA 4CECA 3AA5X 4DTJA 5D3GA 1LWEA 2P9IA 2HNDA 3DWLA 3FR0A 4N56A 4DWIA 4CJLA 1VQON 3VA0A 3K9JA 3AVGA 2EWSA 2G8FA 4K43A 3KJVA 1JLQA 1VSMA 1JXEA 1MWKA 2UXDK 3VEYA 1IKYA 3VQ4A 1NLVA 1S6PA 3DRPA 4B1YB 4CJWA 3C0BA 2YHXA 1HKGA 4AHRA 3CJ1A 4BR5A 4YOXA 3H1QA 4AQYK 4KH5A 1RGIA 2E8AA 2D0OA 5JS1A 2ZE2A 3WQTA 4QOZB 1RTHA 1T3VA 5F2RA 3HYFA 3HTVA 5K14A 1SL1A 4FZXC 1QHTA 4KB0A 2HF3A 3NGIA 3FGUA 3V9SA 3AA3A 4JRQA 3THYA 2W41A 2YJFA 5J2PA 1RBTA 1K73O 1XC3A 1IO2A 2IVNA 3SV3A 4DTNA 1O13A 3ATVA 1S1WA 1YAGA 3ZSVA 4Z4HA 3V1RA 4CEAA 3FZKA 4DR1K 2QK9A 3RMBA 4BRKA 1C6VA 4FWRA 4MO4A 4GV3A 4UQGA 3TAFA 1X9WA 4O5BA 1B9DA 2P9SB 1R59O 3ID6A 5GINA 1WOQA 5AQOA 3O4WA 4JHDB 3ZEUB 2DFFA 1Z26A 2X78A 1OH8A 1KVAA 3SAGA 3MWTA 3AO5A 4O8UA 3T7ZA 4FJ8A 1BI4B 4JYAK 4BROA 2CGKA 3VQ5A 5AQGA 1N33K 4DFMA 4CZIA 1KFSA 1HYSA 3QFUA 3LPUA 2BANA 1GLJO 3ALYA 4LFAK 5C2FA 2WFBA 3M1FA 4B3TK 1BQMA 3LL3A 5M1QA 3IG1A 3UKUB 1WBDA 1YT3A 1HPZA 4DTXA 2P9NB 2X74A 3J7ZO 5KRSA 4LD0A 4AHTA 1BUPA 2D4WA 4YOVA 1XQSC 3LZJA 3V9ZA 3NF6A 4A5AA 5M1FA 1LW0A 2RF2A 3MN7A 3KIOA 4A2BA 2OPSA 1T7PA 2ZJQL 5EX5A 4I9QA 4CI6A 2HNYA 3NF9A 3QIOA 2QEXN 4KTWA 4JI2K 1U6ZA 1SKWA 1EETA 3ZSWA 4CZFA 5AQLA 4ZHRA 3LM9A 3LDQA 4OPKA 4KO0A 1Y97A 2Z1HA 1KAXA 4YOYA 4YOTA 3UE5A 3A5MC 1QVFM 1SAZA 1WSJA 5MLCQ 3WNFA 4CHYA 2Z1JA 2E6MA 3V1QA 3QMLA 4H0VB 4GKKK 2XY6A 4B9NA 4BR0A 3H45C 5F1XA 4DUZK 2I7NA 3OBYA 4W5RA 1YJWN 4YORA 4IFYA 4BRHA 3OS2A 1YITN 4YOWA 3HVTA 3DXMA 4CF0A 5AFUH 4XH5A 1XC9A 4LF5K 4X66K 3A8YA 3C6AA 2BH1A 1JXBA 3KD5E 3I33A 2XY8A 2XY5A 1SKSA 3OYHA 1YHQN 3PIOL 4CVNE 5EY4A 4DB3A 4BRQA 1RFQA 5C42A 4H0XB 5ADXH 2X6NA 3H6EA 3ZETB 3IAYA 1F21A 4B9MA 1EKEA 3DLRA 2E6LA 3BF3A 5C25A 4IOAL 4GV6A 4FK2A 3VF6A 2P5OA 3HP9A 5AQWA 5GAGP 1RT6A 2HHUA 1QSSA 4A2AA 1VSFA 3DLHA 3QLHA 4H5TA 3TPQA 5HROA 3SYZA 4DFKA 4CK2A 2G8IA 3RR8A 1BCOA 3AAPA 3NVMA 4FWMA 4JEPA 1DEJA 4CGDA 5F0XA 5HRSA 2OPRA 2O8EB 3DXKA 3GL1A 1W2BM 4DS4A 1P8ZA 4OPHA 3TR8A 2HOEA 3AGRA 3AV9A 4DR4K 4F4KA 4NXNK 3OYKA 1RDWX 3L2WA 1DT9A 1WAFA 3AVMA 2GUPA 1YI2N 3GG4A 3VGLA 1XNQK 4CGIA 3ULEA 3RTVA 4KI4A 3L6QA 4Y1DA 4TSXA 4JI3K 2OANA 5C12A 1DKGD 1MDUB 1HLUA 3C65A 4JD2A 4F2SA 3ZCMA 4YDUA 1GLLO 4O4GA 3RMDA 2VG5A 3O9TA 2KLAA 3C6HA 2IDOA 1BL3A 3I56N 2F9TA 3C94A 4RW7A 3MXJA 4CF2A 3J8AA 4M3ZA 1NK0A 4H8KA 4AHSA 3GBTA 1VRUA 5IT9O 4NCAA 4BR7A 2HF4A 2IGIA 1TL3A 1HKCA 4E19A 4DQIA 4X64K 1WB9A 4XH1A 1GLEG 5LY3A 3O8MA 1LOTB 1U45A 1J54A 2YHYA 5AQQA 1HMVA 1JLFA 4FM2A 4FJGA 3K9KA 2E1ZA 2QXFA 2HW3A 2ZGZA 3SQ0A 3G25A 5JMVA 3OJUA 3OYLA 1JL2A 1VQNN 4JKAA 1VQMN 3MWPA 4CHOA 3IDHA 2YI1A 1HUXA 2XY7A 2O4GA 2ZF5O 3QDKA 1QZ6A 3JAMO 4H03B 4HUEA 5BREA 1K8KA 4BQZA 4E1NA 5KPRA 1NK9A 4CESA 3QO9A 4CW7B 1TK5A 3D2FA 3I0RA 3BP8A 3TSUA 4ELVA 1S9EA 3EE9A 4H5WA 2YKMA 4CJEA 1NKCA 4AF1A 3DRSA 4BC4A 3OYGA 2YX6A 1ZBFA 3ENOA 3L0QA 2IS3A 4KH4A 5LMNK 4I9LA 3NH2A 1JLGA 1BOTO 4EP4A 3OYBA 1K9MO 4DSJA 2BGGA 2O4IA 4YFUA 3K58A 4OKJA 1O1WA 3MX2A 4CBUA 4CJTA 1RT5A 2IIRA 1FXXA 3WNEA 5AQHA 3VQPA 3ZYYX 1GOCA 1TK8A 2F4VK 5AQPA 3CCLN 3BDPA 4DCHA 3QBWA 5J2NA 4FW1A 4EIAA 4DQSA 3EY1A 2CH5A 4CJPA 4DTUA 1HKBA 3NF8A 5M1OA 1KC8O 4FLVA 3AVAA 3RR7A 3CFPA 4DTSA 4JNEA 2NRRA 1VQ9N 5BN8A 1SL0A 4BVOA 1KRPA 1KD1O 1C0UA 1T6DA 3AO2A 3J80O 4CZKA 5AZIB 1SV5A 2VWBA 3VTIA 3DM2A 1NK4A 2FBVA 1D4XA 3WXIA 4FJJA 4DQRA 3SPYA 4IOXA 5BN9A 1BWFO 2QI2A 4ICLA 2P9PB 5M1NA 4Z94A 4DR5K 3TAGA 2E5LK 4EZ9A 3HI0A 3SUOA 5CE3A 2RKIA 1XUPO 1S9GA 1G99A 4DU1A 4EFHA 4NYFA 3EYZA 5JICA 4PL8A 1QQOA 3TU5A 1S1XA 1NNEA 5C0YA 3C7NB 3VOVA 2OTJN 3R1XA 4FJLA 4DV0K 4C8KA 3QNOA 3BZCA 1HR0K 2QKBA 1QVGM 1X9SA 2GEMA 4RG8A 1YF5L 3LP0A 2YNIA 4CD1A 1YXQA 1M90O 3OYCA 4CJVA 4E89A 4DR2K 1VQ4N 1OH6A 1JJ2M 4LFBK 1GLDG 1IV0A 5JLFA 2D0BA 1E4GT 4B9QA 3SJHA 2Q3SA 5AQIA 4E7IA 5SZTA 3VQDA 3T1HK 2P9KB 1J6ZA 1TUYA 4A62A 3RWUA 4KHSA 3QEIA 3NFAA 3OA9A 1EP4A 1VQKN 4F9OA 1CZAN 1YVNA 4DR7K 4DV6K 4BRFA 4G9ZA 1ASUA 2OPQA 3DAWA 4IFVA 4CE9A 5J2QA 4GVEA 3VQEA 4JK9A 4LF6K 3QBXA 3IMXA 4J8FA 4CF8A 3EKSA 3FZLA 1CLQA 3MMVA 3SUNA 4K25A 3O3FA 1REVA 3K2PA 4GY2B 1D9DA 4CJ5A 3LDOA 2D1KA 3KLHA 3I55N 3V81A 3TTFA 4Z4GA 4AHVA 3E01A 4KBOA 3V9XA 4JHDA 1JCFA 3DLGA 3OYAA 1EO1A 3QESA 4W5OA 1VRTA 1RBRA 2P1JA 3VENA 3VEVA 1RT7A 1T05A 5FRMA 5E26A 2FBYA 4BDYA 4HUGA 5FLXO 1BI4A 3MEGA 2O8BA 2DY4A 1TV6A 4ISFA 2A42A 3FZMA 2ASOA 4C1NK 1VSEA 2UYTA 3DYAA 3WNGA 4FOEA 2P51A 4CJRA 4M63C 5KRTA 3T3FA 1W7AA 4JN4A 4FLTA 2O8DA 4Z4FA 2P9UA 4L3QA 1IBLK 4BWMA 2QWMA 4BR9A 3PSIA 4WE1A 4H0YB 4RW8A 3TAQA 4E3SA 3TARA 2VGMA 3FFIA 4RWTA 3NH0A 2FXUA 3ENHA 4KH6A 1YTUA 4CEOA 4WFNL 5FDLA 4B9SA 1NMDA 4FJNA 4E0DA 3NMUA 1RBVA 3M8SA 4BRIA 4WF9L 2Q0RA 4FLWA 2VQFK 1NGAA 3AY9A 1TKXA 2RHKA 3SI6A 4PY5A 1LWFA 3KZBA 4CERA 3NH1A 2QWQA 4MDAA 3E66A 3M8RA 3WXMB 3HPOA 3HSCA 4K8XA 1ESVA 4BE2A 4PHTX 4ILHA 1JLBA 3ZSQA 4ELTA 4NLCA 3IS9A 4DSKA 3D7EO 1BIZA 1JLAA 3SK3A 3U9DA 1OKJA 2E2NA 1JL1A 3THVA 4B9VA 1U2VB 3F73A 1DGKN 1V4SA 1CZBA 1VAZA 4B1UB 4CIFA 1XNRK 1HNZK 3L4IA 2HHWA 1C1AA 3D6RA 4PKIA 3AVLA 4IO8A 3TTDA 1S5JA 3ATUA 4U67L 2QTDA 2VYPA 3VETA 5BRDA 4IZ9A 2B6AA 3QEVA 4KREA 4AM6A 1IG8A 1TKDA 3L4QA 3KTQA 2VCPA 4DMNA 3HXMA 1VQ5N 1TK0A 2VQEK 4RCHA 3O6WA 1B9FA 1NK8A 4CZMA 3ZX3A 2O8FB 3I8BA 5E84A 2HHHK 3HK2A 3VN5A 2HVIA 3LM2A 2FSNA 3CC4N 2A41A 4U7BA 1NKBA 4DUYK 3O1WA 4DF8A 3SJJA 1SS6A 3NHGA 1S1UA 1V4TA 1VSHA 3G71N 3MCPA 3SV4A 4E1JA 1NJZA 4KB1A 1SQKA 4KHPK 2NRHA 5A2QO 5AZJA 1ZYQA 4FPAA 3C6TA 3SUQA 4W5NA 1VSJA 3AVBA 2G8KA 3G6EN 3LANA 2QWNA 3KLEA 4FXDA 2A1SA 4ILGB 4IJAA 4IO9L 2D5RA 1H1VA 4JKDA 4NB4A 1NJXA 3JYTA 3AVJA 4K8ZA 3AVIA 1NGJA 5DK5A 1J53A 4LH4A 1C0MA 5M1PA 5KPZA 4DSFA 1WSFA 2W40A 4H4OA 3JS6A 5BRFA 4LF8K 4BRPA 4MLEA 1NK7A 1NBWA 4C23A 3M8PA 5E41A 4KPYA 1GOBA 4KV8A 5AQJA 1JKHA 3LPTA 5AQFA 2B5JA 2LSNA 5CYQA 2Q0UA 1TYQB 4FJKA 4B1WB 4OPAA 4A61A 4HHTA 4FYDA 3LDNA 4CFBA 3I8DA 3E1YA 2I7PA 3EZ5A 4BWJA 4LF7K 4FL9A 1ATRA 5FPEA 4EHUA 2AP1A 4JKGA 2VWKA 1RT3A 4R5PA 3VESA 4HTLA 4E7HA 4J2AA 1CXUA 2ITMA 2A6AA 2O8CA 1NU0A 2G8UA 5AQZA 1VSLA 3OJSA 1N36K 4FK0A 4CGHA 3MK6A 1LW2A 2HHSA 2YJEA 3AO4A 3P1GA 4M7XA 4DTMA 1DTQA 3G0ZA 3H08A 4FJHA 3K5LA 2NUBA 4I6MA 3SUPA 3HM9A 3ZX0A 5HRPA 5DMRA 5J2MA 1HX1A 4B1ZA 4A5BA 4CZJA 1Q7YO 1HYZA 3P83D 3Q7BA 2HBMA 2HNZA 1FKOA 2V51B 4CF1A 5CY4A 1HPMA 4B3SK 1OVQA 3NGZA 1SZ2A 4OGCA 3SBTA 2G8HA 2XO7A 2GV9A 4RW4A 3L8BA 4K0KK 3CCVN 4CJFA 5JLHA 4BDPA 4Z0UA 1MWMA 3AARA 4CJ7A 4F3TA 1X9JA 3BY5A 3OYNA 4N76A 2GWJA 2NRXA 3R8EA 1HJRA 3NVKA 1EQYA 3U6FA 5KGWA 4DV4K 3OYMA 4K42A 2DFHA 1JCEA 4OVLA 4BRLA 1NKEA 1C0GA 1GLFO 4H5RA 4XIUA 3NGYA 4DTPA 4JI7K 3JSMA 3OYFA 1X3MA 4OJRA 3ULDA 4FLYA 4FLUA 1IG9A 4CEDA 3PV8A 2ZGYA 4B3MK 4Q0BA 2YNFA 1HNVA 1NJYA 3U4LA 1S3XA 1UWBA 4MLHA 4IEEA 2OTLN 4JV5K 3CC2N 2Y1JA 3ZT0A 3C6UA 5LJVA 4CFAA 1KLMA 4CK3A 1N6QA 1NGEA 3WEEB 4BE0A 4M3UA 2GELA 3QIPA 1FK9A 1QS4A 3HOSA 3CF5L 2ITGA 1GLAG 3CQYA 3MEEA 5AZIA 3WXKA 3RRGA 2UXBK 1K8AO 2UXCK 4CJKA 1KSPA 1FKPA 3O5BA 3CETA 3AVCA 1JLEA 4DHYA 5BR9A 3DOKA 4BVPA 3LP1A 2ZD1A 5KGXA 1TKTA 1U04A 3V9WA 3DMJA 3ZSOA 3T19A 2P9PA 3CPEA 2QWOA 3LZIA 3LWLA 5CZ2A 1HNWK 3DRRA 2IVPA 3KK3A 3FZFA 2P5GA 3C7NA 4BACA 2UU9K 4Z4CA 1S1TA 3OYEA 3CC7N 4DTOA 4B8CA 4LC9B 1N8RO 3E9PA 1GLBG 4BR2A 3CPWM 4BRDA 3D2EA 2CGLA 3J7AP 3T69A 4O44A 3TANA 4OO1J 4AILC 1WAJA 3EO3A 3R6MA 1OVYA 4BRAA 3WUHA 2EX3A 1T8EA 1RT1A 3HOTA 3GOIA 4JKHA 4O0IA 2G8VA 4FWKA 3D45A 3LP3A 3M5RA 4KHUA 4UY8O 4H0TB 3CQXA 3SAFA 1DLOA 3DJCA 2KFNA 4ID1A 2ETJA 3ITHA 1XHXA 2W6KA 4OX9K 4F3OA 4BRCA 5KQDA 4DV1K 3BGRA 1BO5O 5FROA 3SMPA 4GNIA 4C8MA 4IEIA 4B1VA 3K5MA 2ZQBA 5KPTA 1LV5A 5CHIA 3OS1A 4JKCA 3VA3A 3TAEA 4JLHA 1RDCA 4BC2A 4CEZA 1IKVA 3PY8A 5AQTA 1CXQA 3P5JA 4DQ8A 3WQUA 3VGMA 1X3NA 4F2RA 1YIJN 5I3UA 3DLEA 2QWRA 1FW6A 3OBWA 3O9SA 2Y1IA 2I5JA 4KTZA 1SUQA 3P39A 3B6PA 3OYDA 1RDUA 1UAXA 4H5VA 2UUBK 1W0HA 3CJ9A 2YHWA 1KVCA 2YHBA 3VQ7A 3KK1A 5BPNA 3ZSXA 1RTIA 3S41A 5H1SQ 4EAHD 3SMSA 1B92A 2BUPA 1Q8IA 1A5WA 3DXKB 4CGGA 1VQ7N 3N4PA 1TVRA 2IAJA 1WSIA 4CGJA 1VSDA 3QETA 3CFOA 3MDQA 3L2QA 4FCYA 3HO1A 2F8SA 3MX5A 1OH7A 3CM5A 3CCQN 1UA0A 2PBDA 5FPNA 3EE8A 5HRRA 4A59A 3ULEB 4KI6A 3PLAA 3HZ6A 3VEXA 4EZ6A 3CCMN 5C2DA 3PUFA 2EHGA 3PO4A 4E7KA 3M3ZA 3K57A 3B6OA 1WSHA 3O1BA 4BC3A 1TL1A 4I2PA 2KFZA 1S1VA 4GVMA 1IKXA 1QHAA 2FLOA 2JLEA 4JKBA 3VTHA 1E3MA 3U9ZA 3W3DA 4M3XA 4PL7A 5JS2A 3U8XA 4WCEL 1U2VA 1XI1A 2OA8A 2P9LB 3QFPA 3KK2A 1LAWA 3A5LC 4IOCL 4IBNA 1YVUA 1ZBSA 3HBTA 4DV3K 3HRGA 3QEWA 4JI1K 1RCHA 4CIEA 2KTQA 1VSKA 2W6LA 1IBKK 4W5TA 5KTQA 1VQ8N 4CEEA 3V1OA 5EXWA 3ISNC 2HSTA 2Z1IA 5HP1A 3P38A 2Q36A 2A3ZA 4YHHK 3CD6N 2QXLA 2X6SA 4B9LA 1RT4A 1ITGA 1QZ5A 2O8FA 2KQ2A 2GBZA 3CYMA 3RSEB 3CIPA 3L2RA 4NCBA 3A2FA 4EP5A 3ZT4A 2B4JA 4KRFA 3R3LA 2HHQA 3SLCA 1BCMA 1K8KB 3P31A 1X9MA 3BZKA 2P9SA 3CHWA 3HJFA 3THWB 3A0IX 3H1VX 3RVCA 1YJ9N 4AHCA 3ZEUA 3F2KA 1XMOK 4GMJB 3F9KA 3CJCA 1RILA 1E4FT 3CG7A 3LAKA 4Z4EA 2Q2RA 4WQ4C 4CZLA 2NRZA 4NCGA 1C1BA 3PX4A 1N32K 3ZX2A 1BG3A 5AQYA 3RMAA 4QS7A 3SBGA 4DV2K 2D0CA 3VQ6A 1ASVA 3OVNA 3LDSA 2HMPA 4CIGA 1TAUA 1VQLN 3VF2A 3AO1A 3K5OA 4E7JA 3OYJA 1X1PA 3VQQA 3LAMA 5LJWA 1JCGA 2OZSA 2NNWA 1C1CA 1Q82O 2HVHA 3DLLL 2VG6A 1NGHA 3O4NA 3UKUA 5KQ8A 1KFDA 2P9NA 2A1RA 1RTJA 3M6GA 5GAEP 4DFPA 1U47A 1Z6RA 4WQ5C 2IOCA 2YKNA 1Q9YA 4KKOA 4B8AB 4JK7A 1TYQA 2OCEA 4LY7A 2ZJRL 3WNHA 1J5EK 1IKWA 4FM1A 3TSQA 4FWOA 3CCRN 1KQSM 5FPMA 1Q86O 3WT0A 1RT2A 2KZZA 2WOMA 4J2DA 4JKFA 2QKKA 4CGFA 4DR6K 1HNIA 4BRMA 1NGCA 3BEXA 2HHXA 3UB5A 3LDPA 4PWDA 1BA0A 4DKWA 3S9HA 2HB5A 3OHRA 2WTUA 1NK6A 3O80A 2RE2A 1KTQA 2YCHA 3JXUA 2CH6A 4CJUA 4RTFD 4KHYA 4O55A 3THXB 4FO0A 3VQ9A 3ENBA 1IJJA 2Q1NA 3AAQA 1D9FA 1T44A 1W97L 3VF4A 3NDKA 1HQUA 3AA4A 3CJBA 4FPBA 4JS4A 3VMFB 3MEDA 2ZJPL 4FSVA 5AJ3K 3O9QA 2NLXA 1L3UA 4LFCK 4FJMA 4IFEA 1A5VA 4NLBA 2HHVA 1C0TA 1RNHA 2KHOA 3HP6A 1T6CA 1OH5A 2FF3B 4M45A 2VG7A 3ZETA 3RRHA 5C15A 4HCCA 3FFKB 2E2QA 2E2OA 5C10A 4M42A 1G15A 1R0AA 4PA1A 5JVHL 3K5NA 4CEQA 3ASMA 3QNNA 3MN9A 4FVMA 4W5QA 2PAVA 2E88A 4IJNA 3QICA 4MDBA 4OGEA 5SWMA 3OTOK 5HOOA 2O8EA 4CHPA 1BA1A 3LWMA 3VQAA 1MU2A 2YNHA 3SQ1A 1QQNA 4JI4K 3VQ8A 2UUCK 4IKFA 4Y1CA 3CJ7A 3J7YP 1NWKA 3AA2A 1VQPN 4I2QA 4R79A 3D0PA 4ILJA 3LP2A 4KHQA 4DTRA 3SQ2A 3MECA 1D8YA 4RW9A 3UKRB 5M1KA 4CZEA 5T7BA 3QB0A 3WEEA 3VEWA 2O8BB 4IDHA 3EN9A 4FM0A 5HLFA 3QEXA 4CZGA 3TSPA 3L2UA 2AJQA 3IKMA 1YUWA 3K59A 1IH7A 1M1KO 1TAQA 3UIQA 2O8DB 2P9UB 4DQPA 4B9UA 1I39A 4CJ4A 3NCIA 2ZM6K 3NE6A 1QQMA 3SPZA 1BDGA 4KHNA 4IG0A 1WNSA 3PIPL 4FW2A 4OLAA 2FF6A 1C0FA 1ZBUA 4GKJK 2FBTA 4CD3A 1ZBIA 3KLFA 4DQQA 4A57A 1ZC6A 3OS0A 3F9MA 5GADP 3FZHA 3TI0A 1L3SA 1NOYA 3CJAA 4CEBA 1S22A 1ASWA 2E2PA 4GV9A 4YY3K 4EHTA 1VQ6N 3AGKA 3J81O 4O0JA 2BE2A 4OKEA 3OYIA 2ZWHA 1EWRA 2P9IB 2ATQA 3MCAB 2R7YA 4IDKA 5BR8K 4N47A 1RDBA 5AQVA 4DLGA 3IFRA 4JS5A 3VQBA 4DSLA 4IXCA 5AR0A 2HMIA 4NXMK 1I94K 1LWCA 1HJOA 4AHUA 4C8NA 5ELZA 3CERA 4LF9K 3KWGA 4CEFA 3QINA 4M3RA 4CJ3A 5HRNA 4N5SA 4LSNA 5HBMA 3GE1A 4MQ3A 1ZBLA 2Q97A 4BG9A 3CCUN 4BDZA 2RPIA 2H3GX 4AH9A 2XRIA 4JRPA 3QERA 3H3NO 3TABA 3THYB 3VGKA 1EXQA 4DFJA 2CGJA 2A40A 3VQCA 2JWKA 1RDAA 4PQUA 3DLBA 1ATNA 4JI5K 1Z05A 3EL2A 2JWLA 1WSEA 1QE1A 4B08A 4F8RA 2D0PA 3U3GA 5HL7L 4YOUA 3FLCO 4O8KA 2PZSA 2DPNA 3TAPA 5CZ1A 3N4QA 1Q81O 3ID8A 3TWHA 4M3WA 1Z25A 5AZJB 4DSEA 3K0SA 4JKEA 3KD1E 1BIUA 4BG8A 4DV7K 3CI5A 4DU3A 1KLNA 3CFRA 1YJNN 2ASPA 4J2EA 3EZWA 3KKRA 4CK1A 3G4SN 2PYLA 3HPHA 1BISA 4QS9A 5AQXA 3BF1A 4YDUC 4BE1A 2VGNA 2QWLA 3DI6A 3KLGA 3F5TA 2A5XA 1FJGK 5AQRA 3LDLA 1WBBA 2HBJA 4IG3A 1T03A 2YNGA 4H4MA 2J4RA 3G10A 1RBSA 2DTUA 5JVGL 3T1YK 1NOZA 5IWAK 3OY9A 3MXMA 4C1NI 1BGXT 5AQUA 4BRNA 4B3RK 3ZT1A 2BDPA 4DS5A 4CZHA 4CCHA 2NRVA 1NM1A 3HM8A 4H5NA 5GIOA 2QWPA 2P9LA 5CYMA 4X65K 1KAZA 1CZ9A 1L3TA 4FLZA 1NGBA 1XWLA 2FSKA 3KK7A 1VSIA 5BPLA 4I7FA 3CMAN 4KHWA 5TKYA 2JGUA 3SQ4A 4FZZA 4KFBA 3O9UA 3IUCA 3O08A 3MXIA 4JKGB 4MO5A 3S3OA 1NGDA 4PUOA 3PX0A 2YV0X 1HYVA 4J2BA 4FZYA 4FWQA 2QM1A 3H46O 2P9KA 3PSFA 4FVUA 4M3YA 2O8CB 2G8WA 1EX4A 5EOYA 3H3OB 1HRHA 1HQEA 3ZSZA 3KVGA 1L5UA 4CHNA 4JI0K 3AVKA 3RSEA 3T1AA 4QAGA 4I6MB 4DF4A 4NO7A 3CMEN 3PO5A 3AVFA 4CJSA 5EVZA 1RBUA 4ID5A 4LF4K 1QQCA 1ZBHA 4CBXA 4FWPA 2KW4A 3SAHA 1QSLA 4C8LA 2V7ZA 1UA1A 3L3VA 2D0AA 3BUZB 3VERA 3DXMB 4CBWA 3THWA 4JI8K 4KAZA 3V9UA 3E9OA 5AQKA 5KI6A 1WSGA 4CJQA 1J9AA 1S6QA 1L3VA 3RMCA 5AQMA 3A5OC 4FJIA 1VHXA 3M8QA 4BREA 4CHQA 4BQLA 2XHBA 3VEOA 5BRHA 2GX9A 2V52B 4FK4A 1GLCG 2GWKA 2FBXA 3W0LA 1A5XA 4HTUA 3A5NC 3C95A 4H0OA 3E9LA 2V7YA 2PFUA 3DLKA 1VK0A 3R9PA 4WFAL 3O4QA 2KZMA 4FOIA 2F9WA 5LL6Z 3L2VA 4DLEA 4B3OA 4LSLA 2HBLA 3TTCA 1WUAA 3B8AX 3S3NA 2Q31A 4WFBL 2FSJA 4QCLA 1I3AA 1YTAA 1HNXK 1ATSA 1XMQK 4XH4A 1DTTA 3U3YA 1D5AA 2HBKA 2ASMA 4YNQA 1SKRA 3GDQA 4ZTJA 2PY5A 3TAMA 1ILYA 3VEZA 4XEIA 4BRGA 4KTQA 3P4IA 2HHTA 3CCJN 2FC0A 1IBMK 1TUUA 1KVBA 4JAXA 5AQSA 1BHLA 1Y64A 3O3GA 1J5OA 3KWIA 3ZT3A 4PKGA 2AA4A 4BGBA 3AVNA 2WONA 4JD2B 5GAHP 2F7TA 3MN5A 4H0PA 1Q9XA 4O5FA 4ISEA 1BQNA 4M41A 4Q5VA 4BGAA 2NRWA 4WYBA 4Y0WA 3O3HA 4K41A 3CQ8A 2WBNA 4ELUA 3SZ2A 3SNNA 2OZMA 3EEQA 5I9EB 4RW6A 1MA9B 4FJ5A 4B9TA 3HSTB 3NBPA 3PX6A 2GTDA 3THXA 5DM7L 4CF9A 2E1YA 2WUSA 1NGIA 1NMNA 5FRNA 4ISGA 2GUIA 1UOCA 3KHYA 3I0SA 1KXPA 4DU4A 1WLJA 4HUFA 3KLIA 1RTDA 1NJIO 3LALA 2E4LA 5BPMA 4BY9C 2IVOA 3HT3A 4B1XB 1U4BA 2QA4N 1RDDA 3D2EB
chains in the Genus database with same CATH topology
4DR5K 4LFCK 2E5LK 4LFAK 3JAMO 4YY3K 2UU9K 4B3SK 4KHPK 5A2QO 3J81O 4B3TK 1FJGK 1N32K 4CW7B 4DV2K 4K0KK 4DV0K 5LL6Z 5BR8K 2UXDK 1HR0K 3J7AP 2VQFK 3T1YK 5IWAK 4DR4K 1HNXK 1N34K 1XMQK 4DR2K 4NXNK 4B3RK 4NXMK 1I94K 4LFBK 4AQYK 4LF9K 4DV4K 3OTOK 1XNQK 5LMNK 4LF8K 4X62K 4JI2K 3T1HK 4X65K 1IBMK 4OX9K 4JI7K 4V19S 4JI3K 4DV1K 4JI4K 2UUCK 3J7YP 4B3MK 4DR7K 4DV6K 5LMUK 1J5EK 4DV3K 4DV5K 4JI6K 4LF6K 4JI1K 1XNRK 1IBKK 1HNZK 4JV5K 4DR6K 4DR1K 2F4VK 4JI5K 4GKKK 5IT9O 4LF7K 4YHHK 4DUZK 4JI0K 4X64K 4DR3K 2UUBK 2VQEK 2UUAK 4LF4K 2UXBK 4LF5K 4X66K 2UXCK 5FLXO 1N36K 2ZM6K 3J80O 4JI8K 4CVNE 2HHHK 4JYAK 1N33K 4GKJK 4DV7K 4DUYK 1HNWK 1IBLK 5AJ3K 1XMOK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 K;  4LFC K;  2E5L K;  4LFA K;  3JAM O;  4YY3 K;  2UU9 K;  4B3S K;  4KHP K;  5A2Q O;  3J81 O;  4B3T K;  1FJG K;  1N32 K;  4CW7 B;  4DV2 K;  4K0K K;  4DV0 K;  5LL6 Z;  5BR8 K;  2UXD K;  1HR0 K;  3J7A P;  2VQF K;  3T1Y K;  5IWA K;  4DR4 K;  1HNX K;  1N34 K;  1XMQ K;  4DR2 K;  4NXN K;  4B3R K;  4NXM K;  1I94 K;  4LFB K;  4AQY K;  4LF9 K;  4DV4 K;  3OTO K;  1XNQ K;  5LMN K;  4LF8 K;  4X62 K;  4JI2 K;  3T1H K;  4X65 K;  1IBM K;  4OX9 K;  4JI7 K;  4V19 S;  4JI3 K;  4DV1 K;  4JI4 K;  2UUC K;  3J7Y P;  4B3M K;  4DR7 K;  4DV6 K;  5LMU K;  1J5E K;  4DV3 K;  4DV5 K;  4JI6 K;  4LF6 K;  4JI1 K;  1XNR K;  1IBK K;  1HNZ K;  4JV5 K;  4DR6 K;  4DR1 K;  2F4V K;  4JI5 K;  4GKK K;  5IT9 O;  4LF7 K;  4YHH K;  4DUZ K;  4JI0 K;  4X64 K;  4DR3 K;  2UUB K;  2VQE K;  2UUA K;  4LF4 K;  2UXB K;  4LF5 K;  4X66 K;  2UXC K;  5FLX O;  1N36 K;  2ZM6 K;  3J80 O;  4JI8 K;  4CVN E;  2HHH K;  4JYA K;  1N33 K;  4GKJ K;  4DV7 K;  4DUY K;  1HNW K;  1IBL K;  5AJ3 K;  1XMO K; 
#chains in the Genus database with same CATH topology
 2NZT A;  2YHA A;  4CFD A;  1LAV A;  1WN7 A;  5I42 A;  4M7Y A;  2KKZ A;  3O9R A;  2NRT A;  4FJX A;  3HPG A;  3IRX A;  1W9H A;  2DFE A;  5DM6 L;  4C8O A;  4OLB A;  1SL2 A;  3CCE N;  4FWS A;  4FWN A;  4FJ7 A;  3S3M A;  1GOA A;  4BC5 A;  3D2F B;  3OW2 M;  3NAE A;  4DG1 A;  2IC3 A;  2OPP A;  3KKS A;  2QW9 A;  4MFB A;  5EU7 A;  2Z1G A;  1N34 K;  2E20 A;  4N41 A;  4BR4 A;  5C24 A;  4HWI A;  4ZTF A;  4FJ9 A;  4FLX A;  1NJW A;  4AM7 A;  1NK5 A;  2VWJ A;  3CXC M;  1KCF A;  1TKZ A;  3NF7 A;  4HVJ A;  4JK8 A;  1ZXO A;  4E7L A;  2F96 A;  4X62 K;  5TKW A;  5J1E A;  1N5Y A;  3DOL A;  3L3U A;  4V19 S;  2WC9 A;  1TGO A;  1NG9 A;  2BTF A;  4OPJ A;  5CR4 A;  4Z4I A;  3UKR A;  1QSY A;  5LMU K;  4DV5 K;  4WQ4 A;  4JI6 K;  5FPD A;  4GW6 A;  1U49 A;  3ZSY A;  1BU6 O;  4PKH A;  1EWQ A;  3EKU A;  3AO3 A;  3CCS N;  1U48 A;  1XHZ A;  4DSI A;  4FWL A;  4OKK A;  3ZSR A;  3MAQ A;  4L8R B;  2OYQ A;  2PYJ A;  1Q18 A;  5GIP A;  4HCB A;  3VPZ A;  3ZLJ A;  3V4I A;  2RN2 A;  5B8H A;  4QS8 A;  3HVR A;  4E1M A;  4DR3 K;  5AQN A;  4M3T A;  3SCX A;  1LCU A;  3WXL A;  1S72 N;  1P90 A;  3FE1 A;  2UUA K;  1KAY A;  3QEP A;  4NYN A;  1NGG A;  4LH5 A;  3WXJ A;  2F8T A;  5AFU A;  2W42 A;  3MN6 A;  4WQ5 A;  3CM6 A;  1QTM A;  3HL8 A;  1K6Y A;  1NGF A;  3AVH A;  1JLC A;  3Q7C A;  3V6D A;  4IWV A;  4CFC A;  3ZT2 A;  5ADX A;  4CHZ A;  4G1Q A;  4CEC A;  3AA5 X;  4DTJ A;  5D3G A;  1LWE A;  2P9I A;  2HND A;  3DWL A;  3FR0 A;  4N56 A;  4DWI A;  4CJL A;  1VQO N;  3VA0 A;  3K9J A;  3AVG A;  2EWS A;  2G8F A;  4K43 A;  3KJV A;  1JLQ A;  1VSM A;  1JXE A;  1MWK A;  2UXD K;  3VEY A;  1IKY A;  3VQ4 A;  1NLV A;  1S6P A;  3DRP A;  4B1Y B;  4CJW A;  3C0B A;  2YHX A;  1HKG A;  4AHR A;  3CJ1 A;  4BR5 A;  4YOX A;  3H1Q A;  4AQY K;  4KH5 A;  1RGI A;  2E8A A;  2D0O A;  5JS1 A;  2ZE2 A;  3WQT A;  4QOZ B;  1RTH A;  1T3V A;  5F2R A;  3HYF A;  3HTV A;  5K14 A;  1SL1 A;  4FZX C;  1QHT A;  4KB0 A;  2HF3 A;  3NGI A;  3FGU A;  3V9S A;  3AA3 A;  4JRQ A;  3THY A;  2W41 A;  2YJF A;  5J2P A;  1RBT A;  1K73 O;  1XC3 A;  1IO2 A;  2IVN A;  3SV3 A;  4DTN A;  1O13 A;  3ATV A;  1S1W A;  1YAG A;  3ZSV A;  4Z4H A;  3V1R A;  4CEA A;  3FZK A;  4DR1 K;  2QK9 A;  3RMB A;  4BRK A;  1C6V A;  4FWR A;  4MO4 A;  4GV3 A;  4UQG A;  3TAF A;  1X9W A;  4O5B A;  1B9D A;  2P9S B;  1R59 O;  3ID6 A;  5GIN A;  1WOQ A;  5AQO A;  3O4W A;  4JHD B;  3ZEU B;  2DFF A;  1Z26 A;  2X78 A;  1OH8 A;  1KVA A;  3SAG A;  3MWT A;  3AO5 A;  4O8U A;  3T7Z A;  4FJ8 A;  1BI4 B;  4JYA K;  4BRO A;  2CGK A;  3VQ5 A;  5AQG A;  1N33 K;  4DFM A;  4CZI A;  1KFS A;  1HYS A;  3QFU A;  3LPU A;  2BAN A;  1GLJ O;  3ALY A;  4LFA K;  5C2F A;  2WFB A;  3M1F A;  4B3T K;  1BQM A;  3LL3 A;  5M1Q A;  3IG1 A;  3UKU B;  1WBD A;  1YT3 A;  1HPZ A;  4DTX A;  2P9N B;  2X74 A;  3J7Z O;  5KRS A;  4LD0 A;  4AHT A;  1BUP A;  2D4W A;  4YOV A;  1XQS C;  3LZJ A;  3V9Z A;  3NF6 A;  4A5A A;  5M1F A;  1LW0 A;  2RF2 A;  3MN7 A;  3KIO A;  4A2B A;  2OPS A;  1T7P A;  2ZJQ L;  5EX5 A;  4I9Q A;  4CI6 A;  2HNY A;  3NF9 A;  3QIO A;  2QEX N;  4KTW A;  4JI2 K;  1U6Z A;  1SKW A;  1EET A;  3ZSW A;  4CZF A;  5AQL A;  4ZHR A;  3LM9 A;  3LDQ A;  4OPK A;  4KO0 A;  1Y97 A;  2Z1H A;  1KAX A;  4YOY A;  4YOT A;  3UE5 A;  3A5M C;  1QVF M;  1SAZ A;  1WSJ A;  5MLC Q;  3WNF A;  4CHY A;  2Z1J A;  2E6M A;  3V1Q A;  3QML A;  4H0V B;  4GKK K;  2XY6 A;  4B9N A;  4BR0 A;  3H45 C;  5F1X A;  4DUZ K;  2I7N A;  3OBY A;  4W5R A;  1YJW N;  4YOR A;  4IFY A;  4BRH A;  3OS2 A;  1YIT N;  4YOW A;  3HVT A;  3DXM A;  4CF0 A;  5AFU H;  4XH5 A;  1XC9 A;  4LF5 K;  4X66 K;  3A8Y A;  3C6A A;  2BH1 A;  1JXB A;  3KD5 E;  3I33 A;  2XY8 A;  2XY5 A;  1SKS A;  3OYH A;  1YHQ N;  3PIO L;  4CVN E;  5EY4 A;  4DB3 A;  4BRQ A;  1RFQ A;  5C42 A;  4H0X B;  5ADX H;  2X6N A;  3H6E A;  3ZET B;  3IAY A;  1F21 A;  4B9M A;  1EKE A;  3DLR A;  2E6L A;  3BF3 A;  5C25 A;  4IOA L;  4GV6 A;  4FK2 A;  3VF6 A;  2P5O A;  3HP9 A;  5AQW A;  5GAG P;  1RT6 A;  2HHU A;  1QSS A;  4A2A A;  1VSF A;  3DLH A;  3QLH A;  4H5T A;  3TPQ A;  5HRO A;  3SYZ A;  4DFK A;  4CK2 A;  2G8I A;  3RR8 A;  1BCO A;  3AAP A;  3NVM A;  4FWM A;  4JEP A;  1DEJ A;  4CGD A;  5F0X A;  5HRS A;  2OPR A;  2O8E B;  3DXK A;  3GL1 A;  1W2B M;  4DS4 A;  1P8Z A;  4OPH A;  3TR8 A;  2HOE A;  3AGR A;  3AV9 A;  4DR4 K;  4F4K A;  4NXN K;  3OYK A;  1RDW X;  3L2W A;  1DT9 A;  1WAF A;  3AVM A;  2GUP A;  1YI2 N;  3GG4 A;  3VGL A;  1XNQ K;  4CGI A;  3ULE A;  3RTV A;  4KI4 A;  3L6Q A;  4Y1D A;  4TSX A;  4JI3 K;  2OAN A;  5C12 A;  1DKG D;  1MDU B;  1HLU A;  3C65 A;  4JD2 A;  4F2S A;  3ZCM A;  4YDU A;  1GLL O;  4O4G A;  3RMD A;  2VG5 A;  3O9T A;  2KLA A;  3C6H A;  2IDO A;  1BL3 A;  3I56 N;  2F9T A;  3C94 A;  4RW7 A;  3MXJ A;  4CF2 A;  3J8A A;  4M3Z A;  1NK0 A;  4H8K A;  4AHS A;  3GBT A;  1VRU A;  5IT9 O;  4NCA A;  4BR7 A;  2HF4 A;  2IGI A;  1TL3 A;  1HKC A;  4E19 A;  4DQI A;  4X64 K;  1WB9 A;  4XH1 A;  1GLE G;  5LY3 A;  3O8M A;  1LOT B;  1U45 A;  1J54 A;  2YHY A;  5AQQ A;  1HMV A;  1JLF A;  4FM2 A;  4FJG A;  3K9K A;  2E1Z A;  2QXF A;  2HW3 A;  2ZGZ A;  3SQ0 A;  3G25 A;  5JMV A;  3OJU A;  3OYL A;  1JL2 A;  1VQN N;  4JKA A;  1VQM N;  3MWP A;  4CHO A;  3IDH A;  2YI1 A;  1HUX A;  2XY7 A;  2O4G A;  2ZF5 O;  3QDK A;  1QZ6 A;  3JAM O;  4H03 B;  4HUE A;  5BRE A;  1K8K A;  4BQZ A;  4E1N A;  5KPR A;  1NK9 A;  4CES A;  3QO9 A;  4CW7 B;  1TK5 A;  3D2F A;  3I0R A;  3BP8 A;  3TSU A;  4ELV A;  1S9E A;  3EE9 A;  4H5W A;  2YKM A;  4CJE A;  1NKC A;  4AF1 A;  3DRS A;  4BC4 A;  3OYG A;  2YX6 A;  1ZBF A;  3ENO A;  3L0Q A;  2IS3 A;  4KH4 A;  5LMN K;  4I9L A;  3NH2 A;  1JLG A;  1BOT O;  4EP4 A;  3OYB A;  1K9M O;  4DSJ A;  2BGG A;  2O4I A;  4YFU A;  3K58 A;  4OKJ A;  1O1W A;  3MX2 A;  4CBU A;  4CJT A;  1RT5 A;  2IIR A;  1FXX A;  3WNE A;  5AQH A;  3VQP A;  3ZYY X;  1GOC A;  1TK8 A;  2F4V K;  5AQP A;  3CCL N;  3BDP A;  4DCH A;  3QBW A;  5J2N A;  4FW1 A;  4EIA A;  4DQS A;  3EY1 A;  2CH5 A;  4CJP A;  4DTU A;  1HKB A;  3NF8 A;  5M1O A;  1KC8 O;  4FLV A;  3AVA A;  3RR7 A;  3CFP A;  4DTS A;  4JNE A;  2NRR A;  1VQ9 N;  5BN8 A;  1SL0 A;  4BVO A;  1KRP A;  1KD1 O;  1C0U A;  1T6D A;  3AO2 A;  3J80 O;  4CZK A;  5AZI B;  1SV5 A;  2VWB A;  3VTI A;  3DM2 A;  1NK4 A;  2FBV A;  1D4X A;  3WXI A;  4FJJ A;  4DQR A;  3SPY A;  4IOX A;  5BN9 A;  1BWF O;  2QI2 A;  4ICL A;  2P9P B;  5M1N A;  4Z94 A;  4DR5 K;  3TAG A;  2E5L K;  4EZ9 A;  3HI0 A;  3SUO A;  5CE3 A;  2RKI A;  1XUP O;  1S9G A;  1G99 A;  4DU1 A;  4EFH A;  4NYF A;  3EYZ A;  5JIC A;  4PL8 A;  1QQO A;  3TU5 A;  1S1X A;  1NNE A;  5C0Y A;  3C7N B;  3VOV A;  2OTJ N;  3R1X A;  4FJL A;  4DV0 K;  4C8K A;  3QNO A;  3BZC A;  1HR0 K;  2QKB A;  1QVG M;  1X9S A;  2GEM A;  4RG8 A;  1YF5 L;  3LP0 A;  2YNI A;  4CD1 A;  1YXQ A;  1M90 O;  3OYC A;  4CJV A;  4E89 A;  4DR2 K;  1VQ4 N;  1OH6 A;  1JJ2 M;  4LFB K;  1GLD G;  1IV0 A;  5JLF A;  2D0B A;  1E4G T;  4B9Q A;  3SJH A;  2Q3S A;  5AQI A;  4E7I A;  5SZT A;  3VQD A;  3T1H K;  2P9K B;  1J6Z A;  1TUY A;  4A62 A;  3RWU A;  4KHS A;  3QEI A;  3NFA A;  3OA9 A;  1EP4 A;  1VQK N;  4F9O A;  1CZA N;  1YVN A;  4DR7 K;  4DV6 K;  4BRF A;  4G9Z A;  1ASU A;  2OPQ A;  3DAW A;  4IFV A;  4CE9 A;  5J2Q A;  4GVE A;  3VQE A;  4JK9 A;  4LF6 K;  3QBX A;  3IMX A;  4J8F A;  4CF8 A;  3EKS A;  3FZL A;  1CLQ A;  3MMV A;  3SUN A;  4K25 A;  3O3F A;  1REV A;  3K2P A;  4GY2 B;  1D9D A;  4CJ5 A;  3LDO A;  2D1K A;  3KLH A;  3I55 N;  3V81 A;  3TTF A;  4Z4G A;  4AHV A;  3E01 A;  4KBO A;  3V9X A;  4JHD A;  1JCF A;  3DLG A;  3OYA A;  1EO1 A;  3QES A;  4W5O A;  1VRT A;  1RBR A;  2P1J A;  3VEN A;  3VEV A;  1RT7 A;  1T05 A;  5FRM A;  5E26 A;  2FBY A;  4BDY A;  4HUG A;  5FLX O;  1BI4 A;  3MEG A;  2O8B A;  2DY4 A;  1TV6 A;  4ISF A;  2A42 A;  3FZM A;  2ASO A;  4C1N K;  1VSE A;  2UYT A;  3DYA A;  3WNG A;  4FOE A;  2P51 A;  4CJR A;  4M63 C;  5KRT A;  3T3F A;  1W7A A;  4JN4 A;  4FLT A;  2O8D A;  4Z4F A;  2P9U A;  4L3Q A;  1IBL K;  4BWM A;  2QWM A;  4BR9 A;  3PSI A;  4WE1 A;  4H0Y B;  4RW8 A;  3TAQ A;  4E3S A;  3TAR A;  2VGM A;  3FFI A;  4RWT A;  3NH0 A;  2FXU A;  3ENH A;  4KH6 A;  1YTU A;  4CEO A;  4WFN L;  5FDL A;  4B9S A;  1NMD A;  4FJN A;  4E0D A;  3NMU A;  1RBV A;  3M8S A;  4BRI A;  4WF9 L;  2Q0R A;  4FLW A;  2VQF K;  1NGA A;  3AY9 A;  1TKX A;  2RHK A;  3SI6 A;  4PY5 A;  1LWF A;  3KZB A;  4CER A;  3NH1 A;  2QWQ A;  4MDA A;  3E66 A;  3M8R A;  3WXM B;  3HPO A;  3HSC A;  4K8X A;  1ESV A;  4BE2 A;  4PHT X;  4ILH A;  1JLB A;  3ZSQ A;  4ELT A;  4NLC A;  3IS9 A;  4DSK A;  3D7E O;  1BIZ A;  1JLA A;  3SK3 A;  3U9D A;  1OKJ A;  2E2N A;  1JL1 A;  3THV A;  4B9V A;  1U2V B;  3F73 A;  1DGK N;  1V4S A;  1CZB A;  1VAZ A;  4B1U B;  4CIF A;  1XNR K;  1HNZ K;  3L4I A;  2HHW A;  1C1A A;  3D6R A;  4PKI A;  3AVL A;  4IO8 A;  3TTD A;  1S5J A;  3ATU A;  4U67 L;  2QTD A;  2VYP A;  3VET A;  5BRD A;  4IZ9 A;  2B6A A;  3QEV A;  4KRE A;  4AM6 A;  1IG8 A;  1TKD A;  3L4Q A;  3KTQ A;  2VCP A;  4DMN A;  3HXM A;  1VQ5 N;  1TK0 A;  2VQE K;  4RCH A;  3O6W A;  1B9F A;  1NK8 A;  4CZM A;  3ZX3 A;  2O8F B;  3I8B A;  5E84 A;  2HHH K;  3HK2 A;  3VN5 A;  2HVI A;  3LM2 A;  2FSN A;  3CC4 N;  2A41 A;  4U7B A;  1NKB A;  4DUY K;  3O1W A;  4DF8 A;  3SJJ A;  1SS6 A;  3NHG A;  1S1U A;  1V4T A;  1VSH A;  3G71 N;  3MCP A;  3SV4 A;  4E1J A;  1NJZ A;  4KB1 A;  1SQK A;  4KHP K;  2NRH A;  5A2Q O;  5AZJ A;  1ZYQ A;  4FPA A;  3C6T A;  3SUQ A;  4W5N A;  1VSJ A;  3AVB A;  2G8K A;  3G6E N;  3LAN A;  2QWN A;  3KLE A;  4FXD A;  2A1S A;  4ILG B;  4IJA A;  4IO9 L;  2D5R A;  1H1V A;  4JKD A;  4NB4 A;  1NJX A;  3JYT A;  3AVJ A;  4K8Z A;  3AVI A;  1NGJ A;  5DK5 A;  1J53 A;  4LH4 A;  1C0M A;  5M1P A;  5KPZ A;  4DSF A;  1WSF A;  2W40 A;  4H4O A;  3JS6 A;  5BRF A;  4LF8 K;  4BRP A;  4MLE A;  1NK7 A;  1NBW A;  4C23 A;  3M8P A;  5E41 A;  4KPY A;  1GOB A;  4KV8 A;  5AQJ A;  1JKH A;  3LPT A;  5AQF A;  2B5J A;  2LSN A;  5CYQ A;  2Q0U A;  1TYQ B;  4FJK A;  4B1W B;  4OPA A;  4A61 A;  4HHT A;  4FYD A;  3LDN A;  4CFB A;  3I8D A;  3E1Y A;  2I7P A;  3EZ5 A;  4BWJ A;  4LF7 K;  4FL9 A;  1ATR A;  5FPE A;  4EHU A;  2AP1 A;  4JKG A;  2VWK A;  1RT3 A;  4R5P A;  3VES A;  4HTL A;  4E7H A;  4J2A A;  1CXU A;  2ITM A;  2A6A A;  2O8C A;  1NU0 A;  2G8U A;  5AQZ A;  1VSL A;  3OJS A;  1N36 K;  4FK0 A;  4CGH A;  3MK6 A;  1LW2 A;  2HHS A;  2YJE A;  3AO4 A;  3P1G A;  4M7X A;  4DTM A;  1DTQ A;  3G0Z A;  3H08 A;  4FJH A;  3K5L A;  2NUB A;  4I6M A;  3SUP A;  3HM9 A;  3ZX0 A;  5HRP A;  5DMR A;  5J2M A;  1HX1 A;  4B1Z A;  4A5B A;  4CZJ A;  1Q7Y O;  1HYZ A;  3P83 D;  3Q7B A;  2HBM A;  2HNZ A;  1FKO A;  2V51 B;  4CF1 A;  5CY4 A;  1HPM A;  4B3S K;  1OVQ A;  3NGZ A;  1SZ2 A;  4OGC A;  3SBT A;  2G8H A;  2XO7 A;  2GV9 A;  4RW4 A;  3L8B A;  4K0K K;  3CCV N;  4CJF A;  5JLH A;  4BDP A;  4Z0U A;  1MWM A;  3AAR A;  4CJ7 A;  4F3T A;  1X9J A;  3BY5 A;  3OYN A;  4N76 A;  2GWJ A;  2NRX A;  3R8E A;  1HJR A;  3NVK A;  1EQY A;  3U6F A;  5KGW A;  4DV4 K;  3OYM A;  4K42 A;  2DFH A;  1JCE A;  4OVL A;  4BRL A;  1NKE A;  1C0G A;  1GLF O;  4H5R A;  4XIU A;  3NGY A;  4DTP A;  4JI7 K;  3JSM A;  3OYF A;  1X3M A;  4OJR A;  3ULD A;  4FLY A;  4FLU A;  1IG9 A;  4CED A;  3PV8 A;  2ZGY A;  4B3M K;  4Q0B A;  2YNF A;  1HNV A;  1NJY A;  3U4L A;  1S3X A;  1UWB A;  4MLH A;  4IEE A;  2OTL N;  4JV5 K;  3CC2 N;  2Y1J A;  3ZT0 A;  3C6U A;  5LJV A;  4CFA A;  1KLM A;  4CK3 A;  1N6Q A;  1NGE A;  3WEE B;  4BE0 A;  4M3U A;  2GEL A;  3QIP A;  1FK9 A;  1QS4 A;  3HOS A;  3CF5 L;  2ITG A;  1GLA G;  3CQY A;  3MEE A;  5AZI A;  3WXK A;  3RRG A;  2UXB K;  1K8A O;  2UXC K;  4CJK A;  1KSP A;  1FKP A;  3O5B A;  3CET A;  3AVC A;  1JLE A;  4DHY A;  5BR9 A;  3DOK A;  4BVP A;  3LP1 A;  2ZD1 A;  5KGX A;  1TKT A;  1U04 A;  3V9W A;  3DMJ A;  3ZSO A;  3T19 A;  2P9P A;  3CPE A;  2QWO A;  3LZI A;  3LWL A;  5CZ2 A;  1HNW K;  3DRR A;  2IVP A;  3KK3 A;  3FZF A;  2P5G A;  3C7N A;  4BAC A;  2UU9 K;  4Z4C A;  1S1T A;  3OYE A;  3CC7 N;  4DTO A;  4B8C A;  4LC9 B;  1N8R O;  3E9P A;  1GLB G;  4BR2 A;  3CPW M;  4BRD A;  3D2E A;  2CGL A;  3J7A P;  3T69 A;  4O44 A;  3TAN A;  4OO1 J;  4AIL C;  1WAJ A;  3EO3 A;  3R6M A;  1OVY A;  4BRA A;  3WUH A;  2EX3 A;  1T8E A;  1RT1 A;  3HOT A;  3GOI A;  4JKH A;  4O0I A;  2G8V A;  4FWK A;  3D45 A;  3LP3 A;  3M5R A;  4KHU A;  4UY8 O;  4H0T B;  3CQX A;  3SAF A;  1DLO A;  3DJC A;  2KFN A;  4ID1 A;  2ETJ A;  3ITH A;  1XHX A;  2W6K A;  4OX9 K;  4F3O A;  4BRC A;  5KQD A;  4DV1 K;  3BGR A;  1BO5 O;  5FRO A;  3SMP A;  4GNI A;  4C8M A;  4IEI A;  4B1V A;  3K5M A;  2ZQB A;  5KPT A;  1LV5 A;  5CHI A;  3OS1 A;  4JKC A;  3VA3 A;  3TAE A;  4JLH A;  1RDC A;  4BC2 A;  4CEZ A;  1IKV A;  3PY8 A;  5AQT A;  1CXQ A;  3P5J A;  4DQ8 A;  3WQU A;  3VGM A;  1X3N A;  4F2R A;  1YIJ N;  5I3U A;  3DLE A;  2QWR A;  1FW6 A;  3OBW A;  3O9S A;  2Y1I A;  2I5J A;  4KTZ A;  1SUQ A;  3P39 A;  3B6P A;  3OYD A;  1RDU A;  1UAX A;  4H5V A;  2UUB K;  1W0H A;  3CJ9 A;  2YHW A;  1KVC A;  2YHB A;  3VQ7 A;  3KK1 A;  5BPN A;  3ZSX A;  1RTI A;  3S41 A;  5H1S Q;  4EAH D;  3SMS A;  1B92 A;  2BUP A;  1Q8I A;  1A5W A;  3DXK B;  4CGG A;  1VQ7 N;  3N4P A;  1TVR A;  2IAJ A;  1WSI A;  4CGJ A;  1VSD A;  3QET A;  3CFO A;  3MDQ A;  3L2Q A;  4FCY A;  3HO1 A;  2F8S A;  3MX5 A;  1OH7 A;  3CM5 A;  3CCQ N;  1UA0 A;  2PBD A;  5FPN A;  3EE8 A;  5HRR A;  4A59 A;  3ULE B;  4KI6 A;  3PLA A;  3HZ6 A;  3VEX A;  4EZ6 A;  3CCM N;  5C2D A;  3PUF A;  2EHG A;  3PO4 A;  4E7K A;  3M3Z A;  3K57 A;  3B6O A;  1WSH A;  3O1B A;  4BC3 A;  1TL1 A;  4I2P A;  2KFZ A;  1S1V A;  4GVM A;  1IKX A;  1QHA A;  2FLO A;  2JLE A;  4JKB A;  3VTH A;  1E3M A;  3U9Z A;  3W3D A;  4M3X A;  4PL7 A;  5JS2 A;  3U8X A;  4WCE L;  1U2V A;  1XI1 A;  2OA8 A;  2P9L B;  3QFP A;  3KK2 A;  1LAW A;  3A5L C;  4IOC L;  4IBN A;  1YVU A;  1ZBS A;  3HBT A;  4DV3 K;  3HRG A;  3QEW A;  4JI1 K;  1RCH A;  4CIE A;  2KTQ A;  1VSK A;  2W6L A;  1IBK K;  4W5T A;  5KTQ A;  1VQ8 N;  4CEE A;  3V1O A;  5EXW A;  3ISN C;  2HST A;  2Z1I A;  5HP1 A;  3P38 A;  2Q36 A;  2A3Z A;  4YHH K;  3CD6 N;  2QXL A;  2X6S A;  4B9L A;  1RT4 A;  1ITG A;  1QZ5 A;  2O8F A;  2KQ2 A;  2GBZ A;  3CYM A;  3RSE B;  3CIP A;  3L2R A;  4NCB A;  3A2F A;  4EP5 A;  3ZT4 A;  2B4J A;  4KRF A;  3R3L A;  2HHQ A;  3SLC A;  1BCM A;  1K8K B;  3P31 A;  1X9M A;  3BZK A;  2P9S A;  3CHW A;  3HJF A;  3THW B;  3A0I X;  3H1V X;  3RVC A;  1YJ9 N;  4AHC A;  3ZEU A;  3F2K A;  1XMO K;  4GMJ B;  3F9K A;  3CJC A;  1RIL A;  1E4F T;  3CG7 A;  3LAK A;  4Z4E A;  2Q2R A;  4WQ4 C;  4CZL A;  2NRZ A;  4NCG A;  1C1B A;  3PX4 A;  1N32 K;  3ZX2 A;  1BG3 A;  5AQY A;  3RMA A;  4QS7 A;  3SBG A;  4DV2 K;  2D0C A;  3VQ6 A;  1ASV A;  3OVN A;  3LDS A;  2HMP A;  4CIG A;  1TAU A;  1VQL N;  3VF2 A;  3AO1 A;  3K5O A;  4E7J A;  3OYJ A;  1X1P A;  3VQQ A;  3LAM A;  5LJW A;  1JCG A;  2OZS A;  2NNW A;  1C1C A;  1Q82 O;  2HVH A;  3DLL L;  2VG6 A;  1NGH A;  3O4N A;  3UKU A;  5KQ8 A;  1KFD A;  2P9N A;  2A1R A;  1RTJ A;  3M6G A;  5GAE P;  4DFP A;  1U47 A;  1Z6R A;  4WQ5 C;  2IOC A;  2YKN A;  1Q9Y A;  4KKO A;  4B8A B;  4JK7 A;  1TYQ A;  2OCE A;  4LY7 A;  2ZJR L;  3WNH A;  1J5E K;  1IKW A;  4FM1 A;  3TSQ A;  4FWO A;  3CCR N;  1KQS M;  5FPM A;  1Q86 O;  3WT0 A;  1RT2 A;  2KZZ A;  2WOM A;  4J2D A;  4JKF A;  2QKK A;  4CGF A;  4DR6 K;  1HNI A;  4BRM A;  1NGC A;  3BEX A;  2HHX A;  3UB5 A;  3LDP A;  4PWD A;  1BA0 A;  4DKW A;  3S9H A;  2HB5 A;  3OHR A;  2WTU A;  1NK6 A;  3O80 A;  2RE2 A;  1KTQ A;  2YCH A;  3JXU A;  2CH6 A;  4CJU A;  4RTF D;  4KHY A;  4O55 A;  3THX B;  4FO0 A;  3VQ9 A;  3ENB A;  1IJJ A;  2Q1N A;  3AAQ A;  1D9F A;  1T44 A;  1W97 L;  3VF4 A;  3NDK A;  1HQU A;  3AA4 A;  3CJB A;  4FPB A;  4JS4 A;  3VMF B;  3MED A;  2ZJP L;  4FSV A;  5AJ3 K;  3O9Q A;  2NLX A;  1L3U A;  4LFC K;  4FJM A;  4IFE A;  1A5V A;  4NLB A;  2HHV A;  1C0T A;  1RNH A;  2KHO A;  3HP6 A;  1T6C A;  1OH5 A;  2FF3 B;  4M45 A;  2VG7 A;  3ZET A;  3RRH A;  5C15 A;  4HCC A;  3FFK B;  2E2Q A;  2E2O A;  5C10 A;  4M42 A;  1G15 A;  1R0A A;  4PA1 A;  5JVH L;  3K5N A;  4CEQ A;  3ASM A;  3QNN A;  3MN9 A;  4FVM A;  4W5Q A;  2PAV A;  2E88 A;  4IJN A;  3QIC A;  4MDB A;  4OGE A;  5SWM A;  3OTO K;  5HOO A;  2O8E A;  4CHP A;  1BA1 A;  3LWM A;  3VQA A;  1MU2 A;  2YNH A;  3SQ1 A;  1QQN A;  4JI4 K;  3VQ8 A;  2UUC K;  4IKF A;  4Y1C A;  3CJ7 A;  3J7Y P;  1NWK A;  3AA2 A;  1VQP N;  4I2Q A;  4R79 A;  3D0P A;  4ILJ A;  3LP2 A;  4KHQ A;  4DTR A;  3SQ2 A;  3MEC A;  1D8Y A;  4RW9 A;  3UKR B;  5M1K A;  4CZE A;  5T7B A;  3QB0 A;  3WEE A;  3VEW A;  2O8B B;  4IDH A;  3EN9 A;  4FM0 A;  5HLF A;  3QEX A;  4CZG A;  3TSP A;  3L2U A;  2AJQ A;  3IKM A;  1YUW A;  3K59 A;  1IH7 A;  1M1K O;  1TAQ A;  3UIQ A;  2O8D B;  2P9U B;  4DQP A;  4B9U A;  1I39 A;  4CJ4 A;  3NCI A;  2ZM6 K;  3NE6 A;  1QQM A;  3SPZ A;  1BDG A;  4KHN A;  4IG0 A;  1WNS A;  3PIP L;  4FW2 A;  4OLA A;  2FF6 A;  1C0F A;  1ZBU A;  4GKJ K;  2FBT A;  4CD3 A;  1ZBI A;  3KLF A;  4DQQ A;  4A57 A;  1ZC6 A;  3OS0 A;  3F9M A;  5GAD P;  3FZH A;  3TI0 A;  1L3S A;  1NOY A;  3CJA A;  4CEB A;  1S22 A;  1ASW A;  2E2P A;  4GV9 A;  4YY3 K;  4EHT A;  1VQ6 N;  3AGK A;  3J81 O;  4O0J A;  2BE2 A;  4OKE A;  3OYI A;  2ZWH A;  1EWR A;  2P9I B;  2ATQ A;  3MCA B;  2R7Y A;  4IDK A;  5BR8 K;  4N47 A;  1RDB A;  5AQV A;  4DLG A;  3IFR A;  4JS5 A;  3VQB A;  4DSL A;  4IXC A;  5AR0 A;  2HMI A;  4NXM K;  1I94 K;  1LWC A;  1HJO A;  4AHU A;  4C8N A;  5ELZ A;  3CER A;  4LF9 K;  3KWG A;  4CEF A;  3QIN A;  4M3R A;  4CJ3 A;  5HRN A;  4N5S A;  4LSN A;  5HBM A;  3GE1 A;  4MQ3 A;  1ZBL A;  2Q97 A;  4BG9 A;  3CCU N;  4BDZ A;  2RPI A;  2H3G X;  4AH9 A;  2XRI A;  4JRP A;  3QER A;  3H3N O;  3TAB A;  3THY B;  3VGK A;  1EXQ A;  4DFJ A;  2CGJ A;  2A40 A;  3VQC A;  2JWK A;  1RDA A;  4PQU A;  3DLB A;  1ATN A;  4JI5 K;  1Z05 A;  3EL2 A;  2JWL A;  1WSE A;  1QE1 A;  4B08 A;  4F8R A;  2D0P A;  3U3G A;  5HL7 L;  4YOU A;  3FLC O;  4O8K A;  2PZS A;  2DPN A;  3TAP A;  5CZ1 A;  3N4Q A;  1Q81 O;  3ID8 A;  3TWH A;  4M3W A;  1Z25 A;  5AZJ B;  4DSE A;  3K0S A;  4JKE A;  3KD1 E;  1BIU A;  4BG8 A;  4DV7 K;  3CI5 A;  4DU3 A;  1KLN A;  3CFR A;  1YJN N;  2ASP A;  4J2E A;  3EZW A;  3KKR A;  4CK1 A;  3G4S N;  2PYL A;  3HPH A;  1BIS A;  4QS9 A;  5AQX A;  3BF1 A;  4YDU C;  4BE1 A;  2VGN A;  2QWL A;  3DI6 A;  3KLG A;  3F5T A;  2A5X A;  1FJG K;  5AQR A;  3LDL A;  1WBB A;  2HBJ A;  4IG3 A;  1T03 A;  2YNG A;  4H4M A;  2J4R A;  3G10 A;  1RBS A;  2DTU A;  5JVG L;  3T1Y K;  1NOZ A;  5IWA K;  3OY9 A;  3MXM A;  4C1N I;  1BGX T;  5AQU A;  4BRN A;  4B3R K;  3ZT1 A;  2BDP A;  4DS5 A;  4CZH A;  4CCH A;  2NRV A;  1NM1 A;  3HM8 A;  4H5N A;  5GIO A;  2QWP A;  2P9L A;  5CYM A;  4X65 K;  1KAZ A;  1CZ9 A;  1L3T A;  4FLZ A;  1NGB A;  1XWL A;  2FSK A;  3KK7 A;  1VSI A;  5BPL A;  4I7F A;  3CMA N;  4KHW A;  5TKY A;  2JGU A;  3SQ4 A;  4FZZ A;  4KFB A;  3O9U A;  3IUC A;  3O08 A;  3MXI A;  4JKG B;  4MO5 A;  3S3O A;  1NGD A;  4PUO A;  3PX0 A;  2YV0 X;  1HYV A;  4J2B A;  4FZY A;  4FWQ A;  2QM1 A;  3H46 O;  2P9K A;  3PSF A;  4FVU A;  4M3Y A;  2O8C B;  2G8W A;  1EX4 A;  5EOY A;  3H3O B;  1HRH A;  1HQE A;  3ZSZ A;  3KVG A;  1L5U A;  4CHN A;  4JI0 K;  3AVK A;  3RSE A;  3T1A A;  4QAG A;  4I6M B;  4DF4 A;  4NO7 A;  3CME N;  3PO5 A;  3AVF A;  4CJS A;  5EVZ A;  1RBU A;  4ID5 A;  4LF4 K;  1QQC A;  1ZBH A;  4CBX A;  4FWP A;  2KW4 A;  3SAH A;  1QSL A;  4C8L A;  2V7Z A;  1UA1 A;  3L3V A;  2D0A A;  3BUZ B;  3VER A;  3DXM B;  4CBW A;  3THW A;  4JI8 K;  4KAZ A;  3V9U A;  3E9O A;  5AQK A;  5KI6 A;  1WSG A;  4CJQ A;  1J9A A;  1S6Q A;  1L3V A;  3RMC A;  5AQM A;  3A5O C;  4FJI A;  1VHX A;  3M8Q A;  4BRE A;  4CHQ A;  4BQL A;  2XHB A;  3VEO A;  5BRH A;  2GX9 A;  2V52 B;  4FK4 A;  1GLC G;  2GWK A;  2FBX A;  3W0L A;  1A5X A;  4HTU A;  3A5N C;  3C95 A;  4H0O A;  3E9L A;  2V7Y A;  2PFU A;  3DLK A;  1VK0 A;  3R9P A;  4WFA L;  3O4Q A;  2KZM A;  4FOI A;  2F9W A;  5LL6 Z;  3L2V A;  4DLE A;  4B3O A;  4LSL A;  2HBL A;  3TTC A;  1WUA A;  3B8A X;  3S3N A;  2Q31 A;  4WFB L;  2FSJ A;  4QCL A;  1I3A A;  1YTA A;  1HNX K;  1ATS A;  1XMQ K;  4XH4 A;  1DTT A;  3U3Y A;  1D5A A;  2HBK A;  2ASM A;  4YNQ A;  1SKR A;  3GDQ A;  4ZTJ A;  2PY5 A;  3TAM A;  1ILY A;  3VEZ A;  4XEI A;  4BRG A;  4KTQ A;  3P4I A;  2HHT A;  3CCJ N;  2FC0 A;  1IBM K;  1TUU A;  1KVB A;  4JAX A;  5AQS A;  1BHL A;  1Y64 A;  3O3G A;  1J5O A;  3KWI A;  3ZT3 A;  4PKG A;  2AA4 A;  4BGB A;  3AVN A;  2WON A;  4JD2 B;  5GAH P;  2F7T A;  3MN5 A;  4H0P A;  1Q9X A;  4O5F A;  4ISE A;  1BQN A;  4M41 A;  4Q5V A;  4BGA A;  2NRW A;  4WYB A;  4Y0W A;  3O3H A;  4K41 A;  3CQ8 A;  2WBN A;  4ELU A;  3SZ2 A;  3SNN A;  2OZM A;  3EEQ A;  5I9E B;  4RW6 A;  1MA9 B;  4FJ5 A;  4B9T A;  3HST B;  3NBP A;  3PX6 A;  2GTD A;  3THX A;  5DM7 L;  4CF9 A;  2E1Y A;  2WUS A;  1NGI A;  1NMN A;  5FRN A;  4ISG A;  2GUI A;  1UOC A;  3KHY A;  3I0S A;  1KXP A;  4DU4 A;  1WLJ A;  4HUF A;  3KLI A;  1RTD A;  1NJI O;  3LAL A;  2E4L A;  5BPM A;  4BY9 C;  2IVO A;  3HT3 A;  4B1X B;  1U4B A;  2QA4 N;  1RDD A;  3D2E B; 
#chains in the Genus database with same CATH homology
 4DR5 K;  4LFC K;  2E5L K;  4LFA K;  3JAM O;  4YY3 K;  2UU9 K;  4B3S K;  4KHP K;  5A2Q O;  3J81 O;  4B3T K;  1FJG K;  1N32 K;  4CW7 B;  4DV2 K;  4K0K K;  4DV0 K;  5LL6 Z;  5BR8 K;  2UXD K;  1HR0 K;  3J7A P;  2VQF K;  3T1Y K;  5IWA K;  4DR4 K;  1HNX K;  1N34 K;  1XMQ K;  4DR2 K;  4NXN K;  4B3R K;  4NXM K;  1I94 K;  4LFB K;  4AQY K;  4LF9 K;  4DV4 K;  3OTO K;  1XNQ K;  5LMN K;  4LF8 K;  4X62 K;  4JI2 K;  3T1H K;  4X65 K;  1IBM K;  4OX9 K;  4JI7 K;  4V19 S;  4JI3 K;  4DV1 K;  4JI4 K;  2UUC K;  3J7Y P;  4B3M K;  4DR7 K;  4DV6 K;  5LMU K;  1J5E K;  4DV3 K;  4DV5 K;  4JI6 K;  4LF6 K;  4JI1 K;  1XNR K;  1IBK K;  1HNZ K;  4JV5 K;  4DR6 K;  4DR1 K;  2F4V K;  4JI5 K;  4GKK K;  5IT9 O;  4LF7 K;  4YHH K;  4DUZ K;  4JI0 K;  4X64 K;  4DR3 K;  2UUB K;  2VQE K;  2UUA K;  4LF4 K;  2UXB K;  4LF5 K;  4X66 K;  2UXC K;  5FLX O;  1N36 K;  2ZM6 K;  3J80 O;  4JI8 K;  4CVN E;  2HHH K;  4JYA K;  1N33 K;  4GKJ K;  4DV7 K;  4DUY K;  1HNW K;  1IBL K;  5AJ3 K;  1XMO K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...