4YHHK

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tigecycline
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
115
structure length
115
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structural characterization of an alternative mode of tigecycline binding to the bacterial ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4yhhK00
2UXDK 4DR7K 4DV1K 1HR0K 2UUCK 3J7AP 4LF5K 2VQFK 5BR8K 2ZM6K 4DV2K 4B3SK 4CW7B 1IBLK 5IWAK 4DV4K 1XNRK 4KHPK 4YY3K 1IBKK 4DR6K 3OTOK 2E5LK 4DUYK 2VQEK 2F4VK 4JI5K 4DR5K 4AQYK 1XMOK 4X66K 1XMQK 3J81O 4JI4K 2HHHK 2UU9K 4LFCK 3J80O 2UUBK 4B3TK 4JYAK 4JI3K 4LF7K 1IBMK 5FLXO 5IT9O 4LF4K 4JI6K 3J7YP 4GKJK 3JAMO 5A2QO 4DV0K 4JI1K 1I94K 4DR3K 4X64K 4LFAK 4DUZK 1HNWK 4OX9K 2UUAK 4NXMK 4NXNK 4DV5K 4V19S 1N33K 5LMNK 4CVNE 4GKKK 4YHHK 1FJGK 4DR1K 5LL6Z 4B3MK 4LF9K 1N34K 3T1HK 4DV7K 4JI0K 4DV6K 4DV3K 4LFBK 4B3RK 4DR2K 1J5EK 4LF6K 1N36K 4X65K 2UXBK 4JV5K 1N32K 4K0KK 4X62K 5LMUK 4JI7K 2UXCK 4DR4K 1HNXK 4JI2K 4JI8K 1HNZK 3T1YK 5AJ3K 4LF8K 1XNQK
chains in the Genus database with same CATH superfamily
4DR7K 1VRUA 4DV1K 1HR0K 4CZEA 3S41A 3QIPA 1IG9A 3CC7N 3VTIA 1IG8A 2KFNA 3LANA 3CD6N 1LOTB 2NZTA 3FLCO 1EO1A 1NGDA 4IG0A 3AO1A 3G0ZA 4CBUA 3QINA 3C0BA 3AO4A 3ZSOA 4FJ8A 4DS5A 3ULEA 1T03A 2O8BA 1U4BA 1X9SA 3AA3A 3I0SA 2HHVA 3EO3A 1QQCA 3QICA 1XMQK 3PIOL 5AZIA 4LFCK 1NGHA 2YJEA 5J2QA 1B92A 4E7LA 1S6QA 4JYAK 3D7EO 4H5RA 3ZSVA 3LP1A 3PX6A 2JGUA 4DSEA 5EVZA 1NK9A 2BGGA 4IEIA 2P9PB 2RPIA 4JI1K 3ID6A 4DUZK 3CCMN 4KHNA 3OW2M 3ALYA 4TSXA 3LP0A 4CEQA 3RSEB 4FPAA 4OPAA 2HW3A 5KPRA 2PY5A 1BL3A 3MMVA 4E3SA 4PA1A 5GAEP 3M8SA 1HKCA 3BF3A 2CH6A 4OPHA 2HHUA 4BR4A 4FK0A 3LP3A 3QEPA 2YNHA 1C6VA 3T7ZA 2VG5A 4BC4A 4KHUA 2KFZA 1S3XA 3R3LA 2YNIA 1ATNA 1N36K 3SUQA 1HPMA 4H0XB 1T7PA 3E1YA 5LY3A 2Z1HA 3SQ0A 4BC5A 2D0PA 5EX5A 1L3SA 1SL1A 5AQSA 4H5WA 4GVMA 1X9MA 3EY1A 2UXDK 4BC2A 4O55A 3SV3A 2HNYA 4BVPA 1S5JA 3HXMA 1Z26A 3QNOA 1BI4A 4H5VA 2BTFA 3I55N 4FM2A 3V9ZA 1UAXA 3A8YA 4BRFA 4CW7B 3OYEA 1TKXA 2X74A 4W5TA 3VQ5A 4ISFA 5IWAK 1E4FT 2QWRA 3O08A 1HYSA 3T69A 3VA3A 2D5RA 3EL2A 1U48A 2BUPA 1EETA 1BA1A 2QK9A 5C2DA 3AGRA 4JI5K 4PKHA 2FSKA 4IKFA 3U3GA 1NKBA 4L8RB 2D1KA 4IJNA 1MU2A 2JWLA 2UUBK 3K9KA 4KTZA 1KFSA 3RR7A 3DOLA 1W2BM 3KLGA 1B9DA 1N5YA 1TUYA 4Z4EA 4I6MA 1BHLA 3OYJA 4JS5A 1Y64A 3TAGA 1JL1A 1LAVA 1Z6RA 4WQ4A 4YDUA 4FWQA 3OYKA 1IKVA 1VQON 1O1WA 5LMNK 4BRDA 4FJ9A 4Q0BA 4FPBA 4FW2A 1WAFA 5AQRA 1MA9B 3UKUA 3AVNA 4AHTA 2ZJRL 2A41A 3SNNA 4H5NA 4C8LA 4EZ9A 3F9KA 4KBOA 4CEAA 5LJVA 3NF9A 1KRPA 3K5OA 1NNEA 3MN7A 4ID1A 2FBXA 4CGJA 1JKHA 4CJRA 3QDKA 5LMUK 2WUSA 4CBXA 5JS2A 3L3UA 1R0AA 4PQUA 1IV0A 4DR4K 3PLAA 5M1NA 3M3ZA 3NGZA 4CHZA 3LPTA 3JXUA 4CZIA 3OYMA 2HOEA 1C0FA 2KQ2A 4CEFA 2NRRA 1JLFA 4CF2A 4AF1A 4CGDA 1OVQA 3OYHA 2ASOA 4LH5A 4CJ7A 3SQ2A 4E7IA 5BR8K 5CR4A 3R9PA 4CZKA 1RTDA 5C25A 1NGGA 3OA9A 1NOYA 3RVCA 4A2BA 4R5PA 1KCFA 2AA4A 4JKFA 2P9IB 2HBKA 3SBGA 4KHWA 4HUEA 4B9TA 2F4VK 3TARA 3ZX0A 3K5NA 3DLRA 4FJGA 1YF5L 3HK2A 4DF8A 2YCHA 3MECA 5CE3A 1EKEA 1KC8O 1DGKN 1JLBA 3SK3A 3OS0A 2RE2A 4O5FA 3SAFA 5E26A 2P9KA 1WSEA 3AVAA 3TTCA 3CC4N 3G10A 2FBTA 3H1QA 3ZSZA 4K25A 2IAJA 4A61A 4JHDA 2BH1A 5CZ1A 2XO7A 4K41A 4E7HA 3CYMA 2HBMA 3DLGA 4IDKA 3TR8A 2A1RA 3CPWM 4BDZA 4CZHA 3V6DA 3O4WA 4BRPA 3NF7A 1T3VA 1F21A 4LF9K 3SMSA 1TK5A 1VSMA 1SL2A 1BQNA 3ZEUB 2IC3A 3MCAB 1D9FA 3HOTA 4QAGA 1T8EA 1KFDA 4M3XA 2Q0UA 5KI6A 1VQNN 4HTLA 5AQKA 1REVA 4M3RA 5BREA 2VCPA 1XI1A 3AVKA 3MWPA 3P4IA 1N32K 3H45C 1NJYA 2PYJA 3MCPA 2UXCK 3HPHA 3WNGA 4LD0A 4FLWA 3B6OA 2P9UA 3MAQA 4FO0A 3QESA 3SZ2A 1OVYA 3BUZB 3VQAA 5JVGL 3KIOA 4ZHRA 2Q0RA 1LCUA 5C15A 4JNEA 2V51B 3V1OA 4AHCA 1LWCA 4OPKA 2IIRA 1ZBHA 2PBDA 3V81A 1XC9A 4XIUA 1Z25A 3K2PA 3EKSA 4H03B 2EX3A 1KQSM 3BDPA 4FK2A 4JKEA 4BRMA 3RTVA 4H0YB 2KLAA 1VSHA 3LDPA 3SJJA 3IUCA 4H0OA 4WQ5A 4PWDA 3DXKB 1B9FA 4E1JA 5J2NA 4B1YB 1MDUB 4O8KA 3CJ7A 2J4RA 2H3GX 3K59A 4FWNA 4BE2A 2NRVA 3SV4A 3C6TA 4I2PA 4G1QA 5GIOA 5SZTA 2KKZA 3RWUA 4B9NA 1S1WA 5M1QA 3J7YP 1KLNA 3LM9A 1C0MA 2Z1GA 4NCBA 3QFPA 3CERA 3D2FA 4C1NI 2Q36A 2F9TA 4CJLA 5HOOA 2P9SA 3L3VA 3K5LA 1VSKA 4FLVA 4BRQA 1WAJA 1K6YA 2WOMA 4IOCL 3HVRA 1NBWA 1S22A 5D3GA 5HRRA 4B1WB 1G15A 5TKWA 1BIUA 4DTJA 3DAWA 2ZE2A 3R8EA 3N4QA 2GEMA 1D5AA 3VTHA 4IO8A 5FROA 3AV9A 1M90O 3SMPA 5KTQA 4M42A 4DB3A 3VQEA 1C0TA 1C1AA 2BE2A 2QWLA 3PSIA 1TK0A 5HBMA 3RRHA 4DFKA 3ISNC 1HYVA 4OKKA 1VSEA 2P9PA 3R1XA 3ZT0A 4JD2B 3J7ZO 4NCGA 3KTQA 3HM8A 1YAGA 4N41A 2A1SA 3RSEA 4DTUA 1WSIA 2PFUA 1S6PA 3CI5A 4DR6K 3OTOK 1ASUA 3O4NA 3C6UA 1HYZA 4HCBA 4JK7A 3VGLA 1DTQA 1EQYA 4EHUA 2B4JA 3VEYA 4BG9A 3OYNA 1NK0A 4CCHA 2O8FA 3QO9A 3DLBA 2VG6A 3CFPA 4F8RA 4FVUA 1QZ5A 4CESA 3LAKA 3S3NA 3H3OB 3I8BA 1KXPA 2Q2RA 5DM7L 4V19S 4Y0WA 3TAPA 3QETA 3NVMA 1SQKA 2XY7A 2QWNA 4F3OA 1YJNN 5DM6L 3PIPL 3VA0A 4DTRA 2HHQA 2ATQA 1N6QA 1S9GA 1BCOA 3AVIA 4IFYA 4U7BA 1A5XA 3BGRA 3T19A 3WEEB 4JI0K 3NGYA 3L0QA 4MO4A 1WSFA 3SUOA 3S3OA 1X9JA 3VGKA 5CHIA 3HTVA 1JLGA 2D0CA 2IVNA 3F9MA 3CM6A 2UXBK 3BY5A 1YTAA 5AZJB 5M1KA 3KLFA 3QEXA 3VPZA 3TI0A 3HP9A 1HRHA 4BDYA 3OJUA 1NWKA 5BRFA 4OVLA 4C8NA 3QB0A 1MWMA 1VSLA 1RBVA 5FDLA 4CJ3A 2YHXA 2A6AA 3FZHA 1U47A 3CC2N 3EN9A 2CGJA 1QVGM 2ETJA 1W97L 4CI6A 3KD5E 4XH1A 1Q86O 4BDPA 1HQEA 4J2DA 4RTFD 3LZJA 2Z1IA 3F5TA 2V7ZA 2A40A 5BR9A 1ITGA 1GOCA 2QWPA 4GY2B 4DV4K 2VWBA 1XNRK 3D2EB 3HPGA 3ZT4A 3O9SA 4YFUA 1VQ7N 3VEWA 2GV9A 2OYQA 4KI4A 3DM2A 1IJJA 3SAHA 1I3AA 3ID8A 4K8ZA 4DHYA 4EHTA 3CETA 3OVNA 3KHYA 4YOVA 4CE9A 3U6FA 3ZT3A 4BRKA 4LF4K 1NG9A 3ZSQA 1NKCA 3L2QA 5C2FA 2O4IA 3TABA 4M7XA 4DTNA 2ZWHA 5AFUH 3WXMB 3THXB 1Q9XA 4X64K 4DSIA 4B1UB 4NXNK 4FJNA 4FJMA 1JLEA 3MX5A 4IG3A 2ZJPL 4JK8A 4DU3A 3HM9A 2UYTA 2OA8A 4GKKK 1NGCA 4E89A 3CQ8A 3V1QA 4DTPA 2G8IA 4FZXC 5LL6Z 3E9OA 3T3FA 3OBYA 2DPNA 3CM5A 3DRSA 4CFBA 2G8WA 2V52B 3VMFB 4DV6K 4U67L 1ZBUA 1BCMA 1J5EK 4RG8A 3EEQA 4FLTA 1L3TA 4H4MA 3VQQA 4KH6A 2P9LB 1VSJA 4G9ZA 2P9IA 5BRDA 1EX4A 3E66A 4CJ5A 3KK3A 4KAZA 1S1VA 2XHBA 1JLQA 3WXIA 4DTMA 3H08A 3O4QA 1VQ8N 1OH7A 4YOTA 1RT6A 3QMLA 2HB5A 4FJXA 1YVUA 2UUCK 4F2RA 3HVTA 4Q5VA 4JKGB 4M63C 3PY8A 4LF5K 1U2VB 4CEBA 4AILC 1RT2A 1QS4A 3O3FA 3L2RA 4A5AA 1OH8A 4ELVA 3UB5A 3LZIA 4O5BA 5HRPA 3O6WA 1GLBG 2YNGA 3VF2A 3CFRA 3TAQA 3L4QA 4WQ4C 4YDUC 3MEGA 4MLEA 2WONA 4EP5A 2LSNA 3NGIA 5HRSA 3AVJA 3GBTA 1RBTA 2GX9A 1VQLN 3NCIA 3V9SA 3O5BA 1ZBFA 1J5OA 3J8AA 4KHYA 2FLOA 3RMAA 4LF7K 3ZEUA 3U3YA 5J2MA 3P1GA 2DFHA 4NYFA 2VYPA 1TAUA 4B9LA 2ZD1A 4EIAA 4KB0A 4GNIA 1RILA 1G99A 2PAVA 2HHXA 1JL2A 4CIFA 3P39A 3HYFA 1WN7A 3U9ZA 2ZQBA 3ATVA 3THYB 5AQFA 3LDLA 4DU4A 4BRNA 4FJ7A 4GV9A 2DY4A 2D0OA 2EWSA 5F0XA 4LH4A 3S3MA 4QOZB 3CHWA 5EOYA 4RW9A 3TSPA 1YI2N 3L6QA 3DI6A 4BR7A 4E1MA 5HL7L 4C8KA 4DQSA 2OANA 5ADXA 1TYQB 3QBXA 1HX1A 3AVHA 4UQGA 5M1FA 4B1VA 3WXLA 4XH5A 4JI2K 2F8SA 2ZGYA 5AQGA 3FFKB 3EYZA 3KVGA 1X9WA 3DXKA 1HMVA 4I9QA 2QW9A 2NNWA 2RF2A 1RT5A 3UIQA 2YJFA 2HVHA 1RT4A 4CHYA 4BREA 4BG8A 3LDNA 3I56N 2HHWA 2Q97A 4CIEA 4QS7A 3S9HA 3AVGA 4CJEA 2ITGA 4HWIA 1DKGD 1S72N 4CHOA 3RMCA 3CCEN 4FM1A 4IFEA 4Z0UA 1SL0A 2G8FA 3CJ1A 2KHOA 1DT9A 3ZX2A 3CJAA 4DQ8A 3PV8A 3RMBA 4FK4A 5AQIA 1ZC6A 5BRHA 2RKIA 2QKKA 4JEPA 2KW4A 3GE1A 3HJFA 1IKXA 3MEDA 2RN2A 3ZCMA 4CJPA 3HRGA 4JKCA 3DXMB 1LW0A 3F2KA 1NJXA 1QQMA 3WNFA 3MWTA 1NK7A 3G71N 4RW8A 4BQZA 4CF8A 4DV0K 3ZETB 2ITMA 4YNQA 1NGIA 3DWLA 3C65A 3PX4A 3WQTA 4FJIA 2Y1JA 3NH1A 5I3UA 1XHZA 4K8XA 3VEOA 3KD1E 3VF6A 2GUIA 3KLHA 3AA2A 3VN5A 4ELUA 3SYZA 3UE5A 4JK9A 4N56A 1XQSC 3MEEA 1RGIA 3WQUA 4BACA 4KTQA 4DQIA 4E7JA 4AM6A 1C1CA 4DFMA 1KTQA 3ENBA 4F9OA 3RR8A 4FWLA 1K73O 4JD2A 4IEEA 3O9RA 2OPQA 4CJUA 2KTQA 4IDHA 3AAQA 3M6GA 3TTFA 3KLIA 3A5MC 2F96A 4KO0A 3T1AA 4JI8K 3V9XA 2NRTA 1JLCA 2D4WA 4C8MA 3MN5A 2D0AA 1V4TA 4WQ5C 3E9PA 3VQ8A 4H4OA 3CCLN 4IWVA 4HUGA 4QCLA 2E20A 4Z4IA 5KPTA 1VQMN 4WFNL 1IO2A 4BRCA 3L8BA 2VWKA 3AAPA 3ZYYX 4CGIA 3MXMA 2HNZA 4A57A 4YY3K 2OTJN 1NKEA 2QI2A 3OS2A 1WBDA 4FJHA 4BVOA 2IGIA 4DS4A 4GMJB 1S1XA 2UU9K 4BWJA 4FJLA 1X1PA 1Q8IA 1WSJA 3VETA 4KHQA 2E6LA 3LDSA 1VQ6N 1IBMK 4HUFA 4NO7A 1KVAA 1RBUA 4B8CA 4OLBA 5IT9O 4M3UA 5JS1A 1X3NA 1KSPA 4J8FA 4N47A 3E9LA 4KB1A 3JAMO 4FLYA 3OY9A 4MFBA 1RNHA 5DK5A 3MX2A 5A2QO 2OTLN 2IVOA 4JAXA 2HMIA 5FRMA 2CGKA 5AZJA 2QWOA 4LFAK 1JCFA 2NRZA 1S1TA 1NM1A 3LDQA 1EXQA 2GTDA 1QSLA 4Z4GA 5HROA 1RTJA 1Y97A 1BIZA 4YHHK 4CFAA 2IOCA 3H6EA 2E2NA 3GG4A 3VENA 4O0JA 3HZ6A 2OPSA 5JMVA 2I7PA 2Q31A 2BANA 1KLMA 1JLAA 4FSVA 1N34K 2P5GA 3EZWA 4DV7K 5C0YA 1QTMA 3FGUA 2O4GA 5AQWA 4DV3K 4B1XB 1OKJA 4DR2K 4LF6K 4W5QA 1OH5A 3OYLA 2R7YA 1XC3A 5AQMA 3OYAA 2VWJA 4K0KK 2D0BA 1FKPA 3A2FA 4PY5A 3D2EA 3DYAA 3UKRB 3VOVA 5KRSA 1HNIA 4O8UA 4CJ4A 2A5XA 5AJ3K 2FC0A 3WT0A 3WUHA 1ZYQA 4MDBA 4ILHA 1L3UA 1H1VA 4FCYA 3TANA 4NYNA 1Q82O 3I8DA 4JKDA 4CFCA 1D9DA 3QEVA 1NJZA 2PYLA 4LY7A 4J2EA 1RTHA 3BZKA 3DRRA 3PO4A 5K14A 5BPMA 4KH4A 1T6DA 2FSNA 4DFPA 5BN9A 1TKDA 4BY9C 3AY9A 4NCAA 1FKOA 3HP6A 4AHVA 3THXA 3QIOA 4BE0A 5JICA 4FLXA 3EE9A 3FFIA 5HP1A 3QEIA 1Q81O 4FWKA 1K8KB 3O9TA 3IS9A 1IBKK 3M8PA 1CZBA 2E5LK 1NJWA 3ASMA 3KWIA 1WNSA 4ID5A 4FYDA 2G8HA 2NUBA 3VGMA 5MLCQ 4B3OA 2O8EB 4FW1A 4K42A 1EWQA 3CF5L 4W5NA 4CJFA 1NGFA 2E88A 4FZYA 2O8CB 2ASPA 1N8RO 2O8DB 1CXUA 4BC3A 5AR0A 2JWKA 1HJOA 4M3ZA 5KGWA 1W7AA 1ZBIA 4GKJK 3OJSA 2NRWA 2P9LA 3CFOA 4YORA 4YOUA 2P5OA 4IZ9A 4N5SA 1KVBA 3B8AX 3MXJA 3SUPA 1YJ9N 3KK2A 1NLVA 2GELA 5C12A 4CVNE 4CK3A 5C24A 1UA0A 3CIPA 3NHGA 3TAFA 4Y1DA 4CZLA 4DQQA 4H0PA 2FF3B 3K58A 4JKGA 4DLEA 1U2VA 3K5MA 2OCEA 1TKZA 4CJQA 2Y1IA 3I33A 1CZ9A 2AP1A 2JLEA 4JV5K 4DMNA 1BOTO 1K9MO 1NMDA 3P5JA 3CQYA 3JSMA 1X3MA 3DJCA 3A5OC 1NK8A 2CH5A 4OGEA 3K57A 4JRQA 2YV0X 4ICLA 5AQXA 5F1XA 5AQNA 1J9AA 1QHTA 1ILYA 1U45A 4DFJA 4OLAA 4CZMA 4LSLA 3JS6A 1VQ5N 3CCQN 3E01A 3J7AP 4BROA 3V9UA 2DTUA 3O8MA 3V9WA 3SPZA 3NDKA 1LW2A 3DLKA 3VESA 3NF6A 4Y1CA 5HLFA 5ELZA 4Z94A 3AO2A 4A5BA 2Z1JA 1RDAA 1RTIA 3L4IA 1ATRA 1GOAA 2GWKA 4DR5K 3THYA 3OYDA 3J81O 3KJVA 2HHHK 3DLHA 4KHSA 1YJWN 3VQ4A 4FXDA 1IH7A 3L2UA 1TAQA 4BR0A 4JI6K 3ENOA 2HVIA 4LC9B 3HSCA 1O13A 1TYQA 3AARA 3N4PA 3VQCA 1JXEA 3LDOA 4BR5A 2QTDA 4ILGB 4DR3K 1YT3A 1C0UA 4RW7A 2XY5A 1ESVA 1V4SA 2UUAK 3THVA 2XY6A 3TAEA 3H1VX 3THWB 1Z05A 5AQOA 4UY8O 4DSLA 3D2FB 4MO5A 4ISEA 3HO1A 3AVBA 3G6EN 3D45A 3EZ5A 4BQLA 1E4GT 2P9SB 1MWKA 3C6AA 2FF6A 1NK6A 4IBNA 3SCXA 5GAHP 1LWEA 4DQPA 1S9EA 2NRHA 1Q9YA 3LWMA 4JKHA 5AQPA 3ULDA 4A59A 4JN4A 4KPYA 1RDUA 3FZKA 4X65K 4ELTA 1K8AO 3MN6A 1WSHA 4CGFA 3RMDA 1SZ2A 3OYGA 1TK8A 1L5UA 4JKAA 2F7TA 4CBWA 4DF4A 1RBSA 3O9QA 3ZSWA 3TPQA 4GV3A 4KRFA 2NLXA 4PKGA 3AVFA 2OPPA 1HPZA 3O3GA 5AQQA 3U9DA 1TL3A 5JLHA 3FR0A 3DXMA 3LP2A 1C0GA 1SAZA 4IOXA 1TV6A 2VQFK 5M1OA 3KLEA 4DU1A 3KWGA 3ZETA 5BPLA 3HBTA 4W5RA 5CYQA 4FJ5A 3NBPA 1T05A 5CZ2A 3O1WA 3PUFA 3GL1A 5J1EA 5GINA 4DSJA 3WNHA 4QS9A 1YIJN 4K43A 1TUUA 4KFBA 3DLLL 1HJRA 2B6AA 3EE8A 1TGOA 1JXBA 4AQYK 1XMOK 1P8ZA 4X66K 1QHAA 2DFEA 4BRLA 4BRHA 2P9NB 3IDHA 4E19A 3OYBA 1GLJO 1DTTA 3CCUN 1W9HA 3AVCA 4C8OA 3HOSA 2Q3SA 1QSYA 3LAMA 3O9UA 3VQPA 4OJRA 2HHTA 2E6MA 1QVFM 3LWLA 2ZGZA 4CJTA 5JLFA 2O8FB 1WBBA 2PZSA 1EP4A 4OPJA 3CJ9A 2HSTA 3QLHA 4JRPA 1NK4A 3AGKA 3OYCA 3ATUA 2YHYA 4H5TA 1DLOA 4EAHD 3ZLJA 1U04A 1GLAG 4PHTX 2QM1A 4DG1A 3JYTA 3C7NB 3FZMA 2HBLA 2OPRA 4Z4CA 4C1NK 4DR1K 1BISA 4EP4A 1HQUA 1YITN 3NE6A 2W42A 1HKBA 3W3DA 4OO1J 3CPEA 4DSKA 4IFVA 3BP8A 4CHQA 4AHRA 3V4IA 3SBTA 4CECA 4IJAA 4RW4A 4CK1A 4BE1A 2EHGA 3DRPA 5FPNA 4OGCA 4BWMA 4M45A 3QEWA 1BQMA 4BR2A 1HNXK 3TAMA 3AO5A 1ZBLA 1VSIA 5AQVA 1HNZK 1XWLA 4O4GA 1T6CA 4LF8K 3FZFA 4HVJA 3MXIA 2HNDA 4CZGA 4DLGA 3W0LA 1KAYA 1BWFO 4DQRA 3A5NC 4OKEA 1RCHA 3O1BA 3QBWA 3VQBA 4FLUA 3G4SN 5AQZA 3ZT1A 4L3QA 2ZM6K 3AA4A 4B3SK 5E84A 4NLCA 3U8XA 1RDDA 2OZMA 5F2RA 3ZT2A 1ZXOA 3KK7A 4CF9A 3OBWA 2A3ZA 5C10A 3WXJA 1GLCG 5E41A 1UA1A 1CXQA 3I0RA 4XEIA 4A2AA 5B8HA 3IRXA 1JCEA 3WNEA 2CGLA 4NB4A 3DOKA 2GBZA 4CJVA 2G8VA 1NMNA 5KPZA 3VEXA 1YUWA 1XHXA 5FLXO 4DKWA 4EZ6A 4FVMA 2W41A 4IOAL 4KH5A 4DCHA 4KI6A 3RRGA 3U4LA 3VF4A 3MN9A 4BR9A 4E7KA 4CD3A 2YNFA 3P31A 2YKNA 4B9VA 3HL8A 3UKRA 2FBVA 1XUPO 2DFFA 2G8KA 4DV5K 1R59O 1U6ZA 4FJJA 2YKMA 1QE1A 3ULEB 4WE1A 2BDPA 2O8BB 4M3YA 3NH2A 3VQ6A 1GLDG 3A0IX 4CHNA 3K9JA 3LM2A 2YI1A 1FJGK 3IMXA 5AZIB 1TKTA 4H0TB 4B3MK 4AM7A 4H0VB 3WXKA 5JVHL 1SS6A 2GUPA 3T1HK 3LPUA 4QS8A 5T7BA 1YTUA 4WFBL 4Z4HA 3HT3A 4B9QA 4F3TA 1L3VA 4LSNA 1WSGA 3HPOA 3CMEN 3SUNA 4X62K 4Z4FA 4CJKA 1K8KA 4CJSA 1UOCA 3VEVA 4ISGA 4FL9A 3SPYA 4F4KA 5ADXH 2WTUA 2IS3A 1QQNA 2YHAA 4PL7A 3BEXA 4B9SA 1LV5A 2P51A 4C23A 2O8EA 2FBYA 3OYFA 3L2WA 2YX6A 2ASMA 4CERA 1QZ6A 2O8CA 2O8DA 2W6KA 2YHBA 3M1FA 3SLCA 4J2AA 2XRIA 1KAXA 5EXWA 3C95A 5TKYA 3TWHA 4F2SA 4E0DA 3SJHA 4CK2A 3H3NO 1HLUA 4B9MA 4YOYA 3FZLA 2E2OA 3M8RA 1TVRA 1RDBA 1BUPA 5H1SQ 4B9UA 5GIPA 2I7NA 3NH0A 4FLZA 4KTWA 2NRXA 2IDOA 2QKBA 3J80O 5I9EB 4WCEL 4BGAA 3DLEA 4JI3K 1GLEG 4CFDA 1ZBSA 1BI4B 2KZZA 4CF0A 1C1BA 1HKGA 4PKIA 5AQYA 5DMRA 4O0IA 4M7YA 4RW6A 4PUOA 3TU5A 1I94K 3QNNA 4CGGA 1BGXT 1NK5A 4CEEA 3FE1A 1CZAN 1VK0A 4IXCA 3D6RA 4R79A 1N33K 4HCCA 1RT3A 4JLHA 4CJWA 4CIGA 3NVKA 4M41A 3WEEA 1VSDA 5CY4A 5J2PA 1U49A 1KAZA 2GWJA 5BPNA 1YXQA 1NOZA 4WFAL 3HI0A 2KZMA 4B3RK 4I6MB 4FOIA 5KRTA 2AJQA 1TL1A 4FM0A 4O44A 4FWOA 4CF1A 4YOWA 3ZSRA 4BGBA 1EWRA 3QERA 4H8KA 3CG7A 4CHPA 3F73A 3IKMA 3KK1A 1BU6O 4RCHA 4AHSA 1SKRA 1FW6A 3MDQA 1LWFA 1FK9A 4FWRA 2QXFA 5AQJA 4DTXA 5KQDA 5I42A 3K0SA 3VEZA 5KQ8A 5GAGP 3UKUB 1LAWA 2HF3A 3O80A 1NGJA 1P90A 3OYIA 1A5VA 2WC9A 2B5JA 4W5OA 1W0HA 4BRGA 1NGEA 2XY8A 4I7FA 1BA0A 3SQ4A 1NGBA 3M5RA 1KVCA 2E1YA 2E2PA 3R6MA 3Q7BA 2ZJQL 4HTUA 4GV6A 1CLQA 2X6NA 4KKOA 2ZF5O 1IKWA 1SKWA 4KHPK 1J53A 3SAGA 1GOBA 3THWA 1RBRA 3KZBA 4NLBA 3CJBA 4JS4A 4HHTA 4DUYK 1ASVA 4CZJA 2VQEK 3NF8A 1UWBA 5AQHA 1RDCA 2QA4N 2HMPA 3LL3A 4EFHA 3IG1A 4JI4K 1RDWX 4B3TK 5CYMA 2E1ZA 2QWMA 1HUXA 2OZSA 1RFQA 1D4XA 5AQTA 5C42A 3CQXA 1M1KO 3A5LC 3BZCA 5BN8A 4DWIA 3ITHA 1WOQA 4M3WA 2WFBA 3V1RA 3PO5A 5FPDA 2RHKA 4YOXA 3O3HA 3PX0A 3VERA 2HF4A 3G25A 4FWMA 5FRNA 5EU7A 1QSSA 3P38A 1YVNA 4PL8A 4NXMK 2VGNA 4FWPA 1Q7YO 1VQKN 1VRTA 2IVPA 5M1PA 2P1JA 1I39A 3DMJA 3LALA 3IAYA 2QXLA 3ZSXA 1RT7A 4WYBA 4DTOA 2W6LA 4ZTFA 4FJKA 1BO5O 1NU0A 2WBNA 4LFBK 4A62A 2HBJA 2E8AA 2P9KB 1JCGA 1GLLO 3AO3A 1VQ4N 1JJ2M 1VHXA 1NGAA 3ZSYA 4JI7K 2QEXN 1KD1O 3KKRA 2A42A 5FPMA 3VQ7A 4E1NA 4JHDB 2W40A 1VSFA 3ZX3A 4AH9A 5GADP 3M8QA 4XH4A 4AHUA 3AA5X 3TSQA 4CZFA 3Q7CA 2P9NA 3PSFA 1NJIO 4CEOA 3SI6A 1IKYA 1WLJA 1Q18A 5AQUA 2X6SA 3L2VA 1VQ9N 4N76A 3GDQA 3OHRA 1SKSA 1A5WA 4DSFA 4DV2K 2VG7A 2V7YA 3ENHA 1IBLK 2E4LA 1OH6A 1ATSA 3CCSN 2HHSA 4ILJA 3AVLA 2G8UA 1BDGA 1J6ZA 1J54A 3HSTB 3VQDA 1E3MA 5LJWA 4WF9L 4GVEA 4CD1A 2P9UB 5KGXA 3CMAN 4GW6A 4J2BA 1GLFO 4JKBA 1FXXA 2QWQA 3C7NA 3TSUA 4RWTA 3AVMA 2VGMA 2F9WA 2X78A 2I5JA 3IFRA 5AFUA 3QFUA 3BF1A 1BG3A 1S1UA 1ASWA 2FSJA 1VAZA 3SQ1A 5EY4A 4B1ZA 1VQPN 3MK6A 5FPEA 4M3TA 3NMUA 4B08A 3C94A 3EKUA 1DEJA 4I2QA 4CGHA 1YHQN 4MDAA 1HNWK 4FOEA 4OX9K 1WUAA 3TTDA 3NFAA 4B8AB 1SV5A 4IO9L 3VQ9A 2E2QA 4FZZA 2FXUA 4OKJA 3OS1A 4KREA 1D8YA 5AQLA 3CCVN 3B6PA 3C6HA 4MQ3A 3P83D 1T44A 4KV8A 3KKSA 4CEDA 2YHWA 4MLHA 1SUQA 1HNVA 4FWSA 3D0PA 1QQOA 3CCRN 4BRAA 4ZTJA 3CCJN 1WB9A 4BRIA 5HRNA 2Q1NA 3NAEA 3CJCA 2F8TA 3T1YK 5SWMA 4CEZA 3CXCM 4DTSA 3H46O 4I9LA 3GOIA 1RT1A 1XNQK
chains in the Genus database with same CATH topology
2UXDK 4DR7K 4DV1K 1HR0K 2UUCK 3J7AP 4LF5K 2VQFK 5BR8K 2ZM6K 4DV2K 4B3SK 4CW7B 1IBLK 5IWAK 4DV4K 1XNRK 4KHPK 4YY3K 1IBKK 4DR6K 3OTOK 2E5LK 4DUYK 2VQEK 2F4VK 4JI5K 4DR5K 4AQYK 1XMOK 4X66K 1XMQK 3J81O 4JI4K 2HHHK 2UU9K 4LFCK 3J80O 2UUBK 4B3TK 4JYAK 4JI3K 4LF7K 1IBMK 5FLXO 5IT9O 4LF4K 4JI6K 3J7YP 4GKJK 3JAMO 5A2QO 4DV0K 4JI1K 1I94K 4DR3K 4X64K 4LFAK 4DUZK 1HNWK 4OX9K 2UUAK 4NXMK 4NXNK 4DV5K 4V19S 1N33K 5LMNK 4CVNE 4GKKK 4YHHK 1FJGK 4DR1K 5LL6Z 4B3MK 4LF9K 1N34K 3T1HK 4DV7K 4JI0K 4DV6K 4DV3K 4LFBK 4B3RK 4DR2K 1J5EK 4LF6K 1N36K 4X65K 2UXBK 4JV5K 1N32K 4K0KK 4X62K 5LMUK 4JI7K 2UXCK 4DR4K 1HNXK 4JI2K 4JI8K 1HNZK 3T1YK 5AJ3K 4LF8K 1XNQK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXD K;  4DR7 K;  4DV1 K;  1HR0 K;  2UUC K;  3J7A P;  4LF5 K;  2VQF K;  5BR8 K;  2ZM6 K;  4DV2 K;  4B3S K;  4CW7 B;  1IBL K;  5IWA K;  4DV4 K;  1XNR K;  4KHP K;  4YY3 K;  1IBK K;  4DR6 K;  3OTO K;  2E5L K;  4DUY K;  2VQE K;  2F4V K;  4JI5 K;  4DR5 K;  4AQY K;  1XMO K;  4X66 K;  1XMQ K;  3J81 O;  4JI4 K;  2HHH K;  2UU9 K;  4LFC K;  3J80 O;  2UUB K;  4B3T K;  4JYA K;  4JI3 K;  4LF7 K;  1IBM K;  5FLX O;  5IT9 O;  4LF4 K;  4JI6 K;  3J7Y P;  4GKJ K;  3JAM O;  5A2Q O;  4DV0 K;  4JI1 K;  1I94 K;  4DR3 K;  4X64 K;  4LFA K;  4DUZ K;  1HNW K;  4OX9 K;  2UUA K;  4NXM K;  4NXN K;  4DV5 K;  4V19 S;  1N33 K;  5LMN K;  4CVN E;  4GKK K;  4YHH K;  1FJG K;  4DR1 K;  5LL6 Z;  4B3M K;  4LF9 K;  1N34 K;  3T1H K;  4DV7 K;  4JI0 K;  4DV6 K;  4DV3 K;  4LFB K;  4B3R K;  4DR2 K;  1J5E K;  4LF6 K;  1N36 K;  4X65 K;  2UXB K;  4JV5 K;  1N32 K;  4K0K K;  4X62 K;  5LMU K;  4JI7 K;  2UXC K;  4DR4 K;  1HNX K;  4JI2 K;  4JI8 K;  1HNZ K;  3T1Y K;  5AJ3 K;  4LF8 K;  1XNQ K; 
#chains in the Genus database with same CATH topology
 4DR7 K;  1VRU A;  4DV1 K;  1HR0 K;  4CZE A;  3S41 A;  3QIP A;  1IG9 A;  3CC7 N;  3VTI A;  1IG8 A;  2KFN A;  3LAN A;  3CD6 N;  1LOT B;  2NZT A;  3FLC O;  1EO1 A;  1NGD A;  4IG0 A;  3AO1 A;  3G0Z A;  4CBU A;  3QIN A;  3C0B A;  3AO4 A;  3ZSO A;  4FJ8 A;  4DS5 A;  3ULE A;  1T03 A;  2O8B A;  1U4B A;  1X9S A;  3AA3 A;  3I0S A;  2HHV A;  3EO3 A;  1QQC A;  3QIC A;  1XMQ K;  3PIO L;  5AZI A;  4LFC K;  1NGH A;  2YJE A;  5J2Q A;  1B92 A;  4E7L A;  1S6Q A;  4JYA K;  3D7E O;  4H5R A;  3ZSV A;  3LP1 A;  3PX6 A;  2JGU A;  4DSE A;  5EVZ A;  1NK9 A;  2BGG A;  4IEI A;  2P9P B;  2RPI A;  4JI1 K;  3ID6 A;  4DUZ K;  3CCM N;  4KHN A;  3OW2 M;  3ALY A;  4TSX A;  3LP0 A;  4CEQ A;  3RSE B;  4FPA A;  4OPA A;  2HW3 A;  5KPR A;  2PY5 A;  1BL3 A;  3MMV A;  4E3S A;  4PA1 A;  5GAE P;  3M8S A;  1HKC A;  3BF3 A;  2CH6 A;  4OPH A;  2HHU A;  4BR4 A;  4FK0 A;  3LP3 A;  3QEP A;  2YNH A;  1C6V A;  3T7Z A;  2VG5 A;  4BC4 A;  4KHU A;  2KFZ A;  1S3X A;  3R3L A;  2YNI A;  1ATN A;  1N36 K;  3SUQ A;  1HPM A;  4H0X B;  1T7P A;  3E1Y A;  5LY3 A;  2Z1H A;  3SQ0 A;  4BC5 A;  2D0P A;  5EX5 A;  1L3S A;  1SL1 A;  5AQS A;  4H5W A;  4GVM A;  1X9M A;  3EY1 A;  2UXD K;  4BC2 A;  4O55 A;  3SV3 A;  2HNY A;  4BVP A;  1S5J A;  3HXM A;  1Z26 A;  3QNO A;  1BI4 A;  4H5V A;  2BTF A;  3I55 N;  4FM2 A;  3V9Z A;  1UAX A;  3A8Y A;  4BRF A;  4CW7 B;  3OYE A;  1TKX A;  2X74 A;  4W5T A;  3VQ5 A;  4ISF A;  5IWA K;  1E4F T;  2QWR A;  3O08 A;  1HYS A;  3T69 A;  3VA3 A;  2D5R A;  3EL2 A;  1U48 A;  2BUP A;  1EET A;  1BA1 A;  2QK9 A;  5C2D A;  3AGR A;  4JI5 K;  4PKH A;  2FSK A;  4IKF A;  3U3G A;  1NKB A;  4L8R B;  2D1K A;  4IJN A;  1MU2 A;  2JWL A;  2UUB K;  3K9K A;  4KTZ A;  1KFS A;  3RR7 A;  3DOL A;  1W2B M;  3KLG A;  1B9D A;  1N5Y A;  1TUY A;  4Z4E A;  4I6M A;  1BHL A;  3OYJ A;  4JS5 A;  1Y64 A;  3TAG A;  1JL1 A;  1LAV A;  1Z6R A;  4WQ4 A;  4YDU A;  4FWQ A;  3OYK A;  1IKV A;  1VQO N;  1O1W A;  5LMN K;  4BRD A;  4FJ9 A;  4Q0B A;  4FPB A;  4FW2 A;  1WAF A;  5AQR A;  1MA9 B;  3UKU A;  3AVN A;  4AHT A;  2ZJR L;  2A41 A;  3SNN A;  4H5N A;  4C8L A;  4EZ9 A;  3F9K A;  4KBO A;  4CEA A;  5LJV A;  3NF9 A;  1KRP A;  3K5O A;  1NNE A;  3MN7 A;  4ID1 A;  2FBX A;  4CGJ A;  1JKH A;  4CJR A;  3QDK A;  5LMU K;  2WUS A;  4CBX A;  5JS2 A;  3L3U A;  1R0A A;  4PQU A;  1IV0 A;  4DR4 K;  3PLA A;  5M1N A;  3M3Z A;  3NGZ A;  4CHZ A;  3LPT A;  3JXU A;  4CZI A;  3OYM A;  2HOE A;  1C0F A;  2KQ2 A;  4CEF A;  2NRR A;  1JLF A;  4CF2 A;  4AF1 A;  4CGD A;  1OVQ A;  3OYH A;  2ASO A;  4LH5 A;  4CJ7 A;  3SQ2 A;  4E7I A;  5BR8 K;  5CR4 A;  3R9P A;  4CZK A;  1RTD A;  5C25 A;  1NGG A;  3OA9 A;  1NOY A;  3RVC A;  4A2B A;  4R5P A;  1KCF A;  2AA4 A;  4JKF A;  2P9I B;  2HBK A;  3SBG A;  4KHW A;  4HUE A;  4B9T A;  2F4V K;  3TAR A;  3ZX0 A;  3K5N A;  3DLR A;  4FJG A;  1YF5 L;  3HK2 A;  4DF8 A;  2YCH A;  3MEC A;  5CE3 A;  1EKE A;  1KC8 O;  1DGK N;  1JLB A;  3SK3 A;  3OS0 A;  2RE2 A;  4O5F A;  3SAF A;  5E26 A;  2P9K A;  1WSE A;  3AVA A;  3TTC A;  3CC4 N;  3G10 A;  2FBT A;  3H1Q A;  3ZSZ A;  4K25 A;  2IAJ A;  4A61 A;  4JHD A;  2BH1 A;  5CZ1 A;  2XO7 A;  4K41 A;  4E7H A;  3CYM A;  2HBM A;  3DLG A;  4IDK A;  3TR8 A;  2A1R A;  3CPW M;  4BDZ A;  4CZH A;  3V6D A;  3O4W A;  4BRP A;  3NF7 A;  1T3V A;  1F21 A;  4LF9 K;  3SMS A;  1TK5 A;  1VSM A;  1SL2 A;  1BQN A;  3ZEU B;  2IC3 A;  3MCA B;  1D9F A;  3HOT A;  4QAG A;  1T8E A;  1KFD A;  4M3X A;  2Q0U A;  5KI6 A;  1VQN N;  4HTL A;  5AQK A;  1REV A;  4M3R A;  5BRE A;  2VCP A;  1XI1 A;  3AVK A;  3MWP A;  3P4I A;  1N32 K;  3H45 C;  1NJY A;  2PYJ A;  3MCP A;  2UXC K;  3HPH A;  3WNG A;  4LD0 A;  4FLW A;  3B6O A;  2P9U A;  3MAQ A;  4FO0 A;  3QES A;  3SZ2 A;  1OVY A;  3BUZ B;  3VQA A;  5JVG L;  3KIO A;  4ZHR A;  2Q0R A;  1LCU A;  5C15 A;  4JNE A;  2V51 B;  3V1O A;  4AHC A;  1LWC A;  4OPK A;  2IIR A;  1ZBH A;  2PBD A;  3V81 A;  1XC9 A;  4XIU A;  1Z25 A;  3K2P A;  3EKS A;  4H03 B;  2EX3 A;  1KQS M;  3BDP A;  4FK2 A;  4JKE A;  4BRM A;  3RTV A;  4H0Y B;  2KLA A;  1VSH A;  3LDP A;  3SJJ A;  3IUC A;  4H0O A;  4WQ5 A;  4PWD A;  3DXK B;  1B9F A;  4E1J A;  5J2N A;  4B1Y B;  1MDU B;  4O8K A;  3CJ7 A;  2J4R A;  2H3G X;  3K59 A;  4FWN A;  4BE2 A;  2NRV A;  3SV4 A;  3C6T A;  4I2P A;  4G1Q A;  5GIO A;  5SZT A;  2KKZ A;  3RWU A;  4B9N A;  1S1W A;  5M1Q A;  3J7Y P;  1KLN A;  3LM9 A;  1C0M A;  2Z1G A;  4NCB A;  3QFP A;  3CER A;  3D2F A;  4C1N I;  2Q36 A;  2F9T A;  4CJL A;  5HOO A;  2P9S A;  3L3V A;  3K5L A;  1VSK A;  4FLV A;  4BRQ A;  1WAJ A;  1K6Y A;  2WOM A;  4IOC L;  3HVR A;  1NBW A;  1S22 A;  5D3G A;  5HRR A;  4B1W B;  1G15 A;  5TKW A;  1BIU A;  4DTJ A;  3DAW A;  2ZE2 A;  3R8E A;  3N4Q A;  2GEM A;  1D5A A;  3VTH A;  4IO8 A;  5FRO A;  3AV9 A;  1M90 O;  3SMP A;  5KTQ A;  4M42 A;  4DB3 A;  3VQE A;  1C0T A;  1C1A A;  2BE2 A;  2QWL A;  3PSI A;  1TK0 A;  5HBM A;  3RRH A;  4DFK A;  3ISN C;  1HYV A;  4OKK A;  1VSE A;  2P9P A;  3R1X A;  3ZT0 A;  4JD2 B;  3J7Z O;  4NCG A;  3KTQ A;  3HM8 A;  1YAG A;  4N41 A;  2A1S A;  3RSE A;  4DTU A;  1WSI A;  2PFU A;  1S6P A;  3CI5 A;  4DR6 K;  3OTO K;  1ASU A;  3O4N A;  3C6U A;  1HYZ A;  4HCB A;  4JK7 A;  3VGL A;  1DTQ A;  1EQY A;  4EHU A;  2B4J A;  3VEY A;  4BG9 A;  3OYN A;  1NK0 A;  4CCH A;  2O8F A;  3QO9 A;  3DLB A;  2VG6 A;  3CFP A;  4F8R A;  4FVU A;  1QZ5 A;  4CES A;  3LAK A;  3S3N A;  3H3O B;  3I8B A;  1KXP A;  2Q2R A;  5DM7 L;  4V19 S;  4Y0W A;  3TAP A;  3QET A;  3NVM A;  1SQK A;  2XY7 A;  2QWN A;  4F3O A;  1YJN N;  5DM6 L;  3PIP L;  3VA0 A;  4DTR A;  2HHQ A;  2ATQ A;  1N6Q A;  1S9G A;  1BCO A;  3AVI A;  4IFY A;  4U7B A;  1A5X A;  3BGR A;  3T19 A;  3WEE B;  4JI0 K;  3NGY A;  3L0Q A;  4MO4 A;  1WSF A;  3SUO A;  3S3O A;  1X9J A;  3VGK A;  5CHI A;  3HTV A;  1JLG A;  2D0C A;  2IVN A;  3F9M A;  3CM6 A;  2UXB K;  3BY5 A;  1YTA A;  5AZJ B;  5M1K A;  3KLF A;  3QEX A;  3VPZ A;  3TI0 A;  3HP9 A;  1HRH A;  4BDY A;  3OJU A;  1NWK A;  5BRF A;  4OVL A;  4C8N A;  3QB0 A;  1MWM A;  1VSL A;  1RBV A;  5FDL A;  4CJ3 A;  2YHX A;  2A6A A;  3FZH A;  1U47 A;  3CC2 N;  3EN9 A;  2CGJ A;  1QVG M;  2ETJ A;  1W97 L;  4CI6 A;  3KD5 E;  4XH1 A;  1Q86 O;  4BDP A;  1HQE A;  4J2D A;  4RTF D;  3LZJ A;  2Z1I A;  3F5T A;  2V7Z A;  2A40 A;  5BR9 A;  1ITG A;  1GOC A;  2QWP A;  4GY2 B;  4DV4 K;  2VWB A;  1XNR K;  3D2E B;  3HPG A;  3ZT4 A;  3O9S A;  4YFU A;  1VQ7 N;  3VEW A;  2GV9 A;  2OYQ A;  4KI4 A;  3DM2 A;  1IJJ A;  3SAH A;  1I3A A;  3ID8 A;  4K8Z A;  4DHY A;  4EHT A;  3CET A;  3OVN A;  3KHY A;  4YOV A;  4CE9 A;  3U6F A;  3ZT3 A;  4BRK A;  4LF4 K;  1NG9 A;  3ZSQ A;  1NKC A;  3L2Q A;  5C2F A;  2O4I A;  3TAB A;  4M7X A;  4DTN A;  2ZWH A;  5AFU H;  3WXM B;  3THX B;  1Q9X A;  4X64 K;  4DSI A;  4B1U B;  4NXN K;  4FJN A;  4FJM A;  1JLE A;  3MX5 A;  4IG3 A;  2ZJP L;  4JK8 A;  4DU3 A;  3HM9 A;  2UYT A;  2OA8 A;  4GKK K;  1NGC A;  4E89 A;  3CQ8 A;  3V1Q A;  4DTP A;  2G8I A;  4FZX C;  5LL6 Z;  3E9O A;  3T3F A;  3OBY A;  2DPN A;  3CM5 A;  3DRS A;  4CFB A;  2G8W A;  2V52 B;  3VMF B;  4DV6 K;  4U67 L;  1ZBU A;  1BCM A;  1J5E K;  4RG8 A;  3EEQ A;  4FLT A;  1L3T A;  4H4M A;  3VQQ A;  4KH6 A;  2P9L B;  1VSJ A;  4G9Z A;  2P9I A;  5BRD A;  1EX4 A;  3E66 A;  4CJ5 A;  3KK3 A;  4KAZ A;  1S1V A;  2XHB A;  1JLQ A;  3WXI A;  4DTM A;  3H08 A;  3O4Q A;  1VQ8 N;  1OH7 A;  4YOT A;  1RT6 A;  3QML A;  2HB5 A;  4FJX A;  1YVU A;  2UUC K;  4F2R A;  3HVT A;  4Q5V A;  4JKG B;  4M63 C;  3PY8 A;  4LF5 K;  1U2V B;  4CEB A;  4AIL C;  1RT2 A;  1QS4 A;  3O3F A;  3L2R A;  4A5A A;  1OH8 A;  4ELV A;  3UB5 A;  3LZI A;  4O5B A;  5HRP A;  3O6W A;  1GLB G;  2YNG A;  3VF2 A;  3CFR A;  3TAQ A;  3L4Q A;  4WQ4 C;  4YDU C;  3MEG A;  4MLE A;  2WON A;  4EP5 A;  2LSN A;  3NGI A;  5HRS A;  3AVJ A;  3GBT A;  1RBT A;  2GX9 A;  1VQL N;  3NCI A;  3V9S A;  3O5B A;  1ZBF A;  1J5O A;  3J8A A;  4KHY A;  2FLO A;  3RMA A;  4LF7 K;  3ZEU A;  3U3Y A;  5J2M A;  3P1G A;  2DFH A;  4NYF A;  2VYP A;  1TAU A;  4B9L A;  2ZD1 A;  4EIA A;  4KB0 A;  4GNI A;  1RIL A;  1G99 A;  2PAV A;  2HHX A;  1JL2 A;  4CIF A;  3P39 A;  3HYF A;  1WN7 A;  3U9Z A;  2ZQB A;  3ATV A;  3THY B;  5AQF A;  3LDL A;  4DU4 A;  4BRN A;  4FJ7 A;  4GV9 A;  2DY4 A;  2D0O A;  2EWS A;  5F0X A;  4LH4 A;  3S3M A;  4QOZ B;  3CHW A;  5EOY A;  4RW9 A;  3TSP A;  1YI2 N;  3L6Q A;  3DI6 A;  4BR7 A;  4E1M A;  5HL7 L;  4C8K A;  4DQS A;  2OAN A;  5ADX A;  1TYQ B;  3QBX A;  1HX1 A;  3AVH A;  4UQG A;  5M1F A;  4B1V A;  3WXL A;  4XH5 A;  4JI2 K;  2F8S A;  2ZGY A;  5AQG A;  3FFK B;  3EYZ A;  3KVG A;  1X9W A;  3DXK A;  1HMV A;  4I9Q A;  2QW9 A;  2NNW A;  2RF2 A;  1RT5 A;  3UIQ A;  2YJF A;  2HVH A;  1RT4 A;  4CHY A;  4BRE A;  4BG8 A;  3LDN A;  3I56 N;  2HHW A;  2Q97 A;  4CIE A;  4QS7 A;  3S9H A;  3AVG A;  4CJE A;  2ITG A;  4HWI A;  1DKG D;  1S72 N;  4CHO A;  3RMC A;  3CCE N;  4FM1 A;  4IFE A;  4Z0U A;  1SL0 A;  2G8F A;  3CJ1 A;  2KHO A;  1DT9 A;  3ZX2 A;  3CJA A;  4DQ8 A;  3PV8 A;  3RMB A;  4FK4 A;  5AQI A;  1ZC6 A;  5BRH A;  2RKI A;  2QKK A;  4JEP A;  2KW4 A;  3GE1 A;  3HJF A;  1IKX A;  3MED A;  2RN2 A;  3ZCM A;  4CJP A;  3HRG A;  4JKC A;  3DXM B;  1LW0 A;  3F2K A;  1NJX A;  1QQM A;  3WNF A;  3MWT A;  1NK7 A;  3G71 N;  4RW8 A;  4BQZ A;  4CF8 A;  4DV0 K;  3ZET B;  2ITM A;  4YNQ A;  1NGI A;  3DWL A;  3C65 A;  3PX4 A;  3WQT A;  4FJI A;  2Y1J A;  3NH1 A;  5I3U A;  1XHZ A;  4K8X A;  3VEO A;  3KD1 E;  3VF6 A;  2GUI A;  3KLH A;  3AA2 A;  3VN5 A;  4ELU A;  3SYZ A;  3UE5 A;  4JK9 A;  4N56 A;  1XQS C;  3MEE A;  1RGI A;  3WQU A;  4BAC A;  4KTQ A;  4DQI A;  4E7J A;  4AM6 A;  1C1C A;  4DFM A;  1KTQ A;  3ENB A;  4F9O A;  3RR8 A;  4FWL A;  1K73 O;  4JD2 A;  4IEE A;  3O9R A;  2OPQ A;  4CJU A;  2KTQ A;  4IDH A;  3AAQ A;  3M6G A;  3TTF A;  3KLI A;  3A5M C;  2F96 A;  4KO0 A;  3T1A A;  4JI8 K;  3V9X A;  2NRT A;  1JLC A;  2D4W A;  4C8M A;  3MN5 A;  2D0A A;  1V4T A;  4WQ5 C;  3E9P A;  3VQ8 A;  4H4O A;  3CCL N;  4IWV A;  4HUG A;  4QCL A;  2E20 A;  4Z4I A;  5KPT A;  1VQM N;  4WFN L;  1IO2 A;  4BRC A;  3L8B A;  2VWK A;  3AAP A;  3ZYY X;  4CGI A;  3MXM A;  2HNZ A;  4A57 A;  4YY3 K;  2OTJ N;  1NKE A;  2QI2 A;  3OS2 A;  1WBD A;  4FJH A;  4BVO A;  2IGI A;  4DS4 A;  4GMJ B;  1S1X A;  2UU9 K;  4BWJ A;  4FJL A;  1X1P A;  1Q8I A;  1WSJ A;  3VET A;  4KHQ A;  2E6L A;  3LDS A;  1VQ6 N;  1IBM K;  4HUF A;  4NO7 A;  1KVA A;  1RBU A;  4B8C A;  4OLB A;  5IT9 O;  4M3U A;  5JS1 A;  1X3N A;  1KSP A;  4J8F A;  4N47 A;  3E9L A;  4KB1 A;  3JAM O;  4FLY A;  3OY9 A;  4MFB A;  1RNH A;  5DK5 A;  3MX2 A;  5A2Q O;  2OTL N;  2IVO A;  4JAX A;  2HMI A;  5FRM A;  2CGK A;  5AZJ A;  2QWO A;  4LFA K;  1JCF A;  2NRZ A;  1S1T A;  1NM1 A;  3LDQ A;  1EXQ A;  2GTD A;  1QSL A;  4Z4G A;  5HRO A;  1RTJ A;  1Y97 A;  1BIZ A;  4YHH K;  4CFA A;  2IOC A;  3H6E A;  2E2N A;  3GG4 A;  3VEN A;  4O0J A;  3HZ6 A;  2OPS A;  5JMV A;  2I7P A;  2Q31 A;  2BAN A;  1KLM A;  1JLA A;  4FSV A;  1N34 K;  2P5G A;  3EZW A;  4DV7 K;  5C0Y A;  1QTM A;  3FGU A;  2O4G A;  5AQW A;  4DV3 K;  4B1X B;  1OKJ A;  4DR2 K;  4LF6 K;  4W5Q A;  1OH5 A;  3OYL A;  2R7Y A;  1XC3 A;  5AQM A;  3OYA A;  2VWJ A;  4K0K K;  2D0B A;  1FKP A;  3A2F A;  4PY5 A;  3D2E A;  3DYA A;  3UKR B;  3VOV A;  5KRS A;  1HNI A;  4O8U A;  4CJ4 A;  2A5X A;  5AJ3 K;  2FC0 A;  3WT0 A;  3WUH A;  1ZYQ A;  4MDB A;  4ILH A;  1L3U A;  1H1V A;  4FCY A;  3TAN A;  4NYN A;  1Q82 O;  3I8D A;  4JKD A;  4CFC A;  1D9D A;  3QEV A;  1NJZ A;  2PYL A;  4LY7 A;  4J2E A;  1RTH A;  3BZK A;  3DRR A;  3PO4 A;  5K14 A;  5BPM A;  4KH4 A;  1T6D A;  2FSN A;  4DFP A;  5BN9 A;  1TKD A;  4BY9 C;  3AY9 A;  4NCA A;  1FKO A;  3HP6 A;  4AHV A;  3THX A;  3QIO A;  4BE0 A;  5JIC A;  4FLX A;  3EE9 A;  3FFI A;  5HP1 A;  3QEI A;  1Q81 O;  4FWK A;  1K8K B;  3O9T A;  3IS9 A;  1IBK K;  3M8P A;  1CZB A;  2E5L K;  1NJW A;  3ASM A;  3KWI A;  1WNS A;  4ID5 A;  4FYD A;  2G8H A;  2NUB A;  3VGM A;  5MLC Q;  4B3O A;  2O8E B;  4FW1 A;  4K42 A;  1EWQ A;  3CF5 L;  4W5N A;  4CJF A;  1NGF A;  2E88 A;  4FZY A;  2O8C B;  2ASP A;  1N8R O;  2O8D B;  1CXU A;  4BC3 A;  5AR0 A;  2JWK A;  1HJO A;  4M3Z A;  5KGW A;  1W7A A;  1ZBI A;  4GKJ K;  3OJS A;  2NRW A;  2P9L A;  3CFO A;  4YOR A;  4YOU A;  2P5O A;  4IZ9 A;  4N5S A;  1KVB A;  3B8A X;  3MXJ A;  3SUP A;  1YJ9 N;  3KK2 A;  1NLV A;  2GEL A;  5C12 A;  4CVN E;  4CK3 A;  5C24 A;  1UA0 A;  3CIP A;  3NHG A;  3TAF A;  4Y1D A;  4CZL A;  4DQQ A;  4H0P A;  2FF3 B;  3K58 A;  4JKG A;  4DLE A;  1U2V A;  3K5M A;  2OCE A;  1TKZ A;  4CJQ A;  2Y1I A;  3I33 A;  1CZ9 A;  2AP1 A;  2JLE A;  4JV5 K;  4DMN A;  1BOT O;  1K9M O;  1NMD A;  3P5J A;  3CQY A;  3JSM A;  1X3M A;  3DJC A;  3A5O C;  1NK8 A;  2CH5 A;  4OGE A;  3K57 A;  4JRQ A;  2YV0 X;  4ICL A;  5AQX A;  5F1X A;  5AQN A;  1J9A A;  1QHT A;  1ILY A;  1U45 A;  4DFJ A;  4OLA A;  4CZM A;  4LSL A;  3JS6 A;  1VQ5 N;  3CCQ N;  3E01 A;  3J7A P;  4BRO A;  3V9U A;  2DTU A;  3O8M A;  3V9W A;  3SPZ A;  3NDK A;  1LW2 A;  3DLK A;  3VES A;  3NF6 A;  4Y1C A;  5HLF A;  5ELZ A;  4Z94 A;  3AO2 A;  4A5B A;  2Z1J A;  1RDA A;  1RTI A;  3L4I A;  1ATR A;  1GOA A;  2GWK A;  4DR5 K;  3THY A;  3OYD A;  3J81 O;  3KJV A;  2HHH K;  3DLH A;  4KHS A;  1YJW N;  3VQ4 A;  4FXD A;  1IH7 A;  3L2U A;  1TAQ A;  4BR0 A;  4JI6 K;  3ENO A;  2HVI A;  4LC9 B;  3HSC A;  1O13 A;  1TYQ A;  3AAR A;  3N4P A;  3VQC A;  1JXE A;  3LDO A;  4BR5 A;  2QTD A;  4ILG B;  4DR3 K;  1YT3 A;  1C0U A;  4RW7 A;  2XY5 A;  1ESV A;  1V4S A;  2UUA K;  3THV A;  2XY6 A;  3TAE A;  3H1V X;  3THW B;  1Z05 A;  5AQO A;  4UY8 O;  4DSL A;  3D2F B;  4MO5 A;  4ISE A;  3HO1 A;  3AVB A;  3G6E N;  3D45 A;  3EZ5 A;  4BQL A;  1E4G T;  2P9S B;  1MWK A;  3C6A A;  2FF6 A;  1NK6 A;  4IBN A;  3SCX A;  5GAH P;  1LWE A;  4DQP A;  1S9E A;  2NRH A;  1Q9Y A;  3LWM A;  4JKH A;  5AQP A;  3ULD A;  4A59 A;  4JN4 A;  4KPY A;  1RDU A;  3FZK A;  4X65 K;  4ELT A;  1K8A O;  3MN6 A;  1WSH A;  4CGF A;  3RMD A;  1SZ2 A;  3OYG A;  1TK8 A;  1L5U A;  4JKA A;  2F7T A;  4CBW A;  4DF4 A;  1RBS A;  3O9Q A;  3ZSW A;  3TPQ A;  4GV3 A;  4KRF A;  2NLX A;  4PKG A;  3AVF A;  2OPP A;  1HPZ A;  3O3G A;  5AQQ A;  3U9D A;  1TL3 A;  5JLH A;  3FR0 A;  3DXM A;  3LP2 A;  1C0G A;  1SAZ A;  4IOX A;  1TV6 A;  2VQF K;  5M1O A;  3KLE A;  4DU1 A;  3KWG A;  3ZET A;  5BPL A;  3HBT A;  4W5R A;  5CYQ A;  4FJ5 A;  3NBP A;  1T05 A;  5CZ2 A;  3O1W A;  3PUF A;  3GL1 A;  5J1E A;  5GIN A;  4DSJ A;  3WNH A;  4QS9 A;  1YIJ N;  4K43 A;  1TUU A;  4KFB A;  3DLL L;  1HJR A;  2B6A A;  3EE8 A;  1TGO A;  1JXB A;  4AQY K;  1XMO K;  1P8Z A;  4X66 K;  1QHA A;  2DFE A;  4BRL A;  4BRH A;  2P9N B;  3IDH A;  4E19 A;  3OYB A;  1GLJ O;  1DTT A;  3CCU N;  1W9H A;  3AVC A;  4C8O A;  3HOS A;  2Q3S A;  1QSY A;  3LAM A;  3O9U A;  3VQP A;  4OJR A;  2HHT A;  2E6M A;  1QVF M;  3LWL A;  2ZGZ A;  4CJT A;  5JLF A;  2O8F B;  1WBB A;  2PZS A;  1EP4 A;  4OPJ A;  3CJ9 A;  2HST A;  3QLH A;  4JRP A;  1NK4 A;  3AGK A;  3OYC A;  3ATU A;  2YHY A;  4H5T A;  1DLO A;  4EAH D;  3ZLJ A;  1U04 A;  1GLA G;  4PHT X;  2QM1 A;  4DG1 A;  3JYT A;  3C7N B;  3FZM A;  2HBL A;  2OPR A;  4Z4C A;  4C1N K;  4DR1 K;  1BIS A;  4EP4 A;  1HQU A;  1YIT N;  3NE6 A;  2W42 A;  1HKB A;  3W3D A;  4OO1 J;  3CPE A;  4DSK A;  4IFV A;  3BP8 A;  4CHQ A;  4AHR A;  3V4I A;  3SBT A;  4CEC A;  4IJA A;  4RW4 A;  4CK1 A;  4BE1 A;  2EHG A;  3DRP A;  5FPN A;  4OGC A;  4BWM A;  4M45 A;  3QEW A;  1BQM A;  4BR2 A;  1HNX K;  3TAM A;  3AO5 A;  1ZBL A;  1VSI A;  5AQV A;  1HNZ K;  1XWL A;  4O4G A;  1T6C A;  4LF8 K;  3FZF A;  4HVJ A;  3MXI A;  2HND A;  4CZG A;  4DLG A;  3W0L A;  1KAY A;  1BWF O;  4DQR A;  3A5N C;  4OKE A;  1RCH A;  3O1B A;  3QBW A;  3VQB A;  4FLU A;  3G4S N;  5AQZ A;  3ZT1 A;  4L3Q A;  2ZM6 K;  3AA4 A;  4B3S K;  5E84 A;  4NLC A;  3U8X A;  1RDD A;  2OZM A;  5F2R A;  3ZT2 A;  1ZXO A;  3KK7 A;  4CF9 A;  3OBW A;  2A3Z A;  5C10 A;  3WXJ A;  1GLC G;  5E41 A;  1UA1 A;  1CXQ A;  3I0R A;  4XEI A;  4A2A A;  5B8H A;  3IRX A;  1JCE A;  3WNE A;  2CGL A;  4NB4 A;  3DOK A;  2GBZ A;  4CJV A;  2G8V A;  1NMN A;  5KPZ A;  3VEX A;  1YUW A;  1XHX A;  5FLX O;  4DKW A;  4EZ6 A;  4FVM A;  2W41 A;  4IOA L;  4KH5 A;  4DCH A;  4KI6 A;  3RRG A;  3U4L A;  3VF4 A;  3MN9 A;  4BR9 A;  4E7K A;  4CD3 A;  2YNF A;  3P31 A;  2YKN A;  4B9V A;  3HL8 A;  3UKR A;  2FBV A;  1XUP O;  2DFF A;  2G8K A;  4DV5 K;  1R59 O;  1U6Z A;  4FJJ A;  2YKM A;  1QE1 A;  3ULE B;  4WE1 A;  2BDP A;  2O8B B;  4M3Y A;  3NH2 A;  3VQ6 A;  1GLD G;  3A0I X;  4CHN A;  3K9J A;  3LM2 A;  2YI1 A;  1FJG K;  3IMX A;  5AZI B;  1TKT A;  4H0T B;  4B3M K;  4AM7 A;  4H0V B;  3WXK A;  5JVH L;  1SS6 A;  2GUP A;  3T1H K;  3LPU A;  4QS8 A;  5T7B A;  1YTU A;  4WFB L;  4Z4H A;  3HT3 A;  4B9Q A;  4F3T A;  1L3V A;  4LSN A;  1WSG A;  3HPO A;  3CME N;  3SUN A;  4X62 K;  4Z4F A;  4CJK A;  1K8K A;  4CJS A;  1UOC A;  3VEV A;  4ISG A;  4FL9 A;  3SPY A;  4F4K A;  5ADX H;  2WTU A;  2IS3 A;  1QQN A;  2YHA A;  4PL7 A;  3BEX A;  4B9S A;  1LV5 A;  2P51 A;  4C23 A;  2O8E A;  2FBY A;  3OYF A;  3L2W A;  2YX6 A;  2ASM A;  4CER A;  1QZ6 A;  2O8C A;  2O8D A;  2W6K A;  2YHB A;  3M1F A;  3SLC A;  4J2A A;  2XRI A;  1KAX A;  5EXW A;  3C95 A;  5TKY A;  3TWH A;  4F2S A;  4E0D A;  3SJH A;  4CK2 A;  3H3N O;  1HLU A;  4B9M A;  4YOY A;  3FZL A;  2E2O A;  3M8R A;  1TVR A;  1RDB A;  1BUP A;  5H1S Q;  4B9U A;  5GIP A;  2I7N A;  3NH0 A;  4FLZ A;  4KTW A;  2NRX A;  2IDO A;  2QKB A;  3J80 O;  5I9E B;  4WCE L;  4BGA A;  3DLE A;  4JI3 K;  1GLE G;  4CFD A;  1ZBS A;  1BI4 B;  2KZZ A;  4CF0 A;  1C1B A;  1HKG A;  4PKI A;  5AQY A;  5DMR A;  4O0I A;  4M7Y A;  4RW6 A;  4PUO A;  3TU5 A;  1I94 K;  3QNN A;  4CGG A;  1BGX T;  1NK5 A;  4CEE A;  3FE1 A;  1CZA N;  1VK0 A;  4IXC A;  3D6R A;  4R79 A;  1N33 K;  4HCC A;  1RT3 A;  4JLH A;  4CJW A;  4CIG A;  3NVK A;  4M41 A;  3WEE A;  1VSD A;  5CY4 A;  5J2P A;  1U49 A;  1KAZ A;  2GWJ A;  5BPN A;  1YXQ A;  1NOZ A;  4WFA L;  3HI0 A;  2KZM A;  4B3R K;  4I6M B;  4FOI A;  5KRT A;  2AJQ A;  1TL1 A;  4FM0 A;  4O44 A;  4FWO A;  4CF1 A;  4YOW A;  3ZSR A;  4BGB A;  1EWR A;  3QER A;  4H8K A;  3CG7 A;  4CHP A;  3F73 A;  3IKM A;  3KK1 A;  1BU6 O;  4RCH A;  4AHS A;  1SKR A;  1FW6 A;  3MDQ A;  1LWF A;  1FK9 A;  4FWR A;  2QXF A;  5AQJ A;  4DTX A;  5KQD A;  5I42 A;  3K0S A;  3VEZ A;  5KQ8 A;  5GAG P;  3UKU B;  1LAW A;  2HF3 A;  3O80 A;  1NGJ A;  1P90 A;  3OYI A;  1A5V A;  2WC9 A;  2B5J A;  4W5O A;  1W0H A;  4BRG A;  1NGE A;  2XY8 A;  4I7F A;  1BA0 A;  3SQ4 A;  1NGB A;  3M5R A;  1KVC A;  2E1Y A;  2E2P A;  3R6M A;  3Q7B A;  2ZJQ L;  4HTU A;  4GV6 A;  1CLQ A;  2X6N A;  4KKO A;  2ZF5 O;  1IKW A;  1SKW A;  4KHP K;  1J53 A;  3SAG A;  1GOB A;  3THW A;  1RBR A;  3KZB A;  4NLB A;  3CJB A;  4JS4 A;  4HHT A;  4DUY K;  1ASV A;  4CZJ A;  2VQE K;  3NF8 A;  1UWB A;  5AQH A;  1RDC A;  2QA4 N;  2HMP A;  3LL3 A;  4EFH A;  3IG1 A;  4JI4 K;  1RDW X;  4B3T K;  5CYM A;  2E1Z A;  2QWM A;  1HUX A;  2OZS A;  1RFQ A;  1D4X A;  5AQT A;  5C42 A;  3CQX A;  1M1K O;  3A5L C;  3BZC A;  5BN8 A;  4DWI A;  3ITH A;  1WOQ A;  4M3W A;  2WFB A;  3V1R A;  3PO5 A;  5FPD A;  2RHK A;  4YOX A;  3O3H A;  3PX0 A;  3VER A;  2HF4 A;  3G25 A;  4FWM A;  5FRN A;  5EU7 A;  1QSS A;  3P38 A;  1YVN A;  4PL8 A;  4NXM K;  2VGN A;  4FWP A;  1Q7Y O;  1VQK N;  1VRT A;  2IVP A;  5M1P A;  2P1J A;  1I39 A;  3DMJ A;  3LAL A;  3IAY A;  2QXL A;  3ZSX A;  1RT7 A;  4WYB A;  4DTO A;  2W6L A;  4ZTF A;  4FJK A;  1BO5 O;  1NU0 A;  2WBN A;  4LFB K;  4A62 A;  2HBJ A;  2E8A A;  2P9K B;  1JCG A;  1GLL O;  3AO3 A;  1VQ4 N;  1JJ2 M;  1VHX A;  1NGA A;  3ZSY A;  4JI7 K;  2QEX N;  1KD1 O;  3KKR A;  2A42 A;  5FPM A;  3VQ7 A;  4E1N A;  4JHD B;  2W40 A;  1VSF A;  3ZX3 A;  4AH9 A;  5GAD P;  3M8Q A;  4XH4 A;  4AHU A;  3AA5 X;  3TSQ A;  4CZF A;  3Q7C A;  2P9N A;  3PSF A;  1NJI O;  4CEO A;  3SI6 A;  1IKY A;  1WLJ A;  1Q18 A;  5AQU A;  2X6S A;  3L2V A;  1VQ9 N;  4N76 A;  3GDQ A;  3OHR A;  1SKS A;  1A5W A;  4DSF A;  4DV2 K;  2VG7 A;  2V7Y A;  3ENH A;  1IBL K;  2E4L A;  1OH6 A;  1ATS A;  3CCS N;  2HHS A;  4ILJ A;  3AVL A;  2G8U A;  1BDG A;  1J6Z A;  1J54 A;  3HST B;  3VQD A;  1E3M A;  5LJW A;  4WF9 L;  4GVE A;  4CD1 A;  2P9U B;  5KGX A;  3CMA N;  4GW6 A;  4J2B A;  1GLF O;  4JKB A;  1FXX A;  2QWQ A;  3C7N A;  3TSU A;  4RWT A;  3AVM A;  2VGM A;  2F9W A;  2X78 A;  2I5J A;  3IFR A;  5AFU A;  3QFU A;  3BF1 A;  1BG3 A;  1S1U A;  1ASW A;  2FSJ A;  1VAZ A;  3SQ1 A;  5EY4 A;  4B1Z A;  1VQP N;  3MK6 A;  5FPE A;  4M3T A;  3NMU A;  4B08 A;  3C94 A;  3EKU A;  1DEJ A;  4I2Q A;  4CGH A;  1YHQ N;  4MDA A;  1HNW K;  4FOE A;  4OX9 K;  1WUA A;  3TTD A;  3NFA A;  4B8A B;  1SV5 A;  4IO9 L;  3VQ9 A;  2E2Q A;  4FZZ A;  2FXU A;  4OKJ A;  3OS1 A;  4KRE A;  1D8Y A;  5AQL A;  3CCV N;  3B6P A;  3C6H A;  4MQ3 A;  3P83 D;  1T44 A;  4KV8 A;  3KKS A;  4CED A;  2YHW A;  4MLH A;  1SUQ A;  1HNV A;  4FWS A;  3D0P A;  1QQO A;  3CCR N;  4BRA A;  4ZTJ A;  3CCJ N;  1WB9 A;  4BRI A;  5HRN A;  2Q1N A;  3NAE A;  3CJC A;  2F8T A;  3T1Y K;  5SWM A;  4CEZ A;  3CXC M;  4DTS A;  3H46 O;  4I9L A;  3GOI A;  1RT1 A;  1XNQ K; 
#chains in the Genus database with same CATH homology
 2UXD K;  4DR7 K;  4DV1 K;  1HR0 K;  2UUC K;  3J7A P;  4LF5 K;  2VQF K;  5BR8 K;  2ZM6 K;  4DV2 K;  4B3S K;  4CW7 B;  1IBL K;  5IWA K;  4DV4 K;  1XNR K;  4KHP K;  4YY3 K;  1IBK K;  4DR6 K;  3OTO K;  2E5L K;  4DUY K;  2VQE K;  2F4V K;  4JI5 K;  4DR5 K;  4AQY K;  1XMO K;  4X66 K;  1XMQ K;  3J81 O;  4JI4 K;  2HHH K;  2UU9 K;  4LFC K;  3J80 O;  2UUB K;  4B3T K;  4JYA K;  4JI3 K;  4LF7 K;  1IBM K;  5FLX O;  5IT9 O;  4LF4 K;  4JI6 K;  3J7Y P;  4GKJ K;  3JAM O;  5A2Q O;  4DV0 K;  4JI1 K;  1I94 K;  4DR3 K;  4X64 K;  4LFA K;  4DUZ K;  1HNW K;  4OX9 K;  2UUA K;  4NXM K;  4NXN K;  4DV5 K;  4V19 S;  1N33 K;  5LMN K;  4CVN E;  4GKK K;  4YHH K;  1FJG K;  4DR1 K;  5LL6 Z;  4B3M K;  4LF9 K;  1N34 K;  3T1H K;  4DV7 K;  4JI0 K;  4DV6 K;  4DV3 K;  4LFB K;  4B3R K;  4DR2 K;  1J5E K;  4LF6 K;  1N36 K;  4X65 K;  2UXB K;  4JV5 K;  1N32 K;  4K0K K;  4X62 K;  5LMU K;  4JI7 K;  2UXC K;  4DR4 K;  1HNX K;  4JI2 K;  4JI8 K;  1HNZ K;  3T1Y K;  5AJ3 K;  4LF8 K;  1XNQ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...