4YHHK

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tigecycline
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
115
structure length
115
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of an alternative mode of tigecycline binding to the bacterial ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 26
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4yhhK00
4DV6K 4NXNK 1IBMK 1IBLK 5AJ3K 1J5EK 4CVNE 4X64K 4V19S 1IBKK 4GKJK 5LMNK 4B3RK 5A2QO 5FLXO 4JYAK 1XMOK 4JI5K 1HNXK 4YY3K 4DUZK 1XMQK 2UUCK 5BR8K 5IT9O 4JI2K 5IWAK 4LFBK 4DV1K 3T1YK 2UUBK 4NXMK 4DR3K 4DR4K 3T1HK 4AQYK 1I94K 4JI4K 4GKKK 4K0KK 4B3SK 1HNWK 4X66K 2UXDK 4DR7K 4DR1K 2VQEK 4JI8K 4DUYK 4B3TK 4DV4K 4DR6K 1XNRK 3JAMO 1N36K 4JV5K 4LF5K 1HR0K 4LF8K 2F4VK 2UU9K 1XNQK 2UXCK 2HHHK 1N34K 4OX9K 4LF4K 2UXBK 3J80O 4DV0K 4LFCK 3J81O 4X65K 4JI3K 4X62K 2ZM6K 4DV7K 4DV2K 5LL6Z 2VQFK 1N33K 3J7YP 4DV5K 2E5LK 4JI1K 4YHHK 4CW7B 3OTOK 4B3MK 4LF9K 4KHPK 2UUAK 3J7AP 4JI6K 4JI0K 4LF6K 5LMUK 1N32K 4DR5K 4DV3K 4DR2K 4LFAK 4JI7K 1HNZK 4LF7K 1FJGK
chains in the Genus database with same CATH superfamily
4B9TA 4NXNK 4CERA 1QHTA 4RW7A 1TVRA 5C2DA 2FBXA 1YHQN 2YV0X 4CFCA 2QK9A 1DLOA 2OANA 1ESVA 2HNDA 3CCQN 2ZF5O 4ILGB 4F4KA 4NLCA 2QKKA 3MEGA 3R3LA 1NGBA 3TAFA 5GAHP 2VWKA 4FLYA 4CZEA 3IFRA 3EE8A 4LSNA 4FJKA 4DTJA 3DXMA 4B3OA 4FJ5A 5GIPA 4CEDA 1BGXT 4XH1A 1BQMA 3QEWA 4CHOA 3NAEA 1GOBA 3AGKA 4BRDA 4K25A 4WFAL 3AVKA 1WBBA 3FFIA 2NRVA 5F2RA 2UXDK 4KH6A 3DLHA 1KFSA 4BVPA 3GL1A 1SKSA 4Y1CA 2W6LA 3THXB 1ZXOA 3F5TA 1XWLA 2OPQA 4JRPA 4ELVA 3SMPA 3LDQA 5C25A 3THWB 3O08A 4JD2A 3CM6A 3WNEA 3O9SA 4FSVA 2QI2A 3CI5A 1RTJA 4F3OA 4CHNA 4DMNA 2HHTA 4A59A 4B1ZA 4JAXA 1BG3A 3HTVA 5DM6L 2X6SA 3C7NA 3G4SN 3R6MA 4DV0K 3KLGA 1LWEA 1C0FA 4DSKA 2G8UA 3AVIA 4H03B 4C8LA 5BPMA 4CBXA 2OYQA 3V9UA 4AHUA 4JI1K 3QERA 2ZD1A 4CECA 3F9KA 2OPRA 2P9KB 1U45A 4O4GA 4PHTX 5BPNA 3DWLA 1HYVA 1DTTA 5ELZA 4H5NA 3TWHA 2HF3A 3E01A 4JS5A 4JI7K 2P51A 2D5RA 5BR9A 2RN2A 3KD1E 3LAKA 3HM8A 5C0YA 3DLGA 3LP3A 2H3GX 5GINA 1F21A 3PV8A 5CHIA 3SMSA 2HHQA 4GMJB 1NJZA 1XHXA 4DQSA 4Z4EA 3WNGA 4MO4A 1VQNN 2PYJA 1Q9YA 5IT9O 3GDQA 4OKKA 4H5WA 1VSDA 1D4XA 2E1ZA 3A5NC 3CQYA 3VGKA 3I56N 3VEOA 1VQLN 4N47A 4XEIA 1KFDA 3OYLA 1S6QA 3HXMA 5CYMA 3VEWA 1KC8O 1KRPA 4W5NA 1JCEA 3NGZA 3C6TA 3EN9A 4EAHD 4M3UA 1CZBA 2I7PA 1N8RO 1IKWA 3CETA 4CZLA 1TL1A 5J1EA 3A8YA 3NMUA 4LF8K 4HCBA 1EKEA 4FJXA 2KZZA 1Y64A 2IGIA 3O1BA 2UXBK 3PSIA 4BVOA 3F9MA 4KREA 3WT0A 4DTMA 3P1GA 3EKUA 3LPUA 5LL6Z 2IOCA 3U9DA 3DOKA 2G8HA 4DV5K 3AVCA 4CF9A 2R7YA 5SZTA 4HUFA 2EWSA 1RT3A 3IDHA 1LW2A 1ATRA 4PKGA 2F8SA 1VSEA 1W9HA 2QA4N 2ITGA 3VTIA 4B3MK 4IO9L 1QSLA 1ZBFA 3RVCA 4Z4HA 1TKXA 3V1RA 2WOMA 4RW6A 5AQLA 3PX4A 1V4TA 1N6QA 3KK2A 4FZYA 1RILA 3K57A 2HHXA 1YF5L 3SBGA 4DSIA 2AP1A 1ZBLA 4YFUA 4LH5A 4KB0A 1WSHA 1IH7A 3HPHA 4MO5A 4YOWA 2RPIA 1TK0A 3T3FA 4BC2A 1L3VA 2B4JA 5HRPA 2WTUA 1JLEA 4CEOA 1VQ5N 4HCCA 1EWQA 3TSQA 1C0TA 3H1VX 4A61A 3VA0A 1NK7A 4K41A 3WXIA 5DM7L 1RDBA 4BRMA 3CFRA 2HW3A 1YUWA 1NMNA 4I2QA 3VEYA 1JLFA 3UB5A 4RW9A 1UA1A 2RKIA 3PO5A 4FWSA 3PX0A 5FRNA 1E4FT 1TYQB 4GVMA 4A5BA 1HMVA 4CK1A 2OPPA 4BRAA 4IEIA 4HHTA 3LDNA 3O4NA 3QMLA 2F8TA 3G71N 2P9SB 1WSEA 1GLLO 2A42A 3O1WA 5HRNA 4M3YA 3ATVA 4F8RA 1GLEG 5LJVA 4DV4K 4DSEA 3KLEA 1QVGM 4FWLA 4CIFA 4AH9A 1HR0K 2VWJA 1DTQA 3CQXA 2ZGYA 5BN8A 4ID1A 4FCYA 1VQKN 2Q2RA 3ID8A 4KO0A 3L2QA 2JLEA 3O6WA 3WXKA 3LWMA 2OCEA 3HP6A 3N4PA 3QBXA 4FZZA 4HTUA 5KRSA 4BE1A 5M1NA 5AQQA 4CJVA 3L3VA 1NWKA 1W0HA 3MXIA 2ZE2A 3I8DA 1IG8A 3K2PA 4FWRA 3LALA 1JLBA 2FF3B 4DF8A 3AO5A 1HNZK 3WEEA 2P5OA 4KHUA 4AHSA 2P9NA 4CJ4A 1J5OA 1E3MA 3OBWA 5JMVA 4CJQA 2GWJA 2P9UA 4X64K 5AQYA 2PZSA 4PKIA 1UWBA 3R1XA 3MEEA 4H4OA 4OLAA 3K5MA 3MK6A 1JCFA 4FJLA 3VQ9A 2P9IB 2EHGA 1KSPA 4JI5K 3I8BA 3U4LA 1WSIA 2BGGA 1HRHA 3VESA 4CEZA 1ASUA 4M45A 4EFHA 4DQRA 3TSUA 1NK5A 3NFAA 1YI2N 5D3GA 1T6CA 4CGGA 4YOVA 3M8RA 3SZ2A 2KFNA 3HM9A 1BQNA 2VG5A 1NGJA 4BRKA 3T1HK 3KK3A 3SYZA 4QS7A 1EP4A 4CHQA 3TANA 4GKKK 3QO9A 1QSSA 1Z25A 2O8BB 4K8ZA 3RMCA 4MDAA 3GBTA 4WE1A 4JEPA 3WUHA 3ZSZA 4B3TK 4GY2B 2DY4A 3AO4A 4MLHA 3DLBA 1P8ZA 4WFNL 4CI6A 4FJ7A 4E1JA 2QWPA 3TAMA 3E9LA 4O5FA 3UIQA 4H5VA 1OH7A 4A2BA 5CY4A 1X9SA 1QQMA 4RW4A 1C1BA 1BU6O 4BRQA 4EHTA 3J80O 1NOZA 1HPMA 3E1YA 5FROA 3U3YA 2HHSA 3CJ7A 5AQOA 2O4GA 3E9PA 3O80A 4IEEA 1CZAN 2NNWA 3CG7A 3NF9A 4B9VA 3U9ZA 5BRDA 3AGRA 5GADP 3S3NA 3DM2A 3CJ1A 3B6PA 4KV8A 4FWPA 5AQKA 4LF6K 3DLEA 4F2SA 3KK7A 5LJWA 4CEQA 3CF5L 5AQVA 2DTUA 3C6HA 1VSKA 2GELA 4Z4GA 1IBMK 4J2AA 1IBLK 3D6RA 4MFBA 1VQ4N 3LP1A 4YDUA 5J2QA 3ENOA 3OYIA 4RW8A 1JLAA 1JXEA 2YHAA 4FVUA 3DRRA 3C0BA 2BTFA 4FM2A 5I3UA 1NLVA 3DLLL 3D2EB 3TU5A 3OYNA 1TKTA 1FK9A 2KKZA 3KD5E 1HJOA 4PL8A 2CGKA 1Z6RA 3L0QA 4M3ZA 3VOVA 1S1XA 4QS9A 3OYFA 4CGJA 1ZBHA 1YITN 1QZ5A 3GOIA 2WUSA 3DRPA 3D0PA 4B1VA 3A5MC 3G0ZA 4DR1K 4Y1DA 5AQJA 4JS4A 1NJWA 2P9SA 4FWOA 3DXKB 3MXJA 3BDPA 4ID5A 5C15A 3K9JA 3QEVA 4WQ5A 4W5QA 1GLFO 1EX4A 2HNYA 1XNQK 1K73O 4OX9K 3QIPA 5AQHA 1J9AA 5J2PA 1S72N 4ELUA 4CBWA 3RRHA 3VEZA 4WFBL 4Y0WA 3MMVA 5FPNA 4CJ3A 1XHZA 4KTZA 2Q1NA 3J7YP 2E6MA 2P1JA 4CK2A 4FPBA 3ZSRA 4B8AB 1VQMN 2RE2A 2OTLN 3WQUA 4JKBA 2Z1IA 1KVCA 3IG1A 3IMXA 4FW1A 3V9WA 4CHZA 4DS5A 5EXWA 1HJRA 4LF9K 2FC0A 4MLEA 2UUAK 3KVGA 3KLHA 4I2PA 2YNHA 3H1QA 4G1QA 3AVBA 4GV9A 3FZMA 4H8KA 1KLMA 4AM7A 1OKJA 4LF5K 1WUAA 3LPTA 3AVAA 1T7PA 3PSFA 4E89A 2P9NB 3HZ6A 4M3RA 1XC9A 3CMAN 4DTOA 4FM1A 1NK8A 3SI6A 4IG0A 3VA3A 5CZ1A 2ASMA 4JLHA 1KAXA 1QVFM 3CCEN 2KTQA 4YDUC 2NRXA 1DKGD 4BG8A 1TUUA 3VQ8A 2IC3A 4DFKA 4WYBA 5AQPA 3CC2N 3QETA 2ZWHA 5IWAK 4FJMA 1EQYA 3BEXA 3ZLJA 4PY5A 2O8DB 1T3VA 3MN7A 2AJQA 2UUBK 3K9KA 4CJ5A 1U4BA 3R8EA 1VSMA 2G8FA 4KRFA 2ZGZA 3NVKA 1XQSC 1S22A 4B9MA 4DTXA 2LSNA 3H45C 2CGLA 4JI4K 4Z4CA 4EP5A 3BZCA 4B3SK 1C1AA 1X9MA 4X66K 1RBUA 4M3XA 4N56A 4HUGA 2HHUA 1H1VA 3ZETB 1SL2A 1ZBIA 2RF2A 4H5RA 4JKCA 4BRIA 1TAQA 2ITMA 4FPAA 2ETJA 3BP8A 4CHYA 3CCVN 5FRMA 1A5XA 4IFEA 2BH1A 2NRHA 3HI0A 5GAGP 3O8MA 2Z1HA 5JS2A 3B8AX 1JL2A 1S9EA 3EY1A 4J2DA 1U2VB 2PY5A 2GX9A 4JHDB 4H0XB 3M8PA 3L2VA 3LL3A 4GNIA 2ZM6K 5JVHL 3RRGA 5I42A 1T03A 4BWMA 1C0MA 3CPEA 3LDSA 3MX2A 1W97L 3C95A 1ASWA 2FBVA 4BY9C 3LM2A 4DFMA 3SV3A 3PO4A 4F3TA 1KVBA 1Q8IA 4JKAA 4KHPK 3WXLA 3S3MA 1HQUA 4CEFA 5LMUK 3OYAA 4B1YB 3SCXA 3TTDA 2XY8A 3SK3A 3J7ZO 5C2FA 1YJNN 1RCHA 1FJGK 3LM9A 4DTPA 3TPQA 3QLHA 1A5VA 4H4MA 3AVLA 3LAMA 5LY3A 3OA9A 3AAPA 2D4WA 3TAGA 3ZSVA 4ZTFA 3L2UA 1VQ8N 4AF1A 3MWPA 3TAPA 2A3ZA 5A2QO 2IVOA 3VQBA 3QNNA 3CPWM 4DTUA 4PQUA 1TV6A 3SQ0A 2QW9A 3L2RA 3HL8A 5CR4A 2KZMA 4JI2K 1U49A 3EZWA 5KQ8A 2VWBA 4ILHA 3OYDA 1M1KO 3VN5A 1WBDA 1QSYA 3UKRB 4M41A 3CERA 4KBOA 3OBYA 3B6OA 1RTIA 2A6AA 3QDKA 4FJ9A 5BN9A 4B9QA 5E41A 4KHWA 1S1WA 2KHOA 3PUFA 3CM5A 1IKVA 2YCHA 3AA2A 4RCHA 1CXUA 3HVTA 3RSEB 4IJNA 1RTDA 2E8AA 4DUYK 3LDLA 2ZJRL 3ZX3A 1ILYA 2WFBA 4DFJA 1BOTO 1N36K 5HLFA 2NRWA 2V52B 1IV0A 1J53A 1D9DA 1W7AA 2E1YA 2JWLA 4ILJA 3BY5A 3LANA 1SS6A 4OKJA 2PAVA 2FLOA 4CF2A 1X3MA 4GV3A 3NE6A 1RBTA 4FJJA 1X1PA 4KH5A 3CC4N 4IXCA 1HKBA 4AM6A 4BREA 4I9QA 4B1XB 3L3UA 3VQ5A 2O8CB 3OTOK 5KPTA 2O4IA 5AQNA 4DF4A 1V4SA 4B08A 5AFUA 4FYDA 4O0IA 4PUOA 1IKYA 4KTQA 4DQIA 3AVNA 4JNEA 5ADXH 3VF2A 3EEQA 5AZJB 1ASVA 4DV6K 4FO0A 1X9WA 4FJIA 3K0SA 5AJ3K 2XY5A 4E1MA 2AA4A 3HO1A 3A2FA 1IBKK 5LMNK 2CGJA 4BDZA 4KH4A 2WONA 4ISFA 1UOCA 4FLWA 1M90O 3SUQA 4CJWA 3CFPA 1C6VA 1TKZA 1U2VA 4CEBA 5EOYA 3THVA 3MAQA 1XC3A 4B8CA 4A5AA 4FL9A 1RGIA 1T6DA 3EO3A 4E7IA 3VQQA 4IBNA 1RDWX 1Q86O 3AA4A 3CJ9A 4KKOA 4CGDA 4DU4A 1VSLA 4CZGA 4E7HA 3VETA 3VGMA 3TSPA 2FSNA 3OHRA 4WQ4C 3A5LC 3O3HA 4E7JA 3TABA 2Z1GA 1G99A 2B6AA 4DTSA 4M42A 3VEVA 1NG9A 5DK5A 1I3AA 1KVAA 3JAMO 1JCGA 5J2NA 4PL7A 3VF6A 4I9LA 1RT1A 2J4RA 3TTCA 3DXKA 5AQZA 3QICA 1BCMA 4Z0UA 3ZX0A 4J8FA 1GLCG 4HTLA 2F7TA 4IG3A 4TSXA 4LFCK 5K14A 4B9SA 3HBTA 4CJRA 4DV7K 4DV2K 1N33K 4CZHA 3OYCA 1VQ9N 1RT6A 2F9WA 2VGMA 2YHWA 3CFOA 3LZIA 2E5LK 3IAYA 3V9ZA 4NLBA 4NYNA 4BE0A 2W41A 1E4GT 1NM1A 4CW7B 1BI4A 2Q36A 3S3OA 3H46O 1SQKA 3NBPA 4DR5K 4DV3K 4ELTA 1KD1O 1OH8A 1RDDA 4FK4A 3SQ1A 5KGXA 4CF8A 4IDKA 1W2BM 3WXJA 1Q18A 3O3GA 1S1VA 3IUCA 3MN5A 1NGFA 1RDCA 5HL7L 1TL3A 3NCIA 3V1OA 3QB0A 5AFUH 1NK6A 4ZHRA 2NRZA 5FLXO 5M1KA 1LWCA 2GTDA 4RTFD 2PYLA 2E2QA 1LAVA 4I6MB 1GLJO 2KLAA 3I0SA 2IS3A 4XH5A 1KLNA 4U67L 2YNGA 3O9RA 1UAXA 4OO1J 2HOEA 2YHXA 5C10A 2HSTA 3T1YK 1HYSA 4M3WA 1NK0A 5EY4A 3HOTA 4DQ8A 1Q7YO 3VQ4A 4DR4K 3OS2A 3SLCA 2Q31A 1WSFA 1QQNA 1ATSA 3VERA 2O8DA 4CZFA 3OW2M 3VQPA 1KAYA 2WBNA 3HT3A 2G8WA 1ZC6A 1B9DA 3C7NB 1NK4A 4BDPA 2E88A 5BPLA 2GWKA 4XIUA 3VQCA 3V9XA 3QFPA 4BRFA 3ENBA 4FLXA 3ZSOA 5HP1A 2GV9A 5TKYA 1VRUA 1NJYA 2X6NA 4IFYA 1TK5A 1L3SA 1SKRA 5JICA 1VK0A 1GLBG 2UXCK 2W42A 3TAQA 3NH1A 2P9KA 4CZMA 4DG1A 2QWQA 1JLGA 4CJ7A 5C42A 3CJBA 3SPYA 2VQFK 4WF9L 1BA0A 4Z4FA 3E66A 2P5GA 1BWFO 3SQ2A 3CYMA 2E20A 4B9NA 3QBWA 1O1WA 3KLIA 1YJWN 3ZT4A 4BQLA 3QESA 1SUQA 4CFAA 1G15A 1NGAA 1S6PA 4FM0A 1IJJA 3KZBA 3UKUA 3FZHA 4IDHA 5KTQA 4LSLA 3AO2A 1VHXA 3D45A 2OTJN 4CZIA 5F0XA 1X9JA 3D7EO 1RT2A 3O9TA 1RDUA 1RFQA 3OYGA 3FLCO 2VYPA 4OGEA 2HBLA 5AQSA 2D1KA 4KI4A 2KQ2A 3ZCMA 3Q7BA 1EWRA 3FFKB 4CFDA 2V51B 1IKXA 2ATQA 3LP2A 4E3SA 1J5EK 3W3DA 2O8BA 1GLAG 3CC7N 3FZKA 4GKJK 1OVYA 4Q5VA 1L3TA 1BDGA 1RTHA 4FW2A 4EIAA 4M7YA 1EXQA 1K9MO 3KWGA 5EVZA 2NZTA 1NGGA 3OS1A 2UUCK 2JGUA 3ZT1A 3ZX2A 4BRPA 2DFEA 1HKCA 1WLJA 2X78A 1RBSA 2IAJA 1VSIA 4DR3K 5CYQA 4FLTA 5ADXA 3KWIA 2QWLA 3FZLA 3VPZA 3GG4A 1XUPO 3H3OB 3RWUA 1QQCA 1HNWK 2P9PB 1D8YA 1SZ2A 1U48A 4JI8K 4IZ9A 4W5RA 4BWJA 3J8AA 3ENHA 4BRGA 3MWTA 4N5SA 3AVFA 4OLBA 3LWLA 3F2KA 4BRNA 1HQEA 1BIUA 1NJXA 4YORA 3MECA 2YJFA 4CEAA 4CK3A 2O8FA 4JI3K 3SAHA 5HRSA 2YHYA 1BL3A 5AQUA 4X62K 1D9FA 2HBMA 4BROA 5AZIB 4WCEL 1YTUA 1HPZA 4NCBA 2CH6A 3EYZA 1HLUA 4YHHK 3CIPA 3VMFB 1K8KB 1EO1A 5HBMA 3NGIA 4JD2B 3ZSWA 1KTQA 1NGIA 3M6GA 5E26A 1NKEA 1BI4B 1LAWA 4JI0K 2JWKA 5AQRA 1ATNA 2DFFA 2FXUA 1VSHA 2O8CA 5SWMA 3WNFA 4KTWA 1FW6A 1JLCA 1FKPA 3DAWA 2CH5A 2W40A 2HVIA 2FSKA 4BGAA 4FWMA 4QS8A 3HPGA 5KRTA 5AZJA 4OPJA 1C1CA 1MDUB 3FGUA 5BRHA 3PY8A 5AR0A 1K6YA 3EKSA 1TYQA 2ASPA 3ZT2A 4DLGA 4RWTA 3GE1A 5AQWA 5M1OA 5KPZA 2BUPA 2O8FB 4GVEA 3RR7A 4M63C 5FPMA 3VQAA 1WOQA 4QOZB 2HHWA 1S5JA 2KFZA 2D0CA 1K8KA 3CCMN 1RT4A 1K8AO 1RBVA 3C6AA 3IS9A 1NNEA 1T8EA 3AV9A 3HVRA 4CJLA 4CZKA 3DI6A 2GBZA 3O5BA 4I7FA 1BA1A 3OVNA 3WXMB 3SNNA 4DR7K 1ZBSA 4CJTA 2YNIA 3MN9A 4OPKA 3ULDA 3SJHA 3HPOA 3K5OA 4FJNA 3T69A 2F4VK 1NMDA 3RMBA 1SKWA 1HX1A 3QEPA 2A1RA 4E1NA 2ZJPL 4LF4K 3A5OC 4IJAA 2DPNA 4CFBA 4H0OA 2QKBA 1NGEA 3THYA 3DLKA 1YAGA 1ZBUA 3QEXA 2F9TA 3SUNA 3ZT3A 1RDAA 3PIOL 2P9LB 3KKSA 3SBTA 4WQ4A 4AILC 4DS4A 3V4IA 4C8NA 3RMDA 1OH5A 1L5UA 4CJFA 3V1QA 3KK1A 4C8KA 3CCUN 3L4QA 4OKEA 1KXPA 4C1NI 3FZFA 4K42A 4IOAL 4LFAK 3NGYA 4CEEA 3LDOA 4CJSA 1YTAA 3SAGA 4O5BA 5E84A 1NBWA 4C8MA 4FVMA 3PX6A 3L2WA 4BRCA 3UE5A 3AVJA 4K43A 1BHLA 3LZJA 2E6LA 2HMPA 2XY6A 2V7YA 2P9PA 4V19S 1BIZA 4K8XA 4GW6A 1MWMA 4B9LA 1R59O 1C0GA 3M8QA 3WEEB 4DHYA 3RR8A 4DUZK 5C12A 2G8VA 1HNIA 2ZQBA 3DLRA 4O8KA 3ALYA 3DRSA 3MXMA 3NHGA 1Q82O 2HMIA 2I5JA 4OGCA 5T7BA 5AZIA 2E4LA 3MCPA 4JKGA 1S1UA 1YVNA 1I94K 4NCAA 3ZEUB 4K0KK 5JLHA 3AO3A 3CCSN 3MEDA 4IWVA 4NO7A 3M3ZA 3G10A 5AQXA 2YNFA 4O44A 2B5JA 5C24A 1Q9XA 3L6QA 2XRIA 2HNZA 1VRTA 3DOLA 4DU1A 4MQ3A 1VQPN 3CCLN 1DEJA 2NLXA 5FPDA 2QM1A 5FPEA 5BREA 1REVA 3CXCM 2UU9K 2HHHK 2IVNA 3CCRN 4KAZA 4E19A 3SAFA 1BCOA 5AQIA 4CJKA 4H0YB 4DFPA 3TARA 3J81O 3HRGA 3O4QA 5CE3A 3K58A 2VGNA 1NOYA 4FJHA 1JKHA 4DLEA 4C1NK 4R79A 4BRLA 3G6EN 4FLVA 2F96A 1WB9A 2OZSA 2IDOA 4CBUA 4JK7A 1Y97A 4ZTJA 3J7AP 2YI1A 4BDYA 3CCJN 3OYJA 2D0PA 3FE1A 3TR8A 3HSTB 4FWQA 3OYBA 4LF7K 4A62A 1IO2A 1VSJA 1GLDG 2FBTA 5M1PA 1VQ7N 1P90A 3SJJA 4U7BA 3O4WA 3VTHA 3R9PA 2V7ZA 1OVQA 3OYHA 4CGHA 3K5LA 3NH2A 4O8UA 1XMOK 4GV6A 5MLCQ 1X3NA 3IKMA 4NB4A 5AQTA 2E2OA 3ULEB 1FKOA 1TK8A 4PA1A 1T05A 2Q3SA 4CIGA 1ITGA 1HKGA 3NF6A 3O9UA 1A5WA 3OY9A 5KGWA 3O9QA 2P9UB 3AARA 3NVMA 1N5YA 2VCPA 4OVLA 4BR5A 2P9LA 2FF6A 1I39A 4L8RB 1CZ9A 3AVHA 3SQ4A 3ID6A 4IO8A 2Q0UA 3A0IX 2A40A 4PKHA 5JLFA 4HVJA 2P9IA 3AA3A 2OPSA 4W5OA 1B92A 4CGFA 1IG9A 4M7XA 3ITHA 3T19A 3BUZB 3S41A 3KLFA 3EL2A 3OJSA 4EHUA 2OA8A 4JKHA 4O55A 3F73A 1TGOA 2NRTA 2UYTA 4OPAA 1JL1A 2QWOA 3MCAB 1WN7A 1YVUA 1QTMA 4KPYA 2QTDA 4G9ZA 1SL0A 3QNOA 4H0VB 1EETA 2XY7A 4X65K 2QXFA 3VQ6A 4A57A 1MU2A 3OYKA 4FLZA 1VQ6N 4JKEA 1U6ZA 2DFHA 3ULEA 5EU7A 4KI6A 3AA5X 2YJEA 4Z94A 3V6DA 1S3XA 2D0OA 2PFUA 3M8SA 1B9FA 4DU3A 3KHYA 2HHVA 5BRFA 4JI6K 1NJIO 3D2FA 1O13A 4M3TA 4CJPA 3OJUA 4QCLA 4JKFA 1GOAA 4ISGA 4FJGA 3SV4A 1QQOA 3ISNC 5I9EB 3BF1A 3I55N 4KB1A 4JRQA 3UKUB 4A2AA 3EZ5A 1FXXA 4DQPA 3U8XA 3WNHA 4CVNE 3AY9A 2Z1JA 4R5PA 5AQMA 3U3GA 4LH4A 4BR0A 4OJRA 5B8HA 1JLQA 4FK0A 4B3RK 4YOXA 3P39A 1RNHA 1SAZA 2NUBA 4FWNA 1Z26A 4RG8A 4IOCL 4BC4A 3MN6A 3VGLA 3AAQA 3I33A 3WQTA 2FBYA 2YKMA 3SPZA 4KHYA 2VG6A 4AHVA 3U6FA 3OYEA 2RHKA 3ASMA 1TAUA 4DSFA 4ISEA 3H3NO 3T7ZA 4NXMK 3M5RA 4CESA 3DMJA 1HNVA 4EZ6A 5DMRA 1NU0A 3FR0A 5HROA 2BDPA 3NH0A 4FZXC 3HSCA 2WC9A 4CJEA 1VSFA 2HB5A 4BR4A 4CIEA 4Q0BA 4IOXA 3VQ7A 2KW4A 3L8BA 5EX5A 1CLQA 3THWA 2VQEK 4CE9A 1YIJN 1WAJA 3CJCA 4CZJA 4DR6K 4FK2A 3CMEN 3OS0A 4JK9A 4BACA 1XI1A 1KCFA 3Q7CA 4UQGA 1QE1A 4NCGA 2BE2A 3JS6A 3CHWA 4FLUA 3VQEA 4B1UB 1U47A 3HK2A 3BGRA 3ZETA 1TUYA 2YX6A 1C0UA 2QXLA 1LW0A 3G25A 4BC3A 2X74A 5H1SQ 3BZKA 4CD3A 5J2MA 3NDKA 1ZYQA 4KHNA 3DJCA 4KFBA 2QWNA 3HOSA 1L3UA 3H6EA 1TKDA 4BRHA 4DSJA 4OPHA 4JHDA 2A5XA 4CD1A 4FWKA 1WNSA 5KQDA 3ZSXA 3ZT0A 3VF4A 3W0LA 4PWDA 1WSGA 3KTQA 3NF7A 1BUPA 3AVGA 3HP9A 4C8OA 4NYFA 2Y1JA 2NRRA 4AHTA 3N4QA 5GAEP 2BANA 2HVHA 2FSJA 4E7LA 4CF1A 1LWFA 1NGCA 4AHCA 1QHAA 2ASOA 3VEXA 4DKWA 4F9OA 3MDQA 4KHSA 4FOEA 3UKRA 4HUEA 4IKFA 4W5TA 1JXBA 3S9HA 4DCHA 4DTRA 4EZ9A 2QEXN 1S1TA 1HYZA 3QIOA 2IIRA 4BQZA 2QWRA 4AHRA 1XMQK 1DGKN 2YHBA 4Z4IA 3JSMA 4QAGA 3ZSQA 3RSEA 4LFBK 5AQFA 1WSJA 3TI0A 1YJ9N 1Q81O 3RMAA 4DWIA 3VENA 1R0AA 4J2BA 3IRXA 3P38A 3AVMA 1D5AA 1S9GA 1MWKA 4CGIA 3TAEA 2GUPA 4HWIA 2G8IA 4WQ5C 1DT9A 4CCHA 4JKGB 4FOIA 4BC5A 3ZEUA 3K5NA 3D2FB 4BR9A 2GEMA 3QFUA 1LV5A 3CD6N 4LD0A 3HJFA 3D2EA 3JYTA 5TKWA 4J2EA 2IVPA 5HRRA 3K59A 2QWMA 1QS4A 1N34K 2XHBA 2A41A 4DQQA 3RTVA 2XO7A 3ZSYA 5KPRA 4CF0A 3JXUA 4IFVA 3QEIA 4YOYA 4BGBA 5M1FA 1HUXA 2HBJA 1MA9B 5GIOA 4N41A 3ATUA 2D0AA 5CZ2A 2Y1IA 1LCUA 4BG9A 5JVGL 3HYFA 2OZMA 2I7NA 4E0DA 3OYMA 1CXQA 4UY8O 3THYB 5JS1A 3LDPA 4XH4A 2EX3A 3H08A 4I6MA 3NF8A 3THXA 1U04A 1RT5A 4ICLA 4LY7A 4H0PA 4DTNA 2W6KA 3V9SA 2O8EB 1BO5O 4EP4A 3SUPA 1QZ6A 3CQ8A 3KIOA 5AQGA 1NGHA 3C6UA 2Q0RA 4CJUA 4BE2A 4JYAK 1YXQA 4O0JA 1HNXK 4YY3K 4BR2A 4YOUA 4YOTA 2GUIA 4H0TB 5BR8K 1KAZA 2D0BA 1GOCA 4C23A 3C65A 3VQDA 1NKCA 2G8KA 4DV1K 1NGDA 3KJVA 3T1AA 4MDBA 2YKNA 3AO1A 3KKRA 3P83D 1SV5A 3P31A 3MX5A 4E7KA 1T44A 4AQYK 2ZJQL 3PLAA 3QINA 5HOOA 5KI6A 4KHQA 4FJ8A 3M1FA 1WAFA 2VG7A 3P5JA 1KQSM 2E2PA 4BR7A 1XNRK 1RT7A 4CHPA 5F1XA 4JV5K 3I0RA 1VQON 4B9UA 2O8EA 3BF3A 4F2RA 2E2NA 4L3QA 1J6ZA 4DSLA 3L4IA 1SL1A 4JK8A 1LOTB 2PBDA 4B1WB 2Q97A 4N76A 4JKDA 3O3FA 3DXMB 1OH6A 2A1SA 4LC9B 1YT3A 2HBKA 1Z05A 3SUOA 4FXDA 3EE9A 3DYAA 1NK9A 4JN4A 1BISA 1VAZA 1J54A 1UA0A 1JJ2M 3ZYYX 5FDLA 3P4IA 3PIPL 3E9OA 5M1QA 1N32K 3TTFA 3C94A 4DR2K 2HF4A 4H5TA 4DB3A 3V81A 1NKBA 1RBRA 4YNQA 3CJAA 3LP0A
chains in the Genus database with same CATH topology
4DV6K 4NXNK 1IBMK 1IBLK 5AJ3K 1J5EK 4CVNE 4X64K 4V19S 1IBKK 4GKJK 5LMNK 4B3RK 5A2QO 5FLXO 4JYAK 1XMOK 4JI5K 1HNXK 4YY3K 4DUZK 1XMQK 2UUCK 5BR8K 5IT9O 4JI2K 5IWAK 4LFBK 4DV1K 3T1YK 2UUBK 4NXMK 4DR3K 4DR4K 3T1HK 4AQYK 1I94K 4JI4K 4GKKK 4K0KK 4B3SK 1HNWK 4X66K 2UXDK 4DR7K 4DR1K 2VQEK 4JI8K 4DUYK 4B3TK 4DV4K 4DR6K 1XNRK 3JAMO 1N36K 4JV5K 4LF5K 1HR0K 4LF8K 2F4VK 2UU9K 1XNQK 2UXCK 2HHHK 1N34K 4OX9K 4LF4K 2UXBK 3J80O 4DV0K 4LFCK 3J81O 4X65K 4JI3K 4X62K 2ZM6K 4DV7K 4DV2K 5LL6Z 2VQFK 1N33K 3J7YP 4DV5K 2E5LK 4JI1K 4YHHK 4CW7B 3OTOK 4B3MK 4LF9K 4KHPK 2UUAK 3J7AP 4JI6K 4JI0K 4LF6K 5LMUK 1N32K 4DR5K 4DV3K 4DR2K 4LFAK 4JI7K 1HNZK 4LF7K 1FJGK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 K;  4NXN K;  1IBM K;  1IBL K;  5AJ3 K;  1J5E K;  4CVN E;  4X64 K;  4V19 S;  1IBK K;  4GKJ K;  5LMN K;  4B3R K;  5A2Q O;  5FLX O;  4JYA K;  1XMO K;  4JI5 K;  1HNX K;  4YY3 K;  4DUZ K;  1XMQ K;  2UUC K;  5BR8 K;  5IT9 O;  4JI2 K;  5IWA K;  4LFB K;  4DV1 K;  3T1Y K;  2UUB K;  4NXM K;  4DR3 K;  4DR4 K;  3T1H K;  4AQY K;  1I94 K;  4JI4 K;  4GKK K;  4K0K K;  4B3S K;  1HNW K;  4X66 K;  2UXD K;  4DR7 K;  4DR1 K;  2VQE K;  4JI8 K;  4DUY K;  4B3T K;  4DV4 K;  4DR6 K;  1XNR K;  3JAM O;  1N36 K;  4JV5 K;  4LF5 K;  1HR0 K;  4LF8 K;  2F4V K;  2UU9 K;  1XNQ K;  2UXC K;  2HHH K;  1N34 K;  4OX9 K;  4LF4 K;  2UXB K;  3J80 O;  4DV0 K;  4LFC K;  3J81 O;  4X65 K;  4JI3 K;  4X62 K;  2ZM6 K;  4DV7 K;  4DV2 K;  5LL6 Z;  2VQF K;  1N33 K;  3J7Y P;  4DV5 K;  2E5L K;  4JI1 K;  4YHH K;  4CW7 B;  3OTO K;  4B3M K;  4LF9 K;  4KHP K;  2UUA K;  3J7A P;  4JI6 K;  4JI0 K;  4LF6 K;  5LMU K;  1N32 K;  4DR5 K;  4DV3 K;  4DR2 K;  4LFA K;  4JI7 K;  1HNZ K;  4LF7 K;  1FJG K; 
#chains in the Genus database with same CATH topology
 4B9T A;  4NXN K;  4CER A;  1QHT A;  4RW7 A;  1TVR A;  5C2D A;  2FBX A;  1YHQ N;  2YV0 X;  4CFC A;  2QK9 A;  1DLO A;  2OAN A;  1ESV A;  2HND A;  3CCQ N;  2ZF5 O;  4ILG B;  4F4K A;  4NLC A;  2QKK A;  3MEG A;  3R3L A;  1NGB A;  3TAF A;  5GAH P;  2VWK A;  4FLY A;  4CZE A;  3IFR A;  3EE8 A;  4LSN A;  4FJK A;  4DTJ A;  3DXM A;  4B3O A;  4FJ5 A;  5GIP A;  4CED A;  1BGX T;  4XH1 A;  1BQM A;  3QEW A;  4CHO A;  3NAE A;  1GOB A;  3AGK A;  4BRD A;  4K25 A;  4WFA L;  3AVK A;  1WBB A;  3FFI A;  2NRV A;  5F2R A;  2UXD K;  4KH6 A;  3DLH A;  1KFS A;  4BVP A;  3GL1 A;  1SKS A;  4Y1C A;  2W6L A;  3THX B;  1ZXO A;  3F5T A;  1XWL A;  2OPQ A;  4JRP A;  4ELV A;  3SMP A;  3LDQ A;  5C25 A;  3THW B;  3O08 A;  4JD2 A;  3CM6 A;  3WNE A;  3O9S A;  4FSV A;  2QI2 A;  3CI5 A;  1RTJ A;  4F3O A;  4CHN A;  4DMN A;  2HHT A;  4A59 A;  4B1Z A;  4JAX A;  1BG3 A;  3HTV A;  5DM6 L;  2X6S A;  3C7N A;  3G4S N;  3R6M A;  4DV0 K;  3KLG A;  1LWE A;  1C0F A;  4DSK A;  2G8U A;  3AVI A;  4H03 B;  4C8L A;  5BPM A;  4CBX A;  2OYQ A;  3V9U A;  4AHU A;  4JI1 K;  3QER A;  2ZD1 A;  4CEC A;  3F9K A;  2OPR A;  2P9K B;  1U45 A;  4O4G A;  4PHT X;  5BPN A;  3DWL A;  1HYV A;  1DTT A;  5ELZ A;  4H5N A;  3TWH A;  2HF3 A;  3E01 A;  4JS5 A;  4JI7 K;  2P51 A;  2D5R A;  5BR9 A;  2RN2 A;  3KD1 E;  3LAK A;  3HM8 A;  5C0Y A;  3DLG A;  3LP3 A;  2H3G X;  5GIN A;  1F21 A;  3PV8 A;  5CHI A;  3SMS A;  2HHQ A;  4GMJ B;  1NJZ A;  1XHX A;  4DQS A;  4Z4E A;  3WNG A;  4MO4 A;  1VQN N;  2PYJ A;  1Q9Y A;  5IT9 O;  3GDQ A;  4OKK A;  4H5W A;  1VSD A;  1D4X A;  2E1Z A;  3A5N C;  3CQY A;  3VGK A;  3I56 N;  3VEO A;  1VQL N;  4N47 A;  4XEI A;  1KFD A;  3OYL A;  1S6Q A;  3HXM A;  5CYM A;  3VEW A;  1KC8 O;  1KRP A;  4W5N A;  1JCE A;  3NGZ A;  3C6T A;  3EN9 A;  4EAH D;  4M3U A;  1CZB A;  2I7P A;  1N8R O;  1IKW A;  3CET A;  4CZL A;  1TL1 A;  5J1E A;  3A8Y A;  3NMU A;  4LF8 K;  4HCB A;  1EKE A;  4FJX A;  2KZZ A;  1Y64 A;  2IGI A;  3O1B A;  2UXB K;  3PSI A;  4BVO A;  3F9M A;  4KRE A;  3WT0 A;  4DTM A;  3P1G A;  3EKU A;  3LPU A;  5LL6 Z;  2IOC A;  3U9D A;  3DOK A;  2G8H A;  4DV5 K;  3AVC A;  4CF9 A;  2R7Y A;  5SZT A;  4HUF A;  2EWS A;  1RT3 A;  3IDH A;  1LW2 A;  1ATR A;  4PKG A;  2F8S A;  1VSE A;  1W9H A;  2QA4 N;  2ITG A;  3VTI A;  4B3M K;  4IO9 L;  1QSL A;  1ZBF A;  3RVC A;  4Z4H A;  1TKX A;  3V1R A;  2WOM A;  4RW6 A;  5AQL A;  3PX4 A;  1V4T A;  1N6Q A;  3KK2 A;  4FZY A;  1RIL A;  3K57 A;  2HHX A;  1YF5 L;  3SBG A;  4DSI A;  2AP1 A;  1ZBL A;  4YFU A;  4LH5 A;  4KB0 A;  1WSH A;  1IH7 A;  3HPH A;  4MO5 A;  4YOW A;  2RPI A;  1TK0 A;  3T3F A;  4BC2 A;  1L3V A;  2B4J A;  5HRP A;  2WTU A;  1JLE A;  4CEO A;  1VQ5 N;  4HCC A;  1EWQ A;  3TSQ A;  1C0T A;  3H1V X;  4A61 A;  3VA0 A;  1NK7 A;  4K41 A;  3WXI A;  5DM7 L;  1RDB A;  4BRM A;  3CFR A;  2HW3 A;  1YUW A;  1NMN A;  4I2Q A;  3VEY A;  1JLF A;  3UB5 A;  4RW9 A;  1UA1 A;  2RKI A;  3PO5 A;  4FWS A;  3PX0 A;  5FRN A;  1E4F T;  1TYQ B;  4GVM A;  4A5B A;  1HMV A;  4CK1 A;  2OPP A;  4BRA A;  4IEI A;  4HHT A;  3LDN A;  3O4N A;  3QML A;  2F8T A;  3G71 N;  2P9S B;  1WSE A;  1GLL O;  2A42 A;  3O1W A;  5HRN A;  4M3Y A;  3ATV A;  4F8R A;  1GLE G;  5LJV A;  4DV4 K;  4DSE A;  3KLE A;  1QVG M;  4FWL A;  4CIF A;  4AH9 A;  1HR0 K;  2VWJ A;  1DTQ A;  3CQX A;  2ZGY A;  5BN8 A;  4ID1 A;  4FCY A;  1VQK N;  2Q2R A;  3ID8 A;  4KO0 A;  3L2Q A;  2JLE A;  3O6W A;  3WXK A;  3LWM A;  2OCE A;  3HP6 A;  3N4P A;  3QBX A;  4FZZ A;  4HTU A;  5KRS A;  4BE1 A;  5M1N A;  5AQQ A;  4CJV A;  3L3V A;  1NWK A;  1W0H A;  3MXI A;  2ZE2 A;  3I8D A;  1IG8 A;  3K2P A;  4FWR A;  3LAL A;  1JLB A;  2FF3 B;  4DF8 A;  3AO5 A;  1HNZ K;  3WEE A;  2P5O A;  4KHU A;  4AHS A;  2P9N A;  4CJ4 A;  1J5O A;  1E3M A;  3OBW A;  5JMV A;  4CJQ A;  2GWJ A;  2P9U A;  4X64 K;  5AQY A;  2PZS A;  4PKI A;  1UWB A;  3R1X A;  3MEE A;  4H4O A;  4OLA A;  3K5M A;  3MK6 A;  1JCF A;  4FJL A;  3VQ9 A;  2P9I B;  2EHG A;  1KSP A;  4JI5 K;  3I8B A;  3U4L A;  1WSI A;  2BGG A;  1HRH A;  3VES A;  4CEZ A;  1ASU A;  4M45 A;  4EFH A;  4DQR A;  3TSU A;  1NK5 A;  3NFA A;  1YI2 N;  5D3G A;  1T6C A;  4CGG A;  4YOV A;  3M8R A;  3SZ2 A;  2KFN A;  3HM9 A;  1BQN A;  2VG5 A;  1NGJ A;  4BRK A;  3T1H K;  3KK3 A;  3SYZ A;  4QS7 A;  1EP4 A;  4CHQ A;  3TAN A;  4GKK K;  3QO9 A;  1QSS A;  1Z25 A;  2O8B B;  4K8Z A;  3RMC A;  4MDA A;  3GBT A;  4WE1 A;  4JEP A;  3WUH A;  3ZSZ A;  4B3T K;  4GY2 B;  2DY4 A;  3AO4 A;  4MLH A;  3DLB A;  1P8Z A;  4WFN L;  4CI6 A;  4FJ7 A;  4E1J A;  2QWP A;  3TAM A;  3E9L A;  4O5F A;  3UIQ A;  4H5V A;  1OH7 A;  4A2B A;  5CY4 A;  1X9S A;  1QQM A;  4RW4 A;  1C1B A;  1BU6 O;  4BRQ A;  4EHT A;  3J80 O;  1NOZ A;  1HPM A;  3E1Y A;  5FRO A;  3U3Y A;  2HHS A;  3CJ7 A;  5AQO A;  2O4G A;  3E9P A;  3O80 A;  4IEE A;  1CZA N;  2NNW A;  3CG7 A;  3NF9 A;  4B9V A;  3U9Z A;  5BRD A;  3AGR A;  5GAD P;  3S3N A;  3DM2 A;  3CJ1 A;  3B6P A;  4KV8 A;  4FWP A;  5AQK A;  4LF6 K;  3DLE A;  4F2S A;  3KK7 A;  5LJW A;  4CEQ A;  3CF5 L;  5AQV A;  2DTU A;  3C6H A;  1VSK A;  2GEL A;  4Z4G A;  1IBM K;  4J2A A;  1IBL K;  3D6R A;  4MFB A;  1VQ4 N;  3LP1 A;  4YDU A;  5J2Q A;  3ENO A;  3OYI A;  4RW8 A;  1JLA A;  1JXE A;  2YHA A;  4FVU A;  3DRR A;  3C0B A;  2BTF A;  4FM2 A;  5I3U A;  1NLV A;  3DLL L;  3D2E B;  3TU5 A;  3OYN A;  1TKT A;  1FK9 A;  2KKZ A;  3KD5 E;  1HJO A;  4PL8 A;  2CGK A;  1Z6R A;  3L0Q A;  4M3Z A;  3VOV A;  1S1X A;  4QS9 A;  3OYF A;  4CGJ A;  1ZBH A;  1YIT N;  1QZ5 A;  3GOI A;  2WUS A;  3DRP A;  3D0P A;  4B1V A;  3A5M C;  3G0Z A;  4DR1 K;  4Y1D A;  5AQJ A;  4JS4 A;  1NJW A;  2P9S A;  4FWO A;  3DXK B;  3MXJ A;  3BDP A;  4ID5 A;  5C15 A;  3K9J A;  3QEV A;  4WQ5 A;  4W5Q A;  1GLF O;  1EX4 A;  2HNY A;  1XNQ K;  1K73 O;  4OX9 K;  3QIP A;  5AQH A;  1J9A A;  5J2P A;  1S72 N;  4ELU A;  4CBW A;  3RRH A;  3VEZ A;  4WFB L;  4Y0W A;  3MMV A;  5FPN A;  4CJ3 A;  1XHZ A;  4KTZ A;  2Q1N A;  3J7Y P;  2E6M A;  2P1J A;  4CK2 A;  4FPB A;  3ZSR A;  4B8A B;  1VQM N;  2RE2 A;  2OTL N;  3WQU A;  4JKB A;  2Z1I A;  1KVC A;  3IG1 A;  3IMX A;  4FW1 A;  3V9W A;  4CHZ A;  4DS5 A;  5EXW A;  1HJR A;  4LF9 K;  2FC0 A;  4MLE A;  2UUA K;  3KVG A;  3KLH A;  4I2P A;  2YNH A;  3H1Q A;  4G1Q A;  3AVB A;  4GV9 A;  3FZM A;  4H8K A;  1KLM A;  4AM7 A;  1OKJ A;  4LF5 K;  1WUA A;  3LPT A;  3AVA A;  1T7P A;  3PSF A;  4E89 A;  2P9N B;  3HZ6 A;  4M3R A;  1XC9 A;  3CMA N;  4DTO A;  4FM1 A;  1NK8 A;  3SI6 A;  4IG0 A;  3VA3 A;  5CZ1 A;  2ASM A;  4JLH A;  1KAX A;  1QVF M;  3CCE N;  2KTQ A;  4YDU C;  2NRX A;  1DKG D;  4BG8 A;  1TUU A;  3VQ8 A;  2IC3 A;  4DFK A;  4WYB A;  5AQP A;  3CC2 N;  3QET A;  2ZWH A;  5IWA K;  4FJM A;  1EQY A;  3BEX A;  3ZLJ A;  4PY5 A;  2O8D B;  1T3V A;  3MN7 A;  2AJQ A;  2UUB K;  3K9K A;  4CJ5 A;  1U4B A;  3R8E A;  1VSM A;  2G8F A;  4KRF A;  2ZGZ A;  3NVK A;  1XQS C;  1S22 A;  4B9M A;  4DTX A;  2LSN A;  3H45 C;  2CGL A;  4JI4 K;  4Z4C A;  4EP5 A;  3BZC A;  4B3S K;  1C1A A;  1X9M A;  4X66 K;  1RBU A;  4M3X A;  4N56 A;  4HUG A;  2HHU A;  1H1V A;  3ZET B;  1SL2 A;  1ZBI A;  2RF2 A;  4H5R A;  4JKC A;  4BRI A;  1TAQ A;  2ITM A;  4FPA A;  2ETJ A;  3BP8 A;  4CHY A;  3CCV N;  5FRM A;  1A5X A;  4IFE A;  2BH1 A;  2NRH A;  3HI0 A;  5GAG P;  3O8M A;  2Z1H A;  5JS2 A;  3B8A X;  1JL2 A;  1S9E A;  3EY1 A;  4J2D A;  1U2V B;  2PY5 A;  2GX9 A;  4JHD B;  4H0X B;  3M8P A;  3L2V A;  3LL3 A;  4GNI A;  2ZM6 K;  5JVH L;  3RRG A;  5I42 A;  1T03 A;  4BWM A;  1C0M A;  3CPE A;  3LDS A;  3MX2 A;  1W97 L;  3C95 A;  1ASW A;  2FBV A;  4BY9 C;  3LM2 A;  4DFM A;  3SV3 A;  3PO4 A;  4F3T A;  1KVB A;  1Q8I A;  4JKA A;  4KHP K;  3WXL A;  3S3M A;  1HQU A;  4CEF A;  5LMU K;  3OYA A;  4B1Y B;  3SCX A;  3TTD A;  2XY8 A;  3SK3 A;  3J7Z O;  5C2F A;  1YJN N;  1RCH A;  1FJG K;  3LM9 A;  4DTP A;  3TPQ A;  3QLH A;  1A5V A;  4H4M A;  3AVL A;  3LAM A;  5LY3 A;  3OA9 A;  3AAP A;  2D4W A;  3TAG A;  3ZSV A;  4ZTF A;  3L2U A;  1VQ8 N;  4AF1 A;  3MWP A;  3TAP A;  2A3Z A;  5A2Q O;  2IVO A;  3VQB A;  3QNN A;  3CPW M;  4DTU A;  4PQU A;  1TV6 A;  3SQ0 A;  2QW9 A;  3L2R A;  3HL8 A;  5CR4 A;  2KZM A;  4JI2 K;  1U49 A;  3EZW A;  5KQ8 A;  2VWB A;  4ILH A;  3OYD A;  1M1K O;  3VN5 A;  1WBD A;  1QSY A;  3UKR B;  4M41 A;  3CER A;  4KBO A;  3OBY A;  3B6O A;  1RTI A;  2A6A A;  3QDK A;  4FJ9 A;  5BN9 A;  4B9Q A;  5E41 A;  4KHW A;  1S1W A;  2KHO A;  3PUF A;  3CM5 A;  1IKV A;  2YCH A;  3AA2 A;  4RCH A;  1CXU A;  3HVT A;  3RSE B;  4IJN A;  1RTD A;  2E8A A;  4DUY K;  3LDL A;  2ZJR L;  3ZX3 A;  1ILY A;  2WFB A;  4DFJ A;  1BOT O;  1N36 K;  5HLF A;  2NRW A;  2V52 B;  1IV0 A;  1J53 A;  1D9D A;  1W7A A;  2E1Y A;  2JWL A;  4ILJ A;  3BY5 A;  3LAN A;  1SS6 A;  4OKJ A;  2PAV A;  2FLO A;  4CF2 A;  1X3M A;  4GV3 A;  3NE6 A;  1RBT A;  4FJJ A;  1X1P A;  4KH5 A;  3CC4 N;  4IXC A;  1HKB A;  4AM6 A;  4BRE A;  4I9Q A;  4B1X B;  3L3U A;  3VQ5 A;  2O8C B;  3OTO K;  5KPT A;  2O4I A;  5AQN A;  4DF4 A;  1V4S A;  4B08 A;  5AFU A;  4FYD A;  4O0I A;  4PUO A;  1IKY A;  4KTQ A;  4DQI A;  3AVN A;  4JNE A;  5ADX H;  3VF2 A;  3EEQ A;  5AZJ B;  1ASV A;  4DV6 K;  4FO0 A;  1X9W A;  4FJI A;  3K0S A;  5AJ3 K;  2XY5 A;  4E1M A;  2AA4 A;  3HO1 A;  3A2F A;  1IBK K;  5LMN K;  2CGJ A;  4BDZ A;  4KH4 A;  2WON A;  4ISF A;  1UOC A;  4FLW A;  1M90 O;  3SUQ A;  4CJW A;  3CFP A;  1C6V A;  1TKZ A;  1U2V A;  4CEB A;  5EOY A;  3THV A;  3MAQ A;  1XC3 A;  4B8C A;  4A5A A;  4FL9 A;  1RGI A;  1T6D A;  3EO3 A;  4E7I A;  3VQQ A;  4IBN A;  1RDW X;  1Q86 O;  3AA4 A;  3CJ9 A;  4KKO A;  4CGD A;  4DU4 A;  1VSL A;  4CZG A;  4E7H A;  3VET A;  3VGM A;  3TSP A;  2FSN A;  3OHR A;  4WQ4 C;  3A5L C;  3O3H A;  4E7J A;  3TAB A;  2Z1G A;  1G99 A;  2B6A A;  4DTS A;  4M42 A;  3VEV A;  1NG9 A;  5DK5 A;  1I3A A;  1KVA A;  3JAM O;  1JCG A;  5J2N A;  4PL7 A;  3VF6 A;  4I9L A;  1RT1 A;  2J4R A;  3TTC A;  3DXK A;  5AQZ A;  3QIC A;  1BCM A;  4Z0U A;  3ZX0 A;  4J8F A;  1GLC G;  4HTL A;  2F7T A;  4IG3 A;  4TSX A;  4LFC K;  5K14 A;  4B9S A;  3HBT A;  4CJR A;  4DV7 K;  4DV2 K;  1N33 K;  4CZH A;  3OYC A;  1VQ9 N;  1RT6 A;  2F9W A;  2VGM A;  2YHW A;  3CFO A;  3LZI A;  2E5L K;  3IAY A;  3V9Z A;  4NLB A;  4NYN A;  4BE0 A;  2W41 A;  1E4G T;  1NM1 A;  4CW7 B;  1BI4 A;  2Q36 A;  3S3O A;  3H46 O;  1SQK A;  3NBP A;  4DR5 K;  4DV3 K;  4ELT A;  1KD1 O;  1OH8 A;  1RDD A;  4FK4 A;  3SQ1 A;  5KGX A;  4CF8 A;  4IDK A;  1W2B M;  3WXJ A;  1Q18 A;  3O3G A;  1S1V A;  3IUC A;  3MN5 A;  1NGF A;  1RDC A;  5HL7 L;  1TL3 A;  3NCI A;  3V1O A;  3QB0 A;  5AFU H;  1NK6 A;  4ZHR A;  2NRZ A;  5FLX O;  5M1K A;  1LWC A;  2GTD A;  4RTF D;  2PYL A;  2E2Q A;  1LAV A;  4I6M B;  1GLJ O;  2KLA A;  3I0S A;  2IS3 A;  4XH5 A;  1KLN A;  4U67 L;  2YNG A;  3O9R A;  1UAX A;  4OO1 J;  2HOE A;  2YHX A;  5C10 A;  2HST A;  3T1Y K;  1HYS A;  4M3W A;  1NK0 A;  5EY4 A;  3HOT A;  4DQ8 A;  1Q7Y O;  3VQ4 A;  4DR4 K;  3OS2 A;  3SLC A;  2Q31 A;  1WSF A;  1QQN A;  1ATS A;  3VER A;  2O8D A;  4CZF A;  3OW2 M;  3VQP A;  1KAY A;  2WBN A;  3HT3 A;  2G8W A;  1ZC6 A;  1B9D A;  3C7N B;  1NK4 A;  4BDP A;  2E88 A;  5BPL A;  2GWK A;  4XIU A;  3VQC A;  3V9X A;  3QFP A;  4BRF A;  3ENB A;  4FLX A;  3ZSO A;  5HP1 A;  2GV9 A;  5TKY A;  1VRU A;  1NJY A;  2X6N A;  4IFY A;  1TK5 A;  1L3S A;  1SKR A;  5JIC A;  1VK0 A;  1GLB G;  2UXC K;  2W42 A;  3TAQ A;  3NH1 A;  2P9K A;  4CZM A;  4DG1 A;  2QWQ A;  1JLG A;  4CJ7 A;  5C42 A;  3CJB A;  3SPY A;  2VQF K;  4WF9 L;  1BA0 A;  4Z4F A;  3E66 A;  2P5G A;  1BWF O;  3SQ2 A;  3CYM A;  2E20 A;  4B9N A;  3QBW A;  1O1W A;  3KLI A;  1YJW N;  3ZT4 A;  4BQL A;  3QES A;  1SUQ A;  4CFA A;  1G15 A;  1NGA A;  1S6P A;  4FM0 A;  1IJJ A;  3KZB A;  3UKU A;  3FZH A;  4IDH A;  5KTQ A;  4LSL A;  3AO2 A;  1VHX A;  3D45 A;  2OTJ N;  4CZI A;  5F0X A;  1X9J A;  3D7E O;  1RT2 A;  3O9T A;  1RDU A;  1RFQ A;  3OYG A;  3FLC O;  2VYP A;  4OGE A;  2HBL A;  5AQS A;  2D1K A;  4KI4 A;  2KQ2 A;  3ZCM A;  3Q7B A;  1EWR A;  3FFK B;  4CFD A;  2V51 B;  1IKX A;  2ATQ A;  3LP2 A;  4E3S A;  1J5E K;  3W3D A;  2O8B A;  1GLA G;  3CC7 N;  3FZK A;  4GKJ K;  1OVY A;  4Q5V A;  1L3T A;  1BDG A;  1RTH A;  4FW2 A;  4EIA A;  4M7Y A;  1EXQ A;  1K9M O;  3KWG A;  5EVZ A;  2NZT A;  1NGG A;  3OS1 A;  2UUC K;  2JGU A;  3ZT1 A;  3ZX2 A;  4BRP A;  2DFE A;  1HKC A;  1WLJ A;  2X78 A;  1RBS A;  2IAJ A;  1VSI A;  4DR3 K;  5CYQ A;  4FLT A;  5ADX A;  3KWI A;  2QWL A;  3FZL A;  3VPZ A;  3GG4 A;  1XUP O;  3H3O B;  3RWU A;  1QQC A;  1HNW K;  2P9P B;  1D8Y A;  1SZ2 A;  1U48 A;  4JI8 K;  4IZ9 A;  4W5R A;  4BWJ A;  3J8A A;  3ENH A;  4BRG A;  3MWT A;  4N5S A;  3AVF A;  4OLB A;  3LWL A;  3F2K A;  4BRN A;  1HQE A;  1BIU A;  1NJX A;  4YOR A;  3MEC A;  2YJF A;  4CEA A;  4CK3 A;  2O8F A;  4JI3 K;  3SAH A;  5HRS A;  2YHY A;  1BL3 A;  5AQU A;  4X62 K;  1D9F A;  2HBM A;  4BRO A;  5AZI B;  4WCE L;  1YTU A;  1HPZ A;  4NCB A;  2CH6 A;  3EYZ A;  1HLU A;  4YHH K;  3CIP A;  3VMF B;  1K8K B;  1EO1 A;  5HBM A;  3NGI A;  4JD2 B;  3ZSW A;  1KTQ A;  1NGI A;  3M6G A;  5E26 A;  1NKE A;  1BI4 B;  1LAW A;  4JI0 K;  2JWK A;  5AQR A;  1ATN A;  2DFF A;  2FXU A;  1VSH A;  2O8C A;  5SWM A;  3WNF A;  4KTW A;  1FW6 A;  1JLC A;  1FKP A;  3DAW A;  2CH5 A;  2W40 A;  2HVI A;  2FSK A;  4BGA A;  4FWM A;  4QS8 A;  3HPG A;  5KRT A;  5AZJ A;  4OPJ A;  1C1C A;  1MDU B;  3FGU A;  5BRH A;  3PY8 A;  5AR0 A;  1K6Y A;  3EKS A;  1TYQ A;  2ASP A;  3ZT2 A;  4DLG A;  4RWT A;  3GE1 A;  5AQW A;  5M1O A;  5KPZ A;  2BUP A;  2O8F B;  4GVE A;  3RR7 A;  4M63 C;  5FPM A;  3VQA A;  1WOQ A;  4QOZ B;  2HHW A;  1S5J A;  2KFZ A;  2D0C A;  1K8K A;  3CCM N;  1RT4 A;  1K8A O;  1RBV A;  3C6A A;  3IS9 A;  1NNE A;  1T8E A;  3AV9 A;  3HVR A;  4CJL A;  4CZK A;  3DI6 A;  2GBZ A;  3O5B A;  4I7F A;  1BA1 A;  3OVN A;  3WXM B;  3SNN A;  4DR7 K;  1ZBS A;  4CJT A;  2YNI A;  3MN9 A;  4OPK A;  3ULD A;  3SJH A;  3HPO A;  3K5O A;  4FJN A;  3T69 A;  2F4V K;  1NMD A;  3RMB A;  1SKW A;  1HX1 A;  3QEP A;  2A1R A;  4E1N A;  2ZJP L;  4LF4 K;  3A5O C;  4IJA A;  2DPN A;  4CFB A;  4H0O A;  2QKB A;  1NGE A;  3THY A;  3DLK A;  1YAG A;  1ZBU A;  3QEX A;  2F9T A;  3SUN A;  3ZT3 A;  1RDA A;  3PIO L;  2P9L B;  3KKS A;  3SBT A;  4WQ4 A;  4AIL C;  4DS4 A;  3V4I A;  4C8N A;  3RMD A;  1OH5 A;  1L5U A;  4CJF A;  3V1Q A;  3KK1 A;  4C8K A;  3CCU N;  3L4Q A;  4OKE A;  1KXP A;  4C1N I;  3FZF A;  4K42 A;  4IOA L;  4LFA K;  3NGY A;  4CEE A;  3LDO A;  4CJS A;  1YTA A;  3SAG A;  4O5B A;  5E84 A;  1NBW A;  4C8M A;  4FVM A;  3PX6 A;  3L2W A;  4BRC A;  3UE5 A;  3AVJ A;  4K43 A;  1BHL A;  3LZJ A;  2E6L A;  2HMP A;  2XY6 A;  2V7Y A;  2P9P A;  4V19 S;  1BIZ A;  4K8X A;  4GW6 A;  1MWM A;  4B9L A;  1R59 O;  1C0G A;  3M8Q A;  3WEE B;  4DHY A;  3RR8 A;  4DUZ K;  5C12 A;  2G8V A;  1HNI A;  2ZQB A;  3DLR A;  4O8K A;  3ALY A;  3DRS A;  3MXM A;  3NHG A;  1Q82 O;  2HMI A;  2I5J A;  4OGC A;  5T7B A;  5AZI A;  2E4L A;  3MCP A;  4JKG A;  1S1U A;  1YVN A;  1I94 K;  4NCA A;  3ZEU B;  4K0K K;  5JLH A;  3AO3 A;  3CCS N;  3MED A;  4IWV A;  4NO7 A;  3M3Z A;  3G10 A;  5AQX A;  2YNF A;  4O44 A;  2B5J A;  5C24 A;  1Q9X A;  3L6Q A;  2XRI A;  2HNZ A;  1VRT A;  3DOL A;  4DU1 A;  4MQ3 A;  1VQP N;  3CCL N;  1DEJ A;  2NLX A;  5FPD A;  2QM1 A;  5FPE A;  5BRE A;  1REV A;  3CXC M;  2UU9 K;  2HHH K;  2IVN A;  3CCR N;  4KAZ A;  4E19 A;  3SAF A;  1BCO A;  5AQI A;  4CJK A;  4H0Y B;  4DFP A;  3TAR A;  3J81 O;  3HRG A;  3O4Q A;  5CE3 A;  3K58 A;  2VGN A;  1NOY A;  4FJH A;  1JKH A;  4DLE A;  4C1N K;  4R79 A;  4BRL A;  3G6E N;  4FLV A;  2F96 A;  1WB9 A;  2OZS A;  2IDO A;  4CBU A;  4JK7 A;  1Y97 A;  4ZTJ A;  3J7A P;  2YI1 A;  4BDY A;  3CCJ N;  3OYJ A;  2D0P A;  3FE1 A;  3TR8 A;  3HST B;  4FWQ A;  3OYB A;  4LF7 K;  4A62 A;  1IO2 A;  1VSJ A;  1GLD G;  2FBT A;  5M1P A;  1VQ7 N;  1P90 A;  3SJJ A;  4U7B A;  3O4W A;  3VTH A;  3R9P A;  2V7Z A;  1OVQ A;  3OYH A;  4CGH A;  3K5L A;  3NH2 A;  4O8U A;  1XMO K;  4GV6 A;  5MLC Q;  1X3N A;  3IKM A;  4NB4 A;  5AQT A;  2E2O A;  3ULE B;  1FKO A;  1TK8 A;  4PA1 A;  1T05 A;  2Q3S A;  4CIG A;  1ITG A;  1HKG A;  3NF6 A;  3O9U A;  1A5W A;  3OY9 A;  5KGW A;  3O9Q A;  2P9U B;  3AAR A;  3NVM A;  1N5Y A;  2VCP A;  4OVL A;  4BR5 A;  2P9L A;  2FF6 A;  1I39 A;  4L8R B;  1CZ9 A;  3AVH A;  3SQ4 A;  3ID6 A;  4IO8 A;  2Q0U A;  3A0I X;  2A40 A;  4PKH A;  5JLF A;  4HVJ A;  2P9I A;  3AA3 A;  2OPS A;  4W5O A;  1B92 A;  4CGF A;  1IG9 A;  4M7X A;  3ITH A;  3T19 A;  3BUZ B;  3S41 A;  3KLF A;  3EL2 A;  3OJS A;  4EHU A;  2OA8 A;  4JKH A;  4O55 A;  3F73 A;  1TGO A;  2NRT A;  2UYT A;  4OPA A;  1JL1 A;  2QWO A;  3MCA B;  1WN7 A;  1YVU A;  1QTM A;  4KPY A;  2QTD A;  4G9Z A;  1SL0 A;  3QNO A;  4H0V B;  1EET A;  2XY7 A;  4X65 K;  2QXF A;  3VQ6 A;  4A57 A;  1MU2 A;  3OYK A;  4FLZ A;  1VQ6 N;  4JKE A;  1U6Z A;  2DFH A;  3ULE A;  5EU7 A;  4KI6 A;  3AA5 X;  2YJE A;  4Z94 A;  3V6D A;  1S3X A;  2D0O A;  2PFU A;  3M8S A;  1B9F A;  4DU3 A;  3KHY A;  2HHV A;  5BRF A;  4JI6 K;  1NJI O;  3D2F A;  1O13 A;  4M3T A;  4CJP A;  3OJU A;  4QCL A;  4JKF A;  1GOA A;  4ISG A;  4FJG A;  3SV4 A;  1QQO A;  3ISN C;  5I9E B;  3BF1 A;  3I55 N;  4KB1 A;  4JRQ A;  3UKU B;  4A2A A;  3EZ5 A;  1FXX A;  4DQP A;  3U8X A;  3WNH A;  4CVN E;  3AY9 A;  2Z1J A;  4R5P A;  5AQM A;  3U3G A;  4LH4 A;  4BR0 A;  4OJR A;  5B8H A;  1JLQ A;  4FK0 A;  4B3R K;  4YOX A;  3P39 A;  1RNH A;  1SAZ A;  2NUB A;  4FWN A;  1Z26 A;  4RG8 A;  4IOC L;  4BC4 A;  3MN6 A;  3VGL A;  3AAQ A;  3I33 A;  3WQT A;  2FBY A;  2YKM A;  3SPZ A;  4KHY A;  2VG6 A;  4AHV A;  3U6F A;  3OYE A;  2RHK A;  3ASM A;  1TAU A;  4DSF A;  4ISE A;  3H3N O;  3T7Z A;  4NXM K;  3M5R A;  4CES A;  3DMJ A;  1HNV A;  4EZ6 A;  5DMR A;  1NU0 A;  3FR0 A;  5HRO A;  2BDP A;  3NH0 A;  4FZX C;  3HSC A;  2WC9 A;  4CJE A;  1VSF A;  2HB5 A;  4BR4 A;  4CIE A;  4Q0B A;  4IOX A;  3VQ7 A;  2KW4 A;  3L8B A;  5EX5 A;  1CLQ A;  3THW A;  2VQE K;  4CE9 A;  1YIJ N;  1WAJ A;  3CJC A;  4CZJ A;  4DR6 K;  4FK2 A;  3CME N;  3OS0 A;  4JK9 A;  4BAC A;  1XI1 A;  1KCF A;  3Q7C A;  4UQG A;  1QE1 A;  4NCG A;  2BE2 A;  3JS6 A;  3CHW A;  4FLU A;  3VQE A;  4B1U B;  1U47 A;  3HK2 A;  3BGR A;  3ZET A;  1TUY A;  2YX6 A;  1C0U A;  2QXL A;  1LW0 A;  3G25 A;  4BC3 A;  2X74 A;  5H1S Q;  3BZK A;  4CD3 A;  5J2M A;  3NDK A;  1ZYQ A;  4KHN A;  3DJC A;  4KFB A;  2QWN A;  3HOS A;  1L3U A;  3H6E A;  1TKD A;  4BRH A;  4DSJ A;  4OPH A;  4JHD A;  2A5X A;  4CD1 A;  4FWK A;  1WNS A;  5KQD A;  3ZSX A;  3ZT0 A;  3VF4 A;  3W0L A;  4PWD A;  1WSG A;  3KTQ A;  3NF7 A;  1BUP A;  3AVG A;  3HP9 A;  4C8O A;  4NYF A;  2Y1J A;  2NRR A;  4AHT A;  3N4Q A;  5GAE P;  2BAN A;  2HVH A;  2FSJ A;  4E7L A;  4CF1 A;  1LWF A;  1NGC A;  4AHC A;  1QHA A;  2ASO A;  3VEX A;  4DKW A;  4F9O A;  3MDQ A;  4KHS A;  4FOE A;  3UKR A;  4HUE A;  4IKF A;  4W5T A;  1JXB A;  3S9H A;  4DCH A;  4DTR A;  4EZ9 A;  2QEX N;  1S1T A;  1HYZ A;  3QIO A;  2IIR A;  4BQZ A;  2QWR A;  4AHR A;  1XMQ K;  1DGK N;  2YHB A;  4Z4I A;  3JSM A;  4QAG A;  3ZSQ A;  3RSE A;  4LFB K;  5AQF A;  1WSJ A;  3TI0 A;  1YJ9 N;  1Q81 O;  3RMA A;  4DWI A;  3VEN A;  1R0A A;  4J2B A;  3IRX A;  3P38 A;  3AVM A;  1D5A A;  1S9G A;  1MWK A;  4CGI A;  3TAE A;  2GUP A;  4HWI A;  2G8I A;  4WQ5 C;  1DT9 A;  4CCH A;  4JKG B;  4FOI A;  4BC5 A;  3ZEU A;  3K5N A;  3D2F B;  4BR9 A;  2GEM A;  3QFU A;  1LV5 A;  3CD6 N;  4LD0 A;  3HJF A;  3D2E A;  3JYT A;  5TKW A;  4J2E A;  2IVP A;  5HRR A;  3K59 A;  2QWM A;  1QS4 A;  1N34 K;  2XHB A;  2A41 A;  4DQQ A;  3RTV A;  2XO7 A;  3ZSY A;  5KPR A;  4CF0 A;  3JXU A;  4IFV A;  3QEI A;  4YOY A;  4BGB A;  5M1F A;  1HUX A;  2HBJ A;  1MA9 B;  5GIO A;  4N41 A;  3ATU A;  2D0A A;  5CZ2 A;  2Y1I A;  1LCU A;  4BG9 A;  5JVG L;  3HYF A;  2OZM A;  2I7N A;  4E0D A;  3OYM A;  1CXQ A;  4UY8 O;  3THY B;  5JS1 A;  3LDP A;  4XH4 A;  2EX3 A;  3H08 A;  4I6M A;  3NF8 A;  3THX A;  1U04 A;  1RT5 A;  4ICL A;  4LY7 A;  4H0P A;  4DTN A;  2W6K A;  3V9S A;  2O8E B;  1BO5 O;  4EP4 A;  3SUP A;  1QZ6 A;  3CQ8 A;  3KIO A;  5AQG A;  1NGH A;  3C6U A;  2Q0R A;  4CJU A;  4BE2 A;  4JYA K;  1YXQ A;  4O0J A;  1HNX K;  4YY3 K;  4BR2 A;  4YOU A;  4YOT A;  2GUI A;  4H0T B;  5BR8 K;  1KAZ A;  2D0B A;  1GOC A;  4C23 A;  3C65 A;  3VQD A;  1NKC A;  2G8K A;  4DV1 K;  1NGD A;  3KJV A;  3T1A A;  4MDB A;  2YKN A;  3AO1 A;  3KKR A;  3P83 D;  1SV5 A;  3P31 A;  3MX5 A;  4E7K A;  1T44 A;  4AQY K;  2ZJQ L;  3PLA A;  3QIN A;  5HOO A;  5KI6 A;  4KHQ A;  4FJ8 A;  3M1F A;  1WAF A;  2VG7 A;  3P5J A;  1KQS M;  2E2P A;  4BR7 A;  1XNR K;  1RT7 A;  4CHP A;  5F1X A;  4JV5 K;  3I0R A;  1VQO N;  4B9U A;  2O8E A;  3BF3 A;  4F2R A;  2E2N A;  4L3Q A;  1J6Z A;  4DSL A;  3L4I A;  1SL1 A;  4JK8 A;  1LOT B;  2PBD A;  4B1W B;  2Q97 A;  4N76 A;  4JKD A;  3O3F A;  3DXM B;  1OH6 A;  2A1S A;  4LC9 B;  1YT3 A;  2HBK A;  1Z05 A;  3SUO A;  4FXD A;  3EE9 A;  3DYA A;  1NK9 A;  4JN4 A;  1BIS A;  1VAZ A;  1J54 A;  1UA0 A;  1JJ2 M;  3ZYY X;  5FDL A;  3P4I A;  3PIP L;  3E9O A;  5M1Q A;  1N32 K;  3TTF A;  3C94 A;  4DR2 K;  2HF4 A;  4H5T A;  4DB3 A;  3V81 A;  1NKB A;  1RBR A;  4YNQ A;  3CJA A;  3LP0 A; 
#chains in the Genus database with same CATH homology
 4DV6 K;  4NXN K;  1IBM K;  1IBL K;  5AJ3 K;  1J5E K;  4CVN E;  4X64 K;  4V19 S;  1IBK K;  4GKJ K;  5LMN K;  4B3R K;  5A2Q O;  5FLX O;  4JYA K;  1XMO K;  4JI5 K;  1HNX K;  4YY3 K;  4DUZ K;  1XMQ K;  2UUC K;  5BR8 K;  5IT9 O;  4JI2 K;  5IWA K;  4LFB K;  4DV1 K;  3T1Y K;  2UUB K;  4NXM K;  4DR3 K;  4DR4 K;  3T1H K;  4AQY K;  1I94 K;  4JI4 K;  4GKK K;  4K0K K;  4B3S K;  1HNW K;  4X66 K;  2UXD K;  4DR7 K;  4DR1 K;  2VQE K;  4JI8 K;  4DUY K;  4B3T K;  4DV4 K;  4DR6 K;  1XNR K;  3JAM O;  1N36 K;  4JV5 K;  4LF5 K;  1HR0 K;  4LF8 K;  2F4V K;  2UU9 K;  1XNQ K;  2UXC K;  2HHH K;  1N34 K;  4OX9 K;  4LF4 K;  2UXB K;  3J80 O;  4DV0 K;  4LFC K;  3J81 O;  4X65 K;  4JI3 K;  4X62 K;  2ZM6 K;  4DV7 K;  4DV2 K;  5LL6 Z;  2VQF K;  1N33 K;  3J7Y P;  4DV5 K;  2E5L K;  4JI1 K;  4YHH K;  4CW7 B;  3OTO K;  4B3M K;  4LF9 K;  4KHP K;  2UUA K;  3J7A P;  4JI6 K;  4JI0 K;  4LF6 K;  5LMU K;  1N32 K;  4DR5 K;  4DV3 K;  4DR2 K;  4LFA K;  4JI7 K;  1HNZ K;  4LF7 K;  1FJG K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...