4YHHK

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tigecycline
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
115
structure length
115
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Structural characterization of an alternative mode of tigecycline binding to the bacterial ribosome.
pubmed doi rcsb
total genus 26
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4yhhK00
4DR2K 1IBLK 4LFBK 1XMOK 1HNZK 3J80O 4X66K 4B3MK 4KHPK 4DR6K 4DR3K 4DV0K 4K0KK 4LF8K 4LF5K 1I94K 4B3SK 4JI7K 4DR1K 4JI4K 4CW7B 3JAMO 1HR0K 4DUZK 1FJGK 5IWAK 3J7YP 4B3TK 4LFCK 5IT9O 4JI6K 2E5LK 4OX9K 4JI5K 4JI8K 3OTOK 3T1HK 4CVNE 4DV5K 4GKJK 5BR8K 4DV7K 4JI3K 4YY3K 2F4VK 1N36K 1IBMK 4YHHK 4X65K 5AJ3K 4DR5K 4DV4K 5LMUK 4JYAK 2HHHK 4X62K 1XNQK 4JI2K 3T1YK 4NXMK 4X64K 4NXNK 4DUYK 5FLXO 2UU9K 4LF6K 5LMNK 5LL6Z 4JI1K 1IBKK 1J5EK 4LF9K 4DV6K 3J7AP 4LF4K 2VQFK 4V19S 2UXBK 5A2QO 4LFAK 2UUCK 1HNXK 2VQEK 1N33K 2UXDK 4JV5K 4LF7K 4DR7K 3J81O 4DV2K 4AQYK 4GKKK 2UUAK 4JI0K 2ZM6K 2UXCK 4DV1K 1XMQK 4DR4K 4DV3K 1N32K 1XNRK 1HNWK 1N34K 4B3RK 2UUBK
chains in the Genus database with same CATH superfamily
3O9UA 3TU5A 2EWSA 1RGIA 5EY4A 1QE1A 4DLEA 4W5RA 4KHPK 3FLCO 2QI2A 4BDPA 4DR3K 1RNHA 4DU1A 3AVNA 3LP3A 4ISEA 4N41A 2VYPA 4DSKA 2ASOA 1E3MA 3KTQA 4M3ZA 3AVKA 5C2FA 1KVBA 3OYCA 2O4IA 3D0PA 4JS5A 3AO3A 4U67L 1MWKA 3C95A 1JLGA 4FJ8A 3M1FA 4M7XA 4BG8A 1V4SA 1RT1A 3I8BA 1YVNA 4AHSA 4DTMA 1ZYQA 4DG1A 1K8AO 1WBDA 2DTUA 2QXLA 2GTDA 4BRGA 3E01A 2RE2A 5J2MA 3TTFA 3CM5A 2BH1A 2QWMA 3IRXA 3RR7A 4BGAA 3O9TA 2FF3B 3E1YA 3QFUA 4E89A 1IO2A 3M8PA 4AHTA 3AY9A 4OPHA 3HT3A 4LF6K 1JJ2M 1LWEA 5HP1A 2A40A 4O5FA 4WQ4C 1N5YA 2OZSA 3J7AP 2NRVA 2Y1JA 2V51B 1TK5A 5AQYA 4IXCA 5DM6L 3OJUA 5AZIA 4CI6A 1MWMA 2I7PA 2FBTA 5KPTA 3CCSN 2OTJN 2ZGZA 3RSEB 2PAVA 1K73O 1Z6RA 3Q7CA 3VA0A 3OYBA 3I56N 1HJRA 3OYGA 3I8DA 3PX0A 1GLCG 1SKSA 4BRDA 1YHQN 3C7NA 4BR2A 5KGXA 3SJHA 4BE2A 4BQLA 2IS3A 1WSFA 1T05A 4GW6A 4BVPA 4ISGA 3VMFB 2UUBK 4MDAA 5CY4A 3V1OA 1ITGA 4K0KK 5JVGL 2QEXN 4JI7K 1JL1A 1VQON 2HNYA 5TKWA 3IFRA 3QICA 5LY3A 4BR7A 3NH1A 1GLEG 3V6DA 2QWNA 3J7YP 3CJ7A 3QEIA 3MCAB 2VGMA 3LAKA 3KK3A 4B3TK 3FZLA 4YOWA 3TTDA 4ICLA 2ZE2A 5BPMA 1NGJA 3EE9A 1N6QA 4CHOA 2GX9A 4KKOA 3T1HK 4JHDA 1NGGA 3QNOA 4OKEA 4NLBA 1KQSM 3RRGA 4M3TA 2R7YA 2VG5A 3HM9A 4X65K 3T1AA 1ATSA 5ADXA 4WF9L 1BCOA 4BRHA 2O8EB 4BC3A 2D5RA 1X1PA 3V9WA 3SBTA 4CF0A 5CE3A 4HHTA 4JHDB 4J8FA 4KHWA 2P9NB 1NOZA 2GELA 2OPSA 4KI6A 1D4XA 4FJHA 3S3OA 4K8XA 2PZSA 2UU9K 3B6OA 4YOTA 3OW2M 3WXKA 3DXKB 4H0XB 4JKBA 2A41A 2I7NA 4KV8A 3IAYA 2W6KA 4Z0UA 4LF9K 5E84A 2P5OA 3UB5A 3EKUA 1S6QA 3OJSA 3HXMA 5JVHL 3OYIA 2IOCA 3F5TA 3MDQA 3KLGA 2QKBA 3PSIA 3MCPA 4FWMA 3TAFA 3VEVA 2YNFA 3B6PA 3V81A 5J2NA 4CBWA 2HHVA 1VRUA 3DLEA 3H45C 3NCIA 4DHYA 5EU7A 2A1RA 3L4IA 3NVMA 1GLBG 4ILGB 5DMRA 5CR4A 1QSYA 4LSLA 3TAQA 3NF8A 3NGYA 5FPEA 3C6AA 1EP4A 5KI6A 1IBLK 4IEEA 4LFBK 3DMJA 3TAGA 3QIOA 3CCQN 4M3WA 4B1XB 4R5PA 1KXPA 2BANA 5KQ8A 3HP6A 3VF2A 4FWSA 3CI5A 1JCEA 2WONA 1WNSA 1HKGA 4DUZK 4B9MA 4IWVA 2JWLA 2YHWA 1RDWX 3C6UA 5IT9O 4CECA 3KLHA 4ILJA 2AJQA 4DFPA 2QW9A 1S1WA 2P9PA 2KKZA 3CCJN 4O5BA 3SMSA 2HBLA 1RDDA 4JI8K 4DV5K 1JLEA 1R0AA 4CGHA 3SCXA 1UWBA 1IBMK 3ATVA 3OS1A 1T8EA 1RT4A 1EETA 1IV0A 4J2BA 1X3MA 1ZBUA 5AQOA 4DV4K 5LMUK 1WN7A 3THWB 5AQFA 2O8FA 4YNQA 5AZJB 4DS4A 4FJKA 4OLBA 3O6WA 1W9HA 1OH8A 3GDQA 2P9LA 4FZZA 2ITGA 1OKJA 4ID1A 4MO5A 3D2EB 3HVTA 4WFAL 1WSJA 5CZ1A 1D9DA 1BIUA 3TABA 4CGGA 1L3TA 3KHYA 3TSUA 4FK0A 3DLLL 4YDUC 4I2QA 2P9SA 4B08A 3NFAA 3PIOL 1WB9A 3NMUA 4DR7K 2HSTA 3H1QA 4CK2A 4FLTA 1RTHA 2KFNA 4ELUA 5JS1A 3WQTA 4M3XA 2JLEA 4HWIA 1TVRA 4FJIA 3ASMA 3AO1A 4CEOA 2HF4A 3MN6A 4CJ7A 3MXIA 1TYQA 2Q1NA 4GVMA 4KH5A 3GBTA 4JK8A 4BR0A 4FWPA 3O4NA 3U9ZA 3BP8A 3QBXA 2O8CA 3LP2A 5AFUA 4I6MA 1W0HA 5BPLA 5AQKA 1W97L 2V52B 1T7PA 3U4LA 3HP9A 3QO9A 1ZBLA 1YTUA 4B3MK 1JCGA 3HRGA 5C25A 1FXXA 3BUZB 1ZBHA 5GAHP 3C6HA 4FJXA 2VWBA 3L2VA 1RTJA 2F9TA 4LY7A 1TKZA 4JI4K 3L4QA 3BZCA 4BQZA 4CW7B 3CCMN 2HF3A 3E9LA 1KD1O 4KO0A 4BWMA 1CXQA 4RW7A 1XC3A 1VQMN 2P9KA 1VSDA 5F2RA 1VSMA 2QA4N 3VF6A 1C0TA 3BY5A 2X6SA 4JKHA 2HHUA 2W42A 2D0CA 4HVJA 4C1NK 4CJWA 3OYEA 2E5LK 4IDHA 3RTVA 2Y1IA 3WXLA 4DMNA 4CCHA 4CVNE 3AGRA 3VQPA 1BWFO 4KTZA 4BG9A 3L2QA 4CHPA 3QIPA 1NK9A 4A5AA 4KHSA 5AJ3K 4BE0A 4LSNA 3HBTA 1VSLA 4FL9A 1QHAA 2HHQA 2V7YA 2E6MA 2WUSA 1ASVA 4AM6A 1JLFA 4CEEA 3L2WA 4DUYK 2WC9A 5JS2A 1QQNA 4KAZA 5AQQA 3VEXA 2Q36A 2BE2A 3RMBA 2UYTA 4FM1A 4F2RA 4DSEA 1DLOA 1HPZA 2A6AA 4DTUA 3C94A 4FWOA 5HOOA 5FPDA 1EO1A 3ENBA 3IUCA 1JCFA 1BQMA 2I5JA 3ZSRA 3MMVA 1QVFM 3VQ8A 5HROA 3MWPA 3M8SA 3MN5A 3DJCA 3L2RA 4JRQA 4DS5A 1VAZA 3TR8A 5KPRA 4CBUA 2YHBA 4PKGA 4IOCL 4RG8A 4DTNA 3U9DA 3VQ5A 1NJXA 3ZCMA 2NRTA 4BRKA 3FZHA 3OVNA 1HQUA 2VWKA 3KK2A 1Q8IA 1U49A 4CZIA 3CHWA 5EOYA 1RBTA 1N34K 2HHSA 4X66K 2YNGA 4Q0BA 1VSJA 4CF1A 4GV9A 5BR9A 4LF5K 2PBDA 4B3SK 1NK7A 1BI4A 2Q31A 3KD1E 1G99A 4KHUA 4F8RA 3G25A 3HVRA 5SZTA 3BGRA 1QQMA 3V9XA 4IFYA 1SKWA 2Q2RA 4JKGB 4KPYA 1BL3A 5BREA 4B1WB 3HK2A 2ASPA 2ZJQL 2IDOA 1RFQA 2F8TA 2E2QA 4EFHA 3SUQA 3GE1A 5AQUA 1T6DA 3NAEA 2HVIA 5AQHA 1A5WA 3KLFA 3ZSWA 4JI3K 4ZTFA 3DLRA 1C1AA 3CCLN 1FK9A 4MQ3A 4CHNA 3WXJA 2E1YA 2RPIA 2P9UA 1K8KB 3TWHA 1VHXA 2JGUA 4I7FA 1KC8O 2NLXA 4DQ8A 3VF4A 1TKTA 1S9EA 3DI6A 4LH5A 3EN9A 3A5MC 5AR0A 1VQ8N 3PO4A 5FLXO 1EXQA 4IJNA 3W3DA 4BRAA 1NJIO 5LL6Z 1D8YA 2O8BA 4JI1K 3O4QA 1UA0A 4FCYA 1VQKN 1E4GT 3OS0A 1YF5L 4B9UA 2UXBK 4KTWA 1CLQA 4PY5A 4E7LA 2WBNA 3A5OC 4LF7K 5AQWA 3HPHA 3J81O 4AQYK 4GV6A 4FPBA 1F21A 3AVBA 5M1PA 2XRIA 2HBKA 4BC2A 4PA1A 3O8MA 3P5JA 4FWLA 4BRMA 4JN4A 4E7IA 2F9WA 3QINA 3H3NO 4DR4K 3BF1A 4LH4A 1YIJN 4EP5A 4W5QA 4BGBA 4UQGA 5M1NA 5J2QA 1NLVA 2BGGA 1NK8A 3PIPL 4CJTA 5KQDA 4Z94A 1BO5O 1EX4A 3M3ZA 3PUFA 5E41A 3KK1A 3OHRA 3ZSVA 1C0MA 2ZQBA 4OLAA 2F7TA 4LF8K 3OY9A 3PX4A 3FFIA 1WBBA 5AQVA 3ZEUB 4CZJA 4B9NA 2W41A 3QNNA 3CCUN 2E2OA 4XH4A 4M3UA 3FZMA 1LWFA 2PYLA 5AQRA 3V4IA 3MEEA 3VQ4A 4FJJA 3O3GA 4BY9C 4KB1A 2VCPA 1KCFA 2XY7A 1WLJA 1WUAA 3O1BA 3C6TA 4JI6K 4FZYA 3MXJA 3AVMA 5CYMA 1W2BM 4JI5K 4GY2B 4GKJK 4CIEA 4HCCA 1O1WA 4Y0WA 4U7BA 4PHTX 4FVUA 3AVLA 2OTLN 2DFEA 1CZBA 4E1MA 2QWRA 4H4MA 1REVA 3AA4A 3ULDA 5JLHA 3ZT3A 5I3UA 4K43A 4N56A 1Q9XA 1NOYA 4O55A 4E0DA 1RBRA 4CGDA 1XUPO 3CYMA 4GVEA 5GINA 4EAHD 3OYDA 1QS4A 1VQNN 3LDQA 3E9PA 1C0GA 3ISNC 2E2PA 1SAZA 4KFBA 5EVZA 4BDZA 3TARA 4DV6K 4NCGA 4CZMA 1NGAA 2GWKA 3LZIA 3K5NA 4MLHA 3DRPA 3K0SA 2YX6A 4RCHA 4CEQA 2KLAA 1Q9YA 3UIQA 4KHNA 4OGCA 1X9SA 4JKAA 3A5LC 3CJ9A 4E7JA 4G9ZA 1EQYA 3SQ2A 3ZSYA 2Q0RA 3SBGA 3AVHA 4FXDA 4WQ5C 5AFUH 3VESA 5HL7L 1U48A 3RSEA 1BHLA 4QS9A 3W0LA 1J54A 4DU4A 3CFPA 3C65A 4W5TA 4A2AA 4YOYA 2FBXA 1E4FT 2X6NA 1U2VB 4EHTA 5AQXA 3DOKA 3HSCA 1TKXA 3K2PA 2P9IB 2ITMA 4DR6K 4YOXA 1NKCA 4DV0K 4Z4FA 1FKOA 4CEAA 4JD2B 1LCUA 1X9WA 4DTJA 5C0YA 2QTDA 3DLHA 3RVCA 2E2NA 2IVNA 4BROA 1ATRA 3QLHA 1RBVA 2Z1HA 1VQ6N 3JSMA 2ATQA 1QQCA 3F2KA 1KAXA 1BIZA 4AF1A 4GV3A 3ENOA 5F1XA 1B9FA 1RDUA 1FKPA 3LWLA 4M3YA 2F4VK 4CFAA 4W5OA 4KHQA 2OPQA 3VEOA 1NU0A 5M1KA 3H6EA 4HUGA 2B6AA 4F3OA 4DTSA 1NBWA 4DFJA 2D4WA 4EP4A 3CMEN 3EO3A 2O8EA 3WNEA 4DQPA 4H5NA 2DPNA 1RDCA 3JS6A 5C42A 3RMDA 2P9NA 5KTQA 4HTLA 4BR5A 1WOQA 4FK4A 4FPAA 3QEXA 3NF9A 4F3TA 1J5EK 3T19A 2BUPA 3L3UA 1YT3A 2CGJA 4IG3A 2Z1GA 5A2QO 3DXKA 1HNXK 5C10A 4WQ4A 2YNIA 3AO4A 2UXDK 3LDNA 1SQKA 5DM7L 3MX5A 1OVYA 3VN5A 4BRPA 2WOMA 3VETA 2QWPA 4O0JA 2OA8A 2E6LA 3V1RA 4PKHA 1HYSA 1JXBA 4OPJA 4CIFA 4CD1A 2PYJA 1K6YA 1RDBA 4IOAL 1B92A 4DV1K 1I39A 3KKSA 1S22A 3V9ZA 1DKGD 1KLNA 1NGFA 1XNRK 2D1KA 1P90A 1HNWK 1KAYA 4CERA 4J2AA 3ZX3A 1IKXA 1XMOK 1LW0A 3VTIA 1HNZK 5KRTA 1C1CA 3I55N 3MAQA 3DLKA 4CZFA 1TK8A 5MLCQ 1KRPA 1S1UA 3H46O 5GIOA 4CJ4A 3OYMA 3M5RA 1NMNA 4FWQA 3FFKB 1NM1A 4RWTA 3CJBA 3AVIA 4CJ3A 5BRHA 3MECA 1NJZA 1YAGA 3CETA 3S9HA 4AM7A 2LSNA 4DSLA 4KRFA 4JS4A 4JNEA 4KTQA 4DFMA 1B9DA 2ZJPL 4BRNA 3CIPA 5BR8K 5M1FA 3P39A 3K58A 1BA0A 4CF9A 3GOIA 3QEWA 3KWGA 4XH1A 3I33A 4KREA 1NGHA 3VGKA 3SAGA 4OPKA 1C0UA 4ID5A 1U4BA 2FSKA 2OANA 3A5NC 4CFBA 1NK4A 4CEBA 4MFBA 4NXMK 3A0IX 3SAHA 4DFKA 1VQLN 3MXMA 3THWA 1EWRA 5AQNA 2NZTA 3RR8A 4A59A 2G8IA 3NHGA 5AZJA 1IBKK 1Z05A 3CCVN 4FLVA 4O4GA 2FXUA 4WFBL 1NGIA 1M1KO 3TPQA 5FRNA 4BDYA 3K9KA 2ASMA 3D2EA 1SL1A 2E88A 4WYBA 4AHCA 4XH5A 4JV5K 3TAEA 2NRRA 2G8HA 1BQNA 2A42A 1HNVA 3LM9A 4BVOA 3P38A 2ZWHA 5I42A 3VA3A 5AQMA 1Y97A 3IKMA 2UUAK 2O8DB 5FPMA 2IGIA 4H5TA 1TL3A 2D0PA 2O4GA 4QOZB 4CD3A 4CZHA 4KB0A 2V7ZA 4E3SA 3SPYA 1SL0A 4DQIA 3NH0A 1N32K 3TTCA 4CJ5A 1JLCA 4YORA 3VQ9A 1NGCA 5K14A 1YTAA 5KPZA 4CJRA 3ZT1A 4B9LA 1NKBA 1G15A 4CJPA 4B8AB 2CH5A 3WXIA 1VSEA 1IH7A 2XY8A 3HI0A 2RHKA 4KI4A 5AQIA 3UKUB 4DLGA 4IZ9A 3DLGA 4AHVA 2YHAA 4CEFA 5IWAK 4B1YB 1NKEA 4BRCA 3SQ0A 2GV9A 2G8VA 4N5SA 3CERA 4M7YA 3DXMB 3AVJA 4FYDA 4RW6A 4OX9K 1S1VA 3U3GA 3IMXA 4BWJA 1WSEA 4WE1A 1U04A 1GOBA 1EWQA 4A2BA 2G8WA 1QVGM 4OO1J 5B8HA 1N36K 4K25A 2HHWA 4YHHK 4BR9A 2NRXA 2RF2A 3ZETB 3H1VX 3ID6A 1YUWA 1X3NA 3CPWM 2HB5A 2ZJRL 4B9SA 3H3OB 3P31A 3NGIA 3DAWA 3AO2A 1VQ7N 2AA4A 1DTTA 1VSHA 4N47A 2X78A 3CG7A 3LP1A 4JKDA 4YFUA 4DQQA 4LF4K 3CC7N 3ZSXA 3KLIA 3M8QA 1NGDA 4LFAK 2B4JA 2VGNA 3P83D 4F4KA 1ESVA 4L3QA 1RTDA 1KSPA 3HZ6A 4PUOA 1UAXA 1ZXOA 3HJFA 1QTMA 3CXCM 2P1JA 3CJCA 2Z1JA 1P8ZA 4M42A 4BRLA 3U6FA 4CE9A 4CZGA 1LV5A 3LALA 1GOAA 5BRFA 4FW1A 4CK3A 3RRHA 3DRRA 4DSFA 4EZ6A 4CEZA 5GADP 3A8YA 4FWRA 5C15A 4B1UB 4IO9L 4H8KA 3GG4A 2QKKA 1D5AA 3ENHA 1KVAA 2YCHA 1HKCA 3R6MA 5M1OA 1NJYA 1TAQA 3F9KA 4Z4EA 1W7AA 1NK5A 3TSQA 3O3FA 4QS8A 4Z4CA 4F2SA 2XY5A 3KLEA 1C1BA 4H0PA 1WSIA 5ELZA 3D2FB 3FE1A 3O1WA 5GAEP 4CF8A 4CGIA 3LWMA 1RTIA 1T6CA 4NLCA 2ETJA 4BC4A 4B9TA 4JKGA 2HOEA 3OBYA 3QEPA 3WUHA 4M41A 4MO4A 3A2FA 4FZXC 3C0BA 3V1QA 1SZ2A 1WAFA 3LP0A 4JYAK 2QWLA 3ZT0A 1L3VA 2FC0A 1ZBFA 3WNHA 1K8KA 1VQ9N 1LAVA 4EZ9A 4NXNK 3MEGA 1NK6A 4J2EA 4PL8A 3KVGA 2CH6A 3MX2A 3THYB 3SZ2A 3QBWA 4RW9A 3J7ZO 4IDKA 4DQRA 1WAJA 4IJAA 4H5WA 4FLZA 4V19S 4R79A 4CFDA 2B5JA 4AHUA 1NJWA 3SUOA 4YOVA 1Y64A 4WFNL 4NCAA 1KFSA 4PL7A 4DTXA 3R3LA 3FZKA 4FJLA 3KJVA 1IG9A 3V9SA 3UKRB 4CGFA 4JEPA 3BZKA 4DV3K 2F8SA 1JLAA 1YVUA 3KIOA 3KKRA 5HRSA 2KTQA 2A3ZA 3E9OA 2PFUA 2KHOA 3CPEA 2J4RA 3R1XA 1VSFA 4RTFD 3CF5L 1L3SA 1IKVA 1OVQA 3LPTA 4JLHA 4K8ZA 1HNIA 4LD0A 1L5UA 2DY4A 1KLMA 1RBUA 4IKFA 3ZEUA 3SYZA 5CHIA 1BA1A 4H03B 3ZT2A 3L0QA 3OA9A 4CIGA 3OYKA 4C23A 4I9LA 3EZ5A 5HBMA 4OPAA 2F96A 3L8BA 1S1XA 2P51A 4CJUA 2XY6A 3OYLA 4Z4HA 3M8RA 1DEJA 2HHHK 1XNQK 1JLQA 2YV0X 3G10A 4DTPA 1LW2A 1U6ZA 1YJWN 1JKHA 1CXUA 3AAQA 3G71N 1YJ9N 3LAMA 1XHZA 2Q0UA 2WTUA 1HJOA 4CHYA 3HOSA 1LOTB 5J2PA 5FDLA 3HM8A 1J53A 1N33K 3ZSOA 3PLAA 3DWLA 3EZWA 1Q81O 4DV2K 4IBNA 2HNDA 4CJLA 4JK7A 3QMLA 4CJVA 5KGWA 1HKBA 4BACA 4I2PA 3SNNA 4DQSA 5FPNA 4JI0K 1QQOA 4A57A 2HMPA 3I0SA 5AQGA 3ULEB 4H5RA 1X9JA 4OKKA 3NGZA 1NK0A 4CEDA 1VK0A 3TI0A 1TUUA 3K59A 2JWKA 4E19A 1ZBSA 4CGJA 1TV6A 3WNFA 4QCLA 4AH9A 3G6EN 1UA1A 3ZX0A 1U2VA 1RT7A 3JXUA 3MK6A 3WNGA 1Q86O 4CHQA 1HMVA 3LANA 2E8AA 2P9IA 3TAMA 3QEVA 4M63C 3EE8A 1Q7YO 1GLFO 4JD2A 1FJGK 1S5JA 2H3GX 3AO5A 4L8RB 5GAGP 2G8FA 3T3FA 3FGUA 2QM1A 2NRWA 1J6ZA 4K41A 3SV4A 3N4PA 2NRZA 3O08A 4FM2A 1A5VA 3S41A 2A5XA 4YY3K 3AAPA 3AA5X 3HOTA 3CQ8A 3VGMA 3AGKA 2QK9A 4CBXA 4PQUA 4X62K 3WEEA 2CGKA 3SLCA 1S1TA 4C8OA 5AQSA 3ZSQA 4X64K 4IO8A 3NBPA 2WFBA 4FJ9A 3O3HA 4FLXA 5AZIB 1BCMA 3WEEB 4IEIA 3VQQA 2FSNA 2W6LA 3VOVA 4FLYA 1TL1A 4DTRA 2HNZA 5CYQA 5BN8A 2QWOA 1JXEA 3DLBA 2IAJA 3UE5A 4IG0A 1GOCA 1OH5A 1ATNA 3IG1A 1J5OA 1BOTO 3C7NB 4Q5VA 1LWCA 2ZM6K 2EX3A 1VRTA 2UXCK 2AP1A 3P1GA 3SMPA 3R8EA 4M3RA 2HHXA 3Q7BA 4GMJB 4E7KA 4WQ5A 2YI1A 5H1SQ 2VWJA 3NF7A 3SQ4A 4B9VA 4GNIA 4B3RK 3N4QA 2D0BA 1HUXA 4O8KA 4CJEA 1HRHA 4JKFA 2QWQA 1BG3A 5BN9A 3O9SA 5HRNA 4BC5A 4C8NA 4K42A 2BTFA 3AVAA 3TANA 4CJFA 2YJEA 2HVHA 3JAMO 1HR0K 1BU6O 1TKDA 3WT0A 1M90O 1BISA 2HBMA 3CC2N 3AA2A 1IKYA 4FWNA 4HUFA 4N76A 1HPMA 3NH2A 4LFCK 1Q18A 3LZJA 4DSIA 3SV3A 1C0FA 2VG7A 1L3UA 3CFRA 3FZFA 3CM6A 3AV9A 3FR0A 1HX1A 1ZC6A 4O8UA 2YHYA 1V4TA 5AQLA 3MN9A 3OTOK 4HUEA 4CZKA 3VQ6A 3NE6A 4WCEL 5HRRA 5C2DA 4XIUA 5FROA 4H0OA 5EX5A 4FJ7A 5AQZA 4DCHA 4CESA 4UY8O 4B8CA 4DR5K 3MWTA 4ILHA 4HCBA 4FSVA 1GLDG 1R59O 5KRSA 3SUNA 3O5BA 4AILC 2IIRA 3T1YK 1NGEA 2YHXA 3LDLA 3LM2A 3OYFA 3U8XA 1QSLA 2GUPA 3ZLJA 1DTQA 2W40A 3M6GA 2E1ZA 3KZBA 4DB3A 4FM0A 3RMCA 5HRPA 1IG8A 4CHZA 3VENA 1GLLO 2OPPA 4OGEA 3I0RA 3ZYYX 3EY1A 3OYNA 3G0ZA 3F73A 4JRPA 2FBYA 3PX6A 2D0OA 3HYFA 4QS7A 4JK9A 2BDPA 1BGXT 1I3AA 2KW4A 1J9AA 2RN2A 3U3YA 4FW2A 3DOLA 4BREA 4KH6A 2HHTA 4CFCA 1LAWA 3CC4N 3O9QA 2VG6A 3LDSA 2O8DA 5DK5A 4CF2A 4FOIA 3VQBA 3QERA 2Z1IA 4LC9B 3VGLA 4DR2K 5D3GA 4DU3A 1QHTA 2XO7A 3BDPA 4CZEA 4FOEA 1RT6A 3K5OA 4FWKA 3ATUA 3DM2A 5AQJA 4E7HA 4M45A 2P9PB 4ZHRA 1SL2A 1NNEA 5FRMA 4BE1A 1QZ6A 5TKYA 1NGBA 3UKUA 3BEXA 2HMIA 4H5VA 1C6VA 1KVCA 2YKNA 2ZD1A 2YNHA 3SUPA 3E66A 2DFHA 3GL1A 2DFFA 3RWUA 3DXMA 3QESA 4DV7K 1ZBIA 5BRDA 2O8FB 3THVA 2QXFA 3T7ZA 1JLBA 1HYZA 2NUBA 1YJNN 2P9LB 2E20A 4H0VB 3JYTA 3SJJA 4NO7A 3ZETA 1XC9A 4IFVA 3VQDA 3WQUA 4RW8A 2KZMA 4JKEA 3S3NA 1S6PA 4I9QA 3CMAN 4ELVA 2P9SB 3SI6A 3O9RA 4HTUA 5JICA 2VQFK 4CZLA 3CQYA 3VPZA 2UUCK 2G8KA 4NYFA 3PY8A 3EL2A 1QSSA 3LDOA 2GBZA 4CJQA 3PV8A 1U47A 1VQ5N 2ZGYA 3LDPA 3PSFA 1T03A 1TYQB 3D6RA 1U45A 1TUYA 4JKCA 1CZ9A 4H0TB 2O8CB 1Z26A 4I6MB 1VQPN 3K9JA 4F9OA 3HTVA 1S9GA 3HO1A 5GIPA 4Z4IA 4FVMA 1DGKN 4KHYA 4IOXA 4YDUA 5JMVA 1OH6A 1RBSA 3IDHA 3K57A 4JAXA 5LJVA 5LJWA 3S3MA 3CD6N 2XHBA 3O80A 4O0IA 2P9KB 4NCBA 1XQSC 5E26A 2GWJA 4EHUA 4FJ5A 3HL8A 2CGLA 1WSHA 5M1QA 1TAUA 3AARA 3L2UA 3AVGA 4DF8A 1X9MA 3OYHA 1YITN 3SPZA 3VQEA 1MA9B 4ISFA 1KAZA 3CFOA 5C12A 4NYNA 5I9EB 4B1VA 3QFPA 3TSPA 3VQCA 1T3VA 4YOUA 3H08A 3OBWA 1KFDA 2YKMA 4DSJA 4AHRA 1SS6A 3D7EO 1K9MO 3D2FA 2Q97A 3B8AX 3O4WA 3J8AA 1GLAG 1HQEA 5F0XA 1S72N 1YXQA 4DKWA 4W5NA 4FLWA 4O44A 3K5MA 1FW6A 4ZTJA 2GUIA 2HBJA 4CJSA 3OS2A 1KTQA 3QETA 5EXWA 5SWMA 2HW3A 4C1NI 3HSTB 5LMNK 1D9FA 3LL3A 4B9QA 3VTHA 1Z25A 4E1NA 1HYVA 1OH7A 4DF4A 1BUPA 4ELTA 4EIAA 4CK1A 1XHXA 4G1QA 3THYA 1NG9A 4MLEA 5CZ2A 1RT3A 2VQEK 4PKIA 1ASWA 1TGOA 3QB0A 3D45A 3NVKA 4TSXA 1QZ5A 3LPUA 4Z4GA 3F9MA 4GKKK 3AVCA 4BRQA 2FSJA 4DWIA 5C24A 4CJKA 4RW4A 3R9PA 3CJAA 1GLJO 4H4OA 2IVPA 2X74A 2FBVA 2YJFA 5AQTA 4DTOA 1SUQA 2Q3SA 1BDGA 4FO0A 2KZZA 4A62A 5J1EA 3VERA 3UKRA 2E4LA 1RILA 3EYZA 3MEDA 3HPGA 1HLUA 5HLFA 1A5XA 1ASUA 1BI4B 4Y1CA 3J80O 1VSIA 2GEMA 2RKIA 3G4SN 4H0YB 5ADXH 1I94K 4DR1K 1TK0A 4FK2A 4A61A 3ITHA 1T44A 3P4IA 5JLFA 2D0AA 1WSGA 2EHGA 3MN7A 1YI2N 1ILYA 4B1ZA 4KH4A 4C8MA 1UOCA 3DRSA 3VQAA 2NNWA 3AVFA 3ZX2A 2OZMA 1RDAA 3KD5E 3EKSA 3ALYA 4MDBA 5AQPA 2G8UA 1IJJA 2P9UB 3EEQA 2IC3A 3NDKA 3SQ1A 3KK7A 4OVLA 3T69A 3ZT4A 1N8RO 4OKJA 3SAFA 3VEWA 1RCHA 4FJMA 4BRFA 3CCRN 2PY5A 4XEIA 1DT9A 4FLUA 2KFZA 3THXA 1MU2A 3KWIA 4JI2K 1VQ4N 3OYAA 2O8BB 4BR4A 3IS9A 1H1VA 3QDKA 3ZSZA 3OYJA 4FJNA 2OCEA 4E1JA 2OYQA 4FJGA 2NRHA 3SK3A 3VEZA 3THXB 1CZAN 3CCEN 5BPNA 4PWDA 4BRIA 3TAPA 2IVOA 1Q82O 4KBOA 2FF6A 3PO5A 2A1SA 1XWLA 4IFEA 4OJRA 3WXMB 3RMAA 1XI1A 1SKRA 1NMDA 1S3XA 2ZF5O 1JL2A 4C8KA 4QAGA 1O13A 4J2DA 3L6QA 3AA3A 5T7BA 4A5BA 4B3OA 3VQ7A 1EKEA 1SV5A 4NB4A 3V9UA 3VEYA 2FLOA 3NF6A 3ID8A 1XMQK 2OPRA 4C8LA 1MDUB 1NWKA 1IKWA 1RT5A 3BF3A 3CJ1A 3DYAA 4Y1DA 1VSKA 3K5LA 3HPOA 3CQXA 2KQ2A 3L3VA 2P5GA 1RT2A 3ULEA
chains in the Genus database with same CATH topology
4DR2K 1IBLK 4LFBK 1XMOK 1HNZK 3J80O 4X66K 4B3MK 4KHPK 4DR6K 4DR3K 4DV0K 4K0KK 4LF8K 4LF5K 1I94K 4B3SK 4JI7K 4DR1K 4JI4K 4CW7B 3JAMO 1HR0K 4DUZK 1FJGK 5IWAK 3J7YP 4B3TK 4LFCK 5IT9O 4JI6K 2E5LK 4OX9K 4JI5K 4JI8K 3OTOK 3T1HK 4CVNE 4DV5K 4GKJK 5BR8K 4DV7K 4JI3K 4YY3K 2F4VK 1N36K 1IBMK 4YHHK 4X65K 5AJ3K 4DR5K 4DV4K 5LMUK 4JYAK 2HHHK 4X62K 1XNQK 4JI2K 3T1YK 4NXMK 4X64K 4NXNK 4DUYK 5FLXO 2UU9K 4LF6K 5LMNK 5LL6Z 4JI1K 1IBKK 1J5EK 4LF9K 4DV6K 3J7AP 4LF4K 2VQFK 4V19S 2UXBK 5A2QO 4LFAK 2UUCK 1HNXK 2VQEK 1N33K 2UXDK 4JV5K 4LF7K 4DR7K 3J81O 4DV2K 4AQYK 4GKKK 2UUAK 4JI0K 2ZM6K 2UXCK 4DV1K 1XMQK 4DR4K 4DV3K 1N32K 1XNRK 1HNWK 1N34K 4B3RK 2UUBK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR2 K;  1IBL K;  4LFB K;  1XMO K;  1HNZ K;  3J80 O;  4X66 K;  4B3M K;  4KHP K;  4DR6 K;  4DR3 K;  4DV0 K;  4K0K K;  4LF8 K;  4LF5 K;  1I94 K;  4B3S K;  4JI7 K;  4DR1 K;  4JI4 K;  4CW7 B;  3JAM O;  1HR0 K;  4DUZ K;  1FJG K;  5IWA K;  3J7Y P;  4B3T K;  4LFC K;  5IT9 O;  4JI6 K;  2E5L K;  4OX9 K;  4JI5 K;  4JI8 K;  3OTO K;  3T1H K;  4CVN E;  4DV5 K;  4GKJ K;  5BR8 K;  4DV7 K;  4JI3 K;  4YY3 K;  2F4V K;  1N36 K;  1IBM K;  4YHH K;  4X65 K;  5AJ3 K;  4DR5 K;  4DV4 K;  5LMU K;  4JYA K;  2HHH K;  4X62 K;  1XNQ K;  4JI2 K;  3T1Y K;  4NXM K;  4X64 K;  4NXN K;  4DUY K;  5FLX O;  2UU9 K;  4LF6 K;  5LMN K;  5LL6 Z;  4JI1 K;  1IBK K;  1J5E K;  4LF9 K;  4DV6 K;  3J7A P;  4LF4 K;  2VQF K;  4V19 S;  2UXB K;  5A2Q O;  4LFA K;  2UUC K;  1HNX K;  2VQE K;  1N33 K;  2UXD K;  4JV5 K;  4LF7 K;  4DR7 K;  3J81 O;  4DV2 K;  4AQY K;  4GKK K;  2UUA K;  4JI0 K;  2ZM6 K;  2UXC K;  4DV1 K;  1XMQ K;  4DR4 K;  4DV3 K;  1N32 K;  1XNR K;  1HNW K;  1N34 K;  4B3R K;  2UUB K; 
#chains in the Genus database with same CATH topology
 3O9U A;  3TU5 A;  2EWS A;  1RGI A;  5EY4 A;  1QE1 A;  4DLE A;  4W5R A;  4KHP K;  3FLC O;  2QI2 A;  4BDP A;  4DR3 K;  1RNH A;  4DU1 A;  3AVN A;  3LP3 A;  4ISE A;  4N41 A;  2VYP A;  4DSK A;  2ASO A;  1E3M A;  3KTQ A;  4M3Z A;  3AVK A;  5C2F A;  1KVB A;  3OYC A;  2O4I A;  3D0P A;  4JS5 A;  3AO3 A;  4U67 L;  1MWK A;  3C95 A;  1JLG A;  4FJ8 A;  3M1F A;  4M7X A;  4BG8 A;  1V4S A;  1RT1 A;  3I8B A;  1YVN A;  4AHS A;  4DTM A;  1ZYQ A;  4DG1 A;  1K8A O;  1WBD A;  2DTU A;  2QXL A;  2GTD A;  4BRG A;  3E01 A;  2RE2 A;  5J2M A;  3TTF A;  3CM5 A;  2BH1 A;  2QWM A;  3IRX A;  3RR7 A;  4BGA A;  3O9T A;  2FF3 B;  3E1Y A;  3QFU A;  4E89 A;  1IO2 A;  3M8P A;  4AHT A;  3AY9 A;  4OPH A;  3HT3 A;  4LF6 K;  1JJ2 M;  1LWE A;  5HP1 A;  2A40 A;  4O5F A;  4WQ4 C;  1N5Y A;  2OZS A;  3J7A P;  2NRV A;  2Y1J A;  2V51 B;  1TK5 A;  5AQY A;  4IXC A;  5DM6 L;  3OJU A;  5AZI A;  4CI6 A;  1MWM A;  2I7P A;  2FBT A;  5KPT A;  3CCS N;  2OTJ N;  2ZGZ A;  3RSE B;  2PAV A;  1K73 O;  1Z6R A;  3Q7C A;  3VA0 A;  3OYB A;  3I56 N;  1HJR A;  3OYG A;  3I8D A;  3PX0 A;  1GLC G;  1SKS A;  4BRD A;  1YHQ N;  3C7N A;  4BR2 A;  5KGX A;  3SJH A;  4BE2 A;  4BQL A;  2IS3 A;  1WSF A;  1T05 A;  4GW6 A;  4BVP A;  4ISG A;  3VMF B;  2UUB K;  4MDA A;  5CY4 A;  3V1O A;  1ITG A;  4K0K K;  5JVG L;  2QEX N;  4JI7 K;  1JL1 A;  1VQO N;  2HNY A;  5TKW A;  3IFR A;  3QIC A;  5LY3 A;  4BR7 A;  3NH1 A;  1GLE G;  3V6D A;  2QWN A;  3J7Y P;  3CJ7 A;  3QEI A;  3MCA B;  2VGM A;  3LAK A;  3KK3 A;  4B3T K;  3FZL A;  4YOW A;  3TTD A;  4ICL A;  2ZE2 A;  5BPM A;  1NGJ A;  3EE9 A;  1N6Q A;  4CHO A;  2GX9 A;  4KKO A;  3T1H K;  4JHD A;  1NGG A;  3QNO A;  4OKE A;  4NLB A;  1KQS M;  3RRG A;  4M3T A;  2R7Y A;  2VG5 A;  3HM9 A;  4X65 K;  3T1A A;  1ATS A;  5ADX A;  4WF9 L;  1BCO A;  4BRH A;  2O8E B;  4BC3 A;  2D5R A;  1X1P A;  3V9W A;  3SBT A;  4CF0 A;  5CE3 A;  4HHT A;  4JHD B;  4J8F A;  4KHW A;  2P9N B;  1NOZ A;  2GEL A;  2OPS A;  4KI6 A;  1D4X A;  4FJH A;  3S3O A;  4K8X A;  2PZS A;  2UU9 K;  3B6O A;  4YOT A;  3OW2 M;  3WXK A;  3DXK B;  4H0X B;  4JKB A;  2A41 A;  2I7N A;  4KV8 A;  3IAY A;  2W6K A;  4Z0U A;  4LF9 K;  5E84 A;  2P5O A;  3UB5 A;  3EKU A;  1S6Q A;  3OJS A;  3HXM A;  5JVH L;  3OYI A;  2IOC A;  3F5T A;  3MDQ A;  3KLG A;  2QKB A;  3PSI A;  3MCP A;  4FWM A;  3TAF A;  3VEV A;  2YNF A;  3B6P A;  3V81 A;  5J2N A;  4CBW A;  2HHV A;  1VRU A;  3DLE A;  3H45 C;  3NCI A;  4DHY A;  5EU7 A;  2A1R A;  3L4I A;  3NVM A;  1GLB G;  4ILG B;  5DMR A;  5CR4 A;  1QSY A;  4LSL A;  3TAQ A;  3NF8 A;  3NGY A;  5FPE A;  3C6A A;  1EP4 A;  5KI6 A;  1IBL K;  4IEE A;  4LFB K;  3DMJ A;  3TAG A;  3QIO A;  3CCQ N;  4M3W A;  4B1X B;  4R5P A;  1KXP A;  2BAN A;  5KQ8 A;  3HP6 A;  3VF2 A;  4FWS A;  3CI5 A;  1JCE A;  2WON A;  1WNS A;  1HKG A;  4DUZ K;  4B9M A;  4IWV A;  2JWL A;  2YHW A;  1RDW X;  3C6U A;  5IT9 O;  4CEC A;  3KLH A;  4ILJ A;  2AJQ A;  4DFP A;  2QW9 A;  1S1W A;  2P9P A;  2KKZ A;  3CCJ N;  4O5B A;  3SMS A;  2HBL A;  1RDD A;  4JI8 K;  4DV5 K;  1JLE A;  1R0A A;  4CGH A;  3SCX A;  1UWB A;  1IBM K;  3ATV A;  3OS1 A;  1T8E A;  1RT4 A;  1EET A;  1IV0 A;  4J2B A;  1X3M A;  1ZBU A;  5AQO A;  4DV4 K;  5LMU K;  1WN7 A;  3THW B;  5AQF A;  2O8F A;  4YNQ A;  5AZJ B;  4DS4 A;  4FJK A;  4OLB A;  3O6W A;  1W9H A;  1OH8 A;  3GDQ A;  2P9L A;  4FZZ A;  2ITG A;  1OKJ A;  4ID1 A;  4MO5 A;  3D2E B;  3HVT A;  4WFA L;  1WSJ A;  5CZ1 A;  1D9D A;  1BIU A;  3TAB A;  4CGG A;  1L3T A;  3KHY A;  3TSU A;  4FK0 A;  3DLL L;  4YDU C;  4I2Q A;  2P9S A;  4B08 A;  3NFA A;  3PIO L;  1WB9 A;  3NMU A;  4DR7 K;  2HST A;  3H1Q A;  4CK2 A;  4FLT A;  1RTH A;  2KFN A;  4ELU A;  5JS1 A;  3WQT A;  4M3X A;  2JLE A;  4HWI A;  1TVR A;  4FJI A;  3ASM A;  3AO1 A;  4CEO A;  2HF4 A;  3MN6 A;  4CJ7 A;  3MXI A;  1TYQ A;  2Q1N A;  4GVM A;  4KH5 A;  3GBT A;  4JK8 A;  4BR0 A;  4FWP A;  3O4N A;  3U9Z A;  3BP8 A;  3QBX A;  2O8C A;  3LP2 A;  5AFU A;  4I6M A;  1W0H A;  5BPL A;  5AQK A;  1W97 L;  2V52 B;  1T7P A;  3U4L A;  3HP9 A;  3QO9 A;  1ZBL A;  1YTU A;  4B3M K;  1JCG A;  3HRG A;  5C25 A;  1FXX A;  3BUZ B;  1ZBH A;  5GAH P;  3C6H A;  4FJX A;  2VWB A;  3L2V A;  1RTJ A;  2F9T A;  4LY7 A;  1TKZ A;  4JI4 K;  3L4Q A;  3BZC A;  4BQZ A;  4CW7 B;  3CCM N;  2HF3 A;  3E9L A;  1KD1 O;  4KO0 A;  4BWM A;  1CXQ A;  4RW7 A;  1XC3 A;  1VQM N;  2P9K A;  1VSD A;  5F2R A;  1VSM A;  2QA4 N;  3VF6 A;  1C0T A;  3BY5 A;  2X6S A;  4JKH A;  2HHU A;  2W42 A;  2D0C A;  4HVJ A;  4C1N K;  4CJW A;  3OYE A;  2E5L K;  4IDH A;  3RTV A;  2Y1I A;  3WXL A;  4DMN A;  4CCH A;  4CVN E;  3AGR A;  3VQP A;  1BWF O;  4KTZ A;  4BG9 A;  3L2Q A;  4CHP A;  3QIP A;  1NK9 A;  4A5A A;  4KHS A;  5AJ3 K;  4BE0 A;  4LSN A;  3HBT A;  1VSL A;  4FL9 A;  1QHA A;  2HHQ A;  2V7Y A;  2E6M A;  2WUS A;  1ASV A;  4AM6 A;  1JLF A;  4CEE A;  3L2W A;  4DUY K;  2WC9 A;  5JS2 A;  1QQN A;  4KAZ A;  5AQQ A;  3VEX A;  2Q36 A;  2BE2 A;  3RMB A;  2UYT A;  4FM1 A;  4F2R A;  4DSE A;  1DLO A;  1HPZ A;  2A6A A;  4DTU A;  3C94 A;  4FWO A;  5HOO A;  5FPD A;  1EO1 A;  3ENB A;  3IUC A;  1JCF A;  1BQM A;  2I5J A;  3ZSR A;  3MMV A;  1QVF M;  3VQ8 A;  5HRO A;  3MWP A;  3M8S A;  3MN5 A;  3DJC A;  3L2R A;  4JRQ A;  4DS5 A;  1VAZ A;  3TR8 A;  5KPR A;  4CBU A;  2YHB A;  4PKG A;  4IOC L;  4RG8 A;  4DTN A;  3U9D A;  3VQ5 A;  1NJX A;  3ZCM A;  2NRT A;  4BRK A;  3FZH A;  3OVN A;  1HQU A;  2VWK A;  3KK2 A;  1Q8I A;  1U49 A;  4CZI A;  3CHW A;  5EOY A;  1RBT A;  1N34 K;  2HHS A;  4X66 K;  2YNG A;  4Q0B A;  1VSJ A;  4CF1 A;  4GV9 A;  5BR9 A;  4LF5 K;  2PBD A;  4B3S K;  1NK7 A;  1BI4 A;  2Q31 A;  3KD1 E;  1G99 A;  4KHU A;  4F8R A;  3G25 A;  3HVR A;  5SZT A;  3BGR A;  1QQM A;  3V9X A;  4IFY A;  1SKW A;  2Q2R A;  4JKG B;  4KPY A;  1BL3 A;  5BRE A;  4B1W B;  3HK2 A;  2ASP A;  2ZJQ L;  2IDO A;  1RFQ A;  2F8T A;  2E2Q A;  4EFH A;  3SUQ A;  3GE1 A;  5AQU A;  1T6D A;  3NAE A;  2HVI A;  5AQH A;  1A5W A;  3KLF A;  3ZSW A;  4JI3 K;  4ZTF A;  3DLR A;  1C1A A;  3CCL N;  1FK9 A;  4MQ3 A;  4CHN A;  3WXJ A;  2E1Y A;  2RPI A;  2P9U A;  1K8K B;  3TWH A;  1VHX A;  2JGU A;  4I7F A;  1KC8 O;  2NLX A;  4DQ8 A;  3VF4 A;  1TKT A;  1S9E A;  3DI6 A;  4LH5 A;  3EN9 A;  3A5M C;  5AR0 A;  1VQ8 N;  3PO4 A;  5FLX O;  1EXQ A;  4IJN A;  3W3D A;  4BRA A;  1NJI O;  5LL6 Z;  1D8Y A;  2O8B A;  4JI1 K;  3O4Q A;  1UA0 A;  4FCY A;  1VQK N;  1E4G T;  3OS0 A;  1YF5 L;  4B9U A;  2UXB K;  4KTW A;  1CLQ A;  4PY5 A;  4E7L A;  2WBN A;  3A5O C;  4LF7 K;  5AQW A;  3HPH A;  3J81 O;  4AQY K;  4GV6 A;  4FPB A;  1F21 A;  3AVB A;  5M1P A;  2XRI A;  2HBK A;  4BC2 A;  4PA1 A;  3O8M A;  3P5J A;  4FWL A;  4BRM A;  4JN4 A;  4E7I A;  2F9W A;  3QIN A;  3H3N O;  4DR4 K;  3BF1 A;  4LH4 A;  1YIJ N;  4EP5 A;  4W5Q A;  4BGB A;  4UQG A;  5M1N A;  5J2Q A;  1NLV A;  2BGG A;  1NK8 A;  3PIP L;  4CJT A;  5KQD A;  4Z94 A;  1BO5 O;  1EX4 A;  3M3Z A;  3PUF A;  5E41 A;  3KK1 A;  3OHR A;  3ZSV A;  1C0M A;  2ZQB A;  4OLA A;  2F7T A;  4LF8 K;  3OY9 A;  3PX4 A;  3FFI A;  1WBB A;  5AQV A;  3ZEU B;  4CZJ A;  4B9N A;  2W41 A;  3QNN A;  3CCU N;  2E2O A;  4XH4 A;  4M3U A;  3FZM A;  1LWF A;  2PYL A;  5AQR A;  3V4I A;  3MEE A;  3VQ4 A;  4FJJ A;  3O3G A;  4BY9 C;  4KB1 A;  2VCP A;  1KCF A;  2XY7 A;  1WLJ A;  1WUA A;  3O1B A;  3C6T A;  4JI6 K;  4FZY A;  3MXJ A;  3AVM A;  5CYM A;  1W2B M;  4JI5 K;  4GY2 B;  4GKJ K;  4CIE A;  4HCC A;  1O1W A;  4Y0W A;  4U7B A;  4PHT X;  4FVU A;  3AVL A;  2OTL N;  2DFE A;  1CZB A;  4E1M A;  2QWR A;  4H4M A;  1REV A;  3AA4 A;  3ULD A;  5JLH A;  3ZT3 A;  5I3U A;  4K43 A;  4N56 A;  1Q9X A;  1NOY A;  4O55 A;  4E0D A;  1RBR A;  4CGD A;  1XUP O;  3CYM A;  4GVE A;  5GIN A;  4EAH D;  3OYD A;  1QS4 A;  1VQN N;  3LDQ A;  3E9P A;  1C0G A;  3ISN C;  2E2P A;  1SAZ A;  4KFB A;  5EVZ A;  4BDZ A;  3TAR A;  4DV6 K;  4NCG A;  4CZM A;  1NGA A;  2GWK A;  3LZI A;  3K5N A;  4MLH A;  3DRP A;  3K0S A;  2YX6 A;  4RCH A;  4CEQ A;  2KLA A;  1Q9Y A;  3UIQ A;  4KHN A;  4OGC A;  1X9S A;  4JKA A;  3A5L C;  3CJ9 A;  4E7J A;  4G9Z A;  1EQY A;  3SQ2 A;  3ZSY A;  2Q0R A;  3SBG A;  3AVH A;  4FXD A;  4WQ5 C;  5AFU H;  3VES A;  5HL7 L;  1U48 A;  3RSE A;  1BHL A;  4QS9 A;  3W0L A;  1J54 A;  4DU4 A;  3CFP A;  3C65 A;  4W5T A;  4A2A A;  4YOY A;  2FBX A;  1E4F T;  2X6N A;  1U2V B;  4EHT A;  5AQX A;  3DOK A;  3HSC A;  1TKX A;  3K2P A;  2P9I B;  2ITM A;  4DR6 K;  4YOX A;  1NKC A;  4DV0 K;  4Z4F A;  1FKO A;  4CEA A;  4JD2 B;  1LCU A;  1X9W A;  4DTJ A;  5C0Y A;  2QTD A;  3DLH A;  3RVC A;  2E2N A;  2IVN A;  4BRO A;  1ATR A;  3QLH A;  1RBV A;  2Z1H A;  1VQ6 N;  3JSM A;  2ATQ A;  1QQC A;  3F2K A;  1KAX A;  1BIZ A;  4AF1 A;  4GV3 A;  3ENO A;  5F1X A;  1B9F A;  1RDU A;  1FKP A;  3LWL A;  4M3Y A;  2F4V K;  4CFA A;  4W5O A;  4KHQ A;  2OPQ A;  3VEO A;  1NU0 A;  5M1K A;  3H6E A;  4HUG A;  2B6A A;  4F3O A;  4DTS A;  1NBW A;  4DFJ A;  2D4W A;  4EP4 A;  3CME N;  3EO3 A;  2O8E A;  3WNE A;  4DQP A;  4H5N A;  2DPN A;  1RDC A;  3JS6 A;  5C42 A;  3RMD A;  2P9N A;  5KTQ A;  4HTL A;  4BR5 A;  1WOQ A;  4FK4 A;  4FPA A;  3QEX A;  3NF9 A;  4F3T A;  1J5E K;  3T19 A;  2BUP A;  3L3U A;  1YT3 A;  2CGJ A;  4IG3 A;  2Z1G A;  5A2Q O;  3DXK A;  1HNX K;  5C10 A;  4WQ4 A;  2YNI A;  3AO4 A;  2UXD K;  3LDN A;  1SQK A;  5DM7 L;  3MX5 A;  1OVY A;  3VN5 A;  4BRP A;  2WOM A;  3VET A;  2QWP A;  4O0J A;  2OA8 A;  2E6L A;  3V1R A;  4PKH A;  1HYS A;  1JXB A;  4OPJ A;  4CIF A;  4CD1 A;  2PYJ A;  1K6Y A;  1RDB A;  4IOA L;  1B92 A;  4DV1 K;  1I39 A;  3KKS A;  1S22 A;  3V9Z A;  1DKG D;  1KLN A;  1NGF A;  1XNR K;  2D1K A;  1P90 A;  1HNW K;  1KAY A;  4CER A;  4J2A A;  3ZX3 A;  1IKX A;  1XMO K;  1LW0 A;  3VTI A;  1HNZ K;  5KRT A;  1C1C A;  3I55 N;  3MAQ A;  3DLK A;  4CZF A;  1TK8 A;  5MLC Q;  1KRP A;  1S1U A;  3H46 O;  5GIO A;  4CJ4 A;  3OYM A;  3M5R A;  1NMN A;  4FWQ A;  3FFK B;  1NM1 A;  4RWT A;  3CJB A;  3AVI A;  4CJ3 A;  5BRH A;  3MEC A;  1NJZ A;  1YAG A;  3CET A;  3S9H A;  4AM7 A;  2LSN A;  4DSL A;  4KRF A;  4JS4 A;  4JNE A;  4KTQ A;  4DFM A;  1B9D A;  2ZJP L;  4BRN A;  3CIP A;  5BR8 K;  5M1F A;  3P39 A;  3K58 A;  1BA0 A;  4CF9 A;  3GOI A;  3QEW A;  3KWG A;  4XH1 A;  3I33 A;  4KRE A;  1NGH A;  3VGK A;  3SAG A;  4OPK A;  1C0U A;  4ID5 A;  1U4B A;  2FSK A;  2OAN A;  3A5N C;  4CFB A;  1NK4 A;  4CEB A;  4MFB A;  4NXM K;  3A0I X;  3SAH A;  4DFK A;  1VQL N;  3MXM A;  3THW A;  1EWR A;  5AQN A;  2NZT A;  3RR8 A;  4A59 A;  2G8I A;  3NHG A;  5AZJ A;  1IBK K;  1Z05 A;  3CCV N;  4FLV A;  4O4G A;  2FXU A;  4WFB L;  1NGI A;  1M1K O;  3TPQ A;  5FRN A;  4BDY A;  3K9K A;  2ASM A;  3D2E A;  1SL1 A;  2E88 A;  4WYB A;  4AHC A;  4XH5 A;  4JV5 K;  3TAE A;  2NRR A;  2G8H A;  1BQN A;  2A42 A;  1HNV A;  3LM9 A;  4BVO A;  3P38 A;  2ZWH A;  5I42 A;  3VA3 A;  5AQM A;  1Y97 A;  3IKM A;  2UUA K;  2O8D B;  5FPM A;  2IGI A;  4H5T A;  1TL3 A;  2D0P A;  2O4G A;  4QOZ B;  4CD3 A;  4CZH A;  4KB0 A;  2V7Z A;  4E3S A;  3SPY A;  1SL0 A;  4DQI A;  3NH0 A;  1N32 K;  3TTC A;  4CJ5 A;  1JLC A;  4YOR A;  3VQ9 A;  1NGC A;  5K14 A;  1YTA A;  5KPZ A;  4CJR A;  3ZT1 A;  4B9L A;  1NKB A;  1G15 A;  4CJP A;  4B8A B;  2CH5 A;  3WXI A;  1VSE A;  1IH7 A;  2XY8 A;  3HI0 A;  2RHK A;  4KI4 A;  5AQI A;  3UKU B;  4DLG A;  4IZ9 A;  3DLG A;  4AHV A;  2YHA A;  4CEF A;  5IWA K;  4B1Y B;  1NKE A;  4BRC A;  3SQ0 A;  2GV9 A;  2G8V A;  4N5S A;  3CER A;  4M7Y A;  3DXM B;  3AVJ A;  4FYD A;  4RW6 A;  4OX9 K;  1S1V A;  3U3G A;  3IMX A;  4BWJ A;  1WSE A;  4WE1 A;  1U04 A;  1GOB A;  1EWQ A;  4A2B A;  2G8W A;  1QVG M;  4OO1 J;  5B8H A;  1N36 K;  4K25 A;  2HHW A;  4YHH K;  4BR9 A;  2NRX A;  2RF2 A;  3ZET B;  3H1V X;  3ID6 A;  1YUW A;  1X3N A;  3CPW M;  2HB5 A;  2ZJR L;  4B9S A;  3H3O B;  3P31 A;  3NGI A;  3DAW A;  3AO2 A;  1VQ7 N;  2AA4 A;  1DTT A;  1VSH A;  4N47 A;  2X78 A;  3CG7 A;  3LP1 A;  4JKD A;  4YFU A;  4DQQ A;  4LF4 K;  3CC7 N;  3ZSX A;  3KLI A;  3M8Q A;  1NGD A;  4LFA K;  2B4J A;  2VGN A;  3P83 D;  4F4K A;  1ESV A;  4L3Q A;  1RTD A;  1KSP A;  3HZ6 A;  4PUO A;  1UAX A;  1ZXO A;  3HJF A;  1QTM A;  3CXC M;  2P1J A;  3CJC A;  2Z1J A;  1P8Z A;  4M42 A;  4BRL A;  3U6F A;  4CE9 A;  4CZG A;  1LV5 A;  3LAL A;  1GOA A;  5BRF A;  4FW1 A;  4CK3 A;  3RRH A;  3DRR A;  4DSF A;  4EZ6 A;  4CEZ A;  5GAD P;  3A8Y A;  4FWR A;  5C15 A;  4B1U B;  4IO9 L;  4H8K A;  3GG4 A;  2QKK A;  1D5A A;  3ENH A;  1KVA A;  2YCH A;  1HKC A;  3R6M A;  5M1O A;  1NJY A;  1TAQ A;  3F9K A;  4Z4E A;  1W7A A;  1NK5 A;  3TSQ A;  3O3F A;  4QS8 A;  4Z4C A;  4F2S A;  2XY5 A;  3KLE A;  1C1B A;  4H0P A;  1WSI A;  5ELZ A;  3D2F B;  3FE1 A;  3O1W A;  5GAE P;  4CF8 A;  4CGI A;  3LWM A;  1RTI A;  1T6C A;  4NLC A;  2ETJ A;  4BC4 A;  4B9T A;  4JKG A;  2HOE A;  3OBY A;  3QEP A;  3WUH A;  4M41 A;  4MO4 A;  3A2F A;  4FZX C;  3C0B A;  3V1Q A;  1SZ2 A;  1WAF A;  3LP0 A;  4JYA K;  2QWL A;  3ZT0 A;  1L3V A;  2FC0 A;  1ZBF A;  3WNH A;  1K8K A;  1VQ9 N;  1LAV A;  4EZ9 A;  4NXN K;  3MEG A;  1NK6 A;  4J2E A;  4PL8 A;  3KVG A;  2CH6 A;  3MX2 A;  3THY B;  3SZ2 A;  3QBW A;  4RW9 A;  3J7Z O;  4IDK A;  4DQR A;  1WAJ A;  4IJA A;  4H5W A;  4FLZ A;  4V19 S;  4R79 A;  4CFD A;  2B5J A;  4AHU A;  1NJW A;  3SUO A;  4YOV A;  1Y64 A;  4WFN L;  4NCA A;  1KFS A;  4PL7 A;  4DTX A;  3R3L A;  3FZK A;  4FJL A;  3KJV A;  1IG9 A;  3V9S A;  3UKR B;  4CGF A;  4JEP A;  3BZK A;  4DV3 K;  2F8S A;  1JLA A;  1YVU A;  3KIO A;  3KKR A;  5HRS A;  2KTQ A;  2A3Z A;  3E9O A;  2PFU A;  2KHO A;  3CPE A;  2J4R A;  3R1X A;  1VSF A;  4RTF D;  3CF5 L;  1L3S A;  1IKV A;  1OVQ A;  3LPT A;  4JLH A;  4K8Z A;  1HNI A;  4LD0 A;  1L5U A;  2DY4 A;  1KLM A;  1RBU A;  4IKF A;  3ZEU A;  3SYZ A;  5CHI A;  1BA1 A;  4H03 B;  3ZT2 A;  3L0Q A;  3OA9 A;  4CIG A;  3OYK A;  4C23 A;  4I9L A;  3EZ5 A;  5HBM A;  4OPA A;  2F96 A;  3L8B A;  1S1X A;  2P51 A;  4CJU A;  2XY6 A;  3OYL A;  4Z4H A;  3M8R A;  1DEJ A;  2HHH K;  1XNQ K;  1JLQ A;  2YV0 X;  3G10 A;  4DTP A;  1LW2 A;  1U6Z A;  1YJW N;  1JKH A;  1CXU A;  3AAQ A;  3G71 N;  1YJ9 N;  3LAM A;  1XHZ A;  2Q0U A;  2WTU A;  1HJO A;  4CHY A;  3HOS A;  1LOT B;  5J2P A;  5FDL A;  3HM8 A;  1J53 A;  1N33 K;  3ZSO A;  3PLA A;  3DWL A;  3EZW A;  1Q81 O;  4DV2 K;  4IBN A;  2HND A;  4CJL A;  4JK7 A;  3QML A;  4CJV A;  5KGW A;  1HKB A;  4BAC A;  4I2P A;  3SNN A;  4DQS A;  5FPN A;  4JI0 K;  1QQO A;  4A57 A;  2HMP A;  3I0S A;  5AQG A;  3ULE B;  4H5R A;  1X9J A;  4OKK A;  3NGZ A;  1NK0 A;  4CED A;  1VK0 A;  3TI0 A;  1TUU A;  3K59 A;  2JWK A;  4E19 A;  1ZBS A;  4CGJ A;  1TV6 A;  3WNF A;  4QCL A;  4AH9 A;  3G6E N;  1UA1 A;  3ZX0 A;  1U2V A;  1RT7 A;  3JXU A;  3MK6 A;  3WNG A;  1Q86 O;  4CHQ A;  1HMV A;  3LAN A;  2E8A A;  2P9I A;  3TAM A;  3QEV A;  4M63 C;  3EE8 A;  1Q7Y O;  1GLF O;  4JD2 A;  1FJG K;  1S5J A;  2H3G X;  3AO5 A;  4L8R B;  5GAG P;  2G8F A;  3T3F A;  3FGU A;  2QM1 A;  2NRW A;  1J6Z A;  4K41 A;  3SV4 A;  3N4P A;  2NRZ A;  3O08 A;  4FM2 A;  1A5V A;  3S41 A;  2A5X A;  4YY3 K;  3AAP A;  3AA5 X;  3HOT A;  3CQ8 A;  3VGM A;  3AGK A;  2QK9 A;  4CBX A;  4PQU A;  4X62 K;  3WEE A;  2CGK A;  3SLC A;  1S1T A;  4C8O A;  5AQS A;  3ZSQ A;  4X64 K;  4IO8 A;  3NBP A;  2WFB A;  4FJ9 A;  3O3H A;  4FLX A;  5AZI B;  1BCM A;  3WEE B;  4IEI A;  3VQQ A;  2FSN A;  2W6L A;  3VOV A;  4FLY A;  1TL1 A;  4DTR A;  2HNZ A;  5CYQ A;  5BN8 A;  2QWO A;  1JXE A;  3DLB A;  2IAJ A;  3UE5 A;  4IG0 A;  1GOC A;  1OH5 A;  1ATN A;  3IG1 A;  1J5O A;  1BOT O;  3C7N B;  4Q5V A;  1LWC A;  2ZM6 K;  2EX3 A;  1VRT A;  2UXC K;  2AP1 A;  3P1G A;  3SMP A;  3R8E A;  4M3R A;  2HHX A;  3Q7B A;  4GMJ B;  4E7K A;  4WQ5 A;  2YI1 A;  5H1S Q;  2VWJ A;  3NF7 A;  3SQ4 A;  4B9V A;  4GNI A;  4B3R K;  3N4Q A;  2D0B A;  1HUX A;  4O8K A;  4CJE A;  1HRH A;  4JKF A;  2QWQ A;  1BG3 A;  5BN9 A;  3O9S A;  5HRN A;  4BC5 A;  4C8N A;  4K42 A;  2BTF A;  3AVA A;  3TAN A;  4CJF A;  2YJE A;  2HVH A;  3JAM O;  1HR0 K;  1BU6 O;  1TKD A;  3WT0 A;  1M90 O;  1BIS A;  2HBM A;  3CC2 N;  3AA2 A;  1IKY A;  4FWN A;  4HUF A;  4N76 A;  1HPM A;  3NH2 A;  4LFC K;  1Q18 A;  3LZJ A;  4DSI A;  3SV3 A;  1C0F A;  2VG7 A;  1L3U A;  3CFR A;  3FZF A;  3CM6 A;  3AV9 A;  3FR0 A;  1HX1 A;  1ZC6 A;  4O8U A;  2YHY A;  1V4T A;  5AQL A;  3MN9 A;  3OTO K;  4HUE A;  4CZK A;  3VQ6 A;  3NE6 A;  4WCE L;  5HRR A;  5C2D A;  4XIU A;  5FRO A;  4H0O A;  5EX5 A;  4FJ7 A;  5AQZ A;  4DCH A;  4CES A;  4UY8 O;  4B8C A;  4DR5 K;  3MWT A;  4ILH A;  4HCB A;  4FSV A;  1GLD G;  1R59 O;  5KRS A;  3SUN A;  3O5B A;  4AIL C;  2IIR A;  3T1Y K;  1NGE A;  2YHX A;  3LDL A;  3LM2 A;  3OYF A;  3U8X A;  1QSL A;  2GUP A;  3ZLJ A;  1DTQ A;  2W40 A;  3M6G A;  2E1Z A;  3KZB A;  4DB3 A;  4FM0 A;  3RMC A;  5HRP A;  1IG8 A;  4CHZ A;  3VEN A;  1GLL O;  2OPP A;  4OGE A;  3I0R A;  3ZYY X;  3EY1 A;  3OYN A;  3G0Z A;  3F73 A;  4JRP A;  2FBY A;  3PX6 A;  2D0O A;  3HYF A;  4QS7 A;  4JK9 A;  2BDP A;  1BGX T;  1I3A A;  2KW4 A;  1J9A A;  2RN2 A;  3U3Y A;  4FW2 A;  3DOL A;  4BRE A;  4KH6 A;  2HHT A;  4CFC A;  1LAW A;  3CC4 N;  3O9Q A;  2VG6 A;  3LDS A;  2O8D A;  5DK5 A;  4CF2 A;  4FOI A;  3VQB A;  3QER A;  2Z1I A;  4LC9 B;  3VGL A;  4DR2 K;  5D3G A;  4DU3 A;  1QHT A;  2XO7 A;  3BDP A;  4CZE A;  4FOE A;  1RT6 A;  3K5O A;  4FWK A;  3ATU A;  3DM2 A;  5AQJ A;  4E7H A;  4M45 A;  2P9P B;  4ZHR A;  1SL2 A;  1NNE A;  5FRM A;  4BE1 A;  1QZ6 A;  5TKY A;  1NGB A;  3UKU A;  3BEX A;  2HMI A;  4H5V A;  1C6V A;  1KVC A;  2YKN A;  2ZD1 A;  2YNH A;  3SUP A;  3E66 A;  2DFH A;  3GL1 A;  2DFF A;  3RWU A;  3DXM A;  3QES A;  4DV7 K;  1ZBI A;  5BRD A;  2O8F B;  3THV A;  2QXF A;  3T7Z A;  1JLB A;  1HYZ A;  2NUB A;  1YJN N;  2P9L B;  2E20 A;  4H0V B;  3JYT A;  3SJJ A;  4NO7 A;  3ZET A;  1XC9 A;  4IFV A;  3VQD A;  3WQU A;  4RW8 A;  2KZM A;  4JKE A;  3S3N A;  1S6P A;  4I9Q A;  3CMA N;  4ELV A;  2P9S B;  3SI6 A;  3O9R A;  4HTU A;  5JIC A;  2VQF K;  4CZL A;  3CQY A;  3VPZ A;  2UUC K;  2G8K A;  4NYF A;  3PY8 A;  3EL2 A;  1QSS A;  3LDO A;  2GBZ A;  4CJQ A;  3PV8 A;  1U47 A;  1VQ5 N;  2ZGY A;  3LDP A;  3PSF A;  1T03 A;  1TYQ B;  3D6R A;  1U45 A;  1TUY A;  4JKC A;  1CZ9 A;  4H0T B;  2O8C B;  1Z26 A;  4I6M B;  1VQP N;  3K9J A;  4F9O A;  3HTV A;  1S9G A;  3HO1 A;  5GIP A;  4Z4I A;  4FVM A;  1DGK N;  4KHY A;  4IOX A;  4YDU A;  5JMV A;  1OH6 A;  1RBS A;  3IDH A;  3K57 A;  4JAX A;  5LJV A;  5LJW A;  3S3M A;  3CD6 N;  2XHB A;  3O80 A;  4O0I A;  2P9K B;  4NCB A;  1XQS C;  5E26 A;  2GWJ A;  4EHU A;  4FJ5 A;  3HL8 A;  2CGL A;  1WSH A;  5M1Q A;  1TAU A;  3AAR A;  3L2U A;  3AVG A;  4DF8 A;  1X9M A;  3OYH A;  1YIT N;  3SPZ A;  3VQE A;  1MA9 B;  4ISF A;  1KAZ A;  3CFO A;  5C12 A;  4NYN A;  5I9E B;  4B1V A;  3QFP A;  3TSP A;  3VQC A;  1T3V A;  4YOU A;  3H08 A;  3OBW A;  1KFD A;  2YKM A;  4DSJ A;  4AHR A;  1SS6 A;  3D7E O;  1K9M O;  3D2F A;  2Q97 A;  3B8A X;  3O4W A;  3J8A A;  1GLA G;  1HQE A;  5F0X A;  1S72 N;  1YXQ A;  4DKW A;  4W5N A;  4FLW A;  4O44 A;  3K5M A;  1FW6 A;  4ZTJ A;  2GUI A;  2HBJ A;  4CJS A;  3OS2 A;  1KTQ A;  3QET A;  5EXW A;  5SWM A;  2HW3 A;  4C1N I;  3HST B;  5LMN K;  1D9F A;  3LL3 A;  4B9Q A;  3VTH A;  1Z25 A;  4E1N A;  1HYV A;  1OH7 A;  4DF4 A;  1BUP A;  4ELT A;  4EIA A;  4CK1 A;  1XHX A;  4G1Q A;  3THY A;  1NG9 A;  4MLE A;  5CZ2 A;  1RT3 A;  2VQE K;  4PKI A;  1ASW A;  1TGO A;  3QB0 A;  3D45 A;  3NVK A;  4TSX A;  1QZ5 A;  3LPU A;  4Z4G A;  3F9M A;  4GKK K;  3AVC A;  4BRQ A;  2FSJ A;  4DWI A;  5C24 A;  4CJK A;  4RW4 A;  3R9P A;  3CJA A;  1GLJ O;  4H4O A;  2IVP A;  2X74 A;  2FBV A;  2YJF A;  5AQT A;  4DTO A;  1SUQ A;  2Q3S A;  1BDG A;  4FO0 A;  2KZZ A;  4A62 A;  5J1E A;  3VER A;  3UKR A;  2E4L A;  1RIL A;  3EYZ A;  3MED A;  3HPG A;  1HLU A;  5HLF A;  1A5X A;  1ASU A;  1BI4 B;  4Y1C A;  3J80 O;  1VSI A;  2GEM A;  2RKI A;  3G4S N;  4H0Y B;  5ADX H;  1I94 K;  4DR1 K;  1TK0 A;  4FK2 A;  4A61 A;  3ITH A;  1T44 A;  3P4I A;  5JLF A;  2D0A A;  1WSG A;  2EHG A;  3MN7 A;  1YI2 N;  1ILY A;  4B1Z A;  4KH4 A;  4C8M A;  1UOC A;  3DRS A;  3VQA A;  2NNW A;  3AVF A;  3ZX2 A;  2OZM A;  1RDA A;  3KD5 E;  3EKS A;  3ALY A;  4MDB A;  5AQP A;  2G8U A;  1IJJ A;  2P9U B;  3EEQ A;  2IC3 A;  3NDK A;  3SQ1 A;  3KK7 A;  4OVL A;  3T69 A;  3ZT4 A;  1N8R O;  4OKJ A;  3SAF A;  3VEW A;  1RCH A;  4FJM A;  4BRF A;  3CCR N;  2PY5 A;  4XEI A;  1DT9 A;  4FLU A;  2KFZ A;  3THX A;  1MU2 A;  3KWI A;  4JI2 K;  1VQ4 N;  3OYA A;  2O8B B;  4BR4 A;  3IS9 A;  1H1V A;  3QDK A;  3ZSZ A;  3OYJ A;  4FJN A;  2OCE A;  4E1J A;  2OYQ A;  4FJG A;  2NRH A;  3SK3 A;  3VEZ A;  3THX B;  1CZA N;  3CCE N;  5BPN A;  4PWD A;  4BRI A;  3TAP A;  2IVO A;  1Q82 O;  4KBO A;  2FF6 A;  3PO5 A;  2A1S A;  1XWL A;  4IFE A;  4OJR A;  3WXM B;  3RMA A;  1XI1 A;  1SKR A;  1NMD A;  1S3X A;  2ZF5 O;  1JL2 A;  4C8K A;  4QAG A;  1O13 A;  4J2D A;  3L6Q A;  3AA3 A;  5T7B A;  4A5B A;  4B3O A;  3VQ7 A;  1EKE A;  1SV5 A;  4NB4 A;  3V9U A;  3VEY A;  2FLO A;  3NF6 A;  3ID8 A;  1XMQ K;  2OPR A;  4C8L A;  1MDU B;  1NWK A;  1IKW A;  1RT5 A;  3BF3 A;  3CJ1 A;  3DYA A;  4Y1D A;  1VSK A;  3K5L A;  3HPO A;  3CQX A;  2KQ2 A;  3L3V A;  2P5G A;  1RT2 A;  3ULE A; 
#chains in the Genus database with same CATH homology
 4DR2 K;  1IBL K;  4LFB K;  1XMO K;  1HNZ K;  3J80 O;  4X66 K;  4B3M K;  4KHP K;  4DR6 K;  4DR3 K;  4DV0 K;  4K0K K;  4LF8 K;  4LF5 K;  1I94 K;  4B3S K;  4JI7 K;  4DR1 K;  4JI4 K;  4CW7 B;  3JAM O;  1HR0 K;  4DUZ K;  1FJG K;  5IWA K;  3J7Y P;  4B3T K;  4LFC K;  5IT9 O;  4JI6 K;  2E5L K;  4OX9 K;  4JI5 K;  4JI8 K;  3OTO K;  3T1H K;  4CVN E;  4DV5 K;  4GKJ K;  5BR8 K;  4DV7 K;  4JI3 K;  4YY3 K;  2F4V K;  1N36 K;  1IBM K;  4YHH K;  4X65 K;  5AJ3 K;  4DR5 K;  4DV4 K;  5LMU K;  4JYA K;  2HHH K;  4X62 K;  1XNQ K;  4JI2 K;  3T1Y K;  4NXM K;  4X64 K;  4NXN K;  4DUY K;  5FLX O;  2UU9 K;  4LF6 K;  5LMN K;  5LL6 Z;  4JI1 K;  1IBK K;  1J5E K;  4LF9 K;  4DV6 K;  3J7A P;  4LF4 K;  2VQF K;  4V19 S;  2UXB K;  5A2Q O;  4LFA K;  2UUC K;  1HNX K;  2VQE K;  1N33 K;  2UXD K;  4JV5 K;  4LF7 K;  4DR7 K;  3J81 O;  4DV2 K;  4AQY K;  4GKK K;  2UUA K;  4JI0 K;  2ZM6 K;  2UXC K;  4DV1 K;  1XMQ K;  4DR4 K;  4DV3 K;  1N32 K;  1XNR K;  1HNW K;  1N34 K;  4B3R K;  2UUB K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...