4HVJA

Crystal structure of a putative uncharacterized protein from mycobacterium tuberculosis in complex with amp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
160
structure length
156
Chain Sequence
b'SMVRYFYDTEFIEDGHTIELISIGVVAEDGREYYAVSTEFDPERAGSWVRTHVLPKLPPPASQLWRSRQQIRLDLEEFLRIDGTDSIELWAWVGAYDHVALCQLWGPMTALPPTVPRFTRELRQLWEDRGCPRMPPVHDALVDARDQLRRFRLITS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
molecule tags Unknown function
source organism Mycobacterium tuberculosis
publication title Mycobacterium tuberculosis Rv2179c Protein Establishes a New Exoribonuclease Family with Broad Phylogenetic Distribution.
pubmed doi rcsb
total genus 52
structure length 156
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4hvjA00
1NJYA 1WAFA 3ULDA 4ELVA 4DTJA 5HP1A 5DMRA 4CHYA 1CZ9A 3K5OA 1TKXA 4CGJA 1LWCA 4I2PA 3SQ0A 3LZIA 1T8EA 1J5OA 3DOLA 1Q9YA 3D45A 3ZCMA 5C25A 3A2FA 3V9XA 1CLQA 3SI6A 3K5MA 1S9GA 2OYQA 4IDKA 1L5UA 3O4QA 1JKHA 4FK0A 1S5JA 4OVLA 4ELTA 4FM1A 1CZBA 1HYZA 4ICLA 4HUFA 3QIOA 4DU3A 3V4IA 4HTUA 1BCOA 4JRPA 2ITGA 3ALYA 4KHNA 1ZBIA 1SL0A 5HRNA 3QEPA 1D5AA 1BIUA 4CFAA 3KLHA 4Z4EA 3ZT1A 4E3SA 3ZT4A 4M3RA 3RRGA 2Y1JA 2QXFA 4IFVA 3OJSA 3SPZA 3P83D 3CFRA 4BDYA 3OYLA 3HPGA 5J2NA 2YKNA 4BE1A 3SV3A 3TAMA 3LAMA 1LAWA 3ZT3A 4B9NA 1W0HA 4KTQA 3DOKA 4DMNA 2FBVA 2VWKA 4CJEA 3P5JA 3EYZA 3K57A 3ISNC 2FBXA 2ETJA 2Z1IA 1S1WA 4O55A 2JGUA 3VQ8A 3TWHA 4FXDA 3VQ5A 1JLQA 4KPYA 1XHZA 3F73A 4RW7A 1Y97A 4I2QA 4FLVA 2OZMA 1D9DA 2F8TA 1J54A 4N41A 4CJQA 3AVJA 5I42A 4E1NA 4E7KA 1S9EA 1B9DA 1I3AA 4CFDA 4HUGA 3DLRA 1WSIA 4AHUA 3I8DA 4F8RA 1ASVA 3B6OA 4KKOA 1IKWA 1TL1A 4G1QA 1TKTA 1NK7A 3CFPA 1QTMA 4DS4A 2YNIA 2O4IA 2DTUA 5J2PA 3MEDA 4MQ3A 4OKKA 4CJUA 5HRPA 3K5NA 4CEAA 4DTOA 4LD0A 4CJRA 2DFFA 3QEXA 5HBMA 1VSFA 1BI4A 1VSIA 2IAJA 2KW4A 3V9SA 1LWFA 3HP6A 1XI1A 3KKSA 2R7YA 4DG1A 3M8RA 2KZMA 4Z4IA 3CG7A 3PO4A 4CESA 3NGYA 4KHUA 3LWMA 3QEVA 1EP4A 3DRRA 1WNSA 4B9LA 1O1WA 3LANA 3S3OA 3LALA 4N5SA 4NYFA 3HM9A 5SZTA 4CEQA 3RTVA 3CQ8A 3DLBA 4KHSA 3RRHA 4H8KA 4RW6A 1FKOA 1WSFA 1S1XA 2ATQA 3DYAA 1FKPA 4BE2A 3V9WA 3VA3A 3AVKA 3MXJA 4CJKA 4DF4A 3L2UA 4CHQA 1Q9XA 4FJKA 3ITHA 2HHQA 3K5LA 4E7JA 1KLMA 4FJMA 3HPHA 2QKKA 3UIQA 3KKRA 1BISA 3QEWA 3FFIA 3MEGA 4N47A 2YNGA 4FJ7A 2OZSA 1NKCA 4FLWA 1JLCA 4KFBA 4AHTA 4E1MA 4CJLA 1DTQA 3HT3A 1NOYA 2VWJA 4FYDA 1JLBA 3C6UA 3KK1A 2HNYA 4AHRA 1N6QA 4I9QA 2HHSA 4AILC 5DK5A 4J2BA 4CJTA 2BDPA 4O44A 4FJGA 1KVBA 2HB5A 3ZSRA 3HPOA 3OYNA 3AO1A 3KLEA 4ID1A 2G8IA 4B9VA 2FC0A 2HNZA 1HJRA 3QINA 1QHTA 3OS1A 3LWLA 3EZ5A 1TKDA 1D8YA 4BWMA 4M3YA 4EZ6A 4OGCA 1RTHA 4NYNA 1WSGA 4HCCA 3G0ZA 3LDSA 1GOAA 1L3VA 2OA8A 3QIPA 1TKZA 4OJRA 1F21A 2XY7A 1N5YA 2HW3A 4O4GA 1I39A 3NGIA 4Q0BA 3KJVA 2GUIA 3AV9A 5K14A 3ZSWA 4CIGA 3NH1A 5HRRA 4CJVA 1JXBA 3OYMA 3PX0A 1NK5A 4B9MA 4FZYA 4B3OA 2WOMA 4FLYA 1IO2A 1BCMA 4CK3A 1NJZA 3LAKA 4ZTFA 1IKVA 1C1CA 3NFAA 4E89A 3NF9A 3S9HA 4DSLA 2E4LA 1A5WA 3KLFA 1S6PA 3AO3A 4K8XA 3TR8A 5D3GA 4ID5A 3SJJA 1VSLA 2IGIA 1S1TA 1Z26A 1U45A 1RBTA 1EKEA 3OYIA 3HO1A 1FK9A 1GOCA 1BQMA 3SUPA 4DSIA 4N76A 3AVCA 3PUFA 2G8HA 2RF2A 4CEBA 2E6MA 2P5GA 3AVLA 4CE9A 3TAFA 1QE1A 4CJPA 3V1QA 1J53A 1RT3A 1RT2A 3TANA 4KV8A 1JLGA 4IG3A 3ZSZA 3C6TA 4FJJA 2QK9A 5HRSA 2G8VA 5I3UA 1U47A 4E19A 3T3FA 1VK0A 3AVIA 3KD1E 4FVMA 1A5VA 4CK1A 1VSKA 1WSHA 1ZBFA 3AO4A 4O0IA 3SQ4A 2PYLA 2G8KA 4JS5A 3PX4A 3OYAA 1EX4A 1K6YA 4XIUA 3TAGA 1VRTA 3TARA 1ZYQA 3VQ4A 3RR7A 2BANA 4FJIA 2VG7A 1HQEA 2YHBA 4FLUA 3CYMA 3AA5X 4PQUA 4W5QA 3MXIA 2HVIA 3VQCA 4FCYA 2X6NA 4FW1A 4CIEA 4W5TA 2HNDA 4DSJA 2IC3A 4B9SA 2XY5A 3LP2A 5C24A 4YFUA 3L3VA 1QQCA 1T05A 3AVHA 1BGXT 1VSJA 2Z1GA 4C8KA 3NBPA 3LPUA 3IRXA 2P51A 3M8QA 2Z1HA 3KLGA 3P1GA 1W9HA 3SYZA 1YTAA 4B9TA 5FRNA 3LZJA 1KVAA 4KHQA 5FRMA 3PO5A 1RT4A 4OKJA 3VQPA 4DQQA 2HHTA 1XWLA 2ZQBA 3HVRA 3S3MA 2A1SA 2NUBA 3V9UA 2IDOA 2RPIA 4N56A 1RNHA 4J2EA 4Q5VA 2D0CA 4IFYA 5CY4A 2XRIA 4HUEA 4BDZA 2DFHA 4IG0A 4RG8A 1BHLA 3AA3A 1UA0A 1FXXA 4HHTA 4FM0A 4C8NA 5JS1A 4R5PA 3O4NA 3V6DA 4OLAA 3VQBA 5CZ2A 4DTSA 1JLAA 3PV8A 3TAQA 1S1VA 3PY8A 2XO7A 1ZBHA 4Z0UA 1DLOA 2HHXA 3M8PA 3THVA 3L2RA 4CJ3A 4NCAA 1WAJA 4B9UA 2BGGA 1ASWA 1RCHA 4CK2A 3SPYA 2D0AA 1NK0A 2D0BA 1CXUA 3OYHA 1QSLA 2OPPA 3OYBA 2A1RA 4FJ5A 2HVHA 4RW9A 3T1AA 4M41A 1RDBA 2G8FA 3V9ZA 4EZ9A 1C0UA 1YTUA 1RTDA 4AHSA 4CFCA 5HROA 4FZZA 3ZSQA 4QAGA 1RT1A 4CEFA 4DSFA 4CCHA 4CJFA 1KFSA 3AVGA 3OS0A 1B9FA 3AVAA 3KLIA 3AVFA 1REVA 1EETA 4OKEA 4DFMA 4DF8A 5J2MA 4CGIA 3RMBA 1UAXA 2IOCA 3RMDA 2P1JA 3AVBA 4CF0A 1LV5A 4FZXC 1TAUA 1KLNA 1SUQA 1U48A 4RW4A 3U6FA 1IH7A 3RMAA 4DQPA 3VN5A 4CEOA 4NCBA 1C0MA 1NK4A 3QESA 1X9MA 3U3GA 2YHAA 3IAYA 2DFEA 3K59A 1L3UA 1SKWA 3OYJA 3SUNA 2RN2A 3MEEA 1LWEA 3NF7A 4LH5A 1ZBUA 3VQAA 4DLEA 4NCGA 1YT3A 4RW8A 1JL2A 2X78A 3OJUA 4E7IA 1NJWA 3BGRA 4CGGA 1Q8IA 1VSHA 2B4JA 4ZHRA 3OYEA 3V1OA 4JRQA 1S1UA 4Z4GA 2AJQA 1G15A 4CEDA 3SUOA 1VSDA 4CIFA 2KFNA 4CJ5A 4FJLA 4JS4A 3AA4A 1RBRA 3LP0A 4DU1A 3VQ7A 4Z4HA 4CFBA 2XY8A 4CEEA 4K8ZA 1UWBA 1VSMA 4CJSA 3ZSXA 4C8LA 3ZSYA 2F8SA 2GBZA 5SWMA 5KGWA 4E7LA 4M3TA 2OPRA 1HRHA 2PZSA 4FJXA 4M3XA 4E7HA 2B5JA 2PYJA 3KK2A 4L8RB 1JLEA 4KI6A 3KIOA 4FJNA 5KGXA 3S3NA 4KB0A 1NJXA 2EHGA 1RBSA 2Q3SA 4CGHA 4UQGA 4FM2A 3WNHA 1JXEA 3O3HA 4M45A 2GV9A 2EX3A 4DQSA 4M3ZA 3OYCA 3KK3A 3L2VA 4FLZA 1U04A 4DFKA 1NK6A 1KSPA 4CECA 3L8BA 3DRSA 4FW2A 4W5OA 3HYFA 3L2WA 2PY5A 3KD5E 4IKFA 4LY7A 4OLBA 4FLTA 2KTQA 4I9LA 1KVCA 4C8MA 4ZTJA 5J2QA 1LW2A 1LAVA 4C8OA 1WSJA 1RDCA 4KO0A 2VG6A 1UA1A 2HMIA 4KI4A 3ZT0A 4FK4A 4QCLA 4FLXA 3LP1A 3OYFA 3NE6A 3DI6A 3RWUA 4KAZA 3JYTA 2BE2A 1NOZA 1WSEA 1BQNA 3QO9A 4OPKA 1R0AA 1L3SA 1X1PA 4DTNA 4F2RA 4TSXA 3L2QA 4GVMA 4CHNA 3I0RA 3VQQA 4O0JA 2I5JA 4CJ4A 3D0PA 3SZ2A 3TAEA 1CXQA 3MXMA 1IKYA 4CF9A 2D5RA 1QSSA 3RR8A 1SL2A 3AO5A 4CJWA 2KQ2A 3ZT2A 4DQRA 3SUQA 3B6PA 2FBTA 4I7FA 4YNQA 1X9SA 4F3OA 3ZSOA 5FDLA 4Z4CA 3O3FA 1HMVA 1QS4A 4BWJA 2O4GA 3VQEA 4BDPA 4J2AA 1BI4B 4KB1A 4J2DA 1U4BA 4FJ9A 4QOZB 2F96A 3E01A 4HCBA 2YKMA 5CYQA 4EP4A 4IBNA 2YV0X 4DS5A 1C6VA 3QETA 4O5BA 1T03A 3DLEA 4CGFA 2YNHA 2WONA 3IG1A 4B8CA 1BL3A 4DSEA 4ELUA 3L3UA 4DSKA 2XY6A 1LW0A 4PUOA 1JLFA 4FJHA 4DTXA 1SL1A 2ZE2A 1C1AA 5T7BA 3OS2A 3OY9A 4DFJA 1NK8A 3BDPA 3HJFA 5KRTA 3M8SA 4M3UA 5KI6A 2OPQA 3AA2A 3OVNA 4DFPA 1IKXA 3KTQA 4KHWA 3DMJA 1WN7A 4OPJA 1Z25A 4DTRA 1ZBLA 3NHGA 3HXMA 4PY5A 3TABA 3DRPA 3HSTB 2G8UA 2QKBA 3OYGA 2B6AA 3NF8A 4Y1CA 3AVNA 4CERA 3I0SA 3QEIA 2LSNA 3OYKA 4GW6A 2KZZA 4H4OA 3DLKA 4AHCA 4KREA 1UOCA 4DU4A 4DQIA 1A5XA 1ITGA 3SV4A 1NKEA 3U3YA 1RBUA 3EY1A 4OGEA 5FROA 4CHPA 1KFDA 1X9WA 1BIZA 1GOBA 1KCFA 1TV6A 4B08A 3T19A 2W42A 2FBYA 3VQ9A 4BE0A 4LSNA 1C1BA 2RKIA 1RDAA 3SQ2A 5CYMA 1YVUA 4H4MA 4DWIA 5KRSA 2KFZA 4CF1A 1C0TA 3AVMA 4PA1A 3CM6A 1EXQA 3LP3A 4HVJA 2JLEA 3NH2A 4DTPA 3MECA 3DLHA 4FK2A 4Z4FA 2DY4A 1RT5A 1RTJA 4BACA 1TL3A 3OYDA 1JL1A 1RILA 4MFBA 4CHZA 3TI0A 4DTMA 3ASMA 3SQ1A 4CF2A 1HYSA 2Z1JA 3VA0A 1TK0A 3NF6A 3VQ6A 2HHWA 3HVTA 3WNEA 5E41A 1HPZA 3NGZA 3K58A 1U49A 1WLJA 3F9KA 4CF8A 2X74A 1XHXA 4CGDA 3QERA 1J9AA 1QSYA 1RBVA 3H08A 1MU2A 2ZD1A 4M42A 4Y1DA 5J1EA 2P5OA 2HHUA 1HNVA 1NK9A 3TAPA 3ZSVA 1SKRA 1SKSA 3NAEA 1RT6A 5CZ1A 3WNGA 3DM2A 5KTQA 3QNNA 4F3TA 3O3GA 2G8WA 2IS3A 3VQDA 4LSLA 1HYVA 1RT7A 1TK5A 4KTWA 3G10A 1TAQA 1TVRA 3LPTA 1HQUA 4JLHA 4AH9A 4CHOA 1HNIA 5EU7A 4AHVA 3SCXA 3MAQA 1KRPA 1L3TA 2E6LA 4W5RA 3DLGA 1VRUA 1B92A 3SNNA 1S6QA 5HLFA 1VSEA 3HK2A 1DTTA 1TK8A 4KTZA 1RDDA 3V1RA 3WNFA 4B8AB 5C42A 4FJ8A 3NDKA 3C95A 3IS9A 4WE1A 3K2PA 1TGOA 3NCIA 2HHVA 4F4KA 4M3WA 3HP9A 2X6SA 4W5NA 1ASUA 4EP5A 2VG5A 4DTUA 1XC9A 1D9FA 3AO2A 1RTIA 4DLGA 1NKBA 3RMCA 3QNOA 1T7PA 1KTQA 3V81A 4PWDA 1IG9A 3C94A 2XHBA 4KHYA 4E0DA 4F2SA 3JSMA 2Y1IA 4GMJB 2YNFA 3QLHA 4KRFA 3HL8A 2OPSA 1SV5A 4CEZA 3CFOA 4LH4A 3NH0A 3CM5A 5JS2A 3PX6A
chains in the Genus database with same CATH superfamily
3ULDA 3IUCA 1CZ9A 4CGJA 1TKXA 2AA4A 1WOQA 4NLBA 4AM6A 4C1NI 3SI6A 1QQOA 2OYQA 1L5UA 5AQIA 4FK0A 1K8KB 4ELTA 1HYZA 3V4IA 4HTUA 3R1XA 4CZLA 3SK3A 1ZBIA 2WC9A 3QEPA 2O8FA 3ZT4A 5AQJA 2QWLA 3RRGA 1ZC6A 2Y1JA 2AP1A 2QXFA 1MWMA 1YIJN 1YAGA 4YORA 3P5JA 1VQ4N 2CH6A 1BUPA 5AQKA 3MCPA 3O5BA 5AQVA 3F73A 1BA1A 1D9DA 3EE9A 3A5LC 3LM9A 3U9DA 4FWRA 3TSPA 1I3AA 4HUGA 1ASVA 1NK7A 4B9VA 2O4IA 2YNIA 1VAZA 2KW4A 1LWFA 3KKSA 4DG1A 5C15A 2CGLA 5FPEA 3NGYA 4KHUA 3VF4A 3CC7N 3DRRA 1J5EK 3GL1A 2UXDK 2E5LK 3LANA 5C12A 4N5SA 3BZCA 1Q7YO 3QFUA 1MA9B 3RTVA 2QTDA 3CQ8A 1ATRA 3FR0A 3LDPA 3PIOL 1WSFA 1FKPA 4CHQA 2HHQA 4JD2A 1NGFA 2FF3B 2HOEA 4K42A 2IIRA 3UIQA 1YHQN 4A62A 3QEWA 3O9UA 4FJ7A 4FLWA 1OKJA 4YOTA 4CJLA 1NOYA 5LL6Z 3KK1A 3IFRA 4JI0K 2D1KA 2PBDA 4YOYA 4ID1A 5EXWA 2G8IA 1HJRA 4BQZA 3LWLA 4BC4A 4IOCL 5AQOA 4BR2A 2Q97A 4NLCA 3LDSA 1W7AA 1L3VA 5AQTA 3QIPA 3ENOA 5KPZA 4OJRA 1OVYA 1N5YA 1I39A 5M1OA 4Q0BA 3KJVA 4CZGA 2D0PA 5HRRA 2Q1NA 4DHYA 1WB9A 4DR5K 4FLYA 1IO2A 3LAKA 1IKVA 4E89A 3S9HA 5ELZA 1S6PA 4ID5A 2P9KB 3I8BA 1QVGM 1Z26A 3CCVN 3ZEUB 1EKEA 1XNQK 3A5MC 4N76A 1DKGD 3HI0A 1ILYA 3HSCA 2E6MA 2P5GA 3AVLA 4CE9A 1QZ6A 1J53A 3TANA 3RSEA 3WXKA 4DQ8A 4KV8A 4H5NA 1JLGA 4IG3A 4NB4A 1Q82O 1U47A 2ASPA 4CK1A 4IDHA 3SQ4A 3CJ1A 3KK7A 3MX2A 2E2PA 4WF9L 1S72N 3PX4A 3VEOA 1ZYQA 4KHPK 3VQ4A 5AQYA 3OBYA 1HQEA 4MDBA 2YHBA 3MX5A 3CYMA 5AQXA 1NGDA 2HVIA 2X6NA 3I56N 4W5TA 4DSJA 4B9SA 3P39A 3L3VA 3IKMA 1T05A 3UKRA 4C8KA 3G6EN 1W2BM 3LPUA 4YDUC 3WQUA 3KLGA 2YI1A 3A8YA 2ZQBA 5LJWA 4YOXA 3HOTA 3BUZB 3CERA 1NGEA 1BA0A 4BC2A 3V9UA 2IDOA 3I55N 4N56A 3KVGA 2D0CA 4Q5VA 2XRIA 4OLAA 3PY8A 3VMFB 1VQPN 3GDQA 4O8UA 2BGGA 3P38A 5AQQA 4CK2A 3SPYA 1NGBA 1RDWX 5F1XA 4FJ5A 3WT0A 3T1AA 3VTIA 1RDBA 3K9JA 3VOVA 1NG9A 3A5NC 2HBKA 4B1YB 1YTUA 3ZSQA 4QAGA 1RT1A 4CEFA 2QEXN 2FSNA 1QZ5A 3OS0A 1B9FA 5JMVA 4DFMA 4DF8A 3SLCA 4CGIA 3FLCO 1NGGA 3AVBA 3CI5A 4CF0A 5CHIA 5GADP 4MLEA 2V7ZA 3QESA 3DLLL 3K59A 2OANA 3WQTA 2QM1A 3NF7A 2O8EB 3CCJN 4B3TK 1X9JA 1C0GA 1GLJO 4E7IA 4M63C 3E9LA 1Q8IA 3V1OA 1S1UA 2KLAA 2NZTA 4DV6K 3O6WA 1VSDA 2KFNA 4CJ5A 3VEVA 3CCMN 3AA4A 1RBRA 3RVCA 2HF3A 4Z4HA 4CFBA 3B8AX 4K8ZA 1UWBA 1VSMA 4JEPA 4FWMA 3ZSXA 2F8SA 3ZSYA 1TYQA 5SWMA 3J7YP 4M3TA 4M3XA 3THXB 4FJXA 4E7HA 1V4TA 1JLEA 4FJNA 5AQZA 4B1VA 1RBSA 4UQGA 4M7YA 3O3HA 3EKSA 3OYCA 4MDAA 4FLZA 4EAHD 3ATVA 3L8BA 4FW2A 4JK7A 3HYFA 4OLBA 1ESVA 3H45C 1LW2A 4A2BA 1UA1A 4KI4A 1DGKN 4DUYK 4FLXA 3C7NB 4B3SK 5AFUH 1XC3A 4PKHA 2HSTA 4FWQA 4F2RA 4CBXA 1CZAN 4IJNA 2I5JA 4CD1A 4K43A 3AO5A 4DQRA 4F3OA 2FBTA 1X9SA 3ZSOA 3O3FA 3VQEA 1T6CA 4KB1A 2NRHA 4LF7K 2YV0X 4DS5A 1C6VA 3DLEA 4CGFA 1ZBSA 4DSEA 2UXCK 3O1BA 1SL1A 4U7BA 3AY9A 5T7BA 1NK8A 4WQ5A 3AA2A 4JK9A 3NHGA 2IVOA 4OPHA 3OYGA 3LDLA 2B6AA 4ILHA 4CERA 1N36K 5BRFA 3OYKA 2V51B 3DLKA 4AHCA 4DQIA 1K8KA 2QWMA 1NKEA 3U3YA 1RBUA 5FPNA 1BIZA 1SQKA 1TV6A 3H1VX 2W42A 1HPMA 5TKYA 5C2DA 4FOEA 4G9ZA 3SQ2A 1BG3A 5BPNA 3ZLJA 2WFBA 4CF1A 3ZX2A 3D2EA 1EXQA 1NU0A 2JLEA 3MECA 2DY4A 1RT5A 4BACA 3OYDA 1RILA 3VESA 3W0LA 4JHDB 4CZJA 4CF2A 3D2EB 3NF6A 3ZYYX 1OH6A 5E41A 3WNEA 1K73O 5AR0A 1U49A 2QWQA 2HBLA 3S41A 1KD1O 4CD3A 3C6HA 4BR0A 4OX9K 4B9QA 5KTQA 4H0YB 4F3TA 4FWSA 3QNNA 3FZLA 1HYVA 1TK5A 3G10A 1HQUA 4JLHA 5M1NA 4CHOA 3FZFA 5EU7A 1L3TA 4W5RA 3SNNA 5HLFA 3HK2A 3WXJA 1QQNA 3WNFA 3QFPA 3UE5A 3IS9A 3EKUA 5I9EB 5BR9A 1N33K 1TGOA 2O8EA 3IDHA 4W5NA 2VG5A 4DTUA 4DLGA 3QNOA 3SBGA 1IG9A 4DV0K 2A42A 3VEYA 2OTJN 4LH4A 3CM5A 5GAHP 1NJYA 1WAFA 3I33A 2UUBK 5DMRA 5AQSA 1LWCA 4I2PA 4Z94A 3LZIA 3SQ0A 1WUAA 1Q9YA 3A2FA 1HKGA 3VTHA 1JKHA 2P9LA 1S5JA 3NMUA 3O08A 5BN9A 3T69A 1BCOA 3MN9A 4HWIA 4KHNA 1D5AA 1BIUA 3KLHA 3CXCM 4M3RA 4IFVA 3OJSA 4X66K 3CFRA 4IEIA 2YKNA 3TAMA 4B9NA 1LAWA 4DV3K 3MK6A 4KTQA 4LF4K 1KC8O 3EYZA 4FO0A 4X62K 2W6LA 2ZF5O 4O55A 3TWHA 4FXDA 1C0FA 3VGLA 5M1QA 2A6AA 3WXMB 1B9DA 1RFQA 5M1PA 1WSIA 3H1QA 3CPEA 4AHUA 4F8RA 3RSEB 3UB5A 1N34K 3CFPA 1QTMA 4DS4A 5AQLA 5J2PA 3F2KA 3MEDA 4MQ3A 4OKKA 2ITMA 4CJUA 4LD0A 4CJRA 3QEXA 5AQUA 5HBMA 1VSFA 2IAJA 3HP6A 1XI1A 5E26A 3M8RA 4Z4IA 2W40A 3CG7A 3PO4A 4CESA 4AQYK 2E88A 2P9SA 3D2FB 1MWKA 1WNSA 2NRWA 5A2QO 4XEIA 3WUHA 3DLBA 4RW6A 1FKOA 2ATQA 3V9WA 3VA3A 3Q7CA 1KAXA 3MXJA 4O8KA 4CJKA 3K5LA 4E7JA 1KLMA 5BRHA 3HPHA 3R6MA 2QKKA 2NNWA 4IOAL 3KKRA 4LFAK 1BISA 2YJEA 3MEGA 2YNGA 2OZSA 1NKCA 4XH5A 4KFBA 3HT3A 3TPQA 2VWJA 3C6UA 1N6QA 2HHSA 4CJTA 4O44A 4FJGA 1KVBA 3F5TA 4JNEA 3ZSRA 3AO1A 1O13A 3E9PA 2HNZA 3LDNA 4M3YA 3ZX0A 2YJFA 4NYNA 1WSGA 3KZBA 2YHWA 1QHAA 2XY7A 4GVEA 5JLHA 2GUIA 3AV9A 4CIGA 4N41A 3OYMA 4CZEA 1Y64A 3AGKA 4CK3A 1NJZA 4ZTFA 3NF9A 2Q0UA 5D3GA 5FPMA 4K8XA 3EL2A 3SJJA 2VYPA 1RBTA 5KQDA 3OYIA 4KH5A 3W3DA 1GOCA 3SUPA 3AVCA 4BRQA 2RF2A 1X3NA 3JS6A 1XQSC 1QE1A 4CJPA 1RT3A 1RT2A 2HHHK 2YCHA 3C6TA 1I94K 2G8VA 4E19A 3T3FA 3VGKA 1A5VA 4O0IA 1WSHA 2PYLA 3AO4A 3VF2A 4IO8A 4QS8A 3E66A 2BANA 4JN4A 5KPRA 4BG8A 5AQWA 1E4GT 1HNWK 4GV9A 3CCSN 2PAVA 3LP2A 5C24A 4YFUA 1E4FT 3AVHA 2VWBA 2ZJRL 3MMVA 3NBPA 2P51A 2W41A 4BRIA 1YTAA 3P4IA 1R59O 1KVAA 4KHQA 4OKJA 3VQPA 4UY8O 3HVRA 4BVOA 2F7TA 2NUBA 4J2EA 2Q36A 5CY4A 4HUEA 1BHLA 3DXMB 3AA3A 4R5PA 3O4NA 3VQBA 5BPLA 3OW2M 4H5WA 3DAWA 4B9UA 1GLBG 5ADXH 4JD2B 1CXUA 3OYHA 4FWLA 2QWPA 1S3XA 4RW9A 4M41A 1C0UA 4FWOA 2VGNA 2E1YA 4BREA 3PIPL 3DWLA 4CCHA 1BDGA 1YJWN 1REVA 4OKEA 5J2MA 4OO1J 4CZFA 3RMBA 1UAXA 2P1JA 4JI6K 4FZXC 4BR7A 3U6FA 1IH7A 4ILGB 1NJIO 2P9IB 4CEOA 4DQPA 1NK4A 4DV5K 1HNZK 3CD6N 1SKWA 5TKWA 2RN2A 1LWEA 4CBWA 1NGJA 4BRFA 4DLEA 4BRLA 4CJ7A 4A5AA 4RW8A 3DXKA 2X78A 3N4PA 3BGRA 3D2FA 4Z4GA 2AJQA 2NRVA 4CEDA 3C0BA 3BZKA 4JS4A 4YDUA 4WFNL 2NRZA 4BRHA 3QBXA 4CEEA 4B3RK 1LOTB 4C8LA 2GBZA 3M6GA 3QB0A 3O1WA 4H5VA 4E7LA 3TU5A 2PYJA 4L8RB 4KI6A 3KIOA 3O9SA 2DPNA 2EHGA 3K0SA 1GLFO 1HUXA 2Q31A 3WNHA 5F0XA 2JWLA 2GV9A 2EX3A 4JI3K 3ZX3A 3L2VA 3MDQA 4DFKA 1U04A 4IFEA 5EOYA 3DRSA 1GLLO 3KHYA 3J7AP 4FL9A 4LY7A 4IKFA 4RTFD 4EIAA 4I9LA 4C8MA 1OH7A 1WSJA 2HMIA 3R8EA 3ZT0A 4DR3K 5AZJB 3LP1A 4KAZA 3JYTA 1WSEA 3VEZA 1NGIA 1R0AA 4CBUA 1XMQK 1X1PA 3CQXA 1YXQA 4GVMA 3VQQA 4O0JA 4CJ4A 2O8BA 3MXMA 2D5RA 3RR8A 4J2AA 4BDPA 1QS4A 3E01A 1IBLK 3E1YA 3QETA 3EZWA 2WONA 4B8CA 2P9UB 1GLAG 4FJHA 1KQSM 1C1AA 4DFJA 3BDPA 5KRTA 3LDQA 5KI6A 4DFPA 4KHWA 1IKXA 3DMJA 1WN7A 1Q86O 4PY5A 3CC2N 3DRPA 3HSTB 2QKBA 4CZMA 4Y1CA 4BRNA 4BRCA 1UOCA 4CW7B 1OVQA 4JKCA 1A5XA 1ITGA 3CIPA 3SV4A 2W6KA 4A57A 3JAMO 5JICA 4OGEA 4BRGA 1KFDA 1GOBA 3T19A 2FBYA 3R3LA 2RKIA 4CI6A 1RDAA 5KRSA 1C0TA 3CM6A 4HVJA 4PHTX 4FK2A 4MFBA 2KHOA 3WEEB 3SQ1A 2Z1JA 2HHWA 1HPZA 4LC9B 1WLJA 1J9AA 1RBVA 3H08A 1MU2A 4H0VB 4M42A 4Y1DA 3JXUA 4C1NK 5E84A 3EEQA 3ZSVA 1SKRA 3ID6A 2F4VK 1SKSA 5CZ1A 3DM2A 2ASOA 2IS3A 1V4SA 3QMLA 3VENA 4QS9A 5LMUK 4AH9A 2VQEK 4AHVA 3MAQA 3DLGA 1B92A 4ISGA 1VSEA 1DTTA 1RDDA 4MO4A 5EVZA 4O5FA 3BF3A 2RHKA 2Q0RA 4EFHA 1H1VA 3CJAA 3MN6A 4J8FA 3HP9A 2X6SA 3C7NA 4V19S 3TTDA 1VQON 1T7PA 4PWDA 3NVMA 2WUSA 2XHBA 2P9NB 2Y1IA 1SV5A 4CEZA 3CFOA 1K9MO 3PX6A 4DTJA 5JLFA 4CHYA 4FWPA 3K5OA 3SAFA 3LM2A 1YJNN 4NO7A 3DOLA 3ZCMA 5C25A 1W97L 3K5MA 2YHXA 5GIPA 3O4QA 4JI8K 4FM1A 1CZBA 2FLOA 3MCAB 4ICLA 3DXMA 5BREA 3QIOA 4DU3A 4YOWA 3CCEN 2GELA 4JRPA 1SL0A 5HRNA 4CFAA 4Z4EA 3U8XA 4WCEL 3AAQA 4E1JA 1YUWA 3SV3A 3ZT3A 2OCEA 3DOKA 4DMNA 2FBVA 4CJEA 2GWKA 3M3ZA 3ISNC 2ETJA 2RE2A 2JGUA 4DUZK 1JLQA 2YHYA 1XHZA 4RW7A 4I2QA 2OZMA 1J54A 2IVNA 4CJQA 5C2FA 1WBDA 5I42A 4B3MK 4E1NA 2VQFK 3L6QA 4E7KA 2P9PB 2UYTA 3DLRA 3CPWM 3I8DA 2IVPA 4KKOA 1IKWA 3G4SN 4G1QA 5KQ8A 3M5RA 3K5NA 4CEAA 4DTOA 4FSVA 1BI4A 3V9SA 2A40A 3CJ7A 1J6ZA 2R7YA 2KZMA 3WXLA 4DR2K 4BRMA 2FSJA 3QEVA 4JKGA 4DCHA 4WFBL 4DR4K 1O1WA 4B1XB 3CETA 5HL7L 4NYFA 5SZTA 4CEQA 4KHSA 4JKGB 3RRHA 3J80O 1S1XA 1TUUA 3DYAA 4CVNE 4BE2A 3AVKA 4DR6K 3TSUA 4JKHA 4WQ5C 4FJMA 1FJGK 3PSFA 2E20A 4H0OA 3HBTA 3ZEUA 1GLEG 4N47A 2O8DA 4GKKK 4FYDA 1YJ9N 3ATUA 4FOIA 2HNYA 4AHRA 5AZIB 4XH1A 4I9QA 2UU9K 4IOXA 4J2BA 3T1YK 2HB5A 5FLXO 3HPOA 3KLEA 1IJJA 2FC0A 3MN5A 1QHTA 3OS1A 3EZ5A 1TKDA 4OGCA 1RTHA 1IBMK 1GOAA 2OA8A 3R9PA 1TKZA 3P31A 4BGBA 2HW3A 3NGIA 5KPTA 5JVHL 3NH1A 3PX0A 4CJVA 4B3OA 4B9MA 2WOMA 4LFBK 3KLFA 3AO3A 1HLUA 1S1TA 3UKRB 4JAXA 3WXIA 3HO1A 5GAGP 1BQMA 4LF6K 4BRAA 2P9IA 2G8HA 3TAFA 4QS7A 3OHRA 4A5BA 4FJJA 3ZSZA 2QK9A 5I3UA 3AVIA 1EQYA 1KXPA 4X64K 4I6MA 2G8KA 4H0TB 1K6YA 5AJ3K 3RR7A 4BRPA 4FLUA 4W5QA 4GNIA 2E2QA 4FCYA 5LMNK 3ULEA 4A2AA 1JJ2M 3TTFA 2V7YA 1VSJA 2Z1GA 3M8QA 2Z1HA 3P1GA 1P8ZA 1W9HA 1N32K 4M7XA 3SYZA 3LZJA 4L3QA 1RT4A 3PO5A 2HHTA 2P9LB 2QWRA 2RPIA 2D0OA 2A5XA 2DFHA 3E9OA 4MLHA 4CZKA 1UA0A 4PKIA 3ZETA 4FM0A 3THYA 3V6DA 3GOIA 5CZ2A 4DTSA 3PV8A 2QI2A 3TAQA 2XO7A 1DLOA 2HHXA 3M8PA 3THVA 4PL7A 3L2RA 4CJ3A 1VQ8N 1VQ7N 4NCAA 3GBTA 1RCHA 2ASMA 2D0BA 4BC5A 1SS6A 1QSLA 2OPPA 4GY2B 3OYBA 2E1ZA 5LJVA 2HMPA 2G8FA 3J7ZO 4EZ9A 1BU6O 4FZZA 4AHSA 4CFCA 5HROA 1TYQB 2BTFA 4DSFA 4CJFA 3CF5L 3AVGA 3KLIA 4BVPA 3AVFA 4BRKA 3FZHA 4IXCA 4K0KK 1LV5A 4DV7K 1SUQA 2O8FB 3SAHA 1U48A 4RW4A 3BEXA 3VN5A 4NCBA 1NWKA 1C0MA 4DV1K 2YHAA 1JCEA 3IAYA 3T7ZA 3AGRA 4LH5A 3VQAA 4NCGA 1FW6A 3GE1A 1RDUA 3OYEA 2B4JA 4ZHRA 1G15A 4MO5A 4CIFA 5FPDA 1GLCG 3BP8A 4DU1A 3VQ7A 2VGMA 2GWJA 4XH4A 4A61A 3KWGA 2OPRA 1HRHA 4DR1K 2B5JA 2UXBK 5KGXA 3S3NA 4KB0A 2O8DB 3TSQA 2QXLA 2Q3SA 3O9RA 4CGHA 4FM2A 1JXEA 5BN8A 4M45A 2CH5A 5H1SQ 4DQSA 4M3ZA 3KK3A 1KSPA 1NK6A 3KD5E 3CHWA 3L2WA 2PY5A 3CQYA 4H0PA 2KTQA 4ZTJA 2P9UA 5JVGL 3ZETB 1LAVA 1OH5A 3H46O 1YF5L 1RDCA 2VG6A 3J8AA 4DB3A 3NE6A 2EWSA 3DI6A 3RWUA 1BQNA 2UUCK 3QO9A 2VCPA 5AQPA 4DTNA 2HBJA 1ATNA 4CHNA 3D0PA 3SZ2A 3C6AA 1IKYA 4CJWA 2KQ2A 5EX5A 3ZT2A 4YNQA 4BR4A 5FDLA 4Z4CA 1HMVA 4BWJA 2O4GA 3VETA 2GUPA 1BI4B 4FJ9A 1U4BA 2F96A 4HCBA 4O5BA 1T03A 2HBMA 3G71N 3IG1A 1HX1A 3K9KA 3L3UA 4YY3K 1LW0A 1EWRA 1JLFA 4JHDA 4DTXA 4BC3A 4JKAA 2ZE2A 3OS2A 3OY9A 1M90O 3QBWA 3M8SA 3KTQA 2OPQA 3MWPA 1SZ2A 1EO1A 4OPJA 4DTRA 3QDKA 1HKBA 2J4RA 1NGHA 4LF8K 3NF8A 3UKUB 3AVNA 3I0SA 3QEIA 2LSNA 4EHUA 3G25A 3CJCA 3VEWA 2KZZA 4KREA 3O8MA 4DU4A 1EWQA 4H5TA 4DR7K 1NMDA 4NXNK 1KCFA 4B08A 3VQ9A 3L4IA 2YX6A 4BGAA 4BR5A 4DWIA 1YVUA 4H4MA 2ZJPL 3LP3A 3OBWA 4PKGA 5C0YA 3VGMA 3NH2A 4Z4FA 5IT9O 4CHZA 3TI0A 3ASMA 3J81O 1HYSA 3VA0A 2OTLN 2GX9A 3HVTA 3SJHA 2Q2RA 3F9KA 4CF8A 5BPMA 1XHXA 4CGDA 3TTCA 1VQ9N 3EO3A 5J1EA 1N8RO 2HHUA 1NK9A 4LF9K 3TAPA 2O8CA 4FVUA 1P90A 3NAEA 3WNGA 2A41A 3O3GA 5AQFA 4IO9L 2G8WA 4LSLA 1TVRA 1M1KO 5C10A 1IV0A 4B1ZA 1HNIA 5BR8K 5CE3A 2E6LA 4IWVA 1S6QA 4KTZA 2NRXA 3V1RA 2A3ZA 4B8AB 4FJ8A 3NDKA 5LY3A 3K2PA 2HHVA 1VQKN 1Q18A 1ASUA 3BY5A 4EP5A 1D9FA 3AO2A 1RTIA 1YI2N 1NBWA 3RMCA 1KTQA 3V81A 3C94A 4K41A 4F2SA 3FE1A 1XUPO 4GMJB 2YNFA 3QLHA 2ZM6K 3HL8A 4X65K 1VQ6N 1JCFA 4KH6A 4ELVA 4OPAA 5HP1A 1J5OA 1T8EA 1U2VB 4JKBA 1CLQA 3D45A 3V9XA 3AAPA 1S9GA 4IDKA 4IZ9A 5BRDA 4OVLA 1SAZA 1IG8A 3THWA 1VQLN 4HUFA 4U67L 2QWNA 2ITGA 3ALYA 5GIOA 2FXUA 3IMXA 3ZT1A 1KAZA 4E3SA 2NRTA 3THWB 3CMAN 3SPZA 3P83D 4BDYA 3OYLA 3HPGA 5J2NA 4BE1A 1NNEA 1E3MA 3LAMA 3CCQN 1NGAA 3HOSA 1W0HA 4RCHA 1IBKK 2VWKA 3K57A 2FBXA 3HTVA 3L4QA 2Z1IA 1S1WA 3VQ8A 4YOUA 3VQ5A 1XNRK 4KPYA 1Y97A 4FLVA 4DKWA 2F8TA 2BUPA 3O4WA 4JKEA 3AVJA 5MLCQ 2O8CB 4JI1K 1S9EA 2ZGYA 4CFDA 4JV5K 3B6OA 1TL1A 1TKTA 1YVNA 2DTUA 5HRPA 4JI5K 2DFFA 2P9PA 4YHHK 1HJOA 1VSIA 4FWKA 4H03B 3A5OC 4JI2K 3EN9A 3LWMA 1EP4A 1DEJA 2H3GX 4B9LA 1WBBA 3S3OA 3LALA 3HM9A 1D4XA 4H8KA 3NVKA 2FSKA 4DF4A 4BR9A 2BH1A 2NLXA 3L2UA 1Q9XA 4FJKA 3ITHA 3PLAA 1BWFO 3FZMA 4HTLA 4K25A 2JWKA 3FFIA 2PFUA 4R79A 3THXA 1JLCA 3VF6A 2ZGZA 4AHTA 4E1MA 1DTQA 1JLBA 4AILC 1T6DA 5DK5A 2BDPA 4H0XB 3OYNA 3CMEN 3N4QA 3QINA 1D8YA 4C23A 4BWMA 3WEEA 4EZ6A 3H3OB 1Q81O 4HCCA 3G0ZA 5B8HA 1F21A 1NMNA 3F9MA 4O4GA 4FWNA 5K14A 3ZSWA 4GKJK 4IEEA 1NK5A 1JXBA 4FZYA 1BCMA 3SMPA 3O9TA 3FFKB 1C1CA 1G99A 2KKZA 3NFAA 4AF1A 1YITN 4DSLA 2E4LA 1A5WA 4BROA 3ULEB 3TR8A 3U9ZA 1VSLA 2IGIA 1U45A 2FF6A 2I7NA 1FK9A 4DSIA 3CCUN 4ISFA 3PUFA 4CEBA 4A59A 2QW9A 3V1QA 1Z05A 5HRSA 1VK0A 3KD1E 4FVMA 5M1FA 1VSKA 2QWOA 1ZBFA 4BY9C 4JS5A 3THYB 3OYAA 1EX4A 4XIUA 3TAGA 1JCGA 1VRTA 3TARA 4ILJA 4BQLA 3FGUA 4FJIA 3O9QA 2VG7A 4BG9A 3AA5X 4PQUA 2P9NA 3MXIA 3VQCA 4FW1A 4CIEA 2HNDA 2IC3A 1BO5O 2XY5A 4CZHA 1QQCA 1TUYA 3LL3A 1BGXT 1U6ZA 1HKCA 3IRXA 3ENHA 5ADXA 4F9OA 3HM8A 3ENBA 4B9TA 5CR4A 5FRNA 5FRMA 3OA9A 1NM1A 3O80A 1XMOK 4Y0WA 4DQQA 1XWLA 3S3MA 2A1SA 1RNHA 3H3NO 4IFYA 4BDZA 3HZ6A 4IG0A 5AQGA 2P9SB 3GG4A 4RG8A 5JS1A 1FXXA 4HHTA 4C8NA 2F9WA 1DT9A 1JLAA 3DJCA 1S1VA 1ZBHA 4Z0UA 4LFCK 3ID8A 3CJ9A 1WAJA 1ASWA 2GTDA 2D0AA 4BRDA 1NK0A 1LCUA 1T3VA 2A1RA 2HVHA 2UUAK 3V9ZA 1RTDA 3VERA 1BOTO 5AQNA 1KFSA 3AVAA 2V52B 4JK8A 5F2RA 5AZIA 1EETA 2IOCA 2P9KA 3RMDA 4DV2K 1NGCA 3CJBA 3SAGA 1TAUA 1KLNA 2WTUA 3RMAA 5EY4A 4GV3A 1X9MA 3U3GA 2DFEA 1L3UA 3D6RA 1KAYA 3OYJA 3SUNA 3MEEA 1ZBUA 5AQRA 1YT3A 1JL2A 3OJUA 1NJWA 1Z6RA 1NLVA 4CGGA 1VSHA 4NXMK 5AZJA 4JRQA 1VHXA 4JYAK 2QA4N 3SUOA 2ZJQL 4FJLA 3HRGA 4LF5K 4B1WB 3LP0A 2XY8A 4CJSA 4AM7A 4DV4K 1GLDG 5KGWA 2PZSA 5AFUA 1VQNN 4CZIA 3KK2A 3D7EO 5DM7L 1NJXA 1VQMN 2F9TA 4I6MB 3A0IX 3SBTA 4WQ4A 4CECA 4W5OA 4FLTA 2I7PA 2CGKA 3MWTA 1KVCA 3EE8A 5J2QA 5M1KA 5GAEP 4C8OA 1S22A 4KO0A 4QCLA 5GINA 4FK4A 3OYFA 2BE2A 1NOZA 4EHTA 4FPBA 4OPKA 1L3SA 3QICA 1VQ5N 4TSXA 3L2QA 3I0RA 3PSIA 3TAEA 4H5RA 1CXQA 4CF9A 1QSSA 1SL2A 3SUQA 3BF1A 3B6PA 4I7FA 3M1FA 3FZKA 4FPAA 3VEXA 2E8AA 4J2DA 4QOZB 5IWAK 2YKMA 5CYQA 4EP4A 4IBNA 3SMSA 1QVFM 2YNHA 1BL3A 4ELUA 4DSKA 2XY6A 1MDUB 4PUOA 3VPZA 1HNXK 5AQMA 3HJFA 2E2OA 4M3UA 3OVNA 3T1HK 1ZBLA 1Z25A 1X3MA 3HXMA 3TABA 2G8UA 4GW6A 2WBNA 2O8BB 3CC4N 4H4OA 4GV6A 3Q7BA 3CCLN 3KWIA 3UKUA 3U4LA 3EY1A 5FROA 4CHPA 1X9WA 4BE0A 4LSNA 3LDOA 1C1BA 1T44A 5CYMA 2NRRA 2KFZA 4WFAL 5HOOA 4JKFA 4WYBA 3AVMA 4PA1A 3L0QA 5DM6L 4DTPA 3DLHA 3DXKB 1RTJA 1TL3A 4JI7K 1JL1A 3H6EA 4DTMA 3CCRN 2HF4A 3VQ6A 1TK0A 4JI4K 3NGZA 3K58A 3MN7A 2X74A 3QERA 1QSYA 1ZXOA 2ZD1A 3C65A 4KBOA 1HR0K 2P5OA 1HNVA 3AARA 4JKDA 4PL8A 2ZWHA 1QQMA 1RT6A 1K8AO 2D4WA 4B1UB 3OTOK 3VQDA 1OH8A 1RT7A 4KTWA 1TAQA 3LPTA 1U2VA 2E2NA 4WQ4C 3SCXA 1KRPA 1VRUA 4KH4A 1TK8A 2GEMA 5C42A 3C95A 4WE1A 5AQHA 3NCIA 4F4KA 4M3WA 1ATSA 1RGIA 4IJAA 1XC9A 2CGJA 4RWTA 1NKBA 4E0DA 4YOVA 3JSMA 4ISEA 4KRFA 3NH0A 2OPSA 4KHYA 5JS2A
chains in the Genus database with same CATH topology
1NJYA 1WAFA 3ULDA 4ELVA 4DTJA 5HP1A 5DMRA 4CHYA 1CZ9A 3K5OA 1TKXA 4CGJA 1LWCA 4I2PA 3SQ0A 3LZIA 1T8EA 1J5OA 3DOLA 1Q9YA 3D45A 3ZCMA 5C25A 3A2FA 3V9XA 1CLQA 3SI6A 3K5MA 1S9GA 2OYQA 4IDKA 1L5UA 3O4QA 1JKHA 4FK0A 1S5JA 4OVLA 4ELTA 4FM1A 1CZBA 1HYZA 4ICLA 4HUFA 3QIOA 4DU3A 3V4IA 4HTUA 1BCOA 4JRPA 2ITGA 3ALYA 4KHNA 1ZBIA 1SL0A 5HRNA 3QEPA 1D5AA 1BIUA 4CFAA 3KLHA 4Z4EA 3ZT1A 4E3SA 3ZT4A 4M3RA 3RRGA 2Y1JA 2QXFA 4IFVA 3OJSA 3SPZA 3P83D 3CFRA 4BDYA 3OYLA 3HPGA 5J2NA 2YKNA 4BE1A 3SV3A 3TAMA 3LAMA 1LAWA 3ZT3A 4B9NA 1W0HA 4KTQA 3DOKA 4DMNA 2FBVA 2VWKA 4CJEA 3P5JA 3EYZA 3K57A 3ISNC 2FBXA 2ETJA 2Z1IA 1S1WA 4O55A 2JGUA 3VQ8A 3TWHA 4FXDA 3VQ5A 1JLQA 4KPYA 1XHZA 3F73A 4RW7A 1Y97A 4I2QA 4FLVA 2OZMA 1D9DA 2F8TA 1J54A 4N41A 4CJQA 3AVJA 5I42A 4E1NA 4E7KA 1S9EA 1B9DA 1I3AA 4CFDA 4HUGA 3DLRA 1WSIA 4AHUA 3I8DA 4F8RA 1ASVA 3B6OA 4KKOA 1IKWA 1TL1A 4G1QA 1TKTA 1NK7A 3CFPA 1QTMA 4DS4A 2YNIA 2O4IA 2DTUA 5J2PA 3MEDA 4MQ3A 4OKKA 4CJUA 5HRPA 3K5NA 4CEAA 4DTOA 4LD0A 4CJRA 2DFFA 3QEXA 5HBMA 1VSFA 1BI4A 1VSIA 2IAJA 2KW4A 3V9SA 1LWFA 3HP6A 1XI1A 3KKSA 2R7YA 4DG1A 3M8RA 2KZMA 4Z4IA 3CG7A 3PO4A 4CESA 3NGYA 4KHUA 3LWMA 3QEVA 1EP4A 3DRRA 1WNSA 4B9LA 1O1WA 3LANA 3S3OA 3LALA 4N5SA 4NYFA 3HM9A 5SZTA 4CEQA 3RTVA 3CQ8A 3DLBA 4KHSA 3RRHA 4H8KA 4RW6A 1FKOA 1WSFA 1S1XA 2ATQA 3DYAA 1FKPA 4BE2A 3V9WA 3VA3A 3AVKA 3MXJA 4CJKA 4DF4A 3L2UA 4CHQA 1Q9XA 4FJKA 3ITHA 2HHQA 3K5LA 4E7JA 1KLMA 4FJMA 3HPHA 2QKKA 3UIQA 3KKRA 1BISA 3QEWA 3FFIA 3MEGA 4N47A 2YNGA 4FJ7A 2OZSA 1NKCA 4FLWA 1JLCA 4KFBA 4AHTA 4E1MA 4CJLA 1DTQA 3HT3A 1NOYA 2VWJA 4FYDA 1JLBA 3C6UA 3KK1A 2HNYA 4AHRA 1N6QA 4I9QA 2HHSA 4AILC 5DK5A 4J2BA 4CJTA 2BDPA 4O44A 4FJGA 1KVBA 2HB5A 3ZSRA 3HPOA 3OYNA 3AO1A 3KLEA 4ID1A 2G8IA 4B9VA 2FC0A 2HNZA 1HJRA 3QINA 1QHTA 3OS1A 3LWLA 3EZ5A 1TKDA 1D8YA 4BWMA 4M3YA 4EZ6A 4OGCA 1RTHA 4NYNA 1WSGA 4HCCA 3G0ZA 3LDSA 1GOAA 1L3VA 2OA8A 3QIPA 1TKZA 4OJRA 1F21A 2XY7A 1N5YA 2HW3A 4O4GA 1I39A 3NGIA 4Q0BA 3KJVA 2GUIA 3AV9A 5K14A 3ZSWA 4CIGA 3NH1A 5HRRA 4CJVA 1JXBA 3OYMA 3PX0A 1NK5A 4B9MA 4FZYA 4B3OA 2WOMA 4FLYA 1IO2A 1BCMA 4CK3A 1NJZA 3LAKA 4ZTFA 1IKVA 1C1CA 3NFAA 4E89A 3NF9A 3S9HA 4DSLA 2E4LA 1A5WA 3KLFA 1S6PA 3AO3A 4K8XA 3TR8A 5D3GA 4ID5A 3SJJA 1VSLA 2IGIA 1S1TA 1Z26A 1U45A 1RBTA 1EKEA 3OYIA 3HO1A 1FK9A 1GOCA 1BQMA 3SUPA 4DSIA 4N76A 3AVCA 3PUFA 2G8HA 2RF2A 4CEBA 2E6MA 2P5GA 3AVLA 4CE9A 3TAFA 1QE1A 4CJPA 3V1QA 1J53A 1RT3A 1RT2A 3TANA 4KV8A 1JLGA 4IG3A 3ZSZA 3C6TA 4FJJA 2QK9A 5HRSA 2G8VA 5I3UA 1U47A 4E19A 3T3FA 1VK0A 3AVIA 3KD1E 4FVMA 1A5VA 4CK1A 1VSKA 1WSHA 1ZBFA 3AO4A 4O0IA 3SQ4A 2PYLA 2G8KA 4JS5A 3PX4A 3OYAA 1EX4A 1K6YA 4XIUA 3TAGA 1VRTA 3TARA 1ZYQA 3VQ4A 3RR7A 2BANA 4FJIA 2VG7A 1HQEA 2YHBA 4FLUA 3CYMA 3AA5X 4PQUA 4W5QA 3MXIA 2HVIA 3VQCA 4FCYA 2X6NA 4FW1A 4CIEA 4W5TA 2HNDA 4DSJA 2IC3A 4B9SA 2XY5A 3LP2A 5C24A 4YFUA 3L3VA 1QQCA 1T05A 3AVHA 1BGXT 1VSJA 2Z1GA 4C8KA 3NBPA 3LPUA 3IRXA 2P51A 3M8QA 2Z1HA 3KLGA 3P1GA 1W9HA 3SYZA 1YTAA 4B9TA 5FRNA 3LZJA 1KVAA 4KHQA 5FRMA 3PO5A 1RT4A 4OKJA 3VQPA 4DQQA 2HHTA 1XWLA 2ZQBA 3HVRA 3S3MA 2A1SA 2NUBA 3V9UA 2IDOA 2RPIA 4N56A 1RNHA 4J2EA 4Q5VA 2D0CA 4IFYA 5CY4A 2XRIA 4HUEA 4BDZA 2DFHA 4IG0A 4RG8A 1BHLA 3AA3A 1UA0A 1FXXA 4HHTA 4FM0A 4C8NA 5JS1A 4R5PA 3O4NA 3V6DA 4OLAA 3VQBA 5CZ2A 4DTSA 1JLAA 3PV8A 3TAQA 1S1VA 3PY8A 2XO7A 1ZBHA 4Z0UA 1DLOA 2HHXA 3M8PA 3THVA 3L2RA 4CJ3A 4NCAA 1WAJA 4B9UA 2BGGA 1ASWA 1RCHA 4CK2A 3SPYA 2D0AA 1NK0A 2D0BA 1CXUA 3OYHA 1QSLA 2OPPA 3OYBA 2A1RA 4FJ5A 2HVHA 4RW9A 3T1AA 4M41A 1RDBA 2G8FA 3V9ZA 4EZ9A 1C0UA 1YTUA 1RTDA 4AHSA 4CFCA 5HROA 4FZZA 3ZSQA 4QAGA 1RT1A 4CEFA 4DSFA 4CCHA 4CJFA 1KFSA 3AVGA 3OS0A 1B9FA 3AVAA 3KLIA 3AVFA 1REVA 1EETA 4OKEA 4DFMA 4DF8A 5J2MA 4CGIA 3RMBA 1UAXA 2IOCA 3RMDA 2P1JA 3AVBA 4CF0A 1LV5A 4FZXC 1TAUA 1KLNA 1SUQA 1U48A 4RW4A 3U6FA 1IH7A 3RMAA 4DQPA 3VN5A 4CEOA 4NCBA 1C0MA 1NK4A 3QESA 1X9MA 3U3GA 2YHAA 3IAYA 2DFEA 3K59A 1L3UA 1SKWA 3OYJA 3SUNA 2RN2A 3MEEA 1LWEA 3NF7A 4LH5A 1ZBUA 3VQAA 4DLEA 4NCGA 1YT3A 4RW8A 1JL2A 2X78A 3OJUA 4E7IA 1NJWA 3BGRA 4CGGA 1Q8IA 1VSHA 2B4JA 4ZHRA 3OYEA 3V1OA 4JRQA 1S1UA 4Z4GA 2AJQA 1G15A 4CEDA 3SUOA 1VSDA 4CIFA 2KFNA 4CJ5A 4FJLA 4JS4A 3AA4A 1RBRA 3LP0A 4DU1A 3VQ7A 4Z4HA 4CFBA 2XY8A 4CEEA 4K8ZA 1UWBA 1VSMA 4CJSA 3ZSXA 4C8LA 3ZSYA 2F8SA 2GBZA 5SWMA 5KGWA 4E7LA 4M3TA 2OPRA 1HRHA 2PZSA 4FJXA 4M3XA 4E7HA 2B5JA 2PYJA 3KK2A 4L8RB 1JLEA 4KI6A 3KIOA 4FJNA 5KGXA 3S3NA 4KB0A 1NJXA 2EHGA 1RBSA 2Q3SA 4CGHA 4UQGA 4FM2A 3WNHA 1JXEA 3O3HA 4M45A 2GV9A 2EX3A 4DQSA 4M3ZA 3OYCA 3KK3A 3L2VA 4FLZA 1U04A 4DFKA 1NK6A 1KSPA 4CECA 3L8BA 3DRSA 4FW2A 4W5OA 3HYFA 3L2WA 2PY5A 3KD5E 4IKFA 4LY7A 4OLBA 4FLTA 2KTQA 4I9LA 1KVCA 4C8MA 4ZTJA 5J2QA 1LW2A 1LAVA 4C8OA 1WSJA 1RDCA 4KO0A 2VG6A 1UA1A 2HMIA 4KI4A 3ZT0A 4FK4A 4QCLA 4FLXA 3LP1A 3OYFA 3NE6A 3DI6A 3RWUA 4KAZA 3JYTA 2BE2A 1NOZA 1WSEA 1BQNA 3QO9A 4OPKA 1R0AA 1L3SA 1X1PA 4DTNA 4F2RA 4TSXA 3L2QA 4GVMA 4CHNA 3I0RA 3VQQA 4O0JA 2I5JA 4CJ4A 3D0PA 3SZ2A 3TAEA 1CXQA 3MXMA 1IKYA 4CF9A 2D5RA 1QSSA 3RR8A 1SL2A 3AO5A 4CJWA 2KQ2A 3ZT2A 4DQRA 3SUQA 3B6PA 2FBTA 4I7FA 4YNQA 1X9SA 4F3OA 3ZSOA 5FDLA 4Z4CA 3O3FA 1HMVA 1QS4A 4BWJA 2O4GA 3VQEA 4BDPA 4J2AA 1BI4B 4KB1A 4J2DA 1U4BA 4FJ9A 4QOZB 2F96A 3E01A 4HCBA 2YKMA 5CYQA 4EP4A 4IBNA 2YV0X 4DS5A 1C6VA 3QETA 4O5BA 1T03A 3DLEA 4CGFA 2YNHA 2WONA 3IG1A 4B8CA 1BL3A 4DSEA 4ELUA 3L3UA 4DSKA 2XY6A 1LW0A 4PUOA 1JLFA 4FJHA 4DTXA 1SL1A 2ZE2A 1C1AA 5T7BA 3OS2A 3OY9A 4DFJA 1NK8A 3BDPA 3HJFA 5KRTA 3M8SA 4M3UA 5KI6A 2OPQA 3AA2A 3OVNA 4DFPA 1IKXA 3KTQA 4KHWA 3DMJA 1WN7A 4OPJA 1Z25A 4DTRA 1ZBLA 3NHGA 3HXMA 4PY5A 3TABA 3DRPA 3HSTB 2G8UA 2QKBA 3OYGA 2B6AA 3NF8A 4Y1CA 3AVNA 4CERA 3I0SA 3QEIA 2LSNA 3OYKA 4GW6A 2KZZA 4H4OA 3DLKA 4AHCA 4KREA 1UOCA 4DU4A 4DQIA 1A5XA 1ITGA 3SV4A 1NKEA 3U3YA 1RBUA 3EY1A 4OGEA 5FROA 4CHPA 1KFDA 1X9WA 1BIZA 1GOBA 1KCFA 1TV6A 4B08A 3T19A 2W42A 2FBYA 3VQ9A 4BE0A 4LSNA 1C1BA 2RKIA 1RDAA 3SQ2A 5CYMA 1YVUA 4H4MA 4DWIA 5KRSA 2KFZA 4CF1A 1C0TA 3AVMA 4PA1A 3CM6A 1EXQA 3LP3A 4HVJA 2JLEA 3NH2A 4DTPA 3MECA 3DLHA 4FK2A 4Z4FA 2DY4A 1RT5A 1RTJA 4BACA 1TL3A 3OYDA 1JL1A 1RILA 4MFBA 4CHZA 3TI0A 4DTMA 3ASMA 3SQ1A 4CF2A 1HYSA 2Z1JA 3VA0A 1TK0A 3NF6A 3VQ6A 2HHWA 3HVTA 3WNEA 5E41A 1HPZA 3NGZA 3K58A 1U49A 1WLJA 3F9KA 4CF8A 2X74A 1XHXA 4CGDA 3QERA 1J9AA 1QSYA 1RBVA 3H08A 1MU2A 2ZD1A 4M42A 4Y1DA 5J1EA 2P5OA 2HHUA 1HNVA 1NK9A 3TAPA 3ZSVA 1SKRA 1SKSA 3NAEA 1RT6A 5CZ1A 3WNGA 3DM2A 5KTQA 3QNNA 4F3TA 3O3GA 2G8WA 2IS3A 3VQDA 4LSLA 1HYVA 1RT7A 1TK5A 4KTWA 3G10A 1TAQA 1TVRA 3LPTA 1HQUA 4JLHA 4AH9A 4CHOA 1HNIA 5EU7A 4AHVA 3SCXA 3MAQA 1KRPA 1L3TA 2E6LA 4W5RA 3DLGA 1VRUA 1B92A 3SNNA 1S6QA 5HLFA 1VSEA 3HK2A 1DTTA 1TK8A 4KTZA 1RDDA 3V1RA 3WNFA 4B8AB 5C42A 4FJ8A 3NDKA 3C95A 3IS9A 4WE1A 3K2PA 1TGOA 3NCIA 2HHVA 4F4KA 4M3WA 3HP9A 2X6SA 4W5NA 1ASUA 4EP5A 2VG5A 4DTUA 1XC9A 1D9FA 3AO2A 1RTIA 4DLGA 1NKBA 3RMCA 3QNOA 1T7PA 1KTQA 3V81A 4PWDA 1IG9A 3C94A 2XHBA 4KHYA 4E0DA 4F2SA 3JSMA 2Y1IA 4GMJB 2YNFA 3QLHA 4KRFA 3HL8A 2OPSA 1SV5A 4CEZA 3CFOA 4LH4A 3NH0A 3CM5A 5JS2A 3PX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJY A;  1WAF A;  3ULD A;  4ELV A;  4DTJ A;  5HP1 A;  5DMR A;  4CHY A;  1CZ9 A;  3K5O A;  1TKX A;  4CGJ A;  1LWC A;  4I2P A;  3SQ0 A;  3LZI A;  1T8E A;  1J5O A;  3DOL A;  1Q9Y A;  3D45 A;  3ZCM A;  5C25 A;  3A2F A;  3V9X A;  1CLQ A;  3SI6 A;  3K5M A;  1S9G A;  2OYQ A;  4IDK A;  1L5U A;  3O4Q A;  1JKH A;  4FK0 A;  1S5J A;  4OVL A;  4ELT A;  4FM1 A;  1CZB A;  1HYZ A;  4ICL A;  4HUF A;  3QIO A;  4DU3 A;  3V4I A;  4HTU A;  1BCO A;  4JRP A;  2ITG A;  3ALY A;  4KHN A;  1ZBI A;  1SL0 A;  5HRN A;  3QEP A;  1D5A A;  1BIU A;  4CFA A;  3KLH A;  4Z4E A;  3ZT1 A;  4E3S A;  3ZT4 A;  4M3R A;  3RRG A;  2Y1J A;  2QXF A;  4IFV A;  3OJS A;  3SPZ A;  3P83 D;  3CFR A;  4BDY A;  3OYL A;  3HPG A;  5J2N A;  2YKN A;  4BE1 A;  3SV3 A;  3TAM A;  3LAM A;  1LAW A;  3ZT3 A;  4B9N A;  1W0H A;  4KTQ A;  3DOK A;  4DMN A;  2FBV A;  2VWK A;  4CJE A;  3P5J A;  3EYZ A;  3K57 A;  3ISN C;  2FBX A;  2ETJ A;  2Z1I A;  1S1W A;  4O55 A;  2JGU A;  3VQ8 A;  3TWH A;  4FXD A;  3VQ5 A;  1JLQ A;  4KPY A;  1XHZ A;  3F73 A;  4RW7 A;  1Y97 A;  4I2Q A;  4FLV A;  2OZM A;  1D9D A;  2F8T A;  1J54 A;  4N41 A;  4CJQ A;  3AVJ A;  5I42 A;  4E1N A;  4E7K A;  1S9E A;  1B9D A;  1I3A A;  4CFD A;  4HUG A;  3DLR A;  1WSI A;  4AHU A;  3I8D A;  4F8R A;  1ASV A;  3B6O A;  4KKO A;  1IKW A;  1TL1 A;  4G1Q A;  1TKT A;  1NK7 A;  3CFP A;  1QTM A;  4DS4 A;  2YNI A;  2O4I A;  2DTU A;  5J2P A;  3MED A;  4MQ3 A;  4OKK A;  4CJU A;  5HRP A;  3K5N A;  4CEA A;  4DTO A;  4LD0 A;  4CJR A;  2DFF A;  3QEX A;  5HBM A;  1VSF A;  1BI4 A;  1VSI A;  2IAJ A;  2KW4 A;  3V9S A;  1LWF A;  3HP6 A;  1XI1 A;  3KKS A;  2R7Y A;  4DG1 A;  3M8R A;  2KZM A;  4Z4I A;  3CG7 A;  3PO4 A;  4CES A;  3NGY A;  4KHU A;  3LWM A;  3QEV A;  1EP4 A;  3DRR A;  1WNS A;  4B9L A;  1O1W A;  3LAN A;  3S3O A;  3LAL A;  4N5S A;  4NYF A;  3HM9 A;  5SZT A;  4CEQ A;  3RTV A;  3CQ8 A;  3DLB A;  4KHS A;  3RRH A;  4H8K A;  4RW6 A;  1FKO A;  1WSF A;  1S1X A;  2ATQ A;  3DYA A;  1FKP A;  4BE2 A;  3V9W A;  3VA3 A;  3AVK A;  3MXJ A;  4CJK A;  4DF4 A;  3L2U A;  4CHQ A;  1Q9X A;  4FJK A;  3ITH A;  2HHQ A;  3K5L A;  4E7J A;  1KLM A;  4FJM A;  3HPH A;  2QKK A;  3UIQ A;  3KKR A;  1BIS A;  3QEW A;  3FFI A;  3MEG A;  4N47 A;  2YNG A;  4FJ7 A;  2OZS A;  1NKC A;  4FLW A;  1JLC A;  4KFB A;  4AHT A;  4E1M A;  4CJL A;  1DTQ A;  3HT3 A;  1NOY A;  2VWJ A;  4FYD A;  1JLB A;  3C6U A;  3KK1 A;  2HNY A;  4AHR A;  1N6Q A;  4I9Q A;  2HHS A;  4AIL C;  5DK5 A;  4J2B A;  4CJT A;  2BDP A;  4O44 A;  4FJG A;  1KVB A;  2HB5 A;  3ZSR A;  3HPO A;  3OYN A;  3AO1 A;  3KLE A;  4ID1 A;  2G8I A;  4B9V A;  2FC0 A;  2HNZ A;  1HJR A;  3QIN A;  1QHT A;  3OS1 A;  3LWL A;  3EZ5 A;  1TKD A;  1D8Y A;  4BWM A;  4M3Y A;  4EZ6 A;  4OGC A;  1RTH A;  4NYN A;  1WSG A;  4HCC A;  3G0Z A;  3LDS A;  1GOA A;  1L3V A;  2OA8 A;  3QIP A;  1TKZ A;  4OJR A;  1F21 A;  2XY7 A;  1N5Y A;  2HW3 A;  4O4G A;  1I39 A;  3NGI A;  4Q0B A;  3KJV A;  2GUI A;  3AV9 A;  5K14 A;  3ZSW A;  4CIG A;  3NH1 A;  5HRR A;  4CJV A;  1JXB A;  3OYM A;  3PX0 A;  1NK5 A;  4B9M A;  4FZY A;  4B3O A;  2WOM A;  4FLY A;  1IO2 A;  1BCM A;  4CK3 A;  1NJZ A;  3LAK A;  4ZTF A;  1IKV A;  1C1C A;  3NFA A;  4E89 A;  3NF9 A;  3S9H A;  4DSL A;  2E4L A;  1A5W A;  3KLF A;  1S6P A;  3AO3 A;  4K8X A;  3TR8 A;  5D3G A;  4ID5 A;  3SJJ A;  1VSL A;  2IGI A;  1S1T A;  1Z26 A;  1U45 A;  1RBT A;  1EKE A;  3OYI A;  3HO1 A;  1FK9 A;  1GOC A;  1BQM A;  3SUP A;  4DSI A;  4N76 A;  3AVC A;  3PUF A;  2G8H A;  2RF2 A;  4CEB A;  2E6M A;  2P5G A;  3AVL A;  4CE9 A;  3TAF A;  1QE1 A;  4CJP A;  3V1Q A;  1J53 A;  1RT3 A;  1RT2 A;  3TAN A;  4KV8 A;  1JLG A;  4IG3 A;  3ZSZ A;  3C6T A;  4FJJ A;  2QK9 A;  5HRS A;  2G8V A;  5I3U A;  1U47 A;  4E19 A;  3T3F A;  1VK0 A;  3AVI A;  3KD1 E;  4FVM A;  1A5V A;  4CK1 A;  1VSK A;  1WSH A;  1ZBF A;  3AO4 A;  4O0I A;  3SQ4 A;  2PYL A;  2G8K A;  4JS5 A;  3PX4 A;  3OYA A;  1EX4 A;  1K6Y A;  4XIU A;  3TAG A;  1VRT A;  3TAR A;  1ZYQ A;  3VQ4 A;  3RR7 A;  2BAN A;  4FJI A;  2VG7 A;  1HQE A;  2YHB A;  4FLU A;  3CYM A;  3AA5 X;  4PQU A;  4W5Q A;  3MXI A;  2HVI A;  3VQC A;  4FCY A;  2X6N A;  4FW1 A;  4CIE A;  4W5T A;  2HND A;  4DSJ A;  2IC3 A;  4B9S A;  2XY5 A;  3LP2 A;  5C24 A;  4YFU A;  3L3V A;  1QQC A;  1T05 A;  3AVH A;  1BGX T;  1VSJ A;  2Z1G A;  4C8K A;  3NBP A;  3LPU A;  3IRX A;  2P51 A;  3M8Q A;  2Z1H A;  3KLG A;  3P1G A;  1W9H A;  3SYZ A;  1YTA A;  4B9T A;  5FRN A;  3LZJ A;  1KVA A;  4KHQ A;  5FRM A;  3PO5 A;  1RT4 A;  4OKJ A;  3VQP A;  4DQQ A;  2HHT A;  1XWL A;  2ZQB A;  3HVR A;  3S3M A;  2A1S A;  2NUB A;  3V9U A;  2IDO A;  2RPI A;  4N56 A;  1RNH A;  4J2E A;  4Q5V A;  2D0C A;  4IFY A;  5CY4 A;  2XRI A;  4HUE A;  4BDZ A;  2DFH A;  4IG0 A;  4RG8 A;  1BHL A;  3AA3 A;  1UA0 A;  1FXX A;  4HHT A;  4FM0 A;  4C8N A;  5JS1 A;  4R5P A;  3O4N A;  3V6D A;  4OLA A;  3VQB A;  5CZ2 A;  4DTS A;  1JLA A;  3PV8 A;  3TAQ A;  1S1V A;  3PY8 A;  2XO7 A;  1ZBH A;  4Z0U A;  1DLO A;  2HHX A;  3M8P A;  3THV A;  3L2R A;  4CJ3 A;  4NCA A;  1WAJ A;  4B9U A;  2BGG A;  1ASW A;  1RCH A;  4CK2 A;  3SPY A;  2D0A A;  1NK0 A;  2D0B A;  1CXU A;  3OYH A;  1QSL A;  2OPP A;  3OYB A;  2A1R A;  4FJ5 A;  2HVH A;  4RW9 A;  3T1A A;  4M41 A;  1RDB A;  2G8F A;  3V9Z A;  4EZ9 A;  1C0U A;  1YTU A;  1RTD A;  4AHS A;  4CFC A;  5HRO A;  4FZZ A;  3ZSQ A;  4QAG A;  1RT1 A;  4CEF A;  4DSF A;  4CCH A;  4CJF A;  1KFS A;  3AVG A;  3OS0 A;  1B9F A;  3AVA A;  3KLI A;  3AVF A;  1REV A;  1EET A;  4OKE A;  4DFM A;  4DF8 A;  5J2M A;  4CGI A;  3RMB A;  1UAX A;  2IOC A;  3RMD A;  2P1J A;  3AVB A;  4CF0 A;  1LV5 A;  4FZX C;  1TAU A;  1KLN A;  1SUQ A;  1U48 A;  4RW4 A;  3U6F A;  1IH7 A;  3RMA A;  4DQP A;  3VN5 A;  4CEO A;  4NCB A;  1C0M A;  1NK4 A;  3QES A;  1X9M A;  3U3G A;  2YHA A;  3IAY A;  2DFE A;  3K59 A;  1L3U A;  1SKW A;  3OYJ A;  3SUN A;  2RN2 A;  3MEE A;  1LWE A;  3NF7 A;  4LH5 A;  1ZBU A;  3VQA A;  4DLE A;  4NCG A;  1YT3 A;  4RW8 A;  1JL2 A;  2X78 A;  3OJU A;  4E7I A;  1NJW A;  3BGR A;  4CGG A;  1Q8I A;  1VSH A;  2B4J A;  4ZHR A;  3OYE A;  3V1O A;  4JRQ A;  1S1U A;  4Z4G A;  2AJQ A;  1G15 A;  4CED A;  3SUO A;  1VSD A;  4CIF A;  2KFN A;  4CJ5 A;  4FJL A;  4JS4 A;  3AA4 A;  1RBR A;  3LP0 A;  4DU1 A;  3VQ7 A;  4Z4H A;  4CFB A;  2XY8 A;  4CEE A;  4K8Z A;  1UWB A;  1VSM A;  4CJS A;  3ZSX A;  4C8L A;  3ZSY A;  2F8S A;  2GBZ A;  5SWM A;  5KGW A;  4E7L A;  4M3T A;  2OPR A;  1HRH A;  2PZS A;  4FJX A;  4M3X A;  4E7H A;  2B5J A;  2PYJ A;  3KK2 A;  4L8R B;  1JLE A;  4KI6 A;  3KIO A;  4FJN A;  5KGX A;  3S3N A;  4KB0 A;  1NJX A;  2EHG A;  1RBS A;  2Q3S A;  4CGH A;  4UQG A;  4FM2 A;  3WNH A;  1JXE A;  3O3H A;  4M45 A;  2GV9 A;  2EX3 A;  4DQS A;  4M3Z A;  3OYC A;  3KK3 A;  3L2V A;  4FLZ A;  1U04 A;  4DFK A;  1NK6 A;  1KSP A;  4CEC A;  3L8B A;  3DRS A;  4FW2 A;  4W5O A;  3HYF A;  3L2W A;  2PY5 A;  3KD5 E;  4IKF A;  4LY7 A;  4OLB A;  4FLT A;  2KTQ A;  4I9L A;  1KVC A;  4C8M A;  4ZTJ A;  5J2Q A;  1LW2 A;  1LAV A;  4C8O A;  1WSJ A;  1RDC A;  4KO0 A;  2VG6 A;  1UA1 A;  2HMI A;  4KI4 A;  3ZT0 A;  4FK4 A;  4QCL A;  4FLX A;  3LP1 A;  3OYF A;  3NE6 A;  3DI6 A;  3RWU A;  4KAZ A;  3JYT A;  2BE2 A;  1NOZ A;  1WSE A;  1BQN A;  3QO9 A;  4OPK A;  1R0A A;  1L3S A;  1X1P A;  4DTN A;  4F2R A;  4TSX A;  3L2Q A;  4GVM A;  4CHN A;  3I0R A;  3VQQ A;  4O0J A;  2I5J A;  4CJ4 A;  3D0P A;  3SZ2 A;  3TAE A;  1CXQ A;  3MXM A;  1IKY A;  4CF9 A;  2D5R A;  1QSS A;  3RR8 A;  1SL2 A;  3AO5 A;  4CJW A;  2KQ2 A;  3ZT2 A;  4DQR A;  3SUQ A;  3B6P A;  2FBT A;  4I7F A;  4YNQ A;  1X9S A;  4F3O A;  3ZSO A;  5FDL A;  4Z4C A;  3O3F A;  1HMV A;  1QS4 A;  4BWJ A;  2O4G A;  3VQE A;  4BDP A;  4J2A A;  1BI4 B;  4KB1 A;  4J2D A;  1U4B A;  4FJ9 A;  4QOZ B;  2F96 A;  3E01 A;  4HCB A;  2YKM A;  5CYQ A;  4EP4 A;  4IBN A;  2YV0 X;  4DS5 A;  1C6V A;  3QET A;  4O5B A;  1T03 A;  3DLE A;  4CGF A;  2YNH A;  2WON A;  3IG1 A;  4B8C A;  1BL3 A;  4DSE A;  4ELU A;  3L3U A;  4DSK A;  2XY6 A;  1LW0 A;  4PUO A;  1JLF A;  4FJH A;  4DTX A;  1SL1 A;  2ZE2 A;  1C1A A;  5T7B A;  3OS2 A;  3OY9 A;  4DFJ A;  1NK8 A;  3BDP A;  3HJF A;  5KRT A;  3M8S A;  4M3U A;  5KI6 A;  2OPQ A;  3AA2 A;  3OVN A;  4DFP A;  1IKX A;  3KTQ A;  4KHW A;  3DMJ A;  1WN7 A;  4OPJ A;  1Z25 A;  4DTR A;  1ZBL A;  3NHG A;  3HXM A;  4PY5 A;  3TAB A;  3DRP A;  3HST B;  2G8U A;  2QKB A;  3OYG A;  2B6A A;  3NF8 A;  4Y1C A;  3AVN A;  4CER A;  3I0S A;  3QEI A;  2LSN A;  3OYK A;  4GW6 A;  2KZZ A;  4H4O A;  3DLK A;  4AHC A;  4KRE A;  1UOC A;  4DU4 A;  4DQI A;  1A5X A;  1ITG A;  3SV4 A;  1NKE A;  3U3Y A;  1RBU A;  3EY1 A;  4OGE A;  5FRO A;  4CHP A;  1KFD A;  1X9W A;  1BIZ A;  1GOB A;  1KCF A;  1TV6 A;  4B08 A;  3T19 A;  2W42 A;  2FBY A;  3VQ9 A;  4BE0 A;  4LSN A;  1C1B A;  2RKI A;  1RDA A;  3SQ2 A;  5CYM A;  1YVU A;  4H4M A;  4DWI A;  5KRS A;  2KFZ A;  4CF1 A;  1C0T A;  3AVM A;  4PA1 A;  3CM6 A;  1EXQ A;  3LP3 A;  4HVJ A;  2JLE A;  3NH2 A;  4DTP A;  3MEC A;  3DLH A;  4FK2 A;  4Z4F A;  2DY4 A;  1RT5 A;  1RTJ A;  4BAC A;  1TL3 A;  3OYD A;  1JL1 A;  1RIL A;  4MFB A;  4CHZ A;  3TI0 A;  4DTM A;  3ASM A;  3SQ1 A;  4CF2 A;  1HYS A;  2Z1J A;  3VA0 A;  1TK0 A;  3NF6 A;  3VQ6 A;  2HHW A;  3HVT A;  3WNE A;  5E41 A;  1HPZ A;  3NGZ A;  3K58 A;  1U49 A;  1WLJ A;  3F9K A;  4CF8 A;  2X74 A;  1XHX A;  4CGD A;  3QER A;  1J9A A;  1QSY A;  1RBV A;  3H08 A;  1MU2 A;  2ZD1 A;  4M42 A;  4Y1D A;  5J1E A;  2P5O A;  2HHU A;  1HNV A;  1NK9 A;  3TAP A;  3ZSV A;  1SKR A;  1SKS A;  3NAE A;  1RT6 A;  5CZ1 A;  3WNG A;  3DM2 A;  5KTQ A;  3QNN A;  4F3T A;  3O3G A;  2G8W A;  2IS3 A;  3VQD A;  4LSL A;  1HYV A;  1RT7 A;  1TK5 A;  4KTW A;  3G10 A;  1TAQ A;  1TVR A;  3LPT A;  1HQU A;  4JLH A;  4AH9 A;  4CHO A;  1HNI A;  5EU7 A;  4AHV A;  3SCX A;  3MAQ A;  1KRP A;  1L3T A;  2E6L A;  4W5R A;  3DLG A;  1VRU A;  1B92 A;  3SNN A;  1S6Q A;  5HLF A;  1VSE A;  3HK2 A;  1DTT A;  1TK8 A;  4KTZ A;  1RDD A;  3V1R A;  3WNF A;  4B8A B;  5C42 A;  4FJ8 A;  3NDK A;  3C95 A;  3IS9 A;  4WE1 A;  3K2P A;  1TGO A;  3NCI A;  2HHV A;  4F4K A;  4M3W A;  3HP9 A;  2X6S A;  4W5N A;  1ASU A;  4EP5 A;  2VG5 A;  4DTU A;  1XC9 A;  1D9F A;  3AO2 A;  1RTI A;  4DLG A;  1NKB A;  3RMC A;  3QNO A;  1T7P A;  1KTQ A;  3V81 A;  4PWD A;  1IG9 A;  3C94 A;  2XHB A;  4KHY A;  4E0D A;  4F2S A;  3JSM A;  2Y1I A;  4GMJ B;  2YNF A;  3QLH A;  4KRF A;  3HL8 A;  2OPS A;  1SV5 A;  4CEZ A;  3CFO A;  4LH4 A;  3NH0 A;  3CM5 A;  5JS2 A;  3PX6 A; 
#chains in the Genus database with same CATH topology
 3ULD A;  3IUC A;  1CZ9 A;  4CGJ A;  1TKX A;  2AA4 A;  1WOQ A;  4NLB A;  4AM6 A;  4C1N I;  3SI6 A;  1QQO A;  2OYQ A;  1L5U A;  5AQI A;  4FK0 A;  1K8K B;  4ELT A;  1HYZ A;  3V4I A;  4HTU A;  3R1X A;  4CZL A;  3SK3 A;  1ZBI A;  2WC9 A;  3QEP A;  2O8F A;  3ZT4 A;  5AQJ A;  2QWL A;  3RRG A;  1ZC6 A;  2Y1J A;  2AP1 A;  2QXF A;  1MWM A;  1YIJ N;  1YAG A;  4YOR A;  3P5J A;  1VQ4 N;  2CH6 A;  1BUP A;  5AQK A;  3MCP A;  3O5B A;  5AQV A;  3F73 A;  1BA1 A;  1D9D A;  3EE9 A;  3A5L C;  3LM9 A;  3U9D A;  4FWR A;  3TSP A;  1I3A A;  4HUG A;  1ASV A;  1NK7 A;  4B9V A;  2O4I A;  2YNI A;  1VAZ A;  2KW4 A;  1LWF A;  3KKS A;  4DG1 A;  5C15 A;  2CGL A;  5FPE A;  3NGY A;  4KHU A;  3VF4 A;  3CC7 N;  3DRR A;  1J5E K;  3GL1 A;  2UXD K;  2E5L K;  3LAN A;  5C12 A;  4N5S A;  3BZC A;  1Q7Y O;  3QFU A;  1MA9 B;  3RTV A;  2QTD A;  3CQ8 A;  1ATR A;  3FR0 A;  3LDP A;  3PIO L;  1WSF A;  1FKP A;  4CHQ A;  2HHQ A;  4JD2 A;  1NGF A;  2FF3 B;  2HOE A;  4K42 A;  2IIR A;  3UIQ A;  1YHQ N;  4A62 A;  3QEW A;  3O9U A;  4FJ7 A;  4FLW A;  1OKJ A;  4YOT A;  4CJL A;  1NOY A;  5LL6 Z;  3KK1 A;  3IFR A;  4JI0 K;  2D1K A;  2PBD A;  4YOY A;  4ID1 A;  5EXW A;  2G8I A;  1HJR A;  4BQZ A;  3LWL A;  4BC4 A;  4IOC L;  5AQO A;  4BR2 A;  2Q97 A;  4NLC A;  3LDS A;  1W7A A;  1L3V A;  5AQT A;  3QIP A;  3ENO A;  5KPZ A;  4OJR A;  1OVY A;  1N5Y A;  1I39 A;  5M1O A;  4Q0B A;  3KJV A;  4CZG A;  2D0P A;  5HRR A;  2Q1N A;  4DHY A;  1WB9 A;  4DR5 K;  4FLY A;  1IO2 A;  3LAK A;  1IKV A;  4E89 A;  3S9H A;  5ELZ A;  1S6P A;  4ID5 A;  2P9K B;  3I8B A;  1QVG M;  1Z26 A;  3CCV N;  3ZEU B;  1EKE A;  1XNQ K;  3A5M C;  4N76 A;  1DKG D;  3HI0 A;  1ILY A;  3HSC A;  2E6M A;  2P5G A;  3AVL A;  4CE9 A;  1QZ6 A;  1J53 A;  3TAN A;  3RSE A;  3WXK A;  4DQ8 A;  4KV8 A;  4H5N A;  1JLG A;  4IG3 A;  4NB4 A;  1Q82 O;  1U47 A;  2ASP A;  4CK1 A;  4IDH A;  3SQ4 A;  3CJ1 A;  3KK7 A;  3MX2 A;  2E2P A;  4WF9 L;  1S72 N;  3PX4 A;  3VEO A;  1ZYQ A;  4KHP K;  3VQ4 A;  5AQY A;  3OBY A;  1HQE A;  4MDB A;  2YHB A;  3MX5 A;  3CYM A;  5AQX A;  1NGD A;  2HVI A;  2X6N A;  3I56 N;  4W5T A;  4DSJ A;  4B9S A;  3P39 A;  3L3V A;  3IKM A;  1T05 A;  3UKR A;  4C8K A;  3G6E N;  1W2B M;  3LPU A;  4YDU C;  3WQU A;  3KLG A;  2YI1 A;  3A8Y A;  2ZQB A;  5LJW A;  4YOX A;  3HOT A;  3BUZ B;  3CER A;  1NGE A;  1BA0 A;  4BC2 A;  3V9U A;  2IDO A;  3I55 N;  4N56 A;  3KVG A;  2D0C A;  4Q5V A;  2XRI A;  4OLA A;  3PY8 A;  3VMF B;  1VQP N;  3GDQ A;  4O8U A;  2BGG A;  3P38 A;  5AQQ A;  4CK2 A;  3SPY A;  1NGB A;  1RDW X;  5F1X A;  4FJ5 A;  3WT0 A;  3T1A A;  3VTI A;  1RDB A;  3K9J A;  3VOV A;  1NG9 A;  3A5N C;  2HBK A;  4B1Y B;  1YTU A;  3ZSQ A;  4QAG A;  1RT1 A;  4CEF A;  2QEX N;  2FSN A;  1QZ5 A;  3OS0 A;  1B9F A;  5JMV A;  4DFM A;  4DF8 A;  3SLC A;  4CGI A;  3FLC O;  1NGG A;  3AVB A;  3CI5 A;  4CF0 A;  5CHI A;  5GAD P;  4MLE A;  2V7Z A;  3QES A;  3DLL L;  3K59 A;  2OAN A;  3WQT A;  2QM1 A;  3NF7 A;  2O8E B;  3CCJ N;  4B3T K;  1X9J A;  1C0G A;  1GLJ O;  4E7I A;  4M63 C;  3E9L A;  1Q8I A;  3V1O A;  1S1U A;  2KLA A;  2NZT A;  4DV6 K;  3O6W A;  1VSD A;  2KFN A;  4CJ5 A;  3VEV A;  3CCM N;  3AA4 A;  1RBR A;  3RVC A;  2HF3 A;  4Z4H A;  4CFB A;  3B8A X;  4K8Z A;  1UWB A;  1VSM A;  4JEP A;  4FWM A;  3ZSX A;  2F8S A;  3ZSY A;  1TYQ A;  5SWM A;  3J7Y P;  4M3T A;  4M3X A;  3THX B;  4FJX A;  4E7H A;  1V4T A;  1JLE A;  4FJN A;  5AQZ A;  4B1V A;  1RBS A;  4UQG A;  4M7Y A;  3O3H A;  3EKS A;  3OYC A;  4MDA A;  4FLZ A;  4EAH D;  3ATV A;  3L8B A;  4FW2 A;  4JK7 A;  3HYF A;  4OLB A;  1ESV A;  3H45 C;  1LW2 A;  4A2B A;  1UA1 A;  4KI4 A;  1DGK N;  4DUY K;  4FLX A;  3C7N B;  4B3S K;  5AFU H;  1XC3 A;  4PKH A;  2HST A;  4FWQ A;  4F2R A;  4CBX A;  1CZA N;  4IJN A;  2I5J A;  4CD1 A;  4K43 A;  3AO5 A;  4DQR A;  4F3O A;  2FBT A;  1X9S A;  3ZSO A;  3O3F A;  3VQE A;  1T6C A;  4KB1 A;  2NRH A;  4LF7 K;  2YV0 X;  4DS5 A;  1C6V A;  3DLE A;  4CGF A;  1ZBS A;  4DSE A;  2UXC K;  3O1B A;  1SL1 A;  4U7B A;  3AY9 A;  5T7B A;  1NK8 A;  4WQ5 A;  3AA2 A;  4JK9 A;  3NHG A;  2IVO A;  4OPH A;  3OYG A;  3LDL A;  2B6A A;  4ILH A;  4CER A;  1N36 K;  5BRF A;  3OYK A;  2V51 B;  3DLK A;  4AHC A;  4DQI A;  1K8K A;  2QWM A;  1NKE A;  3U3Y A;  1RBU A;  5FPN A;  1BIZ A;  1SQK A;  1TV6 A;  3H1V X;  2W42 A;  1HPM A;  5TKY A;  5C2D A;  4FOE A;  4G9Z A;  3SQ2 A;  1BG3 A;  5BPN A;  3ZLJ A;  2WFB A;  4CF1 A;  3ZX2 A;  3D2E A;  1EXQ A;  1NU0 A;  2JLE A;  3MEC A;  2DY4 A;  1RT5 A;  4BAC A;  3OYD A;  1RIL A;  3VES A;  3W0L A;  4JHD B;  4CZJ A;  4CF2 A;  3D2E B;  3NF6 A;  3ZYY X;  1OH6 A;  5E41 A;  3WNE A;  1K73 O;  5AR0 A;  1U49 A;  2QWQ A;  2HBL A;  3S41 A;  1KD1 O;  4CD3 A;  3C6H A;  4BR0 A;  4OX9 K;  4B9Q A;  5KTQ A;  4H0Y B;  4F3T A;  4FWS A;  3QNN A;  3FZL A;  1HYV A;  1TK5 A;  3G10 A;  1HQU A;  4JLH A;  5M1N A;  4CHO A;  3FZF A;  5EU7 A;  1L3T A;  4W5R A;  3SNN A;  5HLF A;  3HK2 A;  3WXJ A;  1QQN A;  3WNF A;  3QFP A;  3UE5 A;  3IS9 A;  3EKU A;  5I9E B;  5BR9 A;  1N33 K;  1TGO A;  2O8E A;  3IDH A;  4W5N A;  2VG5 A;  4DTU A;  4DLG A;  3QNO A;  3SBG A;  1IG9 A;  4DV0 K;  2A42 A;  3VEY A;  2OTJ N;  4LH4 A;  3CM5 A;  5GAH P;  1NJY A;  1WAF A;  3I33 A;  2UUB K;  5DMR A;  5AQS A;  1LWC A;  4I2P A;  4Z94 A;  3LZI A;  3SQ0 A;  1WUA A;  1Q9Y A;  3A2F A;  1HKG A;  3VTH A;  1JKH A;  2P9L A;  1S5J A;  3NMU A;  3O08 A;  5BN9 A;  3T69 A;  1BCO A;  3MN9 A;  4HWI A;  4KHN A;  1D5A A;  1BIU A;  3KLH A;  3CXC M;  4M3R A;  4IFV A;  3OJS A;  4X66 K;  3CFR A;  4IEI A;  2YKN A;  3TAM A;  4B9N A;  1LAW A;  4DV3 K;  3MK6 A;  4KTQ A;  4LF4 K;  1KC8 O;  3EYZ A;  4FO0 A;  4X62 K;  2W6L A;  2ZF5 O;  4O55 A;  3TWH A;  4FXD A;  1C0F A;  3VGL A;  5M1Q A;  2A6A A;  3WXM B;  1B9D A;  1RFQ A;  5M1P A;  1WSI A;  3H1Q A;  3CPE A;  4AHU A;  4F8R A;  3RSE B;  3UB5 A;  1N34 K;  3CFP A;  1QTM A;  4DS4 A;  5AQL A;  5J2P A;  3F2K A;  3MED A;  4MQ3 A;  4OKK A;  2ITM A;  4CJU A;  4LD0 A;  4CJR A;  3QEX A;  5AQU A;  5HBM A;  1VSF A;  2IAJ A;  3HP6 A;  1XI1 A;  5E26 A;  3M8R A;  4Z4I A;  2W40 A;  3CG7 A;  3PO4 A;  4CES A;  4AQY K;  2E88 A;  2P9S A;  3D2F B;  1MWK A;  1WNS A;  2NRW A;  5A2Q O;  4XEI A;  3WUH A;  3DLB A;  4RW6 A;  1FKO A;  2ATQ A;  3V9W A;  3VA3 A;  3Q7C A;  1KAX A;  3MXJ A;  4O8K A;  4CJK A;  3K5L A;  4E7J A;  1KLM A;  5BRH A;  3HPH A;  3R6M A;  2QKK A;  2NNW A;  4IOA L;  3KKR A;  4LFA K;  1BIS A;  2YJE A;  3MEG A;  2YNG A;  2OZS A;  1NKC A;  4XH5 A;  4KFB A;  3HT3 A;  3TPQ A;  2VWJ A;  3C6U A;  1N6Q A;  2HHS A;  4CJT A;  4O44 A;  4FJG A;  1KVB A;  3F5T A;  4JNE A;  3ZSR A;  3AO1 A;  1O13 A;  3E9P A;  2HNZ A;  3LDN A;  4M3Y A;  3ZX0 A;  2YJF A;  4NYN A;  1WSG A;  3KZB A;  2YHW A;  1QHA A;  2XY7 A;  4GVE A;  5JLH A;  2GUI A;  3AV9 A;  4CIG A;  4N41 A;  3OYM A;  4CZE A;  1Y64 A;  3AGK A;  4CK3 A;  1NJZ A;  4ZTF A;  3NF9 A;  2Q0U A;  5D3G A;  5FPM A;  4K8X A;  3EL2 A;  3SJJ A;  2VYP A;  1RBT A;  5KQD A;  3OYI A;  4KH5 A;  3W3D A;  1GOC A;  3SUP A;  3AVC A;  4BRQ A;  2RF2 A;  1X3N A;  3JS6 A;  1XQS C;  1QE1 A;  4CJP A;  1RT3 A;  1RT2 A;  2HHH K;  2YCH A;  3C6T A;  1I94 K;  2G8V A;  4E19 A;  3T3F A;  3VGK A;  1A5V A;  4O0I A;  1WSH A;  2PYL A;  3AO4 A;  3VF2 A;  4IO8 A;  4QS8 A;  3E66 A;  2BAN A;  4JN4 A;  5KPR A;  4BG8 A;  5AQW A;  1E4G T;  1HNW K;  4GV9 A;  3CCS N;  2PAV A;  3LP2 A;  5C24 A;  4YFU A;  1E4F T;  3AVH A;  2VWB A;  2ZJR L;  3MMV A;  3NBP A;  2P51 A;  2W41 A;  4BRI A;  1YTA A;  3P4I A;  1R59 O;  1KVA A;  4KHQ A;  4OKJ A;  3VQP A;  4UY8 O;  3HVR A;  4BVO A;  2F7T A;  2NUB A;  4J2E A;  2Q36 A;  5CY4 A;  4HUE A;  1BHL A;  3DXM B;  3AA3 A;  4R5P A;  3O4N A;  3VQB A;  5BPL A;  3OW2 M;  4H5W A;  3DAW A;  4B9U A;  1GLB G;  5ADX H;  4JD2 B;  1CXU A;  3OYH A;  4FWL A;  2QWP A;  1S3X A;  4RW9 A;  4M41 A;  1C0U A;  4FWO A;  2VGN A;  2E1Y A;  4BRE A;  3PIP L;  3DWL A;  4CCH A;  1BDG A;  1YJW N;  1REV A;  4OKE A;  5J2M A;  4OO1 J;  4CZF A;  3RMB A;  1UAX A;  2P1J A;  4JI6 K;  4FZX C;  4BR7 A;  3U6F A;  1IH7 A;  4ILG B;  1NJI O;  2P9I B;  4CEO A;  4DQP A;  1NK4 A;  4DV5 K;  1HNZ K;  3CD6 N;  1SKW A;  5TKW A;  2RN2 A;  1LWE A;  4CBW A;  1NGJ A;  4BRF A;  4DLE A;  4BRL A;  4CJ7 A;  4A5A A;  4RW8 A;  3DXK A;  2X78 A;  3N4P A;  3BGR A;  3D2F A;  4Z4G A;  2AJQ A;  2NRV A;  4CED A;  3C0B A;  3BZK A;  4JS4 A;  4YDU A;  4WFN L;  2NRZ A;  4BRH A;  3QBX A;  4CEE A;  4B3R K;  1LOT B;  4C8L A;  2GBZ A;  3M6G A;  3QB0 A;  3O1W A;  4H5V A;  4E7L A;  3TU5 A;  2PYJ A;  4L8R B;  4KI6 A;  3KIO A;  3O9S A;  2DPN A;  2EHG A;  3K0S A;  1GLF O;  1HUX A;  2Q31 A;  3WNH A;  5F0X A;  2JWL A;  2GV9 A;  2EX3 A;  4JI3 K;  3ZX3 A;  3L2V A;  3MDQ A;  4DFK A;  1U04 A;  4IFE A;  5EOY A;  3DRS A;  1GLL O;  3KHY A;  3J7A P;  4FL9 A;  4LY7 A;  4IKF A;  4RTF D;  4EIA A;  4I9L A;  4C8M A;  1OH7 A;  1WSJ A;  2HMI A;  3R8E A;  3ZT0 A;  4DR3 K;  5AZJ B;  3LP1 A;  4KAZ A;  3JYT A;  1WSE A;  3VEZ A;  1NGI A;  1R0A A;  4CBU A;  1XMQ K;  1X1P A;  3CQX A;  1YXQ A;  4GVM A;  3VQQ A;  4O0J A;  4CJ4 A;  2O8B A;  3MXM A;  2D5R A;  3RR8 A;  4J2A A;  4BDP A;  1QS4 A;  3E01 A;  1IBL K;  3E1Y A;  3QET A;  3EZW A;  2WON A;  4B8C A;  2P9U B;  1GLA G;  4FJH A;  1KQS M;  1C1A A;  4DFJ A;  3BDP A;  5KRT A;  3LDQ A;  5KI6 A;  4DFP A;  4KHW A;  1IKX A;  3DMJ A;  1WN7 A;  1Q86 O;  4PY5 A;  3CC2 N;  3DRP A;  3HST B;  2QKB A;  4CZM A;  4Y1C A;  4BRN A;  4BRC A;  1UOC A;  4CW7 B;  1OVQ A;  4JKC A;  1A5X A;  1ITG A;  3CIP A;  3SV4 A;  2W6K A;  4A57 A;  3JAM O;  5JIC A;  4OGE A;  4BRG A;  1KFD A;  1GOB A;  3T19 A;  2FBY A;  3R3L A;  2RKI A;  4CI6 A;  1RDA A;  5KRS A;  1C0T A;  3CM6 A;  4HVJ A;  4PHT X;  4FK2 A;  4MFB A;  2KHO A;  3WEE B;  3SQ1 A;  2Z1J A;  2HHW A;  1HPZ A;  4LC9 B;  1WLJ A;  1J9A A;  1RBV A;  3H08 A;  1MU2 A;  4H0V B;  4M42 A;  4Y1D A;  3JXU A;  4C1N K;  5E84 A;  3EEQ A;  3ZSV A;  1SKR A;  3ID6 A;  2F4V K;  1SKS A;  5CZ1 A;  3DM2 A;  2ASO A;  2IS3 A;  1V4S A;  3QML A;  3VEN A;  4QS9 A;  5LMU K;  4AH9 A;  2VQE K;  4AHV A;  3MAQ A;  3DLG A;  1B92 A;  4ISG A;  1VSE A;  1DTT A;  1RDD A;  4MO4 A;  5EVZ A;  4O5F A;  3BF3 A;  2RHK A;  2Q0R A;  4EFH A;  1H1V A;  3CJA A;  3MN6 A;  4J8F A;  3HP9 A;  2X6S A;  3C7N A;  4V19 S;  3TTD A;  1VQO N;  1T7P A;  4PWD A;  3NVM A;  2WUS A;  2XHB A;  2P9N B;  2Y1I A;  1SV5 A;  4CEZ A;  3CFO A;  1K9M O;  3PX6 A;  4DTJ A;  5JLF A;  4CHY A;  4FWP A;  3K5O A;  3SAF A;  3LM2 A;  1YJN N;  4NO7 A;  3DOL A;  3ZCM A;  5C25 A;  1W97 L;  3K5M A;  2YHX A;  5GIP A;  3O4Q A;  4JI8 K;  4FM1 A;  1CZB A;  2FLO A;  3MCA B;  4ICL A;  3DXM A;  5BRE A;  3QIO A;  4DU3 A;  4YOW A;  3CCE N;  2GEL A;  4JRP A;  1SL0 A;  5HRN A;  4CFA A;  4Z4E A;  3U8X A;  4WCE L;  3AAQ A;  4E1J A;  1YUW A;  3SV3 A;  3ZT3 A;  2OCE A;  3DOK A;  4DMN A;  2FBV A;  4CJE A;  2GWK A;  3M3Z A;  3ISN C;  2ETJ A;  2RE2 A;  2JGU A;  4DUZ K;  1JLQ A;  2YHY A;  1XHZ A;  4RW7 A;  4I2Q A;  2OZM A;  1J54 A;  2IVN A;  4CJQ A;  5C2F A;  1WBD A;  5I42 A;  4B3M K;  4E1N A;  2VQF K;  3L6Q A;  4E7K A;  2P9P B;  2UYT A;  3DLR A;  3CPW M;  3I8D A;  2IVP A;  4KKO A;  1IKW A;  3G4S N;  4G1Q A;  5KQ8 A;  3M5R A;  3K5N A;  4CEA A;  4DTO A;  4FSV A;  1BI4 A;  3V9S A;  2A40 A;  3CJ7 A;  1J6Z A;  2R7Y A;  2KZM A;  3WXL A;  4DR2 K;  4BRM A;  2FSJ A;  3QEV A;  4JKG A;  4DCH A;  4WFB L;  4DR4 K;  1O1W A;  4B1X B;  3CET A;  5HL7 L;  4NYF A;  5SZT A;  4CEQ A;  4KHS A;  4JKG B;  3RRH A;  3J80 O;  1S1X A;  1TUU A;  3DYA A;  4CVN E;  4BE2 A;  3AVK A;  4DR6 K;  3TSU A;  4JKH A;  4WQ5 C;  4FJM A;  1FJG K;  3PSF A;  2E20 A;  4H0O A;  3HBT A;  3ZEU A;  1GLE G;  4N47 A;  2O8D A;  4GKK K;  4FYD A;  1YJ9 N;  3ATU A;  4FOI A;  2HNY A;  4AHR A;  5AZI B;  4XH1 A;  4I9Q A;  2UU9 K;  4IOX A;  4J2B A;  3T1Y K;  2HB5 A;  5FLX O;  3HPO A;  3KLE A;  1IJJ A;  2FC0 A;  3MN5 A;  1QHT A;  3OS1 A;  3EZ5 A;  1TKD A;  4OGC A;  1RTH A;  1IBM K;  1GOA A;  2OA8 A;  3R9P A;  1TKZ A;  3P31 A;  4BGB A;  2HW3 A;  3NGI A;  5KPT A;  5JVH L;  3NH1 A;  3PX0 A;  4CJV A;  4B3O A;  4B9M A;  2WOM A;  4LFB K;  3KLF A;  3AO3 A;  1HLU A;  1S1T A;  3UKR B;  4JAX A;  3WXI A;  3HO1 A;  5GAG P;  1BQM A;  4LF6 K;  4BRA A;  2P9I A;  2G8H A;  3TAF A;  4QS7 A;  3OHR A;  4A5B A;  4FJJ A;  3ZSZ A;  2QK9 A;  5I3U A;  3AVI A;  1EQY A;  1KXP A;  4X64 K;  4I6M A;  2G8K A;  4H0T B;  1K6Y A;  5AJ3 K;  3RR7 A;  4BRP A;  4FLU A;  4W5Q A;  4GNI A;  2E2Q A;  4FCY A;  5LMN K;  3ULE A;  4A2A A;  1JJ2 M;  3TTF A;  2V7Y A;  1VSJ A;  2Z1G A;  3M8Q A;  2Z1H A;  3P1G A;  1P8Z A;  1W9H A;  1N32 K;  4M7X A;  3SYZ A;  3LZJ A;  4L3Q A;  1RT4 A;  3PO5 A;  2HHT A;  2P9L B;  2QWR A;  2RPI A;  2D0O A;  2A5X A;  2DFH A;  3E9O A;  4MLH A;  4CZK A;  1UA0 A;  4PKI A;  3ZET A;  4FM0 A;  3THY A;  3V6D A;  3GOI A;  5CZ2 A;  4DTS A;  3PV8 A;  2QI2 A;  3TAQ A;  2XO7 A;  1DLO A;  2HHX A;  3M8P A;  3THV A;  4PL7 A;  3L2R A;  4CJ3 A;  1VQ8 N;  1VQ7 N;  4NCA A;  3GBT A;  1RCH A;  2ASM A;  2D0B A;  4BC5 A;  1SS6 A;  1QSL A;  2OPP A;  4GY2 B;  3OYB A;  2E1Z A;  5LJV A;  2HMP A;  2G8F A;  3J7Z O;  4EZ9 A;  1BU6 O;  4FZZ A;  4AHS A;  4CFC A;  5HRO A;  1TYQ B;  2BTF A;  4DSF A;  4CJF A;  3CF5 L;  3AVG A;  3KLI A;  4BVP A;  3AVF A;  4BRK A;  3FZH A;  4IXC A;  4K0K K;  1LV5 A;  4DV7 K;  1SUQ A;  2O8F B;  3SAH A;  1U48 A;  4RW4 A;  3BEX A;  3VN5 A;  4NCB A;  1NWK A;  1C0M A;  4DV1 K;  2YHA A;  1JCE A;  3IAY A;  3T7Z A;  3AGR A;  4LH5 A;  3VQA A;  4NCG A;  1FW6 A;  3GE1 A;  1RDU A;  3OYE A;  2B4J A;  4ZHR A;  1G15 A;  4MO5 A;  4CIF A;  5FPD A;  1GLC G;  3BP8 A;  4DU1 A;  3VQ7 A;  2VGM A;  2GWJ A;  4XH4 A;  4A61 A;  3KWG A;  2OPR A;  1HRH A;  4DR1 K;  2B5J A;  2UXB K;  5KGX A;  3S3N A;  4KB0 A;  2O8D B;  3TSQ A;  2QXL A;  2Q3S A;  3O9R A;  4CGH A;  4FM2 A;  1JXE A;  5BN8 A;  4M45 A;  2CH5 A;  5H1S Q;  4DQS A;  4M3Z A;  3KK3 A;  1KSP A;  1NK6 A;  3KD5 E;  3CHW A;  3L2W A;  2PY5 A;  3CQY A;  4H0P A;  2KTQ A;  4ZTJ A;  2P9U A;  5JVG L;  3ZET B;  1LAV A;  1OH5 A;  3H46 O;  1YF5 L;  1RDC A;  2VG6 A;  3J8A A;  4DB3 A;  3NE6 A;  2EWS A;  3DI6 A;  3RWU A;  1BQN A;  2UUC K;  3QO9 A;  2VCP A;  5AQP A;  4DTN A;  2HBJ A;  1ATN A;  4CHN A;  3D0P A;  3SZ2 A;  3C6A A;  1IKY A;  4CJW A;  2KQ2 A;  5EX5 A;  3ZT2 A;  4YNQ A;  4BR4 A;  5FDL A;  4Z4C A;  1HMV A;  4BWJ A;  2O4G A;  3VET A;  2GUP A;  1BI4 B;  4FJ9 A;  1U4B A;  2F96 A;  4HCB A;  4O5B A;  1T03 A;  2HBM A;  3G71 N;  3IG1 A;  1HX1 A;  3K9K A;  3L3U A;  4YY3 K;  1LW0 A;  1EWR A;  1JLF A;  4JHD A;  4DTX A;  4BC3 A;  4JKA A;  2ZE2 A;  3OS2 A;  3OY9 A;  1M90 O;  3QBW A;  3M8S A;  3KTQ A;  2OPQ A;  3MWP A;  1SZ2 A;  1EO1 A;  4OPJ A;  4DTR A;  3QDK A;  1HKB A;  2J4R A;  1NGH A;  4LF8 K;  3NF8 A;  3UKU B;  3AVN A;  3I0S A;  3QEI A;  2LSN A;  4EHU A;  3G25 A;  3CJC A;  3VEW A;  2KZZ A;  4KRE A;  3O8M A;  4DU4 A;  1EWQ A;  4H5T A;  4DR7 K;  1NMD A;  4NXN K;  1KCF A;  4B08 A;  3VQ9 A;  3L4I A;  2YX6 A;  4BGA A;  4BR5 A;  4DWI A;  1YVU A;  4H4M A;  2ZJP L;  3LP3 A;  3OBW A;  4PKG A;  5C0Y A;  3VGM A;  3NH2 A;  4Z4F A;  5IT9 O;  4CHZ A;  3TI0 A;  3ASM A;  3J81 O;  1HYS A;  3VA0 A;  2OTL N;  2GX9 A;  3HVT A;  3SJH A;  2Q2R A;  3F9K A;  4CF8 A;  5BPM A;  1XHX A;  4CGD A;  3TTC A;  1VQ9 N;  3EO3 A;  5J1E A;  1N8R O;  2HHU A;  1NK9 A;  4LF9 K;  3TAP A;  2O8C A;  4FVU A;  1P90 A;  3NAE A;  3WNG A;  2A41 A;  3O3G A;  5AQF A;  4IO9 L;  2G8W A;  4LSL A;  1TVR A;  1M1K O;  5C10 A;  1IV0 A;  4B1Z A;  1HNI A;  5BR8 K;  5CE3 A;  2E6L A;  4IWV A;  1S6Q A;  4KTZ A;  2NRX A;  3V1R A;  2A3Z A;  4B8A B;  4FJ8 A;  3NDK A;  5LY3 A;  3K2P A;  2HHV A;  1VQK N;  1Q18 A;  1ASU A;  3BY5 A;  4EP5 A;  1D9F A;  3AO2 A;  1RTI A;  1YI2 N;  1NBW A;  3RMC A;  1KTQ A;  3V81 A;  3C94 A;  4K41 A;  4F2S A;  3FE1 A;  1XUP O;  4GMJ B;  2YNF A;  3QLH A;  2ZM6 K;  3HL8 A;  4X65 K;  1VQ6 N;  1JCF A;  4KH6 A;  4ELV A;  4OPA A;  5HP1 A;  1J5O A;  1T8E A;  1U2V B;  4JKB A;  1CLQ A;  3D45 A;  3V9X A;  3AAP A;  1S9G A;  4IDK A;  4IZ9 A;  5BRD A;  4OVL A;  1SAZ A;  1IG8 A;  3THW A;  1VQL N;  4HUF A;  4U67 L;  2QWN A;  2ITG A;  3ALY A;  5GIO A;  2FXU A;  3IMX A;  3ZT1 A;  1KAZ A;  4E3S A;  2NRT A;  3THW B;  3CMA N;  3SPZ A;  3P83 D;  4BDY A;  3OYL A;  3HPG A;  5J2N A;  4BE1 A;  1NNE A;  1E3M A;  3LAM A;  3CCQ N;  1NGA A;  3HOS A;  1W0H A;  4RCH A;  1IBK K;  2VWK A;  3K57 A;  2FBX A;  3HTV A;  3L4Q A;  2Z1I A;  1S1W A;  3VQ8 A;  4YOU A;  3VQ5 A;  1XNR K;  4KPY A;  1Y97 A;  4FLV A;  4DKW A;  2F8T A;  2BUP A;  3O4W A;  4JKE A;  3AVJ A;  5MLC Q;  2O8C B;  4JI1 K;  1S9E A;  2ZGY A;  4CFD A;  4JV5 K;  3B6O A;  1TL1 A;  1TKT A;  1YVN A;  2DTU A;  5HRP A;  4JI5 K;  2DFF A;  2P9P A;  4YHH K;  1HJO A;  1VSI A;  4FWK A;  4H03 B;  3A5O C;  4JI2 K;  3EN9 A;  3LWM A;  1EP4 A;  1DEJ A;  2H3G X;  4B9L A;  1WBB A;  3S3O A;  3LAL A;  3HM9 A;  1D4X A;  4H8K A;  3NVK A;  2FSK A;  4DF4 A;  4BR9 A;  2BH1 A;  2NLX A;  3L2U A;  1Q9X A;  4FJK A;  3ITH A;  3PLA A;  1BWF O;  3FZM A;  4HTL A;  4K25 A;  2JWK A;  3FFI A;  2PFU A;  4R79 A;  3THX A;  1JLC A;  3VF6 A;  2ZGZ A;  4AHT A;  4E1M A;  1DTQ A;  1JLB A;  4AIL C;  1T6D A;  5DK5 A;  2BDP A;  4H0X B;  3OYN A;  3CME N;  3N4Q A;  3QIN A;  1D8Y A;  4C23 A;  4BWM A;  3WEE A;  4EZ6 A;  3H3O B;  1Q81 O;  4HCC A;  3G0Z A;  5B8H A;  1F21 A;  1NMN A;  3F9M A;  4O4G A;  4FWN A;  5K14 A;  3ZSW A;  4GKJ K;  4IEE A;  1NK5 A;  1JXB A;  4FZY A;  1BCM A;  3SMP A;  3O9T A;  3FFK B;  1C1C A;  1G99 A;  2KKZ A;  3NFA A;  4AF1 A;  1YIT N;  4DSL A;  2E4L A;  1A5W A;  4BRO A;  3ULE B;  3TR8 A;  3U9Z A;  1VSL A;  2IGI A;  1U45 A;  2FF6 A;  2I7N A;  1FK9 A;  4DSI A;  3CCU N;  4ISF A;  3PUF A;  4CEB A;  4A59 A;  2QW9 A;  3V1Q A;  1Z05 A;  5HRS A;  1VK0 A;  3KD1 E;  4FVM A;  5M1F A;  1VSK A;  2QWO A;  1ZBF A;  4BY9 C;  4JS5 A;  3THY B;  3OYA A;  1EX4 A;  4XIU A;  3TAG A;  1JCG A;  1VRT A;  3TAR A;  4ILJ A;  4BQL A;  3FGU A;  4FJI A;  3O9Q A;  2VG7 A;  4BG9 A;  3AA5 X;  4PQU A;  2P9N A;  3MXI A;  3VQC A;  4FW1 A;  4CIE A;  2HND A;  2IC3 A;  1BO5 O;  2XY5 A;  4CZH A;  1QQC A;  1TUY A;  3LL3 A;  1BGX T;  1U6Z A;  1HKC A;  3IRX A;  3ENH A;  5ADX A;  4F9O A;  3HM8 A;  3ENB A;  4B9T A;  5CR4 A;  5FRN A;  5FRM A;  3OA9 A;  1NM1 A;  3O80 A;  1XMO K;  4Y0W A;  4DQQ A;  1XWL A;  3S3M A;  2A1S A;  1RNH A;  3H3N O;  4IFY A;  4BDZ A;  3HZ6 A;  4IG0 A;  5AQG A;  2P9S B;  3GG4 A;  4RG8 A;  5JS1 A;  1FXX A;  4HHT A;  4C8N A;  2F9W A;  1DT9 A;  1JLA A;  3DJC A;  1S1V A;  1ZBH A;  4Z0U A;  4LFC K;  3ID8 A;  3CJ9 A;  1WAJ A;  1ASW A;  2GTD A;  2D0A A;  4BRD A;  1NK0 A;  1LCU A;  1T3V A;  2A1R A;  2HVH A;  2UUA K;  3V9Z A;  1RTD A;  3VER A;  1BOT O;  5AQN A;  1KFS A;  3AVA A;  2V52 B;  4JK8 A;  5F2R A;  5AZI A;  1EET A;  2IOC A;  2P9K A;  3RMD A;  4DV2 K;  1NGC A;  3CJB A;  3SAG A;  1TAU A;  1KLN A;  2WTU A;  3RMA A;  5EY4 A;  4GV3 A;  1X9M A;  3U3G A;  2DFE A;  1L3U A;  3D6R A;  1KAY A;  3OYJ A;  3SUN A;  3MEE A;  1ZBU A;  5AQR A;  1YT3 A;  1JL2 A;  3OJU A;  1NJW A;  1Z6R A;  1NLV A;  4CGG A;  1VSH A;  4NXM K;  5AZJ A;  4JRQ A;  1VHX A;  4JYA K;  2QA4 N;  3SUO A;  2ZJQ L;  4FJL A;  3HRG A;  4LF5 K;  4B1W B;  3LP0 A;  2XY8 A;  4CJS A;  4AM7 A;  4DV4 K;  1GLD G;  5KGW A;  2PZS A;  5AFU A;  1VQN N;  4CZI A;  3KK2 A;  3D7E O;  5DM7 L;  1NJX A;  1VQM N;  2F9T A;  4I6M B;  3A0I X;  3SBT A;  4WQ4 A;  4CEC A;  4W5O A;  4FLT A;  2I7P A;  2CGK A;  3MWT A;  1KVC A;  3EE8 A;  5J2Q A;  5M1K A;  5GAE P;  4C8O A;  1S22 A;  4KO0 A;  4QCL A;  5GIN A;  4FK4 A;  3OYF A;  2BE2 A;  1NOZ A;  4EHT A;  4FPB A;  4OPK A;  1L3S A;  3QIC A;  1VQ5 N;  4TSX A;  3L2Q A;  3I0R A;  3PSI A;  3TAE A;  4H5R A;  1CXQ A;  4CF9 A;  1QSS A;  1SL2 A;  3SUQ A;  3BF1 A;  3B6P A;  4I7F A;  3M1F A;  3FZK A;  4FPA A;  3VEX A;  2E8A A;  4J2D A;  4QOZ B;  5IWA K;  2YKM A;  5CYQ A;  4EP4 A;  4IBN A;  3SMS A;  1QVF M;  2YNH A;  1BL3 A;  4ELU A;  4DSK A;  2XY6 A;  1MDU B;  4PUO A;  3VPZ A;  1HNX K;  5AQM A;  3HJF A;  2E2O A;  4M3U A;  3OVN A;  3T1H K;  1ZBL A;  1Z25 A;  1X3M A;  3HXM A;  3TAB A;  2G8U A;  4GW6 A;  2WBN A;  2O8B B;  3CC4 N;  4H4O A;  4GV6 A;  3Q7B A;  3CCL N;  3KWI A;  3UKU A;  3U4L A;  3EY1 A;  5FRO A;  4CHP A;  1X9W A;  4BE0 A;  4LSN A;  3LDO A;  1C1B A;  1T44 A;  5CYM A;  2NRR A;  2KFZ A;  4WFA L;  5HOO A;  4JKF A;  4WYB A;  3AVM A;  4PA1 A;  3L0Q A;  5DM6 L;  4DTP A;  3DLH A;  3DXK B;  1RTJ A;  1TL3 A;  4JI7 K;  1JL1 A;  3H6E A;  4DTM A;  3CCR N;  2HF4 A;  3VQ6 A;  1TK0 A;  4JI4 K;  3NGZ A;  3K58 A;  3MN7 A;  2X74 A;  3QER A;  1QSY A;  1ZXO A;  2ZD1 A;  3C65 A;  4KBO A;  1HR0 K;  2P5O A;  1HNV A;  3AAR A;  4JKD A;  4PL8 A;  2ZWH A;  1QQM A;  1RT6 A;  1K8A O;  2D4W A;  4B1U B;  3OTO K;  3VQD A;  1OH8 A;  1RT7 A;  4KTW A;  1TAQ A;  3LPT A;  1U2V A;  2E2N A;  4WQ4 C;  3SCX A;  1KRP A;  1VRU A;  4KH4 A;  1TK8 A;  2GEM A;  5C42 A;  3C95 A;  4WE1 A;  5AQH A;  3NCI A;  4F4K A;  4M3W A;  1ATS A;  1RGI A;  4IJA A;  1XC9 A;  2CGJ A;  4RWT A;  1NKB A;  4E0D A;  4YOV A;  3JSM A;  4ISE A;  4KRF A;  3NH0 A;  2OPS A;  4KHY A;  5JS2 A; 
#chains in the Genus database with same CATH homology
 1NJY A;  1WAF A;  3ULD A;  4ELV A;  4DTJ A;  5HP1 A;  5DMR A;  4CHY A;  1CZ9 A;  3K5O A;  1TKX A;  4CGJ A;  1LWC A;  4I2P A;  3SQ0 A;  3LZI A;  1T8E A;  1J5O A;  3DOL A;  1Q9Y A;  3D45 A;  3ZCM A;  5C25 A;  3A2F A;  3V9X A;  1CLQ A;  3SI6 A;  3K5M A;  1S9G A;  2OYQ A;  4IDK A;  1L5U A;  3O4Q A;  1JKH A;  4FK0 A;  1S5J A;  4OVL A;  4ELT A;  4FM1 A;  1CZB A;  1HYZ A;  4ICL A;  4HUF A;  3QIO A;  4DU3 A;  3V4I A;  4HTU A;  1BCO A;  4JRP A;  2ITG A;  3ALY A;  4KHN A;  1ZBI A;  1SL0 A;  5HRN A;  3QEP A;  1D5A A;  1BIU A;  4CFA A;  3KLH A;  4Z4E A;  3ZT1 A;  4E3S A;  3ZT4 A;  4M3R A;  3RRG A;  2Y1J A;  2QXF A;  4IFV A;  3OJS A;  3SPZ A;  3P83 D;  3CFR A;  4BDY A;  3OYL A;  3HPG A;  5J2N A;  2YKN A;  4BE1 A;  3SV3 A;  3TAM A;  3LAM A;  1LAW A;  3ZT3 A;  4B9N A;  1W0H A;  4KTQ A;  3DOK A;  4DMN A;  2FBV A;  2VWK A;  4CJE A;  3P5J A;  3EYZ A;  3K57 A;  3ISN C;  2FBX A;  2ETJ A;  2Z1I A;  1S1W A;  4O55 A;  2JGU A;  3VQ8 A;  3TWH A;  4FXD A;  3VQ5 A;  1JLQ A;  4KPY A;  1XHZ A;  3F73 A;  4RW7 A;  1Y97 A;  4I2Q A;  4FLV A;  2OZM A;  1D9D A;  2F8T A;  1J54 A;  4N41 A;  4CJQ A;  3AVJ A;  5I42 A;  4E1N A;  4E7K A;  1S9E A;  1B9D A;  1I3A A;  4CFD A;  4HUG A;  3DLR A;  1WSI A;  4AHU A;  3I8D A;  4F8R A;  1ASV A;  3B6O A;  4KKO A;  1IKW A;  1TL1 A;  4G1Q A;  1TKT A;  1NK7 A;  3CFP A;  1QTM A;  4DS4 A;  2YNI A;  2O4I A;  2DTU A;  5J2P A;  3MED A;  4MQ3 A;  4OKK A;  4CJU A;  5HRP A;  3K5N A;  4CEA A;  4DTO A;  4LD0 A;  4CJR A;  2DFF A;  3QEX A;  5HBM A;  1VSF A;  1BI4 A;  1VSI A;  2IAJ A;  2KW4 A;  3V9S A;  1LWF A;  3HP6 A;  1XI1 A;  3KKS A;  2R7Y A;  4DG1 A;  3M8R A;  2KZM A;  4Z4I A;  3CG7 A;  3PO4 A;  4CES A;  3NGY A;  4KHU A;  3LWM A;  3QEV A;  1EP4 A;  3DRR A;  1WNS A;  4B9L A;  1O1W A;  3LAN A;  3S3O A;  3LAL A;  4N5S A;  4NYF A;  3HM9 A;  5SZT A;  4CEQ A;  3RTV A;  3CQ8 A;  3DLB A;  4KHS A;  3RRH A;  4H8K A;  4RW6 A;  1FKO A;  1WSF A;  1S1X A;  2ATQ A;  3DYA A;  1FKP A;  4BE2 A;  3V9W A;  3VA3 A;  3AVK A;  3MXJ A;  4CJK A;  4DF4 A;  3L2U A;  4CHQ A;  1Q9X A;  4FJK A;  3ITH A;  2HHQ A;  3K5L A;  4E7J A;  1KLM A;  4FJM A;  3HPH A;  2QKK A;  3UIQ A;  3KKR A;  1BIS A;  3QEW A;  3FFI A;  3MEG A;  4N47 A;  2YNG A;  4FJ7 A;  2OZS A;  1NKC A;  4FLW A;  1JLC A;  4KFB A;  4AHT A;  4E1M A;  4CJL A;  1DTQ A;  3HT3 A;  1NOY A;  2VWJ A;  4FYD A;  1JLB A;  3C6U A;  3KK1 A;  2HNY A;  4AHR A;  1N6Q A;  4I9Q A;  2HHS A;  4AIL C;  5DK5 A;  4J2B A;  4CJT A;  2BDP A;  4O44 A;  4FJG A;  1KVB A;  2HB5 A;  3ZSR A;  3HPO A;  3OYN A;  3AO1 A;  3KLE A;  4ID1 A;  2G8I A;  4B9V A;  2FC0 A;  2HNZ A;  1HJR A;  3QIN A;  1QHT A;  3OS1 A;  3LWL A;  3EZ5 A;  1TKD A;  1D8Y A;  4BWM A;  4M3Y A;  4EZ6 A;  4OGC A;  1RTH A;  4NYN A;  1WSG A;  4HCC A;  3G0Z A;  3LDS A;  1GOA A;  1L3V A;  2OA8 A;  3QIP A;  1TKZ A;  4OJR A;  1F21 A;  2XY7 A;  1N5Y A;  2HW3 A;  4O4G A;  1I39 A;  3NGI A;  4Q0B A;  3KJV A;  2GUI A;  3AV9 A;  5K14 A;  3ZSW A;  4CIG A;  3NH1 A;  5HRR A;  4CJV A;  1JXB A;  3OYM A;  3PX0 A;  1NK5 A;  4B9M A;  4FZY A;  4B3O A;  2WOM A;  4FLY A;  1IO2 A;  1BCM A;  4CK3 A;  1NJZ A;  3LAK A;  4ZTF A;  1IKV A;  1C1C A;  3NFA A;  4E89 A;  3NF9 A;  3S9H A;  4DSL A;  2E4L A;  1A5W A;  3KLF A;  1S6P A;  3AO3 A;  4K8X A;  3TR8 A;  5D3G A;  4ID5 A;  3SJJ A;  1VSL A;  2IGI A;  1S1T A;  1Z26 A;  1U45 A;  1RBT A;  1EKE A;  3OYI A;  3HO1 A;  1FK9 A;  1GOC A;  1BQM A;  3SUP A;  4DSI A;  4N76 A;  3AVC A;  3PUF A;  2G8H A;  2RF2 A;  4CEB A;  2E6M A;  2P5G A;  3AVL A;  4CE9 A;  3TAF A;  1QE1 A;  4CJP A;  3V1Q A;  1J53 A;  1RT3 A;  1RT2 A;  3TAN A;  4KV8 A;  1JLG A;  4IG3 A;  3ZSZ A;  3C6T A;  4FJJ A;  2QK9 A;  5HRS A;  2G8V A;  5I3U A;  1U47 A;  4E19 A;  3T3F A;  1VK0 A;  3AVI A;  3KD1 E;  4FVM A;  1A5V A;  4CK1 A;  1VSK A;  1WSH A;  1ZBF A;  3AO4 A;  4O0I A;  3SQ4 A;  2PYL A;  2G8K A;  4JS5 A;  3PX4 A;  3OYA A;  1EX4 A;  1K6Y A;  4XIU A;  3TAG A;  1VRT A;  3TAR A;  1ZYQ A;  3VQ4 A;  3RR7 A;  2BAN A;  4FJI A;  2VG7 A;  1HQE A;  2YHB A;  4FLU A;  3CYM A;  3AA5 X;  4PQU A;  4W5Q A;  3MXI A;  2HVI A;  3VQC A;  4FCY A;  2X6N A;  4FW1 A;  4CIE A;  4W5T A;  2HND A;  4DSJ A;  2IC3 A;  4B9S A;  2XY5 A;  3LP2 A;  5C24 A;  4YFU A;  3L3V A;  1QQC A;  1T05 A;  3AVH A;  1BGX T;  1VSJ A;  2Z1G A;  4C8K A;  3NBP A;  3LPU A;  3IRX A;  2P51 A;  3M8Q A;  2Z1H A;  3KLG A;  3P1G A;  1W9H A;  3SYZ A;  1YTA A;  4B9T A;  5FRN A;  3LZJ A;  1KVA A;  4KHQ A;  5FRM A;  3PO5 A;  1RT4 A;  4OKJ A;  3VQP A;  4DQQ A;  2HHT A;  1XWL A;  2ZQB A;  3HVR A;  3S3M A;  2A1S A;  2NUB A;  3V9U A;  2IDO A;  2RPI A;  4N56 A;  1RNH A;  4J2E A;  4Q5V A;  2D0C A;  4IFY A;  5CY4 A;  2XRI A;  4HUE A;  4BDZ A;  2DFH A;  4IG0 A;  4RG8 A;  1BHL A;  3AA3 A;  1UA0 A;  1FXX A;  4HHT A;  4FM0 A;  4C8N A;  5JS1 A;  4R5P A;  3O4N A;  3V6D A;  4OLA A;  3VQB A;  5CZ2 A;  4DTS A;  1JLA A;  3PV8 A;  3TAQ A;  1S1V A;  3PY8 A;  2XO7 A;  1ZBH A;  4Z0U A;  1DLO A;  2HHX A;  3M8P A;  3THV A;  3L2R A;  4CJ3 A;  4NCA A;  1WAJ A;  4B9U A;  2BGG A;  1ASW A;  1RCH A;  4CK2 A;  3SPY A;  2D0A A;  1NK0 A;  2D0B A;  1CXU A;  3OYH A;  1QSL A;  2OPP A;  3OYB A;  2A1R A;  4FJ5 A;  2HVH A;  4RW9 A;  3T1A A;  4M41 A;  1RDB A;  2G8F A;  3V9Z A;  4EZ9 A;  1C0U A;  1YTU A;  1RTD A;  4AHS A;  4CFC A;  5HRO A;  4FZZ A;  3ZSQ A;  4QAG A;  1RT1 A;  4CEF A;  4DSF A;  4CCH A;  4CJF A;  1KFS A;  3AVG A;  3OS0 A;  1B9F A;  3AVA A;  3KLI A;  3AVF A;  1REV A;  1EET A;  4OKE A;  4DFM A;  4DF8 A;  5J2M A;  4CGI A;  3RMB A;  1UAX A;  2IOC A;  3RMD A;  2P1J A;  3AVB A;  4CF0 A;  1LV5 A;  4FZX C;  1TAU A;  1KLN A;  1SUQ A;  1U48 A;  4RW4 A;  3U6F A;  1IH7 A;  3RMA A;  4DQP A;  3VN5 A;  4CEO A;  4NCB A;  1C0M A;  1NK4 A;  3QES A;  1X9M A;  3U3G A;  2YHA A;  3IAY A;  2DFE A;  3K59 A;  1L3U A;  1SKW A;  3OYJ A;  3SUN A;  2RN2 A;  3MEE A;  1LWE A;  3NF7 A;  4LH5 A;  1ZBU A;  3VQA A;  4DLE A;  4NCG A;  1YT3 A;  4RW8 A;  1JL2 A;  2X78 A;  3OJU A;  4E7I A;  1NJW A;  3BGR A;  4CGG A;  1Q8I A;  1VSH A;  2B4J A;  4ZHR A;  3OYE A;  3V1O A;  4JRQ A;  1S1U A;  4Z4G A;  2AJQ A;  1G15 A;  4CED A;  3SUO A;  1VSD A;  4CIF A;  2KFN A;  4CJ5 A;  4FJL A;  4JS4 A;  3AA4 A;  1RBR A;  3LP0 A;  4DU1 A;  3VQ7 A;  4Z4H A;  4CFB A;  2XY8 A;  4CEE A;  4K8Z A;  1UWB A;  1VSM A;  4CJS A;  3ZSX A;  4C8L A;  3ZSY A;  2F8S A;  2GBZ A;  5SWM A;  5KGW A;  4E7L A;  4M3T A;  2OPR A;  1HRH A;  2PZS A;  4FJX A;  4M3X A;  4E7H A;  2B5J A;  2PYJ A;  3KK2 A;  4L8R B;  1JLE A;  4KI6 A;  3KIO A;  4FJN A;  5KGX A;  3S3N A;  4KB0 A;  1NJX A;  2EHG A;  1RBS A;  2Q3S A;  4CGH A;  4UQG A;  4FM2 A;  3WNH A;  1JXE A;  3O3H A;  4M45 A;  2GV9 A;  2EX3 A;  4DQS A;  4M3Z A;  3OYC A;  3KK3 A;  3L2V A;  4FLZ A;  1U04 A;  4DFK A;  1NK6 A;  1KSP A;  4CEC A;  3L8B A;  3DRS A;  4FW2 A;  4W5O A;  3HYF A;  3L2W A;  2PY5 A;  3KD5 E;  4IKF A;  4LY7 A;  4OLB A;  4FLT A;  2KTQ A;  4I9L A;  1KVC A;  4C8M A;  4ZTJ A;  5J2Q A;  1LW2 A;  1LAV A;  4C8O A;  1WSJ A;  1RDC A;  4KO0 A;  2VG6 A;  1UA1 A;  2HMI A;  4KI4 A;  3ZT0 A;  4FK4 A;  4QCL A;  4FLX A;  3LP1 A;  3OYF A;  3NE6 A;  3DI6 A;  3RWU A;  4KAZ A;  3JYT A;  2BE2 A;  1NOZ A;  1WSE A;  1BQN A;  3QO9 A;  4OPK A;  1R0A A;  1L3S A;  1X1P A;  4DTN A;  4F2R A;  4TSX A;  3L2Q A;  4GVM A;  4CHN A;  3I0R A;  3VQQ A;  4O0J A;  2I5J A;  4CJ4 A;  3D0P A;  3SZ2 A;  3TAE A;  1CXQ A;  3MXM A;  1IKY A;  4CF9 A;  2D5R A;  1QSS A;  3RR8 A;  1SL2 A;  3AO5 A;  4CJW A;  2KQ2 A;  3ZT2 A;  4DQR A;  3SUQ A;  3B6P A;  2FBT A;  4I7F A;  4YNQ A;  1X9S A;  4F3O A;  3ZSO A;  5FDL A;  4Z4C A;  3O3F A;  1HMV A;  1QS4 A;  4BWJ A;  2O4G A;  3VQE A;  4BDP A;  4J2A A;  1BI4 B;  4KB1 A;  4J2D A;  1U4B A;  4FJ9 A;  4QOZ B;  2F96 A;  3E01 A;  4HCB A;  2YKM A;  5CYQ A;  4EP4 A;  4IBN A;  2YV0 X;  4DS5 A;  1C6V A;  3QET A;  4O5B A;  1T03 A;  3DLE A;  4CGF A;  2YNH A;  2WON A;  3IG1 A;  4B8C A;  1BL3 A;  4DSE A;  4ELU A;  3L3U A;  4DSK A;  2XY6 A;  1LW0 A;  4PUO A;  1JLF A;  4FJH A;  4DTX A;  1SL1 A;  2ZE2 A;  1C1A A;  5T7B A;  3OS2 A;  3OY9 A;  4DFJ A;  1NK8 A;  3BDP A;  3HJF A;  5KRT A;  3M8S A;  4M3U A;  5KI6 A;  2OPQ A;  3AA2 A;  3OVN A;  4DFP A;  1IKX A;  3KTQ A;  4KHW A;  3DMJ A;  1WN7 A;  4OPJ A;  1Z25 A;  4DTR A;  1ZBL A;  3NHG A;  3HXM A;  4PY5 A;  3TAB A;  3DRP A;  3HST B;  2G8U A;  2QKB A;  3OYG A;  2B6A A;  3NF8 A;  4Y1C A;  3AVN A;  4CER A;  3I0S A;  3QEI A;  2LSN A;  3OYK A;  4GW6 A;  2KZZ A;  4H4O A;  3DLK A;  4AHC A;  4KRE A;  1UOC A;  4DU4 A;  4DQI A;  1A5X A;  1ITG A;  3SV4 A;  1NKE A;  3U3Y A;  1RBU A;  3EY1 A;  4OGE A;  5FRO A;  4CHP A;  1KFD A;  1X9W A;  1BIZ A;  1GOB A;  1KCF A;  1TV6 A;  4B08 A;  3T19 A;  2W42 A;  2FBY A;  3VQ9 A;  4BE0 A;  4LSN A;  1C1B A;  2RKI A;  1RDA A;  3SQ2 A;  5CYM A;  1YVU A;  4H4M A;  4DWI A;  5KRS A;  2KFZ A;  4CF1 A;  1C0T A;  3AVM A;  4PA1 A;  3CM6 A;  1EXQ A;  3LP3 A;  4HVJ A;  2JLE A;  3NH2 A;  4DTP A;  3MEC A;  3DLH A;  4FK2 A;  4Z4F A;  2DY4 A;  1RT5 A;  1RTJ A;  4BAC A;  1TL3 A;  3OYD A;  1JL1 A;  1RIL A;  4MFB A;  4CHZ A;  3TI0 A;  4DTM A;  3ASM A;  3SQ1 A;  4CF2 A;  1HYS A;  2Z1J A;  3VA0 A;  1TK0 A;  3NF6 A;  3VQ6 A;  2HHW A;  3HVT A;  3WNE A;  5E41 A;  1HPZ A;  3NGZ A;  3K58 A;  1U49 A;  1WLJ A;  3F9K A;  4CF8 A;  2X74 A;  1XHX A;  4CGD A;  3QER A;  1J9A A;  1QSY A;  1RBV A;  3H08 A;  1MU2 A;  2ZD1 A;  4M42 A;  4Y1D A;  5J1E A;  2P5O A;  2HHU A;  1HNV A;  1NK9 A;  3TAP A;  3ZSV A;  1SKR A;  1SKS A;  3NAE A;  1RT6 A;  5CZ1 A;  3WNG A;  3DM2 A;  5KTQ A;  3QNN A;  4F3T A;  3O3G A;  2G8W A;  2IS3 A;  3VQD A;  4LSL A;  1HYV A;  1RT7 A;  1TK5 A;  4KTW A;  3G10 A;  1TAQ A;  1TVR A;  3LPT A;  1HQU A;  4JLH A;  4AH9 A;  4CHO A;  1HNI A;  5EU7 A;  4AHV A;  3SCX A;  3MAQ A;  1KRP A;  1L3T A;  2E6L A;  4W5R A;  3DLG A;  1VRU A;  1B92 A;  3SNN A;  1S6Q A;  5HLF A;  1VSE A;  3HK2 A;  1DTT A;  1TK8 A;  4KTZ A;  1RDD A;  3V1R A;  3WNF A;  4B8A B;  5C42 A;  4FJ8 A;  3NDK A;  3C95 A;  3IS9 A;  4WE1 A;  3K2P A;  1TGO A;  3NCI A;  2HHV A;  4F4K A;  4M3W A;  3HP9 A;  2X6S A;  4W5N A;  1ASU A;  4EP5 A;  2VG5 A;  4DTU A;  1XC9 A;  1D9F A;  3AO2 A;  1RTI A;  4DLG A;  1NKB A;  3RMC A;  3QNO A;  1T7P A;  1KTQ A;  3V81 A;  4PWD A;  1IG9 A;  3C94 A;  2XHB A;  4KHY A;  4E0D A;  4F2S A;  3JSM A;  2Y1I A;  4GMJ B;  2YNF A;  3QLH A;  4KRF A;  3HL8 A;  2OPS A;  1SV5 A;  4CEZ A;  3CFO A;  4LH4 A;  3NH0 A;  3CM5 A;  5JS2 A;  3PX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...