4HVJA

Crystal structure of a putative uncharacterized protein from mycobacterium tuberculosis in complex with amp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
160
structure length
156
Chain Sequence
SMVRYFYDTEFIEDGHTIELISIGVVAEDGREYYAVSTEFDPERAGSWVRTHVLPKLPPPASQLWRSRQQIRLDLEEFLRIDGTDSIELWAWVGAYDHVALCQLWGPMTALPPTVPRFTRELRQLWEDRGCPRMPPVHDALVDARDQLRRFRLITS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Mycobacterium tuberculosis Rv2179c Protein Establishes a New Exoribonuclease Family with Broad Phylogenetic Distribution.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
total genus 52
structure length 156
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4hvjA00
3DI6A 3QINA 4DSFA 4DTPA 3VQPA 4E7KA 1XI1A 4FJ8A 4OJRA 3LZJA 2B5JA 3SQ4A 1TK8A 1U48A 3L3VA 4BACA 2NUBA 4B8AB 3RMBA 3AVFA 1T7PA 5JS2A 1IKVA 4FJ9A 2F8SA 4I7FA 4CJKA 3KK1A 4N47A 4CGFA 2VWKA 4W5OA 3EY1A 1LWCA 1RBVA 4CHPA 3KLGA 3AO3A 1X9SA 1Z25A 3IAYA 5K14A 3P83D 1NKBA 1RBTA 1SV5A 3VQAA 4M3WA 3HXMA 2O4IA 3V81A 3K58A 5DK5A 4CJTA 2X74A 3OS1A 3QO9A 2QKBA 1WAFA 2E6LA 2FBTA 4GMJB 4BWMA 4B9VA 4DTRA 3RRHA 3MXIA 4E7HA 4IDKA 2AJQA 3LP3A 3WNFA 4CIEA 4EP5A 3D0PA 2Y1IA 1HNVA 1BIZA 2XY5A 1Q9XA 4CJ5A 4Z4CA 3VQ5A 3KLFA 4DU3A 3V9ZA 2G8WA 3VQ4A 5T7BA 1NJXA 1ASVA 4R5PA 2OYQA 1FK9A 4W5QA 3V9XA 3QETA 3NF6A 1LWEA 3SV3A 2OZMA 4KHQA 1NK9A 4J2EA 4Z4IA 2PZSA 3OYAA 2YKNA 1VSEA 4B9NA 3HP6A 3MECA 1SKWA 2HHQA 2ZE2A 1TKZA 3ALYA 3VA0A 3M8RA 3K57A 3K5OA 3ZSVA 1QTMA 4LD0A 3PUFA 3DLHA 3HT3A 3EYZA 3V9WA 5J2QA 3E01A 3CFPA 3CYMA 4E1MA 4AILC 4H8KA 4FW1A 4KI6A 3IS9A 5J2PA 1LAWA 4E89A 3KKSA 2YNFA 3DRRA 4ZHRA 1RTJA 4JRPA 4DSJA 4FJMA 1CZBA 4XIUA 3QLHA 4KHSA 2HW3A 1EXQA 4KO0A 4DTOA 1SL0A 4CF9A 4JS5A 4AHVA 1VRTA 3H08A 2XO7A 3ZCMA 5HRNA 3BDPA 1S5JA 1CXQA 4DU4A 4JRQA 4C8OA 3SCXA 4KHNA 2KTQA 2OPRA 1HQUA 3NAEA 1HYZA 1HPZA 2HHVA 3QNOA 1BISA 2RKIA 1N5YA 4HUGA 4LSNA 1RBUA 3MXMA 4HHTA 1SKRA 1DTQA 4AH9A 4N41A 1SL1A 4O4GA 1LWFA 4I2QA 1VSMA 2E4LA 3O3HA 3FFIA 5FROA 4E7LA 3TAFA 1I39A 1J5OA 4HUEA 1FKOA 5HROA 4KHWA 4DQPA 4FJJA 3RMCA 4FCYA 5HRSA 4DSIA 3L3UA 1RT6A 3V6DA 4DTUA 2KFNA 1JLFA 2VG7A 4CF0A 2PYJA 1YTUA 1GOCA 1WN7A 1BI4B 3OVNA 3SPYA 1Q8IA 3PO5A 1JL2A 1ZBUA 4HCBA 4M41A 2YKMA 1KFSA 4GVMA 2IAJA 5J1EA 4RG8A 3ZT3A 3TAPA 4KRFA 1RT3A 3PY8A 2R7YA 3V1OA 4CK2A 4CFBA 3AA5X 1VSJA 4E3SA 4OKKA 3IRXA 1VSDA 4CGJA 3IG1A 4UQGA 3KK2A 3UIQA 3QERA 4FJNA 4J2BA 1J9AA 4CF1A 1RT2A 2Y1JA 4FW2A 4KKOA 4CFAA 4HUFA 4CGDA 4CGHA 1ASWA 3OYIA 3SJJA 1QSLA 5SWMA 3KIOA 4KREA 4YNQA 4DSKA 3CFOA 4EZ6A 3TAMA 3LDSA 3L2UA 1R0AA 3VQDA 3SPZA 3NF9A 4FJXA 2HHWA 4CF8A 4Z0UA 3AVAA 1FXXA 3HL8A 1S1UA 4CJQA 5JS1A 1VK0A 1Z26A 3NF7A 1RTHA 1WAJA 4C8NA 4Z4GA 2G8VA 1UOCA 5FRNA 3S3NA 4E1NA 4FLZA 3KKRA 1NJZA 1KSPA 2G8FA 3V1QA 2FBYA 1VSLA 5I3UA 3L2RA 2I5JA 3I0RA 1GOAA 1L3SA 4OPKA 1BL3A 4H4OA 4KFBA 4K8ZA 4E7IA 4EZ9A 5KRSA 3CM6A 4CEAA 3OJUA 3TAEA 4FZYA 4KTZA 3ZSXA 3SYZA 1KLNA 4DS4A 2QK9A 3O3FA 2P5GA 2YNHA 4FK4A 2HVIA 3ITHA 4M45A 3RMAA 1UWBA 2EHGA 4ZTJA 2WOMA 3LPUA 3QIOA 5CYQA 1C1AA 1C1BA 4DTSA 4CJ3A 1QS4A 2XRIA 4K8XA 1XC9A 2IDOA 1QE1A 2B6AA 1BIUA 4FLXA 1WSIA 4BDPA 1RDAA 3ASMA 4OLAA 4CK3A 4FM0A 3T3FA 4DQRA 3VQEA 4CEEA 3BGRA 4BE1A 4DFKA 3HVTA 4M3TA 3NE6A 4RW6A 3U6FA 1HJRA 4DSLA 3T1AA 3VQ7A 2YHBA 1U45A 3AVLA 1BI4A 2DFFA 3SQ2A 3V1RA 4DLGA 2F8TA 1NOZA 1L3UA 3OYDA 1RILA 4FJKA 2OPPA 4F2RA 3KK3A 2EX3A 3LPTA 3NF8A 2HMIA 2OPQA 2Z1HA 3PV8A 4FJLA 1KTQA 4DSEA 3SUOA 1HRHA 1TAQA 3HP9A 2X78A 1VSKA 3RR7A 1RCHA 4DTXA 4FJHA 3DYAA 4CECA 1DLOA 3HVRA 4OGEA 3TR8A 3SI6A 4CHZA 4CHOA 2W42A 3SNNA 3DLBA 3LALA 4O0IA 4QAGA 3NCIA 4HTUA 4DU1A 1NK0A 1T8EA 1LW2A 1NK4A 3LP1A 5J2NA 4CGGA 1RT4A 3K5NA 3O4QA 1LV5A 3SV4A 3VQ8A 3PX4A 3TARA 4ZTFA 2QXFA 4OLBA 1U49A 4BE2A 5DMRA 3DLGA 1XWLA 4LY7A 3L8BA 1NK8A 2DFEA 1RT5A 4RW7A 3I0SA 1RTIA 3DLEA 1WLJA 4CEQA 4CHQA 3RMDA 1B9FA 4FJ5A 5KGWA 1CXUA 2D0BA 4FLVA 4FLWA 2D5RA 4CJSA 4W5RA 4CIFA 3OY9A 1C0TA 3NGYA 1TKDA 1U47A 2ZD1A 1A5VA 4CJPA 3ISNC 3M8SA 4OVLA 3LAMA 3NH2A 4B9UA 2KFZA 3LWMA 3AO2A 1JL1A 3B6PA 1S1XA 1XHXA 4FYDA 4DQSA 1ZBIA 4FXDA 3QEIA 5I42A 1S1WA 1S9EA 4F3OA 3QESA 3M8QA 4RW9A 4M3YA 1BQNA 1VSIA 3LZIA 4QCLA 2IS3A 3LWLA 2ITGA 4OKJA 5FRMA 3AVIA 3AO4A 2HNDA 4DQQA 3HO1A 5HBMA 1ZBHA 4B9LA 1A5XA 3KLHA 4E7JA 1D5AA 1KLMA 1IO2A 2Z1IA 3DLRA 2YNIA 4PWDA 2QKKA 3P1GA 3LP2A 4KAZA 3MEDA 4B9TA 4CEZA 4CGIA 2X6NA 4DWIA 4CESA 3DM2A 4FJGA 4NCBA 2D0AA 1G15A 1UAXA 2X6SA 4NCGA 4C8MA 3VQBA 1ASUA 4B08A 3OYFA 3RR8A 2G8UA 4HCCA 3TI0A 4FLYA 2BDPA 1S6PA 4O5BA 4N5SA 5HRPA 1NKEA 1REVA 3L2WA 3SUQA 4E0DA 4MFBA 4F3TA 1J54A 1W9HA 1EKEA 1RBSA 1VSFA 4B8CA 3OS0A 4G1QA 1T03A 3RRGA 2GUIA 3OYGA 4DFMA 3NGIA 4Z4FA 4CE9A 3QNNA 3PO4A 3K2PA 4LH5A 1B92A 5HLFA 4RW4A 3KLEA 4DLEA 3NBPA 3RTVA 4JS4A 3OYKA 3ZSOA 3MXJA 3QIPA 1HNIA 3TWHA 4ICLA 3P5JA 3PX0A 4GW6A 1NK6A 4FM1A 1BCMA 4DF8A 4B9MA 3HJFA 1U04A 4FVMA 4M42A 4DF4A 2F96A 5KTQA 1TAUA 4CJVA 3NFAA 1Y97A 3B6OA 1SL2A 4C8KA 2YV0X 4H4MA 1WNSA 4DMNA 3RWUA 2DTUA 1TKTA 4FM2A 5KGXA 4DFJA 1J53A 4CCHA 4FJIA 3WNGA 3ZSRA 3NH0A 4Z4EA 1ZBLA 2XY8A 3AVHA 3QEVA 5CZ2A 2RN2A 4DG1A 3OJSA 2OA8A 1JLQA 1NJWA 4Y1DA 1I3AA 4B9SA 1W0HA 3K59A 1RDBA 3OYNA 2DY4A 3V9SA 2D0CA 1S9GA 3S3OA 1JXBA 3K5MA 1IKYA 5E41A 5C25A 1L3TA 2G8KA 3AVNA 1JKHA 4KHYA 2YHAA 1Q9YA 4ELUA 1TK0A 1GOBA 2O4GA 1DTTA 4NYNA 1WSHA 3CFRA 3OYCA 1U4BA 4TSXA 4CEOA 3HYFA 1IH7A 3AA3A 4FLTA 4C8LA 4QOZB 3C94A 2RF2A 4M3UA 2ZQBA 1L5UA 1JLCA 3JSMA 2YNGA 4KTWA 1VSHA 3F73A 4O44A 1HYVA 1F21A 3ULDA 2HHTA 5CYMA 3SQ1A 1TKXA 2G8HA 1NKCA 3KD5E 2VWJA 3AVGA 3AVMA 4CJFA 1CZ9A 4CHNA 3QEXA 4CIGA 4FK0A 2G8IA 3HPHA 5CY4A 1S6QA 2HNZA 1EETA 2HB5A 4FLUA 3AO5A 1ZYQA 3CG7A 3QEWA 4PA1A 1O1WA 1RNHA 1SUQA 1BHLA 4CEFA 3V4IA 1UA1A 4F8RA 4DFPA 1IKWA 1X1PA 4IG3A 2JGUA 5SZTA 3U3YA 3QEPA 2KQ2A 2WONA 3LAKA 3WNEA 1BGXT 4N76A 4BWJA 1FKPA 4FK2A 3C95A 3WNHA 1RT7A 4IKFA 4DS5A 2HVHA 2A1RA 4IFVA 3KJVA 4KTQA 3KLIA 3TAGA 4OKEA 1JLEA 3CQ8A 1EX4A 4KV8A 1MU2A 1C1CA 4CJWA 1TK5A 3LP0A 2B4JA 4M3XA 1K6YA 4N56A 1HMVA 2PYLA 3TABA 1KVAA 2BANA 3AA4A 3AV9A 3C6TA 4CHYA 4NYFA 5HRRA 1RDCA 2P5OA 3F9KA 1C6VA 2IOCA 3NH1A 3CM5A 1YT3A 3MAQA 2FBXA 3G10A 3VQQA 4LH4A 3V9UA 4PUOA 1HYSA 1RDDA 3AVCA 3OS2A 3JYTA 4FZXC 4LSLA 3AVKA 3O4NA 4BDYA 3THVA 4CJUA 3MEEA 1D8YA 1ITGA 4J2DA 3TANA 4B3OA 1X9MA 3C6UA 2Z1JA 4FJ7A 4O0JA 1RTDA 4AHRA 3K5LA 3S9HA 2BGGA 1RT1A 4CFDA 4ELTA 5FDLA 1LAVA 3OYLA 3KTQA 4IFYA 3D45A 4ID5A 2KW4A 1KRPA 4I2PA 5KI6A 4CJRA 1NK7A 1NJYA 4L8RB 1L3VA 4OGCA 3A2FA 4DTNA 3NGZA 2KZMA 3OYBA 5C24A 4DTMA 2Z1GA 1TL1A 3DOLA 3MEGA 1QSYA 1CLQA 4AHCA 4RW8A 2HHSA 2Q3SA 2VG5A 2VG6A 1NK5A 2IGIA 2HHXA 3OYHA 1KVCA 1A5WA 1C0UA 1TVRA 1SKSA 1QSSA 2JLEA 4PY5A 4Q5VA 4I9QA 3ZSYA 1D9FA 4CJLA 5D3GA 4PQUA 2ATQA 4JLHA 1T05A 5J2MA 3ZT1A 4FZZA 2HNYA 4NCAA 1QQCA 3NHGA 1WSEA 3SUPA 4F4KA 3OYMA 1IG9A 3HPGA 1TGOA 3EZ5A 3SZ2A 3OYJA 2GV9A 3AVJA 3SUNA 4M3ZA 1JLBA 3L2VA 4KB0A 4E19A 3ZT2A 1S1TA 4ID1A 4OPJA 2P1JA 3AVBA 4AHUA 3HPOA 3ZT0A 4EP4A 4AHSA 5HP1A 4CJEA 1N6QA 1WSFA 4WE1A 1D9DA 4CEBA 1WSGA 1LW0A 2E6MA 3L2QA 1XHZA 2RPIA 3O3GA 4CFCA 3VA3A 1WSJA 2KZZA 1EP4A 1KFDA 1NOYA 4CK1A 3DRPA 5C42A 3ZSWA 4DTJA 4HVJA 2HHUA 3OYEA 4AHTA 1KCFA 2OPSA 4O55A 1C0MA 1YVUA 2BE2A 4Q0BA 4IG0A 3AO1A 3T19A 3AA2A 4MQ3A 2XY6A 3KD1E 4KB1A 1BQMA 3I8DA 3ZSQA 4CJ4A 1YTAA 3U3GA 4DQIA 4KHUA 4M3RA 1BCOA 2ETJA 4I9LA 3DMJA 3G0ZA 3VQ6A 5KRTA 1TV6A 4KI4A 2XY7A 1KVBA 5CZ1A 4CF2A 3HSTB 2P51A 1RBRA 4W5TA 3DOKA 3LANA 2OZSA 4KPYA 4BDZA 3DRSA 4CERA 3S3MA 3HM9A 4IBNA 2FC0A 1HQEA 5EU7A 3VQCA 3M8PA 2PY5A 1IKXA 1B9DA 1JLAA 2GBZA 3ZSZA 4ELVA 1ZBFA 4BE0A 4Y1CA 3TAQA 1S1VA 3ZT4A 1JXEA 1TL3A 4Z4HA 2A1SA 3PX6A 3SQ0A 3DLKA 3NDKA 3HK2A 1VRUA 2IC3A 4J2AA 4W5NA 1UA0A 2FBVA 1X9WA 2XHBA 4CEDA 3VN5A 2LSNA 1QHTA 3VQ9A 2DFHA 4F2SA 1JLGA 4YFUA
chains in the Genus database with same CATH superfamily
4DSFA 1QZ6A 2WC9A 1U2VA 4OJRA 2B5JA 1TK8A 2JWLA 1U48A 4H5VA 3RMBA 3AVFA 1T7PA 1LCUA 3QB0A 4N47A 3VEOA 2VWKA 4W5OA 3EY1A 1KC8O 4CHPA 4DV7K 4BQZA 3P83D 1NKBA 3VQAA 2O4IA 5DK5A 3ZX3A 4CJTA 3QO9A 3TTFA 3MXIA 2OANA 2UUAK 4EP5A 3WNFA 1KAYA 2O8CB 5LY3A 4WQ4A 5AQSA 4CBXA 2G8WA 3FLCO 1ASVA 3BF3A 1JCEA 1BG3A 2QXLA 5EY4A 3ZX0A 3SV3A 2OZMA 3OYAA 4DV5K 4B9NA 1TKZA 1YXQA 3K57A 4H0XB 3PUFA 2BH1A 3EYZA 4KHPK 5J2QA 4YOYA 4E1MA 4JKCA 2OTLN 4BY9C 3IS9A 4DUYK 3KKSA 4ZHRA 3DRRA 3GDQA 1RTJA 3A5OC 1CZBA 4XIUA 2HW3A 4DTOA 3UKRB 4WYBA 4JS5A 4JI4K 3SAFA 3BDPA 1S5JA 4DU4A 3SCXA 2QTDA 1HQUA 3NAEA 1HYZA 1O13A 3QNOA 1C0GA 1SKRA 1DTQA 1SL1A 2UXDK 2E4LA 4FWSA 4IEEA 1I39A 5AJ3K 5AQZA 1J5OA 5C15A 3V6DA 1RT6A 2PYJA 4CF0A 2ZWHA 1VQPN 4JHDA 1WN7A 3SPYA 2ASOA 1Q8IA 2CGJA 2VQEK 2YKMA 4GVMA 1QQOA 2IAJA 5J1EA 3ZT3A 3TAPA 1VQNN 4IJNA 4FWOA 3HBTA 4E3SA 4OKKA 1XMQK 3DJCA 3IG1A 2HBJA 3SAGA 3GBTA 4J2BA 2Y1JA 3SJJA 4IOAL 2P9LB 5E84A 1QQNA 4H5RA 3LDSA 1VQMN 4BRFA 3W0LA 2HHWA 5CHIA 2E2PA 2KKZA 2QWPA 4O5FA 1FJGK 3ZX2A 4JD2B 3IMXA 3C7NA 2VCPA 1YF5L 3T1HK 4K8ZA 5KRSA 3OJUA 4KH5A 3G25A 3CCQN 2WBNA 3O3FA 5AQGA 2YNHA 3I8BA 2ZF5O 3QIOA 1MWMA 1C1BA 1OH5A 1QE1A 2B6AA 4ISFA 5ADXH 3ASMA 4BRHA 4JAXA 3T3FA 4DFKA 4RW6A 2GELA 3T1AA 3VQ7A 1SZ2A 3DXKA 3V1RA 2F8TA 2CGKA 3TTCA 4FJKA 1BO5O 3KK3A 2EX3A 4H0VB 2OPQA 4DSEA 3SUOA 3NMUA 1T3VA 4IEIA 3DYAA 3R8EA 2W42A 4GNIA 3LALA 4QAGA 3VGMA 2YI1A 4IZ9A 1HX1A 3H3NO 4CGGA 4MDBA 3K5NA 3VQ8A 3PX4A 3SBGA 2E20A 2QXFA 1U49A 4BE2A 5DMRA 3L8BA 2DFEA 1RT5A 1SQKA 3I0SA 5FPNA 4CHQA 1OH8A 3AARA 5GAGP 2HSTA 3G4SN 1B9FA 4FJ5A 1Q18A 2D5RA 4BG8A 4W5RA 1C0TA 3O80A 4CJPA 3M8SA 3LAMA 4B9UA 4PHTX 4MO5A 2KFZA 4WQ5C 3LWMA 1JL1A 1VQ8N 1S1XA 1XHXA 3A0IX 1YHQN 4DQSA 2P9SB 4FXDA 5I42A 1S1WA 3VEYA 3M8QA 1BQNA 3LZIA 4QCLA 1WOQA 4BRGA 3A8YA 3LWLA 2W40A 3N4PA 5FRMA 3AO4A 2HNDA 1ZBHA 1BUPA 4E7JA 1KLMA 1IO2A 4PWDA 3O9SA 5M1PA 3LP2A 3MEDA 4B9TA 1T6DA 4NCBA 5KPZA 4FJGA 1G15A 3C6HA 4NCGA 4C8MA 4YY3K 1ASUA 4HCCA 1K8AO 2VYPA 5HRPA 1REVA 3L2WA 3SUQA 4XEIA 4MFBA 3KWGA 3OS0A 1T03A 3TPQA 1ZXOA 3RRGA 4DFMA 4CE9A 3PO4A 4LH5A 1B92A 1E3MA 2ITMA 3RTVA 3OYKA 3ZSOA 3MXJA 3RVCA 3PX0A 3HJFA 1JJ2M 3MCAB 3IUCA 4FVMA 4M42A 5KTQA 1NNEA 1Q7YO 4H4MA 1WNSA 3RWUA 2DTUA 1BU6O 3MDQA 4FJIA 1ZBLA 2OA8A 4FSVA 2QWLA 4Y1DA 4B9SA 3OYNA 3CPEA 2D0CA 3R3LA 2A5XA 2A42A 3C0BA 1JKHA 4KHYA 1Q9YA 4B1WB 2ASMA 2IIRA 3CCSN 3E9OA 3CFRA 1NU0A 1U4BA 4CEOA 4BRNA 4BR7A 4FLTA 4BRLA 2YNGA 4KTWA 5CYMA 2G8HA 3F5TA 4K0KK 1NKCA 2Q1NA 3KD5E 3FZLA 4CIGA 4LF4K 3FZMA 3CG7A 3QEWA 4PA1A 5LL6Z 4JI5K 4IG3A 2KQ2A 3WNEA 4LF7K 3ID6A 5AZIA 1RT7A 3LDPA 3L6QA 3FR0A 4DS5A 2GUPA 4IFVA 3KJVA 5BPNA 1GLFO 1C1CA 3DXMB 3LP0A 1FW6A 3AA4A 3AV9A 4CHYA 1VQ4N 4J8FA 1GLBG 3F9KA 3ZETB 1C6VA 2IOCA 4FOIA 3MAQA 4PUOA 2FBXA 4LH4A 4YORA 1RDUA 5CR4A 2Q97A 1ATSA 3UKUA 4FZXC 1BDGA 3RSEA 1TYQA 2D0PA 1ITGA 3DAWA 5BPMA 4B3OA 1X9MA 3E9PA 4O0JA 3K5LA 4WFNL 2BGGA 3C65A 3QFUA 5EOYA 5FDLA 3D2FA 4I2PA 5KI6A 4CJRA 1NK7A 2AP1A 4DQ8A 3LL3A 4DTMA 2Z1GA 3DOLA 3MEGA 1QSYA 5JVHL 1CLQA 3N4QA 1NGIA 3VENA 2VG6A 1C0UA 2ASPA 5AQWA 4CZIA 1D9FA 1NGFA 1U2VB 4JLHA 1NG9A 5J2MA 4FZZA 4NCAA 3SUPA 1WSEA 5JICA 3MN7A 1IG9A 3HPGA 1XNQK 3OYJA 2GV9A 3L2VA 4ID1A 3ZLJA 4OPJA 3AVBA 2UU9K 1EWQA 3SMPA 1GLCG 1WSFA 2F7TA 2YCHA 3K0SA 3VA3A 3TTDA 1EP4A 2ZM6K 4DTJA 3OYEA 4RCHA 2OPSA 4CJ7A 2BE2A 4IG0A 3HRGA 3MX5A 4LFCK 3AO1A 4YOUA 1BQMA 3ZSQA 1YTAA 3U3GA 4DQIA 2FF3B 4B9QA 3CJBA 4F9OA 3O9QA 1BCOA 5AZJA 4KI4A 1TV6A 4BR5A 1RBRA 3DOKA 1NJIO 1DGKN 2NRZA 4JI1K 3HM9A 5EU7A 4PKIA 3M8PA 4PKGA 3ZSZA 3LDOA 4IOCL 5BRDA 5M1FA 4A5BA 1KAZA 3CJ9A 2IC3A 4A5AA 2FBVA 1UA0A 1X9WA 2XHBA 2GWKA 1NGJA 3QINA 4DTPA 3AGKA 5FPMA 3VQPA 4E7KA 1HNWK 3VTHA 3SQ4A 4BACA 3CJ1A 3SMSA 4FJ9A 4I7FA 4CGFA 3WT0A 1X3MA 3KLGA 2W6KA 1X9SA 4ISGA 4B3TK 1RBTA 4DR6K 1HNZK 1TUUA 3ZEUA 1WAFA 2E6LA 4GMJB 4DTRA 3RRHA 4JHDB 4E7HA 3LP3A 3D0PA 1HNVA 1BIZA 4DR1K 1MDUB 5FPDA 3CCLN 2A3ZA 3V9ZA 4K25A 3J7ZO 3CCEN 2WTUA 4OPAA 4KHQA 2V52B 4J2EA 4Z4IA 2PZSA 4JK8A 1NGAA 4CZGA 1SKWA 3VA0A 3M8RA 2P9NA 1QTMA 4LD0A 3U9ZA 5AQUA 5BN9A 3L4QA 3HT3A 2O8EB 4JI2K 1W97L 3E01A 3CYMA 4AILC 2Q36A 4H03B 3C7NB 2FXUA 4FJMA 3T7ZA 1SL0A 4CF9A 3O4WA 1CXQA 5F0XA 2HHHK 2KTQA 3QICA 3CC7N 3O6WA 1HPZA 4QS7A 2YJEA 2HHVA 1N5YA 4LSNA 4HHTA 4AH9A 4JV5K 5TKYA 4O4GA 4I2QA 4JI8K 3O3HA 5FROA 4E7LA 3TAFA 3ULEA 1FKOA 5HROA 2RE2A 3L3UA 2A41A 4K43A 5CE3A 3JAMO 3PO5A 4HCBA 2HF3A 1KFSA 4KRFA 3AA5X 1VSJA 5AQTA 1VSDA 4UQGA 4FJNA 3QERA 4JKFA 4CF1A 1WB9A 4CFAA 4CGDA 5SWMA 3CJCA 4DV0K 3TAMA 3L2UA 2UYTA 3SPZA 1W7AA 4BVOA 4FJXA 4CF8A 4Z0UA 2O8BA 1S1UA 5JS1A 1VK0A 3O08A 3NF7A 4H0PA 1OH7A 3W3DA 2G8VA 1UOCA 3O1BA 3BP8A 5FRNA 3S3NA 4E1NA 3KKRA 3WXJA 4JI7K 3V1QA 5I3UA 3L2RA 4ILGB 3AAQA 4H4OA 4CI6A 1YJWN 3CCRN 3R1XA 1T44A 4KTZA 3ZSXA 3THWB 2QK9A 3ATUA 4EIAA 3FE1A 4A57A 2HVIA 4CZFA 4M45A 1VQ7N 4ZTJA 5CYQA 1C1AA 4DTSA 4CJ3A 2VGMA 3MN9A 2IDOA 2P9KA 4FLXA 2HOEA 1T6CA 1WSIA 4DHYA 2IVOA 4OLAA 3CC4N 1IBMK 5AQHA 3VQEA 3BGRA 3CD6N 4M3TA 2P9IA 4DKWA 3HM8A 5AFUA 1RILA 5E26A 4F2RA 3NF8A 4FJLA 4K42A 1HRHA 1TAQA 2X78A 1VSKA 4OPHA 1RCHA 2IVPA 4DTXA 3MK6A 4IJAA 1DLOA 4CECA 3TR8A 2HHTA 4CHZA 4CHOA 3QFPA 4O0IA 1DKGD 4CBWA 4KBOA 1KAXA 4DU1A 1NK0A 1T8EA 1NK4A 1RT4A 1LV5A 3SV4A 1Q82O 1NLVA 4NXMK 3LM2A 2WFBA 4ZTFA 4OLBA 1NK8A 3AGRA 4X66K 3RMDA 2Q2RA 1CXUA 2D0BA 4FLWA 3EKUA 3OY9A 3NGYA 4CVNE 1TKDA 3J80O 3ISNC 4OVLA 2GEMA 4BC2A 4MLEA 1ZBIA 5C2DA 4F3OA 3QESA 4RW9A 3M6GA 3CMEN 5HBMA 2E8AA 2QW9A 2Z1IA 1X9JA 4CESA 2A6AA 2QM1A 1M1KO 5I9EB 1S6PA 1HPMA 4F3TA 1J54A 1RBSA 2KHOA 4G1QA 2ZGZA 4Z4FA 3K2PA 5HLFA 3TSPA 1HUXA 4DLEA 1I94K 3NBPA 3OW2M 4JS4A 2AA4A 4ILHA 3P5JA 4FM1A 4DF8A 4YDUC 1U04A 3MN5A 4DF4A 2F96A 1BWFO 1Y97A 4H5TA 3HZ6A 4YOXA 1TKTA 1J53A 3RSEB 5CZ2A 2RN2A 4DG1A 3OJSA 1NJWA 1I3AA 3THYA 4DCHA 3K59A 1BOTO 2DY4A 4FL9A 4KH6A 3AAPA 3S3OA 1JXBA 5E41A 2YHAA 3D2FB 1TK0A 4R79A 4QOZB 3M5RA 3D7EO 3M3ZA 4JKGA 3JSMA 3LDLA 4B3MK 1VQKN 3SQ1A 1TKXA 2VWJA 3AVMA 4JKBA 4CHNA 1CZ9A 4GV9A 4FK0A 4FLUA 1BA0A 3AO5A 1ZYQA 1M90O 1O1WA 1RNHA 4CEFA 3ZYYX 1UA1A 1IKWA 5SZTA 3U3YA 5LJWA 4N76A 4RWTA 3CCJN 3WNHA 3O9UA 4IKFA 2HVHA 3I56N 3KLIA 2HBMA 3EN9A 4KV8A 3UE5A 1MU2A 4CJWA 5LMNK 2GWJA 2PYLA 3TABA 4NYFA 1RDCA 4FO0A 5GAHP 3QDKA 3NH1A 4DU3A 3PIPL 1HYSA 3VQQA 2OCEA 1RDDA 2D0OA 1K73O 3JYTA 4LSLA 4K41A 4BDYA 1D8YA 4CJUA 2Q0RA 3K9JA 5AQJA 4FJ7A 1VQLN 1TUYA 2HBLA 5AZJB 3QBWA 3OYLA 1XQSC 3F2KA 1NMDA 4L8RB 1L3VA 3BF1A 2P9PA 5BRFA 1WBBA 3OYBA 1TL1A 5C10A 3PIOL 1N8RO 4GVEA 3CETA 4RW8A 2FSKA 2Q3SA 2IGIA 3H6EA 3OYHA 1KVCA 4DV4K 1SKSA 2JLEA 4PY5A 1NGGA 4Q5VA 3NVMA 4BRKA 3ZSYA 4I9QA 4ISEA 4CJLA 4CW7B 4PL8A 4BRAA 1RDWX 1T05A 1SS6A 2FLOA 4FOEA 3OYMA 1TGOA 3SZ2A 3AVJA 4H0OA 4U7BA 3ZT0A 4AHSA 1VQ6N 5HP1A 1N6QA 3ZEUB 5C2FA 4DV6K 1D9DA 4CEBA 1WSGA 2E6MA 3P31A 1XHZA 2RPIA 4JKAA 1NOYA 1KFDA 3HOTA 3DRPA 3OA9A 1KCFA 4O55A 2XY6A 4KB1A 2QWQA 4AF1A 1YAGA 5AR0A 1EO1A 3KHYA 3DMJA 3G0ZA 3VQ6A 1K8KA 5CZ1A 2P51A 4W5TA 4KPYA 2P9NB 4BDZA 3S3MA 4IBNA 2FC0A 3VQCA 1B9DA 2BTFA 1JLAA 4GV3A 1ZBFA 1XNRK 2V7YA 2UUCK 3O8MA 3ZT4A 2A1SA 3LM9A 4BRMA 3HK2A 4W5NA 3UKRA 2LSNA 2DFHA 2NRHA 1JLGA 3WXKA 1XI1A 4FJ8A 3LZJA 1WBDA 3L3VA 2NUBA 4JKHA 5M1NA 4B8AB 2BUPA 5JS2A 4BGBA 3K9KA 4CJKA 5GAEP 2UXCK 3IDHA 1Z25A 5K14A 1LOTB 4FWKA 4XH1A 3V81A 3K58A 2X74A 3OS1A 2FBTA 4BWMA 2AJQA 4CIEA 4H0YB 1Q9XA 4CJ5A 4Z4CA 3VQ5A 3TU5A 3DLLL 5MLCQ 2QI2A 1NJXA 4R5PA 5AQLA 3NF6A 3B8AX 4UY8O 1R59O 3J81O 1VSEA 2ZE2A 4Y0WA 3WUHA 1NWKA 4CZJA 2I7PA 1RFQA 2O8BB 4BC3A 2NRXA 2PFUA 4H8KA 4KI6A 4O8KA 1LAWA 2YNFA 2VQFK 1NMNA 2YX6A 4JRPA 3CI5A 3THXA 4KO0A 3VERA 3H3OB 4AHVA 3H08A 3ZCMA 5HRNA 4YOWA 4KH4A 3LDQA 4YDUA 1BISA 4FWRA 1OVQA 3I55N 1RBUA 5LMUK 4DR3K 4N41A 4MLHA 5AQIA 5M1OA 3FFIA 2NLXA 4FPBA 1C0FA 2P9KB 3UB5A 2NRVA 4NLCA 4FCYA 5HRSA 4C23A 3CCUN 2P9IB 1JLFA 2VG7A 4JNEA 1YTUA 3WQUA 3VEZA 2EWSA 4IO8A 1JL2A 1EQYA 1RT3A 3WXIA 2R7YA 3V1OA 4CK2A 4DV1K 4CFBA 3TSQA 2P9UA 3UIQA 1J9AA 1RT2A 4KKOA 1NGBA 4CGHA 1ASWA 3KIOA 4DSKA 3CFOA 4EZ6A 5BRHA 1FXXA 1WAJA 3KK7A 4FLZA 1NJZA 4ILJA 3QMLA 1KSPA 2G8FA 1GLAG 2FBYA 2CH5A 1VSLA 1VHXA 1GOAA 5KQ8A 4OPKA 2Q31A 1KXPA 4JI0K 4EZ9A 4CEAA 1GLLO 4FZYA 1MWKA 3H45C 1KLNA 3NVKA 1XMOK 2P9SA 4B3SK 4DS4A 2QWMA 2PBDA 1IBLK 3RMAA 1UWBA 2WOMA 3LPUA 3T1YK 4YOTA 3CC2N 3IKMA 4K8XA 4GY2B 1XC9A 1YJNN 1BIUA 4BDPA 1RDAA 1Z6RA 1IV0A 3M1FA 4FM0A 4DQRA 4B1UB 2E5LK 4IWVA 3U6FA 5KQDA 2YHBA 4WQ5A 1BI4A 3SQ2A 1NOZA 4JN4A 4X65K 5AQOA 2OPPA 3FZKA 3U9DA 3PV8A 5M1KA 3HP9A 1ATRA 2J4RA 4Z94A 4FJHA 2GX9A 4OGEA 3SNNA 3DLBA 3TSUA 3NCIA 3WEEA 4HTUA 1LW2A 2H3GX 3LP1A 5J2NA 3O4QA 4BRCA 1NGCA 2YHYA 3BZKA 2V7ZA 3DLGA 1XWLA 4LY7A 4M63C 3CMAN 1YJ9N 4LF8K 1RTIA 4CEQA 4DR5K 4C1NK 1DEJA 4CIFA 3VEXA 1GLDG 4B1YB 4GKJK 2QEXN 3WXLA 2O8DA 4HTLA 3THYB 1DT9A 4BQLA 3CPWM 1OVYA 3QEIA 1S9EA 3FZFA 2IS3A 2ITGA 3G71N 1K9MO 4DQQA 4XH4A 3MX2A 5GIOA 1A5XA 3DLRA 2YNIA 3GOIA 3P1GA 4JKGB 1E4FT 4KAZA 4CEZA 5C0YA 4CGIA 2X6NA 4DWIA 4OO1J 3DM2A 5B8HA 2D0AA 3AY9A 2X6SA 4B08A 3RR8A 3VQBA 3OYFA 2HMPA 3DXKB 2G8UA 3TI0A 4FLYA 4O5BA 4CZHA 4N5SA 1NKEA 3H1QA 4E0DA 4QS8A 3F9MA 1W9HA 1EKEA 1VSFA 2GUIA 5GADP 3NGIA 3GE1A 3O9RA 4RW4A 3J7AP 4LFBK 3QIPA 4ICLA 4GW6A 2E1ZA 1VAZA 1TAUA 3ZETA 4C8KA 3B6OA 1SL2A 2YV0X 4DMNA 2ZGYA 4GV6A 4JKDA 4LC9B 4DFJA 4BC4A 4CCHA 2DPNA 3D2EA 3ZSRA 4Z4EA 2XY8A 3QEVA 4DB3A 1Y64A 1KQSM 3O1WA 1RDBA 4NO7A 4FWQA 2FF6A 3V9SA 1S9GA 1P90A 2V51B 1L3TA 1H1VA 4NXNK 3AVNA 5EX5A 4ELUA 4OX9K 2O4GA 1DTTA 1WSHA 4B1VA 2P9PB 4BVPA 1IH7A 3AA3A 4C8LA 3D6RA 2RF2A 4M3UA 1CZAN 2ZQBA 1L5UA 3ATVA 3F73A 4O44A 1HYVA 1F21A 5KPTA 4AM6A 4QS9A 3SJHA 5CY4A 1S6QA 3VTIA 3VEWA 3MWPA 1SUQA 1BHLA 2VGNA 3V4IA 1VQON 1X1PA 2JGUA 1RGIA 3QEPA 3E9LA 4BRQA 3LAKA 5JMVA 2UUBK 3U8XA 5AQNA 1FKPA 4BWJA 3C95A 3KWIA 1S22A 3WXMB 4KTQA 4OKEA 3CQ8A 3VF6A 3PSIA 4IXCA 2B4JA 4B1XB 4I6MA 4N56A 1KVAA 5F2RA 3E1YA 2ZJQL 1KD1O 4A62A 5HRRA 4B3RK 2F9WA 4JK7A 3A5MC 1J6ZA 3LDNA 2I7NA 3V9UA 3AVCA 2E1YA 3U4LA 5IT9O 1IJJA 1ZBSA 3MEEA 2HF4A 4NB4A 2Q0UA 2QWOA 1NGHA 3C6UA 4BROA 1RTDA 1RT1A 3L4IA 1K8KB 1LAVA 3D45A 4ID5A 1NJYA 4DTNA 2KZMA 2VWBA 2D4WA 4FVUA 2JWKA 4GKKK 2HHSA 3VEVA 1Z05A 1QSSA 1TVRA 4BR2A 3VGLA 3P38A 3EE9A 3I33A 3CQYA 5D3GA 1QZ5A 4JYAK 3CJ7A 3ZT1A 1QQCA 4IFEA 3NHGA 4F4KA 4M3ZA 3SUNA 4KB0A 5AZIB 1S1TA 2P1JA 4CJEA 1QQMA 1VQ9N 4CZMA 3P39A 1YITN 1V4SA 4HVJA 4AHTA 2YHWA 3CIPA 2O8FA 4XH5A 4Q0BA 3H1VX 3T19A 3OBYA 3KD1E 5BREA 3UKUB 3SAHA 5FLXO 4CJ4A 1TYQB 3BY5A 3KVGA 4BRPA 1N33K 1IG8A 4KHUA 4M3RA 3PSFA 2ETJA 5FPEA 1KVBA 3IFRA 4H5WA 4CF2A 1YIJN 3MMVA 2NRRA 2OZSA 3LANA 5AQRA 1NGEA 2O8EA 3L0QA 3DRSA 4CERA 3E66A 5AQXA 5C12A 2GBZA 4Y1CA 2RHKA 1JXEA 1TL3A 3DLKA 3NDKA 1VRUA 1XC3A 4DV2K 3THXB 3H46O 4CEDA 1QHTA 3VQ9A 3VOVA 3J8AA 3DI6A 1ESVA 1IKVA 2F8SA 3KK1A 5H1SQ 1QVGM 1LWCA 1RBVA 4CZEA 3EKSA 1YVNA 3AO3A 1SV5A 4M3WA 4FPAA 3HXMA 1ILYA 2QKBA 4B9VA 2FSNA 4O8UA 2OTJN 3CCMN 4IDKA 5AQKA 4BREA 4BG9A 2Y1IA 2XY5A 3KLFA 5AQFA 3VQ4A 5T7BA 2OYQA 1FK9A 4W5QA 3V9XA 3QETA 2P9UB 1LWEA 3CQXA 1HKBA 1NK9A 2YKNA 1QHAA 5DM6L 1S72N 5HL7L 1N34K 3HP6A 3MECA 2HHQA 3ALYA 3R9PA 5HOOA 4FWPA 3K5OA 3ZSVA 2NZTA 4DR4K 3R6MA 3DLHA 5DM7L 3V9WA 1U6ZA 3CFPA 1J5EK 3HTVA 2YJFA 4FW1A 3VMFB 5J2PA 4E89A 3MCPA 4DSJA 3QLHA 4FWNA 4KHSA 1EXQA 1MA9B 4DUZK 1VRTA 2NRTA 5BPLA 2XO7A 4KHNA 3THWA 4JRQA 4C8OA 2OPRA 4V19S 3KZBA 2RKIA 4C1NI 4HUGA 3VETA 5KPRA 3MXMA 1XUPO 1LWFA 5GIPA 1VSMA 3T69A 4M7XA 3OTOK 4PL7A 4HUEA 5AQYA 4KHWA 5AQQA 4DQPA 4FJJA 3RMCA 4DSIA 3P4IA 4M3YA 1GLJO 3PLAA 4DTUA 2KFNA 1OKJA 1D4XA 4JK9A 1GOCA 1BI4B 3OVNA 2O8CA 2QWRA 1ZBUA 4M41A 5JVGL 5JLHA 4RG8A 3CXCM 3PY8A 4DV3K 1ATNA 3HI0A 3IRXA 4CGJA 3JXUA 3KK2A 4FW2A 4HUFA 1QSLA 3OYIA 4KREA 4YNQA 3BUZB 4CD1A 3WEEB 4M7YA 1R0AA 4BRDA 3VQDA 4RTFD 3NF9A 3A5LC 3AVAA 4E1JA 3HL8A 4CJQA 2IVNA 1Z26A 3MWTA 1RTHA 3VPZA 4H5NA 4C8NA 4Z4GA 4G9ZA 2FSJA 2I5JA 1GLEG 3I0RA 4BGAA 1L3SA 1BL3A 2QA4N 4KFBA 4E7IA 4JEPA 2O8DB 3CM6A 3TAEA 3SYZA 1NGDA 2P5GA 2KLAA 3VF4A 4FK4A 3EEQA 2GTDA 3ITHA 3CCVN 2EHGA 3ENOA 5IWAK 2PAVA 2NRWA 1QS4A 2XRIA 1YI2N 3ULEB 2F9TA 4CK3A 4BE1A 4CEEA 3HVTA 3SK3A 3NE6A 4DSLA 1HJRA 1Q86O 4BR9A 3ENHA 1U45A 3AVLA 2DFFA 4DLGA 3G6EN 1L3UA 3OYDA 4BR0A 4EFHA 5AFUH 3FFKB 5BR9A 3LPTA 2HMIA 4HWIA 2Z1HA 3O9TA 1KTQA 3ENBA 4WFAL 4LF9K 3RR7A 1BA1A 3SI6A 3HVRA 4JI3K 1G99A 2P9LA 2HBKA 4MDAA 3CJAA 2WUSA 3CERA 3S41A 4U67L 5JLFA 3EZWA 2YHXA 3TARA 4PKHA 1X3NA 4YOVA 4IOXA 4RW7A 2CH6A 4JD2A 3DLEA 1WLJA 2ZJRL 5KGWA 4FLVA 1IBKK 4CJSA 4X62K 1Q81O 3D2EB 1U47A 2ZD1A 1A5VA 3NH2A 3AO2A 3B6PA 5F1XA 4FYDA 3A5NC 4WQ4C 1VSIA 1JCGA 1JCFA 3FGUA 3GG4A 4OKJA 3AVIA 3BEXA 3HO1A 5BR8K 4B9LA 3DWLA 3KLHA 1D5AA 2QKKA 1VQ5N 2E2NA 4LF5K 3C6AA 1UAXA 5GINA 2BDPA 4CZKA 4B8CA 1OH6A 2E2OA 3FZHA 3OYGA 3QNNA 1NM1A 1W2BM 3KLEA 1HNIA 3TWHA 1V4TA 1SAZA 4I6MB 1NK6A 1BCMA 4A2BA 4B9MA 4CJVA 3NFAA 4JKEA 3J7YP 4FWLA 5LJVA 4IO9L 3CF5L 4FM2A 5KGXA 2E88A 3WNGA 3NH0A 4WCEL 1WUAA 3AVHA 2W41A 1JLQA 1W0HA 2D1KA 3IAYA 2G8KA 3K5MA 1IKYA 4EHUA 5C25A 3OBWA 4CZLA 1GOBA 4BRIA 4LF6K 4NYNA 5ADXA 3OYCA 4TSXA 3HYFA 3BZCA 4H0TB 3C94A 1JLCA 1VSHA 5AQPA 3ULDA 3MN6A 3EO3A 5AQMA 4BC5A 3AVGA 4CJFA 3QEXA 2G8IA 2NNWA 4A61A 3HPHA 2HNZA 1EETA 2HB5A 4F8RA 4DFPA 5AQVA 2WONA 1BGXT 3GL1A 4FK2A 3ID8A 2A1RA 3SLCA 5EXWA 4DR2K 3TAGA 1JLEA 1HLUA 2A40A 1EX4A 3HSCA 3EE8A 1TK5A 4M3XA 1K6YA 1EWRA 1HMVA 3WQTA 2BANA 3C6TA 1QVFM 2P5OA 3CM5A 1YT3A 3QBXA 3G10A 2O8FB 3OHRA 3Q7BA 4B1ZA 4AQYK 3OS2A 1E4GT 3AVKA 3O4NA 3VF2A 5BN8A 2CGLA 3THVA 2E2QA 4J2DA 3TANA 2QWNA 2Z1JA 4AHRA 4A59A 3S9HA 4CBUA 4CFDA 4ELTA 5TKWA 3KTQA 4IFYA 2KW4A 1KRPA 3CHWA 4OGCA 3EL2A 3A2FA 3NGZA 4CD3A 5C24A 1HR0K 4AHCA 2VG5A 1NK5A 4MO4A 2HHXA 1A5WA 2ZJPL 2UXBK 3Q7CA 4PQUA 1S3XA 2ATQA 4A2AA 1HKGA 3VGKA 2HNYA 5EVZA 4X64K 1ZC6A 4FWMA 3HOSA 3O5BA 3EZ5A 1JLBA 4E19A 2F4VK 3ZT2A 1HKCA 4EHTA 4AM7A 4AHUA 3HPOA 4EP4A 5ELZA 3DXMA 4WE1A 4JI6K 1LW0A 3L2QA 3O3GA 4YHHK 4CFCA 4DR7K 2KZZA 1WSJA 5M1QA 4WF9L 4CK1A 5C42A 3ZSWA 4EAHD 2HHUA 4WFBL 1C0MA 1YVUA 4L3QA 4BR4A 3AA2A 4MQ3A 3I8DA 3JS6A 1N32K 1NBWA 1P8ZA 4I9LA 5KRTA 2XY7A 1YUWA 3VESA 3HSTB 4IDHA 1HNXK 1HJOA 2W6LA 1HQEA 4LFAK 2PY5A 1IKXA 4ELVA 4BE0A 3TAQA 1S1VA 4Z4HA 3SQ0A 3PX6A 3SBTA 4J2AA 4NLBA 1N36K 3VN5A 5A2QO 4F2SA 4YFUA
chains in the Genus database with same CATH topology
3DI6A 3QINA 4DSFA 4DTPA 3VQPA 4E7KA 1XI1A 4FJ8A 4OJRA 3LZJA 2B5JA 3SQ4A 1TK8A 1U48A 3L3VA 4BACA 2NUBA 4B8AB 3RMBA 3AVFA 1T7PA 5JS2A 1IKVA 4FJ9A 2F8SA 4I7FA 4CJKA 3KK1A 4N47A 4CGFA 2VWKA 4W5OA 3EY1A 1LWCA 1RBVA 4CHPA 3KLGA 3AO3A 1X9SA 1Z25A 3IAYA 5K14A 3P83D 1NKBA 1RBTA 1SV5A 3VQAA 4M3WA 3HXMA 2O4IA 3V81A 3K58A 5DK5A 4CJTA 2X74A 3OS1A 3QO9A 2QKBA 1WAFA 2E6LA 2FBTA 4GMJB 4BWMA 4B9VA 4DTRA 3RRHA 3MXIA 4E7HA 4IDKA 2AJQA 3LP3A 3WNFA 4CIEA 4EP5A 3D0PA 2Y1IA 1HNVA 1BIZA 2XY5A 1Q9XA 4CJ5A 4Z4CA 3VQ5A 3KLFA 4DU3A 3V9ZA 2G8WA 3VQ4A 5T7BA 1NJXA 1ASVA 4R5PA 2OYQA 1FK9A 4W5QA 3V9XA 3QETA 3NF6A 1LWEA 3SV3A 2OZMA 4KHQA 1NK9A 4J2EA 4Z4IA 2PZSA 3OYAA 2YKNA 1VSEA 4B9NA 3HP6A 3MECA 1SKWA 2HHQA 2ZE2A 1TKZA 3ALYA 3VA0A 3M8RA 3K57A 3K5OA 3ZSVA 1QTMA 4LD0A 3PUFA 3DLHA 3HT3A 3EYZA 3V9WA 5J2QA 3E01A 3CFPA 3CYMA 4E1MA 4AILC 4H8KA 4FW1A 4KI6A 3IS9A 5J2PA 1LAWA 4E89A 3KKSA 2YNFA 3DRRA 4ZHRA 1RTJA 4JRPA 4DSJA 4FJMA 1CZBA 4XIUA 3QLHA 4KHSA 2HW3A 1EXQA 4KO0A 4DTOA 1SL0A 4CF9A 4JS5A 4AHVA 1VRTA 3H08A 2XO7A 3ZCMA 5HRNA 3BDPA 1S5JA 1CXQA 4DU4A 4JRQA 4C8OA 3SCXA 4KHNA 2KTQA 2OPRA 1HQUA 3NAEA 1HYZA 1HPZA 2HHVA 3QNOA 1BISA 2RKIA 1N5YA 4HUGA 4LSNA 1RBUA 3MXMA 4HHTA 1SKRA 1DTQA 4AH9A 4N41A 1SL1A 4O4GA 1LWFA 4I2QA 1VSMA 2E4LA 3O3HA 3FFIA 5FROA 4E7LA 3TAFA 1I39A 1J5OA 4HUEA 1FKOA 5HROA 4KHWA 4DQPA 4FJJA 3RMCA 4FCYA 5HRSA 4DSIA 3L3UA 1RT6A 3V6DA 4DTUA 2KFNA 1JLFA 2VG7A 4CF0A 2PYJA 1YTUA 1GOCA 1WN7A 1BI4B 3OVNA 3SPYA 1Q8IA 3PO5A 1JL2A 1ZBUA 4HCBA 4M41A 2YKMA 1KFSA 4GVMA 2IAJA 5J1EA 4RG8A 3ZT3A 3TAPA 4KRFA 1RT3A 3PY8A 2R7YA 3V1OA 4CK2A 4CFBA 3AA5X 1VSJA 4E3SA 4OKKA 3IRXA 1VSDA 4CGJA 3IG1A 4UQGA 3KK2A 3UIQA 3QERA 4FJNA 4J2BA 1J9AA 4CF1A 1RT2A 2Y1JA 4FW2A 4KKOA 4CFAA 4HUFA 4CGDA 4CGHA 1ASWA 3OYIA 3SJJA 1QSLA 5SWMA 3KIOA 4KREA 4YNQA 4DSKA 3CFOA 4EZ6A 3TAMA 3LDSA 3L2UA 1R0AA 3VQDA 3SPZA 3NF9A 4FJXA 2HHWA 4CF8A 4Z0UA 3AVAA 1FXXA 3HL8A 1S1UA 4CJQA 5JS1A 1VK0A 1Z26A 3NF7A 1RTHA 1WAJA 4C8NA 4Z4GA 2G8VA 1UOCA 5FRNA 3S3NA 4E1NA 4FLZA 3KKRA 1NJZA 1KSPA 2G8FA 3V1QA 2FBYA 1VSLA 5I3UA 3L2RA 2I5JA 3I0RA 1GOAA 1L3SA 4OPKA 1BL3A 4H4OA 4KFBA 4K8ZA 4E7IA 4EZ9A 5KRSA 3CM6A 4CEAA 3OJUA 3TAEA 4FZYA 4KTZA 3ZSXA 3SYZA 1KLNA 4DS4A 2QK9A 3O3FA 2P5GA 2YNHA 4FK4A 2HVIA 3ITHA 4M45A 3RMAA 1UWBA 2EHGA 4ZTJA 2WOMA 3LPUA 3QIOA 5CYQA 1C1AA 1C1BA 4DTSA 4CJ3A 1QS4A 2XRIA 4K8XA 1XC9A 2IDOA 1QE1A 2B6AA 1BIUA 4FLXA 1WSIA 4BDPA 1RDAA 3ASMA 4OLAA 4CK3A 4FM0A 3T3FA 4DQRA 3VQEA 4CEEA 3BGRA 4BE1A 4DFKA 3HVTA 4M3TA 3NE6A 4RW6A 3U6FA 1HJRA 4DSLA 3T1AA 3VQ7A 2YHBA 1U45A 3AVLA 1BI4A 2DFFA 3SQ2A 3V1RA 4DLGA 2F8TA 1NOZA 1L3UA 3OYDA 1RILA 4FJKA 2OPPA 4F2RA 3KK3A 2EX3A 3LPTA 3NF8A 2HMIA 2OPQA 2Z1HA 3PV8A 4FJLA 1KTQA 4DSEA 3SUOA 1HRHA 1TAQA 3HP9A 2X78A 1VSKA 3RR7A 1RCHA 4DTXA 4FJHA 3DYAA 4CECA 1DLOA 3HVRA 4OGEA 3TR8A 3SI6A 4CHZA 4CHOA 2W42A 3SNNA 3DLBA 3LALA 4O0IA 4QAGA 3NCIA 4HTUA 4DU1A 1NK0A 1T8EA 1LW2A 1NK4A 3LP1A 5J2NA 4CGGA 1RT4A 3K5NA 3O4QA 1LV5A 3SV4A 3VQ8A 3PX4A 3TARA 4ZTFA 2QXFA 4OLBA 1U49A 4BE2A 5DMRA 3DLGA 1XWLA 4LY7A 3L8BA 1NK8A 2DFEA 1RT5A 4RW7A 3I0SA 1RTIA 3DLEA 1WLJA 4CEQA 4CHQA 3RMDA 1B9FA 4FJ5A 5KGWA 1CXUA 2D0BA 4FLVA 4FLWA 2D5RA 4CJSA 4W5RA 4CIFA 3OY9A 1C0TA 3NGYA 1TKDA 1U47A 2ZD1A 1A5VA 4CJPA 3ISNC 3M8SA 4OVLA 3LAMA 3NH2A 4B9UA 2KFZA 3LWMA 3AO2A 1JL1A 3B6PA 1S1XA 1XHXA 4FYDA 4DQSA 1ZBIA 4FXDA 3QEIA 5I42A 1S1WA 1S9EA 4F3OA 3QESA 3M8QA 4RW9A 4M3YA 1BQNA 1VSIA 3LZIA 4QCLA 2IS3A 3LWLA 2ITGA 4OKJA 5FRMA 3AVIA 3AO4A 2HNDA 4DQQA 3HO1A 5HBMA 1ZBHA 4B9LA 1A5XA 3KLHA 4E7JA 1D5AA 1KLMA 1IO2A 2Z1IA 3DLRA 2YNIA 4PWDA 2QKKA 3P1GA 3LP2A 4KAZA 3MEDA 4B9TA 4CEZA 4CGIA 2X6NA 4DWIA 4CESA 3DM2A 4FJGA 4NCBA 2D0AA 1G15A 1UAXA 2X6SA 4NCGA 4C8MA 3VQBA 1ASUA 4B08A 3OYFA 3RR8A 2G8UA 4HCCA 3TI0A 4FLYA 2BDPA 1S6PA 4O5BA 4N5SA 5HRPA 1NKEA 1REVA 3L2WA 3SUQA 4E0DA 4MFBA 4F3TA 1J54A 1W9HA 1EKEA 1RBSA 1VSFA 4B8CA 3OS0A 4G1QA 1T03A 3RRGA 2GUIA 3OYGA 4DFMA 3NGIA 4Z4FA 4CE9A 3QNNA 3PO4A 3K2PA 4LH5A 1B92A 5HLFA 4RW4A 3KLEA 4DLEA 3NBPA 3RTVA 4JS4A 3OYKA 3ZSOA 3MXJA 3QIPA 1HNIA 3TWHA 4ICLA 3P5JA 3PX0A 4GW6A 1NK6A 4FM1A 1BCMA 4DF8A 4B9MA 3HJFA 1U04A 4FVMA 4M42A 4DF4A 2F96A 5KTQA 1TAUA 4CJVA 3NFAA 1Y97A 3B6OA 1SL2A 4C8KA 2YV0X 4H4MA 1WNSA 4DMNA 3RWUA 2DTUA 1TKTA 4FM2A 5KGXA 4DFJA 1J53A 4CCHA 4FJIA 3WNGA 3ZSRA 3NH0A 4Z4EA 1ZBLA 2XY8A 3AVHA 3QEVA 5CZ2A 2RN2A 4DG1A 3OJSA 2OA8A 1JLQA 1NJWA 4Y1DA 1I3AA 4B9SA 1W0HA 3K59A 1RDBA 3OYNA 2DY4A 3V9SA 2D0CA 1S9GA 3S3OA 1JXBA 3K5MA 1IKYA 5E41A 5C25A 1L3TA 2G8KA 3AVNA 1JKHA 4KHYA 2YHAA 1Q9YA 4ELUA 1TK0A 1GOBA 2O4GA 1DTTA 4NYNA 1WSHA 3CFRA 3OYCA 1U4BA 4TSXA 4CEOA 3HYFA 1IH7A 3AA3A 4FLTA 4C8LA 4QOZB 3C94A 2RF2A 4M3UA 2ZQBA 1L5UA 1JLCA 3JSMA 2YNGA 4KTWA 1VSHA 3F73A 4O44A 1HYVA 1F21A 3ULDA 2HHTA 5CYMA 3SQ1A 1TKXA 2G8HA 1NKCA 3KD5E 2VWJA 3AVGA 3AVMA 4CJFA 1CZ9A 4CHNA 3QEXA 4CIGA 4FK0A 2G8IA 3HPHA 5CY4A 1S6QA 2HNZA 1EETA 2HB5A 4FLUA 3AO5A 1ZYQA 3CG7A 3QEWA 4PA1A 1O1WA 1RNHA 1SUQA 1BHLA 4CEFA 3V4IA 1UA1A 4F8RA 4DFPA 1IKWA 1X1PA 4IG3A 2JGUA 5SZTA 3U3YA 3QEPA 2KQ2A 2WONA 3LAKA 3WNEA 1BGXT 4N76A 4BWJA 1FKPA 4FK2A 3C95A 3WNHA 1RT7A 4IKFA 4DS5A 2HVHA 2A1RA 4IFVA 3KJVA 4KTQA 3KLIA 3TAGA 4OKEA 1JLEA 3CQ8A 1EX4A 4KV8A 1MU2A 1C1CA 4CJWA 1TK5A 3LP0A 2B4JA 4M3XA 1K6YA 4N56A 1HMVA 2PYLA 3TABA 1KVAA 2BANA 3AA4A 3AV9A 3C6TA 4CHYA 4NYFA 5HRRA 1RDCA 2P5OA 3F9KA 1C6VA 2IOCA 3NH1A 3CM5A 1YT3A 3MAQA 2FBXA 3G10A 3VQQA 4LH4A 3V9UA 4PUOA 1HYSA 1RDDA 3AVCA 3OS2A 3JYTA 4FZXC 4LSLA 3AVKA 3O4NA 4BDYA 3THVA 4CJUA 3MEEA 1D8YA 1ITGA 4J2DA 3TANA 4B3OA 1X9MA 3C6UA 2Z1JA 4FJ7A 4O0JA 1RTDA 4AHRA 3K5LA 3S9HA 2BGGA 1RT1A 4CFDA 4ELTA 5FDLA 1LAVA 3OYLA 3KTQA 4IFYA 3D45A 4ID5A 2KW4A 1KRPA 4I2PA 5KI6A 4CJRA 1NK7A 1NJYA 4L8RB 1L3VA 4OGCA 3A2FA 4DTNA 3NGZA 2KZMA 3OYBA 5C24A 4DTMA 2Z1GA 1TL1A 3DOLA 3MEGA 1QSYA 1CLQA 4AHCA 4RW8A 2HHSA 2Q3SA 2VG5A 2VG6A 1NK5A 2IGIA 2HHXA 3OYHA 1KVCA 1A5WA 1C0UA 1TVRA 1SKSA 1QSSA 2JLEA 4PY5A 4Q5VA 4I9QA 3ZSYA 1D9FA 4CJLA 5D3GA 4PQUA 2ATQA 4JLHA 1T05A 5J2MA 3ZT1A 4FZZA 2HNYA 4NCAA 1QQCA 3NHGA 1WSEA 3SUPA 4F4KA 3OYMA 1IG9A 3HPGA 1TGOA 3EZ5A 3SZ2A 3OYJA 2GV9A 3AVJA 3SUNA 4M3ZA 1JLBA 3L2VA 4KB0A 4E19A 3ZT2A 1S1TA 4ID1A 4OPJA 2P1JA 3AVBA 4AHUA 3HPOA 3ZT0A 4EP4A 4AHSA 5HP1A 4CJEA 1N6QA 1WSFA 4WE1A 1D9DA 4CEBA 1WSGA 1LW0A 2E6MA 3L2QA 1XHZA 2RPIA 3O3GA 4CFCA 3VA3A 1WSJA 2KZZA 1EP4A 1KFDA 1NOYA 4CK1A 3DRPA 5C42A 3ZSWA 4DTJA 4HVJA 2HHUA 3OYEA 4AHTA 1KCFA 2OPSA 4O55A 1C0MA 1YVUA 2BE2A 4Q0BA 4IG0A 3AO1A 3T19A 3AA2A 4MQ3A 2XY6A 3KD1E 4KB1A 1BQMA 3I8DA 3ZSQA 4CJ4A 1YTAA 3U3GA 4DQIA 4KHUA 4M3RA 1BCOA 2ETJA 4I9LA 3DMJA 3G0ZA 3VQ6A 5KRTA 1TV6A 4KI4A 2XY7A 1KVBA 5CZ1A 4CF2A 3HSTB 2P51A 1RBRA 4W5TA 3DOKA 3LANA 2OZSA 4KPYA 4BDZA 3DRSA 4CERA 3S3MA 3HM9A 4IBNA 2FC0A 1HQEA 5EU7A 3VQCA 3M8PA 2PY5A 1IKXA 1B9DA 1JLAA 2GBZA 3ZSZA 4ELVA 1ZBFA 4BE0A 4Y1CA 3TAQA 1S1VA 3ZT4A 1JXEA 1TL3A 4Z4HA 2A1SA 3PX6A 3SQ0A 3DLKA 3NDKA 3HK2A 1VRUA 2IC3A 4J2AA 4W5NA 1UA0A 2FBVA 1X9WA 2XHBA 4CEDA 3VN5A 2LSNA 1QHTA 3VQ9A 2DFHA 4F2SA 1JLGA 4YFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DI6 A;  3QIN A;  4DSF A;  4DTP A;  3VQP A;  4E7K A;  1XI1 A;  4FJ8 A;  4OJR A;  3LZJ A;  2B5J A;  3SQ4 A;  1TK8 A;  1U48 A;  3L3V A;  4BAC A;  2NUB A;  4B8A B;  3RMB A;  3AVF A;  1T7P A;  5JS2 A;  1IKV A;  4FJ9 A;  2F8S A;  4I7F A;  4CJK A;  3KK1 A;  4N47 A;  4CGF A;  2VWK A;  4W5O A;  3EY1 A;  1LWC A;  1RBV A;  4CHP A;  3KLG A;  3AO3 A;  1X9S A;  1Z25 A;  3IAY A;  5K14 A;  3P83 D;  1NKB A;  1RBT A;  1SV5 A;  3VQA A;  4M3W A;  3HXM A;  2O4I A;  3V81 A;  3K58 A;  5DK5 A;  4CJT A;  2X74 A;  3OS1 A;  3QO9 A;  2QKB A;  1WAF A;  2E6L A;  2FBT A;  4GMJ B;  4BWM A;  4B9V A;  4DTR A;  3RRH A;  3MXI A;  4E7H A;  4IDK A;  2AJQ A;  3LP3 A;  3WNF A;  4CIE A;  4EP5 A;  3D0P A;  2Y1I A;  1HNV A;  1BIZ A;  2XY5 A;  1Q9X A;  4CJ5 A;  4Z4C A;  3VQ5 A;  3KLF A;  4DU3 A;  3V9Z A;  2G8W A;  3VQ4 A;  5T7B A;  1NJX A;  1ASV A;  4R5P A;  2OYQ A;  1FK9 A;  4W5Q A;  3V9X A;  3QET A;  3NF6 A;  1LWE A;  3SV3 A;  2OZM A;  4KHQ A;  1NK9 A;  4J2E A;  4Z4I A;  2PZS A;  3OYA A;  2YKN A;  1VSE A;  4B9N A;  3HP6 A;  3MEC A;  1SKW A;  2HHQ A;  2ZE2 A;  1TKZ A;  3ALY A;  3VA0 A;  3M8R A;  3K57 A;  3K5O A;  3ZSV A;  1QTM A;  4LD0 A;  3PUF A;  3DLH A;  3HT3 A;  3EYZ A;  3V9W A;  5J2Q A;  3E01 A;  3CFP A;  3CYM A;  4E1M A;  4AIL C;  4H8K A;  4FW1 A;  4KI6 A;  3IS9 A;  5J2P A;  1LAW A;  4E89 A;  3KKS A;  2YNF A;  3DRR A;  4ZHR A;  1RTJ A;  4JRP A;  4DSJ A;  4FJM A;  1CZB A;  4XIU A;  3QLH A;  4KHS A;  2HW3 A;  1EXQ A;  4KO0 A;  4DTO A;  1SL0 A;  4CF9 A;  4JS5 A;  4AHV A;  1VRT A;  3H08 A;  2XO7 A;  3ZCM A;  5HRN A;  3BDP A;  1S5J A;  1CXQ A;  4DU4 A;  4JRQ A;  4C8O A;  3SCX A;  4KHN A;  2KTQ A;  2OPR A;  1HQU A;  3NAE A;  1HYZ A;  1HPZ A;  2HHV A;  3QNO A;  1BIS A;  2RKI A;  1N5Y A;  4HUG A;  4LSN A;  1RBU A;  3MXM A;  4HHT A;  1SKR A;  1DTQ A;  4AH9 A;  4N41 A;  1SL1 A;  4O4G A;  1LWF A;  4I2Q A;  1VSM A;  2E4L A;  3O3H A;  3FFI A;  5FRO A;  4E7L A;  3TAF A;  1I39 A;  1J5O A;  4HUE A;  1FKO A;  5HRO A;  4KHW A;  4DQP A;  4FJJ A;  3RMC A;  4FCY A;  5HRS A;  4DSI A;  3L3U A;  1RT6 A;  3V6D A;  4DTU A;  2KFN A;  1JLF A;  2VG7 A;  4CF0 A;  2PYJ A;  1YTU A;  1GOC A;  1WN7 A;  1BI4 B;  3OVN A;  3SPY A;  1Q8I A;  3PO5 A;  1JL2 A;  1ZBU A;  4HCB A;  4M41 A;  2YKM A;  1KFS A;  4GVM A;  2IAJ A;  5J1E A;  4RG8 A;  3ZT3 A;  3TAP A;  4KRF A;  1RT3 A;  3PY8 A;  2R7Y A;  3V1O A;  4CK2 A;  4CFB A;  3AA5 X;  1VSJ A;  4E3S A;  4OKK A;  3IRX A;  1VSD A;  4CGJ A;  3IG1 A;  4UQG A;  3KK2 A;  3UIQ A;  3QER A;  4FJN A;  4J2B A;  1J9A A;  4CF1 A;  1RT2 A;  2Y1J A;  4FW2 A;  4KKO A;  4CFA A;  4HUF A;  4CGD A;  4CGH A;  1ASW A;  3OYI A;  3SJJ A;  1QSL A;  5SWM A;  3KIO A;  4KRE A;  4YNQ A;  4DSK A;  3CFO A;  4EZ6 A;  3TAM A;  3LDS A;  3L2U A;  1R0A A;  3VQD A;  3SPZ A;  3NF9 A;  4FJX A;  2HHW A;  4CF8 A;  4Z0U A;  3AVA A;  1FXX A;  3HL8 A;  1S1U A;  4CJQ A;  5JS1 A;  1VK0 A;  1Z26 A;  3NF7 A;  1RTH A;  1WAJ A;  4C8N A;  4Z4G A;  2G8V A;  1UOC A;  5FRN A;  3S3N A;  4E1N A;  4FLZ A;  3KKR A;  1NJZ A;  1KSP A;  2G8F A;  3V1Q A;  2FBY A;  1VSL A;  5I3U A;  3L2R A;  2I5J A;  3I0R A;  1GOA A;  1L3S A;  4OPK A;  1BL3 A;  4H4O A;  4KFB A;  4K8Z A;  4E7I A;  4EZ9 A;  5KRS A;  3CM6 A;  4CEA A;  3OJU A;  3TAE A;  4FZY A;  4KTZ A;  3ZSX A;  3SYZ A;  1KLN A;  4DS4 A;  2QK9 A;  3O3F A;  2P5G A;  2YNH A;  4FK4 A;  2HVI A;  3ITH A;  4M45 A;  3RMA A;  1UWB A;  2EHG A;  4ZTJ A;  2WOM A;  3LPU A;  3QIO A;  5CYQ A;  1C1A A;  1C1B A;  4DTS A;  4CJ3 A;  1QS4 A;  2XRI A;  4K8X A;  1XC9 A;  2IDO A;  1QE1 A;  2B6A A;  1BIU A;  4FLX A;  1WSI A;  4BDP A;  1RDA A;  3ASM A;  4OLA A;  4CK3 A;  4FM0 A;  3T3F A;  4DQR A;  3VQE A;  4CEE A;  3BGR A;  4BE1 A;  4DFK A;  3HVT A;  4M3T A;  3NE6 A;  4RW6 A;  3U6F A;  1HJR A;  4DSL A;  3T1A A;  3VQ7 A;  2YHB A;  1U45 A;  3AVL A;  1BI4 A;  2DFF A;  3SQ2 A;  3V1R A;  4DLG A;  2F8T A;  1NOZ A;  1L3U A;  3OYD A;  1RIL A;  4FJK A;  2OPP A;  4F2R A;  3KK3 A;  2EX3 A;  3LPT A;  3NF8 A;  2HMI A;  2OPQ A;  2Z1H A;  3PV8 A;  4FJL A;  1KTQ A;  4DSE A;  3SUO A;  1HRH A;  1TAQ A;  3HP9 A;  2X78 A;  1VSK A;  3RR7 A;  1RCH A;  4DTX A;  4FJH A;  3DYA A;  4CEC A;  1DLO A;  3HVR A;  4OGE A;  3TR8 A;  3SI6 A;  4CHZ A;  4CHO A;  2W42 A;  3SNN A;  3DLB A;  3LAL A;  4O0I A;  4QAG A;  3NCI A;  4HTU A;  4DU1 A;  1NK0 A;  1T8E A;  1LW2 A;  1NK4 A;  3LP1 A;  5J2N A;  4CGG A;  1RT4 A;  3K5N A;  3O4Q A;  1LV5 A;  3SV4 A;  3VQ8 A;  3PX4 A;  3TAR A;  4ZTF A;  2QXF A;  4OLB A;  1U49 A;  4BE2 A;  5DMR A;  3DLG A;  1XWL A;  4LY7 A;  3L8B A;  1NK8 A;  2DFE A;  1RT5 A;  4RW7 A;  3I0S A;  1RTI A;  3DLE A;  1WLJ A;  4CEQ A;  4CHQ A;  3RMD A;  1B9F A;  4FJ5 A;  5KGW A;  1CXU A;  2D0B A;  4FLV A;  4FLW A;  2D5R A;  4CJS A;  4W5R A;  4CIF A;  3OY9 A;  1C0T A;  3NGY A;  1TKD A;  1U47 A;  2ZD1 A;  1A5V A;  4CJP A;  3ISN C;  3M8S A;  4OVL A;  3LAM A;  3NH2 A;  4B9U A;  2KFZ A;  3LWM A;  3AO2 A;  1JL1 A;  3B6P A;  1S1X A;  1XHX A;  4FYD A;  4DQS A;  1ZBI A;  4FXD A;  3QEI A;  5I42 A;  1S1W A;  1S9E A;  4F3O A;  3QES A;  3M8Q A;  4RW9 A;  4M3Y A;  1BQN A;  1VSI A;  3LZI A;  4QCL A;  2IS3 A;  3LWL A;  2ITG A;  4OKJ A;  5FRM A;  3AVI A;  3AO4 A;  2HND A;  4DQQ A;  3HO1 A;  5HBM A;  1ZBH A;  4B9L A;  1A5X A;  3KLH A;  4E7J A;  1D5A A;  1KLM A;  1IO2 A;  2Z1I A;  3DLR A;  2YNI A;  4PWD A;  2QKK A;  3P1G A;  3LP2 A;  4KAZ A;  3MED A;  4B9T A;  4CEZ A;  4CGI A;  2X6N A;  4DWI A;  4CES A;  3DM2 A;  4FJG A;  4NCB A;  2D0A A;  1G15 A;  1UAX A;  2X6S A;  4NCG A;  4C8M A;  3VQB A;  1ASU A;  4B08 A;  3OYF A;  3RR8 A;  2G8U A;  4HCC A;  3TI0 A;  4FLY A;  2BDP A;  1S6P A;  4O5B A;  4N5S A;  5HRP A;  1NKE A;  1REV A;  3L2W A;  3SUQ A;  4E0D A;  4MFB A;  4F3T A;  1J54 A;  1W9H A;  1EKE A;  1RBS A;  1VSF A;  4B8C A;  3OS0 A;  4G1Q A;  1T03 A;  3RRG A;  2GUI A;  3OYG A;  4DFM A;  3NGI A;  4Z4F A;  4CE9 A;  3QNN A;  3PO4 A;  3K2P A;  4LH5 A;  1B92 A;  5HLF A;  4RW4 A;  3KLE A;  4DLE A;  3NBP A;  3RTV A;  4JS4 A;  3OYK A;  3ZSO A;  3MXJ A;  3QIP A;  1HNI A;  3TWH A;  4ICL A;  3P5J A;  3PX0 A;  4GW6 A;  1NK6 A;  4FM1 A;  1BCM A;  4DF8 A;  4B9M A;  3HJF A;  1U04 A;  4FVM A;  4M42 A;  4DF4 A;  2F96 A;  5KTQ A;  1TAU A;  4CJV A;  3NFA A;  1Y97 A;  3B6O A;  1SL2 A;  4C8K A;  2YV0 X;  4H4M A;  1WNS A;  4DMN A;  3RWU A;  2DTU A;  1TKT A;  4FM2 A;  5KGX A;  4DFJ A;  1J53 A;  4CCH A;  4FJI A;  3WNG A;  3ZSR A;  3NH0 A;  4Z4E A;  1ZBL A;  2XY8 A;  3AVH A;  3QEV A;  5CZ2 A;  2RN2 A;  4DG1 A;  3OJS A;  2OA8 A;  1JLQ A;  1NJW A;  4Y1D A;  1I3A A;  4B9S A;  1W0H A;  3K59 A;  1RDB A;  3OYN A;  2DY4 A;  3V9S A;  2D0C A;  1S9G A;  3S3O A;  1JXB A;  3K5M A;  1IKY A;  5E41 A;  5C25 A;  1L3T A;  2G8K A;  3AVN A;  1JKH A;  4KHY A;  2YHA A;  1Q9Y A;  4ELU A;  1TK0 A;  1GOB A;  2O4G A;  1DTT A;  4NYN A;  1WSH A;  3CFR A;  3OYC A;  1U4B A;  4TSX A;  4CEO A;  3HYF A;  1IH7 A;  3AA3 A;  4FLT A;  4C8L A;  4QOZ B;  3C94 A;  2RF2 A;  4M3U A;  2ZQB A;  1L5U A;  1JLC A;  3JSM A;  2YNG A;  4KTW A;  1VSH A;  3F73 A;  4O44 A;  1HYV A;  1F21 A;  3ULD A;  2HHT A;  5CYM A;  3SQ1 A;  1TKX A;  2G8H A;  1NKC A;  3KD5 E;  2VWJ A;  3AVG A;  3AVM A;  4CJF A;  1CZ9 A;  4CHN A;  3QEX A;  4CIG A;  4FK0 A;  2G8I A;  3HPH A;  5CY4 A;  1S6Q A;  2HNZ A;  1EET A;  2HB5 A;  4FLU A;  3AO5 A;  1ZYQ A;  3CG7 A;  3QEW A;  4PA1 A;  1O1W A;  1RNH A;  1SUQ A;  1BHL A;  4CEF A;  3V4I A;  1UA1 A;  4F8R A;  4DFP A;  1IKW A;  1X1P A;  4IG3 A;  2JGU A;  5SZT A;  3U3Y A;  3QEP A;  2KQ2 A;  2WON A;  3LAK A;  3WNE A;  1BGX T;  4N76 A;  4BWJ A;  1FKP A;  4FK2 A;  3C95 A;  3WNH A;  1RT7 A;  4IKF A;  4DS5 A;  2HVH A;  2A1R A;  4IFV A;  3KJV A;  4KTQ A;  3KLI A;  3TAG A;  4OKE A;  1JLE A;  3CQ8 A;  1EX4 A;  4KV8 A;  1MU2 A;  1C1C A;  4CJW A;  1TK5 A;  3LP0 A;  2B4J A;  4M3X A;  1K6Y A;  4N56 A;  1HMV A;  2PYL A;  3TAB A;  1KVA A;  2BAN A;  3AA4 A;  3AV9 A;  3C6T A;  4CHY A;  4NYF A;  5HRR A;  1RDC A;  2P5O A;  3F9K A;  1C6V A;  2IOC A;  3NH1 A;  3CM5 A;  1YT3 A;  3MAQ A;  2FBX A;  3G10 A;  3VQQ A;  4LH4 A;  3V9U A;  4PUO A;  1HYS A;  1RDD A;  3AVC A;  3OS2 A;  3JYT A;  4FZX C;  4LSL A;  3AVK A;  3O4N A;  4BDY A;  3THV A;  4CJU A;  3MEE A;  1D8Y A;  1ITG A;  4J2D A;  3TAN A;  4B3O A;  1X9M A;  3C6U A;  2Z1J A;  4FJ7 A;  4O0J A;  1RTD A;  4AHR A;  3K5L A;  3S9H A;  2BGG A;  1RT1 A;  4CFD A;  4ELT A;  5FDL A;  1LAV A;  3OYL A;  3KTQ A;  4IFY A;  3D45 A;  4ID5 A;  2KW4 A;  1KRP A;  4I2P A;  5KI6 A;  4CJR A;  1NK7 A;  1NJY A;  4L8R B;  1L3V A;  4OGC A;  3A2F A;  4DTN A;  3NGZ A;  2KZM A;  3OYB A;  5C24 A;  4DTM A;  2Z1G A;  1TL1 A;  3DOL A;  3MEG A;  1QSY A;  1CLQ A;  4AHC A;  4RW8 A;  2HHS A;  2Q3S A;  2VG5 A;  2VG6 A;  1NK5 A;  2IGI A;  2HHX A;  3OYH A;  1KVC A;  1A5W A;  1C0U A;  1TVR A;  1SKS A;  1QSS A;  2JLE A;  4PY5 A;  4Q5V A;  4I9Q A;  3ZSY A;  1D9F A;  4CJL A;  5D3G A;  4PQU A;  2ATQ A;  4JLH A;  1T05 A;  5J2M A;  3ZT1 A;  4FZZ A;  2HNY A;  4NCA A;  1QQC A;  3NHG A;  1WSE A;  3SUP A;  4F4K A;  3OYM A;  1IG9 A;  3HPG A;  1TGO A;  3EZ5 A;  3SZ2 A;  3OYJ A;  2GV9 A;  3AVJ A;  3SUN A;  4M3Z A;  1JLB A;  3L2V A;  4KB0 A;  4E19 A;  3ZT2 A;  1S1T A;  4ID1 A;  4OPJ A;  2P1J A;  3AVB A;  4AHU A;  3HPO A;  3ZT0 A;  4EP4 A;  4AHS A;  5HP1 A;  4CJE A;  1N6Q A;  1WSF A;  4WE1 A;  1D9D A;  4CEB A;  1WSG A;  1LW0 A;  2E6M A;  3L2Q A;  1XHZ A;  2RPI A;  3O3G A;  4CFC A;  3VA3 A;  1WSJ A;  2KZZ A;  1EP4 A;  1KFD A;  1NOY A;  4CK1 A;  3DRP A;  5C42 A;  3ZSW A;  4DTJ A;  4HVJ A;  2HHU A;  3OYE A;  4AHT A;  1KCF A;  2OPS A;  4O55 A;  1C0M A;  1YVU A;  2BE2 A;  4Q0B A;  4IG0 A;  3AO1 A;  3T19 A;  3AA2 A;  4MQ3 A;  2XY6 A;  3KD1 E;  4KB1 A;  1BQM A;  3I8D A;  3ZSQ A;  4CJ4 A;  1YTA A;  3U3G A;  4DQI A;  4KHU A;  4M3R A;  1BCO A;  2ETJ A;  4I9L A;  3DMJ A;  3G0Z A;  3VQ6 A;  5KRT A;  1TV6 A;  4KI4 A;  2XY7 A;  1KVB A;  5CZ1 A;  4CF2 A;  3HST B;  2P51 A;  1RBR A;  4W5T A;  3DOK A;  3LAN A;  2OZS A;  4KPY A;  4BDZ A;  3DRS A;  4CER A;  3S3M A;  3HM9 A;  4IBN A;  2FC0 A;  1HQE A;  5EU7 A;  3VQC A;  3M8P A;  2PY5 A;  1IKX A;  1B9D A;  1JLA A;  2GBZ A;  3ZSZ A;  4ELV A;  1ZBF A;  4BE0 A;  4Y1C A;  3TAQ A;  1S1V A;  3ZT4 A;  1JXE A;  1TL3 A;  4Z4H A;  2A1S A;  3PX6 A;  3SQ0 A;  3DLK A;  3NDK A;  3HK2 A;  1VRU A;  2IC3 A;  4J2A A;  4W5N A;  1UA0 A;  2FBV A;  1X9W A;  2XHB A;  4CED A;  3VN5 A;  2LSN A;  1QHT A;  3VQ9 A;  2DFH A;  4F2S A;  1JLG A;  4YFU A; 
#chains in the Genus database with same CATH topology
 4DSF A;  1QZ6 A;  2WC9 A;  1U2V A;  4OJR A;  2B5J A;  1TK8 A;  2JWL A;  1U48 A;  4H5V A;  3RMB A;  3AVF A;  1T7P A;  1LCU A;  3QB0 A;  4N47 A;  3VEO A;  2VWK A;  4W5O A;  3EY1 A;  1KC8 O;  4CHP A;  4DV7 K;  4BQZ A;  3P83 D;  1NKB A;  3VQA A;  2O4I A;  5DK5 A;  3ZX3 A;  4CJT A;  3QO9 A;  3TTF A;  3MXI A;  2OAN A;  2UUA K;  4EP5 A;  3WNF A;  1KAY A;  2O8C B;  5LY3 A;  4WQ4 A;  5AQS A;  4CBX A;  2G8W A;  3FLC O;  1ASV A;  3BF3 A;  1JCE A;  1BG3 A;  2QXL A;  5EY4 A;  3ZX0 A;  3SV3 A;  2OZM A;  3OYA A;  4DV5 K;  4B9N A;  1TKZ A;  1YXQ A;  3K57 A;  4H0X B;  3PUF A;  2BH1 A;  3EYZ A;  4KHP K;  5J2Q A;  4YOY A;  4E1M A;  4JKC A;  2OTL N;  4BY9 C;  3IS9 A;  4DUY K;  3KKS A;  4ZHR A;  3DRR A;  3GDQ A;  1RTJ A;  3A5O C;  1CZB A;  4XIU A;  2HW3 A;  4DTO A;  3UKR B;  4WYB A;  4JS5 A;  4JI4 K;  3SAF A;  3BDP A;  1S5J A;  4DU4 A;  3SCX A;  2QTD A;  1HQU A;  3NAE A;  1HYZ A;  1O13 A;  3QNO A;  1C0G A;  1SKR A;  1DTQ A;  1SL1 A;  2UXD K;  2E4L A;  4FWS A;  4IEE A;  1I39 A;  5AJ3 K;  5AQZ A;  1J5O A;  5C15 A;  3V6D A;  1RT6 A;  2PYJ A;  4CF0 A;  2ZWH A;  1VQP N;  4JHD A;  1WN7 A;  3SPY A;  2ASO A;  1Q8I A;  2CGJ A;  2VQE K;  2YKM A;  4GVM A;  1QQO A;  2IAJ A;  5J1E A;  3ZT3 A;  3TAP A;  1VQN N;  4IJN A;  4FWO A;  3HBT A;  4E3S A;  4OKK A;  1XMQ K;  3DJC A;  3IG1 A;  2HBJ A;  3SAG A;  3GBT A;  4J2B A;  2Y1J A;  3SJJ A;  4IOA L;  2P9L B;  5E84 A;  1QQN A;  4H5R A;  3LDS A;  1VQM N;  4BRF A;  3W0L A;  2HHW A;  5CHI A;  2E2P A;  2KKZ A;  2QWP A;  4O5F A;  1FJG K;  3ZX2 A;  4JD2 B;  3IMX A;  3C7N A;  2VCP A;  1YF5 L;  3T1H K;  4K8Z A;  5KRS A;  3OJU A;  4KH5 A;  3G25 A;  3CCQ N;  2WBN A;  3O3F A;  5AQG A;  2YNH A;  3I8B A;  2ZF5 O;  3QIO A;  1MWM A;  1C1B A;  1OH5 A;  1QE1 A;  2B6A A;  4ISF A;  5ADX H;  3ASM A;  4BRH A;  4JAX A;  3T3F A;  4DFK A;  4RW6 A;  2GEL A;  3T1A A;  3VQ7 A;  1SZ2 A;  3DXK A;  3V1R A;  2F8T A;  2CGK A;  3TTC A;  4FJK A;  1BO5 O;  3KK3 A;  2EX3 A;  4H0V B;  2OPQ A;  4DSE A;  3SUO A;  3NMU A;  1T3V A;  4IEI A;  3DYA A;  3R8E A;  2W42 A;  4GNI A;  3LAL A;  4QAG A;  3VGM A;  2YI1 A;  4IZ9 A;  1HX1 A;  3H3N O;  4CGG A;  4MDB A;  3K5N A;  3VQ8 A;  3PX4 A;  3SBG A;  2E20 A;  2QXF A;  1U49 A;  4BE2 A;  5DMR A;  3L8B A;  2DFE A;  1RT5 A;  1SQK A;  3I0S A;  5FPN A;  4CHQ A;  1OH8 A;  3AAR A;  5GAG P;  2HST A;  3G4S N;  1B9F A;  4FJ5 A;  1Q18 A;  2D5R A;  4BG8 A;  4W5R A;  1C0T A;  3O80 A;  4CJP A;  3M8S A;  3LAM A;  4B9U A;  4PHT X;  4MO5 A;  2KFZ A;  4WQ5 C;  3LWM A;  1JL1 A;  1VQ8 N;  1S1X A;  1XHX A;  3A0I X;  1YHQ N;  4DQS A;  2P9S B;  4FXD A;  5I42 A;  1S1W A;  3VEY A;  3M8Q A;  1BQN A;  3LZI A;  4QCL A;  1WOQ A;  4BRG A;  3A8Y A;  3LWL A;  2W40 A;  3N4P A;  5FRM A;  3AO4 A;  2HND A;  1ZBH A;  1BUP A;  4E7J A;  1KLM A;  1IO2 A;  4PWD A;  3O9S A;  5M1P A;  3LP2 A;  3MED A;  4B9T A;  1T6D A;  4NCB A;  5KPZ A;  4FJG A;  1G15 A;  3C6H A;  4NCG A;  4C8M A;  4YY3 K;  1ASU A;  4HCC A;  1K8A O;  2VYP A;  5HRP A;  1REV A;  3L2W A;  3SUQ A;  4XEI A;  4MFB A;  3KWG A;  3OS0 A;  1T03 A;  3TPQ A;  1ZXO A;  3RRG A;  4DFM A;  4CE9 A;  3PO4 A;  4LH5 A;  1B92 A;  1E3M A;  2ITM A;  3RTV A;  3OYK A;  3ZSO A;  3MXJ A;  3RVC A;  3PX0 A;  3HJF A;  1JJ2 M;  3MCA B;  3IUC A;  4FVM A;  4M42 A;  5KTQ A;  1NNE A;  1Q7Y O;  4H4M A;  1WNS A;  3RWU A;  2DTU A;  1BU6 O;  3MDQ A;  4FJI A;  1ZBL A;  2OA8 A;  4FSV A;  2QWL A;  4Y1D A;  4B9S A;  3OYN A;  3CPE A;  2D0C A;  3R3L A;  2A5X A;  2A42 A;  3C0B A;  1JKH A;  4KHY A;  1Q9Y A;  4B1W B;  2ASM A;  2IIR A;  3CCS N;  3E9O A;  3CFR A;  1NU0 A;  1U4B A;  4CEO A;  4BRN A;  4BR7 A;  4FLT A;  4BRL A;  2YNG A;  4KTW A;  5CYM A;  2G8H A;  3F5T A;  4K0K K;  1NKC A;  2Q1N A;  3KD5 E;  3FZL A;  4CIG A;  4LF4 K;  3FZM A;  3CG7 A;  3QEW A;  4PA1 A;  5LL6 Z;  4JI5 K;  4IG3 A;  2KQ2 A;  3WNE A;  4LF7 K;  3ID6 A;  5AZI A;  1RT7 A;  3LDP A;  3L6Q A;  3FR0 A;  4DS5 A;  2GUP A;  4IFV A;  3KJV A;  5BPN A;  1GLF O;  1C1C A;  3DXM B;  3LP0 A;  1FW6 A;  3AA4 A;  3AV9 A;  4CHY A;  1VQ4 N;  4J8F A;  1GLB G;  3F9K A;  3ZET B;  1C6V A;  2IOC A;  4FOI A;  3MAQ A;  4PUO A;  2FBX A;  4LH4 A;  4YOR A;  1RDU A;  5CR4 A;  2Q97 A;  1ATS A;  3UKU A;  4FZX C;  1BDG A;  3RSE A;  1TYQ A;  2D0P A;  1ITG A;  3DAW A;  5BPM A;  4B3O A;  1X9M A;  3E9P A;  4O0J A;  3K5L A;  4WFN L;  2BGG A;  3C65 A;  3QFU A;  5EOY A;  5FDL A;  3D2F A;  4I2P A;  5KI6 A;  4CJR A;  1NK7 A;  2AP1 A;  4DQ8 A;  3LL3 A;  4DTM A;  2Z1G A;  3DOL A;  3MEG A;  1QSY A;  5JVH L;  1CLQ A;  3N4Q A;  1NGI A;  3VEN A;  2VG6 A;  1C0U A;  2ASP A;  5AQW A;  4CZI A;  1D9F A;  1NGF A;  1U2V B;  4JLH A;  1NG9 A;  5J2M A;  4FZZ A;  4NCA A;  3SUP A;  1WSE A;  5JIC A;  3MN7 A;  1IG9 A;  3HPG A;  1XNQ K;  3OYJ A;  2GV9 A;  3L2V A;  4ID1 A;  3ZLJ A;  4OPJ A;  3AVB A;  2UU9 K;  1EWQ A;  3SMP A;  1GLC G;  1WSF A;  2F7T A;  2YCH A;  3K0S A;  3VA3 A;  3TTD A;  1EP4 A;  2ZM6 K;  4DTJ A;  3OYE A;  4RCH A;  2OPS A;  4CJ7 A;  2BE2 A;  4IG0 A;  3HRG A;  3MX5 A;  4LFC K;  3AO1 A;  4YOU A;  1BQM A;  3ZSQ A;  1YTA A;  3U3G A;  4DQI A;  2FF3 B;  4B9Q A;  3CJB A;  4F9O A;  3O9Q A;  1BCO A;  5AZJ A;  4KI4 A;  1TV6 A;  4BR5 A;  1RBR A;  3DOK A;  1NJI O;  1DGK N;  2NRZ A;  4JI1 K;  3HM9 A;  5EU7 A;  4PKI A;  3M8P A;  4PKG A;  3ZSZ A;  3LDO A;  4IOC L;  5BRD A;  5M1F A;  4A5B A;  1KAZ A;  3CJ9 A;  2IC3 A;  4A5A A;  2FBV A;  1UA0 A;  1X9W A;  2XHB A;  2GWK A;  1NGJ A;  3QIN A;  4DTP A;  3AGK A;  5FPM A;  3VQP A;  4E7K A;  1HNW K;  3VTH A;  3SQ4 A;  4BAC A;  3CJ1 A;  3SMS A;  4FJ9 A;  4I7F A;  4CGF A;  3WT0 A;  1X3M A;  3KLG A;  2W6K A;  1X9S A;  4ISG A;  4B3T K;  1RBT A;  4DR6 K;  1HNZ K;  1TUU A;  3ZEU A;  1WAF A;  2E6L A;  4GMJ B;  4DTR A;  3RRH A;  4JHD B;  4E7H A;  3LP3 A;  3D0P A;  1HNV A;  1BIZ A;  4DR1 K;  1MDU B;  5FPD A;  3CCL N;  2A3Z A;  3V9Z A;  4K25 A;  3J7Z O;  3CCE N;  2WTU A;  4OPA A;  4KHQ A;  2V52 B;  4J2E A;  4Z4I A;  2PZS A;  4JK8 A;  1NGA A;  4CZG A;  1SKW A;  3VA0 A;  3M8R A;  2P9N A;  1QTM A;  4LD0 A;  3U9Z A;  5AQU A;  5BN9 A;  3L4Q A;  3HT3 A;  2O8E B;  4JI2 K;  1W97 L;  3E01 A;  3CYM A;  4AIL C;  2Q36 A;  4H03 B;  3C7N B;  2FXU A;  4FJM A;  3T7Z A;  1SL0 A;  4CF9 A;  3O4W A;  1CXQ A;  5F0X A;  2HHH K;  2KTQ A;  3QIC A;  3CC7 N;  3O6W A;  1HPZ A;  4QS7 A;  2YJE A;  2HHV A;  1N5Y A;  4LSN A;  4HHT A;  4AH9 A;  4JV5 K;  5TKY A;  4O4G A;  4I2Q A;  4JI8 K;  3O3H A;  5FRO A;  4E7L A;  3TAF A;  3ULE A;  1FKO A;  5HRO A;  2RE2 A;  3L3U A;  2A41 A;  4K43 A;  5CE3 A;  3JAM O;  3PO5 A;  4HCB A;  2HF3 A;  1KFS A;  4KRF A;  3AA5 X;  1VSJ A;  5AQT A;  1VSD A;  4UQG A;  4FJN A;  3QER A;  4JKF A;  4CF1 A;  1WB9 A;  4CFA A;  4CGD A;  5SWM A;  3CJC A;  4DV0 K;  3TAM A;  3L2U A;  2UYT A;  3SPZ A;  1W7A A;  4BVO A;  4FJX A;  4CF8 A;  4Z0U A;  2O8B A;  1S1U A;  5JS1 A;  1VK0 A;  3O08 A;  3NF7 A;  4H0P A;  1OH7 A;  3W3D A;  2G8V A;  1UOC A;  3O1B A;  3BP8 A;  5FRN A;  3S3N A;  4E1N A;  3KKR A;  3WXJ A;  4JI7 K;  3V1Q A;  5I3U A;  3L2R A;  4ILG B;  3AAQ A;  4H4O A;  4CI6 A;  1YJW N;  3CCR N;  3R1X A;  1T44 A;  4KTZ A;  3ZSX A;  3THW B;  2QK9 A;  3ATU A;  4EIA A;  3FE1 A;  4A57 A;  2HVI A;  4CZF A;  4M45 A;  1VQ7 N;  4ZTJ A;  5CYQ A;  1C1A A;  4DTS A;  4CJ3 A;  2VGM A;  3MN9 A;  2IDO A;  2P9K A;  4FLX A;  2HOE A;  1T6C A;  1WSI A;  4DHY A;  2IVO A;  4OLA A;  3CC4 N;  1IBM K;  5AQH A;  3VQE A;  3BGR A;  3CD6 N;  4M3T A;  2P9I A;  4DKW A;  3HM8 A;  5AFU A;  1RIL A;  5E26 A;  4F2R A;  3NF8 A;  4FJL A;  4K42 A;  1HRH A;  1TAQ A;  2X78 A;  1VSK A;  4OPH A;  1RCH A;  2IVP A;  4DTX A;  3MK6 A;  4IJA A;  1DLO A;  4CEC A;  3TR8 A;  2HHT A;  4CHZ A;  4CHO A;  3QFP A;  4O0I A;  1DKG D;  4CBW A;  4KBO A;  1KAX A;  4DU1 A;  1NK0 A;  1T8E A;  1NK4 A;  1RT4 A;  1LV5 A;  3SV4 A;  1Q82 O;  1NLV A;  4NXM K;  3LM2 A;  2WFB A;  4ZTF A;  4OLB A;  1NK8 A;  3AGR A;  4X66 K;  3RMD A;  2Q2R A;  1CXU A;  2D0B A;  4FLW A;  3EKU A;  3OY9 A;  3NGY A;  4CVN E;  1TKD A;  3J80 O;  3ISN C;  4OVL A;  2GEM A;  4BC2 A;  4MLE A;  1ZBI A;  5C2D A;  4F3O A;  3QES A;  4RW9 A;  3M6G A;  3CME N;  5HBM A;  2E8A A;  2QW9 A;  2Z1I A;  1X9J A;  4CES A;  2A6A A;  2QM1 A;  1M1K O;  5I9E B;  1S6P A;  1HPM A;  4F3T A;  1J54 A;  1RBS A;  2KHO A;  4G1Q A;  2ZGZ A;  4Z4F A;  3K2P A;  5HLF A;  3TSP A;  1HUX A;  4DLE A;  1I94 K;  3NBP A;  3OW2 M;  4JS4 A;  2AA4 A;  4ILH A;  3P5J A;  4FM1 A;  4DF8 A;  4YDU C;  1U04 A;  3MN5 A;  4DF4 A;  2F96 A;  1BWF O;  1Y97 A;  4H5T A;  3HZ6 A;  4YOX A;  1TKT A;  1J53 A;  3RSE B;  5CZ2 A;  2RN2 A;  4DG1 A;  3OJS A;  1NJW A;  1I3A A;  3THY A;  4DCH A;  3K59 A;  1BOT O;  2DY4 A;  4FL9 A;  4KH6 A;  3AAP A;  3S3O A;  1JXB A;  5E41 A;  2YHA A;  3D2F B;  1TK0 A;  4R79 A;  4QOZ B;  3M5R A;  3D7E O;  3M3Z A;  4JKG A;  3JSM A;  3LDL A;  4B3M K;  1VQK N;  3SQ1 A;  1TKX A;  2VWJ A;  3AVM A;  4JKB A;  4CHN A;  1CZ9 A;  4GV9 A;  4FK0 A;  4FLU A;  1BA0 A;  3AO5 A;  1ZYQ A;  1M90 O;  1O1W A;  1RNH A;  4CEF A;  3ZYY X;  1UA1 A;  1IKW A;  5SZT A;  3U3Y A;  5LJW A;  4N76 A;  4RWT A;  3CCJ N;  3WNH A;  3O9U A;  4IKF A;  2HVH A;  3I56 N;  3KLI A;  2HBM A;  3EN9 A;  4KV8 A;  3UE5 A;  1MU2 A;  4CJW A;  5LMN K;  2GWJ A;  2PYL A;  3TAB A;  4NYF A;  1RDC A;  4FO0 A;  5GAH P;  3QDK A;  3NH1 A;  4DU3 A;  3PIP L;  1HYS A;  3VQQ A;  2OCE A;  1RDD A;  2D0O A;  1K73 O;  3JYT A;  4LSL A;  4K41 A;  4BDY A;  1D8Y A;  4CJU A;  2Q0R A;  3K9J A;  5AQJ A;  4FJ7 A;  1VQL N;  1TUY A;  2HBL A;  5AZJ B;  3QBW A;  3OYL A;  1XQS C;  3F2K A;  1NMD A;  4L8R B;  1L3V A;  3BF1 A;  2P9P A;  5BRF A;  1WBB A;  3OYB A;  1TL1 A;  5C10 A;  3PIO L;  1N8R O;  4GVE A;  3CET A;  4RW8 A;  2FSK A;  2Q3S A;  2IGI A;  3H6E A;  3OYH A;  1KVC A;  4DV4 K;  1SKS A;  2JLE A;  4PY5 A;  1NGG A;  4Q5V A;  3NVM A;  4BRK A;  3ZSY A;  4I9Q A;  4ISE A;  4CJL A;  4CW7 B;  4PL8 A;  4BRA A;  1RDW X;  1T05 A;  1SS6 A;  2FLO A;  4FOE A;  3OYM A;  1TGO A;  3SZ2 A;  3AVJ A;  4H0O A;  4U7B A;  3ZT0 A;  4AHS A;  1VQ6 N;  5HP1 A;  1N6Q A;  3ZEU B;  5C2F A;  4DV6 K;  1D9D A;  4CEB A;  1WSG A;  2E6M A;  3P31 A;  1XHZ A;  2RPI A;  4JKA A;  1NOY A;  1KFD A;  3HOT A;  3DRP A;  3OA9 A;  1KCF A;  4O55 A;  2XY6 A;  4KB1 A;  2QWQ A;  4AF1 A;  1YAG A;  5AR0 A;  1EO1 A;  3KHY A;  3DMJ A;  3G0Z A;  3VQ6 A;  1K8K A;  5CZ1 A;  2P51 A;  4W5T A;  4KPY A;  2P9N B;  4BDZ A;  3S3M A;  4IBN A;  2FC0 A;  3VQC A;  1B9D A;  2BTF A;  1JLA A;  4GV3 A;  1ZBF A;  1XNR K;  2V7Y A;  2UUC K;  3O8M A;  3ZT4 A;  2A1S A;  3LM9 A;  4BRM A;  3HK2 A;  4W5N A;  3UKR A;  2LSN A;  2DFH A;  2NRH A;  1JLG A;  3WXK A;  1XI1 A;  4FJ8 A;  3LZJ A;  1WBD A;  3L3V A;  2NUB A;  4JKH A;  5M1N A;  4B8A B;  2BUP A;  5JS2 A;  4BGB A;  3K9K A;  4CJK A;  5GAE P;  2UXC K;  3IDH A;  1Z25 A;  5K14 A;  1LOT B;  4FWK A;  4XH1 A;  3V81 A;  3K58 A;  2X74 A;  3OS1 A;  2FBT A;  4BWM A;  2AJQ A;  4CIE A;  4H0Y B;  1Q9X A;  4CJ5 A;  4Z4C A;  3VQ5 A;  3TU5 A;  3DLL L;  5MLC Q;  2QI2 A;  1NJX A;  4R5P A;  5AQL A;  3NF6 A;  3B8A X;  4UY8 O;  1R59 O;  3J81 O;  1VSE A;  2ZE2 A;  4Y0W A;  3WUH A;  1NWK A;  4CZJ A;  2I7P A;  1RFQ A;  2O8B B;  4BC3 A;  2NRX A;  2PFU A;  4H8K A;  4KI6 A;  4O8K A;  1LAW A;  2YNF A;  2VQF K;  1NMN A;  2YX6 A;  4JRP A;  3CI5 A;  3THX A;  4KO0 A;  3VER A;  3H3O B;  4AHV A;  3H08 A;  3ZCM A;  5HRN A;  4YOW A;  4KH4 A;  3LDQ A;  4YDU A;  1BIS A;  4FWR A;  1OVQ A;  3I55 N;  1RBU A;  5LMU K;  4DR3 K;  4N41 A;  4MLH A;  5AQI A;  5M1O A;  3FFI A;  2NLX A;  4FPB A;  1C0F A;  2P9K B;  3UB5 A;  2NRV A;  4NLC A;  4FCY A;  5HRS A;  4C23 A;  3CCU N;  2P9I B;  1JLF A;  2VG7 A;  4JNE A;  1YTU A;  3WQU A;  3VEZ A;  2EWS A;  4IO8 A;  1JL2 A;  1EQY A;  1RT3 A;  3WXI A;  2R7Y A;  3V1O A;  4CK2 A;  4DV1 K;  4CFB A;  3TSQ A;  2P9U A;  3UIQ A;  1J9A A;  1RT2 A;  4KKO A;  1NGB A;  4CGH A;  1ASW A;  3KIO A;  4DSK A;  3CFO A;  4EZ6 A;  5BRH A;  1FXX A;  1WAJ A;  3KK7 A;  4FLZ A;  1NJZ A;  4ILJ A;  3QML A;  1KSP A;  2G8F A;  1GLA G;  2FBY A;  2CH5 A;  1VSL A;  1VHX A;  1GOA A;  5KQ8 A;  4OPK A;  2Q31 A;  1KXP A;  4JI0 K;  4EZ9 A;  4CEA A;  1GLL O;  4FZY A;  1MWK A;  3H45 C;  1KLN A;  3NVK A;  1XMO K;  2P9S A;  4B3S K;  4DS4 A;  2QWM A;  2PBD A;  1IBL K;  3RMA A;  1UWB A;  2WOM A;  3LPU A;  3T1Y K;  4YOT A;  3CC2 N;  3IKM A;  4K8X A;  4GY2 B;  1XC9 A;  1YJN N;  1BIU A;  4BDP A;  1RDA A;  1Z6R A;  1IV0 A;  3M1F A;  4FM0 A;  4DQR A;  4B1U B;  2E5L K;  4IWV A;  3U6F A;  5KQD A;  2YHB A;  4WQ5 A;  1BI4 A;  3SQ2 A;  1NOZ A;  4JN4 A;  4X65 K;  5AQO A;  2OPP A;  3FZK A;  3U9D A;  3PV8 A;  5M1K A;  3HP9 A;  1ATR A;  2J4R A;  4Z94 A;  4FJH A;  2GX9 A;  4OGE A;  3SNN A;  3DLB A;  3TSU A;  3NCI A;  3WEE A;  4HTU A;  1LW2 A;  2H3G X;  3LP1 A;  5J2N A;  3O4Q A;  4BRC A;  1NGC A;  2YHY A;  3BZK A;  2V7Z A;  3DLG A;  1XWL A;  4LY7 A;  4M63 C;  3CMA N;  1YJ9 N;  4LF8 K;  1RTI A;  4CEQ A;  4DR5 K;  4C1N K;  1DEJ A;  4CIF A;  3VEX A;  1GLD G;  4B1Y B;  4GKJ K;  2QEX N;  3WXL A;  2O8D A;  4HTL A;  3THY B;  1DT9 A;  4BQL A;  3CPW M;  1OVY A;  3QEI A;  1S9E A;  3FZF A;  2IS3 A;  2ITG A;  3G71 N;  1K9M O;  4DQQ A;  4XH4 A;  3MX2 A;  5GIO A;  1A5X A;  3DLR A;  2YNI A;  3GOI A;  3P1G A;  4JKG B;  1E4F T;  4KAZ A;  4CEZ A;  5C0Y A;  4CGI A;  2X6N A;  4DWI A;  4OO1 J;  3DM2 A;  5B8H A;  2D0A A;  3AY9 A;  2X6S A;  4B08 A;  3RR8 A;  3VQB A;  3OYF A;  2HMP A;  3DXK B;  2G8U A;  3TI0 A;  4FLY A;  4O5B A;  4CZH A;  4N5S A;  1NKE A;  3H1Q A;  4E0D A;  4QS8 A;  3F9M A;  1W9H A;  1EKE A;  1VSF A;  2GUI A;  5GAD P;  3NGI A;  3GE1 A;  3O9R A;  4RW4 A;  3J7A P;  4LFB K;  3QIP A;  4ICL A;  4GW6 A;  2E1Z A;  1VAZ A;  1TAU A;  3ZET A;  4C8K A;  3B6O A;  1SL2 A;  2YV0 X;  4DMN A;  2ZGY A;  4GV6 A;  4JKD A;  4LC9 B;  4DFJ A;  4BC4 A;  4CCH A;  2DPN A;  3D2E A;  3ZSR A;  4Z4E A;  2XY8 A;  3QEV A;  4DB3 A;  1Y64 A;  1KQS M;  3O1W A;  1RDB A;  4NO7 A;  4FWQ A;  2FF6 A;  3V9S A;  1S9G A;  1P90 A;  2V51 B;  1L3T A;  1H1V A;  4NXN K;  3AVN A;  5EX5 A;  4ELU A;  4OX9 K;  2O4G A;  1DTT A;  1WSH A;  4B1V A;  2P9P B;  4BVP A;  1IH7 A;  3AA3 A;  4C8L A;  3D6R A;  2RF2 A;  4M3U A;  1CZA N;  2ZQB A;  1L5U A;  3ATV A;  3F73 A;  4O44 A;  1HYV A;  1F21 A;  5KPT A;  4AM6 A;  4QS9 A;  3SJH A;  5CY4 A;  1S6Q A;  3VTI A;  3VEW A;  3MWP A;  1SUQ A;  1BHL A;  2VGN A;  3V4I A;  1VQO N;  1X1P A;  2JGU A;  1RGI A;  3QEP A;  3E9L A;  4BRQ A;  3LAK A;  5JMV A;  2UUB K;  3U8X A;  5AQN A;  1FKP A;  4BWJ A;  3C95 A;  3KWI A;  1S22 A;  3WXM B;  4KTQ A;  4OKE A;  3CQ8 A;  3VF6 A;  3PSI A;  4IXC A;  2B4J A;  4B1X B;  4I6M A;  4N56 A;  1KVA A;  5F2R A;  3E1Y A;  2ZJQ L;  1KD1 O;  4A62 A;  5HRR A;  4B3R K;  2F9W A;  4JK7 A;  3A5M C;  1J6Z A;  3LDN A;  2I7N A;  3V9U A;  3AVC A;  2E1Y A;  3U4L A;  5IT9 O;  1IJJ A;  1ZBS A;  3MEE A;  2HF4 A;  4NB4 A;  2Q0U A;  2QWO A;  1NGH A;  3C6U A;  4BRO A;  1RTD A;  1RT1 A;  3L4I A;  1K8K B;  1LAV A;  3D45 A;  4ID5 A;  1NJY A;  4DTN A;  2KZM A;  2VWB A;  2D4W A;  4FVU A;  2JWK A;  4GKK K;  2HHS A;  3VEV A;  1Z05 A;  1QSS A;  1TVR A;  4BR2 A;  3VGL A;  3P38 A;  3EE9 A;  3I33 A;  3CQY A;  5D3G A;  1QZ5 A;  4JYA K;  3CJ7 A;  3ZT1 A;  1QQC A;  4IFE A;  3NHG A;  4F4K A;  4M3Z A;  3SUN A;  4KB0 A;  5AZI B;  1S1T A;  2P1J A;  4CJE A;  1QQM A;  1VQ9 N;  4CZM A;  3P39 A;  1YIT N;  1V4S A;  4HVJ A;  4AHT A;  2YHW A;  3CIP A;  2O8F A;  4XH5 A;  4Q0B A;  3H1V X;  3T19 A;  3OBY A;  3KD1 E;  5BRE A;  3UKU B;  3SAH A;  5FLX O;  4CJ4 A;  1TYQ B;  3BY5 A;  3KVG A;  4BRP A;  1N33 K;  1IG8 A;  4KHU A;  4M3R A;  3PSF A;  2ETJ A;  5FPE A;  1KVB A;  3IFR A;  4H5W A;  4CF2 A;  1YIJ N;  3MMV A;  2NRR A;  2OZS A;  3LAN A;  5AQR A;  1NGE A;  2O8E A;  3L0Q A;  3DRS A;  4CER A;  3E66 A;  5AQX A;  5C12 A;  2GBZ A;  4Y1C A;  2RHK A;  1JXE A;  1TL3 A;  3DLK A;  3NDK A;  1VRU A;  1XC3 A;  4DV2 K;  3THX B;  3H46 O;  4CED A;  1QHT A;  3VQ9 A;  3VOV A;  3J8A A;  3DI6 A;  1ESV A;  1IKV A;  2F8S A;  3KK1 A;  5H1S Q;  1QVG M;  1LWC A;  1RBV A;  4CZE A;  3EKS A;  1YVN A;  3AO3 A;  1SV5 A;  4M3W A;  4FPA A;  3HXM A;  1ILY A;  2QKB A;  4B9V A;  2FSN A;  4O8U A;  2OTJ N;  3CCM N;  4IDK A;  5AQK A;  4BRE A;  4BG9 A;  2Y1I A;  2XY5 A;  3KLF A;  5AQF A;  3VQ4 A;  5T7B A;  2OYQ A;  1FK9 A;  4W5Q A;  3V9X A;  3QET A;  2P9U B;  1LWE A;  3CQX A;  1HKB A;  1NK9 A;  2YKN A;  1QHA A;  5DM6 L;  1S72 N;  5HL7 L;  1N34 K;  3HP6 A;  3MEC A;  2HHQ A;  3ALY A;  3R9P A;  5HOO A;  4FWP A;  3K5O A;  3ZSV A;  2NZT A;  4DR4 K;  3R6M A;  3DLH A;  5DM7 L;  3V9W A;  1U6Z A;  3CFP A;  1J5E K;  3HTV A;  2YJF A;  4FW1 A;  3VMF B;  5J2P A;  4E89 A;  3MCP A;  4DSJ A;  3QLH A;  4FWN A;  4KHS A;  1EXQ A;  1MA9 B;  4DUZ K;  1VRT A;  2NRT A;  5BPL A;  2XO7 A;  4KHN A;  3THW A;  4JRQ A;  4C8O A;  2OPR A;  4V19 S;  3KZB A;  2RKI A;  4C1N I;  4HUG A;  3VET A;  5KPR A;  3MXM A;  1XUP O;  1LWF A;  5GIP A;  1VSM A;  3T69 A;  4M7X A;  3OTO K;  4PL7 A;  4HUE A;  5AQY A;  4KHW A;  5AQQ A;  4DQP A;  4FJJ A;  3RMC A;  4DSI A;  3P4I A;  4M3Y A;  1GLJ O;  3PLA A;  4DTU A;  2KFN A;  1OKJ A;  1D4X A;  4JK9 A;  1GOC A;  1BI4 B;  3OVN A;  2O8C A;  2QWR A;  1ZBU A;  4M41 A;  5JVG L;  5JLH A;  4RG8 A;  3CXC M;  3PY8 A;  4DV3 K;  1ATN A;  3HI0 A;  3IRX A;  4CGJ A;  3JXU A;  3KK2 A;  4FW2 A;  4HUF A;  1QSL A;  3OYI A;  4KRE A;  4YNQ A;  3BUZ B;  4CD1 A;  3WEE B;  4M7Y A;  1R0A A;  4BRD A;  3VQD A;  4RTF D;  3NF9 A;  3A5L C;  3AVA A;  4E1J A;  3HL8 A;  4CJQ A;  2IVN A;  1Z26 A;  3MWT A;  1RTH A;  3VPZ A;  4H5N A;  4C8N A;  4Z4G A;  4G9Z A;  2FSJ A;  2I5J A;  1GLE G;  3I0R A;  4BGA A;  1L3S A;  1BL3 A;  2QA4 N;  4KFB A;  4E7I A;  4JEP A;  2O8D B;  3CM6 A;  3TAE A;  3SYZ A;  1NGD A;  2P5G A;  2KLA A;  3VF4 A;  4FK4 A;  3EEQ A;  2GTD A;  3ITH A;  3CCV N;  2EHG A;  3ENO A;  5IWA K;  2PAV A;  2NRW A;  1QS4 A;  2XRI A;  1YI2 N;  3ULE B;  2F9T A;  4CK3 A;  4BE1 A;  4CEE A;  3HVT A;  3SK3 A;  3NE6 A;  4DSL A;  1HJR A;  1Q86 O;  4BR9 A;  3ENH A;  1U45 A;  3AVL A;  2DFF A;  4DLG A;  3G6E N;  1L3U A;  3OYD A;  4BR0 A;  4EFH A;  5AFU H;  3FFK B;  5BR9 A;  3LPT A;  2HMI A;  4HWI A;  2Z1H A;  3O9T A;  1KTQ A;  3ENB A;  4WFA L;  4LF9 K;  3RR7 A;  1BA1 A;  3SI6 A;  3HVR A;  4JI3 K;  1G99 A;  2P9L A;  2HBK A;  4MDA A;  3CJA A;  2WUS A;  3CER A;  3S41 A;  4U67 L;  5JLF A;  3EZW A;  2YHX A;  3TAR A;  4PKH A;  1X3N A;  4YOV A;  4IOX A;  4RW7 A;  2CH6 A;  4JD2 A;  3DLE A;  1WLJ A;  2ZJR L;  5KGW A;  4FLV A;  1IBK K;  4CJS A;  4X62 K;  1Q81 O;  3D2E B;  1U47 A;  2ZD1 A;  1A5V A;  3NH2 A;  3AO2 A;  3B6P A;  5F1X A;  4FYD A;  3A5N C;  4WQ4 C;  1VSI A;  1JCG A;  1JCF A;  3FGU A;  3GG4 A;  4OKJ A;  3AVI A;  3BEX A;  3HO1 A;  5BR8 K;  4B9L A;  3DWL A;  3KLH A;  1D5A A;  2QKK A;  1VQ5 N;  2E2N A;  4LF5 K;  3C6A A;  1UAX A;  5GIN A;  2BDP A;  4CZK A;  4B8C A;  1OH6 A;  2E2O A;  3FZH A;  3OYG A;  3QNN A;  1NM1 A;  1W2B M;  3KLE A;  1HNI A;  3TWH A;  1V4T A;  1SAZ A;  4I6M B;  1NK6 A;  1BCM A;  4A2B A;  4B9M A;  4CJV A;  3NFA A;  4JKE A;  3J7Y P;  4FWL A;  5LJV A;  4IO9 L;  3CF5 L;  4FM2 A;  5KGX A;  2E88 A;  3WNG A;  3NH0 A;  4WCE L;  1WUA A;  3AVH A;  2W41 A;  1JLQ A;  1W0H A;  2D1K A;  3IAY A;  2G8K A;  3K5M A;  1IKY A;  4EHU A;  5C25 A;  3OBW A;  4CZL A;  1GOB A;  4BRI A;  4LF6 K;  4NYN A;  5ADX A;  3OYC A;  4TSX A;  3HYF A;  3BZC A;  4H0T B;  3C94 A;  1JLC A;  1VSH A;  5AQP A;  3ULD A;  3MN6 A;  3EO3 A;  5AQM A;  4BC5 A;  3AVG A;  4CJF A;  3QEX A;  2G8I A;  2NNW A;  4A61 A;  3HPH A;  2HNZ A;  1EET A;  2HB5 A;  4F8R A;  4DFP A;  5AQV A;  2WON A;  1BGX T;  3GL1 A;  4FK2 A;  3ID8 A;  2A1R A;  3SLC A;  5EXW A;  4DR2 K;  3TAG A;  1JLE A;  1HLU A;  2A40 A;  1EX4 A;  3HSC A;  3EE8 A;  1TK5 A;  4M3X A;  1K6Y A;  1EWR A;  1HMV A;  3WQT A;  2BAN A;  3C6T A;  1QVF M;  2P5O A;  3CM5 A;  1YT3 A;  3QBX A;  3G10 A;  2O8F B;  3OHR A;  3Q7B A;  4B1Z A;  4AQY K;  3OS2 A;  1E4G T;  3AVK A;  3O4N A;  3VF2 A;  5BN8 A;  2CGL A;  3THV A;  2E2Q A;  4J2D A;  3TAN A;  2QWN A;  2Z1J A;  4AHR A;  4A59 A;  3S9H A;  4CBU A;  4CFD A;  4ELT A;  5TKW A;  3KTQ A;  4IFY A;  2KW4 A;  1KRP A;  3CHW A;  4OGC A;  3EL2 A;  3A2F A;  3NGZ A;  4CD3 A;  5C24 A;  1HR0 K;  4AHC A;  2VG5 A;  1NK5 A;  4MO4 A;  2HHX A;  1A5W A;  2ZJP L;  2UXB K;  3Q7C A;  4PQU A;  1S3X A;  2ATQ A;  4A2A A;  1HKG A;  3VGK A;  2HNY A;  5EVZ A;  4X64 K;  1ZC6 A;  4FWM A;  3HOS A;  3O5B A;  3EZ5 A;  1JLB A;  4E19 A;  2F4V K;  3ZT2 A;  1HKC A;  4EHT A;  4AM7 A;  4AHU A;  3HPO A;  4EP4 A;  5ELZ A;  3DXM A;  4WE1 A;  4JI6 K;  1LW0 A;  3L2Q A;  3O3G A;  4YHH K;  4CFC A;  4DR7 K;  2KZZ A;  1WSJ A;  5M1Q A;  4WF9 L;  4CK1 A;  5C42 A;  3ZSW A;  4EAH D;  2HHU A;  4WFB L;  1C0M A;  1YVU A;  4L3Q A;  4BR4 A;  3AA2 A;  4MQ3 A;  3I8D A;  3JS6 A;  1N32 K;  1NBW A;  1P8Z A;  4I9L A;  5KRT A;  2XY7 A;  1YUW A;  3VES A;  3HST B;  4IDH A;  1HNX K;  1HJO A;  2W6L A;  1HQE A;  4LFA K;  2PY5 A;  1IKX A;  4ELV A;  4BE0 A;  3TAQ A;  1S1V A;  4Z4H A;  3SQ0 A;  3PX6 A;  3SBT A;  4J2A A;  4NLB A;  1N36 K;  3VN5 A;  5A2Q O;  4F2S A;  4YFU A; 
#chains in the Genus database with same CATH homology
 3DI6 A;  3QIN A;  4DSF A;  4DTP A;  3VQP A;  4E7K A;  1XI1 A;  4FJ8 A;  4OJR A;  3LZJ A;  2B5J A;  3SQ4 A;  1TK8 A;  1U48 A;  3L3V A;  4BAC A;  2NUB A;  4B8A B;  3RMB A;  3AVF A;  1T7P A;  5JS2 A;  1IKV A;  4FJ9 A;  2F8S A;  4I7F A;  4CJK A;  3KK1 A;  4N47 A;  4CGF A;  2VWK A;  4W5O A;  3EY1 A;  1LWC A;  1RBV A;  4CHP A;  3KLG A;  3AO3 A;  1X9S A;  1Z25 A;  3IAY A;  5K14 A;  3P83 D;  1NKB A;  1RBT A;  1SV5 A;  3VQA A;  4M3W A;  3HXM A;  2O4I A;  3V81 A;  3K58 A;  5DK5 A;  4CJT A;  2X74 A;  3OS1 A;  3QO9 A;  2QKB A;  1WAF A;  2E6L A;  2FBT A;  4GMJ B;  4BWM A;  4B9V A;  4DTR A;  3RRH A;  3MXI A;  4E7H A;  4IDK A;  2AJQ A;  3LP3 A;  3WNF A;  4CIE A;  4EP5 A;  3D0P A;  2Y1I A;  1HNV A;  1BIZ A;  2XY5 A;  1Q9X A;  4CJ5 A;  4Z4C A;  3VQ5 A;  3KLF A;  4DU3 A;  3V9Z A;  2G8W A;  3VQ4 A;  5T7B A;  1NJX A;  1ASV A;  4R5P A;  2OYQ A;  1FK9 A;  4W5Q A;  3V9X A;  3QET A;  3NF6 A;  1LWE A;  3SV3 A;  2OZM A;  4KHQ A;  1NK9 A;  4J2E A;  4Z4I A;  2PZS A;  3OYA A;  2YKN A;  1VSE A;  4B9N A;  3HP6 A;  3MEC A;  1SKW A;  2HHQ A;  2ZE2 A;  1TKZ A;  3ALY A;  3VA0 A;  3M8R A;  3K57 A;  3K5O A;  3ZSV A;  1QTM A;  4LD0 A;  3PUF A;  3DLH A;  3HT3 A;  3EYZ A;  3V9W A;  5J2Q A;  3E01 A;  3CFP A;  3CYM A;  4E1M A;  4AIL C;  4H8K A;  4FW1 A;  4KI6 A;  3IS9 A;  5J2P A;  1LAW A;  4E89 A;  3KKS A;  2YNF A;  3DRR A;  4ZHR A;  1RTJ A;  4JRP A;  4DSJ A;  4FJM A;  1CZB A;  4XIU A;  3QLH A;  4KHS A;  2HW3 A;  1EXQ A;  4KO0 A;  4DTO A;  1SL0 A;  4CF9 A;  4JS5 A;  4AHV A;  1VRT A;  3H08 A;  2XO7 A;  3ZCM A;  5HRN A;  3BDP A;  1S5J A;  1CXQ A;  4DU4 A;  4JRQ A;  4C8O A;  3SCX A;  4KHN A;  2KTQ A;  2OPR A;  1HQU A;  3NAE A;  1HYZ A;  1HPZ A;  2HHV A;  3QNO A;  1BIS A;  2RKI A;  1N5Y A;  4HUG A;  4LSN A;  1RBU A;  3MXM A;  4HHT A;  1SKR A;  1DTQ A;  4AH9 A;  4N41 A;  1SL1 A;  4O4G A;  1LWF A;  4I2Q A;  1VSM A;  2E4L A;  3O3H A;  3FFI A;  5FRO A;  4E7L A;  3TAF A;  1I39 A;  1J5O A;  4HUE A;  1FKO A;  5HRO A;  4KHW A;  4DQP A;  4FJJ A;  3RMC A;  4FCY A;  5HRS A;  4DSI A;  3L3U A;  1RT6 A;  3V6D A;  4DTU A;  2KFN A;  1JLF A;  2VG7 A;  4CF0 A;  2PYJ A;  1YTU A;  1GOC A;  1WN7 A;  1BI4 B;  3OVN A;  3SPY A;  1Q8I A;  3PO5 A;  1JL2 A;  1ZBU A;  4HCB A;  4M41 A;  2YKM A;  1KFS A;  4GVM A;  2IAJ A;  5J1E A;  4RG8 A;  3ZT3 A;  3TAP A;  4KRF A;  1RT3 A;  3PY8 A;  2R7Y A;  3V1O A;  4CK2 A;  4CFB A;  3AA5 X;  1VSJ A;  4E3S A;  4OKK A;  3IRX A;  1VSD A;  4CGJ A;  3IG1 A;  4UQG A;  3KK2 A;  3UIQ A;  3QER A;  4FJN A;  4J2B A;  1J9A A;  4CF1 A;  1RT2 A;  2Y1J A;  4FW2 A;  4KKO A;  4CFA A;  4HUF A;  4CGD A;  4CGH A;  1ASW A;  3OYI A;  3SJJ A;  1QSL A;  5SWM A;  3KIO A;  4KRE A;  4YNQ A;  4DSK A;  3CFO A;  4EZ6 A;  3TAM A;  3LDS A;  3L2U A;  1R0A A;  3VQD A;  3SPZ A;  3NF9 A;  4FJX A;  2HHW A;  4CF8 A;  4Z0U A;  3AVA A;  1FXX A;  3HL8 A;  1S1U A;  4CJQ A;  5JS1 A;  1VK0 A;  1Z26 A;  3NF7 A;  1RTH A;  1WAJ A;  4C8N A;  4Z4G A;  2G8V A;  1UOC A;  5FRN A;  3S3N A;  4E1N A;  4FLZ A;  3KKR A;  1NJZ A;  1KSP A;  2G8F A;  3V1Q A;  2FBY A;  1VSL A;  5I3U A;  3L2R A;  2I5J A;  3I0R A;  1GOA A;  1L3S A;  4OPK A;  1BL3 A;  4H4O A;  4KFB A;  4K8Z A;  4E7I A;  4EZ9 A;  5KRS A;  3CM6 A;  4CEA A;  3OJU A;  3TAE A;  4FZY A;  4KTZ A;  3ZSX A;  3SYZ A;  1KLN A;  4DS4 A;  2QK9 A;  3O3F A;  2P5G A;  2YNH A;  4FK4 A;  2HVI A;  3ITH A;  4M45 A;  3RMA A;  1UWB A;  2EHG A;  4ZTJ A;  2WOM A;  3LPU A;  3QIO A;  5CYQ A;  1C1A A;  1C1B A;  4DTS A;  4CJ3 A;  1QS4 A;  2XRI A;  4K8X A;  1XC9 A;  2IDO A;  1QE1 A;  2B6A A;  1BIU A;  4FLX A;  1WSI A;  4BDP A;  1RDA A;  3ASM A;  4OLA A;  4CK3 A;  4FM0 A;  3T3F A;  4DQR A;  3VQE A;  4CEE A;  3BGR A;  4BE1 A;  4DFK A;  3HVT A;  4M3T A;  3NE6 A;  4RW6 A;  3U6F A;  1HJR A;  4DSL A;  3T1A A;  3VQ7 A;  2YHB A;  1U45 A;  3AVL A;  1BI4 A;  2DFF A;  3SQ2 A;  3V1R A;  4DLG A;  2F8T A;  1NOZ A;  1L3U A;  3OYD A;  1RIL A;  4FJK A;  2OPP A;  4F2R A;  3KK3 A;  2EX3 A;  3LPT A;  3NF8 A;  2HMI A;  2OPQ A;  2Z1H A;  3PV8 A;  4FJL A;  1KTQ A;  4DSE A;  3SUO A;  1HRH A;  1TAQ A;  3HP9 A;  2X78 A;  1VSK A;  3RR7 A;  1RCH A;  4DTX A;  4FJH A;  3DYA A;  4CEC A;  1DLO A;  3HVR A;  4OGE A;  3TR8 A;  3SI6 A;  4CHZ A;  4CHO A;  2W42 A;  3SNN A;  3DLB A;  3LAL A;  4O0I A;  4QAG A;  3NCI A;  4HTU A;  4DU1 A;  1NK0 A;  1T8E A;  1LW2 A;  1NK4 A;  3LP1 A;  5J2N A;  4CGG A;  1RT4 A;  3K5N A;  3O4Q A;  1LV5 A;  3SV4 A;  3VQ8 A;  3PX4 A;  3TAR A;  4ZTF A;  2QXF A;  4OLB A;  1U49 A;  4BE2 A;  5DMR A;  3DLG A;  1XWL A;  4LY7 A;  3L8B A;  1NK8 A;  2DFE A;  1RT5 A;  4RW7 A;  3I0S A;  1RTI A;  3DLE A;  1WLJ A;  4CEQ A;  4CHQ A;  3RMD A;  1B9F A;  4FJ5 A;  5KGW A;  1CXU A;  2D0B A;  4FLV A;  4FLW A;  2D5R A;  4CJS A;  4W5R A;  4CIF A;  3OY9 A;  1C0T A;  3NGY A;  1TKD A;  1U47 A;  2ZD1 A;  1A5V A;  4CJP A;  3ISN C;  3M8S A;  4OVL A;  3LAM A;  3NH2 A;  4B9U A;  2KFZ A;  3LWM A;  3AO2 A;  1JL1 A;  3B6P A;  1S1X A;  1XHX A;  4FYD A;  4DQS A;  1ZBI A;  4FXD A;  3QEI A;  5I42 A;  1S1W A;  1S9E A;  4F3O A;  3QES A;  3M8Q A;  4RW9 A;  4M3Y A;  1BQN A;  1VSI A;  3LZI A;  4QCL A;  2IS3 A;  3LWL A;  2ITG A;  4OKJ A;  5FRM A;  3AVI A;  3AO4 A;  2HND A;  4DQQ A;  3HO1 A;  5HBM A;  1ZBH A;  4B9L A;  1A5X A;  3KLH A;  4E7J A;  1D5A A;  1KLM A;  1IO2 A;  2Z1I A;  3DLR A;  2YNI A;  4PWD A;  2QKK A;  3P1G A;  3LP2 A;  4KAZ A;  3MED A;  4B9T A;  4CEZ A;  4CGI A;  2X6N A;  4DWI A;  4CES A;  3DM2 A;  4FJG A;  4NCB A;  2D0A A;  1G15 A;  1UAX A;  2X6S A;  4NCG A;  4C8M A;  3VQB A;  1ASU A;  4B08 A;  3OYF A;  3RR8 A;  2G8U A;  4HCC A;  3TI0 A;  4FLY A;  2BDP A;  1S6P A;  4O5B A;  4N5S A;  5HRP A;  1NKE A;  1REV A;  3L2W A;  3SUQ A;  4E0D A;  4MFB A;  4F3T A;  1J54 A;  1W9H A;  1EKE A;  1RBS A;  1VSF A;  4B8C A;  3OS0 A;  4G1Q A;  1T03 A;  3RRG A;  2GUI A;  3OYG A;  4DFM A;  3NGI A;  4Z4F A;  4CE9 A;  3QNN A;  3PO4 A;  3K2P A;  4LH5 A;  1B92 A;  5HLF A;  4RW4 A;  3KLE A;  4DLE A;  3NBP A;  3RTV A;  4JS4 A;  3OYK A;  3ZSO A;  3MXJ A;  3QIP A;  1HNI A;  3TWH A;  4ICL A;  3P5J A;  3PX0 A;  4GW6 A;  1NK6 A;  4FM1 A;  1BCM A;  4DF8 A;  4B9M A;  3HJF A;  1U04 A;  4FVM A;  4M42 A;  4DF4 A;  2F96 A;  5KTQ A;  1TAU A;  4CJV A;  3NFA A;  1Y97 A;  3B6O A;  1SL2 A;  4C8K A;  2YV0 X;  4H4M A;  1WNS A;  4DMN A;  3RWU A;  2DTU A;  1TKT A;  4FM2 A;  5KGX A;  4DFJ A;  1J53 A;  4CCH A;  4FJI A;  3WNG A;  3ZSR A;  3NH0 A;  4Z4E A;  1ZBL A;  2XY8 A;  3AVH A;  3QEV A;  5CZ2 A;  2RN2 A;  4DG1 A;  3OJS A;  2OA8 A;  1JLQ A;  1NJW A;  4Y1D A;  1I3A A;  4B9S A;  1W0H A;  3K59 A;  1RDB A;  3OYN A;  2DY4 A;  3V9S A;  2D0C A;  1S9G A;  3S3O A;  1JXB A;  3K5M A;  1IKY A;  5E41 A;  5C25 A;  1L3T A;  2G8K A;  3AVN A;  1JKH A;  4KHY A;  2YHA A;  1Q9Y A;  4ELU A;  1TK0 A;  1GOB A;  2O4G A;  1DTT A;  4NYN A;  1WSH A;  3CFR A;  3OYC A;  1U4B A;  4TSX A;  4CEO A;  3HYF A;  1IH7 A;  3AA3 A;  4FLT A;  4C8L A;  4QOZ B;  3C94 A;  2RF2 A;  4M3U A;  2ZQB A;  1L5U A;  1JLC A;  3JSM A;  2YNG A;  4KTW A;  1VSH A;  3F73 A;  4O44 A;  1HYV A;  1F21 A;  3ULD A;  2HHT A;  5CYM A;  3SQ1 A;  1TKX A;  2G8H A;  1NKC A;  3KD5 E;  2VWJ A;  3AVG A;  3AVM A;  4CJF A;  1CZ9 A;  4CHN A;  3QEX A;  4CIG A;  4FK0 A;  2G8I A;  3HPH A;  5CY4 A;  1S6Q A;  2HNZ A;  1EET A;  2HB5 A;  4FLU A;  3AO5 A;  1ZYQ A;  3CG7 A;  3QEW A;  4PA1 A;  1O1W A;  1RNH A;  1SUQ A;  1BHL A;  4CEF A;  3V4I A;  1UA1 A;  4F8R A;  4DFP A;  1IKW A;  1X1P A;  4IG3 A;  2JGU A;  5SZT A;  3U3Y A;  3QEP A;  2KQ2 A;  2WON A;  3LAK A;  3WNE A;  1BGX T;  4N76 A;  4BWJ A;  1FKP A;  4FK2 A;  3C95 A;  3WNH A;  1RT7 A;  4IKF A;  4DS5 A;  2HVH A;  2A1R A;  4IFV A;  3KJV A;  4KTQ A;  3KLI A;  3TAG A;  4OKE A;  1JLE A;  3CQ8 A;  1EX4 A;  4KV8 A;  1MU2 A;  1C1C A;  4CJW A;  1TK5 A;  3LP0 A;  2B4J A;  4M3X A;  1K6Y A;  4N56 A;  1HMV A;  2PYL A;  3TAB A;  1KVA A;  2BAN A;  3AA4 A;  3AV9 A;  3C6T A;  4CHY A;  4NYF A;  5HRR A;  1RDC A;  2P5O A;  3F9K A;  1C6V A;  2IOC A;  3NH1 A;  3CM5 A;  1YT3 A;  3MAQ A;  2FBX A;  3G10 A;  3VQQ A;  4LH4 A;  3V9U A;  4PUO A;  1HYS A;  1RDD A;  3AVC A;  3OS2 A;  3JYT A;  4FZX C;  4LSL A;  3AVK A;  3O4N A;  4BDY A;  3THV A;  4CJU A;  3MEE A;  1D8Y A;  1ITG A;  4J2D A;  3TAN A;  4B3O A;  1X9M A;  3C6U A;  2Z1J A;  4FJ7 A;  4O0J A;  1RTD A;  4AHR A;  3K5L A;  3S9H A;  2BGG A;  1RT1 A;  4CFD A;  4ELT A;  5FDL A;  1LAV A;  3OYL A;  3KTQ A;  4IFY A;  3D45 A;  4ID5 A;  2KW4 A;  1KRP A;  4I2P A;  5KI6 A;  4CJR A;  1NK7 A;  1NJY A;  4L8R B;  1L3V A;  4OGC A;  3A2F A;  4DTN A;  3NGZ A;  2KZM A;  3OYB A;  5C24 A;  4DTM A;  2Z1G A;  1TL1 A;  3DOL A;  3MEG A;  1QSY A;  1CLQ A;  4AHC A;  4RW8 A;  2HHS A;  2Q3S A;  2VG5 A;  2VG6 A;  1NK5 A;  2IGI A;  2HHX A;  3OYH A;  1KVC A;  1A5W A;  1C0U A;  1TVR A;  1SKS A;  1QSS A;  2JLE A;  4PY5 A;  4Q5V A;  4I9Q A;  3ZSY A;  1D9F A;  4CJL A;  5D3G A;  4PQU A;  2ATQ A;  4JLH A;  1T05 A;  5J2M A;  3ZT1 A;  4FZZ A;  2HNY A;  4NCA A;  1QQC A;  3NHG A;  1WSE A;  3SUP A;  4F4K A;  3OYM A;  1IG9 A;  3HPG A;  1TGO A;  3EZ5 A;  3SZ2 A;  3OYJ A;  2GV9 A;  3AVJ A;  3SUN A;  4M3Z A;  1JLB A;  3L2V A;  4KB0 A;  4E19 A;  3ZT2 A;  1S1T A;  4ID1 A;  4OPJ A;  2P1J A;  3AVB A;  4AHU A;  3HPO A;  3ZT0 A;  4EP4 A;  4AHS A;  5HP1 A;  4CJE A;  1N6Q A;  1WSF A;  4WE1 A;  1D9D A;  4CEB A;  1WSG A;  1LW0 A;  2E6M A;  3L2Q A;  1XHZ A;  2RPI A;  3O3G A;  4CFC A;  3VA3 A;  1WSJ A;  2KZZ A;  1EP4 A;  1KFD A;  1NOY A;  4CK1 A;  3DRP A;  5C42 A;  3ZSW A;  4DTJ A;  4HVJ A;  2HHU A;  3OYE A;  4AHT A;  1KCF A;  2OPS A;  4O55 A;  1C0M A;  1YVU A;  2BE2 A;  4Q0B A;  4IG0 A;  3AO1 A;  3T19 A;  3AA2 A;  4MQ3 A;  2XY6 A;  3KD1 E;  4KB1 A;  1BQM A;  3I8D A;  3ZSQ A;  4CJ4 A;  1YTA A;  3U3G A;  4DQI A;  4KHU A;  4M3R A;  1BCO A;  2ETJ A;  4I9L A;  3DMJ A;  3G0Z A;  3VQ6 A;  5KRT A;  1TV6 A;  4KI4 A;  2XY7 A;  1KVB A;  5CZ1 A;  4CF2 A;  3HST B;  2P51 A;  1RBR A;  4W5T A;  3DOK A;  3LAN A;  2OZS A;  4KPY A;  4BDZ A;  3DRS A;  4CER A;  3S3M A;  3HM9 A;  4IBN A;  2FC0 A;  1HQE A;  5EU7 A;  3VQC A;  3M8P A;  2PY5 A;  1IKX A;  1B9D A;  1JLA A;  2GBZ A;  3ZSZ A;  4ELV A;  1ZBF A;  4BE0 A;  4Y1C A;  3TAQ A;  1S1V A;  3ZT4 A;  1JXE A;  1TL3 A;  4Z4H A;  2A1S A;  3PX6 A;  3SQ0 A;  3DLK A;  3NDK A;  3HK2 A;  1VRU A;  2IC3 A;  4J2A A;  4W5N A;  1UA0 A;  2FBV A;  1X9W A;  2XHB A;  4CED A;  3VN5 A;  2LSN A;  1QHT A;  3VQ9 A;  2DFH A;  4F2S A;  1JLG A;  4YFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...