4HVJA

Crystal structure of a putative uncharacterized protein from mycobacterium tuberculosis in complex with amp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
160
structure length
156
Chain Sequence
SMVRYFYDTEFIEDGHTIELISIGVVAEDGREYYAVSTEFDPERAGSWVRTHVLPKLPPPASQLWRSRQQIRLDLEEFLRIDGTDSIELWAWVGAYDHVALCQLWGPMTALPPTVPRFTRELRQLWEDRGCPRMPPVHDALVDARDQLRRFRLITS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
publication title Mycobacterium tuberculosis Rv2179c Protein Establishes a New Exoribonuclease Family with Broad Phylogenetic Distribution.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 52
structure length 156
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4hvjA00
4Z4HA 4YFUA 4KHQA 3K58A 2OPQA 3SNNA 3D0PA 3MXIA 4J2DA 4NYNA 2XO7A 4HUEA 3SUPA 1I39A 4CECA 2PY5A 2HHSA 1B9FA 3VQ7A 2G8HA 1KVBA 3L3VA 4G1QA 1RBTA 1S1UA 2YNGA 3M8PA 4DQQA 4OLBA 4CHZA 1BL3A 3IS9A 2Z1GA 4FJNA 2FBYA 2X78A 3ZT1A 4CJ3A 4CFAA 1ASUA 4OLAA 4E19A 2QKBA 2HVIA 2HHVA 3OVNA 2GUIA 4CJQA 3DRRA 1WSFA 5C25A 1ASVA 3E01A 2E6LA 1QHTA 4CJWA 3CYMA 1VSMA 2B4JA 2Z1IA 3SCXA 3LWMA 2G8FA 3DLRA 3HL8A 2FBTA 1RTHA 5KGXA 1J54A 3C94A 3F9KA 4LSLA 1T8EA 3S9HA 1B9DA 3PUFA 2YHAA 1TL1A 4CGGA 1T7PA 3PO4A 3G0ZA 4B08A 2KFNA 1FKPA 1NJZA 1BQNA 4PWDA 3T1AA 4OKJA 1XHZA 1BIZA 4M45A 3DOLA 3HP6A 4DFMA 4TSXA 1XI1A 1REVA 2WOMA 3DYAA 4R5PA 4B9VA 1WSEA 1NK7A 4DFJA 4KTWA 4E89A 1VK0A 4DU1A 4AH9A 1HQEA 1K6YA 2E4LA 3WNEA 4EP5A 3NCIA 3OYDA 1SL2A 1L3TA 3RR7A 3PO5A 4Q0BA 4DMNA 4FYDA 1LW2A 3ZSYA 4HCCA 2HHQA 4F2RA 4CGIA 4HUFA 1U47A 3QLHA 2IOCA 5KI6A 2OPPA 3NGZA 3KD1E 1SL0A 2Q3SA 3V9UA 3PX0A 3L3UA 1S5JA 4HTUA 1LWCA 2X6SA 4OKEA 4E7HA 4AHTA 4CHOA 2E6MA 3CQ8A 1VSJA 2JGUA 3AA3A 3AV9A 1QSSA 1D9FA 3ZSQA 1SUQA 4MFBA 1CXUA 1HNIA 3HSTB 1LWFA 5KGWA 4CF1A 1JLGA 4CHPA 4HUGA 1QE1A 1LW0A 3RMDA 1TAUA 3ZCMA 1ZBHA 1D8YA 1GOAA 2XY5A 1WNSA 1EETA 4QAGA 5J2PA 1BCMA 4DF4A 4CJLA 3KTQA 4M3TA 5JS2A 1J5OA 1RT5A 1CZ9A 2VG7A 4O0JA 3ZSZA 2ITGA 1Q8IA 5SWMA 2OYQA 1BHLA 5C42A 2QKKA 3VA0A 1Q9XA 2BE2A 1RTDA 2HB5A 3P83D 4CJ4A 1UWBA 3SYZA 4Z0UA 1U49A 5J1EA 4J2EA 2DTUA 3H08A 3QO9A 3T3FA 5T7BA 4F8RA 4GMJB 1RTJA 2RKIA 4RG8A 4CK3A 3AA4A 4DQPA 4KI6A 4ID1A 1EP4A 1RTIA 5DK5A 4EP4A 3M8QA 3NFAA 1JLFA 4KV8A 1L3SA 1WSJA 4ICLA 2G8IA 4CEFA 1TKTA 3VQPA 1WAJA 3OYEA 1T03A 2FBXA 4KAZA 1JL2A 4CCHA 1A5VA 2VG6A 2IAJA 3LPUA 4CJSA 3V9SA 3SUNA 4OVLA 4CIFA 2O4GA 3OYFA 3K59A 1BISA 4AHRA 1QSLA 3OYGA 2HNYA 2RPIA 3D45A 3RR8A 2YHBA 4FLUA 3MXJA 1EKEA 1S1XA 3O4NA 3RTVA 1Z25A 3QESA 1VSDA 3LPTA 3IG1A 1L3UA 2BANA 4BE0A 2VWJA 1BQMA 1IH7A 3DRSA 4RW7A 4FM1A 4DTUA 3SI6A 3O4QA 4CEOA 4FLXA 1UOCA 1BI4A 3TAGA 4OPJA 4BWMA 3WNHA 3MEDA 4DLGA 3VN5A 5KTQA 2HVHA 5CYMA 3QEXA 4IDKA 4IG3A 4J2AA 2KQ2A 1JL1A 3HYFA 3FFIA 3RMCA 3AVBA 3OYJA 1QS4A 3TR8A 5J2MA 4DQIA 1NKEA 3VQAA 1HQUA 3ITHA 3NF6A 1KVCA 5FROA 4CGDA 4IG0A 1U04A 4CFBA 3F73A 3HPOA 4FJ5A 4CHNA 3TAQA 4B9SA 5HP1A 2B5JA 3QETA 4FM0A 1TK0A 4KB0A 3CFRA 4KI4A 4MQ3A 4FK4A 3LANA 4DQRA 4QOZB 3LP2A 3VQBA 3NDKA 2P1JA 1XWLA 3V9ZA 4B9NA 3L2RA 3V9WA 4JRQA 4PUOA 5I42A 1W0HA 2HW3A 3AVAA 4LD0A 3RRHA 4F3OA 1U48A 1TKDA 4ZTFA 2FC0A 4CEDA 5J2QA 4CJKA 2Z1JA 3MEEA 3AA5X 4FJ7A 1KTQA 3U3GA 4CIEA 5FDLA 3ULDA 2QXFA 3AVGA 1C1CA 5FRMA 3SZ2A 1TK5A 4AHVA 4JLHA 2Y1IA 4DTMA 4H4MA 3PX4A 3NGYA 3NF9A 1ZBFA 1X9MA 2ZD1A 1NJXA 5J2NA 1LAWA 1IKXA 2OPRA 1HYSA 3OJSA 1DTQA 3ZT2A 4H4OA 4DQSA 4FLWA 2IDOA 2X6NA 3AVJA 3NH0A 3U6FA 1NK4A 4QCLA 4JS5A 3KLIA 3AO5A 4FW1A 4KKOA 4KHNA 2EX3A 3CM5A 3LP0A 4B9MA 4DG1A 3AVFA 3LP3A 4DTOA 4Z4FA 3DOKA 3PX6A 3A2FA 2F96A 5HRSA 3V1RA 2BDPA 3B6OA 3QIOA 1BCOA 1DTTA 1FKOA 4AHCA 5E41A 3QEWA 4J2BA 1C1AA 1TL3A 3KLGA 3SJJA 4CJ5A 4N41A 2YKMA 4OGCA 4FLVA 4C8NA 3L2UA 1X9WA 3S3NA 3VQDA 4ELUA 3V9XA 1S6QA 3DM2A 4W5QA 3QEIA 4GVMA 3ZSVA 3K5OA 3PV8A 1SKWA 4ID5A 4FW2A 4JRPA 3NF7A 2G8UA 3IAYA 4Z4CA 3RRGA 4CHQA 1NJWA 3AO4A 3THVA 4ELTA 3S3OA 1BGXT 1F21A 1YTUA 4Z4GA 4CK2A 3L2VA 1RT3A 3OYBA 3VQ4A 4FJXA 4DU4A 1ZYQA 4FJMA 1TAQA 2EHGA 4N47A 1O1WA 1NK6A 2HNZA 3HPHA 3KK1A 3HXMA 4E1NA 5D3GA 5CY4A 3OY9A 4PQUA 1UAXA 4DTXA 4OPKA 4I9LA 4FJJA 4JS4A 1HYVA 4Q5VA 1A5WA 2VG5A 4HCBA 1W9HA 2PYJA 4FM2A 1TGOA 3DLHA 3CM6A 4O55A 3HT3A 2OPSA 4FJGA 4CJTA 5EU7A 1NK9A 4CGJA 1RILA 1R0AA 1LWEA 3ASMA 1VSKA 4W5TA 3SUOA 2OA8A 1VSIA 5HLFA 1IKYA 3K5LA 3KLEA 2DFFA 4B8CA 4CE9A 1S9EA 3QEVA 4PA1A 3LAKA 5HRNA 2RF2A 1NKBA 1HNVA 4E7KA 4C8LA 5JS1A 4FXDA 4LH5A 1RDCA 4FJKA 3TAPA 3IRXA 5C24A 4BDYA 3AVCA 3C95A 4DSKA 1WSHA 5HRPA 1YTAA 1JLBA 3I8DA 4NYFA 2P5OA 4DF8A 3NBPA 4CEAA 1FK9A 1ITGA 1RT7A 2DFHA 4N76A 1CZBA 3QERA 4C8MA 2G8WA 1X9SA 3NGIA 3L8BA 4DSFA 3EY1A 1Q9YA 3SUQA 1VRTA 3KKSA 3OYMA 4ZHRA 3BGRA 4DU3A 1VRUA 2IS3A 4CJFA 2PZSA 3RWUA 3QIPA 1J53A 1SKRA 4I9QA 2O4IA 3K2PA 3VQ5A 2DFEA 2HNDA 2IGIA 3V1OA 3OYNA 2Y1JA 3NE6A 2KZMA 1QSYA 1WN7A 1SV5A 3NAEA 3VQ6A 2XY8A 2G8VA 4KTZA 3TANA 4CEEA 3OYLA 4HHTA 2DY4A 3OS0A 3AVLA 4CFCA 3HM9A 3K5NA 1X1PA 2KW4A 3AVKA 3P1GA 2B6AA 4DS5A 3SPYA 1FXXA 1YT3A 1QTMA 3HJFA 3DLEA 3OYIA 4E3SA 4BWJA 1ZBIA 4F4KA 1NOZA 4DTSA 2ZE2A 1CXQA 1NJYA 3O3GA 1WLJA 1KLMA 1RBVA 3EZ5A 3WNFA 5HROA 3DLGA 4L8RB 1TKZA 4CF9A 3VQ8A 4O4GA 1JLEA 2D0BA 4RW4A 3O3HA 1S1WA 2XY6A 2D0CA 3B6PA 4M3YA 2HHXA 3KLHA 1BIUA 1HPZA 1C0UA 1TKXA 1NK5A 2RN2A 1A5XA 1D5AA 1TK8A 4E0DA 4HVJA 4B3OA 4W5NA 4OKKA 4KRFA 4EZ6A 4CF0A 3G10A 3C6TA 3VQ9A 1IG9A 2PYLA 4AHSA 2QK9A 3AVHA 3HVTA 3KLFA 3JYTA 4DFPA 2F8TA 2YNIA 4CK1A 3RMBA 1KRPA 4Y1DA 4C8KA 4RW9A 3TAMA 4FLTA 1CLQA 2A1SA 1VSHA 2ATQA 3QNNA 3T19A 2KFZA 1WSGA 2R7YA 3SV3A 3NH1A 4FLYA 2ZQBA 4M41A 1RBSA 4FZXC 3KD5E 4K8ZA 2G8KA 1C0MA 1LAVA 4FJLA 1IKVA 4DS4A 4M3XA 1RBUA 3QNOA 5CYQA 1VSFA 2YV0X 4CEQA 4CJEA 2I5JA 3VQEA 4DSIA 4FJIA 3NHGA 1BI4B 5CZ1A 2D5RA 5HBMA 1XHXA 4I7FA 3DMJA 2OZSA 3EYZA 4Z4IA 4KHYA 1RBRA 3CFOA 1MU2A 1IKWA 3KKRA 3ZT4A 4BDZA 4KFBA 3MAQA 1HYZA 4DLEA 2HHTA 1G15A 1HMVA 4YNQA 2NUBA 3AO1A 3TWHA 4M3ZA 1UA0A 3OYHA 1KLNA 1VSLA 1TVRA 3NF8A 4CEBA 4CF8A 4CHYA 4DWIA 4Z4EA 1RDAA 4LH4A 3JSMA 4PY5A 3AVMA 4B9UA 3NH2A 3AO3A 3VA3A 1C1BA 2XHBA 3V6DA 3LALA 1RT2A 4M3RA 1S1TA 2KTQA 1LV5A 3V1QA 3OYAA 3PY8A 3TAFA 3CG7A 1NKCA 4OJRA 3HK2A 4F3TA 4O0IA 4FCYA 2HHWA 3L2WA 3V81A 1S6PA 3K5MA 5KRTA 3SQ1A 1TV6A 4W5RA 3ZT3A 4E7IA 4CGHA 2ETJA 1JXBA 3VQCA 4BE1A 1S9GA 1YVUA 4CF2A 4DTPA 1KSPA 4WE1A 1S1VA 4ZTJA 3MECA 1T05A 3KIOA 1EX4A 5I3UA 3I0SA 1JXEA 3ZT0A 3SQ2A 4FJ8A 4KHUA 3DRPA 3OYKA 5CZ2A 4KHWA 2GV9A 4LY7A 3OS2A 2WONA 3TAEA 2BGGA 4I2PA 3OYCA 5SZTA 1NK0A 3AVIA 2JLEA 5KRSA 1U45A 1RDBA 3LWLA 1SL1A 4Y1CA 4KREA 3SPZA 1EXQA 1KVAA 1VSEA 3OS1A 2AJQA 2F8SA 4CGFA 4E1MA 3DLBA 2YNHA 3KK3A 4NCBA 4FVMA 4KHSA 4NCAA 1B92A 3DI6A 3VQQA 2GBZA 1HJRA 2D0AA 1RT4A 4CJRA 4DSLA 4IFYA 1RNHA 2P5GA 3HO1A 1RT1A 3AVNA 2A1RA 1XC9A 1IO2A 3HP9A 3TARA 3ZSRA 3HVRA 1D9DA 1C6VA 1N6QA 3M8RA 2IC3A 4OGEA 4W5OA 1ZBUA 4IBNA 3RMAA 4I2QA 4BE2A 4BDPA 3LDSA 4FK0A 2Z1HA 4M3WA 1I3AA 4FJ9A 4B8AB 3UIQA 1Y97A 4H8KA 3ZSXA 1DLOA 3ALYA 3LZJA 4DTNA 1NOYA 3BDPA 4FJHA 4CJPA 4DSJA 4FZYA 1RDDA 4ELVA 1QQCA 3O3FA 4RW6A 3SV4A 2YKNA 4B9LA 4KPYA 2OZMA 4AHUA 3CFPA 4O44A 4GW6A 4IKFA 4LSNA 1N5YA 5FRNA 3V4IA 1KFDA 4CJUA 5HRRA 4N56A 4FK2A 4NCGA 1L5UA 3AO2A 5DMRA 4UQGA 3ISNC 4DFKA 3QEPA 4RW8A 1ZBLA 4KTQA 1UA1A 3TI0A 3TABA 3MEGA 1RT6A 1KFSA 2P51A 4IFVA 4DSEA 1KCFA 1RCHA 1WSIA 3HPGA 3LAMA 1J9AA 4M3UA 1L3VA 4O5BA 3LZIA 4DTJA 1JLCA 3WNGA 2FBVA 3ZSWA 1NK8A 1JLAA 2X74A 3OJUA 3K57A 4FZZA 4CIGA 4AILC 1JKHA 3C6UA 2LSNA 2VWKA 4B9TA 3M8SA 4K8XA 2W42A 1GOBA 4KB1A 4M42A 3ZSOA 1JLQA 1SKSA 4F2SA 3AA2A 1ASWA 3I0RA 1C0TA 3MXMA 1U4BA 3QINA 4EZ9A 3P5JA 3SQ4A 1HRHA 2YNFA 2XY7A 3SQ0A 1WAFA 2KZZA 4FLZA 3LP1A 4CERA 4CESA 4E7LA 5K14A 2HMIA 4CEZA 4XIUA 3KJVA 3L2QA 3DLKA 3KK2A 4E7JA 4DTRA 4CJVA 3U3YA 2XRIA 4C8OA 4N5SA 4BACA 4CFDA 2HHUA 1Z26A 3S3MA 4KO0A 1GOCA
chains in the Genus database with same CATH superfamily
4Z4HA 1OH8A 3C7NB 2OPQA 5M1FA 4J2DA 3BZKA 3A5NC 4NO7A 2O8FB 2G8HA 2FSJA 2E88A 4QS8A 2OTLN 3IS9A 4EHUA 2X78A 4FOEA 5AR0A 4E19A 1YJ9N 3VETA 4CD3A 4YOTA 3QBXA 3QFPA 3CYMA 1VSMA 2B4JA 3LWMA 3HL8A 5KGXA 4LSLA 4H0XB 4K43A 2YHAA 3QBWA 4CGGA 1T7PA 1LOTB 3G0ZA 1SQKA 3H3OB 1WBBA 3T1AA 4OKJA 2IVOA 1IJJA 5AFUH 4I6MA 3DOLA 1REVA 2WOMA 3DYAA 4B9VA 4KTWA 4DU1A 1SL2A 3C6AA 3GE1A 1NG9A 4FYDA 4A5BA 2GWJA 3KD1E 2OPPA 3NGZA 5AFUA 2Q3SA 3PX0A 4CZIA 1S5JA 2NRHA 4AHTA 2P9KA 3IFRA 3CQ8A 1VQ9N 2JGUA 3P39A 4B9QA 3ZSQA 1SUQA 1CXUA 4CF1A 3RMDA 1YXQA 4JKCA 1LW0A 1TAUA 1D8YA 2ASPA 4JKAA 1OVYA 1WNSA 5J2PA 3D6RA 3J7YP 3KTQA 5EY4A 1NGCA 2VG7A 2OYQA 2ITGA 5SWMA 3U9ZA 1OH7A 2ZGYA 1Q9XA 1UWBA 4J2EA 4FPAA 4BRPA 5JLFA 3BY5A 2RKIA 4BVPA 2A42A 2O8DA 4DQPA 2CH5A 1RTIA 5DK5A 1WSJA 2P9SB 1WAJA 1JL2A 3E9OA 3LPUA 5AQMA 1QZ6A 4OVLA 2QI2A 3SLCA 3K59A 3OYGA 3D45A 4X66K 1EKEA 3QESA 4JKBA 3VMFB 1ZC6A 5AZJB 3IG1A 2O8EB 4DR2K 1DT9A 1BQMA 5KQ8A 3SI6A 4MDAA 4DKWA 2I7NA 1UOCA 3T1YK 3TAGA 2NNWA 4FWSA 4BWMA 3WNHA 2E20A 1VQ8N 3HYFA 4BRMA 3FFIA 5GAHP 2NRXA 4DQIA 1HQUA 3QETA 2IIRA 4FK4A 2W6LA 1RFQA 2BH1A 4PUOA 3ULEA 3RRHA 4F3OA 1TKDA 4ZTFA 2FC0A 4CEDA 5J2QA 5AQTA 1VQ7N 1NM1A 3MEEA 3CI5A 3CJBA 4JN4A 2HBJA 1C1CA 5FRMA 2QWOA 4AHVA 4JLHA 3NGYA 1KD1O 1XNQK 1LAWA 3ZT2A 3VPZA 1ZBSA 1N32K 3MMVA 4B1XB 2IDOA 2FSNA 3NH0A 3BP8A 4JS5A 4KHNA 3N4QA 1OH5A 4B9MA 3AVFA 1NGJA 3DOKA 3L4QA 2BDPA 3TTCA 1BCOA 1FKOA 3GG4A 4AHCA 4J2BA 5AQGA 3KLGA 4CZFA 4EFHA 4C8NA 3N4PA 3VQDA 1J6ZA 3SBTA 1KQSM 4UY8O 1SKWA 3IAYA 4FW2A 2G8UA 4AM6A 4Z4CA 3RRGA 4CHQA 4JK9A 4ELTA 1BGXT 1F21A 4FOIA 1YTUA 4Z4GA 4BY9C 4K0KK 4DU4A 1TAQA 4C23A 1XMQK 1O1WA 1NK6A 1HPMA 4PQUA 3HXMA 2QWRA 3CJ7A 2O8CA 1DEJA 3D2EA 4LFAK 1Z05A 2PYJA 4FM2A 3HT3A 2OPSA 4W5TA 2A6AA 2F4VK 1IV0A 1M1KO 3M5RA 1S9EA 2HF4A 3E9PA 1HX1A 1TUUA 5HRNA 2HBLA 4FWLA 3IRXA 5C24A 3C95A 1WSHA 4DR3K 1JLBA 2HF3A 5M1KA 4DF8A 1FK9A 4BRAA 2F7TA 3L8BA 2NRVA 1Q9YA 3SUQA 3OYMA 3RWUA 3BGRA 3J7ZO 2YCHA 3FZKA 2PZSA 1U2VB 3OYNA 1QQOA 3NE6A 2ZWHA 2KZMA 3R3LA 3NAEA 2ZM6K 3TANA 1X1PA 2KW4A 2B6AA 4LFCK 1NOZA 4BC5A 2F9WA 3P4IA 5IT9O 3O3GA 1RBVA 2PBDA 1TKZA 3VQ8A 5AQOA 1S1WA 2D0CA 2HHXA 2RN2A 2E8AA 4FWPA 4OKKA 4EZ6A 4BRNA 4CF0A 3AVHA 4BR2A 3KLFA 2F8TA 4CK1A 5CE3A 3WXKA 4GV9A 1VSHA 1QQMA 3CCEN 1VHXA 1RBSA 4L3QA 3KD5E 1VQKN 3QNOA 2YV0X 2Q97A 5LJVA 3CCRN 4IXCA 1BI4B 5HBMA 2D5RA 1XHXA 4I7FA 5BN8A 3CCQN 3DMJA 2OZSA 1Q86O 4Z4IA 1MU2A 3ZT4A 3CQYA 2YJEA 3AO1A 3O4WA 3TWHA 3OYHA 1KLNA 1NLVA 1WOQA 4XEIA 4PY5A 3AVMA 4B9UA 3VA3A 1C1BA 2XHBA 3LALA 4KBOA 2KTQA 2ZGZA 3V1QA 3HK2A 4F3TA 5KRTA 4JKEA 4O8KA 4CF2A 1KSPA 3P38A 1S1VA 3LDNA 3KIOA 4DV1K 3THXA 1JXEA 4KHUA 3OYKA 3ZYYX 4IEIA 4FSVA 4BG9A 2NRRA 4R79A 3TAEA 1GLEG 1VQNN 1RDBA 4BR7A 1SS6A 1EXQA 4ILGB 1KVAA 1VSEA 3WT0A 4IOXA 3SAHA 2AJQA 4BRFA 2YHWA 3DLBA 2A3ZA 2UYTA 3VEOA 3G71N 3DI6A 1HJRA 3E9LA 2P5GA 3J8AA 1HKCA 1RT1A 1IO2A 4DV5K 1WBDA 1C6VA 3M8RA 1ZBUA 4BE2A 4BDPA 5BPLA 5GINA 2PFUA 2VYPA 4M3WA 3KWGA 2VQFK 4H8KA 1S3XA 3ZSXA 3LZJA 4KH5A 1HR0K 3MCPA 4NLBA 4OPHA 5AQHA 4KPYA 4AHUA 4GW6A 5BR9A 4AF1A 3V4IA 4CJUA 5BRHA 1P90A 3A0IX 1L5UA 1YHQN 5DMRA 4KHYA 1ZBLA 4XH1A 4KTQA 2P51A 1RCHA 4GV6A 3EE8A 3LZIA 1JLCA 3ZSWA 1ATNA 2X74A 3K57A 4YHHK 3CHWA 1JKHA 4B9TA 4KB1A 2BUPA 2UXCK 3I0RA 3MXMA 4H0VB 2P9LA 4JK8A 3P5JA 2YNFA 2XY7A 3VERA 4CESA 4CEZA 4H5NA 3KK2A 3DLLL 4CJVA 4C8OA 4CBWA 4N5SA 3W0LA 2FF3B 5LMUK 3A5OC 3FZFA 3P31A 1GOCA 3ZCMA 3SBGA 4KHQA 5CHIA 4H5RA 4WQ5C 3K58A 5AQZA 2J4RA 4NYNA 2XO7A 3VQ7A 4OLBA 3M6GA 2Z1GA 4WCEL 2FBYA 4IJNA 1ASUA 2HVIA 3IUCA 3E01A 2E6LA 2Z1IA 3HOSA 3OBWA 2Q0UA 4ISEA 2QEXN 3S9HA 3O9RA 3E1YA 3L0QA 4O8UA 3PO4A 2E2OA 2FLOA 2KFNA 4CZLA 1GLBG 1NGHA 1NJZA 1BQNA 2O8BB 1XHZA 3O5BA 4TSXA 4B1UB 1NK7A 4DFJA 3WNEA 4EP5A 3PO5A 4Q0BA 3OYDA 2GELA 3NMUA 3MN7A 1LW2A 3ZSYA 4HCCA 3KZBA 2HHQA 4CGIA 4HUFA 5E26A 2IOCA 2QWMA 4YY3K 3V9UA 1HKBA 3HTVA 3L3UA 4HTUA 1LWCA 3A8YA 3O9QA 3AA3A 3AV9A 1FW6A 1D9FA 2ZJPL 1HNIA 4DS5A 3HSTB 1JLGA 3SAFA 4BRHA 1U2VA 2XY5A 5GIPA 1XQSC 3VEXA 1RT5A 3MCAB 1BHLA 4YORA 5C42A 2QKKA 1RTDA 2HB5A 3SYZA 1U49A 2OANA 3QO9A 3WXLA 1V4TA 4C1NI 3HOTA 5AQNA 1EP4A 2NZTA 1JLFA 4YOVA 3O8MA 3ZX2A 3VQPA 1T03A 3OYEA 4JI7K 2FBXA 2IAJA 4CJSA 5GAEP 3V9SA 4V19S 3SUNA 4GKKK 1NGDA 4CIFA 2O4GA 3VEZA 5BN9A 2RPIA 4FLUA 1VSDA 1R59O 3LPTA 1NMDA 3M1FA 3G6EN 3CCSN 1M90O 2BANA 3GDQA 2VWJA 5EX5A 5ELZA 4CEOA 1BI4A 3MX5A 5KTQA 4FWKA 5FROA 4JEPA 2QWLA 3TAQA 3QFUA 2B5JA 2P9UB 1TK0A 3KWIA 3CFRA 4KI4A 4MQ3A 3VGLA 4QOZB 4JI6K 3LP2A 4H03B 3VQBA 4X64K 4AQYK 3NDKA 3V9ZA 1XWLA 1W2BM 3CC7N 5I42A 4OO1J 4LF8K 1U48A 4A2AA 4RWTA 4CIEA 5C0YA 2QXFA 3AVGA 3G25A 2VCPA 4GY2B 1TK5A 3PX4A 3DAWA 4H4MA 2ASMA 3NF9A 3EKSA 1ZBFA 2ZD1A 5KPZA 5J2NA 4LFBK 1OKJA 1IKXA 1HYSA 1DTQA 4JI2K 3ZX3A 3AARA 3AVJA 2EX3A 3LP0A 2D1KA 5HRSA 1K9MO 3QIOA 5AQJA 1DTTA 3UKRB 3ENBA 4LF5K 2YX6A 3D7EO 4X65K 4CJ5A 3L2UA 3OW2M 1KXPA 4ELUA 3DM2A 3ZSVA 5BPNA 3K5OA 4HCBA 4JRPA 3NF7A 2D0OA 1NJWA 3AO4A 3SJHA 3VEYA 4BQLA 2QM1A 3L2VA 1RT3A 1EWQA 4YOUA 4DR5K 3VQ4A 4A59A 2EHGA 3EE9A 4N47A 3HPHA 2GTDA 3KK1A 2NRTA 3CXCM 1E3MA 1EWRA 4FJJA 1RDWX 1HYVA 5AQRA 1IBLK 1A5WA 2VG5A 1IBKK 3DLHA 3CCVN 1RILA 1VSKA 4H5VA 3SUOA 5GAGP 2OA8A 3THXB 3GOIA 3KLEA 4LF6K 4B1WB 5C2DA 3QEVA 3UB5A 4PA1A 5JVHL 3LDLA 2RF2A 4PL7A 4BR0A 1NKBA 5JS1A 4BDYA 4CW7B 1YTAA 5FPNA 5HRPA 3VGMA 1ITGA 1RT7A 4N76A 1CZBA 4DSFA 3J7AP 1VRTA 4DU3A 2IVPA 4GNIA 2O4IA 1J53A 3DXKA 4BG8A 3K2PA 2UUAK 1QSYA 1SV5A 2XY8A 2G8VA 4KTZA 4CEEA 4HHTA 3HM9A 3AVLA 4CFCA 3AAPA 3K5NA 1YT3A 4JNEA 1QVFM 2KKZA 3S3MA 2ZE2A 1KLMA 4B3TK 5HROA 3DLGA 3O9UA 4O4GA 4U67L 2UXDK 2D0BA 4RW4A 3O3HA 2XY6A 3B6PA 1OH6A 1BIUA 1C0UA 1NK5A 1A5XA 1D5AA 3RVCA 3MN9A 3ID8A 3C6TA 4IO8A 1JCEA 3F5TA 3FZMA 2CGLA 3KHYA 4JAXA 4PL8A 3CIPA 3JYTA 4DFPA 5AQLA 3MN6A 3G4SN 3TAMA 2O8BA 2ATQA 3QNNA 3T19A 3VF4A 1QVGM 2R7YA 3SV3A 1T3VA 3LDQA 4FLYA 4FZXC 2G8KA 1LAVA 4FJLA 4DS4A 1RBUA 1U6ZA 3CMAN 5AQUA 2P9LB 4B1YB 1RBRA 4BDZA 3FLCO 2VQEK 3AAQA 4DV4K 4C1NK 2NUBA 2V7YA 4M3ZA 1UA0A 4OPAA 4CF8A 4DWIA 4Z4EA 1RDAA 3JSMA 3V6DA 3E66A 3R9PA 5FPDA 1NGBA 1LV5A 3PY8A 2AA4A 3CQXA 4JKHA 4FCYA 2HHWA 3K9KA 3QICA 3ZETB 1S6PA 4WYBA 4A57A 3Q7CA 3L2WA 1TV6A 4CGHA 2ETJA 3W3DA 1KAXA 1S9GA 3EEQA 4ZTJA 3I0SA 3ZT0A 4KH6A 3DRPA 2ZJRL 4I2PA 3OYCA 5SZTA 1NK0A 2JLEA 5KRSA 3SAGA 1SL1A 4KREA 3SPZA 3OS1A 4E1MA 4DR1K 3K9JA 2YNHA 3KK3A 3WXJA 1D4XA 4KHSA 4NCAA 1BU6O 4WQ4C 2A40A 4CJRA 4IFYA 3KK7A 4QS7A 5JVGL 1XC9A 3TARA 3HVRA 4JI1K 1N6QA 4OGEA 2NLXA 2E5LK 4IDHA 3RMAA 4I2QA 4PKHA 2CH6A 4FK0A 4PHTX 4B8AB 1DLOA 4DTNA 5EXWA 4FJHA 4DSJA 4MDBA 2YKNA 4ILJA 2P9UA 4BC3A 3CFPA 3BF3A 4CBUA 5FRNA 1KFDA 4N56A 4NXMK 4FK2A 1T6DA 5B8HA 1UA1A 1NWKA 3MEGA 1KFSA 4DSEA 1KCFA 1Q82O 1J9AA 4O5BA 4DTJA 3WNGA 2FBVA 3CERA 4EIAA 1BA0A 1JLAA 5CR4A 3JXUA 5LL6Z 3OJUA 4FZZA 5AZIB 4AILC 4JI8K 4WQ4A 4K8XA 2W42A 1GOBA 1JLQA 3U9DA 4RCHA 1SKSA 1ASWA 1E4FT 3QINA 3JAMO 2NRWA 1ILYA 3ZLJA 1HRHA 3SQ0A 1WAFA 3LP1A 5LJWA 5K14A 4NB4A 3TSQA 3DXMB 3U3YA 1MDUB 4DHYA 1S72N 5BR8K 3CCLN 4FPBA 1Z26A 4KO0A 3UKRA 4YFUA 4JHDB 3SNNA 3D0PA 3SUPA 4HUEA 1I39A 2PY5A 1B9FA 1KVBA 3L3VA 4G1QA 1RBTA 3M8PA 1BL3A 1TYQB 4FJNA 4CJ3A 4CFAA 5M1PA 4OLAA 2QKBA 1Q7YO 3OVNA 2GUIA 4H5WA 5C25A 2G8FA 3FZHA 4HWIA 3DLRA 3CPEA 2FBTA 1T8EA 1J54A 3F9KA 4IZ9A 2EWSA 3ATVA 1B9DA 3PUFA 4KH4A 3THYB 4CD1A 1GLDG 1SAZA 4JKGA 3VEVA 1N34K 2HBMA 2P9IA 3EO3A 1LCUA 2E2NA 4FL9A 4M45A 3HP6A 1XI1A 3T1HK 4YDUC 4AH9A 1K6YA 4BR5A 3RR7A 4DMNA 4F2RA 1K73O 4OKEA 4CHOA 4EHTA 2E6MA 4WFBL 3FE1A 1QSSA 4CHPA 5KGWA 4DUZK 4HUGA 1QE1A 4ISFA 1GOAA 1EETA 4QAGA 4DF4A 3HSCA 5C12A 4M3TA 5JS2A 3ZSZA 1CZ9A 1Q8IA 1EQYA 2KLAA 3VA0A 3MK6A 1X3MA 5AQKA 5BRFA 3GBTA 1HJOA 3UE5A 3T3FA 5T7BA 4GMJB 1RTJA 4RG8A 3AA4A 4KI6A 4ID1A 3M8QA 4YDUA 3TSPA 4DV3K 4CEFA 4BROA 3NVKA 3VTHA 1MWKA 3OYFA 1QSLA 3RR8A 2YHBA 4X62K 3MXJA 4B3SK 2CGKA 3RTVA 1Z25A 5EVZA 4BE0A 4RW7A 4FM1A 2E1YA 5DM7L 2VWBA 3CCUN 5F2RA 2HSTA 3VN5A 4Y0WA 4BRKA 1XUPO 3QEXA 3WXIA 2KQ2A 2GEMA 3BUZB 2W6KA 3L4IA 1QS4A 3TR8A 3VQAA 3ITHA 3NF6A 2YJFA 3VF2A 4CFBA 1U04A 3HPOA 2E2QA 4CHNA 2HBKA 3DXKB 5HP1A 4KB0A 3A5LC 3LL3A 4BQZA 4BREA 3LDPA 3O6WA 1NU0A 2P1JA 4K41A 4GV3A 3FGUA 4B9NA 1BWFO 1W0HA 3ZETA 4YOWA 4JD2B 4LD0A 5DM6L 4Z94A 4JYAK 5FDLA 2WFBA 4DR4K 2QA4N 1EO1A 2QW9A 3VEWA 2P9PA 2Y1IA 4CZKA 4DTMA 2HOEA 2H3GX 1N8RO 1YITN 4DQSA 4FLWA 3R8EA 1NK4A 3U6FA 4QCLA 4MLHA 3O9SA 2Q36A 3KLIA 4FW1A 4KKOA 2ZJQL 3VGKA 3CM5A 3CJ9A 4JKDA 3VESA 3T7ZA 4DTOA 3A2FA 3V1RA 3QEWA 4FWRA 5I9EB 3SJJA 4N41A 5AJ3K 1E4GT 4FLVA 4BR4A 3V9XA 4W5QA 3QEIA 4WQ5A 3CJCA 3TSUA 3THVA 2F9TA 1HKGA 4CK2A 3OYBA 4FJXA 3I56N 4IOCL 1ZYQA 4FJMA 4JV5K 5GIOA 5D3GA 4E1NA 1UAXA 5ADXH 4OPKA 4I9LA 1RGIA 3EZWA 4FO0A 1K8KA 4IOAL 1XNRK 1W9HA 1DGKN 4H0YB 1TGOA 4O55A 4CJTA 5EU7A 1NK9A 2FXUA 3CMEN 4YOXA 1V4SA 1YI2N 3SK3A 1HNWK 5HLFA 5ADXA 3K5LA 2DFFA 4CE9A 5AZIA 3LAKA 4FWQA 4MLEA 3HM8A 1HNVA 2WTUA 4CZEA 4LH5A 4FJKA 3TAPA 4DSKA 3AVCA 5KPRA 4BRIA 1S22A 3MWTA 3I8DA 4LF9K 1JCFA 1NGFA 5AQWA 4CEAA 2DFHA 1ATSA 2JWKA 4C8MA 1X9SA 3NGIA 1BUPA 3R1XA 3EY1A 4K25A 3KKSA 2HVHA 3DXMA 3QIPA 1SZ2A 2NRZA 2DFEA 2HNDA 2IGIA 3V1OA 3I33A 4A62A 2Y1JA 2UU9K 3VQ6A 1VQMN 2DY4A 3OYLA 5TKYA 3OS0A 3HI0A 4BC2A 4IWVA 4JHDA 1QTMA 4QS9A 4E3SA 4BWJA 1VQ6N 3WUHA 1CXQA 1QHAA 1TYQA 2I7PA 1WLJA 2BTFA 3WNFA 1WUAA 1YVNA 1JLEA 4H0OA 1X3NA 1HPZA 4BVOA 2QXLA 5M1QA 4HVJA 4B3OA 4W5NA 2QWNA 4KRFA 3THYA 1IG9A 3VQ9A 3G10A 2QK9A 1MA9B 3HVTA 2YNIA 3RMBA 1KRPA 4C8KA 3PLAA 3DJCA 4FLTA 1CLQA 2ZF5O 2KFZA 1WSGA 5AQYA 3NH1A 4K8ZA 3H45C 1C0MA 5A2QO 3CD6N 5CYQA 1VSFA 2JWLA 4CEQA 4CJEA 2I5JA 4DSIA 3O1WA 2Q31A 3NHGA 4DB3A 2A41A 2DPNA 3CFOA 3KKRA 1IKWA 4KFBA 3MAQA 1HYZA 1G15A 1HMVA 4YNQA 1KC8O 1TVRA 3J81O 3H6EA 4H5TA 3AO3A 3CPWM 1W7AA 1S1TA 2FSKA 4DV2K 3L6QA 3TAFA 3CG7A 1NKCA 1NGEA 4O0IA 3V81A 3SQ1A 4W5RA 3ZT3A 4E7IA 2YI1A 4JI0K 4BE1A 4WE1A 3MECA 2V7ZA 5I3UA 3QB0A 3EKUA 3SQ2A 4FJ8A 2YHXA 5CZ2A 3H1VX 4BR9A 2GV9A 2WONA 2BGGA 4LF7K 3AVIA 1U45A 2V52B 3AY9A 3D2FB 4JKGB 3FR0A 5HOOA 2P9IB 2F8SA 5C2FA 3IMXA 4NCBA 2P9NA 1B92A 4NLCA 2GBZA 1RT4A 2Q2RA 4DSLA 4JI3K 4JKFA 3HP9A 1D9DA 4IBNA 4BRLA 4F9OA 1T6CA 1H1VA 1BDGA 3ALYA 1NOYA 5TKWA 5LMNK 4DR7K 4CJPA 2UXBK 4A2BA 4FZYA 1RDDA 4ELVA 4DUYK 4RW6A 5C15A 1KAZA 4LSNA 4WF9L 1XC3A 2WC9A 3QEPA 4DFKA 4RW8A 3TABA 2WUSA 3O08A 4IFVA 4JD2A 1WSIA 3LAMA 3TTDA 1VQ5N 3C0BA 1NK8A 2RE2A 4DV7K 3M8SA 1GLJO 4PKIA 3RSEA 4F2SA 4CZGA 3S41A 1U4BA 4EZ9A 3TU5A 3AGRA 3H46O 4H0PA 4M63C 3CETA 2QWPA 4CERA 2HMIA 4XIUA 4FWMA 3KJVA 3L2QA 4E7JA 4DTRA 2XRIA 3QDKA 4BACA 4CFDA 4IEEA 1CZAN 3MXIA 1QQNA 2HHSA 2A5XA 4CECA 4JK7A 1S1UA 2YNGA 4DQQA 5C10A 1J5EK 3CC2N 2AP1A 3ZT1A 3SMSA 2HHVA 4CJQA 4CVNE 3DRRA 1WSFA 1ASVA 4CJWA 2DTUA 1QHTA 3SCXA 3FFKB 1RTHA 3C94A 1NJIO 5BPMA 1TL1A 3WEEB 3VOVA 4FVUA 4B08A 4M7YA 1FKPA 4PWDA 5FLXO 3CCJN 1ESVA 1GLLO 1BIZA 4BC4A 4DFMA 4R5PA 1WSEA 4E89A 1VK0A 4G9ZA 1HQEA 2E4LA 3NCIA 1L3TA 2Q0RA 3CC4N 1IBMK 2GX9A 2P9PB 4RTFD 2CGJA 1U47A 1RDUA 3QLHA 5KI6A 5AQPA 1SL0A 4DV0K 3J80O 2HMPA 2X6SA 3VTIA 4E7HA 4WFNL 4ILHA 1VSJA 5JICA 4CHZA 4MFBA 1KAYA 1LWFA 3CJAA 2UUCK 1ZBHA 3VENA 3OHRA 2QWQA 2E2PA 1BCMA 4CJLA 1J5OA 4O0JA 4YOYA 4O5FA 1HLUA 3H3NO 1JCGA 2BE2A 3P83D 4CJ4A 1MWMA 4Z0UA 5J1EA 3PIPL 3H08A 4F8RA 1GLAG 4CK3A 3A5MC 1NGAA 1W97L 4DCHA 4EP4A 3NFAA 4KV8A 1L3SA 1TUYA 4ICLA 2G8IA 1TKTA 4KAZA 3BF1A 4HTLA 4EAHD 4CCHA 1A5VA 4MO4A 2VG6A 4A5AA 3THWB 1K8KB 5LY3A 3EL2A 5KQDA 1BISA 4AHRA 3QMLA 3HRGA 2HNYA 1N33K 1Z6RA 1S1XA 3O4NA 4BRQA 1L3UA 1IH7A 3DRSA 5JMVA 4FWOA 4DTUA 4NXNK 3O4QA 3BZCA 3ID6A 4FLXA 3C7NA 2QTDA 4B1ZA 4OPJA 2O8FA 3MEDA 4DLGA 1K8AO 5CYMA 4IDKA 4IG3A 4J2AA 1JL1A 3RMCA 3AVBA 2GWKA 3OYJA 5J2MA 1NKEA 1KVCA 4CGDA 4IG0A 3ENOA 3F73A 4FJ5A 4U7BA 1DKGD 2ITMA 4B9SA 4FM0A 4JI4K 3LANA 4DQRA 4PKGA 1T44A 3L2RA 3V9WA 4JRQA 3ZEUB 4OX9K 2HW3A 3LM9A 3AVAA 3CCMN 5E84A 4KHPK 4CJKA 1VQON 1G99A 2Z1JA 3AA5X 4FJ7A 1KTQA 3U3GA 5F0XA 3ULDA 2W40A 4IFEA 3WQUA 3UKUB 5AQIA 3SZ2A 1X9MA 5AQXA 1NJXA 2OPRA 1VAZA 1BOTO 3D2FA 3OJSA 4DQ8A 4H4OA 4LC9B 2X6NA 4IO9L 3NVMA 3AO5A 4DG1A 1GLCG 4H0TB 3LP3A 5EOYA 3O80A 3OTOK 4Z4FA 4AM7A 2W41A 3PX6A 2F96A 2OCEA 1C0GA 3HZ6A 3B6OA 5E41A 4XH5A 1C1AA 1TL3A 2D4WA 2YKMA 4OGCA 4BRCA 1X9WA 3S3NA 3LM2A 4FXDA 1S6QA 3PV8A 4GVMA 4ID5A 3OA9A 2KHOA 1WB9A 2ASOA 2HHHK 3ENHA 1C0FA 3S3OA 3FZLA 1HNXK 1P8ZA 1ZXOA 3I8BA 2IVNA 4LF4K 2HNZA 2UUBK 5CY4A 2P9SA 3OY9A 4CBXA 4DTXA 3MN5A 5AQVA 4JS4A 5M1NA 4Q5VA 2VGMA 3O9TA 4IJAA 3CM6A 1N36K 4FJGA 4I6MB 2WBNA 4CGJA 1R0AA 1LWEA 3ASMA 1GLFO 3IKMA 1VSIA 1IKYA 5AZJA 3DWLA 4B8CA 5KPTA 4B3RK 2O8EA 4CI6A 3HBTA 4E7KA 4C8LA 3PSFA 1RDCA 3ZX0A 1NGIA 4NYFA 4CZMA 2P5OA 1NNEA 4B3MK 3NBPA 2P9KB 3AGKA 2GUPA 4E1JA 3QERA 2G8WA 4MO5A 1NMNA 2P9NB 4ZHRA 5FPMA 1VRUA 2IS3A 3H1QA 4CJFA 1SKRA 4A61A 3ATUA 1HNZK 4I9QA 3VQ5A 2PAVA 1WN7A 1VQ4N 1BA1A 3AVKA 3P1GA 3SPYA 1FXXA 3HJFA 5BREA 1Y64A 3DLEA 3OYIA 1ZBIA 4F4KA 4FWNA 4DTSA 5BRDA 1NJYA 3WXMB 3EZ5A 1YJWN 4L8RB 2O8DB 5H1SQ 4CF9A 5AQQA 3GL1A 1NGGA 4M3YA 3KLHA 1NBWA 1TKXA 1TK8A 4E0DA 3O1BA 3EN9A 3WEEA 2PYLA 2D0PA 3VF6A 4AHSA 1Q18A 4Y1DA 4CZJA 1VQLN 4RW9A 4WFAL 2A1SA 5IWAK 3CF5L 1YIJN 2ZQBA 4M41A 4M3XA 1IKVA 2OTJN 1YJNN 3VQEA 4FJIA 3RSEB 5CZ1A 4XH4A 3EYZA 4B1VA 3PSIA 4K42A 1X9JA 4DLEA 2HHTA 3Q7BA 2V51B 3CJ1A 3I55N 4BRDA 3F2KA 2RHKA 1HUXA 1VSLA 3NF8A 4CEBA 4CHYA 4LH4A 1QZ5A 5GADP 3NH2A 1RT2A 4ISGA 1IG8A 4M3RA 3MDQA 1YF5L 3OYAA 1I94K 3IDHA 3PIOL 4OJRA 3ULEB 3K5MA 4M7XA 3VQCA 1JXBA 5F1XA 4DTPA 1YVUA 5AQSA 3MWPA 2FF6A 4GKJK 1T05A 1EX4A 5FPEA 1FJGK 4GVEA 1JJ2M 3TTFA 5M1OA 4KHWA 4LY7A 3OS2A 3T69A 3U4LA 3JS6A 2VGNA 3THWA 3LWLA 4Y1CA 1YAGA 4CGFA 2Q1NA 1BG3A 4CJ7A 3LDOA 4FVMA 3VQQA 2D0AA 1RNHA 3HO1A 3AVNA 2A1RA 4BGAA 3ZSRA 4J8FA 2IC3A 4W5OA 3R6MA 1YUWA 4BGBA 5HL7L 5MLCQ 3LDSA 2Z1HA 3K0SA 1I3AA 4FJ9A 3UIQA 1Y97A 4DV6K 3BDPA 1BO5O 1ATRA 4DR6K 1QQCA 3O3FA 4BRGA 3SV4A 4B9LA 3M3ZA 2OZMA 4O44A 4IKFA 1N5YA 2O8CB 3KVGA 5AQFA 1Q81O 3D2EB 5HRRA 3C65A 3U8XA 2E1ZA 4NCGA 3AO2A 4UQGA 3B8AX 3ISNC 3MX2A 3C6HA 3TI0A 3ZEUA 3OBYA 1RT6A 2YHYA 1O13A 3HPGA 4M3UA 3TPQA 3WQTA 1L3VA 1OVQA 4JI5K 4CIGA 3C6UA 2LSNA 2VWKA 3UKUA 4M42A 3ZSOA 5JLHA 3F9MA 3AA2A 1C0TA 3BEXA 3SQ4A 2KZZA 1VQPN 4FLZA 4E7LA 3DLKA 1XMOK 2HHUA 3SMPA 4CZHA
chains in the Genus database with same CATH topology
4Z4HA 4YFUA 4KHQA 3K58A 2OPQA 3SNNA 3D0PA 3MXIA 4J2DA 4NYNA 2XO7A 4HUEA 3SUPA 1I39A 4CECA 2PY5A 2HHSA 1B9FA 3VQ7A 2G8HA 1KVBA 3L3VA 4G1QA 1RBTA 1S1UA 2YNGA 3M8PA 4DQQA 4OLBA 4CHZA 1BL3A 3IS9A 2Z1GA 4FJNA 2FBYA 2X78A 3ZT1A 4CJ3A 4CFAA 1ASUA 4OLAA 4E19A 2QKBA 2HVIA 2HHVA 3OVNA 2GUIA 4CJQA 3DRRA 1WSFA 5C25A 1ASVA 3E01A 2E6LA 1QHTA 4CJWA 3CYMA 1VSMA 2B4JA 2Z1IA 3SCXA 3LWMA 2G8FA 3DLRA 3HL8A 2FBTA 1RTHA 5KGXA 1J54A 3C94A 3F9KA 4LSLA 1T8EA 3S9HA 1B9DA 3PUFA 2YHAA 1TL1A 4CGGA 1T7PA 3PO4A 3G0ZA 4B08A 2KFNA 1FKPA 1NJZA 1BQNA 4PWDA 3T1AA 4OKJA 1XHZA 1BIZA 4M45A 3DOLA 3HP6A 4DFMA 4TSXA 1XI1A 1REVA 2WOMA 3DYAA 4R5PA 4B9VA 1WSEA 1NK7A 4DFJA 4KTWA 4E89A 1VK0A 4DU1A 4AH9A 1HQEA 1K6YA 2E4LA 3WNEA 4EP5A 3NCIA 3OYDA 1SL2A 1L3TA 3RR7A 3PO5A 4Q0BA 4DMNA 4FYDA 1LW2A 3ZSYA 4HCCA 2HHQA 4F2RA 4CGIA 4HUFA 1U47A 3QLHA 2IOCA 5KI6A 2OPPA 3NGZA 3KD1E 1SL0A 2Q3SA 3V9UA 3PX0A 3L3UA 1S5JA 4HTUA 1LWCA 2X6SA 4OKEA 4E7HA 4AHTA 4CHOA 2E6MA 3CQ8A 1VSJA 2JGUA 3AA3A 3AV9A 1QSSA 1D9FA 3ZSQA 1SUQA 4MFBA 1CXUA 1HNIA 3HSTB 1LWFA 5KGWA 4CF1A 1JLGA 4CHPA 4HUGA 1QE1A 1LW0A 3RMDA 1TAUA 3ZCMA 1ZBHA 1D8YA 1GOAA 2XY5A 1WNSA 1EETA 4QAGA 5J2PA 1BCMA 4DF4A 4CJLA 3KTQA 4M3TA 5JS2A 1J5OA 1RT5A 1CZ9A 2VG7A 4O0JA 3ZSZA 2ITGA 1Q8IA 5SWMA 2OYQA 1BHLA 5C42A 2QKKA 3VA0A 1Q9XA 2BE2A 1RTDA 2HB5A 3P83D 4CJ4A 1UWBA 3SYZA 4Z0UA 1U49A 5J1EA 4J2EA 2DTUA 3H08A 3QO9A 3T3FA 5T7BA 4F8RA 4GMJB 1RTJA 2RKIA 4RG8A 4CK3A 3AA4A 4DQPA 4KI6A 4ID1A 1EP4A 1RTIA 5DK5A 4EP4A 3M8QA 3NFAA 1JLFA 4KV8A 1L3SA 1WSJA 4ICLA 2G8IA 4CEFA 1TKTA 3VQPA 1WAJA 3OYEA 1T03A 2FBXA 4KAZA 1JL2A 4CCHA 1A5VA 2VG6A 2IAJA 3LPUA 4CJSA 3V9SA 3SUNA 4OVLA 4CIFA 2O4GA 3OYFA 3K59A 1BISA 4AHRA 1QSLA 3OYGA 2HNYA 2RPIA 3D45A 3RR8A 2YHBA 4FLUA 3MXJA 1EKEA 1S1XA 3O4NA 3RTVA 1Z25A 3QESA 1VSDA 3LPTA 3IG1A 1L3UA 2BANA 4BE0A 2VWJA 1BQMA 1IH7A 3DRSA 4RW7A 4FM1A 4DTUA 3SI6A 3O4QA 4CEOA 4FLXA 1UOCA 1BI4A 3TAGA 4OPJA 4BWMA 3WNHA 3MEDA 4DLGA 3VN5A 5KTQA 2HVHA 5CYMA 3QEXA 4IDKA 4IG3A 4J2AA 2KQ2A 1JL1A 3HYFA 3FFIA 3RMCA 3AVBA 3OYJA 1QS4A 3TR8A 5J2MA 4DQIA 1NKEA 3VQAA 1HQUA 3ITHA 3NF6A 1KVCA 5FROA 4CGDA 4IG0A 1U04A 4CFBA 3F73A 3HPOA 4FJ5A 4CHNA 3TAQA 4B9SA 5HP1A 2B5JA 3QETA 4FM0A 1TK0A 4KB0A 3CFRA 4KI4A 4MQ3A 4FK4A 3LANA 4DQRA 4QOZB 3LP2A 3VQBA 3NDKA 2P1JA 1XWLA 3V9ZA 4B9NA 3L2RA 3V9WA 4JRQA 4PUOA 5I42A 1W0HA 2HW3A 3AVAA 4LD0A 3RRHA 4F3OA 1U48A 1TKDA 4ZTFA 2FC0A 4CEDA 5J2QA 4CJKA 2Z1JA 3MEEA 3AA5X 4FJ7A 1KTQA 3U3GA 4CIEA 5FDLA 3ULDA 2QXFA 3AVGA 1C1CA 5FRMA 3SZ2A 1TK5A 4AHVA 4JLHA 2Y1IA 4DTMA 4H4MA 3PX4A 3NGYA 3NF9A 1ZBFA 1X9MA 2ZD1A 1NJXA 5J2NA 1LAWA 1IKXA 2OPRA 1HYSA 3OJSA 1DTQA 3ZT2A 4H4OA 4DQSA 4FLWA 2IDOA 2X6NA 3AVJA 3NH0A 3U6FA 1NK4A 4QCLA 4JS5A 3KLIA 3AO5A 4FW1A 4KKOA 4KHNA 2EX3A 3CM5A 3LP0A 4B9MA 4DG1A 3AVFA 3LP3A 4DTOA 4Z4FA 3DOKA 3PX6A 3A2FA 2F96A 5HRSA 3V1RA 2BDPA 3B6OA 3QIOA 1BCOA 1DTTA 1FKOA 4AHCA 5E41A 3QEWA 4J2BA 1C1AA 1TL3A 3KLGA 3SJJA 4CJ5A 4N41A 2YKMA 4OGCA 4FLVA 4C8NA 3L2UA 1X9WA 3S3NA 3VQDA 4ELUA 3V9XA 1S6QA 3DM2A 4W5QA 3QEIA 4GVMA 3ZSVA 3K5OA 3PV8A 1SKWA 4ID5A 4FW2A 4JRPA 3NF7A 2G8UA 3IAYA 4Z4CA 3RRGA 4CHQA 1NJWA 3AO4A 3THVA 4ELTA 3S3OA 1BGXT 1F21A 1YTUA 4Z4GA 4CK2A 3L2VA 1RT3A 3OYBA 3VQ4A 4FJXA 4DU4A 1ZYQA 4FJMA 1TAQA 2EHGA 4N47A 1O1WA 1NK6A 2HNZA 3HPHA 3KK1A 3HXMA 4E1NA 5D3GA 5CY4A 3OY9A 4PQUA 1UAXA 4DTXA 4OPKA 4I9LA 4FJJA 4JS4A 1HYVA 4Q5VA 1A5WA 2VG5A 4HCBA 1W9HA 2PYJA 4FM2A 1TGOA 3DLHA 3CM6A 4O55A 3HT3A 2OPSA 4FJGA 4CJTA 5EU7A 1NK9A 4CGJA 1RILA 1R0AA 1LWEA 3ASMA 1VSKA 4W5TA 3SUOA 2OA8A 1VSIA 5HLFA 1IKYA 3K5LA 3KLEA 2DFFA 4B8CA 4CE9A 1S9EA 3QEVA 4PA1A 3LAKA 5HRNA 2RF2A 1NKBA 1HNVA 4E7KA 4C8LA 5JS1A 4FXDA 4LH5A 1RDCA 4FJKA 3TAPA 3IRXA 5C24A 4BDYA 3AVCA 3C95A 4DSKA 1WSHA 5HRPA 1YTAA 1JLBA 3I8DA 4NYFA 2P5OA 4DF8A 3NBPA 4CEAA 1FK9A 1ITGA 1RT7A 2DFHA 4N76A 1CZBA 3QERA 4C8MA 2G8WA 1X9SA 3NGIA 3L8BA 4DSFA 3EY1A 1Q9YA 3SUQA 1VRTA 3KKSA 3OYMA 4ZHRA 3BGRA 4DU3A 1VRUA 2IS3A 4CJFA 2PZSA 3RWUA 3QIPA 1J53A 1SKRA 4I9QA 2O4IA 3K2PA 3VQ5A 2DFEA 2HNDA 2IGIA 3V1OA 3OYNA 2Y1JA 3NE6A 2KZMA 1QSYA 1WN7A 1SV5A 3NAEA 3VQ6A 2XY8A 2G8VA 4KTZA 3TANA 4CEEA 3OYLA 4HHTA 2DY4A 3OS0A 3AVLA 4CFCA 3HM9A 3K5NA 1X1PA 2KW4A 3AVKA 3P1GA 2B6AA 4DS5A 3SPYA 1FXXA 1YT3A 1QTMA 3HJFA 3DLEA 3OYIA 4E3SA 4BWJA 1ZBIA 4F4KA 1NOZA 4DTSA 2ZE2A 1CXQA 1NJYA 3O3GA 1WLJA 1KLMA 1RBVA 3EZ5A 3WNFA 5HROA 3DLGA 4L8RB 1TKZA 4CF9A 3VQ8A 4O4GA 1JLEA 2D0BA 4RW4A 3O3HA 1S1WA 2XY6A 2D0CA 3B6PA 4M3YA 2HHXA 3KLHA 1BIUA 1HPZA 1C0UA 1TKXA 1NK5A 2RN2A 1A5XA 1D5AA 1TK8A 4E0DA 4HVJA 4B3OA 4W5NA 4OKKA 4KRFA 4EZ6A 4CF0A 3G10A 3C6TA 3VQ9A 1IG9A 2PYLA 4AHSA 2QK9A 3AVHA 3HVTA 3KLFA 3JYTA 4DFPA 2F8TA 2YNIA 4CK1A 3RMBA 1KRPA 4Y1DA 4C8KA 4RW9A 3TAMA 4FLTA 1CLQA 2A1SA 1VSHA 2ATQA 3QNNA 3T19A 2KFZA 1WSGA 2R7YA 3SV3A 3NH1A 4FLYA 2ZQBA 4M41A 1RBSA 4FZXC 3KD5E 4K8ZA 2G8KA 1C0MA 1LAVA 4FJLA 1IKVA 4DS4A 4M3XA 1RBUA 3QNOA 5CYQA 1VSFA 2YV0X 4CEQA 4CJEA 2I5JA 3VQEA 4DSIA 4FJIA 3NHGA 1BI4B 5CZ1A 2D5RA 5HBMA 1XHXA 4I7FA 3DMJA 2OZSA 3EYZA 4Z4IA 4KHYA 1RBRA 3CFOA 1MU2A 1IKWA 3KKRA 3ZT4A 4BDZA 4KFBA 3MAQA 1HYZA 4DLEA 2HHTA 1G15A 1HMVA 4YNQA 2NUBA 3AO1A 3TWHA 4M3ZA 1UA0A 3OYHA 1KLNA 1VSLA 1TVRA 3NF8A 4CEBA 4CF8A 4CHYA 4DWIA 4Z4EA 1RDAA 4LH4A 3JSMA 4PY5A 3AVMA 4B9UA 3NH2A 3AO3A 3VA3A 1C1BA 2XHBA 3V6DA 3LALA 1RT2A 4M3RA 1S1TA 2KTQA 1LV5A 3V1QA 3OYAA 3PY8A 3TAFA 3CG7A 1NKCA 4OJRA 3HK2A 4F3TA 4O0IA 4FCYA 2HHWA 3L2WA 3V81A 1S6PA 3K5MA 5KRTA 3SQ1A 1TV6A 4W5RA 3ZT3A 4E7IA 4CGHA 2ETJA 1JXBA 3VQCA 4BE1A 1S9GA 1YVUA 4CF2A 4DTPA 1KSPA 4WE1A 1S1VA 4ZTJA 3MECA 1T05A 3KIOA 1EX4A 5I3UA 3I0SA 1JXEA 3ZT0A 3SQ2A 4FJ8A 4KHUA 3DRPA 3OYKA 5CZ2A 4KHWA 2GV9A 4LY7A 3OS2A 2WONA 3TAEA 2BGGA 4I2PA 3OYCA 5SZTA 1NK0A 3AVIA 2JLEA 5KRSA 1U45A 1RDBA 3LWLA 1SL1A 4Y1CA 4KREA 3SPZA 1EXQA 1KVAA 1VSEA 3OS1A 2AJQA 2F8SA 4CGFA 4E1MA 3DLBA 2YNHA 3KK3A 4NCBA 4FVMA 4KHSA 4NCAA 1B92A 3DI6A 3VQQA 2GBZA 1HJRA 2D0AA 1RT4A 4CJRA 4DSLA 4IFYA 1RNHA 2P5GA 3HO1A 1RT1A 3AVNA 2A1RA 1XC9A 1IO2A 3HP9A 3TARA 3ZSRA 3HVRA 1D9DA 1C6VA 1N6QA 3M8RA 2IC3A 4OGEA 4W5OA 1ZBUA 4IBNA 3RMAA 4I2QA 4BE2A 4BDPA 3LDSA 4FK0A 2Z1HA 4M3WA 1I3AA 4FJ9A 4B8AB 3UIQA 1Y97A 4H8KA 3ZSXA 1DLOA 3ALYA 3LZJA 4DTNA 1NOYA 3BDPA 4FJHA 4CJPA 4DSJA 4FZYA 1RDDA 4ELVA 1QQCA 3O3FA 4RW6A 3SV4A 2YKNA 4B9LA 4KPYA 2OZMA 4AHUA 3CFPA 4O44A 4GW6A 4IKFA 4LSNA 1N5YA 5FRNA 3V4IA 1KFDA 4CJUA 5HRRA 4N56A 4FK2A 4NCGA 1L5UA 3AO2A 5DMRA 4UQGA 3ISNC 4DFKA 3QEPA 4RW8A 1ZBLA 4KTQA 1UA1A 3TI0A 3TABA 3MEGA 1RT6A 1KFSA 2P51A 4IFVA 4DSEA 1KCFA 1RCHA 1WSIA 3HPGA 3LAMA 1J9AA 4M3UA 1L3VA 4O5BA 3LZIA 4DTJA 1JLCA 3WNGA 2FBVA 3ZSWA 1NK8A 1JLAA 2X74A 3OJUA 3K57A 4FZZA 4CIGA 4AILC 1JKHA 3C6UA 2LSNA 2VWKA 4B9TA 3M8SA 4K8XA 2W42A 1GOBA 4KB1A 4M42A 3ZSOA 1JLQA 1SKSA 4F2SA 3AA2A 1ASWA 3I0RA 1C0TA 3MXMA 1U4BA 3QINA 4EZ9A 3P5JA 3SQ4A 1HRHA 2YNFA 2XY7A 3SQ0A 1WAFA 2KZZA 4FLZA 3LP1A 4CERA 4CESA 4E7LA 5K14A 2HMIA 4CEZA 4XIUA 3KJVA 3L2QA 3DLKA 3KK2A 4E7JA 4DTRA 4CJVA 3U3YA 2XRIA 4C8OA 4N5SA 4BACA 4CFDA 2HHUA 1Z26A 3S3MA 4KO0A 1GOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z4H A;  4YFU A;  4KHQ A;  3K58 A;  2OPQ A;  3SNN A;  3D0P A;  3MXI A;  4J2D A;  4NYN A;  2XO7 A;  4HUE A;  3SUP A;  1I39 A;  4CEC A;  2PY5 A;  2HHS A;  1B9F A;  3VQ7 A;  2G8H A;  1KVB A;  3L3V A;  4G1Q A;  1RBT A;  1S1U A;  2YNG A;  3M8P A;  4DQQ A;  4OLB A;  4CHZ A;  1BL3 A;  3IS9 A;  2Z1G A;  4FJN A;  2FBY A;  2X78 A;  3ZT1 A;  4CJ3 A;  4CFA A;  1ASU A;  4OLA A;  4E19 A;  2QKB A;  2HVI A;  2HHV A;  3OVN A;  2GUI A;  4CJQ A;  3DRR A;  1WSF A;  5C25 A;  1ASV A;  3E01 A;  2E6L A;  1QHT A;  4CJW A;  3CYM A;  1VSM A;  2B4J A;  2Z1I A;  3SCX A;  3LWM A;  2G8F A;  3DLR A;  3HL8 A;  2FBT A;  1RTH A;  5KGX A;  1J54 A;  3C94 A;  3F9K A;  4LSL A;  1T8E A;  3S9H A;  1B9D A;  3PUF A;  2YHA A;  1TL1 A;  4CGG A;  1T7P A;  3PO4 A;  3G0Z A;  4B08 A;  2KFN A;  1FKP A;  1NJZ A;  1BQN A;  4PWD A;  3T1A A;  4OKJ A;  1XHZ A;  1BIZ A;  4M45 A;  3DOL A;  3HP6 A;  4DFM A;  4TSX A;  1XI1 A;  1REV A;  2WOM A;  3DYA A;  4R5P A;  4B9V A;  1WSE A;  1NK7 A;  4DFJ A;  4KTW A;  4E89 A;  1VK0 A;  4DU1 A;  4AH9 A;  1HQE A;  1K6Y A;  2E4L A;  3WNE A;  4EP5 A;  3NCI A;  3OYD A;  1SL2 A;  1L3T A;  3RR7 A;  3PO5 A;  4Q0B A;  4DMN A;  4FYD A;  1LW2 A;  3ZSY A;  4HCC A;  2HHQ A;  4F2R A;  4CGI A;  4HUF A;  1U47 A;  3QLH A;  2IOC A;  5KI6 A;  2OPP A;  3NGZ A;  3KD1 E;  1SL0 A;  2Q3S A;  3V9U A;  3PX0 A;  3L3U A;  1S5J A;  4HTU A;  1LWC A;  2X6S A;  4OKE A;  4E7H A;  4AHT A;  4CHO A;  2E6M A;  3CQ8 A;  1VSJ A;  2JGU A;  3AA3 A;  3AV9 A;  1QSS A;  1D9F A;  3ZSQ A;  1SUQ A;  4MFB A;  1CXU A;  1HNI A;  3HST B;  1LWF A;  5KGW A;  4CF1 A;  1JLG A;  4CHP A;  4HUG A;  1QE1 A;  1LW0 A;  3RMD A;  1TAU A;  3ZCM A;  1ZBH A;  1D8Y A;  1GOA A;  2XY5 A;  1WNS A;  1EET A;  4QAG A;  5J2P A;  1BCM A;  4DF4 A;  4CJL A;  3KTQ A;  4M3T A;  5JS2 A;  1J5O A;  1RT5 A;  1CZ9 A;  2VG7 A;  4O0J A;  3ZSZ A;  2ITG A;  1Q8I A;  5SWM A;  2OYQ A;  1BHL A;  5C42 A;  2QKK A;  3VA0 A;  1Q9X A;  2BE2 A;  1RTD A;  2HB5 A;  3P83 D;  4CJ4 A;  1UWB A;  3SYZ A;  4Z0U A;  1U49 A;  5J1E A;  4J2E A;  2DTU A;  3H08 A;  3QO9 A;  3T3F A;  5T7B A;  4F8R A;  4GMJ B;  1RTJ A;  2RKI A;  4RG8 A;  4CK3 A;  3AA4 A;  4DQP A;  4KI6 A;  4ID1 A;  1EP4 A;  1RTI A;  5DK5 A;  4EP4 A;  3M8Q A;  3NFA A;  1JLF A;  4KV8 A;  1L3S A;  1WSJ A;  4ICL A;  2G8I A;  4CEF A;  1TKT A;  3VQP A;  1WAJ A;  3OYE A;  1T03 A;  2FBX A;  4KAZ A;  1JL2 A;  4CCH A;  1A5V A;  2VG6 A;  2IAJ A;  3LPU A;  4CJS A;  3V9S A;  3SUN A;  4OVL A;  4CIF A;  2O4G A;  3OYF A;  3K59 A;  1BIS A;  4AHR A;  1QSL A;  3OYG A;  2HNY A;  2RPI A;  3D45 A;  3RR8 A;  2YHB A;  4FLU A;  3MXJ A;  1EKE A;  1S1X A;  3O4N A;  3RTV A;  1Z25 A;  3QES A;  1VSD A;  3LPT A;  3IG1 A;  1L3U A;  2BAN A;  4BE0 A;  2VWJ A;  1BQM A;  1IH7 A;  3DRS A;  4RW7 A;  4FM1 A;  4DTU A;  3SI6 A;  3O4Q A;  4CEO A;  4FLX A;  1UOC A;  1BI4 A;  3TAG A;  4OPJ A;  4BWM A;  3WNH A;  3MED A;  4DLG A;  3VN5 A;  5KTQ A;  2HVH A;  5CYM A;  3QEX A;  4IDK A;  4IG3 A;  4J2A A;  2KQ2 A;  1JL1 A;  3HYF A;  3FFI A;  3RMC A;  3AVB A;  3OYJ A;  1QS4 A;  3TR8 A;  5J2M A;  4DQI A;  1NKE A;  3VQA A;  1HQU A;  3ITH A;  3NF6 A;  1KVC A;  5FRO A;  4CGD A;  4IG0 A;  1U04 A;  4CFB A;  3F73 A;  3HPO A;  4FJ5 A;  4CHN A;  3TAQ A;  4B9S A;  5HP1 A;  2B5J A;  3QET A;  4FM0 A;  1TK0 A;  4KB0 A;  3CFR A;  4KI4 A;  4MQ3 A;  4FK4 A;  3LAN A;  4DQR A;  4QOZ B;  3LP2 A;  3VQB A;  3NDK A;  2P1J A;  1XWL A;  3V9Z A;  4B9N A;  3L2R A;  3V9W A;  4JRQ A;  4PUO A;  5I42 A;  1W0H A;  2HW3 A;  3AVA A;  4LD0 A;  3RRH A;  4F3O A;  1U48 A;  1TKD A;  4ZTF A;  2FC0 A;  4CED A;  5J2Q A;  4CJK A;  2Z1J A;  3MEE A;  3AA5 X;  4FJ7 A;  1KTQ A;  3U3G A;  4CIE A;  5FDL A;  3ULD A;  2QXF A;  3AVG A;  1C1C A;  5FRM A;  3SZ2 A;  1TK5 A;  4AHV A;  4JLH A;  2Y1I A;  4DTM A;  4H4M A;  3PX4 A;  3NGY A;  3NF9 A;  1ZBF A;  1X9M A;  2ZD1 A;  1NJX A;  5J2N A;  1LAW A;  1IKX A;  2OPR A;  1HYS A;  3OJS A;  1DTQ A;  3ZT2 A;  4H4O A;  4DQS A;  4FLW A;  2IDO A;  2X6N A;  3AVJ A;  3NH0 A;  3U6F A;  1NK4 A;  4QCL A;  4JS5 A;  3KLI A;  3AO5 A;  4FW1 A;  4KKO A;  4KHN A;  2EX3 A;  3CM5 A;  3LP0 A;  4B9M A;  4DG1 A;  3AVF A;  3LP3 A;  4DTO A;  4Z4F A;  3DOK A;  3PX6 A;  3A2F A;  2F96 A;  5HRS A;  3V1R A;  2BDP A;  3B6O A;  3QIO A;  1BCO A;  1DTT A;  1FKO A;  4AHC A;  5E41 A;  3QEW A;  4J2B A;  1C1A A;  1TL3 A;  3KLG A;  3SJJ A;  4CJ5 A;  4N41 A;  2YKM A;  4OGC A;  4FLV A;  4C8N A;  3L2U A;  1X9W A;  3S3N A;  3VQD A;  4ELU A;  3V9X A;  1S6Q A;  3DM2 A;  4W5Q A;  3QEI A;  4GVM A;  3ZSV A;  3K5O A;  3PV8 A;  1SKW A;  4ID5 A;  4FW2 A;  4JRP A;  3NF7 A;  2G8U A;  3IAY A;  4Z4C A;  3RRG A;  4CHQ A;  1NJW A;  3AO4 A;  3THV A;  4ELT A;  3S3O A;  1BGX T;  1F21 A;  1YTU A;  4Z4G A;  4CK2 A;  3L2V A;  1RT3 A;  3OYB A;  3VQ4 A;  4FJX A;  4DU4 A;  1ZYQ A;  4FJM A;  1TAQ A;  2EHG A;  4N47 A;  1O1W A;  1NK6 A;  2HNZ A;  3HPH A;  3KK1 A;  3HXM A;  4E1N A;  5D3G A;  5CY4 A;  3OY9 A;  4PQU A;  1UAX A;  4DTX A;  4OPK A;  4I9L A;  4FJJ A;  4JS4 A;  1HYV A;  4Q5V A;  1A5W A;  2VG5 A;  4HCB A;  1W9H A;  2PYJ A;  4FM2 A;  1TGO A;  3DLH A;  3CM6 A;  4O55 A;  3HT3 A;  2OPS A;  4FJG A;  4CJT A;  5EU7 A;  1NK9 A;  4CGJ A;  1RIL A;  1R0A A;  1LWE A;  3ASM A;  1VSK A;  4W5T A;  3SUO A;  2OA8 A;  1VSI A;  5HLF A;  1IKY A;  3K5L A;  3KLE A;  2DFF A;  4B8C A;  4CE9 A;  1S9E A;  3QEV A;  4PA1 A;  3LAK A;  5HRN A;  2RF2 A;  1NKB A;  1HNV A;  4E7K A;  4C8L A;  5JS1 A;  4FXD A;  4LH5 A;  1RDC A;  4FJK A;  3TAP A;  3IRX A;  5C24 A;  4BDY A;  3AVC A;  3C95 A;  4DSK A;  1WSH A;  5HRP A;  1YTA A;  1JLB A;  3I8D A;  4NYF A;  2P5O A;  4DF8 A;  3NBP A;  4CEA A;  1FK9 A;  1ITG A;  1RT7 A;  2DFH A;  4N76 A;  1CZB A;  3QER A;  4C8M A;  2G8W A;  1X9S A;  3NGI A;  3L8B A;  4DSF A;  3EY1 A;  1Q9Y A;  3SUQ A;  1VRT A;  3KKS A;  3OYM A;  4ZHR A;  3BGR A;  4DU3 A;  1VRU A;  2IS3 A;  4CJF A;  2PZS A;  3RWU A;  3QIP A;  1J53 A;  1SKR A;  4I9Q A;  2O4I A;  3K2P A;  3VQ5 A;  2DFE A;  2HND A;  2IGI A;  3V1O A;  3OYN A;  2Y1J A;  3NE6 A;  2KZM A;  1QSY A;  1WN7 A;  1SV5 A;  3NAE A;  3VQ6 A;  2XY8 A;  2G8V A;  4KTZ A;  3TAN A;  4CEE A;  3OYL A;  4HHT A;  2DY4 A;  3OS0 A;  3AVL A;  4CFC A;  3HM9 A;  3K5N A;  1X1P A;  2KW4 A;  3AVK A;  3P1G A;  2B6A A;  4DS5 A;  3SPY A;  1FXX A;  1YT3 A;  1QTM A;  3HJF A;  3DLE A;  3OYI A;  4E3S A;  4BWJ A;  1ZBI A;  4F4K A;  1NOZ A;  4DTS A;  2ZE2 A;  1CXQ A;  1NJY A;  3O3G A;  1WLJ A;  1KLM A;  1RBV A;  3EZ5 A;  3WNF A;  5HRO A;  3DLG A;  4L8R B;  1TKZ A;  4CF9 A;  3VQ8 A;  4O4G A;  1JLE A;  2D0B A;  4RW4 A;  3O3H A;  1S1W A;  2XY6 A;  2D0C A;  3B6P A;  4M3Y A;  2HHX A;  3KLH A;  1BIU A;  1HPZ A;  1C0U A;  1TKX A;  1NK5 A;  2RN2 A;  1A5X A;  1D5A A;  1TK8 A;  4E0D A;  4HVJ A;  4B3O A;  4W5N A;  4OKK A;  4KRF A;  4EZ6 A;  4CF0 A;  3G10 A;  3C6T A;  3VQ9 A;  1IG9 A;  2PYL A;  4AHS A;  2QK9 A;  3AVH A;  3HVT A;  3KLF A;  3JYT A;  4DFP A;  2F8T A;  2YNI A;  4CK1 A;  3RMB A;  1KRP A;  4Y1D A;  4C8K A;  4RW9 A;  3TAM A;  4FLT A;  1CLQ A;  2A1S A;  1VSH A;  2ATQ A;  3QNN A;  3T19 A;  2KFZ A;  1WSG A;  2R7Y A;  3SV3 A;  3NH1 A;  4FLY A;  2ZQB A;  4M41 A;  1RBS A;  4FZX C;  3KD5 E;  4K8Z A;  2G8K A;  1C0M A;  1LAV A;  4FJL A;  1IKV A;  4DS4 A;  4M3X A;  1RBU A;  3QNO A;  5CYQ A;  1VSF A;  2YV0 X;  4CEQ A;  4CJE A;  2I5J A;  3VQE A;  4DSI A;  4FJI A;  3NHG A;  1BI4 B;  5CZ1 A;  2D5R A;  5HBM A;  1XHX A;  4I7F A;  3DMJ A;  2OZS A;  3EYZ A;  4Z4I A;  4KHY A;  1RBR A;  3CFO A;  1MU2 A;  1IKW A;  3KKR A;  3ZT4 A;  4BDZ A;  4KFB A;  3MAQ A;  1HYZ A;  4DLE A;  2HHT A;  1G15 A;  1HMV A;  4YNQ A;  2NUB A;  3AO1 A;  3TWH A;  4M3Z A;  1UA0 A;  3OYH A;  1KLN A;  1VSL A;  1TVR A;  3NF8 A;  4CEB A;  4CF8 A;  4CHY A;  4DWI A;  4Z4E A;  1RDA A;  4LH4 A;  3JSM A;  4PY5 A;  3AVM A;  4B9U A;  3NH2 A;  3AO3 A;  3VA3 A;  1C1B A;  2XHB A;  3V6D A;  3LAL A;  1RT2 A;  4M3R A;  1S1T A;  2KTQ A;  1LV5 A;  3V1Q A;  3OYA A;  3PY8 A;  3TAF A;  3CG7 A;  1NKC A;  4OJR A;  3HK2 A;  4F3T A;  4O0I A;  4FCY A;  2HHW A;  3L2W A;  3V81 A;  1S6P A;  3K5M A;  5KRT A;  3SQ1 A;  1TV6 A;  4W5R A;  3ZT3 A;  4E7I A;  4CGH A;  2ETJ A;  1JXB A;  3VQC A;  4BE1 A;  1S9G A;  1YVU A;  4CF2 A;  4DTP A;  1KSP A;  4WE1 A;  1S1V A;  4ZTJ A;  3MEC A;  1T05 A;  3KIO A;  1EX4 A;  5I3U A;  3I0S A;  1JXE A;  3ZT0 A;  3SQ2 A;  4FJ8 A;  4KHU A;  3DRP A;  3OYK A;  5CZ2 A;  4KHW A;  2GV9 A;  4LY7 A;  3OS2 A;  2WON A;  3TAE A;  2BGG A;  4I2P A;  3OYC A;  5SZT A;  1NK0 A;  3AVI A;  2JLE A;  5KRS A;  1U45 A;  1RDB A;  3LWL A;  1SL1 A;  4Y1C A;  4KRE A;  3SPZ A;  1EXQ A;  1KVA A;  1VSE A;  3OS1 A;  2AJQ A;  2F8S A;  4CGF A;  4E1M A;  3DLB A;  2YNH A;  3KK3 A;  4NCB A;  4FVM A;  4KHS A;  4NCA A;  1B92 A;  3DI6 A;  3VQQ A;  2GBZ A;  1HJR A;  2D0A A;  1RT4 A;  4CJR A;  4DSL A;  4IFY A;  1RNH A;  2P5G A;  3HO1 A;  1RT1 A;  3AVN A;  2A1R A;  1XC9 A;  1IO2 A;  3HP9 A;  3TAR A;  3ZSR A;  3HVR A;  1D9D A;  1C6V A;  1N6Q A;  3M8R A;  2IC3 A;  4OGE A;  4W5O A;  1ZBU A;  4IBN A;  3RMA A;  4I2Q A;  4BE2 A;  4BDP A;  3LDS A;  4FK0 A;  2Z1H A;  4M3W A;  1I3A A;  4FJ9 A;  4B8A B;  3UIQ A;  1Y97 A;  4H8K A;  3ZSX A;  1DLO A;  3ALY A;  3LZJ A;  4DTN A;  1NOY A;  3BDP A;  4FJH A;  4CJP A;  4DSJ A;  4FZY A;  1RDD A;  4ELV A;  1QQC A;  3O3F A;  4RW6 A;  3SV4 A;  2YKN A;  4B9L A;  4KPY A;  2OZM A;  4AHU A;  3CFP A;  4O44 A;  4GW6 A;  4IKF A;  4LSN A;  1N5Y A;  5FRN A;  3V4I A;  1KFD A;  4CJU A;  5HRR A;  4N56 A;  4FK2 A;  4NCG A;  1L5U A;  3AO2 A;  5DMR A;  4UQG A;  3ISN C;  4DFK A;  3QEP A;  4RW8 A;  1ZBL A;  4KTQ A;  1UA1 A;  3TI0 A;  3TAB A;  3MEG A;  1RT6 A;  1KFS A;  2P51 A;  4IFV A;  4DSE A;  1KCF A;  1RCH A;  1WSI A;  3HPG A;  3LAM A;  1J9A A;  4M3U A;  1L3V A;  4O5B A;  3LZI A;  4DTJ A;  1JLC A;  3WNG A;  2FBV A;  3ZSW A;  1NK8 A;  1JLA A;  2X74 A;  3OJU A;  3K57 A;  4FZZ A;  4CIG A;  4AIL C;  1JKH A;  3C6U A;  2LSN A;  2VWK A;  4B9T A;  3M8S A;  4K8X A;  2W42 A;  1GOB A;  4KB1 A;  4M42 A;  3ZSO A;  1JLQ A;  1SKS A;  4F2S A;  3AA2 A;  1ASW A;  3I0R A;  1C0T A;  3MXM A;  1U4B A;  3QIN A;  4EZ9 A;  3P5J A;  3SQ4 A;  1HRH A;  2YNF A;  2XY7 A;  3SQ0 A;  1WAF A;  2KZZ A;  4FLZ A;  3LP1 A;  4CER A;  4CES A;  4E7L A;  5K14 A;  2HMI A;  4CEZ A;  4XIU A;  3KJV A;  3L2Q A;  3DLK A;  3KK2 A;  4E7J A;  4DTR A;  4CJV A;  3U3Y A;  2XRI A;  4C8O A;  4N5S A;  4BAC A;  4CFD A;  2HHU A;  1Z26 A;  3S3M A;  4KO0 A;  1GOC A; 
#chains in the Genus database with same CATH topology
 4Z4H A;  1OH8 A;  3C7N B;  2OPQ A;  5M1F A;  4J2D A;  3BZK A;  3A5N C;  4NO7 A;  2O8F B;  2G8H A;  2FSJ A;  2E88 A;  4QS8 A;  2OTL N;  3IS9 A;  4EHU A;  2X78 A;  4FOE A;  5AR0 A;  4E19 A;  1YJ9 N;  3VET A;  4CD3 A;  4YOT A;  3QBX A;  3QFP A;  3CYM A;  1VSM A;  2B4J A;  3LWM A;  3HL8 A;  5KGX A;  4LSL A;  4H0X B;  4K43 A;  2YHA A;  3QBW A;  4CGG A;  1T7P A;  1LOT B;  3G0Z A;  1SQK A;  3H3O B;  1WBB A;  3T1A A;  4OKJ A;  2IVO A;  1IJJ A;  5AFU H;  4I6M A;  3DOL A;  1REV A;  2WOM A;  3DYA A;  4B9V A;  4KTW A;  4DU1 A;  1SL2 A;  3C6A A;  3GE1 A;  1NG9 A;  4FYD A;  4A5B A;  2GWJ A;  3KD1 E;  2OPP A;  3NGZ A;  5AFU A;  2Q3S A;  3PX0 A;  4CZI A;  1S5J A;  2NRH A;  4AHT A;  2P9K A;  3IFR A;  3CQ8 A;  1VQ9 N;  2JGU A;  3P39 A;  4B9Q A;  3ZSQ A;  1SUQ A;  1CXU A;  4CF1 A;  3RMD A;  1YXQ A;  4JKC A;  1LW0 A;  1TAU A;  1D8Y A;  2ASP A;  4JKA A;  1OVY A;  1WNS A;  5J2P A;  3D6R A;  3J7Y P;  3KTQ A;  5EY4 A;  1NGC A;  2VG7 A;  2OYQ A;  2ITG A;  5SWM A;  3U9Z A;  1OH7 A;  2ZGY A;  1Q9X A;  1UWB A;  4J2E A;  4FPA A;  4BRP A;  5JLF A;  3BY5 A;  2RKI A;  4BVP A;  2A42 A;  2O8D A;  4DQP A;  2CH5 A;  1RTI A;  5DK5 A;  1WSJ A;  2P9S B;  1WAJ A;  1JL2 A;  3E9O A;  3LPU A;  5AQM A;  1QZ6 A;  4OVL A;  2QI2 A;  3SLC A;  3K59 A;  3OYG A;  3D45 A;  4X66 K;  1EKE A;  3QES A;  4JKB A;  3VMF B;  1ZC6 A;  5AZJ B;  3IG1 A;  2O8E B;  4DR2 K;  1DT9 A;  1BQM A;  5KQ8 A;  3SI6 A;  4MDA A;  4DKW A;  2I7N A;  1UOC A;  3T1Y K;  3TAG A;  2NNW A;  4FWS A;  4BWM A;  3WNH A;  2E20 A;  1VQ8 N;  3HYF A;  4BRM A;  3FFI A;  5GAH P;  2NRX A;  4DQI A;  1HQU A;  3QET A;  2IIR A;  4FK4 A;  2W6L A;  1RFQ A;  2BH1 A;  4PUO A;  3ULE A;  3RRH A;  4F3O A;  1TKD A;  4ZTF A;  2FC0 A;  4CED A;  5J2Q A;  5AQT A;  1VQ7 N;  1NM1 A;  3MEE A;  3CI5 A;  3CJB A;  4JN4 A;  2HBJ A;  1C1C A;  5FRM A;  2QWO A;  4AHV A;  4JLH A;  3NGY A;  1KD1 O;  1XNQ K;  1LAW A;  3ZT2 A;  3VPZ A;  1ZBS A;  1N32 K;  3MMV A;  4B1X B;  2IDO A;  2FSN A;  3NH0 A;  3BP8 A;  4JS5 A;  4KHN A;  3N4Q A;  1OH5 A;  4B9M A;  3AVF A;  1NGJ A;  3DOK A;  3L4Q A;  2BDP A;  3TTC A;  1BCO A;  1FKO A;  3GG4 A;  4AHC A;  4J2B A;  5AQG A;  3KLG A;  4CZF A;  4EFH A;  4C8N A;  3N4P A;  3VQD A;  1J6Z A;  3SBT A;  1KQS M;  4UY8 O;  1SKW A;  3IAY A;  4FW2 A;  2G8U A;  4AM6 A;  4Z4C A;  3RRG A;  4CHQ A;  4JK9 A;  4ELT A;  1BGX T;  1F21 A;  4FOI A;  1YTU A;  4Z4G A;  4BY9 C;  4K0K K;  4DU4 A;  1TAQ A;  4C23 A;  1XMQ K;  1O1W A;  1NK6 A;  1HPM A;  4PQU A;  3HXM A;  2QWR A;  3CJ7 A;  2O8C A;  1DEJ A;  3D2E A;  4LFA K;  1Z05 A;  2PYJ A;  4FM2 A;  3HT3 A;  2OPS A;  4W5T A;  2A6A A;  2F4V K;  1IV0 A;  1M1K O;  3M5R A;  1S9E A;  2HF4 A;  3E9P A;  1HX1 A;  1TUU A;  5HRN A;  2HBL A;  4FWL A;  3IRX A;  5C24 A;  3C95 A;  1WSH A;  4DR3 K;  1JLB A;  2HF3 A;  5M1K A;  4DF8 A;  1FK9 A;  4BRA A;  2F7T A;  3L8B A;  2NRV A;  1Q9Y A;  3SUQ A;  3OYM A;  3RWU A;  3BGR A;  3J7Z O;  2YCH A;  3FZK A;  2PZS A;  1U2V B;  3OYN A;  1QQO A;  3NE6 A;  2ZWH A;  2KZM A;  3R3L A;  3NAE A;  2ZM6 K;  3TAN A;  1X1P A;  2KW4 A;  2B6A A;  4LFC K;  1NOZ A;  4BC5 A;  2F9W A;  3P4I A;  5IT9 O;  3O3G A;  1RBV A;  2PBD A;  1TKZ A;  3VQ8 A;  5AQO A;  1S1W A;  2D0C A;  2HHX A;  2RN2 A;  2E8A A;  4FWP A;  4OKK A;  4EZ6 A;  4BRN A;  4CF0 A;  3AVH A;  4BR2 A;  3KLF A;  2F8T A;  4CK1 A;  5CE3 A;  3WXK A;  4GV9 A;  1VSH A;  1QQM A;  3CCE N;  1VHX A;  1RBS A;  4L3Q A;  3KD5 E;  1VQK N;  3QNO A;  2YV0 X;  2Q97 A;  5LJV A;  3CCR N;  4IXC A;  1BI4 B;  5HBM A;  2D5R A;  1XHX A;  4I7F A;  5BN8 A;  3CCQ N;  3DMJ A;  2OZS A;  1Q86 O;  4Z4I A;  1MU2 A;  3ZT4 A;  3CQY A;  2YJE A;  3AO1 A;  3O4W A;  3TWH A;  3OYH A;  1KLN A;  1NLV A;  1WOQ A;  4XEI A;  4PY5 A;  3AVM A;  4B9U A;  3VA3 A;  1C1B A;  2XHB A;  3LAL A;  4KBO A;  2KTQ A;  2ZGZ A;  3V1Q A;  3HK2 A;  4F3T A;  5KRT A;  4JKE A;  4O8K A;  4CF2 A;  1KSP A;  3P38 A;  1S1V A;  3LDN A;  3KIO A;  4DV1 K;  3THX A;  1JXE A;  4KHU A;  3OYK A;  3ZYY X;  4IEI A;  4FSV A;  4BG9 A;  2NRR A;  4R79 A;  3TAE A;  1GLE G;  1VQN N;  1RDB A;  4BR7 A;  1SS6 A;  1EXQ A;  4ILG B;  1KVA A;  1VSE A;  3WT0 A;  4IOX A;  3SAH A;  2AJQ A;  4BRF A;  2YHW A;  3DLB A;  2A3Z A;  2UYT A;  3VEO A;  3G71 N;  3DI6 A;  1HJR A;  3E9L A;  2P5G A;  3J8A A;  1HKC A;  1RT1 A;  1IO2 A;  4DV5 K;  1WBD A;  1C6V A;  3M8R A;  1ZBU A;  4BE2 A;  4BDP A;  5BPL A;  5GIN A;  2PFU A;  2VYP A;  4M3W A;  3KWG A;  2VQF K;  4H8K A;  1S3X A;  3ZSX A;  3LZJ A;  4KH5 A;  1HR0 K;  3MCP A;  4NLB A;  4OPH A;  5AQH A;  4KPY A;  4AHU A;  4GW6 A;  5BR9 A;  4AF1 A;  3V4I A;  4CJU A;  5BRH A;  1P90 A;  3A0I X;  1L5U A;  1YHQ N;  5DMR A;  4KHY A;  1ZBL A;  4XH1 A;  4KTQ A;  2P51 A;  1RCH A;  4GV6 A;  3EE8 A;  3LZI A;  1JLC A;  3ZSW A;  1ATN A;  2X74 A;  3K57 A;  4YHH K;  3CHW A;  1JKH A;  4B9T A;  4KB1 A;  2BUP A;  2UXC K;  3I0R A;  3MXM A;  4H0V B;  2P9L A;  4JK8 A;  3P5J A;  2YNF A;  2XY7 A;  3VER A;  4CES A;  4CEZ A;  4H5N A;  3KK2 A;  3DLL L;  4CJV A;  4C8O A;  4CBW A;  4N5S A;  3W0L A;  2FF3 B;  5LMU K;  3A5O C;  3FZF A;  3P31 A;  1GOC A;  3ZCM A;  3SBG A;  4KHQ A;  5CHI A;  4H5R A;  4WQ5 C;  3K58 A;  5AQZ A;  2J4R A;  4NYN A;  2XO7 A;  3VQ7 A;  4OLB A;  3M6G A;  2Z1G A;  4WCE L;  2FBY A;  4IJN A;  1ASU A;  2HVI A;  3IUC A;  3E01 A;  2E6L A;  2Z1I A;  3HOS A;  3OBW A;  2Q0U A;  4ISE A;  2QEX N;  3S9H A;  3O9R A;  3E1Y A;  3L0Q A;  4O8U A;  3PO4 A;  2E2O A;  2FLO A;  2KFN A;  4CZL A;  1GLB G;  1NGH A;  1NJZ A;  1BQN A;  2O8B B;  1XHZ A;  3O5B A;  4TSX A;  4B1U B;  1NK7 A;  4DFJ A;  3WNE A;  4EP5 A;  3PO5 A;  4Q0B A;  3OYD A;  2GEL A;  3NMU A;  3MN7 A;  1LW2 A;  3ZSY A;  4HCC A;  3KZB A;  2HHQ A;  4CGI A;  4HUF A;  5E26 A;  2IOC A;  2QWM A;  4YY3 K;  3V9U A;  1HKB A;  3HTV A;  3L3U A;  4HTU A;  1LWC A;  3A8Y A;  3O9Q A;  3AA3 A;  3AV9 A;  1FW6 A;  1D9F A;  2ZJP L;  1HNI A;  4DS5 A;  3HST B;  1JLG A;  3SAF A;  4BRH A;  1U2V A;  2XY5 A;  5GIP A;  1XQS C;  3VEX A;  1RT5 A;  3MCA B;  1BHL A;  4YOR A;  5C42 A;  2QKK A;  1RTD A;  2HB5 A;  3SYZ A;  1U49 A;  2OAN A;  3QO9 A;  3WXL A;  1V4T A;  4C1N I;  3HOT A;  5AQN A;  1EP4 A;  2NZT A;  1JLF A;  4YOV A;  3O8M A;  3ZX2 A;  3VQP A;  1T03 A;  3OYE A;  4JI7 K;  2FBX A;  2IAJ A;  4CJS A;  5GAE P;  3V9S A;  4V19 S;  3SUN A;  4GKK K;  1NGD A;  4CIF A;  2O4G A;  3VEZ A;  5BN9 A;  2RPI A;  4FLU A;  1VSD A;  1R59 O;  3LPT A;  1NMD A;  3M1F A;  3G6E N;  3CCS N;  1M90 O;  2BAN A;  3GDQ A;  2VWJ A;  5EX5 A;  5ELZ A;  4CEO A;  1BI4 A;  3MX5 A;  5KTQ A;  4FWK A;  5FRO A;  4JEP A;  2QWL A;  3TAQ A;  3QFU A;  2B5J A;  2P9U B;  1TK0 A;  3KWI A;  3CFR A;  4KI4 A;  4MQ3 A;  3VGL A;  4QOZ B;  4JI6 K;  3LP2 A;  4H03 B;  3VQB A;  4X64 K;  4AQY K;  3NDK A;  3V9Z A;  1XWL A;  1W2B M;  3CC7 N;  5I42 A;  4OO1 J;  4LF8 K;  1U48 A;  4A2A A;  4RWT A;  4CIE A;  5C0Y A;  2QXF A;  3AVG A;  3G25 A;  2VCP A;  4GY2 B;  1TK5 A;  3PX4 A;  3DAW A;  4H4M A;  2ASM A;  3NF9 A;  3EKS A;  1ZBF A;  2ZD1 A;  5KPZ A;  5J2N A;  4LFB K;  1OKJ A;  1IKX A;  1HYS A;  1DTQ A;  4JI2 K;  3ZX3 A;  3AAR A;  3AVJ A;  2EX3 A;  3LP0 A;  2D1K A;  5HRS A;  1K9M O;  3QIO A;  5AQJ A;  1DTT A;  3UKR B;  3ENB A;  4LF5 K;  2YX6 A;  3D7E O;  4X65 K;  4CJ5 A;  3L2U A;  3OW2 M;  1KXP A;  4ELU A;  3DM2 A;  3ZSV A;  5BPN A;  3K5O A;  4HCB A;  4JRP A;  3NF7 A;  2D0O A;  1NJW A;  3AO4 A;  3SJH A;  3VEY A;  4BQL A;  2QM1 A;  3L2V A;  1RT3 A;  1EWQ A;  4YOU A;  4DR5 K;  3VQ4 A;  4A59 A;  2EHG A;  3EE9 A;  4N47 A;  3HPH A;  2GTD A;  3KK1 A;  2NRT A;  3CXC M;  1E3M A;  1EWR A;  4FJJ A;  1RDW X;  1HYV A;  5AQR A;  1IBL K;  1A5W A;  2VG5 A;  1IBK K;  3DLH A;  3CCV N;  1RIL A;  1VSK A;  4H5V A;  3SUO A;  5GAG P;  2OA8 A;  3THX B;  3GOI A;  3KLE A;  4LF6 K;  4B1W B;  5C2D A;  3QEV A;  3UB5 A;  4PA1 A;  5JVH L;  3LDL A;  2RF2 A;  4PL7 A;  4BR0 A;  1NKB A;  5JS1 A;  4BDY A;  4CW7 B;  1YTA A;  5FPN A;  5HRP A;  3VGM A;  1ITG A;  1RT7 A;  4N76 A;  1CZB A;  4DSF A;  3J7A P;  1VRT A;  4DU3 A;  2IVP A;  4GNI A;  2O4I A;  1J53 A;  3DXK A;  4BG8 A;  3K2P A;  2UUA K;  1QSY A;  1SV5 A;  2XY8 A;  2G8V A;  4KTZ A;  4CEE A;  4HHT A;  3HM9 A;  3AVL A;  4CFC A;  3AAP A;  3K5N A;  1YT3 A;  4JNE A;  1QVF M;  2KKZ A;  3S3M A;  2ZE2 A;  1KLM A;  4B3T K;  5HRO A;  3DLG A;  3O9U A;  4O4G A;  4U67 L;  2UXD K;  2D0B A;  4RW4 A;  3O3H A;  2XY6 A;  3B6P A;  1OH6 A;  1BIU A;  1C0U A;  1NK5 A;  1A5X A;  1D5A A;  3RVC A;  3MN9 A;  3ID8 A;  3C6T A;  4IO8 A;  1JCE A;  3F5T A;  3FZM A;  2CGL A;  3KHY A;  4JAX A;  4PL8 A;  3CIP A;  3JYT A;  4DFP A;  5AQL A;  3MN6 A;  3G4S N;  3TAM A;  2O8B A;  2ATQ A;  3QNN A;  3T19 A;  3VF4 A;  1QVG M;  2R7Y A;  3SV3 A;  1T3V A;  3LDQ A;  4FLY A;  4FZX C;  2G8K A;  1LAV A;  4FJL A;  4DS4 A;  1RBU A;  1U6Z A;  3CMA N;  5AQU A;  2P9L B;  4B1Y B;  1RBR A;  4BDZ A;  3FLC O;  2VQE K;  3AAQ A;  4DV4 K;  4C1N K;  2NUB A;  2V7Y A;  4M3Z A;  1UA0 A;  4OPA A;  4CF8 A;  4DWI A;  4Z4E A;  1RDA A;  3JSM A;  3V6D A;  3E66 A;  3R9P A;  5FPD A;  1NGB A;  1LV5 A;  3PY8 A;  2AA4 A;  3CQX A;  4JKH A;  4FCY A;  2HHW A;  3K9K A;  3QIC A;  3ZET B;  1S6P A;  4WYB A;  4A57 A;  3Q7C A;  3L2W A;  1TV6 A;  4CGH A;  2ETJ A;  3W3D A;  1KAX A;  1S9G A;  3EEQ A;  4ZTJ A;  3I0S A;  3ZT0 A;  4KH6 A;  3DRP A;  2ZJR L;  4I2P A;  3OYC A;  5SZT A;  1NK0 A;  2JLE A;  5KRS A;  3SAG A;  1SL1 A;  4KRE A;  3SPZ A;  3OS1 A;  4E1M A;  4DR1 K;  3K9J A;  2YNH A;  3KK3 A;  3WXJ A;  1D4X A;  4KHS A;  4NCA A;  1BU6 O;  4WQ4 C;  2A40 A;  4CJR A;  4IFY A;  3KK7 A;  4QS7 A;  5JVG L;  1XC9 A;  3TAR A;  3HVR A;  4JI1 K;  1N6Q A;  4OGE A;  2NLX A;  2E5L K;  4IDH A;  3RMA A;  4I2Q A;  4PKH A;  2CH6 A;  4FK0 A;  4PHT X;  4B8A B;  1DLO A;  4DTN A;  5EXW A;  4FJH A;  4DSJ A;  4MDB A;  2YKN A;  4ILJ A;  2P9U A;  4BC3 A;  3CFP A;  3BF3 A;  4CBU A;  5FRN A;  1KFD A;  4N56 A;  4NXM K;  4FK2 A;  1T6D A;  5B8H A;  1UA1 A;  1NWK A;  3MEG A;  1KFS A;  4DSE A;  1KCF A;  1Q82 O;  1J9A A;  4O5B A;  4DTJ A;  3WNG A;  2FBV A;  3CER A;  4EIA A;  1BA0 A;  1JLA A;  5CR4 A;  3JXU A;  5LL6 Z;  3OJU A;  4FZZ A;  5AZI B;  4AIL C;  4JI8 K;  4WQ4 A;  4K8X A;  2W42 A;  1GOB A;  1JLQ A;  3U9D A;  4RCH A;  1SKS A;  1ASW A;  1E4F T;  3QIN A;  3JAM O;  2NRW A;  1ILY A;  3ZLJ A;  1HRH A;  3SQ0 A;  1WAF A;  3LP1 A;  5LJW A;  5K14 A;  4NB4 A;  3TSQ A;  3DXM B;  3U3Y A;  1MDU B;  4DHY A;  1S72 N;  5BR8 K;  3CCL N;  4FPB A;  1Z26 A;  4KO0 A;  3UKR A;  4YFU A;  4JHD B;  3SNN A;  3D0P A;  3SUP A;  4HUE A;  1I39 A;  2PY5 A;  1B9F A;  1KVB A;  3L3V A;  4G1Q A;  1RBT A;  3M8P A;  1BL3 A;  1TYQ B;  4FJN A;  4CJ3 A;  4CFA A;  5M1P A;  4OLA A;  2QKB A;  1Q7Y O;  3OVN A;  2GUI A;  4H5W A;  5C25 A;  2G8F A;  3FZH A;  4HWI A;  3DLR A;  3CPE A;  2FBT A;  1T8E A;  1J54 A;  3F9K A;  4IZ9 A;  2EWS A;  3ATV A;  1B9D A;  3PUF A;  4KH4 A;  3THY B;  4CD1 A;  1GLD G;  1SAZ A;  4JKG A;  3VEV A;  1N34 K;  2HBM A;  2P9I A;  3EO3 A;  1LCU A;  2E2N A;  4FL9 A;  4M45 A;  3HP6 A;  1XI1 A;  3T1H K;  4YDU C;  4AH9 A;  1K6Y A;  4BR5 A;  3RR7 A;  4DMN A;  4F2R A;  1K73 O;  4OKE A;  4CHO A;  4EHT A;  2E6M A;  4WFB L;  3FE1 A;  1QSS A;  4CHP A;  5KGW A;  4DUZ K;  4HUG A;  1QE1 A;  4ISF A;  1GOA A;  1EET A;  4QAG A;  4DF4 A;  3HSC A;  5C12 A;  4M3T A;  5JS2 A;  3ZSZ A;  1CZ9 A;  1Q8I A;  1EQY A;  2KLA A;  3VA0 A;  3MK6 A;  1X3M A;  5AQK A;  5BRF A;  3GBT A;  1HJO A;  3UE5 A;  3T3F A;  5T7B A;  4GMJ B;  1RTJ A;  4RG8 A;  3AA4 A;  4KI6 A;  4ID1 A;  3M8Q A;  4YDU A;  3TSP A;  4DV3 K;  4CEF A;  4BRO A;  3NVK A;  3VTH A;  1MWK A;  3OYF A;  1QSL A;  3RR8 A;  2YHB A;  4X62 K;  3MXJ A;  4B3S K;  2CGK A;  3RTV A;  1Z25 A;  5EVZ A;  4BE0 A;  4RW7 A;  4FM1 A;  2E1Y A;  5DM7 L;  2VWB A;  3CCU N;  5F2R A;  2HST A;  3VN5 A;  4Y0W A;  4BRK A;  1XUP O;  3QEX A;  3WXI A;  2KQ2 A;  2GEM A;  3BUZ B;  2W6K A;  3L4I A;  1QS4 A;  3TR8 A;  3VQA A;  3ITH A;  3NF6 A;  2YJF A;  3VF2 A;  4CFB A;  1U04 A;  3HPO A;  2E2Q A;  4CHN A;  2HBK A;  3DXK B;  5HP1 A;  4KB0 A;  3A5L C;  3LL3 A;  4BQZ A;  4BRE A;  3LDP A;  3O6W A;  1NU0 A;  2P1J A;  4K41 A;  4GV3 A;  3FGU A;  4B9N A;  1BWF O;  1W0H A;  3ZET A;  4YOW A;  4JD2 B;  4LD0 A;  5DM6 L;  4Z94 A;  4JYA K;  5FDL A;  2WFB A;  4DR4 K;  2QA4 N;  1EO1 A;  2QW9 A;  3VEW A;  2P9P A;  2Y1I A;  4CZK A;  4DTM A;  2HOE A;  2H3G X;  1N8R O;  1YIT N;  4DQS A;  4FLW A;  3R8E A;  1NK4 A;  3U6F A;  4QCL A;  4MLH A;  3O9S A;  2Q36 A;  3KLI A;  4FW1 A;  4KKO A;  2ZJQ L;  3VGK A;  3CM5 A;  3CJ9 A;  4JKD A;  3VES A;  3T7Z A;  4DTO A;  3A2F A;  3V1R A;  3QEW A;  4FWR A;  5I9E B;  3SJJ A;  4N41 A;  5AJ3 K;  1E4G T;  4FLV A;  4BR4 A;  3V9X A;  4W5Q A;  3QEI A;  4WQ5 A;  3CJC A;  3TSU A;  3THV A;  2F9T A;  1HKG A;  4CK2 A;  3OYB A;  4FJX A;  3I56 N;  4IOC L;  1ZYQ A;  4FJM A;  4JV5 K;  5GIO A;  5D3G A;  4E1N A;  1UAX A;  5ADX H;  4OPK A;  4I9L A;  1RGI A;  3EZW A;  4FO0 A;  1K8K A;  4IOA L;  1XNR K;  1W9H A;  1DGK N;  4H0Y B;  1TGO A;  4O55 A;  4CJT A;  5EU7 A;  1NK9 A;  2FXU A;  3CME N;  4YOX A;  1V4S A;  1YI2 N;  3SK3 A;  1HNW K;  5HLF A;  5ADX A;  3K5L A;  2DFF A;  4CE9 A;  5AZI A;  3LAK A;  4FWQ A;  4MLE A;  3HM8 A;  1HNV A;  2WTU A;  4CZE A;  4LH5 A;  4FJK A;  3TAP A;  4DSK A;  3AVC A;  5KPR A;  4BRI A;  1S22 A;  3MWT A;  3I8D A;  4LF9 K;  1JCF A;  1NGF A;  5AQW A;  4CEA A;  2DFH A;  1ATS A;  2JWK A;  4C8M A;  1X9S A;  3NGI A;  1BUP A;  3R1X A;  3EY1 A;  4K25 A;  3KKS A;  2HVH A;  3DXM A;  3QIP A;  1SZ2 A;  2NRZ A;  2DFE A;  2HND A;  2IGI A;  3V1O A;  3I33 A;  4A62 A;  2Y1J A;  2UU9 K;  3VQ6 A;  1VQM N;  2DY4 A;  3OYL A;  5TKY A;  3OS0 A;  3HI0 A;  4BC2 A;  4IWV A;  4JHD A;  1QTM A;  4QS9 A;  4E3S A;  4BWJ A;  1VQ6 N;  3WUH A;  1CXQ A;  1QHA A;  1TYQ A;  2I7P A;  1WLJ A;  2BTF A;  3WNF A;  1WUA A;  1YVN A;  1JLE A;  4H0O A;  1X3N A;  1HPZ A;  4BVO A;  2QXL A;  5M1Q A;  4HVJ A;  4B3O A;  4W5N A;  2QWN A;  4KRF A;  3THY A;  1IG9 A;  3VQ9 A;  3G10 A;  2QK9 A;  1MA9 B;  3HVT A;  2YNI A;  3RMB A;  1KRP A;  4C8K A;  3PLA A;  3DJC A;  4FLT A;  1CLQ A;  2ZF5 O;  2KFZ A;  1WSG A;  5AQY A;  3NH1 A;  4K8Z A;  3H45 C;  1C0M A;  5A2Q O;  3CD6 N;  5CYQ A;  1VSF A;  2JWL A;  4CEQ A;  4CJE A;  2I5J A;  4DSI A;  3O1W A;  2Q31 A;  3NHG A;  4DB3 A;  2A41 A;  2DPN A;  3CFO A;  3KKR A;  1IKW A;  4KFB A;  3MAQ A;  1HYZ A;  1G15 A;  1HMV A;  4YNQ A;  1KC8 O;  1TVR A;  3J81 O;  3H6E A;  4H5T A;  3AO3 A;  3CPW M;  1W7A A;  1S1T A;  2FSK A;  4DV2 K;  3L6Q A;  3TAF A;  3CG7 A;  1NKC A;  1NGE A;  4O0I A;  3V81 A;  3SQ1 A;  4W5R A;  3ZT3 A;  4E7I A;  2YI1 A;  4JI0 K;  4BE1 A;  4WE1 A;  3MEC A;  2V7Z A;  5I3U A;  3QB0 A;  3EKU A;  3SQ2 A;  4FJ8 A;  2YHX A;  5CZ2 A;  3H1V X;  4BR9 A;  2GV9 A;  2WON A;  2BGG A;  4LF7 K;  3AVI A;  1U45 A;  2V52 B;  3AY9 A;  3D2F B;  4JKG B;  3FR0 A;  5HOO A;  2P9I B;  2F8S A;  5C2F A;  3IMX A;  4NCB A;  2P9N A;  1B92 A;  4NLC A;  2GBZ A;  1RT4 A;  2Q2R A;  4DSL A;  4JI3 K;  4JKF A;  3HP9 A;  1D9D A;  4IBN A;  4BRL A;  4F9O A;  1T6C A;  1H1V A;  1BDG A;  3ALY A;  1NOY A;  5TKW A;  5LMN K;  4DR7 K;  4CJP A;  2UXB K;  4A2B A;  4FZY A;  1RDD A;  4ELV A;  4DUY K;  4RW6 A;  5C15 A;  1KAZ A;  4LSN A;  4WF9 L;  1XC3 A;  2WC9 A;  3QEP A;  4DFK A;  4RW8 A;  3TAB A;  2WUS A;  3O08 A;  4IFV A;  4JD2 A;  1WSI A;  3LAM A;  3TTD A;  1VQ5 N;  3C0B A;  1NK8 A;  2RE2 A;  4DV7 K;  3M8S A;  1GLJ O;  4PKI A;  3RSE A;  4F2S A;  4CZG A;  3S41 A;  1U4B A;  4EZ9 A;  3TU5 A;  3AGR A;  3H46 O;  4H0P A;  4M63 C;  3CET A;  2QWP A;  4CER A;  2HMI A;  4XIU A;  4FWM A;  3KJV A;  3L2Q A;  4E7J A;  4DTR A;  2XRI A;  3QDK A;  4BAC A;  4CFD A;  4IEE A;  1CZA N;  3MXI A;  1QQN A;  2HHS A;  2A5X A;  4CEC A;  4JK7 A;  1S1U A;  2YNG A;  4DQQ A;  5C10 A;  1J5E K;  3CC2 N;  2AP1 A;  3ZT1 A;  3SMS A;  2HHV A;  4CJQ A;  4CVN E;  3DRR A;  1WSF A;  1ASV A;  4CJW A;  2DTU A;  1QHT A;  3SCX A;  3FFK B;  1RTH A;  3C94 A;  1NJI O;  5BPM A;  1TL1 A;  3WEE B;  3VOV A;  4FVU A;  4B08 A;  4M7Y A;  1FKP A;  4PWD A;  5FLX O;  3CCJ N;  1ESV A;  1GLL O;  1BIZ A;  4BC4 A;  4DFM A;  4R5P A;  1WSE A;  4E89 A;  1VK0 A;  4G9Z A;  1HQE A;  2E4L A;  3NCI A;  1L3T A;  2Q0R A;  3CC4 N;  1IBM K;  2GX9 A;  2P9P B;  4RTF D;  2CGJ A;  1U47 A;  1RDU A;  3QLH A;  5KI6 A;  5AQP A;  1SL0 A;  4DV0 K;  3J80 O;  2HMP A;  2X6S A;  3VTI A;  4E7H A;  4WFN L;  4ILH A;  1VSJ A;  5JIC A;  4CHZ A;  4MFB A;  1KAY A;  1LWF A;  3CJA A;  2UUC K;  1ZBH A;  3VEN A;  3OHR A;  2QWQ A;  2E2P A;  1BCM A;  4CJL A;  1J5O A;  4O0J A;  4YOY A;  4O5F A;  1HLU A;  3H3N O;  1JCG A;  2BE2 A;  3P83 D;  4CJ4 A;  1MWM A;  4Z0U A;  5J1E A;  3PIP L;  3H08 A;  4F8R A;  1GLA G;  4CK3 A;  3A5M C;  1NGA A;  1W97 L;  4DCH A;  4EP4 A;  3NFA A;  4KV8 A;  1L3S A;  1TUY A;  4ICL A;  2G8I A;  1TKT A;  4KAZ A;  3BF1 A;  4HTL A;  4EAH D;  4CCH A;  1A5V A;  4MO4 A;  2VG6 A;  4A5A A;  3THW B;  1K8K B;  5LY3 A;  3EL2 A;  5KQD A;  1BIS A;  4AHR A;  3QML A;  3HRG A;  2HNY A;  1N33 K;  1Z6R A;  1S1X A;  3O4N A;  4BRQ A;  1L3U A;  1IH7 A;  3DRS A;  5JMV A;  4FWO A;  4DTU A;  4NXN K;  3O4Q A;  3BZC A;  3ID6 A;  4FLX A;  3C7N A;  2QTD A;  4B1Z A;  4OPJ A;  2O8F A;  3MED A;  4DLG A;  1K8A O;  5CYM A;  4IDK A;  4IG3 A;  4J2A A;  1JL1 A;  3RMC A;  3AVB A;  2GWK A;  3OYJ A;  5J2M A;  1NKE A;  1KVC A;  4CGD A;  4IG0 A;  3ENO A;  3F73 A;  4FJ5 A;  4U7B A;  1DKG D;  2ITM A;  4B9S A;  4FM0 A;  4JI4 K;  3LAN A;  4DQR A;  4PKG A;  1T44 A;  3L2R A;  3V9W A;  4JRQ A;  3ZEU B;  4OX9 K;  2HW3 A;  3LM9 A;  3AVA A;  3CCM N;  5E84 A;  4KHP K;  4CJK A;  1VQO N;  1G99 A;  2Z1J A;  3AA5 X;  4FJ7 A;  1KTQ A;  3U3G A;  5F0X A;  3ULD A;  2W40 A;  4IFE A;  3WQU A;  3UKU B;  5AQI A;  3SZ2 A;  1X9M A;  5AQX A;  1NJX A;  2OPR A;  1VAZ A;  1BOT O;  3D2F A;  3OJS A;  4DQ8 A;  4H4O A;  4LC9 B;  2X6N A;  4IO9 L;  3NVM A;  3AO5 A;  4DG1 A;  1GLC G;  4H0T B;  3LP3 A;  5EOY A;  3O80 A;  3OTO K;  4Z4F A;  4AM7 A;  2W41 A;  3PX6 A;  2F96 A;  2OCE A;  1C0G A;  3HZ6 A;  3B6O A;  5E41 A;  4XH5 A;  1C1A A;  1TL3 A;  2D4W A;  2YKM A;  4OGC A;  4BRC A;  1X9W A;  3S3N A;  3LM2 A;  4FXD A;  1S6Q A;  3PV8 A;  4GVM A;  4ID5 A;  3OA9 A;  2KHO A;  1WB9 A;  2ASO A;  2HHH K;  3ENH A;  1C0F A;  3S3O A;  3FZL A;  1HNX K;  1P8Z A;  1ZXO A;  3I8B A;  2IVN A;  4LF4 K;  2HNZ A;  2UUB K;  5CY4 A;  2P9S A;  3OY9 A;  4CBX A;  4DTX A;  3MN5 A;  5AQV A;  4JS4 A;  5M1N A;  4Q5V A;  2VGM A;  3O9T A;  4IJA A;  3CM6 A;  1N36 K;  4FJG A;  4I6M B;  2WBN A;  4CGJ A;  1R0A A;  1LWE A;  3ASM A;  1GLF O;  3IKM A;  1VSI A;  1IKY A;  5AZJ A;  3DWL A;  4B8C A;  5KPT A;  4B3R K;  2O8E A;  4CI6 A;  3HBT A;  4E7K A;  4C8L A;  3PSF A;  1RDC A;  3ZX0 A;  1NGI A;  4NYF A;  4CZM A;  2P5O A;  1NNE A;  4B3M K;  3NBP A;  2P9K B;  3AGK A;  2GUP A;  4E1J A;  3QER A;  2G8W A;  4MO5 A;  1NMN A;  2P9N B;  4ZHR A;  5FPM A;  1VRU A;  2IS3 A;  3H1Q A;  4CJF A;  1SKR A;  4A61 A;  3ATU A;  1HNZ K;  4I9Q A;  3VQ5 A;  2PAV A;  1WN7 A;  1VQ4 N;  1BA1 A;  3AVK A;  3P1G A;  3SPY A;  1FXX A;  3HJF A;  5BRE A;  1Y64 A;  3DLE A;  3OYI A;  1ZBI A;  4F4K A;  4FWN A;  4DTS A;  5BRD A;  1NJY A;  3WXM B;  3EZ5 A;  1YJW N;  4L8R B;  2O8D B;  5H1S Q;  4CF9 A;  5AQQ A;  3GL1 A;  1NGG A;  4M3Y A;  3KLH A;  1NBW A;  1TKX A;  1TK8 A;  4E0D A;  3O1B A;  3EN9 A;  3WEE A;  2PYL A;  2D0P A;  3VF6 A;  4AHS A;  1Q18 A;  4Y1D A;  4CZJ A;  1VQL N;  4RW9 A;  4WFA L;  2A1S A;  5IWA K;  3CF5 L;  1YIJ N;  2ZQB A;  4M41 A;  4M3X A;  1IKV A;  2OTJ N;  1YJN N;  3VQE A;  4FJI A;  3RSE B;  5CZ1 A;  4XH4 A;  3EYZ A;  4B1V A;  3PSI A;  4K42 A;  1X9J A;  4DLE A;  2HHT A;  3Q7B A;  2V51 B;  3CJ1 A;  3I55 N;  4BRD A;  3F2K A;  2RHK A;  1HUX A;  1VSL A;  3NF8 A;  4CEB A;  4CHY A;  4LH4 A;  1QZ5 A;  5GAD P;  3NH2 A;  1RT2 A;  4ISG A;  1IG8 A;  4M3R A;  3MDQ A;  1YF5 L;  3OYA A;  1I94 K;  3IDH A;  3PIO L;  4OJR A;  3ULE B;  3K5M A;  4M7X A;  3VQC A;  1JXB A;  5F1X A;  4DTP A;  1YVU A;  5AQS A;  3MWP A;  2FF6 A;  4GKJ K;  1T05 A;  1EX4 A;  5FPE A;  1FJG K;  4GVE A;  1JJ2 M;  3TTF A;  5M1O A;  4KHW A;  4LY7 A;  3OS2 A;  3T69 A;  3U4L A;  3JS6 A;  2VGN A;  3THW A;  3LWL A;  4Y1C A;  1YAG A;  4CGF A;  2Q1N A;  1BG3 A;  4CJ7 A;  3LDO A;  4FVM A;  3VQQ A;  2D0A A;  1RNH A;  3HO1 A;  3AVN A;  2A1R A;  4BGA A;  3ZSR A;  4J8F A;  2IC3 A;  4W5O A;  3R6M A;  1YUW A;  4BGB A;  5HL7 L;  5MLC Q;  3LDS A;  2Z1H A;  3K0S A;  1I3A A;  4FJ9 A;  3UIQ A;  1Y97 A;  4DV6 K;  3BDP A;  1BO5 O;  1ATR A;  4DR6 K;  1QQC A;  3O3F A;  4BRG A;  3SV4 A;  4B9L A;  3M3Z A;  2OZM A;  4O44 A;  4IKF A;  1N5Y A;  2O8C B;  3KVG A;  5AQF A;  1Q81 O;  3D2E B;  5HRR A;  3C65 A;  3U8X A;  2E1Z A;  4NCG A;  3AO2 A;  4UQG A;  3B8A X;  3ISN C;  3MX2 A;  3C6H A;  3TI0 A;  3ZEU A;  3OBY A;  1RT6 A;  2YHY A;  1O13 A;  3HPG A;  4M3U A;  3TPQ A;  3WQT A;  1L3V A;  1OVQ A;  4JI5 K;  4CIG A;  3C6U A;  2LSN A;  2VWK A;  3UKU A;  4M42 A;  3ZSO A;  5JLH A;  3F9M A;  3AA2 A;  1C0T A;  3BEX A;  3SQ4 A;  2KZZ A;  1VQP N;  4FLZ A;  4E7L A;  3DLK A;  1XMO K;  2HHU A;  3SMP A;  4CZH A; 
#chains in the Genus database with same CATH homology
 4Z4H A;  4YFU A;  4KHQ A;  3K58 A;  2OPQ A;  3SNN A;  3D0P A;  3MXI A;  4J2D A;  4NYN A;  2XO7 A;  4HUE A;  3SUP A;  1I39 A;  4CEC A;  2PY5 A;  2HHS A;  1B9F A;  3VQ7 A;  2G8H A;  1KVB A;  3L3V A;  4G1Q A;  1RBT A;  1S1U A;  2YNG A;  3M8P A;  4DQQ A;  4OLB A;  4CHZ A;  1BL3 A;  3IS9 A;  2Z1G A;  4FJN A;  2FBY A;  2X78 A;  3ZT1 A;  4CJ3 A;  4CFA A;  1ASU A;  4OLA A;  4E19 A;  2QKB A;  2HVI A;  2HHV A;  3OVN A;  2GUI A;  4CJQ A;  3DRR A;  1WSF A;  5C25 A;  1ASV A;  3E01 A;  2E6L A;  1QHT A;  4CJW A;  3CYM A;  1VSM A;  2B4J A;  2Z1I A;  3SCX A;  3LWM A;  2G8F A;  3DLR A;  3HL8 A;  2FBT A;  1RTH A;  5KGX A;  1J54 A;  3C94 A;  3F9K A;  4LSL A;  1T8E A;  3S9H A;  1B9D A;  3PUF A;  2YHA A;  1TL1 A;  4CGG A;  1T7P A;  3PO4 A;  3G0Z A;  4B08 A;  2KFN A;  1FKP A;  1NJZ A;  1BQN A;  4PWD A;  3T1A A;  4OKJ A;  1XHZ A;  1BIZ A;  4M45 A;  3DOL A;  3HP6 A;  4DFM A;  4TSX A;  1XI1 A;  1REV A;  2WOM A;  3DYA A;  4R5P A;  4B9V A;  1WSE A;  1NK7 A;  4DFJ A;  4KTW A;  4E89 A;  1VK0 A;  4DU1 A;  4AH9 A;  1HQE A;  1K6Y A;  2E4L A;  3WNE A;  4EP5 A;  3NCI A;  3OYD A;  1SL2 A;  1L3T A;  3RR7 A;  3PO5 A;  4Q0B A;  4DMN A;  4FYD A;  1LW2 A;  3ZSY A;  4HCC A;  2HHQ A;  4F2R A;  4CGI A;  4HUF A;  1U47 A;  3QLH A;  2IOC A;  5KI6 A;  2OPP A;  3NGZ A;  3KD1 E;  1SL0 A;  2Q3S A;  3V9U A;  3PX0 A;  3L3U A;  1S5J A;  4HTU A;  1LWC A;  2X6S A;  4OKE A;  4E7H A;  4AHT A;  4CHO A;  2E6M A;  3CQ8 A;  1VSJ A;  2JGU A;  3AA3 A;  3AV9 A;  1QSS A;  1D9F A;  3ZSQ A;  1SUQ A;  4MFB A;  1CXU A;  1HNI A;  3HST B;  1LWF A;  5KGW A;  4CF1 A;  1JLG A;  4CHP A;  4HUG A;  1QE1 A;  1LW0 A;  3RMD A;  1TAU A;  3ZCM A;  1ZBH A;  1D8Y A;  1GOA A;  2XY5 A;  1WNS A;  1EET A;  4QAG A;  5J2P A;  1BCM A;  4DF4 A;  4CJL A;  3KTQ A;  4M3T A;  5JS2 A;  1J5O A;  1RT5 A;  1CZ9 A;  2VG7 A;  4O0J A;  3ZSZ A;  2ITG A;  1Q8I A;  5SWM A;  2OYQ A;  1BHL A;  5C42 A;  2QKK A;  3VA0 A;  1Q9X A;  2BE2 A;  1RTD A;  2HB5 A;  3P83 D;  4CJ4 A;  1UWB A;  3SYZ A;  4Z0U A;  1U49 A;  5J1E A;  4J2E A;  2DTU A;  3H08 A;  3QO9 A;  3T3F A;  5T7B A;  4F8R A;  4GMJ B;  1RTJ A;  2RKI A;  4RG8 A;  4CK3 A;  3AA4 A;  4DQP A;  4KI6 A;  4ID1 A;  1EP4 A;  1RTI A;  5DK5 A;  4EP4 A;  3M8Q A;  3NFA A;  1JLF A;  4KV8 A;  1L3S A;  1WSJ A;  4ICL A;  2G8I A;  4CEF A;  1TKT A;  3VQP A;  1WAJ A;  3OYE A;  1T03 A;  2FBX A;  4KAZ A;  1JL2 A;  4CCH A;  1A5V A;  2VG6 A;  2IAJ A;  3LPU A;  4CJS A;  3V9S A;  3SUN A;  4OVL A;  4CIF A;  2O4G A;  3OYF A;  3K59 A;  1BIS A;  4AHR A;  1QSL A;  3OYG A;  2HNY A;  2RPI A;  3D45 A;  3RR8 A;  2YHB A;  4FLU A;  3MXJ A;  1EKE A;  1S1X A;  3O4N A;  3RTV A;  1Z25 A;  3QES A;  1VSD A;  3LPT A;  3IG1 A;  1L3U A;  2BAN A;  4BE0 A;  2VWJ A;  1BQM A;  1IH7 A;  3DRS A;  4RW7 A;  4FM1 A;  4DTU A;  3SI6 A;  3O4Q A;  4CEO A;  4FLX A;  1UOC A;  1BI4 A;  3TAG A;  4OPJ A;  4BWM A;  3WNH A;  3MED A;  4DLG A;  3VN5 A;  5KTQ A;  2HVH A;  5CYM A;  3QEX A;  4IDK A;  4IG3 A;  4J2A A;  2KQ2 A;  1JL1 A;  3HYF A;  3FFI A;  3RMC A;  3AVB A;  3OYJ A;  1QS4 A;  3TR8 A;  5J2M A;  4DQI A;  1NKE A;  3VQA A;  1HQU A;  3ITH A;  3NF6 A;  1KVC A;  5FRO A;  4CGD A;  4IG0 A;  1U04 A;  4CFB A;  3F73 A;  3HPO A;  4FJ5 A;  4CHN A;  3TAQ A;  4B9S A;  5HP1 A;  2B5J A;  3QET A;  4FM0 A;  1TK0 A;  4KB0 A;  3CFR A;  4KI4 A;  4MQ3 A;  4FK4 A;  3LAN A;  4DQR A;  4QOZ B;  3LP2 A;  3VQB A;  3NDK A;  2P1J A;  1XWL A;  3V9Z A;  4B9N A;  3L2R A;  3V9W A;  4JRQ A;  4PUO A;  5I42 A;  1W0H A;  2HW3 A;  3AVA A;  4LD0 A;  3RRH A;  4F3O A;  1U48 A;  1TKD A;  4ZTF A;  2FC0 A;  4CED A;  5J2Q A;  4CJK A;  2Z1J A;  3MEE A;  3AA5 X;  4FJ7 A;  1KTQ A;  3U3G A;  4CIE A;  5FDL A;  3ULD A;  2QXF A;  3AVG A;  1C1C A;  5FRM A;  3SZ2 A;  1TK5 A;  4AHV A;  4JLH A;  2Y1I A;  4DTM A;  4H4M A;  3PX4 A;  3NGY A;  3NF9 A;  1ZBF A;  1X9M A;  2ZD1 A;  1NJX A;  5J2N A;  1LAW A;  1IKX A;  2OPR A;  1HYS A;  3OJS A;  1DTQ A;  3ZT2 A;  4H4O A;  4DQS A;  4FLW A;  2IDO A;  2X6N A;  3AVJ A;  3NH0 A;  3U6F A;  1NK4 A;  4QCL A;  4JS5 A;  3KLI A;  3AO5 A;  4FW1 A;  4KKO A;  4KHN A;  2EX3 A;  3CM5 A;  3LP0 A;  4B9M A;  4DG1 A;  3AVF A;  3LP3 A;  4DTO A;  4Z4F A;  3DOK A;  3PX6 A;  3A2F A;  2F96 A;  5HRS A;  3V1R A;  2BDP A;  3B6O A;  3QIO A;  1BCO A;  1DTT A;  1FKO A;  4AHC A;  5E41 A;  3QEW A;  4J2B A;  1C1A A;  1TL3 A;  3KLG A;  3SJJ A;  4CJ5 A;  4N41 A;  2YKM A;  4OGC A;  4FLV A;  4C8N A;  3L2U A;  1X9W A;  3S3N A;  3VQD A;  4ELU A;  3V9X A;  1S6Q A;  3DM2 A;  4W5Q A;  3QEI A;  4GVM A;  3ZSV A;  3K5O A;  3PV8 A;  1SKW A;  4ID5 A;  4FW2 A;  4JRP A;  3NF7 A;  2G8U A;  3IAY A;  4Z4C A;  3RRG A;  4CHQ A;  1NJW A;  3AO4 A;  3THV A;  4ELT A;  3S3O A;  1BGX T;  1F21 A;  1YTU A;  4Z4G A;  4CK2 A;  3L2V A;  1RT3 A;  3OYB A;  3VQ4 A;  4FJX A;  4DU4 A;  1ZYQ A;  4FJM A;  1TAQ A;  2EHG A;  4N47 A;  1O1W A;  1NK6 A;  2HNZ A;  3HPH A;  3KK1 A;  3HXM A;  4E1N A;  5D3G A;  5CY4 A;  3OY9 A;  4PQU A;  1UAX A;  4DTX A;  4OPK A;  4I9L A;  4FJJ A;  4JS4 A;  1HYV A;  4Q5V A;  1A5W A;  2VG5 A;  4HCB A;  1W9H A;  2PYJ A;  4FM2 A;  1TGO A;  3DLH A;  3CM6 A;  4O55 A;  3HT3 A;  2OPS A;  4FJG A;  4CJT A;  5EU7 A;  1NK9 A;  4CGJ A;  1RIL A;  1R0A A;  1LWE A;  3ASM A;  1VSK A;  4W5T A;  3SUO A;  2OA8 A;  1VSI A;  5HLF A;  1IKY A;  3K5L A;  3KLE A;  2DFF A;  4B8C A;  4CE9 A;  1S9E A;  3QEV A;  4PA1 A;  3LAK A;  5HRN A;  2RF2 A;  1NKB A;  1HNV A;  4E7K A;  4C8L A;  5JS1 A;  4FXD A;  4LH5 A;  1RDC A;  4FJK A;  3TAP A;  3IRX A;  5C24 A;  4BDY A;  3AVC A;  3C95 A;  4DSK A;  1WSH A;  5HRP A;  1YTA A;  1JLB A;  3I8D A;  4NYF A;  2P5O A;  4DF8 A;  3NBP A;  4CEA A;  1FK9 A;  1ITG A;  1RT7 A;  2DFH A;  4N76 A;  1CZB A;  3QER A;  4C8M A;  2G8W A;  1X9S A;  3NGI A;  3L8B A;  4DSF A;  3EY1 A;  1Q9Y A;  3SUQ A;  1VRT A;  3KKS A;  3OYM A;  4ZHR A;  3BGR A;  4DU3 A;  1VRU A;  2IS3 A;  4CJF A;  2PZS A;  3RWU A;  3QIP A;  1J53 A;  1SKR A;  4I9Q A;  2O4I A;  3K2P A;  3VQ5 A;  2DFE A;  2HND A;  2IGI A;  3V1O A;  3OYN A;  2Y1J A;  3NE6 A;  2KZM A;  1QSY A;  1WN7 A;  1SV5 A;  3NAE A;  3VQ6 A;  2XY8 A;  2G8V A;  4KTZ A;  3TAN A;  4CEE A;  3OYL A;  4HHT A;  2DY4 A;  3OS0 A;  3AVL A;  4CFC A;  3HM9 A;  3K5N A;  1X1P A;  2KW4 A;  3AVK A;  3P1G A;  2B6A A;  4DS5 A;  3SPY A;  1FXX A;  1YT3 A;  1QTM A;  3HJF A;  3DLE A;  3OYI A;  4E3S A;  4BWJ A;  1ZBI A;  4F4K A;  1NOZ A;  4DTS A;  2ZE2 A;  1CXQ A;  1NJY A;  3O3G A;  1WLJ A;  1KLM A;  1RBV A;  3EZ5 A;  3WNF A;  5HRO A;  3DLG A;  4L8R B;  1TKZ A;  4CF9 A;  3VQ8 A;  4O4G A;  1JLE A;  2D0B A;  4RW4 A;  3O3H A;  1S1W A;  2XY6 A;  2D0C A;  3B6P A;  4M3Y A;  2HHX A;  3KLH A;  1BIU A;  1HPZ A;  1C0U A;  1TKX A;  1NK5 A;  2RN2 A;  1A5X A;  1D5A A;  1TK8 A;  4E0D A;  4HVJ A;  4B3O A;  4W5N A;  4OKK A;  4KRF A;  4EZ6 A;  4CF0 A;  3G10 A;  3C6T A;  3VQ9 A;  1IG9 A;  2PYL A;  4AHS A;  2QK9 A;  3AVH A;  3HVT A;  3KLF A;  3JYT A;  4DFP A;  2F8T A;  2YNI A;  4CK1 A;  3RMB A;  1KRP A;  4Y1D A;  4C8K A;  4RW9 A;  3TAM A;  4FLT A;  1CLQ A;  2A1S A;  1VSH A;  2ATQ A;  3QNN A;  3T19 A;  2KFZ A;  1WSG A;  2R7Y A;  3SV3 A;  3NH1 A;  4FLY A;  2ZQB A;  4M41 A;  1RBS A;  4FZX C;  3KD5 E;  4K8Z A;  2G8K A;  1C0M A;  1LAV A;  4FJL A;  1IKV A;  4DS4 A;  4M3X A;  1RBU A;  3QNO A;  5CYQ A;  1VSF A;  2YV0 X;  4CEQ A;  4CJE A;  2I5J A;  3VQE A;  4DSI A;  4FJI A;  3NHG A;  1BI4 B;  5CZ1 A;  2D5R A;  5HBM A;  1XHX A;  4I7F A;  3DMJ A;  2OZS A;  3EYZ A;  4Z4I A;  4KHY A;  1RBR A;  3CFO A;  1MU2 A;  1IKW A;  3KKR A;  3ZT4 A;  4BDZ A;  4KFB A;  3MAQ A;  1HYZ A;  4DLE A;  2HHT A;  1G15 A;  1HMV A;  4YNQ A;  2NUB A;  3AO1 A;  3TWH A;  4M3Z A;  1UA0 A;  3OYH A;  1KLN A;  1VSL A;  1TVR A;  3NF8 A;  4CEB A;  4CF8 A;  4CHY A;  4DWI A;  4Z4E A;  1RDA A;  4LH4 A;  3JSM A;  4PY5 A;  3AVM A;  4B9U A;  3NH2 A;  3AO3 A;  3VA3 A;  1C1B A;  2XHB A;  3V6D A;  3LAL A;  1RT2 A;  4M3R A;  1S1T A;  2KTQ A;  1LV5 A;  3V1Q A;  3OYA A;  3PY8 A;  3TAF A;  3CG7 A;  1NKC A;  4OJR A;  3HK2 A;  4F3T A;  4O0I A;  4FCY A;  2HHW A;  3L2W A;  3V81 A;  1S6P A;  3K5M A;  5KRT A;  3SQ1 A;  1TV6 A;  4W5R A;  3ZT3 A;  4E7I A;  4CGH A;  2ETJ A;  1JXB A;  3VQC A;  4BE1 A;  1S9G A;  1YVU A;  4CF2 A;  4DTP A;  1KSP A;  4WE1 A;  1S1V A;  4ZTJ A;  3MEC A;  1T05 A;  3KIO A;  1EX4 A;  5I3U A;  3I0S A;  1JXE A;  3ZT0 A;  3SQ2 A;  4FJ8 A;  4KHU A;  3DRP A;  3OYK A;  5CZ2 A;  4KHW A;  2GV9 A;  4LY7 A;  3OS2 A;  2WON A;  3TAE A;  2BGG A;  4I2P A;  3OYC A;  5SZT A;  1NK0 A;  3AVI A;  2JLE A;  5KRS A;  1U45 A;  1RDB A;  3LWL A;  1SL1 A;  4Y1C A;  4KRE A;  3SPZ A;  1EXQ A;  1KVA A;  1VSE A;  3OS1 A;  2AJQ A;  2F8S A;  4CGF A;  4E1M A;  3DLB A;  2YNH A;  3KK3 A;  4NCB A;  4FVM A;  4KHS A;  4NCA A;  1B92 A;  3DI6 A;  3VQQ A;  2GBZ A;  1HJR A;  2D0A A;  1RT4 A;  4CJR A;  4DSL A;  4IFY A;  1RNH A;  2P5G A;  3HO1 A;  1RT1 A;  3AVN A;  2A1R A;  1XC9 A;  1IO2 A;  3HP9 A;  3TAR A;  3ZSR A;  3HVR A;  1D9D A;  1C6V A;  1N6Q A;  3M8R A;  2IC3 A;  4OGE A;  4W5O A;  1ZBU A;  4IBN A;  3RMA A;  4I2Q A;  4BE2 A;  4BDP A;  3LDS A;  4FK0 A;  2Z1H A;  4M3W A;  1I3A A;  4FJ9 A;  4B8A B;  3UIQ A;  1Y97 A;  4H8K A;  3ZSX A;  1DLO A;  3ALY A;  3LZJ A;  4DTN A;  1NOY A;  3BDP A;  4FJH A;  4CJP A;  4DSJ A;  4FZY A;  1RDD A;  4ELV A;  1QQC A;  3O3F A;  4RW6 A;  3SV4 A;  2YKN A;  4B9L A;  4KPY A;  2OZM A;  4AHU A;  3CFP A;  4O44 A;  4GW6 A;  4IKF A;  4LSN A;  1N5Y A;  5FRN A;  3V4I A;  1KFD A;  4CJU A;  5HRR A;  4N56 A;  4FK2 A;  4NCG A;  1L5U A;  3AO2 A;  5DMR A;  4UQG A;  3ISN C;  4DFK A;  3QEP A;  4RW8 A;  1ZBL A;  4KTQ A;  1UA1 A;  3TI0 A;  3TAB A;  3MEG A;  1RT6 A;  1KFS A;  2P51 A;  4IFV A;  4DSE A;  1KCF A;  1RCH A;  1WSI A;  3HPG A;  3LAM A;  1J9A A;  4M3U A;  1L3V A;  4O5B A;  3LZI A;  4DTJ A;  1JLC A;  3WNG A;  2FBV A;  3ZSW A;  1NK8 A;  1JLA A;  2X74 A;  3OJU A;  3K57 A;  4FZZ A;  4CIG A;  4AIL C;  1JKH A;  3C6U A;  2LSN A;  2VWK A;  4B9T A;  3M8S A;  4K8X A;  2W42 A;  1GOB A;  4KB1 A;  4M42 A;  3ZSO A;  1JLQ A;  1SKS A;  4F2S A;  3AA2 A;  1ASW A;  3I0R A;  1C0T A;  3MXM A;  1U4B A;  3QIN A;  4EZ9 A;  3P5J A;  3SQ4 A;  1HRH A;  2YNF A;  2XY7 A;  3SQ0 A;  1WAF A;  2KZZ A;  4FLZ A;  3LP1 A;  4CER A;  4CES A;  4E7L A;  5K14 A;  2HMI A;  4CEZ A;  4XIU A;  3KJV A;  3L2Q A;  3DLK A;  3KK2 A;  4E7J A;  4DTR A;  4CJV A;  3U3Y A;  2XRI A;  4C8O A;  4N5S A;  4BAC A;  4CFD A;  2HHU A;  1Z26 A;  3S3M A;  4KO0 A;  1GOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...