4HVJA

Crystal structure of a putative uncharacterized protein from mycobacterium tuberculosis in complex with amp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
160
structure length
156
Chain Sequence
SMVRYFYDTEFIEDGHTIELISIGVVAEDGREYYAVSTEFDPERAGSWVRTHVLPKLPPPASQLWRSRQQIRLDLEEFLRIDGTDSIELWAWVGAYDHVALCQLWGPMTALPPTVPRFTRELRQLWEDRGCPRMPPVHDALVDARDQLRRFRLITS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycobacterium tuberculosis Rv2179c Protein Establishes a New Exoribonuclease Family with Broad Phylogenetic Distribution.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
total genus 52
structure length 156
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4hvjA00
3LZIA 1C6VA 4CK1A 3AVIA 4Z4FA 1W0HA 2VWKA 3DLKA 3O3GA 1C0MA 2KFZA 1BIZA 3ZCMA 3AO3A 2Z1GA 3VQ4A 4FJ7A 2OZSA 4FJ9A 4CGDA 1DLOA 5FRMA 3VQCA 4DQRA 1NOYA 4DTJA 3CG7A 2X74A 4H4MA 4CJLA 3RRGA 4FJIA 2RPIA 2YNIA 3MXIA 1U04A 1Q9YA 3AA3A 3SCXA 3TAPA 4KI6A 4Y1CA 1VRUA 4F3OA 4DTMA 4B9SA 3V81A 4FK0A 4KB0A 1HYZA 3HO1A 1XWLA 1HRHA 4DTXA 3EYZA 3OYKA 4DG1A 3AO2A 4Q5VA 1TAQA 3IRXA 3V9XA 1QSLA 2HHTA 3NCIA 2YV0X 1X9WA 4K8XA 3V1RA 1ASUA 3K5NA 2HMIA 4AHRA 3MXMA 5HRRA 3SV3A 1BCOA 2HHWA 4BDZA 4CK2A 4DTSA 4FVMA 4IFVA 4CIGA 2P1JA 3KD5E 4FZXC 3CM5A 3RR7A 3QLHA 4JS5A 4FJGA 1WSEA 1QSYA 1TKDA 3OYJA 3G0ZA 3L3UA 4KO0A 3KLIA 3VQPA 4FLXA 1BQMA 3KLFA 2E4LA 3ASMA 4CE9A 3O4NA 4KTQA 4CJFA 3PO4A 4FZYA 4J2EA 1W9HA 1LAVA 3DRRA 2GUIA 1EETA 2ATQA 3OYCA 3QEWA 3UIQA 4Y1DA 4NCAA 4FJMA 5J2QA 3SPYA 4KREA 4KFBA 3V1OA 3P1GA 5HRNA 4B8CA 3KLHA 2XO7A 4HCBA 4K8ZA 1IKWA 3DYAA 3AVNA 3VQ9A 2DTUA 3DI6A 3AVMA 2EHGA 5JS2A 4CHQA 2B6AA 1VSMA 1VSDA 1NK8A 3AVGA 4IBNA 4Z0UA 4CEFA 2DFHA 4FK2A 4BE1A 4BWJA 1REVA 2IOCA 4CJKA 4ELTA 1TVRA 1RT6A 1WLJA 2QK9A 3HSTB 3ULDA 1C1BA 1Z25A 4AHCA 2DY4A 2FBYA 4WE1A 2XRIA 3L8BA 4DS4A 1RDAA 4PA1A 3U6FA 3SQ4A 2P5OA 4PY5A 4W5NA 4OLBA 2B4JA 3MEGA 3C94A 4CJ5A 4E7KA 1WAJA 3ZT3A 1TKTA 1J5OA 1HNVA 2HW3A 4KRFA 3V9SA 3KLEA 3L3VA 4B9LA 2G8WA 3HJFA 2FBXA 2HNZA 1QTMA 3PX6A 1L3UA 4EZ9A 3DM2A 1S9GA 2Y1JA 3AO4A 2HHVA 4FJNA 4DTNA 1S6PA 2I5JA 2YNFA 4AILC 3K5MA 1IH7A 3MEDA 1ZBUA 4Z4HA 4DTUA 4FJXA 4E1MA 5CZ2A 4I9LA 3SUOA 3DLBA 1VK0A 3VQ8A 4JLHA 2YKMA 4ELUA 3DLGA 1X9SA 3SUQA 3IS9A 3DLHA 4CEQA 3QERA 4DU4A 4M3WA 3OYAA 1A5XA 3L2VA 3ISNC 2KFNA 3JSMA 4C8OA 1JL2A 3OYDA 4DQSA 2QKBA 1S1TA 3P83D 2KW4A 4E19A 4CF0A 1IG9A 4FLVA 3ALYA 4O0JA 1S1UA 3OYLA 1WSIA 3PV8A 4DFJA 3MXJA 3L2WA 3QESA 4N76A 1EXQA 4CEBA 1DTTA 3KK2A 4NCBA 3VQBA 2XY8A 3K2PA 5CYQA 4EZ6A 1N5YA 4PUOA 4CFBA 1BIUA 3M8QA 4KPYA 1TK5A 5C24A 3TANA 4QAGA 4W5TA 4HHTA 1WAFA 4FK4A 1XI1A 1WN7A 2KQ2A 4DQQA 2XY7A 4CJVA 2F8TA 1UA0A 1KFSA 4W5OA 4Z4CA 4LD0A 3ZSOA 1NK6A 1HYSA 1T03A 1ZYQA 3VQQA 3K5OA 3NF9A 2KTQA 1RTHA 4M3RA 3ZT4A 4BACA 2HVHA 1SV5A 5I42A 1HJRA 2YNGA 4CJRA 1ZBLA 3LAMA 1NK4A 2PZSA 1JL1A 5FDLA 3ZSRA 1QE1A 4KKOA 1RT3A 4ICLA 1RTJA 4C8MA 1RDCA 4H4OA 1NOZA 1ITGA 4NYFA 4MQ3A 3TAGA 1BCMA 4G1QA 4KAZA 3SV4A 2D5RA 1LWEA 2IDOA 2RN2A 4F4KA 4ELVA 4HVJA 4R5PA 4N41A 2Y1IA 3S3OA 2JGUA 4DTOA 1U48A 2O4GA 1S1VA 1VSJA 3SUNA 2WOMA 5KRTA 1JLAA 3OYBA 3SUPA 4O5BA 2YNHA 3TARA 1I3AA 4KTWA 4MFBA 1GOAA 4B9UA 3OVNA 3ZT0A 2HHUA 1NK9A 5C25A 4RW9A 4CHYA 4M42A 1U4BA 3LP2A 2Z1JA 2XY6A 1FKPA 3NFAA 4M3XA 4FM0A 1VRTA 4RW8A 5HLFA 4I7FA 4KHUA 3QO9A 3WNEA 3DRSA 3LP3A 4OVLA 2PY5A 1WSGA 4M3ZA 4CF8A 3OYEA 2FBVA 4ZTFA 1KVCA 3V6DA 1RT7A 1VSHA 4LSNA 2D0CA 4FJKA 3AVJA 3V9ZA 3DMJA 1S6QA 2VG7A 1B9DA 3I0RA 3AVAA 1NJWA 4CJEA 3VA3A 1HMVA 3SQ1A 2YHBA 1RDDA 1VSFA 1QHTA 5CYMA 4ID1A 3VQAA 3SYZA 2X6NA 4CJ4A 4FW1A 3VQ5A 1GOCA 4GW6A 2IAJA 4FLUA 4FCYA 4IG3A 3BDPA 5J1EA 2BANA 3AO1A 4KHYA 3OYIA 4QOZB 3QIOA 2KZMA 4M3UA 4HUFA 1RILA 2Q3SA 1ASVA 3E01A 3JYTA 4HCCA 3F9KA 1IKVA 1KLMA 1J9AA 3TR8A 3VQEA 4CJPA 1SKSA 3AVLA 3NF6A 4DSJA 1RT1A 1RBRA 3AO5A 4GVMA 3RTVA 1TL1A 5CZ1A 1RT2A 4IDKA 4XIUA 2KZZA 1Q8IA 1RTDA 1RBVA 3OJUA 3LDSA 3RWUA 3QEPA 1J54A 4IG0A 4FM2A 4O0IA 3LANA 4OGCA 3VQDA 3NH2A 5HP1A 1YT3A 1SL2A 1GOBA 3HL8A 5JS1A 4CHOA 1QQCA 3QEIA 1KRPA 4CEEA 3OY9A 2P5GA 4DF4A 2X78A 1Z26A 2PYJA 2WONA 1RTIA 1K6YA 3O3HA 4J2BA 1NJYA 3QIPA 3DOKA 1IKYA 4CF2A 3T3FA 3OS0A 3I8DA 1KFDA 3H08A 1CXQA 1ASWA 1S5JA 2Z1HA 4NYNA 1TV6A 2QXFA 4E7IA 1YTAA 4O44A 3DOLA 3SQ2A 2FC0A 3QEXA 3PUFA 2G8IA 4H8KA 3WNGA 2HB5A 3OS1A 3OYMA 4DFMA 1Q9XA 1O1WA 4KV8A 2OPPA 4C8NA 3PX0A 1I39A 5D3GA 2D0AA 3NF7A 4CHNA 3SQ0A 3HP6A 1KLNA 4TSXA 3AA4A 5FRNA 5T7BA 4DFPA 1C1CA 1RNHA 4BE0A 4CEAA 3OYGA 1NJZA 1D8YA 3RMAA 4M41A 4FZZA 4N56A 4DF8A 3RRHA 2G8HA 3RR8A 1CLQA 1IO2A 2RKIA 1VSKA 4DTPA 4KB1A 1RT4A 3KTQA 5SZTA 3NF8A 4DWIA 3HYFA 3KIOA 3LZJA 2DFEA 2YHAA 3QINA 1HYVA 3TAQA 3QEVA 1JLCA 4J2DA 1JXBA 1JLBA 1WSHA 2G8VA 2B5JA 4RW6A 1EP4A 1LW0A 1N6QA 4F2RA 5SWMA 2XY5A 5J2PA 4M45A 3V1QA 2G8FA 3K5LA 2ETJA 3KD1E 3CFPA 3D45A 1BI4A 3S3MA 1X1PA 2BDPA 1NK0A 3KK1A 4L8RB 5J2MA 4CGFA 3NAEA 4CIEA 1J53A 1C0TA 4FJHA 4CFDA 1XC9A 3AVKA 4PQUA 4LH4A 4LSLA 1ZBFA 3C6UA 4ZTJA 2X6SA 3K57A 1U45A 3LP0A 3OYNA 3L2RA 1KTQA 4F8RA 1KCFA 4B08A 4Q0BA 4DFKA 4QCLA 3M8SA 3WNFA 3AA5X 2ZD1A 4UQGA 4FLYA 1WSJA 3AVBA 4HUGA 1LV5A 4C8LA 2HHQA 3MAQA 3LPTA 1JLFA 3OS2A 1NJXA 4FLWA 1UWBA 4CGGA 4B8AB 4FXDA 3V9WA 4CJSA 1TK0A 4C8KA 2O4IA 3DRPA 2XHBA 3TAEA 4FJ5A 3EZ5A 2PYLA 4RG8A 3T19A 1RDBA 4GMJB 4W5QA 4DLGA 4E89A 3O4QA 3G10A 4DSFA 1T7PA 1IKXA 4J2AA 3HPHA 1RBUA 4KI4A 2E6LA 3SNNA 3NH0A 2E6MA 4EP5A 2VWJA 1S1WA 4KHQA 4F3TA 3ZSYA 1S9EA 3TWHA 4DQPA 4KHWA 2GBZA 2OA8A 2HNYA 4O55A 3SJJA 1EX4A 3ZSXA 3HPOA 3K59A 1UA1A 2HNDA 4I2PA 3ZSQA 4HUEA 4KHNA 1SUQA 3ITHA 3M8PA 4BDYA 5HRSA 5KRSA 1FK9A 4RW4A 3LWLA 3F73A 4LY7A 5CY4A 4M3TA 4CFCA 2D0BA 3L2UA 5KGXA 5KTQA 5C42A 3NE6A 3QETA 3HK2A 1LAWA 1QS4A 4CEOA 1D9DA 1U49A 4OPJA 1L3VA 4CJUA 4DTRA 2JLEA 1L3TA 4AHTA 4DS5A 4E7HA 4OKEA 3LAKA 1G15A 5KGWA 3LP1A 2DFFA 2VG5A 1WNSA 4CEZA 1TGOA 4B9NA 2OYQA 3NDKA 4E3SA 2EX3A 1A5WA 2YKNA 4DSKA 4DSLA 1JKHA 4M3YA 4CJQA 4AH9A 3KKSA 4NCGA 1QSSA 2AJQA 5KI6A 3V9UA 1NK5A 3C6TA 3PO5A 1BHLA 3ZSZA 3RMCA 1BL3A 2G8UA 1XHXA 1UOCA 4CEDA 4JRPA 4OJRA 2ZE2A 2F8SA 3VN5A 1CXUA 1HNIA 5J2NA 1ZBHA 2A1SA 2QKKA 3PX4A 1CZ9A 1WSFA 3S9HA 1MU2A 4CGJA 3SI6A 1TAUA 1A5VA 1D5AA 3RMBA 3KJVA 4AHUA 4W5RA 1X9MA 5FROA 1TK8A 5DMRA 1KSPA 3THVA 4DQIA 1VSLA 2ZQBA 4DU3A 1B9FA 4E7JA 4N47A 4IKFA 2HHSA 1C0UA 2BE2A 3T1AA 2OZMA 1Y97A 2LSNA 4CIFA 3NHGA 5HBMA 3IG1A 3HT3A 4F2SA 1VSEA 2FBTA 4B9VA 3HVRA 2P51A 5HRPA 1ZBIA 3MECA 1BI4B 4B3OA 3SZ2A 1U47A 1L3SA 1TKXA 3B6OA 4OKJA 1C1AA 1YTUA 1LWCA 3ZT1A 3KLGA 1LWFA 4JRQA 1TKZA 3FFIA 3HM9A 4E0DA 3AVFA 3HP9A 5K14A 4AHVA 3NGIA 4FLTA 3V4IA 1BISA 3AV9A 3BGRA 4ID5A 4CERA 4PWDA 5DK5A 3HVTA 2F96A 4YFUA 2RF2A 1JLQA 3U3YA 4Z4GA 4E1NA 3NBPA 3OYHA 3TI0A 3IAYA 1T8EA 4DLEA 4OPKA 3CFOA 2OPSA 1DTQA 2Z1IA 4FJJA 4CECA 4EP4A 2G8KA 1RCHA 4CHZA 3QNOA 3WNHA 4CHPA 4CGIA 5EU7A 3M8RA 4I9QA 3LALA 3CM6A 3DLEA 4N5SA 4CGHA 4CJWA 3DLRA 2NUBA 3EY1A 4CF9A 1BGXT 1T05A 1SL0A 3PY8A 2HVIA 3A2FA 4DSIA 1UAXA 3LWMA 3AVCA 4DU1A 4HTUA 4FJ8A 4Z4IA 3RMDA 1KVAA 4ZHRA 2IS3A 3U3GA 3ZSWA 3S3NA 1BQNA 2W42A 2ITGA 3CQ8A 4BDPA 4CJ3A 3VA0A 3MEEA 1JLEA 1L5UA 1D9FA 4KHSA 1RBSA 1LW2A 2GV9A 1HPZA 5I3UA 3D0PA 1NK7A 3P5JA 1HQEA 2OPRA 3I0SA 5HROA 1XHZA 3VQ7A 1SKWA 4CK3A 1R0AA 4CJTA 3ZSVA 3L2QA 2HHXA 3TAMA 4OGEA 4FLZA 4FM1A 4DSEA 4E7LA 4B9MA 3AA2A 3NH1A 3QNNA 4CCHA 4OKKA 1NKBA 4BE2A 5E41A 4FJLA 3VQ6A 4I2QA 3TABA 4BWMA 1SKRA 3KK3A 2OPQA 3KKRA 4CF1A 3LPUA 1B92A 3B6PA 4Z4EA 1TL3A 1FKOA 4JS4A 3TAFA 3HXMA 3C95A 2IC3A 4CFAA 1JLGA 1S1XA 4RW7A 2IGIA 4FYDA 1FXXA 4AHSA 1NKEA 4YNQA 3NGYA 2A1RA 1CZBA 1VSIA 4FW2A 2R7YA 1SL1A 1HQUA 3NGZA 3OYFA 3O3FA 2BGGA 2VG6A 4B9TA 1JXEA 3CYMA 1F21A 3K58A 3HPGA 4CESA 1EKEA 3OJSA 1NKCA 1RT5A 1RBTA 3SPZA 1KVBA 3ZT2A 1YVUA 4LH5A 4O4GA 4DMNA 4KTZA 3CFRA 4OLAA 3AVHA 4IFYA
chains in the Genus database with same CATH superfamily
3MMVA 2VWKA 3DLKA 3O3GA 2D0OA 3VF4A 1BIZA 5B8HA 3ZCMA 3CQYA 4FJ7A 1X3MA 4CGDA 1DLOA 5FRMA 4XH4A 4DQRA 4DTJA 3DXKA 4CJLA 4H4MA 4JK8A 4BR7A 5C12A 2RPIA 4C1NI 1U04A 3TAPA 3C7NB 4CZMA 4F3OA 3FFKB 3V81A 4FK0A 2QWNA 5BPMA 3OYKA 4DG1A 3IRXA 3A5MC 4IZ9A 3PSFA 1X9WA 2HMIA 3SV3A 4BDZA 4CK2A 4FVMA 4IFVA 5F2RA 3CM5A 3ATUA 3QLHA 4MDBA 3OYJA 3F9MA 3KLIA 2E4LA 1XMOK 1YHQN 1NMNA 3PO4A 1N32K 2P9IA 4J2EA 3AY9A 3OYCA 2GUIA 3DRRA 1EETA 4BGBA 4Y1DA 4NCAA 1KD1O 5EVZA 4KREA 3P1GA 1ZXOA 4HCBA 4WFNL 3AVNA 2UUCK 2F4VK 4OPAA 2EHGA 2GEMA 3AVGA 4IBNA 4M7XA 4FWSA 3GOIA 3LDLA 1LOTB 4BE1A 2OTJN 4CJKA 2QK9A 3ULDA 1DKGD 3VEYA 1BA0A 4WE1A 4XEIA 3THYB 4DS4A 1RDAA 4PA1A 3U6FA 3CCRN 3JXUA 2P5OA 4W5NA 3CC2N 4CJ5A 4BR2A 5FPNA 3ZT3A 3MK6A 1J5OA 5BRHA 2E2QA 1OH7A 3CJBA 4B9LA 3HJFA 3DM2A 3VPZA 3RSEA 4AILC 5JVHL 1IH7A 3MEDA 1ZBUA 4Z4HA 1O13A 3CJCA 3VQ8A 4IOCL 2FF3B 3DLGA 1SQKA 1X9SA 3DLHA 1E3MA 3WXMB 4M3WA 3L2VA 3O6WA 3VTIA 4C8OA 5FPDA 4FSVA 1S1TA 1VQLN 3KHYA 2KW4A 4CF0A 1IG9A 2ASPA 4O0JA 1S1UA 3VESA 3D2FA 5AQXA 3PV8A 3QESA 4G9ZA 4N76A 4CEBA 1QQMA 4IOAL 3CJAA 3O9TA 5CYQA 2P9SA 4PUOA 2P9UA 1BIUA 3KWIA 4HWIA 4MLHA 1WAFA 4BRKA 1WN7A 4IO8A 2F8TA 4Z4CA 3OBWA 3CD6N 3DXKB 4FOEA 4H5RA 1RTHA 4NLBA 2HVHA 1HJRA 2D0PA 5FDLA 1HLUA 1QE1A 4KKOA 3ZSRA 4CBUA 4C8MA 1C0FA 3AGRA 1NOZA 1S72N 2QW9A 3QFUA 3F2KA 2IDOA 4HTLA 4BR5A 3S3OA 3FLCO 1U48A 2O4GA 4K41A 5KRTA 3G25A 4K42A 1I3AA 2Q0UA 3OVNA 3ZT0A 5C25A 4CHYA 2XY6A 1QQNA 4FM0A 1U2VB 5A2QO 3E66A 4B1VA 4JKGA 4MO4A 4DUZK 2GWJA 4H0VB 2D0CA 2P9NB 4XH5A 1B9DA 2E1ZA 3I0RA 1GLJO 3AVAA 3LM2A 1VSFA 5CYMA 2X6NA 4GW6A 2V51B 4IG3A 3SMSA 1J6ZA 5J1EA 5GIPA 2BANA 4RWTA 1QVGM 4HUFA 1ASVA 3H3OB 5AQPA 2YJEA 4DR7K 4MO5A 2ZJPL 3VQEA 4R79A 1SKSA 1J9AA 4OLBA 1RTDA 3OJUA 3LDSA 3QEPA 4FVUA 4IG0A 4FM2A 2F9WA 3LANA 4OGCA 3VQDA 4CW7B 3NH2A 3HL8A 4CHOA 4CEEA 3OY9A 2P5GA 3R8EA 3O3HA 1NJYA 2IIRA 4CF2A 4YDUC 3OS0A 3I8DA 2O8CA 3H08A 1CXQA 4DR5K 3SQ2A 5JLHA 4CZGA 2G8IA 3OS1A 3PX0A 2D0AA 3VEXA 3PIOL 2ZF5O 4TSXA 5TKWA 3THWA 4CEAA 1D8YA 4DF8A 5AZIB 1CLQA 4YOTA 2RKIA 4KB1A 2E2PA 2DPNA 3I8BA 3R9PA 2O8FB 3QEVA 1N8RO 2HBMA 1EP4A 3EE8A 4M45A 3HOTA 2UXCK 3OBYA 1X1PA 4CIEA 3MN5A 1J53A 1XC9A 4DB3A 1U45A 4K0KK 3LP0A 4DFKA 5HL7L 1OVQA 3TSUA 2E20A 3EKSA 2ZD1A 1EQYA 3IMXA 2HHQA 3MAQA 1NJXA 4FLWA 1UWBA 4FXDA 3V9WA 1M1KO 3EO3A 3EZ5A 3T19A 1RDBA 4DSFA 4E89A 5AZJA 4EP5A 1U2VA 1K8AO 4KHQA 1S9EA 1DT9A 3QBXA 3SJJA 1UA1A 4JKHA 4QS9A 3K59A 2HNDA 3ITHA 4JYAK 5HRSA 5KRSA 4RW4A 3VGLA 3F73A 5CY4A 5BREA 3QETA 3NE6A 4DUYK 3HK2A 5AQIA 4H03B 1GLBG 1RDUA 4OKEA 1G15A 5F0XA 3LP1A 2VG5A 1WNSA 4DSKA 4E3SA 1VQ6N 4NCGA 5KI6A 2O8EB 4BRNA 3UE5A 4CEDA 1ILYA 5DM6L 1HNIA 2WTUA 3PX4A 4KH4A 3SI6A 1TAUA 1D5AA 3KJVA 1KSPA 5DMRA 1VSLA 4JK7A 1C0UA 3HSCA 1NU0A 1SAZA 4A2BA 5HBMA 3HI0A 3O4WA 2O8CB 4EFHA 3FE1A 2FBTA 4B9VA 2P51A 5HRPA 3MECA 4B3OA 1TKXA 4JKAA 1NNEA 3ZT1A 1LWFA 5AQRA 3CERA 4EHTA 4DV0K 3HP9A 5K14A 4FLTA 2NNWA 3THWB 4ID5A 4PWDA 1XC3A 2F96A 4YFUA 3THYA 3ZEUA 1JLQA 3U3YA 4H0YB 4E1NA 3NBPA 3OYHA 1CZAN 4FWLA 4DLEA 3I33A 2W6LA 4EP4A 3C6AA 3P38A 4CGIA 3SAFA 3O80A 4CJWA 4DV6K 3TTCA 1T05A 5GAEP 4IDHA 4CZEA 4DSIA 1UAXA 4K43A 4HTUA 3VEVA 1KVAA 2KKZA 2I7PA 1OH5A 2ITGA 3CQ8A 3VA0A 1MWKA 1LW2A 5I3UA 1NK7A 2OPRA 3I0SA 5AQUA 3LDNA 4DR2K 4CK3A 3WT0A 3ZSVA 1YVNA 5AQYA 4OGEA 4A61A 4OKKA 1HUXA 1NM1A 3GL1A 5E41A 2W40A 1SKRA 5AQLA 2RE2A 2OPQA 4CF1A 4PKGA 3B6PA 2BH1A 3EZWA 3MN9A 4FWRA 3TAFA 4RW7A 3VEOA 1FXXA 3DAWA 4YNQA 5BN8A 5EXWA 4JD2A 1CZBA 2VQEK 1VSIA 1RFQA 3O3FA 2VG6A 1JXEA 4FWPA 1F21A 2QWPA 3K58A 1VQ7N 1NKCA 3Q7CA 4JI5K 4LH5A 1YJNN 1S22A 3CFRA 4OLAA 3AVHA 4FPBA 3LZIA 1NJIO 4Z4FA 1XNRK 1C0MA 1LCUA 3AO3A 4PHTX 4BR9A 5TKYA 2OZSA 4FJ9A 1NGDA 3CHWA 2X74A 2E8AA 4FJIA 2YNIA 2O8EA 3DXMB 4KI6A 4Y1CA 4DTMA 4B9SA 3HO1A 1XWLA 1HRHA 4KHPK 5CR4A 3V9XA 2HHTA 2YV0X 1ASUA 4AHRA 5I9EB 1BCOA 4A57A 4DTSA 4FZXC 2P1JA 4FJGA 1QSYA 4GKKK 3G0ZA 3L3UA 4KO0A 3SLCA 4DV5K 1E4GT 3MCPA 2QEXN 4KTQA 3TSQA 3HBTA 4BRDA 4CD3A 4CJFA 4K25A 1W9HA 1LAVA 2ATQA 1ZC6A 1EWQA 4FJMA 5J2QA 5AQFA 3U9ZA 3KLHA 4GVEA 2XO7A 4K8ZA 3VQ9A 1W2BM 3BZCA 4JKDA 3AVMA 2B6AA 1VSMA 1BOTO 1HX1A 5JMVA 4BRMA 1REVA 2IOCA 4BY9C 5LY3A 1W97L 1C1BA 2NLXA 3CJ7A 4IJNA 3CXCM 3ZLJA 2VYPA 4PY5A 1KC8O 3T7ZA 2PFUA 4LF9K 2V7YA 1WAJA 4EAHD 2HW3A 4KRFA 3IKMA 2BTFA 2HBLA 2G8WA 4H0OA 1K73O 1L3UA 5AQJA 2Y1JA 4EZ9A 3AO4A 1S6PA 2P9PB 3K5MA 4JHDB 4E1MA 3SUOA 2WFBA 1VK0A 5H1SQ 2Q1NA 3ULEA 2HBJA 4CEQA 1A5XA 4WQ5C 1GLLO 3JSMA 1JL2A 4DQSA 3H1VX 4H5WA 4E19A 4JD2B 4CZIA 4FLVA 3OYLA 5C2DA 3L2WA 1WB9A 2XY8A 3K2PA 1HNZK 3MDQA 3DLLL 3OTOK 2NRWA 4QAGA 3HTVA 3N4QA 4DQQA 3SJHA 4CJVA 4FWNA 1UA0A 4LD0A 3ZSOA 1T03A 3NF9A 2KTQA 1NBWA 3ZT4A 2CH5A 1SV5A 1TYQA 4C1NK 2P9IB 4CJRA 3LAMA 4X64K 1HPMA 1RT3A 4ICLA 1NGBA 5AQQA 4PL7A 1ITGA 3HZ6A 2D5RA 4F4KA 4HVJA 5ADXA 2Y1IA 1S1VA 3SUNA 2ASOA 4KTWA 4MFBA 1MWMA 4LFCK 4B1XB 1GLFO 3LP2A 2Z1JA 3WQUA 1FKPA 3NFAA 1GLAG 1JCFA 3GE1A 4EHUA 4KHUA 5AZIA 2PY5A 2A42A 4BVOA 3OYEA 2FBVA 1KVCA 3V6DA 1RT7A 1VSHA 3J7YP 4FJKA 2F9TA 3AVJA 1S6QA 4FWQA 4A62A 1HMVA 3SQ1A 2YHBA 1RDDA 3VQAA 4ID1A 4FW1A 3VQ5A 2UYTA 1GOCA 2UXDK 5GAHP 4FCYA 3BDPA 4QOZB 4FWMA 4M3UA 4IOXA 3D6RA 4M7YA 3E01A 1M90O 4HCCA 3F9KA 1IKVA 4BRCA 4DSJA 3AVLA 5M1QA 1RT2A 4YOWA 4XIUA 1Q8IA 3RWUA 5HP1A 1SL2A 5JS1A 3QEIA 2QWOA 4GV9A 4GV3A 3W3DA 1YJ9N 1NGAA 5EOYA 1ASWA 1S5JA 1TV6A 4YORA 1YTAA 4E7IA 3ULEB 2W41A 3MCAB 4DFMA 3CC7N 5D3GA 1O1WA 2WC9A 1I39A 4ILHA 1KLNA 1EWRA 3ZETB 1HKBA 5T7BA 2P9PA 3RMAA 4FZZA 2JWKA 3RR8A 4X62K 1IO2A 5AQVA 4CZFA 3BY5A 4DTPA 2O8DA 2QWLA 1RT4A 2QWMA 3KTQA 3UKRB 4DWIA 3H6EA 3HYFA 3LZJA 2DFEA 1ESVA 1HYVA 1JXBA 5C0YA 2JWLA 2G8VA 2B5JA 1LW0A 1QQOA 2XY5A 3V1QA 4B1YB 1VQNN 4I6MA 1BI4A 2BDPA 3K9KA 4L8RB 5J2MA 4CFDA 1FW6A 4PQUA 4NO7A 2P9NA 2ZGYA 3ID8A 2ZM6K 4ZTJA 2X6SA 3QFPA 3L2RA 1KTQA 4QCLA 3O9QA 2A40A 3K0SA 3MX2A 4UQGA 4HUGA 4LF7K 3OS2A 3O1BA 4B8AB 2UUAK 2GTDA 3M3ZA 4DV7K 2HF3A 2XHBA 5AQWA 3CCMN 3TAEA 4FJ5A 2PYLA 4RG8A 3TTFA 4W5QA 2QKBA 5JLFA 4JKEA 4J2AA 3HPHA 1RBUA 2E6MA 2VWJA 1VQ5N 1S1WA 4F3TA 2FSJA 5EY4A 3ZSXA 2NRXA 4I2PA 4BRFA 5BPLA 4HUEA 1SUQA 4BDYA 1FK9A 5BR9A 3E9OA 2ZGZA 3M5RA 4CFCA 2D0BA 3L2UA 3CIPA 5KGXA 4X65K 5C42A 3S41A 4KBOA 1LAWA 1U49A 4OPJA 4H5TA 4U7BA 1L3VA 4DTRA 4AHTA 2AP1A 3LAKA 1OH8A 2DFFA 1WOQA 1TGOA 2V52B 2EX3A 1A5WA 2YKNA 4BC5A 4IO9L 1KAYA 4JV5K 3KKSA 1QSSA 1P90A 4RTFD 1YITN 4IEEA 3V9UA 1NK5A 3ZSZA 2G8UA 1UOCA 4JRPA 4OJRA 2ZE2A 4JI2K 3WXJA 4DR1K 2F8SA 4H0XB 3VN5A 1NGCA 3O9RA 4PKHA 1YXQA 2A1SA 2QKKA 4FWKA 1CZ9A 1WSFA 4BQZA 3S9HA 4CBXA 4CGJA 4B3MK 3J7AP 4W5RA 5KPZA 3CPEA 2ZQBA 2P9LA 1XNQK 2BE2A 1BUPA 1Q81O 2OZMA 2LSNA 4CIFA 1VSEA 3WEEB 1Q18A 3QICA 3HVRA 4CZKA 1NWKA 2E5LK 1RGIA 3SZ2A 3B6OA 3H45C 1C1AA 3N4PA 1LWCA 1TKZA 4AHVA 3V4IA 3BGRA 3VGKA 4IXCA 4JI8K 4Z4GA 2P9KA 1SZ2A 3IAYA 4OPKA 3CFOA 2YI1A 2Z1IA 1MA9B 4CECA 2G8KA 1RCHA 4CHZA 3QNOA 3LDOA 3G4SN 4CHPA 3UB5A 4N5SA 4UY8O 4A2AA 4BC2A 1SL0A 2HVIA 3A2FA 4FJ8A 2IVOA 4H5VA 3U3GA 4YY3K 1VHXA 4CJ3A 3MEEA 1L5UA 2H3GX 4KHSA 1HPZA 1HQEA 1XHZA 4LC9B 1R0AA 4CJTA 3L2QA 2HHXA 4FLZA 3AA2A 4BE2A 4I2QA 1GLDG 3KK3A 4BRQA 1R59O 3LPUA 4DR6K 1FKOA 4LFBK 3KVGA 1U6ZA 4CZJA 4DV3K 4AHSA 1NKEA 2A1RA 2R7YA 1BO5O 1VQ4N 3NGZA 2BGGA 3EKUA 4PL8A 5KPRA 1BU6O 1EKEA 3CCSN 3OW2M 1E4FT 3VEZA 1KVBA 1OVYA 3ZT2A 2A3ZA 4DMNA 4KTZA 3RSEB 4F2SA 2W6KA 1C6VA 4CK1A 2KFZA 1W0HA 4BC4A 3VQCA 5GINA 3SCXA 3ENHA 3CI5A 4JI4K 1VRUA 2QI2A 3ZEUB 1HYZA 3ZX2A 3GDQA 4Q5VA 3NCIA 3V1RA 1T3VA 1T6CA 3IDHA 5HRRA 5M1PA 2HHWA 3WQTA 4CIGA 3RR7A 3TU5A 1WSEA 4EIAA 4DQ8A 2QTDA 3HOSA 3ASMA 3THXA 4CE9A 3QBWA 1T44A 3UIQA 4WYBA 2P9UB 4E1JA 3C65A 3SPYA 4B3TK 3V1OA 5HRNA 4B8CA 5BPNA 1IKWA 3A5NC 3U9DA 5JS2A 4JN4A 4CHQA 1VSDA 4Z0UA 4CEFA 2DFHA 4FK2A 4QS7A 4ELTA 1WLJA 5KQ8A 1YF5L 3HSTB 1Z25A 2XRIA 2V7ZA 3D2EB 3F5TA 3AGKA 3C94A 3J8AA 3ENBA 3BP8A 1HNVA 4PKIA 3KLEA 2GELA 4DV1K 1BDGA 2FBXA 2HNZA 3C7NA 3PX6A 2HHVA 3LDPA 4FJNA 2YNFA 4WQ4A 2WUSA 2NRZA 5FPEA 4FJXA 2O8DB 4I9LA 4MDAA 3ZX3A 4ELUA 3LL3A 3SUQA 3QERA 4DU4A 3ISNC 2KFNA 2E88A 3P83D 2UU9K 3ZX0A 4DR4K 2UXBK 1NMDA 4WQ4C 2NRVA 1KXPA 5C2FA 4DFJA 1EXQA 3VQBA 3FGUA 4KPYA 5AQZA 4W5TA 4HHTA 1YI2N 1XI1A 4C23A 1KFSA 3LM9A 4BQLA 1HYSA 1NK6A 1TUUA 1ZYQA 2A41A 4BRIA 4V19S 3VQQA 3K5OA 4M3RA 2YHWA 3FZHA 2YNGA 4BR0A 4H4OA 1K8KA 3TAGA 1BCMA 4AM7A 5KQDA 4CZLA 2JGUA 4DTOA 3OYBA 5AQSA 4O5BA 3TARA 1GOAA 5LMNK 2HHUA 5E84A 4BREA 3ATVA 4IWVA 4M3XA 4AF1A 5HLFA 1HKGA 3WNEA 3DRSA 3LP3A 1WSGA 3IFRA 4NB4A 5ELZA 3UKRA 1NG9A 3V9ZA 3DMJA 3QDKA 2E1YA 4GKJK 1NJWA 3MN7A 3EL2A 1XQSC 2F7TA 4BRLA 4FPAA 4FLUA 2E2NA 4JEPA 3AAPA 3AO1A 3CCVN 3BF3A 3OYIA 2KZMA 3VTHA 2E2OA 1RILA 3IUCA 2FLOA 1KLMA 4CJPA 3TR8A 3D2EA 1RT1A 1RBRA 3AO5A 4IDKA 2KZZA 2VGNA 3HM8A 1J54A 4O0IA 4XH1A 2FF6A 1YT3A 3BF1A 4YOVA 4DF4A 1TUYA 1QVFM 2PYJA 2WONA 1RTIA 4J2BA 3JAMO 3QIPA 4BG9A 3T3FA 1OH6A 1KFDA 4NLCA 3VENA 4NYNA 2QXFA 3CQXA 3PUFA 2AA4A 4B9QA 4H8KA 4IFEA 3WNGA 3OYMA 4KV8A 4C8NA 1XMQK 3ID6A 5FRNA 3HP6A 3AA4A 1DEJA 5AR0A 1C1CA 1NJZA 2P9KB 1Z05A 2G8HA 3Q7BA 4A5AA 5JVGL 5SZTA 3KIOA 2YHAA 2VGMA 1JLCA 4J2DA 1JLBA 4RW6A 1N6QA 4F2RA 5SWMA 5FPMA 5J2PA 2PBDA 3VMFB 2G8FA 4OO1J 2ETJA 3KD1E 3D45A 3S3MA 1NK0A 3KK1A 1MDUB 4JKGB 1C0TA 4FJHA 3AVKA 5IWAK 4LSLA 1ZBFA 3BEXA 3TPQA 3K57A 1KCFA 3DJCA 5M1OA 3M8SA 3WNFA 3AA5X 4FLYA 1WSJA 1LV5A 4C8LA 3CCQN 3KK7A 3LPTA 1JLFA 3UKUB 1VQON 4CGGA 3SBTA 2QWQA 4CBWA 1TK0A 3EN9A 1Q7YO 4GMJB 5AQMA 3O4QA 5LMUK 4BVPA 5LL6Z 1IBLK 3TWHA 4YOXA 4DQPA 3HRGA 3H1QA 2HNYA 4O55A 5AQNA 1EX4A 3L0QA 3HPOA 3G6EN 4OX9K 3M8PA 5C15A 5KTQA 4CVNE 3SAGA 3MWPA 4CEOA 1VQ9N 3C6HA 2WBNA 4CJUA 2JLEA 4ILGB 1L3TA 4E7HA 5KGWA 5FLXO 4B9NA 3NDKA 4DSLA 4M3YA 4IEIA 1JKHA 1SS6A 1K9MO 4CJQA 4AH9A 2AJQA 3CF5L 2O8FA 1VQPN 3PO5A 1BHLA 3G71N 3RMCA 1NGEA 2Q2RA 1XHXA 3OHRA 1CXUA 4GY2B 5J2NA 1MU2A 1ATNA 3EE9A 3RMBA 5FROA 4DQIA 2YCHA 4E7JA 4JI0K 4N47A 3U8XA 1HNWK 4CD1A 1Y97A 4DR3K 2OANA 5GAGP 3NHGA 3T69A 4YDUA 4I6MB 4JKBA 4OKJA 4JRQA 3L6QA 3AVFA 1BISA 4CERA 5DK5A 4BRAA 2RF2A 4Z94A 3I55N 2HMPA 1NGGA 4M63C 5KPTA 4F9OA 2Q36A 4FJJA 1VQKN 5EU7A 4I9QA 2QA4N 3CM6A 2YX6A 4KH6A 4CGHA 2NUBA 3EY1A 4CF9A 1BGXT 3A5OC 3PY8A 4LFAK 4CI6A 1W7AA 3AVCA 4DU1A 4Z4IA 4A59A 4ZHRA 3ZSWA 3S3NA 1BQNA 3H46O 3BZKA 2W42A 3GG4A 3P4IA 1JLEA 1D9FA 2GV9A 3TTDA 2J4RA 1KQSM 4FOIA 3D0PA 3P5JA 1SKWA 5HROA 3QB0A 5HOOA 3O9SA 3TAMA 5LJVA 4FM1A 4E7LA 3E9PA 4B3SK 3NH1A 3QNNA 1NKBA 3UKUA 4FJLA 3VQ6A 3TABA 5ADXH 2Q0RA 4Z4EA 1B92A 4H5NA 3CCEN 1TL3A 3L4QA 4H0TB 4JS4A 3HXMA 2IC3A 3E1YA 5AQOA 3PSIA 3NGYA 1SL1A 3OYFA 1RT5A 3VGMA 1RBTA 3T1HK 3K9JA 4O4GA 1WBBA 1RTJA 3AVIA 4JHDA 3MX5A 1YIJN 2GWKA 3A0IX 3OA9A 2Z1GA 3VQ4A 4DCHA 1Z6RA 1NOYA 2ITMA 3CG7A 3RRGA 2GUPA 3MXIA 4AQYK 1Q9YA 3AA3A 1XUPO 1V4TA 2YHXA 5MLCQ 4KB0A 4CZHA 3RVCA 4DTXA 3EYZA 3AO2A 1TAQA 2ZJQL 1QSLA 3WXIA 4K8XA 2VWBA 3K5NA 1ATSA 3WXLA 3MXMA 5EX5A 4YOUA 2QWRA 3KD5E 4JS5A 1TKDA 3VQPA 2Q97A 4BROA 4FLXA 1BQMA 2RHKA 4L3QA 3KLFA 4B3RK 1X3NA 5M1KA 1IJJA 3O4NA 5AFUA 3SMPA 2HOEA 1TYQB 4FZYA 4NXNK 2CGKA 3QEWA 3R6MA 1FJGK 1HNXK 4KFBA 3CJ9A 2DTUA 3DYAA 3DI6A 3C0BA 1NK8A 3R1XA 5GADP 3WUHA 3PIPL 4BWJA 1YUWA 3WXKA 1TVRA 1RT6A 4AHCA 3CMAN 2DY4A 2FBYA 3GBTA 3L8BA 2HSTA 2OCEA 3DWLA 3SQ4A 2B4JA 3MEGA 2ZJRL 3BUZB 5BRFA 4WCEL 4E7KA 1TKTA 3I56N 4DHYA 3FZLA 2FSKA 1IG8A 3V9SA 2O8BB 3L3VA 1T6DA 4DV2K 4LF6K 1QTMA 4JI3K 1S9GA 4DTNA 2I5JA 4DTUA 5CZ2A 3O1WA 5AJ3K 3DLBA 4JLHA 2YKMA 4WQ5A 2YHYA 3IS9A 4DKWA 1JCEA 4JI1K 2NRHA 4QS8A 3OYAA 3CJ1A 4LF4K 3OYDA 1QZ5A 1IBMK 1JCGA 3DXMA 4ISFA 1NGFA 3VERA 3ALYA 4Y0WA 1WSIA 3MXJA 1NGHA 1BA1A 1DTTA 3KK2A 4NCBA 2QM1A 4EZ6A 1N5YA 3AAQA 4CFBA 3J7ZO 3M8QA 3U4LA 1TK5A 5C24A 3TANA 3LDQA 2KLAA 4FK4A 2KQ2A 2XY7A 3PLAA 4W5OA 3FZKA 3THXB 3CCJN 1P8ZA 4BACA 1NGJA 5I42A 1ZBLA 1NK4A 2PZSA 1JL1A 2EWSA 1Y64A 3T1YK 1RDCA 5AQKA 4NYFA 4MQ3A 1NLVA 4G1QA 4KAZA 4JKFA 3SV4A 1LWEA 2RN2A 4ELVA 5M1FA 4R5PA 3EEQA 4N41A 1S3XA 1VSJA 2WOMA 1JLAA 3SUPA 2YNHA 1EO1A 4B9UA 1QHAA 4FO0A 3VF2A 1NK9A 4RW9A 4M42A 5BR8K 1U4BA 1VRTA 4RW8A 4I7FA 3QO9A 4OVLA 4M3ZA 1X9JA 4BRHA 4CF8A 1V4SA 2FXUA 2I7NA 4ZTFA 4LSNA 3VEWA 4B1ZA 2VG7A 1GLCG 1VQMN 4ISEA 3SBGA 4CJEA 4H0PA 3VA3A 1QHTA 3SYZA 3D2FB 4CJ4A 2NZTA 2KHOA 4ISGA 2IAJA 4AM6A 3KZBA 4KHYA 2HBKA 3QIOA 2HF4A 1WUAA 2NRTA 2Q3SA 5GIOA 3O08A 1ATRA 3JYTA 5M1NA 5CHIA 3O9UA 3CC4N 3NF6A 3RTVA 3R3LA 4GVMA 1TL1A 5CZ1A 1RBVA 5BRDA 1G99A 1GOBA 2D1KA 4LF5K 1QQCA 1HJOA 3M1FA 2CGJA 1KRPA 2X78A 1Z26A 1K6YA 4FL9A 3DOKA 1IKYA 4B1WB 3SAHA 1DGKN 2Z1HA 4JAXA 4O44A 3DOLA 2FC0A 4KH5A 3QEXA 4WF9L 1Q9XA 2HB5A 1YJWN 1WBDA 2OPPA 1HKCA 3NF7A 4CHNA 3SQ0A 4A5BA 4DFPA 4BE0A 1RNHA 3OYGA 2PAVA 4YOYA 4M41A 4N56A 3RRHA 4ILJA 1VSKA 1K8KB 1KAXA 2VCPA 3ENOA 3AARA 4CJ7A 1QZ6A 3NF8A 4NXMK 4O5FA 2BUPA 4JNEA 3QINA 3SK3A 3TAQA 4BC3A 1WSHA 5C10A 4JI6K 3ZYYX 4BGAA 3VETA 3K5LA 3CFPA 4CGFA 3NAEA 3E9LA 3D7EO 4LH4A 2P9SB 3NVKA 3C6UA 4Q0BA 3OYNA 4F8RA 2Q31A 4MLEA 4B08A 4OPHA 3P39A 3J80O 1C0GA 3A8YA 3AVBA 1IV0A 3WEEA 4CJSA 5AQHA 4WFBL 4C8KA 2O4IA 3DRPA 5F1XA 1NGIA 2VQFK 3CCUN 1N34K 1JJ2M 4DLGA 3G10A 1IKXA 4KI4A 2E6LA 3SNNA 3NH0A 1HR0K 3ZSYA 4JKCA 1BG3A 1H1VA 2YJFA 4KHWA 2GBZA 2OA8A 3TSPA 1T7PA 3ZSQA 4KHNA 3LWLA 4M3TA 4LY7A 5BN9A 3J81O 1VQ8N 5LJWA 1QS4A 1D9DA 2OTLN 1YAGA 4DS5A 1VAZA 5AQTA 4U67L 2CGLA 2OYQA 4CEZA 1BWFO 4FWOA 3H3NO 4JK9A 3FZFA 1BL3A 3ZETA 2UUBK 4GV6A 4B1UB 1ZBHA 5DM7L 3P31A 1N36K 1A5VA 1Q86O 5AQGA 4AHUA 1X9MA 1TK8A 3O8MA 3THVA 4J8FA 4DU3A 1B9FA 4JI7K 4IKFA 2HHSA 2ASMA 3T1AA 2ZWHA 3IG1A 3HT3A 1ZBSA 3JS6A 2IVNA 2D4WA 2A5XA 1ZBIA 1BI4B 1U47A 3VF6A 1L3SA 3CMEN 1YTUA 2CH6A 4LF8K 3KLGA 1J5EK 3FFIA 3HM9A 5CE3A 4E0DA 3NGIA 3AV9A 3HVTA 4BRPA 3TI0A 1T8EA 3QMLA 4X66K 3A5LC 2OPSA 1DTQA 1OKJA 3VOVA 3FZMA 3CPWM 4IJAA 3WNHA 2O8BA 2A6AA 4O8UA 3M8RA 3LALA 3MWTA 3DLEA 3DLRA 3LWMA 3B8AX 3KWGA 1IBKK 3RMDA 2IS3A 2QXLA 3M6GA 3CCLN 4BDPA 3CETA 2IVPA 4YHHK 1RBSA 2NRRA 4GNIA 3VQ7A 4WFAL 4BR4A 2FSNA 4BG8A 1I94K 4DSEA 4B9MA 5JICA 1N33K 5E26A 4CCHA 3O5BA 4BWMA 4RCHA 2HHHK 3KKRA 2P9LB 3C95A 4CFAA 1JLGA 1S1XA 4FYDA 2IGIA 1D4XA 5AZJB 5IT9O 4O8KA 4FW2A 1GLEG 3MN6A 2GX9A 1HQUA 1RDWX 3FR0A 3NMUA 4B9TA 3CYMA 4BRGA 3W0LA 5AFUH 3HPGA 1Q82O 4CESA 3L4IA 3OJSA 3NVMA 4DV4K 3SPZA 1KAZA 1YVUA 3C6TA 4IFYA
chains in the Genus database with same CATH topology
3LZIA 1C6VA 4CK1A 3AVIA 4Z4FA 1W0HA 2VWKA 3DLKA 3O3GA 1C0MA 2KFZA 1BIZA 3ZCMA 3AO3A 2Z1GA 3VQ4A 4FJ7A 2OZSA 4FJ9A 4CGDA 1DLOA 5FRMA 3VQCA 4DQRA 1NOYA 4DTJA 3CG7A 2X74A 4H4MA 4CJLA 3RRGA 4FJIA 2RPIA 2YNIA 3MXIA 1U04A 1Q9YA 3AA3A 3SCXA 3TAPA 4KI6A 4Y1CA 1VRUA 4F3OA 4DTMA 4B9SA 3V81A 4FK0A 4KB0A 1HYZA 3HO1A 1XWLA 1HRHA 4DTXA 3EYZA 3OYKA 4DG1A 3AO2A 4Q5VA 1TAQA 3IRXA 3V9XA 1QSLA 2HHTA 3NCIA 2YV0X 1X9WA 4K8XA 3V1RA 1ASUA 3K5NA 2HMIA 4AHRA 3MXMA 5HRRA 3SV3A 1BCOA 2HHWA 4BDZA 4CK2A 4DTSA 4FVMA 4IFVA 4CIGA 2P1JA 3KD5E 4FZXC 3CM5A 3RR7A 3QLHA 4JS5A 4FJGA 1WSEA 1QSYA 1TKDA 3OYJA 3G0ZA 3L3UA 4KO0A 3KLIA 3VQPA 4FLXA 1BQMA 3KLFA 2E4LA 3ASMA 4CE9A 3O4NA 4KTQA 4CJFA 3PO4A 4FZYA 4J2EA 1W9HA 1LAVA 3DRRA 2GUIA 1EETA 2ATQA 3OYCA 3QEWA 3UIQA 4Y1DA 4NCAA 4FJMA 5J2QA 3SPYA 4KREA 4KFBA 3V1OA 3P1GA 5HRNA 4B8CA 3KLHA 2XO7A 4HCBA 4K8ZA 1IKWA 3DYAA 3AVNA 3VQ9A 2DTUA 3DI6A 3AVMA 2EHGA 5JS2A 4CHQA 2B6AA 1VSMA 1VSDA 1NK8A 3AVGA 4IBNA 4Z0UA 4CEFA 2DFHA 4FK2A 4BE1A 4BWJA 1REVA 2IOCA 4CJKA 4ELTA 1TVRA 1RT6A 1WLJA 2QK9A 3HSTB 3ULDA 1C1BA 1Z25A 4AHCA 2DY4A 2FBYA 4WE1A 2XRIA 3L8BA 4DS4A 1RDAA 4PA1A 3U6FA 3SQ4A 2P5OA 4PY5A 4W5NA 4OLBA 2B4JA 3MEGA 3C94A 4CJ5A 4E7KA 1WAJA 3ZT3A 1TKTA 1J5OA 1HNVA 2HW3A 4KRFA 3V9SA 3KLEA 3L3VA 4B9LA 2G8WA 3HJFA 2FBXA 2HNZA 1QTMA 3PX6A 1L3UA 4EZ9A 3DM2A 1S9GA 2Y1JA 3AO4A 2HHVA 4FJNA 4DTNA 1S6PA 2I5JA 2YNFA 4AILC 3K5MA 1IH7A 3MEDA 1ZBUA 4Z4HA 4DTUA 4FJXA 4E1MA 5CZ2A 4I9LA 3SUOA 3DLBA 1VK0A 3VQ8A 4JLHA 2YKMA 4ELUA 3DLGA 1X9SA 3SUQA 3IS9A 3DLHA 4CEQA 3QERA 4DU4A 4M3WA 3OYAA 1A5XA 3L2VA 3ISNC 2KFNA 3JSMA 4C8OA 1JL2A 3OYDA 4DQSA 2QKBA 1S1TA 3P83D 2KW4A 4E19A 4CF0A 1IG9A 4FLVA 3ALYA 4O0JA 1S1UA 3OYLA 1WSIA 3PV8A 4DFJA 3MXJA 3L2WA 3QESA 4N76A 1EXQA 4CEBA 1DTTA 3KK2A 4NCBA 3VQBA 2XY8A 3K2PA 5CYQA 4EZ6A 1N5YA 4PUOA 4CFBA 1BIUA 3M8QA 4KPYA 1TK5A 5C24A 3TANA 4QAGA 4W5TA 4HHTA 1WAFA 4FK4A 1XI1A 1WN7A 2KQ2A 4DQQA 2XY7A 4CJVA 2F8TA 1UA0A 1KFSA 4W5OA 4Z4CA 4LD0A 3ZSOA 1NK6A 1HYSA 1T03A 1ZYQA 3VQQA 3K5OA 3NF9A 2KTQA 1RTHA 4M3RA 3ZT4A 4BACA 2HVHA 1SV5A 5I42A 1HJRA 2YNGA 4CJRA 1ZBLA 3LAMA 1NK4A 2PZSA 1JL1A 5FDLA 3ZSRA 1QE1A 4KKOA 1RT3A 4ICLA 1RTJA 4C8MA 1RDCA 4H4OA 1NOZA 1ITGA 4NYFA 4MQ3A 3TAGA 1BCMA 4G1QA 4KAZA 3SV4A 2D5RA 1LWEA 2IDOA 2RN2A 4F4KA 4ELVA 4HVJA 4R5PA 4N41A 2Y1IA 3S3OA 2JGUA 4DTOA 1U48A 2O4GA 1S1VA 1VSJA 3SUNA 2WOMA 5KRTA 1JLAA 3OYBA 3SUPA 4O5BA 2YNHA 3TARA 1I3AA 4KTWA 4MFBA 1GOAA 4B9UA 3OVNA 3ZT0A 2HHUA 1NK9A 5C25A 4RW9A 4CHYA 4M42A 1U4BA 3LP2A 2Z1JA 2XY6A 1FKPA 3NFAA 4M3XA 4FM0A 1VRTA 4RW8A 5HLFA 4I7FA 4KHUA 3QO9A 3WNEA 3DRSA 3LP3A 4OVLA 2PY5A 1WSGA 4M3ZA 4CF8A 3OYEA 2FBVA 4ZTFA 1KVCA 3V6DA 1RT7A 1VSHA 4LSNA 2D0CA 4FJKA 3AVJA 3V9ZA 3DMJA 1S6QA 2VG7A 1B9DA 3I0RA 3AVAA 1NJWA 4CJEA 3VA3A 1HMVA 3SQ1A 2YHBA 1RDDA 1VSFA 1QHTA 5CYMA 4ID1A 3VQAA 3SYZA 2X6NA 4CJ4A 4FW1A 3VQ5A 1GOCA 4GW6A 2IAJA 4FLUA 4FCYA 4IG3A 3BDPA 5J1EA 2BANA 3AO1A 4KHYA 3OYIA 4QOZB 3QIOA 2KZMA 4M3UA 4HUFA 1RILA 2Q3SA 1ASVA 3E01A 3JYTA 4HCCA 3F9KA 1IKVA 1KLMA 1J9AA 3TR8A 3VQEA 4CJPA 1SKSA 3AVLA 3NF6A 4DSJA 1RT1A 1RBRA 3AO5A 4GVMA 3RTVA 1TL1A 5CZ1A 1RT2A 4IDKA 4XIUA 2KZZA 1Q8IA 1RTDA 1RBVA 3OJUA 3LDSA 3RWUA 3QEPA 1J54A 4IG0A 4FM2A 4O0IA 3LANA 4OGCA 3VQDA 3NH2A 5HP1A 1YT3A 1SL2A 1GOBA 3HL8A 5JS1A 4CHOA 1QQCA 3QEIA 1KRPA 4CEEA 3OY9A 2P5GA 4DF4A 2X78A 1Z26A 2PYJA 2WONA 1RTIA 1K6YA 3O3HA 4J2BA 1NJYA 3QIPA 3DOKA 1IKYA 4CF2A 3T3FA 3OS0A 3I8DA 1KFDA 3H08A 1CXQA 1ASWA 1S5JA 2Z1HA 4NYNA 1TV6A 2QXFA 4E7IA 1YTAA 4O44A 3DOLA 3SQ2A 2FC0A 3QEXA 3PUFA 2G8IA 4H8KA 3WNGA 2HB5A 3OS1A 3OYMA 4DFMA 1Q9XA 1O1WA 4KV8A 2OPPA 4C8NA 3PX0A 1I39A 5D3GA 2D0AA 3NF7A 4CHNA 3SQ0A 3HP6A 1KLNA 4TSXA 3AA4A 5FRNA 5T7BA 4DFPA 1C1CA 1RNHA 4BE0A 4CEAA 3OYGA 1NJZA 1D8YA 3RMAA 4M41A 4FZZA 4N56A 4DF8A 3RRHA 2G8HA 3RR8A 1CLQA 1IO2A 2RKIA 1VSKA 4DTPA 4KB1A 1RT4A 3KTQA 5SZTA 3NF8A 4DWIA 3HYFA 3KIOA 3LZJA 2DFEA 2YHAA 3QINA 1HYVA 3TAQA 3QEVA 1JLCA 4J2DA 1JXBA 1JLBA 1WSHA 2G8VA 2B5JA 4RW6A 1EP4A 1LW0A 1N6QA 4F2RA 5SWMA 2XY5A 5J2PA 4M45A 3V1QA 2G8FA 3K5LA 2ETJA 3KD1E 3CFPA 3D45A 1BI4A 3S3MA 1X1PA 2BDPA 1NK0A 3KK1A 4L8RB 5J2MA 4CGFA 3NAEA 4CIEA 1J53A 1C0TA 4FJHA 4CFDA 1XC9A 3AVKA 4PQUA 4LH4A 4LSLA 1ZBFA 3C6UA 4ZTJA 2X6SA 3K57A 1U45A 3LP0A 3OYNA 3L2RA 1KTQA 4F8RA 1KCFA 4B08A 4Q0BA 4DFKA 4QCLA 3M8SA 3WNFA 3AA5X 2ZD1A 4UQGA 4FLYA 1WSJA 3AVBA 4HUGA 1LV5A 4C8LA 2HHQA 3MAQA 3LPTA 1JLFA 3OS2A 1NJXA 4FLWA 1UWBA 4CGGA 4B8AB 4FXDA 3V9WA 4CJSA 1TK0A 4C8KA 2O4IA 3DRPA 2XHBA 3TAEA 4FJ5A 3EZ5A 2PYLA 4RG8A 3T19A 1RDBA 4GMJB 4W5QA 4DLGA 4E89A 3O4QA 3G10A 4DSFA 1T7PA 1IKXA 4J2AA 3HPHA 1RBUA 4KI4A 2E6LA 3SNNA 3NH0A 2E6MA 4EP5A 2VWJA 1S1WA 4KHQA 4F3TA 3ZSYA 1S9EA 3TWHA 4DQPA 4KHWA 2GBZA 2OA8A 2HNYA 4O55A 3SJJA 1EX4A 3ZSXA 3HPOA 3K59A 1UA1A 2HNDA 4I2PA 3ZSQA 4HUEA 4KHNA 1SUQA 3ITHA 3M8PA 4BDYA 5HRSA 5KRSA 1FK9A 4RW4A 3LWLA 3F73A 4LY7A 5CY4A 4M3TA 4CFCA 2D0BA 3L2UA 5KGXA 5KTQA 5C42A 3NE6A 3QETA 3HK2A 1LAWA 1QS4A 4CEOA 1D9DA 1U49A 4OPJA 1L3VA 4CJUA 4DTRA 2JLEA 1L3TA 4AHTA 4DS5A 4E7HA 4OKEA 3LAKA 1G15A 5KGWA 3LP1A 2DFFA 2VG5A 1WNSA 4CEZA 1TGOA 4B9NA 2OYQA 3NDKA 4E3SA 2EX3A 1A5WA 2YKNA 4DSKA 4DSLA 1JKHA 4M3YA 4CJQA 4AH9A 3KKSA 4NCGA 1QSSA 2AJQA 5KI6A 3V9UA 1NK5A 3C6TA 3PO5A 1BHLA 3ZSZA 3RMCA 1BL3A 2G8UA 1XHXA 1UOCA 4CEDA 4JRPA 4OJRA 2ZE2A 2F8SA 3VN5A 1CXUA 1HNIA 5J2NA 1ZBHA 2A1SA 2QKKA 3PX4A 1CZ9A 1WSFA 3S9HA 1MU2A 4CGJA 3SI6A 1TAUA 1A5VA 1D5AA 3RMBA 3KJVA 4AHUA 4W5RA 1X9MA 5FROA 1TK8A 5DMRA 1KSPA 3THVA 4DQIA 1VSLA 2ZQBA 4DU3A 1B9FA 4E7JA 4N47A 4IKFA 2HHSA 1C0UA 2BE2A 3T1AA 2OZMA 1Y97A 2LSNA 4CIFA 3NHGA 5HBMA 3IG1A 3HT3A 4F2SA 1VSEA 2FBTA 4B9VA 3HVRA 2P51A 5HRPA 1ZBIA 3MECA 1BI4B 4B3OA 3SZ2A 1U47A 1L3SA 1TKXA 3B6OA 4OKJA 1C1AA 1YTUA 1LWCA 3ZT1A 3KLGA 1LWFA 4JRQA 1TKZA 3FFIA 3HM9A 4E0DA 3AVFA 3HP9A 5K14A 4AHVA 3NGIA 4FLTA 3V4IA 1BISA 3AV9A 3BGRA 4ID5A 4CERA 4PWDA 5DK5A 3HVTA 2F96A 4YFUA 2RF2A 1JLQA 3U3YA 4Z4GA 4E1NA 3NBPA 3OYHA 3TI0A 3IAYA 1T8EA 4DLEA 4OPKA 3CFOA 2OPSA 1DTQA 2Z1IA 4FJJA 4CECA 4EP4A 2G8KA 1RCHA 4CHZA 3QNOA 3WNHA 4CHPA 4CGIA 5EU7A 3M8RA 4I9QA 3LALA 3CM6A 3DLEA 4N5SA 4CGHA 4CJWA 3DLRA 2NUBA 3EY1A 4CF9A 1BGXT 1T05A 1SL0A 3PY8A 2HVIA 3A2FA 4DSIA 1UAXA 3LWMA 3AVCA 4DU1A 4HTUA 4FJ8A 4Z4IA 3RMDA 1KVAA 4ZHRA 2IS3A 3U3GA 3ZSWA 3S3NA 1BQNA 2W42A 2ITGA 3CQ8A 4BDPA 4CJ3A 3VA0A 3MEEA 1JLEA 1L5UA 1D9FA 4KHSA 1RBSA 1LW2A 2GV9A 1HPZA 5I3UA 3D0PA 1NK7A 3P5JA 1HQEA 2OPRA 3I0SA 5HROA 1XHZA 3VQ7A 1SKWA 4CK3A 1R0AA 4CJTA 3ZSVA 3L2QA 2HHXA 3TAMA 4OGEA 4FLZA 4FM1A 4DSEA 4E7LA 4B9MA 3AA2A 3NH1A 3QNNA 4CCHA 4OKKA 1NKBA 4BE2A 5E41A 4FJLA 3VQ6A 4I2QA 3TABA 4BWMA 1SKRA 3KK3A 2OPQA 3KKRA 4CF1A 3LPUA 1B92A 3B6PA 4Z4EA 1TL3A 1FKOA 4JS4A 3TAFA 3HXMA 3C95A 2IC3A 4CFAA 1JLGA 1S1XA 4RW7A 2IGIA 4FYDA 1FXXA 4AHSA 1NKEA 4YNQA 3NGYA 2A1RA 1CZBA 1VSIA 4FW2A 2R7YA 1SL1A 1HQUA 3NGZA 3OYFA 3O3FA 2BGGA 2VG6A 4B9TA 1JXEA 3CYMA 1F21A 3K58A 3HPGA 4CESA 1EKEA 3OJSA 1NKCA 1RT5A 1RBTA 3SPZA 1KVBA 3ZT2A 1YVUA 4LH5A 4O4GA 4DMNA 4KTZA 3CFRA 4OLAA 3AVHA 4IFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LZI A;  1C6V A;  4CK1 A;  3AVI A;  4Z4F A;  1W0H A;  2VWK A;  3DLK A;  3O3G A;  1C0M A;  2KFZ A;  1BIZ A;  3ZCM A;  3AO3 A;  2Z1G A;  3VQ4 A;  4FJ7 A;  2OZS A;  4FJ9 A;  4CGD A;  1DLO A;  5FRM A;  3VQC A;  4DQR A;  1NOY A;  4DTJ A;  3CG7 A;  2X74 A;  4H4M A;  4CJL A;  3RRG A;  4FJI A;  2RPI A;  2YNI A;  3MXI A;  1U04 A;  1Q9Y A;  3AA3 A;  3SCX A;  3TAP A;  4KI6 A;  4Y1C A;  1VRU A;  4F3O A;  4DTM A;  4B9S A;  3V81 A;  4FK0 A;  4KB0 A;  1HYZ A;  3HO1 A;  1XWL A;  1HRH A;  4DTX A;  3EYZ A;  3OYK A;  4DG1 A;  3AO2 A;  4Q5V A;  1TAQ A;  3IRX A;  3V9X A;  1QSL A;  2HHT A;  3NCI A;  2YV0 X;  1X9W A;  4K8X A;  3V1R A;  1ASU A;  3K5N A;  2HMI A;  4AHR A;  3MXM A;  5HRR A;  3SV3 A;  1BCO A;  2HHW A;  4BDZ A;  4CK2 A;  4DTS A;  4FVM A;  4IFV A;  4CIG A;  2P1J A;  3KD5 E;  4FZX C;  3CM5 A;  3RR7 A;  3QLH A;  4JS5 A;  4FJG A;  1WSE A;  1QSY A;  1TKD A;  3OYJ A;  3G0Z A;  3L3U A;  4KO0 A;  3KLI A;  3VQP A;  4FLX A;  1BQM A;  3KLF A;  2E4L A;  3ASM A;  4CE9 A;  3O4N A;  4KTQ A;  4CJF A;  3PO4 A;  4FZY A;  4J2E A;  1W9H A;  1LAV A;  3DRR A;  2GUI A;  1EET A;  2ATQ A;  3OYC A;  3QEW A;  3UIQ A;  4Y1D A;  4NCA A;  4FJM A;  5J2Q A;  3SPY A;  4KRE A;  4KFB A;  3V1O A;  3P1G A;  5HRN A;  4B8C A;  3KLH A;  2XO7 A;  4HCB A;  4K8Z A;  1IKW A;  3DYA A;  3AVN A;  3VQ9 A;  2DTU A;  3DI6 A;  3AVM A;  2EHG A;  5JS2 A;  4CHQ A;  2B6A A;  1VSM A;  1VSD A;  1NK8 A;  3AVG A;  4IBN A;  4Z0U A;  4CEF A;  2DFH A;  4FK2 A;  4BE1 A;  4BWJ A;  1REV A;  2IOC A;  4CJK A;  4ELT A;  1TVR A;  1RT6 A;  1WLJ A;  2QK9 A;  3HST B;  3ULD A;  1C1B A;  1Z25 A;  4AHC A;  2DY4 A;  2FBY A;  4WE1 A;  2XRI A;  3L8B A;  4DS4 A;  1RDA A;  4PA1 A;  3U6F A;  3SQ4 A;  2P5O A;  4PY5 A;  4W5N A;  4OLB A;  2B4J A;  3MEG A;  3C94 A;  4CJ5 A;  4E7K A;  1WAJ A;  3ZT3 A;  1TKT A;  1J5O A;  1HNV A;  2HW3 A;  4KRF A;  3V9S A;  3KLE A;  3L3V A;  4B9L A;  2G8W A;  3HJF A;  2FBX A;  2HNZ A;  1QTM A;  3PX6 A;  1L3U A;  4EZ9 A;  3DM2 A;  1S9G A;  2Y1J A;  3AO4 A;  2HHV A;  4FJN A;  4DTN A;  1S6P A;  2I5J A;  2YNF A;  4AIL C;  3K5M A;  1IH7 A;  3MED A;  1ZBU A;  4Z4H A;  4DTU A;  4FJX A;  4E1M A;  5CZ2 A;  4I9L A;  3SUO A;  3DLB A;  1VK0 A;  3VQ8 A;  4JLH A;  2YKM A;  4ELU A;  3DLG A;  1X9S A;  3SUQ A;  3IS9 A;  3DLH A;  4CEQ A;  3QER A;  4DU4 A;  4M3W A;  3OYA A;  1A5X A;  3L2V A;  3ISN C;  2KFN A;  3JSM A;  4C8O A;  1JL2 A;  3OYD A;  4DQS A;  2QKB A;  1S1T A;  3P83 D;  2KW4 A;  4E19 A;  4CF0 A;  1IG9 A;  4FLV A;  3ALY A;  4O0J A;  1S1U A;  3OYL A;  1WSI A;  3PV8 A;  4DFJ A;  3MXJ A;  3L2W A;  3QES A;  4N76 A;  1EXQ A;  4CEB A;  1DTT A;  3KK2 A;  4NCB A;  3VQB A;  2XY8 A;  3K2P A;  5CYQ A;  4EZ6 A;  1N5Y A;  4PUO A;  4CFB A;  1BIU A;  3M8Q A;  4KPY A;  1TK5 A;  5C24 A;  3TAN A;  4QAG A;  4W5T A;  4HHT A;  1WAF A;  4FK4 A;  1XI1 A;  1WN7 A;  2KQ2 A;  4DQQ A;  2XY7 A;  4CJV A;  2F8T A;  1UA0 A;  1KFS A;  4W5O A;  4Z4C A;  4LD0 A;  3ZSO A;  1NK6 A;  1HYS A;  1T03 A;  1ZYQ A;  3VQQ A;  3K5O A;  3NF9 A;  2KTQ A;  1RTH A;  4M3R A;  3ZT4 A;  4BAC A;  2HVH A;  1SV5 A;  5I42 A;  1HJR A;  2YNG A;  4CJR A;  1ZBL A;  3LAM A;  1NK4 A;  2PZS A;  1JL1 A;  5FDL A;  3ZSR A;  1QE1 A;  4KKO A;  1RT3 A;  4ICL A;  1RTJ A;  4C8M A;  1RDC A;  4H4O A;  1NOZ A;  1ITG A;  4NYF A;  4MQ3 A;  3TAG A;  1BCM A;  4G1Q A;  4KAZ A;  3SV4 A;  2D5R A;  1LWE A;  2IDO A;  2RN2 A;  4F4K A;  4ELV A;  4HVJ A;  4R5P A;  4N41 A;  2Y1I A;  3S3O A;  2JGU A;  4DTO A;  1U48 A;  2O4G A;  1S1V A;  1VSJ A;  3SUN A;  2WOM A;  5KRT A;  1JLA A;  3OYB A;  3SUP A;  4O5B A;  2YNH A;  3TAR A;  1I3A A;  4KTW A;  4MFB A;  1GOA A;  4B9U A;  3OVN A;  3ZT0 A;  2HHU A;  1NK9 A;  5C25 A;  4RW9 A;  4CHY A;  4M42 A;  1U4B A;  3LP2 A;  2Z1J A;  2XY6 A;  1FKP A;  3NFA A;  4M3X A;  4FM0 A;  1VRT A;  4RW8 A;  5HLF A;  4I7F A;  4KHU A;  3QO9 A;  3WNE A;  3DRS A;  3LP3 A;  4OVL A;  2PY5 A;  1WSG A;  4M3Z A;  4CF8 A;  3OYE A;  2FBV A;  4ZTF A;  1KVC A;  3V6D A;  1RT7 A;  1VSH A;  4LSN A;  2D0C A;  4FJK A;  3AVJ A;  3V9Z A;  3DMJ A;  1S6Q A;  2VG7 A;  1B9D A;  3I0R A;  3AVA A;  1NJW A;  4CJE A;  3VA3 A;  1HMV A;  3SQ1 A;  2YHB A;  1RDD A;  1VSF A;  1QHT A;  5CYM A;  4ID1 A;  3VQA A;  3SYZ A;  2X6N A;  4CJ4 A;  4FW1 A;  3VQ5 A;  1GOC A;  4GW6 A;  2IAJ A;  4FLU A;  4FCY A;  4IG3 A;  3BDP A;  5J1E A;  2BAN A;  3AO1 A;  4KHY A;  3OYI A;  4QOZ B;  3QIO A;  2KZM A;  4M3U A;  4HUF A;  1RIL A;  2Q3S A;  1ASV A;  3E01 A;  3JYT A;  4HCC A;  3F9K A;  1IKV A;  1KLM A;  1J9A A;  3TR8 A;  3VQE A;  4CJP A;  1SKS A;  3AVL A;  3NF6 A;  4DSJ A;  1RT1 A;  1RBR A;  3AO5 A;  4GVM A;  3RTV A;  1TL1 A;  5CZ1 A;  1RT2 A;  4IDK A;  4XIU A;  2KZZ A;  1Q8I A;  1RTD A;  1RBV A;  3OJU A;  3LDS A;  3RWU A;  3QEP A;  1J54 A;  4IG0 A;  4FM2 A;  4O0I A;  3LAN A;  4OGC A;  3VQD A;  3NH2 A;  5HP1 A;  1YT3 A;  1SL2 A;  1GOB A;  3HL8 A;  5JS1 A;  4CHO A;  1QQC A;  3QEI A;  1KRP A;  4CEE A;  3OY9 A;  2P5G A;  4DF4 A;  2X78 A;  1Z26 A;  2PYJ A;  2WON A;  1RTI A;  1K6Y A;  3O3H A;  4J2B A;  1NJY A;  3QIP A;  3DOK A;  1IKY A;  4CF2 A;  3T3F A;  3OS0 A;  3I8D A;  1KFD A;  3H08 A;  1CXQ A;  1ASW A;  1S5J A;  2Z1H A;  4NYN A;  1TV6 A;  2QXF A;  4E7I A;  1YTA A;  4O44 A;  3DOL A;  3SQ2 A;  2FC0 A;  3QEX A;  3PUF A;  2G8I A;  4H8K A;  3WNG A;  2HB5 A;  3OS1 A;  3OYM A;  4DFM A;  1Q9X A;  1O1W A;  4KV8 A;  2OPP A;  4C8N A;  3PX0 A;  1I39 A;  5D3G A;  2D0A A;  3NF7 A;  4CHN A;  3SQ0 A;  3HP6 A;  1KLN A;  4TSX A;  3AA4 A;  5FRN A;  5T7B A;  4DFP A;  1C1C A;  1RNH A;  4BE0 A;  4CEA A;  3OYG A;  1NJZ A;  1D8Y A;  3RMA A;  4M41 A;  4FZZ A;  4N56 A;  4DF8 A;  3RRH A;  2G8H A;  3RR8 A;  1CLQ A;  1IO2 A;  2RKI A;  1VSK A;  4DTP A;  4KB1 A;  1RT4 A;  3KTQ A;  5SZT A;  3NF8 A;  4DWI A;  3HYF A;  3KIO A;  3LZJ A;  2DFE A;  2YHA A;  3QIN A;  1HYV A;  3TAQ A;  3QEV A;  1JLC A;  4J2D A;  1JXB A;  1JLB A;  1WSH A;  2G8V A;  2B5J A;  4RW6 A;  1EP4 A;  1LW0 A;  1N6Q A;  4F2R A;  5SWM A;  2XY5 A;  5J2P A;  4M45 A;  3V1Q A;  2G8F A;  3K5L A;  2ETJ A;  3KD1 E;  3CFP A;  3D45 A;  1BI4 A;  3S3M A;  1X1P A;  2BDP A;  1NK0 A;  3KK1 A;  4L8R B;  5J2M A;  4CGF A;  3NAE A;  4CIE A;  1J53 A;  1C0T A;  4FJH A;  4CFD A;  1XC9 A;  3AVK A;  4PQU A;  4LH4 A;  4LSL A;  1ZBF A;  3C6U A;  4ZTJ A;  2X6S A;  3K57 A;  1U45 A;  3LP0 A;  3OYN A;  3L2R A;  1KTQ A;  4F8R A;  1KCF A;  4B08 A;  4Q0B A;  4DFK A;  4QCL A;  3M8S A;  3WNF A;  3AA5 X;  2ZD1 A;  4UQG A;  4FLY A;  1WSJ A;  3AVB A;  4HUG A;  1LV5 A;  4C8L A;  2HHQ A;  3MAQ A;  3LPT A;  1JLF A;  3OS2 A;  1NJX A;  4FLW A;  1UWB A;  4CGG A;  4B8A B;  4FXD A;  3V9W A;  4CJS A;  1TK0 A;  4C8K A;  2O4I A;  3DRP A;  2XHB A;  3TAE A;  4FJ5 A;  3EZ5 A;  2PYL A;  4RG8 A;  3T19 A;  1RDB A;  4GMJ B;  4W5Q A;  4DLG A;  4E89 A;  3O4Q A;  3G10 A;  4DSF A;  1T7P A;  1IKX A;  4J2A A;  3HPH A;  1RBU A;  4KI4 A;  2E6L A;  3SNN A;  3NH0 A;  2E6M A;  4EP5 A;  2VWJ A;  1S1W A;  4KHQ A;  4F3T A;  3ZSY A;  1S9E A;  3TWH A;  4DQP A;  4KHW A;  2GBZ A;  2OA8 A;  2HNY A;  4O55 A;  3SJJ A;  1EX4 A;  3ZSX A;  3HPO A;  3K59 A;  1UA1 A;  2HND A;  4I2P A;  3ZSQ A;  4HUE A;  4KHN A;  1SUQ A;  3ITH A;  3M8P A;  4BDY A;  5HRS A;  5KRS A;  1FK9 A;  4RW4 A;  3LWL A;  3F73 A;  4LY7 A;  5CY4 A;  4M3T A;  4CFC A;  2D0B A;  3L2U A;  5KGX A;  5KTQ A;  5C42 A;  3NE6 A;  3QET A;  3HK2 A;  1LAW A;  1QS4 A;  4CEO A;  1D9D A;  1U49 A;  4OPJ A;  1L3V A;  4CJU A;  4DTR A;  2JLE A;  1L3T A;  4AHT A;  4DS5 A;  4E7H A;  4OKE A;  3LAK A;  1G15 A;  5KGW A;  3LP1 A;  2DFF A;  2VG5 A;  1WNS A;  4CEZ A;  1TGO A;  4B9N A;  2OYQ A;  3NDK A;  4E3S A;  2EX3 A;  1A5W A;  2YKN A;  4DSK A;  4DSL A;  1JKH A;  4M3Y A;  4CJQ A;  4AH9 A;  3KKS A;  4NCG A;  1QSS A;  2AJQ A;  5KI6 A;  3V9U A;  1NK5 A;  3C6T A;  3PO5 A;  1BHL A;  3ZSZ A;  3RMC A;  1BL3 A;  2G8U A;  1XHX A;  1UOC A;  4CED A;  4JRP A;  4OJR A;  2ZE2 A;  2F8S A;  3VN5 A;  1CXU A;  1HNI A;  5J2N A;  1ZBH A;  2A1S A;  2QKK A;  3PX4 A;  1CZ9 A;  1WSF A;  3S9H A;  1MU2 A;  4CGJ A;  3SI6 A;  1TAU A;  1A5V A;  1D5A A;  3RMB A;  3KJV A;  4AHU A;  4W5R A;  1X9M A;  5FRO A;  1TK8 A;  5DMR A;  1KSP A;  3THV A;  4DQI A;  1VSL A;  2ZQB A;  4DU3 A;  1B9F A;  4E7J A;  4N47 A;  4IKF A;  2HHS A;  1C0U A;  2BE2 A;  3T1A A;  2OZM A;  1Y97 A;  2LSN A;  4CIF A;  3NHG A;  5HBM A;  3IG1 A;  3HT3 A;  4F2S A;  1VSE A;  2FBT A;  4B9V A;  3HVR A;  2P51 A;  5HRP A;  1ZBI A;  3MEC A;  1BI4 B;  4B3O A;  3SZ2 A;  1U47 A;  1L3S A;  1TKX A;  3B6O A;  4OKJ A;  1C1A A;  1YTU A;  1LWC A;  3ZT1 A;  3KLG A;  1LWF A;  4JRQ A;  1TKZ A;  3FFI A;  3HM9 A;  4E0D A;  3AVF A;  3HP9 A;  5K14 A;  4AHV A;  3NGI A;  4FLT A;  3V4I A;  1BIS A;  3AV9 A;  3BGR A;  4ID5 A;  4CER A;  4PWD A;  5DK5 A;  3HVT A;  2F96 A;  4YFU A;  2RF2 A;  1JLQ A;  3U3Y A;  4Z4G A;  4E1N A;  3NBP A;  3OYH A;  3TI0 A;  3IAY A;  1T8E A;  4DLE A;  4OPK A;  3CFO A;  2OPS A;  1DTQ A;  2Z1I A;  4FJJ A;  4CEC A;  4EP4 A;  2G8K A;  1RCH A;  4CHZ A;  3QNO A;  3WNH A;  4CHP A;  4CGI A;  5EU7 A;  3M8R A;  4I9Q A;  3LAL A;  3CM6 A;  3DLE A;  4N5S A;  4CGH A;  4CJW A;  3DLR A;  2NUB A;  3EY1 A;  4CF9 A;  1BGX T;  1T05 A;  1SL0 A;  3PY8 A;  2HVI A;  3A2F A;  4DSI A;  1UAX A;  3LWM A;  3AVC A;  4DU1 A;  4HTU A;  4FJ8 A;  4Z4I A;  3RMD A;  1KVA A;  4ZHR A;  2IS3 A;  3U3G A;  3ZSW A;  3S3N A;  1BQN A;  2W42 A;  2ITG A;  3CQ8 A;  4BDP A;  4CJ3 A;  3VA0 A;  3MEE A;  1JLE A;  1L5U A;  1D9F A;  4KHS A;  1RBS A;  1LW2 A;  2GV9 A;  1HPZ A;  5I3U A;  3D0P A;  1NK7 A;  3P5J A;  1HQE A;  2OPR A;  3I0S A;  5HRO A;  1XHZ A;  3VQ7 A;  1SKW A;  4CK3 A;  1R0A A;  4CJT A;  3ZSV A;  3L2Q A;  2HHX A;  3TAM A;  4OGE A;  4FLZ A;  4FM1 A;  4DSE A;  4E7L A;  4B9M A;  3AA2 A;  3NH1 A;  3QNN A;  4CCH A;  4OKK A;  1NKB A;  4BE2 A;  5E41 A;  4FJL A;  3VQ6 A;  4I2Q A;  3TAB A;  4BWM A;  1SKR A;  3KK3 A;  2OPQ A;  3KKR A;  4CF1 A;  3LPU A;  1B92 A;  3B6P A;  4Z4E A;  1TL3 A;  1FKO A;  4JS4 A;  3TAF A;  3HXM A;  3C95 A;  2IC3 A;  4CFA A;  1JLG A;  1S1X A;  4RW7 A;  2IGI A;  4FYD A;  1FXX A;  4AHS A;  1NKE A;  4YNQ A;  3NGY A;  2A1R A;  1CZB A;  1VSI A;  4FW2 A;  2R7Y A;  1SL1 A;  1HQU A;  3NGZ A;  3OYF A;  3O3F A;  2BGG A;  2VG6 A;  4B9T A;  1JXE A;  3CYM A;  1F21 A;  3K58 A;  3HPG A;  4CES A;  1EKE A;  3OJS A;  1NKC A;  1RT5 A;  1RBT A;  3SPZ A;  1KVB A;  3ZT2 A;  1YVU A;  4LH5 A;  4O4G A;  4DMN A;  4KTZ A;  3CFR A;  4OLA A;  3AVH A;  4IFY A; 
#chains in the Genus database with same CATH topology
 3MMV A;  2VWK A;  3DLK A;  3O3G A;  2D0O A;  3VF4 A;  1BIZ A;  5B8H A;  3ZCM A;  3CQY A;  4FJ7 A;  1X3M A;  4CGD A;  1DLO A;  5FRM A;  4XH4 A;  4DQR A;  4DTJ A;  3DXK A;  4CJL A;  4H4M A;  4JK8 A;  4BR7 A;  5C12 A;  2RPI A;  4C1N I;  1U04 A;  3TAP A;  3C7N B;  4CZM A;  4F3O A;  3FFK B;  3V81 A;  4FK0 A;  2QWN A;  5BPM A;  3OYK A;  4DG1 A;  3IRX A;  3A5M C;  4IZ9 A;  3PSF A;  1X9W A;  2HMI A;  3SV3 A;  4BDZ A;  4CK2 A;  4FVM A;  4IFV A;  5F2R A;  3CM5 A;  3ATU A;  3QLH A;  4MDB A;  3OYJ A;  3F9M A;  3KLI A;  2E4L A;  1XMO K;  1YHQ N;  1NMN A;  3PO4 A;  1N32 K;  2P9I A;  4J2E A;  3AY9 A;  3OYC A;  2GUI A;  3DRR A;  1EET A;  4BGB A;  4Y1D A;  4NCA A;  1KD1 O;  5EVZ A;  4KRE A;  3P1G A;  1ZXO A;  4HCB A;  4WFN L;  3AVN A;  2UUC K;  2F4V K;  4OPA A;  2EHG A;  2GEM A;  3AVG A;  4IBN A;  4M7X A;  4FWS A;  3GOI A;  3LDL A;  1LOT B;  4BE1 A;  2OTJ N;  4CJK A;  2QK9 A;  3ULD A;  1DKG D;  3VEY A;  1BA0 A;  4WE1 A;  4XEI A;  3THY B;  4DS4 A;  1RDA A;  4PA1 A;  3U6F A;  3CCR N;  3JXU A;  2P5O A;  4W5N A;  3CC2 N;  4CJ5 A;  4BR2 A;  5FPN A;  3ZT3 A;  3MK6 A;  1J5O A;  5BRH A;  2E2Q A;  1OH7 A;  3CJB A;  4B9L A;  3HJF A;  3DM2 A;  3VPZ A;  3RSE A;  4AIL C;  5JVH L;  1IH7 A;  3MED A;  1ZBU A;  4Z4H A;  1O13 A;  3CJC A;  3VQ8 A;  4IOC L;  2FF3 B;  3DLG A;  1SQK A;  1X9S A;  3DLH A;  1E3M A;  3WXM B;  4M3W A;  3L2V A;  3O6W A;  3VTI A;  4C8O A;  5FPD A;  4FSV A;  1S1T A;  1VQL N;  3KHY A;  2KW4 A;  4CF0 A;  1IG9 A;  2ASP A;  4O0J A;  1S1U A;  3VES A;  3D2F A;  5AQX A;  3PV8 A;  3QES A;  4G9Z A;  4N76 A;  4CEB A;  1QQM A;  4IOA L;  3CJA A;  3O9T A;  5CYQ A;  2P9S A;  4PUO A;  2P9U A;  1BIU A;  3KWI A;  4HWI A;  4MLH A;  1WAF A;  4BRK A;  1WN7 A;  4IO8 A;  2F8T A;  4Z4C A;  3OBW A;  3CD6 N;  3DXK B;  4FOE A;  4H5R A;  1RTH A;  4NLB A;  2HVH A;  1HJR A;  2D0P A;  5FDL A;  1HLU A;  1QE1 A;  4KKO A;  3ZSR A;  4CBU A;  4C8M A;  1C0F A;  3AGR A;  1NOZ A;  1S72 N;  2QW9 A;  3QFU A;  3F2K A;  2IDO A;  4HTL A;  4BR5 A;  3S3O A;  3FLC O;  1U48 A;  2O4G A;  4K41 A;  5KRT A;  3G25 A;  4K42 A;  1I3A A;  2Q0U A;  3OVN A;  3ZT0 A;  5C25 A;  4CHY A;  2XY6 A;  1QQN A;  4FM0 A;  1U2V B;  5A2Q O;  3E66 A;  4B1V A;  4JKG A;  4MO4 A;  4DUZ K;  2GWJ A;  4H0V B;  2D0C A;  2P9N B;  4XH5 A;  1B9D A;  2E1Z A;  3I0R A;  1GLJ O;  3AVA A;  3LM2 A;  1VSF A;  5CYM A;  2X6N A;  4GW6 A;  2V51 B;  4IG3 A;  3SMS A;  1J6Z A;  5J1E A;  5GIP A;  2BAN A;  4RWT A;  1QVG M;  4HUF A;  1ASV A;  3H3O B;  5AQP A;  2YJE A;  4DR7 K;  4MO5 A;  2ZJP L;  3VQE A;  4R79 A;  1SKS A;  1J9A A;  4OLB A;  1RTD A;  3OJU A;  3LDS A;  3QEP A;  4FVU A;  4IG0 A;  4FM2 A;  2F9W A;  3LAN A;  4OGC A;  3VQD A;  4CW7 B;  3NH2 A;  3HL8 A;  4CHO A;  4CEE A;  3OY9 A;  2P5G A;  3R8E A;  3O3H A;  1NJY A;  2IIR A;  4CF2 A;  4YDU C;  3OS0 A;  3I8D A;  2O8C A;  3H08 A;  1CXQ A;  4DR5 K;  3SQ2 A;  5JLH A;  4CZG A;  2G8I A;  3OS1 A;  3PX0 A;  2D0A A;  3VEX A;  3PIO L;  2ZF5 O;  4TSX A;  5TKW A;  3THW A;  4CEA A;  1D8Y A;  4DF8 A;  5AZI B;  1CLQ A;  4YOT A;  2RKI A;  4KB1 A;  2E2P A;  2DPN A;  3I8B A;  3R9P A;  2O8F B;  3QEV A;  1N8R O;  2HBM A;  1EP4 A;  3EE8 A;  4M45 A;  3HOT A;  2UXC K;  3OBY A;  1X1P A;  4CIE A;  3MN5 A;  1J53 A;  1XC9 A;  4DB3 A;  1U45 A;  4K0K K;  3LP0 A;  4DFK A;  5HL7 L;  1OVQ A;  3TSU A;  2E20 A;  3EKS A;  2ZD1 A;  1EQY A;  3IMX A;  2HHQ A;  3MAQ A;  1NJX A;  4FLW A;  1UWB A;  4FXD A;  3V9W A;  1M1K O;  3EO3 A;  3EZ5 A;  3T19 A;  1RDB A;  4DSF A;  4E89 A;  5AZJ A;  4EP5 A;  1U2V A;  1K8A O;  4KHQ A;  1S9E A;  1DT9 A;  3QBX A;  3SJJ A;  1UA1 A;  4JKH A;  4QS9 A;  3K59 A;  2HND A;  3ITH A;  4JYA K;  5HRS A;  5KRS A;  4RW4 A;  3VGL A;  3F73 A;  5CY4 A;  5BRE A;  3QET A;  3NE6 A;  4DUY K;  3HK2 A;  5AQI A;  4H03 B;  1GLB G;  1RDU A;  4OKE A;  1G15 A;  5F0X A;  3LP1 A;  2VG5 A;  1WNS A;  4DSK A;  4E3S A;  1VQ6 N;  4NCG A;  5KI6 A;  2O8E B;  4BRN A;  3UE5 A;  4CED A;  1ILY A;  5DM6 L;  1HNI A;  2WTU A;  3PX4 A;  4KH4 A;  3SI6 A;  1TAU A;  1D5A A;  3KJV A;  1KSP A;  5DMR A;  1VSL A;  4JK7 A;  1C0U A;  3HSC A;  1NU0 A;  1SAZ A;  4A2B A;  5HBM A;  3HI0 A;  3O4W A;  2O8C B;  4EFH A;  3FE1 A;  2FBT A;  4B9V A;  2P51 A;  5HRP A;  3MEC A;  4B3O A;  1TKX A;  4JKA A;  1NNE A;  3ZT1 A;  1LWF A;  5AQR A;  3CER A;  4EHT A;  4DV0 K;  3HP9 A;  5K14 A;  4FLT A;  2NNW A;  3THW B;  4ID5 A;  4PWD A;  1XC3 A;  2F96 A;  4YFU A;  3THY A;  3ZEU A;  1JLQ A;  3U3Y A;  4H0Y B;  4E1N A;  3NBP A;  3OYH A;  1CZA N;  4FWL A;  4DLE A;  3I33 A;  2W6L A;  4EP4 A;  3C6A A;  3P38 A;  4CGI A;  3SAF A;  3O80 A;  4CJW A;  4DV6 K;  3TTC A;  1T05 A;  5GAE P;  4IDH A;  4CZE A;  4DSI A;  1UAX A;  4K43 A;  4HTU A;  3VEV A;  1KVA A;  2KKZ A;  2I7P A;  1OH5 A;  2ITG A;  3CQ8 A;  3VA0 A;  1MWK A;  1LW2 A;  5I3U A;  1NK7 A;  2OPR A;  3I0S A;  5AQU A;  3LDN A;  4DR2 K;  4CK3 A;  3WT0 A;  3ZSV A;  1YVN A;  5AQY A;  4OGE A;  4A61 A;  4OKK A;  1HUX A;  1NM1 A;  3GL1 A;  5E41 A;  2W40 A;  1SKR A;  5AQL A;  2RE2 A;  2OPQ A;  4CF1 A;  4PKG A;  3B6P A;  2BH1 A;  3EZW A;  3MN9 A;  4FWR A;  3TAF A;  4RW7 A;  3VEO A;  1FXX A;  3DAW A;  4YNQ A;  5BN8 A;  5EXW A;  4JD2 A;  1CZB A;  2VQE K;  1VSI A;  1RFQ A;  3O3F A;  2VG6 A;  1JXE A;  4FWP A;  1F21 A;  2QWP A;  3K58 A;  1VQ7 N;  1NKC A;  3Q7C A;  4JI5 K;  4LH5 A;  1YJN N;  1S22 A;  3CFR A;  4OLA A;  3AVH A;  4FPB A;  3LZI A;  1NJI O;  4Z4F A;  1XNR K;  1C0M A;  1LCU A;  3AO3 A;  4PHT X;  4BR9 A;  5TKY A;  2OZS A;  4FJ9 A;  1NGD A;  3CHW A;  2X74 A;  2E8A A;  4FJI A;  2YNI A;  2O8E A;  3DXM B;  4KI6 A;  4Y1C A;  4DTM A;  4B9S A;  3HO1 A;  1XWL A;  1HRH A;  4KHP K;  5CR4 A;  3V9X A;  2HHT A;  2YV0 X;  1ASU A;  4AHR A;  5I9E B;  1BCO A;  4A57 A;  4DTS A;  4FZX C;  2P1J A;  4FJG A;  1QSY A;  4GKK K;  3G0Z A;  3L3U A;  4KO0 A;  3SLC A;  4DV5 K;  1E4G T;  3MCP A;  2QEX N;  4KTQ A;  3TSQ A;  3HBT A;  4BRD A;  4CD3 A;  4CJF A;  4K25 A;  1W9H A;  1LAV A;  2ATQ A;  1ZC6 A;  1EWQ A;  4FJM A;  5J2Q A;  5AQF A;  3U9Z A;  3KLH A;  4GVE A;  2XO7 A;  4K8Z A;  3VQ9 A;  1W2B M;  3BZC A;  4JKD A;  3AVM A;  2B6A A;  1VSM A;  1BOT O;  1HX1 A;  5JMV A;  4BRM A;  1REV A;  2IOC A;  4BY9 C;  5LY3 A;  1W97 L;  1C1B A;  2NLX A;  3CJ7 A;  4IJN A;  3CXC M;  3ZLJ A;  2VYP A;  4PY5 A;  1KC8 O;  3T7Z A;  2PFU A;  4LF9 K;  2V7Y A;  1WAJ A;  4EAH D;  2HW3 A;  4KRF A;  3IKM A;  2BTF A;  2HBL A;  2G8W A;  4H0O A;  1K73 O;  1L3U A;  5AQJ A;  2Y1J A;  4EZ9 A;  3AO4 A;  1S6P A;  2P9P B;  3K5M A;  4JHD B;  4E1M A;  3SUO A;  2WFB A;  1VK0 A;  5H1S Q;  2Q1N A;  3ULE A;  2HBJ A;  4CEQ A;  1A5X A;  4WQ5 C;  1GLL O;  3JSM A;  1JL2 A;  4DQS A;  3H1V X;  4H5W A;  4E19 A;  4JD2 B;  4CZI A;  4FLV A;  3OYL A;  5C2D A;  3L2W A;  1WB9 A;  2XY8 A;  3K2P A;  1HNZ K;  3MDQ A;  3DLL L;  3OTO K;  2NRW A;  4QAG A;  3HTV A;  3N4Q A;  4DQQ A;  3SJH A;  4CJV A;  4FWN A;  1UA0 A;  4LD0 A;  3ZSO A;  1T03 A;  3NF9 A;  2KTQ A;  1NBW A;  3ZT4 A;  2CH5 A;  1SV5 A;  1TYQ A;  4C1N K;  2P9I B;  4CJR A;  3LAM A;  4X64 K;  1HPM A;  1RT3 A;  4ICL A;  1NGB A;  5AQQ A;  4PL7 A;  1ITG A;  3HZ6 A;  2D5R A;  4F4K A;  4HVJ A;  5ADX A;  2Y1I A;  1S1V A;  3SUN A;  2ASO A;  4KTW A;  4MFB A;  1MWM A;  4LFC K;  4B1X B;  1GLF O;  3LP2 A;  2Z1J A;  3WQU A;  1FKP A;  3NFA A;  1GLA G;  1JCF A;  3GE1 A;  4EHU A;  4KHU A;  5AZI A;  2PY5 A;  2A42 A;  4BVO A;  3OYE A;  2FBV A;  1KVC A;  3V6D A;  1RT7 A;  1VSH A;  3J7Y P;  4FJK A;  2F9T A;  3AVJ A;  1S6Q A;  4FWQ A;  4A62 A;  1HMV A;  3SQ1 A;  2YHB A;  1RDD A;  3VQA A;  4ID1 A;  4FW1 A;  3VQ5 A;  2UYT A;  1GOC A;  2UXD K;  5GAH P;  4FCY A;  3BDP A;  4QOZ B;  4FWM A;  4M3U A;  4IOX A;  3D6R A;  4M7Y A;  3E01 A;  1M90 O;  4HCC A;  3F9K A;  1IKV A;  4BRC A;  4DSJ A;  3AVL A;  5M1Q A;  1RT2 A;  4YOW A;  4XIU A;  1Q8I A;  3RWU A;  5HP1 A;  1SL2 A;  5JS1 A;  3QEI A;  2QWO A;  4GV9 A;  4GV3 A;  3W3D A;  1YJ9 N;  1NGA A;  5EOY A;  1ASW A;  1S5J A;  1TV6 A;  4YOR A;  1YTA A;  4E7I A;  3ULE B;  2W41 A;  3MCA B;  4DFM A;  3CC7 N;  5D3G A;  1O1W A;  2WC9 A;  1I39 A;  4ILH A;  1KLN A;  1EWR A;  3ZET B;  1HKB A;  5T7B A;  2P9P A;  3RMA A;  4FZZ A;  2JWK A;  3RR8 A;  4X62 K;  1IO2 A;  5AQV A;  4CZF A;  3BY5 A;  4DTP A;  2O8D A;  2QWL A;  1RT4 A;  2QWM A;  3KTQ A;  3UKR B;  4DWI A;  3H6E A;  3HYF A;  3LZJ A;  2DFE A;  1ESV A;  1HYV A;  1JXB A;  5C0Y A;  2JWL A;  2G8V A;  2B5J A;  1LW0 A;  1QQO A;  2XY5 A;  3V1Q A;  4B1Y B;  1VQN N;  4I6M A;  1BI4 A;  2BDP A;  3K9K A;  4L8R B;  5J2M A;  4CFD A;  1FW6 A;  4PQU A;  4NO7 A;  2P9N A;  2ZGY A;  3ID8 A;  2ZM6 K;  4ZTJ A;  2X6S A;  3QFP A;  3L2R A;  1KTQ A;  4QCL A;  3O9Q A;  2A40 A;  3K0S A;  3MX2 A;  4UQG A;  4HUG A;  4LF7 K;  3OS2 A;  3O1B A;  4B8A B;  2UUA K;  2GTD A;  3M3Z A;  4DV7 K;  2HF3 A;  2XHB A;  5AQW A;  3CCM N;  3TAE A;  4FJ5 A;  2PYL A;  4RG8 A;  3TTF A;  4W5Q A;  2QKB A;  5JLF A;  4JKE A;  4J2A A;  3HPH A;  1RBU A;  2E6M A;  2VWJ A;  1VQ5 N;  1S1W A;  4F3T A;  2FSJ A;  5EY4 A;  3ZSX A;  2NRX A;  4I2P A;  4BRF A;  5BPL A;  4HUE A;  1SUQ A;  4BDY A;  1FK9 A;  5BR9 A;  3E9O A;  2ZGZ A;  3M5R A;  4CFC A;  2D0B A;  3L2U A;  3CIP A;  5KGX A;  4X65 K;  5C42 A;  3S41 A;  4KBO A;  1LAW A;  1U49 A;  4OPJ A;  4H5T A;  4U7B A;  1L3V A;  4DTR A;  4AHT A;  2AP1 A;  3LAK A;  1OH8 A;  2DFF A;  1WOQ A;  1TGO A;  2V52 B;  2EX3 A;  1A5W A;  2YKN A;  4BC5 A;  4IO9 L;  1KAY A;  4JV5 K;  3KKS A;  1QSS A;  1P90 A;  4RTF D;  1YIT N;  4IEE A;  3V9U A;  1NK5 A;  3ZSZ A;  2G8U A;  1UOC A;  4JRP A;  4OJR A;  2ZE2 A;  4JI2 K;  3WXJ A;  4DR1 K;  2F8S A;  4H0X B;  3VN5 A;  1NGC A;  3O9R A;  4PKH A;  1YXQ A;  2A1S A;  2QKK A;  4FWK A;  1CZ9 A;  1WSF A;  4BQZ A;  3S9H A;  4CBX A;  4CGJ A;  4B3M K;  3J7A P;  4W5R A;  5KPZ A;  3CPE A;  2ZQB A;  2P9L A;  1XNQ K;  2BE2 A;  1BUP A;  1Q81 O;  2OZM A;  2LSN A;  4CIF A;  1VSE A;  3WEE B;  1Q18 A;  3QIC A;  3HVR A;  4CZK A;  1NWK A;  2E5L K;  1RGI A;  3SZ2 A;  3B6O A;  3H45 C;  1C1A A;  3N4P A;  1LWC A;  1TKZ A;  4AHV A;  3V4I A;  3BGR A;  3VGK A;  4IXC A;  4JI8 K;  4Z4G A;  2P9K A;  1SZ2 A;  3IAY A;  4OPK A;  3CFO A;  2YI1 A;  2Z1I A;  1MA9 B;  4CEC A;  2G8K A;  1RCH A;  4CHZ A;  3QNO A;  3LDO A;  3G4S N;  4CHP A;  3UB5 A;  4N5S A;  4UY8 O;  4A2A A;  4BC2 A;  1SL0 A;  2HVI A;  3A2F A;  4FJ8 A;  2IVO A;  4H5V A;  3U3G A;  4YY3 K;  1VHX A;  4CJ3 A;  3MEE A;  1L5U A;  2H3G X;  4KHS A;  1HPZ A;  1HQE A;  1XHZ A;  4LC9 B;  1R0A A;  4CJT A;  3L2Q A;  2HHX A;  4FLZ A;  3AA2 A;  4BE2 A;  4I2Q A;  1GLD G;  3KK3 A;  4BRQ A;  1R59 O;  3LPU A;  4DR6 K;  1FKO A;  4LFB K;  3KVG A;  1U6Z A;  4CZJ A;  4DV3 K;  4AHS A;  1NKE A;  2A1R A;  2R7Y A;  1BO5 O;  1VQ4 N;  3NGZ A;  2BGG A;  3EKU A;  4PL8 A;  5KPR A;  1BU6 O;  1EKE A;  3CCS N;  3OW2 M;  1E4F T;  3VEZ A;  1KVB A;  1OVY A;  3ZT2 A;  2A3Z A;  4DMN A;  4KTZ A;  3RSE B;  4F2S A;  2W6K A;  1C6V A;  4CK1 A;  2KFZ A;  1W0H A;  4BC4 A;  3VQC A;  5GIN A;  3SCX A;  3ENH A;  3CI5 A;  4JI4 K;  1VRU A;  2QI2 A;  3ZEU B;  1HYZ A;  3ZX2 A;  3GDQ A;  4Q5V A;  3NCI A;  3V1R A;  1T3V A;  1T6C A;  3IDH A;  5HRR A;  5M1P A;  2HHW A;  3WQT A;  4CIG A;  3RR7 A;  3TU5 A;  1WSE A;  4EIA A;  4DQ8 A;  2QTD A;  3HOS A;  3ASM A;  3THX A;  4CE9 A;  3QBW A;  1T44 A;  3UIQ A;  4WYB A;  2P9U B;  4E1J A;  3C65 A;  3SPY A;  4B3T K;  3V1O A;  5HRN A;  4B8C A;  5BPN A;  1IKW A;  3A5N C;  3U9D A;  5JS2 A;  4JN4 A;  4CHQ A;  1VSD A;  4Z0U A;  4CEF A;  2DFH A;  4FK2 A;  4QS7 A;  4ELT A;  1WLJ A;  5KQ8 A;  1YF5 L;  3HST B;  1Z25 A;  2XRI A;  2V7Z A;  3D2E B;  3F5T A;  3AGK A;  3C94 A;  3J8A A;  3ENB A;  3BP8 A;  1HNV A;  4PKI A;  3KLE A;  2GEL A;  4DV1 K;  1BDG A;  2FBX A;  2HNZ A;  3C7N A;  3PX6 A;  2HHV A;  3LDP A;  4FJN A;  2YNF A;  4WQ4 A;  2WUS A;  2NRZ A;  5FPE A;  4FJX A;  2O8D B;  4I9L A;  4MDA A;  3ZX3 A;  4ELU A;  3LL3 A;  3SUQ A;  3QER A;  4DU4 A;  3ISN C;  2KFN A;  2E88 A;  3P83 D;  2UU9 K;  3ZX0 A;  4DR4 K;  2UXB K;  1NMD A;  4WQ4 C;  2NRV A;  1KXP A;  5C2F A;  4DFJ A;  1EXQ A;  3VQB A;  3FGU A;  4KPY A;  5AQZ A;  4W5T A;  4HHT A;  1YI2 N;  1XI1 A;  4C23 A;  1KFS A;  3LM9 A;  4BQL A;  1HYS A;  1NK6 A;  1TUU A;  1ZYQ A;  2A41 A;  4BRI A;  4V19 S;  3VQQ A;  3K5O A;  4M3R A;  2YHW A;  3FZH A;  2YNG A;  4BR0 A;  4H4O A;  1K8K A;  3TAG A;  1BCM A;  4AM7 A;  5KQD A;  4CZL A;  2JGU A;  4DTO A;  3OYB A;  5AQS A;  4O5B A;  3TAR A;  1GOA A;  5LMN K;  2HHU A;  5E84 A;  4BRE A;  3ATV A;  4IWV A;  4M3X A;  4AF1 A;  5HLF A;  1HKG A;  3WNE A;  3DRS A;  3LP3 A;  1WSG A;  3IFR A;  4NB4 A;  5ELZ A;  3UKR A;  1NG9 A;  3V9Z A;  3DMJ A;  3QDK A;  2E1Y A;  4GKJ K;  1NJW A;  3MN7 A;  3EL2 A;  1XQS C;  2F7T A;  4BRL A;  4FPA A;  4FLU A;  2E2N A;  4JEP A;  3AAP A;  3AO1 A;  3CCV N;  3BF3 A;  3OYI A;  2KZM A;  3VTH A;  2E2O A;  1RIL A;  3IUC A;  2FLO A;  1KLM A;  4CJP A;  3TR8 A;  3D2E A;  1RT1 A;  1RBR A;  3AO5 A;  4IDK A;  2KZZ A;  2VGN A;  3HM8 A;  1J54 A;  4O0I A;  4XH1 A;  2FF6 A;  1YT3 A;  3BF1 A;  4YOV A;  4DF4 A;  1TUY A;  1QVF M;  2PYJ A;  2WON A;  1RTI A;  4J2B A;  3JAM O;  3QIP A;  4BG9 A;  3T3F A;  1OH6 A;  1KFD A;  4NLC A;  3VEN A;  4NYN A;  2QXF A;  3CQX A;  3PUF A;  2AA4 A;  4B9Q A;  4H8K A;  4IFE A;  3WNG A;  3OYM A;  4KV8 A;  4C8N A;  1XMQ K;  3ID6 A;  5FRN A;  3HP6 A;  3AA4 A;  1DEJ A;  5AR0 A;  1C1C A;  1NJZ A;  2P9K B;  1Z05 A;  2G8H A;  3Q7B A;  4A5A A;  5JVG L;  5SZT A;  3KIO A;  2YHA A;  2VGM A;  1JLC A;  4J2D A;  1JLB A;  4RW6 A;  1N6Q A;  4F2R A;  5SWM A;  5FPM A;  5J2P A;  2PBD A;  3VMF B;  2G8F A;  4OO1 J;  2ETJ A;  3KD1 E;  3D45 A;  3S3M A;  1NK0 A;  3KK1 A;  1MDU B;  4JKG B;  1C0T A;  4FJH A;  3AVK A;  5IWA K;  4LSL A;  1ZBF A;  3BEX A;  3TPQ A;  3K57 A;  1KCF A;  3DJC A;  5M1O A;  3M8S A;  3WNF A;  3AA5 X;  4FLY A;  1WSJ A;  1LV5 A;  4C8L A;  3CCQ N;  3KK7 A;  3LPT A;  1JLF A;  3UKU B;  1VQO N;  4CGG A;  3SBT A;  2QWQ A;  4CBW A;  1TK0 A;  3EN9 A;  1Q7Y O;  4GMJ B;  5AQM A;  3O4Q A;  5LMU K;  4BVP A;  5LL6 Z;  1IBL K;  3TWH A;  4YOX A;  4DQP A;  3HRG A;  3H1Q A;  2HNY A;  4O55 A;  5AQN A;  1EX4 A;  3L0Q A;  3HPO A;  3G6E N;  4OX9 K;  3M8P A;  5C15 A;  5KTQ A;  4CVN E;  3SAG A;  3MWP A;  4CEO A;  1VQ9 N;  3C6H A;  2WBN A;  4CJU A;  2JLE A;  4ILG B;  1L3T A;  4E7H A;  5KGW A;  5FLX O;  4B9N A;  3NDK A;  4DSL A;  4M3Y A;  4IEI A;  1JKH A;  1SS6 A;  1K9M O;  4CJQ A;  4AH9 A;  2AJQ A;  3CF5 L;  2O8F A;  1VQP N;  3PO5 A;  1BHL A;  3G71 N;  3RMC A;  1NGE A;  2Q2R A;  1XHX A;  3OHR A;  1CXU A;  4GY2 B;  5J2N A;  1MU2 A;  1ATN A;  3EE9 A;  3RMB A;  5FRO A;  4DQI A;  2YCH A;  4E7J A;  4JI0 K;  4N47 A;  3U8X A;  1HNW K;  4CD1 A;  1Y97 A;  4DR3 K;  2OAN A;  5GAG P;  3NHG A;  3T69 A;  4YDU A;  4I6M B;  4JKB A;  4OKJ A;  4JRQ A;  3L6Q A;  3AVF A;  1BIS A;  4CER A;  5DK5 A;  4BRA A;  2RF2 A;  4Z94 A;  3I55 N;  2HMP A;  1NGG A;  4M63 C;  5KPT A;  4F9O A;  2Q36 A;  4FJJ A;  1VQK N;  5EU7 A;  4I9Q A;  2QA4 N;  3CM6 A;  2YX6 A;  4KH6 A;  4CGH A;  2NUB A;  3EY1 A;  4CF9 A;  1BGX T;  3A5O C;  3PY8 A;  4LFA K;  4CI6 A;  1W7A A;  3AVC A;  4DU1 A;  4Z4I A;  4A59 A;  4ZHR A;  3ZSW A;  3S3N A;  1BQN A;  3H46 O;  3BZK A;  2W42 A;  3GG4 A;  3P4I A;  1JLE A;  1D9F A;  2GV9 A;  3TTD A;  2J4R A;  1KQS M;  4FOI A;  3D0P A;  3P5J A;  1SKW A;  5HRO A;  3QB0 A;  5HOO A;  3O9S A;  3TAM A;  5LJV A;  4FM1 A;  4E7L A;  3E9P A;  4B3S K;  3NH1 A;  3QNN A;  1NKB A;  3UKU A;  4FJL A;  3VQ6 A;  3TAB A;  5ADX H;  2Q0R A;  4Z4E A;  1B92 A;  4H5N A;  3CCE N;  1TL3 A;  3L4Q A;  4H0T B;  4JS4 A;  3HXM A;  2IC3 A;  3E1Y A;  5AQO A;  3PSI A;  3NGY A;  1SL1 A;  3OYF A;  1RT5 A;  3VGM A;  1RBT A;  3T1H K;  3K9J A;  4O4G A;  1WBB A;  1RTJ A;  3AVI A;  4JHD A;  3MX5 A;  1YIJ N;  2GWK A;  3A0I X;  3OA9 A;  2Z1G A;  3VQ4 A;  4DCH A;  1Z6R A;  1NOY A;  2ITM A;  3CG7 A;  3RRG A;  2GUP A;  3MXI A;  4AQY K;  1Q9Y A;  3AA3 A;  1XUP O;  1V4T A;  2YHX A;  5MLC Q;  4KB0 A;  4CZH A;  3RVC A;  4DTX A;  3EYZ A;  3AO2 A;  1TAQ A;  2ZJQ L;  1QSL A;  3WXI A;  4K8X A;  2VWB A;  3K5N A;  1ATS A;  3WXL A;  3MXM A;  5EX5 A;  4YOU A;  2QWR A;  3KD5 E;  4JS5 A;  1TKD A;  3VQP A;  2Q97 A;  4BRO A;  4FLX A;  1BQM A;  2RHK A;  4L3Q A;  3KLF A;  4B3R K;  1X3N A;  5M1K A;  1IJJ A;  3O4N A;  5AFU A;  3SMP A;  2HOE A;  1TYQ B;  4FZY A;  4NXN K;  2CGK A;  3QEW A;  3R6M A;  1FJG K;  1HNX K;  4KFB A;  3CJ9 A;  2DTU A;  3DYA A;  3DI6 A;  3C0B A;  1NK8 A;  3R1X A;  5GAD P;  3WUH A;  3PIP L;  4BWJ A;  1YUW A;  3WXK A;  1TVR A;  1RT6 A;  4AHC A;  3CMA N;  2DY4 A;  2FBY A;  3GBT A;  3L8B A;  2HST A;  2OCE A;  3DWL A;  3SQ4 A;  2B4J A;  3MEG A;  2ZJR L;  3BUZ B;  5BRF A;  4WCE L;  4E7K A;  1TKT A;  3I56 N;  4DHY A;  3FZL A;  2FSK A;  1IG8 A;  3V9S A;  2O8B B;  3L3V A;  1T6D A;  4DV2 K;  4LF6 K;  1QTM A;  4JI3 K;  1S9G A;  4DTN A;  2I5J A;  4DTU A;  5CZ2 A;  3O1W A;  5AJ3 K;  3DLB A;  4JLH A;  2YKM A;  4WQ5 A;  2YHY A;  3IS9 A;  4DKW A;  1JCE A;  4JI1 K;  2NRH A;  4QS8 A;  3OYA A;  3CJ1 A;  4LF4 K;  3OYD A;  1QZ5 A;  1IBM K;  1JCG A;  3DXM A;  4ISF A;  1NGF A;  3VER A;  3ALY A;  4Y0W A;  1WSI A;  3MXJ A;  1NGH A;  1BA1 A;  1DTT A;  3KK2 A;  4NCB A;  2QM1 A;  4EZ6 A;  1N5Y A;  3AAQ A;  4CFB A;  3J7Z O;  3M8Q A;  3U4L A;  1TK5 A;  5C24 A;  3TAN A;  3LDQ A;  2KLA A;  4FK4 A;  2KQ2 A;  2XY7 A;  3PLA A;  4W5O A;  3FZK A;  3THX B;  3CCJ N;  1P8Z A;  4BAC A;  1NGJ A;  5I42 A;  1ZBL A;  1NK4 A;  2PZS A;  1JL1 A;  2EWS A;  1Y64 A;  3T1Y K;  1RDC A;  5AQK A;  4NYF A;  4MQ3 A;  1NLV A;  4G1Q A;  4KAZ A;  4JKF A;  3SV4 A;  1LWE A;  2RN2 A;  4ELV A;  5M1F A;  4R5P A;  3EEQ A;  4N41 A;  1S3X A;  1VSJ A;  2WOM A;  1JLA A;  3SUP A;  2YNH A;  1EO1 A;  4B9U A;  1QHA A;  4FO0 A;  3VF2 A;  1NK9 A;  4RW9 A;  4M42 A;  5BR8 K;  1U4B A;  1VRT A;  4RW8 A;  4I7F A;  3QO9 A;  4OVL A;  4M3Z A;  1X9J A;  4BRH A;  4CF8 A;  1V4S A;  2FXU A;  2I7N A;  4ZTF A;  4LSN A;  3VEW A;  4B1Z A;  2VG7 A;  1GLC G;  1VQM N;  4ISE A;  3SBG A;  4CJE A;  4H0P A;  3VA3 A;  1QHT A;  3SYZ A;  3D2F B;  4CJ4 A;  2NZT A;  2KHO A;  4ISG A;  2IAJ A;  4AM6 A;  3KZB A;  4KHY A;  2HBK A;  3QIO A;  2HF4 A;  1WUA A;  2NRT A;  2Q3S A;  5GIO A;  3O08 A;  1ATR A;  3JYT A;  5M1N A;  5CHI A;  3O9U A;  3CC4 N;  3NF6 A;  3RTV A;  3R3L A;  4GVM A;  1TL1 A;  5CZ1 A;  1RBV A;  5BRD A;  1G99 A;  1GOB A;  2D1K A;  4LF5 K;  1QQC A;  1HJO A;  3M1F A;  2CGJ A;  1KRP A;  2X78 A;  1Z26 A;  1K6Y A;  4FL9 A;  3DOK A;  1IKY A;  4B1W B;  3SAH A;  1DGK N;  2Z1H A;  4JAX A;  4O44 A;  3DOL A;  2FC0 A;  4KH5 A;  3QEX A;  4WF9 L;  1Q9X A;  2HB5 A;  1YJW N;  1WBD A;  2OPP A;  1HKC A;  3NF7 A;  4CHN A;  3SQ0 A;  4A5B A;  4DFP A;  4BE0 A;  1RNH A;  3OYG A;  2PAV A;  4YOY A;  4M41 A;  4N56 A;  3RRH A;  4ILJ A;  1VSK A;  1K8K B;  1KAX A;  2VCP A;  3ENO A;  3AAR A;  4CJ7 A;  1QZ6 A;  3NF8 A;  4NXM K;  4O5F A;  2BUP A;  4JNE A;  3QIN A;  3SK3 A;  3TAQ A;  4BC3 A;  1WSH A;  5C10 A;  4JI6 K;  3ZYY X;  4BGA A;  3VET A;  3K5L A;  3CFP A;  4CGF A;  3NAE A;  3E9L A;  3D7E O;  4LH4 A;  2P9S B;  3NVK A;  3C6U A;  4Q0B A;  3OYN A;  4F8R A;  2Q31 A;  4MLE A;  4B08 A;  4OPH A;  3P39 A;  3J80 O;  1C0G A;  3A8Y A;  3AVB A;  1IV0 A;  3WEE A;  4CJS A;  5AQH A;  4WFB L;  4C8K A;  2O4I A;  3DRP A;  5F1X A;  1NGI A;  2VQF K;  3CCU N;  1N34 K;  1JJ2 M;  4DLG A;  3G10 A;  1IKX A;  4KI4 A;  2E6L A;  3SNN A;  3NH0 A;  1HR0 K;  3ZSY A;  4JKC A;  1BG3 A;  1H1V A;  2YJF A;  4KHW A;  2GBZ A;  2OA8 A;  3TSP A;  1T7P A;  3ZSQ A;  4KHN A;  3LWL A;  4M3T A;  4LY7 A;  5BN9 A;  3J81 O;  1VQ8 N;  5LJW A;  1QS4 A;  1D9D A;  2OTL N;  1YAG A;  4DS5 A;  1VAZ A;  5AQT A;  4U67 L;  2CGL A;  2OYQ A;  4CEZ A;  1BWF O;  4FWO A;  3H3N O;  4JK9 A;  3FZF A;  1BL3 A;  3ZET A;  2UUB K;  4GV6 A;  4B1U B;  1ZBH A;  5DM7 L;  3P31 A;  1N36 K;  1A5V A;  1Q86 O;  5AQG A;  4AHU A;  1X9M A;  1TK8 A;  3O8M A;  3THV A;  4J8F A;  4DU3 A;  1B9F A;  4JI7 K;  4IKF A;  2HHS A;  2ASM A;  3T1A A;  2ZWH A;  3IG1 A;  3HT3 A;  1ZBS A;  3JS6 A;  2IVN A;  2D4W A;  2A5X A;  1ZBI A;  1BI4 B;  1U47 A;  3VF6 A;  1L3S A;  3CME N;  1YTU A;  2CH6 A;  4LF8 K;  3KLG A;  1J5E K;  3FFI A;  3HM9 A;  5CE3 A;  4E0D A;  3NGI A;  3AV9 A;  3HVT A;  4BRP A;  3TI0 A;  1T8E A;  3QML A;  4X66 K;  3A5L C;  2OPS A;  1DTQ A;  1OKJ A;  3VOV A;  3FZM A;  3CPW M;  4IJA A;  3WNH A;  2O8B A;  2A6A A;  4O8U A;  3M8R A;  3LAL A;  3MWT A;  3DLE A;  3DLR A;  3LWM A;  3B8A X;  3KWG A;  1IBK K;  3RMD A;  2IS3 A;  2QXL A;  3M6G A;  3CCL N;  4BDP A;  3CET A;  2IVP A;  4YHH K;  1RBS A;  2NRR A;  4GNI A;  3VQ7 A;  4WFA L;  4BR4 A;  2FSN A;  4BG8 A;  1I94 K;  4DSE A;  4B9M A;  5JIC A;  1N33 K;  5E26 A;  4CCH A;  3O5B A;  4BWM A;  4RCH A;  2HHH K;  3KKR A;  2P9L B;  3C95 A;  4CFA A;  1JLG A;  1S1X A;  4FYD A;  2IGI A;  1D4X A;  5AZJ B;  5IT9 O;  4O8K A;  4FW2 A;  1GLE G;  3MN6 A;  2GX9 A;  1HQU A;  1RDW X;  3FR0 A;  3NMU A;  4B9T A;  3CYM A;  4BRG A;  3W0L A;  5AFU H;  3HPG A;  1Q82 O;  4CES A;  3L4I A;  3OJS A;  3NVM A;  4DV4 K;  3SPZ A;  1KAZ A;  1YVU A;  3C6T A;  4IFY A; 
#chains in the Genus database with same CATH homology
 3LZI A;  1C6V A;  4CK1 A;  3AVI A;  4Z4F A;  1W0H A;  2VWK A;  3DLK A;  3O3G A;  1C0M A;  2KFZ A;  1BIZ A;  3ZCM A;  3AO3 A;  2Z1G A;  3VQ4 A;  4FJ7 A;  2OZS A;  4FJ9 A;  4CGD A;  1DLO A;  5FRM A;  3VQC A;  4DQR A;  1NOY A;  4DTJ A;  3CG7 A;  2X74 A;  4H4M A;  4CJL A;  3RRG A;  4FJI A;  2RPI A;  2YNI A;  3MXI A;  1U04 A;  1Q9Y A;  3AA3 A;  3SCX A;  3TAP A;  4KI6 A;  4Y1C A;  1VRU A;  4F3O A;  4DTM A;  4B9S A;  3V81 A;  4FK0 A;  4KB0 A;  1HYZ A;  3HO1 A;  1XWL A;  1HRH A;  4DTX A;  3EYZ A;  3OYK A;  4DG1 A;  3AO2 A;  4Q5V A;  1TAQ A;  3IRX A;  3V9X A;  1QSL A;  2HHT A;  3NCI A;  2YV0 X;  1X9W A;  4K8X A;  3V1R A;  1ASU A;  3K5N A;  2HMI A;  4AHR A;  3MXM A;  5HRR A;  3SV3 A;  1BCO A;  2HHW A;  4BDZ A;  4CK2 A;  4DTS A;  4FVM A;  4IFV A;  4CIG A;  2P1J A;  3KD5 E;  4FZX C;  3CM5 A;  3RR7 A;  3QLH A;  4JS5 A;  4FJG A;  1WSE A;  1QSY A;  1TKD A;  3OYJ A;  3G0Z A;  3L3U A;  4KO0 A;  3KLI A;  3VQP A;  4FLX A;  1BQM A;  3KLF A;  2E4L A;  3ASM A;  4CE9 A;  3O4N A;  4KTQ A;  4CJF A;  3PO4 A;  4FZY A;  4J2E A;  1W9H A;  1LAV A;  3DRR A;  2GUI A;  1EET A;  2ATQ A;  3OYC A;  3QEW A;  3UIQ A;  4Y1D A;  4NCA A;  4FJM A;  5J2Q A;  3SPY A;  4KRE A;  4KFB A;  3V1O A;  3P1G A;  5HRN A;  4B8C A;  3KLH A;  2XO7 A;  4HCB A;  4K8Z A;  1IKW A;  3DYA A;  3AVN A;  3VQ9 A;  2DTU A;  3DI6 A;  3AVM A;  2EHG A;  5JS2 A;  4CHQ A;  2B6A A;  1VSM A;  1VSD A;  1NK8 A;  3AVG A;  4IBN A;  4Z0U A;  4CEF A;  2DFH A;  4FK2 A;  4BE1 A;  4BWJ A;  1REV A;  2IOC A;  4CJK A;  4ELT A;  1TVR A;  1RT6 A;  1WLJ A;  2QK9 A;  3HST B;  3ULD A;  1C1B A;  1Z25 A;  4AHC A;  2DY4 A;  2FBY A;  4WE1 A;  2XRI A;  3L8B A;  4DS4 A;  1RDA A;  4PA1 A;  3U6F A;  3SQ4 A;  2P5O A;  4PY5 A;  4W5N A;  4OLB A;  2B4J A;  3MEG A;  3C94 A;  4CJ5 A;  4E7K A;  1WAJ A;  3ZT3 A;  1TKT A;  1J5O A;  1HNV A;  2HW3 A;  4KRF A;  3V9S A;  3KLE A;  3L3V A;  4B9L A;  2G8W A;  3HJF A;  2FBX A;  2HNZ A;  1QTM A;  3PX6 A;  1L3U A;  4EZ9 A;  3DM2 A;  1S9G A;  2Y1J A;  3AO4 A;  2HHV A;  4FJN A;  4DTN A;  1S6P A;  2I5J A;  2YNF A;  4AIL C;  3K5M A;  1IH7 A;  3MED A;  1ZBU A;  4Z4H A;  4DTU A;  4FJX A;  4E1M A;  5CZ2 A;  4I9L A;  3SUO A;  3DLB A;  1VK0 A;  3VQ8 A;  4JLH A;  2YKM A;  4ELU A;  3DLG A;  1X9S A;  3SUQ A;  3IS9 A;  3DLH A;  4CEQ A;  3QER A;  4DU4 A;  4M3W A;  3OYA A;  1A5X A;  3L2V A;  3ISN C;  2KFN A;  3JSM A;  4C8O A;  1JL2 A;  3OYD A;  4DQS A;  2QKB A;  1S1T A;  3P83 D;  2KW4 A;  4E19 A;  4CF0 A;  1IG9 A;  4FLV A;  3ALY A;  4O0J A;  1S1U A;  3OYL A;  1WSI A;  3PV8 A;  4DFJ A;  3MXJ A;  3L2W A;  3QES A;  4N76 A;  1EXQ A;  4CEB A;  1DTT A;  3KK2 A;  4NCB A;  3VQB A;  2XY8 A;  3K2P A;  5CYQ A;  4EZ6 A;  1N5Y A;  4PUO A;  4CFB A;  1BIU A;  3M8Q A;  4KPY A;  1TK5 A;  5C24 A;  3TAN A;  4QAG A;  4W5T A;  4HHT A;  1WAF A;  4FK4 A;  1XI1 A;  1WN7 A;  2KQ2 A;  4DQQ A;  2XY7 A;  4CJV A;  2F8T A;  1UA0 A;  1KFS A;  4W5O A;  4Z4C A;  4LD0 A;  3ZSO A;  1NK6 A;  1HYS A;  1T03 A;  1ZYQ A;  3VQQ A;  3K5O A;  3NF9 A;  2KTQ A;  1RTH A;  4M3R A;  3ZT4 A;  4BAC A;  2HVH A;  1SV5 A;  5I42 A;  1HJR A;  2YNG A;  4CJR A;  1ZBL A;  3LAM A;  1NK4 A;  2PZS A;  1JL1 A;  5FDL A;  3ZSR A;  1QE1 A;  4KKO A;  1RT3 A;  4ICL A;  1RTJ A;  4C8M A;  1RDC A;  4H4O A;  1NOZ A;  1ITG A;  4NYF A;  4MQ3 A;  3TAG A;  1BCM A;  4G1Q A;  4KAZ A;  3SV4 A;  2D5R A;  1LWE A;  2IDO A;  2RN2 A;  4F4K A;  4ELV A;  4HVJ A;  4R5P A;  4N41 A;  2Y1I A;  3S3O A;  2JGU A;  4DTO A;  1U48 A;  2O4G A;  1S1V A;  1VSJ A;  3SUN A;  2WOM A;  5KRT A;  1JLA A;  3OYB A;  3SUP A;  4O5B A;  2YNH A;  3TAR A;  1I3A A;  4KTW A;  4MFB A;  1GOA A;  4B9U A;  3OVN A;  3ZT0 A;  2HHU A;  1NK9 A;  5C25 A;  4RW9 A;  4CHY A;  4M42 A;  1U4B A;  3LP2 A;  2Z1J A;  2XY6 A;  1FKP A;  3NFA A;  4M3X A;  4FM0 A;  1VRT A;  4RW8 A;  5HLF A;  4I7F A;  4KHU A;  3QO9 A;  3WNE A;  3DRS A;  3LP3 A;  4OVL A;  2PY5 A;  1WSG A;  4M3Z A;  4CF8 A;  3OYE A;  2FBV A;  4ZTF A;  1KVC A;  3V6D A;  1RT7 A;  1VSH A;  4LSN A;  2D0C A;  4FJK A;  3AVJ A;  3V9Z A;  3DMJ A;  1S6Q A;  2VG7 A;  1B9D A;  3I0R A;  3AVA A;  1NJW A;  4CJE A;  3VA3 A;  1HMV A;  3SQ1 A;  2YHB A;  1RDD A;  1VSF A;  1QHT A;  5CYM A;  4ID1 A;  3VQA A;  3SYZ A;  2X6N A;  4CJ4 A;  4FW1 A;  3VQ5 A;  1GOC A;  4GW6 A;  2IAJ A;  4FLU A;  4FCY A;  4IG3 A;  3BDP A;  5J1E A;  2BAN A;  3AO1 A;  4KHY A;  3OYI A;  4QOZ B;  3QIO A;  2KZM A;  4M3U A;  4HUF A;  1RIL A;  2Q3S A;  1ASV A;  3E01 A;  3JYT A;  4HCC A;  3F9K A;  1IKV A;  1KLM A;  1J9A A;  3TR8 A;  3VQE A;  4CJP A;  1SKS A;  3AVL A;  3NF6 A;  4DSJ A;  1RT1 A;  1RBR A;  3AO5 A;  4GVM A;  3RTV A;  1TL1 A;  5CZ1 A;  1RT2 A;  4IDK A;  4XIU A;  2KZZ A;  1Q8I A;  1RTD A;  1RBV A;  3OJU A;  3LDS A;  3RWU A;  3QEP A;  1J54 A;  4IG0 A;  4FM2 A;  4O0I A;  3LAN A;  4OGC A;  3VQD A;  3NH2 A;  5HP1 A;  1YT3 A;  1SL2 A;  1GOB A;  3HL8 A;  5JS1 A;  4CHO A;  1QQC A;  3QEI A;  1KRP A;  4CEE A;  3OY9 A;  2P5G A;  4DF4 A;  2X78 A;  1Z26 A;  2PYJ A;  2WON A;  1RTI A;  1K6Y A;  3O3H A;  4J2B A;  1NJY A;  3QIP A;  3DOK A;  1IKY A;  4CF2 A;  3T3F A;  3OS0 A;  3I8D A;  1KFD A;  3H08 A;  1CXQ A;  1ASW A;  1S5J A;  2Z1H A;  4NYN A;  1TV6 A;  2QXF A;  4E7I A;  1YTA A;  4O44 A;  3DOL A;  3SQ2 A;  2FC0 A;  3QEX A;  3PUF A;  2G8I A;  4H8K A;  3WNG A;  2HB5 A;  3OS1 A;  3OYM A;  4DFM A;  1Q9X A;  1O1W A;  4KV8 A;  2OPP A;  4C8N A;  3PX0 A;  1I39 A;  5D3G A;  2D0A A;  3NF7 A;  4CHN A;  3SQ0 A;  3HP6 A;  1KLN A;  4TSX A;  3AA4 A;  5FRN A;  5T7B A;  4DFP A;  1C1C A;  1RNH A;  4BE0 A;  4CEA A;  3OYG A;  1NJZ A;  1D8Y A;  3RMA A;  4M41 A;  4FZZ A;  4N56 A;  4DF8 A;  3RRH A;  2G8H A;  3RR8 A;  1CLQ A;  1IO2 A;  2RKI A;  1VSK A;  4DTP A;  4KB1 A;  1RT4 A;  3KTQ A;  5SZT A;  3NF8 A;  4DWI A;  3HYF A;  3KIO A;  3LZJ A;  2DFE A;  2YHA A;  3QIN A;  1HYV A;  3TAQ A;  3QEV A;  1JLC A;  4J2D A;  1JXB A;  1JLB A;  1WSH A;  2G8V A;  2B5J A;  4RW6 A;  1EP4 A;  1LW0 A;  1N6Q A;  4F2R A;  5SWM A;  2XY5 A;  5J2P A;  4M45 A;  3V1Q A;  2G8F A;  3K5L A;  2ETJ A;  3KD1 E;  3CFP A;  3D45 A;  1BI4 A;  3S3M A;  1X1P A;  2BDP A;  1NK0 A;  3KK1 A;  4L8R B;  5J2M A;  4CGF A;  3NAE A;  4CIE A;  1J53 A;  1C0T A;  4FJH A;  4CFD A;  1XC9 A;  3AVK A;  4PQU A;  4LH4 A;  4LSL A;  1ZBF A;  3C6U A;  4ZTJ A;  2X6S A;  3K57 A;  1U45 A;  3LP0 A;  3OYN A;  3L2R A;  1KTQ A;  4F8R A;  1KCF A;  4B08 A;  4Q0B A;  4DFK A;  4QCL A;  3M8S A;  3WNF A;  3AA5 X;  2ZD1 A;  4UQG A;  4FLY A;  1WSJ A;  3AVB A;  4HUG A;  1LV5 A;  4C8L A;  2HHQ A;  3MAQ A;  3LPT A;  1JLF A;  3OS2 A;  1NJX A;  4FLW A;  1UWB A;  4CGG A;  4B8A B;  4FXD A;  3V9W A;  4CJS A;  1TK0 A;  4C8K A;  2O4I A;  3DRP A;  2XHB A;  3TAE A;  4FJ5 A;  3EZ5 A;  2PYL A;  4RG8 A;  3T19 A;  1RDB A;  4GMJ B;  4W5Q A;  4DLG A;  4E89 A;  3O4Q A;  3G10 A;  4DSF A;  1T7P A;  1IKX A;  4J2A A;  3HPH A;  1RBU A;  4KI4 A;  2E6L A;  3SNN A;  3NH0 A;  2E6M A;  4EP5 A;  2VWJ A;  1S1W A;  4KHQ A;  4F3T A;  3ZSY A;  1S9E A;  3TWH A;  4DQP A;  4KHW A;  2GBZ A;  2OA8 A;  2HNY A;  4O55 A;  3SJJ A;  1EX4 A;  3ZSX A;  3HPO A;  3K59 A;  1UA1 A;  2HND A;  4I2P A;  3ZSQ A;  4HUE A;  4KHN A;  1SUQ A;  3ITH A;  3M8P A;  4BDY A;  5HRS A;  5KRS A;  1FK9 A;  4RW4 A;  3LWL A;  3F73 A;  4LY7 A;  5CY4 A;  4M3T A;  4CFC A;  2D0B A;  3L2U A;  5KGX A;  5KTQ A;  5C42 A;  3NE6 A;  3QET A;  3HK2 A;  1LAW A;  1QS4 A;  4CEO A;  1D9D A;  1U49 A;  4OPJ A;  1L3V A;  4CJU A;  4DTR A;  2JLE A;  1L3T A;  4AHT A;  4DS5 A;  4E7H A;  4OKE A;  3LAK A;  1G15 A;  5KGW A;  3LP1 A;  2DFF A;  2VG5 A;  1WNS A;  4CEZ A;  1TGO A;  4B9N A;  2OYQ A;  3NDK A;  4E3S A;  2EX3 A;  1A5W A;  2YKN A;  4DSK A;  4DSL A;  1JKH A;  4M3Y A;  4CJQ A;  4AH9 A;  3KKS A;  4NCG A;  1QSS A;  2AJQ A;  5KI6 A;  3V9U A;  1NK5 A;  3C6T A;  3PO5 A;  1BHL A;  3ZSZ A;  3RMC A;  1BL3 A;  2G8U A;  1XHX A;  1UOC A;  4CED A;  4JRP A;  4OJR A;  2ZE2 A;  2F8S A;  3VN5 A;  1CXU A;  1HNI A;  5J2N A;  1ZBH A;  2A1S A;  2QKK A;  3PX4 A;  1CZ9 A;  1WSF A;  3S9H A;  1MU2 A;  4CGJ A;  3SI6 A;  1TAU A;  1A5V A;  1D5A A;  3RMB A;  3KJV A;  4AHU A;  4W5R A;  1X9M A;  5FRO A;  1TK8 A;  5DMR A;  1KSP A;  3THV A;  4DQI A;  1VSL A;  2ZQB A;  4DU3 A;  1B9F A;  4E7J A;  4N47 A;  4IKF A;  2HHS A;  1C0U A;  2BE2 A;  3T1A A;  2OZM A;  1Y97 A;  2LSN A;  4CIF A;  3NHG A;  5HBM A;  3IG1 A;  3HT3 A;  4F2S A;  1VSE A;  2FBT A;  4B9V A;  3HVR A;  2P51 A;  5HRP A;  1ZBI A;  3MEC A;  1BI4 B;  4B3O A;  3SZ2 A;  1U47 A;  1L3S A;  1TKX A;  3B6O A;  4OKJ A;  1C1A A;  1YTU A;  1LWC A;  3ZT1 A;  3KLG A;  1LWF A;  4JRQ A;  1TKZ A;  3FFI A;  3HM9 A;  4E0D A;  3AVF A;  3HP9 A;  5K14 A;  4AHV A;  3NGI A;  4FLT A;  3V4I A;  1BIS A;  3AV9 A;  3BGR A;  4ID5 A;  4CER A;  4PWD A;  5DK5 A;  3HVT A;  2F96 A;  4YFU A;  2RF2 A;  1JLQ A;  3U3Y A;  4Z4G A;  4E1N A;  3NBP A;  3OYH A;  3TI0 A;  3IAY A;  1T8E A;  4DLE A;  4OPK A;  3CFO A;  2OPS A;  1DTQ A;  2Z1I A;  4FJJ A;  4CEC A;  4EP4 A;  2G8K A;  1RCH A;  4CHZ A;  3QNO A;  3WNH A;  4CHP A;  4CGI A;  5EU7 A;  3M8R A;  4I9Q A;  3LAL A;  3CM6 A;  3DLE A;  4N5S A;  4CGH A;  4CJW A;  3DLR A;  2NUB A;  3EY1 A;  4CF9 A;  1BGX T;  1T05 A;  1SL0 A;  3PY8 A;  2HVI A;  3A2F A;  4DSI A;  1UAX A;  3LWM A;  3AVC A;  4DU1 A;  4HTU A;  4FJ8 A;  4Z4I A;  3RMD A;  1KVA A;  4ZHR A;  2IS3 A;  3U3G A;  3ZSW A;  3S3N A;  1BQN A;  2W42 A;  2ITG A;  3CQ8 A;  4BDP A;  4CJ3 A;  3VA0 A;  3MEE A;  1JLE A;  1L5U A;  1D9F A;  4KHS A;  1RBS A;  1LW2 A;  2GV9 A;  1HPZ A;  5I3U A;  3D0P A;  1NK7 A;  3P5J A;  1HQE A;  2OPR A;  3I0S A;  5HRO A;  1XHZ A;  3VQ7 A;  1SKW A;  4CK3 A;  1R0A A;  4CJT A;  3ZSV A;  3L2Q A;  2HHX A;  3TAM A;  4OGE A;  4FLZ A;  4FM1 A;  4DSE A;  4E7L A;  4B9M A;  3AA2 A;  3NH1 A;  3QNN A;  4CCH A;  4OKK A;  1NKB A;  4BE2 A;  5E41 A;  4FJL A;  3VQ6 A;  4I2Q A;  3TAB A;  4BWM A;  1SKR A;  3KK3 A;  2OPQ A;  3KKR A;  4CF1 A;  3LPU A;  1B92 A;  3B6P A;  4Z4E A;  1TL3 A;  1FKO A;  4JS4 A;  3TAF A;  3HXM A;  3C95 A;  2IC3 A;  4CFA A;  1JLG A;  1S1X A;  4RW7 A;  2IGI A;  4FYD A;  1FXX A;  4AHS A;  1NKE A;  4YNQ A;  3NGY A;  2A1R A;  1CZB A;  1VSI A;  4FW2 A;  2R7Y A;  1SL1 A;  1HQU A;  3NGZ A;  3OYF A;  3O3F A;  2BGG A;  2VG6 A;  4B9T A;  1JXE A;  3CYM A;  1F21 A;  3K58 A;  3HPG A;  4CES A;  1EKE A;  3OJS A;  1NKC A;  1RT5 A;  1RBT A;  3SPZ A;  1KVB A;  3ZT2 A;  1YVU A;  4LH5 A;  4O4G A;  4DMN A;  4KTZ A;  3CFR A;  4OLA A;  3AVH A;  4IFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...