1CXQA

Atomic resolution asv integrase core domain from ammonium sulfate
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
147
structure length
143
Chain Sequence
GRGLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AVIAN SARCOMA VIRUS INTEGRASE
publication title Atomic resolution structures of the core domain of avian sarcoma virus integrase and its D64N mutant.
pubmed doi rcsb
source organism Avian sarcoma virus
molecule tags Transferase
total genus 52
structure length 143
sequence length 147
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1cxqA00
4RW7A 1JLEA 1TGOA 4JRQA 3DLBA 4LSLA 2OPQA 2X74A 3IRXA 3O4NA 3HO1A 1C1CA 3CYMA 2HHUA 4M42A 3TANA 1T7PA 1CXQA 2X6NA 3MEGA 1IG9A 4HCBA 4RW8A 1S9EA 4E19A 4ID5A 4CHNA 1QQCA 1RBUA 2WOMA 4CEDA 4CJKA 1QSLA 4YNQA 1D9DA 2IOCA 1BI4A 1TAUA 4LH4A 1L3UA 2G8FA 4NCBA 2F8TA 3DMJA 3OYCA 2BE2A 3AO3A 4IG0A 4R5PA 5J2NA 4FJIA 4KHYA 4JS4A 5HRPA 3LZIA 1FXXA 3M8QA 3TAFA 4WE1A 4B3OA 3M8PA 3K2PA 4KFBA 5DMRA 3ZSXA 3TWHA 4DU3A 1IO2A 3KLIA 4DSIA 4KTQA 4L8RB 4O55A 3BDPA 4DSKA 5C24A 3PX4A 4FJJA 4DF4A 3L2VA 1A5VA 1BIZA 3NH0A 2HHTA 3LP2A 3EYZA 1UWBA 4ID1A 4OPKA 3QETA 3U6FA 1J9AA 1RDAA 4HUGA 4B08A 3MXMA 3QO9A 4CGHA 1W9HA 3LP3A 5I3UA 4NYNA 2YNIA 3LAMA 2X78A 3VQ5A 5KGWA 1TKXA 4JLHA 3O3FA 2OPRA 4CJLA 3OYKA 3HL8A 3IS9A 2W42A 4DFMA 3ZCMA 1Q8IA 3BGRA 1C6VA 4FYDA 4DTXA 3H08A 1JXEA 4CK3A 1CZBA 2QXFA 5CYMA 2I5JA 2PY5A 4JS5A 4EZ6A 2KTQA 1ASVA 4I2QA 4CFAA 1BL3A 4CJVA 4BACA 3PX6A 3V1QA 4DSJA 1HYSA 3O3GA 1RILA 1TKTA 4F3OA 1NOZA 2XRIA 4YFUA 3EZ5A 1NK8A 4CHOA 2P5OA 3DI6A 3ZSWA 1VSJA 1NK7A 4I9LA 4CJ3A 3NFAA 1LWCA 4M45A 3VQ4A 3M8SA 5FROA 5KGXA 3I0RA 4B9SA 3A2FA 4BDZA 1HYVA 5J2MA 3TI0A 1VSDA 5CY4A 5FDLA 4CGJA 4DTRA 1S1WA 1LAVA 2BDPA 3DYAA 4N5SA 3KTQA 3AA5X 4CEZA 3QLHA 4IDKA 1Z25A 1REVA 4FJGA 1ASUA 3V1RA 4B9LA 1JLQA 1HPZA 4DS4A 4F4KA 3NBPA 3AVBA 3CFRA 1UA1A 1RTIA 3SV4A 1C0TA 5EU7A 1L3VA 1BIUA 4BWJA 3MECA 3NGYA 4CJSA 3LZJA 1VSHA 3SPZA 4M3ZA 4G1QA 2DFEA 1QTMA 4K8ZA 3V1OA 4DLEA 1NJXA 3HVTA 1FKPA 4O0IA 2Z1HA 1D9FA 3VQ8A 3AO2A 4ZTJA 2PYLA 2B5JA 4M3YA 4UQGA 3JYTA 1JLAA 1TKZA 1RNHA 3V9UA 4CJ5A 4DFKA 4CEFA 1KTQA 4CERA 3RMDA 4CHQA 1VRUA 2EHGA 3DRSA 3AA2A 3QEWA 3IAYA 3ZSZA 2D0CA 4CJRA 3L2QA 3LDSA 3D45A 3SI6A 4KHWA 1WSHA 1YVUA 4CJEA 2FC0A 3LPTA 3AVNA 1U48A 3QIOA 1U49A 1B92A 1L3TA 4KI4A 3WNEA 1BI4B 1KLMA 3AA4A 1JLFA 3VQAA 3SNNA 1VSMA 1ITGA 2G8KA 3ALYA 2YKNA 1JLCA 3K5NA 4CEBA 4AHRA 3C6UA 3DOKA 4FLZA 3SPYA 4ELUA 1D8YA 5D3GA 3MEDA 3L2RA 2IAJA 2LSNA 3ZT3A 5JS1A 3AVMA 3DLEA 1K6YA 2B4JA 1NOYA 1WSEA 4Q0BA 4B9UA 5JS2A 3RMAA 2ZE2A 4DQRA 4E7JA 4KB1A 1TV6A 4E89A 5SWMA 3SQ0A 1RBSA 2XY8A 4BWMA 4Z4CA 4AHCA 1I39A 2HVIA 3P5JA 4AHVA 1CLQA 3NCIA 4DQQA 4IFYA 4B9MA 1KFSA 2IGIA 2YHAA 1UOCA 2HHWA 2G8HA 1B9FA 4W5TA 4B9TA 3NGZA 4H4OA 4CEEA 3K5MA 1BQMA 1UAXA 4FM1A 1NK0A 1QSSA 1O1WA 2D5RA 2QKBA 2IS3A 3ZSRA 4CEQA 4O5BA 1ZBFA 3VQPA 4CJQA 1CZ9A 1RT1A 3HPHA 4CJPA 3VQBA 3SQ1A 3OJUA 1KSPA 3CM5A 4IG3A 3M8RA 4AH9A 1VK0A 1EXQA 3TAEA 2PZSA 2DY4A 3HPGA 4BE0A 1SL0A 1U04A 2HHQA 2YNGA 3OYAA 4RW4A 2HB5A 3OYIA 1JKHA 2GUIA 3RR8A 1TL1A 4OKEA 1XWLA 3LANA 4CFBA 3HP9A 3L3UA 3KK2A 3THVA 1S6PA 1BISA 4I2PA 3OYFA 5J1EA 3VQ9A 1U47A 3HSTB 3HPOA 4E7LA 1LWEA 2OPSA 1XC9A 4CHZA 4C8OA 1RT3A 1ZBIA 4Z4IA 5HROA 5HP1A 1VSLA 3LAKA 3HYFA 1LW0A 4FM0A 4ELVA 2G8WA 4MFBA 3KD1E 3CQ8A 1RDDA 1HQEA 1WAFA 4E7KA 4DG1A 2HNYA 2VWKA 4CGIA 2G8UA 1SV5A 5FRMA 3UIQA 1HQUA 1QE1A 3AVIA 1KLNA 2ZD1A 3D0PA 2O4IA 3SUQA 4C8KA 4HCCA 2ZQBA 3NF9A 2Z1IA 4FK4A 4Z4EA 3DM2A 3CFOA 2A1RA 3ULDA 1FK9A 4ELTA 1QHTA 4PA1A 5HRNA 4N56A 1U45A 1J53A 1TK8A 4CIGA 2VG5A 4GVMA 3RR7A 3OYDA 2Y1JA 1BHLA 5HLFA 2O4GA 2OZMA 5T7BA 1BCMA 4E1MA 2KW4A 4DS5A 4E3SA 1J5OA 4CFCA 1KRPA 3DLGA 4FVMA 1Q9XA 4BDPA 4DSLA 5KRSA 3AO5A 4HTUA 4AHTA 1WLJA 1N5YA 4C8LA 1YT3A 1X9WA 2GV9A 3OYMA 3TAGA 3KKRA 3JSMA 2FBYA 3TARA 1ZBHA 1KVBA 4CF1A 4KTZA 3OYBA 4KRFA 4XIUA 3PV8A 3KLGA 1A5WA 2B6AA 2IDOA 3ZT4A 1NK6A 2AJQA 3OYHA 4PQUA 4KHUA 3C94A 3HJFA 3WNFA 2F96A 5C25A 3PO4A 1GOBA 1KVCA 4FLVA 1BCOA 2OYQA 3QERA 2YNFA 4CEAA 3ZSQA 2BANA 3VQDA 4DQPA 1KVAA 1IKYA 4OJRA 1SKRA 4KAZA 3VN5A 4N41A 3L3VA 4E7IA 1S5JA 3ZSOA 1RT5A 3VA3A 4CCHA 1WNSA 4JRPA 3WNGA 3OS2A 1N6QA 2PYJA 2RF2A 3B6PA 4OGCA 4B9VA 4F2SA 1HJRA 5C42A 1X9MA 1JXBA 5HBMA 2D0AA 3I8DA 4FZXC 3OYGA 3ZT0A 1UA0A 1RT7A 3KLHA 3NE6A 1C1AA 4FLYA 3LALA 2ITGA 1BQNA 3LP0A 4FJ5A 3SQ2A 4KTWA 3DRRA 4EZ9A 3AVJA 4FZZA 1TL3A 4PY5A 4IBNA 1VSFA 2OZSA 3MAQA 1RBRA 3DLRA 4Z4HA 1NK5A 2FBVA 4KPYA 4PWDA 2XY6A 3AVLA 2DFHA 3U3GA 2QKKA 4CF9A 4CE9A 3FFIA 3V9WA 4M3XA 4AHUA 4HUEA 3KLFA 1C0UA 5CZ1A 3NGIA 1HNIA 1FKOA 4Y1CA 3TAMA 3RRHA 3RMCA 3VQQA 4KI6A 3OYJA 3V9XA 3OJSA 1LWFA 1NJZA 1R0AA 2OA8A 4FK2A 2WONA 2IC3A 3AVFA 3VQCA 1JLGA 4CJUA 4RW9A 2DFFA 4FXDA 3RMBA 4CGGA 2KQ2A 3MEEA 4CEOA 3V81A 4CF0A 4NYFA 3SZ2A 4FJLA 4J2BA 1KFDA 3CM6A 3NH1A 4FLXA 4CF8A 2VG6A 4OKKA 3NHGA 1VSIA 4KV8A 5J2PA 2HHXA 3KIOA 1Z26A 3F9KA 1NKEA 4FJMA 5DK5A 1XHXA 5KI6A 4CIEA 1HYZA 4FM2A 3HT3A 1TKDA 2X6SA 4J2AA 1WSJA 3K5LA 4W5QA 3RRGA 3TAQA 1JLBA 2EX3A 3V6DA 4C8MA 4KO0A 4HVJA 3C6TA 2ATQA 4LY7A 1RCHA 1RBTA 4CF2A 1ASWA 3RWUA 4CGFA 2XHBA 4LSNA 3T1AA 3SQ4A 4FJ7A 1RDCA 3ZT1A 3IG1A 3HM9A 4DTPA 4FK0A 2XY5A 3SUNA 3MXJA 4KKOA 2RN2A 1W0HA 4RG8A 3OYLA 1S1VA 1I3AA 4DU1A 4K8XA 3V4IA 1IKVA 1D5AA 3LPUA 3S3NA 3I0SA 2BGGA 1T8EA 4CGDA 3LWMA 1VRTA 1SKWA 4GW6A 5HRSA 2DTUA 1RT6A 2E6LA 1GOAA 1LW2A 5CZ2A 3T3FA 3SUPA 3G10A 3ZT2A 1LV5A 2G8VA 5J2QA 1SL2A 1BGXT 1JL1A 2RPIA 3V9SA 1S6QA 4GMJB 4RW6A 3S3OA 3L8BA 4CJ4A 2JGUA 4CECA 1S1UA 4B8CA 1RDBA 4QAGA 2YV0X 4LD0A 4E7HA 1NKCA 1J54A 3E01A 2A1SA 4ICLA 3K58A 1SKSA 3WNHA 4AHSA 5K14A 2P5GA 2KFZA 3MXIA 4DSFA 1S1TA 1IH7A 1L5UA 2Y1IA 2G8IA 4FCYA 4FJKA 1Q9YA 3S3MA 2P1JA 3KK3A 4IFVA 1RTDA 4CJTA 3QEVA 1RTJA 2RKIA 3ITHA 3ZSYA 3AVCA 3O3HA 4HUFA 4FLUA 4FW1A 4OPJA 1WSFA 2NUBA 3S9HA 4BE1A 4M3UA 4OLBA 1NK4A 4F3TA 3K57A 4Y1DA 4H8KA 1DTTA 2Q3SA 1G15A 3CG7A 2YHBA 4DMNA 3K59A 3P83D 3DOLA 4W5NA 4FJXA 2HW3A 3SYZA 4DTNA 2KZMA 4DFJA 4ZTFA 3SV3A 1XHZA 3NH2A 1L3SA 1MU2A 1RT2A 3DRPA 1HRHA 3QNOA 4KB0A 4KHNA 4FJ9A 2KZZA 3C95A 2ETJA 1TAQA 2HMIA 3HK2A 5SZTA 4OLAA 4M3RA 1YTAA 1X1PA 1Y97A 3ISNC 3SJJA 3TAPA 1C1BA 4O44A 4F8RA 1QSYA 4NCAA 1NK9A 2KFNA 4EP4A 4B8AB 1NJWA 3AVKA 3V9ZA 4DQSA 1CXUA 4DLGA 1TK5A 1WSGA 2FBXA 3LP1A 4AILC 4LH5A 4O4GA 4B9NA 1DTQA 3AO1A 4EP5A 3HXMA 3QESA 1U4BA 4KREA 4F2RA 3OS1A 3QNNA 3NF6A 4I7FA 2HNDA 1HNVA 1QS4A 1EKEA 4DTSA 3KJVA 2F8SA 3LWLA 1SUQA 3AO4A 1HMVA 3AVGA 4OGEA 3G0ZA 2P51A 4FZYA 1WN7A 2E4LA 4E0DA 4DTUA 4FJ8A 4I9QA 5E41A 4N47A 4J2EA 2HHVA 2HHSA 4CESA 3F73A 2HNZA 1DLOA 3PO5A 1S9GA 1VSEA 5CYQA 2JLEA 2YNHA 4DFPA 3QEXA 1NJYA 4HHTA 4M41A 3RTVA 3OY9A 1GOCA 4C8NA 1JL2A 3EY1A 4Z4GA 4DWIA 4IKFA 4DTMA 4DTOA 1S1XA 3QINA 5HRRA 3PUFA 1WSIA 4FLWA 4MQ3A 4KHQA 2R7YA 3AA3A 3AVAA 3OYEA 1EX4A 4J2DA 3VQEA 1SL1A 4W5OA 3QEIA 2HVHA 2YKMA 4M3WA 3KLEA 1A5XA 1RT4A 3NF7A 4CIFA 4DTJA 1YTUA 3CFPA 5FRNA 1KCFA 2D0BA 4FW2A 4H4MA 3NAEA 4DSEA 4W5RA 3VQ7A 4DQIA 3OS0A 2QK9A 2E6MA 3KK1A 1F21A 3U3YA 3T19A 2FBTA 3VQ6A 3AVHA 2Z1JA 4CHYA 3L2UA 3HVRA 1VSKA 4ZHRA 1RBVA 5I42A 3PY8A 4DU4A 4OKJA 4OVLA 4TSXA 4BE2A 4FJHA 4FJNA 2Z1GA 3ZSVA 4KHSA 4Z0UA 4N76A 2GBZA 1T05A 1C0MA 1IKXA 4CHPA 2XO7A 3TABA 3K5OA 3SCXA 1ZBLA 1LAWA 2OPPA 4DF8A 1T03A 4Q5VA 1TK0A 1IKWA 3PX0A 4CJFA 4QOZB 2XY7A 4Z4FA 1EP4A 1TVRA 3DLKA 3TR8A 3P1GA 4CFDA 3HP6A 2VWJA 4PUOA 3VA0A 3DLHA 1ZBUA 3QEPA 5KTQA 3O4QA 3NF8A 3ASMA 3OVNA 4BDYA 3NDKA 1RTHA 3KKSA 4NCGA 1XI1A 1WAJA 4QCLA 2VG7A 3B6OA 4CK2A 4FLTA 1EETA 4CJWA 3QIPA 4M3TA 3OYNA 3KD5E 4CK1A 1B9DA 4E1NA 3AV9A 3SUOA 4O0JA 5KRTA 1NKBA 3L2WA 1ZYQA 1X9SA
chains in the Genus database with same CATH superfamily
4DR6K 4JK9A 1T7PA 3MEGA 4RW8A 1S9EA 4E19A 4PHTX 1QQCA 1RBUA 4CEDA 1T6DA 1BI4A 3ZEUA 4IG0A 4FJIA 4KHYA 4JS4A 1FXXA 2GUPA 3K2PA 2Q0RA 4DU3A 4L8RB 3BDPA 4OPAA 3PX4A 3LP2A 3EYZA 4OPKA 3QO9A 2YI1A 2X78A 4IZ9A 3VQ5A 1TKXA 4JLHA 3O3FA 3OYKA 5KPRA 2UUCK 3H1VX 3ZCMA 4GNIA 3BGRA 1C6VA 4B1VA 2UU9K 1JXEA 2V52B 2QWNA 2WBNA 3BF1A 1HNWK 4BACA 1NGFA 3PX6A 1HYSA 4B3MK 2OCEA 1RILA 4F3OA 4YFUA 4CHOA 4B3TK 3DI6A 1VSJA 4I9LA 2CH5A 3NFAA 5H1SQ 3WXLA 3A2FA 1HYVA 4BC2A 3TI0A 4DTRA 3DYAA 3I55N 2DPNA 4FJGA 5KPZA 3V1RA 4B9LA 2WUSA 1JLQA 3GG4A 4F4KA 3NBPA 5ADXA 3CFRA 3GE1A 1VQNN 1RTIA 1L3VA 3MECA 3M1FA 3MWPA 3WQTA 3HVTA 1FKPA 5BN9A 1VQ5N 4ZTJA 2ZJQL 2B5JA 4M3YA 2Q1NA 1U6ZA 4KH4A 1K8KB 3TARA 4AM7A 2EHGA 4CHQA 3DRSA 3QEWA 3L2QA 4KHWA 1WSHA 2QI2A 1YVUA 3WQUA 3VMFB 2FC0A 3LPTA 3QIOA 2GEMA 2A41A 1B92A 2IVNA 1L3TA 3KHYA 3WNEA 1KLMA 3AA4A 3UKUB 3DWLA 1JLCA 3K5NA 5AQOA 3L2RA 5JS1A 1ZBSA 3DLEA 2P9UB 1NOYA 4KBOA 3F9MA 3EKSA 5DM7L 3RMAA 3H45C 4DQRA 3WEEB 1TV6A 1K8AO 3DXMB 3SQ0A 1RBSA 4Z4CA 2HVIA 3P5JA 1LOTB 4DQQA 1KFSA 2IGIA 1UOCA 2QWLA 1B9FA 1BO5O 4NXMK 4H4OA 4CEEA 4U67L 1QSSA 2QKBA 1O1WA 4CEQA 1SAZA 4OX9K 3CM5A 2CGJA 3R8EA 3HPGA 1U04A 4JI0K 3KVGA 4FPBA 4RW4A 2HB5A 4DV1K 3OYIA 4IOXA 4JI7K 3HP9A 3KK2A 3I33A 1S6PA 5JMVA 1BISA 4I2PA 3S41A 5C15A 3HPOA 4BVOA 1RT3A 2KLAA 5HROA 4ELVA 1VQ9N 2G8WA 2GELA 1RDDA 1HQEA 3CIPA 4CW7B 2VWKA 2AP1A 2G8UA 3UIQA 1KLNA 2O4IA 3LDNA 3VOVA 3D0PA 4YHHK 4HCCA 3NF9A 1FK9A 2E88A 5BRDA 4QS8A 3RR7A 3MCAB 1SZ2A 1BHLA 2ZM6K 1DT9A 4CFCA 2W6LA 4FVMA 4BR7A 4DSLA 1BDGA 1YAGA 1N5YA 1J5EK 3HM8A 2GV9A 3OYMA 3KKRA 1KVBA 2E8AA 3KLGA 1GLLO 3KWIA 3VF6A 4KHUA 5AZJA 1OH7A 3PO4A 3LDOA 2YNFA 4JKBA 1SKRA 2E5LK 3L3VA 2UYTA 5GAGP 3CJAA 1IJJA 2NNWA 3PIOL 3EE8A 2HBKA 1N6QA 3OS2A 3FZKA 2RF2A 2NRVA 4A57A 5C42A 1JXBA 5HBMA 3SBGA 3CF5L 1W2BM 2GTDA 3NVKA 1NGCA 1C1AA 4YOVA 1BQNA 4MO4A 4EZ9A 4KTWA 3DRRA 2FLOA 4NB4A 1RBRA 4QS9A 1SS6A 3CERA 3FGUA 4B1YB 4X62K 3DXKB 1KQSM 4NXNK 2FF6A 4WQ5A 4YDUC 4M3XA 2OTLN 3KLFA 1HNIA 3TAMA 4KI6A 3RRHA 3O4WA 3RMCA 3ATVA 3U9ZA 4AF1A 2YX6A 3N4QA 2DFFA 4FXDA 3RMBA 1NGJA 2KQ2A 5KPTA 2Q31A 4CEOA 1KFDA 4OO1J 4B3SK 1Z26A 1QZ6A 4LFCK 4CIEA 5AQFA 2X6SA 2O8BA 4H5RA 3K5LA 3TAQA 1JLBA 2EX3A 1TYQB 4LY7A 1N34K 1RCHA 1RBTA 1ASWA 1NBWA 4BROA 3QMLA 4LSNA 3SQ4A 1RDCA 3IG1A 3H3NO 4DTPA 4FK0A 4DU1A 2RN2A 3V4IA 4LF5K 3GDQA 3LPUA 4CGDA 2DTUA 4GW6A 1GOAA 4H5NA 2FSKA 3G10A 3ZT2A 4BRFA 4YOUA 1BGXT 1JL1A 4RW6A 3S3OA 2YHXA 3L8BA 1QZ5A 4CECA 2YV0X 3TTCA 1J54A 2A1SA 5BR8K 3A5MC 3WNHA 5K14A 2P5GA 3MXIA 3ZETA 1S1TA 1X3MA 3CC2N 2Q36A 5C12A 3LL3A 4FJKA 3S3MA 3UKRA 3ITHA 3VPZA 4HUFA 4FW1A 1WSFA 3S9HA 1NK4A 3CCJN 1DTTA 4X65K 4ILHA 3P83D 2QWPA 4ZTFA 3SV3A 1XHZA 3NVMA 3DRPA 4WCEL 3C95A 2ETJA 5SZTA 4OLAA 1X1PA 5JLHA 3DAWA 4GKKK 3AVKA 3CI5A 3PSIA 4IOCL 1HR0K 5CE3A 4WQ4C 4KREA 4I7FA 5AJ3K 1GLFO 1KXPA 1HNVA 3D2FA 3U4LA 3LWLA 3AVGA 5GINA 2P51A 1NU0A 4DV2K 4FZYA 2A42A 1D4XA 3IFRA 3IMXA 5E41A 4J2EA 2VYPA 2J4RA 5E26A 1DLOA 3VEVA 5CYQA 3Q7CA 3R6MA 3QEXA 1NJYA 4EAHD 3RTVA 4C8NA 2P9SB 3H6EA 4J8FA 4H0OA 5HRRA 4H0PA 2P9PB 3CQXA 1IBMK 1P8ZA 1E3MA 4DR2K 4JN4A 1EX4A 3OYEA 4W5OA 2ZGYA 3O1WA 3NF7A 4U7BA 2D0BA 3K0SA 2KKZA 1HKCA 3W0LA 2E6MA 3U3YA 2HOEA 2Z1JA 3HVRA 5AZIA 1RBVA 4YOXA 4JKHA 4OVLA 4FJNA 4FWOA 3KZBA 4Z0UA 3ZEUB 3SJHA 4CHPA 3SCXA 2OPPA 1TK0A 1IKWA 4QOZB 4YORA 3HP6A 3P1GA 3ASMA 3OVNA 5FPEA 4NCGA 4WYBA 4QCLA 2VG7A 1V4TA 3B6OA 4CK2A 3EKUA 3QIPA 1RDUA 4M7YA 4JK7A 5AQZA 3THYB 2D4WA 1JLEA 2NRXA 4JRQA 2QM1A 2OPQA 3BZCA 3O4NA 3HO1A 1C1CA 3CYMA 2UXBK 1CXQA 2HBJA 1IG9A 5AQUA 2WOMA 4FVUA 1QSLA 4YNQA 1D9DA 1TAUA 1MA9B 4DR1K 4JKGA 4LH4A 4JKCA 5M1OA 5HRPA 3M8QA 5MLCQ 4WE1A 4B3OA 3ZSXA 4KFBA 1U2VB 3TWHA 3VF4A 5C24A 1HPMA 4DF4A 3L2VA 1A5VA 3U6FA 4JYAK 3QBWA 4HUGA 3WXMB 4B08A 4KHPK 1W9HA 5I3UA 2YNIA 3LAMA 2OPRA 5AQXA 3P31A 1G99A 2O8FB 5EOYA 1Q8IA 4ILGB 3AAQA 1NGDA 4CK3A 2QXFA 4BR9A 2O8EA 4EZ6A 4JD2A 2KTQA 1DGKN 4CFAA 1BL3A 5BRFA 1BU6O 3V1QA 3MWTA 2RHKA 3O3GA 4CI6A 1TKTA 1NK8A 3ZSWA 3BP8A 4M45A 3M8SA 5KGXA 3L0QA 1K73O 4BRGA 2HF3A 1WOQA 4CGJA 2BDPA 4N5SA 3KTQA 3WUHA 3E1YA 1IV0A 1ASUA 1HPZA 4JKEA 4DS4A 3AVBA 1UA1A 3SV4A 2FXUA 4M3ZA 3NGYA 4CJSA 3LZJA 1VSHA 1VQ6N 3VGKA 2QA4N 4K8ZA 4JI2K 4DLEA 1NJXA 5AQTA 3MN6A 3JYTA 3RMDA 1RNHA 5BPNA 4CEFA 2E2QA 4CERA 1VRUA 3ZSZA 4LFBK 3VEWA 2HF4A 4PKHA 3SI6A 5AQJA 5EY4A 5ELZA 1U48A 3FFKB 3EN9A 3RSEB 5BN8A 4A2AA 3SMPA 1NGGA 4DB3A 3P4IA 1ESVA 4DV5K 3DOKA 3R3LA 5E84A 4ELUA 1D8YA 3N4PA 3MEDA 3ZT3A 1K6YA 2B4JA 3OTOK 2UXDK 4Q0BA 4E7JA 3CCMN 4E89A 1KAYA 2H3GX 5AQPA 3L4QA 4CZEA 1EWRA 4BGAA 4AHVA 4JI8K 4H03B 4IFYA 4B9MA 1VHXA 2YHAA 2HHWA 5AFUH 4JKAA 2G8HA 4PKIA 3TSPA 5C10A 3NGZA 1QQMA 2VWBA 1NK0A 1QVFM 4G9ZA 3ENOA 3ZSRA 3VQPA 1U4BA 1CZ9A 3T7ZA 3VQBA 5CR4A 4K41A 5C2DA 4AH9A 2IVOA 3R1XA 4BE0A 2HHQA 4ISFA 1ILYA 4ISEA 1JKHA 2GUIA 1TL1A 2QWRA 1XWLA 4I6MA 4CFBA 3L3UA 4O8KA 3OYFA 3HSTB 1XC9A 4CHZA 4IWVA 3LAKA 3HYFA 2CGLA 3O5BA 1KAZA 4FM0A 3CJ7A 3KD1E 1Z05A 4CGIA 5FRMA 2P9NB 1CZAN 3AVIA 5FPDA 4FWSA 2O8DA 2ZD1A 3A5LC 4C8KA 3DM2A 1IG8A 3CFOA 3ULDA 4DR3K 4ELTA 5HRNA 1J53A 3OHRA 3TSQA 4GVMA 5FLXO 2O8CA 3A5OC 5T7BA 1BCMA 4DS5A 1J5OA 4BRKA 1XNQK 4BDPA 4BR4A 5KRSA 3AO5A 4HTUA 4CZIA 4AHTA 3AGRA 5GAHP 4NLCA 4LF6K 5AQRA 3OYBA 4KRFA 1O13A 4NLBA 4XIUA 2IDOA 2BTFA 4FPAA 2AJQA 3SAGA 4CZMA 3WNFA 5A2QO 2OYQA 5AQMA 4DQPA 3MX5A 3QERA 3VQDA 1KVAA 3FZMA 4N41A 1S5JA 2WFBA 3FR0A 1NMDA 3KK7A 2PYJA 1EO1A 3B6PA 4A61A 1BA1A 3I8DA 5AQYA 4A59A 3ZT0A 1UA0A 2ASOA 3CJCA 4FLYA 2ITGA 3LP0A 4PY5A 4FZZA 3W3DA 3MAQA 1EQYA 2OANA 5BRHA 1VQPN 5F1XA 3CCQN 1GLEG 5EXWA 1W7AA 2YHYA 4Y1CA 3VQQA 5AQSA 3V9XA 4FK2A 4CZGA 4NO7A 3AVFA 4H0YB 4F9OA 2HMPA 4CF0A 4J2BA 3C7NB 3CM6A 2VG6A 4OKKA 5J2PA 1VSIA 4FJMA 1HUXA 4YDUA 4J2AA 3ULEA 3RRGA 4C8MA 3CMEN 4OPHA 3C6TA 4JI5K 3RWUA 4MDAA 3U9DA 4WF9L 3ZT1A 3SUNA 1GLBG 1I3AA 2YJFA 1GLCG 1YXQA 3C65A 4FWRA 2BGGA 1SKWA 5HRSA 4DUZK 3Q7BA 3AY9A 1VQ8N 5AQVA 1SL2A 3GBTA 3MCPA 3E9PA 1S6QA 3H1QA 1VQON 3ENHA 1NNEA 4QAGA 2QEXN 1NKCA 4ICLA 3E01A 3K58A 1SKSA 4JI4K 4DV3K 4IJNA 2G8IA 3K9KA 4PKGA 1Q9YA 4KH5A 3G6EN 4CJTA 4PWDA 1RTJA 2RKIA 4IDHA 3ZSYA 3O3HA 3O9RA 3CPEA 4Y1DA 3CG7A 2YHBA 3DOLA 4W5NA 4DTNA 1Q7YO 1JCFA 1L3SA 4KB0A 1HRHA 3SK3A 3O1BA 4KHNA 2KZZA 4CBUA 1TAQA 1YTAA 2V7YA 4O44A 1QSYA 1Y64A 4EP4A 1N8RO 2KFNA 3CD6N 3V9ZA 4DQSA 2W41A 1WSGA 2YCHA 1H1VA 3LP1A 3AAPA 2A3ZA 3HTVA 4IJAA 3HXMA 3QESA 4F2RA 2CH6A 2HNDA 2OTJN 2E2NA 3G0ZA 4FJ8A 4I9QA 3I56N 5M1NA 4JI3K 3PO5A 1VSEA 2YNHA 3BEXA 3O80A 4BRAA 3EY1A 4WQ4A 4DWIA 4DTMA 2P9IB 1S1XA 2JWKA 3QINA 3PUFA 3MN9A 1IBLK 1IBKK 2UUBK 3AA3A 3THWB 4H5WA 3CC7N 3VQEA 1SL1A 2HVHA 3L6QA 3J8AA 2PFUA 2BH1A 4BY9C 3LDLA 3D2EB 4DTJA 5TKWA 4BRQA 4JHDB 3R9PA 3CFPA 5FRNA 1YTUA 4H4MA 3VQ7A 2AA4A 1ATSA 4XEIA 3VQ6A 3AVHA 3DJCA 5I42A 2PAVA 1N36K 4FJHA 3CC4N 2Z1GA 3ZSVA 1HX1A 4KHSA 4N76A 1T44A 1C0MA 4CZFA 4DF8A 4CJFA 3CXCM 2F9TA 2XY7A 1EP4A 3DLKA 3TR8A 2VWJA 3VA0A 3WT0A 3J7ZO 3QEPA 3EZWA 3NDKA 1MWKA 4BQLA 3A5NC 1HNZK 3VEOA 2P9LB 4FL9A 4H0XB 2HHHK 1EETA 4KH6A 3OA9A 2A5XA 3B8AX 4A5AA 3PIPL 3OYNA 3KD5E 1B9DA 1K8KA 5AQIA 3VETA 3I8BA 1NKBA 3EEQA 1TGOA 3E66A 3DLBA 4LSLA 3P39A 4K0KK 4M42A 3TANA 5EVZA 4XH4A 3FZFA 2IOCA 4NCBA 2G8FA 3UKUA 2BE2A 3O8MA 4R5PA 1OH6A 3ZLJA 1HNXK 4X64K 3LZIA 1GLDG 3OBWA 5DMRA 1IO2A 3KLIA 2P9UA 4KTQA 4O55A 4DSKA 1T3VA 4FJJA 1BIZA 3WEEA 1XMQK 3NH0A 3E9OA 1UWBA 4ID1A 3QETA 1J9AA 1MWMA 3CPWM 3MXMA 3HBTA 2ASPA 4NYNA 3SLCA 1RGIA 5I9EB 5KGWA 4DCHA 2W42A 5DM6L 4DFMA 1NMNA 4BVPA 4MLEA 1K9MO 1FW6A 1CZBA 5CYMA 1ZC6A 4JS5A 1Q86O 3VEZA 4I2QA 4O8UA 4CBXA 4DSJA 4BREA 2YJEA 2P5OA 1NK7A 1XQSC 4CJ3A 4BR2A 5FROA 3THXB 4B9SA 2HBLA 4C1NI 4BDZA 5FDLA 3ZX2A 3TTDA 5IT9O 1WUAA 1LAVA 3P38A 5LY3A 3AA5X 4CEZA 1REVA 2NRHA 3VGLA 4ISGA 5FPNA 5EU7A 1BIUA 1M1KO 3SPZA 2VCPA 3D6RA 4PL8A 3V1OA 1NJIO 4O0IA 1D9FA 2Z1HA 3VQ8A 3AO2A 2CGKA 1KD1O 2PYLA 4B1XB 4DFKA 3V9UA 4CJ5A 1KTQA 3IAYA 3AA2A 2D0CA 3LDSA 4B1ZA 4BRNA 2F4VK 4CJEA 4DKWA 3AVNA 4IEEA 1U49A 1V4SA 4KI4A 1BI4B 1E4GT 3VQAA 3SNNA 2JWLA 1VSMA 2G8KA 3A8YA 3ALYA 3KWGA 4CEBA 3C6UA 3SPYA 1XC3A 1HJOA 2IAJA 1WSEA 4B9UA 1LCUA 2ZE2A 3LM2A 4WFNL 4KB1A 4A62A 3CQYA 1YJNN 2W40A 2XY8A 2QWOA 4BG8A 3SBTA 4BRMA 5JLFA 1DKGD 3K5MA 3FE1A 1BQMA 2D5RA 2FF3B 4R79A 2GWJA 4O5BA 3SQ1A 1NG9A 4CJQA 3HPHA 4CJPA 3DXKA 4IG3A 3M8RA 4B9QA 1VK0A 1EXQA 2DY4A 1SL0A 4DR7K 2YNGA 3OYAA 3AGKA 4OKEA 3O9SA 1BWFO 4IFEA 3VQ9A 1LWEA 1RFQA 2HSTA 1ZXOA 2OPSA 1ZBIA 1N33K 5HP1A 3IKMA 1JJ2M 4MFBA 3CQ8A 4X66K 5HOOA 5M1PA 1BG3A 4E7KA 4DG1A 1SV5A 1QE1A 3SUQA 1C0GA 2A1RA 4PA1A 1U45A 1TYQA 1TK8A 4CIGA 3OYDA 1XMOK 2O4GA 2OZMA 2KW4A 2A6AA 3VEXA 5AQHA 1S3XA 3TAGA 3JSMA 2FBYA 4JEPA 3M6GA 4KTZA 4BRCA 4GV3A 1A5WA 2B6AA 3ZT4A 3O9TA 3SAFA 3MMVA 4PQUA 4HTLA 2RE2A 3HJFA 1BCOA 2BANA 2ZJRL 1KAXA 3FZHA 5BPLA 3ZSOA 3VA3A 1WNSA 4CZLA 4MO5A 2ITMA 4OGCA 1HJRA 2BUPA 2D0AA 4FWMA 1VQLN 3KLHA 4BRDA 4CVNE 3TTFA 1VSFA 3CMAN 3UE5A 2FBVA 2XY6A 3AVLA 4FWLA 1EWQA 1T6CA 1QQOA 1VAZA 5FPMA 4HUEA 3ZX3A 5BR9A 1FKOA 5AR0A 5AQQA 5LJWA 1LWFA 2E1YA 3EE9A 1Q81O 1R0AA 4O5FA 2WONA 3GL1A 3PLAA 5M1QA 4CJUA 5B8HA 3MEEA 5BREA 3SZ2A 3HOTA 3MDQA 4MLHA 3SMSA 4HWIA 2E20A 3NHGA 4KV8A 3F9KA 4GV9A 1J6ZA 3BZKA 2GWKA 3J80O 1XHXA 5AQLA 3J7YP 5KI6A 2QTDA 3HT3A 1WSJA 2IIRA 1KC8O 1I94K 4BRIA 4KO0A 2ATQA 2P9SA 2ZGZA 4CGFA 2XHBA 3CJ9A 1NGIA 2UUAK 4FJ7A 1NM1A 2P9PA 1QVGM 3HM9A 3FZLA 2Q2RA 3MXJA 4KKOA 1W0HA 3OYLA 1S1VA 1QQNA 3BF3A 4K8XA 1IKVA 1D5AA 3I0SA 4K25A 1T8EA 2W6KA 3LWMA 1VRTA 1OH5A 2E6LA 4FOIA 5CZ2A 3U8XA 3SUPA 4A5BA 3VENA 1LV5A 1GLJO 2G8VA 2IVPA 3V9SA 4GMJB 5AZJB 3O9QA 2VQEK 1HLUA 4E7HA 4B8CA 4UY8O 4GY2B 4JNEA 4AHSA 4DSFA 1P90A 3O08A 1L5UA 4FCYA 2E2OA 3VESA 3KK3A 3C0BA 4IFVA 1QTMA 3QEVA 2PBDA 3AVCA 3HSCA 4CD3A 4OPJA 3OW2M 2NUBA 4BE1A 5AFUA 4PL7A 1YUWA 4H8KA 2Q3SA 1G15A 1Q18A 4MDBA 4FJXA 4FSVA 2HW3A 4WFAL 1E4FT 3NH2A 5ADXH 1MU2A 3QNOA 2QW9A 5KQDA 3IDHA 1VQ7N 4M3RA 1Y97A 1SQKA 4B1WB 3THYA 3M5RA 1CXUA 4DLGA 1NGAA 1NWKA 2FBXA 2QWMA 4AILC 4LH5A 4O4GA 1VQMN 5C0YA 1DTQA 3D7EO 3AO1A 1NLVA 4BC3A 3OS1A 5GAEP 3QNNA 1QS4A 4DTSA 3KJVA 2VQFK 2F8SA 5AQGA 1SUQA 3AO4A 4OGEA 1M90O 4LFAK 1WN7A 3EO3A 3VTHA 1ATRA 4LF4K 4N47A 3VEYA 1U2VA 4DV4K 1S9GA 3G71N 2O8BB 4H0VB 2JLEA 2P9KA 4DFPA 4Y0WA 1HKBA 3CJ1A 4QS7A 4HHTA 3OY9A 1JL2A 2ZF5O 4Z4GA 5GIPA 1YVNA 4DTOA 3JS6A 4FLWA 3MN5A 5JVHL 3QEIA 4M3WA 2O8FA 3KLEA 1RT4A 4FW2A 4DSEA 4A2BA 4W5RA 3OS0A 4EFHA 2QK9A 3KK1A 4CZKA 3ATUA 4IOAL 3L2UA 1VSKA 3LDPA 4H0TB 1WB9A 4ZHRA 4B3RK 1R59O 4DU4A 4TSXA 2D0PA 3ZETB 2GBZA 1T05A 1IKXA 3TABA 3K5OA 3UKRB 1ZBLA 1LAWA 3CJBA 4H5TA 3PX0A 4JK8A 4Z4FA 3O6WA 1ZBUA 4BG9A 3O4QA 3NF8A 4BDYA 5JICA 3KKSA 1WAJA 4DR4K 4BR0A 3CCVN 3VGMA 3SUOA 4E1NA 3AV9A 2VGMA 4E1JA 1ZYQA 1X9SA 4RW7A 1QHAA 1YF5L 3IRXA 2X74A 2HHUA 2I7NA 2X6NA 3VTIA 4HCBA 3IUCA 4ID5A 4CHNA 5LMUK 3UB5A 3RSEA 3D2FB 4CJKA 1HKGA 2GX9A 1L3UA 2F8TA 3DMJA 3OYCA 3BUZB 3AO3A 5J2NA 4LF8K 4Z94A 3TAFA 2VGNA 3F2KA 4DQ8A 3M8PA 4DSIA 2HHTA 3G25A 1RDAA 2ZWHA 4CGHA 1MDUB 3LP3A 4GKJK 1Z6RA 2Q97A 4CJLA 3HL8A 3IS9A 1YJ9N 2QWQA 4FYDA 4DTXA 3H08A 4EHTA 2I5JA 3T69A 2PY5A 4RCHA 3PSFA 1ASVA 4CJVA 2ZJPL 2NZTA 3WXIA 5LL6Z 1NOZA 5AZIB 2XRIA 3EZ5A 4GVEA 1X3NA 5AQNA 1LWCA 4GV6A 3VQ4A 4BR5A 1YHQN 3I0RA 3WXJA 5J2MA 1VSDA 2FSNA 5CY4A 1S1WA 4XH5A 5KQ8A 2P9NA 3QLHA 1Z25A 4IDKA 3CCLN 2NLXA 3H3OB 1C0TA 4BWJA 4JI6K 3QB0A 2DFEA 4G1QA 1YJWN 4C1NK 4B1UB 4UQGA 3J7AP 4K42A 1JLAA 1TKZA 4FJ5A 1YITN 3S3NA 4FWNA 4CJRA 1BA0A 1VQ4N 3GOIA 3D45A 2D0OA 2A40A 4K43A 4XH1A 1JLFA 4JKGB 4JAXA 1ITGA 3MX2A 2FSJA 4DUYK 5TKYA 2YKNA 4AHRA 4FLZA 5D3GA 3TU5A 2LSNA 3CCUN 3AVMA 4BRLA 3QICA 5BPMA 5JS2A 4H5VA 4BRPA 2F7TA 5SWMA 4BWMA 4AHCA 1I39A 1CLQA 3NCIA 1Q82O 4YY3K 3RVCA 4W5TA 4YOWA 4B9TA 3M3ZA 4FM1A 4BQZA 1UAXA 3CCSN 2IS3A 1ZBFA 1RT1A 1KSPA 5IWAK 3OJUA 2O8EB 3TAEA 4JD2B 2PZSA 4LF9K 3LDQA 4C23A 3RR8A 3C6HA 3LANA 4FOEA 3THVA 4M7XA 5J1EA 1U47A 4C8OA 4E7LA 3J81O 1OVYA 4Z4IA 1VSLA 1LW0A 3C7NA 3C6AA 3QDKA 1WAFA 2HNYA 3DXMA 1HQUA 1BUPA 2ZQBA 2Z1IA 4FK4A 4Z4EA 1VQKN 1WBDA 2HBMA 1QHTA 4N56A 3NMUA 1OKJA 2YHWA 2VG5A 2Y1JA 5HLFA 2UXCK 4E1MA 3ID8A 4E3SA 1TUUA 3F5TA 1KRPA 3DLGA 1Q9XA 2NRRA 1WLJA 3AARA 4C8LA 1YT3A 1X9WA 4JI1K 1X9JA 1ZBHA 4CF1A 1NGEA 3DLLL 3PV8A 4BC5A 1S22A 1NK6A 1NGHA 3OBYA 3OYHA 3C94A 4YOTA 2F96A 5C25A 1GOBA 1KVCA 4FLVA 4ILJA 3TSUA 4CEAA 3QBXA 3ZSQA 3T1HK 1IKYA 4OJRA 4KAZA 3VN5A 5F2RA 4E7IA 2EWSA 4IXCA 1RT5A 4WQ5C 1S72N 4CCHA 3BY5A 5M1KA 4JRPA 3WNGA 3G4SN 1JCGA 4B9VA 4F2SA 1X9MA 4CD1A 2NRWA 4BGBA 4FZXC 3OYGA 1RT7A 3NE6A 3LALA 4CBWA 3SQ2A 3AVJA 1TL3A 4IBNA 4DR5K 2OZSA 3DLRA 4Z4HA 1NK5A 4KPYA 1NGBA 3MN7A 2DFHA 3U3GA 2QKKA 3CCEN 4CF9A 4CE9A 3FFIA 3V9WA 4AHUA 4WFBL 1C0UA 3A0IX 5CZ1A 3NGIA 2D1KA 3VF2A 3OYJA 5AQKA 3OJSA 1XUPO 4I6MB 1NJZA 2OA8A 2IC3A 3VQCA 1JLGA 4RW9A 5GIOA 3HI0A 4CGGA 3V81A 4NYFA 4FJLA 3NH1A 4FLXA 4CF8A 2HHXA 5EX5A 3CETA 5AQWA 3KIOA 1NKEA 4RTFD 2O8DB 5DK5A 1YI2N 1N32K 1HYZA 4FM2A 1TKDA 4W5QA 2E1ZA 2WTUA 3JAMO 3V6DA 4HVJA 3H46O 4CF2A 2O8CB 2P9IA 3T1AA 3VERA 2NRTA 4L3QA 4JKFA 2XY5A 4RG8A 2V51B 3THWA 4BC4A 4CJ7A 1DEJA 1BOTO 3D2EA 3QFPA 1RT6A 4JHDA 1LW2A 3T3FA 1JCEA 1GLAG 5J2QA 3LM9A 2RPIA 4FWPA 3FLCO 3K9JA 4CJ4A 2JGUA 1S1UA 1RDBA 4LD0A 3SAHA 2KFZA 3CCRN 1IH7A 2Y1IA 2NRZA 2P1JA 4IO9L 1OVQA 1RTDA 3HRGA 4FLUA 4DV7K 4M3UA 3EL2A 4OLBA 4F3TA 2ASMA 3K57A 3K59A 5F0XA 4DMNA 2P9KB 3SYZA 2KZMA 4DFJA 2P9LA 5C2FA 1RT2A 3MK6A 1OH8A 5JVGL 4FJ9A 4V19S 2HMIA 3HZ6A 3HK2A 1YIJN 3SJJA 3TAPA 3ISNC 4EIAA 1C1BA 4F8RA 4NCAA 1NK9A 4B8AB 4JV5K 1NJWA 3T1YK 5GADP 1TK5A 3ZX0A 4B9NA 2Q0UA 4EP5A 1XNRK 5LJVA 1TUYA 3NF6A 1EKEA 4FO0A 1WBBA 1HMVA 4DHYA 3CHWA 4E0DA 2E4LA 4DTUA 4FWKA 3ZYYX 3ENBA 3TPQA 2HHVA 2HHSA 4CESA 3F73A 2HNZA 3O9UA 3ULEB 4FWQA 4M41A 1GOCA 4IKFA 1FJGK 4AM6A 1WSIA 4CZJA 3E9LA 4MQ3A 4EHUA 4KHQA 2R7YA 5LMNK 3AVAA 4J2DA 4LF7K 2YKMA 1A5XA 4CIFA 1KCFA 5CHIA 4AQYK 5M1FA 3NAEA 4IEIA 4RWTA 3WXKA 4DQIA 2QXLA 3L4IA 1F21A 3T19A 4CZHA 2FBTA 4CHYA 1RDWX 2F9WA 1ATNA 5HL7L 4LC9B 3PY8A 4JKDA 4OKJA 4IO8A 4DV0K 4BE2A 4DV6K 3THXA 4YOYA 2XO7A 1T03A 2E2PA 4Q5VA 3HOSA 1TVRA 3QFUA 4CFDA 1W97L 4PUOA 3DLHA 5KTQA 1RTHA 2I7PA 1XI1A 4BRHA 3ID6A 4FLTA 1C0FA 2WC9A 4CJWA 3JXUA 4M3TA 4CK1A 4M63C 2V7ZA 4O0JA 5KRTA 2KHOA 3L2WA
chains in the Genus database with same CATH topology
4RW7A 1JLEA 1TGOA 4JRQA 3DLBA 4LSLA 2OPQA 2X74A 3IRXA 3O4NA 3HO1A 1C1CA 3CYMA 2HHUA 4M42A 3TANA 1T7PA 1CXQA 2X6NA 3MEGA 1IG9A 4HCBA 4RW8A 1S9EA 4E19A 4ID5A 4CHNA 1QQCA 1RBUA 2WOMA 4CEDA 4CJKA 1QSLA 4YNQA 1D9DA 2IOCA 1BI4A 1TAUA 4LH4A 1L3UA 2G8FA 4NCBA 2F8TA 3DMJA 3OYCA 2BE2A 3AO3A 4IG0A 4R5PA 5J2NA 4FJIA 4KHYA 4JS4A 5HRPA 3LZIA 1FXXA 3M8QA 3TAFA 4WE1A 4B3OA 3M8PA 3K2PA 4KFBA 5DMRA 3ZSXA 3TWHA 4DU3A 1IO2A 3KLIA 4DSIA 4KTQA 4L8RB 4O55A 3BDPA 4DSKA 5C24A 3PX4A 4FJJA 4DF4A 3L2VA 1A5VA 1BIZA 3NH0A 2HHTA 3LP2A 3EYZA 1UWBA 4ID1A 4OPKA 3QETA 3U6FA 1J9AA 1RDAA 4HUGA 4B08A 3MXMA 3QO9A 4CGHA 1W9HA 3LP3A 5I3UA 4NYNA 2YNIA 3LAMA 2X78A 3VQ5A 5KGWA 1TKXA 4JLHA 3O3FA 2OPRA 4CJLA 3OYKA 3HL8A 3IS9A 2W42A 4DFMA 3ZCMA 1Q8IA 3BGRA 1C6VA 4FYDA 4DTXA 3H08A 1JXEA 4CK3A 1CZBA 2QXFA 5CYMA 2I5JA 2PY5A 4JS5A 4EZ6A 2KTQA 1ASVA 4I2QA 4CFAA 1BL3A 4CJVA 4BACA 3PX6A 3V1QA 4DSJA 1HYSA 3O3GA 1RILA 1TKTA 4F3OA 1NOZA 2XRIA 4YFUA 3EZ5A 1NK8A 4CHOA 2P5OA 3DI6A 3ZSWA 1VSJA 1NK7A 4I9LA 4CJ3A 3NFAA 1LWCA 4M45A 3VQ4A 3M8SA 5FROA 5KGXA 3I0RA 4B9SA 3A2FA 4BDZA 1HYVA 5J2MA 3TI0A 1VSDA 5CY4A 5FDLA 4CGJA 4DTRA 1S1WA 1LAVA 2BDPA 3DYAA 4N5SA 3KTQA 3AA5X 4CEZA 3QLHA 4IDKA 1Z25A 1REVA 4FJGA 1ASUA 3V1RA 4B9LA 1JLQA 1HPZA 4DS4A 4F4KA 3NBPA 3AVBA 3CFRA 1UA1A 1RTIA 3SV4A 1C0TA 5EU7A 1L3VA 1BIUA 4BWJA 3MECA 3NGYA 4CJSA 3LZJA 1VSHA 3SPZA 4M3ZA 4G1QA 2DFEA 1QTMA 4K8ZA 3V1OA 4DLEA 1NJXA 3HVTA 1FKPA 4O0IA 2Z1HA 1D9FA 3VQ8A 3AO2A 4ZTJA 2PYLA 2B5JA 4M3YA 4UQGA 3JYTA 1JLAA 1TKZA 1RNHA 3V9UA 4CJ5A 4DFKA 4CEFA 1KTQA 4CERA 3RMDA 4CHQA 1VRUA 2EHGA 3DRSA 3AA2A 3QEWA 3IAYA 3ZSZA 2D0CA 4CJRA 3L2QA 3LDSA 3D45A 3SI6A 4KHWA 1WSHA 1YVUA 4CJEA 2FC0A 3LPTA 3AVNA 1U48A 3QIOA 1U49A 1B92A 1L3TA 4KI4A 3WNEA 1BI4B 1KLMA 3AA4A 1JLFA 3VQAA 3SNNA 1VSMA 1ITGA 2G8KA 3ALYA 2YKNA 1JLCA 3K5NA 4CEBA 4AHRA 3C6UA 3DOKA 4FLZA 3SPYA 4ELUA 1D8YA 5D3GA 3MEDA 3L2RA 2IAJA 2LSNA 3ZT3A 5JS1A 3AVMA 3DLEA 1K6YA 2B4JA 1NOYA 1WSEA 4Q0BA 4B9UA 5JS2A 3RMAA 2ZE2A 4DQRA 4E7JA 4KB1A 1TV6A 4E89A 5SWMA 3SQ0A 1RBSA 2XY8A 4BWMA 4Z4CA 4AHCA 1I39A 2HVIA 3P5JA 4AHVA 1CLQA 3NCIA 4DQQA 4IFYA 4B9MA 1KFSA 2IGIA 2YHAA 1UOCA 2HHWA 2G8HA 1B9FA 4W5TA 4B9TA 3NGZA 4H4OA 4CEEA 3K5MA 1BQMA 1UAXA 4FM1A 1NK0A 1QSSA 1O1WA 2D5RA 2QKBA 2IS3A 3ZSRA 4CEQA 4O5BA 1ZBFA 3VQPA 4CJQA 1CZ9A 1RT1A 3HPHA 4CJPA 3VQBA 3SQ1A 3OJUA 1KSPA 3CM5A 4IG3A 3M8RA 4AH9A 1VK0A 1EXQA 3TAEA 2PZSA 2DY4A 3HPGA 4BE0A 1SL0A 1U04A 2HHQA 2YNGA 3OYAA 4RW4A 2HB5A 3OYIA 1JKHA 2GUIA 3RR8A 1TL1A 4OKEA 1XWLA 3LANA 4CFBA 3HP9A 3L3UA 3KK2A 3THVA 1S6PA 1BISA 4I2PA 3OYFA 5J1EA 3VQ9A 1U47A 3HSTB 3HPOA 4E7LA 1LWEA 2OPSA 1XC9A 4CHZA 4C8OA 1RT3A 1ZBIA 4Z4IA 5HROA 5HP1A 1VSLA 3LAKA 3HYFA 1LW0A 4FM0A 4ELVA 2G8WA 4MFBA 3KD1E 3CQ8A 1RDDA 1HQEA 1WAFA 4E7KA 4DG1A 2HNYA 2VWKA 4CGIA 2G8UA 1SV5A 5FRMA 3UIQA 1HQUA 1QE1A 3AVIA 1KLNA 2ZD1A 3D0PA 2O4IA 3SUQA 4C8KA 4HCCA 2ZQBA 3NF9A 2Z1IA 4FK4A 4Z4EA 3DM2A 3CFOA 2A1RA 3ULDA 1FK9A 4ELTA 1QHTA 4PA1A 5HRNA 4N56A 1U45A 1J53A 1TK8A 4CIGA 2VG5A 4GVMA 3RR7A 3OYDA 2Y1JA 1BHLA 5HLFA 2O4GA 2OZMA 5T7BA 1BCMA 4E1MA 2KW4A 4DS5A 4E3SA 1J5OA 4CFCA 1KRPA 3DLGA 4FVMA 1Q9XA 4BDPA 4DSLA 5KRSA 3AO5A 4HTUA 4AHTA 1WLJA 1N5YA 4C8LA 1YT3A 1X9WA 2GV9A 3OYMA 3TAGA 3KKRA 3JSMA 2FBYA 3TARA 1ZBHA 1KVBA 4CF1A 4KTZA 3OYBA 4KRFA 4XIUA 3PV8A 3KLGA 1A5WA 2B6AA 2IDOA 3ZT4A 1NK6A 2AJQA 3OYHA 4PQUA 4KHUA 3C94A 3HJFA 3WNFA 2F96A 5C25A 3PO4A 1GOBA 1KVCA 4FLVA 1BCOA 2OYQA 3QERA 2YNFA 4CEAA 3ZSQA 2BANA 3VQDA 4DQPA 1KVAA 1IKYA 4OJRA 1SKRA 4KAZA 3VN5A 4N41A 3L3VA 4E7IA 1S5JA 3ZSOA 1RT5A 3VA3A 4CCHA 1WNSA 4JRPA 3WNGA 3OS2A 1N6QA 2PYJA 2RF2A 3B6PA 4OGCA 4B9VA 4F2SA 1HJRA 5C42A 1X9MA 1JXBA 5HBMA 2D0AA 3I8DA 4FZXC 3OYGA 3ZT0A 1UA0A 1RT7A 3KLHA 3NE6A 1C1AA 4FLYA 3LALA 2ITGA 1BQNA 3LP0A 4FJ5A 3SQ2A 4KTWA 3DRRA 4EZ9A 3AVJA 4FZZA 1TL3A 4PY5A 4IBNA 1VSFA 2OZSA 3MAQA 1RBRA 3DLRA 4Z4HA 1NK5A 2FBVA 4KPYA 4PWDA 2XY6A 3AVLA 2DFHA 3U3GA 2QKKA 4CF9A 4CE9A 3FFIA 3V9WA 4M3XA 4AHUA 4HUEA 3KLFA 1C0UA 5CZ1A 3NGIA 1HNIA 1FKOA 4Y1CA 3TAMA 3RRHA 3RMCA 3VQQA 4KI6A 3OYJA 3V9XA 3OJSA 1LWFA 1NJZA 1R0AA 2OA8A 4FK2A 2WONA 2IC3A 3AVFA 3VQCA 1JLGA 4CJUA 4RW9A 2DFFA 4FXDA 3RMBA 4CGGA 2KQ2A 3MEEA 4CEOA 3V81A 4CF0A 4NYFA 3SZ2A 4FJLA 4J2BA 1KFDA 3CM6A 3NH1A 4FLXA 4CF8A 2VG6A 4OKKA 3NHGA 1VSIA 4KV8A 5J2PA 2HHXA 3KIOA 1Z26A 3F9KA 1NKEA 4FJMA 5DK5A 1XHXA 5KI6A 4CIEA 1HYZA 4FM2A 3HT3A 1TKDA 2X6SA 4J2AA 1WSJA 3K5LA 4W5QA 3RRGA 3TAQA 1JLBA 2EX3A 3V6DA 4C8MA 4KO0A 4HVJA 3C6TA 2ATQA 4LY7A 1RCHA 1RBTA 4CF2A 1ASWA 3RWUA 4CGFA 2XHBA 4LSNA 3T1AA 3SQ4A 4FJ7A 1RDCA 3ZT1A 3IG1A 3HM9A 4DTPA 4FK0A 2XY5A 3SUNA 3MXJA 4KKOA 2RN2A 1W0HA 4RG8A 3OYLA 1S1VA 1I3AA 4DU1A 4K8XA 3V4IA 1IKVA 1D5AA 3LPUA 3S3NA 3I0SA 2BGGA 1T8EA 4CGDA 3LWMA 1VRTA 1SKWA 4GW6A 5HRSA 2DTUA 1RT6A 2E6LA 1GOAA 1LW2A 5CZ2A 3T3FA 3SUPA 3G10A 3ZT2A 1LV5A 2G8VA 5J2QA 1SL2A 1BGXT 1JL1A 2RPIA 3V9SA 1S6QA 4GMJB 4RW6A 3S3OA 3L8BA 4CJ4A 2JGUA 4CECA 1S1UA 4B8CA 1RDBA 4QAGA 2YV0X 4LD0A 4E7HA 1NKCA 1J54A 3E01A 2A1SA 4ICLA 3K58A 1SKSA 3WNHA 4AHSA 5K14A 2P5GA 2KFZA 3MXIA 4DSFA 1S1TA 1IH7A 1L5UA 2Y1IA 2G8IA 4FCYA 4FJKA 1Q9YA 3S3MA 2P1JA 3KK3A 4IFVA 1RTDA 4CJTA 3QEVA 1RTJA 2RKIA 3ITHA 3ZSYA 3AVCA 3O3HA 4HUFA 4FLUA 4FW1A 4OPJA 1WSFA 2NUBA 3S9HA 4BE1A 4M3UA 4OLBA 1NK4A 4F3TA 3K57A 4Y1DA 4H8KA 1DTTA 2Q3SA 1G15A 3CG7A 2YHBA 4DMNA 3K59A 3P83D 3DOLA 4W5NA 4FJXA 2HW3A 3SYZA 4DTNA 2KZMA 4DFJA 4ZTFA 3SV3A 1XHZA 3NH2A 1L3SA 1MU2A 1RT2A 3DRPA 1HRHA 3QNOA 4KB0A 4KHNA 4FJ9A 2KZZA 3C95A 2ETJA 1TAQA 2HMIA 3HK2A 5SZTA 4OLAA 4M3RA 1YTAA 1X1PA 1Y97A 3ISNC 3SJJA 3TAPA 1C1BA 4O44A 4F8RA 1QSYA 4NCAA 1NK9A 2KFNA 4EP4A 4B8AB 1NJWA 3AVKA 3V9ZA 4DQSA 1CXUA 4DLGA 1TK5A 1WSGA 2FBXA 3LP1A 4AILC 4LH5A 4O4GA 4B9NA 1DTQA 3AO1A 4EP5A 3HXMA 3QESA 1U4BA 4KREA 4F2RA 3OS1A 3QNNA 3NF6A 4I7FA 2HNDA 1HNVA 1QS4A 1EKEA 4DTSA 3KJVA 2F8SA 3LWLA 1SUQA 3AO4A 1HMVA 3AVGA 4OGEA 3G0ZA 2P51A 4FZYA 1WN7A 2E4LA 4E0DA 4DTUA 4FJ8A 4I9QA 5E41A 4N47A 4J2EA 2HHVA 2HHSA 4CESA 3F73A 2HNZA 1DLOA 3PO5A 1S9GA 1VSEA 5CYQA 2JLEA 2YNHA 4DFPA 3QEXA 1NJYA 4HHTA 4M41A 3RTVA 3OY9A 1GOCA 4C8NA 1JL2A 3EY1A 4Z4GA 4DWIA 4IKFA 4DTMA 4DTOA 1S1XA 3QINA 5HRRA 3PUFA 1WSIA 4FLWA 4MQ3A 4KHQA 2R7YA 3AA3A 3AVAA 3OYEA 1EX4A 4J2DA 3VQEA 1SL1A 4W5OA 3QEIA 2HVHA 2YKMA 4M3WA 3KLEA 1A5XA 1RT4A 3NF7A 4CIFA 4DTJA 1YTUA 3CFPA 5FRNA 1KCFA 2D0BA 4FW2A 4H4MA 3NAEA 4DSEA 4W5RA 3VQ7A 4DQIA 3OS0A 2QK9A 2E6MA 3KK1A 1F21A 3U3YA 3T19A 2FBTA 3VQ6A 3AVHA 2Z1JA 4CHYA 3L2UA 3HVRA 1VSKA 4ZHRA 1RBVA 5I42A 3PY8A 4DU4A 4OKJA 4OVLA 4TSXA 4BE2A 4FJHA 4FJNA 2Z1GA 3ZSVA 4KHSA 4Z0UA 4N76A 2GBZA 1T05A 1C0MA 1IKXA 4CHPA 2XO7A 3TABA 3K5OA 3SCXA 1ZBLA 1LAWA 2OPPA 4DF8A 1T03A 4Q5VA 1TK0A 1IKWA 3PX0A 4CJFA 4QOZB 2XY7A 4Z4FA 1EP4A 1TVRA 3DLKA 3TR8A 3P1GA 4CFDA 3HP6A 2VWJA 4PUOA 3VA0A 3DLHA 1ZBUA 3QEPA 5KTQA 3O4QA 3NF8A 3ASMA 3OVNA 4BDYA 3NDKA 1RTHA 3KKSA 4NCGA 1XI1A 1WAJA 4QCLA 2VG7A 3B6OA 4CK2A 4FLTA 1EETA 4CJWA 3QIPA 4M3TA 3OYNA 3KD5E 4CK1A 1B9DA 4E1NA 3AV9A 3SUOA 4O0JA 5KRTA 1NKBA 3L2WA 1ZYQA 1X9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RW7 A;  1JLE A;  1TGO A;  4JRQ A;  3DLB A;  4LSL A;  2OPQ A;  2X74 A;  3IRX A;  3O4N A;  3HO1 A;  1C1C A;  3CYM A;  2HHU A;  4M42 A;  3TAN A;  1T7P A;  1CXQ A;  2X6N A;  3MEG A;  1IG9 A;  4HCB A;  4RW8 A;  1S9E A;  4E19 A;  4ID5 A;  4CHN A;  1QQC A;  1RBU A;  2WOM A;  4CED A;  4CJK A;  1QSL A;  4YNQ A;  1D9D A;  2IOC A;  1BI4 A;  1TAU A;  4LH4 A;  1L3U A;  2G8F A;  4NCB A;  2F8T A;  3DMJ A;  3OYC A;  2BE2 A;  3AO3 A;  4IG0 A;  4R5P A;  5J2N A;  4FJI A;  4KHY A;  4JS4 A;  5HRP A;  3LZI A;  1FXX A;  3M8Q A;  3TAF A;  4WE1 A;  4B3O A;  3M8P A;  3K2P A;  4KFB A;  5DMR A;  3ZSX A;  3TWH A;  4DU3 A;  1IO2 A;  3KLI A;  4DSI A;  4KTQ A;  4L8R B;  4O55 A;  3BDP A;  4DSK A;  5C24 A;  3PX4 A;  4FJJ A;  4DF4 A;  3L2V A;  1A5V A;  1BIZ A;  3NH0 A;  2HHT A;  3LP2 A;  3EYZ A;  1UWB A;  4ID1 A;  4OPK A;  3QET A;  3U6F A;  1J9A A;  1RDA A;  4HUG A;  4B08 A;  3MXM A;  3QO9 A;  4CGH A;  1W9H A;  3LP3 A;  5I3U A;  4NYN A;  2YNI A;  3LAM A;  2X78 A;  3VQ5 A;  5KGW A;  1TKX A;  4JLH A;  3O3F A;  2OPR A;  4CJL A;  3OYK A;  3HL8 A;  3IS9 A;  2W42 A;  4DFM A;  3ZCM A;  1Q8I A;  3BGR A;  1C6V A;  4FYD A;  4DTX A;  3H08 A;  1JXE A;  4CK3 A;  1CZB A;  2QXF A;  5CYM A;  2I5J A;  2PY5 A;  4JS5 A;  4EZ6 A;  2KTQ A;  1ASV A;  4I2Q A;  4CFA A;  1BL3 A;  4CJV A;  4BAC A;  3PX6 A;  3V1Q A;  4DSJ A;  1HYS A;  3O3G A;  1RIL A;  1TKT A;  4F3O A;  1NOZ A;  2XRI A;  4YFU A;  3EZ5 A;  1NK8 A;  4CHO A;  2P5O A;  3DI6 A;  3ZSW A;  1VSJ A;  1NK7 A;  4I9L A;  4CJ3 A;  3NFA A;  1LWC A;  4M45 A;  3VQ4 A;  3M8S A;  5FRO A;  5KGX A;  3I0R A;  4B9S A;  3A2F A;  4BDZ A;  1HYV A;  5J2M A;  3TI0 A;  1VSD A;  5CY4 A;  5FDL A;  4CGJ A;  4DTR A;  1S1W A;  1LAV A;  2BDP A;  3DYA A;  4N5S A;  3KTQ A;  3AA5 X;  4CEZ A;  3QLH A;  4IDK A;  1Z25 A;  1REV A;  4FJG A;  1ASU A;  3V1R A;  4B9L A;  1JLQ A;  1HPZ A;  4DS4 A;  4F4K A;  3NBP A;  3AVB A;  3CFR A;  1UA1 A;  1RTI A;  3SV4 A;  1C0T A;  5EU7 A;  1L3V A;  1BIU A;  4BWJ A;  3MEC A;  3NGY A;  4CJS A;  3LZJ A;  1VSH A;  3SPZ A;  4M3Z A;  4G1Q A;  2DFE A;  1QTM A;  4K8Z A;  3V1O A;  4DLE A;  1NJX A;  3HVT A;  1FKP A;  4O0I A;  2Z1H A;  1D9F A;  3VQ8 A;  3AO2 A;  4ZTJ A;  2PYL A;  2B5J A;  4M3Y A;  4UQG A;  3JYT A;  1JLA A;  1TKZ A;  1RNH A;  3V9U A;  4CJ5 A;  4DFK A;  4CEF A;  1KTQ A;  4CER A;  3RMD A;  4CHQ A;  1VRU A;  2EHG A;  3DRS A;  3AA2 A;  3QEW A;  3IAY A;  3ZSZ A;  2D0C A;  4CJR A;  3L2Q A;  3LDS A;  3D45 A;  3SI6 A;  4KHW A;  1WSH A;  1YVU A;  4CJE A;  2FC0 A;  3LPT A;  3AVN A;  1U48 A;  3QIO A;  1U49 A;  1B92 A;  1L3T A;  4KI4 A;  3WNE A;  1BI4 B;  1KLM A;  3AA4 A;  1JLF A;  3VQA A;  3SNN A;  1VSM A;  1ITG A;  2G8K A;  3ALY A;  2YKN A;  1JLC A;  3K5N A;  4CEB A;  4AHR A;  3C6U A;  3DOK A;  4FLZ A;  3SPY A;  4ELU A;  1D8Y A;  5D3G A;  3MED A;  3L2R A;  2IAJ A;  2LSN A;  3ZT3 A;  5JS1 A;  3AVM A;  3DLE A;  1K6Y A;  2B4J A;  1NOY A;  1WSE A;  4Q0B A;  4B9U A;  5JS2 A;  3RMA A;  2ZE2 A;  4DQR A;  4E7J A;  4KB1 A;  1TV6 A;  4E89 A;  5SWM A;  3SQ0 A;  1RBS A;  2XY8 A;  4BWM A;  4Z4C A;  4AHC A;  1I39 A;  2HVI A;  3P5J A;  4AHV A;  1CLQ A;  3NCI A;  4DQQ A;  4IFY A;  4B9M A;  1KFS A;  2IGI A;  2YHA A;  1UOC A;  2HHW A;  2G8H A;  1B9F A;  4W5T A;  4B9T A;  3NGZ A;  4H4O A;  4CEE A;  3K5M A;  1BQM A;  1UAX A;  4FM1 A;  1NK0 A;  1QSS A;  1O1W A;  2D5R A;  2QKB A;  2IS3 A;  3ZSR A;  4CEQ A;  4O5B A;  1ZBF A;  3VQP A;  4CJQ A;  1CZ9 A;  1RT1 A;  3HPH A;  4CJP A;  3VQB A;  3SQ1 A;  3OJU A;  1KSP A;  3CM5 A;  4IG3 A;  3M8R A;  4AH9 A;  1VK0 A;  1EXQ A;  3TAE A;  2PZS A;  2DY4 A;  3HPG A;  4BE0 A;  1SL0 A;  1U04 A;  2HHQ A;  2YNG A;  3OYA A;  4RW4 A;  2HB5 A;  3OYI A;  1JKH A;  2GUI A;  3RR8 A;  1TL1 A;  4OKE A;  1XWL A;  3LAN A;  4CFB A;  3HP9 A;  3L3U A;  3KK2 A;  3THV A;  1S6P A;  1BIS A;  4I2P A;  3OYF A;  5J1E A;  3VQ9 A;  1U47 A;  3HST B;  3HPO A;  4E7L A;  1LWE A;  2OPS A;  1XC9 A;  4CHZ A;  4C8O A;  1RT3 A;  1ZBI A;  4Z4I A;  5HRO A;  5HP1 A;  1VSL A;  3LAK A;  3HYF A;  1LW0 A;  4FM0 A;  4ELV A;  2G8W A;  4MFB A;  3KD1 E;  3CQ8 A;  1RDD A;  1HQE A;  1WAF A;  4E7K A;  4DG1 A;  2HNY A;  2VWK A;  4CGI A;  2G8U A;  1SV5 A;  5FRM A;  3UIQ A;  1HQU A;  1QE1 A;  3AVI A;  1KLN A;  2ZD1 A;  3D0P A;  2O4I A;  3SUQ A;  4C8K A;  4HCC A;  2ZQB A;  3NF9 A;  2Z1I A;  4FK4 A;  4Z4E A;  3DM2 A;  3CFO A;  2A1R A;  3ULD A;  1FK9 A;  4ELT A;  1QHT A;  4PA1 A;  5HRN A;  4N56 A;  1U45 A;  1J53 A;  1TK8 A;  4CIG A;  2VG5 A;  4GVM A;  3RR7 A;  3OYD A;  2Y1J A;  1BHL A;  5HLF A;  2O4G A;  2OZM A;  5T7B A;  1BCM A;  4E1M A;  2KW4 A;  4DS5 A;  4E3S A;  1J5O A;  4CFC A;  1KRP A;  3DLG A;  4FVM A;  1Q9X A;  4BDP A;  4DSL A;  5KRS A;  3AO5 A;  4HTU A;  4AHT A;  1WLJ A;  1N5Y A;  4C8L A;  1YT3 A;  1X9W A;  2GV9 A;  3OYM A;  3TAG A;  3KKR A;  3JSM A;  2FBY A;  3TAR A;  1ZBH A;  1KVB A;  4CF1 A;  4KTZ A;  3OYB A;  4KRF A;  4XIU A;  3PV8 A;  3KLG A;  1A5W A;  2B6A A;  2IDO A;  3ZT4 A;  1NK6 A;  2AJQ A;  3OYH A;  4PQU A;  4KHU A;  3C94 A;  3HJF A;  3WNF A;  2F96 A;  5C25 A;  3PO4 A;  1GOB A;  1KVC A;  4FLV A;  1BCO A;  2OYQ A;  3QER A;  2YNF A;  4CEA A;  3ZSQ A;  2BAN A;  3VQD A;  4DQP A;  1KVA A;  1IKY A;  4OJR A;  1SKR A;  4KAZ A;  3VN5 A;  4N41 A;  3L3V A;  4E7I A;  1S5J A;  3ZSO A;  1RT5 A;  3VA3 A;  4CCH A;  1WNS A;  4JRP A;  3WNG A;  3OS2 A;  1N6Q A;  2PYJ A;  2RF2 A;  3B6P A;  4OGC A;  4B9V A;  4F2S A;  1HJR A;  5C42 A;  1X9M A;  1JXB A;  5HBM A;  2D0A A;  3I8D A;  4FZX C;  3OYG A;  3ZT0 A;  1UA0 A;  1RT7 A;  3KLH A;  3NE6 A;  1C1A A;  4FLY A;  3LAL A;  2ITG A;  1BQN A;  3LP0 A;  4FJ5 A;  3SQ2 A;  4KTW A;  3DRR A;  4EZ9 A;  3AVJ A;  4FZZ A;  1TL3 A;  4PY5 A;  4IBN A;  1VSF A;  2OZS A;  3MAQ A;  1RBR A;  3DLR A;  4Z4H A;  1NK5 A;  2FBV A;  4KPY A;  4PWD A;  2XY6 A;  3AVL A;  2DFH A;  3U3G A;  2QKK A;  4CF9 A;  4CE9 A;  3FFI A;  3V9W A;  4M3X A;  4AHU A;  4HUE A;  3KLF A;  1C0U A;  5CZ1 A;  3NGI A;  1HNI A;  1FKO A;  4Y1C A;  3TAM A;  3RRH A;  3RMC A;  3VQQ A;  4KI6 A;  3OYJ A;  3V9X A;  3OJS A;  1LWF A;  1NJZ A;  1R0A A;  2OA8 A;  4FK2 A;  2WON A;  2IC3 A;  3AVF A;  3VQC A;  1JLG A;  4CJU A;  4RW9 A;  2DFF A;  4FXD A;  3RMB A;  4CGG A;  2KQ2 A;  3MEE A;  4CEO A;  3V81 A;  4CF0 A;  4NYF A;  3SZ2 A;  4FJL A;  4J2B A;  1KFD A;  3CM6 A;  3NH1 A;  4FLX A;  4CF8 A;  2VG6 A;  4OKK A;  3NHG A;  1VSI A;  4KV8 A;  5J2P A;  2HHX A;  3KIO A;  1Z26 A;  3F9K A;  1NKE A;  4FJM A;  5DK5 A;  1XHX A;  5KI6 A;  4CIE A;  1HYZ A;  4FM2 A;  3HT3 A;  1TKD A;  2X6S A;  4J2A A;  1WSJ A;  3K5L A;  4W5Q A;  3RRG A;  3TAQ A;  1JLB A;  2EX3 A;  3V6D A;  4C8M A;  4KO0 A;  4HVJ A;  3C6T A;  2ATQ A;  4LY7 A;  1RCH A;  1RBT A;  4CF2 A;  1ASW A;  3RWU A;  4CGF A;  2XHB A;  4LSN A;  3T1A A;  3SQ4 A;  4FJ7 A;  1RDC A;  3ZT1 A;  3IG1 A;  3HM9 A;  4DTP A;  4FK0 A;  2XY5 A;  3SUN A;  3MXJ A;  4KKO A;  2RN2 A;  1W0H A;  4RG8 A;  3OYL A;  1S1V A;  1I3A A;  4DU1 A;  4K8X A;  3V4I A;  1IKV A;  1D5A A;  3LPU A;  3S3N A;  3I0S A;  2BGG A;  1T8E A;  4CGD A;  3LWM A;  1VRT A;  1SKW A;  4GW6 A;  5HRS A;  2DTU A;  1RT6 A;  2E6L A;  1GOA A;  1LW2 A;  5CZ2 A;  3T3F A;  3SUP A;  3G10 A;  3ZT2 A;  1LV5 A;  2G8V A;  5J2Q A;  1SL2 A;  1BGX T;  1JL1 A;  2RPI A;  3V9S A;  1S6Q A;  4GMJ B;  4RW6 A;  3S3O A;  3L8B A;  4CJ4 A;  2JGU A;  4CEC A;  1S1U A;  4B8C A;  1RDB A;  4QAG A;  2YV0 X;  4LD0 A;  4E7H A;  1NKC A;  1J54 A;  3E01 A;  2A1S A;  4ICL A;  3K58 A;  1SKS A;  3WNH A;  4AHS A;  5K14 A;  2P5G A;  2KFZ A;  3MXI A;  4DSF A;  1S1T A;  1IH7 A;  1L5U A;  2Y1I A;  2G8I A;  4FCY A;  4FJK A;  1Q9Y A;  3S3M A;  2P1J A;  3KK3 A;  4IFV A;  1RTD A;  4CJT A;  3QEV A;  1RTJ A;  2RKI A;  3ITH A;  3ZSY A;  3AVC A;  3O3H A;  4HUF A;  4FLU A;  4FW1 A;  4OPJ A;  1WSF A;  2NUB A;  3S9H A;  4BE1 A;  4M3U A;  4OLB A;  1NK4 A;  4F3T A;  3K57 A;  4Y1D A;  4H8K A;  1DTT A;  2Q3S A;  1G15 A;  3CG7 A;  2YHB A;  4DMN A;  3K59 A;  3P83 D;  3DOL A;  4W5N A;  4FJX A;  2HW3 A;  3SYZ A;  4DTN A;  2KZM A;  4DFJ A;  4ZTF A;  3SV3 A;  1XHZ A;  3NH2 A;  1L3S A;  1MU2 A;  1RT2 A;  3DRP A;  1HRH A;  3QNO A;  4KB0 A;  4KHN A;  4FJ9 A;  2KZZ A;  3C95 A;  2ETJ A;  1TAQ A;  2HMI A;  3HK2 A;  5SZT A;  4OLA A;  4M3R A;  1YTA A;  1X1P A;  1Y97 A;  3ISN C;  3SJJ A;  3TAP A;  1C1B A;  4O44 A;  4F8R A;  1QSY A;  4NCA A;  1NK9 A;  2KFN A;  4EP4 A;  4B8A B;  1NJW A;  3AVK A;  3V9Z A;  4DQS A;  1CXU A;  4DLG A;  1TK5 A;  1WSG A;  2FBX A;  3LP1 A;  4AIL C;  4LH5 A;  4O4G A;  4B9N A;  1DTQ A;  3AO1 A;  4EP5 A;  3HXM A;  3QES A;  1U4B A;  4KRE A;  4F2R A;  3OS1 A;  3QNN A;  3NF6 A;  4I7F A;  2HND A;  1HNV A;  1QS4 A;  1EKE A;  4DTS A;  3KJV A;  2F8S A;  3LWL A;  1SUQ A;  3AO4 A;  1HMV A;  3AVG A;  4OGE A;  3G0Z A;  2P51 A;  4FZY A;  1WN7 A;  2E4L A;  4E0D A;  4DTU A;  4FJ8 A;  4I9Q A;  5E41 A;  4N47 A;  4J2E A;  2HHV A;  2HHS A;  4CES A;  3F73 A;  2HNZ A;  1DLO A;  3PO5 A;  1S9G A;  1VSE A;  5CYQ A;  2JLE A;  2YNH A;  4DFP A;  3QEX A;  1NJY A;  4HHT A;  4M41 A;  3RTV A;  3OY9 A;  1GOC A;  4C8N A;  1JL2 A;  3EY1 A;  4Z4G A;  4DWI A;  4IKF A;  4DTM A;  4DTO A;  1S1X A;  3QIN A;  5HRR A;  3PUF A;  1WSI A;  4FLW A;  4MQ3 A;  4KHQ A;  2R7Y A;  3AA3 A;  3AVA A;  3OYE A;  1EX4 A;  4J2D A;  3VQE A;  1SL1 A;  4W5O A;  3QEI A;  2HVH A;  2YKM A;  4M3W A;  3KLE A;  1A5X A;  1RT4 A;  3NF7 A;  4CIF A;  4DTJ A;  1YTU A;  3CFP A;  5FRN A;  1KCF A;  2D0B A;  4FW2 A;  4H4M A;  3NAE A;  4DSE A;  4W5R A;  3VQ7 A;  4DQI A;  3OS0 A;  2QK9 A;  2E6M A;  3KK1 A;  1F21 A;  3U3Y A;  3T19 A;  2FBT A;  3VQ6 A;  3AVH A;  2Z1J A;  4CHY A;  3L2U A;  3HVR A;  1VSK A;  4ZHR A;  1RBV A;  5I42 A;  3PY8 A;  4DU4 A;  4OKJ A;  4OVL A;  4TSX A;  4BE2 A;  4FJH A;  4FJN A;  2Z1G A;  3ZSV A;  4KHS A;  4Z0U A;  4N76 A;  2GBZ A;  1T05 A;  1C0M A;  1IKX A;  4CHP A;  2XO7 A;  3TAB A;  3K5O A;  3SCX A;  1ZBL A;  1LAW A;  2OPP A;  4DF8 A;  1T03 A;  4Q5V A;  1TK0 A;  1IKW A;  3PX0 A;  4CJF A;  4QOZ B;  2XY7 A;  4Z4F A;  1EP4 A;  1TVR A;  3DLK A;  3TR8 A;  3P1G A;  4CFD A;  3HP6 A;  2VWJ A;  4PUO A;  3VA0 A;  3DLH A;  1ZBU A;  3QEP A;  5KTQ A;  3O4Q A;  3NF8 A;  3ASM A;  3OVN A;  4BDY A;  3NDK A;  1RTH A;  3KKS A;  4NCG A;  1XI1 A;  1WAJ A;  4QCL A;  2VG7 A;  3B6O A;  4CK2 A;  4FLT A;  1EET A;  4CJW A;  3QIP A;  4M3T A;  3OYN A;  3KD5 E;  4CK1 A;  1B9D A;  4E1N A;  3AV9 A;  3SUO A;  4O0J A;  5KRT A;  1NKB A;  3L2W A;  1ZYQ A;  1X9S A; 
#chains in the Genus database with same CATH topology
 4DR6 K;  4JK9 A;  1T7P A;  3MEG A;  4RW8 A;  1S9E A;  4E19 A;  4PHT X;  1QQC A;  1RBU A;  4CED A;  1T6D A;  1BI4 A;  3ZEU A;  4IG0 A;  4FJI A;  4KHY A;  4JS4 A;  1FXX A;  2GUP A;  3K2P A;  2Q0R A;  4DU3 A;  4L8R B;  3BDP A;  4OPA A;  3PX4 A;  3LP2 A;  3EYZ A;  4OPK A;  3QO9 A;  2YI1 A;  2X78 A;  4IZ9 A;  3VQ5 A;  1TKX A;  4JLH A;  3O3F A;  3OYK A;  5KPR A;  2UUC K;  3H1V X;  3ZCM A;  4GNI A;  3BGR A;  1C6V A;  4B1V A;  2UU9 K;  1JXE A;  2V52 B;  2QWN A;  2WBN A;  3BF1 A;  1HNW K;  4BAC A;  1NGF A;  3PX6 A;  1HYS A;  4B3M K;  2OCE A;  1RIL A;  4F3O A;  4YFU A;  4CHO A;  4B3T K;  3DI6 A;  1VSJ A;  4I9L A;  2CH5 A;  3NFA A;  5H1S Q;  3WXL A;  3A2F A;  1HYV A;  4BC2 A;  3TI0 A;  4DTR A;  3DYA A;  3I55 N;  2DPN A;  4FJG A;  5KPZ A;  3V1R A;  4B9L A;  2WUS A;  1JLQ A;  3GG4 A;  4F4K A;  3NBP A;  5ADX A;  3CFR A;  3GE1 A;  1VQN N;  1RTI A;  1L3V A;  3MEC A;  3M1F A;  3MWP A;  3WQT A;  3HVT A;  1FKP A;  5BN9 A;  1VQ5 N;  4ZTJ A;  2ZJQ L;  2B5J A;  4M3Y A;  2Q1N A;  1U6Z A;  4KH4 A;  1K8K B;  3TAR A;  4AM7 A;  2EHG A;  4CHQ A;  3DRS A;  3QEW A;  3L2Q A;  4KHW A;  1WSH A;  2QI2 A;  1YVU A;  3WQU A;  3VMF B;  2FC0 A;  3LPT A;  3QIO A;  2GEM A;  2A41 A;  1B92 A;  2IVN A;  1L3T A;  3KHY A;  3WNE A;  1KLM A;  3AA4 A;  3UKU B;  3DWL A;  1JLC A;  3K5N A;  5AQO A;  3L2R A;  5JS1 A;  1ZBS A;  3DLE A;  2P9U B;  1NOY A;  4KBO A;  3F9M A;  3EKS A;  5DM7 L;  3RMA A;  3H45 C;  4DQR A;  3WEE B;  1TV6 A;  1K8A O;  3DXM B;  3SQ0 A;  1RBS A;  4Z4C A;  2HVI A;  3P5J A;  1LOT B;  4DQQ A;  1KFS A;  2IGI A;  1UOC A;  2QWL A;  1B9F A;  1BO5 O;  4NXM K;  4H4O A;  4CEE A;  4U67 L;  1QSS A;  2QKB A;  1O1W A;  4CEQ A;  1SAZ A;  4OX9 K;  3CM5 A;  2CGJ A;  3R8E A;  3HPG A;  1U04 A;  4JI0 K;  3KVG A;  4FPB A;  4RW4 A;  2HB5 A;  4DV1 K;  3OYI A;  4IOX A;  4JI7 K;  3HP9 A;  3KK2 A;  3I33 A;  1S6P A;  5JMV A;  1BIS A;  4I2P A;  3S41 A;  5C15 A;  3HPO A;  4BVO A;  1RT3 A;  2KLA A;  5HRO A;  4ELV A;  1VQ9 N;  2G8W A;  2GEL A;  1RDD A;  1HQE A;  3CIP A;  4CW7 B;  2VWK A;  2AP1 A;  2G8U A;  3UIQ A;  1KLN A;  2O4I A;  3LDN A;  3VOV A;  3D0P A;  4YHH K;  4HCC A;  3NF9 A;  1FK9 A;  2E88 A;  5BRD A;  4QS8 A;  3RR7 A;  3MCA B;  1SZ2 A;  1BHL A;  2ZM6 K;  1DT9 A;  4CFC A;  2W6L A;  4FVM A;  4BR7 A;  4DSL A;  1BDG A;  1YAG A;  1N5Y A;  1J5E K;  3HM8 A;  2GV9 A;  3OYM A;  3KKR A;  1KVB A;  2E8A A;  3KLG A;  1GLL O;  3KWI A;  3VF6 A;  4KHU A;  5AZJ A;  1OH7 A;  3PO4 A;  3LDO A;  2YNF A;  4JKB A;  1SKR A;  2E5L K;  3L3V A;  2UYT A;  5GAG P;  3CJA A;  1IJJ A;  2NNW A;  3PIO L;  3EE8 A;  2HBK A;  1N6Q A;  3OS2 A;  3FZK A;  2RF2 A;  2NRV A;  4A57 A;  5C42 A;  1JXB A;  5HBM A;  3SBG A;  3CF5 L;  1W2B M;  2GTD A;  3NVK A;  1NGC A;  1C1A A;  4YOV A;  1BQN A;  4MO4 A;  4EZ9 A;  4KTW A;  3DRR A;  2FLO A;  4NB4 A;  1RBR A;  4QS9 A;  1SS6 A;  3CER A;  3FGU A;  4B1Y B;  4X62 K;  3DXK B;  1KQS M;  4NXN K;  2FF6 A;  4WQ5 A;  4YDU C;  4M3X A;  2OTL N;  3KLF A;  1HNI A;  3TAM A;  4KI6 A;  3RRH A;  3O4W A;  3RMC A;  3ATV A;  3U9Z A;  4AF1 A;  2YX6 A;  3N4Q A;  2DFF A;  4FXD A;  3RMB A;  1NGJ A;  2KQ2 A;  5KPT A;  2Q31 A;  4CEO A;  1KFD A;  4OO1 J;  4B3S K;  1Z26 A;  1QZ6 A;  4LFC K;  4CIE A;  5AQF A;  2X6S A;  2O8B A;  4H5R A;  3K5L A;  3TAQ A;  1JLB A;  2EX3 A;  1TYQ B;  4LY7 A;  1N34 K;  1RCH A;  1RBT A;  1ASW A;  1NBW A;  4BRO A;  3QML A;  4LSN A;  3SQ4 A;  1RDC A;  3IG1 A;  3H3N O;  4DTP A;  4FK0 A;  4DU1 A;  2RN2 A;  3V4I A;  4LF5 K;  3GDQ A;  3LPU A;  4CGD A;  2DTU A;  4GW6 A;  1GOA A;  4H5N A;  2FSK A;  3G10 A;  3ZT2 A;  4BRF A;  4YOU A;  1BGX T;  1JL1 A;  4RW6 A;  3S3O A;  2YHX A;  3L8B A;  1QZ5 A;  4CEC A;  2YV0 X;  3TTC A;  1J54 A;  2A1S A;  5BR8 K;  3A5M C;  3WNH A;  5K14 A;  2P5G A;  3MXI A;  3ZET A;  1S1T A;  1X3M A;  3CC2 N;  2Q36 A;  5C12 A;  3LL3 A;  4FJK A;  3S3M A;  3UKR A;  3ITH A;  3VPZ A;  4HUF A;  4FW1 A;  1WSF A;  3S9H A;  1NK4 A;  3CCJ N;  1DTT A;  4X65 K;  4ILH A;  3P83 D;  2QWP A;  4ZTF A;  3SV3 A;  1XHZ A;  3NVM A;  3DRP A;  4WCE L;  3C95 A;  2ETJ A;  5SZT A;  4OLA A;  1X1P A;  5JLH A;  3DAW A;  4GKK K;  3AVK A;  3CI5 A;  3PSI A;  4IOC L;  1HR0 K;  5CE3 A;  4WQ4 C;  4KRE A;  4I7F A;  5AJ3 K;  1GLF O;  1KXP A;  1HNV A;  3D2F A;  3U4L A;  3LWL A;  3AVG A;  5GIN A;  2P51 A;  1NU0 A;  4DV2 K;  4FZY A;  2A42 A;  1D4X A;  3IFR A;  3IMX A;  5E41 A;  4J2E A;  2VYP A;  2J4R A;  5E26 A;  1DLO A;  3VEV A;  5CYQ A;  3Q7C A;  3R6M A;  3QEX A;  1NJY A;  4EAH D;  3RTV A;  4C8N A;  2P9S B;  3H6E A;  4J8F A;  4H0O A;  5HRR A;  4H0P A;  2P9P B;  3CQX A;  1IBM K;  1P8Z A;  1E3M A;  4DR2 K;  4JN4 A;  1EX4 A;  3OYE A;  4W5O A;  2ZGY A;  3O1W A;  3NF7 A;  4U7B A;  2D0B A;  3K0S A;  2KKZ A;  1HKC A;  3W0L A;  2E6M A;  3U3Y A;  2HOE A;  2Z1J A;  3HVR A;  5AZI A;  1RBV A;  4YOX A;  4JKH A;  4OVL A;  4FJN A;  4FWO A;  3KZB A;  4Z0U A;  3ZEU B;  3SJH A;  4CHP A;  3SCX A;  2OPP A;  1TK0 A;  1IKW A;  4QOZ B;  4YOR A;  3HP6 A;  3P1G A;  3ASM A;  3OVN A;  5FPE A;  4NCG A;  4WYB A;  4QCL A;  2VG7 A;  1V4T A;  3B6O A;  4CK2 A;  3EKU A;  3QIP A;  1RDU A;  4M7Y A;  4JK7 A;  5AQZ A;  3THY B;  2D4W A;  1JLE A;  2NRX A;  4JRQ A;  2QM1 A;  2OPQ A;  3BZC A;  3O4N A;  3HO1 A;  1C1C A;  3CYM A;  2UXB K;  1CXQ A;  2HBJ A;  1IG9 A;  5AQU A;  2WOM A;  4FVU A;  1QSL A;  4YNQ A;  1D9D A;  1TAU A;  1MA9 B;  4DR1 K;  4JKG A;  4LH4 A;  4JKC A;  5M1O A;  5HRP A;  3M8Q A;  5MLC Q;  4WE1 A;  4B3O A;  3ZSX A;  4KFB A;  1U2V B;  3TWH A;  3VF4 A;  5C24 A;  1HPM A;  4DF4 A;  3L2V A;  1A5V A;  3U6F A;  4JYA K;  3QBW A;  4HUG A;  3WXM B;  4B08 A;  4KHP K;  1W9H A;  5I3U A;  2YNI A;  3LAM A;  2OPR A;  5AQX A;  3P31 A;  1G99 A;  2O8F B;  5EOY A;  1Q8I A;  4ILG B;  3AAQ A;  1NGD A;  4CK3 A;  2QXF A;  4BR9 A;  2O8E A;  4EZ6 A;  4JD2 A;  2KTQ A;  1DGK N;  4CFA A;  1BL3 A;  5BRF A;  1BU6 O;  3V1Q A;  3MWT A;  2RHK A;  3O3G A;  4CI6 A;  1TKT A;  1NK8 A;  3ZSW A;  3BP8 A;  4M45 A;  3M8S A;  5KGX A;  3L0Q A;  1K73 O;  4BRG A;  2HF3 A;  1WOQ A;  4CGJ A;  2BDP A;  4N5S A;  3KTQ A;  3WUH A;  3E1Y A;  1IV0 A;  1ASU A;  1HPZ A;  4JKE A;  4DS4 A;  3AVB A;  1UA1 A;  3SV4 A;  2FXU A;  4M3Z A;  3NGY A;  4CJS A;  3LZJ A;  1VSH A;  1VQ6 N;  3VGK A;  2QA4 N;  4K8Z A;  4JI2 K;  4DLE A;  1NJX A;  5AQT A;  3MN6 A;  3JYT A;  3RMD A;  1RNH A;  5BPN A;  4CEF A;  2E2Q A;  4CER A;  1VRU A;  3ZSZ A;  4LFB K;  3VEW A;  2HF4 A;  4PKH A;  3SI6 A;  5AQJ A;  5EY4 A;  5ELZ A;  1U48 A;  3FFK B;  3EN9 A;  3RSE B;  5BN8 A;  4A2A A;  3SMP A;  1NGG A;  4DB3 A;  3P4I A;  1ESV A;  4DV5 K;  3DOK A;  3R3L A;  5E84 A;  4ELU A;  1D8Y A;  3N4P A;  3MED A;  3ZT3 A;  1K6Y A;  2B4J A;  3OTO K;  2UXD K;  4Q0B A;  4E7J A;  3CCM N;  4E89 A;  1KAY A;  2H3G X;  5AQP A;  3L4Q A;  4CZE A;  1EWR A;  4BGA A;  4AHV A;  4JI8 K;  4H03 B;  4IFY A;  4B9M A;  1VHX A;  2YHA A;  2HHW A;  5AFU H;  4JKA A;  2G8H A;  4PKI A;  3TSP A;  5C10 A;  3NGZ A;  1QQM A;  2VWB A;  1NK0 A;  1QVF M;  4G9Z A;  3ENO A;  3ZSR A;  3VQP A;  1U4B A;  1CZ9 A;  3T7Z A;  3VQB A;  5CR4 A;  4K41 A;  5C2D A;  4AH9 A;  2IVO A;  3R1X A;  4BE0 A;  2HHQ A;  4ISF A;  1ILY A;  4ISE A;  1JKH A;  2GUI A;  1TL1 A;  2QWR A;  1XWL A;  4I6M A;  4CFB A;  3L3U A;  4O8K A;  3OYF A;  3HST B;  1XC9 A;  4CHZ A;  4IWV A;  3LAK A;  3HYF A;  2CGL A;  3O5B A;  1KAZ A;  4FM0 A;  3CJ7 A;  3KD1 E;  1Z05 A;  4CGI A;  5FRM A;  2P9N B;  1CZA N;  3AVI A;  5FPD A;  4FWS A;  2O8D A;  2ZD1 A;  3A5L C;  4C8K A;  3DM2 A;  1IG8 A;  3CFO A;  3ULD A;  4DR3 K;  4ELT A;  5HRN A;  1J53 A;  3OHR A;  3TSQ A;  4GVM A;  5FLX O;  2O8C A;  3A5O C;  5T7B A;  1BCM A;  4DS5 A;  1J5O A;  4BRK A;  1XNQ K;  4BDP A;  4BR4 A;  5KRS A;  3AO5 A;  4HTU A;  4CZI A;  4AHT A;  3AGR A;  5GAH P;  4NLC A;  4LF6 K;  5AQR A;  3OYB A;  4KRF A;  1O13 A;  4NLB A;  4XIU A;  2IDO A;  2BTF A;  4FPA A;  2AJQ A;  3SAG A;  4CZM A;  3WNF A;  5A2Q O;  2OYQ A;  5AQM A;  4DQP A;  3MX5 A;  3QER A;  3VQD A;  1KVA A;  3FZM A;  4N41 A;  1S5J A;  2WFB A;  3FR0 A;  1NMD A;  3KK7 A;  2PYJ A;  1EO1 A;  3B6P A;  4A61 A;  1BA1 A;  3I8D A;  5AQY A;  4A59 A;  3ZT0 A;  1UA0 A;  2ASO A;  3CJC A;  4FLY A;  2ITG A;  3LP0 A;  4PY5 A;  4FZZ A;  3W3D A;  3MAQ A;  1EQY A;  2OAN A;  5BRH A;  1VQP N;  5F1X A;  3CCQ N;  1GLE G;  5EXW A;  1W7A A;  2YHY A;  4Y1C A;  3VQQ A;  5AQS A;  3V9X A;  4FK2 A;  4CZG A;  4NO7 A;  3AVF A;  4H0Y B;  4F9O A;  2HMP A;  4CF0 A;  4J2B A;  3C7N B;  3CM6 A;  2VG6 A;  4OKK A;  5J2P A;  1VSI A;  4FJM A;  1HUX A;  4YDU A;  4J2A A;  3ULE A;  3RRG A;  4C8M A;  3CME N;  4OPH A;  3C6T A;  4JI5 K;  3RWU A;  4MDA A;  3U9D A;  4WF9 L;  3ZT1 A;  3SUN A;  1GLB G;  1I3A A;  2YJF A;  1GLC G;  1YXQ A;  3C65 A;  4FWR A;  2BGG A;  1SKW A;  5HRS A;  4DUZ K;  3Q7B A;  3AY9 A;  1VQ8 N;  5AQV A;  1SL2 A;  3GBT A;  3MCP A;  3E9P A;  1S6Q A;  3H1Q A;  1VQO N;  3ENH A;  1NNE A;  4QAG A;  2QEX N;  1NKC A;  4ICL A;  3E01 A;  3K58 A;  1SKS A;  4JI4 K;  4DV3 K;  4IJN A;  2G8I A;  3K9K A;  4PKG A;  1Q9Y A;  4KH5 A;  3G6E N;  4CJT A;  4PWD A;  1RTJ A;  2RKI A;  4IDH A;  3ZSY A;  3O3H A;  3O9R A;  3CPE A;  4Y1D A;  3CG7 A;  2YHB A;  3DOL A;  4W5N A;  4DTN A;  1Q7Y O;  1JCF A;  1L3S A;  4KB0 A;  1HRH A;  3SK3 A;  3O1B A;  4KHN A;  2KZZ A;  4CBU A;  1TAQ A;  1YTA A;  2V7Y A;  4O44 A;  1QSY A;  1Y64 A;  4EP4 A;  1N8R O;  2KFN A;  3CD6 N;  3V9Z A;  4DQS A;  2W41 A;  1WSG A;  2YCH A;  1H1V A;  3LP1 A;  3AAP A;  2A3Z A;  3HTV A;  4IJA A;  3HXM A;  3QES A;  4F2R A;  2CH6 A;  2HND A;  2OTJ N;  2E2N A;  3G0Z A;  4FJ8 A;  4I9Q A;  3I56 N;  5M1N A;  4JI3 K;  3PO5 A;  1VSE A;  2YNH A;  3BEX A;  3O80 A;  4BRA A;  3EY1 A;  4WQ4 A;  4DWI A;  4DTM A;  2P9I B;  1S1X A;  2JWK A;  3QIN A;  3PUF A;  3MN9 A;  1IBL K;  1IBK K;  2UUB K;  3AA3 A;  3THW B;  4H5W A;  3CC7 N;  3VQE A;  1SL1 A;  2HVH A;  3L6Q A;  3J8A A;  2PFU A;  2BH1 A;  4BY9 C;  3LDL A;  3D2E B;  4DTJ A;  5TKW A;  4BRQ A;  4JHD B;  3R9P A;  3CFP A;  5FRN A;  1YTU A;  4H4M A;  3VQ7 A;  2AA4 A;  1ATS A;  4XEI A;  3VQ6 A;  3AVH A;  3DJC A;  5I42 A;  2PAV A;  1N36 K;  4FJH A;  3CC4 N;  2Z1G A;  3ZSV A;  1HX1 A;  4KHS A;  4N76 A;  1T44 A;  1C0M A;  4CZF A;  4DF8 A;  4CJF A;  3CXC M;  2F9T A;  2XY7 A;  1EP4 A;  3DLK A;  3TR8 A;  2VWJ A;  3VA0 A;  3WT0 A;  3J7Z O;  3QEP A;  3EZW A;  3NDK A;  1MWK A;  4BQL A;  3A5N C;  1HNZ K;  3VEO A;  2P9L B;  4FL9 A;  4H0X B;  2HHH K;  1EET A;  4KH6 A;  3OA9 A;  2A5X A;  3B8A X;  4A5A A;  3PIP L;  3OYN A;  3KD5 E;  1B9D A;  1K8K A;  5AQI A;  3VET A;  3I8B A;  1NKB A;  3EEQ A;  1TGO A;  3E66 A;  3DLB A;  4LSL A;  3P39 A;  4K0K K;  4M42 A;  3TAN A;  5EVZ A;  4XH4 A;  3FZF A;  2IOC A;  4NCB A;  2G8F A;  3UKU A;  2BE2 A;  3O8M A;  4R5P A;  1OH6 A;  3ZLJ A;  1HNX K;  4X64 K;  3LZI A;  1GLD G;  3OBW A;  5DMR A;  1IO2 A;  3KLI A;  2P9U A;  4KTQ A;  4O55 A;  4DSK A;  1T3V A;  4FJJ A;  1BIZ A;  3WEE A;  1XMQ K;  3NH0 A;  3E9O A;  1UWB A;  4ID1 A;  3QET A;  1J9A A;  1MWM A;  3CPW M;  3MXM A;  3HBT A;  2ASP A;  4NYN A;  3SLC A;  1RGI A;  5I9E B;  5KGW A;  4DCH A;  2W42 A;  5DM6 L;  4DFM A;  1NMN A;  4BVP A;  4MLE A;  1K9M O;  1FW6 A;  1CZB A;  5CYM A;  1ZC6 A;  4JS5 A;  1Q86 O;  3VEZ A;  4I2Q A;  4O8U A;  4CBX A;  4DSJ A;  4BRE A;  2YJE A;  2P5O A;  1NK7 A;  1XQS C;  4CJ3 A;  4BR2 A;  5FRO A;  3THX B;  4B9S A;  2HBL A;  4C1N I;  4BDZ A;  5FDL A;  3ZX2 A;  3TTD A;  5IT9 O;  1WUA A;  1LAV A;  3P38 A;  5LY3 A;  3AA5 X;  4CEZ A;  1REV A;  2NRH A;  3VGL A;  4ISG A;  5FPN A;  5EU7 A;  1BIU A;  1M1K O;  3SPZ A;  2VCP A;  3D6R A;  4PL8 A;  3V1O A;  1NJI O;  4O0I A;  1D9F A;  2Z1H A;  3VQ8 A;  3AO2 A;  2CGK A;  1KD1 O;  2PYL A;  4B1X B;  4DFK A;  3V9U A;  4CJ5 A;  1KTQ A;  3IAY A;  3AA2 A;  2D0C A;  3LDS A;  4B1Z A;  4BRN A;  2F4V K;  4CJE A;  4DKW A;  3AVN A;  4IEE A;  1U49 A;  1V4S A;  4KI4 A;  1BI4 B;  1E4G T;  3VQA A;  3SNN A;  2JWL A;  1VSM A;  2G8K A;  3A8Y A;  3ALY A;  3KWG A;  4CEB A;  3C6U A;  3SPY A;  1XC3 A;  1HJO A;  2IAJ A;  1WSE A;  4B9U A;  1LCU A;  2ZE2 A;  3LM2 A;  4WFN L;  4KB1 A;  4A62 A;  3CQY A;  1YJN N;  2W40 A;  2XY8 A;  2QWO A;  4BG8 A;  3SBT A;  4BRM A;  5JLF A;  1DKG D;  3K5M A;  3FE1 A;  1BQM A;  2D5R A;  2FF3 B;  4R79 A;  2GWJ A;  4O5B A;  3SQ1 A;  1NG9 A;  4CJQ A;  3HPH A;  4CJP A;  3DXK A;  4IG3 A;  3M8R A;  4B9Q A;  1VK0 A;  1EXQ A;  2DY4 A;  1SL0 A;  4DR7 K;  2YNG A;  3OYA A;  3AGK A;  4OKE A;  3O9S A;  1BWF O;  4IFE A;  3VQ9 A;  1LWE A;  1RFQ A;  2HST A;  1ZXO A;  2OPS A;  1ZBI A;  1N33 K;  5HP1 A;  3IKM A;  1JJ2 M;  4MFB A;  3CQ8 A;  4X66 K;  5HOO A;  5M1P A;  1BG3 A;  4E7K A;  4DG1 A;  1SV5 A;  1QE1 A;  3SUQ A;  1C0G A;  2A1R A;  4PA1 A;  1U45 A;  1TYQ A;  1TK8 A;  4CIG A;  3OYD A;  1XMO K;  2O4G A;  2OZM A;  2KW4 A;  2A6A A;  3VEX A;  5AQH A;  1S3X A;  3TAG A;  3JSM A;  2FBY A;  4JEP A;  3M6G A;  4KTZ A;  4BRC A;  4GV3 A;  1A5W A;  2B6A A;  3ZT4 A;  3O9T A;  3SAF A;  3MMV A;  4PQU A;  4HTL A;  2RE2 A;  3HJF A;  1BCO A;  2BAN A;  2ZJR L;  1KAX A;  3FZH A;  5BPL A;  3ZSO A;  3VA3 A;  1WNS A;  4CZL A;  4MO5 A;  2ITM A;  4OGC A;  1HJR A;  2BUP A;  2D0A A;  4FWM A;  1VQL N;  3KLH A;  4BRD A;  4CVN E;  3TTF A;  1VSF A;  3CMA N;  3UE5 A;  2FBV A;  2XY6 A;  3AVL A;  4FWL A;  1EWQ A;  1T6C A;  1QQO A;  1VAZ A;  5FPM A;  4HUE A;  3ZX3 A;  5BR9 A;  1FKO A;  5AR0 A;  5AQQ A;  5LJW A;  1LWF A;  2E1Y A;  3EE9 A;  1Q81 O;  1R0A A;  4O5F A;  2WON A;  3GL1 A;  3PLA A;  5M1Q A;  4CJU A;  5B8H A;  3MEE A;  5BRE A;  3SZ2 A;  3HOT A;  3MDQ A;  4MLH A;  3SMS A;  4HWI A;  2E20 A;  3NHG A;  4KV8 A;  3F9K A;  4GV9 A;  1J6Z A;  3BZK A;  2GWK A;  3J80 O;  1XHX A;  5AQL A;  3J7Y P;  5KI6 A;  2QTD A;  3HT3 A;  1WSJ A;  2IIR A;  1KC8 O;  1I94 K;  4BRI A;  4KO0 A;  2ATQ A;  2P9S A;  2ZGZ A;  4CGF A;  2XHB A;  3CJ9 A;  1NGI A;  2UUA K;  4FJ7 A;  1NM1 A;  2P9P A;  1QVG M;  3HM9 A;  3FZL A;  2Q2R A;  3MXJ A;  4KKO A;  1W0H A;  3OYL A;  1S1V A;  1QQN A;  3BF3 A;  4K8X A;  1IKV A;  1D5A A;  3I0S A;  4K25 A;  1T8E A;  2W6K A;  3LWM A;  1VRT A;  1OH5 A;  2E6L A;  4FOI A;  5CZ2 A;  3U8X A;  3SUP A;  4A5B A;  3VEN A;  1LV5 A;  1GLJ O;  2G8V A;  2IVP A;  3V9S A;  4GMJ B;  5AZJ B;  3O9Q A;  2VQE K;  1HLU A;  4E7H A;  4B8C A;  4UY8 O;  4GY2 B;  4JNE A;  4AHS A;  4DSF A;  1P90 A;  3O08 A;  1L5U A;  4FCY A;  2E2O A;  3VES A;  3KK3 A;  3C0B A;  4IFV A;  1QTM A;  3QEV A;  2PBD A;  3AVC A;  3HSC A;  4CD3 A;  4OPJ A;  3OW2 M;  2NUB A;  4BE1 A;  5AFU A;  4PL7 A;  1YUW A;  4H8K A;  2Q3S A;  1G15 A;  1Q18 A;  4MDB A;  4FJX A;  4FSV A;  2HW3 A;  4WFA L;  1E4F T;  3NH2 A;  5ADX H;  1MU2 A;  3QNO A;  2QW9 A;  5KQD A;  3IDH A;  1VQ7 N;  4M3R A;  1Y97 A;  1SQK A;  4B1W B;  3THY A;  3M5R A;  1CXU A;  4DLG A;  1NGA A;  1NWK A;  2FBX A;  2QWM A;  4AIL C;  4LH5 A;  4O4G A;  1VQM N;  5C0Y A;  1DTQ A;  3D7E O;  3AO1 A;  1NLV A;  4BC3 A;  3OS1 A;  5GAE P;  3QNN A;  1QS4 A;  4DTS A;  3KJV A;  2VQF K;  2F8S A;  5AQG A;  1SUQ A;  3AO4 A;  4OGE A;  1M90 O;  4LFA K;  1WN7 A;  3EO3 A;  3VTH A;  1ATR A;  4LF4 K;  4N47 A;  3VEY A;  1U2V A;  4DV4 K;  1S9G A;  3G71 N;  2O8B B;  4H0V B;  2JLE A;  2P9K A;  4DFP A;  4Y0W A;  1HKB A;  3CJ1 A;  4QS7 A;  4HHT A;  3OY9 A;  1JL2 A;  2ZF5 O;  4Z4G A;  5GIP A;  1YVN A;  4DTO A;  3JS6 A;  4FLW A;  3MN5 A;  5JVH L;  3QEI A;  4M3W A;  2O8F A;  3KLE A;  1RT4 A;  4FW2 A;  4DSE A;  4A2B A;  4W5R A;  3OS0 A;  4EFH A;  2QK9 A;  3KK1 A;  4CZK A;  3ATU A;  4IOA L;  3L2U A;  1VSK A;  3LDP A;  4H0T B;  1WB9 A;  4ZHR A;  4B3R K;  1R59 O;  4DU4 A;  4TSX A;  2D0P A;  3ZET B;  2GBZ A;  1T05 A;  1IKX A;  3TAB A;  3K5O A;  3UKR B;  1ZBL A;  1LAW A;  3CJB A;  4H5T A;  3PX0 A;  4JK8 A;  4Z4F A;  3O6W A;  1ZBU A;  4BG9 A;  3O4Q A;  3NF8 A;  4BDY A;  5JIC A;  3KKS A;  1WAJ A;  4DR4 K;  4BR0 A;  3CCV N;  3VGM A;  3SUO A;  4E1N A;  3AV9 A;  2VGM A;  4E1J A;  1ZYQ A;  1X9S A;  4RW7 A;  1QHA A;  1YF5 L;  3IRX A;  2X74 A;  2HHU A;  2I7N A;  2X6N A;  3VTI A;  4HCB A;  3IUC A;  4ID5 A;  4CHN A;  5LMU K;  3UB5 A;  3RSE A;  3D2F B;  4CJK A;  1HKG A;  2GX9 A;  1L3U A;  2F8T A;  3DMJ A;  3OYC A;  3BUZ B;  3AO3 A;  5J2N A;  4LF8 K;  4Z94 A;  3TAF A;  2VGN A;  3F2K A;  4DQ8 A;  3M8P A;  4DSI A;  2HHT A;  3G25 A;  1RDA A;  2ZWH A;  4CGH A;  1MDU B;  3LP3 A;  4GKJ K;  1Z6R A;  2Q97 A;  4CJL A;  3HL8 A;  3IS9 A;  1YJ9 N;  2QWQ A;  4FYD A;  4DTX A;  3H08 A;  4EHT A;  2I5J A;  3T69 A;  2PY5 A;  4RCH A;  3PSF A;  1ASV A;  4CJV A;  2ZJP L;  2NZT A;  3WXI A;  5LL6 Z;  1NOZ A;  5AZI B;  2XRI A;  3EZ5 A;  4GVE A;  1X3N A;  5AQN A;  1LWC A;  4GV6 A;  3VQ4 A;  4BR5 A;  1YHQ N;  3I0R A;  3WXJ A;  5J2M A;  1VSD A;  2FSN A;  5CY4 A;  1S1W A;  4XH5 A;  5KQ8 A;  2P9N A;  3QLH A;  1Z25 A;  4IDK A;  3CCL N;  2NLX A;  3H3O B;  1C0T A;  4BWJ A;  4JI6 K;  3QB0 A;  2DFE A;  4G1Q A;  1YJW N;  4C1N K;  4B1U B;  4UQG A;  3J7A P;  4K42 A;  1JLA A;  1TKZ A;  4FJ5 A;  1YIT N;  3S3N A;  4FWN A;  4CJR A;  1BA0 A;  1VQ4 N;  3GOI A;  3D45 A;  2D0O A;  2A40 A;  4K43 A;  4XH1 A;  1JLF A;  4JKG B;  4JAX A;  1ITG A;  3MX2 A;  2FSJ A;  4DUY K;  5TKY A;  2YKN A;  4AHR A;  4FLZ A;  5D3G A;  3TU5 A;  2LSN A;  3CCU N;  3AVM A;  4BRL A;  3QIC A;  5BPM A;  5JS2 A;  4H5V A;  4BRP A;  2F7T A;  5SWM A;  4BWM A;  4AHC A;  1I39 A;  1CLQ A;  3NCI A;  1Q82 O;  4YY3 K;  3RVC A;  4W5T A;  4YOW A;  4B9T A;  3M3Z A;  4FM1 A;  4BQZ A;  1UAX A;  3CCS N;  2IS3 A;  1ZBF A;  1RT1 A;  1KSP A;  5IWA K;  3OJU A;  2O8E B;  3TAE A;  4JD2 B;  2PZS A;  4LF9 K;  3LDQ A;  4C23 A;  3RR8 A;  3C6H A;  3LAN A;  4FOE A;  3THV A;  4M7X A;  5J1E A;  1U47 A;  4C8O A;  4E7L A;  3J81 O;  1OVY A;  4Z4I A;  1VSL A;  1LW0 A;  3C7N A;  3C6A A;  3QDK A;  1WAF A;  2HNY A;  3DXM A;  1HQU A;  1BUP A;  2ZQB A;  2Z1I A;  4FK4 A;  4Z4E A;  1VQK N;  1WBD A;  2HBM A;  1QHT A;  4N56 A;  3NMU A;  1OKJ A;  2YHW A;  2VG5 A;  2Y1J A;  5HLF A;  2UXC K;  4E1M A;  3ID8 A;  4E3S A;  1TUU A;  3F5T A;  1KRP A;  3DLG A;  1Q9X A;  2NRR A;  1WLJ A;  3AAR A;  4C8L A;  1YT3 A;  1X9W A;  4JI1 K;  1X9J A;  1ZBH A;  4CF1 A;  1NGE A;  3DLL L;  3PV8 A;  4BC5 A;  1S22 A;  1NK6 A;  1NGH A;  3OBY A;  3OYH A;  3C94 A;  4YOT A;  2F96 A;  5C25 A;  1GOB A;  1KVC A;  4FLV A;  4ILJ A;  3TSU A;  4CEA A;  3QBX A;  3ZSQ A;  3T1H K;  1IKY A;  4OJR A;  4KAZ A;  3VN5 A;  5F2R A;  4E7I A;  2EWS A;  4IXC A;  1RT5 A;  4WQ5 C;  1S72 N;  4CCH A;  3BY5 A;  5M1K A;  4JRP A;  3WNG A;  3G4S N;  1JCG A;  4B9V A;  4F2S A;  1X9M A;  4CD1 A;  2NRW A;  4BGB A;  4FZX C;  3OYG A;  1RT7 A;  3NE6 A;  3LAL A;  4CBW A;  3SQ2 A;  3AVJ A;  1TL3 A;  4IBN A;  4DR5 K;  2OZS A;  3DLR A;  4Z4H A;  1NK5 A;  4KPY A;  1NGB A;  3MN7 A;  2DFH A;  3U3G A;  2QKK A;  3CCE N;  4CF9 A;  4CE9 A;  3FFI A;  3V9W A;  4AHU A;  4WFB L;  1C0U A;  3A0I X;  5CZ1 A;  3NGI A;  2D1K A;  3VF2 A;  3OYJ A;  5AQK A;  3OJS A;  1XUP O;  4I6M B;  1NJZ A;  2OA8 A;  2IC3 A;  3VQC A;  1JLG A;  4RW9 A;  5GIO A;  3HI0 A;  4CGG A;  3V81 A;  4NYF A;  4FJL A;  3NH1 A;  4FLX A;  4CF8 A;  2HHX A;  5EX5 A;  3CET A;  5AQW A;  3KIO A;  1NKE A;  4RTF D;  2O8D B;  5DK5 A;  1YI2 N;  1N32 K;  1HYZ A;  4FM2 A;  1TKD A;  4W5Q A;  2E1Z A;  2WTU A;  3JAM O;  3V6D A;  4HVJ A;  3H46 O;  4CF2 A;  2O8C B;  2P9I A;  3T1A A;  3VER A;  2NRT A;  4L3Q A;  4JKF A;  2XY5 A;  4RG8 A;  2V51 B;  3THW A;  4BC4 A;  4CJ7 A;  1DEJ A;  1BOT O;  3D2E A;  3QFP A;  1RT6 A;  4JHD A;  1LW2 A;  3T3F A;  1JCE A;  1GLA G;  5J2Q A;  3LM9 A;  2RPI A;  4FWP A;  3FLC O;  3K9J A;  4CJ4 A;  2JGU A;  1S1U A;  1RDB A;  4LD0 A;  3SAH A;  2KFZ A;  3CCR N;  1IH7 A;  2Y1I A;  2NRZ A;  2P1J A;  4IO9 L;  1OVQ A;  1RTD A;  3HRG A;  4FLU A;  4DV7 K;  4M3U A;  3EL2 A;  4OLB A;  4F3T A;  2ASM A;  3K57 A;  3K59 A;  5F0X A;  4DMN A;  2P9K B;  3SYZ A;  2KZM A;  4DFJ A;  2P9L A;  5C2F A;  1RT2 A;  3MK6 A;  1OH8 A;  5JVG L;  4FJ9 A;  4V19 S;  2HMI A;  3HZ6 A;  3HK2 A;  1YIJ N;  3SJJ A;  3TAP A;  3ISN C;  4EIA A;  1C1B A;  4F8R A;  4NCA A;  1NK9 A;  4B8A B;  4JV5 K;  1NJW A;  3T1Y K;  5GAD P;  1TK5 A;  3ZX0 A;  4B9N A;  2Q0U A;  4EP5 A;  1XNR K;  5LJV A;  1TUY A;  3NF6 A;  1EKE A;  4FO0 A;  1WBB A;  1HMV A;  4DHY A;  3CHW A;  4E0D A;  2E4L A;  4DTU A;  4FWK A;  3ZYY X;  3ENB A;  3TPQ A;  2HHV A;  2HHS A;  4CES A;  3F73 A;  2HNZ A;  3O9U A;  3ULE B;  4FWQ A;  4M41 A;  1GOC A;  4IKF A;  1FJG K;  4AM6 A;  1WSI A;  4CZJ A;  3E9L A;  4MQ3 A;  4EHU A;  4KHQ A;  2R7Y A;  5LMN K;  3AVA A;  4J2D A;  4LF7 K;  2YKM A;  1A5X A;  4CIF A;  1KCF A;  5CHI A;  4AQY K;  5M1F A;  3NAE A;  4IEI A;  4RWT A;  3WXK A;  4DQI A;  2QXL A;  3L4I A;  1F21 A;  3T19 A;  4CZH A;  2FBT A;  4CHY A;  1RDW X;  2F9W A;  1ATN A;  5HL7 L;  4LC9 B;  3PY8 A;  4JKD A;  4OKJ A;  4IO8 A;  4DV0 K;  4BE2 A;  4DV6 K;  3THX A;  4YOY A;  2XO7 A;  1T03 A;  2E2P A;  4Q5V A;  3HOS A;  1TVR A;  3QFU A;  4CFD A;  1W97 L;  4PUO A;  3DLH A;  5KTQ A;  1RTH A;  2I7P A;  1XI1 A;  4BRH A;  3ID6 A;  4FLT A;  1C0F A;  2WC9 A;  4CJW A;  3JXU A;  4M3T A;  4CK1 A;  4M63 C;  2V7Z A;  4O0J A;  5KRT A;  2KHO A;  3L2W A; 
#chains in the Genus database with same CATH homology
 4RW7 A;  1JLE A;  1TGO A;  4JRQ A;  3DLB A;  4LSL A;  2OPQ A;  2X74 A;  3IRX A;  3O4N A;  3HO1 A;  1C1C A;  3CYM A;  2HHU A;  4M42 A;  3TAN A;  1T7P A;  1CXQ A;  2X6N A;  3MEG A;  1IG9 A;  4HCB A;  4RW8 A;  1S9E A;  4E19 A;  4ID5 A;  4CHN A;  1QQC A;  1RBU A;  2WOM A;  4CED A;  4CJK A;  1QSL A;  4YNQ A;  1D9D A;  2IOC A;  1BI4 A;  1TAU A;  4LH4 A;  1L3U A;  2G8F A;  4NCB A;  2F8T A;  3DMJ A;  3OYC A;  2BE2 A;  3AO3 A;  4IG0 A;  4R5P A;  5J2N A;  4FJI A;  4KHY A;  4JS4 A;  5HRP A;  3LZI A;  1FXX A;  3M8Q A;  3TAF A;  4WE1 A;  4B3O A;  3M8P A;  3K2P A;  4KFB A;  5DMR A;  3ZSX A;  3TWH A;  4DU3 A;  1IO2 A;  3KLI A;  4DSI A;  4KTQ A;  4L8R B;  4O55 A;  3BDP A;  4DSK A;  5C24 A;  3PX4 A;  4FJJ A;  4DF4 A;  3L2V A;  1A5V A;  1BIZ A;  3NH0 A;  2HHT A;  3LP2 A;  3EYZ A;  1UWB A;  4ID1 A;  4OPK A;  3QET A;  3U6F A;  1J9A A;  1RDA A;  4HUG A;  4B08 A;  3MXM A;  3QO9 A;  4CGH A;  1W9H A;  3LP3 A;  5I3U A;  4NYN A;  2YNI A;  3LAM A;  2X78 A;  3VQ5 A;  5KGW A;  1TKX A;  4JLH A;  3O3F A;  2OPR A;  4CJL A;  3OYK A;  3HL8 A;  3IS9 A;  2W42 A;  4DFM A;  3ZCM A;  1Q8I A;  3BGR A;  1C6V A;  4FYD A;  4DTX A;  3H08 A;  1JXE A;  4CK3 A;  1CZB A;  2QXF A;  5CYM A;  2I5J A;  2PY5 A;  4JS5 A;  4EZ6 A;  2KTQ A;  1ASV A;  4I2Q A;  4CFA A;  1BL3 A;  4CJV A;  4BAC A;  3PX6 A;  3V1Q A;  4DSJ A;  1HYS A;  3O3G A;  1RIL A;  1TKT A;  4F3O A;  1NOZ A;  2XRI A;  4YFU A;  3EZ5 A;  1NK8 A;  4CHO A;  2P5O A;  3DI6 A;  3ZSW A;  1VSJ A;  1NK7 A;  4I9L A;  4CJ3 A;  3NFA A;  1LWC A;  4M45 A;  3VQ4 A;  3M8S A;  5FRO A;  5KGX A;  3I0R A;  4B9S A;  3A2F A;  4BDZ A;  1HYV A;  5J2M A;  3TI0 A;  1VSD A;  5CY4 A;  5FDL A;  4CGJ A;  4DTR A;  1S1W A;  1LAV A;  2BDP A;  3DYA A;  4N5S A;  3KTQ A;  3AA5 X;  4CEZ A;  3QLH A;  4IDK A;  1Z25 A;  1REV A;  4FJG A;  1ASU A;  3V1R A;  4B9L A;  1JLQ A;  1HPZ A;  4DS4 A;  4F4K A;  3NBP A;  3AVB A;  3CFR A;  1UA1 A;  1RTI A;  3SV4 A;  1C0T A;  5EU7 A;  1L3V A;  1BIU A;  4BWJ A;  3MEC A;  3NGY A;  4CJS A;  3LZJ A;  1VSH A;  3SPZ A;  4M3Z A;  4G1Q A;  2DFE A;  1QTM A;  4K8Z A;  3V1O A;  4DLE A;  1NJX A;  3HVT A;  1FKP A;  4O0I A;  2Z1H A;  1D9F A;  3VQ8 A;  3AO2 A;  4ZTJ A;  2PYL A;  2B5J A;  4M3Y A;  4UQG A;  3JYT A;  1JLA A;  1TKZ A;  1RNH A;  3V9U A;  4CJ5 A;  4DFK A;  4CEF A;  1KTQ A;  4CER A;  3RMD A;  4CHQ A;  1VRU A;  2EHG A;  3DRS A;  3AA2 A;  3QEW A;  3IAY A;  3ZSZ A;  2D0C A;  4CJR A;  3L2Q A;  3LDS A;  3D45 A;  3SI6 A;  4KHW A;  1WSH A;  1YVU A;  4CJE A;  2FC0 A;  3LPT A;  3AVN A;  1U48 A;  3QIO A;  1U49 A;  1B92 A;  1L3T A;  4KI4 A;  3WNE A;  1BI4 B;  1KLM A;  3AA4 A;  1JLF A;  3VQA A;  3SNN A;  1VSM A;  1ITG A;  2G8K A;  3ALY A;  2YKN A;  1JLC A;  3K5N A;  4CEB A;  4AHR A;  3C6U A;  3DOK A;  4FLZ A;  3SPY A;  4ELU A;  1D8Y A;  5D3G A;  3MED A;  3L2R A;  2IAJ A;  2LSN A;  3ZT3 A;  5JS1 A;  3AVM A;  3DLE A;  1K6Y A;  2B4J A;  1NOY A;  1WSE A;  4Q0B A;  4B9U A;  5JS2 A;  3RMA A;  2ZE2 A;  4DQR A;  4E7J A;  4KB1 A;  1TV6 A;  4E89 A;  5SWM A;  3SQ0 A;  1RBS A;  2XY8 A;  4BWM A;  4Z4C A;  4AHC A;  1I39 A;  2HVI A;  3P5J A;  4AHV A;  1CLQ A;  3NCI A;  4DQQ A;  4IFY A;  4B9M A;  1KFS A;  2IGI A;  2YHA A;  1UOC A;  2HHW A;  2G8H A;  1B9F A;  4W5T A;  4B9T A;  3NGZ A;  4H4O A;  4CEE A;  3K5M A;  1BQM A;  1UAX A;  4FM1 A;  1NK0 A;  1QSS A;  1O1W A;  2D5R A;  2QKB A;  2IS3 A;  3ZSR A;  4CEQ A;  4O5B A;  1ZBF A;  3VQP A;  4CJQ A;  1CZ9 A;  1RT1 A;  3HPH A;  4CJP A;  3VQB A;  3SQ1 A;  3OJU A;  1KSP A;  3CM5 A;  4IG3 A;  3M8R A;  4AH9 A;  1VK0 A;  1EXQ A;  3TAE A;  2PZS A;  2DY4 A;  3HPG A;  4BE0 A;  1SL0 A;  1U04 A;  2HHQ A;  2YNG A;  3OYA A;  4RW4 A;  2HB5 A;  3OYI A;  1JKH A;  2GUI A;  3RR8 A;  1TL1 A;  4OKE A;  1XWL A;  3LAN A;  4CFB A;  3HP9 A;  3L3U A;  3KK2 A;  3THV A;  1S6P A;  1BIS A;  4I2P A;  3OYF A;  5J1E A;  3VQ9 A;  1U47 A;  3HST B;  3HPO A;  4E7L A;  1LWE A;  2OPS A;  1XC9 A;  4CHZ A;  4C8O A;  1RT3 A;  1ZBI A;  4Z4I A;  5HRO A;  5HP1 A;  1VSL A;  3LAK A;  3HYF A;  1LW0 A;  4FM0 A;  4ELV A;  2G8W A;  4MFB A;  3KD1 E;  3CQ8 A;  1RDD A;  1HQE A;  1WAF A;  4E7K A;  4DG1 A;  2HNY A;  2VWK A;  4CGI A;  2G8U A;  1SV5 A;  5FRM A;  3UIQ A;  1HQU A;  1QE1 A;  3AVI A;  1KLN A;  2ZD1 A;  3D0P A;  2O4I A;  3SUQ A;  4C8K A;  4HCC A;  2ZQB A;  3NF9 A;  2Z1I A;  4FK4 A;  4Z4E A;  3DM2 A;  3CFO A;  2A1R A;  3ULD A;  1FK9 A;  4ELT A;  1QHT A;  4PA1 A;  5HRN A;  4N56 A;  1U45 A;  1J53 A;  1TK8 A;  4CIG A;  2VG5 A;  4GVM A;  3RR7 A;  3OYD A;  2Y1J A;  1BHL A;  5HLF A;  2O4G A;  2OZM A;  5T7B A;  1BCM A;  4E1M A;  2KW4 A;  4DS5 A;  4E3S A;  1J5O A;  4CFC A;  1KRP A;  3DLG A;  4FVM A;  1Q9X A;  4BDP A;  4DSL A;  5KRS A;  3AO5 A;  4HTU A;  4AHT A;  1WLJ A;  1N5Y A;  4C8L A;  1YT3 A;  1X9W A;  2GV9 A;  3OYM A;  3TAG A;  3KKR A;  3JSM A;  2FBY A;  3TAR A;  1ZBH A;  1KVB A;  4CF1 A;  4KTZ A;  3OYB A;  4KRF A;  4XIU A;  3PV8 A;  3KLG A;  1A5W A;  2B6A A;  2IDO A;  3ZT4 A;  1NK6 A;  2AJQ A;  3OYH A;  4PQU A;  4KHU A;  3C94 A;  3HJF A;  3WNF A;  2F96 A;  5C25 A;  3PO4 A;  1GOB A;  1KVC A;  4FLV A;  1BCO A;  2OYQ A;  3QER A;  2YNF A;  4CEA A;  3ZSQ A;  2BAN A;  3VQD A;  4DQP A;  1KVA A;  1IKY A;  4OJR A;  1SKR A;  4KAZ A;  3VN5 A;  4N41 A;  3L3V A;  4E7I A;  1S5J A;  3ZSO A;  1RT5 A;  3VA3 A;  4CCH A;  1WNS A;  4JRP A;  3WNG A;  3OS2 A;  1N6Q A;  2PYJ A;  2RF2 A;  3B6P A;  4OGC A;  4B9V A;  4F2S A;  1HJR A;  5C42 A;  1X9M A;  1JXB A;  5HBM A;  2D0A A;  3I8D A;  4FZX C;  3OYG A;  3ZT0 A;  1UA0 A;  1RT7 A;  3KLH A;  3NE6 A;  1C1A A;  4FLY A;  3LAL A;  2ITG A;  1BQN A;  3LP0 A;  4FJ5 A;  3SQ2 A;  4KTW A;  3DRR A;  4EZ9 A;  3AVJ A;  4FZZ A;  1TL3 A;  4PY5 A;  4IBN A;  1VSF A;  2OZS A;  3MAQ A;  1RBR A;  3DLR A;  4Z4H A;  1NK5 A;  2FBV A;  4KPY A;  4PWD A;  2XY6 A;  3AVL A;  2DFH A;  3U3G A;  2QKK A;  4CF9 A;  4CE9 A;  3FFI A;  3V9W A;  4M3X A;  4AHU A;  4HUE A;  3KLF A;  1C0U A;  5CZ1 A;  3NGI A;  1HNI A;  1FKO A;  4Y1C A;  3TAM A;  3RRH A;  3RMC A;  3VQQ A;  4KI6 A;  3OYJ A;  3V9X A;  3OJS A;  1LWF A;  1NJZ A;  1R0A A;  2OA8 A;  4FK2 A;  2WON A;  2IC3 A;  3AVF A;  3VQC A;  1JLG A;  4CJU A;  4RW9 A;  2DFF A;  4FXD A;  3RMB A;  4CGG A;  2KQ2 A;  3MEE A;  4CEO A;  3V81 A;  4CF0 A;  4NYF A;  3SZ2 A;  4FJL A;  4J2B A;  1KFD A;  3CM6 A;  3NH1 A;  4FLX A;  4CF8 A;  2VG6 A;  4OKK A;  3NHG A;  1VSI A;  4KV8 A;  5J2P A;  2HHX A;  3KIO A;  1Z26 A;  3F9K A;  1NKE A;  4FJM A;  5DK5 A;  1XHX A;  5KI6 A;  4CIE A;  1HYZ A;  4FM2 A;  3HT3 A;  1TKD A;  2X6S A;  4J2A A;  1WSJ A;  3K5L A;  4W5Q A;  3RRG A;  3TAQ A;  1JLB A;  2EX3 A;  3V6D A;  4C8M A;  4KO0 A;  4HVJ A;  3C6T A;  2ATQ A;  4LY7 A;  1RCH A;  1RBT A;  4CF2 A;  1ASW A;  3RWU A;  4CGF A;  2XHB A;  4LSN A;  3T1A A;  3SQ4 A;  4FJ7 A;  1RDC A;  3ZT1 A;  3IG1 A;  3HM9 A;  4DTP A;  4FK0 A;  2XY5 A;  3SUN A;  3MXJ A;  4KKO A;  2RN2 A;  1W0H A;  4RG8 A;  3OYL A;  1S1V A;  1I3A A;  4DU1 A;  4K8X A;  3V4I A;  1IKV A;  1D5A A;  3LPU A;  3S3N A;  3I0S A;  2BGG A;  1T8E A;  4CGD A;  3LWM A;  1VRT A;  1SKW A;  4GW6 A;  5HRS A;  2DTU A;  1RT6 A;  2E6L A;  1GOA A;  1LW2 A;  5CZ2 A;  3T3F A;  3SUP A;  3G10 A;  3ZT2 A;  1LV5 A;  2G8V A;  5J2Q A;  1SL2 A;  1BGX T;  1JL1 A;  2RPI A;  3V9S A;  1S6Q A;  4GMJ B;  4RW6 A;  3S3O A;  3L8B A;  4CJ4 A;  2JGU A;  4CEC A;  1S1U A;  4B8C A;  1RDB A;  4QAG A;  2YV0 X;  4LD0 A;  4E7H A;  1NKC A;  1J54 A;  3E01 A;  2A1S A;  4ICL A;  3K58 A;  1SKS A;  3WNH A;  4AHS A;  5K14 A;  2P5G A;  2KFZ A;  3MXI A;  4DSF A;  1S1T A;  1IH7 A;  1L5U A;  2Y1I A;  2G8I A;  4FCY A;  4FJK A;  1Q9Y A;  3S3M A;  2P1J A;  3KK3 A;  4IFV A;  1RTD A;  4CJT A;  3QEV A;  1RTJ A;  2RKI A;  3ITH A;  3ZSY A;  3AVC A;  3O3H A;  4HUF A;  4FLU A;  4FW1 A;  4OPJ A;  1WSF A;  2NUB A;  3S9H A;  4BE1 A;  4M3U A;  4OLB A;  1NK4 A;  4F3T A;  3K57 A;  4Y1D A;  4H8K A;  1DTT A;  2Q3S A;  1G15 A;  3CG7 A;  2YHB A;  4DMN A;  3K59 A;  3P83 D;  3DOL A;  4W5N A;  4FJX A;  2HW3 A;  3SYZ A;  4DTN A;  2KZM A;  4DFJ A;  4ZTF A;  3SV3 A;  1XHZ A;  3NH2 A;  1L3S A;  1MU2 A;  1RT2 A;  3DRP A;  1HRH A;  3QNO A;  4KB0 A;  4KHN A;  4FJ9 A;  2KZZ A;  3C95 A;  2ETJ A;  1TAQ A;  2HMI A;  3HK2 A;  5SZT A;  4OLA A;  4M3R A;  1YTA A;  1X1P A;  1Y97 A;  3ISN C;  3SJJ A;  3TAP A;  1C1B A;  4O44 A;  4F8R A;  1QSY A;  4NCA A;  1NK9 A;  2KFN A;  4EP4 A;  4B8A B;  1NJW A;  3AVK A;  3V9Z A;  4DQS A;  1CXU A;  4DLG A;  1TK5 A;  1WSG A;  2FBX A;  3LP1 A;  4AIL C;  4LH5 A;  4O4G A;  4B9N A;  1DTQ A;  3AO1 A;  4EP5 A;  3HXM A;  3QES A;  1U4B A;  4KRE A;  4F2R A;  3OS1 A;  3QNN A;  3NF6 A;  4I7F A;  2HND A;  1HNV A;  1QS4 A;  1EKE A;  4DTS A;  3KJV A;  2F8S A;  3LWL A;  1SUQ A;  3AO4 A;  1HMV A;  3AVG A;  4OGE A;  3G0Z A;  2P51 A;  4FZY A;  1WN7 A;  2E4L A;  4E0D A;  4DTU A;  4FJ8 A;  4I9Q A;  5E41 A;  4N47 A;  4J2E A;  2HHV A;  2HHS A;  4CES A;  3F73 A;  2HNZ A;  1DLO A;  3PO5 A;  1S9G A;  1VSE A;  5CYQ A;  2JLE A;  2YNH A;  4DFP A;  3QEX A;  1NJY A;  4HHT A;  4M41 A;  3RTV A;  3OY9 A;  1GOC A;  4C8N A;  1JL2 A;  3EY1 A;  4Z4G A;  4DWI A;  4IKF A;  4DTM A;  4DTO A;  1S1X A;  3QIN A;  5HRR A;  3PUF A;  1WSI A;  4FLW A;  4MQ3 A;  4KHQ A;  2R7Y A;  3AA3 A;  3AVA A;  3OYE A;  1EX4 A;  4J2D A;  3VQE A;  1SL1 A;  4W5O A;  3QEI A;  2HVH A;  2YKM A;  4M3W A;  3KLE A;  1A5X A;  1RT4 A;  3NF7 A;  4CIF A;  4DTJ A;  1YTU A;  3CFP A;  5FRN A;  1KCF A;  2D0B A;  4FW2 A;  4H4M A;  3NAE A;  4DSE A;  4W5R A;  3VQ7 A;  4DQI A;  3OS0 A;  2QK9 A;  2E6M A;  3KK1 A;  1F21 A;  3U3Y A;  3T19 A;  2FBT A;  3VQ6 A;  3AVH A;  2Z1J A;  4CHY A;  3L2U A;  3HVR A;  1VSK A;  4ZHR A;  1RBV A;  5I42 A;  3PY8 A;  4DU4 A;  4OKJ A;  4OVL A;  4TSX A;  4BE2 A;  4FJH A;  4FJN A;  2Z1G A;  3ZSV A;  4KHS A;  4Z0U A;  4N76 A;  2GBZ A;  1T05 A;  1C0M A;  1IKX A;  4CHP A;  2XO7 A;  3TAB A;  3K5O A;  3SCX A;  1ZBL A;  1LAW A;  2OPP A;  4DF8 A;  1T03 A;  4Q5V A;  1TK0 A;  1IKW A;  3PX0 A;  4CJF A;  4QOZ B;  2XY7 A;  4Z4F A;  1EP4 A;  1TVR A;  3DLK A;  3TR8 A;  3P1G A;  4CFD A;  3HP6 A;  2VWJ A;  4PUO A;  3VA0 A;  3DLH A;  1ZBU A;  3QEP A;  5KTQ A;  3O4Q A;  3NF8 A;  3ASM A;  3OVN A;  4BDY A;  3NDK A;  1RTH A;  3KKS A;  4NCG A;  1XI1 A;  1WAJ A;  4QCL A;  2VG7 A;  3B6O A;  4CK2 A;  4FLT A;  1EET A;  4CJW A;  3QIP A;  4M3T A;  3OYN A;  3KD5 E;  4CK1 A;  1B9D A;  4E1N A;  3AV9 A;  3SUO A;  4O0J A;  5KRT A;  1NKB A;  3L2W A;  1ZYQ A;  1X9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...