1CXQA

Atomic resolution asv integrase core domain from ammonium sulfate
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
147
structure length
143
Chain Sequence
GRGLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords AVIAN SARCOMA VIRUS INTEGRASE
publication title Atomic resolution structures of the core domain of avian sarcoma virus integrase and its D64N mutant.
pubmed doi rcsb
source organism Avian sarcoma virus
total genus 52
structure length 143
sequence length 147
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1cxqA00
4DU3A 4BWJA 4DLGA 3ZSZA 3SNNA 1VSMA 4KHWA 2OPQA 4B08A 4CK1A 3AA4A 4DSKA 1WSGA 3DLRA 3QEPA 2GV9A 3EY1A 4DQRA 3RRHA 4YNQA 3OYAA 3SUPA 3SUQA 4KTQA 2IC3A 1S9GA 4HUGA 4IKFA 1JLBA 3NGIA 3VQQA 3NH0A 3AO3A 2FBYA 1A5WA 3NFAA 1VSHA 4AHRA 4DQIA 3SUNA 2KW4A 2G8IA 4CF1A 3VA3A 4FJ7A 4E7HA 1BHLA 3AA5X 3NF7A 1HNIA 3B6OA 1CXQA 4CF8A 4CGIA 3LZIA 2YKMA 1ZBLA 3DMJA 5K14A 3KTQA 3MXJA 1RNHA 1HJRA 5FRMA 1RT1A 1BQMA 1TV6A 4W5TA 2YNHA 4DU4A 4KB0A 3K2PA 1S5JA 1X9MA 3VQPA 1C0TA 3CG7A 3KKSA 1KSPA 3UIQA 2LSNA 2BE2A 4HCBA 2G8HA 4I9LA 4I9QA 4BDPA 1SL0A 4AHUA 3VQ5A 3PX4A 4DF8A 5EU7A 4PWDA 4FZYA 3NHGA 4FJ8A 2VWJA 3V9WA 1I39A 1S1XA 3OYKA 3LWLA 1FKOA 1JKHA 4OJRA 4L8RB 4RW7A 3U6FA 1X1PA 3V9SA 2D0CA 3ISNC 4CHOA 3KIOA 3V4IA 4FJIA 1GOCA 1KVAA 3AVLA 3KLHA 2A1RA 4E7IA 3PO5A 2PY5A 2HNZA 4FJKA 1KLMA 5DMRA 3HVRA 4DU1A 1LV5A 3MEDA 3QEXA 1UOCA 3WNFA 2XHBA 4DTJA 4C8NA 3L2WA 3AVMA 3WNEA 4DF4A 4C8MA 1RT3A 3D45A 5C42A 1J9AA 3NDKA 3TR8A 1NJXA 4OPJA 3SQ2A 2VWKA 4NCAA 1C1AA 3E01A 4Z4FA 2FC0A 4Z4EA 1WSFA 4LSNA 5D3GA 4FLXA 4QOZB 1NJWA 4FCYA 1J53A 1B9FA 1LAWA 3C94A 4B9VA 1CZBA 3SYZA 1WNSA 3CFOA 4C8OA 1XHXA 3PX0A 4CEBA 3KD5E 1BIZA 1RT7A 4F3OA 4CEOA 4AHTA 1RBVA 2XY8A 3IG1A 2Z1IA 4DSEA 1DLOA 3DRRA 3HPGA 3M8SA 1HPZA 2IS3A 1RT5A 3LAMA 3ZSXA 1TGOA 4CJ5A 3KK1A 1CXUA 3RMDA 4J2EA 4F4KA 3HP9A 1FK9A 1ZBUA 1JL1A 3ZT4A 4CF9A 3JSMA 4BE2A 4LSLA 5HRSA 1A5XA 3WNHA 4FJ5A 2I5JA 4WE1A 1RDAA 3QETA 4ID5A 3OS0A 4CK2A 3QEIA 5KRSA 3AO2A 3VQDA 4OKKA 3JYTA 1IO2A 4IG0A 4CJQA 1B9DA 1XHZA 4HHTA 3MEEA 3K5LA 1R0AA 1TKTA 4E7LA 2X6NA 3TABA 4Y1CA 2G8WA 2DFHA 2OPSA 2HHTA 4KRFA 4DWIA 2HHWA 3NGYA 4LH4A 3OJSA 2FBVA 3NCIA 1UA0A 4FYDA 2R7YA 4PY5A 2NUBA 3OJUA 1VSLA 4KO0A 1W0HA 3RR7A 2YNIA 3KJVA 3K59A 2HHQA 4CGJA 3HK2A 3PV8A 1UA1A 2VG6A 3OYJA 2Z1GA 1S1UA 1L3TA 1JLFA 1KTQA 3C6TA 2HNYA 5J2NA 4CEQA 4NYFA 3TAFA 3RRGA 1ZBIA 2PYJA 3LZJA 4N47A 4M41A 4OVLA 3ZSYA 4KPYA 1LAVA 2OYQA 3TAQA 3VQ4A 2QKBA 1CZ9A 1NOZA 3QEVA 3U3GA 4EZ9A 2YHBA 4CGGA 3L2RA 4CEAA 4AILC 3TANA 4DFKA 1FXXA 2G8VA 1IKXA 2HW3A 4J2DA 2KFNA 4W5NA 3BDPA 4DLEA 1NJZA 1BCMA 3QNNA 4I2PA 3HYFA 3QLHA 1NKBA 1X9SA 5I3UA 3THVA 3RR8A 1KVBA 4OLAA 3HSTB 1YTAA 3CFPA 4DTSA 3DLBA 3S3MA 4B9TA 1YVUA 4RW4A 3VN5A 3L8BA 2KZZA 2RN2A 4NYNA 4BE0A 1JLAA 4LD0A 3NH1A 1KLNA 4CEFA 2IOCA 4J2BA 4K8ZA 3AO4A 2RPIA 1NK8A 3F9KA 3TWHA 1NKCA 2E4LA 4RG8A 2DTUA 1RDBA 2B6AA 3DYAA 4E1MA 3DOLA 5E41A 3VA0A 4M42A 3OS1A 4FJNA 1BISA 4ELVA 1RBTA 4KHNA 1VK0A 5SZTA 3CFRA 4CJSA 4KFBA 1VSKA 4B9MA 3PX6A 2XRIA 4KTZA 1X9WA 3AVJA 3MXIA 4EZ6A 3AVKA 3LP3A 1EETA 1S1WA 4DTOA 3RMBA 4ELTA 2FBXA 3HL8A 4Z4IA 4FVMA 1W9HA 4FLWA 4FLUA 1SKWA 4DQPA 1KVCA 1C1CA 1EKEA 3U3YA 4CCHA 5JS1A 1IG9A 4H4OA 1VRTA 5HRNA 1Z26A 3CYMA 2HNDA 4E89A 3FFIA 4DSFA 4CJ3A 4H8KA 3V6DA 3SUOA 2QK9A 3ZSVA 2Q3SA 3PO4A 1FKPA 2B4JA 3IRXA 3QESA 2OZSA 1F21A 3DLGA 1SKSA 2F8SA 2HB5A 3ZT2A 2X6SA 5CZ1A 4Z4CA 3KLGA 2IGIA 4CIFA 4FK4A 4FM0A 3L3UA 2QXFA 3ZSWA 5FROA 2Y1JA 4ELUA 1A5VA 1ZBHA 3T19A 4CGHA 4HCCA 1HNVA 5T7BA 2HVHA 4B8CA 1TAQA 4CHYA 3OS2A 1DTQA 3OYHA 2HVIA 2HMIA 4KB1A 1KCFA 1QSLA 4C8LA 3ULDA 2ZQBA 4M45A 3V9ZA 4ID1A 1SUQA 4GW6A 3VQAA 4XIUA 1L3VA 2HHVA 1JLEA 1JLGA 4M3RA 1WSEA 4CF2A 3TAMA 5KI6A 4AHCA 3NF8A 4DSJA 4HUEA 4B3OA 1C0MA 4DFJA 1ITGA 4N56A 4FLTA 4IDKA 2IAJA 3V9UA 3RMCA 4ZTJA 1S6PA 1L5UA 4FK2A 3CQ8A 1XC9A 1TKXA 4E7KA 1RBUA 1U49A 3HT3A 3AVFA 4CJPA 3LP1A 4FLVA 4KAZA 4DTXA 1WAFA 2IDOA 1JL2A 1Q9YA 2W42A 4CF0A 2Z1JA 2Z1HA 3AO5A 3G10A 3OYBA 3K57A 4DFPA 1U04A 4KI4A 4KTWA 4CHQA 1XWLA 4CGDA 3HM9A 2YHAA 4I7FA 3DLHA 3LPUA 4CFBA 2GUIA 3O4NA 3K5OA 3QIOA 3K58A 4FM2A 2XY6A 3PY8A 1NK5A 4F3TA 2F96A 1RBRA 4CK3A 3HPOA 4HTUA 3A2FA 3QNOA 4KV8A 5CYQA 4NCBA 1TVRA 1S6QA 2EHGA 4CJUA 2QKKA 2P5GA 4DSIA 2YKNA 4OKJA 2OPRA 1RT4A 3AA2A 4CEDA 4B9NA 4TSXA 4CEEA 3HP6A 4F2SA 3O3GA 4FW1A 4Q0BA 4JRQA 4LH5A 3O3FA 1TL1A 1RTIA 3MAQA 4H4MA 3MXMA 4OLBA 4CE9A 4DSLA 5KGXA 1N5YA 4Z0UA 3KK2A 1NK7A 1HMVA 1ASVA 3DLEA 5KRTA 2HHUA 3G0ZA 4Z4GA 3M8QA 3RWUA 4BDYA 3TI0A 1U4BA 2O4IA 4CJKA 4CFAA 4CJ4A 3OYGA 1QSYA 1EX4A 1HRHA 1IH7A 1D5AA 1TL3A 3DLKA 1T7PA 1J5OA 1O1WA 2F8TA 3AA3A 1NOYA 1VSJA 3C95A 1BL3A 3SV3A 1Y97A 2O4GA 1MU2A 3VQEA 1Q9XA 1G15A 3KK3A 5DK5A 5J2MA 4DMNA 4IFYA 2KZMA 4CJLA 1BCOA 2ATQA 3QO9A 1REVA 5JS2A 1C0UA 1HYSA 3EZ5A 1LWEA 4DTRA 1YTUA 1IKYA 3V81A 1SL2A 4IG3A 1IKWA 2E6MA 3S3OA 4BE1A 1B92A 3L2QA 4DFMA 1TAUA 1TK5A 2D0BA 3ITHA 3NF6A 4FJGA 4FJMA 4GVMA 2VG5A 3ZSQA 2EX3A 3NAEA 4R5PA 4CIGA 1TK0A 2VG7A 2P1JA 3MEGA 4UQGA 2A1SA 3TAGA 4JLHA 1VSEA 1BIUA 1GOAA 4DS5A 3HPHA 1C6VA 4LY7A 2ZD1A 4MFBA 3LANA 4CFCA 3QINA 3S9HA 1TKDA 2ZE2A 4DS4A 1RTDA 2XY7A 2HHXA 1TK8A 3C6UA 5CY4A 3ZCMA 3SJJA 1QHTA 4M3UA 4BACA 4Z4HA 3CM5A 3SCXA 3KD1E 1C1BA 4AHSA 5HRPA 4FJLA 2BDPA 4O44A 3M8PA 4N76A 4CIEA 3QEWA 1VSDA 2KFZA 5HBMA 4FLYA 4E19A 3LWMA 4O55A 3CM6A 3VQ8A 4YFUA 3HXMA 2KTQA 3HVTA 3SPYA 4NCGA 4KKOA 4Q5VA 1BQNA 4CJTA 5FRNA 4Y1DA 4KI6A 5CYMA 5I42A 3ZT3A 1D8YA 4HVJA 2PYLA 5J1EA 1QE1A 3PUFA 3HO1A 4E0DA 4DQQA 1QS4A 3P1GA 4M3XA 2P5OA 4O5BA 2RKIA 3SQ1A 1WSIA 3K5NA 4GMJB 1JXEA 3O3HA 1T8EA 4DG1A 4KREA 3TAPA 2ETJA 3T3FA 2BANA 4BWMA 3RTVA 3KLIA 2D0AA 3P83D 1I3AA 3VQ6A 2YNFA 2WONA 3TAEA 1QSSA 3OYMA 3ZSRA 3SZ2A 1EXQA 3V1OA 4B9SA 5HRRA 4AHVA 2JGUA 4CJRA 1ZYQA 4DQSA 4KHYA 4PQUA 2YNGA 5CZ2A 1NK6A 3IAYA 3OYFA 4G1QA 4M3ZA 1GOBA 2E6LA 1KFSA 1S1VA 4PA1A 1BI4A 3K5MA 3L3VA 4KHUA 4FZZA 3I8DA 2BGGA 1WSJA 4RW8A 2D5RA 3OVNA 4K8XA 3AVGA 1NK0A 4HUFA 3NGZA 3MECA 3H08A 4F2RA 1VSFA 3ZT0A 4CJFA 1UWBA 4B8AB 2AJQA 3ZT1A 4OGCA 3VQ7A 3L2VA 4N5SA 4N41A 2DFFA 2XY5A 4KHSA 1YT3A 3DRPA 3P5JA 4B9LA 2DFEA 3VQCA 2Y1IA 3OYEA 2KQ2A 1RTJA 4ICLA 1ASWA 3V9XA 1L3UA 5C24A 1KFDA 3NH2A 2G8UA 3SQ4A 1J54A 2YV0X 1WAJA 4ZHRA 4FK0A 4C8KA 4QAGA 3I0RA 3DM2A 4CECA 5HLFA 2OA8A 1RBSA 3B6PA 4O4GA 3V1QA 4CJWA 2FBTA 2X74A 3AV9A 3RMAA 4ZTFA 1RT6A 1VRUA 1WSHA 3DI6A 1T05A 3DRSA 1HYVA 4JS4A 3BGRA 3SV4A 1S1TA 3AVAA 3OYNA 4CESA 1JLCA 1KRPA 5HP1A 3NF9A 1QTMA 3OYDA 3AO1A 2X78A 1XI1A 1U47A 1SL1A 4RW9A 1HQUA 2GBZA 1JXBA 1JLQA 3SPZA 3LP0A 1RTHA 4CGFA 4W5OA 2B5JA 3OYCA 4I2QA 2JLEA 3I0SA 2HHSA 1RCHA 4O0IA 3AVCA 3VQ9A 1ZBFA 4AH9A 1CLQA 2RF2A 4DTPA 3WNGA 4CJVA 1TKZA 3L2UA 4FJHA 4FJJA 5HROA 4IFVA 4FJXA 3ASMA 4CFDA 4E7JA 4BDZA 3QERA 3T1AA 4M3WA 3NE6A 4IBNA 1LW2A 5SWMA 3V1RA 3KLFA 4JS5A 4DTUA 1VSIA 4B9UA 3OY9A 3LPTA 3AVNA 4FM1A 1BGXT 4CJEA 4FXDA 4CHPA 1LW0A 2P51A 4CERA 3SQ0A 1ASUA 3S3NA 4KHQA 1BI4B 1S9EA 3EYZA 3IS9A 3LALA 2DY4A 1RILA 5C25A 4EP5A 4FZXC 4F8RA 1SKRA 1DTTA 2G8KA 5J2PA 3D0PA 4FLZA 4QCLA 3NBPA 1U48A 1LWCA 4W5QA 5KTQA 1NKEA 4M3YA 5J2QA 3ALYA 3OYIA 2OPPA 1UAXA 1WLJA 1D9DA 4E1NA 4PUOA 1EP4A 2XO7A 3AVIA 1SV5A 2ITGA 4MQ3A 5KGWA 3HJFA 1IKVA 4OKEA 1K6YA 1N6QA 1RDDA 4EP4A 4OPKA 1T03A 1L3SA 3KKRA 3QIPA 4J2AA 5FDLA 3AVBA 4OGEA 3SI6A 4FW2A 4JRPA 1RDCA 1NK9A 1NK4A 1LWFA 3LAKA 4CEZA 4W5RA 3AVHA 3KLEA 3F73A 3VQBA 3M8RA 1D9FA 3LDSA 4O0JA 4DTMA 4E3SA 2PZSA 1NJYA 4FJ9A 4CHNA 3TARA 2OZMA 3OYLA 4RW6A 1Q8IA 3ZSOA 1QQCA 1HQEA 2G8FA 3LP2A 4CHZA 1HYZA 2WOMA 4DTNA 3DOKA 1RT2A 1WN7A 3O4QA 4M3TA 1Z25A 1U45A
chains in the Genus database with same CATH superfamily
3ID8A 2OPQA 4CK1A 2O8FA 2CGJA 2QEXN 3P31A 2P9SB 4J8FA 3QEPA 1OKJA 3SUPA 1VSHA 3BZKA 4E7HA 1BHLA 3AA5X 3NF7A 1HNIA 1NM1A 2YKMA 2VYPA 4IZ9A 2PFUA 3EE9A 1HNXK 3KTQA 1HJRA 1ZC6A 5BREA 1W7AA 1TV6A 4W5TA 5BRFA 3CCSN 4O8KA 4B3RK 3KKSA 2LSNA 2G8HA 4I9LA 1Q18A 3OA9A 4I9QA 4BDPA 3H46O 2HOEA 4AHUA 3O8MA 3H1QA 4CZFA 3NHGA 4FJ8A 2NRRA 1BUPA 4WYBA 2HBKA 2D0PA 3U6FA 1X1PA 2D0CA 3ISNC 3KIOA 2JWKA 3AVLA 4BC4A 4E7IA 4DU1A 3QEXA 1UOCA 5C2DA 3L2WA 3AVMA 3WNEA 4C8MA 3CJ7A 2HBLA 4C23A 2VWKA 4Z4EA 3GOIA 4FLXA 1IBMK 1NJWA 4QOZB 1M1KO 1NGJA 5AQJA 3HK2A 5LJVA 3CFOA 4F3OA 3UE5A 4AHTA 2XY8A 3RSEB 4DSEA 3DRRA 3M8SA 4JKFA 3RMDA 4CF9A 3JSMA 4LSLA 3LM9A 3U4LA 3QB0A 2I5JA 4ISFA 3OS0A 3P38A 4CK2A 4OKKA 3JYTA 2CGKA 4IG0A 4HHTA 3A5MC 3MEEA 3K5LA 4E7LA 2X6NA 1W97L 4CBWA 4Y1CA 3G6EN 3TABA 2G8WA 2HHWA 3OJSA 4CZKA 4PY5A 4KO0A 3KJVA 2HHQA 1UA1A 3P4IA 4LC9B 1C0GA 1KTQA 1ZBIA 2E88A 5J2NA 3RRGA 4MLHA 3J81O 4CW7B 2OYQA 1NOZA 5EY4A 3QEVA 2YHBA 4DFKA 1BA1A 2G8VA 2KFNA 5AZJB 4GV3A 3FFKB 1ESVA 3QNNA 3FZKA 4EFHA 3QLHA 1NKBA 3THVA 4JHDA 1KVBA 4NB4A 3TPQA 1OH8A 3DLBA 3S3MA 2FXUA 4B9TA 3CJBA 2IOCA 4J2BA 4CZHA 3AO4A 3F9KA 2E2PA 4RG8A 3DYAA 3DOLA 2OANA 3OS1A 4B3TK 1BISA 4RCHA 4CZLA 1RBTA 3AY9A 1VSKA 2XRIA 4KTZA 4H5WA 3AVKA 3LP3A 5HL7L 4EIAA 4R79A 2ZM6K 3RMBA 4DV2K 4DQPA 1KVCA 1C1CA 5JS1A 1NU0A 3B8AX 1Y64A 4JV5K 3BEXA 2QK9A 1HR0K 5M1QA 1YHQN 3W0LA 1FKPA 2HB5A 3ZT2A 2X6SA 2V52B 4Z4CA 3KLGA 1LOTB 2QXFA 3D6RA 2Y1JA 3HSCA 3T19A 3KWIA 5F1XA 4JKAA 4CZMA 1TUUA 1C0FA 1S72N 4DR4K 1QSLA 4C8LA 3ULDA 4M45A 4IEEA 2UUCK 1Z6RA 4IO9L 4GW6A 3VQAA 4XIUA 1JLEA 1JLGA 4M3RA 1WSEA 1NMNA 5KI6A 4HUEA 2NRVA 4U7BA 1ITGA 4FLTA 3RMCA 1WBDA 1L5UA 2F7TA 2EWSA 2NNWA 4C1NK 2ZJQL 2E2NA 1DKGD 4B3SK 1VQNN 3VGMA 3UB5A 3MWTA 2W42A 1OH6A 3G10A 4KTWA 3LPUA 4FM2A 2XY6A 3PY8A 3QIOA 1RBRA 3HPOA 3A5OC 4CEEA 4NXNK 4FW1A 5CHIA 2GUPA 3O3FA 3MXMA 1RTIA 3F5TA 1FW6A 1NK7A 3RWUA 3R3LA 3TI0A 3OYGA 5LY3A 3BDPA 5M1PA 2F8TA 4YOXA 4MO5A 1J5OA 1EO1A 1VSJA 1Y97A 4DCHA 2P9LB 5J2MA 1NLVA 3C65A 4IFYA 3FE1A 4PL8A 4CJLA 1BCOA 4KH5A 2ATQA 1GLLO 3QO9A 5JS2A 2OCEA 4BRNA 1GLFO 3S3OA 1TK5A 2YJFA 3NF6A 3ZLJA 3J80O 2EX3A 3C0BA 4YY3K 4CIGA 4R5PA 1GOAA 1Z05A 1QVGM 3CJ1A 4NXMK 1C6VA 4LY7A 1RTDA 1TK8A 3H1VX 3SJJA 2F9TA 4Z4HA 3KD1E 4AHSA 4YOVA 3QDKA 4CIEA 3QEWA 4IXCA 5C0YA 3VQ8A 2KTQA 4H5NA 1D8YA 4JYAK 1VQ7N 4MO4A 4E0DA 4DQQA 3P1GA 2P5OA 3I56N 2V51B 4A62A 2IIRA 4H03B 1VHXA 3KVGA 3M3ZA 3F9MA 3CC7N 3TSQA 4ISGA 4UY8O 3E9PA 5EVZA 2WONA 1QSSA 2YJEA 2WC9A 4KHYA 5CZ2A 4M3ZA 2P9NA 2P9KB 4JI1K 4V19S 3FZLA 4PA1A 1BI4A 4KHUA 3LDPA 1WSJA 4BR5A 3CPEA 4DUZK 3O80A 4DV4K 3AVGA 3VF6A 3PSIA 5JVHL 4K43A 1YJ9N 3H08A 5AQVA 1E4GT 3ZT0A 4CJFA 2CGLA 3MN9A 4B8AB 2AJQA 3ZT1A 3VQ7A 2A41A 3P5JA 1ASWA 2ZF5O 3NH2A 2G8UA 3SQ4A 3NVMA 3O9SA 1S22A 5KQDA 5EX5A 2PBDA 3DM2A 2Q0RA 4LF8K 3V1QA 1E3MA 3O9UA 2X74A 4CD3A 1RT6A 1WSHA 1XMQK 1T05A 3ZEUA 1NGIA 4JS4A 3K9JA 3OYNA 1JLCA 1KRPA 1WOQA 3AO1A 1XI1A 4BRPA 1YUWA 3LDOA 1JLQA 3SPZA 4W5OA 3C7NA 2HHSA 1W2BM 1CLQA 3WNGA 4FJHA 4FJJA 1VQKN 4IFVA 4E7JA 4BDZA 3QERA 1NGFA 4IBNA 1LW2A 3KLFA 4B9UA 3LPTA 3AVNA 4CHPA 1LW0A 3SQ0A 5GAHP 4KHQA 2KLAA 1RILA 1V4TA 3VF2A 4E1JA 1SKRA 2G8KA 2UYTA 1U48A 4M3YA 4AM6A 3MMVA 2UUBK 2HF4A 3OYIA 2OPPA 1T6DA 1D9DA 4PUOA 2VGNA 1SV5A 3JS6A 5KGWA 3CIPA 2WFBA 1IKVA 1T03A 4JD2B 3E1YA 1SS6A 1NK9A 1LWFA 3LAKA 5AQFA 3KLEA 3OHRA 3LDSA 4FPBA 4FJ9A 4CHNA 3OYLA 1N36K 4CHZA 3GBTA 1KAXA 3VENA 1U45A 2O8EB 4DSKA 3AA4A 3DLRA 4YNQA 1GLBG 1NGDA 1NGHA 4IKFA 3NH0A 3AO3A 2FBYA 1A5WA 3NFAA 1QZ5A 4AHRA 1BG3A 4M7YA 4JI3K 3VA3A 4FJ7A 1OVYA 3HI0A 4CGIA 5GINA 3SAGA 1ZBLA 1NGCA 3DMJA 5K14A 3MXJA 3SBTA 3CG7A 2BE2A 1SL0A 4A5BA 3VQ5A 4DF8A 5EU7A 4LF7K 3DXKA 4FWLA 3VEVA 1I39A 1OH7A 1X3NA 4XH1A 3V9SA 4CHOA 3LL3A 5BR8K 1NNEA 4FJIA 1GOCA 3KLHA 2UU9K 3A0IX 2PY5A 3HVRA 2E8AA 1LV5A 4JI6K 4DTJA 3U9DA 3GL1A 3NDKA 4DV3K 4NCAA 4C1NI 3E01A 5C12A 4LSNA 4QS9A 5JLFA 3PX0A 1MWMA 3KD5E 1BIZA 2YHWA 1RBVA 1G99A 2Z1IA 4JKEA 4CZGA 3HPGA 3ZSXA 4CJ5A 2O8FB 4FPAA 3CJAA 2FSJA 2YI1A 4F4KA 4J2EA 3EO3A 4PKHA 3ZT4A 3O5BA 4H0OA 1A5XA 3WNHA 4WE1A 2Q2RA 3QEIA 3VETA 5KRSA 3AO2A 3VQDA 4CJQA 1B9DA 2DFHA 1ZXOA 4KRFA 4DWIA 3TSPA 3NGYA 3NCIA 3SAFA 1UA0A 2R7YA 3OJUA 1VSLA 4X65K 3VF4A 3WXKA 5M1OA 2FSKA 1S1UA 1L3TA 1JLFA 3C6TA 3TAFA 1CZAN 1JJ2M 1NJIO 4KPYA 4PHTX 2O8CA 1DGKN 3VQ4A 3FLCO 4EZ9A 3Q7CA 4CEAA 5DM6L 3TANA 1FXXA 1U2VA 4MDAA 4J2DA 4W5NA 4DLEA 1NJZA 1NBWA 4I2PA 5AQSA 1N8RO 3HYFA 3AGKA 2KKZA 5I3UA 3RR8A 4OLAA 4DTSA 2ITMA 4DR2K 4FWRA 4KH4A 4RW4A 3VN5A 2KZZA 4NYNA 1JLAA 3IFRA 3O9QA 3NH1A 1J5EK 5FPDA 3IKMA 2RPIA 4FWMA 3IDHA 3TWHA 2E4LA 1RDBA 2B6AA 3VA0A 1TYQA 4ELVA 4FJNA 4KHNA 1VK0A 4MLEA 1YF5L 2HMPA 4IO8A 4KFBA 4BRHA 3PX6A 3AVJA 5BN8A 3G4SN 5LL6Z 3VPZA 4FLWA 4KHPK 4CCHA 1IG9A 1RFQA 2E2QA 2D1KA 1Z26A 3CYMA 2HNDA 5TKWA 4DSFA 3V6DA 3SUOA 3I55N 1S3XA 3CPWM 1NGGA 1SQKA 3PO4A 3EKUA 3QESA 4LF4K 3T69A 3ZX2A 3ZSWA 4B3MK 1U6ZA 3CCQN 1IBKK 4B1UB 3SLCA 4BRMA 5KQ8A 1ZBHA 3MN7A 2ASPA 4FVUA 1TAQA 1DTQA 1ATSA 2HMIA 2HVIA 3EE8A 4IWVA 4ID1A 3M5RA 1GLCG 1L3VA 2W6KA 5GIOA 2OTLN 4WFBL 3PIOL 3NF8A 2BH1A 1C0MA 4DFJA 3PLAA 4IDKA 2KHOA 4JHDB 4A2AA 1TKXA 2RE2A 3CQ8A 4BR2A 3VEOA 4KAZA 3LP1A 4DTXA 1JL2A 1GLJO 2HBJA 4NLCA 3C6HA 1JCEA 2QTDA 1HPMA 1XNQK 3HM9A 2YHAA 5F0XA 5LMNK 4HTUA 3A2FA 4KV8A 5CYQA 2QW9A 4BY9C 4OKJA 3AA2A 4B9NA 4CI6A 4DHYA 4TSXA 3HP6A 4Q0BA 4H0VB 1SAZA 3MAQA 4H4MA 1IG8A 4DSLA 4Z0UA 2I7NA 1HMVA 3E9LA 1BU6O 2F9WA 3G0ZA 4Z4GA 4BDYA 2O4IA 1BO5O 2VCPA 1EX4A 1D5AA 1O1WA 1YXQA 3A8YA 1NOYA 3N4QA 4X62K 2O4GA 3CCUN 2ZGZA 3J7YP 1G15A 3VESA 4DMNA 2HSTA 1REVA 1YTUA 1MA9B 4IG3A 5JLHA 2A5XA 1N33K 4K0KK 1B92A 2D0BA 3ITHA 4FJMA 4GKKK 3ZSQA 1HKCA 2VG5A 3UKUA 1TK0A 2VG7A 5ADXA 2A1SA 4JLHA 1BIUA 2FLOA 2GTDA 2ZD1A 3LANA 3S9HA 1TKDA 4AM7A 3TU5A 4DS4A 2XY7A 4BG8A 2HHXA 5CY4A 3ZCMA 3ZETB 3OTOK 5C10A 3CM5A 4FJLA 4LF6K 2BDPA 4GVEA 3W3DA 2CH5A 3CXCM 5GAGP 3CM6A 3O08A 4FWQA 4YHHK 4CJTA 1MWKA 4Y1DA 1XMOK 2PYLA 3BZCA 4A59A 5J1EA 3PUFA 5AQMA 4FOEA 3HO1A 5FPNA 1GLDG 1QS4A 3CCVN 4O5BA 3SQ1A 4O8UA 4PKIA 3RVCA 1N32K 4OPHA 3LDNA 3ULEA 2ETJA 4EAHD 2BANA 3RTVA 2VQFK 3VQ6A 5MLCQ 3T1HK 1VQMN 1VQ8N 2YNFA 3VMFB 4WQ4C 4FOIA 4H0YB 4K41A 3V1OA 5HRRA 4AHVA 3CC2N 2YNGA 1NK6A 3IAYA 3OYFA 4G9ZA 2H3GX 2A40A 5AQGA 5DM7L 1YJNN 4HWIA 3DLLL 4FSVA 4HUFA 5AQIA 3NGZA 5AQZA 4F2RA 4WQ5A 4OGCA 4N41A 4IJAA 3O9RA 3VQCA 4BVOA 3ZETA 1XUPO 1KFDA 1T3VA 2YV0X 5AQWA 4ZHRA 3TTCA 3I0RA 4IJNA 3GDQA 4CJWA 3AV9A 4ZTFA 1VRUA 1X3MA 3DI6A 5CR4A 3R9PA 5FPEA 1KD1O 5AR0A 4DV7K 3BGRA 3SV4A 3ID6A 4BRLA 2NRZA 4CESA 3NF9A 2J4RA 3TSUA 1U47A 2GBZA 1JXBA 5BN9A 3OW2M 2NRXA 2B5JA 4A61A 5AQRA 3AVCA 3VQ9A 1ZBFA 2RF2A 3WQTA 3AAPA 3ZX3A 3L2UA 2ASMA 2D0OA 4GKJK 4YOYA 3AAQA 2UXDK 4XH5A 4CFDA 3T1AA 4M3WA 3NE6A 4KH6A 4DTUA 2NZTA 3U9ZA 5GAEP 3OY9A 1NGEA 4FM1A 2P9NB 4CJEA 4B9QA 3S3NA 1BI4B 3IS9A 2FF3B 1NMDA 2DY4A 2FF6A 4EP5A 3CMAN 3D0PA 3NBPA 5M1FA 3K0SA 4YOTA 4GV9A 1WLJA 4YOUA 1EP4A 3AVIA 2PAVA 4MQ3A 4BR4A 1K6YA 5IWAK 4J2AA 3QIPA 5FDLA 4OGEA 3SI6A 4BRGA 4W5RA 1O13A 2VWBA 5M1KA 3BF1A 4DTMA 3WXLA 4E3SA 2OZMA 4DV5K 4RW6A 3ZSOA 3ZEUB 2G8FA 1XNRK 3A5LC 4K42A 3SNNA 3ZSZA 1VSMA 4B08A 1OVQA 1WSGA 3C7NB 3MDQA 3EY1A 4DQRA 2D4WA 3OYAA 4H5RA 4HUGA 2YHXA 2QWNA 3SUNA 2KW4A 4CF1A 2BUPA 3CQYA 4CF8A 1RNHA 4I6MA 5FRMA 1RT1A 1BQMA 4DU4A 1S5JA 1X9MA 3VQPA 1KSPA 3UIQA 2QWLA 5AJ3K 3PX4A 1QZ6A 4FL9A 3V9WA 4DUYK 3OYKA 1FKOA 4FWSA 3LDQA 2P9UA 1VQPN 1JKHA 4L8RB 4RW7A 2IVNA 3HZ6A 4CBXA 3V4IA 3IUCA 2A1RA 1KLMA 3SMSA 4BROA 4LFBK 3WNFA 2XHBA 4DF4A 1RT3A 3D45A 5C42A 1J9AA 3K9KA 4OPJA 3SQ2A 2QXLA 1C1AA 3JAMO 2AA4A 3VEZA 1WSFA 3R6MA 3MN6A 1J53A 1LAWA 3C94A 4B9VA 1CZBA 3SYZA 4C8OA 3CCRN 1XHXA 1RT7A 3MX2A 4CEOA 2CH6A 3HRGA 3IG1A 1DLOA 3LAMA 2IS3A 1RT5A 2QWMA 5AQTA 4BE2A 1JL1A 3HTVA 1RDAA 2GWKA 3QETA 4O5FA 1HKBA 4DKWA 2O8DA 3THXA 1P8ZA 1R0AA 2OPSA 4B1VA 3BY5A 4BC5A 4ILGB 3E66A 4B1WB 4M63C 2NUBA 4K25A 1IJJA 1W0HA 1JCFA 3RR7A 2YNIA 3K59A 3PV8A 5BRHA 2Z1GA 3HBTA 3DXKB 4NYFA 1M90O 2PYJA 3AGRA 4IDHA 4N47A 3ZSYA 3HM8A 2QI2A 1LAVA 2FSNA 2QKBA 4BG9A 3L2RA 5KPZA 2WBNA 3ENOA 4A5AA 2DPNA 1VQLN 4DV0K 1X9SA 1NWKA 1YTAA 1YVUA 3L8BA 4JK8A 2RN2A 4BE0A 4WFAL 1KLNA 4CEFA 3CJ9A 2YX6A 1QQOA 2DTUA 4E1MA 4IFEA 4A57A 3CFRA 1SZ2A 4H5TA 1X9WA 4WQ4A 4EZ6A 1HJOA 4DTOA 2FBXA 3HL8A 3Q7BA 4FVMA 4FLUA 3U3YA 3J7AP 4H4OA 5AQKA 1VRTA 3H3OB 4AQYK 4BC3A 3FFIA 4H8KA 3O1WA 4XH4A 1YITN 4EHUA 5AQHA 5TKYA 3IRXA 2OZSA 1SKSA 5CZ1A 2IGIA 4CIFA 2P9PA 3L3UA 3FR0A 5FROA 4CGHA 4HCCA 3VOVA 1HNVA 2HVHA 4B8CA 4CHYA 2O8BB 3OYHA 1KAYA 4DV6K 4KB1A 3VGKA 2O8CB 1K9MO 2ZQBA 3M1FA 3V9ZA 1VQ6N 1SUQA 1U2VB 4X66K 2HHVA 2QWQA 1EWQA 4AHCA 4DSJA 4B3OA 4N56A 3V9UA 2IAJA 4FWPA 3O1BA 4WQ5C 1MDUB 1RBUA 1U49A 4BRCA 3HT3A 4CJPA 4DR7K 1WAFA 3HOSA 2IDOA 4CVNE 3THWB 4CF0A 2Z1JA 2Z1HA 4KI4A 1KAZA 3OYBA 3K57A 1U04A 4HTLA 4CGDA 5FPMA 3D2FB 4DV1K 3DLHA 2UXBK 2GUIA 3O4NA 3K5OA 4F3TA 1TYQB 2F96A 4CK3A 3QNOA 4BRDA 3OBWA 4NCBA 1TVRA 2EHGA 2P5GA 4GY2B 4DSIA 3DAWA 2OPRA 1RT4A 3WXMB 1WB9A 2HBMA 1WUAA 4LH5A 1TL1A 3F2KA 4OLBA 4CE9A 5KGXA 1N5YA 2HHUA 1ASVA 2VGMA 3M8QA 1GLAG 2QM1A 4CJKA 4CJ4A 1QSYA 1T7PA 1TL3A 1HRHA 4CD1A 5KPRA 3DLKA 3AA3A 4L3QA 3C95A 3CF5L 5JICA 3VQEA 3SV3A 5DK5A 1K73O 3WQUA 2O8BA 1ZBSA 2KZMA 4DTRA 3D2EA 3V81A 1SL2A 4GNIA 1IKWA 4BE1A 3EEQA 4DFMA 1TAUA 1T6CA 4GVMA 3NAEA 2P1JA 3MEGA 3QBXA 4UQGA 3TAGA 2QWOA 4DS5A 4YDUA 3HPHA 4MFBA 4CFCA 4OX9K 3THWA 3C6UA 1VQ5N 4M3UA 5HRPA 3O6WA 1HX1A 3M8PA 4N76A 3D2FA 1VSDA 2YCHA 5HBMA 1HNWK 3VEWA 4FLYA 4O55A 5AQPA 2E5LK 3HVTA 3SPYA 4NCGA 1YJWN 1BQNA 3GE1A 5FRNA 3O9TA 4KI6A 5CYMA 5I42A 1QHAA 3ZT3A 2NRTA 4HVJA 1QE1A 2W6LA 1HKGA 2NRHA 3A5NC 4JI8K 1T44A 3TTDA 1WSIA 4GMJB 3UKRA 1JXEA 5LJWA 4DG1A 3MN5A 4KREA 4A2BA 3QBWA 3C6AA 3T3FA 2D0AA 3P83D 3SAHA 5LMUK 1I3AA 3CC4N 3THYA 3TAEA 3J8AA 3SZ2A 5EXWA 3WEEA 4B9SA 2JGUA 3FZHA 3BUZB 4G1QA 1HLUA 2IVOA 2W40A 4FZZA 2BGGA 4WCEL 4RW8A 2W41A 3OVNA 3U8XA 2NLXA 3R1XA 3MECA 1BWFO 3UKUB 3BF3A 3L2VA 4N5SA 2DFFA 3DRPA 2A42A 4CJ7A 1LCUA 2KQ2A 1RTJA 4ICLA 4BQLA 3OYEA 3V9XA 1L3UA 5C24A 1WAJA 4FK0A 4C8KA 3PSFA 1BOTO 4CECA 5HLFA 3QICA 4IOAL 4PL7A 3RMAA 2NRWA 4DR3K 3DRSA 4JKDA 5HP1A 1K8KA 3OYDA 2X78A 1SL1A 4RW9A 3DJCA 3LP0A 3CCEN 2P9SA 3OYCA 4I2QA 2JLEA 3I0SA 3VEYA 1RCHA 4O0IA 5AZIB 3J7ZO 3ULEB 1EQYA 4CJVA 1VQ9N 5HROA 4JKBA 2HF3A 4LF9K 4U67L 2QA4N 4JS5A 4QS8A 3CETA 3I8BA 4FXDA 4JNEA 4CERA 5AQYA 2RHKA 4JK7A 3EYZA 3LALA 5C25A 4FZXC 4F8RA 2VQEK 4H0XB 4W5QA 1NKEA 5J2QA 5AQXA 3CJCA 2XO7A 2ITGA 5ADXH 2OTJN 4OKEA 1N6QA 1RDDA 4EP4A 4OPKA 3T7ZA 3KKRA 5AQQA 3AVBA 2YHYA 4FW2A 1RDCA 4OPAA 1HUXA 4CEZA 3AVHA 1D9FA 4JI5K 5KPTA 1Q8IA 3SK3A 1QQCA 1HQEA 4BRQA 3LP2A 4FWOA 4BREA 1HYZA 2WOMA 4NLBA 3DOKA 1WN7A 4M3TA 2A6AA 3RSEA 1Z25A 4PWDA 3VEXA 1NK4A 4DU3A 4BWJA 2Q0UA 4DLGA 4LFCK 4KHWA 1EWRA 1Q82O 4WFNL 5AZIA 2GV9A 3RRHA 2IVPA 3SUQA 4KTQA 2IC3A 4QS7A 1S9GA 1BDGA 1JLBA 3NGIA 3VQQA 1BA0A 1QQNA 4DQIA 2G8IA 3CHWA 3B6OA 3LZIA 1CXQA 4ILHA 4H0TB 3WT0A 2YNHA 4KB0A 5M1NA 3K2PA 1C0TA 3HOTA 4HCBA 3L6QA 4ILJA 4FZYA 3CERA 2VWJA 2GEMA 3LWLA 1S1XA 4LFAK 4OJRA 4JEPA 4RWTA 4H5VA 4M7XA 1XC3A 4DR6K 4MDBA 1KVAA 3PO5A 4JI7K 4FJKA 1TUYA 4RTFD 2HNZA 5DMRA 5AZJA 2ZJPL 3MEDA 5IT9O 4C8NA 2A3ZA 1NJXA 3TR8A 4Z4FA 3CCLN 1XQSC 2FC0A 3G71N 3N4PA 5D3GA 4YOWA 4FCYA 4H0PA 1B9FA 3H3NO 1WNSA 4CEBA 2F4VK 4BGAA 3R8EA 1YI2N 4WF9L 1HPZA 3KK1A 2Q1NA 1TGOA 1CXUA 2Q31A 2P9IB 3HP9A 1FK9A 1ZBUA 5AFUA 5HRSA 3IMXA 1E4FT 4FJ5A 4CBUA 4ID5A 3E9OA 3FZMA 5C15A 5AFUH 1RDUA 1IO2A 3EZWA 1XHZA 1YAGA 1TKTA 3L0QA 4I6MB 2HHTA 1Q7YO 2E1YA 4LH4A 2GX9A 2FBVA 4FYDA 1V4SA 3H6EA 4CGJA 1D4XA 2VG6A 3OYJA 3T1YK 2HNYA 4CEQA 5BPLA 3LZJA 4LF5K 2P9UB 4OVLA 4M41A 1QVFM 5C2FA 3TAQA 1CZ9A 5E84A 3U3GA 4CGGA 4AILC 2HW3A 1IKXA 1ILYA 1BCMA 3GG4A 1VQ4N 3CI5A 4Y0WA 4PKGA 5B8HA 1R59O 1OH5A 3HSTB 3CFPA 3S41A 4GV6A 4JI2K 4YDUC 1Q81O 4LD0A 2HHHK 4JKGB 4DR1K 3VTIA 4K8ZA 1NK8A 1NKCA 2P9IA 5FLXO 2WUSA 5E41A 1KC8O 4M42A 2GELA 5EOYA 5SZTA 4CJSA 1YIJN 2WTUA 4B9MA 3MXIA 1EETA 1S1WA 4BVPA 4ELTA 4BRFA 2Q36A 1W9HA 1H1VA 1SKWA 1DT9A 2O8DB 1EKEA 1QQMA 3MX5A 3THXB 5HRNA 5GADP 4DB3A 4E89A 4CJ3A 5AQLA 3ZSVA 2Q3SA 3LM2A 2B4JA 2F8SA 1F21A 3DLGA 4BGBA 3HJFA 4FK4A 4FM0A 5AQOA 1J6ZA 3EL2A 4BRKA 2P9LA 4ELUA 1A5VA 3VTHA 2E20A 5T7BA 3OS2A 3ATVA 2GWJA 1NGBA 1KCFA 5BPNA 3ZX0A 5JVGL 4JK9A 4CF2A 3TAMA 3FGUA 4PQUA 5AQUA 5BRDA 5ELZA 4ZTJA 4FK2A 1S6PA 1XC9A 4E7KA 3AVFA 4FLVA 4JKGA 3CCMN 3CCJN 1Q9YA 3AO5A 4DFPA 3TTFA 3L4IA 3MWPA 1XWLA 4CHQA 4I7FA 2BTFA 1N34K 4CFBA 3K58A 1NK5A 1GLEG 4JKHA 1S6QA 4CJUA 1KQSM 2QKKA 1WBBA 2YKNA 5CE3A 4CEDA 2AP1A 4F2SA 3O3GA 4JRQA 4EHTA 5H1SQ 3VERA 1VQON 3KK2A 3DLEA 3SJHA 5KRTA 5F2RA 1KXPA 4BR7A 1U4BA 4CFAA 1IH7A 3EN9A 4KBOA 3CD6N 2P9PB 1BL3A 4CZEA 1Q9XA 1MU2A 4BR0A 3QFUA 3KK3A 3ENBA 3M6GA 2P9KA 1C0UA 4FWKA 4B1YB 3EZ5A 1LWEA 1HYSA 1IKYA 4IOXA 3I33A 3NVKA 2E2OA 2E6MA 3L2QA 2UUAK 4FJGA 2UXCK 3MK6A 1X9JA 4NO7A 4JI4K 3DXMB 1VSEA 1IBLK 4BC2A 5HOOA 3QINA 4AF1A 1I94K 2ZE2A 3SMPA 1HNZK 1QHTA 4BACA 3ZYYX 3SCXA 1C1BA 4O44A 2KFZA 4E19A 3LWMA 1NGAA 4YFUA 3HXMA 4KKOA 4Q5VA 4CZJA 3KZBA 4IEIA 2I7PA 1YVNA 3G25A 4Z94A 4M3XA 4FO0A 4ISEA 3LDLA 2RKIA 3K5NA 1ATRA 3O3HA 1T8EA 3TAPA 4BWMA 2QWRA 3KLIA 3AARA 4BR9A 3OYMA 2E1ZA 3ZSRA 1EXQA 1JCGA 4CJRA 1ZYQA 4DQ8A 4DQSA 1Q86O 3BP8A 3O4WA 3WXJA 4IOCL 1GOBA 2E6LA 1KFSA 1S1VA 3K5MA 3D2EB 3L3VA 3ATUA 3NMUA 3I8DA 2D5RA 4K8XA 1NK0A 1RGIA 3MCAB 2ZWHA 3DXMA 1VSFA 4FWNA 1UWBA 3PIPL 5AQNA 2XY5A 3SBGA 4KHSA 1YT3A 2ZGYA 4B9LA 2DFEA 2Y1IA 4JD2A 3FZFA 3QFPA 5BR9A 5I9EB 1J54A 4QAGA 5JMVA 3WUHA 1RBSA 2OA8A 3B6PA 4O4GA 5E26A 2FBTA 3H45C 2ASOA 1HYVA 1S1TA 3AVAA 1QTMA 1ATNA 5BPMA 1HQUA 2O8EA 2V7ZA 4CGFA 1RTHA 1P90A 4OO1J 5A2QO 1VAZA 4JKCA 3UKRB 3KHYA 4AH9A 3WXIA 3CQXA 4DTPA 1TKZA 3D7EO 4BQZA 4BRIA 3THYB 3CMEN 4FJXA 3ASMA 2ZJRL 1IV0A 3KK7A 3WEEB 5SWMA 3V1RA 1VSIA 4JI0K 1BGXT 2P51A 2V7YA 3DWLA 3EKSA 1ASUA 3MCPA 3P39A 4YORA 1S9EA 4B1XB 4XEIA 3OBYA 1DEJA 4B1ZA 4JN4A 1DTTA 5J2PA 4FLZA 4QCLA 5GIPA 3QMLA 1K8AO 1LWCA 3VGLA 5KTQA 3ALYA 1UAXA 4E1NA 2QWPA 1RDWX 3L4QA 4CZIA 1NG9A 4Z4IA 4BRAA 1L3SA 3ENHA 2JWLA 4JRPA 1FJGK 3F73A 3VQBA 3M8RA 4F9OA 4O0JA 2PZSA 4DR5K 1NJYA 4JAXA 3TARA 3JXUA 4DTNA 3KWGA 1RT2A 3O4QA 1K8KB 2Q97A 4X64K
chains in the Genus database with same CATH topology
4DU3A 4BWJA 4DLGA 3ZSZA 3SNNA 1VSMA 4KHWA 2OPQA 4B08A 4CK1A 3AA4A 4DSKA 1WSGA 3DLRA 3QEPA 2GV9A 3EY1A 4DQRA 3RRHA 4YNQA 3OYAA 3SUPA 3SUQA 4KTQA 2IC3A 1S9GA 4HUGA 4IKFA 1JLBA 3NGIA 3VQQA 3NH0A 3AO3A 2FBYA 1A5WA 3NFAA 1VSHA 4AHRA 4DQIA 3SUNA 2KW4A 2G8IA 4CF1A 3VA3A 4FJ7A 4E7HA 1BHLA 3AA5X 3NF7A 1HNIA 3B6OA 1CXQA 4CF8A 4CGIA 3LZIA 2YKMA 1ZBLA 3DMJA 5K14A 3KTQA 3MXJA 1RNHA 1HJRA 5FRMA 1RT1A 1BQMA 1TV6A 4W5TA 2YNHA 4DU4A 4KB0A 3K2PA 1S5JA 1X9MA 3VQPA 1C0TA 3CG7A 3KKSA 1KSPA 3UIQA 2LSNA 2BE2A 4HCBA 2G8HA 4I9LA 4I9QA 4BDPA 1SL0A 4AHUA 3VQ5A 3PX4A 4DF8A 5EU7A 4PWDA 4FZYA 3NHGA 4FJ8A 2VWJA 3V9WA 1I39A 1S1XA 3OYKA 3LWLA 1FKOA 1JKHA 4OJRA 4L8RB 4RW7A 3U6FA 1X1PA 3V9SA 2D0CA 3ISNC 4CHOA 3KIOA 3V4IA 4FJIA 1GOCA 1KVAA 3AVLA 3KLHA 2A1RA 4E7IA 3PO5A 2PY5A 2HNZA 4FJKA 1KLMA 5DMRA 3HVRA 4DU1A 1LV5A 3MEDA 3QEXA 1UOCA 3WNFA 2XHBA 4DTJA 4C8NA 3L2WA 3AVMA 3WNEA 4DF4A 4C8MA 1RT3A 3D45A 5C42A 1J9AA 3NDKA 3TR8A 1NJXA 4OPJA 3SQ2A 2VWKA 4NCAA 1C1AA 3E01A 4Z4FA 2FC0A 4Z4EA 1WSFA 4LSNA 5D3GA 4FLXA 4QOZB 1NJWA 4FCYA 1J53A 1B9FA 1LAWA 3C94A 4B9VA 1CZBA 3SYZA 1WNSA 3CFOA 4C8OA 1XHXA 3PX0A 4CEBA 3KD5E 1BIZA 1RT7A 4F3OA 4CEOA 4AHTA 1RBVA 2XY8A 3IG1A 2Z1IA 4DSEA 1DLOA 3DRRA 3HPGA 3M8SA 1HPZA 2IS3A 1RT5A 3LAMA 3ZSXA 1TGOA 4CJ5A 3KK1A 1CXUA 3RMDA 4J2EA 4F4KA 3HP9A 1FK9A 1ZBUA 1JL1A 3ZT4A 4CF9A 3JSMA 4BE2A 4LSLA 5HRSA 1A5XA 3WNHA 4FJ5A 2I5JA 4WE1A 1RDAA 3QETA 4ID5A 3OS0A 4CK2A 3QEIA 5KRSA 3AO2A 3VQDA 4OKKA 3JYTA 1IO2A 4IG0A 4CJQA 1B9DA 1XHZA 4HHTA 3MEEA 3K5LA 1R0AA 1TKTA 4E7LA 2X6NA 3TABA 4Y1CA 2G8WA 2DFHA 2OPSA 2HHTA 4KRFA 4DWIA 2HHWA 3NGYA 4LH4A 3OJSA 2FBVA 3NCIA 1UA0A 4FYDA 2R7YA 4PY5A 2NUBA 3OJUA 1VSLA 4KO0A 1W0HA 3RR7A 2YNIA 3KJVA 3K59A 2HHQA 4CGJA 3HK2A 3PV8A 1UA1A 2VG6A 3OYJA 2Z1GA 1S1UA 1L3TA 1JLFA 1KTQA 3C6TA 2HNYA 5J2NA 4CEQA 4NYFA 3TAFA 3RRGA 1ZBIA 2PYJA 3LZJA 4N47A 4M41A 4OVLA 3ZSYA 4KPYA 1LAVA 2OYQA 3TAQA 3VQ4A 2QKBA 1CZ9A 1NOZA 3QEVA 3U3GA 4EZ9A 2YHBA 4CGGA 3L2RA 4CEAA 4AILC 3TANA 4DFKA 1FXXA 2G8VA 1IKXA 2HW3A 4J2DA 2KFNA 4W5NA 3BDPA 4DLEA 1NJZA 1BCMA 3QNNA 4I2PA 3HYFA 3QLHA 1NKBA 1X9SA 5I3UA 3THVA 3RR8A 1KVBA 4OLAA 3HSTB 1YTAA 3CFPA 4DTSA 3DLBA 3S3MA 4B9TA 1YVUA 4RW4A 3VN5A 3L8BA 2KZZA 2RN2A 4NYNA 4BE0A 1JLAA 4LD0A 3NH1A 1KLNA 4CEFA 2IOCA 4J2BA 4K8ZA 3AO4A 2RPIA 1NK8A 3F9KA 3TWHA 1NKCA 2E4LA 4RG8A 2DTUA 1RDBA 2B6AA 3DYAA 4E1MA 3DOLA 5E41A 3VA0A 4M42A 3OS1A 4FJNA 1BISA 4ELVA 1RBTA 4KHNA 1VK0A 5SZTA 3CFRA 4CJSA 4KFBA 1VSKA 4B9MA 3PX6A 2XRIA 4KTZA 1X9WA 3AVJA 3MXIA 4EZ6A 3AVKA 3LP3A 1EETA 1S1WA 4DTOA 3RMBA 4ELTA 2FBXA 3HL8A 4Z4IA 4FVMA 1W9HA 4FLWA 4FLUA 1SKWA 4DQPA 1KVCA 1C1CA 1EKEA 3U3YA 4CCHA 5JS1A 1IG9A 4H4OA 1VRTA 5HRNA 1Z26A 3CYMA 2HNDA 4E89A 3FFIA 4DSFA 4CJ3A 4H8KA 3V6DA 3SUOA 2QK9A 3ZSVA 2Q3SA 3PO4A 1FKPA 2B4JA 3IRXA 3QESA 2OZSA 1F21A 3DLGA 1SKSA 2F8SA 2HB5A 3ZT2A 2X6SA 5CZ1A 4Z4CA 3KLGA 2IGIA 4CIFA 4FK4A 4FM0A 3L3UA 2QXFA 3ZSWA 5FROA 2Y1JA 4ELUA 1A5VA 1ZBHA 3T19A 4CGHA 4HCCA 1HNVA 5T7BA 2HVHA 4B8CA 1TAQA 4CHYA 3OS2A 1DTQA 3OYHA 2HVIA 2HMIA 4KB1A 1KCFA 1QSLA 4C8LA 3ULDA 2ZQBA 4M45A 3V9ZA 4ID1A 1SUQA 4GW6A 3VQAA 4XIUA 1L3VA 2HHVA 1JLEA 1JLGA 4M3RA 1WSEA 4CF2A 3TAMA 5KI6A 4AHCA 3NF8A 4DSJA 4HUEA 4B3OA 1C0MA 4DFJA 1ITGA 4N56A 4FLTA 4IDKA 2IAJA 3V9UA 3RMCA 4ZTJA 1S6PA 1L5UA 4FK2A 3CQ8A 1XC9A 1TKXA 4E7KA 1RBUA 1U49A 3HT3A 3AVFA 4CJPA 3LP1A 4FLVA 4KAZA 4DTXA 1WAFA 2IDOA 1JL2A 1Q9YA 2W42A 4CF0A 2Z1JA 2Z1HA 3AO5A 3G10A 3OYBA 3K57A 4DFPA 1U04A 4KI4A 4KTWA 4CHQA 1XWLA 4CGDA 3HM9A 2YHAA 4I7FA 3DLHA 3LPUA 4CFBA 2GUIA 3O4NA 3K5OA 3QIOA 3K58A 4FM2A 2XY6A 3PY8A 1NK5A 4F3TA 2F96A 1RBRA 4CK3A 3HPOA 4HTUA 3A2FA 3QNOA 4KV8A 5CYQA 4NCBA 1TVRA 1S6QA 2EHGA 4CJUA 2QKKA 2P5GA 4DSIA 2YKNA 4OKJA 2OPRA 1RT4A 3AA2A 4CEDA 4B9NA 4TSXA 4CEEA 3HP6A 4F2SA 3O3GA 4FW1A 4Q0BA 4JRQA 4LH5A 3O3FA 1TL1A 1RTIA 3MAQA 4H4MA 3MXMA 4OLBA 4CE9A 4DSLA 5KGXA 1N5YA 4Z0UA 3KK2A 1NK7A 1HMVA 1ASVA 3DLEA 5KRTA 2HHUA 3G0ZA 4Z4GA 3M8QA 3RWUA 4BDYA 3TI0A 1U4BA 2O4IA 4CJKA 4CFAA 4CJ4A 3OYGA 1QSYA 1EX4A 1HRHA 1IH7A 1D5AA 1TL3A 3DLKA 1T7PA 1J5OA 1O1WA 2F8TA 3AA3A 1NOYA 1VSJA 3C95A 1BL3A 3SV3A 1Y97A 2O4GA 1MU2A 3VQEA 1Q9XA 1G15A 3KK3A 5DK5A 5J2MA 4DMNA 4IFYA 2KZMA 4CJLA 1BCOA 2ATQA 3QO9A 1REVA 5JS2A 1C0UA 1HYSA 3EZ5A 1LWEA 4DTRA 1YTUA 1IKYA 3V81A 1SL2A 4IG3A 1IKWA 2E6MA 3S3OA 4BE1A 1B92A 3L2QA 4DFMA 1TAUA 1TK5A 2D0BA 3ITHA 3NF6A 4FJGA 4FJMA 4GVMA 2VG5A 3ZSQA 2EX3A 3NAEA 4R5PA 4CIGA 1TK0A 2VG7A 2P1JA 3MEGA 4UQGA 2A1SA 3TAGA 4JLHA 1VSEA 1BIUA 1GOAA 4DS5A 3HPHA 1C6VA 4LY7A 2ZD1A 4MFBA 3LANA 4CFCA 3QINA 3S9HA 1TKDA 2ZE2A 4DS4A 1RTDA 2XY7A 2HHXA 1TK8A 3C6UA 5CY4A 3ZCMA 3SJJA 1QHTA 4M3UA 4BACA 4Z4HA 3CM5A 3SCXA 3KD1E 1C1BA 4AHSA 5HRPA 4FJLA 2BDPA 4O44A 3M8PA 4N76A 4CIEA 3QEWA 1VSDA 2KFZA 5HBMA 4FLYA 4E19A 3LWMA 4O55A 3CM6A 3VQ8A 4YFUA 3HXMA 2KTQA 3HVTA 3SPYA 4NCGA 4KKOA 4Q5VA 1BQNA 4CJTA 5FRNA 4Y1DA 4KI6A 5CYMA 5I42A 3ZT3A 1D8YA 4HVJA 2PYLA 5J1EA 1QE1A 3PUFA 3HO1A 4E0DA 4DQQA 1QS4A 3P1GA 4M3XA 2P5OA 4O5BA 2RKIA 3SQ1A 1WSIA 3K5NA 4GMJB 1JXEA 3O3HA 1T8EA 4DG1A 4KREA 3TAPA 2ETJA 3T3FA 2BANA 4BWMA 3RTVA 3KLIA 2D0AA 3P83D 1I3AA 3VQ6A 2YNFA 2WONA 3TAEA 1QSSA 3OYMA 3ZSRA 3SZ2A 1EXQA 3V1OA 4B9SA 5HRRA 4AHVA 2JGUA 4CJRA 1ZYQA 4DQSA 4KHYA 4PQUA 2YNGA 5CZ2A 1NK6A 3IAYA 3OYFA 4G1QA 4M3ZA 1GOBA 2E6LA 1KFSA 1S1VA 4PA1A 1BI4A 3K5MA 3L3VA 4KHUA 4FZZA 3I8DA 2BGGA 1WSJA 4RW8A 2D5RA 3OVNA 4K8XA 3AVGA 1NK0A 4HUFA 3NGZA 3MECA 3H08A 4F2RA 1VSFA 3ZT0A 4CJFA 1UWBA 4B8AB 2AJQA 3ZT1A 4OGCA 3VQ7A 3L2VA 4N5SA 4N41A 2DFFA 2XY5A 4KHSA 1YT3A 3DRPA 3P5JA 4B9LA 2DFEA 3VQCA 2Y1IA 3OYEA 2KQ2A 1RTJA 4ICLA 1ASWA 3V9XA 1L3UA 5C24A 1KFDA 3NH2A 2G8UA 3SQ4A 1J54A 2YV0X 1WAJA 4ZHRA 4FK0A 4C8KA 4QAGA 3I0RA 3DM2A 4CECA 5HLFA 2OA8A 1RBSA 3B6PA 4O4GA 3V1QA 4CJWA 2FBTA 2X74A 3AV9A 3RMAA 4ZTFA 1RT6A 1VRUA 1WSHA 3DI6A 1T05A 3DRSA 1HYVA 4JS4A 3BGRA 3SV4A 1S1TA 3AVAA 3OYNA 4CESA 1JLCA 1KRPA 5HP1A 3NF9A 1QTMA 3OYDA 3AO1A 2X78A 1XI1A 1U47A 1SL1A 4RW9A 1HQUA 2GBZA 1JXBA 1JLQA 3SPZA 3LP0A 1RTHA 4CGFA 4W5OA 2B5JA 3OYCA 4I2QA 2JLEA 3I0SA 2HHSA 1RCHA 4O0IA 3AVCA 3VQ9A 1ZBFA 4AH9A 1CLQA 2RF2A 4DTPA 3WNGA 4CJVA 1TKZA 3L2UA 4FJHA 4FJJA 5HROA 4IFVA 4FJXA 3ASMA 4CFDA 4E7JA 4BDZA 3QERA 3T1AA 4M3WA 3NE6A 4IBNA 1LW2A 5SWMA 3V1RA 3KLFA 4JS5A 4DTUA 1VSIA 4B9UA 3OY9A 3LPTA 3AVNA 4FM1A 1BGXT 4CJEA 4FXDA 4CHPA 1LW0A 2P51A 4CERA 3SQ0A 1ASUA 3S3NA 4KHQA 1BI4B 1S9EA 3EYZA 3IS9A 3LALA 2DY4A 1RILA 5C25A 4EP5A 4FZXC 4F8RA 1SKRA 1DTTA 2G8KA 5J2PA 3D0PA 4FLZA 4QCLA 3NBPA 1U48A 1LWCA 4W5QA 5KTQA 1NKEA 4M3YA 5J2QA 3ALYA 3OYIA 2OPPA 1UAXA 1WLJA 1D9DA 4E1NA 4PUOA 1EP4A 2XO7A 3AVIA 1SV5A 2ITGA 4MQ3A 5KGWA 3HJFA 1IKVA 4OKEA 1K6YA 1N6QA 1RDDA 4EP4A 4OPKA 1T03A 1L3SA 3KKRA 3QIPA 4J2AA 5FDLA 3AVBA 4OGEA 3SI6A 4FW2A 4JRPA 1RDCA 1NK9A 1NK4A 1LWFA 3LAKA 4CEZA 4W5RA 3AVHA 3KLEA 3F73A 3VQBA 3M8RA 1D9FA 3LDSA 4O0JA 4DTMA 4E3SA 2PZSA 1NJYA 4FJ9A 4CHNA 3TARA 2OZMA 3OYLA 4RW6A 1Q8IA 3ZSOA 1QQCA 1HQEA 2G8FA 3LP2A 4CHZA 1HYZA 2WOMA 4DTNA 3DOKA 1RT2A 1WN7A 3O4QA 4M3TA 1Z25A 1U45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DU3 A;  4BWJ A;  4DLG A;  3ZSZ A;  3SNN A;  1VSM A;  4KHW A;  2OPQ A;  4B08 A;  4CK1 A;  3AA4 A;  4DSK A;  1WSG A;  3DLR A;  3QEP A;  2GV9 A;  3EY1 A;  4DQR A;  3RRH A;  4YNQ A;  3OYA A;  3SUP A;  3SUQ A;  4KTQ A;  2IC3 A;  1S9G A;  4HUG A;  4IKF A;  1JLB A;  3NGI A;  3VQQ A;  3NH0 A;  3AO3 A;  2FBY A;  1A5W A;  3NFA A;  1VSH A;  4AHR A;  4DQI A;  3SUN A;  2KW4 A;  2G8I A;  4CF1 A;  3VA3 A;  4FJ7 A;  4E7H A;  1BHL A;  3AA5 X;  3NF7 A;  1HNI A;  3B6O A;  1CXQ A;  4CF8 A;  4CGI A;  3LZI A;  2YKM A;  1ZBL A;  3DMJ A;  5K14 A;  3KTQ A;  3MXJ A;  1RNH A;  1HJR A;  5FRM A;  1RT1 A;  1BQM A;  1TV6 A;  4W5T A;  2YNH A;  4DU4 A;  4KB0 A;  3K2P A;  1S5J A;  1X9M A;  3VQP A;  1C0T A;  3CG7 A;  3KKS A;  1KSP A;  3UIQ A;  2LSN A;  2BE2 A;  4HCB A;  2G8H A;  4I9L A;  4I9Q A;  4BDP A;  1SL0 A;  4AHU A;  3VQ5 A;  3PX4 A;  4DF8 A;  5EU7 A;  4PWD A;  4FZY A;  3NHG A;  4FJ8 A;  2VWJ A;  3V9W A;  1I39 A;  1S1X A;  3OYK A;  3LWL A;  1FKO A;  1JKH A;  4OJR A;  4L8R B;  4RW7 A;  3U6F A;  1X1P A;  3V9S A;  2D0C A;  3ISN C;  4CHO A;  3KIO A;  3V4I A;  4FJI A;  1GOC A;  1KVA A;  3AVL A;  3KLH A;  2A1R A;  4E7I A;  3PO5 A;  2PY5 A;  2HNZ A;  4FJK A;  1KLM A;  5DMR A;  3HVR A;  4DU1 A;  1LV5 A;  3MED A;  3QEX A;  1UOC A;  3WNF A;  2XHB A;  4DTJ A;  4C8N A;  3L2W A;  3AVM A;  3WNE A;  4DF4 A;  4C8M A;  1RT3 A;  3D45 A;  5C42 A;  1J9A A;  3NDK A;  3TR8 A;  1NJX A;  4OPJ A;  3SQ2 A;  2VWK A;  4NCA A;  1C1A A;  3E01 A;  4Z4F A;  2FC0 A;  4Z4E A;  1WSF A;  4LSN A;  5D3G A;  4FLX A;  4QOZ B;  1NJW A;  4FCY A;  1J53 A;  1B9F A;  1LAW A;  3C94 A;  4B9V A;  1CZB A;  3SYZ A;  1WNS A;  3CFO A;  4C8O A;  1XHX A;  3PX0 A;  4CEB A;  3KD5 E;  1BIZ A;  1RT7 A;  4F3O A;  4CEO A;  4AHT A;  1RBV A;  2XY8 A;  3IG1 A;  2Z1I A;  4DSE A;  1DLO A;  3DRR A;  3HPG A;  3M8S A;  1HPZ A;  2IS3 A;  1RT5 A;  3LAM A;  3ZSX A;  1TGO A;  4CJ5 A;  3KK1 A;  1CXU A;  3RMD A;  4J2E A;  4F4K A;  3HP9 A;  1FK9 A;  1ZBU A;  1JL1 A;  3ZT4 A;  4CF9 A;  3JSM A;  4BE2 A;  4LSL A;  5HRS A;  1A5X A;  3WNH A;  4FJ5 A;  2I5J A;  4WE1 A;  1RDA A;  3QET A;  4ID5 A;  3OS0 A;  4CK2 A;  3QEI A;  5KRS A;  3AO2 A;  3VQD A;  4OKK A;  3JYT A;  1IO2 A;  4IG0 A;  4CJQ A;  1B9D A;  1XHZ A;  4HHT A;  3MEE A;  3K5L A;  1R0A A;  1TKT A;  4E7L A;  2X6N A;  3TAB A;  4Y1C A;  2G8W A;  2DFH A;  2OPS A;  2HHT A;  4KRF A;  4DWI A;  2HHW A;  3NGY A;  4LH4 A;  3OJS A;  2FBV A;  3NCI A;  1UA0 A;  4FYD A;  2R7Y A;  4PY5 A;  2NUB A;  3OJU A;  1VSL A;  4KO0 A;  1W0H A;  3RR7 A;  2YNI A;  3KJV A;  3K59 A;  2HHQ A;  4CGJ A;  3HK2 A;  3PV8 A;  1UA1 A;  2VG6 A;  3OYJ A;  2Z1G A;  1S1U A;  1L3T A;  1JLF A;  1KTQ A;  3C6T A;  2HNY A;  5J2N A;  4CEQ A;  4NYF A;  3TAF A;  3RRG A;  1ZBI A;  2PYJ A;  3LZJ A;  4N47 A;  4M41 A;  4OVL A;  3ZSY A;  4KPY A;  1LAV A;  2OYQ A;  3TAQ A;  3VQ4 A;  2QKB A;  1CZ9 A;  1NOZ A;  3QEV A;  3U3G A;  4EZ9 A;  2YHB A;  4CGG A;  3L2R A;  4CEA A;  4AIL C;  3TAN A;  4DFK A;  1FXX A;  2G8V A;  1IKX A;  2HW3 A;  4J2D A;  2KFN A;  4W5N A;  3BDP A;  4DLE A;  1NJZ A;  1BCM A;  3QNN A;  4I2P A;  3HYF A;  3QLH A;  1NKB A;  1X9S A;  5I3U A;  3THV A;  3RR8 A;  1KVB A;  4OLA A;  3HST B;  1YTA A;  3CFP A;  4DTS A;  3DLB A;  3S3M A;  4B9T A;  1YVU A;  4RW4 A;  3VN5 A;  3L8B A;  2KZZ A;  2RN2 A;  4NYN A;  4BE0 A;  1JLA A;  4LD0 A;  3NH1 A;  1KLN A;  4CEF A;  2IOC A;  4J2B A;  4K8Z A;  3AO4 A;  2RPI A;  1NK8 A;  3F9K A;  3TWH A;  1NKC A;  2E4L A;  4RG8 A;  2DTU A;  1RDB A;  2B6A A;  3DYA A;  4E1M A;  3DOL A;  5E41 A;  3VA0 A;  4M42 A;  3OS1 A;  4FJN A;  1BIS A;  4ELV A;  1RBT A;  4KHN A;  1VK0 A;  5SZT A;  3CFR A;  4CJS A;  4KFB A;  1VSK A;  4B9M A;  3PX6 A;  2XRI A;  4KTZ A;  1X9W A;  3AVJ A;  3MXI A;  4EZ6 A;  3AVK A;  3LP3 A;  1EET A;  1S1W A;  4DTO A;  3RMB A;  4ELT A;  2FBX A;  3HL8 A;  4Z4I A;  4FVM A;  1W9H A;  4FLW A;  4FLU A;  1SKW A;  4DQP A;  1KVC A;  1C1C A;  1EKE A;  3U3Y A;  4CCH A;  5JS1 A;  1IG9 A;  4H4O A;  1VRT A;  5HRN A;  1Z26 A;  3CYM A;  2HND A;  4E89 A;  3FFI A;  4DSF A;  4CJ3 A;  4H8K A;  3V6D A;  3SUO A;  2QK9 A;  3ZSV A;  2Q3S A;  3PO4 A;  1FKP A;  2B4J A;  3IRX A;  3QES A;  2OZS A;  1F21 A;  3DLG A;  1SKS A;  2F8S A;  2HB5 A;  3ZT2 A;  2X6S A;  5CZ1 A;  4Z4C A;  3KLG A;  2IGI A;  4CIF A;  4FK4 A;  4FM0 A;  3L3U A;  2QXF A;  3ZSW A;  5FRO A;  2Y1J A;  4ELU A;  1A5V A;  1ZBH A;  3T19 A;  4CGH A;  4HCC A;  1HNV A;  5T7B A;  2HVH A;  4B8C A;  1TAQ A;  4CHY A;  3OS2 A;  1DTQ A;  3OYH A;  2HVI A;  2HMI A;  4KB1 A;  1KCF A;  1QSL A;  4C8L A;  3ULD A;  2ZQB A;  4M45 A;  3V9Z A;  4ID1 A;  1SUQ A;  4GW6 A;  3VQA A;  4XIU A;  1L3V A;  2HHV A;  1JLE A;  1JLG A;  4M3R A;  1WSE A;  4CF2 A;  3TAM A;  5KI6 A;  4AHC A;  3NF8 A;  4DSJ A;  4HUE A;  4B3O A;  1C0M A;  4DFJ A;  1ITG A;  4N56 A;  4FLT A;  4IDK A;  2IAJ A;  3V9U A;  3RMC A;  4ZTJ A;  1S6P A;  1L5U A;  4FK2 A;  3CQ8 A;  1XC9 A;  1TKX A;  4E7K A;  1RBU A;  1U49 A;  3HT3 A;  3AVF A;  4CJP A;  3LP1 A;  4FLV A;  4KAZ A;  4DTX A;  1WAF A;  2IDO A;  1JL2 A;  1Q9Y A;  2W42 A;  4CF0 A;  2Z1J A;  2Z1H A;  3AO5 A;  3G10 A;  3OYB A;  3K57 A;  4DFP A;  1U04 A;  4KI4 A;  4KTW A;  4CHQ A;  1XWL A;  4CGD A;  3HM9 A;  2YHA A;  4I7F A;  3DLH A;  3LPU A;  4CFB A;  2GUI A;  3O4N A;  3K5O A;  3QIO A;  3K58 A;  4FM2 A;  2XY6 A;  3PY8 A;  1NK5 A;  4F3T A;  2F96 A;  1RBR A;  4CK3 A;  3HPO A;  4HTU A;  3A2F A;  3QNO A;  4KV8 A;  5CYQ A;  4NCB A;  1TVR A;  1S6Q A;  2EHG A;  4CJU A;  2QKK A;  2P5G A;  4DSI A;  2YKN A;  4OKJ A;  2OPR A;  1RT4 A;  3AA2 A;  4CED A;  4B9N A;  4TSX A;  4CEE A;  3HP6 A;  4F2S A;  3O3G A;  4FW1 A;  4Q0B A;  4JRQ A;  4LH5 A;  3O3F A;  1TL1 A;  1RTI A;  3MAQ A;  4H4M A;  3MXM A;  4OLB A;  4CE9 A;  4DSL A;  5KGX A;  1N5Y A;  4Z0U A;  3KK2 A;  1NK7 A;  1HMV A;  1ASV A;  3DLE A;  5KRT A;  2HHU A;  3G0Z A;  4Z4G A;  3M8Q A;  3RWU A;  4BDY A;  3TI0 A;  1U4B A;  2O4I A;  4CJK A;  4CFA A;  4CJ4 A;  3OYG A;  1QSY A;  1EX4 A;  1HRH A;  1IH7 A;  1D5A A;  1TL3 A;  3DLK A;  1T7P A;  1J5O A;  1O1W A;  2F8T A;  3AA3 A;  1NOY A;  1VSJ A;  3C95 A;  1BL3 A;  3SV3 A;  1Y97 A;  2O4G A;  1MU2 A;  3VQE A;  1Q9X A;  1G15 A;  3KK3 A;  5DK5 A;  5J2M A;  4DMN A;  4IFY A;  2KZM A;  4CJL A;  1BCO A;  2ATQ A;  3QO9 A;  1REV A;  5JS2 A;  1C0U A;  1HYS A;  3EZ5 A;  1LWE A;  4DTR A;  1YTU A;  1IKY A;  3V81 A;  1SL2 A;  4IG3 A;  1IKW A;  2E6M A;  3S3O A;  4BE1 A;  1B92 A;  3L2Q A;  4DFM A;  1TAU A;  1TK5 A;  2D0B A;  3ITH A;  3NF6 A;  4FJG A;  4FJM A;  4GVM A;  2VG5 A;  3ZSQ A;  2EX3 A;  3NAE A;  4R5P A;  4CIG A;  1TK0 A;  2VG7 A;  2P1J A;  3MEG A;  4UQG A;  2A1S A;  3TAG A;  4JLH A;  1VSE A;  1BIU A;  1GOA A;  4DS5 A;  3HPH A;  1C6V A;  4LY7 A;  2ZD1 A;  4MFB A;  3LAN A;  4CFC A;  3QIN A;  3S9H A;  1TKD A;  2ZE2 A;  4DS4 A;  1RTD A;  2XY7 A;  2HHX A;  1TK8 A;  3C6U A;  5CY4 A;  3ZCM A;  3SJJ A;  1QHT A;  4M3U A;  4BAC A;  4Z4H A;  3CM5 A;  3SCX A;  3KD1 E;  1C1B A;  4AHS A;  5HRP A;  4FJL A;  2BDP A;  4O44 A;  3M8P A;  4N76 A;  4CIE A;  3QEW A;  1VSD A;  2KFZ A;  5HBM A;  4FLY A;  4E19 A;  3LWM A;  4O55 A;  3CM6 A;  3VQ8 A;  4YFU A;  3HXM A;  2KTQ A;  3HVT A;  3SPY A;  4NCG A;  4KKO A;  4Q5V A;  1BQN A;  4CJT A;  5FRN A;  4Y1D A;  4KI6 A;  5CYM A;  5I42 A;  3ZT3 A;  1D8Y A;  4HVJ A;  2PYL A;  5J1E A;  1QE1 A;  3PUF A;  3HO1 A;  4E0D A;  4DQQ A;  1QS4 A;  3P1G A;  4M3X A;  2P5O A;  4O5B A;  2RKI A;  3SQ1 A;  1WSI A;  3K5N A;  4GMJ B;  1JXE A;  3O3H A;  1T8E A;  4DG1 A;  4KRE A;  3TAP A;  2ETJ A;  3T3F A;  2BAN A;  4BWM A;  3RTV A;  3KLI A;  2D0A A;  3P83 D;  1I3A A;  3VQ6 A;  2YNF A;  2WON A;  3TAE A;  1QSS A;  3OYM A;  3ZSR A;  3SZ2 A;  1EXQ A;  3V1O A;  4B9S A;  5HRR A;  4AHV A;  2JGU A;  4CJR A;  1ZYQ A;  4DQS A;  4KHY A;  4PQU A;  2YNG A;  5CZ2 A;  1NK6 A;  3IAY A;  3OYF A;  4G1Q A;  4M3Z A;  1GOB A;  2E6L A;  1KFS A;  1S1V A;  4PA1 A;  1BI4 A;  3K5M A;  3L3V A;  4KHU A;  4FZZ A;  3I8D A;  2BGG A;  1WSJ A;  4RW8 A;  2D5R A;  3OVN A;  4K8X A;  3AVG A;  1NK0 A;  4HUF A;  3NGZ A;  3MEC A;  3H08 A;  4F2R A;  1VSF A;  3ZT0 A;  4CJF A;  1UWB A;  4B8A B;  2AJQ A;  3ZT1 A;  4OGC A;  3VQ7 A;  3L2V A;  4N5S A;  4N41 A;  2DFF A;  2XY5 A;  4KHS A;  1YT3 A;  3DRP A;  3P5J A;  4B9L A;  2DFE A;  3VQC A;  2Y1I A;  3OYE A;  2KQ2 A;  1RTJ A;  4ICL A;  1ASW A;  3V9X A;  1L3U A;  5C24 A;  1KFD A;  3NH2 A;  2G8U A;  3SQ4 A;  1J54 A;  2YV0 X;  1WAJ A;  4ZHR A;  4FK0 A;  4C8K A;  4QAG A;  3I0R A;  3DM2 A;  4CEC A;  5HLF A;  2OA8 A;  1RBS A;  3B6P A;  4O4G A;  3V1Q A;  4CJW A;  2FBT A;  2X74 A;  3AV9 A;  3RMA A;  4ZTF A;  1RT6 A;  1VRU A;  1WSH A;  3DI6 A;  1T05 A;  3DRS A;  1HYV A;  4JS4 A;  3BGR A;  3SV4 A;  1S1T A;  3AVA A;  3OYN A;  4CES A;  1JLC A;  1KRP A;  5HP1 A;  3NF9 A;  1QTM A;  3OYD A;  3AO1 A;  2X78 A;  1XI1 A;  1U47 A;  1SL1 A;  4RW9 A;  1HQU A;  2GBZ A;  1JXB A;  1JLQ A;  3SPZ A;  3LP0 A;  1RTH A;  4CGF A;  4W5O A;  2B5J A;  3OYC A;  4I2Q A;  2JLE A;  3I0S A;  2HHS A;  1RCH A;  4O0I A;  3AVC A;  3VQ9 A;  1ZBF A;  4AH9 A;  1CLQ A;  2RF2 A;  4DTP A;  3WNG A;  4CJV A;  1TKZ A;  3L2U A;  4FJH A;  4FJJ A;  5HRO A;  4IFV A;  4FJX A;  3ASM A;  4CFD A;  4E7J A;  4BDZ A;  3QER A;  3T1A A;  4M3W A;  3NE6 A;  4IBN A;  1LW2 A;  5SWM A;  3V1R A;  3KLF A;  4JS5 A;  4DTU A;  1VSI A;  4B9U A;  3OY9 A;  3LPT A;  3AVN A;  4FM1 A;  1BGX T;  4CJE A;  4FXD A;  4CHP A;  1LW0 A;  2P51 A;  4CER A;  3SQ0 A;  1ASU A;  3S3N A;  4KHQ A;  1BI4 B;  1S9E A;  3EYZ A;  3IS9 A;  3LAL A;  2DY4 A;  1RIL A;  5C25 A;  4EP5 A;  4FZX C;  4F8R A;  1SKR A;  1DTT A;  2G8K A;  5J2P A;  3D0P A;  4FLZ A;  4QCL A;  3NBP A;  1U48 A;  1LWC A;  4W5Q A;  5KTQ A;  1NKE A;  4M3Y A;  5J2Q A;  3ALY A;  3OYI A;  2OPP A;  1UAX A;  1WLJ A;  1D9D A;  4E1N A;  4PUO A;  1EP4 A;  2XO7 A;  3AVI A;  1SV5 A;  2ITG A;  4MQ3 A;  5KGW A;  3HJF A;  1IKV A;  4OKE A;  1K6Y A;  1N6Q A;  1RDD A;  4EP4 A;  4OPK A;  1T03 A;  1L3S A;  3KKR A;  3QIP A;  4J2A A;  5FDL A;  3AVB A;  4OGE A;  3SI6 A;  4FW2 A;  4JRP A;  1RDC A;  1NK9 A;  1NK4 A;  1LWF A;  3LAK A;  4CEZ A;  4W5R A;  3AVH A;  3KLE A;  3F73 A;  3VQB A;  3M8R A;  1D9F A;  3LDS A;  4O0J A;  4DTM A;  4E3S A;  2PZS A;  1NJY A;  4FJ9 A;  4CHN A;  3TAR A;  2OZM A;  3OYL A;  4RW6 A;  1Q8I A;  3ZSO A;  1QQC A;  1HQE A;  2G8F A;  3LP2 A;  4CHZ A;  1HYZ A;  2WOM A;  4DTN A;  3DOK A;  1RT2 A;  1WN7 A;  3O4Q A;  4M3T A;  1Z25 A;  1U45 A; 
#chains in the Genus database with same CATH topology
 3ID8 A;  2OPQ A;  4CK1 A;  2O8F A;  2CGJ A;  2QEX N;  3P31 A;  2P9S B;  4J8F A;  3QEP A;  1OKJ A;  3SUP A;  1VSH A;  3BZK A;  4E7H A;  1BHL A;  3AA5 X;  3NF7 A;  1HNI A;  1NM1 A;  2YKM A;  2VYP A;  4IZ9 A;  2PFU A;  3EE9 A;  1HNX K;  3KTQ A;  1HJR A;  1ZC6 A;  5BRE A;  1W7A A;  1TV6 A;  4W5T A;  5BRF A;  3CCS N;  4O8K A;  4B3R K;  3KKS A;  2LSN A;  2G8H A;  4I9L A;  1Q18 A;  3OA9 A;  4I9Q A;  4BDP A;  3H46 O;  2HOE A;  4AHU A;  3O8M A;  3H1Q A;  4CZF A;  3NHG A;  4FJ8 A;  2NRR A;  1BUP A;  4WYB A;  2HBK A;  2D0P A;  3U6F A;  1X1P A;  2D0C A;  3ISN C;  3KIO A;  2JWK A;  3AVL A;  4BC4 A;  4E7I A;  4DU1 A;  3QEX A;  1UOC A;  5C2D A;  3L2W A;  3AVM A;  3WNE A;  4C8M A;  3CJ7 A;  2HBL A;  4C23 A;  2VWK A;  4Z4E A;  3GOI A;  4FLX A;  1IBM K;  1NJW A;  4QOZ B;  1M1K O;  1NGJ A;  5AQJ A;  3HK2 A;  5LJV A;  3CFO A;  4F3O A;  3UE5 A;  4AHT A;  2XY8 A;  3RSE B;  4DSE A;  3DRR A;  3M8S A;  4JKF A;  3RMD A;  4CF9 A;  3JSM A;  4LSL A;  3LM9 A;  3U4L A;  3QB0 A;  2I5J A;  4ISF A;  3OS0 A;  3P38 A;  4CK2 A;  4OKK A;  3JYT A;  2CGK A;  4IG0 A;  4HHT A;  3A5M C;  3MEE A;  3K5L A;  4E7L A;  2X6N A;  1W97 L;  4CBW A;  4Y1C A;  3G6E N;  3TAB A;  2G8W A;  2HHW A;  3OJS A;  4CZK A;  4PY5 A;  4KO0 A;  3KJV A;  2HHQ A;  1UA1 A;  3P4I A;  4LC9 B;  1C0G A;  1KTQ A;  1ZBI A;  2E88 A;  5J2N A;  3RRG A;  4MLH A;  3J81 O;  4CW7 B;  2OYQ A;  1NOZ A;  5EY4 A;  3QEV A;  2YHB A;  4DFK A;  1BA1 A;  2G8V A;  2KFN A;  5AZJ B;  4GV3 A;  3FFK B;  1ESV A;  3QNN A;  3FZK A;  4EFH A;  3QLH A;  1NKB A;  3THV A;  4JHD A;  1KVB A;  4NB4 A;  3TPQ A;  1OH8 A;  3DLB A;  3S3M A;  2FXU A;  4B9T A;  3CJB A;  2IOC A;  4J2B A;  4CZH A;  3AO4 A;  3F9K A;  2E2P A;  4RG8 A;  3DYA A;  3DOL A;  2OAN A;  3OS1 A;  4B3T K;  1BIS A;  4RCH A;  4CZL A;  1RBT A;  3AY9 A;  1VSK A;  2XRI A;  4KTZ A;  4H5W A;  3AVK A;  3LP3 A;  5HL7 L;  4EIA A;  4R79 A;  2ZM6 K;  3RMB A;  4DV2 K;  4DQP A;  1KVC A;  1C1C A;  5JS1 A;  1NU0 A;  3B8A X;  1Y64 A;  4JV5 K;  3BEX A;  2QK9 A;  1HR0 K;  5M1Q A;  1YHQ N;  3W0L A;  1FKP A;  2HB5 A;  3ZT2 A;  2X6S A;  2V52 B;  4Z4C A;  3KLG A;  1LOT B;  2QXF A;  3D6R A;  2Y1J A;  3HSC A;  3T19 A;  3KWI A;  5F1X A;  4JKA A;  4CZM A;  1TUU A;  1C0F A;  1S72 N;  4DR4 K;  1QSL A;  4C8L A;  3ULD A;  4M45 A;  4IEE A;  2UUC K;  1Z6R A;  4IO9 L;  4GW6 A;  3VQA A;  4XIU A;  1JLE A;  1JLG A;  4M3R A;  1WSE A;  1NMN A;  5KI6 A;  4HUE A;  2NRV A;  4U7B A;  1ITG A;  4FLT A;  3RMC A;  1WBD A;  1L5U A;  2F7T A;  2EWS A;  2NNW A;  4C1N K;  2ZJQ L;  2E2N A;  1DKG D;  4B3S K;  1VQN N;  3VGM A;  3UB5 A;  3MWT A;  2W42 A;  1OH6 A;  3G10 A;  4KTW A;  3LPU A;  4FM2 A;  2XY6 A;  3PY8 A;  3QIO A;  1RBR A;  3HPO A;  3A5O C;  4CEE A;  4NXN K;  4FW1 A;  5CHI A;  2GUP A;  3O3F A;  3MXM A;  1RTI A;  3F5T A;  1FW6 A;  1NK7 A;  3RWU A;  3R3L A;  3TI0 A;  3OYG A;  5LY3 A;  3BDP A;  5M1P A;  2F8T A;  4YOX A;  4MO5 A;  1J5O A;  1EO1 A;  1VSJ A;  1Y97 A;  4DCH A;  2P9L B;  5J2M A;  1NLV A;  3C65 A;  4IFY A;  3FE1 A;  4PL8 A;  4CJL A;  1BCO A;  4KH5 A;  2ATQ A;  1GLL O;  3QO9 A;  5JS2 A;  2OCE A;  4BRN A;  1GLF O;  3S3O A;  1TK5 A;  2YJF A;  3NF6 A;  3ZLJ A;  3J80 O;  2EX3 A;  3C0B A;  4YY3 K;  4CIG A;  4R5P A;  1GOA A;  1Z05 A;  1QVG M;  3CJ1 A;  4NXM K;  1C6V A;  4LY7 A;  1RTD A;  1TK8 A;  3H1V X;  3SJJ A;  2F9T A;  4Z4H A;  3KD1 E;  4AHS A;  4YOV A;  3QDK A;  4CIE A;  3QEW A;  4IXC A;  5C0Y A;  3VQ8 A;  2KTQ A;  4H5N A;  1D8Y A;  4JYA K;  1VQ7 N;  4MO4 A;  4E0D A;  4DQQ A;  3P1G A;  2P5O A;  3I56 N;  2V51 B;  4A62 A;  2IIR A;  4H03 B;  1VHX A;  3KVG A;  3M3Z A;  3F9M A;  3CC7 N;  3TSQ A;  4ISG A;  4UY8 O;  3E9P A;  5EVZ A;  2WON A;  1QSS A;  2YJE A;  2WC9 A;  4KHY A;  5CZ2 A;  4M3Z A;  2P9N A;  2P9K B;  4JI1 K;  4V19 S;  3FZL A;  4PA1 A;  1BI4 A;  4KHU A;  3LDP A;  1WSJ A;  4BR5 A;  3CPE A;  4DUZ K;  3O80 A;  4DV4 K;  3AVG A;  3VF6 A;  3PSI A;  5JVH L;  4K43 A;  1YJ9 N;  3H08 A;  5AQV A;  1E4G T;  3ZT0 A;  4CJF A;  2CGL A;  3MN9 A;  4B8A B;  2AJQ A;  3ZT1 A;  3VQ7 A;  2A41 A;  3P5J A;  1ASW A;  2ZF5 O;  3NH2 A;  2G8U A;  3SQ4 A;  3NVM A;  3O9S A;  1S22 A;  5KQD A;  5EX5 A;  2PBD A;  3DM2 A;  2Q0R A;  4LF8 K;  3V1Q A;  1E3M A;  3O9U A;  2X74 A;  4CD3 A;  1RT6 A;  1WSH A;  1XMQ K;  1T05 A;  3ZEU A;  1NGI A;  4JS4 A;  3K9J A;  3OYN A;  1JLC A;  1KRP A;  1WOQ A;  3AO1 A;  1XI1 A;  4BRP A;  1YUW A;  3LDO A;  1JLQ A;  3SPZ A;  4W5O A;  3C7N A;  2HHS A;  1W2B M;  1CLQ A;  3WNG A;  4FJH A;  4FJJ A;  1VQK N;  4IFV A;  4E7J A;  4BDZ A;  3QER A;  1NGF A;  4IBN A;  1LW2 A;  3KLF A;  4B9U A;  3LPT A;  3AVN A;  4CHP A;  1LW0 A;  3SQ0 A;  5GAH P;  4KHQ A;  2KLA A;  1RIL A;  1V4T A;  3VF2 A;  4E1J A;  1SKR A;  2G8K A;  2UYT A;  1U48 A;  4M3Y A;  4AM6 A;  3MMV A;  2UUB K;  2HF4 A;  3OYI A;  2OPP A;  1T6D A;  1D9D A;  4PUO A;  2VGN A;  1SV5 A;  3JS6 A;  5KGW A;  3CIP A;  2WFB A;  1IKV A;  1T03 A;  4JD2 B;  3E1Y A;  1SS6 A;  1NK9 A;  1LWF A;  3LAK A;  5AQF A;  3KLE A;  3OHR A;  3LDS A;  4FPB A;  4FJ9 A;  4CHN A;  3OYL A;  1N36 K;  4CHZ A;  3GBT A;  1KAX A;  3VEN A;  1U45 A;  2O8E B;  4DSK A;  3AA4 A;  3DLR A;  4YNQ A;  1GLB G;  1NGD A;  1NGH A;  4IKF A;  3NH0 A;  3AO3 A;  2FBY A;  1A5W A;  3NFA A;  1QZ5 A;  4AHR A;  1BG3 A;  4M7Y A;  4JI3 K;  3VA3 A;  4FJ7 A;  1OVY A;  3HI0 A;  4CGI A;  5GIN A;  3SAG A;  1ZBL A;  1NGC A;  3DMJ A;  5K14 A;  3MXJ A;  3SBT A;  3CG7 A;  2BE2 A;  1SL0 A;  4A5B A;  3VQ5 A;  4DF8 A;  5EU7 A;  4LF7 K;  3DXK A;  4FWL A;  3VEV A;  1I39 A;  1OH7 A;  1X3N A;  4XH1 A;  3V9S A;  4CHO A;  3LL3 A;  5BR8 K;  1NNE A;  4FJI A;  1GOC A;  3KLH A;  2UU9 K;  3A0I X;  2PY5 A;  3HVR A;  2E8A A;  1LV5 A;  4JI6 K;  4DTJ A;  3U9D A;  3GL1 A;  3NDK A;  4DV3 K;  4NCA A;  4C1N I;  3E01 A;  5C12 A;  4LSN A;  4QS9 A;  5JLF A;  3PX0 A;  1MWM A;  3KD5 E;  1BIZ A;  2YHW A;  1RBV A;  1G99 A;  2Z1I A;  4JKE A;  4CZG A;  3HPG A;  3ZSX A;  4CJ5 A;  2O8F B;  4FPA A;  3CJA A;  2FSJ A;  2YI1 A;  4F4K A;  4J2E A;  3EO3 A;  4PKH A;  3ZT4 A;  3O5B A;  4H0O A;  1A5X A;  3WNH A;  4WE1 A;  2Q2R A;  3QEI A;  3VET A;  5KRS A;  3AO2 A;  3VQD A;  4CJQ A;  1B9D A;  2DFH A;  1ZXO A;  4KRF A;  4DWI A;  3TSP A;  3NGY A;  3NCI A;  3SAF A;  1UA0 A;  2R7Y A;  3OJU A;  1VSL A;  4X65 K;  3VF4 A;  3WXK A;  5M1O A;  2FSK A;  1S1U A;  1L3T A;  1JLF A;  3C6T A;  3TAF A;  1CZA N;  1JJ2 M;  1NJI O;  4KPY A;  4PHT X;  2O8C A;  1DGK N;  3VQ4 A;  3FLC O;  4EZ9 A;  3Q7C A;  4CEA A;  5DM6 L;  3TAN A;  1FXX A;  1U2V A;  4MDA A;  4J2D A;  4W5N A;  4DLE A;  1NJZ A;  1NBW A;  4I2P A;  5AQS A;  1N8R O;  3HYF A;  3AGK A;  2KKZ A;  5I3U A;  3RR8 A;  4OLA A;  4DTS A;  2ITM A;  4DR2 K;  4FWR A;  4KH4 A;  4RW4 A;  3VN5 A;  2KZZ A;  4NYN A;  1JLA A;  3IFR A;  3O9Q A;  3NH1 A;  1J5E K;  5FPD A;  3IKM A;  2RPI A;  4FWM A;  3IDH A;  3TWH A;  2E4L A;  1RDB A;  2B6A A;  3VA0 A;  1TYQ A;  4ELV A;  4FJN A;  4KHN A;  1VK0 A;  4MLE A;  1YF5 L;  2HMP A;  4IO8 A;  4KFB A;  4BRH A;  3PX6 A;  3AVJ A;  5BN8 A;  3G4S N;  5LL6 Z;  3VPZ A;  4FLW A;  4KHP K;  4CCH A;  1IG9 A;  1RFQ A;  2E2Q A;  2D1K A;  1Z26 A;  3CYM A;  2HND A;  5TKW A;  4DSF A;  3V6D A;  3SUO A;  3I55 N;  1S3X A;  3CPW M;  1NGG A;  1SQK A;  3PO4 A;  3EKU A;  3QES A;  4LF4 K;  3T69 A;  3ZX2 A;  3ZSW A;  4B3M K;  1U6Z A;  3CCQ N;  1IBK K;  4B1U B;  3SLC A;  4BRM A;  5KQ8 A;  1ZBH A;  3MN7 A;  2ASP A;  4FVU A;  1TAQ A;  1DTQ A;  1ATS A;  2HMI A;  2HVI A;  3EE8 A;  4IWV A;  4ID1 A;  3M5R A;  1GLC G;  1L3V A;  2W6K A;  5GIO A;  2OTL N;  4WFB L;  3PIO L;  3NF8 A;  2BH1 A;  1C0M A;  4DFJ A;  3PLA A;  4IDK A;  2KHO A;  4JHD B;  4A2A A;  1TKX A;  2RE2 A;  3CQ8 A;  4BR2 A;  3VEO A;  4KAZ A;  3LP1 A;  4DTX A;  1JL2 A;  1GLJ O;  2HBJ A;  4NLC A;  3C6H A;  1JCE A;  2QTD A;  1HPM A;  1XNQ K;  3HM9 A;  2YHA A;  5F0X A;  5LMN K;  4HTU A;  3A2F A;  4KV8 A;  5CYQ A;  2QW9 A;  4BY9 C;  4OKJ A;  3AA2 A;  4B9N A;  4CI6 A;  4DHY A;  4TSX A;  3HP6 A;  4Q0B A;  4H0V B;  1SAZ A;  3MAQ A;  4H4M A;  1IG8 A;  4DSL A;  4Z0U A;  2I7N A;  1HMV A;  3E9L A;  1BU6 O;  2F9W A;  3G0Z A;  4Z4G A;  4BDY A;  2O4I A;  1BO5 O;  2VCP A;  1EX4 A;  1D5A A;  1O1W A;  1YXQ A;  3A8Y A;  1NOY A;  3N4Q A;  4X62 K;  2O4G A;  3CCU N;  2ZGZ A;  3J7Y P;  1G15 A;  3VES A;  4DMN A;  2HST A;  1REV A;  1YTU A;  1MA9 B;  4IG3 A;  5JLH A;  2A5X A;  1N33 K;  4K0K K;  1B92 A;  2D0B A;  3ITH A;  4FJM A;  4GKK K;  3ZSQ A;  1HKC A;  2VG5 A;  3UKU A;  1TK0 A;  2VG7 A;  5ADX A;  2A1S A;  4JLH A;  1BIU A;  2FLO A;  2GTD A;  2ZD1 A;  3LAN A;  3S9H A;  1TKD A;  4AM7 A;  3TU5 A;  4DS4 A;  2XY7 A;  4BG8 A;  2HHX A;  5CY4 A;  3ZCM A;  3ZET B;  3OTO K;  5C10 A;  3CM5 A;  4FJL A;  4LF6 K;  2BDP A;  4GVE A;  3W3D A;  2CH5 A;  3CXC M;  5GAG P;  3CM6 A;  3O08 A;  4FWQ A;  4YHH K;  4CJT A;  1MWK A;  4Y1D A;  1XMO K;  2PYL A;  3BZC A;  4A59 A;  5J1E A;  3PUF A;  5AQM A;  4FOE A;  3HO1 A;  5FPN A;  1GLD G;  1QS4 A;  3CCV N;  4O5B A;  3SQ1 A;  4O8U A;  4PKI A;  3RVC A;  1N32 K;  4OPH A;  3LDN A;  3ULE A;  2ETJ A;  4EAH D;  2BAN A;  3RTV A;  2VQF K;  3VQ6 A;  5MLC Q;  3T1H K;  1VQM N;  1VQ8 N;  2YNF A;  3VMF B;  4WQ4 C;  4FOI A;  4H0Y B;  4K41 A;  3V1O A;  5HRR A;  4AHV A;  3CC2 N;  2YNG A;  1NK6 A;  3IAY A;  3OYF A;  4G9Z A;  2H3G X;  2A40 A;  5AQG A;  5DM7 L;  1YJN N;  4HWI A;  3DLL L;  4FSV A;  4HUF A;  5AQI A;  3NGZ A;  5AQZ A;  4F2R A;  4WQ5 A;  4OGC A;  4N41 A;  4IJA A;  3O9R A;  3VQC A;  4BVO A;  3ZET A;  1XUP O;  1KFD A;  1T3V A;  2YV0 X;  5AQW A;  4ZHR A;  3TTC A;  3I0R A;  4IJN A;  3GDQ A;  4CJW A;  3AV9 A;  4ZTF A;  1VRU A;  1X3M A;  3DI6 A;  5CR4 A;  3R9P A;  5FPE A;  1KD1 O;  5AR0 A;  4DV7 K;  3BGR A;  3SV4 A;  3ID6 A;  4BRL A;  2NRZ A;  4CES A;  3NF9 A;  2J4R A;  3TSU A;  1U47 A;  2GBZ A;  1JXB A;  5BN9 A;  3OW2 M;  2NRX A;  2B5J A;  4A61 A;  5AQR A;  3AVC A;  3VQ9 A;  1ZBF A;  2RF2 A;  3WQT A;  3AAP A;  3ZX3 A;  3L2U A;  2ASM A;  2D0O A;  4GKJ K;  4YOY A;  3AAQ A;  2UXD K;  4XH5 A;  4CFD A;  3T1A A;  4M3W A;  3NE6 A;  4KH6 A;  4DTU A;  2NZT A;  3U9Z A;  5GAE P;  3OY9 A;  1NGE A;  4FM1 A;  2P9N B;  4CJE A;  4B9Q A;  3S3N A;  1BI4 B;  3IS9 A;  2FF3 B;  1NMD A;  2DY4 A;  2FF6 A;  4EP5 A;  3CMA N;  3D0P A;  3NBP A;  5M1F A;  3K0S A;  4YOT A;  4GV9 A;  1WLJ A;  4YOU A;  1EP4 A;  3AVI A;  2PAV A;  4MQ3 A;  4BR4 A;  1K6Y A;  5IWA K;  4J2A A;  3QIP A;  5FDL A;  4OGE A;  3SI6 A;  4BRG A;  4W5R A;  1O13 A;  2VWB A;  5M1K A;  3BF1 A;  4DTM A;  3WXL A;  4E3S A;  2OZM A;  4DV5 K;  4RW6 A;  3ZSO A;  3ZEU B;  2G8F A;  1XNR K;  3A5L C;  4K42 A;  3SNN A;  3ZSZ A;  1VSM A;  4B08 A;  1OVQ A;  1WSG A;  3C7N B;  3MDQ A;  3EY1 A;  4DQR A;  2D4W A;  3OYA A;  4H5R A;  4HUG A;  2YHX A;  2QWN A;  3SUN A;  2KW4 A;  4CF1 A;  2BUP A;  3CQY A;  4CF8 A;  1RNH A;  4I6M A;  5FRM A;  1RT1 A;  1BQM A;  4DU4 A;  1S5J A;  1X9M A;  3VQP A;  1KSP A;  3UIQ A;  2QWL A;  5AJ3 K;  3PX4 A;  1QZ6 A;  4FL9 A;  3V9W A;  4DUY K;  3OYK A;  1FKO A;  4FWS A;  3LDQ A;  2P9U A;  1VQP N;  1JKH A;  4L8R B;  4RW7 A;  2IVN A;  3HZ6 A;  4CBX A;  3V4I A;  3IUC A;  2A1R A;  1KLM A;  3SMS A;  4BRO A;  4LFB K;  3WNF A;  2XHB A;  4DF4 A;  1RT3 A;  3D45 A;  5C42 A;  1J9A A;  3K9K A;  4OPJ A;  3SQ2 A;  2QXL A;  1C1A A;  3JAM O;  2AA4 A;  3VEZ A;  1WSF A;  3R6M A;  3MN6 A;  1J53 A;  1LAW A;  3C94 A;  4B9V A;  1CZB A;  3SYZ A;  4C8O A;  3CCR N;  1XHX A;  1RT7 A;  3MX2 A;  4CEO A;  2CH6 A;  3HRG A;  3IG1 A;  1DLO A;  3LAM A;  2IS3 A;  1RT5 A;  2QWM A;  5AQT A;  4BE2 A;  1JL1 A;  3HTV A;  1RDA A;  2GWK A;  3QET A;  4O5F A;  1HKB A;  4DKW A;  2O8D A;  3THX A;  1P8Z A;  1R0A A;  2OPS A;  4B1V A;  3BY5 A;  4BC5 A;  4ILG B;  3E66 A;  4B1W B;  4M63 C;  2NUB A;  4K25 A;  1IJJ A;  1W0H A;  1JCF A;  3RR7 A;  2YNI A;  3K59 A;  3PV8 A;  5BRH A;  2Z1G A;  3HBT A;  3DXK B;  4NYF A;  1M90 O;  2PYJ A;  3AGR A;  4IDH A;  4N47 A;  3ZSY A;  3HM8 A;  2QI2 A;  1LAV A;  2FSN A;  2QKB A;  4BG9 A;  3L2R A;  5KPZ A;  2WBN A;  3ENO A;  4A5A A;  2DPN A;  1VQL N;  4DV0 K;  1X9S A;  1NWK A;  1YTA A;  1YVU A;  3L8B A;  4JK8 A;  2RN2 A;  4BE0 A;  4WFA L;  1KLN A;  4CEF A;  3CJ9 A;  2YX6 A;  1QQO A;  2DTU A;  4E1M A;  4IFE A;  4A57 A;  3CFR A;  1SZ2 A;  4H5T A;  1X9W A;  4WQ4 A;  4EZ6 A;  1HJO A;  4DTO A;  2FBX A;  3HL8 A;  3Q7B A;  4FVM A;  4FLU A;  3U3Y A;  3J7A P;  4H4O A;  5AQK A;  1VRT A;  3H3O B;  4AQY K;  4BC3 A;  3FFI A;  4H8K A;  3O1W A;  4XH4 A;  1YIT N;  4EHU A;  5AQH A;  5TKY A;  3IRX A;  2OZS A;  1SKS A;  5CZ1 A;  2IGI A;  4CIF A;  2P9P A;  3L3U A;  3FR0 A;  5FRO A;  4CGH A;  4HCC A;  3VOV A;  1HNV A;  2HVH A;  4B8C A;  4CHY A;  2O8B B;  3OYH A;  1KAY A;  4DV6 K;  4KB1 A;  3VGK A;  2O8C B;  1K9M O;  2ZQB A;  3M1F A;  3V9Z A;  1VQ6 N;  1SUQ A;  1U2V B;  4X66 K;  2HHV A;  2QWQ A;  1EWQ A;  4AHC A;  4DSJ A;  4B3O A;  4N56 A;  3V9U A;  2IAJ A;  4FWP A;  3O1B A;  4WQ5 C;  1MDU B;  1RBU A;  1U49 A;  4BRC A;  3HT3 A;  4CJP A;  4DR7 K;  1WAF A;  3HOS A;  2IDO A;  4CVN E;  3THW B;  4CF0 A;  2Z1J A;  2Z1H A;  4KI4 A;  1KAZ A;  3OYB A;  3K57 A;  1U04 A;  4HTL A;  4CGD A;  5FPM A;  3D2F B;  4DV1 K;  3DLH A;  2UXB K;  2GUI A;  3O4N A;  3K5O A;  4F3T A;  1TYQ B;  2F96 A;  4CK3 A;  3QNO A;  4BRD A;  3OBW A;  4NCB A;  1TVR A;  2EHG A;  2P5G A;  4GY2 B;  4DSI A;  3DAW A;  2OPR A;  1RT4 A;  3WXM B;  1WB9 A;  2HBM A;  1WUA A;  4LH5 A;  1TL1 A;  3F2K A;  4OLB A;  4CE9 A;  5KGX A;  1N5Y A;  2HHU A;  1ASV A;  2VGM A;  3M8Q A;  1GLA G;  2QM1 A;  4CJK A;  4CJ4 A;  1QSY A;  1T7P A;  1TL3 A;  1HRH A;  4CD1 A;  5KPR A;  3DLK A;  3AA3 A;  4L3Q A;  3C95 A;  3CF5 L;  5JIC A;  3VQE A;  3SV3 A;  5DK5 A;  1K73 O;  3WQU A;  2O8B A;  1ZBS A;  2KZM A;  4DTR A;  3D2E A;  3V81 A;  1SL2 A;  4GNI A;  1IKW A;  4BE1 A;  3EEQ A;  4DFM A;  1TAU A;  1T6C A;  4GVM A;  3NAE A;  2P1J A;  3MEG A;  3QBX A;  4UQG A;  3TAG A;  2QWO A;  4DS5 A;  4YDU A;  3HPH A;  4MFB A;  4CFC A;  4OX9 K;  3THW A;  3C6U A;  1VQ5 N;  4M3U A;  5HRP A;  3O6W A;  1HX1 A;  3M8P A;  4N76 A;  3D2F A;  1VSD A;  2YCH A;  5HBM A;  1HNW K;  3VEW A;  4FLY A;  4O55 A;  5AQP A;  2E5L K;  3HVT A;  3SPY A;  4NCG A;  1YJW N;  1BQN A;  3GE1 A;  5FRN A;  3O9T A;  4KI6 A;  5CYM A;  5I42 A;  1QHA A;  3ZT3 A;  2NRT A;  4HVJ A;  1QE1 A;  2W6L A;  1HKG A;  2NRH A;  3A5N C;  4JI8 K;  1T44 A;  3TTD A;  1WSI A;  4GMJ B;  3UKR A;  1JXE A;  5LJW A;  4DG1 A;  3MN5 A;  4KRE A;  4A2B A;  3QBW A;  3C6A A;  3T3F A;  2D0A A;  3P83 D;  3SAH A;  5LMU K;  1I3A A;  3CC4 N;  3THY A;  3TAE A;  3J8A A;  3SZ2 A;  5EXW A;  3WEE A;  4B9S A;  2JGU A;  3FZH A;  3BUZ B;  4G1Q A;  1HLU A;  2IVO A;  2W40 A;  4FZZ A;  2BGG A;  4WCE L;  4RW8 A;  2W41 A;  3OVN A;  3U8X A;  2NLX A;  3R1X A;  3MEC A;  1BWF O;  3UKU B;  3BF3 A;  3L2V A;  4N5S A;  2DFF A;  3DRP A;  2A42 A;  4CJ7 A;  1LCU A;  2KQ2 A;  1RTJ A;  4ICL A;  4BQL A;  3OYE A;  3V9X A;  1L3U A;  5C24 A;  1WAJ A;  4FK0 A;  4C8K A;  3PSF A;  1BOT O;  4CEC A;  5HLF A;  3QIC A;  4IOA L;  4PL7 A;  3RMA A;  2NRW A;  4DR3 K;  3DRS A;  4JKD A;  5HP1 A;  1K8K A;  3OYD A;  2X78 A;  1SL1 A;  4RW9 A;  3DJC A;  3LP0 A;  3CCE N;  2P9S A;  3OYC A;  4I2Q A;  2JLE A;  3I0S A;  3VEY A;  1RCH A;  4O0I A;  5AZI B;  3J7Z O;  3ULE B;  1EQY A;  4CJV A;  1VQ9 N;  5HRO A;  4JKB A;  2HF3 A;  4LF9 K;  4U67 L;  2QA4 N;  4JS5 A;  4QS8 A;  3CET A;  3I8B A;  4FXD A;  4JNE A;  4CER A;  5AQY A;  2RHK A;  4JK7 A;  3EYZ A;  3LAL A;  5C25 A;  4FZX C;  4F8R A;  2VQE K;  4H0X B;  4W5Q A;  1NKE A;  5J2Q A;  5AQX A;  3CJC A;  2XO7 A;  2ITG A;  5ADX H;  2OTJ N;  4OKE A;  1N6Q A;  1RDD A;  4EP4 A;  4OPK A;  3T7Z A;  3KKR A;  5AQQ A;  3AVB A;  2YHY A;  4FW2 A;  1RDC A;  4OPA A;  1HUX A;  4CEZ A;  3AVH A;  1D9F A;  4JI5 K;  5KPT A;  1Q8I A;  3SK3 A;  1QQC A;  1HQE A;  4BRQ A;  3LP2 A;  4FWO A;  4BRE A;  1HYZ A;  2WOM A;  4NLB A;  3DOK A;  1WN7 A;  4M3T A;  2A6A A;  3RSE A;  1Z25 A;  4PWD A;  3VEX A;  1NK4 A;  4DU3 A;  4BWJ A;  2Q0U A;  4DLG A;  4LFC K;  4KHW A;  1EWR A;  1Q82 O;  4WFN L;  5AZI A;  2GV9 A;  3RRH A;  2IVP A;  3SUQ A;  4KTQ A;  2IC3 A;  4QS7 A;  1S9G A;  1BDG A;  1JLB A;  3NGI A;  3VQQ A;  1BA0 A;  1QQN A;  4DQI A;  2G8I A;  3CHW A;  3B6O A;  3LZI A;  1CXQ A;  4ILH A;  4H0T B;  3WT0 A;  2YNH A;  4KB0 A;  5M1N A;  3K2P A;  1C0T A;  3HOT A;  4HCB A;  3L6Q A;  4ILJ A;  4FZY A;  3CER A;  2VWJ A;  2GEM A;  3LWL A;  1S1X A;  4LFA K;  4OJR A;  4JEP A;  4RWT A;  4H5V A;  4M7X A;  1XC3 A;  4DR6 K;  4MDB A;  1KVA A;  3PO5 A;  4JI7 K;  4FJK A;  1TUY A;  4RTF D;  2HNZ A;  5DMR A;  5AZJ A;  2ZJP L;  3MED A;  5IT9 O;  4C8N A;  2A3Z A;  1NJX A;  3TR8 A;  4Z4F A;  3CCL N;  1XQS C;  2FC0 A;  3G71 N;  3N4P A;  5D3G A;  4YOW A;  4FCY A;  4H0P A;  1B9F A;  3H3N O;  1WNS A;  4CEB A;  2F4V K;  4BGA A;  3R8E A;  1YI2 N;  4WF9 L;  1HPZ A;  3KK1 A;  2Q1N A;  1TGO A;  1CXU A;  2Q31 A;  2P9I B;  3HP9 A;  1FK9 A;  1ZBU A;  5AFU A;  5HRS A;  3IMX A;  1E4F T;  4FJ5 A;  4CBU A;  4ID5 A;  3E9O A;  3FZM A;  5C15 A;  5AFU H;  1RDU A;  1IO2 A;  3EZW A;  1XHZ A;  1YAG A;  1TKT A;  3L0Q A;  4I6M B;  2HHT A;  1Q7Y O;  2E1Y A;  4LH4 A;  2GX9 A;  2FBV A;  4FYD A;  1V4S A;  3H6E A;  4CGJ A;  1D4X A;  2VG6 A;  3OYJ A;  3T1Y K;  2HNY A;  4CEQ A;  5BPL A;  3LZJ A;  4LF5 K;  2P9U B;  4OVL A;  4M41 A;  1QVF M;  5C2F A;  3TAQ A;  1CZ9 A;  5E84 A;  3U3G A;  4CGG A;  4AIL C;  2HW3 A;  1IKX A;  1ILY A;  1BCM A;  3GG4 A;  1VQ4 N;  3CI5 A;  4Y0W A;  4PKG A;  5B8H A;  1R59 O;  1OH5 A;  3HST B;  3CFP A;  3S41 A;  4GV6 A;  4JI2 K;  4YDU C;  1Q81 O;  4LD0 A;  2HHH K;  4JKG B;  4DR1 K;  3VTI A;  4K8Z A;  1NK8 A;  1NKC A;  2P9I A;  5FLX O;  2WUS A;  5E41 A;  1KC8 O;  4M42 A;  2GEL A;  5EOY A;  5SZT A;  4CJS A;  1YIJ N;  2WTU A;  4B9M A;  3MXI A;  1EET A;  1S1W A;  4BVP A;  4ELT A;  4BRF A;  2Q36 A;  1W9H A;  1H1V A;  1SKW A;  1DT9 A;  2O8D B;  1EKE A;  1QQM A;  3MX5 A;  3THX B;  5HRN A;  5GAD P;  4DB3 A;  4E89 A;  4CJ3 A;  5AQL A;  3ZSV A;  2Q3S A;  3LM2 A;  2B4J A;  2F8S A;  1F21 A;  3DLG A;  4BGB A;  3HJF A;  4FK4 A;  4FM0 A;  5AQO A;  1J6Z A;  3EL2 A;  4BRK A;  2P9L A;  4ELU A;  1A5V A;  3VTH A;  2E20 A;  5T7B A;  3OS2 A;  3ATV A;  2GWJ A;  1NGB A;  1KCF A;  5BPN A;  3ZX0 A;  5JVG L;  4JK9 A;  4CF2 A;  3TAM A;  3FGU A;  4PQU A;  5AQU A;  5BRD A;  5ELZ A;  4ZTJ A;  4FK2 A;  1S6P A;  1XC9 A;  4E7K A;  3AVF A;  4FLV A;  4JKG A;  3CCM N;  3CCJ N;  1Q9Y A;  3AO5 A;  4DFP A;  3TTF A;  3L4I A;  3MWP A;  1XWL A;  4CHQ A;  4I7F A;  2BTF A;  1N34 K;  4CFB A;  3K58 A;  1NK5 A;  1GLE G;  4JKH A;  1S6Q A;  4CJU A;  1KQS M;  2QKK A;  1WBB A;  2YKN A;  5CE3 A;  4CED A;  2AP1 A;  4F2S A;  3O3G A;  4JRQ A;  4EHT A;  5H1S Q;  3VER A;  1VQO N;  3KK2 A;  3DLE A;  3SJH A;  5KRT A;  5F2R A;  1KXP A;  4BR7 A;  1U4B A;  4CFA A;  1IH7 A;  3EN9 A;  4KBO A;  3CD6 N;  2P9P B;  1BL3 A;  4CZE A;  1Q9X A;  1MU2 A;  4BR0 A;  3QFU A;  3KK3 A;  3ENB A;  3M6G A;  2P9K A;  1C0U A;  4FWK A;  4B1Y B;  3EZ5 A;  1LWE A;  1HYS A;  1IKY A;  4IOX A;  3I33 A;  3NVK A;  2E2O A;  2E6M A;  3L2Q A;  2UUA K;  4FJG A;  2UXC K;  3MK6 A;  1X9J A;  4NO7 A;  4JI4 K;  3DXM B;  1VSE A;  1IBL K;  4BC2 A;  5HOO A;  3QIN A;  4AF1 A;  1I94 K;  2ZE2 A;  3SMP A;  1HNZ K;  1QHT A;  4BAC A;  3ZYY X;  3SCX A;  1C1B A;  4O44 A;  2KFZ A;  4E19 A;  3LWM A;  1NGA A;  4YFU A;  3HXM A;  4KKO A;  4Q5V A;  4CZJ A;  3KZB A;  4IEI A;  2I7P A;  1YVN A;  3G25 A;  4Z94 A;  4M3X A;  4FO0 A;  4ISE A;  3LDL A;  2RKI A;  3K5N A;  1ATR A;  3O3H A;  1T8E A;  3TAP A;  4BWM A;  2QWR A;  3KLI A;  3AAR A;  4BR9 A;  3OYM A;  2E1Z A;  3ZSR A;  1EXQ A;  1JCG A;  4CJR A;  1ZYQ A;  4DQ8 A;  4DQS A;  1Q86 O;  3BP8 A;  3O4W A;  3WXJ A;  4IOC L;  1GOB A;  2E6L A;  1KFS A;  1S1V A;  3K5M A;  3D2E B;  3L3V A;  3ATU A;  3NMU A;  3I8D A;  2D5R A;  4K8X A;  1NK0 A;  1RGI A;  3MCA B;  2ZWH A;  3DXM A;  1VSF A;  4FWN A;  1UWB A;  3PIP L;  5AQN A;  2XY5 A;  3SBG A;  4KHS A;  1YT3 A;  2ZGY A;  4B9L A;  2DFE A;  2Y1I A;  4JD2 A;  3FZF A;  3QFP A;  5BR9 A;  5I9E B;  1J54 A;  4QAG A;  5JMV A;  3WUH A;  1RBS A;  2OA8 A;  3B6P A;  4O4G A;  5E26 A;  2FBT A;  3H45 C;  2ASO A;  1HYV A;  1S1T A;  3AVA A;  1QTM A;  1ATN A;  5BPM A;  1HQU A;  2O8E A;  2V7Z A;  4CGF A;  1RTH A;  1P90 A;  4OO1 J;  5A2Q O;  1VAZ A;  4JKC A;  3UKR B;  3KHY A;  4AH9 A;  3WXI A;  3CQX A;  4DTP A;  1TKZ A;  3D7E O;  4BQZ A;  4BRI A;  3THY B;  3CME N;  4FJX A;  3ASM A;  2ZJR L;  1IV0 A;  3KK7 A;  3WEE B;  5SWM A;  3V1R A;  1VSI A;  4JI0 K;  1BGX T;  2P51 A;  2V7Y A;  3DWL A;  3EKS A;  1ASU A;  3MCP A;  3P39 A;  4YOR A;  1S9E A;  4B1X B;  4XEI A;  3OBY A;  1DEJ A;  4B1Z A;  4JN4 A;  1DTT A;  5J2P A;  4FLZ A;  4QCL A;  5GIP A;  3QML A;  1K8A O;  1LWC A;  3VGL A;  5KTQ A;  3ALY A;  1UAX A;  4E1N A;  2QWP A;  1RDW X;  3L4Q A;  4CZI A;  1NG9 A;  4Z4I A;  4BRA A;  1L3S A;  3ENH A;  2JWL A;  4JRP A;  1FJG K;  3F73 A;  3VQB A;  3M8R A;  4F9O A;  4O0J A;  2PZS A;  4DR5 K;  1NJY A;  4JAX A;  3TAR A;  3JXU A;  4DTN A;  3KWG A;  1RT2 A;  3O4Q A;  1K8K B;  2Q97 A;  4X64 K; 
#chains in the Genus database with same CATH homology
 4DU3 A;  4BWJ A;  4DLG A;  3ZSZ A;  3SNN A;  1VSM A;  4KHW A;  2OPQ A;  4B08 A;  4CK1 A;  3AA4 A;  4DSK A;  1WSG A;  3DLR A;  3QEP A;  2GV9 A;  3EY1 A;  4DQR A;  3RRH A;  4YNQ A;  3OYA A;  3SUP A;  3SUQ A;  4KTQ A;  2IC3 A;  1S9G A;  4HUG A;  4IKF A;  1JLB A;  3NGI A;  3VQQ A;  3NH0 A;  3AO3 A;  2FBY A;  1A5W A;  3NFA A;  1VSH A;  4AHR A;  4DQI A;  3SUN A;  2KW4 A;  2G8I A;  4CF1 A;  3VA3 A;  4FJ7 A;  4E7H A;  1BHL A;  3AA5 X;  3NF7 A;  1HNI A;  3B6O A;  1CXQ A;  4CF8 A;  4CGI A;  3LZI A;  2YKM A;  1ZBL A;  3DMJ A;  5K14 A;  3KTQ A;  3MXJ A;  1RNH A;  1HJR A;  5FRM A;  1RT1 A;  1BQM A;  1TV6 A;  4W5T A;  2YNH A;  4DU4 A;  4KB0 A;  3K2P A;  1S5J A;  1X9M A;  3VQP A;  1C0T A;  3CG7 A;  3KKS A;  1KSP A;  3UIQ A;  2LSN A;  2BE2 A;  4HCB A;  2G8H A;  4I9L A;  4I9Q A;  4BDP A;  1SL0 A;  4AHU A;  3VQ5 A;  3PX4 A;  4DF8 A;  5EU7 A;  4PWD A;  4FZY A;  3NHG A;  4FJ8 A;  2VWJ A;  3V9W A;  1I39 A;  1S1X A;  3OYK A;  3LWL A;  1FKO A;  1JKH A;  4OJR A;  4L8R B;  4RW7 A;  3U6F A;  1X1P A;  3V9S A;  2D0C A;  3ISN C;  4CHO A;  3KIO A;  3V4I A;  4FJI A;  1GOC A;  1KVA A;  3AVL A;  3KLH A;  2A1R A;  4E7I A;  3PO5 A;  2PY5 A;  2HNZ A;  4FJK A;  1KLM A;  5DMR A;  3HVR A;  4DU1 A;  1LV5 A;  3MED A;  3QEX A;  1UOC A;  3WNF A;  2XHB A;  4DTJ A;  4C8N A;  3L2W A;  3AVM A;  3WNE A;  4DF4 A;  4C8M A;  1RT3 A;  3D45 A;  5C42 A;  1J9A A;  3NDK A;  3TR8 A;  1NJX A;  4OPJ A;  3SQ2 A;  2VWK A;  4NCA A;  1C1A A;  3E01 A;  4Z4F A;  2FC0 A;  4Z4E A;  1WSF A;  4LSN A;  5D3G A;  4FLX A;  4QOZ B;  1NJW A;  4FCY A;  1J53 A;  1B9F A;  1LAW A;  3C94 A;  4B9V A;  1CZB A;  3SYZ A;  1WNS A;  3CFO A;  4C8O A;  1XHX A;  3PX0 A;  4CEB A;  3KD5 E;  1BIZ A;  1RT7 A;  4F3O A;  4CEO A;  4AHT A;  1RBV A;  2XY8 A;  3IG1 A;  2Z1I A;  4DSE A;  1DLO A;  3DRR A;  3HPG A;  3M8S A;  1HPZ A;  2IS3 A;  1RT5 A;  3LAM A;  3ZSX A;  1TGO A;  4CJ5 A;  3KK1 A;  1CXU A;  3RMD A;  4J2E A;  4F4K A;  3HP9 A;  1FK9 A;  1ZBU A;  1JL1 A;  3ZT4 A;  4CF9 A;  3JSM A;  4BE2 A;  4LSL A;  5HRS A;  1A5X A;  3WNH A;  4FJ5 A;  2I5J A;  4WE1 A;  1RDA A;  3QET A;  4ID5 A;  3OS0 A;  4CK2 A;  3QEI A;  5KRS A;  3AO2 A;  3VQD A;  4OKK A;  3JYT A;  1IO2 A;  4IG0 A;  4CJQ A;  1B9D A;  1XHZ A;  4HHT A;  3MEE A;  3K5L A;  1R0A A;  1TKT A;  4E7L A;  2X6N A;  3TAB A;  4Y1C A;  2G8W A;  2DFH A;  2OPS A;  2HHT A;  4KRF A;  4DWI A;  2HHW A;  3NGY A;  4LH4 A;  3OJS A;  2FBV A;  3NCI A;  1UA0 A;  4FYD A;  2R7Y A;  4PY5 A;  2NUB A;  3OJU A;  1VSL A;  4KO0 A;  1W0H A;  3RR7 A;  2YNI A;  3KJV A;  3K59 A;  2HHQ A;  4CGJ A;  3HK2 A;  3PV8 A;  1UA1 A;  2VG6 A;  3OYJ A;  2Z1G A;  1S1U A;  1L3T A;  1JLF A;  1KTQ A;  3C6T A;  2HNY A;  5J2N A;  4CEQ A;  4NYF A;  3TAF A;  3RRG A;  1ZBI A;  2PYJ A;  3LZJ A;  4N47 A;  4M41 A;  4OVL A;  3ZSY A;  4KPY A;  1LAV A;  2OYQ A;  3TAQ A;  3VQ4 A;  2QKB A;  1CZ9 A;  1NOZ A;  3QEV A;  3U3G A;  4EZ9 A;  2YHB A;  4CGG A;  3L2R A;  4CEA A;  4AIL C;  3TAN A;  4DFK A;  1FXX A;  2G8V A;  1IKX A;  2HW3 A;  4J2D A;  2KFN A;  4W5N A;  3BDP A;  4DLE A;  1NJZ A;  1BCM A;  3QNN A;  4I2P A;  3HYF A;  3QLH A;  1NKB A;  1X9S A;  5I3U A;  3THV A;  3RR8 A;  1KVB A;  4OLA A;  3HST B;  1YTA A;  3CFP A;  4DTS A;  3DLB A;  3S3M A;  4B9T A;  1YVU A;  4RW4 A;  3VN5 A;  3L8B A;  2KZZ A;  2RN2 A;  4NYN A;  4BE0 A;  1JLA A;  4LD0 A;  3NH1 A;  1KLN A;  4CEF A;  2IOC A;  4J2B A;  4K8Z A;  3AO4 A;  2RPI A;  1NK8 A;  3F9K A;  3TWH A;  1NKC A;  2E4L A;  4RG8 A;  2DTU A;  1RDB A;  2B6A A;  3DYA A;  4E1M A;  3DOL A;  5E41 A;  3VA0 A;  4M42 A;  3OS1 A;  4FJN A;  1BIS A;  4ELV A;  1RBT A;  4KHN A;  1VK0 A;  5SZT A;  3CFR A;  4CJS A;  4KFB A;  1VSK A;  4B9M A;  3PX6 A;  2XRI A;  4KTZ A;  1X9W A;  3AVJ A;  3MXI A;  4EZ6 A;  3AVK A;  3LP3 A;  1EET A;  1S1W A;  4DTO A;  3RMB A;  4ELT A;  2FBX A;  3HL8 A;  4Z4I A;  4FVM A;  1W9H A;  4FLW A;  4FLU A;  1SKW A;  4DQP A;  1KVC A;  1C1C A;  1EKE A;  3U3Y A;  4CCH A;  5JS1 A;  1IG9 A;  4H4O A;  1VRT A;  5HRN A;  1Z26 A;  3CYM A;  2HND A;  4E89 A;  3FFI A;  4DSF A;  4CJ3 A;  4H8K A;  3V6D A;  3SUO A;  2QK9 A;  3ZSV A;  2Q3S A;  3PO4 A;  1FKP A;  2B4J A;  3IRX A;  3QES A;  2OZS A;  1F21 A;  3DLG A;  1SKS A;  2F8S A;  2HB5 A;  3ZT2 A;  2X6S A;  5CZ1 A;  4Z4C A;  3KLG A;  2IGI A;  4CIF A;  4FK4 A;  4FM0 A;  3L3U A;  2QXF A;  3ZSW A;  5FRO A;  2Y1J A;  4ELU A;  1A5V A;  1ZBH A;  3T19 A;  4CGH A;  4HCC A;  1HNV A;  5T7B A;  2HVH A;  4B8C A;  1TAQ A;  4CHY A;  3OS2 A;  1DTQ A;  3OYH A;  2HVI A;  2HMI A;  4KB1 A;  1KCF A;  1QSL A;  4C8L A;  3ULD A;  2ZQB A;  4M45 A;  3V9Z A;  4ID1 A;  1SUQ A;  4GW6 A;  3VQA A;  4XIU A;  1L3V A;  2HHV A;  1JLE A;  1JLG A;  4M3R A;  1WSE A;  4CF2 A;  3TAM A;  5KI6 A;  4AHC A;  3NF8 A;  4DSJ A;  4HUE A;  4B3O A;  1C0M A;  4DFJ A;  1ITG A;  4N56 A;  4FLT A;  4IDK A;  2IAJ A;  3V9U A;  3RMC A;  4ZTJ A;  1S6P A;  1L5U A;  4FK2 A;  3CQ8 A;  1XC9 A;  1TKX A;  4E7K A;  1RBU A;  1U49 A;  3HT3 A;  3AVF A;  4CJP A;  3LP1 A;  4FLV A;  4KAZ A;  4DTX A;  1WAF A;  2IDO A;  1JL2 A;  1Q9Y A;  2W42 A;  4CF0 A;  2Z1J A;  2Z1H A;  3AO5 A;  3G10 A;  3OYB A;  3K57 A;  4DFP A;  1U04 A;  4KI4 A;  4KTW A;  4CHQ A;  1XWL A;  4CGD A;  3HM9 A;  2YHA A;  4I7F A;  3DLH A;  3LPU A;  4CFB A;  2GUI A;  3O4N A;  3K5O A;  3QIO A;  3K58 A;  4FM2 A;  2XY6 A;  3PY8 A;  1NK5 A;  4F3T A;  2F96 A;  1RBR A;  4CK3 A;  3HPO A;  4HTU A;  3A2F A;  3QNO A;  4KV8 A;  5CYQ A;  4NCB A;  1TVR A;  1S6Q A;  2EHG A;  4CJU A;  2QKK A;  2P5G A;  4DSI A;  2YKN A;  4OKJ A;  2OPR A;  1RT4 A;  3AA2 A;  4CED A;  4B9N A;  4TSX A;  4CEE A;  3HP6 A;  4F2S A;  3O3G A;  4FW1 A;  4Q0B A;  4JRQ A;  4LH5 A;  3O3F A;  1TL1 A;  1RTI A;  3MAQ A;  4H4M A;  3MXM A;  4OLB A;  4CE9 A;  4DSL A;  5KGX A;  1N5Y A;  4Z0U A;  3KK2 A;  1NK7 A;  1HMV A;  1ASV A;  3DLE A;  5KRT A;  2HHU A;  3G0Z A;  4Z4G A;  3M8Q A;  3RWU A;  4BDY A;  3TI0 A;  1U4B A;  2O4I A;  4CJK A;  4CFA A;  4CJ4 A;  3OYG A;  1QSY A;  1EX4 A;  1HRH A;  1IH7 A;  1D5A A;  1TL3 A;  3DLK A;  1T7P A;  1J5O A;  1O1W A;  2F8T A;  3AA3 A;  1NOY A;  1VSJ A;  3C95 A;  1BL3 A;  3SV3 A;  1Y97 A;  2O4G A;  1MU2 A;  3VQE A;  1Q9X A;  1G15 A;  3KK3 A;  5DK5 A;  5J2M A;  4DMN A;  4IFY A;  2KZM A;  4CJL A;  1BCO A;  2ATQ A;  3QO9 A;  1REV A;  5JS2 A;  1C0U A;  1HYS A;  3EZ5 A;  1LWE A;  4DTR A;  1YTU A;  1IKY A;  3V81 A;  1SL2 A;  4IG3 A;  1IKW A;  2E6M A;  3S3O A;  4BE1 A;  1B92 A;  3L2Q A;  4DFM A;  1TAU A;  1TK5 A;  2D0B A;  3ITH A;  3NF6 A;  4FJG A;  4FJM A;  4GVM A;  2VG5 A;  3ZSQ A;  2EX3 A;  3NAE A;  4R5P A;  4CIG A;  1TK0 A;  2VG7 A;  2P1J A;  3MEG A;  4UQG A;  2A1S A;  3TAG A;  4JLH A;  1VSE A;  1BIU A;  1GOA A;  4DS5 A;  3HPH A;  1C6V A;  4LY7 A;  2ZD1 A;  4MFB A;  3LAN A;  4CFC A;  3QIN A;  3S9H A;  1TKD A;  2ZE2 A;  4DS4 A;  1RTD A;  2XY7 A;  2HHX A;  1TK8 A;  3C6U A;  5CY4 A;  3ZCM A;  3SJJ A;  1QHT A;  4M3U A;  4BAC A;  4Z4H A;  3CM5 A;  3SCX A;  3KD1 E;  1C1B A;  4AHS A;  5HRP A;  4FJL A;  2BDP A;  4O44 A;  3M8P A;  4N76 A;  4CIE A;  3QEW A;  1VSD A;  2KFZ A;  5HBM A;  4FLY A;  4E19 A;  3LWM A;  4O55 A;  3CM6 A;  3VQ8 A;  4YFU A;  3HXM A;  2KTQ A;  3HVT A;  3SPY A;  4NCG A;  4KKO A;  4Q5V A;  1BQN A;  4CJT A;  5FRN A;  4Y1D A;  4KI6 A;  5CYM A;  5I42 A;  3ZT3 A;  1D8Y A;  4HVJ A;  2PYL A;  5J1E A;  1QE1 A;  3PUF A;  3HO1 A;  4E0D A;  4DQQ A;  1QS4 A;  3P1G A;  4M3X A;  2P5O A;  4O5B A;  2RKI A;  3SQ1 A;  1WSI A;  3K5N A;  4GMJ B;  1JXE A;  3O3H A;  1T8E A;  4DG1 A;  4KRE A;  3TAP A;  2ETJ A;  3T3F A;  2BAN A;  4BWM A;  3RTV A;  3KLI A;  2D0A A;  3P83 D;  1I3A A;  3VQ6 A;  2YNF A;  2WON A;  3TAE A;  1QSS A;  3OYM A;  3ZSR A;  3SZ2 A;  1EXQ A;  3V1O A;  4B9S A;  5HRR A;  4AHV A;  2JGU A;  4CJR A;  1ZYQ A;  4DQS A;  4KHY A;  4PQU A;  2YNG A;  5CZ2 A;  1NK6 A;  3IAY A;  3OYF A;  4G1Q A;  4M3Z A;  1GOB A;  2E6L A;  1KFS A;  1S1V A;  4PA1 A;  1BI4 A;  3K5M A;  3L3V A;  4KHU A;  4FZZ A;  3I8D A;  2BGG A;  1WSJ A;  4RW8 A;  2D5R A;  3OVN A;  4K8X A;  3AVG A;  1NK0 A;  4HUF A;  3NGZ A;  3MEC A;  3H08 A;  4F2R A;  1VSF A;  3ZT0 A;  4CJF A;  1UWB A;  4B8A B;  2AJQ A;  3ZT1 A;  4OGC A;  3VQ7 A;  3L2V A;  4N5S A;  4N41 A;  2DFF A;  2XY5 A;  4KHS A;  1YT3 A;  3DRP A;  3P5J A;  4B9L A;  2DFE A;  3VQC A;  2Y1I A;  3OYE A;  2KQ2 A;  1RTJ A;  4ICL A;  1ASW A;  3V9X A;  1L3U A;  5C24 A;  1KFD A;  3NH2 A;  2G8U A;  3SQ4 A;  1J54 A;  2YV0 X;  1WAJ A;  4ZHR A;  4FK0 A;  4C8K A;  4QAG A;  3I0R A;  3DM2 A;  4CEC A;  5HLF A;  2OA8 A;  1RBS A;  3B6P A;  4O4G A;  3V1Q A;  4CJW A;  2FBT A;  2X74 A;  3AV9 A;  3RMA A;  4ZTF A;  1RT6 A;  1VRU A;  1WSH A;  3DI6 A;  1T05 A;  3DRS A;  1HYV A;  4JS4 A;  3BGR A;  3SV4 A;  1S1T A;  3AVA A;  3OYN A;  4CES A;  1JLC A;  1KRP A;  5HP1 A;  3NF9 A;  1QTM A;  3OYD A;  3AO1 A;  2X78 A;  1XI1 A;  1U47 A;  1SL1 A;  4RW9 A;  1HQU A;  2GBZ A;  1JXB A;  1JLQ A;  3SPZ A;  3LP0 A;  1RTH A;  4CGF A;  4W5O A;  2B5J A;  3OYC A;  4I2Q A;  2JLE A;  3I0S A;  2HHS A;  1RCH A;  4O0I A;  3AVC A;  3VQ9 A;  1ZBF A;  4AH9 A;  1CLQ A;  2RF2 A;  4DTP A;  3WNG A;  4CJV A;  1TKZ A;  3L2U A;  4FJH A;  4FJJ A;  5HRO A;  4IFV A;  4FJX A;  3ASM A;  4CFD A;  4E7J A;  4BDZ A;  3QER A;  3T1A A;  4M3W A;  3NE6 A;  4IBN A;  1LW2 A;  5SWM A;  3V1R A;  3KLF A;  4JS5 A;  4DTU A;  1VSI A;  4B9U A;  3OY9 A;  3LPT A;  3AVN A;  4FM1 A;  1BGX T;  4CJE A;  4FXD A;  4CHP A;  1LW0 A;  2P51 A;  4CER A;  3SQ0 A;  1ASU A;  3S3N A;  4KHQ A;  1BI4 B;  1S9E A;  3EYZ A;  3IS9 A;  3LAL A;  2DY4 A;  1RIL A;  5C25 A;  4EP5 A;  4FZX C;  4F8R A;  1SKR A;  1DTT A;  2G8K A;  5J2P A;  3D0P A;  4FLZ A;  4QCL A;  3NBP A;  1U48 A;  1LWC A;  4W5Q A;  5KTQ A;  1NKE A;  4M3Y A;  5J2Q A;  3ALY A;  3OYI A;  2OPP A;  1UAX A;  1WLJ A;  1D9D A;  4E1N A;  4PUO A;  1EP4 A;  2XO7 A;  3AVI A;  1SV5 A;  2ITG A;  4MQ3 A;  5KGW A;  3HJF A;  1IKV A;  4OKE A;  1K6Y A;  1N6Q A;  1RDD A;  4EP4 A;  4OPK A;  1T03 A;  1L3S A;  3KKR A;  3QIP A;  4J2A A;  5FDL A;  3AVB A;  4OGE A;  3SI6 A;  4FW2 A;  4JRP A;  1RDC A;  1NK9 A;  1NK4 A;  1LWF A;  3LAK A;  4CEZ A;  4W5R A;  3AVH A;  3KLE A;  3F73 A;  3VQB A;  3M8R A;  1D9F A;  3LDS A;  4O0J A;  4DTM A;  4E3S A;  2PZS A;  1NJY A;  4FJ9 A;  4CHN A;  3TAR A;  2OZM A;  3OYL A;  4RW6 A;  1Q8I A;  3ZSO A;  1QQC A;  1HQE A;  2G8F A;  3LP2 A;  4CHZ A;  1HYZ A;  2WOM A;  4DTN A;  3DOK A;  1RT2 A;  1WN7 A;  3O4Q A;  4M3T A;  1Z25 A;  1U45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...