2IAJA

Crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with atp
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
551
structure length
551
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H (p66 RT)
publication title Crystal Structures of Clinically Relevant Lys103Asn/Tyr181Cys Double Mutant HIV-1 Reverse Transcriptase in Complexes with ATP and Non-nucleoside Inhibitor HBY 097.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
total genus 142
structure length 551
sequence length 551
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2iajA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iajA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iajA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iajA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2iajA05
2NUBA 3DOKA 2ATLA 3SI8A 2C28A 1S0NA 5HRSA 3VQ5A 1N4LA 2HHQA 1SUQB 3CJ4A 1C6VA 1C1CA 4KAIA 3JYTA 3AO4A 5J2NA 4R8UB 4KRFA 1T8EA 3T5HA 1T05A 3I0RB 4KREA 1JXEA 1NK4A 3QNOA 3ZSXA 2YNHB 2UUTA 5EUHA 1SL1A 4K8XA 4ZPAA 4BDZA 4O3RA 2FBYA 2BQRA 2P5GA 3OYCA 3V6DA 4CJFA 4URSA 3VQ6A 4LSLB 1XR6A 2Y1JA 1WSGA 1JKHB 4EZ9A 1BGXT 3FFIB 3VQ7A 2I1RA 1RT1A 4I7FA 2RF2B 2FBTA 2GC8A 3G0ZA 5EWFA 3DOLA 3CM6A 2I5JB 1U47A 4DFJA 2BQUA 1ZETA 2OZMA 3KLGB 4H4MB 3PW5A 2VWKA 4ZPCA 2DY4A 3H08A 5SZTA 3OYBA 4FJ5A 1L5UA 1BIZA 4NLPA 3VA3A 3SJJA 2YNIB 4I2QB 4DTUA 2UUWA 2PYJA 3KMQA 1YVUA 2C22A 4RNMA 3PX4A 3OS1A 2W9AA 3D28A 4ZP9A 1C1BA 4KTWA 3QERA 2YKNB 1CXQA 4J9LA 2UVUA 4O3PA 4ZP7A 4F4ZA 3K2PA 4U7CA 1C1AA 4GVMA 4C8MA 1IKWA 4O3SA 1LWEB 2Z1GA 4CERA 4OPJA 3ISND 4IBNA 2HWIA 1LW2A 4F50A 4EBEA 1TKXB 2R2TA 4K50A 4Y3CA 4NRUA 2O4GA 3ITHA 1RTDA 4DQPA 2XCPA 1REVA 4M95A 1K1SA 4HUEA 1LWFB 4CEDA 3OYDA 1C0MA 4W5NA 4ZMMA 3SI6A 5JS1A 2WB4A 2AJQA 4CF1A 3ZSQA 2FVRA 4KO0B 4Q44A 3KD1E 4E0DA 3KOAA 5KFVA 1TL1A 3NFAA 3OL6A 4IH7A 3LZJA 3DI6B 2RDIA 3K5OA 1VRTB 1VSHA 4DSIA 3M9MB 4QW8A 4HUGA 4ZPDA 5DLGA 1MU2B 2OA8A 2YHBA 3EYZA 1T03B 4TN2A 5KFXA 3MTKA 4GW6A 1RTIB 2IM2A 2ETJA 4NYFA 3WNEA 1D1UA 4MIBA 4AILC 1RDBA 2JEFA 2ILYA 4CEBA 1RBSA 3PZPA 1SH3A 3V4IB 4EP4A 3LP2B 3OYJA 4KKOB 3PW4A 2QXFA 4CCHA 1RT6A 3OYEA 5JXSA 4JRPA 1VRUA 2HNDA 3TAMB 4CF9A 5F8GA 4Z4FA 3ALYA 3OLBA 4NCAA 1TK5A 3T5JA 4DU3A 3CJ5A 2OPQA 3O4NA 4I2PB 2KFNA 4DTJA 3DLRA 4F2SA 5KFLA 1SKSA 3AVJA 3V9ZA 4RW4A 1BIUA 3NCIA 1WSHA 3KJVB 4NLVA 3QEVA 4B9NA 4Z4GA 4KBIA 4FLWA 4CJVA 2W9BB 3HM9A 4LD0A 4XPEA 1S1WB 3P1GA 3KLFA 4EYIB 3L3VA 4K4XA 4ELTA 4KI4A 2ILZA 3PR4A 1GOCA 2IOCA 4DG1A 5C24A 2J6TA 2B5JA 1N5YA 4Z4EA 4M42A 3V6JA 3OS0A 3HVTB 2JEGA 4TYAA 3KK3A 4ED2A 3DYAB 4PWDA 3HL8A 3NL0A 4M3TA 4E7IA 5KFGA 4JRQA 4ZTJA 4BWMA 1RT7B 1EETA 3AO3A 3I5BA 2BRLA 3HHKA 4ICLB 4DL2A 2IM3A 2EX3A 3V1RA 1DLOA 4RG8A 1JLCB 1LAWA 4KV8B 3OVNA 1HRHA 3VQ4A 4O4RA 4DL3A 1EX4A 1I3AA 3PW2A 5K14B 3RWUA 4R0EA 1T3NA 3RB3A 1L3TA 3QGHA 2RKIB 1TAQA 1ZTTA 5KT5A 2HVIA 1RT2A 4KB0A 3NAEA 2XO7A 1S6PA 2V0NA 1LW0A 1TL3A 3ZSVA 4DL6A 1RT3B 5KFWA 4NCGB 1RT5A 3NAHA 1NNDA 1W0HA 4OKEA 4WXWA 4HYKA 4FLYA 3BREA 4IKFA 3GV7B 4JLHA 4DFKA 3P83D 1JLQA 2IBKA 5FDLB 5L1JA 3HJFA 3RB0A 1HQEA 3VQDA 1D9DA 3QINA 4R5PA 5EDWA 2GV9A 4ZPBA 1TP7A 1J5OB 3E01B 5KT7A 2PZSA 3ZT1A 4Q0BA 3JSMA 1WLJA 1ZBUA 3AA2A 3QEWA 1TGOA 1U4BA 4Z0UA 5KFIA 5KG2A 2YNGA 2FBVA 1Q9YA 5J2MA 4FBUA 2RN2A 4LSNB 2W7PA 4CHQA 3NHGA 2ITGA 5F8JA 1Y97A 3PVXA 5C25B 3PO5A 4Q5VA 4Z4HA 4J2BA 1JL2A 3DLBA 3OYMA 3AO5A 2F96A 3LP1B 2HNYB 1X1PA 4CFAA 4DQQA 3T1AA 5KRTA 3C6UB 3N6MA 1S1XB 3NBPB 3K5NA 4W5QA 3DRSA 4KHUA 2AWZA 4YR0A 1UAXA 1QHTA 1NHVA 4FZZA 4K4UA 1HNIB 1BI4B 2ZD1B 1N56A 3TABA 3LP3A 4WYLA 3QGIA 3NAIA 4TQSA 2Z1IA 3LDSA 3AA5X 2RPIA 1KTQA 5DQIA 3PV8A 5KFNA 4IG0B 3N6NA 3DM2A 4TSXA 1J54A 3KIOA 3MXIA 2WK4A 2JEJA 1S1TB 3FQLA 1EXQA 3I0SA 3SUNA 4JV1A 2R8HA 3QZ8A 3K59A 3SNNA 3LP0A 3PO4A 3Q8RB 2X78A 4J9SA 2IDOA 4M3WA 2HNZB 1XI1A 4QPXA 4UQGA 1RYRA 3NF7A 4HTUA 2YNFA 3LAMA 1QUVA 2OPPA 1BQNA 4RW7B 4O44A 4NLDA 2GUIA 4ZP6A 5D3GA 3G6XA 1JLAB 4RNFA 2ASJA 3M8RA 1QE1A 1RDAA 1RILA 1BQMA 3QNNA 4CGFA 3PW0A 1YTAA 3P5JA 1EKEA 3DLGB 4FJLA 4RW8A 2OPSB 1ITGA 1XHXA 4M3ZA 5KFUA 1NKCA 4FJ9A 5HBMA 1RT4B 4F3OA 1IKVB 2VG5B 3SYZA 1SV5A 5J1EA 4K4YA 1U45A 4I9QA 1HMVB 1T7PA 3VN5A 4LQ3A 5FRMA 3M8QB 4ED6A 1JIHA 2A1RA 4HVJA 3IGVA 2IGIA 5KFHA 4MFBA 4FW2A 3FSIA 3KLHA 4FXDA 5KTQA 1RTHB 1W9HA 4YFUA 3RAQA 1C0TB 4F2RA 4DQRA 3M9NB 5J2PB 4DTXA 4KFBA 4HCBA 4G1QA 2OZSA 4PQUA 3CDWA 1NK0A 4FW1A 2D7SA 3NH1A 2ASLA 1NK5A 1SH0A 4DL5A 4J2EA 2FC0A 2P5OA 3Q8PB 3ULDA 4CJTA 3V9SA 4WE1B 3HXMA 4PA1A 4ZHRB 4ECSA 1TKDA 1FKOA 4IDKA 2X74A 5KFMA 4EP5A 3G6YA 3ZT3A 1TV6B 3CO9A 4NLXA 2LSNA 3LWMA 4CHYA 4J9RA 3V6HA 4DFPA 4DTOA 4C8OA 3BSAA 5KT6A 3NGIA 3AA4A 4AHVA 4ED7A 3H5XA 2E6LA 1JLFB 1FKPB 2G8KA 3OYKA 2DPIA 3HP9A 3RB6A 1JL1A 3QETA 2FVQA 4QWCA 3L2UA 3VQCA 4M45A 2BGGA 3LZIA 3T5KA 4RW6A 4YR3A 2GIRA 4DL4A 4IR9A 4RNHA 1TVRB 4ID5B 3QLHA 3OS2A 1KCFA 3KHGA 4H4OB 3IN5A 5HLFA 3PX0A 4TLRA 1C0UA 3K5LA 3U3GA 4OKJA 4IR1A 2EHGA 4DS5A 3MEDB 2BE2B 4EO6A 3KNAA 3EZUA 1S0OA 1LWCA 2CKWA 2R7YA 1DTTB 1GOAA 3L2RA 3KTQA 2VG7A 1IKXB 2J6SA 3DLKB 2OPRB 3SCXA 1S48A 4J9KA 4CIGA 3NE6A 3SQ4A 2R2SA 1WSIA 3HK2A 2GBZA 1LV5A 1ASUA 2D0BA 1KVCA 4DU4A 4CGJA 3OY9A 3PHEA 1SL0A 5EU7A 3L2VA 1NK7A 1S1VB 2D3UA 2FLLA 3T5LA 3GV5B 3SUOA 3IRXA 2ZE2B 3NKYA 1FK9A 3KK1B 1NK9A 3OYHA 4CECA 1EP4B 1S5JA 4ELVA 4N76A 4GMJB 4RUAA 1R0AB 4QOZB 3RRGA 2E9RX 1HYSB 4E1MA 1I39A 1N6QB 5I3UA 4F4YA 5HP1B 4E89A 5SWMA 2KZZA 4XPCA 4TY8A 4LH5A 3AVIA 4Y34A 3UDLA 3L2QA 3IS9B 3NF9A 3SQ0A 2VG6A 3G86A 3O3HA 3DRPA 1XWLA 3AVHA 2B6AA 3VQAA 3SUQA 4BE0A 2V4RA 2W9CB 3QIDA 3OSPA 2WOMA 4AHRA 3BGRB 4PUOB 4M3XA 1ZYQA 4N47A 4B9UA 4CJ5A 4RW9B 3ICLA 4IFVB 3DMJB 1S9EA 1U04A 4C8LA 2FBXA 2CJQA 3QESA 1IH7A 5CYQB 3K58A 3EY1A 4K4SA 3TR8A 3U6FA 3O4QA 2AGQA 4CF8A 4ECXA 2R8GA 3RMAA 1JLBB 3NH2A 4KTZA 4CF2A 3BSOA 3V9XA 5HROB 4Y1DA 1JLGB 5L1IA 4FZYA 1S9GA 3EPGA 4URGA 1NOZA 4B3OB 1TKTA 1KLMB 4X2BA 3CDUA 4OLAA 2JC1A 2A1SA 1S1UB 4FS1A 5CYMB 1KHWA 2D3ZA 2XY7A 3DOKB 4KHNA 2P51A 3AO2A 4CJRA 2KFZA 5KI6A 4FLUA 2DFEA 1C1CB 2C2DA 3OYFA 3VQ8A 4O0JA 1U48A 3V1QA 4YMEA 3JYTB 2IJNA 5J2NB 2HAIA 1NK6A 3V1OA 1VK0A 4DMNA 5L1LA 4LY7A 1T05B 3N6LA 3BDPA 2IJFA 3D45A 3IG1A 3MEEA 3EPIA 4MK7A 2BRKA 2IC3A 2BDPA 4FLTA 1QS4A 3DLEA 3V6DB 1UWBA 3TAGA 5DGBA 2UVVA 1S0MA 1TKZA 1CZBA 3I8DA 2O4IA 3AVFA 1RT1B 3GIMA 3AV9A 4ED8A 4CK2A 4I7FB 2IAJA 2P1JA 3PJWA 1ASWA 1ZTWA 4ZTFA 4W5TA 3RR7A 3SZ2A 2R2UA 4OPKA 4JUZA 3DOLB 3S9HA 5J2QA 3MECA 4O4GA 1GOBA 1S6QA 3MR5A 4FLZA 3L8BA 3KMSA 1NK8A 4HCCA 4J9PA 2X6SA 3GV8B 4B9TA 4QW9A 1RTJA 5KFOA 5JS2A 1QTMA 4URQU 1IKYA 3F73A 4CGHA 4OLBA 4O3OA 4ECQA 4JS4A 2KW4A 3CJ3A 4JV0A 4NLSA 2OH2A 4CJPA 5L9XA 3H5SA 4J2DA 4WXOA 1C1BB 4CE9A 4M3UA 4MQ3A 1HNVA 4IG3A 3AVGA 4DTNA 3DRRA 5KFEA 3QIPA 1A5XA 3NGYA 1IKWB 1UOCA 4M3RA 4DLEA 1KVBA 4CEOA 1LW2B 4IFYA 4CJUA 4FJ7A 3C6TA 1HQUA 3TAFA 4DFMA 5DG7A 2KZMA 1CZ9A 2D41A 2F8SA 5F8LA 3ITHB 1RTDB 4NCBA 4K4VA 1REVB 1JLEA 2YKMA 3ZSZA 4E7LA 5HRPA 5C42A 1WN7A 1NJXA 1SKWA 3PX6A 3SPYA 4NLQA 2BANA 2WONA 5DQGA 2IA6A 1L3SA 1HARA 3VQQA 3OYGA 4N5SA 2XRIA 2HHSA 1TL1B 4YP3A 3B6OA 2HMIA 3HP6A 2G8WA 2E9TA 4DSEA 2V9WA 2FJVA 2ATQA 1RA7A 3MEGA 1VSKA 3H5UA 4JS5A 4AHSA 3SV4A 3D0PA 4CESA 2HW3A 3QGGA 3NDKA 3M8PA 3HKWA 4HHTA 1VSMA 1KHVA 3AVCA 3ZT2A 2AX0A 1XC9A 1U49A 4ED0A 4K8ZA 4MK8A 4CFBA 1D0EA 4DU1A 1RT6B 4W5OA 1DTQA 3NMAA 1VRUB 2HNDB 3H40A 2B4JA 4FZXC 3NF8A 4AHUA 3TI0A 3RMBA 3G6VA 2HHWA 2OPQB 1HPZA 1B9FA 3CIZA 4FJKA 5KT3A 1WSFA 3HPHA 4DLGA 2IS3A 4KHYA 4FJJA 3LANA 3BQ2A 4FCYA 4RW4B 4CHPA 2OYQA 3KLIA 1JX4A 1SH2A 4AHTA 4B9LA 4M94A 5CZ2A 3KLFB 3OSNA 3QO9A 3KHRA 3KLEA 1Q9XA 3AVNA 3K5MA 2ASDA 2F8TA 4DG1B 3KK2A 4NLRA 5C24B 3LAKA 4QWDA 4CHZA 5I42A 4FK2A 2B5JB 3V81A 4KTQA 1N5YB 3V9UA 4KE5A 1KSPA 3FQKA 5KFDA 3GIJA 2FVCA 3KK3B 4NZ0A 1NJZA 1D8YA 4PWDB 3OJUA 3OYIA 1ASVA 3H98A 1SUQA 2AU0A 3CJ2A 1EETB 2ZQBA 2R8IA 4AH9A 4Z4IA 3TWHA 1FXXA 4FJHA 4M3YA 1NHUA 3KHLA 4Q45A 4R8UA 1DLOB 3T19A 1X9WA 3I0RA 2FLPA 4U6PA 2X6NA 4J9MA 5F8NA 1YT3A 1WAJA 4N41A 2YNHA 4BE1A 3TARA 1K1QA 3MR2A 4BACA 1RT2B 1S6PB 3GQCA 1LW0B 1TL3B 2G8VA 2HHVA 2HB5A 1RT5B 4LSLA 3CJ0A 1JKHA 3FRZA 4CJWA 1ZBHA 3FFIA 4FJIA 3MEDA 3ZSYA 1NOYA 4KPYA 4KB7A 5DLFA 5JUMA 4QAGA 4YNQA 4CGDA 3HPOA 5DMRA 2RF2A 3KD5E 1JLQB 3CDEA 3CFRA 1SKRA 3HO1A 4CJ3A 3AVLA 1HQEB 2DPJA 3MR6A 3TAEA 4R5PB 4CHNA 4B9SA 4CJLA 2I5JA 1S4FA 3E51A 4FVMA 4EZ6A 3KLGA 4IRCA 3WNHA 4H4MA 4O3NA 4EO8A 4DS4A 2V4QA 3TANA 2XWYA 3H4BA 5KG1A 1VSLA 3KK1A 5KG4A 4DQSA 2UVRA 4Q0BB 3HVRA 4Y2CA 3JSMB 4OVLA 3SFUA 4CIFA 4E3SA 4WFZA 2VA2A 2YNIA 4I2QA 5KG5A 2B43A 3TAPA 5DK5A 5F8IA 4DSKA 2JGUA 2ZKUA 5J2MB 3SFGA 2YKNA 4IH6A 4M41A 3L2WA 3F9KA 4CEZA 4O3QA 4Q8FA 1QSLA 3GIKA 3EZ5A 1LWEA 1L3UA 4MKBA 4J9OA 2XHBA 4CEFA 1A5WA 5KFYA 4FM2A 4RNNA 1BCMA 1TKXA 3VQBA 4B08A 1Z4UA 4DSFA 3H4DA 3CM5A 3H5YA 4ZVEA 2QKKA 3M9OB 3OYNA 4K4WA 1LWFA 4OKKA 1ZBLA 4B9MA 4DWIA 1K6YA 3DRSB 5F8HA 4BWJA 4GC7A 3HSTB 4WZMA 1TK8A 1UA0A 4KO0A 4EYHB 3M8SA 1RYSA 3DI6A 5FROA 5KG3A 3MFHA 3ZCMA 3OLAA 1VRTA 1I6JA 5KG7A 1MU2A 1O1WA 3S3NA 4MIAA 1T03A 3SPZA 1RTIA 2DFHA 1NJYA 3DM2B 4F3TA 2DFFA 4FK4A 4OL8A 2HWHA 4CFDA 1BHLA 3I0SB 3MR3A 2J6UA 4KB1A 4IRKA 1J53A 4TY9A 2BR0A 2XI2A 3V4IA 4O55A 4FBTA 3LP2A 3K57A 2FJWA 4KKOA 2IMWP 3A2FA 3LP0B 4ELUA 4ED3A 4DF4A 3G10A 3TAMA 3KKSA 4I9LA 3S3MA 4I2PA 4XIUA 2F8EX 3OL9A 4ECUA 2YNFB 2OPPB 1BQNB 5KFFA 1RBRA 4FJMA 4BDPA 4O44B 3RR8A 3UR0A 3ZSWA 3KJVA 5D3GB 4JV2A 3PW7A 5E41A 2KTQA 2QV6A 1QE1B 4CFCA 3PJXA 3CQ8A 2W9BA 1S1WA 4H8KA 2VWJA 1BQMB 4Q8EA 1T94A 3CFPA 2JEIA 4RW8B 3RBDA 2XY6A 3LALA 1IO2A 4OGEA 1GX6A 1CSJA 5HBMB 1QAJA 1B9DA 1QSSA 3HVTA 3VA0A 1KVAA 1SV5B 4FLVA 5J1EB 3ASMA 3DYAA 5KFRA 1VSDA 4ECWA 4CHOA 2JLEA 2WCXA 4K4TA 1WNEA 2FJXA 2VA3A 1RT7A 3HVAA 5KFAA 1J9AA 1CLQA 4ICLA 4MFBB 2W8LA 3O3GA 3KLHB 4F8RA 3MAQA 1OS5A 1JLCA 4KV8A 3HVWA 1Z26A 3AVAA 3PR5B 5K14A 4XO0A 3I5CA 1VSIA 3QEIA 4KFBB 4B8AB 4G1QB 3H2LA 4PQUB 4FM1A 2C2EA 4KHSA 2RKIA 3TVKA 5CZ1A 4F4WA 1RT3A 4MKAA 1IG9A 4NCGA 4QWBA 4ECVA 4H54A 1U09A 4BE2A 4ECRA 5KFKA 1FKOB 4DSLA 4IDKB 5FDLA 2HVHA 4MK9A 4EBDA 4IOBA 1G15A 4CJSA 1BISA 1J5OA 3E01A 5KFJA 2XY5A 1X9MA 3I5AA 3MXJA 3MF5A 4EBCA 1ZBFA 2AGOA 3PY8A 4DSJA 3WNGA 4NYZA 4ZVGA 4K4ZA 1L3VA 2GIQA 4ED1A 1JXBA 1RBTA 2W7OA 4RW6B 2HHUA 5F8MA 5DQHA 2UVWA 3QLHB 1VSJA 2QE5A 5HLFB 1JXLA 4ECZA 4LSNA 3GYNA 1XHZA 1C0UB 4QCLA 1KFDA 4KHRA 3Q8SB 5C25A 1YVFA 1S49A 1LWCB 3LP1A 2VG7B 2HNYA 4NRTA 5F9LA 2C2RA 4FM0A 2BQ3A 3T3FA 2Z1JA 3C6UA 4Y2AA 4TQRA 5KGXA 4J9NA 4CK1A 1S1XA 3NBPA 4WFYA 2XY8A 1QSYA 4FLXA 3NF6A 1S10A 4FS2A 3IRXB 1XR5A 1UA1A 2AGPA 1FK9B 1WSJA 3CWJA 2G8FA 4KHMA 3QYYA 3DDKA 3RMDA 4MH8A 5T14A 2QK9A 1HNIA 5I3UB 1BI4A 4NLGA 1WNSA 2ZD1A 4E7KA 3V9WA 4TY8B 3ZSRA 1S97A 2G8IA 2VG6B 4PY5A 3DRPB 4IG0A 3BR9A 2B6AB 4IKAA 1S1TA 4CEAA 4BDYA 3CVKA 5DGAA 3C95A 4O5BA 1BCOA 2WOMB 5KFPA 3C94A 2JC0A 3VQPA 3AVMA 1N48A 1NJWA 1ZBIA 1S9EB 3QEPA 2IM0A 1A5VA 4NLWA 1NKEA 4NLOA 3NGZA 3CG7A 3TAQA 2HNZA 3L3UA 3OL8A 5KFQA 3FDSA 5KT4A 4RW7A 4J2AA 2FVPA 4DL7A 5KFSA 1S9GB 2O5DA 1JLAA 4ZP8A 1TKTB 2AQ4A 1RAJA 5CY4A 4IH5A 5KG6A 3GILA 4N56A 1SL2A 4C8KA 2AX1A 3DLGA 3BSCA 2OPSA 2D5RA 3KHHA 5KFCA 3LPTA 5L1KA 4TXSA 1D5AA 3AA3A 3WNFA 1TK0A 1RT4A 5KFZA 1IKVA 2VG5A 3RB4A 3BSNA 1WSEA 3OYAA 1GX5A 2Q3SA 1HMVA 3IAYA 1Z25A 3M8QA 1TQLA 3IGNA 3Q8QB 3LPUA 4CEEA 2E9ZA 3IG1B 3MEEB 3UPFA 2YHAA 4CEQA 4QWEA 3KKRA 3LWLA 4LH4A 1RTHA 4YR2A 2IC3B 4AHCA 1C0TA 4KHWA 3DLEB 1UWBB 4J9QA 3RTVA 1HYZA 5KG0A 3AO1A 3OJSA 5J2PA 1TKZB 3KLVA 1X9SA 4O0IA 1F21A 4FK0A 2EC0A 4TYBA 2IAJB 4C8NA 1HYVA 3OYLA 2G8HA 2WRMA 4FJGA 2W42A 4WE1A 3VQ9A 4FYDA 3U3YA 3VQEA 5J2QB 4LQ9A 4ZHRA 3MECB 4O4GB 1S6QB 4QWAA 5HRNA 4FJXA 3BJYA 2XGPA 4DTPA 4FJNA 2R8KA 2WHOA 1TV6A 3UQSA 3OHAA 4GC6A 1BL3A 2G8UA 4HKQA 4NLUA 4ECTA 1RNHA 1RA6A 1RTJB 4E19A 3ZT4A 2D0AA 4L8RB 4ZVHA 4F4XA 4KI6A 1XR7A 1IKYB 4DF8A 4F4KA 2XCAA 3ISNC 3THVA 1JLFA 1FKPA 5FRNA 2Z1HA 1RBUA 2E4LA 1KLNA 2E6MA 2KQ2A 3S3OA 3NGDA 1W25A 5KT2A 1HNVB 4IG3B 1RDDA 2R2RA 3UIQA 4RUCA 3DRRB 4CIEA 3QIPB 4KAZA 5EWEA 1TVRA 4ID5A 1QQCA 3OL7A 4OGCA 5KGWA 4H4OA 4IFYB 4CJKA 4KSEB 1KFSA 3C6TB 1HQUB 2XI3A 4DTMA 3RRHA 1D9FA 3RAXA 5HRRA 5EWGA 2BE2A 4ZVFA 5F9NA 3QEXA 4WFXA 1JLEB 1QAIA 2YKMB 1DTTA 5C42B 4WYWA 4RU9A 2QKBA 4E7JA 4NLYA 1IKXA 3DLKA 4KHQA 2OPRA 3BQ0A 2BANB 3GIIA 4CJQA 4CJ4A 4E7HA 2WONB 4CF0A 1RDCA 4NLTA 1WAFA 2R8JA 1S9FA 3MXMA 5T7BA 1S1VA 3SQ1A 4CGGA 4FJ8A 2HMIB 2ZE2A 2RDJA 3CFOA 2IM1A 3HYFA 3SUPA 1EP4A 3MEGB 5KRSA 1R0AA 3AVBA 1HYSA 5KFBA 2W8KA 3HPGA 3ZT0A 1YTUA 1N6QA 4OJRA 5DG9A 4DQIA 5HP1A 4RNOA 2YV0X 2YNGB 5C5JA 1MMLA 2FVSA 4DEZA 3M8PB 1HJRA 3IS9A 3CYMA 4IRDA 3QZ7A 3O3FA 2DTUA 4ID1A 2XC9A 2W9CA 1VSFA 1DTQB 4EEYA 3BQ1A 1RCHA 3RBEA 4G3IA 3ZSOA 4Z4CA 5DG8A 3BGRA 3D5MA 4PUOA 2HHTA 1RDRA 4IQXA 4RZRA 1RBVA 4CJEA 3NH0A 1VSEA 2PY5A 2HHXA 4RW9A 2FLNA 1HPZB 3V6KA 4IFVA 3DMJA 3RMCA 4Q43A 4B8CA 3OHBA 5CYQA 4YQWA 3QIOA 2XGQA 3H59A 4CGIA 3DLHA 4DTRA 4DTSA 1B92A 3KLIB 3HT3A 1KRPA 2ALZA 2Y1IA 1JLBA 4CK3A 2WTFA 1LAVA 1Q8IA 4W5RA 5HROA 4E1NA 1JLGA 1CXUA 3B6PA 3QO9B 4WZQA 4B9VA 4Y1CA 4HUFA 5KFTA 3AVKA 3MFIA 3KLEB 4B3OA 1IM4A 1KLMA 1C2PA 3TQ1A 3KK2B 2PYLA 5I42B 4ECYA 2D0CA 3PUFA 4NYNA 3V81B 3SV3A 3VQSA 1NKBA 1S1UA 3SQ2A 5CYMA 1TAUA
chains in the Genus database with same CATH superfamily
2NUBA 3SI8A 6FDRA 3VQ5A 3A5OC 2GHPA 1C6VA 1C1CA 1YZ6A 3BKFA 2CVIA 4U67Q 2ZJQQ 1IVZA 2V7ZA 1YI2N 1U24A 2ZBCA 4YY3F 2BVZA 4UZBA 4R8UB 2FD2A 1NSAA 3I0RB 1R7IA 2OFHX 4EK2A 4CBXA 1CULA 4IWVA 3SQGB 3QNOA 1HNWJ 2YNHB 2EFQA 2F1FA 1NWKA 1KC8O 5EUHA 5LL6d 3FMBA 3HOSA 3HSGA 4BDZA 2JLFA 3TJ8A 1T9TA 2V34A 4HDGA 4O3RA 3DXKA 5JMNA 5DDRC 4WCEL 4DR3J 3TSQA 2MB0B 4OPAA 3VQ6A 1NBEB 1NBWA 4LSLB 1XR6A 3NGRA 2H54B 2OD6A 1JKHB 2DHAA 4IDHA 4EZ9A 1RT1A 1XBWA 3O5TB 2RF2B 2FBTA 5HMXA 3D6FB 2FDNA 2FGOA 1U47A 4DFJA 5A8WB 1ZETA 3B6BA 3GOIA 3X3UA 3KLGB 4KC5A 2OO4A 4ZCKA 1QTNB 2A5XA 4A62A 2GVDB 2B0GA 3OYBA 4WFNQ 1DAXA 4NLPA 2FXUA 2YNIB 3VCDA 4RUBA 1YVUA 4I4BA 4F0KA 4BCAA 1HA1A 3PX4A 2XZTB 2QLWA 4KTWA 2YKNB 4F4ZA 3QATA 4CERA 1WKKA 3DKDA 1U1LA 2DBBA 2C3OA 4R25A 2O8EB 4F36A 3GE1A 1R8PA 3FBFA 4A8OA 3H0PA 2ZVSA 1K9MO 3ITHA 1RTDA 4LT6A 3R1HA 1REVA 4M95A 4HUEA 1LWFB 4X65J 3OYDA 4ZMMA 3VOVA 3VAFA 3Q24A 4KO0B 5L9NA 3KD1E 2DNLA 5KFVA 1R89A 3MM5A 3OL6A 4IH7A 2LEBA 4GKKJ 5ETRA 4DSIA 3M9MB 2HVDA 4HUGA 3IXQA 2M5YA 2OA8A 2GS8A 2D9PA 2IM2A 5GVQA 2QWLA 1V9OA 3CCJS 2MQPA 3TZXA 4B3MJ 3V4IB 1AFIA 2XS7A 5AQHA 3OYJA 2CJAA 3MOJB 4C98A 4YB6A 5JXSA 4JRPA 4EFHA 3ENAA 5F8GA 4Z4FA 2K06A 2OTLS 3M6WA 1TK5A 1Q53A 2WBRA 3T1HJ 2OPQA 3O4NA 4I2PB 4DTJA 4LFBK 4F2SA 1Y3JA 2B4PA 3AVJA 4ZVRB 1FRMA 5AQFA 4GKJK 1S6OA 1WHVA 1FDAA 2AEJA 3ENVA 4NEZA 4DR6J 3VF0B 2QWPA 1FEEA 4OZLA 4CJVA 4IOAQ 4LD0A 1S77D 1S1WB 3P1GA 3KLFA 1O0PA 3GPAA 4X4NA 1NAQA 4KI4A 5AQJA 2VPWB 2AW0A 4Y00A 3PR4A 1GOCA 3AAQA 1K9MT 3KWIA 4USJC 2XLJA 1OVQA 2UYTA 3BM7A 3S8SA 4FXVA 3OS0A 5AQIA 2Z58B 3HVTB 2JEGA 4TYAA 4XAKA 5D4LA 1B7YB 4PWDA 1JCFA 2CGLA 4YOUA 3QFWA 4E7IA 2HFZA 5AZJA 4BWMA 1RT7B 3HRGA 1SJRA 3NNAA 4OI1A 2BRLA 2GMJA 3HHKA 2IM3A 2O8CA 3V1RA 2WTUA 1DLOA 3OVNA 4GNIA 1HRHA 3C65A 1I3AA 2WW4A 2D1KA 3RWUA 2HWTA 4R0EA 2P9SB 2KJWA 2O8BA 1YJWN 1TAQA 2HVIA 1C4CA 1IQTA 1OH7A 1FW6A 2XO7A 1LW0A 1TL3A 2GMHA 4NCGB 3CJCA 3W2VA 1NNDA 2ZC4A 3IWNC 1W0HA 3QAUA 4OKEA 1RAFB 4NEYA 4U8YA 2ZH4A 4MTPA 3FEYB 4IKFA 2EPIA 1JLQA 1WBDA 2L3MA 2V52B 3M3ZA 3HJFA 3RB0A 3QINA 3R8YA 1KVKA 3NWRA 2M52A 5LMNJ 4EHTA 3AFGA 5L39A 1WEXA 1S12A 3C15A 1LOUA 1GLBG 1IBLF 1SBRA 1VQ6N 1ZA1B 2B9WA 3ZT1A 4Q0BA 4WIIA 3EX7B 1ZBUA 2XZWA 1U4BA 1TGOA 3TSPA 4GV3A 2OFGX 1T44A 2YNGA 4BRLA 1YVNA 4KH0B 4USUA 1KTVA 2VYPA 5ETOA 4B1VA 3SAGA 2AEMA 2W7PA 3UVJA 3THXB 3PO5A 4Z4HA 1MMNA 2F96A 3JB9k 2YWWA 3V4MA 3OFEA 1CJUB 4CFAA 4BBYA 1E4FT 4DQQA 5I9EB 1D09B 3O80A 3P45B 5AQVA 1TUYA 2DO4A 4YR0A 1X4CA 2QA4G 1A6LA 4FP9A 5KOXA 3GFZA 2DNZA 2ZWHA 3HKZD 4F02A 3C2PA 3CD0A 1ZZFA 2ZD1B 2PDAA 4RBVA 2O8FB 4WYLA 3QGIA 2IIRA 5G4DA 4WFAL 2Z1IA 1KTQA 2B7CB 2QA2A 2VFVA 2K7KA 3G71S 1SC3B 1MROB 3KK7A 1CPZA 3MXIA 2WK4A 2GHWA 3NMRA 1T9YA 4DV3J 3VTHA 1GMWD 3SUNA 5CR4A 3QZ8A 4OJGA 3I33A 2AF6A 4ZOSA 5GAHP 3WZ0A 1XQSC 1KS2A 4J9SA 4F4AA 2QWMA 2HNZB 3JTOA 4QPXA 5HMZA 2ALYB 5BN8A 1KKHA 2DRBA 4KH4A 2YNFA 2OKQA 4O44A 5D3GA 1Q79A 1APSA 4MO4A 3IDHA 1TL7B 2CPXA 3I9V9 3EEQA 3CCJN 2ZZTA 4DV4F 2R7QA 1IG8A 3MDQA 1XHXA 4Y0FA 2FZKB 3MCOA 1HJOA 3G82B 2RB7A 1P9YA 2P9CA 4LRBA 3SYZA 5J1EA 5A2QU 4K4YA 1U45A 4AFFA 4CBUA 3VF6A 2UP1A 4LQ3A 3HFZB 2A1BA 2OHDA 4TLQA 3IGVA 2IGIA 2GQCA 1Q8LA 4WQ4A 2BACA 1LQ9A 4PXDA 4NXNK 2HZVA 3EJMA 1RP5A 3GP9A 2YQ3A 5J2PB 3DHXA 1VQMS 2AJFE 3BPSP 2L9DA 5ETPA 3QMLA 3NH1A 2ZUGA 3BF3A 4PR6A 3RW6A 1JQGA 2D74B 3I32A 5GAGU 2FC0A 4OYOA 4CO1A 3ULDA 3V9SA 1BD6A 1RK8A 1M5HA 1TZ0A 2XWXA 4LF8K 1FKOA 2XM3A 4JYAJ 4AYBD 2NRWA 2MTLA 1V3SA 2X74A 4EP5A 5K20B 1HW9A 4NLXA 3WHIA 2LSNA 3UDEA 2LQ8A 4PAAA 4C8OA 3BSAA 4CO5A 4ED7A 2ZH6A 2O8DA 3OBIA 4USTA 3QETA 3HSJA 4ZCMA 4QIFA 1VQYA 3P31A 4M45A 3T5KA 4YR3A 4DL4A 1X4AA 3OS2A 2CJ9A 1NM1A 2CNLB 4H4KC 2ZH1A 5T41A 5HLFA 4BC9A 3PX0A 3ILIA 3U3GA 1Q86O 2ZJPL 1V5IB 2EHGA 1NHKL 2MGZB 1IV0A 3EZUA 1LWCA 4AQYF 2KKZA 1DTTB 2EBEA 3KTQA 2VG7A 1IKXB 2RUGA 2BABA 4DX8H 2BJ7A 1G4CA 1ESVA 5HOOA 1KVCA 4DU4A 1IJFB 5EU7A 3L2VA 3KUGA 5ETNA 4H5NA 3GSDA 3IRXA 1V4TA 3KK1B 2ZGYA 2HBLA 2GQQA 1X4FA 4CECA 3RG6A 4N76A 4GMJB 4RUAA 1R0AB 2BOPA 4E1MA 1N6QB 5I3UA 3BB5A 2E2PA 3L2QA 3G86A 4DU8A 1GLLO 3SUQA 2AJ0A 2E44A 3U02A 4QU6A 1VGYA 1W2BM 3CT9A 1UW9A 2ADCA 4AQYK 3L9ZA 1ZYQA 4N47A 4B9UA 2LYVA 4CJ5A 4RW9B 3ICLA 1AYEA 1S9EA 5KPTA 1VK8A 4K4SA 2J76E 2HFOA 3RSEB 4QS7A 4C1NI 2B9EA 4ECXA 5K9FA 2GJFA 2R8GA 1VQ4N 1O51A 2HK2A 1IBKF 3IR7B 4AM6A 3NH2A 2FLOA 4KTZA 4JI7J 1IBMJ 1U0HB 2DNGA 5L1IA 4N7TA 2ZDOA 3EPGA 4URGA 4A47A 4ZPVR 3G71N 1N32F 4B3OB 1TKTA 2M70A 2UU9F 2W6KA 3N4WA 2ASOA 1KHWA 3PHTA 4DUZF 1K73T 2D3ZA 1HNWK 3FE1A 2P51A 2FUG9 1KWMA 2KFZA 4CJRA 1SCJB 1C1CB 3NLCA 8RUCA 3VQ8A 1WB9A 4O0JA 5AQOA 4DR3K 4BQLA 4IYQA 2HK3A 3E3XA 2EWSA 1VK0A 4LY7A 5TKWA 4O8UA 1UWAA 3GWCA 1CULB 1XMOJ 2WBMA 4HEA9 3D45A 1F9HA 1FNXH 1IBKK 3MEEA 2Q31A 2BRKA 3ZZOA 4NO7A 1RHRB 3DXKB 2YWHA 3EN9A 3DLEA 2Q6CA 4JK9A 2YJFA 1N32K 4EAHD 4L3KA 2DR8A 2DISA 5D6GA 3HHDA 3MOZA 1RT1B 3DXSX 4LF5F 4DV6F 2YCHA 2IAJA 2P1JA 4YHHJ 3PJWA 2VODA 5LT5A 1UW4A 3PYEA 1CS4A 4ZTFA 2K3KA 3RR7A 3VGVA 4JI5J 4OPKA 4JUZA 3KWGA 2W2OP 3R7SB 3ZZTA 2WSCC 3MR5A 1QLNA 2LP4A 2HBJA 4WK1A 3PDNA 2SXLA 1GAOA 3GV8B 3B8HA 3HJVA 1RTJA 5JS2A 4ZPTR 3KZBA 5H9FJ 4ECQA 4WU3A 1VQMN 4CJPA 3H5SA 2BX6A 4ZJLA 4CE9A 1RWXB 3Q8UA 4MLHA 4M3UA 3K0JA 1H2VZ 3W9IA 1MWMA 5C12A 2VQFJ 3T6BA 3QIPA 4DOZA 3NGYA 4LF1A 5GMEA 3CC2S 4DLEA 2E2NA 3W8GA 3CIMA 5E3PA 1KVBA 4PWWA 4IFYA 5H1SQ 3GYXB 1HQUA 4H5TA 4RKUC 2VGNA 4CNYA 2KZMA 3BH7B 3GG1A 1CZ9A 4LREA 2F8SA 2DK2A 3ITHB 4ES1A 2HFSA 1RTDB 4ZLJA 2WFBA 4K4VA 1REVB 3MWPA 2YKMA 3KUHA 5C42A 2CJYB 1NJXA 4K5RA 4DQ8A 5L8RC 1PIEA 3SPYA 4HHUA 1VISA 2I0XA 3AH6A 4PYDA 2OSRA 2IA6A 2LLZA 4A8KA 4YP3A 3MM5B 3WXMB 5EHHA 3JAMY 1VLYA 3KG1A 2PD1A 4DSEA 2UUBF 5IWAJ 4IEIA 3TEGA 3K5PA 1NXIA 4C3KA 1R8CA 5HL7L 3AD9C 3WC2A 5F3ZA 3M8PA 3HKWA 4JV5J 2XSJA 1VSMA 2VPXB 4NLCA 4NASA 1KHVA 2OANA 4WFBL 3AVCA 4H03B 1RCOB 4JI2F 4K8ZA 4CFBA 4DR6K 3ULEA 4A8YA 3TI0A 3F2KA 1HX1A 1R0BG 2OPQB 1HPZA 4FJKA 4ATNA 3VWSA 5AQUA 5E3RA 4W4MA 4BRPA 3LANA 3R2CJ 2UUAF 2E5LF 3VF4A 3M8ZA 5E33A 2YKAA 5GAEP 1B64A 1Q7LB 3LF0A 2J0QD 3KLFB 2AIRB 3VZHA 4YEAA 1U1KA 3CMQA 2F7VA 3KHRA 5DM7L 3KLEA 3OXFA 2F8TA 2IDEA 4CZFA 3Q23A 4YS2A 2FVCA 3DCAA 1LCUA 4PWDB 5ADXA 3OJUA 1ZOTA 1LKZA 3FCWA 2AU0A 5AZJB 1VI7A 3CJ2A 3CJ9A 2JVOA 2Z4PA 3J81U 4NXMF 3B4MA 2M9KA 2O8CB 3AD7C 3R1LA 1DLOB 4KPCA 1FTCA 4NA3A 4M5KA 4OX9J 3HBTA 1HBUA 2NRXA 5F8NA 2UUAK 1WAJA 1HKGA 2E5LK 3MTJA 1DBDA 2FHMA 2O8BB 2YKQA 3MR2A 4BACA 2ZITA 4CO4A 2J8SA 4JAXA 1LW0B 2CNOB 1TL3B 4NZ7A 4PKGA 3M1FA 5LMNK 3W2VB 5LL6Z 4CZKA 1SIWB 3CJ8A 4FJIA 3ZSYA 2EKYA 1UJ5A 5JUMA 1JLQB 5A76A 3KHYA 1EX8A 4CJ3A 4B9SA 4CJLA 2I5JA 1REGX 3T1YF 1S72N 1GTHA 2CGJA 4H4MA 2KYZA 4EMDA 4DS4A 2FB0A 1GMWA 3C15B 2XWYA 3P5TL 1VQPS 3LGHA 5KG4A 3MHYA 3P4IA 4Q0BB 4Y2CA 1QAYA 4FWKA 3W60A 3SFUA 3TUIC 1YBAA 4WFZA 2IVFB 2VA2A 4I2QA 2VB6A 2RVJA 3TAPA 5DK5A 2GO9A 4XH4A 2F4VF 3A8JA 3ILJA 1OVYA 4YOVA 4XK8C 2C2KB 3UWTA 5HVFA 2PBDA 3W62A 3OTCA 4CEZA 3OBYA 3GIKA 1LWEA 4MKBA 1RTZA 3UVJB 3E8OA 4K41A 2J5AA 4FM2A 5GADI 1WHYA 4ZVEA 3ETOA 3W3SA 3JXOA 3OYNA 3HHLD 4UF4A 2GVZA 2HS4A 2M0GB 3T69A 1WC0A 5F8HA 4GC7A 1QM9A 4WZMA 1UA0A 5SUHA 4EYHB 5U47A 2E5GA 3BF1A 3M8SA 4DV3K 4GVEA 1IJJA 3I56N 1EZZB 3OLAA 1VRTA 1KDNA 2X51A 3MN6A 3GIRA 1X31C 1O1WA 1FDNA 3CC2N 3S3NA 1T03A 2X1FA 2G2YA 2DFHA 2Q2RA 2HWHA 4UZCA 5K5MA 4KB1A 4G9ZA 2KVQE 4CRJA 1J53A 5D4NA 3CPWM 1O13A 1VR6A 3OFGA 5D0RA 2FJAB 3A2FA 4F67A 3VPZA 4KHPJ 1SIZA 4JI6J 3BF4A 1WC6A 3G10A 3A1YG 3C6HA 2RJZA 2UUCF 3D6TB 2Q0UA 2C1EB 2HHPA 4XIUA 2F8EX 3OUYA 2YNFB 4IJAA 1DQ8A 1XJWB 4BDPA 2G0JA 3P96A 4O44B 3WXLA 3ZSWA 2QWQA 5AXLA 5D3GB 4JV2A 3PW7A 1N5SA 3ATVA 3UW1A 2LQBA 1GXTA 4H8KA 3O8MA 9RUBA 3CE8A 1PG5B 5B0DA 4KGMA 2HIQA 2XNRA 1VC6A 2XMUA 1IO2A 1EIYB 3H7HB 3MUMP 1QSSA 3K17A 4V19S 3SMSA 2A18A 5EOYA 1M5SA 2KRBA 3J7YP 3S01A 1N34J 3TQEA 1DZ5A 5J1EB 3ASMA 5H9EJ 2WCXA 2VV5A 2PN6A 2FJXA 2PA3A 3FNNA 1GLEG 3DLLQ 1J9AA 3NGSA 3HULA 3W5XA 2YBVA 2B4UA 4FOEA 1OS5A 3KJNB 1EQYA 1GT8A 4CT9A 3I5CA 2BV3A 4FYWB 3QEIA 2W7AA 5HI7A 3H2LA 1E3MA 1FJEB 2RKIA 3TVKA 5B0GA 2O01C 1XN9A 2OMLA 3J81O 2E1AA 4W90B 3ISZA 2Q6BA 2Z0GA 1FDBA 3VGKA 2W6LA 3D0GE 4BVOA 3U7JA 5KFKA 1FKOB 1JJ2M 3AHPA 4DSLA 5FDLA 3R1XA 1NSPA 1HW8A 1GFWB 2E2OA 1OQ3A 1D4XA 5H1SV 1W2BR 1J5OA 2MKSA 3I5AA 3MXJA 1S76D 3HFVA 4NMXA 2O8DB 4DSJA 1J5EJ 2NRZA 4NYZA 5K8OA 1XEZA 2GIQA 2G9OA 2H9ZA 2QLJB 1BY9A 4WQ4C 2FSKA 2QE5A 3HD2A 2EEYA 2H65B 5HLFB 5J1NA 3THWA 2JJ4D 4ECZA 4QCLA 4IO1A 4CZGA 5B0FA 3J7ZO 4M5JA 2L41A 2OMOA 3AXMA 1LWCB 2VG7B 4ENOA 4NRTA 1RWMB 1VQPN 3U9DA 2ASMA 3D7SB 4BC3A 3TP2A 5FLXY 1J2VA 3T3FA 5F41A 3EWGA 2E5HA 3DLJA 2HBRB 2B7BB 2MLYA 3QQCD 1XNQK 2MKYA 3IRXB 3EGWB 1UA1A 3GLJA 4I69A 3CWJA 4EIAA 3M5RA 4RWTA 4PKHA 3RMDA 3LA0A 5I3UB 3ZETA 1ZBTA 2B4OA 1MNEA 1YKWA 1YJNN 2ACMA 1BDGA 2G8IA 2XNQA 3K9JA 3EDQB 3O1WA 2ZH2A 3BR9A 2PC6A 2E7XA 4H0YB 1TL4A 5D8HB 3T7ZA 4DV7F 3UD3P 4ISFA 3UDVA 1OH5A 2LCWA 3CVKA 4DUTA 2NUHA 3L3CA 1RZMA 4JI7K 2JC0A 4C23A 1IBMK 3VQPA 1BO5O 5A6PA 1S9EB 2QMUB 2LXFA 5IT9U 1X5OA 3NGZA 3TAQA 4DR4F 1P6TA 3KG0A 5D77A 4RW7A 4J2AA 2FVPA 2ZM6J 5FPNA 2O5DA 1TKTB 3KJFB 1NG9A 2M2BA 5KG6A 4DR5F 5IM0A 4A8XA 3DLGA 3PFEA 3BSCA 2O66A 2D5RA 3O9QA 1XMOK 2A10A 4ISGA 2D0OA 3N01A 3G25A 2AV5A 4TXSA 4PXEA 1ZXOA 1IKVA 4FF2A 1EQMA 3W61A 2YX6A 4V1Ak 2HG4A 2LEPA 1HMVA 3IAYA 3IGNA 1NB2A 3LPUA 4YHHK 4F25A 3MEEB 3SCKE 5BYQA 4L75A 1SQKA 1RTHA 4OV6A 1K8KA 5E5NA 1C0TA 3DLEB 3H2VE 3M4XA 3CCRN 2Y1RI 2QSWA 1JJCB 3OJSA 1RAAB 3KLVA 1X9SA 2GGPA 4N8OA 3VTIA 1NNEA 4TYBA 4DV1J 1Q5VA 2UXDJ 5IV4A 1PC4A 2IAJB 4JI3J 1CS4B 2G8HA 3W9HA 4FJGA 4O0NA 4S0MA 3VQ9A 1MW7A 1T9WA 5H9FK 3U3YA 4LQ9A 2WAQD 1IN0A 2BE7D 1A9NB 1N33F 3CXCM 1RAGB 4DCJB 2ZZNA 4J5OA 1FFGB 2H5JB 1TV6A 3UQSA 3OHAA 1BL3A 4OHZA 2ZEJA 3M2VA 2VQFK 9ATCB 1RTJB 2DRAA 1F2GA 2BW7A 5CHIA 1RBAA 1E6YA 4F4KA 1GLDG 3QB0A 2KB2A 4RLEA 1RBUA 2E4LA 2R9LA 4RO0A 2E6MA 4CZHA 1BE4A 5KT2A 2ASYA 3CJRA 4RUCA 3O9SA 3QIPB 2RQMA 5AXMA 4EU0A 4DV5J 1TVRA 2HHHF 4OI3A 5B09A 4OGCA 4H4OA 4IFYB 3K89A 1HQUB 3SAFA 4DR2K 3RRHA 2VIHA 2RD5C 4DHVA 3THTA 3DWLA 4WFXA 4IJNA 2YKMB 5BN9A 5C42B 2QKBA 5IWAK 4KHQA 1WELA 2P9LA 3GIIA 4E7HA 5C7PA 1RDCA 2NZTA 1WAFA 4DN9A 3I4PA 5A8KA 1S9FA 1AUDA 1OJ4A 4FJ8A 3CFOA 2IM1A 4Y6IA 1UFWA 3AVBA 5KFBA 4OJRA 3NY0A 4WTYA 3I82A 3JTPA 5DG9A 4DQIA 2Z2ZA 3IWLA 4JKHA 5C5JA 3PJ9A 2BM1A 2FVSA 4RPFA 1RB0A 3GCXP 3M8PB 4A8MP 1HJRA 2XSJB 5IV3A 2RS8A 5E7OB 2Q36A 3GR0A 4LFCJ 1HNXF 2OP5A 2P9GA 1WSRA 2XC9A 3ULEB 3W66A 4CI0B 2UXBF 4PUOA 1HD0A 1VSEA 1HPZB 3V6KA 5LXYA 2E1ZA 3DMJA 1NLKL 2LQJA 3ZTSA 4B8CA 1FWKA 1FJGJ 3VAKA 5I3QA 3H59A 2JOQA 4LFAJ 4DTSA 2HRTA 1TR0A 2Y1IA 4DV2F 4CK3A 4OI0A 3B6PA 4B9VA 2IA0A 4WP3A 4HUFA 1BU6O 1WUAA 1RSCA 1ROFA 3KLEB 1IM4A 3E9OA 4PG4A 3VESA 1C2PA 1UEUA 2VH7A 4ECYA 2D0CA 5AQTA 3PUFA 4NYNA 2EK6A 4LUBA 1S1UA 3SQ2A 4OX9K 1HNXK 3B78A 4ANCA 3FGVA 4DV0J 5BR8K 4K0KK 1S0NA 2XMMA 4KAIA 2DB1A 4UOHA 3JYTA 4FPBA 5J2NA 4MT1A 1Y5IB 4KREA 1HBUB 1JXEA 2D9OA 4B3RF 1T0TV 5DS7A 1RKJA 3HHLA 1SL1A 4KJIA 1Y10A 1B70B 5A6WA 2BQRA 2P5GA 3V6DA 2MY8A 4CJFA 3SMPA 3CIPA 1WSGA 1VQ5N 1YLXA 5AFUH 3VQ7A 1M90O 2I1RA 4I7FA 4HT5A 3SCJE 5T7LA 3J7A1 4H5RA 1X3MA 3WUHA 3G0ZA 2DT9A 3GCWP 1QQNA 1HI0P 3HDSA 2I5JB 2BUPA 4OPHA 4H4MB 5F2RA 3BO3A 3PW5A 3CPWR 4JI0J 2DY4A 3VAGA 1QHAA 3RBXA 2E2QA 3VAMA 4FJ5A 1L5UA 1BIZA 1OKJA 3H45C 4O5FA 2J0XA 4RBTA 2MJUA 1VRQC 4I2QB 2HZCA 4DTUA 1YJTA 3KMQA 3NGUA 2IVYA 4RNMA 1AROP 2XB2D 2K3IA 3D28A 4ZP9A 2GA7A 3PIOL 4YOXA 2EFNA 4J9LA 4V19X 2J7UA 3K2PA 2NXNA 4U7CA 2WSEC 4PYAA 3WX4A 1IKWA 4O3SA 1LWEB 2Z1GA 1VBKA 4OPJA 5D4OA 4LF9J 2VQEJ 1H2TZ 4F50A 4RBUA 2IVMA 1NZAA 4LF7F 1RDWX 4NRUA 1X5TA 1B3TA 4TU9A 3PYFA 2GIFA 4QR0A 1SS6A 2GVZB 1WF2A 2BZ2A 4LF6F 1D3WA 5HQ8A 3ZSQA 1B7FA 3RGIA 4ZA1A 1VRTB 1VSHA 1M90T 4QW8A 2DIVA 4ZPDA 1Y64A 2QEXS 2YHBA 1T03B 4OLPA 4JNEA 1T95A 5LOQA 2W2MP 1RAEB 1HBNA 1VQNS 4MIBA 2RE2A 2E1YA 2JEFA 1KN6A 4DU7A 2HBYB 3RW7A 2DNRA 1U1NA 2NYHA 2GCFA 3N5BA 4M63A 2R7VA 3PW4A 2QXFA 1RT6A 1TUVA 2MY7A 4CLTA 1VRUA 2HNDA 4WKYA 2HBZB 4X65F 4ERDA 1NGJA 3ALYA 3U1NA 3R3TA 3MR7A 3OLBA 1JJ2R 3T5JA 5B08A 2B8QA 4DU3A 5C2CA 4I6WA 3DLRA 3OUYB 2ZJRL 4DDFA 1SKSA 3V9ZA 3NNHA 3MI7X 3SIPB 4RW4A 1WSHA 3CCES 3IR6B 4ZVTB 1X4HA 4U7UK 1N34K 4FLWA 4UOFA 4N77A 5B7WA 5AZIA 4R0JA 1N52B 1DARA 4EYIB 2VFUA 4K4XA 7FDRA 2AYEA 5FIIA 4Q7AA 2DY1A 2IOCA 4DG1A 4KR0B 1SC4B 2GO8A 1EB0A 4BR9A 3K0SA 2B5JA 2QA4N 1NGCA 2V94A 4RU2A 3SAHA 3KK3A 1OY9A 4J9VA 4A8FA 4QQBA 4F26A 4M5HA 1CVJA 4M3TA 3Q8YA 4KRWA 1I94F 2CQDA 4JRQA 4ZTJA 3FEXB 2FTRA 2H51B 2VL1A 4DL2A 3KG4A 4U96A 1ATRA 4RG8A 2CPFA 3PW2A 3CCMN 5K8PA 4OHWA 1HLWA 4D3HA 1ZZNA 4FPAA 2RKIB 4OYXA 4K43A 5AQPA 1RT2A 4K42A 1S6PA 2V0NA 4DL6A 2I7NA 3NG8A 3OXGA 3CULA 4C2MA 3M32A 1WACA 5FDLB 1RAOA 1RGVA 4DR7F 3AB4B 2DHGA 2QRRA 3O9UA 1I94K 2E1MC 3BR8A 1MDUB 2VF3A 1J5OB 1PBUA 5KT7A 4J91A 3PKMA 2Q79A 1K0TA 5DDPC 4YDDB 3ZTOA 3QWPA 3KFWX 1NPPA 2K7JA 5ETTA 5GAHI 5C10A 4WF9Q 2F40A 5KG2A 4ZVUB 1R0CB 2NRVA 2CQGA 2QC3A 4NOHA 3CETA 3QWUA 1Q9YA 3THWB 2GNKA 4A57A 1VQ9N 4B1UB 2OSQA 5F8JA 4Q5VA 4RCHA 3F5TA 2C3YA 5E0OA 2RUSA 1FRJA 4DR7K 3N9UC 1Q81T 3TX8A 1M1GA 1X1PA 3OHRA 4BRAA 1PAEX 3JSYA 3JSBA 5KRTA 1WF0A 1WJ9A 2Y3YA 2F9DA 4CM0A 4KHUA 4PPDA 1RGIA 3MPWA 1NHVA 3OTOJ 4GVBA 2XBPA 3ZETB 4USIA 2HRYA 1RHKB 5CD4H 4X62F 2ZH8A 4JEPA 4GO5X 4ZLNA 1MWYA 3LDSA 3AA5X 1LOTB 1PJ6A 2RPIA 4HWIA 3N6NA 3BBCA 3V5RA 3QJJA 1X60A 2FF6A 3PXGa 3KIOA 1T6DA 3TYTA 5GADU 1S0VA 4BC7A 4IOCL 2R8HA 1NDKA 4F04B 1GMVA 3SNNA 4JKDA 2ZM6K 3LP0A 1NPRA 2P9PA 3TA1A 3Q8RB 3PIPL 4JN4A 2CJBA 3FCHA 3VGTA 1TTHB 4HTUA 1FO1A 1S3XA 1KP6A 3R7BB 1QUVA 2ZHAA 4RW7B 1UPMB 4JOUA 2PAVA 2QEXN 2GUIA 5AQWA 4ZP6A 3MXHP 2ASJA 8ATCB 1WKLA 4FWMA 5IZHA 5IM0B 1BQMA 4OIXA 3OQ2A 1FNMA 1YTAA 3DLGB 4Y2MA 1ITGA 2QWRA 4X4OA 4M8LA 4FJ9A 1M5VC 1GLAG 3A3NB 3ZZ0A 1IKVB 1SV5A 2EKNA 1G1XA 1HMVB 2DPNA 5FRMA 1Q18A 2NYIA 4DV1K 4PEOA 4HVJA 1GQEA 5KFHA 5CZXA 4MFBA 4JI3K 3FSIA 1R43A 2W40A 2XYGB 3MX5A 1RTHB 2GMLA 1K8KB 1TU0B 1C0TB 4YY3J 4PPZA 2NRRA 3M9NB 2R7TA 4DTXA 3OVSA 4X4VA 4HCBA 2GGPB 1E6VA 1CQMA 1NK0A 4FW1A 4JKGA 2ASLA 2QYGA 2KHCA 3OBWA 2IRYA 1UVKA 5JVHQ 3VETA 2DGXA 2P5OA 2KHDA 2A41A 3JXUA 3HXMA 5E3QA 4PA1A 1IXKA 2HLUA 2OAUA 2EW9A 4PHTX 3G6YA 3ZT3A 1H98A 1TV6B 3CO9A 2RIJA 3M2VB 3V6HA 1KOHA 3NNCA 2F3JA 5AE1A 3OA9A 4ILMA 2A6AA 3AA4A 1GXUA 1KD1O 1E6YB 3DU6A 2E6LA 2C3UA 2VDIA 2PSZA 3HP9A 4PG5A 2DEJA 3K8VA 1QDUB 2P5VA 3VQCA 2HURA 1NH7A 3AAPA 4DKWA 2E29A 4IR9A 2GIRA 4UQTA 1TVRB 4FVUA 4CTAA 4UY8T 3X1LB 3A4TA 4H4OB 1FJ7A 2YKOA 3EXYA 3ILLA 4CVNE 3CCQN 1XMBA 3K5LA 2RRNA 4I0WA 3MEDB 3KNAA 4P2XA 4A46A 2J6SA 3OW2M 2ZHOA 1RADB 2P9LB 2QZ8A 2CH6A 1WSIA 3BV8A 1ASUA 2D0BA 5A8KB 3PHEA 3OY9A 4KY3A 2D3UA 4B3TF 3M6UA 3SUOA 2BJ8A 3S7RA 4A8SA 3ZTQA 2EWHA 2YHXA 4LFCK 2HS3A 3HZGA 1MSWD 3MM9A 3OYHA 3DXBA 3R5JB 3PG9A 5IC4B 3GJSB 4QOZB 1UETA 1I39A 1G6BA 3T9NA 2KZZA 3CW2C 4XPCA 4U8VA 4TY8A 5ETKA 1HBMA 3AVIA 3QJPA 5B0AA 2R7XA 2NXJA 3O3HA 3VQAA 2ABYA 4LFAK 3D66A 4R79A 1F6TA 2KRRA 3PSIA 1XC3A 2MMYA 3OSPA 2WOMA 2R7WA 3G87A 4PUOB 5HN0A 1KD1T 2MKIA 2QWOA 3DMJB 2FBXA 4FWSA 4QYZJ 3QESA 1IH7A 3VAHA 3EY1A 1W97L 1WOQA 2P2CB 3HF5A 4ZN1A 2NQPA 3BSOA 1TMMA 1Q82T 1PJ5A 2A2CA 4FZYA 3SJHA 1S9GA 3ADAC 3D3BJ 1VIOA 1VLOA 4X2BA 4HI2A 3HI0A 5HQMA 1Y4ZB 2HOEA 2L08A 1S1UB 4L74A 1NGHA 1MN9A 2LKZA 2XS2A 4ZPWR 4BRFA 4KHNA 1EHWA 2VJVA 3KUEA 4OYMA 1KVIA 1EO1A 5KI6A 3CCVS 2EFGA 5B0BA 4ETZA 3ID6A 3ZZYA 3JYTB 2IJNA 5J2NB 2G1DA 3IM9A 1NK6A 3V1OA 5L1LA 1SJFA 5HO4A 2IJFA 1NJIT 1FX2A 3W5YA 3EPIA 3HHLB 2VJUA 2BDPA 3V6DB 4JI4K 5A2QY 2UVVA 1S0MA 3C6AA 4DUYF 1AW0A 1CZBA 4WWSA 2BKNA 2Q0RA 3AV9A 4ED8A 4I7FB 5T7LB 2PMWA 3QSYB 1ASWA 4KT0C 2DNOA 2R2UA 3S9HA 3A8EA 1N5QA 3TZYA 1S6QA 2WUSA 1X0PA 4DB3A 3CCZA 5E3CA 4FLZA 3KMSA 2CQ4A 3CJ1A 3HOTA 3FJ2A 3G6ES 3D1OA 2VFTA 1ZPWX 1IKYA 4LF9K 5HQLA 2VQEK 2BJ9A 1R31A 3CJ3A 4EUVA 1SVDA 4J2DA 1IBLJ 5HANA 5M2RA 1T9VA 4MQ3A 1HNVA 1Z2ZA 1Q16B 4A2BA 1IKWB 4USHA 4M3RA 3HHLC 5GAEI 2LECA 3TAFA 3R5GA 4A8QA 4BC5A 4NCBA 4E7LA 5HRPA 2PFUA 1ZH5A 2GZOA 2QLBB 2JSXA 3N4PA 1L3SA 3OYGA 3FZFA 3J80O 4ED5A 2HQIA 3B6OA 1I51B 3TUJC 1RAHB 4L76A 2FJVA 4LRAA 1VSKA 4A8WA 3OV7A 2CPDA 3SV4A 4NZ6A 1HBNB 1NGFA 4OYPA 3LUYA 5BPLA 4HHTA 4ANEA 2RNEA 2YX7A 2AX0A 3A5MC 3O8WA 3CCSN 3KNGA 4LMZA 1RT6B 2JHEA 3NMAA 1VRUB 2HNDB 5DRKA 1ZM9A 1HR0F 3G6VA 4OHYA 3VEXA 2FHKA 1B9FA 3CIZA 4Z2XA 1G99A 5KT3A 3HPHA 4DLGA 1KXPA 2D1CA 3MM6A 5ETLA 4USWA 2FSJA 4RW4B 2MSSA 1JX4A 4BY9C 4AHTA 4M94A 4J8FA 5CZ2A 1JNZB 5AZIB 2EFVA 3EKUA 4YORA 4JI8F 3QT8A 5LSRA 1FE4A 3RUBL 2ASDA 4B1WB 4DG1B 3KK2A 2NRTA 3LAKA 2R3VA 4QWDA 2B5JB 2ERRA 1KSPA 3FQKA 4PQAA 3GIJA 3KK3B 4FF1A 1D8YA 4DV4J 2J9DA 4QJVA 5AQKA 1I3OB 1NRKA 5BYSA 1M0SA 3CJSA 4FJHA 4M3YA 1NHUA 4CH0S 4QR2A 3ULHA 2GWJA 4M63C 1F9EB 2FLPA 3OVBA 2HFUA 2HSEB 5HMYA 2VC1A 1YJ9S 1RT2B 1S6PB 2DR6A 4DPXA 2Z2MA 5HVGA 3CJ0A 4C9DA 3IUCA 3FRZA 2BH1A 2PO4A 2VBYA 1ZBHA 1FWLA 2OLWA 4MYUA 4KB7A 2CQPA 5DLFA 2HQ3A 4QAGA 4CGDA 2CQ0A 3M32B 3CCVN 1Y11A 2FJEB 1S7HA 3CDEA 2O67A 3AVLA 2DPJA 3M2RA 1Y5NB 3L7PA 3E51A 1ZPVA 3VZIA 4EZ6A 3D2EA 3M30A 2H3GX 3WNHA 4EO8A 2V4QA 3TANA 1DKGD 5LJVA 2R7UA 1WEYA 5KG1A 1VSLA 3KK1A 5M1PA 1AUSL 5BXIA 3DDNA 4E3SA 3A13A 3FK4A 3SK3A 2HRUA 4NE9C 4ZJOA 2E66A 2PT0A 4CP5A 4I56A 1JB0C 5F8IA 4DSKA 2JGUA 4L3QA 4NYOA 2F9WA 4IH6A 1HWLA 3QDKA 4Q8FA 1JWWA 1L3UA 2XHBA 2FHOB 2CYYA 1A5WA 4OFZA 2YXLA 3ZO7A 4RNNA 1TKXA 2O1PA 4H0TB 3P4UB 3H4DA 2YHYA 3MM8A 4AL6A 2DTJA 3M9OB 1FA0A 1KBRA 4K4WA 2RH3A 2XULA 4B9MA 1YITS 1FHTA 4AQYJ 2PEHA 2F5GA 2N3LA 1RFQA 4CH1A 4K25A 5DZ7A 3EMTA 1U1PA 4GVBB 5AJ3F 2MEWA 3DI6A 1MMDA 3OR2A 5KG3A 1X5PA 4MKYA 3QJLA 4PZVA 4XH1A 5E3AA 3OTEA 3ZTPA 1BA1A 3W9JA 4CFDA 4CLLA 1XUPO 1YJ7A 1DQ9A 2DEIA 4BR2A 2BR0A 3R9LA 1R59O 3D6MB 4O55A 4FBTA 3LP2A 3E1YA 2AYGA 3D9BA 3LP0B 2P9PB 4ELUA 4FF4A 1HI8A 1CLFA 4DF4A 2LXIA 1VS3A 1VC0A 3UD5A 3JAMU 4A5AA 2PMZD 2CQ3A 1SJ4P 1M1KO 3PEJA 2YWKA 5KFFA 2RHSB 2IVNA 5HJXA 5ETSA 5LMUF 2JFKA 2HYIB 4BRNA 2CIMA 3KJVA 1R8BA 1YG0A 3HZEA 1QZ5A 4OJ3A 1IBKJ 3CI5A 1BQMB 5FJ4A 1XQIA 3I96A 3JQKA 3LALA 3UNGC 4P10A 1BUPA 4OGEA 1CSJA 1N32J 3GONA 2E7VA 4JHDA 2UU9J 2HBMA 1XMQF 2B51A 4YY3K 4FPIA 1P8ZA 1SV5B 4U67L 2ZJQL 4A5BA 4JI6F 3TR5A 5KFRA 4CHOA 4DUZJ 4K4TA 2DGVA 2VA3A 4NMLA 2X3DA 2BBEA 3L7UA 4ICLA 4MFBB 1V3ZA 2W8LA 3O3GA 3OW2R 4F8RA 3MAQA 5CABA 1GLJO 4KV8A 2NLXA 1HQ2A 2V2ZA 3I87A 5K14A 3ZZRA 1VSIA 1E6VB 4JKGB 2BE9B 5CZ1A 3J81Y 1ZAVA 2XMJA 4F4WA 4MKAA 4LBIA 1OY6A 4H54A 4CLPA 2OTJN 4YOWA 2IVOA 1FRLA 4OYAA 1XMQK 1KC8T 2MKCA 1SKUB 4LF5J 2D3OR 4IOBA 4CJSA 4WFNL 3P5BP 5KFJA 2XY5A 3UDCA 2AGOA 3PY8A 4YOTA 2YWEA 1YJ9N 4H0XB 3BEGB 4ZVGA 3MN5A 4ED4A 4ED1A 3DRYA 1IWGA 2HHUA 2KDOA 4IOXA 5F8MA 1Q7YO 5DQHA 2UVWA 4CTAB 4UUWA 3UKUA 4FYVB 1M1HA 4P71A 5J1PA 4LSNA 3GYNA 3U1LA 4KHRA 2H48B 2BEFA 3VEYA 3D3CJ 1YJVA 3C8YA 2ZH3A 5F0UA 4ZVQB 3FLCO 2CPIA 2BQ3A 4C3MA 4FWPA 4J9NA 1QSYA 2XY8A 1S10A 4FS2A 2ZGZA 2AGPA 1FESA 5GAHU 1Z6RA 3FGUA 3MM9B 4MMOA 5T14A 2ROEA 2QK9A 3RAMA 1HNIA 4NLGA 1WNSA 1T3VA 3V9WA 1HL6A 4TY8B 1HBMB 3D0HE 4M5LA 4U9RA 4K5SA 1OH8A 1S97A 5IC6B 3DC2A 4QYZK 4O8KA 4FWQA 5ELZA 2UUBJ 4IG0A 4MKVA 1FX4A 3LPEA 2JVRA 3BS9A 2D3O1 4IKAA 4JKCA 1S1TA 4CEAA 3CCUN 5DO2A 3MZIA 2NXEA 2WOMB 2DH7A 3OFFA 1N48A 1O6XA 2ZNZA 1YITN 2F63A 3AT1B 1GLFO 2IM0A 3BBFA 3QEPA 4LRCA 4DPWA 2FQQB 1NKEA 4NLOA 3FZ2A 4TNOA 1Q5YA 2B56A 3L3UA 3OL8A 5TKYA 4B1ZA 5KT4A 4JI1F 4IOAL 2JDJA 2WBNA 1S9GB 3GJTB 2ROPA 1QY7A 3B54A 4ZP8A 2UUAJ 3MMJA 2AQ4A 2ACYA 2E5LJ 5AQGA 4LR8A 4IH5A 1IBCB 3NEKA 2R7RA 4C8KA 4CZMA 2AX1A 3MMAA 1UCNA 3OR1A 3O9TA 2HEKA 2XHWA 1AXQA 1S4EA 2V69A 3PEHA 1UVMA 2YWFA 1IUJA 5KFZA 2VG5A 2K8GA 3NMUA 3BSNA 1GX5A 2Q3SA 1Z25A 4CWBA 1BOTO 3FC9A 3QT5A 1TQLA 3Q8QB 1EWQA 2VOPA 2RAQA 1KOOA 4NXMJ 4KHWA 1BWVA 5IQQA 2WSFC 2ATCB 2KXHA 5AQSA 3W7BA 3AD8C 2EC0A 5LJ3Y 3D6HB 4KIAA 3OYLA 1JNRB 2W42A 4WE1A 4FYDA 4OX8A 2CG8A 4ZHRA 3K7RA 1FD8A 1Q8BA 1S6QB 5HJYA 1IBLK 2L9WA 2CDRB 3SSQA 3H90A 2R8KA 4AM7A 4Y2IA 4DX5A 2CPYA 3TUZC 4ECTA 4BG9A 1RA6A 1U25A 1UJ4A 3ZT4A 3T1YJ 4F4XA 5D0EA 3MM7A 1XR7A 4PG6A 4KI6A 1IKYB 1HWKA 4PG7A 2XCAA 3MPDA 1JLFA 1FKPA 3NCPA 4OLOA 3E2EA 4BRHA 4P73A 3CF5Q 1OSCA 3NGDA 1W25A 1P9QC 2J9EA 1HNVB 1RDDA 4OYZA 1Y3KA 3MPVA 1ACMB 4KAZA 2ZUAA 5JVGQ 1XNRF 2PEBA 4ID5A 3U1MA 1QQCA 3OL7A 5KGWA 3WEEA 4CJKA 3M05A 2XI3A 4DTMA 2F4VJ 4P2FA 5EWGA 5F9NA 2CQIA 3SBMA 3DGVA 4RU9A 3BZQA 4NLYA 3OPKA 2OPRA 3BQ0A 3EE8A 4Y2KA 3SEOA 4NLTA 1OYEA 2R8JA 1T9XA 5I3PA 3I8BA 3SBTA 5T7BA 1S1VA 3RRKA 3SQ1A 1RWOB 2A6OA 3ZNUA 2BMBA 2J9CA 2QL9B 3TWZA 1P1LA 5M1QA 1EP4A 4JBCA 3CERA 2W8KA 3A5LC 2V67A 3HPGA 3ZT0A 1YRTA 1YTUA 2E5JA 4RNOA 4DV5F 3G2XA 4P52A 2LQ5A 2XMKA 4A2AA 1VQ8S 1BWEA 4IRDA 3CCTA 3QZ7A 2OTLN 4AE5A 4ZJQA 2DTUA 3D68A 5FLXU 2V51B 2W9CA 1VSFA 4EEYA 1UVLA 3RBEA 1RCHA 4LF4F 2CPJA 5DG8A 3BGRA 4X64F 4OV1A 1RBVA 2PY5A 2HHXA 3BZCA 4IFEA 3WX8A 3OHBA 2OGUA 3MM6B 4YQWA 3QIOA 2XGQA 1HNZF 2V8PA 2WVEA 1NGGA 3NGKA 4K8RA 3M6GA 1VQSA 3HT3A 3UB5A 2OCEA 1FE0A 2J7KA 1X4EA 1Q8IA 3PM9A 4W5RA 4FKYA 4DV4K 4E1NA 1JLGA 2HFNA 3POTA 3G8SA 1RACB 4M7YA 5IT9Y 3MFIA 3UN3A 1KLMA 3NGTA 3RBZA 3KK2B 5CAAA 4QOTA 3W63A 4OZ1A 1NKBA 3H20A 1QAIA 5CYMA 3UCGA 1F2HA 3WT0A 2HBQB 1FTRA 3CJ4A 1T02A 1UFLA 2VFRA 2IJRA 2E1CA 5EY4A 2MKKA 3UO0A 2WZ1A 4I1TA 1T8EA 3NS6A 4B17A 2W4CA 5LSOA 1CBKA 3P3DA 1NK4A 1ZAXA 3ZSXA 4X4TA 4CJ7A 2MKHA 2UUTA 4BVPA 4ID8A 4K8XA 4ZPAA 3NOCA 2N3OA 3O6WA 5AQRA 3OYCA 1SQGA 4DMZA 4URSA 3A3PB 3G4SS 1U8SA 2G0CA 2D0PA 1BGXT 2YH1A 3Q22A 2EG2A 4MAKA 1W7WA 2GC8A 4DV0F 2IDLA 2KI2A 5EWFA 2CA9A 3N4QA 4BR7A 4UOGA 3DOLA 3M2RB 3CM6A 1WI6A 4YB1P 1NDLA 1KVJA 1ILYA 2ASPA 3D2EB 1NMEB 2G13A 3M30B 2A42A 4L6V3 3UR3C 5D4PA 2IIHA 3NCRA 4AXJA 1YSJA 1MLAA 3CGIA 1N88A 5M1FA 5DM6Q 4AD6A 2V5HG 3SJJA 1WTFA 2C22A 1WDDA 3OS1A 3JS9A 2W9AA 3AA9A 3DFEA 4A61A 3QERA 1XNQJ 2XS5A 2HSTA 4O3PA 4ZP7A 4C8MA 1C1AA 1K44A 1V5VA 3ISND 1JMTA 1TKXB 1VBZA 2N7CA 1RI7A 1V6HA 3MM8B 4Y3CA 3L95X 5F0WA 4KGVB 2O4GA 2XCPA 4U7BA 1FF2A 4JI0F 2H5IB 4QIGA 4X66F 4KYZA 3SI6A 3KKFA 4UW2A 3GG4A 2AJQA 2KLAA 2FVRA 2KHOA 3FR0A 4NB4A 4P74A 4E0DA 3F0NA 1AZSA 1TL1A 3NFAA 2VGMA 1YX2A 1KQFB 1Q86T 3DI6B 2RDIA 3HHNB 3OR2B 4Q2LA 3H25A 3QPIA 1GLCG 1WOOA 1UJ6A 5DLGA 2JWKA 3EYZA 3VEVA 2P9IA 3S41A 4FXWA 4TN2A 5KFXA 2HGMA 3MTKA 2ETJA 4NYFA 3WNEA 3CDAA 3BZKA 5BJRA 2OEJA 5GAEU 1RDBA 2AA4A 2HS0A 1ITPA 2QL7B 3J81j 3PZPA 1NU4A 3W65A 2AYBA 2MLZA 3LP2B 3CMAS 4CCHA 2DH9A 3OYEA 2HGNA 2W01A 1K8AO 4DV7J 4CF9A 4QU7A 2B9XA 3O3LA 3CJ5A 2KFNA 3ENHA 1V4SA 1EKRA 4HTJA 4HHJA 5CHCB 5A2QO 2AP1A 3NCIA 3KJVB 2UU9K 1FRKA 4NLVA 3QEVA 4DR4J 2BA9A 1EWRA 4Z4GA 1N54B 3HM9A 2JRSA 3HSZA 3L3VA 4DUZK 1VQ8N 4ELTA 1N36F 4A48A 2Q97A 4B3SF 2FGCA 1WC4A 1YAGA 3TNVA 4JHDB 4Z4EA 4DJBA 5CE3A 4TU8A 5AQQA 4DR5J 3NP5A 3NL0A 3T6JA 5KFGA 3J7AN 2Z56B 4IEEA 2RDDA 3BY5A 3ILOA 1Z2LA 1EETA 3AO3A 1HWUA 3I5BA 2COLA 5ADXH 1UZHA 4ICLB 4ILLA 4KV8B 1WI8A 2BKOA 3VQ4A 4QIVA 1EX4A 5K14B 3QMQA 1L3TA 3QGHA 4LF5K 4DV6K 3PNIA 2FZCB 2AZ3A 2UXCF 4NI2A 3NAHA 3QBCA 3PRVA 3WDOA 4WXWA 2A40A 3MPYA 3GV7B 4OJHA 3DOMB 4JLHA 1D8ZA 3P83D 5L1JA 3CHWA 1HQEA 3VQDA 1D9DA 4R5PA 5EDWA 3VMFB 2GV9A 3NXZA 3HI9A 1ULRA 4DR2J 4ZPBA 2RMLA 1WUUA 2PZSA 1N33J 2VOOA 4E98A 4CZEA 3IMXA 3JSMA 1BMQB 2CH5A 1WLJA 2Y8WA 1RE1B 2DHSA 2CZ9A 2C42A 1URRA 2Z2LA 1XIQA 1BUXA 4DR1F 3ID8A 5J2MA 4FBUA 1S7IA 2UXCK 3UKUB 2RN2A 4WU2A 4LSNB 2XTJP 1WTBA 3ZX2A 4CHQA 3FRYA 4IO9Q 1RHQB 4K59A 4CLKA 5DETA 3N28A 2VD3A 1UP1A 4J2BA 3DLBA 1UTAA 2MZQA 3AO5A 2IHR1 2HHHJ 3W0LA 3AARA 1U7LA 3D4JA 1ZM3A 3T1AA 3N6MA 2CQHA 2LU1A 2NXCA 3K5NA 3DRSA 2UUBK 2AWZA 4NLBA 4DN0A 1UAXA 5M1NA 1QHTA 1FRXA 4FZZA 2HQCA 1G7CB 1HNIB 1UAWA 3JTNA 2XHCA 1N56A 3TABA 3UI3A 1VBYA 4TQSA 5DQIA 3PV8A 5C2GA 3UFCX 4IG0B 4JI2K 3DM2A 4TSXA 4QS8A 4DXLA 1RWKB 2JEJA 5EN1A 1S1TB 3FQLA 1EXQA 4C0OC 2WVDA 2A0FB 3EVMA 2XMVA 2AP6A 3ZNJ1 4OZNA 3BKTA 3L4IA 3PO4A 1HNXJ 2X78A 4LRDA 1J27A 5BR8J 4K0KJ 4M3WA 1I5OB 4EWTA 3LM2A 2VZ9A 3J7YU 3QT7A 2UXBJ 4AT1B 1WSVA 3OTOF 3LAMA 2LA4A 2OPPA 3V2UC 3Q0AA 5F0XA 2W2NP 3UN2A 2ZC3A 3W3DA 3G6XA 4RNFA 3M8RA 2FPHX 1QE1A 3VGMA 2BJ1A 3I9ZA 3QT6A 2CQCA 2J0WA 2MQ8A 4DV2J 2CG4A 3P5JA 1EKEA 4FJLA 4RW8A 3MMAB 3OR1B 1FFSB 3CMAN 4NA2A 5HBMA 3MMCA 4NXMK 2VG5B 5HMWA 2GX8A 1X4BA 1YF5L 3SLCA 5IFMA 1YRXA 4I9QA 1T7PA 3VN5A 4GO7X 5F1XA 1YBUA 4FW2A 4HHHA 1HIYA 5HK4A 3UKRA 3G8TA 2NRHA 2CUYA 3FEZA 4GV9A 2QSFA 3HMJG 4KFBA 4CDIA 5KPRA 2MKJA 4RWWA 2MSTA 1IR1A 4WCEQ 3L4BC 2BJDA 1SH0A 3TW0A 3EGVA 4J2EA 4PL8A 3TTFA 4CJTA 3MCAB 3T1YK 4WE1B 1YJWS 1NH8A 2Q1NA 4ZHRB 2I9SA 3VEWA 3M2UA 3P38A 3CJQA 2U2FA 1ZBSA 1YGYA 3FCVA 5C15A 4CHYA 3U9ZA 4J9RA 4QYRA 2DGQA 1X3NA 4P9SA 4DTOA 3F56A 2I6WA 5KT6A 3MM7B 2CQBA 4AHVA 3OFHA 3H5XA 3IC1A 4NWBA 1JLFB 5HATA 5JMVA 1FKPB 1H7WA 2F4VK 1YUWA 1B0PA 3RB6A 1XK8A 2MZTA 1NGIA 1NSQA 3KYLA 2FVQA 3L2UA 3H42A 1VQ6S 2IMOA 3SQOP 2BGGA 3LZIA 4ID5B 3QLHA 2ZH9A 1KCFA 2LVWA 2IRXA 3IN5A 1Q0NA 3L0QA 4BR0A 3WEEB 2DCLA 4HL9A 2WB1D 4I67A 1C0UA 4OKJA 2AJ4A 3TOQA 4DS5A 2OEKA 4H5VA 2YI1A 1S0OA 2CKWA 3SDEA 1GOAA 3L2RA 2ZNYA 2OPRB 4J9KA 1P90A 2DNMA 2AYMA 3NE6A 2R2SA 4ZIVA 4LF7J 4B02A 1LV5A 5AQXA 1T3OA 2ZH7A 1NK7A 1S1VB 1H72C 1NB7A 4XEIA 2ZFHA 1FK9A 5IOLA 2F8MA 3I55S 1NK9A 1EP4B 4LF6J 3RRGA 3G96A 2E9RX 1C0FA 4E89A 3O08A 3GL1A 2GQ2A 4Y34A 3NF9A 2QMWA 4A4JA 1W7AA 2VG6A 1VFJA 3VR1A 1HFEL 3DRPA 3IBCB 2BJ3A 3Q7CA 1SJ3P 5DZ6A 1PYTA 3D6RA 4BE0A 2W9CB 2UUCK 4G1PA 3QIDA 3W2WA 1U0SA 3BGRB 3P8BB 1U1QA 3AOCA 1U04A 4C8LA 3JSRA 1FD2A 1NGDA 3K58A 2VBZA 1RQ0A 2KJVA 3E9LA 4CF8A 1WORA 1VYAA 3FZKA 4PRFA 3RMAA 3BO2A 1DEJA 4CF2A 4LFBF 2V9KA 4Y1DA 1JLGB 2IYGA 3POTB 4ES3A 4OHVA 3ZX3A 4GKJF 3MDFA 4KGXB 2HZAA 1GEHA 1KLMB 2MZSA 4DBQA 2RILA 2NSCA 4OLAA 5CYMB 2GTDA 2XY7A 1B4SA 4C3LA 3AOBA 3AO2A 2U1AA 4FLUA 4L73A 2DFEA 2VASA 2EI5A 2LXUA 3DLLL 2QM1A 5AQNA 3H2UB 2OUGA 3V1QA 4CZLA 4YMEA 1DT9A 2HAIA 4LC9B 4HACA 4ZVOB 3HTVA 2BUNA 2VKZG 2QA1A 1I94J 3FVYA 4HTLA 4EGLA 1HD1A 1NMDA 1NO8A 4FZVA 2IC3A 1RBOB 4FLTA 1QS4A 3WC0A 3Q83A 5KQDA 3TAGA 1GTEA 5DGBA 3BN7A 3O44A 1AB8A 1BC6A 2O4IA 2V4JA 2QYCA 2J0SD 3GIMA 4FWOA 2FYXA 4CK2A 1OQ6A 3J8AA 1ZTWA 3D7EO 4W5TA 3Q8VA 3SZ2A 4W98A 3DOLB 3IMQJ 2KG1A 3PLAA 5D78A 3MECA 1GOBA 5CXTA 3L8BA 1NK8A 5AE3A 2HVEA 2X6SA 1OH6A 1VDHA 4DR7J 3D2WA 3R3LA 2MQMA 2JFDA 7FD1A 1QZ6A 2KT5A 5KFOA 4NPOA 1WC1A 3GMGA 3F73A 4OLBA 4JS4A 4PG8A 4ILJA 4JV0A 4BC2A 2DKOB 4NLSA 2F9JA 5L9XA 1W26A 1VHFA 3SSSA 4IG3A 3AVGA 4BS2A 3EE3A 1A5XA 4C4WA 4CEOA 2ZBQA 2MHEA 4FJ7A 3C6TA 4G6VB 3O2IA 5DG7A 3D2FA 5EXWA 1ZM2A 2D41A 5F8LA 4EHUA 4QBUA 5ETMA 3EGZA 4GMKA 1JLEA 3ZSZA 2M7SA 4RX6A 1SKWA 3PX6A 5D0HA 5DQGA 3HM8A 3J80Y 1HARA 1AZSB 2F8HA 3LDOA 2XRIA 1TL1B 1S5ZA 3EM1A 3SSRA 3J7ZT 1Z05A 2HMIA 4Y65A 3CJKA 2CXEA 1RDUA 3R5BA 2IVPA 2G8WA 4PKIA 2ATQA 1RA7A 2JWLA 2P9IB 3H5UA 4DV7K 3D0PA 3LW5C 3H46O 2E1RA 2HW3A 3LPYA 3QGGA 4WFAQ 3R6MA 3NDKA 2YX1A 4X62J 4KH1B 3QRQA 2FHJD 4BRGA 4G65A 1XC9A 1U49A 4MK8A 2B4VA 1DTQA 3WXJA 4DR4K 3NF8A 4AHUA 1NGAA 1SAZA 3RMBA 5CCLA 2B3TB 3LDQA 2E7WA 2ZWPA 2IBOA 2RE1A 4KGKA 1P27B 1NGBA 4FJJA 3I55N 4FCYA 1KONA 4CZJA 3M8YA 2HQDA 3OTBA 4OJ1A 2OYQA 3KLIA 2MQOA 2KU7A 1SH2A 1NCLA 4DR5K 4AL7A 1RHUB 3FKBA 1CG2A 4DPYA 3OSNA 1X4DA 4J7CA 3CJAA 3ENQA 1VQ4S 1Q9XA 3OXLA 3AVNA 4NLRA 4FDFA 3MUTP 4HT7A 5I42A 4FK2A 3V81A 1ICEB 3O4WA 4XDDA 3V9UA 5L46A 2NPFA 4FL9A 1H73A 4NZ0A 1NJZA 2WVCA 4QS9A 1ASVA 3H98A 1SUQA 1EETB 2R8IA 4Z4IA 3TWHA 1FXXA 2WVFA 5THWA 2FIUA 3BPDA 3T19A 1U2RA 4U6PA 2K1RA 4DHYA 1YT3A 3ZFVA 4N41A 4BE1A 2FC8A 3IFEA 4HVZA 2IYIA 3TARA 1K1QA 1X9JA 2I2YA 4NXNF 3GQCA 3PFOA 4NI2B 4OHXA 3BBBA 1BQXA 1FNOA 3FFIA 3MEDA 2Q66A 1NOYA 4KPYA 2PI4A 1N33K 3VALA 3HPOA 4BG8A 2HBKA 3CFRA 1SKRA 3HO1A 1HQEB 3MR6A 4BLGA 4R5PB 1FXDA 1DQAA 2JLGA 1S4FA 2DHXA 4O3NA 3AJDA 5LJ5Y 5JICA 4LF8F 1B0VA 4USKA 4C11A 1IWAA 1NPKA 2UVRA 3HVRA 1TELA 3JSMB 4ZS6A 1CJKA 1PSDA 3LDPA 4CIFA 2KVIA 3A8IA 1J6ZA 1U2CA 4WQ5A 1UFKA 3M6XA 5KG5A 2B43A 2HHHK 4WTOB 2OEMA