2IAJA

Crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with atp
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
551
structure length
551
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Clinically Relevant Lys103Asn/Tyr181Cys Double Mutant HIV-1 Reverse Transcriptase in Complexes with ATP and Non-nucleoside Inhibitor HBY 097.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H (p66 RT)
total genus 142
structure length 551
sequence length 551
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2iajA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iajA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iajA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iajA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2iajA05
4MK8A 3BQ1A 2B43A 3CJ0A 3OYIA 3OHAA 4NLOA 4BWJA 4ZP9A 4J9OA 4F8RA 5KT4A 3GV8B 4DF8A 3ZT3A 2D7SA 2OPPB 3P83D 4F4KA 4O4RA 2ZE2A 2QKKA 1C1CB 2ASJA 4EP4A 4R8UA 2YKNB 2P51A 3AVBA 1KFDA 3SUOA 2R8IA 1JLCB 3DRSB 3AA3A 1KSPA 2IC3A 4ED2A 4C8MA 3LZIA 1T03A 3OYJA 1LWFA 1TV6B 3ICLA 4DTUA 1D5AA 4PQUB 4DQPA 2UVVA 3OL7A 3QLHA 2UVRA 5C42A 2FLLA 4HCBA 3V6DB 5KGXA 3KLIA 3GIIA 4FLYA 1RT7A 3O4NA 3ISNC 3CJ3A 4EEYA 1S0MA 3M9OB 1RDBA 4FVMA 2OZSA 4KHSA 5J2PA 2JEFA 1HMVA 4ZHRA 4BDZA 2X74A 3Q8RB 2IDOA 5EDWA 3MEGB 5DGAA 4I2QB 3OS1A 1S48A 3HPHA 1QSLA 3UR0A 4CGHA 3V1RA 4I2QA 4J9MA 1VSEA 2FLNA 3KLFA 2F8EX 1KVAA 3DRRB 2YKNA 1BISA 3ZSVA 3VQPA 1C1BA 1RT1A 5CYQA 4HUFA 3V1QA 2JEGA 4CJQA 1ZBHA 1RT1B 5CYQB 1EP4B 3OSPA 2WOMA 3DDKA 2O4IA 1S49A 3DI6A 5JUMA 3OS0A 2D0AA 4Y1CA 1SKWA 1T7PA 1LWEB 3TAFA 4AHVA 1JL2A 1QE1B 4DU1A 3V81B 4LSNB 4KHWA 5CZ2A 3TAGA 1TKZB 3AO2A 1T03B 2IM0A 2BQRA 1FXXA 1FKPB 3MR5A 3I0RB 3V4IA 4ED0A 5KFPA 2ZQBA 1O1WA 4CEZA 2R2RA 1B9DA 2ZKUA 5KG5A 4CEOA 3SCXA 2WTFA 4IG3B 4K4YA 5J2QA 5F8JA 1RBTA 2IBKA 4DTSA 1TK0A 3KLGB 1MU2B 1VSFA 1IO2A 3CG7A 1LV5A 3TAMB 2R8KA 1X9WA 1NK6A 1KLMA 1L3VA 1CZBA 2I5JB 3NBPA 4CGGA 5KG3A 4DTRA 3QIDA 3M8PA 2PYLA 2BQUA 1NOYA 4AHUA 3Q8QB 2IAJB 4MKAA 5F9LA 4JV0A 4FK0A 1RT3B 5DK5A 3GIKA 3K59A 4B9SA 2YKMA 4ECUA 4OL8A 4LSLB 1U47A 3UDLA 2W8KA 2VA3A 4DL4A 1NK0A 3SUNA 1EX4A 4ZVHA 2R2SA 2YNFA 5I42B 3LP0B 4IR1A 3HYFA 4RNHA 1A5XA 3NGZA 1NJYA 3HJFA 4MIBA 4DTMA 4FJKA 2XO7A 4K4UA 5KFCA 4DSIA 4CFBA 3PO4A 4J9KA 2IS3A 4FJJA 4MK9A 2HNYA 4NCAA 4DTNA 4RW4A 4O3SA 5KFGA 1A5WA 4M3TA 2DPIA 3QETA 2RDJA 3SZ2A 1S6PA 2R7YA 3N6NA 3AVLA 3F9KA 4B8CA 4RUCA 2XY5A 3V1OA 4EO8A 2R8HA 3BQ2A 4FJIA 2C2RA 4J9RA 1C1BB 4ECVA 4DLEA 3AO3A 5KRSA 3M8PB 2IM1A 1ZBLA 2J6TA 2XHBA 1CLQA 5T14A 1UWBA 4KTZA 1YTUA 1IH7A 5SZTA 3QNOA 5KFZA 5C25B 4NLVA 1K1SA 1GOBA 3DLKA 3KNAA 1EETA 4IBNA 1N5YA 4IG0A 3U6FA 3ISND 1HYZA 2GC8A 2ASDA 1LAWA 4CJSA 3BQ0A 3V9UA 2RF2B 1YTAA 3D45A 2YNFB 3S9HA 3BGRB 3MF5A 2XY6A 2IJNA 1HQEA 4IFVB 4ZP7A 1GX6A 3DOLA 4CHQA 4B9MA 3RB4A 2AWZA 4NRTA 1C0UB 4KI6A 3C6TB 5DG8A 3DYAA 2OPRA 3TAMA 2JEJA 4RW4B 4CHOA 3SV3A 2QE5A 1RT5A 1RT3A 4TXSA 1N4LA 1IKYB 3QEXA 3JYTB 3GQCA 3RWUA 2FVSA 1ZBIA 4E7IA 1BL3A 1JLFA 1NKCA 1EP4A 2OPPA 3DM2A 4KFBB 4JV2A 1WSEA 2JGUA 4WZQA 2YHAA 3HKWA 1RDAA 1JLAB 3VQBA 1KTQA 1QS4A 2P5OA 1R0AB 4OKEA 1EETB 4I7FA 4QWCA 3M8RA 2HNDB 3VN5A 1R0AA 4Q0BA 4L8RB 4RUAA 4WFZA 4Q5VA 3SFUA 1JLBB 1NK7A 5F8IA 1S10A 3QINA 4N76A 3VQCA 3RRGA 2FBVA 1RT7B 1JXBA 1NK9A 3LPUA 3VQSA 3DOKB 4KAZA 3NGDA 4CIEA 4URGA 4RW8A 1C6VA 2Z1GA 4FZYA 1TVRA 4EP5A 3HVWA 1RYSA 3KK3A 3QEPA 4OGEA 4DFPA 4NYNA 1JLGA 3M9NB 1U09A 2KFZA 3KK2A 4WYLA 3M9MB 2RKIB 4CJEA 4WZMA 3B6PA 1J54A 4N5SA 4ELTA 4WE1B 5KFXA 4Q45A 3KHRA 1HPZB 2FVCA 1BQMA 3MEDA 1BCMA 2Z1JA 3OSNA 4FLTA 3KK1A 5JXSA 1T8EA 1U04A 4NLRA 4M42A 1UWBB 1S9EB 3DMJA 5HRPA 1S1TB 2KZZA 3UPFA 1JXLA 3QIPB 4KAIA 2UVUA 1SV5B 4DU4A 3DOKA 2XY8A 3RR7A 1S6QA 2IC3B 3FDSA 1ZBFA 1I3AA 3OYDA 4KPYA 4F4WA 1SUQA 4ED8A 3T5JA 5L1KA 4IRKA 1RTHB 3VQ8A 3H2LA 1RT2B 4Y1DA 2RF2A 3QNNA 1S4FA 3TAEA 3QLHB 4DSLA 4NLXA 4C8NA 4Z4GA 3I5BA 4IH5A 3LWMA 2ITGA 4LH4A 1B92A 3MEGA 1S0NA 4DTPA 1MU2A 2W9BA 2BANA 4KRFA 4NRUA 3N6MA 1NK5A 2F96A 3G86A 1T94A 4N56A 3K5NA 1RTJB 5J1EB 3RAQA 4DL5A 5KT2A 4W5TA 1S6PB 4XPEA 4DS5A 3DRPA 4OVLA 4QOZB 1S1TA 4IDKB 2VG5B 3PR5B 4DQRA 2BGGA 3V81A 4I7FB 4YQWA 2D3ZA 3L2QA 1REVB 4ECWA 1RILA 3KIOA 3LP1A 3V9SA 3DI6B 4CF9A 1LWEA 3SFGA 3OYMA 4KO0B 1JXEA 1XC9A 4DTJA 4UQGA 2VWKA 1J5OB 5HP1B 4G1QA 5KFBA 3IS9B 5KFEA 1VSIA 4CE9A 1J5OA 4FCYA 4G1QB 1XI1A 1ZTWA 4CHZA 4F3OA 3CJ5A 3TARA 3BSCA 3CJ4A 5F8MA 3VQDA 1ASVA 3KJVA 1RBUA 3KHLA 3LAMA 5HLFB 3RAXA 4TYAA 1ITGA 1C0TB 1ASWA 1WAFA 4QWBA 2HB5A 5J2PB 3KKSA 1VSJA 3KLHB 4B9VA 5KFTA 4EBCA 4Q8EA 2IAJA 1YVUA 1KLMB 4E3SA 4CHPA 1UA1A 3KLFB 2I5JA 1VRUA 3FQLA 4C8OA 4E7LA 3AVNA 1L3UA 2A1SA 3LP2A 3HVRA 1HQUA 4CEAA 4QPXA 2W7PA 4RNMA 5K14B 3RMDA 3LP3A 4CF0A 4C8LA 1TL1B 3JSMB 1WNSA 3KD1E 1D1UA 1RTHA 4M3XA 4W5RA 2HHWA 2PY5A 4K4VA 4DWIA 2B6AA 4JS5A 3N6LA 4FBTA 4EZ9A 4RU9A 4F50A 3OYGA 1SL0A 3AVGA 4M3ZA 4E0DA 4XO0A 3KHGA 3RMAA 3AO1A 4IFYB 3RR8A 2G8UA 3IG1B 3GV5B 3RB0A 2O5DA 4CJFA 1EKEA 3FQKA 2YNGB 3KLVA 2R2TA 2HHVA 3S3OA 4WE1A 1WSHA 3V6DA 2WOMB 2XCPA 5L9XA 4NLQA 4CESA 1Y97A 1HNVA 4Z0UA 3G0ZA 1S1XB 4M3RA 1KHVA 5KFJA 4CJUA 3ITHA 3NCIA 1RT4B 2NUBA 3LP2B 1DLOB 2UUWA 1SH3A 2XCAA 4LD0A 2FBYA 1RDRA 3I0SB 3L2WA 4XIUA 4M94A 3VQQA 3S3NA 1TVRB 1U45A 1S9FA 3GILA 5J2MB 2XY7A 2OPSA 3KLIB 4CJ5A 2JC1A 1LW2A 1MMLA 3KLGA 2Z1IA 1L3SA 1T05B 3KJVB 5KI6A 4DEZA 4I9LA 4HUEA 3SI8A 4IR9A 1RTIB 1ZETA 4X2BA 5HRSA 1JL1A 1X9SA 1U48A 1JLCA 5HBMA 4J2AA 2FJXA 2E9ZA 2RKIA 3I8DA 4K4WA 4CCHA 1NJXA 3MECA 4E89A 3RBDA 3DM2B 4KFBA 3H40A 1YT3A 3MR6A 5CZ1A 4RNOA 3LP0A 5C24B 3E51A 4CHYA 3AVFA 1HYVA 4NZ0A 4MFBA 1ASUA 4DSJA 4CEEA 3L2RA 4Z4IA 2IGIA 5DLFA 3SPYA 4DG1A 3QIOA 4ELVA 3DLGA 2FJWA 3EPGA 4DS4A 2ILZA 4E7JA 2WB4A 3ZT2A 4ED1A 3PUFA 5KGWA 3QZ7A 3DLKB 4RW6A 2GV9A 3AVHA 4RW9A 1B9FA 3RRHA 1TL3B 1VK0A 1VSMA 4ECXA 3RB6A 2JEIA 4F3TA 1VSKA 3ZSZA 3OYLA 4CGIA 3CWJA 1FKOB 1U4BA 3CFOA 1D9DA 2KQ2A 4DFJA 4YNQA 2E4LA 2G8VA 4B9LA 1CXUA 1NKEA 1LW0A 3L3VA 3SUQA 3MR2A 5DMRA 3NF9A 3DLBA 2HHQA 3AVJA 3T5HA 4FJ9A 4CJRA 3OYAA 1IKXA 4PWDB 1WNEA 1U49A 2QK9A 1LAVA 4FBUA 1J9AA 2W8LA 3MXIA 2F8SA 5T7BA 1RDDA 1DTTA 3HSTB 1EXQA 4AILC 1N56A 1TAUA 1S9EA 1S0OA 1UAXA 3TAPA 2DFEA 3OJUA 2J6UA 5DLGA 2FVPA 3BDPA 3CM5A 4MFBB 3AVKA 3QZ8A 1K6YA 3CQ8A 4OLAA 2D0CA 4K4TA 4NYFA 2YNHB 3DRRA 4AHCA 3VQ9A 1X9MA 3WNGA 3NH1A 3MEEB 2VG6A 5L1IA 2BRLA 4G3IA 3QGGA 5J2NA 5DG9A 4ZPAA 3RMBA 4CK2A 4RW8B 4KB0A 4E1MA 4KSEB 3AO5A 2CJQA 2UUTA 3HXMA 1IKVA 4TY8B 4DTXA 4DSEA 2BE2A 2BR0A 2C22A 4TY8A 4EYIB 3KD5E 4OLBA 1LWCB 3G6XA 2V4QA 4Q8FA 2GIQA 4W5QA 4FJ5A 2ZD1A 3OYKA 2XC9A 5C24A 4E7HA 3AA4A 3VQEA 3IGNA 4NLSA 1KHWA 4AHRA 3T5KA 5SWMA 4O55A 5KFYA 1BHLA 3VA0A 3BSOA 2A1RA 4PY5A 1TL3A 2ILYA 4R5PB 2XGPA 5F8NA 5KT7A 2OYQA 4K4ZA 4FZZA 3PHEA 1QUVA 2IJFA 4U6PA 2ASLA 4JS4A 4K4XA 3THVA 4HCCA 2D3UA 1JLGB 2XGQA 3NGYA 4M95A 3V6HA 4DU3A 4KV8A 1IKYA 3LP1B 3CDEA 1S9GB 1SH0A 3H98A 5EWEA 4CIGA 3G10A 4RNFA 3AVIA 2G8IA 3DYAB 4U7CA 3LWLA 1D8YA 4NLDA 4BDYA 3PW5A 4PWDA 3MR3A 3EPIA 1XR7A 2HVIA 3BSNA 2V0NA 3U3GA 1ZYQA 3NFAA 4J2DA 4FJLA 5KFNA 2BANB 2D5RA 3AVCA 4URQU 2AU0A 4CJWA 4JUZA 3AA5X 3OHBA 2WCXA 4F4XA 1XHXA 3ITHB 4EZ6A 1JKHA 4RW7A 3HVTB 3VQ6A 3ZSRA 4ZVGA 1RTDB 1S5JA 4FW1A 4EBDA 3EZUA 1TKXA 3E01B 4YR0A 2F8TA 3KHHA 1DTQA 2WONA 2XI2A 4K8ZA 2R8JA 3SI6A 1HYSA 3TI0A 4M3UA 3SV4A 4OPKA 3I5CA 1HQEB 2VG6B 3HPGA 2Y1IA 3PW4A 3OL9A 3H4BA 1JLQB 4GVMA 1VRTA 4WYWA 2WHOA 5KG1A 2GBZA 3NH2A 2AQ4A 5KFFA 1TGOA 4BE0A 1JLAA 2D41A 2VWJA 2C2DA 1TKTB 3PW2A 2ALZA 1KVCA 1IM4A 4M45A 3HK2A 4KO0A 4FM2A 1XR5A 1NKBA 1BIZA 2AX1A 3WNFA 1Z25A 3OYNA 3HHKA 1BI4A 3HT3A 3ZT0A 4HTUA 5CYMA 4HVJA 2YKMB 2IOCA 3SQ1A 1TP7A 4GC7A 4EO6A 4DSKA 3H5YA 3SNNA 1DTQB 1Q9XA 3HM9A 3Q8PB 4FLZA 4RG8A 1RA7A 4JRQA 3RB3A 1QAIA 1WSIA 4JLHA 5I3UA 1T3NA 3A2FA 2HVHA 1RAJA 3WNHA 3IRXA 4O44B 4TQRA 4O3RA 4TYBA 4CGDA 2VG7A 4KTQA 3FFIA 4KHNA 2XI3A 4EBEA 2KFNA 4AHSA 4MK7A 5DQHA 4W5NA 2Y1JA 5KFRA 5HBMB 2BQ3A 2X6NA 4NLGA 2HHUA 5D3GA 3M8QA 5KRTA 3H5SA 3IG1A 4QAGA 1CXQA 1RTIA 5KG7A 2OPQA 1RBSA 1WSFA 2W7OA 2HMIA 1K1QA 3BREA 4MQ3A 4YR3A 2VG5A 4ECYA 4CEDA 2Q3SA 4DL7A 3K2PA 2G8WA 4YP3A 3DLEB 1CSJA 4BDPA 4Z4EA 1TKXB 1HRHA 4IG0B 3LPTA 3E01A 4B9TA 5FDLB 3P5JA 2X78A 1NHVA 1VRTB 4IG3A 5KTQA 1SL2A 4EYHB 4BE2A 4F2SA 1D9FA 4QW9A 1S1WA 2HNZA 4ECTA 2FC0A 1JLEA 4MKBA 4FJ7A 4QWEA 3KLEA 3LANA 3ZSXA 4FK4A 3QIPA 3HPOA 4FJNA 3NKYA 1QHTA 5EUHA 1C0TA 5KT5A 2QXFA 5CYMB 1OS5A 4CJLA 1TK5A 1FK9B 5EU7A 4KHRA 3C6UA 4ECRA 5KFAA 4DG1B 3SQ2A 3PZPA 4RW7B 1TV6A 4WXOA 4ZMMA 4H54A 5HROB 4FLVA 4KI4A 2HNDA 4ID5A 3SJJA 1BIUA 3NF7A 4ID5B 1TL1A 3JSMA 3ALYA 3TABA 1RT2A 4DL2A 3QEIA 1YVFA 3K5MA 5KFUA 1NK8A 3GIJA 3GYNA 4KKOB 3OLAA 2ATQA 5EWFA 3FFIB 4E19A 1RT5B 3NAEA 4ZHRB 4IKFA 1VSLA 3QEWA 3OL6A 3D0PA 1Z4UA 5L1LA 1RBRA 4Q44A 2I1RA 2BRKA 3O3HA 4IKAA 2FBXA 1RT6B 4O0IA 3MEDB 3IN5A 4CK3A 4CEBA 4FYDA 3L8BA 4CJKA 3DLGB 2FLPA 2EX3A 3CJ2A 1NOZA 4CJ4A 3L2VA 3QO9A 2E9RX 3NF8A 4DL6A 4IQXA 4KB1A 1HNIB 4O4GB 1IKWA 4RW9B 4K50A 3C95A 5FDLA 1SH2A 2OA8A 3VQ4A 4TQSA 1RCHA 4FXDA 4CJPA 4H4MB 2C28A 3WNEA 1SV5A 5KFDA 3MTKA 5KFOA 3KLHA 2LSNA 5KG2A 4F4ZA 3QERA 3O4QA 3P1GA 5DG7A 2E6MA 4CF2A 1HYSB 4CEFA 5EWGA 3G6YA 5KFMA 1GOCA 1TKTA 1KCFA 1HPZA 1QQCA 4B9UA 2YNIB 2B5JB 1LW0B 3HP6A 1JLEB 4FJXA 2B5JA 5CY4A 3CYMA 5KFHA 1S1VB 3PX4A 2IMWP 1JLFB 1C1CA 5KG0A 4N47A 4AH9A 5HROA 3H4DA 4FS2A 1Q8IA 4FJ8A 3PX0A 3ZSWA 1L3TA 3CVKA 4ECZA 1VSHA 3H08A 4URSA 2JC0A 5KFVA 4QWAA 2E9TA 3VQAA 4DMNA 3C6UB 4IDKA 2PZSA 4DFMA 1NNDA 2GUIA 4ZPCA 4KTWA 3EY1A 4BACA 3ZSQA 4DL3A 4CF1A 4ICLB 3T19A 4O3NA 4IH6A 3RBEA 2HHTA 2DFHA 4ICLA 2HMIB 2DY4A 4J9LA 3VA3A 2DPJA 2W9BB 5HLFA 4I9QA 3HL8A 3ULDA 3LALA 3EYZA 1FKOA 1QAJA 2HNYB 3AVAA 1TKDA 3KMSA 1IG9A 4IOBA 1KRPA 3HP9A 4DFKA 1A5VA 3M8QB 3KMQA 4Z4HA 1N48A 4HUGA 3SUPA 1GOAA 3KTQA 3MECB 4FJHA 1RNHA 2ZE2B 2R8GA 4ECSA 1NJZA 2DTUA 3MFIA 1GX5A 3Q8SB 2W9CA 4ZVEA 5F8LA 4O4GA 5KFSA 1HARA 4KHMA 4BE1A 5FRNA 4WFYA 4TN2A 5HRNA 1KVBA 3C94A 4OPJA 4PUOB 4NLTA 4NCBA 4OJRA 4LSNA 3CDWA 4NLUA 4CFAA 3PVXA 3NGIA 4FW2A 3PW7A 4GW6A 1WSGA 2IA6A 3PJWA 4NLWA 3OVNA 4YMEA 2RN2A 3KOAA 4ZTJA 5KG4A 3SQ4A 3O3GA 4H4OA 3UIQA 1Z26A 1T05A 3IRXB 4O44A 4H4OB 4KHQA 3ZT4A 3KK3B 3SYZA 2ZD1B 4KHYA 5KFKA 4ED3A 4FJMA 5F9NA 1S97A 1XWLA 4LQ9A 2BE2B 1HNVB 2XWYA 3DLRA 3L2UA 4B3OA 4YR2A 3NMAA 3LAKA 1I6JA 4CF8A 4K8XA 2WRMA 1G15A 3K5LA 4ZVFA 2OPQB 4QW8A 5C42B 4DF4A 1JKHB 2E6LA 2HHXA 1TKZA 2G8KA 2FJVA 4O0JA 2HWIA 4MIAA 1ZBUA 1Q9YA 5J2QB 3T5LA 5HP1A 1TAQA 3PW0A 2YNHA 3PV8A 4J9QA 3ZT1A 1QTMA 3M8SA 2UVWA 1D0EA 1JLQA 3AA2A 4ID1A 4O3OA 3QESA 3L3UA 3I0RA 3V4IB 3QGIA 2RDIA 2HWHA 1J53A 3D28A 2OPSB 3CO9A 4FZXC 2FVQA 4ZP8A 4TY9A 1N6QA 1S9GA 4OKKA 4IFVA 1N6QB 3NF6A 1F21A 4N41A 4IH7A 4CJVA 3CDUA 4K4SA 2KZMA 4FLUA 2O4GA 3ASMA 2Z1HA 4J2EA 4ZP6A 2KTQA 1IKWB 3EZ5A 1N5YB 3AO4A 3NBPB 3CIZA 1JIHA 3BSAA 1LWFB 4KBIA 3H5XA 1S1XA 4W5OA 4LQ3A 5D3GB 3QEVA 1S1VA 4FLWA 5DQIA 1BGXT 3T1AA 3CFRA 4CK1A 4F4YA 1FKPA 4H8KA 3PJXA 5DQGA 3ZCMA 4ED6A 1RYRA 4NCGB 1JLBA 4WXWA 3PX6A 2OZMA 2W9AA 3FSIA 3HVAA 3MAQA 2B4JA 1CZ9A 5KFIA 1WLJA 5KFQA 3T3FA 1LW2B 4I2PA 4Y2CA 4J2BA 4ELUA 2GIRA 4RZRA 4B3OB 2CKWA 4O5BA 1XR6A 4JRPA 3IGVA 1W9HA 4DTOA 1IKXB 4ZTFA 2G8FA 4DQSA 3AV9A 3QYYA 3NAHA 4J9PA 1KLNA 1L5UA 4Z4CA 4QCLA 4O3PA 2FBTA 3OL8A 4B8AB 3K57A 1DLOA 3QO9B 5DGBA 2X6SA 2KW4A 1BQNA 1HMVB 3F73A 1I39A 1HJRA 4ZPBA 4RW6B 4DLGA 1ZTTA 2V9WA 4FM0A 4FLXA 4B08A 4TLRA 4MH8A 4E7KA 2WK4A 3V6JA 3VQ7A 4KE5A 2ATLA 2OH2A 4M41A 3PO5A 3V9XA 2AGOA 4IFYA 5J2NB 4GMJB 1SKRA 4CJ3A 5C5JA 3O3FA 3V9ZA 4CIFA 3MXJA 4Z4FA 2B6AB 2R2UA 3MXMA 1TK8A 2W9CB 4KKOA 4ECQA 2D0BA 2AX0A 4LH5A 3JYTA 4YFUA 3OYEA 4XPCA 2VG7B 3LDSA 3TAQA 3V9WA 1HQUB 2P1JA 2C2EA 4LY7A 1NHUA 1FK9A 5JS1A 1UA0A 1QSYA 4LSLA 2WONB 3KK1B 3QGHA 1LWCA 3TR8A 2G8HA 1QE1A 3BJYA 3DRPB 2RPIA 3HO1A 3TWHA 3BGRA 4KB7A 5F8GA 2HW3A 4H4MA 4ZPDA 4NLPA 3FRZA 1S1WB 2HNZB 4FS1A 3U3YA 1C1AA 1RBVA 3KK2B 3RMCA 4NLYA 5KT6A 2P5GA 2ETJA 1NJWA 5I3UB 2HHSA 4B9NA 2IM2A 4KREA 1SKSA 2YNIA 4J9SA 3RTVA 4PA1A 4JV1A 4R8UB 3CM6A 3V6KA 2VA2A 3UQSA 4M3YA 4Y34A 4Q0BB 4PQUA 4PUOA 1DTTB 1C2PA 1W0HA 1WSJA 3DMJB 5HRRA 2PYJA 1SL1A 4R0EA 3MFHA 4HYKA 1BQMB 3OYCA 2BDPA 3DOLB 4WFXA 1KFSA 1JX4A 3NDKA 5K14A 4KV8B 5KT3A 4Q43A 2QKBA 3D5MA 1X1PA 2AGQA 5FRMA 2AGPA 1S1UA 1RTDA 3NL0A 2IM3A 2EC0A 5I42A 1UOCA 2EHGA 4KHUA 4AHTA 4CJTA 3LZJA 4CERA 2XRIA 5JS2A 3TANA 3MEEA 4ED7A 3BR9A 4FM1A 3B6OA 1RT6A 3TVKA 2YNGA 1C0MA 1RTJA 1IKVB 5J1EA 3PY8A 4F2RA 2YHBA 2DFFA 2AJQA 3KLEB 4CHNA 3OYHA 3OS2A 3TQ1A 5KFLA 5C25A 1BI4B 3SQ0A 4GC6A 1TQLA 4DQIA 4RNNA 2V4RA 3I0SA 3OY9A 4DQQA 1BCOA 3H5UA 1S1UB 1WAJA 2J6SA 1SUQB 4TSXA 3DLHA 4IRDA 4R5PA 3ZSOA 3IS9A 4CGJA 3CFPA 5FROA 4BWMA 3H59A 4I2PB 1C0UA 4O3QA 2QV6A 3C6TA 3AVMA 1RDCA 2OPRB 1W25A 5KG6A 3GV7B 3OYFA 3K5OA 4FK2A 3NHGA 5J2MA 5E41A 3GIMA 4CEQA 2JLEA 4QWDA 4C8KA 3DRSA 3ZSYA 4IRCA 3G6VA 1WN7A 3NH0A 2W42A 4OKJA 3OLBA 3NAIA 1BQNB 4CGFA 3SPZA 3VQ5A 3NE6A 1QSSA 5KFWA 4OGCA 4HHTA 1VRUB 1HNIA 3KKRA 3HVTA 3OJSA 4CECA 2HAIA 4CFCA 1RT4A 3K58A 4DSFA 2FVRA 3IAYA 1VSDA 3S3MA 2YV0X 1NK4A 3DLEA 5F8HA 4M3WA 1S6QB 4Y3CA 4NYZA 5L1JA 4FJGA 4Y2AA 1REVA 4CFDA 4E1NA 1RA6A 3I5AA 1XHZA 4HKQA 4J9NA 3PR4A 3OYBA 4NCGA
chains in the Genus database with same CATH superfamily
4MK8A 1LFPA 3BQ1A 4NXMF 3MI7X 4U7UK 3CC2N 4DJBA 4DV5J 3OHAA 3VAJA 5HVGA 2CH5A 1RXOB 1RU1A 3D9BA 4BWJA 4J9OA 4X64J 4AD6A 3GV8B 3ZT3A 2CDRB 5FPEA 2H4YB 2QKKA 2FZGB 5HL7L 3ZEUB 1U2CA 4R8UA 3EGZA 3SUOA 3FE1A 2DNGA 3DRSB 5EHHA 4C8MA 5FJ4A 1WEZA 4K0KJ 3ICLA 1PKUA 3POTB 2J7KA 2UVVA 4F67A 1N34K 2B4PA 2FLLA 2V9KA 3V6DB 5KGXA 4FLYA 3QBCA 1RT7A 2AA4A 1CJVA 2V4JA 2VH7A 1UVJA 4KHSA 3OD2A 1I94J 3Q8RB 5EDWA 2MSTA 2FHMA 5D4PA 4CLKA 3V2UC 3AY0A 3OVBA 5AXNA 4RBTA 3TW0A 1KVAA 4NXNJ 1OYDA 2VL1A 1PCAA 3V1QA 2JEGA 3MOJB 3TZWA 3JXUA 1RT1B 1EP4B 3OSPA 2WOMA 3DDKA 4QR2A 2OEMA 3O9TA 3SMSA 2HVDA 1SKWA 1KEKA 4AHVA 2LQ8A 3DNCA 4JI6F 4H0YB 4CZFA 3CJCA 4KHWA 2HGMA 3VF0B 3US5A 2BQRA 2IM0A 1FKPB 3MR5A 3I0RB 4ED0A 1VHFA 5KOWA 2AIRB 3CCLS 1O1WA 2DCLA 2ZQBA 2VBYA 4WFNL 1NRKA 4HWIA 1NGGA 3GOIA 3SCXA 5J2QA 2PFUA 1VSFA 2PIIA 1URNA 5IXUA 5FD1A 3L6QA 1H72C 4CGGA 4A2AA 2VFSA 4DTRA 3M8PA 2MKKA 3QFPA 2IVFB 2A3ZA 4WPAA 4DR5J 1OPIA 2C2NA 2JRSA 3GIKA 4R0JA 4CZGA 2CAJA 4B9SA 2QLBB 4ECUA 3L09A 4ILJA 3W8GA 4YB7A 5E33A 3UE5A 3UDLA 2W8KA 1OQ3A 4OZ3A 1U8SA 3SUNA 5BN8A 2RQKA 3POTA 1VQ7S 4ZVHA 2C2ZB 2YNFA 2B9WA 3G25A 1YJWS 2P9GA 1R3NA 1H7WA 2YQ3A 1NJYA 1A5XA 4ISEA 2Q66A 1DFDA 1V4SA 3CCVS 4YEAA 3VZHA 3M4XA 2DNLA 4FJKA 4DSIA 4CFBA 1H0HB 2Q43A 1B0TA 4MK9A 1K44A 2HNYA 1RQ0A 2IIRA 4DTNA 5KFGA 1A5WA 2AJFE 4P10A 3M32B 3QICA 4OX6A 3N6NA 3AVLA 1H38A 3PACA 4RUCA 2XY5A 3OR1B 2R8HA 4TNOA 2P9NA 3S7RA 4FJIA 1WTFA 2C2RA 4J9RA 4FWOA 4M63C 1V5VA 2A0FB 1OMSA 1ZBLA 3TWZA 1CLQA 5T14A 4LRDA 2HHPA 1RAEB 2UXCF 2VUGA 1IH7A 2B9EA 2M0GB 5C25B 2JH3A 3KNAA 2E2OA 5A0YB 2YHXA 1N5YA 3ISND 2AHOB 4HDHA 4ZLLA 2KB2A 2GC8A 4Z7YA 4CJSA 3BQ0A 1XBWA 5F0UA 4JKGB 1P1TA 2C3MA 2RF2B 1YTAA 2YNFB 3BGRB 2XY6A 2PMZD 4JI4J 3A1YG 1HQEA 2HG4A 3B4MA 1GX6A 3DOLA 4CLYA 5B0EA 1C0UB 1QJHA 2OFGX 4QPTA 4JI2J 2G0CA 2GMHA 4W90B 2JEJA 4RW4B 2M3DA 3SV3A 1HL6A 3PIPQ 1RT3A 4TXSA 1N4LA 2VQEF 3D3BJ 3GWCA 3MMAA 2CWKA 1BL3A 1UW4A 1UVIA 2JGUA 4I1TA 2YHAA 3HKWA 3HI9A 1JLAB 1BD6A 1K0VA 2P5OA 4JI0K 1EETB 2MMYA 3CJQA 4GRSA 4X65J 4JK8A 4WFZA 2YX1A 1VQ7N 4PG7A 4WWSA 1Q53A 4I64A 4DUYJ 1S10A 3RRGA 1NLKL 2ZUAA 2J8AA 1W2BM 1JXBA 2KT2A 4LF6F 2ATCB 4QR1A 1UZHA 2BZ2A 2DPNA 2RRAA 1VHIA 3GJRB 3SJHA 2OTJS 4YOXA 4YY3K 1FDBA 2AMCB 1R8BA 1JLGA 1OH6A 2DISA 3U27A 2MB0B 4CJEA 1F3FA 4WE1B 3KHRA 2KH9A 3VERA 4EUVA 4ZS6A 4OFZA 1RWMB 3S1TA 2H9ZA 4DPXA 4YOTA 1CJTA 1F60B 1EIYB 4FLTA 3N79A 1U04A 4AQYF 2VQFK 5HRPA 4UOGA 2KZZA 2A41A 3UPFA 1JXLA 2ZHAA 1VOMA 2VYPA 1BO5O 3MM5A 4USIA 3CQXA 3PFEA 3TVZA 3BV8A 1SUQA 5L1KA 3UN2A 5KQ8A 1YI2N 5BN9A 2IVOA 1XMOJ 2MLYA 3FZKA 3N01A 4C8NA 3HRGA 2QM1A 4Z4GA 3LWMA 4IH5A 1NGAA 4LH4A 1JNZB 2CQPA 5CZXA 1TFYA 2BKNA 1MU2A 4WFBQ 2BANA 3W63A 4KRFA 3LO3A 4NRUA 3HHNB 3G86A 3VEVA 5J1EB 1MMDA 5KT2A 2HPUA 5AQRA 2YXLA 3MAHA 4XPEA 3T1HF 4CZKA 1Y5IB 2AYGA 2OKQA 4IFEA 3GONA 1V9OA 2BGGA 3X1LB 4I7FB 4WP8A 4C6AA 4NLCA 2D3ZA 1D09B 4C2MA 3L2QA 2O01C 3ATVA 3P5TL 1REGX 3L7OA 2MGZB 2GQQA 2IRYA 4KO0B 2VWKA 3A8YA 1HNWK 3ATUA 1TMMA 2GGPB 5A8KA 3IS9B 3SCLE 4G1QB 5GIPA 1ZTWA 2B9XA 5H9EK 5E3QA 3BSCA 3VV2B 2P9CA 1S5ZA 4CLTA 2OAUA 3EXYA 3KHLA 1MSWD 1ITGA 4B1YB 1WAFA 4QWBA 5J2PB 5EXWA 1GLCG 3KKSA 1YXQA 4B9VA 2E7XA 3WXIA 1ZS6A 2FHKA 2OHDA 3CEDA 2QL9B 2O8FB 2P9NB 4BG8A 3HCXA 4JKCA 1N32J 4LBPA 1EZZB 4C8OA 2XYHB 4OI4A 1EQ0A 1WKLA 3GFXA 3AVNA 2A1SA 3TTCA 3HVRA 1V4TA 4CEAA 1OPZA 3GCWP 4QPXA 2QG9B 2W7PA 4DV7J 2ZH2A 2XNRA 2ZM6J 3DC2A 2W6LA 4CF0A 1TL1B 4PKHA 1WNSA 4M3XA 2UUBF 4F25A 4K4VA 1SC4B 4DWIA 1KC8O 4JEPA 3N6LA 4FBTA 4F50A 3UN5A 3OYGA 3WZ0A 3OUYA 3RMAA 3VAKA 5ETPA 1C0FA 3GV5B 2O5DA 3AA9A 2QLXA 4WK3A 3G71S 1HWLA 1FF2A 2R2TA 4WE1A 2Q79A 5L9XA 3CD7A 2F63A 1TL7A 4CESA 3G0ZA 3QGPA 3ITHA 1RT4B 3J8AA 1DLOB 2UUWA 2KYXA 4DX8H 4ZOSA 3I0SB 2FQQB 4XIUA 1IWGA 4M94A 3H20A 2RB7A 3S3NA 4RR5A 4X4NA 1RE1B 1SJFA 3Q8VA 1YKWA 3GILA 3DXKA 2OPSA 2NLWA 2I6WA 2YPZA 1R6VA 1X7VA 2GHVC 3DXMA 2C42A 2BJ7A 4BRLA 4NE9C 2Z1IA 1IJEB 1YJRA 4HUEA 1CS4A 1R7IA 4DN0A 2IA0A 3CCUN 2E1YA 5HRSA 2BYCA 1JL1A 2E2QA 3G2XA 2WZ1A 1JLCA 2QA4S 2RKIA 2AP1A 3I8DA 4CCHA 5BYRA 4E89A 3RBDA 1YT3A 3LP0A 3J81U 2AEFA 2V8VA 1NUEA 4ZJLA 4NZ0A 4DSJA 4CEEA 4Z4IA 2IGIA 5DLFA 3SPYA 4PXEA 4DR7K 4ELVA 2O8EB 3DLGA 3CCVN 3EPGA 2KJVA 4DS4A 1SJQA 3PHTA 3ILJA 2BUPA 1KQKA 2P9SB 1B7FA 4FWMA 3QZ7A 3SBGA 3DLKB 1NAQA 3AVHA 3AA8A 4BC5A 3PXGa 4DV1J 1HKBA 4EWTA 2ZH5A 3ZSZA 1VQNS 3CWJA 1FKOB 1D9DA 1MWYA 3UE2A 2E4LA 4DV0F 2ZZMA 3G71N 1S3XA 1NKEA 1LW0A 1G4CA 5DMRA 1WACA 2HHQA 4YN3B 2GFFA 2CQ2A 3FR0A 2QK9A 2FPHX 4FBUA 1RDDA 3HSTB 1N56A 3CPWM 3AD9C 1S59A 1UAXA 3ZLJA 5G0RA 3OJUA 3G4SN 2JFKA 3BDPA 4BRMA 3AVKA 3VVUA 3U1LA 2KJWA 3FEXB 4K4TA 1K9MO 2ZJQL 2ROPA 2YNHB 3DRRA 1TMJA 2YJFA 4AHCA 1IBLK 3VQ9A 1X9MA 4IOAQ 1H74A 1HBMA 2FJDB 5L1IA 2BRLA 4G3IA 5J2NA 2E8AA 2CPYA 3RMBA 4ERDA 4WKRA 4CK2A 2NCKL 4IUFA 3DLLL 1NGEA 1VC0A 4KSEB 3Q83A 2CJQA 3HXMA 2BKOA 3FLCO 4DTXA 2JNJA 2BR0A 2MQ8A 4TY8A 4EYIB 3BN4A 3W9IA 1Q82O 1A7GE 3L3CA 4FJ5A 2ZD1A 5C24A 4E7HA 3VQEA 2DXEA 1QAYA 1O5JA 3T5KA 3R6GB 2CQ0A 3ZTQA 1G6BA 4XH4A 4JI7K 2PBDA 4PY5A 2H5JB 1U0SA 3M7VA 1KD1O 4R5PB 3R9PA 2EW9A 5KT7A 2JJ4D 4K4ZA 4FZZA 3MX2A 2ASLA 5DDQC 4HCCA 2D3UA 1JLGB 4BCAA 4M95A 1DKGD 3LP1B 4LFAJ 1L3KA 3CIPA 3MN9A 1VQNN 4WU2A 4BDYA 1YQHA 1VQLS 3NG8A 3MR3A 3EPIA 5CR4A 3EUNA 1OSDA 2UU9F 1KAXA 1NH7A 4A4JA 1ZYQA 4KGZB 4J2DA 2JOQA 5KFNA 3QFUA 2F9DA 2AU0A 2YY3A 4F4XA 5A0YA 1XHXA 1UVLA 3QPIA 4EZ6A 1JKHA 3UVJA 3HVTB 2RVJA 3WQUA 3EVWA 2YKAA 4RUBA 4YR0A 1DQ8A 1ZC6A 4JAXA 5T41A 4KRWA 2WONA 4Y2IA 3UCZP 4MLEA 5KOXA 1RHRB 2R8JA 3M1VA 2BUNA 4M3UA 3I5CA 4LF7F 5C2DA 3CCEN 1HQEB 1M90O 3D67A 2HBJA 3PW4A 4WYWA 4ZKAA 2LXFA 2HZVA 2XMKA 3N9UC 4MKYA 1NBWA 4KO0A 1XR5A 3TUIC 3O44A 1BI4A 4WFBL 2DVIA 1X4HA 3TJ8A 2IOCA 1X4BA 2ZC4A 1BWEA 3SNNA 1AB8A 3HM9A 1UCNA 3QFHA 4FLZA 4BRAA 3UNYA 1T3NA 1K8AT 1WEYA 3A2FA 2YQ0A 3C46A 4LR8A 2MHEA 2W24A 1RHQB 2V8HA 2HRYA 4LF8J 4O3RA 2R9LA 3BF4A 3EGNA 3K9JA 1CJKA 4EBEA 4F26A 1VBYA 4BR9A 2X6NA 3CC4S 3SLCA 2F8MA 3IG1A 2RQ4A 2FGOA 5GADP 4OHZA 3EWGA 5KG7A 5AJ3J 1ELOA 1KVJA 3W9HA 4OQJA 4YDUC 2D0PA 4N7TA 3BREA 5HAOA 2X1FA 4MQ3A 2VG5A 4ECYA 4CEDA 3PLAA 4BDPA 1GH8A 4J9UE 1YF5L 3TQEA 1HRHA 4Y2MA 2X78A 1NGIA 2MZTA 1NHVA 4USMA 4OV1A 1VRTB 2EG2A 4OLPA 1ATSA 2KDOA 5ADXH 5AQYA 4EYHB 4CWBA 4C98A 1D9FA 2AEMA 2F4FA 4JD2A 2RH3A 3MUTP 2XLKA 1YRTA 2E7VA 3M6GA 4P2SA 1QHTA 2QN6B 2ABYA 2Z2LA 3ZNJ1 1QY7A 2YX7A 2PI5A 5BXIA 2P9KA 4KHRA 4ECRA 4DG1B 1N8RO 3PZPA 2UV8A 1IQTA 5HROB 3FSYA 2KXHA 4JI3K 4AF1A 1NMDA 2FSNA 4DCJB 4ID5A 2W6KA 5A8KB 1BIUA 2V8DA 3NF7A 1TL1A 3ALYA 2QA1A 4OI0A 1NK8A 2V8GA 3GYNA 1S6OA 4WCEL 1CJKB 1N52B 2ATQA 3FFIB 2FGCA 2HZAA 4USHA 3PJ9A 3NAEA 4IKFA 1Z4UA 1RBRA 2GVDB 2I1RA 4NA3A 4FNIA 2IVNA 4K5RA 5HK4A 3HSZA 3U4LA 4BROA 4FWSA 1YDLA 4CJKA 2EX3A 3HTVA 1NOZA 4KGMA 1ZBSA 1SBRA 2E9RX 4KB1A 1Q7YT 1SQFA 3TSQA 4RW9B 3BEXA 4ANCA 2JFDA 4JI8F 3EMTA 2DRDA 2YWFA 4TQSA 4WCEQ 2ZEJA 3OFHA 4DV4F 4H4MB 3MTKA 1WC6A 4F4ZA 4F0MA 2NPFA 3ZTPA 1NPKA 4GKJJ 1HYSB 1GOCA 1TKTA 2CQBA 4FYVB 1J5EF 1UKUA 1UETA 4BRKA 5BRDA 4B9UA 3LF0A 2ZH7A 2B5JB 4OX9F 4JI7J 5CY4A 4B3RJ 1C1CA 5KG0A 4N47A 4AH9A 5HROA 1WHXA 1Q8IA 4CLUA 3RU0A 3PX0A 2LFVA 3ZSWA 1ROFA 3Q24A 4ECZA 2HBZB 2P9KB 3AXKA 3HSDA 2I7PA 5KFVA 2CA9A 3CSKA 1FXDA 1BG3A 4IDKA 1FNOA 4DFMA 3RYLA 3T7ZA 4KTWA 5CAAA 8RUCA 2OJ3A 2UUCF 1V3SA 4O3NA 4IH6A 2HHTA 3P38A 2DFHA 5D8HB 4ICLA 4PKGA 3OTOF 4FSVA 3O2IA 3KVGA 3VQTA 4OHVA 2DPJA 1SZ2A 3FBCA 4I9QA 2AYBA 1RBAA 3EYZA 3CMQA 5M1OA 1YK9A 3AVAA 1N36F 1TKDA 1IG9A 1C0GA 1ZM9A 1KRPA 1N5QA 1Z2ZA 4DPTA 2ZBIA 4M5MA 3ZX2A 3HP9A 1GT8A 3M8QB 1AFIA 4CLZA 2YWKA 2G0IA 1N48A 2VFVA 3HHLD 5E3RA 3CQYA 1WF0A 2F1FA 2ZE2B 3NGSA 3MFIA 3Q8SB 1BUXA 5KFSA 2HQIA 1HARA 3O1WA 2RD5C 3FZBA 4WFYA 5HRNA 2B8QA 1KVBA 1YJNN 3NGKA 4NCBA 2XLJA 2Q6CA 4LSNA 4OV6A 3NGIA 4FW2A 2R7TA 2R7XA 4GW6A 3IO1A 1GTEA 3OVNA 3EGWB 4DPUA 1X4GA 5ETVA 3KOAA 3DWLA 2QWOA 3W5ZA 3DN9A 2M52A 2LXIA 4H4OA 4OZLA 1Z26A 4BLGA 5LSLA 2DHGA 2GEMA 5KFKA 4ED3A 4DV5K 3H25A 5LSOA 2J9DA 3K0SA 2ZDPA 4ISFA 3MMAB 2RHQB 1MW7A 3L2UA 3LAKA 4USJC 2L9NA 2V2KA 4K8XA 5G4DA 4CM2A 4P72A 3K5LA 4ZVFA 1YHQN 2OPQB 2HQCA 5AXLA 1SQKA 3MD1A 1DAXA 4MIAA 1ZBUA 4C97A 4ZPTR 4Q2LA 4X66J 3G8TA 2WB1D 1TAQA 3A3PB 2NRTA 3NMRA 3AGRA 3M8SA 1R27B 3IFEA 3JS9A 2E5JA 2JVRA 3AA2A 2WW4A 3ZETB 2KRBA 3QESA 4CI6A 4OYXA 2RDIA 5IV3A 2M8DB 5T7LA 1J53A 2OPSB 4H5WA 3CDAA 1QVGR 4TY9A 1RWOB 1S9GA 1K8KB 1N6QB 3NF6A 4K4SA 4PKDB 4H0XB 2O4GA 4DCHA 1YRUA 1NGBA 5KPRA 1VJWA 3V4MA 5EX5A 3NBPB 7FD1A 3BSAA 3FKBA 4DV2F 1KOHA 5SUHA 4LQ3A 3T9NA 2FTRA 1S1VA 2Q97A 4B1UB 2Y1LB 2PDAA 4FWPA 4JNEA 3EE8A 2B7CB 4OZ0A 1ZAVA 2VICA 4CTAB 1MN7A 5AQNA 4OYBA 1FKPA 4U7BA 4GO5X 4X4SA 3PX6A 1FDAA 3DRYA 2W9AA 3FSIA 2B4JA 5KFIA 3DXMB 5FPNA 5KFQA 1LW2B 4DHYA 3JSBA 1RJJA 2GIRA 4RZRA 4PG6A 4JRPA 3ZZYA 1UFLA 2NLXA 4KYZA 3C6AA 3QRRA 2G8FA 3JSYA 3AV9A 3QYYA 3NAHA 4OYIA 1W2BR 1FFGB 4Z4CA 4QCLA 1YHQS 1SS6A 2IRXA 2J7UA 1DLOA 3QO9B 5DGBA 4CZCA 2X6SA 2KW4A 2R4FA 1HJRA 5A8RA 4WK1A 3D4JA 4RW6B 2ROGA 3HBTA 1X4FA 2V4JB 3GG4A 4C3MA 1K47A 1Q5VA 4B08A 5AQLA 4TLRA 2WK4A 5GAHI 5HMZA 4KE5A 4KJIA 2WSEC 2MZSA 2AGOA 5J2NB 2ASOA 5C5JA 2E20A 1BHNA 4CIFA 1DGKN 1RWPB 4QU6A 4G6VB 1NPRA 2H3EB 4ES2A 2B56A 2ACMA 4KKOA 1NSPA 4PPZA 2PFDA 4O8UA 4LH5A 4CZMA 2P2CB 4RU2A 4ZVTB 1RHJB 4J7CA 2VG7B 3LDSA 3TAQA 1HQUB 1VQMS 3GJSB 2GIFA 1CG2A 5JS1A 4LSLA 4M5DB 2HSTA 3KK1B 3P39A 3QGHA 4B3TF 4BR4A 4USUA 4W92B 2HGNA 4V19J 2QW9A 1IBLF 3HO1A 1Z05A 1YRXA 2QRRA 3BGRA 2X51A 5F8GA 1EQMA 4H4MA 3FRZA 3ADAC 4DZ6A 4FS1A 3Q22A 1LXJA 3U3YA 1Q7LB 1C1AA 2RU3A 1XMBA 4NLYA 1LOUA 2F3JA 2Q3PA 1H6KX 2ETJA 1WTBA 2DGSA 2YWGA 4X84A 4JP8A 4JI8J 4OJGA 5I3UB 2DNPA 2CVIA 5IWAF 4YY3F 1SKSA 2YNIA 4J9SA 3RTVA 2VOPA 3LW5C 3JTNA 2FY8A 2OTLS 4R8UB 1OWXA 4YOUA 1Y0HA 3K7RA 1CJTB 1VCTA 1NGDA 4PQUA 1DTTB 1C2PA 5U47A 3QBXA 1UFKA 3J7Z5 1TZ0A 3LL3A 2HGLA 4LFCJ 1SL1A 1R0CB 2BDPA 3DOLB 4WFXA 1VRQC 1KFSA 4B3SF 5AE1A 4KV8B 4X4PA 2QKBA 2MLXA 1S1UA 4LF4F 4C8ZA 5F1XA 3G8SA 2EHGA 4AHTA 3LZJA 3MEEA 1M1KO 1VBXA 2UUCJ 2VPZB 1RT6A 2YNGA 2NZ4A 5DM6Q 2YHBA 4M63A 1T9YA 2AJQA 3VGLA 3KLEB 2LQBA 3Q89A 3SQOP 2XS7A 1HPMA 5KFLA 3PG9A 1U02A 4DQIA 1JJCB 3I0SA 3D1OA 1VQ6N 4M5DA 3AOBA 4O23A 2V68A 3CJKA 4LF9J 4TSXA 3KWGA 3DLHA 4IRDA 2VJUA 4K43A 2U2FA 2HURA 3VMFB 4C23A 3CFPA 5FROA 4BWMA 1IQZA 3GTYX 4FOIA 4NYPA 4LF7K 1C0UA 4O3QA 2E5IA 2W2PP 2I9SA 1H2VZ 3AVMA 2BEFA 3HHLC 3KXDA 3WHIA 4JV5F 3OYFA 4BBYA 3LTOA 3A5NC 5J2MA 5E41A 2RHSB 3DRSA 1HD1A 1VQKN 1G3OA 2CG4A 1HD0A 1WN7A 2W42A 1TELA 4DUZJ 1QSSA 5KFWA 4ZVOB 4HHTA 1FD8A 3GYXB 1VSDA 1HR0J 1NK4A 3UR3C 3EKSA 5F3TA 3S6EA 2RIJA 3JS6A 1YLXA 4NYZA 4UF4A 5L1JA 1DQAA 1PGZA 5A2QU 4Y2AA 5M1QA 2VHGA 4C4WA 4HKQA 2E2NA 1IG8A 1RBLA 3OYBA 3W3DA 4LFBF 3H45C 3CJ7A 3QT6A 1W7AA 2RJZA 2ZJPL 2QYCA 5KT4A 3SSRA 2MQMA 4F8RA 3ZETA 2OPPB 4F4KA 4ZA1A 4O4RA 1ZBTA 1ZAWA 3MD3A 1FNXH 4ILLA 3D2EA 4U8VA 2YKNB 3D66A 2LEAA 2ZBCA 5B0AA 2V94A 3TZZA 3NCQA 1KSPA 3OBYA 5JLFA 2L48A 4MTPA 4RUHA 3MXHP 3EX7B 3QB0A 3J81j 1D5AA 1NNEA 1VQ9S 4DQPA 3QLHA 3DRXA 1T95A 1SC6A 3HFVA 3O4NA 3ISNC 2N7YA 3CJ3A 4EEYA 3MAAB 2EFNA 1S0MA 3M30B 1RDBA 2GS8A 4FVMA 1P90A 2QJ3A 5J2PA 1NPPA 4O5FA 2H1YA 3HSCA 1K8KA 5CYJA 5DGAA 1G7CB 1S48A 3C8YA 4OPAA 4Y0FA 4FWLA 4CGHA 1VSEA 4HLBA 3KWIA 3H3NO 2F8EX 2YKNA 1HNZJ 2X3DA 4Q2MA 3CMAN 1VQKS 5CYQB 4CO1A 1S49A 3W2WB 3T1YJ 3OS0A 3NXZA 4Y1CA 3MPVA 1T7PA 4DV6J 4XK8C 4DU1A 3V81B 4LSNB 2QLWA 3IBWA 3MCMA 5EY4A 1Q95G 3P8BB 4CZHA 2YKPA 1T0TV 3V4IA 2FY1A 1IVZA 1HBNB 1RTZA 1X5PA 3CCMS 2ZJPQ 1F2GA 4H0OA 4IQMA 4P6QA 1B9DA 2BH1A 2HIQA 5H1SV 2WTFA 2MPUA 1FJGJ 1RBTA 1UEUA 3KJQB 3KLGB 1TK0A 1MU2B 2BE9B 3BO3A 3TAMB 3QSIA 2AJ1A 5L39A 1WELA 2R8KA 1X9WA 1NK6A 1L3VA 1GMUA 3A8JA 2BQUA 4ZIWA 1NOYA 4AHUA 1W2IA 1WSVA 2IAJB 4PG5A 4MKAA 4FF4A 4DR6J 1QHAA 3W2VB 1FT8A 4WQ5A 3T6BA 2U1AA 1WC5A 1NB2A 3HT0A 2VB6A 5LJ3Y 2R2SA 5I42B 1Q5YA 4IR1A 3HYFA 4FF2A 4GV3A 2RSQA 3HJFA 4BR7A 4NEZA 2GO8A 1MWMA 3FJ2A 1X4EA 4K4UA 4J9KA 4GY2B 2QXLA 1TUWA 2A6AA 2N4CA 4RW4A 3FBEA 1ATRA 4JI4K 5LMNF 4M3TA 2MQLA 3QETA 1S6PA 2HFSA 4IEIA 1Y10A 3MM8A 2MDAA 3VTIA 5TKYA 3NS7B 3MM6A 4L75A 4EO8A 2W4CA 2W4DA 2XHWA 1DHMA 1UZDA 3D0IE 4N8NA 1C1BB 4ECVA 3GL1A 4ILMA 4X4OA 3AO3A 3IWLA 3IA0A 2IM1A 2W2MP 2GCFA 4FWQA 4ANDA 1EHWA 2RQMA 5IWAJ 4NLVA 1K1SA 3DLKA 4NX9A 3MM9A 1YITS 1EETA 4IBNA 4IG0A 3F41A 3U6FA 5C0YA 1HYZA 5LXRA 4NL5A 4USKA 4OI6A 1N5VA 3V9UA 3BBFA 3WQPA 2NRWA 3S9HA 3MF5A 2IJNA 4X66K 5AJ3K 4ZP7A 5EGYA 4GVLA 4NRTA 1P1LA 2HS0A 1N88A 3C6TB 2MY7A 2YQ1A 2OPRA 2H65B 4FWKA 4CHOA 1D4XA 1WOSA 1YWXA 2W7AA 3QEXA 2FSKA 3RWUA 4ALZA 3ZC4A 4DB3A 4E7IA 2O8BB 1NKCA 1X4DA 1WSEA 1BUPA 2M7SA 2ZZTA 1X0PA 2VGNA 3QJJA 4OKEA 4QWCA 5I9EB 3VN5A 4JK9A 3O5BA 4Q0BA 1A9NB 4Q5VA 2CGJA 2VKZG 2DTJA 1JLBB 2CADA 1NK7A 1I3OB 2YTCA 4N76A 5ETNA 3VQCA 1KKHA 4M1KA 3K89A 3DOKB 1TFWA 3NGDA 4RW8A 2Z1GA 1VIXA 3EEQA 4FZYA 3FUYA 3HVWA 3KK3A 2HBQB 3T1HK 1JMTA 3CTRA 1HX1A 4OGEA 4NYNA 3M9NB 1FVQA 5AZIA 4ANEA 3M9MB 2RKIB 2XS2A 4WZMA 2P9IB 4ELTA 2FVCA 3D2EB 4JHDA 3MEDA 2V63A 2OLWA 1BCMA 3OSNA 1U1RA 5LMUF 4M42A 4NLRA 1YIJS 3DMJA 4ZITA 4OHXA 2XMUA 4DU4A 4H5NA 3RR7A 1ACMB 1S6QA 2IC3B 3ZXWA 4ED8A 1F1BB 3NY0A 1RT2B 1IBKJ 2WVCA 1ZOTA 5A76A 1ZA2B 1SQEA 2ZH8A 3W3SA 3FCHA 4NPOA 1XQIA 4DTPA 3DU5A 1H73A 2W9BA 3TUPA 1NK5A 2LA4A 5AQZA 1PC5A 2N4DA 5J1PA 1T94A 4N56A 4OZNA 4DL5A 1TYQB 2J8SA 1X4CA 3CD6N 4DR4F 2VU5A 2MZJA 3DRPA 4OVLA 4ZVUB 4QOZB 1S1TA 3I56N 2VG5B 1FESA 2IY5B 4DQRA 2BV3A 4QZVB 2HQ3A 3V81A 2J0XA 5B0BA 1HHSA 2LA6A 1T9WA 4ITSA 3V9SA 3TNVA 3CC7N 4C9DA 4CF9A 3B6BA 3EVOA 2JLGA 2AT1B 2EFQA 2HBMA 5BR8J 4GV6A 3GE9A 1J5OB 1VQ5S 1W97L 4G1QA 2H3GX 5KFEA 1VSIA 3OFFA 3EDRB 1TUYA 4CHZA 4F3OA 3TARA 1A6LA 5AZIB 1OY6A 1SIWB 3CJKB 2UP1A 3CJ4A 2W40A 1RBUA 3LAMA 2DNYA 1N5TA 1C0TB 1S99A 2AYMA 1TL5A 2HB5A 2OMOA 2K7KA 3B8HA 2O8FA 3IMXA 4EBCA 4EGLA 1DJ0A 4U96A 4LREA 4Q8EA 1TUGB 4E3SA 4BRPA 3UKRB 4UUXA 1UA1A 3KLFB 5B0GA 2I5JA 1NGFA 4BRHA 5HQMA 5H1SQ 3UVJB 4E7LA 3J7YI 1S72S 3HM8A 1M90T 3ETOA 3SAHA 2KG1A 3LP2A 2Z8QA 2QLFB 3IWXA 4YOVA 3PNIA 2AZ3A 2YCHA 3WX4A 4JI5F 3OTBA 4MYTA 4C8LA 3LP3A 1FEHA 5GADI 2JWNA 1HKCA 3PRVA 3OHRA 4JS5A 5GMKa 2BKPA 4RU9A 3EDQB 4KR0B 3ID8A 4E0DA 1HWJA 3SIPB 3RR8A 2G8UA 3LH2S 3AOCA 1EKEA 4J9VA 2H5EA 4B17A 4B1XB 4NOHA 1AT1B 1WSHA 5HSPA 5JVHL 2VIHA 1RLCL 5KFJA 2ROEA 2NUBA 3PYFA 1PAUB 3BY5A 3IR5B 2N7CA 3FMBA 1WC1A 3W5YA 3GYGA 4DR5F 1TVRB 4PQAA 3C7NA 1RBOB 2H5IB 5J2MB 2XY7A 2BJEA 5D0HA 3TTFA 3UCUP 3UKUB 3KLGA 2MKCA 1T05B 3KJVB 4JI1K 4DEZA 3BGOP 4I9LA 4AM7A 3SI8A 4IR9A 1RTIB 1XJWB 1YZ6A 4RWWA 1HI0P 5M2PA 1X9SA 3UWTA 3CCSN 4FXWA 5IWAK 1M5PC 1U48A 2E9ZA 2IVYA 3H40A 1VK3A 4IJNA 1AXQA 5C24B 2E66A 4Z37A 3C16B 3JAMO 4MFBA 1ASUA 4O8KA 2WTUA 2O67A 3EM1A 4UOHA 1HKAA 5AXMA 1BOTO 3F0NA 2Q0RA 3HF5A 2ILZA 2V69A 2WB4A 3ZT2A 2V7YA 3PUFA 2G2OA 1F9HA 4YOEA 3CCQS 2QGFB 4K8RA 4RW9A 4K25A 2HS4A 3RRHA 5M1FA 1TL3B 2MHNA 1VK0A 3K8WA 1AZSB 5IQ6A 1VSKA 4CT9A 4GV9A 2HRTA 2V8PA 3W8PA 2E1MC 4M5HA 4YNQA 4B9LA 5AQKA 5GAGI 1CXUA 3UD3P 3VEZA 3PKMA 3SUQA 3MR2A 4OYMA 4LF6K 3L4BC 3T5HA 4BRGA 1U2VB 1W26A 1WNEA 3L4IA 1I1GA 4Y28C 2BJ9A 3MXIA 5T7BA 1DTTA 1RAFB 1YJ9S 1ICEB 1TAUA 3J81Y 1S9EA 3JQMA 5IC4B 3CT9A 1KXPA 1CULA 5DLGA 2FVPA 1BY9A 4ZVQB 4DR3F 3QZ8A 2EBEA 2RT3A 4OLAA 4C1NI 4OHYA 3SSQA 4FKYA 4ZCLA 1YSJA 5DDPC 3A5MC 2ZF5O 4NZ7A 1YUWA 3VVTA 3MEEB 2A6MA 3VETA 4WF9Q 1XN9A 2PSZA 5LSRA 2XMWA 1IBMF 4DBQA 1GXLA 4PPDA 1V3ZA 2FC9A 3NP5A 4L74A 1CJUB 3R97A 3AO5A 1WBDA 4P2FA 4DSEA 3M3ZA 4H4KC 3CCJN 3KD5E 1YITN 1MROA 1WI8A 2E29A 2GVDA 4Q8FA 4W5QA 4MYUA 2VC1A 2YPYA 2QO3A 4BS2A 1NZ8A 3WC0A 4I6AA 4DXLA 3QJPA 4ID8A 1ILYA 4PABA 1LEOA 3BSOA 3F2KA 2XGPA 1FE0A 3PHEA 4LRCA 2O8CA 4U6PA 3BPSP 1O51A 3AH6A 2Y1RI 3U1NA 5GMEA 3V6HA 4MJKA 1X0FA 3CDEA 5EWEA 3RSEB 2D3O1 3C66A 3ENHA 3AVIA 1C4AA 4ZIVA 3O6WA 4U7CA 3KFWX 5DDOC 3MMCB 1U1PA 3CF5Q 2P9UA 4OZJA 3SBTA 1YX2A 4IZ9A 1CVJA 1BU6O 3PW5A 3TX0A 3FGUA 2D1CA 3FCVA 4CH0S 1XC3A 2RILA 1OYEA 2V0NA 4WIIA 1DURA 5DO2A 5H9FJ 4FJLA 2RQCA 3B4DA 2GVZB 2D5RA 3AVCA 4URQU 5ETTA 2WVBA 4CJWA 2FDNA 4HTJA 4JUZA 3AA5X 1FFWB 3OHBA 1YJ9N 4K42A 1AUSL 4CLFA 3HI0A 3O1LA 2NQPA 4BRDA 2V34A 3VQ6A 1D3WA 2H4WB 3AARA 2V52B 1RTDB 4CLLA 4L3QA 4J5OA 4FW1A 2NXEA 4K0KF 2DGUA 2HF4A 3E01B 2F8TA 3THXA 1H98A 5F0XA 1MMNA 2ZDOA 2QIFA 1I5OB 4HH1A 4ILHA 4K2JA 3R5BA 1T11A 3IP0A 3TI0A 3VGVA 3SV4A 4OPKA 2EWSA 3RAMA 4LFCK 3R1XA 1UEVA 2Y1IA 4GVMA 2DNMA 5KG1A 3BR8A 3I82A 1U6ZA 2AQ4A 2QC3A 5KFFA 3BO4A 5EX3A 4M7XA 3PW2A 2OMLA 5K20B 2PAVA 1KVCA 1HNXJ 1IM4A 3AJDA 5DM7Q 2X1AA 1BIZA 2AX1A 1HI8A 1NLVA 3R5CA 3WNFA 1YVNA 1RHUB 1Q78A 5ETMA 4CBUA 4HTUA 5CYMA 4HVJA 2YKMB 1D8ZA 2YVSA 4GC7A 4DSKA 2RUGA 3H5YA 4WF9L 2EFOA 3PIOQ 3UCGA 3CULA 3VEWA 4DV5F 4KT0C 2MKIA 1XQSC 3H90A 1MA9B 1RGVA 3FZFA 2AKWB 1QAIA 5I3UA 2MYFA 1WDDA 1R8AA 1RAJA 3TOQA 3EVMA 3GP9A 3WNHA 2R7QA 3MM7A 3IRXA 4O44B 2A2DA 4P52A 2J5AA 3ULHA 1VMBA 4CTAA 1F5CA 2XI3A 3OT9A 2EFGA 4NWBA 2OP5A 2Y1JA 5HBMB 2BQ3A 4NLGA 4I69A 5KRTA 2IBOA 4QAGA 3SCIE 1CXQA 3CC7S 3NGUA 2OPQA 2PA3A 1HLWA 1F5BA 2W7OA 5ETQA 3VOVA 3BGLA 3GZ7A 3I56S 3GPAA 4JYAJ 4YR3A 5A2QY 4DL7A 2MZRA 3OXGA 4CO2A 1FJEB 4IG0B 1H7XA 5HJXA 3MPDA 3M8WA 3TA0A 1FDNA 3ZNUA 2D9OA 2JWLA 4JYAK 2L9DA 4BE2A 1CQMA 2FC0A 4FJ7A 4QWEA 2Q1NA 3DOMA 2R7VA 3LANA 4YHHF 5KT5A 2QWMA 1OS5A 4CJLA 1WF1A 3C15B 1FK9B 2GHWA 5C2GA 3C6UA 1K73O 4LT6A 5E2QA 1H2UX 2CZ9A 3SQ2A 4WXOA 1TV6A 4HTLA 4WFAL 4KI4A 4LIRA 1VHXA 1YJWN 2G1DA 3JSMA 3OA9A 3TABA 3JB9k 4DL2A 3WXKA 2DR6A 1UVMA 4KKOB 5K5MA 1U1KA 5F41A 5EWFA 2R3VA 1RT5B 4M7YA 1CZAN 1HR0K 3MTJA 4JI3F 5BR8K 3WC2A 5L1LA 3T6JA 2BRKA 2UU9J 4IKAA 1RT6B 4O0IA 2ZWPA 3VEOA 4CK3A 4CEBA 4DV1F 1CQNA 2CPHA 1Y4ZB 3RW6A 4EFHA 2W41A 1JCFA 4CJ4A 2AF6A 3W64A 1NGHA 3TSUA 2ZGZA 3QO9A 3NF8A 2NPIA 4PL8A 4IQXA 3BDEA 3C6HA 4K50A 3L9ZA 2VPXB 3OBIA 1SH2A 3PSFA 4HHHA 5AQVA 4ZCIA 2DCUB 4H5RA 1OVQA 1T3OA 1RCHA 3C65A 2C28A 3WNEA 1SV5A 1GAOA 2KHDA 2LSNA 3LOUA 5KG2A 1EKSA 3BF3A 3GCXP 3UI3A 4NXNK 4BHQA 5DG7A 3BF1A 4N8OA 1T6CA 1F6TA 4U9RA 4F3MA 1OIAA 5KFMA 3SEOA 4DX7A 1KCFA 3LDLA 4AM6A 5I4MA 5IQQA 2YNIB 3M2VB 1APSA 1LW0B 1JLEB 1PBUA 1RABB 1FERA 4FJXA 3DOMB 3CYMA 1X31C 2IMWP 1JLFB 1LK5A 3Q8UA 2C1EB 4IO1A 4CH1A 3ZTRA 2HS3A 3H08A 2RMLA 1PO6A 3SDEA 2W25A 2E9TA 1G2EA 1Z6RA 3NNHA 2CYYA 2BACA 2YX4A 3O80A 4MDBA 5BPLA 5LMUK 2HMIB 4J9LA 3OXLA 4NMXA 2W9BB 3HL8A 1XMQF 2CQIA 3LALA 1QAJA 2FB0A 3KMSA 4IXCA 2CDQA 2ZBPA 4M5KA 1YZ7A 2BX6A 4Z4HA 4HUGA 2FXUA 3KTQA 4IOCL 4JI2K 3Q8YA 2ZJRL 3BS9A 1CBKA 1RNHA 3QDKA 5DZ6A 4DKWA 3H0PA 2W9CA 4A59A 3WBZA 4UZBA 4GMKA 3M2VA 3IAS9 4FYWB 1X60A 4KHMA 2JZ5A 4YHHK 1VQ9N 4BE1A 4PUOB 2CIMA 4NLTA 1ZM2A 4OJRA 3M6UA 5GAGP 7AT1B 5CHCB 2HQFA 3PW7A 1WSGA 2NRZA 2IA6A 2JDJA 1Q8BA 4RBUA 4YMEA 2RN2A 4ZTJA 3M2RA 3UDCA 1P9YA 1GLBG 3C19A 1FO1A 4RBVA 3E2EA 1AYEA 2CNLB 3BO2A 1T05A 5D6GA 4H4OB 1UTAA 1IR2A 3KK3B 3PTWA 2ZD1B 3QNWB 4DDFA 5HI7A 2VASA 5AXKA 4FJMA 5F9NA 4LQ9A 3PFOA 3EJMA 3SMPA 1HNVB 2XWYA 1B4SA 3AOAA 3NOCA 3GJQB 2GNKA 4YR2A 3NMAA 5B08A 3RGIA 4LVNP 1XNQK 4QW8A 3AQOA 4XH1A 2HHXA 4A8KA 1BWFO 2FJVA 3GR1A 3VENA 4O0JA 2CPIA 3C7NB 4BGAA 4HDGA 2YNHA 1S12A 1N33J 4DR2J 1YBTA 3ZT1A 2PMWA 1TTHB 2OCEA 1SC1B 1WD6A 3W7BA 1D0EA 4YOWA 4QJVA 3T41A 3JSRA 3A4TA 3L3UA 4K7QA 2NRHA 1ATNA 1E6VA 3QGIA 2E5LK 2HWHA 5BRHA 4UOFA 2AYEA 1TUVA 3MZIA 3IWNC 4CVNE 3BP8A 5CHIA 4LF5F 1N6QA 4DR7J 4JI2F 4OYOA 4N41A 3CDUA 2Z1HA 2OELA 3CO0P 1Q82T 1NSAA 2DHSA 4FKXA 3EZ5A 1EWRA 3AO4A 2QWQA 1JIHA 4DUYK 3C2PA 4XAKA 3H5XA 4W5OA 3O3LA 3CF5L 3AHPA 3QEVA 2HBYB 5KPZA 3WUHA 1NBEB 3OBWA 2LECA 2G9OA 2R7SA 4CK1A 5LXYA 2VWBA 1Y5NB 1Y3KA 3PJXA 5B09A 3E8OA 3CE8A 1HNWJ 1RYRA 1WOQA 4NCGB 4WXWA 1F3VA 3HOTA 3MAQA 1CZ9A 4KIAA 3F44A 4JYAF 2GJ2A 3IR6B 4Y2CA 1J5EJ 3QSYB 4J2BA 3K2YA 4B3OB 4OX9J 2CKWA 2LQ9A 4ED4A 2JLFA 1W9HA 4DTOA 4ZTFA 2LLZA 2QT7A 2DNQA 4DQSA 2P9LA 3SDEB 1KVKA 3NEKA 4CP5A 1O8BA 1L5UA 4W4MA 2CGKA 4O3PA 3K57A 3O9RA 4X4TA 1FEEA 3R3TA 2A3JA 1RFQA 4DV0K 3ILIA 1I39A 2HZCA 2DXFA 2COLA 3BH7B 1NZAA 4DLGA 3THXB 1ZTTA 4FLXA 3ZO7A 1P9QC 4MH8A 3MCPA 4QOTA 5AFUA 4KH4A 1FE4A 3V9XA 4IFYA 4GMJB 1IBKF 3TU5A 2GX8A 3O3FA 3V9ZA 5D0RA 3VGMA 1WG5A 4C11A 2B6AB 1TK8A 5DZ7A 3UD5A 3GBTA 3I4PA 2CRLA 3VTHA 2AX0A 4G1PA 3A5LC 5F3ZA 5IT4A 5A6PA 3TZXA 3U8XA 3OYEA 1GQEA 4RX6A 2AJ0A 1AA1B 3VGKA 4QIFA 2P1JA 3J80Y 3Q2TC 2C2EA 4LY7A 1Y7PA 2PGCA 1FK9A 3D1QA 1QSYA 3QT5A 4DR4J 4FWRA 4JI0F 3J7YU 3TR8A 3BZCA 2QFIA 3VGUA 2RPIA 4FPAA 4NLPA 4FZVA 5A8RB 4P2XA 1EQYA 2ZC3A 2OTJN 2ZBRA 3KK2B 1FFSB 1WOPA 4KGXB 2UXDF 3ENAA 2GJFA 1F2HA 3U1MA 4DR3K 4KGKA 2DH7A 4JHDB 2DKOB 2DY1A 4B9NA 5AQSA 2P9LB 1RAAB 4JI8K 3QWPA 1ESVA 2VGMA 4DV4J 4PA1A 4JV1A 2YWWA 1HWKA 4J90A 1WDTA 1CJVB 1CC8A 1T9VA 2XSJA 3AAPA 1S7IA 3FSXA 4BY9C 4F02A 2VD3A 4PUOA 1W0HA 3BKUA 4Y65A 3MCSA 3R8YA 2KM8C 3R6MA 1BQMB 4EK2A 1YI2S 4QR0A 4OI2A 2OO4A 3NDKA 5ETSA 1VLOA 3DAWA 4Q43A 3D5MA 5ADXA 2AGQA 4DV7F 2F9JA 5IS2A 3NL0A 3PYEA 3NS5A 5GAEU 3ILOA 2O1PA 4CERA 2XRIA 5JS2A 2VC0A 4OZ5A 5AQOA 2D9PA 5ELZA 2HQDA 4NA1A 3UKRA 4LF2A 5H9FK 4FVCA 1U2VA 5JVGQ 1NM2A 3TVKA 5JVHQ 5J1EA 1IKVB 1HNXK 1PG5B 3QMQA 4OX7A 5AZJA 3PYDA 4PKIA 4FF3A 3IR7B 5IT9Y 1BI4B 3SQ0A 1TQLA 2V4RA 3OY9A 4YDDB 1BCOA 2R7WA 2A1BA 2F5GA 2Y0SD 1KQFB 4Z2XA 1WAJA 4QIVA 2GHPA 3DLJA 4GVBA 3IS9A 3WX8A 2GGPA 2E1RA 4CGJA 1HHTP 2VQFJ 3MM5B 4I2PB 3WIUA 2V6AA 4AL6A 1RDCA 1B0VA 1S76D 2XMMA 4QS8A 2NYHA 4M5JA 3GV7B 2CPJA 1HA1A 4D3GA 3K5OA 3M6VA 3GIMA 1Y9OA 4C8KA 2KI2A 1O0PA 2C2OB 4IRCA 1EO1A 3NH0A 3S8SA 3OLBA 4CGFA 1NH8A 2LEPA 4OGCA 4QIEA 3HVTA 4UZCA 4J37A 3OJSA 4CECA 4AT1B 4OO1J 1RT4A 4C0HA 4C0OC 1WORA 4X62F 4E98A 1VQMN 1PYSB 3DHWC 4KC5A 3DLEA 4M3WA 1S6QB 3D7SB 4NO7A 2HK2A 1REVA 4Z94A 2ZITA 4E1NA 3I5AA 2CPEA 3PR4A 2CG8A 1Q81T 3CUNA 1HBMB 5GMDA 3CJ0A 4I6WA 3CCES 3OYIA 3HDSA 2ERRA 1N33F 4DR2F 2DGOA 2D7SA 3WEEB 1C1CB 4RL1A 4EP4A 3OQ2A 2R8IA 5IT9U 3CJ9A 2FJAB 3BKFA 3GR0A 3AA3A 5DM6L 4ED2A 3CCRS 3FEZA 1T03A 1XEZA 3OYJA 5A8WB 1TV6B 5AZJB 4PQUB 3OL7A 4B3TJ 4NA2A 5C42A 2BW7A 3ONQA 4C3KA 4GKKF 5TKWA 3HD1A 4H0PA 3KLIA 4DL0C 1HI1A 4HL9A 1IBLJ 4OJHA 4GKJK 5FPDA 4IOAL 3W65A 4WYBA 5M1NA 2OZSA 3CJAA 5LJ5Y 1HMVA 4ZHRA 3SXLA 4DPWA 3MEGB 1J2VA 5E3CA 4I2QB 3TJAA 3RSEA 3HPHA 1RWKB 3UR0A 4I2QA 3UFCX 3MMBB 3TUJC 5CD4A 2FLNA 3KLFA 1QTNB 1BISA 4E8UA 1WSRA 1C1BA 5CYQA 3NGRA 2F4VJ 4CJQA 1ZBHA 1X4AA 5JUMA 2DGWA 3WXMB 3TAFA 3DU6A 1QE1B 4AQYK 4CH7A 2OSRA 4XEIA 2CZVC 5M2UA 3CHWA 5CZ2A 2ZOGA 3AO2A 4YORA 1T03B 2CJBA 5HL7Q 1NCLA 5KFPA 3ILLA 2YWEA 3KJFB 1EKRA 3HHDA 2XYGB 3CD5A 1RACB 5CD4H 1FRMA 1LKZA 2ZKUA 4CEOA 3MMBA 4IG3B 3CJSA 1KC8T 2P5VA 3JTPA 1IO2A 3CG7A 1A0OB 2Q31A 3BZQA 3AXMA 1KLMA 2N3OA 4AFFA 3IBCB 1CZBA 3M8ZA 3WQTA 2XMJA 2WC9A 3P45B 3QIDA 1R8CA 2K3IA 4OIXA 4ZN3A 5EOYA 1KTVA 1LXNA 3TRGA 5F9LA 4KHPF 1CULB 4JV0A 4UQTA 4F36A 4BC7A 3K59A 2YKMA 1VR6A 4OL8A 4J8FA 4LSLB 4FVUA 3MN5A 4DL4A 1XTZA 3ENWA 2M88A 1NK0A 1SVDA 1EX4A 3LP0B 4ZCKA 4YB5A 1F9FA 4RO0A 2EXUA 2CPFA 2PFFB 4RNHA 5FPMA 3VAFA 4MIBA 4DTMA 4DUTA 2Z58B 4KH1B 4DCOB 5KFCA 1J27A 4HEA9 3PO4A 4FJJA 2DNHA 4O3SA 1IM6A 5K8NA 3G6EN 2DPIA 2L08A 3SZ2A 2R7YA 3CD6S 3RZAA 3BKTA 3F9KA 4B8CA 2WFBA 3CXCR 3BQ2A 2A2CA 1GTHA 4A47A 1C4CA 1FRXA 3CCTA 5KRSA 3KUHA 2POKA 2J6TA 4ENOA 4AL5A 3H46O 4BREA 3HZEA 5FLXO 1YTUA 2EFVA 1N34F 3QNOA 2VDHA 4OYPA 5KFZA 2LP4A 1VQ4S 1CPZA 4A8XA 2ASDA 3TEHB 1HBNA 3D45A 4PWWA 2W2NP 2JWKA 3H8YA 3I96A 4C0BA 6FDRA 1QZ5A 2UV8G 1YJVA 2D69A 4CHQA 4B9MA 2GWJA 3UKUA 2AWZA 4NXMJ 3H7HB 4KI6A 3LPYA 3O08A 4LFCF 3DYAA 1IWAA 3Q0AA 2W2QP 2FF6A 2DR9A 2QE5A 1IBMK 1HBUB 2QZ8A 3W2VA 3A0IX 1IKYB 4LF8F 3GQCA 1Z1ZA 1ZBIA 2BA9A 1JLFA 2OPPA 1JK9B 3DM2A 4KFBB 4JKAA 3VQBA 1QS4A 4MIWA 2ZH1A 4I7FA 5L8RC 3M8RA 2HNDB 2DNOA 1EWQA 4A46A 3VAMA 4M5NA 3QINA 3E9OA 4FL9A 5AQTA 2FBVA 1ZPWX 4MO5A 1NK9A 4CIOA 3LPUA 2QFJA 3VQSA 4KAZA 3I6PA 4CIEA 5L38A 2EPIA 1C6VA 2E5LJ 4OMFG 1HHQA 1RYSA 4KH6A 3NCPA 2UZAA 1F0XA 3HFKA 1X8DA 3CB4A 4NXNF 4ILGB 2KFZA 3KK2A 2IFXA 3D68A 2K1RA 1LFWA 1ZZNA 1S22A 1X5SA 1J54A 1NU0A 2E1PA 5KFXA 1HPZB 1PSDA 1BQMA 1XNQJ 2IYIA 3SCJE 5JXSA 3KHYA 4JV5J 4P74A 1S9EB 3O5TB 1Q86O 4JI1F 1JJHA 2V50A 2HRUA 1S1TB 4OI3A 5IOLA 3Q23A 3FBFA 3GMGA 5IFMA 3FDSA 1N36J 4FYYB 1ZBFA 3PIPL 3OYDA 2LXUA 2ZFHA 4BRFA 4DV6K 4C7QA 3H2LA 4DV1K 4IWVA 2I2YA 3QNNA 3TAEA 4DSLA 2C3YA 2ITMA 4RWTA 2ITGA 3N4QA 1B92A 4KY3A 1RISA 4A5AA 2VCPA 1S0NA 3EZOA 1HR0F 3R5DA 2E1ZA 3NMUA 3CJTA 1FRIA 2F96A 4OYZA 1RTJB 3KK7A 4JOUA 5AE2A 2GZOA 1KAYA 2VONA 1YBAA 1FJ7A 5C12A 4DS5A 1FX2A 3TUZC 3IFRA 1FW6A 1HBOA 4IDKB 3CDBA 4LFBJ 2CGLA 5GAEI 2UXBK 3ID6A 4C8YA 1F5AA 4WP9A 4YQWA 1N5SA 1BDGA 1REVB 4ECWA 4F7VA 1RILA 3KIOA 4QQBA 5E3PA 3Q2SC 3TP2A 3WDOA 4KGVB 3NLCA 1LWEA 3SFGA 2V67A 3OYMA 1JXEA 4CNZA 1XC9A 4DTJA 4UQGA 2NRRA 4H5VA 5HP1B 1SXLA 4W98A 2EKYA 5KFBA 3UN3A 4P2MA 5HOOA 4FO0A 2F4VK 3CJ5A 3IUCA 5M1KA 2CFXA 1JJ4A 4H5TA 1MNEA 5F8MA 5B0DA 2BE7D 3D6FB 2KG0A 4HT5A 3RAXA 2XMAA 2KM8B 1VSJA 5DRKA 3KLHB 2G1HA 2B9YA 1SB6A 2MZQA 5AQGA 4A48A 2IAJA 1YVUA 4U95A 1KLMB 4BGBA 5FLXU 3FQLA 4ISGA 1WUAA 3GU0A 5E84A 1L3UA 1CEZA 1AUDA 2HVZA 4GO7X 3ETMA 5I3PA 5HVHA 4WU3A 3U9ZA 1QQMA 1YTYA 4RNMA 2CQDA 3RMDA 3S01A 3KD1E 3AQPA 2K06A 1D1UA 1RTHA 4W5RA 2HHWA 2PY5A 3ET6A 1RLDA 3P6YC 3LM9A 5CQGA 4WBFA 1SL0A 3KG0A 4M3ZA 4WFNQ 3CIMA 4PL7A 4XO0A 1DBDA 2MLZA 4IFYB 1SI9A 3AO1A 2VQEJ 5HVFA 3M6WA 2YHWA 2ZM6K 3RB0A 3TYTA 4CJFA 3FQKA 1OJ4A 4U67L 3KLVA 2XM3A 2FJEB 3KKFA 3S3OA 1JCGA 3V6DA 4NLQA 2QMWA 3HD2A 4PAAA 1S1XB 4M3RA 1KHVA 1M1HA 2RUSA 4CJUA 2YBVA 3GB0A 4Y2KA 4PG8A 2F65A 2XCAA 1M0SA 2DJWA 4LD0A 5KPTA 4ZLNA 3JQJA 3L2WA 2WAQD 3KDOA 4H4KA 2DO0A 4N77A 3MEKA 4DR6F 3BBBA 2C3PA 3QATA 1U45A 1S9FA 1T9TA 4K2XA 3A13A 3DGPB 2X1BA 1ITPA 2ZWHA 3KLIB 3G82B 4CJ5A 2J7WA 2IHR1 2JC1A 1MMLA 3VAHA 2MXYA 2DB1A 2WBMA 1E6VB 3J7YP 2F9WA 1L3SA 5KI6A 1HLUA 1ZETA 4X2BA 3IKMA 3ULEB 2PO4A 2MKYA 2DBBA 2C3UA 4J2AA 3QT7A 4K4WA 4JK7A 3MECA 5MAOA 1U2FA 2N3LA 5AQJA 5CZ1A 3Q7CA 4RNOA 3E51A 4DU7A 3C14A 4BVOA 3AVFA 3ZFVA 4DG1A 1R59O 1M5KC 2MQQA 1KQSM 1WHWA 4E7JA 2M8HA 1N8RT 1PILA 3TA2A 5KGWA 2GAGC 2JVOA 4RW6A 4LF4K 5AQUA 1VSMA 4ECXA 2QI2A 3RB6A 2JEIA 4F3TA 1XMOK 3OYLA 4CO0A 1U4BA 5LL6Z 3THYB 3MCNA 1WF2A 2KQ2A 3SQGA 2IVMA 2NSBA 2H48B 3L3VA 3DLBA 4PR6A 4FJ9A 4CJRA 5E26A 1U0HB 1Q1KA 3T1HJ 3UW1A 2E88A 1M1GA 4PWDB 3OYAA 4CO5A 3I87A 1U49A 1TR0A 1J9AA 2W8LA 4HR2A 4AILC 2XHCA 3BM7A 2GMJA 2VBZA 4GVBB 2CPZA 1BA1A 4DV2J 1K6YA 3O8WA 3A8KA 2D0CA 3SK3A 2ALYB 4IDHA 2ZH4A 2QWRA 1OH7A 3NH1A 3KUEA 2HK3A 3WXJA 1OY8A 4ZPAA 4RW8B 4A8SA 4QIGA 2DK2A 1HUXA 3CJ8A 2UUTA 1IKVA 2BM0A 3L0QA 2C22A 1VQPN 5HMYA 5E3AA 3H1QA 2V4QA 2GIQA 5CH7B 2XC9A 3OVAA 3AA4A 5SWMA 3JQKA 1OH8A 3VA0A 3NRBA 2XWXA 1TL3A 2ILYA 3NCRA 3IM8A 3FC9A 2M4MA 1QUVA 2IJFA 4K4XA 2XGQA 3NGYA 1E6YB 3N0VA 4USWA 4KV8A 1IKYA 3OXFA 1SH0A 4CIGA 3H98A 3THTA 1GLLO 4DR4K 3G10A 3LDQA 4RNFA 1WWHA 5ETKA 4CZJA 3DYAB 4F4AA 3GFYA 4NLDA 2ZVSA 4DV3J 4PWDA 4CD1A 1XR7A 1RKJA 3BSNA 2FZCB 3C0BA 1PJ5A 5E5NA 1RWXB 4DU8A 3FMWA 3U3GA 3MCAB 4LFAK 5D4NA 2BANB 4X64F 2AV5A 2XZDB 2ZHOA 2QX0A 2HHHF 2CVEA 3U02A 3ITHB 1UJ6A 2Y3YA 5M1PA 3HULA 2QEXN 3UDVA 3ZSRA 4ZVGA 4Z7CA 2CNOB 4A8WA 3EZUA 1YJUA 4KQZA 3D3CJ 1RDWX 4MAKA 3KHHA 3OUYB 1DTQA 2Z56B 1B64A 4CYUB 1RSCA 4CNYA 4QU7A 3M2UB 3QBWA 3SI6A 5ETRA 3L4QA 5GVQA 5LJVA 3OL9A 3H4BA 1QM9A 1JLQB 4NMLA 3TTDA 1VRTA 2J9CA 1RZMA 2GUPA 1NSKL 4ZJQA 2GBZA 1D9AA 3NH2A 1I94F 1TGOA 4BE0A 3GJTB 3L7UA 1JLAA 1B70B 1RWNB 2VWJA 2CUYA 2CXEA 2HMPA 3D0GE 1TKTB 3R6LB 4DV7K 2ALZA 4ATNA 3NS6A 1UP1A 4M45A 3HK2A 1V6HA 1NKBA 3DLLQ 1Z25A 2QSWA 4YB1P 3EICA 2LDYA 2XQCA 2ASYA 4EO6A 1FHTA 5IV4A 2ZZNA 1DTQB 2NXNA 3EGVA 4PYDA 2RS2A 4RG8A 1UVKA 1RA7A 4JRQA 3F56A 1V5IB 3KDNA 5MLCV 3RB3A 1WSIA 4JLHA 5HN0A 4LF4J 2MQNA 2V2VA 1NEEA 4A8YA 2PEBA 1B0PA 4CGDA 4KTQA 1LOTB 3W5XA 2PE8A 4W5NA 1F9EB 2DEIA 3N5BA 4QYZK 2BOPA 1RDUA 5KFRA 5D3GA 3M8QA 3KYLA 1HWUA 1JCEA 3WXLA 3MCOA 5LMNK 4DUYF 4A57A 1LNQA 4ZDNA 3JXOA 3FFKB 2HMIA 1K1QA 4Y0WA 1BE4A 4U67Q 4LF6J 3K2PA 4YP3A 1NGCA 1CSJA