2IAJA

Crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with atp
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
551
structure length
551
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Clinically Relevant Lys103Asn/Tyr181Cys Double Mutant HIV-1 Reverse Transcriptase in Complexes with ATP and Non-nucleoside Inhibitor HBY 097.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H (p66 RT)
total genus 142
structure length 551
sequence length 551
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2iajA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iajA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iajA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iajA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2iajA05
1K1QA 4RW8B 3O3FA 4ICLA 3L3VA 2QK9A 4JV0A 3TQ1A 3DOLA 3HP9A 4O0IA 5F8NA 1S6QA 4CJVA 4K8XA 3QERA 4CFDA 3ZSQA 2WOMA 3QO9B 1QHTA 2BE2A 3T5KA 2X78A 3KLHA 1CSJA 5HRPA 1RBRA 2PYLA 4CEDA 2VG7A 4ED3A 4J9SA 4CECA 1JLAB 3I0SB 5DLFA 5HROB 4RW7A 3PJWA 1BIZA 4IDKB 1ZBHA 2F8TA 3VQQA 4O4GB 4E1NA 3V6HA 4UQGA 4DSFA 2HMIB 3CWJA 3NF9A 4CHZA 3MEEA 5I3UB 4K4VA 3DOKB 2FLNA 2WRMA 1UA0A 4GVMA 3LAKA 4YMEA 4CJ3A 4J9OA 4TY9A 2PY5A 4KHNA 4DWIA 3FQLA 1W0HA 1C1BB 4FBUA 2VWKA 4Z4HA 3CO9A 4AHUA 5KRSA 4DL4A 2IOCA 4K50A 3MR3A 2IAJB 1RCHA 4CCHA 5KFWA 3GV7B 1T3NA 3KLEB 2YNFA 2GV9A 2I5JA 3OYBA 3FFIB 4CEZA 4CEBA 3I0RB 5KFZA 4M3XA 1VSKA 1XHZA 2YNGA 5CZ1A 2D7SA 4KV8B 4KRFA 4DL6A 4JRPA 1VRTA 1C2PA 4FLYA 1EETB 4TY8A 1U4BA 4F8RA 1S1UB 5DK5A 4IKAA 3SUNA 2W9AA 4FZYA 4ID5B 2E6LA 3K5MA 4O3QA 4BDZA 4EBEA 3BGRA 4IH7A 1RT1B 2VG5A 2D3ZA 4CFAA 4RW4A 4O3OA 4B9TA 3OJUA 2XWYA 1IKWA 2FJXA 4YNQA 2XI2A 4MFBA 4K4TA 4KB1A 1NOYA 4LSNB 2P5OA 3DYAB 2HHWA 4WZQA 2QKKA 2ETJA 1TKDA 1T03A 4DSIA 3HSTB 3EY1A 2HNYA 2HNYB 4OGCA 3OYGA 3IG1A 1T03B 2Z1GA 5JS1A 2BRKA 1I39A 3OS0A 4XPCA 4LD0A 1JIHA 1XR7A 4DS4A 4FLWA 4BWMA 2VG5B 1RT1A 5HRSA 4ECUA 3QEWA 4DTMA 3AVFA 5KFTA 2GIQA 2AX0A 1ZTWA 4KHQA 2JC0A 2UVVA 3DLHA 1TVRB 5L1JA 2D0CA 1NOZA 4TQSA 4NYNA 1FXXA 2BQRA 1ASUA 2FBTA 5L1KA 1WSFA 3OYHA 3OS2A 4Y2CA 1S1UA 3LP2B 3FQKA 3SUOA 4Q8EA 2KZMA 4KV8A 2EHGA 3MFHA 1X9SA 3V6JA 3K59A 3ZSVA 3HVTA 4NLDA 1T7PA 4CJWA 4CF8A 3NGZA 3QESA 3KD1E 1WSJA 2W7OA 3K5NA 2G8WA 3CDEA 1DLOA 3L3UA 3Q8SB 2YNFB 3OYKA 1D8YA 4O3NA 1N5YA 4AH9A 5F8GA 4Y2AA 5DQGA 1QUVA 1JL2A 3IG1B 4R0EA 3KHLA 4O44A 3TAGA 4KAIA 3RB4A 2ATLA 1XR5A 4H54A 3AO2A 4JS5A 3DYAA 3O3GA 2XGQA 4KE5A 3VQ7A 2VA3A 3U3YA 4MFBB 4KI4A 5F9LA 4NLSA 4J9MA 4E19A 2XY7A 3L2QA 4ZVEA 3MEEB 3WNHA 2HHQA 4DLEA 4KO0B 4F4KA 4ID5A 4IKFA 4KHYA 3CDUA 3VQEA 4B9VA 4WYLA 4IH5A 3RMBA 3GQCA 3O4NA 3CFPA 2V4RA 4DQPA 2XY5A 1VRTB 1YTAA 1HJRA 2BE2B 1TKXB 4CJLA 5J1EB 4IRDA 2QXFA 4Q8FA 2R7YA 3I0RA 3VQDA 3FFIA 4WYWA 4ID1A 3U6FA 3ICLA 2XI3A 2I5JB 3QGGA 3OL7A 3UQSA 3RMDA 1X9WA 4XO0A 1J54A 3MXJA 1TKTB 4FYDA 3SPZA 3HP6A 1IKXB 4EO8A 1HYZA 5KT4A 3DDKA 4CIEA 2I1RA 4OJRA 3DOKA 5I3UA 2O4GA 1WNEA 4E3SA 3PZPA 4BDYA 3DM2B 2R8JA 1WN7A 4I2QA 1RT6A 5KFBA 1S1VA 5J2QA 4MKBA 2RKIB 4RW7B 5T7BA 5EDWA 3ZSRA 3I0SA 1KLNA 1HYSA 2VG7B 4TYAA 2BR0A 2C2EA 4I7FB 5KFUA 3SZ2A 5DLGA 3GILA 5JS2A 1C1CA 3AVAA 3BQ1A 1I3AA 1WSEA 4IFVA 3IRXA 4RZRA 2E9ZA 3DOLB 3CJ3A 3AVJA 4KHSA 1S9EA 4RW8A 4Y34A 1VSEA 4B9SA 4Y3CA 1U09A 2IJNA 1S9EB 3KK3B 1Q9YA 4DTNA 4I9LA 4FBTA 1LW0A 4EBDA 4ECTA 1Y97A 3HL8A 2G8UA 3IRXB 4CEFA 2XC9A 4EBCA 1SV5A 4YQWA 1DTQB 3RMCA 3TARA 1HNIA 1SKRA 1HQEB 3BQ2A 3H40A 3NGIA 2EC0A 4AHCA 1Z4UA 3ZCMA 4J2BA 3HPGA 1X9MA 1RT5A 1QAJA 3KTQA 2DY4A 2WTFA 3WNFA 4J2DA 3VQSA 1IG9A 3GV8B 3KJVA 1RT4A 5FDLA 1ZBLA 2R2SA 2NUBA 3OYDA 1QSYA 5J2MB 3KLFB 1NKEA 4RUAA 2B5JB 4NLVA 2ZE2A 1S97A 1TKTA 2FVQA 2IM2A 2OH2A 2C22A 4PWDB 3RR7A 4J9PA 3H4BA 3QEIA 4KBIA 4KHWA 1NNDA 4Y1CA 1TL3B 1NHUA 3NH0A 2AWZA 4YP3A 3KLIB 3HPHA 2FVSA 4H8KA 1UWBA 3PV8A 4F4WA 4B9LA 1S10A 4ECQA 2JGUA 5J1EA 1K1SA 2R8KA 3V4IB 3ALYA 3BSAA 1JLEA 4KTZA 3TI0A 3OHAA 1SL0A 3ZSXA 4C8MA 4J9QA 2XCPA 4CFBA 1NJWA 3T3FA 3LP0A 1VSHA 3ZT1A 3EYZA 2QV6A 4Q45A 4KHUA 1C0TA 4B3OA 2E4LA 1X1PA 4F2RA 4O55A 5D3GB 2D3UA 4DTPA 4O3PA 2YHAA 4B8AB 1L5UA 1BHLA 2J6SA 1O1WA 4F4YA 1C0MA 4OKEA 2OYQA 3E51A 4E7HA 3OYMA 1N5YB 4ZVGA 4AHRA 3G10A 1DLOB 1B92A 3V9XA 1IM4A 2GC8A 3PW4A 4AHVA 2HHTA 4E7KA 3N6NA 2AU0A 1NK6A 4J2AA 1LW2B 3DRRA 1ZBFA 2OPRB 4NCAA 3LP2A 4K4XA 4LQ3A 3DLEB 5DMRA 5FRMA 2OZMA 1CLQA 4J9RA 4E7JA 1KHWA 4ECRA 3SV4A 1JX4A 2ZD1A 2ASJA 4URSA 1MMLA 3OYNA 4PUOB 4KHRA 3B6OA 3SV3A 5HLFA 3H5UA 4O4RA 5KG4A 3KLVA 4LY7A 3DLGB 3LPTA 4M3YA 1HARA 3OVNA 4RNHA 3HK2A 4H4MA 2GIRA 3NE6A 2R2TA 1RBUA 4DFMA 3SQ1A 1BIUA 3VN5A 3SPYA 3DI6B 5F8HA 3AVGA 2JC1A 5CZ2A 3C6UA 4FLZA 3I8DA 3SUQA 4DQIA 2GUIA 4CF1A 4HTUA 4MK8A 4QAGA 4Z4FA 3EPGA 1IKWB 1C6VA 2YKNB 4RW4B 4DEZA 2UVRA 3IS9B 1N4LA 1CXQA 1ASVA 3BGRB 5DG8A 3RB3A 1S1TB 3PY8A 1RT3B 4FZZA 3VQAA 4K4UA 4GC7A 3V9ZA 3PW2A 2RF2B 4Q0BA 4Q5VA 1EETA 4TY8B 4C8KA 4EYIB 1VK0A 3CM5A 2IM3A 2OZSA 3GIKA 5KFGA 3CVKA 2ILYA 3M9NB 2FVCA 4QPXA 3SFGA 2IA6A 1JLGB 4DL5A 1JKHA 3QINA 2XGPA 4CFCA 3KLEA 1ASWA 4ED6A 3LALA 5KFXA 3LP3A 2PYJA 1MU2A 3HKWA 4ZVFA 1LWEB 2QE5A 3M8RA 1NJXA 1RA7A 4NCGA 3CJ5A 4KFBB 4R5PA 3MR5A 2HVIA 3AA3A 5SZTA 1C1BA 1IKYB 3AVLA 2YNIA 1RBSA 3ZSYA 2FVPA 3CJ4A 1RDCA 5KG6A 2UVUA 3MEGA 3NF8A 2XRIA 2W9CA 2HMIA 4KHMA 3UIQA 4FLVA 5HRRA 3PX0A 1BQNA 2E9TA 3KHRA 4C8NA 4B9NA 3ZT0A 5HROA 4ZVHA 4FJNA 4QCLA 1IO2A 3NGYA 5CYMA 4BDPA 2BQ3A 4EYHB 3V1RA 1FKOB 2ATQA 4IG0B 3KLHB 3DLBA 2V4QA 2IM1A 3QO9A 3OL8A 2A1RA 1C0UB 2OPPA 3ITHB 4NLUA 5KT5A 4QWDA 3AO1A 3OYAA 2ALZA 4ICLB 2OPQB 2HW3A 4KB0A 5KFKA 1ZTTA 3VQ4A 3S9HA 4DF4A 3LZJA 4FK0A 2F8SA 4GMJB 4RW9A 4BE0A 3KKSA 4EP4A 4DLGA 1S9FA 4PY5A 4QW9A 1JLBB 2X6SA 4KI6A 2FBVA 2D41A 1Q8IA 3L2WA 3EZ5A 5L9XA 5KGXA 1NJYA 1QAIA 3QGHA 1NK4A 1HPZA 3OLAA 3H5YA 3AVKA 1RTJA 1DTTA 3Q8RB 3MTKA 2W7PA 3AVMA 4FLUA 3H4DA 3H5SA 1VSFA 1W9HA 2QKBA 3KK1B 3DLRA 5KFRA 5CY4A 4EZ6A 4KKOA 1EKEA 4CJPA 1T8EA 1A5WA 4ED2A 5C42B 4FJXA 4M42A 3KHGA 4MIBA 3M9OB 1RTIA 1S49A 3VQ8A 2E9RX 3CYMA 5EWFA 4ECVA 2YKMA 1RYRA 3QLHA 3RTVA 1A5VA 1NK9A 3GIIA 1NK0A 3BSNA 1YVFA 3DRSB 3AA2A 1TL1B 4E1MA 3TAFA 3I5AA 4AHTA 4M3TA 4ZPDA 3HYFA 4AILC 1RT2B 1LWFA 4R8UB 1BL3A 4BACA 4DG1A 3E01B 4G1QB 2A1SA 4DU1A 2RDJA 3OLBA 5T14A 2PZSA 4MIAA 2AJQA 4WXOA 4NYZA 4FJ7A 3S3OA 2C2RA 2W9BB 1S9GA 4CGFA 4DSJA 3EZUA 3FSIA 4FK2A 5F9NA 3CFRA 5F8IA 3I5CA 1JLFA 1RDBA 3NH2A 1T05A 4FS2A 2FVRA 4JRQA 3UR0A 5J2NB 3M8QA 2DFHA 5DGAA 2GBZA 3SNNA 4F2SA 4LSLA 3OL9A 3NMAA 3RBEA 1SH0A 5DQHA 4E7IA 1S1WA 4ECXA 2HNZB 2BANA 1RDRA 3B6PA 2HNDA 5EWEA 5J2PA 4CJFA 3PX6A 2B6AB 2X74A 3KKRA 4CGDA 2WK4A 2UVWA 2G8KA 2HAIA 1KSPA 4FJKA 1ZBIA 4L8RB 1JLQA 1S1XB 4DSLA 4RU9A 2KFNA 3C6TA 1VRUA 2WCXA 4RNOA 3AO3A 4IFYB 4CJTA 3HT3A 4PQUB 1BQMB 3C95A 4XIUA 2D0AA 3V9UA 4MKAA 5C25B 3QIPA 3CM6A 5C24B 1S6PB 1XC9A 1S0OA 1OS5A 4Z4IA 1N6QB 3GYNA 2KQ2A 1KHVA 1S5JA 4DQQA 2IJFA 3OHBA 2DFEA 3OL6A 3QIPB 5KT6A 1RTDB 4CK2A 1YTUA 1RTHA 3GV5B 1RAJA 4RUCA 4M95A 4FJIA 1HQUA 4Q43A 1J5OA 3AVHA 4RW6B 1KRPA 4CF9A 4PQUA 4IFYA 5KG3A 3C6TB 3VQCA 2JEGA 5HP1A 4ED8A 1JXLA 2DTUA 3NF6A 1XR6A 4ZTFA 5K14A 3K58A 3QNOA 3U3GA 3TAEA 4LQ9A 3MECA 4IG3A 3K5LA 2X6NA 4Z4CA 3C94A 3OJSA 3MR6A 3L2UA 5DQIA 3V6DA 2FBYA 3KMQA 4CERA 3KLGA 2BANB 3AVNA 1S1WB 3DMJB 4U7CA 1TK0A 1RYSA 4ZHRB 3FDSA 3M8QB 5J2NA 1EP4B 4N47A 3HHKA 5HBMA 4C8OA 4RNMA 1R0AA 3O4QA 1VSDA 1GOBA 3VQ5A 1WSHA 1JLFB 3BREA 1RBVA 3VQBA 5F8MA 4GW6A 5KG1A 2HVHA 3TWHA 5KG7A 3NBPA 2RN2A 4BE1A 3IGNA 4FJGA 1LAVA 4WFYA 3HJFA 3LWMA 1B9DA 4DTJA 4NLOA 4CHYA 4FJHA 3AVCA 1B9FA 4DG1B 5EUHA 3L8BA 3Q8QB 3L2RA 4R8UA 4FS1A 1LWFB 5CYQA 4KSEB 3G6VA 1HRHA 1VSLA 5KFDA 5F8JA 3QIOA 3NGDA 2OPSB 2OA8A 4HCBA 1S4FA 2CKWA 4KTQA 4TQRA 3QLHB 2UUTA 3KK2B 4I2PB 2G8IA 2R8IA 4M3UA 4KKOB 1TV6B 2ZKUA 2IGIA 4RNNA 2VG6A 4H4OA 3T19A 4ZP6A 4YR2A 2W8KA 2VWJA 4RNFA 2HB5A 2AQ4A 3QETA 3M8PB 4DFKA 2C2DA 1HMVA 2HWIA 3WNGA 3TAMB 1TKZB 1GOCA 3ZT3A 2IM0A 4B9UA 4CE9A 3SQ4A 2KW4A 2VG6B 3S3NA 4NLTA 1KFSA 4DFJA 3DLKA 3QGIA 3ISNC 3ZSZA 4MH8A 1TV6A 3ITHA 3PHEA 4K4ZA 2EX3A 2ASLA 2OPPB 1NKBA 1IH7A 4O3RA 4W5TA 2D5RA 5KI6A 1SKWA 2ASDA 1IKVB 2R2RA 2E6MA 1C1AA 4ZP7A 4M3RA 4DL2A 2FC0A 3TAPA 1LWCA 5L1LA 3WNEA 1SL2A 5SWMA 1FKPA 1N48A 2XHBA 1VSMA 5KFAA 3BQ0A 3NH1A 3LPUA 2KZZA 5KG5A 3MEDA 2IC3A 2YNHB 3MF5A 4IRKA 2C28A 3QYYA 3IN5A 4FK4A 2W9CB 4XPEA 4QW8A 1TKZA 1JL1A 3TAMA 3MEGB 1KLMB 1BI4B 3MXMA 3V1OA 1U47A 3D45A 3SUPA 3PO4A 1W25A 4NYFA 1KCFA 1RT7A 2Q3SA 3FRZA 1IKYA 1S48A 5KFCA 3SQ0A 1JXBA 3ZT2A 4WXWA 1YT3A 4H4OB 3H59A 3PW5A 1VSJA 2Z1JA 4CJQA 4M45A 4CJ5A 3KMSA 4DU3A 2BRLA 2DPIA 4IRCA 3SI6A 5KFPA 2O5DA 3T5LA 4ZHRA 1LAWA 4RG8A 1BCOA 1HNVB 2RF2A 4FJ8A 2OPSA 3K5OA 4QWEA 1KFDA 4CF2A 1GX5A 4TXSA 3AO5A 3PR4A 5KFNA 1KVAA 3RBDA 4JV1A 4DS5A 4K4YA 3PO5A 1TAUA 2VA2A 4NCBA 3JSMB 4F50A 4LH5A 3BDPA 3JYTA 2YKNA 1JLCB 4WE1A 3CJ2A 1QE1A 1TK8A 2FJWA 3NFAA 4KREA 2AGOA 3C6UB 4KB7A 4WFZA 3AA5X 3NBPB 3I5BA 4O0JA 3HXMA 3NAEA 2YV0X 3DI6A 4DTSA 1BGXT 4WFXA 3OYCA 3D28A 1N6QA 1R0AB 5HBMB 2ZQBA 1S6PA 5C24A 4PA1A 1EP4A 1SKSA 5HLFB 2G8VA 4KPYA 3BJYA 3DMJA 3AO4A 5KRTA 4OGEA 1SL1A 1FK9B 3HVRA 4NZ0A 3KLGB 1BQMA 1D0EA 3V6DB 4YR3A 3QZ8A 5I42A 4ELTA 1S1XA 3BR9A 4IG3B 3MECB 3G6YA 3LANA 2V0NA 5KFEA 3CJ0A 3SCXA 1F21A 2F96A 3P83D 3VQPA 4C8LA 4HVJA 1RILA 4KTWA 1A5XA 2W8LA 1QTMA 5HP1B 3H08A 5I42B 4CJSA 4X2BA 4Z4GA 4K4SA 2HNDB 4JV2A 4NLRA 1FK9A 5JXSA 3G86A 1L3UA 4LSLB 3BSCA 3G0ZA 1RTHB 3UDLA 5L1IA 4G3IA 3N6LA 4M94A 1U04A 3GIMA 4NLGA 5KGWA 5D3GA 3NAIA 1RBTA 4J9NA 4K4WA 5KFMA 4WZMA 5C25A 3ISND 2W9BA 5KG2A 2XY8A 4HUFA 2Y1IA 3LWLA 4DTXA 1I6JA 3OYFA 4Q44A 1ZETA 3D0PA 4N76A 2R2UA 3CG7A 4KAZA 5KFSA 1QE1B 3RMAA 1JLCA 4WE1B 3V4IA 3KHHA 4FW1A 3JYTB 3JSMA 4CEOA 4CHQA 1JLQB 5EU7A 1CXUA 5KFVA 4CJRA 4NLWA 2KTQA 3H5XA 3HM9A 3KLIA 3NDKA 1TL1A 4N56A 3HVWA 3VQ6A 4W5RA 5J2PB 2O4IA 1KVBA 3H98A 1HNVA 2RDIA 1K6YA 1TAQA 1CZ9A 1RA6A 1J53A 5KFHA 1N56A 1BCMA 2ZE2B 3V1QA 3SJJA 4YFUA 4JUZA 3AA4A 1T05B 4O5BA 3Q8PB 4CESA 4F3OA 3KK1A 4FJ5A 4M3WA 5J2MA 1D5AA 3KIOA 4K8ZA 4FM0A 1TP7A 4FZXC 1RNHA 1Q9XA 1XWLA 1J9AA 4HYKA 1RT7B 1RTJB 4AHSA 3KD5E 1HPZB 2UUWA 2FLPA 1RT5B 1RDDA 3RRGA 1JXEA 1KLMA 1BI4A 3OS1A 4MK7A 3V9SA 1GX6A 4CJEA 1HNIB 1DTQA 1SV5B 3BSOA 5HRNA 3EPIA 1NKCA 3L2VA 1ZBUA 2FBXA 5KFIA 2IC3B 2YNHA 1LW0B 3MEDB 3OYEA 3OYLA 4BE2A 4ECZA 4E7LA 3TVKA 1XI1A 4FXDA 2KFZA 4EEYA 3KNAA 3A2FA 3DRSA 4CEEA 1FKPB 4JS4A 2HHXA 1LWCB 2FLLA 4I9QA 2J6TA 1IKVA 2BDPA 4CGGA 4HHTA 1RTIB 3QIDA 3NHGA 3QZ7A 1C0UA 4ECSA 4CIFA 1C1CB 4CF0A 5DGBA 4ZP9A 4EZ9A 4IG0A 4BWJA 2RPIA 1D9FA 4HCCA 2BGGA 1HYSB 3DLKB 4GC6A 4DSEA 4F4ZA 2XY6A 4IR1A 2RKIA 4ECWA 1BQNB 1RT6B 4FJMA 5C5JA 2JEJA 1DTTB 3OYIA 4JLHA 3M8SA 3NAHA 3DM2A 4LH4A 2V9WA 1QSSA 4NRUA 1L3SA 5DG9A 1HMVB 3VA3A 4N41A 4EP5A 3HO1A 3M8PA 1WAJA 4FLTA 1U49A 1JLBA 1NHVA 2YNIB 2HHUA 1Z26A 4IQXA 4RW9B 4NCGB 4CK3A 3PUFA 1KTQA 4CJ4A 1LWEA 1BISA 1MU2B 4FCYA 3V9WA 3MAQA 2OPQA 1JKHB 3ASMA 2HHSA 4DSKA 3LZIA 5KFQA 4MK9A 4IOBA 5F8LA 4E0DA 3AV9A 4I2PA 3KK2A 4OKKA 1GOAA 1TKXA 3QEVA 4TN2A 4DL7A 3IAYA 4QWAA 4F4XA 1FKOA 4ZMMA 5CYMB 1G15A 3TABA 2XO7A 4DTUA 4Q0BB 4TLRA 2R8GA 4DU4A 1WLJA 3OSPA 4Y1DA 4CEAA 4ZPAA 1VSIA 4ZPBA 3CIZA 4NLXA 2XCAA 3ZSWA 3OY9A 3CDWA 2Z1IA 1S1TA 1RDAA 4URQU 4J2EA 4KO0A 2P1JA 4DMNA 3PW7A 3HVAA 4HKQA 4FVMA 4ZP8A 3T5HA 5CYQB 3KOAA 3P1GA 3K2PA 3IS9A 1NK5A 3ZT4A 5FROA 1QQCA 4ELUA 4U6PA 3RB0A 4O44B 3IGVA 3G6XA 2IBKA 4KFBA 4R5PB 3LDSA 3M9MB 4FM2A 3NCIA 4B08A 5KT2A 3ULDA 4OLAA 4FJJA 4M3ZA 1JLGA 2IMWP 4ZPCA 3DLGA 4J9LA 4DFPA 1SH3A 3HVTB 1T94A 2HWHA 3CFOA 5KT7A 4OVLA 4PUOA 3TR8A 4N5SA 4CHOA 4OLBA 3D5MA 3AVBA 1NK7A 2DPJA 3DLEA 4IR9A 2OPRA 1Z25A 1NJZA 1RT3A 5EWGA 4ED7A 4YR0A 3K57A 1TQLA 3PJXA 2D0BA 1TVRA 3T1AA 5K14B 4F3TA 2WB4A 4CGJA 2DFFA 2JEIA 2F8EX 4OPJA 4CHPA 2R8HA 2W42A 2B4JA 4RW6A 1NK8A 1J5OB 2JLEA 3RWUA 1HQUB 3VQ9A 3GIJA 4M41A 1RTDA 4LSNA 4CJUA 3QNNA 3S3MA 2ILZA 4H4MB 3SI8A 4CJKA 4B3OB 1C0TB 4FJLA 5KG0A 3LP0B 3SQ2A 2P51A 4B8CA 4W5NA 1WAFA 2ZD1B 1QSLA 1S0NA 3RRHA 1L3VA 4Z4EA 3ZSOA 3RR8A 4IH6A 1TGOA 4URGA 4NLQA 2ITGA 5E41A 2G8FA 1D1UA 1VRUB 3DRRB 3F73A 1LW2A 3PX4A 4ED1A 2YNGB 2AGPA 4J9KA 3OYJA 2P5GA 4DQRA 3PVXA 2B6AA 5JUMA 3MR2A 4QWCA 3AVIA 4FLXA 3V6KA 2HNZA 1XHXA 4HUEA 4DTRA 4FW2A 2IAJA 4FM1A 2AGQA 5KFFA 1KVCA 4EO6A 3OSNA 5KFLA 4CEQA 1L3TA 1D9DA 4ZTJA 3P5JA 1EX4A 3TAQA 3RB6A 2J6UA 3NL0A 1ITGA 3O3HA 4QWBA 4O3SA 2B43A 4FJ9A 2AX1A 1S9GB 1YVUA 3LAMA 3SFUA 3VA0A 5FDLB 1RT4B 3KJVB 2BQUA 4O4GA 3N6MA 4IDKA 2FJVA 3H2LA 1TK5A 1JLEB 1JLAA 4CK1A 3QEPA 3UPFA 5KFJA 1WNSA 3PR5B 4W5QA 1WSIA 4ED0A 3E01A 4G1QA 3QEXA 4CHNA 4ECYA 1RT2A 2WOMB 1UAXA 4TYBA 5FRNA 4QOZB 1UWBB 2HHVA 4CIGA 1S6QB 4OL8A 1CZBA 4Z0UA 1TL3A 3PW0A 5DG7A 3MXIA 4DTOA 3V81A 3F9KA 1UA1A 5KT3A 2Z1HA 3NKYA 1S0MA 3HPOA 3RAQA 4PWDA 4DL3A 4CGIA 3DRPA 3LP1A 2YKMB 4CGHA 4ELVA 4IFVB 4NLYA 2B5JA 1QS4A 4OPKA 4W5OA 5C42A 3MFIA 1REVB 3THVA 3KLFA 4I7FA 2G8HA 3NF7A 2WONA 1WSGA 1SUQB 4NLPA 1U48A 1HYVA 2YHBA 4E89A 1S1VB 5J2QB 4IBNA 1ZYQA 1LV5A 2IDOA 4I2QB 3T5JA 2JEFA 4DF8A 1EXQA 4DQSA 4TSXA 4B9MA 3TANA 1SUQA 3RAXA 2WONB 5KFOA 3SYZA 4NRTA 1HQEA 1REVA 1U45A 5KTQA 1SH2A 2IS3A 2Y1JA 1IKXA 3CQ8A 4MQ3A 4HUGA 2WHOA 1UOCA 3DRPB 3LP1B 2CJQA 5KFYA 2LSNA 3KK3A 4OKJA 3V81B
chains in the Genus database with same CATH superfamily
1WEXA 2CZ4A 3O3FA 4W90B 1YBAA 1X4HA 3CCJN 3VF4A 1E3MA 3MX2A 1TMMA 4CJVA 1ZBSA 3QERA 3VAIA 4C8YA 3N5BA 4CFDA 3T1HF 2BE2A 3T5KA 2DNNA 2GV1A 3MD1A 3CQXA 4MJKA 3UD3P 3O9SA 4ED3A 4J9SA 4M63A 4CM0A 5MLCV 4BGBA 2E5LK 5DLFA 4RW7A 4PG6A 4BRAA 5LJ3Y 1LXJA 3RAMA 4E1NA 2H65B 5GAHP 1RAHB 3QMLA 4JI2K 2E29A 1UA0A 1N0VC 4ALZA 3A8KA 3ENBA 2PY5A 5CE3A 4DWIA 2GS8A 1S6OA 2IVPA 2DJWA 3BS9A 4Z4HA 3AOCA 2VJVA 2HOEA 4AE5A 4K50A 5HL7L 2GFFA 1MWMA 3KLEB 2UV8G 3UKRA 1NMEB 2I5JA 1YZ7A 3FFIB 1Q18A 2ZH8A 1LOTB 4WQ4C 4CEBA 3H8YA 4P7TA 4TNOA 1Y5IB 1XHZA 3WC0A 5HO4A 3W63A 5CZ1A 3CJBA 4KRFA 4KV8B 2VFVA 3D0IE 1VRTA 3TUIC 4FLYA 1XK8A 4Y65A 2ZH1A 4F8RA 3MZIA 1S1UB 3G8SA 5DK5A 3GBTA 4L73A 1H1VA 1P9YA 4IJAA 4BR0A 4O3QA 1N36J 2X1GA 4B1YB 3QGPA 3EGZA 5IT9O 2CPDA 1EX8A 2XWYA 1WD6A 2XI2A 3D9BA 2V94A 5F0XA 4WZQA 2ETJA 2YWKA 4NEZA 3M30A 3FLCO 2RH3A 3C0BA 2BRKA 5CH7B 3T6JA 3OR2A 2C3MA 5T41A 4L3KA 4W92B 4FLWA 1WF0A 1RT1A 3U1MA 3NWGA 2NLWA 2O8DA 5KFTA 4HACB 2HMPA 2BQRA 4PG5A 4JI1F 2EEYA 4NXMJ 4ZCMA 3DNCA 1R31A 2UU9F 1HBUA 2LECA 4JB8B 4C23A 3SUOA 5IQQA 3PLAA 2GAHC 2Q6CA 2IVMA 2PIIA 3MFHA 1HBMB 3HVTA 1T7PA 4DPWA 1HL6A 2PA3A 3JB9k 2W7OA 3K5NA 2G8WA 5LMUJ 3L3UA 1XNQK 3Q8SB 3CJ7A 2YNFB 3OYKA 4O3NA 1N5YA 7FDRA 2CGJA 4E2FB 4PL8A 2RSQA 2K7JA 3NMRA 3RB4A 4ILRA 3G82A 1XR5A 3DYAA 4MFBB 2Q43A 4RPFA 5DM7Q 4WFBQ 4NLSA 4J9MA 4GO5X 3QDKA 3WNHA 4ZVQB 4P2SA 5LSLA 1J6ZA 4ID5A 4IKFA 3IBFB 2UYTA 3I9V9 1Y9OA 3MMBA 3CCQN 2F4FA 4WYLA 5D77A 3SDEB 3TJ9A 4OHYA 2E20A 3O4NA 3CFPA 3R2DJ 5JVGQ 3J7YU 4IRDA 2QXFA 2J8AA 3GG1A 3I0RA 2OJ3A 4B3SJ 3U6FA 4B3SK 4L3QA 2GAGC 3WXJA 1XMOK 5AQMA 3KNGA 3RMDA 4Z94A 4XO0A 2CJ9A 2K8GA 4A2AA 1J54A 3TA1A 4UOFA 2CPZA 1TKTB 1V5VA 3HP6A 1IKXB 5E3QA 1S6UA 1HYZA 3C16A 2P8IA 4BR4A 3R97A 2Q79A 3DOKA 4E3SA 1WNEA 3EKUA 3DM2B 2VF3A 3QB0A 4JI3F 2B8PA 3X1LB 4I2QA 1VC5A 1RT6A 1S1VA 5J2QA 3H20A 2RRBA 1NGHA 2DH7A 1FE4A 3C2PA 2X51A 3AD8C 4ZJOA 2C3UA 3LF0A 1SB6A 3BGOP 5DLGA 2YH0A 1YRUA 1LCUA 1I3AA 1WSEA 2KFYA 4PG4A 3ENVA 4ANEA 5HMZA 5IT9Y 2E9ZA 3DXMB 3ENAA 1N33F 1S9EA 4Y34A 4RO0A 4IYQA 4CO2A 1U09A 2BZ2A 4I4BA 1LW0A 4OI6A 3FRYA 5ITHA 5AJ3K 1FJ7A 2PI5A 1SV5A 3R7BB 1LQ9A 3RMCA 2KG0A 2ZBCA 3TYTA 2PAVA 4WF9L 4J2BA 1RT5A 1T3VA 1QAJA 3KTQA 3ZZUA 2DY4A 1WEYA 2WTFA 3MCOA 2VFRA 3PRDA 4J2DA 3VQSA 1TUVA 3EDQB 2DNLA 4K42A 1RT4A 3AFGA 5LL6d 5CD4H 1ZBLA 4QJVA 1VQ6S 3DDNA 2ZBQA 4A8KA 4XTTA 3KLFB 4RUAA 1JJCB 4LF7J 1HR0F 1X0PA 2LU2A 1RBAA 2HLUA 4YHHF 2IM2A 5BYQA 2C22A 3I87A 4J9PA 4YS2A 3PRBA 2XO6A 3H4BA 1H3DA 1LFWA 4BC4A 1NNDA 2QWQA 2IBOA 3NH0A 2AWZA 1WTBA 2E2NA 4YP3A 4LR7A 1Q16B 3SEOA 1X5PA 2BJ7A 4JN4A 5IT4A 2FVSA 3G9CA 4B9LA 4F4WA 3G4SN 3CMAN 1QLNA 2DR7A 5IM0B 1JLEA 2N4CA 1CEZA 3OHAA 4C8MA 1HJOA 1T44A 3OR1A 3LP0A 4LRDA 1VSHA 3WQUA 2MLXA 3ISZA 3UN3A 2E4LA 3VVUA 4LF4J 1X1PA 1G3OA 3KUGA 3VF0B 4CZHA 4O55A 1HWKA 2MLYA 3GSIA 4F4YA 3R5BA 1ZOTA 3CT9A 4DR5K 4KHPK 1F2HA 3KJFB 1DLOB 1VS3A 1IM4A 2GC8A 2F8MA 3OTDA 4X4TA 1K9MT 4E7KA 2VFSA 1ICEB 4F7VA 2MQMA 1NK6A 2VC1A 2WZ1A 1UVIA 1ZBFA 4NCAA 1OH5A 5DZ6A 1FJEB 3SCLE 1WJ9A 5A2QY 3R1HA 4E7JA 2NRRA 2ZD1A 3TZWA 3MUMP 3QNWB 3W5YA 4PUOB 3B6OA 3SV3A 4O4RA 3LPTA 2ZH6A 3OVNA 4DFMA 3NE6A 3FCWA 1BIUA 3HFZB 1OVQA 2J0WA 3KWMA 1CJVA 1DQ8A 1O51A 5AZIB 3VEWA 4MK8A 4QAGA 3KG4A 2AP1A 4FWOA 4RW4B 2UVRA 1T6CA 4K59A 1CXQA 4FF2A 2DH9A 1X0FA 4OHVA 3CCSS 1OY9A 4LFAJ 5DG8A 1Q5YA 3RB3A 1S1TB 2AZ3A 1RT3B 3NGRA 3C6AA 3CJQA 1IV0A 3PW2A 4WYBA 2F9WA 2XB2D 1R8PA 4Q5VA 2VD3A 2HG4A 4C8KA 1K0TA 3CM5A 4CLFA 2IM3A 2QMXA 2GCFA 1D4XA 3NGKA 2ILYA 3M9NB 5JJBA 2FVCA 4C0OC 3SMSA 1JLGB 1U02A 3QINA 2N3LA 2HFSA 5KFXA 2KI2A 2BM1A 5JICA 4H0TB 2PYJA 3M8RA 2HVIA 3AA3A 2CPJA 5SZTA 3AVLA 1GNKA 3WQPA 4LF5J 3CJ4A 5AQPA 1UP1A 1IBLK 3J81j 3T1HK 3A5OC 2HMIA 4KHMA 4USTA 4CZJA 2CYYA 2DRAA 4FLVA 1BQNA 3ZT0A 3T9ZA 4AT1B 4ZVHA 2F4VK 3CO0P 1WDTA 2EG2A 1MN7A 4FWKA 1K73T 3NGYA 4DV1K 3VEOA 1X8DA 4USVA 3BBBA 1Q81T 2IM1A 3IA0A 2LXIA 1C0UB 2HGMA 5GAGU 1TL5A 1GLJO 2OPPA 3ITHB 5KT5A 3HHLA 2ALZA 3LM2A 4KB0A 5KFKA 1YVNA 4JI8F 4FYXB 3PIPQ 1QZ5A 3KKSA 4RBUA 4PY5A 4P52A 2ZNZA 3N0VA 4DR6K 2YKAA 4OI1A 2D41A 1Q8IA 5JMNA 3MM9B 3N9UC 4U7UK 3L4QA 2Y0SD 3GIRA 5M1FA 3OLAA 4PG8A 1RTJA 5IC4B 1KOOA 1HWIA 4LBPA 4FLUA 1SC4B 1TL7B 1W2BR 3IWXA 3V2UC 4DV7F 4L75A 4FDFA 4ZLJA 4HWIA 3OBWA 1PJ6A 3HD2A 4KHPF 1SQKA 5CY4A 2CAJA 4JKDA 1T8EA 4FJXA 1S7IA 4M42A 3O9RA 4MIBA 2E9RX 4A59A 5TKYA 5ETVA 1TYQB 3QLHA 2M8DB 2UUAJ 2NXCA 1YVFA 5A6PA 3T1YF 4NXNJ 3AA2A 1UPMB 3L9ZA 1Q1KA 5BR9A 2O8CB 4AL5A 4AHTA 3OUYB 2Q0RA 4JKFA 4ZPDA 3NVMA 4BACA 3ELHA 1YJRA 2YWGA 3B4MA 2A1SA 3FSXA 2MZ1A 2F9JA 3VWSA 2K3IA 5T14A 1XMOJ 4EFAC 2MQ8A 3H3OB 2PZSA 4MIAA 1HNZJ 2CWXA 4V19S 2F1FA 3S3OA 4CLPA 1FI4A 1T3OA 1BUPA 2UXCK 2DR6A 4DBQA 1RGVA 2UXBF 4K5RA 3A5MC 3VGSA 3CFRA 3I5CA 2KHOA 2QWOA 3NH2A 1U6BA 4U67L 3CC4N 4JRQA 3ZXWA 2U1AA 2K1RB 4FP9A 4P72A 4TVAB 5BPNA 3RBEA 2CNKB 5DQHA 1FTRA 4E7IA 2XTJP 3B6PA 4CJFA 4DV1J 1DGKN 4CGDA 1EAYC 4DUYK 2CGKA 2G8KA 3I96A 2HAIA 1KSPA 1NDPA 1X4AA 2MXYA 1RAIB 2EWSA 4P7VA 2WFBA 4IFYB 4CJTA 3HOSA 4XIUA 3C19A 2OMLA 5HSPA 3FSYA 3V9UA 4DR6J 1FE0A 4PXDA 5EX3A 5L38A 1Q5VA 2AZ1A 1J5EK 2QLFB 2RHSB 2DGWA 4DQQA 2WVFA 2DFEA 3O9TA 3QIPB 1YTUA 3PYGA 4JI5K 2GQCA 1RTHA 4FJIA 3QT8A 6AT1B 4Q43A 2E1PA 4B1WB 1HKGA 3AVHA 3OBYA 1KRPA 4CZLA 3LDOA 2CVEA 5KG3A 3CMAS 3TA2A 5D15A 2JEGA 2OANA 2ZZTA 4ED8A 2IRXA 1JXLA 4EHUA 3K58A 4EFHA 3U3GA 4LBHA 3TAEA 4LQ9A 3K5LA 4Z4CA 3OJSA 3CCSN 1NDKA 5DQIA 2GO8A 1SKUB 1S1WB 2LQ8A 4U7CA 1I5OB 1YBTA 3CJ1A 3FDSA 2NRVA 4KQZA 1UW9A 3B4DA 1EP4B 4C8OA 4DXLA 1VSDA 2KVIA 5HQMA 3QJLA 4RWTA 2MZJA 1QQOA 2F9TA 2P9KA 2E7XA 4DR1J 4BR7A 2MKYA 2OELA 2W2MP 4C8ZA 2GELA 3VGLA 1Q8BA 4FJGA 1QY7A 2P9SB 3HJFA 1FF2A 4BROA 4CHYA 1DJ0A 3Q23A 3TU5A 2X1AA 3BF1A 1RGIA 3RUBL 3A8YA 5HJYA 2QX0A 1CJKA 3BB5A 3FNNA 2WBNA 1VSLA 3DXKA 1H72C 1KTVA 3CSKA 4ZVTB 1RHQB 3R5JB 3DWLA 2BJ3A 2OA8A 4PPDA 4ZITA 4J7CA 3FZ2A 2BKNA 2KYZA 5GAGP 2VWBA 4K2JA 1LFPA 2FY1A 1UFLA 5T7LB 2E7WA 2IDEA 3ATUA 2R8IA 2VICA 2V34A 2H1YA 2QRRA 4EGLA 3P39A 1H38A 1IWAA 2DGXA 2ZKUA 2XYHB 1RAEB 4IEIA 3R2CJ 2VG6A 3SIPB 4DUZK 3JAMO 4ZP6A 1PAEX 2NUHA 2VWJA 3L3CA 3QETA 3CD5A 2C2DA 2QWNA 5EVZA 3NWRA 2VL1A 3R3TA 5LJ5Y 2BM0A 3ZT3A 4B1ZA 2ZHAA 4I1TA 4B9UA 4CE9A 3ZX0A 3W64A 1RWOB 1GXUA 1NO8A 2KW4A 2ZWOA 3ISNC 3ZSZA 3GR0A 1AFJA 1TV6A 5C2CA 2POKA 3D68A 4K4ZA 2EX3A 1N34F 1NKBA 2D5RA 2AJ0A 2R2RA 3AQPA 2E6MA 4M3RA 4DL2A 4ZVSB 5L1LA 3WNEA 1E6YB 2LDIA 2XHBA 1IR0A 1IBLF 1RHUB 2YX6A 3NH1A 2KZZA 5KG5A 2DGSA 4DV2K 5HJXA 3JXOA 2W9CB 4UTGA 1RKIA 3VALA 4IOAQ 5C7PA 1XMBA 1RAFB 3D45A 4WCEQ 1RT7A 3C7NA 1S48A 1VC0A 3ZT2A 4WXWA 3AA8A 1RHKB 1YT3A 5LT5A 3H59A 1AUSL 2OD6A 4M45A 3KMSA 4DV6F 4LF5K 3WXMB 3I32A 2HRUA 2BRLA 2DPIA 1R27B 4FPIA 1R89A 4QR1A 2MSSA 3ZZTA 5IC6B 3QBCA 2QLBB 3T5LA 5THWA 2UXCF 3EE9A 4BC9A 3TP2A 2C2MB 2NYHA 3K5OA 2KL8A 4TXSA 1U0HB 2ZM6J 1RU1A 3MD3A 3DXKB 1KVAA 4K4YA 4AQYF 2YJEA 4CZCA 2VA2A 3NCPA 1IBKK 4FVUA 4F50A 2YKNA 1TZ0A 3NFAA 2UXDK 2P9SA 4DUYF 3CJSA 4D3GA 3VVTA 3ZETA 5L46A 3HXMA 2YV0X 2DB1A 4DTSA 2P9KB 2CPIA 3R8EA 1BGXT 4WFXA 2PT0A 2IVFB 4JNEA 5BPLA 2ZQBA 1S6PA 1EP4A 5HLFB 1ZA1B 3L4IA 4LMZA 3J8AA 4ZVUB 4JBCA 4QU6A 2QIFA 1VQPN 5KRTA 4OGEA 3M2UA 5AZJB 2GZOA 3P38A 2NZCA 2YKPA 1IQZA 1WDDA 1IN0A 4ELTA 4DR2F 1S1XA 3G6YA 4DR4J 3QJJA 1XEZA 2GMHA 3CJ0A 4MKYA 1F21A 4WTOB 4KTWA 4EI2A 4LF8K 1WACA 2V8HA 4X2BA 2PD1A 3BPDA 5H9EK 2QXLA 2HNDB 3Q2SC 4Q2MA 4H0YB 4NXNK 4LSLB 2CUYA 1RTHB 3A5NC 3VEZA 3N6LA 4UY8T 1VK8A 2RS8A 4MKVA 4EAHD 4M7XA 5KGWA 5D3GA 3C8YA 3OQ2A 2J0XA 5BJRA 3RGIA 1RBTA 4J9NA 4K4WA 1D9AA 4GVEA 4JK8A 2W9BA 2XY8A 1EIYB 4JI7K 2V7ZA 3BF3A 1NSQA 4KGVB 5KFSA 1QE1B 3KHHA 4Z2XA 2WVDA 4W98A 3Q22A 2XMJA 3PJ9A 3T1HJ 3VV2B 4BRLA 4CJRA 1WTFA 3HZ6A 1LEOA 3DXSX 3H5XA 1VAZA 1RZMA 2FSNA 1CULA 1TL1A 2GX8A 5KAKA 2O4IA 5JMVA 1KVBA 3H98A 1HNVA 1K6YA 5CABA 1TAQA 1RA6A 4QPTA 4ERDA 5KFHA 2QA4S 2XMUA 2DR8A 2ZE2B 3VR1A 1WC0A 2RDDA 4YFUA 3SJJA 4E1JA 2HRYA 5U47A 2NUUG 3Q8PB 4CESA 2MB0B 1APSA 1OO0B 3W2WB 1X60A 5G4DA 1XWLA 1J9AA 4JKGA 4KHPJ 1HPZB 2UUWA 3R6LB 1CG2A 1JXEA 2HWTA 2CH6A 3OS1A 3H45C 3DU5A 3V9SA 1GK8A 1GX6A 4DR2J 1UPPA 2P9IA 3NVKA 5HRNA 1CZAN 4L72B 2M70A 3OUYA 2IC3B 2NZTA 4E7LA 1ACMB 4LF4F 5B7WA 4CEEA 4X4SA 2GEMA 4C1NI 1YGYA 4PRFA 1LWCB 2FLLA 1ZH5A 4I9QA 1FJGJ 3VAGA 5HN0A 1UKUA 2GQ2A 3QIDA 3NHGA 1HQ2A 3GDQA 2ZGZA 4CLWA 4CF0A 3DKDA 4DJBA 2NSCA 5B0BA 4CLSA 2BXJA 4HCCA 2BGGA 2O8EB 2LVWA 3M1VB 1MROB 5B0DA 2VQFK 2RKIA 2ZH3A 1EQYA 4ECWA 1KONA 2MKSA 3LQVA 5C5JA 1OPZA 3D7SB 2JEJA 4JLHA 3M8SA 2V9WA 3P5TL 1WC4A 2PMHA 4NZ6A 4MLHA 4LF7K 3EVMA 4IQMA 4YHHJ 3M8PA 1U49A 4FLTA 2KKHA 1PO6A 3PEJA 1LWEA 2QWRA 1S72N 1YITN 4JAXA 3WHIA 2XLJA 1JKHB 4KH4A 3ASMA 2HHSA 5KFQA 4IOBA 2N4DA 3OW2R 4E0DA 1S59A 3CPWR 1HKBA 1GOAA 1FJGF 2V67A 2EPIA 1WORA 3OA9A 1R8CA 4TLQA 1SPBP 2XO7A 4Q0BB 4TLRA 1WLJA 2XNQA 2YH1A 2CJXB 2D3O1 1RDAA 4DCJB 5GMEA 3BZKA 1P1TA 1T9XA 1RADB 3I56N 2D9OA 4F0MA 5EHHA 1K73O 2HK2A 5FPMA 4CYUB 1IBLJ 4PPZA 2P2CB 1RB0A 4LFBF 3LDSA 1WI8A 4B08A 2VZ9A 1Y10A 1M5PC 5F0WA 1JLGA 2DXDA 2J0SD 1HX1A 3UCGA 4ZPCA 1OYEA 4DFPA 3CFOA 4OVLA 4N5SA 1FWKA 3R9LA 5B09A 3RJMB 4CHOA 3FZBA 2UP1A 1VBZA 2VKZG 3SBMA 2OPRA 2V52B 3FKBA 2ZOGA 5KPZA 2FSKA 1RT3A 4MT1A 1TVRA 3T1AA 2MY8A 2W2NP 3IWNC 2WBMA 2DFFA 2JEIA 4CBXA 4DV6K 2R8HA 2VOPA 2FPHX 5AQVA 1Y4ZB 4PEOA 1RTDA 4LSNA 3U9DA 3U1LA 2UV8A 3QNNA 2ILZA 4K0KK 4GKJJ 2CPYA 1C0TB 2W41A 1U6FA 3ZZRA 3JSRA 5KG0A 1ZXOA 4NXNF 1PCAA 1AUDA 3M6WA 4W5NA 4BR5A 2UUAF 1WAFA 2ZD1B 5FPNA 3GFYA 3QT7A 2JWKA 1QSLA 3BH6B 2DXFA 4IH6A 1TGOA 4URGA 3SLCA 4C0HA 2VPZB 5SUHA 4YOWA 1IBCB 1D1UA 3B8HA 4NWBA 3F73A 1M1GA 3PX4A 1IR2A 4OHZA 1X3NA 2E2PA 2YNGB 4J9KA 4DPXA 3OYJA 3QBWA 3CMQA 2W6KA 3ZNUA 1VBYA 3V6KA 1H6KX 4FYVB 1IWGA 3A8EA 1BXNA 2IAJA 4FM1A 2AGQA 3RSEB 2ZGYA 4CO5A 3W9HA 5KFLA 2RS2A 1S72S 1YJNS 5K5MA 3M05A 4OZ0A 2ASOA 4ZVOB 2J6UA 1ITGA 2HPUA 4O3SA 1ESVA 2F8HA 1T95A 5B0GA 4ES2A 4FJ9A 1XUPO 5IZHA 1YRTA 2V4JA 5AXMA 1YVUA 3EN9A 3W5ZA 5FDLB 3KJVB 3MCNA 1FVSA 1KC8O 3BZQA 4LF7F 3N6MA 2D69A 3QBXA 4IDKA 1NGBA 3H2LA 4OHWA 1JLEB 2Y1LB 2NXNA 4ZOSA 2F3JA 4QZVB 3QEPA 3UPFA 4W5QA 3E01A 4NASA 3H7HB 3CJTA 1BQXA 3I6PA 4ECYA 1I1GA 2VQEJ 1MN9A 1UAXA 4M5HA 2E88A 4QOZB 5ETOA 3BYPA 1MNEA 4CH0S 1HI0P 1WKKA 3C3LA 1E6VB 4DTOA 2Z2ZA 4FSVA 4JHDA 2RB7A 2ZKTA 4DR3K 1VQOS 3RAQA 4DU7A 4DL3A 1SC1B 5A8KB 1KR4A 2Q97A 2YKMB 1RP5A 3DOMA 3JQJA 3QPIA 5D4LA 2OD4A 4LF5F 4IFVB 4NLYA 4OPKA 3MWPA 5C42A 4JI7F 1GXTA 3MFIA 1REVB 3A1YG 2B0GA 4DV6J 2D1KA 3KLFA 4I7FA 5E26A 2QEXS 2A10A 2GQQA 1SUQB 3KG0A 3Q83A 3Q7BA 1F60B 1PAUB 4A8FA 3IC1A 1ZYQA 3NLCA 2CWKA 2WC9A 2HBJA 1EQ0A 3CNQP 2DHAA 3TANA 3B78A 3SCIE 4DMZA 3RAXA 1B7FA 1IVZA 4GKJK 4NRTA 1U45A 4DV7K 4YDUA 4DCOB 2WHOA 2P9NB 3LP1B 1PIEA 4M5DB 4UOGA 1S22A 2CA9A 3PIOL 1UZDA 3CCES 3R6MA 3V81B 4ICLA 2HFOA 1EKRA 2QK9A 4QIWD 1E4FT 3R9PA 3HP9A 5F8NA 4QS9A 2KHCA 4GRSA 2FZGB 5L9NA 2WOMA 1QAYA 5DDOC 1QHTA 3KLHA 1RBRA 2H51B 4QYZJ 4CDIA 4YHHK 4YN3B 1HNZF 4CECA 1IQTA 2ZUGA 1OY6A 3E9OA 5HROB 3PJWA 1HLWA 2G0JA 4V1Ak 3A13A 5H9FJ 4CW7B 3NF9A 4CM2A 3GJSB 3DOKB 4X4PA 2BH1A 2FLNA 4M5KA 2G13A 4CJ3A 5B8HA 4I64A 3C16B 4KHNA 5HQ8A 2B8QA 1M5HA 3IRWP 1C1BB 4FBUA 3ZTOA 1XIQA 4AHUA 2B7BB 2NRXA 4DL4A 2IOCA 2WSCC 1RCHA 3WIUA 4AL6A 5KFWA 3GV7B 3EXCX 2GV9A 2Q1LA 3TSUA 5RUBA 3OYBA 2MKJA 3I0RB 4DR7F 1VSKA 4UY85 4U7BA 4MDAA 3QFUA 2CADA 4DR4F 4DL6A 2XLKA 1UZHA 1C2PA 2DBBA 4TY8A 1NPRA 1F2GA 1Q7YT 4ZJQA 3SDEA 4X62J 4IKAA 2YXLA 5DETA 2W9AA 4FZYA 2KO1A 4ZVRB 5CD4A 1MA9B 4BRFA 4ID5B 2E6LA 3K5MA 3K9KA 4BDZA 2CJBA 3BGRA 2DVIA 4OI3A 5LSOA 1CC8A 2VG5A 2D3ZA 2UU9J 3OJUA 3M1FA 1IKWA 4YNQA 4K4TA 4MFBA 3DYAB 2HHWA 5AQTA 3SAGA 2Z2MA 2QKKA 3Q24A 3HSTB 2MGZA 3EY1A 4A8WA 4OGCA 2F40A 2JH3A 2MGZB 2WB1D 3FMWA 2RQCA 2QLJB 5JS1A 1I39A 2DY1A 2ITMA 2VG5B 2HVEA 4ECUA 3A12A 3QEWA 3AVFA 1SC6A 3AXMA 4HLBA 4KHQA 1IXKA 2OFHX 5IWAJ 2D0CA 1NOZA 4TQSA 1VR6A 2Y3YA 4CBWA 2FBTA 3O4WA 2ZEJA 5CHIA 2AJFE 2ZM6F 1Z6RA 2C3PA 1N36F 4DPOA 4RR5A 4ES3A 2GNKA 4OLOA 2IMOA 3W66A 3V6JA 1X9SA 4FN5A 3ZSVA 2VH7A 4CJWA 2O8DB 3CPEA 3NGZA 1RWPB 1MLAA 3OR2B 1D8YA 2ASPA 1IBMK 3E2EA 4FKYA 2NQPA 3ENWA 4O44A 2NYIA 4KAIA 3AB2B 3VERA 2ATLA 4H54A 3U3YA 3VQ7A 2ZBIA 1NXIA 3K9JA 2RVJA 3G2XA 5F9LA 2ZOFA 4BRMA 5IFMA 5D8HB 4E19A 3L2QA 4ZVEA 1FFSB 2ZBRA 2ZDPA 2NLXA 3D0HE 2HHQA 4KO0B 2IJRA 3BGUA 3KXDA 4GKJF 4KHYA 3VQEA 2PEBA 5M1NA 3X3UA 4IH5A 1OQ6A 3RMBA 3GQCA 4ANCA 2V4RA 4DQPA 1VRTB 1GLEG 1FO1A 1HJRA 3C66A 3OHRA 1TKXB 1NDCA 4CJLA 2QYCA 2VFTA 3VAKA 2XS2A 5IOLA 3VQDA 3FFIA 4WYWA 1HIYA 3ICLA 2XI3A 2L48A 2P9UB 2I5JB 3UKRB 1AYEA 3OL7A 1JK9B 3UWTA 3MPYA 1NPPA 1KOHA 1X9WA 4EK2A 1G6BA 1GMUA 2FTRA 1S57A 4EO8A 5KT4A 4NEYA 2MQQA 1X5OA 4K7QA 2I1RA 3PZPA 4BDYA 1EZZB 3PSIA 4MAKA 3CTRA 3T7ZA 1WHWA 3MN7A 4MKBA 4RW7B 4H03B 5T7BA 1UFWA 3Q2TC 1HYSA 4TYAA 4I7FB 5AQQA 3SZ2A 3W9JA 5JS2A 3LDLA 3CCQS 4B3MJ 3E9LA 1C1CA 3VOVA 3BQ1A 4IFVA 3IRXA 2RHQB 4BRPA 3CJ3A 3J81Y 2D4WA 2R7WA 1U0SA 3Q86A 4CP5A 2E1RA 2IJNA 1E6VA 3CD0A 4FBTA 4EBDA 2KJVA 3GCXP 4U8VA 5IS2A 2W2OP 4EBCA 1DTQB 1HNIA 2GGPB 2CPHA 2BMBA 4BREA 2EC0A 4DV7J 3ZCMA 3NS7B 3F0NA 1X4GA 5D0GA 4USKA 3CF5Q 3GV8B 3KJVA 5FDLA 2BW2A 1FFGB 3ZEUB 5MLCQ 2R2SA 2A42A 4DR1F 2HQIA 1NKEA 2MKIA 2B5JB 2FC8A 2CZ9A 5HMYA 2A2DA 3DU6A 1S97A 2FVQA 4PKHA 3DJCA 1SJ1A 5AQKA 3RR7A 3RSEA 3QEIA 4KBIA 3K8VA 4KHWA 5IWAF 2FQQB 3TQEA 3AOAA 1HR0J 4WP3A 3KLIB 4WCEL 2MHEA 3JSYA 1YJVA 1S10A 4ECQA 2JGUA 1AT1B 5J1EA 4IFEA 4JV5K 4AQYJ 3V4IB 4ZN1A 2RQ4A 1B0VA 3W8GA 4FWMA 4DX7A 1VQNN 4HEA9 4CFBA 1E4GT 4CO3A 1N5SA 1NGIA 3EYZA 2QV6A 4Q45A 4KHUA 1C0TA 3NOGA 4F2RA 1B4SA 2D3UA 1NHKL 4N8OA 4NL5A 2KG1A 1UVNA 4DTPA 4B8AB 2OMOA 3IFRA 3P6YC 3E3XA 1C0MA 4ISFA 3TTFA 3OT9A 4E7HA 2J4RA 3W3DA 2MLZA 3MPUB 4WU2A 3G10A 1SIZA 4ANDA 4OX9J 2DHSA 1YIJS 3AD9C 1RU2A 4AHVA 2AYBA 3N6NA 2AU0A 4J2AA 2UUBJ 2OPRB 3LP2A 1RUSA 3D4JA 4OJ3A 4LF8F 3CULA 2HEKA 2VV5A 3P45B 4OZ5A 3HF5A 4J9RA 2Q0UA 2B9WA 1JX4A 3AAQA 2YPZA 3F44A 4AXJA 4DHVA 3SMZA 5AQLA 2HHHJ 4M3YA 2OGUA 4K5SA 3D6TB 4RNHA 2V8PA 2GIRA 3SQ1A 2R2TA 1R7IA 1KD1O 3HCXA 4NB4A 2DCLA 3DI6B 3JSBA 4JKEA 4CTAA 5BREA 2JC1A 2V2ZA 3C6UA 4FLZA 1ZAWA 3SUQA 2GUIA 3SXLA 1Z1ZA 4HTUA 4CYUA 2R42A 1XMOF 4Z4FA 1QAXA 1T9UA 2GWKA 3D2FA 5AQZA 1ASVA 2AEMA 3HD1A 3L0QA 2FJDB 3DGPA 2YTCA 2ZJQQ 2P5VA 1G7CB 3OTOF 2W01A 3PY8A 2KRRA 1KWMA 4C97A 5K8MA 3V9ZA 3KYLA 1FESA 1FDBA 2RF2B 4Q0BA 4BVPA 1MMNA 1VQ4S 3FZHA 1EETA 2ZOMA 4A4JA 5M1OA 3J80Y 4EYIB 3A3OB 1YF5L 4KGXB 3GTYX 2F5GA 1NZAA 3KUHA 4ZDNA 1UFKA 4OX9F 3MM7B 5F1XA 3MGJA 1JKHA 1ASWA 1HPMA 3LALA 3ATVA 3T69A 5CZVA 3HKWA 2GVZB 1X31C 1LWEB 2QE5A 3EICA 4ZVFA 1NJXA 5ETSA 1RE1B 4F04B 1R59O 1RBSA 1N52B 3ZSYA 1NH8A 5KG6A 2CG4A 3KVGA 1YJ7A 1NCLA 4CO1A 4IZ9A 1HBOA 2HFVA 4C8NA 3M5RA 4NLCA 1IO2A 3O8MA 4DV2F 2VQEF 2BQ3A 4EYHB 1BA1A 4X66J 1TFWA 1HI1A 3BR8A 3QO9A 3AHPA 3OL8A 1S3XA 5DM6L 2A1RA 1MWZA 2EK6A 2RILA 4NLUA 2OFGX 4JP8A 3OYAA 5J1PA 2OPQB 5KPRA 1ZTTA 1HNZK 2QLXA 1M0SA 2D0OA 1DY3A 3EZOA 4DLGA 4QW9A 2X6SA 2BYCA 1Q81O 3UO0A 4WWSA 4DOZA 3L2WA 4QYZK 3S6EA 3VPZA 1HPZA 2XMWA 4NI2A 3H5YA 4NMXA 2KM8C 5DRKA 1XN9A 1VI7A 4XH5A 4FF4A 2RJZA 2DNPA 4CZKA 3AVMA 3K89A 1VSFA 1DURA 4IWVA 2VDHA 4WIQA 3I55N 3DGVA 3DLRA 1EKEA 4AQYK 2VDIA 4LRCA 3VZIA 2QC3A 2V8VA 4R0JA 3BZCA 3P8BB 3M9OB 4WQ5C 4ECVA 3LTOA 3CMEN 1NK0A 2E1YA 1VQLN 1UW4A 2WVBA 3MEKA 3G71N 1TL1B 3AOBA 3ZZ0A 4OJHA 1RT2B 3TJ8A 3H0PA 4G1QB 3C15B 2RDJA 1OH6A 3OLBA 1HKCA 2Z2LA 3VHQA 2AJQA 4NYZA 2C2RA 2W9BB 2M9KA 4DUZJ 3GJRB 3FZFA 1S0VA 3THTA 2ZC3A 2CNLB 4DSJA 4ZLLA 5AQWA 2DNOA 3WIVA 2GW8A 1P8ZA 1JLFA 1RDBA 3EDRB 3VEXA 1FEEA 1RISA 1YIJN 2QTWA 4FS2A 2FVRA 3HHNB 3FEYB 3UE5A 2BEFA 5DGAA 4DR5F 4LSLA 1AW0A 3OL9A 2JHEA 4ECXA 2HNZB 2BANA 3ULHA 2HNDA 5EWEA 2B6AB 3KKRA 1OSDA 2J7WA 2OI2A 2MPUA 1NGFA 2UVWA 1WKLA 4CI6A 4FJKA 4QIVA 4L8RB 2V7YA 1S1XB 4LFBJ 2CFXA 1VRUA 2OSRA 1VQKS 4GVBB 3HT3A 5MAOA 1TTHB 4GV9A 4FO0A 3F5TA 4MKAA 2DGOA 3FE1A 2EG1A 4OI0A 1YSJA 4X64J 5BN8A 2HQ3A 1S6PB 1XC9A 1S0OA 3GYNA 1V6HA 2QGFB 2V6AA 3OHBA 2BVZA 4XAKA 4CK2A 3TX0A 2ZF5O 3VTIA 3M6XA 3ZETB 1HQUA 2PBDA 1RAAB 3FVYA 3IAS9 1J5OA 4RW6B 4LF9J 4PQUA 5IV4A 3C6TB 2ZC4A 1Q7YO 3PM9A 3U7JA 3VF6A 2DTUA 1BWVA 4ZTFA 5K14A 3FGVA 3M2VA 4LJMA 3MECA 3C94A 4LSZB 3ZLJA 2M8HA 1AA1B 3V6DA 3VAJA 2XMTA 4CT8A 3U02A 3KLGA 3CDAA 4WFAL 1U2RA 2KB2A 4RUBA 3DMJB 1RYSA 3BYRA 4O5FA 3D2EB 4I6AA 1H98A 3M8QB 5J2NA 1OJ4A 5ADZA 1Y11A 5KOXA 3HHKA 1R0AA 1GOBA 5HI7A 3VQ5A 4DUYJ 1RBVA 5F8MA 4GW6A 3O8WA 4K2XA 3O08A 4X66F 3NGTA 3NBPA 1ZZNA 1FJGK 2LU1A 5A76A 4A5AA 4FJHA 4BRKA 2QSWA 4DG1B 1B9FA 4DZ6A 5EUHA 3L2RA 1GTEA 4R8UA 5LMNJ 3M6UA 1LWFB 1MWQA 2H54B 3TZZA 3CJRA 4JYAF 4U67Q 3HULA 5F8JA 2EWHA 2R7UA 3NGDA 4X62F 2OPSB 2IRYA 4HH0A 2RU3A 3N4WA 2N82B 3RRKA 2CKWA 2VU5A 3B82A 2UUTA 2PFDA 5BRDA 2VKRA 2LEPA 2G8IA 2RMLA 4KKOB 1TV6B 1CBKA 3MX5A 2HBYB 3BN4A 4RNNA 2D0PA 1BWFO 1B0TA 3T19A 5GAHI 3D6RA 8AT1B 4ZPVR 2W8KA 4RNFA 3ENQA 3L7UA 5HMWA 4DFKA 4ER8A 3HJVA 2ZH2A 3T6BA 2HHHK 3WNGA 3VMFB 3TAMB 5A8WA 2C42A 1GOCA 2E1CA 3F9MA 2IM0A 4H5TA 4U9RA 1GMWA 5CAAA 2UZAA 4TKTA 3SQ4A 3MHYA 3QWUA 3D6FB 2VG6B 9RUBA 4MH8A 2R3VA 3HSZA 5D4NA 4W5TA 3IM9A 1SKWA 1IKVB 1D3WA 2KT5A 4LVNP 3LO3A 2DGVA 5CYJA 3DLLQ 5AR0A 1N48A 2BX6A 2XZWA 5KFAA 4YOVA 3RYLA 1S7HA 1KVIA 4ZKAA 1IJFB 1UVKA 2NNWA 2YNHB 1SC3B 4IRKA 3R3LA 1UVJA 4BG8A 3LGMA 3T1YJ 2V2VA 1VQMS 1TKZA 2XULA 5DO2A 2CDRB 1MG7A 3MEGB 1KLMB 1BI4B 2P9LA 2FLOA 1N5VA 3V1OA 2H48B 4TU9A 1AFIA 2GA7A 5BR8F 3FRZA 1IKYA 5GIOA 1JXBA 3ADAC 3VESA 2D9PA 1SJ4P 4HDHA 3PW5A 1VHXA 1VSJA 1F3FA 4CJQA 2HF3A 3BUZB 2Q2RA 2QMUB 1C4CA 1VYAA 2E66A 2QZ8A 5KFPA 2A3JA 3TZXA 3MCPA 1OY8A 4B3RK 1FT8A 1BCOA 4YB6A 4E98A 2IVYA 4LFCF 2W40A 1KFDA 1YTYA 3AO5A 1NB2A 2N7CA 3KFWX 4JV1A 1R0CB 3D0GE 1M1HA 3PO5A 1TAUA 2AP6A 4JKCA 3JSMB 1JLCB 4WE1A 1TR0A 2O8FB 2UUAK 4DV5K 1GLLO 5AT1B 2AGOA 4DPTA 4OHXA 2COLA 2CJYB 3OVBA 1F9HA 3H90A 4O0JA 1S79A 3NAEA 1UJ4A 3ONQA 3WEEA 3K5PA 1ELOA 3OD2A 2BE7D 4CLYA 3R1XA 4ZA1A 4BRIA 4DN9A 2CQ3A 1GTHA 3D2WA 5JLHA 4IXCA 4C9DA 4QOTA 3K8WA 2Y0BB 3HVRA 2KN4A 1D0EA 1V3ZA 1CJTB 5GAGI 4YR3A 5I42A 4ENOA 4JI2F 4IG3B 4F02A 5KFEA 4C8LA 3VQPA 3P83D 1A5XA 2W8LA 2EBEA 1QTMA 1KS2A 5I42B 5FJ4A 1RWKB 4K4SA 5DM7L 1RI7A 3CJ8A 2QYGA 4MMOA 3LGNA 5JXSA 2CPFA 1VIXA 1RBLA 2RNEA 3CXCR 4P10A 2R7SA 4FPBA 4M94A 1O5JA 4GKKK 3EE3A 5BYRA 4YOXA 2EBGA 3D6MB 2B9YA 2WW4A 3PFOA 1YKWA 1JJ2M 4B3MF 4PWUA 1W26A 4WZMA 5C25A 2MKCA 3EVWA 2M0GB 3CJCA 3ISND 5KG2A 4H0VB 3OYFA 1UEVA 3HMJG 1N34J 3N01A 4FPAA 1JLCA 4WE1B 4CI0B 3VF2A 1KAYA 3JSMA 3VGUA 1JLQB 3N28A 3SMPA 4XDDA 3QFPA 4C3KA 2KTQA 2YBVA 4M5MA 3VQ6A 3TOQA 3CCJS 4X65F 4N7TA 2QW9A 3QJPA 5K8NA 5HVHA 2DYAA 1TYQA 2V69A 3LA0A 1N56A 3IDHA 1SQFA 2DNKA 2RQKA 1JJ2R 2DH8A 4F3OA 4FJ5A 5J2MA 2ZJPL 4DV5F 4QIFA 2X1FA 1D5AA 4K8ZA 1TL7A 3I8BA 2P9CA 1NGJA 4FZXC 1RNHA 4HYKA 4CD3A 1RTJB 4JI0F 2FLPA 2ZZMA 1RDDA 1KLMA 1BI4A 3OW2M 3MCMA 4MK7A 1Z05A 4DDFA 2XLIA 1GLAG 3EPIA 1OYDA 5KFIA 3CGIA 2YNHA 5GINA 4CLZA 1RFQA 1XI1A 1VHIA 3UW1A 2VCPA 3DRSA 4CZFA 4YY3F 2KJWA 2HFNA 4CQ1A 3QWPA 3HHLB 2JOQA 1IKVA 2BDPA 3Q89A 2FD2A 4HHTA 4LIRA 3IO1A 1NRKA 2XG8A 1C0UA 4ECSA 3HT0A 5DGBA 1JCGA 4CO0A 4BWJA 1D9FA 4CVNE 3R8YA 3CCWA 4DSEA 3AGRA 2J7UA 4LIWA 1BQNB 1VJQA 1GLDG 3S01A 1QDUB 2HAFA 3L95X 3W61A 4A62A 1QSSA 3M32A 5DG9A 2YX4A 3HO1A 4NMLA 1WAJA 1NSAA 3MPDA 2QL9B 3P96A 3HOTA 3PUFA 4YUDA 2O67A 5DJBA 3KHYA 3CCUS 4UOHA 2ZVIA 4MK9A 3T1YK 4CO4A 3OVSA 3QMQA 5CR4A 3MN5A 2AMCB 2XM3A 4TN2A 3IAYA 4L6V3 1YK9A 1FKOA 4F4XA 2J0QD 5CYMB 3CCLS 1REGX 4DU4A 3OSPA 3H42A 1N32K 4ZPAA 4ZPBA 3ZSWA 3QFWA 1O13A 1S1TA 2JL9A 2LDYA 4FVMA 4AD6A 2LMIA 4EWTA 3KOAA 4DR6F 2RUSA 1N33J 1NK5A 1Q86O 2GJ2A 1FXRA 3RU0A 4PAAA 4ELUA 5BYSA 4RU2A 1YBUA 4JKBA 3IGVA 1U1QA 5D0HA 2IBKA 4KFBA 3HZEA 8ATCB 4BC7A 4JI3K 4OLAA 4PXEA 4WF9Q 4FJJA 1YG0A 4LR8A 3N5FA 2H4WB 1T94A 2HWHA 4PUOA 1IBMJ 2DEJA 2YCHA 4J8FA 2XHCA 2DITA 3AVBA 1NK7A 1CJUA 4L3NA 4P71A 1BWEA 5EWGA 5K20B 2UXBJ 1B99A 2D0BA 5K14B 3OBIA 1SJFA 4F3TA 3U27A 4W4MA 2F8EX 2MKHA 1YJNN 4CHPA 3J7ZT 1LK7A 4P2FA 1BC6A 2W42A 2KDOA 4RW6A 1J5OB 3UCUP 2KKZA 2ZNYA 1YAGA 1HQUB 2HHHF 4DQ8A 4FL9A 4P2MA 1DAXA 1HNXK 1FX2A 4IO1A 3S3MA 5AQFA 4H4MB 4CJKA 3NNHA 5E3AA 4ID8A 5B08A 5ETPA 5B0EA 4QU7A 4NA1A 3LP0B 2K2PA 3H2UB 3SQ2A 1VOMA 5EX0A 2AV5A 2HS4A 5AQOA 3R5DA 1S0NA 3RRHA 3RR8A 4XH4A 3ZSOA 3ZTSA 1XNQF 4M5IA 1VRUB 3DRRB 3UVJB 3A8IA 3UDVA 2VB6A 4ED1A 5AQUA 5B0AA 4OYWA 3PCOB 2EFPA 1VGYA 5LMUF 1HR0K 4UY8O 3ILOA 3VZHA 1UMJA 2B6AA 2F7VA 3MR2A 4QWCA 3AVIA 2ZBPA 2HNZA 1YJTA 1XHXA 4HUEA 1UVLA 4FW2A 3NCQA 3CCMN 4EO6A 1YZ6A 1VQPS 4QR2A 2Y8WA 1WF1A 3FJ2A 1L3TA 3P5JA 1EX4A 1VQ5S 3UNGC 2GMLA 1CS4B 5GAHU 3O3HA 4JI1J 1GFWB 2VGNA 3PEHA 4BC3A 2Z30B 2B43A 2KH9A 2HZCA 4KT0C 2LLZA 5LSRA 2KRBA 1RT4B 1KEKA 1VQ8N 1QZ6A 4FWPA 4O4GA 5AE3A 1FNOA 2F9DA 1KP6A 1JLAA 3QEXA 1JMTA 3VTHA 4G1QA 3C15A 4R79A 2CQIA 2VIHA 1RT2A 4TYBA 1UWBB 5I3QA 1S6QB 4DV4J 1KDNA 3IBCB 4OYIA 5GADP 1NMDA 3AARA 2I38A 3FBBA 5BR8K 1CZBA 4LF9K 4WFNL 3F9KA 3B6BA 5C2FA 3GR1A 2Z1HA 1OSCA 1U1PA 1S0MA 3DXMA 2UUBK 2Z8QA 2UXCJ 1BO5O 2WW8A 1GMWD 1TUGB 4CGHA 2G1DA 5IV3A 3PYDA 4W5OA 4ZLNA 4Y0WA 1IM6A 3THVA 3DRYA 4U96A 2YHBA 2MKKA 3D6HB 1S1VB 5J2QB 3WUHA 4DKWA 3NP5A 4I2QB 1K8KB 2HSEB 2JEFA 3TSQA 4DB3A 2FF6A 3NMUA 1HQEA 1Q53A 1M1KO 4WQ5A 2OSQA 4V19J 2DTJA 2Y1JA 1IKXA 2ABYA 2E5JA 2CJQA 3D67A 3I31A 2LSNA 3KK3A 3D1HA 4ATNA 2OAUA 4RW8B 2FHJD 2KXHA 4YB7A 3CD6S 1WELA 4JV0A 2Q66A 4DR4K 3ILLA 3JTOA 2X3DA 4O0IA 1S6QA 3ZNJ1 2DO0A 3KUEA 1U25A 4CRJA 3QO9B 1NUEA 3BEGB 3M8YA 2X78A 2PYLA 1CSJA 2V63A 4OZJA 2BTFA 3FC9A 2VG7A 3CPWM 3HSJA 5D6GA 4JI8K 1I51B 1JLAB 1LNQA 3MMBB 2DPNA 2F8TA 2QTDA 2CNNB 1ZBHA 3VQQA 4O4GB 3WQTA 1UL3A 1EARA 3V6HA 4DSFA 1FTCA 3GJQB 2BJ8A 4CHZA 3IBWA 2WRMA 3HHEA 2PC6A 3LAKA 4YMEA 3GG4A 4J9OA 4TY9A 2HYIB 1W0HA 2VWKA 3CO9A 4CD1A 3P4IA 5KPTA 2H5JB 3PHTA 4RWXA 2GVZA 4CCHA 2BJ1A 2CH5A 2YNFA 1J2VA 4IOCL 3AT1B 3MM7A 1U8WA 5KQDA 1WI6A 4CEZA 5KFZA 4M3XA 2JNJA 5J1NA 4X65K 4QIEA 4JV5F 1EETB 4DR1K 1NSKL 2I8EA 3GB0A 3SUNA 3J7AN 1VHFA 2FHKA 1TUWA 4C3LA 2MSTA 3M7VA 4EBEA 3DGPB 4IH7A 2ZH7A 4JI4K 4LF4K 1RT1B 3OFHA 2DIVA 4LF6J 1S12A 2NCKL 4PZVA 1RWWB 2FJXA 2BABA 3W1YC 2P5OA 1H74A 4DSIA 4O8UA 2A1BA 1XNRK 2SXLA 2Z1GA 5LMNK 2PA8D 3HI9A 1U1NA 1RHMB 4XPCA 2AD9A 4B3TK 4DS4A 2NR0A 2C3YA 1U6ZA 1XMQJ 3BP8A 5HRSA 3R6GB 3W2VA 4XEIA 2AX0A 2JC0A 2UVVA 3DLHA 4JI5J 1ASUA 2J9DA 2RT3A 2IIRA 3D7EO 5L1KA 1U1MA 4P73A 1WSFA 1KAZA 3O80A 3OYHA 1KQSM 4Y2CA 1S1UA 3LP2B 4Q8EA 2KLAA 4KV8A 1ATSA 3OTCA 3PYEA 3K59A 3RVCA 4FF1A 5M1QA 5LL6Z 4IJNA 3C6HA 3QESA 3KD1E 4IO9L 3CDEA 3OTOK 3CC7N 4RX6A 4AH9A 1FRJA 5F8GA 4Y2AA 2P9GA 5DQGA 1JL2A 3IG1B 4WBFA 3U4LA 3AO2A 4JS5A 1M90O 2VA3A 2OCEA 4KPCA 3H25A 2Z2YB 3LDQA 2HVZA 1SZ2A 4DR3F 1WHVA 1WC6A 4LRAA 1N8RO 3WBZA 4DLEA 2ZWPA 4B9VA 5E5NA 3N79A 3C65A 4B3RJ 3OXLA 5LY3A 4X64K 2XY5A 2VBXA 3IUCA 1OH8A 2IDLA 2XSJB 4LR9A 1RLDA 2BE2B 1OVYA 5J1EB 2MQPA 4K0KF 2R7YA 3ZZYA 2DGQA 1NMNA 1FDAA 3ENHA 3QGGA 1XC3A 1FVQA 1SJQA 5F0UA 3UQSA 4RCHA 2DNQA 3TZYA 4Q7AA 5JVHQ 1X4BA 1IR1A 3MURP 2JLFA 3L6QA 3SPZA 1KQFB 5H1SV 3CCRS 2XWXA 1T9TA 3IAM9 3M32B 1RSCA 5I3UA 2O4GA 2FDNA 1WN7A 4FWQA 5KFBA 1RTZA 4G6VB 3QQCD 5LM7E 3EKSA 3ZSRA 3I0SA 4IOAL 2P6SA 3UD5A 2BR0A 3THWB 2C2EA 3IWLA 5KFUA 2GGPA 2PEHA 4ILGB 3K0SA 2BJDA 2R7OA 1PG5B 4RZRA 3CCTA 3DOLB 1N88A 2QT7A 1WG1A 3AVJA 4B9SA 3MMCA 2LQJA 2EK1A 3SQGA 4DTNA 3TX8A 4ECTA 2G8UA 4JI6K 3IRXB 4CEFA 2ACMA 1NEEA 3E8OA 4YQWA 3NRBA 4OJ1A 3TARA 1EWQA 4HTJA 1SKRA 3BQ2A 1HHQA 1WC1A 2CQPA 3H40A 3NGIA 2X1BA 4DCPB 3HPGA 1NZ8A 4P9SA 2XYGB 1IG9A 4O8KA 4DPYA 2BOPA 5ETRA 2NRHA 1Q78A 1T11A 1A0OB 1DRZA 2Y1RI 3OYDA 5J2MB 4AL7A 2ZITA 4OQJA 2K06A 4YDDB 3G6EN 4PG7A 1PYTA 2CQHA 1YJ9N 4S0MA 4PWDB 1JNZB 3MM5A 4C6AA 4JI8J 2HQGA 2IRUA 3RBZA 2EFNA 1NGDA 4Y1CA 1TL3B 1NHUA 3GFXA 3FEXB 2ZUAA 2LA6A 2CDQA 1HWUA 2VPXB 4X66K 4H8KA 2YKQA 3PV8A 1U1OA 3MCSA 1K1SA 2R8KA 1BDGA 4ILJA 3MUVP 3EL2A 2CRLA 1H2VZ 5M1PA 3TI0A 1RCOB 3BPSP 1SL0A 2GHPA 3GLJA 4J9QA 2XCPA 4JD2B 2YY3A 1D8ZA 3T3FA 5H1SQ 2QA1A 4N8NA 3JQMA 1PKUA 2LQ9A 2IA0A 2CQ1A 5ETQA 3J81U 3ZZPA 4O3PA 2YHAA 2L9NA 1SJ3P 1L5UA 1FRLA 3OPKA 2XQCA 5CQGA 4OKEA 5G0RA 1W7AA 2OYQA 3OYMA 4JK9A 3OTEA 4KGMA 1TL4A 3PDNA 4LT6A 4ZVGA 4AHRA 4BQZA 1B92A 3V9XA 5M2RA 4BGAA 4PR6A 2NXUA 1M5OC 1VQ8S 1WHXA 2HHTA 3J7YP 3A3PB 1CPZA 1LW2B 2YX1A 3MTJA 3K0JA 5BRFA 2QWLA 4K4XA 4LQ3A 5DMRA 1HFEL 2E5IA 2OZMA 4ECRA 2DHHA 2EI5A 2VBYA 3OYNA 4KHRA 3H5UA 3KLVA 3LOUA 3DLGB 2L08A 3HK2A 3DHWC 4OZ1A 1IBMF 3VN5A 1PBAA 3WEEB 3SPYA 4X62K 3P49B 3O3LA 1IBKJ 5HVGA 1WSRA 5CZ2A 3Q8YA 2L9DA 4B3MK 4DQIA 4J90A 2MEWA 2HBRB 4ISGA 3U9ZA 3EPGA 1IKWB 5K8PA 4YDXA 3IS9B 1N4LA 3O1WA 3MN6A 2HLTA 3DN9A 3BGRB 2HF4A 2CQ4A 3CXCM 1F1BB 1FRMA 4FZZA 4C11A 4K4UA 4RBVA 2C2ZB 5E3CA 2KXNB 1DEJA 4TY8B 2UUCF 3AY9A 2OZSA 5A6WA 4HTIA 3GIKA 4I67A 2IYIA 2O3DA 4ZJLA 3CVKA 2PFFB 2IA6A 2B51A 2Z56B 4C1NK 4TU8A 2ZM6K 5FPDA 2B4UA 3CJ5A 4R5PA 4WFNQ 1C1BA 1IKYB 3SBTA 1N36K 2YNIA 1XJWB 2FVPA 1QVFM 2P9LB 3TTCA 2UVUA 3MEGA 4C3MA 1RK8A 3NF8A 4YOEA 2XRIA 2BOAA 2HBQB 2QL7B 3PX0A 4CIOA 3IP0A 3O1BA 1Q82O 1F5AA 4JYAK 1R8HA 2PMZD 1XNRJ 4ZCKA 5HROA 3EXYA 4QCLA 3VAFA 5D0RA 2FYXA 1U1LA 3GONA 2BE9B 4OZ3A 3S1TA 2FHOB 3V1RA 4IG0B 3KLHB 2O01C 1XMQF 3DAWA 4M7YA 1ITPA 4EMDA 5E7OB 4WIIA 3AO1A 2ADCA 4C98A 2W25A 4ICLB 2A6AA 1BY9A 2HW3A 2ALYB 3U8XA 4FK0A 1PSDA 4GMJB 4RW9A 4M5DA 4PKDB 2P9NA 1S9FA 1JLBB 1FRIA 4KI6A 1T9VA 2D1CA 3DLLL 3LPYA 2XEXA 1PYOB 5L9XA 2CQDA 5KGXA 1NJYA 2IVOA 1QAIA 3QGHA 1NK4A 2GMJA 2R7TA 3UN5A 2LQBA 3AVKA 1P90A 1DTTA 2JWNA 4LC9B 1BOTO 2AJ2A 3H5SA 2QM1A 1Q8KA 1W9HA 3QATA 2QKBA 1WOQA 1NGEA 1SJRA 4KKOA 5C42B 3JS6A 3HFVA 5ADXA 1RTIA 3VQ8A 3CYMA 5EWFA 4DI6A 2YKMA 3RTVA 5A8KA 2Y9HA 2QI2A 3GIIA 3ETMA 1S4EA 1YXQA 3TUPA 4E1MA 4RBTA 4NZ7A 3I5AA 1L3KA 2OTJN 3CJKB 2LYVA 5FPEA 1LWFA 4X65J 1PGZA 2HGNA 1A9NB 4R8UB 1BL3A 4J37A 1GXLA 4DG1A 1OMSA 3E01B 4DU1A 3EWGA 3FBEA 1NNEA 1ZBTA 4YOTA 1EKSA 3ZTRA 4FJ7A 1DQ9A 2XZDB 2APOA 4JI3J 4CGFA 4X4VA 4OI4A 3EZUA 3FSIA 4FK2A 5F9NA 4BY9C 3P4UB 2CJAA 3R5AA 5F8IA 1T05A 5BXIA 4DV0J 2XS7A 2YX7A 5J2NB 3M8QA 4BVOA 4DV3J 2DFHA 4MLEA 3D2EA 2Z57B 4AM6A 3POTB 3SNNA 4F2SA 4OYBA 1CQNA 2DHGA 4PL7A 1SH0A 2EVZA 1RDRA 4DR7K 2A40A 5J2PA 3US5A 2FY8A 4I56A 4QS7A 2X74A 1SCJB 3WDOA 4B3SF 5H9FK 1V5IB 1EB0A 4UT4A 2BBEA 1ZBIA 1KQKA 1DQAA 2RQMA 3DC2A 3BKTA 3UFCX 4DSLA 3HSGA 4RU9A 3C6TA 3AO3A 3EJMA 4FVCA 4PQUB 3C95A 1LXNA 4A8YA 1M1KT 1X4FA 2OEJA 3SSRA 5AQJA 2ZJPQ 1Q79A 1EWRA 3CM6A 4FXVA 3W8PA 3H2VE 5C24B 5E0OA 4Z4IA 1YITS 3KDNA 1BHNA 1N6QB 4BC5A 2ZJRL 4IOCQ 5A8RB 4K43A 1Q95G 2DR5A 3OL6A 2V9KA 5KT6A 1RTDB 2L9WA 2EKNA 2QL5B 1RAJA 3GV5B 1N32J 1FA0A 4F9OA 2ERRA 1RBOB 1X5TA 1AZSB 2A0FB 1Z2LA 2JSXA 2N7YA 1F3VA 3VQCA 5HP1A 3F56A 2YHYA 2H3GX 3NF6A 2NS1B 4CLTA 5AJ3J 4JOUA 4U7UD 2LXUA 4WK3A 3MR6A 2PGCA 3L2UA 3UNYA 1KNZA 1ZM3A 2HK3A 4LVOP 1R8BA 2FBYA 4G9ZA 1OIAA 3KMQA 1LOUA 2BANB 4LF2A 4H5RA 1YX2A 1TK0A 3FFKB 1UVMA 2HVDA 2ATCB 3J81O 3CMES 5HBMA 3UDCA 1JLFB 3W0LA 2ZHBA 1PYSB 3AXKA 4DV4K 1WC5A 1SIWB 1N33K 5KG7A 4ETZA 1ZA2B 2RN2A 4HI1A 2HQDA 1LAVA 4WFYA 4P2XA 4JI4J 4I6MB 1B9DA 4DTJA 4NLOA 2UXBK 2PE8A 2YQ0A 4ILMA 4JI6F 3CHWA 1N54B 3PNIA 3QSIA 1TELA 3Q8QB 1N32F 4OZLA 2ZZNA 4FS1A 4HHHA 3VEYA 4KSEB 3G6VA 3J7AP 1H0HB 1K8AT 3QIOA 3CJ9A 2CNOB 3TW0A 1R0BG 1DZ5A 2G0IA 3O5BA 4HCBA 1S4FA 4KTQA 2VPYB 2V2QA 3GJTB 1WBDA 5JLFA 1ZM9A 4A5BA 1S99A 3MMAA 3CC4S 2RU9A 2C2NA 2IGIA 1A6LA 3W7BA 2W4DA 4H4OA 3N4QA 4YOUA 1ROFA 2V50A 3HHLC 3O44A 4YR2A 4UUWA 2HB5A 2A18A 5BN9A 3M8PB 2PFUA 3I56S 2RD5C 1HNWF 4UZBA 2W2PP 1BG3A 4X4NA 2HWIA 4I0WA 2AHOB 4USWA 2WVEA 4UUXA 2RIJA 3I4HX 5GVQA 3GE1A 4AYBD 1F5CA 2WSFC 4ZVPB 1RHJB 4USJC 3GYXB 1X3MA 2CQGA 4MIWA 3S3NA 4NLTA 1KFSA 4DFJA 4KIAA 4YY3K 1B7YB 2GVDA 1NG9A 3PHEA 4OPHA 4YB5A 2B4VA 2QA4G 3IR6B 1QVFR 1UWAA 5KI6A 4H5NA 2GHWA 4KBOA 1KKHA 1C1AA 1RWVB 1ZM2A 5LJWA 1QD1A 1LWCA 1HWJA 4A8QA 1RLCL 3FCVA 3I33A 2CQ0A 1VSMA 3CIPA 1VQ4N 2IC3A 3MF5A 2C28A 3FZMA 3QYYA 5GAEU