2IAJA

Crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with atp
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
551
structure length
551
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H (p66 RT)
publication title Crystal Structures of Clinically Relevant Lys103Asn/Tyr181Cys Double Mutant HIV-1 Reverse Transcriptase in Complexes with ATP and Non-nucleoside Inhibitor HBY 097.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 142
structure length 551
sequence length 551
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2iajA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iajA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iajA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iajA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2iajA05
1UWBA 1DTQA 1ASVA 1YVUA 4W5NA 1C1BA 4LSNB 3LAMA 5EUHA 4M3XA 3L2VA 1TKTA 4K4ZA 4OLBA 3SYZA 1T8EA 5FDLA 3K2PA 1J5OB 4EO8A 2D3UA 1VK0A 5KG4A 3T5HA 3HM9A 4RW6A 1BQNA 3NF7A 4QWEA 4ED2A 4CEZA 3KLFA 1KSPA 1GX5A 4CGHA 4M94A 3NE6A 4IR9A 3Q8SB 1C0UB 4E19A 1ITGA 2BGGA 5KT7A 3OVNA 5HLFB 2W9BA 1RDCA 4TLRA 4PUOB 4Y2CA 1TKXA 4RW7B 3VQAA 3BGRB 2IOCA 4B9LA 2XI2A 1RT7B 4TYBA 4OKEA 4I2PA 4J9LA 1BL3A 2XHBA 4CJWA 4ELTA 3AVLA 1TP7A 4NYFA 4CEEA 2ATLA 1WLJA 4R5PA 1JL1A 4DQQA 4YR3A 4FLVA 2HB5A 4NLOA 5I3UB 3MECA 3QO9B 3DRRA 4FLYA 1QQCA 4YR2A 2HNDA 3C94A 2WOMA 3TABA 4J9MA 2ZQBA 4C8LA 4PA1A 1RT1A 2WB4A 4B8AB 3BQ0A 3H5UA 4IRDA 4Q8EA 2I1RA 3L3VA 4BDYA 2D41A 4MQ3A 3OHBA 3AVMA 3RMDA 4CHPA 1SH0A 5DGAA 1S9GA 4Y3CA 4O3QA 4TY9A 1HNVA 5F8JA 1RDRA 4R8UA 3PW0A 4CGJA 2WRMA 2R8JA 4ZP8A 2PYLA 2W9AA 1VSFA 1JLFA 3ZSOA 3V6KA 3UR0A 4MFBA 1S1TA 1L5UA 4DF8A 4IRCA 1DLOB 4CJTA 1TVRA 4N47A 3OYGA 1Z25A 3CFRA 1B92A 5DLFA 2RKIA 5CYMA 4LH5A 3TARA 1KLMA 2OPRB 4KI4A 4K8XA 1NKBA 2OPSB 4O44B 4I7FA 5KFPA 1S0NA 2HMIA 3FQKA 5KFEA 2G8WA 2OPQA 4DQSA 1S9EA 4RU9A 3ZT4A 4RNOA 3C6UB 2FBVA 3K5OA 1QSLA 2GC8A 5DG9A 1RBVA 1MMLA 3QNOA 3MXJA 2FLNA 1KFSA 2IM2A 4ECZA 1RTIA 4K50A 3DYAB 3PR5B 4DSFA 4URSA 4CK3A 3K58A 3GYNA 3QETA 3O3FA 3QESA 1HYSA 4DU1A 3I5BA 1T03B 4KB7A 4IH5A 3NH1A 3K5NA 4URGA 4F3OA 4CJKA 5KFAA 3PW2A 4ED0A 4OGCA 4E1MA 5HRPA 3PVXA 2Z1GA 3V1OA 3ULDA 5KFGA 4ZP6A 2WK4A 3PV8A 1S6PA 4DTNA 2IGIA 3TAPA 4EYHB 1QTMA 3RR8A 4ECSA 4M3UA 3HJFA 1JXBA 2OZSA 1T3NA 4X2BA 4WFZA 1RTJB 4FZXC 4ELUA 3Q8PB 1B9FA 4NYZA 2O4IA 5F9LA 4QWCA 3DM2B 2B4JA 3I8DA 3SUNA 3AVHA 2R8GA 2IC3A 4JV0A 3H5SA 3DI6A 5L9XA 3RWUA 1LWEB 3IS9A 4CJLA 4AILC 5I42A 4BE0A 2BQ3A 4K4WA 4RUCA 4DL3A 3OS1A 5C25A 2KQ2A 1REVB 2IM1A 2O4GA 2HNZA 4E89A 3DOKA 3QINA 1C1CA 1EETA 5CYQA 1TL3B 4FCYA 3DOLA 1FKPA 3G6XA 1IM4A 4DS4A 1RTHB 4ZVGA 4QWAA 4FJJA 3HHKA 3LANA 4CFCA 1N56A 2ZE2A 2V9WA 4NLPA 3N6LA 4HTUA 2G8KA 4H4MA 3CJ0A 3CIZA 1WAFA 3LPTA 5KFFA 2QKBA 4QWDA 2YKNB 5EWEA 4Q43A 4CFAA 4I9LA 3OL9A 3SV4A 5KG6A 4AHTA 3L2UA 4O4RA 2JC0A 5KTQA 5J2MA 5KG1A 3OYJA 1TV6B 4IH7A 1BI4B 1VRUB 2BE2B 2HHTA 3NCIA 4DTXA 3V4IB 4M3WA 2B5JB 4JRPA 4KFBB 4NLSA 5DLGA 3KNAA 4CFBA 1HRHA 1TK8A 4CFDA 3DLEA 4OLAA 4MKBA 2OPPA 4DTOA 1S6QA 3NF9A 2E9ZA 3MAQA 1CXQA 5KFVA 2D0BA 4ED8A 1U47A 2D7SA 5FRNA 2X6NA 5F8NA 2VWKA 3CDUA 3KK3B 3V6DB 4O4GA 4FVMA 4ZHRB 3AVIA 1MU2B 3M9OB 4NLRA 1XC9A 3LP3A 4AHSA 3RB3A 3SUOA 2DFEA 4XIUA 3M8QA 3QEPA 4RW4B 4Y34A 5KFJA 3ZT3A 1X1PA 1JLEB 2R2TA 3BQ1A 4ED1A 3KJVA 4E7HA 4JV2A 3PW7A 3D5MA 3OS2A 4K4YA 1B9DA 5KFLA 1RTDA 4KPYA 1S1VB 1BHLA 1SKWA 5JS2A 4CESA 4KO0B 3HVRA 4FJ9A 3RRHA 3OHAA 1IKVB 2V4QA 4PQUB 2AGOA 4KTQA 2PYJA 1TAQA 1NK0A 3EZUA 4CF9A 5DG7A 1IH7A 4FJ7A 2KFZA 1FK9A 4DSLA 2HVIA 3VQ4A 2IM3A 4KKOA 5KT3A 5KFBA 1BCOA 2W42A 1L3SA 4U7CA 3ZSQA 1LWCB 4O55A 2IJFA 3U6FA 2Q3SA 4FS1A 4BDPA 4WYLA 3DRPB 3LP0B 1EX4A 1IKXB 2ILYA 3EPIA 5D3GB 1HYZA 3KTQA 3I5CA 1ASUA 2JEJA 2RN2A 4CEDA 1XHZA 2OYQA 2W8KA 2VG7B 1EP4A 1WSHA 5HROB 2XCAA 2JLEA 3NBPB 4KB1A 4HYKA 4RW9A 4F4KA 1LW2A 1ZTWA 4ICLB 4QWBA 1RILA 1U49A 4KHYA 1YTAA 2E6LA 2Y1JA 2GV9A 4J2AA 1HPZB 2OH2A 3LALA 1GX6A 4GW6A 5KGXA 1U09A 3OYEA 3RTVA 1RCHA 4B3OA 2HWIA 2DPIA 2G8HA 4QCLA 1C2PA 4QW8A 3OYLA 3G0ZA 5L1LA 4W5RA 4I2QA 3I0RA 5DGBA 4Z4GA 1LWFB 3NAIA 3OL7A 3D0PA 3SUPA 1LW0B 2VG5B 3L2QA 4DQRA 1RT3A 2IBKA 4DL5A 1RT5B 1BQMB 1JLCA 3MEDB 3OY9A 3DDKA 2KZZA 1RT2A 2VG6A 3VQSA 4H54A 3AA3A 4O0JA 3PY8A 5J2NB 2GIRA 4FK4A 1UAXA 3WNEA 3V9ZA 1JLAB 4W5TA 3DRSB 3SUQA 2C2RA 3MXMA 4KRFA 2R8KA 3QEVA 4OJRA 3QGGA 2HVHA 4HUFA 1UOCA 1R0AA 3QIPB 1U04A 4J9QA 5C42B 3S3OA 4B9SA 2IAJA 3IGVA 3V9UA 3ZT2A 4DTJA 2WONA 4GC6A 4IRKA 3V81B 3QLHA 2AGQA 3H5YA 1D9DA 4DS5A 3QO9A 4NLDA 1HNIB 3GV5B 1SKRA 3SFGA 2W9CB 4TY8B 2Z1JA 4PWDB 1XR7A 3ZCMA 3TAMB 2X6SA 3QZ7A 1NK7A 4FK0A 1SV5A 2I5JB 5KFKA 3KMQA 4IKFA 3NGDA 5KRTA 2HNYA 1SUQA 3M9MB 1NK9A 1C1AA 3PUFA 3S3NA 3KLIB 3DLGB 4DL7A 5J2QA 1KVCA 4WZQA 4CGDA 1S1XA 2UVUA 4CJ4A 3BJYA 3KK2A 2GBZA 4M45A 4NZ0A 1NKCA 4H4OB 3EZ5A 2R7YA 3BR9A 4ED7A 3OYKA 3MXIA 1DLOA 1FKOA 3THVA 4F4ZA 2F8SA 4MIBA 1KFDA 4F3TA 5KG7A 3E01A 3LP2A 1IKYB 3FFIB 4DSJA 3RR7A 3LZIA 4KV8B 5DMRA 3CG7A 3CWJA 1WSGA 3CO9A 4K4TA 4Q5VA 2YHAA 3QIOA 3C6TB 4O44A 4TQSA 3VQPA 4RNHA 4XPEA 1XI1A 2HWHA 2R2UA 3HSTB 3K5LA 3QEIA 1NK5A 3LP1A 2EC0A 4IFYA 3KK1A 5CZ1A 3OYAA 3NKYA 3TAQA 4WFYA 3SNNA 3K57A 5HBMA 5KFIA 3PO4A 2HHUA 1OS5A 5KFMA 4LY7A 3D45A 2YNFA 4DTUA 5E41A 4CF1A 4FJLA 1N6QA 5KFYA 4YFUA 2FVRA 1HJRA 1S97A 1VRTA 5F8GA 4YP3A 4ZMMA 2J6SA 1VSLA 4YR0A 1HMVB 1K6YA 2P5GA 4DQPA 1SL2A 3KHGA 4OGEA 4M3YA 4HHTA 3M8PB 3CJ3A 5C5JA 2YNGB 1SH3A 1JIHA 3QGHA 4Q0BB 1NOZA 4Y1CA 4KHNA 5J2PB 3JYTB 1Q9YA 4KBIA 3IRXB 1JKHA 1QHTA 4NCGB 3BSOA 2DTUA 5KFZA 5KG3A 3AA4A 4FLXA 3IG1B 3LPUA 4IG3B 3NF8A 4C8KA 4OKKA 5KFTA 2W8LA 1JLGB 5L1IA 4F50A 4LQ3A 2ZD1B 4ZP9A 3L2WA 3HVTA 4EBEA 4J9NA 1ZBUA 1TQLA 3V9WA 3DLKA 3RBDA 1TKZB 1Z26A 2R8IA 3EPGA 4NLXA 1A5WA 1NJYA 2R2SA 3KD5E 2KTQA 4O3NA 1GOAA 1Y97A 3FQLA 1S5JA 2J6TA 1CXUA 1J53A 1G15A 5JS1A 3OS0A 3U3YA 4F8RA 3SJJA 1RT4B 4IFVA 2D0AA 3BSNA 5F8LA 1GOCA 3M8SA 4ED3A 5C24A 1S49A 4Z4EA 4JRQA 1WSIA 1NJWA 4WE1B 2B43A 4KREA 2A1SA 4W5QA 3AA2A 4IG0B 1IKWB 4CJRA 1ZBIA 3KLHA 3VQDA 4F2SA 1TAUA 3T5JA 4CK1A 3TAGA 4KTWA 1DTTB 2FVPA 4B8CA 1C0TA 4FLZA 4Z4CA 3ISNC 4HUGA 4LSLA 4DG1B 3ZT1A 2PZSA 4DTRA 3VQCA 2DFFA 2R2RA 4CEOA 4K4VA 2VA3A 3FSIA 4RW8B 3T19A 3HVAA 3HPGA 4KHRA 4ID5A 3VQ8A 4O3PA 1SKSA 2B6AB 4F4WA 1S1UA 1NJZA 1JLQA 3HP9A 5KFCA 4Q8FA 4NYNA 1VSKA 2D5RA 2DPJA 2IM0A 1S9FA 4DTPA 1W9HA 3U3GA 3I0SA 5EWGA 1UWBB 1DTQB 4AHVA 3V9SA 3DMJA 1C1BB 2X78A 1JLBA 4ED6A 1S48A 4FW1A 4PY5A 1TL1A 1VSJA 2RF2A 5FDLB 5KFXA 1KRPA 1LAWA 5DQHA 3VN5A 3IGNA 4B08A 3KK3A 4DSIA 5KG5A 4CJSA 5KFQA 4RW6B 3AO3A 4FM2A 1RYSA 4ELVA 1BQNB 4CF0A 4L8RB 3KLFB 5F9NA 2VA2A 3RMAA 3PJXA 1T05B 1RA7A 1QS4A 3L8BA 4FJNA 3CM5A 1D0EA 2ATQA 3AO4A 4O0IA 3KLEB 2W9BB 3N6NA 4FLTA 1TKXB 1RNHA 3WNHA 1D5AA 1JXEA 5FROA 4KB0A 4I2PB 4DSEA 4FJHA 4KHMA 5KFHA 3BSAA 4R5PB 3QERA 5FRMA 5KFNA 2E9RX 1IO2A 3DRRB 3NH2A 4FS2A 2HNDB 2WOMB 4JS4A 4DLEA 4I9QA 1Q8IA 1ZBLA 3MEGA 3CDWA 4J9KA 1RT1B 2HHXA 4ECVA 3HVWA 3RB0A 4E7LA 2OZMA 1RDDA 3OLBA 4FJ5A 1NHUA 4ECQA 3MEEA 3PJWA 1VSDA 2UVRA 4M95A 1S9GB 3TANA 2QKKA 4J9SA 1HNVB 4R8UB 4U6PA 2BR0A 4M3RA 4FJ8A 1JLFB 2UVWA 4CEAA 4G1QA 4MFBB 2D3ZA 1S1TB 3KLVA 2E4LA 4CJEA 5HP1B 2FBXA 3MR6A 2YKMA 4CHNA 1TVRB 5L1JA 1S1WA 2BRLA 2JEGA 5HRSA 1L3UA 2RKIB 4RZRA 5CYMB 3GV8B 1KLMB 3AVBA 3H40A 4Z4IA 3KLGA 4JUZA 4JS5A 2FLLA 1Q9XA 4I7FB 4QOZB 4F2RA 2BQUA 2HMIB 4YMEA 2E9TA 2OPQB 5EWFA 3Q8QB 1S9EB 3V9XA 4BWMA 1BIUA 1I39A 3O4QA 4MH8A 3AV9A 4AHRA 2AJQA 4XPCA 4CK2A 2P51A 4TQRA 3JSMA 3HKWA 1VSHA 1RTIB 4GMJB 3AA5X 4EBCA 4WYWA 3KHHA 3OYIA 3AVCA 5T14A 5J1EA 1HYSB 2G8IA 3ITHA 3SQ1A 1L3TA 1KHVA 4CIFA 5CY4A 4MIAA 4C8OA 3EY1A 4IDKB 4KHUA 1RAJA 1QE1A 3OSPA 2XI3A 3AVAA 1S6PB 3GIKA 2F96A 3ICLA 5DG8A 3ZT0A 2A1RA 4FM1A 3PX6A 1RDBA 2YNHA 4QPXA 4ECXA 4OPKA 1WNSA 3NGYA 4HUEA 5K14A 4DQIA 3FRZA 4MK9A 4TN2A 3OSNA 2IC3B 2F8TA 5KG2A 4N5SA 3DI6B 3IS9B 4O3SA 3OYDA 5I42B 1HQUA 1XWLA 1YVFA 2ITGA 3ASMA 3ISND 5C25B 3CJ2A 3L3UA 4OVLA 1N5YA 3GV7B 4CEQA 2HNZB 4N76A 2GUIA 2BANA 3H08A 2W7PA 1ZBFA 3LWMA 4E3SA 4ZVHA 2IMWP 1ASWA 4FZZA 5CYQB 1EETB 3PR4A 3OJUA 1W25A 3T5KA 5SZTA 4CHQA 3DOLB 1D8YA 1FKPB 2YNIA 2FC0A 3GIIA 4DFJA 3LAKA 3SI8A 1RT6A 3K59A 1HQEA 1RA6A 4Z4FA 3AO5A 2VWJA 4LSNA 4FJGA 3B6PA 3PO5A 3CYMA 2V4RA 2WCXA 1F21A 3SPYA 1RBTA 2FJXA 2D0CA 4DSKA 1J5OA 1K1SA 1WSFA 3NDKA 2XY7A 3MR3A 3O3GA 3G10A 4NRTA 5KT5A 4EZ6A 3DLBA 4DL2A 4C8MA 4NCAA 3DLEB 3V1QA 1S6QB 3AVNA 2V0NA 3ALYA 1CZ9A 1C0UA 3N6MA 1XHXA 4O4GB 4EP5A 5HLFA 4PUOA 5J2PA 3D28A 4RW7A 5DK5A 4R0EA 3KIOA 3BGRA 2W7OA 4B9MA 4Q45A 4ZPBA 3V6HA 4RNMA 1RT7A 3EYZA 2ILZA 2WHOA 3M8QB 2R8HA 4DL6A 4E1NA 2Y1IA 1XR6A 2X74A 5JUMA 3LWLA 3KJVB 2C2DA 5I3UA 4EBDA 3OYCA 3L2RA 4ECUA 1RTDB 4NLUA 4CGFA 4YNQA 3CFPA 1LAVA 4CJQA 2AQ4A 3BQ2A 1A5XA 5KFUA 2RDJA 2FJWA 1FK9B 1VSEA 4CEFA 4BWJA 4HVJA 4KKOB 4NLTA 1KHWA 3DLHA 3I5AA 1X9WA 4NLQA 1WAJA 3BREA 2ASLA 4E7JA 4O5BA 4ECRA 4CJFA 1EKEA 4O3RA 4E0DA 5JXSA 4LQ9A 4URQU 4EP4A 4M42A 4IKAA 3B6OA 3ZSWA 4DTMA 4IG0A 4MKAA 3IAYA 3HYFA 2J6UA 4AHUA 3O3HA 2OPRA 1EP4B 4KE5A 3TWHA 2Z1HA 4IR1A 2OPSA 4J9OA 4DMNA 4RW9B 1LW2B 3M8RA 3VQ9A 3NAEA 3AVFA 4CF2A 2KFNA 3HT3A 3CDEA 1JX4A 4ECYA 3C6UA 4G3IA 4FXDA 1S4FA 3KD1E 3M9NB 2FVCA 3VA3A 4ZTJA 4B3OB 3PX0A 5KFWA 1I6JA 4FJMA 3C95A 3DYAA 3OL8A 4I2QB 3I0RB 1TGOA 4AH9A 3FDSA 4WXOA 2P1JA 1RT3B 1T03A 1YT3A 4DF4A 1JLCB 1C0MA 3QNNA 1RT2B 2VG6B 4IQXA 3P5JA 3NFAA 3S3MA 2HHQA 3A2FA 4HKQA 3TVKA 3OL6A 2E6MA 3HK2A 1RTJA 4ECWA 4ECTA 1T05A 3H2LA 3AVGA 4NCBA 3MTKA 3NH0A 4BE1A 3DM2A 2EX3A 3KLEA 1ZBHA 3AVKA 1U4BA 1LWEA 3QYYA 2DFHA 2G8FA 1R0AB 3RMCA 4CHZA 1RBSA 2IAJB 1REVA 4FBUA 2WONB 3HPHA 4IH6A 3PX4A 1VSIA 2FVQA 5KGWA 4C8NA 3QLHB 4RNFA 4CE9A 3HO1A 3NMAA 1TL3A 3TR8A 2DY4A 1N48A 3PHEA 3F9KA 3T1AA 2WTFA 1RTHA 2IS3A 4ZTFA 1SL0A 1TK5A 1SV5B 4CCHA 1ZETA 1FXXA 2YV0X 3SPZA 2HNYB 1SUQB 2G8UA 2YKNA 4TSXA 1D9FA 4DL4A 2ASDA 5J2QB 3RBEA 1S1XB 1S0OA 2O5DA 4HCBA 3KK2B 1JXLA 5EU7A 3GQCA 3OJSA 4DFKA 4BDZA 4B9UA 2XWYA 1TV6A 5HP1A 2G8VA 1WN7A 3NGZA 1FKOB 4ZPDA 3UPFA 1BI4A 1VRUA 3TQ1A 2UUTA 2BE2A 4EEYA 3E01B 4TXSA 3RB6A 3LP2B 4O3OA 3QZ8A 3PW5A 1NNDA 3V4IA 3GILA 3T3FA 2B5JA 4KFBA 2JC1A 2ASJA 2ZKUA 2GIQA 2XGPA 4NLGA 1TKTB 3WNFA 1QSYA 2XY8A 3LP1B 5KFSA 4IFYB 2FBTA 3KK1B 3TI0A 5KRSA 3UDLA 3VQ7A 5HBMB 4B9TA 4UQGA 5KT4A 4FLWA 2QK9A 2YNFB 3V6DA 4TYAA 4ZHRA 2FBYA 5F8MA 1MU2A 1N6QB 3H59A 4OKJA 3VQ6A 3S9HA 3VQEA 2ETJA 1VRTB 3K5MA 2XRIA 3MFHA 3SQ2A 3Q8RB 3G86A 3SQ0A 4RW4A 3V1RA 1JLEA 4KAZA 5KFDA 4WZMA 3G6YA 4QAGA 4IDKA 1KCFA 2KZMA 1YTUA 3QEXA 1S1VA 1JKHB 3OYMA 1QAIA 4KO0A 1LV5A 4M3TA 4DFPA 1T7PA 1IKVA 4PQUA 3P83D 3VQBA 4CJ5A 3VQ5A 5KFRA 4CHOA 1J9AA 1U45A 3V6JA 1BISA 4KAIA 4MK8A 4FM0A 3MECB 1W0HA 1T94A 4F4YA 5KI6A 4M3ZA 2RDIA 3HVTB 3G6VA 1LWCA 4J2DA 3DLKB 3KHRA 3H98A 3NL0A 3DRPA 3BDPA 3LP0A 3SZ2A 1XR5A 3NGIA 4CERA 1IKXA 2IJNA 4KSEB 3ZSYA 3UIQA 5D3GA 1HYVA 1X9SA 2AX0A 2RPIA 4FLUA 2QE5A 3RAXA 3PW4A 4IFVB 3O4NA 3HXMA 3T5LA 3SQ4A 2VG7A 5C24B 4ZP7A 5HROA 3QIDA 5EDWA 2QXFA 1TK0A 3RAQA 5KFOA 1S0MA 3NBPA 2XGQA 1U48A 1C6VA 4ICLA 5F8IA 2IDOA 2CKWA 3KLHB 1I3AA 5HRNA 1NHVA 3GIJA 1QSSA 4DWIA 4GVMA 3RMBA 4YQWA 4CIEA 1HPZA 1C0TB 3SFUA 4LSLB 4NLVA 4W5OA 4J2EA 5KT2A 3UQSA 3OYHA 3BSCA 4HCCA 4OPJA 3PZPA 3MF5A 3HPOA 1NK6A 4NRUA 4LD0A 4RG8A 4NLWA 4ZVEA 3MFIA 4B9VA 1LWFA 4ID5B 1LW0A 2VG5A 1NOYA 3RB4A 2Z1IA 3P1GA 1S1UB 4NLYA 1JLQB 3AVJA 2KW4A 1RT5A 1BQMA 3MEDA 1JL2A 4ID1A 3I0SB 3H4DA 2YHBA 4BE2A 1UA1A 3DMJB 2XY6A 4FJXA 4FBTA 4RNNA 4F4XA 1JLBB 2UVVA 5J2NA 4ZPCA 1TL1B 1JLAA 3NAHA 3DRSA 2RF2B 4FZYA 4CIGA 2JEFA 4N56A 3CM6A 3ZSVA 1RBRA 4EZ9A 2EHGA 3CJ5A 4H8KA 3QIPA 4B9NA 1J54A 4CJ3A 3WNGA 3MR2A 5C42A 1NKEA 1BIZA 3KKRA 3SI6A 1WNEA 4KHQA 1BCMA 4KHWA 4RUAA 1N4LA 3V81A 3AO2A 4QW9A 4M41A 2HAIA 4FK2A 4FJIA 3LZJA 4DU3A 2PY5A 1HNIA 2W9CA 4CECA 4TY8A 4PWDA 1ZYQA 3TAMA 3VA0A 4CGGA 3TAFA 2I5JA 2HW3A 1SH2A 4AHCA 3DOKB 4KI6A 2HHSA 3E51A 3KOAA 1C1CB 4KTZA 4Z4HA 2LSNA 1ZTTA 3DLGA 3KLIA 1WSJA 1RYRA 2FLPA 3TAEA 4CJPA 3MEGB 4K4XA 1L3VA 2JEIA 2BRKA 3SV3A 4WXWA 1BGXT 4Z0UA 4Q44A 2NUBA 3RRGA 4H4OA 3CFOA 1CLQA 2ZE2B 5F8HA 3MEEB 4H4MB 3ZSXA 2JGUA 4CEBA 1S10A 2HHWA 1WSEA 1KTQA 1CSJA 1IKYA 4DU4A 3FFIA 5KT6A 1EXQA 4KV8A 1RBUA 3C6TA 4G1QB 5J2MB 3VQQA 1VSMA 1IG9A 1K1QA 3H5XA 2YKMB 1QUVA 1GOBA 1S1WB 2HHVA 4CJVA 2C28A 2BQRA 1KLNA 1NK4A 3KLGB 2QV6A 3OYNA 2UUWA 3KHLA 1A5VA 4Y2AA 1QAJA 4FW2A 3F73A 4CJUA 2OPPB 1HMVA 2CJQA 4N41A 4DLGA 4LH4A 2AU0A 3AO1A 4EO6A 5SWMA 2XCPA 3JSMB 3M8PA 4FYDA 4E7KA 2YNGA 4Q0BA 5T7BA 4Y1DA 3JYTA 1TKDA 4CGIA 2IA6A 3IRXA 4NCGA 5J1EB 5CZ2A 3GIMA 5DQIA 3ITHB 4J9PA 4OL8A 3NF6A 3IG1A 3MR5A 2AX1A 4IG3A 4BACA 4CF8A 3DLRA 1D1UA 1KVBA 3QGIA 5L1KA 1QE1B 2C22A 3CJ4A 1JLGA 4XO0A 2ZD1A 4J9RA 5KG0A 2OA8A 4K8ZA 1TKZA 3NHGA 2P5OA 2YNHB 4DEZA 5HRRA 3HL8A 3OYFA 3CQ8A 5K14B 4EYIB 2FVSA 4ZVFA 2XY5A 4FJKA 4K4UA 3SCXA 4CHYA 2XO7A 3ZSZA 4E7IA 2FJVA 2F8EX 4JV1A 3OLAA 2AGPA 2XC9A 1HQUB 4JLHA 3OYBA 3LDSA 1RT4A 1RDAA 1CZBA 1N5YB 1KVAA 3H4BA 4K4SA 4DFMA 3IN5A 2BANB 4WE1A 3HP6A 4GC7A 2ALZA 4MK7A 1IKWA 4J2BA 2AWZA 2YNIB 1X9MA 1DTTA 3KMSA 1NJXA 2BDPA 3CVKA 4DG1A 1O1WA 4WFXA 3KKSA 2C2EA 1RT6B 4IBNA 1UA0A 4RW8A 1SL1A 1NK8A 1HQEB 1HARA 2B6AA 4IOBA 4KHSA 4ZPAA 3ZSRA 4DTSA 3QEWA 1Z4UA 5DQGA
chains in the Genus database with same CATH superfamily
5FPEA 2HBLA 1UWBA 1ASVA 1C1BA 5EUHA 3R5CA 3FCWA 1NRKA 2B9YA 1S7HA 3L2VA 3FVYA 5CABA 2WZ1A 3B6BA 3AARA 1F9EB 5FDLA 1FI4A 3K2PA 5C10A 4F3QA 1J5OB 4WQ4A 5AT1B 2D3UA 4O8KA 3I33A 3R9PA 2FSJA 1YI2S 4JI5J 2XYGB 1BQNA 3W2WB 1VQ4S 1Q82O 1NHKL 4OV1A 2DNQA 4CEZA 3VGMA 2ZUAA 2CQ2A 1KSPA 2RHQB 4CGHA 4M94A 1VQMN 2DR8A 3C7NA 2OMOA 5AXNA 2GJ2A 4DUYF 2HFNA 2W9BA 1RDCA 4Y2CA 4IO8A 1N34F 2IOCA 4JI4F 3CJ8A 2RU9A 4YHHJ 3WQTA 5GIOA 4X4OA 2IA0A 4NYFA 4LF8J 4CEEA 1WLJA 3RSEA 4DI6A 4GVEA 4NLOA 3MCPA 3CTRA 4RR5A 3TABA 3L9ZA 3HOSA 1R7IA 4B8AB 1FJCA 1FDNA 4Q8EA 3HHEA 3EVWA 3N01A 4KH6A 1S9GA 4Y3CA 2JFKA 2B0GA 5BPMA 5E3CA 2WRMA 3O3LA 3CNQP 2P9GA 4JI0F 4FWPA 5L8RC 3TJ9A 4PG8A 1S1TA 1RWOB 2W2NP 4U7BA 3FZMA 1LNQA 4AXIA 4C7QA 3EUNA 3FR0A 1RACB 4EWTA 4DU7A 4K8XA 2VPYB 3C0BA 4K43A 4QS8A 2F4VJ 1S0NA 1FHTA 5M2UA 4P52A 2ZBRA 1XNRK 2GQCA 4DQSA 4RU9A 4DHVA 2VC1A 2MTLA 4RNOA 2FBVA 2MLYA 3K5OA 2GC8A 5DG9A 3QNOA 2FLNA 4HHJA 1MMDA 1LK5A 2E88A 3IMXA 4DR6J 2IVYA 1KFSA 2Q43A 1T44A 4JI7J 4ECZA 1L3KA 3K58A 1Q79A 3QESA 3I5BA 2OAUA 1HKAA 2AEMA 4WCEQ 2HQ3A 4CJKA 1DQ8A 4B02A 4OJGA 3PVXA 4F3MA 3L95X 3TX8A 3ULDA 1I3OB 3D1QA 4JHDB 3PV8A 3J7AN 3RR8A 2VGMA 3VVTA 4M3UA 1WEYA 1VQLN 2A2DA 1RTJB 4FZXC 1B9FA 1DAXA 3I55S 4RL1A 4QWCA 2IMOA 2MLXA 4QIWD 2R8GA 4MO4A 2R42A 3D2WA 3RWUA 4CJLA 4X62J 2KT3A 1KONA 2HSTA 2CWXA 4K4WA 1NZAA 3OS1A 3P4IA 3HFVA 2O4GA 3G71S 2HNZA 3QWPA 1FVQA 2QEXN 3DOKA 3QICA 4B3SJ 1FTCA 4CH1A 2MY8A 1M0SA 5RUBA 3CB4A 4FCYA 3OR1A 1EKSA 2JOQA 2NSBA 3G6XA 3VAIA 1IM4A 4DS4A 1Q82T 2FF3B 2IIRA 4QWAA 2HG4A 2QL5B 4B3MJ 2K8GA 4NLPA 4NXNF 2GUPA 5B0GA 3CJ0A 2QKBA 2K7JA 2YKNB 3MAAA 2I0XA 5EWEA 3EXCX 4C3KA 3FKBA 1B7FA 1X31C 2A10A 4ILJA 1NAQA 2E5JA 2WSEC 4UZCA 5KG6A 1APSA 3QQCD 3B8HA 4O4RA 5GADI 5KTQA 5J2MA 3TSUA 3V5RA 1TV6B 4OYOA 4IH7A 1VRUB 3AQOA 3NCIA 5AQHA 2CQPA 2W6LA 3CCMS 2CPDA 2DNNA 3VGUA 4GY2B 1AZSB 2JSXA 3HDSA 3EX7B 4DTOA 1S6QA 1I1GA 4ES2A 3H6EA 2E9ZA 3OD2A 1CXQA 5KFVA 2D0BA 2A3ZA 2UUCK 2QSFA 2V8PA 1FNOA 1RLCL 2EVZA 4FVMA 4ZHRB 4PQAA 5HMWA 1MU2B 3RBXA 4NLRA 3PYEA 4OZ3A 2DHSA 3QT6A 2GVZB 3KJFB 5KFJA 3MMAB 4BR2A 1HL6A 3IR5B 5EX0A 5EY4A 4LF4J 3D5MA 1B9DA 1HR0F 1RTDA 1BHLA 2ZJRQ 3RRHA 1IKVB 2RQ4A 4L3NA 2V4QA 1RB0A 2KYZA 2CWKA 2OTJN 5JLHA 4AQYJ 4I68A 5KT3A 5KFBA 2W42A 1BWVA 1R27B 4USUA 1L3SA 4U7CA 4BBYA 3LP0B 1EWRA 3RJMB 1MA9B 1K73O 2O8CA 2ILYA 5D3GB 1R8AA 3HMJG 2RN2A 2WVBA 4QBUA 4FOIA 1XHZA 2DNZA 1VR6A 2J9EA 2MEWA 2VG7B 2H51B 4XH1A 2QIFA 4H5NA 2V2ZA 1WSHA 5HROB 4F7VA 4ICLB 1RILA 2QYGA 2CJYB 5GMKa 2Y1JA 2E6LA 4DV0F 4P75A 1HPZB 2BACA 2ZJQQ 4GW6A 3G82B 2XTJP 3CD5A 4BQZA 1BA1A 3DU5A 4B3OA 4DMZA 4QCLA 2G8HA 3L7PA 3QPIA 1N5SA 3OHRA 3I0RA 4HTIA 5DGBA 3SUPA 4ENOA 1WOPA 3OL7A 3OBIA 3L2QA 4LFCK 4DQRA 2M4MA 1RT3A 1NJIO 1BQMB 3SSQA 2OTLS 4FWNA 1S22A 1JB0C 2DNPA 1YQHA 4ZCLA 2G9OA 3UR3C 1IXKA 4DR6F 1G6BA 2BXJA 4NWBA 3WNEA 4YN3B 5JLFA 3MXMA 4Y2IA 3FEXB 2UUBJ 3QEVA 4I6AA 4HUFA 1WHWA 3HHDA 3B54A 1R0AA 2E7WA 4B9SA 2IAJA 2W24A 2DRDA 2WONA 2VD3A 2ZM6J 3V81B 3TA0A 4J9UE 3H5YA 4BRQA 2Z2MA 4WPAA 3DHWC 2CQIA 3UO0A 4CLYA 3SFGA 2CVEA 4CLTA 2A41A 5CXTA 3P4UB 3JXOA 2G0CA 2BJDA 5K8PA 4LT6A 4L3QA 2I5JB 2G13A 4IKFA 5AZIA 1R6VA 5KRTA 3G6ES 2HNYA 1LKZA 3KLIB 1HPMA 3EWGA 2CIMA 5J2QA 2V7ZA 4JI1F 2AYGA 2MHEA 4C1NI 3BJYA 4EIAA 3OUYB 3K89A 4LFBK 3IO1A 3D6TB 3OYKA 1RWVB 3Q7BA 4F4ZA 2F8SA 2JVOA 4MIBA 4IO9L 2J0XA 3E01A 2DRAA 1WUAA 2BJ9A 1IKYB 3QJJA 4DJBA 2BX6A 3H3OB 3CG7A 3FBCA 3A3NB 1WSGA 5AZJB 4NE9C 4Q5VA 3C6TB 2UXCF 1H73A 2ZWOA 3QJLA 4LF5K 4TQSA 3E9LA 4RNHA 4XPEA 5FLXY 4MDBA 2JWNA 1ZPVA 3K5LA 3QEIA 4ZVOB 3MM8B 3VGKA 4GV9A 5L9NA 3UD3P 2R7TA 3OYAA 3TAQA 1DARA 3PO4A 4EHUA 5KFMA 4LY7A 2ZH3A 1K73T 3GSIA 1YI2N 4W4MA 1HJRA 1VQ4N 1WC0A 3IAS9 5F8GA 2XNQA 1UFWA 3AY9A 4UOFA 4YR0A 1HMVB 2AD9A 2M9KA 4DQPA 3D4JA 4HHTA 3PXGa 3M8PB 3SMPA 5C5JA 1NOZA 1QQOA 1GK8A 3BSOA 1YZ7A 5KFZA 4CO4A 2XO6A 1WOOA 2CADA 1CJVA 1XMOF 3PJ9A 4H5RA 5KFTA 4QZVB 5AE3A 4CD1A 3LOUA 2D1CA 1R59O 3BKUA 4F50A 3L2WA 2ZD1B 4IOCL 3HVTA 3VZHA 3J80Y 1TQLA 1RHRB 5J1NA 2CZ9A 4LRBA 5CZXA 2NUUG 1NJIT 3QMLA 5JMNA 1NJYA 3KD5E 3BGOP 1OY9A 5A2QU 3UKRB 1GOAA 3MOJB 4PEOA 2YHYA 1S5JA 1IQZA 1HNXK 5JS1A 3OS0A 3LF0A 4F8RA 1FJGJ 4IFVA 1GOCA 4ED3A 5BRFA 5JVGL 3CF5L 4Z2XA 1FFGB 4WE1B 2BJEA 4LC9B 2A1SA 4IJAA 4JYAF 3AH6A 1ZBIA 4ES1A 4KTWA 2FVPA 2CQDA 3ISNC 5AFUA 4LSLA 3ZT1A 2PZSA 5B0DA 4K4VA 3GFXA 3FSIA 4KHRA 2RUSA 1VHIA 3VQ8A 1VC6A 2GJFA 1VK8A 4HWIA 2BKPA 4F4WA 1S1UA 5F41A 4DR3J 3U27A 1VSKA 3WUHA 1W9HA 3TA1A 4LF9F 3MMCB 1S0VA 3EO3A 1QZ6A 2X78A 4YB7A 1OSDA 1YJNS 4DV6F 4C6AA 3SEOA 5DETA 4FW1A 4PY5A 3JAMO 3M8YA 2UU9J 2BJ1A 2Q79A 2HZVA 3UNGC 1KRPA 3MCSA 3VN5A 4LBPA 5KG5A 4CJSA 2AW0A 3T7ZA 1RYSA 4ELVA 1NU4A 4ZVRB 1RHKB 4QU7A 5ADXA 3KLFB 4DV3F 3I55N 3FBEA 3PJXA 3PNIA 3VAHA 3CM5A 2C3OA 3AO4A 1RNHA 1D5AA 1UKUA 5CD4H 3H90A 4A8SA 2W25A 1BU6O 1IVZA 1F3FA 2GVDA 2GS8A 2WC9A 4KGVB 4GKKK 2KI2A 3O1BA 5KFHA 1VI7A 1N32F 4R5PB 5B09A 2H48B 3QERA 1XNRJ 4JI3F 1DURA 4UOCA 2E9RX 1Q1KA 3P8BB 3NH2A 4JS4A 2LVWA 3MM6B 2E7VA 4BCAA 1Q8IA 1ZBLA 4CLWA 1ZAVA 4ECVA 3HVWA 3RB0A 4ZPWR 4BREA 2C42A 1T9XA 2PIIA 3S7RA 5ELZA 4IXCA 1EWQA 4P7VA 3TANA 2J4RA 4J9SA 1HNVB 2VUGA 2ITMA 4R8UB 3JQJA 2UP1A 4FJ8A 3L0QA 1BD6A 2PI5A 3EGZA 4CEAA 2D3ZA 3KLVA 4FXVA 4ERDA 1FRLA 2YKMA 1C4AA 3MM5B 4FKYA 5ADZA 2QFIA 3WX8A 1L3UA 2RKIB 4RZRA 3AA8A 2GGPB 1KLMB 2MKIA 3KLGA 3P39A 3SSSA 3CCMN 2AJ0A 2HZAA 4FF1A 2O66A 4QOZB 4F2RA 4PKIA 3DXSX 3R7NB 5IM0A 4Z94A 2E9TA 4M63A 5EWFA 4RCHA 1S9EB 1H7XA 3HSGA 1HNZF 2G2YA 1PC5A 4DR4F 2LQ9A 4DR1F 2HHHF 3HKWA 3O80A 1RTIB 2J7KA 1Q8KA 3AA5X 4JAXA 3UNYA 3OXFA 2EFGA 3MAHA 5T14A 5J1EA 4BRHA 1J5EK 4Y0FA 3ITHA 1L3TA 3D2FA 3SQ1A 3I82A 2LYVA 3CHWA 3THWB 4IDKB 1X5OA 1RAJA 3OSPA 1QQMA 3ICLA 3MOZA 2P9KB 5DG8A 3ENOA 2CYYA 3DCAA 4PWWA 1WNSA 5GAGP 2W2OP 1SJQA 4DQIA 3CD0A 5TKYA 3M2RA 1IR1A 4TN2A 4BHQA 2IC3B 3T6BA 3IS9B 4O3SA 3OYDA 3LGNA 1T9YA 4A8OA 1RHMB 2XWXA 1Y0HA 1T6DA 5C25B 1N5YA 1U8SA 1QLNA 4N76A 3CQYA 3HJVA 2G0IA 2W7PA 2AV5A 3LWMA 2IMWP 4ZVHA 5CYQB 1EETB 4NASA 5ETSA 3PR4A 4CLSA 4QJVA 2FLOA 4G9ZA 2P8IA 3DOLB 2FQQB 4QS9A 1UEKA 3ZX3A 2P6SA 3PACA 2H54B 2ZHOA 1VQ5N 4DFJA 1OQ3A 1RT6A 2CPZA 2Z2YB 1FXRA 4NLCA 2VBXA 2Q6BA 5GAEP 4G1IA 2DR6A 3OV7A 3W65A 3CCSS 1FWPA 1Y5LB 3G87A 4MT1A 4BRCA 3ENQA 2CPJA 1CJKB 3AO5A 5E26A 1CVJA 4WTOB 3PO5A 4ISGA 2MJNA 2WCXA 1F21A 3JQMA 4F02A 3SPYA 2OTLN 4CBUA 4DSKA 1J5OA 4PG4A 1RXOB 3O3GA 3AGRA 2GX9A 5D4PA 3DLBA 3W2WA 2RS2A 4C8MA 5AQXA 3V1QA 2YWEA 2VDIA 4GV3A 3PEHA 1WKKA 4L3KA 3T6JA 3MPWA 4O4GB 3D28A 2DYAA 4W90B 4Q45A 1IBLK 3ZTPA 5CA5A 1NBEB 2CNNB 4WFNL 2R8HA 4E1NA 5BRHA 5D77A 2IYGA 3QJPA 1NLVA 1PIEA 2NRTA 4YNQA 3LL3A 2W01A 1IBMK 2DEJA 4BRKA 4CJQA 4DV4K 1FE4A 4RX6A 3LPYA 2MQMA 2RNEA 4WFAL 2YPYA 1VSEA 4CEFA 4HVJA 2QXLA 4MLEA 2DGTA 4LFCJ 4PKGA 3EKSA 4R79A 3I5AA 2DNGA 3GL1A 3BM7A 1YF5L 4E7JA 4JP8A 1EKEA 3J7YP 4AL6A 1QJHA 4M42A 2FJDB 1VRQC 3MMBB 4FF3A 1CLFA 1SKUB 4GKJJ 1EQMA 2DD8S 4KR0B 1K0TA 1YBAA 2AYMA 2HSEB 1XN9A 2BKOA 3O3HA 2OFHX 3TWHA 3LM2A 4FWMA 2DGUA 4DMNA 2PSZA 3FBBA 3O08A 2AT1B 5MLCV 3M8RA 3ZFVA 1NMEB 3HT3A 8RUCA 4DX5A 3CDEA 1JX4A 4A57A 3DU6A 1M5HA 1NG9A 2BJ8A 4NEZA 2FVCA 3CCZA 3S8SA 4UZBA 3BPDA 4DN9A 3D68A 3PFEA 4F04B 1YT3A 4DF4A 2RAQA 1JLCB 5LM7E 3SCIE 1FRMA 1OWXA 1GLCG 4CWBA 3S3MA 4JHDA 3CJCA 2E6MA 3O5BA 1RTJA 4ATNA 4CO2A 4ECTA 1T05A 3AVGA 3WZ0A 3W64A 3PTWA 1QQNA 1NM1A 5JMVA 3ZX2A 1U4BA 2R7RA 3QYYA 2DFHA 4BRGA 4DPWA 1R8BA 2GHPA 3GE9A 5ETPA 3W9IA 4FBUA 3PX4A 1VSIA 2X3DA 4LF5J 4C8NA 2A0FB 2HBYB 4MAKA 1W7AA 4CE9A 3ATUA 2D1KA 2LDIA 2HIQA 1UPMB 2CNOB 2HRYA 3PHEA 2WTFA 1PYSB 2XMMA 3ZZ0A 1SJFA 2YKQA 1ZETA 4BC3A 1H38A 1M90O 3R27A 2HQCA 3T1HJ 1SUQB 2YKNA 1KP6A 3WT0A 1D9FA 4DR7K 1G4CA 2QWLA 3TU5A 1S99A 1S1XB 1CULB 1RKIA 2ASMA 1KAXA 2XMJA 2O5DA 3A8KA 3KK2B 1VQSA 4ZA1A 4DFKA 4LF6K 4B9UA 1UTAA 2AHOB 1TV6A 1WORA 2G8VA 1WN7A 4LREA 2UUCF 3UPFA 4ISEA 1VRUA 2G4BA 1RDUA 2UUTA 5DRKA 2QYCA 1NWKA 3THPA 1LFWA 4A8YA 2ZITA 2VBZA 3BZQA 1NLKL 2HURA 1AZSA 5LL6d 3WNFA 4OHXA 5KFSA 1S5ZA 2FBTA 4I1TA 2QLWA 3Q7CA 4UQGA 2CPHA 3CJ9A 3W7BA 3DAWA 1QTNB 2KT5A 4CO3A 4ZHRA 2CZ4A 2FBYA 1MU2A 4WKYA 1HNXJ 2W1BA 4OKJA 3VQEA 1VRTB 2F7VA 2XRIA 5HVHA 6FD1A 3G86A 5LSOA 2GVZA 2LMIA 3MMAA 3V1RA 4V19J 1CZAN 1Q8BA 5KFDA 5BREA 4ZPTR 1KQGB 4QYZJ 5GAHU 3SBMA 2KZMA 2MQPA 3BBCA 1RK8A 2GO9A 4XK8C 5H9FJ 2R7SA 4W92B 2A40A 5AQFA 1QAIA 4KH5A 1RI7A 1HKGA 3MUMP 4DFPA 1IKVA 1JK9B 3P83D 5DZ7A 5C0YA 1J9AA 5TKWA 1U45A 4LVOP 5KI6A 4M3ZA 2RDIA 3NCRA 1SXLA 4J2DA 4U95A 2EG2A 3RU0A 3KHRA 3R2DJ 3D7EO 2NR0A 3LP0A 3SZ2A 1RAOA 3A5NC 5JVGQ 1G1XA 3S41A 2VDHA 5D3GA 2OJ3A 5HAOA 2AX0A 5KPZA 4KRWA 4DUZK 1Q86O 4ZITA 3PW4A 3E9PA 4CZMA 3SQ4A 2F9WA 2VG7A 3CMQA 5C24B 4LFCF 2OFGX 5HROA 2DBBA 2XMTA 3QIDA 1DHMA 3M1FA 5KFOA 2N4DA 1UW4A 3SCLE 4ICLA 3ILIA 5F3ZA 3MZIA 4V19S 2CUYA 2CPXA 3KLHB 4CDIA 3NY0A 2KM8B 3M1VB 4GVMA 1HPZA 1C0TB 3SFUA 2E66A 1ILYA 3AOCA 3G82A 1IR2A 4W5OA 4UF4A 3MF5A 4NRUA 4LD0A 5M1KA 1CEZA 1URRA 4AYBD 2KFYA 4GKKJ 2VYPA 3P1GA 3LDOA 3W5YA 5EN1A 1BQMA 5AFUH 3D0HE 4ZCMA 1N33K 1JL2A 4NA3A 2X1AA 1NCLA 2FHJA 5M1NA 4LFAJ 3O9RA 2CA9A 1M1KO 1N5TA 2YXLA 5BYQA 2BV3A 1TL1B 4IOAQ 2RF2B 2NCKL 2JEFA 2NZTA 4CZIA 1OSCA 2K3KA 3DDNA 4CW7B 2P2CB 3H20A 3CJ5A 4IOXA 2PEHA 4B9NA 5KPTA 1EB0A 3F9MA 3I31A 4Y28C 5LJ3Y 1BIZA 2APOA 1WNEA 4WQ4C 4KHQA 1LEOA 3VWSA 3V81A 2UXBJ 4FK2A 4IDHA 5J1PA 4QS7A 2L9NA 1KEKA 4DU3A 1WWHA 4LFBF 5ADXH 4P2SA 4J91A 1FW6A 2LLZA 3B4DA 4B1UB 1XQSC 4CGGA 2I5JA 5AQWA 4AHCA 4P72A 3E51A 1MMNA 3KWMA 5DO2A 4IYQA 4S0MA 8AT1B 4WP8A 1VQNS 4Z4HA 2LSNA 4PXDA 3KLIA 2ZBPA 1RYRA 3K17A 3TAEA 3TQEA 4CJPA 2ASYA 4K4XA 1L3VA 1BGXT 3FBFA 4DV7K 3MDFA 2IY5B 4Q44A 3RRGA 3CFOA 2YPZA 4H4MB 4KC5A 2JGUA 1T11A 2NYHA 1U1NA 4CEBA 3KWIA 1YJ7A 3ZTSA 3MPUB 5IOLA 2X1GA 5HVFA 1CSJA 1IKYA 1BO5O 4DU4A 2HHPA 3L09A 3NGUA 3EL2A 5AZJA 2AJ4A 3C6TA 3KWGA 1E6VB 4XH4A 3D54A 1F0XA 3MM8A 3W5ZA 4CJVA 3LM9A 2ZEJA 2BQRA 1NK4A 3ZZRA 2NXEA 4X66F 3ET6B 2UUWA 4DV2J 4FPAA 2Q1LA 1A5VA 2H3EB 4Y2AA 1QAJA 1OPIA 2VODA 4I6MB 3ISZA 2DHXA 3M6VA 3W2VB 1Q86T 1HMVA 5GAGI 5HK4A 5SWMA 2L41A 4OZ0A 3M8PA 4MYTA 5T7BA 3KDNA 1Y5IB 3GTYX 1TKDA 3C3LA 1VMBA 2KG1A 5CZ2A 4YOXA 5CZVA 3GIMA 2LEBA 1ATNA 4J9PA 3IXQA 2CPFA 1N88A 2JRSA 3OQ2A 1D1UA 5LSRA 3QGIA 5L1KA 2ZD1A 5BPNA 1EJ7L 4J9RA 5KG0A 1S4EA 4K8ZA 5GIPA 4PG5A 4ZKAA 3NNAA 3FFKB 1EAYC 3FC9A 3F2KA 4DEZA 2X1FA 4ZVFA 1YKWA 3UKRA 4K4UA 3OFHA 4YOTA 5GAEI 3O6WA 9RUBA 2XC9A 1OH8A 3N79A 1VQKN 1B0TA 5IC4B 3H4BA 1KVAA 4EAHD 4KH4A 4R0JA 5ETTA 3KUGA 4WE1A 1RGVA 1RJJA 3I4HX 3SAHA 2YNIB 4O5FA 3NGRA 2LECA 3KMSA 1NJXA 1HX1A 1JNZB 4DHYA 3EVOA 4OQJA 1U2RA 7FDRA 1SL1A 4IEEA 5BN8A 1NGAA 3KDOA 3C6HA 4IUFA 2VOOA 1Q16B 4PXBA 2C2ZB 5ETOA 1VDHA 4N8NA 3THXA 5DQGA 3MMCA 2Z4PA 3LAMA 1P9YA 3CCJN 2BE7D 2DGQA 4MLHA 1TKTA 4PRFA 3TZZA 5D4NA 3SYZA 3HULA 1ZBSA 3A13A 2JZ5A 1T8EA 2O01C 4FSVA 3BY5A 4EO8A 1VK0A 2VFVA 4JKHA 1WTFA 3HM9A 3SXLA 3DRXA 2O1PA 3EN9A 3JSBA 4EK2A 3KLFA 2J76E 2M52A 3CCUS 2RT3A 3NE6A 1WUUA 4DR5K 3Q8SB 1C0UB 4H4KA 5KT7A 1D4XA 4C8YA 5AXLA 1HLWA 2EI5A 4B9LA 2XI2A 1RT7B 3NGSA 4OKEA 4J9LA 5FPDA 3J7YI 4CJWA 2OHDA 2E5LK 1BWFO 1GXLA 2ATLA 3CPEA 4R5PA 1X4FA 2ZJPL 3DC2A 3TSPA 4DQQA 4YR3A 2HB5A 4OYWA 5I3UB 2N7CA 3MECA 3QO9B 4FLYA 1Y3JA 1KN6A 4YR2A 2VBWA 3C94A 3MM6A 2ZQBA 2ZH8A 3O9UA 4C8LA 4FWQA 1TL4A 4JI2K 4PA1A 2GO8A 3BQ0A 4IRDA 4HL9A 2I1RA 4BDYA 3DWLA 1Q8LA 4ZJQA 5E0OA 2DK2A 4MQ3A 3OHBA 1X4EA 5AJ3J 2B7CB 3AVMA 5BXIA 4O3QA 4TY9A 3GBTA 1HNVA 1RDRA 4R8UA 3PW0A 4CGJA 3CPWM 2B4VA 3SIPB 4RO0A 2W9AA 2RILA 3PG9A 3UR0A 2ZWPA 4N8OA 3TUJC 4HACB 2BMBA 1L5UA 1PC4A 3MM5A 1WELA 3CFRA 3CMAS 4AFFA 2RKIA 2GGPA 1NPKA 1KLMA 1RCOB 4J7CA 1NKBA 3JTOA 1J5EF 4B1ZA 3HF5A 3ID6A 3VOVA 3U4LA 2CZVC 2QW9A 3MCMA 1S9EA 3ZT4A 2BZ2A 1Y3KA 1QVGR 4HEA9 3MWBA 3G8QA 1XK8A 3AODA 5FLXU 4JI6K 4DR2J 4BRNA 3ULHA 1VHFA 2YBVA 2EFPA 2YWGA 3AXKA 1RTIA 3HD2A 4K50A 2COLA 2W2MP 4CK3A 2XSFA 4CLFA 3DXMB 2R3VA 1FFWB 1HNWK 2WAQD 4KB7A 1F9FA 3NH1A 2D0OA 1HA1A 2FJEB 3THWA 3W8GA 1A7GE 4ED0A 4OGCA 3W3DA 3V1OA 1H7WA 5KFGA 3S1TA 5DM6Q 5EVZA 2P9KA 2IGIA 1PJ5A 4EYHB 5LXRA 4ECSA 4JI8J 2Z0GA 3HJFA 2CPEA 1T3NA 2J0SD 2C2NA 1PYOB 2WTUA 2BH1A 4LF6J 1B99A 2C2MB 4NYZA 4AL7A 1WDTA 2Q66A 3MN6A 1W2IA 5F9LA 3SUNA 2A6AA 1TUGB 2IC3A 3D0GE 4JV0A 3H5SA 5A8RB 4AILC 3IS9A 3R97A 2MQNA 4PG7A 1R43A 4RUCA 4DL3A 5DS7A 5C2DA 5C25A 1REVB 2IM1A 5AQUA 2GQQA 1A6LA 5AQJA 4KT0C 2MQLA 3J80U 4P71A 4E89A 2GMLA 4HI1A 2ZHAA 3K0JA 1KVKA 5CYQA 1EETA 1KAZA 3QBXA 2ZZTA 3QRRA 3NVKA 1HD1A 4CJ7A 2O8BB 1Y64A 3DOLA 2YQ3A 2B4UA 2ACMA 4ZVGA 4BR9A 4JK8A 1U0HB 4XDCA 1N56A 2ASPA 3N6LA 3LPTA 2DNOA 2MGZB 5KFFA 2DGVA 4P9SA 2NRXA 4DKWA 4X65K 2NXUA 2CXEA 4ZCKA 4NO7A 3MN7A 1DKGD 3HFKA 3EJMA 2ZVIA 1QAYA 2JC0A 5SUHA 5HSPA 3I9V9 5KG1A 3OYJA 4GO7X 1BI4B 1HIYA 4X4PA 3CCVS 3RVCA 1EQ0A 2HHTA 1IBLF 4X4QA 1JJHA 2B5JB 3UD5A 4NB4A 4JRPA 2VIHA 4UUWA 2NUHA 1HRHA 1TK8A 1UETA 4CFDA 4MKVA 1NGIA 1YUWA 1RAEB 4OLAA 4MKBA 2FC9A 3NF9A 3DFEA 3AFGA 1IBMF 3N4PA 2X6NA 4NX9A 4DV4F 4OX8A 5F8NA 3V6DB 4O4GA 2IRYA 2ZH4A 3M9OB 4GMKA 1WC1A 2XMUA 4Y6IA 3SUOA 3H8YA 4XIUA 1KWMA 3PYFA 4KBOA 2K3IA 2VPZB 1JLEB 2MKYA 2R2TA 1HWJA 2IVPA 3PW7A 5DDPC 3OS2A 2L3MA 3NXZA 1S1VB 1F60B 2ZH1A 4U96A 5JS2A 1VQON 3QATA 3HVRA 3OHAA 1BLUA 4H0TB 5B8HA 2VKZG 2AGOA 2LEAA 3HCXA 5DDQC 4LBIA 1H2VZ 1Y00A 1YJ9S 2HVIA 5LL6Z 3K8VA 3O9SA 3FUYA 1VQNN 4DV1J 2QM1A 4HHUA 1LWCB 4O55A 4I6WA 3AGKA 1N33J 2Q3SA 4BDPA 2KT2A 3O8WA 4USHA 4YDDB 4UW2A 1V5VA 4I69A 1Q78A 4CQ1A 3M7VA 4DZ6A 1YRXA 2PT0A 2LQ5A 1HYZA 3MMBA 3I5CA 1ESVA 1ASUA 2JEJA 5EX3A 3FZ2A 1WC4A 2OYQA 1DZ5A 3GCXP 5M1PA 3R1XA 2JLEA 3NNHA 1EX8A 2XNRA 1FESA 1UFLA 2GMJA 3ZZOA 3GR0A 3U1LA 2R9LA 1U49A 2E8AA 3ZZZA 3SAFA 3PSIA 1VQ8S 2ZDOA 3ZNJ1 3D6FB 3OYEA 4OHWA 1HHSA 2DPIA 2HWIA 2X7IA 4OMFG 4IWVA 5AQGA 4QW8A 3OYLA 4PPDA 3G0ZA 2M7SA 3GCWP 5KOWA 2HQGA 5ITHA 1K9MO 3WXJA 3H42A 3D0PA 4CIOA 1LW0B 2VG5B 2QO3A 1K44A 4DL5A 2KKZA 3ONQA 1JLCA 4PXCA 3TUPA 3OY9A 1OH5A 2OCEA 2DH9A 4X64J 3C46A 5B7WA 4CO5A 2DISA 5J2NB 3D1HA 4FO0A 1WB9A 1UAXA 4OPAA 4DV7J 4IO1A 4RPFA 1JLAB 2RMLA 3DRSB 3SUQA 3WBZA 2C2RA 3T1YF 4KRFA 4I67A 2R8KA 4ZVQB 1ZA1B 3QGGA 1X4GA 2HVHA 4XTTA 2OP5A 2J9DE 4A46A 4J9QA 2YX7A 4GNIA 3QAEA 2HF4A 3S3OA 2OO4A 4DR7F 4F0MA 2KRRA 2Q3PA 3O44A 3NEKA 4XAKA 4OYBA 1HNIB 1SKRA 2ROGA 2W9CB 4TY8B 2LCWA 4BGBA 1HI1A 1KOHA 2X6SA 1NK7A 1KVIA 4OZ5A 3CJRA 4OX7A 1SUQA 3IM9A 5LMUJ 4G65A 1C1AA 3DLGB 4WU3A 1KVCA 5HQ8A 4WZQA 4CGDA 1S1XA 1CULA 3J7AP 1UVKA 3ULEB 3KK2A 4M45A 3T41A 1ELOA 2HK2A 3IR6B 3BR9A 1DLOA 3THVA 4F3TA 5KG7A 2FZCB 3SDEB 2LQJA 3CCLS 2QFJA 3FFIB 4DSJA 4YHHK 1RAAB 4KV8B 5DMRA 3CWJA 4K4TA 4O44A 4LF8K 1B4SA 3VQPA 4PWUA 1WSVA 3HSTB 3TEHB 2EC0A 3J81Y 3NKYA 3FSXA 3MWPA 1RWXB 3SNNA 4CLKA 3K57A 3G4SS 5KFIA 4PABA 1BY9A 2XG8A 1UJ5A 3D45A 3OTOK 5HATA 2BA9A 1S97A 1VRTA 1YHQS 2E44A 4ZMMA 2J6SA 3OVBA 3CCUN 2YKOA 1SL2A 3KHGA 4OGEA 3AAQA 4M3YA 1P90A 4F4AA 4BC7A 2YNGB 1RWNB 1JIHA 3QGHA 2QI2A 3CULA 4Y1CA 1HQ2A 2DRBA 4M63C 2VV5A 4FYXB 1ZBTA 3IA0A 1I94J 2B4PA 4AM7A 1VS3A 3FZKA 2FB0A 4DUZF 4DCJB 4YY3K 3VERA 2DH8A 4WF9L 2F4VK 2MKSA 5D8HB 4V1Ak 1JLGB 1W7WA 5A6PA 1HBMB 1K9MT 4J9NA 4L75A 3NGTA 1FEEA 3RBDA 1TKZB 1W26A 1Z26A 3MX5A 3EPGA 4NLXA 2ERRA 3SMSA 1A5WA 2HVZA 2FD2A 3BPSP 4Y0WA 2BTFA 3FQLA 4ZLLA 1CXUA 2YTCA 1G15A 3J7Z5 3U3YA 3SJJA 2DHHA 3RAMA 2KVIA 3BSNA 5F8LA 2V8HA 3Q8YA 5C24A 4A5BA 1S49A 2RSQA 1WSIA 1NJWA 4M5KA 1RWKB 4KREA 4FYYB 1G3OA 1N33F 4W5QA 2AYBA 3AA2A 4USKA 1EHWA 1IKWB 2DNKA 4CJRA 3KLHA 4F2SA 1MWMA 2HBMA 3T5JA 3M1VA 1N5QA 3UDVA 4B8CA 1C0TA 2KLAA 4DR5J 4Z4CA 3R3LA 4DG1B 5CR4A 3IP0A 3VAKA 2UUAJ 2L9DA 3A4TA 2ZH7A 3HVAA 3T19A 3Q2SC 1X5SA 4ANEA 2P9SB 2K2PA 1SKSA 3HKZD 4X62K 1NJZA 2E5LJ 5KFCA 2D5RA 4WK1A 4Z7YA 2R7WA 2VGNA 1S9FA 4DTPA 3U3GA 1NDLA 1DTQB 2KVQE 1U1KA 4B3SK 2Z2ZA 3D7SB 1WOQA 4ED6A 1S48A 4Y2MA 1FEHA 1TL1A 4RWTA 1VSJA 1DFDA 2RF2A 3C15B 2ZGZA 2W4DA 1V5IB 5DQHA 3IGNA 3KK3A 2FC8A 4DSIA 1U1LA 2OUGA 4B3MK 5KFQA 1P1LA 3FGUA 4CF0A 3U8XA 4L8RB 2V9KA 3ZEUB 2AYEA 3C6AA 1WC5A 1FRJA 2RHSB 5IXUA 5K5MA 3RMAA 4MYUA 2NRVA 2CNKB 3ID8A 4OHVA 1GH8A 2MYFA 4O0IA 3KLEB 5A8KB 3EZOA 2ZJPQ 4FLTA 2C3YA 1TKXB 3N9UC 2ALYB 4OPHA 5A6WA 4LR8A 5FROA 3NMUA 5C2GA 4W98A 3L4IA 1VQLS 2A6MA 4KHMA 2PN6A 1N36J 1XEZA 3H1QA 4OLPA 1IO2A 3OXGA 1M5PC 1UP1A 2HNDB 4DLEA 4JI6J 1BWEA 2E5GA 3FMBA 2OEKA 3PYGA 3LDPA 4KHPJ 3ILJA 2RQKA 1KD1O 3OLBA 4QYRA 4FJ5A 4ECQA 1TZ0A 3PJWA 1X8DA 1GLAG 1SCJB 3R2CJ 1XTZA 1HNWJ 3KHYA 1RWUA 1TUYA 2F1FA 2XZTB 3WXKA 2QA4G 4U6PA 4N7TA 1NGEA 3BGUA 1JLFB 4KGZB 2UVWA 4JK7A 4LF4K 3MR6A 2V34A 3CCVN 1TVRB 2JEGA 2DY9A 3ZX0A 2WSCC 5CYMB 3GV8B 2V69A 4Z4IA 4NMXA 4JUZA 3I9ZA 3NWRA 4KQZA 4K42A 4JS5A 3ET6A 5BR8K 1Q9XA 1U0SA 2QLXA 3FRYA 2DR5A 2BQUA 4CLUA 2BUNA 1B7YB 4I6MA 4LVNP 3Q8QB 2BOPA 2ZJQL 3RGIA 4AQYK 3CJ7A 3W2VA 1Q0NA 2JDJA 2MLZA 3O4QA 4MH8A 5E3PA 3AV9A 4AHRA 4XPCA 1IWAA 4BY9C 1VQ9N 4EBCA 3KHHA 2BUPA 3NS5A 4MMOA 1ZZFA 3TTFA 1GXUA 1NGHA 4MIAA 4LF7J 5EX5A 4KHUA 3OT9A 1HI8A 4WP3A 2HGLA 3HI0A 1IBCB 3AVAA 1FJ7A 2XLIA 2A1RA 2E1PA 1RDBA 2IRXA 4OPKA 1CJUB 2FSKA 1YJ9N 4CLZA 2LDYA 3KXDA 3AY0A 3R9LA 2QWPA 4N5SA 3DI6B 1NPPA 5I42B 2YI1A 4JKFA 2PMZD 3Q23A 1RKJA 2AJ1A 3ASMA 3ISND 4YDUA 1W2BR 1FWLA 5KAKA 4OVLA 3GV7B 2NSCA 2NQPA 4CZCA 3H08A 1KTVA 1ZBFA 3WEEB 2ZVSA 3D9BA 3SQOP 3OJUA 1OMSA 2OTJS 3GJRB 1FKPB 1U6FA 2YNIA 3E8OA 1AT1B 1REGX 1NB2A 3UVJA 2FC0A 3A8JA 2M2BA 3PIPQ 3R1HA 5B0AA 3GIIA 5LMNJ 2F8HA 4ES3A 3VHQA 3TTCA 3SSRA 3SI8A 1GLDG 4DQ8A 1FVSA 2V8VA 1RGIA 1RA6A 2V67A 1VQ8N 4AE5A 2KKHA 3CCES 4FL9A 2LXUA 2NXCA 5AQZA 2HFVA 3CD6S 3EM1A 4UT4A 4K5SA 3B6PA 1EO1A 1TELA 3RW7A 5H9EJ 1RBTA 3C14B 1FA0A 4BC4A 3W60A 2FJXA 2L9WA 5E3AA 3EE9A 1KD1T 3E3XA 3NDKA 1IUJA 2E5LF 5KT5A 1TR0A 4H5TA 4EZ6A 3J8AA 1XMQJ 3CJAA 4OI1A 2QWQA 3T69A 1PBAA 2V8DA 2ZBIA 1C0UA 3N6MA 4JI2F 1FFSB 1XHXA 5ETKA 2AMCB 4PCQA 5J2PA 4R0EA 4K8RA 2W7OA 1XERA 1JNRB 1RT7A 1VQYA 4Z7CA 2KJWA 1XR6A 3LDNA 3LWLA 2C2DA 5I3UA 4EBDA 3MDQA 3LDQA 4BR4A 4NLUA 3N5BA 5IWAJ 5HANA 3BQ2A 3HTVA 1NGGA 2I38A 1NGFA 2HRTA 1WKLA 3ZYYX 1FK9B 4OI2A 2QZ8A 4OJHA 1Y5NB 4PKHA 4F67A 3TRGA 3BN4A 4A8WA 2BOAA 2J0WA 3TWZA 1WAJA 5EHHA 2ASLA 4LQ9A 4EP4A 4QU6A 2HFOA 4HACA 3MGJA 5B0CA 3PSFA 2FJAB 3ZSWA 4DTMA 4IG0A 3IAYA 1HWIA 1E6YB 1XNQF 1S76D 4AHUA 2VC0A 4FYVB 4NXMF 5JJBA 1MLAA 1HNWF 4KE5A 4RW9B 1V3ZA 1OY6A 4PYAA 2KFNA 4CF2A 2FUG9 4JKCA 2PMWA 3CJQA 3O4WA 4A61A 4FVUA 3GU0A 4ECYA 3G4SN 2ABYA 4ANDA 3PX0A 3AD9C 4FJMA 2OLWA 3C95A 1QD1A 1S7IA 2YX6A 1LWXA 3OL8A 2HBKA 2M8HA 1YHQN 2H5EA 3DXMA 3I6PA 4P74A 4OI0A 3GPAA 3M6XA 4CTAB 3W0LA 1FJGK 3OXLA 1RDWX 4B3RJ 4Q2MA 2VG6B 5IT9O 3SLCA 2CG8A 1ACMB 2ZOFA 3A2FA 2B9WA 5CD4A 3AA9A 1WC6A 1JJ4A 1IG8A 3ZZUA 3MD1A 1M5VC 4UOGA 4NCBA 3NH0A 4BE1A 2EX3A 5THWA 5K8MA 1GMWD 2EKNA 5A8RA 2G8FA 2PE8A 1SQGA 5DZ6A 5LT5A 1NH8A 5D6GA 3RMCA 1SIWB 3R5DA 2PI4A 3MN9A 1REVA 2VPWB 3HPHA 4IH6A 2QTWA 4DR3K 3QRPA 4X65F 1YITS 5KGWA 3CXCM 4M7YA 2MQ8A 2MQQA 2DR7A 3NMAA 3BEXA 2DY4A 2O8BA 2RQMA 3W9JA 2IS3A 1J27A 3FLCO 3WXIA 1SL0A 1TK5A 2UU9K 3UN2A 3K7RA 4CH0S 1U0HA 3OTOJ 3QBWA 3DOMB 2EKYA 3GR1A 4YB5A 1EIYB 2YV0X 3SPZA 2G8UA 4TSXA 1YBUA 1IBKK 3BEGB 2NXJA 1ATRA 2ASDA 2CQGA 3RBEA 3PRVA 2VQFF 4G6VB 2ZZNA 2ROPA 1JXLA 4KYZA 5B0FA 5EU7A 2E1YA 4BDZA 2XWYA 3UFCX 5HP1A 1FKOB 4ZPDA 1BI4A 3HZ6A 2MSSA 3BO2A 4TXSA 3LP2B 1DQAA 4O3OA 3GILA 2B5JA 3ILLA 4YY3J 2Z2LA 1VQ7S 2JC1A 1N0VC 2ASJA 2ZKUA 2XGPA 2V52B 1U25A 1H74A 2VQEK 4IFYB 1HWKA 3BH7B 5KRSA 1WDDA 1X4CA 5HBMB 6AT1B 4UY85 3A3OB 4YORA 2QK9A 3V6DA 2FGOA 2J7WA 3BDEA 2OEMA 3H59A 2VWBA 3MFHA 3SQ2A 1AB8A 2C2KB 4AUKA 1JLEA 2DO0A 1F1BB 4QAGA 3BO3A 1S1VA 4WF9Q 1JKHB 3SJHA 2HEKA 3P5TL 3GJTB 4M3TA 3VQBA 1FKAF 1U2VB 3VQ5A 2XSJB 2VZ9A 2IHR1 1BISA 4KAIA 3M30B 2K7KA 2HS3A 2DHAA 4F4YA 1GLFO 1W0HA 3GJSB 3U1MA 1LWCA 3GFHA 2OD6A 3PIOQ 3FZLA 4DUYK 3BDPA 2P9LB 2GV1A 1IQTA 5K20B 3VGVA 5CQGA 1MWYA 2IJNA 2B9EA 2Y0SD 2QWMA 1N34K 4KSEB 4JI4K 1GLJO 5D4LA 4BG9A 2DITA 2G1DA 4BRAA 4FLUA 3AAWB 1KR4A 3O4NA 3T5LA 4KH0B 1TUUA 5EDWA 2P5VA 1O5JA 5ETQA 1C6VA 1ZOTA 1ROFA 2DPNA 2CKWA 2WB1D 3PLAA 1YJVA 1NHVA 3GIJA 1WEZA 1XJWB 4YQWA 3NOGA 4ZPVR 4NLVA 2GWKA 4J2EA 2L48A 1TL7B 5FPNA 3HPOA 1NK6A 1MWZA 1Q18A 1LW0A 2VG5A 7FD1A 5EOYA 2Z1IA 5JICA 4NLYA 1JLQB 1VBKA 3AVJA 4WIIA 2CQ4A 1FE0A 1P8GA 4ID1A 2LQ8A 2YHBA 2KU7A 1BA0A 2XY6A 4FJXA 4RNNA 3HBTA 1JLBB 1KVJA 5J2NA 1EARA 4OX9J 4B1WB 1JLAA 3DRSA 3UN5A 4N56A 3CM6A 1S57A 3AJ2A 2FHOB 2EK1A 3NVMA 4JV5J 2UZAA 1U1RA 1ULRA 4HHHA 3DXKB 1B0PA 4CJ3A 2QWRA 3SI6A 1SAZA 4JI5F 1IJJA 1BCMA 4KHWA 4RUAA 5C15A 1FRKA 3AO2A 4QW9A 1R8PA 1FCAA 9ATCB 1FD8A 1HNIA 1O0PA 2PY5A 1RU1A 2W9CA 4TY8A 4ALZA 5BR8J 3VA0A 1HWUA 4MDAA 4FWKA 2HW3A 1SH2A 5AXKA 3KZBA 4H4KC 3DOKB 2GMHA 1Y9OA 4KI6A 4YHHF 1S72S 4KTZA 2POKA 4LF8F 2K1RB 4ZDNA 4JNEA 3DLGA 3UDCA 3HSDA 4J37A 3ZZTA 4WXWA 4Z0UA 4QIVA 2NUBA 3CJKB 1MROB 3LGMA 3MEEB 3ZSXA 3I96A 1WJ9A 2LEPA 5AQNA 3AD7C 1HHQA 3CCEN 4CT8A 1S10A 2HHWA 1TMMA 3SDEA 5K9FA 1WSEA 3CXCR 3FFIA 5KT6A 4KV8A 3CD6N 4GV6A 3FNNA 3A5OC 1VQ5S 5J2MB 1BDGA 1IG9A 3JSRA 2HHVA 4H03B 2V6AA 4P2MA 4NXNK 4JD2B 3OYNA 1B70B 4CD3A 3UCUP 2UV8A 4BR0A 2KB2A 4B1XB 3BR8A 2R7XA 2P9UB 3VETA 2HRUA 2F4VF 4CJUA 4C8ZA 2A18A 2AU0A 1Q4RA 2IJRA 2E5HA 1FT8A 1PGZA 3EGWB 4E7KA 2YNGA 5E2QA 3IBCB 1NSQA 2IA6A 4GKJK 4ZVSB 4JI7F 4WQ5A 3EGNA 3GZ7A 4DDFA 4BACA 2Q0RA 2F8MA 2C22A 1QE1B 3CJ4A 1JLGA 3B82A 2LP4A 1UFKA 1HBMA 2OA8A 1X0PA 3UE5A 1TKZA 1VBZA 4LRFA 3OYFA 1S79A 1DQ9A 3CE8A 3L7UA 4FJKA 2M5YA 3SCXA 1NGDA 4E7IA 2FJVA 2F8EX 1UJ4A 1F5CA 2HBRB 1HQUB 2QRRA 3LDSA 3H45C 2A3JA 1RHUB 3IRWP 4X62F 3H46O 3IN5A 2HIYA 1FDDA 3HP6A 4CZEA 2WBMA 2ZZMA 2ALZA 4MK7A 1ITPA 1IKWA 3ADAC 3ELHA 5M1QA 4BVPA 4J2BA 3HFZB 1X9MA 4B3SF 2BM0A 4DX6A 3PKMA 4DX8H 3DDIA 2BDPA 4DG1A 4WFXA 3W61A 2C2EA 4KGKA 2OKQA 1UA0A 1V9OA 4QR2A 3GYXB 3TZYA 2P9SA 4A4JA 1HARA 1RHQB 5BN9A 2FHKA 4B3MF 2EW9A 2N3OA 4DTSA 2UV8G 3QEWA 3ZLJA 4ZCIA 3X1LB 2F9TA 3QT8A 3KJQB 1KKHA 1NDPA 1DTQA 1KQSM 3G8SA 3KUHA 1F3VA 1UMJA 2HGNA 4JK9A 3O9QA 5LJ5Y 4K4ZA 3IMQJ 3KNGA 3MD3A 4OLBA 3C15A 2AJ2A 1M5KC 2NPFA 2W2PP 2VB6A 2XEXA 3UCZP 2WBNA 3D0IE 5KG4A 4CVNE 2ZH9A 2YY3A 1K0VA 4DV0K 3S6EA 3AAPA 2GCFA 3US5A 3T1HK 1YRTA 2BKNA 3ZEUA 4I56A 4L72B 2ADBA 4QIGA 4IR9A 1ITGA 2BGGA 5HLFB 5AQQA 4PG6A 4PUOB 1TKXA 4RW7B 3VQAA 3BGRB 1GMWA 4C9DA 4LRDA 2GFFA 5C7PA 1ZPWX 4ELTA 4DV5J 1TP7A 3M8WA 4D3HA 1YITN 2B56A 1QVFR 1JL1A 2B8QA 3WIUA 4FLVA 5GAHP 2ZH2A 1QQCA 2HNDA 3E66A 1HD0A 2XMWA 4J9MA 3J81O 4LF4F 2CH6A 1RSCA 3W1YC 2WB4A 2H65B 3CJSA 3P45B 2VJVA 2G2ZA 2D41A 4M5GA 2AF6A 3RMDA 2U1AA 3CCRN 5BYRA 4GVLA 5F8JA 4CT9A 4AQYF 2PYLA 1VSFA 1JLFA 3V6KA 2K06A 1N8RO 3SAGA 1VJQA 1X5TA 1VFJA 4QYZK 4ANCA 2PO4A 4CJTA 1TVRA 4N47A 4CYUB 3OYGA 1Z25A 1E4GT 4E1JA 1H2TZ 1VQ6S 5H9FK 2KXFA 4JEPA 5CYMA 1N54B 3TARA 2DR9A 2NREA 2OPRB 1WTBA 1MWKA 4CO0A 2DGSA 1VQ7N 2OPSB 1M1GA 3FQKA 1YZ6A 1O6XA 5KFEA 2G8WA 1CQMA 4JI1K 1RHJB 3C6UB 2D9OA 4NYOA 1WBBA 5ETLA 1T3VA 3CCQN 2IM2A 4OZNA 1ZM9A 3PR5B 2X1BA 3SCJE 2CVIA 4GVBB 4DU1A 1T03B 3FCVA 1MDUB 2EEYA 4PPZA 3K5NA 1RBLA 4F3OA 3O1WA 1O8BA 4F25A 3MEKA 2C3PA 2XBPA 5HRPA 2Z1GA 1IBKJ 1T6CA 2WK4A 4IOAL 2J8SA 4KPCA 3TW0A 3TAPA 1YXQA 1JXBA 2V2VA 2OZSA 4X2BA 1CJUA 4WFZA 4ELUA 4FKXA 1QY7A 2YWWA 4ZVPB 4C0BA 2KHDA 3DM2B 2B4JA 3I8DA 1YJWN 2ZNZA 3AVHA 3KUEA 3DI6A 5L9XA 4H5VA 1LWEB 5I42A 4LJMA 3VENA 3GONA 2UUBF 1UL3A 2FZKB 4K0KJ 1Q7LB 3R7BB 3PRBA 1DJ0A 3WEEA 1C1CA 4M5JA 1RE1B 2VQEJ 1TL3B 1T0TV 1FKPA 4LFAK 2ZM6F 1RTHB 2ADCA 4FPBA 2Z58B 1NUEA 4B3TJ 4CFCA 2ZE2A 4OZ2A 2YWFA 2VU5A 4ED4A 1WAFA 5ETRA 3JAMU 4QWDA 2M0GB 3IDHA 4CFAA 1KQKA 2FY8A 4I9LA 1WF1A 2FHMA 1WC3A 3OL9A 3SV4A 3C2PA 5IT0A 3U9ZA 3GIRA 3TPQA 3CQXA 4H5WA 3BGFA 4K5RA 2UXBK 3UB5A 3EGVA 2ROEA 4TVAB 2YWKA 3IM8A 3C14A 4DTXA 1I5OB 4KFBB 5DLGA 3AT1B 3KNAA 4CFBA 5KOXA 4ETZA 1YJUA 3HHNB 4M5IA 1VQPS 2VFSA 4M5DB 2H3GX 2OPPA 4DUYJ 3MAQA 5AXMA 4ED8A 1U47A 2CAJA 2D7SA 5G4DA 5K8NA 1N34J 4JI4J 1ZM2A 3UW1A 3CDUA 4ZIWA 2FHJD 4PHTX 3AVIA 1N8RT 4M5MA 1AA1B 2VFTA 4BRLA 3RG6A 4M8LA 3H3NO 3P96A 3CI5A 1KQSR 4LF9K 3QEPA 5AR0A 4RW4B 3ZT3A 3IC1A 4PL8A 4C23A 3Q0AA 3BQ1A 4ED1A 1TFYA 2DJWA 4JV2A 4Q7AA 4LR9A 4DCHA 4C0HA 1X9JA 3MWTA 1U6ZA 4KPYA 1SKWA 2GWJA 4CESA 3F5TA 2GNKA 4FJ9A 4HI2A 3GLJA 4PQUB 4KTQA 2PYJA 5AQTA 1NK0A 4H0XB 3EZUA 4CF9A 5DG7A 2VOPA 2KFZA 1IH7A 1FK9A 4DSLA 1S72N 4DV2K 3VQ4A 2IM3A 2KHOA 4DV3K 4JI0J 4DBQA 1BCOA 2VBYA 3D66A 1R8CA 3U6FA 4FS1A 4WYLA 3DRPB 3CT9A 3HX9A 2IRUA 1IV0A 1ZAXA 4XH5A 4X4TA 4WIQA 4ZIVA 1E6YA 1N32K 5HL7Q 3NG8A 3RZAA 4CEDA 3MM9B 3S01A 3CDAA 2W8KA 3CC7S 3FMWA 3OA9A 3KJNB 4HYKA 4RW9A 1V4TA 1FJGF 3CERA 1RAHB 4P2XA 2Y8YA 1BOTO 1VC0A 4KHYA 1YTAA 4DPUA 1FNMA 3KG4A 5EGYA 1WHXA 1HBOB 2LKZA 4YDXA 4A47A 1RCHA 2VH7A 4BR7A 4BVOA 1XQIA 2M88A 5IM0B 1LWFB 2E1AA 3FEYB 3NAIA 3PYDA 4WK3A 2A5XA 2KM8C 3TOQA 2DNHA 2IBKA 2MKJA 1RBAA 1RT5B 4CTAA 1PJ7A 5M1FA 5CAAA 3DDKA 2EXUA 2VG6A 2MY7A 4DR3F 4FZVA 3VQSA 4H54A 4OHYA 2GIRA 2ZC3A 4FK4A 3K9KA 3QSIA 2PFFB 5LJWA 3VQTA 4W5TA 1RUSA 2RJZA 3BP8A 5F0XA 2YJEA 2D9PA 1K8AO 2UU9F 2XS7A 2YHXA 2QMUB 1T95A 1UOCA 4QPTA 2X51A 1HNZK 4DR1K 1U1QA 5C42B 4ZLPA 3OBWA 3V9UA 4DTJA 2VHGA 4GC6A 1CPZA 2R7QA 4HT5A 3FCHA 4IRKA 3TJAA 3BGLA 2AGQA 4WKRA 4NLDA 3IAM9 5IT4A 4NXNJ 6FDRA 2KXNB 2Z1JA 4PWDB 3ZCMA 2ASOA 5BPLA 2WFBA 3TAMB 3QZ7A 4FK0A 5KFKA 3KMQA 1C4CA 3MXHP 2YWHA 5F3TA 5FD1A 2Y9HA 2QN6B 3POTB 2CQCA 2HOEA 3PUFA 3TR5A 2HLUA 5DM7Q 1XNRF 3MM7B 3PKYA 2ZOMA 5BJRA 3W63A 4OJ1A 3WXLA 1VIXA 1VQKS 2GBZA 4X4RA 1NKCA 2NZCA 2YH0A 2R7YA 3MXIA 1FKOA 4JB8B 1ZXOA 3RRKA 4PL7A 3LP2A 2MSTA 1T9VA 3TA2A 3VESA 3LZIA 2W40A 3CO9A 3QIOA 4ILHA 3M5RA 3IWNC 4ZOSA 2HWHA 4LF1A 2R2UA 1LOTB 1WSRA 1NK5A 4IFYA 3AOAA 3F41A 4WFYA 4DPYA 1NH7A 5HBMA 1N0UA 3GJQB 1OS5A 3F56A 2NNWA 3EZWA 4FJLA 4YFUA 4C11B 3CCJS 4YP3A 2VJUA 5AJ3K 5B0EA 1K6YA 4OI4A 4EI2A 2P5GA 2ZUGA 1R0CB 1HR0J 2D69A 4KHNA 1SH3A 2C3MA 2H5JB 1DBDA 4WU2A 3JYTB 1Q9YA 1OYEA 4KBIA 4CZJA 1JKHA 1QHTA 4NCGB 2DTUA 2W4PA 3LW5C 4RBVA 3AA4A 4FLXA 4IG3B 1U2VA 2XSJA 1IM6A 5AE1A 4C8KA 1LXNA 3M30A 5DM6L 1DT9A 3QT7A 5L1IA 4LQ3A 2UYTA 3Q83A 3V9WA 3OW2R 2R4FA 3H25A 2R8IA 1WG1A 4YS2A 3HLUA 3C16B 2P9LA 3BO4A 4DR2K 2R2SA 4O3NA 4CRJA 1Y97A 4FWOA 2ZKTA 2QT7A 2EC2A 1J53A 3N4QA 2KN4A 2RS8A 4FN5A 4ID8A 3MTJA 3HHLC 3NP5A 1U2CA 3X3UA 4P6QA 1PKUA 4JRQA 4Z4EA 4DV0J 4YOWA 2B43A 1BUPA 1K8AT 3V4MA 3QFHA 1VQ6N 2DCLA 2GTDA 3VQDA 1PAEX 4CK1A 1FDBA 3I87A 3B78A 4YDUC 4MKYA 1M5OC 4JI8K 4FLZA 3IFRA 3D6HB 1TL7A 4DTRA 3VQCA 1U7LA 2DFFA 2R2RA 2Z30B 1HKCA 4CEOA 3ENAA 2VA3A 4RW8B 3HPGA 3VF2A 2B6AB 4DZDA 2EWSA 1JLQA 2LA6A 4NYNA 5U47A 2DXFA 2OSRA 2DPJA 2ZC4A 2IM0A 1WG4A 2DGWA 2QL7B 4AHVA 3HM8A 4RTFD 4H0YB 1DY3A 3FSYA 4L73A 2IVNA 2DVIA 1JLBA 2XS5A 1WG5A 3IWXA 1C0GA 1U02A 2DNYA 2LXIA 4OJ3A 1LAWA 4ILLA 2GAHC 3NGKA 5GAHI 4RW6B 4FM2A 3DXKA 3W9HA 2PA8D 2XYPB 1DEJA 5F9NA 2AJFE 4AXJA 3VF6A 1KOOA 1NM2A 3BF4A 4DU8A 4CI0B 1YRUA 1T05B 2B3TB 1RA7A 1QS4A 3L8BA 1YG0A 1D0EA 2ATQA 3N6NA 2O8DB 3WNHA 3BZKA 1V6HA 2PA3A 2J5AA 4KB0A 4I2PB 4DSEA 3NLCA 1NU0A 2FY1A 4WYBA 2GHWA 5FRMA 4RJVA 1F9HA 4JI1J 3W66A 3DRRB 5ETMA 3LQVA 3MK6A 2WOMB 3THTA 2K1RA 2XMAA 4I9QA 1AFJA 2MZQA 1BQXA 4JKEA 1RT1B 4E7LA 1RDDA 3Q8VA 1NHUA 3CJKA 1MROA 3MEEA 1VSDA 4BRDA 4J90A 2CNLB 1SQKA 2R7OA 4U67Q 1LFPA 2ZWHA 2YVSA 2UVRA 4M95A 3HSZA 2UXCJ 2VCPA 4DOZA 3QNWB 4A8MP 2BR0A 3MHYA 3GB0A 1CBKA 4MFBB 4CJEA 1WEXA 1Q53A 4CHNA 5L1JA 2BRLA 1SB6A 5T7LB 2NRZA 4LR7A 3AVBA 1MWQA 4JD2A 4GKJF 4FPRA 1J6ZA 2FLLA 4K7QA 2D3OR 4I7FB 5GADU 2HMIB 1VQPN 2OPQB 3WHIA 2P9UA 3K9JA 3V9XA 4DV1K 2ZHBA 1I39A 4CK2A 2P51A 4TQRA 3A3PB 3Q2TC 4FF4A 1NDCA 1FX4A 2HQFA 1XUPO 3AD8C 5CHIA 1XMOJ 3DLLL 1F2HA 1HYSB 2I8EA 5K8OA 1KHVA 5CY4A 3H2UB 1QAXA 1YBTA 2BEFA 5F1XA 2V68A 3M32B 2XYHB 3M05A 1QE1A 2ZOGA 1FX2A 1S6PB 3GIKA 2F96A 5D0EA 5A0YB 4FM1A 4RU2A 4ECXA 3HD1A 2EPIA 4HUEA 2DNRA 2ATCB 3D3CJ 2FJBB 5D15A 5KG2A 1HQUA 1RTZA 2ITGA 5T41A 4TU8A 3GG0A 1VQOS 2FZGB 4JYAJ 3CJ2A 4CEQA 4F0HA 2GUIA 3H2VE 4E3SA 1ASWA 2W41A 4MIWA 4X64K 1PSDA 2J9CA 1W25A <