2IAJA

Crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with atp
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
551
structure length
551
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Clinically Relevant Lys103Asn/Tyr181Cys Double Mutant HIV-1 Reverse Transcriptase in Complexes with ATP and Non-nucleoside Inhibitor HBY 097.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H (p66 RT)
total genus 142
structure length 551
sequence length 551
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2iajA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iajA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iajA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iajA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2iajA05
1RDDA 5C25A 3VQ4A 2BR0A 4IFVB 4I2PB 1SH3A 5C24B 4CHPA 2HNDA 2FVPA 3BQ2A 3KK1A 3CJ5A 3H2LA 4LSLA 3T5JA 4TQRA 3SI8A 3C6UA 3DLEB 4RW7A 4OL8A 4H4OA 1IKYB 1JKHB 4DLGA 5JXSA 4DEZA 1UWBB 3S3NA 2AQ4A 5DQIA 1KRPA 3M9OB 3SV4A 3SYZA 4CIGA 5C5JA 2ITGA 4IDKB 4E7LA 1S1VA 3TR8A 4ZP7A 2BQUA 4KKOA 3TVKA 3HVAA 2VG6A 5DG8A 4F50A 5KG6A 4K50A 4O5BA 2IJNA 3PX0A 1NKEA 3NAHA 3PW4A 2BQ3A 3NKYA 4I7FA 4RU9A 4ZVHA 4NLRA 3KK2A 5KFHA 1ZETA 3NBPB 2FVQA 5F8MA 2GIQA 2GIRA 1QAIA 4DTMA 1JXBA 4RG8A 4EO6A 5DG7A 3RR8A 4CHYA 4FK0A 3KTQA 4FM2A 3CFOA 4LSNA 4OLAA 1HARA 4H4OB 4E0DA 5HROB 3ZSXA 4RW6A 3KKSA 3K5MA 3HVRA 3NH2A 4ID5B 2F96A 1RT3A 3NF8A 1SKRA 3E01B 4CIFA 3AVHA 3BQ0A 3PV8A 4CJQA 1RBTA 5HBMA 2YNIA 1IG9A 3RBDA 1HYSA 3M8QA 3NCIA 1ZBHA 3FDSA 3TABA 3CIZA 1HMVB 1S9EA 3QEPA 4AHRA 1RTJB 4JRPA 2VA2A 4WZQA 3WNHA 2E9TA 3JSMA 1QHTA 2AU0A 4KHUA 4FLYA 4JV0A 3KLHA 1EX4A 4ID1A 3D5MA 3UIQA 3CYMA 2XI2A 3QEWA 3OYBA 2W7OA 1NK9A 4FJXA 4CEFA 2YNHA 1RNHA 4KAZA 3IG1A 1U09A 4OPKA 1A5XA 2FBVA 3GQCA 4W5QA 4CF0A 4KFBA 2ZE2A 1NKBA 2BGGA 4TQSA 2IGIA 4NRTA 3H5SA 1S9GA 2P1JA 5CYQB 2C2RA 4B9VA 4NCBA 3FRZA 3CVKA 3OHBA 4RNNA 2IAJB 2D0BA 4DTPA 1MU2A 1W25A 1LWCA 1D0EA 4RNMA 3NMAA 3AVCA 4ED0A 1CLQA 5F8HA 1DLOB 4CFBA 1RDRA 4YNQA 5KG5A 3UPFA 3KIOA 4FBTA 4KB0A 3RMCA 2P5OA 2UVVA 2HHWA 1JLAA 3MR2A 2KFZA 1RTDB 3S3OA 3V6JA 2IOCA 2XCAA 1EXQA 1ZBFA 4G1QA 1TKTB 4KKOB 3TAMA 4MIAA 4LQ3A 2KZMA 1S9EB 3SQ4A 3EYZA 3PUFA 2AX1A 3NF7A 1IH7A 1UWBA 1HYZA 5FDLB 2GUIA 4IRDA 4F4WA 1OS5A 2JEFA 1DTQB 2HNYB 4ECRA 3MEEA 3IGNA 5T14A 1J9AA 2FVSA 1S0NA 2WHOA 4FJLA 5KFPA 4C8MA 5SWMA 3OY9A 1B9DA 5DGAA 3MEGA 2UUTA 2JEJA 2F8SA 4B8AB 2V9WA 3NBPA 1N5YA 4YQWA 4FS2A 1TK8A 3MEDA 1BL3A 5FRNA 3VQAA 3AA5X 1JLAB 1RDAA 1D8YA 4AHVA 4CFAA 3SCXA 3G10A 4PWDB 1RTIB 4FLZA 4RNHA 3IN5A 3IRXB 4KHSA 3UDLA 3JYTA 3DOLA 3KLEA 4QW8A 3I8DA 1UAXA 3NE6A 3EPGA 4DU4A 1EETB 3MEDB 2I1RA 5KG0A 2W9BB 4B9NA 4QAGA 2PZSA 3EZUA 3RRHA 2Y1IA 2QE5A 1VSKA 4DQSA 1CSJA 4Y34A 3AVLA 2B6AB 3RBEA 4O3QA 3Q8PB 3H4DA 4MFBB 2ASJA 1K1QA 4KI6A 2BE2B 3MEGB 4ECZA 1BI4B 1SL2A 4DQRA 4R5PA 4CFCA 1BCMA 3TARA 2I5JA 1WLJA 1RDCA 1JL1A 3OHAA 3SFGA 4J9LA 2HHTA 3DLGA 4DMNA 4GMJB 3MEEB 2XO7A 4FM0A 1IO2A 3AVAA 5HRSA 3KK1B 3QEXA 3CJ2A 5KFVA 4WZMA 4KSEB 4IFVA 3C94A 3QIPB 4O55A 2FLPA 3M9NB 4RW9B 1WSHA 4ED3A 4B9UA 3QLHA 3H5XA 4ZMMA 4WFXA 2AWZA 4HKQA 3HSTB 1NOYA 3L3UA 4WE1B 5D3GA 4DSFA 4Y1CA 4ECWA 1Z4UA 2RPIA 3NFAA 4FZXC 1S1UA 4JS5A 1LW0A 5FRMA 2C2EA 4OPJA 5J2NB 3ZSRA 5KFXA 1HYSB 4YMEA 4JV1A 3SNNA 3PHEA 4ECYA 3S3MA 3AVJA 4KHRA 3OYAA 2BANB 4CEEA 4RUCA 4DTOA 1QAJA 2KW4A 1ZTWA 3QYYA 1KLMA 4MKBA 3DMJB 4FBUA 1MU2B 3QEVA 2G8HA 2YNGA 1DTTA 1ASVA 3T19A 3SUQA 2OPRB 4NRUA 4G3IA 3VQCA 3CJ4A 3B6PA 1XC9A 2WB4A 4N56A 1U45A 4JRQA 1ASWA 4CGGA 4KFBB 1BQMB 3KMSA 4Z4HA 4K4VA 3THVA 3DMJA 3NF9A 3DRPB 4PUOA 4PA1A 1JLGB 1JLCA 4QWDA 1NJZA 2W8KA 4E89A 1NK5A 2Y1JA 4W5RA 4HUGA 4BWMA 1S48A 3OLBA 5KFFA 1XWLA 3QO9B 4B8CA 2XCPA 4YFUA 4PQUB 3BJYA 1KTQA 4CHNA 4CJ3A 1C0UB 3OS0A 3V9UA 2VA3A 3HXMA 4ECVA 2XI3A 4TXSA 3CQ8A 4TN2A 3OS1A 1TAUA 1RBRA 3OL8A 3GV8B 2FVCA 1D1UA 1RT2A 1WSGA 3VQBA 5HBMB 1RT7B 4ED7A 2HHXA 1SV5B 3AA2A 3AO5A 2G8UA 4KTWA 3FFIB 3DM2B 1TV6B 3DLHA 3LANA 2V4QA 5KFOA 3D0PA 1J5OB 3ASMA 2YKNB 4ELUA 5J1EB 1Q9XA 3OYFA 5KFMA 3QIDA 3FFIA 4IH7A 2D0CA 3O3HA 4C8LA 1TAQA 4R5PB 5C24A 4DL4A 4Y3CA 2E4LA 4IKFA 2FJWA 2BE2A 3EZ5A 1IKVB 4J9QA 2IM1A 2R2SA 1TVRA 4N5SA 4DU1A 3AVIA 4DS4A 3PJXA 2HHSA 5HP1A 3KK2B 1WN7A 1HPZA 3V6HA 1BIUA 2QV6A 3QERA 4RW4B 2FJVA 1U04A 3LZJA 2OZSA 2AX0A 3IS9A 1RTIA 2YKMA 4FJHA 3OJUA 4TYAA 3ZSZA 3HHKA 3LWMA 1KFSA 4FJNA 3DOKB 3F73A 3OYKA 4BE0A 3AVKA 4TSXA 3BSCA 1IM4A 4H4MA 3T3FA 1RTHB 3K2PA 3UR0A 3VQEA 1IKVA 5CYQA 1BGXT 3E51A 1BQNB 3PR5B 2KFNA 2OPRA 4W5TA 3QETA 3LAKA 2ZE2B 4IBNA 2IC3B 1NJXA 3HPOA 3D45A 2FLNA 2ATQA 1IKXA 3PW5A 3CFPA 3MXJA 4NLUA 5J1EA 3L8BA 1CZBA 2HHVA 2HW3A 1SL0A 1RYRA 4R0EA 4NLYA 2HMIA 3DYAB 1N48A 3Q8QB 3NH1A 2RDJA 3KHGA 1RT7A 2WRMA 4FLVA 4PY5A 1TQLA 3H98A 4H54A 4NZ0A 3M8PB 1HNVB 4OGCA 5KI6A 3HKWA 3AV9A 3RMAA 3K57A 3ZSWA 4FLUA 4ZP8A 2DFHA 3N6NA 2JC0A 1KHWA 2ASDA 4L8RB 1XR5A 3M8QB 4F8RA 3QLHB 1NNDA 3TAQA 1S1WA 4DL7A 3QIPA 3V4IB 4CEBA 5KFYA 1KVCA 4DG1A 3AO3A 3HK2A 4NYZA 2HB5A 4DSKA 4EYHB 1QSLA 3GV5B 4DTSA 3U6FA 5CZ1A 1VRTA 4DFMA 4E1MA 1JL2A 2W9AA 4CERA 2W9CB 1BQNA 4MFBA 2R2UA 4K8XA 1D9DA 1C1BB 1R0AA 1X9SA 1A5WA 3KK3B 4O3PA 4NLPA 4HHTA 2HVHA 2W42A 1N6QB 2D0AA 3LP2A 3RTVA 1HNIA 1S1XB 2FJXA 2HWHA 3AVNA 4MKAA 4CFDA 4FJJA 4FJ8A 3JYTB 2Z1GA 4BACA 2HNZA 4I2QB 5K14B 3ZT4A 4Y1DA 1WSFA 4MK7A 4DQIA 3AVMA 3ZSOA 3CFRA 4QCLA 3AO2A 3DLRA 4GC6A 4QWCA 4FJMA 4DTNA 4DTUA 3SUOA 2RN2A 3QNNA 1B92A 4NLTA 4DFPA 1S49A 1JLQA 4ED1A 2D7SA 2JGUA 4K4ZA 3BDPA 3H5UA 3MECB 1HNVA 4QWAA 4CJ4A 4ZTFA 2UUWA 5KT3A 2UVUA 5KGWA 3VQ9A 4ZVGA 1BCOA 4FJ5A 4ZHRB 4NLWA 3TAPA 4FJKA 3I0SA 3ISND 1DTQA 1TK0A 2HHQA 4FLWA 4KHNA 2IJFA 3O3FA 4IG0B 2JEIA 4ZP6A 4I2PA 3ITHB 4HTUA 1S6QB 3BSAA 3AVGA 2OZMA 5HLFA 5KFCA 4ED6A 2EX3A 4UQGA 1GOBA 4EYIB 3KHLA 3V6KA 1O1WA 4AHCA 1ZBLA 4F2SA 3BSOA 4NCGA 3NF6A 4Q8EA 2VWJA 2VG5A 3NGZA 2IDOA 2IBKA 3V81A 4ZVEA 2NUBA 4NLXA 1WAFA 4KHWA 4K4WA 1IKWB 1KSPA 4OKJA 3OYIA 4IG3A 4CEDA 1KVAA 1VSMA 3AA3A 4B9TA 1I6JA 3P83D 4K4UA 4K4YA 1Y97A 3HJFA 1FKOA 1S97A 3PO5A 3GILA 1FK9A 1R0AB 4AHUA 2Z1HA 1T8EA 4RNOA 1S9GB 1SKWA 1TL1B 3RB6A 4BWJA 3SJJA 2WOMB 4AH9A 4YP3A 4DF4A 1NK8A 2F8TA 4DTXA 3AO1A 2YKNA 1MMLA 4MK8A 1VRUA 1B9FA 1F21A 5E41A 4IRCA 3HT3A 3S9HA 3SV3A 2R8HA 2HWIA 2E9RX 3GYNA 1NK7A 3VA0A 3VN5A 4M94A 4E7HA 4KHYA 2CKWA 4Z0UA 2OYQA 3RAXA 3PO4A 5C42B 4HUFA 1S0MA 3DRRA 5KFSA 4AHTA 4CJSA 3CG7A 4ELVA 2O5DA 3HVTA 4W5OA 4CJ5A 1TKTA 4CF1A 1LWEA 4BDZA 3QESA 4IOBA 4CHOA 4M3XA 5DLGA 4CJRA 2HNZB 4XPEA 3ULDA 1SUQB 2D5RA 4K4SA 3TAEA 3U3YA 2I5JB 4ED8A 5F9LA 3OSPA 4URSA 5KFDA 2QKKA 4NLSA 4WYWA 4B08A 1QE1B 2OPSB 2W7PA 1A5VA 1VSJA 4B9LA 4KHMA 4IH6A 2W9CA 1Q9YA 2IS3A 5L1JA 4U6PA 5JS2A 4EEYA 5KFAA 2ETJA 4J9NA 1S10A 3OYHA 1LAWA 2ZQBA 4ED2A 2Z1JA 1C0TA 1YVUA 2FC0A 5KGXA 3KLFA 1T05A 4O4RA 3V1OA 2W8LA 5JS1A 3V9WA 4YR3A 1T03B 3DLKA 5F8GA 4CEAA 3SI6A 3KLHB 3P5JA 4CGFA 3G6VA 4NCAA 4ECQA 4WXOA 2B5JB 1JLBA 5I3UB 2G8WA 2FBTA 3LPTA 1HMVA 1G15A 1HQUB 1RT1B 1WSJA 5KFWA 3K59A 2G8VA 2PYLA 5L1LA 4XIUA 5HLFB 3SQ0A 1RDBA 5HRPA 1QSYA 4ICLB 4KHQA 5J2MA 4EP4A 2LSNA 3MR3A 3C6UB 3E01A 1JLFA 3V6DB 1NK0A 2E6LA 1T3NA 4FLXA 3TWHA 5KTQA 4LSLB 1SH0A 4WFYA 3LPUA 4O3OA 4NYFA 4ZHRA 4KO0A 2XY6A 2WK4A 1VSDA 3G0ZA 4KB7A 2RKIA 3MR6A 1VSLA 3I5AA 3SUPA 3BGRA 4M45A 5DQGA 3LDSA 1KFDA 4F3TA 4QWEA 2KQ2A 4O3NA 4LD0A 4B3OB 5I3UA 4FJ9A 4J9PA 4ZPAA 3KHHA 3AA4A 1X1PA 2XY8A 3VQ6A 3HM9A 1EETA 2W9BA 4QPXA 3OL6A 1L3UA 2XHBA 2R8GA 4WYLA 1Q8IA 4C8NA 4DTJA 4MIBA 4FXDA 2X6NA 3V1QA 1T05B 1W0HA 1WNEA 4KREA 3KOAA 1N56A 4M3WA 2PYJA 1RT4A 1D5AA 4DF8A 5F8JA 3RB4A 4GW6A 2D3ZA 3KMQA 2YNFA 3H5YA 4RUAA 4CCHA 4KAIA 4WFZA 2OPSA 1D9FA 2G8KA 4R8UB 5EU7A 2RKIB 3LP3A 4KO0B 1IKYA 1JKHA 4FVMA 3L2VA 2YHBA 3QNOA 4Z4GA 3MTKA 3NGDA 4CJEA 3I0SB 2HAIA 2C22A 2YV0X 5DK5A 3RMDA 4U7CA 4E7KA 4ICLA 5FDLA 2BANA 1RAJA 2IMWP 5EDWA 4IR1A 4FK2A 4Q0BA 1KLNA 3FSIA 5I42A 3MECA 3HVWA 5DGBA 5KFRA 4ZVFA 3LP0A 3HVTB 1ASUA 1BIZA 2J6SA 1TL3B 1TL3A 3GIMA 3SQ2A 3DRRB 3UQSA 5F8LA 1FXXA 2C28A 4WE1A 5D3GB 1VSFA 1C0UA 2IM3A 1RT5B 4M41A 5JUMA 4RW9A 3HYFA 3IAYA 2BDPA 3VA3A 4ZPCA 3MXIA 4DLEA 1SH2A 2DFEA 5K14A 2D3UA 4IFYA 3OYNA 3L2RA 3V9SA 2HMIB 3PW7A 3K5OA 3OL7A 1W9HA 2OPQA 3A2FA 1VRUB 4M3ZA 3DRPA 2OH2A 3QZ8A 5KT6A 4EZ6A 4LSNB 1BI4A 4CE9A 2O4GA 3ICLA 3V1RA 4KPYA 4GVMA 5EUHA 4CGIA 5DQHA 1VRTB 4EBEA 2VWKA 4CHQA 4K8ZA 3PX4A 3V9ZA 1RBUA 4TY8A 4WXWA 1NOZA 4DL3A 4Z4EA 2OPQB 4FW2A 3KLEB 5L1IA 2YKMB 4CF9A 4IG3B 3KLIB 3IS9B 3VQPA 5EWFA 4O3SA 5KT5A 3TAGA 4M3TA 3DI6B 4J9KA 4NLOA 5EWEA 1NHVA 4NCGB 1S1VB 4HVJA 2OPPB 1LW2B 1UOCA 3PZPA 3HPHA 3NGYA 1LWFB 4HUEA 2AJQA 3DRSA 4BE2A 3NH0A 3N6LA 4Q0BB 1ZBIA 4OLBA 1XHZA 2J6TA 1KHVA 4FLTA 4CGDA 2Q3SA 2GC8A 4CF8A 4FCYA 2HNYA 1TV6A 3DM2A 3QINA 1YT3A 5KRTA 3TANA 4ECXA 1C1AA 1RA6A 5J2MB 3PX6A 1SV5A 3WNFA 4FS1A 1NJWA 4XO0A 4MQ3A 1U4BA 1TL1A 4IQXA 4F3OA 3DLBA 4EO8A 3KNAA 2DFFA 3NHGA 4Y2CA 1L3SA 1FKOB 3H59A 3TAMB 1CXQA 3Q8RB 1J54A 3DOKA 3KLGB 1RTDA 4N47A 1HQEA 2WONB 5KG2A 1ITGA 4I7FB 4CJVA 3PR4A 3KLIA 1GOAA 2XC9A 4HCBA 3OSNA 1HNIB 3KD1E 1JLGA 4OVLA 4TY8B 4PUOB 1C0TB 3M9MB 2VG6B 1N6QA 4BDPA 2R2RA 3ZCMA 3QIOA 1TP7A 4NLVA 3MXMA 2BRKA 4Q8FA 5SZTA 1X9MA 3ITHA 3CDUA 1UA1A 4K4XA 5CY4A 1YTAA 1C2PA 4DL2A 3C6TA 1WSEA 1RBSA 2XGPA 4DL5A 4ECSA 1JLFB 3KLVA 2ALZA 4DU3A 4URQU 4O4GB 1GX6A 1Z25A 3KHRA 4DSIA 3OL9A 3M8SA 1JIHA 4DSLA 1N4LA 4DQPA 5J2NA 3SQ1A 1HQUA 1RT1A 3JSMB 3DRSB 3H4BA 4CEQA 4CEOA 1RCHA 3QGGA 1L3TA 1SKSA 4FW1A 3OYEA 5I42B 4X2BA 3T1AA 3VQ8A 4OKEA 4F4ZA 1U48A 4K4TA 3NDKA 3QO9A 4IH5A 2D41A 2B43A 4MH8A 3OYGA 4AHSA 3FQLA 4I2QA 2QXFA 4CHZA 1DLOA 1TKXB 2E9ZA 5KFJA 1S1XA 3C6TB 1CXUA 5KFTA 1TGOA 2G8FA 1VSEA 4CJTA 4YR2A 1IKXB 3KKRA 4J9SA 3GIKA 1REVB 1UA0A 4YR0A 4O0IA 2PY5A 4CF2A 4Q45A 3NGIA 3RB3A 3MAQA 3VQ7A 4RW8A 5J2PB 2X6SA 3AVBA 4Q5VA 4DSEA 3CDEA 2YNFB 3TAFA 1NJYA 4H4MB 4M3YA 2X74A 1NK4A 4TLRA 1FKPA 1KLMB 3M8RA 1JXEA 4M3RA 2RDIA 4KV8A 4DS5A 5EWGA 1I39A 4TY9A 5KFQA 3I5CA 4CK2A 5KG3A 4IFYB 3ZSVA 4DFJA 1RT6B 3BREA 3GIIA 3OYCA 4B9SA 3SPYA 4BDYA 5KFIA 3CJ0A 2KZZA 2DY4A 1VSHA 3CWJA 4ZP9A 1TVRB 3LP0B 3C95A 5DG9A 3PW2A 3M8PA 3BGRB 4OJRA 4ZPBA 2GV9A 3HL8A 3FQKA 2FLLA 3QGHA 4IG0A 3G6XA 2R2TA 3QZ7A 3WNEA 2JC1A 1J5OA 3OJSA 1TKZA 5KFUA 3LZIA 4IR9A 1C0MA 4IRKA 3T5LA 4E19A 2J6UA 2XY5A 4CGJA 3HP9A 1WSIA 2HNDB 4DTRA 3ZSYA 3CM6A 1RT2B 3CDWA 3ZT3A 1GX5A 3AVFA 1RTHA 1FK9B 1LW2A 2OPPA 3WNGA 1JLBB 4Q43A 1ZTTA 3KD5E 4CGHA 4CK1A 4PQUA 4GC7A 1T03A 2EHGA 3DOLB 1CZ9A 2AGQA 1S6PB 1S6PA 4PWDA 3RR7A 4ECUA 3LP1A 4M42A 4RNFA 2ILZA 4I9LA 1EP4A 4CJUA 1HQEB 2WONA 3KLFB 4KB1A 3LP2B 5KFKA 1LWCB 3AO4A 2GBZA 4FJIA 1QUVA 4JLHA 4EBDA 2ATLA 3OYMA 5J2PA 4TYBA 4DWIA 1QE1A 3SZ2A 4OKKA 4E7IA 4LH5A 3L2QA 2YNGB 4ECTA 2UVWA 2X78A 3DLEA 4RW7B 5L9XA 4FYDA 1TKZB 2RF2A 4FZYA 2R7YA 1XI1A 5DLFA 2XRIA 3LAMA 1JX4A 4CK3A 3V4IA 2F8EX 4CJLA 5C25B 3OLAA 4XPCA 3VQDA 1LWFA 3H40A 2Z1IA 1RILA 4LH4A 3SFUA 3LALA 5C42A 1SL1A 4KI4A 3U3GA 5KFZA 3VQ5A 3Q8SB 4ZTJA 4F4XA 3T5HA 5CYMA 3DLKB 5KFEA 3NL0A 4HCCA 5KRSA 4JUZA 3LWLA 3OYDA 2ZD1A 5F8NA 3DYAA 4URGA 5KFLA 5CZ2A 4KRFA 3K58A 3O3GA 4KV8B 4HYKA 4J2DA 3SUNA 1HYVA 5J2QA 2HHUA 5HROA 4CECA 2IC3A 1T94A 5FROA 1VSIA 4J2EA 4J9MA 3ZSQA 5HRNA 1BHLA 3TI0A 3KJVA 3HO1A 2V4RA 1KVBA 4KE5A 1DTTB 3L3VA 1XHXA 1X9WA 3ZT1A 3F9KA 4F2RA 4OGEA 3V9XA 4Q44A 3DDKA 4C8KA 4EZ9A 2BRLA 1YTUA 4NYNA 2YNHB 4DSJA 2QKBA 4CJKA 1IKWA 4QOZB 1XR7A 3EY1A 4ELTA 1HJRA 5KG4A 4DFKA 5CYMB 1YVFA 5F9NA 2DPJA 3ZT2A 1LW0B 1HPZB 1HRHA 4JS4A 4IDKA 3T5KA 4B3OA 2VG7A 3GIJA 1GOCA 2FVRA 4FM1A 2ASLA 4KBIA 5KFNA 3O4NA 1U47A 5DMRA 1S6QA 3GV7B 2YHAA 4B9MA 1EKEA 1JXLA 4E7JA 2JLEA 3MF5A 3VQQA 3N6MA 3BQ1A 3BSNA 1C1CA 1C1CB 4AILC 4ID5A 2WCXA 3I5BA 4NLGA 1I3AA 4Z4IA 3G6YA 3V6DA 2XWYA 3PW0A 4FZZA 2ZKUA 1TK5A 4IKAA 1K6YA 3G86A 5HRRA 3OYLA 1NHUA 3HP6A 4FJ7A 4Y2AA 3I0RB 1JLQB 1U49A 2A1RA 3MR5A 2VG7B 1BISA 3IGVA 1S1TB 4M95A 3SPZA 3RRGA 3PVXA 3O4QA 4Z4FA 3PJWA 2R8IA 1RT4B 2A1SA 4E3SA 3DI6A 1WAJA 4NLQA 3ISNC 3K5LA 1RT6A 1L3VA 3BR9A 3LP1B 4ZPDA 1RBVA 4LQ9A 2V0NA 3TQ1A 1LAVA 5KFGA 2EC0A 1VK0A 4KTQA 3RAQA 1JLCB 4J9RA 4RW4A 3EPIA 2IA6A 3KLGA 2VG5B 2C2DA 1FKPB 2E6MA 1ZBUA 1LV5A 4CEZA 1N5YB 4CJPA 3KK3A 4QW9A 3HPGA 1S1TA 4N41A 3KJVB 4E1NA 4RW8B 1C1BA 4H8KA 3I0RA 4J2BA 2QK9A 4C8OA 3RWUA 2DTUA 4F4YA 4EP5A 4CJFA 2IM0A 4Z4CA 4NLDA 2FBXA 4CIEA 1XR6A 1NK6A 1TKXA 2CJQA 3B6OA 2P5GA 4DG1B 1L5UA 3K5NA 2ZD1B 4O0JA 5KT2A 3VQSA 2O4IA 1C6VA 5KT4A 3OS2A 2UVRA 1S1WB 1QSSA 1J53A 1S9FA 1NKCA 1LWEB 2BQRA 4CESA 1S1UB 1RTJA 1WNSA 2HVIA 2B5JA 5KG7A 2FBYA 2P51A 1TKDA 4G1QB 1RYSA 1JLEB 4FK4A 4JV2A 5T7BA 2YNIB 3ZT0A 4O44A 4J9OA 4O4GA 4BE1A 4DL6A 3RMBA 3CM5A 1QTMA 3MFHA 2R8JA 4I9QA 4M3UA 2ILYA 1RT3B 1K1SA 3RB0A 1T7PA 3H08A 2RF2B 2DPIA 3DLGB 1QQCA 3CJ3A 5F8IA 4RW6B 2G8IA 1BQMA 1S0OA 4DQQA 2IAJA 2WOMA 4W5NA 1QS4A 4J2AA 4R8UA 1S5JA 2AGPA 2JEGA 2B6AA 3D28A 2IM2A 5L1KA 1Z26A 4EBCA 4FJGA 1REVA 4KTZA 3CO9A 5KFBA 2KTQA 3QEIA 4CJWA 2R8KA 2B4JA 5J2QB 1KCFA 4RZRA 3MFIA 3OVNA 4MK9A 1SUQA 3IG1B 1EP4B 4LY7A 2WTFA 3OYJA 1RA7A 3L2UA 4N76A 2OA8A 5KG1A 3L2WA 3IRXA 3NAEA 1S4FA 1ZYQA 3ALYA 4O44B 1RT5A 3V81B 1JLEA 3PY8A 4F4KA 5HP1B 2XGQA 3P1GA 2XY7A 3NAIA 3QGIA 2AGOA 4QWBA 4O3RA 5KT7A
chains in the Genus database with same CATH superfamily
4KBOA 4ZITA 5BREA 1SPBP 2BR0A 4IFVB 1F5AA 4X62F 2FVPA 3KK1A 4EUVA 1VLOA 4X4QA 2PGCA 2HHHF 4RW7A 4OL8A 3Q7CA 3S41A 1UWBB 2VYPA 3S3NA 4M63A 1TFWA 4W4MA 3CW2C 1RE1B 3CCLS 4E7LA 2DT9A 4KKOA 3TVKA 5MLCQ 5DG8A 1N8RT 5B0CA 4F50A 4O5BA 4P73A 4FP9A 5A2QU 1FWKA 2O01C 3FKBA 3HDSA 1T02A 3MDFA 3A4TA 3SQGB 4QR2A 3NBPB 2FVQA 1Y5IB 5F8MA 1U1PA 4BRNA 5LMUF 1MNEA 2ZM6F 4F67A 2ROPA 3C66A 1YI2N 1S7IA 4N77A 2MTLA 4MTPA 4C98A 4WKRA 2BXJA 4OLAA 1OY6A 1S79A 4RBVA 1DKGD 3HVRA 4JKEA 4R79A 4IOCL 4FF1A 1WC4A 3HFVA 1WG1A 1SKRA 1T95A 4CIFA 2SXLA 3KG4A 3BQ0A 3G25A 2Y1RI 4PG6A 2LVWA 1UVMA 4LF6K 2DB1A 5HBMA 5FPMA 1XIQA 3NCIA 2C2ZB 3FK4A 1ZBHA 2BABA 1S9EA 2EEYA 4DV4K 2RUSA 3EDRB 1QVFM 4W98A 3D6TB 2XLIA 1QHTA 3KLHA 4ID1A 1N5SA 3D5MA 3CYMA 2AYBA 3W66A 2XI2A 3JTNA 3QEWA 2W7OA 5K8NA 3HSDA 4CEFA 4J91A 4A59A 1RNHA 5E2QA 4YORA 3AY9A 1P27B 4OPKA 3GQCA 3ONQA 4CF0A 2PFFB 3M2RB 3VWSA 1ZBSA 4DHYA 4CZLA 2U2FA 2IGIA 2P1JA 4DX5A 2QTWA 5ADXA 3CJQA 2D0BA 2R7OA 3UVJB 1LWCA 3NMAA 1FDNA 1W7AA 2ASMA 4C23A 1RDRA 5KG5A 3I33A 5AJ3J 4FBTA 3R5CA 4P2FA 4HR2A 3S3OA 1TKTB 1S5ZA 3UE5A 3VZIA 4CO0A 5GADU 3S6EA 4BQZA 3PUFA 1RWVB 2HFOA 1VQ4N 1IH7A 4CDIA 1UWBA 5FDLB 1Q4RA 4IRDA 1M0SA 4JHDB 4F4WA 1FW6A 1OS5A 3DLLQ 1BE4A 4ECRA 4JI1J 3FBCA 3IGNA 2VQFJ 3OR2B 2Z30B 3HRGA 3DXMB 4JI5F 1B9DA 2JEJA 2KJVA 3K7RA 3RSEB 5BYRA 4A8WA 1NSAA 3CCJS 1RHQB 2HFVA 2GO9A 4YQWA 3MEDA 3AXKA 2JJ4D 5G0RB 2Y8YA 1JLAB 4DPYA 5HVGA 3A5NC 1H0HB 5D4NA 3G10A 1WEXA 5DM6Q 4FLZA 3IN5A 3IRXB 4QOTA 3K9KA 3KLEA 1IBCB 4F7VA 1UPMB 7FDRA 2XHWA 4CLLA 4MLEA 3R1LA 3HF5A 1FA0A 4LC9B 4TNOA 4QAGA 3QJPA 5D78A 4Y34A 3AVLA 1E6VB 2B6AB 3H4DA 1U2VB 4KI6A 1WOSA 3BP8A 3NMUA 1I5OB 3WUHA 4DQRA 1YK9A 2BEFA 3AAWB 4DU8A 1KP6A 1BCMA 2FC9A 2I5JA 1HWUA 3SFGA 4X4PA 4GMJB 2MLYA 3QWUA 3KK1B 2UUAJ 5KFVA 4WZMA 4IFVA 3C94A 4C1NI 1RLCL 2CQDA 1XMQJ 1F9FA 2F4FA 2W7AA 4WFXA 3BO3A 3BR8A 5D3GA 4GO7X 5A8KA 2KKHA 3C65A 1Z4UA 2DK2A 3NFAA 2G0CA 2OTLS 4J5OA 2RVJA 4CO3A 3ZSRA 3MUTP 3PHEA 3OTOJ 4CEEA 2DGXA 4DTOA 4JI4K 3VAFA 1HNWJ 1VMBA 1GK8A 2D1CA 3O9TA 4FPBA 2DNKA 2ZJPQ 2P5VA 3TEHB 3LDPA 4FBUA 4IDHA 1UVLA 4OI0A 3HFZB 4NPOA 5EX0A 2VGMA 2B7CB 3R97A 4P10A 3CT9A 3VQCA 3EN9A 1U45A 4FWSA 3DDIA 4Z94A 2FJEB 3QSIA 2UV8A 2LDIA 1CC7A 4PUOA 3NVMA 4RWXA 3D3CJ 3I9V9 2ZH5A 3CC2S 2LKZA 4E89A 1NH7A 5KFFA 2GHPA 4B8CA 2V6AA 4YFUA 2W41A 1FVQA 2ZGYA 4LMZA 1C0UB 4X64J 3CQ8A 1X5OA 2DEJA 4JKHA 4YOXA 4RPFA 3US5A 1D1UA 1MWYA 2APOA 1WSGA 3VQBA 2BX6A 4CWBA 1CULA 2G8UA 5DM7L 4QPTA 1F5BA 2KHDA 1TV6B 2M4MA 5D0GA 2WC9A 1VQ7N 1J5OB 4GV9A 1Q9XA 4M8LA 2FTRA 5KFMA 1CLFA 1NGCA 2D0CA 2H54B 4MKYA 1TAQA 3DGVA 5C24A 5D4LA 4DL4A 2RD5C 1OIAA 4IKFA 2DNQA 1MROA 1U1RA 1ZAXA 4WJBA 1TVRA 3MMCB 1SCJB 2HZVA 3QBXA 3AVIA 4P71A 1HPZA 2FD2A 1T44A 4PZVA 3QERA 2G2ZA 3EVWA 3D7SB 3VCDA 2OZSA 2AX0A 2VPXB 1RTIA 3OJUA 3ZSZA 3HHKA 1LNQA 3R8YA 3ZZOA 3DOKB 3F73A 3OYKA 1FVSA 4AYBD 2CFXA 3OV7A 3AVKA 4ZVTB 1RTHB 2NS1B 3K2PA 2VPYB 2FY1A 1BQNB 3MWPA 1BDGA 1RFQA 3M2VB 3D45A 1OJ4A 4LF9K 3MXJA 4RTFD 2FF3B 1NO8A 2E2OA 1JJ2M 5LMNF 1SL0A 1F0XA 2AKWB 1QAXA 4NLYA 2RSQA 3DYAB 5J1NA 3QBWA 4DV6F 4FL9A 4DV4F 4UOHA 3H98A 2ACMA 2P9CA 3U02A 3Q7BA 3EEQA 3ZSWA 2HPUA 2DFHA 1RADB 5A0YA 1E6YB 4DR5J 2C1EB 3SXLA 2DISA 3IWLA 3TAQA 1QQMA 2HVZA 1GXUA 2IBOA 3OTDA 2E5HA 1KNZA 3V4IB 4CNZA 5CZXA 2V63A 5LMNJ 1EWRA 1FD8A 2ZKTA 3HK2A 4NYZA 1NWKA 5H9FK 1F60B 4LF7J 2MEWA 1QSLA 3GV5B 1VQ4S 2IA0A 3ZZPA 5E3CA 5B09A 1U6FA 4DFMA 1RBAA 2QYCA 2FGOA 2PEHA 3A8KA 4MFBA 4UY85 3PYGA 2WVDA 1C1BB 3W9IA 1F3VA 2JWLA 1A5WA 4F0KA 2YWHA 2HVHA 2W42A 3TU5A 3MN5A 2LXUA 1DQAA 3RTVA 4YOWA 3K8VA 1S1XB 2HWHA 2R7SA 2P9IB 3ZX2A 2O66A 4FJJA 3JYTB 3G82A 4WK1A 5IWAK 1UJ4A 3ZT4A 4MK7A 1S22A 4QCLA 3MEKA 4UT4A 3FUYA 3ZNUA 3PIPQ 3TTCA 2UUCF 4DTUA 3FLCO 2CNNB 3UD3P 1VQYA 2RN2A 2FC8A 1S49A 2D7SA 4RUHA 1S59A 5AE3A 2KU7A 3WBZA 4ZTFA 4Q2MA 4RUBA 5KT3A 5KGWA 3RAMA 1U0HA 4NLWA 3TAPA 4FJKA 1M1HA 3EZOA 2QSFA 4P52A 1DTQA 1NSQA 4QR0A 2HRTA 3CD0A 3TNVA 3MM9B 4DR7J 2EX3A 4OJ1A 3DLJA 1VISA 2UXBK 4EYIB 3KHLA 2QA4S 4AHCA 4CLFA 4WQ4A 4NCGA 4GMKA 2AIRB 4X4TA 3NGZA 2IDOA 4FYXB 4EIAA 4GNIA 2NUBA 4NLXA 4KHWA 4K4WA 4JI8J 1NMEB 4AM7A 3AA3A 2COLA 1I6JA 5E3QA 4K4UA 2BJ9A 4DV3J 3LPYA 3HJFA 2PEBA 1FKOA 4DUYK 2CJYB 3PO5A 1P1TA 2DXFA 1R0AB 1U6ZA 1NAQA 1T8EA 2BKOA 1SKWA 2K3KA 1A7GE 5JLFA 3QWPA 3SJJA 1SIWB 3L3CA 2F7TA 2WOMB 3TWZA 4AH9A 3D2FA 2KFYA 2UV8G 2YKNA 2V69A 1B9FA 1F21A 3VMFB 3OUYB 4WFNQ 3BB5A 2E9RX 3VA0A 4QYZJ 2VIHA 4M94A 1GQEA 4E7HA 4KHYA 2ZEJA 2KHCA 1WKJA 1U1NA 1XNQJ 2OYQA 5EHHA 2NLWA 2UUBK 5L9NA 5C42B 1SZ2A 3CXCM 3M2UA 4HUFA 3O4WA 2Z2LA 4ELVA 2O5DA 3HVTA 2JWKA 1ACMB 1KQFB 1TKTA 4BDZA 1LWEA 2ZJQL 1FJCA 1VQON 1VQLN 1PO6A 1RWUA 3D68A 5EX5A 1Z2LA 3WXKA 2NXUA 4IOBA 1FRMA 5DLGA 3W64A 4C11A 1HNXF 3BO4A 2MJNA 2PMHA 3O9UA 4A8XA 3O6QA 1Q95G 2I5JB 4RKUC 3R3LA 3WXJA 2LQJA 4URSA 5KFDA 4NLSA 4ALZA 2OPSB 5CHCB 3EUNA 4DUZF 2V52B 1N32J 4J8FA 2LQ8A 2C3MA 5ADXH 1Q9YA 4JNEA 3CD6S 5L1JA 1BA0A 5JS2A 4YOVA 5KFAA 3GJSB 2ETJA 1S10A 3C46A 3OYHA 1LAWA 2ZQBA 3AOCA 4DHVA 5KGXA 1VQPN 3KLFA 3C15B 4L72B 1RAHB 3LDNA 3H0PA 2POKA 1SC6A 1DHMA 2F4VF 4YR3A 2Y0BB 4B02A 4GVLA 5AQRA 2YJFA 3IBCB 2CXEA 2IYIA 4WXOA 1HBUB 2B5JB 1FDAA 1UETA 2FBTA 3LPTA 4AE5A 1BU6O 4CZFA 2HBLA 4M5MA 1LK7A 3Q8VA 3Q0AA 1HQUB 1G15A 1KONA 2G8VA 3M05A 1VOMA 4XK8C 2CGLA 4KGVB 1FX4A 1K9MT 4ICLB 1Z1ZA 3V5RA 2LSNA 2QI2A 2IYGA 3MAAB 5C2GA 1KR4A 2IDLA 4RBTA 2R3VA 2XTJP 1SH0A 3LPUA 3PLAA 2K7JA 4O3OA 1XNQF 4KO0A 2XY6A 1VSDA 3LGNA 4ERDA 2RKIA 3MR6A 2D4WA 4M45A 2HFZA 2VV5A 4OYMA 1MWMA 1QUPA 4O3NA 4FSVA 1VJWA 2WVFA 1RP5A 2XBPA 2E88A 4ZPAA 3AA4A 3QATA 2XY8A 2W9BA 2UXBF 2MKSA 4QPXA 1X4BA 1L3UA 1PJ5A 3GSIA 2XHBA 2K3IA 2OELA 2PMZD 4JKCA 2GS8A 5HOOA 5ETPA 4GKJK 3FGUA 4KREA 3KOAA 5F2RA 2PYJA 1D5AA 4DF8A 5C12A 1HI8A 1RWXB 2LU1A 3DRXA 3RBZA 3D6RA 3KMQA 1T9XA 2YNFA 3QFPA 3QJJA 4IZ9A 2B51A 3FEZA 1NXIA 4DV0K 2RKIB 4KO0B 2O8EA 2YHBA 1KQGB 4C3KA 4IO9L 2J8SA 2MZJA 4QR1A 5EXWA 3I0SB 4DR1F 2VC1A 1VDHA 4E7KA 2B9EA 5EVZA 2RQMA 2HQFA 3IWNC 4IR1A 1KLNA 4AL7A 2F5GA 5KFRA 3ULEA 4CH1A 3THYB 1TL3A 3NOCA 3UQSA 1FXXA 3U1LA 2QA4N 1D3WA 3RUBL 5A8RB 5AZIB 1RUSA 3CD7A 4B3SJ 4M41A 4GKKK 1XNRF 4DLEA 1SH2A 4IFYA 4K2XA 1PYTA 4JKDA 4HEA9 2VQFF 1W9HA 2OPQA 1C4AA 3T6JA 4UY8T 1WOQA 2OH2A 3G8TA 5KT6A 4EZ6A 2FGCA 5E0OA 2C3PA 4RU2A 3ICLA 3V1RA 2WTUA 2VBXA 2QYGA 4CGIA 3NLCA 4EBEA 3PX4A 2W6KA 4TY8A 2PD1A 4B3SK 2ZVSA 5L1IA 2MMYA 4V1Ak 3TSQA 2IHR1 4IG3B 4L6V3 4CF9A 2HQIA 1RHUB 2HBYB 5EWFA 2CQ0A 5KOWA 2XLKA 3TAGA 5D77A 3DJCA 3IWXA 3EVMA 4NLOA 1N8RO 3U8XA 1NHVA 1V9OA 3KFWX 1LW2B 5F41A 4HUEA 3NWGA 3K2YA 1E4GT 3DWLA 4H5VA 5A6PA 2W2MP 3CF5L 4OLBA 3TEGA 1Y5NB 5ETSA 2J6TA 1KHVA 5DDQC 2H65B 4CGDA 2Q3SA 3QICA 1JCFA 1U0HB 3TVYA 4ECXA 3P31A 1C1AA 5KPZA 1WF1A 2H51B 2W25A 1NJWA 1YITS 4LF8K 4KYZA 4TKTA 4H5NA 4DV7K 2EFPA 4IQXA 3CCLN 3DLBA 4MKVA 3NHGA 4K59A 1L3SA 4PG7A 1P9YA 5D0EA 3UI3A 3Q8RB 2E5JA 3O5TB 3UO0A 1TUGB 5AJ3K 2FJAB 2L08A 1UW9A 1HNIB 1MMNA 1S12A 3SAFA 2M9KA 2MKYA 1R27B 1YJ9N 1N6QA 5CR4A 1TP7A 4NLVA 4M7YA 4PKGA 3PKMA 1UVJA 2GX8A 2ZOGA 3EXCX 2HZAA 2BE9B 4JB8B 3VAKA 3LM2A 1C2PA 4DL2A 4OHWA 5JVHL 4JI1K 2BMBA 1YWXA 1RWKB 4ECSA 3KLVA 2CH5A 4DU3A 4OHZA 1IXKA 2EG1A 3OL9A 2QWRA 1N5VA 4BRHA 4DQPA 5HN0A 3SQ1A 1RT1A 4BRMA 3DAWA 2OEMA 1FRXA 4ISGA 2LFVA 4CD3A 3GJTB 3H4BA 4LFBF 3UD4P 1NGFA 1L3TA 5A2QO 2Z56B 4QQBA 2LQ9A 1SKSA 3HHLC 2D9PA 4TU9A 1U2RA 2DNLA 1XMQK 1UEVA 3QO9A 4IH5A 2D41A 4CW7B 4YB1P 4AHSA 4I2QA 1TUWA 1N5TA 4Z37A 1HWKA 2UXCJ 1S1XA 2MY8A 5DS7A 5KFTA 2YX6A 1TYQA 1VSEA 4YR2A 3FCHA 1P6TA 3VVTA 2E2PA 2VQEK 4OYZA 4RW8A 1AXQA 1WKLA 3U27A 3NG8A 4M3YA 2YTCA 4TLRA 1FKPA 1KLMB 3CB4A 1JXEA 3CSKA 3PKYA 4G1PA 2QWLA 3I5CA 4CK2A 5IZHA 2L9WA 3ZSVA 1EJ7L 4JK9A 3NNCA 4NA3A 1V5VA 5IQ6A 4Y0FA 5KFIA 2WVCA 3CJ0A 4FWPA 1ZA2B 3CWJA 3CMAS 4ANDA 1TVRB 4DV1K 1NLVA 4BVPA 3C95A 5DG9A 3R9PA 5B0EA 3DGPB 4DCPB 3C6AA 2KVQE 4B3RK 3OTOF 4ER8A 3HSJA 5KFUA 4LRCA 4DR6K 3HT0A 4USTA 4CGJA 1WSIA 4ZCKA 3CJSA 1TU0B 3Q2TC 1R8HA 2OD6A 2RQCA 4H5TA 3CM6A 3PACA 1T0TV 4LF4F 1HNXJ 3AVFA 1RTHA 2DD8S 2OTLN 4OYWA 3AA9A 4Q43A 4MT1A 5KPRA 5IT0A 1ZTTA 1C4CA 3C7NB 4IOAQ 1TELA 1HKGA 4XDCA 1S77D 2E44A 1CZ9A 1S6PA 2GW8A 4PCQA 3RR7A 4ECUA 2C42A 3LP1A 4CZMA 3L7UA 5A6WA 2DH9A 2IY5B 4KB1A 4BRAA 2NUUG 4DDFA 2GBZA 2V2KA 1QUVA 3Q83A 5DO2A 1TTHB 2J76E 4JLHA 2ATLA 4NE9C 1BY9A 3OYMA 3VEYA 4FWKA 3P8BB 2Q36A 3SZ2A 2ZHAA 3POTA 2KI2A 4LH5A 3L2QA 5BR9A 4CH0S 5F0XA 4DB3A 5L9XA 2FPHX 1TKZB 1X5TA 3UFCX 2P9SA 4FO0A 2XRIA 1KQSR 4DV1J 1JX4A 1AA1B 4F26A 1RLDA 2QTDA 5AR0A 4ES1A 2QGFB 2ABYA 3PIPL 1Y3JA 4NZ7A 4RO0A 3LALA 4LFAK 1XNRK 2Q2RA 2Z2MA 1NDKA 3QRQA 2FLOA 5KFZA 3MPVA 4OPAA 2QO3A 3T5HA 3DLKB 3NL0A 5HQLA 5KRSA 2E5IA 2ZD1A 3BH7B 4F3MA 3FGVA 4DMZA 4YY3F 1HW9A 4P74A 1NGEA 4KRFA 4NYOA 3K58A 5J2QA 5HROA 2O8EB 3UB5A 3MMBA 2MLZA 1RBOB 1S6OA 4K43A 4NXNF 1Q0NA 4J9MA 4AQYK 3NWRA 3VTHA 1VQ8S 4YHHF 3H42A 1U1QA 2KXHA 2A40A 2MQNA 2CDQA 3ZT1A 5LL6Z 4C8KA 4EZ9A 3BN7A 3HZ6A 1YTUA 5JVGL 1B70B 3U9DA 1UZHA 1XR7A 3HD2A 1HJRA 5KG4A 4DFKA 1YVFA 5F9NA 4AL5A 4H0PA 2RHQB 3OXLA 5M1KA 5ETLA 4JD2B 3G8QA 1UEUA 1EKSA 3O4NA 1U47A 3PJ9A 1YAGA 1UJ6A 4E7JA 1X4CA 3MF5A 2BBEA 3JAMO 1OVYA 2OCEA 5AQKA 3N6MA 1GH8A 1C1CA 1I3OB 3I5BA 1LFWA 1I3AA 2Z2YB 1TK5A 4IKAA 1V4TA 2RDDA 1GMWD 3HP6A 2QZ8A 4FJ7A 2FSJA 4Y2AA 3FR0A 1JLQB 3BGLA 1U49A 5GMEA 1M90O 2ZDOA 4JV5K 1S1TB 3TO8A 1V4SA 4USMA 2LQBA 2A1SA 4E3SA 4FKYA 1JK9B 2A6AA 2OIHA 3K5LA 2E2NA 4A46A 3QT8A 2FSKA 3CJ7A 2V0NA 4KGKA 3TQ1A 2CQ4A 1LAVA 1VK0A 1OO0B 1UVIA 2AZ1A 2HBMA 2AHOB 2BM1A 5K8MA 2F9WA 4B3TK 3GU0A 5HVFA 3KUGA 2C2DA 2E6MA 3ZZ0A 4QW9A 2ZH3A 1NPRA 3KJVB 4P2XA 1C1BA 2DBBA 3I0RA 1WWHA 4J2BA 2QEXS 1Q78A 2G13A 5D6GA 4U8YA 1U1LA 2DTUA 2W2NP 4F4YA 2HOEA 4LF7F 4EP5A 4CLWA 3P4IA 2CQHA 4I67A 4WF9L 5JVHQ 3CERA 2RS8A 4DBQA 4C1NK 3HHLA 3K0SA 3C16A 3CJBA 1BMQB 2CJQA 4B3RJ 4OX9J 1DBDA 3NOGA 2ZD1B 4OFZA 5KT2A 2XMTA 1JMTA 3D6HB 2UVRA 1N36J 1J53A 1S9FA 2OMOA 2J9EA 2A41A 3CMQA 4CESA 1NEEA 3IFEA 5E3PA 1YIJS 1RCOB 2C2KB 5IQQA 2FBYA 3D1OA 4G1QB 3NS5A 2PFDA 2WW4A 4G1IA 2YNIB 4O44A 4O4GA 1PIEA 3RMBA 3KDNA 3CM5A 1QTMA 2Q3PA 3N9UC 4M3UA 5DZ7A 5IV3A 3MM6B 3QAUA 4NI2A 3OTBA 1WI8A 2AJ1A 3D66A 3DLGB 1QQCA 2BJ7A 3D2EB 4GY2B 5F8IA 2L3MA 3AAPA 3M6UA 1S0OA 2IAJA 3WEEA 5GADP 1R3NA 2Q43A 2QA4G 1VQ9S 3W2VA 2AGPA 4DPWA 2B6AA 1DRZA 4OX6A 1Z26A 2PIIA 3QFHA 1RWMB 1HR0K 4KTZA 3WQUA 5KFBA 3QEIA 4CJWA 2YHXA 5J2QB 1KCFA 3SEOA 4MK9A 1SUQA 6AT1B 3CCSS 4LY7A 5T7LA 1RA7A 2OA8A 2E7XA 3IRXA 2DKOB 4CT9A 4OV1A 2GWJA 1T9WA 3NAEA 3MUMP 4O44B 4CQ1A 4A8SA 2KYXA 3PG9A 2H4YB 1YI2S 3RZAA 4WPAA 1IR1A 1UVKA 5CHIA 2IVMA 3P1GA 1D4XA 2VWBA 3WT0A 3D6MB 2H5IB 4B1VA 3O1LA 4I2PB 1SH3A 4M5IA 2HNDA 3B82A 3CHWA 4U9RA 4H4OA 4DPOA 5C15A 4KH6A 4DLGA 5JXSA 4DEZA 1PG5B 3JB9k 1GLBG 2GFFA 2DHSA 3MZIA 2DITA 5FLXO 3SV4A 1OWXA 4K0KJ 4UUWA 5AQMA 1UFKA 2BQUA 4FDFA 4PL8A 2VG6A 5BN9A 3HFKA 2GGPB 5KG6A 4K50A 5KQ8A 4AD6A 2ACYA 3PX0A 3NAHA 3PW4A 3MN7A 3FNNA 1EWQA 2HK3A 4M5NA 2HVEA 3D1QA 4ILRA 4B1ZA 2ZHOA 2V4JA 4RLEA 4CTAA 3KK2A 2YQ1A 1Q5YA 5IM0A 2YH1A 3MM5A 2GIRA 4X66F 1WHWA 2OEJA 4DTMA 1OPIA 5DG7A 3PSFA 1WC5A 1NRKA 3BS9A 1R8BA 3WHIA 1X3MA 4LSNA 4BCAA 3ZZRA 3K5MA 3NH2A 3FCVA 5M1OA 5CZVA 3R9LA 2ZC3A 2F96A 3GE9A 4B17A 3OBYA 4BRIA 2N4CA 4CJQA 2W4PA 2CZ9A 2ZBRA 2YNIA 5GAEP 2JLGA 3M8QA 2Q1LA 3TABA 3CIZA 1HMVB 1RTJB 3QNWB 3UE2A 2PAVA 2XG8A 1V5IB 2KH9A 1SQKA 4BC7A 2AU0A 4IWVA 1VJQA 4FLYA 4JV0A 4RL1A 1XUPO 3UIQA 2C2MB 1MLAA 2LP4A 2MKKA 1MWQA 3AQOA 3TZYA 3CCEN 2HRUA 4IJAA 1UCNA 3PDNA 3IG1A 1VIXA 4JI7J 3ZNJ1 1HD1A 2CJBA 2DNYA 4KFBA 1NKBA 3TA2A 1KVIA 4TQSA 1DEJA 2KYZA 4DR5F 4K0KF 2C2RA 4B9VA 3OQ2A 3CVKA 1OY9A 2K7KA 5KAKA 2VBWA 2IAJB 2KT3A 4DTPA 1MU2A 2UUCK 3TW0A 2AJ4A 4RNMA 5FPEA 2GELA 2OP5A 1NB2A 3TX0A 4LVOP 5HAOA 4ED0A 4KHPF 5F8HA 4BRLA 3KDOA 1ZC6A 2A5XA 3RMCA 2QSWA 1AW0A 4JI6J 2UVVA 3MR2A 1B3TA 4LFBK 2DNNA 3V6JA 2P9PA 4KKOB 3JSYA 3M30A 4MIAA 2ZH8A 4EHUA 2E1MC 1MN9A 4L76A 4WF9Q 3EX7B 3EYZA 1GNKA 2VFSA 3NF7A 1QLNA 1T9VA 2VOOA 2VU5A 3OTEA 4ZDNA 1YZ7A 3ID6A 2GZOA 2ZVIA 2M0GB 2CADA 1DTQB 4LUBA 3MEEA 3F0NA 4IQMA 3BZCA 1IN0A 4ZKAA 2E1ZA 4U7UK 3I56S 1G6BA 3VEXA 1YBUA 1U1KA 4EHTA 2KB2A 4C8MA 4CLKA 1RAAB 2FSNA 4XH1A 3MOZA 3LGHA 4B8AB 3HSZA 1FX2A 3ZXWA 5E7OB 2EPIA 4LT6A 2J7UA 1UW4A 3HOTA 3ADAC 4ZN1A 2ZF5O 2W4CA 1UZDA 3AA5X 4U96A 1D8YA 3LA0A 4CZJA 3DOLA 3AB4B 4WFAQ 3I8DA 1UAXA 4FN5A 3I55S 2I1RA 3MEDB 1BXNA 3EZUA 3CCMN 3K17A 3RJMB 3OW2R 4P2MA 1CPZA 4DQSA 1A6LA 1CSJA 2ZH2A 2QL9B 3NY0A 1RDWX 1Q1KA 3Q8PB 2ASJA 4FNIA 2BE2B 5BPMA 3OTOK 4I69A 5AT1B 1CVJA 4CFCA 2O8DA 3TARA 4BC5A 1FD2A 3LDLA 1JL1A 1NB7A 1HBMA 3UWTA 2XMAA 4FM0A 3MAAA 1NGGA 3MX5A 3BF4A 2CVIA 4EI2A 1BLUA 4UZCA 4RW9B 1WSHA 3JTOA 4ED3A 2DHAA 4ZMMA 4QIWD 1NOYA 4HKQA 3J7AN 4DSFA 1NPKA 2KO1A 2LXFA 4Y1CA 2J7WA 3D9BA 4FYWB 2RPIA 3MM8B 3H2VE 4FZXC 4LRBA 4JS5A 2C2EA 4OPJA 3I55N 4YMEA 1OYDA 3CC4N 4ECYA 3AJDA 4KHRA 3OYAA 2BANB 2E1YA 1KD1T 1VK3A 1KVKA 4BQLA 2M88A 1QAJA 2ADBA 2UP1A 2KW4A 3CCES 1WJ9A 4JYAF 1IBMF 2DO0A 3QYYA 3DMJB 1MU2B 2KLAA 5F1XA 1DTTA 2DRAA 2YBVA 3T19A 3BBFA 3NCQA 2OPRB 2YKAA 5FPNA 4OYAA 4BR7A 1GMWA 2BJEA 5LT5A 1XC9A 1NMNA 3AY0A 3MM5B 4JRQA 1ASWA 4KFBB 3KKFA 3KMSA 4Z4HA 1J5EF 3I4HX 3SQGA 3NF9A 4O8UA 1JLGB 1NJZA 5H9EJ 1NK5A 4BWMA 3OLBA 1XWLA 3QO9B 5B0BA 5HJYA 3BJYA 3FMBA 3OS0A 3OFFA 3V9UA 5BJRA 4ECVA 4TXSA 1LWXA 3L6QA 1IWAA 2Q31A 2O3DA 4JI7F 3THYA 4PPDA 3T69A 3GPAA 4RJVA 3GIRA 1TAUA 4C3LA 4WWSA 4TVAB 1N36F 2JVRA 5HBMB 4B1YB 4M1KA 2HHXA 2CQGA 3OBWA 4USJC 9RUBA 3IUCA 5J1EB 1YGYA 1SQEA 3QIDA 2GQQA 2F9JA 1OH5A 2NQPA 1CJKB 4MJKA 4IXCA 2IM1A 2R2SA 4JD2A 4N5SA 4DU1A 2IVPA 3V6HA 5AQNA 1BIUA 2CVEA 3X1LB 1KTVA 4RW4B 2FJVA 1U04A 2QA2A 1FXDA 3LZJA 3T6BA 2W24A 2FHJD 3VGUA 3D6FB 4Y28C 3KXDA 4OZ1A 8RUCA 3SCJE 4A62A 4BE0A 3HHDA 4FPRA 1IM4A 3E66A 3DDNA 5DZ6A 3UR0A 1O51A 5CYQA 4NASA 2KFNA 4W5TA 1UMJA 3QETA 1MG7A 3OFHA 3BBBA 1NJXA 3HPOA 3CPWR 2XULA 2J9DE 3PTWA 1CZBA 2HW3A 1RYRA 2KG0A 2HMIA 1Y64A 4KGMA 1VC5A 1N48A 3Q8QB 3NH1A 4F04B 4YDDB 3H3OB 2KG1A 2HQDA 4FLVA 4PY5A 3DRYA 4H54A 3G71S 4NZ0A 1R8CA 4OGCA 2DNHA 5KI6A 3MCSA 1WDDA 3AV9A 3W5XA 4FF3A 3ULHA 2VQFK 4FLUA 3GZ7A 4P72A 1YHQN 5CQGA 1RK8A 1GTEA 1KHWA 3BKTA 4L8RB 3M8QB 1DY3A 3MD1A 4DL7A 1K73T 1HA1A 1KC8T 4CEBA 3NGSA 5KFYA 3LM9A 4R0JA 4DG1A 3U7JA 1RAOA 2DCUB 4DSKA 4A8KA 1HBMB 3TUPA 4CLZA 2H5EA 4BR5A 2M52A 2FJBB 2ZWOA 1JL2A 2W9AA 4CERA 3A3PB 1BQNA 3EKUA 3L4IA 1NDCA 4NLPA 1R0BG 1RZMA 1F2HA 2KN4A 4CLTA 3MMAB 2RRBA 2EBGA 2UU9J 1HNIA 3AVNA 1TUUA 4LBPA 3SAHA 4FJ8A 2Z1GA 4BACA 5EY4A 5K14B 4Y1DA 4DV2K 4DQIA 3TJ8A 1WSFA 2YI1A 3THWA 3AO2A 3DLRA 2EFNA 4GC6A 2ITMA 3J81U 1SVDA 4DTNA 3P39A 3SUOA 1B92A 2OTJN 4NXMF 4NLTA 2C3UA 4FOEA 3SSSA 1JLQA 4A8FA 4K4ZA 2GQ2A 3H5UA 3MECB 2CQ1A 2DY1A 5M2RA 2VHGA 3OHRA 3MPUB 5AQPA 2GX9A 3Q86A 2XMVA 2X1GA 2VF3A 3FZHA 3I0SA 3ISND 4BR0A 1N33J 4DZ6A 1TK0A 2HHQA 4KHNA 3J81j 2E1RA 3ZTQA 4IG0B 2JEIA 3HHNB 4YB7A 2ZHBA 5HMZA 3L9ZA 3BSAA 1UTAA 4DV3F 3KHYA 4F0MA 3KWGA 3A1YG 4BRKA 3A5MC 1N0UA 1VBYA 3TX8A 2NYHA 4ZJLA 2UXCF 2BJ8A 5DJBA 4CTAB 1REGX 4DR3F 4JI4F 1WAFA 3TUIC 3OYIA 4FVUA 4IG3A 4FWQA 3VALA 1VQMN 1VSMA 3P83D 2CQCA 2VKZG 3G2XA 1YJNN 2VBZA 1ATRA 1MW7A 2FIUA 1TL7A 1PAEX 5E3RA 2AZ3A 4AHUA 3N5FA 4RNOA 3CULA 4YY3J 5LXYA 1U6BA 1IQTA 4DF4A 4FPIA 4KH0B 2AF6A 5HANA 2F8TA 4USVA 4P7TA 4LF5J 4MK8A 3JAMU 4IRCA 2R8HA 2BJ1A 1JNZB 1F3FA 5A8WB 3Q2SC 2N7YA 3LTOA 4DUYF 4Z0UA 1IBMJ 1EQMA 5AQVA 4N7TA 2CZVC 3GP9A 4YHHJ 5AZIA 1X4EA 1KOOA 1LK5A 3MAHA 4CJSA 4YUDA 3CG7A 1WUAA 4CF1A 4YN3B 3G4SS 2YKQA 2YWGA 2BJDA 4LF5F 3CJAA 2CPJA 4HI2A 3IR7B 2L9NA 2HNZB 1OH8A 4XPEA 1FFSB 2D5RA 4K4SA 2YQ3A 3GFZA 4JI2J 2VJUA 4WYWA 4B1XB 1QE1B 1K9MO 3GCXP 2W7PA 4B9LA 1P9QC 5RUBA 3LO3A 4IH6A 2W9CA 2IS3A 3LOUA 4U6PA 1Q81O 2NRVA 2FC0A 5LJVA 2LQ5A 4E2FB 2I8EA 4HH0A 4BREA 3H3NO 1VHIA 3V9WA 3A12A 4A48A 1ZM9A 2BUPA 1T03B 5F8GA 1K73O 3KLHB 4FF4A 1JB0C 3T1YK 3PYFA 4A2BA 3CCMS 1HMVA 1UL3A 3K59A 3IM9A 2PYLA 5L1LA 2H1YA 3SQ0A 5HRPA 5ADZA 4DR2F 4IEIA 3U1NA 1QSYA 2FDNA 2YX7A 4KHQA 5E5NA 3C6UB 3E01A 3V6DB 2E6LA 4FLXA 4JI6K 5KTQA 4GVEA 5IXUA 2W6LA 1PYOB 4NYFA 5C2FA 2G4BA 3AQPA 1N88A 3U1MA 3G0ZA 4G6VB 1VSLA 2IVYA 3I5AA 4RX6A 3BGRA 1Y5LB 3M32A 5DQGA 1WBBA 3W61A 1RAGB 4QWEA 3OD2A 2KKZA 2KQ2A 1WC1A 4B1UB 2B9YA 1GLJO 5I3UA 4FJ9A 4J9PA 2D0PA 3CTRA 2CJ9A 3KVGA 3VQ6A 5IT9U 3HM9A 2WZ1A 4JI0K 4WYLA 4C8NA 4I6WA 1E4FT 2IVOA 2PI4A 1SJ3P 4MIBA 2X6NA 4NXNJ 1J27A 1T05B 3BPSP 4YOTA 1W0HA 1WNEA 2DNMA 1N56A 2JVOA 4M3WA 4EU0A 2A1BA 3MMAA 1RT4A 2UXDJ 1J5EJ 3THTA 5F8JA 5KQDA 3RB4A 2GWKA 4L73A 4GW6A 2D3ZA 4PXBA 2NREA 5C2CA 2ZJQQ 3H5YA 1KC8O 4KAIA 4WFZA 4OYXA 1D9FA 2EG2A 4R8UB 5EU7A 1HNZJ 2ZBIA 4HVZA 3L2VA 5B0DA 3MM7A 4C2MA 1FRLA 2UUBF 3QNOA 4P75A 4BVOA 4P2SA 1KAYA 4CJEA 2HAIA 4MYUA 2UUAK 1X60A 4C7QA 2C22A 5M1FA 3Q8UA 1G99A 5FDLA 2BANA 3MWTA 3WQPA 3FSIA 4RWWA 1HNXK 3KK7A 1NGIA 1TL3B 3SQ2A 3DRRB 4USWA 4HTIA 5F8LA 3BYRA 5D3GB 1EHWA 2OJ3A 1C0UA 2IM3A 1RT5B 4NYPA 3HYFA 4NZ6A 3MXIA 2X7IA 3H1QA 3ILOA 2DHHA 5L8RC 2FJDB 2NR0A 1EAYC 5DETA 4ZIWA 3OL7A 3T41A 3A2FA 2HHPA 1VQKS 4M3ZA 4JK8A 1VQ5N 1DARA 2XMWA 1ITPA 1M5VC 2Z58B 2A3JA 4XH4A 1EB0A 2XNQA 4ZVSB 1BI4A 2U1AA 1WSRA 5EUHA 1M5OC 1HJOA 1HWJA 2QMWA 4K8ZA 3VQTA 1RBUA 1NOZA 2XM3A 4Z4EA 1WF2A 5EX3A 2CQ2A 2GNKA 1X0FA 2YKMB 3KLIB 4K8RA 1F9EB 4BY9C 3B78A 2G1DA 2LEBA 4O3SA 1FJGK 1U7LA 3PNIA 5A8RA 4J9KA 1NZAA 4NCGB 1S1VB 3TUJC 1UOCA 4DZDA 3HPHA 2AJQA 1V6HA 1O8BA 1DGKN 2EWHA 4CLPA 3M32B 4Q0BB 1H74A 1KDNA 1XHZA 4H5WA 4K0KK 3QPIA 1C0FA 3CCRS 2YHYA 4M5DB 2GV1A 2HFUA 3D7EO 1YJTA 3CJ8A 1YT3A 5KRTA 2QWNA 5LMUJ 2RU9A 3NVKA 4XDDA 2XS7A 1IJJA 3PX6A 1SV5A 2YHWA 2NUHA 4FS1A 3VERA 2CPHA 3ENWA 1U4BA 2UXCK 4F3OA 3KNAA 2VASA 1RBLA 5GAEI 4Y2CA 4AXIA 3FZBA 1FKOB 3H59A 4ED5A 4N8NA 2R7WA 1J54A 5M2UA 4O5FA 2VFRA 2BH1A 3DOKA 1RTDA 4KQZA 1ITGA 3R8EA 1X31C 3PR4A 5CD4H 1NGDA 3CQXA 4KHPJ 2Z4PA 3ZO7A 4CZGA 1JLGA 3MDQA 4GV6A 4PUOB 3ZZZA 5HSPA 3QIOA 1RU2A 3MXMA 3M1VA 2AJFE 1KQSM 3WIVA 1B0TA 1HKBA 2E7VA 4L3QA 1H2UX 1WELA 4LF9J 1UVNA 3CDUA 2GVZB 4BG9A 1UA1A 2E5LK 1WSEA 3L4BC 1RBSA 4JI2F 4CT8A 1VQ9N 1XTZA 2EK1A 1JLFB 2P9LA 1ZM2A 3CJRA 1CULB 2R42A 2RRAA 3S01A 4ATNA 1JIHA 1N4LA 5A76A 5J2NA 4K5SA 4HHUA 4I56A 1N0VC 3DRSB 1QM9A 1YBTA 3O8MA 2Q6BA 1RCHA 5AQWA 3P3DA 3QGGA 2Q0RA 2EW9A 2EFQA 4DX8H 2C3OA 3T1AA 3VQ8A 4OKEA 4GRSA 4LBHA 3L7PA 1BUPA 4B3TJ 1DLOA 1TKXB 4OX9F 2Y3YA 3WZ0A 4PAAA 4NLBA 2K1RB 3C6TB 2VB6A 4B3MF 2XSJA 1REVB 1GEHA 1UA0A 4YR0A 3P49B 4WU3A 2PY5A 1FFGB 1GLAG 3ZX0A 1SQGA 2MHEA 3VGSA 4KGXB 3NGIA 2R7QA 4UW2A 3RB3A 3VQ7A 3CDEA 3AD9C 3UN3A 4BC9A 4K25A 1ICEB 2XMKA 1B64A 3M8RA 4IO9Q 2ZWHA 4HLBA 4KV8A 4RWTA 1QVFR 5EWGA 4ILMA 4KY3A 1I39A 1SB6A 2IJRA 4TY9A 5KFQA 4H0YB 5HL7L 4DFJA 3O9SA 1RT6B 1RWWB 3BREA 3F44A 1TUVA 4B9SA 4Z7YA 3LH2S 4FYVB 1LQ9A 1NG9A 3JSBA 4LR9A 3LP0B 4LBIA 2RUGA 1CJKA 3ILLA 2D1KA 2UU9K 3PEHA 2CUYA 2XO6A 1HIYA 2P6TA 3W5YA 4J90A 4LFBJ 4KH1B 2R2TA 4AUKA 2YX4A 2J0WA 2JC1A 3UW1A 3LZIA 1CJUB 4IRKA 2XSFA 2J6UA 3IBFB 3HP9A 1DJ0A 4G65A 3PCOB 2WVEA 3GYGA 2V8VA 3ZSYA 4LF2A 3WC2A 2H9ZA 4IJNA 1RT2B 1B7YB 5B08A 1GX5A 1VHXA 1H38A 1JLBB 4DR1J 1NGJA 3O80A 1LOUA 1BQXA 3ZZUA 4CK1A 2MZ1A 2XYHB 1G4CA 3W7BA 3DOLB 4ZCLA 1CBKA 2AGQA 1S6PB 3VGMA 4DPUA 1AUDA 3PFEA 4I9LA 2WONA 2YPYA 4DX7A 1LWCB 2GO8A 4JI5K 5C2DA 5K20B 4FJIA 5BRFA 4PR6A 3MCNA 2LCWA 4ILJA 1FJEB 1XNRJ 2BYCA 2HVDA 3SIPB 3MM9A 1QE1A 1RQ0A 1S99A 2I6WA 2AEMA 4ECTA 4WTYA 5FLXY 3PRDA 2X78A 3DLEA 2FHKA 4ZN3A 5HI7A 3ENBA 4Q7AA 3UKRA 5DLFA 3GFYA 1OY8A 1H2VZ 3LAMA 5LL6d 1M1KO 1IBKK 4MLHA 3V4IA 5C25B 3ZTSA 4XPCA 5ETRA 3VQDA 3W8PA 5LMUK 2LMIA 3SMPA 4MIWA 1FJ7A 1LWFA 2VC0A 3CEDA 2HYIB 2Z1IA 4LH4A 3J7YP 3HSGA 5C42A 4CD1A 3PM9A 3U3GA 3M6XA 1CJTA 3X3UA 5KFEA 4HCCA 4JUZA 3LWLA 2OI2A 5F8NA 1IG8A 2MJUA 3BY5A 1HBNA 5KFLA 1ZAVA 4KV8B 3SUNA 1FE0A 2HHUA 3POTB 4KHPK 4AL6A 1LKZA 4J2EA 2VQEJ 3M1FA 2BUNA 3ZSQA 3IAS9 1OH6A 1BHLA 3TI0A 3HO1A 1GFWB 4C0OC 4KE5A 3L3VA 5LY3A 2DO4A 1BD6A 4OGEA 2VGNA 3V9XA 4A61A 4Q44A 4C3MA 3HTVA 2L48A 1R31A 3MTJA 3C19A 5JMNA 4F4AA 4JKGB 2EVZA 1IKWA 4QIFA 2GHWA 3EY1A 2K2PA 1M90T 4ELTA 2WBNA 3ZT2A 1LW0B 2E1CA 4JS4A 4IDKA 4CI6A 3T5KA 5BRHA 4B3OA 3A8IA 5HMXA 1JNRB 4KH4A 2FVRA 5F3ZA 4KBIA 2LEAA 4U67L 5DMRA 2JHEA 2YHAA 1EKEA 4ANEA 2JLEA 2OMLA 1H2TZ 1R89A 2RH3A 2QM1A 3BSNA 2YQ0A 1ZPVA 1H72C 2BA9A 2XWYA 5CABA 3OVBA 2Q0UA 2ZKUA 4ID8A 2GTDA 2V50A 2FYXA 3G86A 2GAHC 5U47A 2CPEA 2WBRA 1Q8KA 5M1NA 2K06A 3I0RB 2MGZA 5DRKA 2A1RA 2VG7B 4M5JA 2XZDB 3SPZA 3O4QA 4Z4FA 3BYPA 3IO1A 2E5LJ 3FFKB 2R8IA 3SQOP 2H3EB 1FRJA 3V4MA 5B8HA 2NXNA 3MHYA 1YIJN 4LQ9A 2UU9F 4CJ7A 2OAUA 4KTQA 2M8HA 1CEZA 4HTJA 4J9RA 3EPIA 5G0RA 2C3YA 1FKPB 4R25A 4CH7A 4BC2A 3KK3A 3UDEA 3IP0A 1YITN 1OVQA 2QK9A 4C8OA 1NHKL 3RWUA 3M2RA 4DV3K 2VPWB 2ASPA 1M1GA 4CJFA 2IM0A 4CIOA 4NLDA 2F40A 3CJKA 4CIEA 2MPUA 1T9TA 2ROEA 3B6OA 2P5GA 3EGNA 1SJRA 4DG1B 4UTGA 5M1QA 3B8HA 1U1MA 3T1YF 3VQSA 1C6VA 4LF8J 3DGPA 3N0VA 1S57A 3EE3A 5ETKA 2EFGA 1WBDA 3K89A 2HVIA 2VPZB 5KG7A 2NRHA 4QS8A 1JLEB 4M5KA 4FK4A 4JV2A 5KPTA 2QXLA 2ASYA 3ZT0A 4FWLA 2KJWA 2QN6B 4DCHA 5BN8A 2ILYA 4Z2XA 1T7PA 2UZAA 3H08A 3TJ9A 4OZ0A 1U2CA 4RW6B 1X4DA 3CMEN 2V8DA 2UYTA 2G8IA 1BQMA 1BWVA 1QTNB 4J2AA 3WC0A 2CPIA 4PHTX 1TMMA 4IOXA 2IM2A 2MKIA 3O1BA 4F02A 3TUZC 3BZKA 1REVA 1L3KA 3CO9A 2KTQA 1GLDG 3VGKA 3IG1B 1RAIB 1EP4B 3D67A 2WTFA 1CJVB 1GTHA 5KG1A 4BR9A 3J7YI 1UFLA 2E8AA 2QWOA 1APSA 4WQ5A 4A8MP 1S4FA 2XLJA 1F6TA 1FFWB 2AD9A 1R43A 5THWA 4QS7A 4DR4K 3V81B 4K42A 2HAFA 3PY8A 5HP1B 1XMOJ 1WHVA 3V2UC 3F2KA 1KQKA 5A8KB 2XY7A 3NAIA 2HS3A 4BRGA 1YG0A 4O3RA 4H0VB 1RDDA 4HT5A 4FVCA 5C25A 3VQ4A 1FRIA 1VQ8N 4DV5K 4CZCA 3M4XA 3KJQB 2VQEF 3CJ5A 3H2LA 2PBDA 2VBYA 2RQKA 4LSLA 3T5JA 2V34A 3SI8A 3C6UA 2CJXB 3DLEB 4FXWA 4JI2K 1H73A 4ITSA 2AQ4A 5DQIA 1KRPA 2JDJA 1LEOA 4CIGA 3MGJA 5C5JA 4IDKB 1S1VA 4ZP7A 3M8WA 3PEJA 4I1TA 4AFFA 5HMWA 2QLJB 3HVAA 2JH3A 2DR8A 3QB0A 1M1KT 2F1FA 2IJNA 3GFXA 2QWPA 4PKDB 4YY3K 1NKEA 1JJ4A 3EZWA 1WHYA 2CPFA 1FWPA 2PT0A 2BQ3A 2VJVA 4I7FA 2DRBA 4RU9A 1RI7A 2CQIA 4NLRA 2F9DA 3IM8A 1W97L 4X66K 1RXOB 3I31A 2V7ZA 2HURA 1OQ3A 5KFHA 3N4WA 1ZETA 3IR6B 2V2VA 1DAXA 2Y1LB 4CZEA 1QQOA 3GCWP 4CHYA 3SMZA 3ZEUA 2J0SD 4DI6A 2QX0A 1GLEG 2NNWA 2AEJA 4H4OB 1JXVA 5HROB 4E0DA 2O8CA 3DXBA 3R5BA 4ID5B 3HOSA 3CCSN 4FWOA 2ZJRL 3VOVA 3AVHA 1WDTA 1RBTA 5GINA 1TL4A 4WFAL 1IG9A 3CCTA 4HT7A 3RBDA 5BR8K 3FDSA 4E8UA 3MMJA 3VF0B 4X4OA 4AHRA 4JRPA 4LF5K 1RWNB 2V2ZA 4NX9A 3FZMA 1X4GA 3C14A 3AOAA 2LYVA 1EX4A 4ISEA 3OYBA 2W2QP 4FJXA 4BGAA 2YNHA 1VHFA 4F25A 1U09A 1D09B 1AROP 3HHLD 1A5XA 2FBVA 4X65K 3AFGA 3BKUA 2BGGA 2V5HG 3EGVA 1IBLF 3QJLA 1NU0A 1WTBA 5AE2A 5CYQB 2PDAA 1TR0A 1EO1A 3T1YJ 3FRZA 4Q2LA 4RNNA 4JKAA 4QIVA 4F9OA 1SJ1A 4YEAA 1W25A 1VQPS 3LUYA 2OO4A 5AXKA 4X66J 2KT2A 3AT1B 4NI2B 4OX7A 1CLQA 1DLOB 4YNQA 3UPFA 2DJWA 3KIOA 2HRYA 3KZBA 4KRWA 5I4MA 1RWOB 1RTDB 2A3ZA 3C14B 2RILA 2XCAA 2IOCA 3C7NA 5G4DA 3TAMA 4X65J 4LQ3A 1WUUA 1RHKB 2KZMA 3THPA 1S9EB 1OSDA 3SQ4A 4CZIA 1OH7A 2AEFA 1B0PA 1GXTA 2JFKA 1YJ7A 2GUIA 2F8HA 2QLWA 2BOPA 3GDQA 3S1TA 2H3GX 2O67A 2LECA 2HNYB 2E1PA 3GFHA 1T3VA 5T14A 3OW2M 2ZC4A 4BRQA 2O8FB 1Q7YT 4FJLA 5KFPA 5SWMA 1BOTO 3SCKE 2YJEA 2F8SA 2V9WA 2Z2ZA 4MDAA 4DR4F 3GE1A 2DCLA 1N5YA 1TK8A 5HQMA 3DN9A 1BL3A 5FRNA 4A4JA 2XS2A 3LPEA 4LFCF 3EKSA 3IR5B 1RDAA 4EWTA 4I6MA 4PWDB 1RTIB 4ZOSA 3UDLA 3JYTA 3G82B 5T41A 4ILGB 2B8PA 4QW8A 1TFYA 4DU4A 1XNQK 1EETB 2PZSA 2PA3A 4WQ5C 2KDOA 4GVBB 5IC4B 4L74A 3DU5A 2QE5A 1VSKA 4H03B 4NWBA 1MWZA 2F4VK 3RBEA 3WXLA 4MFBB 1K1QA 3MEGB 4FXVA 1SL2A 3AOBA 2P9NB 3JAMY 4R5PA 3HULA 1FKAF 1RDCA 4C48A 2N3LA 4DR2J 4J9LA 2HHTA 3DLGA 3D2EA 4DMNA 4UOCA 1FEHA 3AVAA 5HRSA 4Y2MA 4CBUA 5FD1A 4C8ZA 3NXZA 2CAJA 2FLPA 4B9UA 4V19X 3H5XA 2VICA 3TZWA 3CDBA 4JKFA 4WE1B 4LFAJ 1OQ6A 4FWMA 2IVNA 4ZLPA 1VC0A 1LW0A 3ULEB 4UUXA 2LA6A 4BGBA 3AVJA 1VBKA 2DHGA 4WQ4C 1VBXA 3KWIA 1CJVA 3T1HK 3JQJA 2EWSA 4DUYJ 1ZTWA 1KLMA 2A18A 2DGSA 4MKBA 2G8HA 5LSRA 2YNGA 1RABB 1FERA 2M7SA 3SUQA 3M3ZA 1WC0A 3CJ4A 3OA9A 2YWWA 3B6PA 2QWMA 1IBLK 3S7RA 4K4VA 2A2CA 3DMJA 3CCJN 1KKHA 2F63A 4WFNL 4XTTA 4LF1A 2CG8A 3QFUA 2W8KA 3AA8A 3ATUA 2Y1JA 4W5RA 4H5RA 2LEPA 4OV6A 3C2PA 4N8OA 2UUBJ 4PQUB 4ZPWR 3GOIA 1VIOA 4CHNA 3ZTPA 2VA3A 3MM8A 2XI3A 4U7BA 1AFJA 4TN2A 3OS1A 2LA4A 1MROB 1GLFO 1ATNA 4DV6K 3O44A 1RT7B 4ED7A 2JL9A 4OLPA 3AO5A 2MB0B 4KTWA 3FFIB 2HBRB 3DM2B 3DLHA 3LANA 2V4QA 2YKNB 3OYFA 1RKIA 3D2FB 3FFIA 2V2QA 3O3HA 4C8LA 1YZ6A 4Y3CA 4X4UA 4XAKA 2GVDA 2NRWA 5IT9O 4LF6J 1NGAA 5GAGP 4J9QA 3AD7C 1SQFA 2YCHA 5ETVA 1IR2A 4DS4A 3ZETA 2CWXA 3CCQS 5HP1A 3L09A 3KK2B 1WN7A 3NP5A 3W9HA 5F0WA 4WP9A 3G8SA 2D3O1 3W62A 3CD6N 2QV6A 2V94A 2A6OA 1H1VA 1XJWB 3CO0P 3IS9A 2V51B 2YKMA 2CZ4A 4FJHA 2N3OA 3MK6A 4TYAA 5BR8J 2PA8D 1HI0P 1KFSA 4FJNA 2GGPA 3GB0A 1VQNN 5GVQA 3SCLE 4LIRA 3L0QA 3T3FA 3IKMA 3Q24A 3VQEA 1IKVA 5GAHP 2PSZA 1BGXT 3E51A 3PR5B 4P6QA 3LAKA 2IC3B 4JEPA 3TRGA 2FLNA 2ATQA 1IKXA 4DKWA 3CFPA 3CI5A 4NLUA 5J1EA 2I7NA 4NB4A 2HHVA 4R0EA 1B99A 3W2WB 4X4VA 4CO1A 3KHGA 1RT7A 3QMQA 2OKQA 1TQLA 4MO5A 2ATCB 3M8PB 3J81Y 2O1PA 2F9TA 1X3NA 1QVGR 3HKWA 3EXYA 1AT1B 3GTYX 4NEZA 3RMAA 3K57A 3R5DA 4D3HA 4ZP8A 1H6KX 4OZJA 4JI8K 1VC6A 1HBUA 3DHWC 2JC0A 3CJ1A 3I96A 3DOMB 3ET6B 4F8RA 4BBYA 1KVCA 3CUNA 4AQYF 4DU7A 1IR0A 2NRTA 2I2YA 2HB5A 4X65F 1EARA 4DV5F 3OUYA 4EYHB 3Q23A 1J5EK 4DTSA 5LOQA 1XN9A 3U6FA 1I94F 1VRTA 1FESA 2LDYA 4E1MA 1O6XA 2W9CB 2R2UA 1N32K 4K8XA 1S7HA 1D9DA 1Q82O 2B4PA 4UOGA 2OSRA 3KK3B 3K9JA 3PYDA 1N6QB 2V8HA 2D0AA 3LP2A 5LM7E 4MKAA 2DR5A 4I2QB 3I4PA 5K5MA 3RG6A 4CP5A 3ZSOA 3CFRA 2N82B 4QWCA 4FJMA 2W4DA 2DHXA 3EDQB 3QNNA 4LRDA 2GHVC 4DFPA 1FTCA 2B4UA 2JGUA 3BDPA 4OQJA 1B0VA 1HNVA 3GLJA 4YOEA 1ROFA 4CJ4A 2CIMA 5FIIA 4ZVGA 1BCOA 4FJ5A 2QWQA 2UXDF 1SC1B 3TTDA 5LSOA 1X5PA 3ENOA 3HSCA 1HHSA 2MQPA 1RDUA 2JX2A 2EBEA 2IJFA 3O3FA 4ZP6A 2BVZA 2NPFA 5L46A 1S6QB 3AVGA 5HLFA 5KFCA 4ED6A 5F0UA 4LJMA 3M1VB 4UQGA 1GOBA 1HUXA 1T3OA 3IFRA 4CBWA 1WD6A 3V6KA 2JSXA 4B3TF 2F65A 2KXFA 1ZBLA 3R5GA 4ZA1A 3BSOA 3NF6A 4S0MA 2UUCJ 4Q8EA 3CCWA 4FKXA 2VG5A 2N7CA 4EK2A 4ZVEA 3BDEA 5B7WA 3IAM9 3W3SA 1QHAA 2GJ2A 4OHXA 5KOXA 1IKWB 1HFEL 2A42A 4OKJA 3EVOA 3O1WA 4B9TA 4ZLNA 1M5PC 5H1SV 4B9QA 4JI6F 3QGPA 1QZ5A 1S97A 5CXTA 1TUYA 3NNHA 1FK9A 2X3GA 2R7UA 3UNGC 2Z1HA 3VGTA 1TL1B 3B8AX 4BWJA 3H90A 3JSRA 2HFSA 1MSWD 4YP3A 1NK8A 2DR7A 3AO1A 3CC2N 3M7VA 1VRUA 2KT5A 5E41A 3SV3A 2R4FA 1UKUA 4TU8A 2HWIA 2XNRA 1ZXOA 2RHSB 3M6WA 1NK7A 1U26A 3TP2A 2CJKA 4PG5A 4PXEA 2GEMA 3RAXA 3RYLA 1S0MA 1PGZA 2D74B 1Q5VA 2DGOA 4A5AA 1WEYA 4CJ5A 5A2QY 5BPNA 1WTFA 4MMOA 4H0XB 3THWB 5EGYA 3CIMA 3ZYYX 4CHOA 3BH6B 1XERA 3CJ9A 1VR6A 4TLQA 3KJNB 4CJRA 1FNXH 5BPLA 1BWEA 3ULDA 1SUQB 1U02A 1RGVA 1U8WA 2CRLA 5F9LA 3VR1A 4B08A 3MMVA 1QD1A 1MN7A 3P45B 4ZVQB 5MLCV 2ZJPL 3BEXA 3LDQA 1ZS6A 5AQFA 2VFVA 2Z1JA 1C0TA 2K1RA 1ZZFA 2ZUAA 4ZVOB 1DFDA 4O4RA 2JZ5A 4LFCK 1RCXB 3RRKA 5AXNA 3DLKA 3TZZA 3VF6A 3P5JA 4CGFA 5LSLA 3UCUP 3G6VA 4NCAA 4ECQA 2HIQA 1YJ9S 1E6YA 1KEKA 1JLBA 5I3UB 4WFBQ 3M2UB 1RT1B 4XIUA 5HLFB 2QT7A 2DTJA 3PXGa 1HHTP 5J2MA 1RHRB 4EP4A 3MR3A 1NK0A 1JLFA 1HNWK 1T3NA 3SJHA 2OEKA 4LSLB 4O8KA 2QA1A 4WFYA 4ZHRA 4PEOA 2WK4A 3GYXB 2M3DA 3BUZB 3GL1A 3LDSA 1KFDA 1R59O 3LDOA 5AQIA 2QLBB 4PKHA 4LD0A 4B3OB 4BR4A 3KHHA 2OFHX 4GV3A 1X1PA 2V4JB 2GMJA 2DNPA 3ISZA 4D3GA 3HD1A 2NPIA 4USHA 2FZCB 3W3DA 2Q66A 4NLCA 3UR3C 4DTJA 4FXDA 2HBKA 4DR1K 2CWKA 1K8AT 3ILIA 1HW8A 5CYJA 1URNA 4OHVA 2FZKB 2P2CB 3R5JB 4I6AA 3WIUA 4HDHA 4LIWA 5AFUH 4OYIA 2HGLA 4AQYJ 4PABA 2OPSA 4OZ3A 4JI5J 4ED4A 3A8JA 1GAOA 4CO5A 1IKYA 1JKHA 4FVMA 4USKA 4B3MJ 4Z4GA 3DKDA 1T6DA 4EMDA 2CQ3A 3VPZA 2CGJA 2YV0X 2HF4A 3I82A 4O0NA 4CI0B 4QU6A 2ZM6K 1RAJA 4DL0C 3G6ES 5EDWA 2IMWP 4FK2A 2ZZTA 2O8BB 2QC3A 4Q0BA 3MECA 1NJIO 3HVWA 1UWAA 3FC9A 4ZVFA 4HACB 2E2QA 3LP0A 1S0VA 3HVTB 1LXJA 1BIZA 3GIMA 5ETTA 5D8HB 2FF6A 2J9DA 3SMSA 4F36A 1VSFA 3D54A 3P5BP 5JUMA 4CZHA 4BRDA 3IAYA 1KWMA 4BHQA 2DFEA 5K14A 3M8ZA 2ZBQA 2D3UA