3BGRA

Crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with tmc278 (rilpivirine), a non-nucleoside rt inhibitor
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of HIV-1 reverse transcriptase/TMC278 complexes: Strategic flexibility explains potency against resistance mutations.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase, hydrolase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 158
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3bgrA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bgrA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bgrA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bgrA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3bgrA05
3LP0B 3VQCA 4K4TA 4O3QA 4F2SA 3RMAA 4NCGA 4CE9A 3AO5A 4IRDA 4ED1A 4CJKA 1S1XA 4BDYA 3DYAA 4ICLB 3T3FA 4ID5A 3KLGB 1S1WA 5T7BA 2D0BA 3M9OB 3CWJA 4Y3CA 3L3VA 3MEDA 4ED0A 3H98A 2BQ3A 3F73A 1NK6A 1TL3A 5KFVA 1FKPB 4CK3A 4MQ3A 4CJ5A 1RT2A 5KG6A 3AVKA 3S9HA 3MF5A 4ED7A 4OGEA 4HUEA 3DDKA 4LQ3A 1NKBA 4KPYA 3CIZA 3BGRA 4ECWA 4AHTA 3OHBA 1S0NA 5CYMB 3ZSXA 3KHHA 3GIIA 3VQQA 1WAJA 4IR9A 3RTVA 3QESA 1IKXA 3EZUA 1HYZA 1SH3A 2CKWA 4Z4IA 4CHOA 4J9SA 3AVMA 4KRFA 2KZMA 1LWCA 3OYLA 5J2QB 1FKOB 3KOAA 4CEOA 3T5JA 3HVRA 1VSFA 3OYCA 3EY1A 4LSLA 2OA8A 2YNIA 2W8KA 4KTWA 1ZBFA 4KREA 4CK1A 3UR0A 5KFGA 2R2RA 3HM9A 2Y1JA 3QEIA 4JV1A 1BQMA 3KLIA 4IG3B 3KLFA 4E3SA 1QAJA 1N4LA 1OS5A 1RA7A 1LW0A 4I2QA 2FJXA 3OL9A 4XPCA 3BQ1A 3MR2A 2BQRA 3GIMA 1WNSA 3MEEB 2ASJA 5L1KA 3NMAA 4WE1A 3V6HA 1RT4B 2PYLA 1EETB 4NLYA 3PW7A 2EC0A 2V4QA 2FC0A 1KVBA 4M94A 1EXQA 1GX6A 3KIOA 4GW6A 4E7JA 1D9FA 1RDRA 3ZT4A 5F9LA 5HLFB 1C6VA 3SUNA 4KHYA 4ELTA 5HLFA 3FQLA 2FLLA 3ZSOA 4ECXA 2A1SA 4EBDA 3V9XA 1WLJA 3N6NA 1RBTA 2BANA 3M8QB 2UVRA 1XWLA 3VQ5A 4QWBA 4B08A 2AGQA 3KK3B 2HMIB 2YNGA 4FYDA 3SPYA 5KFCA 3RRGA 2HB5A 3CFPA 4KO0A 3MEEA 1BL3A 3IAYA 4NLPA 1JXLA 2D41A 4Q8EA 4LY7A 4KHRA 5KFBA 4DQRA 1HNVB 4FLUA 1EETA 3T1AA 4OVLA 3LZJA 4HUGA 2F96A 4WE1B 3K5MA 3TARA 3ZCMA 5J2NA 4CEBA 4BE0A 3V1QA 3BSNA 5KFTA 1YTAA 2WHOA 3I5CA 4TQRA 3RBEA 2XY6A 2FJVA 3TI0A 5C24B 3ULDA 4O4GB 3QYYA 3SI8A 3KLIB 1QE1B 3K5LA 5DLGA 1WAFA 5I3UB 3NF7A 4OKKA 4RG8A 4J2BA 3VA3A 2JLEA 5HROA 3MTKA 2UUTA 2RF2B 4RW6A 1RBVA 4QOZB 4BDZA 4NLUA 5J2PB 1KLNA 4OL8A 3OYBA 5J2QA 4WZMA 2Z1JA 2EHGA 3TR8A 4FJHA 4DFMA 3IRXB 2Y1IA 3AVGA 1LWEB 1S49A 5HRSA 4LSNA 1S9EA 2RKIA 3OYEA 3PVXA 1ZTTA 5KRSA 3QO9B 4GVMA 1BHLA 5EWEA 3IS9A 4QW9A 4FJXA 3ZSYA 3JYTA 3BJYA 3BGRB 3L2WA 1CZBA 4O0JA 1UWBA 5FROA 1L3TA 1NOZA 1TQLA 4DS5A 2OPPA 1TL3B 3ISND 1TK5A 3VQ6A 3HHKA 4CERA 4FK2A 3B6PA 3DOKB 5KFEA 4F50A 1NK7A 3C6UA 4FLZA 1S0OA 3V1OA 1KHWA 2DFEA 3NF9A 3GQCA 1RTJB 1S1XB 5J2MA 5KGXA 3PY8A 4KI6A 4DEZA 5L1JA 5L9XA 3WNFA 1Q9XA 4O55A 1TL1A 3LP2B 4EEYA 2WK4A 3M8PA 4J2EA 4N41A 2BE2A 4FLTA 4K8ZA 2ALZA 2Z1GA 1JXBA 3K2PA 1DLOB 3MR3A 4C8MA 3V81A 4ZMMA 3PJXA 2VWKA 2QE5A 4H4OB 5I42A 4DG1A 1S6QB 3FQKA 3G86A 5KG1A 4TYAA 2R8HA 3LZIA 1S0MA 1S9GB 4CEAA 4CGHA 4HKQA 4RNOA 3HO1A 2J6UA 4J9OA 4CJPA 1D1UA 2C28A 2R2UA 2KZZA 1MU2B 4CIGA 1L3UA 2W9BA 1BIUA 1T8EA 4Y34A 2IA6A 1ZYQA 4Z4CA 3AVFA 4CHQA 4CEQA 1Z4UA 4YP3A 3GV8B 2FVRA 5T14A 3KK2B 4MK7A 5HRPA 2FJWA 3PX4A 3DRSA 3KK2A 2IMWP 3QEWA 1NJXA 2OPSB 3MFHA 4CHNA 3DLGB 1T3NA 3SQ2A 4NLOA 2W9BB 4CESA 1D8YA 1KFDA 1JIHA 3GV5B 4RW8B 1HPZA 2OZSA 1LW2B 3HVAA 4E7LA 1S6QA 1L3VA 4ECVA 2ASLA 1C1BA 5KFQA 4IFVA 2IC3A 3KLEA 3RB0A 2BE2B 4NZ0A 1NK5A 4ID1A 4U7CA 1GOBA 1RBSA 5KFUA 4IH5A 1KLMA 2B4JA 2YHAA 3SUPA 2IM0A 4ZP8A 3BR9A 1RNHA 3DRPB 4ZVEA 4KB0A 2WOMB 5KRTA 3QIPA 3OYHA 5J2MB 3O4QA 4Q0BA 4TN2A 4FM1A 4DTOA 4WYLA 3DI6B 4ED6A 1JLQA 4CF0A 4FJ7A 1BI4A 5EUHA 4F3OA 1CXQA 3KJVA 4DL2A 3L2VA 4IQXA 3WNGA 3AVAA 3NDKA 2HNYB 4R0EA 3OYNA 4O44A 4M3UA 3H5XA 2OPPB 3HSTB 4EBEA 1VSMA 3V9SA 4ED3A 1EX4A 3DLHA 4Q5VA 2W9CA 1LWFB 4YFUA 1JKHB 4NLXA 4CEDA 4JS4A 5C25A 1KSPA 2FLNA 4M3XA 4CJSA 4MH8A 1N6QB 4IDKB 2HHVA 4CECA 4AHRA 3BSAA 2FVSA 2HW3A 4NLWA 1VSEA 3RRHA 5DLFA 4WZQA 1JLCA 3I0SA 1GX5A 1LWEA 4FCYA 4DMNA 4WYWA 3I5AA 3DRRA 4PWDB 1HYSB 1JLFA 1S97A 3LDSA 4ECZA 3SQ0A 4K4YA 3QZ8A 4KKOB 4ZTJA 1WSEA 3AVNA 5J2PA 4IH6A 5KFYA 2DPIA 4OKJA 4DTJA 4OPJA 4M3TA 3LPUA 4G1QA 1SKSA 3U3YA 4CHPA 4DTSA 4KI4A 1BIZA 1CLQA 5KG3A 3OJSA 2Z1IA 4O3OA 4NLQA 3FFIB 2IM3A 1IM4A 3IGVA 4FLYA 5JS1A 3T5HA 4OKEA 3VQ8A 3AVCA 1JLCB 3I0SB 4I9LA 4DQSA 2JEFA 3M9MB 2ZKUA 4M95A 1U09A 1RT1B 4WXWA 4FJJA 3G6VA 2OPRA 1VSJA 4YQWA 4RW4B 5FRMA 4MKBA 2R2TA 3DRRB 2W9AA 4EYIB 4PUOA 3PR4A 1JKHA 3QLHA 1LWFA 1DTQA 3HXMA 2E6LA 3SCXA 1WSJA 4O0IA 1A5VA 4DQPA 1IKWB 5CYQA 3V1RA 2VWJA 3CYMA 3V6DB 2XO7A 3QETA 4EZ9A 1TKZB 1A5XA 1LV5A 2PYJA 3OYJA 3E51A 1C0TB 3RMDA 2BGGA 3QGGA 3C94A 1BI4B 3SFUA 5F9NA 3BREA 3BSCA 4QWDA 2WTFA 3ZSZA 4CF8A 4E19A 4Q0BB 3D0PA 2XY8A 1KVCA 3U3GA 3MFIA 3QZ7A 4RUAA 4CJ3A 1ZBLA 3V4IB 3KJVB 4FJNA 4KTQA 3S3OA 3MR6A 1RCHA 4HVJA 1R0AB 4PA1A 3HYFA 3C6TB 4IFYA 3SUOA 4KHUA 4IBNA 1HQEB 3S3MA 5HBMB 1BCMA 1U48A 3O3GA 1WSGA 4CJQA 1TVRB 3TABA 2Z1HA 3DRPA 1VSHA 2DTUA 1HMVA 3AO1A 1X9MA 5F8LA 1KLMB 1TKDA 1IKYB 1TV6A 4AHVA 3THVA 5DQIA 2YKNB 2ZQBA 5DQHA 3DLGA 3RB6A 1TAUA 4Q43A 1RBUA 4E7IA 3KNAA 1RILA 4H54A 5J1EB 2VA3A 2ATLA 2KW4A 4CJFA 3O3FA 1S4FA 1ASWA 1JLGB 2R8KA 2WCXA 2HHQA 5F8MA 5KG0A 3P83D 1DTTB 4FZYA 4W5TA 4W5OA 1EP4A 4I2PA 1D5AA 3AA3A 4FJ5A 5CZ1A 4PY5A 1HRHA 4GC7A 2VG7A 1WSIA 1XR6A 4NLDA 4DG1B 4R5PA 3GIKA 4DLGA 4TQSA 1DLOA 3PUFA 1RBRA 3KMQA 5KT5A 1N5YB 3CG7A 1MU2A 3HP9A 3M8SA 4WFXA 4ZP9A 4KFBB 3TAGA 4N47A 5DQGA 1W0HA 2J6SA 4FK0A 3CDUA 3NF8A 5C42B 2E4LA 3TQ1A 4FJ8A 1IH7A 2VA2A 4R8UA 3DLRA 4FBTA 2GBZA 1ZETA 3LPTA 1FK9B 4B9MA 2FBVA 2XCPA 3GV7B 4B9NA 3KKRA 3WNHA 3LP1A 2P5GA 2ZD1B 3B6OA 4YR0A 1S1WB 4NRUA 3H5UA 4FBUA 3NGYA 1FK9A 3JSMB 3CJ3A 4KHWA 4R8UB 5DG7A 3PHEA 3DOLB 4J2AA 2R8IA 3C6UB 2ZD1A 1NHUA 1RT3A 4N56A 3IG1B 3SZ2A 1VK0A 3LP1B 4M45A 3IS9B 4RW9A 1CXUA 2IBKA 4BWJA 2XWYA 2UVVA 5CZ2A 2YNHA 2F8EX 1G15A 3PX6A 2RN2A 2B5JB 4AHCA 3H4BA 4JV0A 3AVBA 4IH7A 3JYTB 2VG7B 2E9RX 1YT3A 1SL0A 4M3WA 5KT2A 4RUCA 4ZVFA 3AVIA 1N5YA 4J9RA 1VSDA 4O3SA 4E89A 4R5PB 3ICLA 1S9EB 2FBXA 1NK0A 2YHBA 2HNDA 2UVWA 4CEFA 2WONB 3V9UA 3HPHA 1CZ9A 3FSIA 4MFBB 2IM2A 3P1GA 2HNZB 1SV5B 3OLBA 4K4ZA 4DL4A 1EP4B 2WB4A 4O4GA 4H8KA 5C24A 1C0MA 2RF2A 2D3UA 2YKNA 2D7SA 4DQQA 4E1NA 5E41A 3NF6A 1T03B 5F8NA 2YV0X 3MAQA 3VQDA 1HMVB 3HPOA 4FJ9A 4FW2A 1SH0A 4I9QA 4EYHB 2OH2A 3ZT2A 4LQ9A 1RDAA 1TV6B 3NGDA 3C6TA 4FS2A 4CJTA 1NHVA 5SWMA 1R0AA 5JUMA 3KMSA 1SH2A 4J9QA 2D3ZA 3V4IA 4Y2CA 1RA6A 2O5DA 3LANA 2HMIA 3OYIA 3ZSQA 1HNVA 4L8RB 4URQU 4DTUA 3D5MA 4DSFA 4FLVA 4YR3A 3NGIA 3V9WA 4F4WA 2X6NA 1QHTA 3V6DA 3AA4A 3C95A 4QWCA 3TAEA 5EWGA 3SV4A 5CYQB 1K6YA 1B92A 3E01A 2E9TA 1QTMA 1SKWA 2HVHA 4CGIA 1RT4A 1SKRA 3OY9A 3G6YA 3KK1B 1MMLA 3VQSA 4RW4A 2FVPA 1Q9YA 3QGIA 1X9SA 2V9WA 2XI3A 3GIJA 3KKSA 2PZSA 3RAXA 3NGZA 3RR7A 4MKAA 3SPZA 3PW0A 3NKYA 3ZSRA 1SL2A 4Q45A 1LW0B 4I2QB 3NAHA 1ZTWA 3NH1A 3UIQA 1U47A 4B3OA 3LWMA 3TWHA 2IAJA 3TAFA 4JUZA 2Q3SA 4ZVHA 1K1QA 2IJFA 5KFLA 2OPRB 1ITGA 1Z26A 4KHNA 2E9ZA 4M42A 4KAIA 4FJGA 3ASMA 3KD5E 1S48A 3Q8RB 1CSJA 1SUQA 4LSLB 4CF1A 4DQIA 3H40A 2JC1A 2OYQA 4EZ6A 4KKOA 1JL2A 4OJRA 4DFKA 5KFDA 2ILYA 3SYZA 4UQGA 1SV5A 4NCBA 2G8IA 3CDEA 1HNIA 2O4GA 4TY9A 2XY7A 2HHUA 4RNHA 3OS0A 4DTXA 1NJWA 2WONA 5KG7A 3I0RA 1REVA 3QNOA 3ITHA 3OL8A 4CIEA 2R2SA 4NRTA 1IKXB 1UA1A 3M9NB 4DSKA 3KLVA 4DL5A 4CF2A 1N6QA 5FDLB 1VSKA 5KG4A 3KHRA 3CFRA 3LP3A 3M8RA 4GMJB 4PQUA 3L8BA 3NH2A 2W9CB 4FVMA 4DF8A 1NKCA 1S6PA 2EX3A 2YNHB 1BISA 2ITGA 4E7KA 4IDKA 4KTZA 3DLBA 1VRTB 4RW9B 1S9FA 4AHUA 3I5BA 3TAPA 3IG1A 3O4NA 4B8CA 3DOLA 4BACA 1QSYA 1JLQB 4HUFA 4Z4EA 1FXXA 3JSMA 4QCLA 2HNYA 4NCGB 3D28A 4EP5A 2V4RA 4DU4A 3RB3A 2GC8A 1C1CA 1J5OB 4OGCA 2R8JA 3DI6A 2AX0A 3DYAB 4ICLA 1RTIA 5K14B 3K59A 5KI6A 1ZBHA 5C42A 1C1BB 3NAIA 3OL7A 2WOMA 2KQ2A 2FLPA 4DTRA 2OPQB 3QERA 3PJWA 3S3NA 3BQ2A 2BQUA 4NLSA 4KV8A 4X2BA 4CJ4A 3KLEB 1NOYA 1XR5A 5CY4A 4DSJA 3PW5A 5KG2A 4M3YA 5C5JA 3V6KA 3OYMA 1XC9A 4TY8B 4IOBA 1U45A 3LAMA 1J54A 3L2RA 4I2PB 4CGDA 3VQ9A 3LAKA 3H2LA 1W9HA 1RT7A 2OPSA 2DY4A 1DTTA 1JLEB 3DM2A 5HRRA 4ED2A 3H4DA 2WRMA 4HYKA 4WFYA 4OLAA 4IR1A 2BR0A 1VSIA 3HL8A 2BRLA 4TY8A 4ECQA 2HHSA 4ZTFA 3AA5X 1RYSA 4F8RA 1BCOA 4DSIA 1RT7B 4DS4A 1TGOA 1IKYA 2HHXA 4F4ZA 5DG8A 1QS4A 3RMCA 3AVLA 2KFNA 4ZPCA 3RB4A 4E1MA 2G8FA 4CJVA 3H5YA 3IN5A 4DFJA 3G10A 5I42B 3OYFA 3FDSA 4EO8A 3SFGA 3SI6A 4KHSA 1HQEA 3KTQA 1S1VA 4IFYB 4KV8B 5JS2A 1X9WA 3ZT0A 3TVKA 1EKEA 3M8PB 1BQNB 3OLAA 3MXJA 1TL1B 3LP2A 2C2DA 1JX4A 4C8KA 4IRCA 2XHBA 2IJNA 2HWIA 3OYDA 2IM1A 5EDWA 4IRKA 2KFZA 4TXSA 5D3GB 1W25A 3DOKA 2C22A 1C0TA 4CCHA 1TKZA 4DL7A 2KTQA 2X6SA 1S1TA 2JEIA 1UA0A 1DTQB 3O3HA 3QLHB 3GILA 3MEGA 4ZP6A 4PUOB 1TKXA 3VQ4A 4F4KA 1VRTA 4K4VA 1SL1A 2ETJA 2AGPA 2XRIA 3A2FA 3V6JA 2ILZA 3QEXA 1RT1A 1TKTA 1C1AA 1XHZA 2I5JA 3N6LA 3AVHA 4OLBA 4RZRA 5KT3A 4LSNB 4RW6B 4PQUB 4QPXA 4NLRA 4TLRA 3LWLA 4B9TA 2AU0A 1NK8A 3HKWA 1RTDB 4JLHA 5JXSA 3ALYA 1Q8IA 3PO4A 1U4BA 2LSNA 3F9KA 4FJMA 3QIOA 4DL6A 3CJ0A 4FZXC 4IKAA 2W7OA 1HNIB 1JXEA 4IKFA 1D9DA 4ZP7A 3LALA 5I3UA 2DPJA 1T7PA 5J2NB 4LD0A 2IAJB 5KTQA 3OS2A 1C2PA 3OS1A 4B3OB 1NNDA 3MECA 3NH0A 4H4MA 1SUQB 2O4IA 1NJZA 2V0NA 3KD1E 3VA0A 1B9FA 1RYRA 2JEGA 4EBCA 5EU7A 2GIQA 4O3RA 4Z4GA 3AO3A 3VN5A 5C25B 1HQUB 3EPIA 2YNGB 3NL0A 3VQ7A 3KK3A 3E01B 4YR2A 2PY5A 4YMEA 3T5LA 4W5RA 5DGAA 2YKMA 4KO0B 4O44B 4F4YA 2G8UA 2E6MA 4N76A 4B8AB 4YNQA 3KLHA 3GYNA 4FW1A 3DLKA 2XI2A 1S1UA 3DMJB 4MK8A 3RBDA 3G0ZA 4DTMA 1RT6A 4C8NA 1S1UB 3DMJA 4DTNA 4FS1A 5KFPA 4FM2A 4Y1DA 1N56A 4QWAA 2G8VA 3RR8A 4WFZA 4DSEA 4F2RA 3PW2A 4AILC 4RU9A 2NUBA 4FJLA 2F8TA 4HCBA 4U6PA 5F8HA 4ZPAA 4CFDA 2JEJA 4J2DA 1QAIA 2GUIA 2P5OA 1HQUA 4IG3A 4NLGA 3CJ5A 3QIDA 4B9SA 5KFHA 3MR5A 4C8OA 1BQMB 2XY5A 3MXIA 1HPZB 4KBIA 4RW8A 1WSHA 4TYBA 5KFFA 2IOCA 1T03A 3EZ5A 4O4RA 1O1WA 2W42A 3PV8A 1XHXA 4FJKA 1IO2A 2YNIB 4TSXA 4WXOA 5EWFA 3OHAA 3NE6A 3AO4A 4DTPA 2YNFB 1FKOA 2DFHA 1GOCA 1JLBA 3Q8SB 4RNMA 4Q8FA 2AWZA 4J9PA 2FVQA 1IKVA 1RDBA 3NHGA 4URGA 1L3SA 2HNDB 5F8GA 3SV3A 5L1IA 4CJWA 4IG0B 2F8SA 1RTDA 3K5NA 3EYZA 1GOAA 2HNZA 2QXFA 5CYMA 4MFBA 2UUWA 3OVNA 3HK2A 4K4SA 3AA2A 1S9GA 1BGXT 2HHWA 3T5KA 4XO0A 4H4OA 3RWUA 5KFNA 2XC9A 2I5JB 2IGIA 2QKKA 1FKPA 3CDWA 5HRNA 4ZHRA 5KFRA 4HTUA 2C2EA 4M41A 3OYGA 2ASDA 3CVKA 1NK4A 5KFSA 4GC6A 1TAQA 2B5JA 4ID5B 1RTJA 4G3IA 4I7FA 3VQAA 5KT7A 5F8JA 2FBYA 2FVCA 4AH9A 3KHGA 1RT3B 1I6JA 4JV2A 3SQ1A 4ECTA 1VRUA 3FRZA 3IGNA 4MIBA 1RDDA 3KLGA 4I7FB 5L1LA 3ISNC 4QAGA 1I39A 1UWBB 4KB7A 2HHTA 4CJUA 4B9UA 3OYKA 4ELUA 4DLEA 4KFBA 3TAMB 4JRPA 4NYFA 4ZHRB 4J9LA 3QO9A 2B6AB 1RAJA 2RKIB 1ZBUA 4E7HA 4Q44A 1JLAA 2RDIA 4ED8A 1QUVA 3BQ0A 3IRXA 3TANA 2FBTA 1ASVA 1U49A 5FRNA 3HPGA 4IG0A 4O3NA 2HAIA 2XGQA 3UPFA 4K4XA 4MK9A 4CGFA 5HROB 1JLGA 3QEVA 3HJFA 4LH5A 1F21A 1U04A 4HCCA 4KB1A 1S5JA 3I8DA 1RTHA 1JLBB 5J1EA 4QWEA 1XI1A 5SZTA 1QE1A 3CQ8A 3G6XA 2X74A 1B9DA 4BDPA 4O3PA 4J9KA 1IKVB 4KSEB 1T05A 3T19A 4HHTA 1NK9A 2D0CA 1Y97A 4BE2A 2YNFA 5DK5A 1QQCA 4B9VA 4J9NA 4DU3A 4NLVA 3EPGA 2ATQA 4DWIA 3OL6A 4M3RA 1HYVA 2RPIA 4Z4HA 4EP4A 1T94A 3CJ4A 1TK8A 3U6FA 1C0UA 3VQEA 2OPQA 3MXMA 3AO2A 1TVRA 3VQBA 4CGGA 4CEZA 3OSNA 4CFAA 4W5QA 5HBMA 1RTIB 5K14A 4ZPDA 4CHZA 3K5OA 2I1RA 1RT6B 3DLEA 2BANB 3M8QA 3L3UA 3HT3A 4CK2A 3KLHB 3SNNA 1YVUA 5KFAA 3SJJA 2QK9A 3QGHA 5DGBA 1KFSA 1LAWA 4JRQA 5HP1B 2D5RA 1IG9A 1S10A 4NCAA 1YTUA 1NKEA 2R8GA 4LH4A 3PX0A 3DLKB 4ZVGA 3CM6A 3H59A 1RT5A 2QKBA 3HVTB 4DU1A 4DL3A 2ZE2B 2YKMB 3PO5A 4ZPBA 4NYZA 1IKWA 1KCFA 4ECSA 1QSLA 1S6PB 1K1SA 4FLWA 3OJUA 3Q8PB 2DFFA 4H4MB 2IS3A 2VG5B 3MECB 2IDOA 3CFOA 3KLFB 3NBPB 2CJQA 4BWMA 3CO9A 3FFIA 4J9MA 5FDLA 5KFKA 3CM5A 2GIRA 2VG6B 4EO6A 4CGJA 3K57A 3ITHB 3AV9A 1REVB 3I0RB 4G1QB 5KFIA 1ZBIA 4KAZA 1J9AA 4FLXA 1UOCA 2G8HA 3SQ4A 5F8IA 1LWCB 2P1JA 1KTQA 1NJYA 3HP6A 1JLFB 1L5UA 2HWHA 2HVIA 1RDCA 2VG5A 1TP7A 4RNFA 2G8KA 5KFWA 3PZPA 4F3TA 4MIAA 2VG6A 4Y1CA 3SUQA 2AX1A 4DSLA 1HYSA 4FJIA 3HVTA 4PWDA 3NBPA 5KFJA 3NCIA 2XCAA 3ZT1A 3BSOA 3MEGB 3Q8QB 4BE1A 3V9ZA 4KHQA 3ZT3A 3N6MA 1HJRA 5KFMA 3RMBA 1WNEA 4AHSA 2AGOA 1TKTB 1RT2B 2ZE2A 1WN7A 4KE5A 2JGUA 5HP1A 1WSFA 1YVFA 3BDPA 3OSPA 3KK1A 1RT5B 1TKXB 3MEDB 3QNNA 3TAQA 1TK0A 2B43A 4KHMA 1D0EA 4ECRA 2XGPA 4URSA 4CJEA 3RAQA 3AVJA 4FM0A 5KFZA 1I3AA 4CJLA 2OZMA 1KHVA 2D0AA 2R7YA 4O5BA 2AQ4A 1S1TB 1KVAA 2JC0A 2QV6A 3QEPA 3QIPB 5KG5A 4JS5A 4CF9A 3UQSA 3LP0A 4N5SA 2P51A 1KRPA 4QW8A 1BQNA 5D3GA 3DLEB 2BDPA 4C8LA 1VSLA 3K58A 1S1VB 3PR5B 4DFPA 4CFCA 4IFVB 4K8XA 4B9LA 5KFXA 4DF4A 4W5NA 1C0UB 4CIFA 4K4WA 1XR7A 2AJQA 4CFBA 4K4UA 1N48A 4RNNA 3UDLA 2IC3B 4Z0UA 2X78A 4XIUA 2UVUA 3ZSWA 3OYAA 3ZSVA 2RDJA 1LW2A 4F4XA 4Y2AA 3H08A 4FZZA 3NFAA 2C2RA 1T05B 3VQPA 4K50A 2G8WA 4RW7A 1JLEA 3DM2B 4CJRA 1A5WA 4RW7B 2W7PA 3L2UA 1LAVA 1RTHB 5KFOA 3QINA 3DRSB 2W8LA 5KT4A 1JLAB 2A1RA 4FXDA 4CEEA 3V81B 4ELVA 5KGWA 3KHLA 2B6AA 2J6TA 4M3ZA 1J53A 5DMRA 1UAXA 5KT6A 3HVWA 4CHYA 4OPKA 4FK4A 1X1PA 4ECUA 5DG9A 3TAMA 4NYNA 4XPEA 4ECYA 1Z25A 3P5JA 1JL1A 4E0DA 1QSSA 4NLTA 3L2QA 3NAEA 2GV9A 3WNEA 3CJ2A 3D45A 1ASUA 3PW4A 1HARA 4Z4FA 1J5OA 1C1CB 1VRUB 2BRKA 3H5SA
chains in the Genus database with same CATH superfamily
4X66J 1ESVA 5K8PA 1Z05A 2HZCA 4NCGA 3C14B 4ICLB 3N5BA 3KLGB 2MMYA 1NZAA 3WDOA 1ZAXA 1S1WA 4JI8J 3MUVP 3CWJA 3L3VA 1VLOA 2CPFA 3MEDA 5DO2A 1NDPA 2GGPB 3F56A 2LXIA 3MM6B 4ERDA 5HVFA 4CK3A 2HHHF 4CJ5A 3HMJG 1N34K 3AJDA 4BROA 3MF5A 4ED7A 4HUEA 3DDKA 1F3FA 4LFCJ 1NU4A 1RBOB 1QQNA 2KL8A 3NS6A 2OO4A 3W5ZA 2XULA 2CQCA 4PAAA 3K9KA 5CYMB 3ZSXA 3D2WA 4X66F 4IJAA 3KHHA 1WAJA 4FVUA 1GXTA 3RTVA 2UXDK 2MQPA 3BUZB 3WXJA 4U8YA 2RVJA 3DLJA 3WEEA 4ISFA 2HWTA 5GAEI 2B4VA 1SH3A 4Z4IA 4J9SA 3AVMA 4KRFA 1LWCA 4USUA 3VF6A 3KOAA 3T5JA 3HVRA 1VSFA 3Q0AA 1KTVA 3M8WA 5ETSA 1ZBFA 4WIQA 4ILMA 1NB7A 3UR0A 2HLTA 1NLVA 3HX9A 2HF4A 5LSLA 1BQMA 2AMCB 1N4LA 2V50A 2ZJPQ 3MR2A 2DK2A 3ULEB 4EFHA 4CZMA 1SCJB 4HHJA 2BQRA 4J8FA 2QL7B 3D4JA 2M88A 1NJIT 4WE1A 1EETB 1HKAA 3JQKA 1TFWA 4CM2A 3EVWA 2B0GA 2EC0A 2FC0A 1KVBA 2PMHA 3KIOA 5DM7Q 1RQ0A 1D9FA 4PKGA 2PEBA 3GL1A 5HLFB 1C6VA 4BC2A 3I33A 3HD2A 2WB1D 2E2QA 2QA4N 3OTOF 2DGSA 2R3VA 4ECXA 3FBFA 1IJFB 1FDBA 3V9XA 1WLJA 2DGOA 2HQIA 4C97A 3VQ5A 2RHKA 3ZNUA 4B08A 4UY8O 2G4BA 4DUYF 2MLYA 3R7BB 4CZKA 3UKUB 2HSTA 3LF0A 4DV2F 3IAYA 4BRDA 5HL7L 2N4CA 1RAOA 4B02A 3M6WA 1NMNA 4FLUA 1EETA 2FJAB 2QSWA 1VC5A 1X0PA 4WE1B 3ZCMA 3V1QA 1YTAA 2QWOA 3GSDA 4OZ3A 3VGSA 3GFZA 1H6KX 4TQRA 3QMQA 3RBEA 2W41A 3MCOA 3FMBA 4CZGA 1H74A 2VKZG 5I3UB 2CPHA 3NF7A 4C3MA 2LA4A 1LNQA 2DNQA 1K44A 2JLEA 4IO8A 1J5EK 4Q2MA 4X62K 3CPEA 2UUTA 4RW6A 1MMNA 2HS0A 4QOZB 3OR1A 4NLUA 3DXBA 5J2PB 4KC5A 2WW4A 2U2FA 4WZMA 3R7SB 1FWKA 2Z1JA 2EHGA 3IRXB 2IRUA 1YJ7A 2Y1IA 1UJ6A 2W2PP 3JSYA 1LWEB 1S3XA 2W2OP 1S9EA 3C2PA 3TZXA 3CJCA 3HKZD 1EQMA 5KRSA 2K1RB 3ATUA 1NDCA 3IS9A 1FE0A 7FDRA 3BGRB 4MAKA 4O0JA 1EJ7L 2MHEA 4DS5A 4DHYA 2OPPA 3CMAN 1VLYA 3VQ6A 2GGPA 2LEBA 1YVNA 5C15A 4F50A 4FLZA 3SQGB 1ZA1B 1KHWA 2DFEA 4CLKA 4RJVA 2R7SA 3L6QA 3SBTA 1VQMS 4KI6A 4GO5X 4M5DB 4NMXA 1YWXA 3WXIA 5L9XA 4DV6K 5H9EJ 4RLEA 5AQTA 4O55A 3LP2B 3RU0A 5FIIA 3ID8A 1HD1A 2XMKA 4DMZA 2UUBF 2XHWA 3K2PA 1DLOB 4PHTX 3O80A 2AZ1A 4JI1J 4H5RA 2CVEA 1S0MA 3IWXA 1S9GB 4CGHA 4HKQA 5HJYA 2J5AA 3AQPA 4JV5J 3TRGA 3THWA 2KZZA 1QAXA 1V3SA 4M5HA 5HK4A 5IXUA 1U25A 1T8EA 4Y34A 2F63A 4Z4CA 1Q7LB 4CHQA 4YP3A 3GWCA 1XEZA 4B1VA 3DRSA 3KK2A 4IOCQ 2MZQA 1KEKA 2DBBA 5LL6Z 3OVBA 4YOUA 1WTFA 1T3NA 4ED4A 2HRUA 2QTDA 4OYBA 5KOWA 4RW8B 4A5AA 3HVAA 4A48A 4E7LA 4JI7J 1SAZA 2UXDJ 2NXCA 4ECVA 2ASLA 4C0BA 5KFQA 2CPIA 1N36F 2CNNB 3RB0A 2BE2B 2A3JA 1HBUB 2YHAA 2IM0A 1MNEA 4OHZA 4KB0A 2KYZA 4DR7F 2W6KA 3ZC4A 3OYHA 2XSJA 3L7OA 4LF6K 3ID6A 3NOCA 4OZNA 1NXIA 1B7FA 1JLQA 1H3DA 4OZ1A 2A2CA 4DL2A 3Q2SC 2YHXA 3LM2A 3WQUA 2VPWB 3FBEA 4Z2XA 1VS3A 4R0EA 3MWTA 4OYOA 2N7CA 4EBEA 1VSMA 4X4TA 4BQLA 4YHHF 4A46A 3UN5A 1RAEB 3GIRA 1KSPA 2YPYA 2FLNA 5IC4B 1IBCB 4MH8A 1N6QB 1C0GA 1S6UA 3O9TA 3M32A 2KO1A 5IT9U 4PPDA 2NXNA 3PNIA 3I0SA 1Y11A 1GX5A 2OANA 4DMNA 1KQFB 3I5AA 3DRRA 4AQYK 3GB0A 4OFZA 3UD3P 3CJ1A 1WC4A 3SQ0A 3QZ8A 4RBUA 2E5HA 3M6UA 5KFYA 1VBZA 4LF8F 4ZCMA 5LMNK 5ETOA 1CQMA 4DI6A 2ZF5O 4DTSA 1N5QA 4KI4A 2ZBQA 1BIZA 3OJSA 4NLQA 3FFIB 2ZH8A 1IM4A 3A8YA 3UB5A 5K8MA 4OKEA 4GV3A 3I0SB 1U1NA 2NR0A 2DHHA 4DQSA 2XYGB 2JEFA 1S6OA 2HS3A 4OI6A 2ZJQL 3Q8VA 4Y65A 2EVZA 3H1VX 4FJJA 5GAGI 3CJ9A 2OSRA 1Q8BA 5FRMA 2P9LB 2R7QA 4WP9A 4CZLA 4M63A 3QT8A 4J9UE 3QLHA 1RGIA 3D54A 1TL7B 1HNWJ 1WSVA 3SCXA 1WSJA 4O0IA 2O8FA 2K7KA 1WELA 5AQYA 5CYQA 3BBBA 3C7NB 3M2UB 3CYMA 2QLJB 2F5GA 4HT7A 4C0HA 4EZ9A 2EBGA 1A5XA 4LF9K 3E51A 1QVGR 5AQUA 4GVBB 5ETKA 2JZ5A 3ZSZA 4CF8A 1J6ZA 1SI9A 4NYPA 4YOWA 4GKJF 3D0PA 1KVCA 3QZ7A 2KG1A 5AQGA 4NX9A 3JXUA 3QFPA 3R5DA 3KJVB 3S3OA 3C6AA 4HVJA 4PA1A 3C6TB 2D9PA 4IFYA 3SUOA 1HQEB 2XZWA 2MKHA 4B3SK 2ZH4A 2VUGA 2DJWA 2XHCA 4C6AA 1WSGA 1I94K 2Z1HA 1NGJA 5AE3A 5DM6L 3AO1A 2N4DA 3PIPQ 4U96A 1TKDA 1IKYB 3MDFA 3THVA 3RB6A 4BR2A 4Q43A 1RILA 1PSDA 3GTYX 4CLTA 1WKJA 3A3NB 2E5IA 2R8KA 2HRTA 1F9FA 2MLXA 3DC2A 2GHWA 1DTTB 2VQFJ 2YH0A 4CBXA 4JD2B 4C8ZA 4PY5A 1BQXA 2BJ1A 2AD9A 1S99A 5CH7B 1XR6A 4NLDA 4DG1B 1SQFA 1WF1A 1DLOA 3KMQA 5KT5A 4AQYJ 1JCEA 4DR7K 1MU2A 1FVQA 3FEYB 4KFBB 4KR0B 5AJ3J 1W0HA 2WSEC 3NF8A 1RDUA 3TQ1A 4FJ8A 1B3TA 1IH7A 3CDAA 2VA2A 1VQ6S 2GJIA 3DLRA 4FBTA 4B9MA 3ISZA 1MWMA 4B9NA 1RBLA 4CQ1A 4KGMA 1RABB 1ROFA 1M5OC 1CC7A 2ZD1B 3B6OA 4YR0A 3ENWA 4OYIA 1WDTA 4KHWA 2R8IA 3C6UB 5A2QO 2ZD1A 2GVDA 3IG1B 1VK0A 1GNKA 3IS9B 2FLOA 3KG0A 2IBKA 3Q8UA 2UVVA 4K43A 1XMOK 3ILLA 2RN2A 2B5JB 3MX2A 1S4EA 4AHCA 3JAMU 3UCZP 4JV0A 1S59A 2VG7B 2E9RX 5HQLA 3H2VE 4M3WA 4RUCA 2P2CB 4H0YB 1IBMF 3AVIA 2MKCA 1RHKB 2C2MB 1U1QA 4E89A 2E1PA 1KQGB 1IQZA 1MW7A 4CEFA 2WONB 3W8PA 3EEQA 3HPHA 1CZ9A 3FSIA 2IM2A 1IR2A 3ZO7A 2HNZB 1VISA 1J5EF 2P9NA 3EDQB 4DL4A 3T7ZA 3J7ZT 1CJUB 2FZGB 4IEIA 4Y2MA 2RF2A 1IBKK 1AUSL 1D3WA 3FBBA 5AQHA 3NF6A 1T03B 5F8NA 1RWUA 4K5SA 3MAQA 3HPOA 1M5VC 4FW2A 4F7VA 3QFUA 4I9QA 2XNRA 4LQ9A 4JKGA 4CJTA 1NHVA 5SWMA 4JKEA 1R0AA 1WI8A 1I51B 1SH2A 4A62A 1TELA 3V4IA 3MM8A 4DR5K 2O5DA 3O9SA 4GKKK 2CZVC 4AF1A 3ZEUA 2F1FA 4DUYK 4URQU 1GLCG 3D5MA 3NGSA 1L3KA 4YR3A 1YRXA 3NGIA 4U8VA 2Y3YA 1ZC6A 1VQ7S 5D8HB 1QHTA 3OBIA 1FDAA 2Y8YA 2KHOA 1SZ2A 4BG9A 2E29A 3ATVA 5M1NA 1K6YA 2E9TA 2HVHA 4CGIA 2J9DE 1HWKA 5L46A 4DCJB 3L95X 3OY9A 4J5OA 4WBFA 1Q9YA 1VYAA 3QGIA 1X9SA 2OTLS 1T0TV 3UE5A 4WYBA 3SXLA 1BA1A 3F41A 3SPZA 4X65F 1BD6A 4Q45A 2M8DB 3CJSA 3UKRA 3NAHA 1XIQA 5B8HA 8AT1B 2NUUG 3TAFA 2W4DA 4JUZA 5L39A 4ZVHA 4CT8A 1K1QA 2OPRB 4KHNA 2CWKA 3P96A 4KAIA 5GAEU 3D1OA 4Z7YA 1R89A 2X3GA 3Q8RB 1FDNA 3FLCO 2DNRA 1RAIB 4DUYJ 3TUJC 1UPPA 3PYDA 1ZA2B 4DFKA 2FXUA 3SYZA 2ILYA 1SV5A 3AAQA 3MWPA 3CCTA 1XMQF 2H5IB 4TY9A 2HHUA 4RNHA 4DTXA 2CXEA 3K7RA 1VJWA 4IYQA 4UY85 4JI0F 5FLXO 1REVA 1X4DA 5KPRA 2XNQA 3OL8A 1R8BA 2VF3A 2R2SA 4NRTA 1IKXB 3Q23A 4CF2A 3BBCA 1VSKA 4ILLA 3J7YI 1WC0A 4GMJB 3L8BA 3NH2A 4FVMA 2GELA 2K3IA 2WVDA 3G25A 1IJJA 3BEGB 2E1AA 3I5BA 4LR7A 4LMZA 1NAQA 3R6GB 1KBRA 4B8CA 3DOLA 1QSYA 4DCOB 4PG8A 3VAKA 4A5BA 4Z4EA 2GIFA 3T1YJ 2PC6A 1TYQB 4EP5A 4M63C 4DU4A 1OO0B 3RB3A 2YWFA 4FWMA 1KP6A 2ZHBA 2QO3A 1B99A 4OGCA 1WSRA 1VHXA 2R8JA 2NZ4A 2AX0A 1RTIA 2CYYA 3J80Y 1H2TZ 1C1BB 4JI1F 1YF5L 4N8NA 5LJ3Y 3BV8A 3E8OA 4F25A 3ZTRA 1NOYA 1TL5A 2RSQA 5KG2A 4AYBD 3OUYB 3V6KA 1FNXH 2D4WA 3OYMA 3DHWC 1FJGK 3O8WA 4IOBA 2GMHA 4MLHA 4ES2A 1U45A 1YHQN 5CZVA 1OMSA 3VQ9A 3H2LA 4OIXA 4IWVA 2B9XA 1WKLA 2ROEA 1VSIA 3UDVA 2Q31A 4ZTFA 3PACA 1RYSA 1BCOA 2Z56B 4FVCA 1KOOA 5AQIA 1TGOA 2HHXA 2XTJP 1QS4A 3BZCA 3AVLA 2KFNA 4ZPCA 2G8FA 4CJVA 3IN5A 3ULHA 3G10A 3OYFA 1MDUB 4RPFA 2DNKA 4EO8A 3M2VA 1VRQC 1S1VA 1X3MA 3EDRB 4HH0A 1MG7A 4ZJOA 3M8PB 1BQNB 5ETVA 4FWSA 2QM1A 2UU9J 1TL1B 4LJMA 2NSCA 4P52A 4DV0J 4C8KA 4IRCA 2HWIA 2IM1A 1NUEA 3G82A 3TX8A 1YAGA 5GIPA 1W25A 3DOKA 2FYXA 1NZ8A 2C22A 3TP2A 4JI7K 4DR1F 1TKZA 3GG0A 1WKKA 4DL7A 4JI3J 2X6SA 2JEIA 5LSRA 2MJUA 3GILA 3DCAA 1TKXA 4ZK7M 3NLCA 1FI4A 3IMQJ 1OKJA 2AGPA 2XRIA 3A2FA 4BLGA 2I0XA 1C1AA 2GX8A 3SDEB 3AVHA 3ZZUA 2NRRA 3D6HB 2J9DA 2OCEA 3WQTA 2UXCJ 3Q7BA 4PQUB 4QPXA 4NLRA 3CCLN 1UVJA 3LWLA 4B9TA 4QYZK 2AF6A 3DRYA 2HURA 3THTA 2HOEA 5D0RA 3VCDA 3T1HF 4JLHA 1BA0A 4LF7J 3ALYA 1YSJA 3PO4A 4DV4K 3T6JA 3M5RA 2LSNA 1RDWX 5L9NA 1VQMN 1R3NA 2B4UA 1CLFA 2W7OA 1Q0NA 5RUBA 2BUPA 1HNIB 4IKFA 1D9DA 3LALA 3PXGa 1RAAB 4LD0A 2IAJB 4I4BA 4LF2A 1VIXA 1C4AA 3AA8A 2XMJA 4BRFA 1VFJA 1CPZA 2HLUA 4H5WA 3KD1E 3MWBA 3MMCA 1SXLA 2JEGA 3M6VA 1HQUB 2LXFA 1GLDG 1XMOF 2IVNA 2WW8A 4O44B 3EN9A 4FPAA 1FVSA 2ZWHA 2ACMA 4DV1J 3GYNA 4CJ7A 1S1UA 2CIMA 4X4NA 1YTYA 1RT6A 3KG1A 3N4QA 1HKCA 3MCSA 3DMJA 1KNZA 2OTJS 3DAWA 5M2RA 1LFWA 4OI1A 4FM2A 1N56A 4QWAA 3RR8A 4DSEA 3OTDA 3J81O 3PW2A 4AILC 2EFQA 1HNWK 3HHLA 3D6FB 4PABA 4JKGB 2QMXA 4ZPAA 3U1MA 2JEJA 1S7HA 2PGCA 1KXPA 1HQUA 1VCTA 3AAWB 5AXMA 3O8MA 5CE3A 2YJEA 3S6EA 1HPZB 3AOAA 2XWXA 1WSHA 2IOCA 1Q82O 3N4WA 2H5JB 1NU0A 2ZHOA 2YNIB 2PSZA 1PJ7A 3AO4A 4DTPA 2DFHA 2QWLA 3CD5A 1UJ5A 3EL2A 1IKVA 1RDBA 3L4IA 2PN6A 1LXNA 4URGA 2CQBA 1L3SA 5F8GA 3SV3A 3NY0A 3W3SA 3VMFB 4IG0B 4F0KA 3TW0A 2F8SA 4HVZA 2GFFA 4DR2K 3H1QA 3J7AN 4MFBA 3UN2A 2UUWA 5LL6d 2O8DB 1BGXT 2H54B 2KVIA 2HHWA 3W1YC 4RWTA 4NASA 2VPYB 2I5JB 3T6BA 2QKKA 5HRNA 1G1XA 2C2EA 2ASDA 5GADP 4PYAA 4NEZA 1NK4A 2MPUA 5T7LA 4BQZA 3IRWP 3P4IA 2I38A 4ID5B 1FW6A 3I87A 4G3IA 1UVMA 5F8JA 4FF4A 4OZ5A 1VQ7N 5AQNA 3TU5A 4OQJA 2ZDPA 1RT3B 1DGKN 4QYZJ 1W26A 4RCHA 2QA4S 3FRZA 3IGNA 4MIBA 3OFFA 2XS7A 5L1LA 3ISNC 1F5CA 3W61A 4JKCA 2UUCJ 1TUWA 5CYJA 5AQWA 1DBDA 3OYKA 4ELUA 4QR1A 4ZHRB 4HTJA 2U1AA 5AQQA 2A6OA 3QO9A 3C66A 2B6AB 2RKIB 1ZBUA 4E7HA 1VQPN 1IUJA 2K8GA 2QSFA 4AL5A 2RDIA 2LYVA 4ED8A 4RUBA 3FE1A 2RRBA 2E7XA 3PIOL 2O3DA 3HZGA 2O8BB 2ROPA 5M1FA 3C8YA 3UNYA 3HSCA 4YB1P 5BRFA 1V4SA 1I1GA 3NNHA 5EHHA 2DB1A 1JLGA 2LQ9A 4B3TJ 2IPOB 1VBYA 1F21A 4LC9B 2Q6CA 1RTHA 2X51A 3I6PA 1XNQJ 2CG4A 3G87A 2HS4A 2KFYA 3ENBA 2K7JA 2MSSA 3T19A 3CE8A 4HHTA 2C2NA 1IR1A 4YOXA 3CETA 1U0SA 4J9NA 3A5OC 3DLLQ 2ASYA 1AXQA 4M3RA 2PMWA 2JOQA 2JX2A 4JI6F 1VQ9N 2LFVA 1U24A 3J7YP 3CJ4A 1TK8A 3U6FA 2OPQA 2VPZB 1U7LA 2QMWA 2JNJA 1P1LA 4A8QA 4CHZA 3IFRA 1U2RA 3M8QA 1PIEA 3HT3A 2FSKA 3HHLB 1N36J 2Z4PA 3KLHB 3SNNA 1YVUA 4P6QA 5KFAA 3SJJA 1AZSA 2DXEA 4FWRA 2D5RA 1RCXB 1FRHA 3AD9C 1UP1A 4NCAA 5BYRA 3PDNA 1NKEA 2O8FB 9ATCB 3VAMA 3DLKB 2Z2MA 3MM5B 2CPEA 3OTCA 3H59A 2HFNA 3FCWA 2V2VA 2L9NA 4DU1A 4DL3A 3VTIA 2ZE2B 2QC3A 3PO5A 4NA2A 1GLFO 3M6XA 2VASA 4NYZA 1KCFA 4ECSA 3OJUA 3VEZA 4H4MB 2IS3A 1NDKA 2IDOA 1Q86O 3ADAC 3NBPB 1U6ZA 5FDLA 1NGHA 4EO6A 3CMEN 3P5BP 4X4PA 4MMOA 3UCUP 3NGUA 1REVB 4G1QB 4JI8K 1FESA 5D0EA 1WG4A 2BW2A 2LDIA 4NA1A 2P5VA 4FLXA 1I5OB 3HZ6A 4JKFA 1KTQA 1VIOA 1NJYA 3D66A 2HVIA 1YJWN 2G0IA 1EHWA 2EPIA 1K0TA 1RDCA 1U1PA 2OP5A 5A8WA 1MROA 2G8KA 3PZPA 1NGFA 1N5VA 2HPUA 3TTDA 2VG6A 5CCLA 4OYAA 2HIYA 2X7IA 3HF5A 4Y1CA 2O8CB 1HYSA 3KFWX 5KFJA 1RZMA 3MEGB 1BUPA 3V9ZA 4ZCKA 5D15A 3N6MA 2DVIA 1G6BA 4UTGA 1ZM9A 5KFMA 3RMBA 1YI2S 1CULB 2DCLA 4AHSA 4JB8B 3HOSA 1T6CA 4TKTA 4C98A 2OI2A 2RNEA 2JGUA 4ZJQA 1WSFA 4IUFA 1TKXB 3ETOA 4C7QA 2DR5A 2B43A 4KHMA 4ECRA 2XGPA 4URSA 1GLLO 1KHVA 5LMNF 5DETA 3HULA 4NMLA 4O5BA 4LF4K 3NGKA 4WTYA 5KG5A 3VV2B 4JS5A 2JWNA 4JI4J 3D68A 4QW8A 4EHUA 5D3GA 3DLEB 4BC3A 3GMGA 1FXDA 3PR5B 2AP6A 2Z0GA 2ZKTA 4B9LA 5KFXA 4DZ6A 2IBOA 1URNA 1C0UB 4L73A 3BZQA 2MEWA 4K4WA 1FTRA 3TSUA 1N48A 4WFBL 2AYMA 3UDLA 2IC3B 2Y0SD 4PG5A 1UETA 4WPAA 4BRAA 1HW8A 3QAEA 2CPZA 1BWFO 4BREA 3CCLS 1LW2A 4F4XA 3NFAA 2V8GA 1T05B 2LKZA 5C12A 4DV5K 2B9EA 3SSRA 4X4RA 4NA3A 4ZITA 1YJWS 3IXQA 4RW7B 2W7PA 4NB4A 5KFOA 3BP8A 2O8BA 1N36K 3D1QA 2ZH2A 2BW7A 1BMQB 4L3KA 1X4GA 3UR3C 4FXDA 3CC2S 4CEEA 4ELVA 5KGWA 4DR3J 1UAXA 3LDOA 4FK4A 5FD1A 4CHYA 1X1PA 1R0CB 4CT9A 2C3PA 4A57A 2Q6BA 4ECUA 4FWPA 5DG9A 5AFUH 4XPEA 2QWMA 2AW0A 1CZAN 4LVOP 3TUZC 3GFXA 3CCJS 1FJCA 1NM1A 1GT8A 4NLTA 2AEMA 5IC6B 3CJ2A 3D45A 4FYYB 3KVGA 1NGGA 1J5OA 1AB8A 3A0IX 1VRUB 3R9LA 1U1OA 1U1RA 3H5SA 4IXCA 2XYPB 4O3QA 4CE9A 4F67A 4CJKA 4BDYA 3DYAA 3T3FA 2DH9A 3J81j 3RZAA 5JVGL 1PILA 3D2FB 2WAQD 2X1GA 2J76E 4ED0A 2V2QA 4F3QA 3F73A 4DV4F 5G0RA 3CJAA 2A41A 3D2EB 3H46O 3AVKA 1MWYA 4OGEA 3CIZA 2MZ1A 5F3TA 5K8OA 4AHTA 1A9NB 1DJ0A 2O8DA 3CCZA 1GTHA 4G9ZA 2O8CA 4DUZJ 1Q95G 5HO4A 2HBYB 3SAHA 2DHSA 2BV3A 3UE2A 1O0PA 1HYZA 2Y0BB 2XZDB 3M1FA 3VQTA 3CCWA 4C23A 1AUDA 4L74A 2BM0A 5J2QB 1Q79A 4CEOA 1Q7YT 3OYCA 1FJEB 3EY1A 3SSQA 3O9QA 4DV6J 1T3OA 3GYGA 1XMBA 1NSAA 4KREA 4X64K 2IJRA 4JV1A 5B0DA 3BS9A 5HMXA 3FC9A 2IIRA 3KLIA 4E3SA 1QAJA 3CF5Q 1XMOJ 4XPCA 4CWBA 5AE1A 1WTBA 3SCKE 2W2QP 4DDFA 3PRBA 3EICA 1YHQS 5L1KA 3CI5A 2KHCA 3C46A 3TJ9A 1NHKL 4NLYA 2NXJA 4OYMA 1E6YA 2IVYA 3BDEA 4E7JA 4FL9A 4MKVA 5F9LA 4KHYA 4ELTA 5B0FA 5IT9Y 5HLFA 3NWGA 2G2YA 1R31A 3ZSOA 1Q81O 2KKHA 3CIMA 2B56A 4EBDA 1RBTA 2LQ5A 3M8QB 3OW2M 2AGQA 2VYPA 3KK3B 2HMIB 4E1JA 2YWWA 2CUYA 3SPYA 5KFCA 1DEJA 5M1QA 3MAHA 4DR2F 3CFPA 4J90A 4KO0A 3MEEA 4PG7A 4RWXA 1JXLA 3MMCB 5KFBA 4PKIA 2NYHA 4DQRA 1MA9B 2K2PA 3PEHA 2COLA 2PT0A 2V69A 3K5MA 2F9DA 3CF5L 5J2NA 4DL0C 6FDRA 4BE0A 2MB0B 3BSNA 3ENQA 2E5LF 4FZVA 4IEEA 2FJVA 3TI0A 4TU8A 5HVHA 3QYYA 3SI8A 1OVYA 4WFNL 3ZZTA 4A8KA 5IWAK 3BGFA 1NGIA 5BN9A 5LJVA 3VVUA 3R5AA 3FEXB 3MTKA 1HHTP 1SJ3P 1KLNA 4OL8A 5IFMA 3OYBA 2QA2A 1X4EA 5J2QA 1IXKA 1Z2ZA 3GZ7A 4OYXA 4ILRA 1F6TA 2P9NB 4FO0A 3DGPB 3TR8A 4FJHA 4LBPA 4DFMA 1KQSR 2EXUA 2R7RA 4LSNA 2DGTA 4RL1A 1HA1A 2EEYA 2ZH9A 3ZTPA 3AHPA 3FUYA 1JNZB 3PVXA 4DU8A 3QO9B 4NXMK 1BUXA 3TTCA 2VQEF 1U2CA 1XK8A 2HRYA 4KH0B 3WBZA 1RB0A 1UWBA 1L3TA 2E5JA 1VC0A 1SIZA 5G4DA 3ISND 1X4FA 4CERA 5C0YA 4FK2A 2Q97A 4FF2A 3TOQA 3L0QA 2VQEK 2HYIB 3OXGA 3C6UA 1S0OA 3V1OA 5KGXA 3PY8A 2H3EB 1U8SA 2J9EA 3QGPA 2I7PA 3NVMA 1Q81T 1Q9XA 2ASOA 4OYWA 4EEYA 4DUZF 4CD3A 3FEZA 4AE5A 2BE2A 1HI0P 3MR3A 4C8MA 3V81A 2YWHA 4ZMMA 1SVDA 2QE5A 2PA3A 2V63A 2JRSA 5KG1A 3CXCM 2XQCA 4UUWA 1KKHA 2J6UA 3S01A 3B82A 2R2UA 4LF6J 4DN9A 4CIGA 3J7A1 1L3UA 3EGVA 1BIUA 1M0SA 3O6QA 2IA6A 3R8YA 3W7BA 4CEQA 5CABA 4GV9A 4LBHA 4FPIA 2VV5A 4A2AA 3CCMN 5T14A 2W01A 3KK2B 3THPA 3VEOA 2Y1LB 3CHWA 3SJHA 2HBZB 2F7VA 1HNZK 2OPSB 3AY9A 4DV3K 2VFUA 2W9BB 4CESA 2VHGA 1D8YA 4YY3K 4FPBA 1PC4A 1KOHA 4WQ4C 5H9EK 1QJHA 4JKBA 1S6QA 4KT0C 1L3VA 4MDBA 2IC3A 1SBRA 3KLEA 4CLFA 4NZ0A 4U7CA 1GOBA 1PYSB 1KLMA 2Z58B 1AYEA 3VAFA 1QZ5A 1ZM4A 4F02A 4ZP8A 1BDGA 1RNHA 3B8AX 4GMKA 2FJBB 2DNHA 5BXIA 3IKMA 2D74B 1CJTA 4M5DA 4JV5K 4BBYA 2LEAA 4LF4F 5EN1A 4WYLA 3DI6B 4H03B 4N7TA 4I0WA 1ZM2A 4CLLA 1P8ZA 5EUHA 4F3OA 1CXQA 3KJVA 3L2VA 4IQXA 5HN0A 1IBKF 5B0GA 2WVFA 4Y2KA 3H5XA 2OPPB 4ZKAA 1RJJA 4J37A 5DZ6A 2H3GX 2KM8C 5E3QA 4Q5VA 3EKUA 2W9CA 1LWFB 4YFUA 1JKHB 4NLXA 4JS4A 5LSOA 2NRZA 4M3XA 3POTA 4W4MA 2MQLA 5KQ8A 4IDKB 2KHDA 4CECA 4AHRA 4QJVA 3KWIA 3BSAA 4USMA 1CULA 2HW3A 4NLWA 1H7WA 3RRHA 1PGZA 2F4VK 1VQ6N 4EI2A 3LW5C 2LEPA 3W2VA 4QBUA 4PWDB 1HYSB 2BX6A 4ZA1A 1RAFB 4KKOB 4ZTJA 3TA2A 1WSEA 2FSJA 1HNXJ 1K73T 1UWAA 3AVNA 5AQPA 4JK7A 3JB9k 2W4CA 4OKJA 2HBQB 3K2YA 4NXMF 4OPJA 2ZNZA 3PM9A 2CQDA 3UVJA 1N8RT 4JHDB 1P1TA 4FPRA 3L09A 1UZHA 3I4HX 4O3OA 3TPQA 3A3PB 3TA0A 5EX5A 3IGVA 2CA9A 3T5HA 5D0HA 2I8EA 3AVCA 1X8DA 4W92B 4I9LA 4OI3A 3VEXA 1LK7A 1B0VA 4M95A 2DXFA 1E3MA 4CBWA 3JTNA 1XNRK 1VSJA 4K42A 4X65J 5F2RA 3PIOQ 4YQWA 3M8ZA 2JWLA 3X3UA 2MSTA 3DRRB 3TO8A 2W9AA 5DDQC 1KVJA 4H4KA 4EWTA 1OH5A 1LWFA 3GFYA 4JKAA 1G3OA 4JI3K 1A5VA 1SS6A 1FCAA 2VWJA 4CLZA 2YX6A 3O3LA 3R3TA 4CD1A 2XO7A 3CNQP 1TKZB 4YOTA 1DQ8A 2ZBCA 1LV5A 2ACYA 2PYJA 5K20B 3OYJA 1C0TB 3MN7A 3QGGA 1F1BB 1OSCA 4BY9C 5F9NA 4X4OA 1IBKJ 3GU0A 1RXOB 3C15A 4B3RF 3JS9A 3RGIA 4Q0BB 3NEKA 3L7PA 2XY8A 3U3GA 4ZVQB 4RUAA 3PYFA 1HLUA 2DT9A 3EVMA 4FJNA 1WOOA 2C3OA 3TVYA 3HYFA 1K9MO 4DR7J 1RBAA 4OI0A 3NMRA 1VBXA 5BPLA 3PTWA 5AQJA 3FZKA 1P90A 1VSHA 2DTUA 2NRVA 1TV6A 3KWMA 4B9QA 3VGMA 2ZQBA 1G7CB 2DYAA 3H20A 3SK3A 2YXLA 1RBUA 3KNAA 2YWEA 3QT7A 2ZOGA 2ATLA 5FLXU 2UYTA 2KW4A 2VQEJ 1RKJA 4DV1K 2BKOA 3NCPA 5M2PA 1G99A 3O3FA 1ASWA 1N8RO 3HSDA 2W2MP 5F8MA 5KG0A 1Y9OA 3ONQA 5B0AA 1KAXA 3ZZPA 3D3BJ 3HLUA 2NRHA 1EP4A 2M8HA 2RHQB 5LMUF 5L38A 1D5AA 3AA3A 2VG7A 5D77A 3DDNA 3BF1A 3KK7A 4R5PA 1RHMB 1M1KO 4DLGA 1RBRA 4Z37A 1NNEA 3THWB 1S57A 2HBKA 1HW9A 2YX7A 3VF2A 2ZH3A 3CDUA 4QS7A 2UUAJ 2E4LA 1V6HA 3QRRA 2GNKA 1U8WA 3A8JA 2GBZA 1ZETA 1FK9B 4DX8H 3GV7B 3KKRA 4FNHA 3GOIA 1JK9B 2R7XA 3AA9A 1N5SA 4FNIA 1M5PC 1S1WB 5IQQA 3FR0A 4FBUA 4DV7K 5GVQA 1CVJA 1FF2A 2DR8A 4J2AA 2JWKA 3R5JB 4CLWA 5CQGA 2LXUA 2XWYA 3NWRA 2RIJA 1W7WA 3U8XA 2KXHA 3OFHA 2MHNA 2P9PA 3H4BA 4IH7A 3JYTB 1Q78A 4P9SA 1YT3A 4LFBJ 3DGPA 5ETLA 2X1BA 2PA8D 2YKOA 3MDQA 1FWPA 1Y00A 4R5PB 3PSIA 1S9EB 2FBXA 1NK0A 2UUCF 2FHJD 2RMLA 2G2ZA 3FZ2A 2BH1A 5BR8J 5A6WA 5BRHA 4MFBB 3P1GA 1SV5B 3CCVS 1VHFA 4K4ZA 1EP4B 1WDDA 4H8KA 4BRCA 5C24A 1Y0HA 2V8VA 2D3UA 2YKNA 2D7SA 4JI3F 2J8SA 1PYOB 1DZ5A 2RD5C 3W9IA 2AJFE 3A8KA 1YIJS 4DR1J 3TTFA 1M90T 1SH0A 3ENHA 2FF3B 2FGCA 2ZUGA 2OH2A 5E5NA 3QBWA 4Z94A 1R6VA 5U47A 3C6TA 4FS2A 1XTZA 3FSYA 2JFDA 5JUMA 3KMSA 2BJDA 2BJ7A 1J5EJ 2A10A 2KRRA 2HMPA 4OZ2A 2E1RA 1CEZA 4EK2A 1ZAWA 4USVA 2HMIA 3OYIA 3PYGA 1HNVA 2QMUB 1ZZNA 4DTUA 3SCJE 3GR0A 2DIUA 5HSPA 1ATSA 3V9WA 2AYBA 4F4WA 3CD6N 3AD7C 1BWVA 3V6DA 4QIFA 3VZHA 3AA4A 3C15B 3TAEA 4XK8C 3SV4A 5CYQB 4I68A 1X31C 2QYCA 2Q2RA 4IO1A 1IV0A 1XBWA 5BREA 2EK1A 2GQCA 1MMLA 4RW4A 2FVPA 2QL9B 4RKUC 3MUMP 3K0SA 3CCJN 1F5AA 3NGZA 4YDDB 4OX9K 4MKAA 2RU3A 5D6GA 2MTLA 3PW0A 3ZSRA 1LW0B 4I2QB 3NH1A 3UIQA 4B3OA 3C0BA 3LWMA 2Q3SA 3P6YC 1Z26A 4DV7J 4M42A 4FJGA 1ACMB 2FD2A 3AXMA 2OJ3A 3ASMA 3KD5E 4KGXB 1IQTA 2NZTA 1VQKN 3CCES 4PKHA 2DY1A 3H40A 1CJUA 4YB6A 2NS1B 3H3OB 3M4XA 2ZJRQ 5KFDA 1FWLA 3CDEA 1HNIA 2O4GA 3SMPA 3UVJB 2XY7A 3OTOJ 2CQGA 1NJWA 2WONA 1Y64A 4K0KK 5CHCB 3I0RA 3LOUA 2YHWA 3ITHA 3Q24A 3DU5A 1UAWA 1UA1A 1JJ2M 3M32B 1EQ0A 2HFUA 5H9FJ 3DOMB 3KLVA 4DL5A 2UU9F 1HQ2A 1S22A 4WWSA 2JLGA 3NS7B 4LR9A 5KG4A 3KHRA 3CFRA 4NOHA 3M8RA 3LM9A 3E3XA 4DF8A 1PYTA 1R8PA 4P2MA 1BISA 2ITGA 1EARA 4IDKA 2MLZA 5EY4A 2VJVA 1NSKL 3LQVA 2CNKB 2DHXA 3IG1A 4KGKA 2GVDB 5ITHA 1MMDA 4HUFA 5E3RA 3FNNA 1EZZB 2XSJB 4WFNQ 1K8KA 1QD1A 2VDIA 4ALZA 2J7UA 2ZH6A 2OEMA 4ICLA 1HWLA 5K14B 3OD2A 3NAIA 3ZZRA 2WOMA 4DB3A 2CNOB 1LK5A 5HQ8A 2AV5A 3GJQB 1P27B 4NLSA 4KV8A 2RQ4A 4BR7A 3E9OA 3HTVA 5CY4A 4GRSA 4CH1A 4JI2K 3PW5A 2JVOA 2DEJA 4M3YA 4YOYA 4ZCIA 4HR2A 2BACA 3TZZA 4TY8B 4ZS6A 1ILYA 4LUBA 1NCLA 2BTFA 2YH1A 4I2PB 1W9HA 4ZPWR 2OPSA 2DH7A 4JI6K 1DTTA 1Q7YO 3D0HE 5E3AA 4ED2A 2RRAA 1WUAA 4WFYA 2J7KA 3BZKA 3T1YK 9RUBA 4TY8A 4ECQA 2HHSA 4F8RA 1N0VC 4KJIA 1RADB 3I31A 3QPIA 2FHJA 4DS4A 3KUEA 2K06A 1CBKA 1FRMA 3BEXA 4F4ZA 5D4LA 3P3DA 4O8UA 3RB4A 4USJC 1GQEA 1IBLF 3H5YA 4DFJA 2M7SA 3FDSA 4WCEQ 4NXNK 3SI6A 3LDPA 1RCOB 1HQEA 2GHVC 4O8KA 4IFYB 3T1HJ 4A8XA 5JS2A 1EKEA 4MLEA 1B0PA 4A59A 3CJBA 4QS8A 2EFVA 8RUCA 2C2DA 1D4XA 3FGVA 2P9UB 3SSSA 1PG5B 4ZLPA 5EDWA 2E88A 3QB0A 4FWQA 4TXSA 5IOLA 2OGUA 3MMJA 2QRRA 2VC0A 2E2PA 3IR5B 2P9CA 4A8SA 2UV8G 2Q66A 1S1TA 2FGOA 1HNXK 1UA0A 1UEUA 5M1OA 3KJQB 3K9JA 2M5YA 5JVHQ 1UJ4A 1DTQB 1BO5O 1B0TA 2EC2A 2DGWA 2V5HG 3QLHB 1YZ6A 3LDQA 3M2RA 3VQ4A 4ZVPB 1VRTA 1SL1A 3HFKA 4F36A 4CM0A 3V6JA 3ZFVA 3DOMA 3G8SA 3QEXA 1BY9A 2IVFB 3N6LA 4OLBA 1OVQA 4RZRA 3MD3A 2DNOA 4JEPA 4UOFA 4JI0K 4RW6B 4TLRA 2JJ4D 1SC3B 3CT9A 4CO5A 5J1PA 1IVZA 4AUKA 1UVKA 1NO8A 3FZHA 4KHPF 1M1HA 2DITA 4NEYA 4FZXC 3H0PA 1TL4A 2DH8A 3R6LB 2CWXA 2P9KB 2DPJA 3OS2A 1C2PA 4B3OB 4ITSA 3MHYA 3MECA 2GQ2A 2O4IA 3HM8A 2V0NA 1B9FA 1RYRA 1NM2A 4PG6A 2AEFA 1OPZA 4EBCA 4K8RA 2GIQA 4O3RA 3TQEA 5C25B 2E1MC 4YR2A 4X64F 2W2NP 5A2QU 3T5LA 3HFZB 3TJAA 4KO0B 5FPEA 1VQ8S 2FZKB 2CGLA 1JJ4A 2E6MA 4ETZA 3NG8A 3KLHA 2D1KA 4FW1A 4MK8A 4BGBA 2DNMA 3GCXP 4ANCA 4CO1A 1ZH5A 2DXDA 4C8NA 2EG2A 3CJKA 2ZVSA 4OJHA 1UZDA 5KFPA 2G8VA 3JS6A 4RU9A 2NUBA 3HSJA 2DIVA 2F8TA 2ZZTA 3RYLA 2Q0UA 3AOCA 4CFDA 4OLOA 1QAIA 2CPJA 2M0GB 5HATA 2H5EA 4IG3A 4XAKA 3VZIA 5KFHA 1BQMB 2XY5A 1URRA 4KBIA 3QATA 4TYBA 2JL9A 3EZ5A 3GJRB 1SJ4P 2W42A 1V5VA 1DQ9A 1XHXA 4FJKA 2QJ3A 1YJTA 5EWFA 1X7VA 1FKOA 1GOCA 4Y0FA 3AARA 4J9PA 2FVQA 4AD6A 6FD1A 3IFEA 4BRMA 3WEEB 5L8RC 3MCMA 3EE3A 2HVEA 4H5NA 3QSIA 3BH6B 3QT6A 3MPWA 3K5NA 3JQJA 3EYZA 2V7YA 2HNZA 2QXFA 2CQ3A 4K4SA 1Q86T 1ATNA 3T9NA 1RI7A 4Q2LA 1JJ2R 1YUWA 2DGUA 4XO0A 2H51B 3VF4A 3VAJA 5AT1B 3RWUA 2ADBA 4WQ4A 4JNEA 4NXNF 1U0HB 4UOGA 1UW4A 3ILJA 1REGX 2KRBA 3HCXA 4KH6A 4ZHRA 4I6WA 3MXHP 5KFRA 2QA1A 3VAGA 3HZEA 3BO3A 2GHPA 1TAQA 4PRFA 1NSPA 2B5JA 2HGLA 3N5FA 1Y5IB 2O1PA 4I7FA 4DUTA 5FPDA 3KHGA 2VQFF 5DDOC 2YTCA 1I39A 3CEDA 4CDIA 2VC1A 3FSXA 2YHYA 1FERA 4CJUA 1M1GA 4DLEA 2OTLN 3TAMB 1WOSA 4EUVA 4U67Q 3CJQA 4YUDA 4P2XA 3MR7A 1SC4B 3BO2A 4IOXA 3VEWA 1RAJA 3R2CJ 2YCHA 3CO0P 4U9RA 3IC1A 3MOZA 4BHQA 3CCRS 3IR6B 3IRXA 4BRIA 2FBTA 4IG0A 3U1NA 1X4BA 2XGQA 1NPKA 2V67A 3UPFA 4K4XA 4MK9A 4CGFA 2F8HA 1OY8A 4LH5A 3DXMA 4H0XB 4LIRA 3TSPA 2WUSA 5CCMA 2NLWA 4DV5F 3PHTA 3R1HA 4BRQA 2PDAA 2CPYA 1T02A 4PWUA 2UUAF 1FO1A 2D0CA 2R4FA 5JLFA 3R1XA 4M5IA 4BR9A 3EPGA 2UXCK 3OL6A 1VQ5N 2XMUA 4ZLNA 3OFGA 1WF2A 3HD1A 4DPOA 1C0UA 3VQEA 3KJNB 1TVRA 1YITN 1RAHB 4CEZA 3BYPA 3OSNA 3E2EA 1T11A 3LH2S 4P7VA 5AQVA 5HBMA 3ZZOA 3MMVA 1FJGF 1XN9A 3K5OA 1OH7A 1N88A 3VGLA 2BANB 3L3UA 2ZM6K 3DFEA 1RWKB 5KAKA 4LFBF 3BR8A 2CFXA 1KFSA 4LFAF 1IG9A 2HAFA 3KDNA 3AGKA 5AR0A 2HG4A 4ZDNA 2BOAA 4ZVGA 3CM6A 4FYXB 1VJQA 4NZ7A 1FRXA 3GBTA 2QKBA 2F7TA 2OIHA 1VR6A 3E9PA 1HD0A 2CJBA 2LU1A 1QSLA 1S6PB 1K1SA 2DFFA 5CZXA 3KLFB 2Q0RA 4J9MA 5KFKA 3CM5A 2VG6B 5MAOA 1UVLA 4JHDA 4G1IA 1MROB 3AV9A 4NYOA 4GVLA 2A40A 1ZBIA 4JAXA 4P2FA 2ZBIA 1UOCA 2G8HA 2DPNA 3LL3A 5GAHU 1LWCB 2P1JA 3HP6A 2BOPA 1L5UA 2EK6A 1N34J 3VETA 3W2VB 3DRXA 1C0FA 3N01A 5JMNA 5H1SV 3CJRA 4RNFA 3O2IA 3DXKB 4BC9A 4F3TA 2ASMA 4WTOB 2M4MA 1NBEB 2HQGA 1R8CA 4USHA 3THXA 3DLLL 3VGKA 3CC2N 1FE4A 3BSOA 3AFGA 4HI2A 4M5LA 2E8AA 4BE1A 4KHQA 2VOOA 3ZT3A 1WNEA 1TKTB 4B3SJ 2MKKA 5A8KB 4WFAQ 5HP1A 1YVFA 2CQIA 3OSPA 3KK1A 2NPFA 1KONA 1RT5B 3MEDB 1TK0A 2QI2A 3IAM9 1Q4RA 1RHQB 4FM0A 2OZMA 2BEFA 3MPVA 2R7YA 2AQ4A 4KPCA 1KVAA 5GAHP 3QJJA 2JC0A 3MN9A 2V51B 4U67L 3QEPA 1S77D 1OYEA 1TUVA 4N5SA 1QUPA 4B3TK 2V7ZA 2EWSA 2AKWB 1YZ7A 4OJ3A 3HOTA 1VQNS 1YX2A 4JI6J 5JICA 2DRDA 3T1YF 1HBNB 3NXZA 4CZJA 3SAFA 2CQ1A 3IM9A 2UUBK 4XIUA 3LGHA 3ZSWA 4WU2A 1YLXA 4X66K 2ZVIA 4AM6A 3CD6S 5DM6Q 3VR1A 3VQPA 4Q7AA 1JCFA 5AQMA 4HEA9 2NQPA 3RJMB 4JK9A 2W7AA 1BG3A 2UUCK 1JLEA 3DM2B 1DKGD 2ZFHA 4CJRA 2BJ3A 2JHEA 1RWMB 3J81Y 5EX3A 2XBPA 1RTHB 3IMXA 4TU9A 1EKSA 5M1PA 1S5ZA 1NGCA 1HWJA 2IA0A 5KT4A 2A1RA 1H2VZ 3V81B 3KHLA 3VESA 4M3ZA 4NO7A 1SJRA 5KT6A 2IVMA 3VEVA 2E2NA 4ZLLA 2VCPA 5BRDA 5K5MA 3ILIA 4CYUB 5CA5A 3C16A 1QSSA 3WNEA 1VQKS 4ZIVA 3L9ZA 1RHUB 4Z4FA 1VK8A 4MJKA 1FFWB 1C1CB 4LFAK 2ZZNA 3CMES 2BABA 2QIFA 3LP0B 3L4BC 4F2SA 4DN0A 2GJFA 3RMAA 4ZJLA 1ULRA 3DU6A 4IRDA 4ED1A 2AYEA 2ZJQQ 3W2WA 3R5BA 3FZMA 2NRXA 3EE9A 4WF9Q 1RHRB 1WC1A 1SQEA 4O0NA 2D0BA 2HZAA 2H65B 3JTOA 3H98A 5I3PA 1HBOB 2BQ3A 5A8KA 1CC8A 1NGAA 5KFVA 2DY9A 4PYDA 1T44A 5DM7L 4MQ3A 4OHYA 4ZN3A 3S9HA 4QIWD 4LQ3A 1NKBA 4KPYA 2IDEA 3MM7A 4K0KF 5E3CA 3BGRA 3M30A 1F9HA 4WIIA 3THXB 2M52A 3H90A 1RGVA 4IR9A 1YBTA 1IKXA 2BYCA 4OMFG 3BM7A 4M7YA 3TEGA 2V34A 4ZPVR 4LF5J 1LCUA 4CHOA 3HFVA 1ZM3A 1N32F 2IRYA 4JBCA 1FKOB 1QQOA 3G4SN 4LSLA 2N3OA 2W8KA 4KTWA 2ZNYA 3OTEA 4CK1A 2WSCC 5KFGA 2FIUA 1T9XA 2P8IA 2F9WA 3HM9A 2GTDA 2DNZA 1KDNA 2RU9A 3QEIA 1A7GE 5LT5A 4MKYA 3F9MA 4IG3B 3KDOA 3P31A 3KLFA 5M2UA 4CBUA 1OS5A 2HQ3A 1RA7A 3HSZA 3UKRB 2KT3A 2FJXA 3OL9A 3BQ1A 4OZ0A 1U2FA 5GAHI 1WNSA 4G1PA 3MEEB 2ASJA 1M5HA 3A5MC 1OY9A 4YHHJ 1RT4B 3P5TL 3CULA 1SJ1A 1CJVA 3QICA 4X4SA 2V4QA 4I6YA 3FZLA 4OYPA 1GX6A 4GW6A 3DGVA 2YWKA 1RDRA 3FVYA 3SUNA 1Y3KA 3FQLA 2FLLA 3CCUN 2VFRA 4ZVUB 2A1SA 4QIEA 2BANA 2LDYA 4F0HA 4IOCL 3H6EA 2NCKL 2PEHA 4K25A 2QLFB 1H98A 2J9CA 5HMZA 4YORA 4NLPA 3GJSB 4Q8EA 4KHRA 4LY7A 1GXLA 3C65A 1HNVB 1PBUA 3T1AA 1LOUA 1AROP 2G13A 5IWAF 4DR3K 3W65A 1HPMA 5E33A 4CEBA 4OI2A 5D0GA 1LQ9A 2H1YA 2I7NA 3QJLA 2XY6A 3IAS9 5B0BA 2ZM6F 2VB6A 1UCNA 2BE9B 4BRPA 5DLGA 2Z2LA 1PBAA 5AQXA 1F9EB 4J2BA 1CQNA 3VA3A 2YX4A 3IWLA 2OD4A 3A12A 5BPNA 3ZX2A 2M70A 5F3ZA 3ZZZA 2AJ4A 4JV5F 2MGZA 5B09A 1HR0F 3ZETA 4PL7A 3M2RB 3AVGA 4J7CA 1S49A 1IBMJ 5HRSA 1F5BA 2BXJA 3NS5A 2VH7A 3OYEA 3D2EA 1ZTTA 3KUHA 4GVMA 1N33F 4LF8K 3P39A 3WXMB 3PKYA 4RBVA 4Y6IA 3X1LB 2W40A 3ZSYA 3JYTA 3MM7B 4ZPTR 1GLBG 5AZJA 3OFEA 3CD7A 3OR2A 1TQLA 3DN9A 2RE1A 3MM9A 4IOAQ 4B1XB 2FF6A 3HHKA 1OH8A 2XSFA 3B6PA 4DCPB 3DOKB 3V4MA 5KFEA 4KIAA 2VL1A 3MMBA 4KQZA 4LF1A 1NJIO 1GXUA 4MTPA 3NF9A 3I96A 3GQCA 1UMJA 3ENAA 4WJBA 1RTJB 4X62J 3W2WB 2N3LA 2X1FA 1DRZA 5EVZA 4YEAA 1X5OA 4ID8A 4DEZA 5L1JA 1FEEA 3BB5A 1TL1A 1PAEX 1SC6A 2RILA 3M8PA 1RHJB 4J2EA 2KYXA 4O23A 4N41A 4FLTA 4K8ZA 2GMJA 1U26A 3AJ1A 2IY5B 2VWKA 4H4OB 4DG1A 1S6QB 5MLCQ 1VQ8N 3G86A 4CEAA 2QLXA 1MLAA 4RNOA 3HO1A 3MPYA 4CI6A 2BVZA 4J9OA 4CJPA 1D1UA 2QEXS 2OUGA 2W9BA 1NRKA 1NWKA 3PFEA 2FVRA 2FJWA 3PX4A 2IMWP 1MWKA 5LY3A 1WHWA 3MFHA 3ZNJ1 5K9FA 4LREA 3DLGB 3GG1A 4IJNA 3GV5B 5LJWA 3VF0B 4PEOA 5BPMA 2R7UA 2OZSA 4PCQA 2ZUAA 4IFVA 2F4VJ 4BC5A 4M8LA 1NK5A 1FJGJ 4ID1A 4BR5A 4MYUA 1XERA 5KFUA 1H0HB 4CZCA 3SUPA 3MMAB 3FZFA 3BR9A 1ZOTA 3H45C 3VVTA 5KRTA 3QIPA 4ETXA 5J2MB 3O4QA 1HHQA 4TN2A 4DTOA 5DRKA 2WFBA 3TNVA 4K41A 2VGNA 4H5VA 3AVAA 2A3ZA 3V9SA 1FA0A 1NGBA 1HNZJ 4MYTA 4QPTA 3KG4A 1BHNA 1MN7A 2VD3A 5C25A 4K2JA 1Z1ZA 3EWGA 3QQCD 1HI1A 3I32A 3QWUA 2WC9A 4DR1K 3TVZA 2GWJA 2D3OR 2KJVA 4LF4J 5M1KA 1VSEA 2QEXN 1YXQA 1PO6A 3QRQA 3H8YA 5BJRA 4WZQA 1JLCA 1BOTO 4FCYA 5JJBA 2NRWA 2MKIA 4LF9J 1VDHA 1JLFA 1S97A 3G8QA 4DV0K 3ENVA 1WB9A 2D1CA 2DNPA 2G1DA 2F4VF 2DPIA 3A8EA 4G1QA 5A8RA 1SKSA 2V4JA 4NLBA 1MWZA 3HHNB 4Y0WA 4Y00A 1CLQA 5KG3A 3ZTQA 2Z1IA 2H9ZA 2VFTA 3HJVA 2IM3A 1VC6A 1ZPWX 1GMUA 3UFCX 3VQ8A 1VQYA 1JLCB 3M1VB 5F0WA 2ZKUA 4H0VB 4I6MA 4WXWA 5ADXH 2OPRA 1U1KA 4ATNA 4RW4B 2YI1A 4MKBA 4FXVA 2LECA 3O4WA 2GZOA 3D1HA 1DTQA 3E1YA 4WQ5A 2E6LA 4DQPA 2Q36A 1IKWB 2O66A 1NLKL 4DPYA 1YJRA 1M5KC 5BR8K 1VQPS 4G6VB 3U4LA 3V6DB 4W98A 3QETA 3U7JA 2WBRA 3RMDA 5D4OA 3AT1B 3D6RA 3C94A 3GYXB 2ZZMA 3BSCA 4QWDA 4A8YA 3NMUA 3CCMS 3WQPA 3MFIA 1IG8A 2MQMA 4CJ3A 2HBJA 2R7OA 1ZBLA 2JDJA 3GDQA 3MR6A 1RCHA 1PJ5A 1HHSA 1JJCB 2O67A 2VWBA 4KHUA 2WVCA 4IBNA 2YWGA 3ZX3A 1R6YA 1R7IA 1VQ5S 3S3MA 5HBMB 1CJTB 1X0FA 1BCMA 4DV2K 5IV4A 4CJQA 1TVRB 4F3MA 3DRPA 3P38A 5C7PA 1X9MA 2OELA 2Y9HA 1KLMB 4H0OA 4AHVA 3O6WA 2YKNB 3DLGA 4C0OC 4N77A 1TAUA 2PBDA 4E7IA 4H54A 3MTJA 1S0VA 2B7CB 2DGQA 1HKBA 4I6AA 5AQSA 4CJFA 2D9OA 4FOEA 2LVWA 3AJ2A 1JLGB 2P6SA 1A6LA 2HHQA 2HEKA 3BPSP 4FZYA 2KLAA 5JVHL 1TFYA 5ETPA 4I2PA 2CQ2A 4FJ5A 1F0XA 4DPXA 2OFGX 5F1XA 2YY3A 1YJVA 3EXCX 3GIKA 4TQSA 3PUFA 3LGNA 4CP5A 3GG4A 3PG9A 5MLCV 3CG7A 1FHTA 4FF3A 2MZRA 1YIJN 3M8SA 4WFXA 1KAYA 1R8AA 3KXDA 3B54A 1N54B 5DQGA 3G6ES 4DBQA 1FX4A 4BRNA 4LT6A 1KS2A 2MQNA 4R8UA 3LPTA 4X84A 2RAQA 2QL5B 2XCPA 5E0OA 5F0UA 4WCEL 2L48A 3WNHA 2BA9A 2Z2ZA 1DT9A 3H5UA 2HQCA 1FK9A 2F65A 5DG7A 1UFWA 3PHEA 3SCLE 1R43A 1NHUA 4N56A 2A2DA 4M45A 3WZ0A 1CXUA 2R42A 4BWJA 1VQSA 5CZ2A 2C3MA 2YNHA 2F8EX 1VQLS 1G15A 2DO0A 3TR5A 1N34F 3PYEA 1T95A 1S12A 1FRJA 1SL0A 4DU7A 1UL3A 5KT2A 1IN0A 4A4JA 4ZVFA 5AJ3K 4J9RA 4O3SA 3QBXA 4AL6A 3EZOA 2A6AA 2YHBA 3IBWA 2UVWA 3TUPA 1B70B 2GUPA 3V9UA 2CDRB 2AJ2A 4FDFA 4M5KA 2WTUA 1KQKA 3VERA 2HBLA 4KH1B 1D9AA 2IVOA 2WB4A 4AM7A 2ZEJA 1C0MA 1U6FA 2P9EA 1W2BR 3A4TA 3DXSX 2FUG9 1HMVB 4RUHA 3K17A 4FJ9A 3IA0A 4EYHB 4GKKF 3PLAA 2VODA 2W24A 3NGDA 4QR0A 5IWAJ 4OPAA 1RACB 4J9QA 1RWWB 3QSYB 4Y2CA 1RA6A 3B4DA 1U6BA 2L9DA 3BF4A 3Q89A 3ZSQA 4R79A 4CNYA 2CJXB 3CMAS 4PXDA 1UFLA 3DHXA 4KH5A 4DSFA 4FLVA 2A5XA 2Z2YB 4F26A 2VKRA 2NNWA 2F8MA 3Q2TC 3RBZA 2IIHA 4QWCA 3K0JA 1VQ4S 1UVIA 2V2ZA 1B92A 3E01A 1QTMA 4FKXA 1SKWA 2CJ9A 5AXNA 1RT4A 5KPZA 3G6YA 4QU7A 3VQSA 1HR0K 1WWHA 2V9WA 3M2UA 3AOBA 1K8AT 3CCSN 1VGYA 3RAXA 3EO3A 3QT5A 1EWRA 1IBMK 3A1YG 3HSGA 3NKYA 1SL2A 5K8NA 1TL7A 1ZBSA 1WHXA 4ILGB 2MXYA 3TA1A 2EBEA 1X4HA 5E2QA 1A0OB 3TWHA 2IAJA 5AXLA 3EJMA 5KFLA 1ITGA 4PQAA 2EFGA 4ZCLA 2HKEA 1X5SA 5IZHA 1S48A 2FDNA 1QQMA 1CSJA 1SUQA 4LSLB 4DQIA 1IWAA 3A5NC 3IR7B 2JC1A 3FJ2A 4KKOA 2POKA 4A2BA 4LF8J 2CH6A 5SUHA 4UQGA 1RWVB 2YKAA 1ITPA 1AFJA 5A8RB 3QNOA 5LXRA 4CIEA 3OXLA 4U7BA 4RBTA 2QA4G 1P9QC 4DQ8A 3M9NB 1IJEB 4DSKA 1E6VB 1Y10A 2E1YA 5FDLB 1HLWA 2FY8A 3LP3A 2BJEA 2W9CB 4XDCA 4A8MP 1RSCA 1MN9A 2EX3A 5B08A 4E7KA 4KTZA 4X4UA 5ETMA 1PAUB 1VRTB 4DKWA 3U02A 4RW9B 1WBDA 4AHUA 1I3OB 3ETMA 5GMKa 4DV4J 4XTTA 4BACA 3W9JA 3DWLA 1FXXA 3JSMA 4ZIWA 1NG9A 1YQHA 4R0JA 2P9GA 2DCUB 2PI5A 4NCGB 1Q82T 4B1WB 4JI1K 3QMLA 1Z2LA 2V4RA 4D3GA 2H4YB 5I4MA 4Y2IA 3F2KA 4BGAA 4HDGA 1C1CA 3DYAB 4WKRA 2NXUA 4DV3J 2RT3A 5C42A 3C16B 5JMVA 3OL7A 2KQ2A 4V19J 2FLPA 2OPQB 2LCWA 4HT5A 3MMAA 4NXNJ 2ZITA 3GE1A 4RTFD 2BQUA 2MZSA 2RE2A 2ZBPA 1KN6A 2GCFA 1KR4A 1ZAVA 3SBMA 3OPKA 3AAPA 5LJ5Y 3D9BA 1XC9A 2R9LA 2OFHX 3LAMA 2FJDB 1DAXA 3U9DA 5E84A 1UEKA 3L2RA 2KJWA 3LAKA 3D6TB 3OA9A 1UKUA 2DY4A 1KAZA 1JLEB 3DM2A 4JI8F 3H4DA 2V94A 2G1HA 2WRMA 3MZIA