3BGRA

Crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with tmc278 (rilpivirine), a non-nucleoside rt inhibitor
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of HIV-1 reverse transcriptase/TMC278 complexes: Strategic flexibility explains potency against resistance mutations.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase, hydrolase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 158
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3bgrA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bgrA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bgrA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bgrA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3bgrA05
3ZT3A 3VQSA 4FLWA 2ITGA 3FRZA 1LAVA 1JXEA 4FK2A 4GC6A 4LSNA 1TVRB 1VSMA 4LY7A 4IH6A 3DRRA 4CJWA 3I0RB 1TKXB 1TKDA 4KB1A 1TKZB 4LSLA 3MAQA 5F8GA 4AHVA 1YVUA 4ICLB 2ZQBA 3M8QA 3DOKB 1KSPA 5F8NA 3OJUA 4CJPA 4RW7B 3E01B 1S1VA 4J9LA 3RMBA 3QINA 3OY9A 4OKEA 4DTNA 3OS1A 2JEJA 3DLRA 1CSJA 2HHUA 3JSMA 4N47A 4CJUA 1R0AB 4CFAA 4Y34A 5DMRA 2XI3A 4YFUA 4CJKA 3C6UB 2YKNA 3FDSA 4KAZA 2IM1A 5J2NB 5SZTA 3VQ7A 4ZHRA 4I9LA 3OJSA 4F3TA 3CJ2A 3QYYA 2E6LA 2KZZA 3TAEA 2Q3SA 1TVRA 3JYTA 4KKOA 3RB3A 5J1EB 2HMIB 3AVNA 3CFPA 4HUFA 1HQEB 3ZSOA 3NKYA 5KFJA 1MMLA 1REVA 1NJYA 2GC8A 4FJXA 1RTJB 4BDZA 4RNOA 4EZ6A 2HAIA 1QAIA 3BR9A 5KFTA 5FROA 4DQRA 3AV9A 4EZ9A 4FK0A 5KFYA 4O4RA 3NH0A 4E7LA 3KK2A 2ILYA 3VQEA 3AO5A 3MEDB 4EYHB 3VQAA 3S3NA 3CM5A 4WE1A 1EP4B 1TK0A 5L1KA 1RYSA 1S1WB 4HKQA 3LAMA 1D5AA 1ZTWA 3KLVA 4KBIA 3ITHB 4NLPA 3NAHA 3DRPB 5KFFA 1WLJA 3G10A 1QSLA 1T03A 1T94A 1TL3B 3PX4A 3RB6A 4DFJA 3SUOA 4M3UA 2FVCA 5KT5A 4RNHA 1S9GB 3MR5A 3NGYA 3MEGB 4CJEA 4IDKA 4R0EA 2BDPA 1S1TB 4Z4FA 3V6HA 4NLXA 3JYTB 4TYBA 2D0CA 3PO4A 4QOZB 2CJQA 1J54A 3N6MA 3PVXA 3PW0A 4RW8A 2B6AB 4E3SA 4FLYA 2YNIB 4LQ3A 3L2UA 1LWCA 3RAQA 3L2WA 4F4YA 2EC0A 1D8YA 4FM1A 1TKZA 3OYGA 1GOBA 3OLAA 5KFZA 2VG7B 1RTDB 4NLVA 3P83D 3M8RA 2D7SA 5F9NA 1IKVB 2FVPA 1RBRA 1S10A 4KB7A 3O4NA 3THVA 5I3UB 3TI0A 4RW4A 3HXMA 4RW4B 4NLOA 2AGPA 2FC0A 1RBTA 2YNFB 3AVCA 3HM9A 4WXOA 4I7FA 3NE6A 1S0MA 4DTJA 4FS1A 4LD0A 3G86A 3ASMA 1T05B 4J9QA 4DQPA 2FBVA 4ED8A 4E7KA 3DRSB 3CDWA 3DOLA 1S97A 3CQ8A 3ZSRA 2ZE2A 2BGGA 1HNIA 4RNNA 2VG5A 3QEVA 1I3AA 2B4JA 5KFNA 4F4ZA 4ELVA 4OPJA 4CF8A 4OKKA 3GIMA 4GW6A 1JIHA 3BQ0A 1VSDA 3BDPA 1GX6A 3PJWA 3V9UA 1RT3A 1FKPB 4KHSA 1C0MA 1KLMA 4DL7A 4U6PA 2E9ZA 5DG9A 3MEGA 1L3VA 5KFHA 4UQGA 3CFRA 3KK2B 1S1VB 4Y2CA 4YR3A 3H4DA 1RT6A 1LW2A 4ID5B 1C1CB 2V4RA 1JLFA 3LP1A 4MIAA 3UIQA 2HHSA 4RU9A 1HYVA 4CCHA 4QWCA 3DLKA 4H4OA 3RMDA 3PX6A 4CJTA 1HMVA 3BSNA 2ZD1A 4QPXA 2UUWA 3QIPA 5F8HA 3WNGA 2YKNB 2OZSA 4PUOB 1VK0A 4CJ5A 3LZIA 4KAIA 4CEZA 3LP1B 4G1QA 3PW7A 2IJFA 1EETB 3OYKA 1KRPA 3KLHB 3RMAA 1VSEA 1REVB 2W9BA 1UAXA 2Z1GA 1S4FA 1HRHA 1WN7A 3T1AA 5E41A 4O44B 3HP6A 2RF2A 3OLBA 2IM3A 5C25B 4AHSA 4ZVHA 5C25A 2WOMA 1S48A 3OHBA 2W9AA 5EUHA 2QE5A 3ZSQA 3D0PA 4CGJA 4ZMMA 2RN2A 4W5NA 3LZJA 1BI4B 4ECQA 2HHQA 4WYLA 4XPEA 3RB4A 2KQ2A 2JLEA 5DG7A 3DOLB 1QSSA 4AHUA 4QW9A 1QHTA 3ISND 3PV8A 3O3HA 4FS2A 4HVJA 5K14A 5KGXA 2IC3B 5HROA 3HVTB 5EU7A 1ZBUA 2VA2A 1JLAA 1UA0A 4Q43A 3CJ3A 1S1XB 3BSAA 1A5VA 4BE1A 1U4BA 4FM0A 3KKRA 3SPYA 2BANB 4TLRA 1NKCA 3DM2A 4YR2A 5CY4A 3RMCA 1VSFA 1HQEA 1GOCA 4FJ8A 3ZSZA 3M9MB 4PUOA 4BDYA 3N6NA 3QIDA 2DPIA 5I42B 4KE5A 3K57A 4B3OB 3V6DA 4B3OA 4DTSA 4RUCA 1RCHA 3IRXB 3QZ8A 4IRDA 3TANA 1WNSA 3VQ9A 4NRUA 4CHZA 1WAJA 2HNYB 4ED2A 2V9WA 4NCGB 1HYSA 3OVNA 1HNVB 1BI4A 5KG1A 1QTMA 2KTQA 3D45A 4FYDA 5HP1A 3SI6A 1IKWB 4DL4A 1JKHB 3GYNA 3DI6B 3KLGB 3T19A 5KRSA 3AVJA 4RUAA 4K4SA 3MXJA 1N56A 4FJHA 4F2SA 3V6JA 4CK3A 3CM6A 1RDDA 2ILZA 2VG6A 4R8UB 2GBZA 3TARA 1L3UA 3V6KA 4Q45A 1BGXT 1TGOA 3UR0A 4RW6B 1RT6B 4KB0A 1HQUA 4J2EA 1K6YA 3FSIA 1Q9YA 5J2PB 3QETA 2BQ3A 4CGHA 1NKBA 1LWEA 1DLOA 1RTHB 3SV3A 1U48A 1HPZB 1LWCB 3KMSA 4NLRA 4IKFA 2WHOA 4Q5VA 5CZ1A 4JRPA 3C6TB 5KFIA 3AVHA 1X9SA 4OPKA 1N5YB 1X9MA 4M95A 3U3GA 1A5WA 3CO9A 3PUFA 3TAGA 4FVMA 5KFKA 1IKVA 1ZTTA 1TKTB 1DLOB 3AO4A 2HMIA 4O3QA 1WNEA 1RTHA 4FBTA 3DMJA 4ED3A 3NGZA 1W9HA 1T7PA 3CIZA 1EKEA 2PZSA 5I42A 3SUPA 4MKBA 4F50A 3HYFA 3M8PB 2ASJA 5KG5A 3DLBA 1ZYQA 2C2RA 4ZVGA 1NHVA 2BR0A 3HK2A 4DS5A 1KTQA 3ALYA 5KI6A 3OL8A 2DPJA 4DS4A 2IMWP 1XHXA 2E6MA 4PQUA 4DEZA 3M8SA 2G8KA 4IDKB 3DI6A 3KLGA 4K4VA 2QKBA 1LWFA 3P5JA 2WCXA 1NHUA 1BQMB 3SCXA 2XGQA 2DFHA 3M8QB 4CGIA 4K4YA 3KK3B 2IAJB 2R8KA 1S6PA 3CDUA 3V1QA 4IQXA 3NH1A 2CKWA 5KFEA 3N6LA 4CEBA 1ZBHA 5KG7A 3UQSA 4B9TA 1NJWA 5J2NA 3DLGA 4CJSA 4TY8B 4OVLA 4OGCA 4WFYA 3RAXA 1KFDA 3T5LA 4FM2A 3MF5A 3P1GA 3SQ4A 3AVFA 3SZ2A 2R8JA 1C1CA 4OJRA 3HVAA 4TXSA 4JS5A 4DFPA 3TVKA 1HNVA 4ID1A 5KFOA 4CHPA 3MR2A 3LPUA 3OYAA 4IG3A 3H08A 1I39A 3NF6A 4TY8A 1EXQA 4F2RA 3QGHA 1BIZA 4F4KA 4ECUA 1K1QA 4J2BA 1TK8A 1LAWA 2DFFA 3AVBA 2O4IA 3VA3A 1HQUB 4DL6A 4ECXA 4ZP8A 3RWUA 4N5SA 1EETA 1RTIA 2R8IA 4ZP6A 1HNIB 3OSNA 4RNMA 4NCAA 2ZKUA 3KK3A 4LH5A 4NYNA 3VQ4A 3VQ5A 1SV5B 1J53A 3NAEA 4IRCA 4KREA 4QAGA 1C1BA 4IFVB 2JC1A 3CJ4A 2EX3A 4CF1A 3OYIA 3KLEA 2DTUA 1TAUA 3OYBA 4HUEA 3DM2B 4WZMA 1U47A 1JX4A 3NCIA 3I0SA 5JS2A 2OPRA 4FW2A 3IGVA 1BQMA 3GILA 1JLCB 2C2EA 3SFUA 4O3RA 3NF7A 3TR8A 1NOZA 3AVGA 2IBKA 5KFUA 3V81A 1UWBA 3MFIA 4GC7A 4JRQA 4ELTA 1I6JA 3O4QA 3PY8A 4FW1A 4KV8A 1NOYA 2F8SA 1DTTB 2AWZA 2FLPA 3BGRB 4J9SA 1SKSA 3RB0A 3E01A 4B9SA 2BANA 3OYCA 4ECRA 1XWLA 3GIJA 4DWIA 3BSCA 3ULDA 3ZSXA 4J9KA 4N41A 4IH5A 1B9FA 3QGIA 4IR1A 3L3UA 3OYJA 4KTZA 3HVTA 3CYMA 1JXLA 1NK5A 4I7FB 3FFIA 3PR5B 5KT6A 1UA1A 3DDKA 4DTUA 1L3SA 1IKWA 1KCFA 4DU3A 4YNQA 3TAQA 4BWMA 4NRTA 4H54A 4L8RB 2QV6A 3SPZA 1SH2A 2VG6B 4R8UA 1N6QA 5J2MA 4O4GB 4DL3A 5HLFA 1KVBA 4JUZA 3V9XA 1O1WA 4Z4CA 1U49A 3MEEA 4CHOA 1JLBA 2Z1HA 3UDLA 5L1LA 4CFDA 4E0DA 4IFYB 5KFDA 3DLHA 3HO1A 4KO0B 3OYFA 1RDRA 3U3YA 2E9RX 3AO3A 3I5CA 3HPGA 4M3YA 4M94A 4DQSA 2ASDA 1HJRA 4LH4A 3Q8QB 2ALZA 4W5TA 2YV0X 4C8OA 4ZP9A 4ZPBA 2YNHB 2QXFA 1CZ9A 2VG7A 5L1JA 5L1IA 3AO2A 1RYRA 4KFBA 2KZMA 1RT5B 4CHQA 3KHGA 3NBPB 5KRTA 1NK0A 1S6QB 4CHNA 2HWIA 5C42A 3LP3A 4DG1B 4FJJA 4FJGA 4ZPCA 4CJVA 3V6DB 3H4BA 1C0TA 4I2QB 2WTFA 3L3VA 4YQWA 4FLUA 2OYQA 3GV5B 4CEQA 3LALA 1C6VA 4JV0A 4CJ3A 3QZ7A 4M3RA 3OSPA 4NLUA 4DMNA 4ED7A 4Q8EA 3MR6A 4FJLA 2YKMA 4JLHA 4PY5A 4DSLA 4CJLA 3I0SB 3DRSA 4ED0A 3TWHA 4FLZA 3SFGA 2HHTA 3IGNA 2VA3A 4WXWA 1MU2A 2IM2A 4E7HA 4MKAA 1J9AA 3K5LA 3MXMA 2BE2B 5J2QA 2BRKA 1S0OA 1S49A 2UVWA 3MEDA 1GX5A 2FLLA 4ZPAA 2WONA 1T8EA 3BREA 1S1XA 1YTAA 3QLHB 4WYWA 1JL2A 5CYMA 1KFSA 2HNDB 5F8LA 4TYAA 2R2RA 4G1QB 1RTIB 1NK4A 4NLGA 4TQRA 3ISNC 2G8UA 3H5YA 4DL2A 4DQIA 4FLTA 3T5KA 4HCBA 4H8KA 5K14B 1QAJA 3LP2B 3DLGB 2P1JA 2AGOA 5KG2A 1RT1A 3NF9A 1KLNA 4CGDA 1VSHA 4H4MB 4DFMA 4CHYA 3KLFA 1RT7B 1HMVB 2BRLA 3G0ZA 5KG0A 3ZCMA 4ECVA 1A5XA 2D0BA 4FCYA 5CYQB 4CIGA 5EWFA 4FXDA 1DTQB 3KLHA 2FVQA 3KOAA 5EDWA 3K5MA 2Y1JA 2RF2B 3LPTA 5J1EA 4U7CA 1MU2B 4DTXA 4I2PA 5DK5A 5HLFB 1C0TB 4HCCA 3ZT4A 1SV5A 2XO7A 3MR3A 3AA4A 1SUQA 2X78A 4ICLA 1KVAA 3DOKA 2IGIA 1L3TA 1CXQA 1OS5A 2OA8A 3DRPA 3KKSA 2RDIA 3CG7A 2W8LA 3LP2A 3HT3A 3V9WA 2D0AA 3WNEA 4CK1A 2OPPA 4FK4A 4URSA 2IAJA 4EBCA 4FZYA 1QS4A 3TAPA 2OPRB 3RR7A 1U45A 4OGEA 4EBDA 4AHTA 3RTVA 3C6TA 3RR8A 1TAQA 4BE0A 2GIQA 1RT4A 3FFIB 1BQNB 1RAJA 4Y2AA 3NL0A 3L2VA 4R5PA 1ZBLA 2G8WA 4R5PB 1S1TA 2RKIB 3DLEA 3QO9B 2P5GA 3CJ5A 4KKOB 4CEAA 5J2MB 4FJNA 4RG8A 3TAFA 3DMJB 2XCAA 3F73A 1BCMA 3KD5E 3KJVB 1RA6A 1D9FA 5KFCA 3PR4A 4CIFA 4K8XA 2X74A 2GV9A 3M8PA 3E51A 4FZZA 4M3XA 3T5JA 4KO0A 1W25A 4PWDA 3K2PA 3AVKA 4C8KA 1J5OB 3D28A 5C5JA 3VQ6A 4URGA 4RZRA 4AHRA 4PQUB 1JKHA 2WRMA 2Z1JA 4CFCA 3KD1E 1IKXB 3IG1B 3NFAA 1D9DA 3AVAA 2FBTA 2FJVA 3C94A 1QQCA 2HVIA 4DSFA 4M41A 4K4XA 3PW5A 2ATLA 4Q8FA 1RT5A 4O5BA 2XRIA 3VA0A 3KLFB 1XI1A 1NK8A 2HHWA 1QUVA 1HARA 2HB5A 2XHBA 1VRUA 1SKWA 1TL1B 2OPQA 2FBXA 2LSNA 2B5JA 5C24B 5FRNA 3I5AA 4K4ZA 2W42A 4CFBA 4HTUA 3H2LA 1C0UB 1XR7A 5I3UA 2AX1A 1U04A 1RNHA 4WFXA 3SJJA 1S5JA 3B6PA 1WSFA 1SKRA 2C22A 4O55A 1DTTA 1XHZA 1KLMB 4HYKA 1RTDA 5KFAA 3V9SA 2HWHA 4ZHRB 1S1WA 1Y97A 2DFEA 2HNDA 3VQ8A 3PJXA 1BCOA 1C2PA 4DTPA 2R2UA 2G8IA 3AA5X 3ZSWA 2V0NA 3VQCA 3HJFA 1JL1A 4QCLA 4O3PA 3MTKA 1YTUA 1U09A 2RPIA 3HPHA 4DSEA 4LQ9A 2I1RA 3KJVA 5KT7A 3OL9A 2UVRA 1CXUA 3EPIA 4H4MA 4KTQA 3MECA 5JXSA 3AVLA 1Q9XA 4Z4IA 4EP4A 4OLBA 4CK2A 4K8ZA 2ZD1B 3S3OA 1EX4A 4ECYA 1VSJA 3AVIA 1RT2A 2W7PA 1TKTA 4CGGA 2O5DA 1ASWA 1Z25A 4TQSA 3HKWA 1SH3A 1FK9B 4ZPDA 2JEGA 1XR5A 4M3WA 5HP1B 3HVWA 4Q44A 4X2BA 5JS1A 2IOCA 3Q8RB 1LV5A 3QEPA 1LWFB 3CVKA 5F9LA 4HHTA 1TKXA 4KHMA 1RTJA 5SWMA 2J6TA 2BE2A 1JLBB 4DF4A 4DL5A 4NYZA 4B8CA 2HNZA 1FKPA 1RT3B 3CJ0A 5EWEA 4EO8A 3MXIA 4E89A 4EEYA 4QWDA 3TAMA 3U6FA 4ZVFA 1FKOA 1RDBA 4W5RA 1QE1A 2IA6A 4O0IA 4ID5A 1LW2B 5CZ2A 1JLFB 2OH2A 2HVHA 3PZPA 2RDJA 2XC9A 2G8VA 4MQ3A 3KHRA 3SUNA 4IG0B 2XGPA 3HVRA 4M3TA 4KTWA 4MFBA 3EZ5A 1IH7A 4W5OA 1N48A 4J9MA 4CGFA 3QIPB 4B08A 3QNOA 3AO1A 2YNFA 3NGIA 4DTRA 5F8MA 3PW2A 3DYAA 4DLGA 4CESA 2QK9A 2AX0A 3LDSA 4DSJA 2VG5B 1TL3A 3B6OA 2AJQA 4Z0UA 5C24A 2IDOA 2DY4A 4FLVA 1ZETA 3GV7B 1JLGA 1WSJA 1XC9A 1S1UB 4EBEA 2ETJA 4RW9A 1N6QB 3KK1A 3HL8A 4AHCA 1YT3A 1BQNA 3ZT1A 4DSIA 3M9OB 5T14A 4NLTA 1RDCA 3C95A 4IFYA 3IS9B 1C1AA 5T7BA 1NK9A 3KLEB 4C8NA 3H5UA 4NLDA 2W8KA 2AGQA 2O4GA 4E7JA 4O0JA 4FJIA 3M9NB 2OPSB 2ASLA 4K4TA 4KV8B 4C8LA 3MEEB 2HHVA 2D3UA 3KHHA 3I8DA 3V4IB 4E1MA 3V81B 3ICLA 1XR6A 3MECB 4KRFA 4H4OB 1JLQB 4DU4A 4J9PA 1BIUA 2F96A 2G8FA 1NK6A 1HYSB 1NJXA 4ED6A 3QEWA 1UOCA 4DSKA 1B92A 3G6VA 1B9DA 4FJ7A 1D0EA 5KT4A 1RT1B 5D3GB 2RKIA 4NZ0A 5KFSA 2ATQA 2FLNA 4TN2A 3OYEA 1G15A 2WOMB 3WNFA 1UWBB 2R8HA 4RW9B 3A2FA 3OYHA 4MIBA 2W9BB 1BHLA 3KLIA 2FJWA 1SL2A 1HYZA 4B9MA 4ECZA 2FJXA 1S6QA 3VQQA 2XY8A 4Y1DA 4GMJB 1S9FA 4EP5A 2HW3A 2B6AA 2BQRA 1GOAA 3Q8PB 2D41A 1FKOB 2EHGA 1IKYA 3FQLA 2YNGA 5KFXA 2KW4A 4XIUA 3OS2A 3RBDA 1VSKA 1YVFA 1JLGB 3O3FA 3ZSYA 3DLKB 3KNAA 4K4UA 4IG0A 4IG3B 1RBVA 5HRRA 4ECTA 4FZXC 1FXXA 4RW7A 3NHGA 3OYMA 3NGDA 2JEIA 1RBSA 4CJFA 4NLYA 3QESA 2F8TA 2FBYA 3V1OA 1JLAB 1IM4A 1ZBFA 4CECA 2B5JB 1RA7A 1C1BB 3RRGA 3ITHA 3MFHA 1LWEB 3SI8A 2W9CA 1JXBA 1SH0A 2NUBA 5DLFA 4CF2A 1WSEA 5KG4A 1ZBIA 4BACA 3T5HA 4ED1A 4J2DA 3ZT0A 4KHUA 3RRHA 4OL8A 1Q8IA 2UVVA 3FQKA 4EYIB 1TL1A 4B9NA 1T05A 3NAIA 4KPYA 3KTQA 2YNGB 2A1RA 3OL7A 4I2QA 5FDLB 2G8HA 5FDLA 5D3GA 2R2TA 5HRPA 4CIEA 2YHBA 3K5NA 4ZTFA 1C0UA 2IJNA 2KFNA 2I5JB 1VSIA 1QSYA 2JGUA 4IOBA 3SV4A 3K5OA 5CYQA 2GIRA 2Z1IA 4M42A 1WSHA 3V9ZA 4IKAA 2AQ4A 2BQUA 2W7OA 1W0HA 4AILC 5DGAA 1NKEA 2VWJA 3TAMB 4JV1A 4MH8A 4DFKA 4KHQA 5KTQA 3EYZA 3H98A 1Z26A 1BL3A 3L2RA 2OPSA 4RNFA 4BDPA 4Z4GA 2JC0A 4Y3CA 5DQGA 4TSXA 2XCPA 3I5BA 3Q8SB 1S9EB 2IM0A 3T3FA 2PY5A 4KHYA 4FJMA 4NYFA 1N5YA 3NDKA 2WB4A 4MK9A 4BE2A 4NLQA 3KLIB 4O3OA 3VN5A 2GUIA 4FLXA 1S0NA 3K59A 4ECWA 2KFZA 3BQ1A 3VQBA 2OPQB 3QEXA 1VRTA 3BQ2A 1TP7A 3L2QA 4KI4A 4DU1A 3S9HA 4DF8A 4LSNB 1S1UA 4CJQA 3OYDA 4O3SA 2P51A 3OYLA 3SQ0A 4F3OA 2PYLA 3LP0B 3LP0A 4YMEA 5HBMA 1SUQB 3PHEA 1RT7A 4JV2A 1RBUA 5KFQA 1CZBA 5FRMA 4FJ9A 3K58A 3QGGA 3DLEB 3QO9A 3OL6A 4DQQA 2XY5A 3OS0A 3D5MA 4N56A 4WE1B 1IKYB 5KFWA 4CEEA 1J5OA 2IS3A 4CERA 4Q0BB 4F4XA 5CYMB 2D3ZA 4QW8A 3GQCA 4J9NA 1ITGA 1IKXA 3IG1A 2R8GA 4K4WA 1RILA 2I5JA 4K50A 4YR0A 5J2QB 1JLEB 4KFBB 3QERA 4NCGA 4Z4HA 1RT2B 4EO6A 1L5UA 4E1NA 1D1UA 3KK1B 1S9GA 4KHWA 3HHKA 5J2PA 4FBUA 4CF9A 3OYNA 5KFVA 4KHRA 4MK7A 1KVCA 3G6YA 1F21A 3CWJA 1BISA 4FJ5A 3S3MA 3IS9A 4M3ZA 4KSEB 1JLCA 4ZVEA 4GVMA 4ZP7A 1CLQA 4RW8B 4DTMA 4J9RA 2VWKA 3V4IA 4I2PB 3PX0A 3IN5A 4W5QA 4NCBA 4IFVA 1SL0A 3GIIA 2F8EX 5HROB 1KHVA 4J9OA 1TK5A 2C2DA 5KG3A 1ASUA 4NLWA 1RT4B 3GV8B 3SNNA 2WK4A 3QLHA 3ZT2A 4DTOA 4DG1A 1Z4UA 4J2AA 2FVRA 3KHLA 5KFGA 1RDAA 3CFOA 2IC3A 2HNYA 3JSMB 5KT2A 3NMAA 2J6SA 1IG9A 4F8RA 1EP4A 3OHAA 3H40A 3PO5A 2XY7A 4WFZA 2Y1IA 1TV6B 3BJYA 4FJKA 4YP3A 1JLEA 2R2SA 5KFRA 2YKMB 4IRKA 4TY9A 5DQIA 3IAYA 2X6SA 1K1SA 2XWYA 2D5RA 5JUMA 2PYJA 1FK9A 3H5SA 3BSOA 3O3GA 1S9EA 1T3NA 3RBEA 4F4WA 3SQ1A 3VQDA 3EPGA 1TV6A 3I0RA 3LANA 3V1RA 4CF0A 2B43A 5KFBA 2UUTA 1NJZA 1KHWA 4QWEA 1X9WA 5L9XA 1VRUB 5HRSA 1NK7A 2YHAA 2HNZB 3HP9A 4CEFA 1NNDA 4B9UA 3SQ2A 5KFLA 5KGWA 4M45A 4QWBA 4CEOA 1WAFA 1SL1A 2XY6A 1T03B 4HUGA 2R7YA 4CJ4A 4Q0BA 3AA2A 1X1PA 2AU0A 3LWMA 4IH7A 3TQ1A 2YNHA 4B8AB 4KHNA 2W9CB 4QWAA 3ZSVA 5F8JA 4MFBB 3GIKA 2X6NA 5DLGA 4XO0A 4DLEA 4NLSA 5KG6A 4MK8A 4ELUA 3NBPA 2XI2A 4IBNA 5C42B 3HSTB 3WNHA 1N4LA 4CE9A 4KI6A 2ZE2B 4ZTJA 4URQU 3VQPA 5EWGA 3QNNA 4Y1CA 1WSIA 4E7IA 3DRRB 3IRXA 4B9VA 3AVMA 2P5OA 1ASVA 2QKKA 2A1SA 4OKJA 3F9KA 1S6PB 3LAKA 1IO2A 4G3IA 1LW0A 3CDEA 2UVUA 2WONB 5F8IA 2J6UA 3BGRA 3AA3A 4LSLB 3TABA 2V4QA 4CJRA 4Z4EA 4B9LA 4AH9A 2OPPB 4XPCA 3L8BA 5KFPA 3LWLA 3G6XA 4E19A 2OZMA 5KT3A 1WSGA 3NH2A 3QEIA 4PWDB 5DGBA 5HBMB 1LW0B 2E4LA 3C6UA 4RW6A 1QE1B 1JLQA 4OLAA 5KFMA 4WZQA 3PW4A 2JEFA 4PA1A 4C8MA 3KMQA 2C28A 3EZUA 3SUQA 3DYAB 2FVSA 1R0AA 4CEDA 3H5XA 4ECSA 1VRTB 1HPZA 3NF8A 4N76A 2HHXA 1TQLA 3QIOA 3UPFA 4O44A 5DG8A 1VSLA 3KIOA 4BWJA 2E9TA 2YNIA 4JS4A 4O4GA 5DQHA 3HPOA 5HRNA 4O3NA 4I9QA 3H59A 3SYZA 3EY1A 4IR9A 1DTQA
chains in the Genus database with same CATH superfamily
3VQSA 2J0QD 1X31C 2ITGA 1LAVA 2DXDA 4CZMA 1XMQK 1VQ6N 4GC6A 5THWA 3ZFVA 4LSNA 3WQPA 2DNKA 1TKXB 4LSLA 2OLWA 5F8GA 2DJWA 1YVUA 2AYBA 1I5OB 2ZQBA 2H5IB 1KSPA 5F8NA 1Z2LA 4QIGA 4HEA9 3RMBA 2V2KA 4ZKAA 4Y0WA 3OS1A 2JEJA 3DLRA 1LXJA 2KRRA 4P74A 5B0AA 3JSMA 4ZCKA 4N47A 2IIRA 1R0BG 1VIOA 2WC9A 2I6WA 3DU5A 2XI3A 1W26A 1IBKF 1HBNA 1N52B 3Q8YA 4C9DA 3H46O 4KAZA 2IM1A 5J2NB 1ZXOA 5SZTA 3OJSA 3CJ2A 4USVA 2Q3SA 2CPYA 4Z7CA 3JYTA 4KKOA 3RB3A 3AVNA 4HUFA 2OP5A 2E1CA 3KXDA 3NKYA 1REVA 2VFUA 3T9NA 4RNOA 4EZ6A 1J5EF 2HAIA 2DR7A 4EAHD 2XHWA 5KFYA 4DR2K 5E3RA 1Q7YO 1OO0B 2CVIA 2Y8WA 1RWMB 3W2VA 4TU8A 4AL5A 3VQAA 1RU1A 4OI4A 2DNNA 1ATNA 4HKQA 3UKUB 3R9PA 2W6LA 5KFFA 1FJGJ 2O8BB 3TUPA 2H4WB 1RWXB 5HI7A 4DFJA 3SUOA 4M3UA 4YHHF 4QR0A 4RNHA 5A6WA 2PC6A 2D0PA 1WC3A 3NGYA 4LF7F 4CJEA 3P5BP 4IDKA 1S7HA 1DQ8A 2CQDA 4NLXA 3JYTB 3BDEA 4TYBA 3CCRS 2CJQA 1RAFB 1VQNS 2JH3A 2RNEA 1KTVA 3N6MA 4LJMA 2MGZB 1VQKS 3PW0A 4MMOA 4FLYA 4OJHA 2HS4A 2HBYB 3HHLA 2LKZA 3ZZ0A 1TKZA 4DR1F 4RWWA 1GOBA 4YN3B 4GKKK 1FFWB 3NCPA 4LMZA 2VG7B 4O8UA 4JKGA 1T95A 3RRKA 1CJVA 2D7SA 5F9NA 3OFHA 3CMAN 3CO0P 3K5PA 3CJSA 1HKBA 4KB7A 2RHSB 3THVA 3TI0A 3Q8VA 2AGPA 2QFJA 2XMTA 2V69A 5E5NA 3MM9B 4K25A 4WXOA 1TZ0A 4I7FA 1E6VA 3VEYA 2KXNB 1BO5O 1HLWA 2MQ8A 2Q6CA 1T05B 3QWPA 4J9QA 2MDAA 3N4PA 4OJGA 5ETPA 3R1LA 4ED8A 3DDNA 2QLBB 2O8DA 4CO0A 4CO2A 2DYAA 3ZSRA 2ZE2A 2C3MA 3M2VA 2WFBA 4RNNA 5BRDA 2B4JA 5KFNA 4J7CA 1SKUB 4F4ZA 2QWMA 1EKSA 1NZAA 4OPJA 5JVHL 5DO2A 2E7VA 4CF8A 4B1YB 2CFXA 3BQ0A 3IC1A 3MD3A 3BDPA 1GX6A 2VC1A 1C0MA 3ZZOA 1KLMA 4U6PA 2IVFB 5HL7Q 2HIYA 2HS3A 5GMKa 1WDDA 3VOVA 4UQGA 3CFRA 1S1VB 3TJ8A 3UD5A 4ID5B 2V4RA 4BG8A 3KNGA 3LGNA 2QA4G 1NDLA 4RU9A 1X0PA 3DLKA 5LMUJ 2V63A 4XH5A 4CJTA 3EGNA 1MN7A 2B9EA 4QPXA 1GLFO 1GLCG 1H7WA 1VRQC 2OTJN 1UVIA 1T44A 5F8HA 3UKRA 2K3IA 3WNGA 2YKNB 2ZNZA 4KAIA 3M05A 3PW7A 1EETB 3W2WA 3ZZUA 1UAXA 1S4FA 1HRHA 2BV3A 4HLBA 4O44B 2IM3A 3OLBA 4ZVHA 3OHBA 3IO1A 3AOBA 1AUDA 3N28A 4B3SF 3JTPA 3D0PA 4CGJA 3MM6B 2VPYB 1DGKN 2OFGX 3R7SB 4ECQA 3FFKB 1RCOB 2JLEA 3C6HA 4TVAB 1VQLN 2Q1NA 3BGFA 1WHWA 3L7OA 1QUPA 3MMCA 4OYPA 1QHTA 3PV8A 1WKJA 1H7XA 4ETZA 1AYEA 5A0YA 3CPEA 5EU7A 1JLAA 3EGWB 1VGYA 3VR1A 1S1XB 4W92B 2QXLA 4JKDA 4BE1A 5EHHA 4M5LA 3KKRA 3CCSN 1VIXA 2FIUA 1NKCA 3F56A 3D6MB 4WFAQ 1VSFA 1SQGA 5CHCB 4MO5A 4CWBA 5HVHA 3FVYA 4DTSA 1M90O 1B64A 3IRXB 4IRDA 3TANA 4JV5K 5GADI 4NRUA 4CHZA 2W2MP 1WAJA 3OFFA 4ED2A 2V9WA 4NCGB 3GOIA 1N33J 1W2BM 4YY3J 4B1ZA 3OTOJ 5GAEI 4FPRA 3W8GA 1JKHB 4ZPVR 5M2PA 3GYNA 3PIOQ 5EX3A 1WI8A 2VKZG 3MXJA 1WC4A 1N56A 2E5IA 4WPAA 4F2SA 3V6JA 3MMAB 3OXLA 4EU0A 3D54A 2VG6A 1RDDA 3CM6A 3O9TA 3EDQB 1L3UA 3V6KA 1EAYC 4QYZK 1MG7A 1IR1A 2Z2ZA 2V6AA 4YY3K 4J2EA 1Q9YA 4EFAC 2JLFA 2GAHC 3SV3A 1U48A 4FN5A 5F41A 1HW9A 3O1BA 4DZDA 4LF7J 4CO5A 2KJVA 3CQXA 2WHOA 1RCXB 3LA0A 4Q5VA 4JV5F 2EG2A 5CZ1A 4C0OC 3AVHA 4OV1A 4OPKA 4OZJA 1X9MA 3U3GA 2H3GX 2EXUA 3US5A 4GV9A 3CERA 4NZ6A 1TKTB 2MSTA 3LDLA 1VBKA 3EUNA 2F3JA 4JD2B 4U95A 2B9YA 3JS6A 4A47A 4QU7A 1QZ5A 2F9JA 1KONA 3GB0A 2ASYA 2PMZD 4F50A 1XQIA 4CD3A 3ZNJ1 5BRHA 2XMMA 4IXCA 1BQXA 1P9YA 5BPNA 4C8ZA 5KPZA 3QNWB 4DS4A 1Z2ZA 4PQUA 1Q8KA 4ZVTB 4DEZA 4CLUA 2OAUA 1T9YA 2UUCJ 2GCFA 4M5NA 2JVOA 4K4VA 4K43A 4OYOA 3I82A 1OQ3A 2UUAJ 3P5JA 1Y9OA 1NHUA 3IBWA 2XGQA 3M8QB 4CGIA 1Y11A 3QT7A 1S6PA 1KNZA 3THYA 5KFEA 1FWPA 2KXFA 2KDOA 3UQSA 1VQLS 1NGIA 4OGCA 4WFYA 3VETA 3T5LA 2E1YA 2Q36A 1W7WA 3GIRA 4RO0A 3GYXB 3WC2A 3SQ4A 3E2EA 3O9QA 4OJRA 3FZBA 2CZ4A 1OH8A 3B78A 2O67A 3MAAA 2DCLA 5KQDA 3TJ9A 4NZ7A 1Q16B 3NF6A 1CJVB 2MKYA 3FBCA 4F2RA 3QGHA 1TK8A 2HLUA 1LAWA 3J80O 1SZ2A 4DL6A 2LVWA 2HBLA 1BY9A 3JQMA 3PYEA 2V68A 1RTIA 1YBUA 1ZM2A 3M1VA 4NCAA 3CCLN 3R5BA 3A8JA 1U8WA 3VQ5A 2Z58B 4X65F 3PKMA 3MWBA 4KREA 3FMWA 4QAGA 3G4SN 2CGJA 2JC1A 2X1GA 4CF1A 3OYIA 2U1AA 2BJ7A 2HQIA 2WBRA 4DCPB 1TAUA 4UY8T 1U47A 3NGUA 3NCIA 1P1TA 1R8HA 4WU3A 3J7AP 3TR8A 1Q7LB 1YRUA 3AD9C 5LM7E 4GC7A 1GLBG 4B3RJ 3QMQA 3O4QA 3PY8A 2ZJPL 1NOYA 5IZHA 2R7WA 2DNLA 3O9UA 2AF6A 1KD1O 1VQ9S 1YITS 3M32A 2VC0A 1JNZB 3OYCA 1XWLA 5EY4A 3GIJA 3B8AX 3BSCA 3MCPA 4IH5A 1B9FA 4HWIA 3T1YJ 4IR1A 2VL1A 2XYGB 1C0GA 3L3UA 3KK7A 1NK5A 2DHGA 4I7FB 1BC6A 3FFIA 3ELHA 3DDKA 2ROGA 2H5JB 1QD1A 2BM0A 4NRTA 4YOXA 4ZDNA 3O44A 5H1SV 5AZIB 2GS8A 2FYXA 2GUPA 5A8RA 4QS7A 4WP3A 4YEAA 3IAS9 4O4GB 4DL3A 4DR5K 5HLFA 4NA1A 3V9XA 1N8RO 2X7IA 1O1WA 3MDQA 4NX9A 3IFRA 3F5TA 3C15A 4DUZJ 3QT6A 1NSAA 3SQGB 3EE9A 5KFDA 2LQ9A 3Q86A 3HO1A 5RUBA 3I5CA 3IUCA 3HPGA 5JVGQ 1CJTB 4DQSA 4I68A 3M32B 2GO9A 2M52A 1NSPA 1T02A 5AQJA 4MLEA 4W5TA 1MMDA 3BO3A 1YJWS 2ZJRL 2KU7A 4DR1K 2HLTA 2VG7A 3A5LC 5AJ3J 2HIQA 2ZJQQ 1CVJA 3CIPA 2OSQA 1RYRA 3WHIA 4CP5A 4I69A 3NBPB 4CHNA 2HWIA 3LP3A 3DC2A 1KC8T 4FJJA 4PABA 5K20B 4OZNA 1WUUA 4B3RF 2FF3B 3H4BA 1C0TA 2J7WA 3MK6A 2DGVA 3GV5B 3MPWA 4CEQA 4A8WA 2RS8A 2P8IA 3ILIA 3I55S 3D2EB 2V4JB 4CJLA 4P75A 3CCMN 3I0SB 2O8DB 3MCOA 4FLZA 3SFGA 2FC8A 2HHTA 2GEMA 2RAQA 5AQKA 4UOHA 4CYUA 2IM2A 3SDEA 5C2FA 3CCVN 4E7HA 3OBYA 2PD1A 1X3MA 3VZIA 2Q0UA 2BE2B 5J2QA 1S49A 3MEDA 2IPOB 2VIHA 3U9DA 4ZPAA 4PQAA 1N33F 4ILGB 1S72S 1R0CB 4X84A 1S1XA 1QM9A 3QLHB 2QX0A 1NCLA 1JL2A 5CYMA 1OH6A 4ER8A 4BREA 2R2RA 1U1LA 5D15A 3ISNC 3MM8B 3D6RA 1X5TA 4FLTA 4HCBA 2VONA 1QAJA 3LP2B 5HQ8A 5KG2A 4A8OA 3MN5A 4KH6A 2M4MA 4JN4A 3FEYB 3AFGA 1VK8A 5CD4H 3UCUP 1S72N 1BHNA 4CIGA 4KHPK 4FXDA 1DARA 4H03B 1IXKA 1RDUA 1W2BR 3IDHA 3VWSA 5EDWA 4GNIA 1LFPA 1KEKA 2QEXS 5ADXH 3SDEB 4I2PA 1C0TB 3THWA 1YJUA 3CJ7A 1LEOA 1SV5A 3W1YC 1DAXA 3MR3A 4BVOA 4P7VA 2HKEA 4ICLA 2V8HA 4DPYA 1D09B 4BC5A 3KKSA 2NRVA 3A8KA 2RDIA 3CG7A 1ZM4A 2W8LA 1KAYA 3LP2A 3J7AN 2CPDA 1VI7A 1SIZA 2DGXA 1FNMA 3MM8A 3EE3A 1MA9B 4EBCA 3JB9k 1Q95G 1FFSB 1U45A 2DXEA 4PKHA 4IDHA 4ZLNA 3NRBA 3QBXA 3UVJA 3CT9A 4UOCA 1RKJA 1VQPN 3A4TA 9RUBA 1T0TV 2NPFA 1RAJA 4HH0A 4DR3K 4DV4J 5AZJA 4JYAK 3DMJB 3F73A 1CZAN 3HD2A 4LFAF 1BCMA 3TUJC 4LIRA 4ZN3A 2VBXA 4K8XA 4CVNE 4Q2MA 2MTLA 1S6OA 4M3XA 5CCMA 4CLTA 1W25A 2V8PA 2M2BA 5BR9A 5LSLA 5JLFA 4RZRA 4G6VB 1RKIA 2V2VA 2MKIA 1NEEA 1JKHA 1ZPWX 2Z1JA 2MMYA 3W5YA 1KVKA 1FHTA 1X5SA 2XRIA 3T6BA 3KLFB 1QUVA 5E84A 3IMXA 4YDUA 8RUCA 1PAUB 5HVGA 2OPQA 2FBXA 2LSNA 3RU0A 5C24B 5FRNA 1IM6A 4DR2F 2BA9A 2DRBA 2MKKA 4K4ZA 2BM1A 3NCRA 1GLAG 4WF9L 2CQ2A 1C0UB 3CMQA 3EICA 2C1EB 1AA1B 1WSFA 3HULA 2C22A 4O55A 4HYKA 1NU4A 5KFAA 2WVDA 2HWHA 2DFEA 3PJXA 1VHIA 1C2PA 1Y5LB 3UN5A 3ZSWA 3HJFA 1VC6A 4QCLA 4O3PA 3HZGA 4C4WA 2EFGA 1M90T 3OL9A 1CXUA 1GLDG 4H4MA 2M7SA 3EO3A 3MECA 1HKGA 3AVLA 5IQ6A 4Z4IA 3Q89A 3PNIA 1WOPA 1RAHB 3VAIA 4CK2A 1HWIA 3S3OA 4OZ3A 1VSJA 4CGGA 5AT1B 5GAHI 5M1FA 5B09A 2I7NA 3HKWA 2F7VA 1E3MA 1WG4A 1R43A 5HP1B 4Q44A 4HHUA 5JS1A 5CE3A 3AY0A 5F9LA 6FDRA 4HHTA 4J9UE 1RI7A 1TKXA 4KHMA 1RTJA 2GIFA 3B8HA 1QAXA 4NLBA 4NYZA 4B8CA 2HNZA 1RT3B 4IUFA 5E0OA 3BBBA 4IQMA 4EEYA 3HOSA 1Q8BA 2GVZA 3U6FA 4ZVFA 4CZCA 4NWBA 3SAHA 1QE1A 2IA6A 4DR6J 1M5HA 3E9OA 1YBAA 4ZK7M 4IEIA 3EM1A 2G8VA 1U1OA 4MQ3A 3KHRA 3SUNA 3GSIA 1Z6RA 2CXEA 4M3TA 4AFFA 3ULHA 1IH7A 1N48A 2FPHX 3HCXA 2WSCC 4DR4J 5F8MA 2NZ4A 5AQNA 2BJ3A 3K9JA 2QFIA 2K8GA 2MQNA 3FZKA 3CCEN 2CVEA 4OJ1A 3SCIE 4NA3A 1S1UB 3FE1A 2FDNA 1Q1KA 1N6QB 2YPZA 3ZX3A 3OR1B 4WK3A 3DNCA 4H4KC 5T14A 4NLTA 2DR5A 1U8SA 1GMUA 1XNQJ 1C1AA 2ZWHA 2NXUA 4GVBB 5F0WA 2P2CB 2WSFC 3A8YA 3MEEB 2VFTA 2MY7A 3KHHA 3I8DA 4H4OB 2F4VF 3JSRA 1CEZA 4J8FA 4TLQA 1GXUA 2ATCB 4JI1K 3P5TL 2CAJA 4KH4A 3JS9A 2IVYA 3LH2S 3J7YU 1NJXA 1FE4A 2IFXA 3QICA 3QEWA 3O8WA 1WHXA 2RKIA 4NZ0A 5KFSA 2ATQA 2FLNA 4TN2A 3OYEA 2MKJA 1YJWN 4X4VA 2ZH5A 2COLA 4J37A 4MTPA 3AB4B 2QSFA 4CLSA 3KLIA 1SL2A 3T6JA 4B9MA 4ECZA 4DV7K 4ZOSA 3VQQA 2VHGA 2B6AA 3Q8PB 1FKOB 2G0IA 3ET6A 4LC9B 2YNGA 5KFXA 4XIUA 4WFNQ 1T9XA 4OI3A 3SSSA 2DR8A 5CH7B 2GMLA 4JKEA 3O3FA 3ZSYA 1HW8A 1K8AT 4O5FA 2SXLA 4GVBA 3EZWA 2DNPA 1RBVA 2FUG9 4ECTA 2YWEA 2DGQA 3CJQA 1S0VA 5AQQA 5AQPA 3NGDA 3OYMA 1RBSA 4C7QA 2LQBA 2XMJA 3QESA 4C0HA 3CUNA 3V1OA 1IM4A 4YB1P 2B5JB 2ZH4A 1HNWJ 3R5CA 4DV5J 3MFHA 1NLVA 2FHJA 3SI8A 3GG1A 4ETXA 4OX9J 1JXBA 1FEEA 4HVZA 1MW7A 1SH0A 3WC0A 3RSEA 3C14B 3IWNC 3KJNB 4CF2A 2KVQE 4ILMA 1ZBIA 3R9LA 1TMMA 4DV6K 3ZT0A 4KHUA 3RRHA 5D78A 4BRLA 2LDYA 1Q8IA 2UVVA 3BBFA 3VGVA 1T05A 2YNGB 2A1RA 1I94F 1OMSA 1P90A 4ISFA 4ZTFA 5B7WA 2KFNA 2XNRA 3H3NO 3CF5Q 3K5OA 1X60A 4M42A 2DH7A 2BQUA 2W7OA 2FF6A 4BQLA 2KYZA 2AJ4A 4JV1A 2E8AA 3MUTP 1YHQS 5IQQA 3VGSA 2RU3A 4LFAK 1S5ZA 3G6EN 5E26A 1VQ7N 2OPSA 4RNFA 5L46A 5DQGA 4IJNA 4LUBA 3MX5A 3D4JA 3HSDA 2PEHA 4M1KA 2RH3A 3EMTA 3PYDA 2GJIA 1N5YA 4B02A 5BRFA 4NLQA 1FRLA 4BE2A 4FLXA 4LFBK 1S0NA 2J7KA 1X4EA 4ECWA 2KFZA 3T1HK 1G4CA 2OPQB 1IWAA 4USWA 3A5OC 1VRTA 2CPZA 1K73T 3TR5A 4DF8A 2C42A 3SCKE 4O23A 4O3SA 1I94K 2KRBA 1QVFM 3LP0A 4ILRA 2IYIA 1PGZA 1XMOK 4JV2A 4JEPA 3DLJA 4NOHA 8AT1B 1HNXK 1QVGR 4FF3A 1DHMA 2NNWA 3OL6A 3QBCA 1K8KA 4CEEA 1J5OA 3E1YA 2V9KA 5CYMB 4E8UA 3LM2A 4YOVA 3NNHA 3E9PA 1ITGA 1F9FA 2R8GA 4K4WA 1JLEB 4KFBB 4NCGA 3DXBA 1L5UA 1FD2A 2HRYA 4OI6A 4X4UA 3KK1B 1DQ9A 3OYNA 4CF9A 2E1MC 2Z4PA 4DU8A 3K17A 4KHRA 4M63C 5KQ8A 2IYGA 1IBKK 3OW2R 4I67A 2A18A 5D4PA 1VCTA 3OR2A 4X64J 2KXHA 4DKWA 1CLQA 4E98A 2MHNA 1NDCA 5B0FA 3MMAA 3V4IA 3J80U 1VQ4S 4I2PB 1YVNA 1NPRA 3PX0A 3IN5A 4XTTA 5DDRC 3MCSA 4WQ4A 2F8EX 1KHVA 2L08A 3JSYA 5KG3A 1I51B 3GPAA 4AQYK 2DR6A 2YQ0A 3EX7B 5FPDA 5AQLA 2W25A 2YWFA 4PG4A 4TU9A 3CFOA 2OHDA 3O2IA 3D1OA 4ILHA 2P9UA 3SBTA 3D0HE 2HFSA 1WEXA 3D67A 1EP4A 1YZ7A 1PYTA 2QLFB 3OHAA 2WB1D 1JLEA 3QRQA 1HHQA 4RL1A 4DL0C 5AQZA 7FD1A 5DQIA 3O4WA 1NDPA 2YWKA 4WQ5C 1K1SA 3AA8A 2XWYA 1K0TA 4LF7K 3BSOA 1T3NA 3RBEA 4ATNA 1YJNS 4F4WA 1GH8A 1G2EA 4R25A 5L38A 4B1UB 1HBMB 2B43A 1T9VA 1KHWA 4RU2A 4ZIVA 5L9XA 2F9TA 3HP9A 3SQ2A 4FO0A 4LREA 4M45A 2YKQA 2YQ1A 3PYGA 3MD1A 3GL1A 4CEOA 2HBQB 5IM0B 4ZLPA 4AQYF 1WAFA 2VPXB 1T03B 1RE1B 1EX8A 1EWQA 1NAQA 1X1PA 3AT1B 2UXDF 3K89A 3UNYA 3P38A 2YNHA 3HHEA 3AD8C 2E1AA 1TELA 5DLGA 1NLKL 4DLEA 3TYTA 5KG6A 2OEKA 4ELUA 2VYPA 3VAKA 3CCQS 2GQ2A 2VQEJ 2RSQA 2D3O1 4IBNA 3AAQA 1KAZA 2DTJA 3FZMA 3HSTB 2K3KA 1N4LA 3CI5A 2RJZA 4BCAA 4CI0B 1P8ZA 3KHYA 3VALA 2E1ZA 3CCZA 3QRPA 3WIUA 2ZVSA 2ZJQL 1ASVA 4JI4J 4ENOA 1SPBP 1YKWA 1AB8A 3F9KA 1S6PB 2R7QA 4QIFA 1IJFB 3WQTA 3LAKA 2ZHOA 2ZVIA 1UVLA 3FBFA 2V52B 4M5KA 2UVUA 1BA0A 2UU9F 3AGKA 4BRCA 1K47A 3BGRA 2NLWA 3AA3A 2GVDB 5GIOA 3D2FB 3T1YF 3IMQJ 2VCPA 3LWLA 3G6XA 4ZN1A 2OZMA 1J2VA 5ETQA 1IVZA 3QEIA 2AJFE 5DGBA 3M4XA 4HHJA 1WHYA 4LT6A 1RGIA 3C6UA 5LMUF 3MMBB 3R8YA 1QE1B 4OLAA 3EJMA 2WVCA 2JEFA 4YB6A 1P1LA 3HHLD 4FWRA 2DGSA 2V8DA 3MUVP 3MPVA 1B0VA 5BR8K 2MQMA 2MZRA 5MAOA 4K2JA 3K0JA 2V94A 4N76A 3VF0B 3QPIA 2AZ3A 1G7CB 5K8PA 4JS4A 3G96A 1ZAXA 4FXVA 1O6XA 1YRXA 1C4AA 3H59A 3ZTQA 4IR9A 1DTQA 1CC7A 5HANA 1HA1A 4FLWA 3MMVA 2F1FA 3FRZA 3DWLA 1JXEA 2MQOA 1FNOA 4I6AA 2EFVA 3PKYA 1HBUA 1D3WA 2GJ2A 3C46A 3I0RB 2QZ8A 4A61A 1B99A 1JCFA 3BF1A 1TKZB 3J81O 4C6AA 2N82B 1T3VA 3MWPA 1AZSA 1EO1A 3U27A 2VZ9A 1WF1A 4CJPA 2AJ1A 4DV0K 5DZ7A 4J9LA 3ZZPA 2GFFA 3HZEA 4RWTA 5LMNK 3GCXP 3NWRA 3D3BJ 1KAXA 3QFUA 3QINA 3HSGA 4OKEA 4DTNA 1MROA 2ZZNA 1CSJA 3EKSA 1H1VA 3WIVA 3CD5A 4FWPA 1HWUA 2A10A 3I6PA 1SAZA 1EZZB 5AQHA 1Q5VA 2UUBK 2Q43A 3SAFA 1RISA 2F4VK 1WUAA 5CZVA 2K7JA 4CT8A 3C6UB 2P9KA 5JICA 3UFCX 1N34F 2UP1A 2FY8A 2G9OA 4I9LA 2KZZA 2E6LA 1NGDA 3GFHA 2HFUA 5J1EB 3B4MA 2HFNA 3FC9A 2FTRA 1HQEB 3ZSOA 1FW6A 1MMLA 2E5LK 4ZS6A 4BDZA 1Q81O 5FROA 1T3OA 1S3XA 3LO3A 2KG0A 3NH0A 4E7LA 1TTHB 3VQEA 4LRCA 3CCMS 2MJUA 3CM5A 5C0YA 3UKRB 1RYSA 2DR9A 1S1WB 2UUAF 3LAMA 1ZTWA 1R59O 2QMWA 3NAHA 4CJ7A 1WLJA 1SBRA 1T9UA 1CJTA 3M30B 4K7QA 4UT4A 5IWAJ 3DGVA 1M1GA 2DGWA 2FVCA 5KT5A 1S9GB 3F9MA 4OMFG 2FQQB 2BDPA 4R0EA 3RYLA 1S1TB 3KFWX 1UFKA 3MN6A 3G71S 2Q2RA 2ERRA 2D0CA 3N4QA 4FDFA 3OA9A 3TZWA 2YH1A 4A5BA 4M5DA 5U47A 4X4NA 3PVXA 4UZCA 2B6AB 1AT1B 2E29A 4PZVA 3FZHA 3VF2A 3L2WA 3RAQA 3VEWA 2VBYA 1FT8A 2DNHA 1FE0A 3DCAA 3M5RA 3DXSX 3O9RA 2GNKA 5KFZA 2NXNA 2DB1A 1RTDB 3P83D 4BVPA 1IKVB 2JFKA 3AARA 5M1NA 2V4JA 3O4NA 2KKHA 5I3UB 2CQCA 2C3OA 3KJQB 1S79A 3P39A 2YNFB 4JYAJ 3AVCA 3NE6A 5AQXA 1PO6A 1S0MA 4CLYA 4OYBA 4FS1A 1H73A 1VQSA 4C3KA 3DRSB 4M7YA 1K9MT 3U1LA 3O5TB 4KIAA 2VG5A 3QEVA 2PFFB 4JKFA 4O0NA 3GIMA 4M5DB 3W63A 4I6WA 2E7XA 3V9UA 1FKPB 1ZM9A 2EK6A 3PCOB 3G25A 1VQ9N 5DG9A 3R97A 1L3VA 5KFHA 3D7EO 4Y2CA 3Q2SC 4YR3A 1UPPA 2EKNA 1LW2A 2BEFA 3ILOA 1C1CB 2XHCA 3IKMA 1M1KT 4NA2A 2YPYA 1ULRA 4MIAA 3R6GB 3UIQA 2RRBA 1HYVA 3CCES 3PX6A 1C0FA 1HMVA 4CLZA 1XMOF 2ZD1A 3JSBA 4HTLA 1KQSM 3FBEA 1R31A 1WSRA 2CQIA 4LFBJ 5EN1A 2OZSA 3CC7N 1Z1ZA 5GAHU 4LF9K 3OYKA 2VBZA 5J1NA 3KLHB 2VKRA 4BR5A 4DN9A 1HNZK 2KHDA 4OFZA 2W9BA 5HK4A 3HP6A 5C25B 2WOMA 2H1YA 2ALYB 4B1XB 5GVQA 4F67A 2DGUA 1VQ6S 1YI2N 3FZFA 2RU9A 5EUHA 2QE5A 5K9FA 2RN2A 4W5NA 2QWQA 1UVKA 4GO7X 3ZNUA 4Z94A 2KQ2A 1F0XA 5DG7A 1H0HB 1QSSA 2NRTA 4AHUA 1JCEA 2OELA 4QW9A 1YJVA 4X66J 3O3HA 4FS2A 5KGXA 2EFNA 2FXUA 3EVOA 2M8DB 3DXMA 1ZBUA 4Q43A 2UU9K 3BUZB 1R8PA 4BRNA 3SEOA 3DM2A 5CY4A 3VEXA 5FIIA 2VODA 1GOCA 3SSRA 4FJ8A 3M9MB 1ZZNA 2W41A 4EFHA 1WBDA 4PR6A 2HVDA 5I42B 4K2XA 4B3OB 2NXEA 4OX9F 2A40A 3DOMB 2J8AA 2HZCA 3O80A 2ZOGA 5I3PA 2P9UB 1FEHA 1CJUB 3MGJA 2N4DA 2AEJA 1HBNB 5KG1A 3HM8A 2CJ9A 3TSUA 1BWEA 2KI2A 5HP1A 1IKWB 3FR0A 4AXJA 3W5XA 3DI6B 3KLGB 3T19A 4ANDA 5KRSA 2C2MB 4RUAA 4USJC 4IOAQ 3NWGA 1RU2A 2HQFA 1SVDA 4FYVB 2ADCA 2YX6A 4WF9Q 2NRHA 2YKPA 1WC1A 3CXCR 2H4YB 1EQMA 2QMXA 4RUHA 1BGXT 4R0JA 4USMA 1Y5IB 2RUSA 3GYGA 3G6ES 1VQ7S 2CPEA 2BQ3A 1CC8A 4FVUA 1NKBA 2Z57B 3QAUA 3CMES 1IBMJ 1HPZB 3IM8A 1TUYA 4S0MA 2E1RA 4MYUA 3KMSA 2CNLB 3BZQA 2UXCK 4DV5F 4JRPA 2MLXA 5KFIA 2WVBA 4EWTA 2CGKA 4BR4A 2C2OB 4ZJLA 3VV2B 3S6EA 1OQ6A 4LIWA 1CJUA 5KFKA 3F41A 4KH5A 2HMIA 2D9OA 4WTOB 3CIZA 4BQZA 5I42A 3SUPA 4MKBA 1APSA 4XK8C 3DHXA 1YG0A 3HYFA 3W9IA 2HQ3A 5KG5A 2HG4A 1NDKA 3DLBA 2WTUA 1ZYQA 2C2RA 4AE5A 4ZVGA 2DNRA 3HK2A 2J9DE 4DS5A 1TU0B 1X8DA 1KTQA 4L72B 3SXLA 1ATRA 3ALYA 5A2QO 3MM7A 1TMJA 2V8VA 2DPJA 5E33A 3D2WA 1XHXA 3M8SA 1B70B 2G8KA 2QWRA 4IDKB 4ZCLA 3DI6A 3KLGA 4KC5A 3C66A 1BQMB 4CQ1A 3EXCX 2N3LA 2FJBB 2GMHA 4K4YA 4JHDA 3KK3B 4CIOA 3V1QA 4USHA 4CH7A 3Q7CA 3NH1A 3QB0A 2CWXA 4X4TA 4DBQA 2DXFA 1UZHA 3ENHA 3F0NA 5DM6L 5J2NA 4JBCA 4CJSA 3CCUN 2V67A 4CO3A 3MF5A 4BRFA 1KD1T 3SZ2A 1LQ9A 5B8HA 3HVAA 2ZKTA 3A12A 3LPYA 2QG9B 1HNVA 5KFOA 1CLFA 3NNAA 4CHPA 3C15B 3MR2A 4LF8K 6FD1A 3H08A 4DQ8A 1JNRB 3NP5A 2BJ9A 1BIZA 2K1RB 4J2BA 1YLXA 4J90A 5A8WA 3VA3A 1HQUB 2KH9A 3CC7S 4ECXA 2VD3A 1WC5A 5GMDA 4ZP8A 2R8IA 4YDXA 4ZP6A 3OSNA 4XEIA 2MB0B 4RNMA 2VFRA 3KK3A 1WORA 3N79A 1V5IB 1VYAA 3G87A 1OH7A 2A2DA 4IRCA 4A8SA 4YDDB 2V5HG 2PSZA 2XWXA 5AR0A 4HUEA 4JOUA 1W97L 1S6UA 3I0SA 4FW2A 1BQMA 1KS2A 3GILA 5C15A 3SFUA 3NF7A 3DN9A 1VISA 2RHKA 5HMYA 1VQON 4JRQA 3WT0A 1MWZA 2RT3A 1WTBA 1JQGA 1N34K 3TO8A 1NGCA 3ENQA 4CD1A 4FZVA 1SKSA 4OYMA 4F9OA 2E5GA 1HL6A 3MUMP 2BANA 2XS5A 1WTFA 4OHZA 4DWIA 1D9AA 2CQ0A 4N41A 1ZC6A 1MROB 3J7YI 3QSYB 1VC0A 4DV3J 2AMCB 1YJTA 2KHCA 3CYMA 2BXJA 3J81U 3ZC4A 2FZGB 5KT6A 4KR0B 1PJ7A 4OI0A 4BRAA 4BWMA 3GCWP 2F9WA 1NH8A 2QV6A 1UVMA 4B9QA 1SH2A 2VG6B 1HWKA 1QVFR 1NXIA 5BYQA 3R5JB 4V19X 2CRLA 2ADBA 3GWCA 2QA2A 3Q22A 3X3UA 4BG9A 2A3ZA 5L1LA 2ACYA 3MXHP 4KY3A 3PYFA 4D3GA 3R5AA 4DPUA 3OYFA 4UUWA 2E9RX 3U3YA 3U7JA 4DV4F 3CETA 4M3YA 4M94A 3P96A 5HATA 2ASDA 1Z05A 1I94J 1G1XA 1PIEA 1RGVA 2OD6A 4P2XA 4ZPBA 3H1QA 1O8BA 2QXFA 2JL9A 4OPHA 1VMBA 3U9ZA 4IEEA 1UL3A 3GU0A 4WFAL 5L1IA 1OIAA 2D1KA 1GLEG 1NK0A 1S6QB 5C42A 2F4VJ 1N54B 4FJGA 4MDAA 5AQYA 3V6DB 2DNZA 2M9KA 2R7TA 4YQWA 2P6TA 2P9SB 5FD1A 3AAPA 3T9ZA 4CJ3A 1J6ZA 3DGPA 4GKJK 3OSPA 3TTDA 4DMNA 4DUTA 3AJ2A 2DO0A 2W2NP 4KRWA 2GA7A 4ED7A 4LFCJ 4Q8EA 2BZ2A 4FJLA 2YKMA 5BYRA 2P9NA 2Z8QA 1WSVA 3DRSA 4FWNA 2G0JA 3PRBA 2VA3A 4ZVQB 1MU2A 3M2RA 2O8FA 2GHVC 2HBZB 2W1BA 2GTDA 3MXMA 3E8OA 1S0OA 3TA2A 2FLLA 3TSQA 4CO1A 4FWMA 5IWAK 1NJIO 4CZFA 2FSJA 2HNDB 3G82A 1NK4A 4NLGA 3H5YA 4DV1K 3M2RB 2O8FB 1IBMK 2DBBA 3DFEA 3DLGB 4ZCMA 1RT1A 4DCOB 3ULEB 4CGDA 1VSHA 4CHYA 3KLFA 1HMVB 3MI7X 3G0ZA 2NYHA 1YSJA 5KG0A 3ZCMA 5HMZA 5CYQB 2VOPA 4GKKF 3TQEA 3KLHA 3NCQA 1PBUA 1BUXA 1SC1B 3MN9A 3K5MA 4LRAA 4RUBA 3AD7C 1ACMB 4WYBA 5ADXA 5ETMA 1MU2B 1HR0F 1VQKN 3ENOA 3W2VB 2XO7A 5DM7L 1VQOS 3I55N 1KVAA 1H6KX 3DOKA 4DR6K 2AHOB 2A5XA 3I9ZA 1CXQA 3CJKA 3JAMU 5ETLA 4CBUA 3L95X 3ENBA 4GO5X 1A6LA 2V50A 4K42A 2AA4A 1FRKA 1TFWA 3V9WA 3HKZD 3UDEA 3K8WA 2OPPA 4BRDA 2LA6A 4B17A 1PAEX 3BN7A 3W62A 1U6BA 5IXUA 2OPRB 3RG6A 4AHTA 1TAQA 2M0GB 2EFPA 4HR2A 2GIQA 1RT4A 4Y2AA 4K8RA 2WVEA 4C3MA 1MWKA 3DLEA 4FKXA 4KKOB 3WX4A 5J2MB 4RG8A 2BJ8A 1T6CA 2XCAA 4X66K 4F0KA 3OVBA 3KJVB 1NSKL 1D9FA 5KFCA 1V4SA 3NGTA 3E51A 3DJCA 4H5RA 4FZZA 4KO0A 2ZZTA 2GVZB 4ANCA 3CDAA 2F65A 4C8KA 2ZGYA 4LBPA 5C5JA 3VQ6A 4AHRA 4PQUB 4JI4F 2BJ1A 1U6ZA 3VEVA 1IKXB 2YX4A 2VUGA 4OHYA 1K8AO 2FJVA 2HVIA 4DSFA 1NNEA 5IS2A 4K4XA 2JOQA 2ATLA 1RT5A 4DXLA 4B3TJ 4O5BA 3OV7A 3UR3C 3VA0A 1XI1A 1NK8A 4ID8A 3IP0A 3QT8A 4U9RA 4EK2A 4DPWA 2HB5A 1BWVA 2JLGA 3LPEA 2XHBA 1SKWA 4DCJB 4U7UK 4W4MA 4KGXB 1MDUB 1SJ1A 1QTNB 2CQBA 2N7YA 3H2LA 3MM5B 2EWSA 2DD8S 3A3PB 1FVSA 3RZAA 1RNHA 4HI1A 1FJGK 2CPXA 1S5JA 3B6PA 3VAJA 1XIQA 2IDLA 1XHZA 1IBCB 3J81Y 1N0VC 5BPMA 4QIVA 4WKRA 1F3FA 2RIJA 3L6QA 2G8IA 3VQCA 3CF5L 1U09A 5IC6B 3HPHA 4LQ9A 3KJVA 3PEHA 4AL6A 2UVRA 2VGMA 4K8ZA 4BBYA 1JWWA 1EX4A 1UW4A 4MKVA 1RT2A 3UDVA 1BU6O 3CSKA 4A46A 2LEAA 1Z25A 2OO4A 2JEGA 1OPZA 1FK9B 2KN4A 1XR5A 1YI2S 2PE8A 1RWUA 1YAGA 3Q8RB 2YBVA 1FXDA 3SIPB 2BE2A 4FYXB 4JP8A 4UUXA 3BS9A 5LMNF 4QWDA 2J0XA 3TAMA 3D1QA 4LF4J 3EE8A 2AEMA 1AFJA 1FKOA 4W5RA 5IT9O 1Q79A 4O0IA 4ID5A 7FDRA 2VQEK 2XEXA 3DKDA 2OH2A 2HVHA 3GONA 2Z0GA 1RFQA 4WFNL 4ZJQA 4KTWA 1FD8A 4J9MA 4B08A 4PG7A 3AO1A 4BRGA 2QJ3A 5EX0A 1IQZA 3B4DA 3DYAA 3HTVA 2AX0A 2ZBCA 4DSJA 4KHPJ 3M30A 1VR6A 4FLVA 3AJ1A 1ZETA 1JLGA 2Y0SD 2V7YA 2M8HA 4IZ9A 4ZIWA 2DPNA 1BQNA 1N88A 2QL9B 3CJ8A 5AXKA 1KVIA 2PA8D 3CJ9A 3DXKB 2BKNA 4ZLJA 3CE8A 3BYPA 4UF4A 3IS9B 3GBTA 2L9WA 1N0UA 2IDEA 3TTCA 5ETRA 2VQEF 4KHPF 3SAGA 3KYLA 4NLDA 2W8KA 3PDNA 2A3JA 4XDCA 2DRAA 4FJIA 3M9NB 4X62F 2BABA 2OPSB 4Y6IA 3GFXA 4K4TA 4C8LA 1OY8A 1VJQA 1KOOA 1F5AA 2IVNA 4E1MA 3ICLA 2KT3A 2GX8A 1QQOA 4MDBA 4DU4A 4LFCK 5C12A 3FKBA 3GSDA 4JI2J 4AQYJ 1UOCA 3CD6S 4DSKA 1B92A 3G6VA 2XYPB 5KT4A 1RT1B 1IN0A 3BKUA 1N34J 2VV5A 3HI9A 3GG0A 5LXRA 1G15A 2I7PA 2B51A 1UWBB 2FJDB 5FLXO 5GAHP 4PYDA 3SLCA 2OJ3A 2FJXA 3IFEA 2EK1A 2XY8A 1IBMF 2MZJA 4Y1DA 2HW3A 1SQEA 3Q83A 4H0OA 4JNEA 1HNWF 3FMBA 3RBDA 1VSKA 1T11A 1JLGB 4P2SA 4Z7YA 3DLKB 2OMLA 3CCRN 4IG3B 5HRRA 1FXXA 1Q0NA 2FBYA 4YUDA 1ZBFA 3ADAC 3R8EA 3ITHA 2QLXA 4JI7K 3CGIA 3LDPA 1NRKA 3DHWC 4CNZA 2XMUA 1WSEA 3T5HA 4ED1A 1Y5NB 5TKWA 3DGPB 1A7GE 2RVJA 3MEKA 5A76A 4OL8A 3VCDA 3X1LB 4PG6A 4KPYA 3KTQA 4JKAA 3CMAS 3L7PA 2QEXN 5FDLB 2W6KA 2CQPA 2RQKA 3QSIA 2GJFA 3J7Z5 2NLXA 4JI0J 1VFJA 1UVNA 1C0UA 3LTOA 2I5JB 1DKGD 1VSIA 2JGUA 1EKRA 2GIRA 3A5MC 2W4DA 3TEGA 4IKAA 2AQ4A 3EVWA 3UI3A 2HHHK 1X4DA 3VPZA 2QW9A 4FPBA 1NGHA 2XLJA 1JJHA 4K5RA 3TA1A 2FB0A 4DX7A 3EYZA 3H98A 2C2KB 2JX2A 1ESVA 1BL3A 5AJ3F 1G99A 2JC0A 2ZJRQ 4TSXA 3I5BA 1LOUA 2DNMA 4DR4F 5AQMA 4KHYA 4FJMA 2LDIA 2BUPA 3RBZA 2N3OA 4O3OA 2QTDA 3K59A 2HZVA 3CCVS 3P8BB 3VQBA 1R27B 2IVMA 5LSOA 4L3QA 3BQ2A 1TP7A 4DU1A 2LLZA 4P72A 3HD1A 3LM9A 2HZAA 2ZZMA 2L41A 2R7UA 1OY9A 4QJVA 4PYAA 3OYLA 2WW8A 1FRJA 3D6HB 3SMZA 1F5CA 2C2NA 1J5EK 1RADB 5HBMA 2B7CB 3PHEA 1RBUA 3MX2A 5KFQA 4JKCA 3K58A 3QGGA 2KKZA 4C2MA 3R6MA 3D5MA 2ZBPA 5KFWA 1V5VA 2DHXA 2IS3A 1N32F 2ZWOA 4F4XA 3C0BA 1S12A 3TX8A 1LK5A 1AFIA 1UFLA 1RILA 1PSDA 2I5JA 1H38A 3PIPL 5GIPA 4YDUC 4FNHA 3Q2TC 5F2RA 4CZLA 3QERA 4Z4HA 1RT2B 4GMKA 1E4FT 2VFVA 3H45C 3HHKA 4XH4A 1KVCA 2XULA 3LW5C 2WVFA 3S3MA 4RR5A 1XNRF 1ZZFA 3MZIA 4BC3A 2YJFA 4RW8B 4DTMA 2DEJA 2XMKA 1RWVB 4DUZK 4I6YA 5B0CA 4FF1A 4IFVA 5M2RA 2Q97A 4B3SK 1RLDA 3MN7A 5HROB 5BR8J 1TYQB 4H5TA 4KJIA 1TK5A 2NR0A 1RT4B 2NCKL 2AEFA 2ZBRA 4NMLA 2B7BB 1HD1A 2WK4A 4OZ2A 2HHHJ 2JHEA 4DG1A 4J2AA 3BGOP 2L9DA 2JWKA 4LF9J 2YWHA 4DZ6A 3G2XA 3CIMA 3VZHA 2I8EA 1Q82O 4KH0B 2HNYA 3PFOA 3JSMB 5KT2A 4F8RA 1YUWA 4JI0K 2OTLS 2B4VA 3H40A 3S7RA 3ENVA 1TV6B 2CIMA 3R27A 4FJKA 4PG8A 1PJ6A 2R2SA 5JMVA 4RJVA 5KFRA 3A8EA 4U8VA 3IAYA 2X6SA 4DPXA 5GAGU 3L4BC 3UE5A 3O3GA 1S9EA 1Y0HA 2VU5A 3NMUA 3O6QA 4ZVPB 3VQDA 1RHRB 1TV6A 3I0RA 3AQPA 1NGGA 4ZPWR 3O08A 5KFBA 2UUTA 1NJZA 1X9WA 2VQFK 2YHAA 2HNZB 1NNDA 4B9UA 3OTOF 5CR4A 1N5QA 5A2QY 3MHYA 1M5KC 3CNQP 1SL1A 7AT1B 1YJNN 3BPDA 2PAVA 2R7YA 4CZEA 4HDHA 4CJ4A 2AU0A 3T7ZA 3LWMA 2DIUA 2P9LB 3TQ1A 2PBDA 2W9CB 3FGUA 4QWAA 3ZSVA 4U67Q 1NWKA 4U7UD 1LCUA 4JI8K 2E66A 4NLSA 4HHHA 4UOGA 4ZVOB 3LGHA 3FJ2A 1B0TA 1MLAA 4ZVSB 2XI2A 2GWKA 5GAEU 1XNQF 4PKDB 4CE9A 4KI6A 4FWLA 4Y1CA 2ZHBA 3DRRB 5H9EK 5HVFA 2PIIA 4B9VA 1UJ6A 3AVMA 2P5OA 4LF8F 2UUCK 2FSKA 1UJ4A 4OKJA 4P52A 4LF6K 3CJRA 2AD9A 1SJQA 2BW2A 1YTYA 2HK2A 3FCVA 4G3IA 4JK7A 4A48A 3DXKA 5BN9A 3W64A 1TUGB 3ZTRA 2GX9A 3AXKA 3CPWM 3TABA 4BHQA 4Z4EA 4B9LA 3G71N 4ES1A 3L8BA 4DR7F 3MM9A 3GFZA 5KT3A 4U8YA 3ZZRA 1EIYB 3TZYA 4PWDB 2E4LA 1FRIA 4RW6A 1QLNA 4WZQA 1WELA 4F26A 4PA1A 4QR1A 2NSCA 2J5AA 3SUQA 3DYAB 1P9QC 2QO3A 1R0AA 3O9SA 1XJWB 4CEDA 3OW2M 4Y65A 3J80Y 2CQ3A 2F9DA 1F60B 3NF8A 2KM8B 2UXBK 2VJUA 4CI6A 2E9TA 4O4GA 1DURA 2X3GA 1HNZF 3QFWA 1P6TA 4RBTA 2MHEA 4CLWA 3ZT3A 2ZDOA 2DH9A 1R6VA 1QDUB 2R7OA 5LY3A 4FK2A 5CAAA 2VPZB 3NMRA 1FWLA 4LY7A 3DRRA 3T1HF 1BA1A 3KG4A 3DRYA 1TKDA 4KB1A 5D4LA 4AHVA 1U02A 2Z2YB 4ICLB 1ITPA 4CLFA 2CPHA 2GHPA 3NS7B 1WHVA 5AQRA 3BR8A 1S1VA 2AYEA 3ILLA 1FDNA 5G0RB 4YOWA 2KL8A 2Q1LA 3OY9A 2P6SA 1WEZA 2YKOA 5AXNA 2HHUA 1XMQF 4JI6K 4LVOP 1JJCB 1R0AB 2ZFHA 2M3DA 3FK4A 1XMOJ 2ZH3A 3WEEB 3GE1A 1P27B 4YFUA 3VGMA 4CLPA 1GK8A 4CJKA 1VQ4N 2ZDPA 2YKNA 5C2DA 4DV4K 3VQ7A 3BV8A 4ZHRA 2NUHA 3UO0A 4AD6A 3QYYA 2UZAA 3Q23A 1ICEB 3BF3A 2JWLA 2BJDA 4V1Ak 4NO7A 1NJYA 4EIAA 2GC8A 4FJXA 1WOSA 1YIJN 1QAIA 3BR9A 3QJLA 1FESA 3R5GA 4UW2A 1HI0P 2CH5A 3AV9A 1I1GA 4EZ9A 4FK0A 4OI2A 2CJXB 2QL5B 3A3OB 5CCLA 2CH6A 1CS4A 2NQPA 4OIXA 4WK1A 3MEDB 4EYHB 4BROA 3S3NA 4WE1A 2CNNB 2JSXA 1OSDA 1D5AA 3KLVA 1UPMB 3ITHB 4NLPA 4DV0J 3ID6A 3DRPB 2LP4A 1T94A 3RBXA 1SQKA 3CW2C 2ABYA 2DNQA 2OD4A 1HHSA 2ZH1A 4FWKA 3HHLC 5A8KB 2CQ4A 1V3RA 3NY0A 4MT1A 3MEGB 4LRFA 2IVPA 4KPCA 4Z4FA 1DT9A 2FD2A 3PO4A 1J54A 1PCAA 3D6FB 3J7A1 2RILA 1LFWA 4RW8A 4CZHA 1ZA2B 1Y64A 2YNIB 3L2UA 5AXLA 1R8CA 1LWCA 4NB4A 4CH1A 2IIHA 1D8YA 2M88A 4JI4K 1GFWB 3CPWR 2X1FA 4Y2IA 3Q8UA 2R4FA 4A4JA 3M8RA 3PIPQ 2K2PA 5A6PA 1X4HA 4EHTA 2FVPA 4UY85 1Y4ZB 4K0KJ 1DBDA 4RW4A 3HXMA 4DR2J 2IMOA 4GV3A 2HVZA 2IJRA 2RUGA 2VICA 4PKGA 4H0YB 3CD6N 3HM9A 2ROEA 4BRQA 2HMPA 1JJ4A 4DTJA 2OSRA 4LD0A 3G86A 2KVIA 2O8EB 4QIWD 2LXIA 2NYIA 2A0FB 3CDWA 3DOLA 1S97A 4X4RA 1HNIA 3CC2S 1FJGF 2W4CA 2FGOA 4DX5A 1URRA 4CW7B 4GW6A 1JIHA 2GGPB 4L73A 3MR7A 1U7LA 3PJWA 1RT3A 3EL2A 5K8MA 1H74A 2E9ZA 2XZWA 3MEGA 3KK2B 4GKKJ 2RQCA 3CJAA 1U1QA 4USUA 2UYTA 1O13A 3HZ6A 4ZA1A 2DGTA 3TWZA 1JLFA 3C6AA 2B8PA 2HHSA 4CCHA 4QWCA 3QMLA 4H4OA 2XZDB 2W4PA 3F44A 4CZIA 4BLGA 3BSNA 1YJRA 3TJAA 3QIPA 4HACA 4CZGA 2B56A 4PUOB 1VK0A 2HRUA 4WQ4C 2W2PP 3MAHA 1Q5YA 1KRPA 2ZOFA 1N32K 2W2OP 1U2RA 5ELZA 5HSPA 2HK3A 2JWNA 1VSEA 1REVB 2Y1LB 2D9PA 1E4GT 1WN7A 3T1AA 5E41A 4A62A 5C25A 3MPYA 5EVZA 1GT8A 2NSBA 4V19S 3QRRA 2XBPA 2XG8A 3ZSQA 1OVQA 3LZJA 5HJYA 3JXOA 1HBOB 2JFDA 3DOLB 1RUSA 4OZ5A 1YF5L 1IBKJ 3C65A 2UUCF 3KG1A 3ZXWA 5K14A 5HJXA 4N7TA 5DDQC 2WW4A 5HROA 2QWNA 3BKTA 3HVTB 4W98A 5T41A 3OFEA 3W3SA 3BSAA 1JK9B 2CADA 4DX6A 1A5VA 3EN9A 3B54A 3D3CJ 3KWGA 4P2FA 1NGJA 2O8BA 3DAWA 1HQEA 4GKJJ 2UV8A 2DNGA 2V7ZA 4PUOA 4ITSA 4YB5A 1DEJA 2L48A 1NU0A 2AT1B 4B3OA 4GVLA 4B3RK 4RUCA 1RCHA 3QZ8A 1WEYA 1GMVA 2HNYB 2E7WA 4KGMA 1HYSA 3VGUA 3OVNA 2ASOA 1HNVB 4RLEA 3IXQA 5AXMA 3CC2N 2J76E 5JVGL 2UUBF 1VAZA 2VDHA 4DN0A 3D45A 5GAEP 4FYDA 4OX7A 1R6YA 1SB6A 3W8PA 1TYQA 3ZX0A 4H0TB 3J7YP 3AVJA 4K4SA 2E2OA 3NOCA 2P9LA 3I31A 3NGKA 4R8UB 2GBZA 4OLPA 3TARA 1WACA 2FHOB 3CCSS 1HKAA 1TL7B 1X5OA 3EXYA 1CG2A 1TGOA 4FOEA 2GO8A 3UR0A 2R7VA 4RW6B 4PAAA 3MMBA 1RT6B 4KB0A 1HQUA 3KKFA 1PILA 3VTHA 1WF2A 3FSIA 1LWEA 1RTHB 4Q2LA 1FO1A 2ZJPQ 4CTAB 4NLRA 2ASPA 4IKFA 1RWNB 4Q7AA 3W0LA 4ED4A 2QC3A 3P6YC 1X9SA 3SQGA 3CO9A 3PUFA 3EDRB 3TAGA 4FYYB 4FVMA 2A6AA 1ZAVA 1IKVA 3ZETA 2NRWA 1ZTTA 2ITMA 4O3QA 4A8FA 1RTHA 4FBTA 3N5FA 3BH7B 3NGZA 4DDFA 1IBLK 2LQ8A 2BJEA 2PZSA 1T9TA 4NE9C 3M8PB 2ASJA 1CS4B 4ZVUB 1NHVA 4LF6F 2BR0A 2YKAA 2G2YA 4F02A 5KI6A 3OL8A 4LF6J 2KYXA 3I96A 3BPSP 4FVCA 1E6VB 1KQGB 3MDFA 3WXJA 1LWFA 5H9EJ 4LF5F 2ZBIA 3SCXA 1UTAA 3CDUA 3VESA 3L0QA 4IQXA 3NLCA 4F3QA 2R3VA 2E44A 4QU6A 3MM6A 5KG7A 4A57A 4B9TA 2KLAA 2G2ZA 4TY8B 4DV2K 1KVJA 1MNEA 4OVLA 2HFVA 2DO4A 1I3OB 1KFDA 3RAXA 4BR2A 2HQGA 4NYOA 3P1GA 1IBLF 1OPIA 3AVFA 4H5VA 4AM6A 4TXSA 3ZTOA 3R3LA 4DFPA 1RLCL 3PM9A 1HUXA 3HDSA 3N9UC 3MTJA 5SUHA 3LPUA 5E3CA 4TY8A 1S77D 3I56S 2YQ3A 1HNXJ 4KYZA 2G1DA 3CHWA 2GMJA 4CH0S 2A42A 4N5SA 1EETA 3BO2A 2RHQB 4A8KA 4CM0A 1LWXA 4LH5A 3VQ4A 3THTA 2FHMA 5AE2A 3ZZYA 1YHQN 2B9XA 1NMEB 1U0HA 3CJ4A 2EX3A 2VDIA 1AUSL 3KLEA 3BYRA 2JZ5A 2OTJS 4WZMA 3OR2B 4OYWA 5JS2A 1JLCB 2C2EA 2IBKA 5KFUA 1NMDA 1QHAA 1VQPS 1UWBA 3MFIA 4ELTA 5K5MA 4FW1A 4KV8A 2CPFA 2HVEA 2GQCA 3UB5A 2FLPA 3RB0A 3D0IE 2RB7A 5AQVA 4B9SA 3C7NB 1X4AA 3NEKA 1NM1A 3DLLQ 5BR8F 2CUYA 4FXWA 5ITHA 2C3YA 3ULDA 1D8ZA 3ZSXA 4J9KA 2DIVA 3H42A 3OYJA 4F3MA 3H7HB 3OTBA 3PR5B 5M1PA 1RACB 1RAAB 4DTUA 1IKWA 5D8HB 4DU3A 4L3NA 2XLIA 4YNQA 4PPZA 4DCHA 2AW0A 2RMLA 3VEOA 4I64A 2W01A 1CULB 5J1PA 4L8RB 2MZQA 3ZZTA 2X51A 2NXCA 3QATA 3DOMA 2HF3A 1NJIT 2M70A 1HBMA 4Z4CA 4RTFD 3UDLA 2MZTA 2ROPA 4DV7F 2R7RA 3TNVA 3SJHA 1DRZA 4CFDA 4E0DA 4IFYB 2BACA 5LJWA 3DLHA 3D68A 1N32J 3LF0A 1RDRA 2GELA 1W7AA 5IM0A 3H3OB 3T69A 4L75A 3ISZA 3SBMA 1M5VC 2O8CB 2VOOA 2XZTB 1HJRA 3Q8QB 2ALZA 1H2TZ 4IJAA 2YV0X 2YNHB 2Z30B 1CZ9A 5FPNA 2DHAA 3ENWA 2W40A 5L1JA 5DS7A 3CJKB 4KFBA 4A2BA 1TR0A 2BVZA 3W9JA 3O8MA 4CHQA 3I87A 5KRTA 1QVGM 2BUNA 3POTA 3ZLJA 3C7NA 3H1VX 2JVRA 4CJVA 3NVKA 2WTFA 3L3VA 1U6FA 3B82A 4FLUA 3KUEA 3LALA 2DHHA 1C6VA 2D69A 4JV0A 3MM7B 4QQBA 3OVSA 3EWGA 1X3NA 4NLUA 1F3VA 2FJEB 1H72C 2VGNA 4JLHA 4PY5A 2B4OA 3GZ7A 4ED0A 3UN3A 3TWHA 1W2IA 3IGNA 4K59A 1YX2A 4X65J 1QY7A 2ZNYA 1BOTO 4WXWA 4DR5F 2MZ1A 3FUYA 4MKAA 1RBOB 2LECA 3VF6A 3WXMB 1J9AA 2UVWA 1OJ4A 3KDNA 4L6V3 3MAAB 3CJCA 1GX5A 2NPIA 3M1FA 2WONA 4CM2A 2OUGA 2H3EB 2YI1A 1T8EA 2H65B 3BREA 1YTAA 4WYWA 3HFZB 1KFSA 1RTIB 2QA4S 1HKCA 5HN0A 2G8UA 3T5KA 2P1JA 1LNQA 2AGOA 1U2CA 2HWTA 4FP9A 1KLNA 3NF9A 5H1SQ 4H4MB 2P9KB 1RT7B 2BRLA 3BZCA 3M3ZA 4ECVA 2D0BA 1HNZJ 1R8AA 2FJAB 1D4XA 3P4UB 2CNKB 3KOAA 1BE4A 3NS5A 1H2VZ 4PHTX 4JI5K 4WU2A 1M5OC 3THXA 1RJJA 1FRMA 3LUYA 3AODA 3A3NB 2FZKB 2MSSA 3LPTA 4EGLA 4U7CA 1N5VA 3C19A 3TUIC 3ZT4A 4X4SA 2OCEA 3AA4A 2DITA 3DDIA 2X78A 3LDNA 3W5ZA 3J7ZO 1HBOA 2A6OA 3ETOA 2CG8A 2OA8A 4HACB 4KGZB 5A8WB 3FCHA 3QGPA 1FDDA 3ZEUA 2DH8A 3WNEA 4Y2KA 4CK1A 3D2FA 2BMBA 3CCWA 4FK4A 2FLOA 1WG5A 3BH6B 2IRXA 4I0WA 1HWLA 1NGBA 3VHQA 4DJBA 3OT9A 3K2YA 3FFIB 2Q66A 4LBHA 2CGLA 2YWWA 2EPIA 1FDBA 4R5PA 1RTZA 5GAGP 2G8WA 2RKIB 3QO9B 3FZ2A 1S22A 4JAXA 4FJNA 1SC6A 3TAFA 3J81j 4NYPA 1TUWA 3KD5E 2EFOA 4CIFA 3AHPA 1OYDA 2GV9A 3M8PA 5LOQA 3BP8A 1IG8A 4YS2A 2J9DA 5AQSA 5AQWA 4FPAA 3PSFA 3L7UA 4JB8B 1KR4A 4X4OA 4WJBA 3AVKA 4WBFA 3HX9A 3D28A 4NLCA 4FSVA 3N01A 3D6TB 4URGA 2BH1A 1V3ZA 3KD1E 3ZX2A 3IG1B 1D9DA 1GMWA 3AVAA 2LQJA 4CLKA 1QQCA 3G9CA 4Q8FA 3FGVA 4LF1A 1VQ8S 1TL7A 1ZM3A 3KUHA 4DV3F 3UKUA 3EVMA 2AJ2A 1TL1B 4RX6A 1OVYA 2WSEC 3CCUS 1BXNA 3D1HA 3CCJS 1GAOA 3GG4A 3I4HX 4B3TK 2W42A 3HSJA 3M7VA 3EZOA 1SJ4P 3K0SA 5I3UA 1NBWA 1U04A 2AJ0A 1KQKA 1NBEB 1JXVA 5AQGA 4YOEA 2ZEJA 1CPZA 1KLMB 4IO1A 1RTDA 4UTGA 3V9SA 4EUVA 5H9FK 1S1WA 1Y97A 3UCGA 1VOMA 1IJEB 4DTPA 2V0NA 3BEGB 3MTKA 2MLYA 2UXBF 1NSQA 5EOYA 1FXRA 4WIIA 4KH1B 4QR2A 2I1RA 2MLZA 5KT7A 1BWFO 4KTQA 3EPIA 1VQMN 1Q9XA 4EP4A 4Y2MA 4JI3F