3BGRA

Crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with tmc278 (rilpivirine), a non-nucleoside rt inhibitor
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title High-resolution structures of HIV-1 reverse transcriptase/TMC278 complexes: Strategic flexibility explains potency against resistance mutations.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase, hydrolase
total genus 158
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3bgrA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bgrA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bgrA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bgrA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3bgrA05
2D3UA 3HVTA 1K6YA 1YTUA 5I42B 3RB0A 5E41A 2XRIA 1Z4UA 1SKWA 1ASUA 1DTTB 1WNEA 2OPRA 3OLBA 1LW2B 3NF7A 2WONA 5HROA 3C6TA 1RBSA 1SV5B 2J6TA 3GIJA 4O4GA 3KK1A 4IFYA 2R2TA 2UVVA 3T3FA 1JIHA 4KHUA 5JS1A 1G15A 4KFBB 1UA0A 3VQCA 1S9FA 3CJ0A 2G8KA 3B6OA 3EZ5A 4Q8FA 5DQIA 2BDPA 3D28A 3V9UA 3S3NA 3F9KA 2D0BA 3ZSOA 4HUGA 1TK8A 1S6PA 1KVAA 3S3OA 3TARA 1N4LA 2FLPA 3DLEB 1JLEB 3C95A 2EX3A 4M3TA 4ZMMA 1J5OA 1HARA 3JYTB 4RNMA 5KFRA 1NKCA 1RCHA 4ZHRA 5HRNA 1K1SA 4KAZA 3AO1A 4RUAA 2JEIA 4MFBA 4IR9A 4CCHA 4ECSA 4CEDA 1ASVA 4FLTA 3SFUA 4RNOA 3BSOA 3SPZA 1B9DA 1ITGA 1KVBA 4CHZA 4CF1A 1U48A 5KT4A 1BQNB 4KI6A 2FBVA 5KFKA 3MEEA 3NFAA 5K14B 4JRPA 3THVA 3TR8A 1HYSA 2J6UA 2XI2A 4K4XA 4C8NA 3MECB 4FVMA 5T7BA 3LZIA 4CF8A 2GC8A 4QWAA 2YNIB 2E6LA 4H4OA 4ED7A 2IM2A 3H59A 4CJ4A 2ZE2A 3OL8A 3QEIA 2IM1A 1N5YA 5KFOA 2B5JB 3OYKA 3RRHA 3NH1A 3DLGB 1RT3B 1C0UA 1JLQB 4O0JA 4CGGA 1JLFB 3BQ0A 2A1RA 3CDWA 4GMJB 3MAQA 1GOAA 1JKHA 4NLOA 3VQSA 4CF9A 3CVKA 4DF8A 1TV6B 4KO0A 4F4KA 4C8KA 5J2QB 4O3PA 1S1TA 4CEFA 2IOCA 1D1UA 4MIBA 5I3UA 4FJ9A 2C22A 3HHKA 5DLFA 1D0EA 4IKFA 4TYBA 3QNOA 1TK5A 4BE0A 2KFZA 1LAWA 3ZCMA 2BANA 2X6NA 3NAHA 2FJVA 3DRRB 4K4VA 1VSEA 5CYMB 4DF4A 4BWMA 2OZMA 3NKYA 2XCAA 5DG9A 5KT6A 5HLFB 4LSLB 3SQ1A 5KFPA 3WNFA 2YNHA 4DL7A 1MU2A 2FLLA 3AVAA 4E89A 3ZT3A 4DSFA 3QIDA 4FS1A 1KTQA 4ZP6A 4WFZA 4ELUA 1RT5B 4DL2A 3OL7A 4O3QA 4CJWA 4ZVGA 3OHAA 2DPJA 1NNDA 1WSGA 2B43A 3ZT0A 2C28A 1Z26A 2DFHA 4RU9A 3BSNA 1T3NA 3L2UA 3VN5A 1SH3A 4NRUA 4ED8A 4F4XA 3CO9A 1WSHA 4M3WA 2E9ZA 2V4QA 3PW4A 3HVTB 3V9SA 4MQ3A 4IG3A 3WNHA 4DL4A 4ECZA 2XY8A 3FFIB 1VSDA 4CJ5A 2WONB 5HROB 4WYWA 1REVA 1TKDA 3D5MA 5CZ1A 4AHVA 4IFYB 3QLHA 4W5TA 4B9MA 3KJVA 3I0SA 4DL6A 4KV8A 5KGXA 2VWKA 3IGVA 1S6PB 1D5AA 1C0MA 4B9TA 4N76A 3BR9A 2X74A 3LP1B 1EP4A 3KLEA 1FKOA 1BHLA 1T03B 1QUVA 3LP2B 2A1SA 4KTZA 1ZTTA 1TGOA 3NF9A 4DTUA 3KLVA 2W42A 4XO0A 1T05A 4ZHRB 4IH5A 1RT7A 3D45A 4CHNA 2XWYA 5J2NA 4WE1A 3AO4A 3OLAA 1VRTA 4MFBB 1RBRA 4KRFA 2HW3A 3SZ2A 1RA7A 1DTQA 4NCBA 4R8UB 2OZSA 3DDKA 4X2BA 4IRKA 3DLRA 1N6QA 4ECTA 1J53A 2PYJA 2EHGA 4KHNA 4RW9A 3LDSA 4RZRA 4Z0UA 1HYVA 2RN2A 4E0DA 3HVWA 4OKEA 1TVRB 2GIQA 2AGOA 1BIZA 1VSMA 3ZT1A 3AVKA 2RPIA 1QHTA 4O3RA 3VQQA 2ITGA 3HT3A 2IDOA 2C2EA 3D0PA 5KFDA 4CK1A 4KB7A 4FLUA 2D5RA 2ZE2B 4DTXA 3Q8RB 3PW5A 5DK5A 3O4NA 1DTTA 3L2WA 3CQ8A 2XC9A 4TXSA 1TKXA 3H5SA 5SWMA 4EBEA 1LW2A 1C0UB 3DM2A 2FBXA 1XR6A 3TAEA 3LALA 2Y1IA 3ZSQA 2XI3A 2W9AA 4F3OA 3CM6A 4KO0B 3VQDA 4DTOA 4AHCA 3BSCA 2ZKUA 4JV0A 3NBPB 1S1TB 3H5YA 1HQUB 1NK6A 2FBTA 1JLBA 3H40A 5I3UB 3QESA 1WSFA 2OPPA 4CJFA 3SUQA 3C6UA 4MK7A 3OYIA 4LY7A 1QSYA 4G1QA 4NLRA 3V81B 4ECQA 1JLEA 4EP5A 4HCBA 4J9OA 4ELTA 4W5QA 2BANB 3HM9A 4KB0A 4CEZA 1KSPA 4Z4GA 3OS1A 4ZTFA 4TSXA 1RT2B 1IKWB 5CZ2A 2QXFA 2GIRA 2G8VA 4RW8A 2YNHB 4AHUA 4HVJA 4LQ3A 1J9AA 4O44B 3H4DA 1S1XA 1ZTWA 3OYBA 1RDCA 4OPKA 4KHRA 4F2SA 3OJUA 3I5CA 4NLQA 3N6MA 3V4IB 1X9SA 3G6XA 4BACA 1BQNA 5KT5A 4I9LA 3FRZA 1KLMA 3GYNA 4F8RA 4FLXA 1S0NA 5KFSA 3HO1A 3HK2A 4KTWA 3MR6A 1CLQA 3MECA 3T5LA 4FBUA 4KKOB 1QE1B 4NRTA 4YNQA 3V6HA 2YNIA 3RAXA 3RB4A 2FJXA 1W0HA 3WNGA 3IAYA 5KFFA 3NL0A 5HRRA 4KTQA 4TYAA 4ECRA 4MK8A 1S1UA 3O3FA 3RMCA 1TKZA 3NH2A 1RT3A 3UR0A 1IO2A 1TKTB 3OL9A 3MR5A 1JLFA 2O5DA 5EWEA 1XHZA 4F50A 2IAJB 1RTIA 1RA6A 4FLVA 5KFQA 1S97A 3QLHB 3QIPB 2RDIA 4FJIA 2HHQA 1N48A 1NK5A 2IS3A 1JL2A 3JSMA 4HYKA 3I0SB 4WZQA 3TQ1A 3OHBA 4KV8B 4I7FA 4KSEB 4ID5B 4PQUA 4HUEA 1LWFA 1RNHA 3S9HA 2ZQBA 3Q8SB 4N5SA 2BQUA 2VWJA 1NK4A 1EP4B 4LD0A 1FKOB 1A5WA 2ASJA 4CK2A 4KHSA 2WTFA 5CYMA 4CEAA 1S5JA 2JEJA 1B9FA 4KI4A 5HLFA 2DTUA 3M9NB 4LSLA 1T05B 3H4BA 4DS4A 3CJ4A 3DRSA 3DYAA 1YTAA 1XHXA 5KFHA 3B6PA 3LWLA 4G3IA 2VG5A 5J2NB 2B6AB 4CGJA 3OYHA 3HPGA 4WE1B 2UUTA 4ICLB 2WHOA 1GX6A 4B9LA 3BREA 3QETA 3AO5A 1JLGB 3GQCA 4AILC 4DTMA 4DSEA 4BDYA 4URGA 3V6DA 1I39A 3T1AA 4Z4EA 3M8PA 1N6QB 1DLOB 3OYDA 1NJWA 1TL1B 3V1QA 4EBDA 5DGAA 4RW9B 2ATQA 4DQQA 3LP0A 5KFCA 2GBZA 1RT4A 2FVSA 3SCXA 2V9WA 3SV3A 4CK3A 4EZ9A 2W7PA 3T5HA 1CZ9A 3QEVA 3UDLA 1U4BA 4NLDA 3V6KA 2DPIA 3FFIA 4DQSA 4FJLA 1TKXB 4OPJA 1BGXT 5KT3A 4NLWA 3DM2B 1S6QB 1ZBLA 3SPYA 2FVRA 3DMJA 2V0NA 3UQSA 3FSIA 1NOYA 3KHHA 1S9GB 4FYDA 4B3OA 3K59A 4K50A 2P51A 4FLYA 4OKJA 3BQ2A 4AHSA 1SUQA 4J2EA 1X1PA 3MR2A 4CIEA 1JLBB 4N41A 4OVLA 2OPPB 4CESA 3G10A 3G86A 1XR5A 1HPZB 3C6UB 2AX1A 1S1WA 4CJ3A 2UUWA 2Y1JA 4G1QB 3VQ7A 3LP1A 2IBKA 1KRPA 4CJPA 1SL0A 1T03A 3M8RA 3LP2A 3DOLB 4Q5VA 2AWZA 1A5XA 3G6VA 1T8EA 4KPYA 1RTDA 1IKYB 3VQBA 1QSLA 3PR4A 4DSKA 4RW8B 2HMIB 3SQ2A 4J9KA 3ZSXA 2QK9A 3SUOA 1S1XB 4DL3A 4IFVB 4CJTA 3GILA 5KT2A 2HAIA 1UWBB 4CEOA 4R8UA 1S9EA 4Q0BB 2HNDB 2FC0A 4CGIA 1WSIA 1C1BA 5F8LA 4IKAA 4U7CA 3T5JA 1KLMB 3TAGA 4DTPA 1TVRA 1S10A 2D41A 3PX0A 4CJLA 5C25B 4LSNA 3IGNA 4Z4CA 3CFPA 2F8TA 3KKRA 3ZT4A 3AVIA 1WLJA 1WSJA 4F4YA 5EDWA 1S1UB 2AU0A 1TKZB 1I3AA 2RDJA 4AHRA 5L1IA 3RMBA 3I5BA 4WYLA 1XWLA 2ETJA 1D9DA 4B8AB 2UVWA 2XO7A 2PY5A 3OYLA 4GW6A 1RTHA 5KFVA 3BQ1A 4YP3A 3L2QA 4TY9A 1RTIB 5L1LA 1TP7A 1C0TA 1RDRA 4BDZA 3RAQA 5KRTA 3NBPA 2KQ2A 4WXOA 1HQUA 3QEPA 3JSMB 3AV9A 2AGQA 3NGZA 4B9NA 1WAFA 3M8QA 4I7FB 3RMAA 2JLEA 4PQUB 3V81A 1JXLA 2AQ4A 1LWFB 4DQIA 4B08A 2X78A 1HMVB 4ZP8A 1BI4B 5KG0A 4OGCA 2VG7B 3Q8QB 2XY5A 1JXBA 1RT2A 5DQGA 1IKWA 3KK3A 1RBTA 3ZSZA 1VSHA 4I2PA 3NF8A 4FM1A 3M8SA 3DRSB 3DYAB 4O3SA 4O44A 2VG5B 1BCOA 3OVNA 4M41A 2FVPA 2Z1JA 4H4MB 3TANA 1JLCB 4QWEA 1WAJA 3KOAA 2RKIB 3OYAA 3V4IA 1CSJA 4IRCA 5DG8A 3ZSYA 3V6DB 1U45A 3ZSWA 3DRPA 3IRXA 3M8PB 4H8KA 4FZYA 3VQ8A 3U3YA 3PW0A 1RT6B 1CXQA 1S0OA 3MF5A 4DSLA 3LP0B 1IM4A 4DMNA 3K58A 1RT4B 4KKOA 1QE1A 4NLTA 3KD5E 4QAGA 3Q8PB 4CF0A 1R0AA 3KIOA 3RRGA 4ZP9A 3N6LA 4GC7A 4FW2A 4YR2A 4AHTA 1N56A 3CG7A 3RR8A 4ZTJA 1TKTA 2F8SA 4Q8EA 4NCGA 1C6VA 2IAJA 4CJSA 3WNEA 1RDDA 4L8RB 3DMJB 2FVCA 1RILA 3KLHB 3QIPA 4J2DA 4EO6A 4B3OB 2RF2B 1FKPB 4CGFA 2R8GA 4FJ5A 3L2RA 1ZBIA 4YR3A 1SUQB 3OJSA 4W5OA 4E19A 3MEGB 4ID5A 2CJQA 4Y2CA 1S1WB 4O3NA 3LZJA 1RTJB 4ZPBA 4HTUA 3HL8A 2NUBA 3CJ5A 1WNSA 4CHQA 5KG3A 2ZD1B 5KFEA 2ATLA 3QIOA 3EPIA 2R2SA 4RW6A 2I1RA 1RTDB 3IN5A 1WSEA 2FJWA 4FJKA 2B6AA 1U47A 3NH0A 3H2LA 4M3YA 4I9QA 3LANA 4ICLA 3RR7A 3E51A 3V9XA 4FLZA 3PR5B 3NAEA 1JLGA 4FZXC 1S9EB 5KG1A 3L3VA 1Q8IA 1SL2A 5DLGA 1C1BB 4NZ0A 3NMAA 1DLOA 4JUZA 3K57A 4TY8A 2BE2A 1TL1A 5JUMA 2HWHA 3OYCA 1ZETA 4DQRA 1W25A 3AA2A 3IG1A 3P1GA 4FK4A 4LSNB 4ZVFA 3LPTA 3PHEA 3AA3A 1NK7A 1BIUA 3F73A 1S4FA 4TQSA 2V4RA 2W8LA 4O55A 3T19A 2HVIA 1WN7A 2PYLA 5CY4A 3NGIA 4R0EA 3DOKB 1HNVA 5KFGA 1U49A 1S6QA 5L1JA 4K8ZA 4CECA 2UVUA 4JS5A 5D3GB 3MFIA 3SUPA 1RTHB 4AH9A 1TAQA 1S9GA 2G8FA 2E4LA 1I6JA 1KHWA 3E01A 4NLPA 2YHBA 4DSIA 3VQ9A 1C0TB 4FK0A 4M3XA 4FJNA 3QEWA 2VA3A 3OYJA 1HQEB 3DLBA 3M8QB 4LQ9A 1HPZA 4HKQA 3K5OA 2O4IA 1QTMA 3GIMA 2OH2A 2R2UA 1LW0A 2OPQB 3UPFA 2UVRA 1QSSA 3DOLA 3HPHA 4EYHB 4CEEA 3RMDA 1D9FA 4Z4FA 4KBIA 2W9CB 1IKYA 4QWDA 3KK3B 2YKNB 3KHLA 1L3VA 1RT1A 4I2PB 2VG6A 2HMIA 3V9ZA 4ZVHA 1L3UA 5F8MA 2IGIA 1HYZA 4IFVA 3HVRA 4OLBA 2ASDA 4FM0A 5KG2A 1UWBA 4FCYA 2G8UA 4Q0BA 2HNDA 4NLSA 2JGUA 3DRPB 4CEBA 3IRXB 4E7IA 2KW4A 1HRHA 5C24B 3CJ3A 2R7YA 5J1EA 3KK2A 1B92A 4EZ6A 5C25A 2WOMB 4CIFA 1X9WA 3SQ0A 4RW4B 5EWGA 3EYZA 4CE9A 5KI6A 4CERA 1R0AB 3VA3A 2QV6A 1KFSA 4F2RA 3KD1E 4ZPDA 3PW7A 3AVFA 1RYRA 3K5MA 4IOBA 3VA0A 1LV5A 3KNAA 2W9BA 2HHUA 4NCGB 5FROA 2F8EX 4IG0B 1JL1A 1BQMA 3TVKA 1SKRA 3LAMA 4DG1A 3AA5X 3OYNA 2AJQA 2ILZA 4MKAA 2KFNA 1F21A 3PV8A 5F8GA 4YMEA 5JXSA 2YNGB 4URSA 1EKEA 3NHGA 4DLEA 4EP4A 2Z1GA 3AVHA 4Z4IA 4DL5A 2Z1HA 3QZ7A 3M9OB 4CHYA 4KREA 1HMVA 3EPGA 1BI4A 2HNYA 5DQHA 4RNHA 2VG7A 1VRUA 2G8WA 1IH7A 2IJFA 4CFDA 2IMWP 2JC0A 4RW6B 2IJNA 1XI1A 4ECXA 2BQ3A 1HJRA 1KLNA 3DLHA 4XIUA 4UQGA 3HXMA 4H4MA 2XGPA 1QQCA 3SQ4A 1JLCA 4M3ZA 2O4GA 1O1WA 1CXUA 4OKKA 4RG8A 2ASLA 2RKIA 3V9WA 4DTNA 4QOZB 2AGPA 4QW8A 4EO8A 3ICLA 2HB5A 4E1NA 1D8YA 3A2FA 4DTSA 3QERA 4RW7A 5KRSA 3GIKA 2EC0A 4TY8B 2BE2B 2OPSA 3RB3A 2E9TA 4QWBA 1RT6A 3KLFB 1NHUA 4GVMA 3TABA 3I5AA 1J54A 4C8MA 3NE6A 4O5BA 2JEGA 2OA8A 2IC3B 3IG1B 2XGQA 3QGIA 5DMRA 1YT3A 2C2DA 3KMQA 2BRKA 4CJUA 2HHWA 3CWJA 4CHPA 2YKMA 1LWCA 3MXIA 1CZBA 1HNVB 5C42B 3PVXA 4F3TA 1T94A 1RYSA 2I5JA 3CDEA 5T14A 5DGBA 3TAMB 1LWEA 3PY8A 1KCFA 4FJ8A 3KLHA 4ECUA 3AVMA 2RF2A 1FKPA 3E01B 3MXJA 3CYMA 5FRNA 2YNFB 1TAUA 4CEQA 4OL8A 1GOBA 3QINA 3MEGA 2JC1A 1RBUA 1OS5A 2HHXA 5FDLA 2P5GA 4Q43A 1S49A 1RTJA 2W7OA 1S0MA 1LW0B 3L3UA 1C1CA 4ZP7A 3S3MA 4OLAA 2ZD1A 1VSFA 4E1MA 2P5OA 2HNZB 1HNIA 1VSLA 3BGRA 4B9VA 3AVNA 4Y3CA 2HHSA 1RT1B 3M9MB 2VG6B 5KFXA 1BISA 2YV0X 1KFDA 2FVQA 3ITHB 4CFBA 4URQU 3VQ4A 4CFCA 4WFYA 3DI6B 1NJZA 2QKBA 2E9RX 4DWIA 3V6JA 3NCIA 3ZT2A 4M42A 2R8HA 2D3ZA 4JV2A 3GV8B 3IS9A 4IDKA 1NK8A 2G8IA 2DFEA 3QGHA 2B4JA 3HYFA 5J1EB 3KK2B 3H08A 1RBVA 1T7PA 2R8JA 5EWFA 4K8XA 1EETA 4CFAA 1TL3A 2G8HA 4ED3A 3H98A 4CHOA 3PW2A 4ED0A 3SV4A 2ALZA 3DOKA 3NGDA 4YQWA 4DU3A 4GC6A 3MFHA 4DQPA 4J2BA 4RNNA 1UAXA 5D3GA 5SZTA 2W9BB 3TAFA 1UOCA 3NGYA 1ASWA 4QPXA 4KHYA 2CKWA 3AA4A 5HBMB 3MEDB 4E7HA 1BQMB 3CJ2A 4NLUA 2QE5A 4FLWA 4DG1B 3QNNA 1FK9A 2W8KA 1FXXA 1HQEA 4PUOB 2FLNA 5KFMA 2HHTA 4M45A 4CJQA 1IKVA 2OPQA 4TQRA 3N6NA 4OGEA 5KFLA 4K4SA 4M3RA 4EBCA 4PWDA 2HNYB 5F8NA 3V1RA 2FBYA 4TN2A 1VRUB 4E7KA 2X6SA 2W9CA 3OSNA 3PUFA 5KG6A 2YKNA 4K4WA 4ED1A 4E3SA 4MH8A 4CJEA 2BGGA 4KB1A 3P5JA 3L8BA 2XY7A 5J2PA 1A5VA 1VSKA 3RTVA 2R8KA 3KLIA 4MK9A 3PO5A 1W9HA 3DLKA 4F4WA 3ALYA 3HPOA 5HP1B 5CYQB 4RNFA 1S48A 1C1AA 3UIQA 3CFRA 2R2RA 1GX5A 2Z1IA 5KTQA 2Q3SA 5KG5A 4RW7B 4Q45A 2OPSB 1QS4A 5C24A 5KFZA 1RDAA 4NLGA 3I0RA 2WOMA 1L3TA 4RW4A 4FJMA 4IH7A 2LSNA 2XCPA 1X9MA 3GIIA 4R5PB 5F9LA 4Y2AA 3OL6A 1JLAB 1Z25A 5C5JA 3TWHA 2GUIA 1SL1A 4QWCA 2AX0A 3LP3A 4N47A 1Q9XA 3SYZA 2YKMB 1LWCB 4PY5A 2I5JB 1IKXB 3KLGA 4FJXA 4ECYA 1TK0A 4FS2A 4K4UA 4JV1A 3AVGA 3VQAA 1LWEB 1QAIA 4IG0A 4ED2A 3G0ZA 4NLYA 1LAVA 3G6YA 4HCCA 2OPRB 1RDBA 5J2MA 4RUCA 4BDPA 1SH0A 5KFJA 5L9XA 2YNGA 3C6TB 3ZSRA 1K1QA 2GV9A 2R8IA 3HP9A 4O4GB 3OYEA 3KK1B 3TAPA 4LH5A 1NK0A 2XHBA 5FDLB 1BL3A 4I2QA 2E6MA 2KZMA 3PJWA 2BR0A 4IRDA 1C1CB 4O0IA 4EEYA 1ZYQA 4CF2A 3QZ8A 1GOCA 3QO9A 1RAJA 1HNIB 3BGRB 4NLVA 5KFIA 2F96A 1Q9YA 3OYMA 3ISND 4OJRA 3PZPA 3PX4A 3OS0A 1EX4A 4FW1A 3VQEA 1NHVA 4WXWA 1J5OB 5KG7A 3OYGA 3GV7B 2HVHA 3SFGA 4BE1A 5F8IA 5DG7A 2P1JA 4CIGA 3KLFA 2C2RA 3IS9B 3TI0A 4IDKB 4MIAA 3QEXA 3LWMA 3SI6A 2IC3A 2WB4A 1KHVA 3FQLA 2OYQA 3NF6A 4QCLA 5KFUA 1EETB 3PO4A 4PA1A 1TL3B 4FXDA 4FJJA 1S1VA 4FM2A 4ZVEA 4NYFA 2VA2A 5HRPA 2HWIA 3RBEA 3K5NA 3OS2A 4JRQA 2BQRA 3MEEB 4DS5A 4DSJA 4ED6A 4FJ7A 5C42A 1HYSB 1QAJA 3K5LA 4YFUA 3FDSA 1VSJA 3GV5B 3ZSVA 3TAMA 4BE2A 4K4ZA 4H4OB 4IR1A 5HRSA 5I42A 4Q44A 3P83D 1EXQA 3NAIA 1N5YB 4E7LA 3SJJA 4KE5A 3HSTB 2YNFA 3AVBA 4BWJA 1FK9B 4J9SA 4H54A 3C94A 4HHTA 1SV5A 4QW9A 3KKSA 4Y1CA 2D0AA 1JKHB 4DLGA 4KHMA 4CGHA 4WFXA 4B9SA 1NJXA 4KFBA 1IKVB 4J9LA 1NKEA 4FJHA 3AVCA 4PWDB 3LPUA 4FK2A 2HNZA 3KHRA 4Y1DA 5EUHA 4ECVA 2DY4A 4NCAA 4J2AA 5L1KA 4DEZA 3HJFA 3H5UA 3QGGA 5KFNA 3DLEA 5J2PB 2HHVA 3KLIB 3ITHA 3CIZA 3KHGA 4KAIA 3HP6A 3DLKB 2BRLA 3RBDA 3DI6A 3JYTA 2ILYA 3PX6A 4ZPAA 5F8JA 1YVUA 2YHAA 3CDUA 4JS4A 4W5RA 4W5NA 5KFBA 4M3UA 1VSIA 4LH4A 1MU2B 2D7SA 3CFOA 4WZMA 4FJGA 2J6SA 4IBNA 3I0RB 4DU4A 2WRMA 1IG9A 3ASMA 1VK0A 4DU1A 3OYFA 3SI8A 5KG4A 4HUFA 5JS2A 1ZBHA 1SKSA 4KHQA 4U6PA 1NK9A 1L3SA 4NYNA 3T5KA 1JXEA 1NOZA 5K14A 4DFJA 3BDPA 1L5UA 3RB6A 3HKWA 3NDKA 4DFMA 3MXMA 1YVFA 2D0CA 3KLGB 5F9NA 3EY1A 5KFWA 5KFTA 1KVCA 4TLRA 3ULDA 2XY6A 5HBMA 3MEDA 2IM0A 4K4TA 4B8CA 4J9QA 2B5JA 4NYZA 4IG3B 3DLGA 1JLQA 2IM3A 3V1OA 3BJYA 4M94A 4PUOA 5J2MB 4DTJA 3MR3A 3AO2A 1REVB 4O4RA 2JEFA 4FZZA 1JX4A 4E7JA 1TV6A 2DFFA 4J9NA 1SH2A 4ECWA 5FRMA 5J2QA 2KTQA 4I2QB 1Y97A 4XPCA 4K4YA 3K2PA 3KJVB 1XC9A 4NLXA 1BCMA 3EZUA 4M95A 3QO9B 1NJYA 5KGWA 3HVAA 4DFKA 4B9UA 4IQXA 1UA1A 4J9PA 3L2VA 3AVJA 4ID1A 4ZPCA 2QKKA 3ISNC 2IA6A 3DRRA 3KLEB 3QYYA 5HP1A 5KT7A 3I8DA 4Y34A 5CYQA 3TAQA 3AVLA 5EU7A 4CGDA 4JLHA 3SNNA 1NKBA 1XR7A 4C8LA 3AO3A 3FQKA 3O3GA 1RT7B 3VQ5A 4FBTA 4CJRA 1ZBUA 1MMLA 1VRTB 1U04A 4CJKA 3MTKA 1RT5A 4Z4HA 4YR0A 4CJVA 3VQ6A 1DTQB 4EYIB 1ZBFA 4IH6A 3U3GA 4F4ZA 3BSAA 5KFAA 4R5PA 3OSPA 4DFPA 3PJXA 3KMSA 4O3OA 3H5XA 2KZZA 4J9RA 1JLAA 4DTRA 3CM5A 1S1VB 3VQPA 1C2PA 4J9MA 1U09A 4C8OA 4MKBA 3LAKA 3KTQA 3OY9A 3SUNA 4XPEA 4N56A 1TQLA 4KHWA 3O3HA 1IKXA 3O4QA 3U6FA 2WK4A 2WCXA 5KFYA 3RWUA 4ELVA 2PZSA 5F8HA
chains in the Genus database with same CATH superfamily
3HVTA 1MMDA 5I42B 2JRSA 1LFPA 5ETQA 3RB0A 4CZLA 5E41A 2WVDA 3WQUA 1RACB 1GT8A 2BUNA 3IMXA 1RBSA 3NGTA 3KK1A 4NXNK 3FMWA 2R2TA 2MLXA 2HVZA 4GVLA 1UA0A 2H51B 3CJ0A 4OYAA 4F0MA 3D28A 3S3OA 2L9WA 3MCNA 3TARA 4MTPA 1N4LA 5D4PA 1RWKB 1G3OA 1JLEB 4KH0B 2VDHA 2FHJD 4M3TA 1SAZA 5GIPA 4BRQA 2ZJPQ 2LCWA 4JI0J 4AQYF 5IT4A 5KFRA 1NKCA 3M8YA 2H5JB 3EM1A 3AO1A 1NGBA 3UCZP 1N88A 4X65J 1S77D 4IR9A 2NSCA 4ECSA 2RILA 4CEDA 3SFUA 4RNOA 3FEZA 3BSOA 1B9DA 1ITGA 1KVBA 2XMTA 4DCHA 1QDUB 1BQNB 2FBVA 5D77A 1RWWB 1A7GE 5KFKA 3LGMA 3NFAA 5K14B 3THVA 3TR8A 3L4IA 2J6UA 3BPDA 4K5SA 2OCEA 4C8NA 2VF3A 3UD5A 3LZIA 1VQ8N 5L38A 2AYBA 3M1FA 1UZHA 1P8ZA 1VQYA 3OL8A 1WOSA 2IM1A 1N5YA 2EFGA 5KFOA 1N33J 3DJCA 5C0YA 3DLGB 1GTEA 3ATVA 3BGOP 5LL6Z 4CGGA 2A1RA 4DU8A 4GMJB 1JKHA 2WW8A 3CVKA 1TV6B 1JWWA 1RXOB 1S1TA 4LFBF 2J7KA 2VWBA 5EY4A 1OPZA 4CEFA 3G87A 3R7SB 1D1UA 4FJ9A 2C22A 4NB4A 1EB0A 3M6WA 4LFAF 3S6EA 2GMJA 3L0QA 3ZCMA 2BANA 2LXUA 1YBUA 4K4VA 1RGVA 1M90T 3QATA 4DF4A 1B7FA 5JLHA 4LSLB 3VF4A 2JWNA 1MU2A 3LOUA 3LQVA 2FLLA 3PSIA 2VFVA 4E89A 1RWXB 3ENAA 4DSFA 3ZT3A 3QIDA 1TL4A 5ETKA 4FS1A 1KTQA 4R79A 1HHSA 4DL2A 4GKKK 1NZAA 4LR7A 4B3RK 4Z7CA 3MX5A 1Y5NB 4NMLA 4X4RA 3H20A 4FVCA 2NXNA 3DWLA 2RHSB 3GG4A 2C28A 3BSNA 1MA9B 2FSNA 2B8PA 3L2UA 3SMPA 4F4XA 1WSHA 2MHEA 2V4QA 3HVTB 3PG9A 1EWRA 2FY8A 3NNCA 2MLYA 1F60B 3VERA 4K43A 1VSDA 1B0PA 3FZ2A 3JXUA 2ZEJA 2NSBA 1RLCL 4BLGA 2XHWA 3HD1A 4AHVA 2A41A 4W5TA 4B9MA 4A57A 2Q0RA 1PYOB 1WG4A 3KJVA 1REGX 4DL6A 4KH1B 3GDQA 1NMNA 1IJJA 1M5OC 3DU5A 4X64K 4DKWA 2VWKA 2F7VA 5EX0A 2H9ZA 3LP1B 3D0GE 1CQMA 1T03B 3EZWA 1ZTTA 3C3LA 1KWMA 1NJIT 3D2FA 2CYYA 4IH5A 1H74A 1FXLA 2XWYA 5J2NA 3LDPA 2GGPA 3AO4A 2ZH9A 2XS5A 1DTQA 1VQMN 3JB9k 2OZSA 1BU6O 2M52A 1N6QA 1P1TA 2BH1A 3TUIC 1WC0A 4EU0A 2EHGA 1F1BB 3WXIA 4KHNA 3NCPA 2NS1B 1LFWA 4Z0UA 1HYVA 2RN2A 1IBKF 2YKOA 3BBCA 1VSMA 3AVKA 1H38A 4O3RA 3HT3A 3VQQA 4B1XB 4FN5A 1ACMB 1UTAA 2E5HA 2LU1A 2AMCB 3PW5A 4PKHA 4TXSA 1TKXA 5SWMA 4FKYA 3TX8A 3KWGA 1LW2A 4C3MA 2XG8A 3H3OB 1XR6A 3NGUA 4M63C 2H4YB 5ELZA 4F3OA 5A0YA 1V3SA 1WOQA 1KONA 3PSFA 1X4GA 3UWTA 1U1KA 2ZKUA 4JV0A 1S1TB 1RU1A 3C46A 2FBTA 1FA0A 4ETXA 1OO0B 1VQ5N 2RD5C 3SUQA 4G1QA 5SUHA 1T9TA 1P9YA 5LMUJ 4DV0F 3K7RA 1FDBA 2C3PA 4USVA 4J9OA 4W5QA 2BANB 2UUBJ 5FPMA 4NWBA 3ET6A 5LT5A 1KSPA 3HBTA 3OS1A 5D6GA 3CJBA 3M2UA 1IKWB 4I6MA 2QXFA 3KJFB 4LQ3A 2R7TA 4LF8K 2I6WA 1WOOA 3CPWR 3OYBA 3CQYA 4F2SA 5JMVA 2YQ1A 4RBUA 2ZM6F 3JS9A 4DV7F 4BACA 3TTDA 3GYNA 3VZHA 1Q7YO 2I38A 3EVWA 5D0HA 4DV2J 5KFSA 3WX8A 2QWPA 3HD2A 4KTWA 4QS8A 1DAXA 4YDUA 1EZZB 1V9OA 1DJ0A 4FBUA 2GX8A 3RAXA 3PYDA 3WNGA 5C7PA 4WFBQ 3MWPA 5GAEU 5HRRA 4TYAA 4DR5F 3EXCX 4MK8A 5GAEI 5IM0A 2HS3A 3NH2A 1RT3A 3UR0A 2HHHF 1CJUA 1Q4RA 3MR5A 4H4KC 4C3LA 3AH6A 5EWEA 1XHZA 1WEXA 3OBYA 3IO1A 4CYUB 2HKEA 2BJ9A 1RTIA 4FLVA 3HDSA 3N5FA 5C2FA 4LF9K 3IA0A 2V9KA 4X4OA 1N48A 1RAGB 2UUAK 2YPYA 4QIGA 1UVJA 2L9NA 3OHBA 1Q1KA 4Z2XA 2MZJA 3NOGA 4ID5B 1O51A 3O80A 2E8AA 3P38A 1GLAG 1RNHA 4N5SA 2VWJA 2BQUA 1UVIA 2MLZA 1A5WA 2WTFA 1OMSA 3L95X 2DHAA 4M5LA 1B9FA 3M9NB 1F3FA 3D2FB 3DRSA 4CZKA 4CD1A 1XHXA 3MMVA 2LEPA 3QAUA 5J2NB 2SXLA 4ISFA 3TVYA 3HPGA 2GGPB 2Q43A 2WHOA 4CZGA 1GX6A 4B9LA 3QJJA 2CQHA 4LFAJ 4URGA 3VR1A 3N0VA 1RUSA 2N4CA 4OZ0A 3M8PA 1N6QB 2XSJA 2OSQA 1IBMF 1NJWA 2DPNA 5I3PA 4OZ2A 2CPYA 3VAMA 1R59O 5IWAK 4DR3K 2YX7A 5HVGA 3G4SN 3CJKB 5L39A 1U4BA 1WHVA 2DPIA 1LQ9A 4DQSA 3EN9A 1TKXB 1BGXT 3HRGA 5KT3A 1LOUA 1S6QB 1ZBLA 5AQVA 2K1RB 3UQSA 1MG7A 1TFWA 4FYDA 5F41A 1HHTP 2GNKA 3MM8A 4ILMA 1EARA 1ZAWA 2Q3PA 3UB5A 3BQ2A 4J2EA 1X1PA 2DK2A 2RNEA 4OVLA 2G2OA 2AX1A 4G1QB 2IDEA 2HQCA 4RJVA 4LFCK 4Q5VA 3W61A 2VBYA 3G6VA 3ET6B 2LQ9A 1T8EA 1RTDA 4OPAA 3ZLJA 4PKIA 2NXJA 1QSLA 4I6MB 3MMJA 3CJ9A 3DC2A 2HMIB 2D74B 1RLDA 1FTCA 3SUOA 4DL3A 4WFNQ 4IFVB 1J27A 5LMNJ 1TTHB 3N79A 1FEHA 3KUGA 4QPTA 4CEOA 2BV3A 4AM6A 4Q0BB 1PO6A 2J9EA 3PFOA 4CGIA 1WSIA 2WBNA 2FXUA 2RRNA 1X31C 5K8NA 2BTFA 3G4SS 3TAGA 1NGGA 2BBEA 1S10A 2D41A 4ZIWA 4LSNA 2JWKA 4ZCMA 3IGNA 2F8TA 4LBHA 2GV1A 2RB7A 2B9WA 4WFAL 3ZT4A 2JX2A 3AVIA 4NASA 4F4YA 5EDWA 2AU0A 3J7AP 3M2VA 5LJVA 2ADBA 4U8VA 3IXQA 1CJUB 4WYLA 3BUZB 3CJQA 1B70B 4B8AB 3JQKA 2HQDA 2AJ2A 4YP3A 3L2QA 3ILIA 1RTIB 5L1LA 5AQYA 2BE7D 1RDRA 2Y1RI 5KRTA 3LUYA 1KAYA 3BGLA 4EMDA 3AFGA 1GTHA 2PFFB 1X5PA 4DUZJ 2QMXA 4O8UA 5C10A 3W62A 2AQ4A 3KZBA 4GKJJ 4DV4F 1NGAA 2GA7A 4JI7K 3KK3A 2RQMA 1VSHA 3NF8A 1TELA 3DRSB 3VAIA 6FDRA 4NZ6A 3O3LA 1BCOA 1VC0A 2FVPA 3TANA 2KM8C 4DBQA 4NLBA 1WAJA 4W92B 3JSYA 5DG8A 1U45A 3ZNUA 3DRPA 3NCQA 3M8PB 2XSJB 3HHLA 3J7YP 3U3YA 1P90A 1RT6B 3IBFB 3IWNC 3BPSP 2ATCB 4P9SA 3ILLA 1YBTA 1IM4A 3K58A 2E7VA 4KKOA 4NLTA 1SC6A 3GZ7A 3RRGA 2E2QA 4FW2A 3JSRA 5F3ZA 1V4SA 1N56A 2DNGA 3CG7A 4DR6K 4ZTJA 1TKTA 5A76A 1T3OA 4DV7J 2E1CA 3ZTQA 2IIHA 4NCGA 3EUNA 1RILA 3CSKA 3QIPA 1XMBA 3TVZA 1RADB 2GMHA 2HAFA 1N36J 4AD6A 1ZBIA 2HSTA 4W5OA 4DR5J 1YJUA 5GAHP 3MEGB 2GEMA 4H5NA 2HHHJ 2W4DA 3TPQA 4YS2A 2WW4A 4F36A 4HTUA 3KYLA 3K9JA 3PFEA 4A8QA 1FD2A 5KG3A 3CJSA 2R7XA 3W7BA 4RW6A 1NM1A 2UXDF 1RTDB 1FFSB 4AL6A 4JK8A 2FJWA 2B6AA 1WTBA 3NH0A 3H2LA 1V5VA 4ICLA 3RR7A 4I9QA 3HT0A 2H4WB 4NI2A 3EGVA 4BC5A 2F4VJ 2QMWA 4Y65A 3L3VA 2DCLA 3LDQA 2QZ8A 4UZCA 1SL2A 5KOWA 2CGKA 1DLOA 3K57A 4JI1J 5IZHA 3E9OA 2HWHA 4X66K 4CZHA 3OYCA 2P9GA 4DQRA 1Y10A 4ZDNA 3P1GA 1RWPB 4FK4A 4LMZA 4LSNB 4ZVFA 1ESVA 3OA9A 3LPTA 4ES2A 3OXGA 3GSIA 1NK7A 4PZVA 2CQ4A 2V4RA 3BO2A 4ZLJA 4O55A 1F0XA 5H1SQ 4X62J 2QA2A 1FRLA 2PEHA 1PBAA 5KFGA 3K0JA 1U49A 5L1JA 4K8ZA 1IBMJ 3DLLL 4J9VA 3MFIA 2HQ3A 1MN9A 5EGYA 1S9GA 2G8FA 1F9HA 4CP5A 3VQ9A 1Y3KA 4EK2A 5K8OA 4FK0A 4M3XA 5I9EB 5F1XA 1Y3JA 5ETPA 4LQ9A 4FOEA 3THWA 2JVRA 1SS6A 3BH7B 4CO0A 1PGZA 1LW0A 2G9OA 3VOVA 2UVRA 4LJMA 3CETA 3D6FB 3KVGA 4DR1J 1OY8A 1NXIA 3T6JA 1D9FA 2DNHA 3NXZA 1M0SA 2D9PA 4QWDA 1VBKA 3KK3B 1F9FA 1M90O 1NZ8A 1RT1A 2O8CA 1HNZJ 3E3XA 3KWIA 3V9ZA 1IM6A 4DR4J 1QVGR 2KKZA 1YRTA 2B4VA 1KVKA 4OLBA 3UD3P 3IFEA 4NZ7A 2DNRA 2IIRA 1UWBA 4OYWA 2ASYA 4FCYA 2WVBA 3NS7B 4WWSA 3R6LB 4MDBA 4H0VB 3DRPB 1OYDA 2BW7A 2ZBRA 4CIFA 2QTWA 3SQ0A 5EWGA 3D7SB 3CDBA 4CE9A 1G7CB 1SJ3P 2ZWPA 2AD9A 2L41A 1XNQK 5L9NA 3VA3A 2FZCB 1KFSA 3MCAB 2JFDA 3AOCA 2D3O1 1P9QC 1RWUA 3PW7A 4B3TJ 5AZJA 1BA1A 1DZ5A 1RYRA 3HTVA 3KNAA 4CH7A 1WSRA 4NCGB 1DT9A 5M1PA 4C8ZA 4CT9A 3DDIA 4I69A 1CLFA 4BRIA 2GX9A 1SKRA 3AA5X 2LP4A 4MKAA 2VD3A 2HFNA 4YMEA 5AZIA 4XDDA 5AE3A 2EK1A 3PNIA 4H5WA 4B3MK 2MTLA 4CHYA 5D4LA 2HBYB 4V19S 3EPGA 4RNHA 2CQDA 4JKEA 1IH7A 2IJFA 4YB5A 2GQCA 3CF5L 4RW6B 2NRTA 1XI1A 2CVEA 3T1YF 1XMQK 4ECXA 1NJIO 1H1VA 5ETTA 3M32A 4UQGA 4DR7F 2XGPA 1QQCA 1JLCA 1EKSA 4NI2B 1CXUA 2CDQA 1K73T 5ETOA 4DN9A 4DTNA 1LXJA 1UWAA 4QW8A 3ICLA 4DV4J 4DTSA 3QERA 2C2NA 1F9EB 2OPSA 1ZM3A 3RB3A 2H1YA 1NHUA 4H5TA 3O1WA 1SJ4P 4FDFA 5KAKA 2QGFB 1XNRF 1VK3A 2WBMA 4ZCKA 1YT3A 2C2DA 3SLCA 3HM8A 5M2UA 4CHPA 1M1HA 3KDOA 1LWCA 1YSJA 4CO5A 2XBPA 3S7RA 1T94A 1NMDA 7AT1B 1LNQA 3TAMB 1LWEA 2B7CB 5G0RB 3W63A 3K89A 3BF3A 3KLHA 2W1BA 3TWZA 3AVMA 1R7IA 3MXJA 2BJDA 3B4MA 4DUTA 3CYMA 5FRNA 1TAUA 4NE9C 2FUG9 4B3SK 2FC9A 4JI3J 4UY85 3ZXWA 2W7OA 1S0MA 3CJ7A 1LW0B 2DNPA 1VRQC 5J1NA 1DHMA 1OVYA 5CD4A 1EQMA 1VSLA 1SQGA 1GK8A 2YJFA 1NBWA 4NLCA 1RT1B 5AXKA 3M9MB 2O8CB 1A6LA 1MW7A 2ZJRL 1OYEA 4RWTA 4XDCA 4CD3A 4LF6J 2GVDA 4URQU 5RUBA 3VQ4A 4WFYA 2QKBA 2AEFA 4YOEA 2VKRA 2Q36A 1AYEA 5ETVA 3CD5A 2NPIA 4A5AA 4IXCA 1ZM9A 1NK8A 2B4JA 1RBVA 3L9ZA 5EVZA 2R8JA 3NVMA 4U7UK 5EWFA 1NH7A 2OLWA 1ATNA 1T9WA 2VQEK 4OJHA 3RBXA 3AD9C 3R97A 2WSEC 4ED0A 5D0EA 3SV4A 3TA1A 3NGDA 1GXUA 1HIYA 4J2BA 4RNNA 3T41A 4M7YA 1RWMB 4ID8A 5HMZA 3LPYA 5E3AA 2XULA 2RMLA 5HBMB 2QIFA 3JQMA 4DX8H 3CJ2A 4NLUA 2QE5A 2HBRB 1T6DA 4HDGA 1FK9A 5I4MA 1XK8A 3CMAS 3RJMB 3ONQA 3ZYYX 4TQRA 1FXRA 3N6NA 2GW8A 4JV5K 1D3WA 4E7KA 2X6SA 4K4WA 4E3SA 4CJEA 5KQ8A 1YTYA 3D1HA 2XYHB 1A5VA 1VSKA 3RTVA 3W9JA 2WSCC 3DLKA 1JCFA 3A12A 3HPOA 3H3NO 1FF2A 2BXJA 2GWKA 2GWJA 3MD3A 2MMYA 4RKUC 3R7BB 1E4FT 1XJWB 2OPSB 2Z2ZA 5C24A 2GZOA 5E0OA 4LR8A 1RDAA 5ETSA 4YN3B 3B4DA 4FJMA 5LM7E 2XCPA 4YORA 2XLJA 4R5PB 2YY3A 4Y2AA 4WJBA 2NZ4A 4BR0A 3MAAA 2GUIA 1SL1A 4N47A 2G13A 1LWCB 2RUGA 5K8MA 3VGLA 2UU9J 1TK0A 3W9HA 4JV1A 1LWEB 1LK7A 2E5JA 4GVBA 2QC3A 3K0SA 2VODA 5HSPA 1S5ZA 1RDBA 3CPEA 3SJHA 4RUCA 4BDPA 2ADCA 1T9UA 1SH0A 1I1GA 1B99A 4AL5A 4XTTA 4AUKA 3TAPA 3HHNB 2K3KA 3Q89A 2OJ3A 2YCHA 2N3OA 3GFYA 3PJWA 2DR6A 3DN9A 1RK8A 3QZ8A 2F9JA 4NA2A 3BEXA 2XNQA 4J90A 2IHR1 1ITPA 3ISND 3FZBA 1VHXA 4ISEA 2XLIA 4OJRA 3PX4A 2GVDB 1NMEB 1G1XA 1TUUA 1OY9A 5AQHA 2HFOA 4WXWA 1J5OB 1WHYA 4DU7A 1Q0NA 2P9KA 3OYGA 4F3MA 3WC2A 2KN4A 3SFGA 4BE1A 2VPYB 1UEUA 2HS0A 4YHHJ 2J0SD 3IRWP 1FTRA 1N8RT 1WC5A 1QTNB 1OY6A 1VIXA 4FXDA 1S1VA 4FM2A 2R7UA 5BRFA 2Y0BB 3RBEA 4JRQA 3OS2A 1WG1A 4DSJA 3G9CA 2HF4A 4ED6A 2R9LA 3OQ2A 3AY9A 1HYSB 2A6OA 1AXQA 3K5LA 4YFUA 4JK9A 1OH7A 3BP8A 1UW4A 1ZM2A 1KAXA 2GELA 4BE2A 2J7UA 3VEWA 4XAKA 3CC4S 1HNXF 4CLPA 4H0XB 3NMRA 1EXQA 3NAIA 4OMFG 4E7LA 3L7UA 3HSTB 4ZVPB 4BWJA 3QNWB 1FK9B 2A18A 3ZX3A 2DVIA 3VGSA 4Y1CA 2YWFA 4DLGA 4KHMA 1KEKA 2Q2RA 1NKEA 3FJ2A 5LSLA 2HNZA 5EUHA 4NCAA 5E3QA 3VTHA 3HJFA 1TR0A 5HVFA 1YQHA 3X1LB 2XS2A 3KHGA 1NM2A 2QO3A 3DLKB 1PILA 3ENOA 4CO3A 2XYPB 4OPHA 4V19X 3PX6A 3CDUA 2Q6CA 4W5RA 3CW2C 1H2VZ 5KFBA 2ZBPA 2GO8A 2L9DA 1Y5LB 4R0JA 1NH8A 3UW1A 1N34K 2VC0A 3R5JB 3CFOA 3EXYA 2J6SA 4LC9B 1FJEB 3KWMA 4JYAF 3P3DA 4G6VB 1IWGA 4U67Q 2WRMA 4PRFA 3P5BP 3VAJA 2UXCF 2CPXA 1SKSA 4KHQA 1NK9A 3OTDA 3KJNB 3T5KA 3O9TA 2Q0UA 4DFJA 2V8DA 3BDPA 2DO0A 3NDKA 1ZAVA 3O2IA 3OUYB 1BD6A 3C7NB 1YAGA 4OHWA 5F9NA 4LF7J 1X5OA 2NNWA 3EY1A 3H45C 2O8EB 5JLFA 2DNZA 3D3BJ 3ULDA 3MEDA 4K4TA 4BVOA 4GVBB 4B8CA 3P45B 1U25A 4J9QA 5BXIA 2W24A 3NRBA 4JI5J 1GXTA 3I6PA 4M94A 4A62A 3DAWA 4RCHA 3J81Y 3QRRA 4DTJA 2EBEA 3FUYA 1REVB 4O4RA 3KJQB 1AB8A 2BJ1A 2DFFA 3ENQA 3IBCB 4FYVB 5FRMA 3NOCA 5J2QA 3CC7N 1IBLK 3SAHA 3K2PA 4K4YA 1XC9A 4NLXA 3EZUA 4PXCA 5HL7Q 3PIPL 1NJYA 4JI4J 4PEOA 4A4JA 4DPXA 1SKUB 2QWQA 2IA6A 3DRRA 4B1VA 2DEIA 2QWNA 2EC2A 4JI6K 3EJMA 3TAQA 4HWIA 1NKBA 1XR7A 3QICA 2P9KB 3AO3A 2MKSA 2P8IA 3LPEA 4Z94A 1RT7B 3VQ5A 4Q2LA 4USUA 2P9SA 2V63A 9RUBA 5BN9A 4NA1A 1U04A 4CJKA 1KP6A 2MJNA 2OUGA 1ZBFA 4EYIB 5BYSA 1WC6A 3OSPA 3NGRA 4O3OA 1GXLA 2FSKA 4H4KA 3CCQN 1S1VB 2DT9A 2HZCA 3RSEA 2O01C 4DI6A 4CRJA 3KTQA 5F3TA 2A3JA 1K0VA 3OTOJ 2AHOB 1EAYC 2W2NP 3U6FA 2WK4A 2WCXA 1SQKA 3RWUA 1NDKA 4ELVA 5IXUA 3ZFVA 2VZ9A 3PKYA 4C0BA 1XC3A 1WNEA 2OPRA 3MEKA 3LDOA 1BMQB 3OLBA 3CC7S 3N5BA 3W9IA 4JN4A 3NF7A 3THYA 3HX9A 2WONA 5GAGI 2J6TA 2G1HA 4WFBL 3GIJA 4O4GA 4QYZK 1OSDA 1RWNB 1FRKA 1F6TA 3PYFA 1G15A 5M1NA 2RQCA 1S9FA 2G8KA 3HFKA 3B6OA 1VQPN 4Q8FA 4CH1A 2D0BA 2ZJQQ 1TK8A 2WTUA 4RTFD 2D9OA 3WQTA 3ZEUB 5AR0A 2EX3A 3THTA 1R8BA 3MTJA 1HARA 2CPZA 4RNMA 2NZTA 4ZHRA 5DETA 1JXVA 4KAZA 2ROEA 2HYIB 2JSXA 2JEIA 3AD8C 3CCQS 2HQGA 2YWGA 4I1TA 3OR1A 1F5CA 2M2BA 4KT0C 1A9NB 4CF1A 4WTYA 4N8NA 1YX2A 1SXLA 1U48A 1TL7A 4KI6A 2DR5A 1F2GA 3W5ZA 1R3NA 3M2RB 1B7YB 3O1LA 5LSRA 2WZ1A 2XI2A 3WBZA 2YPZA 4CF8A 4OFZA 2YNIB 4H4OA 3LTOA 4ED7A 2IM2A 3C14B 3H59A 5AQTA 2ZE2A 2H3EB 1IJFB 3ZZUA 5E3RA 3W2WB 1SC4B 3OYKA 2KU7A 3I4HX 2PE8A 5BR9A 1VQPS 3FSYA 4DX6A 4HI2A 3BQ0A 8ATCB 3OXLA 3MAQA 3R5AA 1GOAA 4K8RA 4CF9A 4KH6A 3VF0B 2E29A 4KO0A 1WHXA 4FP9A 4C8KA 1AA1B 2IVPA 5J2QB 2HFVA 4PHTX 2CJ9A 2IOCA 1SJQA 2KRRA 3MWTA 5I3UA 2MSTA 3THPA 5GIOA 1Q7LB 5DLFA 1DQ9A 1D0EA 1QZ6A 4BC2A 1E6YB 1CJKB 1FNMA 5BYQA 4A61A 3GJQB 1HNWJ 4BRFA 2CQGA 4LFAK 3NAHA 3GE9A 3DRRB 3WZ0A 2BJ3A 2VB6A 2RQ4A 5CYMB 4C48A 2AIRB 1XMOJ 2VDIA 3RBZA 5DG9A 5HLFB 2MZSA 3SQ1A 2X1BA 1FESA 4H0PA 1WELA 3AVAA 3MMCA 1NSQA 2V7ZA 5BPMA 1J5EJ 2F1FA 2PD1A 2AJ4A 1GMVA 1BG3A 5BR8F 4O3QA 4CJWA 4OX9F 3MM9B 1OVQA 1KN6A 3EGNA 2ZVIA 5CA5A 3BF4A 1NNDA 1WSGA 4P71A 2ASMA 1OJ4A 2A3ZA 3ZT0A 4BRGA 1Z26A 3SBMA 1SH3A 1YLXA 3WUHA 3CO9A 2P6SA 1YRUA 4MQ3A 3MUMP 4IDHA 3DLJA 3FFIB 2A6MA 2UXCJ 2R3VA 1GQEA 2WONB 3D5MA 3ZZOA 1W97L 3FR0A 2ZHOA 4AYBD 2U1AA 4M5MA 2DISA 3UKUB 5AJ3F 1XERA 1VHIA 5KGXA 4OHXA 4AL7A 3OR2A 5TKWA 3BR9A 3IWLA 2QWLA 1EP4A 1N32J 1FKOA 1BHLA 3LP2B 3AB2B 2A1SA 2NCKL 4JKBA 2VHGA 1HWKA 4KTZA 1TGOA 4E1JA 4LRFA 2W42A 2AEMA 2IPOB 2C42A 4XO0A 1T05A 4ZHRB 3TSPA 1NU0A 4L3KA 3J7YI 4QJVA 4LSZB 4WE1A 2VFUA 3KFWX 1RBRA 3E9LA 4CO1A 2HW3A 4CT8A 1RA7A 3OR1B 4R8UB 1Z1ZA 1MN7A 3DLRA 2PFDA 2PDAA 3GU0A 2QL9B 1TL7B 4RZRA 4OKEA 1TVRB 3DXBA 2AGOA 1BIZA 3ZT1A 1IBKK 4O0NA 4RPFA 3D0PA 2C2EA 2O8FA 2CG4A 5KFDA 4CK1A 5A2QO 5E5NA 2ZE2B 3EO3A 1DTTA 3ENVA 3L2WA 2FHMA 2XC9A 1KDNA 2C3UA 1N5SA 2CPIA 4EBEA 3VVTA 3I9V9 3PM9A 2ZZNA 2FBXA 2VC1A 4DB3A 3WIUA 3TAEA 2Y1IA 2AYEA 2VU5A 2XI3A 2W9AA 3CM6A 1E3MA 4KO0B 3VQDA 5GAEP 4AHCA 3BSCA 4DJBA 3LO3A 4BCAA 4OZNA 5I3UB 1HLUA 3QDKA 1KOHA 4MK7A 1QSYA 4NLRA 3K9KA 2HRYA 3VMFB 4K2JA 1GEHA 4ECQA 4EP5A 1S12A 3RU0A 4WKRA 1GLEG 4DV0K 1YJRA 3HM9A 4KB0A 2R7OA 3D1QA 4Z4GA 2RSQA 4QR0A 3DOMA 4P2FA 1RT2B 2XHCA 2ZBCA 1BOTO 3ENWA 3IAM9 3TU5A 3WHIA 2E1RA 4HVJA 4N7TA 4PG4A 1ZTWA 3GFZA 3MMCB 4OPKA 1WOPA 4Z7YA 3OJUA 4QR2A 3I5CA 4NLQA 4ILLA 2UXBJ 1X9SA 3G6XA 3AT1B 1FI4A 5ITHA 4F9OA 3FRZA 4DV7K 4WIIA 5C15A 3MURP 1K44A 2CDRB 2XMUA 4F8RA 1FERA 1S0NA 2MQ8A 4RBVA 1OIAA 1CLQA 3MECA 4ANCA 3T5LA 1CJTA 3CCEN 3V6HA 5D78A 1N36K 5KPZA 2G0IA 4ECRA 4F4AA 4DR5K 2ZHBA 1T9YA 1IO2A 3D66A 2NRVA 2HHHK 1JLFA 1X0PA 5HI7A 5U47A 3I55S 3IWXA 1RA6A 5CHIA 3KNGA 4FJIA 1NK5A 2IS3A 2Y8WA 1HKGA 1BE4A 4X4SA 4WZQA 2MB0B 1XIQA 4DUYJ 1K8KA 3L7OA 4I7FA 1BDGA 3OFEA 2W25A 3Q7BA 3OR2B 4UTGA 2K2PA 3G8SA 2ZQBA 1V3ZA 1H7XA 1EP4B 4QQBA 1FKOB 3E1YA 5H9FJ 2V94A 3B8AX 3A5LC 4JI2F 2DRAA 1T05B 4DS4A 3CJ4A 3DYAA 2DNNA 1YTAA 3LWLA 3B6PA 3RVCA 5GMKa 3TYTA 1W2BM 4CGJA 3OYHA 4WE1B 4ZK7M 5ADXH 2EW9A 5C2GA 1PSDA 1JLGB 3BKFA 2QLJB 1N8RO 2O8DB 4BDYA 3R1XA 1IN0A 4Z4EA 3CCES 4OLOA 5CYJA 2P9LA 1YHQN 1IBMK 1FRMA 1JNRB 2AEJA 3CDAA 4MLEA 3A8EA 3LP0A 2QI2A 2GBZA 3QPIA 4BRCA 1WI8A 2YWEA 3VWSA 2V9WA 2W7PA 3QEVA 2F3JA 1NDPA 4OJ3A 1FE0A 5DM6L 3V6KA 5BR8J 3VCDA 1VIOA 3MCMA 3MI7X 4IEEA 3U1LA 4NLWA 2DH9A 3MM5A 3NNAA 3SPYA 4DV6F 3TSUA 1OKJA 3DMJA 2V0NA 3FSIA 2V2KA 3KHHA 4DV5J 1ROFA 2CQPA 1VQON 4DR1K 3CCLN 2OTJN 2BOAA 5BPNA 5K5MA 4BG9A 4OHVA 4CIEA 3Q2SC 3JTOA 1PC4A 1HPZB 2LMIA 4CJ3A 2UUWA 3BGFA 3TJ9A 2FGCA 5IV4A 1KRPA 4WTOB 2MDAA 4DV3J 3CE8A 4JK7A 4RO0A 1HD0A 2UYTA 4MT1A 3TJAA 3QRQA 4DSKA 4JI8J 2DY1A 4CI6A 3SQ2A 4L74A 4UUXA 1U2RA 2QK9A 3GP9A 1YHQS 1M1KO 1S9EA 2QG9B 1QHAA 3HCXA 4RWXA 3VEVA 5F8LA 5AFUA 4C6AA 2ZFHA 4DR2J 4BRDA 3GTYX 2KB2A 4ZLLA 2YWHA 4U7CA 3TUPA 1LXNA 3W5YA 4YOTA 4DTPA 1X3MA 3PX0A 1GAOA 5C25B 2YI1A 5FPDA 1VQKS 4XH4A 2X51A 1CJTB 1UVKA 3CFPA 4QU7A 1M5KC 4PKGA 3F5TA 1WLJA 1WSJA 5DO2A 2VKZG 1VQOS 2RDJA 1I3AA 4AHRA 3CCLS 2OTJS 3HFZB 2ETJA 3MD1A 2UVWA 1MWQA 5F2RA 1XEZA 5C12A 1RTHA 3RRKA 1C0TA 4LVOP 3TW0A 4BDZA 3NBPA 5MLCV 1HQUA 2MZTA 3QEPA 3AV9A 2Q1LA 1WAFA 3LDLA 1S6OA 2E2PA 1K8KB 1PBUA 3M8QA 2DEJA 4I7FB 2D3OR 2EWHA 2M7SA 4FXWA 3V81A 4DQIA 4ILJA 2CZ9A 1HMVB 2V51B 1Q5VA 5CZVA 5KG0A 1BI4B 4DV4K 2BJ8A 3TX0A 4M5KA 4GO5X 3Q8QB 2XY5A 4C3KA 4PG7A 5DQGA 5HMXA 1RBTA 3I31A 3FZFA 3DYAB 1YRXA 4O44A 4IOCQ 1HWUA 2BZ2A 2BJEA 2Z1JA 3B6BA 3E66A 2RJZA 3V4IA 1X5SA 4IRCA 2ZH1A 4K0KJ 1TFYA 1FNOA 3ZSWA 5F0UA 3IRXA 2OGUA 1N54B 2Q79A 3HSGA 4I6YA 4D3HA 1I94J 1S0OA 5D0RA 3LP0B 4DMNA 1QE1A 1HA1A 3T1HJ 4QAGA 2QFJA 1LWXA 4CF0A 2D4WA 3DLLQ 4ZP9A 1FE4A 4YR2A 1VJWA 3TA2A 3EE8A 3GYGA 3MM5B 3LGNA 2F8SA 2BVZA 2Y8YA 2QEXN 2IAJA 4CJSA 4EWTA 3DMJB 2FVCA 3MDQA 2RF2B 5AQIA 1FHTA 3R7NB 4FWNA 4FJ5A 3VEOA 3KG4A 3M5RA 1N52B 4LF5F 2CJQA 2FJDB 1RDUA 4O3NA 4PAAA 4P7TA 4JI0F 4ZPBA 1GMUA 4OX7A 3HL8A 1SJ1A 2FIUA 3CJ5A 4USHA 5A8WA 4CHQA 4N77A 4LIWA 3TA0A 8RUCA 3U4LA 4WK3A 4X65F 3EPIA 1VQ9N 3TP2A 2I1RA 2LFVA 3IN5A 2QA4G 3CCUN 2UXDK 1BO5O 4FJKA 2C3MA 1D09B 2COLA 3D1OA 4ZJQA 3E51A 3BM7A 1BUPA 3PR5B 1CPZA 1OH6A 2O8BA 2VOOA 2NRHA 1S9EB 5KG1A 1VISA 2A5XA 4QIVA 5GMDA 2DHXA 3K5PA 4NYPA 2MEWA 2EVZA 1VBYA 3HFVA 4JUZA 5FLXO 1TL1A 1R6VA 2HHPA 1VGYA 1QVFM 1ZETA 1LEOA 3QAEA 3AA2A 4WF9Q 2NUUG 1YITN 5AQPA 5BREA 3C2PA 3IG1A 1HWJA 2D69A 1N33F 3PHEA 5M1FA 2QEXS 3F73A 1S4FA 2YX1A 2CPFA 2BABA 1WN7A 2ZITA 4Y2IA 3DOKB 4JEPA 1JMTA 1HNVA 4YY3F 2RUSA 2W01A 2XZTB 4CECA 1RBLA 4DMZA 3L09A 1CJVB 1FWLA 1U2CA 2RHQB 1RTHB 4CLUA 1UVLA 2E4LA 1I6JA 1T9XA 4DSIA 2YHBA 1C0TB 1XQSC 4FPAA 5ADXA 2QA4N 5EOYA 4RL1A 2VA3A 3OYJA 3M1VA 1BQXA 1VLOA 3I8BA 3M8QB 4FPBA 4HHJA 1BY9A 2FPHX 3Q8UA 1IQZA 3CF5Q 2ASOA 2OD4A 1UVMA 3CCUS 4CLKA 4NXNJ 1QSSA 4DV6J 3WX4A 3DOLA 3GCXP 4UW2A 4EYHB 3LH2S 2CPJA 4LREA 2ZF5O 4C9DA 4Z4FA 1NB7A 3I4PA 2W9CB 1IKYA 1SIWB 2YKNB 3KHLA 1QLNA 2V8PA 4K25A 3O9SA 1L3UA 1U2FA 2P9EA 2IGIA 3O8MA 4A8XA 4FM0A 2YWWA 5KG2A 5H1SV 2G8UA 1YITS 2HNDA 3EZOA 4MYTA 4ZJLA 2CJBA 2JGUA 2DHHA 3IRXB 4UY8O 4DCOB 3CJ3A 2R7YA 2P9PA 1B92A 2EWSA 1HFEL 3EICA 4LF4J 2WOMB 2FJAB 3GG0A 4CDIA 2JJ4D 2C3YA 5E84A 4F2RA 1DKGD 2MQNA 3J7AN 2XMKA 3HHLD 4CZEA 2QLFB 3UVJA 3ZZ0A 1BC6A 3AVFA 3LDNA 3B82A 4IOBA 5A2QY 4ZN1A 2W9BA 1H3DA 1K9MT 5AQOA 4I0WA 4UF4A 5KOXA 1Q16B 4IG0B 3X3UA 4DCJB 2H65B 3TVKA 2NLWA 3OYNA 4OYIA 2MZRA 2QSFA 3PV8A 1D4XA 5F8GA 2RU3A 1WBBA 2BE9B 4CI0B 3GJTB 3CGIA 1BXNA 3ZTRA 2F9TA 3CD0A 3AVHA 4ZKAA 1DGKN 1ZBSA 4DL5A 3QZ7A 2KJWA 3EDQB 2ZJRQ 4CTAA 3SMZA 2HNYA 5H9EJ 5D4NA 5DQHA 2VG7A 1VRUA 3HSDA 2HWTA 1O13A 2C2MB 4I68A 1EHWA 1FWPA 3CD7A 3QWPA 4A59A 2KDOA 3T1YK 2U2FA 4H4MA 4S0MA 2O1PA 4AE5A 4M3ZA 1BLUA 2O4GA 4DR7K 2L3MA 4RG8A 2RKIA 4WU3A 4TU9A 2O8BB 2AGPA 5K8PA 1V5IB 4EO8A 3KUEA 4U8YA 2HB5A 1D8YA 4RW7A 5KRSA 2E9TA 3TABA 3ZZRA 3NE6A 2P9UB 4DHYA 3H90A 3H2VE 3SXLA 1HBMA 1Y5IB 2JEGA 3D2EA 1FDDA 3AAWB 3IG1B 4KGKA 2YBVA 3QT8A 1IR0A 4A8MP 3F56A 3PHTA 2E66A 3MM6A 5DMRA 1OQ3A 2ERRA 3AJ2A 4GKKJ 2AZ3A 1NAQA 3CWJA 2CGLA 3GLJA 4U67L 4B3RJ 3SEOA 3MXIA 3G25A 1HNVB 3PVXA 4F3TA 4WQ4A 3VQTA 2I5JA 4JKFA 5DGBA 3HHDA 3PY8A 1D9AA 1WDTA 4OJ1A 1KCFA 1FKPA 1VHFA 1FRIA 4FWKA 2QM1A 4A2AA 3PYEA 1H0HB 3JAMO 1GOBA 3MCSA 5LMUF 1VAZA 2UUBF 2JC1A 1RBUA 1NEEA 2HHXA 3R6GB 4Q43A 1RTJA 1U6BA 3GWCA 1C1CA 3OFFA 1DRZA 1T44A 3S3MA 2ZD1A 1VSFA 5LXRA 1KVJA 4E1MA 3BGRA 4B9VA 3FBFA 3DXMB 2V4JA 5FJ4A 3B54A 5JVHL 1KFDA 4HTJA 4LF5J 5HL7L 2MKJA 3D6MB 2C2OB 3ULEA 1NJZA 2WFBA 4DV2F 3BV8A 4EGLA 4CW7B 3QBCA 2E9RX 4DWIA 1GLFO 3ZO7A 2CVIA 1YVNA 1NSKL 3T69A 2D3ZA 2KI2A 1DY3A 2G8IA 3HYFA 1Q18A 2P9PB 1UKUA 2CPDA 4Y0WA 2DGVA 4ZJOA 3G6EN 2G8HA 4CHOA 3PW2A 5B0EA 1HD1A 1QAXA 4B17A 1VDHA 2ZBQA 4YQWA 1X5TA 4GC6A 2HGNA 2NRRA 2DITA 5D3GA 5SZTA 2W9BB 4KGZB 1ZM4A 3VEZA 3NGYA 1QQOA 3L3CA 4KHYA 3AA4A 4UQTA 2RIJA 4DHVA 1VQNN 4YOWA 2W8KA 3FZHA 4JI4K 1HQEA 4PUOB 3R1LA 4U96A 1NSAA 4Y0FA 3CCJS 4YY3J 5D15A 3VAFA 3A0IX 2OPQA 4OGEA 1BWEA 4M3RA 4PWDA 4CTAB 2HNYB 3V1RA 2FBYA 1VRUB 2P2CB 4OYZA 1YGYA 4KY3A 3OSNA 5KG6A 4ED1A 4MH8A 1ZS6A 5DM7Q 3KLIA 2M5YA 4MK9A 5LSOA 4TVAB 3PO5A 4CLFA 1W9HA 3KG0A 3DFEA 4M1KA 4F4WA 1AZSA 1GLDG 2ZJQL 2J9DA 1N5TA 2AW0A 1C1AA 3IR5B 5KG5A 3G6ES 4RW7B 1UW9A 2RS2A 3C66A 3C16A 4NLGA 1L3TA 4RW4A 2ZUAA 1HBMB 3D2EB 2UZAA 4LF8J 1IJEB 3H0PA 1X9MA 3UDVA 2YKAA 3GIIA 4F67A 2EBGA 2LVWA 1Q82T 3MM6B 1JLAB 5C5JA 4J91A 4C23A 3R1HA 3AARA 1S72N 3RYLA 3SYZA 2E1ZA 2LXFA 1VQNS 2CQCA 1QUPA 5JMNA 3H46O 2I5JB 1IKXB 3KLGA 2RAQA 5CH7B 4WQ5A 3K8WA 2NZCA 3MAHA 2HBMA 2LDYA 2YVSA 4J5OA 4M7XA 4ED2A 4EHUA 2YWKA 3G6YA 4YOXA 4BREA 1TUWA 2H3GX 5J2MA 3OHRA 3D7EO 1T3VA 5KFJA 1P6TA 5AT1B 2YNGA 3EMTA 3MMBA 2GV9A 2GHVC 2FQQB 3KK1B 4HACA 1N0UA 4I2QA 4LF9J 2BR0A 4MIWA 1NLKL 1C1CB 4O0IA 1ZYQA 3Q8YA 5AQKA 2FTRA 4U95A 1GOCA 3QO9A 2YQ3A 2UUAJ 3BGRB 2X1FA 2WVCA 4KJIA 3NEKA 5LMNF 1CBKA 3QT5A 4CBUA 3OYMA 2V4JB 1X60A 4OI2A 3PZPA 2V68A 1VQSA 5HJYA 3ULEB 1X8DA 5KG7A 2YH0A 4ISGA 4WCEL 1FVQA 8AT1B 1H6KX 2XNRA 3KLFA 3O9QA 1I51B 3P6YC 3R8EA 1S72S 3KG1A 2IC3A 2WB4A 2IVYA 2OYQA 4FYYB 3BEGB 4QCLA 4ZPWR 3IFRA 3CCTA 2IYGA 4PA1A 5D0GA 3JAMU 4FJJA 3UI3A 1QZ5A 5EX3A 2KYXA 3UE2A 5HRPA 1V6HA 5T7LA 3T9NA 3UFCX 2BQRA 2FJBB 1Z6RA 4DS5A 5C42A 1HKCA 1FNXH 1GLCG 5IWAJ 4HVZA 4DR3J 3TRGA 4QIFA 4IR1A 2EPIA 2RVJA 3VZIA 1N5YB 1HNXK 4USWA 4DUZF 2YNFA 1JK9B 4ZLPA 4G1PA 4J9SA 4GKJF 4H54A 4JAXA 4HHTA 5E7OB 1VK8A 4QW9A 1QQMA 1JKHB 3PIPQ 1RFQA 4J9LA 2VIHA 1WC1A 1WUUA 2KXFA 4BVPA 4PWDB 4FK2A 3MWBA 2E7WA 2PO4A 4J2AA 5L1KA 1X4HA 3EVOA 4DEZA 3H5UA 1WBDA 2LQJA 6FD1A 3DLEA 2DGXA 4BBYA 2HHVA 2W40A 3KLIB 3ITHA 3US5A 2PI5A 2I8EA 3BYRA 5CZXA 3RBDA 1KKHA 4HT5A 3SQOP 3DI6A 3VGVA 4LFCJ 1YXQA 3O5BA 1YVUA 4W5NA 4IO1A 4M3UA 1QY7A 4UOCA 2I7NA 5IT9O 1AFJA 4LH4A 3VGTA 3UCUP 1MU2B 3I33A 2D0PA 2V7YA 4FJGA 3C16B 1M5PC 4IBNA 4QU6A 2JZ5A 4AT1B 4DU4A 3I96A 4BQZA 1NLVA 4JYAK 3QSIA 5FLXY 1HQ2A 4USKA 1VK0A 3Q22A 2LKZA 3SI8A 4LBPA 4U6PA 4NYNA 1FDNA 3E2EA 2UXCK 4NX9A 4HR2A 2A2CA 3V4MA 3HKWA 3RB6A 5BRDA 3MXMA 3KLGB 2JL9A 4PCQA 1N36F 3OPKA 2PI4A 4YEAA 4Y28C 4CM0A 3IAS9 2XY6A 3Q2TC 1F2HA 2ZBIA 2HBLA 4NYZA 1W26A 3ZETA 3C6HA 2ZH2A 4EIAA 3OW2M 1JLQA 3V1OA 4ATNA 2EFNA 5FD1A 2OANA 5J2MB 2HLTA 4FWLA 1IBCB 3BYPA 3MR3A 1YG0A 4H0YB 3MMBB 3QBXA 3MN6A 3DGPA 4HACB 4BR9A 3I87A 1U7LA 1SH2A 4ECWA 2A10A 2OEMA 4I2QB 2CJXB 4QS7A 3KJVB 5AQZA 3OVSA 3M6XA 3R3LA 1B3TA 3BH6B 1YJ7A 3QO9B 5GAGP 3SSSA 4YDXA 4B9UA 3QJLA 3WXJA 5EHHA 2OIHA 4J9PA 5HOOA 2F4VF 2ASPA 3OFHA 2QKKA 3A3NB 3QYYA 4JI1F 5HP1A 4B1UB 5CYQA 3AVLA 5EU7A 3PEJA 4CGDA 3P31A 3SCJE 1TYQA 4JI7J 4FBTA 1PYTA 4CJRA 5LJ3Y 2HOEA 3GPAA 3S41A 2QYCA 1HKAA 4H03B 3CCMN 4C0OC 1DTQB 3MM7A 4F4ZA 5KFAA 3W64A 4DFPA 3SCLE 4E2FB 3GOIA 4X62F 2C2ZB 2KXNB 4F3QA 3CM5A 1C2PA 2DR8A 4J9MA 4C8OA 2BKNA 3SUNA 3HHEA 2V2QA 2DXDA 4BRLA 5KFYA 5F8HA 1YTUA 1F5BA 1RAHB 1Z4UA 1SKWA 4PG5A 3B8HA 3EGWB 3LGHA 1LW2B 4DR6J 5HROA 3C6TA 2W2PP 4CM2A 1Q81T 5K20B 4IFYA 4DR1F 2AA4A 3BBBA 3CB4A 5A0YB 1JIHA 5JS1A 2NRWA 3HOSA 3VQCA 3EZ5A 4CBWA 1HNZF 1Y64A 1QVFR 3BS9A 3VETA 4DR4F 1BWFO 5HJXA 3S3NA 1U8SA 3ZSOA 4HUGA 1S4EA 1R8CA 1KVAA 2H48B 3AD7C 3AOAA 4CJ7A 1RCXB 4KH4A 3FCWA 3DLEB 1H2TZ 2OTLS 4OZ3A 2PIIA 3OVBA 3PKMA 3N4PA 3IMQJ 4OZJA 4ZMMA 4CLYA 2ZOMA 4JBCA 3CCMS 3FCVA 3M2UB 1FXDA 1K1SA 4V1Ak 3FLCO 1BA0A 4OHYA 1XUPO 2B4OA 1ULRA 5MLCQ 1IR2A 3M4XA 4RUAA 2QRRA 4CCHA 1ASVA 4LVNP 3A4TA 4FLTA 4QIWD 2XLKA 3SPZA 2LQ5A 4JP8A 1K47A 1RAEB 4CHZA 4B3TF 3N9UC 5KT4A 4ED5A 1SPBP 1RWOB 3MEEA 4AXJA 5DRKA 1NUEA 3HSZA 3QFWA 3VF6A 3P49B 5B09A 5T7BA 3GB0A 2GC8A 4QWAA 4CO4A 4FWRA 5CE3A 1R89A 1MSWD 1K9MO 3AQOA 3UKRA 2X3DA 3CPWM 2F40A 1TMMA 4QYRA 4FWQA 5IM0B 3RRHA 3NH1A 1RT3B 3ZETB 3HZ6A 1C0UA 2QTDA 1JLQB 2AV5A 4KQZA 4O0JA 3PRVA 4HEA9 2AP1A 4BQLA 3CDWA 4FWOA 3HULA 4WP9A 3OVAA 3WXMB 1KQFB 3DGPB 3JAMY 5H9FK 1KS2A 4O3PA 4IO8A 3J80Y 5IT9U 4MIBA 5AQUA 3J81j 2W2QP 4MO4A 2P6TA 3FEYB 3HHKA 3IKMA 3CCSN 2HK3A 2Z0GA 4IKFA 1TK5A 4BE0A 3F2KA 1LAWA 4C0HA 2X6NA 1VLYA 2FJVA 1HI8A 2ZVSA 3O6QA 3EE3A 3AGKA 3NKYA 2A42A 5KT6A 5KFPA 3WNFA 4KIAA 1TYQB 4KHPJ 1IV0A 4PQAA 2XEXA 3SCIE 4OJGA 2LQ8A 5AQLA 4ZP6A 4ELUA 2IVNA 2HFUA 1RI7A 4ZVGA 5BR8K 3OHAA 4OX9K 1VCTA 3ILOA 4JKHA 4HH1A 1KTVA 1TUVA 2DFHA 4RU9A 1T3NA 3VN5A 4NRUA 4CNZA 5CD4H 3W65A 4LBIA 4C7QA 1R31A 4M3WA 4YB6A 4LF1A 3PW4A 3V9SA 2LA6A 4IG3A 1XNQJ 4DL4A 4JI3F 4CJ5A 2FSJA 3CD6N 1T95A 5HROB 4ZS6A 2GJ2A 2XMJA 5B0DA 2R7VA 2OEKA 4IFYB 2W2MP 3CCSS 3HLUA 3MM8B 1NO8A 4L76A 2IDLA 3VPZA 5HO4A 3I0SA 3UDEA 2IRYA 3J7Z5 1HUXA 2VV5A 3QWUA 3N4QA 2IVFB 5AJ3K 4JI8K 4LF6F 5J1PA 3IGVA 1HBUA 2CFXA 1C0MA 4N76A 2X74A 1UPMB 2IY5B 2OFHX 2ALYB 3KLEA 1QUVA 3T7ZA 4DTUA 3KLVA 3OXFA 3M6UA 1VQ6S 3R5DA 1X4FA 2YQ0A 4PYDA 2YH1A 3OLAA 1VRTA 4XK8C 1WWHA 3GFXA 3G8QA 2BA9A 3SZ2A 4C11A 2FY1A 1UEVA 2E1MC 1J6ZA 4IRKA 4IJNA 4ECTA 4IOCL 1J53A 1HI1A 7FDRA 4USJC 3LDSA 1NGFA 3EKSA 4E0DA 3HVWA 1EX8A 5IV3A 3VAHA 2RPIA 4HTIA 1QHTA 2ITGA 3CD6S 5LJWA 4KB7A 3UKRB 1WKKA 5DK5A 4BRKA 3M2VB 3QT6A 2OEJA 3H5SA 1C0UB 5E2QA 2HS4A 4IO9L 2F9WA 4H5VA 1V4TA 3HSJA 3HKZD 2DNOA 4F7VA 3J81O 2A0FB 1U1OA 2YHWA 3U1MA 5HMYA 2V52B 1NGJA 1X7VA 4DQ8A 2VONA 1NK6A 1JLBA 3H40A 3SSRA 2OPPA 1R8AA 4P73A 3L4QA 4PKDB 3C6UA 3VV2B 3OYIA 4LY7A 1SBRA 4UOFA 1JLEA 4HCBA 4KR0B 1SVDA 4B3SJ 4ELTA 4EHTA 2CNLB 3ZZZA 2MQMA 1CZAN 2L08A 2DRBA 4CEZA 1A0OB 1RABB 2CH5A 1HJOA 1HBNA 1SJRA 2G8VA 4RW8A 3R5CA 1I94K 4HHUA 3H4DA 1S1XA 2ACYA 1RDCA 1APSA 2ZNZA 1B4SA 1DQ8A 2FHOB 5THWA 1TZ0A 2LXIA 3FBCA 2D1KA 1BQNA 1Q82O 2UU9F 1KLMA 2YXLA 3HHLB 2PFUA 4JHDA 4FLXA 2BKOA 3Q7CA 1FJCA 5DM6Q 2KJVA 3HO1A 1CQNA 2BW2A 4KKOB 2ZDOA 2FJXA 1W0HA 5IFMA 3IAYA 4FF4A 5KFFA 2W4PA 4KTQA 4WF9L 5CAAA 3O3FA 2VQEJ 4PPZA 2NREA 1TKZA 1TKTB 2MSSA 3FRYA 4GMKA 4F50A 4A8WA 4N8OA 4BC4A 5KFQA 3QIPB 1JB0C 2RDIA 1OQ6A 4PXDA 3FCHA 2ZH8A 4YOVA 4M5IA 3HZEA 2B3TB 3I0SB 1EO1A 3TQ1A 4L6V3 2EG2A 4KSEB 4DPOA 4WPAA 2A1BA 3VVUA 3S9HA 3Q8SB 3AOBA 1EKRA 1NK4A 4EUVA 3O4WA 4H5RA 4LD0A 2IRXA 2X1AA 2ZHAA 4KHSA 5ETMA 4JKAA 4JV5J 4CEAA 1UJ5A 4LSLA 2I0XA 4YHHF 4JI2K 2RT3A 1ZA1B 2VG5A 2B6AB 2VQFJ 2ZGZA 2UUTA 4ICLB 5HN0A 4ZVRB 4CZCA 3CTRA 3BREA 2HGMA 3AO5A 5IT9Y 1NCLA 4DTMA 5K9FA 3JXOA 1I39A 2K7JA 1KQSM 2KG1A 5HMWA 1KC8O 4NOHA 1WKLA 1DLOB 2VBXA 2FC8A 5DGAA 2ATQA 1MWZA 4DQQA 5KFCA 1RT4A 2DXFA 4UT4A 1O0PA 2FVSA 2D1CA 3SCXA 1VC6A 4EZ9A 2M3DA 3T5HA 3P4IA 1CZ9A 1LK5A 3UDLA 3NS5A 4NLDA 1X0FA 2F4FA 1OPIA 4DPTA 5MAOA 3W66A 5G4DA 2UV8A 2CQ0A 5TKYA 3FGVA 2LYVA 2XMWA 1MLAA 4DV6K 1S9GB 4ZCIA 1HPMA 3T6BA 2LDIA 3O08A 4K50A 3MX2A 4HT7A 1SUQA 3MR2A 2MQPA 1JLBB 2F8HA 3PEHA 1FJGJ 2I9SA 2OPPB 3G10A 2CNOB 3R5GA 4K41A 1XR5A 5FIIA 3C6UB 4BS2A 1S1WA 1R8HA 3THWB 4NXMF 3LP1A 1DURA 1RISA 2IBKA 4FKXA 4CJPA 1SL0A 3WEEA 1S99A 4RUHA 1T03A 2XMVA 2KO1A 3CMAN 2F63A 4ITSA 3VQBA 3PR4A 1HBNB 2IRUA 1FW6A 1U6FA 1U0SA 4RW8B 2AF6A 4LF4K 1UJ4A 4J9KA 3ZSXA 1S1XB 3UNGC 1E4GT 2IA0A 3VHQA 5KT2A 2HAIA 1UWBB 2GJIA 5DDQC 2WAQD 1C1BA 4ANDA 5E26A 1U6ZA 3CUNA 1KLMB 3T5JA 3RGIA 4JHDB 4LF7F 1VFJA 3JTNA 4CJLA 3J81U 3TJ8A 4Z4CA 2GS8A 2XMAA 4IOAL 4JI5F 3CC2N 1QVGM 3PIOL 2K06A 2CQBA 4BRAA 5GADU 4FF3A 3CT9A 5GADI 1TKZB 5JVGL 4ED4A 2AP6A 5AZJB 3I5BA 3RMBA 1UVNA 1XWLA 1PKUA 1D9DA 2PY5A 1TP7A 5H9EK 3QQCD 4MKVA 2QWOA 4GY2B 2POKA 4JI4F 2E20A 3H1VX 2AGQA 3RAMA 4ZITA 2Z2MA 4FWSA 5AZIB 1UETA 3TEHB 4QOTA 1JXLA 4G65A 4NEYA 2X78A 4OGCA 1YBAA 1S76D 4X84A 1JXBA 1ZPWX 1IKWA 3ZSZA 4I2PA 4J37A 1FD8A 2FB0A 2VG5B 3QJPA 3OVNA 2JOQA 3M32B 2VPZB 1NU4A 1JLCB 2MZQA 3O44A 4LT6A 3W1YC 2OP5A 2MXYA 1IR1A 3OW2R 4CQ1A 3OYAA 3W8GA 1CSJA 3AA8A 2R7SA 2DGUA 2NYIA 2Q66A 1VQ8S 1WD6A 1U26A 3GYXB 3CC2S 3OTOF 2FHKA 3PW0A 4IFEA 3VEYA 4DSLA 1N34J 3BBFA 2PA8D 1RT4B 3KD5E 3Q8PB 4TNOA 1R0AA 2JDJA 4ZPVR 2RQKA 3N6LA 3NCRA 4GC7A 1Q78A 1U1MA 4AHTA 2CWKA 4ETZA 2M9KA 3RR8A 3W8PA 1QM9A 1AW0A 5AQQA 3VGUA 4CYUA 1FCAA 1Z2LA 4Q8EA 2QYGA 3WNEA 3Q0AA 4GRSA 4L8RB 2JLGA 2GJFA 3KLHB 1Q81O 3AJDA 4CGFA 4A8YA 2FF3B 1EIYB 3SMSA 3N28A 2XZDB 4YR3A 1SUQB 4NEZA 1IQTA 2OAUA 4ID5A 3AQPA 3U9DA 3CC4N 4Y2CA 1S1WB 4LF5K 3P39A 3THXA 2NUBA 3WEEB 4JI0K 1Y4ZB 2DGOA 4WIQA 3FK4A 5KFEA 2ATLA 3MUVP 4EAHD 1IBLJ 2R2SA 4X65K 3G82A 1YJNN 1GLJO 2EXUA 3WXKA 2G4BA 1R6YA 1ZZFA 4OYBA 3NAEA 3A5OC 4FZXC 2V8HA 1Q8IA 3MUTP 5DM7L 4JI6J 1C1BB 2KKHA 4NZ0A 3NMAA 4TY8A 1RJJA 2R7RA 4XEIA 4ZA1A 3U02A 4OV1A 3M6VA 4I67A 1RKJA 1EQYA 1NPRA 3UN2A 2R7WA 1N33K 3CJKA 3P96A 3EGZA 3PLAA 3T19A 1FFWB 2HVIA 3CCWA 5CY4A 4R0EA 2DO4A 3WXLA 1S6QA 1FT8A 4A8SA 4YY3K 3A8YA 4JS5A 3SUPA 2K1RA 4UUWA 1VYAA 4AH9A 2HEKA 1FWKA 2Z2YB 3BGUA 5IQ6A 3W2VA 1KHWA 3E01A 2XS7A 1ATRA 2K3IA 4FJNA 3TUJC 4KH5A 3QEWA 4LRCA 5AXMA 3GMGA 3DLBA 1HNWF 3U7JA 3R5BA 3ELHA 3ILJA 2HBJA 1C4AA 1KAZA 4YUDA 1XMOF 4QYZJ 3SK3A 3OD2A 1YJNS 3BF1A 4CEEA 3NVKA 1I3OB 4PXEA 3DKDA 1WG5A 4TU8A 1P8GA 1J5EF 1VQMS 4I2PB 4L72B 2VG6A 2HMIA 3HJVA 3M30A 1NRKA 3HVRA 4IFVA 4CIOA 4IUFA 2VGMA 2ASDA 3RG6A 3C65A 4FOIA 4NXMJ 4Q0BA 3IM8A 4NLSA 4CEBA 4F26A 4E7IA 2F8MA 2GTDA 2PMHA 2KW4A 4AQYJ 5C24B 3J7ZT 1YZ7A 2RH3A 3VAKA 1M1KT 5J1EA 1X4EA 3FEXB 2R42A 1MNEA 3EYZA 2MY7A 2ZUGA 1VBXA 3P5TL 3RUBL 1U8WA 1HW8A 1R0AB 4PWUA 5B8HA 3CCVN 4FZVA 3MAAB 4M63A 4ZPDA 7FD1A 1P27B 4K5RA 3K5MA 3VA0A 1LV5A 5AQNA 1Q79A 1NHKL 1VQ5S 3VESA 1CVJA 1NWKA 1JL1A 1BQMA 1JQGA 2Z58B 2HPUA