3BGRA

Crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with tmc278 (rilpivirine), a non-nucleoside rt inhibitor
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title High-resolution structures of HIV-1 reverse transcriptase/TMC278 complexes: Strategic flexibility explains potency against resistance mutations.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase, hydrolase
total genus 158
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3bgrA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bgrA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bgrA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bgrA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3bgrA05
4F2SA 4IFYA 2B43A 3O4QA 1LW2B 2R2RA 2HNYA 4J9KA 3DM2A 3AA4A 3KD5E 4KAIA 4FXDA 2HHQA 4ECVA 3MXMA 3H4BA 4JS4A 1TKTB 1NK0A 4RG8A 4ECUA 3G86A 1KCFA 2ILZA 3V9XA 1S6PB 2P1JA 4ZVFA 3D5MA 2WTFA 2IC3A 2FVCA 5EU7A 1T7PA 5CYMA 2GV9A 5HP1B 5CZ1A 3K57A 4DTXA 4CJQA 3O3GA 1J5OB 4NCAA 1Y97A 3RRGA 4M45A 5KFRA 2ZE2B 2D0CA 1IKYA 2ZD1A 1T05A 1NK9A 1C2PA 3ZSVA 4E7LA 3L2QA 3GV5B 3S3NA 1XR6A 2JEFA 1FK9B 4O0JA 3K5LA 4DL4A 5DLFA 3LDSA 1WNEA 5I3UA 4CEFA 4HUFA 1ZBHA 4N56A 2B5JB 3SYZA 3H4DA 3MFIA 1S1TB 1XHXA 5KFDA 4RNMA 2AGQA 1J9AA 4LSNA 5J2PA 3CVKA 4IG3A 5EWGA 4CCHA 4CFDA 1JLAA 1KVAA 4MK7A 3KHLA 4TXSA 2R2TA 2VA2A 2OPPA 3LZJA 3AO1A 4FJNA 4KB1A 1EKEA 2DPIA 1JLEA 1WNSA 1EX4A 5DQGA 2C2RA 3HPGA 4EZ9A 3DRSB 4CEEA 3RRHA 4J9SA 1UA0A 4RW7B 4C8MA 3QEPA 4FJHA 4FM2A 1HQEA 2KFNA 2RPIA 2YNGB 4NRTA 5DG7A 3Q8SB 1NJXA 1VRUA 5JXSA 4KB0A 2BR0A 1S5JA 3V9UA 3BQ0A 2F8EX 4U6PA 4BDPA 2XY7A 4FZYA 3IAYA 4DSEA 3SZ2A 1S10A 5KFAA 4QPXA 3CQ8A 3CDWA 4Q45A 2IBKA 4ZHRA 4OVLA 4L8RB 2YNFB 3AO5A 3SQ2A 3MXJA 2BRKA 3CJ3A 3RMDA 4RW9A 1RBSA 3KLEA 4WXOA 5KT4A 1RT1A 1S48A 2FVRA 4ZP6A 2V0NA 4Z4FA 3C6TA 5CY4A 3I0SA 4CEOA 3O4NA 2HMIA 2W9AA 4CF8A 3V9SA 4NZ0A 3OJUA 1TAQA 4TY9A 1NNDA 3AVAA 4BE1A 1TKXA 1W0HA 1C1CB 3BR9A 4Z0UA 1U45A 3F9KA 4RNOA 1MU2A 4QW8A 3DLBA 1RNHA 4R8UA 1VSKA 1S4FA 3SPZA 4CK1A 4FJJA 4MKAA 3ZSYA 4Y3CA 3MEDB 3V6DB 3PW7A 2XGQA 2ATLA 5L1KA 4KREA 1BI4A 1A5WA 2EX3A 1ASWA 4FCYA 3I5AA 1UWBA 4NLYA 1FKOB 3T5LA 1ASUA 2FLPA 2IA6A 2JLEA 2O4IA 3SQ0A 3MEGB 4O5BA 3D0PA 4HTUA 1REVB 2OPRA 3QO9A 4NLRA 2KQ2A 5D3GA 4IDKB 4CFCA 4H4OB 2EHGA 4F3TA 1NK7A 4BWJA 1C0UB 2W7PA 2I5JA 2BGGA 1HJRA 1S0MA 1ZTWA 4ED6A 1J54A 5KFQA 3NHGA 2O4GA 3PVXA 2G8UA 5HBMA 3QNOA 4QWDA 3CWJA 4PQUB 3Q8PB 2HWHA 4ZVGA 4RNFA 4QOZB 2C2EA 1TL1A 4Q43A 1D5AA 1HPZB 4FJKA 3CDUA 2J6UA 4ED0A 4IFVB 1JLGB 5KG6A 1CXQA 3SV4A 2CKWA 3D45A 3FSIA 3AO2A 5J2MA 2XC9A 4F4KA 1CSJA 3OYNA 4M3TA 4CECA 2ILYA 3NFAA 4FJXA 3QGHA 3SFGA 1C1BA 3DYAB 3BSCA 1LWCB 3VQPA 3AO4A 2R2UA 3AVHA 3FQLA 5EUHA 3LP1B 4NLOA 1XI1A 5J2QA 3HP6A 3FRZA 2D7SA 2J6SA 3MEEA 2JEJA 4O3OA 5KT3A 2AU0A 2HAIA 2ZKUA 3KLHA 2V9WA 4FLYA 4DFPA 4O3QA 4E7KA 4PWDA 4DFJA 3NGZA 3H08A 3VQ5A 2D3UA 4HCBA 4OKKA 3OYCA 3KJVA 4W5RA 4KV8B 4DS4A 3OVNA 3OY9A 4W5NA 1C0TB 3FFIB 1RTJB 2BDPA 3OHBA 3MR3A 3IGNA 3AVCA 5KG4A 4AHUA 4IQXA 4EO6A 1S1UA 3PW0A 2FJXA 1RYSA 3OYHA 4WZMA 1VSHA 5KFHA 2PYJA 5FDLB 1RYRA 3QLHA 4XO0A 1T03A 3CM6A 1XHZA 5DG8A 1G15A 1SH0A 5HROA 4ZP8A 1RT2B 1RBTA 3VQQA 2I1RA 3H98A 1RT3A 3BDPA 4IBNA 5C25A 4O44A 2D41A 4O55A 3VQ7A 2RF2B 3NAHA 3QYYA 4I2QB 4TYBA 3PX4A 1EXQA 2G8KA 3I8DA 3NCIA 5KTQA 4MQ3A 1TV6A 1WSJA 1EETA 3OYAA 1LWEA 3ZT4A 1GX6A 4DQIA 3BSNA 2C22A 4NLPA 1IKVB 3V6KA 1XR5A 4CK2A 4ECYA 3RMAA 4Q0BA 3L2UA 1XWLA 3RAXA 3PY8A 4IG0B 1N6QB 4DEZA 3VA3A 5KFLA 1UAXA 4WE1A 4DTOA 1UOCA 1NOYA 1SV5B 4OL8A 4KKOA 2R8GA 4M3XA 5F8GA 2HHWA 1N5YA 3VQSA 3RMBA 4IR1A 4LQ3A 2HNZA 3KKRA 3B6OA 3QZ7A 2IJFA 4DSLA 2YKMA 2YNIA 4YR0A 1U47A 1RT6B 3VN5A 1K6YA 1RT4B 1RDBA 3SFUA 4HKQA 3OYEA 1RCHA 2GIQA 4X2BA 3KHGA 4N5SA 4DL7A 5F8HA 1SL0A 3M8PB 1RILA 4YP3A 3V1QA 1BISA 4B9NA 1BQNA 5DG9A 2Y1JA 3GILA 2Z1IA 3PX6A 5KGXA 1KLMB 1SKSA 1RA6A 3PJWA 1NK4A 1JLFA 5L1JA 3U6FA 3SJJA 4WYLA 3ULDA 4J9RA 5I42A 1S1XA 5C24B 3U3GA 3KLIB 4KTZA 4CHOA 1D8YA 4NLSA 4FJ7A 4IFYB 4WFZA 2W9CA 4LY7A 4F4YA 2Y1IA 2G8HA 2IOCA 1RDAA 3QIPA 1B92A 4N76A 3H59A 3V6JA 3HVRA 1HQUB 3M8QA 1FKPA 3RBEA 4ED1A 1BCOA 3AVFA 1A5VA 4FLXA 2YKNA 1TVRA 5KG1A 5JS1A 3LP0A 3GIKA 4O4RA 1YTAA 1S97A 3T19A 4CF2A 4RZRA 4M94A 2IC3B 3QEXA 4J9PA 2UVUA 1RDDA 2QV6A 3D28A 5CYMB 3KHRA 2IMWP 4O3SA 4CHYA 4H8KA 4KI4A 1CLQA 2IM3A 4TSXA 4U7CA 4B3OA 3KK3A 4M3ZA 4EYIB 3DDKA 4QWAA 2PYLA 2ATQA 3V9ZA 1IKYB 1T05B 5DQIA 4DU3A 4OPJA 2HVIA 3ZT1A 1RTHA 5J1EA 2GC8A 1D9DA 3NE6A 5F8JA 1MMLA 2HNDA 3PZPA 3HJFA 3CJ2A 4FS1A 3IN5A 4AHTA 2W9BA 4KHQA 5F9LA 3PW2A 4H54A 3MXIA 3HVWA 2IDOA 4FYDA 3P83D 4LSNB 4URQU 5J2PB 1NKCA 4IG3B 1RTIA 3SUPA 4Y34A 1JLAB 4E0DA 1R0AB 5T7BA 1NK6A 1DLOA 2DFFA 1JKHA 4OLBA 2XY5A 4HYKA 4CGDA 4RW8A 1WSIA 1JLEB 3K5NA 4MFBA 2W8KA 5KI6A 3LP3A 2IM0A 4FW1A 2YNHA 3HO1A 4ZP7A 4OKJA 2QE5A 5KT7A 1RBVA 4M3RA 4F8RA 4Q8FA 4K4UA 4NLDA 5KG2A 4EP5A 4CGHA 4WXWA 3DLKB 3OL9A 4OLAA 4ECSA 4HVJA 5KRSA 2HW3A 5KG5A 4MIBA 3IS9A 3I5CA 4NCBA 1WSGA 5KFJA 1KLNA 1QS4A 2RKIA 4EZ6A 4J2BA 5FRMA 1ZETA 4DU1A 4RW9B 1IKXA 1DTTA 3KLEB 1ZBIA 5CZ2A 2F96A 1RT1B 3QZ8A 3C6TB 4GMJB 2WK4A 2J6TA 4R0EA 5L9XA 2HMIB 3CJ5A 2JEIA 4CIEA 1D1UA 4BE2A 4M3WA 1VK0A 3RB0A 5EWEA 4FJLA 4DTMA 4FLVA 3DOKA 3E01A 1N4LA 2RN2A 5KRTA 1TKXB 2AX0A 4F50A 2UVRA 5KG7A 4B9MA 1QUVA 3PJXA 4CFBA 1MU2B 3CIZA 2VG6A 5F8LA 4B9UA 3KK2A 1Q9XA 4DF8A 1BCMA 1ZTTA 1IKWB 1C0MA 1S9FA 4K4WA 3T5KA 1SL1A 1BI4B 2YHBA 3TI0A 1UWBB 3OL8A 1F21A 4KHRA 3NH0A 3EY1A 5DGAA 1NOZA 4K8XA 1L3SA 2ASLA 4DTJA 1U48A 3PR5B 4CF1A 3QESA 4NCGA 2OPRB 1HNIA 4URSA 2ZQBA 3QO9B 5KFTA 3AVIA 4RW4A 1QSLA 3DRRA 5D3GB 1FXXA 2X74A 1IG9A 4ECZA 1S0NA 3LP2B 1RT5A 3F73A 2Z1GA 4AH9A 2I5JB 4KI6A 4JV0A 4KTWA 4ZVHA 4IH5A 3GIIA 1TK5A 1J53A 2ASJA 5HBMB 4MIAA 4J9MA 5JS2A 3NGYA 3ICLA 4AHSA 3ZSQA 1TL1B 1VSEA 2FLLA 4WFXA 4NYFA 3MFHA 3ZSWA 3VQAA 3IG1A 5T14A 2R8HA 3KK1B 1JL1A 1C1BB 3LWMA 1KVBA 3IRXA 4RW6A 4CE9A 4ID1A 2FJVA 3AVNA 1HNVA 2XCAA 4IRKA 1QE1A 3DLEB 3UPFA 2WOMB 3UR0A 3T5HA 4ZPAA 4KHNA 1JLCB 3TAMA 1XR7A 2KTQA 3WNGA 1TKZA 1SUQA 4RUCA 3OSNA 4DG1B 3OYGA 4CGGA 3S3OA 3DRSA 1SKRA 1HYZA 2E9ZA 5KGWA 3MEEB 3K59A 4BDYA 1NJZA 4WFYA 4RW7A 3GIMA 3PW4A 3WNHA 4YQWA 3QGIA 4BWMA 4JS5A 3LPUA 1LW0A 4CHNA 4DSKA 1T94A 4PWDB 2BQUA 3O3HA 4NRUA 1LWFA 4HHTA 4C8KA 3FDSA 3OYIA 4K4TA 2IAJB 4TQRA 3KKSA 3P1GA 1JL2A 4FS2A 3M8RA 4O4GA 2HHXA 1WLJA 3Q8QB 4PUOA 1D9FA 1VSJA 4EO8A 3T1AA 4FK2A 4CIFA 1S6QA 3QLHB 5HRSA 1T03B 3VQ9A 4ID5A 2FLNA 3PX0A 3HL8A 5F8MA 1QSYA 5FRNA 4G3IA 3HXMA 1JLBA 2AGPA 4KB7A 1HRHA 1RT3B 3HVAA 1NHVA 2DFHA 1I39A 5C25B 4O44B 1K1SA 3MAQA 1BHLA 4CJUA 4URGA 4KRFA 4FW2A 4ZVEA 3ZSRA 3ITHB 4R5PA 1S1VA 2BE2A 3HSTB 2G8IA 2ALZA 4ZMMA 1TV6B 3HVTB 1EETB 4G1QB 4CJWA 4MK9A 1LWEB 3SI8A 2D5RA 1RAJA 3DLGA 4ECXA 4RU9A 4CGIA 4CJEA 3SQ4A 3TQ1A 1S1WB 4TY8A 3M9MB 1WN7A 3HK2A 4CGJA 4Q0BB 3HP9A 3SI6A 1KFDA 4ED8A 3OL7A 4EEYA 5KFEA 3V81B 2E6LA 3E51A 3AA3A 2XHBA 2F8SA 2FBTA 4WE1B 3L3UA 2B6AA 2AWZA 3N6NA 3EPIA 3HKWA 3HPOA 5HLFA 4DQPA 2HNZB 1RT7A 3RB6A 3H2LA 3CFOA 5KFSA 1U04A 1ZYQA 3H5XA 2YKMB 4YFUA 2YNIB 3G0ZA 2BANA 4IH6A 3DLRA 4DLEA 3EZUA 4OGEA 1W25A 5C5JA 1CZBA 4CF9A 1JLGA 4ZPDA 4I9QA 4O3RA 4LH4A 3CJ0A 1LAVA 2Z1JA 4CJFA 3VQCA 4I7FB 3TANA 1HYSA 4JLHA 1RA7A 4J2AA 3BGRB 4MK8A 3V4IB 1BQNB 3RWUA 1LWCA 1KVCA 1YVUA 3G6XA 1Z26A 4IR9A 4QWCA 4KO0A 4DL5A 4ECRA 2FJWA 4LD0A 3QEVA 3OYDA 3MTKA 2OPSA 1VRTB 5L1LA 4DS5A 5I42B 3AA5X 3WNEA 3M9NB 3NH1A 2D3ZA 3DOLB 4CJVA 5SZTA 3OSPA 3NF8A 2ASDA 4C8OA 3KMQA 3JSMB 1TL3B 3SQ1A 3SV3A 2QK9A 4QAGA 3DLHA 1GX5A 4OPKA 4ED3A 4K4XA 4DSFA 1ZBFA 4TQSA 3SUNA 3K5MA 5HRRA 4C8NA 3NBPA 3KNAA 4TN2A 4Q44A 4ELUA 3M8QB 3C6UA 3GYNA 2AQ4A 5KFUA 4FJGA 2DPJA 4O3PA 1WAJA 4QW9A 1C0TA 2YKNB 3LP0B 4K4SA 1SH3A 5C42A 4ECWA 3CG7A 2QKBA 1NJWA 4FBTA 5K14A 5F8IA 1S9GA 4ZPCA 1DTQA 2UVVA 2VG5A 4IKAA 3TAQA 3TAGA 5J2NA 1BQMB 4B3OB 3I0RB 3KK3B 3EPGA 2NUBA 1RT2A 1RTDB 4XPEA 3OYLA 3KTQA 2PZSA 3IGVA 3TABA 5CYQB 5F9NA 1NKEA 1OS5A 4KSEB 2RF2A 2WONA 3VQ8A 2KZZA 3NL0A 3EYZA 1S0OA 2P5OA 1RTHB 5DMRA 1JX4A 3UIQA 2HHTA 4K4YA 4ECTA 4NLVA 2Z1HA 2W9BB 1IO2A 4ZP9A 1Q8IA 3JYTA 3MR2A 3TAEA 4YR2A 3ISND 1SKWA 5KFVA 2CJQA 3UQSA 1RTIB 4M3YA 4AHVA 4CJ5A 3KLFA 4AHCA 2RDIA 3OLBA 2WB4A 4MKBA 4F3OA 4Z4IA 4Z4CA 2HNYB 1WSFA 3DM2B 1DLOB 1JKHB 3DI6A 3THVA 2FVPA 2R8KA 4RW8B 3HT3A 4O0IA 3NH2A 3N6LA 3L8BA 4EBEA 4MFBB 3NKYA 4J9NA 3H5UA 4CJPA 3G10A 3SNNA 4H4MA 1EP4A 3LWLA 1JLQA 4F4ZA 2OZSA 2HHSA 3DMJA 4YMEA 2DFEA 2FBXA 2R8IA 4YNQA 2QKKA 4F4WA 4K8ZA 5SWMA 4JV2A 1S9EA 5JUMA 3MR5A 3TR8A 4I2PA 4Y1CA 2ZD1B 2ETJA 3TAPA 1RT4A 1U49A 4EBDA 3IS9B 3PV8A 5KFCA 3ZCMA 4KFBA 5E41A 1L3VA 4CJ3A 3RB3A 5I3UB 1B9FA 2BRLA 2IGIA 4J9LA 2RKIB 1C1AA 3S3MA 3SUOA 2WHOA 4HUGA 3BREA 3KLGA 1DTTB 4PY5A 4LSLA 2FVQA 4CHPA 1ZBUA 2JGUA 4CEQA 3I5BA 2QXFA 2DY4A 4ICLA 4NLQA 4Y2CA 1RBRA 3HPHA 4E19A 3BQ2A 5C24A 1X9SA 2OPPB 1KTQA 3DOKB 4CJRA 3DRPA 4KHSA 4JV1A 3KIOA 3L2VA 4FJ9A 3MECA 3KLIA 4FBUA 4FLWA 1U09A 3NMAA 4E3SA 4J2DA 4W5OA 3NDKA 3GQCA 2VG6B 5KFYA 4FM1A 2GUIA 2GBZA 3KK2B 1QHTA 3QETA 3RMCA 2E9RX 2OH2A 1KSPA 1HQUA 4FZZA 2VG7A 1HQEB 1TK0A 2OPQA 1VRUB 3RBDA 3KMSA 4B8AB 3KD1E 4KTQA 2GIRA 1GOAA 1QSSA 1L5UA 2XI3A 2XWYA 3OS1A 2G8FA 4NCGB 4ZHRB 3MR6A 2XY6A 2E9TA 1HNIB 3M8SA 3SCXA 4RW4B 5DGBA 3DRRB 5KFXA 2P5GA 1RT5B 2V4RA 2KW4A 1HMVA 5KFFA 4E7JA 2BQRA 4BACA 1LV5A 3B6PA 2W7OA 3I0SB 1LAWA 1BGXT 4CEDA 1B9DA 4LH5A 5KFWA 1IH7A 3L3VA 3AVKA 4BDZA 1WSEA 4CEBA 2HHVA 4DQQA 2AX1A 4F2RA 1BIZA 3IG1B 3CDEA 4CJSA 1CZ9A 4R8UB 4C8LA 4DSIA 1LW2A 1RBUA 1GOBA 1R0AA 4E1NA 3IRXB 4RW6B 4XIUA 1HNVB 1QE1B 2JC0A 4ED2A 4IRCA 5KFIA 4MH8A 1TKTA 4JUZA 3TAMB 1L3UA 3SUQA 1TKZB 1SUQB 4J9QA 5KFOA 1S6PA 4XPCA 3RAQA 4HCCA 2UVWA 3RR8A 3VQ6A 1GOCA 1TK8A 5HP1A 1QAIA 4LQ9A 3GV8B 3OYBA 2VWJA 3G6YA 1LW0B 1J5OA 3O3FA 4W5QA 3DLKA 4OGCA 5F8NA 2R2SA 4RNHA 4JRPA 3M9OB 2ZE2A 4AHRA 1VSFA 4KPYA 1LWFB 3PUFA 1FK9A 4DFMA 4CJLA 5KFMA 5HRPA 4CEZA 4FK4A 4TYAA 1IM4A 3OS0A 2B4JA 2B5JA 4O4GB 4PUOB 4ZPBA 4DU4A 1KRPA 1S1TA 1S6QB 2HWIA 3AV9A 5J2MB 2X6NA 4N41A 4ID5B 3AVLA 4CHQA 2EC0A 3TVKA 4CJTA 4O3NA 1JLBB 3BSOA 4Z4GA 3KOAA 1CXUA 1VSDA 5J2QB 4HUEA 4CFAA 4J9OA 5KFKA 4R5PB 1S1VB 2HB5A 2BE2B 4GC7A 4FJIA 3OS2A 3HM9A 3K5OA 4EYHB 3LALA 1S49A 2G8VA 2Q3SA 3LZIA 4M42A 5KFBA 1IKWA 3KLHB 3SPYA 2YNGA 3HHKA 3DLGB 2FBYA 5DQHA 4GW6A 2X78A 2G8WA 2KFZA 3BJYA 3Q8RB 3G6VA 4AILC 3WNFA 1NKBA 4CGFA 4GVMA 4TY8B 2E4LA 3V9WA 3KJVB 2PY5A 4J2EA 4Z4HA 2FVSA 1WAFA 2D0BA 3OYJA 4CEAA 2YNFA 4TLRA 2B6AB 1I3AA 3HYFA 1S1UB 3KLVA 3LP2A 4FLZA 4FJMA 3V1RA 4N47A 4NLWA 3VA0A 3A2FA 3C94A 3BSAA 4E89A 1C6VA 2A1SA 4RNNA 5HLFB 1RT7B 2FC0A 4CJKA 2YHAA 5HROB 3ZT2A 5KG3A 3QERA 5KFNA 4FVMA 3CO9A 1NK5A 1YTUA 2BANB 4B9SA 4Q5VA 1A5XA 1QTMA 4E7IA 2XY8A 4ELVA 3OHAA 4B08A 4DF4A 1VSLA 1C1CA 2HVHA 2C28A 3ZSZA 2XCPA 4DSJA 4QWBA 1HYSB 1TGOA 3KK1A 1TKDA 3MEDA 3V6DA 3V6HA 3V1OA 4KO0B 2V4QA 3DLEA 4I9LA 2WOMA 3H40A 3QIDA 4B8CA 2OPSB 4Z4EA 1JLCA 3QINA 2JEGA 4DG1A 1FKOA 4KBIA 4F4XA 4M3UA 5EDWA 4NLGA 3QEIA 1ITGA 3PW5A 3TWHA 3MEGA 3QEWA 3NF6A 2P51A 1NJYA 3AVGA 1REVA 3L2WA 2IS3A 4K4ZA 4ELTA 4IDKA 5DLGA 4FZXC 1KHWA 4H4OA 4KKOB 3OYMA 1JXBA 4GC6A 4NLXA 3NBPB 3PO4A 1C0UA 2WCXA 1D0EA 3H5YA 1N5YB 2DTUA 2ITGA 3C6UB 2LSNA 4NYNA 1YT3A 3TARA 1QQCA 2IAJA 3OLAA 4QWEA 3ISNC 4CF0A 2OA8A 3KHHA 4PQUA 5C42B 4ZTJA 4B9VA 4IH7A 3UDLA 5K14B 3PO5A 1S9GB 1HPZA 4B9LA 1DTQB 4KHUA 2VG5B 4IFVA 4NLTA 1NK8A 2OYQA 1T3NA 5J2NB 2X6SA 4KHWA 1N56A 3CYMA 3NGIA 4DTUA 4BE0A 3EZ5A 4FJ8A 4NYZA 3DYAA 4IKFA 4K50A 3OYKA 1NHUA 3GIJA 2XO7A 2XRIA 1O1WA 2F8TA 2UUWA 3LP1A 1X9WA 4ZTFA 1JLFB 2WONB 3QNNA 3RR7A 4KAZA 3ITHA 4FLUA 1S1XB 5KT5A 2XGPA 4CHZA 3JYTB 1YVFA 3HVTA 3NAIA 4DL3A 4G1QA 2D0AA 4CESA 3ASMA 3OYFA 4ED7A 3KLFB 2W9CB 3K58A 4K4VA 2E6MA 3QIPB 1SL2A 1I6JA 4DTPA 4CERA 3DI6B 1S1WA 3OL6A 1FKPB 4CJ4A 4OKEA 1HYVA 2IM2A 3T5JA 4NLUA 4KV8A 4FK0A 2AJQA 3FFIA 1BIUA 1TVRB 3V81A 1RTJA 4JRQA 2A1RA 4DTNA 4WZQA 4H4MB 4B9TA 1EP4B 3OJSA 4M95A 1X1PA 1JLQB 4OJRA 3DMJB 3AVBA 4PA1A 1JXEA 5KT6A 4DWIA 5FDLA 4DL6A 2C2DA 1RDRA 2KZMA 4M41A 5KG0A 1S9EB 3VQBA 4W5TA 4KE5A 4I2PB 5EWFA 3NGDA 5FROA 3ZSOA 4FJ5A 3RB4A 3L2RA 4FLTA 3TAFA 4ECQA 3CM5A 1VSMA 3NAEA 4IRDA 4YR3A 4QCLA 4KFBB 1JIHA 3T3FA 5DK5A 1ASVA 2OZMA 4DTSA 5J1EB 1Q9YA 3QIOA 4I2QA 4I7FA 2HNDB 2VWKA 2O5DA 3VQEA 2JC1A 2XI2A 4CIGA 1JXLA 3BGRA 3V4IA 3LANA 3KLGB 2YV0X 4Y2AA 1T8EA 3VQDA 4LSLB 1W9HA 4DFKA 2IM1A 1BL3A 3VQ4A 2W42A 4DLGA 3LAMA 5L1IA 3GV7B 1VRTA 4ICLB 3K2PA 5HRNA 1K1QA 1N48A 2WRMA 4DTRA 3NF7A 1IKVA 4E1MA 3AA2A 3DRPB 3RTVA 3MECB 3DOLA 3PR4A 1TAUA 2W8LA 4IG0A 3JSMA 1N6QA 1TL3A 5KT2A 3P5JA 2R7YA 1UA1A 1KHVA 1ZBLA 3CJ4A 2YNHB 1X9MA 1SV5A 4RUAA 3MF5A 4Y1DA 3LPTA 1HARA 2VG7B 1KFSA 3BQ1A 4EP4A 3ZSXA 3ZT0A 2OPQB 5KFPA 3AO3A 1WSHA 1L3TA 3PHEA 2BQ3A 2R8JA 3CFPA 3FQKA 1RT6A 4DMNA 3AVMA 4WYWA 3ZT3A 4CK3A 4KHMA 4KHYA 3NF9A 2VA3A 5KFGA 1BQMA 2RDJA 3U3YA 3S9HA 1XC9A 2FBVA 4E7HA 3I0RA 3M8PA 3N6MA 3ALYA 4DQSA 2UUTA 1RTDA 4DL2A 4Q8EA 4UQGA 3C95A 3AVJA 3H5SA 1IKXB 1HMVB 5CYQA 4EBCA 1KLMA 3LAKA 1RDCA 2AGOA 1SH2A 1TQLA 1VSIA 1Z25A 4DQRA 2HHUA 1TP7A 5KFZA 1U4BA 3QGGA 4IOBA 3E01B 1QAJA 1Z4UA 2IJNA 3CFRA 4FM0A
chains in the Genus database with same CATH superfamily
2OJ3A 4WCEQ 7FD1A 4F2SA 1CJKA 4U8VA 2B43A 2B7CB 2E29A 4EFHA 3CUNA 2HNYA 4KAIA 3J7ZO 2UU9J 4BRDA 1O13A 1ZAWA 2V2ZA 3QWPA 4RG8A 2IRUA 3UD5A 2ILZA 3CMEN 3V9XA 1EAYC 5LJWA 4H0OA 2IC3A 4UT4A 1IBLJ 1T7PA 4AXIA 5CYMA 3RSEA 5F0XA 3K57A 4DTXA 3ZTPA 4CJQA 3MCPA 4GV9A 4NCAA 1Q7YO 3G8QA 3RRGA 4F7VA 1N36K 3MX2A 2BW2A 2ZE2B 1N88A 4GVLA 4X66J 3R1HA 1RSCA 4CH7A 2RHKA 3O4WA 2HBYB 3UI3A 3IMXA 4A8OA 1NB7A 3L7UA 4MKYA 3GL1A 4DL4A 5DLFA 4OX8A 1BUPA 4HUFA 4N56A 3W2WB 3GPAA 3H4DA 2FHJD 1AA1B 1S1TB 2AEFA 2EG2A 1NM1A 3G82A 2D4WA 2Y8WA 5EWGA 1EKSA 2FGCA 4LF6F 1JLAA 1W7AA 2EBEA 3G25A 4RX6A 3W8GA 4IUFA 1URRA 3RBXA 2CPXA 3RVCA 5AQHA 1JLEA 4Y2MA 1HFEL 3LF0A 4EZ9A 3KZBA 2WVDA 4J9SA 3CE8A 1FJEB 4NI2A 2P9EA 5GADP 5GAHI 2WC9A 2MLZA 2RPIA 3FCVA 5DG7A 4B3RF 5DZ7A 3V4MA 3GBTA 2EFQA 1VRUA 1X4GA 3BQ0A 2F9JA 2F8EX 1K9MO 3W2VB 3IAYA 3PDNA 1TL4A 2IBKA 1OQ6A 1X31C 4JI0K 4Q7AA 4ZHRA 4M5GA 4HH1A 4LF5J 3B4DA 2KM8C 4RO0A 4YDDB 2QA4S 1ZA1B 2YKOA 3AOCA 3MUTP 4FOIA 1WTFA 3CJ3A 2DEJA 3RMDA 1VQ7S 1RBSA 2VBWA 1RBAA 1F2HA 2HF3A 1RT1A 3KWGA 4CEOA 1FFSB 3SMZA 3AOBA 1KVJA 4WF9Q 3AVAA 1TKXA 2MEWA 4J5OA 2E2NA 3JS6A 4FO0A 4JK8A 1VQMN 1U45A 2OEKA 4RNOA 2F4VJ 4TLQA 3OV7A 3CMAN 1JB0C 1RNHA 4R8UA 2RUSA 1VSKA 3VZIA 3SPZA 4FJJA 3ZSYA 1UVIA 4Y3CA 3MEDB 3V6DB 3D2FB 3PW7A 1KBRA 1R89A 2GJIA 1JJCB 5L1KA 4KREA 1A5WA 3D2EA 1ASWA 2QEXN 4GV3A 3I5AA 4CDIA 1NO8A 4KY3A 3MEGB 3C16B 1QAYA 3D0PA 3VAGA 3MM7B 1S0VA 4NLRA 3CF5L 4ZLPA 4ZVOB 4WFBQ 2BV3A 2W7PA 1SJQA 3O1LA 4ILLA 3H0PA 2AJFE 3QNOA 3Q8PB 4PQUB 2HWHA 2DITA 2XWXA 3I6PA 1ATSA 1VJQA 4IOCL 4ZVGA 2DHGA 1TL1A 4LFCJ 3D45A 2L08A 3D7EO 3N0VA 2FZCB 4F4KA 3OYNA 1N33F 3KFWX 1U0SA 1FT8A 3NFAA 3DYAB 2KFYA 1FTRA 3VQPA 3E8OA 1JK9B 5AT1B 3R7SB 4DR3K 1WHWA 5EUHA 4NLOA 2A3JA 3GCWP 2IMOA 1WI6A 4O23A 2DJWA 3FRZA 2HLUA 1FERA 2K2PA 2ZKTA 3CJQA 2BOPA 2Y9HA 1BLUA 3ZO7A 3MTJA 2MLYA 1FJGK 4DFPA 4O3QA 2PAVA 3J81O 3H08A 3VQ5A 4F3QA 2I9SA 2MPUA 4W5RA 4B3TJ 4DX5A 3GMGA 2FQQB 2AV5A 3OHBA 3AVCA 1X9JA 4QIVA 1S1UA 2H54B 1NMNA 2KL8A 4FF4A 3OYHA 1WG5A 1HWJA 5FDLB 3QLHA 1NSAA 1T03A 1XHZA 3DXSX 4ZP8A 1RT2B 2WSFC 3G6ES 1V3RA 4IBNA 5C25A 2I7PA 2MZJA 1XQSC 3H90A 2VYPA 2QA4N 3H1VX 1Q5YA 4CVNE 3W0LA 3QYYA 1VQ7N 2ZNZA 4YOWA 3NCIA 1T9YA 4AXJA 3TNVA 3D67A 5KTQA 3TOQA 2WUSA 2B0GA 4DQIA 2R4FA 4BVPA 4YDUA 3G2XA 3T1HK 3BSNA 2DR6A 4ES2A 2A3ZA 1IKVB 4ECYA 3TUJC 3RMAA 1H7WA 3PY8A 1KQGB 3VA3A 3W3SA 3EXYA 5KFLA 4WE1A 1G2EA 1QTNB 2R8GA 4M3XA 4JKEA 4LBPA 1IXKA 2E5IA 3QATA 1X3MA 5ETRA 3C65A 3OVSA 4B17A 2IJFA 4DSLA 3RU0A 3ZFVA 5ETNA 3TJ8A 2J76E 4ANCA 3R3TA 3JSYA 4IEIA 2VPZB 1Q79A 1RDBA 3SFUA 4OJ3A 3EE9A 4FVCA 2GIQA 4E98A 4WTOB 3MURP 3JB9k 2PC6A 5C15A 3EJMA 2BMBA 1ESVA 5DG9A 5AFUA 5KGXA 1KLMB 2I6WA 1SKSA 1KS2A 3U6FA 5IOLA 4C0HA 3GJQB 4JI4K 2QLWA 3MM5B 3TX0A 3BV8A 5E26A 3TEGA 3O5BA 3P4UB 3O8MA 3AAQA 1UKUA 3A8JA 2CQPA 3KLIB 4G1PA 1D8YA 4OMFG 4WFZA 4HHUA 4F4YA 3FRYA 1Y3JA 5K9FA 1N34F 4N76A 3BH7B 2ZGYA 2LECA 2X1BA 4F0HA 2ZDOA 3M8QA 5BPLA 3SCIE 3MR7A 1BWVA 5CA5A 1XMOK 3N28A 1S79A 3AVFA 3CQYA 1A5VA 4M5LA 2YKNA 2KXFA 3LP0A 3GIKA 2WVCA 4ZIVA 1UJ6A 4RR5A 4CF2A 4RZRA 2L41A 4HT5A 3QEXA 4J9PA 2UVUA 1RDDA 2E2PA 1IV0A 2JLFA 1NSQA 2BJ9A 4B3OA 3KK3A 1YJUA 3ENBA 4QWAA 1IKYB 4DU3A 2GVZA 4OPJA 5CAAA 3BBCA 1SQFA 3THXB 2DVIA 5J1EA 4CZJA 3NE6A 4FSVA 4OYPA 4AHTA 4L75A 2W9BA 1XNRJ 1D4XA 3MCNA 4KHQA 5F9LA 2UU9F 3HVWA 2XS7A 4URQU 3G6EN 1FFGB 4ZPVR 4IZ9A 2HVEA 3M2VB 4DU8A 5ETSA 2DFFA 1IBLF 4OLBA 3R27A 2GAHC 3QBXA 4NA1A 4JI7F 2ZH1A 2HBMA 5THWA 2BE7D 1C4AA 3LP3A 2IM0A 3R9PA 4P74A 1YHQS 2VFVA 4X66F 3CHWA 2QE5A 1RBVA 1MROB 3A3OB 2LEPA 4F8RA 1P9QC 4G6VB 3OL9A 2W24A 3OT9A 2C2MB 5JVHL 1WBBA 1X4FA 3LDNA 1CS4B 2F65A 3IS9A 1LOUA 2NLWA 3VAJA 5CH7B 4RKUC 1XTZA 4NCBA 3NS7B 2RU9A 2P9UB 3WQTA 1FVQA 3HX9A 5HQMA 4OI6A 4C7QA 4IFEA 2NSBA 1YJWS 4I1TA 2JOQA 3HTVA 5CD4H 4CZCA 3QZ8A 4GMJB 4QPTA 3VGSA 4B3RK 1LQ9A 4WQ4C 1RWUA 4B9MA 1PYOB 2MQLA 3PJXA 5GADU 5AQYA 2NREA 4MYTA 1AB8A 2HGLA 3MMAB 1WUAA 4ISEA 3ZNUA 4B3SK 4M5HA 5ETOA 4NO7A 4B9UA 3KK2A 4YDUC 1Q9XA 4IOAL 1BCMA 1C0MA 4U7UK 2Q3PA 2JJ4D 1IG8A 3SBTA 4LF5F 1BI4B 1DURA 2FZKB 2DR9A 3THPA 5B7WA 1YBTA 2AJ1A 2G0CA 3BDEA 5KPZA 4A8KA 4Y65A 3KNGA 3DLLL 3PR5B 4NCGA 4ED5A 2PA3A 3QO9B 1TUGB 1UFWA 1B64A 3DRRA 3EE8A 4CYUA 2DO4A 2PEBA 1K73T 3SQGB 2Z1GA 3H2UB 2AHOB 3HSDA 5EX3A 2OKQA 2CJKA 3EWGA 2F4VF 4ZCMA 2ASJA 4MIAA 4GNIA 3R3LA 1SC1B 4NLBA 3ICLA 5I4MA 4AHSA 5HK4A 2GTDA 2MZSA 3AB4B 5HOOA 4JI6J 3JXUA 4WFAQ 2R8HA 3FSXA 3T6JA 1KVBA 4ID1A 1HUXA 1HNVA 4KHNA 4ZPAA 4KJIA 4NYPA 1JLCB 1FWLA 2VPYB 3AB2B 2KTQA 1SUQA 4YB5A 1G7CB 3OYGA 5D8HB 3QDKA 3DRSA 1SKRA 2P9PB 3ZETA 1JCGA 4BDYA 4RW7A 4JK7A 3QBWA 2ZH4A 4X84A 1NJIO 6AT1B 4C48A 2P9NA 5EXWA 2KI2A 1UMJA 1NGJA 5JICA 1N33K 3LL3A 1YJRA 4LFCF 2MLXA 4GKKJ 1YHQN 3KKSA 1DZ5A 4E8UA 2HHXA 1EQMA 1NGDA 4AF1A 2YKAA 3IXQA 4B02A 4CIFA 1NH7A 1BXNA 1U2CA 4R0JA 2E7XA 4JHDB 1PJ5A 4ID5A 1PYSB 4NEYA 3PX0A 4I6WA 3HL8A 4M5NA 5FRNA 2B4OA 4ZDNA 4JYAF 2MZQA 2M7SA 3POTB 3HVAA 1KQSR 3A8IA 4O44B 2V34A 3MAQA 3AAPA 5T7LB 1YJWN 3S6EA 1YITN 1C0GA 4R5PA 2WZ1A 2HBRB 2MQ8A 1Q1KA 2MKIA 4DUYJ 1UVMA 5EGYA 4OFZA 1TUWA 4U67Q 4MK9A 4X4SA 1LWEB 3UNGC 3SI8A 1NBEB 4FL9A 1WC1A 2V8PA 3RGIA 1T9WA 4LFAJ 2ZC3A 3TQ1A 2OI2A 1WN7A 4CGJA 1LOTB 5D4NA 3UDEA 4ED8A 2KLAA 3CO0P 3OL7A 4EEYA 1WWHA 4PCQA 2XHBA 4ZJQA 3L3UA 2BH1A 4BROA 2D1KA 2CPIA 5HLFA 4DQPA 3RB6A 3A5LC 2KG0A 1ZYQA 3OW2M 1KOHA 3AJ2A 1VISA 1ZM2A 3G0ZA 4DLEA 1J6ZA 4B1VA 3EZUA 5ETVA 1UW4A 1DARA 4CF9A 4DB3A 3LGMA 2CPJA 4NOHA 2ITMA 4I9QA 3FBCA 4BRFA 2PMWA 2Z1JA 1GXLA 2XMWA 3DOMA 1ROFA 4CO5A 3TANA 2RT3A 1UEKA 3HHLD 2LP4A 1KVCA 4FWNA 4FWLA 1NGHA 1Z26A 4JI2K 1JJ4A 4DL5A 3VF2A 5FPDA 3IKMA 1P8ZA 3OYDA 3DN9A 1S72S 5E33A 4DS5A 3UE5A 3L4IA 3MPUB 2EK6A 1RAIB 3AA5X 3JQMA 3M9NB 3NH1A 2D3ZA 3D1OA 3DDIA 1R0CB 1X5TA 2FC8A 2ASDA 4C8OA 2VBYA 3JSMB 3SQ1A 1GX5A 3M30A 4K4XA 4QYZK 1ZBFA 3HD1A 1MA9B 1VFJA 2MKKA 1PSDA 1Y5NB 2RSQA 3GYNA 4FJGA 2ZJQQ 3MWPA 3SLCA 1NGGA 1YI2S 4QW9A 3DGVA 1KTVA 3IC1A 2FXUA 4EWTA 2VG5A 3TAQA 3CJTA 5J2NA 1BQMB 2EEYA 3S8SA 3ONQA 2AYMA 1WKKA 2V50A 2PFDA 3MDFA 2RE1A 5LJ3Y 3F5TA 5CYQB 1NKEA 2EFOA 3VQ8A 2KZZA 3NL0A 1N34K 3EYZA 3FGUA 4H5VA 4JKCA 3CCMS 1OY9A 4ECTA 2GZOA 4BQZA 3A1YG 1IO2A 2CZVC 2CJQA 4DN0A 3KLFA 3MD3A 2GWKA 4EGLA 2RDIA 2KG1A 4Z4IA 4F3OA 1P1LA 2HNYB 2XQCA 2M5YA 3AAWB 2W6KA 1JKHB 5LMNJ 2R8KA 1Q18A 2CPYA 3PRBA 5LY3A 3N6LA 4EBEA 4MFBB 2DNGA 3H5UA 1GXTA 3ZTSA 1T3VA 1EP4A 4CJ7A 3SMPA 2IIHA 4OJGA 2OZSA 4DZ6A 2R8IA 3FEZA 3NP5A 2XMKA 4K8ZA 5A0YA 5EVZA 4XDDA 4JAXA 2PFFB 1QY7A 3MR5A 2UU9K 1PILA 1FDNA 4I2PA 3K89A 2I7NA 1TU0B 3EVWA 1XNRF 4HHHA 1LK7A 3LA0A 1L3VA 3ATVA 3UKRA 1IBLK 2BRLA 1GAOA 1H6KX 4FYWB 2C2NA 2HS4A 4OIXA 1DTTB 1T9VA 1S22A 3HOSA 4PY5A 5H9FJ 4QIGA 3R5CA 3G82B 4CHPA 4X66K 1HI8A 2QJ3A 2GQCA 2QXFA 1VLOA 2CQGA 1HHQA 1RBRA 4IJAA 2EFNA 4E19A 1QDUB 5HANA 5H9EJ 1KTQA 4CJRA 4JV1A 3KIOA 3GG1A 2E5HA 4FLWA 1U09A 3VOVA 2QXLA 3U02A 4FPAA 1F5BA 1QHTA 3QETA 2OH2A 1VOMA 1KSPA 1S72N 1HQUA 2ZM6J 1U1KA 1F5CA 2M3DA 1TK0A 1OYEA 2DKOB 2DNMA 1VRUB 4MKVA 3OBIA 2QA2A 2NZ4A 2VF3A 4KTQA 2HQDA 1AFIA 4ZN1A 1L5UA 2XI3A 2MQQA 2K1RB 4ZIWA 4ZHRB 4CT9A 4ZVSB 5KFXA 2P5GA 2POKA 2G0IA 3ENWA 1RT5B 3PSFA 4OI1A 1YI2N 3H3OB 1K73O 3J7Z5 2BQRA 4E7JA 2IFXA 1IJJA 3DWLA 2VIHA 2HS3A 2A2CA 4JK9A 4CEDA 4FDFA 1CPZA 4P75A 4LF5K 4O5FA 2RRNA 3AVKA 5D6GA 4F2RA 2LA6A 2WVEA 4PWWA 5B0AA 4CJSA 2MXYA 3B8HA 4R8UB 4C8LA 1HR0J 2KXNB 1U0HA 3OD2A 1V5IB 3PFOA 1QE1B 3IMQJ 3M2UB 4ED2A 3CCMN 5KFIA 2IVYA 4OYMA 4ZK7M 3HBTA 4U7UD 4MH8A 1TKTA 2LQ8A 4JUZA 3D2EB 2CPEA 1TKZB 1SI9A 1X0FA 1F6TA 2YHXA 3O9RA 4RTFD 5D77A 4BQLA 4HCCA 3A12A 3TZWA 2F4VK 1GOCA 5HMWA 1MSWD 3CW2C 1G99A 1F3FA 3PKMA 1J5OA 1VQ9S 2UXCJ 3O3FA 4W5QA 4H5NA 2Z58B 3DLKA 4UOHA 2R2SA 2AIRB 3TSUA 1N0VC 4JRPA 4I6YA 1IQZA 2NXUA 2DRBA 4NLCA 2J8AA 4AQYJ 1GLBG 5DS7A 3DGPA 1HWKA 4EIAA 4BRGA 3TUIC 1QVGM 4CEZA 1IM4A 2B4JA 3OFFA 3EGVA 1MMNA 2B5JA 4O4GB 4B1UB 3BZQA 4M5KA 2DIVA 4ZPBA 1KRPA 1QHAA 4LRFA 1WC6A 1GK8A 2B8QA 4B1XB 3QT7A 2DTJA 4CHQA 3MXHP 5B08A 1VYAA 1KR4A 3FSYA 1JLBB 5A76A 3O9UA 2KRBA 3BZKA 2GNKA 2KYXA 2Q79A 1VSDA 2IVNA 3R7BB 2VONA 1S1VB 2BE2B 3T1YJ 4LFCK 4KPCA 4B9QA 3H6EA 4GC7A 4FJIA 3BF4A 2JVOA 2O8DA 3CCVN 2G8VA 5D4OA 4IXCA 4GKKF 4P9SA 1VIOA 2MKYA 3Q8RB 3G6VA 2AEMA 4AILC 1TZ0A 4YEAA 1NKBA 1U1NA 1UVLA 1U02A 3J7AN 3LW5C 4KGZB 3MHYA 4F0MA 2PY5A 1NCLA 2YNFA 2WSEC 3TJAA 3EZWA 2HZVA 4V19X 2DNRA 1WUUA 1S1UB 4OHZA 3KLVA 1IQTA 1QD1A 4FJMA 5JMNA 3A2FA 3BSAA 4HLBA 2A1SA 2DNOA 1ZZFA 2RQMA 3WZ0A 2BM1A 1RWPB 3R1XA 2ABYA 2BANB 3D66A 3WIVA 1A5XA 4J37A 5KOWA 4DUYF 1U2VB 1RWWB 1MW7A 4B3TK 3OHAA 1FJCA 2AP1A 1TR0A 2DH8A 2ZH6A 2HVHA 2A18A 2DNHA 3F44A 3ZSZA 1OSDA 2XCPA 4DSJA 3M5RA 3PJ9A 4KC5A 1HYSB 1TGOA 3NOGA 3F41A 3BGFA 5CCLA 4U9RA 4DCOB 3DLEA 3KWIA 3H40A 1JNZB 3B6BA 2OPSB 4C3MA 2XEXA 1PJ7A 4DG1A 1FKOA 3BN4A 4M3UA 5HVFA 5EDWA 2P2CB 3QT5A 3ZNJ1 3QT6A 3L2WA 1X60A 1HA1A 4H4OA 1A0OB 2XBPA 3P49B 3WEEB 2VDIA 3PO4A 1C0UA 2OO4A 2ZHOA 1UVKA 2ITGA 3HRGA 2XZDB 3KG1A 4NYNA 3S1TA 3N4WA 3C6HA 3TARA 2IAJA 5AQGA 4QWEA 4X4OA 4P7VA 4CF0A 3KHHA 2G2ZA 2LVWA 4U96A 4ZTJA 1O51A 4IH7A 4KHPJ 3D2WA 5K14B 1VQ9N 1SPBP 1HPZA 1DTQB 4KHUA 4NLTA 1NK8A 4UQTA 2OYQA 1T3NA 2X6SA 1OH7A 3KJFB 3CCLS 3D1HA 1N56A 2B56A 3CYMA 4DR7J 4BE0A 3EZ5A 4FJ8A 1S7HA 4KIAA 5AQPA 1NHUA 2XO7A 3GIJA 1ZBTA 2XRIA 1SZ2A 2F8TA 2IDLA 2AW0A 5FD1A 2UUWA 1X9WA 1FRMA 4TNOA 2WONB 1K8AT 2QWPA 3JAMY 1FRKA 2H3EB 3QNNA 3RR7A 2CADA 4KAZA 1VQNS 1P9YA 4MT1A 1UVNA 1KP6A 2UV8A 1MG7A 4GKJJ 3FZFA 4P73A 4DL3A 2HEKA 2HGNA 2DCUB 4AL7A 3OFEA 2JH3A 1W7WA 1RKIA 1PYTA 1V9OA 2YWWA 4DTPA 4CERA 2GJ2A 3U7JA 4DPTA 2ZBIA 4KV8A 2AJQA 3FFIA 1BIUA 2ZUAA 1RTJA 2ZH5A 4JRQA 1NLVA 4DTNA 1T9TA 4WZQA 4B9TA 4H4MB 3OJSA 4M95A 2QWOA 2Q1NA 1X1PA 4OJRA 3DMJB 3AVBA 5CHIA 5ETTA 2MHNA 1BO5O 4DL6A 1U1OA 3F2KA 3EICA 1RADB 4DXLA 1S9EB 4W5TA 4ILGB 3L7OA 4USMA 5EWFA 4CO4A 3RB4A 2PSZA 3L2RA 4FLTA 5AZJB 4YR3A 2NYHA 2DHXA 5DK5A 2OZMA 1F9HA 4W98A 4WFNL 1IM6A 5J1EB 1HKGA 3AT1B 5DM6L 3QNWB 3VQEA 3OFHA 5EX5A 1NG9A 3OA9A 5LMNF 4Y2AA 1M5PC 3VQDA 1W9HA 4OV1A 5DRKA 2HSTA 2W42A 4LF2A 3GV7B 2DGWA 2WRMA 2YCHA 3DRPB 3VENA 3RTVA 3MECB 3HFVA 3PR4A 1TAUA 3AJ1A 1XNRK 1KHVA 2W2OP 3CJ4A 3DXBA 1X0PA 4RUAA 4ETXA 1FX4A 4Y1DA 3LPTA 1M0SA 2VG7B 1KFSA 1Q82O 3L6QA 3FZLA 1B0VA 1RAFB 3AO3A 2R7RA 4H0VB 4BRLA 2Z2MA 2BQ3A 2DR7A 3PCOB 3RG6A 1WBDA 2MGZA 3FQKA 1RT6A 2D0OA 3P3DA 4XDCA 3BBBA 4WYWA 3HJVA 2SXLA 3SSRA 3U3YA 2FBVA 4E7HA 1MN9A 1RHJB 2JDJA 1GMWD 2YWFA 3C95A 3ISZA 2Q97A 2A5XA 1HMVB 3VGMA 4DV7F 4OX6A 2E20A 4AL5A 4H5RA 4UZCA 2AGOA 2NRWA 3QT8A 1BWEA 4DQRA 3JAMU 3GE9A 3G9CA 2MSTA 4IOBA 3UNYA 5HL7Q 2P8IA 2ZM6F 2MKJA 2EWHA 5M2UA 5LT5A 3P31A 1CULB 3K8WA 2D9OA 3TEHB 1BE4A 2E5JA 2RIJA 1VLYA 3DM2A 1TUYA 3AA4A 3M8ZA 1VQNN 3MXMA 4JS4A 1QM9A 1NK0A 2V8DA 1Q78A 3G86A 4NA3A 5M2PA 2BJEA 2HFVA 5A2QO 2CGJA 2WTFA 1OY8A 2R7OA 3DU5A 3NNHA 1EQYA 2GV9A 5HP1B 5CZ1A 4K0KJ 1ATRA 3HSGA 2YHWA 4M45A 2ZZNA 1HWLA 2RAQA 2CNOB 2A6OA 4NXNJ 1NK9A 3L2QA 2YJFA 3S3NA 1U2FA 1Z2ZA 1FK9B 2Z2YB 3K5LA 4O0JA 1NU4A 2VPWB 3LDSA 1YRTA 3FMWA 4BHQA 4B3MJ 2P9LA 4R25A 4LSNA 3LO3A 4EUVA 2YQ1A 1LEOA 2HFUA 3QQCD 3CCRS 1S57A 4A5AA 2BEFA 4OZ5A 1NZAA 2GGPA 4FPIA 3KHLA 4A57A 2R2TA 3NGUA 1W26A 2VA2A 3QBCA 2OPPA 3AO1A 4KB1A 3H8YA 4DV0J 4LFBJ 3ULEA 3NS6A 2UXCF 2PEHA 4YN3B 4DI6A 2DHAA 3IFEA 3DRSB 3M4XA 3RRHA 2EVZA 3ZETB 4CLYA 5IT9O 1UA0A 4JI6K 4RW7B 4AQYF 3QEPA 4FJHA 3AHPA 3Q24A 3CC4S 5JMVA 3FCWA 2YX1A 1PGZA 1NJXA 5JXSA 4KB0A 1S5JA 4AD6A 2GX8A 5KPRA 1RP5A 2XY7A 5M1KA 2PN6A 4FZYA 3SZ2A 3WDOA 4QPXA 3PIPL 8AT1B 4QR2A 4YB1P 4WIQA 2ZHBA 3MXJA 2MKCA 4AM6A 1PJ6A 4K25A 3QGPA 4BR4A 3AXMA 2FVRA 2V0NA 2X3DA 3A4TA 1ELOA 1RU2A 2HMIA 3T1YF 4OX9F 3V9SA 3VEYA 2DEIA 4GKKK 3OTOJ 1NNDA 3GSDA 1OJ4A 5E3PA 2CQIA 5B0CA 3J7YP 5JLHA 1XUPO 1MU2A 5ETQA 4A8WA 2JL9A 4CK1A 4MKAA 3WIUA 2N7YA 4IWVA 2ATLA 4KRWA 4I67A 2CQ2A 2CRLA 3H46O 2BXJA 3NY0A 3T5LA 1ASUA 2FLPA 2IA6A 2JLEA 2VBXA 4AT1B 2O4IA 1M90T 2MQMA 2FHJA 4BVOA 3PACA 2IRXA 2FSNA 3MCOA 2PFUA 4HTUA 1FVSA 1REVB 1OY6A 1R8PA 1RUSA 2BJDA 4DUYK 4LSZB 4B1YB 4YY3J 2BJ8A 2DH9A 4CFCA 3GJSB 1QVFM 1RB0A 2EHGA 4BWJA 4OJHA 2I5JA 2BGGA 1HJRA 1VQ8S 4USTA 1ZTWA 1ZM9A 3FBEA 2CJYB 4LFAK 1H72C 5D4PA 4ED6A 5CQGA 4LF8J 1VHXA 4G65A 3NHGA 2MYFA 1B99A 3PVXA 2O4GA 1IBMJ 5HBMA 4QWDA 2CZ9A 3IBWA 4HVZA 5CZVA 3EUNA 2OTLS 2C2EA 4Q43A 2DR8A 1D5AA 3CDUA 1I5OB 1T6DA 4PPDA 3SV4A 5KG6A 1CXQA 1E6VB 2CKWA 1NUEA 3AO2A 4FWSA 4DX8H 1FD2A 4JKAA 3MPWA 2RUGA 1C1BA 3GWCA 3M6GA 2XM3A 3AVHA 3DRXA 3U27A 1XI1A 1M1KT 5AQKA 3KJQB 4NASA 2J6SA 4FWQA 3MEEA 1KD1T 5KT3A 2AU0A 5L9NA 3CCRN 4ISFA 2HIQA 2A41A 1G1XA 1S76D 3FE1A 4PWDA 3HFZB 1RAAB 3VTHA 5DETA 1NDCA 2C42A 4KHPF 3JSRA 2FF3B 4HCBA 3DJCA 4DS4A 3OY9A 4I68A 2C3OA 3FZMA 3IM8A 5KG4A 2LXIA 3CC4N 1NDKA 2FJXA 1PBUA 2PYJA 1PCAA 1A6LA 2KT2A 4H03B 5DG8A 2BJ7A 1VQLS 1NPPA 4FN5A 4CW7B 1RBTA 4LR9A 2HRUA 2VKRA 2I1RA 1WEZA 3EDQB 2G4BA 4LMZA 5IQQA 2Y1LB 4GKJF 2XMUA 4O55A 3VQ7A 1EZZB 2GVDA 5LL6d 2KT3A 3SK3A 3NAHA 3JQKA 3PX4A 1KOOA 1EXQA 2G8KA 3I8DA 4M5DA 1NNEA 2FTRA 3O3LA 1WSJA 2W41A 1WOOA 3LPEA 3M1FA 1R6VA 1YKWA 4JBCA 2NPIA 5BREA 4DV3J 2KB2A 4CK2A 2KHDA 3AD7C 1BHNA 2K8GA 1FJ7A 1E4GT 1AW0A 3RAXA 1ZXOA 1NGBA 1N6QB 2V4JB 3TTDA 1KQKA 4AFFA 2W4DA 4DTOA 3C46A 4WQ5A 1NOYA 4OL8A 3GIRA 4LBHA 2DGUA 4ZA1A 2P5VA 2HHWA 3SCLE 4CZLA 3VQSA 4IR1A 5A0YB 2HNZA 3KKRA 4WBFA 1Y00A 5LMNK 1AZSA 1WC5A 1QJHA 5LOQA 1U47A 1YLXA 3HT0A 4HKQA 3OYEA 2HKEA 2V7ZA 1RCHA 2M8DB 3CD6S 4X2BA 3KHGA 2RS8A 3M8PB 1RILA 4YP3A 2KH9A 1VQ8N 1BY9A 3GR1A 2V67A 1BQNA 4ZPTR 2LU1A 2Y1JA 2CFXA 3GILA 3PXGa 2Z1IA 3PJWA 3GJTB 1NK4A 3SJJA 3Q23A 2OTLN 1S1XA 2OAUA 1YZ7A 1VJWA 5E7OB 4KTZA 4CHOA 4FJ7A 4IFYB 3DFEA 2G9OA 1VQ4S 2ZFHA 1Q8BA 2G8HA 5H9FK 2E1MC 1RDAA 1JQGA 2KVQE 3GDQA 3UN3A 1HQUB 2QLFB 2ZGZA 4PEOA 3MMCA 1UEUA 2AA4A 4ED1A 2DISA 3BKUA 1FKAF 3VF0B 3SIPB 4X62J 4O4RA 1ZPWX 1YTAA 1S97A 4JKDA 4L3QA 3T19A 4P2MA 3CNQP 5GAHP 3KHRA 2IMWP 4O3SA 4BR5A 1WF2A 1CLQA 2VBZA 1RWXB 2DGOA 2ZM6K 3C15B 4HL9A 3V9ZA 3CI5A 1T05B 2DGTA 2RVJA 1RTHA 1UVJA 2LA4A 3HJFA 3CJ2A 2KU7A 3VMFB 2LCWA 4FS1A 2YWEA 3IN5A 3MI7X 3VQTA 3FJ2A 3S7RA 4F26A 3PW2A 4Y2KA 4XAKA 5DM7Q 1VQLN 1NKCA 5J2PB 4IG3B 2VU5A 1RTIA 1CZAN 3SUPA 4DR1F 4E0DA 4DR5J 3SEOA 4ZCLA 1F0XA 1DLOA 4CTAB 2BKNA 2F4FA 3ZTQA 1WSIA 4K0KF 3NMUA 3IO1A 3K5NA 2W8KA 1TFYA 1IWGA 1GH8A 3EKSA 3DXMA 3W7BA 1FWPA 2X1FA 1KNZA 4JNEA 3CD5A 5BRHA 4O8KA 1HR0K 4ZVUB 3ATUA 4CGHA 3DLKB 3PIPQ 1UJ5A 3AY9A 2HZAA 1ZAXA 3MMBB 3NLCA 2DHSA 1T02A 3F56A 3I5CA 2CYYA 4B3MF 1YG0A 2CQ4A 5KFJA 1KLNA 2F8MA 2E66A 2UXCK 1ZETA 2O8EA 4RW9B 5T41A 3KLEB 1ZBIA 5CZ2A 2F96A 3KK7A 4DV0F 1S12A 1VI7A 4LFBF 3C6TB 2NR0A 1NXIA 2OMOA 4AQYK 1CLFA 2JEIA 4DV2J 1VK0A 3CD6N 3GCXP 4FJLA 4DTMA 3DOKA 1D8ZA 4CBXA 4F50A 1EHWA 5KG7A 2UVRA 1QUVA 2HQIA 3NRBA 4I64A 1KVKA 3RW6A 4FYXB 4LRAA 4UW2A 3CIZA 3VVTA 1YQHA 5F8LA 1WB9A 4W92B 4WCEL 3E66A 3O9SA 1URNA 4OHXA 2ZBCA 4LF6J 1UWBB 3NS5A 2WVBA 1F21A 5D15A 4ZKAA 5DGAA 4K8XA 1VQ4N 5BPNA 1L3SA 4DTJA 1U48A 4WQ5C 3T1YK 2OPRB 1Q7YT 4URSA 2ZQBA 5KFTA 4RW4A 1QSLA 5D3GB 1OIAA 3MUVP 4ECZA 2VICA 1LCUA 5IV3A 3TQEA 4AH9A 3EXCX 2VB6A 4KI6A 4JV0A 2NXJA 2CPHA 2DCLA 3GIIA 2NS1B 2WW8A 1J53A 4Y6IA 3J7YU 2ZBQA 4IO9Q 4A8SA 4JI8F 2R7XA 3OTBA 1EWQA 4DCHA 1S99A 1KWMA 4C0OC 4WFXA 1B7FA 3MFHA 1E3MA 3GP9A 3C8YA 3VQAA 2HQFA 2XSJA 1NDLA 2XNQA 2CQHA 2HYIB 3GG4A 4E1JA 3LWMA 4ZLLA 3TSQA 3DU6A 2I38A 2Z0GA 4CE9A 2FJVA 3VAHA 2XCAA 4FWPA 4IRKA 3DLEB 1CEZA 3UPFA 4JI1J 1RLDA 3TAMA 1XR7A 4RUCA 4DG1B 3ET6A 1M1KO 1R31A 3S3OA 4YY3F 1MWYA 3WQUA 1NJZA 3GIMA 3WNHA 3QGIA 1E6YA 1KD1O 4JS5A 1LW0A 4LF8F 3MN5A 2HQCA 5B0DA 4DSKA 2QW9A 1K9MT 2BVZA 2W7AA 3R5BA 3O3HA 2JWKA 4NRUA 5ADXH 1WC3A 1U6ZA 3FDSA 3OYIA 4K4TA 3C66A 4O8UA 2IAJB 2XZWA 2AKWB 3ZEUB 3P1GA 3M8RA 4HH0A 2B9XA 2PBDA 3V2UC 3D54A 3CCJN 3T1AA 4FK2A 3OVAA 2KXHA 4CP5A 1S6QA 3PG9A 5HRSA 1SC3B 3QMLA 1RT3B 4QOTA 2FPHX 1UJ4A 2BE9B 1VK8A 1K1SA 4N77A 5C12A 4CJUA 4URGA 4KHPK 3L0QA 4C8ZA 1HBOA 2GMHA 4BR0A 4CZFA 1UL3A 4WF9L 3EVOA 2PI5A 4J90A 3HSTB 4CLTA 1WKJA 2FUG9 1FNXH 4ZMMA 4DR7K 1TV6B 1EETB 2FF6A 3G4SS 3AODA 5E3RA 2FHKA 3EGNA 1DKGD 4FYYB 4RU9A 1T3OA 2CJBA 5AQLA 3JXOA 3M9MB 4Q0BB 3HP9A 1KFDA 3O9TA 1WHVA 1Z05A 3SJHA 4GKJK 1D3WA 2X1AA 2CG4A 1RKJA 2F8SA 4HT7A 2ZHAA 4CLKA 4OZ0A 3N6NA 3EPIA 1HNWF 3LTOA 3CFOA 1RT7A 1U04A 5MLCV 3J81j 4WFBL 2YKMB 4YFUA 2YNIB 3CXCM 4AE5A 4IH6A 2N82B 2UUCJ 5IV4A 4UOCA 1W25A 4JKGA 4WU3A 1JLGA 3M32A 1LAVA 3J7YI 4UF4A 5AQOA 4JLHA 5BR9A 3THWA 4PXBA 3CCQS 1LWCA 4X4UA 4P10A 5JJBA 4KO0A 5GIPA 4CD3A 3PTWA 4LD0A 3MTKA 5BN8A 4MYUA 5L1LA 3D0HE 2HK2A 5I42B 3THYA 3LGHA 2CDRB 3EO3A 5G4DA 3A8YA 2AEJA 2VOPA 3AA8A 3AD9C 5JLFA 2QK9A 3DLHA 4OPKA 2ZC4A 3K5MA 2GJFA 5AQWA 3KNAA 1RHKB 5AFUH 5J1PA 4PKHA 5KFUA 1MNEA 1TL5A 2ACYA 3C19A 2D1CA 5BYSA 2F9TA 1CJTA 3DNCA 1SH3A 4ECWA 3IWXA 1X5PA 5F8IA 1S9GA 1TMMA 1J2VA 3PKYA 3TAGA 4OPHA 1RHQB 3I8BA 3EPGA 4OZ2A 2V9KA 3OYLA 2QL7B 4M5IA 3MPVA 3KTQA 2P6SA 2PZSA 3TABA 3Q7BA 2LLZA 2MQOA 1OS5A 5HAOA 2RF2A 4HDHA 2EPIA 5G0RB 5E0OA 2P5OA 1Q7LB 2BBEA 1ZOTA 2HHTA 4EU0A 2Z1HA 1WEXA 4L6V3 4ZP9A 3JYTA 3CJRA 3TAEA 1JJ2M 1IWAA 1O5JA 2O8CA 1OH8A 1CJUB 1HHSA 2MJUA 1WSFA 3DM2B 4LVOP 2JHEA 2FVPA 1UAWA 1YK9A 1P27B 4RW8B 1VBKA 5E3AA 1S7IA 3FZHA 2QA4G 4C1NK 3G10A 3SNNA 2VV5A 1T0TV 3LWLA 3G4SN 3OXFA 1JLQA 4F4ZA 1FE4A 2DFEA 2FBXA 5HVHA 3EGWB 4YNQA 2QKKA 4F4WA 1H3DA 3E1YA 4C11A 5JUMA 3E9PA 5JVGQ 5GAEP 4JKBA 2EKYA 3GB0A 2IVPA 3TR8A 4HWIA 3TAPA 4LF1A 4EBDA 5HI7A 1I94J 3ZCMA 2Z2LA 4KFBA 2K7KA 2B7BB 4CJ3A 1IR2A 2DGQA 4DR5F 2EG1A 2RKIB 2F5GA 4K0KK 3SUOA 3DHWC 2QLBB 2VGNA 1OSCA 3T9NA 4HUGA 5LL6Z 2CXEA 3KLGA 3C7NB 2XTJP 2P9LB 3LM9A 2WAQD 4QS8A 3PHTA 1ZBUA 1SC6A 3R1LA 3CPEA 5IS2A 4NXNK 2JGUA 2DY4A 3WBZA 3AD8C 4ISGA 2OPPB 4ZOSA 1NHKL 4DV1J 1DRZA 3L2VA 4FJ9A 3AA9A 5IM0A 4FBUA 5AZIA 3CCQN 4CI6A 3NMAA 4J2DA 5A8KB 4KH0B 3W9HA 3VESA 4N8OA 4B3MK 4BRQA 2VG6B 5KFYA 2FY8A 2IRYA 2LXFA 3ZZPA 2GBZA 1B7YB 3CULA 2RHQB 2OELA 2KT5A 2FDNA 1FRXA 2OPQA 3EZOA 5H1SV 4DV6J 3RBDA 4B8AB 3KD1E 4DV0K 2GIRA 3R6LB 1GOAA 1VQ6S 4MO5A 4LFBK 2D0PA 1PAEX 4H0PA 3MX5A 2G8FA 4CLLA 3L4QA 3MR6A 1HNIB 2E9TA 4B1ZA 1VCTA 4JI7J 1XQIA 3SCXA 5KAKA 4FPRA 4RU2A 5IXUA 2VKZG 4DV2F 3RUBL 4DV5F 2V4RA 2KW4A 2V2KA 1VRQC 5HMXA 1LV5A 4JV5J 3G71S 2CJ9A 3UFCX 3B6PA 3ZX3A 1HNZJ 1U8SA 2O67A 1R6YA 2P9SA 2FJBB 3UKUA 2CQBA 1GXUA 2W01A 1WSEA 4CEBA 2HBJA 2HHVA 2NXEA 1LK5A 1BIZA 3IG1B 4HHJA 1CZ9A 3QRQA 2CQCA 2VHGA 1GOBA 1RBUA 3IRXB 4RW6B 2CUYA 2V69A 2G2YA 5I3QA 4NX9A 3OTOK 1H7XA 3O6WA 3HD2A 3ZZRA 2P9IA 4XPCA 3RAQA 3RR8A 1LXJA 3EX7B 1TK8A 1WDTA 2Z4PA 4LQ9A 2HWTA 3OYBA 2VWJA 2MZRA 1RFQA 5A8WA 3EMTA 4OGCA 1YGYA 3WT0A 2HBLA 2ZE2A 1HBUB 1ZH5A 4C2MA 3OBWA 3PYDA 1VGYA 1LWFB 3PUFA 4CWBA 5AQQA 4DFMA 3US5A 1HD1A 4WIIA 5KFMA 4TYAA 3W2WA 3GE1A 4PUOB 5BR8J 1YJ7A 3I31A 1SQGA 1S1TA 1AFJA 4F25A 2LEAA 4YY3K 2HWIA 3AV9A 4WJBA 3TVZA 4JI1F 4N41A 3AVLA 2FJDB 3M6XA 2VQEF 1GLLO 3MDQA 4LF8K 2KKZA 1O8BA 1IBMK 4Z4GA 3VEVA 4UTGA 1FRLA 4RBUA 3CIMA 1GFWB 5KFKA 4NZ6A 2YXLA 3HSCA 5CABA 1VBYA 3CCWA 3WUHA 4RBTA 3OS2A 2Z8QA 5I3PA 1ZPVA 2Q3SA 3G8TA 2MY7A 3LZIA 1IKWA 3SPYA 1FF2A 3DLGB 2X78A 2G8WA 4X4PA 4BLGA 3Q0AA 4GVMA 3TW0A 3P8BB 2V5HG 3PIOQ 2EWSA 4TY8B 3W2VA 4ZJOA 1R8AA 1X4AA 3ILJA 2GEMA 2FVSA 1VQOS 3WQPA 2XB2D 3SQOP 4TLRA 1WHXA 2B6AB 5AQZA 3LP2A 4FLZA 4NLWA 3VA0A 1C6VA 5M1PA 4PYAA 2I8EA 4OX7A 1VQ6N 4CJKA 3CJAA 3ADAC 3ZZUA 3ZT2A 3QERA 5KFNA 4FVMA 1Q4RA 4B9SA 1TTHB 1UTAA 2L9DA 1BQXA 1VMBA 2XY8A 4DF4A 4OYXA 2CWXA 4UUWA 4QZVB 2M52A 2ADCA 4X4RA 3FKBA 1P90A 4WKRA 3G71N 3MEDA 3V6DA 1X4DA 3CC2S 3V6HA 5ADXA 4ZVRB 4WFAL 3FLCO 3QIDA 3BF3A 4XEIA 4C0BA 1S5ZA 1F5AA 1L3KA 2O8FA 4JYAJ 4KBIA 1N32J 4F4XA 4IQMA 2MJNA 3QEIA 1ITGA 4YOUA 3MEGA 3C16A 4P2XA 1NJIT 3D0IE 4OYAA 3NF6A 3AVGA 2QWMA 1YAGA 5LSRA 1Q53A 2RB7A 2UUCF 3NBPB 1Z2LA 4NPOA 1D0EA 2GA7A 3KKFA 2GV1A 4D3GA 3C6UB 5F1XA 4M63A 3VAFA 2HIYA 5IWAJ 1GQEA 5MLCQ 4DV3K 1DT9A 3OLAA 3VAMA 5ELZA 2XMVA 4C23A 4A2BA 3CDAA 3HFKA 2XLIA 4PQUA 5C42B 4OHWA 3UDLA 3QFWA 4OI4A 2AYGA 4B9LA 2ZOMA 5AQMA 1BA0A 1XMQF 4KHWA 5GMDA 2VODA 1S4EA 2E7WA 3NGIA 2Z57B 4HTJA 5M2RA 3ZX2A 1Y7PA 4NYZA 3DYAA 1V3SA 2IBOA 3WHIA 1N5QA 2ZBPA 3Q2SC 2UYTA 2ZNYA 4XTTA 1HPMA 1RWNB 2ZWPA 4BBYA 3NWGA 4OHVA 4FLUA 4FWOA 4CZGA 2RJZA 1S1XB 4WQ4A 5KT5A 2XGPA 4WP8A 1ZAVA 3HVTA 2ACMA 3NAIA 4KH6A 4G1QA 3WXLA 3ASMA 3ILLA 3OYFA 4ED7A 4AYBD 3W9JA 1HBNB 2Q0UA 2E6MA 2XYGB 1SL2A 4U67L 3DI6B 2P6TA 2HK3A 4CJ4A 4OKEA 1HYVA 1HBMB 4H0YB 1J27A 3C3LA 1FX2A 4JKHA 3BEGB 3DXKB 3V81A 1HLUA 3ILIA 4BS2A 4WU2A 5A6PA 2FJAB 3CPWM 1OQ3A 2K3KA 3MZIA 5FDLA 3ZZOA 4GO7X 4W4MA 4F67A 2NQPA 3VQBA 5DDQC 4JI3J 2B9YA 4UY8O 2OEJA 5GVQA 5FROA 3TX8A 1VQON 3TAFA 4X62K 3WX4A 3X1LB 3CM5A 3T3FA 4I7FA 4FVUA 1VHIA 2JC1A 1YZ6A 3ENVA 2XI2A 4K5SA 3ETOA 3BGRA 5L8RC 1TYQB 3W5ZA 3LANA 2YV0X 5HVGA 1HNXJ 5AJ3J 4LSLB 4JI5J 4ZPWR 1LKZA 3QFPA 2YWHA 4DLGA 3LAMA 4ICLB 5HRNA 3CCTA 1K1QA 1U1LA 1IKVA 1GNKA 4E1MA 3FBFA 2V8GA 3M3ZA 3P4IA 2W8LA 2W4CA 1BDGA 1IR1A 2WBNA 1TL3A 3KG0A 2R7YA 3FEYB 3CC2N 1PIEA 2XMTA 3CB4A 1X9MA 4QU7A 3OTDA 4HTLA 4K42A 4X64F 5GAEU 4XH5A 1W2BR 2W2MP 3DAWA 4DR5K 3BQ1A 4EP4A 1I94F 4A62A 4QYRA 5E2QA 3HMJG 4YOEA 2ZH9A 4BG8A 2A10A 4FP9A 5KFPA 1RAGB 1L3TA 4MTPA 3IA0A 2HOEA 3AVMA 2ZJQL 3MWBA 1NGAA 4KHMA 2U1AA 2W1BA 5KFGA 2V52B 5B0FA 3N6MA 3ALYA 4HDGA 2UUTA 1RTDA 4DR6J 4CH1A 3AVJA 3HHEA 4KGXB 4LJMA 1FA0A 4DV1F 3TZYA 1WF0A 4EBCA 2WVFA 1KLMA 2YQ3A 1Z25A 5F2RA 2M2BA 3HHNB 3K7RA 4MO4A 1RBOB 1Q5VA 2BOAA 3JTOA 3CFRA 1NAQA 1SVDA 4DPUA 2QG9B 1ZM3A 1JWWA 1SBRA 2GMLA 1RLCL 3MAAB 4DV6F 1LW2B 4DR2J 2R2RA 5IC6B 4HI2A 3KD5E 4FXDA 4J9VA 3LPYA 2HHQA 3W64A 3WXKA 4DV2K 3H4BA 5H1SQ 2PO4A 3TUPA 4ECUA 1S6PB 3MD1A 2XLJA 1DQ8A 2P1JA 4ZVFA 1AXQA 2GAGC 2FVCA 5EU7A 2RE2A 4A4JA 4OHYA 1YIJS 4JV5F 1S6OA 1F60B 1QLNA 3MM6B 1HNZF 3GG0A 3CJ8A 4Z7YA 1Y97A 4LVNP 4M63C 1WHYA 5LMUJ 2VJVA 4A8YA 5KFRA 4DPOA 3NMRA 3F9MA 2D0CA 1IKYA 2ZD1A 1C2PA 3ZSVA 4LF6K 2H48B 1S77D 2JEFA 3THXA 2J0WA 1WNEA 5I3UA 3IDHA 3MM9B 4MDAA 4CM0A 3KJNB 4BC9A 2ZH8A 3SYZA 3PYFA 4YB6A 2CJXB 5A2QU 2QMXA 5LJVA 3D6TB 2DXFA 4BC7A 3BR8A 1XHXA 5KFDA 4RNMA 2AGQA 3CVKA 1RI7A 2AP6A 2MY8A 2FSJA 1MWQA 3ZXWA 2P9KB 1PKUA 2H5IB 1YBAA 4CFDA 4MK7A 3UO0A 2GWJA 2NRXA 3R5GA 4TXSA 2VD3A 2Q6CA 4I69A 1FEHA 4B1WB 3H1QA 1EKEA 2DPIA 3EL2A 5DQGA 2C2RA 1V4TA 1K0VA 2GUPA 2E5GA 2U2FA 3I87A 3R5AA 3VF6A 1U6FA 4Q2MA 3DKDA 3SAHA 1XNQJ 4D3HA 2YNGB 4NRTA 3Q8SB 2R42A 2I2YA 2BR0A 4FNHA 3NGKA 4OO1J 3OBYA 5GAEI 4JI1K 5BR8F 3SDEB 1SS6A 4U6PA 4BDPA 1CS4A 1V6HA 5K8MA 4DSEA 3CQ8A 5KFAA 3CDWA 4Q45A 1SJRA 3QJPA 2E88A 2L48A 1OWXA 4L8RB 3AO5A 4M7XA 4C8YA 3SQ2A 3CJKB 2G1HA 4OLOA 2X51A 1R43A 2H51B 3CETA 2BRKA 2RD5C 4B3SJ 1PG5B 5KT4A 4PKGA 2QFIA 3M1VB 2O01C 4ZP6A 4Z4FA 2E7VA 5CY4A 2F7VA 2ZF5O 3O4NA 4CF8A 1RTZA 4NZ0A 2RQ4A 1TAQA 4BC5A 2W2NP 4BR2A 1C1CB 3BR9A 4HTIA 4YOXA 1HBOB 2EFPA 1FFWB 3TVYA 3MMAA 1VC0A 4QW8A 3DLBA 2JFDA 1S4FA 2CVEA 1T9XA 3BYRA 1YBUA 3PRDA 2BUPA 2XGQA 3FZKA 1BI4A 4NLYA 1F1BB 2HBKA 5FPMA 3QO9A 3PNIA 2V2QA 5IZHA 5K8OA 4IDKB 1N8RO 3Q8YA 1GLFO 4F3TA 3SQGA 1NK7A 1N5TA 1T6CA 4DPYA 3AGRA 2QX0A 5EY4A 5KFQA 4A2AA 3SMSA 3CWJA 1QQNA 1YIJN 1NGCA 2FIUA 2V6AA 4RNFA 2WW4A 4JKGB 2QYGA 1H2VZ 4IFVB 1JLGB 3M32B 5J2MA 2XC9A 1CSJA 4M3TA 4CECA 2NUUG 1RAEB 4FJXA 5AQVA 3SFGA 3TA1A 2LFVA 1N32F 1LWCB 2DHHA 2VWBA 4OV6A 3FQLA 2LEBA 3LP1B 2UUCK 5J2QA 2QZ8A 5U47A 1OPZA 1P6TA 4MJKA 3THYB 4RWTA 3BBFA 3TA2A 4GO5X 2ZDPA 4O3OA 5IWAF 3KLHA 1K8KB 2V9WA 4UOGA 4NB4A 4NEZA 3GU0A 3C0BA 3U4LA 4E7KA 3EE3A 2A2DA 1ZA2B 3T9ZA 2D3UA 1D9AA 1XEZA 5IT0A 3OYCA 2B9WA 2RRBA 1EX8A 3OVNA 4WP9A 4DCJB 2GELA 2R7SA 2BDPA 2DRAA 1UETA 3MR3A 3IGNA 2NSCA 5DZ6A 4Y28C 4AHUA 3PEHA 1FJGF 3PW0A 1RYSA 1VSHA 4GV6A 7FDRA 2KYZA 4USWA 2KM8B 1RYRA 4NE9C 4XO0A 3CM6A 2VZ9A 5GMKa 3LUYA 1SH0A 2PA8D 1VQ5S 4YHHJ 3GSIA 4P71A 1MMDA 3BDPA 2JSXA 3SCKE 4O44A 4FF1A 4N7TA 1YX2A 2RF2B 1M1GA 2QTWA 5T7LA 4EMDA 4J91A 3R8YA 2WTUA 4I2QB 2O3DA 4TYBA 4USIA 4PWUA 2CAJA 4MQ3A 4GRSA 3OYAA 3TP2A 2FLOA 1LWEA 1GX6A 5HO4A 1IN0A 3KUEA 1RABB 3ZZZA 1AYEA 2C22A 4NLPA 5BPMA 4PHTX 3V6KA 2OD6A 2UP1A 2HRTA 3T41A 3UVJB 1XWLA 3L2UA 3WXMB 1QZ5A 1IVZA 1TL7B 4IG0B 4DEZA 1HHTP 4JI3F 1UOCA 1SV5B 1OMSA 4KKOA 3OTCA 3QFUA 2XMAA 5F8GA 4CM2A 1IBCB 3RMBA 3FZBA 3B6OA 2ZBRA 5A6WA 3QZ7A 2JFKA 1U8WA 2YBVA 1CC8A 1H38A 1XJWB 3DC2A 3VN5A 1K6YA 5AXKA 1RCXB 1HNXF 5AJ3F 4RWWA 3KYLA 4JI5F 3PM9A 4DL7A 4YS2A 5F8HA 3V1QA 5IC4B 1ICEB 4B9NA 1DAXA 3CD0A 5L1JA 1H73A 2Z30B 2QWQA 2Z56B 4ER8A 2EW9A 3ULDA 3IM9A 3K2YA 1OH5A 1I94K 5D0RA 3Q2TC 5AQNA 2YH0A 5IM0B 2NRRA 4NLSA 3LGNA 1CJKB 3RBZA 5AZIB 5HQ8A 2W9CA 1CQNA 4OLPA 4OZJA 1B92A 3HVRA 3V6JA 3HDSA 1FKPA 2FB0A 3RBEA 1HI1A 8RUCA 2A0FB 1QQMA 3JAMO 1VBZA 4DV1K 4AM7A 4DR6F 2ASMA 3TRGA 2GHPA 2IC3B 1U25A 2QV6A 5CYMB 1K0TA 3RSEB 1NSKL 2IVOA 1N0UA 2IM3A 5E3CA 4TSXA 4U7CA 1SJFA 4M3ZA 4EYIB 3TTFA 2PYLA 3I9V9 1XMOF 4DV6K 2MMYA 2HVIA 2Q43A 3KHYA 2GC8A 5F3TA 2P9SB 3UKUB 2OIHA 1MMLA 2HNDA 3PZPA 2HMPA 1HW9A 3OR1A 1FTCA 4DR2F 1QZ6A 4JI7K 2R7WA 4GVEA 2E1RA 3O8WA 2OLWA 4PR6A 3MXIA 1VQ5N 3P83D 4OQJA 1V5VA 1RK8A 3NCRA 1JLAB 4KGKA 1NMEB 4JV5K 5T7BA 1HNZK 1JKHA 3MOZA 3U9ZA 4HYKA 4CGDA 4PL8A 4DV7J 4USUA 1JLEB 2R7TA 3FVYA 3TPQA 3OVBA 4MFBA 1G4CA 3H45C 5KI6A 3VF4A 3TSPA 1R8HA 2P9IB 4FW1A 2WB1D 5LMUF 2YNHA 3FR0A 4NI2B 2W4PA 3P5BP 3HO1A 1K47A 1Q82T 2CH6A 3GYXB 2DR5A 4Q8FA 4K4UA 4ZVQB 5A8WB 4WXWA 4OLAA 5D0GA 4DHYA 1A9NB 5KRSA 2COLA 1WJ9A 3HSZA 4BRAA 3HOTA 4MIBA 2E2QA 4FOEA 1N52B 2XYPB 4EZ6A 4QR1A 4L72B 4IJNA 5FLXO 3IAS9 4W90B 5DDOC 4DU1A 1IKXA 1DTTA 2VOOA 4CT8A 1RT1B 2E1YA 5M1FA 1Z1ZA 3FUYA 4R0EA 5L9XA 4CIEA 4PRFA 1RWOB 2C3PA 3RB0A 3VGTA 3MOJB 1QQOA 3CJ7A 4FLVA 3HULA 4KBOA 3E01A 2NLXA 1TKXB 1XNQF 4ID8A 5ADZA 4CFBA 3I96A 5BR8K 2RHSB 1EO1A 3LM2A 4PG7A 5HL7L 2QA1A 1DQAA 4O0NA 3I4HX 3NOCA 3H2VE 1IKWB 3UW1A 5C0YA 1S9FA 1SIWB 3MGJA 3TA0A 1SL1A 2YHBA 4CD1A 3A3PB 1ZZNA 3W60A 3EY1A 2ZZTA 4B3SF 5LM7E 2K1RA 3QESA 4KH1B 1TMJA 4LREA 2YY3A 3GTYX 3FK4A 3LQVA 1FXXA 2X74A 4DL0C 1IG9A 3LP2B 1RT5A 3Q8VA 3F73A 4L74A 4KGVB 1UCNA 4A47A 1HLWA 4IH5A 1ZBSA 1TK5A 2AT1B 4FXVA 1NZ8A 3ZZTA 2Q2RA 4J9MA 2GQQA 5JS2A 2OMLA 3NGYA 1TL1B 1VSEA 2FLLA 3O1BA 3VHQA 4NZ7A 2A42A 3ZSWA 4XH4A 1GT8A 3L7PA 3M2RA 2QLJB 4QS9A 2BKPA 2OTJS 1KAXA 3AVNA 1HKCA 4ES1A 2AJ2A 3CMQA 1QE1A 3M2UA 2HSEB 3WX8A 3L09A 3WNGA 1TKZA 1ZC6A 3OSNA 4CGGA 2O8FB 4OX9J 2H3GX 2E1CA 2E9ZA 2J8SA 1WOPA 5KGWA 3VEWA 3PW4A 5ETMA 2MQPA 4NWBA 1YJTA 3T7ZA 4CHNA 2O66A 3Q7CA 2PIIA 2H9ZA 2FZGB 4G9ZA 3R5JB 2XS5A 4HHTA 4RPFA 5HQLA 4JYAK 3B82A 1N32K 4AL6A 4L76A 2JWNA 1RXOB 4FS2A 1H1VA 3CCES 4L73A 3AGKA 4O4GA 1WLJA 1BWFO 1VSJA 4EO8A 2GO9A 3UDVA 3QLHB 4YOTA 1T03B 4A59A 3VQ9A 2FLNA 1RDWX 4F36A 1F3VA 2PE8A 1H2UX 1QSYA 3ETMA 4G3IA 5IWAK 1JLBA 3B54A 4PKDB 2DH7A 1HRHA 1NHVA 2DFHA 1I39A 5C25B 2ASOA 1BHLA 4OI0A 1LXNA 2KJWA 4ZVEA 3BGOP 4BRKA 4QIWD 1S1VA 4FZVA 3MM8A 4BG9A 2BE2A 2PGCA 2G8IA 1JXVA 2ZOFA 4HEA9 3I55S 1KQSM 3GJRB 3HVTB 4WKYA 4G1QB 4OYWA 1GLJO 3OHRA 2ROEA 2OHDA 4PPZA 1RAJA 2E1AA 2PDAA 3N5FA 3SQ4A 3T69A 2OSRA 4XH1A 5CCMA 3HK2A 3MCMA 1U1MA 4QU6A 3V5RA 5KFEA 3V81B 3O80A 3OW2R 3AOAA 4KQZA 4M1KA 3AA3A 1MWZA 4YHHF 3J80Y 2XULA 4WE1B 1N5SA 1Y11A 2AWZA 1HX1A 3HKWA 2J7UA 5KFSA 2HHPA 3HI0A 3H5XA 1Y3KA 1VC6A 4ZCKA 2BANA 3DLRA 4WTYA 1U2VA 4OGEA 2ZH3A 2GQ2A 1RAOA 5C5JA 1GTEA 5LSOA 4LF4J 3ZZYA 3E9OA 2WFBA 3OR2A 4ZPDA 4O3RA 3CJ0A 4CJFA 1Q0NA 3VQCA 4I7FB 2Q1LA 1HYSA 2LU2A 2M8HA 3B8AX 4J2AA 3BGRB 2DNPA 1YVUA 1WDDA 3G6XA 2BW7A 3DLJA 2K06A 4JI3K 4LF9J 2NXCA 4ECRA 4HACA 2OPSA 2F1FA 2APOA 2R3VA 1X3NA 3VETA 1CVJA 4PG8A 4CI0B 2VUGA 4DN9A 1EIYB 2M88A 2XNRA 3WNEA 2UXBJ 4ZN3A 5SZTA 3OSPA 3KMQA 1TL3B 2OTJN 3SV3A 4JI2F 4C97A 4ED3A 1HNXK 2N7CA 4DSFA 5AJ3K 4JI5K 5CE3A 3WEEA 1LNQA 4C8NA 3D1QA 4TN2A 4Q44A 3M8QB 1HI0P 2Z2ZA 2AQ4A 2DPJA 4O3PA 1C0TA 2YKNB 4C98A 3LP0B 4K4SA 1F9EB 3IWLA 3CG7A 4L3NA 1UZHA 1NJWA 5K14A 2OFHX 2RQCA 6FDRA 5L46A 4ZPCA 1DTQA 2UVVA 1UW9A 4IKAA 2Q0RA 1RWMB 3I56S 2ZEJA