3BGRA

Crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with tmc278 (rilpivirine), a non-nucleoside rt inhibitor
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, hydrolase
molecule keywords Reverse transcriptase/ribonuclease H
publication title High-resolution structures of HIV-1 reverse transcriptase/TMC278 complexes: Strategic flexibility explains potency against resistance mutations.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 158
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3bgrA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bgrA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bgrA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bgrA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3bgrA05
3CFRA 4N47A 2AX0A 2ASLA 2UUWA 1KHWA 2B5JA 3U3GA 4E3SA 3V6DB 1I6JA 4AHTA 4M42A 1B9DA 4H8KA 4XO0A 2HNDA 3VQSA 3LP0B 1L3UA 3K5OA 3AO2A 2NUBA 4CF2A 5J2NA 3GIMA 4OJRA 4DL4A 4HCBA 2KFZA 3QZ7A 4MH8A 4EO8A 4HUEA 1TKTA 4Y3CA 5KFYA 5L9XA 3VQ7A 1K1SA 4DL2A 5JS2A 3ZT0A 2O5DA 1C0TA 4ED1A 4H4OB 2WRMA 3MECA 3TAGA 1S1TA 1D9DA 4W5QA 2IAJA 2ZE2B 3AA2A 1HQUA 1T3NA 3E01B 4K8XA 1JLEA 2UUTA 3BQ0A 1D9FA 4Y1DA 2KZMA 1VSMA 3C95A 4J9MA 5KFGA 4Q0BA 3KHHA 1LWCB 1S1UB 3HVAA 4NLGA 4RNMA 1IKVA 3V9XA 3HO1A 2FJVA 2XRIA 1KVBA 3DLRA 1YTAA 2ASJA 3DDKA 4DS5A 2OPQB 2QE5A 2EC0A 1VSIA 1L3SA 4ECVA 3OYDA 1CXUA 4FYDA 4CJRA 4Q8EA 3KK1A 3K5LA 3PR4A 4CIGA 3KIOA 5J2QA 3NFAA 1RT4B 1C1CA 5KFWA 5D3GB 1KVCA 4ELUA 4CJLA 1JLBB 2FVQA 3ZSWA 3KLIB 1S6QA 1R0AA 3LZJA 3BDPA 1NK6A 3V6DA 3G6VA 1C1BB 3ZSZA 4BDZA 4W5NA 2FVRA 2RN2A 3VQ8A 3G10A 3LP0A 4E1NA 3LPTA 2FLLA 3OHBA 5EU7A 3N6LA 2IMWP 1QQCA 4JV1A 3ALYA 4DFJA 1NHVA 1S0MA 4EBCA 3SUQA 4KAIA 4ED7A 4RNOA 2D0AA 4ZHRA 3I0RA 1RBVA 2FJWA 5HRNA 3SQ2A 4ZP9A 3V6KA 1NKCA 1N56A 2W9AA 3RMCA 2QK9A 4RUCA 1LV5A 4ECWA 1S9EA 3VN5A 4H4OA 3BR9A 3RRGA 3OL6A 1B9FA 3OYMA 4FS2A 1VSKA 4DS4A 1LW2A 4BDPA 4R8UA 3OYHA 4CIEA 5I3UA 3S9HA 3OS2A 1S1UA 1JLAB 4RU9A 3MF5A 1NJYA 4QPXA 3QGHA 3MR6A 2OPRA 4FS1A 4Z4HA 2HNZA 1BI4A 4G1QA 3P1GA 1X9MA 1CSJA 3NAEA 3QLHB 2OPQA 4KHSA 1UA1A 3KLHA 4J9KA 3ZSYA 3CFPA 5C5JA 1BIUA 2WHOA 4DTUA 2OYQA 4KAZA 1WSEA 4CJ3A 2ZKUA 3OLAA 4B9VA 4EBDA 4QWDA 1J5OA 3RB6A 4CERA 1RYSA 2XY7A 3D28A 1JLBA 4E1MA 4WYWA 4LH4A 1HNIA 4WFZA 4CJFA 1TKXA 3HSTB 5EWGA 4ECZA 2J6SA 2IDOA 3AA3A 4HVJA 4K8ZA 2A1RA 2WTFA 1HYZA 1A5XA 3K57A 3IRXB 2IOCA 4AHVA 5KT5A 2I5JB 2FBTA 1IKWB 4YFUA 5DG9A 2W9CB 1L3VA 2O4GA 2HHUA 3NCIA 5HROA 4ZP7A 4DSJA 5KFVA 1NK5A 2Z1HA 1KVAA 3JYTA 4IBNA 1ITGA 3SYZA 3ASMA 3DLBA 3OYBA 2HMIA 3M9MB 1YVUA 2X6SA 3EYZA 4GVMA 2ITGA 3LP1B 5CZ2A 1FKPB 1RCHA 4CEQA 1SKRA 4YR0A 1ZBHA 1FKOB 1T03B 4M3UA 3ISND 2R7YA 3SJJA 4B3OB 3QYYA 1HYVA 2XY6A 3TABA 5EUHA 1QE1B 4OPJA 3KLEB 1S1WB 3QINA 3PW0A 3FFIB 4KHRA 4E7IA 1I3AA 2KTQA 4ECUA 3VQPA 3JSMA 5HP1B 3BQ1A 1REVA 1XI1A 4E19A 1BGXT 3T1AA 4ZMMA 4CGJA 3NH0A 4J2AA 1SUQB 3M8SA 3OYJA 4DF4A 1RT5B 4KREA 3HHKA 3VQ4A 1HMVA 5KFKA 4RW6A 5DLFA 5I42A 4CJKA 3M9NB 1GX5A 1WSJA 4QWCA 3GV8B 4WXOA 4I9QA 3OJSA 3KD1E 1J54A 3OY9A 1TV6B 4O3OA 2PYLA 2VG5B 3DLGA 3IRXA 1ZETA 4NCGB 3HK2A 1YTUA 3AVLA 3I5AA 4DSLA 3PX6A 5DK5A 3FDSA 3H40A 4FLXA 2XI2A 4QW8A 3IS9A 4HYKA 4M3TA 1BL3A 3H98A 4KHMA 4OPKA 3AVBA 1U09A 3GQCA 1VRUA 1S48A 1L5UA 3EPGA 2JEGA 4KHWA 2G8IA 4GC6A 3RB0A 1FKPA 3GV5B 5KFOA 2R8IA 4N5SA 2R2SA 3OHAA 4IG0A 1FKOA 3OSNA 3DRRA 3AO3A 4GW6A 3SCXA 4MQ3A 4LSLB 5SZTA 3O3HA 4Y2AA 5K14B 3TAMA 3HL8A 4B3OA 2ILYA 5KG3A 4CESA 3AO4A 4NLUA 3HP9A 3OL7A 4CFCA 3KLEA 1S1VB 1S1WA 2R2TA 1MU2B 4DG1B 1HPZA 4W5OA 4B9UA 2HHSA 3HPGA 2ASDA 2GIQA 2FVCA 5CYMB 1ZBUA 2D0CA 4CEFA 4NLDA 3RR7A 5C24A 4FLZA 1DTQB 2OA8A 3U3YA 4CEDA 4F2RA 1SUQA 3TARA 4AHRA 4CEOA 1N4LA 1RT3A 3DYAB 4AHCA 3MEDB 4Y34A 4EEYA 1TK5A 4MK8A 1YT3A 3DMJA 4OLBA 3LZIA 3LANA 3SUNA 1YVFA 2IC3A 3SFGA 2J6TA 3L2VA 3DRPB 4O5BA 5CYQA 4DEZA 1QSLA 4FXDA 3CM6A 4KB7A 1JXLA 4CF0A 2ZQBA 1VSDA 2VG5A 2Y1IA 4QWEA 3U6FA 5F8HA 4QOZB 2XC9A 4WE1B 4DLEA 2GBZA 5SWMA 1RT7B 4DTXA 4ZVEA 5C42B 2W8LA 3GIIA 4ED6A 1C0UB 2B4JA 1JLGB 2W9BB 3PJWA 4HCCA 3ZT2A 2B6AB 1JLQA 5KFUA 2VG6B 1GOCA 4TYBA 3AVKA 3AVJA 1K1QA 4CF9A 3BSOA 4O0JA 2F96A 2BGGA 4ELTA 3B6OA 4DSKA 3V4IA 3TAQA 4EBEA 4FLYA 4N56A 4DTPA 4K50A 4IG3A 5KFEA 3V9SA 4B8CA 3L2QA 2XGQA 4DTRA 2B5JB 1HNVA 5F8MA 2JGUA 3MXMA 1WNEA 5KGXA 4KSEB 2HNDB 4DU4A 2IM3A 2YNHB 3H5UA 3H4DA 1ZTWA 2Z1IA 2UVUA 1S1VA 2IBKA 1TKTB 4DG1A 5E41A 5F8GA 1SL2A 3QIOA 4CJWA 3TAPA 3KLFA 5CYMA 3AA4A 3VQCA 4AHUA 4K4SA 2DFFA 4J9OA 2C2RA 2E6MA 3K58A 3RMDA 4J9PA 5KFAA 4GC7A 2IA6A 1C0TB 3G86A 1IG9A 3MECB 4DL5A 2IAJB 3DYAA 4ED3A 3MEDA 1D0EA 1HQUB 5DMRA 3ZSOA 3P5JA 3OYGA 1JLEB 3RB4A 4OVLA 1FXXA 3V81A 5L1IA 3QO9A 3DRSA 3TVKA 4H4MA 4LQ3A 2YNGA 1BQMA 4Q0BB 2FLPA 2XHBA 2IJFA 3SQ1A 1IKVB 1KLNA 3Q8QB 1ZYQA 3P83D 4TN2A 4CJTA 1ZBLA 1RT7A 2P51A 1U4BA 4EZ9A 1TL1A 4HHTA 4M3WA 1NHUA 3BQ2A 5EWFA 4I7FA 1UAXA 4IDKA 4E7LA 4RW9B 4CFBA 4RUAA 3KK1B 4FJ5A 5KG6A 3TANA 5J2QB 5DLGA 2JEIA 2P1JA 2D3ZA 4QWBA 4Q5VA 1RAJA 3KLGB 1C1CB 2ILZA 2AX1A 2V9WA 1SH2A 3KKRA 1TVRB 1S6QB 3CVKA 1EP4A 4QAGA 1R0AB 3MXJA 1LAVA 2JLEA 4Z0UA 2ETJA 1XHZA 2YNHA 3QZ8A 5KFXA 2HB5A 1KHVA 3PW5A 3RB3A 4URQU 3RMBA 2FVPA 4NYNA 2X78A 1WAJA 4ZHRB 2HVIA 2DY4A 3I0RB 4CJ5A 4OKEA 4C8OA 4JRQA 3QEXA 3AO1A 4FZZA 3VA0A 3IN5A 5L1LA 4B8AB 1S9EB 3EPIA 4TYAA 3BREA 4IH7A 2EX3A 1BCMA 3ZT1A 1S0NA 1VK0A 2FBYA 4AHSA 3CJ2A 3WNGA 4XIUA 1LW2B 4R8UB 4JV2A 3PO4A 3IGVA 2UVRA 5I3UB 1QAJA 4DQIA 2V4QA 1G15A 3BJYA 4YQWA 1Y97A 5J2PA 4CF8A 2OPRB 4DU3A 2DFEA 4RW7A 5DQGA 2HNZB 1TKZA 4PWDA 1BI4B 4G1QB 3AVFA 4FJLA 4BWMA 2RPIA 1DLOA 1KCFA 4B9LA 3NBPA 3KLHB 5KG1A 2R8GA 4RW9A 3HT3A 4QW9A 3QETA 4DQQA 1VSFA 3PY8A 1S6PA 3KLGA 1J5OB 4DL3A 1CZBA 3H2LA 2R2RA 3V1RA 3LDSA 4O44A 1UA0A 3CDWA 1HNIB 3CJ5A 1TVRA 2WCXA 4C8MA 1TKXB 1B92A 5T14A 2HW3A 4C8LA 1RBSA 2Y1JA 1RDCA 4KO0A 1WSIA 5KFFA 2VA3A 4K4TA 4NLVA 2YKMA 3M8PB 1NKBA 4MKAA 4LQ9A 3DOLA 1RBRA 3G0ZA 3DLEA 5KFQA 5HROB 4MFBB 1ASVA 3JYTB 4CEZA 2HMIB 3V1QA 2V4RA 1S4FA 1BISA 4ICLA 4Z4GA 2OH2A 4CGFA 1RT6B 2QKKA 2FVSA 2OPSA 3VQ9A 4E7JA 4ZTFA 3FRZA 4QCLA 3NH2A 2KQ2A 4CEEA 1Z25A 3QGIA 4DFPA 4NYZA 3FQLA 3UR0A 4CFAA 3TWHA 3AVHA 4O3SA 3UQSA 2HNYA 4URSA 5KT6A 4EYHB 2YHBA 3DLKA 1C0MA 2QV6A 4KTQA 3SV4A 2O4IA 3OYIA 1SKSA 4IR1A 1SL0A 2IM0A 4ZVGA 3CDEA 2AU0A 4MKBA 1JL1A 5F8LA 3OSPA 1HJRA 1ZBFA 3GV7B 4I2QB 3JSMB 4CEBA 5HRSA 3PX4A 1REVB 4X2BA 3H5XA 4ZP8A 5FRNA 3S3OA 2AGQA 4E7KA 4Z4FA 3NF8A 1RBTA 5KI6A 1RTIB 4DTJA 3V9WA 5F8IA 2R8HA 3C6TA 1HMVB 4RW6B 4KFBB 5I42B 3PV8A 3PO5A 1ASWA 2E9ZA 3OYNA 2G8KA 3O3FA 4PUOB 3WNFA 4FJJA 3DLGB 4RZRA 1T05B 3M8PA 1C6VA 3DOKA 2D41A 3MAQA 3MEEA 1HYSB 4ZPAA 4ZTJA 2IS3A 3VQ6A 4ELVA 3IGNA 4IRDA 3BSCA 4MFBA 4OL8A 3MR2A 4BACA 4KHYA 3CDUA 3IS9B 2LSNA 3LPUA 3TQ1A 4FBTA 3OYCA 3RAQA 2BQ3A 3BGRA 1VRUB 1JKHA 4EYIB 1RT6A 1S1XA 4CEAA 4NRTA 4FJ7A 4DQRA 4IFYA 5F9LA 3V9UA 3QESA 4IG0B 3DRRB 4FZXC 4O3NA 4BDYA 3QIPA 4IFVA 1ZTTA 3I0SA 2DPIA 1KTQA 3RRHA 3TAMB 1XC9A 1L3TA 5KTQA 2PZSA 2FJXA 1T94A 5KG7A 2YHAA 3EY1A 4TY8A 4Z4CA 4WYLA 1JXBA 1BIZA 2YV0X 2R2UA 1HPZB 3NH1A 1KSPA 4Z4EA 4LSNA 4CGDA 3NF6A 4I2QA 4KHNA 2CKWA 4K4XA 3N6NA 5C24B 2C28A 3LP2A 3D5MA 1BHLA 4CK3A 3M9OB 1RT3B 1RTIA 1W9HA 3TR8A 5L1JA 2G8FA 3DMJB 1VRTB 5KFLA 3Q8PB 1HQEB 2IC3B 3WNHA 4KFBA 4O4GB 4KI4A 4ECXA 2HHXA 3NAIA 5CYQB 4OGCA 4CECA 2G8HA 3IG1A 1J53A 3LWMA 3ULDA 4PUOA 2F8SA 5EWEA 1T05A 4N76A 1GX6A 5HBMA 4KPYA 1HYSA 4Q44A 4FJ8A 2PY5A 1JLQB 3VA3A 4M41A 4F3OA 4CGHA 1KLMA 2OZSA 3HVRA 4OKKA 2DPJA 3QNNA 3V4IB 2BANA 1S9GA 4FM1A 3SI8A 4CJVA 4NLOA 1TP7A 4IG3B 2AWZA 2GC8A 3DM2A 2P5OA 2IGIA 4DQPA 1HNVB 5FRMA 3LALA 5KG4A 2EHGA 1UWBA 4FJIA 1N6QA 1GOAA 4DSIA 4G3IA 4I2PA 4RW4A 1QHTA 4EZ6A 4NLXA 4MK7A 4J9RA 1Q9YA 2YNIB 3OYLA 2OPPA 4AILC 4CJSA 2KW4A 3KLFB 1U47A 1RA7A 1QSSA 1JLCA 2XY8A 3Q8RB 3CM5A 3HVTA 4Q43A 5JXSA 1IM4A 1W25A 1F21A 1HRHA 5DGBA 5DG7A 3KMQA 3CYMA 4ECRA 2QKBA 2JC1A 4JS5A 1SL1A 1VRTA 1HQEA 4KV8A 5C25B 4FLWA 3O4NA 3V81B 4O4GA 2J6UA 3QO9B 3DRSB 1IH7A 3H4BA 4H4MB 3AVNA 2YNGB 1BQMB 5CZ1A 4U7CA 2BRLA 4FBUA 2GIRA 1HARA 3KHRA 4FJHA 2KFNA 3ZSVA 1RDBA 4E89A 2I1RA 4FLVA 3GIKA 1TL1B 3HJFA 3SQ4A 1KRPA 2HHVA 4I7FB 1JX4A 2W7PA 4IDKB 4PY5A 1XHXA 3KLVA 4TSXA 3L2UA 1NK4A 1LW0B 3F9KA 1JLFB 3KTQA 3OYEA 4B9TA 2OZMA 3ZT3A 2WOMB 3VQAA 1RYRA 2IM2A 3DI6B 5FDLA 4MIBA 1S9FA 1QTMA 1DTTA 1U49A 3G6XA 4FVMA 4NLYA 4FCYA 2E9TA 2AGPA 2WK4A 1EP4B 2XCPA 4W5TA 1NNDA 1QAIA 4BWJA 3VQDA 3NAHA 4NLTA 1RDAA 2E9RX 3KHGA 4ECQA 4IR9A 3HM9A 1RDDA 3AV9A 1TK8A 3UPFA 4J2BA 2YNIA 4ECYA 1KFSA 1RTHB 4H54A 2PYJA 4J9LA 3NGZA 4M3ZA 2HWIA 2BE2B 4XPEA 4DL6A 3PZPA 2ALZA 4DQSA 3L3UA 1WN7A 4CHNA 4I9LA 4DMNA 4NCBA 1SV5A 2E4LA 3VQ5A 2YKNA 3PR5B 3KK2A 3NE6A 4DU1A 5KFSA 5C25A 2RKIA 4YP3A 5KG0A 5KRSA 2HAIA 4K4UA 3KJVA 4LD0A 2RF2A 1S0OA 4FK2A 3CJ3A 4TXSA 4F8RA 4DLGA 3OS0A 5L1KA 3KK3A 1XR5A 4CJUA 5J2PB 1VSHA 4B9SA 3TAFA 3AA5X 4CHQA 1RTJA 1NOYA 4RW7B 2C2EA 1TKZB 4PWDB 4LY7A 3MR5A 1DLOB 4O3PA 1X1PA 3NBPB 3HKWA 4FLUA 1N5YB 3G6YA 4O4RA 4KTWA 3GIJA 4IH6A 1LW0A 4ED0A 1JLFA 4YNQA 1NOZA 1VSJA 4FJGA 3ITHB 2WOMA 4B08A 4KKOB 3C6UA 1FK9A 1S6PB 3DI6A 4O44B 3L3VA 4Q45A 2GUIA 4DSEA 3FSIA 3CFOA 5KFPA 3RWUA 4FW1A 4DTOA 2WB4A 4DFMA 5KFBA 2B43A 5DQIA 4NYFA 4IH5A 4JRPA 4F4WA 4KO0B 2D3UA 3PX0A 2Z1GA 4DL7A 1CZ9A 4FK4A 2DFHA 3S3MA 2YKMB 3ISNC 3K59A 4O3RA 4Y1CA 4CHPA 1RTHA 3DOLB 3I5BA 4YR2A 3DLEB 1N48A 4FJKA 3CJ0A 1O1WA 4TQSA 3CG7A 4E7HA 2BE2A 4ID1A 3QNOA 1LWEB 4KRFA 2W8KA 1QSYA 3IAYA 4Z4IA 1CLQA 2ATLA 1Q9XA 4ICLB 2D0BA 3ICLA 4M3XA 4CIFA 3M8QA 2OPSB 3QEWA 5KGWA 2JEFA 4FM2A 4FLTA 2HVHA 4QWAA 4KB0A 3T5HA 4RW8A 5HLFA 4ZP6A 3H59A 2HNYB 1CXQA 1WSGA 5KFNA 4WZMA 4L8RB 3K2PA 2AJQA 3DLKB 3I5CA 1JL2A 5EDWA 2FC0A 3SI6A 3V6HA 4WFYA 1D8YA 3NDKA 4B9NA 1N5YA 4O3QA 4DFKA 3ZSRA 4HTUA 1JXEA 1LWFA 3CWJA 1XR7A 3ITHA 1U48A 4KKOA 2VWJA 1VSEA 4YR3A 4FM0A 4WFXA 1X9WA 3PJXA 1RA6A 3NL0A 3E51A 3PUFA 4M3RA 2V0NA 3QIDA 3EZ5A 1TK0A 3C6TB 3LP3A 1RILA 4IRCA 4J2EA 4EP5A 3T5KA 2WONA 2VG7B 4NLSA 4J9SA 5KT2A 1BCOA 2HHQA 5KRTA 2HWHA 3H5YA 3DOKB 3QEPA 1EXQA 3MEEB 3KKSA 4C8NA 4PQUB 3NF9A 1LWEA 3AVIA 5F8JA 1RT2B 1I39A 1D1UA 4KTZA 3K5MA 3BGRB 5KT4A 3OYFA 2XCAA 1JKHB 1S1XB 4F4XA 3T5LA 4DSFA 4IFYB 4RNNA 4HUFA 3RR8A 3RTVA 3HVWA 3N6MA 2Q3SA 2IM1A 4KHUA 4Q8FA 3H5SA 4E0DA 3CIZA 3QIPB 3SNNA 4IFVB 4ED8A 3I0SB 4F4KA 5KFRA 3KOAA 1MMLA 5KFMA 2ZE2A 1JIHA 2D5RA 3E01A 3OS1A 4DWIA 4TY8B 2KZZA 3PVXA 2F8EX 3SUPA 1T8EA 3V6JA 4AH9A 4LSNB 2R8KA 1LWCA 2HHTA 3QEIA 4WXWA 3T19A 1RNHA 4F3TA 1IKXB 3LP2B 4FZYA 2QXFA 1BQNB 2ATQA 2G8UA 3KNAA 3BSNA 4EP4A 4BE2A 1VSLA 4N41A 1WSHA 3IG1B 2VG7A 3VQEA 1RT4A 2XY5A 3TI0A 4ZVHA 5D3GA 3ZCMA 3UDLA 3OJUA 5KFCA 2AQ4A 4HUGA 3B6PA 5KT7A 5HBMB 5KFJA 1TGOA 3KLIA 1WAFA 2X6NA 1C1BA 3EZUA 4ECTA 3OVNA 3SPZA 4PQUA 3NMAA 4JLHA 5KG2A 2X74A 2P5GA 4JUZA 1KLMB 1RT2A 1TAUA 3UIQA 2BANB 1S9GB 1WLJA 4M45A 1KFDA 3HYFA 4KE5A 3MXIA 1SH0A 3DM2B 3HPHA 3VQBA 1NK8A 1UWBB 4URGA 1K6YA 1N6QB 4B9MA 4I2PB 4RW4B 4FK0A 4CGIA 1WSFA 3GYNA 4M95A 4HKQA 3PHEA 4CHZA 1RT1B 2BDPA 4NZ0A 3FQKA 2OPPB 3V1OA 3KMSA 3ZSXA 4OKJA 4J9QA 5KFDA 1JLAA 1JLCB 2ZD1B 1EETB 3HVTB 4FW2A 5T7BA 1IKXA 4R5PB 4WZQA 4ED2A 1NKEA 3SZ2A 1D5AA 4UQGA 4FJNA 4NLWA 4F50A 4CCHA 1J9AA 2F8TA 1IKYB 1TKDA 3QLHA 1BQNA 1SKWA 1TL3B 4KV8B 4CJPA 4TLRA 5CY4A 4CHYA 4J2DA 2FLNA 1GOBA 1ZBIA 4NLQA 3D45A 4O55A 1XWLA 1S97A 3OYAA 4U6PA 3F73A 3RBDA 1LAWA 4CGGA 1IO2A 3WNEA 3S3NA 4DTNA 3I8DA 4CK2A 3SQ0A 1RTDB 3SUOA 3MFHA 3MTKA 3Q8SB 4ID5B 2RDJA 4R0EA 5FROA 4CJEA 4FJXA 2I5JA 2BR0A 3VQQA 1IKWA 1QUVA 3QEVA 3OLBA 2W9CA 4IOBA 4C8KA 4PA1A 5FDLB 1S10A 3L8BA 4CK1A 2A1SA 3NHGA 1DTTB 4M94A 5KFTA 2DTUA 3NGDA 3KHLA 2XI3A 5JUMA 4O0IA 3T5JA 2YNFB 3TAEA 2XGPA 1A5WA 1TAQA 3PW7A 3PW4A 4OGEA 3AVMA 5KG5A 1XR6A 3M8RA 3LP1A 3AVAA 2HHWA 4IKAA 4BE1A 1RT1A 3O3GA 1T03A 4LH5A 3NGYA 1EX4A 3OL9A 2IJNA 3LAKA 5KFZA 2ZD1A 1EETA 1QE1A 4FJMA 4R5PA 1ASUA 3H08A 1RBUA 3L2RA 5J2MB 4CJQA 4NRUA 3OL8A 4F4YA 1SV5B 2VWKA 4EO6A 3CO9A 1IKYA 2YKNB 3LWLA 1NJWA 3KK2B 1TL3A 3FFIA 2RKIB 2RDIA 2D7SA 2W42A 5HP1A 4ECSA 1EKEA 4FJ9A 3KJVB 2RF2B 1W0HA 4CHOA 2C22A 5HRPA 3PW2A 3KK3B 1RT5A 2UVWA 4NLRA 1U04A 1RDRA 3QGGA 1RTJB 3AO5A 4M3YA 1UOCA 3C94A 4MK9A 1A5VA 2BRKA 3V9ZA 1RTDA 3A2FA 4RNHA 2FBXA 3MEGB 2W7OA 4ID5A 4ZPDA 3AVGA 4W5RA 1TV6A 2UVVA 1S49A 4NCGA 2BQRA 5JS1A 5F8NA 3MR3A 2XWYA 3HPOA 3D0PA 3C6UB 1FK9B 4TY9A 1NJZA 1Q8IA 4KI6A 1U45A 4MIAA 3T3FA 4IQXA 4XPCA 4K4WA 4KHQA 2YNFA 1OS5A 4Y2CA 2BQUA 3O4QA 3RMAA 1NJXA 3HP6A 4CF1A 4KBIA 4GMJB 3L2WA 4RNFA 5J1EB 4NLPA 1X9SA 4DF8A 2FBVA 2R8JA 5DG8A 4K4ZA 3CQ8A 3ZSQA 4CE9A 3HXMA 4LSLA 4BE0A 3SPYA 5F9NA 5K14A 4JS4A 4DTSA 2XO7A 5KT3A 5J2NB 4NCAA 5J2MA 3BSAA 1MU2A 4TQRA 4ZVFA 4CFDA 4ZPBA 3RAXA 3M8QB 3KD5E 2AGOA 4F2SA 3NF7A 1SH3A 4JV0A 2G8VA 3SV3A 5DQHA 3RBEA 5KFIA 4RW8B 1DTQA 5HLFB 3AVCA 2JEJA 4DTMA 1S1TB 1T7PA 4ZPCA 3LAMA 2VA2A 3NKYA 2E6LA 1C2PA 4RG8A 1NK7A 1S5JA 3DRPA 4IKFA 4CJ4A 5KFHA 2JC0A 3THVA 3MEGA 4J9NA 2CJQA 2C2DA 3DLHA 3ZT4A 3NGIA 4OLAA 3CJ4A 3SFUA 3OYKA 5DGAA 1LWFB 4IRKA 4WE1A 2G8WA 4K4YA 1Z26A 4K4VA 5C42A 1Z4UA 1C0UA 4KB1A 1JLGA 2W9BA 1WNSA 2B6AA 3K5NA 1NK9A 2VG6A 2GV9A 1TQLA 3MFIA 1QS4A 3QERA 1C1AA 2WONB 5J1EA 2Z1JA 4F4ZA 3GILA 1NK0A 4YMEA 5HRRA
chains in the Genus database with same CATH superfamily
1JJ4A 4X66F 2F4FA 2ASLA 4B9QA 1KHWA 4OZ5A 3V6DB 3H42A 4JI5J 4IO8A 4M42A 4F0MA 3VAGA 1B9DA 1NGDA 1X3MA 4LF4K 1Q82T 2DPNA 3B4MA 3DN9A 3AO2A 3ILOA 5J2NA 4MTPA 4DL4A 4HCBA 3VAMA 4MH8A 5BXIA 4HUEA 4LVOP 4X65J 1HWUA 2ROEA 3R5AA 1N36J 4L72B 4DL2A 2HG4A 4DPYA 3RYLA 2O5DA 2VFRA 3R6LB 1KQSM 4OJ1A 3MM7B 1VJWA 2WRMA 3TAGA 3E01B 4ZVRB 1EB0A 1R27B 1JLEA 3GG0A 4QQBA 2EFPA 2YKPA 3S1TA 4MAKA 3C7NB 3N0VA 5AXKA 1S1UB 2ADCA 4NLGA 3HO1A 2B8PA 2FJVA 2H4WB 4DZ6A 3W3DA 2D9PA 2XRIA 4WKRA 3DLRA 3HBTA 1CJVB 1YTAA 3GFZA 2ASJA 4DS5A 5LXRA 2OPQB 3ATVA 5LMNK 1VSIA 2V34A 2ZH7A 2P9PB 1CXUA 2QC3A 4Q8EA 2F4VK 5HL7L 4CIGA 5KFWA 2QSWA 1KVCA 2CZ4A 2HVZA 4ZJLA 3W0LA 3PIPQ 2CPJA 3SAFA 4ER8A 5AZJB 3KLIB 3BDPA 1V9OA 1H1VA 1FF2A 3ZSZA 2CPHA 2D1KA 3VQ8A 3SEOA 3G10A 4K0KJ 2O67A 2FLLA 3SBGA 1PIEA 1IR0A 3I9ZA 2IMWP 3Q89A 4CO2A 3A5OC 4KAIA 3W8GA 2KU7A 3I4PA 2DNYA 4ZP9A 5HVFA 1NKCA 3G71S 3DCAA 2MEWA 4ECWA 2G9OA 1D8ZA 1S9EA 2QEXS 1K8AT 1SB6A 3DGPA 4OZJA 3ZEUB 1B9FA 1YBTA 1IV0A 3NGUA 1VSKA 1PCAA 1K9MT 2CJBA 4ILHA 1U26A 1KOOA 4DV7F 2VV5A 3OPKA 1LK7A 3DRXA 3LM9A 3O1BA 3S9HA 2ZGZA 4RU9A 4ILRA 3QGHA 2KHDA 2OPRA 1RHJB 5HQLA 3W2WB 3OFGA 4X66K 3GJTB 4FWNA 1Y5NB 3JAMO 2ZH9A 2OD6A 2YQ3A 2ZKUA 2XYPB 1O51A 4UOFA 2JRSA 3OLAA 4B9VA 4QWDA 3RB6A 1WF1A 3D28A 1VMBA 4WYWA 2ZDPA 2D3OR 3HSTB 5EWGA 1SJFA 2IDOA 4NA3A 1QQMA 2H9ZA 4K8ZA 3OW2R 1WELA 2IVYA 1FE4A 2VDHA 1NJIT 1U1RA 3IRXB 2FF3B 5KT5A 2FBTA 4MIWA 2U1AA 2CPYA 3NS7B 5DG9A 1NZAA 4LF9F 2FXUA 3AGKA 4U9RA 1XNQJ 3EXYA 1LXNA 4IBNA 2P9NB 3DLBA 1TUGB 1YVUA 1N32J 2X6SA 4H5RA 2ZBRA 3AA8A 4ZA1A 3EYZA 3DHXA 1XIQA 2ITGA 2HBMA 1FKPB 3TOQA 1CZAN 4CEQA 1SKRA 4C3KA 2K8GA 1IXKA 1SVDA 2VD3A 2PEBA 4WFNL 4I6WA 2VBWA 2R7YA 4U7UD 2XY6A 1HYVA 4RWXA 3MPDA 3CCES 1Q8KA 4A8XA 2WVCA 2HZVA 1HBOA 3TJ8A 1M5SA 3KLEB 1YI2N 1KVJA 1E6YB 4LIWA 4X64K 2XLIA 4QIFA 3FFIB 3PW0A 2KTQA 4ECUA 4LR7A 3MCNA 1U2VA 2AEMA 3LL3A 2E5LF 4NZ7A 4F0HA 4M5IA 1BGXT 3T1AA 4HLBA 5HO4A 4JI2K 4CGJA 4J2AA 3M8SA 2QN6B 1A9NB 2YX7A 5T7LB 2YH1A 3B82A 4CZFA 3HHKA 2V68A 1F9HA 5KFKA 1Y00A 5I42A 4CJKA 4U67Q 2DH8A 4QWCA 4I9QA 4OYBA 4DX8H 4LFAK 2PYLA 1BHNA 1ZETA 1HNXJ 2UXBK 4A57A 3I5AA 4YB1P 3ZX3A 5ETMA 3CC4N 4OHXA 1H0HB 3H40A 5AFUA 4A8WA 1O8BA 2XI2A 3IS9A 4M3TA 1FXDA 3CC7S 2BVZA 3EPGA 2RVJA 1HNZJ 3OHAA 4GKJK 2QIFA 1IBKK 3SCXA 2OEJA 4LSLB 3IWXA 2VGMA 4JI4J 2AJFE 3HP9A 5JVHQ 3T1YJ 1CJKB 3WC0A 4AUKA 2G0JA 4IXCA 2ZDOA 2GO9A 3CIMA 3N4PA 1JWWA 1ZBUA 3AT1B 1Q5YA 3Q8UA 2I7PA 4NLDA 3RR7A 3CF5L 2ROGA 3CE8A 3E66A 4FLZA 1RTZA 4RKUC 1NGGA 2OEMA 2G1DA 1N4LA 3ZTRA 3MEDB 1TK5A 3BO4A 3DMJA 5IM0A 4DR7F 1D09B 4LJMA 1YVFA 1UFLA 4YB6A 3SFGA 3PHTA 3DRPB 2K1RA 4O5BA 2EK1A 2HKEA 1O6XA 3P49B 2ZQBA 3BV8A 1YQHA 2WVEA 3OVAA 1F1BB 4WE1B 2XSFA 5SWMA 1S6UA 2VKRA 3CO0P 1RT7B 4BRPA 3KWGA 5C42B 2W8LA 5K9FA 4ED6A 3DAWA 1KS2A 2B4JA 4DV4K 4ZVOB 2W9BB 2ASMA 4HCCA 4MMOA 2C2OB 4JI0F 3ULEA 3DXSX 2I2YA 1B3TA 2F96A 2V69A 3V4IA 4CZIA 3SMPA 2Y3YA 4PG7A 4K50A 3M32B 4WTYA 3ZZUA 3CMQA 4UZBA 2RDDA 4DU4A 2IM3A 3O3LA 2YNHB 4PWWA 4CLUA 3M6XA 1ZTWA 2GVZA 2Z1IA 2UVUA 5ADZA 2EXUA 4DG1A 5E41A 4JNEA 3TAPA 2HQGA 1KXPA 3AA4A 1CULA 2FC9A 3TZXA 3TA0A 3RMDA 4J9PA 5C0YA 4NI2A 3U7JA 4DPXA 2XMKA 4PYAA 3DYAA 1D0EA 2LXFA 3OYGA 4C3LA 2XO6A 2UV8A 2R7UA 1Q1KA 1X4BA 2B0GA 2HVDA 3CJTA 2OIHA 3V81A 4DV6J 1FXXA 3CXCM 4QIGA 1F0XA 3QO9A 4WKYA 1IJJA 5H9FJ 3MGJA 1WDTA 1IKVB 1ZYQA 3P83D 2GGPA 4RCHA 1ZBLA 4FWPA 3D2EA 1XMQJ 3MM6B 2E5IA 4LF6F 1GXTA 4EK2A 3AOAA 3N4WA 3R27A 4IDKA 5IWAK 4E7LA 2ZH2A 2YHWA 2CA9A 2WUSA 5J2QB 2D3ZA 4QWBA 3CCRS 3DNCA 3CJ1A 1NDPA 4P71A 3BF1A 1RWMB 2EI5A 5E7OB 2HGLA 3UE2A 1TVRB 2XEXA 1S6QB 3CVKA 4QAGA 4GV6A 2VQFK 3MCAB 1RB0A 3OUYB 5D0RA 2DIVA 4B1YB 1ZAVA 3QZ8A 1RAHB 5KFXA 3MCOA 3WXLA 1RBAA 3SLCA 3TO8A 1LCUA 4NYNA 3EMTA 4P7TA 1NCLA 2QMUB 4OKEA 2B9XA 3NVKA 4JRQA 2VOPA 3MWPA 1DJ0A 4FXVA 3IN5A 3G6ES 5L1LA 4B8AB 3CB4A 2XLJA 1S0NA 1VK0A 4AHSA 1S76D 3CCVS 1YHQS 3WNGA 1KN6A 3W9HA 3MTJA 5D8HB 2R4FA 4R8UB 4JV2A 4HACB 4DV3K 1RCOB 2K7KA 3I8BA 2UVRA 4KHPF 1QAJA 2RHKA 2F7VA 2XNRA 4BC9A 4HH0A 3M6GA 1PGZA 4USHA 3OHRA 3NVMA 3H25A 5A8RA 1MROA 5DQGA 1RWWB 1VFJA 3M2RB 4FJLA 2RPIA 4DR6K 2BJDA 3C15A 1LQ9A 3M5RA 5AQIA 3KLHB 3Q8YA 4RW9A 3HT3A 3KG1A 3QETA 1RWVB 4ILLA 1HIYA 2BM0A 3H2LA 4X84A 2A6AA 1HNIB 2XZDB 4JKGB 1RGIA 2PMWA 2WCXA 3PG9A 2LA6A 5T14A 3M8ZA 4NO7A 3CD0A 1RGVA 3CF5Q 4LFBF 1RDCA 1HNWJ 3TPQA 2GUPA 3KWMA 1M1HA 5A6PA 4G1PA 4LQ9A 3DOLA 4Q2MA 2KXNB 4FPAA 2CWKA 4CZEA 3FZBA 3M6VA 3HMJG 2VWBA 3C16B 3I32A 3KUHA 1W97L 1R31A 2D4WA 5CR4A 4CEZA 3QWPA 8AT1B 3H46O 1S4FA 4ICLA 2OH2A 2QKKA 3DGVA 4QCLA 4OIXA 2KQ2A 1PC4A 1J5EK 5ETOA 2ALYB 1EJ7L 4M5LA 5KT6A 3VAJA 3BF3A 3ID8A 4BVPA 2QWNA 2GO8A 3O1LA 4FYYB 3ENOA 1SL0A 3FE1A 3RAMA 4QYZJ 2JX2A 4MKBA 1VISA 3GU0A 4LRDA 1YRXA 1VBZA 3VGMA 2XS5A 4FP9A 3S3OA 4USUA 4Z4FA 1RI7A 5G0RA 2IBOA 4LF5F 4QS9A 3N5BA 3D7EO 4PL7A 5F8IA 2JOQA 2R8HA 1RQ0A 3C6TA 3HSJA 4KFBB 1IBLJ 5LXYA 3PO5A 2LP4A 2E9ZA 2M0GB 2Z4PA 1WHWA 3PTWA 2JWLA 4E98A 3O3FA 3DLGB 1Q81T 1T05B 2DT9A 3M8PA 3NG8A 3T69A 3RVCA 2D41A 1GXUA 4FWSA 4BR9A 1BWFO 4OYZA 4ELVA 4OL8A 4DPWA 3SDEA 3MR2A 4BACA 5C2FA 4BRQA 3IP0A 3L4QA 5AJ3J 4H5NA 3R7NB 2CQHA 4EFAC 4JI1K 2NCKL 3OYCA 3PRVA 3QGPA 2ZJQL 1VRUB 4EYIB 4K2JA 2GTDA 4DQRA 4IFYA 5F9LA 3V9UA 2Q6BA 2ZVIA 4FZXC 3BYPA 4O3NA 1UJ6A 3CJQA 4FDFA 5LJWA 3OXGA 4H4KA 3MCMA 4LF8J 3L7UA 2PZSA 2MQMA 1Q0NA 1T94A 4JI7J 1LOUA 4WYLA 4JKCA 3NMRA 4GKKF 2C2MB 3CERA 4M5NA 2YV0X 2R2UA 4ANDA 5DDPC 4Z4EA 3KYLA 3N01A 4CGDA 4JV5K 4DR2F 7FD1A 4I2QA 2XS7A 2CKWA 2H51B 5CAAA 3RW6A 2QA4S 1JCGA 3AD8C 3LP2A 2Y1RI 1HD0A 5HVGA 3M9OB 1N52B 1RT3B 1B7FA 4Y2KA 1WHVA 2Q3PA 5L1JA 4YB5A 4KC5A 1JNZB 2V52B 3BYRA 2YY3A 3R9LA 3QNWB 2PC6A 4OGCA 4UW2A 3LWMA 3ULDA 3S6EA 2HPUA 2F63A 3UCZP 1HYSA 3GG4A 3RSEB 4HTIA 2DYAA 1H72C 1S4EA 2EK6A 1HBMB 2GJ2A 1VYAA 1AT1B 2PN6A 3J81j 3VEYA 1KOHA 3FVYA 4OKKA 5AQJA 2CPFA 2BANA 3BO2A 3PFEA 4GY2B 3M1VB 4NLOA 5EX3A 2E44A 1C4AA 4I6MB 4CNYA 2QYGA 4DQPA 1NUEA 2NREA 2EHGA 2RAQA 1XNRK 3ISZA 1UWBA 2ZH6A 4FJIA 1GOAA 5D0HA 2UU9F 3QWUA 4MK7A 2UXCK 1Q9YA 2BOPA 2ZJRQ 2WC9A 2YNIB 2DNLA 3OYLA 2HS4A 2Z56B 3MMAB 4OYIA 4CJSA 4YY3J 3W63A 1RA7A 4CTAA 4Q43A 4CBUA 1W25A 1F21A 2ZUAA 5DGBA 2E8AA 3UVJB 4QR0A 4GVBA 4JKEA 3ZZOA 2B8QA 4DR3F 4ECRA 3CCTA 1VRTA 4KV8A 5GINA 1SIZA 4YHHK 3DRSB 4DX7A 1IH7A 3AJ2A 3FR0A 1TMMA 4WFBQ 4FJHA 3ZSVA 2OFGX 3HFVA 4YEAA 3PKMA 1NGJA 2J0SD 1YG0A 2YHXA 4E89A 4OQJA 1U0HA 2YWGA 3GIKA 4XK8C 4OPHA 3HJFA 2Q2RA 1VOMA 1KRPA 2HRUA 4AQYF 2W7PA 4I6AA 3EN9A 4TSXA 3BP8A 1JLFB 3OYEA 1VQYA 7FDRA 1VC6A 1Y5LB 2FQQB 4B17A 1RYRA 1KC8O 1S9FA 4CD3A 1H7WA 1NG9A 2E2QA 3G6XA 1C0FA 4DR4K 3FMWA 2E9TA 2AGPA 2NXCA 4DR2K 1TYQA 3O6WA 1UVLA 4NLTA 1H2TZ 2M4MA 3CGIA 2VF3A 2FLOA 1ZC6A 1ZPWX 3OD2A 2E9RX 4PXBA 4DN9A 1TK8A 1WG5A 3LDPA 4ECYA 1RTHB 2PYJA 4J9LA 3GFHA 2YWKA 2YWEA 3ZZZA 3F5TA 1X4GA 4I9LA 3TZYA 4DMNA 4NCBA 1WJ9A 2MQNA 2E4LA 1C0GA 2VBXA 2XB2D 2VBYA 3PR5B 3GSDA 2RKIA 2V94A 2RJZA 3LA0A 3NNHA 4TXSA 4CWBA 2VASA 3OS0A 3PIOL 1FA0A 3KK3A 1XR5A 4LRBA 4FPIA 2VH7A 1NLVA 3H8YA 4RW7B 4L6V3 1TKZB 4PWDB 4O0NA 4WJBA 2V8GA 1DLOB 4FLUA 3D3CJ 1N5YB 2CGKA 4O4RA 2NUUG 3QFPA 1NGHA 2HIQA 1VSJA 2DKOB 4FJGA 1H74A 3WBZA 1XMOF 4BHQA 2ZHAA 3UKRB 2WW4A 5HQ8A 1QAXA 5AQMA 3L3VA 3TEHB 1OH6A 4X4NA 1REGX 4WQ5A 3CFOA 2PEHA 4HVZA 3JTNA 1FVSA 2BYCA 2Q1NA 4X62K 2B43A 2FHOB 4AL5A 3QATA 3F0NA 4F4WA 5ETLA 2DFHA 3MM8A 2HBRB 4DR3K 1VDHA 3QDKA 1ILYA 4FJKA 1KQKA 1O1WA 1TL5A 4JI5F 4AL6A 1HFEL 1NPKA 4PL8A 4WF9L 1X3NA 5J1NA 2MSTA 1QQOA 4Z4IA 1Q9XA 4M3XA 1NB7A 3BBCA 2OPSB 4F26A 3LDQA 4IWVA 4X65F 4OHYA 5KGWA 2ZBIA 3HSDA 3LDOA 4HI1A 1N36F 3HHDA 3T5HA 3QRPA 4IYQA 4EUVA 2YI1A 4ZP6A 3VGUA 1QLNA 1CXQA 5KFNA 3K2PA 3I5CA 2BUNA 1ULRA 5ETPA 1J2VA 1CEZA 5EDWA 3SI6A 1VQ9N 4N8NA 2ZWHA 5A2QU 2XM3A 1JJ2M 4EU0A 5A8KA 1FT8A 2MKYA 4FWQA 4C6AA 1U48A 5HQMA 4BRMA 3L9ZA 5A8WB 3B6BA 1VC5A 2VYPA 3TEGA 1BWVA 1FESA 1KONA 4USWA 4CZCA 3QIDA 3EWGA 3EEQA 3IM8A 2HOEA 4D3HA 2KO1A 2GIFA 3D3BJ 3ETMA 2EFNA 4NLSA 3VZIA 4J9SA 5KT2A 2DGSA 4CJ7A 3DOKB 1S0VA 3MEEB 1M1GA 4JHDB 4PKIA 2ZEJA 2Y8WA 2B7BB 3DLJA 2DD8S 1VS3A 4PQUB 4O8KA 3IM9A 3IKMA 4K0KF 1VQON 5F8JA 1Y4ZB 2HIYA 1I39A 3MDQA 4ISGA 4L3KA 1OH8A 1HR0K 4NXNK 2DITA 3T5LA 1G7CB 1YKWA 4DSFA 3KVGA 1R8AA 3RR8A 3HVWA 1F6TA 4KYZA 2Q3SA 4KHUA 4Q8FA 4FF2A 2Q36A 3H5SA 2R7TA 4B3TK 4IFVB 4ED8A 4KH6A 3I0SB 4F4KA 4E1JA 4ITSA 3ZLJA 3KOAA 3HFKA 5C2CA 2ZE2A 3VF4A 5A76A 2KZZA 3PVXA 1XMOK 3ZTOA 1GLCG 3TUIC 3FGUA 3EZOA 2QMXA 3V6JA 5BYQA 2R8KA 2OELA 3THTA 1LWCA 3C0BA 1FRMA 2RUGA 3BY5A 4WXWA 1IKXB 1ZA2B 3IMQJ 2QYCA 4KY3A 4KT0C 4JKFA 3KNAA 2G4BA 4YOUA 4M5DB 1MDUB 1OWXA 2A10A 4N41A 4JI5K 5M1FA 2M7SA 4A2AA 1RDUA 1ZH5A 5D3GA 1T9VA 4BRNA 4IEEA 5KFCA 1NU4A 2DHXA 1YJNN 5KFJA 1TGOA 1WAFA 3L6QA 2XG8A 1KQSR 3SPZA 1NLKL 4WQ4A 5KG2A 1VQKS 1N36K 4OI1A 2GAGC 2APOA 3S8SA 2AF6A 3F41A 3HDSA 1TAUA 3QBWA 4B1WB 1RLDA 3O8WA 4CZJA 1NPPA 1OYDA 1F9EB 3EVWA 5K5MA 4IEIA 1S9GB 2G0CA 2NXEA 2AD9A 1S57A 2GJIA 1XNQF 4IOCL 5GMEA 4U95A 4L73A 2CPIA 3M2UA 2YPZA 4CLSA 1WOPA 5HK4A 4URGA 1N32F 1K6YA 2IYGA 2IY5B 1N6QB 4I2PB 1HQ2A 4RW4B 1FD8A 2JVOA 1SBRA 3I56N 1VQLN 4HKQA 3PHEA 2HBZB 2BDPA 4NZ0A 3V1OA 4DPUA 4J9QA 1TMJA 2LDIA 2ZD1B 2KHCA 1N34J 4B1XB 5T7BA 5FJ4A 4R5PB 1OSDA 1WD6A 2CWXA 3HX9A 5E3PA 4DV1F 4EWTA 4F50A 3EO3A 3EZWA 4CCHA 1TKDA 3IDHA 1BQNA 4FWMA 3Q7BA 5EX0A 4DCPB 3KJNB 1ZBIA 4NLQA 4BRGA 4O55A 4C2MA 3OYAA 1TUWA 3QJJA 2GX8A 1UVIA 3Q8SB 4PEOA 3ILLA 3QQCD 3NCPA 2I5JA 3VQQA 1HNXF 4PZVA 2JWNA 2JNJA 1VQMN 2ACYA 2BZ2A 3DC2A 3EUNA 2AZ3A 2W6KA 4LREA 2DTUA 2QWMA 4PKDB 2GV1A 2XI3A 5T41A 4ATNA 5F1XA 1XK8A 2HHWA 1CVJA 4RWTA 1HNZF 5E5NA 4XH5A 4GRSA 1RT1A 1NGAA 1SC3B 1EETA 1MWZA 4QOTA 1QE1A 3J7ZO 1ASUA 1M0SA 4JI4F 4EHUA 5A2QY 5J2MB 2Q1LA 3T1YF 1WC6A 4EO6A 5ETSA 1TL3A 4C0BA 2GZOA 4LF4J 4A8QA 5HP1A 5BYRA 3OFHA 3KJVB 3CCUS 1W0HA 1N0UA 4QS8A 1S5ZA 2BEFA 4B3SK 3PW2A 4M63C 1EX8A 1U04A 4M3YA 1RADB 1UOCA 1U2RA 4MK9A 1B70B 2BRKA 3V9ZA 4DPOA 5CE3A 1AROP 3GR0A 1V6HA 5HSPA 1TV6A 4UUWA 3O2IA 2GJFA 2PA8D 1NJZA 1KAYA 1SQFA 3H20A 3T3FA 3W61A 1T0TV 1YJRA 2GHPA 2QO3A 3O4QA 2BQUA 4Z94A 3JAMU 2EVZA 3L2WA 1FKAF 2XMAA 2E20A 4DV1K 3M8YA 5LMNJ 5LT5A 3KG0A 1TUUA 4K4ZA 3CQ8A 3ZSQA 1SAZA 3HXMA 3AAQA 3M2VA 2F4VJ 4V1Ak 2BJ7A 1JMTA 5HMYA 2KRBA 4UOHA 3FZFA 5ETKA 5ITHA 2RHQB 1G6BA 3PYGA 5AZIB 3D2WA 1F60B 3BSAA 4DV5J 4C1NK 2LEPA 4CFDA 3NGRA 4ZCLA 4ZPBA 3RAXA 3KD5E 2CG4A 3AH6A 3PJ9A 3NF7A 1HWKA 2YWHA 2G8VA 4ZS6A 4BS2A 4LMZA 1RJJA 3IR6B 4AXJA 2JEJA 4S0MA 1W2IA 1YBUA 5K8OA 1S1TB 2FJAB 3LAMA 4CDIA 1HNXK 3QICA 3CMAN 4X4QA 2UUBK 1S5JA 4IKFA 4CZHA 4DV6F 4CI0B 1NSPA 2JC0A 3L3CA 2O8CA 2GQQA 3H2UB 1MMDA 3SAGA 3NGIA 4OLAA 3CJ4A 5DGAA 1LWFB 5JJBA 4J7CA 1BE4A 3K17A 3THWA 2POKA 4K4VA 3CC2N 4C11B 1Z4UA 1C0UA 5AQKA 1XMQF 2HS3A 1JLGA 1WKLA 3DJCA 1YRUA 1SC1B 3K5NA 3FBFA 1IM6A 2H5IB 4F25A 3ZZRA 1TQLA 1QS4A 3CQYA 3DLLL 2WONB 3HHLB 1FJCA 1NK0A 4X66J 4YS2A 4N47A 4PPZA 2QWOA 2B5JA 3U3GA 3PRDA 3MN7A 3G4SN 3BN7A 4UUXA 3DXMB 4XO0A 3VQSA 3LP0B 4DUZK 1FWKA 5A0YB 3GE1A 3BR8A 4EO8A 4A62A 3WQUA 4Y3CA 3CPEA 5L9XA 3VQ7A 1K1SA 4DXLA 4DB3A 5JS2A 5C2DA 5GMDA 4LBHA 3BGFA 2L9DA 2IAJA 4BROA 2O66A 4WBFA 2B9YA 2QLJB 3P31A 1LKZA 2KZMA 4H5VA 1VSMA 4P2MA 1BXNA 1CQMA 2J76E 3C95A 2JLGA 5KFGA 4Q0BA 3F56A 5BRDA 3V9XA 2CPEA 3D4JA 1MW7A 2NRVA 5LY3A 2XHCA 4DV0K 2V67A 5BR9A 4FYDA 1VQ8N 4F36A 4LF1A 2LEAA 5GAEU 1OVYA 3VQTA 3G2XA 1X8DA 1UEVA 3NFAA 3R5DA 1C1CA 3O9QA 2CQ4A 4X64J 4F3MA 5IT9Y 1R6VA 1JLBB 1NSAA 2MLYA 3H7HB 3G8QA 1R0AA 3FEXB 4X4PA 3V6DA 2PI5A 4BDZA 1TZ0A 2BJEA 3CCLN 2CZVC 4JI2J 1LNQA 3TJAA 5EU7A 5M2UA 1HNWF 1P9QC 1NHVA 3D1QA 4A48A 2W1BA 3SUQA 2W2NP 3CXCR 2VFVA 3I0RA 1RBVA 3R5JB 1WKKA 2FHKA 5HRNA 3SQ2A 3CCJS 4LFAJ 2YWWA 3ENQA 4RUCA 3GWCA 2RILA 3VN5A 2UXBJ 2B56A 3C19A 3BGOP 3BR9A 1X31C 5K8NA 2KXFA 3A8JA 1QTNB 1IJEB 4V19S 1GLFO 1T9UA 3IUCA 3C7NA 1PC5A 2XHWA 4AYBD 2BTFA 1S1UA 3MF5A 4AL7A 4U8YA 4BRIA 1NM1A 1I5OB 4QPXA 1MWMA 4WIIA 5ETQA 3AD9C 3P39A 2A1BA 4GKJJ 3AHPA 1CJVA 4G1QA 2K3IA 5THWA 3P1GA 1BWEA 1IBKJ 1X9MA 4W90B 2OPQA 5HMWA 4KHSA 2KM8B 1UA1A 5KQ8A 3CFPA 5C5JA 1BIUA 4DTUA 4KAZA 1WSEA 2DBBA 2QL5B 4Y65A 1SPBP 4EBDA 2LA4A 1J5OA 3TA2A 2V2KA 2DISA 2MY8A 2QWRA 1QM9A 2NS1B 4LH4A 1BD6A 3DDNA 2B7CB 4RLEA 4TU8A 1IBLF 2P9CA 4L3QA 2PIIA 3K57A 2CYYA 3ZNJ1 1ICEB 4C9DA 4AHVA 1IKWB 4I1TA 2HHUA 4AE5A 4ZP7A 2DNNA 4N8OA 1NK5A 3JYTA 3W7BA 5AJ3F 3ASMA 3OXFA 2HMIA 1OJ4A 3NRBA 2R7OA 2DHSA 3C46A 5CZ2A 3MCPA 4DV4J 3D6MB 3W65A 3I55N 1FKOB 4P74A 1T03B 1S3XA 3I9V9 5HAOA 5KOXA 2AYGA 4B3OB 3J7Z5 3IFRA 2ATCB 2VB6A 1FX4A 4LF8F 4JI7F 1U0SA 2E29A 2KKZA 1S1WB 2ZKTA 2MYFA 4OYMA 2A6OA 4KHRA 1I3AA 1EARA 3ATUA 3VQPA 2AYBA 2WVFA 3BQ1A 3BBBA 4F02A 1N5TA 4PCQA 2BH1A 2DY1A 4JI6K 4ZMMA 3T41A 3QB0A 3IBFB 3QRQA 2C42A 2QLXA 3DWLA 1HMVA 1GX5A 4WXOA 3KD1E 1J54A 4Y0WA 3O9UA 4O3OA 2VG5B 3IRXA 3AVLA 3PX6A 1LFWA 1HBUB 2RD5C 4P9SA 3R6MA 5DM6L 4LT6A 5K8MA 2LCWA 3D6HB 2DH7A 1W26A 3MDFA 4DUYK 5F0XA 2IVNA 1BL3A 1S7IA 3H98A 1NGBA 2AJ4A 3AXKA 2E7XA 1S48A 4AT1B 2JEGA 3MAAA 4KHWA 5F0UA 1VHXA 3RB0A 1FDAA 1FKPA 3M4XA 2UV8G 3L4BC 5IWAJ 3OSNA 1DBDA 4RWWA 3EGWB 4GW6A 4NWBA 1NGCA 3JSRA 3O3HA 5K14B 4CESA 2O8EB 5KG3A 1FDDA 1P9YA 1HLWA 3AO4A 3HZEA 3KLEA 1S1VB 3PXGa 1MU2B 1E6YA 2GAHC 3T6JA 5CCMA 4ZIWA 2ZF5O 2Y9HA 2VQFJ 4K5RA 2GIQA 2FVCA 3H90A 2X1BA 4YY3F 3Q2SC 2D0CA 5C24A 1KC8T 1DTQB 2OA8A 2V51B 3B54A 3EJMA 3U3YA 3G25A 3TARA 2OTLS 4Y34A 4EEYA 1YT3A 3BDEA 3UD4P 2ADBA 1V5IB 3LANA 2VC0A 3SUNA 2RE1A 3L2VA 3R97A 6AT1B 5CYQA 3GSIA 1QSLA 1T9YA 2CDRB 3OTOK 4LUBA 2FUG9 5D0GA 4OPAA 4CF0A 1VI7A 2W6LA 3MK6A 4ILJA 3ZETB 3U6FA 2M8DB 4WCEL 4QZVB 2XC9A 4DLEA 4NZ6A 4ZVEA 4ETZA 2J8SA 4DV3J 5JMVA 3PJWA 2QA1A 3W3SA 2B6AB 2VG6B 1MLAA 4ED5A 3OTEA 3AVKA 2A3JA 2NQPA 2BABA 3BM7A 4EBEA 2A41A 2P9IA 4DTPA 2OAUA 2H54B 4DR6J 1PG5B 1JK9B 2J9EA 3HD2A 4IG3A 3X1LB 3W9IA 1U25A 4OJHA 2H65B 4KSEB 2DNRA 5CXTA 1U6BA 3H5UA 2VJUA 1CJKA 2IBKA 5KPZA 4FF4A 5F8GA 1FXRA 2V8HA 3QIOA 4LR9A 2DRAA 4A5BA 3WHIA 4L3NA 3VQCA 1VIOA 4UOCA 3K58A 5MAOA 1IG9A 2KFYA 5TKYA 3MEDA 5DMRA 4Z7YA 1JLEB 1U2CA 4OVLA 2O8DA 3MUMP 2DHGA 4JN4A 1K73O 4LQ3A 3O5BA 4A4JA 4IOXA 2HBJA 2IJFA 4W4MA 1DAXA 3Q8QB 2F8MA 1RT7A 2P51A 3EE9A 2NR0A 1J5EJ 4EZ9A 1KKHA 3UI3A 4I7FA 3LW5C 3Q24A 2X7IA 1NDKA 4FJ5A 1WC1A 5KG6A 1WDDA 2RSQA 3KLGB 2OTJS 1HW9A 2V9WA 1FTRA 2Y8YA 2MZQA 4C7QA 3M32A 1VK3A 1N5SA 1XQIA 1MWKA 1EP4A 1HWJA 2ZZTA 2JLEA 3HD1A 3O44A 1ZPVA 2RRNA 1EAYC 2V6AA 2YNHA 1KHVA 3TTCA 2ZJPL 2FVPA 1U1OA 5GADI 4CJ5A 2DK2A 4YOEA 3MMBA 4A8YA 2X51A 3CD6S 3QEXA 4K41A 1RDWX 2G13A 1S9EB 2R7VA 2OEKA 4TYAA 4H0TB 3DGPB 2EX3A 5AQSA 1RKJA 4XIUA 4HR2A 1YUWA 1KVKA 3B4DA 2P5VA 2DY9A 3KG4A 4KPCA 4JI1J 2FY8A 1SC4B 4YQWA 4JKAA 1Y97A 5J2PA 3MWBA 2OPRB 5GAHI 1HD1A 3MX5A 3MZIA 1KCFA 3NBPA 4KQZA 2DIUA 4KRWA 3ENBA 1XC3A 3DFEA 1Y3KA 4DQQA 1YK9A 1G1XA 1VSFA 2ZGYA 1S6PA 1RHKB 2QM1A 4JV5J 1LOTB 4C4WA 1TVRA 2Z2ZA 3OUYA 4Y28C 4C8LA 2CUYA 2VPWB 4KO0A 1WSIA 4CQ1A 3WXMB 4NLVA 2AJ1A 1FJ7A 4JKHA 4ES3A 4MO4A 4LF7K 2O8FA 2ZC4A 1RWXB 3DLEA 1UKUA 1MNEA 4MFBB 5H1SQ 1ASVA 2N4CA 2M52A 3U02A 3KNGA 3V1QA 3O80A 2V4RA 1EZZB 4Z4GA 3AB2B 3WQPA 1XN9A 1TUYA 2FVSA 4ZTFA 3J7YI 3CJBA 3TUJC 1RAAB 3GYGA 1T95A 3QGIA 4NYZA 1LFPA 3FQLA 3O5TB 4CO5A 2HNYA 4URSA 4RUHA 5E3AA 3B8AX 2FPHX 2YHBA 5CHCB 1G3OA 3SV4A 2IM0A 2DCUB 3H3OB 3M2RA 3D68A 5D0EA 3CDEA 3R8EA 1JL1A 5F8LA 1XNRJ 4CEBA 5HRSA 3PX4A 3QPIA 5IZHA 1U2VB 5EHHA 5DZ6A 4ZVTB 5A6WA 4X2BA 3UD3P 2F5GA 2UXCJ 1TU0B 2E5HA 2ZBQA 3CCWA 4E7KA 2NXJA 4OI4A 5CD4H 3NF8A 4X4TA 3H1VX 2EKYA 2I6WA 3TJ9A 5I42B 3IAS9 3PV8A 3BKTA 4NLBA 1ASWA 2MDAA 4W98A 4BRKA 3WNFA 4RZRA 1NU0A 1HLUA 1C6VA 2UUAK 3MAQA 2UZAA 5D77A 4YHHJ 4MT1A 3IGNA 2WVBA 2GQ2A 4O23A 4IRDA 4WPAA 2BX6A 5DDQC 4YDUC 4KHYA 3IS9B 4U7BA 3TQ1A 3M05A 1NDLA 3BGRA 1JKHA 4XH4A 4WP9A 4JKBA 1NBEB 4OMFG 1X0PA 3MUTP 4EGLA 2HMPA 1YJ9N 1JJ2R 4A61A 3HKZD 1DY3A 4BDYA 3NNCA 1ZTTA 1QDUB 2NPIA 3U1LA 1YDLA 5KG7A 2YHAA 3EY1A 4CH0S 4DI6A 2HBLA 3H6EA 4ETXA 4Z4CA 1GMVA 4DR4J 2CRLA 3TUZC 4IOAQ 4LSNA 5AQUA 3NF6A 3ID6A 4LRFA 4K4XA 1N34F 3V4MA 2LQ8A 2YHYA 3A8IA 1W9HA 2G8FA 2FB0A 3DMJB 3Q8PB 2ZOGA 5IM0B 1X4EA 1SKUB 3MPVA 4KFBA 4O4GB 4CD1A 4KI4A 3HI9A 3C6AA 2K1RB 2G8HA 3W5XA 1YJWS 3IG1A 2F8SA 5EWEA 2QSFA 1L3KA 1T05A 2Z2MA 2QTWA 1XBWA 1PBUA 1GX6A 2J9DE 5HBMA 4FJ8A 3J7ZT 4BC4A 2PY5A 1UVNA 3GCWP 3VA3A 3ULEB 1BDGA 4NASA 2OZSA 2BE7D 4DPTA 2DNZA 1TTHB 3VENA 3N5FA 3QNNA 3V4IB 2J7KA 4ILMA 2HFNA 2GC8A 3DM2A 4GVLA 1S72S 2IGIA 3CUNA 4ZJQA 1X5TA 3QT7A 4BQZA 3MN9A 4CZMA 4EZ6A 3FRYA 4NLXA 3C3LA 3UKUB 2GVZB 2D74B 1IQTA 4H0OA 2E1CA 4V19J 2I38A 2CQ0A 3L7PA 2OPPA 3TU5A 9RUBA 2KW4A 1U47A 1EO1A 4X62J 1JLCA 2XY8A 3G82A 1UFKA 3HVTA 3VEXA 1BUPA 2IVOA 5DG7A 1MSWD 3R2DJ 4DR3J 5AFUH 3AY0A 2YKAA 3HT0A 4PHTX 2QKBA 1KQGB 4JS5A 4RBUA 4FLWA 3O4NA 3V81B 4LF4F 4G1IA 3QO9B 3H4BA 3GFYA 3AVNA 2HAFA 1Y0HA 1VQSA 5CZ1A 4I64A 4U7CA 4FBUA 2GIRA 2KFNA 4WFAQ 2C3YA 1RDBA 2I1RA 4IZ9A 2FHMA 3H1QA 4A2BA 1HBMA 4IDKB 3KLVA 1ESVA 1JB0C 1LW0B 4PG4A 3GE9A 3GYXB 2OZMA 3CDBA 5GIPA 3S41A 5IT4A 2WOMB 3VQAA 1FJEB 1KBRA 2O3DA 2MB0B 3N79A 3DI6B 5FDLA 4MIBA 3HI0A 2CQ1A 2KI2A 1VQ6S 2A5XA 3K9KA 1DTTA 3M1VA 1U49A 4I6YA 2JVRA 4NLYA 1UJ5A 4CW7B 4FCYA 3NGKA 2ACMA 2WK4A 4OI0A 3M6UA 2A2CA 2F1FA 3ZZ0A 1YVNA 4HWIA 2HQFA 3UPFA 4J2BA 2YNIA 5LMNF 4G6VB 1KFSA 4BG9A 2YVSA 4OX8A 4V19X 3NGZA 4M3ZA 2MKCA 2F4VF 3MM5A 2BE2B 1RWOB 3P96A 3PZPA 1VR6A 3IC1A 1NM2A 2ALZA 4DQSA 1YSJA 3L3UA 2J9CA 1WN7A 1A6LA 3UVJA 3WXKA 4P2SA 1SV5A 2IYIA 4DV5F 3LOUA 2YKNA 2NRZA 3KK2A 5KFSA 2DCLA 4F9OA 3I4HX 2BJ1A 3NWRA 2CJ9A 3RJMB 2HAIA 3CCZA 2RF2A 3CJ3A 2CVIA 1HR0J 1QZ5A 3C65A 4NXNJ 5L1KA 1W7AA 3AOBA 3AA5X 2KH9A 4CHQA 3EGVA 1U24A 1RTJA 2C2EA 3NLCA 4B1UB 1X1PA 4B3TJ 3BS9A 2CAJA 3C15B 4KTWA 3EGZA 4IH6A 1EHWA 1JLFA 4YNQA 1NOZA 4K59A 5L9NA 3ITHB 3JXOA 1RCXB 1FK9A 3TTFA 3IBWA 1ATNA 3MPYA 4F0KA 3GR1A 4RO0A 2JFDA 2GUIA 1MA9B 5ETNA 3RWUA 1HHTP 3ZXWA 2DR6A 2MKJA 3ZZPA 3G96A 4FW1A 2R9LA 5KFBA 3M30A 2PT0A 4BQLA 3MX2A 3PX0A 2HVEA 1NH7A 5AT1B 3ISNC 3HRGA 1Q7YT 3O6QA 1RTHA 3DOLB 3I5BA 1ZZFA 4YR2A 2DJWA 3MCSA 1N48A 3CJ0A 4NPOA 3HSCA 1A0OB 1RAFB 4ID1A 1N33K 3QNOA 1LWEB 5FPMA 3OR1A 4KGVB 3OW2M 1QSYA 1WACA 1VRQC 2IIHA 2Z58B 1DQ8A 2EPIA 3IWNC 3HZ6A 1CLQA 1VQ4N 2QA2A 2OFHX 1X7VA 5JVGL 4ICLB 2XYGB 4K8RA 4CIFA 3M8QA 3ULHA 4RJVA 2JEFA 2HVHA 4QWAA 5FPEA 3FC9A 2D69A 2HWTA 3A3OB 2AJ0A 4RW8A 1XJWB 3FBBA 2BXJA 5HLFA 2XMWA 2COLA 3PM9A 2RIJA 1GEHA 4ENOA 3E2EA 3CI5A 2LDYA 5IOLA 1D8YA 1N5YA 1XR7A 1HWLA 2CJXB 3R5GA 5AQNA 3UKRA 4YR3A 1RHQB 3EX7B 3PJXA 5IT9O 3NL0A 5LSRA 3PUFA 2R3VA 3C6TB 1X9JA 4EHTA 4IRCA 1FE0A 4EP5A 1PJ6A 3T5KA 2VG7B 2HHQA 3RZAA 4X64F 2HWHA 3NEKA 4BCAA 4BBYA 4DV5K 3KKSA 1EQYA 1U1KA 4CYUA 2Z2LA 3SDEB 2YKQA 2K2PA 2VPZB 3AVIA 4JI2F 3W1YC 4KTZA 3K5MA 3ENAA 1BA0A 3K7RA 4F4XA 1WI8A 2ZZMA 4IFYB 4HUFA 3RTVA 3VEWA 1NGIA 1KWMA 3N6MA 2IM1A 2H3GX 2CQDA 2VJVA 3P38A 5L39A 5CCLA 2H3EB 3AARA 4BRHA 3CIZA 3SNNA 4LFAF 5DDRC 5KFRA 4DN0A 2UXBF 4Y2IA 3W5YA 1JIHA 2D5RA 4OYXA 1T6DA 1WSRA 2BE9B 2F8EX 3HOSA 1B0PA 1T8EA 4BRAA 2FSKA 2OANA 4ANCA 4XH1A 2V8DA 3EKUA 3GBTA 3T19A 1Q5VA 4ZCMA 4TU7A 3LTOA 3LP2B 5LJ5Y 2C3OA 4R0JA 4GKJF 2KJWA 3CD7A 1IBKF 2ATQA 2G8UA 2OJ3A 2D0OA 1K0VA 2CPZA 2R7XA 3I33A 4EP4A 1SQKA 1VSLA 2KN4A 1WOOA 4BGBA 1RT4A 3TI0A 4ZPVR 1GTHA 4ZVHA 3ZCMA 2H5JB 3FCVA 6FDRA 1U02A 1CJTA 3B6PA 5KT7A 3VAFA 2EBEA 5GAGU 1C1BA 3EZUA 4E2FB 5BR8K 4P75A 4PQUA 4DU8A 4B1VA 4B3SJ 2PBDA 3WUHA 4BRLA 3SQGA 2MQQA 5B08A 5HMXA 3UN2A 2BANB 3PLAA 2P6TA 3JQJA 1U1PA 2HBKA 2A3ZA 4KE5A 4IO9Q 1SH0A 3FZLA 4CZGA 3BZCA 1K47A 1UWBB 2MSSA 3DOMA 2RE2A 2LXIA 4B9MA 2QFJA 1Q86O 3MURP 1P27B 4DV4F 5LM7E 2ZC3A 1CJUA 3FQKA 2CADA 2IDLA 3G71N 1WUAA 1FRXA 2P9GA 4OI2A 3KMSA 1AW0A 4OKJA 5ADXH 4FPBA 2YQ1A 1U1QA 4CTAB 3MM9B 1JLAA 3SJHA 1P8GA 2QEXN 2IFXA 4OZ2A 2F9JA 1IKXA 5BPMA 4DV1J 4WZQA 1F3FA 2NSBA 4ED2A 1FW6A 2ZITA 4M63A 1D5AA 4GVBB 4OZ1A 1APSA 1J9AA 1M5PC 1IKYB 3QLHA 1SKWA 4CI6A 3QMLA 2GHWA 4KV8B 1Z2ZA 4CHYA 3WEEA 4J2DA 1GOBA 2LLZA 2HFSA 3D45A 4DBQA 3K89A 1S97A 4U6PA 1I94K 2HFOA 2CQIA 2K3KA 3RBDA 5HI7A 4ZCKA 4CGGA 3BB5A 2YXLA 3S3NA 4Q2LA 1U0HB 1NGFA 2LKZA 1D9AA 2DR5A 4CK2A 2KT2A 4MDBA 3IAM9 1RTDB 2R42A 3D1HA 2ZM6J 3CEDA 1FEEA 2ZOMA 2HHHK 1HI0P 1Y5IB 3KJFB 1QUVA 1OQ6A 2W9CA 5AR0A 2UUBJ 4A8FA 1S10A 1DRZA 2GELA 2J5AA 3PDNA 4DHVA 3NGDA 3QSYB 4U7UK 4O0IA 4NOHA 3T5JA 2YNFB 3TAEA 2P8IA 1ATSA 3HHNB 2V8PA 1X4AA 3PW7A 3PW4A 4OGEA 4GV9A 1XR6A 2PFDA 3LP1A 3M8RA 2QXLA 2E1RA 4BE1A 4BVOA 4LVNP 4I68A 4JOUA 3MOJB 4LH5A 5IWAF 2KKHA 2IJNA 3LAKA 3SMZA 3QJPA 1YIJS 3SBTA 4CBWA 2ZD1A 4NXMK 1FHTA 1M5OC 4R5PA 3TX8A 9ATCB 3UN5A 4FNIA 5HL7Q 3CULA 3VR1A 1X5SA 5HJYA 5AE1A 1NJWA 3ZYYX 4DR1J 4NYPA 2E5JA 3GZ7A 2VQFF 2RKIB 4HT5A 1VQNS 1K8KB 4DUZJ 4ECSA 1EKEA 1VLYA 5AQWA 1RWPB 4JP8A 3CCEN 4CHOA 1VC0A 4C0HA 4A8SA 2C22A 4WU2A 2XMUA 1H98A 2Z8QA 4ZN3A 3GJQB 3LDLA 3KK3B 1RT5A 3QGGA 3HTVA 3E3XA 3C94A 4G65A 3LM2A 4IQMA 4ZPDA 4W5RA 2YWFA 4NCGA 5F8NA 5ELZA 3OR2A 1IBMJ 1Q8IA 4KI6A 1Z05A 4DV3F 1YITN 2DXDA 5EX5A 1YXQA 2FJBB 4KHQA 2V8VA 5HATA 1UL3A 1OS5A 4Y2CA 3HSGA 3HP6A 2F40A 4CT9A 4GMJB 2J8AA 3EM1A 4NLPA 4DV0J 3S01A 1VQ5S 4DF8A 1K73T 4DR6F 3MM8B 5AXNA 2R8JA 5DG8A 2EFQA 4CE9A 5MLCQ 4KGKA 4P6QA 5F9NA 3L4IA 4ZLNA 3CC7N 1G4CA 2IRXA 3K8WA 3MAHA 3FBEA 2XZWA 3CCQS 3KHYA 4NCAA 5J2MA 1T44A 2FTRA 1VBYA 2Z57B 2DRDA 4OZ0A 4ED4A 1ZM2A 1I51B 5DQHA 5JMNA 2RQCA 1ACMB 1VQPS 4DV2K 2LQ5A 1T7PA 1NBWA 2FGCA 2E6LA 1IR1A 2C2ZB 2ZNYA 4R25A 3O9RA 5KFHA 3OV7A 4J9NA 3CDAA 5A8KB 2CJQA 2C2DA 3A8KA 5E33A 3OYKA 2DNMA 1ROFA 2MKSA 1W2BM 2WBRA 3FK4A 4K4YA 1Z26A 4X4VA 1J5EF 1WNSA 3N9UC 2NXUA 1NK9A 2GW8A 2M2BA 2V4JA 4WFNQ 1Z2LA 4A47A 1AUDA 1FRKA 3LF0A 1R3NA 2YJFA 4MYTA 2Z1JA 4F4ZA 3GILA 1IUJA 4KH4A 5HRRA 3CFRA 4ZJOA 1UAWA 2AX0A 2O1PA 1Y9OA 2UUWA 1QY7A 5RUBA 1I6JA 3C6HA 4AHTA 5B09A 1NNEA 4IJNA 4H8KA 2HNDA 1L3UA 2PMHA 3K5OA 2NUBA 4CF2A 3GIMA 2ZH8A 4OJRA 3UN3A 3QZ7A 4ID8A 1TKTA 3NOGA 2HK2A 3FUYA 3LPYA 4LRAA 4YB7A 1B7YB 3HFZB 1FI4A 3ZT0A 2DTJA 1T3OA 1C0TA 4ED1A 4H4OB 2MZRA 4FZVA 3MECA 1WHXA 1S1TA 4W5QA 2ZE2B 1HQUA 2DNGA 1T3NA 2UUTA 2XNQA 3JS6A 4Y1DA 4FL9A 2PSZA 3RBZA 2QA4G 3ZZYA 3QMQA 1LWCB 1R43A 4JI1F 4AM7A 4J91A 5DM7L 1SJ1A 1TL7A 2CGLA 1KVBA 4C11A 2GX9A 3DDKA 3TNVA 3ETOA 4CJRA 3KUEA 3KK1A 3PR4A 3KIOA 5D3GB 2HHPA 3MPUB 4ERDA 3E9LA 2GWJA 4CJLA 1M90O 4JV5F 4QU7A 3ZSWA 2G0IA 1ZBSA 3VGKA 1J27A 4WP8A 3DXMA 4JI6J 3LP0A 2VQEF 4E1NA 2W4DA 3CCRN 3CJSA 4PKGA 4JV1A 4X4RA 2DGOA 8RUCA 3DXBA 2I9SA 4ED7A 4RNOA 2MXYA 2E5GA 1CC8A 4ZHRA 4CBXA 2FJWA 3CJKB 2X3DA 3V6KA 2WAQD 1V4TA 4KJIA 2CQCA 1UW9A 2W9AA 3CPWR 4LIRA 2N3OA 3RRGA 3VF2A 5GADP 3D2FA 5HVHA 2G2OA 4USJC 4DCJB 4FS2A 4B02A 4B3RK 1RAIB 1LW2A 4DUYJ 2DNOA 2E2NA 1V3ZA 4CIEA 5I3UA 3G6EN 1NJYA 3MR6A 3D6TB 5EOYA 3CCVN 1YHQN 2YPYA 2HNZA 1BI4A 3OBYA 1C4CA 3UWTA 1FRLA 1T9TA 1EWQA 4J9KA 1DFDA 1PAUB 1XNRF 3BKUA 2HFVA 3ET6A 5GAHP 2DNQA 5H9EK 2UXCF 4CERA 1YGYA 5IS2A 2XY7A 2KVIA 5CH7B 3IXQA 4Y2MA 1JLBA 4E1MA 1UVMA 4WFZA 4M5HA 1TKXA 3EDRB 2P9SA 3AA3A 4HVJA 4CLKA 3VAIA 4EAHD 4NMLA 1HYZA 1A5XA 1VQ7S 4FF1A 1X5PA 2IOCA 4B3MK 2I5JB 1MWYA 1QJHA 4YFUA 2P9UA 1L3VA 8ATCB 5FLXO 4C8ZA 5HROA 4YHHF 5KFVA 1YLXA 3OTOJ 1KVAA 2E1YA 2ZBPA 2J7WA 3OYBA 2LQ9A 2RHSB 4QIVA 4GVMA 1E4FT 2DGVA 3K5PA 4YR0A 4LBIA 4JI8K 3R1LA 3ISND 3MHYA 3THXA 2MZ1A 5EUHA 1QE1B 3DXKA 3CNQP 3J7YP 4OPJA 4YUDA 2WTUA 2OLWA 4DR4F 1RZMA 4UOGA 4E7IA 3JSMA 2LU2A 3LO3A 1UVKA 4PAAA 5HP1B 4PG5A 3R9PA 1REVA 4E19A 2VQEK 3NH0A 1SUQB 3WQTA 3KXDA 4DCOB 4C97A 2Q6CA 3VQ4A 5DLFA 4RW6A 2W4PA 2O8BB 3VERA 1DQAA 4DJBA 5IV4A 3GV8B 1WSJA 1LK5A 3ZNUA 1TV6B 4UZCA 3HK2A 2MMYA 2QWQA 3BGLA 3FZHA 3FDSA 3O4WA 4FLXA 4QW8A 4HYKA 1P8ZA 2HEKA 4KHMA 4OPKA 4JK7A 2G8IA 2UUCK 1DHMA 1SI9A 3T1HK 2PMZD 5KFOA 4N5SA 1J6ZA 4FO0A 2R2SA 5IV3A 2MLZA 4IG0A 1FKOA 4ALZA 3DRRA 3AO3A 4MQ3A 3M2VB 2H4YB 3TAMA 4H0YB 4B3OA 2ILYA 3KDOA 4HTLA 2Q0RA 1ZA1B 2UXDK 4OHZA 2R7RA 4CFCA 2D1CA 1S1WA 2R2TA 2IPOB 1HPZA 2HHSA 2ASDA 5CYMB 5BPNA 4X62F 4IFEA 1YJ7A 4I69A 2PGCA 3WZ0A 3CCMS 3WX4A 1HWIA 4AHRA 4CEOA 2AT1B 4MK8A 3GJSB 2IC3A 5F0WA 2DGXA 5D4OA 2QA4N 2O8CB 2VGNA 1EKRA 4KB7A 3GOIA 1FO1A 2VG5A 2Y1IA 4QWEA 2MQOA 2WFBA 2BOAA 5IC4B 4DTXA 2DXEA 3GIIA 1HBUA 1C0UB 1JLGB 4KH0B 3ZT2A 4OO1J 1NMNA 1X5OA 1U7LA 1JLQA 2J9DA 1QQNA 1GOCA 2I8EA 2N4DA 5BRFA 1EIYB 3AVJA 2FYXA 2E88A 4CF9A 1MWQA 3BSOA 5F41A 1XTZA 4JI3K 4FVUA 2HQIA 2N7CA 3TAQA 1HJOA 4FLYA 4N56A 4CLYA 4C23A 1ELOA 2G2YA 2M70A 3V9SA 2LMIA 2XGQA 2RRAA 4DTRA 2B5JB 1HNVA 1BC6A 2W24A 2JGUA 3MXMA 1WNEA 5KGXA 3HULA 2W2MP 5K8PA 3VVTA 1H73A 4JBCA 1WB9A 3KWIA 3H4DA 2QL9B 5BN8A 1S1VA 3F9MA 5K20B 2LQBA 2DNPA 4H5WA 2FHJA 3KLFA 3UD5A 3MMCB 2AYMA 1FJGJ 3HLUA 4K4SA 2DFFA 2MJUA 2E6MA 1UPMB 1GMWD 1YJUA 3TTDA 2IA6A 4YORA 3G86A 5HOOA 2GEMA 5JICA 4DL5A 3GONA 4ZLLA 1KDNA 2IAJB 4LF7J 2DEIA 3P5JA 3RB4A 3CSKA 4KIAA 3E9PA 5L1IA 3IBCB 3TVKA 4H4MA 1ZAWA 2YNGA 1BQMA 4Q0BB 1CPZA 3OXLA 1HR0F 2XHBA 4NXNF 3ZETA 1KLNA 3VWSA 3JQKA 2ZJQQ 3G8SA 1VJQA 2PDAA 1U4BA 1NZ8A 1TL1A 4HHTA 3BQ2A 4JYAK 5EWFA 1AZSA 2E2PA 4B3TF 1CS4A 4RUAA 5EXWA 1LXJA 2XSJA 5CZVA 5DLGA 2JEIA 1RAJA 1C1CB 1CG2A 2VFUA 2AX1A 3NY0A 5IC6B 1SH2A 4P52A 3C14A 2HFZA 4DU7A 1R0AB 1O5JA 3MXJA 1LAVA 2DR8A 4Z0UA 2ETJA 1WC3A 2XTJP 1XHZA 3PW5A 2DNHA 1CQNA 5HMZA 3RB3A 4URQU 2WSFC 1SQEA 2JHEA 2BJ9A 4U67L 1HKBA 1WAJA 1PAEX 3P8BB 2HVIA 5E3QA 3I0RB 1GTEA 4C8OA 2J0XA 3ZO7A 3CJRA 1FFWB 1JQGA 2PFUA 4FZZA 5AQTA 4HHJA 3WDOA 2UUAJ 4OX9K 1B0VA 4IH7A 3NCRA 1BCMA 3VGSA 3CJ2A 4PXDA 3PO4A 3IGVA 1RACB 4HDHA 3THPA 2RU3A 1G15A 3BJYA 1YJTA 3H0PA 5LMUK 3PSFA 4RR5A 4Z7CA 3WXIA 5DRKA 4G1QB 3AVFA 4PR6A 3FZ2A 4WP3A 1QVFR 5KG1A 2R8GA 2QWPA 4ISEA 2DRBA 1Q78A 4QW9A 2BV3A 1VBKA 4L76A 1NHKL 5I3PA 5JVHL 3X3UA 1UCNA 3PY8A 3KLGA 1J5OB 1BY9A 2R2RA 3LDSA 4O44A 3MI7X 1UA0A 1OY6A 2IIRA 3IR7B 1FFGB 2HW3A 4YDUA 4QYRA 3VPZA 2NRWA 1F5BA 4M5MA 2B4UA 1RBSA 1NO8A 4DQ8A 3C2PA 2VA3A 5AQRA 2MGZB 2YKMA 3G87A 1KD1O 1NKBA 3CD5A 5KFQA 2G2ZA 5TKWA 2E1PA 2V63A 1QVGR 5CD4A 2AV5A 3JYTB 1IN0A 2HMIB 3W2VA 2C1EB 1RT6B 3PYFA 3SQOP 3VQ9A 3QT5A 1YI2S 3NH2A 3J80O 3UR0A 3V5RA 4CFAA 3AVHA 4O3SA 3UQSA 3R1HA 2F9TA 4YOXA 1GK8A 2BKOA 3E8OA 1TFYA 3DLKA 2EC2A 1C0MA 4PABA 1Q18A 2QV6A 2O4IA 3OYIA 1YJVA 3AJ1A 3KDNA 4CO1A 3RBXA 4LFCJ 1U1NA 2AU0A 1ZBFA 3GV7B 4NMXA 2Q0UA 1FVQA 4RU2A 3AD7C 4ZP8A 2GS8A 1WSVA 1F2HA 3OVBA 1PYTA 3SCLE 2AGQA 1KAXA 3AAWB 1RBTA 1RTIB 1FNXH 3CC4S 1IWGA 1HMVB 5L46A 1EKSA 2OCEA 3UR3C 2QL7B 4G9ZA 2I0XA 5I4MA 1Q86T 2WBNA 3OYNA 4XDCA 4PUOB 2OHDA 2GVDA 1WC4A 2OI2A 3VTIA 4ZTJA 2VIHA 3VQ6A 1T9WA 4MFBA 2RB7A 3L09A 2NZCA 3CDUA 2LSNA 1G99A 5IXUA 1M1KT 3LPUA 3OFEA 4IUFA 2E1MC 4B3SF 3V2UC 2BQ3A 1S1XA 3MAAB 4CEAA 4NRTA 4FJ7A 2PD1A 3PIOQ 4QJVA 3OFFA 3NXZA 1RP5A 1VLOA 2AA4A 3AQPA 1B64A 2ZZNA 3QIPA 2DPIA 1XC9A 1L3TA 5KTQA 2FJXA 4TY8A 1NMEB 1JXBA 3SBMA 3P3DA 3I31A 1BIZA 3VESA 2LQJA 3JS9A 3LGHA 2PI4A 4BG8A 1NGEA 4C1NI 4KHNA 3CW2C 3O1WA 3VEOA 1ZOTA 2L48A 5C24B 1UPPA 4FWLA 5GAEI 3E9OA 3D5MA 1BHLA 2FSJA 2MLXA 3GJRB 1GLBG 1NH8A 1HQEB 4FOIA 1YITS 3NAIA 5CYQB 3GMGA 2MJNA 2VICA 2V7ZA 1UEKA 4WF9Q 2B9WA 3ENVA 4N76A 4Q44A 3JSYA 1P6TA 1HKCA 2YCHA 3TWZA 4UT4A 4DV7K 2XMTA 2W2OP 4M41A 4F3OA 2ZM6F 4CGHA 1KLMA 4A5AA 1WG4A 2W4CA 3HVRA 2KYZA 2DPJA 1D4XA 1Q79A 2P9IB 3SI8A 3QRRA 4UY8O 5AQZA 3EKSA 2UUBF 3CJ9A 1R8PA 1UMJA 1FWLA 1QUPA 4IG3B 2VPYB 3C8YA 1T11A 1VQKN 5IT9U 2YTCA 3LALA 5KG4A 1GNKA 4FYWB 4DSIA 4ZOSA 3TUPA 4J9RA 3LQVA 3RUBL 4AILC 4YOYA 1FEHA 3Q8RB 3CM5A 1E6VB 1IM4A 2HQCA 1NSQA 2N3LA 3KMQA 1P90A 4BRCA 2JC1A 3GTYX 1SL1A 2DEJA 5C25B 2O8DB 5CQGA 3QBCA 4DR1F 1N33J 3A5MC 4LF9K 3RRKA 4BRDA 4O4GA 2OP5A 2P9KA 4RTFD 4DUZF 1WEYA 1NPRA 4IO1A 3GCXP 2BW2A 1F9FA 3R6GB 4ZITA 1QZ6A 1ZM3A 2F9DA 3W62A 4QR2A 4JK8A 5I3QA 2BJ3A 2CH6A 4FPRA 2FY1A 3SQ4A 2XS2A 4FSVA 4I7FB 1JX4A 3GFXA 4HI2A 2P9LA 2NLXA 3WIVA 1NK4A 3KTQA 4B9TA 4RBVA 2LYVA 2IM2A 2FC8A 2OKQA 2DXFA 1IBMF 2EFVA 3EDQB 2ASOA 4C98A 3LPEA 1EP4B 3THYA 2U2FA 2DGTA 3T9ZA 4BWJA 5CYJA 2E5LK 2LECA 3KHGA 4IR9A 3AV9A 3UKUA 3KKFA 2NUHA 2BW7A