1TKTA

Crystal structure of hiv-1 reverse transcriptase in complex with gw426318
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
534
structure length
515
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Pol polyproteins [Reverse transcriptase], Chain A
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 135
structure length 515
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tktA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tktA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tktA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tktA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tktA05
1RT4B 2C22A 2W9BA 3GV8B 1NJWA 1N5YA 2OZSA 1HJRA 2IA6A 3CDEA 2HHVA 1ITGA 4PA1A 1RTDA 3UIQA 4J9SA 3C6UB 4OKKA 2GV9A 1BHLA 2KZZA 1KSPA 2HHWA 3O4QA 1TK0A 4QWCA 5KT3A 5HROA 4URQU 1VRUB 5KFPA 5KFNA 4IR1A 2HHUA 2E6MA 1KVBA 5D3GB 1JIHA 3RRGA 3KHLA 1S1TB 4ZVGA 3NGIA 1RT1A 4I2QA 1LWEA 3KK2B 4QWBA 4PUOA 4RNNA 1JLEB 4ED7A 3AVMA 1VSEA 5HRNA 3FDSA 4RUCA 1JLBB 3U3YA 1VRTA 4ELUA 4TQSA 1WAJA 3MEDB 5EWFA 4ECWA 4NLXA 3DM2A 4IFVA 3I5BA 2XRIA 1ZBLA 1BI4A 3RMDA 3U3GA 1RT2B 3NBPB 4PQUB 3HP9A 3K5MA 1EX4A 2DPIA 1CLQA 4CEBA 2G8WA 4NLPA 4J2DA 2AX0A 2XY7A 1TQLA 2HNZB 2BQRA 4EZ9A 2I5JB 5FDLA 3KD1E 3ZSOA 1WN7A 2HNDA 3LZIA 2DFEA 4DEZA 4IR9A 1I39A 1HQUB 4ID5B 1XC9A 2ASJA 3L3UA 4IRCA 3CFOA 3OYEA 3KHHA 2F96A 1WNSA 5L1LA 3TVKA 5HBMB 4HKQA 1T94A 4CIGA 1S49A 3AVJA 4M95A 3BGRA 1LWFB 3HVAA 4QAGA 3MFIA 5KFXA 3QGIA 3CIZA 3H4BA 3NDKA 5HLFA 2WHOA 5J2NB 2XCPA 3V9ZA 1SUQA 1J9AA 1L3SA 4ECRA 3AVAA 2HMIB 4RNMA 4BWJA 1GOCA 5J2QB 3ZSXA 4KAIA 1CSJA 4AH9A 3RBDA 3QEIA 4M41A 3L2QA 4HHTA 3QYYA 4ED8A 3ZSYA 4ED3A 3C6TA 2R7YA 4ZTJA 1EETB 1HQEA 4BDZA 1TL1B 2XY8A 4FJLA 4TSXA 4E7JA 5F8JA 3V6KA 1C1BB 1DTQA 1C6VA 3SV4A 4DQSA 3V6JA 3DMJA 3TAFA 2Z1JA 2BE2A 5KFQA 1ZBFA 1VSDA 3VA0A 5J1EB 1GOAA 1S5JA 4TY8A 2YNIB 4ECYA 3KNAA 4LSLA 2B5JB 3ZT1A 4NLWA 4CF2A 2HB5A 3V9UA 1S1WA 2IM2A 4IFYA 3V4IB 2GBZA 4RW7B 4KTZA 3B6PA 3NF8A 1RAJA 4M3YA 4GC7A 1YTAA 3PW7A 4DSLA 3I5AA 2HVIA 3THVA 3GV7B 2I1RA 3QEPA 3CWJA 4QW8A 1FKOA 2Y1IA 2CJQA 4KTWA 1RBSA 3N6MA 4DSKA 3WNGA 4NCAA 3AVBA 4JS5A 5KT4A 3LPUA 4F4XA 4ZVEA 4NYNA 2FJWA 1J53A 2HWHA 4FLZA 3SQ1A 2IGIA 1S6PB 3T1AA 3K5NA 1BGXT 3CFPA 2C2EA 3NF9A 4HVJA 4OGCA 4I9QA 1NHUA 1XR6A 2FLNA 3OJUA 3D0PA 1HYZA 3OYIA 3SPZA 2X6NA 5DG7A 3NAHA 5HP1B 2ITGA 3V9XA 3NH0A 4MH8A 4WXOA 2VG5B 4CIEA 4CJEA 3RBEA 1Z26A 2YNFA 1WSIA 4ED0A 3SJJA 4AILC 1VK0A 4K4WA 2V0NA 3TANA 3IS9B 2W9BB 1RTHA 3SUQA 2ATQA 1RTDB 1K1SA 4CFDA 4OPJA 3TR8A 4MIAA 3P1GA 4KHYA 3QETA 2FVCA 3KJVA 3RTVA 1HRHA 1JLGA 3N6LA 4K4VA 3KMQA 3HT3A 1XR7A 1QTMA 2F8SA 4ED1A 3P5JA 4YNQA 3BSCA 3RB4A 2IM0A 1SH0A 1KHWA 1RT1B 4AHSA 5KRTA 1LWEB 4IG0A 3CYMA 4YR3A 1BCOA 1VRTB 4KFBA 4FJGA 3ISND 5KG1A 4K4UA 4ED2A 4DQPA 3DM2B 3NL0A 4JS4A 4FVMA 4J9NA 1BI4B 4XPEA 3HPGA 1ZTTA 4CEFA 3NCIA 1UA1A 3LP0A 4CHYA 4FW1A 3WNHA 3S3NA 3A2FA 5F8NA 3AO5A 4Q8FA 2E9ZA 4KHSA 1RYSA 3VQ7A 2XGPA 4CGJA 5FDLB 2HNDB 4WFYA 2B4JA 1N6QA 4ZP7A 4TY9A 1XHXA 1WSHA 3DRSA 1RTIA 3T5HA 2YNHB 5C25A 3MR2A 3EPGA 2PY5A 3ZSQA 4JV0A 1U48A 4DTNA 3BGRB 4O3OA 5KFYA 3ULDA 4FJ5A 2PYLA 3QEVA 1IM4A 4CJUA 4DWIA 1RT7A 1CZ9A 2Q3SA 4ECQA 5HLFB 5EUHA 4WFZA 4DU1A 3CJ3A 3ASMA 4KBIA 3QIDA 4E1NA 3AA5X 4FZYA 3QEXA 3OYKA 2ZE2B 4XIUA 3L2WA 1YVFA 4FXDA 4FZZA 5C5JA 3BSAA 5D3GA 2FJVA 1S1TA 3CJ5A 4B9LA 1R0AB 1FXXA 4Q0BB 4DS4A 2BDPA 1HPZB 3KK2A 1JLEA 3T19A 3T5LA 1TK8A 5KFHA 2YKMB 4NLUA 4IRDA 3C6TB 4Y2AA 3GILA 4EEYA 3CM6A 4DL7A 4NYFA 5KFOA 1U04A 1HQEB 4NLGA 3QIPA 4B8CA 3QEWA 4ZP8A 5L9XA 2Z1HA 1G15A 4KI6A 4Z4EA 3NBPA 2FLPA 1SV5A 3OYAA 3DMJB 3HL8A 2JLEA 4FS2A 2OPRA 4K4SA 4KKOA 3NHGA 3FFIB 2HNZA 3KLGB 3KHGA 2I5JA 1TAUA 3OL8A 2AWZA 3OYGA 3MR6A 4LSLB 4KB0A 4IKFA 1BIZA 4KHWA 4IFYB 4NLVA 3LWLA 4K4XA 2W7OA 3V1OA 2G8VA 3ZSRA 1EP4A 2JEGA 4JUZA 4ZPBA 1FKOB 5L1IA 4RUAA 4JV2A 3OYFA 1BL3A 1S0NA 4I7FA 1D8YA 3DLGB 1Z4UA 3KLEB 5F8GA 1UOCA 1LW0A 3BQ2A 1TP7A 2G8HA 4CFCA 2EHGA 3OLBA 5J2NA 3SFUA 1HNIB 1QAIA 3QERA 3VQQA 3IN5A 3EZ5A 1S1UA 2J6SA 2R8GA 3AVFA 4OJRA 1QSLA 4MK9A 4Y2CA 4DTJA 3NAIA 4C8MA 2HHTA 4B9NA 3F9KA 2UVRA 1JLFB 3M9OB 2RN2A 3VQCA 4FLYA 3ZT0A 4QW9A 1YTUA 5KFLA 2JGUA 1RTHB 1C1BA 2FLLA 4DMNA 4TYBA 3AA2A 1BCMA 2Y1JA 4QWDA 3TQ1A 1X9WA 4CJKA 3AVCA 3NKYA 3G10A 1KLMA 2G8FA 4O3SA 2YNIA 2FC0A 1KTQA 5C24B 1IKXB 1X9MA 3CM5A 2V9WA 1LAWA 3TAPA 1TKTB 2ASDA 1HARA 2W8KA 4FK2A 2C2DA 1CZBA 4RW4A 4IG0B 4KV8A 5JS2A 4KFBB 1C1AA 3PHEA 4TXSA 4CJFA 2WTFA 3SQ2A 3HKWA 4FW2A 3K5LA 4U7CA 2AX1A 3LP0B 5KFMA 3HPOA 5KG7A 5KG2A 1ASWA 3BQ0A 4E7IA 2GUIA 5DMRA 1C2PA 4EYIB 4ZPCA 1L3UA 3PR4A 1U09A 1T03B 3Q8PB 1BIUA 2WOMB 2WONB 4Z4FA 3S3MA 4B9VA 3QNOA 4YR0A 4F3TA 4EO8A 1RTIB 3TAEA 3KLHA 1RBVA 3HVTA 5C25B 5CYMB 3QZ7A 4F4YA 3MR5A 3V9WA 4ECXA 4FJXA 4BWMA 4CF8A 3IS9A 2R8IA 1TAQA 4DTSA 2KFZA 3MECA 3HSTB 4RW8B 4NLTA 2R8HA 3G86A 4IOBA 3LP2B 3OSPA 1RT7B 4TLRA 4U6PA 3GIIA 1L5UA 4X2BA 2YKNA 4IKAA 4Q5VA 4DSJA 1IO2A 1RNHA 4NZ0A 1DLOB 4FJKA 3EPIA 1TKDA 4EBDA 4YQWA 4WE1A 4K4ZA 1T3NA 1W25A 2W8LA 3EYZA 3TARA 2VWKA 5DLFA 3ZT4A 1RT6B 3QIPB 4AHRA 3HM9A 4FJMA 4M3TA 1Q9XA 5KT5A 4WYWA 1SV5B 2WB4A 4O4GB 3KLIA 3SUOA 4DTPA 1N4LA 1BISA 2OPRB 4KKOB 1TL3B 1RBRA 3NGZA 3RWUA 1C0MA 1SH2A 4O5BA 3V1RA 2HHQA 3HVRA 1TKZA 3KLFA 1L3TA 3HK2A 4BE1A 4CJRA 4CGIA 3EY1A 1XI1A 2FVRA 1HMVB 4B9TA 3I0SB 4CEZA 3AV9A 2YNHA 1EP4B 4BDPA 4QPXA 1JXEA 3H40A 3ISNC 4QWEA 1Y97A 1IKYA 2IJNA 4NLYA 1VSFA 2KFNA 3SCXA 2VA3A 4N56A 4I7FB 5I42A 2DY4A 4ELVA 4TQRA 4L8RB 4IG3B 4PY5A 1LW0B 4DTOA 1RDDA 4OLAA 3PX6A 1NKCA 4J9RA 3RB6A 3FQKA 1ASVA 2ZE2A 5J2MB 4FJIA 1S9GA 3CDUA 4KRFA 3DRPA 5DQHA 3U6FA 1K6YA 4DFPA 1R0AA 1TGOA 1S1UB 4G3IA 4Q0BA 4Y34A 2GIRA 4RNOA 1HPZA 3BJYA 2FVPA 3WNFA 4DL6A 3L2RA 5HRRA 2YKMA 4H4MA 2VG7B 2IOCA 5KFSA 5DK5A 1NNDA 4MKBA 4LD0A 4DLGA 4AHUA 1EKEA 3RB3A 3BQ1A 2C28A 1JKHA 3UPFA 1RDRA 4TN2A 2X74A 3TAMB 2UVVA 4FJ9A 4NLDA 2IAJA 3LP3A 3FFIA 4ED6A 2XGQA 3KLGA 1KLMB 3HJFA 1RT5A 1GX6A 3AVKA 3OJSA 4DTUA 4YMEA 4CJSA 4RW4B 2D7SA 3AVNA 1CXQA 3PW0A 4J9LA 3DRRA 4IH6A 3PW4A 4K8ZA 4Q45A 4KV8B 5K14B 5F9NA 1RDBA 4R8UA 4WXWA 1D1UA 2B6AB 1REVA 3UDLA 1HNVB 2RKIB 2OPQB 3DI6B 3AVLA 1I3AA 3M9MB 3RMBA 1XR5A 4CGGA 4J2AA 3DLGA 3KOAA 3KLEA 2JC1A 2IMWP 5EWGA 3CJ4A 3NMAA 4CJ5A 3OYBA 4OGEA 1Z25A 4J9QA 4Z4IA 5DG9A 1HNIA 1WSFA 4FS1A 4E3SA 2LSNA 4OVLA 4M94A 3MTKA 2KW4A 3Q8QB 1QSSA 3OS0A 1NHVA 4W5NA 3VQAA 5CYQA 2UUWA 2XI3A 4EO6A 1S6QA 3KLHB 1JLCB 1JLFA 3HVTB 2X78A 3MEEA 3FQLA 4DSEA 3SUNA 3EZUA 4MK8A 4DL3A 2YV0X 3MECB 5KFWA 4B9MA 2FBVA 3VQ6A 3E51A 4KO0B 4J9OA 2CKWA 1ZBIA 1T7PA 1JLQA 1F21A 4FLVA 1S9EB 3KTQA 3MF5A 4CK3A 3H4DA 1QQCA 5KGXA 4CHNA 2YKNB 3DLEA 4YP3A 5C24A 1A5XA 1IKXA 3DOKA 3TWHA 4XO0A 3V6DB 4Q8EA 4Y3CA 3QO9B 1X9SA 1TKTA 1NJYA 4ZP6A 4MK7A 3ZT2A 4FJJA 5KG6A 3SPYA 4DLEA 5DQGA 4IDKA 2QKBA 4K4TA 3C94A 2Z1IA 1C1CA 4AHCA 4WE1B 4E0DA 2ATLA 3AO1A 5FRNA 4DSFA 4DTRA 3D45A 2R2SA 4JRQA 4KPYA 2XHBA 4ZPDA 3KLIB 3T5JA 3AVIA 4Q43A 3LZJA 5JS1A 1KHVA 3LWMA 4NLRA 4CHPA 3DYAB 2BANB 3KKRA 3I0RB 1TKZB 3KLFB 1T03A 2WOMA 4R0EA 1NK9A 1I6JA 4AHVA 2WONA 4CJVA 5KG0A 4OPKA 2E6LA 2FJXA 3AO3A 3L8BA 1IKWA 3E01B 4BE0A 3ZSWA 4J9PA 4IRKA 1LAVA 1NK4A 5CYMA 4F8RA 3V81B 2D5RA 3OYJA 1Q9YA 5DLGA 4OKJA 1IKYB 1UAXA 2F8TA 1X1PA 2EX3A 4RW8A 4ID1A 4LH4A 4GW6A 5I42B 4M3WA 5EU7A 2XWYA 3LP2A 3PW5A 1ASUA 4DSIA 2KTQA 2E9RX 1BQMA 1S9GB 4FLTA 3DRPB 1S1XB 1T05A 4CGHA 4K50A 1WSEA 2D0BA 1DLOA 3ZSVA 4MIBA 4CEAA 3NE6A 3OL7A 4PWDA 3K57A 4H4MB 3IRXB 2O5DA 2UVWA 1LWCA 3GIKA 4CIFA 3T3FA 2E9TA 2NUBA 1RT6A 2XC9A 4AHTA 4O3NA 2OZMA 1ZTWA 1JKHB 1LV5A 4KI4A 4O4GA 3QZ8A 3O4NA 2RDIA 2IAJB 4CJLA 4O0IA 4CHOA 3KD5E 3VA3A 1TL3A 1QHTA 4NCGB 3RRHA 1RT5B 3GV5B 1KVAA 4H54A 1QSYA 3G0ZA 2ZD1A 1KCFA 3IG1B 3VQPA 2HVHA 4CJ4A 3NAEA 2HHSA 2ILZA 1NKBA 4W5RA 1RTJB 1HMVA 3I0SA 3M8QA 3RMCA 5F8LA 2FBTA 3VN5A 5F8IA 3DRRB 3VQ4A 4CCHA 4ELTA 3SYZA 5KI6A 4R8UB 1REVB 1JX4A 1KRPA 5KG5A 2ALZA 3AO4A 1NK5A 1LW2A 4IG3A 3IGVA 3O3GA 1T8EA 2BR0A 4M3ZA 5L1JA 1W0HA 2QV6A 3TAGA 5J2MA 3QGGA 4ECSA 4E1MA 4FZXC 1ZYQA 2ASLA 2IBKA 4EBCA 4ICLB 4TYAA 3PW2A 4J9MA 3VQEA 1O1WA 4I2PB 5CYQB 2DPJA 1QS4A 1S6QB 4LQ9A 1FK9A 4J2BA 2VG7A 2W9CA 1VSHA 5CY4A 2G8IA 3MEEB 4E7LA 3CJ2A 2R8JA 3OVNA 3QLHB 5DG8A 3PX0A 3P83D 5J2PB 1U47A 1GX5A 3HYFA 1VSIA 3OS1A 1RA6A 4ECZA 3DLHA 4ZP9A 1S48A 5KFGA 1RILA 4RNFA 4KHMA 1JLQB 1HYSA 4O3RA 3TAMA 3JSMA 3DOLB 3CJ0A 3V1QA 3VQ5A 2G8KA 3DLEB 2GIQA 3DOKB 3QIOA 3NF7A 1QAJA 1S97A 3TAQA 2QE5A 1QE1A 2JEFA 4KB1A 4NYZA 2J6UA 3OYNA 3KHRA 5KFCA 4IDKB 4DL4A 3S9HA 3DLKA 3QESA 4I9LA 4EBEA 1C1CB 5K14A 3H98A 3PVXA 2B6AA 1U45A 1HNVA 2RKIA 2OPQA 5KFJA 3DI6A 4CF9A 3F73A 2BRKA 1TKXB 1RDAA 4DQRA 3IGNA 1KLNA 1WLJA 3MXMA 4DG1A 1TK5A 1NK0A 2A1RA 5KFIA 3ZCMA 4F4ZA 1U49A 4MQ3A 1RCHA 4KTQA 2R2TA 3Q8RB 1QUVA 5KFAA 4CFAA 4FJ7A 2C2RA 2IC3B 3D5MA 3NGYA 4DL5A 1IKWB 1SL0A 1JLCA 3MEGA 3OYCA 4E89A 2V4QA 3JYTA 2IM1A 4JRPA 4EZ6A 1NK7A 1YT3A 3GIMA 4KO0A 2A1SA 5KFZA 4EP5A 1Q8IA 1N56A 3H08A 2W7PA 4O4RA 3LALA 5T14A 1S9EA 3LAMA 2OPSB 3CQ8A 2W9AA 2JC0A 3AA4A 5FRMA 2UVUA 5I3UA 1BQMB 3PR5B 3V6DA 4CF1A 4KHQA 3QO9A 1T05B 3HPHA 3LAKA 4K8XA 4OLBA 5KFKA 4IQXA 3KK3A 3AA3A 2O4IA 3WNEA 1JL2A 5KFRA 4F4WA 4CK2A 2WRMA 4PWDB 2OYQA 2RDJA 1LWCB 3NF6A 4DU4A 4ZVHA 4M3RA 2FVSA 5C42B 3N6NA 3GIJA 2FBXA 4NLOA 3VQBA 3ICLA 4M45A 3SI6A 2YNGA 3HO1A 3AO2A 4CFBA 2KQ2A 3DYAA 5JXSA 2BANA 2ZD1B 3I0RA 5JUMA 1N48A 3O3FA 2YHBA 4CESA 3PY8A 3SQ4A 4DTXA 3M8QB 3E01A 4RZRA 2AGOA 4NCBA 4ZVFA 5KTQA 3V81A 2P1JA 4GC6A 4NRTA 5DGAA 1SKRA 3BDPA 5EWEA 4DF4A 2XCAA 3CFRA 2GC8A 1LW2B 1EXQA 3LP1A 3VQ8A 4URSA 4N76A 3MXJA 1TV6B 4N47A 4DQIA 2ZKUA 4HYKA 4BACA 3SQ0A 5DGBA 3V9SA 4MKAA 4KHUA 1S1XA 5KFVA 2X6SA 2AGQA 3H5YA 3B6OA 3C95A 4J2EA 4M3XA 1IH7A 1S0MA 4Y1CA 4DU3A 3L3VA 3VQ9A 2VG6B 3M8SA 2J6TA 1FK9B 2BRLA 4KHRA 3IRXA 2RF2B 2W9CB 4CJQA 2AU0A 2VWJA 4FK0A 4MFBA 2O4GA 4CJTA 3KK1A 5SZTA 4RW6B 4IH5A 4FYDA 3BSOA 1K1QA 1HYSB 5KGWA 3JSMB 2YHAA 1IKVA 4CJ3A 4BDYA 1S1VB 1NK8A 1UWBB 4NCGA 1ZBUA 1RDCA 1WAFA 4CEQA 3IG1A 3D28A 4ZTFA 3RAXA 3SNNA 4CERA 1J5OA 1U4BA 1RTJA 1QE1B 4LY7A 3O3HA 2OPPA 3MXIA 1RT3B 3DLKB 4KE5A 4FM1A 5F8MA 4FCYA 1A5WA 3KIOA 4CHQA 4CEOA 2V4RA 2WK4A 4H4OB 1WSGA 3KLVA 1D5AA 5KRSA 4G1QB 3ZT3A 1NJZA 2QXFA 4R5PA 2P51A 4HUFA 3M8PA 3ITHB 3Q8SB 3K58A 1S9FA 3OLAA 3MAQA 3PO4A 4DG1B 4F2SA 2FVQA 3LPTA 4CEDA 5KG3A 2IDOA 1A5VA 5HRPA 1SKSA 3L2UA 2PZSA 3RR8A 3OSNA 4HTUA 3HXMA 4NLQA 4ICLA 4QCLA 2IS3A 3MFHA 4I2PA 4FLUA 2PYJA 4Z0UA 1TVRB 3FSIA 4F50A 5FROA 3MEGB 3RB0A 1SL2A 3KMSA 2IM3A 2XI2A 3PV8A 4O44A 4KHNA 3JYTB 3QLHA 5J2PA 5KT2A 1S0OA 2P5GA 3OYDA 3PUFA 4YFUA 3GQCA 3DLRA 3OYMA 3DOLA 1KFDA 2AJQA 1JLAB 1SH3A 4HUGA 4FLXA 5KT6A 3ZSZA 1S10A 4RW9B 4ECUA 2ZQBA 4NLSA 5I3UB 1N5YB 3IAYA 2HW3A 4FK4A 2HHXA 3LANA 3CVKA 1JXBA 3AVGA 4JV1A 4KSEB 3KK3B 4O0JA 4FJHA 4IBNA 3TI0A 3VQDA 3NGDA 5HROB 3VQSA 4B9SA 3MR3A 3S3OA 4C8OA 4C8LA 3TABA 1FKPA 4FBTA 1TKXA 1VSJA 1C0TA 2VA2A 4CEEA 5DQIA 4I2QB 4B3OA 3LDSA 2YNGB 4PUOB 2D41A 4Y1DA 4YR2A 3BREA 4F2RA 3K59A 4LSNA 3HHKA 1W9HA 3UR0A 3HVWA 2RPIA 1NKEA 1B9DA 4IFVB 3AVHA 4IH7A 2IC3A 1DTTA 1MU2A 4WZMA 1D9FA 1IG9A 5F9LA 3T5KA 4DQQA 4DFKA 2EC0A 2W42A 1KFSA 4FM2A 4CJPA 4ECTA 1KVCA 1B92A 3PJXA 4RNHA 5CZ2A 1SL1A 3G6XA 1VSKA 2DFHA 3SI8A 4OL8A 2HNYA 3DDKA 4EP4A 4ZHRA 1C0UA 5KFEA 3LP1B 2HAIA 4O3QA 3OHBA 1RA7A 3BSNA 2OPSA 2F8EX 3K5OA 2QK9A 3BR9A 2QKKA 1BQNA 4Z4GA 3KKSA 1RT4A 4CE9A 5KFBA 3QINA 2D3UA 3ALYA 2AQ4A 5F8HA 4DFJA 2XY6A 4DL2A 3C6UA 3H2LA 2E4LA 1NOZA 2JEIA 1YVUA 1SUQB 4Q44A 2D0AA 4M3UA 4Z4CA 1VRUA 4QOZB 4MFBB 4LH5A 5L1KA 2BQUA 2BQ3A 3I5CA 3KK1B 4LQ3A 4H8KA 1XWLA 5C42A 4DF8A 4QWAA 3SFGA 3NH1A 3NH2A 4UQGA 4K4YA 4B8AB 4F4KA 4EYHB 3NFAA 2DTUA 1JLBA 4E19A 3OL6A 1IKVB 4CGDA 1SKWA 2D3ZA 3MEDA 4KREA 4ZMMA 4CF0A 4M42A 4Z4HA 1DTQB 1RT2A 4PQUA 4J9KA 1J5OB 3SZ2A 1NJXA 1B9FA 2BE2B 2OPPB 4ZPAA 3K2PA 4W5QA 4TY8B 5KFTA 1MMLA 3CDWA 1NK6A 3CG7A 3QNNA 3RAQA 2FBYA 1S1WB 3OYHA 1HQUA 4ID5A 4R5PB 3M8PB 4KB7A 1OS5A 5KG4A 3OL9A 2KZMA 4FJNA 1TV6A 2OH2A 1WSJA 3CO9A 4O55A 5HRSA 3PX4A 2OA8A 3L2VA 4XPCA 1WNEA 2R2UA 4CGFA 5HBMA 4GMJB 4CJWA 5T7BA 1RBTA 3GYNA 2R2RA 3SV3A 1LWFA 4JLHA 2UUTA 2VG6A 4N41A 3G6VA 4CHZA 5SWMA 2RF2A 3UQSA 4FM0A 4F3OA 4RU9A 4O44B 3OS2A 1UA0A 2HMIA 3RR7A 4ECVA 1XHZA 2HWIA 1HYVA 4N5SA 4RW6A 2B43A 3I8DA 5J2QA 3PO5A 2G8UA 4HCCA 2ILYA 4C8KA 4KAZA 1ZBHA 5EDWA 2YNFB 4GVMA 5CZ1A 4URGA 1S1VA 1UWBA 5KFUA 1EETA 1TL1A 1L3VA 3DLBA 2XY5A 4WFXA 3OY9A 1S4FA 2Z1GA 3HP6A 4B9UA 4DFMA 2XO7A 5E41A 2R8KA 3FRZA 2AGPA 3KJVB 4FBUA 1RT3A 1JLGB 2P5OA 5KFFA 5J1EA 3V6HA 4NRUA 2B5JA 4H4OA 3RMAA 3V4IA 4HCBA 4G1QA 4RW7A 4C8NA 1FKPB 1C0TB 3G6YA 3ITHA 3H59A 4B3OB 1VSLA 1ZETA 4CECA 1J54A 5KFDA 1VSMA 2IJFA 3SUPA 4LSNB 5KT7A 2ETJA 1RBUA 3PJWA 3M8RA 2D0CA 1JL1A 4B08A 4W5OA 3H5XA 3M9NB 1D9DA 4E7HA 1NOYA 1D0EA 4W5TA 1S6PA 1DTTB 4O3PA 1MU2B 1TVRA 1CXUA 2WCXA 1GOBA 1JXLA 4CK1A 1RYRA 4FLWA 4FJ8A 4DTMA 3OYLA 2JEJA 4RG8A 2DFFA 4WYLA 3OHAA 4WZQA 1N6QB 3H5UA 2HNYB 5HP1A 4OKEA 4ZHRB 1C0UB 3PZPA 4BE2A 4HUEA 3DRSB 4E7KA 2VG5A 1JLAA 3QGHA 4DS5A 2BGGA 1BQNB 3H5SA 4RW9A
chains in the Genus database with same CATH superfamily
3TYTA 1RT4B 2Q2RA 3GV8B 3HZ6A 4O0NA 2IA6A 3CJ7A 1ITGA 1RTDA 3IMQJ 3UIQA 1OJ4A 3V2UC 2GV9A 3C66A 5F0WA 1FA0A 3O4QA 3HOTA 1J5EK 2E88A 1YBUA 3MCPA 4OX6A 5KFNA 2ZH5A 1U6BA 1QVGM 3MD1A 3N5FA 1JIHA 3KHLA 4C97A 3IAM9 3NGIA 1ZM2A 3UKRA 1LWEA 1JLEB 4ED7A 3AVMA 5A8KA 3J7A1 3KZBA 2HVZA 2VBXA 3VHQA 4TQSA 1WAJA 4B1VA 2F63A 3NWGA 4IOXA 3UE5A 1CJUB 3DM2A 5IWAF 4DV7J 1BI4A 3RMDA 2DO4A 3G87A 3NBPB 2HLUA 2XMWA 4L72B 4PXEA 2DPIA 1NCLA 3I82A 2G8WA 4NLPA 1V3ZA 3ZXWA 1TQLA 3E1YA 2F4FA 1VFJA 5BR8K 5HN0A 2OHDA 2MJNA 1OH8A 3ZSOA 1Y9OA 2HK2A 3RG6A 2IBOA 1NM2A 2D9OA 1XC9A 2P6TA 2ASJA 4DCJB 3CFOA 3AY0A 4LF6K 2QX0A 2HFVA 4IJNA 4X64J 4DXLA 4O23A 2UYTA 2H5EA 1U7LA 4X4SA 1CLFA 1ZC6A 3BGRA 1FD2A 3VAHA 2M8HA 3UDEA 3MFIA 3CCLN 1K9MT 1AFJA 3CC7N 3NDKA 5E7OB 3LM2A 2J0SD 1N33F 1SUQA 3K8VA 1H73A 1GLAG 1CEZA 4PQAA 5D4OA 2WBRA 4KAIA 1AB8A 2VD3A 3NGUA 2CVEA 3O2IA 4HHTA 4CO3A 3ZSYA 4LFAF 3H20A 4ED3A 4X66K 4YORA 2R7YA 4ZTJA 4DR5K 2QLFB 4JK8A 1IN0A 4TSXA 4E7JA 2HBYB 3VTIA 2MPUA 3LO3A 5IC4B 1VSDA 4HLBA 2YNIB 4ECYA 3KNAA 1WJ9A 2UUAK 2GBZA 1HKBA 1BA0A 2VFTA 3B6PA 4WU2A 3DXMA 2ERRA 1B7FA 2MZRA 2JZ5A 3MTJA 3GV7B 1NJIT 3CWJA 3QSIA 2Y1IA 1IVZA 3UD4P 1ZBSA 1Z1ZA 3DDIA 3VV2B 4KTWA 1IR0A 4LFBJ 3LPYA 3RRKA 4PPDA 1A9NB 3AVBA 4NOHA 4F4XA 1RGVA 2E1MC 2WSFC 4WIQA 1S79A 2IGIA 1FRKA 2UUCF 1VQON 3J81Y 3ISZA 3V5RA 4B3TF 5A76A 3CFPA 1YZ6A 2DH7A 2HQDA 4BY9C 2EC2A 2DNKA 4OGCA 1KDNA 1XNRJ 1VQ8N 5DG7A 1KVJA 5HP1B 3IFRA 2ITGA 3NH0A 2HF3A 2DBBA 2CIMA 3D1OA 4K2XA 2YNFA 1WSIA 3SJJA 4AILC 1VK0A 2A3JA 2QL7B 4K4WA 2V0NA 3TANA 3IS9B 3QJJA 1RTHA 1PKUA 1D4XA 3CMEN 2GW8A 3L7PA 1W26A 3SMPA 3RTVA 1HRHA 2BKNA 1JLGA 4GKJF 3TTDA 2ACMA 1QTMA 2F8SA 2I2YA 2VFSA 1C0GA 3RB4A 3R1XA 4GMKA 2MEWA 4IG0A 1S12A 2WVFA 1BCOA 3TUPA 1VRTB 4OZ2A 4LF2A 4FJGA 5KG1A 4K4UA 4FDFA 4DQPA 1H2VZ 5KOXA 4NE9C 2J0QD 1UFLA 2GO8A 1WHYA 4PG8A 4CEFA 2XBPA 3NCIA 4CHYA 1DHMA 3S3NA 2DITA 5CAAA 4Q8FA 2E9ZA 4KHSA 4HTIA 3UW1A 2K1RB 3W8PA 2A42A 1IBKK 5J1NA 1B0TA 2DR7A 4FXWA 5HVGA 2QFJA 5IT9O 2W01A 2P9CA 1QY7A 3J81j 2QO3A 2GEMA 3TZXA 2ZM6F 1F0XA 4P6QA 3ZSQA 4JV0A 1U48A 4GO5X 2QA4N 3QEVA 2KT2A 2CDRB 1RT7A 3ATUA 2QT7A 1DJ0A 3M30B 3J7AN 4CLSA 2I8EA 4FZYA 5AQLA 3OYKA 2ZE2B 4XIUA 3VF0B 3KWMA 2M70A 3DRYA 2NLWA 2X1AA 2E5GA 4FNHA 3L7OA 4DS4A 4USJC 3KK2A 1TK8A 3K9KA 4I0WA 4WKRA 3C6TB 3NVMA 2VASA 1YJ9S 3JSYA 5D0GA 4O5FA 4B8CA 3CUNA 3SCJE 2AIRB 3J81U 3CQYA 4OPAA 4Z4EA 2FLPA 3FVYA 1SV5A 3OXFA 3DMJB 3CIPA 5LMNK 3QBXA 5U47A 2N82B 3FFIB 4GV3A 3KHGA 1YITS 1ILYA 1TAUA 3MR6A 4LSLB 2VOPA 4KB0A 2Q1NA 1BIZA 4IFYB 4USUA 1M5OC 4DR7J 3ZSRA 2UXDF 4JUZA 4ZPBA 3THXB 2N3OA 3PNIA 2NRHA 1Q7LB 4JYAK 4JV2A 1QQMA 1IBLK 3D7SB 1BL3A 3BPSP 3GONA 3TUJC 4P73A 1Z4UA 5F8GA 2ASYA 3NNCA 1LW0A 1XMQK 2G8HA 3OLBA 2HQ3A 5B0BA 5J2NA 3SFUA 3W63A 4DV6K 3JAMY 1QAIA 2W24A 2C2ZB 4A8WA 3QERA 1SQFA 1YI2S 2MQNA 2ZJQL 2HQFA 2RSQA 4Y6IA 3EZ5A 1X4HA 2HGLA 1FWKA 1QSLA 4DTJA 4YB1P 4PG4A 1CJTA 4IEIA 3CJTA 4OZ3A 2YQ1A 3V4MA 3M9OB 2QXLA 4QW9A 2X7IA 1R8AA 1C1BA 2FLLA 2HBZB 2YPYA 1ZPVA 5ETQA 1RBLA 4BRQA 3TQ1A 5I9EB 2E66A 4WTYA 3Q8VA 4H5VA 3MD3A 2LQ8A 4C3LA 2G8FA 3CCJN 3OVBA 5C24B 1MWKA 2P8IA 2AYGA 5H1SV 4QYZJ 2W2MP 3QFHA 4FK2A 2C2DA 5M1OA 2BOAA 3DXBA 4CW7B 2ZH1A 4DR1J 4KV8A 1GK8A 3VGUA 2I7NA 4TXSA 4CJFA 4A5BA 1UEKA 2KRBA 3HKWA 3T1HF 1X5PA 4U7CA 4BR4A 3OVSA 1WEXA 1XNQJ 3LDQA 3KXDA 1Q16B 3EJMA 1OQ3A 9ATCB 2LYVA 5DMRA 1L3UA 3R8EA 5AZJA 1U09A 3Q8PB 2YHWA 4Z4FA 3LW5C 5ETMA 3S3MA 5M1KA 2EWHA 3MAAB 3P39A 3TAEA 1CULB 2ZKTA 3EGZA 3QBWA 1OKJA 1O8BA 4EGLA 3OFEA 1MA9B 5LL6Z 2BE7D 3R3TA 3MHYA 4DMZA 4DDFA 1GLEG 4NLTA 4IQMA 2R8HA 4YY3J 3LP2B 3OSPA 4LF8J 3LOUA 4U6PA 1H2UX 3TVZA 3EE8A 4X2BA 3SJHA 5AR0A 3M2UB 4NXNJ 1DLOB 4ETZA 3BUZB 4F4AA 2OLWA 1BY9A 4CLYA 3EPIA 1TKDA 3AJDA 1QHAA 1T3NA 5C0YA 3TARA 2VWKA 4R25A 2CPFA 1Z6RA 3HM9A 4M3TA 2RILA 3P45B 5KT5A 2CJBA 4O4GB 3KLIA 1N4LA 2OPRB 4KKOB 2JFKA 3G71N 4B1XB 3W5YA 4HHUA 3UDVA 3NGZA 3VEYA 3RWUA 1EQ0A 1YJTA 4O5BA 1UZDA 3KLFA 4CJRA 1XI1A 2ZGYA 5HMWA 3LPEA 1HMVB 2BUPA 2OIHA 1WEYA 5B08A 4IEEA 3ZZTA 2DGXA 2IFXA 3NGRA 2G1DA 1EIYB 2HS3A 2RU3A 1HQ2A 2MLZA 1YK9A 1LFWA 4WF9Q 4Z94A 1TR0A 4I7FB 4FWPA 3THYA 1SQEA 5LMUJ 4IXCA 1F9HA 2XZWA 4PY5A 2DNYA 1NGFA 3ADAC 2AJ4A 4H4KC 4KPCA 1RDDA 1OH5A 1NKCA 4HI1A 4A48A 5AQTA 3CDUA 4KRFA 1NPRA 1OO0B 2CPYA 1RWNB 5DQHA 3W5ZA 3U6FA 1K6YA 1Z2ZA 1R0AA 4G3IA 4Q0BA 2NLXA 2GIRA 2FVPA 4K5SA 1FE0A 1J5EJ 4H4MA 5KFSA 1JWWA 4MKBA 5E5NA 4X84A 1DY3A 4H5TA 3GTYX 2BACA 5C12A 2JVOA 1SVDA 4X62K 1B99A 5K8PA 3KLGA 4JNEA 2CJYB 1NHKL 3EUNA 4KGKA 3F5TA 3AVKA 4DTUA 4YMEA 3CC2S 3TA1A 2D7SA 1HUXA 1CXQA 3DRRA 4GNIA 3ENHA 4IH6A 3VOVA 5BR8J 4I1TA 4LIWA 3NY0A 4WXWA 1D1UA 4LREA 2JFDA 1I3AA 4BC9A 2XYPB 5ETRA 2JC1A 3A1YG 4CJ5A 5BREA 3EKSA 3DHXA 4OHVA 3HFZB 1KOHA 5DG9A 4EWTA 2JLGA 2EG1A 4E3SA 2YH0A 4ZCLA 2C1EB 1S0VA 2LSNA 5LOQA 4OVLA 3MTKA 1JNRB 3PIPQ 1QSSA 2MQMA 2KJVA 2UUWA 4Z7CA 2XI3A 2YCHA 2X78A 1JK9B 4L6V3 3NS7B 2MZ1A 3EICA 4MK8A 3CGIA 4DL3A 1TZ0A 3O9QA 3VQ6A 1X31C 2CKWA 1T7PA 4UUXA 1F21A 4JK9A 4FLVA 4X66J 3KTQA 3MF5A 1HD0A 1GH8A 5KGXA 1Q78A 2UV8A 4DR5J 4J90A 4XO0A 3V6DB 3A12A 1ROFA 1X9SA 3OVAA 4PPZA 1RU1A 2YH1A 3ZT2A 5IQQA 5ITHA 5E26A 1DAXA 3FZMA 2UV8G 1NGGA 3M2VB 2QFIA 4WE1B 4E0DA 3AO1A 3EN9A 4DUZJ 4DSFA 4LIRA 3H2VE 1G4CA 3D45A 4EUVA 2SXLA 3GJTB 1LEOA 4IO9L 2GUPA 5HO4A 3O08A 1TUYA 4ZN1A 2DNRA 2A2CA 3GB0A 4DN9A 3AVIA 3LZJA 1KHVA 1TUGB 3LWMA 1CC8A 3O1LA 1IBMK 1SZ2A 4ZITA 2K8GA 1QDUB 2B9YA 3I0RB 3TA2A 2Z58B 4OX9F 4R0EA 1I6JA 2Q79A 1GLDG 4CT9A 2FJXA 3CD7A 3E01B 3MN9A 3VAGA 1LAVA 5EOYA 2O8DA 4QS9A 2IVOA 5A2QY 1WTBA 3HTVA 2D5RA 2C3OA 3UB5A 3VAIA 2MHNA 1T11A 3SQGB 2W7AA 3EM1A 2N7YA 4OZLA 5C10A 3EGNA 2MZQA 2XYGB 3OR2B 5I42B 2V67A 4OX7A 2XWYA 2VBWA 1C4CA 1CS4A 1JMTA 3MMJA 2EFVA 1WBDA 1ZXOA 4DSIA 1X4CA 2IVNA 2LQ9A 3I55S 4DU8A 3T1YJ 4FLTA 1S1XB 1YQHA 3AODA 2I7PA 3FGVA 1RB0A 4FP9A 1S3XA 3LGNA 1VQPS 1YIJS 1HBOA 1UJ6A 3DAWA 1KR4A 1HWJA 3IRWP 4ZDNA 5LT5A 1FX2A 2LU1A 1ZTWA 1JKHB 5C2FA 1CQNA 2P9EA 2HFOA 3G6ES 3HZEA 4CJLA 4O0IA 3ET6A 1YUWA 1F6TA 2YBVA 1TL3A 3JTOA 3RRHA 3HKZD 1QSYA 1KVAA 1KCFA 3IG1B 3VQPA 3NAEA 3P49B 4CZGA 4W5RA 3LDOA 3R6GB 2YWEA 3M8QA 2AJFE 3VN5A 3VQ4A 4MDBA 4ELTA 4LF5F 1E6VA 1M5HA 4P75A 3NCQA 3AA9A 3TEGA 1LNQA 1KRPA 2LFVA 1R8BA 4JI6J 1LOUA 4AL7A 2ZBQA 2DNHA 2XO6A 3J81O 3WX4A 1LW2A 2O8FA 3NCRA 3C6AA 2ASMA 3IGVA 5GVQA 1T8EA 3O3GA 2KYXA 2RJZA 3BO3A 1QD1A 4OIXA 3SSSA 3Q0AA 4C1NI 1TYQA 5J2MA 3QGGA 3BN4A 4E1MA 2ASLA 2C2NA 5K8MA 2V6AA 4EBCA 4ICLB 2R7RA 2VH7A 3ZNUA 2E7WA 1X4AA 3PW2A 2R7XA 4I2PB 2Q6CA 3CJ1A 4CBWA 4FWLA 1WTFA 4ZIWA 4LQ9A 5A8RA 1FK9A 3PEJA 4X4OA 1TTHB 5CY4A 3MEEB 4E7LA 3QLHB 1N33K 4RPFA 2DGWA 1YTYA 1RA6A 3DLHA 4OJGA 3SMSA 1RILA 4UOCA 3J8AA 1JLQB 4O3RA 2EFQA 3TAMA 3CJ0A 4DUYJ 3V1QA 2UP1A 4DV3F 2CADA 3DLEB 3CCTA 3OTOF 3MM9B 4IOCQ 1LK7A 3TAQA 4ITSA 1WBBA 1ZAVA 1QE1A 4KB1A 5A2QU 1R31A 1HNXF 2PSZA 3OYNA 2FSKA 3HHEA 1P9QC 3DLKA 2HGNA 1Q8BA 2EVZA 4EBEA 1C1CB 5K14A 2KH9A 1NGJA 3H98A 2B6AA 3Q24A 1N36J 1F1BB 5DDQC 4PYAA 4CF9A 1B4SA 4OI4A 3F73A 4DPXA 4TVAB 2BRKA 1TKXB 3IGNA 4A8XA 1GLJO 1PGZA 2DR8A 4JYAJ 4NXMF 4ZK7M 1IBLJ 4F4ZA 1U49A 1RCHA 3DLLQ 4GVBA 3T9NA 2V4JB 1NPKA 4LF9F 2ZOGA 5HVFA 2FY1A 1SL0A 3OYCA 3MEGA 3MPYA 2UUCK 2W4DA 3JYTA 4B3TK 4JRPA 1VHIA 2V8GA 5DJBA 2OTLN 2DYAA 2WVBA 4HT5A 4BC7A 3GIMA 4KO0A 4EP5A 5KFZA 3MX2A 1Q8IA 4DV0F 3H08A 2W7PA 4O4RA 3LALA 2AJ1A 3DJCA 1S9EA 3KJQB 2JC0A 2YX4A 2NYIA 2BTFA 5EY4A 5I3UA 4XAKA 1BQMB 3PR5B 1IBCB 4KHQA 1PBUA 3QO9A 1NGIA 1OY8A 4K8XA 4WQ5C 4IQXA 3KK3A 4HWIA 3AA3A 4I6MA 1JL2A 5KFRA 3M32B 5AQJA 4ZVHA 4M3RA 2E5LK 4PWWA 4GKJK 3EEQA 1FRLA 5C42B 3N6NA 3UN2A 1U1QA 4XEIA 1I51B 3ICLA 3AD7C 3Q2TC 2X3GA 4P72A 2AZ3A 2GELA 2GVZA 4CFBA 1Y7PA 5JXSA 2ZD1B 5ADXA 2YPZA 2DXDA 3O3FA 3FKBA 3JQKA 3VTHA 5GAHP 4X65K 1G6BA 4NCBA 5KTQA 1PAEX 4PZVA 2UUBF 3CD0A 3O1WA 5GADP 2MY8A 2P1JA 4BVPA 2DH8A 3FUYA 3BYPA 3ETMA 2VL1A 2W4PA 1B0VA 2J76E 3Q8YA 3TOQA 3VQ8A 4BG8A 3N0VA 2FUG9 1T3VA 3JAMO 1TV6B 5GAHU 3S41A 1Y5IB 5GADU 4DL0C 4HYKA 2VODA 3SQ0A 5DGBA 4KHUA 4GV6A 2P5VA 3VGLA 2VONA 3KKFA 4K43A 3HHNB 4RTFD 4Y1CA 3L3VA 2VG6B 4C4WA 4ZVTB 2BRLA 3QT8A 3IRXA 1S22A 4UOGA 4CJQA 4MFBA 5I3QA 3W3SA 3IBWA 2JJ4D 4ISEA 4RW6B 3RGIA 3U9ZA 1UVNA 1S59A 1N0VC 4M5IA 5GIOA 5GMEA 3JSMB 3KK7A 1IKVA 3NOCA 4CJ3A 1R0CB 4BDYA 1S1VB 1UWBB 2P9UB 1VMBA 4NCGA 2AYEA 1WHVA 3O9SA 3G9CA 1VQ9N 3CHWA 1ATNA 4ZTFA 3RAXA 3SNNA 4LRBA 2F7TA 3W9IA 1HL6A 5G4DA 3O3HA 2OPPA 1RT3B 4KE5A 4M5DB 3TX8A 6AT1B 5F8MA 1A5WA 4CHQA 4DV7F 4H4OB 3TR5A 4JOUA 1I1GA 3EL2A 1OVYA 1D5AA 5KRSA 3MMCB 4F9OA 1NJZA 2QXFA 4I6WA 4R5PA 4ER8A 1S9FA 3KWGA 3JXOA 1WI6A 1T9XA 5HMXA 4DR4K 3VETA 1VQKS 2IDOA 2ZHBA 4MKYA 1YJ9N 2PZSA 4HTUA 5TKWA 5EVZA 1Y3KA 4CM0A 5DS7A 2ADCA 4Z0UA 2GAHC 3HHLB 5FROA 2CQ2A 2NUUG 2DNOA 3KMSA 4E1JA 4X64F 2XI2A 3GMGA 1YITN 3G2XA 4FF4A 3PJ9A 3C65A 5KT2A 1U1LA 1U0HB 1VDHA 1NPPA 1JJ2R 3DKDA 5JVHQ 2BKPA 4YFUA 3E2EA 5AQYA 3DOLA 2PDAA 1KFDA 4HUGA 4FLXA 4B1UB 5LM7E 3QICA 3Q2SC 4ZVSB 4RW9B 2A40A 4Z2XA 4HI2A 1WC6A 4NO7A 4G1PA 1NGHA 2MQOA 4CTAA 2NQPA 2RQCA 4DV4K 5HQ8A 1HWKA 3TWZA 2F9JA 2VCPA 1MMNA 3EO3A 3MOJB 5MLCQ 1YI2N 3G96A 2CPXA 3MR3A 3S3OA 1VSJA 3KWIA 1GMUA 4ZLLA 5DQIA 2QYCA 3LDSA 4FPIA 4Y1DA 3NMRA 4CDIA 4YR2A 5A8KB 1W2IA 5H9EK 4LSNA 2BH1A 1OYDA 2Z2YB 3HVWA 3CJKA 3ULEA 2Q97A 4NI2A 2ZH9A 3AVHA 2XYHB 4IH7A 3O5TB 3T1HK 1D9FA 5IT0A 2U2FA 5F9LA 2P9LB 2W42A 1KFSA 2KRRA 1YBAA 4LFBF 3HI0A 4MO5A 1VIXA 3MOZA 4ECTA 4OV1A 4FWNA 1HA1A 3LGMA 5DDOC 4BRPA 3PJXA 1W2BR 1K0VA 2QYGA 4OL8A 1ICEB 2YX1A 2IIHA 3D6RA 1FXDA 4JB8B 5HATA 1MN9A 3BSNA 2F8EX 1MWZA 1NU4A 3BR9A 1BQNA 3THTA 3PYDA 3KKSA 1RT4A 2XLIA 1YJ7A 4QJVA 3F44A 4LJMA 5KFBA 4EIAA 3QINA 1XNRF 1Y3JA 5CA5A 4DFJA 1F9EB 1OIAA 1Y0HA 3AA8A 2UXCJ 3T41A 5D0RA 2AEFA 2E4LA 3BB5A 3GFXA 1F60B 2R7TA 1SUQB 4Q44A 2D0AA 4FL9A 2W2NP 4LH5A 2BQUA 2BQ3A 5B0EA 2HFZA 1XWLA 5B0GA 3GJQB 3AOBA 4UQGA 3NH2A 4DV2K 2ZWHA 3L09A 5AZIB 4WFNL 4BQLA 1NSAA 1EARA 3U1NA 3EXYA 3CC4S 1BUXA 1OSDA 4ZKAA 1UVMA 1S57A 1J5OB 1D8ZA 4AL5A 1H98A 3I8BA 4LF1A 4LVOP 2CQ4A 2DVIA 3F9MA 1NZAA 1S5ZA 2XTJP 2PIIA 4OMFG 2KG1A 3UCGA 2FBYA 1FX4A 4X4RA 5FPEA 3DXMB 4KB7A 1OS5A 2MDAA 2KZMA 2KXNB 3CO9A 1DBDA 4E2FB 3UVJB 2K06A 1YRTA 2XULA 3IR5B 3L2VA 3ILJA 4HDHA 1EQYA 4CGFA 5ADZA 3D67A 4JLHA 2HAFA 1MW7A 3UI3A 5HL7Q 4USMA 4CHZA 3MDFA 2VUGA 5SWMA 3UQSA 4M7XA 4F3OA 4RU9A 4N5SA 3M1FA 1J6ZA 2R42A 2B0GA 4CZKA 2P9KA 4HCCA 2B4PA 2ILYA 3ZZPA 5EDWA 2E2OA 2YNFB 1L3VA 3T69A 2HK3A 4OV6A 5AT1B 3GE1A 3FRZA 4CLTA 3J7AP 4OYMA 2ZH8A 1JLGB 3RU0A 5KFFA 2RRNA 1CBKA 1DRZA 3JS9A 5JMNA 5FD1A 2R9LA 3R5BA 3R6MA 4HCBA 3TSQA 1MSWD 3ITHA 3M3ZA 2XHWA 1OH7A 5ADXH 1ZETA 4IOAQ 2V2KA 3TTCA 4CECA 1E4FT 2GAGC 5FLXY 5FPMA 4AYBD 4RKUC 2R7UA 3PJWA 3HULA 4W5OA 2IVPA 3BR8A 3VAFA 3M9NB 2AP6A 2LVWA 4DR7F 2Z30B 1H38A 1D0EA 1DTTB 1MU2B 1TVRA 1RKJA 4EMDA 1BOTO 3SCLE 3A8YA 4FLWA 2GNKA 5DM6Q 5D4LA 2JEJA 2DFFA 1SI9A 2WVEA 4WZQA 2R7VA 4KH4A 2O1PA 5HP1A 3CC2N 4KIAA 4ZHRB 1C0UB 3PZPA 1AA1B 1Z05A 2GVDA 5DO2A 2B8PA 2HOEA 2FHMA 1K9MO 3TTFA 2OZSA 2BJDA 2HHVA 4OKKA 3C6UB 5ETPA 4P10A 4HTJA 4A46A 2KZZA 2IRYA 3GE9A 4DZDA 5KT3A 4URQU 1VRUB 4JV5K 1QAYA 3FEXB 3M8YA 3K17A 2PN6A 2V8VA 3G8TA 4QWBA 3KK2B 1T9YA 2OMOA 4OYAA 1NEEA 4RUCA 3I9ZA 1VRTA 2HBRB 2DNGA 4DX8H 3M8WA 1E6YA 3PSIA 4ECWA 1HLUA 3QMLA 2CQHA 3DHWC 4E98A 1C0FA 2CH6A 2YJFA 4DR1F 4CEBA 2PEHA 2AX0A 2XY7A 5A6PA 3OTEA 4B1WB 2FJAB 2K1RA 4EZ9A 5AE3A 5CR4A 1FI4A 2DFEA 1WKJA 4DEZA 4IR9A 3TP2A 1I39A 1RTZA 1XTZA 4U7UD 1NJIO 1XNQF 2CQGA 4ZLNA 1FJ7A 4IRCA 2Z0GA 2IY5B 3KHHA 5T7LB 2F96A 4PR6A 2Y0BB 1HBNB 3M5RA 5LL6d 2WVCA 5L1LA 3G82B 1WC5A 2V50A 3AJ1A 4DBQA 3AVJA 1XBWA 2L9NA 2Q43A 2D69A 3HVAA 2GS8A 2LP4A 3BBFA 5KFXA 2L41A 3CIZA 3H4BA 3PKYA 4JKHA 5J2NB 3M30A 3X3UA 3AVAA 2HMIB 4C6AA 4OI0A 2F40A 3DNCA 4OYWA 4OQJA 5L8RC 1P6TA 5FLXU 1CSJA 4LF8F 1DGKN 4RU2A 4AH9A 4M41A 1H72C 3QYYA 3C14A 1ITPA 3KUEA 3C6TA 1KONA 2E5LJ 1EETB 3GDQA 4BDZA 4NXNF 2H48B 2XY8A 4XH4A 1BWEA 5HQLA 4CO1A 3V6KA 1C1BB 3SK3A 4YOYA 4DQSA 3V6JA 3DMJA 4I64A 1VBZA 2BVZA 4Y2IA 4KGVB 2BE2A 4EI2A 5LJ3Y 3QT7A 4FOIA 4JN4A 2NYHA 5J1EB 4L3KA 1GOAA 4TY8A 4LSLA 3I55N 4NLWA 1H3DA 1KQGB 4IFYA 3V4IB 4RW7B 4KTZA 3VWSA 3I9V9 2LMIA 2MSTA 3NF8A 4X65J 4M3YA 2R7OA 2BM0A 2BABA 4GC7A 4C1NK 1YTAA 2X1FA 4DSLA 3I5AA 2HVIA 1X4FA 1VQPN 3THVA 2I1RA 3GOIA 3QEPA 3THXA 2B9XA 2XG8A 1DKGD 4DSKA 3TRGA 1LFPA 3SQ1A 2AYMA 1NO8A 4Q2MA 1VR6A 2C2EA 3TJAA 5HMYA 3MEKA 2FLNA 5B0DA 2ITMA 4LF4J 4ZJOA 5LMUF 3SPZA 5AZJB 4BR2A 2F65A 5DDRC 2QWPA 4JI1K 5HMZA 2VG5B 3L4BC 3B78A 4WYBA 4DR6J 3W2WA 1W2BM 3PG9A 2FSJA 3TR8A 4MIAA 3QJPA 3QETA 2FVCA 2Z2ZA 3N6LA 3G8SA 3HT3A 4NZ7A 2M7SA 4UQTA 4ED1A 1BMQB 5BRHA 1RWKB 3NGKA 2MQLA 3OTOK 1KHWA 3W7BA 4AHSA 1U2RA 5KRTA 3H3OB 1U1NA 3CYMA 5F41A 3AY9A 3MMVA 3CCRS 3LGHA 5GAEI 2Q66A 1AUDA 3ISND 2HURA 6FD1A 4J9NA 3HPGA 4UF4A 1MWMA 2HHHJ 1LOTB 3A2FA 5F8NA 3AO5A 4DR4J 4MLEA 1ATSA 2B4OA 3VQ7A 1FDBA 1PG5B 4M5GA 1GXUA 2HNDB 1LXJA 2NRTA 4MMOA 1Q86T 1XHXA 1WSRA 1HHQA 3DRSA 3MAAA 3NNHA 1XK8A 1WG4A 2MKYA 2DR6A 1VBXA 3LA0A 3UO0A 3EPGA 3C46A 2PY5A 1RQ0A 4FPBA 1K47A 3E9OA 2OI2A 1ZM9A 4DTNA 1IR1A 2GZOA 3KFWX 5KFYA 4WKYA 4FJ5A 2PYLA 1CJVB 1IM4A 3BH6B 1UFKA 4WFZA 4DU1A 3CJ3A 1HLWA 2E1AA 3HSDA 3QIDA 3L2WA 2CWKA 5LXYA 4IWVA 2FJVA 3MWPA 2BJEA 1S1TA 3CJ5A 2KYZA 3FSXA 3M2UA 4H03B 1R0AB 2BM1A 1FXXA 4Q0BB 1XJWB 2YWHA 4X66F 4DV4J 5DRKA 3P5BP 1GTEA 3FZ2A 5KFHA 3R5CA 2G1HA 4DR5F 4IRDA 1F3VA 2ZJRQ 4DL7A 2DGVA 5KFOA 1Y11A 3C7NB 5L9XA 3FMWA 4C8ZA 5JMVA 1RXOB 3W62A 1G15A 4KI6A 1SIZA 3VVUA 5H9EJ 2OPRA 3U4LA 4KKOA 4DUZF 2F8HA 1NRKA 3KLGB 4IDHA 4M5HA 1QTNB 4CZIA 1JNZB 4IKFA 1M1GA 3DWLA 4KHWA 4NLVA 3R1LA 4I6YA 3LWLA 5T41A 1MWQA 1UW4A 1L3KA 5AQZA 4D3HA 2JEGA 3K9JA 1YJNS 1GLBG 4M5MA 2QL5B 4BRDA 2UUBK 4CVNE 2F1FA 5I4MA 1KQKA 4I7FA 3O9UA 1N88A 2GTDA 3L95X 3BQ2A 1IJJA 4XTTA 1YZ7A 3JSRA 3VENA 1FFSB 4PKIA 2Y8WA 1X3NA 1JCGA 4OJRA 2OTJS 4LRDA 4USHA 2JX2A 2DR9A 2HHTA 3F9KA 2EI5A 4ZPVR 3T1YF 3CPWM 3BP8A 2JGUA 4DV2J 2X51A 3OFHA 2P9IB 2OGUA 1LKZA 3UN3A 1MNEA 2BEFA 4O3SA 2FC0A 2ADBA 2M0GB 3PCOB 2OEMA 4JP8A 4TU7A 1X9MA 3CJQA 1NLVA 2ZUGA 3TAPA 2ASDA 1CZBA 5ELZA 3VR1A 3BBBA 4F67A 5JS2A 1U8SA 1YJWS 4P2FA 3AHPA 3ZETA 3VESA 3PHEA 3J80O 3SQ2A 4JK7A 3K5LA 4QS8A 3TEHB 1XMOJ 2AX1A 2KHDA 3LP0B 5KFMA 4BREA 2HSEB 3BQ0A 4A62A 4JI6F 5B0AA 2PO4A 1C2PA 4YS2A 1YXQA 4ZPCA 3GSIA 1Y4ZB 4KH1B 5ETTA 3K89A 2VOOA 3CETA 4CI6A 1VQ5S 1NGEA 5C25B 3QZ7A 4BRKA 3RAMA 2R8IA 1TAQA 4DTSA 3OBYA 2MYFA 1YDLA 3A8JA 1L5UA 3D9BA 1VQKN 2C42A 1HKCA 4Q5VA 4WWSA 2P9PB 1YJUA 2E1PA 3DLJA 3Q23A 5GAGP 4DUYF 3MDQA 1EB0A 3M2VA 3B6BA 3KJNB 5EX3A 1IUJA 4WE1A 4K4ZA 2JL9A 1HBOB 2HZVA 3EYZA 4JI2J 3FLCO 2J8AA 3VERA 3ZT4A 3FCVA 5HVHA 1RHKB 2R7SA 3QIPB 4AHRA 2HBLA 4LUBA 1NGDA 3FBFA 5GAGU 5LSLA 4DTPA 5AQFA 4PKDB 3ET6B 1N36F 1H7WA 4L3NA 2G0IA 1TL3B 1RBRA 3LTOA 1KQSM 2RNEA 4H5RA 3V1RA 3FSYA 2HHQA 1MMDA 3HK2A 2YVSA 3ZFVA 2OAUA 4CGIA 3EY1A 4FYWB 4CLPA 2J0WA 4A2AA 4JI7J 5M1QA 4DHVA 2E29A 1E6VB 4QWEA 4NLYA 1BUPA 5GINA 2X3DA 2E7VA 5I42A 1R59O 4ELVA 3T6JA 2GHVC 2DGTA 3R97A 2CA9A 4JI3K 3ZC4A 4AF1A 3VAJA 4OLAA 3PX6A 3ZTRA 3RB6A 2ZF5O 1SPBP 2VB6A 5J2MB 1QVGR 4A8YA 4AM6A 5K9FA 2C2OB 1VQ4N 4DFPA 1TGOA 2HQCA 1XNRK 1RHJB 4RNOA 3BKTA 2GA7A 3NMUA 4DL6A 3BV8A 2YKMA 2XEXA 5A8RB 4K41A 2ZJQQ 1YKWA 2HS4A 4JV5J 5DK5A 3U1MA 1T9TA 1NNDA 2V8HA 4LD0A 3HCXA 5E3RA 1KS2A 5IOLA 4AHUA 1HHSA 1PJ6A 1EKEA 2XHCA 1JKHA 3UPFA 3KUHA 4YOXA 3MN5A 4B17A 5BPMA 2O8BB 5L38A 2X74A 3TAMB 2A0FB 2UVVA 2M52A 4FJ9A 4NLDA 2FDNA 1KP6A 4ED6A 2XGQA 1KLMB 7AT1B 1PYTA 3LDPA 4MKVA 3W60A 3KHYA 2D74B 3ZEUA 2RE2A 4QR2A 1ZA2B 4RW4B 2AKWB 3CJ9A 1V6HA 4B3SJ 4ED4A 1FJGK 1X4GA 5K14B 3IR6B 2B6AB 3POTA 4K59A 1UZHA 4HTLA 3AVLA 2VC0A 4ZPTR 3KOAA 3KLEA 1FEEA 3NMAA 4HR2A 2ZWPA 1Z25A 3A8IA 4J9QA 2XWXA 1HWLA 2DEIA 4Z4IA 4OZNA 1R27B 3OTBA 2FF6A 4B1ZA 4OYBA 3VPZA 4M94A 3MXHP 4V19J 4XH1A 3CC4N 1R6VA 3HLUA 4W5NA 1VGYA 2VPYB 1LCUA 3KLHB 2QA1A 1HNZJ 1S72N 3MEEA 3HI9A 1X7VA 3CJ8A 3EZUA 1WF1A 3GWCA 4FOEA 3MECB 2NXUA 4KQZA 2HVDA 3E51A 4KO0B 1C4AA 8ATCB 4UOHA 1JLQA 2LXFA 1JJHA 1N54B 4FVUA 2EBGA 4DI6A 1S9EB 3PKMA 4CHNA 2YKNB 1KNZA 3DLEA 4AFFA 1A5XA 1IKXA 1N34J 3MM9A 3FE1A 2AV5A 4Q8EA 3SSRA 3OV7A 3A5LC 3QO9B 5IZHA 1NJYA 2D3OR 1Y5LB 2Q6BA 3D2FB 3M4XA 1VQ6N 2QI2A 4GV9A 4C3MA 5DQGA 4OI6A 2QMWA 5E0OA 3FZFA 3FEYB 2MB0B 1C1CA 4AHCA 4C23A 1IWAA 5FRNA 1I94J 3OR1B 2R2SA 4JRQA 2VBZA 4CLLA 2IDEA 2XHBA 1SKUB 3QWPA 2HBQB 2HFUA 3CT9A 2MHEA 3KDNA 2VQEK 5I3PA 4U8VA 2QTWA 4ZJLA 5AQNA 1UVIA 2RUSA 4QBUA 2BJ8A 1RAFB 2GVZB 1Q7YO 4WIIA 1TL7A 3CCSS 3BZKA 3AFGA 4AQYK 3CCWA 3KKRA 3IC1A 4M1KA 1TKZB 1T03A 4OI1A 3CCES 2WOMA 1NK9A 2V4JA 1Q18A 3NRBA 3AO3A 3H25A 1R7IA 3ZSWA 1NK4A 4DR7K 4WTOB 3QFPA 4F8RA 2OD4A 2Z2MA 4AD6A 5IC6B 2PFDA 1Q9YA 5DLGA 4OKJA 1IKYB 1UAXA 1IJFB 2EX3A 4RW8A 4UTGA 4GW6A 5EXWA 4JI1J 5EU7A 3AD8C 3VGKA 3PW5A 3DOMB 3FZBA 4PKGA 3H90A 2E9RX 1YJVA 1BQMA 3DRPB 4EHUA 1U2VA 4FYYB 3K2YA 5AQRA 4K50A 3DU6A 3VEXA 5DDPC 3I31A 2CFXA 3CF5L 1URRA 2QWQA 3NE6A 5A8WA 1VC0A 3M32A 3IWNC 3SCIE 3IRXB 2UVWA 1RISA 3T3FA 3FFKB 2E9TA 2W6LA 1RT6A 4AHTA 2OZMA 5HSPA 4KI4A 3QZ8A 4ES1A 3O4NA 1VS3A 4FWSA 3B54A 2IAJB 3ZZ0A 4CHOA 3MCOA 4NCGB 4A47A 1X4DA 1X5TA 4H54A 3G0ZA 2ZD1A 2HHSA 4YDUC 3GBTA 1NKBA 3SAHA 1QVFM 2MKKA 3I0SA 4WF9L 5F8LA 1HKGA 1DEJA 2RQKA 3GG4A 4G1IA 4DR1K 4NPOA 2IYIA 2HLTA 1REVB 4DN0A 3SIPB 3WZ0A 5KG5A 2ALZA 3AO4A 1OMSA 1QZ6A 1O51A 4M3ZA 5L1JA 1W0HA 3WXLA 1VBYA 3UNGC 2MQPA 3RVCA 4FZXC 3IXQA 4NYPA 1ATRA 2IBKA 5LY3A 1WSVA 4C0BA 3EGVA 2FQQB 2IRUA 1UEUA 3VQEA 1O1WA 3F41A 5CYQB 1QS4A 1S6QB 4OHWA 2F4VF 2R8JA 3AGKA 3OVNA 1G99A 2UXCF 4PKHA 4ECZA 2BA9A 1S48A 3SDEB 4OJ1A 4KHMA 1K0TA 1RUSA 3JSMA 3DOLB 1HW9A 1T3OA 3VQ5A 3LM9A 4LF8K 3B8HA 1VJQA 2YWWA 5DETA 2P9UA 5HOOA 2MJUA 1XQIA 4NMXA 1S97A 1FRXA 4NXNK 3UDCA 2J6UA 2FTRA 2RU9A 4KHPF 4DL4A 1EJ7L 2V63A 2FD2A 4I9LA 4M8LA 5M2RA 1QJHA 4G9ZA 2YQ0A 3DI6A 2LKZA 2AP1A 4ZCKA 3PIPL 4KBOA 5AFUA 2H3EB 2V94A 3MXMA 1NK0A 1P90A 4H0YB 3A8KA 3CJKB 5KFIA 3ZCMA 5BN9A 4IO9Q 1LWXA 4J7CA 3VVTA 4F36A 4GKKK 3HM8A 3EKUA 1Q81T 3B8AX 3E66A 4FJ7A 1VOMA 3NGYA 1IKWB 1JLCA 4E89A 2V4QA 2IM1A 3BBCA 1RE1B 2K3KA 5BYSA 4K0KF 4A4JA 2WVDA 5LMUK 4KYZA 3BGLA 2CQ0A 1NSQA 2JVRA 3WIUA 2W9AA 3PYEA 4GVEA 5FRMA 3MCSA 4CF1A 1T05B 3HMJG 2GX8A 2YY3A 4PWDB 2RDJA 1LWCB 2AYBA 2M2BA 2XB2D 4DX6A 5ETSA 2P2CB 4U67Q 3P38A 4NLOA 3FCHA 1P1LA 3SI6A 3HO1A 3FZHA 1YSJA 1EQMA 1R0BG 1ZAXA 4QZVB 3DYAA 5JUMA 4KH6A 1FNOA 1NDLA 3BEGB 5CHCB 5AQIA 3HSCA 1FNXH 2PAVA 4ZVFA 2P9LA 3L7UA 4ILLA 1KKHA 2F3JA 4YHHK 4NRTA 3G25A 5DGAA 4JKGB 1FD8A 5EWEA 2MZSA 3I56N 2XCAA 3PRVA 3TU5A 1EXQA 4URSA 3CCMS 3MXJA 5LSRA 4N47A 1X60A 4CLKA 1D3WA 3R1HA 2CH5A 2ZUAA 2E8AA 3HHDA 2GV1A 2KXFA 2EFNA 3H5YA 3C95A 2CQIA 1MROB 4FWQA 1S0MA 1FFGB 2V68A 4CLZA 2FJDB 3M8SA 3BZQA 1R89A 2VQFJ 5IM0B 4Y2MA 2O4GA 2XNRA 3CDBA 5SZTA 3IWXA 4FYDA 3BSOA 1K1QA 1RDWX 1HYSB 4DUTA 1AZSB 3LH2S 2P9KB 3EDQB 2QSFA 5AXMA 5AZIA 4RWXA 1RHMB 1RDCA 1BDGA 4USIA 3F2KA 1J5OA 1KAZA 3KG4A 3CMAS 3QBCA 1N32J 4V19S 2WK4A 3MUTP 2MKCA 3MM5B 4DUZK 1PIEA 3KLVA 3B4DA 3IUCA 5F3ZA 2P51A 4HUFA 4F3QA 3ITHB 3K58A 3OLAA 3C6HA 4CH7A 4DG1B 2FVQA 2HVEA 3LPTA 3UVJA 4CEDA 5IS2A 5KG3A 3OD2A 3GIRA 4DR2F 5HRPA 3RR8A 4HL9A 5AQVA 3W9HA 3SLCA 4H0OA 3D0GE 1KC8T 2PC6A 4JI3J 1TVRB 4F50A 3PHTA 2F9TA 2IM3A 3PV8A 1S0OA 3OYDA 1JJ4A 1TFWA 1APSA 4EK2A 5JLFA 3W8GA 2GVDB 2H51B 1S10A 4ECUA 2QGFB 3T1YK 3EGWB 4FK4A 2YWFA 2HRUA 3CVKA 1JXBA 3AVGA 4JV1A 4P71A 4A8OA 1BU6O 1FW6A 2RAQA 2E5LF 3MR7A 3TI0A 3VQDA 2HF4A 4K25A 3FZLA 4OJHA 3CD5A 2MKJA 4C8LA 3CCZA 4A8SA 2V2VA 5IV4A 4CEEA 3CCLS 4BC3A 1FWLA 2YNGB 2D41A 3W5XA 1FJGJ 1V3SA 4F2RA 4IO8A 3HHKA 1W9HA 3B82A 1E6YB 2RPIA 2Q0RA 1NKEA 2RQMA 1HNWK 5HK4A 2BV3A 2H3GX 4X65F 3BF1A 3E8OA 1DTTA 1MU2A 2O67A 1KVIA 1IG9A 4DQQA 3T5KA 4DFKA 1MN7A 5EN1A 4FM2A 4YDXA 2VPWB 3THPA 2O8CB 2QEXS 3O4WA 2W6KA 4OPHA 3SAGA 1X5OA 1ZS6A 1PILA 1T6DA 5ETKA 4JI6K 3DDKA 3BY5A 4ZHRA 1C0UA 2C3YA 5KFEA 4HEA9 2HAIA 6FDRA 3OHBA 5E3AA 4KGXB 1RWMB 3P4IA 2OPSA 2OCEA 4NA1A 5F1XA 4Z4GA 1E4GT 4LF4F 1H74A 2D3UA 4DPYA 4USTA 2AQ4A 2XY6A 1U8WA 3OHRA 4ID8A 3C6UA 2CJKA 1NXIA 1GMWA 2HRYA 2OD6A 5D15A 3H2LA 3VCDA 2ROGA 1U6ZA 1PC4A 1YVUA 4CZMA 4M3UA 4C11B 4Z4CA 1VRUA 1U1MA 3RYLA 4DR6F 3QFWA 4LQ3A 4ERDA 5FJ4A 4WBFA 1TL4A 2CYYA 4QWAA 1UL3A 3EE9A 1RAGB 4B8AB 4F4KA 3A3NB 2CWXA 1VQOS 1N52B 4OX8A 3I32A 1RLDA 1VQ5N 3C14B 3OL6A 1D9AA 4DUYK 1SKWA 3THWA 2ROEA 4B3RJ 4M42A 4FKYA 3DC2A 2VQEJ 4YOUA 4DPWA 1VQ8S 1U1KA 4FF3A 3SZ2A 3JB9k 1NJXA 2BE2B 3D6MB 2DB1A 2PMWA 4ZPAA 2ALYB 2ZNYA 2Q3PA 3K2PA 1FTCA 5AFUH 4TY8B 1VAZA 4XDCA 1MMLA 4AQYJ 3CDWA 5BPNA 1N36K 4EFAC 2HHHF 3M8PB 3CMES 2Y8YA 4DR4F 2I38A 2OH2A 1WSJA 5HRSA 4LC9B 5T7LA 3IAS9 1HBNA 3PX4A 1O5JA 2DH9A 2OA8A 2KDOA 4M63A 4GMJB 3G82A 5E3CA 5T7BA 3H2UB 5B7WA 1RBTA 2B51A 1UJ4A 2ZBIA 2OFHX 3N4PA 2UUTA 2UXBJ 4N41A 3G6VA 4KH0B 2VKRA 2DY9A 2HMIA 3RR7A 4QPTA 1R8PA 1WKKA 3M6UA 4FN5A 2WC9A 2ZBCA 3I8DA 2CQ3A 4KGMA 3MMBA 3PO5A 2G8UA 1ZBHA 3C2PA 3A0IX 4LVNP 3VMFB 5KFUA 5FPDA 1EETA 1RZMA 4YB5A 1T95A 2I6WA 3DLBA 4WFXA 3OY9A 5D6GA 3W2WB 4DV4F 4UW2A 4DFMA 4I56A 3KNGA 5E41A 2AGPA 1SAZA 4FBUA 4CWBA 4NLBA 2P5OA 1IR2A 5J1EA 3V6HA 1FDNA 1MG7A 1CC7A 3H1VX 1FE4A 3V4IA 1VLOA 4RW7A 4DR3F 1FKPB 4PXBA 2PI5A 3G6YA 2OMLA 2QA4S 2WTUA 2MKHA 3D1QA 4OI2A 5KT7A 3WC0A 1RBUA 2D0OA 1UTAA 4B08A 1RADB 3CCUN 1U25A 1VCTA 3CDAA 4OHZA 4O3PA 4CO2A 1CXUA 3PXGa 4LT6A 2O8EB 1PC5A 4RG8A 4XH5A 3D54A 3ZTSA 2W4CA 3C8YA 1NWKA 2H9ZA 4OKEA 3QSYB 3DRSB 3HZGA 2VG5A 1RAHB 3QGHA 4DS5A 3GU0A 4F7VA 2DHAA 2KB2A 3SBMA 3H5SA 2KKHA 1KAXA 1HJRA 3CDEA 3PM9A 4PA1A 4J9SA 3S6EA 1HBUB 1BHLA 2QG9B 4FSVA 3ILOA 5JJBA 4J9UE 2VDHA 4C0OC 5HROA 2QWLA 5KFPA 4IR1A 4DV2F 2AF6A 5HI7A 3RRGA 1S1TB 2DHGA 4BVOA 2MXYA 4I2QA 4PUOA 2VIHA 5HRNA 2ZZMA 5H9FJ 1JLBB 4EFHA 5KPTA 1Q95G 2EFGA 2CAJA 2DPNA 1UVJA 2BJ9A 1GQEA 3U02A 4IFVA 1FESA 3NNAA 1HPMA 2YX7A 2AJ0A 3U3GA 5G0RA 2FY8A 4PQUB 3HP9A 3JAMU 3K5MA 1NDKA 1TMMA 4WFNQ 3D6TB 2JSXA 4LR9A 4J2DA 1HWIA 3VEVA 4KC5A 2YQ3A 2BQRA 2WW4A 2XQCA 3KD1E 4GKKJ 1WN7A 2HNDA 3LZIA 1K8AT 2HZCA 4P74A 1XMOF 3F56A 1HQUB 4ID5B 2CNKB 4A59A 3L3UA 4OZ0A 1YBTA 2WSCC 2GGPB 3PLAA 3T9ZA 3CCJS 4QU7A 4X4TA 2FB0A 3TVKA 4CIGA 3GJSB 1TMJA 4NZ6A 1S49A 2C3MA 1YLXA 1LWFB 2PGCA 4QAGA 2DNZA 2EW9A 1P8ZA 1CJVA 3QGIA 4ZLJA 3HSGA 2XMUA 2XCPA 3V9ZA 2RE1A 4JI0K 4C9DA 1DQAA 2V2QA 3D68A 4UY85 3W65A 3CCEN 2PFFB 5J2QB 1YHQN 3RBDA 3QAEA 3QEIA 4IFEA 3L2QA 3CPEA 2DEJA 2KG0A 1SCJB 2IHR1 1BE4A 2XSJB 5BYQA 1TL1B 3C7NA 4FJLA 2VZ9A 4CZFA 1DTQA 4NWBA 2Z1JA 2BMBA 4NASA 2E7XA 2EBEA 3CO0P 4JI2F 4JI4F 3RSEA 3VA0A 1X0FA 1N5TA 1S5JA 4EU0A 2B5JB 2KM8C 1VQMS 2CPZA 2IM2A 2CVIA 4X4QA 1RAJA 1J2VA 5E2QA 4PG5A 4DV5K 4QU6A 4QW8A 5HL7L 2ZDOA 3VGSA 2PMHA 4YHHJ 2CJQA 4NLCA 2CG8A 4NA3A 3ZETB 3N6MA 4BQZA 4JS5A 3LPUA 4ZVEA 4ETXA 3TJ9A 4NYNA 5CCMA 1RLCL 4JI7F 5AE1A 5F0UA 1S6PB 3D66A 3K5NA 1BGXT 5FIIA 1Q86O 3T7ZA 1GMVA 3DXKA 4I9QA 3OJUA 3D0PA 2G0JA 3OT9A 2J9DA 3OYIA 4ES2A 4CNZA 5EHHA 4PG6A 2X6NA 5CHIA 2E2QA 3NAHA 2P6SA 4HHHA 4RCHA 3V9XA 2HEKA 4WXOA 2GX9A 4CIEA 4CJEA 3G71S 3RBEA 1Q79A 1EKSA 3TNVA 2ZBRA 3D2EA 1BWVA 2F4VK 2OKQA 2W9BB 3SUQA 2J9CA 2ATQA 2UXCK 3P1GA 2P9IA 2D1CA 2LLZA 4JV5F 3GJRB 3WBZA 1G2EA 3QNWB 3WX8A 4CO4A 2B56A 4IOAL 1XR7A 1AT1B 4USWA 3CJBA 4YNQA 1P9YA 5AQQA 3BSCA 2IM0A 1SH0A 1RT1B 1RGIA 4H0PA 4YR3A 4WK3A 2G2YA 2CPJA 2H5JB 1N5SA 5GMKa 4KHPK 3R7SB 3S8SA 3JQJA 3VF4A 4JS4A 2XLKA 5DM6L 4XPEA 2FJBB 2XS5A 1ZTTA 1XUPO 4B3SF 5GAHI 3LP0A 2AJ2A 4FW1A 2FYXA 3DRXA 5GADI 2FZGB 4CGJA 3OBWA 3WQTA 5FDLB 1V5VA 4WFYA 2B3TB 3TUZC 2GQCA 4ZP7A 2ZHOA 3O1BA 4TY9A 1WSHA 1R8HA 1NBEB 3T5HA 2JH3A 5C25A 1OYEA 4A57A 1PAUB 1FWPA 3HFKA 1WOSA 3VAMA 4S0MA 3VF6A 3ULDA 2LXUA 2DKOB 3GYGA 1HNZF 4K0KK 4DWIA 5AQWA 1CZ9A 2Q3SA 4ECQA 5HLFB 5EUHA 3SSQA 3M1VA 1FO1A 1G3OA 4L75A 2P9PA 5C5JA 2Z57B 5D3GA 3O44A 2CPEA 2YHYA 2IVFB 2CZ4A 3W3DA 1VQ7N 2BDPA 4M5NA 2HIYA 3T5LA 2YKMB 4NLUA 1N34F 4Y2AA 4EEYA 3CM6A 4NYFA 5RUBA 1HQEB 3QEWA 3QIPA 3HOSA 4P9SA 2Z1HA 3FMBA 4K42A 2VJUA 2DD8S 3IM8A 3HL8A 4FF2A 3BF3A 4X4UA 3NHGA 3QGPA 1I94F 2JWNA 3AARA 2HNZA 1WORA 3L0QA 2I5JA 3RBXA 1HNWJ 2AWZA 2ZZNA 3OYGA 1U1RA 3SQOP 1Q7YT 3ZEUB 2VFVA 4K4XA 4P2MA 2W7OA 3V1OA 2CQDA 2W2OP 3EVWA 5CXTA 1FKOB 1HX1A 3POTB 3J7YP 4CRJA 1M1HA 3JQMA 3AB2B 1S0NA 1D8YA 3KLEB 1UOCA 4Y2KA 3ID8A 2KVIA 4HT7A 4CFCA 4ZVRB 2EHGA 4OYIA 1WOQA 1REGX 1BA1A 1NMNA 2YKOA 2W2QP 4OHYA 2BYCA 3GP9A 4JI1F 1V4TA 2J6SA 3AVFA 4PG7A 5SUHA 4MK9A 3KG0A 4Y2CA 3NAIA 4C8MA 4OZ5A 2O01C 3VQCA 1UAWA 2GMHA 1YVNA 4FLYA 3MPVA 1YTUA 5B09A 4B3MJ 1M5VC 2VWBA 2I9SA 3GG1A 5BPLA 2EFPA 1KD1T 3HD2A 2NUHA 1BCMA 2O8BA 4QWDA 1X9WA 5A0YB 2R3VA 3UWTA 4FNIA 4CJKA 1PBAA 4WK1A 1ZM4A 3AVCA 1CZAN 1KLMA 4WFBL 3OUYA 1IKXB 2D3O1 3CM5A 3D2WA 2W8KA 4F25A 4RW4A 4BROA 4DQ8A 1VRQC 4N77A 2CJAA 2E20A 3GR1A 4KFBB 1C1AA 2WTFA 3F0NA 3N4WA 4FW2A 5MLCV 4Y0WA 2ZJPQ 8RUCA 4OYXA 4A8KA 1ASWA 2MKSA 1FXRA 2B7CB 3I33A 1NAQA 1WHXA 4EYIB 1TL7B 3PR4A 4W4MA 1B7YB 1GEHA 1T03B 1BIUA 4DR2K 2WOMB 4JI5J 2NXCA 3CMAN 2HSTA 2RS8A 4YR0A 2RH3A 1WACA 2Y3YA 1RTIB 3KLHA 4EAHD 4F4YA 5C2DA 2UU9K 3MR5A 5AQMA 4KR0B 2OEKA 2CZVC 3NP5A 4BWMA 4DPTA 2KFZA 3MECA 4RW8B 2Z4PA 2Q31A 3G86A 4IOBA 3A5OC 4WCEL 4N8NA 2WAQD 3AXKA 2YKNA 2YI1A 1FERA 4DSJA 1U2VB 3PRDA 3D2FA 4FJKA 2B4UA 2BE9B 1RI7A 5A8WB 3R5AA 4L3QA 1W25A 3R5JB 2W8LA 1FXLA 1UCNA 5DLFA 2GJ2A 2NSBA 1RT6B 3OR1A 4B02A 1HIYA 2P9SA 1Q9XA 2M88A 1K73T 2WB4A 4BCAA 2OJ3A 2N4CA 3SUOA 1BISA 2NPFA 3TZZA 2O3DA 2IIRA 1E3MA 1SH2A 2IYGA 1TKZA 4BE1A 1X8DA 1QM9A 2FVRA 3KDOA 3UCUP 2CNOB 1OWXA 4B9TA 3I0SB 4YDDB 3N28A 3AV9A 2YNHA 5KAKA 1EP4B 4BDPA 1KTVA 1JXEA 3H40A 3ISNC 1Y97A 1IKYA 2IJNA 3IWLA 1VSFA 2RT3A 2YKQA 3SCXA 3HHLD 4C3KA 5BYRA 4N56A 1PCAA 3BKUA 2V7YA 4L8RB 3N01A 4J91A 2B4VA 2BX6A 1MDUB 3DOMA 3LDNA 3FQKA 1ASVA 2LEAA 3DRPA 1CJKB 2ZJRL 1AXQA 4LF4K 1QQOA 2QW9A 1S1UB 2KO1A 1SJ1A 1HPZA 2ZHAA 3BJYA 3WNFA 5HRRA 1YRXA 2C3PA 4A2BA 3D4JA 3TUIC 5LJVA 2XS2A 2IOCA 3HSZA 4HH0A 4DLGA 2QEXN 4FO0A 4DOZA 3BQ1A 2NZCA 1SJRA 1PYOB 2XSFA 4DR6K 4JI8K 2JLFA 4H0TB 1ZPWX 4TN2A 2IAJA 2RIJA 3K5PA 2A10A 2GHWA 4YB7A 3WHIA 3MN7A 1HR0F 2OTLS 4TNOA 3BEXA 1GX6A 2BJ7A 2BJ1A 1KOOA 3OJSA 3FNNA 4UOFA 4CJSA 3AVNA 3PW0A 4J9LA 3NS6A 3PW4A 3Q22A 4Q45A 3P8BB 1RDBA 2MMYA 2CXEA 4MDAA 1REVA 3ENWA 2BUNA 3DI6B 4H4KA 1XR5A 1I5OB 3DLGA 2IMWP 4CH0S 2XLJA 2HHHK 2J9EA 4N8OA 2IVMA 3HBTA 1HNIA 1WSFA 4FS1A 1PJ7A 2K3IA 3O9TA 3KUGA 2FHOB 4ILRA 3OS0A 4M5JA 1NHVA 4OJ3A 1KXPA 3RBZA 1ACMB 1RWVB 5CYQA 4EO6A 1S6QA 4JI0J 1JLCB 1JLFA 3HVTB 5TKYA 1WUUA 3ILIA 4CLWA 2O66A 4DSEA 3TJ8A 3C16B 4B9MA 1HBMA 4J9OA 3SDEA 4JKFA 2CPHA 3R2DJ 2XMTA 2DJWA 1OQ6A 2VQFF 3PIOL 1FFWB 4K7QA 3H4DA 1T9VA 3OW2R 1OY6A 2LXIA 4YP3A 2DHSA 5F2RA 3TWHA 2HQIA 1TKTA 2EEYA 2EG2A 4ZP6A 4FJJA 4FPAA 3SPYA 4DLEA 4LBIA 4K4TA 3C94A 2Z1IA 4ANDA 4ILJA 2NZ4A 3MM8B 3VGMA 2ATLA 4DCPB 1PJ5A 4J8FA 4ATNA 2OELA 3IM9A 3MUMP 1H0HB 1ZZFA 4KPYA 2WB1D 4DX5A 4ILMA 2QC3A 2BXJA 3ZTQA 4GO7X 1KN6A 3T5JA 1PO6A 4DR3K 4DV5J 4Q43A 1N32F 1OSCA 1R6YA 4JHDA 4NLRA 4LF7J 2DT9A 2XMJA 2X1GA 3W66A 2C2MB 4JD2B 3DYAB 2XNQA 4IJAA 1S7HA 3J80Y 2WONA 4PL8A 2E6LA 5CABA 1IKWA 3HF5A 2EWSA 1N8RO 1JB0C 5CYMA 2F8TA 4WJBA 1VQ9S 1V4SA 1X1PA 1DT9A 1VQNS 2VDIA 4ID1A 4LH4A 1GLLO 4JI3F 3EVOA 3ZZOA 3S7RA 1ASUA 1OH6A 1FRHA 1XIQA 2F4VJ 2H65B 1LQ9A 3QFUA 1S9GB 2VPZB 1T05A 2F8MA 3ID6A 1G1XA 1VQSA 3ZSVA 2YHXA 1IQZA 2A6MA 3N5BA 4CEAA 3OL7A 4PWDA 2O5DA 1LWCA 4CIFA 1IJEB 2NUBA 4RLEA 1UWAA 2XC9A 1WI8A 2VU5A 2VGNA 1OVQA 3ZZUA 5HANA 4KHPJ 3U7JA 3VA3A 1T0TV 1NGBA 1RT5B 3NG8A 2DTJA 2HVHA 1YRUA 3BGOP 1FJGF 2E5JA 2FBTA 1OPZA 5F8IA 1BO5O 3NVKA 4JKEA 3SYZA 3RW7A 4R8UB 2BBEA 4JKGA 3R5DA 1YJRA 4ZVPB 2PA8D 3J7Z5 4IG3A 1XMOK 2XMVA 2VYPA 1ZM3A 4P52A 2BR0A 3OFGA 2QV6A 1Q81O 3EZOA 4ZOSA 2CZ9A 4ECSA 1ZYQA 4LBHA 1QZ5A 3OBIA 1MROA 1WWHA 4TYAA 3O80A 1HD1A 1M1KT 1DQ9A 3U1LA 4K0KJ 2MY7A 2DPJA 1NZ8A 3MWTA 2DNMA 4J2BA 2VG7A 2KT5A 2QN6B 3UFCX 5IM0A 2IVYA 1NMDA 1VSHA 2G8IA 2VFUA