1TKTA

Crystal structure of hiv-1 reverse transcriptase in complex with gw426318
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
534
structure length
515
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Pol polyproteins [Reverse transcriptase], Chain A
total genus 135
structure length 515
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tktA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tktA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tktA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tktA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tktA05
5KFCA 1SL0A 2JEIA 4IR1A 1FKOB 1JLQB 5DG9A 2V0NA 5J1EA 2HNDB 4ZPAA 5K14A 3ZT4A 4ZVHA 4EBDA 2OPPB 1RT3B 4CESA 4MK8A 1TKTB 3F73A 1X9WA 4XPEA 3SUOA 4RG8A 4KBIA 3U6FA 2ZD1B 4EBEA 1T3NA 3OL8A 1KVAA 3F9KA 3KNAA 2D0BA 3DI6A 3KLEA 1WAJA 3NH1A 4KB0A 2HWIA 3PO5A 3BSNA 3HJFA 3ASMA 4K50A 1OS5A 4B9LA 3H4BA 4BE0A 2W8LA 1A5XA 4HYKA 4FS1A 2YNIB 3FFIB 2HMIB 4J9LA 3LAMA 3JYTB 3C95A 4K4VA 2V4QA 1RDDA 3K59A 3QETA 5D3GB 2ASLA 2EC0A 4EBCA 5KG2A 3L2WA 4DQSA 1EETB 2HAIA 2FC0A 4J9QA 1D1UA 4DTPA 3HHKA 3NAEA 4YFUA 4CF8A 3IRXA 1D8YA 3DLBA 4TQRA 3PW7A 3OYKA 4CEZA 3HVTB 4M95A 3QO9A 4FJJA 2AX0A 2XRIA 4JUZA 2HHUA 3AVHA 3G6XA 1QSSA 2RDIA 3PHEA 3KJVB 1J9AA 3HXMA 4JV1A 3I5AA 1C1CB 4F2SA 1LWFA 3GV7B 4NZ0A 4ECXA 4KB7A 4QW8A 2ZQBA 2PZSA 3P83D 2YKMA 1SUQB 1ZBIA 4ECTA 4I2QB 1NKBA 4FLYA 1LWCA 3NMAA 4G1QB 3K2PA 3VQ5A 4H4OA 1J5OB 3RMBA 4RW4B 2IBKA 4CJPA 1TKXB 2W7OA 4PWDB 3DRRA 4ZHRA 5HRPA 5FDLB 5DQHA 1LW2B 4ECSA 3H98A 1RTJA 3MR3A 2KZZA 1XC9A 4ZTFA 4QAGA 3HP6A 1S1XA 4OGCA 3AO3A 3DLKB 3KLGB 5DLFA 4NRUA 1JLFA 4IG3A 4RNNA 4CERA 4CHOA 3AO1A 1WSJA 5FRNA 3H5SA 3HO1A 3NF9A 4ICLB 4MKBA 4Q44A 1EP4B 1D0EA 1MMLA 3VQQA 4N5SA 1Y97A 3M9MB 3O4QA 2HWHA 1D9FA 4FJ8A 1RT2B 4H54A 3V6JA 4KFBA 5F9NA 2C2EA 3VQ4A 2WCXA 1TKZA 3EYZA 2B43A 5EWEA 1ZBLA 5DK5A 1YTUA 4IR9A 2OPSA 3VQSA 4CJ4A 2GIRA 4CK3A 3P1GA 1CZBA 1S48A 4R5PA 2RPIA 3MEDB 3ZCMA 1HRHA 1C0TB 3HPOA 2RKIB 2EX3A 4F4YA 4FLTA 2E9RX 3KOAA 3OYJA 1HYZA 2VG7B 2JEFA 2IOCA 2BRKA 3ISND 1X9SA 3PJXA 1LWEA 2AU0A 3C6UA 3DOLB 2ALZA 1XR7A 1Z4UA 2HHWA 5KFRA 1S1VB 3RR7A 5HP1B 3C6TB 1B9FA 4HCBA 3NH2A 3TAPA 4GC7A 1VSMA 2OPQA 3UR0A 3AVAA 4I9LA 2R2RA 4HVJA 4B08A 5KFFA 2RDJA 4MFBB 4DF8A 4O3RA 3BSCA 4DL3A 4EEYA 1DTTB 2G8VA 2YNFB 3TR8A 1CZ9A 2KFNA 2XC9A 3L8BA 1HQEB 3N6LA 1IKWB 2E9ZA 2R8IA 4FZXC 3AVCA 5SWMA 3OYMA 2OYQA 3RMCA 2R8KA 2W9CB 2QK9A 3AVKA 3EY1A 4ECQA 4ECUA 4Y1DA 3NFAA 1JLBB 3ULDA 3M8PA 4CF2A 3PX6A 2P1JA 4O55A 4RW8B 1LAWA 3ALYA 3HVAA 3TAMB 4AHRA 3QERA 5KFKA 5J2NA 3OL9A 4FJMA 1BCOA 2C2DA 3DLGA 3UPFA 3TQ1A 5HROB 2VA3A 1U4BA 4GW6A 1DTQA 3DLEA 5KG1A 2DPIA 4I2PB 2ZKUA 1L3SA 4M3YA 3QEIA 3K57A 1KHWA 3NAIA 2J6TA 1DLOB 3CG7A 1FKPA 3CFOA 4E7IA 1RTHB 1WSGA 4M3XA 4JS5A 4ZP6A 3AVMA 2WOMA 3OYEA 2WHOA 2BR0A 3V9ZA 1TVRB 3NCIA 1BQMA 4M94A 1REVA 3AVGA 1HQUA 3DOKB 1C0MA 3K58A 3MEEB 3AVNA 3SUNA 4FJHA 3OYGA 1HJRA 2OZMA 3M8QA 4K8ZA 2YKNA 1IKYB 3SJJA 4ELUA 4NRTA 3DRPB 4PQUB 3KHRA 4EZ9A 2IAJB 4DEZA 1S6QB 1GOAA 5C42B 3G6VA 1S49A 3AVBA 4F3TA 4B9MA 4NYZA 1LW0A 1QS4A 1S1UB 2IM2A 4CEOA 1IH7A 2B5JB 1R0AB 3U3YA 4ED8A 4DSJA 3D28A 4Z4HA 4Q0BA 2DFHA 2AGQA 3DDKA 2D7SA 4KREA 4B9NA 4J2EA 4C8NA 2GUIA 5FROA 2Q3SA 3KD5E 4CFDA 3GIKA 4K4XA 3LP2B 3MECA 4WXOA 1RNHA 4AHTA 5C42A 5DG8A 1Z25A 1S6QA 4E7LA 5KRTA 3U3GA 4NLSA 1NJYA 1FK9B 4PQUA 1HNVB 2HNZB 4Z4FA 3OYDA 2G8UA 2B6AA 2YNHB 1VSFA 2X78A 1UWBB 2WB4A 1KHVA 4FLWA 2RF2B 3MEEA 4KRFA 1RAJA 2JGUA 4L8RB 4C8OA 3KTQA 4AILC 1JLAB 2HHTA 5CYMB 2QXFA 4CJQA 4M3WA 4ED1A 3KHLA 3MXMA 5F8JA 3RAXA 3BGRA 1RTHA 3QEVA 4WE1B 4B9VA 3DYAA 3MEGA 4KI6A 3H40A 2DY4A 5HROA 1GX6A 3DLGB 1RBSA 3NBPA 4KE5A 1RT6A 4E3SA 1SKWA 2Z1GA 4FJ9A 1NHUA 2P5OA 1HYSB 5L9XA 4FJGA 3TAMA 4Y34A 1T7PA 3ZSZA 1YVFA 4FK2A 3LP1B 4ZPBA 1NK6A 3NBPB 5CZ2A 4IRCA 2WTFA 4CJTA 4EYIB 3NF6A 4J9OA 1SKRA 5KT3A 2W9CA 3L3VA 2ZE2B 4TN2A 4W5TA 2KW4A 1HQEA 4NLOA 3NH0A 5CYMA 4EO8A 2W9BA 2XI3A 2IGIA 4OKKA 1ASWA 2IJNA 1W9HA 4FJNA 2FVQA 3L2RA 3KIOA 1FK9A 4Q5VA 1K6YA 1ZBFA 2I1RA 1SH2A 1RTIB 4KPYA 1C1BA 3GIMA 4HUFA 4DL7A 4KHRA 4FM2A 1IKXA 4CGFA 4DQRA 3SZ2A 1FXXA 4FXDA 1TV6B 3O3HA 4IDKA 4FLXA 1TP7A 3C6UB 4QWDA 4FJKA 5JUMA 1SH3A 5KFLA 4RNMA 2UVUA 4E19A 5KFJA 2J6UA 4PA1A 2G8FA 4WYLA 4IH7A 5DQIA 3B6OA 2B5JA 1R0AA 4CJKA 3AA5X 3FRZA 3SQ4A 1RBTA 3QGGA 2FBVA 3RBDA 1ZTTA 1EKEA 4CEAA 3ZSWA 5CYQB 4XIUA 3SPZA 3N6MA 5J2MB 3OYLA 3KLFB 4UQGA 1BL3A 4JLHA 4BDZA 1VK0A 1S5JA 4I9QA 3RTVA 4Q8FA 1MU2A 3PJWA 3KHGA 3TAQA 1RT2A 1IKYA 2YKNB 3M8QB 4LY7A 4OGEA 1TL1A 1RTDA 4GC6A 3DOKA 4IKFA 4ZMMA 3QNOA 3OS2A 1S0NA 3T5LA 3PW5A 5KFGA 4TY9A 1TVRA 4Y3CA 3JSMA 4ZPCA 1VSHA 2F8SA 3DRSA 1JLFB 4NLUA 1S1XB 4DS5A 1ZBUA 2R8JA 3RRGA 4J9PA 3WNFA 3N6NA 5F8LA 4KHSA 2G8WA 1DTQB 4CEQA 1LAVA 2ITGA 3DLHA 4FJXA 5FDLA 5HBMA 3MFIA 5KFZA 3DRRB 3QEWA 3BR9A 2YV0X 4RW4A 1XHZA 4H4OB 1J5OA 4K8XA 1TK0A 5F8IA 2OA8A 5J2NB 2ILYA 5EUHA 4NYFA 4O0IA 3TAEA 5I3UB 2QKKA 3OHBA 2YKMB 3OLBA 3RB0A 1U47A 4RW8A 2CKWA 2YHBA 3RR8A 3QEXA 3D5MA 4NLTA 1JLBA 4FZZA 1WNEA 3KJVA 4CGJA 4B3OA 4DU3A 1I39A 5KT6A 4OL8A 3KK2B 4HTUA 4ECYA 4CCHA 3OY9A 1VSDA 1CLQA 4Q45A 1RDAA 2FLNA 2GBZA 3AA4A 4FYDA 3V6DB 1RDCA 1ITGA 4EZ6A 5HLFA 1DTTA 1QAJA 3H59A 3CIZA 3OL7A 4O3NA 4NLDA 4CF9A 3D45A 1L5UA 1CSJA 4ZP7A 4ZVGA 3VQ6A 3AVIA 1HARA 3LPTA 2DFEA 3RMDA 4CFCA 4G3IA 3C6TA 3DMJA 4TXSA 4NLRA 3QLHB 2OH2A 3AA3A 2F8EX 3FFIA 4DL4A 3TANA 4ECZA 1SKSA 1YT3A 3ZSOA 2XGQA 2P51A 3TI0A 1BIUA 4O0JA 1KLNA 2E4LA 1NK5A 3VA3A 1QSLA 4DTJA 1S0OA 3BQ1A 1Q9XA 4OLBA 3MEDA 2WRMA 4QCLA 4R5PB 1BISA 1Q8IA 4HKQA 5KT7A 1BGXT 3GILA 1L3VA 5K14B 4K4WA 1YVUA 1TKZB 5J1EB 3QYYA 1JXEA 2D3UA 3DMJB 1JX4A 4CIFA 4DFKA 2W42A 1EP4A 3GV8B 4YNQA 3PY8A 4ELVA 2E6LA 4AH9A 2ILZA 2FVPA 5T14A 2R2UA 4CEFA 4IG3B 3TABA 1IO2A 1I3AA 1U45A 3M9NB 1QQCA 3BSAA 5KFPA 3PW4A 1VSLA 3LWLA 5HLFB 1RTJB 3V6DA 2IDOA 5KFEA 5JS2A 2KZMA 2X6NA 1BQNA 4ZHRB 4KO0A 3A2FA 1TKXA 4J9RA 3QEPA 3BDPA 1J54A 4N41A 4G1QA 3EZ5A 4CHYA 4DTNA 3SV4A 3D0PA 3FQLA 4YMEA 3KK2A 2FJWA 3OYHA 3T1AA 1RT1A 4MKAA 5SZTA 1RA6A 2ASDA 4CGHA 3O3FA 5KG4A 2E9TA 2NUBA 3TWHA 5I42B 1LWFB 3UQSA 2XCAA 3OSNA 1Q9YA 1TGOA 3FQKA 3RRHA 1NHVA 4ED7A 1UA1A 3GV5B 2FJXA 3CFPA 4JS4A 5I3UA 4RNHA 4KAZA 3ZSYA 2PY5A 4URQU 2D0CA 4N76A 4WFXA 1C2PA 1NJWA 2UVVA 1JL2A 4DSKA 3KMSA 1W0HA 4M42A 1S1WB 2VG5A 1WSIA 1S6PB 2R2SA 2XGPA 3V9UA 1CXQA 4K4ZA 1TK5A 3DRSB 4J2AA 3PW0A 3JSMB 2FVSA 2X74A 3Q8PB 3RWUA 1JLGA 3KHHA 4ZPDA 1QSYA 4RW9A 1TL1B 3G6YA 4EP5A 3HPHA 2AGOA 4URGA 3RAQA 1MU2B 2V9WA 1WSFA 5FRMA 3I8DA 1T94A 4FLUA 2YNIA 1RDRA 5KFVA 1WSEA 3KLFA 2HW3A 1U09A 1C0UB 4N56A 4ED6A 3ITHB 4TSXA 3ZT2A 3QIPB 2EHGA 4KHQA 3TAFA 2C28A 3CJ2A 4DQPA 4IBNA 3Q8SB 5DLGA 4H8KA 1QAIA 4DTSA 5L1IA 2BE2A 3DI6B 4E7HA 3THVA 4U6PA 4DWIA 1N48A 2GV9A 3IGVA 4CIEA 2XI2A 4ZTJA 4NLWA 4IFVA 3OSPA 2FBXA 2O5DA 3AVLA 3EPGA 3TARA 5J2QB 1RYSA 4QOZB 4IRKA 2C2RA 1RT3A 4E89A 3V1RA 3S3MA 2PYLA 2LSNA 3OLAA 4ECRA 3SFGA 4IDKB 3L3UA 3BJYA 1SH0A 4OPJA 1IKXB 3OVNA 3QLHA 1FKOA 1BI4A 3NKYA 4O4GA 4CHPA 1B92A 4MIAA 1UOCA 4B8CA 1RTIA 5KG5A 4DFMA 1N6QB 1TQLA 3NF8A 4F4ZA 3M8RA 4RW7B 3K5LA 3RB6A 4ZVFA 5KFBA 4DTUA 3KLVA 4BDYA 4DQIA 2E6MA 3FDSA 2DTUA 5F8NA 1T03A 1VSEA 4FJ7A 1KLMA 1C1AA 4NLXA 4W5OA 1JIHA 3VQ7A 4CHQA 4W5NA 3O4NA 3GQCA 1NOZA 1EX4A 2X6SA 3IG1B 3VQ8A 4B3OB 2HVHA 2J6SA 2V4RA 2GIQA 4WFZA 3LP1A 1RBRA 4YP3A 1HYSA 4KTQA 2F8TA 4CK1A 1IKVA 4YR3A 1ZTWA 3CDEA 5F8HA 1RT4B 4AHSA 5HBMB 4NLQA 4LSNB 3KLHB 4FW2A 1D5AA 4CGDA 4BWMA 3DYAB 3MEGB 3MAQA 2HVIA 1F21A 3H4DA 2O4IA 3PZPA 4WE1A 3HSTB 1T05B 3QGHA 4Y1CA 4DMNA 4F4KA 4IFYA 5EWFA 3K5OA 4K4UA 4FLVA 1RTDB 3BREA 3NF7A 2RF2A 1K1SA 4Z4EA 5KGWA 4IOBA 4DL6A 2Z1JA 3V9SA 4GMJB 1T8EA 5CY4A 1TKDA 1JKHB 2B6AB 5KFHA 4RNOA 2HNZA 2IC3A 1HNVA 2QKBA 4Z4GA 2KFZA 4YQWA 3I0RB 5J2MA 3ZT0A 2IS3A 5CYQA 2OPRA 3IGNA 4WFYA 3MECB 4I7FB 1GOCA 2ETJA 4J2BA 5C5JA 4CJLA 4CECA 1NK9A 3NGYA 1NJZA 5J2PA 3NGDA 1RCHA 1RT7B 3KK3A 4N47A 4J9SA 3ZSRA 4DFJA 1S9FA 4Q0BB 4IG0A 3PO4A 4Z4CA 5C24A 2DPJA 4FZYA 3HKWA 3LPUA 1S9EB 4MIBA 3MF5A 4CHZA 5DMRA 3ISNC 3SUQA 3LP0B 3I5CA 4DTRA 1VSIA 1TV6A 3SQ2A 3SNNA 1S1UA 3HT3A 5KFQA 1NOYA 1ASVA 4IRDA 4MK7A 2FVRA 3ZSVA 1NK7A 1C1BB 3T19A 2IMWP 1B9DA 1VRTB 4R0EA 4FJIA 2IAJA 1KCFA 3PX0A 2FBTA 3DRPA 3HP9A 5HRNA 4FBTA 3QIOA 3MXJA 3VQEA 5KT5A 2XCPA 4MK9A 1SV5B 1BQMB 4B8AB 2W9BB 3MR2A 2G8KA 3CQ8A 5L1KA 3ZT1A 3L2UA 3PUFA 4WYWA 4H4MA 4F4XA 4BWJA 3HPGA 2ZE2A 1DLOA 1KFSA 4NLGA 4O3SA 3MTKA 4Z4IA 1A5VA 5KTQA 2BGGA 3E51A 2IA6A 2HB5A 2FBYA 4DQQA 3DLEB 5L1LA 2XY8A 1WN7A 3QGIA 1S9GA 5L1JA 3M8SA 3OYIA 1X9MA 3KLIA 5F8GA 5EU7A 2AGPA 1KRPA 2D0AA 4RW6B 3TVKA 2R8HA 1RT6B 4O5BA 4Z0UA 4KAIA 1RBUA 4E7KA 5KFSA 3KKRA 4JV2A 4EYHB 2YNGB 4O3OA 5KI6A 2JLEA 4CE9A 4DU1A 3LDSA 1WLJA 3HVWA 4BE1A 4O3QA 3VQ9A 3OYFA 3BSOA 1SL2A 3BGRB 5KT2A 1IKWA 3AVJA 4MQ3A 4BACA 3LAKA 4TYAA 3IS9B 4FCYA 3V9XA 5KGXA 1JLAA 4DSEA 2YNFA 4CF1A 3IN5A 4M45A 1L3TA 1XR5A 2GC8A 3QZ8A 4KB1A 4NCAA 3V4IB 2Y1JA 4ECWA 1JL1A 4O44A 4QPXA 2JEGA 1UWBA 2YNHA 4XO0A 4MFBA 4NCBA 4DTMA 4NCGA 2BQRA 5HRSA 4DS4A 3E01B 4ED3A 3LP2A 3QINA 5KFUA 4ID1A 1HMVA 1TAQA 4DG1B 1O1WA 3OYCA 2FLPA 2W7PA 3MFHA 1S1VA 3SI6A 3VQBA 4RZRA 1NJXA 3Q8QB 3NDKA 4CEDA 2AWZA 3NE6A 4RUCA 4DL2A 1LWEB 4WXWA 1XI1A 2G8HA 3KD1E 2HNYB 4K4TA 2R8GA 2VG6B 1UA0A 5F8MA 2KTQA 3CFRA 2VG7A 3SFUA 4X2BA 1RILA 4DFPA 4ECVA 2W9AA 3CJ5A 4E7JA 3UDLA 4CEEA 2RKIA 1U48A 1C0TA 1LW0B 3SUPA 1ZYQA 4Y2AA 4Q8EA 3T3FA 3WNEA 3KK1B 3VQCA 2Z1HA 4AHCA 3H5UA 2ATQA 3V81A 1HNIA 1N5YB 3PR4A 4TYBA 3VQDA 2G8IA 3CO9A 3G0ZA 4U7CA 4TY8A 1J53A 4KFBB 4F50A 4KHYA 4J9KA 1TK8A 3SQ0A 4HUEA 5KFWA 3OYAA 2XY7A 3G10A 1NKCA 4FLZA 3OJUA 4OKJA 1HNIB 1N5YA 4LH4A 3V81B 4ZVEA 1HQUB 1REVB 3KK1A 2UUTA 4AHUA 3DM2A 4CJRA 3LZIA 3ZT3A 1XR6A 4CFBA 3EPIA 4FK0A 2WOMB 1XHXA 3IAYA 2I5JB 1VSKA 3KLGA 1FKPB 4DSLA 3DLKA 5KFIA 3NGZA 5KG0A 1S1TB 1S97A 4I2PA 4GVMA 1LW2A 3MR5A 4TLRA 1S10A 2BQ3A 4CEBA 4CGIA 3ZSQA 3BQ0A 4RNFA 4YR0A 3QZ7A 4M3ZA 4I2QA 1SUQA 1TL3A 4C8KA 4DG1A 3CYMA 3M8PB 4B9TA 1C1CA 1XWLA 3E01A 4CJUA 3CWJA 1RA7A 5DQGA 4OPKA 4F8RA 4KHUA 2WONA 1JLCA 4FJ5A 3V6KA 2HHQA 4KTZA 1JLEB 4E1NA 4KHWA 3LZJA 5KFXA 4M3TA 1WSHA 4IH6A 4O44B 3CDUA 1ZETA 2XY6A 3I0SB 3V9WA 3DLRA 2D41A 3IRXB 3OYBA 4M3UA 3G86A 1Z26A 3I0SA 3IS9A 3QIDA 4CGGA 1SL1A 2WK4A 2FLLA 4Q43A 1JLEA 4OLAA 1K1QA 5EWGA 1EETA 1KFDA 1JLCB 4OJRA 2WONB 2XHBA 2UUWA 2KQ2A 1IM4A 2OPQB 3RMAA 5D3GA 4ED2A 4B9SA 4EO6A 4ED0A 5HP1A 4RW6A 5DGAA 1TL3B 3AA2A 4DTOA 2C22A 1EXQA 1BHLA 3CVKA 1C6VA 4DTXA 2IM0A 2YHAA 3DOLA 2IM1A 4QWEA 2UVRA 4C8MA 3H5YA 3P5JA 1S1TA 2XO7A 5HRRA 3S3OA 3K5MA 3K5NA 4RUAA 4CJ3A 1JXLA 4HHTA 1L3UA 4H4MB 3NL0A 3OS0A 5F9LA 2I5JA 3PR5B 3LWMA 4DL5A 2OZSA 3ICLA 4AHVA 1KVCA 3TAGA 1QTMA 4OVLA 3DM2B 2OPSB 1SV5A 5T7BA 1TKTA 4KHMA 3VQPA 1ASUA 4NLYA 3GIJA 4QWCA 4KSEB 2R7YA 4CJWA 4TY8B 4JRPA 4XPCA 1VSJA 4ELTA 1GOBA 3RB4A 2ATLA 2VA2A 2P5GA 1U04A 4ID5B 3AO4A 4ICLA 1WAFA 3MR6A 1QUVA 3H5XA 4NLPA 3SCXA 3AO5A 1YTAA 3LP0A 5CZ1A 2HHSA 1NK8A 4KHNA 4W5RA 4PUOB 3I5BA 4FM1A 2VG6A 4IQXA 3NHGA 1KSPA 5C24B 4PWDA 2HNYA 4LH5A 2AJQA 2D5RA 1RT7A 4RU9A 2CJQA 1LWCB 3HYFA 5KFNA 3OJSA 4Y2CA 4URSA 1HMVB 3QESA 4I7FA 3WNHA 4NCGB 1NK0A 4QW9A 1UAXA 4CF0A 3V1OA 2IC3B 4CFAA 4J2DA 3L2VA 1JKHA 3QO9B 4LD0A 1RT5B 3HL8A 3HVTA 3V4IA 4QWBA 1NNDA 4HCCA 3PW2A 5KFAA 1N56A 1S4FA 4TQSA 2QE5A 4IFYB 3OYNA 3H2LA 2HHXA 3QNNA 4FJLA 1WNSA 1BIZA 3SPYA 1VRUA 5KFDA 2AQ4A 4WZQA 2IM3A 1IG9A 4YR2A 2DFFA 4J9NA 4LQ9A 3RBEA 3H08A 2HHVA 4CK2A 2YNGA 1RBVA 4OKEA 2JC0A 4PY5A 3JYTA 5DGBA 1IKVB 4BE2A 5KG6A 3B6PA 1QE1B 3S9HA 2HMIA 1LV5A 3KLIB 3CJ3A 3O3GA 2BANB 4K4YA 3HM9A 4CJEA 4DLEA 4ZP9A 1JXBA 4JRQA 5KG7A 4KKOA 1S9GB 3BQ2A 5KRSA 4FW1A 1BCMA 2JEJA 3IG1A 1S0MA 4W5QA 1HYVA 3VQAA 3KLEB 4KTWA 3S3NA 3KKSA 3SQ1A 2ZD1A 5KFTA 1KLMB 4K4SA 1NK4A 4B9UA 1T03B 4C8LA 1GX5A 4IKAA 2D3ZA 3UIQA 2OPPA 3T5HA 4CJFA 3GYNA 2XY5A 3CDWA 2BRLA 3MXIA 2HNDA 4F4WA 1TAUA 3LALA 2VWJA 2R2TA 2FJVA 3OHAA 2RN2A 2W8KA 4FS2A 1N6QA 1JLQA 5KT4A 3T5KA 4F2RA 1A5WA 1VRTA 2Y1IA 4O4GB 1KTQA 1CXUA 4FK4A 5JXSA 1BI4B 3WNGA 5C25B 4CJSA 3GIIA 1HPZB 3AV9A 4DU4A 1S9EA 3V6HA 4HUGA 5J2QA 4LSLA 5EDWA 3VA0A 3V1QA 4KI4A 4E0DA 2Z1IA 2ASJA 4IFVB 4R8UA 4FVMA 4IG0B 5KFYA 4DSIA 2FVCA 1D9DA 3KK3B 4J9MA 5J2PB 5E41A 3SV3A 2PYJA 2BE2B 1QHTA 3SI8A 3OS1A 5DG7A 3VN5A 2XWYA 4KV8A 3QIPA 3AO2A 4M3RA 3ITHA 2OPRB 3PX4A 3SYZA 1C0UA 1U49A 3I0RA 4KKOB 4MH8A 4DLGA 2BANA 1ZBHA 4CIGA 1G15A 1N4LA 1QE1A 4M41A 4DF4A 4FBUA 2AX1A 4FM0A 3HVRA 4RW9B 4BDPA 3LP3A 1JLGB 1VRUB 1T05A 4O4RA 3CJ0A 3T5JA 1S6PA 3LANA 2VG5B 3OL6A 1S1WA 4ZP8A 5JS1A 1I6JA 2A1SA 5KFOA 2VWKA 4LQ3A 4LSNA 3KLHA 3EZUA 4E1MA 4CHNA 3HK2A 1RT4A 1W25A 1RT5A 1X1PA 1NKEA 4CJVA 4IH5A 4O3PA 3CJ4A 3PVXA 2JC1A 3NAHA 4WZMA 4CJ5A 3AVFA 2O4GA 2QV6A 1KVBA 4DSFA 4KV8B 5I42A 1RT1B 4NYNA 4EP4A 3C94A 3KMQA 3CM6A 2A1RA 3ZSXA 2IJFA 2BQUA 2F96A 4KO0B 4R8UB 3CM5A 1BQNB 1RYRA 3RB3A 4LSLB 5KG3A 4PUOA 3PV8A 3NGIA 4NLVA 5KFMA 3M9OB 2UVWA 1HPZA 2BDPA 4RW7A 3FSIA 3Q8RB 5C25A 4JV0A 4QWAA 2B4JA 3L2QA 1RDBA 4F3OA 4ID5A
chains in the Genus database with same CATH superfamily
4JV5F 2FDNA 4QIGA 1AUDA 2WC9A 2V0NA 4X84A 4X4OA 1Y00A 2HNDB 2BXJA 1VQ6S 2VC0A 3PYGA 4LF8K 1RT3B 4YY3J 1TKTB 3HSDA 5EY4A 2WW8A 4RG8A 1CZAN 2ZD1B 4HH1A 1FDNA 1S76D 3GG0A 2KFYA 1QLNA 1LXNA 4OJ3A 2JHEA 3PO5A 1DEJA 3BSNA 3VEOA 1VQYA 3ASMA 2GW8A 3WIVA 5C15A 2V4JA 2W8LA 2FJAB 2QI2A 4OZ2A 2HMIB 1HD1A 1NAQA 4DV0K 3Q23A 4J9LA 2ZJQL 2QMUB 1IN0A 3W3SA 4QZVB 2V4QA 3K59A 2HF4A 1QVFM 4EBCA 2BW7A 1X4AA 3OW2M 3G71S 3J7AN 5KG2A 3THYB 2MB0B 1VHIA 1IBMK 1EETB 4ILRA 2B9XA 4O23A 3ZC4A 2VFVA 3BR8A 2M8DB 1TMJA 2CQ0A 2X3GA 5LJ3Y 3CULA 4BC7A 4BGAA 1FD8A 4M95A 1FFGB 4Z37A 3UCUP 2JWKA 3WC2A 2AX0A 1Y9OA 2UUAF 2B9YA 3G6XA 3PHEA 1J9AA 3HXMA 1VGYA 3I5AA 1RK8A 3TTFA 2YKPA 1UETA 3GV7B 4NZ0A 1S7HA 4QW8A 2CH6A 2YKMA 4K59A 1NKBA 3ISZA 3NCQA 3VQ5A 1J5OB 2W2PP 4DMZA 1TKXB 4ZHRA 1ZM3A 2NYHA 1LW2B 3H98A 4QAGA 1S1XA 4QJVA 3AO3A 3DLKB 2QA2A 3Q8UA 4Y00A 3KLGB 2CGKA 3DU5A 4IG3A 3IO1A 2AV5A 1BY9A 5FRNA 1KKHA 4ICLB 4FN5A 3VQQA 4A2AA 1TYQA 4N5SA 1Y97A 3M9MB 4H54A 2F9DA 4DUYF 3EYZA 4PXCA 3IFRA 1KVIA 2J7WA 3EGZA 3AOCA 3GR1A 4M1KA 2EFOA 3MD1A 4CO3A 3CIPA 4M7XA 3VQSA 1WC4A 4AF1A 3P1GA 4JI5J 1S48A 4U96A 1N5TA 2B4UA 3JSRA 3HPOA 4F4YA 2XMVA 3G82A 4ATNA 3JS9A 2E9RX 2O1PA 1NJIT 4QIEA 1LK5A 3SMSA 2JEFA 4OZ0A 1QQMA 5F1XA 1F60B 3GTYX 2E1MC 1X9SA 3DOLB 3M4XA 1MWMA 2ZJPL 4L3KA 1ZAWA 1PAUB 1OY9A 2J8AA 3IRWP 1M1KO 4GC7A 3HHLB 3FBFA 3MMJA 3BKUA 4HVJA 3W5YA 2JSXA 4MFBB 1VQ8N 4HHJA 4Z7CA 3GL1A 2QYGA 4DL3A 4RUBA 3LL3A 1DTTB 3RYLA 2VB6A 2YNFB 3M05A 1ZZNA 1CZ9A 2KFNA 2ZVSA 1WHVA 2ZBPA 2H5IB 3AY0A 4CNYA 1CJVA 3EVMA 3G8SA 5IQQA 2OGUA 3AVCA 4E1JA 3H25A 2R8KA 1OMSA 1RJJA 4BR4A 1EB0A 4B9QA 1HJOA 4ECUA 3MWTA 3V4MA 3CJBA 3E8OA 2XMKA 2BKOA 2DBBA 2P1JA 1LFPA 3SQOP 2XZWA 3IUCA 3EVOA 3CO0P 2NRHA 2ZH8A 5J2NA 2J9EA 3GYXB 3MMBA 3DLGA 3LGHA 4NO7A 4QBUA 5BRHA 2OKQA 1DTQA 4I2PB 3H1VX 2LQBA 4A8MP 1TL7B 4JS5A 3RU0A 2WVCA 3MPYA 1U2RA 1NDPA 1OY6A 4ZOSA 3UE5A 1I51B 3OVAA 1FX4A 4DV7K 2XSJB 4DV4K 3I4PA 1WUUA 3SMPA 1REVA 2UXCK 1RAOA 4KH5A 2LLZA 3GPAA 1N33K 2VBZA 2CJXB 3SUNA 4DR6J 1HJRA 4K8ZA 3M8QA 2YKNA 3SJJA 4JV5K 1Y64A 2NPIA 4DEZA 3PKYA 3G6VA 2BE9B 1RLDA 2Z57B 1S49A 3AVBA 5ETRA 4Y0FA 2A42A 2B5JB 1R0AB 1R8PA 4JK9A 2HVEA 4EWTA 2NXNA 4DSJA 2B56A 3HM8A 3K8VA 2MKSA 3D28A 1YLXA 1HLUA 2J9CA 2NUUG 4IEEA 1YX2A 2HFOA 5FPEA 4KREA 4J2EA 2Q3SA 1GMVA 2D69A 3KD5E 4CFDA 3GIKA 2KT3A 1NB2A 1YVNA 2YXLA 4CYUA 1RNHA 4FSVA 4CZHA 1S6QA 2QWLA 4E7LA 4PG8A 1F5AA 1WHWA 5KRTA 1IQZA 4NLSA 1NJYA 3AJDA 2DD8S 1HNVB 2HNZB 3OYDA 2B6AA 4H0VB 2CYYA 1VSFA 3WXLA 3JAMO 2WB4A 3NNAA 3ZLJA 2JLGA 4NASA 1KHVA 4PPZA 3MEEA 4KRFA 2CPYA 4WK3A 4HACB 3HD2A 2GQ2A 2HHTA 5CYMB 2VWBA 7FDRA 4M3WA 3KHLA 4K0KF 5F8JA 2M5YA 3QEVA 4WE1B 4I0WA 2KJVA 3DYAA 4MDAA 2P9IB 3R8YA 4DL0C 5HROA 1YG0A 1RBSA 3NBPA 4KE5A 2Z8QA 2EFGA 4B02A 2E5GA 1WC0A 1FEEA 4CH7A 1YVFA 1NK6A 4AXJA 3UFCX 2BJDA 4CJTA 3JS6A 4F04B 4ANDA 2AP1A 1SKRA 2CWXA 4W5TA 1NMNA 4ZLNA 2W9BA 3LM2A 3R6GB 3D1QA 3MUTP 3HSZA 1ASWA 2KDOA 4JK7A 2OTJS 5K20B 3PKMA 1W9HA 5CXTA 5AZIB 3ZTRA 4OZ3A 4KR0B 3OFFA 1IUJA 3EGNA 3I55N 4LUBA 3C65A 2I1RA 5LMUF 2KJWA 1S7IA 4B3RK 2HS3A 4WQ5A 1NPPA 2YWWA 4FM2A 4DQRA 4CGFA 1SPBP 3CCMS 2RH3A 2QLFB 1WKJA 3CDBA 2CH5A 2GEMA 3GYGA 2DB1A 4WTOB 5JUMA 1SH3A 5KFLA 4ZLPA 1VQ7N 3VOVA 2UVUA 4E19A 5KFJA 2CPJA 5LM7E 5TKWA 2GX8A 4JI3J 3MAAB 5A6PA 4CH1A 1XMOF 5CYJA 2J6UA 2G8FA 4WYLA 3I82A 3NOCA 3B6OA 1VQLS 3AA5X 5CE3A 3JAMU 1M5VC 4HHUA 2E1ZA 5LMNK 2QLXA 3RBDA 1ZTTA 2LMIA 4XIUA 3KLFB 1BL3A 4JLHA 4BDZA 4M5NA 1VK0A 4I9QA 3RTVA 4EHTA 3TAQA 1RT2A 3W3DA 2KLAA 3M8QB 1ZA2B 2UXBF 3NXZA 4JI6K 3E66A 2F8HA 5KFGA 2J5AA 1N34K 3DRYA 4XDCA 4CVNE 3FNNA 4IJAA 1T44A 2R8JA 2E1RA 3N6NA 1DTQB 5KFZA 5LY3A 3OR1B 3T1HK 4RW4A 2E1CA 5J2NB 2HLUA 4NYFA 4O0IA 3OHBA 2MKIA 1WNEA 4A2BA 3KJVA 2HHHK 3CMES 4DU3A 3SIPB 1PSDA 3KK2B 3C66A 4CCHA 1IBKK 4PABA 4Q45A 1RDAA 1F9FA 3L7UA 4MJKA 5T41A 4NOHA 4EZ6A 4DZDA 1VC5A 4DV7F 3OL7A 4O3NA 3ZO7A 4CF9A 1SBRA 1CSJA 1PBUA 4BC4A 3FR0A 4KHPJ 4ZVGA 5ELZA 3AVIA 1HARA 3CJAA 3LPTA 4ED5A 3RMDA 1BWFO 3U9ZA 1NDLA 4U7UK 1OYDA 2EKNA 4JYAF 1DFDA 2OH2A 1Q8LA 4BROA 3TANA 1SKSA 3OTOK 1CQMA 2XGQA 3HDSA 3J7YP 1OPIA 1WUAA 4O0JA 1KLNA 3E9PA 6FD1A 3CD6S 2YWFA 4OLBA 4QCLA 2OO4A 3PYDA 3CMAN 3JB9k 4WBFA 3G9CA 1Q8IA 4HKQA 3AD8C 4L76A 2OTLN 2QWMA 1I94J 3TZYA 1BA1A 4FPIA 4OFZA 1L3VA 5K14B 2GCFA 2DYAA 2UUBK 4B3SK 3VGSA 1JXEA 3NMRA 2XHWA 2AHOB 2C1EB 1VLOA 2W42A 1EP4A 4LBPA 4I64A 1N5SA 1PYTA 1CULB 1B3TA 3PSFA 2ZDOA 1IR0A 4YOYA 2FVPA 3NY0A 2CNNB 5T14A 3K0JA 4PKIA 1ZZFA 4IG3B 3D54A 3PW4A 4O8KA 1EWQA 2ASYA 5H9EK 1TUYA 2X6NA 5DM6L 1TKXA 4F67A 4GNIA 1J54A 1PC5A 3ZZZA 3SV4A 2UUAK 4YMEA 3KK2A 2AA4A 3JSBA 5AZJA 3T1AA 3D7EO 3O3FA 2AZ3A 1N32K 6AT1B 1S79A 1LWFB 1GLJO 4WQ4C 3UQSA 2XCAA 3POTA 2I2YA 1Q9YA 3FQKA 3RRHA 2ITMA 4RKUC 2FJXA 3GV5B 4JS4A 3P45B 4UOFA 2YY3A 2E2NA 1G7CB 2HK2A 2NRRA 4JI2F 3FZMA 1WD6A 1HA1A 3CD7A 3S7RA 4WFXA 4J91A 1JL2A 4I6MB 2DNGA 3SMZA 3C14B 2HRUA 4MO5A 3A4TA 2HSEB 4K4ZA 3DRSB 3PW0A 1XNQF 2BEFA 2LA6A 2ZF5O 2DISA 3Q8PB 3KHHA 2Y0SD 3GBTA 5FPNA 1NU4A 2ERRA 2P6SA 3G6YA 3UO0A 1MN7A 2AGOA 4URGA 3K8WA 3I56N 2PEHA 5K9FA 2YNIA 3OPKA 5IC6B 1FJ7A 4N56A 3EZWA 1XERA 4KHQA 5D6GA 3Q8SB 5IT9O 1QAIA 4KC5A 1EQYA 4P7TA 3DI6B 4U6PA 2XBPA 4DR2J 3AAWB 2E5LJ 4NLWA 2FBXA 2UUCK 1RYSA 4QOZB 2LQJA 4QIWD 3S3MA 3R2CJ 2LSNA 2G2OA 3OLAA 4ECRA 4OI2A 2ZBRA 5MLCQ 1IWGA 1SH0A 4HTIA 5AFUH 2RMLA 1FKOA 1BI4A 3TWZA 1NSKL 4A8WA 3NKYA 4B3MJ 5CR4A 1BE4A 1CJTB 2G2ZA 4DFMA 1O5JA 3J7AP 3VEZA 2H4WB 3NF8A 1KOOA 3FZ2A 2HFUA 4WQ5C 3C7NB 4ZS6A 3K5LA 1K0VA 4DTUA 4KT0C 3VENA 4FWMA 3J7ZT 4FJ7A 4IUFA 1FERA 4RWWA 3UNYA 2EWHA 4W5OA 3PFOA 4EUVA 1JIHA 2NS1B 4P72A 2CPIA 3O4NA 1SB6A 4IXCA 1EX4A 2BM0A 2PE8A 2HVHA 4O0NA 1VFJA 2GIQA 1VCTA 2ABYA 1RBRA 5IV4A 2AF6A 3ENQA 1YXQA 3OUYA 1UCNA 2U1AA 1VQOS 2W2MP 4YR3A 1ZTWA 5F8HA 1RT4B 4WQ4A 4TNOA 4P74A 1QJHA 1DHMA 1D5AA 2IHR1 4KJIA 2FTRA 4Y1CA 4ZIWA 4M5GA 2V50A 1FRMA 3IBWA 3MX2A 3W2WA 4IFYA 4HACA 5CQGA 4N8NA 5EWFA 3SCLE 1RTDB 2D1CA 4A59A 4H5NA 1TKDA 2B6AB 4K5RA 3GMGA 4LVNP 1U0HB 2HNZA 4M5DA 2IC3A 3Q86A 1FNXH 4PWUA 2IS3A 2OPRA 4G1PA 1CJKA 2RHKA 1QHAA 2OTJN 3SSQA 1Q78A 2IYIA 3NGDA 2BJ9A 1RCHA 1RT7B 4DFJA 1S9FA 5FLXY 4Q0BB 4IG0A 5C24A 3H45C 3OHRA 3HKWA 4YN3B 1U1RA 1URNA 2HS0A 2GVZB 1G1XA 3QJPA 5DMRA 3P38A 3R3LA 5D4OA 3K17A 3LP0B 4DTRA 1VSIA 3CCMN 3HT3A 1VQ7S 3CEDA 4MK7A 2AJ2A 3Q83A 1M90T 4R0EA 2IAJA 4CZJA 1KR4A 3PX0A 2P9SB 2ZBIA 5HRNA 3FJ2A 2M2BA 3QIOA 1WKKA 3QPIA 2E2QA 4JBCA 3IAS9 5JJBA 4WU3A 1A6LA 3EE8A 3CB4A 4BR7A 1K8AO 4FF2A 5L46A 4DJBA 2WW4A 2G8KA 4NE9C 3IMXA 5HAOA 2B51A 4J5OA 5ETLA 5L1KA 4B3TJ 3E9LA 3L2UA 4JI7K 1C4AA 4BWJA 3CDAA 4BC9A 5BRDA 2YH1A 4NLGA 4Z4IA 1A5VA 3O80A 2HB5A 3L3CA 5L1LA 2XY8A 3GIRA 3OXFA 3AJ1A 1FRXA 1P90A 2DPNA 2B8QA 1KD1T 1X9MA 1RGIA 2YQ3A 4RW6B 3TVKA 1RT6B 4O5BA 1RBUA 2Q43A 4DPTA 2N4CA 1U1KA 5KI6A 1WLJA 1Q81O 3N5BA 3IDHA 4BE1A 3THXA 2K1RB 1NPRA 3VAJA 5IFMA 2GAHC 4KH0B 1P6TA 4BACA 1CJVB 3IS9B 3SAFA 5KGXA 1SS6A 2RUSA 4DSEA 2CVIA 1L3TA 1XR5A 3GJQB 2JEGA 2ZH1A 4XO0A 3NWRA 4NCBA 4NXMJ 4N7TA 4FPRA 2QMWA 1FW6A 4B3RF 1NBEB 1N8RO 4QU6A 4DR3J 5HRSA 3BUZB 3E01B 2AYBA 1O1WA 3OYCA 3MFHA 1HQ2A 2XWXA 4DUYJ 3R9LA 4P9SA 1HX1A 2AWZA 4F02A 1MN9A 3O44A 3FMBA 1XI1A 3KD1E 1HNZF 5ETOA 1EIYB 2VG6B 1BHNA 3LH2S 4M5IA 1BMQB 1FI4A 2KTQA 2DHXA 1N0UA 1RILA 4DFPA 4Y2KA 1Q1KA 2PBDA 2COLA 1SKUB 1RBOB 5GVQA 5RUBA 5DJBA 4AHCA 5HATA 2Z1HA 5JICA 5D78A 4BGBA 2MZ1A 2DXEA 4ZJLA 4TYBA 2G8IA 4WCEQ 1PGZA 2MQPA 5EX5A 4WFAL 4KFBB 3NG8A 2QXLA 2BTFA 5ETPA 1T0TV 4CM0A 4FLZA 3L95X 5AE2A 2ZM6J 2IVPA 1N5YA 4DV1J 4LH4A 3V81B 4BBYA 3KK1A 3DCAA 3DM2A 4LF5J 3ZT3A 2OHDA 5AE1A 5ETMA 2EI5A 4FK0A 4RBTA 1S0VA 2CZ4A 4G65A 4CD3A 5HQ8A 1RWKB 3DLKA 1B4SA 3R9PA 3NGZA 1S97A 4DCHA 2O8BB 1JCGA 3CTRA 3A1YG 1K8AT 2FY1A 1S10A 2PD1A 2HBZB 2EKYA 2GTDA 3DDNA 1MDUB 1WSRA 4M3ZA 3O1BA 4F26A 4C8KA 2UXDJ 3CXCR 2F1FA 2ZNYA 4B9TA 5A8RB 1SIZA 4FPBA 4CJUA 3E01A 2JJ4D 1GQEA 1M1GA 4HI2A 2Q0RA 3V6KA 4E1NA 3KG1A 2YKQA 5IWAK 3LZJA 1M5SA 4P2XA 4D3HA 2CG8A 3CDUA 4DV5F 4ZPTR 3DLRA 2D41A 1YBUA 5EX0A 3OYBA 3G86A 2AW0A 3IS9A 3H3OB 1M5HA 3K2YA 1EHWA 2RQMA 3PLAA 2WK4A 2CDRB 2OFHX 4KQZA 2HZCA 1S6UA 2FJBB 1K1QA 2K1RA 3KZBA 1U1NA 4OJRA 2C2OB 3M2VB 2HLTA 4X62J 2KQ2A 2XHBA 3AQPA 2DR6A 2F4VJ 1LNQA 4RW6A 1TL3B 2HK3A 3FMWA 5E7OB 2C22A 1EXQA 1RUSA 4UT4A 2Y0BB 3CVKA 4DTXA 2YHAA 2XO6A 1RISA 2IM1A 2OANA 1Q7YO 2RIJA 3BO2A 3H5YA 2R7TA 4TKTA 3K5MA 5AQLA 2QEXS 1RCOB 1X4EA 3C2PA 1Z6RA 3ZZUA 1LWXA 1JXLA 4HHTA 1LXJA 2VQFF 5F9LA 2I5JA 3GE1A 2CQ4A 3HSJA 2OZSA 1KVCA 4N77A 1HL6A 2OPSB 1TKTA 4PKGA 3O2IA 4DPOA 4TY8B 4XPCA 1O51A 2RRBA 2DGQA 3MURP 4RPFA 1VQNN 3MM8B 4F36A 2DNOA 2CVEA 3F9MA 2ATLA 1F9HA 3AO4A 4W90B 1JJ4A 3MR6A 3QAEA 2JX2A 1JWWA 5FPDA 3P49B 4JI7F 4OYMA 2VGNA 4PWDA 1WOOA 2NLWA 2AJQA 1LK7A 4G1IA 4K0KJ 2W24A 2D5RA 4U8VA 4GVBB 5IQ6A 4DR7K 4GKJJ 4KRWA 3EEQA 1HWIA 3WNHA 2DRBA 3ET6A 1NK0A 3WQTA 2HIQA 4QIVA 2IC3B 3EJMA 1JKHA 3BBFA 4LF9F 1X3MA 1HR0J 5M1NA 4QWBA 1HBOA 2ZHAA 5KFAA 1N56A 1MG7A 3DLJA 4TQSA 4IFYB 3AQOA 3W2WB 3H2LA 1XNQK 4PRFA 4XH1A 1WG1A 4NI2B 4FWSA 1VRUA 1JJCB 4WZQA 2IM3A 4P7VA 4YR2A 4LQ9A 2LEBA 4K25A 4L75A 3PIOQ 1F6TA 2HFNA 2YNGA 3C16A 3Q7BA 4PY5A 4IOAL 3GE9A 4LFCK 4BRIA 3B6PA 3EZOA 3TSQA 3CJ3A 2YX7A 2BANB 2P5VA 1S9GB 3KJFB 2NSCA 3CD0A 2VFRA 2R7UA 5M2UA 1SIWB 3KLEB 4KTWA 2C3YA 3X3UA 3KKSA 1S77D 5SUHA 1YKWA 2W2QP 1KLMB 1UP1A 1IM6A 3M6VA 1XMQF 5F2RA 1T03B 3FUYA 1CVJA 4C8LA 2ZBQA 4IKAA 3UIQA 2FZKB 1MWYA 2Q79A 3D2EB 1YITS 1GEHA 3MXIA 3PRVA 3OHAA 1JNZB 2ROGA 3J7ZO 1RXOB 2QYCA 1CJTA 3FZFA 2Y1IA 4AT1B 4QR2A 1KTQA 1S5ZA 3M32A 5JXSA 5E3QA 1BI4B 2YWKA 2AJ0A 1RLCL 3RW7A 1YK9A 4CNZA 2FZCB 3WXJA 4KYZA 2XS2A 2XMMA 4UY8O 4ZN3A 3HJVA 3CC2S 4UOCA 3V6HA 4HUGA 2MGZB 4EAHD 2LXUA 2K8GA 4DV5J 3P5BP 4FVMA 3HSGA 4TLQA 4YDUA 3M8YA 2W01A 2JDJA 3QMLA 4J9MA 5J2PB 3PIPQ 1QHTA 4TU7A 4HWIA 2HQCA 4AL7A 5HQMA 3UE2A 4MH8A 3FZKA 1I3OB 2GQCA 2V2ZA 4OHVA 1X4DA 5AQPA 3DGPA 3W5XA 4ZITA 4FBUA 2F8MA 1CG2A 2AX1A 3J7Z5 2RS8A 1OWXA 3CC7S 5BYQA 4JEPA 2IYGA 4JI3K 4R0JA 2HQIA 1OQ6A 1CS4A 2VG5B 3C14A 2V2KA 2AT1B 5JS1A 3SCJE 1LKZA 3VTHA 2VWKA 4LSNA 2HRTA 3BGFA 1E3MA 4P75A 5KAKA 4CJVA 3OD2A 3VWSA 3RG6A 4WZMA 1H6KX 3BGLA 3H90A 5TKYA 1J2VA 3WUHA 4KV8B 2ZJRL 2CADA 4U8YA 3GJSB 4DCJB 5L39A 4YOWA 3C94A 3CM6A 1BD6A 4CZMA 1RKIA 2NNWA 2IJFA 5C10A 2F96A 4OQJA 2HVDA 4R8UB 4BC2A 3PDNA 4AM7A 1RYRA 2BBEA 3LPEA 3RB3A 4LSLB 1YRTA 1KBRA 2VQFK 4WK1A 1AXQA 4KIAA 1HPZA 2VASA 1RWWB 3WDOA 1TUUA 3FSIA 3M6UA 3MD3A 4JV0A 3VAKA 3L2QA 2FF3B 2VU5A 4ID5A 1CULA 2P9KB 3W9IA 3VVUA 1HNZJ 2AYMA 2VFSA 2EFVA 2UV8G 5DG9A 2J9DA 2E7XA 1KTVA 3MPUB 4K2XA 3JTPA 3MOJB 3ZT4A 4ZVHA 1HKBA 5BR9A 3F73A 4MDBA 3TRGA 3N01A 1X9WA 3O6QA 1K44A 5A2QO 3T1YJ 5CA5A 4DV2J 1S57A 1KVAA 1FJGK 3OL8A 2D0BA 2QN6B 2PC6A 1Y4ZB 1VQ5N 4FWRA 1AA1B 5JVHL 2VPXB 2V8VA 4DV1F 2LQ9A 1FRLA 4FS1A 3FFIB 1SQEA 4LJMA 1YIJS 1K73O 3QRQA 2RQKA 2O8FB 3LW5C 1NH8A 5E5NA 3C95A 3QETA 4LVOP 3AAQA 1ZM9A 3TOQA 5BPLA 3L2WA 1RAGB 3AH6A 4ANEA 4DQSA 2HAIA 3CCLS 1OQ3A 5MLCV 4J9QA 4IJNA 1IJFB 3P39A 3CMEN 4DTPA 1TTHB 3HHKA 2A1BA 4ZLJA 4CF8A 4GO5X 2VCPA 3W1YC 3MMCA 1D8YA 3GB0A 1ZC6A 4QYRA 2G4BA 4DUZJ 4JK8A 4CEZA 2N3LA 2LEPA 3HVTB 4Z7YA 3ULHA 3KFWX 1ZBSA 4JV5J 3M30B 4JUZA 1VI7A 2HHUA 3KUGA 2OCEA 1QSSA 2RUGA 4BRCA 2KHCA 4BRFA 4F2SA 1H73A 4JB8B 2ZQBA 1UVIA 2KXNB 4ECTA 4I2QB 1HNZK 2XEXA 4DR4F 4FLYA 1LWCA 3NMAA 1FNOA 2NXCA 3HMJG 3IXQA 3K2PA 3RMBA 4RW4B 4CJPA 2W7OA 3DRRA 5FDLB 3G4SN 5FLXO 1RTJA 2KZZA 1XC9A 3VVTA 2RDDA 1N54B 4X66J 1J5EJ 2NZTA 4OGCA 3OTDA 1M5KC 3QJLA 1UWAA 1Q7LB 5AQQA 2JVOA 3MCMA 4CERA 2E5LF 3H5SA 1IBLJ 3HO1A 1JCEA 3MN6A 4UOHA 4Q44A 1MMLA 3FKBA 2DNMA 2XLJA 1D9FA 4DR1J 2CPFA 1TKZA 3RSEA 3AXMA 1YTUA 5DK5A 3G8TA 1U6BA 4KGZB 1T9TA 3NNHA 2HRYA 4CJ4A 2GIRA 4CK3A 2QSWA 4TVAB 2HKEA 2RPIA 1PIEA 2R4FA 2RKIB 2EX3A 4BQZA 4FLTA 2HVZA 1VQMS 2NRWA 3HX9A 2DITA 1P27B 1YBAA 2PMWA 2V7YA 4ZCLA 3ISND 1DZ5A 2LCWA 1LWEA 2P9UB 4JI8F 2KG0A 3C6UA 2ALZA 1WHYA 1Z4UA 3LQVA 1FFWB 5KFRA 1S1VB 4DZ6A 5F0WA 2ZJQQ 4XK8C 4YHHJ 1B9FA 3A8KA 4PG6A 4K43A 4CLFA 3TAPA 2HHHF 2GZOA 3I55S 1N5QA 2GHPA 2A18A 4B08A 3UDCA 2RDJA 3A8YA 4DF8A 3W5ZA 4CO2A 3BSCA 1SJ4P 4FVCA 5LSRA 4I6AA 4LR9A 5AJ3J 5K5MA 1HBMA 2RHQB 4JI5K 3L8BA 1IKWB 2CNOB 4NEYA 2G13A 1A9NB 3RMCA 3D67A 2QK9A 5AQJA 4ECQA 1VQLN 3VMFB 2MLYA 2GA7A 3NFAA 4F9OA 4A8XA 1T9UA 3ULDA 2QLJB 4CF2A 1X0FA 4RW8B 4DR5K 3AA9A 2P6TA 3A3PB 3OL9A 4FJMA 2CRLA 1U26A 2C2DA 4QS9A 2BKNA 4USIA 1CEZA 3TQ1A 5HROB 1U4BA 4P2SA 1FDAA 2DPIA 1L3SA 1FVQA 1P9YA 3QEIA 3K57A 1KHWA 1DLOB 3CG7A 1FKPA 2VOOA 3MM5A 4QR0A 2BA9A 4ZP6A 3AVMA 3VPZA 1FEHA 1OIAA 3V9ZA 4I6YA 3M2RB 3NCIA 1BQMA 1C0MA 3TTDA 3MEEB 3TX8A 1HLWA 3AVNA 3OYGA 1ZS6A 3EICA 3P31A 4BC3A 4PQUB 2QA4S 3PEHA 3OVBA 2MQQA 1AYEA 3J80U 1GOAA 4CYUB 2VJVA 1W7WA 4B9MA 3WHIA 4LFCJ 4OJGA 4CEOA 2VFTA 5LMUJ 3MUVP 4CBWA 2ASOA 2JWNA 3U3YA 2ATCB 3A12A 4ED8A 2V7ZA 7AT1B 1B7YB 1FT8A 3NGSA 3SCKE 3FCWA 5AQWA 4Z4HA 3DDKA 2KYZA 3QICA 2WVDA 2BJ7A 2GUIA 4KGMA 2UU9K 3MECA 4WXOA 2Z0GA 1R59O 4ZCMA 5C42A 4LMZA 1Z25A 5I3QA 3I8BA 3DOMA 1FWLA 5HK4A 3FE1A 2OELA 3WX4A 2V6AA 4Z4FA 1WEYA 1R27B 1UWBB 3OVSA 2PIIA 4JKDA 5B0FA 2RF2B 3B4DA 1CLFA 3FFKB 5M2PA 4ED1A 3DLLQ 3BGRA 3K7RA 5E3PA 4Z94A 4BRHA 1ZXOA 4B9VA 2NLXA 1CBKA 3THXB 5C0YA 3MEGA 4KI6A 5CCMA 2RU9A 5AQHA 3CMAS 3DLGB 4XH4A 1RT6A 3MMBB 1SKWA 4FJ9A 4IDHA 1VQPN 1NHUA 3DAWA 2P5OA 1HYSB 4Y34A 4DV0F 5AJ3F 3LM9A 3LP1B 4CT8A 1ROFA 2QA4N 2EG1A 4FWOA 3O5TB 3QSYB 4H5WA 1WHXA 3GP9A 2W9CA 3L3VA 1YRXA 5THWA 2CNLB 2KL8A 2KW4A 1XMQK 1HQEA 1YAGA 3NH0A 1VIOA 2V94A 1YDLA 4ED4A 9ATCB 4FJNA 1D8ZA 5E26A 1VQ9S 3O1WA 4CZFA 1FK9A 4Q5VA 1YJ9S 1RTIB 1R8BA 2LDYA 2B7BB 2CQDA 2Z2YB 4C3MA 3GIMA 3MTJA 3HFVA 1QM9A 4KHRA 2CIMA 4KHPF 1E6VB 2Z2ZA 3TA1A 3CCJS 1V6HA 5AQRA 1YJWN 4IDKA 1TP7A 3D4JA 1WORA 4OIXA 4QWDA 1M90O 2XMWA 3ZXWA 3MCNA 1FO1A 4IH7A 4CLUA 4FYVB 2OLWA 4CJKA 3FRZA 3ILIA 3J81O 4JI8K 3SQ4A 3V2UC 1CJKB 1GNKA 2GVDB 1EKEA 3ZSWA 5AXNA 3N6MA 5J2MB 3OYLA 3GDQA 2YX1A 2CNKB 2DNYA 5K8NA 1S5JA 3AGKA 2RJZA 3PJWA 4ES1A 1N5VA 4HDGA 3U9DA 2FHKA 3ATVA 3DOKA 3QNOA 2CUYA 2Q31A 3M2RA 3T5LA 5CAAA 4TY9A 4Y3CA 3JSMA 3P4IA 1GFWB 1VSHA 1PBAA 2MJUA 4M5JA 1C4CA 1S1XB 2YKAA 3LGNA 1UKUA 5F8LA 1LAVA 2ITGA 4JI0K 2CPDA 3QEWA 2QM1A 3HFKA 4JYAK 1XHZA 1J5OA 4K8XA 5F8IA 4OLOA 2ZWOA 2XNRA 5EUHA 2FSKA 2YPZA 2GWKA 4RW8A 2GJ2A 3VF0B 2YHBA 2GIFA 3ZZPA 3D5MA 1YJVA 1JLBA 2NZCA 1RWVB 1Z1ZA 4ES3A 4CGJA 4OX9F 1U8WA 1KVKA 1NDKA 3C3LA 1WC3A 3VHQA 4LSZB 5KT6A 4HTUA 2G0IA 1T11A 3C15A 4CW7B 1CLQA 1P1LA 4NYOA 3AA4A 1XMOJ 4FYDA 1UMJA 4GV6A 4P10A 2F4FA 3BF3A 4OMFG 2Q6BA 2HSTA 3H59A 3SQGB 4BRAA 3UVJB 1RHMB 3D45A 3VQ6A 1GMUA 1FHTA 5EHHA 3L7OA 1VQKN 3DMJA 5IOLA 1KAXA 4NLRA 4Y65A 3CJSA 2LYVA 3AA3A 4CZKA 2A5XA 2MQOA 3J81U 2V4JB 1PAEX 2X1BA 3NLCA 1YT3A 5LJWA 4NXMK 2D4WA 4GO7X 3AHPA 3TI0A 3WIUA 1BIUA 2E4LA 3MXHP 3A5MC 1PILA 2VBYA 2HFZA 4DTJA 1RFQA 2W4PA 3TQEA 1BA0A 3BGOP 3OTEA 2MLXA 1UFLA 3CCQS 4R5PB 1BISA 1R8HA 1WELA 5KT7A 2R7QA 2MSSA 3GILA 2H9ZA 1U25A 1YVUA 3CPEA 3RSEB 2UZAA 1TKZB 1G2EA 2Y9HA 4GKJF 2WVBA 2D3UA 1IQTA 2WFBA 1RU2A 1C0GA 2Z2LA 3PHTA 4GMKA 4DBQA 3GV8B 4H5TA 4ELVA 1X4GA 1T6CA 2ZC3A 1H1VA 1Y10A 4CZIA 5C12A 1IO2A 1I3AA 3M9NB 3BSAA 1VSLA 3LWLA 4I4BA 2V67A 4Q7AA 5JS2A 2A2DA 4H0XB 2UXBJ 4KO0A 1KQSM 5KOWA 3QEPA 3BDPA 4EK2A 4CIOA 2WTUA 4N41A 1LEOA 3EZ5A 3D0PA 3UN2A 3FQLA 4ILMA 3OYHA 1ATRA 3O3LA 4MKAA 4CGHA 5KG4A 5LT5A 3UNGC 1RDWX 3ILJA 1WG5A 4ED7A 1IXKA 2VJUA 3W9JA 1ATSA 2XULA 4FP9A 4RNHA 5D77A 3NGKA 4DPYA 2LKZA 4N76A 1VBYA 2D0CA 1UW9A 1OH5A 1NJWA 4QPTA 2RU3A 4M42A 1S1WB 5B08A 1T9WA 3L0QA 2MXYA 2Y1RI 1SC6A 3DXMA 4J2AA 3JSMB 2W6KA 3R5AA 2X74A 2P2CB 3K89A 4JI1K 3CCVN 3PG9A 3N5FA 3RWUA 3RRKA 4FPAA 4LF6K 5ETNA 2CFXA 4ZPDA 3MPVA 2EWSA 4RW9A 4RO0A 1TL1B 3TJAA 4E2FB 2VPWB 4CQ1A 5M2RA 3RAQA 1MU2B 2V9WA 3VEXA 1WSFA 3M7VA 5EN1A 3MOZA 3IWXA 4XEIA 3SJHA 1Q5YA 2HW3A 3O9UA 4OPHA 1U09A 1X5PA 1QQOA 1VIXA 2EFPA 2VGMA 3QIPB 8AT1B 2EHGA 4BHQA 5CH7B 1F5CA 4AL5A 3KYLA 2BH1A 2QLWA 2BE2A 4PXDA 4CIEA 1NBWA 2XI2A 1YBTA 2ZOGA 4IFVA 2R7XA 4NYPA 2DY9A 1F3FA 3ZZ0A 4IRKA 3N4QA 4E89A 2CG4A 4QYZJ 3SFGA 4IDKB 4DR4J 5AQOA 3BJYA 3HI0A 3WEEA 3BBBA 3OVNA 2JZ5A 1UEKA 3S01A 4V19S 3MCSA 3HHDA 1UOCA 1KN6A 2MYFA 2JL9A 5KG5A 2G9OA 1N6QB 1TQLA 3IM8A 2R7SA 4DPUA 3CT9A 5C2DA 3RB6A 4ZVFA 4DV5K 1M5PC 5CHIA 4LFAF 5BYRA 2D0PA 3P3DA 3CCTA 1C1AA 1WB9A 4DR1F 3WBZA 3A5OC 3VQ7A 4U9RA 4IO1A 4CHQA 5GAEP 2IVOA 3GQCA 2AZ1A 3R1LA 1NOZA 5BN8A 3I96A 3NGUA 3TUIC 4X65J 3VQ8A 3FCHA 3UWTA 2J6SA 3SBTA 4WFZA 3AARA 1HNWK 3RZAA 4HR2A 3LP1A 4FDFA 4YP3A 1HYSA 2H65B 4KTQA 2KU7A 3IBFB 3R7SB 4A61A 4CK1A 5BR8J 1OH8A 5HVFA 3EDQB 4AHSA 5HBMB 3W64A 5B09A 3KLHB 4HEA9 4FW2A 4NB4A 1S22A 1FTRA 4UTGA 4BWMA 2XYHB 3ZEUA 4CGDA 3H4DA 2IVFB 1U1LA 1VQ5S 3SCIE 4WFBL 1N52B 2HG4A 1IV0A 2XS7A 1LOUA 4H5RA 4FLVA 1XBWA 1M1KT 4HT7A 5JVGQ 4LF4F 4Z4EA 1QUPA 1R6YA 4IOBA 1XN9A 2X1GA 5L8RC 5CY4A 2MZJA 2QW9A 1Z2LA 4WU2A 4RNOA 1Y7PA 3MMVA 1KQFB 2ZH9A 4EIAA 2QKBA 2KFZA 3R3TA 3CCRN 5I3PA 4YQWA 5AQIA 3I0RB 3HHEA 4DV3J 1GOCA 1VQSA 4IOAQ 2XG8A 1K47A 4CECA 2QFJA 1SJ3P 3NGYA 3TW0A 3MK6A 4JKAA 2R7WA 1YJ9N 4X4SA 3CQYA 4Z4CA 3IAM9 3PRBA 4DX8H 4FZYA 3MCPA 1URRA 1UL3A 4AFFA 2KH9A 4CLWA 3TZWA 2HURA 3ISNC 2C3PA 1AZSA 3I5CA 4AQYK 1EAYC 1PJ5A 3VF6A 2YBVA 5KFQA 1NOYA 4UF4A 3LDOA 2W2OP 1VRTB 1VBXA 4GKJK 4F3MA 3DRPA 2AP6A 1PJ7A 4OYPA 3I9ZA 3MXJA 1BUXA 3F2KA 2F7VA 3C0BA 2XCPA 4MK9A 3OTOF 3MM7A 2XLIA 1BQMB 3WC0A 2W9BB 4FYYB 2HYIB 2CQPA 3CQ8A 2ZDPA 4ES2A 4WYWA 4H4MA 4F4XA 2ZE2A 1XJWB 1HBNA 5FIIA 1RWMB 3CJ8A 4J9VA 4DQQA 2FBYA 5DM7L 4WPAA 2VQEK 3QGIA 1PCAA 1S9GA 4LFCF 2V8HA 2HIYA 2FQQB 2A6MA 4L3QA 2MKHA 2VYPA 1H74A 4DV6J 3LUYA 2DY1A 2NRXA 1G6BA 4OX6A 4B3SF 3SLCA 1R0CB 2A10A 4DX7A 4KAIA 4Z0UA 4E7KA 5KFSA 3KKRA 3O9RA 2GUPA 5E84A 3OV7A 3BB5A 2JLEA 1UPPA 2GMJA 2P9IA 3O1LA 3KG0A 2PA8D 1EWRA 4O3QA 1GLLO 3R5CA 2BW2A 1JLAA 3Q8VA 3E3XA 5C2GA 4CF1A 4X64J 1TZ0A 4M45A 1NO8A 1W97L 3QZ8A 2YH0A 3V4IB 4CO0A 4LF6F 4J9UE 1WACA 4XTTA 1N32F 3KK7A 5GAEU 1ACMB 3NGTA 4DS4A 3AFGA 2MKCA 4B1UB 1A7GE 4LRBA 4KH1B 2DK2A 1HNXJ 1S1VA 3Q8QB 3NDKA 4CEDA 4X64K 4Y28C 1LWEB 4WXWA 3VZHA 2DH8A 4K4TA 3JQKA 5F8MA 3SFUA 2VHGA 4ECVA 1B64A 2CPXA 2E5IA 3NVKA 2Q97A 1QQNA 2RKIA 1U48A 1C0TA 2C2NA 1KEKA 1ZYQA 4DV3F 1F1BB 3T3FA 3VQCA 3H42A 3PYFA 2ATQA 4L3NA 3PR4A 3MM8A 1FFSB 1NWKA 3CCZA 1J53A 4KHYA 4C2MA 4ILGB 4J9KA 3E9OA 2VL1A 3OYAA 4CBXA 3G10A 2E20A 2P9PA 1HNIB 3HHLD 1HQUB 1REVB 1ZM2A 3LZIA 4CJRA 3ID8A 3D7SB 4WKYA 1XIQA 4DSLA 4BG9A 2HHPA 1VBKA 3GG4A 4E8UA 5KFIA 4CLSA 5GIPA 2EC2A 1U2FA 3VF4A 2QJ3A 1HHTP 3TYTA 4CEBA 3V5RA 4OV6A 2DTJA 3ZSQA 3BQ0A 3KJNB 4RNFA 3K0SA 4YR0A 4LF4J 4I2QA 5HMXA 4JNEA 3L4IA 3TA2A 3HZ6A 3CYMA 2CJ9A 1U2VB 4RTFD 3VEYA 1YJ7A 3BV8A 4JKGB 2EEYA 3GU0A 2CXEA 1AT1B 3HZGA 1FJCA 1XWLA 3CWJA 4X4PA 4OPKA 4HLBA 2VICA 4F8RA 3MWBA 1JLCA 4PXBA 1YI2S 1AROP 5AR0A 4IH6A 1O13A 1S6OA 5HVHA 5EXWA 2F9TA 4OX8A 4QYZK 1ESVA 3GCXP 1DQ8A 4YB5A 1O6XA 1FESA 4CGGA 5AQTA 5BRFA 3PRDA 2BJ8A 3BZCA 2FLLA 5F0XA 1JLEA 4OLAA 3MR7A 2PO4A 5EWGA 3GONA 1KFDA 2HQDA 5J1PA 2VODA 3HHLA 5D3GA 1RHJB 4ED2A 1RAIB 5A8RA 2DGUA 2PT0A 2FGOA 2VPZB 2PN6A 4EO6A 2OEMA 3TP2A 4DTOA 3W65A 1HHSA 1BHLA 2M3DA 2IM0A 4JD2B 3DOLA 4NXMF 3B8HA 4NEZA 1VOMA 1X7VA 3MN5A 4C8MA 2H3EB 5GMKa 3D6TB 3K5NA 4LF6J 4CJ3A 3MWPA 3NL0A 2N4DA 3Q0AA 3OS0A 3QRPA 3ICLA 4OVLA 4N8OA 2MKYA 3HT0A 2FY8A 4NLYA 4HH0A 4WFNL 4KSEB 3H8YA 1NGDA 1YJNN 1IWAA 1WBBA 2NR0A 4L73A 4I68A 3LDLA 3WT0A 4ID5B 2BVZA 3SEOA 3IR5B 4ICLA 1YSJA 4NXNJ 2DNNA 1WAFA 2NRTA 1VYAA 4CLKA 3SCXA 2I0XA 3AO5A 1KVJA 1IJJA 2Q36A 5CZ1A 3CMQA 2HHSA 4NA2A 2ZM6F 1HUXA 1VK8A 3D2FA 2DIVA 2BACA 3DLLL 4LH5A 2HNYA 4LF5F 2AEFA 3M2UB 1GTHA 2FC9A 4X62F 3PIPL 4OYXA 3HYFA 2J7KA 2C2MB 2GQQA 1U1OA 4TU8A 1HMVB 2IVYA 3DGVA 1CJUB 2HFVA 2B9WA 2DXFA 4C3LA 3FBCA 1YJWS 4QW9A 4AQYJ 4C0OC 4CF0A 4DR4K 4CFAA 3L2VA 1QY7A 4V19J 2V51B 5LSLA 5ITHA 4LD0A 2UXDF 3PW2A 2FUG9 1S4FA 2HBMA 2NYIA 2OSRA 3OYNA 2KRBA 1F0XA 1XQSC 3JXOA 5D0EA 1RSCA 1U1MA 4FJLA 2LP4A 2E5LK 3JSYA 5KFDA 2ADBA 2AQ4A 2A3ZA 5DDPC 2ZJPQ 4DR2K 1IG9A 3P8BB 1PC4A 4J9NA 3RBEA 2HHVA 3H08A 1WDTA 2M8HA 1RHQB 4G6VB 2JC0A 2Y3YA 4IYQA 1UZDA 4DHYA 4BE2A 3DGPB 3NRBA 4A8OA 1QE1B 2HMIA 4BCAA 3G6EN 2QLBB 4K4YA 4CJEA 2QO3A 4ZP9A 4YOUA 1YIJN 5KG7A 1OVYA 2B4PA 5KRSA 3EKSA 5ETVA 1BCMA 3CCEN 3IG1A 1HYVA 4ZVTB 3VQAA 3D3BJ 4W92B 1XEZA 4ISFA 4IQMA 3CJQA 2ZD1A 4KGVB 5KFTA 1QZ5A 1S3XA 1VC6A 4K4SA 2QGFB 4JP8A 1NK4A 4B9UA 2MSTA 1GX5A 4X66K 2D3ZA 2OPPA 2RHSB 2XY5A 1E6YB 2RB7A 3GFZA 1GH8A 2BRLA 2YI1A 2HNDA 4F4WA 1TAUA 3LALA 3M1VA 2VWJA 2FJVA 1M1HA 2RN2A 1N6QA 3T5KA 2OEJA 4CDIA 4RU2A 4DHVA 2HEKA 3RW6A 4O4GB 2RRNA 1CXUA 2FGCA 2XLKA 4PR6A 1D9AA 3EDRB 2F4VK 5C25B 3WEEB 2XMAA 4LFAK 7FD1A 1NU0A 1UTAA 2Y8WA 2QL7B 5CABA 5M1FA 1ATNA 4DU4A 5IT9Y 5J2QA 4DOZA 4JI5F 1WF1A 2GMHA 2ASJA 1B99A 3HBTA 3BP8A 2JLFA 4B1WB 5KFYA 2FVCA 4C0BA 1H72C 3VAMA 2BE2B 1RWNB 1YHQN 5DG7A 1VISA 3VN5A 3KUEA 1FWKA 2XB2D 2XYGB 3AO2A 1NJIO 3PX4A 1NGEA 5LMNF 4DR5F 2BANA 3ULEA 4M5DB 1F5BA 3O08A 1R8AA 4F0KA 4Q2LA 5DETA 3TJ8A 2LVWA 4RW9B 4MMOA 4BVPA 1LCUA 4BDPA 2WBRA 2DR7A 1GT8A 1QAYA 3RJMB 4DU7A 4JKHA 4JI6F 1ZAVA 1VRUB 1T05A 4O4RA 4OZ1A 4NI2A 3FBEA 5ETKA 1EX8A 1XK8A 2NUHA 4PL7A 1S1WA 2O67A 4JN4A 4LRAA 2YJFA 4DV6F 1I6JA 2WAQD 2W41A 3M8WA 1A0OB 4E1MA 3OBYA 1RT4A 3W63A 1R89A 4LRCA 2E44A 1XC3A 1FF2A 3SAGA 2HWTA 2Z30B 4IH5A 4O3PA 3CJ4A 2JC1A 2H51B 4M5LA 1GLBG 4LFAJ 4MLHA 1CC7A 5ADXA 3BGUA 1VQ9N 1CPZA 1MROB 1I1GA 2O4GA 1KVBA 2V8PA 1T9XA 1RT1B 4R79A 4A5BA 3KMQA 5D0RA 3IP0A 3BZKA 3W8GA 4KO0B 4M63C 3CM5A 1IBLK 2FHJA 2B4OA 3KWMA 3PV8A 4PUOA 5JVHQ 4IO9Q 3AXKA 2V52B 2XM3A 2GO9A 1KDNA 2PAVA 1LQ9A 2DO4A 3BKFA 3C7NA 2UU9F 1LFWA 5C25A 4H0YB 2WUSA 1HNXF 5KFCA 8ATCB 1SL0A 5LL6Z 3DKDA 2JEIA 4IR1A 1FKOB 4OX9J 4DX6A 1WI8A 5J1EA 4NX9A 1U2CA 2MQNA 2V69A 2OPPB 4CESA 1R7IA 4MK8A 1DQAA 1XUPO 4XPEA 2XMJA 3OFEA 2F5GA 4CLZA 3F9KA 5T7LA 4F7VA 2WSEC 3DI6A 2ZM6K 4H03B 3NH1A 3Q2TC 2QX0A 1WI6A 2DJWA 3EE9A 3HJFA 4K50A 1OS5A 5GIOA 4BE0A 1A5XA 1VRQC 1PO6A 4HYKA 2YNIB 4F4AA 3UKUB 3UKRB 2BOPA 2DNHA 3LAMA 4K4VA 4JI8J 3LPYA 4YS2A 3IC1A 5IZHA 1APSA 2YHYA 1H7WA 3H46O 1VJQA 2W2NP 3UVJA 1D1UA 1X0PA 3NAEA 3MAHA 2HGLA 1FDDA 3CCRS 1H2VZ 2DT9A 2H1YA 1GXTA 5D0HA 4TQRA 3PW7A 3OYKA 1SQFA 5ADZA 4IOCQ 3HCXA 4DR3F 4FJJA 3KXDA 1RQ0A 2D0OA 2XRIA 1PKUA 3AVHA 1WF0A 2RDIA 2NXUA 2D3O1 2YVSA 2AJFE 4MTPA 3FLCO 2XS5A 3NNCA 1LWFA 4B3RJ 2H5JB 4KB7A 3MN9A 3LDPA 2PZSA 3TO8A 3ZETB 2DHAA 2K3IA 2AYEA 3BYPA 3KDOA 1NCLA 4BQLA 4H4OA 3M2UA 2IBKA 1MWZA 4JI2K 5DQHA 3MR3A 4ZTFA 2KB2A 4I6WA 2O8BA 3HP6A 4RL1A 5DLFA 4NRUA 1JLFA 4RNNA 5A8KA 2O8CB 1OPZA 4M5MA 4CHOA 2HGNA 2EBEA 3CPWM 1S72S 2E66A 2MMYA 3MHYA 1EP4B 2GAGC 4ZVSB 2E7VA 2GNKA 2IRYA 2ZNZA 3O4QA 2FC8A 2W6LA 3V6JA 2CJBA 4MKVA 4KFBA 5F9NA 2C2EA 4JI4F 2B43A 3E2EA 3MEKA 4P73A 3TX0A 4IR9A 2V2QA 2GVDA 3MCAB 2CZ9A 4OHXA 2DKOB 3VAHA 1CZBA 3MEDB 1ZM4A 1HRHA 4HTLA 4OYIA 2H48B 5GMEA 3KOAA 4JI6J 1FKAF 3TUJC 2QMXA 1BOTO 3AB4B 4LR7A 1KXPA 2K7JA 5DDOC 3PJXA 2AU0A 4JD2A 2ACYA 2HMPA 2OSQA 1JCFA 1AFIA 3MM6B 2CQIA 1HR0K 4HCBA 1UZHA 3NH2A 3W9HA 3UR0A 3OW2R 4NPOA 2ZOFA 2KVIA 4UQTA 5KFFA 3R5GA 4O3RA 2PSZA 3CJTA 3CJ1A 2WZ1A 4EEYA 1BU6O 1GLFO 4BG8A 3AAPA 3OQ2A 4YEAA 1HQEB 3WZ0A 3N6LA 2X7IA 2R8IA 4DN9A 5SWMA 2J4RA 2OYQA 3M1FA 2VC1A 2W9CB 3EY1A 4MT1A 2E7WA 1QVGR 1AB8A 4Y1DA 1Q86T 1RP5A 3CSKA 3M3ZA 5D4NA 1OO0B 3M8PA 1U2VA 2KKZA 4O55A 2OIHA 3HVAA 3TAMB 4PG5A 3ALYA 5KFKA 4B1YB 1BCOA 3SXLA 4WKRA 3Q89A 3N0VA 1DQ9A 4OYOA 4GW6A 3DLEA 2DHGA 4M3YA 2QIFA 3SSSA 4JI3F 2J6TA 4GKKF 4E7IA 1RTHB 4RWTA 4M3XA 3QBCA 4FVUA 2WOMA 4CO4A 2BR0A 3UW1A 1T6DA 4M94A 1OVQA 3K58A 1HQUA 3R7BB 2QL5B 4OI3A 3NS5A 2PI5A 4FJHA 2Z4PA 2OZMA 1B7FA 1YZ7A 1IKYB 1DJ0A 1NGFA 3FCVA 4A46A 2OP5A 4BRMA 3DOMB 3KHRA 4EZ9A 1RTZA 2IAJB 3BN7A 5C42B 3MMAB 4IWVA 3OR2B 2P9NA 4FXWA 4F3TA 4NYZA 2AMCB 5M1OA 5BJRA 1S1UB 3DFEA 1PJ6A 2WB1D 1BDGA 1IH7A 4OO1J 2GVZA 3QFPA 4OZNA 3D6RA 5HQLA 3B82A 4Q0BA 2DFHA 1WF2A 2AGQA 5AXLA 4B9NA 4USTA 3C6HA 3C6AA 4C8NA 1U7LA 2E29A 1P9QC 2NPFA 5ETSA 3LP2B 1I94F 5DG8A 1Q7YT 2GX9A 4EGLA 2IIHA 1YJTA 4PQUA 5C2FA 1RWPB 2G8UA 5KPZA 3CC2N 2YNHB 3WQPA 1R3NA 2MHEA 3LDNA 4L72B 2YQ0A 1YHQS 9RUBA 1RAJA 1OH7A 4OJHA 1SQGA 3D1HA 3KTQA 2O8EA 2NREA 1JLAB 4LC9B 2VQEJ 2QXFA 1Z05A 1RBAA 3MXMA 5DDQC 3WXIA 2B0GA 4CLYA 5B0DA 1OH6A 4PG7A 2DY4A 2JOQA 1HWUA 4IO9L 2JFKA 2LEAA 3QT8A 2FHJD 2DR8A 3P96A 1BUPA 4E3SA 3IWLA 4DV1K 2Z1GA 2DCLA 2E1AA 2MZTA 3MPWA 4LBHA 4DR6K 5D8HB 5L9XA 2LU2A 1AW0A 3ZSZA 3W2VB 5AQXA 3NBPB 1Q0NA 1YQHA 2RQ4A 4CBUA 5CZ2A 3FRYA 1Q53A 4IRCA 3KVGA 1VBZA 5AQVA 4KGXB 2QTWA 2ZE2B 4TN2A 4JI2J 3D6MB 2RQCA 2QG9B 1FRIA 5CYMA 2DH7A 4EO8A 1FA0A 3IWNC 4C1NK 2IGIA 2XI3A 2RILA 4LT6A 4OKKA 1UEVA 3MM7B 3DNCA 1TMMA 4YDDB 3AODA 2FHOB 2VUGA 3SAHA 2D74B 3VGLA 4BRGA 3KIOA 1K6YA 1ZBFA 2D3OR 2ZH6A 1G99A 5JMVA 1WWHA 3HRGA 4BR0A 2RRAA 1C1BA 4WF9Q 2GJFA 2CPEA 4DUYK 1NGHA 4HUFA 4DUTA 4DL7A 1WOQA 4FXDA 1FXXA 1TV6B 1GMWD 3IM9A 3O3HA 1WJ9A 4FLXA 3C6UB 4FJKA 2RSQA 5AJ3K 4ZPWR 5FD1A 2QWPA 4PA1A 3VGVA 5DQIA 2B5JA 1R0AA 3H7HB 3PM9A 2YKOA 2ZWHA 2GHVC 4DI6A 1HNWF 3A5NC 4CEAA 4LREA 5CYQB 3SPZA 3H1QA 3F56A 3BF1A 3CF5L 3CC4N 1YRUA 4Q8FA 3HSCA 3KHGA 1IKYA 2IIRA 2YKNB 4ZK7M 4LY7A 3ENOA 4GC6A 4J7CA 2KYXA 4ZMMA 4WTYA 1ZPVA 3PW5A 2RAQA 4MLEA 3QNWB 3AB2B 2DGOA 2F8SA 2J0WA 3DRSA 3MUMP 1VQNS 1D3WA 1V9OA 4NLUA 4DS5A 3N9UC 3RRGA 3G6ES 3WNFA 4I6MA 4KHSA 2G8WA 3U1MA 2MZRA 4YY3F 5FDLA 5HBMA 2E1PA 3DRRB 3H2VE 3PEJA 3THPA 3L6QA 2YV0X 1KD1O 1TK0A 2OA8A 5IM0A 2ILYA 1NZ8A 2G1HA 3RB0A 3OLBA 2FSNA 1U47A 3AY9A 2CKWA 2V63A 2JNJA 2DGVA 4NLTA 4EHUA 1VHFA 2IVNA 3BKTA 4CLPA 4NZ6A 4XH5A 4B3OA 1SVDA 1ULRA 4ISGA 5K8MA 1YJRA 3O9QA 1VSDA 3G25A 2GBZA 3THWB 3PXGa 2ROEA 3TEGA 3NWGA 1ITGA 2XMUA 1DTTA 2K2PA 5JLFA 1NLVA 1JJ2M 1NSAA 3A8IA 1RAEB 1HNXK 1T95A 1L5UA 3JXUA 4C23A 4ZP7A 1NZAA 5AXKA 2KXFA 5KOXA 4OYZA 4CFCA 4G3IA 4FXVA 2ASPA 2OUGA 3A3NB 3J7A1 2F8EX 3EXYA 3FFIA 5HJXA 4ECZA 4QQBA 1HIYA 2IPOB 3ZSOA 1H3DA 2E5JA 3R1HA 3L09A 5AQGA 2HBQB 3ENHA 2HQGA 4BC5A 4BLGA 1JNRB 1NK5A 2A41A 2PA3A 2N7YA 3MEDA 1X4CA 2WRMA 3I6PA 1OYEA 2H54B 2H4YB 1BWEA 3L4BC 1SJRA 3KHYA 4CJ7A 1BGXT 3QBWA 5IV3A 1TUWA 2QWNA 4K4WA 2CZVC 3M6GA 2IRUA 1B0TA 1FWPA 3EKUA 4CIFA 1BWVA 5DO2A 3W66A 3HI9A 4YNQA 3EO3A 3GSDA 4AH9A 1SC3B 3NGRA 5IXUA 2R2UA 3T1YK 3TABA 2YHWA 3BYRA 1U45A 5D0GA 1KAYA 3CGIA 5KFPA 4X65K 4X4RA 3I87A 4K0KK 2IDOA 5AQFA 4ZHRB 1DBDA 3THWA 3VEVA 4B1VA 1R43A 2ZFHA 2FJWA 1KOHA 1VQ8S 3R2DJ 2BMBA 1RA6A 2E5HA 2E9TA 2NUBA 3TWHA 2X51A 5DDRC 3OSNA 3CJRA 3P4UB 3CCJN 4NXNK 1Y5NB 4IEIA 2YCHA 3F41A 1UA1A 4HL9A 1RAAB 3CFPA 1TUGB 1IG8A 1VC0A 2ZH7A 4PL8A 4KAZA 2PY5A 5IM0B 4URQU 3U02A 3THTA 1DKGD 4P2FA 1RCXB 4DCPB 2E2PA 2VKZG 3BM7A 2VG5A 2R2SA 2XGPA 3V9UA 5KPRA 1CXQA 4O5FA 3QB0A 2FVSA 1LOTB 4P6QA 1WDDA 4DV3K 3HLUA 1QSYA 2GMLA 4EP5A 2G0CA 3HPHA 3NCPA 1KWMA 4C8YA 4Y6IA 3UKUA 3U8XA 5FRMA 3I8DA 1T94A 2JVRA 1NDCA 3BH6B 1HW8A 3WX8A 1WSEA 3KLFA 4B3TF 1PYOB 4F0HA 1C0UB 4ED6A 3ITHB 4TSXA 4HTJA 2VF3A 3K9KA 1W2IA 4DR1K 1GAOA 2PGCA 2RE1A 2C28A 4IBNA 4JHDB 1Q82O 3THVA 3O8WA 1ZPWX 4DWIA 2GV9A 2NZ4A 1SQKA 1V3SA 4ZTJA 3OSPA 3EPGA 2MGZA 1RT3A 3V1RA 4MO4A 2PYLA 3L3UA 5DM7Q 5CD4A 2ZUGA 4OHWA 1HR0F 4CWBA 4ERDA 3QLHA 2RVJA 3ZX2A 3M32B 3ONQA 4CHPA 3QATA 1B92A 4MIAA 4B8CA 2V34A 5L9NA 3GR0A 1W26A 4DR7J 5KQ8A 3FK4A 4UZBA 4ETXA 4DX5A 4F4ZA 2QWRA 4RW7B 3NOGA 1UVKA 5KFBA 2UXBK 3D2EA 5AZIA 3BDEA 3M8ZA 2E6MA 1F9EB 3J81j 2DTUA 3T9ZA 5F8NA 1T03A 1VSEA 4JYAJ 1QDUB 1N34F 3ZNJ1 1KLMA 2EBGA 3EMTA 4LF2A 3L9ZA 4H0TB 4C97A 3CCSS 2MTLA 3LGMA 4USVA 1VQKS 2KHOA 4OYBA 2V4RA 2R7RA 2GELA 1H2UX 2F8TA 1XNRF 5HMZA 4WP9A 5EX3A 2ZH5A 1IKVA 3CDEA 2UUBJ 3QJJA 2CQ1A 4QOTA 5GAGU 3DYAB 5GADP 2DNZA 2I38A 4CLLA 2O4IA 1V3ZA 4WE1A 3LA0A 4BY9C 3J7YI 1T05B 4KGKA 3MM9B 4F4KA 2F3JA 3K5OA 3BREA 3LF0A 3FZBA 3CJCA 4WYBA 1K1SA 5KGWA 2Z1JA 4GMJB 1T8EA 2CGJA 1JKHB 2C3MA 4I69A 4MKYA 2VV5A 1HNVA 2HS4A 2CJAA 5J2MA 2IVMA 3ET6B 1HI0P