1TKTA

Crystal structure of hiv-1 reverse transcriptase in complex with gw426318
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
534
structure length
515
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pol polyproteins [Reverse transcriptase], Chain A
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 135
structure length 515
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tktA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tktA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tktA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tktA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tktA05
1REVB 5CYMB 1NOZA 2BRKA 4CF1A 4JV1A 4RW7B 5J2NA 3CQ8A 4B9LA 4NLOA 4DSIA 3HVRA 4CFDA 4KAIA 3MXJA 4LY7A 2VWJA 4CJTA 4FLVA 1RAJA 1R0AA 5KT2A 3LDSA 3QGGA 4DTOA 3LP2A 3VQ8A 4ID5B 4RUAA 2X74A 1TKZB 4ZVHA 2R8JA 4CHPA 2ALZA 2UVRA 5DQHA 3LAMA 1LWCA 2R8GA 4ICLA 3NF9A 4CGGA 5D3GB 1TVRA 3TAPA 4BACA 4ECWA 3AA4A 1JKHB 1QHTA 3ISNC 3QIPA 1ZETA 1SUQB 3B6OA 3Q8PB 5KFWA 4OJRA 4RG8A 3ASMA 4DL3A 4ZMMA 3H4DA 4CECA 3QNOA 2DFEA 4DQQA 4BWMA 1IKYA 1RDDA 1WSFA 3AA5X 3LP0A 5I42B 3KK2B 3HO1A 2F8EX 1J5OA 2HNDB 3BGRA 4NLVA 1S1UB 2FVCA 2XHBA 3V6DA 5KFFA 3L3UA 4F4ZA 3KLFB 4HCCA 1W9HA 1WNSA 2ZE2B 2FLLA 4FCYA 4I7FA 1T03B 3CM6A 1JLBB 1RBSA 4ZP8A 4QCLA 1TKXB 1T3NA 4H4OB 1RT7B 1TV6B 4O5BA 1YTAA 1JX4A 4IOBA 3L3VA 4O3QA 2JC0A 3MEDB 3OYAA 1S5JA 4DMNA 5FRMA 3KK3A 3D28A 4NZ0A 5L9XA 3FFIA 4XO0A 4DL2A 2ILYA 2BANB 1SH0A 3VQ5A 3D45A 4F4KA 2JEJA 1VSLA 2Z1GA 2ZD1A 3M8QB 2HNZB 2YNHA 3V9UA 1BQMB 1UOCA 2IOCA 2PYLA 1S1VB 1NHVA 3N6MA 3MEGA 1RTIB 4IQXA 4NLUA 3QINA 1HARA 5J1EB 3I0RB 3KD1E 2FJWA 5KT3A 2RDIA 3V9XA 4I2PB 4OVLA 5J2QA 5DGAA 2E9TA 2YKMB 2GBZA 4CF9A 3K59A 3PW7A 3BDPA 1IKWB 1T05A 4KB7A 2HVHA 1LW2B 4KFBA 4RW8A 2IA6A 4DU1A 1TKDA 5EUHA 2WTFA 2B5JB 4NRUA 4GW6A 4BDYA 1LW0B 2WONB 4GC7A 1HQEB 3AVKA 3UIQA 2AQ4A 1XC9A 3DI6A 3PO4A 5J2PB 3K2PA 4NRTA 1S48A 2FJVA 4ED1A 1TGOA 1NJZA 4J9SA 4NLRA 4DSFA 4B9UA 4IFVA 1HPZA 4R5PB 3VQ6A 3T3FA 4OKKA 4NYZA 5F8GA 1RYSA 3SPYA 1S0MA 2KZZA 1JXLA 4DTPA 4FJ5A 3V6JA 4CESA 5T7BA 4CK1A 1XR5A 3OL8A 3ZT2A 4DU4A 1JLFB 3TAMB 2R2SA 4MK8A 3RMCA 3OYHA 3PW2A 3AA2A 3VQPA 1SH3A 3MR2A 2AWZA 4H4MA 2G8HA 3CJ2A 1RT1B 4FLUA 4DL7A 3SFGA 1BISA 1U4BA 3VA0A 3T5LA 2F8TA 4LSLA 1XHXA 1C6VA 4URQU 2ITGA 1HYVA 3DRRA 3RR7A 3VQEA 4EEYA 3KKSA 3AVFA 1B9DA 3G0ZA 4FXDA 4YR0A 3QLHA 1TL3A 3OYBA 1KHWA 1OS5A 2BDPA 5KG7A 3DOKA 4KTZA 1JL1A 2XCPA 3IG1A 3LP2B 3UQSA 3NGYA 2EHGA 4C8NA 2G8KA 4DF4A 5HRPA 1KLMA 3LZIA 5KFVA 4BDZA 2IAJB 3IAYA 4CHYA 3SV3A 4M3TA 4AHRA 1GOAA 3H08A 3P5JA 4NLQA 1IKVB 1LWCB 4DSKA 4TSXA 2IC3A 4M94A 4E89A 1VRTB 2D41A 1TVRB 3L2WA 5KG2A 3CFRA 3DM2B 3QIPB 3MAQA 1UA0A 3KHGA 5CZ2A 4E19A 2D5RA 3KHRA 4DTRA 2HHXA 1J53A 5KFAA 2Z1HA 2BRLA 4FJ9A 1SKWA 1TK5A 3AO3A 3KTQA 1LWEA 3V9WA 4HUGA 1S4FA 4ECTA 3KKRA 1U49A 1IKYB 4DTMA 3HVTA 4BE2A 2XRIA 3LP0B 3IRXA 4FBUA 3O4QA 4M42A 3T5JA 3BGRB 4Z4HA 4DQIA 2FLPA 4KAZA 4ECQA 2XI3A 1T94A 2XY7A 1X1PA 1CSJA 3HVAA 5I3UA 1RDAA 4DQSA 1LWFA 3U6FA 4KSEB 1RTHA 5CYMA 3Q8QB 4QPXA 3EPIA 1JXBA 3ZSOA 4UQGA 2HHQA 4F4YA 2KTQA 4KHRA 4I7FB 4NCBA 3NKYA 4DG1A 2Q3SA 1XI1A 4K4YA 4NCAA 1XWLA 2VG6A 4ZPDA 4QAGA 1F21A 2KQ2A 3V1RA 2C28A 4FW1A 3TAQA 3CYMA 2PYJA 4ID1A 3KK3B 1ZBLA 5KG4A 2DY4A 4FJLA 1D0EA 3CVKA 1NKBA 5HRNA 1NNDA 2FC0A 2PZSA 2W9CA 2ZD1B 2HVIA 2ETJA 1L3TA 4IKAA 1CZ9A 4ZPBA 3KLEB 3BSNA 1BGXT 4EBEA 1YT3A 3PX6A 4IH6A 4LH4A 4O0IA 1TK8A 2AX0A 4KKOB 1TQLA 2B4JA 3ZSRA 3TWHA 3IN5A 1TKTB 1SL2A 3OHAA 2I5JA 5J2QB 1T7PA 5I42A 3KK2A 5KFZA 2HNDA 2V4QA 1HNVA 2ATLA 1BI4A 5KG5A 1QSLA 1T05B 4YQWA 4KFBB 3DLKB 4RW8B 4YMEA 3DRSA 3KNAA 3VQ7A 3AVJA 2ZE2A 3OY9A 3AO1A 2W8LA 3ITHA 3CM5A 4O4GA 1RBVA 3DI6B 3LANA 1EXQA 4W5NA 1JLBA 3QZ7A 3RMBA 4KTWA 4N47A 4URGA 1RT7A 1TV6A 3GV8B 1NK5A 1NK0A 3LP1B 2B43A 4IFVB 4JV0A 4IRCA 1HPZB 1NKCA 1EETA 1VSMA 3CJ5A 1BCOA 1D1UA 3QGIA 1S6PA 2E9ZA 4JRPA 2BANA 1RT3B 4OLBA 4O3PA 2OPQA 3M8QA 2HNZA 4CIEA 4ECXA 1N4LA 4CJKA 3OL9A 3WNFA 3FRZA 5KT5A 3AVAA 3DOLA 4NYFA 4H4MB 4IH5A 1L3SA 2YNFB 3I0RA 3SQ1A 1U47A 2E6MA 4RU9A 3RRGA 2XI2A 4I2PA 4DWIA 4LSLB 3GV5B 1RDCA 1VSJA 3SZ2A 3DRRB 3KHLA 3KMSA 5DLFA 4FM2A 1NK9A 3AA3A 3PR4A 2X78A 3QLHB 1TL3B 4AHTA 2FBXA 3DOKB 3SUQA 4EZ9A 4PA1A 5HRRA 3G86A 3KIOA 4HUEA 3EYZA 3LWLA 4Q5VA 1YVUA 2WONA 3UR0A 4DF8A 1C1CB 3BQ1A 3SUNA 4FJXA 3M9OB 4AHSA 5K14B 1JLEB 3GIMA 2XY8A 1ASWA 2G8WA 4FM1A 1U09A 1ZYQA 4R8UA 3Q8RB 4LSNA 1D9DA 3RMDA 4CF2A 4RNNA 4OKEA 4J2DA 2XCAA 3RBEA 1HJRA 2YV0X 4IBNA 1LWEB 4GC6A 3SPZA 3TAMA 4HYKA 4NLYA 4ED0A 4CJUA 3HVTB 2RPIA 5DG9A 2R8IA 2IMWP 3QEXA 1KTQA 1VSDA 2BR0A 1X9SA 4CCHA 3MF5A 3OLAA 1DTQB 4ED8A 4AH9A 3QIDA 5J2MB 4IG3A 1FXXA 2KFNA 2XWYA 2RN2A 3HK2A 5I3UB 3OYIA 2YHAA 5KFKA 3HP6A 1RTHB 1JLCA 3QETA 4QWEA 3QERA 4KTQA 4DG1B 4Y34A 5F8HA 3KLHA 2J6TA 3AVGA 3SV4A 3QGHA 5L1LA 3QEIA 4MH8A 5KFBA 4WE1B 3ZSXA 2VG6B 2OYQA 2RKIA 3O3HA 2HHVA 2O5DA 4XPCA 4WZQA 2KW4A 4NLGA 5KFIA 3RB3A 2JC1A 3KHHA 3N6LA 4DL4A 3FQLA 2IAJA 2D3UA 3OL7A 2W7OA 2UVUA 4TY8B 3I5BA 1UA1A 3SI8A 4IRDA 3V1QA 1IKVA 4CJ4A 4MKAA 1VRTA 4B9NA 2W9CB 4ECRA 3OYGA 5C25B 5DMRA 4ECUA 3QO9A 3DM2A 3AVIA 2R2TA 3ZSQA 1TK0A 3FSIA 1WSJA 3C6TA 4JUZA 3RAQA 3HSTB 4DFJA 1XHZA 2IM1A 5C24B 5FDLA 4R0EA 1U04A 1S49A 2JEIA 4YFUA 2I5JB 1NOYA 1Z26A 1XR7A 3V81A 3OSNA 3RMAA 4CJQA 3V1OA 1ZTTA 1HNVB 4LD0A 1BI4B 2IJFA 1C0MA 3NAIA 4FS2A 4Z0UA 2OPPB 3DRSB 2OZMA 1NK7A 5F8MA 3EZUA 2AGOA 2ZQBA 3V4IB 3ITHB 3HKWA 4O4GB 1RT6A 4J9LA 2Y1IA 2XGQA 1QE1B 1NK4A 3AVLA 3NAHA 1RTDB 3D5MA 4CFBA 3HHKA 1U48A 1L3VA 4DSJA 2QV6A 1BIZA 1WSHA 2AJQA 4LH5A 4K50A 4IH7A 4E7LA 2DFFA 1EETB 4DTXA 3SQ0A 2O4IA 4CGIA 3CJ0A 5KFRA 2IM2A 3VQBA 1S6PB 4FJNA 3E01B 4DFMA 2CJQA 2HHTA 3F9KA 5KT7A 2OPQB 4JS4A 4Z4EA 3M8RA 3IGNA 3OHBA 3ZT4A 4KB1A 4M3UA 4DL6A 3KLEA 4J9MA 2YHBA 4JRQA 3T19A 3DOLB 2HWHA 4E7IA 4ZHRA 3ZCMA 4ECYA 4PQUB 3H5SA 4EO6A 4KKOA 4Y2CA 1TKTA 5KG0A 4DFKA 5KFYA 4K4VA 3MTKA 1Z4UA 2E9RX 4OPKA 3I5AA 1C2PA 5FROA 2RF2B 3DLKA 4KRFA 3PR5B 1MU2A 3C6UB 2IDOA 5SZTA 3GYNA 4ZVGA 1S1XB 3MECB 3CJ4A 4FBTA 1KFDA 3TVKA 2HNYA 1KSPA 1DLOB 4F2RA 3MEEB 3H4BA 4TQRA 4IFYB 2W42A 4EBCA 4FLWA 1RBUA 3LP1A 4LQ9A 5T14A 4OL8A 3SUOA 4M95A 4N5SA 4CEEA 4FS1A 3CWJA 2AU0A 1W0HA 2G8VA 2W8KA 4R8UB 4LSNB 5F8NA 4M45A 5EWGA 4AHUA 3O3FA 3VA3A 4DTSA 1WAFA 1RT3A 2IGIA 4KHWA 5HLFB 3OS2A 3L2RA 3THVA 4K4XA 4I2QA 4F4XA 4BDPA 2YNFA 4FVMA 4C8OA 4K8XA 4IG3B 2RDJA 4NLTA 3HPOA 1JLCB 4QWAA 4W5RA 3TAFA 3PW4A 1Q8IA 4DLEA 3EY1A 4ZP9A 3V6KA 1QSYA 3T1AA 3PZPA 3KLHB 1LAWA 3CDUA 2VWKA 4CJRA 4YP3A 1C0TB 2RKIB 5KFHA 4CEBA 3KLIA 1BQNB 1RT5A 1C1CA 1N6QB 4CEQA 1LAVA 5KT6A 4J9PA 5JUMA 4X2BA 1JLGB 3QIOA 5DG7A 3FDSA 2OPSA 5FRNA 2GIRA 5CY4A 4CJSA 4CJEA 4IKFA 5K14A 1JLEA 4B9MA 1QUVA 4FLYA 2R2UA 4KBIA 3U3YA 3TR8A 4KHUA 3QO9B 2FVRA 1LV5A 4O3OA 5EDWA 4G3IA 3I0SA 3V9ZA 3C6TB 5FDLB 3N6NA 3PJXA 5KFGA 1TAQA 2LSNA 3RTVA 1VSIA 5L1KA 4RZRA 3OYNA 3MXIA 4KHQA 1QAJA 3V81B 2BQUA 3NE6A 1SH2A 3BQ0A 1CXUA 4RNHA 1DTQA 5HROA 5J2MA 1KHVA 4M3WA 3C95A 4MK9A 2WOMB 3AVBA 3TI0A 1RT4A 2HAIA 1IKXA 4ECSA 4RW6A 4FLZA 1J9AA 4FJ7A 2DFHA 2PY5A 1RT6B 3ZT3A 5F8LA 3D0PA 4K4ZA 3PO5A 3RB0A 1I6JA 2OH2A 4KHYA 4WE1A 3DLBA 1UAXA 4NLDA 4CF8A 4CEFA 4PUOA 3JSMB 1N56A 4GVMA 4F50A 4C8LA 3OYJA 4TY8A 1QTMA 3BSCA 1HMVB 3BREA 3ICLA 4ED6A 3IS9A 4NLSA 3RRHA 4KREA 5C25A 3OLBA 4OPJA 1ASVA 4CGHA 1RDRA 3OYDA 5EWEA 3ZT0A 1HNIA 3M9NB 4ZHRB 3AVNA 5C24A 3OYFA 3VQ9A 4DS5A 4ECZA 3UDLA 4CGDA 4JS5A 1L3UA 1VK0A 3E51A 1SL1A 3H40A 4CEZA 1UWBB 1S0OA 2QKKA 4URSA 2OPPA 3ULDA 4DS4A 3SQ4A 4OLAA 1MU2B 5DG8A 3PW0A 1JLQB 1VRUB 4CF0A 2ZKUA 1W25A 4FJGA 2P1JA 3V4IA 2HNYB 1BL3A 4H8KA 2VG5A 5C42B 2F8SA 1QE1A 3DLGB 4TYBA 3A2FA 3HL8A 2WB4A 5KGWA 3NCIA 1ZBIA 1RTDA 4HCBA 4FW2A 4ZP7A 3LPUA 2IM3A 3S3NA 3BSAA 2WK4A 2R8KA 3OS0A 3DRPA 5KFEA 4F3TA 4QWBA 2FVSA 4Q43A 1S9EB 1T8EA 4DTNA 5KFTA 1KCFA 5KT4A 3E01A 1JLAA 2O4GA 4E7KA 1C0UB 3HXMA 3ISND 3WNHA 1FKOB 5F9NA 1RCHA 4I2QB 3QZ8A 2UVVA 1NHUA 4N56A 3SQ2A 5E41A 3K58A 3QNNA 3DMJA 5C5JA 2X6NA 4CJWA 3OYCA 4PQUA 1EP4A 1VSKA 4ZPCA 2KZMA 4ELVA 2CKWA 3DYAA 5KFJA 3HPGA 3PY8A 3RWUA 2D7SA 3HT3A 5HP1B 4JLHA 4CJ3A 2W9BA 1WAJA 3AO5A 4Z4GA 4YNQA 5KRSA 1NJXA 4IG0B 4OGEA 2RF2A 2R2RA 3C6UA 1KVBA 1VSFA 2HB5A 1S1XA 5SWMA 2D3ZA 3MECA 3QEWA 4LQ3A 1ZBFA 3KLIB 1DLOA 2FJXA 1RT5B 4Q44A 4J9RA 2C2EA 1O1WA 1YVFA 3MEEA 4BE1A 4IFYA 1ZBUA 2WCXA 4M41A 2WRMA 2VA3A 2OPSB 1NK8A 3NH1A 4FZXC 4U6PA 3QEVA 3ZSYA 4J2EA 2Z1IA 3ZSVA 1RTJA 4Q8FA 5EWFA 1N5YA 1QQCA 3ALYA 4MIAA 3OJUA 3VN5A 3I0SB 2BGGA 5KFSA 5KG1A 3DLRA 1SL0A 5HLFA 2A1RA 3H98A 1KLNA 1S9GA 4IRKA 4ZP6A 1S1TB 4PY5A 3B6PA 3OYMA 2HWIA 1B92A 2YKNA 1I39A 4KHNA 1A5VA 3SUPA 5HBMA 4F2SA 4BWJA 2J6SA 4FJ8A 2GC8A 4XIUA 1S0NA 3VQ4A 5HROB 4QWCA 4ED7A 1B9FA 1KVCA 4TY9A 4J9OA 4EO8A 3NHGA 3AVHA 4H54A 1RT4B 1HYSB 1IKXB 1FKPB 1RDBA 4RW6B 3SYZA 3KD5E 3NF6A 1RA7A 2JEFA 4L8RB 3NBPA 4HHTA 3NMAA 4B3OA 1WLJA 4EBDA 1GOBA 4NCGA 4KO0A 3PX0A 1C0TA 4DU3A 1BQNA 1RT2B 4RNMA 3LZJA 4TXSA 1N6QA 1D5AA 2I1RA 3KOAA 4M3ZA 1MMLA 4E1NA 4CHQA 4PUOB 2P5GA 4CEAA 4OKJA 1JLGA 3MR6A 4IR1A 4FLTA 2XY6A 4KI4A 3GIKA 4E7JA 4O3NA 4FZZA 4CHZA 1QSSA 2E6LA 3CDEA 4RW9A 4J9NA 5KTQA 3IS9B 1U45A 5KFPA 2OPRA 3NAEA 2NUBA 1A5WA 2EX3A 4HVJA 3F73A 1HNIB 3JYTB 3G6YA 1KVAA 1GOCA 4CGJA 1A5XA 1S1WA 3V6HA 4PWDA 3QESA 4CK2A 3OYEA 2XGPA 3EPGA 5JXSA 3AVCA 5KFOA 1S6QA 2DPIA 2FBTA 1NJYA 3H2LA 4WXWA 1K1QA 3DLEA 2WOMA 3TAGA 4TQSA 4EYIB 3G10A 2D0AA 4FYDA 1DTTB 3AVMA 3BJYA 4K4UA 4EP5A 3RR8A 2VG5B 3VQDA 4Y3CA 2UVWA 1EX4A 4CFAA 3S3MA 1C1BA 4NLPA 4MIBA 3DRPB 4O44B 4WYLA 2W7PA 2QKBA 3JSMA 3KMQA 3U3GA 1C1AA 2Y1JA 3AO2A 1JLAB 3NF8A 2G8IA 1HMVA 4CJLA 1WN7A 2ASDA 4CIFA 4EYHB 4NLXA 2BE2A 5DQGA 3V9SA 2UUTA 3H5YA 4E0DA 3SCXA 4Z4IA 3HJFA 4CFCA 3MXMA 4J9KA 3HP9A 1SV5A 3BR9A 4B9SA 4TN2A 2V4RA 4YR3A 2HMIA 4I9LA 4CJFA 4JV2A 4RUCA 3TARA 3DMJB 1EKEA 3K5MA 4FK0A 1EP4B 3PX4A 3OYKA 4K4SA 2EC0A 4AHVA 3DYAB 3KK1A 4U7CA 1UWBA 2UUWA 2W9BB 1Q9YA 3LAKA 1TL1B 1CLQA 5CYQA 2X6SA 3MR5A 4Z4CA 4RNOA 1JLQA 1VRUA 3HYFA 4EZ6A 4CJVA 2C2RA 3TABA 3PJWA 4Y1CA 4CEDA 5CZ1A 3T5KA 3PHEA 5C42A 3DLGA 4YR2A 1Z25A 2D0CA 4DFPA 4CE9A 3KLVA 5KG6A 4Q45A 3SI6A 4C8MA 3OL6A 4DSLA 1HRHA 4KI6A 1FK9B 3RAXA 1S9EA 1RTJB 4QW9A 4CIGA 1N5YB 1NKEA 4QWDA 3O3GA 2JLEA 1C0UA 3NGDA 3MFIA 3G6VA 4Q8EA 3AV9A 1S9GB 4K4WA 1FKOA 4WXOA 1S10A 4ZPAA 3M8PA 3LP3A 2YKNB 1BHLA 2YNIA 5HBMB 2VA2A 2YNGB 2VG7B 2C22A 1X9WA 4Q0BB 4NLWA 2BQRA 1RYRA 1WSEA 4B08A 2FLNA 5HP1A 2P5OA 4M3XA 4HTUA 3I5CA 3TAEA 3KLGB 1JXEA 3P1GA 3CFPA 4IG0A 3GQCA 4IDKB 4HKQA 3NBPB 2QE5A 3PW5A 5KFMA 3P83D 4F3OA 4B3OB 4CERA 3NGIA 4E7HA 3ZSZA 4NCGB 4ELTA 4KO0B 3H5UA 3H59A 5KI6A 3KJVA 3C94A 4DTJA 2F96A 2HHWA 1ZTWA 2WHOA 2ASJA 3L2UA 4FJHA 2G8UA 2GIQA 2A1SA 5J2NB 1N48A 3FQKA 3OSPA 4KPYA 1XR6A 1YTUA 2HW3A 3M8SA 4E3SA 1IH7A 2HHSA 2QK9A 1R0AB 3OYLA 2QXFA 4AILC 4RW9B 1SKSA 4KV8A 4KB0A 1HQUA 4O3SA 1IM4A 1BIUA 3NF7A 4K8ZA 4TYAA 4M3YA 2OPRB 2AX1A 2V9WA 3BSOA 1I3AA 3K57A 1JL2A 5KFQA 4G1QA 3CJ3A 1RNHA 2V0NA 3QEPA 4CHNA 4FLXA 3TQ1A 4WFYA 1S1TA 3G6XA 1S1WB 4Y1DA 4PWDB 4ICLB 1D8YA 1HYZA 4ZTFA 1S6QB 5KGXA 4DQRA 4WYWA 2KFZA 4RW4A 3EZ5A 4TLRA 4MFBA 4W5TA 2JEGA 3DLEB 1Q9XA 2B6AA 4W5OA 2XY5A 3MFHA 4KE5A 1HYSA 1ZBHA 1FKPA 4ED3A 5EU7A 1J54A 2ATQA 4B9VA 1J5OB 2IJNA 3WNGA 2R7YA 4WFZA 2FVQA 4N41A 3IGVA 3UPFA 3GIIA 1C1BB 3V6DB 4F4WA 1REVA 3SFUA 1RT2A 3S9HA 1BCMA 4E1MA 3VQSA 4RW7A 4HUFA 3H5XA 3LPTA 4K4TA 3OJSA 3GIJA 4ELUA 4CK3A 1IG9A 5KFXA 5JS2A 3WNEA 4ED2A 4GMJB 4CJPA 2HHUA 3SJJA 3O4NA 1GX6A 2BE2B 3CG7A 4ID5A 4O55A 1SV5B 1TKZA 2HMIB 2C2DA 3I8DA 3S3OA 5KFDA 3K5NA 1WSGA 3JYTA 2XO7A 3FFIB 1S97A 4FM0A 3LALA 3RB6A 5F8IA 3NFAA 4CEOA 5D3GA 3CDWA 2FBYA 4FJJA 3KK1B 2YNHB 1JKHA 1Y97A 1SUQA 3GILA 5KFUA 3MEGB 4MQ3A 5CYQB 4DL5A 4DEZA 4CGFA 4QOZB 3AO4A 4FZYA 4RNFA 1DTTA 2AGPA 3T5HA 1QS4A 3QYYA 2DPJA 5DK5A 3CO9A 2GV9A 4WZMA 5KFLA 2R8HA 1S1UA 5KRTA 1K6YA 3CIZA 3KLFA 2FVPA 4FK4A 4O44A 5HRSA 3VQCA 3NH2A 4J2AA 1RA6A 2G8FA 1WNEA 1T03A 1TKXA 1TAUA 4H4OA 5F8JA 4J9QA 4DLGA 3L2QA 1JIHA 5KFNA 4OGCA 2IBKA 3VQAA 2E4LA 4B9TA 4J2BA 4MKBA 3MEDA 3M8PB 4O0JA 4IR9A 4DSEA 3ZT1A 3NDKA 3HPHA 2Z1JA 2YNIB 4FJIA 5DGBA 4W5QA 3BQ2A 4B8CA 1L5UA 4XPEA 1KRPA 1D9FA 1BQMA 3HM9A 4ECVA 4DTUA 3GV7B 4MK7A 4ZVFA 3SNNA 1S1VA 2OA8A 3MR3A 1RTIA 1TL1A 5KG3A 1S9FA 4AHCA 3DDKA 4EP4A 5J1EA 1VSEA 3K5OA 1VSHA 3K5LA 5JS1A 3DLHA 3L2VA 5L1JA 4KHMA 3KJVB 1IO2A 4DQPA 2OZSA 2YKMA 4FJKA 3NH0A 4NYNA 1K1SA 5DLGA 2XC9A 1IKWA 2ILZA 1RILA 4KHSA 1ASUA 1RBRA 1LW2A 5L1IA 2AGQA 2IS3A 3PVXA 4O4RA 4M3RA 5DQIA 4N76A 3OS1A 3LWMA 2B5JA 3Q8SB 3NL0A 1FK9A 4KV8B 1LW0A 2J6UA 1HQEA 1HQUB 3IG1B 4CHOA 2IM0A 5J2PA 2D0BA 1CZBA 2W9AA 4F8RA 1KLMB 1QAIA 1ITGA 5F9LA 3M9MB 4G1QB 3RBDA 2JGUA 3CFOA 4Y2AA 2ASLA 3PV8A 3NGZA 2IC3B 4R5PA 3ZSWA 3HVWA 3VQQA 1TP7A 4WFXA 1SKRA 1RBTA 2FBVA 4RW4B 2YNGA 1GX5A 4CJ5A 4MFBB 2VG7A 4BE0A 3TANA 1X9MA 2B6AB 2DTUA 4ZTJA 3L8BA 4Q0BA 1JLFA 1NK6A 4FJMA 4FK2A 4ZVEA 3KLGA 4QW8A 4Z4FA 4O3RA 2P51A 3IRXB 3PUFA 1NJWA 1KFSA 4C8KA 2BQ3A 3OVNA 4I9QA 4IDKA 1RT1A 3RB4A 1WSIA 2GUIA 1G15A 4B8AB 1CXQA 1LWFB 5KFCA
chains in the Genus database with same CATH superfamily
1REVB 4X4TA 4ZCMA 1NEEA 4CF1A 3S6EA 3EE9A 2I38A 3CQ8A 3WXLA 2X1FA 4DSIA 3HVRA 4YY3K 3UD3P 3MXJA 3ZEUA 4CJTA 2A0FB 4WQ5A 1JQGA 3DXSX 1V3RA 4DTOA 3BPDA 1I3OB 4ID5B 3UCGA 2X74A 3CCMS 4F7VA 2DNNA 2R8JA 1RDUA 5L8RC 3HHLA 3VOVA 4BRQA 1X7VA 2UVRA 5K8NA 1HLWA 1FHTA 2MKHA 2J4RA 1GK8A 3LAMA 1IBKJ 3RSEB 1H98A 4ICLA 1BDGA 3NF9A 4F0MA 4NMLA 4B3MJ 1NBEB 3TAPA 3QRQA 3B82A 3QIPA 1ZETA 1YITN 3B6OA 1U1RA 4FOEA 1UPPA 1QZ6A 3EZOA 3I9V9 5DETA 2AJ0A 4KHPK 3T1YJ 3HO1A 3A0IX 2F8EX 1MW7A 2QJ3A 1RABB 3BGRA 2UU9F 1MN7A 3CNQP 3SQGA 5AE3A 5ETSA 2A2DA 1MNEA 5CXTA 1W9HA 4ZVTB 2NYIA 1FVSA 4ILHA 2UUAF 3ZTOA 2CADA 2UUCK 1JLBB 1RBSA 4QCLA 3CJKA 2NQPA 1X5OA 4LF5K 1TV6B 4O5BA 3M32B 4O3QA 3UD4P 4NA2A 2MEWA 4BLGA 1UKUA 2V51B 1LKZA 4NZ0A 3FFIA 3MM5B 1UMJA 2ILYA 3BF3A 2BANB 2E2PA 4Q2MA 5CZXA 3JAMY 3HULA 3IKMA 2KVQE 4K25A 2IOCA 2PYLA 2V63A 2M9KA 5HAOA 3N6MA 3MEGA 4IQXA 3I96A 4NLUA 3OXLA 5GIOA 3N01A 4DN9A 5EVZA 2W4CA 2CPJA 5LJVA 3G6EN 2RDIA 4I2PB 3R6LB 2YKMB 4CF9A 2IA6A 3TR5A 4IJNA 2QMUB 1FDAA 3FGUA 5T7LB 5EUHA 2WTFA 2WONB 1EWQA 1VI7A 3FE1A 2VU5A 4LF8F 4RLEA 2IIHA 3CC7N 4DSFA 4B9UA 3MHYA 4OYBA 1VQKS 3J7AN 3OXGA 4FKXA 1KC8T 3ZZRA 4DR4K 4N7TA 1BY9A 1BU6O 2WVEA 4OKKA 3HDSA 3SPYA 2MLZA 3P3DA 4CZIA 4DTPA 3FCHA 3HT0A 5T7BA 2CGKA 5KPRA 4UOGA 2GQ2A 2R2SA 4I6MB 1D4XA 2ZJPL 3RMCA 2APOA 4F4AA 3OYHA 1NG9A 3MR2A 4H4MA 1B4SA 3CJ2A 1Q18A 1RT1B 5D4LA 3CT9A 4PEOA 3SFGA 1BISA 3ZTSA 5ETQA 4CYUB 8ATCB 3G0ZA 2RMLA 2J0QD 1AROP 2ZHBA 5I3PA 4YR0A 1HHTP 3CMAS 3WDOA 3G87A 2DEIA 2ADCA 3IG1A 3LP2B 4LRAA 1GNKA 4ZOSA 3CO0P 3NGYA 2EHGA 4BVPA 1S5ZA 4M5JA 4DF4A 2NXNA 2V8VA 4WPAA 2XHCA 1UETA 2CPIA 3O9UA 4M3TA 4AHRA 1GOAA 3H08A 4NLQA 1LWCB 4DR2F 1TUVA 4M5DA 1GAOA 2CG8A 2D41A 2ZOMA 1UZDA 1FESA 1O6XA 3CQXA 3CFRA 2CQDA 5CZ2A 4DTRA 4WFAL 3HHLD 4FJ9A 3VAFA 3AO3A 2DD8S 1LWEA 2DGXA 1S4FA 3W3SA 3KKRA 2HRYA 4ZA1A 1RACB 4BE2A 1HLUA 3GOIA 2V8HA 4IFEA 4CO4A 1T6DA 3G4SN 3IRXA 3T5JA 1KVIA 4PXCA 3WHIA 2FLPA 5IM0B 4M5MA 1HWUA 2P9KB 1CSJA 3HVAA 1RDAA 3PJ9A 4KSEB 1RTHA 5CYMA 3CPEA 3OFHA 1WTBA 3CQYA 3VAJA 3ZSOA 4UQGA 4F4YA 4I7FB 4NCBA 3R7NB 2ZZNA 4L72B 3U02A 4PKIA 3SCKE 3C19A 2VG6A 4TLQA 1F21A 3T7ZA 3VEVA 3V1RA 5B0CA 2F63A 2V4JA 2Z2LA 2QMWA 3I33A 3KK3B 4BRDA 5GMDA 2HQGA 1D0EA 4AXIA 4TKTA 1NKBA 2VB6A 1R27B 1IVZA 1LOTB 2A6MA 4DV0K 1KQFB 1OKJA 3J81O 2ZD1B 4F0HA 4A8FA 1N5QA 4CD1A 3PIOQ 3L4QA 3MPUB 4ZPBA 3KLEB 2AEJA 3W8PA 1YT3A 4IH6A 4O0IA 4LH4A 2VZ9A 1TQLA 1ZH5A 2B4JA 1IR0A 1X5TA 3IN5A 1TKTB 2F7TA 2CH5A 5J2QB 1T7PA 2KFYA 3HSJA 2GUPA 4C8ZA 2QL7B 4J9VA 1SJRA 2ATLA 1HNVA 4L76A 2MLXA 1BI4A 3H7HB 4RBUA 3D1OA 2XULA 4HR2A 3DLKB 4YMEA 1KNZA 2EK1A 3TVYA 4U96A 3ITHA 1T9XA 3ENWA 3IFRA 5IWAK 1EXQA 3ZZUA 4W5NA 3QZ7A 3W66A 4KTWA 4N47A 2PI4A 3LW5C 3GV8B 1NK5A 3LP1B 4K59A 3OT9A 4IRCA 1PGZA 1SC4B 4DV1K 3K0SA 1VSMA 1I94K 3CJ5A 1OH5A 3QGIA 3PACA 2E9ZA 2BE9B 2AYGA 2ZJRL 4JI1J 4LR8A 3U1MA 3TPQA 3M05A 4O3PA 2VQEK 2HNZA 1NUEA 2IVNA 4CIEA 2Z8QA 4M5LA 1N4LA 1KOHA 3TTCA 2Q1NA 3NCQA 4ENOA 2ASOA 2UUBF 3AVAA 3DOLA 3O3LA 3Q24A 1RTZA 3DRYA 2YQ0A 4IH5A 1L3SA 2SXLA 2LQ9A 3SQ1A 2BJ3A 2I7NA 3JTPA 4YHHK 2J7UA 4OLPA 2HVZA 3KHLA 4CZJA 5DLFA 3G6ES 2KG0A 2WC9A 4OZ1A 2LFVA 3AA3A 3PR4A 2XO6A 4AHTA 3KUHA 4EMDA 5HQLA 4PA1A 5HRRA 3EYZA 3AJ1A 1YVUA 4FPIA 4B3TF 1I5OB 4DPYA 1ATNA 3GLJA 1EQ0A 4CNYA 5AFUA 5HATA 4CZGA 5ETVA 3H42A 2EFVA 2VC0A 2QTDA 4FSVA 4AHSA 4AL6A 2LEPA 3S1TA 2AZ1A 4RWXA 3MGJA 4LF7J 3VGLA 3FMBA 4K5SA 3RMDA 4CF2A 3VPZA 4A62A 2WW8A 2HF4A 1SJFA 2W2PP 4USWA 1YF5L 3SK3A 2YV0X 4IBNA 3MCNA 3EGZA 1ULRA 1C0GA 4Z2XA 3KXDA 4HYKA 4CJUA 2LQ8A 2CQPA 3EGWB 2QWLA 3NCRA 1LXNA 1KTQA 4CCHA 3MF5A 1NJIT 3OLAA 4ED8A 4B1VA 1FO1A 1FXXA 2XWYA 2HEKA 4DX5A 5I3UB 3CXCR 2YHAA 3CDAA 5GAEU 1JLCA 2NCKL 4X4QA 5C2GA 1FDBA 4NOHA 3GYXB 1BE4A 3VAHA 3QERA 2EW9A 2KRBA 4KTQA 4DG1B 4DR7F 1VQ8N 4HT5A 5F8HA 5GIPA 3KG4A 4LF2A 4PPZA 1ATRA 2HFOA 5ADXA 2HHVA 3HJVA 4X62F 4WZQA 1HNZJ 4NLGA 5KFIA 3CJSA 4QYRA 5LMNK 2QIFA 3KHHA 2DCUB 3N6LA 4DL4A 3FQLA 2IAJA 2DHGA 1UA1A 4IRDA 3V1QA 4MKAA 4FNIA 4PG5A 4B9NA 2W9CB 4ECRA 5C25B 2ZBQA 1M90T 3QO9A 3DM2A 3AVIA 3FR0A 2DIVA 3J81U 3FSIA 1WSJA 4JUZA 1KAZA 2QTWA 1T11A 4DFJA 1S49A 1SQFA 2QLWA 1QVFR 1NOYA 3RUBL 3S8SA 2Z2MA 2E5JA 4ZCLA 1YI2N 3DKDA 1ZTTA 1OYDA 3R97A 2IJFA 3G4SS 1QDUB 2L9DA 3DRSB 3KWIA 1NK7A 2KXHA 2O8FA 2ZQBA 3G2XA 4IYQA 1RZMA 2HSEB 4O4GB 2FC9A 1RLDA 1QE1B 1NK4A 1ZAXA 3AVLA 3NAHA 1Y9OA 3LGNA 3VR1A 4HDGA 1VQ5N 4HTIA 3U9DA 4H03B 3D7SB 2E88A 1VS3A 1SJ1A 2VWBA 1EETB 3KWMA 3SQ0A 5ETPA 4CGIA 4MLHA 5LM7E 1FTCA 1RB0A 2O8EB 3VQBA 1XJWB 3E01B 4DFMA 1IBMF 4OPHA 1DJ0A 2HHTA 4U67L 2R3VA 1CJUA 2OPQB 1IJFB 3EDQB 3IGNA 1VQOS 4KB1A 4M3UA 3CF5Q 4DL6A 4EHUA 2UUAJ 2F5GA 3T19A 4ZHRA 3ZCMA 2DNOA 1YJNN 3H5SA 4JKDA 4OZJA 5KG0A 4KIAA 4K4VA 1OY8A 1SVDA 1NBWA 3AA9A 4LRFA 4QU7A 3PIPL 2AV5A 3OTOK 1OY6A 4DV2K 1XNRK 2RF2B 1URRA 2IDOA 1LWXA 3QFPA 3UR3C 4ZVGA 4DV5J 3CJ4A 4FBTA 2JX2A 2P8IA 1KSPA 4F2RA 3MEEB 2DRDA 4IFYB 1NZ8A 2RNEA 5BN8A 4BR5A 1W0HA 2FIUA 2RQKA 1NGJA 1XMQJ 2Z30B 5F8NA 4M45A 2V34A 3VA3A 1VAZA 1IJJA 2LXFA 3BO4A 1WAFA 2C3MA 2IGIA 4KHWA 3OS2A 2X1GA 2GNKA 4LR7A 5K8MA 2CNNB 3D0HE 4NWBA 3O4WA 1AB8A 2ZC3A 1XIQA 1Y4ZB 3FGVA 3GE1A 3THYA 3W9JA 1BC6A 3P5BP 2YNFA 4C8OA 2IPOB 4IG3B 4GKKF 3M6VA 1H6KX 4YDUC 1HHQA 4DLEA 2DGQA 4G9ZA 2A1BA 4ZP9A 2JWLA 1D3WA 1QSYA 3D6RA 3T1AA 2W6LA 4KR0B 4QU6A 3KLHB 4G6VB 5AQNA 2CDQA 3CCSN 4CJRA 2RKIB 5KFHA 5H9EK 1C1CA 3C14A 4CEQA 5JUMA 2E2NA 1UJ6A 5DG7A 4OMFG 4F3QA 1TZ0A 2NUHA 3LDPA 4LFAJ 4CJSA 4IKFA 5K14A 2G0JA 2CVIA 3TEHB 5DM7Q 1HNXK 4P6QA 3AARA 4FLYA 2J9EA 5C2FA 3PFEA 2ZM6K 4G3IA 2DHHA 4JK9A 3SBGA 1GEHA 2DNKA 3AQPA 1J6ZA 3VV2B 3PEHA 5FDLB 3IR5B 2ZFHA 1YJRA 3M3ZA 3SMSA 4ES2A 5L1KA 1OH7A 3NNAA 3CETA 3V81B 3WIVA 2OMLA 1Y5IB 3NE6A 4RNHA 2YWEA 1QQOA 5J2MA 5LXYA 4M3WA 1UFWA 2DNRA 3LGHA 2V67A 2YBVA 3AVBA 3TI0A 1OJ4A 3W5ZA 4WYBA 1FA0A 3I31A 4ECSA 1J9AA 2DFHA 5FIIA 1RT6B 3TUJC 4GKJF 1H74A 5F8LA 2XMJA 5AZIB 1I6JA 4DR4J 1WACA 1AYEA 2ZH5A 3DLBA 3L7PA 4JKCA 3ZXWA 1UAXA 1W97L 1VQ8S 2ABYA 4NLDA 3M2RA 3VGVA 1FXLA 2JLGA 4U7BA 1N56A 1MWMA 4F50A 2HS3A 1K0TA 4IDHA 1WTFA 3FMWA 3UCZP 1YKWA 5FD1A 1HMVB 2O8DA 3BREA 2Q6CA 4USHA 3PCOB 2H48B 1DBDA 4MYTA 5ETRA 1ASVA 4BR9A 3OYDA 1WSVA 1YXQA 4CGDA 4Y2IA 1LQ9A 1HI0P 4C98A 3E51A 3FJ2A 2R7XA 4FWNA 1RGIA 3WQUA 1V3ZA 4ZCKA 1M5VC 1UWBB 3D6FB 2YHYA 3MD3A 3SQ4A 2FJAB 1MU2B 1RCXB 1J5EJ 1VRUB 3QSIA 1Q7YO 2VJVA 4BVOA 2VG5A 3DGPA 4PRFA 3D3BJ 2F8SA 4MLEA 1CBKA 2COLA 1SI9A 2K1RB 3P49B 1RTDA 2C42A 3EJMA 2IFXA 3S3NA 3BSAA 3BGFA 1CS4B 3ZZTA 2W41A 1PYSB 4LBIA 4QWBA 4YDDB 3M1VB 4DV3J 3AQOA 3TA0A 4LJMA 3HXMA 3FZ2A 3ISND 1BLUA 1WI6A 2BJ8A 3C16A 1RCHA 2RQCA 2OIHA 2UVVA 4LMZA 3N4QA 4ISGA 2ZHOA 1GLDG 4NXMF 3K58A 2E5LF 2L9WA 1N33F 2X6NA 2FDNA 4OPAA 1VSKA 3Q22A 1SZ2A 2IRUA 4LC9B 1FEEA 3BO3A 4XDCA 3VMFB 2P9UA 2D7SA 4CJ3A 1X4FA 1NGDA 4IG0B 1RQ0A 1UTAA 3BZQA 1HL6A 1KVBA 5KAKA 2D3ZA 2P9PB 3MECA 2VQFF 4ZN3A 3JQMA 2J8SA 3T6JA 2OEMA 2FHKA 1PJ6A 4J9RA 2C2EA 2AEMA 2UUBJ 4KGXB 3PKMA 2WCXA 2WRMA 2OPSB 1NK8A 3QEVA 3PG9A 3ZSYA 5EN1A 2VKRA 4EAHD 3X1LB 2BZ2A 5SUHA 2HF3A 3OXFA 2F3JA 3OJUA 3BN4A 2RB7A 1F9EB 3I0SB 3HLUA 4CLSA 5KFSA 2NRXA 5HLFA 2LDYA 2A1RA 3H98A 3QFWA 3SCJE 3FSYA 2UU9K 4LFBF 3IR7B 2OD6A 4BBYA 4KHNA 4GVBB 2GHVC 1A5VA 5HBMA 1RWXB 1UVNA 4CO5A 5HROB 2OMOA 2XMTA 2YPZA 4J9OA 3NHGA 4H54A 5AE2A 5L38A 3G8TA 1IKXB 3J7A1 1RDBA 4RW6B 3KD5E 3NF6A 3CMQA 4A2BA 1SAZA 2J9CA 4NCGA 2AEFA 3PX0A 1C0TA 1CJTA 3GPAA 4DU3A 4P9SA 1I94J 3LZJA 1N6QA 4M3ZA 1PKUA 4PUOB 3BM7A 4OKJA 1JLGA 3OTEA 4AL7A 4HVZA 1GMVA 3PHTA 2VH7A 4HH0A 1U1PA 4LF6F 4CRJA 4AQYF 4OV6A 3NWGA 3IS9B 2CFXA 2QYGA 5CA5A 5KFPA 4K7QA 3UI3A 1XNQF 3EE8A 1H73A 3CCUN 1S0VA 1EZZB 5IQQA 5CQGA 3JYTB 1KVAA 3GFYA 1DAXA 1RADB 4WFAQ 1OWXA 1ZBSA 4PWDA 3M1FA 2XGPA 3EPGA 5FPDA 5KFOA 1F9FA 2DPIA 4OX7A 3OR1A 4WXWA 4BRLA 1KR4A 4LF8K 1DTTB 3AVMA 2ALYB 4ID8A 3BJYA 5B8HA 4EP5A 3RR8A 3ZX2A 1N36K 1T6CA 3RBZA 3P31A 4ZJLA 2EFQA 3ZTRA 4YORA 2HAFA 3A5LC 2XMMA 4MIBA 2FXUA 3DRPB 4O44B 3P45B 1PAEX 2FHJA 1CJVB 3IA0A 3KYLA 1ROFA 5DO2A 2V2VA 2I8EA 2G8IA 1H1VA 4NLXA 3AODA 2UUTA 3H5YA 4E0DA 4ZLJA 4J9KA 4TN2A 4CJFA 2CQ2A 1EKEA 4C23A 3MWTA 5AQFA 5TKWA 3OYKA 3A8YA 4K4SA 5E3CA 1S22A 3DYAB 3KK1A 4U7CA 5K9FA 3R6MA 4A5AA 3HOTA 3AY0A 3ULEA 1TL1B 1CLQA 2GHWA 3ZZYA 3MR5A 5JVHL 2O8BB 2OKQA 2JJ4D 4RNOA 3CCJS 1T9WA 2D1CA 2HWTA 3M8WA 3BS9A 3QB0A 3VEYA 5AQYA 4X4VA 2YI1A 4OYWA 3N4PA 4G65A 4HT7A 4CEDA 2RT3A 7FD1A 3PHEA 4DR2K 3DLGA 2V2KA 3AD9C 4IO1A 4CE9A 1RP5A 4C8MA 2AA4A 4DZDA 5CH7B 4RJVA 3RAXA 4JYAK 3L4BC 2KM8C 4JI8F 4QW9A 3E3XA 2CJKA 5EXWA 3EVMA 2QWPA 1Q7YT 3C6HA 3Q8UA 3O3GA 2B9XA 2XB2D 5E3AA 2VHGA 2GVDA 2ZJRQ 1U1MA 4RWWA 3CMES 2IVMA 1WORA 3IMXA 2DK2A 3NGUA 3R9LA 1S72S 4CLPA 1UWAA 4BRGA 4CZHA 3UDVA 4ZS6A 2VG7B 2C22A 1X9WA 3I4HX 5DJBA 3OW2R 4B08A 2P5OA 5GAEI 3QAUA 2KT5A 3KLGB 3OHRA 2MKKA 1JXEA 2MSTA 2ZUGA 3P1GA 2B51A 1NPRA 1R7IA 3GQCA 2PA3A 1FRXA 2F96A 1ZTWA 2F65A 4LRBA 3FQKA 1XEZA 3R8EA 2E1YA 1XR6A 3UKRA 1WG1A 3M8SA 1XUPO 4FF3A 3OYLA 2QXFA 4P71A 4KV8A 1HQUA 2Y8YA 4JI4K 1BIUA 4K8ZA 2OPRB 4EGLA 3B54A 3QNWB 3HHLB 5AXKA 4LFCF 1RNHA 2D1KA 5HJYA 3RVCA 4FLXA 3TQ1A 4WFYA 1S1TA 3FCVA 4ICLB 3C65A 2VF3A 2R9LA 3OTOJ 4ZTFA 3J81Y 2DCLA 1NDCA 1S6QB 2Z57B 3VVUA 4JHDA 2C2OB 4OHWA 4RO0A 1Q9XA 1IQTA 4UUXA 1HYSA 4AE5A 2L41A 5BN9A 1V5VA 4ED3A 3VAGA 2ATQA 2IJNA 3WNGA 1VQ6N 3O2IA 2QFJA 4CBUA 1UL3A 3GIIA 2DEJA 2RHQB 5M2UA 1REVA 2PD1A 4RUBA 3HSCA 1IG9A 2P9CA 4OHVA 1FX4A 4A5BA 4GMJB 4CJPA 3SJJA 1WEZA 2BE2B 4ID5A 3X3UA 1SIZA 3QAEA 1MWQA 2K7JA 3WXMB 2FJDB 4NXNF 4HACA 4BRAA 4HHUA 2HMIB 3K5NA 1HWIA 3FFIB 1T9TA 4H4KA 3UDEA 3LALA 3RB6A 4FO0A 1B7YB 5F8IA 3RSEA 3OFGA 4A8MP 3TTDA 5F3TA 3TQEA 1DZ5A 3TUZC 5RUBA 3MEGB 1YBUA 4B3TK 2OTJS 4I67A 1YJ9N 5CYQB 4QPTA 4QOZB 1M1GA 2CNLB 2FY8A 2YX7A 2RU3A 2F4VF 3ZYYX 4OYPA 3FNNA 4HI1A 2AGPA 1NB2A 3CO9A 3HKZD 3GJRB 4WZMA 1YAGA 5D4PA 1HNXJ 2HHHJ 2RILA 3OPKA 2FVPA 4FK4A 1Q16B 1U6FA 5HRSA 1OVQA 2NR0A 1EJ7L 3T1HJ 2QMXA 3WEEB 3FZLA 1KQGB 5I3QA 3MPYA 1T9VA 3M32A 1T3VA 4JI6K 4JI3F 4MKBA 3CULA 1ZAVA 5LT5A 3ZT1A 2CPHA 3KVGA 3NDKA 3VF4A 4M5KA 1WUUA 5DGBA 3HFKA 2ZNYA 4XPEA 1KONA 3VGTA 4DR7K 3HM9A 2WUSA 3GV7B 1KQKA 2LU2A 4MK7A 2KDOA 2WSFC 3CTRA 3QT6A 1VQYA 4PHTX 2UZAA 1RHQB 1DARA 3UN5A 4C97A 1VSEA 3K5LA 3L2VA 5L1JA 2B4VA 2BJ9A 4DQPA 2YQ1A 2OZSA 2YKMA 1WI8A 1ZPVA 1K1SA 3Q0AA 2XC9A 4A47A 3UKUA 4ZPWR 2QLXA 1A0OB 2IS3A 4DV7F 3PVXA 3CIPA 1HBNB 1U26A 4O4RA 4M3RA 2Q0RA 5T7LA 1CVJA 2DH7A 3LWMA 1VQPS 3C7NB 1SPBP 1S7HA 4LT6A 5HI7A 2MZRA 3AY9A 3IG1B 2OUGA 3QBWA 2IM0A 3P39A 2D0BA 3IBCB 2ROEA 2W9AA 3MUVP 3HX9A 2BJ1A 4CZFA 2ASLA 1Q95G 2W6KA 4WFXA 3D68A 4Z7YA 2FBVA 4RW4B 2YNGA 1VQLN 4JI2K 4MFBB 3AAWB 3NS6A 3R3LA 3VVTA 1YJWN 3D1HA 4ZTJA 2NRVA 5IV3A 4DI6A 1X4HA 1R8CA 1WEYA 4Z4FA 3IRXB 3BZCA 3PUFA 1JCGA 5LMUJ 1IN0A 1RT1A 1WSIA 2GUIA 3NCPA 1CXQA 3J7YU 5CYMB 2NUUG 2VV5A 4B1XB 5J2NA 4B9LA 4USMA 1VBZA 4BG9A 1WDDA 4KAIA 4LY7A 2VWJA 4ZJQA 1SQGA 1RAJA 1S57A 2BACA 3R1LA 2RIJA 1GXTA 2ZF5O 5KT2A 1WKLA 2CZ4A 3LP2A 3TWZA 4C3LA 1DQ8A 5HQ8A 2ZVSA 4RUAA 4OHZA 5DDQC 2ZWOA 3TTFA 1TKZB 5GADI 3BV8A 4U95A 3EMTA 3GJSB 4IUFA 1NWKA 3FZHA 2DTJA 1LWCA 4BQZA 3LA0A 1UAWA 5D3GB 2CZ9A 4GMKA 4ECWA 1QHTA 4Y00A 2QLFB 2F9DA 3Q8PB 3SIPB 1HR0J 2HBYB 3H4DA 3QNOA 4L3KA 1YK9A 2KLAA 4BWMA 5G0RA 4AQYJ 2WVCA 2ZOFA 1X31C 2QEXN 2ASMA 1G99A 3TZXA 2BTFA 1HD0A 2P9KA 3UN2A 5KFFA 3L3UA 4BRHA 1VQ6S 1XMOK 4HCCA 6FD1A 3DLJA 1XERA 3UCUP 2I9SA 1HA1A 4I7FA 2R7VA 3LUYA 4K8RA 2JOQA 3HZEA 1UFKA 1TKXB 2QA4G 5IC4B 4ILLA 4CD3A 4CLYA 1YTAA 2M70A 3CJ7A 2FF3B 3MEDB 4DMNA 4FYYB 4GKKK 3KK3A 1NGFA 3D28A 1PO6A 2DJWA 1U1LA 5L9XA 4DL2A 1NU0A 2HGMA 2XTJP 2FQQB 3GCXP 2PAVA 2ZD1A 4XH5A 2HNZB 2YNHA 5CABA 3TNVA 5IXUA 2XZTB 1NHVA 1NSAA 2ZH4A 3VF6A 4BR7A 4F04B 1Y00A 2B7BB 1WBDA 5J2QA 2P9SB 2E9TA 2E1PA 2H54B 3BDPA 4OZ2A 1GT8A 1KD1O 1XN9A 3OQ2A 2B4OA 2GJ2A 4KB7A 3J7ZT 1GXUA 4BR0A 1GMWD 3CCEN 4NRUA 1R6YA 1M5KC 1H7WA 5J2PB 3CC4S 2YKAA 4PG8A 2HFUA 1WC5A 2AJ4A 1KVJA 1V4TA 1TGOA 1HD1A 2WFBA 4B1ZA 1R0CB 4OLOA 1YBAA 3QRPA 2RRBA 4ETXA 5D0GA 3VQ6A 4BHQA 2VGNA 3Q7CA 1HNWF 1S0MA 2KZZA 4KGZB 1JXLA 4FJ5A 2D9PA 3ULHA 4CESA 1YLXA 2LU1A 4ZVUB 1E4GT 5GAEP 2GQCA 3ZT2A 4GKJK 2HBJA 3LPYA 1SIWB 1JLFB 1KXPA 4MK8A 4JI8J 3THWB 1SH3A 4WIIA 3WQPA 4DR1F 3GFZA 1VQMS 1TFWA 4WCEL 1QZ5A 3H45C 2KHDA 3BO2A 2B0GA 1VHXA 3T5LA 2WAQD 4A61A 4URQU 3C3LA 2ITGA 2YPYA 2NSCA 3AVFA 1B9DA 2WVFA 3E9PA 1NDLA 1OS5A 4W4MA 3CJQA 4BC2A 2Z2YB 1WUAA 2XCPA 3QBCA 2MJUA 2QLJB 1U0HA 3UQSA 3AHPA 3A8EA 4BRFA 5HRPA 1KLMA 5IT9O 2IAJB 4UOFA 4CHYA 4B3RJ 2CJYB 2BABA 3MDFA 4IOCL 4DSKA 4A57A 3KG1A 1TL4A 1TVRB 3L2WA 4IXCA 5KG2A 4WU3A 1R89A 5HMZA 3DM2B 1UA0A 3O5TB 1VYAA 4JB8B 3KHGA 2HVEA 4E19A 2D5RA 3KHRA 2HHXA 3MK6A 4ALZA 2BRLA 1SQKA 2AHOB 5B0FA 2PFFB 1RKJA 3V9WA 4HUGA 4ECTA 2NLXA 1WF0A 5ETOA 1IKYB 1YJTA 1S7IA 1YHQN 4MDBA 3OFFA 4BRKA 4TU7A 2QZ8A 2YX6A 3N79A 4Z4HA 5IOLA 5J1NA 1VBKA 3FCWA 5JMVA 2P5VA 5M1FA 2ROGA 5I3UA 1JNRB 3BBCA 4DQSA 1M1KT 4DUZJ 5AQZA 4K41A 1JXBA 3S41A 4ERDA 3FEZA 3GYGA 4DG1A 3AJDA 3VEZA 1XI1A 5LL6Z 3WUHA 1XWLA 4NXMK 5DZ6A 4QAGA 2KQ2A 4KH6A 4FVUA 3K8WA 1N33K 2C28A 4FW1A 1UW4A 1ZS6A 2PYJA 2J5AA 4ID1A 2R7QA 1PYTA 3CHWA 4LF9K 2H51B 1NMEB 1ZBLA 5KG4A 1FT8A 1FRLA 2VFSA 1JK9B 1YVNA 4Z7CA 4E1JA 1JJ4A 1FX2A 4PL8A 2PZSA 2MHNA 2W9CA 3QMQA 2J0XA 1L3TA 3C15B 2ZH8A 2VQFK 2EVZA 1JCFA 1BGXT 2V2QA 3NGSA 2ZWPA 2DNYA 4KBOA 1SL2A 3A13A 3PRBA 5I42A 3KK2A 1CG2A 1SQEA 2KVIA 1SBRA 4YOXA 3EN9A 4YB7A 4DCHA 1QSLA 2QEXS 5BXIA 4KFBB 4RW8B 4JI4J 3DRSA 3CXCM 1Y10A 4JI0J 1MWKA 3K8VA 1TFYA 2Z58B 2ZE2A 3OY9A 2XSFA 2E5HA 2W8LA 2FHMA 3CM5A 4O4GA 3VAKA 3DI6B 3LANA 1RAGB 1RHUB 3CD0A 4LFBK 3RMBA 3A8JA 4URGA 1RT7A 3DN9A 3R1HA 3CD6N 2L3MA 2B43A 4IFVB 3L0QA 2YX4A 4ZPVR 2ASYA 3K9JA 1EETA 3QWPA 3TSUA 1D1UA 2O8EA 2KI2A 1IWGA 4LBPA 4A8OA 3HM8A 2BUPA 2H5IB 4C0BA 2OPQA 5E0OA 3M8QA 4DMZA 3BEXA 3A8IA 3OL9A 1F5BA 3PRDA 2BJEA 4ER8A 4JV5F 1NGEA 4PCQA 3R7BB 4X64J 4U7UD 2YNFB 3I0RA 5JVHQ 1U47A 5A8WB 2B7CB 2BX6A 4NB4A 1QVFM 2FHOB 4LSLB 3BGLA 3W2VB 3DHXA 4JI3J 1RDCA 3BF4A 1AA1B 3DRRB 3GWCA 4LVOP 3KMSA 2VYPA 2FJEB 2YY3A 1DRZA 3QLHB 2FBXA 3DOKB 3F2KA 4IOXA 4FWSA 4HUEA 4ZVSB 4FYVB 4HTJA 4CO2A 4DF8A 1YZ7A 4BRMA 1C1CB 3CCES 2PI5A 1AUSL 4FJXA 5IFMA 5K14B 2WBMA 2VKZG 3R2DJ 4DUYK 3GIMA 1ASWA 2G8WA 5IT9U 4JI5F 5LSRA 1F5AA 3Q8RB 1D9DA 2MKSA 3K7RA 4KH4A 4J2DA 4DV7J 2XCAA 1VIOA 3RBEA 1VR6A 4M5HA 2P9NB 3ZNUA 4R79A 4GC6A 3HFZB 3R5JB 4NLYA 3HVTB 2PBDA 2H5EA 1LK7A 3FBEA 3MN5A 3BUZB 2R8IA 2I2YA 2BR0A 1WB9A 4AH9A 5J2MB 2KFNA 4IG3A 2B3TB 3HK2A 1WHYA 3OYIA 4X65J 5KFKA 3NGKA 2YJFA 3QETA 3W5XA 4LF4F 3TJ9A 4HDHA 4JI6J 4Y34A 3KLHA 5L1LA 1RWPB 1HPMA 1IBKF 2RKIA 3IWLA 3O3HA 2IA0A 5GADP 2HFNA 4DU8A 3Q7BA 1CQMA 2DNGA 2B8QA 4QS8A 4DR3K 1DEJA 2PA8D 1DKGD 4ISFA 2UVUA 2MZQA 4CJ7A 2G2YA 5FPNA 2MKIA 3I5BA 4OHYA 1LK5A 3SI8A 1IKVA 1VRTA 3GJQB 3IDHA 2Q97A 3ZSQA 4XDDA 1HUXA 3OBIA 1YTYA 1TK0A 2DB1A 2I0XA 3WX8A 5FDLA 5JLHA 4AXJA 2I5JB 1NGCA 3V81A 4WJBA 3ETMA 4LUBA 4LD0A 1HW8A 2CAJA 3GONA 4FS2A 1C0MA 4W90B 5C2DA 4A8XA 3EZUA 4XEIA 1TU0B 2Z2ZA 3QBXA 5GINA 1RT6A 3DGPB 1BWFO 4M7XA 3R6GB 1CC7A 5AZIA 2XQCA 1K47A 1RTDB 4CFBA 3HMJG 3DLLL 1L3VA 1FJ7A 5HL7Q 2DXDA 4DSJA 2QV6A 1WSHA 3AB4B 2AJQA 3VF2A 4K50A 4DTXA 2O4IA 3CJ0A 4F25A 3VEXA 2CJQA 3M5RA 4WBFA 3CJAA 2Q2RA 2RS8A 3J8AA 2DY1A 4P10A 4JS4A 3M8RA 3C16B 4L75A 3OHBA 2PEHA 3JS9A 3ZT4A 2VJUA 1GXLA 4J9MA 5EHHA 2YHBA 1UVJA 2XHWA 1JJ2R 2HWHA 2FZKB 4KKOA 4QIEA 1VC0A 4FWLA 2RD5C 2EEYA 3BPSP 4A8SA 2NZ4A 2KL8A 2P9UB 3FVYA 5AQUA 5BR8K 3M4XA 1Z4UA 3TO8A 4GO7X 5FROA 3V5RA 1MU2A 5SZTA 4B3SJ 2C1EB 3MECB 3P38A 1KFDA 1VQNN 5I9EB 2K1RA 3H4BA 4FLWA 1RBUA 4OL8A 1CS4A 2G1HA 3CWJA 3J7Z5 4YB5A 2Y1RI 2XMAA 1K8KB 5AQKA 4R8UB 2ZBIA 3M1VA 3CCVN 1UZHA 5E26A 3O3FA 3HCXA 3G8SA 1RT3A 3MMJA 5HLFB 3THVA 4M63C 2J76E 4FNHA 4OI3A 4P2FA 4KGKA 4BDPA 5ETMA 2BUNA 4JD2B 1XMOJ 2FB0A 1BMQB 4NLTA 3J7YI 4LREA 4W5RA 1Q8IA 3F5TA 4NXNK 5E7OB 4M5NA 2GMHA 1U1QA 2P9PA 3PTWA 3CDUA 5M2PA 2PMZD 1VHFA 2VWKA 1C0TB 1CJTB 4ILGB 4CEBA 1O0PA 2Y0BB 3U7JA 1N6QB 2BW7A 1RBLA 5ETTA 2QX0A 1JLGB 4DR1J 2OPSA 5FRNA 5CY4A 1KP6A 1QUVA 2DNPA 2LECA 4KBIA 2F4VK 2BOAA 3OFEA 1M5SA 3I0SA 3G71S 1DHMA 1NPKA 4CNZA 2IRYA 3N6NA 5KFGA 2LSNA 2AJ2A 1VSIA 3OYNA 1RSCA 3MXIA 3P4UB 1WOQA 2HBRB 1VBXA 1DTQA 5HROA 2IVOA 1KHVA 2VODA 1GH8A 3BBBA 2AIRB 2GV1A 2G2ZA 1IKXA 4RW6A 4FLZA 4FJ7A 1RHJB 1YJ7A 1UVLA 3A1YG 1GQEA 4OI1A 2AF6A 2KYXA 5AQSA 3GP9A 3UFCX 4CEFA 4PUOA 5AT1B 1N32K 1Q8KA 1VQ7N 4CP5A 1QQMA 4KRWA 2BYCA 2GVZB 3D3CJ 3OYJA 1LFWA 3BSCA 4IEEA 3ICLA 3IS9A 4NLSA 2ZBCA 1Q4RA 4DCOB 4UY8T 2XNRA 4OPJA 1I1GA 2FZGB 1FVQA 2A42A 5IT0A 3OYFA 4M5GA 2VBZA 1MN9A 3WZ0A 1L3UA 5B0GA 1VK0A 3D6MB 1SL1A 2DGTA 3H40A 4A8YA 1NXIA 1NCLA 1Y3JA 3VF0B 4DS4A 2OPPA 2FTRA 1W25A 2R7OA 2GELA 3V4IA 4PL7A 2FSKA 3H1QA 5B0AA 3A2FA 3DLGB 3HL8A 4OIXA 2A2CA 1ZBIA 5FLXO 1FE4A 4QQBA 2IM3A 2E1MC 4JI1F 2WK4A 4HTLA 5KOWA 3DRPA 2HIQA 4Q43A 1T8EA 4ETZA 2PEBA 1M5PC 3T69A 1JJHA 4I68A 4YOTA 4UZCA 3AGKA 5C2CA 1N5SA 1ZA1B 3M2VB 4FXWA 1AFJA 4WQ5C 3SQ2A 3CCLS 5J1PA 2G13A 1BXNA 4WP8A 2W2OP 3LGMA 3W8GA 2CKWA 2CQ3A 3CI5A 1K0VA 4ZIWA 3DYAA 5KFJA 3HPGA 3PY8A 3HHLC 4YB6A 1BG3A 4OI2A 1WAJA 3AO5A 5E3RA 4NA1A 2O8BA 1H72C 2G0CA 5SWMA 4JKHA 2XMWA 4LF9J 1ZBFA 3KLIB 3QATA 4OYMA 1DLOA 2FJXA 5B08A 4Q44A 4OHXA 4LF7F 2EXUA 2KHCA 1YVFA 2NRWA 1FJCA 3L6QA 1ZBUA 4P7TA 5AXMA 4WIQA 2VA3A 3UKRB 3SDEB 4JKAA 2PGCA 3D2EB 2XYPB 4X66J 3CCRS 1UW9A 3N4WA 4RWTA 4H0PA 4YOEA 3MCMA 1P8GA 4Q8FA 3ALYA 1FJEB 4FL9A 4HI2A 2X3DA 1FRMA 4A48A 2BGGA 5KG1A 4P2MA 2NRZA 3IAM9 3T41A 1KLNA 3CCVS 4IRKA 1S1TB 4PY5A 2O8CA 1B92A 1I39A 4L6V3 4NL5A 2ZBPA 4M8LA 3DJCA 2BOPA 3OTBA 4KGMA 4JHDB 4FJ8A 2BE7D 4MTPA 2I6WA 2M0GB 3EM1A 3OA9A 3NS5A 3AVHA 1RT4B 2F8MA 1HYSB 2UV8A 2ZVIA 3TUIC 3SYZA 2W01A 4OYAA 2JEFA 3FBBA 3HRGA 3NMAA 1GOBA 5FPEA 3ENHA 1HKCA 2EFPA 3HZ6A 3D6HB 5E3QA 3SCIE 3R7SB 4B02A 2I1RA 1MMLA 4E1NA 1NM1A 4YOUA 2OSQA 4KI4A 4X4SA 2V8DA 1MLAA 4E7JA 4O3NA 2W1BA 4A46A 4E2FB 4YB1P 1QSSA 4KC5A 3D66A 2FSNA 3R8YA 4LF4J 2OPRA 3NAEA 4HACB 1YDLA 2HBKA 1VLYA 2NUBA 2EX3A 1GOCA 4DR6F 5LL6d 2X7IA 1A5XA 3KZBA 3V6HA 3QESA 4LIWA 4FF2A 2VBWA 3MM8A 3OYEA 1QUPA 1S6QA 2FBTA 3DFEA 1NLKL 3H2LA 2HFSA 1SXLA 2H3EB 3OW2M 1H38A 5DDPC 2XS5A 3G10A 2D0AA 3KDNA 4YN3B 1IM6A 1B64A 1RWVB 2HZCA 3VQDA 1WBBA 2UVWA 1EX4A 4CFAA 5AQLA 1H2UX 1HNWK 2ZBRA 3KUGA 3UE5A 2ZDOA 4DV4J 1VK8A 2W7PA 5FLXU 2ZH7A 1IBLK 3IBWA 2QKBA 3JSMA 1H2TZ 3KMQA 1OSDA 3U3GA 4DN0A 5AQPA 2Y1JA 4ILMA 1JLAB 3ILJA 2B4UA 1WN7A 4K43A 2BE2A 5DQGA 4Z4IA 4U8VA 3SCXA 4CFCA 1OPIA 4YY3F 4B9SA 2Q79A 1VC6A 2V4RA 2HMIA 3CCQN 3OBYA 4RUCA 1N34J 3DMJB 2GA7A 4FK0A 1EP4B 2KJWA 4DV5F 2DO0A 4AHVA 3MPWA 4DV6J 1Y0HA 1UVIA 2V8GA 1Q5YA 2AYMA 5CYQA 2A41A 1WOSA 2DHSA 2NSBA 1R6VA 2L48A 3IP0A 1JLQA 4OZLA 2Z56B 1D09B 3PJWA 3W3DA 4Y1CA 6AT1B 4WFBL 3UKUB 5AFUH 1XMQF 1Z25A 3IRWP 1QLNA 4DFPA 4KHPF 4Q45A 2LYVA 1UVKA 5I4MA 3JSRA 4KI6A 3RU0A 1YWXA 1IV0A 1RTJB 3ISZA 3VAIA 4CIGA 1N5YB 1NKEA 3WEEA 5H1SV 1E3MA 4QWDA 3NS7B 1WELA 4GRSA 1C0UA 2OEJA 3AFGA 3NGDA 1REGX 4Q8EA 3AV9A 3JAMO 1Z1ZA 2FYXA 1S10A 5BYSA 4CDIA 3MX2A 2O67A 2YNGB 4F26A 3SMPA 3J7YP 3EGVA 5D4NA 4RX6A 2BQRA 2DHXA 1RYRA 4J9UE 5HP1A 1W7AA 3IWNC 1XQSC 4M3XA 1AZSA 3I5CA 4BC5A 5CD4A 2HBLA 2LP4A 2QW9A 5ADXH 3CSKA 3DXKB 4HKQA 3NBPB 1F3FA 2QE5A 3PW5A 3P83D 4LFAF 4CERA 3ZSZA 4KO0B 3TZYA 2DRBA 5KI6A 2AZ3A 3DXMB 4DTJA 1Q53A 2WHOA 1ZAWA 3W1YC 4FJHA 2V2ZA 2BM1A 2QWNA 2A1SA 5J2NB 1N48A 2QWOA 5M1PA 4CZLA 4WFNL 1HBNA 3AT1B 4E3SA 1IH7A 3QDKA 5K20B 2LLZA 2V69A 4AD6A 3M30A 3C7NA 2MKCA 3D67A 3IM8A 4JK7A 1IM4A 3NF7A 2KN4A 4USKA 4TYAA 3L7OA 4H0VB 2V9WA 1I3AA 4DR5K 3K57A 2DXEA 3ZZZA 2QL5B 3CJ3A 3O9TA 1U1KA 4CHNA 1U24A 5AE1A 4NLCA 3G6XA 4ZLLA 1WC0A 1HYZA 3MCOA 3TSPA 5KGXA 4ED4A 5IQ6A 3R5CA 4RW4A 1KN6A 4MFBA 2JEGA 4DR4F 3DLEB 5L39A 3Q86A 4WK1A 3CGIA 3CJBA 5G0RB 1BWVA 5EU7A 3VGUA 4B9VA 4CO3A 2OJ3A 2JVRA 2LEBA 2R7YA 2RUGA 4ZVQB 2PE8A 1Q8LA 5B0BA 3SFUA 5BRDA 1BCMA 4E1MA 5G4DA 3GG1A 1G7CB 3O1WA 2B8PA 1CJKA 3CJ8A 3BZKA 4GO5X 4ELUA 4CK3A 5U47A 3WNEA 2DO4A 3MOZA 4ED2A 4JV5K 3O4NA 2DPNA 3CG7A 2UXCJ 4FF1A 2JH3A 2EK6A 2LCWA 1TKZA 3ETOA 3VZIA 2C2DA 3H1VX 3S3OA 5KFDA 3P96A 1WSGA 4WK3A 1J5EF 4IJAA 5D3GA 3J81j 2YNHB 5ADZA 3W62A 5KFUA 4MQ3A 4HHHA 4DL5A 3I8BA 4DEZA 2FY1A 1YITS 3EVOA 3DC2A 4UY85 3T5HA 3DU5A 2ZEJA 2DHAA 4EUVA 1DGKN 2XEXA 1Q8BA 4RTFD 5KFLA 4JI5K 4DV3F 1YIJN 4NZ7A 1VMBA 1NSKL 3CIZA 3D9BA 3ELHA 1BOTO 3DLLQ 3RYLA 4GV3A 3R5AA 4K0KJ 2AMCB 1RGVA 1RA6A 1Q7LB 1WNEA 4U7UK 1TKXA 3KNGA 5BYQA 4OGCA 2IBKA 4PKDB 4B9TA 4H5TA 3MEDA 3M8PB 4IR9A 4RUHA 3AOAA 3HPHA 3JAMU 3P4IA 2YNIB 4FJIA 2RUSA 3SAFA 2OTLN 3P5TL 1Q82O 1N5TA 1HHSA 4OYOA 4OJGA 4ECVA 3FRYA 1UEVA 3DWLA 2OA8A 5KG3A 3W60A 1AXQA 4AHCA 4B3MK 3DDKA 2YCHA 2GAHC 1FWPA 1R43A 3K5OA 4L3NA 4QR0A 2A3JA 5JS1A 1WF2A 2P9SA 2RRAA 2WTUA 4KHMA 1SJQA 4FJKA 4R25A 3IM9A 1NH8A 3GE9A 2ILZA 5H1SQ 2IYGA 1S76D 2NXEA 4EHTA 3T1YK 1N52B 1G6BA 5L1IA 1PSDA 4N76A 3OS1A 2A40A 1C0FA 3Q8SB 4C0OC 1NSPA 2E66A 3KJNB 2RH3A 1U0HB 1T44A 4MKVA 2E1CA 5J2PA 3DU6A 4F8RA 3ZZ0A 1KLMB 2QT7A 1ITGA 1U2VA 4CLFA 4JBCA 3W61A 4G1QB 3RBDA 4C3KA 3E66A 3CFOA 1FD8A 5CHIA 3ZSWA 2ZNZA 3HVWA 1QM9A 1EO1A 3VQQA 5KPTA 3CC7S 2KB2A 2IVFB 3LL3A 4MYUA 3HF5A 2FZCB 2LA4A 1FF2A 4CJ5A 3WBZA 4WF9Q 3HI0A 1S3XA 3TANA 2B6AB 5AJ3K 4DV1F 2HQIA 1JLFA 3THPA 1I94F 4ES3A 4FJMA 4FK2A 2MQLA 3PSIA 3CJRA 3THWA 1NJWA 1VQ9N 1RXOB 1KFSA 4HL9A 2P9LB 4IDKA 4L3QA 2D3OR 1EIYB 3GZ7A 4TNOA 2VPWB 1G15A 1E6YB 1FJGJ 3BEGB 3QICA 2B56A 1GLEG 5F0UA 4Y65A 2D4WA 3V2UC 2CPYA 1R0AA 3C2PA 2H1YA 2DNQA 1B7FA 3LDSA 1WF1A 2C2NA 4WQ4A 5D0HA 2EPIA 4AM6A 2BKNA 4CHPA 3EX7B 4EIAA 5A8KB 2V5HG 4ZN1A 3UDCA 1WG4A 2EFOA 1GLCG 4CGGA 1R8PA 1TVRA 1FXRA 5HSPA 1H3DA 3AA4A 1JKHB 3ISNC 5BPMA 2AYBA 4Y0FA 5KFWA 4OJRA 1U2CA 4DL3A 4CECA 4KT0C 2RSQA 4DQQA 2DFEA 3LOUA 4HEA9 1DURA 2HOEA 2I7PA 4CO0A 1IKYA 1WSFA 1JB0C 5B09A 3AA5X 5I42B 3KK2B 2XMUA 1W2BR 3PXGa 2E1ZA 1LEOA 4NLVA 2KXNB 3BF1A 4DR6J 4F4ZA 3SSRA 2BKOA 1QTNB 4FF4A 1WNSA 2ZE2B 1FXDA 2QL9B 1W26A 2MKJA 4RU2A 5D78A 1T3NA 2V94A 1RT7B 3OVSA 2KKZA 1JX4A 4IOBA 4OX9J 2EI5A 2UXDJ 1S5JA 2DIUA 4L73A 4NE9C 4XO0A 1SH0A 3VQ5A 4F4KA 3FBFA 5CCLA 4IZ9A 1JXVA 3M8QB 4F02A 1EB0A 2Q36A 1BQMB 2J0SD 3C15A 2AT1B 2UXBJ 1S1VB 1OO0B 3EUNA 1SB6A 3ZX0A 3I0RB 3KD1E 3V9XA 1VC5A 4JKFA 4OVLA 4O8KA 2YX1A 3I55N 1NO8A 4YY3J 2GBZA 3K59A 1IKWB 2QWQA 2N82B 3EICA 4B1UB 2HVHA 4KFBA 4RW8A 1Z6RA 2VOOA 4BRCA 4DU1A 1TKDA 3Q8VA 1YBTA 1EAYC 1F1BB 2HKEA 1YIJS 2J7KA 3B8HA 1LW0B 4GC7A 5B7WA 1HQEB 3CPWR 3UIQA 3TSQA 2P9IA 3GTYX 3DI6A 3GG0A 3PO4A 3K2PA 5HVFA 1HFEL 1EQMA 3GJTB 2RVJA 4X84A 1NJZA 4NLRA 2VBXA 4IFVA 2R42A 2QYCA 2DR9A 5LJWA 3JSBA 4R5PB 2HFZA 2BA9A 5F8GA 1RYSA 2ZWHA 4JKGB 4KHPJ 3OL8A 1OYEA 1RBAA 4FPAA 3O8MA 3FZMA 4DU4A 3NG8A 1U7LA 4EWTA 2P6SA 2Y8WA 3AA2A 4XH4A 2AWZA 4AM7A 2XSJB 4W92B 3R9PA 1IBLJ 5A8WA 4LR9A 2M8HA 1U4BA 4JEPA 3VA0A 4I1TA 4LSLA 2A6AA 3SLCA 3W2VA 5E3PA 1C6VA 2UUCJ 4DKWA 3DRRA 2CIMA 1T3OA 4EEYA 3VAMA 1GTEA 4FXDA 1Q82T 4LF5J 3W2WB 3QLHA 1KHWA 3DOKA 3TW0A 1H7XA 4JI7K 3CCMN 4YS2A 4KTZA 1JL1A 2BW2A 4ANCA 4H0OA 3OTOF 2N3LA 3N0VA 4C8NA 3MM6A 3FSXA 2PFDA 1M5HA 3LZIA 5KFVA 2BEFA 2ZITA 4OI0A 3P5JA 3GMGA 1AUDA 3E8OA 1IKVB 2E7WA 4C11B 4HHJA 4TSXA 4E89A 4BGBA 3M6WA 1VRTB 5F2RA 2IVPA 2VASA 1PJ7A 1ZZNA 2NZCA 1J53A 5KFAA 1SKWA 1LXJA 2P9NA 3KTQA 1K9MO 3HI9A 3MMAA 5AQWA 3HVTA 3UB5A 1U1NA 3R3TA 2XRIA 1QAYA 3LP0B 4JI1K 4FBUA 4BC3A 1SJ3P 3O4QA 1EHWA 5D0EA 5A0YB 1NGGA 4DQIA 4KAZA 1R3NA 4ECQA 5DRKA 2XI3A 2XY7A 1X1PA 2OSRA 3NGTA 1LWFA 4F67A 4Y2KA 3Q8QB 1E6VB 2R7UA 3EPIA 2HHQA 2KTQA 4KHRA 1LNQA 3CJTA 4OYIA 1JNZB 5EX3A 4Y28C 3VERA 4K4YA 1EARA 5FLXY 2F7VA 3EVWA 4ZPDA 3SMZA 4USJC 2LQBA 1TTHB 3OTDA 3DAWA 3KFWX 3HZGA 2DY4A 1I51B 2QN6B 2DRAA 4M7YA 5HRNA 3DCAA 3TOQA 1NNDA 3GDQA 3TA2A 3CJ9A 2HVIA 5IV4A 1B0TA 1B99A 4IKAA 1CZ9A 5GADU 1HI8A 3BSNA 3B6BA 3DDIA 1TMMA 4EBEA 5K5MA 1HNXF 2HHHF 4LF7K 1U02A 1F5CA 4KKOB 2V6AA 3TWHA 4K2JA 2I5JA 3ILIA 3MXHP 2VONA 3LO3A 2HNDA 2JNJA 3T1HF 2V4QA 4CZMA 2LXUA 3NNCA 5KG5A 1KC8O 1T05B 3C46A 1YI2S 1RAHB 4DL0C 3CE8A 2VFTA 3AVJA 2VICA 3GCWP 4FYXB 3AO1A 5GMEA 2OANA 4UQTA 5D77A 1VQKN 1Z2ZA 3HHEA 4DQ8A 1CQNA 1ILYA 3ADAC 1HPZB 1VQ5S 2QSFA 1NKCA 4CM0A 4AF1A 5HMXA 2U1AA 3C6AA 4J8FA 1BCOA 4B17A 3MTJA 3GSDA 1HNZK 3PYGA 1DQ9A 1KAXA 1FRHA 4ZDNA 5FJ4A 1RT3B 3FZKA 1HBMB 2M8DB 4ECXA 3ZTPA 3R1XA 4CJKA 1Q79A 3WNFA 1GLFO 4NPOA 3FRZA 4OJ1A 1ZM9A 2L08A 2ZGYA 1RWKB 2CWXA 2MSSA 2E6MA 3BKFA 3RRGA 2XI2A 5BJRA 2ITMA 1PAUB 4DWIA 2UV8G 4UT4A 4QBUA 1YJNS 3MCSA 3SZ2A 1VSJA 3CMAN 3OUYA 1K73O 3MX5A 4FM2A 4WFBQ 1DQAA 3I55S 1TL3B 4M1KA 2DNMA 3G86A 3KIOA 2IVYA 5GVQA 3ID8A 2CWKA 3U1NA 3A5OC 3LWLA 4Q5VA 2KRRA 4P52A 3UR0A 2FD2A 2JVOA 2IMOA 2XS7A 2BM0A 5AQMA 4DV0J 3CERA 4NLBA 3FC9A 2VBYA 2E7VA 3M9OB 2XY8A 2KKHA 1ZXOA 1U09A 3ZC4A 4P75A 1K8KA 3VGMA 4R8UA 2YKOA 4E8UA 1WD6A 5LMUF 3OBWA 2DT9A 4OKEA 2K3IA 1HJRA 1KOOA 3SPZA 3TAMA 4PG7A 2OI2A 4BR4A 2Z0GA 4DDFA 1HKBA 1CC8A 2ZJPQ 2IMWP 1JJ2M 4JD2A 3Q89A 1VSDA 3JXOA 3C0BA 1DTQB 2KM8B 2UUAK 3QIDA 1P1LA 4I0WA 4MO5A 5IWAJ 1VHIA 2NRHA 4ZVOB 4PR6A 1KEKA 4MT1A 1UCNA 4HWIA 4WFNQ 2ZH9A 1QY7A 2J6TA 3AVGA 3QGHA 4MH8A 4DV1J 3ZSXA 2OYQA 3HTVA 2ZKTA 4XPCA 2KW4A 1N0UA 3MM7B 5HN0A 3CCSS 3RB3A 1SJ4P 4DV5K 2MMYA 3VQTA 3O1BA 1FERA 1HR0F 2VQEJ 3ZX3A 2YHWA 1HWLA 4CJ4A 1X8DA 4C7QA 2HK2A 5F0XA 1V4SA 4ECUA 1NGIA 2R2TA 3AAPA 1C4AA 2K06A 3OV7A 5L46A 3RAQA 4YHHJ 1XHZA 2IM1A 1BUPA 4R0EA 3C8YA 1U04A 1XMQK 2F40A 4BS2A 3QMLA 2JEIA 3VGSA 3DGVA 3HD1A 1Z26A 1WKKA 3K0JA 4WU2A 1XR7A 1YSJA 4CJQA 1Z05A 1MMNA 4FWOA 3QWUA 3W64A 1ICEB 2YXLA 1V5IB 3NAIA 4BRPA 4U9RA 2OPPB 1GTHA 4B1WB 2AGOA 3A12A 5F3ZA 3V4IB 1K9MT 3HKWA 2XG8A 2PMWA 2MQNA 2Y1IA 4MDAA 2XGQA 4V19J 4CLUA 2CH6A 3HHKA 1U48A 5KPZA 2NZTA 1U6BA 3CB4A 2DR7A 4LH5A 4IH7A 2BXJA 4E7LA 1RE1B 1B70B 2BBEA 4XH1A 5AJ3J 3N9UC 2IM2A 2GVZA 1S6PB 4USUA 4Z4EA 1P9YA 4LFAK 2VOPA 4JRQA 5CHCB 3BDEA 4ECYA 3CJCA 2M88A 4EO6A 1PILA 4CM2A 2GWKA 4CBXA 3J80O 5KFYA 5FPMA 4P72A 1Z2LA 2EWHA 2F9TA 2W7AA 3MTKA 2YKPA 4PWUA 2H65B 3A8KA 1K44A 1C2PA 4KRFA 1HBUA 2GGPB 3GFXA 3PR5B 3GYNA 1MMDA 4CLWA 1M5OC 5LMNJ 2FF6A 1RLCL 1DLOB 3EDRB 4KH5A 5JMNA 4TQRA 2RHKA 4EBCA 1IJEB 2A5XA 2E7XA 4LQ9A 5T14A 4Y6IA 1N36F 2HGNA 4CEEA 2UP1A 1RISA 1NJIO 2AU0A 3QRRA 4UW2A 1VFJA 2W8KA 2X1BA 4LSNB 1RHKB 5EWGA 4IO9L 2W4PA 3L2RA 1MROB 1HQ2A 2ZUAA 3M2VA 2O8CB 4AUKA 1P8ZA 4JKBA 2NXCA 2HHPA 1OQ6A 2RDJA 3THXB 1UPMB 2XWXA 3DNCA 4QWAA 4H4KC 3PW4A 2RAQA 2O1PA 1UP1A 3V6KA 2A10A 4QYZK 4B3RF 1R59O 2AP6A 3PZPA 1M90O 2CPZA 2V8PA 4QIWD 2LQJA 3KLIA 4BC7A 2GMLA 1NDKA 3A4TA 1J5EK 1S4EA 4J9PA 1CULA 4X2BA 3FDSA 3SDEA 1K73T 1B0PA 2GIRA 3D2EA 1CLFA 1JLEA 4B9MA 2CQBA 1MA9B 3HFVA 1FNXH 2R2UA 3F41A 2FVRA 2HPUA 4LIRA 1LV5A 1OVYA 3VETA 1VQ4N 1WOPA 3MOJB 3V9ZA 3C6TB 4JYAF 4OZ5A 3PJXA 1FFGB 1QJHA 2LKZA 3Q23A 1TAQA 1T02A 3WIUA 4DV3K 4DUZF 4RPFA 3RTVA 4ZJOA 3MM8B 4DV2J 4USTA 4RZRA 5AQTA 1XNRJ 2E8AA 2BQUA 2YWKA 1NH7A 3LQVA 1T0TV 4MK9A 3N5BA 4I69A 1RT4A 1Y11A 2HAIA 3D0PA 3PO5A 2VFUA 5H9FK 4Y2MA 2NXUA 2OH2A 2VFRA 4CI0B 4WE1A 3TVZA 4OQJA 1UEKA 3JSMB 4GVMA 3SAGA 2V68A 4A4JA 3WXIA 1X4DA 4TY8A 1QTMA 1VQON 2UUBK 1F2HA 3TUPA 3O9QA 3RRHA 2E1AA 3LPEA 4KREA 4CGHA 2MQPA 2MLYA 4DPOA 5EWEA 2N4CA 4WKRA 5C24A 4JI4F 3ILOA 3CCUS 4JI0F 3I82A 3UDLA 2MQMA 1LCUA 3W9HA 2E20A 2IDEA 3MAAB 4FZVA 4JI7J 3J80U 2NREA 3MURP 2GZOA 1GLAG 2QKKA 1NDPA 3ULDA 5H9EJ 4QS7A 5DG8A 2V7ZA 4GNIA 1JLQB 2ZKUA 4FJGA 2P1JA 4G1PA 2HNYB 3SSSA 2VPXB 5LJ5Y 3EWGA 4TYBA 2WB4A 3ZETB 3BH6B 1RHMB 5KGWA 4HCBA 1L3KA 4FW2A 4ZP7A 3LPUA 3LDQA 5KFEA 3KG0A 4F3TA 2R4FA 3MR7A 2ZM6J 1TUGB 5M1QA 5GMKa 2R7SA 1KAYA 4DTNA 5LOQA 3AB2B 5KT4A 4X64F 1JLAA 1RWNB 2ZH2A 2W40A 3I32A 4E7KA 1C0UB 2W24A 1BUXA 2VUGA 2CJAA 4U67Q 5F9NA 1BA1A 4I2QB 2OCEA 2QO3A 4KGVB 4X4NA 2G2OA 5T41A 2MZSA 3HOSA 3DMJA 3AXKA 1NHKL 3OYCA 4PQUA 1EP4A 4KPCA 3GR0A 4ZPCA 5ETNA 4J91A 4ELVA 2WBRA 2KZMA 5HP1B 2IYIA 1XBWA 1AZSB 3F56A 4Z4GA 4YNQA