1TKTA

Crystal structure of hiv-1 reverse transcriptase in complex with gw426318
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
534
structure length
515
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Pol polyproteins [Reverse transcriptase], Chain A
total genus 135
structure length 515
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tktA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tktA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tktA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tktA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tktA05
1IKXA 3QEPA 1JXLA 3AVFA 5JS1A 3L8BA 1NKBA 3V6JA 2KFZA 1CSJA 3T5LA 4WYLA 5KRSA 2GUIA 4YQWA 1BQNB 5KT5A 4E0DA 3OL6A 3QIPB 3K59A 3QO9B 1F21A 4BACA 4K50A 1IKWB 5KFDA 4NLWA 3BQ0A 2B5JB 4OL8A 3M8PA 3PHEA 4CJUA 2HW3A 4MK9A 5KFPA 3SQ2A 5EU7A 3I5AA 4J9KA 1YTAA 3M9MB 4IFVA 4G1QA 3KLEB 1K6YA 3QEIA 1RBUA 1GX5A 3TI0A 2HNDA 3O3GA 3SCXA 1TKXB 4KPYA 1DTTB 3DLGA 3SI8A 5KFCA 4ZP7A 3V9SA 3V4IB 2D3ZA 1CLQA 3NF6A 1TKXA 4FCYA 4PWDA 3BSNA 4DL4A 3CM6A 2O4IA 1TK5A 5KFJA 4YP3A 3VQ4A 4IDKA 1N5YB 4ZPDA 3AO5A 3QNOA 4CE9A 4CJWA 1RT1B 1N6QA 4DLGA 1S0MA 2ATQA 5F9LA 1BQMB 1L5UA 1JLEB 4RNMA 2HNYB 3E01B 5KFOA 3T3FA 3HVRA 3SYZA 4IR1A 1D9DA 4EBEA 3NBPB 4ECXA 4CIEA 4EZ6A 1JLCA 1JXEA 2G8UA 3JSMA 4K4WA 3SPZA 1U4BA 4CFBA 4BDZA 4Y1DA 4DWIA 1N48A 3I0RB 3BSOA 2AWZA 4ICLA 4JLHA 2UVVA 4B8CA 3KLFA 4FJJA 4ZP9A 3RMAA 2X6SA 3MR2A 3NL0A 1HQEA 2G8VA 4B9NA 4ICLB 4EBDA 3CG7A 4W5TA 4ZPBA 4HCBA 3NAIA 4DSFA 2D7SA 4DSEA 5CYMA 1QQCA 1KVBA 3QIPA 4DU3A 1LAWA 1L3VA 3QO9A 4F3TA 1RCHA 3PV8A 4FS1A 3V9UA 1RBVA 4RW4A 1RDCA 3OYMA 3SQ4A 4W5NA 3U3YA 3PW2A 3BGRA 3M8PB 4OPKA 5DK5A 3QERA 4QAGA 5KFAA 4YR0A 4CJFA 4LSLA 4RW6B 2FBXA 1HARA 5C42B 2GBZA 4RW9B 1NK8A 2IMWP 3OYEA 4URQU 3KLEA 4O4RA 5C42A 4HKQA 4KAZA 5FDLB 1TAQA 1BCOA 1RT7B 4F2RA 2CJQA 2UVUA 1T94A 2ALZA 4DTSA 4CF9A 4W5RA 4J9SA 4QWDA 1KFSA 1RTDA 1I39A 3RRHA 1U09A 1S48A 2ETJA 2R8KA 4FJKA 4M3WA 2YKMA 1WSJA 5F8LA 1JIHA 4OGEA 5DGAA 1W25A 5SWMA 2P51A 5KFFA 4KKOA 1HQUA 1DTQA 1KTQA 4Z4HA 4DLEA 2WCXA 4ZVHA 1N6QB 3EY1A 3HXMA 1NK5A 3K5MA 1BQMA 3L2WA 3E01A 3LP0A 1HQUB 3RB0A 3AVKA 1CZ9A 2IAJA 3FFIA 3E51A 3L2RA 3TQ1A 3MEDB 4DU4A 2E4LA 3DOKB 4R0EA 1VSEA 1O1WA 3V9WA 4FJIA 1JLCB 3EZ5A 2WOMB 4QW9A 4RW7B 5DGBA 2B4JA 2KQ2A 4DL3A 3ALYA 2WONA 3DRRA 1SH2A 3IS9A 2HWIA 4EEYA 1RT3A 2IM2A 3BSAA 4Y2AA 4DQSA 1TK0A 4IRDA 1KCFA 2ZD1B 1FK9A 2HHWA 4F2SA 1RTHA 3OYAA 4I2QB 3HPOA 4DS5A 4DEZA 1Y97A 4C8MA 1KLNA 4KB1A 1D5AA 1RTJA 3GV5B 4U6PA 2OYQA 3EZUA 4CK3A 3V9ZA 4B9MA 3JYTA 2I5JA 4Q0BB 4KRFA 2AGOA 2D41A 4TLRA 3HL8A 2RKIA 4ECSA 1U47A 1WSGA 1S1WA 2UVRA 4CIGA 3QLHA 2D0AA 3V1OA 2BRLA 2RKIB 5F8IA 1LW0B 1REVA 4O3OA 4TXSA 2HVHA 5KG3A 4Z4FA 2RDJA 4ECTA 3ZT1A 1EETB 3L2QA 3AO3A 3AA2A 4NRUA 3TAGA 2F8SA 1TL3B 2Y1JA 3H08A 4IFYA 4FM0A 1EETA 4C8LA 3MEEA 1TL1B 2O4GA 3KLGA 4E19A 4CGJA 2VG7A 4DFPA 4ELVA 3DLRA 1MMLA 4LSNA 4O3SA 4IQXA 3NF9A 4DTOA 2DY4A 3DLKB 1BCMA 4HHTA 1LWEB 1RT6A 4ZHRA 2RF2A 1RDDA 3KMSA 4PWDB 1C1BB 1DTQB 3CFPA 5I42B 1UWBB 3S3MA 4NLGA 3BQ1A 4C8KA 2DPIA 1C1BA 4QOZB 3SFGA 3V9XA 1JLGB 4OKKA 1WSIA 4Q8FA 1SV5A 1TP7A 4IKFA 4M41A 4CIFA 2BRKA 3BSCA 3IG1B 5DQHA 4CK2A 5J1EA 1SUQB 3AVMA 1UAXA 2YV0X 2IDOA 3OYFA 1JLFA 5HRRA 1GOBA 4FLXA 1VRUA 1DLOB 1RYSA 1C1CA 4F4KA 3L3UA 4OKJA 1RBTA 4LY7A 4DQQA 4TN2A 1HRHA 4MQ3A 2WK4A 3PJWA 1ZBHA 3OHBA 1EKEA 2KFNA 5KFEA 4NYFA 4FLVA 3LPTA 3CDWA 3BJYA 4DSIA 2P5GA 2HHTA 4NLXA 1HQEB 4NLVA 5C24B 1S49A 3TARA 3BR9A 1GX6A 3Q8RB 4ELUA 2W42A 1D0EA 1WSFA 3TR8A 4CGHA 4HTUA 3DM2A 2G8WA 1J9AA 2PYJA 4EBCA 1XWLA 1S9GB 3KKSA 4KREA 1FKPB 2BGGA 1TKZB 4ZTFA 1D9FA 3N6MA 4FYDA 2V4QA 4H4OA 4ZVEA 2BE2A 1UOCA 1LV5A 1NJWA 3OSPA 3DYAA 1RA7A 5KT3A 3TAMB 3TAEA 3GIIA 2HNZA 4CESA 3V6DA 1S10A 1NOZA 1RDRA 4CF8A 3L2VA 2CKWA 3LAKA 1A5XA 1ZBFA 3C6TB 1S1UA 1S9EB 4O3PA 1SL0A 1YT3A 4K8ZA 3V6DB 4M3TA 4MKBA 1KLMA 1RT2A 3QEWA 4KTZA 1OS5A 1SH0A 4JV0A 1VRTA 3C6TA 3DLGB 1ZTWA 4I2PB 4OVLA 5I42A 1NJYA 1JXBA 2QXFA 2XY6A 3KJVA 2XY7A 4WXOA 4FZXC 1IH7A 3MFIA 3HSTB 2BQ3A 3LDSA 2JLEA 4GMJB 4CJ5A 4ZVGA 3FFIB 4HUFA 2V9WA 2VG5A 4B9UA 1NHUA 5T7BA 4IRKA 3H2LA 1WLJA 4F3OA 3WNHA 2BR0A 4B9TA 1C1CB 3LANA 2G8FA 1W0HA 3N6NA 4CGDA 4O3QA 5DMRA 3SQ1A 3GILA 3TAPA 2JGUA 3QIOA 3DLEA 3LPUA 3PW4A 3DMJB 2FJXA 3ZT0A 4R5PA 4H4MB 4NLPA 5J2PA 4AILC 3K58A 5KT4A 4CJTA 4FJMA 4N41A 4QPXA 4J9RA 1N4LA 4KTQA 3LWLA 5J2NB 4GC6A 4OPJA 1RTJB 3GV8B 4DU1A 3DRSA 2FVSA 4J2EA 4OLAA 3L2UA 1BIUA 3H4DA 5CZ1A 4HUEA 2Q3SA 2IGIA 5FROA 1UA1A 4FBUA 3DI6A 3VQ8A 4BWMA 1IKWA 2JEIA 3WNFA 5J2MB 4TQRA 3CDUA 3VQEA 2HNDB 1G15A 4TY8B 5L1IA 1U45A 4CJLA 3QIDA 1IG9A 5J2MA 4CJRA 3K5NA 3SV3A 4ZPAA 3RMCA 1HYSB 2C22A 4DQIA 1WN7A 3P83D 5KFBA 4G1QB 4TY8A 2VG7B 1B92A 4KV8B 3HKWA 4Z4CA 4O3RA 4NLRA 2W9AA 2J6SA 1DTTA 2W7PA 1IO2A 3HT3A 4DSJA 4ECWA 3OL9A 2C28A 4CHZA 4Q43A 3NGIA 1S1VB 1KRPA 4KKOB 3OYLA 1XR6A 1NKCA 2BANB 4URSA 4NCGA 2ILZA 4M3RA 1S1VA 2DTUA 1RTIB 5KFVA 3S3NA 3SZ2A 4ID5B 1S6QB 3RB6A 2GIRA 2IAJB 3V6KA 2J6UA 1SKRA 2VA3A 3CVKA 3VA0A 5DG9A 4MKAA 1RTIA 3KLIA 3AO1A 4RW8A 1FXXA 3K2PA 1RT5B 3MEGA 1JKHB 4IH5A 4CEAA 5J2PB 3KLIB 4KHUA 2WONB 4M3YA 4URGA 3IS9B 3PVXA 4RU9A 2V4RA 1CXUA 3CJ3A 2Z1JA 3AVCA 5EDWA 4I9LA 2OA8A 4HCCA 2VG6B 1JKHA 3O3HA 3OLBA 4DTUA 4NLDA 1SL1A 2AQ4A 2KZZA 1C0TA 3SUPA 3VQCA 2FJWA 3QNNA 4DL2A 2UVWA 1RILA 3OS1A 2GV9A 2D0CA 3GQCA 4NLOA 1GOAA 4RW6A 1IKYB 2I5JB 5CYMB 3FRZA 1WNSA 5KGXA 1QUVA 1ZYQA 2JEJA 4RW4B 4I7FA 4FM2A 2QKKA 1VSIA 3KHRA 4WYWA 1FKOA 4E89A 4CJPA 2YHBA 3GIMA 5HRSA 4IH7A 1Z4UA 4IOBA 2B6AB 2GIQA 2YHAA 5KG5A 4NCBA 2VA2A 4NLYA 3H4BA 4E7JA 1S1XA 2F8TA 4DS4A 4ECZA 3ZT4A 1X9SA 1JLQB 1LW2B 1VSJA 4KV8A 4KB7A 5K14B 1ZETA 4DSKA 3NGDA 3VQSA 3ZSVA 4FK4A 1JLQA 4U7CA 1LW2A 3C94A 4LSNB 4I2PA 4N5SA 4H8KA 4ED6A 4BDPA 3QEVA 3DLKA 1NHVA 1LWCA 1JL2A 1HNVA 1VSKA 1BGXT 1L3TA 1EP4A 1X1PA 4YNQA 3LP0B 3QZ8A 1L3UA 5F8MA 4DF4A 5KFZA 4LQ9A 2XO7A 2OPPB 1D8YA 3C6UB 1HNVB 2XGQA 2FVRA 4QWEA 4OJRA 1EP4B 2XI3A 3K5LA 4FK0A 1WAFA 1T03A 5KFTA 4EYHB 3NH0A 3VQ7A 2P5OA 2WB4A 4RNOA 4DTJA 5KFYA 4IBNA 4HUGA 3CJ2A 3KK3B 4KI6A 3Q8PB 3CFOA 3LP3A 3CJ0A 1SKSA 1XI1A 3DMJA 1FK9B 4J9QA 2KW4A 4KO0A 4F4WA 3PY8A 3OVNA 4IG3A 3EYZA 3MXMA 4DTNA 5HRNA 3G6XA 1JLAA 4KTWA 2HMIA 4O3NA 4ELTA 3HK2A 2XWYA 2VWKA 3D0PA 3CJ5A 2O5DA 4IRCA 4J9PA 4B08A 2PZSA 3OYCA 2PYLA 1U04A 4I9QA 4CFCA 2YNIB 1YVFA 4Z4EA 4KB0A 5J2QB 2FLLA 4FLWA 3M9NB 4C8NA 4HYKA 1KHVA 4NLUA 3CJ4A 3L3VA 1REVB 4NCAA 2R8JA 3AVNA 3NF8A 4F4ZA 3T5JA 4QWAA 5D3GB 4DFMA 1QSLA 3PW5A 3PZPA 3IRXB 3PX4A 3P5JA 3M8QB 1EXQA 4R8UA 2ZE2A 4YR3A 5HRPA 2W8LA 4AH9A 4K4ZA 3O4NA 1TVRA 4ED3A 1HYSA 3H5UA 1KSPA 4FLTA 1K1QA 2IM3A 3N6LA 4M42A 1NKEA 4ZHRB 1HNIB 1CZBA 4C8OA 4NLTA 3ZT3A 1LWCB 4DTPA 3KHGA 3KLGB 2WRMA 4DTXA 4RUAA 3HP9A 4FLZA 3SPYA 1A5VA 4OKEA 1S4FA 4IDKB 1S0OA 3KJVB 1C0MA 2OPSA 1GOCA 2OH2A 2D5RA 4CJKA 3MEDA 3CWJA 4EZ9A 4FVMA 1S0NA 2HNYA 2F96A 2WOMA 4Y3CA 1MU2A 3CO9A 4LD0A 2BDPA 4KHMA 4EO6A 1I3AA 2VG5B 1HJRA 3THVA 3D28A 3JSMB 4ED2A 4RW8B 4DFJA 3I5BA 2E9RX 1HPZB 4E7LA 3OS2A 3AVBA 4ECVA 3S3OA 2E9ZA 1JLFB 3D45A 4WE1A 3F73A 3PUFA 1JLAB 3Q8QB 2A1RA 2FLPA 3KLFB 5KFGA 4MIBA 5EUHA 5JXSA 4N47A 4I2QA 4M94A 1TKTB 3LWMA 3SUOA 2D3UA 4NLSA 3LAMA 2W9BA 5FRMA 3KK2A 4Z4GA 3G0ZA 3VQQA 1U48A 4WFXA 2ZQBA 4B8AB 5JS2A 3K5OA 2W9BB 1NK9A 3NMAA 4FJLA 5HROA 1RT4A 3HVTB 4O0JA 1J5OB 4YMEA 4CHYA 3SV4A 4QW8A 1ASUA 3G6VA 1N56A 5JUMA 1S6PA 3PR5B 4DQRA 1S5JA 3RMDA 1SL2A 2OPRB 3OHAA 2G8IA 1Q9XA 4EO8A 5C5JA 1ZTTA 4BWJA 2B5JA 4FK2A 3H5YA 2E6LA 2R8HA 3HVWA 1S6PB 1FKPA 3T5KA 3VQBA 4FJNA 3TVKA 3QEXA 5FDLA 1BL3A 2BE2B 1RT2B 2KZMA 4IFVB 4MFBA 3GIJA 3OL8A 3OYIA 5F9NA 1HNIA 4E7IA 4FW2A 1TKDA 3VA3A 4DL5A 4M3UA 1RT6B 4J2DA 2HVIA 1C0UA 4FLYA 3B6OA 3RB4A 4K4XA 4CEDA 2D0BA 1LAVA 3AA3A 3NAEA 3KTQA 1D1UA 4LH5A 2YKNA 4ED0A 4E1NA 1VRTB 1WSEA 5I3UA 2IBKA 1QSYA 3IAYA 1C1AA 3OS0A 3OYKA 3NH2A 3TANA 3IGVA 5KT7A 2B43A 2AJQA 4K4SA 3BREA 1NK7A 4KFBA 2J6TA 5DLGA 3MR6A 1C6VA 1RT1A 1T7PA 5FRNA 4LQ3A 1QAIA 4H54A 2P1JA 3KHLA 2EHGA 3SUQA 3DOKA 3NF7A 5E41A 4O44B 3MAQA 2HHUA 2C2RA 1C2PA 3VQPA 1S6QA 4J2BA 4KBIA 2JC1A 4FJXA 3V1QA 1RNHA 2HHVA 3I0SA 4CERA 4TYAA 1JL1A 1NK6A 1S1TB 4L8RB 2OZSA 4KO0B 2RDIA 3MEGB 4CGIA 2W9CA 4O5BA 4FM1A 5HBMA 1TKTA 3NAHA 2DFHA 3MF5A 3AA4A 4CEBA 3NCIA 1ASVA 3DRPA 1S9FA 4JS4A 1LWFB 5KFIA 2RN2A 2IA6A 4W5OA 2JEGA 2VG6A 3QESA 4KHSA 3HP6A 2IM0A 3KK1B 3V6HA 1QE1A 3M9OB 2ASLA 3V81B 3FQLA 1VSHA 3VQ5A 4W5QA 3KOAA 4KSEB 4CJ3A 3ZSRA 2YNIA 1C0TB 3DLHA 3G86A 3ZSQA 4CEEA 3I8DA 1QHTA 1WSHA 1BI4A 1ITGA 4ECQA 3QETA 2OPRA 3SJJA 3M8RA 4FS2A 3SUNA 4MH8A 5KFKA 2DPJA 3NKYA 5DQGA 2X74A 2WHOA 1NJZA 3DI6B 1SKWA 4TSXA 1TAUA 3LP1B 2NUBA 3RRGA 4B9LA 4KE5A 4F4YA 4MK7A 4ECUA 3CQ8A 2HAIA 1S9EA 4OGCA 2QK9A 2PY5A 2OPQB 1XC9A 2ITGA 1TL1A 1K1SA 5EWFA 1NOYA 3RAQA 2XY8A 1XHXA 3NE6A 1VSMA 3HPGA 3P1GA 2FLNA 4AHTA 2R2RA 5HP1B 2RF2B 5I3UB 3ZT2A 2UUTA 5KG0A 4JRQA 2VWJA 4MIAA 3LZJA 5KFLA 3FSIA 2W7OA 4J9OA 3ISND 3VQ6A 2YNFA 4DF8A 4PQUA 2XI2A 4BE0A 1JLGA 2HHXA 5KFRA 3C6UA 4K8XA 2X6NA 3WNEA 3OYDA 3SQ0A 3T19A 2BANA 2WTFA 3ASMA 2V0NA 4KHNA 4RNFA 3LP2B 1SUQA 2Z1IA 3O3FA 2LSNA 3UIQA 1VRUB 1RBRA 1XR7A 5KG4A 3KLHA 1QSSA 5HBMB 4DSLA 3VQAA 1VK0A 5CYQB 4DQPA 1NNDA 1RT5A 3ZSYA 4CJQA 4IG3B 4CGGA 1Z25A 4F8RA 4PY5A 3NH1A 3SFUA 5J2NA 3QGGA 3H5XA 1BISA 3VQ9A 4G3IA 2R7YA 3T5HA 2ZKUA 2IM1A 4FXDA 3BQ2A 3ICLA 4QCLA 2AGQA 4CJEA 2QV6A 3QINA 1NK0A 4KAIA 3ZSOA 3KD1E 5F8NA 4M95A 4DTMA 3S9HA 5KTQA 3RR7A 4KI4A 4KHQA 5KFNA 3DDKA 4AHSA 1TK8A 3KLVA 2IS3A 3OJSA 2FC0A 4ZP8A 4DL7A 1QAJA 2E9TA 4RW9A 2KTQA 3HVAA 4CF2A 2DFFA 5DQIA 1KVAA 2FBVA 3AA5X 3OY9A 1TL3A 1CXQA 2B6AA 4FJ5A 4PUOB 1BHLA 5KG7A 2YNGA 3U3GA 4QWBA 5HP1A 4JRPA 2FBYA 1JX4A 4CEZA 1KHWA 5KFHA 2FVQA 4CEFA 3RMBA 3G10A 1ZBUA 3V4IA 4AHUA 4PQUB 3IN5A 4J9NA 2C2DA 4B3OA 1SH3A 5KT2A 4CGFA 3HM9A 1T05A 1ASWA 3NBPA 4K4UA 2GC8A 3QGHA 2ILYA 3RB3A 1YTUA 2R8IA 3ITHB 3TAFA 4B3OB 1RA6A 1B9DA 4FJ9A 1T03B 3MFHA 4QWCA 2HHQA 4EP4A 4J9MA 4LH4A 1JLBB 5F8HA 5L1JA 5HLFA 3PO4A 1J53A 3SI6A 1DLOA 1HPZA 4E7KA 4O4GA 4M3ZA 4EYIB 1TV6B 1Q8IA 3ZSXA 5HLFB 4HVJA 4CCHA 2EC0A 3UPFA 3OYJA 1RT3B 1WNEA 4RG8A 3ZSWA 5KFWA 4E7HA 5F8GA 4CEOA 1IKXB 3LZIA 1QE1B 4ZPCA 2Z1GA 4IG0B 4BE1A 3RTVA 2G8KA 3MXJA 2X78A 2IC3A 3KK2B 3IGNA 3RAXA 2ASDA 3QYYA 4CHPA 2HHSA 4AHVA 1HMVA 5KGWA 4ED7A 1L3SA 3VN5A 2XCPA 3AVGA 3PW7A 4LSLB 2IC3B 2Y1IA 3PJXA 4I7FB 3JYTB 4TYBA 5KI6A 3ZCMA 5DG7A 1QS4A 4ECRA 3M8QA 3PW0A 1FKOB 1NJXA 3CIZA 3H5SA 3CFRA 4J9LA 5L1LA 3MR3A 3GV7B 3SNNA 2JEFA 3BGRB 1S1WB 4CFAA 1W9HA 1VSFA 1S1XB 3O4QA 5KT6A 4CJVA 1I6JA 1LW0A 5K14A 2R2UA 3MECB 2IJFA 4R8UB 4GC7A 1A5WA 2G8HA 3KKRA 4MFBB 4FBTA 4JS5A 4WZMA 4FJHA 4OLBA 3AVIA 4Y34A 2IOCA 3MECA 2BQUA 3KMQA 1KLMB 3TWHA 4BDYA 1X9WA 3D5MA 1C0UB 2OPSB 2FBTA 1XHZA 3ISNC 3MR5A 4BE2A 2OPPA 5L1KA 3TAQA 4AHCA 3HHKA 4Z4IA 4MK8A 2YKMB 4UQGA 3MXIA 4CJ4A 4ZP6A 3OSNA 2AU0A 5L9XA 3CM5A 1XR5A 4FJ7A 1JLEA 3EPIA 4KFBB 3KK3A 4CEQA 4ID5A 1RYRA 5KFXA 3KNAA 5KFSA 3OYNA 4Q45A 5KRTA 3M8SA 4TY9A 3PX6A 1NK4A 4WZQA 3IG1A 3RBDA 3BDPA 3GYNA 3VQDA 4NLQA 4O4GB 3CDEA 4YR2A 4J2AA 3KD5E 3DOLB 1TV6A 3DLEB 4XPCA 4Y1CA 3DLBA 2FJVA 2HMIB 2C2EA 3H59A 1RTHB 2QKBA 4B9SA 2W9CB 3AV9A 1RDAA 4ZMMA 4H4MA 3DOLA 4Q44A 3OJUA 5T14A 3PX0A 4CFDA 4IG0A 2IJNA 3Q8SB 4CECA 3HO1A 4ED1A 4KHRA 5EWGA 3FQKA 2XHBA 1VSDA 1TGOA 1J5OA 3H98A 1HMVB 3V81A 5C25B 2BQRA 4RUCA 3UQSA 2YNHA 1Q9YA 2HB5A 1IKYA 3LALA 1RBSA 2FVPA 3HJFA 3DM2B 2YNHB 4PA1A 3KHHA 5HROB 3MTKA 3IRXA 1KFDA 3TABA 4Q0BA 4FZYA 2ZE2B 1S9GA 1QTMA 2XCAA 5SZTA 3NHGA 3G6YA 3OL7A 4IFYB 1RT7A 5F8JA 3MEEB 3DYAB 3OLAA 4JV2A 1VSLA 3QLHB 4X2BA 1RTDB 4B9VA 2RPIA 4ECYA 4PUOA 2OPQA 4E3SA 2R2SA 3U6FA 4CHOA 1IKVA 2HWHA 3OYHA 3ZSZA 3H40A 4XPEA 3PR4A 3PO5A 3RBEA 1IKVB 2XY5A 3NGYA 4WFZA 1UA0A 1IM4A 4CF1A 4FZZA 4CHNA 1N5YA 1HYZA 3NGZA 4NCGB 2AGPA 4DG1A 4WFYA 2ASJA 3CYMA 4M45A 4RW7A 4NYNA 3F9KA 4DG1B 1WAJA 3OYGA 3DRPB 4WE1B 1HYVA 3K57A 4TQSA 4N76A 4DTRA 1X9MA 3QGIA 3I0SB 4YFUA 4E1MA 5CYQA 4JV1A 4K4TA 4ED8A 3RWUA 4GW6A 5EWEA 2DFEA 5KFMA 2OZMA 1Z26A 2Z1HA 4XIUA 4ZVFA 2UUWA 1RDBA 4KHWA 2A1SA 5C25A 3WNGA 1BI4B 4K4VA 2XC9A 4CHQA 3HVTA 1RT4B 5CZ2A 1S97A 3AVHA 2R2TA 3UDLA 5J2QA 2JC0A 2F8EX 4XO0A 5DLFA 5C24A 4NZ0A 5DG8A 1YVUA 3DRSB 3QZ7A 3LP1A 4IR9A 3V1RA 4JUZA 2FVCA 1R0AB 2XGPA 1J54A 4O0IA 4EP5A 3AVJA 3TAMA 3AO2A 5D3GA 4F50A 3I5CA 3A2FA 4Y2CA 1TQLA 3NDKA 1R0AA 3AVLA 4ID1A 3T1AA 3FDSA 3OYBA 1TKZA 5KG2A 4H4OB 1S1UB 4FW1A 4CF0A 1TVRB 4CK1A 3UR0A 4FLUA 2HNZB 3HPHA 5KFQA 4KHYA 5CY4A 2YNGB 2YKNB 4F4XA 4DFKA 1ZBIA 1LWEA 4N56A 1T3NA 2YNFB 4WXWA 4K4YA 2QE5A 3KIOA 1UWBA 2AX1A 2ATLA 1T8EA 3GIKA 3C95A 1ZBLA 4M3XA 1EX4A 4RNHA 3AO4A 1SV5B 5KFUA 2R8GA 4Q8EA 4O44A 3EPGA 3NFAA 3AVAA 1T05B 1MU2B 2EX3A 2E6MA 4DL6A 2XRIA 5J1EB 3ITHA 4IH6A 3HYFA 3ULDA 4FJ8A 4CJSA 4GVMA 1U49A 1S1TA 3LP2A 1RAJA 4O55A 4R5PB 4FJGA 3DRRB 5KG6A 1JLBA 4AHRA 4ZTJA 1LWFA 1B9FA 4Z0UA 4Q5VA 3RR8A 4DMNA 5KG1A 4NRTA 4IKAA 1KVCA 3KLHB 3KK1A 3I0RA 4RNNA 2I1RA 2AX0A 2ZD1A 2W8KA 4RZRA 1BIZA 4NYZA 1BQNA 3B6PA
chains in the Genus database with same CATH superfamily
4JKGA 2WSCC 3L8BA 1NKBA 3V6JA 1VR6A 3W61A 5LXRA 2Q43A 3T5LA 2O8DA 4PHTX 4MLEA 4YQWA 2SXLA 1BQNB 2CNKB 3OL6A 2ERRA 4ZVRB 3P8BB 2KKHA 1T6CA 4BACA 3CCRS 1F2GA 2B5JB 3W9JA 2E2QA 2A3JA 3AAWB 5BREA 4B17A 3W3DA 4DR2F 3EZOA 2YVSA 1YKWA 3KLEB 1XMQJ 4ZIVA 1N8RO 3ULHA 1BXNA 2P9KB 2CQ3A 3O3GA 1TKXB 4KJIA 4KPYA 4I6WA 5K8OA 3DLGA 1R89A 2D3ZA 1ZPWX 3NF6A 2VL1A 1TKXA 2ZBCA 5F3ZA 1M90O 4FCYA 4PWDA 1VQNN 2UZAA 3BSNA 2QLFB 2UXBJ 3J7AP 5KFJA 4YP3A 4IDKA 1SC4B 4ZOSA 1P8ZA 4ZPDA 1AFIA 3KG1A 5M1NA 3WXLA 4CO4A 3HD1A 1YZ7A 1F6TA 2ATQA 1PILA 2B9WA 4XH4A 5AZIA 2BUNA 2IFXA 2HNYB 2G0IA 2GHPA 4U67Q 2F7TA 1XMQF 2RIJA 3EXYA 3UD4P 4WTOB 3C2PA 1KQSM 1F5BA 3DKDA 3MR7A 2QWOA 2G8UA 1OPIA 4C1NK 2QWNA 1U4BA 1N32K 3EGWB 2NRXA 3JAMO 5DDRC 4JHDA 4WJBA 4F3QA 4CZLA 5L39A 2VOOA 2AWZA 4H5RA 1HWUA 3A3PB 3GP9A 3FZBA 3OXLA 4KT0C 4ZP9A 3E9LA 4OI3A 3NL0A 3O5TB 2UU9F 4RTFD 3TSUA 3VZHA 2CWXA 4ZPBA 2QLJB 3NAIA 3IFRA 4A8OA 5HN0A 1VFJA 2D7SA 3Q8YA 1N52B 3QJJA 2KJWA 1KVBA 1LAWA 4Y28C 3QO9A 3VWSA 5FLXU 2EFQA 1XC3A 3V9UA 3V5RA 2L08A 3IBCB 3BGRA 4LVNP 2B9XA 4ZPTR 1HARA 2D9PA 2Z8QA 1HBNA 2GWJA 3H42A 5D15A 1NK8A 3ENAA 2IMWP 4QU6A 3N4WA 4FP9A 2HS0A 2K3IA 3CCEN 2Q6BA 3G8TA 1M0SA 4F2RA 3JSRA 5C12A 2H5JB 3M2RB 4KIAA 1PSDA 1U09A 4DR7K 4BREA 5DZ6A 3RU0A 3Q83A 3HSJA 4LIWA 4RU2A 4M3WA 1WSJA 1B0VA 3GCWP 2BOPA 2KHDA 4ED4A 2F3JA 1RAAB 1BHNA 4DV0F 1NUEA 1DTQA 3WHIA 2WCXA 4ZVHA 1N6QB 1RHJB 3EY1A 1NK5A 4LF8J 1VQ7S 3C3LA 1BQMA 2CPEA 3PTWA 2W01A 1LFPA 3ILJA 3VAMA 1HQUB 5AQKA 3FFIA 3J81Y 1Y7PA 2YQ3A 2Z57B 3DU6A 3TJ9A 2ZVSA 3DOKB 1D3WA 1VSEA 1O1WA 3VV2B 3AGRA 2NZ4A 4X64F 2P9EA 4QW9A 4RW7B 2LXIA 3BO4A 3EVWA 1HR0F 1RHUB 1TTHB 4A48A 3DRRA 4EEYA 1RT3A 2IM2A 4WFNQ 3A5MC 2J0WA 4Y2AA 2ZD1B 4C8ZA 4OI1A 2K8GA 3THWB 2NUUG 3ENHA 1OH8A 2LXUA 1RP5A 4DS5A 4DEZA 4PCQA 2G2YA 1U1QA 4HHJA 4JOUA 3GV5B 2B7BB 4CK3A 3V9ZA 5B08A 3JYTA 2YPYA 4KRFA 2B7CB 2AGOA 2D41A 3D1HA 3ZZOA 4OX6A 3CDAA 1TU0B 3M6VA 2UVRA 4CIGA 4M1KA 2C2KB 3V1OA 2BRLA 2RKIB 5F8IA 3ILLA 1LW0B 3M5RA 1FNXH 4O3OA 4TXSA 4Z4FA 3ZT1A 3L2QA 2HIYA 3AO3A 2PMZD 1KAZA 2Z2MA 4YOYA 4M7XA 3EUNA 2F8SA 1TL3B 3R1LA 3MK6A 3UKRA 1EETA 4FYYB 3MEEA 1TL1B 2VOPA 1D8ZA 2KJVA 4TU7A 3OBIA 2RAQA 4IFEA 4ZLJA 2DY4A 1L3KA 1BCMA 2OIHA 2MKIA 3D1OA 1LWEB 1S5ZA 4P9SA 4FNIA 4PWDB 1C1BB 4DR4K 3L7OA 4LVOP 3CFPA 5I42B 3QT8A 1UWBB 3ILOA 1YITS 2O8EB 1RUSA 1TUWA 2DPIA 1C1BA 2GFFA 3D2FA 2AEMA 3GE9A 5JVGL 3IBWA 1VGYA 4IKFA 4M41A 3B54A 1KP6A 4F67A 4DPOA 3BSCA 3D2FB 4AYBD 4HLBA 3AVMA 1UAXA 2IDOA 2V2KA 4DPWA 4FLXA 4F4KA 1C1CA 1RBTA 2RJZA 1U2VB 4EK2A 2YX6A 3DXKA 2WAQD 1CVJA 3PJWA 3CE8A 2BKPA 1PO6A 3M7VA 4BRIA 2KFNA 2E5LK 5KFEA 3I96A 4NLXA 1QM9A 3MM7B 1Q8LA 3QRQA 3TARA 1GX6A 2ZC4A 3K8VA 2E1ZA 5GAHI 2FGOA 2BE7D 4ELUA 2BEFA 5F0UA 1M1KT 3TR8A 3BBBA 1A0OB 3DM2A 1NLVA 2UUCF 3Q89A 1S9GB 3KKSA 1Q53A 2BGGA 3QSYB 4ZTFA 2V4QA 4H4OA 4DU7A 3FZHA 2L9NA 2FD2A 1UOCA 1LV5A 3GCXP 2NREA 3OSPA 3TAMB 4ZKAA 3GIIA 1NOZA 4CF8A 1GLCG 4WIIA 1ZBFA 1S1UA 4P7TA 1S9EB 4O3PA 2CWKA 1SL0A 4K8ZA 1TL4A 3HTVA 4BRCA 4LF8F 4ZPVR 1SH0A 2V9KA 4DN0A 1FCAA 4DV4F 2FHJA 4UY8O 4ZN3A 4OZNA 4DV7J 2OHDA 1KDNA 2ZM6J 3PSFA 1Y5LB 2NQPA 4IJAA 1YJRA 2VBZA 3FJ2A 4FZXC 4LBIA 1IH7A 3GB0A 1GXUA 1R8AA 2BQ3A 2MDAA 1RJJA 3VOVA 2OSQA 2CJKA 1WUUA 1D09B 3FFIB 3D7SB 2J5AA 3FVYA 3JQMA 4IRKA 1WLJA 5D6GA 4LFCJ 2R7OA 3GTYX 2G8FA 2A1BA 3N6NA 3OBYA 1EZZB 4AM7A 5DMRA 4IOCL 2JGUA 2DISA 2LP4A 1UP1A 4Y6IA 2FJXA 2RU3A 5J2PA 3P39A 1F0XA 1S72S 2N82B 4ATNA 4CJTA 4LMZA 4U8YA 4OYPA 2M4MA 3D3BJ 2NRTA 5C2FA 2WUSA 5J2NB 5LMNK 1RTJB 4ENOA 2FVSA 4M5GA 3A8IA 3H4DA 5CZ1A 2V2VA 3KDOA 4I6YA 2IGIA 5FROA 1RKJA 3SAHA 5LOQA 4FBUA 2KKZA 3MCOA 4LBPA 4LFBF 1CJKA 1ZPVA 3UDEA 2YI1A 4YY3J 5IT9U 3O5BA 3VQEA 4BHQA 4TY8B 5L1IA 5B8HA 1JK9B 2HFNA 3SV3A 3RMCA 1UKUA 5GIPA 2C22A 1WN7A 2H5EA 5KFBA 4BVPA 3DHXA 2K06A 2EFNA 3FGVA 1NDPA 4WQ4A 3QT5A 1UPMB 4Z4CA 2P9KA 4Q2LA 1KN6A 4ERDA 4NLRA 5ETPA 2OANA 2QYCA 4IO1A 2W7PA 4ECWA 2IBOA 4HHHA 5AQFA 1S1VB 1S3XA 5AQVA 4NOHA 2EFOA 2QWPA 1DBDA 4GVEA 1NKCA 3OYLA 1U1OA 1XNRK 3LOUA 4URSA 4NCGA 2ILZA 4M3RA 5IWAF 4LF8K 4RWWA 3SZ2A 3SJHA 1XQSC 2A0FB 1KAYA 4HDGA 4LR9A 2MB0B 4DR2J 1YJWN 2HGLA 4WYBA 3N5BA 3W8GA 1LWXA 4IH5A 4EWTA 1OPZA 3KLIB 4CD1A 2OTLN 4KHUA 3GE1A 4PZVA 4URGA 2Z1JA 2FHOB 4C98A 4QIWD 5D0EA 3E1YA 2UXDF 2DGTA 2HEKA 3ZTSA 2MMYA 5CCMA 1I94J 2A2DA 1PBAA 4FNHA 3SUPA 2ROPA 5GVQA 3VQCA 3ZZRA 2FJWA 3QNNA 1RHRB 3W2WA 3D6RA 2B4OA 3BN7A 2D0CA 3GQCA 2VQFJ 1IKYB 4CO1A 3GL1A 1UJ5A 1URRA 4LF7F 3B8AX 1WNSA 3POTB 2NXNA 1RXOB 4DR5J 4WFBQ 4I7FA 1TMJA 3KHRA 4K8RA 4WYWA 4CJPA 1FEHA 1VC6A 1Z4UA 3G87A 4RUBA 2VA2A 3H4BA 2NRWA 4M63C 3K9JA 1FFSB 4WQ5A 4KGMA 1GMWD 4E7JA 3GPAA 1S1XA 4ECZA 1X9SA 3ZT4A 5AQYA 1JLQB 3J7ZO 1VSJA 4KV8A 5K14B 3PSIA 1ZETA 4CO2A 3NGDA 1OJ4A 4LRCA 3VQSA 4FK4A 1KVIA 3JTOA 4Y0FA 2JFKA 4BDPA 3QEVA 3DLKA 1DJ0A 4A2BA 5HOOA 1JL2A 1CLFA 1L3TA 3DXMA 3LP0B 3QZ8A 2FXUA 1L3UA 2POKA 5KFZA 3SAGA 3VAFA 5D78A 5BYRA 3IAS9 4B1WB 1SJQA 1WAFA 4JYAK 2KXFA 4ZVSB 1CJUA 3VQ7A 2WB4A 3AH6A 3K2YA 4DTJA 1ZAWA 3JXUA 1RLDA 2RUGA 3Q7BA 1VJQA 3TJ8A 2NRRA 5LSLA 2XMAA 4J7CA 5J1PA 3CFOA 3H90A 4QYRA 3H46O 3ZETA 2FHKA 1XI1A 1DAXA 3NNCA 1Q7YT 3PY8A 4IG3A 1CJVB 3KJFB 3BY5A 4ZVUB 2A6AA 2HMIA 5D4OA 1HQ2A 4H5VA 4DUTA 3CJ5A 4B1ZA 2PZSA 3OYCA 1E3MA 3HI0A 2YNIB 2E2OA 4EHTA 3OA9A 2HYIB 1R7IA 2IVNA 2FLLA 1IBMK 4BRPA 1HHQA 2DR7A 2NXCA 4NCAA 2R8JA 3NF8A 1GTEA 2DGXA 4IOCQ 4F4ZA 3X1LB 2BE9B 3HSCA 1LCUA 5D3GB 4DFMA 5JVHL 3IRXB 4RWTA 3M8QB 4HL9A 4R8UA 4USHA 4JV5K 1WI8A 2JFDA 5HRPA 1HD0A 1S99A 4U7UD 1TVRA 4Q2MA 4JI4K 4ED3A 4X64K 1C4AA 1HYSA 3H5UA 3T69A 1F3VA 4A5BA 4M42A 1NKEA 1FF2A 4JI5K 5DDQC 4DV4K 3BPDA 1CZBA 1EB0A 3UKRB 3ZT3A 5AJ3F 1LWCB 3KHGA 2WRMA 4DTXA 2W4CA 3ID8A 2LA6A 4UZBA 3UCGA 4RUAA 4FLZA 3WX4A 3MMBA 2QA2A 3QBCA 2QFIA 3B78A 4IDKB 4NB4A 3NGRA 3THYA 5F1XA 1C0MA 4I6MB 2OH2A 2P9SA 2WVDA 5AQPA 3CWJA 2OI2A 3WXKA 1S0NA 3VGKA 2WOMA 2HBMA 4LD0A 3IXQA 2KVQE 1TYQA 2L9WA 3PFEA 2CGJA 3U1MA 4RW8B 1AZSA 4PG6A 4JN4A 4E7LA 3OS2A 4LFCK 3AVBA 1AXQA 4BVOA 3S3OA 5IV4A 1U8WA 4EAHD 3F73A 3KLFB 1BA0A 2M8HA 4ITSA 4N47A 5JXSA 3ETOA 4I2QA 4M94A 5DETA 2WSFC 3N9UC 2HK3A 2GEMA 4Z4GA 1RCOB 2NRZA 2ZQBA 4AF1A 3VF4A 2X3GA 4LC9B 2UUAK 3SQGA 1VQ8N 1GLJO 1X4AA 2AP6A 4YMEA 2GA7A 5M1OA 1ASUA 3PR5B 1S5JA 3RMDA 3AGKA 4FK2A 3P5BP 4C11B 3MUTP 2DH8A 9ATCB 3Q8VA 2GV1A 1EQYA 5JMNA 3ENBA 5ETQA 1G3OA 4CZMA 4LF4K 4IFVB 3Q8UA 3GIJA 5B7WA 1HBMB 3ONQA 4E7IA 2DJWA 4ZPWR 3VAJA 4FW2A 4QIEA 2XWXA 1HBUB 3Q0AA 4C9DA 3B6OA 4GVBB 2JVOA 4F9OA 4K4XA 2IVMA 3CC4N 2EI5A 1D1UA 4LH5A 4ED0A 1WSEA 5I3UA 1M1HA 3QQCD 1RB0A 3IAYA 3VEWA 4B1XB 3PACA 3NH2A 2MHNA 4KGKA 2B43A 5HQ8A 2OLWA 2DXDA 1W7AA 5DLGA 1FXDA 2DK2A 4H54A 2ZGZA 1FX2A 3IR7B 3DOKA 3MAQA 2NRHA 3VGLA 1C2PA 2IHR1 4J2BA 3IBFB 4A8SA 4PXCA 2OO4A 4L8RB 3F44A 3BS9A 3S1TA 3MEGB 5MLCQ 1CJVA 4JS4A 1X4EA 1SQGA 1PJ5A 2JEGA 2VG6A 3BV8A 1VISA 3TZXA 2ZM6F 1NGGA 5HK4A 3GG1A 2DH7A 2YNIA 1C0TB 4CEEA 5M2PA 1ZM2A 4FPAA 1WSHA 2RMLA 2E1MC 2EK6A 1Q82O 3OBWA 2VQFF 4FS2A 2PMWA 2IVYA 4QR0A 1U0SA 2FC9A 3SUNA 4MH8A 3NKYA 5DQGA 4PR6A 2X74A 3HSGA 3E9PA 2WHOA 4YOEA 3DI6B 3TOQA 3O9SA 3W7BA 3LP1B 3TR5A 1OMSA 4IOAL 3UE2A 1TL7B 2HLUA 3FCHA 5LMUF 2FF3B 2RE1A 2HAIA 4OGCA 2MLZA 1Y3JA 2Y0BB 3OHRA 4JYAJ 1TL1A 5EWFA 2FZKB 2O8FA 4FL9A 2HQDA 1VBZA 4YB6A 3UKUA 4AHTA 2XZDB 2FHMA 3CSKA 2O8FB 4ANDA 1WDDA 4MDAA 2DGWA 1NBWA 4H4KA 2VWJA 5KFLA 2W7OA 4J9OA 2HFSA 3IMXA 2QL5B 2HHXA 2FYXA 1F2HA 3QT7A 1XUPO 4FWMA 3T19A 3ASMA 4LBHA 3B4MA 4JI5J 1NWKA 1Q79A 4M5DB 2MKCA 4PKDB 4X66J 3UIQA 3L4BC 3MM5B 3M2UB 3EWGA 5KG4A 1VYAA 2G2ZA 3O9TA 2ZUGA 5HBMB 3P4IA 1VK0A 2GW8A 1F5CA 1ZA2B 1WB9A 4CGGA 5K20B 1QY7A 4AL5A 5KAKA 4Y2IA 2W2QP 2P9CA 2PBDA 4LR8A 1SQFA 2B4VA 2LU1A 2J9EA 2FPHX 1SIWB 2AGQA 1OY8A 4RO0A 3U8XA 2VBWA 3RR7A 4KHQA 4CNYA 4F26A 3UB5A 3SCJE 2VQFK 4L74A 5KFNA 2PEBA 1TK8A 3KLVA 4P72A 1O0PA 1E4FT 4V19X 3LDLA 4C6AA 4ZP8A 1CULA 1QAJA 1NB2A 1ZC6A 2C2OB 2GVDA 4WPAA 4BR5A 4NL5A 4FJ5A 2YNGA 5HP1A 4N8OA 3DXMB 4JRPA 2F9WA 2HF3A 1OH5A 2CXEA 1GEHA 3B82A 3FFKB 2DR5A 4CEFA 3RMBA 4ISGA 1RU1A 5BRDA 3S01A 4AD6A 3RZAA 2YWGA 1UTAA 3HZ6A 2B8QA 4GKKF 1B64A 4J9NA 1XMOF 5BPLA 4X4PA 2Y8YA 2DPNA 3OXFA 3JS9A 3EN9A 4MAKA 2F8HA 3N0VA 5L38A 2GC8A 4J5OA 5K8PA 1S72N 3ZTQA 1RA6A 1I5OB 3RYLA 2E5HA 4FJ9A 2Y8WA 1N33F 3MFHA 3GFHA 2KM8B 1HI8A 3AOCA 4LIRA 1JLBB 4NZ6A 3PO4A 1J53A 2QW9A 3SI6A 1F3FA 1FD2A 4YOTA 1HPZA 4GO5X 4BR0A 3FNNA 1J2VA 4OX9J 5BR8J 3LDOA 3OTDA 2E8AA 4CCHA 1SZ2A 1H73A 5D0GA 2QTDA 3EL2A 1RT3B 1RE1B 4RG8A 2KYZA 3Q24A 5F8GA 4JKGB 4HTIA 3LZIA 4ZPCA 1FRLA 5CR4A 2Z1GA 2VBXA 1H74A 2RRAA 3KK2B 3RAXA 2HHSA 1HNWK 2VV5A 1HMVA 4G6VB 5KGWA 4AHVA 3S6EA 3A8EA 1ATRA 3AVGA 3MTJA 3PJXA 4TYBA 3J7YU 3A13A 4I0WA 5KI6A 3ZCMA 4ECRA 1FKOB 1Q0NA 1PKUA 3QJLA 3H5SA 1RFQA 3RW7A 2FC8A 1N54B 3LW5C 3AA8A 1VQLS 1G1XA 2YJEA 2RRBA 1W9HA 3OTOF 2ZJRL 1I6JA 1LW0A 2BMBA 1WD6A 1FFWB 4DOZA 1WEZA 3Q2SC 4R8UB 1G7CB 1A5WA 2BJEA 2G8HA 1VK8A 4WZMA 4KH1B 2W40A 3AVIA 4QR2A 5AQRA 3ULEB 5H9FJ 4AFFA 2BQUA 4CT8A 1X9WA 1C0UB 1H6KX 2P9SB 2OPPA 5L1KA 1NB7A 4M8LA 3HHKA 4F7VA 4DV3J 3BM7A 3T7ZA 2GAHC 4Z4IA 2HBYB 1IJEB 3NP5A 1HNWJ 4M5IA 2A6OA 1XQIA 4ED5A 4FJ7A 1JLEA 3CETA 4PAAA 5KFXA 3CULA 3KNAA 5IT0A 4S0MA 3OYNA 2CH5A 4DJBA 3BDPA 3R3TA 2YH0A 3VQDA 4ILHA 4O4GB 1MWYA 3CDEA 4YR2A 1TV6A 3R9PA 3DLEB 4Y1CA 3DLBA 4MT1A 5AXLA 1Y11A 4B9SA 4ZS6A 3CMEN 3RJMB 3OJUA 5T14A 4I56A 4IG0A 3CJBA 2CZ9A 2IJNA 2F4VK 1E6VA 4IXCA 3U7JA 3MM7A 2GO9A 2MTLA 1V4SA 5EN1A 2QMWA 2ZKTA 1K8KB 5BR8F 1C4CA 3POTA 5IWAJ 4FF2A 3KHHA 2UUBK 2RS2A 1KFDA 3TABA 1S9GA 2LMIA 3NHGA 4FZVA 1G99A 2FJDB 2MLXA 3G6YA 5AQLA 1FRKA 4CP5A 1H72C 4JV2A 3HHLC 1VQ8S 5M1FA 1RTDB 4PUOA 2OPQA 1F9HA 4OQJA 2R2SA 5ETKA 3T1YK 2HWHA 3G9CA 2HQIA 5BYSA 3ZSZA 3H40A 1CQMA 1VI7A 1TUUA 1FWKA 2MSTA 2Z58B 2KB2A 1JJ2R 1ZBSA 4WFBL 3TX8A 2A42A 5FPDA 1G6BA 3TUJC 3THXA 1N5YA 1V5VA 3VAGA 2B51A 3NGZA 2EG1A 4DG1A 1JXVA 2QGFB 2GTDA 5HMYA 3QWPA 4ETXA 4RW7A 4A8QA 2GX8A 3L0QA 3SMPA 3PJ9A 4YB5A 2VGNA 3HSZA 3RSEB 4N76A 3OW2M 3I0SB 2V2QA 4QS9A 5M2RA 4E1MA 1VBKA 4K4TA 3CCMS 5EWEA 4GW6A 3RSEA 4ZJQA 4CLWA 1J6ZA 2OZMA 2JZ5A 4USUA 1E4GT 4ZVFA 3O6QA 2HRUA 4KHWA 1K73O 4K4VA 4YN3B 1NPKA 4CHQA 3HVTA 1S97A 3MN6A 4BRNA 2F8EX 4XO0A 4LF7J 4CZKA 3QZ7A 3LP1A 4BCAA 3V1RA 1HHSA 1R0AB 2ZEJA 4OX9K 2F8MA 4HHUA 3AO2A 4F50A 3W66A 3A2FA 1TQLA 5A8WB 1R0AA 3T1AA 2HOEA 2JWNA 5EX5A 3CCQN 1TVRB 3LM2A 1REGX 1IWGA 2Q0RA 3ELHA 3H1VX 4USVA 3D2EA 1DQAA 1U8SA 1CG2A 4GY2B 1UFLA 5GMDA 3D0IE 2V8PA 5FPNA 3I31A 2Z2LA 1H7XA 2FJEB 1ZBIA 1LWEA 4N56A 5L46A 4Z94A 2KM8C 2XB2D 4CLTA 1MLAA 1PJ6A 1NDCA 3GIKA 4CW7B 4IQMA 3GOIA 1V9OA 2VQEK 4M3XA 4OZLA 4JV5J 5B0FA 3A8JA 4CH0S 2UV8G 5KFUA 2ZH1A 5GIOA 2H4WB 2HBQB 2EX3A 2J0XA 1LQ9A 3T1YF 2BKNA 4ES2A 4FJ8A 1H0HB 1U49A 1NGDA 3T41A 1S1TA 4O55A 4R5PB 5IC6B 2EKYA 2G9OA 4FJGA 2YKAA 3W5YA 1LWFA 1B9FA 4Q5VA 2CDRB 1VHXA 3T9ZA 2WBNA 3MWTA 2DEIA 5A76A 1IJFB 3L7UA 4RUHA 1CC7A 2H5IB 4TU8A 2W8KA 3UI3A 4NYZA 3QAUA 3QEPA 1JXLA 5JS1A 3U02A 1CSJA 5AZJA 1NNEA 4WK1A 4WYLA 2GUIA 1YUWA 2H51B 3QIPB 4MTPA 5HJYA 3BQ0A 2NZTA 5HQLA 3RGIA 3HSDA 2HW3A 4D3HA 4U9RA 2XG8A 4MK9A 1IBKF 1MMDA 5EU7A 1VQMN 3I5AA 1SS6A 1YK9A 1YTAA 4IFVA 4G1QA 3VGUA 1VQSA 3NXZA 1K6YA 2LYVA 3TI0A 3SCXA 1VQ7N 1J5EF 4CLSA 3B4DA 4BR7A 5F41A 4F0MA 1XNRJ 1Q4RA 2YH1A 5DJBA 3CF5Q 1U25A 2IIRA 1YAGA 1TK5A 5C2DA 4JAXA 1N33J 4CZCA 3VQ4A 5IXUA 4FWSA 1BO5O 1N5YB 3QNOA 3A8KA 3CCRN 1S0MA 3J8AA 1L5UA 1HNXJ 3P6YC 4ANCA 5HL7L 4EBEA 4X4TA 1JCGA 1CJTB 2KLAA 1UMJA 2PA3A 2HFZA 4A47A 2PMHA 1JXEA 2IMOA 3E3XA 4LREA 4WFAQ 4DR3J 1PC5A 1P90A 5AQGA 5FLXY 2IVOA 4CFBA 4BDZA 2X1AA 4DWIA 4DR4J 1N48A 4ICLA 1SVDA 1I1GA 2X6SA 3IA0A 2CQCA 1JQGA 2G8VA 4ICLB 4DL0C 4DSFA 4DSEA 5CYMA 4QJVA 5DZ7A 4IOXA 1YDLA 2ZNYA 2ZNZA 3PKMA 1RCHA 1RBVA 5F2RA 4RW4A 2AZ1A 3PW2A 4GKKK 4LFAK 3OPKA 4GRSA 5DK5A 1UPPA 4LSLA 2DKOB 3O08A 4KH6A 3OYEA 2C42A 3KLEA 2XHWA 4O4RA 2HSTA 3AFGA 2VD3A 1NO8A 4YORA 2UVUA 2A41A 1JNRB 4DTSA 2UXCF 4CF9A 4W5RA 1P1TA 2DEJA 1KQKA 4H5TA 3W2VB 3PKYA 3HLUA 1DRZA 2YHYA 2M2BA 3HMJG 2ETJA 4HACB 2R8KA 2J7KA 3GFXA 4H4KC 3WXJA 1W25A 4I69A 3VEYA 2P51A 3KKFA 1KTQA 4OV6A 1R8BA 3C8YA 3HXMA 3DHWC 3DAWA 3E01A 2GO8A 3UVJB 3AVKA 5DM7Q 1CZ9A 2IAJA 1BLUA 3E51A 3L2RA 4YHHF 4R0EA 4FJIA 3V9WA 2WOMB 4OJGA 3MM5A 2YWKA 5DGBA 2B4JA 1TYQB 2KQ2A 4PYAA 1WUAA 4LF9K 3FLCO 4JKHA 4OZ1A 3BSAA 1Q5YA 2M8DB 3DXKB 4FSVA 1SC1B 4NASA 4IRDA 1KCFA 1RDUA 3N28A 2UUAJ 1U1LA 4YB1P 4C8MA 1D5AA 2MJUA 5HAOA 3ILIA 1WJ9A 4ETZA 1GFWB 2I5JA 4NYPA 2LECA 2Z2ZA 1DFDA 1VBYA 1UEVA 5I9EB 1UFWA 4ECSA 1F60B 1S1WA 1T9TA 5C0YA 5L9NA 2P9IB 1REVA 5KG3A 4M7YA 4NRUA 2JRSA 4C0HA 3H08A 1RBOB 1X5PA 1PIEA 2XMWA 2O4GA 2CPJA 3DLRA 4X4NA 2IYIA 4JI7J 4DTOA 3DLKB 1PG5B 3CD7A 3GG4A 2WSEC 2FZCB 3ZFVA 1HBUA 1YBTA 2RF2A 1RWUA 4XDDA 1RDDA 3KMSA 3MN9A 1OYEA 2BYCA 2V69A 3S3MA 2DO0A 1B3TA 4C8KA 1VIXA 3SFGA 4IYQA 1U1MA 3SLCA 5CCLA 4OKKA 1WSIA 3CJSA 4Q8FA 3NG8A 1SV5A 1TP7A 2VBYA 5E0OA 4CIFA 2BRKA 1HLUA 4DV5K 2HBKA 3IG1B 5BYQA 5J1EA 4I67A 5AQWA 3H45C 4OYOA 5IWAK 3VETA 3VAKA 5HRRA 2CQ0A 3L3UA 2HLTA 4DQQA 4TN2A 2OTLS 2WK4A 4CZEA 3M32B 1WC5A 4FVCA 2Q2RA 3OHBA 4U7BA 4HH0A 3CDWA 3BJYA 4DSIA 1OWXA 2HHTA 1HQEB 5C15A 2M52A 3BR9A 4PXDA 3Q8RB 5D4NA 2O8DB 1D0EA 4PQAA 1NAQA 4BGAA 3MCPA 4UOGA 1NGEA 2CQ4A 1CJKB 4A8YA 3QICA 2CG8A 1EWQA 4DCJB 3DYAA 4ZCLA 2H9ZA 5KT3A 3TAEA 3DJCA 4DV0K 3IFEA 3DFEA 3OR2A 3OUYB 3PHTA 3KZBA 4CESA 1VC5A 2ACYA 1RDRA 3LAKA 3U27A 3OUYA 3W5XA 4BRAA 3EDRB 3W65A 2ZZTA 4M3TA 3C16A 3QEWA 4BR4A 1OS5A 3W62A 4JV0A 1VRTA 1J27A 3DLGB 4I2PB 1K0VA 4OVLA 2DNYA 1NJYA 1YJ7A 1JXBA 2QXFA 2XY6A 1ZH5A 3VHQA 1YHQN 3KJVA 2XY7A 2MZJA 5ETVA 3MFIA 4FF4A 1K47A 5AQMA 3FRYA 3LDSA 4GMJB 1FRMA 3CJ9A 4E1JA 4ZVGA 1VQ9N 1EIYB 2VG5A 2AF6A 3H2LA 2XSJB 3CCJN 2D1CA 3PYFA 4JKDA 3R7BB 4P2SA 4LF1A 4OFZA 2E1RA 4JK7A 3LPUA 3DMJB 2AYMA 1R3NA 1C0GA 1Y5IB 1R8PA 2JVRA 3PIPL 4FJMA 1RTZA 2DH9A 4F04B 2V94A 4N41A 4ILRA 2HQFA 4I68A 3ATVA 4Q7AA 4J9RA 2VASA 4CI0B 5HSPA 2ZWPA 3OTOJ 4CZGA 4DU1A 2OEKA 1G2EA 1ESVA 4OLAA 3HOSA 5IQ6A 4DV2J 4HUEA 2Q3SA 3CJ7A 2PN6A 3R6GB 3CCSS 3MXHP 3BB5A 1NGBA 3VQ8A 3LF0A 4C11A 2QIFA 4IO9L 2V8GA 3BDEA 2RDDA 1WC1A 3WNFA 2GJ2A 2E29A 5L8RC 5BRHA 4CLPA 2HHHF 1N88A 2NSBA 1G15A 1V4TA 1YF5L 1U45A 4CJLA 3HZEA 2LLZA 2Q97A 4DUYF 1NU4A 2QRRA 3ZNUA 5CD4A 5IT9O 4G1QB 4UOHA 1K0TA 2P9LA 3KDNA 5G4DA 3NCPA 1N34J 2W9AA 3H25A 1DTTA 4PG8A 2IIHA 2EVZA 3C19A 4DSJA 3OL9A 4Q43A 4ZLPA 1FHTA 2C3MA 1WG5A 1XR6A 2BANB 3C65A 4KGVB 3CJRA 3VPZA 1FJGJ 3N5FA 4NXMJ 3S3NA 1KQSR 2JOQA 4ID5B 1S6QB 4JYAF 4YOUA 2MHEA 3V6KA 2VA3A 5JLFA 5DG9A 3HHDA 5DM6L 5BR9A 3AB4B 4FWRA 3K2PA 1CJTA 3IR6B 1JKHB 5FIIA 2YPZA 1X4HA 1Q8BA 5J2PB 2WONB 5AQNA 4RU9A 2V4RA 1CXUA 3CJ3A 3DOMA 3AVCA 2OA8A 2HGNA 2N7CA 2VG6B 3O3HA 1WBBA 4DTUA 3E2EA 4NLDA 2E7VA 3EO3A 2BJ3A 4TVAB 4N77A 1Q95G 4DL2A 2UVWA 4L3NA 2QO3A 2CZVC 2NPFA 3OS1A 1YJ9S 2GV9A 1FDDA 1MSWD 4NLOA 1GOAA 5CYMB 3FRZA 3X3UA 4WF9Q 4USJC 4DR6K 5KGXA 3AJ2A 2O66A 3QWUA 2WZ1A 3VVTA 4MYUA 1VSIA 3MMAA 1E6YA 1FKOA 4EFAC 5HRSA 3C0BA 3ISZA 2GIQA 2VF3A 1QZ6A 5KG5A 4OHWA 4X65J 3WUHA 2G13A 4DS4A 2XQCA 1ITPA 1LW2B 4KB7A 4AUKA 2QLBB 3GJTB 4C8YA 3ZSVA 4LF4J 5KPZA 3GSDA 4UUXA 2H3GX 4N5SA 5D0RA 4ED6A 1CQNA 2QA4N 4RX6A 1BGXT 2RD5C 4DF4A 3NWGA 4LQ9A 2XO7A 2UV8A 5AZIB 2FVRA 2VKRA 1WKKA 4QWEA 5IT9Y 4OJRA 1EP4B 1NSPA 2XI3A 3K5LA 3M2VB 1WSVA 2P5OA 2LQ5A 4RNOA 1U0HA 4JKBA 3BGLA 4HUGA 1M5VC 2QA4G 4OI2A 1VQLN 1RWNB 3ZEUA 2CVEA 3CQXA 3LP3A 2ZH8A 3UD5A 4KO0A 5A8KB 5AXNA 2F65A 3OVNA 4Z7CA 4OPAA 4KTWA 3I87A 4O3NA 4ELTA 4DR3K 3R7SB 3HK2A 3MUVP 2VWKA 2O5DA 5HMXA 4IRCA 3EM1A 4B08A 5LY3A 1QUPA 1U04A 3WIUA 4I9QA 3NS5A 4CFCA 2PD1A 4KB0A 3RBZA 4FLWA 2ZHBA 4AL7A 2PAVA 3D0GE 3M9NB 4HYKA 4CVNE 3CJ4A 1FKAF 3K17A 2PFFB 1Q86O 1W2IA 1REVB 4F36A 1HKGA 1TMMA 1EARA 2F63A 2P8IA 3T5JA 5H9EJ 4YHHK 4K42A 4QWAA 3CJ1A 1GLDG 1NDLA 2KXNB 3JTPA 4JNEA 3PX4A 1CZAN 1EXQA 4YR3A 1H38A 2W8LA 4K4ZA 3O4NA 3GIRA 4AQYJ 3SSQA 2GMLA 2G2OA 2YTCA 4NLTA 4C3MA 2UP1A 1VQ6N 4ANEA 1IN0A 3NVKA 4BGBA 3E66A 5E84A 1YIJN 3SPYA 1A5VA 1NJIT 3CI5A 3NS7B 4RKUC 1WC4A 1Z2LA 3EE8A 3MEDA 4D3GA 4NXNK 2CQBA 4Y3CA 1MU2A 2ADCA 1BE4A 3CO9A 1IBMJ 1I3AA 5CA5A 1U1NA 3LM9A 1HJRA 4DV7F 4ED2A 4DFJA 3I5BA 3IWNC 1RABB 2DGUA 5ADZA 3CCJS 3BKFA 1R8CA 2YHWA 4W90B 4P74A 2XLKA 1JLFB 4WE1A 3PUFA 2A1RA 4JP8A 4OMFG 4MIBA 4TNOA 3SUOA 3TW0A 4K7QA 1FJGK 2F1FA 3LAMA 2PIIA 3KK2A 3MM8B 3F56A 2R7TA 3VQQA 2YHXA 5B09A 4UZCA 3GJSB 5G0RA 4DR5K 3K5OA 2W9BB 2B4UA 3HVTB 4O0JA 5KOWA 3UNGC 3SV4A 5I4MA 4IOAQ 3G6VA 5SUHA 1TUYA 3R5AA 4JI0J 4DUZJ 2OPRB 5AE2A 2C3YA 3OHAA 1N36K 3HDSA 4BWJA 2B5JA 3CJCA 2E6LA 4HWIA 2Q3PA 3VF2A 2R8HA 2K7KA 2QX0A 4USIA 4FPRA 2A3ZA 4ILMA 1I94K 2D0OA 1AROP 2BXJA 4J9UE 2BE2B 4I1TA 1F5AA 5B0DA 1RT2B 1KNZA 3D6FB 5LJWA 1HNIA 3R2DJ 3VEVA 2KL8A 4ID8A 1RAGB 2DR9A 1JWWA 1C0UA 4FLYA 1OSDA 1X5TA 1HWLA 2D0BA 2QSWA 5IS2A 4DV3F 3AA3A 4B02A 4FXWA 2GAGC 4KH5A 4OHVA 1EAYC 4E1NA 1VQKS 1VRTB 4ALZA 4BRQA 2IBKA 2KHCA 1UVNA 3J7A1 1HHTP 3GONA 1C1AA 3R9LA 3OYKA 3TANA 3IGVA 2YWHA 2HQCA 1JMTA 2WC9A 4WKYA 5KQ8A 1FJ7A 1KR4A 4XH1A 3M2VA 2BTFA 1T7PA 1PCAA 3GJQB 3MR6A 4KC5A 2AD9A 3WQUA 3Q23A 1QAIA 4DR1F 2D69A 2HHUA 2C2RA 4FJXA 1LK5A 1VQKN 3B6BA 4CERA 4TYAA 1JL1A 1NK6A 5AXMA 4CYUA 3H3NO 1S1TB 1KQFB 4CGIA 2V52B 4FM1A 5H1SQ 3NCIA 4CEBA 1ASVA 1S9FA 3J7YP 2YCHA 3K0SA 1KC8O 2VIHA 4JI3J 3TTFA 4N8NA 3V6HA 1QE1A 1VQON 2ASLA 3V81B 1VSHA 3I82A 4X4VA 3C15A 3R8YA 3DLHA 3G86A 2ZZNA 3PXGa 1HFEL 1QHTA 1ITGA 3QETA 4NLCA 3T6BA 3MM9B 4HTJA 3CHWA 2EPIA 2GS8A 1S77D 5IV3A 1WF2A 1WC0A 3UCUP 4FPIA 1X4GA 1NJZA 1SKWA 2D4WA 1QD1A 1FJCA 2DGSA 2AA4A 4P7VA 2DNRA 4L3QA 4MK7A 3CCES 5LL6d 4UY85 1S9EA 2VFVA 3KJQB 1X0PA 4DV5J 2QK9A 2OPQB 3PIOL 2CZ4A 4JK8A 5D4PA 1S6UA 2FLNA 2R2RA 3OFHA 2JJ4D 2RF2B 3GR0A 3TZWA 4WIQA 5A2QY 4C3KA 3LZJA 3FSIA 4MDBA 4ZCKA 3VQ6A 3DCAA 5GAGU 2YNFA 2DO4A 2ASPA 3MWBA 2CYYA 3FBFA 4BE0A 3L9ZA 1WORA 3PLAA 3MAAB 4GO7X 1SI9A 3WNEA 2BANA 4RNFA 2C3PA 1BA1A 5LMUJ 3GMGA 1DEJA 1S0VA 1QVFR 1XR7A 3WXMB 3L4IA 1QSSA 4GV9A 4DSLA 3RRKA 2O01C 5CYQB 1IBLF 2F9TA 4DQPA 3W1YC 1RT5A 2RNEA 1TUVA 4IG3B 2E1CA 1SJFA 3IM9A 1NM2A 8RUCA 4USMA 1H3DA 3FBCA 3H5XA 3EGNA 3VQ9A 2ACMA 1LXNA 5EHHA 1RI7A 2ZKUA 1PC4A 3M1VB 3CIPA 4FO0A 4FXDA 2CH6A 1NDKA 2PDAA 2P9UB 4F25A 3KD1E 4DX8H 1DGKN 4M95A 2AMCB 3S9HA 1GK8A 4KI4A 2UXDK 4CD3A 3DDKA 4AHSA 2F5GA 2IS3A 4DL7A 2E9TA 1YITN 2KTQA 3HVAA 4CF2A 1NG9A 4CIOA 1FXRA 4UOCA 2UU9J 4JKEA 2R7RA 1KVAA 4WU3A 2UXDJ 2FBVA 2IVFB 2O8CA 3OY9A 1TL3A 4PWWA 3G8SA 1CXQA 4ZJLA 1BHLA 4QWBA 5IQQA 1S79A 1VLYA 4CH7A 4J9VA 3FGUA 4BC5A 4L75A 5KFHA 2XMTA 2VCPA 2AJ1A 3SIPB 3UR3C 3TP2A 3G6EN 1NSAA 3WZ0A 2E5LF 1ZBUA 2PI5A 3OR1B 4AHUA 3IN5A 2C2DA 1W26A 3ZO7A 1ASWA 4I6MA 3NBPA 3QGHA 2RHKA 2ILYA 1W2BM 4DKWA 1X4BA 4B3RF 3TAFA 3CC4S 4X4OA 2RQCA 4EP4A 2HVDA 3O1BA 3ET6B 4J9MA 2EK1A 4LH4A 4H0OA 5HLFA 2AYEA 2CRLA 4CYUB 2LEAA 4XAKA 4K59A 2ZM6K 4E7KA 4O4GA 2IVPA 4CBUA 2FIUA 1S76D 4CZFA 4Z37A 4JV5F 1WNEA 5HVGA 2NXUA 4E7HA 1IKXB 4JHDB 1QE1B 1ZM4A 4EI2A 1HKCA 4BE1A 2FB0A 3RTVA 2G8KA 4RLEA 2ASDA 2Q1NA 2NPIA 2I38A 3O3LA 4DX7A 4B3RJ 4ED7A 1L3SA 4DHYA 5DRKA 3PW7A 1UETA 1X60A 4I7FB 3CNQP 5C2CA 2EC2A 1P27B 1WHVA 3PW0A 3N4QA 4H03B 3J7Z5 1DKGD 4BG9A 3EICA 2UUBJ 1CULB 3IKMA 3SNNA 3BGRB 4PKGA 3UW1A 1S1WB 4DCOB 1U6BA 4CZHA 3KWMA 1S1XB 2GELA 5KT6A 3MDQA 3ZTRA 1N34K 2D9OA 3KKRA 1LNQA 4FBTA 4JS5A 1KD1T 3EDQB 4DR2K 2IOCA 4IEEA 1SBRA 2ZFHA 3QBWA 1KLMB 4OI6A 3G25A 3HULA 3LPEA 2A18A 3D5MA 1ZOTA 1X4DA 2QA4S 2CG4A 3MR5A 1VJWA 3U4LA 3TAQA 2XTJP 4AHCA 1VIOA 2YKQA 4MK8A 5AQQA 4FWQA 3MXIA 4CJ4A 4ZP6A 4XH5A 2APOA 2PC6A 4HVZA 3JTNA 3ATUA 3FZ2A 4B1YB 3KK3A 4ID5A 3EMTA 1RYRA 3BPSP 1WI6A 5KFSA 4IZ9A 2V6AA 1QVFM 2DNOA 1YG0A 5KRTA 3MCSA 3TA1A 4LFBK 1S57A 1WG1A 3GYNA 5CE3A 2W25A 1TZ0A 4X62J 1P6TA 2HZVA 2QWLA 2QWRA 4J2AA 3MAHA 2HHPA 2QL7B 3KD5E 2BOAA 1R0BG 4XTTA 4XPCA 3M8WA 2FJVA 2HMIB 2C2EA 3RW6A 2B0GA 1NMDA 2W9CB 4ZMMA 4IJNA 3DOLA 2XYPB 4Q44A 3PX0A 4CFDA 3HO1A 4CECA 3C14B 5H9FK 5EWGA 1MA9B 2YY3A 2PO4A 1VSDA 2Q0UA 3R6LB 1Y5NB 1FD8A 4CO3A 4GKKJ 1J5OA 1HMVB 4KHPJ 5C25B 2BQRA 4ILJA 3BN4A 3UQSA 5IFMA 1H2VZ 1Q7LB 2E1PA 1J5EJ 1UCNA 2HZCA 3CT9A 4JI1F 3ZTPA 3IRXA 4OHZA 3FZKA 1PYOB 1E6YB 2RH3A 4TKTA 5SZTA 1SB6A 4JD2B 3G71N 2R7QA 1UEKA 5E3CA 1VMBA 5AQHA 3MEEB 3DYAB 3OLAA 3QLHB 2M88A 4DR7J 4EMDA 3ULEA 4DZ6A 2RPIA 1K8AO 4BRLA 3OYHA 2KG1A 2RUSA 1FFGB 5HJXA 2M9KA 2U1AA 3FEZA 1DARA 3JXOA 3PR4A 2I7NA 1X8DA 4DV1J 3RBEA 3CJQA 1IKVB 3AOBA 4YUDA 4NE9C 2EFVA 3ZC4A 4PPDA 5HANA 7AT1B 2E1AA 1Z05A 4CF1A 4FZZA 3WEEA 1Z1ZA 3UVJA 2MY8A 4NCGB 1QVGR 4UTGA 1M5SA 3HHLA 3QSIA 3EKUA 5K9FA 2VFRA 3SBMA 1B7YB 4PG5A 3F9KA 2Z30B 3JQKA 5HVHA 3DRPB 1RAHB 4Y2KA 1HYVA 2QI2A 2VH7A 1X9MA 3QGIA 1YRUA 3MPUB 3G2XA 2JWLA 1MDUB 2Z1HA 3H3OB 4XIUA 1FE4A 2O1PA 3AT1B 3AY0A 1UW4A 2XS7A 2CQDA 6FD1A 5CZ2A 5BJRA 3HHNB 2RU9A 1T9WA 5HI7A 5DLFA 5D4LA 4NZ0A 3UWTA 4DPXA 2OCEA 4IR9A 2Z0GA 1KWMA 4L73A 2IRYA 2GVZA 4EP5A 3N4PA 3AVJA 3IC1A 3TAMA 1I3OB 3H20A 3THTA 2P9IA 1HBNB 4WWSA 1Q82T 2KN4A 1X4CA 2ITMA 3FDSA 1S1UB 3FSXA 1T11A 4JI7K 3CF5L 1UAWA 2DNZA 1TUGB 2DNHA 4HI1A 2VC0A 3PFOA 5JJBA 3LA0A 2XLJA 2HNZB 4CT9A 1P1LA 4NZ7A 4F4XA 4J91A 2YNFB 4WXWA 4K4YA 3NGUA 2QE5A 4ZVQB 4KHPF 3K89A 3F5TA 3BYPA 1LKZA 1OSCA 3C95A 4YDUC 4PABA 5ETRA 1GLAG 4DPYA 3AO4A 1F9EB 5AQJA 2KYXA 1SV5B 3AOAA 2R8GA 2RSQA 4LFBJ 3EPGA 3NFAA 3AVAA 1MU2B 4DDFA 2XRIA 1LFWA 2MQLA 2N4CA 1RBAA 2MZRA 4QBUA 3ULDA 1FDBA 1VQPS 4ES1A 3MX2A 4DI6A 5B0AA 3C7NA 5EX0A 5KG6A 1KS2A 4Z0UA 5KG1A 4NRTA 3AHPA 4DUYJ 4Z2XA 5K8NA 3L6QA 3TU5A 4OJ3A 3BO2A 2VPWB 3KLHB 3DLLL 2MQQA 3K8WA 4RNNA 2I1RA 1I51B 2ZD1A 4DV3K 2XZWA 1BIZA 1QLNA 3B6PA 3AVFA 2DNLA 1FESA 2Y1LB 2KFZA 3NEKA 4H0YB 5KRSA 5KT5A 2DIVA 4LRFA 4FVUA 2OP5A 2ZH7A 2LQ9A 2RQKA 4UW2A 3K59A 1F21A 3FSYA 3MUMP 4K50A 4PXEA 5KFDA 3C66A 5LSOA 4NLWA 3BZQA 4OL8A 3M8PA 3NS6A 4CJUA 3QATA 1NGJA 3SQ2A 2HS3A 3PM9A 4UQTA 4K0KJ 5LL6Z 3MDFA 3QEIA 3BYRA 1FRHA 1NGAA 2EW9A 3LUYA 2ZJQQ 4C3LA 2FY1A 3SI8A 5KFCA 3V9SA 3V4IB 1VQ4N 1K8AT 4KGZB 3TJAA 2UUBF 2XNQA 1IBLK 4B3MJ 4YB7A 3W60A 3CM6A 2O4IA 3NMRA 4LF6F 3AD9C 1FW6A 4CE9A 3UFCX 2LXFA 1RT1B 4LSZB 2XMMA 5F9LA 3EGZA 1JLEB 4RNMA 3E01B 1QZ5A 3HVRA 1WSRA 1D9DA 3NBPB 1AFJA 1FTRA 4ECXA 2YJFA 4K5RA 2JSXA 3ADAC 4NXNF 3LQVA 4QS8A 4K4WA 1DT9A 2OELA 2FUG9 3MMJA 2VKZG 1N36J 4DUZK 4Y1DA 3I0RB 2B8PA 3MPDA 4JLHA 2UVVA 3KLFA 4ILLA 3RBXA 2GMHA 3RMAA 1Y10A 2CNOB 2BV3A 2HPUA 1FTCA 4EBDA 3CG7A 4W5TA 2ROGA 4HCBA 1RADB 4JI5F 3CCLS 1QQCA 3QIPA 2Q6CA 2KT5A 2PGCA 4DU3A 2GIFA 4UOFA 4F3TA 4FS1A 5DS7A 1RAIB 2NRVA 3OYMA 3SQ4A 4W5NA 2R42A 3U3YA 2R7WA 3QERA 5KFAA 4RW6B 2FBXA 5C42B 3BKTA 3FZMA 2GBZA 4RW9B 3SEOA 2ZJPQ 3IO1A 4G65A 3J7ZT 1M5OC 5C42A 4KAZA 5FDLB 2QWMA 3MURP 1RT7B 1UVLA 2CJQA 5BRFA 1WF0A 4O8UA 1T94A 4J9SA 4JI2F 4QWDA 1KFSA 1RTDA 1I39A 2XLIA 3RRHA 2FTRA 1S48A 3M3ZA 4CLKA 4FPBA 2IDLA 2YKMA 2AT1B 2CFXA 4V19S 5F8LA 1JIHA 5DGAA 1EX8A 3S7RA 1W7WA 5KFFA 4KKOA 4JI4F 1HQUA 4DLEA 3BH7B 3K5MA 2K7JA 3D3CJ 5TKYA 4B1UB 3LP0A 2MQNA 3M6GA 3TQ1A 3MEDB 4DU4A 2E4LA 2YWWA 3OFGA 1JLCB 3EZ5A 2CGLA 4M5LA 3NNHA 3KUHA 2EKNA 4DL3A 3F0NA 2WONA 3KFWX 3A4TA 3H8YA 4WKRA 5AQSA 3O9RA 3MD3A 2DYAA 2KRBA 1TK0A 2HHWA 2P9NA 3O6WA 1RTHA 1BY9A 3OYAA 2HAFA 1RWOB 3J81j 3HPOA 4KB1A 1KLNA 4P2MA 4H5NA 1VQMS 2A10A 1HR0J 1RTJA 2P9NB 2OYQA 4NXMF 4ZVTB 4Q0BB 2KVIA 3A8YA 4TLRA 2Y0SD 4BC7A 2KH9A 1R31A 2RKIA 1N32J 2BABA 3NRBA 1A9NB 4P73A 1IQZA 3QLHA 5A8RA 4BR9A 2MLYA 4X62F 4Y00A 4DV6K 1EETB 4DR6F 4NA3A 2UXCK 3AA2A 3W2VA 4KY3A 1NZAA 1PGZA 2PI4A 3SDEB 4C8LA 1WTFA 5AFUH 2E66A 3CQYA 4E19A 3KLGA 4OYIA 4AL6A 4CGJA 2VG7A 4ELVA 3GDQA 1HIYA 1XEZA 3VERA 1MMLA 2UXBK 4O3SA 4IQXA 1LXJA 1WEXA 5E3QA 3SDEA 1RK8A 1U24A 1RT6A 2V4JB 2V5HG 2IJRA 3OD2A 1NPRA 1IBKJ 3LGNA 5LSRA 2IRXA 2KO1A 1DZ5A 1JCEA 2M7SA 1UVJA 2E44A 1M90T 2DB1A 4QOZB 2GJFA 1U0HB 1B0TA 2QJ3A 1V3SA 4CK2A 3IWLA 2MQPA 3R5BA 1SUQB 2YV0X 1U6FA 4C1NI 1UWAA 2QC3A 2X1BA 1RYSA 1B7FA 4OKJA 1GNKA 1HRHA 4RL1A 2VONA 3A5OC 4MQ3A 3P31A 1HNWF 1WOPA 2J8SA 1EKEA 4F3MA 3VEOA 4DZDA 4FLVA 3LPTA 4QQBA 2P5GA 1ELOA 5JLHA 4ZITA 4NLVA 2NLXA 2HFVA 5C24B 1ZA1B 2P6SA 1GLEG 2YX7A 3D6HB 1GTHA 5H9EK 1WSFA 4CGHA 4OZ2A 1S4EA 1J9AA 4OZ5A 4DR4F 4UY8T 4WFAL 1TKZB 1D9FA 2H1YA 2VHGA 2E7WA 4ZVEA 2ASOA 3TEGA 1RA7A 2VDIA 3H6EA 3AD7C 2HNZA 3HF5A 4KBOA 1WBDA 1WHYA 5AQOA 3VMFB 3L2VA 3C6TB 2NUHA 2BACA 4MO5A 3EJMA 2XMVA 5LMNF 1YT3A 3GFZA 1HNZJ 1FT8A 1MN7A 4MKBA 1KLMA 5GADU 4DR3F 3HKZD 3C6TA 2ASYA 2XS5A 4MMOA 2X51A 1WKLA 3I55N 3CMQA 4CM0A 4WXOA 5ADXH 4GVBA 3Q22A 3R8EA 3P38A 1U7LA 4GNIA 2YWFA 1JNZB 2JLEA 3G82B 3SBTA 2GQQA 1CJUB 1KONA 1R0CB 2E1YA 4ZDNA 4WP8A 3L09A 4K0KF 4F3OA 3WNHA 3G4SS 4X84A 4B9TA 4U7UK 1RBLA 3LANA 3R3LA 1W0HA 2EFGA 4B3SF 4CGDA 4OI4A 1D4XA 3CC2S 2QTWA 3PW4A 1SPBP 1UEUA 5CZXA 2P9PB 2WTUA 1K9MT 4NLPA 1UVMA 3ENQA 2GJIA 3DXSX 5KT4A 1NSQA 4QPXA 3S41A 4PG7A 1VOMA 4OPJA 3GV8B 3PG9A 4DV4J 1BIUA 2CNLB 2QZ8A 1UA1A 1HJOA 3DI6A 4J37A 1JJHA 3RVCA 4BWMA 4K2XA 3AA9A 9RUBA 4H5WA 2A5XA 1MG7A 5RUBA 1VAZA 3VALA 5J2MB 1MMNA 3OR2B 2ZH9A 4ZCMA 3CDUA 3MMAB 5IZHA 4IDHA 1KEKA 2YBVA 5E2QA 3QIDA 4WCEL 5J2MA 3K5NA 4ZPAA 1HYSB 1W97L 3P83D 1V3ZA 2HRYA 3JB9k 4TY8A 2VG7B 1DQ9A 1QJHA 2O8CB 1B92A 4O3RA 1NJIO 2RRNA 4OYXA 2ZH4A 2J6SA 4JK9A 1HW9A 3BUZB 1T9VA 4W98A 3ZZYA 1OIAA 3UD3P 2C28A 3NGIA 2X3DA 4DR5F 3NOCA 1R6YA 3WEEB 1V3RA 2XEXA 2V67A 3AARA 4QS7A 1Z6RA 2KG0A 3P5TL 2XM3A 1Q16B 5LJ3Y 1S1VA 2DTUA 1RTIB 5KFVA 5KPTA 1FERA 4WQ5C 1QAXA 3RB6A 2IAJB 1BQXA 1SKRA 2J6UA 3ZZPA 1Y9OA 3VA0A 4G9ZA 2B4PA 1RTIA 4OHYA 3KLIA 3G6ES 2COLA 4RW8A 1AZSB 3HFKA 4CTAB 3CERA 4CEAA 3TVYA 3ZEUB 1B0PA 3IS9B 4DV7K 2BZ2A 4HCCA 1HBOA 3MM6B 3O8WA 2A6MA 4CTAA 1YJVA 1NH8A 3D66A 2H65B 1LOTB 1VQ4S 2KZZA 3BZKA 1AA1B 1RAEB 1RILA 2BX6A 4B3TJ 4RW6A 1T44A 2I5JB 2EBEA 1EQMA 1RISA 5JICA 2ZWHA 2DNGA 2DR8A 1KVJA 4M5JA 2RQMA 5AQTA 3TA2A 4E89A 2YHBA 3GIMA 2DD8S 2XZTB 2VZ9A 2BH1A 2YHAA 4NCBA 1HD1A 1HKBA 2WVEA 1IBCB 3D6TB 1KOHA 2WB1D 2BM0A 1Q78A 3OVBA 4DSKA 2BBEA 5M1KA 2BVZA 3AQPA 2ZBIA 3HT0A 1JLQA 1IG8A 2HBRB 3GWCA 3C94A 4LSNB 2C2ZB 4H8KA 2W2OP 3HD2A 5DO2A 1NHVA 1HNVA 1VSKA 1X1PA 4A4JA 3AAPA 4YNQA 1HX1A 1VBXA 5F8MA 4DBQA 4GVLA 3C6UB 1HNVB 4PRFA 3CC7S 1UFKA 3NH0A 4EYHB 3MCAB 3SQOP 2ZH3A 2F4VF 3KK3B 2C3OA 4FOEA 3I33A 2GNKA 4A59A 2HIQA 4X64J 3HBTA 2G1HA 3J80U 4H0PA 2KW4A 1P9YA 2J7WA 1APSA 3EYZA 3DXBA 4DTNA 5HRNA 5BN8A 4L3KA 3G6XA 1JLAA 4OYAA 2ABYA 4A8KA 2VQEJ 5M1PA 4FYXB 4DV0J 3MN7A 2EG2A 4J9PA 3W9HA 1HWKA 4L6V3 4QIFA 4ZA1A 3O80A 4Z4EA 3I9V9 5J2QB 3DGVA 4LF9F 2E7XA 2R3VA 4H0VB 2DHXA 4C8NA 1YLXA 4YDXA 3L3VA 4UT4A 2OMOA 3AVNA 1H2UX 3R1HA 3Q7CA 3AJ1A 4YEAA 2I8EA 1QSLA 2JNJA 3PZPA 3LTOA 4KH0B 1YJ9N 4HEA9 2GZOA 2CPYA 3I8BA 1YQHA 1HNXF 4A5AA 2W4PA 2IYGA 5FD1A 1OY6A 4LR7A 1GLFO 4FLTA 1N5TA 1IQTA 4O5FA 2XYGB 3KK7A 3KVGA 3OTOK 1NEEA 1XERA 1HNIB 1MN9A 1XNQK 4C8OA 1RHMB 3ZYYX 3D67A 2H4YB 4PL8A 2WW8A 3KLGB 3C6HA 2QSFA 3THYB 2VUGA 4AXJA 3HP9A 3TVZA 4GKJJ 4CLFA 1S4FA 1S0OA 2F7VA 3CJ8A 3KJVB 4PWUA 1GOCA 2CPHA 2O67A 2ZOGA 4DV1K 3CCWA 2HNYA 4CRJA 3R1XA 4KHMA 4A61A 1XMQK 2VG5B 3CD5A 4O23A 2QFJA 3D28A 2ZITA 3IMQJ 1X7VA 2E9RX 3OV7A 3M2UA 4OV1A 3HFZB 3O1WA 2DRBA 2XSJA 1YRXA 2CQ1A 3D9BA 3M4XA 2HG4A 3OTEA 1H98A 2FLPA 3DU5A 2FF6A 5KFGA 4XK8C 2EBGA 4JI8F 3LWMA 4GKJF 2D3UA 4NLSA 4QYZJ 2ZZMA 1RKIA 3G0ZA 2Z2YB 4WFXA 2MKKA 1CBKA 2NZCA 3D7EO 1FRJA 5JS2A 1NK9A 1IVZA 3NMAA 5HROA 4RPFA 1NCLA 3OW2R 1WKJA 3GLJA 1YVNA 4CHYA 4QW8A 1M1GA 5JUMA 1S6PA 3TZZA 2DCLA 2G8IA 2MKYA 1Q9XA 4EO8A 4JI8K 5EOYA 3H5YA 2MXYA 1S6PB 5GMKa 3T5KA 3VQBA 2Z56B 4FJNA 1FRXA 2MQMA 2OFGX 5FDLA 1JCFA 3EE3A 3L3CA 2HKEA 3PDNA 3SCLE 4LRAA 3VVUA 1O13A 2KZMA 4FWLA 1SKUB 4MFBA 4CZJA 3OYIA 4YY3K 2RQ4A 1TKDA 3DC2A 3VA3A 4DL5A 4M3UA 3U9ZA 2P9LB 1RDWX 3LDQA 2WFBA 3BP8A 2ZDPA 4WF9L 3LL3A 3NAEA 3KTQA 2LU2A 2YKNA 3THXB 2F4VJ 1CEZA 1WHXA 3CMAN 2DRAA 5KT7A 1BD6A 3BREA 2DNNA 1H7WA 4LUBA 1NK7A 1RGVA 1OH6A 2J6TA 5THWA 5FRNA 1PJ7A 1C6VA 2JX2A 3A5NC 1GMWA 2P1JA 3KHLA 3SUQA 3NF7A 5E41A