4WCEL

The crystal structure of the large ribosomal subunit of staphylococcus aureus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
110
structure length
110
Chain Sequence
MISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKGVTLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYLYHGRVKALAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S rRNA
publication title Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
pubmed doi rcsb
total genus 20
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4wceL01
3CC4N 1KQSM 5GAHP 5HL7L 1VQNN 3DLLL 1M1KO 1VQ8N 1QVGM 3G4SN 4IO9L 1VQ7N 3CXCM 3PIPL 1K8AO 1ILYA 5JVGL 3CMAN 4IOCL 1VQKN 1NJIO 1Q82O 1VQ9N 3CCMN 5GAEP 1M90O 3CMEN 4WFBL 1YITN 1YJ9N 1VQON 1Q81O 1Q7YO 4UY8O 3CD6N 2OTJN 4U67L 3G6EN 1YJWN 3CCUN 1S72N 2ZJPL 1VQ4N 1VQLN 5GADP 4WCEL 2ZJRL 3CCVN 1KC8O 1YHQN 5GAGP 2OTLN 4WF9L 4WFNL 3CCRN 1YI2N 3J7ZO 1Q86O 3CCJN 1KD1O 1VQ5N 3CF5L 1OVYA 3CCEN 1K73O 5DM7L 3I56N 1QVFM 5JVHL 3CCQN 3G71N 1JJ2M 3CC2N 5MLCQ 4WFAL 3OW2M 2QA4N 1W2BM 1VQ6N 3CCSN 2ZJQL 5DM6L 3PIOL 1VQMN 1YIJN 4IOAL 1K9MO 3CC7N 1YJNN 3CCLN 3CPWM 1VQPN 1N8RO 2QEXN 3I55N 5H1SQ
chains in the Genus database with same CATH superfamily
3R3LA 4JS5A 5EOYA 1SQKA 2ATQA 3VEYA 4BQZA 3HP6A 4FJIA 3UIQA 1OH5A 3V9SA 1NG9A 5CE3A 3L2UA 3M1FA 3I0SA 4IKFA 1P8ZA 1OKJA 5KQ8A 1V4SA 4DTMA 2YHYA 4B3OA 4LD0A 3CMAN 3LALA 5DMRA 1WSFA 3MX5A 3E1YA 2F9TA 2YNHA 3U9ZA 3C95A 3CMEN 3OJSA 5FPMA 5HRSA 1BA1A 2O4GA 3K59A 1VHXA 2CH6A 4CF9A 2YHBA 4PY5A 2OTJN 1ASWA 3VQBA 4F9OA 3QIPA 4WCEL 2Z1IA 1WB9A 3SZ2A 2Z1JA 3VQ4A 2GX9A 3DLEA 4KBOA 1LCUA 4CEBA 3DMJA 3VTIA 5J2MA 2OPRA 2IIRA 4O8UA 2FC0A 4B1VA 3OYNA 4YORA 3IUCA 3HOTA 3DYAA 5E84A 3QB0A 1ATRA 4DTJA 4E19A 2VCPA 3L0QA 4B9QA 5CYQA 3IRXA 3MN9A 4YOXA 4HWIA 4DFKA 1UAXA 4I7FA 3P1GA 3CQXA 3TAMA 2ITGA 3CJAA 1XHXA 2A41A 2HB5A 3C6AA 5FROA 3SQ0A 3CHWA 3QEPA 2NRWA 3ZT2A 3RRHA 4DTPA 3GBTA 2YNFA 3SJJA 4MLEA 5AQLA 1RT7A 4LF5K 3ZEUB 3HI0A 5HBMA 2JGUA 3GE1A 4CIFA 3OYIA 1YIJN 2OPPA 1ATNA 4M7XA 3VF2A 1BDGA 2PYLA 1J5OA 2P5OA 3CQYA 1UWBA 3C7NB 2QWRA 1C0MA 4DQSA 2AJQA 2IC3A 2CGJA 5BR9A 2D0PA 5HROA 1Z6RA 3M6GA 4DQPA 5F1XA 3NBPA 3WNEA 4N56A 4Y1DA 4ZTFA 4I6MB 3ULEA 3AO5A 3B6PA 2HNDA 4B3SK 4KH4A 2GWJA 5AQSA 4R79A 2QWQA 3BUZB 2WUSA 4AH9A 2Y1IA 1DLOA 1FKOA 1O1WA 3TAQA 2NNWA 1YVNA 5EU7A 2ASPA 3KVGA 4BACA 4FXDA 4FVMA 1TAQA 3K57A 4AF1A 5AQOA 2GTDA 1O13A 4FWRA 5CZ2A 1VQ4N 4B9TA 4B9SA 3G0ZA 1JCEA 4KI4A 1RBUA 3MN5A 3L2WA 3DAWA 1NGFA 3HTVA 4CVNE 1BIUA 3OVNA 3ZSRA 5JLHA 3BDPA 3CJ1A 1EWRA 2Y1JA 3J8AA 5BN9A 5AQXA 4DV0K 3CETA 3OS1A 1HNIA 2DPNA 2P9KB 2NRXA 3I8BA 4NCGA 4FLYA 1WN7A 1RBTA 1ZBHA 5ADXA 3MXJA 4CECA 4IOXA 3KWGA 1A5WA 2HF4A 1LWCA 2HF3A 2O8FB 3THWA 3UKUB 3HVTA 4OKJA 5TKWA 3CC2N 4JNEA 1HYSA 4OPHA 4DSFA 3K5OA 4B1UB 3CJ7A 4FW1A 1VSLA 1TAUA 4HTLA 2YNGA 3H3NO 4KKOA 4Y0WA 2E6MA 5E41A 4GW6A 3LWMA 4B9VA 3SJHA 4M7YA 3BZKA 3JSMA 4BRLA 1RDBA 3CCLN 4UQGA 1N8RO 4X66K 4FLZA 2R7YA 3G10A 2KW4A 3SBGA 4JRQA 3SUPA 1TL1A 1EX4A 2QI2A 3OBYA 4DFJA 4J2BA 2EHGA 3PO5A 1JLFA 4RW6A 1RDDA 1ZBSA 5AR0A 4CF1A 3PSFA 2YKNA 4H5RA 4XEIA 4BC5A 1ILYA 4H5NA 3F5TA 5J1EA 4CD3A 2HBJA 3D6RA 5I42A 3EN9A 4DV3K 1A5XA 4ELVA 3BF3A 4KHSA 2VG5A 1CZBA 4C8MA 3MK6A 4CERA 1RCHA 3WEEB 1Q81O 2O8BB 1X9JA 4BC2A 4C23A 1ZBIA 4U67L 4C8KA 1S72N 4FJXA 1JLEA 4CE9A 5BRHA 5GADP 3LDNA 2VGNA 1LW2A 3VQ6A 5HRPA 3DLBA 1ITGA 4DV5K 3C7NA 5C12A 3KK3A 3LDQA 1QTMA 3AO4A 2YKMA 2KLAA 1S1WA 3KTQA 4DCHA 4N41A 1CXUA 4I6MA 1RT5A 3QFPA 3RMDA 2B6AA 4BC4A 3QEWA 4KH5A 2BGGA 3U3GA 3HZ6A 5C25A 4JAXA 3MN6A 3C94A 1NOZA 3HRGA 4J2EA 4ELUA 4A5BA 1BCMA 5KPZA 2V52B 4RW7A 2ZGZA 4V19S 1XHZA 2HVIA 1W0HA 2RF2A 3H1QA 4LF8K 1CZAN 1OVQA 1TKZA 1D8YA 1XNQK 4X65K 3ZT3A 4IO8A 3OYGA 4FK2A 1VSIA 5AQMA 3ZETA 3V9UA 4HVJA 1JLAA 5J2NA 3MAQA 4FPBA 3ZX3A 5TKYA 3E01A 2V7ZA 2YJFA 1NKEA 2VWBA 4NLBA 3L4QA 3S41A 1BOTO 1QZ5A 1VSEA 1VQNN 3V9XA 4X62K 4WQ4A 1X9WA 4A57A 3CM5A 1E3MA 1RFQA 3VMFB 1K8AO 4BRMA 4KHWA 4DLEA 2O8FA 1LV5A 3HM8A 1TK8A 3VF4A 1QZ6A 4DFMA 1M90O 3TWHA 3SK3A 3P5JA 3QO9A 1VRUA 1U2VB 4FJGA 3FR0A 4JKHA 3SAHA 3AVAA 4DTRA 4AHCA 2A3ZA 4OKKA 3L8BA 1NJZA 3DRSA 1ASVA 3NF9A 4HCCA 2OYQA 4KREA 4O5BA 4J8FA 5BPNA 1K8KA 4ICLA 4BR9A 4M45A 4E7HA 3KKRA 4A2AA 3SQ4A 4JHDB 3M8RA 4E0DA 1WBDA 4O55A 3L6QA 3R1XA 5GIOA 2KFZA 2PFUA 3ENBA 1L5UA 3CCRN 1YI2N 1Z26A 1BA0A 1Q86O 4JKBA 3LAKA 1WBBA 3IG1A 4BE1A 3DI6A 4F3OA 2HHSA 2VWJA 2RE2A 2P1JA 3K9JA 1NK8A 4YOUA 4DV2K 1KAYA 2YHWA 1B9FA 3VGLA 1KXPA 4AHSA 3WNFA 3ZX0A 4RW9A 1OH7A 4FJNA 1ZBUA 3WEEA 4OPJA 3FLCO 3HL8A 5J2QA 1S3XA 5JMVA 4Z4GA 3VTHA 4WE1A 3PIOL 1N5YA 5FPNA 4KHUA 4CJQA 4FJJA 3VF6A 4CZGA 2X74A 3PSIA 1XC9A 2X6NA 4DQRA 3KZBA 1G99A 4G1QA 4Q5VA 4XH1A 3RVCA 4CEQA 4CFBA 2B5JA 1BI4B 2P9IB 3V1QA 2P9UB 4A61A 3KK7A 2NRRA 4BDZA 1NGCA 4CHZA 3TSUA 4DQQA 4ISEA 4E1JA 1QVGM 2GWKA 1S6PA 4KI6A 2ZD1A 4I9LA 2OZSA 4O0JA 3MCPA 4H0OA 4IFVA 1JKHA 3J81O 2D0OA 3MDQA 1NK6A 2O8CB 4K41A 3PUFA 1GOCA 3DXMB 1NJIO 3WXKA 1WAFA 4A62A 2RN2A 2HBLA 4FWOA 4JI3K 1KVBA 4CZIA 4KPYA 4W5NA 4FPAA 2Q36A 2E88A 4CEOA 4DU4A 3FE1A 4BRKA 3EYZA 1U04A 1Q7YO 4E1MA 2FBYA 3EKSA 5BREA 2ZF5O 4DSIA 4JI0K 1C0UA 1YT3A 2ZJPL 3AVFA 4M3UA 4YY3K 1NU0A 4JLHA 2WBNA 3AGKA 4CJ5A 5GAGP 4B9LA 5KTQA 4DR1K 3RSEA 4M3YA 5AQYA 4C1NI 3O9QA 3L4IA 5C0YA 2VGMA 1D9DA 3MMVA 3TAPA 3KLIA 4IFEA 1S9EA 2B4JA 3EE8A 4DU3A 2E2OA 1S1VA 4DR6K 4YDUC 1BQNA 1KTQA 4B8CA 1RDUA 1ZC6A 3LPUA 3TAFA 3S9HA 3CCEN 1RDWX 3CERA 3DM2A 5FRNA 2D4WA 4PA1A 3SUQA 4DSKA 2QTDA 3R6MA 3S3MA 1RDAA 1NOYA 2QWOA 3CIPA 1U2VA 1T7PA 4CJSA 5HRRA 4AHTA 5JS1A 1DKGD 3T1AA 4DLGA 3DOLA 1L3SA 1NMDA 4B08A 3HPOA 2GV9A 4CIEA 1IKYA 4DB3A 4FJ8A 4FLVA 1GLDG 3TARA 3O9UA 3KHYA 4JHDA 3CPWM 4W5OA 4DR4K 2P9NB 4QS9A 4CF2A 3O3GA 2BDPA 4CK2A 4YOYA 2GUPA 1JLQA 3V81A 4EHUA 2BTFA 1UOCA 4KTQA 4AHUA 3WXJA 4KHPK 1GLBG 5BPMA 2IVOA 1M1KO 3KK1A 4MQ3A 4LF7K 4K25A 1VQ7N 1QHTA 2KFNA 3V9ZA 3DLHA 3AVNA 3TSPA 1SS6A 4ID1A 1SKRA 2E2NA 4OLAA 1HLUA 1HPZA 4CESA 1G15A 4CHQA 4WFBL 3CFOA 3HK2A 2A40A 4UY8O 4FK4A 3DOKA 4NXNK 3O6WA 1KAXA 4DTOA 4FK0A 2JWKA 1BWFO 3WNGA 2IGIA 1X3MA 2XY7A 3BZCA 1KLMA 4JK9A 4PQUA 3ZSXA 3O9TA 4IZ9A 3WNHA 1EKEA 4FCYA 3CI5A 4EHTA 3AA5X 5AQJA 4CJ4A 4E1NA 3EY1A 3T3FA 1NK4A 4DTSA 1TL3A 1NGIA 5B8HA 4KHQA 3O4NA 1NJXA 4EP5A 3CCJN 4JI2K 3CQ8A 4F8RA 3VETA 1XWLA 2G8HA 4DMNA 4J2AA 1S22A 4PL8A 1DT9A 2YI1A 2NUBA 4C8NA 5DM7L 1UA0A 4N5SA 5AFUA 3GDQA 4JRPA 2YNIA 3QNNA 3TI0A 5AZJB 2HW3A 3G71N 1GLLO 5BN8A 5MLCQ 4PKIA 1QQNA 3E9OA 1J6ZA 1TK0A 1VQMN 3SI6A 3O5BA 4YNQA 1LWEA 2QKBA 3O1BA 4EZ6A 5AQNA 3ENOA 1TYQB 1FW6A 3C6UA 4LFAK 4LFBK 3M8PA 4H03B 3SUNA 2HNZA 3D2EB 4N76A 2E20A 3KLFA 1TUUA 4NYNA 5GAHP 4CJVA 1NGAA 3ZT4A 5KRTA 3NAEA 4BVOA 5KRSA 3T69A 4HUEA 3HOSA 3VQDA 1VSFA 2P9PA 4HHTA 1W7AA 4E7KA 4Z4FA 3AVIA 1VSDA 1SKWA 2F96A 2D5RA 1RNHA 3VA3A 3SCXA 3ZT1A 4H0VB 3O4QA 4OPKA 5HOOA 1VQ9N 1XC3A 4H0TB 4FJ7A 3CYMA 3B6OA 1QQMA 3OHRA 4IJNA 5AQWA 4CJFA 5C2FA 1NGEA 3AA4A 1RILA 4XIUA 1D9FA 4H4OA 1D5AA 3EE9A 4FZYA 4ZTJA 4DV4K 1BHLA 4B9MA 3NMUA 1U48A 4CF8A 3HPGA 1YVUA 1DTQA 2CH5A 4DR7K 3MCAB 4Z4EA 2P9NA 5KPTA 3P38A 2PY5A 5CHIA 3VERA 4DR3K 2O8EB 4G9ZA 4BRAA 3I0RA 1ESVA 5FLXO 4Z0UA 1HNVA 2HHQA 1Q9YA 3RMBA 1ASUA 2WOMA 4JKFA 4FLTA 3K0SA 1B92A 1KD1O 4M42A 1IV0A 1NNEA 2D1KA 4B1XB 5AJ3K 4GMJB 1RTHA 4CEFA 4DV7K 1TKTA 3UKRB 2QWMA 4FLUA 1MA9B 4FJ9A 3TAEA 4AM7A 4JI6K 4IDKA 2EWSA 3V4IA 1W2BM 1TGOA 3AVGA 4CGGA 2QWNA 3M5RA 3KD1E 2A1SA 1QSLA 5C42A 4GVEA 3HYFA 3OYEA 3THYB 3CC7N 3T7ZA 3CFPA 3FZLA 1LW0A 1H1VA 5H1SQ 3AA3A 3NGIA 2XY8A 4WQ5A 3CC4N 3VQCA 4LH5A 4Y1CA 4CJWA 1RTIA 4O0IA 4FOEA 3TTCA 3T1HK 1TK5A 1JLCA 4RWTA 3C65A 4DKWA 1SL0A 4BGAA 4LSLA 3N4QA 1U6ZA 3RMCA 1N36K 3QICA 3J7AP 4BGBA 2QWLA 5BPLA 1BUPA 1Q82O 4DTNA 2IDOA 2O4IA 1WSEA 2Q31A 3H45C 4BRNA 2A1RA 3MWPA 3AO1A 4PUOA 1VRTA 1T6DA 1S5JA 1QS4A 4JYAK 1C0GA 1YF5L 2ZJRL 1Q18A 4CZEA 4JD2B 3E9LA 2AA4A 1VAZA 3NH2A 3A0IX 4PKGA 3CJ9A 3J7YP 1BG3A 2P9SB 3NFAA 4FWPA 1DEJA 3TTDA 5AQKA 3VEZA 5DK5A 1S6QA 1RT2A 4EAHD 4LF4K 1BU6O 4FSVA 3HO1A 3ZEUA 4I2QA 3OYBA 4JV5K 4NCAA 4B1WB 4IBNA 3WQUA 2QXFA 1GOBA 3P83D 1DTTA 4ISGA 3P39A 4NXMK 3KLEA 3CJCA 4Z4HA 5FPDA 4FYDA 4QS7A 4M63C 1X3NA 3DJCA 2UXBK 1IO2A 2KZMA 4OPAA 4FLXA 5LMNK 2P5GA 1HQUA 2A5XA 3AO3A 3MEGA 1MDUB 3IMXA 1SV5A 2E5LK 4ZHRA 3OYHA 4GY2B 3QDKA 3DLRA 2E6LA 2YX6A 4NO7A 1HNXK 3IS9A 1L3VA 3MX2A 4BWJA 3QEXA 3OYJA 3U4LA 3A2FA 2O8EA 4CGJA 2F8SA 2NRTA 3MEEA 1WNSA 1C6VA 1ZYQA 1WAJA 3VEVA 3LP1A 5HP1A 4H0XB 3S3OA 1HQEA 4PKHA 2WONA 2W6KA 4FM2A 4YOVA 2FF6A 4M3XA 5C15A 4RW4A 3OJUA 4Z4IA 5EX5A 3VPZA 3KWIA 4BRQA 4LC9B 3UKRA 1C0TA 4OX9K 4JKGB 5AZIB 1S9GA 1W9HA 1X9SA 4CJ7A 1T3VA 3ZT0A 2KQ2A 1WSHA 4ELTA 3ZSVA 5AQFA 4OLBA 3AGRA 1KFDA 3TR8A 2P9KA 2ASMA 2E8AA 4C8OA 1FXXA 4OVLA 4FJLA 3DXKB 3LM9A 1VSKA 4K8XA 4NLCA 3T19A 5FPEA 3UKUA 4PL7A 1Y97A 3UE5A 3ZSWA 4DUYK 3O9SA 3LDLA 5SWMA 4DSEA 5SZTA 1MU2A 4BRGA 3NGZA 3AVLA 5KPRA 2E1YA 3J7ZO 3B8AX 3D45A 1NM1A 5AQTA 4CBUA 4BR0A 1OH8A 3JAMO 1LOTB 3TTFA 3U3YA 2FLOA 4NYFA 3LAMA 3M3ZA 5C10A 2HNYA 1UA1A 1I94K 2WC9A 3F9MA 3DLKA 4ISFA 4IEEA 4FWKA 2YV0X 1C1CA 2PBDA 3WXLA 1RBSA 5EVZA 1XMOK 4MDAA 2NZTA 2ITMA 1L3TA 4FJMA 1WSGA 3E66A 1IG9A 4HUFA 4F4KA 5GINA 3SQ2A 1IKWA 2P9LB 4DF8A 1RT6A 2O8BA 3DLLL 4B1YB 4BROA 2ETJA 3G4SN 4F3TA 3LDPA 2RHKA 4CF0A 3CXCM 3QETA 3TABA 5JVGL 1C1AA 3ID8A 3HT3A 3VA0A 4LH4A 4B3RK 4FLWA 2QKKA 3VEXA 3CJBA 3VQ8A 4PHTX 5LMUK 4E7IA 4BQLA 5M1NA 4CIGA 3HVRA 3CD6N 1X1PA 3TSQA 3QBXA 1CZ9A 3N4PA 3VGMA 1GOAA 5LY3A 1R59O 1YJWN 4IWVA 2XY6A 4CGDA 4EIAA 3W0LA 3SQ1A 1TVRA 1KC8O 4CBWA 3PLAA 4CW7B 4WF9L 1RBVA 3KKSA 4H4MA 3A8YA 4FL9A 2WTUA 3MEDA 1A5VA 4CJPA 2UYTA 3A5NC 3O4WA 3MXMA 4IXCA 3U6FA 5C2DA 1BQMA 1U45A 4RW8A 4H5WA 1NLVA 2WFBA 2G8UA 3I56N 4CGHA 2QWPA 1NJYA 2XHBA 5M1PA 4GV6A 4CFCA 4BE2A 5AZIA 2F8TA 3VESA 4DSJA 5HRNA 4WFAL 4BR4A 2UU9K 3AAPA 3AVBA 3MECA 1EXQA 2HHTA 1RT3A 2VQFK 3SMPA 5K14A 3VEOA 4IOAL 3MWTA 3AO2A 5D3GA 1VQPN 1IG8A 4B1ZA 4CZJA 1R0AA 2JWLA 2NRZA 2E2PA 3NH1A 3M8SA 1QSYA 3FZFA 4JI8K 2H3GX 1IKXA 3A5LC 2ZQBA 1HJOA 4BRPA 5I3UA 1E4FT 3QERA 4IO9L 1N6QA 3ENHA 5AQPA 1HYZA 2HBKA 1BISA 2D0BA 5JICA 4AQYK 3FZKA 3O08A 1VQKN 3VN5A 1JCGA 3NF8A 1RT1A 2DY4A 4WYBA 3CCMN 2YCHA 3TANA 2UUAK 3IDHA 4JEPA 3C6TA 1YJ9N 1N33K 4TSXA 4BRIA 1BIZA 1X9MA 1YAGA 2V7YA 3L3UA 4KTZA 3OY9A 3PX4A 2GUIA 4JI7K 4DS4A 4DV1K 4KB1A 3SPYA 4JI4K 3BP8A 2FSKA 3PX0A 1T03A 2IS3A 4EFHA 5CZ1A 1J9AA 1TUYA 1S1UA 3NCIA 3LP3A 5AQQA 4K43A 1HNWK 2UXDK 3L2VA 1IH7A 1T8EA 4WFNL 3LANA 4ID5A 4JK8A 3L2RA 4B8AB 2HVHA 2RKIA 4BR2A 5KQDA 3V6DA 3ATUA 3HSCA 1VQ5N 3AVMA 3R8EA 4FW2A 3OYLA 4OO1J 3FFIA 4I9QA 1E4GT 1VK0A 4CJKA 3UB5A 3FZHA 4KO0A 2OZMA 3QLHA 1HJRA 4CGFA 1Q8IA 1HKBA 3BF1A 3NF7A 1BI4A 3CCQN 2P9IA 1NKBA 1JJ2M 2P9UA 4BG9A 4K42A 4BVPA 4FJ5A 3I8DA 4HUGA 4CK3A 1P90A 2ZJQL 1QHAA 3D2FB 4DFPA 4FOIA 4IG0A 3TU5A 3ATVA 4AILC 4M3RA 1KFSA 3WQTA 1NK5A 2W6LA 3D7EO 3THWB 2O8CA 1QSSA 2I7PA 3DXMA 3U9DA 3O8MA 4NCBA 2OPSA 3OS2A 4CHYA 1J54A 4L8RB 3AA2A 3Q7CA 4LF6K 1HR0K 1KQSM 4CHNA 1SL1A 4MLHA 3MXIA 5HL7L 2O8DB 1J5EK 1SUQA 2F9WA 1LWFA 1VQ8N 3AVHA 1EETA 3HBTA 4X64K 4CJTA 1FK9A 2UUCK 3LP0A 4CZHA 4AM6A 4MFBA 4ILHA 2W41A 2F4VK 3LM2A 4BR7A 4A2BA 1EWQA 2XRIA 5A2QO 1L3UA 4DV6K 5AFUH 2W40A 5JS2A 4KAZA 3RTVA 2CGLA 3VQQA 3HPHA 4IDHA 3O80A 3OYCA 2YJEA 3ZSYA 1VQLN 4JN4A 3CCVN 1RGIA 3R9PA 3EEQA 4BREA 4J2DA 4JKEA 1EP4A 1KAZA 2BUPA 2BANA 4OGCA 3SYZA 3CG7A 1K6YA 3AVJA 4YHHK 5AQZA 1NWKA 3LDOA 2V51B 1CXQA 4CEAA 2I7NA 3PX6A 2DFHA 4GKKK 2Q97A 3SV3A 2HHVA 4QOZB 5M1KA 5AQRA 1Y64A 4DWIA 1EO1A 2Q0UA 2LSNA 3D0PA 4JKCA 4O44A 3ID6A 5AQHA 2QA4N 4L3QA 3CCSN 1C0FA 3NHGA 4YDUA 2PYJA 3FZMA 1U47A 1NGBA 3KLGA 4WQ4C 4CGIA 3OYAA 2P51A 4DR2K 1SL2A 5BR8K 4A59A 3PY8A 4KRFA 4O8KA 3ITHA 1TKXA 1DGKN 2QEXN 1NKCA 4B9NA 5FRMA 3FGUA 1W97L 1CLQA 4KH6A 3QINA 4CHPA 4RTFD 4LFCK 1F21A 4MDBA 4JKAA 1N32K 3EO3A 4BWMA 4F2RA 4H0YB 2ZM6K 2G8WA 2QM1A 3IAYA 3H1VX 3L3VA 4KFBA 5LJVA 3ZETB 5BRFA 1ZBLA 2OCEA 3PIPL 2VWKA 3SPZA 4K0KK 2NRVA 3TAGA 2ASOA 4KB0A 2IVNA 2FXUA 2G8VA 1JL2A 4ILJA 3ZSOA 3C6HA 4FVUA 1MWKA 3DWLA 4DR5K 4F2SA 4Q0BA 4CJLA 2NLXA 4HTUA 1KCFA 3ZX2A 2HHUA 2HHXA 5J2PA 3D2FA 2D0AA 3G6EN 4RG8A 3VQ9A 1NK7A 4LY7A 3LZJA 2OPQA 3F2KA 2D0CA 3IFRA 2VG6A 1I3AA 3ZYYX 3DRPA 4W5TA 1NK0A 1RBRA 1XNRK 4BC3A 3OS0A 1RT4A 4BRHA 2HHHK 5ADXH 5AZJA 3HXMA 4FWNA 3OYFA 3JYTA 5CYMA 2O8DA 4O5FA 1IBLK 1XUPO 3A5OC 2HMIA 4DF4A 4CK1A 2QK9A 4GNIA 4CJUA 3KD5E 5T7BA 1K8KB 2UXCK 1K73O 1T6CA 2JLEA 4DS5A 1WUAA 3V1RA 1TYQA 4CZMA 1WLJA 1NGJA 5KI6A 2HHWA 3D2EA 4BR5A 3K9KA 4DTUA 3H08A 4CEEA 4CCHA 4FZXC 1Z25A 1N34K 5DM6L 4IG3A 3AVCA 1JLGA 1IBMK 2KTQA 4BRCA 3ZCMA 4FM0A 1K9MO 4QAGA 5EXWA 5BRDA 2DFFA 1QE1A 1HYVA 4FM1A 1ATSA 2IOCA 2E4LA 3VQEA 4OGEA 3QESA 4BDYA 4CBXA 3VQPA 4FWQA 2KKZA 4H0PA 1XMQK 4BY9C 1JLBA 4BE0A 5M1FA 3J80O 4N47A 4FWSA 3GG4A 4MO4A 5AQVA 3WT0A 4E7LA 2HBMA 1U4BA 4PWDA 1GLFO 4YOWA 1LAVA 2KZZA 5CR4A 3LDSA 3RR8A 2CGKA 2G8IA 1GLCG 4EZ9A 4DQ8A 3HP9A 5F2RA 4BG8A 1TKDA 2G8KA 1J53A 3BGRA 3P31A 3KJVA 4M41A 1EQYA 2Q1NA 2GELA 1Q9XA 4DQIA 4R5PA 4FJKA 2RPIA 4E89A 3KIOA 2ZWHA 2EX3A 3ZLJA 3AARA 4JI1K 4OJRA 5CY4A 1KSPA 3EL2A 3FFKB 4M3ZA 4LF9K 4Z94A 1OH6A 3VENA 4CEZA 3BEXA 1YXQA 3GOIA 3H6EA 3OBWA 4KV8A 1VSMA 2GEMA 3CFRA 4K8ZA 1GLAG 3P4IA 1LAWA 3NF6A 1IBKK 5FDLA 1MWMA 5IWAK 4DTXA 3THXB 3VQ7A 1B9DA 4BRFA 3SV4A 4GKJK 3SUOA 2OANA 2QW9A 4FWMA 3ISNC 3CF5L 1YTUA 4JS4A 1OVYA 2NRHA 5AQIA 3THYA 3VQ5A 4M3TA 3ASMA 1KLNA 2E1ZA 1WOQA 3SAFA 3PO4A 1WSIA 4FZZA 5AQGA 3JS6A 3RSEB 5LL6Z 4CJRA 5GIPA 1GLJO 2IAJA 5AQUA 1QQCA 1VSHA 1KVAA 1BO5O 3QMLA 4E7JA 1VQ6N 3O3HA 1NGHA 3QNOA 3DLGA 1SKSA 4IJAA 4CJ3A 3LL3A 3L2QA 4NB4A 4DU1A 4GVMA 2HMPA 3F73A 2DTUA 3WUHA 3EZWA 4W5QA 1QQOA 3OYMA 4DSLA 1YJNN 3QBWA 1KRPA 4KHYA 4KHNA 3EKUA 4C1NK 3E9PA 5IT9O 3SAGA 4MO5A 4CZFA 3WXIA 4DG1A 3QFUA 2PAVA 3LWLA 2FF3B 1NJWA 4YFUA 5JLFA 1I39A 1BCOA 5ELZA 2AP1A 1IJJA 5EY4A 4Z4CA 3ZSQA 4H5VA 2A6AA 3OYDA 3K5LA 3G25A 3OA9A 4B9UA 4GV9A 1REVA 3F9KA 2X78A 4IFYA 4GV3A 4HCBA 4BRDA 3C0BA 1YTAA 4JD2A 1BGXT 4CJEA 5KGXA 1JXEA 4O4GA 1XQSC 5GAEP 3NGYA 4H8KA 2FSNA 1YITN 2F7TA 2P9SA 1GLEG 2ZGYA 4LSNA 3A5MC 3IKMA 2E2QA 4DHYA 4DUZK 1ZXOA 3CCUN 1S1XA 4B3TK 3I33A 3ULDA 3SLCA 3K58A 3NDKA 2YHAA 3BY5A 4I2PA 3K5NA 4QS8A 4FJHA 2G8FA 5M1QA 3GL1A 3SBTA 3NVMA 5C24A 1HKCA 3HM9A 5HLFA 1RTDA 1HMVA 1FKPA 3VGKA 3KK2A 1V4TA 4ILGB 2GBZA 2VG7A 4CZKA 4B3MK 1HX1A 2QXLA 4A5AA 1FJGK 3OTOK 1VSJA 2HSTA 1S1TA 3K2PA 3W3DA 2OA8A 3QEIA 2VQEK 2W42A 1WSJA 2J4RA 1HNZK 1IKVA 4OKEA 3O1WA 5JVHL 3LP2A 3THVA 4JK7A 3RR7A 5I9EB 4H5TA 4XH4A 2HOEA 1KVCA 1D4XA 1SZ2A 3OW2M 3HSTB 4AHRA 3CM6A 3RRGA 1JCFA 3PV8A 2DFEA 2KHOA 2IVPA 4C8LA 4U7BA 4QCLA 3SMSA 3NE6A 2XY5A 4M3WA 1NGGA 4CZLA 3AV9A 1JXBA 3H46O 3LPTA 5F0XA 4JKGA 1HPMA 3T1YK 2FBXA 3CPEA 5LJWA 2Q0RA 3AVKA 3THXA 2A42A 5M1OA 4RCHA 4XH5A 1NMNA 1RTJA 2VYPA 2Z1HA 3HJFA 2Q3SA 3DXKA 4JI5K 2Q2RA 4CEDA 4IOCL 1HRHA 3QIOA 1NGDA 3U8XA 3NH0A 3EZ5A 3VQAA 2BH1A 4YOTA 3QEVA 3RMAA 3AAQA 1YUWA 1U49A 2UUBK 1VQON 1BL3A 3V9WA 5KGWA 2P9PB 3V1OA 4CHOA 3NVKA 3VEWA 3SNNA 1YHQN 1HUXA 4EP4A 4AHVA 2OTLN 3S3NA 3O9RA 2FSJA 4JKDA 2XO7A 4E3SA 2ZE2A 3ALYA 1NBWA 2YHXA 1SAZA 3ULEB 1JL1A 1RDCA 4IEIA 4FO0A 3KLHA 3TPQA 4CFAA 2I5JA 1QVFM 3K5MA 4FWLA 1Z05A 2FBTA 3OYKA 1ZBFA 1NK9A 2PZSA 3H3OB 3MN7A 3VOVA 2Z1GA 3Q7BA 3AY9A 4WQ5C 3M8QA 3JXUA 3LZIA 1C1BA 3RWUA 1HKGA 3WXMB 2P9LA 3DRRA 3ZSZA 4W5RA 2BE2A 3O3FA 1XI1A 1TV6A 2FBVA 5E26A 4CI6A 4CFDA 4CD1A 4KTWA 2X6SA 1T44A 3I55N 4BDPA 1T05A
chains in the Genus database with same CATH topology
3R3LA 4RTFD 2P9UB 4MDBA 1SQKA 2NRTA 3KK7A 4JKAA 5EOYA 3VEYA 4A61A 4BQZA 3EO3A 2NRRA 1NGCA 4H0YB 3TSUA 5CE3A 3M1FA 3VEVA 2QM1A 4ISEA 4E1JA 1QVGM 2GWKA 4H0XB 1P8ZA 3H1VX 1OKJA 5KQ8A 5LJVA 3ZETB 5BRFA 1V4SA 3PIPL 4PKHA 2YHYA 3MCPA 4H0OA 4YOVA 2FF6A 2NRVA 5C15A 2D0OA 3MDQA 2ASOA 3CMAN 4K41A 2IVNA 2FXUA 3DXMB 5EX5A 3VPZA 4ILJA 3KWIA 1NJIO 4BRQA 4LC9B 3MX5A 3C6HA 3E1YA 2F9TA 3UKRA 3WXKA 4FVUA 1MWKA 3DWLA 4JKGB 3U9ZA 4A62A 4FWOA 2HBLA 5AZIB 3CMEN 4CZIA 4CJ7A 1T3VA 4FPAA 2Q36A 2E88A 2NLXA 5FPMA 3FE1A 4BRKA 1BA1A 1Q7YO 3ZX2A 2CH6A 5AQFA 2OTJN 3EKSA 3AGRA 5BREA 3D2FA 3G6EN 2P9KA 2ZF5O 2ZJPL 4F9OA 2ASMA 2E8AA 3F2KA 4WCEL 3IFRA 3DXKB 3ZYYX 3LM9A 4NLCA 2WBNA 3AGKA 5FPEA 5GAGP 3UKUA 2GX9A 4BC3A 4KBOA 4PL7A 1LCUA 3UE5A 3VTIA 4BRHA 3O9SA 5ADXH 5AZJA 3RSEA 4FWNA 3LDLA 2IIRA 4O8UA 5AQYA 4C1NI 3O9QA 3L4IA 4B1VA 5C0YA 2VGMA 4O5FA 4YORA 3IUCA 4BRGA 3HOTA 1XUPO 3A5OC 3MMVA 5KPRA 4IFEA 2E1YA 3J7ZO 3B8AX 5E84A 1NM1A 3EE8A 1ATRA 3QB0A 2VCPA 5AQTA 3L0QA 4GNIA 4B9QA 2E2OA 4CBUA 4YDUC 1K8KB 3MN9A 4BR0A 1RDUA 4YOXA 1ZC6A 3CCEN 4HWIA 1K73O 1RDWX 1LOTB 1T6CA 3CERA 1WUAA 3TTFA 2FLOA 1TYQA 4CZMA 2D4WA 3CQXA 1NGJA 3CJAA 2QTDA 3D2EA 3R6MA 3M3ZA 2A41A 4BR5A 3K9KA 3C6AA 5C10A 3CHWA 2NRWA 2QWOA 3CIPA 1U2VA 2WC9A 3F9MA 3GBTA 4ISFA 4MLEA 4IEEA 5AQLA 5DM6L 4FWKA 1DKGD 3ZEUB 3HI0A 3GE1A 1YIJN 2PBDA 1NMDA 3WXLA 1ATNA 4M7XA 5EVZA 4BRCA 4MDAA 4DB3A 3VF2A 1BDGA 1K9MO 5EXWA 5BRDA 1GLDG 3CQYA 3O9UA 3KHYA 1ATSA 4JHDA 3CPWM 2NZTA 3C7NB 2ITMA 2QWRA 2P9NB 4QS9A 2CGJA 3E66A 5BR9A 2D0PA 4CBXA 4YOYA 2GUPA 1Z6RA 4FWQA 4EHUA 5GINA 3M6GA 2BTFA 2KKZA 4H0PA 5F1XA 2P9LB 3WXJA 1GLBG 5BPMA 2IVOA 3DLLL 1M1KO 4B1YB 4BY9C 4I6MB 3ULEA 4BROA 3G4SN 5M1FA 3LDPA 4K25A 2RHKA 4KH4A 2GWJA 5AQSA 1VQ7N 4R79A 2QWQA 4FWSA 3CXCM 3GG4A 3BUZB 2WUSA 4MO4A 5AQVA 3WT0A 2HBMA 3TSPA 5JVGL 1SS6A 3ID8A 1GLFO 4YOWA 2E2NA 3VEXA 3CJBA 5CR4A 1HLUA 4PHTX 2CGKA 2NNWA 1YVNA 1GLCG 4WFBL 4BQLA 4DQ8A 5M1NA 5F2RA 2A40A 4BG8A 4UY8O 3CD6N 2ASPA 3KVGA 3P31A 3TSQA 3QBXA 3N4PA 4AF1A 5AQOA 2GTDA 1EQYA 3VGMA 1O13A 2Q1NA 4FWRA 2GELA 5LY3A 3O6WA 1R59O 1KAXA 1YJWN 4IWVA 2JWKA 1VQ4N 4EIAA 1BWFO 4CZFA 2ZWHA 3W0LA 1X3MA 3AARA 1JCEA 1KC8O 4JK9A 3EL2A 3FFKB 3MN5A 4CBWA 3PLAA 3DAWA 4Z94A 1NGFA 3HTVA 3BEXA 3VENA 1YXQA 3O9TA 3GOIA 4IZ9A 4WF9L 3H6EA 3OBWA 3CI5A 4EHTA 5JLHA 5AQJA 2GEMA 3CJ1A 1GLAG 3P4IA 3J8AA 5BN9A 3A8YA 5AQXA 4FL9A 1MWMA 3CETA 1NGIA 5B8HA 2UYTA 3A5NC 3O4WA 2DPNA 4BRFA 2P9KB 3CCJN 2NRXA 3I8BA 4IXCA 3VETA 2OANA 5C2DA 2QW9A 4FWMA 4H5WA 3CF5L 1S22A 5ADXA 1NLVA 1OVYA 2NRHA 4PL8A 1DT9A 2YI1A 3KWGA 4IOXA 5AQIA 2HF4A 2WFBA 5DM7L 2HF3A 3I56N 5AFUA 3GDQA 3UKUB 2QWPA 2E1ZA 1WOQA 3SAFA 4GV6A 5M1PA 5AQGA 3JS6A 5AZJB 3RSEB 5AZIA 3G71N 1GLLO 5TKWA 3VESA 1GLJO 5GIPA 5AQUA 3CC2N 4JNEA 5BN8A 5MLCQ 4WFAL 4OPHA 4PKIA 4B1UB 1BO5O 4BR4A 3AAPA 1QQNA 3CJ7A 3E9OA 3QMLA 1VQ6N 1NGHA 4IJAA 1J6ZA 4HTLA 1VQMN 3O5BA 3LL3A 3H3NO 4Y0WA 4NB4A 3SMPA 2HMPA 3O1BA 3SJHA 3VEOA 3WUHA 4IOAL 3EZWA 4M7YA 1QQOA 5AQNA 3MWTA 3ENOA 4BRLA 1YJNN 3QBWA 1TYQB 3CCLN 1VQPN 1N8RO 1IG8A 3EKUA 4B1ZA 4C1NK 3E9PA 4H03B 4CZJA 3D2EB 3SAGA 2E20A 2JWLA 2NRZA 4MO5A 3SBGA 3OBYA 3QFUA 2QI2A 2PAVA 3WXIA 2E2PA 2FF3B 1TUUA 5GAHP 1NGAA 5JLFA 3FZFA 4BVOA 5ELZA 2AP1A 2H3GX 1ZBSA 3T69A 1IJJA 5EY4A 3HOSA 3A5LC 2P9PA 1HJOA 5AR0A 4BRPA 1E4FT 4H5VA 2A6AA 4IO9L 3ENHA 2HBKA 3G25A 3OA9A 5AQPA 4H5RA 4GV9A 4XEIA 4BC5A 4GV3A 4BRDA 1ILYA 3C0BA 3F5TA 4H5NA 4JD2A 5JICA 3FZKA 3O08A 4CD3A 4H0VB 1VQKN 2HBJA 1JCGA 3D6RA 3EN9A 4WYBA 5HOOA 3CCMN 1VQ9N 2YCHA 3BF3A 1XC3A 1XQSC 4H0TB 5GAEP 1QQMA 2FSNA 3IDHA 3OHRA 4IJNA 4JEPA 2F7TA 5AQWA 5C2FA 1YITN 1NGEA 2P9SA 3MK6A 1YJ9N 1GLEG 2ZGYA 4BRIA 3WEEB 1Q81O 3A5MC 1X9JA 3EE9A 3IKMA 1YAGA 4BC2A 4C23A 2V7YA 2E2QA 4U67L 4DHYA 1ZXOA 3CCUN 1S72N 3I33A 3NMUA 5BRHA 3SLCA 5GADP 3LDNA 3BP8A 2FSKA 2VGNA 2CH5A 4EFHA 4QS8A 3C7NA 1TUYA 3MCAB 5C12A 2P9NA 5KPTA 3P38A 5AQQA 4K43A 3LDQA 3GL1A 5M1QA 3NVMA 3SBTA 5CHIA 3VERA 4WFNL 1HKCA 4G9ZA 4BRAA 2KLAA 1ESVA 4JK8A 3VGKA 1V4TA 4DCHA 4ILGB 4BR2A 4I6MA 5KQDA 3QFPA 4CZKA 1HX1A 4JKFA 3ATUA 4BC4A 3HSCA 2QXLA 4A5AA 1KD1O 1VQ5N 4KH5A 3R8EA 2HSTA 3HZ6A 4JAXA 3MN6A 3W3DA 4OO1J 2D1KA 4B1XB 3HRGA 1E4GT 3UB5A 2J4RA 3FZHA 4A5BA 5KPZA 2V52B 3O1WA 3UKRB 5JVHL 2QWMA 2ZGZA 1MA9B 1HKBA 3BF1A 4JK7A 3CCQN 2P9IA 4H5TA 5I9EB 1JJ2M 4XH4A 4AM7A 2HOEA 2P9UA 2EWSA 3H1QA 1D4XA 1CZAN 1SZ2A 4BG9A 3OW2M 4K42A 4BVPA 1W2BM 1P90A 2ZJQL 1JCFA 1QHAA 2QWNA 3D2FB 2KHOA 2IVPA 3M5RA 4IO8A 4FOIA 3TU5A 3ATVA 4GVEA 5AQMA 3ZETA 4U7BA 3SMSA 3WQTA 3T7ZA 3CC7N 3FZLA 4FPBA 3D7EO 1NGGA 3ZX3A 5TKYA 1H1VA 4CZLA 2I7PA 3DXMA 3U9DA 2V7ZA 2YJFA 3O8MA 5H1SQ 2VWBA 4NLBA 3L4QA 3Q7CA 4WQ5A 3H46O 3S41A 5F0XA 3CC4N 4JKGA 1KQSM 4MLHA 1BOTO 1HPMA 4FOEA 3TTCA 5HL7L 3CPEA 1QZ5A 5LJWA 2Q0RA 4RWTA 3C65A 4DKWA 2F9WA 1VQNN 2A42A 4BGAA 1VQ8N 5M1OA 4RCHA 3N4QA 1U6ZA 4WQ4A 4XH5A 4A57A 3HBTA 3QICA 2VYPA 1RFQA 3VMFB 4BGBA 1K8AO 3DXKA 4BRMA 2Q2RA 4CZHA 4AM6A 4IOCL 2QWLA 5BPLA 1BUPA 3HM8A 4ILHA 2W41A 1Q82O 1NGDA 3LM2A 3U8XA 3VF4A 1QZ6A 2Q31A 4A2BA 4BR7A 1M90O 2BH1A 4YOTA 3H45C 3SK3A 4BRNA 3AAQA 1YUWA 3MWPA 5AFUH 2W40A 1VQON 1U2VB 3FR0A 4JKHA 3SAHA 2P9PB 1T6DA 2CGLA 2A3ZA 3NVKA 3VEWA 4IDHA 3O80A 4J8FA 2YJEA 5BPNA 1VQLN 1K8KA 4JN4A 4BR9A 1C0GA 1YF5L 2ZJRL 1Q18A 4CZEA 4JD2B 3CCVN 1YHQN 1HUXA 1RGIA 3R9PA 3E9LA 2AA4A 1VAZA 4A2AA 4JHDB 4BREA 2OTLN 4JKEA 3A0IX 4PKGA 3CJ9A 1KAZA 3O9RA 2BUPA 3L6QA 1BG3A 3R1XA 5GIOA 2P9SB 2PFUA 2FSJA 4FWPA 3ENBA 1DEJA 4JKDA 5AQZA 1NWKA 3TTDA 3CCRN 3LDOA 1YI2N 2V51B 5AQKA 3VEZA 1BA0A 1NBWA 2YHXA 1SAZA 3ULEB 4EAHD 4JKBA 2I7NA 1Q86O 1BU6O 4FSVA 3ZEUA 4B1WB 2RE2A 2Q97A 3K9JA 4YOUA 4IEIA 3WQUA 4FO0A 3TPQA 5M1KA 5AQRA 4ISGA 3P39A 1QVFM 4FWLA 1KAYA 2YHWA 1Y64A 3CJCA 1Z05A 3VGLA 5FPDA 4QS7A 4M63C 1KXPA 1X3NA 3H3OB 3MN7A 3DJCA 1EO1A 2Q0UA 3Q7BA 3VOVA 3AY9A 4WQ5C 4JKCA 3ZX0A 4OPAA 3ID6A 3JXUA 3WEEA 5AQHA 3FLCO 2QA4N 1HKGA 3WXMB 1S3XA 2P9LA 4L3QA 5JMVA 3CCSN 1C0FA 3VTHA 2A5XA 3PIOL 4YDUA 5FPNA 1MDUB 3FZMA 3IMXA 1NGBA 3VF6A 4WQ4C 4CZGA 4GY2B 4A59A 4O8KA 3QDKA 5E26A 2YX6A 4NO7A 4CI6A 4CD1A 3KZBA 1DGKN 1G99A 1T44A 2QEXN 3MX2A 4XH1A 3I55N 3RVCA 3U4LA 3FGUA 1W97L 2P9IB 4KH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 N;  1KQS M;  5GAH P;  5HL7 L;  1VQN N;  3DLL L;  1M1K O;  1VQ8 N;  1QVG M;  3G4S N;  4IO9 L;  1VQ7 N;  3CXC M;  3PIP L;  1K8A O;  1ILY A;  5JVG L;  3CMA N;  4IOC L;  1VQK N;  1NJI O;  1Q82 O;  1VQ9 N;  3CCM N;  5GAE P;  1M90 O;  3CME N;  4WFB L;  1YIT N;  1YJ9 N;  1VQO N;  1Q81 O;  1Q7Y O;  4UY8 O;  3CD6 N;  2OTJ N;  4U67 L;  3G6E N;  1YJW N;  3CCU N;  1S72 N;  2ZJP L;  1VQ4 N;  1VQL N;  5GAD P;  4WCE L;  2ZJR L;  3CCV N;  1KC8 O;  1YHQ N;  5GAG P;  2OTL N;  4WF9 L;  4WFN L;  3CCR N;  1YI2 N;  3J7Z O;  1Q86 O;  3CCJ N;  1KD1 O;  1VQ5 N;  3CF5 L;  1OVY A;  3CCE N;  1K73 O;  5DM7 L;  3I56 N;  1QVF M;  5JVH L;  3CCQ N;  3G71 N;  1JJ2 M;  3CC2 N;  5MLC Q;  4WFA L;  3OW2 M;  2QA4 N;  1W2B M;  1VQ6 N;  3CCS N;  2ZJQ L;  5DM6 L;  3PIO L;  1VQM N;  1YIJ N;  4IOA L;  1K9M O;  3CC7 N;  1YJN N;  3CCL N;  3CPW M;  1VQP N;  1N8R O;  2QEX N;  3I55 N;  5H1S Q; 
#chains in the Genus database with same CATH topology
 3R3L A;  4JS5 A;  5EOY A;  1SQK A;  2ATQ A;  3VEY A;  4BQZ A;  3HP6 A;  4FJI A;  3UIQ A;  1OH5 A;  3V9S A;  1NG9 A;  5CE3 A;  3L2U A;  3M1F A;  3I0S A;  4IKF A;  1P8Z A;  1OKJ A;  5KQ8 A;  1V4S A;  4DTM A;  2YHY A;  4B3O A;  4LD0 A;  3CMA N;  3LAL A;  5DMR A;  1WSF A;  3MX5 A;  3E1Y A;  2F9T A;  2YNH A;  3U9Z A;  3C95 A;  3CME N;  3OJS A;  5FPM A;  5HRS A;  1BA1 A;  2O4G A;  3K59 A;  1VHX A;  2CH6 A;  4CF9 A;  2YHB A;  4PY5 A;  2OTJ N;  1ASW A;  3VQB A;  4F9O A;  3QIP A;  4WCE L;  2Z1I A;  1WB9 A;  3SZ2 A;  2Z1J A;  3VQ4 A;  2GX9 A;  3DLE A;  4KBO A;  1LCU A;  4CEB A;  3DMJ A;  3VTI A;  5J2M A;  2OPR A;  2IIR A;  4O8U A;  2FC0 A;  4B1V A;  3OYN A;  4YOR A;  3IUC A;  3HOT A;  3DYA A;  5E84 A;  3QB0 A;  1ATR A;  4DTJ A;  4E19 A;  2VCP A;  3L0Q A;  4B9Q A;  5CYQ A;  3IRX A;  3MN9 A;  4YOX A;  4HWI A;  4DFK A;  1UAX A;  4I7F A;  3P1G A;  3CQX A;  3TAM A;  2ITG A;  3CJA A;  1XHX A;  2A41 A;  2HB5 A;  3C6A A;  5FRO A;  3SQ0 A;  3CHW A;  3QEP A;  2NRW A;  3ZT2 A;  3RRH A;  4DTP A;  3GBT A;  2YNF A;  3SJJ A;  4MLE A;  5AQL A;  1RT7 A;  4LF5 K;  3ZEU B;  3HI0 A;  5HBM A;  2JGU A;  3GE1 A;  4CIF A;  3OYI A;  1YIJ N;  2OPP A;  1ATN A;  4M7X A;  3VF2 A;  1BDG A;  2PYL A;  1J5O A;  2P5O A;  3CQY A;  1UWB A;  3C7N B;  2QWR A;  1C0M A;  4DQS A;  2AJQ A;  2IC3 A;  2CGJ A;  5BR9 A;  2D0P A;  5HRO A;  1Z6R A;  3M6G A;  4DQP A;  5F1X A;  3NBP A;  3WNE A;  4N56 A;  4Y1D A;  4ZTF A;  4I6M B;  3ULE A;  3AO5 A;  3B6P A;  2HND A;  4B3S K;  4KH4 A;  2GWJ A;  5AQS A;  4R79 A;  2QWQ A;  3BUZ B;  2WUS A;  4AH9 A;  2Y1I A;  1DLO A;  1FKO A;  1O1W A;  3TAQ A;  2NNW A;  1YVN A;  5EU7 A;  2ASP A;  3KVG A;  4BAC A;  4FXD A;  4FVM A;  1TAQ A;  3K57 A;  4AF1 A;  5AQO A;  2GTD A;  1O13 A;  4FWR A;  5CZ2 A;  1VQ4 N;  4B9T A;  4B9S A;  3G0Z A;  1JCE A;  4KI4 A;  1RBU A;  3MN5 A;  3L2W A;  3DAW A;  1NGF A;  3HTV A;  4CVN E;  1BIU A;  3OVN A;  3ZSR A;  5JLH A;  3BDP A;  3CJ1 A;  1EWR A;  2Y1J A;  3J8A A;  5BN9 A;  5AQX A;  4DV0 K;  3CET A;  3OS1 A;  1HNI A;  2DPN A;  2P9K B;  2NRX A;  3I8B A;  4NCG A;  4FLY A;  1WN7 A;  1RBT A;  1ZBH A;  5ADX A;  3MXJ A;  4CEC A;  4IOX A;  3KWG A;  1A5W A;  2HF4 A;  1LWC A;  2HF3 A;  2O8F B;  3THW A;  3UKU B;  3HVT A;  4OKJ A;  5TKW A;  3CC2 N;  4JNE A;  1HYS A;  4OPH A;  4DSF A;  3K5O A;  4B1U B;  3CJ7 A;  4FW1 A;  1VSL A;  1TAU A;  4HTL A;  2YNG A;  3H3N O;  4KKO A;  4Y0W A;  2E6M A;  5E41 A;  4GW6 A;  3LWM A;  4B9V A;  3SJH A;  4M7Y A;  3BZK A;  3JSM A;  4BRL A;  1RDB A;  3CCL N;  4UQG A;  1N8R O;  4X66 K;  4FLZ A;  2R7Y A;  3G10 A;  2KW4 A;  3SBG A;  4JRQ A;  3SUP A;  1TL1 A;  1EX4 A;  2QI2 A;  3OBY A;  4DFJ A;  4J2B A;  2EHG A;  3PO5 A;  1JLF A;  4RW6 A;  1RDD A;  1ZBS A;  5AR0 A;  4CF1 A;  3PSF A;  2YKN A;  4H5R A;  4XEI A;  4BC5 A;  1ILY A;  4H5N A;  3F5T A;  5J1E A;  4CD3 A;  2HBJ A;  3D6R A;  5I42 A;  3EN9 A;  4DV3 K;  1A5X A;  4ELV A;  3BF3 A;  4KHS A;  2VG5 A;  1CZB A;  4C8M A;  3MK6 A;  4CER A;  1RCH A;  3WEE B;  1Q81 O;  2O8B B;  1X9J A;  4BC2 A;  4C23 A;  1ZBI A;  4U67 L;  4C8K A;  1S72 N;  4FJX A;  1JLE A;  4CE9 A;  5BRH A;  5GAD P;  3LDN A;  2VGN A;  1LW2 A;  3VQ6 A;  5HRP A;  3DLB A;  1ITG A;  4DV5 K;  3C7N A;  5C12 A;  3KK3 A;  3LDQ A;  1QTM A;  3AO4 A;  2YKM A;  2KLA A;  1S1W A;  3KTQ A;  4DCH A;  4N41 A;  1CXU A;  4I6M A;  1RT5 A;  3QFP A;  3RMD A;  2B6A A;  4BC4 A;  3QEW A;  4KH5 A;  2BGG A;  3U3G A;  3HZ6 A;  5C25 A;  4JAX A;  3MN6 A;  3C94 A;  1NOZ A;  3HRG A;  4J2E A;  4ELU A;  4A5B A;  1BCM A;  5KPZ A;  2V52 B;  4RW7 A;  2ZGZ A;  4V19 S;  1XHZ A;  2HVI A;  1W0H A;  2RF2 A;  3H1Q A;  4LF8 K;  1CZA N;  1OVQ A;  1TKZ A;  1D8Y A;  1XNQ K;  4X65 K;  3ZT3 A;  4IO8 A;  3OYG A;  4FK2 A;  1VSI A;  5AQM A;  3ZET A;  3V9U A;  4HVJ A;  1JLA A;  5J2N A;  3MAQ A;  4FPB A;  3ZX3 A;  5TKY A;  3E01 A;  2V7Z A;  2YJF A;  1NKE A;  2VWB A;  4NLB A;  3L4Q A;  3S41 A;  1BOT O;  1QZ5 A;  1VSE A;  1VQN N;  3V9X A;  4X62 K;  4WQ4 A;  1X9W A;  4A57 A;  3CM5 A;  1E3M A;  1RFQ A;  3VMF B;  1K8A O;  4BRM A;  4KHW A;  4DLE A;  2O8F A;  1LV5 A;  3HM8 A;  1TK8 A;  3VF4 A;  1QZ6 A;  4DFM A;  1M90 O;  3TWH A;  3SK3 A;  3P5J A;  3QO9 A;  1VRU A;  1U2V B;  4FJG A;  3FR0 A;  4JKH A;  3SAH A;  3AVA A;  4DTR A;  4AHC A;  2A3Z A;  4OKK A;  3L8B A;  1NJZ A;  3DRS A;  1ASV A;  3NF9 A;  4HCC A;  2OYQ A;  4KRE A;  4O5B A;  4J8F A;  5BPN A;  1K8K A;  4ICL A;  4BR9 A;  4M45 A;  4E7H A;  3KKR A;  4A2A A;  3SQ4 A;  4JHD B;  3M8R A;  4E0D A;  1WBD A;  4O55 A;  3L6Q A;  3R1X A;  5GIO A;  2KFZ A;  2PFU A;  3ENB A;  1L5U A;  3CCR N;  1YI2 N;  1Z26 A;  1BA0 A;  1Q86 O;  4JKB A;  3LAK A;  1WBB A;  3IG1 A;  4BE1 A;  3DI6 A;  4F3O A;  2HHS A;  2VWJ A;  2RE2 A;  2P1J A;  3K9J A;  1NK8 A;  4YOU A;  4DV2 K;  1KAY A;  2YHW A;  1B9F A;  3VGL A;  1KXP A;  4AHS A;  3WNF A;  3ZX0 A;  4RW9 A;  1OH7 A;  4FJN A;  1ZBU A;  3WEE A;  4OPJ A;  3FLC O;  3HL8 A;  5J2Q A;  1S3X A;  5JMV A;  4Z4G A;  3VTH A;  4WE1 A;  3PIO L;  1N5Y A;  5FPN A;  4KHU A;  4CJQ A;  4FJJ A;  3VF6 A;  4CZG A;  2X74 A;  3PSI A;  1XC9 A;  2X6N A;  4DQR A;  3KZB A;  1G99 A;  4G1Q A;  4Q5V A;  4XH1 A;  3RVC A;  4CEQ A;  4CFB A;  2B5J A;  1BI4 B;  2P9I B;  3V1Q A;  2P9U B;  4A61 A;  3KK7 A;  2NRR A;  4BDZ A;  1NGC A;  4CHZ A;  3TSU A;  4DQQ A;  4ISE A;  4E1J A;  1QVG M;  2GWK A;  1S6P A;  4KI6 A;  2ZD1 A;  4I9L A;  2OZS A;  4O0J A;  3MCP A;  4H0O A;  4IFV A;  1JKH A;  3J81 O;  2D0O A;  3MDQ A;  1NK6 A;  2O8C B;  4K41 A;  3PUF A;  1GOC A;  3DXM B;  1NJI O;  3WXK A;  1WAF A;  4A62 A;  2RN2 A;  2HBL A;  4FWO A;  4JI3 K;  1KVB A;  4CZI A;  4KPY A;  4W5N A;  4FPA A;  2Q36 A;  2E88 A;  4CEO A;  4DU4 A;  3FE1 A;  4BRK A;  3EYZ A;  1U04 A;  1Q7Y O;  4E1M A;  2FBY A;  3EKS A;  5BRE A;  2ZF5 O;  4DSI A;  4JI0 K;  1C0U A;  1YT3 A;  2ZJP L;  3AVF A;  4M3U A;  4YY3 K;  1NU0 A;  4JLH A;  2WBN A;  3AGK A;  4CJ5 A;  5GAG P;  4B9L A;  5KTQ A;  4DR1 K;  3RSE A;  4M3Y A;  5AQY A;  4C1N I;  3O9Q A;  3L4I A;  5C0Y A;  2VGM A;  1D9D A;  3MMV A;  3TAP A;  3KLI A;  4IFE A;  1S9E A;  2B4J A;  3EE8 A;  4DU3 A;  2E2O A;  1S1V A;  4DR6 K;  4YDU C;  1BQN A;  1KTQ A;  4B8C A;  1RDU A;  1ZC6 A;  3LPU A;  3TAF A;  3S9H A;  3CCE N;  1RDW X;  3CER A;  3DM2 A;  5FRN A;  2D4W A;  4PA1 A;  3SUQ A;  4DSK A;  2QTD A;  3R6M A;  3S3M A;  1RDA A;  1NOY A;  2QWO A;  3CIP A;  1U2V A;  1T7P A;  4CJS A;  5HRR A;  4AHT A;  5JS1 A;  1DKG D;  3T1A A;  4DLG A;  3DOL A;  1L3S A;  1NMD A;  4B08 A;  3HPO A;  2GV9 A;  4CIE A;  1IKY A;  4DB3 A;  4FJ8 A;  4FLV A;  1GLD G;  3TAR A;  3O9U A;  3KHY A;  4JHD A;  3CPW M;  4W5O A;  4DR4 K;  2P9N B;  4QS9 A;  4CF2 A;  3O3G A;  2BDP A;  4CK2 A;  4YOY A;  2GUP A;  1JLQ A;  3V81 A;  4EHU A;  2BTF A;  1UOC A;  4KTQ A;  4AHU A;  3WXJ A;  4KHP K;  1GLB G;  5BPM A;  2IVO A;  1M1K O;  3KK1 A;  4MQ3 A;  4LF7 K;  4K25 A;  1VQ7 N;  1QHT A;  2KFN A;  3V9Z A;  3DLH A;  3AVN A;  3TSP A;  1SS6 A;  4ID1 A;  1SKR A;  2E2N A;  4OLA A;  1HLU A;  1HPZ A;  4CES A;  1G15 A;  4CHQ A;  4WFB L;  3CFO A;  3HK2 A;  2A40 A;  4UY8 O;  4FK4 A;  3DOK A;  4NXN K;  3O6W A;  1KAX A;  4DTO A;  4FK0 A;  2JWK A;  1BWF O;  3WNG A;  2IGI A;  1X3M A;  2XY7 A;  3BZC A;  1KLM A;  4JK9 A;  4PQU A;  3ZSX A;  3O9T A;  4IZ9 A;  3WNH A;  1EKE A;  4FCY A;  3CI5 A;  4EHT A;  3AA5 X;  5AQJ A;  4CJ4 A;  4E1N A;  3EY1 A;  3T3F A;  1NK4 A;  4DTS A;  1TL3 A;  1NGI A;  5B8H A;  4KHQ A;  3O4N A;  1NJX A;  4EP5 A;  3CCJ N;  4JI2 K;  3CQ8 A;  4F8R A;  3VET A;  1XWL A;  2G8H A;  4DMN A;  4J2A A;  1S22 A;  4PL8 A;  1DT9 A;  2YI1 A;  2NUB A;  4C8N A;  5DM7 L;  1UA0 A;  4N5S A;  5AFU A;  3GDQ A;  4JRP A;  2YNI A;  3QNN A;  3TI0 A;  5AZJ B;  2HW3 A;  3G71 N;  1GLL O;  5BN8 A;  5MLC Q;  4PKI A;  1QQN A;  3E9O A;  1J6Z A;  1TK0 A;  1VQM N;  3SI6 A;  3O5B A;  4YNQ A;  1LWE A;  2QKB A;  3O1B A;  4EZ6 A;  5AQN A;  3ENO A;  1TYQ B;  1FW6 A;  3C6U A;  4LFA K;  4LFB K;  3M8P A;  4H03 B;  3SUN A;  2HNZ A;  3D2E B;  4N76 A;  2E20 A;  3KLF A;  1TUU A;  4NYN A;  5GAH P;  4CJV A;  1NGA A;  3ZT4 A;  5KRT A;  3NAE A;  4BVO A;  5KRS A;  3T69 A;  4HUE A;  3HOS A;  3VQD A;  1VSF A;  2P9P A;  4HHT A;  1W7A A;  4E7K A;  4Z4F A;  3AVI A;  1VSD A;  1SKW A;  2F96 A;  2D5R A;  1RNH A;  3VA3 A;  3SCX A;  3ZT1 A;  4H0V B;  3O4Q A;  4OPK A;  5HOO A;  1VQ9 N;  1XC3 A;  4H0T B;  4FJ7 A;  3CYM A;  3B6O A;  1QQM A;  3OHR A;  4IJN A;  5AQW A;  4CJF A;  5C2F A;  1NGE A;  3AA4 A;  1RIL A;  4XIU A;  1D9F A;  4H4O A;  1D5A A;  3EE9 A;  4FZY A;  4ZTJ A;  4DV4 K;  1BHL A;  4B9M A;  3NMU A;  1U48 A;  4CF8 A;  3HPG A;  1YVU A;  1DTQ A;  2CH5 A;  4DR7 K;  3MCA B;  4Z4E A;  2P9N A;  5KPT A;  3P38 A;  2PY5 A;  5CHI A;  3VER A;  4DR3 K;  2O8E B;  4G9Z A;  4BRA A;  3I0R A;  1ESV A;  5FLX O;  4Z0U A;  1HNV A;  2HHQ A;  1Q9Y A;  3RMB A;  1ASU A;  2WOM A;  4JKF A;  4FLT A;  3K0S A;  1B92 A;  1KD1 O;  4M42 A;  1IV0 A;  1NNE A;  2D1K A;  4B1X B;  5AJ3 K;  4GMJ B;  1RTH A;  4CEF A;  4DV7 K;  1TKT A;  3UKR B;  2QWM A;  4FLU A;  1MA9 B;  4FJ9 A;  3TAE A;  4AM7 A;  4JI6 K;  4IDK A;  2EWS A;  3V4I A;  1W2B M;  1TGO A;  3AVG A;  4CGG A;  2QWN A;  3M5R A;  3KD1 E;  2A1S A;  1QSL A;  5C42 A;  4GVE A;  3HYF A;  3OYE A;  3THY B;  3CC7 N;  3T7Z A;  3CFP A;  3FZL A;  1LW0 A;  1H1V A;  5H1S Q;  3AA3 A;  3NGI A;  2XY8 A;  4WQ5 A;  3CC4 N;  3VQC A;  4LH5 A;  4Y1C A;  4CJW A;  1RTI A;  4O0I A;  4FOE A;  3TTC A;  3T1H K;  1TK5 A;  1JLC A;  4RWT A;  3C65 A;  4DKW A;  1SL0 A;  4BGA A;  4LSL A;  3N4Q A;  1U6Z A;  3RMC A;  1N36 K;  3QIC A;  3J7A P;  4BGB A;  2QWL A;  5BPL A;  1BUP A;  1Q82 O;  4DTN A;  2IDO A;  2O4I A;  1WSE A;  2Q31 A;  3H45 C;  4BRN A;  2A1R A;  3MWP A;  3AO1 A;  4PUO A;  1VRT A;  1T6D A;  1S5J A;  1QS4 A;  4JYA K;  1C0G A;  1YF5 L;  2ZJR L;  1Q18 A;  4CZE A;  4JD2 B;  3E9L A;  2AA4 A;  1VAZ A;  3NH2 A;  3A0I X;  4PKG A;  3CJ9 A;  3J7Y P;  1BG3 A;  2P9S B;  3NFA A;  4FWP A;  1DEJ A;  3TTD A;  5AQK A;  3VEZ A;  5DK5 A;  1S6Q A;  1RT2 A;  4EAH D;  4LF4 K;  1BU6 O;  4FSV A;  3HO1 A;  3ZEU A;  4I2Q A;  3OYB A;  4JV5 K;  4NCA A;  4B1W B;  4IBN A;  3WQU A;  2QXF A;  1GOB A;  3P83 D;  1DTT A;  4ISG A;  3P39 A;  4NXM K;  3KLE A;  3CJC A;  4Z4H A;  5FPD A;  4FYD A;  4QS7 A;  4M63 C;  1X3N A;  3DJC A;  2UXB K;  1IO2 A;  2KZM A;  4OPA A;  4FLX A;  5LMN K;  2P5G A;  1HQU A;  2A5X A;  3AO3 A;  3MEG A;  1MDU B;  3IMX A;  1SV5 A;  2E5L K;  4ZHR A;  3OYH A;  4GY2 B;  3QDK A;  3DLR A;  2E6L A;  2YX6 A;  4NO7 A;  1HNX K;  3IS9 A;  1L3V A;  3MX2 A;  4BWJ A;  3QEX A;  3OYJ A;  3U4L A;  3A2F A;  2O8E A;  4CGJ A;  2F8S A;  2NRT A;  3MEE A;  1WNS A;  1C6V A;  1ZYQ A;  1WAJ A;  3VEV A;  3LP1 A;  5HP1 A;  4H0X B;  3S3O A;  1HQE A;  4PKH A;  2WON A;  2W6K A;  4FM2 A;  4YOV A;  2FF6 A;  4M3X A;  5C15 A;  4RW4 A;  3OJU A;  4Z4I A;  5EX5 A;  3VPZ A;  3KWI A;  4BRQ A;  4LC9 B;  3UKR A;  1C0T A;  4OX9 K;  4JKG B;  5AZI B;  1S9G A;  1W9H A;  1X9S A;  4CJ7 A;  1T3V A;  3ZT0 A;  2KQ2 A;  1WSH A;  4ELT A;  3ZSV A;  5AQF A;  4OLB A;  3AGR A;  1KFD A;  3TR8 A;  2P9K A;  2ASM A;  2E8A A;  4C8O A;  1FXX A;  4OVL A;  4FJL A;  3DXK B;  3LM9 A;  1VSK A;  4K8X A;  4NLC A;  3T19 A;  5FPE A;  3UKU A;  4PL7 A;  1Y97 A;  3UE5 A;  3ZSW A;  4DUY K;  3O9S A;  3LDL A;  5SWM A;  4DSE A;  5SZT A;  1MU2 A;  4BRG A;  3NGZ A;  3AVL A;  5KPR A;  2E1Y A;  3J7Z O;  3B8A X;  3D45 A;  1NM1 A;  5AQT A;  4CBU A;  4BR0 A;  1OH8 A;  3JAM O;  1LOT B;  3TTF A;  3U3Y A;  2FLO A;  4NYF A;  3LAM A;  3M3Z A;  5C10 A;  2HNY A;  1UA1 A;  1I94 K;  2WC9 A;  3F9M A;  3DLK A;  4ISF A;  4IEE A;  4FWK A;  2YV0 X;  1C1C A;  2PBD A;  3WXL A;  1RBS A;  5EVZ A;  1XMO K;  4MDA A;  2NZT A;  2ITM A;  1L3T A;  4FJM A;  1WSG A;  3E66 A;  1IG9 A;  4HUF A;  4F4K A;  5GIN A;  3SQ2 A;  1IKW A;  2P9L B;  4DF8 A;  1RT6 A;  2O8B A;  3DLL L;  4B1Y B;  4BRO A;  2ETJ A;  3G4S N;  4F3T A;  3LDP A;  2RHK A;  4CF0 A;  3CXC M;  3QET A;  3TAB A;  5JVG L;  1C1A A;  3ID8 A;  3HT3 A;  3VA0 A;  4LH4 A;  4B3R K;  4FLW A;  2QKK A;  3VEX A;  3CJB A;  3VQ8 A;  4PHT X;  5LMU K;  4E7I A;  4BQL A;  5M1N A;  4CIG A;  3HVR A;  3CD6 N;  1X1P A;  3TSQ A;  3QBX A;  1CZ9 A;  3N4P A;  3VGM A;  1GOA A;  5LY3 A;  1R59 O;  1YJW N;  4IWV A;  2XY6 A;  4CGD A;  4EIA A;  3W0L A;  3SQ1 A;  1TVR A;  1KC8 O;  4CBW A;  3PLA A;  4CW7 B;  4WF9 L;  1RBV A;  3KKS A;  4H4M A;  3A8Y A;  4FL9 A;  2WTU A;  3MED A;  1A5V A;  4CJP A;  2UYT A;  3A5N C;  3O4W A;  3MXM A;  4IXC A;  3U6F A;  5C2D A;  1BQM A;  1U45 A;  4RW8 A;  4H5W A;  1NLV A;  2WFB A;  2G8U A;  3I56 N;  4CGH A;  2QWP A;  1NJY A;  2XHB A;  5M1P A;  4GV6 A;  4CFC A;  4BE2 A;  5AZI A;  2F8T A;  3VES A;  4DSJ A;  5HRN A;  4WFA L;  4BR4 A;  2UU9 K;  3AAP A;  3AVB A;  3MEC A;  1EXQ A;  2HHT A;  1RT3 A;  2VQF K;  3SMP A;  5K14 A;  3VEO A;  4IOA L;  3MWT A;  3AO2 A;  5D3G A;  1VQP N;  1IG8 A;  4B1Z A;  4CZJ A;  1R0A A;  2JWL A;  2NRZ A;  2E2P A;  3NH1 A;  3M8S A;  1QSY A;  3FZF A;  4JI8 K;  2H3G X;  1IKX A;  3A5L C;  2ZQB A;  1HJO A;  4BRP A;  5I3U A;  1E4F T;  3QER A;  4IO9 L;  1N6Q A;  3ENH A;  5AQP A;  1HYZ A;  2HBK A;  1BIS A;  2D0B A;  5JIC A;  4AQY K;  3FZK A;  3O08 A;  1VQK N;  3VN5 A;  1JCG A;  3NF8 A;  1RT1 A;  2DY4 A;  4WYB A;  3CCM N;  2YCH A;  3TAN A;  2UUA K;  3IDH A;  4JEP A;  3C6T A;  1YJ9 N;  1N33 K;  4TSX A;  4BRI A;  1BIZ A;  1X9M A;  1YAG A;  2V7Y A;  3L3U A;  4KTZ A;  3OY9 A;  3PX4 A;  2GUI A;  4JI7 K;  4DS4 A;  4DV1 K;  4KB1 A;  3SPY A;  4JI4 K;  3BP8 A;  2FSK A;  3PX0 A;  1T03 A;  2IS3 A;  4EFH A;  5CZ1 A;  1J9A A;  1TUY A;  1S1U A;  3NCI A;  3LP3 A;  5AQQ A;  4K43 A;  1HNW K;  2UXD K;  3L2V A;  1IH7 A;  1T8E A;  4WFN L;  3LAN A;  4ID5 A;  4JK8 A;  3L2R A;  4B8A B;  2HVH A;  2RKI A;  4BR2 A;  5KQD A;  3V6D A;  3ATU A;  3HSC A;  1VQ5 N;  3AVM A;  3R8E A;  4FW2 A;  3OYL A;  4OO1 J;  3FFI A;  4I9Q A;  1E4G T;  1VK0 A;  4CJK A;  3UB5 A;  3FZH A;  4KO0 A;  2OZM A;  3QLH A;  1HJR A;  4CGF A;  1Q8I A;  1HKB A;  3BF1 A;  3NF7 A;  1BI4 A;  3CCQ N;  2P9I A;  1NKB A;  1JJ2 M;  2P9U A;  4BG9 A;  4K42 A;  4BVP A;  4FJ5 A;  3I8D A;  4HUG A;  4CK3 A;  1P90 A;  2ZJQ L;  1QHA A;  3D2F B;  4DFP A;  4FOI A;  4IG0 A;  3TU5 A;  3ATV A;  4AIL C;  4M3R A;  1KFS A;  3WQT A;  1NK5 A;  2W6L A;  3D7E O;  3THW B;  2O8C A;  1QSS A;  2I7P A;  3DXM A;  3U9D A;  3O8M A;  4NCB A;  2OPS A;  3OS2 A;  4CHY A;  1J54 A;  4L8R B;  3AA2 A;  3Q7C A;  4LF6 K;  1HR0 K;  1KQS M;  4CHN A;  1SL1 A;  4MLH A;  3MXI A;  5HL7 L;  2O8D B;  1J5E K;  1SUQ A;  2F9W A;  1LWF A;  1VQ8 N;  3AVH A;  1EET A;  3HBT A;  4X64 K;  4CJT A;  1FK9 A;  2UUC K;  3LP0 A;  4CZH A;  4AM6 A;  4MFB A;  4ILH A;  2W41 A;  2F4V K;  3LM2 A;  4BR7 A;  4A2B A;  1EWQ A;  2XRI A;  5A2Q O;  1L3U A;  4DV6 K;  5AFU H;  2W40 A;  5JS2 A;  4KAZ A;  3RTV A;  2CGL A;  3VQQ A;  3HPH A;  4IDH A;  3O80 A;  3OYC A;  2YJE A;  3ZSY A;  1VQL N;  4JN4 A;  3CCV N;  1RGI A;  3R9P A;  3EEQ A;  4BRE A;  4J2D A;  4JKE A;  1EP4 A;  1KAZ A;  2BUP A;  2BAN A;  4OGC A;  3SYZ A;  3CG7 A;  1K6Y A;  3AVJ A;  4YHH K;  5AQZ A;  1NWK A;  3LDO A;  2V51 B;  1CXQ A;  4CEA A;  2I7N A;  3PX6 A;  2DFH A;  4GKK K;  2Q97 A;  3SV3 A;  2HHV A;  4QOZ B;  5M1K A;  5AQR A;  1Y64 A;  4DWI A;  1EO1 A;  2Q0U A;  2LSN A;  3D0P A;  4JKC A;  4O44 A;  3ID6 A;  5AQH A;  2QA4 N;  4L3Q A;  3CCS N;  1C0F A;  3NHG A;  4YDU A;  2PYJ A;  3FZM A;  1U47 A;  1NGB A;  3KLG A;  4WQ4 C;  4CGI A;  3OYA A;  2P51 A;  4DR2 K;  1SL2 A;  5BR8 K;  4A59 A;  3PY8 A;  4KRF A;  4O8K A;  3ITH A;  1TKX A;  1DGK N;  2QEX N;  1NKC A;  4B9N A;  5FRM A;  3FGU A;  1W97 L;  1CLQ A;  4KH6 A;  3QIN A;  4CHP A;  4RTF D;  4LFC K;  1F21 A;  4MDB A;  4JKA A;  1N32 K;  3EO3 A;  4BWM A;  4F2R A;  4H0Y B;  2ZM6 K;  2G8W A;  2QM1 A;  3IAY A;  3H1V X;  3L3V A;  4KFB A;  5LJV A;  3ZET B;  5BRF A;  1ZBL A;  2OCE A;  3PIP L;  2VWK A;  3SPZ A;  4K0K K;  2NRV A;  3TAG A;  2ASO A;  4KB0 A;  2IVN A;  2FXU A;  2G8V A;  1JL2 A;  4ILJ A;  3ZSO A;  3C6H A;  4FVU A;  1MWK A;  3DWL A;  4DR5 K;  4F2S A;  4Q0B A;  4CJL A;  2NLX A;  4HTU A;  1KCF A;  3ZX2 A;  2HHU A;  2HHX A;  5J2P A;  3D2F A;  2D0A A;  3G6E N;  4RG8 A;  3VQ9 A;  1NK7 A;  4LY7 A;  3LZJ A;  2OPQ A;  3F2K A;  2D0C A;  3IFR A;  2VG6 A;  1I3A A;  3ZYY X;  3DRP A;  4W5T A;  1NK0 A;  1RBR A;  1XNR K;  4BC3 A;  3OS0 A;  1RT4 A;  4BRH A;  2HHH K;  5ADX H;  5AZJ A;  3HXM A;  4FWN A;  3OYF A;  3JYT A;  5CYM A;  2O8D A;  4O5F A;  1IBL K;  1XUP O;  3A5O C;  2HMI A;  4DF4 A;  4CK1 A;  2QK9 A;  4GNI A;  4CJU A;  3KD5 E;  5T7B A;  1K8K B;  2UXC K;  1K73 O;  1T6C A;  2JLE A;  4DS5 A;  1WUA A;  3V1R A;  1TYQ A;  4CZM A;  1WLJ A;  1NGJ A;  5KI6 A;  2HHW A;  3D2E A;  4BR5 A;  3K9K A;  4DTU A;  3H08 A;  4CEE A;  4CCH A;  4FZX C;  1Z25 A;  1N34 K;  5DM6 L;  4IG3 A;  3AVC A;  1JLG A;  1IBM K;  2KTQ A;  4BRC A;  3ZCM A;  4FM0 A;  1K9M O;  4QAG A;  5EXW A;  5BRD A;  2DFF A;  1QE1 A;  1HYV A;  4FM1 A;  1ATS A;  2IOC A;  2E4L A;  3VQE A;  4OGE A;  3QES A;  4BDY A;  4CBX A;  3VQP A;  4FWQ A;  2KKZ A;  4H0P A;  1XMQ K;  4BY9 C;  1JLB A;  4BE0 A;  5M1F A;  3J80 O;  4N47 A;  4FWS A;  3GG4 A;  4MO4 A;  5AQV A;  3WT0 A;  4E7L A;  2HBM A;  1U4B A;  4PWD A;  1GLF O;  4YOW A;  1LAV A;  2KZZ A;  5CR4 A;  3LDS A;  3RR8 A;  2CGK A;  2G8I A;  1GLC G;  4EZ9 A;  4DQ8 A;  3HP9 A;  5F2R A;  4BG8 A;  1TKD A;  2G8K A;  1J53 A;  3BGR A;  3P31 A;  3KJV A;  4M41 A;  1EQY A;  2Q1N A;  2GEL A;  1Q9X A;  4DQI A;  4R5P A;  4FJK A;  2RPI A;  4E89 A;  3KIO A;  2ZWH A;  2EX3 A;  3ZLJ A;  3AAR A;  4JI1 K;  4OJR A;  5CY4 A;  1KSP A;  3EL2 A;  3FFK B;  4M3Z A;  4LF9 K;  4Z94 A;  1OH6 A;  3VEN A;  4CEZ A;  3BEX A;  1YXQ A;  3GOI A;  3H6E A;  3OBW A;  4KV8 A;  1VSM A;  2GEM A;  3CFR A;  4K8Z A;  1GLA G;  3P4I A;  1LAW A;  3NF6 A;  1IBK K;  5FDL A;  1MWM A;  5IWA K;  4DTX A;  3THX B;  3VQ7 A;  1B9D A;  4BRF A;  3SV4 A;  4GKJ K;  3SUO A;  2OAN A;  2QW9 A;  4FWM A;  3ISN C;  3CF5 L;  1YTU A;  4JS4 A;  1OVY A;  2NRH A;  5AQI A;  3THY A;  3VQ5 A;  4M3T A;  3ASM A;  1KLN A;  2E1Z A;  1WOQ A;  3SAF A;  3PO4 A;  1WSI A;  4FZZ A;  5AQG A;  3JS6 A;  3RSE B;  5LL6 Z;  4CJR A;  5GIP A;  1GLJ O;  2IAJ A;  5AQU A;  1QQC A;  1VSH A;  1KVA A;  1BO5 O;  3QML A;  4E7J A;  1VQ6 N;  3O3H A;  1NGH A;  3QNO A;  3DLG A;  1SKS A;  4IJA A;  4CJ3 A;  3LL3 A;  3L2Q A;  4NB4 A;  4DU1 A;  4GVM A;  2HMP A;  3F73 A;  2DTU A;  3WUH A;  3EZW A;  4W5Q A;  1QQO A;  3OYM A;  4DSL A;  1YJN N;  3QBW A;  1KRP A;  4KHY A;  4KHN A;  3EKU A;  4C1N K;  3E9P A;  5IT9 O;  3SAG A;  4MO5 A;  4CZF A;  3WXI A;  4DG1 A;  3QFU A;  2PAV A;  3LWL A;  2FF3 B;  1NJW A;  4YFU A;  5JLF A;  1I39 A;  1BCO A;  5ELZ A;  2AP1 A;  1IJJ A;  5EY4 A;  4Z4C A;  3ZSQ A;  4H5V A;  2A6A A;  3OYD A;  3K5L A;  3G25 A;  3OA9 A;  4B9U A;  4GV9 A;  1REV A;  3F9K A;  2X78 A;  4IFY A;  4GV3 A;  4HCB A;  4BRD A;  3C0B A;  1YTA A;  4JD2 A;  1BGX T;  4CJE A;  5KGX A;  1JXE A;  4O4G A;  1XQS C;  5GAE P;  3NGY A;  4H8K A;  2FSN A;  1YIT N;  2F7T A;  2P9S A;  1GLE G;  2ZGY A;  4LSN A;  3A5M C;  3IKM A;  2E2Q A;  4DHY A;  4DUZ K;  1ZXO A;  3CCU N;  1S1X A;  4B3T K;  3I33 A;  3ULD A;  3SLC A;  3K58 A;  3NDK A;  2YHA A;  3BY5 A;  4I2P A;  3K5N A;  4QS8 A;  4FJH A;  2G8F A;  5M1Q A;  3GL1 A;  3SBT A;  3NVM A;  5C24 A;  1HKC A;  3HM9 A;  5HLF A;  1RTD A;  1HMV A;  1FKP A;  3VGK A;  3KK2 A;  1V4T A;  4ILG B;  2GBZ A;  2VG7 A;  4CZK A;  4B3M K;  1HX1 A;  2QXL A;  4A5A A;  1FJG K;  3OTO K;  1VSJ A;  2HST A;  1S1T A;  3K2P A;  3W3D A;  2OA8 A;  3QEI A;  2VQE K;  2W42 A;  1WSJ A;  2J4R A;  1HNZ K;  1IKV A;  4OKE A;  3O1W A;  5JVH L;  3LP2 A;  3THV A;  4JK7 A;  3RR7 A;  5I9E B;  4H5T A;  4XH4 A;  2HOE A;  1KVC A;  1D4X A;  1SZ2 A;  3OW2 M;  3HST B;  4AHR A;  3CM6 A;  3RRG A;  1JCF A;  3PV8 A;  2DFE A;  2KHO A;  2IVP A;  4C8L A;  4U7B A;  4QCL A;  3SMS A;  3NE6 A;  2XY5 A;  4M3W A;  1NGG A;  4CZL A;  3AV9 A;  1JXB A;  3H46 O;  3LPT A;  5F0X A;  4JKG A;  1HPM A;  3T1Y K;  2FBX A;  3CPE A;  5LJW A;  2Q0R A;  3AVK A;  3THX A;  2A42 A;  5M1O A;  4RCH A;  4XH5 A;  1NMN A;  1RTJ A;  2VYP A;  2Z1H A;  3HJF A;  2Q3S A;  3DXK A;  4JI5 K;  2Q2R A;  4CED A;  4IOC L;  1HRH A;  3QIO A;  1NGD A;  3U8X A;  3NH0 A;  3EZ5 A;  3VQA A;  2BH1 A;  4YOT A;  3QEV A;  3RMA A;  3AAQ A;  1YUW A;  1U49 A;  2UUB K;  1VQO N;  1BL3 A;  3V9W A;  5KGW A;  2P9P B;  3V1O A;  4CHO A;  3NVK A;  3VEW A;  3SNN A;  1YHQ N;  1HUX A;  4EP4 A;  4AHV A;  2OTL N;  3S3N A;  3O9R A;  2FSJ A;  4JKD A;  2XO7 A;  4E3S A;  2ZE2 A;  3ALY A;  1NBW A;  2YHX A;  1SAZ A;  3ULE B;  1JL1 A;  1RDC A;  4IEI A;  4FO0 A;  3KLH A;  3TPQ A;  4CFA A;  2I5J A;  1QVF M;  3K5M A;  4FWL A;  1Z05 A;  2FBT A;  3OYK A;  1ZBF A;  1NK9 A;  2PZS A;  3H3O B;  3MN7 A;  3VOV A;  2Z1G A;  3Q7B A;  3AY9 A;  4WQ5 C;  3M8Q A;  3JXU A;  3LZI A;  1C1B A;  3RWU A;  1HKG A;  3WXM B;  2P9L A;  3DRR A;  3ZSZ A;  4W5R A;  2BE2 A;  3O3F A;  1XI1 A;  1TV6 A;  2FBV A;  5E26 A;  4CI6 A;  4CFD A;  4CD1 A;  4KTW A;  2X6S A;  1T44 A;  3I55 N;  4BDP A;  1T05 A; 
#chains in the Genus database with same CATH homology
 3R3L A;  4RTF D;  2P9U B;  4MDB A;  1SQK A;  2NRT A;  3KK7 A;  4JKA A;  5EOY A;  3VEY A;  4A61 A;  4BQZ A;  3EO3 A;  2NRR A;  1NGC A;  4H0Y B;  3TSU A;  5CE3 A;  3M1F A;  3VEV A;  2QM1 A;  4ISE A;  4E1J A;  1QVG M;  2GWK A;  4H0X B;  1P8Z A;  3H1V X;  1OKJ A;  5KQ8 A;  5LJV A;  3ZET B;  5BRF A;  1V4S A;  3PIP L;  4PKH A;  2YHY A;  3MCP A;  4H0O A;  4YOV A;  2FF6 A;  2NRV A;  5C15 A;  2D0O A;  3MDQ A;  2ASO A;  3CMA N;  4K41 A;  2IVN A;  2FXU A;  3DXM B;  5EX5 A;  3VPZ A;  4ILJ A;  3KWI A;  1NJI O;  4BRQ A;  4LC9 B;  3MX5 A;  3C6H A;  3E1Y A;  2F9T A;  3UKR A;  3WXK A;  4FVU A;  1MWK A;  3DWL A;  4JKG B;  3U9Z A;  4A62 A;  4FWO A;  2HBL A;  5AZI B;  3CME N;  4CZI A;  4CJ7 A;  1T3V A;  4FPA A;  2Q36 A;  2E88 A;  2NLX A;  5FPM A;  3FE1 A;  4BRK A;  1BA1 A;  1Q7Y O;  3ZX2 A;  2CH6 A;  5AQF A;  2OTJ N;  3EKS A;  3AGR A;  5BRE A;  3D2F A;  3G6E N;  2P9K A;  2ZF5 O;  2ZJP L;  4F9O A;  2ASM A;  2E8A A;  3F2K A;  4WCE L;  3IFR A;  3DXK B;  3ZYY X;  3LM9 A;  4NLC A;  2WBN A;  3AGK A;  5FPE A;  5GAG P;  3UKU A;  2GX9 A;  4BC3 A;  4KBO A;  4PL7 A;  1LCU A;  3UE5 A;  3VTI A;  4BRH A;  3O9S A;  5ADX H;  5AZJ A;  3RSE A;  4FWN A;  3LDL A;  2IIR A;  4O8U A;  5AQY A;  4C1N I;  3O9Q A;  3L4I A;  4B1V A;  5C0Y A;  2VGM A;  4O5F A;  4YOR A;  3IUC A;  4BRG A;  3HOT A;  1XUP O;  3A5O C;  3MMV A;  5KPR A;  4IFE A;  2E1Y A;  3J7Z O;  3B8A X;  5E84 A;  1NM1 A;  3EE8 A;  1ATR A;  3QB0 A;  2VCP A;  5AQT A;  3L0Q A;  4GNI A;  4B9Q A;  2E2O A;  4CBU A;  4YDU C;  1K8K B;  3MN9 A;  4BR0 A;  1RDU A;  4YOX A;  1ZC6 A;  3CCE N;  4HWI A;  1K73 O;  1RDW X;  1LOT B;  1T6C A;  3CER A;  1WUA A;  3TTF A;  2FLO A;  1TYQ A;  4CZM A;  2D4W A;  3CQX A;  1NGJ A;  3CJA A;  2QTD A;  3D2E A;  3R6M A;  3M3Z A;  2A41 A;  4BR5 A;  3K9K A;  3C6A A;  5C10 A;  3CHW A;  2NRW A;  2QWO A;  3CIP A;  1U2V A;  2WC9 A;  3F9M A;  3GBT A;  4ISF A;  4MLE A;  4IEE A;  5AQL A;  5DM6 L;  4FWK A;  1DKG D;  3ZEU B;  3HI0 A;  3GE1 A;  1YIJ N;  2PBD A;  1NMD A;  3WXL A;  1ATN A;  4M7X A;  5EVZ A;  4BRC A;  4MDA A;  4DB3 A;  3VF2 A;  1BDG A;  1K9M O;  5EXW A;  5BRD A;  1GLD G;  3CQY A;  3O9U A;  3KHY A;  1ATS A;  4JHD A;  3CPW M;  2NZT A;  3C7N B;  2ITM A;  2QWR A;  2P9N B;  4QS9 A;  2CGJ A;  3E66 A;  5BR9 A;  2D0P A;  4CBX A;  4YOY A;  2GUP A;  1Z6R A;  4FWQ A;  4EHU A;  5GIN A;  3M6G A;  2BTF A;  2KKZ A;  4H0P A;  5F1X A;  2P9L B;  3WXJ A;  1GLB G;  5BPM A;  2IVO A;  3DLL L;  1M1K O;  4B1Y B;  4BY9 C;  4I6M B;  3ULE A;  4BRO A;  3G4S N;  5M1F A;  3LDP A;  4K25 A;  2RHK A;  4KH4 A;  2GWJ A;  5AQS A;  1VQ7 N;  4R79 A;  2QWQ A;  4FWS A;  3CXC M;  3GG4 A;  3BUZ B;  2WUS A;  4MO4 A;  5AQV A;  3WT0 A;  2HBM A;  3TSP A;  5JVG L;  1SS6 A;  3ID8 A;  1GLF O;  4YOW A;  2E2N A;  3VEX A;  3CJB A;  5CR4 A;  1HLU A;  4PHT X;  2CGK A;  2NNW A;  1YVN A;  1GLC G;  4WFB L;  4BQL A;  4DQ8 A;  5M1N A;  5F2R A;  2A40 A;  4BG8 A;  4UY8 O;  3CD6 N;  2ASP A;  3KVG A;  3P31 A;  3TSQ A;  3QBX A;  3N4P A;  4AF1 A;  5AQO A;  2GTD A;  1EQY A;  3VGM A;  1O13 A;  2Q1N A;  4FWR A;  2GEL A;  5LY3 A;  3O6W A;  1R59 O;  1KAX A;  1YJW N;  4IWV A;  2JWK A;  1VQ4 N;  4EIA A;  1BWF O;  4CZF A;  2ZWH A;  3W0L A;  1X3M A;  3AAR A;  1JCE A;  1KC8 O;  4JK9 A;  3EL2 A;  3FFK B;  3MN5 A;  4CBW A;  3PLA A;  3DAW A;  4Z94 A;  1NGF A;  3HTV A;  3BEX A;  3VEN A;  1YXQ A;  3O9T A;  3GOI A;  4IZ9 A;  4WF9 L;  3H6E A;  3OBW A;  3CI5 A;  4EHT A;  5JLH A;  5AQJ A;  2GEM A;  3CJ1 A;  1GLA G;  3P4I A;  3J8A A;  5BN9 A;  3A8Y A;  5AQX A;  4FL9 A;  1MWM A;  3CET A;  1NGI A;  5B8H A;  2UYT A;  3A5N C;  3O4W A;  2DPN A;  4BRF A;  2P9K B;  3CCJ N;  2NRX A;  3I8B A;  4IXC A;  3VET A;  2OAN A;  5C2D A;  2QW9 A;  4FWM A;  4H5W A;  3CF5 L;  1S22 A;  5ADX A;  1NLV A;  1OVY A;  2NRH A;  4PL8 A;  1DT9 A;  2YI1 A;  3KWG A;  4IOX A;  5AQI A;  2HF4 A;  2WFB A;  5DM7 L;  2HF3 A;  3I56 N;  5AFU A;  3GDQ A;  3UKU B;  2QWP A;  2E1Z A;  1WOQ A;  3SAF A;  4GV6 A;  5M1P A;  5AQG A;  3JS6 A;  5AZJ B;  3RSE B;  5AZI A;  3G71 N;  1GLL O;  5TKW A;  3VES A;  1GLJ O;  5GIP A;  5AQU A;  3CC2 N;  4JNE A;  5BN8 A;  5MLC Q;  4WFA L;  4OPH A;  4PKI A;  4B1U B;  1BO5 O;  4BR4 A;  3AAP A;  1QQN A;  3CJ7 A;  3E9O A;  3QML A;  1VQ6 N;  1NGH A;  4IJA A;  1J6Z A;  4HTL A;  1VQM N;  3O5B A;  3LL3 A;  3H3N O;  4Y0W A;  4NB4 A;  3SMP A;  2HMP A;  3O1B A;  3SJH A;  3VEO A;  3WUH A;  4IOA L;  3EZW A;  4M7Y A;  1QQO A;  5AQN A;  3MWT A;  3ENO A;  4BRL A;  1YJN N;  3QBW A;  1TYQ B;  3CCL N;  1VQP N;  1N8R O;  1IG8 A;  3EKU A;  4B1Z A;  4C1N K;  3E9P A;  4H03 B;  4CZJ A;  3D2E B;  3SAG A;  2E20 A;  2JWL A;  2NRZ A;  4MO5 A;  3SBG A;  3OBY A;  3QFU A;  2QI2 A;  2PAV A;  3WXI A;  2E2P A;  2FF3 B;  1TUU A;  5GAH P;  1NGA A;  5JLF A;  3FZF A;  4BVO A;  5ELZ A;  2AP1 A;  2H3G X;  1ZBS A;  3T69 A;  1IJJ A;  5EY4 A;  3HOS A;  3A5L C;  2P9P A;  1HJO A;  5AR0 A;  4BRP A;  1E4F T;  4H5V A;  2A6A A;  4IO9 L;  3ENH A;  2HBK A;  3G25 A;  3OA9 A;  5AQP A;  4H5R A;  4GV9 A;  4XEI A;  4BC5 A;  4GV3 A;  4BRD A;  1ILY A;  3C0B A;  3F5T A;  4H5N A;  4JD2 A;  5JIC A;  3FZK A;  3O08 A;  4CD3 A;  4H0V B;  1VQK N;  2HBJ A;  1JCG A;  3D6R A;  3EN9 A;  4WYB A;  5HOO A;  3CCM N;  1VQ9 N;  2YCH A;  3BF3 A;  1XC3 A;  1XQS C;  4H0T B;  5GAE P;  1QQM A;  2FSN A;  3IDH A;  3OHR A;  4IJN A;  4JEP A;  2F7T A;  5AQW A;  5C2F A;  1YIT N;  1NGE A;  2P9S A;  3MK6 A;  1YJ9 N;  1GLE G;  2ZGY A;  4BRI A;  3WEE B;  1Q81 O;  3A5M C;  1X9J A;  3EE9 A;  3IKM A;  1YAG A;  4BC2 A;  4C23 A;  2V7Y A;  2E2Q A;  4U67 L;  4DHY A;  1ZXO A;  3CCU N;  1S72 N;  3I33 A;  3NMU A;  5BRH A;  3SLC A;  5GAD P;  3LDN A;  3BP8 A;  2FSK A;  2VGN A;  2CH5 A;  4EFH A;  4QS8 A;  3C7N A;  1TUY A;  3MCA B;  5C12 A;  2P9N A;  5KPT A;  3P38 A;  5AQQ A;  4K43 A;  3LDQ A;  3GL1 A;  5M1Q A;  3NVM A;  3SBT A;  5CHI A;  3VER A;  4WFN L;  1HKC A;  4G9Z A;  4BRA A;  2KLA A;  1ESV A;  4JK8 A;  3VGK A;  1V4T A;  4DCH A;  4ILG B;  4BR2 A;  4I6M A;  5KQD A;  3QFP A;  4CZK A;  1HX1 A;  4JKF A;  3ATU A;  4BC4 A;  3HSC A;  2QXL A;  4A5A A;  1KD1 O;  1VQ5 N;  4KH5 A;  3R8E A;  2HST A;  3HZ6 A;  4JAX A;  3MN6 A;  3W3D A;  4OO1 J;  2D1K A;  4B1X B;  3HRG A;  1E4G T;  3UB5 A;  2J4R A;  3FZH A;  4A5B A;  5KPZ A;  2V52 B;  3O1W A;  3UKR B;  5JVH L;  2QWM A;  2ZGZ A;  1MA9 B;  1HKB A;  3BF1 A;  4JK7 A;  3CCQ N;  2P9I A;  4H5T A;  5I9E B;  1JJ2 M;  4XH4 A;  4AM7 A;  2HOE A;  2P9U A;  2EWS A;  3H1Q A;  1D4X A;  1CZA N;  1SZ2 A;  4BG9 A;  3OW2 M;  4K42 A;  4BVP A;  1W2B M;  1P90 A;  2ZJQ L;  1JCF A;  1QHA A;  2QWN A;  3D2F B;  2KHO A;  2IVP A;  3M5R A;  4IO8 A;  4FOI A;  3TU5 A;  3ATV A;  4GVE A;  5AQM A;  3ZET A;  4U7B A;  3SMS A;  3WQT A;  3T7Z A;  3CC7 N;  3FZL A;  4FPB A;  3D7E O;  1NGG A;  3ZX3 A;  5TKY A;  1H1V A;  4CZL A;  2I7P A;  3DXM A;  3U9D A;  2V7Z A;  2YJF A;  3O8M A;  5H1S Q;  2VWB A;  4NLB A;  3L4Q A;  3Q7C A;  4WQ5 A;  3H46 O;  3S41 A;  5F0X A;  3CC4 N;  4JKG A;  1KQS M;  4MLH A;  1BOT O;  1HPM A;  4FOE A;  3TTC A;  5HL7 L;  3CPE A;  1QZ5 A;  5LJW A;  2Q0R A;  4RWT A;  3C65 A;  4DKW A;  2F9W A;  1VQN N;  2A42 A;  4BGA A;  1VQ8 N;  5M1O A;  4RCH A;  3N4Q A;  1U6Z A;  4WQ4 A;  4XH5 A;  4A57 A;  3HBT A;  3QIC A;  2VYP A;  1RFQ A;  3VMF B;  4BGB A;  1K8A O;  3DXK A;  4BRM A;  2Q2R A;  4CZH A;  4AM6 A;  4IOC L;  2QWL A;  5BPL A;  1BUP A;  3HM8 A;  4ILH A;  2W41 A;  1Q82 O;  1NGD A;  3LM2 A;  3U8X A;  3VF4 A;  1QZ6 A;  2Q31 A;  4A2B A;  4BR7 A;  1M90 O;  2BH1 A;  4YOT A;  3H45 C;  3SK3 A;  4BRN A;  3AAQ A;  1YUW A;  3MWP A;  5AFU H;  2W40 A;  1VQO N;  1U2V B;  3FR0 A;  4JKH A;  3SAH A;  2P9P B;  1T6D A;  2CGL A;  2A3Z A;  3NVK A;  3VEW A;  4IDH A;  3O80 A;  4J8F A;  2YJE A;  5BPN A;  1VQL N;  1K8K A;  4JN4 A;  4BR9 A;  1C0G A;  1YF5 L;  2ZJR L;  1Q18 A;  4CZE A;  4JD2 B;  3CCV N;  1YHQ N;  1HUX A;  1RGI A;  3R9P A;  3E9L A;  2AA4 A;  1VAZ A;  4A2A A;  4JHD B;  4BRE A;  2OTL N;  4JKE A;  3A0I X;  4PKG A;  3CJ9 A;  1KAZ A;  3O9R A;  2BUP A;  3L6Q A;  1BG3 A;  3R1X A;  5GIO A;  2P9S B;  2PFU A;  2FSJ A;  4FWP A;  3ENB A;  1DEJ A;  4JKD A;  5AQZ A;  1NWK A;  3TTD A;  3CCR N;  3LDO A;  1YI2 N;  2V51 B;  5AQK A;  3VEZ A;  1BA0 A;  1NBW A;  2YHX A;  1SAZ A;  3ULE B;  4EAH D;  4JKB A;  2I7N A;  1Q86 O;  1BU6 O;  4FSV A;  3ZEU A;  4B1W B;  2RE2 A;  2Q97 A;  3K9J A;  4YOU A;  4IEI A;  3WQU A;  4FO0 A;  3TPQ A;  5M1K A;  5AQR A;  4ISG A;  3P39 A;  1QVF M;  4FWL A;  1KAY A;  2YHW A;  1Y64 A;  3CJC A;  1Z05 A;  3VGL A;  5FPD A;  4QS7 A;  4M63 C;  1KXP A;  1X3N A;  3H3O B;  3MN7 A;  3DJC A;  1EO1 A;  2Q0U A;  3Q7B A;  3VOV A;  3AY9 A;  4WQ5 C;  4JKC A;  3ZX0 A;  4OPA A;  3ID6 A;  3JXU A;  3WEE A;  5AQH A;  3FLC O;  2QA4 N;  1HKG A;  3WXM B;  1S3X A;  2P9L A;  4L3Q A;  5JMV A;  3CCS N;  1C0F A;  3VTH A;  2A5X A;  3PIO L;  4YDU A;  5FPN A;  1MDU B;  3FZM A;  3IMX A;  1NGB A;  3VF6 A;  4WQ4 C;  4CZG A;  4GY2 B;  4A59 A;  4O8K A;  3QDK A;  5E26 A;  2YX6 A;  4NO7 A;  4CI6 A;  4CD1 A;  3KZB A;  1DGK N;  1G99 A;  1T44 A;  2QEX N;  3MX2 A;  4XH1 A;  3I55 N;  3RVC A;  3U4L A;  3FGU A;  1W97 L;  2P9I B;  4KH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...