4WCEL

The crystal structure of the large ribosomal subunit of staphylococcus aureus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
110
structure length
110
Chain Sequence
MISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKGVTLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYLYHGRVKALAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S rRNA
publication title Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4wceL01
3CXCM 5JVHL 2QEXN 2OTJN 3CCUN 3CC2N 1VQLN 3I56N 1VQ5N 1M1KO 3J7ZO 1YJWN 1N8RO 3CD6N 2OTLN 1YHQN 1S72N 3OW2M 5H1SQ 3CCLN 3DLLL 3I55N 5GAHP 4WFAL 3CC4N 1W2BM 1VQ7N 1NJIO 3G71N 1VQPN 1YI2N 1KQSM 4IOAL 1K9MO 1YJ9N 4U67L 1ILYA 3CCVN 1VQMN 3G4SN 1VQNN 1VQ4N 3CPWM 1QVFM 5MLCQ 5HL7L 3CCSN 2ZJRL 1Q82O 1KD1O 2QA4N 5GAEP 1OVYA 1VQ8N 1M90O 5GADP 3CMEN 2ZJPL 3CF5L 5JVGL 1Q7YO 1QVGM 1YITN 1VQON 3CMAN 3PIPL 4IO9L 3CC7N 2ZJQL 1VQ9N 3G6EN 1Q86O 1K73O 3CCJN 1VQ6N 5GAGP 4WFBL 5DM7L 5DM6L 3PIOL 4WF9L 4IOCL 4UY8O 3CCQN 1K8AO 4WFNL 1JJ2M 1YJNN 1Q81O 3CCRN 1YIJN 1KC8O 3CCMN 3CCEN 4WCEL 1VQKN
chains in the Genus database with same CATH superfamily
3D7EO 1BA1A 3EO3A 3CCUN 2QM1A 1WSIA 4PQUA 2QKBA 4FO0A 3S41A 3OYIA 3TARA 3MN6A 3OYFA 4RCHA 4KAZA 4BREA 3EEQA 3QICA 4F8RA 3F5TA 2FBTA 4DTXA 4E1JA 3KK3A 3TTDA 3QETA 4G9ZA 1WSEA 3OYKA 1H1VA 1BL3A 4B3SK 1YT3A 4FLUA 4JHDA 4JI6K 4Z4HA 4IG3A 2QXFA 2HVIA 5B8HA 3CI5A 3MMVA 5F2RA 2JWLA 1K9MO 3VQDA 2ZGYA 5BR8K 3DWLA 3KVGA 1NMNA 2FBYA 1TK8A 1BDGA 1NK8A 3JYTA 1OVYA 4CHQA 4BRGA 3SI6A 1HJRA 4F2RA 3SQ0A 1NU0A 4J2AA 3MEDA 4RW8A 3C7NA 3VEXA 3H1QA 4DU3A 4RG8A 3QO9A 4CZEA 4DQRA 3OJUA 3L8BA 3C94A 3KLHA 1NMDA 5AQNA 4FJIA 2RN2A 4DR6K 2A6AA 1SL0A 1JLEA 2O4GA 1NGDA 4KBOA 2ASPA 4H4OA 3E9OA 2P5GA 1QSYA 1EO1A 3QB0A 1MDUB 3TAFA 4HUFA 4LF6K 3BEXA 5HOOA 4EIAA 4FYDA 4PUOA 3C95A 2XY8A 3VERA 4O0IA 3SMSA 3BF3A 5CY4A 3VEOA 5M1FA 3SBTA 1VSFA 3A5OC 3AO4A 2OTJN 5HROA 3CFOA 4LD0A 4FLYA 4E7IA 5ADXH 4B1VA 1JLFA 3DLEA 5BRHA 2VCPA 4FW2A 3WT0A 2G8UA 4E1NA 1K8KB 4M63C 3N4QA 4CGFA 2OTLN 4JKGB 4KI4A 5K14A 3WXJA 4KFBA 1SKRA 1OVQA 2NRHA 2UUBK 3LP2A 3FR0A 4FLZA 3VF2A 5AQJA 5AQSA 4BVPA 4CGJA 2OPQA 4LFAK 4LF4K 3VGLA 4DLEA 2I7PA 3SNNA 4AM6A 3WNEA 2HSTA 1ZBUA 3L6QA 4C8KA 4CFBA 3RRHA 1KQSM 4FWKA 4I7FA 1IO2A 2OANA 2P9NB 4GKJK 4J8FA 3EKUA 3D2EB 3PV8A 4FWSA 2E20A 2HF4A 3DLKA 3THXB 4CECA 4PKHA 2WTUA 3HOTA 2DFFA 3P31A 1LOTB 5GADP 3M1FA 2HBMA 3R3LA 4FM0A 1IKWA 3RSEA 3THWB 2CGJA 1D9DA 2A1RA 4CJ3A 3TTFA 3VTHA 5AJ3K 2NZTA 3R8EA 4BE0A 3O9QA 1X1PA 3LDSA 2WBNA 4OO1J 3C6UA 3O3HA 3O8MA 5AQQA 3V1OA 4UY8O 4DV5K 3UKRB 3VEWA 1T6CA 1IBKK 1J5EK 2F9TA 3ZLJA 3CJAA 1JCGA 4EHUA 4O8KA 4GVMA 1X9SA 1NLVA 3QEWA 3OS0A 3SK3A 3ZX0A 3QEVA 2ZM6K 3NAEA 1REVA 4Z0UA 3U8XA 3CCEN 4FVUA 1DEJA 4V19S 3SJHA 3LPUA 4FWOA 1WOQA 3PY8A 3MEEA 1HUXA 4LFCK 1WSJA 3QMLA 3C65A 1VHXA 3FZFA 4BRIA 5H1SQ 3OHRA 4B8CA 3HP6A 2P9NA 4I9QA 3TAQA 3D2EA 1TGOA 4XH1A 4YOUA 4CJEA 3DLLL 4M3TA 3AVKA 5SWMA 3THXA 3F9KA 3ISNC 5HRRA 4CZGA 2UUCK 1W2BM 4KPYA 3VEZA 3S3OA 1FXXA 2OZMA 5KQDA 3L2VA 5T7BA 3J7YP 5I3UA 4JI0K 3VEVA 2O8BB 1S6QA 3OYMA 1QQNA 3FZLA 4FWQA 3THWA 4I6MB 4LC9B 4KB0A 4CJUA 3A2FA 1EQYA 4FK4A 3LALA 3M8SA 3T19A 4OVLA 1IKXA 1Q82O 3LAMA 1BOTO 3VMFB 4CESA 1RBUA 4Y0WA 4CFAA 1LW2A 2DY4A 4H0YB 1HPMA 3DRPA 4DQ8A 3TAGA 3LDNA 2UXCK 3L4QA 4A57A 3I0SA 4FLWA 3WNFA 1QQMA 3NBPA 3NE6A 1LV5A 2XY7A 1VQ6N 4WFBL 3NF7A 3KZBA 1OH8A 3HK2A 1S6PA 3PIOL 2BTFA 3CCQN 1TVRA 2GTDA 1I94K 2Q3SA 5KRSA 4HWIA 5I42A 4ICLA 4KV8A 4AHSA 2ZD1A 3V1QA 5M1KA 3F73A 3HPHA 2WC9A 4C23A 1KAXA 4KH5A 4JK7A 1F21A 3CIPA 4XH5A 5JVHL 3LL3A 3VQCA 3FFKB 1SAZA 2QK9A 1HNXK 3PO5A 3LDQA 4CI6A 1L3TA 4CZKA 3SUQA 1IBMK 3G25A 3CCLN 1T3VA 1JLCA 3K9JA 1GLDG 3K0SA 1L3VA 3OS2A 2P9KB 1WUAA 5TKYA 1KVAA 3WQUA 2E8AA 4IBNA 1NJIO 4BC4A 2XHBA 4DR1K 1WSGA 2IAJA 2XY5A 4B3OA 2D0CA 4DS4A 1ZBLA 1BI4B 1BIUA 2NRWA 3ENHA 1J6ZA 3U9ZA 3WXLA 2YNHA 1VSKA 1XMQK 1N5YA 3CPWM 2DFEA 2Q31A 3A5LC 1D9FA 2A42A 2V7YA 4RW6A 3FZHA 2KTQA 3KWGA 1XHXA 3MN9A 4EHTA 5GIOA 4YOYA 4J2BA 3GOIA 5JVGL 1QVGM 4JI4K 4BC3A 3IMXA 1NOYA 1TKDA 3B6PA 4KB1A 2FLOA 4K43A 4DTSA 3EKSA 2YNIA 2RPIA 4CHNA 3B6OA 4DU4A 5CR4A 3U3YA 3E9LA 2E1YA 1QSLA 1VK0A 4M3ZA 3AVHA 2F9WA 4DR4K 3HVTA 3O80A 5AQZA 1QHTA 2E2PA 4XIUA 2CH6A 4PWDA 4W5QA 2DFHA 4OPAA 1QTMA 3U6FA 2NRZA 3L3VA 3GG4A 2G8HA 4AILC 2Z1GA 5FRNA 4FJ9A 3VQPA 1UWBA 2IVNA 2QXLA 4B3RK 3D0PA 2BUPA 1RDWX 1ZBHA 2O8DB 1J5OA 3CETA 4H03B 4L3QA 3VQQA 3CJ9A 4N56A 5KGXA 4CIGA 1NJXA 2P9LB 2Q1NA 3QDKA 2P9KA 4BE1A 4CJRA 1T6DA 4R79A 4QS8A 3V9ZA 4O55A 3IDHA 4FJ5A 1CZ9A 5SZTA 1QZ5A 3TSPA 3BGRA 1IG8A 4BR9A 1BQNA 3QBWA 4BE2A 1KCFA 4E89A 5KRTA 3LZIA 4C8OA 2WFBA 2O8EB 1UA1A 3A0IX 2Q0RA 3TSQA 4ZHRA 3LWLA 1EXQA 1XWLA 1BI4A 1U48A 4CFCA 5J1EA 3KLIA 2PZSA 4JKEA 2HBKA 3HXMA 4CD1A 2IIRA 1S9GA 3VQ8A 3ULEB 4OLAA 2EWSA 3QEXA 4BWJA 2CH5A 5KGWA 2YV0X 1UOCA 2QWRA 1WNSA 4OX9K 4JKAA 1CLQA 2B5JA 3R6MA 1Q9XA 4IZ9A 2E2NA 2ZF5O 4AHUA 1QS4A 1YXQA 1NGBA 3KKRA 5LMNK 5EY4A 1GLJO 4ISGA 4YORA 3ZSYA 3MCAB 3HJFA 1V4SA 4WQ5C 4XEIA 4EZ9A 2ASMA 4HVJA 4CK2A 4YOWA 5HLFA 3IAYA 1U47A 3DLGA 3KK1A 1TL3A 1DTQA 1WN7A 3GE1A 3WNGA 2WUSA 4QAGA 4FPAA 4JI2K 3VTIA 3HBTA 4DR7K 5AQYA 1HKGA 2YHBA 4W5NA 4FJ8A 3EL2A 4MO5A 4H5RA 2O8DA 5DM6L 4H0PA 3ZSZA 1Z6RA 4H0XB 2PAVA 2AJQA 4CZJA 1K8AO 1VSMA 4IFYA 1C6VA 2P9LA 4QCLA 3T69A 3PX0A 3P1GA 1E4FT 2QTDA 3AVBA 3EE8A 5ADXA 4DTOA 1SL1A 2FF3B 3E1YA 4WCEL 3V9SA 3CG7A 2G8KA 5LL6Z 4FM1A 1NKBA 4IWVA 3EN9A 5ELZA 4CEAA 3RRGA 5FROA 4JKFA 3BZKA 1HYVA 2D0AA 2D0OA 4KO0A 3I56N 4BROA 3L3UA 5IWAK 3DI6A 4OPJA 3OBYA 1NGAA 4NXMK 1GLFO 3GDQA 5EU7A 2I7NA 4H0OA 1HLUA 4BG8A 3AVCA 2KFNA 1SS6A 1JLQA 4E7HA 2IGIA 4M7XA 4AHVA 3QFPA 1GOAA 4CEDA 1LW0A 3H46O 3OYDA 3AGRA 1JXBA 5F1XA 4KHQA 1NKEA 2AA4A 4B9QA 4YHHK 4PKIA 3RMAA 5HBMA 2HHXA 3TWHA 3O5BA 1WSFA 3I8DA 3R1XA 1N36K 2E5LK 2GEMA 4IOAL 4NCAA 4BQLA 2ETJA 1D5AA 1NGHA 4LF9K 3Q7BA 4FSVA 1I3AA 1TUUA 3A8YA 1J9AA 5KPRA 4NXNK 4JK9A 2ATQA 2FSKA 2YHWA 2Y1JA 3DYAA 2IVOA 1KFDA 4E1MA 3BP8A 1L3UA 1X9JA 4FJKA 4JV5K 5GIPA 1XNQK 3QEPA 4B1XB 5JS2A 4DV6K 3TAEA 4MDBA 3E01A 3J81O 4CBXA 3KD1E 4J2DA 2HB5A 1ZBFA 1S22A 3NVKA 1HJOA 3F9MA 1D4XA 2ZJQL 3O9SA 2H3GX 4GKKK 2UXDK 2O8FB 2FBXA 4BC2A 2Z1JA 2HHSA 2P1JA 4FLVA 4CERA 2I5JA 2HHWA 2EHGA 4DLGA 4BGAA 1S3XA 4E7KA 3CJCA 3FGUA 1DKGD 2W42A 1GOBA 1LAWA 3PSFA 1YUWA 4ILGB 1YJNN 4C8LA 3WNHA 3HPOA 5C0YA 2UYTA 3DM2A 2HBJA 3WUHA 4X64K 1JXEA 4CFDA 4M42A 3NF9A 4CJKA 4KI6A 4M3RA 3QEIA 3TI0A 1C0GA 3OYNA 3SAFA 1IBLK 2W6LA 4DU1A 4FZXC 4ELTA 1VQLN 1ESVA 1RT3A 3AVMA 4N5SA 3AAQA 3HO1A 3W0LA 4OKKA 1S72N 4E7JA 5AQGA 4CHPA 1EKEA 2Z1HA 2E2QA 4AHRA 2D5RA 5M1NA 4MDAA 1S1UA 1JLAA 2IDOA 4FWNA 3RVCA 2UU9K 4BGBA 3MX5A 3TTCA 4H5NA 3NHGA 2CGKA 4BACA 1RCHA 1SUQA 3MN5A 4DTUA 3T1HK 4CJVA 1HNZK 1YJ9N 4OJRA 3SCXA 1HYZA 3RMBA 3AY9A 4FXDA 1VQNN 4BRNA 4DV2K 1RTHA 3F2KA 4DG1A 5KPZA 1QVFM 1W0HA 4A5BA 2VWJA 2ZJRL 1JLBA 2O8FA 4DHYA 3QFUA 4CGHA 3SPYA 3ZT1A 5J2NA 3MAQA 3KTQA 4QOZB 4KRFA 3G0ZA 4OGEA 4L8RB 5KPTA 2WONA 3K9KA 2ZJPL 1C1BA 1N34K 1XI1A 3AO5A 1Q7YO 3QERA 4FLXA 4ZTFA 3NH2A 1JL1A 4BR4A 2HHUA 3DXMB 5M1OA 2W6KA 1FW6A 5GINA 3CYMA 1KRPA 3SZ2A 3O1BA 5KTQA 1Y97A 3L2WA 4OKJA 1ATSA 2ITGA 3TU5A 3T1AA 3K2PA 3MXJA 4DQSA 1O1WA 1MU2A 3P39A 3VGMA 2E6MA 4BR0A 2QKKA 5EVZA 3SBGA 5TKWA 1NK4A 4ZTJA 3HSCA 2P5OA 3MEGA 1Q81O 4EZ6A 4BRCA 2UXBK 1KC8O 3QINA 2Q2RA 5J2PA 3ASMA 3LAKA 4KTWA 1A5VA 2HHHK 3OVNA 4BR2A 4E7LA 4CZMA 4CBUA 3C0BA 4EP5A 3B8AX 4DUYK 2HBLA 1VQ5N 2QWPA 1C0FA 3SQ1A 1NGEA 1D8YA 4ELVA 3OYCA 3OW2M 3NDKA 4DQQA 3OTOK 3MWPA 3HVRA 1K8KA 2E1ZA 3OYAA 1HQEA 4JKGA 2QWNA 2GUPA 5GAHP 3PO4A 5AQUA 4WFAL 3R9PA 5EOYA 3KLEA 3HT3A 2VGNA 3NVMA 4OLBA 2ZQBA 1VQ7N 3BZCA 3OYBA 4MLHA 3NGYA 3RR7A 5AQLA 5HRSA 3KHYA 3VEYA 3HM8A 3FZMA 5BN9A 3M6GA 1WBDA 2A1SA 1BO5O 1ILYA 4FWRA 3DXMA 4NO7A 4CF8A 3LANA 1VQ4N 2R7YA 1RBVA 4FJXA 3DRSA 4EAHD 1RTIA 3NMUA 3ZCMA 4HTUA 1E3MA 4Z4IA 4LF7K 3E9PA 3OYEA 1BA0A 3AA5X 2HNDA 3KKSA 4PL8A 1ITGA 1GLLO 1QQOA 4YDUC 4X62K 4O44A 1YITN 3FZKA 3M8RA 3QLHA 3DLHA 1QE1A 3H3OB 5AQKA 4LF5K 4BG9A 3ZSWA 3VENA 4RW7A 4K42A 4QS9A 4CJ5A 4CJQA 3HZ6A 3VA3A 3VQ5A 1GLEG 3NH0A 1Q86O 1HR0K 2QWOA 4A59A 3O1WA 4CGDA 2P9UB 1NG9A 3KWIA 3D2FB 3VQEA 1LWFA 2OPRA 1WLJA 3ZSOA 4M41A 5AQXA 2OPPA 5M1QA 1QZ6A 3UKRA 4DWIA 3QNOA 5BR9A 1EP4A 3O3FA 1NGGA 4RW4A 4DV0K 3VESA 5CYMA 1C0UA 3O4WA 4GY2B 3FLCO 3SQ4A 3ZSQA 5JLHA 1I39A 1KVCA 1QQCA 4CEEA 3WXKA 1RILA 3LWMA 3AO2A 1LAVA 2B4JA 1M1KO 2YJEA 4E19A 3BDPA 3SLCA 3O4QA 2G8IA 4BRKA 4CBWA 2BDPA 4B1ZA 5CE3A 2RKIA 4O5FA 1ASWA 4NB4A 4FOEA 4JN4A 3AV9A 3CM6A 4DSLA 5HP1A 2YNFA 4LH4A 4AHCA 1VRUA 4BDYA 3QBXA 1UAXA 1TK0A 3GBTA 3ATUA 4A2BA 1LWCA 1ZBIA 4U67L 3RMDA 5AQWA 3M8PA 3CCVN 3G4SN 1RT5A 3K5LA 1Q18A 2O8BA 3S9HA 4N41A 4N76A 4B9NA 4I6MA 3WXIA 3CCSN 2YHAA 3LZJA 2Q36A 4DUZK 4KKOA 4H5VA 1DGKN 3N4PA 2GX9A 3Q7CA 3D2FA 5C2DA 4NYFA 3O3GA 3ZT3A 3V6DA 1VQON 1ATNA 4LF8K 5AQVA 1ATRA 3UIQA 5AZJB 4BWMA 1WAFA 3C6AA 1VQ9N 1BG3A 4DFMA 1K73O 3O4NA 3P4IA 4HTLA 2VQEK 1NBWA 1C1AA 1VSDA 1HNVA 4PHTX 4LFBK 3V9WA 4CJ4A 2W41A 4DSKA 4JI5K 4BDZA 4YY3K 4M3XA 4JRPA 3QESA 2VWBA 3L0QA 1R0AA 3WXMB 5AFUH 3AO1A 2RE2A 2ASOA 5A2QO 1KFSA 1S9EA 2HF3A 2HNZA 5CYQA 5BRDA 2F8TA 1S5JA 5HRNA 2KZZA 4NLCA 2A3ZA 1T7PA 1ASVA 4BRMA 4CEZA 4DFKA 2GUIA 1WAJA 3ZEUB 4IO8A 4DQIA 1NGJA 1ZXOA 1TL1A 4BDPA 1WSHA 1QHAA 2P51A 4RW9A 2HW3A 3T3FA 3JXUA 1NK9A 4CJFA 3PX6A 1Z05A 4CHYA 1CXUA 4H0VB 4A62A 4FJJA 5I9EB 5AQMA 4KHWA 1X9MA 4WE1A 4CJ7A 1TKZA 2VG7A 3L2RA 2KW4A 4WQ4A 4DV7K 5J2QA 2V51B 3ZX2A 4JS4A 3CJBA 3MWTA 2IS3A 1E4GT 4DSFA 5AQOA 1DT9A 1ZC6A 3SV3A 3V4IA 3M3ZA 4FZYA 2J4RA 5DMRA 3G71N 2ITMA 4NLBA 2YNGA 1W7AA 2HMIA 1W9HA 3I0RA 5AR0A 5AQIA 3HP9A 3L4IA 5AZJA 4RWTA 1RT4A 3O9RA 2Q0UA 2HVHA 2F4VK 3ZT2A 1JCEA 3OS1A 1RT1A 1TKXA 4JNEA 3ZSXA 1TYQB 4MQ3A 2X6SA 1M90O 4O8UA 4FZZA 4B9VA 1U49A 4CZLA 3QIOA 3H1VX 1EX4A 1NK0A 1GLCG 1JCFA 4DFPA 4GV3A 1Z26A 4MO4A 2E6LA 4FW1A 3MN7A 4YNQA 3E66A 4BRPA 1NK6A 3H6EA 3CQYA 3CHWA 3ZEUA 3KK7A 1OH6A 3CPEA 4BC5A 3LP3A 4B3TK 4G1QA 1V4TA 4YOXA 4B08A 1YTAA 3T1YK 1L3SA 1HNIA 4HUGA 4E3SA 3SAHA 4DV1K 4K25A 4CEBA 4JRQA 5C12A 4BRDA 4FPBA 1NJWA 5C25A 2OZSA 3VQ4A 1R59O 3ATVA 1VRTA 1RFQA 2D4WA 3RWUA 2JGUA 2QEXN 4KHNA 5HRPA 2BGGA 4ID1A 4NYNA 3CC2N 3J8AA 4H8KA 3CFRA 4BRFA 5IT9O 3OYJA 3KLFA 4FOIA 4CD3A 1YF5L 3J7ZO 1JLGA 3EYZA 1YJWN 1UA0A 3CD6N 1GLBG 3IUCA 5C2FA 3IG1A 4AQYK 4DF4A 4CEOA 5AQFA 2P9PB 1W97L 2UUAK 2NLXA 2O8EA 2FC0A 4DSJA 3WEEB 3I55N 3IRXA 1RTJA 3PUFA 1DLOA 4JKCA 1T44A 3UKUB 1BUPA 2QI2A 3RTVA 4JI1K 1T05A 4LSNA 3ULEA 4CJTA 1IG9A 4IDKA 3D6RA 4CJWA 1LCUA 2IVPA 1NJZA 1IJJA 5AQPA 4HCBA 4KHSA 3K58A 2V7ZA 1CZBA 1RDAA 3L2UA 3G10A 1JKHA 4FM2A 3CJ1A 3CM5A 1NGFA 4WQ5A 3P83D 5KQ8A 3VF6A 3DAWA 3O08A 3QIPA 4JI8K 3CMAN 3HL8A 2XY6A 3PIPL 4F3TA 3CERA 4B1YB 1YVNA 5CZ1A 4TSXA 4BY9C 4A2AA 1ZBSA 2QWQA 3G6EN 3KD5E 5C10A 5M1PA 2PYJA 3VOVA 4IFEA 2G8VA 2RF2A 4IG0A 4KHPK 3DLBA 2FBVA 3I8BA 1G99A 4DQPA 5AZIB 2G8FA 4CJSA 2IOCA 3SUPA 4UQGA 1U4BA 1WB9A 2KHOA 5LJVA 3BUZB 3LPTA 4DTJA 4CF1A 2KZMA 2O8CB 4B9MA 4JI7K 1KLMA 3WQTA 1GLAG 4NCGA 4CE9A 2KQ2A 2B6AA 5C15A 4GW6A 1Q9YA 4K0KK 2KLAA 2P9PA 4YOTA 4PKGA 3A5MC 4CGGA 3JSMA 3WEEA 3VQ7A 3SAGA 4IJNA 4B3MK 1TV6A 3UKUA 3JAMO 5E26A 2GWKA 4O5BA 3OJSA 3DOLA 3ZT4A 1VSHA 4H5WA 4F3OA 3SV4A 1IKYA 2FSJA 3J80O 4DSIA 2W40A 4C1NK 1BCMA 3AARA 3CC4N 1C0MA 1BHLA 3UE5A 4NCBA 4F2SA 2OPSA 1LWEA 3BF1A 5DK5A 2GBZA 3PX4A 5BN8A 3OY9A 1VQMN 3AA3A 1FKOA 3VETA 1A5WA 1MWMA 4HHTA 4C8NA 3NH1A 3VPZA 3VQ9A 1KD1O 3GL1A 2VWKA 3RSEB 4DR3K 4M3UA 4GV6A 4DV4K 3K59A 1S1TA 3RMCA 2A5XA 5BREA 4GVEA 4PA1A 5AZIA 4OPKA 2VG6A 4DTPA 4IFVA 2Y1IA 3ZYYX 4DFJA 2Q97A 2O8CA 1NGCA 4DTNA 4PY5A 4Z4EA 1EETA 2XRIA 5FDLA 1SQKA 3DJCA 3ENOA 1NK7A 4F4KA 3NF6A 3RR8A 3O9TA 1MWKA 4FJNA 1HKCA 2LSNA 5J2MA 1NKCA 4FJHA 4O0JA 2IC3A 3AO3A 4WYBA 5EX5A 2HOEA 3VN5A 3SJJA 1OH5A 5E84A 3T7ZA 5AQRA 2EX3A 1BQMA 4AM7A 5BPNA 2FF6A 3AVFA 1SKWA 4M7YA 4FWPA 3VQ6A 3FE1A 4FWMA 4K8ZA 1DTTA 4Y1DA 3CXCM 1G15A 4FCYA 3MDQA 3ID8A 2X78A 1O13A 3ZSVA 4DMNA 1N8RO 2OA8A 4B1UB 3MECA 5LY3A 4OPHA 1RDCA 3K5NA 2ZGZA 4ILJA 4CVNE 4I9LA 2D0BA 2JLEA 2QWLA 4B9SA 2RHKA 1Z25A 4CIFA 3OBWA 1NOZA 3NCIA 4JD2B 1SL2A 1BWFO 3AGKA 3OA9A 1S1WA 3SUNA 3DXKB 2E88A 3L2QA 4GMJB 4FVMA 3HI0A 3IFRA 3UB5A 1TK5A 4MFBA 4JS5A 3AA2A 4FL9A 5LJWA 4W5RA 3H45C 1FJGK 2ZWHA 3D45A 2A41A 4CCHA 3V9XA 2X6NA 2A40A 3LDPA 3DLRA 3P5JA 5MLCQ 1VSJA 5GAEP 4JKDA 3LDLA 1U04A 5JMVA 5EXWA 3BY5A 4DF8A 1OKJA 4BRLA 4DCHA 4JEPA 3CF5L 2NNWA 4LSLA 3M8QA 1NJYA 4FJLA 1IH7A 1S1XA 5KI6A 4W5TA 3V81A 5AFUA 3CC7N 1BIZA 2OCEA 3CCJN 2GWJA 3CQXA 5CHIA 4CF0A 1KVBA 5DM7L 4CZHA 1XHZA 4K8XA 3M5RA 3HPGA 4OGCA 1VSLA 3VQAA 1TUYA 2VQFK 2O4IA 3O6WA 3H3NO 4B8AB 4CJLA 3CJ7A 3TANA 2PBDA 4DSEA 1Q8IA 3CCMN 4BQZA 3AVGA 1J53A 2CGLA 1QSSA 4JI3K 1HPZA 2D0PA 4A61A 4FWLA 1VSIA 4LH5A 2P9SB 4CHOA 3V9UA 4GNIA 5FLXO 4EP4A 3DRRA 4BR7A 4Z4CA 1X3MA 4JD2A 3LDOA 3AVIA 3U9DA 4B1WB 1TAUA 1BGXT 4Q0BA 3DXKA 5BRFA 3K5OA 3HM9A 4DR5K 1A5XA 3ENBA 4C1NI 3ZSRA 5F0XA 1HNWK 2YX6A 2HMPA 1NM1A 3ID6A 3TAMA 4DS5A 1P90A 2E2OA 4FJMA 2FSNA 1K6YA 3NGIA 3PLAA 4BRQA 4DR2K 1ASUA 5FRMA 1B92A 1RGIA 1S1VA 4JKHA 2KKZA 3THVA 3AA4A 4HUEA 4PL7A 1B9FA 1HQUA 1KAZA 4ISFA 3NFAA 1KSPA 5JS1A 1T8EA 1VQ8N 2VGMA 3HSTB 4MLEA 3K5MA 1EWQA 3AVNA 3IS9A 1P8ZA 2HHVA 3TABA 2YJFA 3PSIA 4YDUA 2YI1A 4IO9L 2P9IB 4M3WA 1HYSA 3AVAA 4HCCA 4C8MA 5GAGP 3W3DA 1J54A 2DTUA 2D1KA 2DPNA 3ULDA 4YOVA 5JLFA 1YAGA 3EZ5A 1SZ2A 3MCPA 1BCOA 2P9UA 1RT6A 1YTUA 4ILHA 2P9SA 3OYHA 1RBSA 4AHTA 2V52B 3TPQA 5LMUK 4CIEA 3TSUA 1RDUA 4I2PA 4Z4GA 4WQ4C 4FJ7A 4IXCA 1KAYA 4FJGA 3EY1A 4JAXA 3C6TA 3ITHA 3AVLA 4CEQA 4A5AA 1NK5A 1YVUA 4ELUA 2PY5A 2NRRA 1RT2A 4O4GA 4N47A 4DV3K 1RNHA 1X9WA 5D3GA 4B9UA 2GV9A 4DKWA 3QNNA 3DOKA 3J7AP 1RDBA 2HNYA 1XUPO 2PFUA 4CF9A 4KH4A 1HKBA 3SPZA 2VYPA 1VAZA 3LM9A 3ZX3A 1U2VB 3MK6A 4M45A 1RBRA 1SV5A 4DB3A 2HHTA 2F7TA 1KTQA 4M3YA 4IJAA 4LY7A 1U6ZA 4F9OA 1YI2N 1NWKA 3TR8A 3HTVA 4ISEA 4EFHA 2NUBA 3A5NC 3C6HA 2X74A 4IKFA 5FPMA 2F96A 2JWKA 2P9IA 3TAPA 3ZETB 3CQ8A 5FPDA 4J2EA 2BE2A 3CFPA 4JKBA 2ZE2A 4JYAK 4GV9A 2NRXA 3SQ2A 3NF8A 4I2QA 2PYLA 2YHYA 3KLGA 3VGKA 4FK0A 1X3NA 3CMEN 1U45A 2BANA 4KREA 3S3MA 3VA0A 5AQTA 1FK9A 4AH9A 4E0DA 4H0TB 4KHYA 3S3NA 4CZIA 4CJPA 3OYLA 3P38A 1OH7A 2XO7A 1GOCA 4Q5VA 4CEFA 2G8WA 4IOCL 1CZAN 3THYB 4WFNL 1JJ2M 4B9TA 3KJVA 4YFUA 2YHXA 1YIJN 4JK8A 4R5PA 4CK1A 3OYGA 1VQKN 4IDHA 3U3GA 3KK2A 4CHZA 5C42A 1VSEA 4CZFA 1C1CA 3FFIA 1U2VA 4BRAA 3ZT0A 1RDDA 1Y64A 4KTQA 4W5OA 1BISA 2E4LA 4KTZA 1WBBA 1EWRA 2YKNA 3SMPA 4X65K 1RTDA 2QWMA 1FKPA 2NRVA 1YHQN 1NGIA 3AAPA 3U4LA 1NNEA 5FPEA 1N32K 5BPMA 1HMVA 1XQSC 3JS6A 3V1RA 5JICA 4DTMA 2F8SA 3O9UA 1T03A 1HX1A 3SYZA 1L5UA 4QS7A 4IEIA 4X66K 2Z1IA 3ZETA 2OYQA 2NRTA 2QW9A 5CZ2A 2KFZA 3HRGA 5BPLA 5AQHA 1TAQA 1VQPN 3LP0A 2YCHA 1XC3A 3VF4A 3K57A 4FK2A 4FLTA 2FXUA 3EE9A 4ID5A 2AP1A 4OKEA 1XC9A 1KLNA 4IOXA 4Z4FA 2WOMA 1IV0A 4H5TA 3VQBA 1N6QA 1HRHA 1BU6O 5HL7L 4BVOA 4JHDB 3HOSA 2QA4N 2HHQA 3EZWA 3KIOA 3NGZA 4KHUA 4BR5A 4XH4A 3I33A 1MA9B 1N33K 3LM2A 3THYA 3H08A 1TYQA 1CXQA 2VG5A 5E41A 1XNRK 3SUOA 3ALYA 1JL2A 3LP1A 3MXIA 3DMJA 3AVJA 1IKVA 4JLHA 1TKTA 4DTRA 4Z94A 2YKMA 4K41A 3MXMA 4CF2A 4AF1A 4WF9L 1B9DA 3MX2A 2GELA 3C7NB 5C24A 1ZYQA 4BRHA 1RBTA 3HYFA 4B9LA 1C0TA 4CW7B 3IKMA 3CCRN 1SKSA 4U7BA 4CK3A 4RTFD 5FPNA 4KH6A 2BH1A 4IEEA 4Y1CA 4H4MA 4CGIA 1XMOK 1KXPA 1RT7A
chains in the Genus database with same CATH topology
3D7EO 1BA1A 3EO3A 2P9LB 3CXCM 3CCUN 2Q1NA 3QDKA 2QM1A 3WXKA 2P9KA 1T6DA 4R79A 4QS8A 3MDQA 3IDHA 3ID8A 4FO0A 1M1KO 2YJEA 1O13A 3SLCA 1QZ5A 3TSPA 1N8RO 1IG8A 4BR9A 3S41A 3QBWA 3MN6A 4RCHA 4B1UB 2WFBA 3A0IX 4BREA 2Q0RA 5LY3A 3TSQA 4BRKA 4CBWA 3QICA 4OPHA 3F5TA 4B1ZA 4E1JA 2ZGZA 3TTDA 4G9ZA 4JKEA 5CE3A 4O5FA 4ILJA 2QWLA 2HBKA 2RHKA 4NB4A 4CD1A 1H1VA 2IIRA 4FOEA 4JN4A 3OBWA 3ULEB 4JD2B 2EWSA 1BWFO 2CH5A 3AGKA 4JHDA 2QWRA 3OA9A 5B8HA 3QBXA 3DXKB 3CI5A 2E88A 3GBTA 3HI0A 3IFRA 3MMVA 3ATUA 4JKAA 3UB5A 5F2RA 2JWLA 4FL9A 5LJWA 4A2BA 1K9MO 3R6MA 3H45C 4U67L 2ZWHA 2A41A 2ZGYA 5AQWA 3CCVN 3DWLA 4IZ9A 3G4SN 3KVGA 1Q18A 2A40A 2ZF5O 2E2NA 3LDPA 1YXQA 1BDGA 1NGBA 5EY4A 1GLJO 4ISGA 4YORA 4I6MA 5MLCQ 3WXIA 3CCSN 2Q36A 3MCAB 1OVYA 5GAEP 4JKDA 1V4SA 3LDLA 1DGKN 3N4PA 4H5VA 4WQ5C 4XEIA 5JMVA 5EXWA 2GX9A 2ASMA 3Q7CA 1OKJA 4BRGA 4BRLA 4DCHA 4YOWA 3D2FA 4JEPA 3CF5L 5C2DA 2NNWA 1VQON 1ATNA 3C7NA 3VEXA 5AQVA 1ATRA 3GE1A 3H1QA 5AZJB 2WUSA 4CZEA 5AFUA 3CC7N 3C6AA 3VTIA 4FPAA 1VQ9N 1BG3A 3HBTA 1K73O 3P4IA 1HKGA 4HTLA 1NMDA 2GWJA 1NBWA 3CQXA 5AQNA 5AQYA 5CHIA 3CCJN 5DM7L 3EL2A 4CZHA 4MO5A 4H5RA 4PHTX 5DM6L 2A6AA 3M5RA 4H0PA 2W41A 1Z6RA 4H0XB 1NGDA 2PAVA 1TUYA 2ASPA 4KBOA 2VWBA 3L0QA 4CZJA 1K8AO 3E9OA 3WXMB 3O6WA 3H3NO 5AFUH 2P9LA 3T69A 1EO1A 2RE2A 3QB0A 2ASOA 1MDUB 3CJ7A 2HF3A 1E4FT 5BRDA 2PBDA 2QTDA 3BEXA 4NLCA 2A3ZA 4EIAA 5HOOA 4BRMA 3EE8A 5ADXA 3CCMN 4BQZA 2FF3B 3E1YA 3VERA 4WCEL 2CGLA 3SMSA 3ZEUB 4IO8A 3BF3A 3VEOA 2D0PA 4IWVA 3SBTA 3EN9A 1NGJA 5ELZA 5M1FA 4A61A 4FWLA 1ZXOA 2P9SB 1QHAA 3A5OC 2OTJN 4GNIA 4JKFA 3JXUA 4BR7A 1X3MA 1Z05A 2D0OA 3I56N 4JD2A 4BROA 4H0VB 3LDOA 4A62A 4B1VA 5ADXH 5I9EB 3U9DA 5AQMA 5BRHA 2VCPA 4B1WB 3WT0A 3DXKA 5BRFA 1K8KB 4M63C 3N4QA 3OBYA 2OTLN 4JKGB 1NGAA 4CJ7A 3ENBA 4C1NI 3WXJA 1GLFO 3GDQA 2I7NA 2NRHA 4H0OA 1HLUA 4WQ4A 4BG8A 5F0XA 3FR0A 3VF2A 1SS6A 2YX6A 5AQJA 2V51B 5AQSA 3ZX2A 2HMPA 1NM1A 3ID6A 4M7XA 4BVPA 3QFPA 1P90A 3CJBA 3MWTA 1E4GT 2E2OA 5AQOA 1DT9A 2FSNA 1ZC6A 3H46O 3AGRA 3PLAA 5F1XA 3VGLA 3M3ZA 2AA4A 2I7PA 4B9QA 2J4RA 4PKIA 4AM6A 2HSTA 4BRQA 3G71N 3O5BA 3L6QA 2ITMA 3R1XA 4NLBA 1KQSM 2GEMA 4FWKA 1RGIA 4IOAL 4BQLA 2OANA 5AR0A 4JKHA 2P9NB 5AQIA 4J8FA 1NGHA 3EKUA 2KKZA 3D2EB 3L4IA 3Q7BA 4FSVA 4FWSA 5AZJA 4RWTA 2E20A 2HF4A 3O9RA 4PL7A 1TUUA 3A8YA 2Q0UA 1KAZA 1JCEA 5KPRA 4PKHA 4ISFA 2FSKA 2YHWA 4JK9A 4JNEA 3HOTA 3P31A 1VQ8N 1TYQB 2IVOA 1M90O 3BP8A 4O8UA 1LOTB 5GADP 2VGMA 3M1FA 2HBMA 1X9JA 3R3LA 4MLEA 4CZLA 5GIPA 3H1VX 3RSEA 4B1XB 1P8ZA 4MDBA 2YJFA 2CGJA 4YDUA 4CBXA 1GLCG 1JCFA 2YI1A 1S22A 4IO9L 3NVKA 1HJOA 2P9IB 3F9MA 4GV3A 4MO4A 3TTFA 1D4XA 2ZJQL 3O9SA 2H3GX 3VTHA 2NZTA 3R8EA 3O9QA 3MN7A 5GAGP 3W3DA 2WBNA 4OO1J 3O8MA 5AQQA 3E66A 4BC2A 4BRPA 2D1KA 3H6EA 2DPNA 4YOVA 3CQYA 5JLFA 4UY8O 1YAGA 3CHWA 1SZ2A 3MCPA 3UKRB 3ZEUA 3KK7A 3VEWA 1T6CA 1S3XA 3CPEA 4BC5A 4BGAA 2F9TA 2P9UA 3CJCA 3CJAA 3FGUA 1JCGA 1DKGD 4EHUA 4O8KA 1NLVA 4ILHA 2P9SA 1YUWA 4ILGB 1YJNN 5C0YA 1V4TA 2V52B 3TPQA 2UYTA 4YOXA 3SK3A 2HBJA 3TSUA 3WUHA 3ZX0A 1RDUA 3SAHA 4WQ4C 4K25A 4IXCA 3U8XA 1KAYA 4BRDA 5C12A 3CCEN 4FPBA 4JAXA 1C0GA 1R59O 4FVUA 4A5AA 3ATVA 3SAFA 2D4WA 1RFQA 1DEJA 2QEXN 2NRRA 3SJHA 3CC2N 3J8AA 4BRFA 1VQLN 4FWOA 1ESVA 4FOIA 1WOQA 4CD3A 1YF5L 3J7ZO 1YJWN 1HUXA 4DKWA 3CD6N 1GLBG 3IUCA 5C2FA 3AAQA 3QMLA 3C65A 1XUPO 2PFUA 5AQFA 4KH4A 3W0LA 1HKBA 1S72N 2P9PB 3FZFA 1W97L 5AQGA 4BRIA 2VYPA 5H1SQ 3OHRA 2E2QA 2NLXA 5M1NA 1VAZA 4MDAA 2P9NA 3LM9A 3ZX3A 1U2VB 3D2EA 3MK6A 4XH1A 4FWNA 4YOUA 3DLLL 3WEEB 3I55N 3RVCA 4JKCA 4DB3A 4BGBA 1T44A 3UKUB 3MX5A 3TTCA 1BUPA 2F7TA 4CZGA 4H5NA 1W2BM 3VEZA 2QI2A 4IJAA 2CGKA 5KQDA 1U6ZA 3ULEA 3MN5A 4F9OA 1YI2N 1NWKA 3VEVA 1QQNA 3FZLA 3HTVA 4ISEA 4FWQA 3D6RA 4EFHA 1YJ9N 4I6MB 3A5NC 4LC9B 1LCUA 3AY9A 3C6HA 1VQNN 4BRNA 2IVPA 5FPMA 1EQYA 2JWKA 1IJJA 2P9IA 3F2KA 5AQPA 3ZETB 5FPDA 5KPZA 4A5BA 1QVFM 1Q82O 2V7ZA 4JKBA 2ZJRL 1BOTO 2NRXA 4DHYA 3VMFB 4GV9A 3QFUA 2YHYA 3VGKA 4Y0WA 3CJ1A 1X3NA 1NGFA 4H0YB 4WQ5A 3CMEN 5KPTA 2ZJPL 3K9KA 1HPMA 5KQ8A 1Q7YO 3VF6A 3DAWA 3O08A 4DQ8A 5AQTA 4BR4A 3CMAN 3LDNA 3DXMB 3PIPL 5M1OA 4H0TB 3CERA 3L4QA 4A57A 4B1YB 4CZIA 1YVNA 4BY9C 4A2AA 1QQMA 5GINA 1ZBSA 3P38A 2QWQA 3G6EN 3O1BA 5C10A 1ATSA 1VQ6N 4WFBL 3TU5A 5M1PA 3VOVA 3KZBA 4IFEA 3PIOL 2BTFA 3P39A 4IOCL 3CCQN 1CZAN 3VGMA 4BR0A 2GTDA 3I8BA 1G99A 5EVZA 3SBGA 5AZIB 5TKWA 4HWIA 4WFNL 2KHOA 5LJVA 1JJ2M 3BUZB 3HSCA 1Q81O 2YHXA 5M1KA 4BRCA 1YIJN 4JK8A 1KC8O 2WC9A 4C23A 1KAXA 3WQTA 1VQKN 4IDHA 1GLAG 4KH5A 5C15A 4CZFA 2KLAA 2P9PA 2Q2RA 4JK7A 4YOTA 3CIPA 4XH5A 4PKGA 3A5MC 1U2VA 5JVHL 3WEEA 3SAGA 4BRAA 3LL3A 4IJNA 4BR2A 4CZMA 4CBUA 3FFKB 3UKUA 1SAZA 3C0BA 3B8AX 1Y64A 2HBLA 1VQ5N 3LDQA 4CI6A 2QWPA 5E26A 1C0FA 2GWKA 4CZKA 3SMPA 1NGEA 2QWMA 2NRVA 1YHQN 3G25A 3OW2M 1NGIA 3AAPA 3U4LA 5FPEA 5BPMA 3CCLN 4H5WA 1XQSC 3JS6A 3MWPA 5JICA 1K8KA 1T3VA 2E1ZA 3O9UA 1HX1A 4JKGA 3K9JA 1GLDG 2FSJA 4QS7A 2QWNA 2GUPA 2P9KB 1WUAA 2W40A 4IEIA 5AQUA 5TKYA 4C1NK 5GAHP 3ZETA 3R9PA 3WQUA 4WFAL 2NRTA 2QW9A 3AARA 2E8AA 3CC4N 5EOYA 2VGNA 3NVMA 1VQ7N 3HRGA 1NJIO 3UE5A 4BC4A 5BPLA 4MLHA 5AQHA 5AQLA 3KHYA 1VQPN 3VEYA 2YCHA 1XC3A 3BF1A 3FZMA 3HM8A 3VF4A 5BN9A 3M6GA 2NRWA 3ENHA 1J6ZA 2FXUA 3EE9A 3U9ZA 1BO5O 5BN8A 1ILYA 2AP1A 3DXMA 4FWRA 4NO7A 3WXLA 1VQMN 1VQ4N 3CPWM 4IOXA 3VETA 1MWMA 2Q31A 3A5LC 4EAHD 4H5TA 1BU6O 5HL7L 4BVOA 3VPZA 4JHDB 3HOSA 3GL1A 2A42A 2QA4N 1KD1O 3RSEB 3NMUA 3EZWA 2V7YA 4BR5A 3E9PA 3FZHA 4XH4A 3KWGA 3MN9A 4EHTA 5GIOA 1BA0A 4YOYA 4GV6A 3GOIA 3I33A 1MA9B 3LM2A 4PL8A 2A5XA 5JVGL 1GLLO 1QQOA 1TYQA 4YDUC 1YITN 1QVGM 4BC3A 3FZKA 3IMXA 4GVEA 5BREA 5AZIA 3H3OB 5AQKA 2FLOA 4K43A 4BG9A 3EKSA 3VENA 4K42A 4QS9A 3ZYYX 3HZ6A 1GLEG 1Q86O 2QWOA 2Q97A 5CR4A 4A59A 1NGCA 2E1YA 3E9LA 3O1WA 4Z94A 2F9WA 4K41A 2P9UB 4AF1A 3O80A 1SQKA 3KWIA 3DJCA 5AQZA 2E2PA 3D2FB 3ENOA 4WF9L 3MX2A 2CH6A 2GELA 3C7NB 4OPAA 3O9TA 5AQXA 1MWKA 1HKCA 5M1QA 1QZ6A 4BRHA 3UKRA 2NRZA 3GG4A 5BR9A 3IKMA 3CCRN 4WYBA 1NGGA 5EX5A 2HOEA 4U7BA 2IVNA 2QXLA 5E84A 3T7ZA 4RTFD 5AQRA 5FPNA 2BUPA 3VESA 4KH6A 1RDWX 2BH1A 4AM7A 2FF6A 4IEEA 5BPNA 3O4WA 3CETA 4H03B 4GY2B 4L3QA 3FLCO 3CJ9A 4M7YA 4FWPA 1KXPA 3FE1A 4FWMA 5JLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC M;  5JVH L;  2QEX N;  2OTJ N;  3CCU N;  3CC2 N;  1VQL N;  3I56 N;  1VQ5 N;  1M1K O;  3J7Z O;  1YJW N;  1N8R O;  3CD6 N;  2OTL N;  1YHQ N;  1S72 N;  3OW2 M;  5H1S Q;  3CCL N;  3DLL L;  3I55 N;  5GAH P;  4WFA L;  3CC4 N;  1W2B M;  1VQ7 N;  1NJI O;  3G71 N;  1VQP N;  1YI2 N;  1KQS M;  4IOA L;  1K9M O;  1YJ9 N;  4U67 L;  1ILY A;  3CCV N;  1VQM N;  3G4S N;  1VQN N;  1VQ4 N;  3CPW M;  1QVF M;  5MLC Q;  5HL7 L;  3CCS N;  2ZJR L;  1Q82 O;  1KD1 O;  2QA4 N;  5GAE P;  1OVY A;  1VQ8 N;  1M90 O;  5GAD P;  3CME N;  2ZJP L;  3CF5 L;  5JVG L;  1Q7Y O;  1QVG M;  1YIT N;  1VQO N;  3CMA N;  3PIP L;  4IO9 L;  3CC7 N;  2ZJQ L;  1VQ9 N;  3G6E N;  1Q86 O;  1K73 O;  3CCJ N;  1VQ6 N;  5GAG P;  4WFB L;  5DM7 L;  5DM6 L;  3PIO L;  4WF9 L;  4IOC L;  4UY8 O;  3CCQ N;  1K8A O;  4WFN L;  1JJ2 M;  1YJN N;  1Q81 O;  3CCR N;  1YIJ N;  1KC8 O;  3CCM N;  3CCE N;  4WCE L;  1VQK N; 
#chains in the Genus database with same CATH topology
 3D7E O;  1BA1 A;  3EO3 A;  3CCU N;  2QM1 A;  1WSI A;  4PQU A;  2QKB A;  4FO0 A;  3S41 A;  3OYI A;  3TAR A;  3MN6 A;  3OYF A;  4RCH A;  4KAZ A;  4BRE A;  3EEQ A;  3QIC A;  4F8R A;  3F5T A;  2FBT A;  4DTX A;  4E1J A;  3KK3 A;  3TTD A;  3QET A;  4G9Z A;  1WSE A;  3OYK A;  1H1V A;  1BL3 A;  4B3S K;  1YT3 A;  4FLU A;  4JHD A;  4JI6 K;  4Z4H A;  4IG3 A;  2QXF A;  2HVI A;  5B8H A;  3CI5 A;  3MMV A;  5F2R A;  2JWL A;  1K9M O;  3VQD A;  2ZGY A;  5BR8 K;  3DWL A;  3KVG A;  1NMN A;  2FBY A;  1TK8 A;  1BDG A;  1NK8 A;  3JYT A;  1OVY A;  4CHQ A;  4BRG A;  3SI6 A;  1HJR A;  4F2R A;  3SQ0 A;  1NU0 A;  4J2A A;  3MED A;  4RW8 A;  3C7N A;  3VEX A;  3H1Q A;  4DU3 A;  4RG8 A;  3QO9 A;  4CZE A;  4DQR A;  3OJU A;  3L8B A;  3C94 A;  3KLH A;  1NMD A;  5AQN A;  4FJI A;  2RN2 A;  4DR6 K;  2A6A A;  1SL0 A;  1JLE A;  2O4G A;  1NGD A;  4KBO A;  2ASP A;  4H4O A;  3E9O A;  2P5G A;  1QSY A;  1EO1 A;  3QB0 A;  1MDU B;  3TAF A;  4HUF A;  4LF6 K;  3BEX A;  5HOO A;  4EIA A;  4FYD A;  4PUO A;  3C95 A;  2XY8 A;  3VER A;  4O0I A;  3SMS A;  3BF3 A;  5CY4 A;  3VEO A;  5M1F A;  3SBT A;  1VSF A;  3A5O C;  3AO4 A;  2OTJ N;  5HRO A;  3CFO A;  4LD0 A;  4FLY A;  4E7I A;  5ADX H;  4B1V A;  1JLF A;  3DLE A;  5BRH A;  2VCP A;  4FW2 A;  3WT0 A;  2G8U A;  4E1N A;  1K8K B;  4M63 C;  3N4Q A;  4CGF A;  2OTL N;  4JKG B;  4KI4 A;  5K14 A;  3WXJ A;  4KFB A;  1SKR A;  1OVQ A;  2NRH A;  2UUB K;  3LP2 A;  3FR0 A;  4FLZ A;  3VF2 A;  5AQJ A;  5AQS A;  4BVP A;  4CGJ A;  2OPQ A;  4LFA K;  4LF4 K;  3VGL A;  4DLE A;  2I7P A;  3SNN A;  4AM6 A;  3WNE A;  2HST A;  1ZBU A;  3L6Q A;  4C8K A;  4CFB A;  3RRH A;  1KQS M;  4FWK A;  4I7F A;  1IO2 A;  2OAN A;  2P9N B;  4GKJ K;  4J8F A;  3EKU A;  3D2E B;  3PV8 A;  4FWS A;  2E20 A;  2HF4 A;  3DLK A;  3THX B;  4CEC A;  4PKH A;  2WTU A;  3HOT A;  2DFF A;  3P31 A;  1LOT B;  5GAD P;  3M1F A;  2HBM A;  3R3L A;  4FM0 A;  1IKW A;  3RSE A;  3THW B;  2CGJ A;  1D9D A;  2A1R A;  4CJ3 A;  3TTF A;  3VTH A;  5AJ3 K;  2NZT A;  3R8E A;  4BE0 A;  3O9Q A;  1X1P A;  3LDS A;  2WBN A;  4OO1 J;  3C6U A;  3O3H A;  3O8M A;  5AQQ A;  3V1O A;  4UY8 O;  4DV5 K;  3UKR B;  3VEW A;  1T6C A;  1IBK K;  1J5E K;  2F9T A;  3ZLJ A;  3CJA A;  1JCG A;  4EHU A;  4O8K A;  4GVM A;  1X9S A;  1NLV A;  3QEW A;  3OS0 A;  3SK3 A;  3ZX0 A;  3QEV A;  2ZM6 K;  3NAE A;  1REV A;  4Z0U A;  3U8X A;  3CCE N;  4FVU A;  1DEJ A;  4V19 S;  3SJH A;  3LPU A;  4FWO A;  1WOQ A;  3PY8 A;  3MEE A;  1HUX A;  4LFC K;  1WSJ A;  3QML A;  3C65 A;  1VHX A;  3FZF A;  4BRI A;  5H1S Q;  3OHR A;  4B8C A;  3HP6 A;  2P9N A;  4I9Q A;  3TAQ A;  3D2E A;  1TGO A;  4XH1 A;  4YOU A;  4CJE A;  3DLL L;  4M3T A;  3AVK A;  5SWM A;  3THX A;  3F9K A;  3ISN C;  5HRR A;  4CZG A;  2UUC K;  1W2B M;  4KPY A;  3VEZ A;  3S3O A;  1FXX A;  2OZM A;  5KQD A;  3L2V A;  5T7B A;  3J7Y P;  5I3U A;  4JI0 K;  3VEV A;  2O8B B;  1S6Q A;  3OYM A;  1QQN A;  3FZL A;  4FWQ A;  3THW A;  4I6M B;  4LC9 B;  4KB0 A;  4CJU A;  3A2F A;  1EQY A;  4FK4 A;  3LAL A;  3M8S A;  3T19 A;  4OVL A;  1IKX A;  1Q82 O;  3LAM A;  1BOT O;  3VMF B;  4CES A;  1RBU A;  4Y0W A;  4CFA A;  1LW2 A;  2DY4 A;  4H0Y B;  1HPM A;  3DRP A;  4DQ8 A;  3TAG A;  3LDN A;  2UXC K;  3L4Q A;  4A57 A;  3I0S A;  4FLW A;  3WNF A;  1QQM A;  3NBP A;  3NE6 A;  1LV5 A;  2XY7 A;  1VQ6 N;  4WFB L;  3NF7 A;  3KZB A;  1OH8 A;  3HK2 A;  1S6P A;  3PIO L;  2BTF A;  3CCQ N;  1TVR A;  2GTD A;  1I94 K;  2Q3S A;  5KRS A;  4HWI A;  5I42 A;  4ICL A;  4KV8 A;  4AHS A;  2ZD1 A;  3V1Q A;  5M1K A;  3F73 A;  3HPH A;  2WC9 A;  4C23 A;  1KAX A;  4KH5 A;  4JK7 A;  1F21 A;  3CIP A;  4XH5 A;  5JVH L;  3LL3 A;  3VQC A;  3FFK B;  1SAZ A;  2QK9 A;  1HNX K;  3PO5 A;  3LDQ A;  4CI6 A;  1L3T A;  4CZK A;  3SUQ A;  1IBM K;  3G25 A;  3CCL N;  1T3V A;  1JLC A;  3K9J A;  1GLD G;  3K0S A;  1L3V A;  3OS2 A;  2P9K B;  1WUA A;  5TKY A;  1KVA A;  3WQU A;  2E8A A;  4IBN A;  1NJI O;  4BC4 A;  2XHB A;  4DR1 K;  1WSG A;  2IAJ A;  2XY5 A;  4B3O A;  2D0C A;  4DS4 A;  1ZBL A;  1BI4 B;  1BIU A;  2NRW A;  3ENH A;  1J6Z A;  3U9Z A;  3WXL A;  2YNH A;  1VSK A;  1XMQ K;  1N5Y A;  3CPW M;  2DFE A;  2Q31 A;  3A5L C;  1D9F A;  2A42 A;  2V7Y A;  4RW6 A;  3FZH A;  2KTQ A;  3KWG A;  1XHX A;  3MN9 A;  4EHT A;  5GIO A;  4YOY A;  4J2B A;  3GOI A;  5JVG L;  1QVG M;  4JI4 K;  4BC3 A;  3IMX A;  1NOY A;  1TKD A;  3B6P A;  4KB1 A;  2FLO A;  4K43 A;  4DTS A;  3EKS A;  2YNI A;  2RPI A;  4CHN A;  3B6O A;  4DU4 A;  5CR4 A;  3U3Y A;  3E9L A;  2E1Y A;  1QSL A;  1VK0 A;  4M3Z A;  3AVH A;  2F9W A;  4DR4 K;  3HVT A;  3O80 A;  5AQZ A;  1QHT A;  2E2P A;  4XIU A;  2CH6 A;  4PWD A;  4W5Q A;  2DFH A;  4OPA A;  1QTM A;  3U6F A;  2NRZ A;  3L3V A;  3GG4 A;  2G8H A;  4AIL C;  2Z1G A;  5FRN A;  4FJ9 A;  3VQP A;  1UWB A;  2IVN A;  2QXL A;  4B3R K;  3D0P A;  2BUP A;  1RDW X;  1ZBH A;  2O8D B;  1J5O A;  3CET A;  4H03 B;  4L3Q A;  3VQQ A;  3CJ9 A;  4N56 A;  5KGX A;  4CIG A;  1NJX A;  2P9L B;  2Q1N A;  3QDK A;  2P9K A;  4BE1 A;  4CJR A;  1T6D A;  4R79 A;  4QS8 A;  3V9Z A;  4O55 A;  3IDH A;  4FJ5 A;  1CZ9 A;  5SZT A;  1QZ5 A;  3TSP A;  3BGR A;  1IG8 A;  4BR9 A;  1BQN A;  3QBW A;  4BE2 A;  1KCF A;  4E89 A;  5KRT A;  3LZI A;  4C8O A;  2WFB A;  2O8E B;  1UA1 A;  3A0I X;  2Q0R A;  3TSQ A;  4ZHR A;  3LWL A;  1EXQ A;  1XWL A;  1BI4 A;  1U48 A;  4CFC A;  5J1E A;  3KLI A;  2PZS A;  4JKE A;  2HBK A;  3HXM A;  4CD1 A;  2IIR A;  1S9G A;  3VQ8 A;  3ULE B;  4OLA A;  2EWS A;  3QEX A;  4BWJ A;  2CH5 A;  5KGW A;  2YV0 X;  1UOC A;  2QWR A;  1WNS A;  4OX9 K;  4JKA A;  1CLQ A;  2B5J A;  3R6M A;  1Q9X A;  4IZ9 A;  2E2N A;  2ZF5 O;  4AHU A;  1QS4 A;  1YXQ A;  1NGB A;  3KKR A;  5LMN K;  5EY4 A;  1GLJ O;  4ISG A;  4YOR A;  3ZSY A;  3MCA B;  3HJF A;  1V4S A;  4WQ5 C;  4XEI A;  4EZ9 A;  2ASM A;  4HVJ A;  4CK2 A;  4YOW A;  5HLF A;  3IAY A;  1U47 A;  3DLG A;  3KK1 A;  1TL3 A;  1DTQ A;  1WN7 A;  3GE1 A;  3WNG A;  2WUS A;  4QAG A;  4FPA A;  4JI2 K;  3VTI A;  3HBT A;  4DR7 K;  5AQY A;  1HKG A;  2YHB A;  4W5N A;  4FJ8 A;  3EL2 A;  4MO5 A;  4H5R A;  2O8D A;  5DM6 L;  4H0P A;  3ZSZ A;  1Z6R A;  4H0X B;  2PAV A;  2AJQ A;  4CZJ A;  1K8A O;  1VSM A;  4IFY A;  1C6V A;  2P9L A;  4QCL A;  3T69 A;  3PX0 A;  3P1G A;  1E4F T;  2QTD A;  3AVB A;  3EE8 A;  5ADX A;  4DTO A;  1SL1 A;  2FF3 B;  3E1Y A;  4WCE L;  3V9S A;  3CG7 A;  2G8K A;  5LL6 Z;  4FM1 A;  1NKB A;  4IWV A;  3EN9 A;  5ELZ A;  4CEA A;  3RRG A;  5FRO A;  4JKF A;  3BZK A;  1HYV A;  2D0A A;  2D0O A;  4KO0 A;  3I56 N;  4BRO A;  3L3U A;  5IWA K;  3DI6 A;  4OPJ A;  3OBY A;  1NGA A;  4NXM K;  1GLF O;  3GDQ A;  5EU7 A;  2I7N A;  4H0O A;  1HLU A;  4BG8 A;  3AVC A;  2KFN A;  1SS6 A;  1JLQ A;  4E7H A;  2IGI A;  4M7X A;  4AHV A;  3QFP A;  1GOA A;  4CED A;  1LW0 A;  3H46 O;  3OYD A;  3AGR A;  1JXB A;  5F1X A;  4KHQ A;  1NKE A;  2AA4 A;  4B9Q A;  4YHH K;  4PKI A;  3RMA A;  5HBM A;  2HHX A;  3TWH A;  3O5B A;  1WSF A;  3I8D A;  3R1X A;  1N36 K;  2E5L K;  2GEM A;  4IOA L;  4NCA A;  4BQL A;  2ETJ A;  1D5A A;  1NGH A;  4LF9 K;  3Q7B A;  4FSV A;  1I3A A;  1TUU A;  3A8Y A;  1J9A A;  5KPR A;  4NXN K;  4JK9 A;  2ATQ A;  2FSK A;  2YHW A;  2Y1J A;  3DYA A;  2IVO A;  1KFD A;  4E1M A;  3BP8 A;  1L3U A;  1X9J A;  4FJK A;  4JV5 K;  5GIP A;  1XNQ K;  3QEP A;  4B1X B;  5JS2 A;  4DV6 K;  3TAE A;  4MDB A;  3E01 A;  3J81 O;  4CBX A;  3KD1 E;  4J2D A;  2HB5 A;  1ZBF A;  1S22 A;  3NVK A;  1HJO A;  3F9M A;  1D4X A;  2ZJQ L;  3O9S A;  2H3G X;  4GKK K;  2UXD K;  2O8F B;  2FBX A;  4BC2 A;  2Z1J A;  2HHS A;  2P1J A;  4FLV A;  4CER A;  2I5J A;  2HHW A;  2EHG A;  4DLG A;  4BGA A;  1S3X A;  4E7K A;  3CJC A;  3FGU A;  1DKG D;  2W42 A;  1GOB A;  1LAW A;  3PSF A;  1YUW A;  4ILG B;  1YJN N;  4C8L A;  3WNH A;  3HPO A;  5C0Y A;  2UYT A;  3DM2 A;  2HBJ A;  3WUH A;  4X64 K;  1JXE A;  4CFD A;  4M42 A;  3NF9 A;  4CJK A;  4KI6 A;  4M3R A;  3QEI A;  3TI0 A;  1C0G A;  3OYN A;  3SAF A;  1IBL K;  2W6L A;  4DU1 A;  4FZX C;  4ELT A;  1VQL N;  1ESV A;  1RT3 A;  3AVM A;  4N5S A;  3AAQ A;  3HO1 A;  3W0L A;  4OKK A;  1S72 N;  4E7J A;  5AQG A;  4CHP A;  1EKE A;  2Z1H A;  2E2Q A;  4AHR A;  2D5R A;  5M1N A;  4MDA A;  1S1U A;  1JLA A;  2IDO A;  4FWN A;  3RVC A;  2UU9 K;  4BGB A;  3MX5 A;  3TTC A;  4H5N A;  3NHG A;  2CGK A;  4BAC A;  1RCH A;  1SUQ A;  3MN5 A;  4DTU A;  3T1H K;  4CJV A;  1HNZ K;  1YJ9 N;  4OJR A;  3SCX A;  1HYZ A;  3RMB A;  3AY9 A;  4FXD A;  1VQN N;  4BRN A;  4DV2 K;  1RTH A;  3F2K A;  4DG1 A;  5KPZ A;  1QVF M;  1W0H A;  4A5B A;  2VWJ A;  2ZJR L;  1JLB A;  2O8F A;  4DHY A;  3QFU A;  4CGH A;  3SPY A;  3ZT1 A;  5J2N A;  3MAQ A;  3KTQ A;  4QOZ B;  4KRF A;  3G0Z A;  4OGE A;  4L8R B;  5KPT A;  2WON A;  3K9K A;  2ZJP L;  1C1B A;  1N34 K;  1XI1 A;  3AO5 A;  1Q7Y O;  3QER A;  4FLX A;  4ZTF A;  3NH2 A;  1JL1 A;  4BR4 A;  2HHU A;  3DXM B;  5M1O A;  2W6K A;  1FW6 A;  5GIN A;  3CYM A;  1KRP A;  3SZ2 A;  3O1B A;  5KTQ A;  1Y97 A;  3L2W A;  4OKJ A;  1ATS A;  2ITG A;  3TU5 A;  3T1A A;  3K2P A;  3MXJ A;  4DQS A;  1O1W A;  1MU2 A;  3P39 A;  3VGM A;  2E6M A;  4BR0 A;  2QKK A;  5EVZ A;  3SBG A;  5TKW A;  1NK4 A;  4ZTJ A;  3HSC A;  2P5O A;  3MEG A;  1Q81 O;  4EZ6 A;  4BRC A;  2UXB K;  1KC8 O;  3QIN A;  2Q2R A;  5J2P A;  3ASM A;  3LAK A;  4KTW A;  1A5V A;  2HHH K;  3OVN A;  4BR2 A;  4E7L A;  4CZM A;  4CBU A;  3C0B A;  4EP5 A;  3B8A X;  4DUY K;  2HBL A;  1VQ5 N;  2QWP A;  1C0F A;  3SQ1 A;  1NGE A;  1D8Y A;  4ELV A;  3OYC A;  3OW2 M;  3NDK A;  4DQQ A;  3OTO K;  3MWP A;  3HVR A;  1K8K A;  2E1Z A;  3OYA A;  1HQE A;  4JKG A;  2QWN A;  2GUP A;  5GAH P;  3PO4 A;  5AQU A;  4WFA L;  3R9P A;  5EOY A;  3KLE A;  3HT3 A;  2VGN A;  3NVM A;  4OLB A;  2ZQB A;  1VQ7 N;  3BZC A;  3OYB A;  4MLH A;  3NGY A;  3RR7 A;  5AQL A;  5HRS A;  3KHY A;  3VEY A;  3HM8 A;  3FZM A;  5BN9 A;  3M6G A;  1WBD A;  2A1S A;  1BO5 O;  1ILY A;  4FWR A;  3DXM A;  4NO7 A;  4CF8 A;  3LAN A;  1VQ4 N;  2R7Y A;  1RBV A;  4FJX A;  3DRS A;  4EAH D;  1RTI A;  3NMU A;  3ZCM A;  4HTU A;  1E3M A;  4Z4I A;  4LF7 K;  3E9P A;  3OYE A;  1BA0 A;  3AA5 X;  2HND A;  3KKS A;  4PL8 A;  1ITG A;  1GLL O;  1QQO A;  4YDU C;  4X62 K;  4O44 A;  1YIT N;  3FZK A;  3M8R A;  3QLH A;  3DLH A;  1QE1 A;  3H3O B;  5AQK A;  4LF5 K;  4BG9 A;  3ZSW A;  3VEN A;  4RW7 A;  4K42 A;  4QS9 A;  4CJ5 A;  4CJQ A;  3HZ6 A;  3VA3 A;  3VQ5 A;  1GLE G;  3NH0 A;  1Q86 O;  1HR0 K;  2QWO A;  4A59 A;  3O1W A;  4CGD A;  2P9U B;  1NG9 A;  3KWI A;  3D2F B;  3VQE A;  1LWF A;  2OPR A;  1WLJ A;  3ZSO A;  4M41 A;  5AQX A;  2OPP A;  5M1Q A;  1QZ6 A;  3UKR A;  4DWI A;  3QNO A;  5BR9 A;  1EP4 A;  3O3F A;  1NGG A;  4RW4 A;  4DV0 K;  3VES A;  5CYM A;  1C0U A;  3O4W A;  4GY2 B;  3FLC O;  3SQ4 A;  3ZSQ A;  5JLH A;  1I39 A;  1KVC A;  1QQC A;  4CEE A;  3WXK A;  1RIL A;  3LWM A;  3AO2 A;  1LAV A;  2B4J A;  1M1K O;  2YJE A;  4E19 A;  3BDP A;  3SLC A;  3O4Q A;  2G8I A;  4BRK A;  4CBW A;  2BDP A;  4B1Z A;  5CE3 A;  2RKI A;  4O5F A;  1ASW A;  4NB4 A;  4FOE A;  4JN4 A;  3AV9 A;  3CM6 A;  4DSL A;  5HP1 A;  2YNF A;  4LH4 A;  4AHC A;  1VRU A;  4BDY A;  3QBX A;  1UAX A;  1TK0 A;  3GBT A;  3ATU A;  4A2B A;  1LWC A;  1ZBI A;  4U67 L;  3RMD A;  5AQW A;  3M8P A;  3CCV N;  3G4S N;  1RT5 A;  3K5L A;  1Q18 A;  2O8B A;  3S9H A;  4N41 A;  4N76 A;  4B9N A;  4I6M A;  3WXI A;  3CCS N;  2YHA A;  3LZJ A;  2Q36 A;  4DUZ K;  4KKO A;  4H5V A;  1DGK N;  3N4P A;  2GX9 A;  3Q7C A;  3D2F A;  5C2D A;  4NYF A;  3O3G A;  3ZT3 A;  3V6D A;  1VQO N;  1ATN A;  4LF8 K;  5AQV A;  1ATR A;  3UIQ A;  5AZJ B;  4BWM A;  1WAF A;  3C6A A;  1VQ9 N;  1BG3 A;  4DFM A;  1K73 O;  3O4N A;  3P4I A;  4HTL A;  2VQE K;  1NBW A;  1C1A A;  1VSD A;  1HNV A;  4PHT X;  4LFB K;  3V9W A;  4CJ4 A;  2W41 A;  4DSK A;  4JI5 K;  4BDZ A;  4YY3 K;  4M3X A;  4JRP A;  3QES A;  2VWB A;  3L0Q A;  1R0A A;  3WXM B;  5AFU H;  3AO1 A;  2RE2 A;  2ASO A;  5A2Q O;  1KFS A;  1S9E A;  2HF3 A;  2HNZ A;  5CYQ A;  5BRD A;  2F8T A;  1S5J A;  5HRN A;  2KZZ A;  4NLC A;  2A3Z A;  1T7P A;  1ASV A;  4BRM A;  4CEZ A;  4DFK A;  2GUI A;  1WAJ A;  3ZEU B;  4IO8 A;  4DQI A;  1NGJ A;  1ZXO A;  1TL1 A;  4BDP A;  1WSH A;  1QHA A;  2P51 A;  4RW9 A;  2HW3 A;  3T3F A;  3JXU A;  1NK9 A;  4CJF A;  3PX6 A;  1Z05 A;  4CHY A;  1CXU A;  4H0V B;  4A62 A;  4FJJ A;  5I9E B;  5AQM A;  4KHW A;  1X9M A;  4WE1 A;  4CJ7 A;  1TKZ A;  2VG7 A;  3L2R A;  2KW4 A;  4WQ4 A;  4DV7 K;  5J2Q A;  2V51 B;  3ZX2 A;  4JS4 A;  3CJB A;  3MWT A;  2IS3 A;  1E4G T;  4DSF A;  5AQO A;  1DT9 A;  1ZC6 A;  3SV3 A;  3V4I A;  3M3Z A;  4FZY A;  2J4R A;  5DMR A;  3G71 N;  2ITM A;  4NLB A;  2YNG A;  1W7A A;  2HMI A;  1W9H A;  3I0R A;  5AR0 A;  5AQI A;  3HP9 A;  3L4I A;  5AZJ A;  4RWT A;  1RT4 A;  3O9R A;  2Q0U A;  2HVH A;  2F4V K;  3ZT2 A;  1JCE A;  3OS1 A;  1RT1 A;  1TKX A;  4JNE A;  3ZSX A;  1TYQ B;  4MQ3 A;  2X6S A;  1M90 O;  4O8U A;  4FZZ A;  4B9V A;  1U49 A;  4CZL A;  3QIO A;  3H1V X;  1EX4 A;  1NK0 A;  1GLC G;  1JCF A;  4DFP A;  4GV3 A;  1Z26 A;  4MO4 A;  2E6L A;  4FW1 A;  3MN7 A;  4YNQ A;  3E66 A;  4BRP A;  1NK6 A;  3H6E A;  3CQY A;  3CHW A;  3ZEU A;  3KK7 A;  1OH6 A;  3CPE A;  4BC5 A;  3LP3 A;  4B3T K;  4G1Q A;  1V4T A;  4YOX A;  4B08 A;  1YTA A;  3T1Y K;  1L3S A;  1HNI A;  4HUG A;  4E3S A;  3SAH A;  4DV1 K;  4K25 A;  4CEB A;  4JRQ A;  5C12 A;  4BRD A;  4FPB A;  1NJW A;  5C25 A;  2OZS A;  3VQ4 A;  1R59 O;  3ATV A;  1VRT A;  1RFQ A;  2D4W A;  3RWU A;  2JGU A;  2QEX N;  4KHN A;  5HRP A;  2BGG A;  4ID1 A;  4NYN A;  3CC2 N;  3J8A A;  4H8K A;  3CFR A;  4BRF A;  5IT9 O;  3OYJ A;  3KLF A;  4FOI A;  4CD3 A;  1YF5 L;  3J7Z O;  1JLG A;  3EYZ A;  1YJW N;  1UA0 A;  3CD6 N;  1GLB G;  3IUC A;  5C2F A;  3IG1 A;  4AQY K;  4DF4 A;  4CEO A;  5AQF A;  2P9P B;  1W97 L;  2UUA K;  2NLX A;  2O8E A;  2FC0 A;  4DSJ A;  3WEE B;  3I55 N;  3IRX A;  1RTJ A;  3PUF A;  1DLO A;  4JKC A;  1T44 A;  3UKU B;  1BUP A;  2QI2 A;  3RTV A;  4JI1 K;  1T05 A;  4LSN A;  3ULE A;  4CJT A;  1IG9 A;  4IDK A;  3D6R A;  4CJW A;  1LCU A;  2IVP A;  1NJZ A;  1IJJ A;  5AQP A;  4HCB A;  4KHS A;  3K58 A;  2V7Z A;  1CZB A;  1RDA A;  3L2U A;  3G10 A;  1JKH A;  4FM2 A;  3CJ1 A;  3CM5 A;  1NGF A;  4WQ5 A;  3P83 D;  5KQ8 A;  3VF6 A;  3DAW A;  3O08 A;  3QIP A;  4JI8 K;  3CMA N;  3HL8 A;  2XY6 A;  3PIP L;  4F3T A;  3CER A;  4B1Y B;  1YVN A;  5CZ1 A;  4TSX A;  4BY9 C;  4A2A A;  1ZBS A;  2QWQ A;  3G6E N;  3KD5 E;  5C10 A;  5M1P A;  2PYJ A;  3VOV A;  4IFE A;  2G8V A;  2RF2 A;  4IG0 A;  4KHP K;  3DLB A;  2FBV A;  3I8B A;  1G99 A;  4DQP A;  5AZI B;  2G8F A;  4CJS A;  2IOC A;  3SUP A;  4UQG A;  1U4B A;  1WB9 A;  2KHO A;  5LJV A;  3BUZ B;  3LPT A;  4DTJ A;  4CF1 A;  2KZM A;  2O8C B;  4B9M A;  4JI7 K;  1KLM A;  3WQT A;  1GLA G;  4NCG A;  4CE9 A;  2KQ2 A;  2B6A A;  5C15 A;  4GW6 A;  1Q9Y A;  4K0K K;  2KLA A;  2P9P A;  4YOT A;  4PKG A;  3A5M C;  4CGG A;  3JSM A;  3WEE A;  3VQ7 A;  3SAG A;  4IJN A;  4B3M K;  1TV6 A;  3UKU A;  3JAM O;  5E26 A;  2GWK A;  4O5B A;  3OJS A;  3DOL A;  3ZT4 A;  1VSH A;  4H5W A;  4F3O A;  3SV4 A;  1IKY A;  2FSJ A;  3J80 O;  4DSI A;  2W40 A;  4C1N K;  1BCM A;  3AAR A;  3CC4 N;  1C0M A;  1BHL A;  3UE5 A;  4NCB A;  4F2S A;  2OPS A;  1LWE A;  3BF1 A;  5DK5 A;  2GBZ A;  3PX4 A;  5BN8 A;  3OY9 A;  1VQM N;  3AA3 A;  1FKO A;  3VET A;  1A5W A;  1MWM A;  4HHT A;  4C8N A;  3NH1 A;  3VPZ A;  3VQ9 A;  1KD1 O;  3GL1 A;  2VWK A;  3RSE B;  4DR3 K;  4M3U A;  4GV6 A;  4DV4 K;  3K59 A;  1S1T A;  3RMC A;  2A5X A;  5BRE A;  4GVE A;  4PA1 A;  5AZI A;  4OPK A;  2VG6 A;  4DTP A;  4IFV A;  2Y1I A;  3ZYY X;  4DFJ A;  2Q97 A;  2O8C A;  1NGC A;  4DTN A;  4PY5 A;  4Z4E A;  1EET A;  2XRI A;  5FDL A;  1SQK A;  3DJC A;  3ENO A;  1NK7 A;  4F4K A;  3NF6 A;  3RR8 A;  3O9T A;  1MWK A;  4FJN A;  1HKC A;  2LSN A;  5J2M A;  1NKC A;  4FJH A;  4O0J A;  2IC3 A;  3AO3 A;  4WYB A;  5EX5 A;  2HOE A;  3VN5 A;  3SJJ A;  1OH5 A;  5E84 A;  3T7Z A;  5AQR A;  2EX3 A;  1BQM A;  4AM7 A;  5BPN A;  2FF6 A;  3AVF A;  1SKW A;  4M7Y A;  4FWP A;  3VQ6 A;  3FE1 A;  4FWM A;  4K8Z A;  1DTT A;  4Y1D A;  3CXC M;  1G15 A;  4FCY A;  3MDQ A;  3ID8 A;  2X78 A;  1O13 A;  3ZSV A;  4DMN A;  1N8R O;  2OA8 A;  4B1U B;  3MEC A;  5LY3 A;  4OPH A;  1RDC A;  3K5N A;  2ZGZ A;  4ILJ A;  4CVN E;  4I9L A;  2D0B A;  2JLE A;  2QWL A;  4B9S A;  2RHK A;  1Z25 A;  4CIF A;  3OBW A;  1NOZ A;  3NCI A;  4JD2 B;  1SL2 A;  1BWF O;  3AGK A;  3OA9 A;  1S1W A;  3SUN A;  3DXK B;  2E88 A;  3L2Q A;  4GMJ B;  4FVM A;  3HI0 A;  3IFR A;  3UB5 A;  1TK5 A;  4MFB A;  4JS5 A;  3AA2 A;  4FL9 A;  5LJW A;  4W5R A;  3H45 C;  1FJG K;  2ZWH A;  3D45 A;  2A41 A;  4CCH A;  3V9X A;  2X6N A;  2A40 A;  3LDP A;  3DLR A;  3P5J A;  5MLC Q;  1VSJ A;  5GAE P;  4JKD A;  3LDL A;  1U04 A;  5JMV A;  5EXW A;  3BY5 A;  4DF8 A;  1OKJ A;  4BRL A;  4DCH A;  4JEP A;  3CF5 L;  2NNW A;  4LSL A;  3M8Q A;  1NJY A;  4FJL A;  1IH7 A;  1S1X A;  5KI6 A;  4W5T A;  3V81 A;  5AFU A;  3CC7 N;  1BIZ A;  2OCE A;  3CCJ N;  2GWJ A;  3CQX A;  5CHI A;  4CF0 A;  1KVB A;  5DM7 L;  4CZH A;  1XHZ A;  4K8X A;  3M5R A;  3HPG A;  4OGC A;  1VSL A;  3VQA A;  1TUY A;  2VQF K;  2O4I A;  3O6W A;  3H3N O;  4B8A B;  4CJL A;  3CJ7 A;  3TAN A;  2PBD A;  4DSE A;  1Q8I A;  3CCM N;  4BQZ A;  3AVG A;  1J53 A;  2CGL A;  1QSS A;  4JI3 K;  1HPZ A;  2D0P A;  4A61 A;  4FWL A;  1VSI A;  4LH5 A;  2P9S B;  4CHO A;  3V9U A;  4GNI A;  5FLX O;  4EP4 A;  3DRR A;  4BR7 A;  4Z4C A;  1X3M A;  4JD2 A;  3LDO A;  3AVI A;  3U9D A;  4B1W B;  1TAU A;  1BGX T;  4Q0B A;  3DXK A;  5BRF A;  3K5O A;  3HM9 A;  4DR5 K;  1A5X A;  3ENB A;  4C1N I;  3ZSR A;  5F0X A;  1HNW K;  2YX6 A;  2HMP A;  1NM1 A;  3ID6 A;  3TAM A;  4DS5 A;  1P90 A;  2E2O A;  4FJM A;  2FSN A;  1K6Y A;  3NGI A;  3PLA A;  4BRQ A;  4DR2 K;  1ASU A;  5FRM A;  1B92 A;  1RGI A;  1S1V A;  4JKH A;  2KKZ A;  3THV A;  3AA4 A;  4HUE A;  4PL7 A;  1B9F A;  1HQU A;  1KAZ A;  4ISF A;  3NFA A;  1KSP A;  5JS1 A;  1T8E A;  1VQ8 N;  2VGM A;  3HST B;  4MLE A;  3K5M A;  1EWQ A;  3AVN A;  3IS9 A;  1P8Z A;  2HHV A;  3TAB A;  2YJF A;  3PSI A;  4YDU A;  2YI1 A;  4IO9 L;  2P9I B;  4M3W A;  1HYS A;  3AVA A;  4HCC A;  4C8M A;  5GAG P;  3W3D A;  1J54 A;  2DTU A;  2D1K A;  2DPN A;  3ULD A;  4YOV A;  5JLF A;  1YAG A;  3EZ5 A;  1SZ2 A;  3MCP A;  1BCO A;  2P9U A;  1RT6 A;  1YTU A;  4ILH A;  2P9S A;  3OYH A;  1RBS A;  4AHT A;  2V52 B;  3TPQ A;  5LMU K;  4CIE A;  3TSU A;  1RDU A;  4I2P A;  4Z4G A;  4WQ4 C;  4FJ7 A;  4IXC A;  1KAY A;  4FJG A;  3EY1 A;  4JAX A;  3C6T A;  3ITH A;  3AVL A;  4CEQ A;  4A5A A;  1NK5 A;  1YVU A;  4ELU A;  2PY5 A;  2NRR A;  1RT2 A;  4O4G A;  4N47 A;  4DV3 K;  1RNH A;  1X9W A;  5D3G A;  4B9U A;  2GV9 A;  4DKW A;  3QNN A;  3DOK A;  3J7A P;  1RDB A;  2HNY A;  1XUP O;  2PFU A;  4CF9 A;  4KH4 A;  1HKB A;  3SPZ A;  2VYP A;  1VAZ A;  3LM9 A;  3ZX3 A;  1U2V B;  3MK6 A;  4M45 A;  1RBR A;  1SV5 A;  4DB3 A;  2HHT A;  2F7T A;  1KTQ A;  4M3Y A;  4IJA A;  4LY7 A;  1U6Z A;  4F9O A;  1YI2 N;  1NWK A;  3TR8 A;  3HTV A;  4ISE A;  4EFH A;  2NUB A;  3A5N C;  3C6H A;  2X74 A;  4IKF A;  5FPM A;  2F96 A;  2JWK A;  2P9I A;  3TAP A;  3ZET B;  3CQ8 A;  5FPD A;  4J2E A;  2BE2 A;  3CFP A;  4JKB A;  2ZE2 A;  4JYA K;  4GV9 A;  2NRX A;  3SQ2 A;  3NF8 A;  4I2Q A;  2PYL A;  2YHY A;  3KLG A;  3VGK A;  4FK0 A;  1X3N A;  3CME N;  1U45 A;  2BAN A;  4KRE A;  3S3M A;  3VA0 A;  5AQT A;  1FK9 A;  4AH9 A;  4E0D A;  4H0T B;  4KHY A;  3S3N A;  4CZI A;  4CJP A;  3OYL A;  3P38 A;  1OH7 A;  2XO7 A;  1GOC A;  4Q5V A;  4CEF A;  2G8W A;  4IOC L;  1CZA N;  3THY B;  4WFN L;  1JJ2 M;  4B9T A;  3KJV A;  4YFU A;  2YHX A;  1YIJ N;  4JK8 A;  4R5P A;  4CK1 A;  3OYG A;  1VQK N;  4IDH A;  3U3G A;  3KK2 A;  4CHZ A;  5C42 A;  1VSE A;  4CZF A;  1C1C A;  3FFI A;  1U2V A;  4BRA A;  3ZT0 A;  1RDD A;  1Y64 A;  4KTQ A;  4W5O A;  1BIS A;  2E4L A;  4KTZ A;  1WBB A;  1EWR A;  2YKN A;  3SMP A;  4X65 K;  1RTD A;  2QWM A;  1FKP A;  2NRV A;  1YHQ N;  1NGI A;  3AAP A;  3U4L A;  1NNE A;  5FPE A;  1N32 K;  5BPM A;  1HMV A;  1XQS C;  3JS6 A;  3V1R A;  5JIC A;  4DTM A;  2F8S A;  3O9U A;  1T03 A;  1HX1 A;  3SYZ A;  1L5U A;  4QS7 A;  4IEI A;  4X66 K;  2Z1I A;  3ZET A;  2OYQ A;  2NRT A;  2QW9 A;  5CZ2 A;  2KFZ A;  3HRG A;  5BPL A;  5AQH A;  1TAQ A;  1VQP N;  3LP0 A;  2YCH A;  1XC3 A;  3VF4 A;  3K57 A;  4FK2 A;  4FLT A;  2FXU A;  3EE9 A;  4ID5 A;  2AP1 A;  4OKE A;  1XC9 A;  1KLN A;  4IOX A;  4Z4F A;  2WOM A;  1IV0 A;  4H5T A;  3VQB A;  1N6Q A;  1HRH A;  1BU6 O;  5HL7 L;  4BVO A;  4JHD B;  3HOS A;  2QA4 N;  2HHQ A;  3EZW A;  3KIO A;  3NGZ A;  4KHU A;  4BR5 A;  4XH4 A;  3I33 A;  1MA9 B;  1N33 K;  3LM2 A;  3THY A;  3H08 A;  1TYQ A;  1CXQ A;  2VG5 A;  5E41 A;  1XNR K;  3SUO A;  3ALY A;  1JL2 A;  3LP1 A;  3MXI A;  3DMJ A;  3AVJ A;  1IKV A;  4JLH A;  1TKT A;  4DTR A;  4Z94 A;  2YKM A;  4K41 A;  3MXM A;  4CF2 A;  4AF1 A;  4WF9 L;  1B9D A;  3MX2 A;  2GEL A;  3C7N B;  5C24 A;  1ZYQ A;  4BRH A;  1RBT A;  3HYF A;  4B9L A;  1C0T A;  4CW7 B;  3IKM A;  3CCR N;  1SKS A;  4U7B A;  4CK3 A;  4RTF D;  5FPN A;  4KH6 A;  2BH1 A;  4IEE A;  4Y1C A;  4H4M A;  4CGI A;  1XMO K;  1KXP A;  1RT7 A; 
#chains in the Genus database with same CATH homology
 3D7E O;  1BA1 A;  3EO3 A;  2P9L B;  3CXC M;  3CCU N;  2Q1N A;  3QDK A;  2QM1 A;  3WXK A;  2P9K A;  1T6D A;  4R79 A;  4QS8 A;  3MDQ A;  3IDH A;  3ID8 A;  4FO0 A;  1M1K O;  2YJE A;  1O13 A;  3SLC A;  1QZ5 A;  3TSP A;  1N8R O;  1IG8 A;  4BR9 A;  3S41 A;  3QBW A;  3MN6 A;  4RCH A;  4B1U B;  2WFB A;  3A0I X;  4BRE A;  2Q0R A;  5LY3 A;  3TSQ A;  4BRK A;  4CBW A;  3QIC A;  4OPH A;  3F5T A;  4B1Z A;  4E1J A;  2ZGZ A;  3TTD A;  4G9Z A;  4JKE A;  5CE3 A;  4O5F A;  4ILJ A;  2QWL A;  2HBK A;  2RHK A;  4NB4 A;  4CD1 A;  1H1V A;  2IIR A;  4FOE A;  4JN4 A;  3OBW A;  3ULE B;  4JD2 B;  2EWS A;  1BWF O;  2CH5 A;  3AGK A;  4JHD A;  2QWR A;  3OA9 A;  5B8H A;  3QBX A;  3DXK B;  3CI5 A;  2E88 A;  3GBT A;  3HI0 A;  3IFR A;  3MMV A;  3ATU A;  4JKA A;  3UB5 A;  5F2R A;  2JWL A;  4FL9 A;  5LJW A;  4A2B A;  1K9M O;  3R6M A;  3H45 C;  4U67 L;  2ZWH A;  2A41 A;  2ZGY A;  5AQW A;  3CCV N;  3DWL A;  4IZ9 A;  3G4S N;  3KVG A;  1Q18 A;  2A40 A;  2ZF5 O;  2E2N A;  3LDP A;  1YXQ A;  1BDG A;  1NGB A;  5EY4 A;  1GLJ O;  4ISG A;  4YOR A;  4I6M A;  5MLC Q;  3WXI A;  3CCS N;  2Q36 A;  3MCA B;  1OVY A;  5GAE P;  4JKD A;  1V4S A;  3LDL A;  1DGK N;  3N4P A;  4H5V A;  4WQ5 C;  4XEI A;  5JMV A;  5EXW A;  2GX9 A;  2ASM A;  3Q7C A;  1OKJ A;  4BRG A;  4BRL A;  4DCH A;  4YOW A;  3D2F A;  4JEP A;  3CF5 L;  5C2D A;  2NNW A;  1VQO N;  1ATN A;  3C7N A;  3VEX A;  5AQV A;  1ATR A;  3GE1 A;  3H1Q A;  5AZJ B;  2WUS A;  4CZE A;  5AFU A;  3CC7 N;  3C6A A;  3VTI A;  4FPA A;  1VQ9 N;  1BG3 A;  3HBT A;  1K73 O;  3P4I A;  1HKG A;  4HTL A;  1NMD A;  2GWJ A;  1NBW A;  3CQX A;  5AQN A;  5AQY A;  5CHI A;  3CCJ N;  5DM7 L;  3EL2 A;  4CZH A;  4MO5 A;  4H5R A;  4PHT X;  5DM6 L;  2A6A A;  3M5R A;  4H0P A;  2W41 A;  1Z6R A;  4H0X B;  1NGD A;  2PAV A;  1TUY A;  2ASP A;  4KBO A;  2VWB A;  3L0Q A;  4CZJ A;  1K8A O;  3E9O A;  3WXM B;  3O6W A;  3H3N O;  5AFU H;  2P9L A;  3T69 A;  1EO1 A;  2RE2 A;  3QB0 A;  2ASO A;  1MDU B;  3CJ7 A;  2HF3 A;  1E4F T;  5BRD A;  2PBD A;  2QTD A;  3BEX A;  4NLC A;  2A3Z A;  4EIA A;  5HOO A;  4BRM A;  3EE8 A;  5ADX A;  3CCM N;  4BQZ A;  2FF3 B;  3E1Y A;  3VER A;  4WCE L;  2CGL A;  3SMS A;  3ZEU B;  4IO8 A;  3BF3 A;  3VEO A;  2D0P A;  4IWV A;  3SBT A;  3EN9 A;  1NGJ A;  5ELZ A;  5M1F A;  4A61 A;  4FWL A;  1ZXO A;  2P9S B;  1QHA A;  3A5O C;  2OTJ N;  4GNI A;  4JKF A;  3JXU A;  4BR7 A;  1X3M A;  1Z05 A;  2D0O A;  3I56 N;  4JD2 A;  4BRO A;  4H0V B;  3LDO A;  4A62 A;  4B1V A;  5ADX H;  5I9E B;  3U9D A;  5AQM A;  5BRH A;  2VCP A;  4B1W B;  3WT0 A;  3DXK A;  5BRF A;  1K8K B;  4M63 C;  3N4Q A;  3OBY A;  2OTL N;  4JKG B;  1NGA A;  4CJ7 A;  3ENB A;  4C1N I;  3WXJ A;  1GLF O;  3GDQ A;  2I7N A;  2NRH A;  4H0O A;  1HLU A;  4WQ4 A;  4BG8 A;  5F0X A;  3FR0 A;  3VF2 A;  1SS6 A;  2YX6 A;  5AQJ A;  2V51 B;  5AQS A;  3ZX2 A;  2HMP A;  1NM1 A;  3ID6 A;  4M7X A;  4BVP A;  3QFP A;  1P90 A;  3CJB A;  3MWT A;  1E4G T;  2E2O A;  5AQO A;  1DT9 A;  2FSN A;  1ZC6 A;  3H46 O;  3AGR A;  3PLA A;  5F1X A;  3VGL A;  3M3Z A;  2AA4 A;  2I7P A;  4B9Q A;  2J4R A;  4PKI A;  4AM6 A;  2HST A;  4BRQ A;  3G71 N;  3O5B A;  3L6Q A;  2ITM A;  3R1X A;  4NLB A;  1KQS M;  2GEM A;  4FWK A;  1RGI A;  4IOA L;  4BQL A;  2OAN A;  5AR0 A;  4JKH A;  2P9N B;  5AQI A;  4J8F A;  1NGH A;  3EKU A;  2KKZ A;  3D2E B;  3L4I A;  3Q7B A;  4FSV A;  4FWS A;  5AZJ A;  4RWT A;  2E20 A;  2HF4 A;  3O9R A;  4PL7 A;  1TUU A;  3A8Y A;  2Q0U A;  1KAZ A;  1JCE A;  5KPR A;  4PKH A;  4ISF A;  2FSK A;  2YHW A;  4JK9 A;  4JNE A;  3HOT A;  3P31 A;  1VQ8 N;  1TYQ B;  2IVO A;  1M90 O;  3BP8 A;  4O8U A;  1LOT B;  5GAD P;  2VGM A;  3M1F A;  2HBM A;  1X9J A;  3R3L A;  4MLE A;  4CZL A;  5GIP A;  3H1V X;  3RSE A;  4B1X B;  1P8Z A;  4MDB A;  2YJF A;  2CGJ A;  4YDU A;  4CBX A;  1GLC G;  1JCF A;  2YI1 A;  1S22 A;  4IO9 L;  3NVK A;  1HJO A;  2P9I B;  3F9M A;  4GV3 A;  4MO4 A;  3TTF A;  1D4X A;  2ZJQ L;  3O9S A;  2H3G X;  3VTH A;  2NZT A;  3R8E A;  3O9Q A;  3MN7 A;  5GAG P;  3W3D A;  2WBN A;  4OO1 J;  3O8M A;  5AQQ A;  3E66 A;  4BC2 A;  4BRP A;  2D1K A;  3H6E A;  2DPN A;  4YOV A;  3CQY A;  5JLF A;  4UY8 O;  1YAG A;  3CHW A;  1SZ2 A;  3MCP A;  3UKR B;  3ZEU A;  3KK7 A;  3VEW A;  1T6C A;  1S3X A;  3CPE A;  4BC5 A;  4BGA A;  2F9T A;  2P9U A;  3CJC A;  3CJA A;  3FGU A;  1JCG A;  1DKG D;  4EHU A;  4O8K A;  1NLV A;  4ILH A;  2P9S A;  1YUW A;  4ILG B;  1YJN N;  5C0Y A;  1V4T A;  2V52 B;  3TPQ A;  2UYT A;  4YOX A;  3SK3 A;  2HBJ A;  3TSU A;  3WUH A;  3ZX0 A;  1RDU A;  3SAH A;  4WQ4 C;  4K25 A;  4IXC A;  3U8X A;  1KAY A;  4BRD A;  5C12 A;  3CCE N;  4FPB A;  4JAX A;  1C0G A;  1R59 O;  4FVU A;  4A5A A;  3ATV A;  3SAF A;  2D4W A;  1RFQ A;  1DEJ A;  2QEX N;  2NRR A;  3SJH A;  3CC2 N;  3J8A A;  4BRF A;  1VQL N;  4FWO A;  1ESV A;  4FOI A;  1WOQ A;  4CD3 A;  1YF5 L;  3J7Z O;  1YJW N;  1HUX A;  4DKW A;  3CD6 N;  1GLB G;  3IUC A;  5C2F A;  3AAQ A;  3QML A;  3C65 A;  1XUP O;  2PFU A;  5AQF A;  4KH4 A;  3W0L A;  1HKB A;  1S72 N;  2P9P B;  3FZF A;  1W97 L;  5AQG A;  4BRI A;  2VYP A;  5H1S Q;  3OHR A;  2E2Q A;  2NLX A;  5M1N A;  1VAZ A;  4MDA A;  2P9N A;  3LM9 A;  3ZX3 A;  1U2V B;  3D2E A;  3MK6 A;  4XH1 A;  4FWN A;  4YOU A;  3DLL L;  3WEE B;  3I55 N;  3RVC A;  4JKC A;  4DB3 A;  4BGB A;  1T44 A;  3UKU B;  3MX5 A;  3TTC A;  1BUP A;  2F7T A;  4CZG A;  4H5N A;  1W2B M;  3VEZ A;  2QI2 A;  4IJA A;  2CGK A;  5KQD A;  1U6Z A;  3ULE A;  3MN5 A;  4F9O A;  1YI2 N;  1NWK A;  3VEV A;  1QQN A;  3FZL A;  3HTV A;  4ISE A;  4FWQ A;  3D6R A;  4EFH A;  1YJ9 N;  4I6M B;  3A5N C;  4LC9 B;  1LCU A;  3AY9 A;  3C6H A;  1VQN N;  4BRN A;  2IVP A;  5FPM A;  1EQY A;  2JWK A;  1IJJ A;  2P9I A;  3F2K A;  5AQP A;  3ZET B;  5FPD A;  5KPZ A;  4A5B A;  1QVF M;  1Q82 O;  2V7Z A;  4JKB A;  2ZJR L;  1BOT O;  2NRX A;  4DHY A;  3VMF B;  4GV9 A;  3QFU A;  2YHY A;  3VGK A;  4Y0W A;  3CJ1 A;  1X3N A;  1NGF A;  4H0Y B;  4WQ5 A;  3CME N;  5KPT A;  2ZJP L;  3K9K A;  1HPM A;  5KQ8 A;  1Q7Y O;  3VF6 A;  3DAW A;  3O08 A;  4DQ8 A;  5AQT A;  4BR4 A;  3CMA N;  3LDN A;  3DXM B;  3PIP L;  5M1O A;  4H0T B;  3CER A;  3L4Q A;  4A57 A;  4B1Y B;  4CZI A;  1YVN A;  4BY9 C;  4A2A A;  1QQM A;  5GIN A;  1ZBS A;  3P38 A;  2QWQ A;  3G6E N;  3O1B A;  5C10 A;  1ATS A;  1VQ6 N;  4WFB L;  3TU5 A;  5M1P A;  3VOV A;  3KZB A;  4IFE A;  3PIO L;  2BTF A;  3P39 A;  4IOC L;  3CCQ N;  1CZA N;  3VGM A;  4BR0 A;  2GTD A;  3I8B A;  1G99 A;  5EVZ A;  3SBG A;  5AZI B;  5TKW A;  4HWI A;  4WFN L;  2KHO A;  5LJV A;  1JJ2 M;  3BUZ B;  3HSC A;  1Q81 O;  2YHX A;  5M1K A;  4BRC A;  1YIJ N;  4JK8 A;  1KC8 O;  2WC9 A;  4C23 A;  1KAX A;  3WQT A;  1VQK N;  4IDH A;  1GLA G;  4KH5 A;  5C15 A;  4CZF A;  2KLA A;  2P9P A;  2Q2R A;  4JK7 A;  4YOT A;  3CIP A;  4XH5 A;  4PKG A;  3A5M C;  1U2V A;  5JVH L;  3WEE A;  3SAG A;  4BRA A;  3LL3 A;  4IJN A;  4BR2 A;  4CZM A;  4CBU A;  3FFK B;  3UKU A;  1SAZ A;  3C0B A;  3B8A X;  1Y64 A;  2HBL A;  1VQ5 N;  3LDQ A;  4CI6 A;  2QWP A;  5E26 A;  1C0F A;  2GWK A;  4CZK A;  3SMP A;  1NGE A;  2QWM A;  2NRV A;  1YHQ N;  3G25 A;  3OW2 M;  1NGI A;  3AAP A;  3U4L A;  5FPE A;  5BPM A;  3CCL N;  4H5W A;  1XQS C;  3JS6 A;  3MWP A;  5JIC A;  1K8K A;  1T3V A;  2E1Z A;  3O9U A;  1HX1 A;  4JKG A;  3K9J A;  1GLD G;  2FSJ A;  4QS7 A;  2QWN A;  2GUP A;  2P9K B;  1WUA A;  2W40 A;  4IEI A;  5AQU A;  5TKY A;  4C1N K;  5GAH P;  3ZET A;  3R9P A;  3WQU A;  4WFA L;  2NRT A;  2QW9 A;  3AAR A;  2E8A A;  3CC4 N;  5EOY A;  2VGN A;  3NVM A;  1VQ7 N;  3HRG A;  1NJI O;  3UE5 A;  4BC4 A;  5BPL A;  4MLH A;  5AQH A;  5AQL A;  3KHY A;  1VQP N;  3VEY A;  2YCH A;  1XC3 A;  3BF1 A;  3FZM A;  3HM8 A;  3VF4 A;  5BN9 A;  3M6G A;  2NRW A;  3ENH A;  1J6Z A;  2FXU A;  3EE9 A;  3U9Z A;  1BO5 O;  5BN8 A;  1ILY A;  2AP1 A;  3DXM A;  4FWR A;  4NO7 A;  3WXL A;  1VQM N;  1VQ4 N;  3CPW M;  4IOX A;  3VET A;  1MWM A;  2Q31 A;  3A5L C;  4EAH D;  4H5T A;  1BU6 O;  5HL7 L;  4BVO A;  3VPZ A;  4JHD B;  3HOS A;  3GL1 A;  2A42 A;  2QA4 N;  1KD1 O;  3RSE B;  3NMU A;  3EZW A;  2V7Y A;  4BR5 A;  3E9P A;  3FZH A;  4XH4 A;  3KWG A;  3MN9 A;  4EHT A;  5GIO A;  1BA0 A;  4YOY A;  4GV6 A;  3GOI A;  3I33 A;  1MA9 B;  3LM2 A;  4PL8 A;  2A5X A;  5JVG L;  1GLL O;  1QQO A;  1TYQ A;  4YDU C;  1YIT N;  1QVG M;  4BC3 A;  3FZK A;  3IMX A;  4GVE A;  5BRE A;  5AZI A;  3H3O B;  5AQK A;  2FLO A;  4K43 A;  4BG9 A;  3EKS A;  3VEN A;  4K42 A;  4QS9 A;  3ZYY X;  3HZ6 A;  1GLE G;  1Q86 O;  2QWO A;  2Q97 A;  5CR4 A;  4A59 A;  1NGC A;  2E1Y A;  3E9L A;  3O1W A;  4Z94 A;  2F9W A;  4K41 A;  2P9U B;  4AF1 A;  3O80 A;  1SQK A;  3KWI A;  3DJC A;  5AQZ A;  2E2P A;  3D2F B;  3ENO A;  4WF9 L;  3MX2 A;  2CH6 A;  2GEL A;  3C7N B;  4OPA A;  3O9T A;  5AQX A;  1MWK A;  1HKC A;  5M1Q A;  1QZ6 A;  4BRH A;  3UKR A;  2NRZ A;  3GG4 A;  5BR9 A;  3IKM A;  3CCR N;  4WYB A;  1NGG A;  5EX5 A;  2HOE A;  4U7B A;  2IVN A;  2QXL A;  5E84 A;  3T7Z A;  4RTF D;  5AQR A;  5FPN A;  2BUP A;  3VES A;  4KH6 A;  1RDW X;  2BH1 A;  4AM7 A;  2FF6 A;  4IEE A;  5BPN A;  3O4W A;  3CET A;  4H03 B;  4GY2 B;  4L3Q A;  3FLC O;  3CJ9 A;  4M7Y A;  4FWP A;  1KXP A;  3FE1 A;  4FWM A;  5JLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...