4WCEL

The crystal structure of the large ribosomal subunit of staphylococcus aureus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
110
structure length
110
Chain Sequence
b'MISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKGVTLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYLYHGRVKALAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S rRNA
publication title Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4wceL01
1VQ6N 1N8RO 3CCLN 5HL7L 1VQON 3CC4N 1YJ9N 4WCEL 1KC8O 5GADP 1KQSM 3I56N 1QVGM 3CCQN 3PIPL 1OVYA 1YHQN 3G6EN 1M90O 2QEXN 1M1KO 1JJ2M 1VQ7N 2QA4N 3CD6N 1W2BM 2ZJRL 3CC7N 1Q7YO 3CCUN 1Q86O 3G4SN 1NJIO 1VQ5N 3CCVN 5GAEP 5JVGL 1YIJN 5GAGP 1K8AO 1YJWN 4UY8O 4U67L 1ILYA 3PIOL 1VQPN 3DLLL 5DM7L 3I55N 4WF9L 3CXCM 3CMEN 3CC2N 5DM6L 1K9MO 4IOAL 1VQNN 3CF5L 3CCMN 1VQ9N 1VQLN 3CCRN 1QVFM 1YJNN 4WFAL 1K73O 3CCSN 2OTJN 3CMAN 3CCEN 4IOCL 3J7ZO 1KD1O 1YI2N 5MLCQ 1VQ4N 1VQ8N 3G71N 1Q81O 5H1SQ 1Q82O 4WFNL 3CPWM 1VQMN 2ZJQL 3OW2M 1VQKN 4IO9L 1YITN 3CCJN 5JVHL 1S72N 2ZJPL 5GAHP 2OTLN 4WFBL
chains in the Genus database with same CATH superfamily
5M1PA 4B1UB 3HPGA 5AQRA 3SUQA 1N8RO 2FSNA 4CGIA 3VQEA 3T1YK 1ZBSA 2A1SA 3I0SA 3L3UA 3AVNA 4LF4K 5GADP 2WONA 3HSTB 5HRSA 4O8KA 4XIUA 2ASPA 4OLAA 1CXUA 3LP2A 5M1QA 3OYIA 2QEXN 3EE9A 2GTDA 4J2AA 3B8AX 3VPZA 3H1QA 1LAVA 4MDBA 4HTLA 1GOCA 4IEIA 2JGUA 3K57A 3T1HK 4DV2K 4NB4A 1EWQA 4CW7B 4B9VA 5LY3A 5M1OA 4NLBA 3THXB 3GDQA 3AA4A 3L2QA 1ZYQA 4DR4K 1TK5A 1RBRA 4WF9L 2O8EA 3PO4A 4GV9A 4DV6K 4O0JA 3ZT3A 3CC2N 2HB5A 3HO1A 4CCHA 3HSCA 3VA0A 1RT4A 4V19S 1IO2A 4YFUA 1TK8A 3O1BA 1QVFM 3BGRA 4DTNA 1RBUA 2BGGA 2XHBA 4B9LA 3D2EB 4FYDA 4IDKA 4LF6K 2Q1NA 1S22A 3GG4A 2QWMA 1U49A 4FWPA 4CEDA 2F7TA 2XY8A 2QKBA 1X9SA 4GVEA 2NRWA 4M63C 4MO5A 2W40A 3SAFA 3VGKA 3W0LA 1GLDG 3ULEB 1VSKA 4H5WA 3MDQA 3UB5A 2PBDA 5J2PA 2ZJQL 2YX6A 3OS2A 4CJ7A 4TSXA 4JHDA 3O9UA 2QK9A 1ATRA 3D2FB 1LWCA 1QE1A 2HHUA 2O8BB 3D45A 3LAMA 4CJ4A 4Z4GA 3VQBA 3O3FA 1O1WA 5DK5A 3MX5A 2W6LA 3AA2A 1QQOA 4IBNA 3B6OA 1NJWA 1OH6A 3FZKA 3C95A 4B9SA 5CZ2A 3CJ7A 2WC9A 4CIEA 1SL0A 4CZGA 3HTVA 4N5SA 1YVUA 1VSDA 5E26A 3TTDA 4MFBA 3OYBA 3THWA 4ISEA 4J8FA 3FLCO 1YXQA 1Y64A 4JK8A 1VHXA 2P9LA 3ZT4A 5AQZA 3L8BA 4JAXA 1WBDA 4FK0A 4DTOA 3CFOA 3K9KA 3K5MA 4F3OA 3G0ZA 4B9NA 3HM8A 1KVBA 3AVHA 4I6MA 4B3RK 2J4RA 4FLXA 1C0TA 4Z4IA 1LWFA 4CF1A 3JYTA 2F9TA 1HNXK 2KW4A 3G10A 5KQDA 1Q18A 3AO4A 4FPAA 4CD3A 4LF7K 1JLFA 3U8XA 3VA3A 1UOCA 3ZSOA 3HVRA 3ZT2A 3CF5L 3CPEA 3K0SA 3SNNA 3IMXA 4H8KA 4Z4FA 2P9KB 4ICLA 3AVLA 2G8FA 3THYA 3KKRA 3VQ7A 2IVOA 4DV5K 4EFHA 2Z1GA 3N4PA 3ENBA 2HHSA 4FPBA 3CMAN 3OYNA 3H08A 4K8XA 2ATQA 3AVMA 1YUWA 5BRHA 2IIRA 4JNEA 4BRKA 3SQ4A 4JEPA 1WN7A 4OPAA 2HBMA 3O9RA 2E2PA 4CJKA 3SBTA 1SL1A 1GOBA 4R79A 3KLEA 1TAQA 3ZX2A 4MLEA 3O08A 3LAKA 3FR0A 3CETA 1LOTB 2Q3SA 3AVBA 4OPKA 3CJAA 5BRDA 3ZCMA 4ZHRA 3BP8A 1RBSA 3UKRA 2QWQA 4O5FA 2H3GX 4K8ZA 3O4QA 2QXFA 4KH4A 4DMNA 1U45A 3TAPA 3C6AA 4FWOA 3VQ4A 4BR0A 5IWAK 2G8IA 5GIOA 5FPEA 4BG8A 1DEJA 1IBMK 3CIPA 3RMDA 1YJ9N 1WB9A 2A5XA 5AZJB 2NRZA 2HBKA 2FXUA 3HI0A 1QVGM 4BVPA 4B1WB 3T69A 3QESA 1NK7A 1TUUA 5KRSA 3I8DA 2YCHA 3WQTA 5M1NA 1HRHA 3IFRA 1V4SA 2XY7A 1XHXA 3VQ8A 4Z94A 5J2QA 5AQPA 3NGZA 1SKRA 1N33K 3K2PA 1QZ6A 4H0TB 1NJIO 1VQ5N 4E7HA 3DXMA 3P39A 4KBOA 3UIQA 4ELTA 3DRSA 4EP4A 4HTUA 1RDCA 4XH1A 1IG9A 1TL3A 3I8BA 3OS1A 1WSIA 3KD1E 4HUFA 5J2MA 3SV4A 1BU6O 2QXLA 2PYLA 2OANA 2Q97A 3SQ1A 3TSUA 2ZM6K 1VQLN 2F8SA 3CCRN 4B9UA 4CF8A 4H0PA 4ZTJA 4JHDB 2DPNA 2YKNA 3T19A 3HOSA 3WNFA 3W3DA 5J2NA 1Z6RA 3U9DA 3LDNA 3QEPA 1W9HA 4JKEA 4GW6A 4KI4A 3LDOA 4FL9A 1JLEA 4KHSA 3WNEA 3J7ZO 3DJCA 4CJWA 4DR5K 1L5UA 2X6NA 2ZGZA 3H3OB 2X74A 4QS7A 5AJ3K 2RE2A 4M3WA 4JD2A 3RMCA 3M8SA 1C0MA 4OLBA 3JSMA 1JLGA 3I33A 5AQHA 1EXQA 3LP0A 3RTVA 2NLXA 1HLUA 2VCPA 4PA1A 3TSQA 3CPWM 1P8ZA 2P9LB 2QI2A 3OYEA 1ZBIA 4DHYA 4FM1A 4Z4CA 4JI6K 3RR7A 3QMLA 1S72N 4I6MB 4DV7K 4FJGA 4H4OA 1G15A 5GAHP 1XMQK 5LMNK 3PLAA 1C1BA 1WSHA 1BWFO 4IFVA 4DQIA 1ZBHA 4ILHA 1VQ6N 2ZGYA 1BUPA 1NK0A 2HHHK 2JLEA 1K8KA 3ZSWA 4DU1A 1SKSA 2OPQA 3JAMO 3JXUA 3OYDA 1KC8O 3KK1A 2JWKA 4OGEA 2HHWA 1TYQA 2Y1JA 1NNEA 4CJQA 4GV6A 4A2BA 1S1XA 4ILGB 1E4FT 4QS8A 3PX6A 5AQUA 1YHQN 2E1ZA 3D6RA 3PUFA 4KI6A 4CHQA 4K0KK 3THYB 4JK9A 3HL8A 3OA9A 2QA4N 5KPRA 3CCUN 1IJJA 4CVNE 2GV9A 3CCVN 1XC3A 4K42A 5GAEP 3RWUA 5CE3A 4DTJA 1NK8A 1VSIA 5IT9O 2F9WA 4H5TA 5AQGA 5LJVA 3TAGA 3UE5A 2E2OA 3D7EO 3DLHA 5AZIA 4FWLA 1T6DA 3L2VA 1DGKN 5AQKA 1K9MO 2YJEA 3P1GA 3ZETB 4BRDA 2HNZA 2V52B 4FW2A 2O8DA 3OS0A 2QWOA 3MEGA 2XO7A 3LPTA 3LP1A 1X9WA 1YTAA 2QM1A 1GOAA 2JWLA 3KK2A 5LMUK 3UKRB 1SAZA 3F5TA 2Q2RA 5EX5A 2YNHA 4E1JA 1GLLO 1DT9A 2D0AA 1WLJA 3TAMA 1CXQA 5KI6A 2FBYA 4PL8A 4IJNA 2GBZA 2EHGA 1HX1A 3ATVA 4FOEA 4H03B 3WQUA 3THVA 2UXBK 3NGYA 4LFAK 2QWRA 1BQNA 1UWBA 4K25A 2QWLA 2HMPA 3KVGA 3QEWA 1U48A 3AAPA 3EE8A 3TU5A 1SS6A 4O0IA 2YHWA 4FWRA 3KK3A 1Z26A 4CEFA 3B6PA 1YITN 3CCJN 1YVNA 2A6AA 4CFAA 5C25A 2FF3B 2E4LA 3DXMB 4M45A 3U3YA 2HVIA 4O4GA 2HMIA 3OBWA 3E1YA 5LJWA 3EYZA 2E5LK 3H6EA 2Z1HA 2HF3A 3FZFA 3L6QA 4FM2A 5AQSA 2YHXA 1VSJA 1RNHA 5TKWA 4H5NA 2GX9A 3S3MA 3P4IA 4AHCA 3OYGA 1S1WA 4KHNA 3H3NO 1QHAA 2FC0A 2WTUA 4BR5A 1JCGA 2VGNA 1KFSA 4DQRA 2QTDA 3SZ2A 1W2BM 4YOUA 3F73A 4HVJA 4DTPA 1EETA 3M3ZA 1N5YA 3S9HA 2HOEA 5CY4A 3A8YA 4EHUA 4JD2B 3R8EA 1NGJA 1BDGA 3EZ5A 3DMJA 1VQPN 2YNGA 3WEEA 4CHYA 3NDKA 2IVNA 1NOZA 3HK2A 4E1MA 4KHWA 3CM5A 1KCFA 3O9SA 1LW2A 3VF4A 3QIOA 4QCLA 4BQLA 1YI2N 1HYVA 4NXNK 4BRIA 5K14A 1YAGA 4LSLA 4K41A 4CEEA 1XC9A 4JI8K 4FLTA 3LDSA 1WAFA 2QWPA 1TKXA 2IGIA 2GUPA 2I5JA 1TKDA 1SL2A 4JKDA 3SLCA 1KD1O 2F4VK 3V9SA 3CQYA 4GV3A 4DV1K 1LCUA 1JLCA 4JLHA 4KFBA 4DTRA 2YHBA 1ASUA 1JLBA 4FJ8A 3KKSA 5AQWA 1TYQB 1HUXA 2GWJA 1YT3A 3ZSZA 3K59A 5SWMA 2UUAK 4H0XB 5C0YA 1L3UA 2OPSA 3E9PA 4CEBA 2GUIA 1P90A 3DI6A 3NE6A 1SUQA 1TL1A 5ELZA 4I9QA 4I9LA 4A61A 5AFUA 2P9UA 4CJLA 3H45C 1TVRA 4A62A 4HHTA 2BE2A 4AHSA 3TSPA 4IEEA 2HHTA 4AILC 2AA4A 3EZWA 4AQYK 1CLQA 5FPDA 4Y1CA 1BIUA 3QIPA 4WCEL 4DQSA 2YJFA 3VQ5A 2O8DB 3O4NA 4DQQA 4BRCA 1VQ7N 1GLEG 1HJRA 2E6MA 3FZLA 4CIFA 3M5RA 3V9UA 3CJ1A 1K8AO 4EAHD 3DRRA 3RVCA 4RW6A 3M8QA 3OYCA 4J2EA 2KZZA 4WQ5A 4KHYA 1EP4A 3I55N 3VTHA 1KSPA 4U7BA 3DLBA 2G8VA 3A5MC 1U47A 2DTUA 4DLGA 1MWMA 4X62K 1JCEA 1VSLA 2P5OA 4B9MA 4C1NK 2KZMA 3NF6A 1VQNN 5CHIA 5AQOA 3KLFA 4MDAA 4CHZA 3MECA 4FWMA 1D8YA 1HYZA 4DSFA 3RSEA 4X65K 2NUBA 3OYMA 4DSIA 4BC2A 3WNHA 4JRQA 1SZ2A 4RWTA 4CJUA 2UUCK 3VQPA 2WFBA 1RGIA 4F2RA 3ZSXA 4DUYK 1NM1A 3QINA 3SI6A 3VETA 2E20A 4FW1A 3ITHA 1OKJA 2O8CA 1VQ4N 4ID1A 3ID8A 3CI5A 5FPNA 1X1PA 3BF1A 1U6ZA 2I7NA 3L2WA 1T3VA 4E7IA 2P9SA 3BEXA 2Q0RA 4FO0A 3NGIA 5JICA 3H1VX 5AQXA 4PHTX 4E1NA 1N34K 3IUCA 4BRGA 3RMBA 3FE1A 3QNOA 4I7FA 3UKUA 2OTLN 4XEIA 3NCIA 4WFBL 1GLCG 3WEEB 3LZIA 3WNGA 2P1JA 3QEIA 1MDUB 1SV5A 2D0OA 2HF4A 4F9OA 4KHUA 3KZBA 4YHHK 3G25A 1C1CA 1Y97A 4WQ5C 4CK3A 3N4QA 1QTMA 3V1QA 1OVYA 3SUOA 3E9LA 4CFDA 2NRHA 1S1VA 2VWBA 4BWJA 2XY5A 4BRNA 1EKEA 4DLEA 4GKKK 1MU2A 3K5NA 4GMJB 5CZ1A 4CJRA 2NRTA 3K5OA 4CGDA 1WSJA 4RG8A 4OJRA 4IG0A 1J5OA 2FBXA 3ID6A 4BRFA 3TAFA 3VGLA 3J7YP 3QEXA 3S3OA 4DF4A 4JI7K 2IAJA 4YORA 4CHNA 4FCYA 3E01A 3OJSA 4FJ7A 5HROA 1W7AA 4F2SA 1IH7A 4BREA 1XUPO 3ASMA 2E8AA 3V1RA 2PY5A 1C0GA 3OYJA 1U2VA 3HYFA 4AM7A 4JYAK 3CCSN 3ISNC 4NO7A 1T7PA 2A40A 3SBGA 4CFCA 4IJAA 1NLVA 3MXIA 1WUAA 4CJFA 4IOCL 2NNWA 1NGBA 3QB0A 2VG5A 5C2DA 4W5TA 1ITGA 4B3TK 2UU9K 1RTIA 4JN4A 4DR3K 1RTHA 4KAZA 2VWKA 4KHQA 2YHAA 1RBTA 4LH4A 4M3RA 4CGGA 3AVKA 3TI0A 2VQFK 3A5LC 3OTOK 2PAVA 3MWPA 3AVGA 2P9IA 1YTUA 1RCHA 4YOXA 3A0IX 2O8FA 5M1FA 1BL3A 4HWIA 4A5BA 4DSKA 1KRPA 3KJVA 4KTWA 4F8RA 2O4IA 3MMVA 1RT3A 3MEEA 5C24A 3MXMA 3TR8A 4FJKA 1J6ZA 2HHVA 2HVHA 3CCLN 1QSLA 4O5BA 4B3SK 4DG1A 2VWJA 3F9KA 4M3YA 4FWSA 1NKCA 1I3AA 3VMFB 4IO8A 4DR7K 5E41A 2Y1IA 2HHQA 3CCQN 4J2BA 5EXWA 3SAGA 4Q5VA 4CESA 3VEWA 4CJVA 1ASVA 4C8LA 4KV8A 3VF6A 1TKZA 3SPYA 3PSFA 4M3TA 3O6WA 4FWKA 2HSTA 3PY8A 2KFNA 3NFAA 4FLWA 3G4SN 1NJZA 1JXBA 2O8EB 4BRQA 5JVGL 1NMDA 5HP1A 1ESVA 3GOIA 4N41A 1QS4A 4E7LA 3QICA 4JKGA 1T8EA 4YOVA 2O4GA 4A2AA 2RPIA 3CG7A 3J7AP 1T03A 3Q7CA 4FM0A 4C8OA 1TAUA 1E3MA 3LDPA 1BG3A 4QAGA 4JKBA 4JV5K 4B1YB 3ULDA 3QO9A 4CF9A 1S6QA 4AHVA 5C2FA 3K9JA 4C1NI 1IV0A 1HKGA 1SQKA 4BRPA 1WAJA 1EX4A 3HT3A 1O13A 4CERA 3EY1A 1R59O 4FLUA 3VEYA 3OBYA 1Q9XA 3O9QA 4BRAA 4Z4HA 5TKYA 4H0VB 1HMVA 3GBTA 3RR8A 3TWHA 2KFZA 4IFYA 5I9EB 1S9EA 3GE1A 2FSKA 4BGAA 1HNZK 5FDLA 5C10A 1QQNA 3OHRA 3L0QA 1FXXA 2E2QA 2P9PA 3FZMA 2G8KA 4LF5K 4LC9B 2P51A 4DTMA 5KRTA 4CZKA 3KWGA 2ASOA 4BR2A 3J80O 1RDDA 1REVA 4BROA 3EKUA 1EO1A 3MXJA 4DV0K 4C8MA 1NBWA 4N47A 4BACA 3ZEUA 1ATNA 4G9ZA 3THWB 2EWSA 3AGKA 3DYAA 1WSFA 1ATSA 1VK0A 4X66K 5AQTA 3AVFA 5ADXH 3VESA 3AVJA 3G6EN 1OH7A 3C7NA 2FSJA 1NGAA 2Q36A 3F9MA 3SJHA 3VTIA 3CFPA 5F2RA 3ZSYA 3C94A 1KTQA 2RHKA 1YIJN 1L3SA 1KLNA 2LSNA 3MN7A 4ZTFA 1JL2A 4FJXA 1DTTA 4FJMA 4LF8K 3OY9A 1RDUA 3ZSRA 4NCBA 3LP3A 4KH6A 4RW9A 4PY5A 2OA8A 2P9IB 1L3VA 1KXPA 3U3GA 5BREA 1JL1A 3TPQA 1JLAA 3DLGA 3VF2A 5AQJA 3D0PA 1EWRA 3H46O 1D9FA 3M1FA 4KRFA 4MQ3A 3VQCA 2UUBK 4M7YA 4DV4K 4WYBA 4DSJA 5HBMA 5JLFA 4Z0UA 5D3GA 5JLHA 1NOYA 1BCOA 3F2KA 4CZIA 3MK6A 4A5AA 1Q9YA 4EHTA 1Z05A 1UA0A 4LFCK 4FVUA 3BZCA 2UXDK 1BI4A 3HPOA 3AA5X 3KTQA 4CJ3A 3LANA 4JS4A 1UAXA 2ZF5O 5JS2A 4O44A 2D4WA 1NGCA 3RRGA 3T1AA 1NK4A 3TARA 4JRPA 2G8UA 3SV3A 1IG8A 3OYLA 3MN5A 4JKGB 1WOQA 1S9GA 3ATUA 1C0FA 3A5NC 2KTQA 3CC4N 1WSGA 1BA1A 2Q31A 2WUSA 2PFUA 3CFRA 4DU3A 3CYMA 3LWMA 2E2NA 4M41A 4I2PA 2VQEK 4DR1K 4CE9A 2IDOA 2FLOA 4XH5A 3CQ8A 2Z1IA 3LZJA 1QSYA 1N32K 3EEQA 5HRNA 1IBLK 1GLJO 4CEAA 2ZJRL 2CH6A 4IWVA 4BQZA 3U6FA 1B9DA 1EQYA 3QLHA 3T7ZA 4JK7A 1C1AA 3DLKA 5E84A 2KQ2A 3AV9A 3CMEN 4UQGA 1BHLA 5DM6L 1NGGA 3MCAB 3FGUA 2BUPA 3R9PA 1B9FA 4CJPA 4CEQA 1IKVA 3OJUA 3CCMN 1HYSA 3AVCA 3O4WA 3ZX0A 3DLEA 3VENA 4CGJA 3FZHA 5KQ8A 2P9PB 3AA3A 4W5RA 4JS5A 3LDLA 1BQMA 1ZBUA 3HXMA 1T6CA 4ELUA 2OZMA 1FKPA 1NU0A 3ZLJA 3FFKB 2W41A 1IBKK 3CCEN 5M1KA 5EOYA 2OZSA 2IVPA 1C0UA 4O8UA 2VYPA 3VEZA 4BY9C 4O55A 4CGHA 4CGFA 5AQYA 4BC3A 3AAQA 4DTSA 4IG3A 1E4GT 2OPRA 1G99A 3NAEA 4FZZA 3C7NB 1QSSA 2YNFA 4RW7A 3SUPA 1VQMN 4CHOA 4JI1K 1ASWA 4CZEA 1V4TA 3O9TA 1Z25A 3KD5E 3DM2A 4AF1A 4DR6K 1DKGD 4KO0A 5A2QO 2FBTA 3VQ6A 1K8KB 3VN5A 3LM2A 4OKEA 1RDAA 2G8WA 5C42A 3VERA 2AP1A 1OH8A 3D2FA 2BDPA 3AO3A 1A5WA 3HBTA 4DSLA 2B6AA 4DV3K 2WOMA 5I42A 5BR8K 4KB0A 4H0YB 1NK6A 4CZMA 4LSNA 1GLBG 3A2FA 4YY3K 1X3NA 4GY2B 3PIPL 1RT2A 4CEZA 5FRMA 1F21A 3C0BA 5AQMA 3O3HA 4OX9K 3E66A 1KLMA 3CM6A 5BPNA 3WXKA 1HR0K 2F96A 4N76A 2UXCK 1QZ5A 4DWIA 1RT5A 5HRPA 5GAGP 5AZIB 1YJWN 2ITGA 4OPHA 2CGJA 5BPMA 3BY5A 4Y1DA 4BWMA 5CYMA 4DKWA 3A5OC 5HOOA 2ZWHA 1BI4B 1NGFA 2X6SA 3SYZA 4H4MA 3CJBA 4RCHA 3O3GA 1W97L 4C8KA 3NH0A 4KPYA 4HCBA 3IDHA 3C6UA 4ISGA 2D1KA 4FVMA 1B92A 1BOTO 4NCGA 1A5VA 4A59A 3NF9A 3TAEA 2IOCA 4JKCA 2D0BA 5DMRA 4CF0A 1KVAA 1ZBFA 4KHPK 4B9QA 3ZSQA 4DFPA 4I2QA 5LL6Z 1XNQK 1TV6A 3OYKA 4LFBK 3KHYA 2IS3A 1NWKA 1T05A 1HNVA 4DFMA 2CGKA 4CIGA 4FLVA 1Q82O 1KVCA 2D5RA 3QFPA 5AQFA 1LWEA 3SMSA 5B8HA 2P9NA 2E1YA 2OYQA 4ILJA 1XMOK 3NMUA 1NGHA 3ZT1A 3AVAA 3DLRA 4CBXA 1D9DA 4X64K 4Q0BA 1KAYA 2RKIA 3WXIA 4N56A 4CFBA 3NHGA 1OVQA 4CJSA 3RMAA 1VRUA 4RW8A 4CZHA 2R7YA 4FJHA 1FW6A 3DWLA 1I39A 1RTDA 4JI3K 3P31A 1QQMA 4JI4K 5AZJA 3VEVA 1M90O 5KTQA 3I0RA 2HHXA 2DFHA 3CD6N 1NK5A 3KLHA 2HBLA 5AFUH 4AHRA 3S3NA 3MEDA 4KREA 1VSHA 3ENOA 4YDUA 4CBWA 4M3XA 4JI2K 3LM9A 3TTFA 3ZX3A 1ILYA 2V7YA 4DFKA 1KAZA 3L4IA 3QERA 5AQNA 3PX4A 3CXCM 4L8RB 1UA1A 2ETJA 4NLCA 5KGWA 2KLAA 2PYJA 1WBBA 2X78A 4FXDA 4QOZB 1VQ9N 5BPLA 4YOTA 3NVMA 1RDBA 4AM6A 5AQLA 1LV5A 3HP6A 1NK9A 3L2RA 5EVZA 5BN9A 3V9WA 1WNSA 1JCFA 2BANA 1ZXOA 4NYFA 4FJLA 4OVLA 4IXCA 4E7JA 4PQUA 1MA9B 4IKFA 4GKJK 4MO4A 4M3ZA 2XY6A 5AR0A 4NCAA 5HLFA 4J2DA 4CBUA 2P9UB 3DAWA 4EZ6A 2CGLA 4E19A 3QEVA 4BG9A 1VQKN 4IO9L 5FRNA 3WXMB 3T3FA 4H0OA 3U9ZA 1HNWK 3OYFA 2NZTA 1WSEA 4DF8A 1LW0A 4CZLA 2ZJPL 1JKHA 1MWKA 3KLIA 2VG7A 5I3UA 4CF2A 1S6PA 4M3UA 1NMNA 4DSEA 4E89A 1S1TA 3MX2A 3LDQA 5HL7L 3IG1A 4Z4EA 2KHOA 4YDUC 1VQON 4CK1A 4CJEA 4W5NA 5JMVA 4WQ4A 5HRRA 4FJ9A 1IKWA 1L3TA 3SUNA 1TKTA 4FSVA 1VSMA 4M7XA 4CK2A 5AQVA 3GL1A 3SPZA 3AO5A 3C6TA 3O5BA 2ZE2A 4B8CA 3BZKA 4B1ZA 4BDYA 5KPZA 1IKXA 1BO5O 3JS6A 5FPMA 1XI1A 1FKOA 5C15A 4UY8O 5AQIA 4U67L 3LPUA 3R6MA 2QKKA 5CYQA 3RSEB 4JKFA 1J53A 3CJCA 3U4LA 1W0HA 3M8PA 2NRRA 3L3VA 1YF5L 1S5JA 1A5XA 4CHPA 4CZFA 3VEXA 3QBWA 4PUOA 1YJNN 3WXJA 3P5JA 4QS9A 4G1QA 2P9NB 3E9OA 4RW4A 1S3XA 5ADXA 1K73O 3IS9A 4YOYA 4AH9A 3ZETA 4KTQA 4B1VA 4E0DA 1T44A 2OTJN 2BH1A 5SZTA 4FLZA 2DY4A 2O8CB 1J9AA 1BIZA 3WXLA 4B8AB 5KPTA 1BGXT 2VGMA 3QFUA 4BR9A 2YHYA 3QETA 2P9SB 3LALA 3G71N 4B1XB 3VQ9A 3HOTA 4E3SA 3SAHA 3HP9A 4JKAA 3WT0A 5BR9A 5GINA 5F1XA 2A42A 4B3OA 3DXKA 4HUGA 1RFQA 1CZAN 3VGMA 3UKUB 4WQ4C 1NJYA 3CERA 4A57A 3Q7BA 4BC4A 4H5RA 1N6QA 4KTZA 4EZ9A 5KGXA 2D0CA 2EX3A 3V9ZA 3SK3A 5FLXO 3ZT0A 1FK9A 1HJOA 3VQAA 4E7KA 4GNIA 2RF2A 3M8RA 2XRIA 2YV0X 3NH1A 3I56N 4FJJA 3L4QA 3LL3A 4DTXA 1KFDA 2RN2A 3ZSVA 4BE1A 4BC5A 3SMPA 1SKWA 4CECA 1GLFO 1M1KO 2FF6A 1HPMA 2ASMA 4PKIA 1QHTA 4ELVA 3QNNA 1JLQA 4IDHA 1CZBA 3BUZB 4CJTA 2E88A 2I7PA 4YOWA 3BF3A 3CQXA 1HKCA 3HVTA 4DU4A 4DTUA 4R5PA 1JXEA 3NF7A 4B3MK 5GIPA 1VSFA 3V4IA 3EKSA 3IAYA 1U2VB 3V81A 1J54A 3MWTA 3SQ2A 5EY4A 3PSIA 1R0AA 1BISA 3HZ6A 4L3QA 5BN8A 1GLAG 1S1UA 4IFEA 2DFEA 1OH5A 1X3MA 4PKHA 4CEOA 4CI6A 3VQDA 2UYTA 2F8TA 3KWIA 4BE0A 1TGOA 1VRTA 3M6GA 4PKGA 1X9JA 4DQPA 4FJ5A 3C6HA 3EO3A 2O8FB 1ZBLA 1NKBA 2YNIA 3OVNA 3TAQA 4AHUA 4BRMA 5H1SQ 2A41A 1NKEA 4WE1A 1VSEA 2GELA 3QBXA 2W6KA 4OKKA 1QQCA 2CH5A 1BCMA 3R3LA 4OKJA 3RRHA 2E6LA 4OO1J 3AO2A 4Y0WA 2HNDA 3NBPA 2QWNA 3V9XA 3C65A 2V51B 2B4JA 4DB3A 4FJNA 4F3TA 4AHTA 1RTJA 3DOLA 2AJQA 2A1RA 1KQSM 1H1VA 1RT7A 3KK7A 2NRVA 1HKBA 4PWDA 1TUYA 4BE2A 1BA0A 3HPHA 4CZJA 2B5JA 4EIAA 4XH4A 3TTCA 4BDPA 4FK2A 2HW3A 1Q7YO 3NH2A 3MN9A 4IOXA 5C12A 1Q86O 4K43A 3VEOA 3BDPA 3K5LA 3HM9A 1DLOA 4CD1A 1J5EK 4KKOA 4DUZK 4BR4A 3DLLL 1VAZA 2VG6A 3AY9A 5F0XA 5DM7L 3TANA 1IKYA 1RT6A 4BGBA 3P38A 2PZSA 2V7ZA 4IOAL 3DXKB 4JKHA 2YI1A 2BTFA 4FK4A 5AQQA 3S41A 3AVIA 2G8HA 4OGCA 4DS5A 1HQUA 2GEMA 1FJGK 2W42A 1HPZA 1NGEA 4KB1A 1RT1A 2ZQBA 3MAQA 3MN6A 4LY7A 3NVKA 4LH5A 3V1OA 3ENHA 3FFIA 4YNQA 2HNYA 2GWKA 1ZC6A 4GVMA 1I94K 2Q0UA 5JS1A 1TK0A 4ID5A 5T7BA 1U4BA 4DR2K 3THXA 1NJXA 4W5QA 1LAWA 2DFFA 2IC3A 1VQ8N 3NF8A 3ZYYX 3WUHA 1X9MA 2QW9A 1Q81O 1XWLA 4WFNL 2ZD1A 4BVOA 4B9TA 3O8MA 1D4XA 3PO5A 5CR4A 2WBNA 3OW2M 3IKMA 4DS4A 4BRLA 1KAXA 3D2EA 3ZEUB 5J1EA 2FBVA 4C8NA 3V6DA 3P83D 4FWQA 3AGRA 4FWNA 1U04A 2Z1JA 3SJJA 3AO1A 1NG9A 3EL2A 3IRXA 4CJ5A 3HJFA 3HRGA 3CHWA 3J8AA 5FROA 1RILA 2OCEA 4LD0A 4FZXC 1N36K 4NYNA 2KKZA 3ULEA 3K58A 1JJ2M 1NGIA 4ISFA 1C6VA 4HCCA 3CC7N 4KH5A 4F4KA 3PV8A 3OYHA 3CJ9A 2O8BA 1HNIA 3KLGA 4DCHA 3PIOL 3SCXA 3R1XA 4RTFD 4EP5A 2P5GA 1HQEA 3DRPA 4HUEA 2YKMA 4FJIA 3SQ0A 1XHZA 4BRHA 2A3ZA 3AARA 1XQSC 1RBVA 3J81O 3LWLA 4JI5K 4C23A 4BR7A 1NGDA 4JI0K 4WFAL 1DTQA 3KIOA 2D0PA 5EU7A 4FOIA 3MCPA 3ALYA 1RDWX 3O80A 2ITMA 4DQ8A 3O1WA 1D5AA 4H5VA 4B08A 5BRFA 4BDZA 3VQQA 2OPPA 3TABA 5MLCQ 4IZ9A 4MLHA 3PX0A 1K6YA 1CZ9A 3DOKA 4FZYA 4FLYA 3QDKA 4DFJA 4OPJA 4W5OA 1XNRK 2P9KA 4LF9K 3EN9A 3OYAA 5JVHL 2NRXA 3L2UA 4PL7A 1Q8IA 2HBJA 4NXMK 3VOVA 4M42A
chains in the Genus database with same CATH topology
5M1PA 4B1UB 3H6EA 1N8RO 5AQRA 1NBWA 2FSNA 2HF3A 3FZFA 3LDQA 3MX2A 5HL7L 3L6QA 1ATNA 1ZBSA 2KHOA 3ZEUA 4YDUC 2EWSA 5AQSA 1VQON 2YHXA 3AGKA 4G9ZA 1ATSA 5TKWA 5JMVA 4H5NA 2GX9A 4WQ4A 3P4IA 5AQTA 5GADP 5ADXH 3VESA 4FSVA 4O8KA 4M7XA 2ASPA 3H3NO 3G6EN 1QHAA 3C7NA 1JCGA 3GL1A 5AQVA 4BR5A 5M1QA 2VGNA 2QEXN 3EE9A 2GTDA 3O5BA 2FSJA 2QTDA 1NGAA 3B8AX 3H1QA 3VPZA 4MDBA 1EO1A 2Q36A 3F9MA 3SJHA 4HTLA 4IEIA 3VTIA 4YOUA 5F2RA 4B1ZA 1BO5O 5KPZA 4NB4A 3JS6A 3M3ZA 5FPMA 2RHKA 2HOEA 1YIJN 5LY3A 3A8YA 4EHUA 4JD2B 5M1OA 5C15A 4NLBA 4UY8O 3MN7A 5AQIA 3R8EA 4U67L 3GDQA 3R6MA 1NGJA 1BDGA 1VQPN 1RDUA 3WEEA 2IVNA 4KH6A 4WF9L 3RSEB 4JKFA 4GV9A 3CC2N 3CJCA 3U4LA 2P9IB 3O9SA 3VF4A 1KXPA 2NRRA 3HSCA 5BREA 1YF5L 3TPQA 4BQLA 1YI2N 4CZFA 3VEXA 3QBWA 3O1BA 1QVFM 1YJNN 4BRIA 3WXJA 3VF2A 1YAGA 4QS9A 5AQJA 2P9NB 3E9OA 4K41A 1K73O 1S3XA 5ADXA 3H46O 4YOYA 3ZETA 3D2EB 3M1FA 4B1VA 1T44A 4M7YA 2OTJN 4WYBA 2BH1A 2QWPA 2Q1NA 1S22A 3GG4A 2QWMA 4FWPA 2GUPA 4JKDA 2F7TA 3WXLA 3SLCA 5JLFA 1KD1O 4GV3A 3CQYA 5KPTA 5JLHA 1LCUA 3F2KA 4GVEA 2VGMA 2NRWA 3QFUA 3MK6A 4M63C 4A5AA 4CZIA 4BR9A 2YHYA 4MO5A 4EHTA 1Z05A 2P9SB 2W40A 5AQWA 1TYQB 3G71N 1HUXA 4B1XB 3SAFA 2GWJA 3HOTA 4FVUA 3VGKA 3SAHA 4JKAA 3W0LA 3WT0A 1GLDG 5BR9A 5GINA 5F1XA 2A42A 3ULEB 3DXKA 4H5WA 1RFQA 4H0XB 5C0YA 3MDQA 1CZAN 3VGMA 3UB5A 3E9PA 3UKUB 2PBDA 1P90A 4WQ4C 2ZJQL 2YX6A 2ZF5O 4CJ7A 4JHDA 3O9UA 5ELZA 3CERA 1ATRA 2D4WA 3D2FB 4A61A 4A57A 1NGCA 5AFUA 2P9UA 3H45C 3Q7BA 4A62A 4BC4A 3TSPA 4IEEA 4H5RA 1IG8A 3MN5A 2AA4A 4JKGB 3EZWA 1WOQA 5FPDA 3MX5A 3ATUA 3SK3A 1C0FA 1QQOA 3A5NC 3CC4N 1HJOA 3FZKA 4WCEL 4GNIA 1BA1A 3CJ7A 2Q31A 2WC9A 2PFUA 2WUSA 2YJFA 4CZGA 3HTVA 3I56N 5E26A 2E2NA 3TTDA 3L4QA 3LL3A 4ISEA 4J8FA 3FLCO 1YXQA 4BRCA 2FLOA 1Y64A 4JK8A 4BC5A 4XH5A 2P9LA 5AQZA 3SMPA 4JAXA 1GLFO 1M1KO 1VQ7N 2FF6A 1HPMA 3K9KA 2ASMA 1GLJO 1GLEG 2ZJRL 3FZLA 4PKIA 2CH6A 4IWVA 4BQZA 3HM8A 3M5RA 4I6MA 2J4RA 4IDHA 3CJ1A 1K8AO 3BUZB 4EAHD 3RVCA 1EQYA 2F9TA 2E88A 2I7PA 4WQ5A 3T7ZA 4JK7A 4YOWA 3BF3A 3CQXA 5E84A 3I55N 1HKCA 3VTHA 4U7BA 5KQDA 1Q18A 3CMEN 3A5MC 4FPAA 4CD3A 5DM6L 1MWMA 1NGGA 3MCAB 1JCEA 3FGUA 2BUPA 3R9PA 3U8XA 4C1NK 1VQNN 5GIPA 3EKSA 5CHIA 3CCMN 3CPEA 5AQOA 1U2VB 3CF5L 4MDAA 3O4WA 4FWMA 3ZX0A 3IMXA 3MWTA 3VENA 3RSEA 2P9KB 3FZHA 5KQ8A 2P9PB 5EY4A 4BC2A 1SZ2A 3LDLA 4RWTA 3HZ6A 4L3QA 1T6CA 2IVOA 5BN8A 1GLAG 2WFBA 4EFHA 1RGIA 4IFEA 3N4PA 3ENBA 1X3MA 3FFKB 2W41A 1NM1A 4FPBA 4PKHA 3CMAN 3CCEN 4CI6A 5M1KA 5EOYA 2UYTA 2IVPA 3KWIA 3M6GA 4PKGA 3VETA 1YUWA 1X9JA 5BRHA 4O8UA 2IIRA 2VYPA 4JNEA 2E20A 3VEZA 4BRKA 4JEPA 4BY9C 3C6HA 3EO3A 1OKJA 1VQ4N 3ID8A 4OPAA 2HBMA 5AQYA 4BC3A 3O9RA 3CI5A 3AAQA 5FPNA 3BF1A 2E2PA 3SBTA 1E4GT 1U6ZA 4BRMA 5H1SQ 1G99A 2A41A 4R79A 2I7NA 1T3VA 2GELA 3C7NB 3QBXA 4MLEA 3ZX2A 2CH5A 2P9SA 3O08A 1VQMN 3BEXA 3FR0A 2Q0RA 4FO0A 3CETA 4CZEA 3R3LA 1LOTB 1V4TA 3O9TA 5JICA 3CJAA 3H1VX 4AF1A 1DKGD 4OO1J 5AQXA 1W2BM 4PHTX 4Y0WA 3IUCA 4BRGA 5BRDA 3BP8A 3UKRA 2QWQA 3FE1A 1K8KB 4O5FA 2H3GX 3UKUA 2QWNA 3LM2A 2OTLN 4XEIA 4KH4A 4WFBL 3C65A 3C6AA 4FWOA 3VERA 2AP1A 4BR0A 1GLCG 2V51B 3WEEB 5GIOA 3D2FA 3HBTA 4DB3A 4BG8A 1MDUB 5FPEA 1DEJA 2D0OA 2HF4A 4F9OA 3CIPA 3KZBA 1YJ9N 2A5XA 5AZJB 3G25A 4H0YB 4CZMA 2NRZA 1GLBG 2HBKA 1H1VA 1X3NA 3KK7A 4WQ5C 2FXUA 3HI0A 4GY2B 1QVGM 1KQSM 3N4QA 2NRVA 4BVPA 1OVYA 4B1WB 3PIPL 1HKBA 3T69A 1TUUA 1TUYA 3E9LA 1BA0A 2NRHA 3C0BA 2YCHA 2VWBA 5AQMA 3WQTA 5M1NA 3IFRA 1V4SA 3E66A 4Z94A 5BPNA 4BRNA 4CZJA 3WXKA 5AQPA 4EIAA 4XH4A 3TTCA 1Q7YO 1QZ6A 3MN9A 4IOXA 5C12A 1Q86O 4H0TB 1NJIO 1QZ5A 1VQ5N 4K43A 3DXMA 3VEOA 2NRTA 3P39A 4KBOA 5GAGP 5AZIB 1YJWN 4OPHA 2CGJA 4CD1A 4XH1A 5BPMA 4BRFA 3ID6A 4BR4A 3I8BA 1VAZA 5F0XA 3AY9A 3VGLA 4DKWA 5DM7L 3DLLL 3A5OC 5HOOA 2ZWHA 4YORA 1NGFA 1BU6O 2QXLA 4BGBA 3P38A 4IOAL 2V7ZA 3DXKB 4JKHA 2OANA 2Q97A 3CJBA 2YI1A 2BTFA 4RCHA 3TSUA 1W97L 5AQQA 3S41A 1VQLN 4BREA 3IDHA 1XUPO 3CCRN 4ISGA 4H0PA 2D1KA 4JHDB 2DPNA 2GEMA 3HOSA 2E8AA 1NGEA 1BOTO 3W3DA 1Z6RA 3MN6A 1C0GA 3U9DA 3NVKA 1U2VA 3LDNA 4A59A 4AM7A 4JKEA 3CCSN 3ENHA 3LDOA 4FL9A 4NO7A 4JKCA 2A40A 3SBGA 4IJAA 1NLVA 1WUAA 4IOCL 2GWKA 2NNWA 1ZC6A 1NGBA 3QB0A 4B9QA 3DJCA 3J7ZO 5C2DA 2Q0UA 2ZGZA 3H3OB 4BROA 4QS7A 2RE2A 4JD2A 4JN4A 3KHYA 1VQ8N 3I33A 3ZYYX 5AQHA 1NWKA 3WUHA 3A5LC 2PAVA 2QW9A 1Q81O 3MWPA 2CGKA 2P9IA 1Q82O 2NLXA 1HLUA 2VCPA 4WFNL 3TSQA 3CPWM 4BVOA 4YOXA 3A0IX 1P8ZA 2P9LB 3O8MA 3QFPA 4HWIA 1D4XA 2QI2A 5AQFA 4A5BA 5CR4A 5M1FA 2WBNA 3SMSA 3OW2M 3IKMA 5B8HA 4BRLA 2P9NA 4DHYA 1KAXA 2E1YA 3MMVA 4ILJA 3QMLA 3NMUA 1S72N 3D2EA 1NGHA 4I6MB 3ZEUB 5GAHP 4CBXA 3PLAA 1J6ZA 1BWFO 1KAYA 3WXIA 4ILHA 1VQ6N 4FWQA 2ZGYA 3AGRA 1BUPA 3CCLN 4FWNA 1K8KA 4CZHA 4FWSA 3EL2A 3DWLA 3JXUA 1KC8O 3HRGA 3CHWA 3VMFB 2JWKA 3J8AA 1TYQA 4IO8A 3P31A 4GV6A 3CCQN 4A2BA 5EXWA 3SAGA 1QQMA 4ILGB 1E4FT 2KKZA 4QS8A 3VEWA 5AQUA 1YHQN 3ULEA 2E1ZA 3D6RA 5AZJA 3VEVA 3VF6A 1M90O 4JK9A 3O6WA 1JJ2M 1NGIA 4FWKA 3OA9A 2QA4N 4ISFA 3CD6N 5KPRA 2HSTA 3CC7N 2HBLA 5AFUH 3CCUN 3G4SN 1IJJA 4KH5A 3ENOA 4YDUA 4CBWA 3CCVN 4BRQA 1XC3A 4K42A 5GAEP 5JVGL 3LM9A 3CJ9A 1NMDA 3TTFA 5CE3A 3ZX3A 5BRFA 1ILYA 4DCHA 2V7YA 1KAZA 1ESVA 2F9WA 3GOIA 3L4IA 4H5TA 5AQGA 5LJVA 3PIOL 5AQNA 3R1XA 3QICA 4JKGA 4RTFD 3UE5A 3CXCM 2E2OA 3D7EO 4YOVA 4A2AA 5AZIA 4FWLA 1T6DA 4NLCA 1DGKN 2KLAA 5AQKA 1K9MO 2YJEA 4BRHA 2A3ZA 3Q7CA 3AARA 3ZETB 1XQSC 2V52B 4BRDA 1VQ9N 4C23A 2QWOA 1NGDA 3LDPA 1BG3A 4BR7A 5BPLA 4JKBA 4WFAL 4YOTA 3NVMA 4B1YB 2D0PA 2QM1A 4AM6A 2JWLA 5AQLA 4FOIA 3UKRB 3MCPA 1RDWX 3O80A 2ITMA 5C2FA 1SAZA 3K9JA 4DQ8A 3F5TA 2Q2RA 5EX5A 4C1NI 4E1JA 1GLLO 3O1WA 1HKGA 1SQKA 4BRPA 1DT9A 4H5VA 5EVZA 1O13A 5BN9A 1JCFA 1R59O 3OBYA 1ZXOA 3ATVA 4FOEA 1HX1A 3O9QA 4H03B 4IJNA 4PL8A 3VEYA 3WQUA 5TKYA 4BRAA 4H0VB 2QWRA 4IXCA 3GBTA 5MLCQ 1MA9B 4IZ9A 2QWLA 4K25A 5I9EB 2HMPA 4MO4A 3GE1A 3KVGA 2FSKA 4MLHA 4BGAA 3AAPA 5AR0A 3EE8A 3TU5A 1SS6A 4CBUA 2P9UB 2YHWA 4FWRA 3QDKA 3DAWA 5C10A 1QQNA 3OHRA 3L0QA 2CGLA 2E2QA 2P9KA 4BG9A 1VQKN 4IO9L 2P9PA 3WXMB 3FZMA 4H0OA 1YITN 3EN9A 1YVNA 2A6AA 2NRXA 4LC9B 3U9ZA 2NZTA 3CCJN 5JVHL 4PL7A 2FF3B 3DXMB 4CZLA 2ZJPL 2HBJA 3VOVA 1MWKA 4CZKA 3KWGA 2ASOA 4BR2A 3OBWA 3E1YA 5LJWA 3EKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 N;  1N8R O;  3CCL N;  5HL7 L;  1VQO N;  3CC4 N;  1YJ9 N;  4WCE L;  1KC8 O;  5GAD P;  1KQS M;  3I56 N;  1QVG M;  3CCQ N;  3PIP L;  1OVY A;  1YHQ N;  3G6E N;  1M90 O;  2QEX N;  1M1K O;  1JJ2 M;  1VQ7 N;  2QA4 N;  3CD6 N;  1W2B M;  2ZJR L;  3CC7 N;  1Q7Y O;  3CCU N;  1Q86 O;  3G4S N;  1NJI O;  1VQ5 N;  3CCV N;  5GAE P;  5JVG L;  1YIJ N;  5GAG P;  1K8A O;  1YJW N;  4UY8 O;  4U67 L;  1ILY A;  3PIO L;  1VQP N;  3DLL L;  5DM7 L;  3I55 N;  4WF9 L;  3CXC M;  3CME N;  3CC2 N;  5DM6 L;  1K9M O;  4IOA L;  1VQN N;  3CF5 L;  3CCM N;  1VQ9 N;  1VQL N;  3CCR N;  1QVF M;  1YJN N;  4WFA L;  1K73 O;  3CCS N;  2OTJ N;  3CMA N;  3CCE N;  4IOC L;  3J7Z O;  1KD1 O;  1YI2 N;  5MLC Q;  1VQ4 N;  1VQ8 N;  3G71 N;  1Q81 O;  5H1S Q;  1Q82 O;  4WFN L;  3CPW M;  1VQM N;  2ZJQ L;  3OW2 M;  1VQK N;  4IO9 L;  1YIT N;  3CCJ N;  5JVH L;  1S72 N;  2ZJP L;  5GAH P;  2OTL N;  4WFB L; 
#chains in the Genus database with same CATH topology
 5M1P A;  4B1U B;  3HPG A;  5AQR A;  3SUQ A;  1N8R O;  2FSN A;  4CGI A;  3VQE A;  3T1Y K;  1ZBS A;  2A1S A;  3I0S A;  3L3U A;  3AVN A;  4LF4 K;  5GAD P;  2WON A;  3HST B;  5HRS A;  4O8K A;  4XIU A;  2ASP A;  4OLA A;  1CXU A;  3LP2 A;  5M1Q A;  3OYI A;  2QEX N;  3EE9 A;  2GTD A;  4J2A A;  3B8A X;  3VPZ A;  3H1Q A;  1LAV A;  4MDB A;  4HTL A;  1GOC A;  4IEI A;  2JGU A;  3K57 A;  3T1H K;  4DV2 K;  4NB4 A;  1EWQ A;  4CW7 B;  4B9V A;  5LY3 A;  5M1O A;  4NLB A;  3THX B;  3GDQ A;  3AA4 A;  3L2Q A;  1ZYQ A;  4DR4 K;  1TK5 A;  1RBR A;  4WF9 L;  2O8E A;  3PO4 A;  4GV9 A;  4DV6 K;  4O0J A;  3ZT3 A;  3CC2 N;  2HB5 A;  3HO1 A;  4CCH A;  3HSC A;  3VA0 A;  1RT4 A;  4V19 S;  1IO2 A;  4YFU A;  1TK8 A;  3O1B A;  1QVF M;  3BGR A;  4DTN A;  1RBU A;  2BGG A;  2XHB A;  4B9L A;  3D2E B;  4FYD A;  4IDK A;  4LF6 K;  2Q1N A;  1S22 A;  3GG4 A;  2QWM A;  1U49 A;  4FWP A;  4CED A;  2F7T A;  2XY8 A;  2QKB A;  1X9S A;  4GVE A;  2NRW A;  4M63 C;  4MO5 A;  2W40 A;  3SAF A;  3VGK A;  3W0L A;  1GLD G;  3ULE B;  1VSK A;  4H5W A;  3MDQ A;  3UB5 A;  2PBD A;  5J2P A;  2ZJQ L;  2YX6 A;  3OS2 A;  4CJ7 A;  4TSX A;  4JHD A;  3O9U A;  2QK9 A;  1ATR A;  3D2F B;  1LWC A;  1QE1 A;  2HHU A;  2O8B B;  3D45 A;  3LAM A;  4CJ4 A;  4Z4G A;  3VQB A;  3O3F A;  1O1W A;  5DK5 A;  3MX5 A;  2W6L A;  3AA2 A;  1QQO A;  4IBN A;  3B6O A;  1NJW A;  1OH6 A;  3FZK A;  3C95 A;  4B9S A;  5CZ2 A;  3CJ7 A;  2WC9 A;  4CIE A;  1SL0 A;  4CZG A;  3HTV A;  4N5S A;  1YVU A;  1VSD A;  5E26 A;  3TTD A;  4MFB A;  3OYB A;  3THW A;  4ISE A;  4J8F A;  3FLC O;  1YXQ A;  1Y64 A;  4JK8 A;  1VHX A;  2P9L A;  3ZT4 A;  5AQZ A;  3L8B A;  4JAX A;  1WBD A;  4FK0 A;  4DTO A;  3CFO A;  3K9K A;  3K5M A;  4F3O A;  3G0Z A;  4B9N A;  3HM8 A;  1KVB A;  3AVH A;  4I6M A;  4B3R K;  2J4R A;  4FLX A;  1C0T A;  4Z4I A;  1LWF A;  4CF1 A;  3JYT A;  2F9T A;  1HNX K;  2KW4 A;  3G10 A;  5KQD A;  1Q18 A;  3AO4 A;  4FPA A;  4CD3 A;  4LF7 K;  1JLF A;  3U8X A;  3VA3 A;  1UOC A;  3ZSO A;  3HVR A;  3ZT2 A;  3CF5 L;  3CPE A;  3K0S A;  3SNN A;  3IMX A;  4H8K A;  4Z4F A;  2P9K B;  4ICL A;  3AVL A;  2G8F A;  3THY A;  3KKR A;  3VQ7 A;  2IVO A;  4DV5 K;  4EFH A;  2Z1G A;  3N4P A;  3ENB A;  2HHS A;  4FPB A;  3CMA N;  3OYN A;  3H08 A;  4K8X A;  2ATQ A;  3AVM A;  1YUW A;  5BRH A;  2IIR A;  4JNE A;  4BRK A;  3SQ4 A;  4JEP A;  1WN7 A;  4OPA A;  2HBM A;  3O9R A;  2E2P A;  4CJK A;  3SBT A;  1SL1 A;  1GOB A;  4R79 A;  3KLE A;  1TAQ A;  3ZX2 A;  4MLE A;  3O08 A;  3LAK A;  3FR0 A;  3CET A;  1LOT B;  2Q3S A;  3AVB A;  4OPK A;  3CJA A;  5BRD A;  3ZCM A;  4ZHR A;  3BP8 A;  1RBS A;  3UKR A;  2QWQ A;  4O5F A;  2H3G X;  4K8Z A;  3O4Q A;  2QXF A;  4KH4 A;  4DMN A;  1U45 A;  3TAP A;  3C6A A;  4FWO A;  3VQ4 A;  4BR0 A;  5IWA K;  2G8I A;  5GIO A;  5FPE A;  4BG8 A;  1DEJ A;  1IBM K;  3CIP A;  3RMD A;  1YJ9 N;  1WB9 A;  2A5X A;  5AZJ B;  2NRZ A;  2HBK A;  2FXU A;  3HI0 A;  1QVG M;  4BVP A;  4B1W B;  3T69 A;  3QES A;  1NK7 A;  1TUU A;  5KRS A;  3I8D A;  2YCH A;  3WQT A;  5M1N A;  1HRH A;  3IFR A;  1V4S A;  2XY7 A;  1XHX A;  3VQ8 A;  4Z94 A;  5J2Q A;  5AQP A;  3NGZ A;  1SKR A;  1N33 K;  3K2P A;  1QZ6 A;  4H0T B;  1NJI O;  1VQ5 N;  4E7H A;  3DXM A;  3P39 A;  4KBO A;  3UIQ A;  4ELT A;  3DRS A;  4EP4 A;  4HTU A;  1RDC A;  4XH1 A;  1IG9 A;  1TL3 A;  3I8B A;  3OS1 A;  1WSI A;  3KD1 E;  4HUF A;  5J2M A;  3SV4 A;  1BU6 O;  2QXL A;  2PYL A;  2OAN A;  2Q97 A;  3SQ1 A;  3TSU A;  2ZM6 K;  1VQL N;  2F8S A;  3CCR N;  4B9U A;  4CF8 A;  4H0P A;  4ZTJ A;  4JHD B;  2DPN A;  2YKN A;  3T19 A;  3HOS A;  3WNF A;  3W3D A;  5J2N A;  1Z6R A;  3U9D A;  3LDN A;  3QEP A;  1W9H A;  4JKE A;  4GW6 A;  4KI4 A;  3LDO A;  4FL9 A;  1JLE A;  4KHS A;  3WNE A;  3J7Z O;  3DJC A;  4CJW A;  4DR5 K;  1L5U A;  2X6N A;  2ZGZ A;  3H3O B;  2X74 A;  4QS7 A;  5AJ3 K;  2RE2 A;  4M3W A;  4JD2 A;  3RMC A;  3M8S A;  1C0M A;  4OLB A;  3JSM A;  1JLG A;  3I33 A;  5AQH A;  1EXQ A;  3LP0 A;  3RTV A;  2NLX A;  1HLU A;  2VCP A;  4PA1 A;  3TSQ A;  3CPW M;  1P8Z A;  2P9L B;  2QI2 A;  3OYE A;  1ZBI A;  4DHY A;  4FM1 A;  4Z4C A;  4JI6 K;  3RR7 A;  3QML A;  1S72 N;  4I6M B;  4DV7 K;  4FJG A;  4H4O A;  1G15 A;  5GAH P;  1XMQ K;  5LMN K;  3PLA A;  1C1B A;  1WSH A;  1BWF O;  4IFV A;  4DQI A;  1ZBH A;  4ILH A;  1VQ6 N;  2ZGY A;  1BUP A;  1NK0 A;  2HHH K;  2JLE A;  1K8K A;  3ZSW A;  4DU1 A;  1SKS A;  2OPQ A;  3JAM O;  3JXU A;  3OYD A;  1KC8 O;  3KK1 A;  2JWK A;  4OGE A;  2HHW A;  1TYQ A;  2Y1J A;  1NNE A;  4CJQ A;  4GV6 A;  4A2B A;  1S1X A;  4ILG B;  1E4F T;  4QS8 A;  3PX6 A;  5AQU A;  1YHQ N;  2E1Z A;  3D6R A;  3PUF A;  4KI6 A;  4CHQ A;  4K0K K;  3THY B;  4JK9 A;  3HL8 A;  3OA9 A;  2QA4 N;  5KPR A;  3CCU N;  1IJJ A;  4CVN E;  2GV9 A;  3CCV N;  1XC3 A;  4K42 A;  5GAE P;  3RWU A;  5CE3 A;  4DTJ A;  1NK8 A;  1VSI A;  5IT9 O;  2F9W A;  4H5T A;  5AQG A;  5LJV A;  3TAG A;  3UE5 A;  2E2O A;  3D7E O;  3DLH A;  5AZI A;  4FWL A;  1T6D A;  3L2V A;  1DGK N;  5AQK A;  1K9M O;  2YJE A;  3P1G A;  3ZET B;  4BRD A;  2HNZ A;  2V52 B;  4FW2 A;  2O8D A;  3OS0 A;  2QWO A;  3MEG A;  2XO7 A;  3LPT A;  3LP1 A;  1X9W A;  1YTA A;  2QM1 A;  1GOA A;  2JWL A;  3KK2 A;  5LMU K;  3UKR B;  1SAZ A;  3F5T A;  2Q2R A;  5EX5 A;  2YNH A;  4E1J A;  1GLL O;  1DT9 A;  2D0A A;  1WLJ A;  3TAM A;  1CXQ A;  5KI6 A;  2FBY A;  4PL8 A;  4IJN A;  2GBZ A;  2EHG A;  1HX1 A;  3ATV A;  4FOE A;  4H03 B;  3WQU A;  3THV A;  2UXB K;  3NGY A;  4LFA K;  2QWR A;  1BQN A;  1UWB A;  4K25 A;  2QWL A;  2HMP A;  3KVG A;  3QEW A;  1U48 A;  3AAP A;  3EE8 A;  3TU5 A;  1SS6 A;  4O0I A;  2YHW A;  4FWR A;  3KK3 A;  1Z26 A;  4CEF A;  3B6P A;  1YIT N;  3CCJ N;  1YVN A;  2A6A A;  4CFA A;  5C25 A;  2FF3 B;  2E4L A;  3DXM B;  4M45 A;  3U3Y A;  2HVI A;  4O4G A;  2HMI A;  3OBW A;  3E1Y A;  5LJW A;  3EYZ A;  2E5L K;  3H6E A;  2Z1H A;  2HF3 A;  3FZF A;  3L6Q A;  4FM2 A;  5AQS A;  2YHX A;  1VSJ A;  1RNH A;  5TKW A;  4H5N A;  2GX9 A;  3S3M A;  3P4I A;  4AHC A;  3OYG A;  1S1W A;  4KHN A;  3H3N O;  1QHA A;  2FC0 A;  2WTU A;  4BR5 A;  1JCG A;  2VGN A;  1KFS A;  4DQR A;  2QTD A;  3SZ2 A;  1W2B M;  4YOU A;  3F73 A;  4HVJ A;  4DTP A;  1EET A;  3M3Z A;  1N5Y A;  3S9H A;  2HOE A;  5CY4 A;  3A8Y A;  4EHU A;  4JD2 B;  3R8E A;  1NGJ A;  1BDG A;  3EZ5 A;  3DMJ A;  1VQP N;  2YNG A;  3WEE A;  4CHY A;  3NDK A;  2IVN A;  1NOZ A;  3HK2 A;  4E1M A;  4KHW A;  3CM5 A;  1KCF A;  3O9S A;  1LW2 A;  3VF4 A;  3QIO A;  4QCL A;  4BQL A;  1YI2 N;  1HYV A;  4NXN K;  4BRI A;  5K14 A;  1YAG A;  4LSL A;  4K41 A;  4CEE A;  1XC9 A;  4JI8 K;  4FLT A;  3LDS A;  1WAF A;  2QWP A;  1TKX A;  2IGI A;  2GUP A;  2I5J A;  1TKD A;  1SL2 A;  4JKD A;  3SLC A;  1KD1 O;  2F4V K;  3V9S A;  3CQY A;  4GV3 A;  4DV1 K;  1LCU A;  1JLC A;  4JLH A;  4KFB A;  4DTR A;  2YHB A;  1ASU A;  1JLB A;  4FJ8 A;  3KKS A;  5AQW A;  1TYQ B;  1HUX A;  2GWJ A;  1YT3 A;  3ZSZ A;  3K59 A;  5SWM A;  2UUA K;  4H0X B;  5C0Y A;  1L3U A;  2OPS A;  3E9P A;  4CEB A;  2GUI A;  1P90 A;  3DI6 A;  3NE6 A;  1SUQ A;  1TL1 A;  5ELZ A;  4I9Q A;  4I9L A;  4A61 A;  5AFU A;  2P9U A;  4CJL A;  3H45 C;  1TVR A;  4A62 A;  4HHT A;  2BE2 A;  4AHS A;  3TSP A;  4IEE A;  2HHT A;  4AIL C;  2AA4 A;  3EZW A;  4AQY K;  1CLQ A;  5FPD A;  4Y1C A;  1BIU A;  3QIP A;  4WCE L;  4DQS A;  2YJF A;  3VQ5 A;  2O8D B;  3O4N A;  4DQQ A;  4BRC A;  1VQ7 N;  1GLE G;  1HJR A;  2E6M A;  3FZL A;  4CIF A;  3M5R A;  3V9U A;  3CJ1 A;  1K8A O;  4EAH D;  3DRR A;  3RVC A;  4RW6 A;  3M8Q A;  3OYC A;  4J2E A;  2KZZ A;  4WQ5 A;  4KHY A;  1EP4 A;  3I55 N;  3VTH A;  1KSP A;  4U7B A;  3DLB A;  2G8V A;  3A5M C;  1U47 A;  2DTU A;  4DLG A;  1MWM A;  4X62 K;  1JCE A;  1VSL A;  2P5O A;  4B9M A;  4C1N K;  2KZM A;  3NF6 A;  1VQN N;  5CHI A;  5AQO A;  3KLF A;  4MDA A;  4CHZ A;  3MEC A;  4FWM A;  1D8Y A;  1HYZ A;  4DSF A;  3RSE A;  4X65 K;  2NUB A;  3OYM A;  4DSI A;  4BC2 A;  3WNH A;  4JRQ A;  1SZ2 A;  4RWT A;  4CJU A;  2UUC K;  3VQP A;  2WFB A;  1RGI A;  4F2R A;  3ZSX A;  4DUY K;  1NM1 A;  3QIN A;  3SI6 A;  3VET A;  2E20 A;  4FW1 A;  3ITH A;  1OKJ A;  2O8C A;  1VQ4 N;  4ID1 A;  3ID8 A;  3CI5 A;  5FPN A;  1X1P A;  3BF1 A;  1U6Z A;  2I7N A;  3L2W A;  1T3V A;  4E7I A;  2P9S A;  3BEX A;  2Q0R A;  4FO0 A;  3NGI A;  5JIC A;  3H1V X;  5AQX A;  4PHT X;  4E1N A;  1N34 K;  3IUC A;  4BRG A;  3RMB A;  3FE1 A;  3QNO A;  4I7F A;  3UKU A;  2OTL N;  4XEI A;  3NCI A;  4WFB L;  1GLC G;  3WEE B;  3LZI A;  3WNG A;  2P1J A;  3QEI A;  1MDU B;  1SV5 A;  2D0O A;  2HF4 A;  4F9O A;  4KHU A;  3KZB A;  4YHH K;  3G25 A;  1C1C A;  1Y97 A;  4WQ5 C;  4CK3 A;  3N4Q A;  1QTM A;  3V1Q A;  1OVY A;  3SUO A;  3E9L A;  4CFD A;  2NRH A;  1S1V A;  2VWB A;  4BWJ A;  2XY5 A;  4BRN A;  1EKE A;  4DLE A;  4GKK K;  1MU2 A;  3K5N A;  4GMJ B;  5CZ1 A;  4CJR A;  2NRT A;  3K5O A;  4CGD A;  1WSJ A;  4RG8 A;  4OJR A;  4IG0 A;  1J5O A;  2FBX A;  3ID6 A;  4BRF A;  3TAF A;  3VGL A;  3J7Y P;  3QEX A;  3S3O A;  4DF4 A;  4JI7 K;  2IAJ A;  4YOR A;  4CHN A;  4FCY A;  3E01 A;  3OJS A;  4FJ7 A;  5HRO A;  1W7A A;  4F2S A;  1IH7 A;  4BRE A;  1XUP O;  3ASM A;  2E8A A;  3V1R A;  2PY5 A;  1C0G A;  3OYJ A;  1U2V A;  3HYF A;  4AM7 A;  4JYA K;  3CCS N;  3ISN C;  4NO7 A;  1T7P A;  2A40 A;  3SBG A;  4CFC A;  4IJA A;  1NLV A;  3MXI A;  1WUA A;  4CJF A;  4IOC L;  2NNW A;  1NGB A;  3QB0 A;  2VG5 A;  5C2D A;  4W5T A;  1ITG A;  4B3T K;  2UU9 K;  1RTI A;  4JN4 A;  4DR3 K;  1RTH A;  4KAZ A;  2VWK A;  4KHQ A;  2YHA A;  1RBT A;  4LH4 A;  4M3R A;  4CGG A;  3AVK A;  3TI0 A;  2VQF K;  3A5L C;  3OTO K;  2PAV A;  3MWP A;  3AVG A;  2P9I A;  1YTU A;  1RCH A;  4YOX A;  3A0I X;  2O8F A;  5M1F A;  1BL3 A;  4HWI A;  4A5B A;  4DSK A;  1KRP A;  3KJV A;  4KTW A;  4F8R A;  2O4I A;  3MMV A;  1RT3 A;  3MEE A;  5C24 A;  3MXM A;  3TR8 A;  4FJK A;  1J6Z A;  2HHV A;  2HVH A;  3CCL N;  1QSL A;  4O5B A;  4B3S K;  4DG1 A;  2VWJ A;  3F9K A;  4M3Y A;  4FWS A;  1NKC A;  1I3A A;  3VMF B;  4IO8 A;  4DR7 K;  5E41 A;  2Y1I A;  2HHQ A;  3CCQ N;  4J2B A;  5EXW A;  3SAG A;  4Q5V A;  4CES A;  3VEW A;  4CJV A;  1ASV A;  4C8L A;  4KV8 A;  3VF6 A;  1TKZ A;  3SPY A;  3PSF A;  4M3T A;  3O6W A;  4FWK A;  2HST A;  3PY8 A;  2KFN A;  3NFA A;  4FLW A;  3G4S N;  1NJZ A;  1JXB A;  2O8E B;  4BRQ A;  5JVG L;  1NMD A;  5HP1 A;  1ESV A;  3GOI A;  4N41 A;  1QS4 A;  4E7L A;  3QIC A;  4JKG A;  1T8E A;  4YOV A;  2O4G A;  4A2A A;  2RPI A;  3CG7 A;  3J7A P;  1T03 A;  3Q7C A;  4FM0 A;  4C8O A;  1TAU A;  1E3M A;  3LDP A;  1BG3 A;  4QAG A;  4JKB A;  4JV5 K;  4B1Y B;  3ULD A;  3QO9 A;  4CF9 A;  1S6Q A;  4AHV A;  5C2F A;  3K9J A;  4C1N I;  1IV0 A;  1HKG A;  1SQK A;  4BRP A;  1WAJ A;  1EX4 A;  3HT3 A;  1O13 A;  4CER A;  3EY1 A;  1R59 O;  4FLU A;  3VEY A;  3OBY A;  1Q9X A;  3O9Q A;  4BRA A;  4Z4H A;  5TKY A;  4H0V B;  1HMV A;  3GBT A;  3RR8 A;  3TWH A;  2KFZ A;  4IFY A;  5I9E B;  1S9E A;  3GE1 A;  2FSK A;  4BGA A;  1HNZ K;  5FDL A;  5C10 A;  1QQN A;  3OHR A;  3L0Q A;  1FXX A;  2E2Q A;  2P9P A;  3FZM A;  2G8K A;  4LF5 K;  4LC9 B;  2P51 A;  4DTM A;  5KRT A;  4CZK A;  3KWG A;  2ASO A;  4BR2 A;  3J80 O;  1RDD A;  1REV A;  4BRO A;  3EKU A;  1EO1 A;  3MXJ A;  4DV0 K;  4C8M A;  1NBW A;  4N47 A;  4BAC A;  3ZEU A;  1ATN A;  4G9Z A;  3THW B;  2EWS A;  3AGK A;  3DYA A;  1WSF A;  1ATS A;  1VK0 A;  4X66 K;  5AQT A;  3AVF A;  5ADX H;  3VES A;  3AVJ A;  3G6E N;  1OH7 A;  3C7N A;  2FSJ A;  1NGA A;  2Q36 A;  3F9M A;  3SJH A;  3VTI A;  3CFP A;  5F2R A;  3ZSY A;  3C94 A;  1KTQ A;  2RHK A;  1YIJ N;  1L3S A;  1KLN A;  2LSN A;  3MN7 A;  4ZTF A;  1JL2 A;  4FJX A;  1DTT A;  4FJM A;  4LF8 K;  3OY9 A;  1RDU A;  3ZSR A;  4NCB A;  3LP3 A;  4KH6 A;  4RW9 A;  4PY5 A;  2OA8 A;  2P9I B;  1L3V A;  1KXP A;  3U3G A;  5BRE A;  1JL1 A;  3TPQ A;  1JLA A;  3DLG A;  3VF2 A;  5AQJ A;  3D0P A;  1EWR A;  3H46 O;  1D9F A;  3M1F A;  4KRF A;  4MQ3 A;  3VQC A;  2UUB K;  4M7Y A;  4DV4 K;  4WYB A;  4DSJ A;  5HBM A;  5JLF A;  4Z0U A;  5D3G A;  5JLH A;  1NOY A;  1BCO A;  3F2K A;  4CZI A;  3MK6 A;  4A5A A;  1Q9Y A;  4EHT A;  1Z05 A;  1UA0 A;  4LFC K;  4FVU A;  3BZC A;  2UXD K;  1BI4 A;  3HPO A;  3AA5 X;  3KTQ A;  4CJ3 A;  3LAN A;  4JS4 A;  1UAX A;  2ZF5 O;  5JS2 A;  4O44 A;  2D4W A;  1NGC A;  3RRG A;  3T1A A;  1NK4 A;  3TAR A;  4JRP A;  2G8U A;  3SV3 A;  1IG8 A;  3OYL A;  3MN5 A;  4JKG B;  1WOQ A;  1S9G A;  3ATU A;  1C0F A;  3A5N C;  2KTQ A;  3CC4 N;  1WSG A;  1BA1 A;  2Q31 A;  2WUS A;  2PFU A;  3CFR A;  4DU3 A;  3CYM A;  3LWM A;  2E2N A;  4M41 A;  4I2P A;  2VQE K;  4DR1 K;  4CE9 A;  2IDO A;  2FLO A;  4XH5 A;  3CQ8 A;  2Z1I A;  3LZJ A;  1QSY A;  1N32 K;  3EEQ A;  5HRN A;  1IBL K;  1GLJ O;  4CEA A;  2ZJR L;  2CH6 A;  4IWV A;  4BQZ A;  3U6F A;  1B9D A;  1EQY A;  3QLH A;  3T7Z A;  4JK7 A;  1C1A A;  3DLK A;  5E84 A;  2KQ2 A;  3AV9 A;  3CME N;  4UQG A;  1BHL A;  5DM6 L;  1NGG A;  3MCA B;  3FGU A;  2BUP A;  3R9P A;  1B9F A;  4CJP A;  4CEQ A;  1IKV A;  3OJU A;  3CCM N;  1HYS A;  3AVC A;  3O4W A;  3ZX0 A;  3DLE A;  3VEN A;  4CGJ A;  3FZH A;  5KQ8 A;  2P9P B;  3AA3 A;  4W5R A;  4JS5 A;  3LDL A;  1BQM A;  1ZBU A;  3HXM A;  1T6C A;  4ELU A;  2OZM A;  1FKP A;  1NU0 A;  3ZLJ A;  3FFK B;  2W41 A;  1IBK K;  3CCE N;  5M1K A;  5EOY A;  2OZS A;  2IVP A;  1C0U A;  4O8U A;  2VYP A;  3VEZ A;  4BY9 C;  4O55 A;  4CGH A;  4CGF A;  5AQY A;  4BC3 A;  3AAQ A;  4DTS A;  4IG3 A;  1E4G T;  2OPR A;  1G99 A;  3NAE A;  4FZZ A;  3C7N B;  1QSS A;  2YNF A;  4RW7 A;  3SUP A;  1VQM N;  4CHO A;  4JI1 K;  1ASW A;  4CZE A;  1V4T A;  3O9T A;  1Z25 A;  3KD5 E;  3DM2 A;  4AF1 A;  4DR6 K;  1DKG D;  4KO0 A;  5A2Q O;  2FBT A;  3VQ6 A;  1K8K B;  3VN5 A;  3LM2 A;  4OKE A;  1RDA A;  2G8W A;  5C42 A;  3VER A;  2AP1 A;  1OH8 A;  3D2F A;  2BDP A;  3AO3 A;  1A5W A;  3HBT A;  4DSL A;  2B6A A;  4DV3 K;  2WOM A;  5I42 A;  5BR8 K;  4KB0 A;  4H0Y B;  1NK6 A;  4CZM A;  4LSN A;  1GLB G;  3A2F A;  4YY3 K;  1X3N A;  4GY2 B;  3PIP L;  1RT2 A;  4CEZ A;  5FRM A;  1F21 A;  3C0B A;  5AQM A;  3O3H A;  4OX9 K;  3E66 A;  1KLM A;  3CM6 A;  5BPN A;  3WXK A;  1HR0 K;  2F96 A;  4N76 A;  2UXC K;  1QZ5 A;  4DWI A;  1RT5 A;  5HRP A;  5GAG P;  5AZI B;  1YJW N;  2ITG A;  4OPH A;  2CGJ A;  5BPM A;  3BY5 A;  4Y1D A;  4BWM A;  5CYM A;  4DKW A;  3A5O C;  5HOO A;  2ZWH A;  1BI4 B;  1NGF A;  2X6S A;  3SYZ A;  4H4M A;  3CJB A;  4RCH A;  3O3G A;  1W97 L;  4C8K A;  3NH0 A;  4KPY A;  4HCB A;  3IDH A;  3C6U A;  4ISG A;  2D1K A;  4FVM A;  1B92 A;  1BOT O;  4NCG A;  1A5V A;  4A59 A;  3NF9 A;  3TAE A;  2IOC A;  4JKC A;  2D0B A;  5DMR A;  4CF0 A;  1KVA A;  1ZBF A;  4KHP K;  4B9Q A;  3ZSQ A;  4DFP A;  4I2Q A;  5LL6 Z;  1XNQ K;  1TV6 A;  3OYK A;  4LFB K;  3KHY A;  2IS3 A;  1NWK A;  1T05 A;  1HNV A;  4DFM A;  2CGK A;  4CIG A;  4FLV A;  1Q82 O;  1KVC A;  2D5R A;  3QFP A;  5AQF A;  1LWE A;  3SMS A;  5B8H A;  2P9N A;  2E1Y A;  2OYQ A;  4ILJ A;  1XMO K;  3NMU A;  1NGH A;  3ZT1 A;  3AVA A;  3DLR A;  4CBX A;  1D9D A;  4X64 K;  4Q0B A;  1KAY A;  2RKI A;  3WXI A;  4N56 A;  4CFB A;  3NHG A;  1OVQ A;  4CJS A;  3RMA A;  1VRU A;  4RW8 A;  4CZH A;  2R7Y A;  4FJH A;  1FW6 A;  3DWL A;  1I39 A;  1RTD A;  4JI3 K;  3P31 A;  1QQM A;  4JI4 K;  5AZJ A;  3VEV A;  1M90 O;  5KTQ A;  3I0R A;  2HHX A;  2DFH A;  3CD6 N;  1NK5 A;  3KLH A;  2HBL A;  5AFU H;  4AHR A;  3S3N A;  3MED A;  4KRE A;  1VSH A;  3ENO A;  4YDU A;  4CBW A;  4M3X A;  4JI2 K;  3LM9 A;  3TTF A;  3ZX3 A;  1ILY A;  2V7Y A;  4DFK A;  1KAZ A;  3L4I A;  3QER A;  5AQN A;  3PX4 A;  3CXC M;  4L8R B;  1UA1 A;  2ETJ A;  4NLC A;  5KGW A;  2KLA A;  2PYJ A;  1WBB A;  2X78 A;  4FXD A;  4QOZ B;  1VQ9 N;  5BPL A;  4YOT A;  3NVM A;  1RDB A;  4AM6 A;  5AQL A;  1LV5 A;  3HP6 A;  1NK9 A;  3L2R A;  5EVZ A;  5BN9 A;  3V9W A;  1WNS A;  1JCF A;  2BAN A;  1ZXO A;  4NYF A;  4FJL A;  4OVL A;  4IXC A;  4E7J A;  4PQU A;  1MA9 B;  4IKF A;  4GKJ K;  4MO4 A;  4M3Z A;  2XY6 A;  5AR0 A;  4NCA A;  5HLF A;  4J2D A;  4CBU A;  2P9U B;  3DAW A;  4EZ6 A;  2CGL A;  4E19 A;  3QEV A;  4BG9 A;  1VQK N;  4IO9 L;  5FRN A;  3WXM B;  3T3F A;  4H0O A;  3U9Z A;  1HNW K;  3OYF A;  2NZT A;  1WSE A;  4DF8 A;  1LW0 A;  4CZL A;  2ZJP L;  1JKH A;  1MWK A;  3KLI A;  2VG7 A;  5I3U A;  4CF2 A;  1S6P A;  4M3U A;  1NMN A;  4DSE A;  4E89 A;  1S1T A;  3MX2 A;  3LDQ A;  5HL7 L;  3IG1 A;  4Z4E A;  2KHO A;  4YDU C;  1VQO N;  4CK1 A;  4CJE A;  4W5N A;  5JMV A;  4WQ4 A;  5HRR A;  4FJ9 A;  1IKW A;  1L3T A;  3SUN A;  1TKT A;  4FSV A;  1VSM A;  4M7X A;  4CK2 A;  5AQV A;  3GL1 A;  3SPZ A;  3AO5 A;  3C6T A;  3O5B A;  2ZE2 A;  4B8C A;  3BZK A;  4B1Z A;  4BDY A;  5KPZ A;  1IKX A;  1BO5 O;  3JS6 A;  5FPM A;  1XI1 A;  1FKO A;  5C15 A;  4UY8 O;  5AQI A;  4U67 L;  3LPU A;  3R6M A;  2QKK A;  5CYQ A;  3RSE B;  4JKF A;  1J53 A;  3CJC A;  3U4L A;  1W0H A;  3M8P A;  2NRR A;  3L3V A;  1YF5 L;  1S5J A;  1A5X A;  4CHP A;  4CZF A;  3VEX A;  3QBW A;  4PUO A;  1YJN N;  3WXJ A;  3P5J A;  4QS9 A;  4G1Q A;  2P9N B;  3E9O A;  4RW4 A;  1S3X A;  5ADX A;  1K73 O;  3IS9 A;  4YOY A;  4AH9 A;  3ZET A;  4KTQ A;  4B1V A;  4E0D A;  1T44 A;  2OTJ N;  2BH1 A;  5SZT A;  4FLZ A;  2DY4 A;  2O8C B;  1J9A A;  1BIZ A;  3WXL A;  4B8A B;  5KPT A;  1BGX T;  2VGM A;  3QFU A;  4BR9 A;  2YHY A;  3QET A;  2P9S B;  3LAL A;  3G71 N;  4B1X B;  3VQ9 A;  3HOT A;  4E3S A;  3SAH A;  3HP9 A;  4JKA A;  3WT0 A;  5BR9 A;  5GIN A;  5F1X A;  2A42 A;  4B3O A;  3DXK A;  4HUG A;  1RFQ A;  1CZA N;  3VGM A;  3UKU B;  4WQ4 C;  1NJY A;  3CER A;  4A57 A;  3Q7B A;  4BC4 A;  4H5R A;  1N6Q A;  4KTZ A;  4EZ9 A;  5KGX A;  2D0C A;  2EX3 A;  3V9Z A;  3SK3 A;  5FLX O;  3ZT0 A;  1FK9 A;  1HJO A;  3VQA A;  4E7K A;  4GNI A;  2RF2 A;  3M8R A;  2XRI A;  2YV0 X;  3NH1 A;  3I56 N;  4FJJ A;  3L4Q A;  3LL3 A;  4DTX A;  1KFD A;  2RN2 A;  3ZSV A;  4BE1 A;  4BC5 A;  3SMP A;  1SKW A;  4CEC A;  1GLF O;  1M1K O;  2FF6 A;  1HPM A;  2ASM A;  4PKI A;  1QHT A;  4ELV A;  3QNN A;  1JLQ A;  4IDH A;  1CZB A;  3BUZ B;  4CJT A;  2E88 A;  2I7P A;  4YOW A;  3BF3 A;  3CQX A;  1HKC A;  3HVT A;  4DU4 A;  4DTU A;  4R5P A;  1JXE A;  3NF7 A;  4B3M K;  5GIP A;  1VSF A;  3V4I A;  3EKS A;  3IAY A;  1U2V B;  3V81 A;  1J54 A;  3MWT A;  3SQ2 A;  5EY4 A;  3PSI A;  1R0A A;  1BIS A;  3HZ6 A;  4L3Q A;  5BN8 A;  1GLA G;  1S1U A;  4IFE A;  2DFE A;  1OH5 A;  1X3M A;  4PKH A;  4CEO A;  4CI6 A;  3VQD A;  2UYT A;  2F8T A;  3KWI A;  4BE0 A;  1TGO A;  1VRT A;  3M6G A;  4PKG A;  1X9J A;  4DQP A;  4FJ5 A;  3C6H A;  3EO3 A;  2O8F B;  1ZBL A;  1NKB A;  2YNI A;  3OVN A;  3TAQ A;  4AHU A;  4BRM A;  5H1S Q;  2A41 A;  1NKE A;  4WE1 A;  1VSE A;  2GEL A;  3QBX A;  2W6K A;  4OKK A;  1QQC A;  2CH5 A;  1BCM A;  3R3L A;  4OKJ A;  3RRH A;  2E6L A;  4OO1 J;  3AO2 A;  4Y0W A;  2HND A;  3NBP A;  2QWN A;  3V9X A;  3C65 A;  2V51 B;  2B4J A;  4DB3 A;  4FJN A;  4F3T A;  4AHT A;  1RTJ A;  3DOL A;  2AJQ A;  2A1R A;  1KQS M;  1H1V A;  1RT7 A;  3KK7 A;  2NRV A;  1HKB A;  4PWD A;  1TUY A;  4BE2 A;  1BA0 A;  3HPH A;  4CZJ A;  2B5J A;  4EIA A;  4XH4 A;  3TTC A;  4BDP A;  4FK2 A;  2HW3 A;  1Q7Y O;  3NH2 A;  3MN9 A;  4IOX A;  5C12 A;  1Q86 O;  4K43 A;  3VEO A;  3BDP A;  3K5L A;  3HM9 A;  1DLO A;  4CD1 A;  1J5E K;  4KKO A;  4DUZ K;  4BR4 A;  3DLL L;  1VAZ A;  2VG6 A;  3AY9 A;  5F0X A;  5DM7 L;  3TAN A;  1IKY A;  1RT6 A;  4BGB A;  3P38 A;  2PZS A;  2V7Z A;  4IOA L;  3DXK B;  4JKH A;  2YI1 A;  2BTF A;  4FK4 A;  5AQQ A;  3S41 A;  3AVI A;  2G8H A;  4OGC A;  4DS5 A;  1HQU A;  2GEM A;  1FJG K;  2W42 A;  1HPZ A;  1NGE A;  4KB1 A;  1RT1 A;  2ZQB A;  3MAQ A;  3MN6 A;  4LY7 A;  3NVK A;  4LH5 A;  3V1O A;  3ENH A;  3FFI A;  4YNQ A;  2HNY A;  2GWK A;  1ZC6 A;  4GVM A;  1I94 K;  2Q0U A;  5JS1 A;  1TK0 A;  4ID5 A;  5T7B A;  1U4B A;  4DR2 K;  3THX A;  1NJX A;  4W5Q A;  1LAW A;  2DFF A;  2IC3 A;  1VQ8 N;  3NF8 A;  3ZYY X;  3WUH A;  1X9M A;  2QW9 A;  1Q81 O;  1XWL A;  4WFN L;  2ZD1 A;  4BVO A;  4B9T A;  3O8M A;  1D4X A;  3PO5 A;  5CR4 A;  2WBN A;  3OW2 M;  3IKM A;  4DS4 A;  4BRL A;  1KAX A;  3D2E A;  3ZEU B;  5J1E A;  2FBV A;  4C8N A;  3V6D A;  3P83 D;  4FWQ A;  3AGR A;  4FWN A;  1U04 A;  2Z1J A;  3SJJ A;  3AO1 A;  1NG9 A;  3EL2 A;  3IRX A;  4CJ5 A;  3HJF A;  3HRG A;  3CHW A;  3J8A A;  5FRO A;  1RIL A;  2OCE A;  4LD0 A;  4FZX C;  1N36 K;  4NYN A;  2KKZ A;  3ULE A;  3K58 A;  1JJ2 M;  1NGI A;  4ISF A;  1C6V A;  4HCC A;  3CC7 N;  4KH5 A;  4F4K A;  3PV8 A;  3OYH A;  3CJ9 A;  2O8B A;  1HNI A;  3KLG A;  4DCH A;  3PIO L;  3SCX A;  3R1X A;  4RTF D;  4EP5 A;  2P5G A;  1HQE A;  3DRP A;  4HUE A;  2YKM A;  4FJI A;  3SQ0 A;  1XHZ A;  4BRH A;  2A3Z A;  3AAR A;  1XQS C;  1RBV A;  3J81 O;  3LWL A;  4JI5 K;  4C23 A;  4BR7 A;  1NGD A;  4JI0 K;  4WFA L;  1DTQ A;  3KIO A;  2D0P A;  5EU7 A;  4FOI A;  3MCP A;  3ALY A;  1RDW X;  3O80 A;  2ITM A;  4DQ8 A;  3O1W A;  1D5A A;  4H5V A;  4B08 A;  5BRF A;  4BDZ A;  3VQQ A;  2OPP A;  3TAB A;  5MLC Q;  4IZ9 A;  4MLH A;  3PX0 A;  1K6Y A;  1CZ9 A;  3DOK A;  4FZY A;  4FLY A;  3QDK A;  4DFJ A;  4OPJ A;  4W5O A;  1XNR K;  2P9K A;  4LF9 K;  3EN9 A;  3OYA A;  5JVH L;  2NRX A;  3L2U A;  4PL7 A;  1Q8I A;  2HBJ A;  4NXM K;  3VOV A;  4M42 A; 
#chains in the Genus database with same CATH homology
 5M1P A;  4B1U B;  3H6E A;  1N8R O;  5AQR A;  1NBW A;  2FSN A;  2HF3 A;  3FZF A;  3LDQ A;  3MX2 A;  5HL7 L;  3L6Q A;  1ATN A;  1ZBS A;  2KHO A;  3ZEU A;  4YDU C;  2EWS A;  5AQS A;  1VQO N;  2YHX A;  3AGK A;  4G9Z A;  1ATS A;  5TKW A;  5JMV A;  4H5N A;  2GX9 A;  4WQ4 A;  3P4I A;  5AQT A;  5GAD P;  5ADX H;  3VES A;  4FSV A;  4O8K A;  4M7X A;  2ASP A;  3H3N O;  3G6E N;  1QHA A;  3C7N A;  1JCG A;  3GL1 A;  5AQV A;  4BR5 A;  5M1Q A;  2VGN A;  2QEX N;  3EE9 A;  2GTD A;  3O5B A;  2FSJ A;  2QTD A;  1NGA A;  3B8A X;  3H1Q A;  3VPZ A;  4MDB A;  1EO1 A;  2Q36 A;  3F9M A;  3SJH A;  4HTL A;  4IEI A;  3VTI A;  4YOU A;  5F2R A;  4B1Z A;  1BO5 O;  5KPZ A;  4NB4 A;  3JS6 A;  3M3Z A;  5FPM A;  2RHK A;  2HOE A;  1YIJ N;  5LY3 A;  3A8Y A;  4EHU A;  4JD2 B;  5M1O A;  5C15 A;  4NLB A;  4UY8 O;  3MN7 A;  5AQI A;  3R8E A;  4U67 L;  3GDQ A;  3R6M A;  1NGJ A;  1BDG A;  1VQP N;  1RDU A;  3WEE A;  2IVN A;  4KH6 A;  4WF9 L;  3RSE B;  4JKF A;  4GV9 A;  3CC2 N;  3CJC A;  3U4L A;  2P9I B;  3O9S A;  3VF4 A;  1KXP A;  2NRR A;  3HSC A;  5BRE A;  1YF5 L;  3TPQ A;  4BQL A;  1YI2 N;  4CZF A;  3VEX A;  3QBW A;  3O1B A;  1QVF M;  1YJN N;  4BRI A;  3WXJ A;  3VF2 A;  1YAG A;  4QS9 A;  5AQJ A;  2P9N B;  3E9O A;  4K41 A;  1K73 O;  1S3X A;  5ADX A;  3H46 O;  4YOY A;  3ZET A;  3D2E B;  3M1F A;  4B1V A;  1T44 A;  4M7Y A;  2OTJ N;  4WYB A;  2BH1 A;  2QWP A;  2Q1N A;  1S22 A;  3GG4 A;  2QWM A;  4FWP A;  2GUP A;  4JKD A;  2F7T A;  3WXL A;  3SLC A;  5JLF A;  1KD1 O;  4GV3 A;  3CQY A;  5KPT A;  5JLH A;  1LCU A;  3F2K A;  4GVE A;  2VGM A;  2NRW A;  3QFU A;  3MK6 A;  4M63 C;  4A5A A;  4CZI A;  4BR9 A;  2YHY A;  4MO5 A;  4EHT A;  1Z05 A;  2P9S B;  2W40 A;  5AQW A;  1TYQ B;  3G71 N;  1HUX A;  4B1X B;  3SAF A;  2GWJ A;  3HOT A;  4FVU A;  3VGK A;  3SAH A;  4JKA A;  3W0L A;  3WT0 A;  1GLD G;  5BR9 A;  5GIN A;  5F1X A;  2A42 A;  3ULE B;  3DXK A;  4H5W A;  1RFQ A;  4H0X B;  5C0Y A;  3MDQ A;  1CZA N;  3VGM A;  3UB5 A;  3E9P A;  3UKU B;  2PBD A;  1P90 A;  4WQ4 C;  2ZJQ L;  2YX6 A;  2ZF5 O;  4CJ7 A;  4JHD A;  3O9U A;  5ELZ A;  3CER A;  1ATR A;  2D4W A;  3D2F B;  4A61 A;  4A57 A;  1NGC A;  5AFU A;  2P9U A;  3H45 C;  3Q7B A;  4A62 A;  4BC4 A;  3TSP A;  4IEE A;  4H5R A;  1IG8 A;  3MN5 A;  2AA4 A;  4JKG B;  3EZW A;  1WOQ A;  5FPD A;  3MX5 A;  3ATU A;  3SK3 A;  1C0F A;  1QQO A;  3A5N C;  3CC4 N;  1HJO A;  3FZK A;  4WCE L;  4GNI A;  1BA1 A;  3CJ7 A;  2Q31 A;  2WC9 A;  2PFU A;  2WUS A;  2YJF A;  4CZG A;  3HTV A;  3I56 N;  5E26 A;  2E2N A;  3TTD A;  3L4Q A;  3LL3 A;  4ISE A;  4J8F A;  3FLC O;  1YXQ A;  4BRC A;  2FLO A;  1Y64 A;  4JK8 A;  4BC5 A;  4XH5 A;  2P9L A;  5AQZ A;  3SMP A;  4JAX A;  1GLF O;  1M1K O;  1VQ7 N;  2FF6 A;  1HPM A;  3K9K A;  2ASM A;  1GLJ O;  1GLE G;  2ZJR L;  3FZL A;  4PKI A;  2CH6 A;  4IWV A;  4BQZ A;  3HM8 A;  3M5R A;  4I6M A;  2J4R A;  4IDH A;  3CJ1 A;  1K8A O;  3BUZ B;  4EAH D;  3RVC A;  1EQY A;  2F9T A;  2E88 A;  2I7P A;  4WQ5 A;  3T7Z A;  4JK7 A;  4YOW A;  3BF3 A;  3CQX A;  5E84 A;  3I55 N;  1HKC A;  3VTH A;  4U7B A;  5KQD A;  1Q18 A;  3CME N;  3A5M C;  4FPA A;  4CD3 A;  5DM6 L;  1MWM A;  1NGG A;  3MCA B;  1JCE A;  3FGU A;  2BUP A;  3R9P A;  3U8X A;  4C1N K;  1VQN N;  5GIP A;  3EKS A;  5CHI A;  3CCM N;  3CPE A;  5AQO A;  1U2V B;  3CF5 L;  4MDA A;  3O4W A;  4FWM A;  3ZX0 A;  3IMX A;  3MWT A;  3VEN A;  3RSE A;  2P9K B;  3FZH A;  5KQ8 A;  2P9P B;  5EY4 A;  4BC2 A;  1SZ2 A;  3LDL A;  4RWT A;  3HZ6 A;  4L3Q A;  1T6C A;  2IVO A;  5BN8 A;  1GLA G;  2WFB A;  4EFH A;  1RGI A;  4IFE A;  3N4P A;  3ENB A;  1X3M A;  3FFK B;  2W41 A;  1NM1 A;  4FPB A;  4PKH A;  3CMA N;  3CCE N;  4CI6 A;  5M1K A;  5EOY A;  2UYT A;  2IVP A;  3KWI A;  3M6G A;  4PKG A;  3VET A;  1YUW A;  1X9J A;  5BRH A;  4O8U A;  2IIR A;  2VYP A;  4JNE A;  2E20 A;  3VEZ A;  4BRK A;  4JEP A;  4BY9 C;  3C6H A;  3EO3 A;  1OKJ A;  1VQ4 N;  3ID8 A;  4OPA A;  2HBM A;  5AQY A;  4BC3 A;  3O9R A;  3CI5 A;  3AAQ A;  5FPN A;  3BF1 A;  2E2P A;  3SBT A;  1E4G T;  1U6Z A;  4BRM A;  5H1S Q;  1G99 A;  2A41 A;  4R79 A;  2I7N A;  1T3V A;  2GEL A;  3C7N B;  3QBX A;  4MLE A;  3ZX2 A;  2CH5 A;  2P9S A;  3O08 A;  1VQM N;  3BEX A;  3FR0 A;  2Q0R A;  4FO0 A;  3CET A;  4CZE A;  3R3L A;  1LOT B;  1V4T A;  3O9T A;  5JIC A;  3CJA A;  3H1V X;  4AF1 A;  1DKG D;  4OO1 J;  5AQX A;  1W2B M;  4PHT X;  4Y0W A;  3IUC A;  4BRG A;  5BRD A;  3BP8 A;  3UKR A;  2QWQ A;  3FE1 A;  1K8K B;  4O5F A;  2H3G X;  3UKU A;  2QWN A;  3LM2 A;  2OTL N;  4XEI A;  4KH4 A;  4WFB L;  3C65 A;  3C6A A;  4FWO A;  3VER A;  2AP1 A;  4BR0 A;  1GLC G;  2V51 B;  3WEE B;  5GIO A;  3D2F A;  3HBT A;  4DB3 A;  4BG8 A;  1MDU B;  5FPE A;  1DEJ A;  2D0O A;  2HF4 A;  4F9O A;  3CIP A;  3KZB A;  1YJ9 N;  2A5X A;  5AZJ B;  3G25 A;  4H0Y B;  4CZM A;  2NRZ A;  1GLB G;  2HBK A;  1H1V A;  1X3N A;  3KK7 A;  4WQ5 C;  2FXU A;  3HI0 A;  4GY2 B;  1QVG M;  1KQS M;  3N4Q A;  2NRV A;  4BVP A;  1OVY A;  4B1W B;  3PIP L;  1HKB A;  3T69 A;  1TUU A;  1TUY A;  3E9L A;  1BA0 A;  2NRH A;  3C0B A;  2YCH A;  2VWB A;  5AQM A;  3WQT A;  5M1N A;  3IFR A;  1V4S A;  3E66 A;  4Z94 A;  5BPN A;  4BRN A;  4CZJ A;  3WXK A;  5AQP A;  4EIA A;  4XH4 A;  3TTC A;  1Q7Y O;  1QZ6 A;  3MN9 A;  4IOX A;  5C12 A;  1Q86 O;  4H0T B;  1NJI O;  1QZ5 A;  1VQ5 N;  4K43 A;  3DXM A;  3VEO A;  2NRT A;  3P39 A;  4KBO A;  5GAG P;  5AZI B;  1YJW N;  4OPH A;  2CGJ A;  4CD1 A;  4XH1 A;  5BPM A;  4BRF A;  3ID6 A;  4BR4 A;  3I8B A;  1VAZ A;  5F0X A;  3AY9 A;  3VGL A;  4DKW A;  5DM7 L;  3DLL L;  3A5O C;  5HOO A;  2ZWH A;  4YOR A;  1NGF A;  1BU6 O;  2QXL A;  4BGB A;  3P38 A;  4IOA L;  2V7Z A;  3DXK B;  4JKH A;  2OAN A;  2Q97 A;  3CJB A;  2YI1 A;  2BTF A;  4RCH A;  3TSU A;  1W97 L;  5AQQ A;  3S41 A;  1VQL N;  4BRE A;  3IDH A;  1XUP O;  3CCR N;  4ISG A;  4H0P A;  2D1K A;  4JHD B;  2DPN A;  2GEM A;  3HOS A;  2E8A A;  1NGE A;  1BOT O;  3W3D A;  1Z6R A;  3MN6 A;  1C0G A;  3U9D A;  3NVK A;  1U2V A;  3LDN A;  4A59 A;  4AM7 A;  4JKE A;  3CCS N;  3ENH A;  3LDO A;  4FL9 A;  4NO7 A;  4JKC A;  2A40 A;  3SBG A;  4IJA A;  1NLV A;  1WUA A;  4IOC L;  2GWK A;  2NNW A;  1ZC6 A;  1NGB A;  3QB0 A;  4B9Q A;  3DJC A;  3J7Z O;  5C2D A;  2Q0U A;  2ZGZ A;  3H3O B;  4BRO A;  4QS7 A;  2RE2 A;  4JD2 A;  4JN4 A;  3KHY A;  1VQ8 N;  3I33 A;  3ZYY X;  5AQH A;  1NWK A;  3WUH A;  3A5L C;  2PAV A;  2QW9 A;  1Q81 O;  3MWP A;  2CGK A;  2P9I A;  1Q82 O;  2NLX A;  1HLU A;  2VCP A;  4WFN L;  3TSQ A;  3CPW M;  4BVO A;  4YOX A;  3A0I X;  1P8Z A;  2P9L B;  3O8M A;  3QFP A;  4HWI A;  1D4X A;  2QI2 A;  5AQF A;  4A5B A;  5CR4 A;  5M1F A;  2WBN A;  3SMS A;  3OW2 M;  3IKM A;  5B8H A;  4BRL A;  2P9N A;  4DHY A;  1KAX A;  2E1Y A;  3MMV A;  4ILJ A;  3QML A;  3NMU A;  1S72 N;  3D2E A;  1NGH A;  4I6M B;  3ZEU B;  5GAH P;  4CBX A;  3PLA A;  1J6Z A;  1BWF O;  1KAY A;  3WXI A;  4ILH A;  1VQ6 N;  4FWQ A;  2ZGY A;  3AGR A;  1BUP A;  3CCL N;  4FWN A;  1K8K A;  4CZH A;  4FWS A;  3EL2 A;  3DWL A;  3JXU A;  1KC8 O;  3HRG A;  3CHW A;  3VMF B;  2JWK A;  3J8A A;  1TYQ A;  4IO8 A;  3P31 A;  4GV6 A;  3CCQ N;  4A2B A;  5EXW A;  3SAG A;  1QQM A;  4ILG B;  1E4F T;  2KKZ A;  4QS8 A;  3VEW A;  5AQU A;  1YHQ N;  3ULE A;  2E1Z A;  3D6R A;  5AZJ A;  3VEV A;  3VF6 A;  1M90 O;  4JK9 A;  3O6W A;  1JJ2 M;  1NGI A;  4FWK A;  3OA9 A;  2QA4 N;  4ISF A;  3CD6 N;  5KPR A;  2HST A;  3CC7 N;  2HBL A;  5AFU H;  3CCU N;  3G4S N;  1IJJ A;  4KH5 A;  3ENO A;  4YDU A;  4CBW A;  3CCV N;  4BRQ A;  1XC3 A;  4K42 A;  5GAE P;  5JVG L;  3LM9 A;  3CJ9 A;  1NMD A;  3TTF A;  5CE3 A;  3ZX3 A;  5BRF A;  1ILY A;  4DCH A;  2V7Y A;  1KAZ A;  1ESV A;  2F9W A;  3GOI A;  3L4I A;  4H5T A;  5AQG A;  5LJV A;  3PIO L;  5AQN A;  3R1X A;  3QIC A;  4JKG A;  4RTF D;  3UE5 A;  3CXC M;  2E2O A;  3D7E O;  4YOV A;  4A2A A;  5AZI A;  4FWL A;  1T6D A;  4NLC A;  1DGK N;  2KLA A;  5AQK A;  1K9M O;  2YJE A;  4BRH A;  2A3Z A;  3Q7C A;  3AAR A;  3ZET B;  1XQS C;  2V52 B;  4BRD A;  1VQ9 N;  4C23 A;  2QWO A;  1NGD A;  3LDP A;  1BG3 A;  4BR7 A;  5BPL A;  4JKB A;  4WFA L;  4YOT A;  3NVM A;  4B1Y B;  2D0P A;  2QM1 A;  4AM6 A;  2JWL A;  5AQL A;  4FOI A;  3UKR B;  3MCP A;  1RDW X;  3O80 A;  2ITM A;  5C2F A;  1SAZ A;  3K9J A;  4DQ8 A;  3F5T A;  2Q2R A;  5EX5 A;  4C1N I;  4E1J A;  1GLL O;  3O1W A;  1HKG A;  1SQK A;  4BRP A;  1DT9 A;  4H5V A;  5EVZ A;  1O13 A;  5BN9 A;  1JCF A;  1R59 O;  3OBY A;  1ZXO A;  3ATV A;  4FOE A;  1HX1 A;  3O9Q A;  4H03 B;  4IJN A;  4PL8 A;  3VEY A;  3WQU A;  5TKY A;  4BRA A;  4H0V B;  2QWR A;  4IXC A;  3GBT A;  5MLC Q;  1MA9 B;  4IZ9 A;  2QWL A;  4K25 A;  5I9E B;  2HMP A;  4MO4 A;  3GE1 A;  3KVG A;  2FSK A;  4MLH A;  4BGA A;  3AAP A;  5AR0 A;  3EE8 A;  3TU5 A;  1SS6 A;  4CBU A;  2P9U B;  2YHW A;  4FWR A;  3QDK A;  3DAW A;  5C10 A;  1QQN A;  3OHR A;  3L0Q A;  2CGL A;  2E2Q A;  2P9K A;  4BG9 A;  1VQK N;  4IO9 L;  2P9P A;  3WXM B;  3FZM A;  4H0O A;  1YIT N;  3EN9 A;  1YVN A;  2A6A A;  2NRX A;  4LC9 B;  3U9Z A;  2NZT A;  3CCJ N;  5JVH L;  4PL7 A;  2FF3 B;  3DXM B;  4CZL A;  2ZJP L;  2HBJ A;  3VOV A;  1MWK A;  4CZK A;  3KWG A;  2ASO A;  4BR2 A;  3OBW A;  3E1Y A;  5LJW A;  3EKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...