4WCEL

The crystal structure of the large ribosomal subunit of staphylococcus aureus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
110
structure length
110
Chain Sequence
MISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKGVTLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYLYHGRVKALAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S rRNA
publication title Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4wceL01
5GAHP 1VQKN 5JVGL 1M90O 4UY8O 1VQON 3CCSN 3G71N 3CCLN 4IOAL 4WFNL 1YHQN 3I55N 5DM7L 1VQ7N 3CC7N 1QVFM 1VQPN 1YITN 1M1KO 5MLCQ 3CCRN 3CCJN 2ZJRL 3G4SN 1YJ9N 1K73O 2QA4N 4U67L 3OW2M 3G6EN 3CC2N 3CXCM 1ILYA 3J7ZO 5JVHL 1Q82O 1VQ8N 1QVGM 3PIOL 2OTLN 1YI2N 2OTJN 3CCQN 1W2BM 1S72N 1VQLN 3I56N 3CC4N 3CMEN 1VQNN 3CF5L 4WF9L 1YIJN 1K8AO 3CCVN 1YJNN 2ZJQL 1K9MO 1YJWN 3DLLL 5DM6L 1KC8O 1Q86O 3PIPL 5HL7L 1KD1O 5GAEP 3CCEN 4WCEL 3CCUN 4IOCL 5H1SQ 1OVYA 5GAGP 1NJIO 3CD6N 1JJ2M 4IO9L 1Q7YO 4WFAL 1VQ6N 1VQ5N 2ZJPL 1KQSM 1Q81O 2QEXN 1VQMN 1VQ9N 1VQ4N 5GADP 3CPWM 3CMAN 3CCMN 1N8RO 4WFBL
chains in the Genus database with same CATH superfamily
4E7HA 3I8DA 4JK7A 4FWPA 4CEZA 2V52B 2Q2RA 5B8HA 5BRFA 4GV6A 3QERA 5FPMA 1HRHA 1NGHA 2BE2A 4WQ5A 2YHYA 3KK3A 1T6CA 4DS5A 1KSPA 1KVCA 4DS4A 4H4MA 5MLCQ 4E19A 1B9DA 3OYEA 2YNHA 4Z94A 3TTDA 4DFJA 1NK8A 4CJUA 2P51A 4G1QA 4DUYK 2O4GA 3OYDA 4GNIA 4FO0A 1TUYA 1J54A 4KH4A 3ZX0A 2G8WA 4WE1A 1TL3A 4AHCA 3CXCM 3AVCA 4G9ZA 2O8EA 2DY4A 1NGIA 3ZT4A 3BEXA 4BRCA 4BQZA 1WAJA 4B1ZA 3SZ2A 3AGRA 4UQGA 3L3UA 3HVRA 3CMEN 4CGHA 1FKPA 4I2QA 3A8YA 4JKGB 5EXWA 1XMOK 4FJ5A 1RT4A 3QETA 3CCVN 4C23A 4M3XA 1VRTA 3EEQA 3NF8A 3VEOA 3K59A 3VA3A 2IDOA 2WFBA 5FROA 2G8HA 2PYLA 2P9UB 4CF2A 4XIUA 3SI6A 1HQEA 2YKNA 2OZSA 4E7KA 4DB3A 3ZSZA 5GAEP 3LPTA 5H1SQ 4X66K 2KLAA 3TI0A 3TWHA 2P1JA 1S3XA 3QBWA 3VEVA 3DLKA 4FJ7A 3WXIA 4DKWA 4WFAL 3C7NB 3R1XA 4A61A 1GLEG 3K9JA 2UXDK 4CF9A 3AA5X 3KIOA 4MO5A 2O8BB 4K41A 2QWNA 1L3TA 4DU1A 2YHAA 1ATNA 3SUQA 4FWQA 3VQBA 4DU3A 1KFSA 4X65K 1N6QA 4J2AA 4CF8A 4OKJA 3CCMN 2OPPA 4K8ZA 4DTOA 3AVJA 5E41A 4WFBL 4I6MA 1VQKN 3AVBA 1VAZA 2PY5A 2F8TA 4JNEA 3O3GA 1Q9YA 1T3VA 3QESA 3THYA 4EP4A 4M3TA 5ADXH 1TYQA 4NCBA 1BGXT 4ILGB 3L3VA 4QS7A 3TSUA 1S1XA 4JI6K 1NBWA 3RTVA 1DTQA 4BRMA 1KTQA 4BY9C 3J81O 1W0HA 2A6AA 4Z4EA 4B1YB 1RT2A 1NJXA 1XI1A 3MX5A 2HOEA 5EOYA 4R5PA 2O8EB 3HI0A 2DPNA 2P9PB 4KBOA 3FZLA 3GDQA 4Y0WA 3DXMA 5AFUA 4YOYA 1IKWA 1DTTA 1ILYA 1XC3A 2AJQA 2VWKA 1T05A 2QWOA 3VQ8A 2F7TA 3O1WA 2QXFA 3VQAA 1TKZA 4H5WA 1ATRA 1IKVA 4M3UA 1YIJN 1WBBA 4GY2B 2BANA 1I3AA 2JWLA 1VSMA 4WQ4C 4FJMA 4BGBA 2HB5A 3G0ZA 4R79A 3WEEB 3LDSA 3WXMB 1GLAG 3EO3A 2ZM6K 1TGOA 4B9SA 3VEXA 2HHVA 5FLXO 3PSFA 3DLGA 5M1OA 3L2VA 1FKOA 3JAMO 4IOCL 3LDOA 2QWQA 3RR8A 1RBUA 1EO1A 4ID1A 4CJ5A 4CIGA 1NKBA 3V9WA 2UUCK 3CI5A 2FBYA 4CJEA 4XH1A 1ZBSA 4FLYA 2FBVA 4CHQA 1SKSA 2D0BA 2ZD1A 4EFHA 2NRTA 1VSKA 3E9LA 1WSFA 3H1QA 3JS6A 4I6MB 3VQDA 2G8FA 4N47A 1W97L 4CZEA 4FJ8A 3THYB 1E3MA 5TKYA 4M3RA 3NHGA 5GAHP 2PZSA 4B9LA 1TYQB 3VQ4A 3BZKA 4FLXA 4XEIA 5JMVA 1SV5A 1BG3A 4JYAK 3LDNA 2HVHA 3CPEA 4Q0BA 1BQNA 3T3FA 4QCLA 3HJFA 5LY3A 1BWFO 1CZAN 2E1YA 1KAYA 2QTDA 3TR8A 1VQPN 4H8KA 4FOEA 4A2BA 2HHQA 1QQOA 3R9PA 4EZ6A 4B3OA 2KKZA 2RHKA 3HL8A 4DWIA 4BWMA 3DXMB 1N32K 5AQRA 1LOTB 1VHXA 3O1BA 1JLCA 1UA1A 1NNEA 3MK6A 2D0OA 1TVRA 5GIOA 3U3YA 4BR7A 2OPQA 3SAGA 3PLAA 4FJ9A 2A42A 4E1MA 1NGCA 3K5MA 1JCGA 2IVNA 4N5SA 1SL2A 5E26A 1XWLA 3U3GA 2E2OA 4FZZA 2ATQA 2KQ2A 3P38A 5BPMA 1L3SA 1HR0K 3D7EO 1N34K 3LP2A 2P9NA 3O4NA 5HLFA 5AQHA 3AA3A 1HUXA 4JRPA 4YOVA 4NB4A 2HHSA 4FJXA 2NZTA 1EKEA 3RSEA 1YJWN 3DLLL 3EL2A 4C8MA 3BUZB 2P9IA 1N36K 1QHTA 4Q5VA 3DM2A 1X3NA 3DXKB 2NRHA 5CZ1A 3QLHA 4IJAA 3MWPA 3RRHA 3HM8A 5GAGP 3QEXA 3SCXA 4FL9A 4RW4A 2X74A 1BUPA 1ATSA 1Q7YO 1HQUA 4AILC 2ZJPL 3IMXA 1S9GA 2BH1A 1J5OA 1VQMN 1QQCA 4E7IA 5M1FA 3M1FA 1X9WA 3BY5A 3E01A 4LH5A 3OTOK 1DLOA 4IFEA 3ENHA 3AO1A 3V1RA 3CQXA 2KTQA 4DQIA 1RT6A 3RMAA 4BRQA 3NF9A 3ZSOA 3BZCA 4GMJB 3ALYA 3VGMA 3C65A 2BTFA 2GUPA 5AQTA 4PHTX 3C6UA 3EKSA 3CCJN 4FWKA 1S6QA 2A40A 4YY3K 3ENOA 1WSEA 4M41A 2QKKA 3CETA 4CJLA 3WQUA 2KW4A 3G10A 5HOOA 1D9FA 4B9NA 3QO9A 3ASMA 4DV3K 1JL1A 3VF2A 3OYHA 2PAVA 4BR5A 3KLGA 2AP1A 2KZMA 3L8BA 4BVOA 3SK3A 2ZE2A 3CERA 2O8DA 1EWQA 4BRLA 4K0KK 2P9NB 2VG6A 1OH6A 2YHXA 3VOVA 3T7ZA 3FZFA 3RSEB 1YTUA 5AQLA 5HP1A 2XY6A 4XH4A 2P9IB 3F2KA 1JXBA 3TTFA 4HWIA 1JL2A 2ZF5O 1JLGA 3V6DA 5HL7L 3H45C 2YNGA 3T19A 1NJZA 1VSLA 2RPIA 1SL1A 3SV4A 2E6LA 4WQ4A 1FW6A 2OYQA 4L8RB 4CIEA 4CJRA 1JJ2M 1RTIA 3DWLA 1QE1A 2GELA 2QWRA 2GUIA 4B1XB 3AVGA 3DRPA 4Y1DA 4IFYA 4OPHA 4H03B 5J2QA 1KFDA 4IO8A 4BQLA 3U9DA 4CFDA 5JLHA 4IXCA 3C6AA 3R8EA 1QSSA 3PO4A 4Y1CA 4DR2K 3L4IA 4DTXA 4OPJA 1J6ZA 3CMAN 5AQZA 1XQSC 2ZGYA 3FR0A 4KAZA 4FW2A 3SLCA 3CJCA 4I7FA 5AQOA 4O8KA 1SS6A 4C8KA 4UY8O 3WNEA 4CZJA 3VENA 3ZSVA 4CEEA 1NJWA 2YHBA 2W6LA 3E1YA 4JKCA 4LF9K 4JKFA 4F3OA 5KQ8A 1R0AA 3OYCA 1IH7A 4O0IA 3TAEA 2O8FA 3CCRN 1VSFA 4CZLA 2HBMA 3O9SA 3MX2A 5GINA 3V9SA 1UWBA 5C10A 3PX6A 3RWUA 1KCFA 2WTUA 3CM6A 3ZSXA 4E7LA 2DFFA 1X9JA 2YCHA 3K9KA 4FWNA 3J7ZO 1A5WA 1LWCA 5KQDA 3CQ8A 4LF8K 5JVHL 3AVNA 2O8DB 1IO2A 4WYBA 4B8CA 1RT7A 3NGIA 1W2BM 5AQSA 4LFCK 3KLFA 2LSNA 4RW8A 3CC4N 2O8CA 1LAWA 3SQ2A 3KK7A 5J2PA 1JLQA 1KXPA 3NVMA 4CGDA 3GG4A 3SJHA 4JEPA 4YFUA 1YJNN 4PKIA 4K8XA 2VYPA 3I0SA 1RBSA 1VSHA 1DKGD 3M5RA 1NMDA 4CK2A 1C0GA 3KTQA 3HP6A 2W40A 4FVMA 4AM6A 1NJIO 1U6ZA 4H5TA 1R59O 4CD3A 2Q36A 3H6EA 4ILJA 1HYVA 4CZKA 1VQ6N 3VERA 4NYFA 5C15A 4MDBA 4BRFA 4ZTFA 4BDZA 4DQQA 2OPRA 1KLNA 5EY4A 4LFAK 3TANA 4EZ9A 1P90A 3V1OA 4M3WA 3T1HK 3SPZA 3CPWM 3LWMA 4PKHA 1BIUA 1XHXA 5AZIA 1C1AA 5F2RA 3O4WA 4YOTA 3IS9A 2P5GA 4DQPA 1MWKA 1GOBA 1N5YA 4GV9A 2GEMA 3S3MA 3K5NA 2WOMA 5F0XA 3C7NA 3AVLA 3TSQA 3OYGA 3CIPA 3I55N 2O8FB 1NK6A 3UE5A 3CC7N 1QVFM 2NNWA 3IRXA 4EIAA 2Q31A 2P9SA 4E0DA 2HHXA 3AA4A 1Y97A 2HHTA 2ZJRL 5T7BA 4M3YA 1JLFA 3U8XA 4CHPA 3NF6A 3HK2A 1HPMA 1QQMA 4L3QA 4FJHA 2I7PA 2FF3B 3PSIA 4N76A 4KI6A 4F4KA 1EWRA 4IEIA 4YOWA 3PIOL 3NAEA 3P31A 5C42A 4DV0K 3VQ5A 2O8CB 3WXJA 1WNSA 3HYFA 4KTWA 1RTHA 4CD1A 1IG8A 5CYQA 3B6OA 2NRXA 2I5JA 3ID6A 1HMVA 4JI4K 4OGEA 1O1WA 2ASOA 5C2DA 1YAGA 1Y64A 3OYFA 4KTQA 3W0LA 2P9PA 2XY8A 1EXQA 5AFUH 3PUFA 1DEJA 3MMVA 5EX5A 3CCEN 3OYBA 1VSIA 4CGGA 1HJOA 1NGJA 2A41A 4FLVA 3AA2A 3VQEA 4H0XB 4FWRA 4PQUA 1C1CA 4CEBA 3BGRA 2RF2A 1C0MA 4M7YA 4FSVA 3F9KA 1L3UA 3SV3A 4DQRA 3A5NC 3BF1A 2FXUA 1BA0A 5AZIB 4O8UA 4RCHA 3HP9A 4W5QA 3WEEA 4B9TA 1NOYA 2A1RA 4GW6A 5KRTA 3DOKA 2EWSA 2FSNA 4C1NK 3GBTA 4KHSA 5EVZA 3D6RA 1YVNA 4W5TA 4JK9A 1JCFA 1RDWX 4F2SA 2P9SB 1NK0A 2ASPA 1W7AA 3H1VX 4IZ9A 5HRRA 5LMNK 2P9LB 2QWMA 2NLXA 2F96A 4C8NA 1YT3A 1HPZA 1NM1A 1K73O 3FFKB 1WBDA 5DMRA 3K2PA 4Z4HA 3V4IA 3KJVA 3TAFA 4FWLA 4M7XA 2YHWA 5BN8A 3KKSA 5J1EA 2IC3A 2A3ZA 4JI1K 2OTLN 1XNQK 4NCGA 3CCQN 4JK8A 5M1KA 1A5XA 1TL1A 3C94A 2E88A 1WSIA 3LZIA 2OANA 4DSFA 4AM7A 3KK1A 4BDYA 3MN7A 3MN6A 1X9MA 1K8AO 1RBRA 3PX4A 1B92A 2UXCK 2FBTA 3HPHA 3MWTA 4OLBA 3VEZA 3O6WA 2QKBA 4EHTA 3ZCMA 4OO1J 5AJ3K 4FLUA 1Z26A 1RT1A 4CJSA 3THXA 4BC3A 4O5BA 3W3DA 2HBLA 3THVA 2IOCA 3GL1A 5HRSA 1TKDA 3CD6N 3G25A 3K5OA 1ZYQA 5AZJA 3M8PA 3ZSWA 5F1XA 3KD5E 4W5NA 4CBXA 2HBKA 1Q81O 3WXLA 4AF1A 5JS2A 3RVCA 5GADP 4Z0UA 4JI5K 4KO0A 3HRGA 3OYAA 1T8EA 3NE6A 4LSLA 1N33K 1BI4A 3DXKA 3WNGA 5IT9O 3VN5A 1LWEA 1XNRK 4X62K 4OKKA 4MLEA 1HYSA 3AAQA 4KI4A 3VEWA 4BC4A 2G8IA 3LDLA 4H0VB 3SPYA 2ZQBA 3WNFA 2D0AA 4KB0A 3S3NA 4IKFA 2IAJA 3VQ9A 4B1WB 2E5LK 4CEQA 4FJNA 3NH1A 3HVTA 2OCEA 1XC9A 4OVLA 4PUOA 2VGMA 2F8SA 3AARA 2UUAK 2NRRA 1U2VA 3CQYA 4U67L 3IAYA 4N41A 4KHUA 4M3ZA 4B8AB 4OPAA 2FSJA 1C0UA 3IFRA 4A2AA 5C25A 2UXBK 1EETA 4ELUA 5FRNA 3ZSRA 3OY9A 2F4VK 3M8RA 4CW7B 5HRPA 3KLEA 3B6PA 1S72N 2HNDA 2UUBK 1HLUA 3EN9A 5BR8K 3A2FA 4WF9L 3VESA 1L3VA 3TAQA 3OS0A 1REVA 3EE9A 4A57A 3WNHA 1T44A 3SMSA 3THXB 3KK2A 1QQNA 3VQQA 4K42A 2ZWHA 3CG7A 3IDHA 4HUEA 3R6MA 1U49A 3ENBA 2GX9A 4CHZA 3DJCA 3KVGA 4CGIA 2E4LA 4O55A 5AZJB 1A5VA 5KTQA 1RBVA 2FC0A 2IVOA 3QIPA 1CXQA 3SAHA 2I7NA 4DU4A 3O9RA 1U04A 5D3GA 4E1JA 4AQYK 4DTUA 1LAVA 5FPDA 1HJRA 2Y1IA 1HNXK 3Q7CA 4CK3A 3BP8A 4OPKA 2G8KA 1VSEA 1BI4B 1NK7A 4FWOA 4DSIA 3CJBA 4B08A 5AQNA 2IS3A 3U9ZA 4LY7A 5AQQA 1TK0A 1ITGA 2E1ZA 1M90O 4J2DA 2FLOA 1IBLK 4BRIA 3VF6A 4FJJA 2IIRA 4WFNL 3BF3A 1I39A 4DV4K 1V4SA 1UAXA 3RRGA 4DTRA 5LJVA 4JI3K 3QEIA 5FPEA 4DTPA 1IV0A 5FRMA 3TPQA 1U2VB 4CERA 2HVIA 4FZXC 4B3SK 1KLMA 4CJ4A 2NRVA 3HT3A 4CZMA 2KHOA 3LDQA 4CJTA 3K0SA 4NLBA 2RN2A 2HHWA 1SAZA 3B8AX 3NGZA 4LF6K 4M45A 4ISFA 3SYZA 4KHWA 1NG9A 2YNIA 3V81A 3OYLA 5AQFA 3I0RA 4DQ8A 3SQ1A 1LV5A 5J2MA 2Z1HA 4DF8A 3LP3A 3LM9A 3SBGA 1VK0A 5C2FA 3A5OC 4AHVA 3HO1A 3AO3A 1D9DA 3KHYA 1DT9A 4RTFD 3ATVA 3CCUN 4CF0A 3V9XA 3O4QA 3VTHA 2ITMA 3ZX3A 3J80O 2GWJA 3IUCA 4CJQA 1BA1A 3S9HA 4KHNA 1YVUA 1YTAA 1VQ5N 3TAPA 4OLAA 4Z4FA 4H5NA 5AQUA 2VG5A 5M1PA 4BE2A 1VQ9N 1VQ4N 2NUBA 5C24A 4PWDA 1BHLA 1BQMA 3HTVA 1Q9XA 1D8YA 4O44A 3HBTA 3LAKA 2OPSA 2D5RA 3H46O 1XMQK 5KGWA 3J7AP 1OH7A 4ICLA 3DLBA 5KPRA 4CFBA 2FBXA 1BCMA 3C0BA 4DQSA 1GLDG 4BRDA 2W41A 3ITHA 1P8ZA 1UOCA 4QS9A 1J53A 4JI7K 3NFAA 2HF3A 3CFPA 4KFBA 3MEGA 2WONA 3OYNA 4I9LA 2B5JA 3MCAB 3ZX2A 3OYJA 1F21A 1O13A 3NCIA 4GKJK 1VQ7N 2YX6A 1HYZA 3RMBA 3CJ9A 2Q1NA 4FK0A 4IOXA 4NYNA 1M1KO 2JGUA 3OYKA 3QIOA 3FZHA 4BROA 2XY5A 3SMPA 3DI6A 4IDKA 4O5FA 3U4LA 2RKIA 3OHRA 3FFIA 4B3MK 2QWPA 2P9KA 4GVEA 4H0YB 1C0TA 1NJYA 4H0OA 2VQEK 1SQKA 3HSTB 3DLEA 4CHNA 2JLEA 4NLCA 1QHAA 3I33A 1WB9A 2QM1A 3QFPA 1QVGM 1S1WA 2PBDA 1VRUA 1LWFA 3M3ZA 1B9FA 3A5LC 1VQLN 5FPNA 3I56N 5JICA 4F2RA 4BC2A 1NU0A 2B4JA 4A59A 4B1UB 1G99A 4JN4A 3P1GA 4JV5K 1Q86O 2A1SA 3NGYA 4B1VA 4DLEA 3E9OA 3QDKA 4IJNA 5CYMA 3F73A 4JHDA 1KD1O 1NKEA 3KKRA 4AHUA 1FK9A 3O3HA 2GV9A 4V19S 3AAPA 4JKAA 3F9MA 5TKWA 5LJWA 1RDDA 3OJSA 1NWKA 3ULEA 4BR2A 4OGCA 1SL0A 3KD1E 3VQ7A 1ZBUA 3D2FA 4LSNA 4JLHA 4JKEA 2HMIA 3OS2A 3QB0A 1ZBLA 4FJLA 4HTUA 1BL3A 1KVBA 3HOTA 4CI6A 3E66A 1ASVA 4FK2A 1ZBFA 4BR4A 4IFVA 4JKDA 2DFHA 5AQVA 1W9HA 1NK9A 1HNZK 1C1BA 4CECA 1H1VA 3ZT2A 2GWKA 4F3TA 1VQON 3PO5A 2DTUA 3OA9A 3H08A 4C8OA 3O08A 4FCYA 1TAUA 4MO4A 3AVKA 1TK8A 3MEEA 3L2QA 4FWSA 1KVAA 2HBJA 2BDPA 3AO5A 4CEAA 3SUPA 1MDUB 4PL7A 2G8VA 2P9KB 5KI6A 3JSMA 5HROA 1RILA 1HNIA 3CFOA 1GLBG 3OW2M 3G6EN 5BRDA 1JLAA 3SJJA 1RDCA 3R3LA 3AVAA 3PY8A 4IDHA 3M8QA 1SUQA 2HF4A 3A0IX 4BR0A 2EHGA 4KTZA 2VCPA 4CK1A 3JYTA 4KV8A 4KH5A 3GE1A 4E89A 3OBWA 4FLWA 1RTJA 2QI2A 4BRPA 4CJVA 4ISGA 3D0PA 4PL8A 3MXJA 3C95A 1HKCA 2P9LA 4A5BA 3VTIA 4E1NA 4MLHA 4JHDB 1RFQA 3EYZA 1RT5A 2CGLA 2J4RA 5AQPA 3L2UA 4M63C 3T69A 5GIPA 4RW9A 2QWLA 4CF1A 1OVYA 3EZWA 2CGKA 5CY4A 4DFPA 4DHYA 4NXNK 1NLVA 3ULEB 4CEFA 3NH2A 1E4GT 3MEDA 2KZZA 5SWMA 3AO4A 3D2FB 4NO7A 3O9UA 4DSEA 4B9MA 1TK5A 1K6YA 1NMNA 3LP0A 4IG0A 4ILHA 4IEEA 4H5VA 3SQ4A 1ZBIA 4CEOA 4FWMA 4RG8A 1K8KA 2B6AA 3ULDA 3VGKA 4B3RK 4FPAA 1QZ5A 3AY9A 3AVIA 5I9EB 2YV0X 4DUZK 4DTSA 3LL3A 2X6SA 2V7ZA 5ELZA 1I94K 1XUPO 1LW0A 3MN5A 4CZGA 3FZMA 3LM2A 3CM5A 1TUUA 1YHQN 1YUWA 2WBNA 3DLRA 4O4GA 3AVHA 1S22A 4DV6K 1ZBHA 4F9OA 3Q7BA 3CFRA 2E2NA 2V51B 4RWTA 4BE1A 1T7PA 4BR9A 4K43A 3HSCA 1CXUA 2QA4N 3SNNA 3LZJA 1ASUA 1HKGA 1MU2A 2Q97A 4LC9B 3CC2N 4FJGA 2HW3A 4M42A 3NBPA 2X78A 2Q0UA 3MN9A 1QTMA 3EY1A 3SAFA 1Q82O 4FM1A 1RCHA 4K25A 4N56A 3MXMA 3HOSA 3E9PA 2QK9A 4DSKA 1YXQA 4TSXA 4CFCA 3O9TA 5BR9A 5KGXA 4MFBA 1NK5A 3AV9A 3QEPA 3RR7A 3L4QA 3CJAA 3F5TA 3QNOA 3D2EB 2ZJQL 2X6NA 3TAGA 3QBXA 4MDAA 1Z25A 3HZ6A 1WN7A 1IKYA 3V9ZA 3V9UA 1LW2A 4ISEA 3PIPL 3OYMA 3DRRA 3SUOA 3ZEUA 4Z4CA 1U45A 2G8UA 5BN9A 3KLIA 3WUHA 1UA0A 5LMUK 1G15A 4A62A 4NXMK 1KRPA 1U47A 3ZSYA 3LALA 1L5UA 4EHUA 1RGIA 4FLZA 3SQ0A 4J8FA 4CJFA 3I8BA 3UB5A 1K8KB 1XHZA 2VG7A 4CJWA 4H0PA 3QEWA 2YJFA 4LH4A 3S3OA 4RW6A 3TABA 1N8RO 4BRKA 3ISNC 4KREA 3OYIA 3QMLA 4DG1A 2E2QA 4BC5A 3THWA 1HNWK 3LWLA 5AQYA 1WOQA 3FE1A 4OKEA 3CCSN 3CJ1A 3G71N 2PFUA 3J8AA 4CHYA 3DLHA 3VMFB 1QSYA 5DM7L 4CHOA 4CZIA 2YJEA 4JS5A 3RMCA 3ID8A 4CEDA 2IVPA 1YITN 5AR0A 1QSLA 4DCHA 3LAMA 3N4PA 2D0PA 1E4FT 4LD0A 5EU7A 4JI0K 4X64K 1BCOA 1ZXOA 5KPZA 2RE2A 4YHHK 3G4SN 1YJ9N 4QAGA 2EX3A 3RMDA 3OBYA 3VQCA 3FLCO 3O5BA 4ID5A 4A5AA 1OH8A 3NDKA 4KH6A 2Z1IA 1VQ8N 3BDPA 2NRZA 3A5MC 4CZHA 4PA1A 1SZ2A 1CLQA 4C8LA 4DMNA 4W5OA 3SBTA 1HNVA 1WSHA 1KAXA 2GBZA 3MDQA 1TKTA 3CF5L 4DTMA 1EP4A 1Z6RA 5M1QA 2E20A 1FJGK 1MA9B 4LFBK 1FXXA 1GOAA 1K9MO 5DM6L 1JKHA 3ZEUB 4LF4K 4CIFA 4JI2K 2F9TA 4PY5A 1JLEA 5AQJA 1BDGA 4YOUA 1TKXA 4KB1A 1DGKN 2WC9A 5KRSA 5ADXA 1IG9A 3H3OB 4IO9L 2CH6A 4FJKA 1Q18A 4AHRA 2YI1A 3UKUA 4CGJA 4FLTA 3FZKA 1TAQA 4BRAA 4BWJA 2HHHK 3VETA 2IGIA 1SKWA 1RBTA 1NGDA 3ZSQA 4EP5A 3KWIA 3J7YP 4GKKK 4IBNA 4YNQA 3M6GA 3V1QA 3THWB 4CJPA 3P83D 1BIZA 4J2EA 3OS1A 1VSDA 2Q0RA 2BGGA 4FZYA 1S9EA 4DR1K 2E6MA 5KPTA 1JXEA 3PV8A 2ASMA 1GLFO 4AHSA 3CCLN 2HHUA 3IKMA 1BO5O 4B9QA 2VGNA 5AQXA 3PX0A 1X1PA 1OH5A 4W5RA 1NGAA 5K14A 3UIQA 3QICA 4BG9A 2KFNA 3DOLA 4BDPA 1SKRA 1KAZA 2HNZA 3EKUA 3NH0A 4JI8K 3QFUA 3MAQA 1NGFA 2Q3SA 2H3GX 3O3FA 5A2QO 2W42A 4DR6K 3MXIA 4BRHA 2ZGZA 3O8MA 1YI2N 2OTJN 2FSKA 2E8AA 2D4WA 2W6KA 1S6PA 2JWKA 5M1NA 2Z1JA 1GLJO 3P4IA 4IWVA 3TTCA 1QZ6A 1U4BA 1HX1A 4HVJA 2XRIA 2R7YA 1S1TA 3FGUA 5CE3A 4DFKA 4H4OA 3VPZA 1ESVA 5AQGA 3N4QA 1OKJA 4YDUC 4DR3K 4RW7A 3MCPA 5JS1A 1GLCG 3H3NO 2KFZA 5C0YA 4QS8A 4FYDA 2NRWA 4KHQA 5BRHA 3D45A 4AHTA 4BE0A 4CVNE 5I42A 3HPOA 4FVUA 1ASWA 4XH5A 3UKUB 1Q8IA 3DYAA 3L6QA 3L2RA 4JS4A 1OVQA 5LL6Z 3LDPA 5AQWA 3KLHA 1J5EK 2YKMA 2UYTA 1LCUA 1QS4A 4DFMA 3UKRA 3ZYYX 4F8RA 1JLBA 1IBKK 4I2PA 1NKCA 4J2BA 4E3SA 3OJUA 4B9UA 4BGAA 2HSTA 4CGFA 1IBMK 3VEYA 4EAHD 4BRGA 4E7JA 3TAMA 3O80A 4DV7K 4WQ5C 4KHYA 5JVGL 2XO7A 1EX4A 5CZ2A 1J9AA 4FK4A 4ELVA 3C6TA 4O0JA 2D1KA 3DMJA 4NCAA 3ZETA 4HHTA 3NVKA 1GLLO 3WXKA 5E84A 5HBMA 4Z4GA 1WSGA 1BISA 4CESA 2A5XA 3IG1A 2QW9A 2CGJA 4FW1A 3ZLJA 4DTJA 4LF5K 3LPUA 3AVFA 3KZBA 2WUSA 3O9QA 4DSLA 4BREA 5CR4A 1ZC6A 5AQMA 2XHBA 4CFAA 2V7YA 4HUFA 2ITGA 4ZTJA 1RDBA 1D5AA 3DAWA 3KWGA 2GTDA 1NGEA 3QINA 1C6VA 4CJ7A 3TSPA 4OX9K 1NK4A 4HUGA 4YORA 2D0CA 4H5RA 4DV1K 1KC8O 4CCHA 3EZ5A 4CJ3A 2HNYA 4U7BA 3EE8A 4WCEL 4BVPA 3L2WA 4DLGA 4MQ3A 3VQPA 4DV2K 1S1UA 1X9SA 4ZHRA 5AQKA 2O4IA 1JCEA 3DRSA 3HPGA 4GV3A 3U6FA 2E2PA 1KQSM 3UKRB 1WLJA 3MECA 4JD2A 2QEXN 2OA8A 1X3MA 3SUNA 3QEVA 2HMPA 3VGLA 4CBWA 2PYJA 3OVNA 2OZMA 4PKGA 4JRQA 4FPBA 2BUPA 3NF7A 4B9VA 3JXUA 3AO2A 1BU6O 1T6DA 1WUAA 3T1AA 4DR7K 1NGBA 3ATUA 1RT3A 4DSJA 3CHWA 3TU5A 1EQYA 3CYMA 3AVMA 4GVMA 4DF4A 3WQTA 3ZETB 5IWAK 4I9QA 1YF5L 4IOAL 3L0QA 1S1VA 1CZBA 1NGGA 2UU9K 4BG8A 5I3UA 2AA4A 1WAFA 5JLFA 4DV5K 3QNNA 3TARA 3CJ7A 2VQFK 2F9WA 4KPYA 4KKOA 3HXMA 4JAXA 5HRNA 3WT0A 4CE9A 2FF6A 3VA0A 5DK5A 3ZT1A 3VF4A 1VSJA 1GOCA 3ZT3A 2CH5A 5CHIA 1T03A 4HTLA 4DR4K 1Z05A 3AGKA 5BPNA 4BACA 1RNHA 3C6HA 5BPLA 4OJRA 4CJKA 2Z1GA 4KHPK 5BREA 4C1NI 3K5LA 1C0FA 3P5JA 3HM9A 2XY7A 4IG3A 2P5OA 1V4TA 1TV6A 3K57A 4KRFA 4CBUA 4FM2A 1VQNN 4BRNA 3NMUA 4QOZB 4HCBA 4DR5K 5C12A 4JKBA 4JKGA 1WSJA 4AH9A 4B3TK 3S41A 5AQIA 1S5JA 1RTDA 5FDLA 2Y1JA 4Z4IA 3GOIA 2VWJA 4JKHA 3M8SA 1U48A 1RDAA 4FJIA 4FOIA 4LF7K 1CZ9A 2P9UA 3ZT0A 4YOXA 2DFEA 1RDUA 2ETJA 4H0TB 4YDUA 5J2NA 4ELTA 1IJJA 4JD2B 5SZTA 3P39A 2VWBA 3LP1A 4HCCA 3K58A 2QXLA 1MWMA 3D2EA 1IKXA 4FM0A 3VQ6A 3LANA 1NOZA 3T1YK 2YNFA 4DTNA 4CZFA 4FXDA 2O8BA 1D4XA 1HKBA 1BOTO
chains in the Genus database with same CATH topology
3QMLA 5AQNA 5AQOA 4O8KA 1SS6A 3U9ZA 4JK7A 4FWPA 2E2QA 2V52B 4BC5A 5AQQA 5AQYA 2E1ZA 1M90O 4UY8O 1WOQA 2FLOA 2Q2RA 5B8HA 5BRFA 3FE1A 4GV6A 4CZJA 3VENA 5FPMA 3CCSN 4BRIA 3CJ1A 3G71N 3VF6A 2IIRA 2PFUA 1NGHA 3E1YA 3J8AA 4JKCA 4WQ5A 4WFNL 3BF3A 2YHYA 3VMFB 1V4SA 5DM7L 4JKFA 4CZIA 2YJEA 1T6CA 5KQ8A 3ID8A 5LJVA 2IVPA 1YITN 5FPEA 5MLCQ 5AR0A 3CCRN 4DCHA 3N4PA 2D0PA 1U2VB 3TPQA 3TTDA 4CZLA 1E4FT 4Z94A 2HBMA 3O9SA 3MX2A 5GINA 1ZXOA 5KPZA 2RE2A 3G4SN 1YJ9N 4GNIA 5C10A 4FO0A 1TUYA 2NRVA 4CZMA 4KH4A 3ZX0A 2KHOA 3OBYA 3LDQA 1X9JA 2YCHA 3K9KA 3CXCM 4FWNA 3J7ZO 3FLCO 3O5BA 5KQDA 4G9ZA 4A5AA 1NGIA 5JVHL 4KH6A 1VQ8N 3BEXA 4BRCA 2NRZA 4BQZA 4WYBA 3A5MC 4B1ZA 4CZHA 4NLBA 1W2BM 5AQSA 1SZ2A 3AGRA 1SAZA 3B8AX 3SBTA 3CC4N 3CMEN 1KAXA 3A8YA 3MDQA 4JKGB 5EXWA 3CF5L 4ISFA 1Z6RA 3KK7A 5M1QA 2E20A 1MA9B 1KXPA 3NVMA 3CCVN 3GG4A 3SJHA 4JEPA 5AQFA 4C23A 4PKIA 4DQ8A 1YJNN 2VYPA 1K9MO 3VEOA 5DM6L 1DKGD 3LM9A 3SBGA 2WFBA 3ZEUB 5C2FA 2P9UB 3A5OC 2F9TA 3KHYA 1DT9A 1NMDA 3M5RA 4RTFD 4DB3A 1C0GA 5GAEP 3ATVA 3CCUN 5AQJA 1BDGA 5H1SQ 4YOUA 2KLAA 1DGKN 2WC9A 2W40A 4AM6A 3VTHA 5ADXA 1U6ZA 4H5TA 1NJIO 2ITMA 1R59O 3ZX3A 1S3XA 2GWJA 3H3OB 3IUCA 3QBWA 1BA1A 2CH6A 3VEVA 2Q36A 4CD3A 1Q18A 4IO9L 3H6EA 3WXIA 4ILJA 4DKWA 4CZKA 2YI1A 4WFAL 3UKUA 3C7NB 1VQ5N 1VQ6N 3R1XA 3VERA 4A61A 5C15A 4MDBA 4BRFA 4H5NA 1GLEG 3FZKA 5AQUA 5M1PA 3K9JA 1VQ9N 1VQ4N 4BRAA 4MO5A 3VETA 4K41A 2QWNA 3HTVA 5EY4A 1P90A 3HBTA 1ATNA 3CPWM 1NGDA 4FWQA 4PKHA 3KWIA 5AZIA 3H46O 3CCMN 3M6GA 5F2RA 4WFBL 5KPRA 3O4WA 4I6MA 4YOTA 1VQKN 1VAZA 4JNEA 3C0BA 1T3VA 1GLDG 1MWKA 4BRDA 2W41A 5ADXH 1P8ZA 1TYQA 2Q0RA 4QS9A 2GEMA 4GV9A 2HF3A 5KPTA 2ASMA 4ILGB 1GLFO 3MCAB 5F0XA 3CCLN 3C7NA 1BO5O 3IKMA 2VGNA 4QS7A 3TSQA 3ZX2A 4B9QA 5AQXA 1O13A 3CIPA 3TSUA 3I55N 1VQ7N 1NBWA 2YX6A 3UE5A 3CC7N 4BRMA 1NGAA 2NNWA 2Q1NA 3CJ9A 1QVFM 4BY9C 4IOXA 4EIAA 2Q31A 1M1KO 2P9SA 3QICA 4BG9A 3FZHA 4BROA 2A6AA 1KAZA 3SMPA 4B1YB 3EKUA 3MX5A 2HOEA 3QFUA 4O5FA 5EOYA 3U4LA 2ZJRL 1NGFA 3OHRA 3U8XA 2QWPA 2P9KA 4GVEA 4H0YB 3HI0A 2DPNA 2P9PB 4H0OA 1SQKA 3FZLA 3GDQA 4KBOA 3DXMA 4Y0WA 1HPMA 2H3GX 5AFUA 1QQMA 4YOYA 4L3QA 1ILYA 1QVGM 2I7PA 1XC3A 2FF3B 4NLCA 1QHAA 3I33A 4BRHA 2ZGZA 2QM1A 2QWOA 3O8MA 3QFPA 3P31A 4IEIA 4YOWA 3PIOL 2F7TA 1YI2N 2PBDA 2OTJN 3M3ZA 2FSKA 2E8AA 3O1WA 2D4WA 3WXJA 3A5LC 1VQLN 5FPNA 3I56N 4CD1A 2JWKA 5M1NA 1IG8A 5JICA 1GLJO 3P4IA 4IWVA 3TTCA 4H5WA 1QZ6A 1ATRA 1HX1A 2NRXA 3ID6A 4BC2A 1YIJN 4A59A 4GY2B 4B1UB 3FGUA 5CE3A 5C2DA 2ASOA 3VPZA 2JWLA 4WQ4C 1ESVA 1G99A 4BGBA 5AQGA 3N4QA 4JN4A 1YAGA 4R79A 1Y64A 3WEEB 3WXMB 1GLAG 1OKJA 3EO3A 4YDUC 1Q86O 3MCPA 2P9PA 3W0LA 4B1VA 1GLCG 3H3NO 3E9OA 3QDKA 5AFUH 3VEXA 4IJNA 5C0YA 5M1OA 4QS8A 1DEJA 4JHDA 1KD1O 2NRWA 3MMVA 5EX5A 5BRHA 3CCEN 4IOCL 3AAPA 3LDOA 2QWQA 1HJOA 1NGJA 2A41A 4JKAA 1EO1A 3F9MA 4FVUA 5TKWA 4H0XB 4XH5A 3UKUB 5LJWA 4FWRA 3L6QA 3CI5A 1NWKA 3ULEA 4BR2A 3LDPA 5AQWA 4XH1A 4M7YA 4FSVA 2UYTA 3D2FA 1ZBSA 4JKEA 1LCUA 3A5NC 3BF1A 3QB0A 3UKRA 2FXUA 1BA0A 3ZYYX 5AZIB 4O8UA 4RCHA 4CI6A 4EFHA 3HOTA 2NRTA 3E66A 3WEEA 3E9LA 3H1QA 3JS6A 4I6MB 1W97L 4BGAA 4CZEA 2HSTA 5TKYA 4BR4A 5GAHP 3VEYA 4JKDA 5AQVA 1TYQB 4EAHD 4BRGA 3O80A 4WQ5C 4XEIA 5JVGL 5JMVA 1BG3A 2EWSA 2FSNA 3SLCA 1H1VA 4C1NK 2GWKA 3GBTA 1VQON 3LDNA 3OA9A 5EVZA 3CPEA 3D6RA 3O08A 1YVNA 4JK9A 4MO4A 1JCFA 1RDWX 2D1KA 4FWSA 5LY3A 3ZETA 2HBJA 3NVKA 1BWFO 1CZAN 2E1YA 2P9SB 1GLLO 3WXKA 1KAYA 5E84A 2QTDA 1VQPN 2ASPA 4FOEA 1MDUB 4A2BA 3H1VX 1QQOA 4PL7A 3R9PA 2KKZA 2RHKA 2A5XA 4IZ9A 2QW9A 2P9LB 2QWMA 2CGJA 2NLXA 2P9KB 1NM1A 1K73O 3FFKB 1GLBG 3DXMB 3OW2M 3G6EN 5AQRA 1LOTB 5BRDA 3KZBA 3O1BA 3R3LA 3VOVA 2WUSA 4IDHA 3MK6A 3O9QA 2D0OA 2HF4A 5GIOA 4FWLA 4M7XA 4BR7A 2YHWA 3SAGA 3PLAA 5BN8A 2A42A 3A0IX 4BREA 1NGCA 5CR4A 4BR0A 1JCGA 1ZC6A 5AQMA 2A3ZA 2VCPA 2V7YA 2OTLN 2IVNA 5E26A 4KH5A 3CCQN 4JK8A 3DAWA 3GE1A 2E2OA 5M1KA 3OBWA 3KWGA 2E88A 3P38A 5BPMA 2QI2A 4BRPA 2GTDA 1NGEA 2OANA 3D7EO 4ISGA 4PL8A 4AM7A 2P9NA 3MN7A 3MN6A 4CJ7A 1K8AO 5AQHA 3TSPA 1HUXA 3MWTA 4YOVA 1HKCA 4NB4A 2P9LA 3VEZA 3O6WA 2NZTA 3RSEA 1YJWN 4YORA 3DLLL 3EL2A 4EHTA 4A5BA 3VTIA 3BUZB 4H5RA 2P9IA 4MLHA 1KC8O 4JHDB 1RFQA 4OO1J 2CGLA 2J4RA 5AQPA 1X3NA 3DXKB 4M63C 4BC3A 2NRHA 3T69A 5GIPA 4U7BA 3EE8A 4WCEL 2QWLA 3W3DA 4BVPA 1OVYA 3EZWA 2HBLA 4IJAA 2CGKA 3MWPA 3HM8A 3GL1A 4DHYA 5GAGP 1NLVA 3ULEB 3CD6N 4FL9A 3G25A 1E4GT 1BUPA 1ATSA 5AZJA 1Q7YO 5AQKA 3D2FB 1JCEA 5F1XA 4NO7A 4GV3A 2ZJPL 2E2PA 4CBXA 2HBKA 3UKRB 3O9UA 3IMXA 3WXLA 4JD2A 1Q81O 1KQSM 2BH1A 2QEXN 4AF1A 1VQMN 3RVCA 5M1FA 5GADP 4ILHA 1X3MA 3M1FA 4IEEA 4H5VA 3HRGA 2HMPA 4FWMA 1K8KA 3VGLA 4CBWA 4IFEA 3VGKA 4FPAA 3ENHA 4PKGA 1QZ5A 3DXKA 4FPBA 2BUPA 3CQXA 3AY9A 3JXUA 5I9EB 1BU6O 1T6DA 1WUAA 4MLEA 4BRQA 3AAQA 1NGBA 3ATUA 3CHWA 3LL3A 1EQYA 2V7ZA 5ELZA 3TU5A 3LDLA 3VEWA 4BC4A 1XUPO 4H0VB 3WQTA 3ZETB 3MN5A 4CZGA 3FZMA 1YF5L 4IOAL 3L0QA 3LM2A 1TUUA 3VGMA 1YHQN 1YUWA 2WBNA 1NGGA 4BG8A 3C65A 2BTFA 2AA4A 5JLFA 3CJ7A 4B1WB 1S22A 2F9WA 2GUPA 5AQTA 4PHTX 4F9OA 3EKSA 3Q7BA 3CCJN 4FWKA 2A40A 2E2NA 4JAXA 3ENOA 3WT0A 2V51B 2FF6A 2VGMA 4RWTA 3AARA 3CETA 2NRRA 4K43A 1U2VA 3CQYA 2CH5A 3HSCA 3VF4A 3WQUA 4BR9A 5CHIA 4HTLA 2QA4N 5HOOA 4U67L 1HKGA 4OPAA 3CC2N 2Q97A 2FSJA 4LC9B 3IFRA 1Z05A 4A2AA 3AGKA 3VF2A 5BPNA 2Q0UA 3MN9A 2PAVA 3SAFA 3C6HA 4BR5A 5BPLA 2AP1A 1Q82O 4BVOA 3SK3A 4K25A 4C1NI 5BREA 1C0FA 3CERA 3E9PA 3HOSA 1S72N 1V4TA 1YXQA 4BRLA 1HLUA 4CBUA 5BR9A 3EN9A 3O9TA 2P9NB 1VQNN 4BRNA 3NMUA 4WF9L 3VESA 5C12A 2YHXA 3T7ZA 3FZFA 3CJAA 3L4QA 3F5TA 4JKBA 3RSEB 3D2EB 4JKGA 5AQLA 2ZJQL 4XH4A 3EE9A 2P9IB 3F2KA 4A57A 3QBXA 3S41A 4MDAA 5AQIA 3HZ6A 1T44A 3SMSA 3TTFA 3GOIA 4HWIA 2ZF5O 4JKHA 4ISEA 3PIPL 5HL7L 1QQNA 3H45C 4FOIA 4K42A 2ZWHA 3ZEUA 3IDHA 2P9UA 3R6MA 3ENBA 2GX9A 4WQ4A 4YOXA 1RDUA 3DJCA 3KVGA 4H0TB 5BN9A 3WUHA 4YDUA 5AZJB 1JJ2M 3DWLA 2GELA 1IJJA 2QWRA 2IVOA 4JD2B 4A62A 3SAHA 4B1XB 2I7NA 3P39A 3O9RA 2VWBA 4OPHA 4H03B 4EHUA 1RGIA 4IO8A 4E1JA 4BQLA 2QXLA 1MWMA 3D2EA 4IXCA 3U9DA 4J8FA 3C6AA 5FPDA 5JLHA 3I8BA 3Q7CA 3R8EA 3UB5A 1K8KB 3BP8A 4H0PA 3L4IA 1J6ZA 2YJFA 4FWOA 5AQZA 1XQSC 4CZFA 3CMAN 1D4XA 2ZGYA 3CJBA 1HKBA 1N8RO 3FR0A 4BRKA 3CJCA 1BOTO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAH P;  1VQK N;  5JVG L;  1M90 O;  4UY8 O;  1VQO N;  3CCS N;  3G71 N;  3CCL N;  4IOA L;  4WFN L;  1YHQ N;  3I55 N;  5DM7 L;  1VQ7 N;  3CC7 N;  1QVF M;  1VQP N;  1YIT N;  1M1K O;  5MLC Q;  3CCR N;  3CCJ N;  2ZJR L;  3G4S N;  1YJ9 N;  1K73 O;  2QA4 N;  4U67 L;  3OW2 M;  3G6E N;  3CC2 N;  3CXC M;  1ILY A;  3J7Z O;  5JVH L;  1Q82 O;  1VQ8 N;  1QVG M;  3PIO L;  2OTL N;  1YI2 N;  2OTJ N;  3CCQ N;  1W2B M;  1S72 N;  1VQL N;  3I56 N;  3CC4 N;  3CME N;  1VQN N;  3CF5 L;  4WF9 L;  1YIJ N;  1K8A O;  3CCV N;  1YJN N;  2ZJQ L;  1K9M O;  1YJW N;  3DLL L;  5DM6 L;  1KC8 O;  1Q86 O;  3PIP L;  5HL7 L;  1KD1 O;  5GAE P;  3CCE N;  4WCE L;  3CCU N;  4IOC L;  5H1S Q;  1OVY A;  5GAG P;  1NJI O;  3CD6 N;  1JJ2 M;  4IO9 L;  1Q7Y O;  4WFA L;  1VQ6 N;  1VQ5 N;  2ZJP L;  1KQS M;  1Q81 O;  2QEX N;  1VQM N;  1VQ9 N;  1VQ4 N;  5GAD P;  3CPW M;  3CMA N;  3CCM N;  1N8R O;  4WFB L; 
#chains in the Genus database with same CATH topology
 4E7H A;  3I8D A;  4JK7 A;  4FWP A;  4CEZ A;  2V52 B;  2Q2R A;  5B8H A;  5BRF A;  4GV6 A;  3QER A;  5FPM A;  1HRH A;  1NGH A;  2BE2 A;  4WQ5 A;  2YHY A;  3KK3 A;  1T6C A;  4DS5 A;  1KSP A;  1KVC A;  4DS4 A;  4H4M A;  5MLC Q;  4E19 A;  1B9D A;  3OYE A;  2YNH A;  4Z94 A;  3TTD A;  4DFJ A;  1NK8 A;  4CJU A;  2P51 A;  4G1Q A;  4DUY K;  2O4G A;  3OYD A;  4GNI A;  4FO0 A;  1TUY A;  1J54 A;  4KH4 A;  3ZX0 A;  2G8W A;  4WE1 A;  1TL3 A;  4AHC A;  3CXC M;  3AVC A;  4G9Z A;  2O8E A;  2DY4 A;  1NGI A;  3ZT4 A;  3BEX A;  4BRC A;  4BQZ A;  1WAJ A;  4B1Z A;  3SZ2 A;  3AGR A;  4UQG A;  3L3U A;  3HVR A;  3CME N;  4CGH A;  1FKP A;  4I2Q A;  3A8Y A;  4JKG B;  5EXW A;  1XMO K;  4FJ5 A;  1RT4 A;  3QET A;  3CCV N;  4C23 A;  4M3X A;  1VRT A;  3EEQ A;  3NF8 A;  3VEO A;  3K59 A;  3VA3 A;  2IDO A;  2WFB A;  5FRO A;  2G8H A;  2PYL A;  2P9U B;  4CF2 A;  4XIU A;  3SI6 A;  1HQE A;  2YKN A;  2OZS A;  4E7K A;  4DB3 A;  3ZSZ A;  5GAE P;  3LPT A;  5H1S Q;  4X66 K;  2KLA A;  3TI0 A;  3TWH A;  2P1J A;  1S3X A;  3QBW A;  3VEV A;  3DLK A;  4FJ7 A;  3WXI A;  4DKW A;  4WFA L;  3C7N B;  3R1X A;  4A61 A;  1GLE G;  3K9J A;  2UXD K;  4CF9 A;  3AA5 X;  3KIO A;  4MO5 A;  2O8B B;  4K41 A;  2QWN A;  1L3T A;  4DU1 A;  2YHA A;  1ATN A;  3SUQ A;  4FWQ A;  3VQB A;  4DU3 A;  1KFS A;  4X65 K;  1N6Q A;  4J2A A;  4CF8 A;  4OKJ A;  3CCM N;  2OPP A;  4K8Z A;  4DTO A;  3AVJ A;  5E41 A;  4WFB L;  4I6M A;  1VQK N;  3AVB A;  1VAZ A;  2PY5 A;  2F8T A;  4JNE A;  3O3G A;  1Q9Y A;  1T3V A;  3QES A;  3THY A;  4EP4 A;  4M3T A;  5ADX H;  1TYQ A;  4NCB A;  1BGX T;  4ILG B;  3L3V A;  4QS7 A;  3TSU A;  1S1X A;  4JI6 K;  1NBW A;  3RTV A;  1DTQ A;  4BRM A;  1KTQ A;  4BY9 C;  3J81 O;  1W0H A;  2A6A A;  4Z4E A;  4B1Y B;  1RT2 A;  1NJX A;  1XI1 A;  3MX5 A;  2HOE A;  5EOY A;  4R5P A;  2O8E B;  3HI0 A;  2DPN A;  2P9P B;  4KBO A;  3FZL A;  3GDQ A;  4Y0W A;  3DXM A;  5AFU A;  4YOY A;  1IKW A;  1DTT A;  1ILY A;  1XC3 A;  2AJQ A;  2VWK A;  1T05 A;  2QWO A;  3VQ8 A;  2F7T A;  3O1W A;  2QXF A;  3VQA A;  1TKZ A;  4H5W A;  1ATR A;  1IKV A;  4M3U A;  1YIJ N;  1WBB A;  4GY2 B;  2BAN A;  1I3A A;  2JWL A;  1VSM A;  4WQ4 C;  4FJM A;  4BGB A;  2HB5 A;  3G0Z A;  4R79 A;  3WEE B;  3LDS A;  3WXM B;  1GLA G;  3EO3 A;  2ZM6 K;  1TGO A;  4B9S A;  3VEX A;  2HHV A;  5FLX O;  3PSF A;  3DLG A;  5M1O A;  3L2V A;  1FKO A;  3JAM O;  4IOC L;  3LDO A;  2QWQ A;  3RR8 A;  1RBU A;  1EO1 A;  4ID1 A;  4CJ5 A;  4CIG A;  1NKB A;  3V9W A;  2UUC K;  3CI5 A;  2FBY A;  4CJE A;  4XH1 A;  1ZBS A;  4FLY A;  2FBV A;  4CHQ A;  1SKS A;  2D0B A;  2ZD1 A;  4EFH A;  2NRT A;  1VSK A;  3E9L A;  1WSF A;  3H1Q A;  3JS6 A;  4I6M B;  3VQD A;  2G8F A;  4N47 A;  1W97 L;  4CZE A;  4FJ8 A;  3THY B;  1E3M A;  5TKY A;  4M3R A;  3NHG A;  5GAH P;  2PZS A;  4B9L A;  1TYQ B;  3VQ4 A;  3BZK A;  4FLX A;  4XEI A;  5JMV A;  1SV5 A;  1BG3 A;  4JYA K;  3LDN A;  2HVH A;  3CPE A;  4Q0B A;  1BQN A;  3T3F A;  4QCL A;  3HJF A;  5LY3 A;  1BWF O;  1CZA N;  2E1Y A;  1KAY A;  2QTD A;  3TR8 A;  1VQP N;  4H8K A;  4FOE A;  4A2B A;  2HHQ A;  1QQO A;  3R9P A;  4EZ6 A;  4B3O A;  2KKZ A;  2RHK A;  3HL8 A;  4DWI A;  4BWM A;  3DXM B;  1N32 K;  5AQR A;  1LOT B;  1VHX A;  3O1B A;  1JLC A;  1UA1 A;  1NNE A;  3MK6 A;  2D0O A;  1TVR A;  5GIO A;  3U3Y A;  4BR7 A;  2OPQ A;  3SAG A;  3PLA A;  4FJ9 A;  2A42 A;  4E1M A;  1NGC A;  3K5M A;  1JCG A;  2IVN A;  4N5S A;  1SL2 A;  5E26 A;  1XWL A;  3U3G A;  2E2O A;  4FZZ A;  2ATQ A;  2KQ2 A;  3P38 A;  5BPM A;  1L3S A;  1HR0 K;  3D7E O;  1N34 K;  3LP2 A;  2P9N A;  3O4N A;  5HLF A;  5AQH A;  3AA3 A;  1HUX A;  4JRP A;  4YOV A;  4NB4 A;  2HHS A;  4FJX A;  2NZT A;  1EKE A;  3RSE A;  1YJW N;  3DLL L;  3EL2 A;  4C8M A;  3BUZ B;  2P9I A;  1N36 K;  1QHT A;  4Q5V A;  3DM2 A;  1X3N A;  3DXK B;  2NRH A;  5CZ1 A;  3QLH A;  4IJA A;  3MWP A;  3RRH A;  3HM8 A;  5GAG P;  3QEX A;  3SCX A;  4FL9 A;  4RW4 A;  2X74 A;  1BUP A;  1ATS A;  1Q7Y O;  1HQU A;  4AIL C;  2ZJP L;  3IMX A;  1S9G A;  2BH1 A;  1J5O A;  1VQM N;  1QQC A;  4E7I A;  5M1F A;  3M1F A;  1X9W A;  3BY5 A;  3E01 A;  4LH5 A;  3OTO K;  1DLO A;  4IFE A;  3ENH A;  3AO1 A;  3V1R A;  3CQX A;  2KTQ A;  4DQI A;  1RT6 A;  3RMA A;  4BRQ A;  3NF9 A;  3ZSO A;  3BZC A;  4GMJ B;  3ALY A;  3VGM A;  3C65 A;  2BTF A;  2GUP A;  5AQT A;  4PHT X;  3C6U A;  3EKS A;  3CCJ N;  4FWK A;  1S6Q A;  2A40 A;  4YY3 K;  3ENO A;  1WSE A;  4M41 A;  2QKK A;  3CET A;  4CJL A;  3WQU A;  2KW4 A;  3G10 A;  5HOO A;  1D9F A;  4B9N A;  3QO9 A;  3ASM A;  4DV3 K;  1JL1 A;  3VF2 A;  3OYH A;  2PAV A;  4BR5 A;  3KLG A;  2AP1 A;  2KZM A;  3L8B A;  4BVO A;  3SK3 A;  2ZE2 A;  3CER A;  2O8D A;  1EWQ A;  4BRL A;  4K0K K;  2P9N B;  2VG6 A;  1OH6 A;  2YHX A;  3VOV A;  3T7Z A;  3FZF A;  3RSE B;  1YTU A;  5AQL A;  5HP1 A;  2XY6 A;  4XH4 A;  2P9I B;  3F2K A;  1JXB A;  3TTF A;  4HWI A;  1JL2 A;  2ZF5 O;  1JLG A;  3V6D A;  5HL7 L;  3H45 C;  2YNG A;  3T19 A;  1NJZ A;  1VSL A;  2RPI A;  1SL1 A;  3SV4 A;  2E6L A;  4WQ4 A;  1FW6 A;  2OYQ A;  4L8R B;  4CIE A;  4CJR A;  1JJ2 M;  1RTI A;  3DWL A;  1QE1 A;  2GEL A;  2QWR A;  2GUI A;  4B1X B;  3AVG A;  3DRP A;  4Y1D A;  4IFY A;  4OPH A;  4H03 B;  5J2Q A;  1KFD A;  4IO8 A;  4BQL A;  3U9D A;  4CFD A;  5JLH A;  4IXC A;  3C6A A;  3R8E A;  1QSS A;  3PO4 A;  4Y1C A;  4DR2 K;  3L4I A;  4DTX A;  4OPJ A;  1J6Z A;  3CMA N;  5AQZ A;  1XQS C;  2ZGY A;  3FR0 A;  4KAZ A;  4FW2 A;  3SLC A;  3CJC A;  4I7F A;  5AQO A;  4O8K A;  1SS6 A;  4C8K A;  4UY8 O;  3WNE A;  4CZJ A;  3VEN A;  3ZSV A;  4CEE A;  1NJW A;  2YHB A;  2W6L A;  3E1Y A;  4JKC A;  4LF9 K;  4JKF A;  4F3O A;  5KQ8 A;  1R0A A;  3OYC A;  1IH7 A;  4O0I A;  3TAE A;  2O8F A;  3CCR N;  1VSF A;  4CZL A;  2HBM A;  3O9S A;  3MX2 A;  5GIN A;  3V9S A;  1UWB A;  5C10 A;  3PX6 A;  3RWU A;  1KCF A;  2WTU A;  3CM6 A;  3ZSX A;  4E7L A;  2DFF A;  1X9J A;  2YCH A;  3K9K A;  4FWN A;  3J7Z O;  1A5W A;  1LWC A;  5KQD A;  3CQ8 A;  4LF8 K;  5JVH L;  3AVN A;  2O8D B;  1IO2 A;  4WYB A;  4B8C A;  1RT7 A;  3NGI A;  1W2B M;  5AQS A;  4LFC K;  3KLF A;  2LSN A;  4RW8 A;  3CC4 N;  2O8C A;  1LAW A;  3SQ2 A;  3KK7 A;  5J2P A;  1JLQ A;  1KXP A;  3NVM A;  4CGD A;  3GG4 A;  3SJH A;  4JEP A;  4YFU A;  1YJN N;  4PKI A;  4K8X A;  2VYP A;  3I0S A;  1RBS A;  1VSH A;  1DKG D;  3M5R A;  1NMD A;  4CK2 A;  1C0G A;  3KTQ A;  3HP6 A;  2W40 A;  4FVM A;  4AM6 A;  1NJI O;  1U6Z A;  4H5T A;  1R59 O;  4CD3 A;  2Q36 A;  3H6E A;  4ILJ A;  1HYV A;  4CZK A;  1VQ6 N;  3VER A;  4NYF A;  5C15 A;  4MDB A;  4BRF A;  4ZTF A;  4BDZ A;  4DQQ A;  2OPR A;  1KLN A;  5EY4 A;  4LFA K;  3TAN A;  4EZ9 A;  1P90 A;  3V1O A;  4M3W A;  3T1H K;  3SPZ A;  3CPW M;  3LWM A;  4PKH A;  1BIU A;  1XHX A;  5AZI A;  1C1A A;  5F2R A;  3O4W A;  4YOT A;  3IS9 A;  2P5G A;  4DQP A;  1MWK A;  1GOB A;  1N5Y A;  4GV9 A;  2GEM A;  3S3M A;  3K5N A;  2WOM A;  5F0X A;  3C7N A;  3AVL A;  3TSQ A;  3OYG A;  3CIP A;  3I55 N;  2O8F B;  1NK6 A;  3UE5 A;  3CC7 N;  1QVF M;  2NNW A;  3IRX A;  4EIA A;  2Q31 A;  2P9S A;  4E0D A;  2HHX A;  3AA4 A;  1Y97 A;  2HHT A;  2ZJR L;  5T7B A;  4M3Y A;  1JLF A;  3U8X A;  4CHP A;  3NF6 A;  3HK2 A;  1HPM A;  1QQM A;  4L3Q A;  4FJH A;  2I7P A;  2FF3 B;  3PSI A;  4N76 A;  4KI6 A;  4F4K A;  1EWR A;  4IEI A;  4YOW A;  3PIO L;  3NAE A;  3P31 A;  5C42 A;  4DV0 K;  3VQ5 A;  2O8C B;  3WXJ A;  1WNS A;  3HYF A;  4KTW A;  1RTH A;  4CD1 A;  1IG8 A;  5CYQ A;  3B6O A;  2NRX A;  2I5J A;  3ID6 A;  1HMV A;  4JI4 K;  4OGE A;  1O1W A;  2ASO A;  5C2D A;  1YAG A;  1Y64 A;  3OYF A;  4KTQ A;  3W0L A;  2P9P A;  2XY8 A;  1EXQ A;  5AFU H;  3PUF A;  1DEJ A;  3MMV A;  5EX5 A;  3CCE N;  3OYB A;  1VSI A;  4CGG A;  1HJO A;  1NGJ A;  2A41 A;  4FLV A;  3AA2 A;  3VQE A;  4H0X B;  4FWR A;  4PQU A;  1C1C A;  4CEB A;  3BGR A;  2RF2 A;  1C0M A;  4M7Y A;  4FSV A;  3F9K A;  1L3U A;  3SV3 A;  4DQR A;  3A5N C;  3BF1 A;  2FXU A;  1BA0 A;  5AZI B;  4O8U A;  4RCH A;  3HP9 A;  4W5Q A;  3WEE A;  4B9T A;  1NOY A;  2A1R A;  4GW6 A;  5KRT A;  3DOK A;  2EWS A;  2FSN A;  4C1N K;  3GBT A;  4KHS A;  5EVZ A;  3D6R A;  1YVN A;  4W5T A;  4JK9 A;  1JCF A;  1RDW X;  4F2S A;  2P9S B;  1NK0 A;  2ASP A;  1W7A A;  3H1V X;  4IZ9 A;  5HRR A;  5LMN K;  2P9L B;  2QWM A;  2NLX A;  2F96 A;  4C8N A;  1YT3 A;  1HPZ A;  1NM1 A;  1K73 O;  3FFK B;  1WBD A;  5DMR A;  3K2P A;  4Z4H A;  3V4I A;  3KJV A;  3TAF A;  4FWL A;  4M7X A;  2YHW A;  5BN8 A;  3KKS A;  5J1E A;  2IC3 A;  2A3Z A;  4JI1 K;  2OTL N;  1XNQ K;  4NCG A;  3CCQ N;  4JK8 A;  5M1K A;  1A5X A;  1TL1 A;  3C94 A;  2E88 A;  1WSI A;  3LZI A;  2OAN A;  4DSF A;  4AM7 A;  3KK1 A;  4BDY A;  3MN7 A;  3MN6 A;  1X9M A;  1K8A O;  1RBR A;  3PX4 A;  1B92 A;  2UXC K;  2FBT A;  3HPH A;  3MWT A;  4OLB A;  3VEZ A;  3O6W A;  2QKB A;  4EHT A;  3ZCM A;  4OO1 J;  5AJ3 K;  4FLU A;  1Z26 A;  1RT1 A;  4CJS A;  3THX A;  4BC3 A;  4O5B A;  3W3D A;  2HBL A;  3THV A;  2IOC A;  3GL1 A;  5HRS A;  1TKD A;  3CD6 N;  3G25 A;  3K5O A;  1ZYQ A;  5AZJ A;  3M8P A;  3ZSW A;  5F1X A;  3KD5 E;  4W5N A;  4CBX A;  2HBK A;  1Q81 O;  3WXL A;  4AF1 A;  5JS2 A;  3RVC A;  5GAD P;  4Z0U A;  4JI5 K;  4KO0 A;  3HRG A;  3OYA A;  1T8E A;  3NE6 A;  4LSL A;  1N33 K;  1BI4 A;  3DXK A;  3WNG A;  5IT9 O;  3VN5 A;  1LWE A;  1XNR K;  4X62 K;  4OKK A;  4MLE A;  1HYS A;  3AAQ A;  4KI4 A;  3VEW A;  4BC4 A;  2G8I A;  3LDL A;  4H0V B;  3SPY A;  2ZQB A;  3WNF A;  2D0A A;  4KB0 A;  3S3N A;  4IKF A;  2IAJ A;  3VQ9 A;  4B1W B;  2E5L K;  4CEQ A;  4FJN A;  3NH1 A;  3HVT A;  2OCE A;  1XC9 A;  4OVL A;  4PUO A;  2VGM A;  2F8S A;  3AAR A;  2UUA K;  2NRR A;  1U2V A;  3CQY A;  4U67 L;  3IAY A;  4N41 A;  4KHU A;  4M3Z A;  4B8A B;  4OPA A;  2FSJ A;  1C0U A;  3IFR A;  4A2A A;  5C25 A;  2UXB K;  1EET A;  4ELU A;  5FRN A;  3ZSR A;  3OY9 A;  2F4V K;  3M8R A;  4CW7 B;  5HRP A;  3KLE A;  3B6P A;  1S72 N;  2HND A;  2UUB K;  1HLU A;  3EN9 A;  5BR8 K;  3A2F A;  4WF9 L;  3VES A;  1L3V A;  3TAQ A;  3OS0 A;  1REV A;  3EE9 A;  4A57 A;  3WNH A;  1T44 A;  3SMS A;  3THX B;  3KK2 A;  1QQN A;  3VQQ A;  4K42 A;  2ZWH A;  3CG7 A;  3IDH A;  4HUE A;  3R6M A;  1U49 A;  3ENB A;  2GX9 A;  4CHZ A;  3DJC A;  3KVG A;  4CGI A;  2E4L A;  4O55 A;  5AZJ B;  1A5V A;  5KTQ A;  1RBV A;  2FC0 A;  2IVO A;  3QIP A;  1CXQ A;  3SAH A;  2I7N A;  4DU4 A;  3O9R A;  1U04 A;  5D3G A;  4E1J A;  4AQY K;  4DTU A;  1LAV A;  5FPD A;  1HJR A;  2Y1I A;  1HNX K;  3Q7C A;  4CK3 A;  3BP8 A;  4OPK A;  2G8K A;  1VSE A;  1BI4 B;  1NK7 A;  4FWO A;  4DSI A;  3CJB A;  4B08 A;  5AQN A;  2IS3 A;  3U9Z A;  4LY7 A;  5AQQ A;  1TK0 A;  1ITG A;  2E1Z A;  1M90 O;  4J2D A;  2FLO A;  1IBL K;  4BRI A;  3VF6 A;  4FJJ A;  2IIR A;  4WFN L;  3BF3 A;  1I39 A;  4DV4 K;  1V4S A;  1UAX A;  3RRG A;  4DTR A;  5LJV A;  4JI3 K;  3QEI A;  5FPE A;  4DTP A;  1IV0 A;  5FRM A;  3TPQ A;  1U2V B;  4CER A;  2HVI A;  4FZX C;  4B3S K;  1KLM A;  4CJ4 A;  2NRV A;  3HT3 A;  4CZM A;  2KHO A;  3LDQ A;  4CJT A;  3K0S A;  4NLB A;  2RN2 A;  2HHW A;  1SAZ A;  3B8A X;  3NGZ A;  4LF6 K;  4M45 A;  4ISF A;  3SYZ A;  4KHW A;  1NG9 A;  2YNI A;  3V81 A;  3OYL A;  5AQF A;  3I0R A;  4DQ8 A;  3SQ1 A;  1LV5 A;  5J2M A;  2Z1H A;  4DF8 A;  3LP3 A;  3LM9 A;  3SBG A;  1VK0 A;  5C2F A;  3A5O C;  4AHV A;  3HO1 A;  3AO3 A;  1D9D A;  3KHY A;  1DT9 A;  4RTF D;  3ATV A;  3CCU N;  4CF0 A;  3V9X A;  3O4Q A;  3VTH A;  2ITM A;  3ZX3 A;  3J80 O;  2GWJ A;  3IUC A;  4CJQ A;  1BA1 A;  3S9H A;  4KHN A;  1YVU A;  1YTA A;  1VQ5 N;  3TAP A;  4OLA A;  4Z4F A;  4H5N A;  5AQU A;  2VG5 A;  5M1P A;  4BE2 A;  1VQ9 N;  1VQ4 N;  2NUB A;  5C24 A;  4PWD A;  1BHL A;  1BQM A;  3HTV A;  1Q9X A;  1D8Y A;  4O44 A;  3HBT A;  3LAK A;  2OPS A;  2D5R A;  3H46 O;  1XMQ K;  5KGW A;  3J7A P;  1OH7 A;  4ICL A;  3DLB A;  5KPR A;  4CFB A;  2FBX A;  1BCM A;  3C0B A;  4DQS A;  1GLD G;  4BRD A;  2W41 A;  3ITH A;  1P8Z A;  1UOC A;  4QS9 A;  1J53 A;  4JI7 K;  3NFA A;  2HF3 A;  3CFP A;  4KFB A;  3MEG A;  2WON A;  3OYN A;  4I9L A;  2B5J A;  3MCA B;  3ZX2 A;  3OYJ A;  1F21 A;  1O13 A;  3NCI A;  4GKJ K;  1VQ7 N;  2YX6 A;  1HYZ A;  3RMB A;  3CJ9 A;  2Q1N A;  4FK0 A;  4IOX A;  4NYN A;  1M1K O;  2JGU A;  3OYK A;  3QIO A;  3FZH A;  4BRO A;  2XY5 A;  3SMP A;  3DI6 A;  4IDK A;  4O5F A;  3U4L A;  2RKI A;  3OHR A;  3FFI A;  4B3M K;  2QWP A;  2P9K A;  4GVE A;  4H0Y B;  1C0T A;  1NJY A;  4H0O A;  2VQE K;  1SQK A;  3HST B;  3DLE A;  4CHN A;  2JLE A;  4NLC A;  1QHA A;  3I33 A;  1WB9 A;  2QM1 A;  3QFP A;  1QVG M;  1S1W A;  2PBD A;  1VRU A;  1LWF A;  3M3Z A;  1B9F A;  3A5L C;  1VQL N;  5FPN A;  3I56 N;  5JIC A;  4F2R A;  4BC2 A;  1NU0 A;  2B4J A;  4A59 A;  4B1U B;  1G99 A;  4JN4 A;  3P1G A;  4JV5 K;  1Q86 O;  2A1S A;  3NGY A;  4B1V A;  4DLE A;  3E9O A;  3QDK A;  4IJN A;  5CYM A;  3F73 A;  4JHD A;  1KD1 O;  1NKE A;  3KKR A;  4AHU A;  1FK9 A;  3O3H A;  2GV9 A;  4V19 S;  3AAP A;  4JKA A;  3F9M A;  5TKW A;  5LJW A;  1RDD A;  3OJS A;  1NWK A;  3ULE A;  4BR2 A;  4OGC A;  1SL0 A;  3KD1 E;  3VQ7 A;  1ZBU A;  3D2F A;  4LSN A;  4JLH A;  4JKE A;  2HMI A;  3OS2 A;  3QB0 A;  1ZBL A;  4FJL A;  4HTU A;  1BL3 A;  1KVB A;  3HOT A;  4CI6 A;  3E66 A;  1ASV A;  4FK2 A;  1ZBF A;  4BR4 A;  4IFV A;  4JKD A;  2DFH A;  5AQV A;  1W9H A;  1NK9 A;  1HNZ K;  1C1B A;  4CEC A;  1H1V A;  3ZT2 A;  2GWK A;  4F3T A;  1VQO N;  3PO5 A;  2DTU A;  3OA9 A;  3H08 A;  4C8O A;  3O08 A;  4FCY A;  1TAU A;  4MO4 A;  3AVK A;  1TK8 A;  3MEE A;  3L2Q A;  4FWS A;  1KVA A;  2HBJ A;  2BDP A;  3AO5 A;  4CEA A;  3SUP A;  1MDU B;  4PL7 A;  2G8V A;  2P9K B;  5KI6 A;  3JSM A;  5HRO A;  1RIL A;  1HNI A;  3CFO A;  1GLB G;  3OW2 M;  3G6E N;  5BRD A;  1JLA A;  3SJJ A;  1RDC A;  3R3L A;  3AVA A;  3PY8 A;  4IDH A;  3M8Q A;  1SUQ A;  2HF4 A;  3A0I X;  4BR0 A;  2EHG A;  4KTZ A;  2VCP A;  4CK1 A;  3JYT A;  4KV8 A;  4KH5 A;  3GE1 A;  4E89 A;  3OBW A;  4FLW A;  1RTJ A;  2QI2 A;  4BRP A;  4CJV A;  4ISG A;  3D0P A;  4PL8 A;  3MXJ A;  3C95 A;  1HKC A;  2P9L A;  4A5B A;  3VTI A;  4E1N A;  4MLH A;  4JHD B;  1RFQ A;  3EYZ A;  1RT5 A;  2CGL A;  2J4R A;  5AQP A;  3L2U A;  4M63 C;  3T69 A;  5GIP A;  4RW9 A;  2QWL A;  4CF1 A;  1OVY A;  3EZW A;  2CGK A;  5CY4 A;  4DFP A;  4DHY A;  4NXN K;  1NLV A;  3ULE B;  4CEF A;  3NH2 A;  1E4G T;  3MED A;  2KZZ A;  5SWM A;  3AO4 A;  3D2F B;  4NO7 A;  3O9U A;  4DSE A;  4B9M A;  1TK5 A;  1K6Y A;  1NMN A;  3LP0 A;  4IG0 A;  4ILH A;  4IEE A;  4H5V A;  3SQ4 A;  1ZBI A;  4CEO A;  4FWM A;  4RG8 A;  1K8K A;  2B6A A;  3ULD A;  3VGK A;  4B3R K;  4FPA A;  1QZ5 A;  3AY9 A;  3AVI A;  5I9E B;  2YV0 X;  4DUZ K;  4DTS A;  3LL3 A;  2X6S A;  2V7Z A;  5ELZ A;  1I94 K;  1XUP O;  1LW0 A;  3MN5 A;  4CZG A;  3FZM A;  3LM2 A;  3CM5 A;  1TUU A;  1YHQ N;  1YUW A;  2WBN A;  3DLR A;  4O4G A;  3AVH A;  1S22 A;  4DV6 K;  1ZBH A;  4F9O A;  3Q7B A;  3CFR A;  2E2N A;  2V51 B;  4RWT A;  4BE1 A;  1T7P A;  4BR9 A;  4K43 A;  3HSC A;  1CXU A;  2QA4 N;  3SNN A;  3LZJ A;  1ASU A;  1HKG A;  1MU2 A;  2Q97 A;  4LC9 B;  3CC2 N;  4FJG A;  2HW3 A;  4M42 A;  3NBP A;  2X78 A;  2Q0U A;  3MN9 A;  1QTM A;  3EY1 A;  3SAF A;  1Q82 O;  4FM1 A;  1RCH A;  4K25 A;  4N56 A;  3MXM A;  3HOS A;  3E9P A;  2QK9 A;  4DSK A;  1YXQ A;  4TSX A;  4CFC A;  3O9T A;  5BR9 A;  5KGX A;  4MFB A;  1NK5 A;  3AV9 A;  3QEP A;  3RR7 A;  3L4Q A;  3CJA A;  3F5T A;  3QNO A;  3D2E B;  2ZJQ L;  2X6N A;  3TAG A;  3QBX A;  4MDA A;  1Z25 A;  3HZ6 A;  1WN7 A;  1IKY A;  3V9Z A;  3V9U A;  1LW2 A;  4ISE A;  3PIP L;  3OYM A;  3DRR A;  3SUO A;  3ZEU A;  4Z4C A;  1U45 A;  2G8U A;  5BN9 A;  3KLI A;  3WUH A;  1UA0 A;  5LMU K;  1G15 A;  4A62 A;  4NXM K;  1KRP A;  1U47 A;  3ZSY A;  3LAL A;  1L5U A;  4EHU A;  1RGI A;  4FLZ A;  3SQ0 A;  4J8F A;  4CJF A;  3I8B A;  3UB5 A;  1K8K B;  1XHZ A;  2VG7 A;  4CJW A;  4H0P A;  3QEW A;  2YJF A;  4LH4 A;  3S3O A;  4RW6 A;  3TAB A;  1N8R O;  4BRK A;  3ISN C;  4KRE A;  3OYI A;  3QML A;  4DG1 A;  2E2Q A;  4BC5 A;  3THW A;  1HNW K;  3LWL A;  5AQY A;  1WOQ A;  3FE1 A;  4OKE A;  3CCS N;  3CJ1 A;  3G71 N;  2PFU A;  3J8A A;  4CHY A;  3DLH A;  3VMF B;  1QSY A;  5DM7 L;  4CHO A;  4CZI A;  2YJE A;  4JS5 A;  3RMC A;  3ID8 A;  4CED A;  2IVP A;  1YIT N;  5AR0 A;  1QSL A;  4DCH A;  3LAM A;  3N4P A;  2D0P A;  1E4F T;  4LD0 A;  5EU7 A;  4JI0 K;  4X64 K;  1BCO A;  1ZXO A;  5KPZ A;  2RE2 A;  4YHH K;  3G4S N;  1YJ9 N;  4QAG A;  2EX3 A;  3RMD A;  3OBY A;  3VQC A;  3FLC O;  3O5B A;  4ID5 A;  4A5A A;  1OH8 A;  3NDK A;  4KH6 A;  2Z1I A;  1VQ8 N;  3BDP A;  2NRZ A;  3A5M C;  4CZH A;  4PA1 A;  1SZ2 A;  1CLQ A;  4C8L A;  4DMN A;  4W5O A;  3SBT A;  1HNV A;  1WSH A;  1KAX A;  2GBZ A;  3MDQ A;  1TKT A;  3CF5 L;  4DTM A;  1EP4 A;  1Z6R A;  5M1Q A;  2E20 A;  1FJG K;  1MA9 B;  4LFB K;  1FXX A;  1GOA A;  1K9M O;  5DM6 L;  1JKH A;  3ZEU B;  4LF4 K;  4CIF A;  4JI2 K;  2F9T A;  4PY5 A;  1JLE A;  5AQJ A;  1BDG A;  4YOU A;  1TKX A;  4KB1 A;  1DGK N;  2WC9 A;  5KRS A;  5ADX A;  1IG9 A;  3H3O B;  4IO9 L;  2CH6 A;  4FJK A;  1Q18 A;  4AHR A;  2YI1 A;  3UKU A;  4CGJ A;  4FLT A;  3FZK A;  1TAQ A;  4BRA A;  4BWJ A;  2HHH K;  3VET A;  2IGI A;  1SKW A;  1RBT A;  1NGD A;  3ZSQ A;  4EP5 A;  3KWI A;  3J7Y P;  4GKK K;  4IBN A;  4YNQ A;  3M6G A;  3V1Q A;  3THW B;  4CJP A;  3P83 D;  1BIZ A;  4J2E A;  3OS1 A;  1VSD A;  2Q0R A;  2BGG A;  4FZY A;  1S9E A;  4DR1 K;  2E6M A;  5KPT A;  1JXE A;  3PV8 A;  2ASM A;  1GLF O;  4AHS A;  3CCL N;  2HHU A;  3IKM A;  1BO5 O;  4B9Q A;  2VGN A;  5AQX A;  3PX0 A;  1X1P A;  1OH5 A;  4W5R A;  1NGA A;  5K14 A;  3UIQ A;  3QIC A;  4BG9 A;  2KFN A;  3DOL A;  4BDP A;  1SKR A;  1KAZ A;  2HNZ A;  3EKU A;  3NH0 A;  4JI8 K;  3QFU A;  3MAQ A;  1NGF A;  2Q3S A;  2H3G X;  3O3F A;  5A2Q O;  2W42 A;  4DR6 K;  3MXI A;  4BRH A;  2ZGZ A;  3O8M A;  1YI2 N;  2OTJ N;  2FSK A;  2E8A A;  2D4W A;  2W6K A;  1S6P A;  2JWK A;  5M1N A;  2Z1J A;  1GLJ O;  3P4I A;  4IWV A;  3TTC A;  1QZ6 A;  1U4B A;  1HX1 A;  4HVJ A;  2XRI A;  2R7Y A;  1S1T A;  3FGU A;  5CE3 A;  4DFK A;  4H4O A;  3VPZ A;  1ESV A;  5AQG A;  3N4Q A;  1OKJ A;  4YDU C;  4DR3 K;  4RW7 A;  3MCP A;  5JS1 A;  1GLC G;  3H3N O;  2KFZ A;  5C0Y A;  4QS8 A;  4FYD A;  2NRW A;  4KHQ A;  5BRH A;  3D45 A;  4AHT A;  4BE0 A;  4CVN E;  5I42 A;  3HPO A;  4FVU A;  1ASW A;  4XH5 A;  3UKU B;  1Q8I A;  3DYA A;  3L6Q A;  3L2R A;  4JS4 A;  1OVQ A;  5LL6 Z;  3LDP A;  5AQW A;  3KLH A;  1J5E K;  2YKM A;  2UYT A;  1LCU A;  1QS4 A;  4DFM A;  3UKR A;  3ZYY X;  4F8R A;  1JLB A;  1IBK K;  4I2P A;  1NKC A;  4J2B A;  4E3S A;  3OJU A;  4B9U A;  4BGA A;  2HST A;  4CGF A;  1IBM K;  3VEY A;  4EAH D;  4BRG A;  4E7J A;  3TAM A;  3O80 A;  4DV7 K;  4WQ5 C;  4KHY A;  5JVG L;  2XO7 A;  1EX4 A;  5CZ2 A;  1J9A A;  4FK4 A;  4ELV A;  3C6T A;  4O0J A;  2D1K A;  3DMJ A;  4NCA A;  3ZET A;  4HHT A;  3NVK A;  1GLL O;  3WXK A;  5E84 A;  5HBM A;  4Z4G A;  1WSG A;  1BIS A;  4CES A;  2A5X A;  3IG1 A;  2QW9 A;  2CGJ A;  4FW1 A;  3ZLJ A;  4DTJ A;  4LF5 K;  3LPU A;  3AVF A;  3KZB A;  2WUS A;  3O9Q A;  4DSL A;  4BRE A;  5CR4 A;  1ZC6 A;  5AQM A;  2XHB A;  4CFA A;  2V7Y A;  4HUF A;  2ITG A;  4ZTJ A;  1RDB A;  1D5A A;  3DAW A;  3KWG A;  2GTD A;  1NGE A;  3QIN A;  1C6V A;  4CJ7 A;  3TSP A;  4OX9 K;  1NK4 A;  4HUG A;  4YOR A;  2D0C A;  4H5R A;  4DV1 K;  1KC8 O;  4CCH A;  3EZ5 A;  4CJ3 A;  2HNY A;  4U7B A;  3EE8 A;  4WCE L;  4BVP A;  3L2W A;  4DLG A;  4MQ3 A;  3VQP A;  4DV2 K;  1S1U A;  1X9S A;  4ZHR A;  5AQK A;  2O4I A;  1JCE A;  3DRS A;  3HPG A;  4GV3 A;  3U6F A;  2E2P A;  1KQS M;  3UKR B;  1WLJ A;  3MEC A;  4JD2 A;  2QEX N;  2OA8 A;  1X3M A;  3SUN A;  3QEV A;  2HMP A;  3VGL A;  4CBW A;  2PYJ A;  3OVN A;  2OZM A;  4PKG A;  4JRQ A;  4FPB A;  2BUP A;  3NF7 A;  4B9V A;  3JXU A;  3AO2 A;  1BU6 O;  1T6D A;  1WUA A;  3T1A A;  4DR7 K;  1NGB A;  3ATU A;  1RT3 A;  4DSJ A;  3CHW A;  3TU5 A;  1EQY A;  3CYM A;  3AVM A;  4GVM A;  4DF4 A;  3WQT A;  3ZET B;  5IWA K;  4I9Q A;  1YF5 L;  4IOA L;  3L0Q A;  1S1V A;  1CZB A;  1NGG A;  2UU9 K;  4BG8 A;  5I3U A;  2AA4 A;  1WAF A;  5JLF A;  4DV5 K;  3QNN A;  3TAR A;  3CJ7 A;  2VQF K;  2F9W A;  4KPY A;  4KKO A;  3HXM A;  4JAX A;  5HRN A;  3WT0 A;  4CE9 A;  2FF6 A;  3VA0 A;  5DK5 A;  3ZT1 A;  3VF4 A;  1VSJ A;  1GOC A;  3ZT3 A;  2CH5 A;  5CHI A;  1T03 A;  4HTL A;  4DR4 K;  1Z05 A;  3AGK A;  5BPN A;  4BAC A;  1RNH A;  3C6H A;  5BPL A;  4OJR A;  4CJK A;  2Z1G A;  4KHP K;  5BRE A;  4C1N I;  3K5L A;  1C0F A;  3P5J A;  3HM9 A;  2XY7 A;  4IG3 A;  2P5O A;  1V4T A;  1TV6 A;  3K57 A;  4KRF A;  4CBU A;  4FM2 A;  1VQN N;  4BRN A;  3NMU A;  4QOZ B;  4HCB A;  4DR5 K;  5C12 A;  4JKB A;  4JKG A;  1WSJ A;  4AH9 A;  4B3T K;  3S41 A;  5AQI A;  1S5J A;  1RTD A;  5FDL A;  2Y1J A;  4Z4I A;  3GOI A;  2VWJ A;  4JKH A;  3M8S A;  1U48 A;  1RDA A;  4FJI A;  4FOI A;  4LF7 K;  1CZ9 A;  2P9U A;  3ZT0 A;  4YOX A;  2DFE A;  1RDU A;  2ETJ A;  4H0T B;  4YDU A;  5J2N A;  4ELT A;  1IJJ A;  4JD2 B;  5SZT A;  3P39 A;  2VWB A;  3LP1 A;  4HCC A;  3K58 A;  2QXL A;  1MWM A;  3D2E A;  1IKX A;  4FM0 A;  3VQ6 A;  3LAN A;  1NOZ A;  3T1Y K;  2YNF A;  4DTN A;  4CZF A;  4FXD A;  2O8B A;  1D4X A;  1HKB A;  1BOT O; 
#chains in the Genus database with same CATH homology
 3QML A;  5AQN A;  5AQO A;  4O8K A;  1SS6 A;  3U9Z A;  4JK7 A;  4FWP A;  2E2Q A;  2V52 B;  4BC5 A;  5AQQ A;  5AQY A;  2E1Z A;  1M90 O;  4UY8 O;  1WOQ A;  2FLO A;  2Q2R A;  5B8H A;  5BRF A;  3FE1 A;  4GV6 A;  4CZJ A;  3VEN A;  5FPM A;  3CCS N;  4BRI A;  3CJ1 A;  3G71 N;  3VF6 A;  2IIR A;  2PFU A;  1NGH A;  3E1Y A;  3J8A A;  4JKC A;  4WQ5 A;  4WFN L;  3BF3 A;  2YHY A;  3VMF B;  1V4S A;  5DM7 L;  4JKF A;  4CZI A;  2YJE A;  1T6C A;  5KQ8 A;  3ID8 A;  5LJV A;  2IVP A;  1YIT N;  5FPE A;  5MLC Q;  5AR0 A;  3CCR N;  4DCH A;  3N4P A;  2D0P A;  1U2V B;  3TPQ A;  3TTD A;  4CZL A;  1E4F T;  4Z94 A;  2HBM A;  3O9S A;  3MX2 A;  5GIN A;  1ZXO A;  5KPZ A;  2RE2 A;  3G4S N;  1YJ9 N;  4GNI A;  5C10 A;  4FO0 A;  1TUY A;  2NRV A;  4CZM A;  4KH4 A;  3ZX0 A;  2KHO A;  3OBY A;  3LDQ A;  1X9J A;  2YCH A;  3K9K A;  3CXC M;  4FWN A;  3J7Z O;  3FLC O;  3O5B A;  5KQD A;  4G9Z A;  4A5A A;  1NGI A;  5JVH L;  4KH6 A;  1VQ8 N;  3BEX A;  4BRC A;  2NRZ A;  4BQZ A;  4WYB A;  3A5M C;  4B1Z A;  4CZH A;  4NLB A;  1W2B M;  5AQS A;  1SZ2 A;  3AGR A;  1SAZ A;  3B8A X;  3SBT A;  3CC4 N;  3CME N;  1KAX A;  3A8Y A;  3MDQ A;  4JKG B;  5EXW A;  3CF5 L;  4ISF A;  1Z6R A;  3KK7 A;  5M1Q A;  2E20 A;  1MA9 B;  1KXP A;  3NVM A;  3CCV N;  3GG4 A;  3SJH A;  4JEP A;  5AQF A;  4C23 A;  4PKI A;  4DQ8 A;  1YJN N;  2VYP A;  1K9M O;  3VEO A;  5DM6 L;  1DKG D;  3LM9 A;  3SBG A;  2WFB A;  3ZEU B;  5C2F A;  2P9U B;  3A5O C;  2F9T A;  3KHY A;  1DT9 A;  1NMD A;  3M5R A;  4RTF D;  4DB3 A;  1C0G A;  5GAE P;  3ATV A;  3CCU N;  5AQJ A;  1BDG A;  5H1S Q;  4YOU A;  2KLA A;  1DGK N;  2WC9 A;  2W40 A;  4AM6 A;  3VTH A;  5ADX A;  1U6Z A;  4H5T A;  1NJI O;  2ITM A;  1R59 O;  3ZX3 A;  1S3X A;  2GWJ A;  3H3O B;  3IUC A;  3QBW A;  1BA1 A;  2CH6 A;  3VEV A;  2Q36 A;  4CD3 A;  1Q18 A;  4IO9 L;  3H6E A;  3WXI A;  4ILJ A;  4DKW A;  4CZK A;  2YI1 A;  4WFA L;  3UKU A;  3C7N B;  1VQ5 N;  1VQ6 N;  3R1X A;  3VER A;  4A61 A;  5C15 A;  4MDB A;  4BRF A;  4H5N A;  1GLE G;  3FZK A;  5AQU A;  5M1P A;  3K9J A;  1VQ9 N;  1VQ4 N;  4BRA A;  4MO5 A;  3VET A;  4K41 A;  2QWN A;  3HTV A;  5EY4 A;  1P90 A;  3HBT A;  1ATN A;  3CPW M;  1NGD A;  4FWQ A;  4PKH A;  3KWI A;  5AZI A;  3H46 O;  3CCM N;  3M6G A;  5F2R A;  4WFB L;  5KPR A;  3O4W A;  4I6M A;  4YOT A;  1VQK N;  1VAZ A;  4JNE A;  3C0B A;  1T3V A;  1GLD G;  1MWK A;  4BRD A;  2W41 A;  5ADX H;  1P8Z A;  1TYQ A;  2Q0R A;  4QS9 A;  2GEM A;  4GV9 A;  2HF3 A;  5KPT A;  2ASM A;  4ILG B;  1GLF O;  3MCA B;  5F0X A;  3CCL N;  3C7N A;  1BO5 O;  3IKM A;  2VGN A;  4QS7 A;  3TSQ A;  3ZX2 A;  4B9Q A;  5AQX A;  1O13 A;  3CIP A;  3TSU A;  3I55 N;  1VQ7 N;  1NBW A;  2YX6 A;  3UE5 A;  3CC7 N;  4BRM A;  1NGA A;  2NNW A;  2Q1N A;  3CJ9 A;  1QVF M;  4BY9 C;  4IOX A;  4EIA A;  2Q31 A;  1M1K O;  2P9S A;  3QIC A;  4BG9 A;  3FZH A;  4BRO A;  2A6A A;  1KAZ A;  3SMP A;  4B1Y B;  3EKU A;  3MX5 A;  2HOE A;  3QFU A;  4O5F A;  5EOY A;  3U4L A;  2ZJR L;  1NGF A;  3OHR A;  3U8X A;  2QWP A;  2P9K A;  4GVE A;  4H0Y B;  3HI0 A;  2DPN A;  2P9P B;  4H0O A;  1SQK A;  3FZL A;  3GDQ A;  4KBO A;  3DXM A;  4Y0W A;  1HPM A;  2H3G X;  5AFU A;  1QQM A;  4YOY A;  4L3Q A;  1ILY A;  1QVG M;  2I7P A;  1XC3 A;  2FF3 B;  4NLC A;  1QHA A;  3I33 A;  4BRH A;  2ZGZ A;  2QM1 A;  2QWO A;  3O8M A;  3QFP A;  3P31 A;  4IEI A;  4YOW A;  3PIO L;  2F7T A;  1YI2 N;  2PBD A;  2OTJ N;  3M3Z A;  2FSK A;  2E8A A;  3O1W A;  2D4W A;  3WXJ A;  3A5L C;  1VQL N;  5FPN A;  3I56 N;  4CD1 A;  2JWK A;  5M1N A;  1IG8 A;  5JIC A;  1GLJ O;  3P4I A;  4IWV A;  3TTC A;  4H5W A;  1QZ6 A;  1ATR A;  1HX1 A;  2NRX A;  3ID6 A;  4BC2 A;  1YIJ N;  4A59 A;  4GY2 B;  4B1U B;  3FGU A;  5CE3 A;  5C2D A;  2ASO A;  3VPZ A;  2JWL A;  4WQ4 C;  1ESV A;  1G99 A;  4BGB A;  5AQG A;  3N4Q A;  4JN4 A;  1YAG A;  4R79 A;  1Y64 A;  3WEE B;  3WXM B;  1GLA G;  1OKJ A;  3EO3 A;  4YDU C;  1Q86 O;  3MCP A;  2P9P A;  3W0L A;  4B1V A;  1GLC G;  3H3N O;  3E9O A;  3QDK A;  5AFU H;  3VEX A;  4IJN A;  5C0Y A;  5M1O A;  4QS8 A;  1DEJ A;  4JHD A;  1KD1 O;  2NRW A;  3MMV A;  5EX5 A;  5BRH A;  3CCE N;  4IOC L;  3AAP A;  3LDO A;  2QWQ A;  1HJO A;  1NGJ A;  2A41 A;  4JKA A;  1EO1 A;  3F9M A;  4FVU A;  5TKW A;  4H0X B;  4XH5 A;  3UKU B;  5LJW A;  4FWR A;  3L6Q A;  3CI5 A;  1NWK A;  3ULE A;  4BR2 A;  3LDP A;  5AQW A;  4XH1 A;  4M7Y A;  4FSV A;  2UYT A;  3D2F A;  1ZBS A;  4JKE A;  1LCU A;  3A5N C;  3BF1 A;  3QB0 A;  3UKR A;  2FXU A;  1BA0 A;  3ZYY X;  5AZI B;  4O8U A;  4RCH A;  4CI6 A;  4EFH A;  3HOT A;  2NRT A;  3E66 A;  3WEE A;  3E9L A;  3H1Q A;  3JS6 A;  4I6M B;  1W97 L;  4BGA A;  4CZE A;  2HST A;  5TKY A;  4BR4 A;  5GAH P;  3VEY A;  4JKD A;  5AQV A;  1TYQ B;  4EAH D;  4BRG A;  3O80 A;  4WQ5 C;  4XEI A;  5JVG L;  5JMV A;  1BG3 A;  2EWS A;  2FSN A;  3SLC A;  1H1V A;  4C1N K;  2GWK A;  3GBT A;  1VQO N;  3LDN A;  3OA9 A;  5EVZ A;  3CPE A;  3D6R A;  3O08 A;  1YVN A;  4JK9 A;  4MO4 A;  1JCF A;  1RDW X;  2D1K A;  4FWS A;  5LY3 A;  3ZET A;  2HBJ A;  3NVK A;  1BWF O;  1CZA N;  2E1Y A;  2P9S B;  1GLL O;  3WXK A;  1KAY A;  5E84 A;  2QTD A;  1VQP N;  2ASP A;  4FOE A;  1MDU B;  4A2B A;  3H1V X;  1QQO A;  4PL7 A;  3R9P A;  2KKZ A;  2RHK A;  2A5X A;  4IZ9 A;  2QW9 A;  2P9L B;  2QWM A;  2CGJ A;  2NLX A;  2P9K B;  1NM1 A;  1K73 O;  3FFK B;  1GLB G;  3DXM B;  3OW2 M;  3G6E N;  5AQR A;  1LOT B;  5BRD A;  3KZB A;  3O1B A;  3R3L A;  3VOV A;  2WUS A;  4IDH A;  3MK6 A;  3O9Q A;  2D0O A;  2HF4 A;  5GIO A;  4FWL A;  4M7X A;  4BR7 A;  2YHW A;  3SAG A;  3PLA A;  5BN8 A;  2A42 A;  3A0I X;  4BRE A;  1NGC A;  5CR4 A;  4BR0 A;  1JCG A;  1ZC6 A;  5AQM A;  2A3Z A;  2VCP A;  2V7Y A;  2OTL N;  2IVN A;  5E26 A;  4KH5 A;  3CCQ N;  4JK8 A;  3DAW A;  3GE1 A;  2E2O A;  5M1K A;  3OBW A;  3KWG A;  2E88 A;  3P38 A;  5BPM A;  2QI2 A;  4BRP A;  2GTD A;  1NGE A;  2OAN A;  3D7E O;  4ISG A;  4PL8 A;  4AM7 A;  2P9N A;  3MN7 A;  3MN6 A;  4CJ7 A;  1K8A O;  5AQH A;  3TSP A;  1HUX A;  3MWT A;  4YOV A;  1HKC A;  4NB4 A;  2P9L A;  3VEZ A;  3O6W A;  2NZT A;  3RSE A;  1YJW N;  4YOR A;  3DLL L;  3EL2 A;  4EHT A;  4A5B A;  3VTI A;  3BUZ B;  4H5R A;  2P9I A;  4MLH A;  1KC8 O;  4JHD B;  1RFQ A;  4OO1 J;  2CGL A;  2J4R A;  5AQP A;  1X3N A;  3DXK B;  4M63 C;  4BC3 A;  2NRH A;  3T69 A;  5GIP A;  4U7B A;  3EE8 A;  4WCE L;  2QWL A;  3W3D A;  4BVP A;  1OVY A;  3EZW A;  2HBL A;  4IJA A;  2CGK A;  3MWP A;  3HM8 A;  3GL1 A;  4DHY A;  5GAG P;  1NLV A;  3ULE B;  3CD6 N;  4FL9 A;  3G25 A;  1E4G T;  1BUP A;  1ATS A;  5AZJ A;  1Q7Y O;  5AQK A;  3D2F B;  1JCE A;  5F1X A;  4NO7 A;  4GV3 A;  2ZJP L;  2E2P A;  4CBX A;  2HBK A;  3UKR B;  3O9U A;  3IMX A;  3WXL A;  4JD2 A;  1Q81 O;  1KQS M;  2BH1 A;  2QEX N;  4AF1 A;  1VQM N;  3RVC A;  5M1F A;  5GAD P;  4ILH A;  1X3M A;  3M1F A;  4IEE A;  4H5V A;  3HRG A;  2HMP A;  4FWM A;  1K8K A;  3VGL A;  4CBW A;  4IFE A;  3VGK A;  4FPA A;  3ENH A;  4PKG A;  1QZ5 A;  3DXK A;  4FPB A;  2BUP A;  3CQX A;  3AY9 A;  3JXU A;  5I9E B;  1BU6 O;  1T6D A;  1WUA A;  4MLE A;  4BRQ A;  3AAQ A;  1NGB A;  3ATU A;  3CHW A;  3LL3 A;  1EQY A;  2V7Z A;  5ELZ A;  3TU5 A;  3LDL A;  3VEW A;  4BC4 A;  1XUP O;  4H0V B;  3WQT A;  3ZET B;  3MN5 A;  4CZG A;  3FZM A;  1YF5 L;  4IOA L;  3L0Q A;  3LM2 A;  1TUU A;  3VGM A;  1YHQ N;  1YUW A;  2WBN A;  1NGG A;  4BG8 A;  3C65 A;  2BTF A;  2AA4 A;  5JLF A;  3CJ7 A;  4B1W B;  1S22 A;  2F9W A;  2GUP A;  5AQT A;  4PHT X;  4F9O A;  3EKS A;  3Q7B A;  3CCJ N;  4FWK A;  2A40 A;  2E2N A;  4JAX A;  3ENO A;  3WT0 A;  2V51 B;  2FF6 A;  2VGM A;  4RWT A;  3AAR A;  3CET A;  2NRR A;  4K43 A;  1U2V A;  3CQY A;  2CH5 A;  3HSC A;  3VF4 A;  3WQU A;  4BR9 A;  5CHI A;  4HTL A;  2QA4 N;  5HOO A;  4U67 L;  1HKG A;  4OPA A;  3CC2 N;  2Q97 A;  2FSJ A;  4LC9 B;  3IFR A;  1Z05 A;  4A2A A;  3AGK A;  3VF2 A;  5BPN A;  2Q0U A;  3MN9 A;  2PAV A;  3SAF A;  3C6H A;  4BR5 A;  5BPL A;  2AP1 A;  1Q82 O;  4BVO A;  3SK3 A;  4K25 A;  4C1N I;  5BRE A;  1C0F A;  3CER A;  3E9P A;  3HOS A;  1S72 N;  1V4T A;  1YXQ A;  4BRL A;  1HLU A;  4CBU A;  5BR9 A;  3EN9 A;  3O9T A;  2P9N B;  1VQN N;  4BRN A;  3NMU A;  4WF9 L;  3VES A;  5C12 A;  2YHX A;  3T7Z A;  3FZF A;  3CJA A;  3L4Q A;  3F5T A;  4JKB A;  3RSE B;  3D2E B;  4JKG A;  5AQL A;  2ZJQ L;  4XH4 A;  3EE9 A;  2P9I B;  3F2K A;  4A57 A;  3QBX A;  3S41 A;  4MDA A;  5AQI A;  3HZ6 A;  1T44 A;  3SMS A;  3TTF A;  3GOI A;  4HWI A;  2ZF5 O;  4JKH A;  4ISE A;  3PIP L;  5HL7 L;  1QQN A;  3H45 C;  4FOI A;  4K42 A;  2ZWH A;  3ZEU A;  3IDH A;  2P9U A;  3R6M A;  3ENB A;  2GX9 A;  4WQ4 A;  4YOX A;  1RDU A;  3DJC A;  3KVG A;  4H0T B;  5BN9 A;  3WUH A;  4YDU A;  5AZJ B;  1JJ2 M;  3DWL A;  2GEL A;  1IJJ A;  2QWR A;  2IVO A;  4JD2 B;  4A62 A;  3SAH A;  4B1X B;  2I7N A;  3P39 A;  3O9R A;  2VWB A;  4OPH A;  4H03 B;  4EHU A;  1RGI A;  4IO8 A;  4E1J A;  4BQL A;  2QXL A;  1MWM A;  3D2E A;  4IXC A;  3U9D A;  4J8F A;  3C6A A;  5FPD A;  5JLH A;  3I8B A;  3Q7C A;  3R8E A;  3UB5 A;  1K8K B;  3BP8 A;  4H0P A;  3L4I A;  1J6Z A;  2YJF A;  4FWO A;  5AQZ A;  1XQS C;  4CZF A;  3CMA N;  1D4X A;  2ZGY A;  3CJB A;  1HKB A;  1N8R O;  3FR0 A;  4BRK A;  3CJC A;  1BOT O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...