1RBVA

Structural study of mutants of escherichia coli ribonuclease hi with enhanced thermostability
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADAKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE H
publication title Structural study of mutants of Escherichia coli ribonuclease HI with enhanced thermostability.
pubmed doi rcsb
source organism Escherichia coli
total genus 52
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rbvA00
1WAJA 4Z4GA 1W9HA 3OJSA 3AA4A 1RT5A 2NUBA 3ASMA 4CFCA 3KTQA 4AHRA 1FKPA 2R7YA 3DOKA 4DTPA 3SPZA 4WE1A 3L2RA 1G15A 3CM5A 3F9KA 2WONA 4I9QA 2X6SA 2DTUA 1QQCA 3ZSOA 4CJQA 1QSSA 4KPYA 1VSHA 1B9FA 1U48A 3QETA 4CJRA 3HL8A 4HHTA 1J9AA 1ASVA 4CERA 1T05A 3OS2A 2I5JA 4E1NA 3SV3A 1FK9A 1UOCA 2FBVA 4PY5A 2X78A 4F3TA 4M41A 1RBSA 3E01A 4H8KA 2KZMA 1W0HA 3DM2A 2Z1HA 3LPTA 1S6PA 5FROA 4W5OA 4LY7A 3SUPA 3AA2A 1ZBLA 1N5YA 2DFFA 3AA3A 3DLGA 2Y1IA 2E4LA 1KFDA 4J2EA 3MEDA 4B9SA 3G0ZA 1C6VA 1WSEA 4CIFA 3KJVA 2O4IA 5E41A 3K59A 4LSNA 3U3GA 4CIEA 3DLHA 3KK1A 1CLQA 1O1WA 4N56A 3L2VA 5EU7A 4M3ZA 2XRIA 1HQEA 4DSKA 2KQ2A 2YNGA 3O3GA 4CFBA 4B08A 2VG5A 4DQQA 1RBRA 1TKTA 4DSFA 3V1OA 1ASUA 3QNNA 4DS5A 5JS1A 4HUEA 5CY4A 1T7PA 1IG9A 2XY7A 2XY5A 1S9EA 3M8RA 1HMVA 3AVCA 3DRRA 3NH1A 5SZTA 1BQMA 4IFVA 3DYAA 3LP0A 4N41A 3LAKA 2IS3A 3AVNA 1ASWA 1XWLA 1L5UA 4AHVA 4LH5A 3HVTA 3NF6A 3TARA 4E7LA 4CF2A 3AVMA 3QO9A 3VQ7A 3LPUA 5KRSA 5J2MA 1BL3A 4C8NA 1TGOA 1NOZA 3SYZA 4J2BA 1TK5A 3CG7A 3S9HA 1BGXT 3JYTA 1KRPA 4KB1A 1JL1A 3ITHA 1JKHA 3LP3A 1ITGA 1J5OA 4KB0A 3V9SA 4FZZA 2YHAA 3DLRA 3O4QA 5DMRA 3NGZA 1BHLA 1S9GA 3DRSA 3AO5A 2HMIA 1BIZA 2ATQA 1KVBA 3AVAA 3NAEA 3TAFA 3B6PA 3L3UA 1KLNA 2HHQA 2AJQA 1RT3A 2YV0X 3VA3A 1T8EA 4FJKA 1CXUA 4IBNA 2IAJA 2WOMA 4FM0A 3PY8A 3HVRA 2ZE2A 4CESA 4E7KA 4IDKA 4DU4A 3H08A 3RR7A 3D45A 2BGGA 4RW4A 2A1SA 1YTUA 2Z1IA 4CECA 4B9LA 4FLZA 2HNDA 5C25A 1SKSA 1JLFA 3T3FA 1TK8A 4DQSA 3HJFA 3NFAA 3EYZA 3VQPA 4JRPA 3C94A 1SL2A 3OYCA 2G8KA 4I9LA 3CQ8A 4AILC 4ELUA 1SKWA 4W5NA 4C8LA 2HNYA 3MXMA 2YNHA 3VQQA 3L2UA 1HNIA 4JRQA 4E7JA 4E7IA 2P5OA 4Z4EA 4CJPA 1QE1A 1L3TA 4F4KA 4KTQA 4FK4A 4CK2A 1Q9YA 4KKOA 3KLFA 1I39A 3K2PA 4DLGA 1D9FA 3DMJA 4KFBA 4B9UA 1U04A 3OJUA 2HHTA 1HPZA 2QKBA 1KVCA 3CM6A 2D0CA 1J54A 2JGUA 4CF9A 4BDYA 2VWJA 1HRHA 1UA0A 1IKVA 1CZBA 3OYMA 5KTQA 4RW9A 1RDBA 3LANA 1NKBA 1NK7A 4JLHA 4DTNA 1LWCA 2GBZA 4FLUA 3HYFA 4CHPA 3PX4A 4Q0BA 2DFHA 4CGFA 4KI6A 1TAUA 3RRGA 3K5LA 3FFIA 1IO2A 3LZIA 2QK9A 1GOAA 4DTXA 2Z1JA 4FM1A 4KHYA 5I42A 3HT3A 2Y1JA 4DTSA 1A5WA 1WNSA 3S3MA 4EZ6A 2OZSA 4CF0A 4J2DA 3VQ9A 3ZSZA 4Y1CA 1XHZA 4F8RA 4N76A 4EP5A 4ZTFA 3SNNA 4N5SA 2IOCA 1Z25A 4DQIA 3PUFA 4LD0A 4DQPA 2D0BA 3TWHA 4AHUA 5HROA 1JLCA 4CEAA 4Z4FA 5HRNA 3V9XA 3OYEA 4FJHA 3U6FA 4F2RA 1JLGA 4CJSA 4Z4HA 5HRPA 4M3WA 1A5VA 1SV5A 3OYNA 1IKWA 3CYMA 2XO7A 3QLHA 1R0AA 2PZSA 4E19A 2IDOA 3AVKA 3ZSXA 3L2QA 1EKEA 5DK5A 4FJ8A 2G8IA 1RT6A 2RN2A 1RTJA 3KIOA 4RW8A 3VQ6A 4BDZA 1TKXA 4K8ZA 1UAXA 3AVFA 3LDSA 3LP1A 5CZ2A 1WSHA 3THVA 3KLHA 1WN7A 5SWMA 4K8XA 3NF7A 3I0SA 1BCMA 3IS9A 4CHYA 2E6LA 3SQ0A 3HP6A 5J2PA 3OY9A 3U3YA 1SKRA 4OJRA 3AA5X 3V4IA 4B9VA 1TK0A 4FM2A 5CYQA 1TL1A 1NK0A 1LWFA 1VSDA 3LP2A 2G8FA 1SL0A 3ZT4A 1S5JA 4BE0A 3SZ2A 5CZ1A 1TL3A 4IFYA 4CGDA 3KLGA 3SUNA 4O5BA 4PA1A 1VRUA 2BE2A 2YKMA 1RT7A 4CK1A 1B9DA 3T1AA 4CGGA 3OVNA 3ZSYA 3CFPA 1L3UA 3QEWA 1KSPA 4IG3A 3SQ4A 4NCGA 1MU2A 2DFEA 1WSJA 1BI4B 3VQ4A 3RTVA 2KZZA 4OVLA 1IKXA 3S3NA 4G1QA 3IG1A 3O3FA 4MQ3A 1L3SA 4KI4A 3QEVA 4HCBA 4C8MA 3ZCMA 4CJ3A 3QIPA 2KTQA 3WNFA 4FK2A 4E89A 4YNQA 2KFZA 3S3OA 1CZ9A 5FRNA 1KTQA 4HUFA 4FJMA 3KD5E 2HVHA 1UWBA 3L2WA 3PV8A 3SV4A 2YNIA 3ZSRA 1I3AA 4O55A 4AH9A 4KV8A 3MAQA 2HW3A 1S1WA 3F73A 2LSNA 4CJ4A 3I0RA 3QEPA 1Q9XA 4N47A 4KAZA 2HNZA 2XHBA 4DQRA 3OYKA 5KI6A 2YHBA 2F8TA 3HP9A 5T7BA 3CFOA 3TAPA 3OS1A 4DTJA 3LALA 3TAGA 3AVGA 4C8OA 4KO0A 3M8SA 5FRMA 1C0MA 2BDPA 1HYSA 4QAGA 3NCIA 1XI1A 4CK3A 3ISNC 5HRRA 3ZT1A 1BIUA 1DLOA 4ICLA 4KREA 1CXQA 5HBMA 3A2FA 4DSEA 4RW6A 2G8WA 3VQCA 3OYDA 3RMBA 2HHUA 3OYAA 4B9TA 2E6MA 3OYFA 2KFNA 1U45A 4FVMA 1NKEA 3HPGA 1KFSA 1BISA 4DTRA 1HQUA 1NK4A 3HXMA 4B9MA 1RDDA 1ZBHA 4H4MA 1NK6A 4DSIA 4B8AB 1QS4A 3HPHA 4FLVA 1WSGA 3V9UA 4CHZA 3NH0A 4FJ7A 3LZJA 4BWMA 3V9ZA 1D5AA 1KLMA 2G8VA 1IKYA 1X9WA 4DFPA 1C1AA 1F21A 4DF4A 1YVUA 2JLEA 4DS4A 1QSYA 3T19A 1S1TA 3AVLA 3OYLA 1TAQA 3EY1A 2OYQA 1RT2A 1JLBA 4CJWA 1JLEA 4E1MA 3SJJA 3HO1A 1NJYA 3K5NA 4FLWA 5K14A 5JS2A 3P83D 1X1PA 4HVJA 2VG7A 3WNHA 2P51A 4CEOA 3DOLA 1VSMA 2FC0A 3WNGA 4C8KA 3C6UA 3OYBA 3RRHA 3SCXA 4B9NA 4YFUA 1BI4A 1VSLA 4CGIA 1WSIA 3HPOA 3RMAA 5I3UA 1HJRA 4M3TA 2HHSA 4UQGA 2QXFA 3NGYA 2DY4A 1RDAA 2YKNA 4CF1A 1VSFA 4CFDA 4FLXA 4KTZA 4DU3A 1BQNA 4Q5VA 4LSLA 4CCHA 3V81A 4W5RA 1RNHA 4CEDA 3NH2A 2EHGA 4OLAA 3VQBA 1TVRA 3UIQA 5HP1A 3K58A 3RMDA 4FJIA 3AVIA 4O4GA 1ZBUA 3IRXA 4W5QA 2A1RA 4HUGA 4E7HA 3WNEA 1N6QA 2W42A 3MECA 4OGEA 4PQUA 3TR8A 3NGIA 4QCLA 5J2NA 1FXXA 2IGIA 4KTWA 3VQEA 3L3VA 3MEGA 4O44A 1Y97A 3G10A 4DU1A 2F96A 3HSTB 4JS5A 4KHWA 2O4GA 1X9SA 2PY5A 4O0IA 4DLEA 4OKKA 3PX0A 4PUOA 3VQAA 3AV9A 3V1RA 4FJJA 4FCYA 1RT4A 2D5RA 5C24A 5J1EA 5KRTA 4CEBA 4EZ9A 4OPJA 3B6OA 1JLAA 4CEFA 2OZMA 4DTMA 3PX6A 3ZSQA 1NKCA 4OLBA 5HRSA 4CGJA 3DLBA 3AO1A 1C1BA 1REVA 3M8PA 4ZTJA 1XC9A 1VSEA 4TSXA 1WAFA 1TKDA 2D0AA 2HVIA 1HYZA 1RILA 2ZQBA 4CJTA 3I8DA 3ULDA 4DG1A 1LAVA 3AO3A 1EP4A 3RMCA 1RTDA 1JXBA 2RKIA 3VQDA 1EX4A 3SPYA 2IC3A 3K5MA 3PO4A 3ZT0A 4F3OA 1RBUA 2PYJA 3SI6A 1YTAA 3AO4A 4Z4IA 3K5OA 4AHSA 1NK5A 1VRTA 4OPKA 4DF8A 1YT3A 4HCCA 1VK0A 3JSMA 3VA0A 4BACA 3M8QA 3LAMA 5KGWA 3C95A 3RWUA 1IH7A 3OS0A 2Z1GA 1X9MA 3NHGA 2P1JA 4DTOA 2ITGA 1NJXA 3IAYA 4F2SA 3V1QA 4QOZB 1LW0A 4BWJA 1S1UA 4O0JA 2OA8A 4KRFA 4E3SA 1LWEA 4BDPA 1DTTA 1RBTA 4AHCA 4FZXC 3O3HA 4L8RB 2YNFA 5FDLA 4FXDA 3K57A 4CJVA 3QIOA 1LV5A 4KHSA 4FJNA 2HHXA 1RDCA 2RPIA 4B8CA 3ZSVA 1D9DA 4NCBA 3MEEA 4OGCA 4M3YA 2ZD1A 4ID1A 1RT1A 4CJLA 1XHXA 5KGXA 1D8YA 4BE2A 4MFBA 1ZBIA 3QNOA 3ZT2A 2Q3SA 1TV6A 4XIUA 3QINA 2F8SA 5D3GA 4Z0UA 1JLQA 1B92A 1S1VA 4NYNA 5C42A 4CHQA 1C0UA 1RTHA 3V6DA 3V9WA 3TABA 1JXEA 4GVMA 4RW7A 4FLTA 2B5JA 3QERA 1QSLA 1C1CA 4IG0A 3CFRA 3SQ2A 4J2AA 4FW2A 1U49A 4RG8A 3DLEA 3AVHA 1A5XA 4CHOA 4DWIA 3SUQA 1EXQA 1BCOA 3KKSA 4CJEA 1NOYA 2G8UA 4FW1A 2GV9A 4CJ5A 4Z4CA 4CE9A 3RR8A 4M42A 4I7FA 2OPRA 2B6AA 1HYVA 2OPPA 3SUOA 4CF8A 3KK3A 4CEEA 2B4JA 4I2QA 1QTMA 5J2QA 2FBXA 2HHWA 1RBVA 1SL1A 4AHTA 2EX3A 4CJFA 3MXIA 1NK8A 4EP4A 4E0DA 1VSIA 3ALYA 3OYGA 3TAQA 1KVAA 4CFAA 4ZHRA 1RCHA 4JS4A 2XY6A 3KK2A 3QEXA 1LW2A 3NDKA 4I2PA 3TAEA 3HK2A 4FJLA 4FJXA 1VSKA 1GOBA 3AVJA 3O4NA 4ID5A 4M3XA 4CIGA 3HM9A 1Z26A 4FJ9A 3QESA 4HTUA 4LH4A 4CJKA 1LAWA 3OYHA 5HLFA 1ZBFA 3BGRA 4NYFA 4CHNA 2VG6A 1L3VA 2RF2A 3DI6A 4M3RA 4CEQA 2X74A 4DFKA 4ELVA 3BDPA 4CJUA 1NJWA 4KHQA 4B3OA 3QEIA 1ZYQA 1KCFA 3OYIA 1C0TA 3DRPA 3OYJA 3VQ8A 1U47A 1T03A 4FJGA 4DMNA 3LWMA 4H4OA 1JL2A 3EZ5A 4DSJA 1SUQA 3PO5A 3AO2A 2KW4A 2FBYA 3SQ1A 2OPQA 3P1GA 1UA1A 2GUIA 4KHUA 4FK0A 2ETJA 1FKOA 1S6QA 3ZT3A 1EETA 4FYDA 3TI0A 3TAMA 1K6YA 4DTUA 1HNVA 3DLKA 2XY8A 4FZYA 3L8BA 4ELTA 3KKRA 1J53A 1WLJA 2HHVA 3VQ5A 4NCAA 4FJ5A 3NBPA 3NF8A 4OKEA 2VWKA 5CYMA 4M45A 4BE1A 3KLEA 3LWLA 1Q8IA 4DFJA 4GMJB 1QHTA 1RTIA 3MXJA 3NE6A 4DFMA 4IKFA 3TANA 2PYLA 4M3UA 1GOCA 2OPSA 1U4BA 4FLYA 3KLIA 3AVBA 2P5GA 3KD1E 1WSFA 3P5JA 2HB5A 4R5PA 3D0PA 1NJZA 2QKKA 1VSJA 4CEZA 1TKZA 3VN5A 4PWDA 4Y1DA 3NF9A 4W5TA 4GW6A 4DSLA 2G8HA 4KHNA 1DTQA 2X6NA 4CGHA 2FBTA 1S1XA 2BANA 1NK9A 3C6TA 3ZSWA 4OKJA
chains in the Genus database with same CATH superfamily
4WYBA 1W9HA 4O8KA 2NUBA 2O8FA 3SPZA 1G15A 2DTUA 1QQCA 3ZSOA 4YOXA 4CJRA 4HHTA 4YOYA 2I5JA 4JK9A 3SBTA 4E1NA 3SV3A 3MN6A 2FBVA 4PY5A 3E01A 4JI1K 1W0HA 2Z1HA 3LPTA 4H0TB 3SUPA 2DFFA 3AAPA 4J2EA 3VEVA 1QVGM 3A5OC 5E41A 4LSNA 1O1WA 4CI6A 3WT0A 4X62K 4CZMA 4CFBA 2QXLA 2GTDA 4B08A 3O9TA 1RBRA 1TKTA 5JS1A 4HUEA 3IMXA 3L6QA 2XY7A 3M8RA 1HMVA 5JMVA 5M1KA 1BQMA 4IFVA 5C2FA 4N41A 2IS3A 1SZ2A 1S22A 3CETA 5KRSA 3QO9A 3VQ7A 5J2MA 1BL3A 3GBTA 1NOZA 3SYZA 2ZJRL 3CG7A 3S9HA 1BGXT 1ITGA 4BVOA 1S9GA 4IXCA 1BIZA 3OHRA 1KVBA 3CQXA 3NAEA 3G25A 2YV0X 3VA3A 3FFKB 1S3XA 3PY8A 4FM0A 3HVRA 3D2FB 4BR2A 4DU4A 1E4GT 3RR7A 4BRCA 3HTVA 4HWIA 4RW4A 3QBWA 4GV9A 1YTUA 1QZ6A 2Z1IA 4CECA 1GLAG 3IDHA 1SKSA 1JLFA 5JVGL 3T1HK 3HJFA 3NFAA 3QICA 4LF8K 3EYZA 4FVUA 3VQPA 4GKJK 5JVHL 4B3MK 3OYCA 1NGHA 4ELUA 2O8CB 4W5NA 2WC9A 4C8LA 4LF4K 5AJ3K 3L2UA 2P5OA 4Z4EA 3CC4N 4KTQA 4CK2A 2HHTA 5FPDA 3ZYYX 3P38A 1HPZA 4IZ9A 3ULEA 2NRVA 2NZTA 3PSFA 1IKVA 3DWLA 4RW9A 3LANA 1NKBA 1NK7A 1JCEA 3EEQA 4DTNA 3P4IA 4FLUA 3HYFA 3KHYA 4EAHD 2DFHA 1TAUA 4BC4A 5AZIB 4CD3A 3FFIA 2QK9A 3LZIA 2Z1JA 5ADXA 3VESA 2Y1JA 1WNSA 2VWBA 3S3MA 2OZSA 4CF0A 3VTHA 4U7BA 4DV7K 4ZTFA 2YHYA 1Z25A 3PUFA 2F4VK 3CMEN 5GAHP 3TWHA 4Z4FA 3FR0A 3J7ZO 3V9XA 4FJHA 3U6FA 1JLGA 4Z4HA 1A5VA 1SV5A 4RWTA 3QLHA 1R0AA 2IDOA 3LDQA 3AVKA 5DK5A 1YAGA 4BDZA 1RTJA 4RW8A 3VEYA 2YJFA 2HBMA 4IJNA 5BN8A 4IOCL 3THVA 5SWMA 3OBYA 1BCMA 2V7YA 3SQ0A 1BDGA 3HP6A 5J2PA 3OY9A 3MN7A 3V4IA 1LWFA 1HNWK 4BE0A 1TL3A 3FZMA 3SUNA 4O5BA 4B9QA 1ZXOA 3T1AA 1Z6RA 3ZSYA 4CJ7A 1P8ZA 4JV5K 4IG3A 2NRZA 4CZJA 4IJAA 1MU2A 3VQ4A 4BRPA 3RTVA 4OVLA 1IKXA 3S3NA 4KH5A 3F9MA 3IG1A 4MQ3A 3QEVA 3WNFA 4E89A 2HOEA 5FRNA 1VAZA 1FW6A 1SAZA 1I3AA 3MAQA 1S1WA 3KWGA 2LSNA 3QEPA 2UUCK 4N47A 2NNWA 3O9RA 2ZF5O 3J7AP 5EOYA 5T7BA 2P9SB 3OS1A 3AVGA 2BDPA 4JHDA 3ISNC 4JI2K 2A42A 3H1QA 3SK3A 3OYAA 1N36K 3BF1A 5HL7L 3HPGA 1KFSA 2P9KB 4B9MA 4KH6A 4H4MA 4DV5K 4DSIA 1QS4A 4FLVA 3IFRA 3V9UA 1DT9A 4H0XB 4DFPA 4RCHA 4CVNE 1S1TA 3CERA 4BRFA 3OYLA 4CW7B 3P31A 2OYQA 1JLBA 1NJYA 2D0PA 4FPAA 3K5NA 4FLWA 1MA9B 5AFUA 4HVJA 2P51A 4C8KA 2A3ZA 3WNGA 3Q7BA 3RRHA 4YFUA 5I3UA 3CJCA 1NBWA 2V52B 2QXFA 4FLXA 2YKNA 1VSFA 3LDOA 4KTZA 1BQNA 5KPTA 5HP1A 1OH6A 3AVIA 1HJOA 1K73O 3CJAA 4B1VA 2UXCK 2WBNA 2QWQA 3NGIA 1XNQK 1FXXA 4O44A 2F96A 4KHWA 3W3DA 2O4GA 3WQUA 4O0IA 1Q82O 5KRTA 4CEBA 3B6OA 1G99A 1XNRK 2OZMA 1NKCA 3WXKA 1YHQN 4ZTJA 1VSEA 2HVIA 3THWA 2Q31A 2E20A 4DV6K 3I8DA 1LAVA 3RMCA 1RTDA 2RKIA 1EX4A 1VQNN 4EHTA 1Z05A 4AHSA 3DLLL 1VK0A 3LAMA 3RWUA 3C95A 1W7AA 1IH7A 4ILGB 3NHGA 1HLUA 2ITGA 1NJXA 5BPNA 3EL2A 1LW0A 5JICA 2OA8A 3D2EA 1P90A 3G71N 2BH1A 4AHCA 4FZXC 4L8RB 4FXDA 3TSPA 2HHXA 1TYQB 3VGMA 4M3YA 2F9TA 1D8YA 5DM7L 1DEJA 2Q3SA 3ZEUB 2F8SA 3DXKB 4BC2A 3CXCM 3UB5A 4NYNA 5AQLA 2QA4N 3THYA 3TABA 3V9WA 4IG0A 1U49A 4AQYK 4RG8A 4FWKA 2CGKA 4DWIA 3SUQA 2G8UA 3MN5A 3AGRA 1NLVA 4CJ5A 3MCPA 4Z4CA 1WBBA 1X9JA 3TTCA 2OPPA 3N4QA 4YY3K 3TPQA 5J2QA 4AHTA 2EX3A 3MXIA 3U8XA 5AQYA 1NK8A 4CFAA 3NVMA 3KK2A 3QEXA 1VQ6N 1LW2A 1T6DA 1NM1A 2O8DB 1EWQA 4RTFD 4LC9B 1VQLN 2NRXA 1Z26A 3QESA 3CIPA 4HTUA 2A6AA 3BGRA 4CHNA 2IVNA 1IG8A 1L3VA 4B3TK 4FOEA 5KQ8A 5M1OA 2P9IB 3QEIA 5AQKA 1C0TA 3DRPA 1V4TA 2YX6A 1U47A 4H4OA 1SUQA 2YI1A 2GWKA 1SS6A 1FKOA 1S6QA 3ZT3A 4FYDA 4FWQA 4YDUC 3E66A 3ZX0A 2HHVA 1WLJA 4CZHA 3CCUN 4Z94A 3HOTA 2VWKA 4I6MB 3LWLA 4JI0K 4DFMA 4CBWA 3TANA 4M3UA 4B3RK 5IT9O 3D6RA 1GLEG 2UUBK 4BRDA 2P5GA 4JAXA 4PKGA 3O80A 2QKKA 5BPMA 4CEZA 4DSLA 2V7ZA 1T3VA 3CJ9A 3LM2A 1N33K 1S1XA 2BANA 4DKWA 4A5BA 2FSKA 2P9NA 4CFCA 4AHRA 1FKPA 2VYPA 2R7YA 4DR3K 3L2RA 5CE3A 4I9QA 2X6SA 1U2VA 4CJQA 1B9FA 5E84A 1BO5O 3QETA 3HL8A 1ASVA 3OS2A 4A2BA 2HBKA 4XH1A 1UOCA 4F3TA 1RBSA 2KZMA 4W5OA 1S6PA 5FROA 3H3OB 4NXNK 4ILJA 3DLGA 1KFDA 3CCJN 4CIFA 3KJVA 1MDUB 2D1KA 4QS7A 4CIEA 1W2BM 1NG9A 3KK1A 4N56A 3L2VA 1NU0A 2XRIA 1HQEA 4DSKA 3MK6A 3G4SN 1VQ9N 4DQQA 2VG5A 4DSFA 3QNNA 5CY4A 1T7PA 1IG9A 2XY5A 1Q18A 1S9EA 2QWLA 3DYAA 3LAKA 3P39A 1VQ8N 1ASWA 1R59O 3HVTA 3TARA 3AVMA 3LPUA 4CZFA 3BZKA 3CCMN 1TGOA 3O9QA 4J2BA 1TK5A 1WOQA 4WQ5C 3CCVN 1KRPA 1JL1A 1JKHA 3LP3A 1J5OA 5EX5A 3DLRA 1BHLA 2HMIA 3AVAA 1OH8A 3B6PA 2HHQA 1TUYA 1RT3A 1GLDG 2VGNA 4FJKA 4LF9K 2A5XA 2IAJA 2WOMA 4F9OA 3U9DA 1BG3A 3VPZA 3LL3A 3H08A 3L0QA 2A1SA 4PL7A 3SAFA 2ASOA 3O8MA 4B9LA 1S72N 5C25A 4JD2A 1TK8A 4QS9A 4JRPA 1FJGK 1SKWA 5M1PA 5GAGP 3VERA 3TSQA 2GUPA 4BRMA 1QHAA 4CZGA 4DHYA 4BRLA 1IJJA 4CJPA 4F4KA 4FWLA 1Q9YA 3VEZA 1D9FA 3DMJA 4KFBA 3OJUA 4GY2B 2QKBA 3CM6A 2D0CA 1J54A 4CF9A 5AQUA 2VWJA 1HRHA 2E2QA 3OYMA 3UKUB 4CGFA 4KI6A 3UKRB 3CPEA 3K5LA 4JKDA 1IO2A 1GOAA 4DTXA 3HBTA 4FM1A 1A5WA 4PHTX 4EZ6A 4DB3A 4Y1CA 1QQNA 4YORA 3BY5A 4EP5A 2RE2A 5C15A 4DQPA 1NJIO 4CEAA 4IWVA 4F2RA 4IO9L 5F0XA 3MMVA 2P9SA 1IKWA 3CYMA 2XO7A 4M7XA 5AQVA 3L2QA 2F9WA 1EKEA 5CHIA 2G8IA 1SQKA 3VQ6A 1TKXA 2GELA 3R9PA 1UAXA 3AVFA 4BR7A 2P9PA 5JLHA 3LDSA 2KLAA 1WSHA 5EXWA 1K8KA 1W97L 3I0SA 3O08A 3IS9A 2E6LA 1NGBA 3OTOK 4OJRA 5FPEA 5CYQA 1VSDA 3KVGA 1SL0A 3ZT4A 3J8AA 4BY9C 2ITMA 4CGDA 4JKEA 3KLGA 2YKMA 4CK1A 1B9DA 4CGGA 4JI4K 3CFPA 5CR4A 1L3UA 3QEWA 1KSPA 4NCGA 1WSJA 1WB9A 1BI4B 2W41A 4KI4A 4HCBA 4C8MA 4CJ3A 4DV1K 4FK2A 1C0FA 1CZ9A 1KTQA 4HUFA 3KD5E 3N4PA 3SV4A 4NB4A 4O55A 4KV8A 2HW3A 3SJHA 3A5LC 2W6KA 3PIOL 2HNZA 3THXB 3B8AX 4JN4A 2O8BB 2YHBA 2V51B 2F8TA 4JYAK 2ZGZA 3TAPA 2OCEA 4DTJA 3LALA 4GNIA 3ENHA 4QAGA 3NCIA 1KAZA 1CXQA 3A2FA 5ADXH 1ZC6A 3GE1A 2QWRA 4B9TA 2E6MA 4FVMA 5AQRA 1V4SA 1BISA 3HRGA 1NK4A 3RSEB 4H0VB 1YVNA 4A2AA 3HPHA 3ENBA 3JS6A 2UYTA 3NH0A 2P9UB 4K41A 5AQXA 3R8EA 3VF6A 5M1FA 3V9ZA 1KLMA 2PAVA 2ZWHA 1IKYA 2BUPA 1X9WA 1C1AA 1OH5A 3A0IX 1C0GA 4DS4A 3GOIA 4NLBA 3AVLA 1H1VA 4FWOA 1RT2A 2FF6A 3SJJA 1VQMN 4FWRA 1HX1A 5K14A 5JS2A 2VG7A 4LFAK 3OYBA 3SCXA 3CC7N 4B9NA 3HPOA 1WSIA 2HSTA 4BG9A 3RMAA 4UQGA 5LJVA 3WXLA 4CFDA 1X3MA 4DU3A 4EIAA 3ZETA 2EHGA 3SLCA 1TVRA 3K58A 1YUWA 3RMDA 4O4GA 4W5QA 1EQYA 4FWPA 2HBLA 2A1RA 1XMQK 3VGLA 1N6QA 2W42A 4NO7A 3KK7A 1J6ZA 5J2NA 2IGIA 1Y97A 3G10A 4DU1A 1X9SA 2PY5A 1XMOK 1HUXA 3SMSA 3VQAA 4FJJA 5TKWA 1T6CA 3VF4A 1NGFA 3F2KA 3WEEA 5HRSA 4OLBA 3DLBA 1C1BA 1Y64A 4WFAL 1XC9A 1RILA 4CJTA 3J80O 3AO3A 4HTLA 3CI5A 3VQDA 2Q1NA 3AO4A 4OPKA 4JI7K 4DCHA 4DF8A 5B8HA 1XUPO 5ELZA 4BACA 1RDUA 3AY9A 3EZWA 3OS0A 4H0PA 4AM7A 2Z1GA 4H5TA 4F2SA 3V1QA 4ILHA 1S1UA 4KRFA 2A40A 3CMAN 1DTTA 2QI2A 4X65K 3O3HA 4JK8A 2E2PA 3O4WA 4KHSA 5C10A 4L3QA 1RDCA 4CBUA 5AQSA 3E9OA 5KPRA 2Q97A 4ID1A 1RT1A 1XHXA 5KGXA 3T1YK 1E4FT 5BPLA 5BREA 1EWRA 4LF5K 4XIUA 3EO3A 3QINA 5AFUH 4Z0UA 1B92A 1X3NA 5C42A 4CHQA 1C0UA 3V6DA 2JWKA 1JXEA 4LFCK 1C1CA 3CFRA 5AQFA 2VQFK 1A5XA 3AAQA 4DR4K 4CJEA 1BCOA 2D0OA 2GV9A 1NGIA 3H45C 4Y0WA 3A5MC 4M42A 4I7FA 2B6AA 4E1JA 3SUOA 1N32K 3F5TA 4BRKA 4CEEA 4I2QA 3O1BA 1QTMA 1ZBSA 2FBXA 2PFUA 4CJFA 5AQZA 2O8FB 2NRWA 4E0DA 3TAQA 3VEOA 4ZHRA 4JS4A 2QEXN 4H03B 3MN9A 3HSCA 5TKYA 1GOBA 4CZEA 4FJ9A 4CJKA 1ZBFA 3QB0A 3GG4A 3BF3A 2E88A 5AQNA 2RF2A 3DAWA 3DI6A 4DFKA 2X74A 3O9UA 4KHQA 3WQTA 4B3OA 3ID6A 2YJEA 3OYIA 4H0OA 4O8UA 4IDHA 5A2QO 3VQ8A 4IOXA 5BR8K 3VOVA 3LWMA 3EZ5A 1JL2A 3H46O 3AO2A 4A57A 1N8RO 3P1GA 3SAHA 2ZJQL 4FK0A 3VTIA 2ETJA 1RFQA 3TU5A 3TAMA 4DTUA 3I56N 1WUAA 3L8BA 4ELTA 1J53A 3NBPA 5KPZA 1QHTA 4CZKA 3H6EA 4H5WA 4FL9A 2OPSA 4FLYA 2GX9A 1WSFA 4M63C 4PWDA 4WFNL 1VSJA 3CCLN 1LOTB 4JEPA 4GW6A 4DUZK 4KHNA 4ISFA 5EY4A 1QQMA 4E7KA 4A59A 3U9ZA 4Z4GA 1HPMA 3KTQA 4DTPA 4WE1A 3F9KA 4WFBL 4KPYA 4OPHA 1T05A 1J9AA 1FK9A 5EVZA 2X78A 4M41A 5BRDA 4H8KA 4MLHA 3AA2A 1OVYA 1Q86O 1BA0A 2Y1IA 1YI2N 4B9SA 3G0ZA 1C6VA 1WSEA 3U3GA 1CLQA 2QW9A 1KAYA 3ULEB 5GAEP 2ZM6K 2KQ2A 2YNGA 2OANA 3FZLA 3V1OA 1ASUA 3WXIA 3E9LA 5AQPA 3E1YA 3O6WA 3AVCA 3DRRA 1HR0K 4MO5A 3NH1A 3FLCO 4XH5A 2VQEK 3LP0A 3MDQA 3WUHA 1L5UA 4MLEA 3NF6A 3IUCA 4CF2A 4E7LA 2GEMA 1M1KO 3PSIA 4KB1A 1LCUA 4KB0A 4FZZA 1HKGA 2YHAA 4B1XB 3O4QA 3SAGA 3NMUA 3AO5A 1TUUA 2O8EA 3I33A 3L3UA 3ATUA 1T8EA 2QTDA 5LMUK 3CF5L 1HNZK 4CESA 4IDKA 1BU6O 3CJBA 2BGGA 1NGAA 2WTUA 4FSVA 4DV4K 4I9LA 4C1NK 3CHWA 3MXMA 2YNHA 4E7JA 4E7IA 1HNIA 1QE1A 5E26A 3HI0A 3D7EO 4PL8A 4FK4A 3KLFA 3K2PA 4CZIA 4BR9A 5H1SQ 4PKHA 5FPMA 2FF3B 1CZBA 3K9JA 4CBXA 5AQQA 4JLHA 1LWCA 4R79A 2ZGYA 4KHYA 4DTSA 3L4IA 4BRNA 3OW2M 1I94K 1YF5L 4J2DA 1VHXA 3R3LA 4N5SA 4JHDB 2HF3A 3C0BA 1JLCA 5HRNA 3OYEA 1HNXK 3DXMB 4MDAA 5HRPA 1Q7YO 3OYNA 3H3NO 5LY3A 4B1YB 2PZSA 4B1UB 4E19A 1DKGD 4DR1K 1RT6A 3KIOA 1N34K 5LMNK 3D2FA 4H5RA 5CZ2A 3ZX3A 1RGIA 3SMPA 3KLHA 4BC3A 3TSUA 4GKKK 4CZLA 2NRHA 3LP2A 4G9ZA 1S5JA 3SZ2A 5CZ1A 2O8CA 4PKIA 2P9UA 2BE2A 4KH4A 1RT7A 1VQ7N 3OVNA 3SQ4A 2DFEA 2KZZA 1KC8O 4GV3A 1L3SA 3ZCMA 2KTQA 3JXUA 1OKJA 4YNQA 2KFZA 4UY8O 5FLXO 4FJMA 3SBGA 1EO1A 2HVHA 1RDWX 2YNIA 3ZSRA 4IO8A 3CCEN 4AH9A 3T7ZA 3F73A 5AZIA 4CJ4A 1Q9XA 1GLFO 2XHBA 4DQRA 3OYKA 4KO0A 3M8SA 5FRMA 1C0MA 3AGKA 1HYSA 2KHOA 2UUAK 1XI1A 4CK3A 5HRRA 1BIUA 1DLOA 2E8AA 4RW6A 2G8WA 4ISEA 3OYDA 2E2OA 3OYFA 3THWB 2KFNA 1U45A 1NKEA 4V19S 1OVQA 4DTRA 1HQUA 1RDDA 1ZBHA 2WUSA 1NK6A 3M5RA 4JNEA 1WSGA 4BWMA 4OX9K 4ISGA 3CPWM 4DF4A 1YVUA 3Q7CA 3I8BA 1YIJN 4E1MA 3HO1A 4JI3K 3P83D 2CH6A 1X1PA 3WNHA 3DOLA 2FC0A 3QDKA 1ESVA 3C6UA 4FWSA 5AZJB 4X64K 2Q2RA 1VQPN 5FPNA 4WQ4C 2DY4A 4CF1A 4CCHA 1NGGA 1DGKN 4LSLA 4Q5VA 3V81A 4W5RA 3NH2A 2VCPA 3UIQA 3THYB 4FJIA 1ZBUA 1BWFO 3IRXA 4HUGA 2P9LB 3QFPA 3CCQN 3MECA 4FOIA 3TR8A 4QCLA 4KTWA 3MEGA 3MX2A 4JS5A 2QM1A 1NMNA 3PX0A 4PUOA 4FCYA 4AF1A 4EHUA 3ENOA 2QWMA 4OPJA 4EZ9A 2Q36A 1HKCA 3PX6A 3ZSQA 4CGJA 3AO1A 4FWNA 1REVA 3M8PA 4BRIA 2YHWA 1HYZA 2ZQBA 3ULDA 3OBWA 4DG1A 1EP4A 2P9KA 1JXBA 4B1ZA 3SPYA 3K5MA 3ZT0A 1RBUA 2PYJA 4WCEL 1YTAA 3K5OA 1NK5A 3EN9A 1VRTA 1MWMA 3R6MA 3JSMA 4IEIA 3M8QA 5KGWA 2P1JA 4DTOA 3IAYA 1IBMK 4BWJA 4O0JA 2I7PA 4E3SA 1LWEA 4CD1A 3C65A 5FDLA 5GIOA 4JKGB 4B8CA 1JCGA 3MWTA 4NCBA 3MEEA 2ZD1A 4AM6A 4BR4A 4MFBA 1ZBIA 1S1VA 1IV0A 4GVMA 2YCHA 2QWOA 2B5JA 3QERA 3DLEA 4K43A 3AVHA 4BR5A 4CHOA 3LDNA 3VEWA 3KKSA 1NOYA 4FW1A 4CE9A 2NRTA 4IEEA 4CF8A 3KK3A 4B1WB 4JI5K 3IKMA 2P9NB 2HHWA 1RBVA 2I7NA 1SL1A 3J7YP 3OYGA 4C1NI 1U2VB 1KVAA 2XY6A 1RCHA 1YXQA 4DR2K 4FJLA 4OPAA 1VSKA 4ID5A 2ZJPL 4M3XA 4OO1J 4CIGA 3M6GA 1LAWA 3OYHA 5HLFA 3K0SA 4NYFA 3CJ1A 2VG6A 4ELVA 2H3GX 3KZBA 3BDPA 3HOSA 1ZYQA 4H0YB 4BQLA 3C7NB 1VQON 1KCFA 2AP1A 3OYJA 3OA9A 4BREA 1XQSC 4DMNA 2JWLA 3O9SA 4X66K 4DSJA 3PO5A 1YJ9N 1NNEA 2FBYA 3FE1A 4KHUA 1EETA 1K6YA 1HNVA 3DLKA 1TYQA 3VQ5A 4OKEA 4M45A 4GVEA 1Q8IA 2OTJN 1ATRA 3ZEUA 4DFJA 4GMJB 3MXJA 3DXKA 2PYLA 3JAMO 1GOCA 3FZFA 3UE5A 4R5PA 2HB5A 2WFBA 1NJZA 2KKZA 3E9PA 4Y1DA 4W5TA 3C6HA 4A5AA 3H1VX 4BROA 2X6NA 3C6TA 4OKJA 1VQ4N 4DV0K 1WAJA 3OJSA 3AA4A 1NMDA 1RT5A 3ASMA 4A62A 3DOKA 4DV2K 3CM5A 2WONA 4JD2B 3T69A 1QSSA 1VSHA 1U48A 2VGMA 4CERA 2O8DA 4YOVA 4DV3K 1XC3A 3DM2A 1IBKK 1N5YA 4LY7A 3LDPA 3AA3A 2E4LA 4LF7K 3MEDA 5BRHA 4YDUA 2O4IA 2W6LA 5GIPA 3K59A 1T44A 2P9IA 3ID8A 5AQGA 3DLHA 4M3ZA 5EU7A 3O3GA 5I9EB 3BEXA 1CZAN 4DS5A 1O13A 5SZTA 4DR5K 3A8YA 3BZCA 3AVNA 1XWLA 5BRFA 4AHVA 4LH5A 2OTLN 4I6MA 4WF9L 4C8NA 3JYTA 3ITHA 3L4QA 3V9SA 5DMRA 3NGZA 3DRSA 3VMFB 2ATQA 4XEIA 3TAFA 1KLNA 2AJQA 5C12A 3I55N 1CXUA 4IBNA 5JLFA 2ZE2A 2P9PB 3D45A 4K25A 2Q0RA 3DXMA 1K8KB 4FLZA 2HNDA 1KD1O 3T3FA 4DQSA 3VGKA 1OH7A 3A5NC 3C94A 1SL2A 2G8KA 3CQ8A 4AILC 2FSJA 4BRGA 3K9KA 2IVPA 2HNYA 4BGAA 4BVPA 3S41A 3VQQA 4JRQA 1L3TA 4IOAL 2QWNA 4KKOA 1I39A 3FZHA 4DLGA 4B9UA 1U04A 1ATSA 1KVCA 2JGUA 4BDYA 1UA0A 1KQSM 5KTQA 4WQ5A 2UU9K 1RDBA 2W40A 2GBZA 4Q0BA 4CHPA 3PX4A 4J8FA 3RRGA 4JKHA 4EFHA 2CH5A 4H5VA 1JCFA 2A41A 4YHHK 5I42A 3HT3A 5LL6Z 2FLOA 3VQ9A 3ZSZA 4F8RA 1XHZA 4N76A 4FPBA 3SNNA 2IOCA 5F2RA 4LD0A 4DQIA 2D0BA 4AHUA 5HROA 5AQJA 3M1FA 4CJSA 3CCRN 4M3WA 3ZSXA 2NLXA 1ATNA 4FJ8A 1E3MA 2RN2A 2AA4A 1YJNN 2E1ZA 4K8ZA 1NGDA 3HZ6A 2CGLA 3LP1A 5AQHA 1YITN 1WN7A 4K8XA 3NF7A 4BC5A 4CHYA 3PLAA 3U3YA 1SKRA 2FSNA 3AA5X 3NVKA 4B9VA 1TK0A 4FM2A 1NK0A 1TL1A 5AR0A 2QWPA 2E5LK 2G8FA 4NLCA 1M90O 4IFYA 4JI6K 4PA1A 1VRUA 1Q81O 4WQ4A 1GLCG 3VENA 3BP8A 3VEXA 4C23A 4BQZA 4G1QA 3O3FA 3CJ7A 3QIPA 3ZETB 3S3OA 2IVOA 2DPNA 1UWBA 3L2WA 5M1NA 3PV8A 4XH4A 5AZJA 4B3SK 3UKUA 2CGJA 2E1YA 3UKRA 3I0RA 4JKCA 3EKSA 4KAZA 3LM9A 5KI6A 1NWKA 3LDLA 3HP9A 4M7YA 3CFOA 5AQOA 3TAGA 4C8OA 4NXMK 1HKBA 1BUPA 2P9LA 3CD6N 4YOTA 3ZT1A 4IFEA 4ICLA 4KREA 5HBMA 3WXMB 3WEEB 5M1QA 4DSEA 3VQCA 3RMBA 3QMLA 2HHUA 1NGJA 3DJCA 3U4LA 2HHHK 4DR7K 4YOUA 3HXMA 4B8AB 4CHZA 4K42A 4FJ7A 3LZJA 4DQ8A 1D5AA 2G8VA 3O5BA 3M3ZA 1F21A 5F1XA 2JLEA 1QSYA 3T19A 1TAQA 3VETA 3EY1A 4CJWA 5LJWA 1JLEA 4BRQA 2RHKA 1YJWN 4CEOA 1VSMA 3CC2N 4MO4A 3TTDA 1BI4A 1VSLA 4CGIA 4M3TA 1HJRA 2HHSA 3NGYA 1RDAA 2EWSA 1NGCA 1RNHA 4CEDA 4OLAA 3VQBA 3PIPL 5AQWA 1NGEA 3W0LA 4JKAA 2Q0UA 4JKGA 1GLLO 4A61A 5DM6L 4E7HA 2HF4A 3WNEA 4PQUA 4OGEA 2HMPA 1MWKA 3THXA 3VQEA 1ZBLA 2PBDA 3L3VA 2O8BA 3HSTB 1QZ5A 3FGUA 4YOWA 4DLEA 4OKKA 3AV9A 3V1RA 2FXUA 1BA1A 1RT4A 2D5RA 5C24A 5J1EA 1JLAA 4CEFA 1IBLK 4DTMA 3AARA 2UXDK 5MLCQ 2GWJA 4TSXA 1WAFA 1TKDA 2D0AA 4LFBK 1BOTO 3RSEA 5BN9A 4JKFA 2BTFA 2IC3A 3BUZB 3J81O 3PO4A 3ZLJA 4F3OA 3SI6A 4JI8K 4Z4IA 1GLJO 1YT3A 4HCCA 3ATVA 3VA0A 1QQOA 4LF6K 4BRAA 1X9MA 5IWAK 2D4WA 2UXBK 5AQIA 5GINA 1VQ5N 4QOZB 5AQMA 1VQKN 4BDPA 4BR0A 1RBTA 2YNFA 3K57A 5C2DA 4CJVA 3QIOA 1LV5A 4FJNA 3C7NA 4DUYK 4GV6A 2RPIA 3ZSVA 1D9DA 1U6ZA 4OGCA 3EKUA 3RVCA 4CJLA 1K9MO 4BE2A 3QNOA 3ZT2A 1TV6A 1ILYA 5D3GA 1JLQA 3MX5A 1RTHA 4FLTA 2E2NA 4RW7A 1QSLA 4J2AA 3SQ2A 4FW2A 3CCSN 3EE9A 3KWIA 1EXQA 5HOOA 4H5NA 4BGBA 4DR6K 1KXPA 5AQTA 3RR8A 4BG8A 4KHPK 2OPRA 1HYVA 2B4JA 1KAXA 2ASMA 3MWPA 2NRRA 1QVFM 3VF2A 4EP4A 1VSIA 3ALYA 4O5FA 2J4RA 3EE8A 3MCAB 3TTFA 3NDKA 4I2PA 3TAEA 3HK2A 4FJXA 3AVJA 3O4NA 3GDQA 3HM9A 1D4XA 4LH4A 4K0KK 3FZKA 3HM8A 2HBJA 3D2EB 4M3RA 4CEQA 3QFUA 1J5EK 3R1XA 4CJUA 1NJWA 1WBDA 1K8AO 4BRHA 2YHXA 3QBXA 1T03A 4FJGA 4FO0A 2KW4A 5C0YA 3SQ1A 2OPQA 1UA1A 2GUIA 2ASPA 3TI0A 4JK7A 2XY8A 4FZYA 3KKRA 3ZX2A 4U67L 5BR9A 3GL1A 4FJ5A 3NF8A 3C6AA 1GLBG 2IIRA 5CYMA 4NCAA 4BE1A 3KLEA 1RTIA 5KQDA 3NE6A 4IKFA 4JKBA 5GADP 4KBOA 1U4BA 3KLIA 3AVBA 3KD1E 3WXJA 3P5JA 3D0PA 1TKZA 3VN5A 3G6EN 3O1WA 4FWMA 2O8EB 3NF9A 2G8HA 1DTQA 3CQYA 1JJ2M 4QS8A 2F7TA 4CGHA 2FBTA 1NK9A 3ZSWA 4MDBA
chains in the Genus database with same CATH topology
1WAJA 4Z4GA 1W9HA 3OJSA 3AA4A 1RT5A 2NUBA 3ASMA 4CFCA 3KTQA 4AHRA 1FKPA 2R7YA 3DOKA 4DTPA 3SPZA 4WE1A 3L2RA 1G15A 3CM5A 3F9KA 2WONA 4I9QA 2X6SA 2DTUA 1QQCA 3ZSOA 4CJQA 1QSSA 4KPYA 1VSHA 1B9FA 1U48A 3QETA 4CJRA 3HL8A 4HHTA 1J9AA 1ASVA 4CERA 1T05A 3OS2A 2I5JA 4E1NA 3SV3A 1FK9A 1UOCA 2FBVA 4PY5A 2X78A 4F3TA 4M41A 1RBSA 3E01A 4H8KA 2KZMA 1W0HA 3DM2A 2Z1HA 3LPTA 1S6PA 5FROA 4W5OA 4LY7A 3SUPA 3AA2A 1ZBLA 1N5YA 2DFFA 3AA3A 3DLGA 2Y1IA 2E4LA 1KFDA 4J2EA 3MEDA 4B9SA 3G0ZA 1C6VA 1WSEA 4CIFA 3KJVA 2O4IA 5E41A 3K59A 4LSNA 3U3GA 4CIEA 3DLHA 3KK1A 1CLQA 1O1WA 4N56A 3L2VA 5EU7A 4M3ZA 2XRIA 1HQEA 4DSKA 2KQ2A 2YNGA 3O3GA 4CFBA 4B08A 2VG5A 4DQQA 1RBRA 1TKTA 4DSFA 3V1OA 1ASUA 3QNNA 4DS5A 5JS1A 4HUEA 5CY4A 1T7PA 1IG9A 2XY7A 2XY5A 1S9EA 3M8RA 1HMVA 3AVCA 3DRRA 3NH1A 5SZTA 1BQMA 4IFVA 3DYAA 3LP0A 4N41A 3LAKA 2IS3A 3AVNA 1ASWA 1XWLA 1L5UA 4AHVA 4LH5A 3HVTA 3NF6A 3TARA 4E7LA 4CF2A 3AVMA 3QO9A 3VQ7A 3LPUA 5KRSA 5J2MA 1BL3A 4C8NA 1TGOA 1NOZA 3SYZA 4J2BA 1TK5A 3CG7A 3S9HA 1BGXT 3JYTA 1KRPA 4KB1A 1JL1A 3ITHA 1JKHA 3LP3A 1ITGA 1J5OA 4KB0A 3V9SA 4FZZA 2YHAA 3DLRA 3O4QA 5DMRA 3NGZA 1BHLA 1S9GA 3DRSA 3AO5A 2HMIA 1BIZA 2ATQA 1KVBA 3AVAA 3NAEA 3TAFA 3B6PA 3L3UA 1KLNA 2HHQA 2AJQA 1RT3A 2YV0X 3VA3A 1T8EA 4FJKA 1CXUA 4IBNA 2IAJA 2WOMA 4FM0A 3PY8A 3HVRA 2ZE2A 4CESA 4E7KA 4IDKA 4DU4A 3H08A 3RR7A 3D45A 2BGGA 4RW4A 2A1SA 1YTUA 2Z1IA 4CECA 4B9LA 4FLZA 2HNDA 5C25A 1SKSA 1JLFA 3T3FA 1TK8A 4DQSA 3HJFA 3NFAA 3EYZA 3VQPA 4JRPA 3C94A 1SL2A 3OYCA 2G8KA 4I9LA 3CQ8A 4AILC 4ELUA 1SKWA 4W5NA 4C8LA 2HNYA 3MXMA 2YNHA 3VQQA 3L2UA 1HNIA 4JRQA 4E7JA 4E7IA 2P5OA 4Z4EA 4CJPA 1QE1A 1L3TA 4F4KA 4KTQA 4FK4A 4CK2A 1Q9YA 4KKOA 3KLFA 1I39A 3K2PA 4DLGA 1D9FA 3DMJA 4KFBA 4B9UA 1U04A 3OJUA 2HHTA 1HPZA 2QKBA 1KVCA 3CM6A 2D0CA 1J54A 2JGUA 4CF9A 4BDYA 2VWJA 1HRHA 1UA0A 1IKVA 1CZBA 3OYMA 5KTQA 4RW9A 1RDBA 3LANA 1NKBA 1NK7A 4JLHA 4DTNA 1LWCA 2GBZA 4FLUA 3HYFA 4CHPA 3PX4A 4Q0BA 2DFHA 4CGFA 4KI6A 1TAUA 3RRGA 3K5LA 3FFIA 1IO2A 3LZIA 2QK9A 1GOAA 4DTXA 2Z1JA 4FM1A 4KHYA 5I42A 3HT3A 2Y1JA 4DTSA 1A5WA 1WNSA 3S3MA 4EZ6A 2OZSA 4CF0A 4J2DA 3VQ9A 3ZSZA 4Y1CA 1XHZA 4F8RA 4N76A 4EP5A 4ZTFA 3SNNA 4N5SA 2IOCA 1Z25A 4DQIA 3PUFA 4LD0A 4DQPA 2D0BA 3TWHA 4AHUA 5HROA 1JLCA 4CEAA 4Z4FA 5HRNA 3V9XA 3OYEA 4FJHA 3U6FA 4F2RA 1JLGA 4CJSA 4Z4HA 5HRPA 4M3WA 1A5VA 1SV5A 3OYNA 1IKWA 3CYMA 2XO7A 3QLHA 1R0AA 2PZSA 4E19A 2IDOA 3AVKA 3ZSXA 3L2QA 1EKEA 5DK5A 4FJ8A 2G8IA 1RT6A 2RN2A 1RTJA 3KIOA 4RW8A 3VQ6A 4BDZA 1TKXA 4K8ZA 1UAXA 3AVFA 3LDSA 3LP1A 5CZ2A 1WSHA 3THVA 3KLHA 1WN7A 5SWMA 4K8XA 3NF7A 3I0SA 1BCMA 3IS9A 4CHYA 2E6LA 3SQ0A 3HP6A 5J2PA 3OY9A 3U3YA 1SKRA 4OJRA 3AA5X 3V4IA 4B9VA 1TK0A 4FM2A 5CYQA 1TL1A 1NK0A 1LWFA 1VSDA 3LP2A 2G8FA 1SL0A 3ZT4A 1S5JA 4BE0A 3SZ2A 5CZ1A 1TL3A 4IFYA 4CGDA 3KLGA 3SUNA 4O5BA 4PA1A 1VRUA 2BE2A 2YKMA 1RT7A 4CK1A 1B9DA 3T1AA 4CGGA 3OVNA 3ZSYA 3CFPA 1L3UA 3QEWA 1KSPA 4IG3A 3SQ4A 4NCGA 1MU2A 2DFEA 1WSJA 1BI4B 3VQ4A 3RTVA 2KZZA 4OVLA 1IKXA 3S3NA 4G1QA 3IG1A 3O3FA 4MQ3A 1L3SA 4KI4A 3QEVA 4HCBA 4C8MA 3ZCMA 4CJ3A 3QIPA 2KTQA 3WNFA 4FK2A 4E89A 4YNQA 2KFZA 3S3OA 1CZ9A 5FRNA 1KTQA 4HUFA 4FJMA 3KD5E 2HVHA 1UWBA 3L2WA 3PV8A 3SV4A 2YNIA 3ZSRA 1I3AA 4O55A 4AH9A 4KV8A 3MAQA 2HW3A 1S1WA 3F73A 2LSNA 4CJ4A 3I0RA 3QEPA 1Q9XA 4N47A 4KAZA 2HNZA 2XHBA 4DQRA 3OYKA 5KI6A 2YHBA 2F8TA 3HP9A 5T7BA 3CFOA 3TAPA 3OS1A 4DTJA 3LALA 3TAGA 3AVGA 4C8OA 4KO0A 3M8SA 5FRMA 1C0MA 2BDPA 1HYSA 4QAGA 3NCIA 1XI1A 4CK3A 3ISNC 5HRRA 3ZT1A 1BIUA 1DLOA 4ICLA 4KREA 1CXQA 5HBMA 3A2FA 4DSEA 4RW6A 2G8WA 3VQCA 3OYDA 3RMBA 2HHUA 3OYAA 4B9TA 2E6MA 3OYFA 2KFNA 1U45A 4FVMA 1NKEA 3HPGA 1KFSA 1BISA 4DTRA 1HQUA 1NK4A 3HXMA 4B9MA 1RDDA 1ZBHA 4H4MA 1NK6A 4DSIA 4B8AB 1QS4A 3HPHA 4FLVA 1WSGA 3V9UA 4CHZA 3NH0A 4FJ7A 3LZJA 4BWMA 3V9ZA 1D5AA 1KLMA 2G8VA 1IKYA 1X9WA 4DFPA 1C1AA 1F21A 4DF4A 1YVUA 2JLEA 4DS4A 1QSYA 3T19A 1S1TA 3AVLA 3OYLA 1TAQA 3EY1A 2OYQA 1RT2A 1JLBA 4CJWA 1JLEA 4E1MA 3SJJA 3HO1A 1NJYA 3K5NA 4FLWA 5K14A 5JS2A 3P83D 1X1PA 4HVJA 2VG7A 3WNHA 2P51A 4CEOA 3DOLA 1VSMA 2FC0A 3WNGA 4C8KA 3C6UA 3OYBA 3RRHA 3SCXA 4B9NA 4YFUA 1BI4A 1VSLA 4CGIA 1WSIA 3HPOA 3RMAA 5I3UA 1HJRA 4M3TA 2HHSA 4UQGA 2QXFA 3NGYA 2DY4A 1RDAA 2YKNA 4CF1A 1VSFA 4CFDA 4FLXA 4KTZA 4DU3A 1BQNA 4Q5VA 4LSLA 4CCHA 3V81A 4W5RA 1RNHA 4CEDA 3NH2A 2EHGA 4OLAA 3VQBA 1TVRA 3UIQA 5HP1A 3K58A 3RMDA 4FJIA 3AVIA 4O4GA 1ZBUA 3IRXA 4W5QA 2A1RA 4HUGA 4E7HA 3WNEA 1N6QA 2W42A 3MECA 4OGEA 4PQUA 3TR8A 3NGIA 4QCLA 5J2NA 1FXXA 2IGIA 4KTWA 3VQEA 3L3VA 3MEGA 4O44A 1Y97A 3G10A 4DU1A 2F96A 3HSTB 4JS5A 4KHWA 2O4GA 1X9SA 2PY5A 4O0IA 4DLEA 4OKKA 3PX0A 4PUOA 3VQAA 3AV9A 3V1RA 4FJJA 4FCYA 1RT4A 2D5RA 5C24A 5J1EA 5KRTA 4CEBA 4EZ9A 4OPJA 3B6OA 1JLAA 4CEFA 2OZMA 4DTMA 3PX6A 3ZSQA 1NKCA 4OLBA 5HRSA 4CGJA 3DLBA 3AO1A 1C1BA 1REVA 3M8PA 4ZTJA 1XC9A 1VSEA 4TSXA 1WAFA 1TKDA 2D0AA 2HVIA 1HYZA 1RILA 2ZQBA 4CJTA 3I8DA 3ULDA 4DG1A 1LAVA 3AO3A 1EP4A 3RMCA 1RTDA 1JXBA 2RKIA 3VQDA 1EX4A 3SPYA 2IC3A 3K5MA 3PO4A 3ZT0A 4F3OA 1RBUA 2PYJA 3SI6A 1YTAA 3AO4A 4Z4IA 3K5OA 4AHSA 1NK5A 1VRTA 4OPKA 4DF8A 1YT3A 4HCCA 1VK0A 3JSMA 3VA0A 4BACA 3M8QA 3LAMA 5KGWA 3C95A 3RWUA 1IH7A 3OS0A 2Z1GA 1X9MA 3NHGA 2P1JA 4DTOA 2ITGA 1NJXA 3IAYA 4F2SA 3V1QA 4QOZB 1LW0A 4BWJA 1S1UA 4O0JA 2OA8A 4KRFA 4E3SA 1LWEA 4BDPA 1DTTA 1RBTA 4AHCA 4FZXC 3O3HA 4L8RB 2YNFA 5FDLA 4FXDA 3K57A 4CJVA 3QIOA 1LV5A 4KHSA 4FJNA 2HHXA 1RDCA 2RPIA 4B8CA 3ZSVA 1D9DA 4NCBA 3MEEA 4OGCA 4M3YA 2ZD1A 4ID1A 1RT1A 4CJLA 1XHXA 5KGXA 1D8YA 4BE2A 4MFBA 1ZBIA 3QNOA 3ZT2A 2Q3SA 1TV6A 4XIUA 3QINA 2F8SA 5D3GA 4Z0UA 1JLQA 1B92A 1S1VA 4NYNA 5C42A 4CHQA 1C0UA 1RTHA 3V6DA 3V9WA 3TABA 1JXEA 4GVMA 4RW7A 4FLTA 2B5JA 3QERA 1QSLA 1C1CA 4IG0A 3CFRA 3SQ2A 4J2AA 4FW2A 1U49A 4RG8A 3DLEA 3AVHA 1A5XA 4CHOA 4DWIA 3SUQA 1EXQA 1BCOA 3KKSA 4CJEA 1NOYA 2G8UA 4FW1A 2GV9A 4CJ5A 4Z4CA 4CE9A 3RR8A 4M42A 4I7FA 2OPRA 2B6AA 1HYVA 2OPPA 3SUOA 4CF8A 3KK3A 4CEEA 2B4JA 4I2QA 1QTMA 5J2QA 2FBXA 2HHWA 1RBVA 1SL1A 4AHTA 2EX3A 4CJFA 3MXIA 1NK8A 4EP4A 4E0DA 1VSIA 3ALYA 3OYGA 3TAQA 1KVAA 4CFAA 4ZHRA 1RCHA 4JS4A 2XY6A 3KK2A 3QEXA 1LW2A 3NDKA 4I2PA 3TAEA 3HK2A 4FJLA 4FJXA 1VSKA 1GOBA 3AVJA 3O4NA 4ID5A 4M3XA 4CIGA 3HM9A 1Z26A 4FJ9A 3QESA 4HTUA 4LH4A 4CJKA 1LAWA 3OYHA 5HLFA 1ZBFA 3BGRA 4NYFA 4CHNA 2VG6A 1L3VA 2RF2A 3DI6A 4M3RA 4CEQA 2X74A 4DFKA 4ELVA 3BDPA 4CJUA 1NJWA 4KHQA 4B3OA 3QEIA 1ZYQA 1KCFA 3OYIA 1C0TA 3DRPA 3OYJA 3VQ8A 1U47A 1T03A 4FJGA 4DMNA 3LWMA 4H4OA 1JL2A 3EZ5A 4DSJA 1SUQA 3PO5A 3AO2A 2KW4A 2FBYA 3SQ1A 2OPQA 3P1GA 1UA1A 2GUIA 4KHUA 4FK0A 2ETJA 1FKOA 1S6QA 3ZT3A 1EETA 4FYDA 3TI0A 3TAMA 1K6YA 4DTUA 1HNVA 3DLKA 2XY8A 4FZYA 3L8BA 4ELTA 3KKRA 1J53A 1WLJA 2HHVA 3VQ5A 4NCAA 4FJ5A 3NBPA 3NF8A 4OKEA 2VWKA 5CYMA 4M45A 4BE1A 3KLEA 3LWLA 1Q8IA 4DFJA 4GMJB 1QHTA 1RTIA 3MXJA 3NE6A 4DFMA 4IKFA 3TANA 2PYLA 4M3UA 1GOCA 2OPSA 1U4BA 4FLYA 3KLIA 3AVBA 2P5GA 3KD1E 1WSFA 3P5JA 2HB5A 4R5PA 3D0PA 1NJZA 2QKKA 1VSJA 4CEZA 1TKZA 3VN5A 4PWDA 4Y1DA 3NF9A 4W5TA 4GW6A 4DSLA 2G8HA 4KHNA 1DTQA 2X6NA 4CGHA 2FBTA 1S1XA 2BANA 1NK9A 3C6TA 3ZSWA 4OKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WAJ A;  4Z4G A;  1W9H A;  3OJS A;  3AA4 A;  1RT5 A;  2NUB A;  3ASM A;  4CFC A;  3KTQ A;  4AHR A;  1FKP A;  2R7Y A;  3DOK A;  4DTP A;  3SPZ A;  4WE1 A;  3L2R A;  1G15 A;  3CM5 A;  3F9K A;  2WON A;  4I9Q A;  2X6S A;  2DTU A;  1QQC A;  3ZSO A;  4CJQ A;  1QSS A;  4KPY A;  1VSH A;  1B9F A;  1U48 A;  3QET A;  4CJR A;  3HL8 A;  4HHT A;  1J9A A;  1ASV A;  4CER A;  1T05 A;  3OS2 A;  2I5J A;  4E1N A;  3SV3 A;  1FK9 A;  1UOC A;  2FBV A;  4PY5 A;  2X78 A;  4F3T A;  4M41 A;  1RBS A;  3E01 A;  4H8K A;  2KZM A;  1W0H A;  3DM2 A;  2Z1H A;  3LPT A;  1S6P A;  5FRO A;  4W5O A;  4LY7 A;  3SUP A;  3AA2 A;  1ZBL A;  1N5Y A;  2DFF A;  3AA3 A;  3DLG A;  2Y1I A;  2E4L A;  1KFD A;  4J2E A;  3MED A;  4B9S A;  3G0Z A;  1C6V A;  1WSE A;  4CIF A;  3KJV A;  2O4I A;  5E41 A;  3K59 A;  4LSN A;  3U3G A;  4CIE A;  3DLH A;  3KK1 A;  1CLQ A;  1O1W A;  4N56 A;  3L2V A;  5EU7 A;  4M3Z A;  2XRI A;  1HQE A;  4DSK A;  2KQ2 A;  2YNG A;  3O3G A;  4CFB A;  4B08 A;  2VG5 A;  4DQQ A;  1RBR A;  1TKT A;  4DSF A;  3V1O A;  1ASU A;  3QNN A;  4DS5 A;  5JS1 A;  4HUE A;  5CY4 A;  1T7P A;  1IG9 A;  2XY7 A;  2XY5 A;  1S9E A;  3M8R A;  1HMV A;  3AVC A;  3DRR A;  3NH1 A;  5SZT A;  1BQM A;  4IFV A;  3DYA A;  3LP0 A;  4N41 A;  3LAK A;  2IS3 A;  3AVN A;  1ASW A;  1XWL A;  1L5U A;  4AHV A;  4LH5 A;  3HVT A;  3NF6 A;  3TAR A;  4E7L A;  4CF2 A;  3AVM A;  3QO9 A;  3VQ7 A;  3LPU A;  5KRS A;  5J2M A;  1BL3 A;  4C8N A;  1TGO A;  1NOZ A;  3SYZ A;  4J2B A;  1TK5 A;  3CG7 A;  3S9H A;  1BGX T;  3JYT A;  1KRP A;  4KB1 A;  1JL1 A;  3ITH A;  1JKH A;  3LP3 A;  1ITG A;  1J5O A;  4KB0 A;  3V9S A;  4FZZ A;  2YHA A;  3DLR A;  3O4Q A;  5DMR A;  3NGZ A;  1BHL A;  1S9G A;  3DRS A;  3AO5 A;  2HMI A;  1BIZ A;  2ATQ A;  1KVB A;  3AVA A;  3NAE A;  3TAF A;  3B6P A;  3L3U A;  1KLN A;  2HHQ A;  2AJQ A;  1RT3 A;  2YV0 X;  3VA3 A;  1T8E A;  4FJK A;  1CXU A;  4IBN A;  2IAJ A;  2WOM A;  4FM0 A;  3PY8 A;  3HVR A;  2ZE2 A;  4CES A;  4E7K A;  4IDK A;  4DU4 A;  3H08 A;  3RR7 A;  3D45 A;  2BGG A;  4RW4 A;  2A1S A;  1YTU A;  2Z1I A;  4CEC A;  4B9L A;  4FLZ A;  2HND A;  5C25 A;  1SKS A;  1JLF A;  3T3F A;  1TK8 A;  4DQS A;  3HJF A;  3NFA A;  3EYZ A;  3VQP A;  4JRP A;  3C94 A;  1SL2 A;  3OYC A;  2G8K A;  4I9L A;  3CQ8 A;  4AIL C;  4ELU A;  1SKW A;  4W5N A;  4C8L A;  2HNY A;  3MXM A;  2YNH A;  3VQQ A;  3L2U A;  1HNI A;  4JRQ A;  4E7J A;  4E7I A;  2P5O A;  4Z4E A;  4CJP A;  1QE1 A;  1L3T A;  4F4K A;  4KTQ A;  4FK4 A;  4CK2 A;  1Q9Y A;  4KKO A;  3KLF A;  1I39 A;  3K2P A;  4DLG A;  1D9F A;  3DMJ A;  4KFB A;  4B9U A;  1U04 A;  3OJU A;  2HHT A;  1HPZ A;  2QKB A;  1KVC A;  3CM6 A;  2D0C A;  1J54 A;  2JGU A;  4CF9 A;  4BDY A;  2VWJ A;  1HRH A;  1UA0 A;  1IKV A;  1CZB A;  3OYM A;  5KTQ A;  4RW9 A;  1RDB A;  3LAN A;  1NKB A;  1NK7 A;  4JLH A;  4DTN A;  1LWC A;  2GBZ A;  4FLU A;  3HYF A;  4CHP A;  3PX4 A;  4Q0B A;  2DFH A;  4CGF A;  4KI6 A;  1TAU A;  3RRG A;  3K5L A;  3FFI A;  1IO2 A;  3LZI A;  2QK9 A;  1GOA A;  4DTX A;  2Z1J A;  4FM1 A;  4KHY A;  5I42 A;  3HT3 A;  2Y1J A;  4DTS A;  1A5W A;  1WNS A;  3S3M A;  4EZ6 A;  2OZS A;  4CF0 A;  4J2D A;  3VQ9 A;  3ZSZ A;  4Y1C A;  1XHZ A;  4F8R A;  4N76 A;  4EP5 A;  4ZTF A;  3SNN A;  4N5S A;  2IOC A;  1Z25 A;  4DQI A;  3PUF A;  4LD0 A;  4DQP A;  2D0B A;  3TWH A;  4AHU A;  5HRO A;  1JLC A;  4CEA A;  4Z4F A;  5HRN A;  3V9X A;  3OYE A;  4FJH A;  3U6F A;  4F2R A;  1JLG A;  4CJS A;  4Z4H A;  5HRP A;  4M3W A;  1A5V A;  1SV5 A;  3OYN A;  1IKW A;  3CYM A;  2XO7 A;  3QLH A;  1R0A A;  2PZS A;  4E19 A;  2IDO A;  3AVK A;  3ZSX A;  3L2Q A;  1EKE A;  5DK5 A;  4FJ8 A;  2G8I A;  1RT6 A;  2RN2 A;  1RTJ A;  3KIO A;  4RW8 A;  3VQ6 A;  4BDZ A;  1TKX A;  4K8Z A;  1UAX A;  3AVF A;  3LDS A;  3LP1 A;  5CZ2 A;  1WSH A;  3THV A;  3KLH A;  1WN7 A;  5SWM A;  4K8X A;  3NF7 A;  3I0S A;  1BCM A;  3IS9 A;  4CHY A;  2E6L A;  3SQ0 A;  3HP6 A;  5J2P A;  3OY9 A;  3U3Y A;  1SKR A;  4OJR A;  3AA5 X;  3V4I A;  4B9V A;  1TK0 A;  4FM2 A;  5CYQ A;  1TL1 A;  1NK0 A;  1LWF A;  1VSD A;  3LP2 A;  2G8F A;  1SL0 A;  3ZT4 A;  1S5J A;  4BE0 A;  3SZ2 A;  5CZ1 A;  1TL3 A;  4IFY A;  4CGD A;  3KLG A;  3SUN A;  4O5B A;  4PA1 A;  1VRU A;  2BE2 A;  2YKM A;  1RT7 A;  4CK1 A;  1B9D A;  3T1A A;  4CGG A;  3OVN A;  3ZSY A;  3CFP A;  1L3U A;  3QEW A;  1KSP A;  4IG3 A;  3SQ4 A;  4NCG A;  1MU2 A;  2DFE A;  1WSJ A;  1BI4 B;  3VQ4 A;  3RTV A;  2KZZ A;  4OVL A;  1IKX A;  3S3N A;  4G1Q A;  3IG1 A;  3O3F A;  4MQ3 A;  1L3S A;  4KI4 A;  3QEV A;  4HCB A;  4C8M A;  3ZCM A;  4CJ3 A;  3QIP A;  2KTQ A;  3WNF A;  4FK2 A;  4E89 A;  4YNQ A;  2KFZ A;  3S3O A;  1CZ9 A;  5FRN A;  1KTQ A;  4HUF A;  4FJM A;  3KD5 E;  2HVH A;  1UWB A;  3L2W A;  3PV8 A;  3SV4 A;  2YNI A;  3ZSR A;  1I3A A;  4O55 A;  4AH9 A;  4KV8 A;  3MAQ A;  2HW3 A;  1S1W A;  3F73 A;  2LSN A;  4CJ4 A;  3I0R A;  3QEP A;  1Q9X A;  4N47 A;  4KAZ A;  2HNZ A;  2XHB A;  4DQR A;  3OYK A;  5KI6 A;  2YHB A;  2F8T A;  3HP9 A;  5T7B A;  3CFO A;  3TAP A;  3OS1 A;  4DTJ A;  3LAL A;  3TAG A;  3AVG A;  4C8O A;  4KO0 A;  3M8S A;  5FRM A;  1C0M A;  2BDP A;  1HYS A;  4QAG A;  3NCI A;  1XI1 A;  4CK3 A;  3ISN C;  5HRR A;  3ZT1 A;  1BIU A;  1DLO A;  4ICL A;  4KRE A;  1CXQ A;  5HBM A;  3A2F A;  4DSE A;  4RW6 A;  2G8W A;  3VQC A;  3OYD A;  3RMB A;  2HHU A;  3OYA A;  4B9T A;  2E6M A;  3OYF A;  2KFN A;  1U45 A;  4FVM A;  1NKE A;  3HPG A;  1KFS A;  1BIS A;  4DTR A;  1HQU A;  1NK4 A;  3HXM A;  4B9M A;  1RDD A;  1ZBH A;  4H4M A;  1NK6 A;  4DSI A;  4B8A B;  1QS4 A;  3HPH A;  4FLV A;  1WSG A;  3V9U A;  4CHZ A;  3NH0 A;  4FJ7 A;  3LZJ A;  4BWM A;  3V9Z A;  1D5A A;  1KLM A;  2G8V A;  1IKY A;  1X9W A;  4DFP A;  1C1A A;  1F21 A;  4DF4 A;  1YVU A;  2JLE A;  4DS4 A;  1QSY A;  3T19 A;  1S1T A;  3AVL A;  3OYL A;  1TAQ A;  3EY1 A;  2OYQ A;  1RT2 A;  1JLB A;  4CJW A;  1JLE A;  4E1M A;  3SJJ A;  3HO1 A;  1NJY A;  3K5N A;  4FLW A;  5K14 A;  5JS2 A;  3P83 D;  1X1P A;  4HVJ A;  2VG7 A;  3WNH A;  2P51 A;  4CEO A;  3DOL A;  1VSM A;  2FC0 A;  3WNG A;  4C8K A;  3C6U A;  3OYB A;  3RRH A;  3SCX A;  4B9N A;  4YFU A;  1BI4 A;  1VSL A;  4CGI A;  1WSI A;  3HPO A;  3RMA A;  5I3U A;  1HJR A;  4M3T A;  2HHS A;  4UQG A;  2QXF A;  3NGY A;  2DY4 A;  1RDA A;  2YKN A;  4CF1 A;  1VSF A;  4CFD A;  4FLX A;  4KTZ A;  4DU3 A;  1BQN A;  4Q5V A;  4LSL A;  4CCH A;  3V81 A;  4W5R A;  1RNH A;  4CED A;  3NH2 A;  2EHG A;  4OLA A;  3VQB A;  1TVR A;  3UIQ A;  5HP1 A;  3K58 A;  3RMD A;  4FJI A;  3AVI A;  4O4G A;  1ZBU A;  3IRX A;  4W5Q A;  2A1R A;  4HUG A;  4E7H A;  3WNE A;  1N6Q A;  2W42 A;  3MEC A;  4OGE A;  4PQU A;  3TR8 A;  3NGI A;  4QCL A;  5J2N A;  1FXX A;  2IGI A;  4KTW A;  3VQE A;  3L3V A;  3MEG A;  4O44 A;  1Y97 A;  3G10 A;  4DU1 A;  2F96 A;  3HST B;  4JS5 A;  4KHW A;  2O4G A;  1X9S A;  2PY5 A;  4O0I A;  4DLE A;  4OKK A;  3PX0 A;  4PUO A;  3VQA A;  3AV9 A;  3V1R A;  4FJJ A;  4FCY A;  1RT4 A;  2D5R A;  5C24 A;  5J1E A;  5KRT A;  4CEB A;  4EZ9 A;  4OPJ A;  3B6O A;  1JLA A;  4CEF A;  2OZM A;  4DTM A;  3PX6 A;  3ZSQ A;  1NKC A;  4OLB A;  5HRS A;  4CGJ A;  3DLB A;  3AO1 A;  1C1B A;  1REV A;  3M8P A;  4ZTJ A;  1XC9 A;  1VSE A;  4TSX A;  1WAF A;  1TKD A;  2D0A A;  2HVI A;  1HYZ A;  1RIL A;  2ZQB A;  4CJT A;  3I8D A;  3ULD A;  4DG1 A;  1LAV A;  3AO3 A;  1EP4 A;  3RMC A;  1RTD A;  1JXB A;  2RKI A;  3VQD A;  1EX4 A;  3SPY A;  2IC3 A;  3K5M A;  3PO4 A;  3ZT0 A;  4F3O A;  1RBU A;  2PYJ A;  3SI6 A;  1YTA A;  3AO4 A;  4Z4I A;  3K5O A;  4AHS A;  1NK5 A;  1VRT A;  4OPK A;  4DF8 A;  1YT3 A;  4HCC A;  1VK0 A;  3JSM A;  3VA0 A;  4BAC A;  3M8Q A;  3LAM A;  5KGW A;  3C95 A;  3RWU A;  1IH7 A;  3OS0 A;  2Z1G A;  1X9M A;  3NHG A;  2P1J A;  4DTO A;  2ITG A;  1NJX A;  3IAY A;  4F2S A;  3V1Q A;  4QOZ B;  1LW0 A;  4BWJ A;  1S1U A;  4O0J A;  2OA8 A;  4KRF A;  4E3S A;  1LWE A;  4BDP A;  1DTT A;  1RBT A;  4AHC A;  4FZX C;  3O3H A;  4L8R B;  2YNF A;  5FDL A;  4FXD A;  3K57 A;  4CJV A;  3QIO A;  1LV5 A;  4KHS A;  4FJN A;  2HHX A;  1RDC A;  2RPI A;  4B8C A;  3ZSV A;  1D9D A;  4NCB A;  3MEE A;  4OGC A;  4M3Y A;  2ZD1 A;  4ID1 A;  1RT1 A;  4CJL A;  1XHX A;  5KGX A;  1D8Y A;  4BE2 A;  4MFB A;  1ZBI A;  3QNO A;  3ZT2 A;  2Q3S A;  1TV6 A;  4XIU A;  3QIN A;  2F8S A;  5D3G A;  4Z0U A;  1JLQ A;  1B92 A;  1S1V A;  4NYN A;  5C42 A;  4CHQ A;  1C0U A;  1RTH A;  3V6D A;  3V9W A;  3TAB A;  1JXE A;  4GVM A;  4RW7 A;  4FLT A;  2B5J A;  3QER A;  1QSL A;  1C1C A;  4IG0 A;  3CFR A;  3SQ2 A;  4J2A A;  4FW2 A;  1U49 A;  4RG8 A;  3DLE A;  3AVH A;  1A5X A;  4CHO A;  4DWI A;  3SUQ A;  1EXQ A;  1BCO A;  3KKS A;  4CJE A;  1NOY A;  2G8U A;  4FW1 A;  2GV9 A;  4CJ5 A;  4Z4C A;  4CE9 A;  3RR8 A;  4M42 A;  4I7F A;  2OPR A;  2B6A A;  1HYV A;  2OPP A;  3SUO A;  4CF8 A;  3KK3 A;  4CEE A;  2B4J A;  4I2Q A;  1QTM A;  5J2Q A;  2FBX A;  2HHW A;  1RBV A;  1SL1 A;  4AHT A;  2EX3 A;  4CJF A;  3MXI A;  1NK8 A;  4EP4 A;  4E0D A;  1VSI A;  3ALY A;  3OYG A;  3TAQ A;  1KVA A;  4CFA A;  4ZHR A;  1RCH A;  4JS4 A;  2XY6 A;  3KK2 A;  3QEX A;  1LW2 A;  3NDK A;  4I2P A;  3TAE A;  3HK2 A;  4FJL A;  4FJX A;  1VSK A;  1GOB A;  3AVJ A;  3O4N A;  4ID5 A;  4M3X A;  4CIG A;  3HM9 A;  1Z26 A;  4FJ9 A;  3QES A;  4HTU A;  4LH4 A;  4CJK A;  1LAW A;  3OYH A;  5HLF A;  1ZBF A;  3BGR A;  4NYF A;  4CHN A;  2VG6 A;  1L3V A;  2RF2 A;  3DI6 A;  4M3R A;  4CEQ A;  2X74 A;  4DFK A;  4ELV A;  3BDP A;  4CJU A;  1NJW A;  4KHQ A;  4B3O A;  3QEI A;  1ZYQ A;  1KCF A;  3OYI A;  1C0T A;  3DRP A;  3OYJ A;  3VQ8 A;  1U47 A;  1T03 A;  4FJG A;  4DMN A;  3LWM A;  4H4O A;  1JL2 A;  3EZ5 A;  4DSJ A;  1SUQ A;  3PO5 A;  3AO2 A;  2KW4 A;  2FBY A;  3SQ1 A;  2OPQ A;  3P1G A;  1UA1 A;  2GUI A;  4KHU A;  4FK0 A;  2ETJ A;  1FKO A;  1S6Q A;  3ZT3 A;  1EET A;  4FYD A;  3TI0 A;  3TAM A;  1K6Y A;  4DTU A;  1HNV A;  3DLK A;  2XY8 A;  4FZY A;  3L8B A;  4ELT A;  3KKR A;  1J53 A;  1WLJ A;  2HHV A;  3VQ5 A;  4NCA A;  4FJ5 A;  3NBP A;  3NF8 A;  4OKE A;  2VWK A;  5CYM A;  4M45 A;  4BE1 A;  3KLE A;  3LWL A;  1Q8I A;  4DFJ A;  4GMJ B;  1QHT A;  1RTI A;  3MXJ A;  3NE6 A;  4DFM A;  4IKF A;  3TAN A;  2PYL A;  4M3U A;  1GOC A;  2OPS A;  1U4B A;  4FLY A;  3KLI A;  3AVB A;  2P5G A;  3KD1 E;  1WSF A;  3P5J A;  2HB5 A;  4R5P A;  3D0P A;  1NJZ A;  2QKK A;  1VSJ A;  4CEZ A;  1TKZ A;  3VN5 A;  4PWD A;  4Y1D A;  3NF9 A;  4W5T A;  4GW6 A;  4DSL A;  2G8H A;  4KHN A;  1DTQ A;  2X6N A;  4CGH A;  2FBT A;  1S1X A;  2BAN A;  1NK9 A;  3C6T A;  3ZSW A;  4OKJ A; 
#chains in the Genus database with same CATH topology
 4WYB A;  1W9H A;  4O8K A;  2NUB A;  2O8F A;  3SPZ A;  1G15 A;  2DTU A;  1QQC A;  3ZSO A;  4YOX A;  4CJR A;  4HHT A;  4YOY A;  2I5J A;  4JK9 A;  3SBT A;  4E1N A;  3SV3 A;  3MN6 A;  2FBV A;  4PY5 A;  3E01 A;  4JI1 K;  1W0H A;  2Z1H A;  3LPT A;  4H0T B;  3SUP A;  2DFF A;  3AAP A;  4J2E A;  3VEV A;  1QVG M;  3A5O C;  5E41 A;  4LSN A;  1O1W A;  4CI6 A;  3WT0 A;  4X62 K;  4CZM A;  4CFB A;  2QXL A;  2GTD A;  4B08 A;  3O9T A;  1RBR A;  1TKT A;  5JS1 A;  4HUE A;  3IMX A;  3L6Q A;  2XY7 A;  3M8R A;  1HMV A;  5JMV A;  5M1K A;  1BQM A;  4IFV A;  5C2F A;  4N41 A;  2IS3 A;  1SZ2 A;  1S22 A;  3CET A;  5KRS A;  3QO9 A;  3VQ7 A;  5J2M A;  1BL3 A;  3GBT A;  1NOZ A;  3SYZ A;  2ZJR L;  3CG7 A;  3S9H A;  1BGX T;  1ITG A;  4BVO A;  1S9G A;  4IXC A;  1BIZ A;  3OHR A;  1KVB A;  3CQX A;  3NAE A;  3G25 A;  2YV0 X;  3VA3 A;  3FFK B;  1S3X A;  3PY8 A;  4FM0 A;  3HVR A;  3D2F B;  4BR2 A;  4DU4 A;  1E4G T;  3RR7 A;  4BRC A;  3HTV A;  4HWI A;  4RW4 A;  3QBW A;  4GV9 A;  1YTU A;  1QZ6 A;  2Z1I A;  4CEC A;  1GLA G;  3IDH A;  1SKS A;  1JLF A;  5JVG L;  3T1H K;  3HJF A;  3NFA A;  3QIC A;  4LF8 K;  3EYZ A;  4FVU A;  3VQP A;  4GKJ K;  5JVH L;  4B3M K;  3OYC A;  1NGH A;  4ELU A;  2O8C B;  4W5N A;  2WC9 A;  4C8L A;  4LF4 K;  5AJ3 K;  3L2U A;  2P5O A;  4Z4E A;  3CC4 N;  4KTQ A;  4CK2 A;  2HHT A;  5FPD A;  3ZYY X;  3P38 A;  1HPZ A;  4IZ9 A;  3ULE A;  2NRV A;  2NZT A;  3PSF A;  1IKV A;  3DWL A;  4RW9 A;  3LAN A;  1NKB A;  1NK7 A;  1JCE A;  3EEQ A;  4DTN A;  3P4I A;  4FLU A;  3HYF A;  3KHY A;  4EAH D;  2DFH A;  1TAU A;  4BC4 A;  5AZI B;  4CD3 A;  3FFI A;  2QK9 A;  3LZI A;  2Z1J A;  5ADX A;  3VES A;  2Y1J A;  1WNS A;  2VWB A;  3S3M A;  2OZS A;  4CF0 A;  3VTH A;  4U7B A;  4DV7 K;  4ZTF A;  2YHY A;  1Z25 A;  3PUF A;  2F4V K;  3CME N;  5GAH P;  3TWH A;  4Z4F A;  3FR0 A;  3J7Z O;  3V9X A;  4FJH A;  3U6F A;  1JLG A;  4Z4H A;  1A5V A;  1SV5 A;  4RWT A;  3QLH A;  1R0A A;  2IDO A;  3LDQ A;  3AVK A;  5DK5 A;  1YAG A;  4BDZ A;  1RTJ A;  4RW8 A;  3VEY A;  2YJF A;  2HBM A;  4IJN A;  5BN8 A;  4IOC L;  3THV A;  5SWM A;  3OBY A;  1BCM A;  2V7Y A;  3SQ0 A;  1BDG A;  3HP6 A;  5J2P A;  3OY9 A;  3MN7 A;  3V4I A;  1LWF A;  1HNW K;  4BE0 A;  1TL3 A;  3FZM A;  3SUN A;  4O5B A;  4B9Q A;  1ZXO A;  3T1A A;  1Z6R A;  3ZSY A;  4CJ7 A;  1P8Z A;  4JV5 K;  4IG3 A;  2NRZ A;  4CZJ A;  4IJA A;  1MU2 A;  3VQ4 A;  4BRP A;  3RTV A;  4OVL A;  1IKX A;  3S3N A;  4KH5 A;  3F9M A;  3IG1 A;  4MQ3 A;  3QEV A;  3WNF A;  4E89 A;  2HOE A;  5FRN A;  1VAZ A;  1FW6 A;  1SAZ A;  1I3A A;  3MAQ A;  1S1W A;  3KWG A;  2LSN A;  3QEP A;  2UUC K;  4N47 A;  2NNW A;  3O9R A;  2ZF5 O;  3J7A P;  5EOY A;  5T7B A;  2P9S B;  3OS1 A;  3AVG A;  2BDP A;  4JHD A;  3ISN C;  4JI2 K;  2A42 A;  3H1Q A;  3SK3 A;  3OYA A;  1N36 K;  3BF1 A;  5HL7 L;  3HPG A;  1KFS A;  2P9K B;  4B9M A;  4KH6 A;  4H4M A;  4DV5 K;  4DSI A;  1QS4 A;  4FLV A;  3IFR A;  3V9U A;  1DT9 A;  4H0X B;  4DFP A;  4RCH A;  4CVN E;  1S1T A;  3CER A;  4BRF A;  3OYL A;  4CW7 B;  3P31 A;  2OYQ A;  1JLB A;  1NJY A;  2D0P A;  4FPA A;  3K5N A;  4FLW A;  1MA9 B;  5AFU A;  4HVJ A;  2P51 A;  4C8K A;  2A3Z A;  3WNG A;  3Q7B A;  3RRH A;  4YFU A;  5I3U A;  3CJC A;  1NBW A;  2V52 B;  2QXF A;  4FLX A;  2YKN A;  1VSF A;  3LDO A;  4KTZ A;  1BQN A;  5KPT A;  5HP1 A;  1OH6 A;  3AVI A;  1HJO A;  1K73 O;  3CJA A;  4B1V A;  2UXC K;  2WBN A;  2QWQ A;  3NGI A;  1XNQ K;  1FXX A;  4O44 A;  2F96 A;  4KHW A;  3W3D A;  2O4G A;  3WQU A;  4O0I A;  1Q82 O;  5KRT A;  4CEB A;  3B6O A;  1G99 A;  1XNR K;  2OZM A;  1NKC A;  3WXK A;  1YHQ N;  4ZTJ A;  1VSE A;  2HVI A;  3THW A;  2Q31 A;  2E20 A;  4DV6 K;  3I8D A;  1LAV A;  3RMC A;  1RTD A;  2RKI A;  1EX4 A;  1VQN N;  4EHT A;  1Z05 A;  4AHS A;  3DLL L;  1VK0 A;  3LAM A;  3RWU A;  3C95 A;  1W7A A;  1IH7 A;  4ILG B;  3NHG A;  1HLU A;  2ITG A;  1NJX A;  5BPN A;  3EL2 A;  1LW0 A;  5JIC A;  2OA8 A;  3D2E A;  1P90 A;  3G71 N;  2BH1 A;  4AHC A;  4FZX C;  4L8R B;  4FXD A;  3TSP A;  2HHX A;  1TYQ B;  3VGM A;  4M3Y A;  2F9T A;  1D8Y A;  5DM7 L;  1DEJ A;  2Q3S A;  3ZEU B;  2F8S A;  3DXK B;  4BC2 A;  3CXC M;  3UB5 A;  4NYN A;  5AQL A;  2QA4 N;  3THY A;  3TAB A;  3V9W A;  4IG0 A;  1U49 A;  4AQY K;  4RG8 A;  4FWK A;  2CGK A;  4DWI A;  3SUQ A;  2G8U A;  3MN5 A;  3AGR A;  1NLV A;  4CJ5 A;  3MCP A;  4Z4C A;  1WBB A;  1X9J A;  3TTC A;  2OPP A;  3N4Q A;  4YY3 K;  3TPQ A;  5J2Q A;  4AHT A;  2EX3 A;  3MXI A;  3U8X A;  5AQY A;  1NK8 A;  4CFA A;  3NVM A;  3KK2 A;  3QEX A;  1VQ6 N;  1LW2 A;  1T6D A;  1NM1 A;  2O8D B;  1EWQ A;  4RTF D;  4LC9 B;  1VQL N;  2NRX A;  1Z26 A;  3QES A;  3CIP A;  4HTU A;  2A6A A;  3BGR A;  4CHN A;  2IVN A;  1IG8 A;  1L3V A;  4B3T K;  4FOE A;  5KQ8 A;  5M1O A;  2P9I B;  3QEI A;  5AQK A;  1C0T A;  3DRP A;  1V4T A;  2YX6 A;  1U47 A;  4H4O A;  1SUQ A;  2YI1 A;  2GWK A;  1SS6 A;  1FKO A;  1S6Q A;  3ZT3 A;  4FYD A;  4FWQ A;  4YDU C;  3E66 A;  3ZX0 A;  2HHV A;  1WLJ A;  4CZH A;  3CCU N;  4Z94 A;  3HOT A;  2VWK A;  4I6M B;  3LWL A;  4JI0 K;  4DFM A;  4CBW A;  3TAN A;  4M3U A;  4B3R K;  5IT9 O;  3D6R A;  1GLE G;  2UUB K;  4BRD A;  2P5G A;  4JAX A;  4PKG A;  3O80 A;  2QKK A;  5BPM A;  4CEZ A;  4DSL A;  2V7Z A;  1T3V A;  3CJ9 A;  3LM2 A;  1N33 K;  1S1X A;  2BAN A;  4DKW A;  4A5B A;  2FSK A;  2P9N A;  4CFC A;  4AHR A;  1FKP A;  2VYP A;  2R7Y A;  4DR3 K;  3L2R A;  5CE3 A;  4I9Q A;  2X6S A;  1U2V A;  4CJQ A;  1B9F A;  5E84 A;  1BO5 O;  3QET A;  3HL8 A;  1ASV A;  3OS2 A;  4A2B A;  2HBK A;  4XH1 A;  1UOC A;  4F3T A;  1RBS A;  2KZM A;  4W5O A;  1S6P A;  5FRO A;  3H3O B;  4NXN K;  4ILJ A;  3DLG A;  1KFD A;  3CCJ N;  4CIF A;  3KJV A;  1MDU B;  2D1K A;  4QS7 A;  4CIE A;  1W2B M;  1NG9 A;  3KK1 A;  4N56 A;  3L2V A;  1NU0 A;  2XRI A;  1HQE A;  4DSK A;  3MK6 A;  3G4S N;  1VQ9 N;  4DQQ A;  2VG5 A;  4DSF A;  3QNN A;  5CY4 A;  1T7P A;  1IG9 A;  2XY5 A;  1Q18 A;  1S9E A;  2QWL A;  3DYA A;  3LAK A;  3P39 A;  1VQ8 N;  1ASW A;  1R59 O;  3HVT A;  3TAR A;  3AVM A;  3LPU A;  4CZF A;  3BZK A;  3CCM N;  1TGO A;  3O9Q A;  4J2B A;  1TK5 A;  1WOQ A;  4WQ5 C;  3CCV N;  1KRP A;  1JL1 A;  1JKH A;  3LP3 A;  1J5O A;  5EX5 A;  3DLR A;  1BHL A;  2HMI A;  3AVA A;  1OH8 A;  3B6P A;  2HHQ A;  1TUY A;  1RT3 A;  1GLD G;  2VGN A;  4FJK A;  4LF9 K;  2A5X A;  2IAJ A;  2WOM A;  4F9O A;  3U9D A;  1BG3 A;  3VPZ A;  3LL3 A;  3H08 A;  3L0Q A;  2A1S A;  4PL7 A;  3SAF A;  2ASO A;  3O8M A;  4B9L A;  1S72 N;  5C25 A;  4JD2 A;  1TK8 A;  4QS9 A;  4JRP A;  1FJG K;  1SKW A;  5M1P A;  5GAG P;  3VER A;  3TSQ A;  2GUP A;  4BRM A;  1QHA A;  4CZG A;  4DHY A;  4BRL A;  1IJJ A;  4CJP A;  4F4K A;  4FWL A;  1Q9Y A;  3VEZ A;  1D9F A;  3DMJ A;  4KFB A;  3OJU A;  4GY2 B;  2QKB A;  3CM6 A;  2D0C A;  1J54 A;  4CF9 A;  5AQU A;  2VWJ A;  1HRH A;  2E2Q A;  3OYM A;  3UKU B;  4CGF A;  4KI6 A;  3UKR B;  3CPE A;  3K5L A;  4JKD A;  1IO2 A;  1GOA A;  4DTX A;  3HBT A;  4FM1 A;  1A5W A;  4PHT X;  4EZ6 A;  4DB3 A;  4Y1C A;  1QQN A;  4YOR A;  3BY5 A;  4EP5 A;  2RE2 A;  5C15 A;  4DQP A;  1NJI O;  4CEA A;  4IWV A;  4F2R A;  4IO9 L;  5F0X A;  3MMV A;  2P9S A;  1IKW A;  3CYM A;  2XO7 A;  4M7X A;  5AQV A;  3L2Q A;  2F9W A;  1EKE A;  5CHI A;  2G8I A;  1SQK A;  3VQ6 A;  1TKX A;  2GEL A;  3R9P A;  1UAX A;  3AVF A;  4BR7 A;  2P9P A;  5JLH A;  3LDS A;  2KLA A;  1WSH A;  5EXW A;  1K8K A;  1W97 L;  3I0S A;  3O08 A;  3IS9 A;  2E6L A;  1NGB A;  3OTO K;  4OJR A;  5FPE A;  5CYQ A;  1VSD A;  3KVG A;  1SL0 A;  3ZT4 A;  3J8A A;  4BY9 C;  2ITM A;  4CGD A;  4JKE A;  3KLG A;  2YKM A;  4CK1 A;  1B9D A;  4CGG A;  4JI4 K;  3CFP A;  5CR4 A;  1L3U A;  3QEW A;  1KSP A;  4NCG A;  1WSJ A;  1WB9 A;  1BI4 B;  2W41 A;  4KI4 A;  4HCB A;  4C8M A;  4CJ3 A;  4DV1 K;  4FK2 A;  1C0F A;  1CZ9 A;  1KTQ A;  4HUF A;  3KD5 E;  3N4P A;  3SV4 A;  4NB4 A;  4O55 A;  4KV8 A;  2HW3 A;  3SJH A;  3A5L C;  2W6K A;  3PIO L;  2HNZ A;  3THX B;  3B8A X;  4JN4 A;  2O8B B;  2YHB A;  2V51 B;  2F8T A;  4JYA K;  2ZGZ A;  3TAP A;  2OCE A;  4DTJ A;  3LAL A;  4GNI A;  3ENH A;  4QAG A;  3NCI A;  1KAZ A;  1CXQ A;  3A2F A;  5ADX H;  1ZC6 A;  3GE1 A;  2QWR A;  4B9T A;  2E6M A;  4FVM A;  5AQR A;  1V4S A;  1BIS A;  3HRG A;  1NK4 A;  3RSE B;  4H0V B;  1YVN A;  4A2A A;  3HPH A;  3ENB A;  3JS6 A;  2UYT A;  3NH0 A;  2P9U B;  4K41 A;  5AQX A;  3R8E A;  3VF6 A;  5M1F A;  3V9Z A;  1KLM A;  2PAV A;  2ZWH A;  1IKY A;  2BUP A;  1X9W A;  1C1A A;  1OH5 A;  3A0I X;  1C0G A;  4DS4 A;  3GOI A;  4NLB A;  3AVL A;  1H1V A;  4FWO A;  1RT2 A;  2FF6 A;  3SJJ A;  1VQM N;  4FWR A;  1HX1 A;  5K14 A;  5JS2 A;  2VG7 A;  4LFA K;  3OYB A;  3SCX A;  3CC7 N;  4B9N A;  3HPO A;  1WSI A;  2HST A;  4BG9 A;  3RMA A;  4UQG A;  5LJV A;  3WXL A;  4CFD A;  1X3M A;  4DU3 A;  4EIA A;  3ZET A;  2EHG A;  3SLC A;  1TVR A;  3K58 A;  1YUW A;  3RMD A;  4O4G A;  4W5Q A;  1EQY A;  4FWP A;  2HBL A;  2A1R A;  1XMQ K;  3VGL A;  1N6Q A;  2W42 A;  4NO7 A;  3KK7 A;  1J6Z A;  5J2N A;  2IGI A;  1Y97 A;  3G10 A;  4DU1 A;  1X9S A;  2PY5 A;  1XMO K;  1HUX A;  3SMS A;  3VQA A;  4FJJ A;  5TKW A;  1T6C A;  3VF4 A;  1NGF A;  3F2K A;  3WEE A;  5HRS A;  4OLB A;  3DLB A;  1C1B A;  1Y64 A;  4WFA L;  1XC9 A;  1RIL A;  4CJT A;  3J80 O;  3AO3 A;  4HTL A;  3CI5 A;  3VQD A;  2Q1N A;  3AO4 A;  4OPK A;  4JI7 K;  4DCH A;  4DF8 A;  5B8H A;  1XUP O;  5ELZ A;  4BAC A;  1RDU A;  3AY9 A;  3EZW A;  3OS0 A;  4H0P A;  4AM7 A;  2Z1G A;  4H5T A;  4F2S A;  3V1Q A;  4ILH A;  1S1U A;  4KRF A;  2A40 A;  3CMA N;  1DTT A;  2QI2 A;  4X65 K;  3O3H A;  4JK8 A;  2E2P A;  3O4W A;  4KHS A;  5C10 A;  4L3Q A;  1RDC A;  4CBU A;  5AQS A;  3E9O A;  5KPR A;  2Q97 A;  4ID1 A;  1RT1 A;  1XHX A;  5KGX A;  3T1Y K;  1E4F T;  5BPL A;  5BRE A;  1EWR A;  4LF5 K;  4XIU A;  3EO3 A;  3QIN A;  5AFU H;  4Z0U A;  1B92 A;  1X3N A;  5C42 A;  4CHQ A;  1C0U A;  3V6D A;  2JWK A;  1JXE A;  4LFC K;  1C1C A;  3CFR A;  5AQF A;  2VQF K;  1A5X A;  3AAQ A;  4DR4 K;  4CJE A;  1BCO A;  2D0O A;  2GV9 A;  1NGI A;  3H45 C;  4Y0W A;  3A5M C;  4M42 A;  4I7F A;  2B6A A;  4E1J A;  3SUO A;  1N32 K;  3F5T A;  4BRK A;  4CEE A;  4I2Q A;  3O1B A;  1QTM A;  1ZBS A;  2FBX A;  2PFU A;  4CJF A;  5AQZ A;  2O8F B;  2NRW A;  4E0D A;  3TAQ A;  3VEO A;  4ZHR A;  4JS4 A;  2QEX N;  4H03 B;  3MN9 A;  3HSC A;  5TKY A;  1GOB A;  4CZE A;  4FJ9 A;  4CJK A;  1ZBF A;  3QB0 A;  3GG4 A;  3BF3 A;  2E88 A;  5AQN A;  2RF2 A;  3DAW A;  3DI6 A;  4DFK A;  2X74 A;  3O9U A;  4KHQ A;  3WQT A;  4B3O A;  3ID6 A;  2YJE A;  3OYI A;  4H0O A;  4O8U A;  4IDH A;  5A2Q O;  3VQ8 A;  4IOX A;  5BR8 K;  3VOV A;  3LWM A;  3EZ5 A;  1JL2 A;  3H46 O;  3AO2 A;  4A57 A;  1N8R O;  3P1G A;  3SAH A;  2ZJQ L;  4FK0 A;  3VTI A;  2ETJ A;  1RFQ A;  3TU5 A;  3TAM A;  4DTU A;  3I56 N;  1WUA A;  3L8B A;  4ELT A;  1J53 A;  3NBP A;  5KPZ A;  1QHT A;  4CZK A;  3H6E A;  4H5W A;  4FL9 A;  2OPS A;  4FLY A;  2GX9 A;  1WSF A;  4M63 C;  4PWD A;  4WFN L;  1VSJ A;  3CCL N;  1LOT B;  4JEP A;  4GW6 A;  4DUZ K;  4KHN A;  4ISF A;  5EY4 A;  1QQM A;  4E7K A;  4A59 A;  3U9Z A;  4Z4G A;  1HPM A;  3KTQ A;  4DTP A;  4WE1 A;  3F9K A;  4WFB L;  4KPY A;  4OPH A;  1T05 A;  1J9A A;  1FK9 A;  5EVZ A;  2X78 A;  4M41 A;  5BRD A;  4H8K A;  4MLH A;  3AA2 A;  1OVY A;  1Q86 O;  1BA0 A;  2Y1I A;  1YI2 N;  4B9S A;  3G0Z A;  1C6V A;  1WSE A;  3U3G A;  1CLQ A;  2QW9 A;  1KAY A;  3ULE B;  5GAE P;  2ZM6 K;  2KQ2 A;  2YNG A;  2OAN A;  3FZL A;  3V1O A;  1ASU A;  3WXI A;  3E9L A;  5AQP A;  3E1Y A;  3O6W A;  3AVC A;  3DRR A;  1HR0 K;  4MO5 A;  3NH1 A;  3FLC O;  4XH5 A;  2VQE K;  3LP0 A;  3MDQ A;  3WUH A;  1L5U A;  4MLE A;  3NF6 A;  3IUC A;  4CF2 A;  4E7L A;  2GEM A;  1M1K O;  3PSI A;  4KB1 A;  1LCU A;  4KB0 A;  4FZZ A;  1HKG A;  2YHA A;  4B1X B;  3O4Q A;  3SAG A;  3NMU A;  3AO5 A;  1TUU A;  2O8E A;  3I33 A;  3L3U A;  3ATU A;  1T8E A;  2QTD A;  5LMU K;  3CF5 L;  1HNZ K;  4CES A;  4IDK A;  1BU6 O;  3CJB A;  2BGG A;  1NGA A;  2WTU A;  4FSV A;  4DV4 K;  4I9L A;  4C1N K;  3CHW A;  3MXM A;  2YNH A;  4E7J A;  4E7I A;  1HNI A;  1QE1 A;  5E26 A;  3HI0 A;  3D7E O;  4PL8 A;  4FK4 A;  3KLF A;  3K2P A;  4CZI A;  4BR9 A;  5H1S Q;  4PKH A;  5FPM A;  2FF3 B;  1CZB A;  3K9J A;  4CBX A;  5AQQ A;  4JLH A;  1LWC A;  4R79 A;  2ZGY A;  4KHY A;  4DTS A;  3L4I A;  4BRN A;  3OW2 M;  1I94 K;  1YF5 L;  4J2D A;  1VHX A;  3R3L A;  4N5S A;  4JHD B;  2HF3 A;  3C0B A;  1JLC A;  5HRN A;  3OYE A;  1HNX K;  3DXM B;  4MDA A;  5HRP A;  1Q7Y O;  3OYN A;  3H3N O;  5LY3 A;  4B1Y B;  2PZS A;  4B1U B;  4E19 A;  1DKG D;  4DR1 K;  1RT6 A;  3KIO A;  1N34 K;  5LMN K;  3D2F A;  4H5R A;  5CZ2 A;  3ZX3 A;  1RGI A;  3SMP A;  3KLH A;  4BC3 A;  3TSU A;  4GKK K;  4CZL A;  2NRH A;  3LP2 A;  4G9Z A;  1S5J A;  3SZ2 A;  5CZ1 A;  2O8C A;  4PKI A;  2P9U A;  2BE2 A;  4KH4 A;  1RT7 A;  1VQ7 N;  3OVN A;  3SQ4 A;  2DFE A;  2KZZ A;  1KC8 O;  4GV3 A;  1L3S A;  3ZCM A;  2KTQ A;  3JXU A;  1OKJ A;  4YNQ A;  2KFZ A;  4UY8 O;  5FLX O;  4FJM A;  3SBG A;  1EO1 A;  2HVH A;  1RDW X;  2YNI A;  3ZSR A;  4IO8 A;  3CCE N;  4AH9 A;  3T7Z A;  3F73 A;  5AZI A;  4CJ4 A;  1Q9X A;  1GLF O;  2XHB A;  4DQR A;  3OYK A;  4KO0 A;  3M8S A;  5FRM A;  1C0M A;  3AGK A;  1HYS A;  2KHO A;  2UUA K;  1XI1 A;  4CK3 A;  5HRR A;  1BIU A;  1DLO A;  2E8A A;  4RW6 A;  2G8W A;  4ISE A;  3OYD A;  2E2O A;  3OYF A;  3THW B;  2KFN A;  1U45 A;  1NKE A;  4V19 S;  1OVQ A;  4DTR A;  1HQU A;  1RDD A;  1ZBH A;  2WUS A;  1NK6 A;  3M5R A;  4JNE A;  1WSG A;  4BWM A;  4OX9 K;  4ISG A;  3CPW M;  4DF4 A;  1YVU A;  3Q7C A;  3I8B A;  1YIJ N;  4E1M A;  3HO1 A;  4JI3 K;  3P83 D;  2CH6 A;  1X1P A;  3WNH A;  3DOL A;  2FC0 A;  3QDK A;  1ESV A;  3C6U A;  4FWS A;  5AZJ B;  4X64 K;  2Q2R A;  1VQP N;  5FPN A;  4WQ4 C;  2DY4 A;  4CF1 A;  4CCH A;  1NGG A;  1DGK N;  4LSL A;  4Q5V A;  3V81 A;  4W5R A;  3NH2 A;  2VCP A;  3UIQ A;  3THY B;  4FJI A;  1ZBU A;  1BWF O;  3IRX A;  4HUG A;  2P9L B;  3QFP A;  3CCQ N;  3MEC A;  4FOI A;  3TR8 A;  4QCL A;  4KTW A;  3MEG A;  3MX2 A;  4JS5 A;  2QM1 A;  1NMN A;  3PX0 A;  4PUO A;  4FCY A;  4AF1 A;  4EHU A;  3ENO A;  2QWM A;  4OPJ A;  4EZ9 A;  2Q36 A;  1HKC A;  3PX6 A;  3ZSQ A;  4CGJ A;  3AO1 A;  4FWN A;  1REV A;  3M8P A;  4BRI A;  2YHW A;  1HYZ A;  2ZQB A;  3ULD A;  3OBW A;  4DG1 A;  1EP4 A;  2P9K A;  1JXB A;  4B1Z A;  3SPY A;  3K5M A;  3ZT0 A;  1RBU A;  2PYJ A;  4WCE L;  1YTA A;  3K5O A;  1NK5 A;  3EN9 A;  1VRT A;  1MWM A;  3R6M A;  3JSM A;  4IEI A;  3M8Q A;  5KGW A;  2P1J A;  4DTO A;  3IAY A;  1IBM K;  4BWJ A;  4O0J A;  2I7P A;  4E3S A;  1LWE A;  4CD1 A;  3C65 A;  5FDL A;  5GIO A;  4JKG B;  4B8C A;  1JCG A;  3MWT A;  4NCB A;  3MEE A;  2ZD1 A;  4AM6 A;  4BR4 A;  4MFB A;  1ZBI A;  1S1V A;  1IV0 A;  4GVM A;  2YCH A;  2QWO A;  2B5J A;  3QER A;  3DLE A;  4K43 A;  3AVH A;  4BR5 A;  4CHO A;  3LDN A;  3VEW A;  3KKS A;  1NOY A;  4FW1 A;  4CE9 A;  2NRT A;  4IEE A;  4CF8 A;  3KK3 A;  4B1W B;  4JI5 K;  3IKM A;  2P9N B;  2HHW A;  1RBV A;  2I7N A;  1SL1 A;  3J7Y P;  3OYG A;  4C1N I;  1U2V B;  1KVA A;  2XY6 A;  1RCH A;  1YXQ A;  4DR2 K;  4FJL A;  4OPA A;  1VSK A;  4ID5 A;  2ZJP L;  4M3X A;  4OO1 J;  4CIG A;  3M6G A;  1LAW A;  3OYH A;  5HLF A;  3K0S A;  4NYF A;  3CJ1 A;  2VG6 A;  4ELV A;  2H3G X;  3KZB A;  3BDP A;  3HOS A;  1ZYQ A;  4H0Y B;  4BQL A;  3C7N B;  1VQO N;  1KCF A;  2AP1 A;  3OYJ A;  3OA9 A;  4BRE A;  1XQS C;  4DMN A;  2JWL A;  3O9S A;  4X66 K;  4DSJ A;  3PO5 A;  1YJ9 N;  1NNE A;  2FBY A;  3FE1 A;  4KHU A;  1EET A;  1K6Y A;  1HNV A;  3DLK A;  1TYQ A;  3VQ5 A;  4OKE A;  4M45 A;  4GVE A;  1Q8I A;  2OTJ N;  1ATR A;  3ZEU A;  4DFJ A;  4GMJ B;  3MXJ A;  3DXK A;  2PYL A;  3JAM O;  1GOC A;  3FZF A;  3UE5 A;  4R5P A;  2HB5 A;  2WFB A;  1NJZ A;  2KKZ A;  3E9P A;  4Y1D A;  4W5T A;  3C6H A;  4A5A A;  3H1V X;  4BRO A;  2X6N A;  3C6T A;  4OKJ A;  1VQ4 N;  4DV0 K;  1WAJ A;  3OJS A;  3AA4 A;  1NMD A;  1RT5 A;  3ASM A;  4A62 A;  3DOK A;  4DV2 K;  3CM5 A;  2WON A;  4JD2 B;  3T69 A;  1QSS A;  1VSH A;  1U48 A;  2VGM A;  4CER A;  2O8D A;  4YOV A;  4DV3 K;  1XC3 A;  3DM2 A;  1IBK K;  1N5Y A;  4LY7 A;  3LDP A;  3AA3 A;  2E4L A;  4LF7 K;  3MED A;  5BRH A;  4YDU A;  2O4I A;  2W6L A;  5GIP A;  3K59 A;  1T44 A;  2P9I A;  3ID8 A;  5AQG A;  3DLH A;  4M3Z A;  5EU7 A;  3O3G A;  5I9E B;  3BEX A;  1CZA N;  4DS5 A;  1O13 A;  5SZT A;  4DR5 K;  3A8Y A;  3BZC A;  3AVN A;  1XWL A;  5BRF A;  4AHV A;  4LH5 A;  2OTL N;  4I6M A;  4WF9 L;  4C8N A;  3JYT A;  3ITH A;  3L4Q A;  3V9S A;  5DMR A;  3NGZ A;  3DRS A;  3VMF B;  2ATQ A;  4XEI A;  3TAF A;  1KLN A;  2AJQ A;  5C12 A;  3I55 N;  1CXU A;  4IBN A;  5JLF A;  2ZE2 A;  2P9P B;  3D45 A;  4K25 A;  2Q0R A;  3DXM A;  1K8K B;  4FLZ A;  2HND A;  1KD1 O;  3T3F A;  4DQS A;  3VGK A;  1OH7 A;  3A5N C;  3C94 A;  1SL2 A;  2G8K A;  3CQ8 A;  4AIL C;  2FSJ A;  4BRG A;  3K9K A;  2IVP A;  2HNY A;  4BGA A;  4BVP A;  3S41 A;  3VQQ A;  4JRQ A;  1L3T A;  4IOA L;  2QWN A;  4KKO A;  1I39 A;  3FZH A;  4DLG A;  4B9U A;  1U04 A;  1ATS A;  1KVC A;  2JGU A;  4BDY A;  1UA0 A;  1KQS M;  5KTQ A;  4WQ5 A;  2UU9 K;  1RDB A;  2W40 A;  2GBZ A;  4Q0B A;  4CHP A;  3PX4 A;  4J8F A;  3RRG A;  4JKH A;  4EFH A;  2CH5 A;  4H5V A;  1JCF A;  2A41 A;  4YHH K;  5I42 A;  3HT3 A;  5LL6 Z;  2FLO A;  3VQ9 A;  3ZSZ A;  4F8R A;  1XHZ A;  4N76 A;  4FPB A;  3SNN A;  2IOC A;  5F2R A;  4LD0 A;  4DQI A;  2D0B A;  4AHU A;  5HRO A;  5AQJ A;  3M1F A;  4CJS A;  3CCR N;  4M3W A;  3ZSX A;  2NLX A;  1ATN A;  4FJ8 A;  1E3M A;  2RN2 A;  2AA4 A;  1YJN N;  2E1Z A;  4K8Z A;  1NGD A;  3HZ6 A;  2CGL A;  3LP1 A;  5AQH A;  1YIT N;  1WN7 A;  4K8X A;  3NF7 A;  4BC5 A;  4CHY A;  3PLA A;  3U3Y A;  1SKR A;  2FSN A;  3AA5 X;  3NVK A;  4B9V A;  1TK0 A;  4FM2 A;  1NK0 A;  1TL1 A;  5AR0 A;  2QWP A;  2E5L K;  2G8F A;  4NLC A;  1M90 O;  4IFY A;  4JI6 K;  4PA1 A;  1VRU A;  1Q81 O;  4WQ4 A;  1GLC G;  3VEN A;  3BP8 A;  3VEX A;  4C23 A;  4BQZ A;  4G1Q A;  3O3F A;  3CJ7 A;  3QIP A;  3ZET B;  3S3O A;  2IVO A;  2DPN A;  1UWB A;  3L2W A;  5M1N A;  3PV8 A;  4XH4 A;  5AZJ A;  4B3S K;  3UKU A;  2CGJ A;  2E1Y A;  3UKR A;  3I0R A;  4JKC A;  3EKS A;  4KAZ A;  3LM9 A;  5KI6 A;  1NWK A;  3LDL A;  3HP9 A;  4M7Y A;  3CFO A;  5AQO A;  3TAG A;  4C8O A;  4NXM K;  1HKB A;  1BUP A;  2P9L A;  3CD6 N;  4YOT A;  3ZT1 A;  4IFE A;  4ICL A;  4KRE A;  5HBM A;  3WXM B;  3WEE B;  5M1Q A;  4DSE A;  3VQC A;  3RMB A;  3QML A;  2HHU A;  1NGJ A;  3DJC A;  3U4L A;  2HHH K;  4DR7 K;  4YOU A;  3HXM A;  4B8A B;  4CHZ A;  4K42 A;  4FJ7 A;  3LZJ A;  4DQ8 A;  1D5A A;  2G8V A;  3O5B A;  3M3Z A;  1F21 A;  5F1X A;  2JLE A;  1QSY A;  3T19 A;  1TAQ A;  3VET A;  3EY1 A;  4CJW A;  5LJW A;  1JLE A;  4BRQ A;  2RHK A;  1YJW N;  4CEO A;  1VSM A;  3CC2 N;  4MO4 A;  3TTD A;  1BI4 A;  1VSL A;  4CGI A;  4M3T A;  1HJR A;  2HHS A;  3NGY A;  1RDA A;  2EWS A;  1NGC A;  1RNH A;  4CED A;  4OLA A;  3VQB A;  3PIP L;  5AQW A;  1NGE A;  3W0L A;  4JKA A;  2Q0U A;  4JKG A;  1GLL O;  4A61 A;  5DM6 L;  4E7H A;  2HF4 A;  3WNE A;  4PQU A;  4OGE A;  2HMP A;  1MWK A;  3THX A;  3VQE A;  1ZBL A;  2PBD A;  3L3V A;  2O8B A;  3HST B;  1QZ5 A;  3FGU A;  4YOW A;  4DLE A;  4OKK A;  3AV9 A;  3V1R A;  2FXU A;  1BA1 A;  1RT4 A;  2D5R A;  5C24 A;  5J1E A;  1JLA A;  4CEF A;  1IBL K;  4DTM A;  3AAR A;  2UXD K;  5MLC Q;  2GWJ A;  4TSX A;  1WAF A;  1TKD A;  2D0A A;  4LFB K;  1BOT O;  3RSE A;  5BN9 A;  4JKF A;  2BTF A;  2IC3 A;  3BUZ B;  3J81 O;  3PO4 A;  3ZLJ A;  4F3O A;  3SI6 A;  4JI8 K;  4Z4I A;  1GLJ O;  1YT3 A;  4HCC A;  3ATV A;  3VA0 A;  1QQO A;  4LF6 K;  4BRA A;  1X9M A;  5IWA K;  2D4W A;  2UXB K;  5AQI A;  5GIN A;  1VQ5 N;  4QOZ B;  5AQM A;  1VQK N;  4BDP A;  4BR0 A;  1RBT A;  2YNF A;  3K57 A;  5C2D A;  4CJV A;  3QIO A;  1LV5 A;  4FJN A;  3C7N A;  4DUY K;  4GV6 A;  2RPI A;  3ZSV A;  1D9D A;  1U6Z A;  4OGC A;  3EKU A;  3RVC A;  4CJL A;  1K9M O;  4BE2 A;  3QNO A;  3ZT2 A;  1TV6 A;  1ILY A;  5D3G A;  1JLQ A;  3MX5 A;  1RTH A;  4FLT A;  2E2N A;  4RW7 A;  1QSL A;  4J2A A;  3SQ2 A;  4FW2 A;  3CCS N;  3EE9 A;  3KWI A;  1EXQ A;  5HOO A;  4H5N A;  4BGB A;  4DR6 K;  1KXP A;  5AQT A;  3RR8 A;  4BG8 A;  4KHP K;  2OPR A;  1HYV A;  2B4J A;  1KAX A;  2ASM A;  3MWP A;  2NRR A;  1QVF M;  3VF2 A;  4EP4 A;  1VSI A;  3ALY A;  4O5F A;  2J4R A;  3EE8 A;  3MCA B;  3TTF A;  3NDK A;  4I2P A;  3TAE A;  3HK2 A;  4FJX A;  3AVJ A;  3O4N A;  3GDQ A;  3HM9 A;  1D4X A;  4LH4 A;  4K0K K;  3FZK A;  3HM8 A;  2HBJ A;  3D2E B;  4M3R A;  4CEQ A;  3QFU A;  1J5E K;  3R1X A;  4CJU A;  1NJW A;  1WBD A;  1K8A O;  4BRH A;  2YHX A;  3QBX A;  1T03 A;  4FJG A;  4FO0 A;  2KW4 A;  5C0Y A;  3SQ1 A;  2OPQ A;  1UA1 A;  2GUI A;  2ASP A;  3TI0 A;  4JK7 A;  2XY8 A;  4FZY A;  3KKR A;  3ZX2 A;  4U67 L;  5BR9 A;  3GL1 A;  4FJ5 A;  3NF8 A;  3C6A A;  1GLB G;  2IIR A;  5CYM A;  4NCA A;  4BE1 A;  3KLE A;  1RTI A;  5KQD A;  3NE6 A;  4IKF A;  4JKB A;  5GAD P;  4KBO A;  1U4B A;  3KLI A;  3AVB A;  3KD1 E;  3WXJ A;  3P5J A;  3D0P A;  1TKZ A;  3VN5 A;  3G6E N;  3O1W A;  4FWM A;  2O8E B;  3NF9 A;  2G8H A;  1DTQ A;  3CQY A;  1JJ2 M;  4QS8 A;  2F7T A;  4CGH A;  2FBT A;  1NK9 A;  3ZSW A;  4MDB A; 
#chains in the Genus database with same CATH homology
 1WAJ A;  4Z4G A;  1W9H A;  3OJS A;  3AA4 A;  1RT5 A;  2NUB A;  3ASM A;  4CFC A;  3KTQ A;  4AHR A;  1FKP A;  2R7Y A;  3DOK A;  4DTP A;  3SPZ A;  4WE1 A;  3L2R A;  1G15 A;  3CM5 A;  3F9K A;  2WON A;  4I9Q A;  2X6S A;  2DTU A;  1QQC A;  3ZSO A;  4CJQ A;  1QSS A;  4KPY A;  1VSH A;  1B9F A;  1U48 A;  3QET A;  4CJR A;  3HL8 A;  4HHT A;  1J9A A;  1ASV A;  4CER A;  1T05 A;  3OS2 A;  2I5J A;  4E1N A;  3SV3 A;  1FK9 A;  1UOC A;  2FBV A;  4PY5 A;  2X78 A;  4F3T A;  4M41 A;  1RBS A;  3E01 A;  4H8K A;  2KZM A;  1W0H A;  3DM2 A;  2Z1H A;  3LPT A;  1S6P A;  5FRO A;  4W5O A;  4LY7 A;  3SUP A;  3AA2 A;  1ZBL A;  1N5Y A;  2DFF A;  3AA3 A;  3DLG A;  2Y1I A;  2E4L A;  1KFD A;  4J2E A;  3MED A;  4B9S A;  3G0Z A;  1C6V A;  1WSE A;  4CIF A;  3KJV A;  2O4I A;  5E41 A;  3K59 A;  4LSN A;  3U3G A;  4CIE A;  3DLH A;  3KK1 A;  1CLQ A;  1O1W A;  4N56 A;  3L2V A;  5EU7 A;  4M3Z A;  2XRI A;  1HQE A;  4DSK A;  2KQ2 A;  2YNG A;  3O3G A;  4CFB A;  4B08 A;  2VG5 A;  4DQQ A;  1RBR A;  1TKT A;  4DSF A;  3V1O A;  1ASU A;  3QNN A;  4DS5 A;  5JS1 A;  4HUE A;  5CY4 A;  1T7P A;  1IG9 A;  2XY7 A;  2XY5 A;  1S9E A;  3M8R A;  1HMV A;  3AVC A;  3DRR A;  3NH1 A;  5SZT A;  1BQM A;  4IFV A;  3DYA A;  3LP0 A;  4N41 A;  3LAK A;  2IS3 A;  3AVN A;  1ASW A;  1XWL A;  1L5U A;  4AHV A;  4LH5 A;  3HVT A;  3NF6 A;  3TAR A;  4E7L A;  4CF2 A;  3AVM A;  3QO9 A;  3VQ7 A;  3LPU A;  5KRS A;  5J2M A;  1BL3 A;  4C8N A;  1TGO A;  1NOZ A;  3SYZ A;  4J2B A;  1TK5 A;  3CG7 A;  3S9H A;  1BGX T;  3JYT A;  1KRP A;  4KB1 A;  1JL1 A;  3ITH A;  1JKH A;  3LP3 A;  1ITG A;  1J5O A;  4KB0 A;  3V9S A;  4FZZ A;  2YHA A;  3DLR A;  3O4Q A;  5DMR A;  3NGZ A;  1BHL A;  1S9G A;  3DRS A;  3AO5 A;  2HMI A;  1BIZ A;  2ATQ A;  1KVB A;  3AVA A;  3NAE A;  3TAF A;  3B6P A;  3L3U A;  1KLN A;  2HHQ A;  2AJQ A;  1RT3 A;  2YV0 X;  3VA3 A;  1T8E A;  4FJK A;  1CXU A;  4IBN A;  2IAJ A;  2WOM A;  4FM0 A;  3PY8 A;  3HVR A;  2ZE2 A;  4CES A;  4E7K A;  4IDK A;  4DU4 A;  3H08 A;  3RR7 A;  3D45 A;  2BGG A;  4RW4 A;  2A1S A;  1YTU A;  2Z1I A;  4CEC A;  4B9L A;  4FLZ A;  2HND A;  5C25 A;  1SKS A;  1JLF A;  3T3F A;  1TK8 A;  4DQS A;  3HJF A;  3NFA A;  3EYZ A;  3VQP A;  4JRP A;  3C94 A;  1SL2 A;  3OYC A;  2G8K A;  4I9L A;  3CQ8 A;  4AIL C;  4ELU A;  1SKW A;  4W5N A;  4C8L A;  2HNY A;  3MXM A;  2YNH A;  3VQQ A;  3L2U A;  1HNI A;  4JRQ A;  4E7J A;  4E7I A;  2P5O A;  4Z4E A;  4CJP A;  1QE1 A;  1L3T A;  4F4K A;  4KTQ A;  4FK4 A;  4CK2 A;  1Q9Y A;  4KKO A;  3KLF A;  1I39 A;  3K2P A;  4DLG A;  1D9F A;  3DMJ A;  4KFB A;  4B9U A;  1U04 A;  3OJU A;  2HHT A;  1HPZ A;  2QKB A;  1KVC A;  3CM6 A;  2D0C A;  1J54 A;  2JGU A;  4CF9 A;  4BDY A;  2VWJ A;  1HRH A;  1UA0 A;  1IKV A;  1CZB A;  3OYM A;  5KTQ A;  4RW9 A;  1RDB A;  3LAN A;  1NKB A;  1NK7 A;  4JLH A;  4DTN A;  1LWC A;  2GBZ A;  4FLU A;  3HYF A;  4CHP A;  3PX4 A;  4Q0B A;  2DFH A;  4CGF A;  4KI6 A;  1TAU A;  3RRG A;  3K5L A;  3FFI A;  1IO2 A;  3LZI A;  2QK9 A;  1GOA A;  4DTX A;  2Z1J A;  4FM1 A;  4KHY A;  5I42 A;  3HT3 A;  2Y1J A;  4DTS A;  1A5W A;  1WNS A;  3S3M A;  4EZ6 A;  2OZS A;  4CF0 A;  4J2D A;  3VQ9 A;  3ZSZ A;  4Y1C A;  1XHZ A;  4F8R A;  4N76 A;  4EP5 A;  4ZTF A;  3SNN A;  4N5S A;  2IOC A;  1Z25 A;  4DQI A;  3PUF A;  4LD0 A;  4DQP A;  2D0B A;  3TWH A;  4AHU A;  5HRO A;  1JLC A;  4CEA A;  4Z4F A;  5HRN A;  3V9X A;  3OYE A;  4FJH A;  3U6F A;  4F2R A;  1JLG A;  4CJS A;  4Z4H A;  5HRP A;  4M3W A;  1A5V A;  1SV5 A;  3OYN A;  1IKW A;  3CYM A;  2XO7 A;  3QLH A;  1R0A A;  2PZS A;  4E19 A;  2IDO A;  3AVK A;  3ZSX A;  3L2Q A;  1EKE A;  5DK5 A;  4FJ8 A;  2G8I A;  1RT6 A;  2RN2 A;  1RTJ A;  3KIO A;  4RW8 A;  3VQ6 A;  4BDZ A;  1TKX A;  4K8Z A;  1UAX A;  3AVF A;  3LDS A;  3LP1 A;  5CZ2 A;  1WSH A;  3THV A;  3KLH A;  1WN7 A;  5SWM A;  4K8X A;  3NF7 A;  3I0S A;  1BCM A;  3IS9 A;  4CHY A;  2E6L A;  3SQ0 A;  3HP6 A;  5J2P A;  3OY9 A;  3U3Y A;  1SKR A;  4OJR A;  3AA5 X;  3V4I A;  4B9V A;  1TK0 A;  4FM2 A;  5CYQ A;  1TL1 A;  1NK0 A;  1LWF A;  1VSD A;  3LP2 A;  2G8F A;  1SL0 A;  3ZT4 A;  1S5J A;  4BE0 A;  3SZ2 A;  5CZ1 A;  1TL3 A;  4IFY A;  4CGD A;  3KLG A;  3SUN A;  4O5B A;  4PA1 A;  1VRU A;  2BE2 A;  2YKM A;  1RT7 A;  4CK1 A;  1B9D A;  3T1A A;  4CGG A;  3OVN A;  3ZSY A;  3CFP A;  1L3U A;  3QEW A;  1KSP A;  4IG3 A;  3SQ4 A;  4NCG A;  1MU2 A;  2DFE A;  1WSJ A;  1BI4 B;  3VQ4 A;  3RTV A;  2KZZ A;  4OVL A;  1IKX A;  3S3N A;  4G1Q A;  3IG1 A;  3O3F A;  4MQ3 A;  1L3S A;  4KI4 A;  3QEV A;  4HCB A;  4C8M A;  3ZCM A;  4CJ3 A;  3QIP A;  2KTQ A;  3WNF A;  4FK2 A;  4E89 A;  4YNQ A;  2KFZ A;  3S3O A;  1CZ9 A;  5FRN A;  1KTQ A;  4HUF A;  4FJM A;  3KD5 E;  2HVH A;  1UWB A;  3L2W A;  3PV8 A;  3SV4 A;  2YNI A;  3ZSR A;  1I3A A;  4O55 A;  4AH9 A;  4KV8 A;  3MAQ A;  2HW3 A;  1S1W A;  3F73 A;  2LSN A;  4CJ4 A;  3I0R A;  3QEP A;  1Q9X A;  4N47 A;  4KAZ A;  2HNZ A;  2XHB A;  4DQR A;  3OYK A;  5KI6 A;  2YHB A;  2F8T A;  3HP9 A;  5T7B A;  3CFO A;  3TAP A;  3OS1 A;  4DTJ A;  3LAL A;  3TAG A;  3AVG A;  4C8O A;  4KO0 A;  3M8S A;  5FRM A;  1C0M A;  2BDP A;  1HYS A;  4QAG A;  3NCI A;  1XI1 A;  4CK3 A;  3ISN C;  5HRR A;  3ZT1 A;  1BIU A;  1DLO A;  4ICL A;  4KRE A;  1CXQ A;  5HBM A;  3A2F A;  4DSE A;  4RW6 A;  2G8W A;  3VQC A;  3OYD A;  3RMB A;  2HHU A;  3OYA A;  4B9T A;  2E6M A;  3OYF A;  2KFN A;  1U45 A;  4FVM A;  1NKE A;  3HPG A;  1KFS A;  1BIS A;  4DTR A;  1HQU A;  1NK4 A;  3HXM A;  4B9M A;  1RDD A;  1ZBH A;  4H4M A;  1NK6 A;  4DSI A;  4B8A B;  1QS4 A;  3HPH A;  4FLV A;  1WSG A;  3V9U A;  4CHZ A;  3NH0 A;  4FJ7 A;  3LZJ A;  4BWM A;  3V9Z A;  1D5A A;  1KLM A;  2G8V A;  1IKY A;  1X9W A;  4DFP A;  1C1A A;  1F21 A;  4DF4 A;  1YVU A;  2JLE A;  4DS4 A;  1QSY A;  3T19 A;  1S1T A;  3AVL A;  3OYL A;  1TAQ A;  3EY1 A;  2OYQ A;  1RT2 A;  1JLB A;  4CJW A;  1JLE A;  4E1M A;  3SJJ A;  3HO1 A;  1NJY A;  3K5N A;  4FLW A;  5K14 A;  5JS2 A;  3P83 D;  1X1P A;  4HVJ A;  2VG7 A;  3WNH A;  2P51 A;  4CEO A;  3DOL A;  1VSM A;  2FC0 A;  3WNG A;  4C8K A;  3C6U A;  3OYB A;  3RRH A;  3SCX A;  4B9N A;  4YFU A;  1BI4 A;  1VSL A;  4CGI A;  1WSI A;  3HPO A;  3RMA A;  5I3U A;  1HJR A;  4M3T A;  2HHS A;  4UQG A;  2QXF A;  3NGY A;  2DY4 A;  1RDA A;  2YKN A;  4CF1 A;  1VSF A;  4CFD A;  4FLX A;  4KTZ A;  4DU3 A;  1BQN A;  4Q5V A;  4LSL A;  4CCH A;  3V81 A;  4W5R A;  1RNH A;  4CED A;  3NH2 A;  2EHG A;  4OLA A;  3VQB A;  1TVR A;  3UIQ A;  5HP1 A;  3K58 A;  3RMD A;  4FJI A;  3AVI A;  4O4G A;  1ZBU A;  3IRX A;  4W5Q A;  2A1R A;  4HUG A;  4E7H A;  3WNE A;  1N6Q A;  2W42 A;  3MEC A;  4OGE A;  4PQU A;  3TR8 A;  3NGI A;  4QCL A;  5J2N A;  1FXX A;  2IGI A;  4KTW A;  3VQE A;  3L3V A;  3MEG A;  4O44 A;  1Y97 A;  3G10 A;  4DU1 A;  2F96 A;  3HST B;  4JS5 A;  4KHW A;  2O4G A;  1X9S A;  2PY5 A;  4O0I A;  4DLE A;  4OKK A;  3PX0 A;  4PUO A;  3VQA A;  3AV9 A;  3V1R A;  4FJJ A;  4FCY A;  1RT4 A;  2D5R A;  5C24 A;  5J1E A;  5KRT A;  4CEB A;  4EZ9 A;  4OPJ A;  3B6O A;  1JLA A;  4CEF A;  2OZM A;  4DTM A;  3PX6 A;  3ZSQ A;  1NKC A;  4OLB A;  5HRS A;  4CGJ A;  3DLB A;  3AO1 A;  1C1B A;  1REV A;  3M8P A;  4ZTJ A;  1XC9 A;  1VSE A;  4TSX A;  1WAF A;  1TKD A;  2D0A A;  2HVI A;  1HYZ A;  1RIL A;  2ZQB A;  4CJT A;  3I8D A;  3ULD A;  4DG1 A;  1LAV A;  3AO3 A;  1EP4 A;  3RMC A;  1RTD A;  1JXB A;  2RKI A;  3VQD A;  1EX4 A;  3SPY A;  2IC3 A;  3K5M A;  3PO4 A;  3ZT0 A;  4F3O A;  1RBU A;  2PYJ A;  3SI6 A;  1YTA A;  3AO4 A;  4Z4I A;  3K5O A;  4AHS A;  1NK5 A;  1VRT A;  4OPK A;  4DF8 A;  1YT3 A;  4HCC A;  1VK0 A;  3JSM A;  3VA0 A;  4BAC A;  3M8Q A;  3LAM A;  5KGW A;  3C95 A;  3RWU A;  1IH7 A;  3OS0 A;  2Z1G A;  1X9M A;  3NHG A;  2P1J A;  4DTO A;  2ITG A;  1NJX A;  3IAY A;  4F2S A;  3V1Q A;  4QOZ B;  1LW0 A;  4BWJ A;  1S1U A;  4O0J A;  2OA8 A;  4KRF A;  4E3S A;  1LWE A;  4BDP A;  1DTT A;  1RBT A;  4AHC A;  4FZX C;  3O3H A;  4L8R B;  2YNF A;  5FDL A;  4FXD A;  3K57 A;  4CJV A;  3QIO A;  1LV5 A;  4KHS A;  4FJN A;  2HHX A;  1RDC A;  2RPI A;  4B8C A;  3ZSV A;  1D9D A;  4NCB A;  3MEE A;  4OGC A;  4M3Y A;  2ZD1 A;  4ID1 A;  1RT1 A;  4CJL A;  1XHX A;  5KGX A;  1D8Y A;  4BE2 A;  4MFB A;  1ZBI A;  3QNO A;  3ZT2 A;  2Q3S A;  1TV6 A;  4XIU A;  3QIN A;  2F8S A;  5D3G A;  4Z0U A;  1JLQ A;  1B92 A;  1S1V A;  4NYN A;  5C42 A;  4CHQ A;  1C0U A;  1RTH A;  3V6D A;  3V9W A;  3TAB A;  1JXE A;  4GVM A;  4RW7 A;  4FLT A;  2B5J A;  3QER A;  1QSL A;  1C1C A;  4IG0 A;  3CFR A;  3SQ2 A;  4J2A A;  4FW2 A;  1U49 A;  4RG8 A;  3DLE A;  3AVH A;  1A5X A;  4CHO A;  4DWI A;  3SUQ A;  1EXQ A;  1BCO A;  3KKS A;  4CJE A;  1NOY A;  2G8U A;  4FW1 A;  2GV9 A;  4CJ5 A;  4Z4C A;  4CE9 A;  3RR8 A;  4M42 A;  4I7F A;  2OPR A;  2B6A A;  1HYV A;  2OPP A;  3SUO A;  4CF8 A;  3KK3 A;  4CEE A;  2B4J A;  4I2Q A;  1QTM A;  5J2Q A;  2FBX A;  2HHW A;  1RBV A;  1SL1 A;  4AHT A;  2EX3 A;  4CJF A;  3MXI A;  1NK8 A;  4EP4 A;  4E0D A;  1VSI A;  3ALY A;  3OYG A;  3TAQ A;  1KVA A;  4CFA A;  4ZHR A;  1RCH A;  4JS4 A;  2XY6 A;  3KK2 A;  3QEX A;  1LW2 A;  3NDK A;  4I2P A;  3TAE A;  3HK2 A;  4FJL A;  4FJX A;  1VSK A;  1GOB A;  3AVJ A;  3O4N A;  4ID5 A;  4M3X A;  4CIG A;  3HM9 A;  1Z26 A;  4FJ9 A;  3QES A;  4HTU A;  4LH4 A;  4CJK A;  1LAW A;  3OYH A;  5HLF A;  1ZBF A;  3BGR A;  4NYF A;  4CHN A;  2VG6 A;  1L3V A;  2RF2 A;  3DI6 A;  4M3R A;  4CEQ A;  2X74 A;  4DFK A;  4ELV A;  3BDP A;  4CJU A;  1NJW A;  4KHQ A;  4B3O A;  3QEI A;  1ZYQ A;  1KCF A;  3OYI A;  1C0T A;  3DRP A;  3OYJ A;  3VQ8 A;  1U47 A;  1T03 A;  4FJG A;  4DMN A;  3LWM A;  4H4O A;  1JL2 A;  3EZ5 A;  4DSJ A;  1SUQ A;  3PO5 A;  3AO2 A;  2KW4 A;  2FBY A;  3SQ1 A;  2OPQ A;  3P1G A;  1UA1 A;  2GUI A;  4KHU A;  4FK0 A;  2ETJ A;  1FKO A;  1S6Q A;  3ZT3 A;  1EET A;  4FYD A;  3TI0 A;  3TAM A;  1K6Y A;  4DTU A;  1HNV A;  3DLK A;  2XY8 A;  4FZY A;  3L8B A;  4ELT A;  3KKR A;  1J53 A;  1WLJ A;  2HHV A;  3VQ5 A;  4NCA A;  4FJ5 A;  3NBP A;  3NF8 A;  4OKE A;  2VWK A;  5CYM A;  4M45 A;  4BE1 A;  3KLE A;  3LWL A;  1Q8I A;  4DFJ A;  4GMJ B;  1QHT A;  1RTI A;  3MXJ A;  3NE6 A;  4DFM A;  4IKF A;  3TAN A;  2PYL A;  4M3U A;  1GOC A;  2OPS A;  1U4B A;  4FLY A;  3KLI A;  3AVB A;  2P5G A;  3KD1 E;  1WSF A;  3P5J A;  2HB5 A;  4R5P A;  3D0P A;  1NJZ A;  2QKK A;  1VSJ A;  4CEZ A;  1TKZ A;  3VN5 A;  4PWD A;  4Y1D A;  3NF9 A;  4W5T A;  4GW6 A;  4DSL A;  2G8H A;  4KHN A;  1DTQ A;  2X6N A;  4CGH A;  2FBT A;  1S1X A;  2BAN A;  1NK9 A;  3C6T A;  3ZSW A;  4OKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...