1RBVA

Structural study of mutants of escherichia coli ribonuclease hi with enhanced thermostability
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADAKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural study of mutants of Escherichia coli ribonuclease HI with enhanced thermostability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE H
total genus 52
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rbvA00
1VSHA 3HPGA 4OJRA 4AHRA 2PYLA 4FLWA 4LD0A 4CEFA 4DQPA 4F2RA 4KRFA 3MXJA 5JS2A 4FJ9A 3M8QA 3L2RA 4E3SA 1LWFA 3MECA 1BI4B 5SWMA 1S1VA 1XHXA 4HTUA 3QESA 1U48A 1T05A 1QSSA 2ZE2A 1IO2A 2ZD1A 4CGHA 4FJGA 4KHUA 1HYZA 2OYQA 1CLQA 1BHLA 4LSLA 1A5XA 1RBVA 4E7HA 4QOZB 4W5OA 2WOMA 2IAJA 1LAVA 2P1JA 4CGGA 2LSNA 5EU7A 4HUGA 1C6VA 4E7JA 1G15A 4DF8A 4KAZA 1I3AA 2B5JA 1JLEA 3AO4A 2D5RA 3OYIA 1NJWA 4M3XA 3HK2A 5E41A 1UOCA 3AA3A 3CQ8A 4BDPA 4FZZA 4OKJA 3K59A 1D8YA 2Z1IA 5HBMA 4WE1A 4HVJA 3U6FA 4C8KA 2KZZA 3NH1A 4FXDA 1RT4A 4ID5A 2BE2A 3F9KA 1S9EA 5KRSA 3ZCMA 2X6NA 1TKZA 3LANA 1KFSA 3OYDA 3TAPA 4B9VA 3SV4A 4GW6A 3LAKA 5KI6A 4F2SA 3JYTA 1L3TA 1KRPA 1WSJA 4PUOA 4CERA 1RBRA 4DTNA 2Y1JA 1UWBA 4BWMA 4E1NA 1J53A 3OJUA 4CF9A 1S6PA 4FLYA 1L5UA 4KHYA 4F3TA 3AVHA 3RMCA 1FKPA 4KPYA 2YNGA 1WAJA 4FJ8A 1RCHA 2G8IA 1RDAA 3SNNA 2YV0X 4B8AB 3M8PA 4DG1A 2KFNA 3SUOA 3KKRA 3K5NA 1XC9A 1ITGA 4AHVA 1KLMA 3VQBA 1HNVA 5J2PA 4FJMA 1TAQA 4BE0A 4DU1A 3QLHA 4CJKA 1BL3A 2OPPA 4DSKA 3C94A 1L3VA 3RR7A 1KVCA 1ZBFA 3QETA 3WNEA 3SQ1A 4CCHA 5FDLA 3KJVA 3DLKA 1KTQA 4CECA 3AVIA 4NCGA 4CGDA 1HQEA 1O1WA 3E01A 3NGYA 3NH0A 1NOYA 4BACA 1LWCA 1A5WA 4CJFA 3SYZA 3L2QA 1VSIA 3RRHA 3B6OA 5J2MA 1U45A 2AJQA 3L2VA 3L2UA 3TI0A 1RT5A 3LP0A 3CFOA 5CY4A 2DTUA 4R5PA 1C0UA 1DTQA 2I5JA 3A2FA 3WNGA 1MU2A 1X1PA 1HQUA 3NF6A 4CF0A 1EETA 2A1SA 1BIUA 4W5QA 4B9SA 3K57A 1DTTA 4DTPA 3M8RA 4OLAA 1FKOA 4DMNA 3V1RA 2G8FA 3ZSQA 4CESA 4AHSA 4KO0A 4N5SA 4ID1A 4CIFA 4CGJA 1N6QA 4OPJA 3SPYA 1RTJA 1A5VA 3HM9A 4CHZA 3HYFA 3QIPA 1NK4A 4KB0A 1S6QA 3QNNA 4J2DA 1RDCA 4OLBA 4CFCA 4AILC 3ZSWA 4DFKA 1YT3A 4O0JA 1RBUA 3NBPA 2VG7A 1TV6A 2OZMA 3WNHA 4CK3A 1SV5A 4M3RA 1KSPA 4AHCA 5C25A 4C8MA 1U04A 4HCCA 4IG0A 2BDPA 3MAQA 2ETJA 4O44A 2W42A 3P1GA 2DY4A 2YNHA 2HNYA 4DQSA 1L3UA 2FBVA 4BWJA 4NYFA 3ZSVA 4BDYA 4KHSA 5J2QA 3K5MA 3HP6A 4B9MA 3NGIA 4UQGA 2ZQBA 3LPUA 3RRGA 3ALYA 1KVAA 3HP9A 2XY5A 3SI6A 1HPZA 4FK2A 1EX4A 1JXEA 1ZBUA 4CJEA 4J2EA 4B08A 3ULDA 2IOCA 3DLRA 4FJ7A 3M8SA 3VA0A 1JLQA 4DQQA 4KI4A 1J9AA 2OPQA 3KK2A 3AVJA 3L8BA 4DTJA 1HYSA 4DSLA 1VRTA 3H08A 3AA5X 1QQCA 1S1TA 2GUIA 3L3UA 1Q8IA 3OYGA 1RTDA 5FRMA 1VSDA 2BGGA 3PX0A 1QE1A 4FVMA 3OYFA 4FZXC 2G8WA 4Z4EA 1JL2A 3DM2A 3TAQA 3S3OA 3MEDA 4B9NA 3D0PA 1D9DA 4C8NA 4DTUA 3K5LA 2YKNA 4AH9A 5KTQA 3LP1A 4FLVA 1NKCA 2HB5A 4CFBA 4KI6A 3JSMA 2P5OA 2HW3A 3TARA 5KGXA 5CZ1A 1TL1A 4N56A 1S1UA 4KV8A 3OYLA 4M3YA 3HSTB 1SL0A 1BQNA 2FC0A 3S3MA 1SKRA 4Z4GA 4CF8A 3AO2A 3I0SA 2GBZA 1ASUA 3DLHA 3SPZA 4O0IA 3UIQA 1XWLA 3V9WA 3AVGA 4CFDA 4F3OA 1HMVA 1UA0A 1ASWA 4I2PA 5HRPA 1NKEA 4QCLA 4N76A 4FLZA 1JLCA 5I3UA 4DSIA 2RPIA 1S1WA 1Q9YA 2FBXA 4BE2A 4Y1CA 4ZTFA 5CYQA 1LV5A 1B9DA 3OS1A 5HLFA 4F8RA 3HPHA 4PQUA 2NUBA 4CJSA 5HROA 4HUEA 1VK0A 1C0TA 1SKWA 3AA2A 3ZSRA 2FBYA 4KTWA 3EY1A 4LY7A 4J2BA 2QKKA 3OY9A 2RKIA 1VSKA 1B92A 4CF1A 4CEZA 1QS4A 3SQ4A 1NK0A 3AVAA 2Z1GA 4RW9A 3DRRA 4DU3A 2YNIA 2IS3A 4G1QA 2YNFA 1UA1A 4NCAA 2WONA 4B8CA 4CJLA 4BE1A 4K8XA 4I7FA 3EYZA 4CJWA 3VQAA 4DTRA 4B9TA 3PO4A 4M3ZA 4Z4FA 2X78A 3ZT4A 1WSFA 4RG8A 1B9FA 3NDKA 2HNZA 4HHTA 4FM0A 4KHQA 3OYBA 3TAEA 1RT7A 4NCBA 3F73A 2E6MA 1N5YA 2F8SA 3VQDA 3IAYA 3QO9A 3AVBA 5HP1A 1X9MA 2YHAA 1YVUA 3AVMA 3C6UA 2EX3A 1C1CA 2YKMA 3FFIA 3IG1A 4Y1DA 3CFRA 4EP5A 1IKXA 2R7YA 3SJJA 3TR8A 5C42A 3RMDA 1HJRA 4HUFA 3KLHA 4FLXA 3ISNC 1SKSA 1QHTA 2HNDA 3V1QA 4W5NA 5SZTA 4CF2A 1ZYQA 2QXFA 4DSEA 3OYMA 2IGIA 3G10A 1X9WA 1WSGA 4OVLA 4CE9A 1VSMA 1TGOA 1C1BA 3O4NA 4ELTA 1F21A 4FJJA 4IKFA 3SQ0A 3QEVA 3KD1E 1WNSA 2FBTA 4B9UA 3DYAA 3V1OA 1I39A 3PY8A 3DRSA 4CFAA 3IS9A 3DI6A 2XY7A 2HHXA 3THVA 4EZ6A 1C0MA 3U3GA 3RR8A 5K14A 1QSYA 3MEEA 2Y1IA 4E1MA 1LW2A 1RT2A 3AVCA 3LZJA 4KB1A 4JS4A 4DS5A 4OPKA 2Z1HA 4RW6A 3O3HA 4W5TA 3SZ2A 4FM2A 3T19A 3DLGA 5J2NA 3KLIA 1VSLA 3QNOA 4FJXA 3S3NA 4CK1A 1X9SA 3ZT0A 4KHNA 2OZSA 3KLEA 1JLFA 3LP2A 4OGCA 4CEAA 4IG3A 3ZSXA 5JS1A 3K2PA 1KCFA 3P5JA 3PV8A 1NKBA 2GV9A 3DLBA 2D0BA 1KFDA 1VRUA 4Z4HA 1TK0A 1CXUA 3NAEA 4FJNA 3LZIA 1YTAA 3VQQA 4E89A 1NOZA 1W9HA 3O3FA 2VG6A 1LWEA 1VSFA 3MEGA 2X6SA 1ZBIA 4DSJA 1C1AA 1EP4A 4DLEA 4EP4A 3VQPA 1RILA 4CHPA 1BCMA 4BDZA 3OS0A 1RT6A 4DTXA 2DFHA 4OGEA 1TK5A 4W5RA 2KZMA 2G8UA 3LALA 3AV9A 3RWUA 2O4GA 3T1AA 4CJ4A 3MXIA 4O5BA 2KTQA 4JLHA 3VQ5A 5I42A 3VQ6A 3NCIA 4JRQA 1RBSA 4DFJA 1VSEA 4M45A 3VQCA 3TANA 2HHQA 3VA3A 2F96A 3AO3A 3KKSA 4AHUA 3SUPA 3QEIA 1W0HA 4FLTA 3ITHA 3VQ8A 2VWJA 2EHGA 2HHVA 3KLGA 3BGRA 1EXQA 2IDOA 5HRNA 4DTSA 5CZ2A 1CZBA 4N41A 4JRPA 4DU4A 3AO1A 4H4OA 3BDPA 4FM1A 3P83D 1WSIA 4IBNA 2G8HA 1BCOA 4TSXA 1RT1A 3CFPA 4ELVA 2BANA 3MXMA 4YFUA 1WSHA 4H4MA 4CJQA 2QK9A 1WN7A 3QEPA 4YNQA 4FYDA 3C6TA 3SUNA 4AHTA 2G8VA 1R0AA 3NF9A 1ZBHA 1REVA 3K58A 2E4LA 4DLGA 3AVLA 1TKTA 1TK8A 3SCXA 3V9UA 4GVMA 2PY5A 4K8ZA 3I0RA 4FCYA 5J1EA 1RTIA 4DTOA 2JGUA 5DK5A 3SV3A 4DFPA 1XHZA 2HMIA 1IKYA 1WSEA 1DLOA 4FJKA 2XRIA 4M41A 2JLEA 1J5OA 4CHYA 3TAGA 2HHSA 1RDBA 3VQ7A 1Q9XA 5HRRA 2A1RA 2OA8A 2QKBA 1Y97A 3OYKA 3LDSA 5KGWA 1JLGA 1NK9A 3AA4A 4J2AA 3NE6A 3ZSYA 4E0DA 4N47A 4FLUA 3L3VA 1BIZA 2RN2A 1GOAA 4CK2A 1TL3A 4DQIA 1YTUA 1K6YA 4ICLA 3AVFA 4FK0A 4O4GA 1IH7A 3DRPA 4DFMA 3ZT1A 4I2QA 1T8EA 3AO5A 1S1XA 2IC3A 4DWIA 1J54A 1JKHA 4NYNA 3RTVA 3CM6A 3LAMA 4E7LA 3ZSOA 4DTMA 3VQ9A 4E7KA 3O3GA 3G0ZA 1EKEA 2ATQA 1T7PA 1FK9A 1Z25A 2PZSA 2KW4A 2DFEA 1RTHA 4Q0BA 3WNFA 1D9FA 3V4IA 5T7BA 3HL8A 4CJRA 4FJHA 1JLBA 1NK8A 3V9ZA 3IRXA 2D0CA 3KIOA 1ASVA 3D45A 4CHNA 1JL1A 3ASMA 4ZHRA 2B4JA 1XI1A 3V81A 4B3OA 2ITGA 1WLJA 2VG5A 4CJVA 4KREA 2KFZA 4CEBA 3QINA 3VN5A 1WAFA 3ZT3A 4Q5VA 4MFBA 3DMJA 3V6DA 3HJFA 4CHOA 4PA1A 3OYJA 2O4IA 1GOCA 3T3FA 1L3SA 3HXMA 1TKDA 4FK4A 1TAUA 4L8RB 3ZSZA 4JS5A 3L2WA 4KKOA 4CJTA 4I9LA 5HRSA 3U3YA 1CZ9A 3AVNA 3PX6A 4DF4A 4ELUA 3HVTA 2Z1JA 4RW4A 3OYAA 3HO1A 3NGZA 2X74A 1JLAA 2D0AA 3VQ4A 4LH5A 3KK1A 1QSLA 2HHWA 2XY6A 1NJZA 3DOLA 2KQ2A 2XHBA 2G8KA 5KRTA 2YHBA 1T03A 1HRHA 1LAWA 3KTQA 3O4QA 1BQMA 4Z0UA 3I8DA 4DS4A 4DSFA 4ZTJA 5CYMA 4M3UA 4OKEA 1JXBA 3QERA 3QEWA 1NJYA 4PY5A 1KVBA 1FXXA 4GMJB 3RMBA 1BISA 3V9SA 1RDDA 3SUQA 3LWMA 3S9HA 1KLNA 2P5GA 3PUFA 4QAGA 3SQ2A 3V9XA 2Q3SA 3LP3A 3HVRA 2XY8A 4MQ3A 4LH4A 4PWDA 3TABA 4H8KA 4CEQA 1U47A 2OPRA 1U49A 4FJ5A 3LWLA 1S9GA 1GOBA 1S5JA 4CJPA 3OS2A 2XO7A 3QEXA 3C95A 4LSNA 2PYJA 1HYVA 2B6AA 4CHQA 2RF2A 3OYNA 3OJSA 4C8OA 2E6LA 3OYEA 4CIGA 4HCBA 1SL1A 3CYMA 3TAFA 4F4KA 4KTZA 2HVIA 4RW8A 1NJXA 4EZ9A 1RBTA 3NF8A 3HT3A 1IKVA 4FJLA 4O55A 4C8LA 1TKXA 4CEEA 4E7IA 3TAMA 4CEDA 4M42A 3B6PA 4OKKA 3HPOA 4Z4CA 5FRNA 3RMAA 4IFVA 3OYCA 1CXQA 1LW0A 4FW1A 1SUQA 4RW7A 5C24A 3KD5E 4B9LA 3DOKA 3VQEA 3CG7A 1ZBLA 1SL2A 1QTMA 1VSJA 4M3WA 3PO5A 2F8TA 4E19A 3CM5A 5D3GA 4Z4IA 3DLEA 3NHGA 2HHTA 4CJ5A 3NH2A 3PX4A 1BGXT 3LPTA 2HHUA 3OYHA 1D5AA 1BI4A 4IDKA 1RT3A 2VWKA 3QIOA 4CEOA 3NFAA 3KLFA 3TWHA 4FZYA 4CJ3A 4CIEA 1IG9A 4FJIA 4KTQA 1NK6A 2OPSA 2DFFA 1NK7A 1NK5A 2HVHA 1RNHA 4IFYA 5DMRA 3ZT2A 4I9QA 4CJUA 1Z26A 1HNIA 3K5OA 4DQRA 4KFBA 3NF7A 1UAXA 4FW2A 1IKWA 4CGFA 3EZ5A 1U4BA 4CGIA 4KHWA 4M3TA 1TVRA 4XIUA 3KK3A 3OVNA 5FROA 2P51A 3AVKA
chains in the Genus database with same CATH superfamily
1VSHA 4AHRA 5KPZA 4F2RA 4LD0A 4LFBK 4LF7K 5SWMA 4HTUA 1QSSA 4GV9A 4CGHA 1VHXA 3QICA 2FSKA 4W5OA 1L3SA 1I3AA 1JLEA 3HK2A 5E41A 5GINA 3THYB 3K59A 2Z1IA 5HBMA 4C8KA 2KZZA 1DGKN 1RT4A 4ID5A 3G4SN 5KRSA 4IO8A 3SV4A 2E2OA 4F2SA 3JYTA 4JKHA 4PUOA 1R59O 4DTNA 2Y1JA 1L5UA 1Q18A 1FKPA 3K0SA 2WTUA 1RCHA 2KFNA 3SUOA 3KKRA 2QWQA 2A5XA 3VEWA 1HNVA 3A0IX 3VGLA 3ZX2A 4X65K 4CJKA 1BL3A 2OPPA 4DSKA 1YITN 3DLLL 3C94A 3G71N 1ZBFA 3WNEA 3JXUA 3C65A 2QEXN 3CCLN 3I33A 4BRCA 4JKCA 1HQEA 3MX2A 4BACA 1A5WA 4EAHD 3L2QA 1VSIA 3L2UA 3TTDA 5AQMA 2I5JA 3A2FA 4B3SK 1X1PA 2NZTA 3WXJA 4EHTA 2BTFA 4DQ8A 3M8RA 1FKOA 3VTHA 2G8FA 4AHSA 4N5SA 4IOAL 3FZHA 1EO1A 1W7AA 3NMUA 1NNEA 4MO5A 4JI3K 5C2DA 4J2DA 2OCEA 2VQFK 2YHXA 2ASOA 2E5LK 2UUCK 1RBUA 2VGMA 4JHDB 2F9WA 3WNHA 4M3RA 2E88A 5C25A 1U04A 4HCCA 4A2AA 3P1GA 1L3UA 4H5RA 4NYFA 3HRGA 5J2QA 4J8FA 4UQGA 3O80A 2HF4A 1JXEA 4J2EA 3ULDA 3M8SA 1QQNA 1JLQA 5AFUH 4FL9A 1J9AA 2AP1A 3VERA 1VRTA 1YJ9N 3AA5X 1S1TA 2GUIA 1Q8IA 1MA9B 4FZXC 3D6RA 4Z4EA 1JL2A 3H1QA 4B9NA 4GV3A 5AQVA 5KTQA 2O8CB 2P9KB 3L6QA 3KVGA 4FLVA 3JSMA 2P5OA 2IVPA 4N56A 1S1UA 4M3YA 2BH1A 3S3MA 2Q2RA 3I0SA 3UIQA 3UKUA 4BG8A 4BRGA 3V9WA 4CFDA 1HMVA 1ASWA 1YUWA 4I2PA 3AAPA 4QCLA 4N76A 4FLZA 2RPIA 4IZ9A 1Q9YA 2FBXA 3BUZB 1HKCA 5HLFA 3HPHA 2NUBA 3J81O 4CJSA 2PBDA 3C7NA 3AA2A 4KTWA 3O1BA 1NGFA 4J2BA 1B92A 1K8KA 3AY9A 1KXPA 1NGBA 4YOTA 2YNIA 4JKGA 4CJLA 4K8XA 1NWKA 4M3ZA 1WSFA 3NDKA 4HHTA 1T6DA 3ENBA 3TAEA 3GE1A 2E6MA 3CCUN 3OA9A 3QO9A 3AVBA 5HP1A 1X9MA 5AZIB 1VQ4N 1SZ2A 2O8DA 5JLFA 3IG1A 2R7YA 3SJJA 4B9VA 3TTCA 3A5OC 1IKXA 4FLXA 1QHTA 3B8AX 3GDQA 1YF5L 3ULEB 3J80O 4BR5A 3CCMN 4FJJA 1TGOA 3OW2M 3RSEA 3CJ7A 5C2FA 2OANA 2UUAK 4CFAA 2WUSA 3IS9A 3GBTA 1EQYA 3THVA 4E1MA 2P9SB 5AQZA 2HBKA 4DS5A 5KPTA 3DXKB 4RW6A 3SZ2A 1NU0A 3MWPA 2D0PA 4FM2A 3T19A 2Q0UA 3VF6A 5J2NA 1BDGA 5JLHA 4FJXA 3S3NA 4CK1A 2QWMA 3TU5A 3MDQA 4OGCA 4CEAA 4B1VA 3K2PA 4IJNA 5F1XA 1TK0A 3NAEA 1C0GA 1OH7A 4E89A 3O3FA 2VG6A 3IDHA 4YOUA 3MEGA 2Q97A 1MDUB 4DSJA 1EWQA 4DUZK 4BDZA 4DTXA 2DFHA 5AFUA 1TK5A 2V51B 3PIPL 3T1AA 4CJ4A 4X64K 1DEJA 4K25A 1BOTO 4JLHA 1TUUA 4JRQA 3HM8A 4M45A 2W6LA 3TANA 2FSNA 4E1JA 3AO3A 2JWKA 3C6AA 1XMOK 2EHGA 4O5FA 1YJNN 4H4OA 3BDPA 4RTFD 2G8HA 4TSXA 1RT1A 3CFPA 3VGKA 4YFUA 3MXMA 4WQ5A 4AM6A 3QEPA 4FYDA 2YJFA 3K58A 4DLGA 3AVLA 3SCXA 3MWTA 4JKEA 2HMIA 3IFRA 3SV3A 4A61A 1DLOA 2XRIA 2JLEA 3H3NO 4CHYA 3TAGA 2HHSA 1RDBA 3VQ7A 2OA8A 2P9PA 1JLGA 3AARA 4JHDA 1NK9A 1KD1O 3PSFA 4E0DA 4N47A 4V19S 1BIZA 2RN2A 4CK2A 3VF2A 2ZJPL 1TL3A 1K6YA 4ICLA 4JI4K 4FK0A 3WXMB 4O4GA 1IH7A 3HBTA 3W3DA 3LAMA 4E7LA 3FGUA 3L4QA 3VQ9A 4C1NI 1OVYA 4BGAA 2PFUA 3V4IA 5T7BA 4DR2K 3WQTA 2GTDA 4RWTA 5EXWA 1ASVA 4ZHRA 2ITGA 4CJVA 4A5BA 3O9SA 5LMUK 4CEBA 3QINA 5AZJA 4DV2K 3VN5A 4Q5VA 4MFBA 4FWMA 3HJFA 3OYJA 1CZAN 3ZEUB 3T3FA 3HXMA 3CCRN 1TAUA 4JS5A 5BPLA 4KKOA 4I9LA 4DF4A 4OO1J 4CZJA 2D0AA 3KK1A 3J7AP 1HRHA 3KTQA 3MN6A 1WBDA 4AM7A 4Z0UA 2D0OA 3N4QA 1E3MA 2OTJN 4OKEA 3FR0A 2V7ZA 3QEWA 2I7NA 3HTVA 3PUFA 1MWKA 4B3MK 3LP3A 4CBWA 4H8KA 4CEQA 4FJ5A 2XO7A 2RHKA 2RF2A 3OYNA 4C8OA 1SL1A 4C23A 4MDBA 4E7IA 3M6GA 3KWGA 4OKKA 4M42A 1H1VA 2QI2A 3RMAA 3OYCA 2UUBK 3U8XA 3VQEA 1QTMA 1VSJA 5AJ3K 3P39A 4H5VA 3CM5A 3OTOK 3E66A 4IDKA 3KLFA 3TWHA 4FJIA 4KTQA 1NK7A 3IKMA 2HVHA 5DMRA 3VEOA 5EOYA 1Z26A 3K5OA 4JI6K 4KFBA 4CGFA 4JN4A 1IKWA 3EZ5A 1J6ZA 1HNXK 3T1YK 3CJBA 4OJRA 4FLWA 4KRFA 3MXJA 5JS2A 1S1VA 1XHXA 2IVOA 3SK3A 3GG4A 4FJGA 1SS6A 1HYZA 2OYQA 3O9TA 1J5EK 3D2FA 3ZETA 3HI0A 4A5AA 5GADP 1C6VA 3AO4A 3SMPA 3WT0A 2D5RA 4CZEA 5IT9O 4FZZA 4BDPA 4GV6A 5E26A 1D8YA 4WE1A 3F9KA 1S9EA 3A5NC 3ZCMA 2X6NA 1TKZA 3LANA 4YDUC 2Q31A 3R9PA 5KI6A 1ATSA 4E1NA 4KHYA 4CF9A 1S6PA 4F3TA 1NGAA 2YNGA 2O8EA 3O9UA 2QTDA 3M8PA 2F4VK 4JKAA 1XC9A 1ITGA 1KLMA 3VQBA 4NLBA 4BE0A 3QLHA 3DAWA 4WQ4A 5ADXA 3FZMA 4H5TA 3RR7A 1KVCA 5FDLA 1KTQA 3SAHA 3NGYA 3E01A 1NOYA 3NH0A 4B1YB 4CJFA 3EKSA 3L2VA 1RT5A 3LP0A 2DTUA 4CZKA 1C0UA 1DTQA 2YI1A 3NF6A 4CF0A 3FZFA 2Q36A 1DTTA 3QFPA 2P9PB 1NG9A 1Z6RA 5CR4A 3UB5A 4JKDA 3V1RA 3ZSQA 3TPQA 4CIFA 4KH6A 4LF9K 2QWLA 1N6QA 4OPJA 4BR9A 1RTJA 5AQWA 3QIPA 3H3OB 3QNNA 4JI7K 1RDCA 3ZSWA 3U9DA 4O0JA 4DR3K 3E9OA 1SV5A 2O8FA 4YOYA 4JI5K 2HNYA 1QZ6A 3ZSVA 2P9UA 3NGIA 2ZQBA 3OBWA 2XY5A 5JVHL 1ZBUA 2P9KA 3VA0A 2ZF5O 3AVJA 1GLDG 3L8BA 4DTJA 4JI8K 1HYSA 1JCEA 4FOEA 4BR7A 1N36K 5FRMA 3BZCA 4FOIA 3OYFA 2G8WA 3OBYA 4H5WA 2A6AA 4H03B 2YKNA 3EL2A 2QWOA 5AQFA 2GEMA 2P9NA 4CFBA 3R3LA 3GOIA 5AQNA 5CZ1A 4CD3A 4KH4A 3OYLA 3ATVA 2FC0A 4X62K 2JWLA 2GBZA 1ASUA 1Y64A 3I56N 4GVEA 3AVGA 4F3OA 5HRPA 4DV6K 1NKEA 4MLHA 5HL7L 3C0BA 1S1WA 2FLOA 4JKFA 3PLAA 4BQZA 3DXKA 4ZTFA 1LV5A 4BRPA 1VK0A 1VQ8N 2KKZA 2FSJA 2O8DB 2QKKA 2RKIA 4BR2A 3WXIA 4CF1A 3SQ4A 2W41A 2Z1GA 4RW9A 4LFAK 4G1QA 2GWKA 4CZMA 4B8CA 3FE1A 3F2KA 1TYQB 4ISEA 4CJWA 3VQAA 4Z4FA 3ZT4A 3RSEB 4FM0A 2HNZA 1NM1A 3ID6A 4NCBA 2E2PA 3WXLA 1NGJA 1N5YA 2F8SA 4CW7B 3AVMA 2YJEA 3CFRA 3FFIA 4B3TK 4EP5A 1IBKK 5C42A 3MK6A 3RMDA 1HJRA 4HUFA 3C7NB 4H0OA 3ISNC 3KLHA 1SKSA 4W5NA 2QXFA 2QWPA 1X9WA 4IKFA 1VSMA 4YOVA 1BO5O 3SQ0A 1WNSA 4DV0K 3E9LA 1OVQA 2FBTA 4JK9A 4FWRA 1K73O 3DI6A 3CCVN 3CD6N 3MN7A 3U3GA 4WFAL 3ENOA 2E1YA 1LW2A 1RT2A 3T1HK 3AVCA 3LZJA 5AZIA 3O3HA 5AQUA 3CJAA 3KLIA 3QNOA 1JJ2M 1X9SA 3LP2A 4ILGB 4BVOA 3CPEA 4K43A 3Q7CA 2A40A 1I94K 4Z4HA 3JAMO 3U9ZA 4MLEA 3VQQA 5ELZA 2WFBA 1YIJN 1W9HA 4DV3K 1HLUA 1NBWA 2HBMA 1VSFA 1ZBIA 1EP4A 5BR9A 3VQPA 1RILA 3WQUA 3OS0A 1RT6A 3UKUB 4JI1K 2KZMA 2G8UA 3CHWA 3AV9A 3RWUA 2O4GA 2Q0RA 3VQ5A 5I42A 1SAZA 5ADXH 1P90A 3CCEN 3DWLA 4G9ZA 3KZBA 1NLVA 2HHQA 2F96A 4XH1A 4AHUA 4JK7A 5AQKA 4FLTA 1GLBG 1T6CA 2HHVA 5CZ2A 1CZBA 4N41A 4DU4A 5AZJB 4IBNA 3C6TA 4AHTA 4F9OA 1ZBHA 5AQXA 3H6EA 3V9UA 4K8ZA 1N8RO 1RTIA 3IUCA 4WQ4C 1WSEA 4M41A 1E4FT 3HOTA 1Q9XA 5HRRA 1XC3A 3KHYA 2A1RA 5M1QA 5FPMA 4CVNE 4YY3K 3OYKA 3LDSA 5KGWA 2ZJQL 4AF1A 3ZSYA 1O13A 1M90O 3SMSA 3CJCA 4BRDA 1Q86O 3AVFA 2QWRA 3DRPA 5JICA 4I2QA 2IC3A 4NYNA 4EFHA 3ENHA 1NMDA 4DTMA 2F9TA 4E7KA 3G0ZA 3VTIA 4JV5K 3P38A 3IMXA 2KW4A 4M7YA 2DFEA 3WNFA 4JNEA 4FJHA 1NK8A 3O5BA 2D0CA 3KIOA 4PL8A 4KREA 2VG5A 1WLJA 3QFUA 2CH5A 5B8HA 1S72N 1WAFA 2EWSA 5AQYA 4GKJK 4PA1A 2O4IA 1GOCA 3O08A 2I7PA 4CBXA 4FWOA 1JCFA 5HRSA 4FO0A 1CZ9A 4ISGA 3OYAA 5BREA 3HO1A 1X3NA 2QXLA 2NRVA 2P9SA 3AGKA 5M1KA 2GUPA 3C6HA 2QA4N 4WYBA 2KQ2A 1NJZA 1T03A 1T44A 1LAWA 1ZBSA 3F9MA 2IIRA 5AQHA 1JXBA 3QERA 1NJYA 4WCEL 3I55N 5F0XA 3S9HA 1KLNA 3O1WA 3HVRA 2XY8A 3THWB 4PWDA 3TABA 3EN9A 1U47A 2OPRA 3LWLA 1D4XA 1GOBA 1KAZA 1S5JA 3A5MC 3WUHA 3QEXA 3D7EO 2B6AA 4CHQA 4KHPK 4CI6A 3EEQA 4F4KA 2GWJA 4LF8K 3VPZA 1RBTA 3ATUA 1GLJO 3NF8A 1IKVA 4FJLA 4O55A 2E8AA 4JI2K 1VQMN 3VEZA 4CEDA 3B6PA 2HBLA 2Q1NA 1OH5A 2IVNA 4IFVA 1LW0A 4FW1A 3SJHA 4H0XB 1SL2A 3QB0A 4CJ7A 2F8TA 4ISFA 4KH5A 3DLEA 3NHGA 5BN8A 2HHTA 3NH2A 1BGXT 3LPTA 2HHUA 4K42A 1D5AA 4BRKA 1RT3A 4CIEA 1IG9A 4JYAK 2OPSA 1YHQN 3NF7A 1UAXA 2ASPA 4FW2A 4MDAA 4XIUA 4NB4A 3OVNA 4DV7K 3TSUA 3HPGA 4XH5A 3FZKA 2PYLA 4DQPA 1BWFO 4CEFA 2P9LA 3M8QA 3L2RA 4E3SA 1LWFA 1BI4B 4PHTX 3QESA 2ZE2A 4FPBA 2ZD1A 4NO7A 4PKHA 4KHUA 4B1UB 1CLQA 2FF6A 1A5XA 3EE8A 4E7HA 4QOZB 5EY4A 2IAJA 4E7JA 1LAVA 2P1JA 2HHXA 2LSNA 5EU7A 4YHHK 4BR4A 1G15A 4FWKA 5M1OA 2B5JA 1NJWA 1KC8O 4M3XA 2P9IA 3ZEUA 5E84A 2V7YA 4GY2B 2UXCK 4OKJA 5C12A 2YCHA 5MLCQ 3NH1A 4JK8A 4DR4K 5AQTA 3TAPA 4GW6A 3EE9A 3MN5A 3LAKA 4A62A 2GX9A 5BPMA 1L3TA 4CERA 4BWMA 3R8EA 3OJUA 1J53A 4FLYA 4FWQA 3RMCA 1WAJA 1Q82O 2G8IA 3LL3A 3SNNA 2YV0X 4B8AB 4DG1A 3O4WA 3RVCA 5J2PA 4FJMA 1TAQA 4DU1A 5KPRA 2QM1A 3CJ9A 1L3VA 3SQ1A 3UKRA 3KJVA 4CECA 4NCGA 4B1ZA 3CF5L 1O1WA 4BQLA 5C15A 4H0PA 1RFQA 3RRHA 3B6OA 3CQYA 5J2MA 1U45A 2AJQA 2HHHK 4YOXA 5I9EB 3N4PA 4R5PA 1XMQK 3VMFB 3HSCA 1BIUA 3K57A 4DTPA 4IXCA 2NLXA 2D1KA 4CESA 4KO0A 5BPNA 3OHRA 3MN9A 3O6WA 1EWRA 3SPYA 3ZX3A 4DUYK 1A5VA 2VQEK 4CHZA 3HYFA 1NK4A 4OLBA 4DFKA 1S22A 1YT3A 3NBPA 2VG7A 2OZMA 4WQ5C 4CK3A 3F5TA 1KSPA 4C8MA 4IG0A 2BDPA 1NGCA 2ETJA 2W42A 1QVGM 4KHSA 4PKGA 3K5MA 3HP6A 3ZETB 2OTLN 2NRHA 3HP9A 1YJWN 4A2BA 4FK2A 4B08A 4FJ7A 3G25A 2ZGYA 5AQRA 2OPQA 3KK2A 5FPNA 4GKKK 4DR5K 4DSLA 3H08A 2DPNA 2J4RA 2O8BB 3L3UA 2ZM6K 3NVMA 5AQGA 5IWAK 3CETA 1QE1A 4FVMA 3PX0A 3DM2A 3S3OA 5F2RA 1D9DA 4C8NA 4AH9A 1K8AO 1XUPO 3LP1A 4KI6A 1NKCA 2HB5A 3VESA 3P4IA 3HSTB 1RDUA 1BQNA 3I8BA 1DT9A 4DHYA 2CH6A 5GAHP 3SPZA 1NGDA 1XWLA 3BF1A 1VQKN 4YORA 4EIAA 1UA0A 3MMVA 2ASMA 1TYQA 4DSIA 1HKBA 3R1XA 4Y1CA 1B9DA 2WBNA 3O9RA 4CZIA 3LDNA 5HROA 4HUEA 1SKWA 5CHIA 3ZSRA 2FBYA 4LY7A 1E4GT 2P9IB 4CEZA 1RDWX 1QS4A 1NK0A 3AVAA 4RCHA 3DRRA 1X3MA 2WONA 4BE1A 4DTRA 4B9TA 2WC9A 3WEEB 1T3VA 4RG8A 4IWVA 4KHQA 4JKBA 3VQDA 3IAYA 1NGEA 2YHAA 1YVUA 1WBBA 1C1CA 4Y1DA 2AA4A 3TR8A 1NJXA 4BY9C 2HNDA 3V1QA 5SZTA 4DSEA 3OYMA 2IGIA 2UYTA 1WSGA 2KHOA 3H1VX 4OVLA 3ZYYX 1P8ZA 2ZJRL 1F21A 1TUYA 4ELTA 3KD1E 3LM2A 1OH6A 1U2VA 1QVFM 3V1OA 1I39A 3PY8A 4BRNA 2XY7A 4EZ6A 1C0MA 5FPEA 3RR8A 2Y1IA 3VOVA 4KB1A 4JS4A 1XNRK 4DR1K 2FXUA 3DLGA 5M1NA 1VSLA 4KHNA 1KQSM 3WEEA 4BC3A 3KLEA 3ZSXA 1C0FA 1KCFA 5GAGP 3PV8A 2GV9A 3DLBA 5AQPA 2D0BA 3BY5A 1VRUA 1CXUA 1YTAA 1NOZA 3WXKA 4JAXA 1LWEA 2D4WA 1Q7YO 2X6SA 4K0KK 1QZ5A 3KK7A 3E1YA 2PAVA 4JKGB 3G6EN 4O5BA 3CMAN 1ILYA 1HKGA 3VQ6A 2W6KA 4IEEA 4LFCK 2NRWA 1RBSA 3VQCA 3VA3A 3CI5A 4BRAA 5BRDA 3QEIA 1W0HA 3DJCA 3VQ8A 4BC5A 5BRHA 1NGHA 3BGRA 1K9MO 2IDOA 1VQ7N 4YDUA 4JRPA 3CIPA 1QQMA 4DKWA 4FM1A 3P83D 3HOSA 3EZWA 1BCOA 4ELVA 2QK9A 1WSHA 4CJQA 1WN7A 4MO4A 3NF9A 4LF6K 2E4LA 3LM9A 1TKTA 1TK8A 4GVMA 4BRQA 5J1EA 4DTOA 4DFPA 3THXB 1XHZA 5KQ8A 1JCGA 4JEPA 3THXA 4BGBA 4WFBL 2QKBA 1GLLO 4B1XB 3UKRB 4J2AA 3NE6A 5BN9A 4IFEA 4CZHA 4FLUA 4DCHA 3VENA 1YTUA 1WB9A 4BROA 3U4LA 4DFMA 5FLXO 3AO5A 3LDLA 3CM6A 4PKIA 1N32K 3ZSOA 3PIOL 3O3GA 1EKEA 1T7PA 2V52B 4WF9L 4DB3A 1RTHA 4Q0BA 1D9FA 5AQJA 1LOTB 4M7XA 3IRXA 2CGKA 3CQXA 3D45A 4CHNA 3ASMA 1XI1A 2B4JA 3V81A 5HOOA 3ZT3A 3V6DA 4CHOA 2A3ZA 3VGMA 1NJIO 3LDQA 5GIPA 4L8RB 3J7YP 3U3YA 3AVNA 3TSQA 3PX6A 3HVTA 1WUAA 2ZGZA 3FFKB 4RW4A 4U7BA 2BUPA 4LH5A 2HHWA 3DOLA 4FWSA 2QWNA 4BR0A 3O4QA 1BQMA 3I8DA 4DV4K 4DS4A 4XH4A 4DSFA 4ZTJA 2P9LB 4PY5A 3R6MA 1NGGA 1KVBA 1FXXA 4GMJB 5AQQA 3RMBA 1RDDA 5AQIA 3LWMA 3SQ2A 4FVUA 3T7ZA 1WOQA 4NLCA 4IOCL 5BRFA 4LH4A 3D2EA 3L4IA 1S9GA 4IEIA 3OS2A 1Q81O 2PYJA 3C95A 4LSNA 1HYVA 3OJSA 4CIGA 4HCBA 3CYMA 3TAFA 4M63C 3CJ1A 4KTZA 2NRRA 4RW8A 4EZ9A 4CZLA 4NXNK 3HT3A 3SAGA 4C8LA 1TKXA 3BZKA 4CEEA 1XQSC 3TAMA 3KWIA 2UU9K 5FRNA 3A5LC 1SUQA 3KD5E 3O9QA 4JD2A 1IJJA 4B9LA 2A42A 1ZBLA 2CGJA 3PO5A 5H1SQ 4E19A 3AAQA 4Z4IA 1IV0A 2NRZA 4CJ5A 3SLCA 3PX4A 3OYHA 1BI4A 2VWKA 1NK6A 3ZT2A 4CJUA 4DQRA 4M3TA 4KHWA 3KK3A 4BRIA 1M1KO 4FJ9A 1KAYA 3W0LA 3MECA 1U48A 1T05A 1NMNA 1OKJA 1IO2A 2NNWA 2YHWA 4BRHA 1YAGA 4QS7A 1BHLA 4LSLA 1VQPN 1RBVA 2WOMA 2P9NB 1BA1A 4HUGA 4CGGA 4DF8A 4KAZA 3OYIA 3CCSN 5M1PA 1VQ6N 1UOCA 3AA3A 3CQ8A 3U6FA 4HVJA 1W2BM 3QMLA 2BE2A 3PSIA 4Y0WA 3OYDA 1KFSA 1SQKA 4CD1A 2O8FB 3SAFA 1QHAA 4LF5K 1KRPA 1WSJA 1RBRA 4FXDA 1UWBA 2ZWHA 3AVHA 4KPYA 4H0TB 5AQLA 4FJ8A 2VCPA 2W40A 3LDPA 1RDAA 3K5NA 4AHVA 3THWA 2VWBA 4YOWA 1ZC6A 4HWIA 2E1ZA 3MX5A 3QETA 5CE3A 4L3QA 4CCHA 3ID8A 3DLKA 2NRTA 3AVIA 1HJOA 4CGDA 2O8BA 1LWCA 3SYZA 2GELA 5GAEP 1ATNA 4BC4A 4LF4K 3TI0A 2HMPA 5CY4A 3CFOA 3SBGA 3WNGA 3P31A 3M1FA 1MU2A 2YHYA 1HQUA 5LJWA 4DV5K 1EETA 2A1SA 4B9SA 4W5QA 4UY8O 2UXDK 5C10A 3CXCM 4OLAA 4DMNA 4ID1A 3S41A 3QBXA 1U6ZA 4CGJA 1N33K 4FWNA 4ILJA 4HTLA 3HM9A 4KB0A 1S6QA 4H0YB 4CFCA 4AILC 4JI0K 3QDKA 1TV6A 5FPDA 4IO9L 3BEXA 3DXMA 4AHCA 4CZFA 3AGRA 3MAQA 3DXMB 2VYPA 4O44A 2DY4A 2YNHA 3T69A 4DQSA 2FBVA 4BWJA 4PL7A 1V4SA 3E9PA 4BDYA 4B9MA 3RRGA 3LPUA 3ALYA 1KVAA 3SI6A 1HPZA 1EX4A 1ZXOA 4CJEA 2IOCA 3DLRA 3EKUA 4DQQA 4KI4A 1KAXA 3VEYA 1FW6A 1K8KB 1QQCA 3OYGA 4IJAA 1RTDA 3K9JA 1VSDA 2BGGA 3THYA 3MCPA 3TAQA 4H5NA 3MEDA 3D0PA 3FLCO 4DR7K 4DTUA 4EHUA 3K5LA 4NXMK 5LL6Z 5AR0A 2FF3B 1G99A 3D2FB 3QBWA 3NVKA 3H46O 2HW3A 3TARA 5KGXA 1VAZA 3O8MA 1TL1A 1FJGK 4KV8A 4I6MB 1SL0A 1SKRA 4Z4GA 4CF8A 4FWPA 3AO2A 1U2VB 3DLHA 4O0IA 3CC4N 2H3GX 3EO3A 4FPAA 1JLCA 5I3UA 1YXQA 2O8CA 4BE2A 5CYQA 5DM6L 3OS1A 4F8RA 4PQUA 1X9JA 4X66K 1C0TA 4K41A 3EY1A 4AQYK 3OY9A 3M5RA 1VSKA 1GLEG 1HX1A 1NGIA 5JVGL 4DU3A 1UA1A 2IS3A 2YNFA 4NCAA 4QS9A 4I7FA 3EYZA 3PO4A 2X78A 4A59A 1B9FA 3OYBA 2HOEA 1RT7A 3F73A 3SBTA 3C6UA 4I6MA 2EX3A 2YKMA 3D2EB 4LC9B 3VEVA 4CF2A 1ZYQA 4BG9A 5LY3A 3G10A 4CE9A 1C1BA 3O4NA 3QEVA 5LJVA 4B9UA 3DYAA 3FZLA 5TKYA 3VETA 3DRSA 2QW9A 5C0YA 4O8UA 5GIOA 5K14A 1QSYA 3MEEA 3CCJN 3BF3A 4JD2B 5EX5A 4OPKA 3UE5A 2Z1HA 4W5TA 1HNZK 1W97L 3A8YA 3ZT0A 3CERA 2OZSA 1JLFA 2F7TA 4IG3A 5JS1A 3P5JA 2E20A 1NKBA 4ILHA 3LDOA 4BC2A 1KFDA 4A57A 5M1FA 1LCUA 3H45C 4FJNA 2KLAA 3LZIA 1BUPA 1MWMA 1ATRA 1C1AA 4DLEA 4EP4A 1GLAG 3L0QA 4CHPA 1VQ5N 1BCMA 1DKGD 4OGEA 4OPAA 4W5RA 3LALA 4BRLA 3MXIA 2KTQA 3NCIA 1HUXA 2A41A 4DFJA 1BG3A 1VSEA 4C1NK 3CC7N 1OH8A 3KKSA 3CCQN 4BVPA 3SUPA 3ZLJA 1IBMK 2CGLA 1GLFO 4OPHA 1VQNN 3ITHA 1YI2N 4BREA 2VWJA 3KLGA 1EXQA 1GLCG 5HRNA 4DTSA 1N34K 3Q7BA 2O8EB 3AO1A 2NRXA 1WSIA 2BANA 4H4MA 3JS6A 4YNQA 1HNWK 3SUNA 2G8VA 1R0AA 4DV1K 1REVA 4QS8A 2E2NA 2PY5A 3I0RA 4KBOA 4FCYA 4BRMA 2JGUA 5DK5A 3TSPA 1IKYA 3J7ZO 4FJKA 1IG8A 4H0VB 1J5OA 1VQLN 1Y97A 5AQOA 4Z94A 3AA4A 5EVZA 4O8KA 3L3VA 1GOAA 4DQIA 4U67L 3ZT1A 1T8EA 1S1XA 4DWIA 1J54A 1JKHA 3RTVA 4B3RK 1S3XA 2ATQA 1FK9A 1Z25A 2PZSA 1Z05A 3HL8A 4CJRA 4R79A 4B1WB 1JLBA 1BA0A 3V9ZA 3CMEN 1JL1A 4B3OA 2RE2A 1V4TA 2KFZA 2E2QA 1ESVA 3BP8A 3DMJA 4FSVA 4XEIA 2HSTA 1TKDA 3MCAB 4FK4A 3TTFA 4CZGA 1HPMA 2YX6A 3ZSZA 3CPWM 3L2WA 4CJTA 5A2QO 5AQSA 4ELUA 2Z1JA 1XNQK 3NGZA 2X74A 1JLAA 3VQ4A 1QSLA 2XY6A 2ITMA 3GL1A 2G8KA 2XHBA 5LMNK 1QQOA 5KRTA 2YHBA 4IDHA 1YVNA 5CYMA 4M3UA 5DM7L 4WFNL 1BISA 3V9SA 3SUQA 2P5GA 4QAGA 3V9XA 2Q3SA 4MQ3A 1U49A 2HBJA 3VF4A 4CJPA 4FWLA 3M3ZA 2HF3A 2E6LA 3OYEA 1IBLK 5BR8K 4DR6K 2HVIA 1RGIA 1HR0K 4B9QA 3VEXA 4BRFA 3HPOA 4Z4CA 1CXQA 4GNIA 2UXBK 2P9UB 4RW7A 5C24A 5JMVA 3DOKA 1VQON 3CG7A 1VQ9N 4M3WA 5D3GA 5KQDA 2VGNA 3J8AA 4CBUA 3HZ6A 1BU6O 3QIOA 5TKWA 4CEOA 3NFAA 4FZYA 4CJ3A 3ZX0A 4IOXA 2DFFA 1NK5A 1RNHA 4IFYA 4I9QA 1HNIA 1U4BA 4OX9K 3K9KA 4CGIA 3ULEA 1TVRA 5FROA 2P51A 3AVKA 3CC2N
chains in the Genus database with same CATH topology
1VSHA 3HPGA 4OJRA 4AHRA 2PYLA 4FLWA 4LD0A 4CEFA 4DQPA 4F2RA 4KRFA 3MXJA 5JS2A 4FJ9A 3M8QA 3L2RA 4E3SA 1LWFA 3MECA 1BI4B 5SWMA 1S1VA 1XHXA 4HTUA 3QESA 1U48A 1T05A 1QSSA 2ZE2A 1IO2A 2ZD1A 4CGHA 4FJGA 4KHUA 1HYZA 2OYQA 1CLQA 1BHLA 4LSLA 1A5XA 1RBVA 4E7HA 4QOZB 4W5OA 2WOMA 2IAJA 1LAVA 2P1JA 4CGGA 2LSNA 5EU7A 4HUGA 1C6VA 4E7JA 1G15A 4DF8A 4KAZA 1I3AA 2B5JA 1JLEA 3AO4A 2D5RA 3OYIA 1NJWA 4M3XA 3HK2A 5E41A 1UOCA 3AA3A 3CQ8A 4BDPA 4FZZA 4OKJA 3K59A 1D8YA 2Z1IA 5HBMA 4WE1A 4HVJA 3U6FA 4C8KA 2KZZA 3NH1A 4FXDA 1RT4A 4ID5A 2BE2A 3F9KA 1S9EA 5KRSA 3ZCMA 2X6NA 1TKZA 3LANA 1KFSA 3OYDA 3TAPA 4B9VA 3SV4A 4GW6A 3LAKA 5KI6A 4F2SA 3JYTA 1L3TA 1KRPA 1WSJA 4PUOA 4CERA 1RBRA 4DTNA 2Y1JA 1UWBA 4BWMA 4E1NA 1J53A 3OJUA 4CF9A 1S6PA 4FLYA 1L5UA 4KHYA 4F3TA 3AVHA 3RMCA 1FKPA 4KPYA 2YNGA 1WAJA 4FJ8A 1RCHA 2G8IA 1RDAA 3SNNA 2YV0X 4B8AB 3M8PA 4DG1A 2KFNA 3SUOA 3KKRA 3K5NA 1XC9A 1ITGA 4AHVA 1KLMA 3VQBA 1HNVA 5J2PA 4FJMA 1TAQA 4BE0A 4DU1A 3QLHA 4CJKA 1BL3A 2OPPA 4DSKA 3C94A 1L3VA 3RR7A 1KVCA 1ZBFA 3QETA 3WNEA 3SQ1A 4CCHA 5FDLA 3KJVA 3DLKA 1KTQA 4CECA 3AVIA 4NCGA 4CGDA 1HQEA 1O1WA 3E01A 3NGYA 3NH0A 1NOYA 4BACA 1LWCA 1A5WA 4CJFA 3SYZA 3L2QA 1VSIA 3RRHA 3B6OA 5J2MA 1U45A 2AJQA 3L2VA 3L2UA 3TI0A 1RT5A 3LP0A 3CFOA 5CY4A 2DTUA 4R5PA 1C0UA 1DTQA 2I5JA 3A2FA 3WNGA 1MU2A 1X1PA 1HQUA 3NF6A 4CF0A 1EETA 2A1SA 1BIUA 4W5QA 4B9SA 3K57A 1DTTA 4DTPA 3M8RA 4OLAA 1FKOA 4DMNA 3V1RA 2G8FA 3ZSQA 4CESA 4AHSA 4KO0A 4N5SA 4ID1A 4CIFA 4CGJA 1N6QA 4OPJA 3SPYA 1RTJA 1A5VA 3HM9A 4CHZA 3HYFA 3QIPA 1NK4A 4KB0A 1S6QA 3QNNA 4J2DA 1RDCA 4OLBA 4CFCA 4AILC 3ZSWA 4DFKA 1YT3A 4O0JA 1RBUA 3NBPA 2VG7A 1TV6A 2OZMA 3WNHA 4CK3A 1SV5A 4M3RA 1KSPA 4AHCA 5C25A 4C8MA 1U04A 4HCCA 4IG0A 2BDPA 3MAQA 2ETJA 4O44A 2W42A 3P1GA 2DY4A 2YNHA 2HNYA 4DQSA 1L3UA 2FBVA 4BWJA 4NYFA 3ZSVA 4BDYA 4KHSA 5J2QA 3K5MA 3HP6A 4B9MA 3NGIA 4UQGA 2ZQBA 3LPUA 3RRGA 3ALYA 1KVAA 3HP9A 2XY5A 3SI6A 1HPZA 4FK2A 1EX4A 1JXEA 1ZBUA 4CJEA 4J2EA 4B08A 3ULDA 2IOCA 3DLRA 4FJ7A 3M8SA 3VA0A 1JLQA 4DQQA 4KI4A 1J9AA 2OPQA 3KK2A 3AVJA 3L8BA 4DTJA 1HYSA 4DSLA 1VRTA 3H08A 3AA5X 1QQCA 1S1TA 2GUIA 3L3UA 1Q8IA 3OYGA 1RTDA 5FRMA 1VSDA 2BGGA 3PX0A 1QE1A 4FVMA 3OYFA 4FZXC 2G8WA 4Z4EA 1JL2A 3DM2A 3TAQA 3S3OA 3MEDA 4B9NA 3D0PA 1D9DA 4C8NA 4DTUA 3K5LA 2YKNA 4AH9A 5KTQA 3LP1A 4FLVA 1NKCA 2HB5A 4CFBA 4KI6A 3JSMA 2P5OA 2HW3A 3TARA 5KGXA 5CZ1A 1TL1A 4N56A 1S1UA 4KV8A 3OYLA 4M3YA 3HSTB 1SL0A 1BQNA 2FC0A 3S3MA 1SKRA 4Z4GA 4CF8A 3AO2A 3I0SA 2GBZA 1ASUA 3DLHA 3SPZA 4O0IA 3UIQA 1XWLA 3V9WA 3AVGA 4CFDA 4F3OA 1HMVA 1UA0A 1ASWA 4I2PA 5HRPA 1NKEA 4QCLA 4N76A 4FLZA 1JLCA 5I3UA 4DSIA 2RPIA 1S1WA 1Q9YA 2FBXA 4BE2A 4Y1CA 4ZTFA 5CYQA 1LV5A 1B9DA 3OS1A 5HLFA 4F8RA 3HPHA 4PQUA 2NUBA 4CJSA 5HROA 4HUEA 1VK0A 1C0TA 1SKWA 3AA2A 3ZSRA 2FBYA 4KTWA 3EY1A 4LY7A 4J2BA 2QKKA 3OY9A 2RKIA 1VSKA 1B92A 4CF1A 4CEZA 1QS4A 3SQ4A 1NK0A 3AVAA 2Z1GA 4RW9A 3DRRA 4DU3A 2YNIA 2IS3A 4G1QA 2YNFA 1UA1A 4NCAA 2WONA 4B8CA 4CJLA 4BE1A 4K8XA 4I7FA 3EYZA 4CJWA 3VQAA 4DTRA 4B9TA 3PO4A 4M3ZA 4Z4FA 2X78A 3ZT4A 1WSFA 4RG8A 1B9FA 3NDKA 2HNZA 4HHTA 4FM0A 4KHQA 3OYBA 3TAEA 1RT7A 4NCBA 3F73A 2E6MA 1N5YA 2F8SA 3VQDA 3IAYA 3QO9A 3AVBA 5HP1A 1X9MA 2YHAA 1YVUA 3AVMA 3C6UA 2EX3A 1C1CA 2YKMA 3FFIA 3IG1A 4Y1DA 3CFRA 4EP5A 1IKXA 2R7YA 3SJJA 3TR8A 5C42A 3RMDA 1HJRA 4HUFA 3KLHA 4FLXA 3ISNC 1SKSA 1QHTA 2HNDA 3V1QA 4W5NA 5SZTA 4CF2A 1ZYQA 2QXFA 4DSEA 3OYMA 2IGIA 3G10A 1X9WA 1WSGA 4OVLA 4CE9A 1VSMA 1TGOA 1C1BA 3O4NA 4ELTA 1F21A 4FJJA 4IKFA 3SQ0A 3QEVA 3KD1E 1WNSA 2FBTA 4B9UA 3DYAA 3V1OA 1I39A 3PY8A 3DRSA 4CFAA 3IS9A 3DI6A 2XY7A 2HHXA 3THVA 4EZ6A 1C0MA 3U3GA 3RR8A 5K14A 1QSYA 3MEEA 2Y1IA 4E1MA 1LW2A 1RT2A 3AVCA 3LZJA 4KB1A 4JS4A 4DS5A 4OPKA 2Z1HA 4RW6A 3O3HA 4W5TA 3SZ2A 4FM2A 3T19A 3DLGA 5J2NA 3KLIA 1VSLA 3QNOA 4FJXA 3S3NA 4CK1A 1X9SA 3ZT0A 4KHNA 2OZSA 3KLEA 1JLFA 3LP2A 4OGCA 4CEAA 4IG3A 3ZSXA 5JS1A 3K2PA 1KCFA 3P5JA 3PV8A 1NKBA 2GV9A 3DLBA 2D0BA 1KFDA 1VRUA 4Z4HA 1TK0A 1CXUA 3NAEA 4FJNA 3LZIA 1YTAA 3VQQA 4E89A 1NOZA 1W9HA 3O3FA 2VG6A 1LWEA 1VSFA 3MEGA 2X6SA 1ZBIA 4DSJA 1C1AA 1EP4A 4DLEA 4EP4A 3VQPA 1RILA 4CHPA 1BCMA 4BDZA 3OS0A 1RT6A 4DTXA 2DFHA 4OGEA 1TK5A 4W5RA 2KZMA 2G8UA 3LALA 3AV9A 3RWUA 2O4GA 3T1AA 4CJ4A 3MXIA 4O5BA 2KTQA 4JLHA 3VQ5A 5I42A 3VQ6A 3NCIA 4JRQA 1RBSA 4DFJA 1VSEA 4M45A 3VQCA 3TANA 2HHQA 3VA3A 2F96A 3AO3A 3KKSA 4AHUA 3SUPA 3QEIA 1W0HA 4FLTA 3ITHA 3VQ8A 2VWJA 2EHGA 2HHVA 3KLGA 3BGRA 1EXQA 2IDOA 5HRNA 4DTSA 5CZ2A 1CZBA 4N41A 4JRPA 4DU4A 3AO1A 4H4OA 3BDPA 4FM1A 3P83D 1WSIA 4IBNA 2G8HA 1BCOA 4TSXA 1RT1A 3CFPA 4ELVA 2BANA 3MXMA 4YFUA 1WSHA 4H4MA 4CJQA 2QK9A 1WN7A 3QEPA 4YNQA 4FYDA 3C6TA 3SUNA 4AHTA 2G8VA 1R0AA 3NF9A 1ZBHA 1REVA 3K58A 2E4LA 4DLGA 3AVLA 1TKTA 1TK8A 3SCXA 3V9UA 4GVMA 2PY5A 4K8ZA 3I0RA 4FCYA 5J1EA 1RTIA 4DTOA 2JGUA 5DK5A 3SV3A 4DFPA 1XHZA 2HMIA 1IKYA 1WSEA 1DLOA 4FJKA 2XRIA 4M41A 2JLEA 1J5OA 4CHYA 3TAGA 2HHSA 1RDBA 3VQ7A 1Q9XA 5HRRA 2A1RA 2OA8A 2QKBA 1Y97A 3OYKA 3LDSA 5KGWA 1JLGA 1NK9A 3AA4A 4J2AA 3NE6A 3ZSYA 4E0DA 4N47A 4FLUA 3L3VA 1BIZA 2RN2A 1GOAA 4CK2A 1TL3A 4DQIA 1YTUA 1K6YA 4ICLA 3AVFA 4FK0A 4O4GA 1IH7A 3DRPA 4DFMA 3ZT1A 4I2QA 1T8EA 3AO5A 1S1XA 2IC3A 4DWIA 1J54A 1JKHA 4NYNA 3RTVA 3CM6A 3LAMA 4E7LA 3ZSOA 4DTMA 3VQ9A 4E7KA 3O3GA 3G0ZA 1EKEA 2ATQA 1T7PA 1FK9A 1Z25A 2PZSA 2KW4A 2DFEA 1RTHA 4Q0BA 3WNFA 1D9FA 3V4IA 5T7BA 3HL8A 4CJRA 4FJHA 1JLBA 1NK8A 3V9ZA 3IRXA 2D0CA 3KIOA 1ASVA 3D45A 4CHNA 1JL1A 3ASMA 4ZHRA 2B4JA 1XI1A 3V81A 4B3OA 2ITGA 1WLJA 2VG5A 4CJVA 4KREA 2KFZA 4CEBA 3QINA 3VN5A 1WAFA 3ZT3A 4Q5VA 4MFBA 3DMJA 3V6DA 3HJFA 4CHOA 4PA1A 3OYJA 2O4IA 1GOCA 3T3FA 1L3SA 3HXMA 1TKDA 4FK4A 1TAUA 4L8RB 3ZSZA 4JS5A 3L2WA 4KKOA 4CJTA 4I9LA 5HRSA 3U3YA 1CZ9A 3AVNA 3PX6A 4DF4A 4ELUA 3HVTA 2Z1JA 4RW4A 3OYAA 3HO1A 3NGZA 2X74A 1JLAA 2D0AA 3VQ4A 4LH5A 3KK1A 1QSLA 2HHWA 2XY6A 1NJZA 3DOLA 2KQ2A 2XHBA 2G8KA 5KRTA 2YHBA 1T03A 1HRHA 1LAWA 3KTQA 3O4QA 1BQMA 4Z0UA 3I8DA 4DS4A 4DSFA 4ZTJA 5CYMA 4M3UA 4OKEA 1JXBA 3QERA 3QEWA 1NJYA 4PY5A 1KVBA 1FXXA 4GMJB 3RMBA 1BISA 3V9SA 1RDDA 3SUQA 3LWMA 3S9HA 1KLNA 2P5GA 3PUFA 4QAGA 3SQ2A 3V9XA 2Q3SA 3LP3A 3HVRA 2XY8A 4MQ3A 4LH4A 4PWDA 3TABA 4H8KA 4CEQA 1U47A 2OPRA 1U49A 4FJ5A 3LWLA 1S9GA 1GOBA 1S5JA 4CJPA 3OS2A 2XO7A 3QEXA 3C95A 4LSNA 2PYJA 1HYVA 2B6AA 4CHQA 2RF2A 3OYNA 3OJSA 4C8OA 2E6LA 3OYEA 4CIGA 4HCBA 1SL1A 3CYMA 3TAFA 4F4KA 4KTZA 2HVIA 4RW8A 1NJXA 4EZ9A 1RBTA 3NF8A 3HT3A 1IKVA 4FJLA 4O55A 4C8LA 1TKXA 4CEEA 4E7IA 3TAMA 4CEDA 4M42A 3B6PA 4OKKA 3HPOA 4Z4CA 5FRNA 3RMAA 4IFVA 3OYCA 1CXQA 1LW0A 4FW1A 1SUQA 4RW7A 5C24A 3KD5E 4B9LA 3DOKA 3VQEA 3CG7A 1ZBLA 1SL2A 1QTMA 1VSJA 4M3WA 3PO5A 2F8TA 4E19A 3CM5A 5D3GA 4Z4IA 3DLEA 3NHGA 2HHTA 4CJ5A 3NH2A 3PX4A 1BGXT 3LPTA 2HHUA 3OYHA 1D5AA 1BI4A 4IDKA 1RT3A 2VWKA 3QIOA 4CEOA 3NFAA 3KLFA 3TWHA 4FZYA 4CJ3A 4CIEA 1IG9A 4FJIA 4KTQA 1NK6A 2OPSA 2DFFA 1NK7A 1NK5A 2HVHA 1RNHA 4IFYA 5DMRA 3ZT2A 4I9QA 4CJUA 1Z26A 1HNIA 3K5OA 4DQRA 4KFBA 3NF7A 1UAXA 4FW2A 1IKWA 4CGFA 3EZ5A 1U4BA 4CGIA 4KHWA 4M3TA 1TVRA 4XIUA 3KK3A 3OVNA 5FROA 2P51A 3AVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VSH A;  3HPG A;  4OJR A;  4AHR A;  2PYL A;  4FLW A;  4LD0 A;  4CEF A;  4DQP A;  4F2R A;  4KRF A;  3MXJ A;  5JS2 A;  4FJ9 A;  3M8Q A;  3L2R A;  4E3S A;  1LWF A;  3MEC A;  1BI4 B;  5SWM A;  1S1V A;  1XHX A;  4HTU A;  3QES A;  1U48 A;  1T05 A;  1QSS A;  2ZE2 A;  1IO2 A;  2ZD1 A;  4CGH A;  4FJG A;  4KHU A;  1HYZ A;  2OYQ A;  1CLQ A;  1BHL A;  4LSL A;  1A5X A;  1RBV A;  4E7H A;  4QOZ B;  4W5O A;  2WOM A;  2IAJ A;  1LAV A;  2P1J A;  4CGG A;  2LSN A;  5EU7 A;  4HUG A;  1C6V A;  4E7J A;  1G15 A;  4DF8 A;  4KAZ A;  1I3A A;  2B5J A;  1JLE A;  3AO4 A;  2D5R A;  3OYI A;  1NJW A;  4M3X A;  3HK2 A;  5E41 A;  1UOC A;  3AA3 A;  3CQ8 A;  4BDP A;  4FZZ A;  4OKJ A;  3K59 A;  1D8Y A;  2Z1I A;  5HBM A;  4WE1 A;  4HVJ A;  3U6F A;  4C8K A;  2KZZ A;  3NH1 A;  4FXD A;  1RT4 A;  4ID5 A;  2BE2 A;  3F9K A;  1S9E A;  5KRS A;  3ZCM A;  2X6N A;  1TKZ A;  3LAN A;  1KFS A;  3OYD A;  3TAP A;  4B9V A;  3SV4 A;  4GW6 A;  3LAK A;  5KI6 A;  4F2S A;  3JYT A;  1L3T A;  1KRP A;  1WSJ A;  4PUO A;  4CER A;  1RBR A;  4DTN A;  2Y1J A;  1UWB A;  4BWM A;  4E1N A;  1J53 A;  3OJU A;  4CF9 A;  1S6P A;  4FLY A;  1L5U A;  4KHY A;  4F3T A;  3AVH A;  3RMC A;  1FKP A;  4KPY A;  2YNG A;  1WAJ A;  4FJ8 A;  1RCH A;  2G8I A;  1RDA A;  3SNN A;  2YV0 X;  4B8A B;  3M8P A;  4DG1 A;  2KFN A;  3SUO A;  3KKR A;  3K5N A;  1XC9 A;  1ITG A;  4AHV A;  1KLM A;  3VQB A;  1HNV A;  5J2P A;  4FJM A;  1TAQ A;  4BE0 A;  4DU1 A;  3QLH A;  4CJK A;  1BL3 A;  2OPP A;  4DSK A;  3C94 A;  1L3V A;  3RR7 A;  1KVC A;  1ZBF A;  3QET A;  3WNE A;  3SQ1 A;  4CCH A;  5FDL A;  3KJV A;  3DLK A;  1KTQ A;  4CEC A;  3AVI A;  4NCG A;  4CGD A;  1HQE A;  1O1W A;  3E01 A;  3NGY A;  3NH0 A;  1NOY A;  4BAC A;  1LWC A;  1A5W A;  4CJF A;  3SYZ A;  3L2Q A;  1VSI A;  3RRH A;  3B6O A;  5J2M A;  1U45 A;  2AJQ A;  3L2V A;  3L2U A;  3TI0 A;  1RT5 A;  3LP0 A;  3CFO A;  5CY4 A;  2DTU A;  4R5P A;  1C0U A;  1DTQ A;  2I5J A;  3A2F A;  3WNG A;  1MU2 A;  1X1P A;  1HQU A;  3NF6 A;  4CF0 A;  1EET A;  2A1S A;  1BIU A;  4W5Q A;  4B9S A;  3K57 A;  1DTT A;  4DTP A;  3M8R A;  4OLA A;  1FKO A;  4DMN A;  3V1R A;  2G8F A;  3ZSQ A;  4CES A;  4AHS A;  4KO0 A;  4N5S A;  4ID1 A;  4CIF A;  4CGJ A;  1N6Q A;  4OPJ A;  3SPY A;  1RTJ A;  1A5V A;  3HM9 A;  4CHZ A;  3HYF A;  3QIP A;  1NK4 A;  4KB0 A;  1S6Q A;  3QNN A;  4J2D A;  1RDC A;  4OLB A;  4CFC A;  4AIL C;  3ZSW A;  4DFK A;  1YT3 A;  4O0J A;  1RBU A;  3NBP A;  2VG7 A;  1TV6 A;  2OZM A;  3WNH A;  4CK3 A;  1SV5 A;  4M3R A;  1KSP A;  4AHC A;  5C25 A;  4C8M A;  1U04 A;  4HCC A;  4IG0 A;  2BDP A;  3MAQ A;  2ETJ A;  4O44 A;  2W42 A;  3P1G A;  2DY4 A;  2YNH A;  2HNY A;  4DQS A;  1L3U A;  2FBV A;  4BWJ A;  4NYF A;  3ZSV A;  4BDY A;  4KHS A;  5J2Q A;  3K5M A;  3HP6 A;  4B9M A;  3NGI A;  4UQG A;  2ZQB A;  3LPU A;  3RRG A;  3ALY A;  1KVA A;  3HP9 A;  2XY5 A;  3SI6 A;  1HPZ A;  4FK2 A;  1EX4 A;  1JXE A;  1ZBU A;  4CJE A;  4J2E A;  4B08 A;  3ULD A;  2IOC A;  3DLR A;  4FJ7 A;  3M8S A;  3VA0 A;  1JLQ A;  4DQQ A;  4KI4 A;  1J9A A;  2OPQ A;  3KK2 A;  3AVJ A;  3L8B A;  4DTJ A;  1HYS A;  4DSL A;  1VRT A;  3H08 A;  3AA5 X;  1QQC A;  1S1T A;  2GUI A;  3L3U A;  1Q8I A;  3OYG A;  1RTD A;  5FRM A;  1VSD A;  2BGG A;  3PX0 A;  1QE1 A;  4FVM A;  3OYF A;  4FZX C;  2G8W A;  4Z4E A;  1JL2 A;  3DM2 A;  3TAQ A;  3S3O A;  3MED A;  4B9N A;  3D0P A;  1D9D A;  4C8N A;  4DTU A;  3K5L A;  2YKN A;  4AH9 A;  5KTQ A;  3LP1 A;  4FLV A;  1NKC A;  2HB5 A;  4CFB A;  4KI6 A;  3JSM A;  2P5O A;  2HW3 A;  3TAR A;  5KGX A;  5CZ1 A;  1TL1 A;  4N56 A;  1S1U A;  4KV8 A;  3OYL A;  4M3Y A;  3HST B;  1SL0 A;  1BQN A;  2FC0 A;  3S3M A;  1SKR A;  4Z4G A;  4CF8 A;  3AO2 A;  3I0S A;  2GBZ A;  1ASU A;  3DLH A;  3SPZ A;  4O0I A;  3UIQ A;  1XWL A;  3V9W A;  3AVG A;  4CFD A;  4F3O A;  1HMV A;  1UA0 A;  1ASW A;  4I2P A;  5HRP A;  1NKE A;  4QCL A;  4N76 A;  4FLZ A;  1JLC A;  5I3U A;  4DSI A;  2RPI A;  1S1W A;  1Q9Y A;  2FBX A;  4BE2 A;  4Y1C A;  4ZTF A;  5CYQ A;  1LV5 A;  1B9D A;  3OS1 A;  5HLF A;  4F8R A;  3HPH A;  4PQU A;  2NUB A;  4CJS A;  5HRO A;  4HUE A;  1VK0 A;  1C0T A;  1SKW A;  3AA2 A;  3ZSR A;  2FBY A;  4KTW A;  3EY1 A;  4LY7 A;  4J2B A;  2QKK A;  3OY9 A;  2RKI A;  1VSK A;  1B92 A;  4CF1 A;  4CEZ A;  1QS4 A;  3SQ4 A;  1NK0 A;  3AVA A;  2Z1G A;  4RW9 A;  3DRR A;  4DU3 A;  2YNI A;  2IS3 A;  4G1Q A;  2YNF A;  1UA1 A;  4NCA A;  2WON A;  4B8C A;  4CJL A;  4BE1 A;  4K8X A;  4I7F A;  3EYZ A;  4CJW A;  3VQA A;  4DTR A;  4B9T A;  3PO4 A;  4M3Z A;  4Z4F A;  2X78 A;  3ZT4 A;  1WSF A;  4RG8 A;  1B9F A;  3NDK A;  2HNZ A;  4HHT A;  4FM0 A;  4KHQ A;  3OYB A;  3TAE A;  1RT7 A;  4NCB A;  3F73 A;  2E6M A;  1N5Y A;  2F8S A;  3VQD A;  3IAY A;  3QO9 A;  3AVB A;  5HP1 A;  1X9M A;  2YHA A;  1YVU A;  3AVM A;  3C6U A;  2EX3 A;  1C1C A;  2YKM A;  3FFI A;  3IG1 A;  4Y1D A;  3CFR A;  4EP5 A;  1IKX A;  2R7Y A;  3SJJ A;  3TR8 A;  5C42 A;  3RMD A;  1HJR A;  4HUF A;  3KLH A;  4FLX A;  3ISN C;  1SKS A;  1QHT A;  2HND A;  3V1Q A;  4W5N A;  5SZT A;  4CF2 A;  1ZYQ A;  2QXF A;  4DSE A;  3OYM A;  2IGI A;  3G10 A;  1X9W A;  1WSG A;  4OVL A;  4CE9 A;  1VSM A;  1TGO A;  1C1B A;  3O4N A;  4ELT A;  1F21 A;  4FJJ A;  4IKF A;  3SQ0 A;  3QEV A;  3KD1 E;  1WNS A;  2FBT A;  4B9U A;  3DYA A;  3V1O A;  1I39 A;  3PY8 A;  3DRS A;  4CFA A;  3IS9 A;  3DI6 A;  2XY7 A;  2HHX A;  3THV A;  4EZ6 A;  1C0M A;  3U3G A;  3RR8 A;  5K14 A;  1QSY A;  3MEE A;  2Y1I A;  4E1M A;  1LW2 A;  1RT2 A;  3AVC A;  3LZJ A;  4KB1 A;  4JS4 A;  4DS5 A;  4OPK A;  2Z1H A;  4RW6 A;  3O3H A;  4W5T A;  3SZ2 A;  4FM2 A;  3T19 A;  3DLG A;  5J2N A;  3KLI A;  1VSL A;  3QNO A;  4FJX A;  3S3N A;  4CK1 A;  1X9S A;  3ZT0 A;  4KHN A;  2OZS A;  3KLE A;  1JLF A;  3LP2 A;  4OGC A;  4CEA A;  4IG3 A;  3ZSX A;  5JS1 A;  3K2P A;  1KCF A;  3P5J A;  3PV8 A;  1NKB A;  2GV9 A;  3DLB A;  2D0B A;  1KFD A;  1VRU A;  4Z4H A;  1TK0 A;  1CXU A;  3NAE A;  4FJN A;  3LZI A;  1YTA A;  3VQQ A;  4E89 A;  1NOZ A;  1W9H A;  3O3F A;  2VG6 A;  1LWE A;  1VSF A;  3MEG A;  2X6S A;  1ZBI A;  4DSJ A;  1C1A A;  1EP4 A;  4DLE A;  4EP4 A;  3VQP A;  1RIL A;  4CHP A;  1BCM A;  4BDZ A;  3OS0 A;  1RT6 A;  4DTX A;  2DFH A;  4OGE A;  1TK5 A;  4W5R A;  2KZM A;  2G8U A;  3LAL A;  3AV9 A;  3RWU A;  2O4G A;  3T1A A;  4CJ4 A;  3MXI A;  4O5B A;  2KTQ A;  4JLH A;  3VQ5 A;  5I42 A;  3VQ6 A;  3NCI A;  4JRQ A;  1RBS A;  4DFJ A;  1VSE A;  4M45 A;  3VQC A;  3TAN A;  2HHQ A;  3VA3 A;  2F96 A;  3AO3 A;  3KKS A;  4AHU A;  3SUP A;  3QEI A;  1W0H A;  4FLT A;  3ITH A;  3VQ8 A;  2VWJ A;  2EHG A;  2HHV A;  3KLG A;  3BGR A;  1EXQ A;  2IDO A;  5HRN A;  4DTS A;  5CZ2 A;  1CZB A;  4N41 A;  4JRP A;  4DU4 A;  3AO1 A;  4H4O A;  3BDP A;  4FM1 A;  3P83 D;  1WSI A;  4IBN A;  2G8H A;  1BCO A;  4TSX A;  1RT1 A;  3CFP A;  4ELV A;  2BAN A;  3MXM A;  4YFU A;  1WSH A;  4H4M A;  4CJQ A;  2QK9 A;  1WN7 A;  3QEP A;  4YNQ A;  4FYD A;  3C6T A;  3SUN A;  4AHT A;  2G8V A;  1R0A A;  3NF9 A;  1ZBH A;  1REV A;  3K58 A;  2E4L A;  4DLG A;  3AVL A;  1TKT A;  1TK8 A;  3SCX A;  3V9U A;  4GVM A;  2PY5 A;  4K8Z A;  3I0R A;  4FCY A;  5J1E A;  1RTI A;  4DTO A;  2JGU A;  5DK5 A;  3SV3 A;  4DFP A;  1XHZ A;  2HMI A;  1IKY A;  1WSE A;  1DLO A;  4FJK A;  2XRI A;  4M41 A;  2JLE A;  1J5O A;  4CHY A;  3TAG A;  2HHS A;  1RDB A;  3VQ7 A;  1Q9X A;  5HRR A;  2A1R A;  2OA8 A;  2QKB A;  1Y97 A;  3OYK A;  3LDS A;  5KGW A;  1JLG A;  1NK9 A;  3AA4 A;  4J2A A;  3NE6 A;  3ZSY A;  4E0D A;  4N47 A;  4FLU A;  3L3V A;  1BIZ A;  2RN2 A;  1GOA A;  4CK2 A;  1TL3 A;  4DQI A;  1YTU A;  1K6Y A;  4ICL A;  3AVF A;  4FK0 A;  4O4G A;  1IH7 A;  3DRP A;  4DFM A;  3ZT1 A;  4I2Q A;  1T8E A;  3AO5 A;  1S1X A;  2IC3 A;  4DWI A;  1J54 A;  1JKH A;  4NYN A;  3RTV A;  3CM6 A;  3LAM A;  4E7L A;  3ZSO A;  4DTM A;  3VQ9 A;  4E7K A;  3O3G A;  3G0Z A;  1EKE A;  2ATQ A;  1T7P A;  1FK9 A;  1Z25 A;  2PZS A;  2KW4 A;  2DFE A;  1RTH A;  4Q0B A;  3WNF A;  1D9F A;  3V4I A;  5T7B A;  3HL8 A;  4CJR A;  4FJH A;  1JLB A;  1NK8 A;  3V9Z A;  3IRX A;  2D0C A;  3KIO A;  1ASV A;  3D45 A;  4CHN A;  1JL1 A;  3ASM A;  4ZHR A;  2B4J A;  1XI1 A;  3V81 A;  4B3O A;  2ITG A;  1WLJ A;  2VG5 A;  4CJV A;  4KRE A;  2KFZ A;  4CEB A;  3QIN A;  3VN5 A;  1WAF A;  3ZT3 A;  4Q5V A;  4MFB A;  3DMJ A;  3V6D A;  3HJF A;  4CHO A;  4PA1 A;  3OYJ A;  2O4I A;  1GOC A;  3T3F A;  1L3S A;  3HXM A;  1TKD A;  4FK4 A;  1TAU A;  4L8R B;  3ZSZ A;  4JS5 A;  3L2W A;  4KKO A;  4CJT A;  4I9L A;  5HRS A;  3U3Y A;  1CZ9 A;  3AVN A;  3PX6 A;  4DF4 A;  4ELU A;  3HVT A;  2Z1J A;  4RW4 A;  3OYA A;  3HO1 A;  3NGZ A;  2X74 A;  1JLA A;  2D0A A;  3VQ4 A;  4LH5 A;  3KK1 A;  1QSL A;  2HHW A;  2XY6 A;  1NJZ A;  3DOL A;  2KQ2 A;  2XHB A;  2G8K A;  5KRT A;  2YHB A;  1T03 A;  1HRH A;  1LAW A;  3KTQ A;  3O4Q A;  1BQM A;  4Z0U A;  3I8D A;  4DS4 A;  4DSF A;  4ZTJ A;  5CYM A;  4M3U A;  4OKE A;  1JXB A;  3QER A;  3QEW A;  1NJY A;  4PY5 A;  1KVB A;  1FXX A;  4GMJ B;  3RMB A;  1BIS A;  3V9S A;  1RDD A;  3SUQ A;  3LWM A;  3S9H A;  1KLN A;  2P5G A;  3PUF A;  4QAG A;  3SQ2 A;  3V9X A;  2Q3S A;  3LP3 A;  3HVR A;  2XY8 A;  4MQ3 A;  4LH4 A;  4PWD A;  3TAB A;  4H8K A;  4CEQ A;  1U47 A;  2OPR A;  1U49 A;  4FJ5 A;  3LWL A;  1S9G A;  1GOB A;  1S5J A;  4CJP A;  3OS2 A;  2XO7 A;  3QEX A;  3C95 A;  4LSN A;  2PYJ A;  1HYV A;  2B6A A;  4CHQ A;  2RF2 A;  3OYN A;  3OJS A;  4C8O A;  2E6L A;  3OYE A;  4CIG A;  4HCB A;  1SL1 A;  3CYM A;  3TAF A;  4F4K A;  4KTZ A;  2HVI A;  4RW8 A;  1NJX A;  4EZ9 A;  1RBT A;  3NF8 A;  3HT3 A;  1IKV A;  4FJL A;  4O55 A;  4C8L A;  1TKX A;  4CEE A;  4E7I A;  3TAM A;  4CED A;  4M42 A;  3B6P A;  4OKK A;  3HPO A;  4Z4C A;  5FRN A;  3RMA A;  4IFV A;  3OYC A;  1CXQ A;  1LW0 A;  4FW1 A;  1SUQ A;  4RW7 A;  5C24 A;  3KD5 E;  4B9L A;  3DOK A;  3VQE A;  3CG7 A;  1ZBL A;  1SL2 A;  1QTM A;  1VSJ A;  4M3W A;  3PO5 A;  2F8T A;  4E19 A;  3CM5 A;  5D3G A;  4Z4I A;  3DLE A;  3NHG A;  2HHT A;  4CJ5 A;  3NH2 A;  3PX4 A;  1BGX T;  3LPT A;  2HHU A;  3OYH A;  1D5A A;  1BI4 A;  4IDK A;  1RT3 A;  2VWK A;  3QIO A;  4CEO A;  3NFA A;  3KLF A;  3TWH A;  4FZY A;  4CJ3 A;  4CIE A;  1IG9 A;  4FJI A;  4KTQ A;  1NK6 A;  2OPS A;  2DFF A;  1NK7 A;  1NK5 A;  2HVH A;  1RNH A;  4IFY A;  5DMR A;  3ZT2 A;  4I9Q A;  4CJU A;  1Z26 A;  1HNI A;  3K5O A;  4DQR A;  4KFB A;  3NF7 A;  1UAX A;  4FW2 A;  1IKW A;  4CGF A;  3EZ5 A;  1U4B A;  4CGI A;  4KHW A;  4M3T A;  1TVR A;  4XIU A;  3KK3 A;  3OVN A;  5FRO A;  2P51 A;  3AVK A; 
#chains in the Genus database with same CATH topology
 1VSH A;  4AHR A;  5KPZ A;  4F2R A;  4LD0 A;  4LFB K;  4LF7 K;  5SWM A;  4HTU A;  1QSS A;  4GV9 A;  4CGH A;  1VHX A;  3QIC A;  2FSK A;  4W5O A;  1L3S A;  1I3A A;  1JLE A;  3HK2 A;  5E41 A;  5GIN A;  3THY B;  3K59 A;  2Z1I A;  5HBM A;  4C8K A;  2KZZ A;  1DGK N;  1RT4 A;  4ID5 A;  3G4S N;  5KRS A;  4IO8 A;  3SV4 A;  2E2O A;  4F2S A;  3JYT A;  4JKH A;  4PUO A;  1R59 O;  4DTN A;  2Y1J A;  1L5U A;  1Q18 A;  1FKP A;  3K0S A;  2WTU A;  1RCH A;  2KFN A;  3SUO A;  3KKR A;  2QWQ A;  2A5X A;  3VEW A;  1HNV A;  3A0I X;  3VGL A;  3ZX2 A;  4X65 K;  4CJK A;  1BL3 A;  2OPP A;  4DSK A;  1YIT N;  3DLL L;  3C94 A;  3G71 N;  1ZBF A;  3WNE A;  3JXU A;  3C65 A;  2QEX N;  3CCL N;  3I33 A;  4BRC A;  4JKC A;  1HQE A;  3MX2 A;  4BAC A;  1A5W A;  4EAH D;  3L2Q A;  1VSI A;  3L2U A;  3TTD A;  5AQM A;  2I5J A;  3A2F A;  4B3S K;  1X1P A;  2NZT A;  3WXJ A;  4EHT A;  2BTF A;  4DQ8 A;  3M8R A;  1FKO A;  3VTH A;  2G8F A;  4AHS A;  4N5S A;  4IOA L;  3FZH A;  1EO1 A;  1W7A A;  3NMU A;  1NNE A;  4MO5 A;  4JI3 K;  5C2D A;  4J2D A;  2OCE A;  2VQF K;  2YHX A;  2ASO A;  2E5L K;  2UUC K;  1RBU A;  2VGM A;  4JHD B;  2F9W A;  3WNH A;  4M3R A;  2E88 A;  5C25 A;  1U04 A;  4HCC A;  4A2A A;  3P1G A;  1L3U A;  4H5R A;  4NYF A;  3HRG A;  5J2Q A;  4J8F A;  4UQG A;  3O80 A;  2HF4 A;  1JXE A;  4J2E A;  3ULD A;  3M8S A;  1QQN A;  1JLQ A;  5AFU H;  4FL9 A;  1J9A A;  2AP1 A;  3VER A;  1VRT A;  1YJ9 N;  3AA5 X;  1S1T A;  2GUI A;  1Q8I A;  1MA9 B;  4FZX C;  3D6R A;  4Z4E A;  1JL2 A;  3H1Q A;  4B9N A;  4GV3 A;  5AQV A;  5KTQ A;  2O8C B;  2P9K B;  3L6Q A;  3KVG A;  4FLV A;  3JSM A;  2P5O A;  2IVP A;  4N56 A;  1S1U A;  4M3Y A;  2BH1 A;  3S3M A;  2Q2R A;  3I0S A;  3UIQ A;  3UKU A;  4BG8 A;  4BRG A;  3V9W A;  4CFD A;  1HMV A;  1ASW A;  1YUW A;  4I2P A;  3AAP A;  4QCL A;  4N76 A;  4FLZ A;  2RPI A;  4IZ9 A;  1Q9Y A;  2FBX A;  3BUZ B;  1HKC A;  5HLF A;  3HPH A;  2NUB A;  3J81 O;  4CJS A;  2PBD A;  3C7N A;  3AA2 A;  4KTW A;  3O1B A;  1NGF A;  4J2B A;  1B92 A;  1K8K A;  3AY9 A;  1KXP A;  1NGB A;  4YOT A;  2YNI A;  4JKG A;  4CJL A;  4K8X A;  1NWK A;  4M3Z A;  1WSF A;  3NDK A;  4HHT A;  1T6D A;  3ENB A;  3TAE A;  3GE1 A;  2E6M A;  3CCU N;  3OA9 A;  3QO9 A;  3AVB A;  5HP1 A;  1X9M A;  5AZI B;  1VQ4 N;  1SZ2 A;  2O8D A;  5JLF A;  3IG1 A;  2R7Y A;  3SJJ A;  4B9V A;  3TTC A;  3A5O C;  1IKX A;  4FLX A;  1QHT A;  3B8A X;  3GDQ A;  1YF5 L;  3ULE B;  3J80 O;  4BR5 A;  3CCM N;  4FJJ A;  1TGO A;  3OW2 M;  3RSE A;  3CJ7 A;  5C2F A;  2OAN A;  2UUA K;  4CFA A;  2WUS A;  3IS9 A;  3GBT A;  1EQY A;  3THV A;  4E1M A;  2P9S B;  5AQZ A;  2HBK A;  4DS5 A;  5KPT A;  3DXK B;  4RW6 A;  3SZ2 A;  1NU0 A;  3MWP A;  2D0P A;  4FM2 A;  3T19 A;  2Q0U A;  3VF6 A;  5J2N A;  1BDG A;  5JLH A;  4FJX A;  3S3N A;  4CK1 A;  2QWM A;  3TU5 A;  3MDQ A;  4OGC A;  4CEA A;  4B1V A;  3K2P A;  4IJN A;  5F1X A;  1TK0 A;  3NAE A;  1C0G A;  1OH7 A;  4E89 A;  3O3F A;  2VG6 A;  3IDH A;  4YOU A;  3MEG A;  2Q97 A;  1MDU B;  4DSJ A;  1EWQ A;  4DUZ K;  4BDZ A;  4DTX A;  2DFH A;  5AFU A;  1TK5 A;  2V51 B;  3PIP L;  3T1A A;  4CJ4 A;  4X64 K;  1DEJ A;  4K25 A;  1BOT O;  4JLH A;  1TUU A;  4JRQ A;  3HM8 A;  4M45 A;  2W6L A;  3TAN A;  2FSN A;  4E1J A;  3AO3 A;  2JWK A;  3C6A A;  1XMO K;  2EHG A;  4O5F A;  1YJN N;  4H4O A;  3BDP A;  4RTF D;  2G8H A;  4TSX A;  1RT1 A;  3CFP A;  3VGK A;  4YFU A;  3MXM A;  4WQ5 A;  4AM6 A;  3QEP A;  4FYD A;  2YJF A;  3K58 A;  4DLG A;  3AVL A;  3SCX A;  3MWT A;  4JKE A;  2HMI A;  3IFR A;  3SV3 A;  4A61 A;  1DLO A;  2XRI A;  2JLE A;  3H3N O;  4CHY A;  3TAG A;  2HHS A;  1RDB A;  3VQ7 A;  2OA8 A;  2P9P A;  1JLG A;  3AAR A;  4JHD A;  1NK9 A;  1KD1 O;  3PSF A;  4E0D A;  4N47 A;  4V19 S;  1BIZ A;  2RN2 A;  4CK2 A;  3VF2 A;  2ZJP L;  1TL3 A;  1K6Y A;  4ICL A;  4JI4 K;  4FK0 A;  3WXM B;  4O4G A;  1IH7 A;  3HBT A;  3W3D A;  3LAM A;  4E7L A;  3FGU A;  3L4Q A;  3VQ9 A;  4C1N I;  1OVY A;  4BGA A;  2PFU A;  3V4I A;  5T7B A;  4DR2 K;  3WQT A;  2GTD A;  4RWT A;  5EXW A;  1ASV A;  4ZHR A;  2ITG A;  4CJV A;  4A5B A;  3O9S A;  5LMU K;  4CEB A;  3QIN A;  5AZJ A;  4DV2 K;  3VN5 A;  4Q5V A;  4MFB A;  4FWM A;  3HJF A;  3OYJ A;  1CZA N;  3ZEU B;  3T3F A;  3HXM A;  3CCR N;  1TAU A;  4JS5 A;  5BPL A;  4KKO A;  4I9L A;  4DF4 A;  4OO1 J;  4CZJ A;  2D0A A;  3KK1 A;  3J7A P;  1HRH A;  3KTQ A;  3MN6 A;  1WBD A;  4AM7 A;  4Z0U A;  2D0O A;  3N4Q A;  1E3M A;  2OTJ N;  4OKE A;  3FR0 A;  2V7Z A;  3QEW A;  2I7N A;  3HTV A;  3PUF A;  1MWK A;  4B3M K;  3LP3 A;  4CBW A;  4H8K A;  4CEQ A;  4FJ5 A;  2XO7 A;  2RHK A;  2RF2 A;  3OYN A;  4C8O A;  1SL1 A;  4C23 A;  4MDB A;  4E7I A;  3M6G A;  3KWG A;  4OKK A;  4M42 A;  1H1V A;  2QI2 A;  3RMA A;  3OYC A;  2UUB K;  3U8X A;  3VQE A;  1QTM A;  1VSJ A;  5AJ3 K;  3P39 A;  4H5V A;  3CM5 A;  3OTO K;  3E66 A;  4IDK A;  3KLF A;  3TWH A;  4FJI A;  4KTQ A;  1NK7 A;  3IKM A;  2HVH A;  5DMR A;  3VEO A;  5EOY A;  1Z26 A;  3K5O A;  4JI6 K;  4KFB A;  4CGF A;  4JN4 A;  1IKW A;  3EZ5 A;  1J6Z A;  1HNX K;  3T1Y K;  3CJB A;  4OJR A;  4FLW A;  4KRF A;  3MXJ A;  5JS2 A;  1S1V A;  1XHX A;  2IVO A;  3SK3 A;  3GG4 A;  4FJG A;  1SS6 A;  1HYZ A;  2OYQ A;  3O9T A;  1J5E K;  3D2F A;  3ZET A;  3HI0 A;  4A5A A;  5GAD P;  1C6V A;  3AO4 A;  3SMP A;  3WT0 A;  2D5R A;  4CZE A;  5IT9 O;  4FZZ A;  4BDP A;  4GV6 A;  5E26 A;  1D8Y A;  4WE1 A;  3F9K A;  1S9E A;  3A5N C;  3ZCM A;  2X6N A;  1TKZ A;  3LAN A;  4YDU C;  2Q31 A;  3R9P A;  5KI6 A;  1ATS A;  4E1N A;  4KHY A;  4CF9 A;  1S6P A;  4F3T A;  1NGA A;  2YNG A;  2O8E A;  3O9U A;  2QTD A;  3M8P A;  2F4V K;  4JKA A;  1XC9 A;  1ITG A;  1KLM A;  3VQB A;  4NLB A;  4BE0 A;  3QLH A;  3DAW A;  4WQ4 A;  5ADX A;  3FZM A;  4H5T A;  3RR7 A;  1KVC A;  5FDL A;  1KTQ A;  3SAH A;  3NGY A;  3E01 A;  1NOY A;  3NH0 A;  4B1Y B;  4CJF A;  3EKS A;  3L2V A;  1RT5 A;  3LP0 A;  2DTU A;  4CZK A;  1C0U A;  1DTQ A;  2YI1 A;  3NF6 A;  4CF0 A;  3FZF A;  2Q36 A;  1DTT A;  3QFP A;  2P9P B;  1NG9 A;  1Z6R A;  5CR4 A;  3UB5 A;  4JKD A;  3V1R A;  3ZSQ A;  3TPQ A;  4CIF A;  4KH6 A;  4LF9 K;  2QWL A;  1N6Q A;  4OPJ A;  4BR9 A;  1RTJ A;  5AQW A;  3QIP A;  3H3O B;  3QNN A;  4JI7 K;  1RDC A;  3ZSW A;  3U9D A;  4O0J A;  4DR3 K;  3E9O A;  1SV5 A;  2O8F A;  4YOY A;  4JI5 K;  2HNY A;  1QZ6 A;  3ZSV A;  2P9U A;  3NGI A;  2ZQB A;  3OBW A;  2XY5 A;  5JVH L;  1ZBU A;  2P9K A;  3VA0 A;  2ZF5 O;  3AVJ A;  1GLD G;  3L8B A;  4DTJ A;  4JI8 K;  1HYS A;  1JCE A;  4FOE A;  4BR7 A;  1N36 K;  5FRM A;  3BZC A;  4FOI A;  3OYF A;  2G8W A;  3OBY A;  4H5W A;  2A6A A;  4H03 B;  2YKN A;  3EL2 A;  2QWO A;  5AQF A;  2GEM A;  2P9N A;  4CFB A;  3R3L A;  3GOI A;  5AQN A;  5CZ1 A;  4CD3 A;  4KH4 A;  3OYL A;  3ATV A;  2FC0 A;  4X62 K;  2JWL A;  2GBZ A;  1ASU A;  1Y64 A;  3I56 N;  4GVE A;  3AVG A;  4F3O A;  5HRP A;  4DV6 K;  1NKE A;  4MLH A;  5HL7 L;  3C0B A;  1S1W A;  2FLO A;  4JKF A;  3PLA A;  4BQZ A;  3DXK A;  4ZTF A;  1LV5 A;  4BRP A;  1VK0 A;  1VQ8 N;  2KKZ A;  2FSJ A;  2O8D B;  2QKK A;  2RKI A;  4BR2 A;  3WXI A;  4CF1 A;  3SQ4 A;  2W41 A;  2Z1G A;  4RW9 A;  4LFA K;  4G1Q A;  2GWK A;  4CZM A;  4B8C A;  3FE1 A;  3F2K A;  1TYQ B;  4ISE A;  4CJW A;  3VQA A;  4Z4F A;  3ZT4 A;  3RSE B;  4FM0 A;  2HNZ A;  1NM1 A;  3ID6 A;  4NCB A;  2E2P A;  3WXL A;  1NGJ A;  1N5Y A;  2F8S A;  4CW7 B;  3AVM A;  2YJE A;  3CFR A;  3FFI A;  4B3T K;  4EP5 A;  1IBK K;  5C42 A;  3MK6 A;  3RMD A;  1HJR A;  4HUF A;  3C7N B;  4H0O A;  3ISN C;  3KLH A;  1SKS A;  4W5N A;  2QXF A;  2QWP A;  1X9W A;  4IKF A;  1VSM A;  4YOV A;  1BO5 O;  3SQ0 A;  1WNS A;  4DV0 K;  3E9L A;  1OVQ A;  2FBT A;  4JK9 A;  4FWR A;  1K73 O;  3DI6 A;  3CCV N;  3CD6 N;  3MN7 A;  3U3G A;  4WFA L;  3ENO A;  2E1Y A;  1LW2 A;  1RT2 A;  3T1H K;  3AVC A;  3LZJ A;  5AZI A;  3O3H A;  5AQU A;  3CJA A;  3KLI A;  3QNO A;  1JJ2 M;  1X9S A;  3LP2 A;  4ILG B;  4BVO A;  3CPE A;  4K43 A;  3Q7C A;  2A40 A;  1I94 K;  4Z4H A;  3JAM O;  3U9Z A;  4MLE A;  3VQQ A;  5ELZ A;  2WFB A;  1YIJ N;  1W9H A;  4DV3 K;  1HLU A;  1NBW A;  2HBM A;  1VSF A;  1ZBI A;  1EP4 A;  5BR9 A;  3VQP A;  1RIL A;  3WQU A;  3OS0 A;  1RT6 A;  3UKU B;  4JI1 K;  2KZM A;  2G8U A;  3CHW A;  3AV9 A;  3RWU A;  2O4G A;  2Q0R A;  3VQ5 A;  5I42 A;  1SAZ A;  5ADX H;  1P90 A;  3CCE N;  3DWL A;  4G9Z A;  3KZB A;  1NLV A;  2HHQ A;  2F96 A;  4XH1 A;  4AHU A;  4JK7 A;  5AQK A;  4FLT A;  1GLB G;  1T6C A;  2HHV A;  5CZ2 A;  1CZB A;  4N41 A;  4DU4 A;  5AZJ B;  4IBN A;  3C6T A;  4AHT A;  4F9O A;  1ZBH A;  5AQX A;  3H6E A;  3V9U A;  4K8Z A;  1N8R O;  1RTI A;  3IUC A;  4WQ4 C;  1WSE A;  4M41 A;  1E4F T;  3HOT A;  1Q9X A;  5HRR A;  1XC3 A;  3KHY A;  2A1R A;  5M1Q A;  5FPM A;  4CVN E;  4YY3 K;  3OYK A;  3LDS A;  5KGW A;  2ZJQ L;  4AF1 A;  3ZSY A;  1O13 A;  1M90 O;  3SMS A;  3CJC A;  4BRD A;  1Q86 O;  3AVF A;  2QWR A;  3DRP A;  5JIC A;  4I2Q A;  2IC3 A;  4NYN A;  4EFH A;  3ENH A;  1NMD A;  4DTM A;  2F9T A;  4E7K A;  3G0Z A;  3VTI A;  4JV5 K;  3P38 A;  3IMX A;  2KW4 A;  4M7Y A;  2DFE A;  3WNF A;  4JNE A;  4FJH A;  1NK8 A;  3O5B A;  2D0C A;  3KIO A;  4PL8 A;  4KRE A;  2VG5 A;  1WLJ A;  3QFU A;  2CH5 A;  5B8H A;  1S72 N;  1WAF A;  2EWS A;  5AQY A;  4GKJ K;  4PA1 A;  2O4I A;  1GOC A;  3O08 A;  2I7P A;  4CBX A;  4FWO A;  1JCF A;  5HRS A;  4FO0 A;  1CZ9 A;  4ISG A;  3OYA A;  5BRE A;  3HO1 A;  1X3N A;  2QXL A;  2NRV A;  2P9S A;  3AGK A;  5M1K A;  2GUP A;  3C6H A;  2QA4 N;  4WYB A;  2KQ2 A;  1NJZ A;  1T03 A;  1T44 A;  1LAW A;  1ZBS A;  3F9M A;  2IIR A;  5AQH A;  1JXB A;  3QER A;  1NJY A;  4WCE L;  3I55 N;  5F0X A;  3S9H A;  1KLN A;  3O1W A;  3HVR A;  2XY8 A;  3THW B;  4PWD A;  3TAB A;  3EN9 A;  1U47 A;  2OPR A;  3LWL A;  1D4X A;  1GOB A;  1KAZ A;  1S5J A;  3A5M C;  3WUH A;  3QEX A;  3D7E O;  2B6A A;  4CHQ A;  4KHP K;  4CI6 A;  3EEQ A;  4F4K A;  2GWJ A;  4LF8 K;  3VPZ A;  1RBT A;  3ATU A;  1GLJ O;  3NF8 A;  1IKV A;  4FJL A;  4O55 A;  2E8A A;  4JI2 K;  1VQM N;  3VEZ A;  4CED A;  3B6P A;  2HBL A;  2Q1N A;  1OH5 A;  2IVN A;  4IFV A;  1LW0 A;  4FW1 A;  3SJH A;  4H0X B;  1SL2 A;  3QB0 A;  4CJ7 A;  2F8T A;  4ISF A;  4KH5 A;  3DLE A;  3NHG A;  5BN8 A;  2HHT A;  3NH2 A;  1BGX T;  3LPT A;  2HHU A;  4K42 A;  1D5A A;  4BRK A;  1RT3 A;  4CIE A;  1IG9 A;  4JYA K;  2OPS A;  1YHQ N;  3NF7 A;  1UAX A;  2ASP A;  4FW2 A;  4MDA A;  4XIU A;  4NB4 A;  3OVN A;  4DV7 K;  3TSU A;  3HPG A;  4XH5 A;  3FZK A;  2PYL A;  4DQP A;  1BWF O;  4CEF A;  2P9L A;  3M8Q A;  3L2R A;  4E3S A;  1LWF A;  1BI4 B;  4PHT X;  3QES A;  2ZE2 A;  4FPB A;  2ZD1 A;  4NO7 A;  4PKH A;  4KHU A;  4B1U B;  1CLQ A;  2FF6 A;  1A5X A;  3EE8 A;  4E7H A;  4QOZ B;  5EY4 A;  2IAJ A;  4E7J A;  1LAV A;  2P1J A;  2HHX A;  2LSN A;  5EU7 A;  4YHH K;  4BR4 A;  1G15 A;  4FWK A;  5M1O A;  2B5J A;  1NJW A;  1KC8 O;  4M3X A;  2P9I A;  3ZEU A;  5E84 A;  2V7Y A;  4GY2 B;  2UXC K;  4OKJ A;  5C12 A;  2YCH A;  5MLC Q;  3NH1 A;  4JK8 A;  4DR4 K;  5AQT A;  3TAP A;  4GW6 A;  3EE9 A;  3MN5 A;  3LAK A;  4A62 A;  2GX9 A;  5BPM A;  1L3T A;  4CER A;  4BWM A;  3R8E A;  3OJU A;  1J53 A;  4FLY A;  4FWQ A;  3RMC A;  1WAJ A;  1Q82 O;  2G8I A;  3LL3 A;  3SNN A;  2YV0 X;  4B8A B;  4DG1 A;  3O4W A;  3RVC A;  5J2P A;  4FJM A;  1TAQ A;  4DU1 A;  5KPR A;  2QM1 A;  3CJ9 A;  1L3V A;  3SQ1 A;  3UKR A;  3KJV A;  4CEC A;  4NCG A;  4B1Z A;  3CF5 L;  1O1W A;  4BQL A;  5C15 A;  4H0P A;  1RFQ A;  3RRH A;  3B6O A;  3CQY A;  5J2M A;  1U45 A;  2AJQ A;  2HHH K;  4YOX A;  5I9E B;  3N4P A;  4R5P A;  1XMQ K;  3VMF B;  3HSC A;  1BIU A;  3K57 A;  4DTP A;  4IXC A;  2NLX A;  2D1K A;  4CES A;  4KO0 A;  5BPN A;  3OHR A;  3MN9 A;  3O6W A;  1EWR A;  3SPY A;  3ZX3 A;  4DUY K;  1A5V A;  2VQE K;  4CHZ A;  3HYF A;  1NK4 A;  4OLB A;  4DFK A;  1S22 A;  1YT3 A;  3NBP A;  2VG7 A;  2OZM A;  4WQ5 C;  4CK3 A;  3F5T A;  1KSP A;  4C8M A;  4IG0 A;  2BDP A;  1NGC A;  2ETJ A;  2W42 A;  1QVG M;  4KHS A;  4PKG A;  3K5M A;  3HP6 A;  3ZET B;  2OTL N;  2NRH A;  3HP9 A;  1YJW N;  4A2B A;  4FK2 A;  4B08 A;  4FJ7 A;  3G25 A;  2ZGY A;  5AQR A;  2OPQ A;  3KK2 A;  5FPN A;  4GKK K;  4DR5 K;  4DSL A;  3H08 A;  2DPN A;  2J4R A;  2O8B B;  3L3U A;  2ZM6 K;  3NVM A;  5AQG A;  5IWA K;  3CET A;  1QE1 A;  4FVM A;  3PX0 A;  3DM2 A;  3S3O A;  5F2R A;  1D9D A;  4C8N A;  4AH9 A;  1K8A O;  1XUP O;  3LP1 A;  4KI6 A;  1NKC A;  2HB5 A;  3VES A;  3P4I A;  3HST B;  1RDU A;  1BQN A;  3I8B A;  1DT9 A;  4DHY A;  2CH6 A;  5GAH P;  3SPZ A;  1NGD A;  1XWL A;  3BF1 A;  1VQK N;  4YOR A;  4EIA A;  1UA0 A;  3MMV A;  2ASM A;  1TYQ A;  4DSI A;  1HKB A;  3R1X A;  4Y1C A;  1B9D A;  2WBN A;  3O9R A;  4CZI A;  3LDN A;  5HRO A;  4HUE A;  1SKW A;  5CHI A;  3ZSR A;  2FBY A;  4LY7 A;  1E4G T;  2P9I B;  4CEZ A;  1RDW X;  1QS4 A;  1NK0 A;  3AVA A;  4RCH A;  3DRR A;  1X3M A;  2WON A;  4BE1 A;  4DTR A;  4B9T A;  2WC9 A;  3WEE B;  1T3V A;  4RG8 A;  4IWV A;  4KHQ A;  4JKB A;  3VQD A;  3IAY A;  1NGE A;  2YHA A;  1YVU A;  1WBB A;  1C1C A;  4Y1D A;  2AA4 A;  3TR8 A;  1NJX A;  4BY9 C;  2HND A;  3V1Q A;  5SZT A;  4DSE A;  3OYM A;  2IGI A;  2UYT A;  1WSG A;  2KHO A;  3H1V X;  4OVL A;  3ZYY X;  1P8Z A;  2ZJR L;  1F21 A;  1TUY A;  4ELT A;  3KD1 E;  3LM2 A;  1OH6 A;  1U2V A;  1QVF M;  3V1O A;  1I39 A;  3PY8 A;  4BRN A;  2XY7 A;  4EZ6 A;  1C0M A;  5FPE A;  3RR8 A;  2Y1I A;  3VOV A;  4KB1 A;  4JS4 A;  1XNR K;  4DR1 K;  2FXU A;  3DLG A;  5M1N A;  1VSL A;  4KHN A;  1KQS M;  3WEE A;  4BC3 A;  3KLE A;  3ZSX A;  1C0F A;  1KCF A;  5GAG P;  3PV8 A;  2GV9 A;  3DLB A;  5AQP A;  2D0B A;  3BY5 A;  1VRU A;  1CXU A;  1YTA A;  1NOZ A;  3WXK A;  4JAX A;  1LWE A;  2D4W A;  1Q7Y O;  2X6S A;  4K0K K;  1QZ5 A;  3KK7 A;  3E1Y A;  2PAV A;  4JKG B;  3G6E N;  4O5B A;  3CMA N;  1ILY A;  1HKG A;  3VQ6 A;  2W6K A;  4IEE A;  4LFC K;  2NRW A;  1RBS A;  3VQC A;  3VA3 A;  3CI5 A;  4BRA A;  5BRD A;  3QEI A;  1W0H A;  3DJC A;  3VQ8 A;  4BC5 A;  5BRH A;  1NGH A;  3BGR A;  1K9M O;  2IDO A;  1VQ7 N;  4YDU A;  4JRP A;  3CIP A;  1QQM A;  4DKW A;  4FM1 A;  3P83 D;  3HOS A;  3EZW A;  1BCO A;  4ELV A;  2QK9 A;  1WSH A;  4CJQ A;  1WN7 A;  4MO4 A;  3NF9 A;  4LF6 K;  2E4L A;  3LM9 A;  1TKT A;  1TK8 A;  4GVM A;  4BRQ A;  5J1E A;  4DTO A;  4DFP A;  3THX B;  1XHZ A;  5KQ8 A;  1JCG A;  4JEP A;  3THX A;  4BGB A;  4WFB L;  2QKB A;  1GLL O;  4B1X B;  3UKR B;  4J2A A;  3NE6 A;  5BN9 A;  4IFE A;  4CZH A;  4FLU A;  4DCH A;  3VEN A;  1YTU A;  1WB9 A;  4BRO A;  3U4L A;  4DFM A;  5FLX O;  3AO5 A;  3LDL A;  3CM6 A;  4PKI A;  1N32 K;  3ZSO A;  3PIO L;  3O3G A;  1EKE A;  1T7P A;  2V52 B;  4WF9 L;  4DB3 A;  1RTH A;  4Q0B A;  1D9F A;  5AQJ A;  1LOT B;  4M7X A;  3IRX A;  2CGK A;  3CQX A;  3D45 A;  4CHN A;  3ASM A;  1XI1 A;  2B4J A;  3V81 A;  5HOO A;  3ZT3 A;  3V6D A;  4CHO A;  2A3Z A;  3VGM A;  1NJI O;  3LDQ A;  5GIP A;  4L8R B;  3J7Y P;  3U3Y A;  3AVN A;  3TSQ A;  3PX6 A;  3HVT A;  1WUA A;  2ZGZ A;  3FFK B;  4RW4 A;  4U7B A;  2BUP A;  4LH5 A;  2HHW A;  3DOL A;  4FWS A;  2QWN A;  4BR0 A;  3O4Q A;  1BQM A;  3I8D A;  4DV4 K;  4DS4 A;  4XH4 A;  4DSF A;  4ZTJ A;  2P9L B;  4PY5 A;  3R6M A;  1NGG A;  1KVB A;  1FXX A;  4GMJ B;  5AQQ A;  3RMB A;  1RDD A;  5AQI A;  3LWM A;  3SQ2 A;  4FVU A;  3T7Z A;  1WOQ A;  4NLC A;  4IOC L;  5BRF A;  4LH4 A;  3D2E A;  3L4I A;  1S9G A;  4IEI A;  3OS2 A;  1Q81 O;  2PYJ A;  3C95 A;  4LSN A;  1HYV A;  3OJS A;  4CIG A;  4HCB A;  3CYM A;  3TAF A;  4M63 C;  3CJ1 A;  4KTZ A;  2NRR A;  4RW8 A;  4EZ9 A;  4CZL A;  4NXN K;  3HT3 A;  3SAG A;  4C8L A;  1TKX A;  3BZK A;  4CEE A;  1XQS C;  3TAM A;  3KWI A;  2UU9 K;  5FRN A;  3A5L C;  1SUQ A;  3KD5 E;  3O9Q A;  4JD2 A;  1IJJ A;  4B9L A;  2A42 A;  1ZBL A;  2CGJ A;  3PO5 A;  5H1S Q;  4E19 A;  3AAQ A;  4Z4I A;  1IV0 A;  2NRZ A;  4CJ5 A;  3SLC A;  3PX4 A;  3OYH A;  1BI4 A;  2VWK A;  1NK6 A;  3ZT2 A;  4CJU A;  4DQR A;  4M3T A;  4KHW A;  3KK3 A;  4BRI A;  1M1K O;  4FJ9 A;  1KAY A;  3W0L A;  3MEC A;  1U48 A;  1T05 A;  1NMN A;  1OKJ A;  1IO2 A;  2NNW A;  2YHW A;  4BRH A;  1YAG A;  4QS7 A;  1BHL A;  4LSL A;  1VQP N;  1RBV A;  2WOM A;  2P9N B;  1BA1 A;  4HUG A;  4CGG A;  4DF8 A;  4KAZ A;  3OYI A;  3CCS N;  5M1P A;  1VQ6 N;  1UOC A;  3AA3 A;  3CQ8 A;  3U6F A;  4HVJ A;  1W2B M;  3QML A;  2BE2 A;  3PSI A;  4Y0W A;  3OYD A;  1KFS A;  1SQK A;  4CD1 A;  2O8F B;  3SAF A;  1QHA A;  4LF5 K;  1KRP A;  1WSJ A;  1RBR A;  4FXD A;  1UWB A;  2ZWH A;  3AVH A;  4KPY A;  4H0T B;  5AQL A;  4FJ8 A;  2VCP A;  2W40 A;  3LDP A;  1RDA A;  3K5N A;  4AHV A;  3THW A;  2VWB A;  4YOW A;  1ZC6 A;  4HWI A;  2E1Z A;  3MX5 A;  3QET A;  5CE3 A;  4L3Q A;  4CCH A;  3ID8 A;  3DLK A;  2NRT A;  3AVI A;  1HJO A;  4CGD A;  2O8B A;  1LWC A;  3SYZ A;  2GEL A;  5GAE P;  1ATN A;  4BC4 A;  4LF4 K;  3TI0 A;  2HMP A;  5CY4 A;  3CFO A;  3SBG A;  3WNG A;  3P31 A;  3M1F A;  1MU2 A;  2YHY A;  1HQU A;  5LJW A;  4DV5 K;  1EET A;  2A1S A;  4B9S A;  4W5Q A;  4UY8 O;  2UXD K;  5C10 A;  3CXC M;  4OLA A;  4DMN A;  4ID1 A;  3S41 A;  3QBX A;  1U6Z A;  4CGJ A;  1N33 K;  4FWN A;  4ILJ A;  4HTL A;  3HM9 A;  4KB0 A;  1S6Q A;  4H0Y B;  4CFC A;  4AIL C;  4JI0 K;  3QDK A;  1TV6 A;  5FPD A;  4IO9 L;  3BEX A;  3DXM A;  4AHC A;  4CZF A;  3AGR A;  3MAQ A;  3DXM B;  2VYP A;  4O44 A;  2DY4 A;  2YNH A;  3T69 A;  4DQS A;  2FBV A;  4BWJ A;  4PL7 A;  1V4S A;  3E9P A;  4BDY A;  4B9M A;  3RRG A;  3LPU A;  3ALY A;  1KVA A;  3SI6 A;  1HPZ A;  1EX4 A;  1ZXO A;  4CJE A;  2IOC A;  3DLR A;  3EKU A;  4DQQ A;  4KI4 A;  1KAX A;  3VEY A;  1FW6 A;  1K8K B;  1QQC A;  3OYG A;  4IJA A;  1RTD A;  3K9J A;  1VSD A;  2BGG A;  3THY A;  3MCP A;  3TAQ A;  4H5N A;  3MED A;  3D0P A;  3FLC O;  4DR7 K;  4DTU A;  4EHU A;  3K5L A;  4NXM K;  5LL6 Z;  5AR0 A;  2FF3 B;  1G99 A;  3D2F B;  3QBW A;  3NVK A;  3H46 O;  2HW3 A;  3TAR A;  5KGX A;  1VAZ A;  3O8M A;  1TL1 A;  1FJG K;  4KV8 A;  4I6M B;  1SL0 A;  1SKR A;  4Z4G A;  4CF8 A;  4FWP A;  3AO2 A;  1U2V B;  3DLH A;  4O0I A;  3CC4 N;  2H3G X;  3EO3 A;  4FPA A;  1JLC A;  5I3U A;  1YXQ A;  2O8C A;  4BE2 A;  5CYQ A;  5DM6 L;  3OS1 A;  4F8R A;  4PQU A;  1X9J A;  4X66 K;  1C0T A;  4K41 A;  3EY1 A;  4AQY K;  3OY9 A;  3M5R A;  1VSK A;  1GLE G;  1HX1 A;  1NGI A;  5JVG L;  4DU3 A;  1UA1 A;  2IS3 A;  2YNF A;  4NCA A;  4QS9 A;  4I7F A;  3EYZ A;  3PO4 A;  2X78 A;  4A59 A;  1B9F A;  3OYB A;  2HOE A;  1RT7 A;  3F73 A;  3SBT A;  3C6U A;  4I6M A;  2EX3 A;  2YKM A;  3D2E B;  4LC9 B;  3VEV A;  4CF2 A;  1ZYQ A;  4BG9 A;  5LY3 A;  3G10 A;  4CE9 A;  1C1B A;  3O4N A;  3QEV A;  5LJV A;  4B9U A;  3DYA A;  3FZL A;  5TKY A;  3VET A;  3DRS A;  2QW9 A;  5C0Y A;  4O8U A;  5GIO A;  5K14 A;  1QSY A;  3MEE A;  3CCJ N;  3BF3 A;  4JD2 B;  5EX5 A;  4OPK A;  3UE5 A;  2Z1H A;  4W5T A;  1HNZ K;  1W97 L;  3A8Y A;  3ZT0 A;  3CER A;  2OZS A;  1JLF A;  2F7T A;  4IG3 A;  5JS1 A;  3P5J A;  2E20 A;  1NKB A;  4ILH A;  3LDO A;  4BC2 A;  1KFD A;  4A57 A;  5M1F A;  1LCU A;  3H45 C;  4FJN A;  2KLA A;  3LZI A;  1BUP A;  1MWM A;  1ATR A;  1C1A A;  4DLE A;  4EP4 A;  1GLA G;  3L0Q A;  4CHP A;  1VQ5 N;  1BCM A;  1DKG D;  4OGE A;  4OPA A;  4W5R A;  3LAL A;  4BRL A;  3MXI A;  2KTQ A;  3NCI A;  1HUX A;  2A41 A;  4DFJ A;  1BG3 A;  1VSE A;  4C1N K;  3CC7 N;  1OH8 A;  3KKS A;  3CCQ N;  4BVP A;  3SUP A;  3ZLJ A;  1IBM K;  2CGL A;  1GLF O;  4OPH A;  1VQN N;  3ITH A;  1YI2 N;  4BRE A;  2VWJ A;  3KLG A;  1EXQ A;  1GLC G;  5HRN A;  4DTS A;  1N34 K;  3Q7B A;  2O8E B;  3AO1 A;  2NRX A;  1WSI A;  2BAN A;  4H4M A;  3JS6 A;  4YNQ A;  1HNW K;  3SUN A;  2G8V A;  1R0A A;  4DV1 K;  1REV A;  4QS8 A;  2E2N A;  2PY5 A;  3I0R A;  4KBO A;  4FCY A;  4BRM A;  2JGU A;  5DK5 A;  3TSP A;  1IKY A;  3J7Z O;  4FJK A;  1IG8 A;  4H0V B;  1J5O A;  1VQL N;  1Y97 A;  5AQO A;  4Z94 A;  3AA4 A;  5EVZ A;  4O8K A;  3L3V A;  1GOA A;  4DQI A;  4U67 L;  3ZT1 A;  1T8E A;  1S1X A;  4DWI A;  1J54 A;  1JKH A;  3RTV A;  4B3R K;  1S3X A;  2ATQ A;  1FK9 A;  1Z25 A;  2PZS A;  1Z05 A;  3HL8 A;  4CJR A;  4R79 A;  4B1W B;  1JLB A;  1BA0 A;  3V9Z A;  3CME N;  1JL1 A;  4B3O A;  2RE2 A;  1V4T A;  2KFZ A;  2E2Q A;  1ESV A;  3BP8 A;  3DMJ A;  4FSV A;  4XEI A;  2HST A;  1TKD A;  3MCA B;  4FK4 A;  3TTF A;  4CZG A;  1HPM A;  2YX6 A;  3ZSZ A;  3CPW M;  3L2W A;  4CJT A;  5A2Q O;  5AQS A;  4ELU A;  2Z1J A;  1XNQ K;  3NGZ A;  2X74 A;  1JLA A;  3VQ4 A;  1QSL A;  2XY6 A;  2ITM A;  3GL1 A;  2G8K A;  2XHB A;  5LMN K;  1QQO A;  5KRT A;  2YHB A;  4IDH A;  1YVN A;  5CYM A;  4M3U A;  5DM7 L;  4WFN L;  1BIS A;  3V9S A;  3SUQ A;  2P5G A;  4QAG A;  3V9X A;  2Q3S A;  4MQ3 A;  1U49 A;  2HBJ A;  3VF4 A;  4CJP A;  4FWL A;  3M3Z A;  2HF3 A;  2E6L A;  3OYE A;  1IBL K;  5BR8 K;  4DR6 K;  2HVI A;  1RGI A;  1HR0 K;  4B9Q A;  3VEX A;  4BRF A;  3HPO A;  4Z4C A;  1CXQ A;  4GNI A;  2UXB K;  2P9U B;  4RW7 A;  5C24 A;  5JMV A;  3DOK A;  1VQO N;  3CG7 A;  1VQ9 N;  4M3W A;  5D3G A;  5KQD A;  2VGN A;  3J8A A;  4CBU A;  3HZ6 A;  1BU6 O;  3QIO A;  5TKW A;  4CEO A;  3NFA A;  4FZY A;  4CJ3 A;  3ZX0 A;  4IOX A;  2DFF A;  1NK5 A;  1RNH A;  4IFY A;  4I9Q A;  1HNI A;  1U4B A;  4OX9 K;  3K9K A;  4CGI A;  3ULE A;  1TVR A;  5FRO A;  2P51 A;  3AVK A;  3CC2 N; 
#chains in the Genus database with same CATH homology
 1VSH A;  3HPG A;  4OJR A;  4AHR A;  2PYL A;  4FLW A;  4LD0 A;  4CEF A;  4DQP A;  4F2R A;  4KRF A;  3MXJ A;  5JS2 A;  4FJ9 A;  3M8Q A;  3L2R A;  4E3S A;  1LWF A;  3MEC A;  1BI4 B;  5SWM A;  1S1V A;  1XHX A;  4HTU A;  3QES A;  1U48 A;  1T05 A;  1QSS A;  2ZE2 A;  1IO2 A;  2ZD1 A;  4CGH A;  4FJG A;  4KHU A;  1HYZ A;  2OYQ A;  1CLQ A;  1BHL A;  4LSL A;  1A5X A;  1RBV A;  4E7H A;  4QOZ B;  4W5O A;  2WOM A;  2IAJ A;  1LAV A;  2P1J A;  4CGG A;  2LSN A;  5EU7 A;  4HUG A;  1C6V A;  4E7J A;  1G15 A;  4DF8 A;  4KAZ A;  1I3A A;  2B5J A;  1JLE A;  3AO4 A;  2D5R A;  3OYI A;  1NJW A;  4M3X A;  3HK2 A;  5E41 A;  1UOC A;  3AA3 A;  3CQ8 A;  4BDP A;  4FZZ A;  4OKJ A;  3K59 A;  1D8Y A;  2Z1I A;  5HBM A;  4WE1 A;  4HVJ A;  3U6F A;  4C8K A;  2KZZ A;  3NH1 A;  4FXD A;  1RT4 A;  4ID5 A;  2BE2 A;  3F9K A;  1S9E A;  5KRS A;  3ZCM A;  2X6N A;  1TKZ A;  3LAN A;  1KFS A;  3OYD A;  3TAP A;  4B9V A;  3SV4 A;  4GW6 A;  3LAK A;  5KI6 A;  4F2S A;  3JYT A;  1L3T A;  1KRP A;  1WSJ A;  4PUO A;  4CER A;  1RBR A;  4DTN A;  2Y1J A;  1UWB A;  4BWM A;  4E1N A;  1J53 A;  3OJU A;  4CF9 A;  1S6P A;  4FLY A;  1L5U A;  4KHY A;  4F3T A;  3AVH A;  3RMC A;  1FKP A;  4KPY A;  2YNG A;  1WAJ A;  4FJ8 A;  1RCH A;  2G8I A;  1RDA A;  3SNN A;  2YV0 X;  4B8A B;  3M8P A;  4DG1 A;  2KFN A;  3SUO A;  3KKR A;  3K5N A;  1XC9 A;  1ITG A;  4AHV A;  1KLM A;  3VQB A;  1HNV A;  5J2P A;  4FJM A;  1TAQ A;  4BE0 A;  4DU1 A;  3QLH A;  4CJK A;  1BL3 A;  2OPP A;  4DSK A;  3C94 A;  1L3V A;  3RR7 A;  1KVC A;  1ZBF A;  3QET A;  3WNE A;  3SQ1 A;  4CCH A;  5FDL A;  3KJV A;  3DLK A;  1KTQ A;  4CEC A;  3AVI A;  4NCG A;  4CGD A;  1HQE A;  1O1W A;  3E01 A;  3NGY A;  3NH0 A;  1NOY A;  4BAC A;  1LWC A;  1A5W A;  4CJF A;  3SYZ A;  3L2Q A;  1VSI A;  3RRH A;  3B6O A;  5J2M A;  1U45 A;  2AJQ A;  3L2V A;  3L2U A;  3TI0 A;  1RT5 A;  3LP0 A;  3CFO A;  5CY4 A;  2DTU A;  4R5P A;  1C0U A;  1DTQ A;  2I5J A;  3A2F A;  3WNG A;  1MU2 A;  1X1P A;  1HQU A;  3NF6 A;  4CF0 A;  1EET A;  2A1S A;  1BIU A;  4W5Q A;  4B9S A;  3K57 A;  1DTT A;  4DTP A;  3M8R A;  4OLA A;  1FKO A;  4DMN A;  3V1R A;  2G8F A;  3ZSQ A;  4CES A;  4AHS A;  4KO0 A;  4N5S A;  4ID1 A;  4CIF A;  4CGJ A;  1N6Q A;  4OPJ A;  3SPY A;  1RTJ A;  1A5V A;  3HM9 A;  4CHZ A;  3HYF A;  3QIP A;  1NK4 A;  4KB0 A;  1S6Q A;  3QNN A;  4J2D A;  1RDC A;  4OLB A;  4CFC A;  4AIL C;  3ZSW A;  4DFK A;  1YT3 A;  4O0J A;  1RBU A;  3NBP A;  2VG7 A;  1TV6 A;  2OZM A;  3WNH A;  4CK3 A;  1SV5 A;  4M3R A;  1KSP A;  4AHC A;  5C25 A;  4C8M A;  1U04 A;  4HCC A;  4IG0 A;  2BDP A;  3MAQ A;  2ETJ A;  4O44 A;  2W42 A;  3P1G A;  2DY4 A;  2YNH A;  2HNY A;  4DQS A;  1L3U A;  2FBV A;  4BWJ A;  4NYF A;  3ZSV A;  4BDY A;  4KHS A;  5J2Q A;  3K5M A;  3HP6 A;  4B9M A;  3NGI A;  4UQG A;  2ZQB A;  3LPU A;  3RRG A;  3ALY A;  1KVA A;  3HP9 A;  2XY5 A;  3SI6 A;  1HPZ A;  4FK2 A;  1EX4 A;  1JXE A;  1ZBU A;  4CJE A;  4J2E A;  4B08 A;  3ULD A;  2IOC A;  3DLR A;  4FJ7 A;  3M8S A;  3VA0 A;  1JLQ A;  4DQQ A;  4KI4 A;  1J9A A;  2OPQ A;  3KK2 A;  3AVJ A;  3L8B A;  4DTJ A;  1HYS A;  4DSL A;  1VRT A;  3H08 A;  3AA5 X;  1QQC A;  1S1T A;  2GUI A;  3L3U A;  1Q8I A;  3OYG A;  1RTD A;  5FRM A;  1VSD A;  2BGG A;  3PX0 A;  1QE1 A;  4FVM A;  3OYF A;  4FZX C;  2G8W A;  4Z4E A;  1JL2 A;  3DM2 A;  3TAQ A;  3S3O A;  3MED A;  4B9N A;  3D0P A;  1D9D A;  4C8N A;  4DTU A;  3K5L A;  2YKN A;  4AH9 A;  5KTQ A;  3LP1 A;  4FLV A;  1NKC A;  2HB5 A;  4CFB A;  4KI6 A;  3JSM A;  2P5O A;  2HW3 A;  3TAR A;  5KGX A;  5CZ1 A;  1TL1 A;  4N56 A;  1S1U A;  4KV8 A;  3OYL A;  4M3Y A;  3HST B;  1SL0 A;  1BQN A;  2FC0 A;  3S3M A;  1SKR A;  4Z4G A;  4CF8 A;  3AO2 A;  3I0S A;  2GBZ A;  1ASU A;  3DLH A;  3SPZ A;  4O0I A;  3UIQ A;  1XWL A;  3V9W A;  3AVG A;  4CFD A;  4F3O A;  1HMV A;  1UA0 A;  1ASW A;  4I2P A;  5HRP A;  1NKE A;  4QCL A;  4N76 A;  4FLZ A;  1JLC A;  5I3U A;  4DSI A;  2RPI A;  1S1W A;  1Q9Y A;  2FBX A;  4BE2 A;  4Y1C A;  4ZTF A;  5CYQ A;  1LV5 A;  1B9D A;  3OS1 A;  5HLF A;  4F8R A;  3HPH A;  4PQU A;  2NUB A;  4CJS A;  5HRO A;  4HUE A;  1VK0 A;  1C0T A;  1SKW A;  3AA2 A;  3ZSR A;  2FBY A;  4KTW A;  3EY1 A;  4LY7 A;  4J2B A;  2QKK A;  3OY9 A;  2RKI A;  1VSK A;  1B92 A;  4CF1 A;  4CEZ A;  1QS4 A;  3SQ4 A;  1NK0 A;  3AVA A;  2Z1G A;  4RW9 A;  3DRR A;  4DU3 A;  2YNI A;  2IS3 A;  4G1Q A;  2YNF A;  1UA1 A;  4NCA A;  2WON A;  4B8C A;  4CJL A;  4BE1 A;  4K8X A;  4I7F A;  3EYZ A;  4CJW A;  3VQA A;  4DTR A;  4B9T A;  3PO4 A;  4M3Z A;  4Z4F A;  2X78 A;  3ZT4 A;  1WSF A;  4RG8 A;  1B9F A;  3NDK A;  2HNZ A;  4HHT A;  4FM0 A;  4KHQ A;  3OYB A;  3TAE A;  1RT7 A;  4NCB A;  3F73 A;  2E6M A;  1N5Y A;  2F8S A;  3VQD A;  3IAY A;  3QO9 A;  3AVB A;  5HP1 A;  1X9M A;  2YHA A;  1YVU A;  3AVM A;  3C6U A;  2EX3 A;  1C1C A;  2YKM A;  3FFI A;  3IG1 A;  4Y1D A;  3CFR A;  4EP5 A;  1IKX A;  2R7Y A;  3SJJ A;  3TR8 A;  5C42 A;  3RMD A;  1HJR A;  4HUF A;  3KLH A;  4FLX A;  3ISN C;  1SKS A;  1QHT A;  2HND A;  3V1Q A;  4W5N A;  5SZT A;  4CF2 A;  1ZYQ A;  2QXF A;  4DSE A;  3OYM A;  2IGI A;  3G10 A;  1X9W A;  1WSG A;  4OVL A;  4CE9 A;  1VSM A;  1TGO A;  1C1B A;  3O4N A;  4ELT A;  1F21 A;  4FJJ A;  4IKF A;  3SQ0 A;  3QEV A;  3KD1 E;  1WNS A;  2FBT A;  4B9U A;  3DYA A;  3V1O A;  1I39 A;  3PY8 A;  3DRS A;  4CFA A;  3IS9 A;  3DI6 A;  2XY7 A;  2HHX A;  3THV A;  4EZ6 A;  1C0M A;  3U3G A;  3RR8 A;  5K14 A;  1QSY A;  3MEE A;  2Y1I A;  4E1M A;  1LW2 A;  1RT2 A;  3AVC A;  3LZJ A;  4KB1 A;  4JS4 A;  4DS5 A;  4OPK A;  2Z1H A;  4RW6 A;  3O3H A;  4W5T A;  3SZ2 A;  4FM2 A;  3T19 A;  3DLG A;  5J2N A;  3KLI A;  1VSL A;  3QNO A;  4FJX A;  3S3N A;  4CK1 A;  1X9S A;  3ZT0 A;  4KHN A;  2OZS A;  3KLE A;  1JLF A;  3LP2 A;  4OGC A;  4CEA A;  4IG3 A;  3ZSX A;  5JS1 A;  3K2P A;  1KCF A;  3P5J A;  3PV8 A;  1NKB A;  2GV9 A;  3DLB A;  2D0B A;  1KFD A;  1VRU A;  4Z4H A;  1TK0 A;  1CXU A;  3NAE A;  4FJN A;  3LZI A;  1YTA A;  3VQQ A;  4E89 A;  1NOZ A;  1W9H A;  3O3F A;  2VG6 A;  1LWE A;  1VSF A;  3MEG A;  2X6S A;  1ZBI A;  4DSJ A;  1C1A A;  1EP4 A;  4DLE A;  4EP4 A;  3VQP A;  1RIL A;  4CHP A;  1BCM A;  4BDZ A;  3OS0 A;  1RT6 A;  4DTX A;  2DFH A;  4OGE A;  1TK5 A;  4W5R A;  2KZM A;  2G8U A;  3LAL A;  3AV9 A;  3RWU A;  2O4G A;  3T1A A;  4CJ4 A;  3MXI A;  4O5B A;  2KTQ A;  4JLH A;  3VQ5 A;  5I42 A;  3VQ6 A;  3NCI A;  4JRQ A;  1RBS A;  4DFJ A;  1VSE A;  4M45 A;  3VQC A;  3TAN A;  2HHQ A;  3VA3 A;  2F96 A;  3AO3 A;  3KKS A;  4AHU A;  3SUP A;  3QEI A;  1W0H A;  4FLT A;  3ITH A;  3VQ8 A;  2VWJ A;  2EHG A;  2HHV A;  3KLG A;  3BGR A;  1EXQ A;  2IDO A;  5HRN A;  4DTS A;  5CZ2 A;  1CZB A;  4N41 A;  4JRP A;  4DU4 A;  3AO1 A;  4H4O A;  3BDP A;  4FM1 A;  3P83 D;  1WSI A;  4IBN A;  2G8H A;  1BCO A;  4TSX A;  1RT1 A;  3CFP A;  4ELV A;  2BAN A;  3MXM A;  4YFU A;  1WSH A;  4H4M A;  4CJQ A;  2QK9 A;  1WN7 A;  3QEP A;  4YNQ A;  4FYD A;  3C6T A;  3SUN A;  4AHT A;  2G8V A;  1R0A A;  3NF9 A;  1ZBH A;  1REV A;  3K58 A;  2E4L A;  4DLG A;  3AVL A;  1TKT A;  1TK8 A;  3SCX A;  3V9U A;  4GVM A;  2PY5 A;  4K8Z A;  3I0R A;  4FCY A;  5J1E A;  1RTI A;  4DTO A;  2JGU A;  5DK5 A;  3SV3 A;  4DFP A;  1XHZ A;  2HMI A;  1IKY A;  1WSE A;  1DLO A;  4FJK A;  2XRI A;  4M41 A;  2JLE A;  1J5O A;  4CHY A;  3TAG A;  2HHS A;  1RDB A;  3VQ7 A;  1Q9X A;  5HRR A;  2A1R A;  2OA8 A;  2QKB A;  1Y97 A;  3OYK A;  3LDS A;  5KGW A;  1JLG A;  1NK9 A;  3AA4 A;  4J2A A;  3NE6 A;  3ZSY A;  4E0D A;  4N47 A;  4FLU A;  3L3V A;  1BIZ A;  2RN2 A;  1GOA A;  4CK2 A;  1TL3 A;  4DQI A;  1YTU A;  1K6Y A;  4ICL A;  3AVF A;  4FK0 A;  4O4G A;  1IH7 A;  3DRP A;  4DFM A;  3ZT1 A;  4I2Q A;  1T8E A;  3AO5 A;  1S1X A;  2IC3 A;  4DWI A;  1J54 A;  1JKH A;  4NYN A;  3RTV A;  3CM6 A;  3LAM A;  4E7L A;  3ZSO A;  4DTM A;  3VQ9 A;  4E7K A;  3O3G A;  3G0Z A;  1EKE A;  2ATQ A;  1T7P A;  1FK9 A;  1Z25 A;  2PZS A;  2KW4 A;  2DFE A;  1RTH A;  4Q0B A;  3WNF A;  1D9F A;  3V4I A;  5T7B A;  3HL8 A;  4CJR A;  4FJH A;  1JLB A;  1NK8 A;  3V9Z A;  3IRX A;  2D0C A;  3KIO A;  1ASV A;  3D45 A;  4CHN A;  1JL1 A;  3ASM A;  4ZHR A;  2B4J A;  1XI1 A;  3V81 A;  4B3O A;  2ITG A;  1WLJ A;  2VG5 A;  4CJV A;  4KRE A;  2KFZ A;  4CEB A;  3QIN A;  3VN5 A;  1WAF A;  3ZT3 A;  4Q5V A;  4MFB A;  3DMJ A;  3V6D A;  3HJF A;  4CHO A;  4PA1 A;  3OYJ A;  2O4I A;  1GOC A;  3T3F A;  1L3S A;  3HXM A;  1TKD A;  4FK4 A;  1TAU A;  4L8R B;  3ZSZ A;  4JS5 A;  3L2W A;  4KKO A;  4CJT A;  4I9L A;  5HRS A;  3U3Y A;  1CZ9 A;  3AVN A;  3PX6 A;  4DF4 A;  4ELU A;  3HVT A;  2Z1J A;  4RW4 A;  3OYA A;  3HO1 A;  3NGZ A;  2X74 A;  1JLA A;  2D0A A;  3VQ4 A;  4LH5 A;  3KK1 A;  1QSL A;  2HHW A;  2XY6 A;  1NJZ A;  3DOL A;  2KQ2 A;  2XHB A;  2G8K A;  5KRT A;  2YHB A;  1T03 A;  1HRH A;  1LAW A;  3KTQ A;  3O4Q A;  1BQM A;  4Z0U A;  3I8D A;  4DS4 A;  4DSF A;  4ZTJ A;  5CYM A;  4M3U A;  4OKE A;  1JXB A;  3QER A;  3QEW A;  1NJY A;  4PY5 A;  1KVB A;  1FXX A;  4GMJ B;  3RMB A;  1BIS A;  3V9S A;  1RDD A;  3SUQ A;  3LWM A;  3S9H A;  1KLN A;  2P5G A;  3PUF A;  4QAG A;  3SQ2 A;  3V9X A;  2Q3S A;  3LP3 A;  3HVR A;  2XY8 A;  4MQ3 A;  4LH4 A;  4PWD A;  3TAB A;  4H8K A;  4CEQ A;  1U47 A;  2OPR A;  1U49 A;  4FJ5 A;  3LWL A;  1S9G A;  1GOB A;  1S5J A;  4CJP A;  3OS2 A;  2XO7 A;  3QEX A;  3C95 A;  4LSN A;  2PYJ A;  1HYV A;  2B6A A;  4CHQ A;  2RF2 A;  3OYN A;  3OJS A;  4C8O A;  2E6L A;  3OYE A;  4CIG A;  4HCB A;  1SL1 A;  3CYM A;  3TAF A;  4F4K A;  4KTZ A;  2HVI A;  4RW8 A;  1NJX A;  4EZ9 A;  1RBT A;  3NF8 A;  3HT3 A;  1IKV A;  4FJL A;  4O55 A;  4C8L A;  1TKX A;  4CEE A;  4E7I A;  3TAM A;  4CED A;  4M42 A;  3B6P A;  4OKK A;  3HPO A;  4Z4C A;  5FRN A;  3RMA A;  4IFV A;  3OYC A;  1CXQ A;  1LW0 A;  4FW1 A;  1SUQ A;  4RW7 A;  5C24 A;  3KD5 E;  4B9L A;  3DOK A;  3VQE A;  3CG7 A;  1ZBL A;  1SL2 A;  1QTM A;  1VSJ A;  4M3W A;  3PO5 A;  2F8T A;  4E19 A;  3CM5 A;  5D3G A;  4Z4I A;  3DLE A;  3NHG A;  2HHT A;  4CJ5 A;  3NH2 A;  3PX4 A;  1BGX T;  3LPT A;  2HHU A;  3OYH A;  1D5A A;  1BI4 A;  4IDK A;  1RT3 A;  2VWK A;  3QIO A;  4CEO A;  3NFA A;  3KLF A;  3TWH A;  4FZY A;  4CJ3 A;  4CIE A;  1IG9 A;  4FJI A;  4KTQ A;  1NK6 A;  2OPS A;  2DFF A;  1NK7 A;  1NK5 A;  2HVH A;  1RNH A;  4IFY A;  5DMR A;  3ZT2 A;  4I9Q A;  4CJU A;  1Z26 A;  1HNI A;  3K5O A;  4DQR A;  4KFB A;  3NF7 A;  1UAX A;  4FW2 A;  1IKW A;  4CGF A;  3EZ5 A;  1U4B A;  4CGI A;  4KHW A;  4M3T A;  1TVR A;  4XIU A;  3KK3 A;  3OVN A;  5FRO A;  2P51 A;  3AVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...