1RBVA

Structural study of mutants of escherichia coli ribonuclease hi with enhanced thermostability
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADAKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Structural study of mutants of Escherichia coli ribonuclease HI with enhanced thermostability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
total genus 52
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rbvA00
2HHXA 2KW4A 3ZSQA 4DTJA 1NK0A 5DMRA 4CHOA 1NKCA 1S1VA 2E6LA 3SV3A 4KRFA 3NGYA 4B8AB 2HHUA 1CXUA 2XY7A 3TAEA 2KFZA 4DF8A 2HNYA 2G8WA 4B9UA 4CJVA 2IOCA 4CERA 2HHTA 5FRMA 3HJFA 4JRPA 2I5JA 1NKBA 4CJPA 3C6TA 4DU4A 4IBNA 1D5AA 2FBYA 4KV8A 1KTQA 3V4IA 3RR7A 4DSIA 2DY4A 3K58A 1FKPA 4Z4GA 3LP1A 4FZXC 1BHLA 2KTQA 1NK4A 1QSYA 5J2QA 3P5JA 3VQCA 4DFKA 1IG9A 4KI6A 3MECA 2R7YA 4FW1A 1BCOA 3V9XA 3QEXA 2XY6A 4K8ZA 3NH1A 4EP5A 4NYFA 4FJKA 4E7LA 4N76A 5HRNA 4E89A 4LH5A 3KD5E 4CF8A 1LV5A 4MFBA 4BDPA 4CJ3A 2FBVA 4B3OA 3TI0A 4CFDA 1DTQA 1I39A 5EU7A 2P51A 4DLEA 3LWMA 5CZ1A 3AO3A 3VQBA 1JLBA 1BISA 4IG0A 4E7HA 3ZSYA 4XIUA 4CK3A 4OKEA 3AA5X 4RW4A 3O4NA 4Q5VA 2P5GA 1QS4A 4CK2A 3QNNA 3L2UA 1S6PA 2YHAA 3LPTA 1ASVA 1XC9A 4DLGA 4E7IA 2F96A 3B6OA 1WSEA 3D0PA 5KRTA 4OLAA 3HSTB 4CEQA 2DFHA 4CJ5A 4J2EA 1TKTA 1Q9YA 3TARA 3S3MA 1RBVA 1IKVA 2D0CA 2WONA 3M8QA 1NK6A 4FJGA 3KKSA 4I2PA 1TL1A 1L3TA 3CM5A 1N5YA 1CZBA 4CFAA 4CF1A 3O3FA 4C8LA 2YKMA 4DQIA 4FM2A 4W5NA 4F3OA 4FJLA 3V81A 4E7KA 1BGXT 4CE9A 3QETA 1W9HA 4DS4A 3V6DA 2HHSA 4KHYA 4CEOA 4IKFA 4KPYA 3AVJA 4OKKA 2W42A 1XHZA 4OJRA 4B08A 4Z4IA 5C24A 2IS3A 2G8IA 2HHWA 2VG7A 1EKEA 1ZBLA 1QQCA 2IAJA 4FJNA 2HHVA 1BQNA 3MXMA 1WN7A 2O4GA 2B6AA 4FW2A 3PX6A 4C8OA 4ELUA 4NCBA 1TKDA 1RBRA 4Z4CA 3VQAA 3KLGA 1BIZA 1ZBFA 2RPIA 3WNEA 3ZT0A 3NH0A 3SUPA 4FK2A 4J2BA 1IKYA 2IC3A 4IDKA 4KTWA 2YNIA 1VSHA 1U48A 3VQEA 2VWJA 3RMAA 3PO5A 4O44A 3QIPA 4CJLA 3ITHA 1VSEA 4IG3A 2G8HA 3VN5A 3AVFA 1U45A 1Q8IA 3DLKA 4CF0A 1T05A 4I2QA 1SKWA 3U3GA 2E6MA 2G8FA 1HPZA 2G8UA 2PYLA 4DTUA 1EX4A 1JL1A 1WSJA 3HP6A 3OJUA 1LW2A 4DTOA 3V9WA 3NE6A 4CGIA 3ZT1A 1BL3A 4CGDA 4CJTA 5KGWA 4W5TA 3OYAA 3C95A 1JLAA 3F73A 4DQSA 3HT3A 1D8YA 3TR8A 3HK2A 3CG7A 1X9WA 4O0JA 3DRPA 2XO7A 4M3WA 2EHGA 5JS1A 1LWCA 3V1RA 3OYNA 2F8TA 3OYDA 4KKOA 4KO0A 2KFNA 4R5PA 3IS9A 3RWUA 2VG6A 1FXXA 1A5VA 4E19A 3RMCA 4EZ6A 3OYMA 1T03A 1HYSA 1UAXA 1GOCA 3PV8A 4QOZB 1Z26A 2ITGA 4DFJA 2HHQA 1KFDA 3D45A 4MQ3A 3DRRA 4CECA 4F4KA 1VSKA 4E0DA 2X74A 4M45A 3VQ4A 1L3UA 4FVMA 4H8KA 1ASWA 3EY1A 5HROA 4FLWA 3WNFA 3TAFA 2KQ2A 2YNFA 1FKOA 1NOZA 2YV0X 3T1AA 3M8SA 3L2RA 3EYZA 3ZSWA 3V9UA 1NK5A 1NJXA 2HVIA 2A1RA 1X9MA 3SUOA 1RBSA 1C1BA 3VA3A 1J5OA 4EZ9A 4KTQA 4Z4EA 3NH2A 1UOCA 3LDSA 4GVMA 4FLXA 1LAWA 5DK5A 1B92A 1WSIA 3CFPA 1S1TA 2OPRA 4DTMA 3QEIA 2JGUA 2PYJA 1TKZA 3KIOA 4DU3A 3P83D 4WE1A 4M41A 2FC0A 1VSJA 4JS4A 4QCLA 1YVUA 4OVLA 2Y1IA 2XY8A 1RBTA 3H08A 4M3ZA 1QE1A 3HPOA 3I0RA 4I9QA 3MXJA 2HVHA 4B9TA 3KD1E 2XHBA 4FJIA 1VK0A 3HVTA 1SKRA 4B8CA 3V9ZA 1WLJA 1A5XA 3IRXA 4CEDA 5J1EA 3OYKA 1U49A 1RCHA 3OYLA 2BDPA 3KK3A 4O55A 4CEZA 1RTHA 1F21A 1W0HA 4DSLA 3IG1A 1WSFA 4E3SA 3ZSXA 1VSMA 4BDYA 1REVA 2D5RA 1L3SA 3KK1A 3SUNA 5HRSA 3SYZA 1WSHA 3TANA 4Z4FA 3AVCA 3L2QA 3QNOA 1TKXA 4Y1DA 4HCCA 1C0UA 3AVHA 4I9LA 3SQ4A 3SPZA 3THVA 4TSXA 2JLEA 3HPHA 3NGZA 1D9DA 4FK0A 3K5LA 5CYMA 5HP1A 3VQDA 1X9SA 1T7PA 2P1JA 4RW6A 1RILA 3AVAA 4IFVA 3VQ5A 1NK9A 1RTDA 4B9MA 1SL0A 2VWKA 3KLIA 3S9HA 3L2WA 1S9EA 4KTZA 1LAVA 4B9NA 4N5SA 5J2MA 3DMJA 3AA2A 3VQ6A 1J53A 3AO4A 3SQ2A 3SQ0A 4ZTFA 2B4JA 4KB1A 3OYFA 3QINA 3SPYA 4FJ9A 3OYIA 3LAKA 5E41A 1C0TA 3QLHA 3LZIA 3ZT4A 3OYHA 4OGCA 1C1CA 4HVJA 3HVRA 3VQ8A 4ZTJA 4FJHA 5D3GA 1KLMA 3WNGA 2QXFA 4DFMA 2KZZA 4HUGA 3B6PA 3BGRA 5SWMA 1ASUA 3V1QA 4CIEA 5KRSA 3I0SA 4H4MA 4LH4A 5I42A 1UA0A 1L3VA 2HW3A 1BI4A 4CGJA 3HPGA 2FBTA 4PUOA 3LP3A 3SUQA 3HL8A 4BE2A 4DTRA 4FLYA 3HXMA 1DTTA 4CJEA 3LAMA 3DLBA 4HUEA 4FJJA 1RT6A 4OGEA 3OYEA 3MEGA 5HBMA 4GW6A 4AHVA 4ICLA 1T8EA 3DOLA 1LWFA 4J2AA 4FLTA 1JXEA 3ZSVA 3VQ9A 2BANA 4W5RA 3CFRA 2HB5A 1JL2A 3DLEA 4E1MA 3ISNC 4Q0BA 1SL2A 4AH9A 1ZBHA 3CM6A 4F3TA 1RNHA 3HM9A 2Y1JA 3ZT2A 3PY8A 4KHUA 3OS0A 3KK2A 2OPQA 3LPUA 3VQPA 4CGGA 3AO5A 3MEEA 4DU1A 3TAQA 1ZBUA 4C8KA 4CK1A 3K2PA 4HUFA 3DRSA 4FCYA 2OA8A 4DQRA 4RW9A 4CIGA 1TVRA 4CEAA 3AA3A 4HCBA 3SJJA 5CZ2A 1S5JA 4Z4HA 3ZCMA 3TAGA 2QKBA 4DSEA 4LSNA 5CY4A 3QERA 4CJUA 4FJ8A 4KHSA 4O0IA 1GOAA 5CYQA 1CLQA 2PZSA 3TWHA 3BDPA 4FZZA 2GBZA 1IH7A 2Z1JA 4BDZA 3NF6A 4W5OA 3DLRA 4PA1A 2OZSA 4AHTA 1N6QA 1EXQA 3KLHA 3HP9A 4E1NA 3NAEA 3AVBA 1SUQA 2HNZA 2O4IA 1BQMA 3QEWA 3VQ7A 4M3UA 1KRPA 4CF2A 4CJWA 3NF7A 3K59A 4Z0UA 4YNQA 4DTSA 2B5JA 3LWLA 3NF8A 4CJFA 4M42A 4N56A 4M3YA 1WAFA 1NJWA 3ZSZA 1U4BA 1XWLA 1QHTA 3OYJA 4CHPA 3L3UA 3DLGA 4CHNA 4K8XA 2ATQA 3S3OA 2KZMA 1KFSA 1TGOA 3ZSOA 4B9SA 1LW0A 4G1QA 1TV6A 4O4GA 1NOYA 3EZ5A 1QSSA 1XHXA 5C42A 1CZ9A 1QSLA 3SQ1A 1HQEA 4JS5A 4UQGA 4NCGA 3MAQA 3RRHA 1RTIA 1FK9A 3C94A 3RMBA 3SCXA 3S3NA 3OYBA 2GUIA 3DLHA 2RF2A 1YTAA 3U3YA 1ITGA 1SKSA 4FYDA 1IKWA 1JLEA 1RT3A 4DSFA 3ASMA 2IGIA 4CCHA 4NYNA 3AVGA 1RDAA 4ZHRA 1BIUA 2DFEA 1JKHA 3RMDA 4ID1A 2RKIA 3LALA 1SV5A 4AHUA 3CFOA 4ID5A 4CIFA 1UA1A 4J2DA 4ELTA 1HJRA 3A2FA 3AO1A 2DTUA 3O4QA 1XI1A 3LZJA 1HYVA 1EP4A 1S9GA 3ALYA 4N47A 2QKKA 4LD0A 4CJ4A 1ZYQA 4KI4A 5HLFA 1L5UA 4B9LA 4PY5A 4YFUA 2OPSA 1S1UA 4CGFA 4HHTA 4FLZA 4OKJA 3OJSA 1WSGA 3SI6A 3OY9A 4PQUA 4DS5A 4CHQA 2YKNA 1KVCA 3CQ8A 1U47A 1HQUA 3L2VA 3QEVA 3SNNA 1C1AA 3HO1A 4CEEA 3OVNA 3KTQA 1UWBA 1SL1A 1G15A 1ZBIA 1VSDA 2YNHA 5I3UA 4DTNA 3NGIA 3V9SA 1X1PA 2WOMA 5FRNA 3AV9A 1MU2A 2OZMA 3C6UA 2QK9A 3CYMA 3AO2A 1GOBA 5HRRA 2E4LA 4DSJA 4FZYA 1B9DA 3MEDA 4CFBA 4E7JA 1NJYA 3KLFA 5FROA 4DWIA 1CXQA 3QO9A 3KKRA 1HYZA 4C8NA 3DI6A 2IDOA 2G8VA 4CF9A 4OPKA 4DQQA 3RTVA 2ZQBA 2A1SA 3G10A 4F2SA 4LY7A 4FK4A 1TK0A 3M8PA 1VRUA 3SZ2A 1IO2A 4IFYA 1KVAA 3L8BA 4B9VA 3TAMA 4CFCA 1JLFA 4DFPA 2Z1IA 1TL3A 2DFFA 5HRPA 3K5MA 1A5WA 4KREA 3F9KA 3OYGA 4BWJA 1R0AA 2Z1HA 3RRGA 3HYFA 4DMNA 2OYQA 3AVLA 4FJ7A 3PO4A 1S1WA 1JLCA 2FBXA 4BACA 3AVIA 2HNDA 4Y1CA 2ZD1A 3ZT3A 4CEBA 5KTQA 1KVBA 3NHGA 1TAUA 1RT2A 3NCIA 3DM2A 1WNSA 1KLNA 4FM1A 2X78A 4PWDA 4LSLA 5KGXA 3T3FA 3NDKA 1RTJA 4FJ5A 3O3HA 1IKXA 2EX3A 1J9AA 3JSMA 3QEPA 1HRHA 4CHZA 3MXIA 4KB0A 3UIQA 4AHSA 4JRQA 3P1GA 5T7BA 2F8SA 3NFAA 4EP4A 1TK8A 1S1XA 3V1OA 4CJQA 2D0BA 3I8DA 2RN2A 2BE2A 4CEFA 2YNGA 1RDCA 2XY5A 1KSPA 3IAYA 4DTXA 1NJZA 4KHWA 4KFBA 1JLQA 4M3TA 1O1WA 1J54A 1HNVA 3PX4A 3AVKA 2ETJA 3K5NA 1WAJA 1NK8A 3WNHA 1I3AA 4W5QA 3ZSRA 3DOKA 4OLBA 1KCFA 1TAQA 2PY5A 2HMIA 1Y97A 4CJSA 4DQPA 1S6QA 2GV9A 3AA4A 4AHRA 3OS1A 4KHNA 1BI4B 3QESA 3OYCA 3TAPA 2P5OA 4ELVA 4GMJB 3O3GA 3VA0A 3K5OA 1JLGA 4JLHA 3JYTA 2X6SA 1HMVA 2Z1GA 3LP2A 3T19A 3KJVA 2G8KA 4I7FA 1NK7A 2LSNA 1BCMA 2Q3SA 4FXDA 1DLOA 1RT4A 2XRIA 4AHCA 4FLVA 4KHQA 4BWMA 1RT1A 3NF9A 3G0ZA 4BE0A 2ZE2A 1B9FA 5J2NA 3TABA 1Q9XA 1C0MA 4FJXA 4AILC 4F8RA 1LWEA 1RDDA 3LANA 4CGHA 2AJQA 1RT5A 3VQQA 1NKEA 2NUBA 1RDBA 3M8RA 4L8RB 3LP0A 4N41A 2X6NA 1C6VA 4H4OA 1RT7A 5SZTA 3SV4A 3DYAA 4C8MA 1VSIA 3OS2A 4FLUA 4F2RA 2YHBA 4KAZA 2BGGA 4HTUA 4NCAA 1EETA 4RW7A 1QTMA 5JS2A 2VG5A 4M3RA 4O5BA 5J2PA 3PX0A 1VSFA 1U04A 1Z25A 3E01A 3PUFA 4DSKA 4CJKA 4OPJA 1RBUA 3L3VA 1JXBA 1K6YA 3AVNA 5KI6A 4M3XA 4FM0A 4FJMA 5C25A 3K57A 2OPPA 3RR8A 4CESA 1YT3A 4QAGA 4RG8A 5FDLA 2D0AA 4DG1A 3KLEA 4BE1A 1VSLA 1VRTA 4CHYA 3ULDA 5K14A 4DF4A 1YTUA 1TK5A 3NBPA 1HNIA 3U6FA 3FFIA 3QIOA 3AVMA 4RW8A 4CJRA 1D9FA 4DTPA
chains in the Genus database with same CATH superfamily
1NK0A 1VQ4N 2QA4N 3SV3A 5AZIB 2XY7A 5AQGA 4CERA 2D1KA 5LJVA 4DU4A 3RR7A 2KHOA 1FKPA 3K58A 1BHLA 5KPZA 2UYTA 3P5JA 4KI6A 4BRKA 2R7YA 4FW1A 4K8ZA 3NH1A 4CJ7A 3TSQA 4FJKA 4LH5A 3KD5E 1VHXA 2FBVA 3TI0A 1I39A 5EU7A 1N34K 3B8AX 3VQBA 3ZSYA 4XIUA 3UKUB 3AA5X 4RW4A 4Q5VA 3EN9A 3MN6A 1T3VA 1ASVA 3ZX3A 4DLGA 1T6CA 2WFBA 3ENHA 1KAYA 4CJ5A 2DFHA 1TKTA 1RBVA 3M8QA 1NK6A 4FJGA 3KKSA 3O9SA 2ZF5O 1TL1A 1L3TA 4CF1A 3O3FA 4FM2A 5M1NA 4E7KA 3QETA 3V6DA 4DS4A 2HHSA 4IKFA 1G99A 3EEQA 1XHZA 2W42A 1VAZA 4OJRA 4H0TB 1EKEA 1QQCA 2IAJA 3C65A 2YX6A 2Q0RA 4FWNA 4ELUA 1TKDA 1RBRA 3KLGA 1U4BA 4FK2A 4IJNA 4J2BA 2YNIA 4H0XB 4BROA 3CCJN 5FPEA 3FR0A 1QHAA 4CJLA 3ITHA 4FOEA 2E20A 3RSEA 3VN5A 1Q8IA 1HLUA 1SKWA 2E6MA 2G8UA 4FSVA 3J80O 1JL1A 1WSJA 3HP6A 2FF6A 4KHPK 4CGDA 3ENOA 3HK2A 5BN8A 2I7NA 4O0JA 3DRPA 2O8BB 2OTJN 4CD1A 3CJBA 2KFNA 3RWUA 1A5VA 3RMCA 3OYMA 1UAXA 4H0YB 4LF5K 4DFJA 5AQHA 3H3OB 3DRRA 4F4KA 1VSKA 1SZ2A 2X74A 3VQ4A 4PKGA 5AR0A 4FVMA 3WNFA 2CH6A 3EYZA 3T1AA 3OW2M 4G9ZA 3ZSWA 2E2NA 3CCMN 2HVIA 2A1RA 5AQZA 3SUOA 1RBSA 3VA3A 4EZ9A 4GV6A 1UOCA 3VEWA 2JGUA 4BRDA 3P83D 4B3RK 5AQMA 5GAEP 4CZMA 4I9QA 2A6AA 2HVHA 2XHBA 1VK0A 3I55N 3HVTA 3IRXA 5J1EA 3OYLA 4CEZA 1F21A 1W0HA 3ZX0A 4PHTX 3CMAN 1VSMA 4BDYA 1REVA 4IJAA 4DQ8A 3KK1A 2O8EB 1WSHA 3CJAA 3OHRA 3AVCA 4Z4FA 3VENA 3CCVN 3SK3A 4HCCA 3AVHA 4I9LA 3SQ4A 3MK6A 3K5LA 1NGFA 1T7PA 2P1JA 3P38A 5CHIA 4CZJA 3SAGA 3S9HA 2FLOA 4B9NA 4WQ4A 3WXIA 3DMJA 1W2BM 3ENBA 4FJ9A 2E1YA 3LAKA 3LZIA 3T1HK 4PKHA 4ZTJA 3WNGA 4AM6A 3TSPA 5KPTA 5SWMA 1ASUA 5KRSA 1UA0A 3VGLA 1IBKK 1NNEA 3MN5A 2UU9K 1TUYA 5JLFA 3N4QA 3HL8A 3LL3A 3R8EA 3DLBA 5HBMA 3THWB 4AHVA 1VQ6N 1K8KB 1T8EA 4J2AA 1MWKA 4FLTA 2BANA 4Q0BA 4E1MA 1IG8A 4FWLA 1SL2A 3UKRA 1NGEA 4X66K 2Y1JA 3KK2A 3BP8A 4CGGA 4DU1A 3TAQA 1ZBUA 3THXB 3IKMA 2NRZA 2QWOA 5A2QO 1S5JA 3EZWA 3VF4A 2QKBA 3QERA 2P9LB 4CJUA 3CPEA 3WEEB 5CYQA 5LMUK 3TWHA 3HI0A 4BDZA 4LF6K 4LC9B 3BZCA 4XEIA 5BPLA 4FVUA 3KHYA 1BQMA 3VQ7A 4M3UA 1KRPA 3NF7A 2B5JA 3AAQA 2HBJA 1U2VB 4CHNA 1M90O 2ATQA 2KZMA 3ZSOA 2A3ZA 3D2FB 1OVYA 4UY8O 5EX5A 4O4GA 1QSSA 1XHXA 3ID8A 3SQ1A 4UQGA 3RMBA 3E9PA 1RTIA 4ISFA 3SCXA 1H1VA 5AQUA 4EHUA 1E4FT 1R59O 3UE5A 4DSFA 2IGIA 1Z6RA 4CCHA 1RDAA 4IWVA 1JKHA 3BUZB 3EE8A 1SV5A 4ID5A 3UKUA 1I94K 1HJRA 3A8YA 3A2FA 3QBXA 2F7TA 3O4QA 3LZJA 5AQPA 1JCEA 4LD0A 4CJ4A 4KI4A 2AA4A 5HLFA 4PY5A 3QMLA 4LFAK 2OPSA 1YUWA 2PBDA 2QWQA 2UUCK 4FLZA 3OY9A 5MLCQ 4JN4A 1HKGA 2OCEA 1ZC6A 2YKNA 1QZ5A 2PFUA 3WXJA 1WUAA 2YNHA 5I3UA 1HNWK 1QQOA 1X1PA 3D7EO 2WOMA 5FRNA 1QQMA 3AV9A 3I33A 4BRPA 2CGJA 2E4LA 2VCPA 4DSJA 4FZYA 3MN7A 4H5TA 4MO4A 4DWIA 3O9QA 3H1QA 4C8NA 5M1FA 4BRGA 4DKWA 3G10A 4FK4A 1KVAA 3C6AA 5C15A 3IUCA 1JLFA 4DFPA 1TL3A 3VEVA 5HRPA 5KPRA 3F9KA 4BWJA 2Z1HA 1OH6A 1S1WA 2WUSA 3EKUA 3O80A 3PSIA 3CD6N 5KTQA 1RT2A 1KLNA 4LSLA 5KGXA 5C2FA 3CJ7A 3CCEN 3T3FA 2O8BA 1NGAA 1VQ7N 3WXKA 2AP1A 3FZMA 3QDKA 4A2AA 4FJ5A 2NRHA 3JSMA 4A5AA 4KB0A 1YXQA 2NLXA 2VWBA 4EP4A 5F2RA 4CJQA 4AF1A 3I8DA 2RN2A 4FL9A 1NGJA 4NO7A 1ATRA 2YNGA 4B1WB 1KSPA 1O1WA 3PX4A 3AVKA 3K5NA 3BEXA 4BC4A 3DOKA 3SBGA 1BG3A 1S6QA 3AA4A 3M6GA 4DR3K 1BI4B 3TAPA 1M1KO 1VQ8N 1JLGA 3TSUA 1BOTO 2YI1A 3FLCO 2G8KA 4BRQA 1X9JA 4I7FA 1NK7A 1W7AA 5AQXA 1DLOA 2D0PA 2XRIA 4DR4K 4JI1K 4KHQA 1XNQK 1RT1A 2ZE2A 4AILC 4F8RA 1LWEA 1RDDA 4CGHA 2GTDA 4U7BA 1NKEA 3VGKA 1C6VA 3W3DA 1RT7A 4EIAA 3QBWA 3DYAA 2NRWA 3FFKB 4F2RA 3GDQA 2YHBA 1EETA 2W40A 4RW7A 2EWSA 1Z25A 3E01A 4OPJA 4LF8K 1DGKN 4M3XA 3AVNA 4FM0A 2E8AA 5C25A 4B9QA 3RR8A 5M1PA 4CESA 1CZAN 4QAGA 4M7XA 5FDLA 3KLEA 5CR4A 1VRTA 3ZEUB 4LFCK 5K14A 1YTUA 5E26A 1TK5A 3NBPA 4QS8A 1HNIA 4HTLA 3FFIA 4WQ4C 1OKJA 4BRAA 2HHXA 2KW4A 4CHOA 1NKCA 4JK7A 2P9NB 3MCAB 4YOWA 4B8AB 3HM8A 1CXUA 3TAEA 2W6LA 2KFZA 4CJVA 4DV4K 5FRMA 3HJFA 2I5JA 2FBYA 3GL1A 1NGHA 2DY4A 3LP1A 2BUPA 3S41A 3O5BA 3THWA 3AGRA 5BPNA 1K8KA 4NYFA 4E7LA 4N76A 2RE2A 4HWIA 5EY4A 2P51A 3TTFA 1NMDA 1JLBA 1BISA 3O4NA 3O9TA 3THXA 4A5BA 1QS4A 2E5LK 1N33K 2ASPA 3H45C 2YHAA 5F0XA 3LPTA 5AQRA 1NGDA 2WBNA 3L0QA 5KRTA 2P9LA 3CJ1A 3S3MA 3PLAA 2A41A 4C8LA 4DQIA 3V81A 1BGXT 4CE9A 1W9HA 4CEOA 4OKKA 4B08A 3U4LA 2VG7A 3QFUA 3WUHA 4CBWA 4FJNA 1U2VA 3SLCA 4DV0K 2P9KB 2O4GA 1V4TA 3PX6A 4NCBA 3CCRN 1BUPA 1BIZA 3WNEA 2RPIA 3D2FA 2IC3A 2VGNA 3GBTA 4U67L 3VQEA 3RMAA 3Q7CA 4KH4A 4O44A 3SAHA 4OPAA 1U45A 4H03B 2G8FA 1HPZA 1EX4A 1LW2A 4OX9K 3NE6A 4CGIA 4CJTA 3F73A 3OYAA 3IFRA 3PIOL 3CC7N 1X9WA 1IBLK 3VETA 5DM7L 3SJHA 2XO7A 4IOXA 1OVQA 2EHGA 2FF3B 3V1RA 2F8TA 1DT9A 4KKOA 2QWMA 4R5PA 3IS9A 2VG6A 4QOZB 1Z26A 4B3SK 4GV3A 4CVNE 4E0DA 4M45A 3ATUA 4YOUA 3KK7A 2RHKA 3DXMB 2QWRA 2KQ2A 2YNFA 2YV0X 1J6ZA 1C1BA 5GIOA 3NH2A 2ASMA 5DK5A 4BC3A 3FZKA 3QEIA 3OBWA 2CGLA 1GLLO 4JS4A 1S72N 2XY8A 1RBTA 1QE1A 3U9DA 3MXJA 4C1NI 4FJIA 4MO5A 2D4WA 4JYAK 5AFUA 4A57A 4XH1A 1U49A 3R3LA 2BDPA 1O13A 2E2QA 3KK3A 3IG1A 3M1FA 4E3SA 1YI2N 2QWPA 5HRSA 3SYZA 3QNOA 2ZJQL 4Y1DA 3CF5L 3O9UA 3THVA 2ZM6K 4CBXA 4JI7K 3ZYYX 4LF4K 3VEZA 1D9DA 5ELZA 4RW6A 3VQ5A 2VWKA 1NGGA 1S9EA 3SQ0A 4ZTFA 3OYFA 2YJFA 3OYIA 3BF3A 1C1CA 3VQ8A 5D3GA 4CBUA 1KLMA 2QXFA 4CIEA 5I42A 3I0SA 4H4MA 4MLEA 1L3VA 1BI4A 4CGJA 2O8CB 3HPGA 3LP3A 4BE2A 4O8UA 2Q31A 4DTRA 1N8RO 3HXMA 1S22A 4HUEA 3LM9A 1RT6A 4OGEA 4DCHA 3DLLL 4ISEA 1JXEA 2HBLA 2HB5A 1DKGD 3ISNC 3GG4A 4AH9A 3HM9A 3PY8A 3WXMB 2HSTA 3OS0A 2Q1NA 4MLHA 2UXCK 3LPUA 3VQPA 3NVMA 3VGMA 3AO5A 3MEEA 4C8KA 4FCYA 2OTLN 4DQRA 4RW9A 4CIGA 1VQON 1NJIO 3AA3A 3O08A 4DSEA 3D6RA 5CY4A 3ZETB 1CLQA 4FZZA 3SBTA 3L4IA 1KD1O 2GBZA 3NF6A 1XMOK 5AQFA 4DR6K 3DLRA 1EXQA 1KQSM 3KLHA 4E1NA 3NAEA 3AVBA 3F5TA 1SUQA 4Y0WA 4WFBL 4FWKA 4CJWA 4M42A 4M3YA 4CJFA 4N56A 1W97L 2P9NA 1XWLA 1QHTA 4K42A 5AQJA 4K8XA 3S3OA 1TGOA 1VQKN 5CE3A 4G1QA 1NOYA 4Z94A 2NRRA 3AGKA 3C94A 2RF2A 4DV2K 3O9RA 5I9EB 3CIPA 4NYNA 3RMDA 4H0VB 1BIUA 2DFEA 1J5EK 4ID1A 4AHUA 3CFOA 4CIFA 4IO9L 4J2DA 1GLEG 2UXDK 4B1ZA 2DTUA 1XI1A 1NGBA 1HYVA 1S9GA 3ALYA 4N47A 1SS6A 1ZYQA 4YOXA 1L5UA 4B9LA 1TYQA 4X64K 3VOVA 4DS5A 3NVKA 4CHQA 5LY3A 3T7ZA 1KVCA 1OH8A 2UXBK 1U47A 1HQUA 1C1AA 1UWBA 2V7ZA 2YJEA 5AQWA 1ZBIA 4BVOA 1C0GA 1K8AO 1MU2A 2OZMA 3C6UA 4ISGA 2QK9A 3VERA 1B9DA 4CFBA 1NJYA 2P9KA 1QVFM 1CXQA 1HYZA 2IDOA 3DAWA 4DQQA 4LY7A 1TK0A 1VRUA 5AZJB 1X3NA 3CC4N 5LJWA 3K5MA 1A5WA 4KREA 3RRGA 3HYFA 4DMNA 4JKGB 4FJ7A 3PO4A 1JLCA 3CCSN 1TAUA 3E66A 5C10A 3VTHA 2X78A 4PWDA 3DWLA 1WOQA 1SQKA 4R79A 3DXKB 4A2BA 1IKXA 1J9AA 1HRHA 2E1ZA 3MXIA 3UIQA 4AHSA 4JRQA 5T7BA 2F8SA 3NFAA 1TK8A 1S1XA 4JKDA 2BE2A 5C2DA 1RDCA 5BRHA 3IAYA 3DXMA 1JLQA 4M3TA 1J54A 1XUPO 1Q18A 1NK8A 2GWKA 2PY5A 5BREA 2HMIA 4CJSA 3G25A 4K43A 1KC8O 3OS1A 4KHNA 1YHQN 3OYCA 4JI5K 4DR7K 3C7NA 4JLHA 3JYTA 3GOIA 1NBWA 3T19A 2I7PA 1BCMA 5AZIA 1YJ9N 4AHCA 3E9LA 3ULEB 4BWMA 3I8BA 4FWPA 4JKBA 5IT9O 1NGIA 1B9FA 3CQXA 4FO0A 3N4PA 3VQQA 2QM1A 2O8FB 3C0BA 4LFBK 2X6NA 4C8MA 3OS2A 4FLUA 1HR0K 4NCAA 4BRMA 5JS2A 4BG8A 5J2PA 1VSFA 3MX5A 3PUFA 3ZLJA 4CJKA 1S3XA 1GLDG 1K6YA 4FJMA 3K57A 3VF6A 1YT3A 4RG8A 2XY5A 4BE1A 4DSLA 1VSLA 4CHYA 4M7YA 1GLBG 3F9MA 4DV3K 3QIOA 5GIPA 5H1SQ 1HPMA 2JWKA 3CI5A 4BR4A 4BR9A 1S1VA 2E6LA 3L4QA 4FPBA 4B1XB 3NGYA 1VQMN 4DF8A 2HNYA 2G8WA 4B9UA 2IOCA 4IDHA 3WQUA 4CJPA 3C6TA 5KQDA 2O8CA 4IBNA 1D5AA 1KTQA 4DSIA 3WXLA 4Z4GA 3E1YA 4FZXC 1NK4A 5J2QA 3G4SN 3VQCA 4DFKA 2JWLA 3MECA 5AQNA 3V9XA 1BCOA 3QEXA 2XY6A 4EP5A 3SMPA 3A5LC 5HRNA 4MFBA 4BDPA 3EL2A 4CFDA 3IMXA 5LMNK 5AFUH 3LWMA 4E7HA 4IG0A 4CK3A 3HTVA 4OKEA 4OPHA 4GV9A 1S6PA 3AARA 1EWQA 3FZFA 2CGKA 2F96A 3B6OA 3D0PA 4OLAA 3HSTB 3ZETA 4CEQA 2O8DB 1Q9YA 3TARA 1IKVA 2D0CA 1XQSC 4I2PA 4GKJK 3A5MC 5AQIA 4BR2A 3CM5A 1N5YA 1CZBA 2YKMA 1T6DA 4F3OA 4FJLA 3CQYA 4KHYA 4Z4IA 2G8IA 4BRNA 4F9OA 1BQNA 4WCEL 1YITN 4FW2A 4IZ9A 4C8OA 4Z4CA 3NH0A 3THYB 3KZBA 1FW6A 3PO5A 1HUXA 4A59A 3QIPA 4IG3A 3HOSA 4YHHK 3AVFA 4YORA 3T1YK 3DLKA 4I2QA 4CZEA 4KH6A 2PYLA 4DTOA 4DV5K 1HNXK 3V9WA 4DQSA 3C95A 1JLAA 5ADXA 3TR8A 1GLFO 3CG7A 4M3WA 3CERA 5JS1A 3AAPA 5IWAK 3OYNA 3OYDA 5GINA 2O8EA 5JVHL 3CJ9A 2NRTA 1T03A 1GOCA 2ITGA 1EQYA 4MQ3A 4CECA 1XNRK 1OH7A 1EWRA 3P39A 5AQVA 4H8KA 1ASWA 3EY1A 4FLWA 5GADP 3TAFA 3M8SA 1FKOA 4MDAA 4KTQA 3VMFB 4CZLA 4Z4EA 1LAWA 3CFPA 1B92A 1WSIA 1S1TA 2PYJA 3KIOA 1JCFA 4WE1A 4M41A 3O8MA 4OVLA 2Y1IA 4M3ZA 4K41A 3I0RA 4CZIA 4B9TA 5AJ3K 3KD1E 5AZJA 5HL7L 1SKRA 3V9ZA 1WLJA 1A5XA 2P9UB 1YJNN 1RCHA 1ATSA 4O55A 1RTHA 3H1VX 1WSFA 1VQNN 4JKGA 3SUNA 1IV0A 2QWNA 4EFHA 1GLAG 1RDWX 4JKCA 3L2QA 3G71N 4JK9A 4JKHA 4ILJA 3MMVA 4TSXA 4B1UB 4FK0A 2QI2A 5CYMA 1Q81O 3DXKA 2QW9A 3VQDA 1X9SA 1RILA 2F9TA 3AVAA 4JD2B 1NK9A 1RTDA 2W41A 1SL0A 3A0IX 3KLIA 3L2WA 4KTZA 4CZGA 3G6EN 3SQ2A 2B4JA 4KB1A 1C0TA 3WEEA 4A62A 3QB0A 4DFMA 4DB3A 3BGRA 4BY9C 2QEXN 4H0OA 4BC5A 2HW3A 3VEYA 2YHYA 3J7AP 2FBTA 4BRLA 3SUQA 4CD3A 4FJJA 1DTTA 2F4VK 3OYEA 4C1NK 3MEGA 5EVZA 3U8XA 2KKZA 4ICLA 4IOAL 3OA9A 4DTNA 3VQ9A 3ULEA 3DLEA 2HBMA 4H0PA 1RNHA 4CW7B 1WBBA 2IVNA 3K9KA 1XC3A 2O8FA 1NLVA 2HHHK 4FWOA 3VF2A 3K2PA 5GAHP 3DRSA 4HUFA 2OA8A 4JEPA 1TVRA 4CEAA 1HKCA 4HCBA 4DUZK 3SJJA 5CZ2A 3ZCMA 5BPMA 4BRFA 4LSNA 4H5RA 3Q7BA 3CXCM 4KHSA 4O0IA 4IEIA 2PZSA 3BDPA 3HRGA 1IH7A 2Z1JA 2QTDA 4JHDB 4FWMA 3BF1A 4CZFA 4PA1A 4E1JA 2ASOA 1HX1A 1U6ZA 1N6QA 3HP9A 3WQTA 3ATVA 4NXNK 2HNZA 2O4IA 4NB4A 3QEWA 4YNQA 4DV1K 3M3ZA 1WAFA 1NJWA 3ZSZA 4H5VA 4WF9L 4CHPA 4YY3K 4JI4K 2QXLA 1KXPA 4PKIA 1KFSA 3UKRB 1WB9A 1NMNA 4B9SA 4BR0A 2E2PA 3H46O 3EZ5A 4BRCA 5C42A 1CZ9A 2NRXA 4JKFA 1QSLA 3RRHA 3MAQA 4NCGA 1FK9A 1LCUA 1Q82O 2HF3A 3OYBA 1YTAA 2P9IB 1C0FA 2BTFA 3ASMA 5C12A 4ZHRA 3R6MA 3LM2A 4ELTA 2UUBK 4DUYK 4BGAA 1BO5O 1JCGA 1FJGK 2QKKA 3UB5A 2O8DA 2E88A 4OKJA 2A5XA 4PQUA 3L2VA 3QEVA 3SNNA 3LDLA 4CEEA 4PL7A 3MN9A 3OVNA 1VSDA 2NRVA 3NGIA 3V9SA 5C0YA 1NGCA 5BRFA 3CYMA 3MEDA 3KLFA 5FROA 2GX9A 3KKRA 4CZHA 3DI6A 5GAGP 2G8VA 4QS7A 3THYA 4F2SA 3M8PA 4H5NA 4WQ5A 3SZ2A 4IFYA 2F9WA 3GE1A 4IXCA 2DFFA 5AQOA 3AVLA 4BACA 2FBXA 3AVIA 3IDHA 2ZD1A 3JXUA 4CEBA 4WYBA 1KVBA 4FM1A 3DJCA 1QZ6A 5TKWA 4DV7K 3L6QA 4CHZA 3JS6A 3I56N 5KQ8A 2ZJPL 4IO8A 2D0BA 4IEEA 4BQLA 4CEFA 1NWKA 4JI6K 1Q86O 1HNVA 2ETJA 4NLCA 3WNHA 4W5QA 4RWTA 2FSJA 1Y97A 2GV9A 3ZEUA 2P5OA 3K5OA 4MDBA 2GEMA 1Y64A 3LP2A 3MDQA 2HF4A 1RT4A 1GLCG 5AQLA 4BREA 3G0ZA 4BE0A 4JI8K 5J2NA 2P9UA 3TABA 5AQYA 4FJXA 3QICA 3CMEN 4LF7K 2NUBA 3M8RA 4N41A 3LP0A 2Q97A 5SZTA 1VSIA 4FWSA 4JK8A 2BGGA 4KBOA 1QTMA 4I6MB 4M3RA 5ADXH 2YHXA 1U04A 4DSKA 3H3NO 3L3VA 1JXBA 4JD2A 5KI6A 4LF9K 4DG1A 2D0AA 3CETA 1QVGM 3ULDA 3LDOA 3U6FA 3AVMA 2QWLA 4CJRA 4DTPA 3LDPA 4AM7A 3SAFA 3ZSQA 1K73O 4DTJA 4KRFA 5DMRA 2WTUA 2IVPA 2HHUA 3W0LA 2HHTA 3QFPA 4JRPA 1NKBA 4KV8A 3V4IA 2KTQA 1QSYA 5BR8K 1IG9A 4E89A 4OO1J 4CF8A 1LV5A 5JMVA 4B3OA 1KAZA 4CJ3A 1DTQA 3D2EB 4DLEA 5CZ1A 3TTDA 3AO3A 1ATNA 2H3GX 2IVOA 4BQZA 1BDGA 5E84A 3SMSA 2P5GA 1YF5L 1E4GT 1YIJN 4CK2A 3BZKA 3QNNA 3L2UA 4BRIA 1XC9A 4E7IA 1WSEA 5JVGL 3O4WA 4J2EA 2WONA 4BVPA 1MWMA 3HSCA 3EO3A 4JHDA 3MWTA 4CFAA 1K9MO 4W5NA 2PAVA 4IFEA 4KPYA 3O1WA 3AVJA 2HHWA 2YCHA 5C24A 2IS3A 4ILHA 2Q2RA 1ZBLA 3T69A 2HHVA 4DV6K 1WN7A 2B6AA 1VQ5N 5DM6L 1GLJO 3VQAA 1ZBFA 3ZT0A 3SUPA 4YOTA 1IKYA 4KTWA 4IDKA 5F1XA 1VSHA 4JI2K 1U48A 1MDUB 2VWJA 2P9PB 4GKKK 1VSEA 4K0KK 4BRHA 2G8HA 1EO1A 1YAGA 1T05A 4CF0A 3VESA 4O5FA 3CHWA 3U3GA 2VQEK 2P9IA 1NM1A 4DTUA 2DPNA 3K0SA 3OJUA 1YJWN 1HNZK 1X3MA 3ZT1A 1BL3A 5KGWA 4W5TA 5AQKA 1D8YA 1V4SA 3HT3A 1WBDA 4ILGB 4JI3K 5FPMA 3ZX2A 3PSFA 5AQQA 3MCPA 1LWCA 4KO0A 2IIRA 1FXXA 2ZWHA 2BH1A 4E19A 4EZ6A 4B3TK 1HYSA 3PV8A 2HHQA 4H5WA 1KFDA 3D45A 3H6EA 4X65K 1L3UA 2NNWA 5HROA 3M5RA 4CI6A 3DLHA 1NOZA 1HJOA 3TPQA 3L2RA 1NJXA 1NK5A 3V9UA 1X9MA 3U9ZA 4B1VA 3ID6A 1J5OA 4JNEA 3LDSA 4FLXA 2NZTA 4GVMA 4DTMA 2OPRA 3O1BA 1TKZA 3F2KA 4DU3A 4DHYA 2FC0A 1VSJA 4QCLA 1YVUA 3H08A 2Q36A 1ESVA 3HPOA 1QQNA 1D4XA 2HMPA 1RFQA 4WQ5C 4B8CA 1TUUA 4CEDA 3FZHA 1NU0A 3OYKA 2FSNA 3HZ6A 3ZSXA 1JJ2M 2P9SB 2D5RA 1L3SA 3TANA 5AQSA 1TKXA 3J8AA 1C0UA 4JV5K 3SPZA 3E9OA 2JLEA 3HPHA 3NGZA 4YDUA 5HP1A 4DR5K 1N32K 4FWRA 4IFVA 2YHWA 3R1XA 4B9MA 3OTOK 1LAVA 4YOVA 4N5SA 5J2MA 5TKYA 3AA2A 3VQ6A 1J53A 3AO4A 3K9JA 3QINA 4JAXA 3SPYA 5E41A 3QLHA 3ZT4A 3OYHA 3CPWM 3EE9A 2Q0UA 4OGCA 4HVJA 3HVRA 3CCQN 4FJHA 2KZZA 5JLHA 3RVCA 5B8HA 4HUGA 3B6PA 3VPZA 3V1QA 1VQLN 4LH4A 4RCHA 4BR5A 3EKSA 3P31A 1XMQK 4PUOA 2J4RA 1BA1A 3KWGA 5BR9A 4FLYA 4CJEA 3LAMA 1BWFO 4GW6A 4NXMK 3DOLA 1LWFA 3LDQA 2W6KA 3ZSVA 4W5RA 3CFRA 1JL2A 4C23A 3WT0A 1ZBHA 3CM6A 4F3TA 3ZT2A 4KHUA 5FPNA 2OPQA 4GY2B 4A61A 1T44A 4CK1A 3MX2A 2HBKA 4Z4HA 3TAGA 4GNIA 4I6MA 4FJ8A 1SAZA 1GOAA 1LOTB 4BR7A 4W5OA 2OZSA 4AHTA 1IBMK 5M1KA 4QS9A 2E2OA 4CF2A 3K59A 3BY5A 3O6WA 4Z0UA 4DTSA 3LWLA 3NF8A 3OYJA 3L3UA 3DLGA 3CC2N 1RGIA 3TU5A 4JI0K 2GUPA 1LW0A 1Z05A 1TV6A 1RDUA 5FLXO 3PIPL 2A40A 4GVEA 4FPAA 1HQEA 4JS5A 3S3NA 3RSEB 2GUIA 3U3YA 1ITGA 1SKSA 2GWJA 4FYDA 1IKWA 2KLAA 1JLEA 1RT3A 3D2EA 3AVGA 1BA0A 2RKIA 3LALA 3KVGA 1UA1A 4WFNL 3AO1A 1ZXOA 2HOEA 4M63C 1VQPN 1EP4A 4J8FA 3VEXA 1DEJA 1OH5A 5EOYA 3A5OC 4YFUA 3CCUN 1S1UA 4CGFA 4HHTA 3OJSA 1WSGA 3SI6A 4NLBA 4B3MK 3CQ8A 2VYPA 1IJJA 1ZBSA 3HO1A 2D0OA 1N36K 1E3MA 3KTQA 1SL1A 1G15A 4B1YB 3A5NC 4XH5A 5LL6Z 3AO2A 1GOBA 5HRRA 1HKBA 2OANA 3FGUA 2UUAK 4RTFD 4E7JA 4XH4A 2V51B 3QO9A 4CF9A 4OPKA 1BU6O 1P90A 2ZQBA 2A1SA 3FZLA 3RTVA 3R9PA 3HOTA 4CZKA 2P9PA 1IO2A 3L8BA 3KWIA 4B9VA 3TAMA 4BC2A 4CFCA 2Z1IA 2CH5A 4YOYA 3OYGA 1VQ9N 1R0AA 2ITMA 5M1OA 4PL8A 2OYQA 1TYQB 2HNDA 4Y1CA 3C6HA 3ZT3A 3NHGA 4K25A 1YVNA 4IOCL 3NCIA 3DM2A 1WNSA 3NDKA 1RTJA 3CCLN 5BN9A 3O3HA 2EX3A 3QEPA 5HOOA 3P1GA 1P8ZA 4JKEA 2WC9A 2ZGYA 3V1OA 5EXWA 4FWQA 2V7YA 1Q7YO 2FSKA 5JICA 3VTIA 4DTXA 1NJZA 4KHWA 4KFBA 1KAXA 3NMUA 4KH5A 1WAJA 1I3AA 4X62K 3ZSRA 4OLBA 1KCFA 1TAQA 4FOIA 4DQPA 3J7YP 4L3QA 4AHRA 1NG9A 3QESA 4ELVA 2FXUA 4GMJB 4BGBA 3O3GA 3HBTA 3VA0A 4V19S 5M1QA 1MA9B 2X6SA 1HMVA 2Z1GA 3KJVA 2V52B 3AY9A 5BRDA 2LSNA 2A42A 2Q3SA 4FXDA 3JAMO 4FLVA 3NF9A 2ZGZA 1Q9XA 1C0MA 3VEOA 3LANA 2AJQA 1RT5A 3P4IA 1ILYA 4BG9A 2P9SA 1RDBA 4L8RB 5AQTA 4H4OA 3SV4A 3CJCA 3LDNA 3OBYA 2VGMA 3J81O 4KAZA 4HTUA 4DR1K 4AQYK 4JKAA 4DR2K 2VG5A 4EAHD 4O5BA 3PX0A 2VQFK 4YDUC 1RBUA 3MWPA 4O8KA 2ZJRL 2GELA 3TTCA 2OPPA 4EHTA 4WFAL 3J7ZO 3MXMA 4DF4A 3FE1A 3C7NB 5FPDA 4RW8A 1D9FA
chains in the Genus database with same CATH topology
2HHXA 2KW4A 3ZSQA 4DTJA 1NK0A 5DMRA 4CHOA 1NKCA 1S1VA 2E6LA 3SV3A 4KRFA 3NGYA 4B8AB 2HHUA 1CXUA 2XY7A 3TAEA 2KFZA 4DF8A 2HNYA 2G8WA 4B9UA 4CJVA 2IOCA 4CERA 2HHTA 5FRMA 3HJFA 4JRPA 2I5JA 1NKBA 4CJPA 3C6TA 4DU4A 4IBNA 1D5AA 2FBYA 4KV8A 1KTQA 3V4IA 3RR7A 4DSIA 2DY4A 3K58A 1FKPA 4Z4GA 3LP1A 4FZXC 1BHLA 2KTQA 1NK4A 1QSYA 5J2QA 3P5JA 3VQCA 4DFKA 1IG9A 4KI6A 3MECA 2R7YA 4FW1A 1BCOA 3V9XA 3QEXA 2XY6A 4K8ZA 3NH1A 4EP5A 4NYFA 4FJKA 4E7LA 4N76A 5HRNA 4E89A 4LH5A 3KD5E 4CF8A 1LV5A 4MFBA 4BDPA 4CJ3A 2FBVA 4B3OA 3TI0A 4CFDA 1DTQA 1I39A 5EU7A 2P51A 4DLEA 3LWMA 5CZ1A 3AO3A 3VQBA 1JLBA 1BISA 4IG0A 4E7HA 3ZSYA 4XIUA 4CK3A 4OKEA 3AA5X 4RW4A 3O4NA 4Q5VA 2P5GA 1QS4A 4CK2A 3QNNA 3L2UA 1S6PA 2YHAA 3LPTA 1ASVA 1XC9A 4DLGA 4E7IA 2F96A 3B6OA 1WSEA 3D0PA 5KRTA 4OLAA 3HSTB 4CEQA 2DFHA 4CJ5A 4J2EA 1TKTA 1Q9YA 3TARA 3S3MA 1RBVA 1IKVA 2D0CA 2WONA 3M8QA 1NK6A 4FJGA 3KKSA 4I2PA 1TL1A 1L3TA 3CM5A 1N5YA 1CZBA 4CFAA 4CF1A 3O3FA 4C8LA 2YKMA 4DQIA 4FM2A 4W5NA 4F3OA 4FJLA 3V81A 4E7KA 1BGXT 4CE9A 3QETA 1W9HA 4DS4A 3V6DA 2HHSA 4KHYA 4CEOA 4IKFA 4KPYA 3AVJA 4OKKA 2W42A 1XHZA 4OJRA 4B08A 4Z4IA 5C24A 2IS3A 2G8IA 2HHWA 2VG7A 1EKEA 1ZBLA 1QQCA 2IAJA 4FJNA 2HHVA 1BQNA 3MXMA 1WN7A 2O4GA 2B6AA 4FW2A 3PX6A 4C8OA 4ELUA 4NCBA 1TKDA 1RBRA 4Z4CA 3VQAA 3KLGA 1BIZA 1ZBFA 2RPIA 3WNEA 3ZT0A 3NH0A 3SUPA 4FK2A 4J2BA 1IKYA 2IC3A 4IDKA 4KTWA 2YNIA 1VSHA 1U48A 3VQEA 2VWJA 3RMAA 3PO5A 4O44A 3QIPA 4CJLA 3ITHA 1VSEA 4IG3A 2G8HA 3VN5A 3AVFA 1U45A 1Q8IA 3DLKA 4CF0A 1T05A 4I2QA 1SKWA 3U3GA 2E6MA 2G8FA 1HPZA 2G8UA 2PYLA 4DTUA 1EX4A 1JL1A 1WSJA 3HP6A 3OJUA 1LW2A 4DTOA 3V9WA 3NE6A 4CGIA 3ZT1A 1BL3A 4CGDA 4CJTA 5KGWA 4W5TA 3OYAA 3C95A 1JLAA 3F73A 4DQSA 3HT3A 1D8YA 3TR8A 3HK2A 3CG7A 1X9WA 4O0JA 3DRPA 2XO7A 4M3WA 2EHGA 5JS1A 1LWCA 3V1RA 3OYNA 2F8TA 3OYDA 4KKOA 4KO0A 2KFNA 4R5PA 3IS9A 3RWUA 2VG6A 1FXXA 1A5VA 4E19A 3RMCA 4EZ6A 3OYMA 1T03A 1HYSA 1UAXA 1GOCA 3PV8A 4QOZB 1Z26A 2ITGA 4DFJA 2HHQA 1KFDA 3D45A 4MQ3A 3DRRA 4CECA 4F4KA 1VSKA 4E0DA 2X74A 4M45A 3VQ4A 1L3UA 4FVMA 4H8KA 1ASWA 3EY1A 5HROA 4FLWA 3WNFA 3TAFA 2KQ2A 2YNFA 1FKOA 1NOZA 2YV0X 3T1AA 3M8SA 3L2RA 3EYZA 3ZSWA 3V9UA 1NK5A 1NJXA 2HVIA 2A1RA 1X9MA 3SUOA 1RBSA 1C1BA 3VA3A 1J5OA 4EZ9A 4KTQA 4Z4EA 3NH2A 1UOCA 3LDSA 4GVMA 4FLXA 1LAWA 5DK5A 1B92A 1WSIA 3CFPA 1S1TA 2OPRA 4DTMA 3QEIA 2JGUA 2PYJA 1TKZA 3KIOA 4DU3A 3P83D 4WE1A 4M41A 2FC0A 1VSJA 4JS4A 4QCLA 1YVUA 4OVLA 2Y1IA 2XY8A 1RBTA 3H08A 4M3ZA 1QE1A 3HPOA 3I0RA 4I9QA 3MXJA 2HVHA 4B9TA 3KD1E 2XHBA 4FJIA 1VK0A 3HVTA 1SKRA 4B8CA 3V9ZA 1WLJA 1A5XA 3IRXA 4CEDA 5J1EA 3OYKA 1U49A 1RCHA 3OYLA 2BDPA 3KK3A 4O55A 4CEZA 1RTHA 1F21A 1W0HA 4DSLA 3IG1A 1WSFA 4E3SA 3ZSXA 1VSMA 4BDYA 1REVA 2D5RA 1L3SA 3KK1A 3SUNA 5HRSA 3SYZA 1WSHA 3TANA 4Z4FA 3AVCA 3L2QA 3QNOA 1TKXA 4Y1DA 4HCCA 1C0UA 3AVHA 4I9LA 3SQ4A 3SPZA 3THVA 4TSXA 2JLEA 3HPHA 3NGZA 1D9DA 4FK0A 3K5LA 5CYMA 5HP1A 3VQDA 1X9SA 1T7PA 2P1JA 4RW6A 1RILA 3AVAA 4IFVA 3VQ5A 1NK9A 1RTDA 4B9MA 1SL0A 2VWKA 3KLIA 3S9HA 3L2WA 1S9EA 4KTZA 1LAVA 4B9NA 4N5SA 5J2MA 3DMJA 3AA2A 3VQ6A 1J53A 3AO4A 3SQ2A 3SQ0A 4ZTFA 2B4JA 4KB1A 3OYFA 3QINA 3SPYA 4FJ9A 3OYIA 3LAKA 5E41A 1C0TA 3QLHA 3LZIA 3ZT4A 3OYHA 4OGCA 1C1CA 4HVJA 3HVRA 3VQ8A 4ZTJA 4FJHA 5D3GA 1KLMA 3WNGA 2QXFA 4DFMA 2KZZA 4HUGA 3B6PA 3BGRA 5SWMA 1ASUA 3V1QA 4CIEA 5KRSA 3I0SA 4H4MA 4LH4A 5I42A 1UA0A 1L3VA 2HW3A 1BI4A 4CGJA 3HPGA 2FBTA 4PUOA 3LP3A 3SUQA 3HL8A 4BE2A 4DTRA 4FLYA 3HXMA 1DTTA 4CJEA 3LAMA 3DLBA 4HUEA 4FJJA 1RT6A 4OGEA 3OYEA 3MEGA 5HBMA 4GW6A 4AHVA 4ICLA 1T8EA 3DOLA 1LWFA 4J2AA 4FLTA 1JXEA 3ZSVA 3VQ9A 2BANA 4W5RA 3CFRA 2HB5A 1JL2A 3DLEA 4E1MA 3ISNC 4Q0BA 1SL2A 4AH9A 1ZBHA 3CM6A 4F3TA 1RNHA 3HM9A 2Y1JA 3ZT2A 3PY8A 4KHUA 3OS0A 3KK2A 2OPQA 3LPUA 3VQPA 4CGGA 3AO5A 3MEEA 4DU1A 3TAQA 1ZBUA 4C8KA 4CK1A 3K2PA 4HUFA 3DRSA 4FCYA 2OA8A 4DQRA 4RW9A 4CIGA 1TVRA 4CEAA 3AA3A 4HCBA 3SJJA 5CZ2A 1S5JA 4Z4HA 3ZCMA 3TAGA 2QKBA 4DSEA 4LSNA 5CY4A 3QERA 4CJUA 4FJ8A 4KHSA 4O0IA 1GOAA 5CYQA 1CLQA 2PZSA 3TWHA 3BDPA 4FZZA 2GBZA 1IH7A 2Z1JA 4BDZA 3NF6A 4W5OA 3DLRA 4PA1A 2OZSA 4AHTA 1N6QA 1EXQA 3KLHA 3HP9A 4E1NA 3NAEA 3AVBA 1SUQA 2HNZA 2O4IA 1BQMA 3QEWA 3VQ7A 4M3UA 1KRPA 4CF2A 4CJWA 3NF7A 3K59A 4Z0UA 4YNQA 4DTSA 2B5JA 3LWLA 3NF8A 4CJFA 4M42A 4N56A 4M3YA 1WAFA 1NJWA 3ZSZA 1U4BA 1XWLA 1QHTA 3OYJA 4CHPA 3L3UA 3DLGA 4CHNA 4K8XA 2ATQA 3S3OA 2KZMA 1KFSA 1TGOA 3ZSOA 4B9SA 1LW0A 4G1QA 1TV6A 4O4GA 1NOYA 3EZ5A 1QSSA 1XHXA 5C42A 1CZ9A 1QSLA 3SQ1A 1HQEA 4JS5A 4UQGA 4NCGA 3MAQA 3RRHA 1RTIA 1FK9A 3C94A 3RMBA 3SCXA 3S3NA 3OYBA 2GUIA 3DLHA 2RF2A 1YTAA 3U3YA 1ITGA 1SKSA 4FYDA 1IKWA 1JLEA 1RT3A 4DSFA 3ASMA 2IGIA 4CCHA 4NYNA 3AVGA 1RDAA 4ZHRA 1BIUA 2DFEA 1JKHA 3RMDA 4ID1A 2RKIA 3LALA 1SV5A 4AHUA 3CFOA 4ID5A 4CIFA 1UA1A 4J2DA 4ELTA 1HJRA 3A2FA 3AO1A 2DTUA 3O4QA 1XI1A 3LZJA 1HYVA 1EP4A 1S9GA 3ALYA 4N47A 2QKKA 4LD0A 4CJ4A 1ZYQA 4KI4A 5HLFA 1L5UA 4B9LA 4PY5A 4YFUA 2OPSA 1S1UA 4CGFA 4HHTA 4FLZA 4OKJA 3OJSA 1WSGA 3SI6A 3OY9A 4PQUA 4DS5A 4CHQA 2YKNA 1KVCA 3CQ8A 1U47A 1HQUA 3L2VA 3QEVA 3SNNA 1C1AA 3HO1A 4CEEA 3OVNA 3KTQA 1UWBA 1SL1A 1G15A 1ZBIA 1VSDA 2YNHA 5I3UA 4DTNA 3NGIA 3V9SA 1X1PA 2WOMA 5FRNA 3AV9A 1MU2A 2OZMA 3C6UA 2QK9A 3CYMA 3AO2A 1GOBA 5HRRA 2E4LA 4DSJA 4FZYA 1B9DA 3MEDA 4CFBA 4E7JA 1NJYA 3KLFA 5FROA 4DWIA 1CXQA 3QO9A 3KKRA 1HYZA 4C8NA 3DI6A 2IDOA 2G8VA 4CF9A 4OPKA 4DQQA 3RTVA 2ZQBA 2A1SA 3G10A 4F2SA 4LY7A 4FK4A 1TK0A 3M8PA 1VRUA 3SZ2A 1IO2A 4IFYA 1KVAA 3L8BA 4B9VA 3TAMA 4CFCA 1JLFA 4DFPA 2Z1IA 1TL3A 2DFFA 5HRPA 3K5MA 1A5WA 4KREA 3F9KA 3OYGA 4BWJA 1R0AA 2Z1HA 3RRGA 3HYFA 4DMNA 2OYQA 3AVLA 4FJ7A 3PO4A 1S1WA 1JLCA 2FBXA 4BACA 3AVIA 2HNDA 4Y1CA 2ZD1A 3ZT3A 4CEBA 5KTQA 1KVBA 3NHGA 1TAUA 1RT2A 3NCIA 3DM2A 1WNSA 1KLNA 4FM1A 2X78A 4PWDA 4LSLA 5KGXA 3T3FA 3NDKA 1RTJA 4FJ5A 3O3HA 1IKXA 2EX3A 1J9AA 3JSMA 3QEPA 1HRHA 4CHZA 3MXIA 4KB0A 3UIQA 4AHSA 4JRQA 3P1GA 5T7BA 2F8SA 3NFAA 4EP4A 1TK8A 1S1XA 3V1OA 4CJQA 2D0BA 3I8DA 2RN2A 2BE2A 4CEFA 2YNGA 1RDCA 2XY5A 1KSPA 3IAYA 4DTXA 1NJZA 4KHWA 4KFBA 1JLQA 4M3TA 1O1WA 1J54A 1HNVA 3PX4A 3AVKA 2ETJA 3K5NA 1WAJA 1NK8A 3WNHA 1I3AA 4W5QA 3ZSRA 3DOKA 4OLBA 1KCFA 1TAQA 2PY5A 2HMIA 1Y97A 4CJSA 4DQPA 1S6QA 2GV9A 3AA4A 4AHRA 3OS1A 4KHNA 1BI4B 3QESA 3OYCA 3TAPA 2P5OA 4ELVA 4GMJB 3O3GA 3VA0A 3K5OA 1JLGA 4JLHA 3JYTA 2X6SA 1HMVA 2Z1GA 3LP2A 3T19A 3KJVA 2G8KA 4I7FA 1NK7A 2LSNA 1BCMA 2Q3SA 4FXDA 1DLOA 1RT4A 2XRIA 4AHCA 4FLVA 4KHQA 4BWMA 1RT1A 3NF9A 3G0ZA 4BE0A 2ZE2A 1B9FA 5J2NA 3TABA 1Q9XA 1C0MA 4FJXA 4AILC 4F8RA 1LWEA 1RDDA 3LANA 4CGHA 2AJQA 1RT5A 3VQQA 1NKEA 2NUBA 1RDBA 3M8RA 4L8RB 3LP0A 4N41A 2X6NA 1C6VA 4H4OA 1RT7A 5SZTA 3SV4A 3DYAA 4C8MA 1VSIA 3OS2A 4FLUA 4F2RA 2YHBA 4KAZA 2BGGA 4HTUA 4NCAA 1EETA 4RW7A 1QTMA 5JS2A 2VG5A 4M3RA 4O5BA 5J2PA 3PX0A 1VSFA 1U04A 1Z25A 3E01A 3PUFA 4DSKA 4CJKA 4OPJA 1RBUA 3L3VA 1JXBA 1K6YA 3AVNA 5KI6A 4M3XA 4FM0A 4FJMA 5C25A 3K57A 2OPPA 3RR8A 4CESA 1YT3A 4QAGA 4RG8A 5FDLA 2D0AA 4DG1A 3KLEA 4BE1A 1VSLA 1VRTA 4CHYA 3ULDA 5K14A 4DF4A 1YTUA 1TK5A 3NBPA 1HNIA 3U6FA 3FFIA 3QIOA 3AVMA 4RW8A 4CJRA 1D9FA 4DTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHX A;  2KW4 A;  3ZSQ A;  4DTJ A;  1NK0 A;  5DMR A;  4CHO A;  1NKC A;  1S1V A;  2E6L A;  3SV3 A;  4KRF A;  3NGY A;  4B8A B;  2HHU A;  1CXU A;  2XY7 A;  3TAE A;  2KFZ A;  4DF8 A;  2HNY A;  2G8W A;  4B9U A;  4CJV A;  2IOC A;  4CER A;  2HHT A;  5FRM A;  3HJF A;  4JRP A;  2I5J A;  1NKB A;  4CJP A;  3C6T A;  4DU4 A;  4IBN A;  1D5A A;  2FBY A;  4KV8 A;  1KTQ A;  3V4I A;  3RR7 A;  4DSI A;  2DY4 A;  3K58 A;  1FKP A;  4Z4G A;  3LP1 A;  4FZX C;  1BHL A;  2KTQ A;  1NK4 A;  1QSY A;  5J2Q A;  3P5J A;  3VQC A;  4DFK A;  1IG9 A;  4KI6 A;  3MEC A;  2R7Y A;  4FW1 A;  1BCO A;  3V9X A;  3QEX A;  2XY6 A;  4K8Z A;  3NH1 A;  4EP5 A;  4NYF A;  4FJK A;  4E7L A;  4N76 A;  5HRN A;  4E89 A;  4LH5 A;  3KD5 E;  4CF8 A;  1LV5 A;  4MFB A;  4BDP A;  4CJ3 A;  2FBV A;  4B3O A;  3TI0 A;  4CFD A;  1DTQ A;  1I39 A;  5EU7 A;  2P51 A;  4DLE A;  3LWM A;  5CZ1 A;  3AO3 A;  3VQB A;  1JLB A;  1BIS A;  4IG0 A;  4E7H A;  3ZSY A;  4XIU A;  4CK3 A;  4OKE A;  3AA5 X;  4RW4 A;  3O4N A;  4Q5V A;  2P5G A;  1QS4 A;  4CK2 A;  3QNN A;  3L2U A;  1S6P A;  2YHA A;  3LPT A;  1ASV A;  1XC9 A;  4DLG A;  4E7I A;  2F96 A;  3B6O A;  1WSE A;  3D0P A;  5KRT A;  4OLA A;  3HST B;  4CEQ A;  2DFH A;  4CJ5 A;  4J2E A;  1TKT A;  1Q9Y A;  3TAR A;  3S3M A;  1RBV A;  1IKV A;  2D0C A;  2WON A;  3M8Q A;  1NK6 A;  4FJG A;  3KKS A;  4I2P A;  1TL1 A;  1L3T A;  3CM5 A;  1N5Y A;  1CZB A;  4CFA A;  4CF1 A;  3O3F A;  4C8L A;  2YKM A;  4DQI A;  4FM2 A;  4W5N A;  4F3O A;  4FJL A;  3V81 A;  4E7K A;  1BGX T;  4CE9 A;  3QET A;  1W9H A;  4DS4 A;  3V6D A;  2HHS A;  4KHY A;  4CEO A;  4IKF A;  4KPY A;  3AVJ A;  4OKK A;  2W42 A;  1XHZ A;  4OJR A;  4B08 A;  4Z4I A;  5C24 A;  2IS3 A;  2G8I A;  2HHW A;  2VG7 A;  1EKE A;  1ZBL A;  1QQC A;  2IAJ A;  4FJN A;  2HHV A;  1BQN A;  3MXM A;  1WN7 A;  2O4G A;  2B6A A;  4FW2 A;  3PX6 A;  4C8O A;  4ELU A;  4NCB A;  1TKD A;  1RBR A;  4Z4C A;  3VQA A;  3KLG A;  1BIZ A;  1ZBF A;  2RPI A;  3WNE A;  3ZT0 A;  3NH0 A;  3SUP A;  4FK2 A;  4J2B A;  1IKY A;  2IC3 A;  4IDK A;  4KTW A;  2YNI A;  1VSH A;  1U48 A;  3VQE A;  2VWJ A;  3RMA A;  3PO5 A;  4O44 A;  3QIP A;  4CJL A;  3ITH A;  1VSE A;  4IG3 A;  2G8H A;  3VN5 A;  3AVF A;  1U45 A;  1Q8I A;  3DLK A;  4CF0 A;  1T05 A;  4I2Q A;  1SKW A;  3U3G A;  2E6M A;  2G8F A;  1HPZ A;  2G8U A;  2PYL A;  4DTU A;  1EX4 A;  1JL1 A;  1WSJ A;  3HP6 A;  3OJU A;  1LW2 A;  4DTO A;  3V9W A;  3NE6 A;  4CGI A;  3ZT1 A;  1BL3 A;  4CGD A;  4CJT A;  5KGW A;  4W5T A;  3OYA A;  3C95 A;  1JLA A;  3F73 A;  4DQS A;  3HT3 A;  1D8Y A;  3TR8 A;  3HK2 A;  3CG7 A;  1X9W A;  4O0J A;  3DRP A;  2XO7 A;  4M3W A;  2EHG A;  5JS1 A;  1LWC A;  3V1R A;  3OYN A;  2F8T A;  3OYD A;  4KKO A;  4KO0 A;  2KFN A;  4R5P A;  3IS9 A;  3RWU A;  2VG6 A;  1FXX A;  1A5V A;  4E19 A;  3RMC A;  4EZ6 A;  3OYM A;  1T03 A;  1HYS A;  1UAX A;  1GOC A;  3PV8 A;  4QOZ B;  1Z26 A;  2ITG A;  4DFJ A;  2HHQ A;  1KFD A;  3D45 A;  4MQ3 A;  3DRR A;  4CEC A;  4F4K A;  1VSK A;  4E0D A;  2X74 A;  4M45 A;  3VQ4 A;  1L3U A;  4FVM A;  4H8K A;  1ASW A;  3EY1 A;  5HRO A;  4FLW A;  3WNF A;  3TAF A;  2KQ2 A;  2YNF A;  1FKO A;  1NOZ A;  2YV0 X;  3T1A A;  3M8S A;  3L2R A;  3EYZ A;  3ZSW A;  3V9U A;  1NK5 A;  1NJX A;  2HVI A;  2A1R A;  1X9M A;  3SUO A;  1RBS A;  1C1B A;  3VA3 A;  1J5O A;  4EZ9 A;  4KTQ A;  4Z4E A;  3NH2 A;  1UOC A;  3LDS A;  4GVM A;  4FLX A;  1LAW A;  5DK5 A;  1B92 A;  1WSI A;  3CFP A;  1S1T A;  2OPR A;  4DTM A;  3QEI A;  2JGU A;  2PYJ A;  1TKZ A;  3KIO A;  4DU3 A;  3P83 D;  4WE1 A;  4M41 A;  2FC0 A;  1VSJ A;  4JS4 A;  4QCL A;  1YVU A;  4OVL A;  2Y1I A;  2XY8 A;  1RBT A;  3H08 A;  4M3Z A;  1QE1 A;  3HPO A;  3I0R A;  4I9Q A;  3MXJ A;  2HVH A;  4B9T A;  3KD1 E;  2XHB A;  4FJI A;  1VK0 A;  3HVT A;  1SKR A;  4B8C A;  3V9Z A;  1WLJ A;  1A5X A;  3IRX A;  4CED A;  5J1E A;  3OYK A;  1U49 A;  1RCH A;  3OYL A;  2BDP A;  3KK3 A;  4O55 A;  4CEZ A;  1RTH A;  1F21 A;  1W0H A;  4DSL A;  3IG1 A;  1WSF A;  4E3S A;  3ZSX A;  1VSM A;  4BDY A;  1REV A;  2D5R A;  1L3S A;  3KK1 A;  3SUN A;  5HRS A;  3SYZ A;  1WSH A;  3TAN A;  4Z4F A;  3AVC A;  3L2Q A;  3QNO A;  1TKX A;  4Y1D A;  4HCC A;  1C0U A;  3AVH A;  4I9L A;  3SQ4 A;  3SPZ A;  3THV A;  4TSX A;  2JLE A;  3HPH A;  3NGZ A;  1D9D A;  4FK0 A;  3K5L A;  5CYM A;  5HP1 A;  3VQD A;  1X9S A;  1T7P A;  2P1J A;  4RW6 A;  1RIL A;  3AVA A;  4IFV A;  3VQ5 A;  1NK9 A;  1RTD A;  4B9M A;  1SL0 A;  2VWK A;  3KLI A;  3S9H A;  3L2W A;  1S9E A;  4KTZ A;  1LAV A;  4B9N A;  4N5S A;  5J2M A;  3DMJ A;  3AA2 A;  3VQ6 A;  1J53 A;  3AO4 A;  3SQ2 A;  3SQ0 A;  4ZTF A;  2B4J A;  4KB1 A;  3OYF A;  3QIN A;  3SPY A;  4FJ9 A;  3OYI A;  3LAK A;  5E41 A;  1C0T A;  3QLH A;  3LZI A;  3ZT4 A;  3OYH A;  4OGC A;  1C1C A;  4HVJ A;  3HVR A;  3VQ8 A;  4ZTJ A;  4FJH A;  5D3G A;  1KLM A;  3WNG A;  2QXF A;  4DFM A;  2KZZ A;  4HUG A;  3B6P A;  3BGR A;  5SWM A;  1ASU A;  3V1Q A;  4CIE A;  5KRS A;  3I0S A;  4H4M A;  4LH4 A;  5I42 A;  1UA0 A;  1L3V A;  2HW3 A;  1BI4 A;  4CGJ A;  3HPG A;  2FBT A;  4PUO A;  3LP3 A;  3SUQ A;  3HL8 A;  4BE2 A;  4DTR A;  4FLY A;  3HXM A;  1DTT A;  4CJE A;  3LAM A;  3DLB A;  4HUE A;  4FJJ A;  1RT6 A;  4OGE A;  3OYE A;  3MEG A;  5HBM A;  4GW6 A;  4AHV A;  4ICL A;  1T8E A;  3DOL A;  1LWF A;  4J2A A;  4FLT A;  1JXE A;  3ZSV A;  3VQ9 A;  2BAN A;  4W5R A;  3CFR A;  2HB5 A;  1JL2 A;  3DLE A;  4E1M A;  3ISN C;  4Q0B A;  1SL2 A;  4AH9 A;  1ZBH A;  3CM6 A;  4F3T A;  1RNH A;  3HM9 A;  2Y1J A;  3ZT2 A;  3PY8 A;  4KHU A;  3OS0 A;  3KK2 A;  2OPQ A;  3LPU A;  3VQP A;  4CGG A;  3AO5 A;  3MEE A;  4DU1 A;  3TAQ A;  1ZBU A;  4C8K A;  4CK1 A;  3K2P A;  4HUF A;  3DRS A;  4FCY A;  2OA8 A;  4DQR A;  4RW9 A;  4CIG A;  1TVR A;  4CEA A;  3AA3 A;  4HCB A;  3SJJ A;  5CZ2 A;  1S5J A;  4Z4H A;  3ZCM A;  3TAG A;  2QKB A;  4DSE A;  4LSN A;  5CY4 A;  3QER A;  4CJU A;  4FJ8 A;  4KHS A;  4O0I A;  1GOA A;  5CYQ A;  1CLQ A;  2PZS A;  3TWH A;  3BDP A;  4FZZ A;  2GBZ A;  1IH7 A;  2Z1J A;  4BDZ A;  3NF6 A;  4W5O A;  3DLR A;  4PA1 A;  2OZS A;  4AHT A;  1N6Q A;  1EXQ A;  3KLH A;  3HP9 A;  4E1N A;  3NAE A;  3AVB A;  1SUQ A;  2HNZ A;  2O4I A;  1BQM A;  3QEW A;  3VQ7 A;  4M3U A;  1KRP A;  4CF2 A;  4CJW A;  3NF7 A;  3K59 A;  4Z0U A;  4YNQ A;  4DTS A;  2B5J A;  3LWL A;  3NF8 A;  4CJF A;  4M42 A;  4N56 A;  4M3Y A;  1WAF A;  1NJW A;  3ZSZ A;  1U4B A;  1XWL A;  1QHT A;  3OYJ A;  4CHP A;  3L3U A;  3DLG A;  4CHN A;  4K8X A;  2ATQ A;  3S3O A;  2KZM A;  1KFS A;  1TGO A;  3ZSO A;  4B9S A;  1LW0 A;  4G1Q A;  1TV6 A;  4O4G A;  1NOY A;  3EZ5 A;  1QSS A;  1XHX A;  5C42 A;  1CZ9 A;  1QSL A;  3SQ1 A;  1HQE A;  4JS5 A;  4UQG A;  4NCG A;  3MAQ A;  3RRH A;  1RTI A;  1FK9 A;  3C94 A;  3RMB A;  3SCX A;  3S3N A;  3OYB A;  2GUI A;  3DLH A;  2RF2 A;  1YTA A;  3U3Y A;  1ITG A;  1SKS A;  4FYD A;  1IKW A;  1JLE A;  1RT3 A;  4DSF A;  3ASM A;  2IGI A;  4CCH A;  4NYN A;  3AVG A;  1RDA A;  4ZHR A;  1BIU A;  2DFE A;  1JKH A;  3RMD A;  4ID1 A;  2RKI A;  3LAL A;  1SV5 A;  4AHU A;  3CFO A;  4ID5 A;  4CIF A;  1UA1 A;  4J2D A;  4ELT A;  1HJR A;  3A2F A;  3AO1 A;  2DTU A;  3O4Q A;  1XI1 A;  3LZJ A;  1HYV A;  1EP4 A;  1S9G A;  3ALY A;  4N47 A;  2QKK A;  4LD0 A;  4CJ4 A;  1ZYQ A;  4KI4 A;  5HLF A;  1L5U A;  4B9L A;  4PY5 A;  4YFU A;  2OPS A;  1S1U A;  4CGF A;  4HHT A;  4FLZ A;  4OKJ A;  3OJS A;  1WSG A;  3SI6 A;  3OY9 A;  4PQU A;  4DS5 A;  4CHQ A;  2YKN A;  1KVC A;  3CQ8 A;  1U47 A;  1HQU A;  3L2V A;  3QEV A;  3SNN A;  1C1A A;  3HO1 A;  4CEE A;  3OVN A;  3KTQ A;  1UWB A;  1SL1 A;  1G15 A;  1ZBI A;  1VSD A;  2YNH A;  5I3U A;  4DTN A;  3NGI A;  3V9S A;  1X1P A;  2WOM A;  5FRN A;  3AV9 A;  1MU2 A;  2OZM A;  3C6U A;  2QK9 A;  3CYM A;  3AO2 A;  1GOB A;  5HRR A;  2E4L A;  4DSJ A;  4FZY A;  1B9D A;  3MED A;  4CFB A;  4E7J A;  1NJY A;  3KLF A;  5FRO A;  4DWI A;  1CXQ A;  3QO9 A;  3KKR A;  1HYZ A;  4C8N A;  3DI6 A;  2IDO A;  2G8V A;  4CF9 A;  4OPK A;  4DQQ A;  3RTV A;  2ZQB A;  2A1S A;  3G10 A;  4F2S A;  4LY7 A;  4FK4 A;  1TK0 A;  3M8P A;  1VRU A;  3SZ2 A;  1IO2 A;  4IFY A;  1KVA A;  3L8B A;  4B9V A;  3TAM A;  4CFC A;  1JLF A;  4DFP A;  2Z1I A;  1TL3 A;  2DFF A;  5HRP A;  3K5M A;  1A5W A;  4KRE A;  3F9K A;  3OYG A;  4BWJ A;  1R0A A;  2Z1H A;  3RRG A;  3HYF A;  4DMN A;  2OYQ A;  3AVL A;  4FJ7 A;  3PO4 A;  1S1W A;  1JLC A;  2FBX A;  4BAC A;  3AVI A;  2HND A;  4Y1C A;  2ZD1 A;  3ZT3 A;  4CEB A;  5KTQ A;  1KVB A;  3NHG A;  1TAU A;  1RT2 A;  3NCI A;  3DM2 A;  1WNS A;  1KLN A;  4FM1 A;  2X78 A;  4PWD A;  4LSL A;  5KGX A;  3T3F A;  3NDK A;  1RTJ A;  4FJ5 A;  3O3H A;  1IKX A;  2EX3 A;  1J9A A;  3JSM A;  3QEP A;  1HRH A;  4CHZ A;  3MXI A;  4KB0 A;  3UIQ A;  4AHS A;  4JRQ A;  3P1G A;  5T7B A;  2F8S A;  3NFA A;  4EP4 A;  1TK8 A;  1S1X A;  3V1O A;  4CJQ A;  2D0B A;  3I8D A;  2RN2 A;  2BE2 A;  4CEF A;  2YNG A;  1RDC A;  2XY5 A;  1KSP A;  3IAY A;  4DTX A;  1NJZ A;  4KHW A;  4KFB A;  1JLQ A;  4M3T A;  1O1W A;  1J54 A;  1HNV A;  3PX4 A;  3AVK A;  2ETJ A;  3K5N A;  1WAJ A;  1NK8 A;  3WNH A;  1I3A A;  4W5Q A;  3ZSR A;  3DOK A;  4OLB A;  1KCF A;  1TAQ A;  2PY5 A;  2HMI A;  1Y97 A;  4CJS A;  4DQP A;  1S6Q A;  2GV9 A;  3AA4 A;  4AHR A;  3OS1 A;  4KHN A;  1BI4 B;  3QES A;  3OYC A;  3TAP A;  2P5O A;  4ELV A;  4GMJ B;  3O3G A;  3VA0 A;  3K5O A;  1JLG A;  4JLH A;  3JYT A;  2X6S A;  1HMV A;  2Z1G A;  3LP2 A;  3T19 A;  3KJV A;  2G8K A;  4I7F A;  1NK7 A;  2LSN A;  1BCM A;  2Q3S A;  4FXD A;  1DLO A;  1RT4 A;  2XRI A;  4AHC A;  4FLV A;  4KHQ A;  4BWM A;  1RT1 A;  3NF9 A;  3G0Z A;  4BE0 A;  2ZE2 A;  1B9F A;  5J2N A;  3TAB A;  1Q9X A;  1C0M A;  4FJX A;  4AIL C;  4F8R A;  1LWE A;  1RDD A;  3LAN A;  4CGH A;  2AJQ A;  1RT5 A;  3VQQ A;  1NKE A;  2NUB A;  1RDB A;  3M8R A;  4L8R B;  3LP0 A;  4N41 A;  2X6N A;  1C6V A;  4H4O A;  1RT7 A;  5SZT A;  3SV4 A;  3DYA A;  4C8M A;  1VSI A;  3OS2 A;  4FLU A;  4F2R A;  2YHB A;  4KAZ A;  2BGG A;  4HTU A;  4NCA A;  1EET A;  4RW7 A;  1QTM A;  5JS2 A;  2VG5 A;  4M3R A;  4O5B A;  5J2P A;  3PX0 A;  1VSF A;  1U04 A;  1Z25 A;  3E01 A;  3PUF A;  4DSK A;  4CJK A;  4OPJ A;  1RBU A;  3L3V A;  1JXB A;  1K6Y A;  3AVN A;  5KI6 A;  4M3X A;  4FM0 A;  4FJM A;  5C25 A;  3K57 A;  2OPP A;  3RR8 A;  4CES A;  1YT3 A;  4QAG A;  4RG8 A;  5FDL A;  2D0A A;  4DG1 A;  3KLE A;  4BE1 A;  1VSL A;  1VRT A;  4CHY A;  3ULD A;  5K14 A;  4DF4 A;  1YTU A;  1TK5 A;  3NBP A;  1HNI A;  3U6F A;  3FFI A;  3QIO A;  3AVM A;  4RW8 A;  4CJR A;  1D9F A;  4DTP A; 
#chains in the Genus database with same CATH topology
 1NK0 A;  1VQ4 N;  2QA4 N;  3SV3 A;  5AZI B;  2XY7 A;  5AQG A;  4CER A;  2D1K A;  5LJV A;  4DU4 A;  3RR7 A;  2KHO A;  1FKP A;  3K58 A;  1BHL A;  5KPZ A;  2UYT A;  3P5J A;  4KI6 A;  4BRK A;  2R7Y A;  4FW1 A;  4K8Z A;  3NH1 A;  4CJ7 A;  3TSQ A;  4FJK A;  4LH5 A;  3KD5 E;  1VHX A;  2FBV A;  3TI0 A;  1I39 A;  5EU7 A;  1N34 K;  3B8A X;  3VQB A;  3ZSY A;  4XIU A;  3UKU B;  3AA5 X;  4RW4 A;  4Q5V A;  3EN9 A;  3MN6 A;  1T3V A;  1ASV A;  3ZX3 A;  4DLG A;  1T6C A;  2WFB A;  3ENH A;  1KAY A;  4CJ5 A;  2DFH A;  1TKT A;  1RBV A;  3M8Q A;  1NK6 A;  4FJG A;  3KKS A;  3O9S A;  2ZF5 O;  1TL1 A;  1L3T A;  4CF1 A;  3O3F A;  4FM2 A;  5M1N A;  4E7K A;  3QET A;  3V6D A;  4DS4 A;  2HHS A;  4IKF A;  1G99 A;  3EEQ A;  1XHZ A;  2W42 A;  1VAZ A;  4OJR A;  4H0T B;  1EKE A;  1QQC A;  2IAJ A;  3C65 A;  2YX6 A;  2Q0R A;  4FWN A;  4ELU A;  1TKD A;  1RBR A;  3KLG A;  1U4B A;  4FK2 A;  4IJN A;  4J2B A;  2YNI A;  4H0X B;  4BRO A;  3CCJ N;  5FPE A;  3FR0 A;  1QHA A;  4CJL A;  3ITH A;  4FOE A;  2E20 A;  3RSE A;  3VN5 A;  1Q8I A;  1HLU A;  1SKW A;  2E6M A;  2G8U A;  4FSV A;  3J80 O;  1JL1 A;  1WSJ A;  3HP6 A;  2FF6 A;  4KHP K;  4CGD A;  3ENO A;  3HK2 A;  5BN8 A;  2I7N A;  4O0J A;  3DRP A;  2O8B B;  2OTJ N;  4CD1 A;  3CJB A;  2KFN A;  3RWU A;  1A5V A;  3RMC A;  3OYM A;  1UAX A;  4H0Y B;  4LF5 K;  4DFJ A;  5AQH A;  3H3O B;  3DRR A;  4F4K A;  1VSK A;  1SZ2 A;  2X74 A;  3VQ4 A;  4PKG A;  5AR0 A;  4FVM A;  3WNF A;  2CH6 A;  3EYZ A;  3T1A A;  3OW2 M;  4G9Z A;  3ZSW A;  2E2N A;  3CCM N;  2HVI A;  2A1R A;  5AQZ A;  3SUO A;  1RBS A;  3VA3 A;  4EZ9 A;  4GV6 A;  1UOC A;  3VEW A;  2JGU A;  4BRD A;  3P83 D;  4B3R K;  5AQM A;  5GAE P;  4CZM A;  4I9Q A;  2A6A A;  2HVH A;  2XHB A;  1VK0 A;  3I55 N;  3HVT A;  3IRX A;  5J1E A;  3OYL A;  4CEZ A;  1F21 A;  1W0H A;  3ZX0 A;  4PHT X;  3CMA N;  1VSM A;  4BDY A;  1REV A;  4IJA A;  4DQ8 A;  3KK1 A;  2O8E B;  1WSH A;  3CJA A;  3OHR A;  3AVC A;  4Z4F A;  3VEN A;  3CCV N;  3SK3 A;  4HCC A;  3AVH A;  4I9L A;  3SQ4 A;  3MK6 A;  3K5L A;  1NGF A;  1T7P A;  2P1J A;  3P38 A;  5CHI A;  4CZJ A;  3SAG A;  3S9H A;  2FLO A;  4B9N A;  4WQ4 A;  3WXI A;  3DMJ A;  1W2B M;  3ENB A;  4FJ9 A;  2E1Y A;  3LAK A;  3LZI A;  3T1H K;  4PKH A;  4ZTJ A;  3WNG A;  4AM6 A;  3TSP A;  5KPT A;  5SWM A;  1ASU A;  5KRS A;  1UA0 A;  3VGL A;  1IBK K;  1NNE A;  3MN5 A;  2UU9 K;  1TUY A;  5JLF A;  3N4Q A;  3HL8 A;  3LL3 A;  3R8E A;  3DLB A;  5HBM A;  3THW B;  4AHV A;  1VQ6 N;  1K8K B;  1T8E A;  4J2A A;  1MWK A;  4FLT A;  2BAN A;  4Q0B A;  4E1M A;  1IG8 A;  4FWL A;  1SL2 A;  3UKR A;  1NGE A;  4X66 K;  2Y1J A;  3KK2 A;  3BP8 A;  4CGG A;  4DU1 A;  3TAQ A;  1ZBU A;  3THX B;  3IKM A;  2NRZ A;  2QWO A;  5A2Q O;  1S5J A;  3EZW A;  3VF4 A;  2QKB A;  3QER A;  2P9L B;  4CJU A;  3CPE A;  3WEE B;  5CYQ A;  5LMU K;  3TWH A;  3HI0 A;  4BDZ A;  4LF6 K;  4LC9 B;  3BZC A;  4XEI A;  5BPL A;  4FVU A;  3KHY A;  1BQM A;  3VQ7 A;  4M3U A;  1KRP A;  3NF7 A;  2B5J A;  3AAQ A;  2HBJ A;  1U2V B;  4CHN A;  1M90 O;  2ATQ A;  2KZM A;  3ZSO A;  2A3Z A;  3D2F B;  1OVY A;  4UY8 O;  5EX5 A;  4O4G A;  1QSS A;  1XHX A;  3ID8 A;  3SQ1 A;  4UQG A;  3RMB A;  3E9P A;  1RTI A;  4ISF A;  3SCX A;  1H1V A;  5AQU A;  4EHU A;  1E4F T;  1R59 O;  3UE5 A;  4DSF A;  2IGI A;  1Z6R A;  4CCH A;  1RDA A;  4IWV A;  1JKH A;  3BUZ B;  3EE8 A;  1SV5 A;  4ID5 A;  3UKU A;  1I94 K;  1HJR A;  3A8Y A;  3A2F A;  3QBX A;  2F7T A;  3O4Q A;  3LZJ A;  5AQP A;  1JCE A;  4LD0 A;  4CJ4 A;  4KI4 A;  2AA4 A;  5HLF A;  4PY5 A;  3QML A;  4LFA K;  2OPS A;  1YUW A;  2PBD A;  2QWQ A;  2UUC K;  4FLZ A;  3OY9 A;  5MLC Q;  4JN4 A;  1HKG A;  2OCE A;  1ZC6 A;  2YKN A;  1QZ5 A;  2PFU A;  3WXJ A;  1WUA A;  2YNH A;  5I3U A;  1HNW K;  1QQO A;  1X1P A;  3D7E O;  2WOM A;  5FRN A;  1QQM A;  3AV9 A;  3I33 A;  4BRP A;  2CGJ A;  2E4L A;  2VCP A;  4DSJ A;  4FZY A;  3MN7 A;  4H5T A;  4MO4 A;  4DWI A;  3O9Q A;  3H1Q A;  4C8N A;  5M1F A;  4BRG A;  4DKW A;  3G10 A;  4FK4 A;  1KVA A;  3C6A A;  5C15 A;  3IUC A;  1JLF A;  4DFP A;  1TL3 A;  3VEV A;  5HRP A;  5KPR A;  3F9K A;  4BWJ A;  2Z1H A;  1OH6 A;  1S1W A;  2WUS A;  3EKU A;  3O80 A;  3PSI A;  3CD6 N;  5KTQ A;  1RT2 A;  1KLN A;  4LSL A;  5KGX A;  5C2F A;  3CJ7 A;  3CCE N;  3T3F A;  2O8B A;  1NGA A;  1VQ7 N;  3WXK A;  2AP1 A;  3FZM A;  3QDK A;  4A2A A;  4FJ5 A;  2NRH A;  3JSM A;  4A5A A;  4KB0 A;  1YXQ A;  2NLX A;  2VWB A;  4EP4 A;  5F2R A;  4CJQ A;  4AF1 A;  3I8D A;  2RN2 A;  4FL9 A;  1NGJ A;  4NO7 A;  1ATR A;  2YNG A;  4B1W B;  1KSP A;  1O1W A;  3PX4 A;  3AVK A;  3K5N A;  3BEX A;  4BC4 A;  3DOK A;  3SBG A;  1BG3 A;  1S6Q A;  3AA4 A;  3M6G A;  4DR3 K;  1BI4 B;  3TAP A;  1M1K O;  1VQ8 N;  1JLG A;  3TSU A;  1BOT O;  2YI1 A;  3FLC O;  2G8K A;  4BRQ A;  1X9J A;  4I7F A;  1NK7 A;  1W7A A;  5AQX A;  1DLO A;  2D0P A;  2XRI A;  4DR4 K;  4JI1 K;  4KHQ A;  1XNQ K;  1RT1 A;  2ZE2 A;  4AIL C;  4F8R A;  1LWE A;  1RDD A;  4CGH A;  2GTD A;  4U7B A;  1NKE A;  3VGK A;  1C6V A;  3W3D A;  1RT7 A;  4EIA A;  3QBW A;  3DYA A;  2NRW A;  3FFK B;  4F2R A;  3GDQ A;  2YHB A;  1EET A;  2W40 A;  4RW7 A;  2EWS A;  1Z25 A;  3E01 A;  4OPJ A;  4LF8 K;  1DGK N;  4M3X A;  3AVN A;  4FM0 A;  2E8A A;  5C25 A;  4B9Q A;  3RR8 A;  5M1P A;  4CES A;  1CZA N;  4QAG A;  4M7X A;  5FDL A;  3KLE A;  5CR4 A;  1VRT A;  3ZEU B;  4LFC K;  5K14 A;  1YTU A;  5E26 A;  1TK5 A;  3NBP A;  4QS8 A;  1HNI A;  4HTL A;  3FFI A;  4WQ4 C;  1OKJ A;  4BRA A;  2HHX A;  2KW4 A;  4CHO A;  1NKC A;  4JK7 A;  2P9N B;  3MCA B;  4YOW A;  4B8A B;  3HM8 A;  1CXU A;  3TAE A;  2W6L A;  2KFZ A;  4CJV A;  4DV4 K;  5FRM A;  3HJF A;  2I5J A;  2FBY A;  3GL1 A;  1NGH A;  2DY4 A;  3LP1 A;  2BUP A;  3S41 A;  3O5B A;  3THW A;  3AGR A;  5BPN A;  1K8K A;  4NYF A;  4E7L A;  4N76 A;  2RE2 A;  4HWI A;  5EY4 A;  2P51 A;  3TTF A;  1NMD A;  1JLB A;  1BIS A;  3O4N A;  3O9T A;  3THX A;  4A5B A;  1QS4 A;  2E5L K;  1N33 K;  2ASP A;  3H45 C;  2YHA A;  5F0X A;  3LPT A;  5AQR A;  1NGD A;  2WBN A;  3L0Q A;  5KRT A;  2P9L A;  3CJ1 A;  3S3M A;  3PLA A;  2A41 A;  4C8L A;  4DQI A;  3V81 A;  1BGX T;  4CE9 A;  1W9H A;  4CEO A;  4OKK A;  4B08 A;  3U4L A;  2VG7 A;  3QFU A;  3WUH A;  4CBW A;  4FJN A;  1U2V A;  3SLC A;  4DV0 K;  2P9K B;  2O4G A;  1V4T A;  3PX6 A;  4NCB A;  3CCR N;  1BUP A;  1BIZ A;  3WNE A;  2RPI A;  3D2F A;  2IC3 A;  2VGN A;  3GBT A;  4U67 L;  3VQE A;  3RMA A;  3Q7C A;  4KH4 A;  4O44 A;  3SAH A;  4OPA A;  1U45 A;  4H03 B;  2G8F A;  1HPZ A;  1EX4 A;  1LW2 A;  4OX9 K;  3NE6 A;  4CGI A;  4CJT A;  3F73 A;  3OYA A;  3IFR A;  3PIO L;  3CC7 N;  1X9W A;  1IBL K;  3VET A;  5DM7 L;  3SJH A;  2XO7 A;  4IOX A;  1OVQ A;  2EHG A;  2FF3 B;  3V1R A;  2F8T A;  1DT9 A;  4KKO A;  2QWM A;  4R5P A;  3IS9 A;  2VG6 A;  4QOZ B;  1Z26 A;  4B3S K;  4GV3 A;  4CVN E;  4E0D A;  4M45 A;  3ATU A;  4YOU A;  3KK7 A;  2RHK A;  3DXM B;  2QWR A;  2KQ2 A;  2YNF A;  2YV0 X;  1J6Z A;  1C1B A;  5GIO A;  3NH2 A;  2ASM A;  5DK5 A;  4BC3 A;  3FZK A;  3QEI A;  3OBW A;  2CGL A;  1GLL O;  4JS4 A;  1S72 N;  2XY8 A;  1RBT A;  1QE1 A;  3U9D A;  3MXJ A;  4C1N I;  4FJI A;  4MO5 A;  2D4W A;  4JYA K;  5AFU A;  4A57 A;  4XH1 A;  1U49 A;  3R3L A;  2BDP A;  1O13 A;  2E2Q A;  3KK3 A;  3IG1 A;  3M1F A;  4E3S A;  1YI2 N;  2QWP A;  5HRS A;  3SYZ A;  3QNO A;  2ZJQ L;  4Y1D A;  3CF5 L;  3O9U A;  3THV A;  2ZM6 K;  4CBX A;  4JI7 K;  3ZYY X;  4LF4 K;  3VEZ A;  1D9D A;  5ELZ A;  4RW6 A;  3VQ5 A;  2VWK A;  1NGG A;  1S9E A;  3SQ0 A;  4ZTF A;  3OYF A;  2YJF A;  3OYI A;  3BF3 A;  1C1C A;  3VQ8 A;  5D3G A;  4CBU A;  1KLM A;  2QXF A;  4CIE A;  5I42 A;  3I0S A;  4H4M A;  4MLE A;  1L3V A;  1BI4 A;  4CGJ A;  2O8C B;  3HPG A;  3LP3 A;  4BE2 A;  4O8U A;  2Q31 A;  4DTR A;  1N8R O;  3HXM A;  1S22 A;  4HUE A;  3LM9 A;  1RT6 A;  4OGE A;  4DCH A;  3DLL L;  4ISE A;  1JXE A;  2HBL A;  2HB5 A;  1DKG D;  3ISN C;  3GG4 A;  4AH9 A;  3HM9 A;  3PY8 A;  3WXM B;  2HST A;  3OS0 A;  2Q1N A;  4MLH A;  2UXC K;  3LPU A;  3VQP A;  3NVM A;  3VGM A;  3AO5 A;  3MEE A;  4C8K A;  4FCY A;  2OTL N;  4DQR A;  4RW9 A;  4CIG A;  1VQO N;  1NJI O;  3AA3 A;  3O08 A;  4DSE A;  3D6R A;  5CY4 A;  3ZET B;  1CLQ A;  4FZZ A;  3SBT A;  3L4I A;  1KD1 O;  2GBZ A;  3NF6 A;  1XMO K;  5AQF A;  4DR6 K;  3DLR A;  1EXQ A;  1KQS M;  3KLH A;  4E1N A;  3NAE A;  3AVB A;  3F5T A;  1SUQ A;  4Y0W A;  4WFB L;  4FWK A;  4CJW A;  4M42 A;  4M3Y A;  4CJF A;  4N56 A;  1W97 L;  2P9N A;  1XWL A;  1QHT A;  4K42 A;  5AQJ A;  4K8X A;  3S3O A;  1TGO A;  1VQK N;  5CE3 A;  4G1Q A;  1NOY A;  4Z94 A;  2NRR A;  3AGK A;  3C94 A;  2RF2 A;  4DV2 K;  3O9R A;  5I9E B;  3CIP A;  4NYN A;  3RMD A;  4H0V B;  1BIU A;  2DFE A;  1J5E K;  4ID1 A;  4AHU A;  3CFO A;  4CIF A;  4IO9 L;  4J2D A;  1GLE G;  2UXD K;  4B1Z A;  2DTU A;  1XI1 A;  1NGB A;  1HYV A;  1S9G A;  3ALY A;  4N47 A;  1SS6 A;  1ZYQ A;  4YOX A;  1L5U A;  4B9L A;  1TYQ A;  4X64 K;  3VOV A;  4DS5 A;  3NVK A;  4CHQ A;  5LY3 A;  3T7Z A;  1KVC A;  1OH8 A;  2UXB K;  1U47 A;  1HQU A;  1C1A A;  1UWB A;  2V7Z A;  2YJE A;  5AQW A;  1ZBI A;  4BVO A;  1C0G A;  1K8A O;  1MU2 A;  2OZM A;  3C6U A;  4ISG A;  2QK9 A;  3VER A;  1B9D A;  4CFB A;  1NJY A;  2P9K A;  1QVF M;  1CXQ A;  1HYZ A;  2IDO A;  3DAW A;  4DQQ A;  4LY7 A;  1TK0 A;  1VRU A;  5AZJ B;  1X3N A;  3CC4 N;  5LJW A;  3K5M A;  1A5W A;  4KRE A;  3RRG A;  3HYF A;  4DMN A;  4JKG B;  4FJ7 A;  3PO4 A;  1JLC A;  3CCS N;  1TAU A;  3E66 A;  5C10 A;  3VTH A;  2X78 A;  4PWD A;  3DWL A;  1WOQ A;  1SQK A;  4R79 A;  3DXK B;  4A2B A;  1IKX A;  1J9A A;  1HRH A;  2E1Z A;  3MXI A;  3UIQ A;  4AHS A;  4JRQ A;  5T7B A;  2F8S A;  3NFA A;  1TK8 A;  1S1X A;  4JKD A;  2BE2 A;  5C2D A;  1RDC A;  5BRH A;  3IAY A;  3DXM A;  1JLQ A;  4M3T A;  1J54 A;  1XUP O;  1Q18 A;  1NK8 A;  2GWK A;  2PY5 A;  5BRE A;  2HMI A;  4CJS A;  3G25 A;  4K43 A;  1KC8 O;  3OS1 A;  4KHN A;  1YHQ N;  3OYC A;  4JI5 K;  4DR7 K;  3C7N A;  4JLH A;  3JYT A;  3GOI A;  1NBW A;  3T19 A;  2I7P A;  1BCM A;  5AZI A;  1YJ9 N;  4AHC A;  3E9L A;  3ULE B;  4BWM A;  3I8B A;  4FWP A;  4JKB A;  5IT9 O;  1NGI A;  1B9F A;  3CQX A;  4FO0 A;  3N4P A;  3VQQ A;  2QM1 A;  2O8F B;  3C0B A;  4LFB K;  2X6N A;  4C8M A;  3OS2 A;  4FLU A;  1HR0 K;  4NCA A;  4BRM A;  5JS2 A;  4BG8 A;  5J2P A;  1VSF A;  3MX5 A;  3PUF A;  3ZLJ A;  4CJK A;  1S3X A;  1GLD G;  1K6Y A;  4FJM A;  3K57 A;  3VF6 A;  1YT3 A;  4RG8 A;  2XY5 A;  4BE1 A;  4DSL A;  1VSL A;  4CHY A;  4M7Y A;  1GLB G;  3F9M A;  4DV3 K;  3QIO A;  5GIP A;  5H1S Q;  1HPM A;  2JWK A;  3CI5 A;  4BR4 A;  4BR9 A;  1S1V A;  2E6L A;  3L4Q A;  4FPB A;  4B1X B;  3NGY A;  1VQM N;  4DF8 A;  2HNY A;  2G8W A;  4B9U A;  2IOC A;  4IDH A;  3WQU A;  4CJP A;  3C6T A;  5KQD A;  2O8C A;  4IBN A;  1D5A A;  1KTQ A;  4DSI A;  3WXL A;  4Z4G A;  3E1Y A;  4FZX C;  1NK4 A;  5J2Q A;  3G4S N;  3VQC A;  4DFK A;  2JWL A;  3MEC A;  5AQN A;  3V9X A;  1BCO A;  3QEX A;  2XY6 A;  4EP5 A;  3SMP A;  3A5L C;  5HRN A;  4MFB A;  4BDP A;  3EL2 A;  4CFD A;  3IMX A;  5LMN K;  5AFU H;  3LWM A;  4E7H A;  4IG0 A;  4CK3 A;  3HTV A;  4OKE A;  4OPH A;  4GV9 A;  1S6P A;  3AAR A;  1EWQ A;  3FZF A;  2CGK A;  2F96 A;  3B6O A;  3D0P A;  4OLA A;  3HST B;  3ZET A;  4CEQ A;  2O8D B;  1Q9Y A;  3TAR A;  1IKV A;  2D0C A;  1XQS C;  4I2P A;  4GKJ K;  3A5M C;  5AQI A;  4BR2 A;  3CM5 A;  1N5Y A;  1CZB A;  2YKM A;  1T6D A;  4F3O A;  4FJL A;  3CQY A;  4KHY A;  4Z4I A;  2G8I A;  4BRN A;  4F9O A;  1BQN A;  4WCE L;  1YIT N;  4FW2 A;  4IZ9 A;  4C8O A;  4Z4C A;  3NH0 A;  3THY B;  3KZB A;  1FW6 A;  3PO5 A;  1HUX A;  4A59 A;  3QIP A;  4IG3 A;  3HOS A;  4YHH K;  3AVF A;  4YOR A;  3T1Y K;  3DLK A;  4I2Q A;  4CZE A;  4KH6 A;  2PYL A;  4DTO A;  4DV5 K;  1HNX K;  3V9W A;  4DQS A;  3C95 A;  1JLA A;  5ADX A;  3TR8 A;  1GLF O;  3CG7 A;  4M3W A;  3CER A;  5JS1 A;  3AAP A;  5IWA K;  3OYN A;  3OYD A;  5GIN A;  2O8E A;  5JVH L;  3CJ9 A;  2NRT A;  1T03 A;  1GOC A;  2ITG A;  1EQY A;  4MQ3 A;  4CEC A;  1XNR K;  1OH7 A;  1EWR A;  3P39 A;  5AQV A;  4H8K A;  1ASW A;  3EY1 A;  4FLW A;  5GAD P;  3TAF A;  3M8S A;  1FKO A;  4MDA A;  4KTQ A;  3VMF B;  4CZL A;  4Z4E A;  1LAW A;  3CFP A;  1B92 A;  1WSI A;  1S1T A;  2PYJ A;  3KIO A;  1JCF A;  4WE1 A;  4M41 A;  3O8M A;  4OVL A;  2Y1I A;  4M3Z A;  4K41 A;  3I0R A;  4CZI A;  4B9T A;  5AJ3 K;  3KD1 E;  5AZJ A;  5HL7 L;  1SKR A;  3V9Z A;  1WLJ A;  1A5X A;  2P9U B;  1YJN N;  1RCH A;  1ATS A;  4O55 A;  1RTH A;  3H1V X;  1WSF A;  1VQN N;  4JKG A;  3SUN A;  1IV0 A;  2QWN A;  4EFH A;  1GLA G;  1RDW X;  4JKC A;  3L2Q A;  3G71 N;  4JK9 A;  4JKH A;  4ILJ A;  3MMV A;  4TSX A;  4B1U B;  4FK0 A;  2QI2 A;  5CYM A;  1Q81 O;  3DXK A;  2QW9 A;  3VQD A;  1X9S A;  1RIL A;  2F9T A;  3AVA A;  4JD2 B;  1NK9 A;  1RTD A;  2W41 A;  1SL0 A;  3A0I X;  3KLI A;  3L2W A;  4KTZ A;  4CZG A;  3G6E N;  3SQ2 A;  2B4J A;  4KB1 A;  1C0T A;  3WEE A;  4A62 A;  3QB0 A;  4DFM A;  4DB3 A;  3BGR A;  4BY9 C;  2QEX N;  4H0O A;  4BC5 A;  2HW3 A;  3VEY A;  2YHY A;  3J7A P;  2FBT A;  4BRL A;  3SUQ A;  4CD3 A;  4FJJ A;  1DTT A;  2F4V K;  3OYE A;  4C1N K;  3MEG A;  5EVZ A;  3U8X A;  2KKZ A;  4ICL A;  4IOA L;  3OA9 A;  4DTN A;  3VQ9 A;  3ULE A;  3DLE A;  2HBM A;  4H0P A;  1RNH A;  4CW7 B;  1WBB A;  2IVN A;  3K9K A;  1XC3 A;  2O8F A;  1NLV A;  2HHH K;  4FWO A;  3VF2 A;  3K2P A;  5GAH P;  3DRS A;  4HUF A;  2OA8 A;  4JEP A;  1TVR A;  4CEA A;  1HKC A;  4HCB A;  4DUZ K;  3SJJ A;  5CZ2 A;  3ZCM A;  5BPM A;  4BRF A;  4LSN A;  4H5R A;  3Q7B A;  3CXC M;  4KHS A;  4O0I A;  4IEI A;  2PZS A;  3BDP A;  3HRG A;  1IH7 A;  2Z1J A;  2QTD A;  4JHD B;  4FWM A;  3BF1 A;  4CZF A;  4PA1 A;  4E1J A;  2ASO A;  1HX1 A;  1U6Z A;  1N6Q A;  3HP9 A;  3WQT A;  3ATV A;  4NXN K;  2HNZ A;  2O4I A;  4NB4 A;  3QEW A;  4YNQ A;  4DV1 K;  3M3Z A;  1WAF A;  1NJW A;  3ZSZ A;  4H5V A;  4WF9 L;  4CHP A;  4YY3 K;  4JI4 K;  2QXL A;  1KXP A;  4PKI A;  1KFS A;  3UKR B;  1WB9 A;  1NMN A;  4B9S A;  4BR0 A;  2E2P A;  3H46 O;  3EZ5 A;  4BRC A;  5C42 A;  1CZ9 A;  2NRX A;  4JKF A;  1QSL A;  3RRH A;  3MAQ A;  4NCG A;  1FK9 A;  1LCU A;  1Q82 O;  2HF3 A;  3OYB A;  1YTA A;  2P9I B;  1C0F A;  2BTF A;  3ASM A;  5C12 A;  4ZHR A;  3R6M A;  3LM2 A;  4ELT A;  2UUB K;  4DUY K;  4BGA A;  1BO5 O;  1JCG A;  1FJG K;  2QKK A;  3UB5 A;  2O8D A;  2E88 A;  4OKJ A;  2A5X A;  4PQU A;  3L2V A;  3QEV A;  3SNN A;  3LDL A;  4CEE A;  4PL7 A;  3MN9 A;  3OVN A;  1VSD A;  2NRV A;  3NGI A;  3V9S A;  5C0Y A;  1NGC A;  5BRF A;  3CYM A;  3MED A;  3KLF A;  5FRO A;  2GX9 A;  3KKR A;  4CZH A;  3DI6 A;  5GAG P;  2G8V A;  4QS7 A;  3THY A;  4F2S A;  3M8P A;  4H5N A;  4WQ5 A;  3SZ2 A;  4IFY A;  2F9W A;  3GE1 A;  4IXC A;  2DFF A;  5AQO A;  3AVL A;  4BAC A;  2FBX A;  3AVI A;  3IDH A;  2ZD1 A;  3JXU A;  4CEB A;  4WYB A;  1KVB A;  4FM1 A;  3DJC A;  1QZ6 A;  5TKW A;  4DV7 K;  3L6Q A;  4CHZ A;  3JS6 A;  3I56 N;  5KQ8 A;  2ZJP L;  4IO8 A;  2D0B A;  4IEE A;  4BQL A;  4CEF A;  1NWK A;  4JI6 K;  1Q86 O;  1HNV A;  2ETJ A;  4NLC A;  3WNH A;  4W5Q A;  4RWT A;  2FSJ A;  1Y97 A;  2GV9 A;  3ZEU A;  2P5O A;  3K5O A;  4MDB A;  2GEM A;  1Y64 A;  3LP2 A;  3MDQ A;  2HF4 A;  1RT4 A;  1GLC G;  5AQL A;  4BRE A;  3G0Z A;  4BE0 A;  4JI8 K;  5J2N A;  2P9U A;  3TAB A;  5AQY A;  4FJX A;  3QIC A;  3CME N;  4LF7 K;  2NUB A;  3M8R A;  4N41 A;  3LP0 A;  2Q97 A;  5SZT A;  1VSI A;  4FWS A;  4JK8 A;  2BGG A;  4KBO A;  1QTM A;  4I6M B;  4M3R A;  5ADX H;  2YHX A;  1U04 A;  4DSK A;  3H3N O;  3L3V A;  1JXB A;  4JD2 A;  5KI6 A;  4LF9 K;  4DG1 A;  2D0A A;  3CET A;  1QVG M;  3ULD A;  3LDO A;  3U6F A;  3AVM A;  2QWL A;  4CJR A;  4DTP A;  3LDP A;  4AM7 A;  3SAF A;  3ZSQ A;  1K73 O;  4DTJ A;  4KRF A;  5DMR A;  2WTU A;  2IVP A;  2HHU A;  3W0L A;  2HHT A;  3QFP A;  4JRP A;  1NKB A;  4KV8 A;  3V4I A;  2KTQ A;  1QSY A;  5BR8 K;  1IG9 A;  4E89 A;  4OO1 J;  4CF8 A;  1LV5 A;  5JMV A;  4B3O A;  1KAZ A;  4CJ3 A;  1DTQ A;  3D2E B;  4DLE A;  5CZ1 A;  3TTD A;  3AO3 A;  1ATN A;  2H3G X;  2IVO A;  4BQZ A;  1BDG A;  5E84 A;  3SMS A;  2P5G A;  1YF5 L;  1E4G T;  1YIJ N;  4CK2 A;  3BZK A;  3QNN A;  3L2U A;  4BRI A;  1XC9 A;  4E7I A;  1WSE A;  5JVG L;  3O4W A;  4J2E A;  2WON A;  4BVP A;  1MWM A;  3HSC A;  3EO3 A;  4JHD A;  3MWT A;  4CFA A;  1K9M O;  4W5N A;  2PAV A;  4IFE A;  4KPY A;  3O1W A;  3AVJ A;  2HHW A;  2YCH A;  5C24 A;  2IS3 A;  4ILH A;  2Q2R A;  1ZBL A;  3T69 A;  2HHV A;  4DV6 K;  1WN7 A;  2B6A A;  1VQ5 N;  5DM6 L;  1GLJ O;  3VQA A;  1ZBF A;  3ZT0 A;  3SUP A;  4YOT A;  1IKY A;  4KTW A;  4IDK A;  5F1X A;  1VSH A;  4JI2 K;  1U48 A;  1MDU B;  2VWJ A;  2P9P B;  4GKK K;  1VSE A;  4K0K K;  4BRH A;  2G8H A;  1EO1 A;  1YAG A;  1T05 A;  4CF0 A;  3VES A;  4O5F A;  3CHW A;  3U3G A;  2VQE K;  2P9I A;  1NM1 A;  4DTU A;  2DPN A;  3K0S A;  3OJU A;  1YJW N;  1HNZ K;  1X3M A;  3ZT1 A;  1BL3 A;  5KGW A;  4W5T A;  5AQK A;  1D8Y A;  1V4S A;  3HT3 A;  1WBD A;  4ILG B;  4JI3 K;  5FPM A;  3ZX2 A;  3PSF A;  5AQQ A;  3MCP A;  1LWC A;  4KO0 A;  2IIR A;  1FXX A;  2ZWH A;  2BH1 A;  4E19 A;  4EZ6 A;  4B3T K;  1HYS A;  3PV8 A;  2HHQ A;  4H5W A;  1KFD A;  3D45 A;  3H6E A;  4X65 K;  1L3U A;  2NNW A;  5HRO A;  3M5R A;  4CI6 A;  3DLH A;  1NOZ A;  1HJO A;  3TPQ A;  3L2R A;  1NJX A;  1NK5 A;  3V9U A;  1X9M A;  3U9Z A;  4B1V A;  3ID6 A;  1J5O A;  4JNE A;  3LDS A;  4FLX A;  2NZT A;  4GVM A;  4DTM A;  2OPR A;  3O1B A;  1TKZ A;  3F2K A;  4DU3 A;  4DHY A;  2FC0 A;  1VSJ A;  4QCL A;  1YVU A;  3H08 A;  2Q36 A;  1ESV A;  3HPO A;  1QQN A;  1D4X A;  2HMP A;  1RFQ A;  4WQ5 C;  4B8C A;  1TUU A;  4CED A;  3FZH A;  1NU0 A;  3OYK A;  2FSN A;  3HZ6 A;  3ZSX A;  1JJ2 M;  2P9S B;  2D5R A;  1L3S A;  3TAN A;  5AQS A;  1TKX A;  3J8A A;  1C0U A;  4JV5 K;  3SPZ A;  3E9O A;  2JLE A;  3HPH A;  3NGZ A;  4YDU A;  5HP1 A;  4DR5 K;  1N32 K;  4FWR A;  4IFV A;  2YHW A;  3R1X A;  4B9M A;  3OTO K;  1LAV A;  4YOV A;  4N5S A;  5J2M A;  5TKY A;  3AA2 A;  3VQ6 A;  1J53 A;  3AO4 A;  3K9J A;  3QIN A;  4JAX A;  3SPY A;  5E41 A;  3QLH A;  3ZT4 A;  3OYH A;  3CPW M;  3EE9 A;  2Q0U A;  4OGC A;  4HVJ A;  3HVR A;  3CCQ N;  4FJH A;  2KZZ A;  5JLH A;  3RVC A;  5B8H A;  4HUG A;  3B6P A;  3VPZ A;  3V1Q A;  1VQL N;  4LH4 A;  4RCH A;  4BR5 A;  3EKS A;  3P31 A;  1XMQ K;  4PUO A;  2J4R A;  1BA1 A;  3KWG A;  5BR9 A;  4FLY A;  4CJE A;  3LAM A;  1BWF O;  4GW6 A;  4NXM K;  3DOL A;  1LWF A;  3LDQ A;  2W6K A;  3ZSV A;  4W5R A;  3CFR A;  1JL2 A;  4C23 A;  3WT0 A;  1ZBH A;  3CM6 A;  4F3T A;  3ZT2 A;  4KHU A;  5FPN A;  2OPQ A;  4GY2 B;  4A61 A;  1T44 A;  4CK1 A;  3MX2 A;  2HBK A;  4Z4H A;  3TAG A;  4GNI A;  4I6M A;  4FJ8 A;  1SAZ A;  1GOA A;  1LOT B;  4BR7 A;  4W5O A;  2OZS A;  4AHT A;  1IBM K;  5M1K A;  4QS9 A;  2E2O A;  4CF2 A;  3K59 A;  3BY5 A;  3O6W A;  4Z0U A;  4DTS A;  3LWL A;  3NF8 A;  3OYJ A;  3L3U A;  3DLG A;  3CC2 N;  1RGI A;  3TU5 A;  4JI0 K;  2GUP A;  1LW0 A;  1Z05 A;  1TV6 A;  1RDU A;  5FLX O;  3PIP L;  2A40 A;  4GVE A;  4FPA A;  1HQE A;  4JS5 A;  3S3N A;  3RSE B;  2GUI A;  3U3Y A;  1ITG A;  1SKS A;  2GWJ A;  4FYD A;  1IKW A;  2KLA A;  1JLE A;  1RT3 A;  3D2E A;  3AVG A;  1BA0 A;  2RKI A;  3LAL A;  3KVG A;  1UA1 A;  4WFN L;  3AO1 A;  1ZXO A;  2HOE A;  4M63 C;  1VQP N;  1EP4 A;  4J8F A;  3VEX A;  1DEJ A;  1OH5 A;  5EOY A;  3A5O C;  4YFU A;  3CCU N;  1S1U A;  4CGF A;  4HHT A;  3OJS A;  1WSG A;  3SI6 A;  4NLB A;  4B3M K;  3CQ8 A;  2VYP A;  1IJJ A;  1ZBS A;  3HO1 A;  2D0O A;  1N36 K;  1E3M A;  3KTQ A;  1SL1 A;  1G15 A;  4B1Y B;  3A5N C;  4XH5 A;  5LL6 Z;  3AO2 A;  1GOB A;  5HRR A;  1HKB A;  2OAN A;  3FGU A;  2UUA K;  4RTF D;  4E7J A;  4XH4 A;  2V51 B;  3QO9 A;  4CF9 A;  4OPK A;  1BU6 O;  1P90 A;  2ZQB A;  2A1S A;  3FZL A;  3RTV A;  3R9P A;  3HOT A;  4CZK A;  2P9P A;  1IO2 A;  3L8B A;  3KWI A;  4B9V A;  3TAM A;  4BC2 A;  4CFC A;  2Z1I A;  2CH5 A;  4YOY A;  3OYG A;  1VQ9 N;  1R0A A;  2ITM A;  5M1O A;  4PL8 A;  2OYQ A;  1TYQ B;  2HND A;  4Y1C A;  3C6H A;  3ZT3 A;  3NHG A;  4K25 A;  1YVN A;  4IOC L;  3NCI A;  3DM2 A;  1WNS A;  3NDK A;  1RTJ A;  3CCL N;  5BN9 A;  3O3H A;  2EX3 A;  3QEP A;  5HOO A;  3P1G A;  1P8Z A;  4JKE A;  2WC9 A;  2ZGY A;  3V1O A;  5EXW A;  4FWQ A;  2V7Y A;  1Q7Y O;  2FSK A;  5JIC A;  3VTI A;  4DTX A;  1NJZ A;  4KHW A;  4KFB A;  1KAX A;  3NMU A;  4KH5 A;  1WAJ A;  1I3A A;  4X62 K;  3ZSR A;  4OLB A;  1KCF A;  1TAQ A;  4FOI A;  4DQP A;  3J7Y P;  4L3Q A;  4AHR A;  1NG9 A;  3QES A;  4ELV A;  2FXU A;  4GMJ B;  4BGB A;  3O3G A;  3HBT A;  3VA0 A;  4V19 S;  5M1Q A;  1MA9 B;  2X6S A;  1HMV A;  2Z1G A;  3KJV A;  2V52 B;  3AY9 A;  5BRD A;  2LSN A;  2A42 A;  2Q3S A;  4FXD A;  3JAM O;  4FLV A;  3NF9 A;  2ZGZ A;  1Q9X A;  1C0M A;  3VEO A;  3LAN A;  2AJQ A;  1RT5 A;  3P4I A;  1ILY A;  4BG9 A;  2P9S A;  1RDB A;  4L8R B;  5AQT A;  4H4O A;  3SV4 A;  3CJC A;  3LDN A;  3OBY A;  2VGM A;  3J81 O;  4KAZ A;  4HTU A;  4DR1 K;  4AQY K;  4JKA A;  4DR2 K;  2VG5 A;  4EAH D;  4O5B A;  3PX0 A;  2VQF K;  4YDU C;  1RBU A;  3MWP A;  4O8K A;  2ZJR L;  2GEL A;  3TTC A;  2OPP A;  4EHT A;  4WFA L;  3J7Z O;  3MXM A;  4DF4 A;  3FE1 A;  3C7N B;  5FPD A;  4RW8 A;  1D9F A; 
#chains in the Genus database with same CATH homology
 2HHX A;  2KW4 A;  3ZSQ A;  4DTJ A;  1NK0 A;  5DMR A;  4CHO A;  1NKC A;  1S1V A;  2E6L A;  3SV3 A;  4KRF A;  3NGY A;  4B8A B;  2HHU A;  1CXU A;  2XY7 A;  3TAE A;  2KFZ A;  4DF8 A;  2HNY A;  2G8W A;  4B9U A;  4CJV A;  2IOC A;  4CER A;  2HHT A;  5FRM A;  3HJF A;  4JRP A;  2I5J A;  1NKB A;  4CJP A;  3C6T A;  4DU4 A;  4IBN A;  1D5A A;  2FBY A;  4KV8 A;  1KTQ A;  3V4I A;  3RR7 A;  4DSI A;  2DY4 A;  3K58 A;  1FKP A;  4Z4G A;  3LP1 A;  4FZX C;  1BHL A;  2KTQ A;  1NK4 A;  1QSY A;  5J2Q A;  3P5J A;  3VQC A;  4DFK A;  1IG9 A;  4KI6 A;  3MEC A;  2R7Y A;  4FW1 A;  1BCO A;  3V9X A;  3QEX A;  2XY6 A;  4K8Z A;  3NH1 A;  4EP5 A;  4NYF A;  4FJK A;  4E7L A;  4N76 A;  5HRN A;  4E89 A;  4LH5 A;  3KD5 E;  4CF8 A;  1LV5 A;  4MFB A;  4BDP A;  4CJ3 A;  2FBV A;  4B3O A;  3TI0 A;  4CFD A;  1DTQ A;  1I39 A;  5EU7 A;  2P51 A;  4DLE A;  3LWM A;  5CZ1 A;  3AO3 A;  3VQB A;  1JLB A;  1BIS A;  4IG0 A;  4E7H A;  3ZSY A;  4XIU A;  4CK3 A;  4OKE A;  3AA5 X;  4RW4 A;  3O4N A;  4Q5V A;  2P5G A;  1QS4 A;  4CK2 A;  3QNN A;  3L2U A;  1S6P A;  2YHA A;  3LPT A;  1ASV A;  1XC9 A;  4DLG A;  4E7I A;  2F96 A;  3B6O A;  1WSE A;  3D0P A;  5KRT A;  4OLA A;  3HST B;  4CEQ A;  2DFH A;  4CJ5 A;  4J2E A;  1TKT A;  1Q9Y A;  3TAR A;  3S3M A;  1RBV A;  1IKV A;  2D0C A;  2WON A;  3M8Q A;  1NK6 A;  4FJG A;  3KKS A;  4I2P A;  1TL1 A;  1L3T A;  3CM5 A;  1N5Y A;  1CZB A;  4CFA A;  4CF1 A;  3O3F A;  4C8L A;  2YKM A;  4DQI A;  4FM2 A;  4W5N A;  4F3O A;  4FJL A;  3V81 A;  4E7K A;  1BGX T;  4CE9 A;  3QET A;  1W9H A;  4DS4 A;  3V6D A;  2HHS A;  4KHY A;  4CEO A;  4IKF A;  4KPY A;  3AVJ A;  4OKK A;  2W42 A;  1XHZ A;  4OJR A;  4B08 A;  4Z4I A;  5C24 A;  2IS3 A;  2G8I A;  2HHW A;  2VG7 A;  1EKE A;  1ZBL A;  1QQC A;  2IAJ A;  4FJN A;  2HHV A;  1BQN A;  3MXM A;  1WN7 A;  2O4G A;  2B6A A;  4FW2 A;  3PX6 A;  4C8O A;  4ELU A;  4NCB A;  1TKD A;  1RBR A;  4Z4C A;  3VQA A;  3KLG A;  1BIZ A;  1ZBF A;  2RPI A;  3WNE A;  3ZT0 A;  3NH0 A;  3SUP A;  4FK2 A;  4J2B A;  1IKY A;  2IC3 A;  4IDK A;  4KTW A;  2YNI A;  1VSH A;  1U48 A;  3VQE A;  2VWJ A;  3RMA A;  3PO5 A;  4O44 A;  3QIP A;  4CJL A;  3ITH A;  1VSE A;  4IG3 A;  2G8H A;  3VN5 A;  3AVF A;  1U45 A;  1Q8I A;  3DLK A;  4CF0 A;  1T05 A;  4I2Q A;  1SKW A;  3U3G A;  2E6M A;  2G8F A;  1HPZ A;  2G8U A;  2PYL A;  4DTU A;  1EX4 A;  1JL1 A;  1WSJ A;  3HP6 A;  3OJU A;  1LW2 A;  4DTO A;  3V9W A;  3NE6 A;  4CGI A;  3ZT1 A;  1BL3 A;  4CGD A;  4CJT A;  5KGW A;  4W5T A;  3OYA A;  3C95 A;  1JLA A;  3F73 A;  4DQS A;  3HT3 A;  1D8Y A;  3TR8 A;  3HK2 A;  3CG7 A;  1X9W A;  4O0J A;  3DRP A;  2XO7 A;  4M3W A;  2EHG A;  5JS1 A;  1LWC A;  3V1R A;  3OYN A;  2F8T A;  3OYD A;  4KKO A;  4KO0 A;  2KFN A;  4R5P A;  3IS9 A;  3RWU A;  2VG6 A;  1FXX A;  1A5V A;  4E19 A;  3RMC A;  4EZ6 A;  3OYM A;  1T03 A;  1HYS A;  1UAX A;  1GOC A;  3PV8 A;  4QOZ B;  1Z26 A;  2ITG A;  4DFJ A;  2HHQ A;  1KFD A;  3D45 A;  4MQ3 A;  3DRR A;  4CEC A;  4F4K A;  1VSK A;  4E0D A;  2X74 A;  4M45 A;  3VQ4 A;  1L3U A;  4FVM A;  4H8K A;  1ASW A;  3EY1 A;  5HRO A;  4FLW A;  3WNF A;  3TAF A;  2KQ2 A;  2YNF A;  1FKO A;  1NOZ A;  2YV0 X;  3T1A A;  3M8S A;  3L2R A;  3EYZ A;  3ZSW A;  3V9U A;  1NK5 A;  1NJX A;  2HVI A;  2A1R A;  1X9M A;  3SUO A;  1RBS A;  1C1B A;  3VA3 A;  1J5O A;  4EZ9 A;  4KTQ A;  4Z4E A;  3NH2 A;  1UOC A;  3LDS A;  4GVM A;  4FLX A;  1LAW A;  5DK5 A;  1B92 A;  1WSI A;  3CFP A;  1S1T A;  2OPR A;  4DTM A;  3QEI A;  2JGU A;  2PYJ A;  1TKZ A;  3KIO A;  4DU3 A;  3P83 D;  4WE1 A;  4M41 A;  2FC0 A;  1VSJ A;  4JS4 A;  4QCL A;  1YVU A;  4OVL A;  2Y1I A;  2XY8 A;  1RBT A;  3H08 A;  4M3Z A;  1QE1 A;  3HPO A;  3I0R A;  4I9Q A;  3MXJ A;  2HVH A;  4B9T A;  3KD1 E;  2XHB A;  4FJI A;  1VK0 A;  3HVT A;  1SKR A;  4B8C A;  3V9Z A;  1WLJ A;  1A5X A;  3IRX A;  4CED A;  5J1E A;  3OYK A;  1U49 A;  1RCH A;  3OYL A;  2BDP A;  3KK3 A;  4O55 A;  4CEZ A;  1RTH A;  1F21 A;  1W0H A;  4DSL A;  3IG1 A;  1WSF A;  4E3S A;  3ZSX A;  1VSM A;  4BDY A;  1REV A;  2D5R A;  1L3S A;  3KK1 A;  3SUN A;  5HRS A;  3SYZ A;  1WSH A;  3TAN A;  4Z4F A;  3AVC A;  3L2Q A;  3QNO A;  1TKX A;  4Y1D A;  4HCC A;  1C0U A;  3AVH A;  4I9L A;  3SQ4 A;  3SPZ A;  3THV A;  4TSX A;  2JLE A;  3HPH A;  3NGZ A;  1D9D A;  4FK0 A;  3K5L A;  5CYM A;  5HP1 A;  3VQD A;  1X9S A;  1T7P A;  2P1J A;  4RW6 A;  1RIL A;  3AVA A;  4IFV A;  3VQ5 A;  1NK9 A;  1RTD A;  4B9M A;  1SL0 A;  2VWK A;  3KLI A;  3S9H A;  3L2W A;  1S9E A;  4KTZ A;  1LAV A;  4B9N A;  4N5S A;  5J2M A;  3DMJ A;  3AA2 A;  3VQ6 A;  1J53 A;  3AO4 A;  3SQ2 A;  3SQ0 A;  4ZTF A;  2B4J A;  4KB1 A;  3OYF A;  3QIN A;  3SPY A;  4FJ9 A;  3OYI A;  3LAK A;  5E41 A;  1C0T A;  3QLH A;  3LZI A;  3ZT4 A;  3OYH A;  4OGC A;  1C1C A;  4HVJ A;  3HVR A;  3VQ8 A;  4ZTJ A;  4FJH A;  5D3G A;  1KLM A;  3WNG A;  2QXF A;  4DFM A;  2KZZ A;  4HUG A;  3B6P A;  3BGR A;  5SWM A;  1ASU A;  3V1Q A;  4CIE A;  5KRS A;  3I0S A;  4H4M A;  4LH4 A;  5I42 A;  1UA0 A;  1L3V A;  2HW3 A;  1BI4 A;  4CGJ A;  3HPG A;  2FBT A;  4PUO A;  3LP3 A;  3SUQ A;  3HL8 A;  4BE2 A;  4DTR A;  4FLY A;  3HXM A;  1DTT A;  4CJE A;  3LAM A;  3DLB A;  4HUE A;  4FJJ A;  1RT6 A;  4OGE A;  3OYE A;  3MEG A;  5HBM A;  4GW6 A;  4AHV A;  4ICL A;  1T8E A;  3DOL A;  1LWF A;  4J2A A;  4FLT A;  1JXE A;  3ZSV A;  3VQ9 A;  2BAN A;  4W5R A;  3CFR A;  2HB5 A;  1JL2 A;  3DLE A;  4E1M A;  3ISN C;  4Q0B A;  1SL2 A;  4AH9 A;  1ZBH A;  3CM6 A;  4F3T A;  1RNH A;  3HM9 A;  2Y1J A;  3ZT2 A;  3PY8 A;  4KHU A;  3OS0 A;  3KK2 A;  2OPQ A;  3LPU A;  3VQP A;  4CGG A;  3AO5 A;  3MEE A;  4DU1 A;  3TAQ A;  1ZBU A;  4C8K A;  4CK1 A;  3K2P A;  4HUF A;  3DRS A;  4FCY A;  2OA8 A;  4DQR A;  4RW9 A;  4CIG A;  1TVR A;  4CEA A;  3AA3 A;  4HCB A;  3SJJ A;  5CZ2 A;  1S5J A;  4Z4H A;  3ZCM A;  3TAG A;  2QKB A;  4DSE A;  4LSN A;  5CY4 A;  3QER A;  4CJU A;  4FJ8 A;  4KHS A;  4O0I A;  1GOA A;  5CYQ A;  1CLQ A;  2PZS A;  3TWH A;  3BDP A;  4FZZ A;  2GBZ A;  1IH7 A;  2Z1J A;  4BDZ A;  3NF6 A;  4W5O A;  3DLR A;  4PA1 A;  2OZS A;  4AHT A;  1N6Q A;  1EXQ A;  3KLH A;  3HP9 A;  4E1N A;  3NAE A;  3AVB A;  1SUQ A;  2HNZ A;  2O4I A;  1BQM A;  3QEW A;  3VQ7 A;  4M3U A;  1KRP A;  4CF2 A;  4CJW A;  3NF7 A;  3K59 A;  4Z0U A;  4YNQ A;  4DTS A;  2B5J A;  3LWL A;  3NF8 A;  4CJF A;  4M42 A;  4N56 A;  4M3Y A;  1WAF A;  1NJW A;  3ZSZ A;  1U4B A;  1XWL A;  1QHT A;  3OYJ A;  4CHP A;  3L3U A;  3DLG A;  4CHN A;  4K8X A;  2ATQ A;  3S3O A;  2KZM A;  1KFS A;  1TGO A;  3ZSO A;  4B9S A;  1LW0 A;  4G1Q A;  1TV6 A;  4O4G A;  1NOY A;  3EZ5 A;  1QSS A;  1XHX A;  5C42 A;  1CZ9 A;  1QSL A;  3SQ1 A;  1HQE A;  4JS5 A;  4UQG A;  4NCG A;  3MAQ A;  3RRH A;  1RTI A;  1FK9 A;  3C94 A;  3RMB A;  3SCX A;  3S3N A;  3OYB A;  2GUI A;  3DLH A;  2RF2 A;  1YTA A;  3U3Y A;  1ITG A;  1SKS A;  4FYD A;  1IKW A;  1JLE A;  1RT3 A;  4DSF A;  3ASM A;  2IGI A;  4CCH A;  4NYN A;  3AVG A;  1RDA A;  4ZHR A;  1BIU A;  2DFE A;  1JKH A;  3RMD A;  4ID1 A;  2RKI A;  3LAL A;  1SV5 A;  4AHU A;  3CFO A;  4ID5 A;  4CIF A;  1UA1 A;  4J2D A;  4ELT A;  1HJR A;  3A2F A;  3AO1 A;  2DTU A;  3O4Q A;  1XI1 A;  3LZJ A;  1HYV A;  1EP4 A;  1S9G A;  3ALY A;  4N47 A;  2QKK A;  4LD0 A;  4CJ4 A;  1ZYQ A;  4KI4 A;  5HLF A;  1L5U A;  4B9L A;  4PY5 A;  4YFU A;  2OPS A;  1S1U A;  4CGF A;  4HHT A;  4FLZ A;  4OKJ A;  3OJS A;  1WSG A;  3SI6 A;  3OY9 A;  4PQU A;  4DS5 A;  4CHQ A;  2YKN A;  1KVC A;  3CQ8 A;  1U47 A;  1HQU A;  3L2V A;  3QEV A;  3SNN A;  1C1A A;  3HO1 A;  4CEE A;  3OVN A;  3KTQ A;  1UWB A;  1SL1 A;  1G15 A;  1ZBI A;  1VSD A;  2YNH A;  5I3U A;  4DTN A;  3NGI A;  3V9S A;  1X1P A;  2WOM A;  5FRN A;  3AV9 A;  1MU2 A;  2OZM A;  3C6U A;  2QK9 A;  3CYM A;  3AO2 A;  1GOB A;  5HRR A;  2E4L A;  4DSJ A;  4FZY A;  1B9D A;  3MED A;  4CFB A;  4E7J A;  1NJY A;  3KLF A;  5FRO A;  4DWI A;  1CXQ A;  3QO9 A;  3KKR A;  1HYZ A;  4C8N A;  3DI6 A;  2IDO A;  2G8V A;  4CF9 A;  4OPK A;  4DQQ A;  3RTV A;  2ZQB A;  2A1S A;  3G10 A;  4F2S A;  4LY7 A;  4FK4 A;  1TK0 A;  3M8P A;  1VRU A;  3SZ2 A;  1IO2 A;  4IFY A;  1KVA A;  3L8B A;  4B9V A;  3TAM A;  4CFC A;  1JLF A;  4DFP A;  2Z1I A;  1TL3 A;  2DFF A;  5HRP A;  3K5M A;  1A5W A;  4KRE A;  3F9K A;  3OYG A;  4BWJ A;  1R0A A;  2Z1H A;  3RRG A;  3HYF A;  4DMN A;  2OYQ A;  3AVL A;  4FJ7 A;  3PO4 A;  1S1W A;  1JLC A;  2FBX A;  4BAC A;  3AVI A;  2HND A;  4Y1C A;  2ZD1 A;  3ZT3 A;  4CEB A;  5KTQ A;  1KVB A;  3NHG A;  1TAU A;  1RT2 A;  3NCI A;  3DM2 A;  1WNS A;  1KLN A;  4FM1 A;  2X78 A;  4PWD A;  4LSL A;  5KGX A;  3T3F A;  3NDK A;  1RTJ A;  4FJ5 A;  3O3H A;  1IKX A;  2EX3 A;  1J9A A;  3JSM A;  3QEP A;  1HRH A;  4CHZ A;  3MXI A;  4KB0 A;  3UIQ A;  4AHS A;  4JRQ A;  3P1G A;  5T7B A;  2F8S A;  3NFA A;  4EP4 A;  1TK8 A;  1S1X A;  3V1O A;  4CJQ A;  2D0B A;  3I8D A;  2RN2 A;  2BE2 A;  4CEF A;  2YNG A;  1RDC A;  2XY5 A;  1KSP A;  3IAY A;  4DTX A;  1NJZ A;  4KHW A;  4KFB A;  1JLQ A;  4M3T A;  1O1W A;  1J54 A;  1HNV A;  3PX4 A;  3AVK A;  2ETJ A;  3K5N A;  1WAJ A;  1NK8 A;  3WNH A;  1I3A A;  4W5Q A;  3ZSR A;  3DOK A;  4OLB A;  1KCF A;  1TAQ A;  2PY5 A;  2HMI A;  1Y97 A;  4CJS A;  4DQP A;  1S6Q A;  2GV9 A;  3AA4 A;  4AHR A;  3OS1 A;  4KHN A;  1BI4 B;  3QES A;  3OYC A;  3TAP A;  2P5O A;  4ELV A;  4GMJ B;  3O3G A;  3VA0 A;  3K5O A;  1JLG A;  4JLH A;  3JYT A;  2X6S A;  1HMV A;  2Z1G A;  3LP2 A;  3T19 A;  3KJV A;  2G8K A;  4I7F A;  1NK7 A;  2LSN A;  1BCM A;  2Q3S A;  4FXD A;  1DLO A;  1RT4 A;  2XRI A;  4AHC A;  4FLV A;  4KHQ A;  4BWM A;  1RT1 A;  3NF9 A;  3G0Z A;  4BE0 A;  2ZE2 A;  1B9F A;  5J2N A;  3TAB A;  1Q9X A;  1C0M A;  4FJX A;  4AIL C;  4F8R A;  1LWE A;  1RDD A;  3LAN A;  4CGH A;  2AJQ A;  1RT5 A;  3VQQ A;  1NKE A;  2NUB A;  1RDB A;  3M8R A;  4L8R B;  3LP0 A;  4N41 A;  2X6N A;  1C6V A;  4H4O A;  1RT7 A;  5SZT A;  3SV4 A;  3DYA A;  4C8M A;  1VSI A;  3OS2 A;  4FLU A;  4F2R A;  2YHB A;  4KAZ A;  2BGG A;  4HTU A;  4NCA A;  1EET A;  4RW7 A;  1QTM A;  5JS2 A;  2VG5 A;  4M3R A;  4O5B A;  5J2P A;  3PX0 A;  1VSF A;  1U04 A;  1Z25 A;  3E01 A;  3PUF A;  4DSK A;  4CJK A;  4OPJ A;  1RBU A;  3L3V A;  1JXB A;  1K6Y A;  3AVN A;  5KI6 A;  4M3X A;  4FM0 A;  4FJM A;  5C25 A;  3K57 A;  2OPP A;  3RR8 A;  4CES A;  1YT3 A;  4QAG A;  4RG8 A;  5FDL A;  2D0A A;  4DG1 A;  3KLE A;  4BE1 A;  1VSL A;  1VRT A;  4CHY A;  3ULD A;  5K14 A;  4DF4 A;  1YTU A;  1TK5 A;  3NBP A;  1HNI A;  3U6F A;  3FFI A;  3QIO A;  3AVM A;  4RW8 A;  4CJR A;  1D9F A;  4DTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...