5CHIA

Crystal structure of pf2046 in complex with ssdna
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
230
structure length
230
Chain Sequence
MMRIVAADTGGAVLDETFEPIGLIATVAVLVEKPYRSAKEVMVKYANPYDYDLTGRQAIRDEVLLAIELARKVKPDVIHLDSTLGGIELRKLDEPTIDALGISDKGKEVWKELSKDLQPLARKFWEETNIEIVAIGKSSVPVRIAEIYAGIYSAKWGIENVEKEGHLIIGLPRYMEVNIKDGKIIGRSLDPREGGLYGSAEVSVPEGVKWEIYPNPVARRFMIFEIFSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of two-nucleotide removal of ssDNA by a cryptic RNase H fold 3'-5' exonuclease PF2046 from Pyrococcus furiosus
rcsb
source organism Pyrococcus furiosus (strain atcc 43587 / dsm 3638 / jcm 8422 / vc1)
molecule tags Hydrolase/dna
molecule keywords Uncharacterized protein
total genus 61
structure length 230
sequence length 230
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13680 DUF4152 Protein of unknown function (DUF4152)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.440 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5chiA00
4YOTA 4YOUA 4O8UA 4YORA 4YOXA 5CHIA 4YOVA 4YOYA 4YOWA
chains in the Genus database with same CATH superfamily
1NGGA 3O9QA 4KO0A 2RN2A 5AQRA 4DV5K 4XH4A 3LDOA 4CJLA 4KREA 3V1OA 3ITHA 3H46O 3U4LA 3AAPA 4DQSA 3EKSA 3SPZA 4A62A 4CJSA 2PY5A 1BQNA 4DB3A 1ESVA 4CJFA 3TTCA 1NK5A 1N33K 2P9SB 1MWKA 1QQOA 3QIOA 2RPIA 3KD1E 3CERA 5AQTA 2PZSA 2XY5A 3CQ8A 3QDKA 4CGFA 5HRSA 4DR1K 3LZIA 4DUZK 3VPZA 4FWSA 1NMDA 3VOVA 1QSYA 3RMBA 3O1WA 5JICA 3DWLA 1CXUA 1HKGA 3OYCA 4FW2A 4J8FA 4DS5A 1RBSA 2LSNA 3WXIA 3OYAA 4NXMK 4DR5K 2UXCK 4HTLA 4Z0UA 5EX5A 3SBTA 2YJFA 3PUFA 3BZKA 3QO9A 5AQJA 4C8NA 2ZD1A 3SUOA 1TYQA 1RBRA 1VQ9N 1RNHA 4B3RK 3I56N 4DF4A 2WFBA 1IBLK 1QSLA 3FZFA 1NK9A 4RG8A 4CEZA 2QW9A 1BA0A 1W0HA 2HB5A 2OPQA 3ZETA 1EP4A 2YX6A 1N6QA 3CI5A 4FWQA 4JK8A 1T6CA 1J54A 4FJKA 5LJVA 2ZJRL 1K6YA 4M7YA 3RWUA 3VTHA 4A61A 2YNGA 3SUNA 4RW6A 4MO5A 3AV9A 4CJVA 1C6VA 4JRPA 3S41A 4ISEA 5EOYA 4B9UA 1UAXA 1RBUA 2BH1A 3LL3A 3LWLA 2OA8A 1F21A 3PX0A 3OS0A 3HXMA 1KVBA 3NGIA 2A5XA 4WQ4C 3PSIA 2D0BA 1L3SA 3DI6A 4LF9K 4FLTA 1VQ6N 4ILHA 1VSJA 3S3OA 2KLAA 2E2NA 4DU4A 4NCGA 5GINA 4CHZA 4Z4FA 3DRSA 3AVLA 3EE9A 4FJ9A 3CCLN 5HBMA 2P9IB 5CY4A 4WCEL 4FJ7A 1WNSA 1WBBA 2P51A 4B1ZA 3MEDA 1KSPA 3NF9A 2Q3SA 3WT0A 4B9LA 4DTRA 4G1QA 2HBJA 4V19S 2FBYA 1G99A 2FF6A 2P9NB 4BQLA 3HOTA 1NKCA 4AM7A 4GMJB 4JI2K 2VG7A 2VG5A 2G8IA 1TKZA 2FBXA 3VMFB 4R79A 4FJ8A 4FJJA 1HUXA 2HHQA 4ELVA 4OPKA 3HSCA 3ZT0A 3WQUA 2IAJA 3OHRA 3QFPA 1C0MA 4WYBA 3VA3A 1LOTB 4WF9L 1JCGA 4A2BA 4AHVA 2I5JA 5K14A 3AO5A 1T03A 4K42A 1NU0A 4CZFA 3O3GA 4JS5A 4BR5A 2A1SA 1RBTA 3NMUA 3SQ0A 3C7NB 3ZSWA 5BR8K 1B9FA 4BDYA 1REVA 1BI4A 3OVNA 4CJTA 3A5OC 2GWKA 4DV3K 1U45A 2YHXA 4E7IA 5FDLA 3DLHA 4ZTJA 3O9RA 2YI1A 1JL1A 3KLIA 1QSSA 4JI8K 4DTOA 1NGCA 1U2VB 3ENOA 3CYMA 3V9UA 3PO5A 2GELA 4B3MK 2OTJN 3NDKA 4GV3A 2E2PA 4DV2K 5CZ2A 5FROA 4OGCA 5KQDA 5KI6A 3TSPA 4CFDA 2XY6A 4AM6A 3J7AP 4KH4A 2QWRA 4CK2A 4HHTA 3N4QA 1ZYQA 3M8SA 3QBWA 3O3FA 2KZMA 3DAWA 2OPPA 2NRVA 3BDPA 4BR2A 4F2RA 3TAPA 1Q9XA 1LAVA 2D0PA 2ATQA 3SZ2A 3CJ7A 1VQPN 2PYLA 4H5TA 4IG3A 4JI3K 1NNEA 1GLLO 2Q36A 4DR2K 1LCUA 4BREA 3OYLA 1Q86O 1Q18A 4DR7K 3HM9A 3NVKA 4FWRA 1D8YA 3QFUA 5AQGA 1YXQA 3NBPA 3NH1A 3BP8A 4CHNA 4H0VB 3BF3A 3EL2A 4O55A 3L2WA 3O9SA 3HPGA 1NG9A 5KQ8A 1KLNA 1I39A 3AARA 2P9PB 4RW8A 4FXDA 2BTFA 5AQFA 4KHNA 2O8EA 3G10A 3T7ZA 3O08A 3NHGA 2IS3A 2BUPA 4K8ZA 4Q0BA 4B9TA 4FK0A 3PIPL 3VQDA 4O4GA 5BRDA 4M41A 5AZIA 3THXB 4O8KA 4FJNA 4FL9A 1XUPO 3V4IA 1VQNN 1IBKK 1VQ5N 3KVGA 4KB0A 1W2BM 2F9WA 5F0XA 2WTUA 3P83D 4M3XA 3KLHA 4I7FA 2I7NA 3ISNC 1WSEA 3J8AA 2FXUA 4U7BA 4FPBA 1OH7A 3ZX3A 2OPSA 1W7AA 3D2EB 3E9OA 2P9UA 1NGAA 3HO1A 2WOMA 4CW7B 3L8BA 2ASMA 2HMPA 5GADP 2Y1JA 2G8KA 3L2QA 3AO2A 4B1VA 4DUYK 3P5JA 4BRPA 1Z05A 4DSEA 3V81A 2ZJQL 4JKGB 2PAVA 3HP6A 3T1AA 4HTUA 3SQ1A 4Z4CA 5EVZA 4YHHK 3PX6A 1BOTO 1W97L 2IVNA 3DXKA 3H3NO 4KKOA 4FM0A 1NK8A 1JLBA 1HNWK 3QICA 2E6MA 4IEIA 3ATVA 4UY8O 4H5RA 4GV9A 1FW6A 3MXMA 1S9GA 4FZYA 5JVHL 5AQLA 4Q5VA 4MFBA 2IVOA 1NKBA 4CFBA 3K5LA 3K2PA 5JLHA 4Z4HA 4FJIA 3ZSOA 5FRNA 5ELZA 4F9OA 2OPRA 2QM1A 2GUIA 1Q8IA 3NE6A 1YHQN 1T44A 2D5RA 2B5JA 4KH5A 3QINA 4OLAA 3GE1A 3OY9A 1TK8A 3SV4A 1YAGA 5CR4A 3W3DA 3UE5A 2HF4A 1BDGA 5HRNA 1NGIA 3WXJA 4BR9A 5KRSA 5ADXH 3GDQA 3KZBA 1IJJA 5AZIB 3ZSQA 3THXA 4IWVA 1VAZA 2ZF5O 4I2QA 3VQCA 3OYJA 2OYQA 4N41A 3HJFA 1BUPA 4I9QA 3VEOA 3SK3A 3CETA 4TSXA 4M45A 4L3QA 4QOZB 1BO5O 2E20A 4GVEA 3A2FA 3DXMB 3KKRA 5M1QA 4JD2A 3AVGA 4UQGA 3OS2A 3HBTA 1K8AO 3I8DA 4BROA 2QEXN 1HJRA 4E19A 3VESA 5GAGP 3DLBA 3NVMA 1TAUA 2HOEA 1EO1A 2H3GX 1GLAG 4I6MB 3U9DA 2VG6A 4CF0A 4DLEA 1GLEG 4N76A 4GY2B 3AA4A 4FWPA 3VF2A 3I0RA 5C0YA 1ZC6A 2E2OA 1SL2A 2HHXA 1VHXA 3AA5X 3H3OB 2W42A 1SQKA 1RT2A 4NYFA 3AGRA 1S1VA 3LPUA 3FFIA 2RKIA 3QB0A 2HSTA 3GG4A 5AFUA 3RMCA 2XRIA 1C1CA 2AA4A 3ZLJA 5AJ3K 5AFUH 3IDHA 3MXJA 2D4WA 1U49A 3S3NA 1L3UA 4K43A 1KFDA 5EY4A 1VQLN 1WSJA 3PLAA 5KRTA 1ITGA 3QBXA 4NCAA 2VYPA 2OANA 2DFFA 2DTUA 4C8KA 4E1NA 4ZTFA 2GV9A 2A1RA 4KHQA 2HVIA 1HPZA 4CESA 3U3GA 4GNIA 3DM2A 1FK9A 2P1JA 2HNZA 4ISGA 1U04A 3KJVA 3CQXA 3DRPA 4BRFA 4J2DA 3NGYA 1T3VA 3D2EA 4AHSA 2BANA 2RHKA 4CECA 4WQ5C 3QMLA 3J80O 3ZSRA 2ZJPL 4CEEA 2QWQA 4ICLA 4KTWA 5AQXA 1NK0A 4CJ5A 4LFBK 2HF3A 1HNZK 2V51B 5BPLA 2HNDA 3AVBA 4MDBA 3HZ6A 4CZGA 4ELUA 4AHUA 1TUYA 3T69A 1C0GA 3T1HK 4LFAK 4H0YB 1RCHA 2CGJA 3BZCA 3I0SA 3SPYA 1QVFM 3VGLA 1BIZA 1WSGA 3VQBA 2X78A 3CJ1A 3CIPA 4DTJA 5AQMA 4JNEA 4BY9C 4H0TB 4FOIA 4M7XA 2ITMA 3M6GA 4BG9A 1L3VA 3SAHA 4JHDB 1T8EA 3LWMA 4JI7K 2G8VA 1P8ZA 1SV5A 1WSFA 1QHTA 4AH9A 2F8TA 3E1YA 4J2BA 1QQNA 2UUCK 2P9KA 1UWBA 4FJXA 2E2QA 3UB5A 4CHOA 3HK2A 4IFEA 5C2DA 3O4NA 3OBWA 2P9KB 3ULEA 4EHUA 1X9SA 4E7HA 2YV0X 1SZ2A 2R7YA 4DSLA 3G4SN 5M1PA 3PX4A 1BCOA 4GKKK 3MWPA 3QEIA 1IKWA 1HPMA 4JHDA 2KQ2A 4NB4A 4GVMA 1RDDA 1BWFO 2ASPA 2QWMA 4CJEA 1EETA 2EX3A 3OBYA 4CBWA 3VGKA 3CM6A 1G15A 2O4IA 3ID8A 1LV5A 3AVHA 3ZEUB 1EQYA 3MMVA 4EP4A 4KTQA 3S9HA 1VQ7N 4PQUA 2X74A 4YNQA 1TK5A 2YHAA 4B1YB 4HCBA 1V4TA 3O9UA 4AHTA 1IG8A 4W5RA 5AR0A 3SMPA 1JL2A 3CFPA 4BRNA 4LC9B 4WQ4A 3GL1A 4H8KA 4E1MA 1ZBFA 3V9SA 3IKMA 1D4XA 4IOCL 3AY9A 4CK3A 1JLEA 4FJGA 3SQ2A 1FKOA 4YOVA 4CJWA 4FWOA 1L3TA 4Z4IA 1BHLA 5J2NA 3G6EN 3NF7A 1Y64A 2G8WA 4DTMA 3FZMA 4LY7A 4RW7A 4B9NA 1GLFO 3CF5L 4JK7A 2BE2A 3SJHA 3DLKA 4CGHA 5DMRA 1U4BA 3C7NA 2FF3B 1HX1A 4FVUA 4E0DA 2BDPA 1MU2A 3HPOA 4JKGA 3EYZA 4KHSA 3WXLA 4CI6A 3NF6A 4CIFA 4CZLA 1ASUA 1YVUA 1UOCA 2ZE2A 4CZEA 4DR4K 1JKHA 1K9MO 3OYGA 3BF1A 1RDAA 3VQ8A 1VSLA 2P5GA 1HKCA 4GV6A 5M1NA 3QNNA 3THVA 4FLZA 1YJNN 4WQ5A 3QEVA 5GAHP 3QEPA 1DGKN 3WNHA 3CHWA 3E9PA 3OYMA 4OJRA 1H1VA 1HRHA 2NRZA 1R59O 2VWBA 4MLEA 1NJWA 4BDPA 2ETJA 1BG3A 1X3MA 3HOSA 4BQZA 5KPZA 1ASWA 4BRIA 3AO4A 4HUFA 3R8EA 4BC3A 5KPRA 4FLVA 3V9XA 2FBVA 1RTJA 2G8FA 2ASOA 4CK1A 1TUUA 1MWMA 2P9SA 5KGWA 4CZKA 3IG1A 1OH5A 1KFSA 3MX2A 2XY7A 4DKWA 1C0TA 3WUHA 1SKRA 1RDCA 4DFKA 1IG9A 4K0KK 3WXMB 4FK4A 5JS1A 4ID1A 5AQIA 3P39A 3RSEB 3FR0A 5J2MA 4N5SA 4BRDA 4AQYK 1S72N 5AQZA 3D6RA 3LANA 1E4GT 4BDZA 1VQKN 2IIRA 3K58A 2KFZA 3G0ZA 5LMUK 1JLCA 4DFJA 3M8QA 3I33A 4BE2A 2Q0RA 4LFCK 4F3TA 3CG7A 3GOIA 3QETA 5E84A 4WFNL 3SYZA 4OPJA 4BRLA 3M8PA 2RE2A 4DU3A 1KD1O 1T6DA 2QXFA 1WAJA 3AAQA 4JI6K 1NOYA 2XHBA 2VGMA 3VQ5A 4OKJA 1BGXT 3MAQA 4BACA 3D7EO 4BR0A 4CF8A 2Z1JA 3VQ7A 3MECA 3CPWM 1CZ9A 2NRHA 4CBXA 3VEYA 3F9MA 2CH6A 4LF8K 4E7LA 4E3SA 1Y97A 1N34K 1BIUA 3LZJA 2PYJA 1UA0A 3V9WA 1VSEA 3GBTA 1HMVA 4JS4A 3U8XA 3TR8A 3IUCA 3CFRA 3CC2N 4BRHA 3K59A 4Y1DA 1MA9B 3O80A 3VA0A 5AQUA 3L2VA 5F2RA 3OS1A 4JLHA 4JKEA 4KV8A 4B3SK 4NO7A 1KAXA 3TAQA 1T05A 1B9DA 5M1KA 2B4JA 3FLCO 2JWLA 4OLBA 5HRPA 4FSVA 1M90O 1J5EK 1XMOK 1X9WA 3P4IA 1EWQA 3WXKA 1GLBG 3LM9A 3J7YP 2UU9K 1XNQK 3OJUA 3VEVA 1LW2A 1C1AA 4B9VA 5TKWA 4OKKA 3KLEA 4DQQA 3L2UA 4GKJK 1TKTA 4XIUA 4IEEA 3O9TA 4JD2B 1K8KB 1ASVA 4O8UA 2DFEA 3J81O 4JKHA 2O8EB 3TABA 1J53A 3OA9A 3K9KA 2YNHA 4BE1A 3EZWA 3QEXA 1R0AA 4CE9A 3DLRA 4FJMA 3H6EA 1X9JA 5CYQA 3CC7N 2Q0UA 3C95A 1D9FA 5FPMA 4N56A 4H5WA 1QHAA 4CJPA 3D0PA 1S1TA 4H4MA 2HHHK 4MQ3A 5AQVA 4IFVA 1IBMK 3C6UA 4B1WB 1JJ2M 4BRAA 1KAZA 5HOOA 1QE1A 3MEGA 3FE1A 1MDUB 2IOCA 3AVKA 1WUAA 1E4FT 3DRRA 3SUQA 3UKUA 2YCHA 1JCEA 2RF2A 2DFHA 4OO1J 3HSTB 4DV1K 3LALA 2HHUA 1V4SA 1CXQA 1TGOA 3B8AX 5HP1A 3MN5A 4A59A 3L0QA 3TPQA 1BCMA 4W5TA 3NAEA 3CFOA 1BISA 3D2FA 2QA4N 4DQIA 4DHYA 2QTDA 2KZZA 3C0BA 3HPHA 2HBMA 4AHRA 1XQSC 4O44A 2O8DB 4EZ9A 4DMNA 1NLVA 4JI4K 4LF6K 3TSQA 4AF1A 1NJZA 1JCFA 1FKPA 3NCIA 1SUQA 2P5OA 3HVTA 3LP0A 5AQKA 1VSDA 4X65K 3AA2A 3AO3A 4E7KA 1D5AA 1NGDA 2GWJA 3NGZA 3OYEA 4IKFA 2E5LK 5HLFA 3OJSA 3A5MC 1VQMN 5JMVA 5A2QO 3N4PA 4KTZA 4CVNE 2NRWA 1WSIA 2NRRA 1YUWA 4DSFA 2HHSA 3O4WA 1HNVA 4RW9A 4CEOA 3JAMO 4CEQA 4N47A 3HYFA 4I2PA 2OZMA 3RMAA 3LDNA 1VRUA 3ZT1A 4H4OA 1TL1A 3R6MA 3CM5A 3LP1A 3O4QA 3VQEA 2F7TA 1A5XA 4OPAA 3WNFA 1J9AA 5JLFA 1RTHA 5CYMA 4DF8A 2OCEA 3THYA 3LM2A 1WLJA 5AQNA 1DLOA 2YHYA 3D45A 4J2AA 4B3OA 3VF6A 3OYIA 4HWIA 3DXMA 5GAEP 5C15A 4X66K 4JAXA 4G9ZA 3SI6A 5SZTA 4FWKA 4CZHA 1YJ9N 3BEXA 3I8BA 3Q7CA 2QWLA 4JKDA 1IKYA 1EWRA 2OZSA 3H1QA 1KC8O 1S1XA 4DR6K 5CZ1A 3RR7A 3ULEB 3CCRN 2QI2A 1M1KO 1VRTA 2UXDK 4BRMA 4X64K 3EE8A 1KQSM 3WNGA 5C24A 4C1NK 4CZMA 1IKXA 2P9UB 4KRFA 3KWIA 3DJCA 5BRHA 3M5RA 4GW6A 4A57A 3CCSN 3VGMA 1Q7YO 3LDPA 1RT1A 4IO9L 3T19A 3VQ6A 4IJNA 3ENHA 1FJGK 3R9PA 5FPNA 4CGJA 1T7PA 4KHWA 1IKVA 2Z1IA 4BR7A 2DY4A 3NH0A 4BWMA 4B8CA 4FJHA 2QWPA 4CZIA 3CJCA 3SUPA 4WFAL 1XC3A 2O8BB 2PBDA 4C8LA 3MN9A 4CJUA 3I55N 3DXKB 3C6TA 4FO0A 3ZX2A 3L4IA 4E1JA 4CIEA 1TKDA 5E26A 3FZHA 4BGAA 3P1GA 3CMAN 4FK2A 4DFMA 1JLFA 1N36K 4W5OA 1XHXA 3A8YA 3O1BA 3RVCA 4BC4A 2UUAK 2VCPA 4YY3K 1RFQA 4JEPA 4DQPA 1DT9A 4KH6A 3EN9A 4X62K 5C10A 1CZAN 1KLMA 3V1RA 4H5NA 1IH7A 1YITN 4XH1A 4H0OA 1J6ZA 3EO3A 4F3OA 4AILC 3SAFA 4EAHD 4FJ5A 3CCQN 3TAGA 1GOCA 1TL3A 3EEQA 1NGBA 1XI1A 4J2EA 1UA1A 3QIPA 3K5MA 3MEEA 2X6NA 4M3TA 1LWCA 4IBNA 3QNOA 2EWSA 4JKAA 2G8UA 3ALYA 1ZBUA 1QZ6A 1BL3A 2D0AA 2IC3A 3O5BA 5AQSA 2HHTA 1I3AA 3MWTA 4IG0A 2Z1GA 3KLGA 1K73O 3HRGA 3H1VX 2E88A 4BVPA 2O8CB 4DWIA 1VQ4N 1BA1A 4FLXA 5J2PA 4A5BA 1I94K 1ZXOA 1HR0K 4JKCA 4W5QA 1IO2A 4BRQA 3PIOL 2GUPA 3S3MA 4CEAA 4LF4K 3K9JA 3DMJA 3NH2A 5KTQA 5FPDA 3SJJA 3OYFA 1U2VA 2F4VK 1NGJA 1WSHA 3NF8A 4KFBA 2NRXA 5AQWA 2ZM6K 4YDUC 4LSNA 1BQMA 1DKGD 1HJOA 4HCCA 3CJAA 4B3TK 2YKMA 4CJ4A 4CHPA 3WEEA 3T3FA 3M1FA 2JWKA 4B1UB 5FLXO 4PL7A 3UKRA 4M3RA 1YTUA 3VQQA 2CGLA 4CEFA 3EKUA 4YORA 4JV5K 3JS6A 1XWLA 4C8MA 3FFKB 5AQQA 1HKBA 1N8RO 4FZXC 3R3LA 5TKYA 2EHGA 1HYZA 5BN8A 4EHTA 4CF1A 4QS9A 3OW2M 3VENA 1KVAA 4FVMA 4PL8A 4MO4A 2E1ZA 3AVNA 2HMIA 2FC0A 2KHOA 4BC2A 4LSLA 3MN6A 2YHWA 3LDLA 4RTFD 3KHYA 5CHIA 3TARA 3FZLA 3UKRB 5LJWA 2O8CA 3MCPA 2GTDA 3VQPA 4DCHA 1RT6A 4QCLA 1N5YA 3Q7BA 3TANA 1LW0A 3AGKA 3LAMA 1RGIA 3F2KA 1VSFA 1JLQA 1YTAA 4ILGB 1TYQB 4WFBL 4IO8A 3WQTA 3E66A 4DSKA 2E6LA 1BU6O 2P9IA 3DYAA 3QLHA 4EZ6A 3F9KA 2D0OA 4ELTA 3F5TA 5BPMA 1QVGM 4JI0K 5EXWA 4NLBA 3CPEA 3LP2A 3L6QA 3WNEA 4PY5A 2JLEA 4CJQA 2Q1NA 4QAGA 2VQFK 4BGBA 3THWA 3BY5A 3FZKA 2D0CA 2PFUA 1ZBHA 4CJKA 2BGGA 1P90A 3ZSZA 4C1NI 3K5NA 2ZQBA 2VWJA 5DK5A 4DTNA 2GBZA 4H5VA 2F96A 4DQRA 4ISFA 4R5PA 4OX9K 1HNIA 5ADXA 1VQ8N 4F4KA 3TTFA 4CD3A 2ZGYA 3AVCA 2YKNA 3IRXA 2FSJA 2Q2RA 4Y0WA 5LY3A 3RTVA 1YJWN 1WOQA 3ZYYX 2YHBA 4YOWA 4DLGA 3U3YA 1KTQA 4FCYA 3TI0A 4JI5K 1IV0A 1KAYA 4BRKA 2W41A 3TWHA 1RBVA 3LDQA 4OVLA 4FZZA 3C65A 2O8BA 4M42A 3VEXA 4ID5A 4CJ3A 2A6AA 2UXBK 2AP1A 2XY8A 2IDOA 3OYDA 2QKKA 1RTDA 1Q81O 1C0UA 3ENBA 3PO4A 3KIOA 4IFYA 4CJRA 1QS4A 2UYTA 2QKBA 3DOLA 2ZWHA 1YI2N 4K8XA 2Z1HA 2KFNA 4KI6A 1QQMA 3AVFA 1NJIO 3CCJN 4FLYA 2HVHA 1B92A 4B8AB 1RILA 3SMSA 1HYSA 5BR9A 1JXBA 1HYVA 4YOTA 2A3ZA 3VTIA 2W6LA 2QK9A 3HI0A 4RW4A 1S6QA 1TAQA 3OYKA 3ZT4A 4PKHA 1RT5A 4JI1K 1NMNA 4CERA 3HVRA 4FWMA 2HHWA 3VERA 3B6OA 1OVYA 1Z25A 2NUBA 3AVMA 4EFHA 3VF4A 1KRPA 2NLXA 4K25A 1ATNA 1GLJO 3CC4N 2HBKA 1DTTA 3TTDA 2FSNA 2XO7A 5KPTA 4XEIA 1RDWX 4DV7K 4RWTA 3TU5A 4FPAA 1SL0A 2ZGZA 4FLWA 5BPNA 3G71N 1RT7A 1NGEA 5EU7A 3SV3A 1O1WA 4FM1A 4BG8A 2NNWA 2A42A 4DTXA 4F2SA 4RCHA 4LH4A 3BGRA 3CQYA 3K0SA 4BWJA 4NXNK 4FLUA 2KTQA 4CEDA 4CEBA 2FSKA 3U9ZA 4A5AA 4CIGA 4KPYA 1U6ZA 5BN9A 3ZSXA 4H0PA 2Y1IA 3MDQA 1S3XA 4DTPA 1ZBLA 3SBGA 1TV6A 1O13A 3L3VA 3CCEN 4CF2A 3OYNA 1NBWA 3KKSA 4WE1A 4FW1A 1WBDA 3VEWA 3THWB 4IDKA 2ITGA 4AHCA 4B08A 2OTLN 5KGXA 4DQ8A 3T1YK 4L8RB 5LL6Z 2YJEA 1VSKA 2KKZA 3AVAA 4MLHA 3RMDA 5GIPA 1Z26A 3HTVA 4B1XB 5T7BA 2AJQA 1XNRK 2P9LB 3L2RA 2O8FA 3SNNA 2X6SA 1VSHA 3J7ZO 2YNFA 2W40A 1ZBIA 3KK7A 3O8MA 4CBUA 3ATUA 5E41A 4KHUA 3BUZB 4KB1A 4HVJA 5FRMA 2E8AA 1EX4A 1YIJN 2F9TA 1Q82O 1NJYA 5JS2A 4Z4EA 4O5FA 1QTMA 1SL1A 1C0FA 3CCMN 1C1BA 3R1XA 1Q9YA 4BC5A 2P9PA 4Z4GA 4B9QA 3KK1A 1W9HA 1X9MA 2JGUA 4I6MA 4O0IA 3LAKA 3DOKA 3IMXA 1GLDG 4CFAA 5IWAK 3KK2A 1NOZA 3F73A 4E7JA 3MK6A 4O0JA 1ILYA 3ZSVA 5I9EB 4B9MA 3G25A 3FGUA 1NK6A 4IJAA 1NWKA 1NK7A 3SAGA 1ZBSA 3MCAB 4DSIA 4DTUA 4K41A 5GIOA 1NGHA 1TK0A 3K5OA 4DU1A 1NGFA 4KAZA 3EZ5A 4IXCA 3HM8A 4H03B 2YNIA 4FM2A 1YT3A 4KHYA 3W0LA 1OH8A 3DLGA 1Z6RA 5B8HA 1LWEA 3PSFA 3MX5A 4LH5A 5BRFA 3QEWA 1RTIA 5DM7L 4YFUA 5H1SQ 1A5VA 4YOUA 1S1WA 1GLCG 4CJ7A 1X1PA 5C42A 4DG1A 4IZ9A 5BREA 1RDBA 1TKXA 4JRQA 5JVGL 5HROA 1D9DA 3VQAA 3OTOK 1DEJA 1N32K 3HP9A 1SAZA 5J2QA 1X3NA 3P31A 1KCFA 3AVJA 1ATSA 1WN7A 4LF5K 5CE3A 3C6HA 2WC9A 5HRRA 5AQYA 1GOAA 5HL7L 4M3WA 4NYNA 2E1YA 1SKWA 5SWMA 4CHQA 4C8OA 1RT3A 1E3MA 4FOEA 1NM1A 1HQUA 5I3UA 1JLGA 4PUOA 3TAMA 3JXUA 3AO1A 4LD0A 1VK0A 4O5BA 4M3ZA 4KHPK 1XC9A 4DV0K 3CXCM 2WBNA 4DTSA 2FLOA 1CLQA 4BRCA 2VQEK 5AZJA 2WUSA 3ZEUA 1OKJA 5C12A 3ASMA 2QXLA 3VQ9A 4Z94A 3RSEA 5C2FA 3CJBA 4JN4A 3TAFA 3VEZA 3IAYA 2G8HA 3UIQA 4M3YA 4YOXA 2DPNA 1QZ5A 3IFRA 3ZCMA 4EIAA 3WEEB 1ATRA 3ZX0A 1S22A 3KD5E 4JK9A 1WAFA 3OYBA 2IVPA 4PWDA 3LPTA 2O8DA 4NLCA 4DV6K 1A5WA 3L4QA 3AVIA 3O3HA 5D3GA 3CJ9A 3HT3A 3V9ZA 2IGIA 3CCUN 3V1QA 1TVRA 1S6PA 3O6WA 5F1XA 4CHYA 1VSMA 2V7YA 4QS7A 1GOBA 1JXEA 3RR8A 3H45C 3SLCA 1RDUA 2D1KA 1KXPA 4M63C 1EKEA 4IOAL 1SS6A 1XHZA 4PKGA 2P9NA 2UUBK 3KTQA 2FBTA 3EY1A 1RT4A 3JYTA 1JLAA 5M1OA 2QWOA 1K8KA 4DS4A 1NJXA 1LWFA 4BR4A 3CCVN 3P38A 1U48A 3DLLL 3SCXA 2V7ZA 2VGNA 5AZJB 3THYB 4CGDA 1HLUA 4F8RA 1S1UA 4PHTX 4CFCA 1VSIA 3H08A 3RRHA 1OH6A 3ID6A 2P9LA 2O8FB 2A41A 3PV8A 2V52B 1J5OA 1S5JA 1NKEA 3NFAA 1OVQA 1SKSA 4CGGA 4MDAA 4M3UA 1FXXA 4CCHA 3M8RA 4CGIA 1U47A 3KLFA 4FJLA 2F8SA 1S9EA 4ILJA 4OKEA 1XMQK 4JKBA 2E4LA 4CF9A 5LMNK 4A2AA 4FWLA 3M3ZA 2I7PA 4BRGA 1VQON 3JSMA 4JKFA 5J1EA 3TSUA 2HBLA 4YDUA 4PA1A 2W6KA 4KI4A 3B6PA 3A5LC 3LP3A 3SQ4A 2GEMA 2NZTA 4U67L 2HHVA 3E9LA 4YOYA 2GX9A 1QQCA 3CD6N 4W5NA 5IT9O 2VWKA 4BE0A 1DTQA 4HUEA 3QERA 4HUGA 2O4GA 4KBOA 2Q31A 5I42A 3ZT3A 4ZHRA 3KK3A 3A0IX 3ZT2A 4JYAK 2HW3A 4DV4K 1HQEA 4EP5A 3OYHA 3ZSYA 3E01A 2WONA 2QWNA 5AQHA 4DSJA 4C23A 4B9SA 2Q97A 3VETA 5C25A 3RRGA 5FPEA 1WB9A 3C6AA 4OGEA 3CMEN 4LF7K 1BI4B 3TAEA 5DM6L 3UKUB 4BVOA 3U6FA 3AA3A 2KW4A 3ZETB 4I9LA 5MLCQ 3A5NC 3VQ4A 3ULDA 3HL8A 3PY8A 2CH5A 3V6DA 3D2FB 4FWNA 1KVCA 2B6AA 4DFPA 3DLEA 3LDSA 4E89A 3C94A 3MN7A 1LAWA 3K57A 1L5UA 4CZJA 5M1FA 1HNXK 4OPHA 4PKIA 1NK4A 3IS9A 2CGKA 2J4RA 5AQPA 4QS8A 4Y1CA 3KWGA 1CZBA 5AQOA 1YF5L 4CD1A 4NCBA 4H0XB 4IOXA 1EXQA 2A40A 4XH5A 4DR3K 2NRTA 4FYDA 4IDHA 2HNYA 3VN5A 3QESA 3L3UA 3MXIA 1YVNA
chains in the Genus database with same CATH topology
3CC7N 3HBTA 1NGGA 1K8AO 4BROA 2Q0UA 3O9QA 1VQKN 5FPMA 2QEXN 4H5WA 3VESA 1QHAA 4PKHA 5AQRA 4XH4A 5GAGP 3LDOA 3NVMA 4FWMA 2HOEA 5AQVA 3VERA 1OVYA 1GLAG 2H3GX 4I6MB 3U9DA 4B1WB 3H46O 1EO1A 4EFHA 3U4LA 4BRAA 1KAZA 5HOOA 3VF4A 1JJ2M 3AAPA 2NLXA 1MDUB 3FE1A 4K25A 1N8RO 1GLEG 1E4FT 1WUAA 3EKSA 1ATNA 4GY2B 3UKUA 1GLJO 4A62A 2YCHA 4FWPA 1JCEA 3VF2A 3CC4N 4DB3A 2HBKA 1ESVA 5C0YA 1ZC6A 2E2OA 3TTDA 4OO1J 2FSNA 3H3OB 3TTCA 1SQKA 5KPTA 2P9SB 1V4SA 1MWKA 3B8AX 1RDWX 4XEIA 3AGRA 4RWTA 1QQOA 3TU5A 4FPAA 3MN5A 3QB0A 2HSTA 4A59A 3GG4A 5AFUA 2ZGZA 3CERA 3L0QA 5AQTA 2AA4A 3TPQA 5BPNA 3G71N 3QDKA 3D2FA 1NGEA 2QA4N 5AFUH 3IDHA 4DHYA 2D4WA 2QTDA 3C0BA 3VPZA 2HBMA 1XQSC 4FWSA 1NMDA 4BG8A 2NNWA 1NLVA 4K43A 2A42A 5EY4A 3TSQA 3VOVA 4AF1A 1VQLN 3O1WA 4RCHA 1JCFA 5JICA 3PLAA 3CQYA 3DWLA 1HKGA 3QBXA 2VYPA 2OANA 4J8FA 5AQKA 3WXIA 2FSKA 3U9ZA 4A5AA 4HTLA 5EX5A 4GNIA 3SBTA 2YJFA 1U6ZA 1NGDA 5BN9A 2GWJA 4H0PA 3MDQA 1S3XA 5AQJA 1VQMN 3A5MC 4ISGA 5JMVA 3N4PA 1TYQA 2NRWA 3CQXA 4BRFA 3SBGA 2NRRA 1VQ9N 3I56N 1O13A 2WFBA 3CCEN 1T3VA 3D2EA 1YUWA 1NBWA 2RHKA 3FZFA 4WQ5C 3VEWA 3O4WA 3QMLA 2QW9A 2ZJPL 1BA0A 3ZETA 2QWQA 2YX6A 2OTLN 4DQ8A 3CI5A 4FWQA 5AQXA 4JK8A 1T6CA 2HF3A 5LJVA 2YJEA 2ZJRL 2KKZA 4M7YA 4MLHA 3VTHA 5GIPA 2V51B 5BPLA 3LDNA 4A61A 3HTVA 4B1XB 4MO5A 4CZGA 4MDBA 3HZ6A 3R6MA 2P9LB 1TUYA 3T69A 2F7TA 3J7ZO 1C0GA 2W40A 3S41A 4OPAA 3KK7A 4ISEA 3O8MA 5EOYA 5JLFA 4CBUA 3ATUA 4H0YB 3LM2A 3BUZB 2CGJA 5AQNA 2BH1A 2YHYA 2E8AA 1QVFM 3VF6A 1YIJN 4HWIA 2F9TA 3VGLA 3LL3A 1Q82O 3DXMA 5GAEP 5C15A 4JAXA 4G9ZA 3CJ1A 3CIPA 4O5FA 1YJ9N 4FWKA 4CZHA 2A5XA 5AQMA 3BEXA 4JNEA 4WQ4C 4BY9C 4H0TB 3I8BA 3Q7CA 2QWLA 4FOIA 4M7XA 1C0FA 4JKDA 2ITMA 3CCMN 3M6GA 4BG9A 1VQ6N 4ILHA 3SAHA 4JHDB 3R1XA 3H1QA 2KLAA 4BC5A 2P9PA 2E2NA 4B9QA 1KC8O 5GINA 1P8ZA 3E1YA 4I6MA 1QQNA 3IMXA 3ULEB 3CCRN 2P9KA 1GLDG 1ILYA 2QI2A 2E2QA 1M1KO 3EE9A 3MK6A 3UB5A 3CCLN 5I9EB 2P9IB 4BRMA 4WCEL 3EE8A 1KQSM 3G25A 3FGUA 4C1NK 4IJAA 4IFEA 1NWKA 5C2DA 3OBWA 2P9KB 4B1ZA 3SAGA 3ULEA 4EHUA 1ZBSA 3MCAB 4CZMA 3WT0A 4K41A 1SZ2A 2P9UB 5GIOA 1NGHA 3G4SN 3KWIA 5M1PA 3DJCA 2HBJA 5BRHA 3MWPA 3M5RA 1NGFA 1G99A 4IXCA 3HM8A 2FF6A 1HPMA 2P9NB 4H03B 4JHDA 4BQLA 4A57A 3HOTA 4NB4A 4AM7A 3CCSN 1BWFO 3W0LA 2ASPA 3VMFB 2QWMA 3VGMA 4R79A 1Q7YO 3LDPA 1Z6RA 3OBYA 5B8HA 3VGKA 4CBWA 4IO9L 4IJNA 3ENHA 1HUXA 3MX5A 5BRFA 3R9PA 3ID8A 3HSCA 5FPNA 3WQUA 5DM7L 3QFPA 3OHRA 1EQYA 3ZEUB 3MMVA 4WYBA 5H1SQ 1LOTB 1VQ7N 4BR7A 4YOUA 4WF9L 1JCGA 2QWPA 4A2BA 4CZIA 3CJCA 1GLCG 4WFAL 4B1YB 1V4TA 3O9UA 1IG8A 4K42A 4CJ7A 4CZFA 1XC3A 5AR0A 3SMPA 4BR5A 2PBDA 4IZ9A 3MN9A 5BREA 3NMUA 4BRNA 4LC9B 4WQ4A 3C7NB 3I55N 5JVGL 3DXKB 3GL1A 1DEJA 4FO0A 3ZX2A 3L4IA 1SAZA 3IKMA 4E1JA 1X3NA 3P31A 3A5OC 2GWKA 5E26A 1D4XA 3FZHA 4IOCL 1ATSA 3AY9A 4BGAA 2YHXA 5CE3A 3CMAN 3C6HA 2WC9A 5AQYA 3A8YA 3O1BA 3O9RA 2YI1A 5HL7L 4YOVA 4FWOA 3RVCA 4BC4A 2VCPA 1RFQA 4JEPA 2E1YA 1DT9A 1NGCA 1U2VB 3ENOA 4KH6A 3G6EN 3EN9A 1Y64A 5C10A 2GELA 1CZAN 4FOEA 2OTJN 1NM1A 4GV3A 2E2PA 3FZMA 1GLFO 3CF5L 5KQDA 4H5NA 1YITN 4JK7A 3TSPA 4XH1A 3SJHA 3C7NA 3JXUA 1J6ZA 2FF3B 4H0OA 3EO3A 1HX1A 4KH4A 2QWRA 4AM6A 4FVUA 3SAFA 4EAHD 3N4QA 3CCQN 4JKGA 3QBWA 3DAWA 1NGBA 3WXLA 2NRVA 4CI6A 4BR2A 3CXCM 2WBNA 2FLOA 4BRCA 4CZLA 4CZEA 5AZJA 2WUSA 3ZEUA 2D0PA 2EWSA 1OKJA 5C12A 1K9MO 4JKAA 3BF1A 3CJ7A 1VQPN 2QXLA 4Z94A 5C2FA 3RSEA 1HKCA 4GV6A 3CJBA 4JN4A 1QZ6A 5M1NA 3VEZA 1YJNN 4H5TA 4WQ5A 3O5BA 5AQSA 5GAHP 4YOXA 1DGKN 3MWTA 2DPNA 1QZ5A 1GLLO 3IFRA 4EIAA 3CHWA 3HRGA 1K73O 3E9PA 3H1VX 3WEEB 2E88A 4BVPA 1VQ4N 1BA1A 1ATRA 1S22A 1H1VA 3ZX0A 2Q36A 1LCUA 2NRZA 4JK9A 4A5BA 4BREA 1R59O 1ZXOA 2VWBA 4JKCA 4MLEA 1Q86O 1Q18A 2IVPA 3NVKA 1BG3A 4BRQA 1X3MA 3PIOL 4FWRA 3HOSA 3QFUA 2GUPA 5AQGA 4BQZA 1YXQA 4NLCA 5KPZA 3K9JA 4BRIA 3L4QA 5FPDA 3BP8A 1U2VA 3CJ9A 3R8EA 4H0VB 3CCUN 1NGJA 3BF3A 3EL2A 4BC3A 3O9SA 5KPRA 3O6WA 5F1XA 2NRXA 5AQWA 4YDUC 2V7YA 2ASOA 1DKGD 1HJOA 4QS7A 3CJAA 5KQ8A 1TUUA 1MWMA 2P9SA 4CZKA 3AARA 3H45C 2P9PB 3SLCA 1RDUA 2D1KA 1KXPA 2BTFA 3WEEA 4M63C 3MX2A 5AQFA 3M1FA 4IOAL 2JWKA 4DKWA 1SS6A 4B1UB 4PL7A 4PKGA 3UKRA 2P9NA 3WUHA 3T7ZA 3O08A 3WXMB 2CGLA 2BUPA 3EKUA 5AQIA 3P39A 3RSEB 3FR0A 4YORA 5M1OA 4BRDA 2QWOA 1K8KA 3JS6A 3PIPL 1S72N 3FFKB 5AQZA 3D6RA 5AQQA 1HKBA 1E4GT 4BR4A 3CCVN 2IIRA 3P38A 3R3LA 5TKYA 5BRDA 3DLLL 5BN8A 2V7ZA 2VGNA 5AZJB 4EHTA 4QS9A 1HLUA 3OW2M 5AZIA 3VENA 4O8KA 4PHTX 4PL8A 3I33A 4MO4A 2E1ZA 4FL9A 1XUPO 2Q0RA 1VQNN 3ID6A 2P9LA 1VQ5N 2A41A 2KHOA 4BC2A 3KVGA 3GOIA 3MN6A 2V52B 5E84A 1W2BM 2F9WA 2YHWA 3LDLA 4RTFD 4WFNL 3KHYA 5CHIA 3FZLA 4BRLA 2RE2A 5F0XA 3UKRB 5LJWA 1KD1O 1T6DA 3MCPA 2GTDA 3AAQA 4MDAA 4DCHA 2VGMA 2I7NA 3J8AA 2FXUA 3Q7BA 4FPBA 4U7BA 3ZX3A 3AGKA 3D2EB 1RGIA 4ILJA 3E9OA 3F2KA 2P9UA 1NGAA 3D7EO 4BR0A 4ILGB 1TYQB 2ASMA 2HMPA 4JKBA 5GADP 4WFBL 3CPWM 4A2AA 4IO8A 3WQTA 3E66A 2NRHA 4FWLA 4CBXA 3M3ZA 3VEYA 3F9MA 2CH6A 4B1VA 2P9IA 1BU6O 4BRPA 2I7PA 1Z05A 4BRGA 1VQON 2D0OA 2ZJQL 3F5TA 4JKFA 4JKGB 3TSUA 2HBLA 5BPMA 1QVGM 2PAVA 4YDUA 5EXWA 4NLBA 3A5LC 3CPEA 5EVZA 3GBTA 3L6QA 2GEMA 3U8XA 2NZTA 4U67L 1BOTO 1W97L 2IVNA 3DXKA 3H3NO 3IUCA 3CC2N 4BRHA 3E9LA 2Q1NA 3QICA 4IEIA 1MA9B 3ATVA 4YOYA 4H5RA 2GX9A 3O80A 4GV9A 4UY8O 3CD6N 4BGBA 3FZKA 2PFUA 5JVHL 5AQLA 5AQUA 1P90A 4C1NI 2IVOA 2Q31A 4KBOA 5F2RA 4JKEA 3A0IX 4H5VA 4NO7A 5JLHA 1KAXA 4ISFA 5M1KA 5ADXA 2QWNA 5ELZA 4F9OA 1VQ8N 2QM1A 3FLCO 5AQHA 1YHQN 4C23A 3TTFA 4CD3A 1T44A 2JWLA 2ZGYA 2Q97A 4FSVA 3VETA 5LY3A 2FSJA 2Q2RA 4Y0WA 5FPEA 1M90O 3C6AA 1YJWN 4KH5A 1WOQA 3CMEN 3P4IA 3ZYYX 3WXKA 4YOWA 3GE1A 5DM6L 1GLBG 3LM9A 3UKUB 1KAYA 4BRKA 2W41A 4BVOA 3LDQA 1YAGA 3VEVA 3ZETB 3C65A 5CR4A 5MLCQ 3VEXA 3A5NC 3UE5A 3W3DA 2HF4A 5TKWA 1BDGA 2A6AA 1NGIA 2AP1A 3WXJA 4BR9A 2CH5A 5ADXH 3GDQA 3KZBA 3D2FB 1IJJA 1Q81O 3ENBA 4FWNA 5AZIB 4IWVA 1VAZA 2ZF5O 3O9TA 4IEEA 3MN7A 4CZJA 4JD2B 5M1FA 1K8KB 2UYTA 4OPHA 4PKIA 2ZWHA 4O8UA 1YI2N 1BUPA 1QQMA 1NJIO 2CGKA 3CCJN 2J4RA 5AQPA 4QS8A 3SMSA 4JKHA 3KWGA 3VEOA 3SK3A 3CETA 3OA9A 5AQOA 1YF5L 4L3QA 4CD1A 4H0XB 4IOXA 1BO5O 2E20A 4GVEA 5BR9A 3K9KA 2A40A 4YOTA 4XH5A 2A3ZA 3VTIA 2NRTA 3EZWA 4IDHA 3HI0A 3DXMB 5M1QA 1YVNA 4JD2A 3H6EA 1X9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YOT A;  4YOU A;  4O8U A;  4YOR A;  4YOX A;  5CHI A;  4YOV A;  4YOY A;  4YOW A; 
#chains in the Genus database with same CATH topology
 1NGG A;  3O9Q A;  4KO0 A;  2RN2 A;  5AQR A;  4DV5 K;  4XH4 A;  3LDO A;  4CJL A;  4KRE A;  3V1O A;  3ITH A;  3H46 O;  3U4L A;  3AAP A;  4DQS A;  3EKS A;  3SPZ A;  4A62 A;  4CJS A;  2PY5 A;  1BQN A;  4DB3 A;  1ESV A;  4CJF A;  3TTC A;  1NK5 A;  1N33 K;  2P9S B;  1MWK A;  1QQO A;  3QIO A;  2RPI A;  3KD1 E;  3CER A;  5AQT A;  2PZS A;  2XY5 A;  3CQ8 A;  3QDK A;  4CGF A;  5HRS A;  4DR1 K;  3LZI A;  4DUZ K;  3VPZ A;  4FWS A;  1NMD A;  3VOV A;  1QSY A;  3RMB A;  3O1W A;  5JIC A;  3DWL A;  1CXU A;  1HKG A;  3OYC A;  4FW2 A;  4J8F A;  4DS5 A;  1RBS A;  2LSN A;  3WXI A;  3OYA A;  4NXM K;  4DR5 K;  2UXC K;  4HTL A;  4Z0U A;  5EX5 A;  3SBT A;  2YJF A;  3PUF A;  3BZK A;  3QO9 A;  5AQJ A;  4C8N A;  2ZD1 A;  3SUO A;  1TYQ A;  1RBR A;  1VQ9 N;  1RNH A;  4B3R K;  3I56 N;  4DF4 A;  2WFB A;  1IBL K;  1QSL A;  3FZF A;  1NK9 A;  4RG8 A;  4CEZ A;  2QW9 A;  1BA0 A;  1W0H A;  2HB5 A;  2OPQ A;  3ZET A;  1EP4 A;  2YX6 A;  1N6Q A;  3CI5 A;  4FWQ A;  4JK8 A;  1T6C A;  1J54 A;  4FJK A;  5LJV A;  2ZJR L;  1K6Y A;  4M7Y A;  3RWU A;  3VTH A;  4A61 A;  2YNG A;  3SUN A;  4RW6 A;  4MO5 A;  3AV9 A;  4CJV A;  1C6V A;  4JRP A;  3S41 A;  4ISE A;  5EOY A;  4B9U A;  1UAX A;  1RBU A;  2BH1 A;  3LL3 A;  3LWL A;  2OA8 A;  1F21 A;  3PX0 A;  3OS0 A;  3HXM A;  1KVB A;  3NGI A;  2A5X A;  4WQ4 C;  3PSI A;  2D0B A;  1L3S A;  3DI6 A;  4LF9 K;  4FLT A;  1VQ6 N;  4ILH A;  1VSJ A;  3S3O A;  2KLA A;  2E2N A;  4DU4 A;  4NCG A;  5GIN A;  4CHZ A;  4Z4F A;  3DRS A;  3AVL A;  3EE9 A;  4FJ9 A;  3CCL N;  5HBM A;  2P9I B;  5CY4 A;  4WCE L;  4FJ7 A;  1WNS A;  1WBB A;  2P51 A;  4B1Z A;  3MED A;  1KSP A;  3NF9 A;  2Q3S A;  3WT0 A;  4B9L A;  4DTR A;  4G1Q A;  2HBJ A;  4V19 S;  2FBY A;  1G99 A;  2FF6 A;  2P9N B;  4BQL A;  3HOT A;  1NKC A;  4AM7 A;  4GMJ B;  4JI2 K;  2VG7 A;  2VG5 A;  2G8I A;  1TKZ A;  2FBX A;  3VMF B;  4R79 A;  4FJ8 A;  4FJJ A;  1HUX A;  2HHQ A;  4ELV A;  4OPK A;  3HSC A;  3ZT0 A;  3WQU A;  2IAJ A;  3OHR A;  3QFP A;  1C0M A;  4WYB A;  3VA3 A;  1LOT B;  4WF9 L;  1JCG A;  4A2B A;  4AHV A;  2I5J A;  5K14 A;  3AO5 A;  1T03 A;  4K42 A;  1NU0 A;  4CZF A;  3O3G A;  4JS5 A;  4BR5 A;  2A1S A;  1RBT A;  3NMU A;  3SQ0 A;  3C7N B;  3ZSW A;  5BR8 K;  1B9F A;  4BDY A;  1REV A;  1BI4 A;  3OVN A;  4CJT A;  3A5O C;  2GWK A;  4DV3 K;  1U45 A;  2YHX A;  4E7I A;  5FDL A;  3DLH A;  4ZTJ A;  3O9R A;  2YI1 A;  1JL1 A;  3KLI A;  1QSS A;  4JI8 K;  4DTO A;  1NGC A;  1U2V B;  3ENO A;  3CYM A;  3V9U A;  3PO5 A;  2GEL A;  4B3M K;  2OTJ N;  3NDK A;  4GV3 A;  2E2P A;  4DV2 K;  5CZ2 A;  5FRO A;  4OGC A;  5KQD A;  5KI6 A;  3TSP A;  4CFD A;  2XY6 A;  4AM6 A;  3J7A P;  4KH4 A;  2QWR A;  4CK2 A;  4HHT A;  3N4Q A;  1ZYQ A;  3M8S A;  3QBW A;  3O3F A;  2KZM A;  3DAW A;  2OPP A;  2NRV A;  3BDP A;  4BR2 A;  4F2R A;  3TAP A;  1Q9X A;  1LAV A;  2D0P A;  2ATQ A;  3SZ2 A;  3CJ7 A;  1VQP N;  2PYL A;  4H5T A;  4IG3 A;  4JI3 K;  1NNE A;  1GLL O;  2Q36 A;  4DR2 K;  1LCU A;  4BRE A;  3OYL A;  1Q86 O;  1Q18 A;  4DR7 K;  3HM9 A;  3NVK A;  4FWR A;  1D8Y A;  3QFU A;  5AQG A;  1YXQ A;  3NBP A;  3NH1 A;  3BP8 A;  4CHN A;  4H0V B;  3BF3 A;  3EL2 A;  4O55 A;  3L2W A;  3O9S A;  3HPG A;  1NG9 A;  5KQ8 A;  1KLN A;  1I39 A;  3AAR A;  2P9P B;  4RW8 A;  4FXD A;  2BTF A;  5AQF A;  4KHN A;  2O8E A;  3G10 A;  3T7Z A;  3O08 A;  3NHG A;  2IS3 A;  2BUP A;  4K8Z A;  4Q0B A;  4B9T A;  4FK0 A;  3PIP L;  3VQD A;  4O4G A;  5BRD A;  4M41 A;  5AZI A;  3THX B;  4O8K A;  4FJN A;  4FL9 A;  1XUP O;  3V4I A;  1VQN N;  1IBK K;  1VQ5 N;  3KVG A;  4KB0 A;  1W2B M;  2F9W A;  5F0X A;  2WTU A;  3P83 D;  4M3X A;  3KLH A;  4I7F A;  2I7N A;  3ISN C;  1WSE A;  3J8A A;  2FXU A;  4U7B A;  4FPB A;  1OH7 A;  3ZX3 A;  2OPS A;  1W7A A;  3D2E B;  3E9O A;  2P9U A;  1NGA A;  3HO1 A;  2WOM A;  4CW7 B;  3L8B A;  2ASM A;  2HMP A;  5GAD P;  2Y1J A;  2G8K A;  3L2Q A;  3AO2 A;  4B1V A;  4DUY K;  3P5J A;  4BRP A;  1Z05 A;  4DSE A;  3V81 A;  2ZJQ L;  4JKG B;  2PAV A;  3HP6 A;  3T1A A;  4HTU A;  3SQ1 A;  4Z4C A;  5EVZ A;  4YHH K;  3PX6 A;  1BOT O;  1W97 L;  2IVN A;  3DXK A;  3H3N O;  4KKO A;  4FM0 A;  1NK8 A;  1JLB A;  1HNW K;  3QIC A;  2E6M A;  4IEI A;  3ATV A;  4UY8 O;  4H5R A;  4GV9 A;  1FW6 A;  3MXM A;  1S9G A;  4FZY A;  5JVH L;  5AQL A;  4Q5V A;  4MFB A;  2IVO A;  1NKB A;  4CFB A;  3K5L A;  3K2P A;  5JLH A;  4Z4H A;  4FJI A;  3ZSO A;  5FRN A;  5ELZ A;  4F9O A;  2OPR A;  2QM1 A;  2GUI A;  1Q8I A;  3NE6 A;  1YHQ N;  1T44 A;  2D5R A;  2B5J A;  4KH5 A;  3QIN A;  4OLA A;  3GE1 A;  3OY9 A;  1TK8 A;  3SV4 A;  1YAG A;  5CR4 A;  3W3D A;  3UE5 A;  2HF4 A;  1BDG A;  5HRN A;  1NGI A;  3WXJ A;  4BR9 A;  5KRS A;  5ADX H;  3GDQ A;  3KZB A;  1IJJ A;  5AZI B;  3ZSQ A;  3THX A;  4IWV A;  1VAZ A;  2ZF5 O;  4I2Q A;  3VQC A;  3OYJ A;  2OYQ A;  4N41 A;  3HJF A;  1BUP A;  4I9Q A;  3VEO A;  3SK3 A;  3CET A;  4TSX A;  4M45 A;  4L3Q A;  4QOZ B;  1BO5 O;  2E20 A;  4GVE A;  3A2F A;  3DXM B;  3KKR A;  5M1Q A;  4JD2 A;  3AVG A;  4UQG A;  3OS2 A;  3HBT A;  1K8A O;  3I8D A;  4BRO A;  2QEX N;  1HJR A;  4E19 A;  3VES A;  5GAG P;  3DLB A;  3NVM A;  1TAU A;  2HOE A;  1EO1 A;  2H3G X;  1GLA G;  4I6M B;  3U9D A;  2VG6 A;  4CF0 A;  4DLE A;  1GLE G;  4N76 A;  4GY2 B;  3AA4 A;  4FWP A;  3VF2 A;  3I0R A;  5C0Y A;  1ZC6 A;  2E2O A;  1SL2 A;  2HHX A;  1VHX A;  3AA5 X;  3H3O B;  2W42 A;  1SQK A;  1RT2 A;  4NYF A;  3AGR A;  1S1V A;  3LPU A;  3FFI A;  2RKI A;  3QB0 A;  2HST A;  3GG4 A;  5AFU A;  3RMC A;  2XRI A;  1C1C A;  2AA4 A;  3ZLJ A;  5AJ3 K;  5AFU H;  3IDH A;  3MXJ A;  2D4W A;  1U49 A;  3S3N A;  1L3U A;  4K43 A;  1KFD A;  5EY4 A;  1VQL N;  1WSJ A;  3PLA A;  5KRT A;  1ITG A;  3QBX A;  4NCA A;  2VYP A;  2OAN A;  2DFF A;  2DTU A;  4C8K A;  4E1N A;  4ZTF A;  2GV9 A;  2A1R A;  4KHQ A;  2HVI A;  1HPZ A;  4CES A;  3U3G A;  4GNI A;  3DM2 A;  1FK9 A;  2P1J A;  2HNZ A;  4ISG A;  1U04 A;  3KJV A;  3CQX A;  3DRP A;  4BRF A;  4J2D A;  3NGY A;  1T3V A;  3D2E A;  4AHS A;  2BAN A;  2RHK A;  4CEC A;  4WQ5 C;  3QML A;  3J80 O;  3ZSR A;  2ZJP L;  4CEE A;  2QWQ A;  4ICL A;  4KTW A;  5AQX A;  1NK0 A;  4CJ5 A;  4LFB K;  2HF3 A;  1HNZ K;  2V51 B;  5BPL A;  2HND A;  3AVB A;  4MDB A;  3HZ6 A;  4CZG A;  4ELU A;  4AHU A;  1TUY A;  3T69 A;  1C0G A;  3T1H K;  4LFA K;  4H0Y B;  1RCH A;  2CGJ A;  3BZC A;  3I0S A;  3SPY A;  1QVF M;  3VGL A;  1BIZ A;  1WSG A;  3VQB A;  2X78 A;  3CJ1 A;  3CIP A;  4DTJ A;  5AQM A;  4JNE A;  4BY9 C;  4H0T B;  4FOI A;  4M7X A;  2ITM A;  3M6G A;  4BG9 A;  1L3V A;  3SAH A;  4JHD B;  1T8E A;  3LWM A;  4JI7 K;  2G8V A;  1P8Z A;  1SV5 A;  1WSF A;  1QHT A;  4AH9 A;  2F8T A;  3E1Y A;  4J2B A;  1QQN A;  2UUC K;  2P9K A;  1UWB A;  4FJX A;  2E2Q A;  3UB5 A;  4CHO A;  3HK2 A;  4IFE A;  5C2D A;  3O4N A;  3OBW A;  2P9K B;  3ULE A;  4EHU A;  1X9S A;  4E7H A;  2YV0 X;  1SZ2 A;  2R7Y A;  4DSL A;  3G4S N;  5M1P A;  3PX4 A;  1BCO A;  4GKK K;  3MWP A;  3QEI A;  1IKW A;  1HPM A;  4JHD A;  2KQ2 A;  4NB4 A;  4GVM A;  1RDD A;  1BWF O;  2ASP A;  2QWM A;  4CJE A;  1EET A;  2EX3 A;  3OBY A;  4CBW A;  3VGK A;  3CM6 A;  1G15 A;  2O4I A;  3ID8 A;  1LV5 A;  3AVH A;  3ZEU B;  1EQY A;  3MMV A;  4EP4 A;  4KTQ A;  3S9H A;  1VQ7 N;  4PQU A;  2X74 A;  4YNQ A;  1TK5 A;  2YHA A;  4B1Y B;  4HCB A;  1V4T A;  3O9U A;  4AHT A;  1IG8 A;  4W5R A;  5AR0 A;  3SMP A;  1JL2 A;  3CFP A;  4BRN A;  4LC9 B;  4WQ4 A;  3GL1 A;  4H8K A;  4E1M A;  1ZBF A;  3V9S A;  3IKM A;  1D4X A;  4IOC L;  3AY9 A;  4CK3 A;  1JLE A;  4FJG A;  3SQ2 A;  1FKO A;  4YOV A;  4CJW A;  4FWO A;  1L3T A;  4Z4I A;  1BHL A;  5J2N A;  3G6E N;  3NF7 A;  1Y64 A;  2G8W A;  4DTM A;  3FZM A;  4LY7 A;  4RW7 A;  4B9N A;  1GLF O;  3CF5 L;  4JK7 A;  2BE2 A;  3SJH A;  3DLK A;  4CGH A;  5DMR A;  1U4B A;  3C7N A;  2FF3 B;  1HX1 A;  4FVU A;  4E0D A;  2BDP A;  1MU2 A;  3HPO A;  4JKG A;  3EYZ A;  4KHS A;  3WXL A;  4CI6 A;  3NF6 A;  4CIF A;  4CZL A;  1ASU A;  1YVU A;  1UOC A;  2ZE2 A;  4CZE A;  4DR4 K;  1JKH A;  1K9M O;  3OYG A;  3BF1 A;  1RDA A;  3VQ8 A;  1VSL A;  2P5G A;  1HKC A;  4GV6 A;  5M1N A;  3QNN A;  3THV A;  4FLZ A;  1YJN N;  4WQ5 A;  3QEV A;  5GAH P;  3QEP A;  1DGK N;  3WNH A;  3CHW A;  3E9P A;  3OYM A;  4OJR A;  1H1V A;  1HRH A;  2NRZ A;  1R59 O;  2VWB A;  4MLE A;  1NJW A;  4BDP A;  2ETJ A;  1BG3 A;  1X3M A;  3HOS A;  4BQZ A;  5KPZ A;  1ASW A;  4BRI A;  3AO4 A;  4HUF A;  3R8E A;  4BC3 A;  5KPR A;  4FLV A;  3V9X A;  2FBV A;  1RTJ A;  2G8F A;  2ASO A;  4CK1 A;  1TUU A;  1MWM A;  2P9S A;  5KGW A;  4CZK A;  3IG1 A;  1OH5 A;  1KFS A;  3MX2 A;  2XY7 A;  4DKW A;  1C0T A;  3WUH A;  1SKR A;  1RDC A;  4DFK A;  1IG9 A;  4K0K K;  3WXM B;  4FK4 A;  5JS1 A;  4ID1 A;  5AQI A;  3P39 A;  3RSE B;  3FR0 A;  5J2M A;  4N5S A;  4BRD A;  4AQY K;  1S72 N;  5AQZ A;  3D6R A;  3LAN A;  1E4G T;  4BDZ A;  1VQK N;  2IIR A;  3K58 A;  2KFZ A;  3G0Z A;  5LMU K;  1JLC A;  4DFJ A;  3M8Q A;  3I33 A;  4BE2 A;  2Q0R A;  4LFC K;  4F3T A;  3CG7 A;  3GOI A;  3QET A;  5E84 A;  4WFN L;  3SYZ A;  4OPJ A;  4BRL A;  3M8P A;  2RE2 A;  4DU3 A;  1KD1 O;  1T6D A;  2QXF A;  1WAJ A;  3AAQ A;  4JI6 K;  1NOY A;  2XHB A;  2VGM A;  3VQ5 A;  4OKJ A;  1BGX T;  3MAQ A;  4BAC A;  3D7E O;  4BR0 A;  4CF8 A;  2Z1J A;  3VQ7 A;  3MEC A;  3CPW M;  1CZ9 A;  2NRH A;  4CBX A;  3VEY A;  3F9M A;  2CH6 A;  4LF8 K;  4E7L A;  4E3S A;  1Y97 A;  1N34 K;  1BIU A;  3LZJ A;  2PYJ A;  1UA0 A;  3V9W A;  1VSE A;  3GBT A;  1HMV A;  4JS4 A;  3U8X A;  3TR8 A;  3IUC A;  3CFR A;  3CC2 N;  4BRH A;  3K59 A;  4Y1D A;  1MA9 B;  3O80 A;  3VA0 A;  5AQU A;  3L2V A;  5F2R A;  3OS1 A;  4JLH A;  4JKE A;  4KV8 A;  4B3S K;  4NO7 A;  1KAX A;  3TAQ A;  1T05 A;  1B9D A;  5M1K A;  2B4J A;  3FLC O;  2JWL A;  4OLB A;  5HRP A;  4FSV A;  1M90 O;  1J5E K;  1XMO K;  1X9W A;  3P4I A;  1EWQ A;  3WXK A;  1GLB G;  3LM9 A;  3J7Y P;  2UU9 K;  1XNQ K;  3OJU A;  3VEV A;  1LW2 A;  1C1A A;  4B9V A;  5TKW A;  4OKK A;  3KLE A;  4DQQ A;  3L2U A;  4GKJ K;  1TKT A;  4XIU A;  4IEE A;  3O9T A;  4JD2 B;  1K8K B;  1ASV A;  4O8U A;  2DFE A;  3J81 O;  4JKH A;  2O8E B;  3TAB A;  1J53 A;  3OA9 A;  3K9K A;  2YNH A;  4BE1 A;  3EZW A;  3QEX A;  1R0A A;  4CE9 A;  3DLR A;  4FJM A;  3H6E A;  1X9J A;  5CYQ A;  3CC7 N;  2Q0U A;  3C95 A;  1D9F A;  5FPM A;  4N56 A;  4H5W A;  1QHA A;  4CJP A;  3D0P A;  1S1T A;  4H4M A;  2HHH K;  4MQ3 A;  5AQV A;  4IFV A;  1IBM K;  3C6U A;  4B1W B;  1JJ2 M;  4BRA A;  1KAZ A;  5HOO A;  1QE1 A;  3MEG A;  3FE1 A;  1MDU B;  2IOC A;  3AVK A;  1WUA A;  1E4F T;  3DRR A;  3SUQ A;  3UKU A;  2YCH A;  1JCE A;  2RF2 A;  2DFH A;  4OO1 J;  3HST B;  4DV1 K;  3LAL A;  2HHU A;  1V4S A;  1CXQ A;  1TGO A;  3B8A X;  5HP1 A;  3MN5 A;  4A59 A;  3L0Q A;  3TPQ A;  1BCM A;  4W5T A;  3NAE A;  3CFO A;  1BIS A;  3D2F A;  2QA4 N;  4DQI A;  4DHY A;  2QTD A;  2KZZ A;  3C0B A;  3HPH A;  2HBM A;  4AHR A;  1XQS C;  4O44 A;  2O8D B;  4EZ9 A;  4DMN A;  1NLV A;  4JI4 K;  4LF6 K;  3TSQ A;  4AF1 A;  1NJZ A;  1JCF A;  1FKP A;  3NCI A;  1SUQ A;  2P5O A;  3HVT A;  3LP0 A;  5AQK A;  1VSD A;  4X65 K;  3AA2 A;  3AO3 A;  4E7K A;  1D5A A;  1NGD A;  2GWJ A;  3NGZ A;  3OYE A;  4IKF A;  2E5L K;  5HLF A;  3OJS A;  3A5M C;  1VQM N;  5JMV A;  5A2Q O;  3N4P A;  4KTZ A;  4CVN E;  2NRW A;  1WSI A;  2NRR A;  1YUW A;  4DSF A;  2HHS A;  3O4W A;  1HNV A;  4RW9 A;  4CEO A;  3JAM O;  4CEQ A;  4N47 A;  3HYF A;  4I2P A;  2OZM A;  3RMA A;  3LDN A;  1VRU A;  3ZT1 A;  4H4O A;  1TL1 A;  3R6M A;  3CM5 A;  3LP1 A;  3O4Q A;  3VQE A;  2F7T A;  1A5X A;  4OPA A;  3WNF A;  1J9A A;  5JLF A;  1RTH A;  5CYM A;  4DF8 A;  2OCE A;  3THY A;  3LM2 A;  1WLJ A;  5AQN A;  1DLO A;  2YHY A;  3D45 A;  4J2A A;  4B3O A;  3VF6 A;  3OYI A;  4HWI A;  3DXM A;  5GAE P;  5C15 A;  4X66 K;  4JAX A;  4G9Z A;  3SI6 A;  5SZT A;  4FWK A;  4CZH A;  1YJ9 N;  3BEX A;  3I8B A;  3Q7C A;  2QWL A;  4JKD A;  1IKY A;  1EWR A;  2OZS A;  3H1Q A;  1KC8 O;  1S1X A;  4DR6 K;  5CZ1 A;  3RR7 A;  3ULE B;  3CCR N;  2QI2 A;  1M1K O;  1VRT A;  2UXD K;  4BRM A;  4X64 K;  3EE8 A;  1KQS M;  3WNG A;  5C24 A;  4C1N K;  4CZM A;  1IKX A;  2P9U B;  4KRF A;  3KWI A;  3DJC A;  5BRH A;  3M5R A;  4GW6 A;  4A57 A;  3CCS N;  3VGM A;  1Q7Y O;  3LDP A;  1RT1 A;  4IO9 L;  3T19 A;  3VQ6 A;  4IJN A;  3ENH A;  1FJG K;  3R9P A;  5FPN A;  4CGJ A;  1T7P A;  4KHW A;  1IKV A;  2Z1I A;  4BR7 A;  2DY4 A;  3NH0 A;  4BWM A;  4B8C A;  4FJH A;  2QWP A;  4CZI A;  3CJC A;  3SUP A;  4WFA L;  1XC3 A;  2O8B B;  2PBD A;  4C8L A;  3MN9 A;  4CJU A;  3I55 N;  3DXK B;  3C6T A;  4FO0 A;  3ZX2 A;  3L4I A;  4E1J A;  4CIE A;  1TKD A;  5E26 A;  3FZH A;  4BGA A;  3P1G A;  3CMA N;  4FK2 A;  4DFM A;  1JLF A;  1N36 K;  4W5O A;  1XHX A;  3A8Y A;  3O1B A;  3RVC A;  4BC4 A;  2UUA K;  2VCP A;  4YY3 K;  1RFQ A;  4JEP A;  4DQP A;  1DT9 A;  4KH6 A;  3EN9 A;  4X62 K;  5C10 A;  1CZA N;  1KLM A;  3V1R A;  4H5N A;  1IH7 A;  1YIT N;  4XH1 A;  4H0O A;  1J6Z A;  3EO3 A;  4F3O A;  4AIL C;  3SAF A;  4EAH D;  4FJ5 A;  3CCQ N;  3TAG A;  1GOC A;  1TL3 A;  3EEQ A;  1NGB A;  1XI1 A;  4J2E A;  1UA1 A;  3QIP A;  3K5M A;  3MEE A;  2X6N A;  4M3T A;  1LWC A;  4IBN A;  3QNO A;  2EWS A;  4JKA A;  2G8U A;  3ALY A;  1ZBU A;  1QZ6 A;  1BL3 A;  2D0A A;  2IC3 A;  3O5B A;  5AQS A;  2HHT A;  1I3A A;  3MWT A;  4IG0 A;  2Z1G A;  3KLG A;  1K73 O;  3HRG A;  3H1V X;  2E88 A;  4BVP A;  2O8C B;  4DWI A;  1VQ4 N;  1BA1 A;  4FLX A;  5J2P A;  4A5B A;  1I94 K;  1ZXO A;  1HR0 K;  4JKC A;  4W5Q A;  1IO2 A;  4BRQ A;  3PIO L;  2GUP A;  3S3M A;  4CEA A;  4LF4 K;  3K9J A;  3DMJ A;  3NH2 A;  5KTQ A;  5FPD A;  3SJJ A;  3OYF A;  1U2V A;  2F4V K;  1NGJ A;  1WSH A;  3NF8 A;  4KFB A;  2NRX A;  5AQW A;  2ZM6 K;  4YDU C;  4LSN A;  1BQM A;  1DKG D;  1HJO A;  4HCC A;  3CJA A;  4B3T K;  2YKM A;  4CJ4 A;  4CHP A;  3WEE A;  3T3F A;  3M1F A;  2JWK A;  4B1U B;  5FLX O;  4PL7 A;  3UKR A;  4M3R A;  1YTU A;  3VQQ A;  2CGL A;  4CEF A;  3EKU A;  4YOR A;  4JV5 K;  3JS6 A;  1XWL A;  4C8M A;  3FFK B;  5AQQ A;  1HKB A;  1N8R O;  4FZX C;  3R3L A;  5TKY A;  2EHG A;  1HYZ A;  5BN8 A;  4EHT A;  4CF1 A;  4QS9 A;  3OW2 M;  3VEN A;  1KVA A;  4FVM A;  4PL8 A;  4MO4 A;  2E1Z A;  3AVN A;  2HMI A;  2FC0 A;  2KHO A;  4BC2 A;  4LSL A;  3MN6 A;  2YHW A;  3LDL A;  4RTF D;  3KHY A;  5CHI A;  3TAR A;  3FZL A;  3UKR B;  5LJW A;  2O8C A;  3MCP A;  2GTD A;  3VQP A;  4DCH A;  1RT6 A;  4QCL A;  1N5Y A;  3Q7B A;  3TAN A;  1LW0 A;  3AGK A;  3LAM A;  1RGI A;  3F2K A;  1VSF A;  1JLQ A;  1YTA A;  4ILG B;  1TYQ B;  4WFB L;  4IO8 A;  3WQT A;  3E66 A;  4DSK A;  2E6L A;  1BU6 O;  2P9I A;  3DYA A;  3QLH A;  4EZ6 A;  3F9K A;  2D0O A;  4ELT A;  3F5T A;  5BPM A;  1QVG M;  4JI0 K;  5EXW A;  4NLB A;  3CPE A;  3LP2 A;  3L6Q A;  3WNE A;  4PY5 A;  2JLE A;  4CJQ A;  2Q1N A;  4QAG A;  2VQF K;  4BGB A;  3THW A;  3BY5 A;  3FZK A;  2D0C A;  2PFU A;  1ZBH A;  4CJK A;  2BGG A;  1P90 A;  3ZSZ A;  4C1N I;  3K5N A;  2ZQB A;  2VWJ A;  5DK5 A;  4DTN A;  2GBZ A;  4H5V A;  2F96 A;  4DQR A;  4ISF A;  4R5P A;  4OX9 K;  1HNI A;  5ADX A;  1VQ8 N;  4F4K A;  3TTF A;  4CD3 A;  2ZGY A;  3AVC A;  2YKN A;  3IRX A;  2FSJ A;  2Q2R A;  4Y0W A;  5LY3 A;  3RTV A;  1YJW N;  1WOQ A;  3ZYY X;  2YHB A;  4YOW A;  4DLG A;  3U3Y A;  1KTQ A;  4FCY A;  3TI0 A;  4JI5 K;  1IV0 A;  1KAY A;  4BRK A;  2W41 A;  3TWH A;  1RBV A;  3LDQ A;  4OVL A;  4FZZ A;  3C65 A;  2O8B A;  4M42 A;  3VEX A;  4ID5 A;  4CJ3 A;  2A6A A;  2UXB K;  2AP1 A;  2XY8 A;  2IDO A;  3OYD A;  2QKK A;  1RTD A;  1Q81 O;  1C0U A;  3ENB A;  3PO4 A;  3KIO A;  4IFY A;  4CJR A;  1QS4 A;  2UYT A;  2QKB A;  3DOL A;  2ZWH A;  1YI2 N;  4K8X A;  2Z1H A;  2KFN A;  4KI6 A;  1QQM A;  3AVF A;  1NJI O;  3CCJ N;  4FLY A;  2HVH A;  1B92 A;  4B8A B;  1RIL A;  3SMS A;  1HYS A;  5BR9 A;  1JXB A;  1HYV A;  4YOT A;  2A3Z A;  3VTI A;  2W6L A;  2QK9 A;  3HI0 A;  4RW4 A;  1S6Q A;  1TAQ A;  3OYK A;  3ZT4 A;  4PKH A;  1RT5 A;  4JI1 K;  1NMN A;  4CER A;  3HVR A;  4FWM A;  2HHW A;  3VER A;  3B6O A;  1OVY A;  1Z25 A;  2NUB A;  3AVM A;  4EFH A;  3VF4 A;  1KRP A;  2NLX A;  4K25 A;  1ATN A;  1GLJ O;  3CC4 N;  2HBK A;  1DTT A;  3TTD A;  2FSN A;  2XO7 A;  5KPT A;  4XEI A;  1RDW X;  4DV7 K;  4RWT A;  3TU5 A;  4FPA A;  1SL0 A;  2ZGZ A;  4FLW A;  5BPN A;  3G71 N;  1RT7 A;  1NGE A;  5EU7 A;  3SV3 A;  1O1W A;  4FM1 A;  4BG8 A;  2NNW A;  2A42 A;  4DTX A;  4F2S A;  4RCH A;  4LH4 A;  3BGR A;  3CQY A;  3K0S A;  4BWJ A;  4NXN K;  4FLU A;  2KTQ A;  4CED A;  4CEB A;  2FSK A;  3U9Z A;  4A5A A;  4CIG A;  4KPY A;  1U6Z A;  5BN9 A;  3ZSX A;  4H0P A;  2Y1I A;  3MDQ A;  1S3X A;  4DTP A;  1ZBL A;  3SBG A;  1TV6 A;  1O13 A;  3L3V A;  3CCE N;  4CF2 A;  3OYN A;  1NBW A;  3KKS A;  4WE1 A;  4FW1 A;  1WBD A;  3VEW A;  3THW B;  4IDK A;  2ITG A;  4AHC A;  4B08 A;  2OTL N;  5KGX A;  4DQ8 A;  3T1Y K;  4L8R B;  5LL6 Z;  2YJE A;  1VSK A;  2KKZ A;  3AVA A;  4MLH A;  3RMD A;  5GIP A;  1Z26 A;  3HTV A;  4B1X B;  5T7B A;  2AJQ A;  1XNR K;  2P9L B;  3L2R A;  2O8F A;  3SNN A;  2X6S A;  1VSH A;  3J7Z O;  2YNF A;  2W40 A;  1ZBI A;  3KK7 A;  3O8M A;  4CBU A;  3ATU A;  5E41 A;  4KHU A;  3BUZ B;  4KB1 A;  4HVJ A;  5FRM A;  2E8A A;  1EX4 A;  1YIJ N;  2F9T A;  1Q82 O;  1NJY A;  5JS2 A;  4Z4E A;  4O5F A;  1QTM A;  1SL1 A;  1C0F A;  3CCM N;  1C1B A;  3R1X A;  1Q9Y A;  4BC5 A;  2P9P A;  4Z4G A;  4B9Q A;  3KK1 A;  1W9H A;  1X9M A;  2JGU A;  4I6M A;  4O0I A;  3LAK A;  3DOK A;  3IMX A;  1GLD G;  4CFA A;  5IWA K;  3KK2 A;  1NOZ A;  3F73 A;  4E7J A;  3MK6 A;  4O0J A;  1ILY A;  3ZSV A;  5I9E B;  4B9M A;  3G25 A;  3FGU A;  1NK6 A;  4IJA A;  1NWK A;  1NK7 A;  3SAG A;  1ZBS A;  3MCA B;  4DSI A;  4DTU A;  4K41 A;  5GIO A;  1NGH A;  1TK0 A;  3K5O A;  4DU1 A;  1NGF A;  4KAZ A;  3EZ5 A;  4IXC A;  3HM8 A;  4H03 B;  2YNI A;  4FM2 A;  1YT3 A;  4KHY A;  3W0L A;  1OH8 A;  3DLG A;  1Z6R A;  5B8H A;  1LWE A;  3PSF A;  3MX5 A;  4LH5 A;  5BRF A;  3QEW A;  1RTI A;  5DM7 L;  4YFU A;  5H1S Q;  1A5V A;  4YOU A;  1S1W A;  1GLC G;  4CJ7 A;  1X1P A;  5C42 A;  4DG1 A;  4IZ9 A;  5BRE A;  1RDB A;  1TKX A;  4JRQ A;  5JVG L;  5HRO A;  1D9D A;  3VQA A;  3OTO K;  1DEJ A;  1N32 K;  3HP9 A;  1SAZ A;  5J2Q A;  1X3N A;  3P31 A;  1KCF A;  3AVJ A;  1ATS A;  1WN7 A;  4LF5 K;  5CE3 A;  3C6H A;  2WC9 A;  5HRR A;  5AQY A;  1GOA A;  5HL7 L;  4M3W A;  4NYN A;  2E1Y A;  1SKW A;  5SWM A;  4CHQ A;  4C8O A;  1RT3 A;  1E3M A;  4FOE A;  1NM1 A;  1HQU A;  5I3U A;  1JLG A;  4PUO A;  3TAM A;  3JXU A;  3AO1 A;  4LD0 A;  1VK0 A;  4O5B A;  4M3Z A;  4KHP K;  1XC9 A;  4DV0 K;  3CXC M;  2WBN A;  4DTS A;  2FLO A;  1CLQ A;  4BRC A;  2VQE K;  5AZJ A;  2WUS A;  3ZEU A;  1OKJ A;  5C12 A;  3ASM A;  2QXL A;  3VQ9 A;  4Z94 A;  3RSE A;  5C2F A;  3CJB A;  4JN4 A;  3TAF A;  3VEZ A;  3IAY A;  2G8H A;  3UIQ A;  4M3Y A;  4YOX A;  2DPN A;  1QZ5 A;  3IFR A;  3ZCM A;  4EIA A;  3WEE B;  1ATR A;  3ZX0 A;  1S22 A;  3KD5 E;  4JK9 A;  1WAF A;  3OYB A;  2IVP A;  4PWD A;  3LPT A;  2O8D A;  4NLC A;  4DV6 K;  1A5W A;  3L4Q A;  3AVI A;  3O3H A;  5D3G A;  3CJ9 A;  3HT3 A;  3V9Z A;  2IGI A;  3CCU N;  3V1Q A;  1TVR A;  1S6P A;  3O6W A;  5F1X A;  4CHY A;  1VSM A;  2V7Y A;  4QS7 A;  1GOB A;  1JXE A;  3RR8 A;  3H45 C;  3SLC A;  1RDU A;  2D1K A;  1KXP A;  4M63 C;  1EKE A;  4IOA L;  1SS6 A;  1XHZ A;  4PKG A;  2P9N A;  2UUB K;  3KTQ A;  2FBT A;  3EY1 A;  1RT4 A;  3JYT A;  1JLA A;  5M1O A;  2QWO A;  1K8K A;  4DS4 A;  1NJX A;  1LWF A;  4BR4 A;  3CCV N;  3P38 A;  1U48 A;  3DLL L;  3SCX A;  2V7Z A;  2VGN A;  5AZJ B;  3THY B;  4CGD A;  1HLU A;  4F8R A;  1S1U A;  4PHT X;  4CFC A;  1VSI A;  3H08 A;  3RRH A;  1OH6 A;  3ID6 A;  2P9L A;  2O8F B;  2A41 A;  3PV8 A;  2V52 B;  1J5O A;  1S5J A;  1NKE A;  3NFA A;  1OVQ A;  1SKS A;  4CGG A;  4MDA A;  4M3U A;  1FXX A;  4CCH A;  3M8R A;  4CGI A;  1U47 A;  3KLF A;  4FJL A;  2F8S A;  1S9E A;  4ILJ A;  4OKE A;  1XMQ K;  4JKB A;  2E4L A;  4CF9 A;  5LMN K;  4A2A A;  4FWL A;  3M3Z A;  2I7P A;  4BRG A;  1VQO N;  3JSM A;  4JKF A;  5J1E A;  3TSU A;  2HBL A;  4YDU A;  4PA1 A;  2W6K A;  4KI4 A;  3B6P A;  3A5L C;  3LP3 A;  3SQ4 A;  2GEM A;  2NZT A;  4U67 L;  2HHV A;  3E9L A;  4YOY A;  2GX9 A;  1QQC A;  3CD6 N;  4W5N A;  5IT9 O;  2VWK A;  4BE0 A;  1DTQ A;  4HUE A;  3QER A;  4HUG A;  2O4G A;  4KBO A;  2Q31 A;  5I42 A;  3ZT3 A;  4ZHR A;  3KK3 A;  3A0I X;  3ZT2 A;  4JYA K;  2HW3 A;  4DV4 K;  1HQE A;  4EP5 A;  3OYH A;  3ZSY A;  3E01 A;  2WON A;  2QWN A;  5AQH A;  4DSJ A;  4C23 A;  4B9S A;  2Q97 A;  3VET A;  5C25 A;  3RRG A;  5FPE A;  1WB9 A;  3C6A A;  4OGE A;  3CME N;  4LF7 K;  1BI4 B;  3TAE A;  5DM6 L;  3UKU B;  4BVO A;  3U6F A;  3AA3 A;  2KW4 A;  3ZET B;  4I9L A;  5MLC Q;  3A5N C;  3VQ4 A;  3ULD A;  3HL8 A;  3PY8 A;  2CH5 A;  3V6D A;  3D2F B;  4FWN A;  1KVC A;  2B6A A;  4DFP A;  3DLE A;  3LDS A;  4E89 A;  3C94 A;  3MN7 A;  1LAW A;  3K57 A;  1L5U A;  4CZJ A;  5M1F A;  1HNX K;  4OPH A;  4PKI A;  1NK4 A;  3IS9 A;  2CGK A;  2J4R A;  5AQP A;  4QS8 A;  4Y1C A;  3KWG A;  1CZB A;  5AQO A;  1YF5 L;  4CD1 A;  4NCB A;  4H0X B;  4IOX A;  1EXQ A;  2A40 A;  4XH5 A;  4DR3 K;  2NRT A;  4FYD A;  4IDH A;  2HNY A;  3VN5 A;  3QES A;  3L3U A;  3MXI A;  1YVN A; 
#chains in the Genus database with same CATH homology
 3CC7 N;  3HBT A;  1NGG A;  1K8A O;  4BRO A;  2Q0U A;  3O9Q A;  1VQK N;  5FPM A;  2QEX N;  4H5W A;  3VES A;  1QHA A;  4PKH A;  5AQR A;  4XH4 A;  5GAG P;  3LDO A;  3NVM A;  4FWM A;  2HOE A;  5AQV A;  3VER A;  1OVY A;  1GLA G;  2H3G X;  4I6M B;  3U9D A;  4B1W B;  3H46 O;  1EO1 A;  4EFH A;  3U4L A;  4BRA A;  1KAZ A;  5HOO A;  3VF4 A;  1JJ2 M;  3AAP A;  2NLX A;  1MDU B;  3FE1 A;  4K25 A;  1N8R O;  1GLE G;  1E4F T;  1WUA A;  3EKS A;  1ATN A;  4GY2 B;  3UKU A;  1GLJ O;  4A62 A;  2YCH A;  4FWP A;  1JCE A;  3VF2 A;  3CC4 N;  4DB3 A;  2HBK A;  1ESV A;  5C0Y A;  1ZC6 A;  2E2O A;  3TTD A;  4OO1 J;  2FSN A;  3H3O B;  3TTC A;  1SQK A;  5KPT A;  2P9S B;  1V4S A;  1MWK A;  3B8A X;  1RDW X;  4XEI A;  3AGR A;  4RWT A;  1QQO A;  3TU5 A;  4FPA A;  3MN5 A;  3QB0 A;  2HST A;  4A59 A;  3GG4 A;  5AFU A;  2ZGZ A;  3CER A;  3L0Q A;  5AQT A;  2AA4 A;  3TPQ A;  5BPN A;  3G71 N;  3QDK A;  3D2F A;  1NGE A;  2QA4 N;  5AFU H;  3IDH A;  4DHY A;  2D4W A;  2QTD A;  3C0B A;  3VPZ A;  2HBM A;  1XQS C;  4FWS A;  1NMD A;  4BG8 A;  2NNW A;  1NLV A;  4K43 A;  2A42 A;  5EY4 A;  3TSQ A;  3VOV A;  4AF1 A;  1VQL N;  3O1W A;  4RCH A;  1JCF A;  5JIC A;  3PLA A;  3CQY A;  3DWL A;  1HKG A;  3QBX A;  2VYP A;  2OAN A;  4J8F A;  5AQK A;  3WXI A;  2FSK A;  3U9Z A;  4A5A A;  4HTL A;  5EX5 A;  4GNI A;  3SBT A;  2YJF A;  1U6Z A;  1NGD A;  5BN9 A;  2GWJ A;  4H0P A;  3MDQ A;  1S3X A;  5AQJ A;  1VQM N;  3A5M C;  4ISG A;  5JMV A;  3N4P A;  1TYQ A;  2NRW A;  3CQX A;  4BRF A;  3SBG A;  2NRR A;  1VQ9 N;  3I56 N;  1O13 A;  2WFB A;  3CCE N;  1T3V A;  3D2E A;  1YUW A;  1NBW A;  2RHK A;  3FZF A;  4WQ5 C;  3VEW A;  3O4W A;  3QML A;  2QW9 A;  2ZJP L;  1BA0 A;  3ZET A;  2QWQ A;  2YX6 A;  2OTL N;  4DQ8 A;  3CI5 A;  4FWQ A;  5AQX A;  4JK8 A;  1T6C A;  2HF3 A;  5LJV A;  2YJE A;  2ZJR L;  2KKZ A;  4M7Y A;  4MLH A;  3VTH A;  5GIP A;  2V51 B;  5BPL A;  3LDN A;  4A61 A;  3HTV A;  4B1X B;  4MO5 A;  4CZG A;  4MDB A;  3HZ6 A;  3R6M A;  2P9L B;  1TUY A;  3T69 A;  2F7T A;  3J7Z O;  1C0G A;  2W40 A;  3S41 A;  4OPA A;  3KK7 A;  4ISE A;  3O8M A;  5EOY A;  5JLF A;  4CBU A;  3ATU A;  4H0Y B;  3LM2 A;  3BUZ B;  2CGJ A;  5AQN A;  2BH1 A;  2YHY A;  2E8A A;  1QVF M;  3VF6 A;  1YIJ N;  4HWI A;  2F9T A;  3VGL A;  3LL3 A;  1Q82 O;  3DXM A;  5GAE P;  5C15 A;  4JAX A;  4G9Z A;  3CJ1 A;  3CIP A;  4O5F A;  1YJ9 N;  4FWK A;  4CZH A;  2A5X A;  5AQM A;  3BEX A;  4JNE A;  4WQ4 C;  4BY9 C;  4H0T B;  3I8B A;  3Q7C A;  2QWL A;  4FOI A;  4M7X A;  1C0F A;  4JKD A;  2ITM A;  3CCM N;  3M6G A;  4BG9 A;  1VQ6 N;  4ILH A;  3SAH A;  4JHD B;  3R1X A;  3H1Q A;  2KLA A;  4BC5 A;  2P9P A;  2E2N A;  4B9Q A;  1KC8 O;  5GIN A;  1P8Z A;  3E1Y A;  4I6M A;  1QQN A;  3IMX A;  3ULE B;  3CCR N;  2P9K A;  1GLD G;  1ILY A;  2QI2 A;  2E2Q A;  1M1K O;  3EE9 A;  3MK6 A;  3UB5 A;  3CCL N;  5I9E B;  2P9I B;  4BRM A;  4WCE L;  3EE8 A;  1KQS M;  3G25 A;  3FGU A;  4C1N K;  4IJA A;  4IFE A;  1NWK A;  5C2D A;  3OBW A;  2P9K B;  4B1Z A;  3SAG A;  3ULE A;  4EHU A;  1ZBS A;  3MCA B;  4CZM A;  3WT0 A;  4K41 A;  1SZ2 A;  2P9U B;  5GIO A;  1NGH A;  3G4S N;  3KWI A;  5M1P A;  3DJC A;  2HBJ A;  5BRH A;  3MWP A;  3M5R A;  1NGF A;  1G99 A;  4IXC A;  3HM8 A;  2FF6 A;  1HPM A;  2P9N B;  4H03 B;  4JHD A;  4BQL A;  4A57 A;  3HOT A;  4NB4 A;  4AM7 A;  3CCS N;  1BWF O;  3W0L A;  2ASP A;  3VMF B;  2QWM A;  3VGM A;  4R79 A;  1Q7Y O;  3LDP A;  1Z6R A;  3OBY A;  5B8H A;  3VGK A;  4CBW A;  4IO9 L;  4IJN A;  3ENH A;  1HUX A;  3MX5 A;  5BRF A;  3R9P A;  3ID8 A;  3HSC A;  5FPN A;  3WQU A;  5DM7 L;  3QFP A;  3OHR A;  1EQY A;  3ZEU B;  3MMV A;  4WYB A;  5H1S Q;  1LOT B;  1VQ7 N;  4BR7 A;  4YOU A;  4WF9 L;  1JCG A;  2QWP A;  4A2B A;  4CZI A;  3CJC A;  1GLC G;  4WFA L;  4B1Y B;  1V4T A;  3O9U A;  1IG8 A;  4K42 A;  4CJ7 A;  4CZF A;  1XC3 A;  5AR0 A;  3SMP A;  4BR5 A;  2PBD A;  4IZ9 A;  3MN9 A;  5BRE A;  3NMU A;  4BRN A;  4LC9 B;  4WQ4 A;  3C7N B;  3I55 N;  5JVG L;  3DXK B;  3GL1 A;  1DEJ A;  4FO0 A;  3ZX2 A;  3L4I A;  1SAZ A;  3IKM A;  4E1J A;  1X3N A;  3P31 A;  3A5O C;  2GWK A;  5E26 A;  1D4X A;  3FZH A;  4IOC L;  1ATS A;  3AY9 A;  4BGA A;  2YHX A;  5CE3 A;  3CMA N;  3C6H A;  2WC9 A;  5AQY A;  3A8Y A;  3O1B A;  3O9R A;  2YI1 A;  5HL7 L;  4YOV A;  4FWO A;  3RVC A;  4BC4 A;  2VCP A;  1RFQ A;  4JEP A;  2E1Y A;  1DT9 A;  1NGC A;  1U2V B;  3ENO A;  4KH6 A;  3G6E N;  3EN9 A;  1Y64 A;  5C10 A;  2GEL A;  1CZA N;  4FOE A;  2OTJ N;  1NM1 A;  4GV3 A;  2E2P A;  3FZM A;  1GLF O;  3CF5 L;  5KQD A;  4H5N A;  1YIT N;  4JK7 A;  3TSP A;  4XH1 A;  3SJH A;  3C7N A;  3JXU A;  1J6Z A;  2FF3 B;  4H0O A;  3EO3 A;  1HX1 A;  4KH4 A;  2QWR A;  4AM6 A;  4FVU A;  3SAF A;  4EAH D;  3N4Q A;  3CCQ N;  4JKG A;  3QBW A;  3DAW A;  1NGB A;  3WXL A;  2NRV A;  4CI6 A;  4BR2 A;  3CXC M;  2WBN A;  2FLO A;  4BRC A;  4CZL A;  4CZE A;  5AZJ A;  2WUS A;  3ZEU A;  2D0P A;  2EWS A;  1OKJ A;  5C12 A;  1K9M O;  4JKA A;  3BF1 A;  3CJ7 A;  1VQP N;  2QXL A;  4Z94 A;  5C2F A;  3RSE A;  1HKC A;  4GV6 A;  3CJB A;  4JN4 A;  1QZ6 A;  5M1N A;  3VEZ A;  1YJN N;  4H5T A;  4WQ5 A;  3O5B A;  5AQS A;  5GAH P;  4YOX A;  1DGK N;  3MWT A;  2DPN A;  1QZ5 A;  1GLL O;  3IFR A;  4EIA A;  3CHW A;  3HRG A;  1K73 O;  3E9P A;  3H1V X;  3WEE B;  2E88 A;  4BVP A;  1VQ4 N;  1BA1 A;  1ATR A;  1S22 A;  1H1V A;  3ZX0 A;  2Q36 A;  1LCU A;  2NRZ A;  4JK9 A;  4A5B A;  4BRE A;  1R59 O;  1ZXO A;  2VWB A;  4JKC A;  4MLE A;  1Q86 O;  1Q18 A;  2IVP A;  3NVK A;  1BG3 A;  4BRQ A;  1X3M A;  3PIO L;  4FWR A;  3HOS A;  3QFU A;  2GUP A;  5AQG A;  4BQZ A;  1YXQ A;  4NLC A;  5KPZ A;  3K9J A;  4BRI A;  3L4Q A;  5FPD A;  3BP8 A;  1U2V A;  3CJ9 A;  3R8E A;  4H0V B;  3CCU N;  1NGJ A;  3BF3 A;  3EL2 A;  4BC3 A;  3O9S A;  5KPR A;  3O6W A;  5F1X A;  2NRX A;  5AQW A;  4YDU C;  2V7Y A;  2ASO A;  1DKG D;  1HJO A;  4QS7 A;  3CJA A;  5KQ8 A;  1TUU A;  1MWM A;  2P9S A;  4CZK A;  3AAR A;  3H45 C;  2P9P B;  3SLC A;  1RDU A;  2D1K A;  1KXP A;  2BTF A;  3WEE A;  4M63 C;  3MX2 A;  5AQF A;  3M1F A;  4IOA L;  2JWK A;  4DKW A;  1SS6 A;  4B1U B;  4PL7 A;  4PKG A;  3UKR A;  2P9N A;  3WUH A;  3T7Z A;  3O08 A;  3WXM B;  2CGL A;  2BUP A;  3EKU A;  5AQI A;  3P39 A;  3RSE B;  3FR0 A;  4YOR A;  5M1O A;  4BRD A;  2QWO A;  1K8K A;  3JS6 A;  3PIP L;  1S72 N;  3FFK B;  5AQZ A;  3D6R A;  5AQQ A;  1HKB A;  1E4G T;  4BR4 A;  3CCV N;  2IIR A;  3P38 A;  3R3L A;  5TKY A;  5BRD A;  3DLL L;  5BN8 A;  2V7Z A;  2VGN A;  5AZJ B;  4EHT A;  4QS9 A;  1HLU A;  3OW2 M;  5AZI A;  3VEN A;  4O8K A;  4PHT X;  4PL8 A;  3I33 A;  4MO4 A;  2E1Z A;  4FL9 A;  1XUP O;  2Q0R A;  1VQN N;  3ID6 A;  2P9L A;  1VQ5 N;  2A41 A;  2KHO A;  4BC2 A;  3KVG A;  3GOI A;  3MN6 A;  2V52 B;  5E84 A;  1W2B M;  2F9W A;  2YHW A;  3LDL A;  4RTF D;  4WFN L;  3KHY A;  5CHI A;  3FZL A;  4BRL A;  2RE2 A;  5F0X A;  3UKR B;  5LJW A;  1KD1 O;  1T6D A;  3MCP A;  2GTD A;  3AAQ A;  4MDA A;  4DCH A;  2VGM A;  2I7N A;  3J8A A;  2FXU A;  3Q7B A;  4FPB A;  4U7B A;  3ZX3 A;  3AGK A;  3D2E B;  1RGI A;  4ILJ A;  3E9O A;  3F2K A;  2P9U A;  1NGA A;  3D7E O;  4BR0 A;  4ILG B;  1TYQ B;  2ASM A;  2HMP A;  4JKB A;  5GAD P;  4WFB L;  3CPW M;  4A2A A;  4IO8 A;  3WQT A;  3E66 A;  2NRH A;  4FWL A;  4CBX A;  3M3Z A;  3VEY A;  3F9M A;  2CH6 A;  4B1V A;  2P9I A;  1BU6 O;  4BRP A;  2I7P A;  1Z05 A;  4BRG A;  1VQO N;  2D0O A;  2ZJQ L;  3F5T A;  4JKF A;  4JKG B;  3TSU A;  2HBL A;  5BPM A;  1QVG M;  2PAV A;  4YDU A;  5EXW A;  4NLB A;  3A5L C;  3CPE A;  5EVZ A;  3GBT A;  3L6Q A;  2GEM A;  3U8X A;  2NZT A;  4U67 L;  1BOT O;  1W97 L;  2IVN A;  3DXK A;  3H3N O;  3IUC A;  3CC2 N;  4BRH A;  3E9L A;  2Q1N A;  3QIC A;  4IEI A;  1MA9 B;  3ATV A;  4YOY A;  4H5R A;  2GX9 A;  3O80 A;  4GV9 A;  4UY8 O;  3CD6 N;  4BGB A;  3FZK A;  2PFU A;  5JVH L;  5AQL A;  5AQU A;  1P90 A;  4C1N I;  2IVO A;  2Q31 A;  4KBO A;  5F2R A;  4JKE A;  3A0I X;  4H5V A;  4NO7 A;  5JLH A;  1KAX A;  4ISF A;  5M1K A;  5ADX A;  2QWN A;  5ELZ A;  4F9O A;  1VQ8 N;  2QM1 A;  3FLC O;  5AQH A;  1YHQ N;  4C23 A;  3TTF A;  4CD3 A;  1T44 A;  2JWL A;  2ZGY A;  2Q97 A;  4FSV A;  3VET A;  5LY3 A;  2FSJ A;  2Q2R A;  4Y0W A;  5FPE A;  1M90 O;  3C6A A;  1YJW N;  4KH5 A;  1WOQ A;  3CME N;  3P4I A;  3ZYY X;  3WXK A;  4YOW A;  3GE1 A;  5DM6 L;  1GLB G;  3LM9 A;  3UKU B;  1KAY A;  4BRK A;  2W41 A;  4BVO A;  3LDQ A;  1YAG A;  3VEV A;  3ZET B;  3C65 A;  5CR4 A;  5MLC Q;  3VEX A;  3A5N C;  3UE5 A;  3W3D A;  2HF4 A;  5TKW A;  1BDG A;  2A6A A;  1NGI A;  2AP1 A;  3WXJ A;  4BR9 A;  2CH5 A;  5ADX H;  3GDQ A;  3KZB A;  3D2F B;  1IJJ A;  1Q81 O;  3ENB A;  4FWN A;  5AZI B;  4IWV A;  1VAZ A;  2ZF5 O;  3O9T A;  4IEE A;  3MN7 A;  4CZJ A;  4JD2 B;  5M1F A;  1K8K B;  2UYT A;  4OPH A;  4PKI A;  2ZWH A;  4O8U A;  1YI2 N;  1BUP A;  1QQM A;  1NJI O;  2CGK A;  3CCJ N;  2J4R A;  5AQP A;  4QS8 A;  3SMS A;  4JKH A;  3KWG A;  3VEO A;  3SK3 A;  3CET A;  3OA9 A;  5AQO A;  1YF5 L;  4L3Q A;  4CD1 A;  4H0X B;  4IOX A;  1BO5 O;  2E20 A;  4GVE A;  5BR9 A;  3K9K A;  2A40 A;  4YOT A;  4XH5 A;  2A3Z A;  3VTI A;  2NRT A;  3EZW A;  4IDH A;  3HI0 A;  3DXM B;  5M1Q A;  1YVN A;  4JD2 A;  3H6E A;  1X9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...