5KGXA

Hiv1 catalytic core domain in complex with an inhibitor (2~{s})-2-[3-(3,4-dihydro-2~{h}-chromen-6-yl)-1-methyl-indol-2-yl]-2-[(2-methylpropan-2-yl)oxy]ethanoic acid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
153
structure length
134
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKTAWWAGIKQEESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Integrase
publication title Indole-based allosteric inhibitors of HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 45
structure length 134
sequence length 153
ec nomenclature
pdb deposition date 2016-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5kgxA00
3LANA 1BI4B 1VRUA 4OVLA 4O4GA 4RG8A 3KTQA 3NHGA 2R7YA 4OLAA 5J2NA 3AVLA 3AA4A 4B8CA 3KK2A 1RT1A 1JXBA 4B08A 4E89A 4KB1A 5HP1A 4M3UA 3KLIA 3SZ2A 3HM9A 4NYNA 1JLAA 3TAMA 4ELTA 3SQ0A 3C95A 4OLBA 5C24A 4DQQA 1K6YA 4CJQA 3ZSQA 3OJSA 3C6UA 4DQPA 4KHYA 1ZBUA 1IO2A 3DM2A 4HTUA 2Z1HA 4Y1CA 2E6MA 4B9SA 4CIGA 3FFIA 1VSLA 4H4OA 4O5BA 3VN5A 1RILA 3NGIA 1Z25A 3WNGA 2ETJA 3ZT2A 3OYFA 3RR7A 4JRPA 4CJLA 2OA8A 3K5OA 4DTOA 2OPRA 4CFAA 5D3GA 3G10A 3LDSA 4BWMA 1RT7A 4LD0A 2P5OA 2FBVA 3AA5X 3SQ4A 2HNYA 2IDOA 3SNNA 4DTRA 4DTMA 1UAXA 4KPYA 3MXIA 4Z4EA 2HVHA 4FM0A 1NJZA 1TVRA 4KV8A 3PUFA 4FZYA 4CJEA 1WSFA 4M3WA 4OPKA 1KLMA 3QLHA 1B92A 1U04A 2F96A 1C0MA 3DOKA 5C42A 4CJRA 1SKRA 2FC0A 4CK1A 1J54A 3OS2A 1D9DA 4KHQA 1T03A 4CK2A 4E7LA 3P5JA 3T3FA 1U4BA 1Y97A 4CERA 4JRQA 2A1RA 1RBUA 2IOCA 4AHCA 3VQPA 4CGHA 1UWBA 3AO5A 4BE2A 2QKKA 5SWMA 5EU7A 3DI6A 5CYQA 4DS5A 1IKXA 4NCAA 1T05A 2B5JA 4KAZA 4FJLA 3HXMA 1RTHA 5CY4A 3LPTA 4CEQA 3TAGA 1VSHA 3VA0A 3AO1A 1VSKA 3SUOA 3ZSZA 4KB0A 3KLFA 5JS1A 4CGJA 1ZYQA 1IKVA 2GBZA 4W5OA 1IH7A 1BGXT 1SL2A 1HYVA 3AA3A 4M3XA 3DRPA 1WN7A 4CFDA 2Z1GA 4ICLA 1CZ9A 5FRNA 1A5VA 3KLEA 1LWFA 3VQCA 1L3VA 3CG7A 2VG7A 3LAKA 1VK0A 1N6QA 4ELVA 3WNEA 1NK9A 3AVJA 1U45A 1XC9A 4ELUA 4FK0A 1D5AA 4E3SA 4B9MA 3LPUA 4GW6A 3SV4A 5J2QA 1RTIA 4DFMA 4CF0A 2G8VA 3DLBA 4OKJA 3AV9A 4F2RA 4KHUA 1FK9A 1ASUA 4FJGA 3AVBA 4CHPA 2X6SA 2XY7A 3QETA 4H4MA 1VRTA 2YNIA 3HSTB 4FLWA 4DSKA 1WSHA 3ZSXA 4XIUA 4QAGA 4CEFA 4CF8A 3OYGA 3KKSA 4OGEA 3ZT3A 4HHTA 3OJUA 3OYDA 2G8UA 1NJWA 1S5JA 4ID1A 3L2WA 3WNFA 2KFZA 2A1SA 1LAWA 1WNSA 3NF9A 4CF9A 3O4QA 4PA1A 3NE6A 1SKWA 1Z26A 2DTUA 3QO9A 3DMJA 5HRSA 2YKNA 1RDBA 3LP2A 1U49A 1UOCA 4FJHA 4DS4A 3HVTA 3ULDA 5J2MA 1W9HA 1I39A 4M45A 3CM5A 2RF2A 3ITHA 4AHSA 4KI4A 3SCXA 4O0IA 3U3YA 4Z4IA 5HRNA 3NF7A 4O44A 3QEXA 1S1VA 2Z1JA 1NK8A 4W5QA 4C8OA 1BIUA 4KFBA 3VQ9A 4KREA 2HHUA 3K59A 1CZBA 2XY8A 3TAFA 1MU2A 4PUOA 3L2QA 3V9WA 4EP4A 3SJJA 4ZTJA 1C0TA 1HRHA 3D0PA 4CEBA 3V4IA 3KD5E 2X78A 1C0UA 1LW0A 3VQEA 4CEOA 4PQUA 3QERA 4BWJA 1C6VA 1C1BA 2WONA 3K5MA 3AVHA 2P51A 4CEEA 4Z4FA 1RBVA 1KVAA 2XY6A 1A5WA 4QCLA 2OZMA 1JLCA 1HNVA 3SQ1A 4CHYA 1U48A 3CFPA 3L2UA 4HUEA 1UA0A 1B9DA 3RR8A 3DLRA 4CJTA 2HHVA 1VSFA 2ITGA 4LSLA 4RW8A 3ASMA 2OZSA 1S9GA 4Y1DA 2G8FA 3OYEA 1QQCA 3RMBA 3TARA 1VSIA 4GMJB 3HPGA 2OPPA 1S6PA 3TI0A 1YTAA 3LP0A 3OYKA 2YKMA 3CM6A 3ISNC 3LZJA 4FJ8A 3C94A 3G0ZA 1GOBA 2BANA 1S1UA 3VQ8A 1NK5A 2G8IA 4FJ7A 3THVA 1QS4A 2IC3A 3HPHA 4AHVA 2XY5A 3C6TA 1KSPA 3QEVA 3BGRA 4G1QA 1TAQA 2YNFA 3BDPA 4FW2A 3SUPA 4FJXA 3DLHA 2KW4A 3AO2A 1ITGA 3V9SA 5I3UA 4TSXA 4AHRA 1BISA 3QIOA 3KIOA 3QNOA 3IRXA 4OJRA 3F9KA 1JKHA 4M41A 2F8TA 1HYSA 1FKPA 1UA1A 3TR8A 4OKKA 4B9VA 3DLEA 4F4KA 4Z4HA 2IS3A 3OYBA 2VG5A 3P83D 4OGCA 3NGZA 3PX4A 3RMCA 3SPZA 3NDKA 3V81A 4PWDA 3SYZA 3PX6A 4DU3A 3QEPA 3AVIA 3L3VA 4JS4A 2X74A 2YHBA 3V1QA 4HVJA 5KI6A 4C8NA 1QTMA 4B9LA 3OYIA 1J9AA 3RTVA 1D9FA 1YT3A 2NUBA 1HMVA 2E6LA 3K58A 4Q0BA 1RTJA 3ZT4A 3L2RA 2GUIA 4KHNA 3TAPA 4CHNA 1KFSA 3PX0A 4F3TA 1VSEA 1Q9XA 3TABA 1DTTA 2I5JA 4AH9A 4O55A 4CEZA 3T19A 3AVFA 3O3HA 2G8KA 1T7PA 4IKFA 3NAEA 3DRSA 3VQQA 1RT2A 3NH2A 4IG3A 5CZ1A 1X9MA 4KRFA 2O4GA 1LWCA 4FYDA 3OYMA 1SV5A 4DFKA 3VA3A 4I9QA 4DSIA 4HCCA 1GOCA 5HLFA 3KD1E 4WE1A 4B3OA 3D45A 5K14A 1SL1A 1FKOA 1HPZA 1RDAA 1SKSA 4EZ9A 1NJYA 1FXXA 1JLQA 1QSSA 1TV6A 1WSGA 4CJWA 4CJFA 5HRRA 4E7KA 4DMNA 4LH5A 4FJIA 3HK2A 3PV8A 1Q8IA 3M8RA 1NJXA 4J2BA 3AVNA 2XO7A 3A2FA 4Z0UA 2ZE2A 1KCFA 3NGYA 5HBMA 4BACA 1S1WA 2DFFA 4FLXA 3HO1A 2HW3A 4FLUA 3OVNA 3HJFA 4FCYA 4HUGA 2QXFA 3NBPA 3OYHA 1NKBA 1WSEA 3AVAA 1RDDA 1W0HA 4YNQA 2VWKA 1YTUA 4RW9A 2PYLA 2LSNA 4FJKA 3PO5A 3AVKA 4M3ZA 4FLZA 2FBTA 3VQ7A 4UQGA 4CJ4A 2HHQA 1TK5A 1O1WA 3UIQA 1IKYA 4CFBA 3ZCMA 2YV0X 3NCIA 4NYFA 2HMIA 4PY5A 3ALYA 1TKTA 4M3RA 1S6QA 5SZTA 1XWLA 1JL1A 3CFRA 4CJSA 4FLYA 3B6PA 3HL8A 1KLNA 3V1RA 3QNNA 1X9SA 1L3TA 3ZSVA 2OPQA 4NCBA 4CFCA 3ZSWA 3V1OA 4CIEA 3H08A 4E7IA 4IDKA 3O3GA 2BE2A 1RT3A 1XHXA 3NH1A 4J2DA 1QE1A 2KFNA 3ZT0A 3CQ8A 1QSYA 1L5UA 1U47A 3RWUA 1ZBFA 3U6FA 4DTUA 4DU1A 3NF8A 1NK0A 4CJ5A 4ID5A 1WLJA 3K57A 4DSLA 4E0DA 4E1MA 2HHWA 5FRMA 2EHGA 4C8KA 4CECA 2W42A 5KGWA 3TWHA 2HB5A 3EY1A 4DLGA 2BDPA 3MEGA 1CXUA 4CIFA 2HHTA 3IG1A 5HROA 3AVMA 2DFEA 4DG1A 3L3UA 1JLBA 1HQEA 1TKXA 3VQDA 3F73A 1XHZA 1KRPA 3E01A 1BCMA 1KVBA 1S9EA 5KRTA 4FXDA 3LWMA 1ASWA 3CFOA 4DWIA 1LW2A 3DLGA 1TL3A 4IFYA 1C1AA 4DSEA 4CEDA 3SPYA 1QHTA 4EP5A 4DQIA 1EETA 4CE9A 4F8RA 1LV5A 4N76A 3L8BA 4BDPA 4N41A 1B9FA 3LAMA 2B6AA 3P1GA 3VQ4A 1NOYA 3I0RA 1EXQA 4BE1A 4DQRA 3S9HA 4KTQA 4K8XA 1DTQA 1TK0A 3EYZA 5FROA 1ZBLA 2HHSA 4FZXC 3AO3A 1SL0A 1EP4A 3O4NA 3V6DA 1RBSA 1TAUA 4CJUA 4W5RA 4B9UA 1JLEA 2ZD1A 3VQAA 3ZT1A 4N5SA 1NK7A 3EZ5A 3DOLA 4RW7A 2E4LA 3HP6A 4CCHA 2YNGA 3OS0A 3S3MA 1RTDA 1RCHA 3U3GA 4C8MA 1NKCA 2PYJA 1JLFA 2OYQA 4KKOA 4KHWA 1HJRA 4FJ9A 1IKWA 3VQ5A 1CLQA 4KHSA 3OS1A 1JLGA 3M8PA 1RNHA 1D8YA 4CGGA 3DRRA 3RRHA 1KVCA 1S1TA 3S3NA 4IBNA 3NH0A 1NK4A 4CJ3A 4FZZA 4DTNA 1SUQA 1KTQA 1RDCA 3QINA 4MQ3A 1JXEA 4KTZA 1L3UA 4CHQA 5CZ2A 1YVUA 1WSIA 2EX3A 5FDLA 4DQSA 2YHAA 1NKEA 1VSJA 4K8ZA 4CK3A 2XHBA 4J2AA 4LH4A 5KGXA 2B4JA 3QEIA 4HCBA 5KRSA 4OPJA 4QOZB 5DK5A 4E7HA 4FJ5A 3AVGA 1A5XA 4B9TA 2OPSA 4EZ6A 2F8SA 1TK8A 2PZSA 3SI6A 1LWEA 1HNIA 3MEDA 4DF8A 4FLTA 4CHZA 2P5GA 5KTQA 2D0BA 2YNHA 2RPIA 4B9NA 3K5LA 3V9UA 4JLHA 2DFHA 3WNHA 4Z4CA 5C25A 3L2VA 4I2PA 1JL2A 1TGOA 4O0JA 4OKEA 1BQNA 2D5RA 4DTSA 1GOAA 4KI6A 3AVCA 3SV3A 1KFDA 3HPOA 4E19A 1J53A 2KZMA 4R5PA 4DTXA 1HQUA 3ZSOA 2G8WA 3JYTA 4M3YA 3OY9A 2KZZA 3QESA 1HYZA 1WSJA 4LSNA 4H8KA 3JSMA 3KJVA 1C1CA 1J5OA 1TL1A 1S1XA 1TKDA 5I42A 1BI4A 1WAFA 4DTPA 5DMRA 1N5YA 4J2EA 2RKIA 1LAVA 4GVMA 4W5TA 3OYCA 5T7BA 2HHXA 1G15A 1CXQA 3TAQA 4DTJA 1BCOA 4CGFA 3O3FA 4ZTFA 3MXMA 4FJJA 4FK4A 2Z1IA 3SUQA 4AHUA 4W5NA 4N56A 3HT3A 1NOZA 4HUFA 3KLHA 4AILC 4Z4GA 2XRIA 3SQ2A 1EX4A 3MEEA 5E41A 4DF4A 1BHLA 3ZSYA 2QK9A 4LY7A 3NF6A 2P1JA 3I0SA 2X6NA 3LZIA 1ZBIA 2DY4A 4FLVA 4AHTA 3LP3A 1R0AA 1T8EA 4FJNA 4CF1A 4CGIA 4BDZA 1XI1A 1RBTA 2HNZA 3KK1A 3PY8A 4M42A 4FW1A 4M3TA 3RMAA 4I2QA 5J1EA 4F2SA 3S3OA 2FBXA 4BE0A 1QSLA 1I3AA 3M8SA 2Y1JA 2HVIA 1F21A 4N47A 1BQMA 3NFAA 4DU4A 5CYMA 3TANA 3MECA 3ZSRA 1BL3A 2BGGA 2IAJA 2AJQA 2GV9A 4DSJA 4JS5A 2HNDA 3HP9A 2VG6A 4CJKA 1ASVA 3LWLA 1BIZA 3RMDA 1DLOA 2G8HA 3QEWA 1RBRA 3K2PA 3OYJA 1ZBHA 3SUNA 4FJMA 2O4IA 3AO4A 4MFBA 4RW4A 3PO4A 2PY5A 1TKZA 4CF2A 3DLKA 4FM1A 3V9XA 2D0AA 3IS9A 3VQ6A 4DLEA 5HRPA 4E7JA 3QIPA 4F3OA 1WAJA 4IG0A 2KTQA 2D0CA 3MXJA 1Q9YA 3V9ZA 5J2PA 4FVMA 3OYNA 3OYAA 2ZQBA 4FM2A 3K5NA 3LP1A 1RT4A 2Q3SA 2KQ2A 3DYAA 2WOMA 4YFUA 4I9LA 4KTWA 4I7FA 3M8QA 2VWJA 4RW6A 4CHOA 4DSFA 3MAQA 3TAEA 4E1NA 4FK2A 1NK6A 1RT6A 3B6OA 1X1PA 3RRGA 1EKEA 3AA2A 3KLGA 3HYFA 1IG9A 2IGIA 4NCGA 4DFJA 3OYLA 4L8RB 2FBYA 3VQBA 1X9WA 5JS2A 1RT5A 4ZHRA 3KK3A 4CGDA 3CYMA 4Q5VA 4CJVA 4IFVA 4DFPA 4B8AB 3I8DA 2Y1IA 4CEAA 1VSDA 4C8LA 3IAYA 3T1AA 1VSMA 4CJPA 4CESA 4BDYA 1L3SA 2JGUA 3LALA 2QKBA 3HVRA 2RN2A 3KKRA 2JLEA 1REVA 4KO0A 2ATQA
chains in the Genus database with same CATH superfamily
5DM7L 3LANA 1BI4B 4RG8A 3CMEN 4OLAA 4B8CA 3H45C 1XMQK 1JXBA 4AF1A 5HP1A 3HOTA 3HM9A 2ITMA 2P9IB 3C95A 5C0YA 1IBLK 4KHYA 2Z1HA 3GDQA 3Q7BA 4KH5A 3J7YP 3BY5A 2ETJA 3WNGA 1BG3A 4B1ZA 3VEYA 4CJLA 4DTOA 2OPRA 4CFAA 5D3GA 3G10A 3LDSA 4LD0A 3AA5X 3SNNA 4DTRA 2HVHA 4KPYA 4Z4EA 5GAGP 4KV8A 4M3WA 4OPKA 1KLMA 5BR9A 4BR7A 1SKRA 3DOKA 4H0YB 4U7BA 4KHQA 2FC0A 5AQQA 4EIAA 2VQEK 1Z6RA 4E7LA 3T3FA 3P5JA 2FF6A 1U4BA 1Y97A 3VGLA 4CERA 2IOCA 4AHCA 4CGHA 1Z05A 4BE2A 1M90O 2F7TA 4X64K 1NGHA 2B5JA 1EO1A 3HXMA 3SUOA 2GBZA 1IH7A 1HYVA 1LOTB 4H0XB 1Q18A 3DRPA 3M5RA 4CFDA 5FRNA 1CZ9A 3W3DA 1LWFA 1L3VA 3CG7A 2ZJPL 1VK0A 1TYQB 5BRHA 4K42A 1XC9A 4ELUA 3LDLA 5J2QA 4DFMA 4F2RA 1FK9A 4BRIA 2X6SA 4LF5K 2XY7A 4H4MA 2P9NB 3HSTB 4EHUA 3R8EA 3OYGA 1S5JA 1QZ6A 1KAXA 3HVTA 4YORA 3ULDA 1G99A 3ITHA 3E9OA 3SCXA 3U3YA 2YHYA 1VQ7N 2Z1JA 4JI6K 1NK8A 3VETA 5LY3A 1MA9B 3TAFA 4MLEA 1MU2A 4OX9K 3N4QA 3OA9A 3V9WA 3G6EN 3SJJA 1NGBA 1HRHA 3WEEB 3GBTA 4C23A 3V4IA 4FWQA 1NGEA 3PLAA 4JI2K 3G4SN 4CEOA 1C6VA 1C1BA 1BA1A 3AVHA 3K5MA 2P51A 2A41A 4JKCA 5JLHA 1RBVA 2V52B 2E2OA 3EZWA 1IBMK 4QCLA 1JLCA 1HNVA 1U48A 3CFPA 3RR8A 1UA0A 2ITGA 4B3TK 3ASMA 3QDKA 1VQ8N 1V4TA 3HPGA 5LJWA 2YI1A 1YTAA 4FWOA 3C94A 1GOBA 2E2PA 4B1VA 4F9OA 4XH1A 4FJ7A 3EN9A 3THVA 3HPHA 2NRHA 4QS8A 2IVOA 2GTDA 3DLHA 1N36K 1GLLO 3KIOA 3RVCA 4JKDA 3OHRA 1HYSA 1FKPA 4FSVA 4BQLA 5BRFA 4M63C 4JHDA 4H5NA 4Z4HA 2O8CB 2VG5A 1SAZA 1EQYA 2W6KA 4JKBA 3SYZA 2YHBA 3V1QA 1IV0A 1YT3A 1RDUA 3VPZA 4B3RK 4Q0BA 5ADXA 3H3NO 2AA4A 1VSEA 2P9LA 3TABA 2I5JA 4O55A 5BREA 3AVFA 2IVNA 5BPNA 4BVOA 1X9MA 2O4GA 4DUYK 3PIPL 3OYMA 1SV5A 3VA3A 4I9QA 2PAVA 4DSIA 4CD1A 3KD1E 2NRTA 4WE1A 2PBDA 4EZ9A 1NJYA 1FXXA 1JLQA 1QSSA 1WSGA 4CJFA 4E7KA 4FJIA 4BRPA 1DKGD 1TUUA 3PV8A 3M8RA 1NJXA 4PKGA 4YOYA 3A2FA 4BRFA 1KCFA 2HHHK 2DFFA 5AJ3K 3OVNA 3HJFA 4CZEA 4CVNE 3T1YK 2O8BA 2LSNA 1GLCG 4Y0WA 1HLUA 3UKRA 3T1HK 3CD6N 2P9SA 3E66A 4CJ4A 1TK5A 4CFBA 3ZCMA 5M1QA 4JKAA 3BEXA 2NZTA 3CFRA 4FLYA 4CJSA 3B6PA 1KLNA 3V1RA 3QNNA 1X9SA 4NCBA 3ZSWA 2W41A 2BE2A 1RT3A 3HSCA 5B8HA 3T69A 5AQUA 4J2DA 3ZT0A 3CQ8A 1WOQA 1QSYA 5AZIA 3MX5A 3DLLL 4DU1A 4JAXA 3C0BA 4E1MA 2HHWA 4YOVA 3L6QA 2ZWHA 4DLGA 3SMPA 3ZLJA 1CXUA 1QQMA 4CIFA 3IG1A 2WC9A 3A5OC 3TSPA 1JLBA 4RTFD 1DT9A 1XHZA 1KVBA 4BRMA 4FWMA 3CCVN 1KD1O 1TL3A 4IFYA 1C1AA 3I55N 4DQIA 2E88A 4WYBA 3UB5A 2KLAA 2B6AA 1U2VA 3RSEB 4KTQA 5M1KA 4CZMA 3O80A 3EYZA 2ASMA 1EP4A 3KHYA 3V6DA 1TAUA 1X3MA 1D4XA 1JLEA 2ZD1A 3VQAA 4N5SA 3CMAN 3EZ5A 4YOUA 4B3SK 3AAQA 3OS0A 4WQ4A 1DGKN 4KHWA 5EVZA 3DRRA 1GLBG 4GV3A 3NMUA 2HMPA 4BG9A 1NK4A 3C7NB 4FZZA 2F9WA 3QINA 1YXQA 3CXCM 1SS6A 1JXEA 4DR6K 3VEXA 1NKEA 4CK3A 4LH4A 1YJNN 4OPJA 3AVGA 1A5XA 5GADP 2O8EB 4E1JA 2F8SA 1TK8A 4CW7B 4IJNA 1LWEA 1GLFO 2EWSA 4IWVA 5KTQA 2D0BA 4A2BA 4BRCA 4JLHA 5E84A 4OKEA 3IMXA 4AQYK 4KI6A 3JS6A 3CJBA 1KFDA 3HPOA 1J53A 4R5PA 3O9TA 1HQUA 3ATVA 3ZSOA 3JYTA 2G8WA 3QESA 3ENOA 1WSJA 4H8KA 4XH5A 3J81O 3Q7CA 4GVMA 5T7BA 4CD3A 4JI3K 4DTJA 1BCOA 4CGFA 4FK4A 3MXMA 2Z1IA 4CI6A 4BR2A 4IFEA 2UXDK 2XRIA 5LMNK 1BUPA 1OH6A 1BHLA 4FVUA 3I0SA 1ZBSA 1ZBIA 4AM6A 4M3TA 4NLBA 1RBTA 1XMOK 1VQ9N 3C6AA 5EX5A 1NWKA 3ZEUB 5J1EA 2UU9K 2FBXA 2Y1JA 1S72N 2W40A 1BQMA 3TSQA 4B3MK 3TTFA 3ZX0A 4KHPK 3A8YA 1GLJO 4RW4A 2PY5A 3D2FB 4FM1A 2D0AA 4DLEA 5HRPA 4E7JA 1HR0K 2D0CA 3MN7A 3MXJA 1HNWK 4FVMA 4GV6A 4FM2A 3EE9A 3K5NA 3M1FA 3CPWM 2GUPA 1NMNA 2KQ2A 1H1VA 4HWIA 4NLCA 3DYAA 2FSJA 2P9UB 2WFBA 4I7FA 4CBXA 3WXLA 4BRQA 3CCRN 4KH6A 2A5XA 1KAZA 1X1PA 1GLDG 1RDWX 5AQIA 3AARA 4DFJA 1HKGA 4FOIA 4YHHK 3KK3A 4Q5VA 4IFVA 5BPLA 5M1PA 4B8AB 4C8LA 3T1AA 1VSMA 4CJPA 5CE3A 3LALA 3TTCA 3O5BA 2O8FB 2GEMA 4KO0A 1S22A 4OVLA 2NRWA 4O4GA 3ID6A 2E5LK 5J2NA 3AVLA 3J7AP 3ZETB 3KK2A 1RT1A 5JLFA 4KB1A 4M3UA 2OTJN 1K8KA 5HOOA 2QA4N 2ASOA 4K43A 1ZBUA 3DM2A 2ZGYA 4Y1CA 2E6MA 4B9SA 5FPDA 3FFIA 2GELA 4BR9A 5CHIA 4BG8A 2E1ZA 4CBWA 4PHTX 2QWPA 3CJ7A 1RT7A 2IDOA 4JI8K 5M1OA 4DTMA 1VQPN 2BTFA 5KQ8A 3MXIA 1NJZA 1TVRA 4FZYA 3PUFA 4IO9L 1WSFA 1T6DA 4A57A 4IEEA 5C42A 2NRXA 3DXKA 3ULEB 3OS2A 1T03A 1N33K 1EWQA 3D2EB 2A1RA 1W97L 5SWMA 3DI6A 1VQON 1IKXA 4YOXA 4H5VA 1OVQA 3FGUA 4KAZA 3LPTA 4CEQA 3TAGA 4DHYA 2D4WA 3ZSZA 4KB0A 5AQVA 2J4RA 4M3XA 1WN7A 2Z1GA 1A5VA 1NGJA 3S41A 3SBGA 2KKZA 3LAKA 3IUCA 3U8XA 3VOVA 5F0XA 5DM6L 1NK9A 1D5AA 4E3SA 4B9MA 4RWTA 4H5RA 4BRNA 5IWAK 4FJGA 3AVBA 1P8ZA 3SJHA 3QETA 3FZHA 4FLWA 4XIUA 4DR7K 4CEFA 4CF8A 1ILYA 4OGEA 3ZT3A 4LF9K 3OJUA 2YHWA 4X65K 3UKUB 3L2WA 1LAWA 3L4QA 3P31A 3NF9A 4CF9A 3O4QA 1SKWA 3CJ9A 1QVGM 1NGCA 1UOCA 4FJHA 3VEWA 3H3OB 1IJJA 1W9HA 3HBTA 1Q7YO 3CM5A 4X66K 4DB3A 4Z4IA 5HRNA 4O44A 2Q1NA 3QEXA 2GWJA 3MN6A 4W5QA 1BIUA 4KFBA 3VQ9A 1E3MA 3THWA 1C0TA 4BRKA 1YUWA 1S3XA 1GLAG 1T44A 4PQUA 2P9KB 4BWJA 4GKKK 2Q97A 3I8BA 5BR8K 2D1KA 3SQ1A 3CERA 4CHYA 2JWLA 3L2UA 4CJTA 2HHVA 4LSLA 4Y1DA 2WUSA 4DKWA 1VSIA 3TI0A 4EAHD 4FJ8A 1HPMA 4ILJA 3VTIA 2F4VK 1S1UA 1T3VA 1NK5A 4PKHA 2QWQA 3C6TA 1KSPA 3QEVA 3BGRA 4G1QA 2YNFA 3GE1A 3V9SA 5I3UA 4TSXA 4C1NI 3F9KA 1JKHA 3HTVA 2F8TA 4MO4A 1UA1A 5AQTA 4G9ZA 4XH4A 4OGCA 5AFUH 3SPZA 3NDKA 4JI0K 4PWDA 3PX6A 4BC3A 4DU3A 3QEPA 4A62A 3AVIA 3TSUA 3L3VA 5KI6A 4C8NA 1VQMN 2NNWA 1HMVA 1RTJA 4B1YB 3TAPA 4CHNA 1HKBA 5AR0A 4IDHA 3IDHA 5C2FA 1T7PA 3DRSA 5CZ1A 4KRFA 1W2BM 3QBWA 4DFKA 4CZHA 3SAGA 4B3OA 3CCEN 1SKSA 3WXMB 5TKWA 4CJWA 3HK2A 4LH5A 4DV3K 3LM2A 4Z0UA 1NLVA 4FLXA 3NBPA 1WSEA 3AVAA 1RDDA 2IVPA 4YNQA 2VWKA 1X3NA 2ZF5O 4RW9A 2PYLA 1C0FA 3IKMA 3VQ7A 4UY8O 2HHQA 1O1WA 4NYFA 4PY5A 5JVHL 4JKGA 1TKTA 5SZTA 1JL1A 2UYTA 5ELZA 3ZSVA 1XQSC 1YJWN 3V1OA 4LFCK 4IDKA 5GIPA 5AQOA 1N32K 4M7XA 1ZBFA 4OO1J 3U6FA 2IIRA 4CJ5A 4ID5A 3QBXA 4DSLA 3WXIA 4R79A 4L3QA 5KGWA 4FWRA 4BR5A 4JV5K 2HHTA 2GX9A 2BUPA 2NRVA 3VQDA 1YHQN 4ILGB 4FXDA 3CFOA 1LW2A 3DLGA 4DSEA 4CEDA 4ISEA 3IFRA 3SPYA 1EETA 2GWKA 5AQWA 4CE9A 1LV5A 4PL7A 3GL1A 3LAMA 4U67L 3P1GA 3VQ4A 1M1KO 4DQRA 1EXQA 1QQOA 3S9HA 5FROA 4JKEA 2HHSA 4H5TA 4FZXC 3O4NA 4Z94A 1YJ9N 4QS7A 4B9UA 3EKSA 4LFAK 2QXLA 3HP6A 4CCHA 2YJFA 4KKOA 3LDPA 3TPQA 1CLQA 4KHSA 3OS1A 3M8PA 4CGGA 3CHWA 3KVGA 1S1TA 1KTQA 4DV5K 3THXB 5AZJA 1L3UA 5CZ2A 1LCUA 3HZ6A 2EX3A 3MMVA 2XHBA 5KGXA 1ATNA 2B4JA 4QOZB 1DEJA 4E7HA 5AQKA 3M3ZA 4BY9C 2P9PA 4FLTA 2QW9A 4BRHA 4NXMK 1ZC6A 4MDAA 3THYA 1TGOA 1BQNA 2D0PA 2QWNA 3DXMA 3CCMN 2KZMA 4DTXA 4M3YA 3OY9A 2YCHA 2KZZA 3E1YA 1HYZA 2DPNA 1C1CA 4PKIA 5KPTA 1S1XA 4YDUC 1BI4A 1WAFA 5I42A 4J2EA 1G15A 3TAQA 5JMVA 3MCAB 4JNEA 3O6WA 3SUQA 2A40A 4AHUA 1IBKK 2P9IA 1NOZA 4HUFA 3KLHA 4Z4GA 5E41A 3PSIA 3BZCA 2QK9A 1MDUB 4DV2K 4FJNA 1T8EA 1XI1A 3D7EO 4BDZA 3KK1A 3PY8A 4M42A 4FW1A 2QWLA 1HNXK 5FPMA 5AQZA 2O8DB 3F5TA 1QSLA 3G25A 4N47A 5EOYA 4DU4A 3ZSRA 5KPRA 2GV9A 4CJKA 2VG6A 1DLOA 5AQNA 4V19S 3ID8A 1RFQA 3K2PA 3OYJA 2O4IA 4MFBA 4B1UB 3PO4A 4B1XB 3FZLA 3IS9A 3VQ6A 1HJOA 4F3OA 1WAJA 1Q9YA 2HF4A 2VWBA 3OYAA 2Q3SA 3O1WA 2WOMA 5LMUK 3N4PA 4ILHA 4YFUA 1KC8O 2VWJA 4RW6A 4HTLA 3QICA 4FK2A 4JI4K 1NK6A 1RT6A 1Q86O 3OYLA 3VQBA 1X9WA 1O13A 4LC9B 4CJVA 1TYQA 2HBJA 5GAEP 4DFPA 2VQFK 2Y1IA 3EE8A 1VSDA 1L3SA 2JGUA 3MN9A 3R3LA 3O9RA 1REVA 3J7ZO 3K0SA 1VRUA 3KTQA 2P9NA 3NHGA 2R7YA 3C6HA 3AA4A 1V4SA 3K9JA 4E89A 1MWMA 1QHAA 3KLIA 3SZ2A 1Y64A 4MDBA 4JI1K 3TAMA 1NGAA 4DQQA 1K6YA 4CJQA 3ZSQA 4JK8A 3OJSA 3C6UA 1IO2A 4O8KA 4CIGA 4DV1K 4JD2B 3HI0A 4M7YA 5EY4A 3VN5A 1KAYA 3ZT2A 3RR7A 1K9MO 3I56N 3FZMA 2P5OA 2FBVA 3SQ4A 2HNYA 3WEEA 1UAXA 4FM0A 1K8AO 5GINA 3QLHA 2Q0RA 1B92A 1U04A 1C0MA 3KZBA 4CJRA 1D9DA 5F2RA 4H5WA 3OBWA 3VQPA 3AO5A 3U9ZA 2QKKA 1NGDA 5EU7A 5MLCQ 3CF5L 2NRZA 4NCAA 3ZYYX 5AFUA 4I6MB 1T05A 4FJLA 3SK3A 1VSHA 2A3ZA 3VA0A 3AO1A 1E4GT 1ZYQA 1IKVA 3CJCA 4IZ9A 1YITN 1SL2A 3AA3A 4ICLA 4FL9A 3B8AX 1N6QA 1VQKN 3M6GA 3WNEA 3AVJA 1U45A 4GW6A 3CETA 3DLBA 4OKJA 4KHUA 2O8CA 1KXPA 1VRTA 2YNIA 4DV4K 1WSHA 3VESA 3ZSXA 3KKSA 4BGAA 3CQXA 2G8UA 2KFZA 3QFUA 1NGGA 4J8FA 4PA1A 3NE6A 3LP2A 5J2MA 3EO3A 3GOIA 1I39A 3BP8A 4M45A 3O9SA 4AHSA 4H0VB 2F9TA 2QI2A 1S1VA 4A59A 3MWPA 4C8OA 2HHUA 3ZX3A 1CZBA 2XY8A 3FFKB 4PUOA 4OPAA 3L2QA 3FZKA 1NGIA 4EP4A 5BPMA 3D0PA 4CEBA 2QWOA 4DR5K 4BR0A 1C0UA 3VQEA 1BDGA 2VGMA 3QERA 4LF4K 1J5EK 5GIOA 2WONA 5AQMA 4BREA 4Z4FA 1KVAA 2XY6A 1A5WA 2FXUA 5H1SQ 1B9DA 2HF3A 4K25A 4RW8A 5M1FA 2QWMA 4YY3K 2WTUA 1QQCA 4DR2K 4GMJB 2OPPA 1S6PA 5AQXA 3CM6A 3ISNC 3WQUA 2UXBK 3H1VX 2Q0UA 2BANA 3VQ8A 4JI7K 2G8IA 1QS4A 2IC3A 4AHVA 4BC5A 4FJXA 3BDPA 3AO2A 1ITGA 4AHRA 3IRXA 1OKJA 4OJRA 1QQNA 5ADXH 3DLEA 1YIJN 4F4KA 5KPZA 2IS3A 1IG8A 3OYBA 4H03B 3P83D 3NGZA 2RE2A 3RMCA 1W7AA 3KWIA 5AQGA 4JS4A 2X74A 4DV6K 4HVJA 4B9LA 3RTVA 1D9FA 3K58A 2HSTA 3HOSA 2GUIA 1Q9XA 4BRGA 3P38A 4H0OA 4CEZA 2G8KA 4IOAL 4IKFA 5EXWA 3NH2A 4FYDA 3RSEA 3BZKA 3EL2A 3OTOK 1GOCA 3TTDA 4WF9L 5HLFA 1TV6A 4DMNA 4IO8A 3UE5A 1OH5A 4J2BA 5FPEA 2XO7A 3HO1A 4FLUA 2HOEA 4HUGA 3SAHA 2Q2RA 1W0HA 1K73O 4GVEA 1YTUA 4XEIA 3L4IA 2NRRA 1VQLN 4WQ5C 3AVKA 3C7NA 4FLZA 4UQGA 1IKYA 3NCIA 2YV0X 2ZJQL 4KH4A 2E1YA 2HMIA 3ALYA 4M3RA 1S6QA 1WB9A 3HL8A 3PIOL 2OPQA 1JCGA 4CFCA 2E2NA 4CIEA 5LJVA 2FSKA 3H08A 2O8EA 4E7IA 3PSFA 2KFNA 4WFAL 3O9UA 3RWUA 1OH7A 1VHXA 3ENHA 3NF8A 5BN9A 4JHDB 3WUHA 1WLJA 4A5BA 4GKJK 2EHGA 4C8KA 4CECA 2W42A 2A6AA 4DCHA 5FLXO 2ZM6K 3EY1A 2BDPA 2PFUA 3DAWA 3QB0A 3MEGA 4DG1A 1NU0A 4FOEA 3VGMA 3ZX2A 1BCMA 2Q31A 4DWIA 2P9LB 1XC3A 1B9FA 3I0RA 3BF3A 4K8XA 1DTQA 4MLHA 1VQ5N 1ZBLA 2QWRA 4BRLA 2JWKA 4W5RA 3ZEUA 1NK7A 2OANA 1ATRA 1NM1A 4PL8A 3A5LC 1RTDA 1RCHA 4C8MA 2PYJA 1JLFA 1NG9A 1HJRA 2O8BB 1RGIA 1OH8A 1RNHA 1JCEA 3CPEA 3UKRB 3RRHA 2P9SB 1NJIO 1KVCA 3S3NA 3D2FA 3A5MC 4DUZK 4DTNA 1SUQA 1RDCA 5A2QO 4JK7A 4MQ3A 4CHQA 3QFPA 1WSIA 5FDLA 4JEPA 5KRSA 1XNQK 2P9UA 5DK5A 4RCHA 2AP1A 4B9QA 4B9TA 2OPSA 1NMDA 4EZ6A 1VAZA 3MEDA 4DF8A 2UUAK 3WXJA 4MO5A 2P5GA 2YNHA 4B9NA 3K5LA 5AZIB 4A61A 2DFHA 3H1QA 3WNHA 3L2VA 4I2PA 1JL2A 4O0JA 2E8AA 3KWGA 4DTSA 1I94K 3VF2A 1FW6A 4E19A 4CZFA 2O8FA 3EEQA 3KJVA 1TL1A 1JCFA 1SQKA 5AQJA 4W5TA 1CXQA 3ZETA 4CZLA 3O3FA 2WBNA 4FJJA 3MK6A 5JICA 4K0KK 4W5NA 4N56A 3HT3A 2W6LA 3SQ2A 1YF5L 3MEEA 4DF4A 4LY7A 3NF6A 1U2VB 4EHTA 5HL7L 3O8MA 4AHTA 3LP3A 4CF1A 4CGIA 3DJCA 3R9PA 3LDQA 4I2QA 2HVIA 5AQPA 1I3AA 1F21A 2AJQA 3MECA 1BL3A 4JS5A 2HNDA 4YOWA 3RMDA 3QEWA 1RBRA 4AM7A 4FJMA 3O9QA 3DLKA 3ULEA 3QIPA 3D2EA 3V9ZA 5J2PA 3OYNA 4FWNA 4A5AA 4DV0K 3U9DA 4NB4A 3LP1A 4YDUA 4KTWA 3M8QA 4DSFA 4CHOA 5LL6Z 1T6CA 3MAQA 4E1NA 4FO0A 2D0OA 1BOTO 3JAMO 3RRGA 3AA2A 3KLGA 3HYFA 4IOXA 2IGIA 4L8RB 3LDOA 3I33A 4JK9A 2FBYA 1RT5A 4ZHRA 3CYMA 3I8DA 4O5FA 3P39A 3E9PA 3IAYA 2I7NA 3VTHA 4FPBA 1X9JA 3KKRA 3O1BA 3AGRA 2ATQA 3T7ZA 4LF8K 2YHXA 4JKFA 3VEVA 2NLXA 4B08A 2HBKA 3UKUA 4DR1K 3J8AA 4NYNA 1JLAA 1NNEA 4ELTA 3LDNA 3SQ0A 4OLBA 5C24A 4B1WB 3AY9A 4DQPA 4BR4A 4HTUA 3VF6A 1VSLA 4H4OA 4O5BA 4BVPA 2I7PA 1RILA 3NGIA 1ATSA 1Z25A 3OYFA 4JRPA 4EFHA 2OA8A 3FLCO 4JI5K 3C65A 3K5OA 4BWMA 5AQFA 5JVGL 1BU6O 1NGFA 4CJEA 5AQLA 2P9KA 2F96A 3CCLN 1J6ZA 4CK1A 1J54A 1GLEG 4CK2A 3VERA 4JRQA 1RBUA 3LM9A 3AGKA 1UWBA 3W0LA 4CJ7A 5CYQA 4DS5A 2KHOA 1RTHA 5CY4A 1VSKA 3KLFA 5JS1A 4CGJA 1FJGK 4W5OA 1BGXT 3CIPA 3MN5A 3KLEA 3VQCA 2VG7A 4ELVA 3CCJN 4FK0A 3LPUA 3SV4A 1RTIA 4CF0A 2G8VA 3AV9A 1ASUA 1NBWA 4CHPA 4LF7K 2FSNA 4DSKA 4QAGA 4HHTA 3OYDA 2UUBK 1NJWA 4ID1A 3WNFA 2A1SA 1WNSA 1K8KB 1MWKA 3O4WA 2DTUA 1Z26A 3QO9A 3DMJA 5HRSA 2YKNA 1RDBA 3FE1A 1U49A 4DS4A 5E26A 1SZ2A 2RF2A 3F9MA 4KI4A 4O0IA 3NF7A 5GAHP 2HBMA 1HUXA 5C12A 4KREA 3ATUA 3EKUA 3K59A 1N34K 4C1NK 3E9LA 4O8UA 1HKCA 2CH6A 2V7YA 5AQSA 4ZTJA 3KD5E 2X78A 3VEOA 1LW0A 4X62K 4BRDA 4CEEA 4JN4A 3DXKB 2OZMA 3VMFB 3D6RA 4HUEA 3DLRA 1VSFA 2OZSA 1S9GA 2G8FA 3OYEA 1E4FT 3RMBA 3TARA 1WBBA 4FWKA 4WFNL 3LP0A 3OYKA 2YKMA 3LZJA 3G0ZA 4CZKA 3VGKA 3LL3A 5F1XA 3CJAA 2XY5A 3A0IX 3J80O 3CC7N 1KQSM 1TAQA 4FW2A 3SUPA 2KW4A 4BC4A 1BISA 3QIOA 3QNOA 4M41A 1VQNN 1N8RO 3MDQA 3TR8A 4OKKA 4B9VA 4IOCL 3CC2N 3PX4A 2OTLN 4CZJA 3V81A 4WCEL 1ZXOA 4BRAA 1QTMA 3OYIA 1J9AA 2H3GX 1P90A 2NUBA 2E6LA 1WBDA 1C0GA 3ZT4A 5BRDA 3L2RA 4CZIA 3CQYA 3A5NC 4KHNA 1KFSA 3PX0A 4F3TA 2VCPA 1DTTA 4AH9A 4JKHA 3T19A 3O3HA 4FWPA 3NAEA 3VQQA 1RT2A 4H0PA 4IG3A 5BN8A 1LWCA 2CGLA 4QS9A 1EWRA 4HCCA 3THWB 1HNZK 3D45A 1QZ5A 5K14A 1SL1A 1FKOA 1HPZA 1RDAA 4LF6K 4BGBA 5HRRA 1JJ2M 1Q8IA 5I9EB 3AVNA 2E2QA 4BACA 2ZE2A 3NGYA 5HBMA 5AQYA 1S1WA 2HW3A 5M1NA 2E20A 2QXFA 3OYHA 4FCYA 1NKBA 3NVKA 5AQRA 3FR0A 5AQHA 5C10A 5KQDA 4FJKA 3PO5A 4H0TB 4M3ZA 2FBTA 4DV7K 3UIQA 2ASPA 3THXA 3AAPA 3R1XA 1XWLA 1BA0A 4CZGA 2RHKA 1L3TA 2UXCK 1YAGA 2CH5A 4DR4K 3CJ1A 4WQ4C 2VGNA 3O3GA 1XHXA 3NH1A 1QE1A 1L5UA 1U47A 4DTUA 3SAFA 1NK0A 3K57A 4E0DA 3H6EA 5FRMA 1BWFO 4BROA 4GY2B 3TWHA 1XNRK 2HB5A 3BF1A 5C2DA 5HROA 4IJAA 3AVMA 2DFEA 3L3UA 1HQEA 1TKXA 3F73A 1KRPA 3E01A 5KRTA 1S9EA 3LWMA 1ASWA 2Q36A 2A42A 1QHTA 4EP5A 4F8RA 4N76A 3L8BA 4BDPA 2QM1A 3BUZB 4N41A 4FWSA 2FLOA 5CR4A 1NOYA 4WQ5A 4BE1A 1TK0A 3SLCA 3AO3A 1SL0A 1RBSA 2YJEA 2BH1A 4CJUA 2O8DA 3L0QA 3ZT1A 1YVNA 3OBYA 3DOLA 3NVMA 4BC2A 4RW7A 2E4LA 2CGKA 2YNGA 3S3MA 2V51B 4NXNK 3U3GA 3SMSA 1NKCA 2OYQA 3G71N 4FJ9A 2ZGZA 1IKWA 3DWLA 3VQ5A 5FPNA 1JLGA 1D8YA 1HX1A 4GNIA 3KK7A 2FF3B 4IBNA 3NH0A 4CJ3A 4KBOA 3O08A 3R6MA 4KTZA 4JKGB 2HBLA 1YVUA 4DQSA 2YHAA 4K8ZA 1VSJA 4YOTA 3HM8A 4J2AA 1WUAA 3U4LA 3QEIA 4HCBA 3CI5A 4FJ5A 1U6ZA 2PZSA 3SI6A 4DQ8A 1HNIA 1ESVA 4CHZA 3H46O 2RPIA 3V9UA 5IT9O 4Z4CA 5C25A 3OW2M 2D5RA 1GOAA 2QEXN 1R59O 4LFBK 3AVCA 3QMLA 4FWLA 3SV3A 3ENBA 4GV9A 2CGJA 4LSNA 1QVFM 3JSMA 1J5OA 1TKDA 4DTPA 1N5YA 5DMRA 2RKIA 1LAVA 3OYCA 2HHXA 2ZJRL 5TKYA 3WXKA 4ZTFA 3JXUA 4FPAA 3WT0A 4AILC 4WFBL 1EX4A 3ZSYA 2P1JA 3WQTA 3K9KA 2X6NA 3LZIA 2DY4A 4ISFA 4OPHA 4FLVA 1R0AA 3CC4N 2VYPA 2HNZA 4JD2A 4NO7A 3RMAA 1OVYA 4CBUA 1BO5O 4F2SA 2OCEA 3S3OA 4BE0A 3M8SA 1YI2N 3NFAA 3TANA 5CYMA 3FZFA 2BGGA 2IAJA 1TUYA 3F2KA 3SBTA 3VEZA 2UUCK 4DSJA 4JYAK 3HP9A 1VQ4N 1ASVA 3LWLA 1BIZA 2G8HA 3CCUN 1VQ6N 1ZBHA 3SUNA 3AO4A 3MCPA 1TKZA 4CF2A 3V9XA 4ISGA 4IG0A 3P4IA 2KTQA 5AZJB 2V7ZA 2ZQBA 3TU5A 4I6MA 1RT4A 3MWTA 2QTDA 3GG4A 3MX2A 4K41A 4I9LA 5C15A 3TAEA 3B6OA 1CZAN 2P9PB 4IEIA 1EKEA 3VENA 1IG9A 4NCGA 3THYB 5JS2A 4CGDA 3CCSN 1XUPO 3DXMB 3VF4A 4CEAA 3CCQN 4IXCA 3HRGA 1Q81O 2YX6A 4CESA 4DR3K 4BDYA 4BQZA 2QKBA 3HVRA 2RN2A 2JLEA 4A2AA 1Q82O
chains in the Genus database with same CATH topology
3LANA 1BI4B 1VRUA 4OVLA 4O4GA 4RG8A 3KTQA 3NHGA 2R7YA 4OLAA 5J2NA 3AVLA 3AA4A 4B8CA 3KK2A 1RT1A 1JXBA 4B08A 4E89A 4KB1A 5HP1A 4M3UA 3KLIA 3SZ2A 3HM9A 4NYNA 1JLAA 3TAMA 4ELTA 3SQ0A 3C95A 4OLBA 5C24A 4DQQA 1K6YA 4CJQA 3ZSQA 3OJSA 3C6UA 4DQPA 4KHYA 1ZBUA 1IO2A 3DM2A 4HTUA 2Z1HA 4Y1CA 2E6MA 4B9SA 4CIGA 3FFIA 1VSLA 4H4OA 4O5BA 3VN5A 1RILA 3NGIA 1Z25A 3WNGA 2ETJA 3ZT2A 3OYFA 3RR7A 4JRPA 4CJLA 2OA8A 3K5OA 4DTOA 2OPRA 4CFAA 5D3GA 3G10A 3LDSA 4BWMA 1RT7A 4LD0A 2P5OA 2FBVA 3AA5X 3SQ4A 2HNYA 2IDOA 3SNNA 4DTRA 4DTMA 1UAXA 4KPYA 3MXIA 4Z4EA 2HVHA 4FM0A 1NJZA 1TVRA 4KV8A 3PUFA 4FZYA 4CJEA 1WSFA 4M3WA 4OPKA 1KLMA 3QLHA 1B92A 1U04A 2F96A 1C0MA 3DOKA 5C42A 4CJRA 1SKRA 2FC0A 4CK1A 1J54A 3OS2A 1D9DA 4KHQA 1T03A 4CK2A 4E7LA 3P5JA 3T3FA 1U4BA 1Y97A 4CERA 4JRQA 2A1RA 1RBUA 2IOCA 4AHCA 3VQPA 4CGHA 1UWBA 3AO5A 4BE2A 2QKKA 5SWMA 5EU7A 3DI6A 5CYQA 4DS5A 1IKXA 4NCAA 1T05A 2B5JA 4KAZA 4FJLA 3HXMA 1RTHA 5CY4A 3LPTA 4CEQA 3TAGA 1VSHA 3VA0A 3AO1A 1VSKA 3SUOA 3ZSZA 4KB0A 3KLFA 5JS1A 4CGJA 1ZYQA 1IKVA 2GBZA 4W5OA 1IH7A 1BGXT 1SL2A 1HYVA 3AA3A 4M3XA 3DRPA 1WN7A 4CFDA 2Z1GA 4ICLA 1CZ9A 5FRNA 1A5VA 3KLEA 1LWFA 3VQCA 1L3VA 3CG7A 2VG7A 3LAKA 1VK0A 1N6QA 4ELVA 3WNEA 1NK9A 3AVJA 1U45A 1XC9A 4ELUA 4FK0A 1D5AA 4E3SA 4B9MA 3LPUA 4GW6A 3SV4A 5J2QA 1RTIA 4DFMA 4CF0A 2G8VA 3DLBA 4OKJA 3AV9A 4F2RA 4KHUA 1FK9A 1ASUA 4FJGA 3AVBA 4CHPA 2X6SA 2XY7A 3QETA 4H4MA 1VRTA 2YNIA 3HSTB 4FLWA 4DSKA 1WSHA 3ZSXA 4XIUA 4QAGA 4CEFA 4CF8A 3OYGA 3KKSA 4OGEA 3ZT3A 4HHTA 3OJUA 3OYDA 2G8UA 1NJWA 1S5JA 4ID1A 3L2WA 3WNFA 2KFZA 2A1SA 1LAWA 1WNSA 3NF9A 4CF9A 3O4QA 4PA1A 3NE6A 1SKWA 1Z26A 2DTUA 3QO9A 3DMJA 5HRSA 2YKNA 1RDBA 3LP2A 1U49A 1UOCA 4FJHA 4DS4A 3HVTA 3ULDA 5J2MA 1W9HA 1I39A 4M45A 3CM5A 2RF2A 3ITHA 4AHSA 4KI4A 3SCXA 4O0IA 3U3YA 4Z4IA 5HRNA 3NF7A 4O44A 3QEXA 1S1VA 2Z1JA 1NK8A 4W5QA 4C8OA 1BIUA 4KFBA 3VQ9A 4KREA 2HHUA 3K59A 1CZBA 2XY8A 3TAFA 1MU2A 4PUOA 3L2QA 3V9WA 4EP4A 3SJJA 4ZTJA 1C0TA 1HRHA 3D0PA 4CEBA 3V4IA 3KD5E 2X78A 1C0UA 1LW0A 3VQEA 4CEOA 4PQUA 3QERA 4BWJA 1C6VA 1C1BA 2WONA 3K5MA 3AVHA 2P51A 4CEEA 4Z4FA 1RBVA 1KVAA 2XY6A 1A5WA 4QCLA 2OZMA 1JLCA 1HNVA 3SQ1A 4CHYA 1U48A 3CFPA 3L2UA 4HUEA 1UA0A 1B9DA 3RR8A 3DLRA 4CJTA 2HHVA 1VSFA 2ITGA 4LSLA 4RW8A 3ASMA 2OZSA 1S9GA 4Y1DA 2G8FA 3OYEA 1QQCA 3RMBA 3TARA 1VSIA 4GMJB 3HPGA 2OPPA 1S6PA 3TI0A 1YTAA 3LP0A 3OYKA 2YKMA 3CM6A 3ISNC 3LZJA 4FJ8A 3C94A 3G0ZA 1GOBA 2BANA 1S1UA 3VQ8A 1NK5A 2G8IA 4FJ7A 3THVA 1QS4A 2IC3A 3HPHA 4AHVA 2XY5A 3C6TA 1KSPA 3QEVA 3BGRA 4G1QA 1TAQA 2YNFA 3BDPA 4FW2A 3SUPA 4FJXA 3DLHA 2KW4A 3AO2A 1ITGA 3V9SA 5I3UA 4TSXA 4AHRA 1BISA 3QIOA 3KIOA 3QNOA 3IRXA 4OJRA 3F9KA 1JKHA 4M41A 2F8TA 1HYSA 1FKPA 1UA1A 3TR8A 4OKKA 4B9VA 3DLEA 4F4KA 4Z4HA 2IS3A 3OYBA 2VG5A 3P83D 4OGCA 3NGZA 3PX4A 3RMCA 3SPZA 3NDKA 3V81A 4PWDA 3SYZA 3PX6A 4DU3A 3QEPA 3AVIA 3L3VA 4JS4A 2X74A 2YHBA 3V1QA 4HVJA 5KI6A 4C8NA 1QTMA 4B9LA 3OYIA 1J9AA 3RTVA 1D9FA 1YT3A 2NUBA 1HMVA 2E6LA 3K58A 4Q0BA 1RTJA 3ZT4A 3L2RA 2GUIA 4KHNA 3TAPA 4CHNA 1KFSA 3PX0A 4F3TA 1VSEA 1Q9XA 3TABA 1DTTA 2I5JA 4AH9A 4O55A 4CEZA 3T19A 3AVFA 3O3HA 2G8KA 1T7PA 4IKFA 3NAEA 3DRSA 3VQQA 1RT2A 3NH2A 4IG3A 5CZ1A 1X9MA 4KRFA 2O4GA 1LWCA 4FYDA 3OYMA 1SV5A 4DFKA 3VA3A 4I9QA 4DSIA 4HCCA 1GOCA 5HLFA 3KD1E 4WE1A 4B3OA 3D45A 5K14A 1SL1A 1FKOA 1HPZA 1RDAA 1SKSA 4EZ9A 1NJYA 1FXXA 1JLQA 1QSSA 1TV6A 1WSGA 4CJWA 4CJFA 5HRRA 4E7KA 4DMNA 4LH5A 4FJIA 3HK2A 3PV8A 1Q8IA 3M8RA 1NJXA 4J2BA 3AVNA 2XO7A 3A2FA 4Z0UA 2ZE2A 1KCFA 3NGYA 5HBMA 4BACA 1S1WA 2DFFA 4FLXA 3HO1A 2HW3A 4FLUA 3OVNA 3HJFA 4FCYA 4HUGA 2QXFA 3NBPA 3OYHA 1NKBA 1WSEA 3AVAA 1RDDA 1W0HA 4YNQA 2VWKA 1YTUA 4RW9A 2PYLA 2LSNA 4FJKA 3PO5A 3AVKA 4M3ZA 4FLZA 2FBTA 3VQ7A 4UQGA 4CJ4A 2HHQA 1TK5A 1O1WA 3UIQA 1IKYA 4CFBA 3ZCMA 2YV0X 3NCIA 4NYFA 2HMIA 4PY5A 3ALYA 1TKTA 4M3RA 1S6QA 5SZTA 1XWLA 1JL1A 3CFRA 4CJSA 4FLYA 3B6PA 3HL8A 1KLNA 3V1RA 3QNNA 1X9SA 1L3TA 3ZSVA 2OPQA 4NCBA 4CFCA 3ZSWA 3V1OA 4CIEA 3H08A 4E7IA 4IDKA 3O3GA 2BE2A 1RT3A 1XHXA 3NH1A 4J2DA 1QE1A 2KFNA 3ZT0A 3CQ8A 1QSYA 1L5UA 1U47A 3RWUA 1ZBFA 3U6FA 4DTUA 4DU1A 3NF8A 1NK0A 4CJ5A 4ID5A 1WLJA 3K57A 4DSLA 4E0DA 4E1MA 2HHWA 5FRMA 2EHGA 4C8KA 4CECA 2W42A 5KGWA 3TWHA 2HB5A 3EY1A 4DLGA 2BDPA 3MEGA 1CXUA 4CIFA 2HHTA 3IG1A 5HROA 3AVMA 2DFEA 4DG1A 3L3UA 1JLBA 1HQEA 1TKXA 3VQDA 3F73A 1XHZA 1KRPA 3E01A 1BCMA 1KVBA 1S9EA 5KRTA 4FXDA 3LWMA 1ASWA 3CFOA 4DWIA 1LW2A 3DLGA 1TL3A 4IFYA 1C1AA 4DSEA 4CEDA 3SPYA 1QHTA 4EP5A 4DQIA 1EETA 4CE9A 4F8RA 1LV5A 4N76A 3L8BA 4BDPA 4N41A 1B9FA 3LAMA 2B6AA 3P1GA 3VQ4A 1NOYA 3I0RA 1EXQA 4BE1A 4DQRA 3S9HA 4KTQA 4K8XA 1DTQA 1TK0A 3EYZA 5FROA 1ZBLA 2HHSA 4FZXC 3AO3A 1SL0A 1EP4A 3O4NA 3V6DA 1RBSA 1TAUA 4CJUA 4W5RA 4B9UA 1JLEA 2ZD1A 3VQAA 3ZT1A 4N5SA 1NK7A 3EZ5A 3DOLA 4RW7A 2E4LA 3HP6A 4CCHA 2YNGA 3OS0A 3S3MA 1RTDA 1RCHA 3U3GA 4C8MA 1NKCA 2PYJA 1JLFA 2OYQA 4KKOA 4KHWA 1HJRA 4FJ9A 1IKWA 3VQ5A 1CLQA 4KHSA 3OS1A 1JLGA 3M8PA 1RNHA 1D8YA 4CGGA 3DRRA 3RRHA 1KVCA 1S1TA 3S3NA 4IBNA 3NH0A 1NK4A 4CJ3A 4FZZA 4DTNA 1SUQA 1KTQA 1RDCA 3QINA 4MQ3A 1JXEA 4KTZA 1L3UA 4CHQA 5CZ2A 1YVUA 1WSIA 2EX3A 5FDLA 4DQSA 2YHAA 1NKEA 1VSJA 4K8ZA 4CK3A 2XHBA 4J2AA 4LH4A 5KGXA 2B4JA 3QEIA 4HCBA 5KRSA 4OPJA 4QOZB 5DK5A 4E7HA 4FJ5A 3AVGA 1A5XA 4B9TA 2OPSA 4EZ6A 2F8SA 1TK8A 2PZSA 3SI6A 1LWEA 1HNIA 3MEDA 4DF8A 4FLTA 4CHZA 2P5GA 5KTQA 2D0BA 2YNHA 2RPIA 4B9NA 3K5LA 3V9UA 4JLHA 2DFHA 3WNHA 4Z4CA 5C25A 3L2VA 4I2PA 1JL2A 1TGOA 4O0JA 4OKEA 1BQNA 2D5RA 4DTSA 1GOAA 4KI6A 3AVCA 3SV3A 1KFDA 3HPOA 4E19A 1J53A 2KZMA 4R5PA 4DTXA 1HQUA 3ZSOA 2G8WA 3JYTA 4M3YA 3OY9A 2KZZA 3QESA 1HYZA 1WSJA 4LSNA 4H8KA 3JSMA 3KJVA 1C1CA 1J5OA 1TL1A 1S1XA 1TKDA 5I42A 1BI4A 1WAFA 4DTPA 5DMRA 1N5YA 4J2EA 2RKIA 1LAVA 4GVMA 4W5TA 3OYCA 5T7BA 2HHXA 1G15A 1CXQA 3TAQA 4DTJA 1BCOA 4CGFA 3O3FA 4ZTFA 3MXMA 4FJJA 4FK4A 2Z1IA 3SUQA 4AHUA 4W5NA 4N56A 3HT3A 1NOZA 4HUFA 3KLHA 4AILC 4Z4GA 2XRIA 3SQ2A 1EX4A 3MEEA 5E41A 4DF4A 1BHLA 3ZSYA 2QK9A 4LY7A 3NF6A 2P1JA 3I0SA 2X6NA 3LZIA 1ZBIA 2DY4A 4FLVA 4AHTA 3LP3A 1R0AA 1T8EA 4FJNA 4CF1A 4CGIA 4BDZA 1XI1A 1RBTA 2HNZA 3KK1A 3PY8A 4M42A 4FW1A 4M3TA 3RMAA 4I2QA 5J1EA 4F2SA 3S3OA 2FBXA 4BE0A 1QSLA 1I3AA 3M8SA 2Y1JA 2HVIA 1F21A 4N47A 1BQMA 3NFAA 4DU4A 5CYMA 3TANA 3MECA 3ZSRA 1BL3A 2BGGA 2IAJA 2AJQA 2GV9A 4DSJA 4JS5A 2HNDA 3HP9A 2VG6A 4CJKA 1ASVA 3LWLA 1BIZA 3RMDA 1DLOA 2G8HA 3QEWA 1RBRA 3K2PA 3OYJA 1ZBHA 3SUNA 4FJMA 2O4IA 3AO4A 4MFBA 4RW4A 3PO4A 2PY5A 1TKZA 4CF2A 3DLKA 4FM1A 3V9XA 2D0AA 3IS9A 3VQ6A 4DLEA 5HRPA 4E7JA 3QIPA 4F3OA 1WAJA 4IG0A 2KTQA 2D0CA 3MXJA 1Q9YA 3V9ZA 5J2PA 4FVMA 3OYNA 3OYAA 2ZQBA 4FM2A 3K5NA 3LP1A 1RT4A 2Q3SA 2KQ2A 3DYAA 2WOMA 4YFUA 4I9LA 4KTWA 4I7FA 3M8QA 2VWJA 4RW6A 4CHOA 4DSFA 3MAQA 3TAEA 4E1NA 4FK2A 1NK6A 1RT6A 3B6OA 1X1PA 3RRGA 1EKEA 3AA2A 3KLGA 3HYFA 1IG9A 2IGIA 4NCGA 4DFJA 3OYLA 4L8RB 2FBYA 3VQBA 1X9WA 5JS2A 1RT5A 4ZHRA 3KK3A 4CGDA 3CYMA 4Q5VA 4CJVA 4IFVA 4DFPA 4B8AB 3I8DA 2Y1IA 4CEAA 1VSDA 4C8LA 3IAYA 3T1AA 1VSMA 4CJPA 4CESA 4BDYA 1L3SA 2JGUA 3LALA 2QKBA 3HVRA 2RN2A 3KKRA 2JLEA 1REVA 4KO0A 2ATQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LAN A;  1BI4 B;  1VRU A;  4OVL A;  4O4G A;  4RG8 A;  3KTQ A;  3NHG A;  2R7Y A;  4OLA A;  5J2N A;  3AVL A;  3AA4 A;  4B8C A;  3KK2 A;  1RT1 A;  1JXB A;  4B08 A;  4E89 A;  4KB1 A;  5HP1 A;  4M3U A;  3KLI A;  3SZ2 A;  3HM9 A;  4NYN A;  1JLA A;  3TAM A;  4ELT A;  3SQ0 A;  3C95 A;  4OLB A;  5C24 A;  4DQQ A;  1K6Y A;  4CJQ A;  3ZSQ A;  3OJS A;  3C6U A;  4DQP A;  4KHY A;  1ZBU A;  1IO2 A;  3DM2 A;  4HTU A;  2Z1H A;  4Y1C A;  2E6M A;  4B9S A;  4CIG A;  3FFI A;  1VSL A;  4H4O A;  4O5B A;  3VN5 A;  1RIL A;  3NGI A;  1Z25 A;  3WNG A;  2ETJ A;  3ZT2 A;  3OYF A;  3RR7 A;  4JRP A;  4CJL A;  2OA8 A;  3K5O A;  4DTO A;  2OPR A;  4CFA A;  5D3G A;  3G10 A;  3LDS A;  4BWM A;  1RT7 A;  4LD0 A;  2P5O A;  2FBV A;  3AA5 X;  3SQ4 A;  2HNY A;  2IDO A;  3SNN A;  4DTR A;  4DTM A;  1UAX A;  4KPY A;  3MXI A;  4Z4E A;  2HVH A;  4FM0 A;  1NJZ A;  1TVR A;  4KV8 A;  3PUF A;  4FZY A;  4CJE A;  1WSF A;  4M3W A;  4OPK A;  1KLM A;  3QLH A;  1B92 A;  1U04 A;  2F96 A;  1C0M A;  3DOK A;  5C42 A;  4CJR A;  1SKR A;  2FC0 A;  4CK1 A;  1J54 A;  3OS2 A;  1D9D A;  4KHQ A;  1T03 A;  4CK2 A;  4E7L A;  3P5J A;  3T3F A;  1U4B A;  1Y97 A;  4CER A;  4JRQ A;  2A1R A;  1RBU A;  2IOC A;  4AHC A;  3VQP A;  4CGH A;  1UWB A;  3AO5 A;  4BE2 A;  2QKK A;  5SWM A;  5EU7 A;  3DI6 A;  5CYQ A;  4DS5 A;  1IKX A;  4NCA A;  1T05 A;  2B5J A;  4KAZ A;  4FJL A;  3HXM A;  1RTH A;  5CY4 A;  3LPT A;  4CEQ A;  3TAG A;  1VSH A;  3VA0 A;  3AO1 A;  1VSK A;  3SUO A;  3ZSZ A;  4KB0 A;  3KLF A;  5JS1 A;  4CGJ A;  1ZYQ A;  1IKV A;  2GBZ A;  4W5O A;  1IH7 A;  1BGX T;  1SL2 A;  1HYV A;  3AA3 A;  4M3X A;  3DRP A;  1WN7 A;  4CFD A;  2Z1G A;  4ICL A;  1CZ9 A;  5FRN A;  1A5V A;  3KLE A;  1LWF A;  3VQC A;  1L3V A;  3CG7 A;  2VG7 A;  3LAK A;  1VK0 A;  1N6Q A;  4ELV A;  3WNE A;  1NK9 A;  3AVJ A;  1U45 A;  1XC9 A;  4ELU A;  4FK0 A;  1D5A A;  4E3S A;  4B9M A;  3LPU A;  4GW6 A;  3SV4 A;  5J2Q A;  1RTI A;  4DFM A;  4CF0 A;  2G8V A;  3DLB A;  4OKJ A;  3AV9 A;  4F2R A;  4KHU A;  1FK9 A;  1ASU A;  4FJG A;  3AVB A;  4CHP A;  2X6S A;  2XY7 A;  3QET A;  4H4M A;  1VRT A;  2YNI A;  3HST B;  4FLW A;  4DSK A;  1WSH A;  3ZSX A;  4XIU A;  4QAG A;  4CEF A;  4CF8 A;  3OYG A;  3KKS A;  4OGE A;  3ZT3 A;  4HHT A;  3OJU A;  3OYD A;  2G8U A;  1NJW A;  1S5J A;  4ID1 A;  3L2W A;  3WNF A;  2KFZ A;  2A1S A;  1LAW A;  1WNS A;  3NF9 A;  4CF9 A;  3O4Q A;  4PA1 A;  3NE6 A;  1SKW A;  1Z26 A;  2DTU A;  3QO9 A;  3DMJ A;  5HRS A;  2YKN A;  1RDB A;  3LP2 A;  1U49 A;  1UOC A;  4FJH A;  4DS4 A;  3HVT A;  3ULD A;  5J2M A;  1W9H A;  1I39 A;  4M45 A;  3CM5 A;  2RF2 A;  3ITH A;  4AHS A;  4KI4 A;  3SCX A;  4O0I A;  3U3Y A;  4Z4I A;  5HRN A;  3NF7 A;  4O44 A;  3QEX A;  1S1V A;  2Z1J A;  1NK8 A;  4W5Q A;  4C8O A;  1BIU A;  4KFB A;  3VQ9 A;  4KRE A;  2HHU A;  3K59 A;  1CZB A;  2XY8 A;  3TAF A;  1MU2 A;  4PUO A;  3L2Q A;  3V9W A;  4EP4 A;  3SJJ A;  4ZTJ A;  1C0T A;  1HRH A;  3D0P A;  4CEB A;  3V4I A;  3KD5 E;  2X78 A;  1C0U A;  1LW0 A;  3VQE A;  4CEO A;  4PQU A;  3QER A;  4BWJ A;  1C6V A;  1C1B A;  2WON A;  3K5M A;  3AVH A;  2P51 A;  4CEE A;  4Z4F A;  1RBV A;  1KVA A;  2XY6 A;  1A5W A;  4QCL A;  2OZM A;  1JLC A;  1HNV A;  3SQ1 A;  4CHY A;  1U48 A;  3CFP A;  3L2U A;  4HUE A;  1UA0 A;  1B9D A;  3RR8 A;  3DLR A;  4CJT A;  2HHV A;  1VSF A;  2ITG A;  4LSL A;  4RW8 A;  3ASM A;  2OZS A;  1S9G A;  4Y1D A;  2G8F A;  3OYE A;  1QQC A;  3RMB A;  3TAR A;  1VSI A;  4GMJ B;  3HPG A;  2OPP A;  1S6P A;  3TI0 A;  1YTA A;  3LP0 A;  3OYK A;  2YKM A;  3CM6 A;  3ISN C;  3LZJ A;  4FJ8 A;  3C94 A;  3G0Z A;  1GOB A;  2BAN A;  1S1U A;  3VQ8 A;  1NK5 A;  2G8I A;  4FJ7 A;  3THV A;  1QS4 A;  2IC3 A;  3HPH A;  4AHV A;  2XY5 A;  3C6T A;  1KSP A;  3QEV A;  3BGR A;  4G1Q A;  1TAQ A;  2YNF A;  3BDP A;  4FW2 A;  3SUP A;  4FJX A;  3DLH A;  2KW4 A;  3AO2 A;  1ITG A;  3V9S A;  5I3U A;  4TSX A;  4AHR A;  1BIS A;  3QIO A;  3KIO A;  3QNO A;  3IRX A;  4OJR A;  3F9K A;  1JKH A;  4M41 A;  2F8T A;  1HYS A;  1FKP A;  1UA1 A;  3TR8 A;  4OKK A;  4B9V A;  3DLE A;  4F4K A;  4Z4H A;  2IS3 A;  3OYB A;  2VG5 A;  3P83 D;  4OGC A;  3NGZ A;  3PX4 A;  3RMC A;  3SPZ A;  3NDK A;  3V81 A;  4PWD A;  3SYZ A;  3PX6 A;  4DU3 A;  3QEP A;  3AVI A;  3L3V A;  4JS4 A;  2X74 A;  2YHB A;  3V1Q A;  4HVJ A;  5KI6 A;  4C8N A;  1QTM A;  4B9L A;  3OYI A;  1J9A A;  3RTV A;  1D9F A;  1YT3 A;  2NUB A;  1HMV A;  2E6L A;  3K58 A;  4Q0B A;  1RTJ A;  3ZT4 A;  3L2R A;  2GUI A;  4KHN A;  3TAP A;  4CHN A;  1KFS A;  3PX0 A;  4F3T A;  1VSE A;  1Q9X A;  3TAB A;  1DTT A;  2I5J A;  4AH9 A;  4O55 A;  4CEZ A;  3T19 A;  3AVF A;  3O3H A;  2G8K A;  1T7P A;  4IKF A;  3NAE A;  3DRS A;  3VQQ A;  1RT2 A;  3NH2 A;  4IG3 A;  5CZ1 A;  1X9M A;  4KRF A;  2O4G A;  1LWC A;  4FYD A;  3OYM A;  1SV5 A;  4DFK A;  3VA3 A;  4I9Q A;  4DSI A;  4HCC A;  1GOC A;  5HLF A;  3KD1 E;  4WE1 A;  4B3O A;  3D45 A;  5K14 A;  1SL1 A;  1FKO A;  1HPZ A;  1RDA A;  1SKS A;  4EZ9 A;  1NJY A;  1FXX A;  1JLQ A;  1QSS A;  1TV6 A;  1WSG A;  4CJW A;  4CJF A;  5HRR A;  4E7K A;  4DMN A;  4LH5 A;  4FJI A;  3HK2 A;  3PV8 A;  1Q8I A;  3M8R A;  1NJX A;  4J2B A;  3AVN A;  2XO7 A;  3A2F A;  4Z0U A;  2ZE2 A;  1KCF A;  3NGY A;  5HBM A;  4BAC A;  1S1W A;  2DFF A;  4FLX A;  3HO1 A;  2HW3 A;  4FLU A;  3OVN A;  3HJF A;  4FCY A;  4HUG A;  2QXF A;  3NBP A;  3OYH A;  1NKB A;  1WSE A;  3AVA A;  1RDD A;  1W0H A;  4YNQ A;  2VWK A;  1YTU A;  4RW9 A;  2PYL A;  2LSN A;  4FJK A;  3PO5 A;  3AVK A;  4M3Z A;  4FLZ A;  2FBT A;  3VQ7 A;  4UQG A;  4CJ4 A;  2HHQ A;  1TK5 A;  1O1W A;  3UIQ A;  1IKY A;  4CFB A;  3ZCM A;  2YV0 X;  3NCI A;  4NYF A;  2HMI A;  4PY5 A;  3ALY A;  1TKT A;  4M3R A;  1S6Q A;  5SZT A;  1XWL A;  1JL1 A;  3CFR A;  4CJS A;  4FLY A;  3B6P A;  3HL8 A;  1KLN A;  3V1R A;  3QNN A;  1X9S A;  1L3T A;  3ZSV A;  2OPQ A;  4NCB A;  4CFC A;  3ZSW A;  3V1O A;  4CIE A;  3H08 A;  4E7I A;  4IDK A;  3O3G A;  2BE2 A;  1RT3 A;  1XHX A;  3NH1 A;  4J2D A;  1QE1 A;  2KFN A;  3ZT0 A;  3CQ8 A;  1QSY A;  1L5U A;  1U47 A;  3RWU A;  1ZBF A;  3U6F A;  4DTU A;  4DU1 A;  3NF8 A;  1NK0 A;  4CJ5 A;  4ID5 A;  1WLJ A;  3K57 A;  4DSL A;  4E0D A;  4E1M A;  2HHW A;  5FRM A;  2EHG A;  4C8K A;  4CEC A;  2W42 A;  5KGW A;  3TWH A;  2HB5 A;  3EY1 A;  4DLG A;  2BDP A;  3MEG A;  1CXU A;  4CIF A;  2HHT A;  3IG1 A;  5HRO A;  3AVM A;  2DFE A;  4DG1 A;  3L3U A;  1JLB A;  1HQE A;  1TKX A;  3VQD A;  3F73 A;  1XHZ A;  1KRP A;  3E01 A;  1BCM A;  1KVB A;  1S9E A;  5KRT A;  4FXD A;  3LWM A;  1ASW A;  3CFO A;  4DWI A;  1LW2 A;  3DLG A;  1TL3 A;  4IFY A;  1C1A A;  4DSE A;  4CED A;  3SPY A;  1QHT A;  4EP5 A;  4DQI A;  1EET A;  4CE9 A;  4F8R A;  1LV5 A;  4N76 A;  3L8B A;  4BDP A;  4N41 A;  1B9F A;  3LAM A;  2B6A A;  3P1G A;  3VQ4 A;  1NOY A;  3I0R A;  1EXQ A;  4BE1 A;  4DQR A;  3S9H A;  4KTQ A;  4K8X A;  1DTQ A;  1TK0 A;  3EYZ A;  5FRO A;  1ZBL A;  2HHS A;  4FZX C;  3AO3 A;  1SL0 A;  1EP4 A;  3O4N A;  3V6D A;  1RBS A;  1TAU A;  4CJU A;  4W5R A;  4B9U A;  1JLE A;  2ZD1 A;  3VQA A;  3ZT1 A;  4N5S A;  1NK7 A;  3EZ5 A;  3DOL A;  4RW7 A;  2E4L A;  3HP6 A;  4CCH A;  2YNG A;  3OS0 A;  3S3M A;  1RTD A;  1RCH A;  3U3G A;  4C8M A;  1NKC A;  2PYJ A;  1JLF A;  2OYQ A;  4KKO A;  4KHW A;  1HJR A;  4FJ9 A;  1IKW A;  3VQ5 A;  1CLQ A;  4KHS A;  3OS1 A;  1JLG A;  3M8P A;  1RNH A;  1D8Y A;  4CGG A;  3DRR A;  3RRH A;  1KVC A;  1S1T A;  3S3N A;  4IBN A;  3NH0 A;  1NK4 A;  4CJ3 A;  4FZZ A;  4DTN A;  1SUQ A;  1KTQ A;  1RDC A;  3QIN A;  4MQ3 A;  1JXE A;  4KTZ A;  1L3U A;  4CHQ A;  5CZ2 A;  1YVU A;  1WSI A;  2EX3 A;  5FDL A;  4DQS A;  2YHA A;  1NKE A;  1VSJ A;  4K8Z A;  4CK3 A;  2XHB A;  4J2A A;  4LH4 A;  5KGX A;  2B4J A;  3QEI A;  4HCB A;  5KRS A;  4OPJ A;  4QOZ B;  5DK5 A;  4E7H A;  4FJ5 A;  3AVG A;  1A5X A;  4B9T A;  2OPS A;  4EZ6 A;  2F8S A;  1TK8 A;  2PZS A;  3SI6 A;  1LWE A;  1HNI A;  3MED A;  4DF8 A;  4FLT A;  4CHZ A;  2P5G A;  5KTQ A;  2D0B A;  2YNH A;  2RPI A;  4B9N A;  3K5L A;  3V9U A;  4JLH A;  2DFH A;  3WNH A;  4Z4C A;  5C25 A;  3L2V A;  4I2P A;  1JL2 A;  1TGO A;  4O0J A;  4OKE A;  1BQN A;  2D5R A;  4DTS A;  1GOA A;  4KI6 A;  3AVC A;  3SV3 A;  1KFD A;  3HPO A;  4E19 A;  1J53 A;  2KZM A;  4R5P A;  4DTX A;  1HQU A;  3ZSO A;  2G8W A;  3JYT A;  4M3Y A;  3OY9 A;  2KZZ A;  3QES A;  1HYZ A;  1WSJ A;  4LSN A;  4H8K A;  3JSM A;  3KJV A;  1C1C A;  1J5O A;  1TL1 A;  1S1X A;  1TKD A;  5I42 A;  1BI4 A;  1WAF A;  4DTP A;  5DMR A;  1N5Y A;  4J2E A;  2RKI A;  1LAV A;  4GVM A;  4W5T A;  3OYC A;  5T7B A;  2HHX A;  1G15 A;  1CXQ A;  3TAQ A;  4DTJ A;  1BCO A;  4CGF A;  3O3F A;  4ZTF A;  3MXM A;  4FJJ A;  4FK4 A;  2Z1I A;  3SUQ A;  4AHU A;  4W5N A;  4N56 A;  3HT3 A;  1NOZ A;  4HUF A;  3KLH A;  4AIL C;  4Z4G A;  2XRI A;  3SQ2 A;  1EX4 A;  3MEE A;  5E41 A;  4DF4 A;  1BHL A;  3ZSY A;  2QK9 A;  4LY7 A;  3NF6 A;  2P1J A;  3I0S A;  2X6N A;  3LZI A;  1ZBI A;  2DY4 A;  4FLV A;  4AHT A;  3LP3 A;  1R0A A;  1T8E A;  4FJN A;  4CF1 A;  4CGI A;  4BDZ A;  1XI1 A;  1RBT A;  2HNZ A;  3KK1 A;  3PY8 A;  4M42 A;  4FW1 A;  4M3T A;  3RMA A;  4I2Q A;  5J1E A;  4F2S A;  3S3O A;  2FBX A;  4BE0 A;  1QSL A;  1I3A A;  3M8S A;  2Y1J A;  2HVI A;  1F21 A;  4N47 A;  1BQM A;  3NFA A;  4DU4 A;  5CYM A;  3TAN A;  3MEC A;  3ZSR A;  1BL3 A;  2BGG A;  2IAJ A;  2AJQ A;  2GV9 A;  4DSJ A;  4JS5 A;  2HND A;  3HP9 A;  2VG6 A;  4CJK A;  1ASV A;  3LWL A;  1BIZ A;  3RMD A;  1DLO A;  2G8H A;  3QEW A;  1RBR A;  3K2P A;  3OYJ A;  1ZBH A;  3SUN A;  4FJM A;  2O4I A;  3AO4 A;  4MFB A;  4RW4 A;  3PO4 A;  2PY5 A;  1TKZ A;  4CF2 A;  3DLK A;  4FM1 A;  3V9X A;  2D0A A;  3IS9 A;  3VQ6 A;  4DLE A;  5HRP A;  4E7J A;  3QIP A;  4F3O A;  1WAJ A;  4IG0 A;  2KTQ A;  2D0C A;  3MXJ A;  1Q9Y A;  3V9Z A;  5J2P A;  4FVM A;  3OYN A;  3OYA A;  2ZQB A;  4FM2 A;  3K5N A;  3LP1 A;  1RT4 A;  2Q3S A;  2KQ2 A;  3DYA A;  2WOM A;  4YFU A;  4I9L A;  4KTW A;  4I7F A;  3M8Q A;  2VWJ A;  4RW6 A;  4CHO A;  4DSF A;  3MAQ A;  3TAE A;  4E1N A;  4FK2 A;  1NK6 A;  1RT6 A;  3B6O A;  1X1P A;  3RRG A;  1EKE A;  3AA2 A;  3KLG A;  3HYF A;  1IG9 A;  2IGI A;  4NCG A;  4DFJ A;  3OYL A;  4L8R B;  2FBY A;  3VQB A;  1X9W A;  5JS2 A;  1RT5 A;  4ZHR A;  3KK3 A;  4CGD A;  3CYM A;  4Q5V A;  4CJV A;  4IFV A;  4DFP A;  4B8A B;  3I8D A;  2Y1I A;  4CEA A;  1VSD A;  4C8L A;  3IAY A;  3T1A A;  1VSM A;  4CJP A;  4CES A;  4BDY A;  1L3S A;  2JGU A;  3LAL A;  2QKB A;  3HVR A;  2RN2 A;  3KKR A;  2JLE A;  1REV A;  4KO0 A;  2ATQ A; 
#chains in the Genus database with same CATH topology
 5DM7 L;  3LAN A;  1BI4 B;  4RG8 A;  3CME N;  4OLA A;  4B8C A;  3H45 C;  1XMQ K;  1JXB A;  4AF1 A;  5HP1 A;  3HOT A;  3HM9 A;  2ITM A;  2P9I B;  3C95 A;  5C0Y A;  1IBL K;  4KHY A;  2Z1H A;  3GDQ A;  3Q7B A;  4KH5 A;  3J7Y P;  3BY5 A;  2ETJ A;  3WNG A;  1BG3 A;  4B1Z A;  3VEY A;  4CJL A;  4DTO A;  2OPR A;  4CFA A;  5D3G A;  3G10 A;  3LDS A;  4LD0 A;  3AA5 X;  3SNN A;  4DTR A;  2HVH A;  4KPY A;  4Z4E A;  5GAG P;  4KV8 A;  4M3W A;  4OPK A;  1KLM A;  5BR9 A;  4BR7 A;  1SKR A;  3DOK A;  4H0Y B;  4U7B A;  4KHQ A;  2FC0 A;  5AQQ A;  4EIA A;  2VQE K;  1Z6R A;  4E7L A;  3T3F A;  3P5J A;  2FF6 A;  1U4B A;  1Y97 A;  3VGL A;  4CER A;  2IOC A;  4AHC A;  4CGH A;  1Z05 A;  4BE2 A;  1M90 O;  2F7T A;  4X64 K;  1NGH A;  2B5J A;  1EO1 A;  3HXM A;  3SUO A;  2GBZ A;  1IH7 A;  1HYV A;  1LOT B;  4H0X B;  1Q18 A;  3DRP A;  3M5R A;  4CFD A;  5FRN A;  1CZ9 A;  3W3D A;  1LWF A;  1L3V A;  3CG7 A;  2ZJP L;  1VK0 A;  1TYQ B;  5BRH A;  4K42 A;  1XC9 A;  4ELU A;  3LDL A;  5J2Q A;  4DFM A;  4F2R A;  1FK9 A;  4BRI A;  2X6S A;  4LF5 K;  2XY7 A;  4H4M A;  2P9N B;  3HST B;  4EHU A;  3R8E A;  3OYG A;  1S5J A;  1QZ6 A;  1KAX A;  3HVT A;  4YOR A;  3ULD A;  1G99 A;  3ITH A;  3E9O A;  3SCX A;  3U3Y A;  2YHY A;  1VQ7 N;  2Z1J A;  4JI6 K;  1NK8 A;  3VET A;  5LY3 A;  1MA9 B;  3TAF A;  4MLE A;  1MU2 A;  4OX9 K;  3N4Q A;  3OA9 A;  3V9W A;  3G6E N;  3SJJ A;  1NGB A;  1HRH A;  3WEE B;  3GBT A;  4C23 A;  3V4I A;  4FWQ A;  1NGE A;  3PLA A;  4JI2 K;  3G4S N;  4CEO A;  1C6V A;  1C1B A;  1BA1 A;  3AVH A;  3K5M A;  2P51 A;  2A41 A;  4JKC A;  5JLH A;  1RBV A;  2V52 B;  2E2O A;  3EZW A;  1IBM K;  4QCL A;  1JLC A;  1HNV A;  1U48 A;  3CFP A;  3RR8 A;  1UA0 A;  2ITG A;  4B3T K;  3ASM A;  3QDK A;  1VQ8 N;  1V4T A;  3HPG A;  5LJW A;  2YI1 A;  1YTA A;  4FWO A;  3C94 A;  1GOB A;  2E2P A;  4B1V A;  4F9O A;  4XH1 A;  4FJ7 A;  3EN9 A;  3THV A;  3HPH A;  2NRH A;  4QS8 A;  2IVO A;  2GTD A;  3DLH A;  1N36 K;  1GLL O;  3KIO A;  3RVC A;  4JKD A;  3OHR A;  1HYS A;  1FKP A;  4FSV A;  4BQL A;  5BRF A;  4M63 C;  4JHD A;  4H5N A;  4Z4H A;  2O8C B;  2VG5 A;  1SAZ A;  1EQY A;  2W6K A;  4JKB A;  3SYZ A;  2YHB A;  3V1Q A;  1IV0 A;  1YT3 A;  1RDU A;  3VPZ A;  4B3R K;  4Q0B A;  5ADX A;  3H3N O;  2AA4 A;  1VSE A;  2P9L A;  3TAB A;  2I5J A;  4O55 A;  5BRE A;  3AVF A;  2IVN A;  5BPN A;  4BVO A;  1X9M A;  2O4G A;  4DUY K;  3PIP L;  3OYM A;  1SV5 A;  3VA3 A;  4I9Q A;  2PAV A;  4DSI A;  4CD1 A;  3KD1 E;  2NRT A;  4WE1 A;  2PBD A;  4EZ9 A;  1NJY A;  1FXX A;  1JLQ A;  1QSS A;  1WSG A;  4CJF A;  4E7K A;  4FJI A;  4BRP A;  1DKG D;  1TUU A;  3PV8 A;  3M8R A;  1NJX A;  4PKG A;  4YOY A;  3A2F A;  4BRF A;  1KCF A;  2HHH K;  2DFF A;  5AJ3 K;  3OVN A;  3HJF A;  4CZE A;  4CVN E;  3T1Y K;  2O8B A;  2LSN A;  1GLC G;  4Y0W A;  1HLU A;  3UKR A;  3T1H K;  3CD6 N;  2P9S A;  3E66 A;  4CJ4 A;  1TK5 A;  4CFB A;  3ZCM A;  5M1Q A;  4JKA A;  3BEX A;  2NZT A;  3CFR A;  4FLY A;  4CJS A;  3B6P A;  1KLN A;  3V1R A;  3QNN A;  1X9S A;  4NCB A;  3ZSW A;  2W41 A;  2BE2 A;  1RT3 A;  3HSC A;  5B8H A;  3T69 A;  5AQU A;  4J2D A;  3ZT0 A;  3CQ8 A;  1WOQ A;  1QSY A;  5AZI A;  3MX5 A;  3DLL L;  4DU1 A;  4JAX A;  3C0B A;  4E1M A;  2HHW A;  4YOV A;  3L6Q A;  2ZWH A;  4DLG A;  3SMP A;  3ZLJ A;  1CXU A;  1QQM A;  4CIF A;  3IG1 A;  2WC9 A;  3A5O C;  3TSP A;  1JLB A;  4RTF D;  1DT9 A;  1XHZ A;  1KVB A;  4BRM A;  4FWM A;  3CCV N;  1KD1 O;  1TL3 A;  4IFY A;  1C1A A;  3I55 N;  4DQI A;  2E88 A;  4WYB A;  3UB5 A;  2KLA A;  2B6A A;  1U2V A;  3RSE B;  4KTQ A;  5M1K A;  4CZM A;  3O80 A;  3EYZ A;  2ASM A;  1EP4 A;  3KHY A;  3V6D A;  1TAU A;  1X3M A;  1D4X A;  1JLE A;  2ZD1 A;  3VQA A;  4N5S A;  3CMA N;  3EZ5 A;  4YOU A;  4B3S K;  3AAQ A;  3OS0 A;  4WQ4 A;  1DGK N;  4KHW A;  5EVZ A;  3DRR A;  1GLB G;  4GV3 A;  3NMU A;  2HMP A;  4BG9 A;  1NK4 A;  3C7N B;  4FZZ A;  2F9W A;  3QIN A;  1YXQ A;  3CXC M;  1SS6 A;  1JXE A;  4DR6 K;  3VEX A;  1NKE A;  4CK3 A;  4LH4 A;  1YJN N;  4OPJ A;  3AVG A;  1A5X A;  5GAD P;  2O8E B;  4E1J A;  2F8S A;  1TK8 A;  4CW7 B;  4IJN A;  1LWE A;  1GLF O;  2EWS A;  4IWV A;  5KTQ A;  2D0B A;  4A2B A;  4BRC A;  4JLH A;  5E84 A;  4OKE A;  3IMX A;  4AQY K;  4KI6 A;  3JS6 A;  3CJB A;  1KFD A;  3HPO A;  1J53 A;  4R5P A;  3O9T A;  1HQU A;  3ATV A;  3ZSO A;  3JYT A;  2G8W A;  3QES A;  3ENO A;  1WSJ A;  4H8K A;  4XH5 A;  3J81 O;  3Q7C A;  4GVM A;  5T7B A;  4CD3 A;  4JI3 K;  4DTJ A;  1BCO A;  4CGF A;  4FK4 A;  3MXM A;  2Z1I A;  4CI6 A;  4BR2 A;  4IFE A;  2UXD K;  2XRI A;  5LMN K;  1BUP A;  1OH6 A;  1BHL A;  4FVU A;  3I0S A;  1ZBS A;  1ZBI A;  4AM6 A;  4M3T A;  4NLB A;  1RBT A;  1XMO K;  1VQ9 N;  3C6A A;  5EX5 A;  1NWK A;  3ZEU B;  5J1E A;  2UU9 K;  2FBX A;  2Y1J A;  1S72 N;  2W40 A;  1BQM A;  3TSQ A;  4B3M K;  3TTF A;  3ZX0 A;  4KHP K;  3A8Y A;  1GLJ O;  4RW4 A;  2PY5 A;  3D2F B;  4FM1 A;  2D0A A;  4DLE A;  5HRP A;  4E7J A;  1HR0 K;  2D0C A;  3MN7 A;  3MXJ A;  1HNW K;  4FVM A;  4GV6 A;  4FM2 A;  3EE9 A;  3K5N A;  3M1F A;  3CPW M;  2GUP A;  1NMN A;  2KQ2 A;  1H1V A;  4HWI A;  4NLC A;  3DYA A;  2FSJ A;  2P9U B;  2WFB A;  4I7F A;  4CBX A;  3WXL A;  4BRQ A;  3CCR N;  4KH6 A;  2A5X A;  1KAZ A;  1X1P A;  1GLD G;  1RDW X;  5AQI A;  3AAR A;  4DFJ A;  1HKG A;  4FOI A;  4YHH K;  3KK3 A;  4Q5V A;  4IFV A;  5BPL A;  5M1P A;  4B8A B;  4C8L A;  3T1A A;  1VSM A;  4CJP A;  5CE3 A;  3LAL A;  3TTC A;  3O5B A;  2O8F B;  2GEM A;  4KO0 A;  1S22 A;  4OVL A;  2NRW A;  4O4G A;  3ID6 A;  2E5L K;  5J2N A;  3AVL A;  3J7A P;  3ZET B;  3KK2 A;  1RT1 A;  5JLF A;  4KB1 A;  4M3U A;  2OTJ N;  1K8K A;  5HOO A;  2QA4 N;  2ASO A;  4K43 A;  1ZBU A;  3DM2 A;  2ZGY A;  4Y1C A;  2E6M A;  4B9S A;  5FPD A;  3FFI A;  2GEL A;  4BR9 A;  5CHI A;  4BG8 A;  2E1Z A;  4CBW A;  4PHT X;  2QWP A;  3CJ7 A;  1RT7 A;  2IDO A;  4JI8 K;  5M1O A;  4DTM A;  1VQP N;  2BTF A;  5KQ8 A;  3MXI A;  1NJZ A;  1TVR A;  4FZY A;  3PUF A;  4IO9 L;  1WSF A;  1T6D A;  4A57 A;  4IEE A;  5C42 A;  2NRX A;  3DXK A;  3ULE B;  3OS2 A;  1T03 A;  1N33 K;  1EWQ A;  3D2E B;  2A1R A;  1W97 L;  5SWM A;  3DI6 A;  1VQO N;  1IKX A;  4YOX A;  4H5V A;  1OVQ A;  3FGU A;  4KAZ A;  3LPT A;  4CEQ A;  3TAG A;  4DHY A;  2D4W A;  3ZSZ A;  4KB0 A;  5AQV A;  2J4R A;  4M3X A;  1WN7 A;  2Z1G A;  1A5V A;  1NGJ A;  3S41 A;  3SBG A;  2KKZ A;  3LAK A;  3IUC A;  3U8X A;  3VOV A;  5F0X A;  5DM6 L;  1NK9 A;  1D5A A;  4E3S A;  4B9M A;  4RWT A;  4H5R A;  4BRN A;  5IWA K;  4FJG A;  3AVB A;  1P8Z A;  3SJH A;  3QET A;  3FZH A;  4FLW A;  4XIU A;  4DR7 K;  4CEF A;  4CF8 A;  1ILY A;  4OGE A;  3ZT3 A;  4LF9 K;  3OJU A;  2YHW A;  4X65 K;  3UKU B;  3L2W A;  1LAW A;  3L4Q A;  3P31 A;  3NF9 A;  4CF9 A;  3O4Q A;  1SKW A;  3CJ9 A;  1QVG M;  1NGC A;  1UOC A;  4FJH A;  3VEW A;  3H3O B;  1IJJ A;  1W9H A;  3HBT A;  1Q7Y O;  3CM5 A;  4X66 K;  4DB3 A;  4Z4I A;  5HRN A;  4O44 A;  2Q1N A;  3QEX A;  2GWJ A;  3MN6 A;  4W5Q A;  1BIU A;  4KFB A;  3VQ9 A;  1E3M A;  3THW A;  1C0T A;  4BRK A;  1YUW A;  1S3X A;  1GLA G;  1T44 A;  4PQU A;  2P9K B;  4BWJ A;  4GKK K;  2Q97 A;  3I8B A;  5BR8 K;  2D1K A;  3SQ1 A;  3CER A;  4CHY A;  2JWL A;  3L2U A;  4CJT A;  2HHV A;  4LSL A;  4Y1D A;  2WUS A;  4DKW A;  1VSI A;  3TI0 A;  4EAH D;  4FJ8 A;  1HPM A;  4ILJ A;  3VTI A;  2F4V K;  1S1U A;  1T3V A;  1NK5 A;  4PKH A;  2QWQ A;  3C6T A;  1KSP A;  3QEV A;  3BGR A;  4G1Q A;  2YNF A;  3GE1 A;  3V9S A;  5I3U A;  4TSX A;  4C1N I;  3F9K A;  1JKH A;  3HTV A;  2F8T A;  4MO4 A;  1UA1 A;  5AQT A;  4G9Z A;  4XH4 A;  4OGC A;  5AFU H;  3SPZ A;  3NDK A;  4JI0 K;  4PWD A;  3PX6 A;  4BC3 A;  4DU3 A;  3QEP A;  4A62 A;  3AVI A;  3TSU A;  3L3V A;  5KI6 A;  4C8N A;  1VQM N;  2NNW A;  1HMV A;  1RTJ A;  4B1Y B;  3TAP A;  4CHN A;  1HKB A;  5AR0 A;  4IDH A;  3IDH A;  5C2F A;  1T7P A;  3DRS A;  5CZ1 A;  4KRF A;  1W2B M;  3QBW A;  4DFK A;  4CZH A;  3SAG A;  4B3O A;  3CCE N;  1SKS A;  3WXM B;  5TKW A;  4CJW A;  3HK2 A;  4LH5 A;  4DV3 K;  3LM2 A;  4Z0U A;  1NLV A;  4FLX A;  3NBP A;  1WSE A;  3AVA A;  1RDD A;  2IVP A;  4YNQ A;  2VWK A;  1X3N A;  2ZF5 O;  4RW9 A;  2PYL A;  1C0F A;  3IKM A;  3VQ7 A;  4UY8 O;  2HHQ A;  1O1W A;  4NYF A;  4PY5 A;  5JVH L;  4JKG A;  1TKT A;  5SZT A;  1JL1 A;  2UYT A;  5ELZ A;  3ZSV A;  1XQS C;  1YJW N;  3V1O A;  4LFC K;  4IDK A;  5GIP A;  5AQO A;  1N32 K;  4M7X A;  1ZBF A;  4OO1 J;  3U6F A;  2IIR A;  4CJ5 A;  4ID5 A;  3QBX A;  4DSL A;  3WXI A;  4R79 A;  4L3Q A;  5KGW A;  4FWR A;  4BR5 A;  4JV5 K;  2HHT A;  2GX9 A;  2BUP A;  2NRV A;  3VQD A;  1YHQ N;  4ILG B;  4FXD A;  3CFO A;  1LW2 A;  3DLG A;  4DSE A;  4CED A;  4ISE A;  3IFR A;  3SPY A;  1EET A;  2GWK A;  5AQW A;  4CE9 A;  1LV5 A;  4PL7 A;  3GL1 A;  3LAM A;  4U67 L;  3P1G A;  3VQ4 A;  1M1K O;  4DQR A;  1EXQ A;  1QQO A;  3S9H A;  5FRO A;  4JKE A;  2HHS A;  4H5T A;  4FZX C;  3O4N A;  4Z94 A;  1YJ9 N;  4QS7 A;  4B9U A;  3EKS A;  4LFA K;  2QXL A;  3HP6 A;  4CCH A;  2YJF A;  4KKO A;  3LDP A;  3TPQ A;  1CLQ A;  4KHS A;  3OS1 A;  3M8P A;  4CGG A;  3CHW A;  3KVG A;  1S1T A;  1KTQ A;  4DV5 K;  3THX B;  5AZJ A;  1L3U A;  5CZ2 A;  1LCU A;  3HZ6 A;  2EX3 A;  3MMV A;  2XHB A;  5KGX A;  1ATN A;  2B4J A;  4QOZ B;  1DEJ A;  4E7H A;  5AQK A;  3M3Z A;  4BY9 C;  2P9P A;  4FLT A;  2QW9 A;  4BRH A;  4NXM K;  1ZC6 A;  4MDA A;  3THY A;  1TGO A;  1BQN A;  2D0P A;  2QWN A;  3DXM A;  3CCM N;  2KZM A;  4DTX A;  4M3Y A;  3OY9 A;  2YCH A;  2KZZ A;  3E1Y A;  1HYZ A;  2DPN A;  1C1C A;  4PKI A;  5KPT A;  1S1X A;  4YDU C;  1BI4 A;  1WAF A;  5I42 A;  4J2E A;  1G15 A;  3TAQ A;  5JMV A;  3MCA B;  4JNE A;  3O6W A;  3SUQ A;  2A40 A;  4AHU A;  1IBK K;  2P9I A;  1NOZ A;  4HUF A;  3KLH A;  4Z4G A;  5E41 A;  3PSI A;  3BZC A;  2QK9 A;  1MDU B;  4DV2 K;  4FJN A;  1T8E A;  1XI1 A;  3D7E O;  4BDZ A;  3KK1 A;  3PY8 A;  4M42 A;  4FW1 A;  2QWL A;  1HNX K;  5FPM A;  5AQZ A;  2O8D B;  3F5T A;  1QSL A;  3G25 A;  4N47 A;  5EOY A;  4DU4 A;  3ZSR A;  5KPR A;  2GV9 A;  4CJK A;  2VG6 A;  1DLO A;  5AQN A;  4V19 S;  3ID8 A;  1RFQ A;  3K2P A;  3OYJ A;  2O4I A;  4MFB A;  4B1U B;  3PO4 A;  4B1X B;  3FZL A;  3IS9 A;  3VQ6 A;  1HJO A;  4F3O A;  1WAJ A;  1Q9Y A;  2HF4 A;  2VWB A;  3OYA A;  2Q3S A;  3O1W A;  2WOM A;  5LMU K;  3N4P A;  4ILH A;  4YFU A;  1KC8 O;  2VWJ A;  4RW6 A;  4HTL A;  3QIC A;  4FK2 A;  4JI4 K;  1NK6 A;  1RT6 A;  1Q86 O;  3OYL A;  3VQB A;  1X9W A;  1O13 A;  4LC9 B;  4CJV A;  1TYQ A;  2HBJ A;  5GAE P;  4DFP A;  2VQF K;  2Y1I A;  3EE8 A;  1VSD A;  1L3S A;  2JGU A;  3MN9 A;  3R3L A;  3O9R A;  1REV A;  3J7Z O;  3K0S A;  1VRU A;  3KTQ A;  2P9N A;  3NHG A;  2R7Y A;  3C6H A;  3AA4 A;  1V4S A;  3K9J A;  4E89 A;  1MWM A;  1QHA A;  3KLI A;  3SZ2 A;  1Y64 A;  4MDB A;  4JI1 K;  3TAM A;  1NGA A;  4DQQ A;  1K6Y A;  4CJQ A;  3ZSQ A;  4JK8 A;  3OJS A;  3C6U A;  1IO2 A;  4O8K A;  4CIG A;  4DV1 K;  4JD2 B;  3HI0 A;  4M7Y A;  5EY4 A;  3VN5 A;  1KAY A;  3ZT2 A;  3RR7 A;  1K9M O;  3I56 N;  3FZM A;  2P5O A;  2FBV A;  3SQ4 A;  2HNY A;  3WEE A;  1UAX A;  4FM0 A;  1K8A O;  5GIN A;  3QLH A;  2Q0R A;  1B92 A;  1U04 A;  1C0M A;  3KZB A;  4CJR A;  1D9D A;  5F2R A;  4H5W A;  3OBW A;  3VQP A;  3AO5 A;  3U9Z A;  2QKK A;  1NGD A;  5EU7 A;  5MLC Q;  3CF5 L;  2NRZ A;  4NCA A;  3ZYY X;  5AFU A;  4I6M B;  1T05 A;  4FJL A;  3SK3 A;  1VSH A;  2A3Z A;  3VA0 A;  3AO1 A;  1E4G T;  1ZYQ A;  1IKV A;  3CJC A;  4IZ9 A;  1YIT N;  1SL2 A;  3AA3 A;  4ICL A;  4FL9 A;  3B8A X;  1N6Q A;  1VQK N;  3M6G A;  3WNE A;  3AVJ A;  1U45 A;  4GW6 A;  3CET A;  3DLB A;  4OKJ A;  4KHU A;  2O8C A;  1KXP A;  1VRT A;  2YNI A;  4DV4 K;  1WSH A;  3VES A;  3ZSX A;  3KKS A;  4BGA A;  3CQX A;  2G8U A;  2KFZ A;  3QFU A;  1NGG A;  4J8F A;  4PA1 A;  3NE6 A;  3LP2 A;  5J2M A;  3EO3 A;  3GOI A;  1I39 A;  3BP8 A;  4M45 A;  3O9S A;  4AHS A;  4H0V B;  2F9T A;  2QI2 A;  1S1V A;  4A59 A;  3MWP A;  4C8O A;  2HHU A;  3ZX3 A;  1CZB A;  2XY8 A;  3FFK B;  4PUO A;  4OPA A;  3L2Q A;  3FZK A;  1NGI A;  4EP4 A;  5BPM A;  3D0P A;  4CEB A;  2QWO A;  4DR5 K;  4BR0 A;  1C0U A;  3VQE A;  1BDG A;  2VGM A;  3QER A;  4LF4 K;  1J5E K;  5GIO A;  2WON A;  5AQM A;  4BRE A;  4Z4F A;  1KVA A;  2XY6 A;  1A5W A;  2FXU A;  5H1S Q;  1B9D A;  2HF3 A;  4K25 A;  4RW8 A;  5M1F A;  2QWM A;  4YY3 K;  2WTU A;  1QQC A;  4DR2 K;  4GMJ B;  2OPP A;  1S6P A;  5AQX A;  3CM6 A;  3ISN C;  3WQU A;  2UXB K;  3H1V X;  2Q0U A;  2BAN A;  3VQ8 A;  4JI7 K;  2G8I A;  1QS4 A;  2IC3 A;  4AHV A;  4BC5 A;  4FJX A;  3BDP A;  3AO2 A;  1ITG A;  4AHR A;  3IRX A;  1OKJ A;  4OJR A;  1QQN A;  5ADX H;  3DLE A;  1YIJ N;  4F4K A;  5KPZ A;  2IS3 A;  1IG8 A;  3OYB A;  4H03 B;  3P83 D;  3NGZ A;  2RE2 A;  3RMC A;  1W7A A;  3KWI A;  5AQG A;  4JS4 A;  2X74 A;  4DV6 K;  4HVJ A;  4B9L A;  3RTV A;  1D9F A;  3K58 A;  2HST A;  3HOS A;  2GUI A;  1Q9X A;  4BRG A;  3P38 A;  4H0O A;  4CEZ A;  2G8K A;  4IOA L;  4IKF A;  5EXW A;  3NH2 A;  4FYD A;  3RSE A;  3BZK A;  3EL2 A;  3OTO K;  1GOC A;  3TTD A;  4WF9 L;  5HLF A;  1TV6 A;  4DMN A;  4IO8 A;  3UE5 A;  1OH5 A;  4J2B A;  5FPE A;  2XO7 A;  3HO1 A;  4FLU A;  2HOE A;  4HUG A;  3SAH A;  2Q2R A;  1W0H A;  1K73 O;  4GVE A;  1YTU A;  4XEI A;  3L4I A;  2NRR A;  1VQL N;  4WQ5 C;  3AVK A;  3C7N A;  4FLZ A;  4UQG A;  1IKY A;  3NCI A;  2YV0 X;  2ZJQ L;  4KH4 A;  2E1Y A;  2HMI A;  3ALY A;  4M3R A;  1S6Q A;  1WB9 A;  3HL8 A;  3PIO L;  2OPQ A;  1JCG A;  4CFC A;  2E2N A;  4CIE A;  5LJV A;  2FSK A;  3H08 A;  2O8E A;  4E7I A;  3PSF A;  2KFN A;  4WFA L;  3O9U A;  3RWU A;  1OH7 A;  1VHX A;  3ENH A;  3NF8 A;  5BN9 A;  4JHD B;  3WUH A;  1WLJ A;  4A5B A;  4GKJ K;  2EHG A;  4C8K A;  4CEC A;  2W42 A;  2A6A A;  4DCH A;  5FLX O;  2ZM6 K;  3EY1 A;  2BDP A;  2PFU A;  3DAW A;  3QB0 A;  3MEG A;  4DG1 A;  1NU0 A;  4FOE A;  3VGM A;  3ZX2 A;  1BCM A;  2Q31 A;  4DWI A;  2P9L B;  1XC3 A;  1B9F A;  3I0R A;  3BF3 A;  4K8X A;  1DTQ A;  4MLH A;  1VQ5 N;  1ZBL A;  2QWR A;  4BRL A;  2JWK A;  4W5R A;  3ZEU A;  1NK7 A;  2OAN A;  1ATR A;  1NM1 A;  4PL8 A;  3A5L C;  1RTD A;  1RCH A;  4C8M A;  2PYJ A;  1JLF A;  1NG9 A;  1HJR A;  2O8B B;  1RGI A;  1OH8 A;  1RNH A;  1JCE A;  3CPE A;  3UKR B;  3RRH A;  2P9S B;  1NJI O;  1KVC A;  3S3N A;  3D2F A;  3A5M C;  4DUZ K;  4DTN A;  1SUQ A;  1RDC A;  5A2Q O;  4JK7 A;  4MQ3 A;  4CHQ A;  3QFP A;  1WSI A;  5FDL A;  4JEP A;  5KRS A;  1XNQ K;  2P9U A;  5DK5 A;  4RCH A;  2AP1 A;  4B9Q A;  4B9T A;  2OPS A;  1NMD A;  4EZ6 A;  1VAZ A;  3MED A;  4DF8 A;  2UUA K;  3WXJ A;  4MO5 A;  2P5G A;  2YNH A;  4B9N A;  3K5L A;  5AZI B;  4A61 A;  2DFH A;  3H1Q A;  3WNH A;  3L2V A;  4I2P A;  1JL2 A;  4O0J A;  2E8A A;  3KWG A;  4DTS A;  1I94 K;  3VF2 A;  1FW6 A;  4E19 A;  4CZF A;  2O8F A;  3EEQ A;  3KJV A;  1TL1 A;  1JCF A;  1SQK A;  5AQJ A;  4W5T A;  1CXQ A;  3ZET A;  4CZL A;  3O3F A;  2WBN A;  4FJJ A;  3MK6 A;  5JIC A;  4K0K K;  4W5N A;  4N56 A;  3HT3 A;  2W6L A;  3SQ2 A;  1YF5 L;  3MEE A;  4DF4 A;  4LY7 A;  3NF6 A;  1U2V B;  4EHT A;  5HL7 L;  3O8M A;  4AHT A;  3LP3 A;  4CF1 A;  4CGI A;  3DJC A;  3R9P A;  3LDQ A;  4I2Q A;  2HVI A;  5AQP A;  1I3A A;  1F21 A;  2AJQ A;  3MEC A;  1BL3 A;  4JS5 A;  2HND A;  4YOW A;  3RMD A;  3QEW A;  1RBR A;  4AM7 A;  4FJM A;  3O9Q A;  3DLK A;  3ULE A;  3QIP A;  3D2E A;  3V9Z A;  5J2P A;  3OYN A;  4FWN A;  4A5A A;  4DV0 K;  3U9D A;  4NB4 A;  3LP1 A;  4YDU A;  4KTW A;  3M8Q A;  4DSF A;  4CHO A;  5LL6 Z;  1T6C A;  3MAQ A;  4E1N A;  4FO0 A;  2D0O A;  1BOT O;  3JAM O;  3RRG A;  3AA2 A;  3KLG A;  3HYF A;  4IOX A;  2IGI A;  4L8R B;  3LDO A;  3I33 A;  4JK9 A;  2FBY A;  1RT5 A;  4ZHR A;  3CYM A;  3I8D A;  4O5F A;  3P39 A;  3E9P A;  3IAY A;  2I7N A;  3VTH A;  4FPB A;  1X9J A;  3KKR A;  3O1B A;  3AGR A;  2ATQ A;  3T7Z A;  4LF8 K;  2YHX A;  4JKF A;  3VEV A;  2NLX A;  4B08 A;  2HBK A;  3UKU A;  4DR1 K;  3J8A A;  4NYN A;  1JLA A;  1NNE A;  4ELT A;  3LDN A;  3SQ0 A;  4OLB A;  5C24 A;  4B1W B;  3AY9 A;  4DQP A;  4BR4 A;  4HTU A;  3VF6 A;  1VSL A;  4H4O A;  4O5B A;  4BVP A;  2I7P A;  1RIL A;  3NGI A;  1ATS A;  1Z25 A;  3OYF A;  4JRP A;  4EFH A;  2OA8 A;  3FLC O;  4JI5 K;  3C65 A;  3K5O A;  4BWM A;  5AQF A;  5JVG L;  1BU6 O;  1NGF A;  4CJE A;  5AQL A;  2P9K A;  2F96 A;  3CCL N;  1J6Z A;  4CK1 A;  1J54 A;  1GLE G;  4CK2 A;  3VER A;  4JRQ A;  1RBU A;  3LM9 A;  3AGK A;  1UWB A;  3W0L A;  4CJ7 A;  5CYQ A;  4DS5 A;  2KHO A;  1RTH A;  5CY4 A;  1VSK A;  3KLF A;  5JS1 A;  4CGJ A;  1FJG K;  4W5O A;  1BGX T;  3CIP A;  3MN5 A;  3KLE A;  3VQC A;  2VG7 A;  4ELV A;  3CCJ N;  4FK0 A;  3LPU A;  3SV4 A;  1RTI A;  4CF0 A;  2G8V A;  3AV9 A;  1ASU A;  1NBW A;  4CHP A;  4LF7 K;  2FSN A;  4DSK A;  4QAG A;  4HHT A;  3OYD A;  2UUB K;  1NJW A;  4ID1 A;  3WNF A;  2A1S A;  1WNS A;  1K8K B;  1MWK A;  3O4W A;  2DTU A;  1Z26 A;  3QO9 A;  3DMJ A;  5HRS A;  2YKN A;  1RDB A;  3FE1 A;  1U49 A;  4DS4 A;  5E26 A;  1SZ2 A;  2RF2 A;  3F9M A;  4KI4 A;  4O0I A;  3NF7 A;  5GAH P;  2HBM A;  1HUX A;  5C12 A;  4KRE A;  3ATU A;  3EKU A;  3K59 A;  1N34 K;  4C1N K;  3E9L A;  4O8U A;  1HKC A;  2CH6 A;  2V7Y A;  5AQS A;  4ZTJ A;  3KD5 E;  2X78 A;  3VEO A;  1LW0 A;  4X62 K;  4BRD A;  4CEE A;  4JN4 A;  3DXK B;  2OZM A;  3VMF B;  3D6R A;  4HUE A;  3DLR A;  1VSF A;  2OZS A;  1S9G A;  2G8F A;  3OYE A;  1E4F T;  3RMB A;  3TAR A;  1WBB A;  4FWK A;  4WFN L;  3LP0 A;  3OYK A;  2YKM A;  3LZJ A;  3G0Z A;  4CZK A;  3VGK A;  3LL3 A;  5F1X A;  3CJA A;  2XY5 A;  3A0I X;  3J80 O;  3CC7 N;  1KQS M;  1TAQ A;  4FW2 A;  3SUP A;  2KW4 A;  4BC4 A;  1BIS A;  3QIO A;  3QNO A;  4M41 A;  1VQN N;  1N8R O;  3MDQ A;  3TR8 A;  4OKK A;  4B9V A;  4IOC L;  3CC2 N;  3PX4 A;  2OTL N;  4CZJ A;  3V81 A;  4WCE L;  1ZXO A;  4BRA A;  1QTM A;  3OYI A;  1J9A A;  2H3G X;  1P90 A;  2NUB A;  2E6L A;  1WBD A;  1C0G A;  3ZT4 A;  5BRD A;  3L2R A;  4CZI A;  3CQY A;  3A5N C;  4KHN A;  1KFS A;  3PX0 A;  4F3T A;  2VCP A;  1DTT A;  4AH9 A;  4JKH A;  3T19 A;  3O3H A;  4FWP A;  3NAE A;  3VQQ A;  1RT2 A;  4H0P A;  4IG3 A;  5BN8 A;  1LWC A;  2CGL A;  4QS9 A;  1EWR A;  4HCC A;  3THW B;  1HNZ K;  3D45 A;  1QZ5 A;  5K14 A;  1SL1 A;  1FKO A;  1HPZ A;  1RDA A;  4LF6 K;  4BGB A;  5HRR A;  1JJ2 M;  1Q8I A;  5I9E B;  3AVN A;  2E2Q A;  4BAC A;  2ZE2 A;  3NGY A;  5HBM A;  5AQY A;  1S1W A;  2HW3 A;  5M1N A;  2E20 A;  2QXF A;  3OYH A;  4FCY A;  1NKB A;  3NVK A;  5AQR A;  3FR0 A;  5AQH A;  5C10 A;  5KQD A;  4FJK A;  3PO5 A;  4H0T B;  4M3Z A;  2FBT A;  4DV7 K;  3UIQ A;  2ASP A;  3THX A;  3AAP A;  3R1X A;  1XWL A;  1BA0 A;  4CZG A;  2RHK A;  1L3T A;  2UXC K;  1YAG A;  2CH5 A;  4DR4 K;  3CJ1 A;  4WQ4 C;  2VGN A;  3O3G A;  1XHX A;  3NH1 A;  1QE1 A;  1L5U A;  1U47 A;  4DTU A;  3SAF A;  1NK0 A;  3K57 A;  4E0D A;  3H6E A;  5FRM A;  1BWF O;  4BRO A;  4GY2 B;  3TWH A;  1XNR K;  2HB5 A;  3BF1 A;  5C2D A;  5HRO A;  4IJA A;  3AVM A;  2DFE A;  3L3U A;  1HQE A;  1TKX A;  3F73 A;  1KRP A;  3E01 A;  5KRT A;  1S9E A;  3LWM A;  1ASW A;  2Q36 A;  2A42 A;  1QHT A;  4EP5 A;  4F8R A;  4N76 A;  3L8B A;  4BDP A;  2QM1 A;  3BUZ B;  4N41 A;  4FWS A;  2FLO A;  5CR4 A;  1NOY A;  4WQ5 A;  4BE1 A;  1TK0 A;  3SLC A;  3AO3 A;  1SL0 A;  1RBS A;  2YJE A;  2BH1 A;  4CJU A;  2O8D A;  3L0Q A;  3ZT1 A;  1YVN A;  3OBY A;  3DOL A;  3NVM A;  4BC2 A;  4RW7 A;  2E4L A;  2CGK A;  2YNG A;  3S3M A;  2V51 B;  4NXN K;  3U3G A;  3SMS A;  1NKC A;  2OYQ A;  3G71 N;  4FJ9 A;  2ZGZ A;  1IKW A;  3DWL A;  3VQ5 A;  5FPN A;  1JLG A;  1D8Y A;  1HX1 A;  4GNI A;  3KK7 A;  2FF3 B;  4IBN A;  3NH0 A;  4CJ3 A;  4KBO A;  3O08 A;  3R6M A;  4KTZ A;  4JKG B;  2HBL A;  1YVU A;  4DQS A;  2YHA A;  4K8Z A;  1VSJ A;  4YOT A;  3HM8 A;  4J2A A;  1WUA A;  3U4L A;  3QEI A;  4HCB A;  3CI5 A;  4FJ5 A;  1U6Z A;  2PZS A;  3SI6 A;  4DQ8 A;  1HNI A;  1ESV A;  4CHZ A;  3H46 O;  2RPI A;  3V9U A;  5IT9 O;  4Z4C A;  5C25 A;  3OW2 M;  2D5R A;  1GOA A;  2QEX N;  1R59 O;  4LFB K;  3AVC A;  3QML A;  4FWL A;  3SV3 A;  3ENB A;  4GV9 A;  2CGJ A;  4LSN A;  1QVF M;  3JSM A;  1J5O A;  1TKD A;  4DTP A;  1N5Y A;  5DMR A;  2RKI A;  1LAV A;  3OYC A;  2HHX A;  2ZJR L;  5TKY A;  3WXK A;  4ZTF A;  3JXU A;  4FPA A;  3WT0 A;  4AIL C;  4WFB L;  1EX4 A;  3ZSY A;  2P1J A;  3WQT A;  3K9K A;  2X6N A;  3LZI A;  2DY4 A;  4ISF A;  4OPH A;  4FLV A;  1R0A A;  3CC4 N;  2VYP A;  2HNZ A;  4JD2 A;  4NO7 A;  3RMA A;  1OVY A;  4CBU A;  1BO5 O;  4F2S A;  2OCE A;  3S3O A;  4BE0 A;  3M8S A;  1YI2 N;  3NFA A;  3TAN A;  5CYM A;  3FZF A;  2BGG A;  2IAJ A;  1TUY A;  3F2K A;  3SBT A;  3VEZ A;  2UUC K;  4DSJ A;  4JYA K;  3HP9 A;  1VQ4 N;  1ASV A;  3LWL A;  1BIZ A;  2G8H A;  3CCU N;  1VQ6 N;  1ZBH A;  3SUN A;  3AO4 A;  3MCP A;  1TKZ A;  4CF2 A;  3V9X A;  4ISG A;  4IG0 A;  3P4I A;  2KTQ A;  5AZJ B;  2V7Z A;  2ZQB A;  3TU5 A;  4I6M A;  1RT4 A;  3MWT A;  2QTD A;  3GG4 A;  3MX2 A;  4K41 A;  4I9L A;  5C15 A;  3TAE A;  3B6O A;  1CZA N;  2P9P B;  4IEI A;  1EKE A;  3VEN A;  1IG9 A;  4NCG A;  3THY B;  5JS2 A;  4CGD A;  3CCS N;  1XUP O;  3DXM B;  3VF4 A;  4CEA A;  3CCQ N;  4IXC A;  3HRG A;  1Q81 O;  2YX6 A;  4CES A;  4DR3 K;  4BDY A;  4BQZ A;  2QKB A;  3HVR A;  2RN2 A;  2JLE A;  4A2A A;  1Q82 O; 
#chains in the Genus database with same CATH homology
 3LAN A;  1BI4 B;  1VRU A;  4OVL A;  4O4G A;  4RG8 A;  3KTQ A;  3NHG A;  2R7Y A;  4OLA A;  5J2N A;  3AVL A;  3AA4 A;  4B8C A;  3KK2 A;  1RT1 A;  1JXB A;  4B08 A;  4E89 A;  4KB1 A;  5HP1 A;  4M3U A;  3KLI A;  3SZ2 A;  3HM9 A;  4NYN A;  1JLA A;  3TAM A;  4ELT A;  3SQ0 A;  3C95 A;  4OLB A;  5C24 A;  4DQQ A;  1K6Y A;  4CJQ A;  3ZSQ A;  3OJS A;  3C6U A;  4DQP A;  4KHY A;  1ZBU A;  1IO2 A;  3DM2 A;  4HTU A;  2Z1H A;  4Y1C A;  2E6M A;  4B9S A;  4CIG A;  3FFI A;  1VSL A;  4H4O A;  4O5B A;  3VN5 A;  1RIL A;  3NGI A;  1Z25 A;  3WNG A;  2ETJ A;  3ZT2 A;  3OYF A;  3RR7 A;  4JRP A;  4CJL A;  2OA8 A;  3K5O A;  4DTO A;  2OPR A;  4CFA A;  5D3G A;  3G10 A;  3LDS A;  4BWM A;  1RT7 A;  4LD0 A;  2P5O A;  2FBV A;  3AA5 X;  3SQ4 A;  2HNY A;  2IDO A;  3SNN A;  4DTR A;  4DTM A;  1UAX A;  4KPY A;  3MXI A;  4Z4E A;  2HVH A;  4FM0 A;  1NJZ A;  1TVR A;  4KV8 A;  3PUF A;  4FZY A;  4CJE A;  1WSF A;  4M3W A;  4OPK A;  1KLM A;  3QLH A;  1B92 A;  1U04 A;  2F96 A;  1C0M A;  3DOK A;  5C42 A;  4CJR A;  1SKR A;  2FC0 A;  4CK1 A;  1J54 A;  3OS2 A;  1D9D A;  4KHQ A;  1T03 A;  4CK2 A;  4E7L A;  3P5J A;  3T3F A;  1U4B A;  1Y97 A;  4CER A;  4JRQ A;  2A1R A;  1RBU A;  2IOC A;  4AHC A;  3VQP A;  4CGH A;  1UWB A;  3AO5 A;  4BE2 A;  2QKK A;  5SWM A;  5EU7 A;  3DI6 A;  5CYQ A;  4DS5 A;  1IKX A;  4NCA A;  1T05 A;  2B5J A;  4KAZ A;  4FJL A;  3HXM A;  1RTH A;  5CY4 A;  3LPT A;  4CEQ A;  3TAG A;  1VSH A;  3VA0 A;  3AO1 A;  1VSK A;  3SUO A;  3ZSZ A;  4KB0 A;  3KLF A;  5JS1 A;  4CGJ A;  1ZYQ A;  1IKV A;  2GBZ A;  4W5O A;  1IH7 A;  1BGX T;  1SL2 A;  1HYV A;  3AA3 A;  4M3X A;  3DRP A;  1WN7 A;  4CFD A;  2Z1G A;  4ICL A;  1CZ9 A;  5FRN A;  1A5V A;  3KLE A;  1LWF A;  3VQC A;  1L3V A;  3CG7 A;  2VG7 A;  3LAK A;  1VK0 A;  1N6Q A;  4ELV A;  3WNE A;  1NK9 A;  3AVJ A;  1U45 A;  1XC9 A;  4ELU A;  4FK0 A;  1D5A A;  4E3S A;  4B9M A;  3LPU A;  4GW6 A;  3SV4 A;  5J2Q A;  1RTI A;  4DFM A;  4CF0 A;  2G8V A;  3DLB A;  4OKJ A;  3AV9 A;  4F2R A;  4KHU A;  1FK9 A;  1ASU A;  4FJG A;  3AVB A;  4CHP A;  2X6S A;  2XY7 A;  3QET A;  4H4M A;  1VRT A;  2YNI A;  3HST B;  4FLW A;  4DSK A;  1WSH A;  3ZSX A;  4XIU A;  4QAG A;  4CEF A;  4CF8 A;  3OYG A;  3KKS A;  4OGE A;  3ZT3 A;  4HHT A;  3OJU A;  3OYD A;  2G8U A;  1NJW A;  1S5J A;  4ID1 A;  3L2W A;  3WNF A;  2KFZ A;  2A1S A;  1LAW A;  1WNS A;  3NF9 A;  4CF9 A;  3O4Q A;  4PA1 A;  3NE6 A;  1SKW A;  1Z26 A;  2DTU A;  3QO9 A;  3DMJ A;  5HRS A;  2YKN A;  1RDB A;  3LP2 A;  1U49 A;  1UOC A;  4FJH A;  4DS4 A;  3HVT A;  3ULD A;  5J2M A;  1W9H A;  1I39 A;  4M45 A;  3CM5 A;  2RF2 A;  3ITH A;  4AHS A;  4KI4 A;  3SCX A;  4O0I A;  3U3Y A;  4Z4I A;  5HRN A;  3NF7 A;  4O44 A;  3QEX A;  1S1V A;  2Z1J A;  1NK8 A;  4W5Q A;  4C8O A;  1BIU A;  4KFB A;  3VQ9 A;  4KRE A;  2HHU A;  3K59 A;  1CZB A;  2XY8 A;  3TAF A;  1MU2 A;  4PUO A;  3L2Q A;  3V9W A;  4EP4 A;  3SJJ A;  4ZTJ A;  1C0T A;  1HRH A;  3D0P A;  4CEB A;  3V4I A;  3KD5 E;  2X78 A;  1C0U A;  1LW0 A;  3VQE A;  4CEO A;  4PQU A;  3QER A;  4BWJ A;  1C6V A;  1C1B A;  2WON A;  3K5M A;  3AVH A;  2P51 A;  4CEE A;  4Z4F A;  1RBV A;  1KVA A;  2XY6 A;  1A5W A;  4QCL A;  2OZM A;  1JLC A;  1HNV A;  3SQ1 A;  4CHY A;  1U48 A;  3CFP A;  3L2U A;  4HUE A;  1UA0 A;  1B9D A;  3RR8 A;  3DLR A;  4CJT A;  2HHV A;  1VSF A;  2ITG A;  4LSL A;  4RW8 A;  3ASM A;  2OZS A;  1S9G A;  4Y1D A;  2G8F A;  3OYE A;  1QQC A;  3RMB A;  3TAR A;  1VSI A;  4GMJ B;  3HPG A;  2OPP A;  1S6P A;  3TI0 A;  1YTA A;  3LP0 A;  3OYK A;  2YKM A;  3CM6 A;  3ISN C;  3LZJ A;  4FJ8 A;  3C94 A;  3G0Z A;  1GOB A;  2BAN A;  1S1U A;  3VQ8 A;  1NK5 A;  2G8I A;  4FJ7 A;  3THV A;  1QS4 A;  2IC3 A;  3HPH A;  4AHV A;  2XY5 A;  3C6T A;  1KSP A;  3QEV A;  3BGR A;  4G1Q A;  1TAQ A;  2YNF A;  3BDP A;  4FW2 A;  3SUP A;  4FJX A;  3DLH A;  2KW4 A;  3AO2 A;  1ITG A;  3V9S A;  5I3U A;  4TSX A;  4AHR A;  1BIS A;  3QIO A;  3KIO A;  3QNO A;  3IRX A;  4OJR A;  3F9K A;  1JKH A;  4M41 A;  2F8T A;  1HYS A;  1FKP A;  1UA1 A;  3TR8 A;  4OKK A;  4B9V A;  3DLE A;  4F4K A;  4Z4H A;  2IS3 A;  3OYB A;  2VG5 A;  3P83 D;  4OGC A;  3NGZ A;  3PX4 A;  3RMC A;  3SPZ A;  3NDK A;  3V81 A;  4PWD A;  3SYZ A;  3PX6 A;  4DU3 A;  3QEP A;  3AVI A;  3L3V A;  4JS4 A;  2X74 A;  2YHB A;  3V1Q A;  4HVJ A;  5KI6 A;  4C8N A;  1QTM A;  4B9L A;  3OYI A;  1J9A A;  3RTV A;  1D9F A;  1YT3 A;  2NUB A;  1HMV A;  2E6L A;  3K58 A;  4Q0B A;  1RTJ A;  3ZT4 A;  3L2R A;  2GUI A;  4KHN A;  3TAP A;  4CHN A;  1KFS A;  3PX0 A;  4F3T A;  1VSE A;  1Q9X A;  3TAB A;  1DTT A;  2I5J A;  4AH9 A;  4O55 A;  4CEZ A;  3T19 A;  3AVF A;  3O3H A;  2G8K A;  1T7P A;  4IKF A;  3NAE A;  3DRS A;  3VQQ A;  1RT2 A;  3NH2 A;  4IG3 A;  5CZ1 A;  1X9M A;  4KRF A;  2O4G A;  1LWC A;  4FYD A;  3OYM A;  1SV5 A;  4DFK A;  3VA3 A;  4I9Q A;  4DSI A;  4HCC A;  1GOC A;  5HLF A;  3KD1 E;  4WE1 A;  4B3O A;  3D45 A;  5K14 A;  1SL1 A;  1FKO A;  1HPZ A;  1RDA A;  1SKS A;  4EZ9 A;  1NJY A;  1FXX A;  1JLQ A;  1QSS A;  1TV6 A;  1WSG A;  4CJW A;  4CJF A;  5HRR A;  4E7K A;  4DMN A;  4LH5 A;  4FJI A;  3HK2 A;  3PV8 A;  1Q8I A;  3M8R A;  1NJX A;  4J2B A;  3AVN A;  2XO7 A;  3A2F A;  4Z0U A;  2ZE2 A;  1KCF A;  3NGY A;  5HBM A;  4BAC A;  1S1W A;  2DFF A;  4FLX A;  3HO1 A;  2HW3 A;  4FLU A;  3OVN A;  3HJF A;  4FCY A;  4HUG A;  2QXF A;  3NBP A;  3OYH A;  1NKB A;  1WSE A;  3AVA A;  1RDD A;  1W0H A;  4YNQ A;  2VWK A;  1YTU A;  4RW9 A;  2PYL A;  2LSN A;  4FJK A;  3PO5 A;  3AVK A;  4M3Z A;  4FLZ A;  2FBT A;  3VQ7 A;  4UQG A;  4CJ4 A;  2HHQ A;  1TK5 A;  1O1W A;  3UIQ A;  1IKY A;  4CFB A;  3ZCM A;  2YV0 X;  3NCI A;  4NYF A;  2HMI A;  4PY5 A;  3ALY A;  1TKT A;  4M3R A;  1S6Q A;  5SZT A;  1XWL A;  1JL1 A;  3CFR A;  4CJS A;  4FLY A;  3B6P A;  3HL8 A;  1KLN A;  3V1R A;  3QNN A;  1X9S A;  1L3T A;  3ZSV A;  2OPQ A;  4NCB A;  4CFC A;  3ZSW A;  3V1O A;  4CIE A;  3H08 A;  4E7I A;  4IDK A;  3O3G A;  2BE2 A;  1RT3 A;  1XHX A;  3NH1 A;  4J2D A;  1QE1 A;  2KFN A;  3ZT0 A;  3CQ8 A;  1QSY A;  1L5U A;  1U47 A;  3RWU A;  1ZBF A;  3U6F A;  4DTU A;  4DU1 A;  3NF8 A;  1NK0 A;  4CJ5 A;  4ID5 A;  1WLJ A;  3K57 A;  4DSL A;  4E0D A;  4E1M A;  2HHW A;  5FRM A;  2EHG A;  4C8K A;  4CEC A;  2W42 A;  5KGW A;  3TWH A;  2HB5 A;  3EY1 A;  4DLG A;  2BDP A;  3MEG A;  1CXU A;  4CIF A;  2HHT A;  3IG1 A;  5HRO A;  3AVM A;  2DFE A;  4DG1 A;  3L3U A;  1JLB A;  1HQE A;  1TKX A;  3VQD A;  3F73 A;  1XHZ A;  1KRP A;  3E01 A;  1BCM A;  1KVB A;  1S9E A;  5KRT A;  4FXD A;  3LWM A;  1ASW A;  3CFO A;  4DWI A;  1LW2 A;  3DLG A;  1TL3 A;  4IFY A;  1C1A A;  4DSE A;  4CED A;  3SPY A;  1QHT A;  4EP5 A;  4DQI A;  1EET A;  4CE9 A;  4F8R A;  1LV5 A;  4N76 A;  3L8B A;  4BDP A;  4N41 A;  1B9F A;  3LAM A;  2B6A A;  3P1G A;  3VQ4 A;  1NOY A;  3I0R A;  1EXQ A;  4BE1 A;  4DQR A;  3S9H A;  4KTQ A;  4K8X A;  1DTQ A;  1TK0 A;  3EYZ A;  5FRO A;  1ZBL A;  2HHS A;  4FZX C;  3AO3 A;  1SL0 A;  1EP4 A;  3O4N A;  3V6D A;  1RBS A;  1TAU A;  4CJU A;  4W5R A;  4B9U A;  1JLE A;  2ZD1 A;  3VQA A;  3ZT1 A;  4N5S A;  1NK7 A;  3EZ5 A;  3DOL A;  4RW7 A;  2E4L A;  3HP6 A;  4CCH A;  2YNG A;  3OS0 A;  3S3M A;  1RTD A;  1RCH A;  3U3G A;  4C8M A;  1NKC A;  2PYJ A;  1JLF A;  2OYQ A;  4KKO A;  4KHW A;  1HJR A;  4FJ9 A;  1IKW A;  3VQ5 A;  1CLQ A;  4KHS A;  3OS1 A;  1JLG A;  3M8P A;  1RNH A;  1D8Y A;  4CGG A;  3DRR A;  3RRH A;  1KVC A;  1S1T A;  3S3N A;  4IBN A;  3NH0 A;  1NK4 A;  4CJ3 A;  4FZZ A;  4DTN A;  1SUQ A;  1KTQ A;  1RDC A;  3QIN A;  4MQ3 A;  1JXE A;  4KTZ A;  1L3U A;  4CHQ A;  5CZ2 A;  1YVU A;  1WSI A;  2EX3 A;  5FDL A;  4DQS A;  2YHA A;  1NKE A;  1VSJ A;  4K8Z A;  4CK3 A;  2XHB A;  4J2A A;  4LH4 A;  5KGX A;  2B4J A;  3QEI A;  4HCB A;  5KRS A;  4OPJ A;  4QOZ B;  5DK5 A;  4E7H A;  4FJ5 A;  3AVG A;  1A5X A;  4B9T A;  2OPS A;  4EZ6 A;  2F8S A;  1TK8 A;  2PZS A;  3SI6 A;  1LWE A;  1HNI A;  3MED A;  4DF8 A;  4FLT A;  4CHZ A;  2P5G A;  5KTQ A;  2D0B A;  2YNH A;  2RPI A;  4B9N A;  3K5L A;  3V9U A;  4JLH A;  2DFH A;  3WNH A;  4Z4C A;  5C25 A;  3L2V A;  4I2P A;  1JL2 A;  1TGO A;  4O0J A;  4OKE A;  1BQN A;  2D5R A;  4DTS A;  1GOA A;  4KI6 A;  3AVC A;  3SV3 A;  1KFD A;  3HPO A;  4E19 A;  1J53 A;  2KZM A;  4R5P A;  4DTX A;  1HQU A;  3ZSO A;  2G8W A;  3JYT A;  4M3Y A;  3OY9 A;  2KZZ A;  3QES A;  1HYZ A;  1WSJ A;  4LSN A;  4H8K A;  3JSM A;  3KJV A;  1C1C A;  1J5O A;  1TL1 A;  1S1X A;  1TKD A;  5I42 A;  1BI4 A;  1WAF A;  4DTP A;  5DMR A;  1N5Y A;  4J2E A;  2RKI A;  1LAV A;  4GVM A;  4W5T A;  3OYC A;  5T7B A;  2HHX A;  1G15 A;  1CXQ A;  3TAQ A;  4DTJ A;  1BCO A;  4CGF A;  3O3F A;  4ZTF A;  3MXM A;  4FJJ A;  4FK4 A;  2Z1I A;  3SUQ A;  4AHU A;  4W5N A;  4N56 A;  3HT3 A;  1NOZ A;  4HUF A;  3KLH A;  4AIL C;  4Z4G A;  2XRI A;  3SQ2 A;  1EX4 A;  3MEE A;  5E41 A;  4DF4 A;  1BHL A;  3ZSY A;  2QK9 A;  4LY7 A;  3NF6 A;  2P1J A;  3I0S A;  2X6N A;  3LZI A;  1ZBI A;  2DY4 A;  4FLV A;  4AHT A;  3LP3 A;  1R0A A;  1T8E A;  4FJN A;  4CF1 A;  4CGI A;  4BDZ A;  1XI1 A;  1RBT A;  2HNZ A;  3KK1 A;  3PY8 A;  4M42 A;  4FW1 A;  4M3T A;  3RMA A;  4I2Q A;  5J1E A;  4F2S A;  3S3O A;  2FBX A;  4BE0 A;  1QSL A;  1I3A A;  3M8S A;  2Y1J A;  2HVI A;  1F21 A;  4N47 A;  1BQM A;  3NFA A;  4DU4 A;  5CYM A;  3TAN A;  3MEC A;  3ZSR A;  1BL3 A;  2BGG A;  2IAJ A;  2AJQ A;  2GV9 A;  4DSJ A;  4JS5 A;  2HND A;  3HP9 A;  2VG6 A;  4CJK A;  1ASV A;  3LWL A;  1BIZ A;  3RMD A;  1DLO A;  2G8H A;  3QEW A;  1RBR A;  3K2P A;  3OYJ A;  1ZBH A;  3SUN A;  4FJM A;  2O4I A;  3AO4 A;  4MFB A;  4RW4 A;  3PO4 A;  2PY5 A;  1TKZ A;  4CF2 A;  3DLK A;  4FM1 A;  3V9X A;  2D0A A;  3IS9 A;  3VQ6 A;  4DLE A;  5HRP A;  4E7J A;  3QIP A;  4F3O A;  1WAJ A;  4IG0 A;  2KTQ A;  2D0C A;  3MXJ A;  1Q9Y A;  3V9Z A;  5J2P A;  4FVM A;  3OYN A;  3OYA A;  2ZQB A;  4FM2 A;  3K5N A;  3LP1 A;  1RT4 A;  2Q3S A;  2KQ2 A;  3DYA A;  2WOM A;  4YFU A;  4I9L A;  4KTW A;  4I7F A;  3M8Q A;  2VWJ A;  4RW6 A;  4CHO A;  4DSF A;  3MAQ A;  3TAE A;  4E1N A;  4FK2 A;  1NK6 A;  1RT6 A;  3B6O A;  1X1P A;  3RRG A;  1EKE A;  3AA2 A;  3KLG A;  3HYF A;  1IG9 A;  2IGI A;  4NCG A;  4DFJ A;  3OYL A;  4L8R B;  2FBY A;  3VQB A;  1X9W A;  5JS2 A;  1RT5 A;  4ZHR A;  3KK3 A;  4CGD A;  3CYM A;  4Q5V A;  4CJV A;  4IFV A;  4DFP A;  4B8A B;  3I8D A;  2Y1I A;  4CEA A;  1VSD A;  4C8L A;  3IAY A;  3T1A A;  1VSM A;  4CJP A;  4CES A;  4BDY A;  1L3S A;  2JGU A;  3LAL A;  2QKB A;  3HVR A;  2RN2 A;  3KKR A;  2JLE A;  1REV A;  4KO0 A;  2ATQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...