5KGXA

Hiv1 catalytic core domain in complex with an inhibitor (2~{s})-2-[3-(3,4-dihydro-2~{h}-chromen-6-yl)-1-methyl-indol-2-yl]-2-[(2-methylpropan-2-yl)oxy]ethanoic acid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
153
structure length
134
Chain Sequence
b'CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKTAWWAGIKQEESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Indole-based allosteric inhibitors of HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
total genus 45
structure length 134
sequence length 153
ec nomenclature
pdb deposition date 2016-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5kgxA00
1J5OA 1R0AA 2XY6A 3NFAA 5KTQA 2YKMA 4AHSA 3KK1A 3ZSOA 3LWMA 3V6DA 1UOCA 5J2PA 1RDCA 2G8WA 4LSNA 3OYCA 1KSPA 1YVUA 4CJSA 1ZYQA 3S3OA 4DLEA 4CF0A 4N47A 3TAPA 3S3NA 5FROA 5E41A 1SKRA 4IDKA 5CYQA 3P1GA 4O0JA 3K5MA 3BDPA 3L3UA 4DFJA 1HYZA 3FFIA 4CFAA 2PY5A 4H8KA 1TKDA 1ZBHA 1TGOA 3TWHA 3SJJA 1BCOA 4FM2A 3NGYA 3JSMA 1CLQA 4QAGA 1JL2A 4FM1A 1S1XA 3HL8A 3QESA 2ZD1A 1LWEA 4R5PA 1XHXA 4PQUA 1T7PA 1SUQA 1KLMA 4ZTFA 4OKKA 4UQGA 4C8LA 1HYSA 3EYZA 4DF8A 3AA3A 2D0AA 4FLWA 4DS5A 3OYKA 2YHAA 1LV5A 3U6FA 4M42A 1C1BA 3PX6A 4KI4A 3LWLA 2OPQA 3E01A 1FXXA 3V81A 1TKTA 4I2PA 4PWDA 1WSHA 5EU7A 1HJRA 1RBVA 3OYDA 4CJPA 4LH5A 2YHBA 3ZT1A 4Q5VA 2ZQBA 1EETA 3AO2A 5J2QA 5FDLA 4DSFA 4AHUA 2HNYA 4CJRA 4KI6A 1IKWA 1S1VA 3L2RA 2ITGA 3RMCA 3PUFA 3KTQA 4RW8A 4E89A 1VSIA 3VQ7A 4DTMA 1RILA 1DTQA 4CIGA 2BDPA 3S9HA 4W5TA 4AHRA 4CEAA 1BISA 3LANA 4CJTA 3OYJA 2XY5A 1NJZA 1HQUA 3AA2A 4KAZA 4DSEA 4PY5A 4H4OA 3KKRA 4DU4A 5J2NA 1XC9A 4CEFA 2KZMA 3OYMA 4EZ6A 4ZTJA 4CEOA 4QOZB 4FJKA 2QK9A 2D0CA 3VQAA 1VRUA 2E4LA 3VQDA 4B9NA 2KFZA 3AVIA 2YV0X 4KB1A 1NJYA 5C25A 3QEPA 3ZSYA 4AH9A 4OPKA 1U49A 3HYFA 1TKZA 4KTWA 4CERA 3KJVA 4BE0A 3QEIA 2YNGA 2RN2A 4HTUA 4FJMA 1EKEA 3LP0A 3ZCMA 3G10A 3ISNC 5HRSA 4J2AA 5JS1A 4B9TA 3DOLA 1J9AA 4AHTA 4ELTA 3DRPA 3SQ4A 2FBVA 3IG1A 4E7HA 2F8TA 1BIUA 3QEXA 4HCBA 4FJ9A 4J2EA 1JLAA 4ELVA 1VSFA 2PYLA 1NJXA 3HJFA 2ETJA 3AVNA 3QLHA 4QCLA 3HVRA 1GOAA 3M8QA 3EZ5A 1BHLA 1NK5A 5HBMA 4DSKA 4FJJA 2I5JA 1VSMA 4CFBA 1WAJA 1WSEA 3MECA 4JS4A 4ELUA 3VQ8A 2OYQA 2QKBA 3SZ2A 3OY9A 4Z4GA 4FCYA 3DRRA 4N41A 4DSJA 2VG7A 1RT4A 1IKVA 4CF8A 4E19A 3OYBA 4HUGA 4CJWA 2HB5A 3AVCA 1BL3A 1WSFA 1HNIA 4Z4FA 4DU1A 3AVAA 3AVJA 2G8FA 1DTTA 4GW6A 3TABA 1LWFA 4PA1A 3NE6A 4FLYA 4KHUA 4HVJA 3DLGA 3VN5A 1RT7A 3QIPA 3L2QA 5J2MA 1TK8A 4IG3A 2BGGA 3D0PA 1KTQA 3MEEA 3NDKA 3PO4A 1VSEA 3NBPA 1CZ9A 1NJWA 4F3OA 4DLGA 3QEWA 2KZZA 2HNDA 3KLGA 4DTXA 4ZHRA 3DLKA 1QS4A 4DQRA 5T7BA 4B9SA 3DM2A 4Z0UA 1TV6A 3LAMA 1IKXA 1BIZA 2D5RA 2VG6A 4C8MA 3VQ9A 5C24A 4CGHA 3LP1A 5J1EA 3LPUA 3CQ8A 4NCAA 3TI0A 1FKOA 4CHPA 4BE2A 2HMIA 1LW0A 4RW7A 2O4GA 4CFCA 2AJQA 5DMRA 4LSLA 1X9WA 3ZSVA 3LZIA 4DMNA 3OYEA 3PX4A 3LALA 3ZSXA 3OJUA 4NCGA 4DQQA 2QKKA 4FK2A 1WSIA 4BACA 5CYMA 3M8RA 3SPYA 3AVFA 2OZMA 1JKHA 4CJFA 5HRPA 4M3YA 4B3OA 4M3TA 3WNEA 1VSLA 3HP6A 3TARA 4B9UA 1S9GA 3QNNA 1L3SA 3PO5A 1VSDA 3G0ZA 3K5LA 1YT3A 5SZTA 3HT3A 3QINA 2Y1IA 1RTJA 4F2SA 2B6AA 3V1QA 2PYJA 1L3VA 4FJ5A 3SQ1A 1XHZA 3SUPA 4KTZA 4IBNA 2YNHA 2W42A 3K5OA 3VQQA 1RT5A 1F21A 1JLBA 2D0BA 3KKSA 1D9DA 2Q3SA 4CCHA 3QEVA 3H08A 3LZJA 1T05A 4J2DA 3SV3A 4FJ7A 3DLEA 3K2PA 1U45A 3VQEA 4FK4A 5HP1A 4NYNA 4B8AB 3K5NA 3NGZA 1RTIA 1TVRA 3LP3A 1NOZA 1VK0A 3LPTA 4MQ3A 1I3AA 4CGJA 3V9XA 3RRHA 3RR8A 2XY7A 1IKYA 3VQPA 3ZT2A 1FKPA 4O4GA 1MU2A 3L2UA 4FK0A 1HMVA 4J2BA 3P83D 4CIEA 5JS2A 4OPJA 1EXQA 1JLEA 3QETA 4DTSA 2KTQA 4K8ZA 2G8VA 2HHQA 3THVA 1RBSA 1FK9A 4CGFA 2IOCA 4CK2A 1S1UA 3AA5X 4RG8A 1GOBA 3VQ5A 1TL1A 1JXEA 1KCFA 2LSNA 2DFEA 3DYAA 3ULDA 2P5GA 1JXBA 4N56A 3CFOA 1X9SA 4E3SA 1WAFA 4N76A 1NK0A 2B5JA 4W5NA 1U47A 1QQCA 3AVBA 3DLRA 3QO9A 1ASVA 5KGXA 4IKFA 4Z4EA 1HNVA 1KVCA 2IGIA 4FJXA 3KD1E 4DF4A 4FZYA 4OKEA 4B9LA 1NKCA 1SV5A 4FZXC 4OGCA 4W5QA 4W5OA 1D9FA 4XIUA 4FJHA 4FLUA 3CG7A 4CEEA 4NYFA 4Z4HA 4LD0A 3AO3A 1C0TA 4H4MA 4GMJB 3MAQA 3U3YA 1UA0A 1KFSA 2XY8A 4MFBA 1T03A 4RW4A 1NKBA 1N5YA 3VQCA 1NK8A 1A5VA 4CHOA 5DK5A 2G8KA 1ASUA 3P5JA 1SKSA 1Q9XA 2FC0A 4CJKA 4CF1A 3LP2A 4RW6A 5SWMA 3SQ2A 1TK5A 2VG5A 3CYMA 1CXUA 1LAVA 1REVA 3WNGA 3ZSQA 2Y1JA 4JRPA 4C8OA 2WOMA 4ID5A 1G15A 3TANA 4E7KA 3DLHA 2XHBA 4KO0A 3LDSA 3VA3A 1W0HA 1L5UA 4DQSA 1DLOA 1BGXT 3AA4A 3ZSZA 4CESA 1UA1A 4I7FA 4DTPA 3BGRA 4FJGA 2OZSA 1RBTA 4ID1A 4AHCA 4CEBA 5FRMA 3HSTB 3MXMA 1KFDA 4OGEA 4Z4CA 4HHTA 3OS2A 2RF2A 3PY8A 4CJQA 4B8CA 1U4BA 3WNHA 4FLTA 3AVGA 1ZBFA 3L3VA 1RT6A 2FBYA 4FJIA 3M8PA 2Z1JA 3C94A 3NHGA 1CZBA 4JLHA 1WSJA 3ZT4A 3PX0A 2G8UA 4KHYA 3AO1A 5K14A 3OYLA 1HPZA 1Y97A 1ASWA 2X74A 3NF8A 3SI6A 1NK4A 1HYVA 3C95A 1A5WA 2KQ2A 3KLIA 3S3MA 4M3UA 5C42A 4E1MA 4BE1A 1BCMA 3CFPA 4M3ZA 3ALYA 3U3GA 1S6PA 4CEDA 4CHNA 1SL2A 1RTDA 2ATQA 3KIOA 4KKOA 1B9DA 4B9VA 4IFVA 1RT2A 3CM5A 4E7JA 1SL1A 4O0IA 4GVMA 3HPHA 4E1NA 4CK1A 4CECA 3TAFA 1JLFA 4OLAA 3EY1A 3AO5A 4CK3A 3AV9A 3OYHA 3OS0A 4OJRA 4DG1A 3V9ZA 1QSSA 2G8IA 1Q9YA 4DFKA 4WE1A 3OYFA 1KRPA 3V1OA 4IG0A 4CE9A 1J53A 1TAUA 1B9FA 5D3GA 4DQPA 3SUNA 2IAJA 4FYDA 3B6PA 3K58A 1WNSA 3RTVA 3MXJA 4TSXA 2PZSA 3T3FA 4LY7A 1U04A 4CF2A 3SV4A 1NKEA 1Z26A 2GBZA 4JRQA 1C0UA 3KLFA 1Z25A 4M3XA 1JLQA 3IRXA 4M3WA 3RMAA 4DQIA 1S9EA 2DY4A 3I0RA 2BANA 3KD5E 4CHQA 3SNNA 1IO2A 1BQNA 3AVMA 4CGGA 2P1JA 3OYGA 1S1WA 5I42A 3JYTA 1JLCA 2HW3A 3TAQA 1HRHA 3OYNA 3ZT3A 4W5RA 2KFNA 3CM6A 1GOCA 3A2FA 3O3FA 3HXMA 4KRFA 3ZSRA 2VWKA 3C6TA 2BE2A 1VSJA 4CIFA 4CJLA 3OYAA 4KHQA 4Y1DA 1UAXA 3NF9A 4JS5A 4E7LA 4CGIA 3PV8A 1C6VA 1LWCA 4FM0A 4I9LA 5CY4A 4M41A 3TAGA 3HO1A 4M45A 4FVMA 1LAWA 5I3UA 3MXIA 4DWIA 2HHTA 2HHSA 4CFDA 2F8SA 1RNHA 3TR8A 5HROA 3IS9A 3RRGA 2F96A 3KLEA 1SL0A 2IDOA 4EZ9A 3I0SA 4Q0BA 4CJUA 3NH0A 3L2VA 4HUEA 4FLVA 2WONA 4YNQA 4BDZA 1JL1A 1YTUA 1WSGA 1UWBA 2E6LA 1X1PA 4C8KA 2X6NA 4KPYA 5KRTA 1ITGA 1VSKA 4KREA 2HHWA 1CXQA 4N5SA 3OS1A 2GUIA 4O5BA 3V9UA 1KLNA 4BDPA 1B92A 1I39A 1NOYA 1L3UA 1RDAA 1HQEA 4BWMA 4Y1CA 1TK0A 1QSYA 2DTUA 3F73A 4CJ4A 3UIQA 4FJLA 3SPZA 1J54A 3ASMA 4EP5A 4KTQA 2DFFA 2DFHA 2P51A 2RPIA 5CZ2A 2OPRA 1TAQA 2QXFA 3QNOA 3ZSWA 1QHTA 3V9SA 2O4IA 4DSLA 1S6QA 3DOKA 4BWJA 3RR7A 1D8YA 3HK2A 1D5AA 1YTAA 2YKNA 1T8EA 4K8XA 1EX4A 4DFMA 2GV9A 1KVBA 4OKJA 3V9WA 1IG9A 4KHWA 2X78A 3CFRA 4OVLA 4DTUA 3KLHA 4I2QA 3DLBA 1BI4B 4KV8A 5CZ1A 4F2RA 1ZBUA 4G1QA 3NAEA 1VSHA 3AVKA 3KK2A 3KK3A 2JLEA 3HPGA 1RTHA 2YNIA 3NGIA 4DFPA 2A1RA 1X9MA 1N6QA 4CJ5A 3VA0A 4F3TA 3RWUA 2OPSA 1TKXA 3V1RA 4E0DA 4FLXA 4FW1A 1VRTA 2IC3A 2ZE2A 1XWLA 2R7YA 1K6YA 2EHGA 3D45A 3ZT0A 4FW2A 5HRNA 2XO7A 4F4KA 3DMJA 4CHZA 4L8RB 3NF6A 4FJNA 2IS3A 4RW9A 3TAMA 2KW4A 4PUOA 4CEZA 1O1WA 4CJEA 3TAEA 3O3GA 3L8BA 2YNFA 3V4IA 2RKIA 3AVLA 1C0MA 5KRSA 3NH1A 4CF9A 3MEDA 3OJSA 4AILC 1S5JA 2A1SA 4CEQA 4DTOA 1RDBA 5FRNA 1QSLA 3HVTA 1QTMA 4CJVA 1RCHA 3SYZA 1NK7A 3NH2A 3QERA 2OA8A 3SQ0A 4KB0A 3HPOA 1QE1A 1W9HA 4O55A 4B08A 4NCBA 4M3RA 1NK9A 4B9MA 3OYIA 4IFYA 3K57A 4BDYA 1ZBIA 2HHUA 4HCCA 3QIOA 4CGDA 4CHYA 3M8SA 4FXDA 5HRRA 2HHXA 4AHVA 1RBUA 1U48A 3ITHA 4KFBA 3T19A 1IH7A 3RMBA 2E6MA 1Q8IA 4E7IA 2EX3A 1TL3A 2FBXA 3L2WA 4KHSA 1ZBLA 2FBTA 3O3HA 1LW2A 3F9KA 3SUOA 4Z4IA 3VQBA 4FZZA 3VQ6A 5KGWA 4DTRA 3OVNA 4KHNA 4LH4A 3RMDA 4DSIA 4DU3A 1C1CA 4CJ3A 2HNZA 2Z1IA 4YFUA 3K59A 2G8HA 3LAKA 1NK6A 4HUFA 1RBRA 4F8RA 4C8NA 4ICLA 1WN7A 3B6OA 3C6UA 3HM9A 2VWJA 4FLZA 4DTNA 3T1AA 2HVIA 5HLFA 4FJ8A 3HP9A 5KI6A 2HVHA 3NCIA 2XRIA 2Z1HA 1RT3A 1XI1A 1JLGA 1L3TA 3AO4A 3SCXA 2JGUA 4EP4A 4O44A 1A5XA 1BQMA 3DRSA 3MEGA 2OPPA 2NUBA 3NF7A 1RT1A 3O4NA 4DS4A 2P5OA 3AVHA 1C1AA 4OLBA 3IAYA 3I8DA 3SUQA 4I9QA 1S1TA 1WLJA 3O4QA 3WNFA 2HHVA 1BI4A 1RDDA 3DI6A 4DTJA 2B4JA 3VQ4A 1EP4A 1SKWA 2X6SA 1KVAA 2Z1GA
chains in the Genus database with same CATH superfamily
5KTQA 4AHSA 4DQ8A 4LSNA 4A5BA 2E5LK 4CJSA 3J8AA 4FPBA 4DLEA 4CF0A 4N47A 1N8RO 4IZ9A 5FROA 5CYQA 3O9SA 3K5MA 3BDPA 3CCEN 2PY5A 4CFAA 1YHQN 4H8KA 1TKDA 1GLLO 1ZBHA 3SJJA 1CLQA 4FM1A 1S1XA 3HL8A 4M7YA 1XHXA 4WQ4C 5BRFA 4OKKA 1YXQA 3VEOA 3AA3A 2QW9A 4FLWA 2VGMA 5BRHA 4BRGA 4M42A 3CCSN 3GBTA 2V7YA 3E01A 4DV2K 2VWBA 4I2PA 4JI0K 2NLXA 1DGKN 3O5BA 3D2EA 3HZ6A 4LH5A 2YHBA 3ZT1A 1YI2N 3JXUA 5HOOA 4WQ5C 2HNYA 4CJRA 4KI6A 1IKWA 1KAZA 1S1VA 2ITGA 3GE1A 3J80O 2A40A 2P9LB 4B1XB 4W5TA 4JI6K 4AHRA 4CJTA 3B8AX 2XY5A 5KPTA 3CPEA 2QI2A 4BVOA 3I55N 4FJKA 2D0CA 4A59A 3VQDA 4CZIA 4B9NA 3AVIA 3D2FA 5C25A 3P38A 4AH9A 2NRVA 3HYFA 1HX1A 4BE0A 1K73O 3I33A 4NO7A 3IDHA 2RN2A 4J2AA 5HRSA 1NMNA 3TPQA 4B9TA 2NRRA 3E66A 4E7HA 2F8TA 2P9NB 3QEXA 2P9IA 4HCBA 3J81O 1JLAA 5LJVA 1T44A 3O1BA 1BHLA 5HBMA 1NGHA 1WSEA 4ELUA 2QKBA 3SZ2A 4Z4GA 4DSJA 4DB3A 4CJWA 1BL3A 2G8FA 3TABA 3NE6A 5AQPA 4HVJA 3IFRA 3H46O 4DR7K 4JKGA 3VN5A 3QBWA 3TTDA 1NNEA 3M6GA 4BRPA 3NDKA 1VSEA 3NBPA 4MLEA 4F3OA 2HNDA 1XMOK 3IMXA 3DLKA 3VEVA 4CZGA 4JKDA 3LAMA 4NCAA 5J1EA 4XH5A 2HMIA 2O4GA 3LZIA 1J5EK 3ZSXA 3OJUA 4NCGA 2QKKA 1WSIA 4BACA 3M8RA 5HRPA 3EO3A 4DR3K 4M3TA 2A6AA 4B9UA 2ZWHA 2QWRA 1YT3A 5SZTA 4I6MA 3ENHA 3EKUA 1XNRK 4KH4A 3QINA 4F2SA 5CHIA 1N33K 1NBWA 5AQWA 1BWFO 2YNHA 3MK6A 1I94K 2D0BA 1ATNA 2Q3SA 4CCHA 3QEVA 3LZJA 4FJ7A 1YITN 1U45A 3VF2A 4NYNA 4B8AB 4MQ3A 4CGJA 1NOZA 2PFUA 3LPTA 3V9XA 3RRHA 4JKAA 1P8ZA 3ZT2A 4FK0A 3QETA 4CBUA 5GIPA 4DTSA 2KTQA 4K8ZA 4CGFA 1S1UA 2E2QA 3UKRB 3H3OB 1KCFA 5AQMA 1WAFA 4N76A 3KWGA 1QQCA 3THXA 3QO9A 2I7NA 3QICA 4JKFA 2IGIA 3U4LA 4HTLA 4B9LA 2YI1A 3N4PA 1MWKA 3CCQN 3CG7A 4U7BA 4CEEA 4MO4A 3C6AA 1KFSA 2E2NA 4B1WB 5GAEP 1NK8A 3EN9A 1ASUA 4DR2K 4YOWA 3VENA 5TKWA 3SQ2A 5SWMA 2VG5A 4C8OA 4O8KA 1JJ2M 2Y1JA 2WOMA 4ID5A 1G15A 4FWLA 4E7KA 1W0HA 4DQSA 3VTIA 4CESA 5HL7L 3T69A 2OZSA 3SAHA 4ID1A 1SAZA 4AHCA 1QZ5A 2HBLA 1E3MA 4OGEA 3OS2A 5EXWA 1SZ2A 4MDAA 3PY8A 3R8EA 1RT6A 2ZJPL 3M8PA 2E88A 2Z1JA 3C94A 3ZT4A 1Q7YO 3TTFA 4M3UA 3C95A 5GAGP 3KLIA 2CGJA 3CFPA 1RTDA 2O8EA 3J7AP 4FWOA 4KKOA 4GV3A 4LFBK 4O0IA 4YOUA 3HPHA 4CVNE 2VCPA 3BF3A 1JLFA 1CZAN 4CK3A 3OYHA 3OS0A 4DG1A 2G8IA 2P9SB 1KRPA 4JD2B 3PSFA 1B9FA 3U9DA 3CCVN 4DV4K 3PLAA 3R3LA 3LDQA 3MXJA 4TSXA 2PZSA 4LY7A 4IOAL 4JEPA 1NKEA 4JRQA 3C65A 3H1VX 4GV6A 4M3XA 3KD5E 2FF3B 4WFAL 1P90A 4CZEA 3WXKA 3OYNA 1NWKA 4NB4A 3BZCA 3A2FA 3QFUA 4MLHA 3ZSRA 2IVPA 2BE2A 3MWTA 5M1PA 3U9ZA 3FGUA 3NF9A 3I56N 1G99A 5AQKA 3SBTA 4FM0A 4I9LA 5CY4A 4M41A 3HO1A 4IOXA 4M45A 2HHTA 1HUXA 1HKBA 4LC9B 4EHTA 3E1YA 3TR8A 5HROA 3A5MC 2O8FA 4Q0BA 1BU6O 2WONA 4BDZA 2E6LA 4J8FA 4EFHA 4AF1A 5LMUK 2HHWA 3OS1A 2O8CB 4KH5A 4U67L 1NOYA 4JK7A 1L3UA 1HQEA 4BWMA 4Y1CA 1VQ7N 3SPZA 3W3DA 3HM8A 4EP5A 4KTQA 2Q2RA 5E26A 5JVHL 5FLXO 1TAQA 2QXFA 4JI4K 1QHTA 3K9JA 3T1HK 1Q18A 4BC5A 1D5AA 3O80A 3ENBA 5AQGA 2A5XA 3CI5A 3CJ1A 4CI6A 4OKJA 3V9WA 3DLBA 1BI4B 1ZBUA 5AQLA 4G1QA 3AVKA 2BUPA 3KK2A 2A1RA 1N6QA 3NGIA 4DFPA 3SMSA 5AZIA 3RWUA 4QS8A 2JWLA 5AQYA 5H1SQ 3SJHA 3J7ZO 1Q82O 2ZE2A 3F5TA 1K6YA 4JHDB 4LF4K 4FW2A 4F4KA 3DMJA 3NF6A 4RW9A 2Q97A 4CEZA 3HTVA 4CZFA 3O3GA 1QVFM 1BO5O 4CF9A 4AILC 3EKSA 4BRMA 4CEQA 3HVTA 1X3NA 1NK7A 2OA8A 3PSIA 4JI7K 3OYIA 4IFYA 3UKUA 2HF3A 4F9OA 3ITHA 4KFBA 3T19A 2HBMA 2IVNA 4YDUC 1Q8IA 1TL3A 1YIJN 4RTFD 1EWRA 2ASMA 3O3HA 3SUOA 4Z4IA 4DV1K 2V51B 3VQ6A 4DTRA 2NRXA 4DSIA 4CJ3A 2Z1IA 3LAKA 1RBRA 3RSEA 4ICLA 1WN7A 3C6UA 2HVIA 2XRIA 2VGNA 1JLGA 3AO4A 4EAHD 2JGUA 4O44A 3BZKA 4JYAK 2NUBA 4DS4A 1MWMA 2OTJN 4DR1K 1WLJA 2E1YA 4DTJA 3DI6A 1EP4A 3CCMN 2W6LA 2YHXA 3CERA 1SKWA 2YHYA 2X6SA 2XY6A 4M63C 3KK1A 3LWMA 1S3XA 2HBKA 4JK9A 1KSPA 1YVUA 1ZYQA 2HF4A 4BRKA 2NZTA 3TAPA 4A57A 3S3NA 4IDKA 2P9UA 1YAGA 1Z05A 4DFJA 1HYZA 2Q31A 3FFIA 1TGOA 5JLFA 4GNIA 4YOXA 1Z6RA 5BN8A 1KLMA 4BC4A 1EWQA 3E9PA 4C8LA 1OH5A 3SMPA 4DS5A 3OYKA 4KHPK 1QHAA 3U6FA 1C1BA 4KI4A 3LWLA 2OPQA 2ZM6K 3O4WA 1WSHA 3T7ZA 1RBVA 4FWMA 3FE1A 4AHUA 2KLAA 3RMCA 1C0FA 3PUFA 4BRDA 1RILA 2BDPA 3S9HA 4WFBL 3LANA 3OYJA 1HQUA 4BR9A 4DSEA 1N34K 4PY5A 1GLAG 2GUPA 3KKRA 5J2NA 3C7NB 4CEFA 3OYMA 3FZMA 4QOZB 3VQAA 5M1FA 2E4LA 1NU0A 4BRAA 4KB1A 1NJYA 4OPKA 4A2BA 4KTWA 4CERA 3QEIA 5M1OA 4A61A 4FJMA 3LP0A 5JS1A 3CCUN 3DOLA 5E84A 1V4SA 3DXMB 3SQ4A 1BIUA 3MN7A 3O08A 4ELVA 3FFKB 3QLHA 4QCLA 1NGFA 3BEXA 3VF6A 3M8QA 4YOVA 1NK5A 4FJJA 1WAJA 4JS4A 3VQ8A 3QB0A 2P9PB 1GLDG 4M7XA 3M1FA 4LF9K 4E19A 3CF5L 1WSFA 4DU1A 4H0TB 4GW6A 4L3QA 1LWFA 4DV3K 4FLYA 3JAMO 4KHUA 2OANA 3EEQA 4BRLA 3CC4N 4NXNK 1KTQA 2F9TA 3MEEA 4PL8A 3R1XA 1CZ9A 4CD1A 3FZFA 4DLGA 1LOTB 3OTOK 3DM2A 4K43A 4FXDA 1BIZA 3LP1A 3OBWA 3TI0A 1FKOA 4RW7A 2GWJA 2AJQA 1RDWX 1IG8A 3G25A 3O9QA 3OYEA 3PX4A 3LALA 5F2RA 5IT9O 4DQQA 3WEEA 1JKHA 4M3YA 3LM9A 4B3OA 3A8YA 1S9GA 5EX5A 3SK3A 1VSDA 3K5LA 5AJ3K 1VQ4N 2YX6A 2PYJA 1O13A 3Q7CA 3BP8A 4WCEL 1D9DA 1LCUA 3CETA 3K2PA 2Q0RA 3VQEA 4FK4A 2P9NA 1TVRA 3RR8A 1I3AA 4LF7K 1IKYA 3L2UA 1JCGA 1HLUA 2NRWA 2G8VA 2QA4N 3THVA 4DCHA 1NGJA 1GOBA 4CW7B 2P5GA 1JXEA 1YUWA 2DFEA 3DYAA 5GINA 4LF8K 3HSCA 3DLRA 5AQNA 4IKFA 1ASVA 5KGXA 4Z4EA 1KVCA 3E9LA 1K8KA 1ZC6A 4FZYA 1NKCA 1YVNA 1D9FA 4FJHA 1YJNN 4Z4HA 1UA0A 3U3YA 2HOEA 4MFBA 2FF6A 1FW6A 4CHOA 3P5JA 2QEXN 1NM1A 2YCHA 3LP2A 3LM2A 4RW6A 4WF9L 3CYMA 1REVA 4FWNA 2UUBK 3DLHA 3QDKA 4CZJA 3LDSA 3VA3A 3VF4A 1BGXT 3ZSZA 5I9EB 3BGRA 4FJGA 4B3RK 5IWAK 4H0PA 4HHTA 4FLTA 1K9MO 3AGRA 4FJIA 5AQFA 1NGGA 1OH7A 3PX0A 5M1NA 4KHYA 1HPZA 2UU9K 3ZX3A 3NF8A 1NK4A 5F0XA 1BCMA 4M3ZA 1SL2A 2ATQA 3A5NC 1RT2A 3CM5A 4E7JA 1NG9A 4GVMA 1BOTO 4CECA 2VQFK 4OLAA 4WFNL 4AQYK 1QSSA 3D2EB 1HJOA 2NNWA 1ZXOA 1Q9YA 3BF1A 4FPAA 1J53A 5AQVA 1TAUA 4FWSA 3AAQA 3H45C 3O9TA 4DQPA 1FJGK 3B6PA 4KBOA 3RTVA 5KPRA 3T3FA 5EOYA 1Z26A 3ZETA 4E1JA 3RVCA 3KLFA 2GX9A 3A5LC 3RMAA 2CGLA 1OKJA 1TYQB 4CHQA 3SNNA 3AVMA 5I42A 5ELZA 2P1JA 4JKHA 1S1WA 5AQRA 1JLCA 3A5OC 3TAQA 1HRHA 2NRHA 3ZT3A 1GOCA 1HKGA 5EVZA 3HXMA 4KRFA 1XC3A 4CIFA 3DJCA 4CJLA 2VQEK 4KHQA 4E7LA 3PV8A 1LWCA 1HPMA 3ATVA 5I3UA 4FVMA 1LAWA 4CFDA 5CR4A 4BG8A 3IS9A 5AZJB 4BRCA 1ATSA 1SL0A 2QWNA 3I0SA 4EZ9A 1HNZK 4H5TA 4MDBA 1WSGA 4KPYA 1VQ9N 1ITGA 1CXQA 4N5SA 3V9UA 1I39A 1B92A 3MX2A 4FJLA 3OA9A 4CJ7A 4JN4A 4OO1J 1D4XA 2DFFA 2DPNA 4R79A 2P51A 2RPIA 4JKEA 5CZ2A 4X66K 3I8BA 1NGCA 3QNOA 2O4IA 1WBBA 3R9PA 3HK2A 1NMDA 1YTAA 2YKNA 1T8EA 2P9SA 1KVBA 4JD2A 3OBYA 1KD1O 2X78A 4DTUA 4F2RA 4C23A 3KK3A 4CJ5A 3VA0A 2AP1A 1NGDA 1TKXA 3V1RA 4E0DA 4FW1A 2UXDK 4FSVA 1BUPA 2EHGA 2E2PA 2XO7A 4CHZA 3WT0A 5C15A 1W97L 4FJNA 2IS3A 1QQMA 2WBNA 4CJEA 3H1QA 1C0GA 2PBDA 2RKIA 3AAPA 3MEDA 3OJSA 1DEJA 3R6MA 5AFUH 3HRGA 5FRNA 3KZBA 1QSLA 1QTMA 3UE5A 1RCHA 3NH2A 3QERA 4KB0A 1W9HA 4B9MA 4AM6A 1NLVA 1ZBIA 3K57A 4H5VA 2HHUA 5TKYA 3VERA 3QIOA 3M8SA 1RBUA 2QXLA 1U48A 2D4WA 5AQSA 4FO0A 3GOIA 3VQBA 4FZZA 2BH1A 3OVNA 3THXB 2O8CA 3RMDA 4BVPA 2HNZA 5AQQA 4C8NA 5ADXH 3B6OA 4DTNA 4FLZA 1RT3A 1XI1A 5KPZA 1L3TA 4EP4A 3BY5A 1BQMA 4JI2K 3DRSA 5AFUA 3SBGA 2D0OA 3NF7A 1RT1A 3MDQA 3IAYA 3I8DA 3THYA 1S1TA 2V7ZA 4DR6K 2HHHK 1BI4A 1RDDA 3FZLA 1KVAA 3TSQA 1J5OA 1R0AA 1Q86O 3NFAA 1KXPA 2IIRA 3ZSOA 5DM6L 5J2PA 4LFCK 4B3MK 3S3OA 2IVOA 3MMVA 4CZMA 5E41A 4IOCL 1SKRA 3P1GA 2F9WA 4O0JA 4JHDA 1VQMN 3GDQA 3TWHA 4BROA 3K9KA 1BCOA 4FM2A 3NGYA 3VEWA 4JKCA 1OH8A 5BREA 2WC9A 1M90O 2UUAK 2W41A 1LWEA 5ADXA 4H0OA 3CCJN 4PQUA 3SAGA 1SUQA 1T7PA 4ZTFA 4UQGA 4H03B 3DAWA 2D0AA 3MCAB 3O8MA 3PIOL 2F7TA 1LV5A 3L0QA 2V52B 4B1VA 1HNXK 3G71N 1FXXA 1RFQA 1TKTA 3OW2M 4PWDA 4BG9A 1X9JA 4Z94A 4Q5VA 4DUYK 2ZQBA 1EETA 5J2QA 1OVYA 5BPLA 4DSFA 3THWA 3VEYA 3L2RA 3EE8A 4E89A 3VQ7A 4CIGA 3TTCA 1YJWN 5M1QA 1KAYA 1IBMK 3NVKA 1NJZA 4H4OA 2AA4A 4IDHA 3CCRN 4DU4A 1XC9A 4BR7A 2KZMA 4CEOA 1U2VB 3TSPA 1Q81O 2EWSA 5AQHA 1VRUA 5AQIA 4BRIA 3QEPA 4IEIA 1U49A 4BRHA 3VTHA 2H3GX 3ZEUA 2UYTA 3LDOA 3KJVA 3F2KA 2YNGA 4HTUA 3ISNC 3IG1A 3AARA 4FWPA 2PYLA 3HJFA 2ETJA 1GOAA 1XUPO 4DSKA 2O8FB 1VSMA 1HKCA 2OYQA 3OY9A 2KKZA 3CMAN 3DRRA 4N41A 3FLCO 2WTUA 2VG7A 1N36K 3OYBA 4HUGA 4YOTA 1IBLK 2O8DB 2HB5A 3AVCA 2RHKA 3AVAA 3AVJA 4YOYA 4DUZK 4PA1A 2O8BA 2CH5A 3DLGA 3QIPA 3L2QA 5J2MA 1TK8A 5AQJA 2BGGA 3IKMA 4X65K 1W2BM 2ZJQL 1NJWA 3QEWA 4A2AA 2KZZA 2FSNA 4DQRA 5BRDA 4IJNA 4Z0UA 1TV6A 3ULEB 1S22A 4A5AA 3CQ8A 4C8MA 4CGHA 3LPUA 4B1ZA 3AY9A 4CHPA 4CFCA 5AZIB 1X9WA 3ZSVA 3SAFA 4DMNA 3EL2A 5CYMA 1EQYA 3AVFA 2OZMA 3WNEA 1VSLA 4GKKK 1L3SA 4OPAA 3QNNA 3GL1A 3HT3A 3WXMB 1RTJA 3EE9A 4FJ5A 1L3VA 3SQ1A 5C2DA 4BRNA 4KTZA 2W42A 3VQQA 1RT5A 5JVGL 1T05A 3SV3A 3DLEA 3DXMA 3K5NA 3LP3A 4BR5A 2XY7A 3VQPA 3ZX0A 1FKPA 1KAXA 1MU2A 3DXKB 1HMVA 3P83D 2ZJRL 3HOTA 1JLEA 2HHQA 4HWIA 1RBSA 4CK2A 2IOCA 4K0KK 3AA5X 3VQ5A 5LY3A 1TL1A 2LSNA 2ZGYA 3ULDA 1JXBA 4N56A 3CFOA 1X9SA 1NK0A 3AVBA 3RSEB 1M1KO 4OKEA 1SV5A 4W5QA 4W5OA 3VGMA 2CGKA 3AO3A 1C0TA 4H4MA 3MAQA 2YJEA 1N5YA 2QWPA 1A5VA 5DK5A 4PL7A 1Q9XA 4CJKA 4CF1A 1IBKK 3S41A 1CXUA 3ZSQA 4H0VB 1OVQA 4KO0A 1RGIA 1DLOA 3AA4A 1BDGA 5B8HA 4I7FA 1QVGM 4Y0WA 2P9UB 4CEBA 2BTFA 4H5RA 3FZHA 3HSTB 5FRMA 2RF2A 2WFBA 3MCPA 1U4BA 3WNHA 1ZBFA 4IJAA 2HBJA 2FBYA 3FR0A 1BA0A 4YHHK 3ZYYX 1CZBA 2G8UA 1WSJA 4DV7K 3AO1A 3OYLA 3K0SA 1Y97A 2X74A 3S3MA 1A5WA 1HNWK 1VAZA 2P9KB 5C42A 4E1MA 3ALYA 1S6PA 3DWLA 3KIOA 4IFVA 5KQ8A 4IWVA 2QTDA 3TAFA 3M3ZA 4W5NA 1WB9A 4K25A 3V9ZA 3OYFA 3V1OA 4IG0A 1T6DA 1ESVA 3H3NO 3VEXA 3G4SN 5D3GA 3WUHA 3SUNA 4FYDA 3K58A 1WNSA 1YJ9N 3SV4A 1C0UA 3CC7N 2P9LA 1JLQA 4ILJA 3IRXA 2E2OA 1S9EA 2BANA 1BQNA 3OYGA 3JYTA 3CJ7A 4W5RA 2KFNA 3CM6A 2UUCK 3ATUA 1VSJA 2GELA 4H5NA 4CZLA 3CMEN 4Y1DA 5A2QO 1UAXA 4BREA 4JS5A 1C6VA 2E20A 4FWKA 3TAGA 3L4IA 1VQPN 4FL9A 4DWIA 1VQ6N 1WOQA 3ID8A 2F96A 4CD3A 2IDOA 5BPMA 4FLVA 3L2VA 4HUEA 1JL1A 4C8KA 5FPEA 3VMFB 1VSKA 4IFEA 2A41A 5BR9A 1BA1A 3UB5A 2GUIA 4BC2A 1KLNA 3O6WA 2DTUA 3F73A 3UIQA 1J54A 4FVUA 3JS6A 3VPZA 4WQ4A 2DFHA 2OPRA 3VETA 4DR4K 3ZSWA 4H5WA 1XNQK 4JI8K 3DOKA 1OH6A 1MDUB 4K8XA 1IG9A 3CFRA 4OVLA 3KLHA 4KV8A 5CZ1A 1S72N 1VSHA 1NGAA 1X9MA 3HPGA 2YNIA 4WQ5A 2JWKA 3WEEB 4FLXA 1Y64A 1SS6A 3O9UA 1XWLA 5JLHA 1TYQA 3D45A 3ZT0A 3KVGA 4DR5K 1R59O 2KW4A 3TAEA 1O1WA 3A0IX 4ISFA 1VQ8N 4XEIA 5KRSA 4QS9A 3NH1A 5AQZA 1S5JA 5LL6Z 4DTOA 3WQTA 4ISEA 1KQSM 4JKBA 4NCBA 4M3RA 1KC8O 3IUCA 3CC2N 4GKJK 3L4QA 1IV0A 4CGDA 4CHYA 3NMUA 5HRRA 5AZJA 2E6MA 5FPNA 1W7AA 2EX3A 1HR0K 2FBXA 3L2WA 3Q7BA 3AGKA 4KHSA 1ZBLA 2FBTA 3N4QA 3UKRA 2W6KA 5KGWA 3LDLA 5KQDA 4KHNA 4DU3A 1C1CA 4YFUA 1K8KB 1NK6A 2QM1A 4HUFA 4CZKA 4F8RA 3L6QA 4NLCA 1J6ZA 5HLFA 3HP9A 3NCIA 2Z1HA 4BRQA 1U6ZA 1DKGD 3D7EO 4PHTX 1A5XA 4GVEA 2QWMA 3MEGA 4EHUA 5M1KA 2P5OA 3VESA 3D2FB 5DM7L 4OLBA 1VQNN 5EY4A 4I9QA 1GLJO 3WNFA 2D1KA 3CQXA 5CE3A 3VQ4A 4A62A 4NXMK 2YKMA 3V6DA 1UOCA 1RDCA 2G8WA 1XMQK 3OYCA 2P9IB 1GLFO 4H0XB 4BRFA 5FPDA 1VQON 3LDPA 3L3UA 1NGBA 4DV6K 3H6EA 3VEZA 1E4GT 5LMNK 3JSMA 3QMLA 4QAGA 1JL2A 3QESA 4BGAA 2ZD1A 1V4TA 4R5PA 2Q36A 1HYSA 5FPMA 2A42A 3EYZA 4JKGB 4DF8A 2YHAA 3PX6A 2RE2A 1IJJA 3V81A 2QWQA 3SLCA 5GIOA 1VQKN 5EU7A 1HJRA 3OYDA 4CJPA 2KHOA 3AO2A 5FDLA 4XH4A 3KTQA 4RW8A 1VSIA 4RWTA 4DTMA 2D0PA 3ZETB 1DTQA 4MO5A 4CEAA 1BISA 3AA2A 4KAZA 3C6HA 2YJFA 2I7PA 1XQSC 3FZKA 4OPHA 4ILGB 4EZ6A 4ZTJA 1VQLN 2QK9A 4I6MB 2KFZA 2YV0X 2ASPA 3ZSYA 2UXCK 2ZGZA 1TKZA 3E9OA 3WXLA 3WQUA 1EKEA 4JI1K 3ZCMA 3G10A 2Q0UA 4ELTA 1J9AA 4AHTA 3DRPA 2NRTA 1TUUA 2FBVA 5BR8K 4V19S 1QQOA 3ENOA 3F9MA 3OHRA 3VGKA 5BN9A 3G6EN 4J2EA 4FJ9A 1VSFA 1NJXA 3C0BA 3AVNA 4JV5K 3HVRA 3J7YP 4O5FA 3EZ5A 2I5JA 1WUAA 2HSTA 4PKHA 4RCHA 4CFBA 5JMVA 3MECA 4FCYA 4C1NK 1RT4A 1IKVA 4CF8A 2PAVA 3MWPA 4XH1A 4DKWA 3ID6A 1HNIA 4Z4FA 2F4VK 1DTTA 5BPNA 1E4FT 3BUZB 3CJBA 3U8XA 1RT7A 4AM7A 4IG3A 3D0PA 3PO4A 3KLGA 4DTXA 2WUSA 4ZHRA 3EZWA 1QS4A 5T7BA 4B9SA 1YF5L 1IKXA 2D5RA 2VG6A 3VQ9A 5C24A 4JI3K 4BE2A 1LW0A 3CD6N 3KK7A 5DMRA 4LSLA 4O8UA 2FXUA 4YORA 4K41A 4BC3A 4FOEA 3MN6A 4FK2A 3SPYA 4CJFA 2NRZA 3TARA 3TU5A 3HP6A 3PO5A 5AQTA 3G0ZA 5C10A 4LF5K 1U2VA 3NVMA 3HI0A 2Y1IA 4H0YB 2B6AA 4LF6K 3V1QA 1XHZA 3SUPA 4X64K 4IBNA 3K5OA 1JCEA 1F21A 1JLBA 2J4RA 3KKSA 3H08A 4J2DA 5HP1A 3NGZA 1RTIA 2O8EB 1VK0A 4BR0A 4O4GA 4J2BA 2W40A 5JS2A 4CIEA 1EXQA 4OPJA 1WBDA 1VHXA 1FK9A 3CPWM 2OTLN 4WYBA 4RG8A 1QZ6A 2O8DA 4E3SA 2B5JA 2GWKA 1U47A 4CBWA 1H1VA 4FOIA 1HNVA 4FWQA 4FJXA 5LJWA 3KD1E 4DF4A 4IXCA 1N32K 4FZXC 4OGCA 4XIUA 3P4IA 4FLUA 1GLEG 3CCLN 4JI5K 4IO8A 4NYFA 4LD0A 4GMJB 1VQ5N 2XY8A 3O9RA 1T03A 4RW4A 1NKBA 1JCFA 4JNEA 3VQCA 4BY9C 2G8KA 3THYB 1SKSA 2FC0A 3ULEA 4X62K 2YHWA 1TK5A 4C1NI 3WNGA 1LAVA 2GTDA 1RDUA 4JRPA 2CH6A 3WXJA 4JK8A 3TANA 2XHBA 3QFPA 2FSJA 1L5UA 1UA1A 4B3SK 4DTPA 2QWOA 1RBTA 3TSUA 3MXMA 1KFDA 4Z4CA 3MX5A 3CQYA 4CJQA 2Q1NA 4B8CA 4B1YB 3AVGA 4BGBA 3L3VA 3NHGA 4JLHA 5K14A 3LDNA 1ASWA 1NJIO 3SI6A 1HYVA 2KQ2A 4BE1A 3U3GA 4CHNA 4CEDA 4CBXA 1B9DA 4B9VA 1SL1A 3D6RA 3DXKA 4E1NA 4CK1A 3EY1A 3AO5A 3AV9A 3MN9A 4IEEA 4OJRA 2ITMA 4WE1A 4DFKA 4K42A 4BR4A 4CE9A 5GAHP 4YDUA 3THWB 2IAJA 2QWLA 1DT9A 4CF2A 1U04A 2GBZA 4UY8O 5AR0A 1Z25A 3LL3A 3VGLA 1T3VA 1EO1A 4M3WA 4DQIA 4EIAA 2DY4A 3I0RA 1IO2A 4CGGA 1ZBSA 4BQZA 2OCEA 3C7NA 1GLCG 2HW3A 3CIPA 4IO9L 4DV5K 4PKIA 3ZEUB 3O3FA 2VWKA 3C6TA 4GV9A 4PKGA 2GEMA 3OYAA 2ASOA 3CJAA 4QS7A 1ILYA 3CHWA 4CGIA 3UKUB 1NGIA 4ILHA 3MXIA 2HHSA 5C0YA 2F8SA 1RNHA 3RRGA 5MLCQ 3KLEA 4CJUA 3NH0A 4YNQA 1YTUA 1UWBA 2P9PA 1X1PA 5AQUA 1X3MA 2X6NA 5KRTA 3VOVA 4KREA 3P31A 4BDPA 4O5BA 3GG4A 3KHYA 4ISGA 1RDAA 1TK0A 1QSYA 4CJ4A 2O8BB 2P9KA 3ASMA 1K8AO 4YY3K 2HMPA 4CZHA 4BR2A 3CJCA 3V9SA 4DSLA 1S6QA 4BWJA 3RR7A 1MA9B 5C12A 1D8YA 1EX4A 4DFMA 2GV9A 4KHWA 3DLLL 3O1WA 4DHYA 4I2QA 4NLBA 3ZLJA 4B9QA 3NAEA 4KH6A 2JLEA 1RTHA 4JAXA 4F3TA 2E8AA 2OPSA 3QBXA 3PIPL 1SQKA 1VRTA 2IC3A 3W0LA 5AQOA 1ATRA 2R7YA 5HRNA 3MN5A 4L8RB 1T6CA 3HBTA 2VYPA 2FLOA 3TAMA 4PUOA 3P39A 1BG3A 2YNFA 4FWRA 3L8BA 3V4IA 3AVLA 1C0MA 1TUYA 2A1SA 1RDBA 3M5RA 4CJVA 3SYZA 3T1YK 3KWIA 3SQ0A 3HPOA 1QE1A 4B08A 4O55A 1NK9A 4BDYA 1GLBG 2A3ZA 4HCCA 1QQNA 2HHXA 4AHVA 4B1UB 4B3TK 2ZF5O 1IH7A 3RMBA 4E7IA 5JICA 1LW2A 3F9KA 1NGEA 3ZX2A 4LH4A 2G8HA 3K59A 2E1ZA 4GY2B 4OX9K 4BQLA 5F1XA 3HM9A 2VWJA 3T1AA 3CXCM 4FJ8A 5GADP 5KI6A 4DV0K 2HVHA 5C2FA 3HOSA 5AQXA 3SCXA 2FSKA 3CJ9A 3WXIA 2OPPA 3O4NA 2UXBK 4G9ZA 3AVHA 1C1AA 3SUQA 3O4QA 2HHVA 2B4JA 4LFAK 2Z1GA
chains in the Genus database with same CATH topology
1J5OA 1R0AA 2XY6A 3NFAA 5KTQA 2YKMA 4AHSA 3KK1A 3ZSOA 3LWMA 3V6DA 1UOCA 5J2PA 1RDCA 2G8WA 4LSNA 3OYCA 1KSPA 1YVUA 4CJSA 1ZYQA 3S3OA 4DLEA 4CF0A 4N47A 3TAPA 3S3NA 5FROA 5E41A 1SKRA 4IDKA 5CYQA 3P1GA 4O0JA 3K5MA 3BDPA 3L3UA 4DFJA 1HYZA 3FFIA 4CFAA 2PY5A 4H8KA 1TKDA 1ZBHA 1TGOA 3TWHA 3SJJA 1BCOA 4FM2A 3NGYA 3JSMA 1CLQA 4QAGA 1JL2A 4FM1A 1S1XA 3HL8A 3QESA 2ZD1A 1LWEA 4R5PA 1XHXA 4PQUA 1T7PA 1SUQA 1KLMA 4ZTFA 4OKKA 4UQGA 4C8LA 1HYSA 3EYZA 4DF8A 3AA3A 2D0AA 4FLWA 4DS5A 3OYKA 2YHAA 1LV5A 3U6FA 4M42A 1C1BA 3PX6A 4KI4A 3LWLA 2OPQA 3E01A 1FXXA 3V81A 1TKTA 4I2PA 4PWDA 1WSHA 5EU7A 1HJRA 1RBVA 3OYDA 4CJPA 4LH5A 2YHBA 3ZT1A 4Q5VA 2ZQBA 1EETA 3AO2A 5J2QA 5FDLA 4DSFA 4AHUA 2HNYA 4CJRA 4KI6A 1IKWA 1S1VA 3L2RA 2ITGA 3RMCA 3PUFA 3KTQA 4RW8A 4E89A 1VSIA 3VQ7A 4DTMA 1RILA 1DTQA 4CIGA 2BDPA 3S9HA 4W5TA 4AHRA 4CEAA 1BISA 3LANA 4CJTA 3OYJA 2XY5A 1NJZA 1HQUA 3AA2A 4KAZA 4DSEA 4PY5A 4H4OA 3KKRA 4DU4A 5J2NA 1XC9A 4CEFA 2KZMA 3OYMA 4EZ6A 4ZTJA 4CEOA 4QOZB 4FJKA 2QK9A 2D0CA 3VQAA 1VRUA 2E4LA 3VQDA 4B9NA 2KFZA 3AVIA 2YV0X 4KB1A 1NJYA 5C25A 3QEPA 3ZSYA 4AH9A 4OPKA 1U49A 3HYFA 1TKZA 4KTWA 4CERA 3KJVA 4BE0A 3QEIA 2YNGA 2RN2A 4HTUA 4FJMA 1EKEA 3LP0A 3ZCMA 3G10A 3ISNC 5HRSA 4J2AA 5JS1A 4B9TA 3DOLA 1J9AA 4AHTA 4ELTA 3DRPA 3SQ4A 2FBVA 3IG1A 4E7HA 2F8TA 1BIUA 3QEXA 4HCBA 4FJ9A 4J2EA 1JLAA 4ELVA 1VSFA 2PYLA 1NJXA 3HJFA 2ETJA 3AVNA 3QLHA 4QCLA 3HVRA 1GOAA 3M8QA 3EZ5A 1BHLA 1NK5A 5HBMA 4DSKA 4FJJA 2I5JA 1VSMA 4CFBA 1WAJA 1WSEA 3MECA 4JS4A 4ELUA 3VQ8A 2OYQA 2QKBA 3SZ2A 3OY9A 4Z4GA 4FCYA 3DRRA 4N41A 4DSJA 2VG7A 1RT4A 1IKVA 4CF8A 4E19A 3OYBA 4HUGA 4CJWA 2HB5A 3AVCA 1BL3A 1WSFA 1HNIA 4Z4FA 4DU1A 3AVAA 3AVJA 2G8FA 1DTTA 4GW6A 3TABA 1LWFA 4PA1A 3NE6A 4FLYA 4KHUA 4HVJA 3DLGA 3VN5A 1RT7A 3QIPA 3L2QA 5J2MA 1TK8A 4IG3A 2BGGA 3D0PA 1KTQA 3MEEA 3NDKA 3PO4A 1VSEA 3NBPA 1CZ9A 1NJWA 4F3OA 4DLGA 3QEWA 2KZZA 2HNDA 3KLGA 4DTXA 4ZHRA 3DLKA 1QS4A 4DQRA 5T7BA 4B9SA 3DM2A 4Z0UA 1TV6A 3LAMA 1IKXA 1BIZA 2D5RA 2VG6A 4C8MA 3VQ9A 5C24A 4CGHA 3LP1A 5J1EA 3LPUA 3CQ8A 4NCAA 3TI0A 1FKOA 4CHPA 4BE2A 2HMIA 1LW0A 4RW7A 2O4GA 4CFCA 2AJQA 5DMRA 4LSLA 1X9WA 3ZSVA 3LZIA 4DMNA 3OYEA 3PX4A 3LALA 3ZSXA 3OJUA 4NCGA 4DQQA 2QKKA 4FK2A 1WSIA 4BACA 5CYMA 3M8RA 3SPYA 3AVFA 2OZMA 1JKHA 4CJFA 5HRPA 4M3YA 4B3OA 4M3TA 3WNEA 1VSLA 3HP6A 3TARA 4B9UA 1S9GA 3QNNA 1L3SA 3PO5A 1VSDA 3G0ZA 3K5LA 1YT3A 5SZTA 3HT3A 3QINA 2Y1IA 1RTJA 4F2SA 2B6AA 3V1QA 2PYJA 1L3VA 4FJ5A 3SQ1A 1XHZA 3SUPA 4KTZA 4IBNA 2YNHA 2W42A 3K5OA 3VQQA 1RT5A 1F21A 1JLBA 2D0BA 3KKSA 1D9DA 2Q3SA 4CCHA 3QEVA 3H08A 3LZJA 1T05A 4J2DA 3SV3A 4FJ7A 3DLEA 3K2PA 1U45A 3VQEA 4FK4A 5HP1A 4NYNA 4B8AB 3K5NA 3NGZA 1RTIA 1TVRA 3LP3A 1NOZA 1VK0A 3LPTA 4MQ3A 1I3AA 4CGJA 3V9XA 3RRHA 3RR8A 2XY7A 1IKYA 3VQPA 3ZT2A 1FKPA 4O4GA 1MU2A 3L2UA 4FK0A 1HMVA 4J2BA 3P83D 4CIEA 5JS2A 4OPJA 1EXQA 1JLEA 3QETA 4DTSA 2KTQA 4K8ZA 2G8VA 2HHQA 3THVA 1RBSA 1FK9A 4CGFA 2IOCA 4CK2A 1S1UA 3AA5X 4RG8A 1GOBA 3VQ5A 1TL1A 1JXEA 1KCFA 2LSNA 2DFEA 3DYAA 3ULDA 2P5GA 1JXBA 4N56A 3CFOA 1X9SA 4E3SA 1WAFA 4N76A 1NK0A 2B5JA 4W5NA 1U47A 1QQCA 3AVBA 3DLRA 3QO9A 1ASVA 5KGXA 4IKFA 4Z4EA 1HNVA 1KVCA 2IGIA 4FJXA 3KD1E 4DF4A 4FZYA 4OKEA 4B9LA 1NKCA 1SV5A 4FZXC 4OGCA 4W5QA 4W5OA 1D9FA 4XIUA 4FJHA 4FLUA 3CG7A 4CEEA 4NYFA 4Z4HA 4LD0A 3AO3A 1C0TA 4H4MA 4GMJB 3MAQA 3U3YA 1UA0A 1KFSA 2XY8A 4MFBA 1T03A 4RW4A 1NKBA 1N5YA 3VQCA 1NK8A 1A5VA 4CHOA 5DK5A 2G8KA 1ASUA 3P5JA 1SKSA 1Q9XA 2FC0A 4CJKA 4CF1A 3LP2A 4RW6A 5SWMA 3SQ2A 1TK5A 2VG5A 3CYMA 1CXUA 1LAVA 1REVA 3WNGA 3ZSQA 2Y1JA 4JRPA 4C8OA 2WOMA 4ID5A 1G15A 3TANA 4E7KA 3DLHA 2XHBA 4KO0A 3LDSA 3VA3A 1W0HA 1L5UA 4DQSA 1DLOA 1BGXT 3AA4A 3ZSZA 4CESA 1UA1A 4I7FA 4DTPA 3BGRA 4FJGA 2OZSA 1RBTA 4ID1A 4AHCA 4CEBA 5FRMA 3HSTB 3MXMA 1KFDA 4OGEA 4Z4CA 4HHTA 3OS2A 2RF2A 3PY8A 4CJQA 4B8CA 1U4BA 3WNHA 4FLTA 3AVGA 1ZBFA 3L3VA 1RT6A 2FBYA 4FJIA 3M8PA 2Z1JA 3C94A 3NHGA 1CZBA 4JLHA 1WSJA 3ZT4A 3PX0A 2G8UA 4KHYA 3AO1A 5K14A 3OYLA 1HPZA 1Y97A 1ASWA 2X74A 3NF8A 3SI6A 1NK4A 1HYVA 3C95A 1A5WA 2KQ2A 3KLIA 3S3MA 4M3UA 5C42A 4E1MA 4BE1A 1BCMA 3CFPA 4M3ZA 3ALYA 3U3GA 1S6PA 4CEDA 4CHNA 1SL2A 1RTDA 2ATQA 3KIOA 4KKOA 1B9DA 4B9VA 4IFVA 1RT2A 3CM5A 4E7JA 1SL1A 4O0IA 4GVMA 3HPHA 4E1NA 4CK1A 4CECA 3TAFA 1JLFA 4OLAA 3EY1A 3AO5A 4CK3A 3AV9A 3OYHA 3OS0A 4OJRA 4DG1A 3V9ZA 1QSSA 2G8IA 1Q9YA 4DFKA 4WE1A 3OYFA 1KRPA 3V1OA 4IG0A 4CE9A 1J53A 1TAUA 1B9FA 5D3GA 4DQPA 3SUNA 2IAJA 4FYDA 3B6PA 3K58A 1WNSA 3RTVA 3MXJA 4TSXA 2PZSA 3T3FA 4LY7A 1U04A 4CF2A 3SV4A 1NKEA 1Z26A 2GBZA 4JRQA 1C0UA 3KLFA 1Z25A 4M3XA 1JLQA 3IRXA 4M3WA 3RMAA 4DQIA 1S9EA 2DY4A 3I0RA 2BANA 3KD5E 4CHQA 3SNNA 1IO2A 1BQNA 3AVMA 4CGGA 2P1JA 3OYGA 1S1WA 5I42A 3JYTA 1JLCA 2HW3A 3TAQA 1HRHA 3OYNA 3ZT3A 4W5RA 2KFNA 3CM6A 1GOCA 3A2FA 3O3FA 3HXMA 4KRFA 3ZSRA 2VWKA 3C6TA 2BE2A 1VSJA 4CIFA 4CJLA 3OYAA 4KHQA 4Y1DA 1UAXA 3NF9A 4JS5A 4E7LA 4CGIA 3PV8A 1C6VA 1LWCA 4FM0A 4I9LA 5CY4A 4M41A 3TAGA 3HO1A 4M45A 4FVMA 1LAWA 5I3UA 3MXIA 4DWIA 2HHTA 2HHSA 4CFDA 2F8SA 1RNHA 3TR8A 5HROA 3IS9A 3RRGA 2F96A 3KLEA 1SL0A 2IDOA 4EZ9A 3I0SA 4Q0BA 4CJUA 3NH0A 3L2VA 4HUEA 4FLVA 2WONA 4YNQA 4BDZA 1JL1A 1YTUA 1WSGA 1UWBA 2E6LA 1X1PA 4C8KA 2X6NA 4KPYA 5KRTA 1ITGA 1VSKA 4KREA 2HHWA 1CXQA 4N5SA 3OS1A 2GUIA 4O5BA 3V9UA 1KLNA 4BDPA 1B92A 1I39A 1NOYA 1L3UA 1RDAA 1HQEA 4BWMA 4Y1CA 1TK0A 1QSYA 2DTUA 3F73A 4CJ4A 3UIQA 4FJLA 3SPZA 1J54A 3ASMA 4EP5A 4KTQA 2DFFA 2DFHA 2P51A 2RPIA 5CZ2A 2OPRA 1TAQA 2QXFA 3QNOA 3ZSWA 1QHTA 3V9SA 2O4IA 4DSLA 1S6QA 3DOKA 4BWJA 3RR7A 1D8YA 3HK2A 1D5AA 1YTAA 2YKNA 1T8EA 4K8XA 1EX4A 4DFMA 2GV9A 1KVBA 4OKJA 3V9WA 1IG9A 4KHWA 2X78A 3CFRA 4OVLA 4DTUA 3KLHA 4I2QA 3DLBA 1BI4B 4KV8A 5CZ1A 4F2RA 1ZBUA 4G1QA 3NAEA 1VSHA 3AVKA 3KK2A 3KK3A 2JLEA 3HPGA 1RTHA 2YNIA 3NGIA 4DFPA 2A1RA 1X9MA 1N6QA 4CJ5A 3VA0A 4F3TA 3RWUA 2OPSA 1TKXA 3V1RA 4E0DA 4FLXA 4FW1A 1VRTA 2IC3A 2ZE2A 1XWLA 2R7YA 1K6YA 2EHGA 3D45A 3ZT0A 4FW2A 5HRNA 2XO7A 4F4KA 3DMJA 4CHZA 4L8RB 3NF6A 4FJNA 2IS3A 4RW9A 3TAMA 2KW4A 4PUOA 4CEZA 1O1WA 4CJEA 3TAEA 3O3GA 3L8BA 2YNFA 3V4IA 2RKIA 3AVLA 1C0MA 5KRSA 3NH1A 4CF9A 3MEDA 3OJSA 4AILC 1S5JA 2A1SA 4CEQA 4DTOA 1RDBA 5FRNA 1QSLA 3HVTA 1QTMA 4CJVA 1RCHA 3SYZA 1NK7A 3NH2A 3QERA 2OA8A 3SQ0A 4KB0A 3HPOA 1QE1A 1W9HA 4O55A 4B08A 4NCBA 4M3RA 1NK9A 4B9MA 3OYIA 4IFYA 3K57A 4BDYA 1ZBIA 2HHUA 4HCCA 3QIOA 4CGDA 4CHYA 3M8SA 4FXDA 5HRRA 2HHXA 4AHVA 1RBUA 1U48A 3ITHA 4KFBA 3T19A 1IH7A 3RMBA 2E6MA 1Q8IA 4E7IA 2EX3A 1TL3A 2FBXA 3L2WA 4KHSA 1ZBLA 2FBTA 3O3HA 1LW2A 3F9KA 3SUOA 4Z4IA 3VQBA 4FZZA 3VQ6A 5KGWA 4DTRA 3OVNA 4KHNA 4LH4A 3RMDA 4DSIA 4DU3A 1C1CA 4CJ3A 2HNZA 2Z1IA 4YFUA 3K59A 2G8HA 3LAKA 1NK6A 4HUFA 1RBRA 4F8RA 4C8NA 4ICLA 1WN7A 3B6OA 3C6UA 3HM9A 2VWJA 4FLZA 4DTNA 3T1AA 2HVIA 5HLFA 4FJ8A 3HP9A 5KI6A 2HVHA 3NCIA 2XRIA 2Z1HA 1RT3A 1XI1A 1JLGA 1L3TA 3AO4A 3SCXA 2JGUA 4EP4A 4O44A 1A5XA 1BQMA 3DRSA 3MEGA 2OPPA 2NUBA 3NF7A 1RT1A 3O4NA 4DS4A 2P5OA 3AVHA 1C1AA 4OLBA 3IAYA 3I8DA 3SUQA 4I9QA 1S1TA 1WLJA 3O4QA 3WNFA 2HHVA 1BI4A 1RDDA 3DI6A 4DTJA 2B4JA 3VQ4A 1EP4A 1SKWA 2X6SA 1KVAA 2Z1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5O A;  1R0A A;  2XY6 A;  3NFA A;  5KTQ A;  2YKM A;  4AHS A;  3KK1 A;  3ZSO A;  3LWM A;  3V6D A;  1UOC A;  5J2P A;  1RDC A;  2G8W A;  4LSN A;  3OYC A;  1KSP A;  1YVU A;  4CJS A;  1ZYQ A;  3S3O A;  4DLE A;  4CF0 A;  4N47 A;  3TAP A;  3S3N A;  5FRO A;  5E41 A;  1SKR A;  4IDK A;  5CYQ A;  3P1G A;  4O0J A;  3K5M A;  3BDP A;  3L3U A;  4DFJ A;  1HYZ A;  3FFI A;  4CFA A;  2PY5 A;  4H8K A;  1TKD A;  1ZBH A;  1TGO A;  3TWH A;  3SJJ A;  1BCO A;  4FM2 A;  3NGY A;  3JSM A;  1CLQ A;  4QAG A;  1JL2 A;  4FM1 A;  1S1X A;  3HL8 A;  3QES A;  2ZD1 A;  1LWE A;  4R5P A;  1XHX A;  4PQU A;  1T7P A;  1SUQ A;  1KLM A;  4ZTF A;  4OKK A;  4UQG A;  4C8L A;  1HYS A;  3EYZ A;  4DF8 A;  3AA3 A;  2D0A A;  4FLW A;  4DS5 A;  3OYK A;  2YHA A;  1LV5 A;  3U6F A;  4M42 A;  1C1B A;  3PX6 A;  4KI4 A;  3LWL A;  2OPQ A;  3E01 A;  1FXX A;  3V81 A;  1TKT A;  4I2P A;  4PWD A;  1WSH A;  5EU7 A;  1HJR A;  1RBV A;  3OYD A;  4CJP A;  4LH5 A;  2YHB A;  3ZT1 A;  4Q5V A;  2ZQB A;  1EET A;  3AO2 A;  5J2Q A;  5FDL A;  4DSF A;  4AHU A;  2HNY A;  4CJR A;  4KI6 A;  1IKW A;  1S1V A;  3L2R A;  2ITG A;  3RMC A;  3PUF A;  3KTQ A;  4RW8 A;  4E89 A;  1VSI A;  3VQ7 A;  4DTM A;  1RIL A;  1DTQ A;  4CIG A;  2BDP A;  3S9H A;  4W5T A;  4AHR A;  4CEA A;  1BIS A;  3LAN A;  4CJT A;  3OYJ A;  2XY5 A;  1NJZ A;  1HQU A;  3AA2 A;  4KAZ A;  4DSE A;  4PY5 A;  4H4O A;  3KKR A;  4DU4 A;  5J2N A;  1XC9 A;  4CEF A;  2KZM A;  3OYM A;  4EZ6 A;  4ZTJ A;  4CEO A;  4QOZ B;  4FJK A;  2QK9 A;  2D0C A;  3VQA A;  1VRU A;  2E4L A;  3VQD A;  4B9N A;  2KFZ A;  3AVI A;  2YV0 X;  4KB1 A;  1NJY A;  5C25 A;  3QEP A;  3ZSY A;  4AH9 A;  4OPK A;  1U49 A;  3HYF A;  1TKZ A;  4KTW A;  4CER A;  3KJV A;  4BE0 A;  3QEI A;  2YNG A;  2RN2 A;  4HTU A;  4FJM A;  1EKE A;  3LP0 A;  3ZCM A;  3G10 A;  3ISN C;  5HRS A;  4J2A A;  5JS1 A;  4B9T A;  3DOL A;  1J9A A;  4AHT A;  4ELT A;  3DRP A;  3SQ4 A;  2FBV A;  3IG1 A;  4E7H A;  2F8T A;  1BIU A;  3QEX A;  4HCB A;  4FJ9 A;  4J2E A;  1JLA A;  4ELV A;  1VSF A;  2PYL A;  1NJX A;  3HJF A;  2ETJ A;  3AVN A;  3QLH A;  4QCL A;  3HVR A;  1GOA A;  3M8Q A;  3EZ5 A;  1BHL A;  1NK5 A;  5HBM A;  4DSK A;  4FJJ A;  2I5J A;  1VSM A;  4CFB A;  1WAJ A;  1WSE A;  3MEC A;  4JS4 A;  4ELU A;  3VQ8 A;  2OYQ A;  2QKB A;  3SZ2 A;  3OY9 A;  4Z4G A;  4FCY A;  3DRR A;  4N41 A;  4DSJ A;  2VG7 A;  1RT4 A;  1IKV A;  4CF8 A;  4E19 A;  3OYB A;  4HUG A;  4CJW A;  2HB5 A;  3AVC A;  1BL3 A;  1WSF A;  1HNI A;  4Z4F A;  4DU1 A;  3AVA A;  3AVJ A;  2G8F A;  1DTT A;  4GW6 A;  3TAB A;  1LWF A;  4PA1 A;  3NE6 A;  4FLY A;  4KHU A;  4HVJ A;  3DLG A;  3VN5 A;  1RT7 A;  3QIP A;  3L2Q A;  5J2M A;  1TK8 A;  4IG3 A;  2BGG A;  3D0P A;  1KTQ A;  3MEE A;  3NDK A;  3PO4 A;  1VSE A;  3NBP A;  1CZ9 A;  1NJW A;  4F3O A;  4DLG A;  3QEW A;  2KZZ A;  2HND A;  3KLG A;  4DTX A;  4ZHR A;  3DLK A;  1QS4 A;  4DQR A;  5T7B A;  4B9S A;  3DM2 A;  4Z0U A;  1TV6 A;  3LAM A;  1IKX A;  1BIZ A;  2D5R A;  2VG6 A;  4C8M A;  3VQ9 A;  5C24 A;  4CGH A;  3LP1 A;  5J1E A;  3LPU A;  3CQ8 A;  4NCA A;  3TI0 A;  1FKO A;  4CHP A;  4BE2 A;  2HMI A;  1LW0 A;  4RW7 A;  2O4G A;  4CFC A;  2AJQ A;  5DMR A;  4LSL A;  1X9W A;  3ZSV A;  3LZI A;  4DMN A;  3OYE A;  3PX4 A;  3LAL A;  3ZSX A;  3OJU A;  4NCG A;  4DQQ A;  2QKK A;  4FK2 A;  1WSI A;  4BAC A;  5CYM A;  3M8R A;  3SPY A;  3AVF A;  2OZM A;  1JKH A;  4CJF A;  5HRP A;  4M3Y A;  4B3O A;  4M3T A;  3WNE A;  1VSL A;  3HP6 A;  3TAR A;  4B9U A;  1S9G A;  3QNN A;  1L3S A;  3PO5 A;  1VSD A;  3G0Z A;  3K5L A;  1YT3 A;  5SZT A;  3HT3 A;  3QIN A;  2Y1I A;  1RTJ A;  4F2S A;  2B6A A;  3V1Q A;  2PYJ A;  1L3V A;  4FJ5 A;  3SQ1 A;  1XHZ A;  3SUP A;  4KTZ A;  4IBN A;  2YNH A;  2W42 A;  3K5O A;  3VQQ A;  1RT5 A;  1F21 A;  1JLB A;  2D0B A;  3KKS A;  1D9D A;  2Q3S A;  4CCH A;  3QEV A;  3H08 A;  3LZJ A;  1T05 A;  4J2D A;  3SV3 A;  4FJ7 A;  3DLE A;  3K2P A;  1U45 A;  3VQE A;  4FK4 A;  5HP1 A;  4NYN A;  4B8A B;  3K5N A;  3NGZ A;  1RTI A;  1TVR A;  3LP3 A;  1NOZ A;  1VK0 A;  3LPT A;  4MQ3 A;  1I3A A;  4CGJ A;  3V9X A;  3RRH A;  3RR8 A;  2XY7 A;  1IKY A;  3VQP A;  3ZT2 A;  1FKP A;  4O4G A;  1MU2 A;  3L2U A;  4FK0 A;  1HMV A;  4J2B A;  3P83 D;  4CIE A;  5JS2 A;  4OPJ A;  1EXQ A;  1JLE A;  3QET A;  4DTS A;  2KTQ A;  4K8Z A;  2G8V A;  2HHQ A;  3THV A;  1RBS A;  1FK9 A;  4CGF A;  2IOC A;  4CK2 A;  1S1U A;  3AA5 X;  4RG8 A;  1GOB A;  3VQ5 A;  1TL1 A;  1JXE A;  1KCF A;  2LSN A;  2DFE A;  3DYA A;  3ULD A;  2P5G A;  1JXB A;  4N56 A;  3CFO A;  1X9S A;  4E3S A;  1WAF A;  4N76 A;  1NK0 A;  2B5J A;  4W5N A;  1U47 A;  1QQC A;  3AVB A;  3DLR A;  3QO9 A;  1ASV A;  5KGX A;  4IKF A;  4Z4E A;  1HNV A;  1KVC A;  2IGI A;  4FJX A;  3KD1 E;  4DF4 A;  4FZY A;  4OKE A;  4B9L A;  1NKC A;  1SV5 A;  4FZX C;  4OGC A;  4W5Q A;  4W5O A;  1D9F A;  4XIU A;  4FJH A;  4FLU A;  3CG7 A;  4CEE A;  4NYF A;  4Z4H A;  4LD0 A;  3AO3 A;  1C0T A;  4H4M A;  4GMJ B;  3MAQ A;  3U3Y A;  1UA0 A;  1KFS A;  2XY8 A;  4MFB A;  1T03 A;  4RW4 A;  1NKB A;  1N5Y A;  3VQC A;  1NK8 A;  1A5V A;  4CHO A;  5DK5 A;  2G8K A;  1ASU A;  3P5J A;  1SKS A;  1Q9X A;  2FC0 A;  4CJK A;  4CF1 A;  3LP2 A;  4RW6 A;  5SWM A;  3SQ2 A;  1TK5 A;  2VG5 A;  3CYM A;  1CXU A;  1LAV A;  1REV A;  3WNG A;  3ZSQ A;  2Y1J A;  4JRP A;  4C8O A;  2WOM A;  4ID5 A;  1G15 A;  3TAN A;  4E7K A;  3DLH A;  2XHB A;  4KO0 A;  3LDS A;  3VA3 A;  1W0H A;  1L5U A;  4DQS A;  1DLO A;  1BGX T;  3AA4 A;  3ZSZ A;  4CES A;  1UA1 A;  4I7F A;  4DTP A;  3BGR A;  4FJG A;  2OZS A;  1RBT A;  4ID1 A;  4AHC A;  4CEB A;  5FRM A;  3HST B;  3MXM A;  1KFD A;  4OGE A;  4Z4C A;  4HHT A;  3OS2 A;  2RF2 A;  3PY8 A;  4CJQ A;  4B8C A;  1U4B A;  3WNH A;  4FLT A;  3AVG A;  1ZBF A;  3L3V A;  1RT6 A;  2FBY A;  4FJI A;  3M8P A;  2Z1J A;  3C94 A;  3NHG A;  1CZB A;  4JLH A;  1WSJ A;  3ZT4 A;  3PX0 A;  2G8U A;  4KHY A;  3AO1 A;  5K14 A;  3OYL A;  1HPZ A;  1Y97 A;  1ASW A;  2X74 A;  3NF8 A;  3SI6 A;  1NK4 A;  1HYV A;  3C95 A;  1A5W A;  2KQ2 A;  3KLI A;  3S3M A;  4M3U A;  5C42 A;  4E1M A;  4BE1 A;  1BCM A;  3CFP A;  4M3Z A;  3ALY A;  3U3G A;  1S6P A;  4CED A;  4CHN A;  1SL2 A;  1RTD A;  2ATQ A;  3KIO A;  4KKO A;  1B9D A;  4B9V A;  4IFV A;  1RT2 A;  3CM5 A;  4E7J A;  1SL1 A;  4O0I A;  4GVM A;  3HPH A;  4E1N A;  4CK1 A;  4CEC A;  3TAF A;  1JLF A;  4OLA A;  3EY1 A;  3AO5 A;  4CK3 A;  3AV9 A;  3OYH A;  3OS0 A;  4OJR A;  4DG1 A;  3V9Z A;  1QSS A;  2G8I A;  1Q9Y A;  4DFK A;  4WE1 A;  3OYF A;  1KRP A;  3V1O A;  4IG0 A;  4CE9 A;  1J53 A;  1TAU A;  1B9F A;  5D3G A;  4DQP A;  3SUN A;  2IAJ A;  4FYD A;  3B6P A;  3K58 A;  1WNS A;  3RTV A;  3MXJ A;  4TSX A;  2PZS A;  3T3F A;  4LY7 A;  1U04 A;  4CF2 A;  3SV4 A;  1NKE A;  1Z26 A;  2GBZ A;  4JRQ A;  1C0U A;  3KLF A;  1Z25 A;  4M3X A;  1JLQ A;  3IRX A;  4M3W A;  3RMA A;  4DQI A;  1S9E A;  2DY4 A;  3I0R A;  2BAN A;  3KD5 E;  4CHQ A;  3SNN A;  1IO2 A;  1BQN A;  3AVM A;  4CGG A;  2P1J A;  3OYG A;  1S1W A;  5I42 A;  3JYT A;  1JLC A;  2HW3 A;  3TAQ A;  1HRH A;  3OYN A;  3ZT3 A;  4W5R A;  2KFN A;  3CM6 A;  1GOC A;  3A2F A;  3O3F A;  3HXM A;  4KRF A;  3ZSR A;  2VWK A;  3C6T A;  2BE2 A;  1VSJ A;  4CIF A;  4CJL A;  3OYA A;  4KHQ A;  4Y1D A;  1UAX A;  3NF9 A;  4JS5 A;  4E7L A;  4CGI A;  3PV8 A;  1C6V A;  1LWC A;  4FM0 A;  4I9L A;  5CY4 A;  4M41 A;  3TAG A;  3HO1 A;  4M45 A;  4FVM A;  1LAW A;  5I3U A;  3MXI A;  4DWI A;  2HHT A;  2HHS A;  4CFD A;  2F8S A;  1RNH A;  3TR8 A;  5HRO A;  3IS9 A;  3RRG A;  2F96 A;  3KLE A;  1SL0 A;  2IDO A;  4EZ9 A;  3I0S A;  4Q0B A;  4CJU A;  3NH0 A;  3L2V A;  4HUE A;  4FLV A;  2WON A;  4YNQ A;  4BDZ A;  1JL1 A;  1YTU A;  1WSG A;  1UWB A;  2E6L A;  1X1P A;  4C8K A;  2X6N A;  4KPY A;  5KRT A;  1ITG A;  1VSK A;  4KRE A;  2HHW A;  1CXQ A;  4N5S A;  3OS1 A;  2GUI A;  4O5B A;  3V9U A;  1KLN A;  4BDP A;  1B92 A;  1I39 A;  1NOY A;  1L3U A;  1RDA A;  1HQE A;  4BWM A;  4Y1C A;  1TK0 A;  1QSY A;  2DTU A;  3F73 A;  4CJ4 A;  3UIQ A;  4FJL A;  3SPZ A;  1J54 A;  3ASM A;  4EP5 A;  4KTQ A;  2DFF A;  2DFH A;  2P51 A;  2RPI A;  5CZ2 A;  2OPR A;  1TAQ A;  2QXF A;  3QNO A;  3ZSW A;  1QHT A;  3V9S A;  2O4I A;  4DSL A;  1S6Q A;  3DOK A;  4BWJ A;  3RR7 A;  1D8Y A;  3HK2 A;  1D5A A;  1YTA A;  2YKN A;  1T8E A;  4K8X A;  1EX4 A;  4DFM A;  2GV9 A;  1KVB A;  4OKJ A;  3V9W A;  1IG9 A;  4KHW A;  2X78 A;  3CFR A;  4OVL A;  4DTU A;  3KLH A;  4I2Q A;  3DLB A;  1BI4 B;  4KV8 A;  5CZ1 A;  4F2R A;  1ZBU A;  4G1Q A;  3NAE A;  1VSH A;  3AVK A;  3KK2 A;  3KK3 A;  2JLE A;  3HPG A;  1RTH A;  2YNI A;  3NGI A;  4DFP A;  2A1R A;  1X9M A;  1N6Q A;  4CJ5 A;  3VA0 A;  4F3T A;  3RWU A;  2OPS A;  1TKX A;  3V1R A;  4E0D A;  4FLX A;  4FW1 A;  1VRT A;  2IC3 A;  2ZE2 A;  1XWL A;  2R7Y A;  1K6Y A;  2EHG A;  3D45 A;  3ZT0 A;  4FW2 A;  5HRN A;  2XO7 A;  4F4K A;  3DMJ A;  4CHZ A;  4L8R B;  3NF6 A;  4FJN A;  2IS3 A;  4RW9 A;  3TAM A;  2KW4 A;  4PUO A;  4CEZ A;  1O1W A;  4CJE A;  3TAE A;  3O3G A;  3L8B A;  2YNF A;  3V4I A;  2RKI A;  3AVL A;  1C0M A;  5KRS A;  3NH1 A;  4CF9 A;  3MED A;  3OJS A;  4AIL C;  1S5J A;  2A1S A;  4CEQ A;  4DTO A;  1RDB A;  5FRN A;  1QSL A;  3HVT A;  1QTM A;  4CJV A;  1RCH A;  3SYZ A;  1NK7 A;  3NH2 A;  3QER A;  2OA8 A;  3SQ0 A;  4KB0 A;  3HPO A;  1QE1 A;  1W9H A;  4O55 A;  4B08 A;  4NCB A;  4M3R A;  1NK9 A;  4B9M A;  3OYI A;  4IFY A;  3K57 A;  4BDY A;  1ZBI A;  2HHU A;  4HCC A;  3QIO A;  4CGD A;  4CHY A;  3M8S A;  4FXD A;  5HRR A;  2HHX A;  4AHV A;  1RBU A;  1U48 A;  3ITH A;  4KFB A;  3T19 A;  1IH7 A;  3RMB A;  2E6M A;  1Q8I A;  4E7I A;  2EX3 A;  1TL3 A;  2FBX A;  3L2W A;  4KHS A;  1ZBL A;  2FBT A;  3O3H A;  1LW2 A;  3F9K A;  3SUO A;  4Z4I A;  3VQB A;  4FZZ A;  3VQ6 A;  5KGW A;  4DTR A;  3OVN A;  4KHN A;  4LH4 A;  3RMD A;  4DSI A;  4DU3 A;  1C1C A;  4CJ3 A;  2HNZ A;  2Z1I A;  4YFU A;  3K59 A;  2G8H A;  3LAK A;  1NK6 A;  4HUF A;  1RBR A;  4F8R A;  4C8N A;  4ICL A;  1WN7 A;  3B6O A;  3C6U A;  3HM9 A;  2VWJ A;  4FLZ A;  4DTN A;  3T1A A;  2HVI A;  5HLF A;  4FJ8 A;  3HP9 A;  5KI6 A;  2HVH A;  3NCI A;  2XRI A;  2Z1H A;  1RT3 A;  1XI1 A;  1JLG A;  1L3T A;  3AO4 A;  3SCX A;  2JGU A;  4EP4 A;  4O44 A;  1A5X A;  1BQM A;  3DRS A;  3MEG A;  2OPP A;  2NUB A;  3NF7 A;  1RT1 A;  3O4N A;  4DS4 A;  2P5O A;  3AVH A;  1C1A A;  4OLB A;  3IAY A;  3I8D A;  3SUQ A;  4I9Q A;  1S1T A;  1WLJ A;  3O4Q A;  3WNF A;  2HHV A;  1BI4 A;  1RDD A;  3DI6 A;  4DTJ A;  2B4J A;  3VQ4 A;  1EP4 A;  1SKW A;  2X6S A;  1KVA A;  2Z1G A; 
#chains in the Genus database with same CATH topology
 5KTQ A;  4AHS A;  4DQ8 A;  4LSN A;  4A5B A;  2E5L K;  4CJS A;  3J8A A;  4FPB A;  4DLE A;  4CF0 A;  4N47 A;  1N8R O;  4IZ9 A;  5FRO A;  5CYQ A;  3O9S A;  3K5M A;  3BDP A;  3CCE N;  2PY5 A;  4CFA A;  1YHQ N;  4H8K A;  1TKD A;  1GLL O;  1ZBH A;  3SJJ A;  1CLQ A;  4FM1 A;  1S1X A;  3HL8 A;  4M7Y A;  1XHX A;  4WQ4 C;  5BRF A;  4OKK A;  1YXQ A;  3VEO A;  3AA3 A;  2QW9 A;  4FLW A;  2VGM A;  5BRH A;  4BRG A;  4M42 A;  3CCS N;  3GBT A;  2V7Y A;  3E01 A;  4DV2 K;  2VWB A;  4I2P A;  4JI0 K;  2NLX A;  1DGK N;  3O5B A;  3D2E A;  3HZ6 A;  4LH5 A;  2YHB A;  3ZT1 A;  1YI2 N;  3JXU A;  5HOO A;  4WQ5 C;  2HNY A;  4CJR A;  4KI6 A;  1IKW A;  1KAZ A;  1S1V A;  2ITG A;  3GE1 A;  3J80 O;  2A40 A;  2P9L B;  4B1X B;  4W5T A;  4JI6 K;  4AHR A;  4CJT A;  3B8A X;  2XY5 A;  5KPT A;  3CPE A;  2QI2 A;  4BVO A;  3I55 N;  4FJK A;  2D0C A;  4A59 A;  3VQD A;  4CZI A;  4B9N A;  3AVI A;  3D2F A;  5C25 A;  3P38 A;  4AH9 A;  2NRV A;  3HYF A;  1HX1 A;  4BE0 A;  1K73 O;  3I33 A;  4NO7 A;  3IDH A;  2RN2 A;  4J2A A;  5HRS A;  1NMN A;  3TPQ A;  4B9T A;  2NRR A;  3E66 A;  4E7H A;  2F8T A;  2P9N B;  3QEX A;  2P9I A;  4HCB A;  3J81 O;  1JLA A;  5LJV A;  1T44 A;  3O1B A;  1BHL A;  5HBM A;  1NGH A;  1WSE A;  4ELU A;  2QKB A;  3SZ2 A;  4Z4G A;  4DSJ A;  4DB3 A;  4CJW A;  1BL3 A;  2G8F A;  3TAB A;  3NE6 A;  5AQP A;  4HVJ A;  3IFR A;  3H46 O;  4DR7 K;  4JKG A;  3VN5 A;  3QBW A;  3TTD A;  1NNE A;  3M6G A;  4BRP A;  3NDK A;  1VSE A;  3NBP A;  4MLE A;  4F3O A;  2HND A;  1XMO K;  3IMX A;  3DLK A;  3VEV A;  4CZG A;  4JKD A;  3LAM A;  4NCA A;  5J1E A;  4XH5 A;  2HMI A;  2O4G A;  3LZI A;  1J5E K;  3ZSX A;  3OJU A;  4NCG A;  2QKK A;  1WSI A;  4BAC A;  3M8R A;  5HRP A;  3EO3 A;  4DR3 K;  4M3T A;  2A6A A;  4B9U A;  2ZWH A;  2QWR A;  1YT3 A;  5SZT A;  4I6M A;  3ENH A;  3EKU A;  1XNR K;  4KH4 A;  3QIN A;  4F2S A;  5CHI A;  1N33 K;  1NBW A;  5AQW A;  1BWF O;  2YNH A;  3MK6 A;  1I94 K;  2D0B A;  1ATN A;  2Q3S A;  4CCH A;  3QEV A;  3LZJ A;  4FJ7 A;  1YIT N;  1U45 A;  3VF2 A;  4NYN A;  4B8A B;  4MQ3 A;  4CGJ A;  1NOZ A;  2PFU A;  3LPT A;  3V9X A;  3RRH A;  4JKA A;  1P8Z A;  3ZT2 A;  4FK0 A;  3QET A;  4CBU A;  5GIP A;  4DTS A;  2KTQ A;  4K8Z A;  4CGF A;  1S1U A;  2E2Q A;  3UKR B;  3H3O B;  1KCF A;  5AQM A;  1WAF A;  4N76 A;  3KWG A;  1QQC A;  3THX A;  3QO9 A;  2I7N A;  3QIC A;  4JKF A;  2IGI A;  3U4L A;  4HTL A;  4B9L A;  2YI1 A;  3N4P A;  1MWK A;  3CCQ N;  3CG7 A;  4U7B A;  4CEE A;  4MO4 A;  3C6A A;  1KFS A;  2E2N A;  4B1W B;  5GAE P;  1NK8 A;  3EN9 A;  1ASU A;  4DR2 K;  4YOW A;  3VEN A;  5TKW A;  3SQ2 A;  5SWM A;  2VG5 A;  4C8O A;  4O8K A;  1JJ2 M;  2Y1J A;  2WOM A;  4ID5 A;  1G15 A;  4FWL A;  4E7K A;  1W0H A;  4DQS A;  3VTI A;  4CES A;  5HL7 L;  3T69 A;  2OZS A;  3SAH A;  4ID1 A;  1SAZ A;  4AHC A;  1QZ5 A;  2HBL A;  1E3M A;  4OGE A;  3OS2 A;  5EXW A;  1SZ2 A;  4MDA A;  3PY8 A;  3R8E A;  1RT6 A;  2ZJP L;  3M8P A;  2E88 A;  2Z1J A;  3C94 A;  3ZT4 A;  1Q7Y O;  3TTF A;  4M3U A;  3C95 A;  5GAG P;  3KLI A;  2CGJ A;  3CFP A;  1RTD A;  2O8E A;  3J7A P;  4FWO A;  4KKO A;  4GV3 A;  4LFB K;  4O0I A;  4YOU A;  3HPH A;  4CVN E;  2VCP A;  3BF3 A;  1JLF A;  1CZA N;  4CK3 A;  3OYH A;  3OS0 A;  4DG1 A;  2G8I A;  2P9S B;  1KRP A;  4JD2 B;  3PSF A;  1B9F A;  3U9D A;  3CCV N;  4DV4 K;  3PLA A;  3R3L A;  3LDQ A;  3MXJ A;  4TSX A;  2PZS A;  4LY7 A;  4IOA L;  4JEP A;  1NKE A;  4JRQ A;  3C65 A;  3H1V X;  4GV6 A;  4M3X A;  3KD5 E;  2FF3 B;  4WFA L;  1P90 A;  4CZE A;  3WXK A;  3OYN A;  1NWK A;  4NB4 A;  3BZC A;  3A2F A;  3QFU A;  4MLH A;  3ZSR A;  2IVP A;  2BE2 A;  3MWT A;  5M1P A;  3U9Z A;  3FGU A;  3NF9 A;  3I56 N;  1G99 A;  5AQK A;  3SBT A;  4FM0 A;  4I9L A;  5CY4 A;  4M41 A;  3HO1 A;  4IOX A;  4M45 A;  2HHT A;  1HUX A;  1HKB A;  4LC9 B;  4EHT A;  3E1Y A;  3TR8 A;  5HRO A;  3A5M C;  2O8F A;  4Q0B A;  1BU6 O;  2WON A;  4BDZ A;  2E6L A;  4J8F A;  4EFH A;  4AF1 A;  5LMU K;  2HHW A;  3OS1 A;  2O8C B;  4KH5 A;  4U67 L;  1NOY A;  4JK7 A;  1L3U A;  1HQE A;  4BWM A;  4Y1C A;  1VQ7 N;  3SPZ A;  3W3D A;  3HM8 A;  4EP5 A;  4KTQ A;  2Q2R A;  5E26 A;  5JVH L;  5FLX O;  1TAQ A;  2QXF A;  4JI4 K;  1QHT A;  3K9J A;  3T1H K;  1Q18 A;  4BC5 A;  1D5A A;  3O80 A;  3ENB A;  5AQG A;  2A5X A;  3CI5 A;  3CJ1 A;  4CI6 A;  4OKJ A;  3V9W A;  3DLB A;  1BI4 B;  1ZBU A;  5AQL A;  4G1Q A;  3AVK A;  2BUP A;  3KK2 A;  2A1R A;  1N6Q A;  3NGI A;  4DFP A;  3SMS A;  5AZI A;  3RWU A;  4QS8 A;  2JWL A;  5AQY A;  5H1S Q;  3SJH A;  3J7Z O;  1Q82 O;  2ZE2 A;  3F5T A;  1K6Y A;  4JHD B;  4LF4 K;  4FW2 A;  4F4K A;  3DMJ A;  3NF6 A;  4RW9 A;  2Q97 A;  4CEZ A;  3HTV A;  4CZF A;  3O3G A;  1QVF M;  1BO5 O;  4CF9 A;  4AIL C;  3EKS A;  4BRM A;  4CEQ A;  3HVT A;  1X3N A;  1NK7 A;  2OA8 A;  3PSI A;  4JI7 K;  3OYI A;  4IFY A;  3UKU A;  2HF3 A;  4F9O A;  3ITH A;  4KFB A;  3T19 A;  2HBM A;  2IVN A;  4YDU C;  1Q8I A;  1TL3 A;  1YIJ N;  4RTF D;  1EWR A;  2ASM A;  3O3H A;  3SUO A;  4Z4I A;  4DV1 K;  2V51 B;  3VQ6 A;  4DTR A;  2NRX A;  4DSI A;  4CJ3 A;  2Z1I A;  3LAK A;  1RBR A;  3RSE A;  4ICL A;  1WN7 A;  3C6U A;  2HVI A;  2XRI A;  2VGN A;  1JLG A;  3AO4 A;  4EAH D;  2JGU A;  4O44 A;  3BZK A;  4JYA K;  2NUB A;  4DS4 A;  1MWM A;  2OTJ N;  4DR1 K;  1WLJ A;  2E1Y A;  4DTJ A;  3DI6 A;  1EP4 A;  3CCM N;  2W6L A;  2YHX A;  3CER A;  1SKW A;  2YHY A;  2X6S A;  2XY6 A;  4M63 C;  3KK1 A;  3LWM A;  1S3X A;  2HBK A;  4JK9 A;  1KSP A;  1YVU A;  1ZYQ A;  2HF4 A;  4BRK A;  2NZT A;  3TAP A;  4A57 A;  3S3N A;  4IDK A;  2P9U A;  1YAG A;  1Z05 A;  4DFJ A;  1HYZ A;  2Q31 A;  3FFI A;  1TGO A;  5JLF A;  4GNI A;  4YOX A;  1Z6R A;  5BN8 A;  1KLM A;  4BC4 A;  1EWQ A;  3E9P A;  4C8L A;  1OH5 A;  3SMP A;  4DS5 A;  3OYK A;  4KHP K;  1QHA A;  3U6F A;  1C1B A;  4KI4 A;  3LWL A;  2OPQ A;  2ZM6 K;  3O4W A;  1WSH A;  3T7Z A;  1RBV A;  4FWM A;  3FE1 A;  4AHU A;  2KLA A;  3RMC A;  1C0F A;  3PUF A;  4BRD A;  1RIL A;  2BDP A;  3S9H A;  4WFB L;  3LAN A;  3OYJ A;  1HQU A;  4BR9 A;  4DSE A;  1N34 K;  4PY5 A;  1GLA G;  2GUP A;  3KKR A;  5J2N A;  3C7N B;  4CEF A;  3OYM A;  3FZM A;  4QOZ B;  3VQA A;  5M1F A;  2E4L A;  1NU0 A;  4BRA A;  4KB1 A;  1NJY A;  4OPK A;  4A2B A;  4KTW A;  4CER A;  3QEI A;  5M1O A;  4A61 A;  4FJM A;  3LP0 A;  5JS1 A;  3CCU N;  3DOL A;  5E84 A;  1V4S A;  3DXM B;  3SQ4 A;  1BIU A;  3MN7 A;  3O08 A;  4ELV A;  3FFK B;  3QLH A;  4QCL A;  1NGF A;  3BEX A;  3VF6 A;  3M8Q A;  4YOV A;  1NK5 A;  4FJJ A;  1WAJ A;  4JS4 A;  3VQ8 A;  3QB0 A;  2P9P B;  1GLD G;  4M7X A;  3M1F A;  4LF9 K;  4E19 A;  3CF5 L;  1WSF A;  4DU1 A;  4H0T B;  4GW6 A;  4L3Q A;  1LWF A;  4DV3 K;  4FLY A;  3JAM O;  4KHU A;  2OAN A;  3EEQ A;  4BRL A;  3CC4 N;  4NXN K;  1KTQ A;  2F9T A;  3MEE A;  4PL8 A;  3R1X A;  1CZ9 A;  4CD1 A;  3FZF A;  4DLG A;  1LOT B;  3OTO K;  3DM2 A;  4K43 A;  4FXD A;  1BIZ A;  3LP1 A;  3OBW A;  3TI0 A;  1FKO A;  4RW7 A;  2GWJ A;  2AJQ A;  1RDW X;  1IG8 A;  3G25 A;  3O9Q A;  3OYE A;  3PX4 A;  3LAL A;  5F2R A;  5IT9 O;  4DQQ A;  3WEE A;  1JKH A;  4M3Y A;  3LM9 A;  4B3O A;  3A8Y A;  1S9G A;  5EX5 A;  3SK3 A;  1VSD A;  3K5L A;  5AJ3 K;  1VQ4 N;  2YX6 A;  2PYJ A;  1O13 A;  3Q7C A;  3BP8 A;  4WCE L;  1D9D A;  1LCU A;  3CET A;  3K2P A;  2Q0R A;  3VQE A;  4FK4 A;  2P9N A;  1TVR A;  3RR8 A;  1I3A A;  4LF7 K;  1IKY A;  3L2U A;  1JCG A;  1HLU A;  2NRW A;  2G8V A;  2QA4 N;  3THV A;  4DCH A;  1NGJ A;  1GOB A;  4CW7 B;  2P5G A;  1JXE A;  1YUW A;  2DFE A;  3DYA A;  5GIN A;  4LF8 K;  3HSC A;  3DLR A;  5AQN A;  4IKF A;  1ASV A;  5KGX A;  4Z4E A;  1KVC A;  3E9L A;  1K8K A;  1ZC6 A;  4FZY A;  1NKC A;  1YVN A;  1D9F A;  4FJH A;  1YJN N;  4Z4H A;  1UA0 A;  3U3Y A;  2HOE A;  4MFB A;  2FF6 A;  1FW6 A;  4CHO A;  3P5J A;  2QEX N;  1NM1 A;  2YCH A;  3LP2 A;  3LM2 A;  4RW6 A;  4WF9 L;  3CYM A;  1REV A;  4FWN A;  2UUB K;  3DLH A;  3QDK A;  4CZJ A;  3LDS A;  3VA3 A;  3VF4 A;  1BGX T;  3ZSZ A;  5I9E B;  3BGR A;  4FJG A;  4B3R K;  5IWA K;  4H0P A;  4HHT A;  4FLT A;  1K9M O;  3AGR A;  4FJI A;  5AQF A;  1NGG A;  1OH7 A;  3PX0 A;  5M1N A;  4KHY A;  1HPZ A;  2UU9 K;  3ZX3 A;  3NF8 A;  1NK4 A;  5F0X A;  1BCM A;  4M3Z A;  1SL2 A;  2ATQ A;  3A5N C;  1RT2 A;  3CM5 A;  4E7J A;  1NG9 A;  4GVM A;  1BOT O;  4CEC A;  2VQF K;  4OLA A;  4WFN L;  4AQY K;  1QSS A;  3D2E B;  1HJO A;  2NNW A;  1ZXO A;  1Q9Y A;  3BF1 A;  4FPA A;  1J53 A;  5AQV A;  1TAU A;  4FWS A;  3AAQ A;  3H45 C;  3O9T A;  4DQP A;  1FJG K;  3B6P A;  4KBO A;  3RTV A;  5KPR A;  3T3F A;  5EOY A;  1Z26 A;  3ZET A;  4E1J A;  3RVC A;  3KLF A;  2GX9 A;  3A5L C;  3RMA A;  2CGL A;  1OKJ A;  1TYQ B;  4CHQ A;  3SNN A;  3AVM A;  5I42 A;  5ELZ A;  2P1J A;  4JKH A;  1S1W A;  5AQR A;  1JLC A;  3A5O C;  3TAQ A;  1HRH A;  2NRH A;  3ZT3 A;  1GOC A;  1HKG A;  5EVZ A;  3HXM A;  4KRF A;  1XC3 A;  4CIF A;  3DJC A;  4CJL A;  2VQE K;  4KHQ A;  4E7L A;  3PV8 A;  1LWC A;  1HPM A;  3ATV A;  5I3U A;  4FVM A;  1LAW A;  4CFD A;  5CR4 A;  4BG8 A;  3IS9 A;  5AZJ B;  4BRC A;  1ATS A;  1SL0 A;  2QWN A;  3I0S A;  4EZ9 A;  1HNZ K;  4H5T A;  4MDB A;  1WSG A;  4KPY A;  1VQ9 N;  1ITG A;  1CXQ A;  4N5S A;  3V9U A;  1I39 A;  1B92 A;  3MX2 A;  4FJL A;  3OA9 A;  4CJ7 A;  4JN4 A;  4OO1 J;  1D4X A;  2DFF A;  2DPN A;  4R79 A;  2P51 A;  2RPI A;  4JKE A;  5CZ2 A;  4X66 K;  3I8B A;  1NGC A;  3QNO A;  2O4I A;  1WBB A;  3R9P A;  3HK2 A;  1NMD A;  1YTA A;  2YKN A;  1T8E A;  2P9S A;  1KVB A;  4JD2 A;  3OBY A;  1KD1 O;  2X78 A;  4DTU A;  4F2R A;  4C23 A;  3KK3 A;  4CJ5 A;  3VA0 A;  2AP1 A;  1NGD A;  1TKX A;  3V1R A;  4E0D A;  4FW1 A;  2UXD K;  4FSV A;  1BUP A;  2EHG A;  2E2P A;  2XO7 A;  4CHZ A;  3WT0 A;  5C15 A;  1W97 L;  4FJN A;  2IS3 A;  1QQM A;  2WBN A;  4CJE A;  3H1Q A;  1C0G A;  2PBD A;  2RKI A;  3AAP A;  3MED A;  3OJS A;  1DEJ A;  3R6M A;  5AFU H;  3HRG A;  5FRN A;  3KZB A;  1QSL A;  1QTM A;  3UE5 A;  1RCH A;  3NH2 A;  3QER A;  4KB0 A;  1W9H A;  4B9M A;  4AM6 A;  1NLV A;  1ZBI A;  3K57 A;  4H5V A;  2HHU A;  5TKY A;  3VER A;  3QIO A;  3M8S A;  1RBU A;  2QXL A;  1U48 A;  2D4W A;  5AQS A;  4FO0 A;  3GOI A;  3VQB A;  4FZZ A;  2BH1 A;  3OVN A;  3THX B;  2O8C A;  3RMD A;  4BVP A;  2HNZ A;  5AQQ A;  4C8N A;  5ADX H;  3B6O A;  4DTN A;  4FLZ A;  1RT3 A;  1XI1 A;  5KPZ A;  1L3T A;  4EP4 A;  3BY5 A;  1BQM A;  4JI2 K;  3DRS A;  5AFU A;  3SBG A;  2D0O A;  3NF7 A;  1RT1 A;  3MDQ A;  3IAY A;  3I8D A;  3THY A;  1S1T A;  2V7Z A;  4DR6 K;  2HHH K;  1BI4 A;  1RDD A;  3FZL A;  1KVA A;  3TSQ A;  1J5O A;  1R0A A;  1Q86 O;  3NFA A;  1KXP A;  2IIR A;  3ZSO A;  5DM6 L;  5J2P A;  4LFC K;  4B3M K;  3S3O A;  2IVO A;  3MMV A;  4CZM A;  5E41 A;  4IOC L;  1SKR A;  3P1G A;  2F9W A;  4O0J A;  4JHD A;  1VQM N;  3GDQ A;  3TWH A;  4BRO A;  3K9K A;  1BCO A;  4FM2 A;  3NGY A;  3VEW A;  4JKC A;  1OH8 A;  5BRE A;  2WC9 A;  1M90 O;  2UUA K;  2W41 A;  1LWE A;  5ADX A;  4H0O A;  3CCJ N;  4PQU A;  3SAG A;  1SUQ A;  1T7P A;  4ZTF A;  4UQG A;  4H03 B;  3DAW A;  2D0A A;  3MCA B;  3O8M A;  3PIO L;  2F7T A;  1LV5 A;  3L0Q A;  2V52 B;  4B1V A;  1HNX K;  3G71 N;  1FXX A;  1RFQ A;  1TKT A;  3OW2 M;  4PWD A;  4BG9 A;  1X9J A;  4Z94 A;  4Q5V A;  4DUY K;  2ZQB A;  1EET A;  5J2Q A;  1OVY A;  5BPL A;  4DSF A;  3THW A;  3VEY A;  3L2R A;  3EE8 A;  4E89 A;  3VQ7 A;  4CIG A;  3TTC A;  1YJW N;  5M1Q A;  1KAY A;  1IBM K;  3NVK A;  1NJZ A;  4H4O A;  2AA4 A;  4IDH A;  3CCR N;  4DU4 A;  1XC9 A;  4BR7 A;  2KZM A;  4CEO A;  1U2V B;  3TSP A;  1Q81 O;  2EWS A;  5AQH A;  1VRU A;  5AQI A;  4BRI A;  3QEP A;  4IEI A;  1U49 A;  4BRH A;  3VTH A;  2H3G X;  3ZEU A;  2UYT A;  3LDO A;  3KJV A;  3F2K A;  2YNG A;  4HTU A;  3ISN C;  3IG1 A;  3AAR A;  4FWP A;  2PYL A;  3HJF A;  2ETJ A;  1GOA A;  1XUP O;  4DSK A;  2O8F B;  1VSM A;  1HKC A;  2OYQ A;  3OY9 A;  2KKZ A;  3CMA N;  3DRR A;  4N41 A;  3FLC O;  2WTU A;  2VG7 A;  1N36 K;  3OYB A;  4HUG A;  4YOT A;  1IBL K;  2O8D B;  2HB5 A;  3AVC A;  2RHK A;  3AVA A;  3AVJ A;  4YOY A;  4DUZ K;  4PA1 A;  2O8B A;  2CH5 A;  3DLG A;  3QIP A;  3L2Q A;  5J2M A;  1TK8 A;  5AQJ A;  2BGG A;  3IKM A;  4X65 K;  1W2B M;  2ZJQ L;  1NJW A;  3QEW A;  4A2A A;  2KZZ A;  2FSN A;  4DQR A;  5BRD A;  4IJN A;  4Z0U A;  1TV6 A;  3ULE B;  1S22 A;  4A5A A;  3CQ8 A;  4C8M A;  4CGH A;  3LPU A;  4B1Z A;  3AY9 A;  4CHP A;  4CFC A;  5AZI B;  1X9W A;  3ZSV A;  3SAF A;  4DMN A;  3EL2 A;  5CYM A;  1EQY A;  3AVF A;  2OZM A;  3WNE A;  1VSL A;  4GKK K;  1L3S A;  4OPA A;  3QNN A;  3GL1 A;  3HT3 A;  3WXM B;  1RTJ A;  3EE9 A;  4FJ5 A;  1L3V A;  3SQ1 A;  5C2D A;  4BRN A;  4KTZ A;  2W42 A;  3VQQ A;  1RT5 A;  5JVG L;  1T05 A;  3SV3 A;  3DLE A;  3DXM A;  3K5N A;  3LP3 A;  4BR5 A;  2XY7 A;  3VQP A;  3ZX0 A;  1FKP A;  1KAX A;  1MU2 A;  3DXK B;  1HMV A;  3P83 D;  2ZJR L;  3HOT A;  1JLE A;  2HHQ A;  4HWI A;  1RBS A;  4CK2 A;  2IOC A;  4K0K K;  3AA5 X;  3VQ5 A;  5LY3 A;  1TL1 A;  2LSN A;  2ZGY A;  3ULD A;  1JXB A;  4N56 A;  3CFO A;  1X9S A;  1NK0 A;  3AVB A;  3RSE B;  1M1K O;  4OKE A;  1SV5 A;  4W5Q A;  4W5O A;  3VGM A;  2CGK A;  3AO3 A;  1C0T A;  4H4M A;  3MAQ A;  2YJE A;  1N5Y A;  2QWP A;  1A5V A;  5DK5 A;  4PL7 A;  1Q9X A;  4CJK A;  4CF1 A;  1IBK K;  3S41 A;  1CXU A;  3ZSQ A;  4H0V B;  1OVQ A;  4KO0 A;  1RGI A;  1DLO A;  3AA4 A;  1BDG A;  5B8H A;  4I7F A;  1QVG M;  4Y0W A;  2P9U B;  4CEB A;  2BTF A;  4H5R A;  3FZH A;  3HST B;  5FRM A;  2RF2 A;  2WFB A;  3MCP A;  1U4B A;  3WNH A;  1ZBF A;  4IJA A;  2HBJ A;  2FBY A;  3FR0 A;  1BA0 A;  4YHH K;  3ZYY X;  1CZB A;  2G8U A;  1WSJ A;  4DV7 K;  3AO1 A;  3OYL A;  3K0S A;  1Y97 A;  2X74 A;  3S3M A;  1A5W A;  1HNW K;  1VAZ A;  2P9K B;  5C42 A;  4E1M A;  3ALY A;  1S6P A;  3DWL A;  3KIO A;  4IFV A;  5KQ8 A;  4IWV A;  2QTD A;  3TAF A;  3M3Z A;  4W5N A;  1WB9 A;  4K25 A;  3V9Z A;  3OYF A;  3V1O A;  4IG0 A;  1T6D A;  1ESV A;  3H3N O;  3VEX A;  3G4S N;  5D3G A;  3WUH A;  3SUN A;  4FYD A;  3K58 A;  1WNS A;  1YJ9 N;  3SV4 A;  1C0U A;  3CC7 N;  2P9L A;  1JLQ A;  4ILJ A;  3IRX A;  2E2O A;  1S9E A;  2BAN A;  1BQN A;  3OYG A;  3JYT A;  3CJ7 A;  4W5R A;  2KFN A;  3CM6 A;  2UUC K;  3ATU A;  1VSJ A;  2GEL A;  4H5N A;  4CZL A;  3CME N;  4Y1D A;  5A2Q O;  1UAX A;  4BRE A;  4JS5 A;  1C6V A;  2E20 A;  4FWK A;  3TAG A;  3L4I A;  1VQP N;  4FL9 A;  4DWI A;  1VQ6 N;  1WOQ A;  3ID8 A;  2F96 A;  4CD3 A;  2IDO A;  5BPM A;  4FLV A;  3L2V A;  4HUE A;  1JL1 A;  4C8K A;  5FPE A;  3VMF B;  1VSK A;  4IFE A;  2A41 A;  5BR9 A;  1BA1 A;  3UB5 A;  2GUI A;  4BC2 A;  1KLN A;  3O6W A;  2DTU A;  3F73 A;  3UIQ A;  1J54 A;  4FVU A;  3JS6 A;  3VPZ A;  4WQ4 A;  2DFH A;  2OPR A;  3VET A;  4DR4 K;  3ZSW A;  4H5W A;  1XNQ K;  4JI8 K;  3DOK A;  1OH6 A;  1MDU B;  4K8X A;  1IG9 A;  3CFR A;  4OVL A;  3KLH A;  4KV8 A;  5CZ1 A;  1S72 N;  1VSH A;  1NGA A;  1X9M A;  3HPG A;  2YNI A;  4WQ5 A;  2JWK A;  3WEE B;  4FLX A;  1Y64 A;  1SS6 A;  3O9U A;  1XWL A;  5JLH A;  1TYQ A;  3D45 A;  3ZT0 A;  3KVG A;  4DR5 K;  1R59 O;  2KW4 A;  3TAE A;  1O1W A;  3A0I X;  4ISF A;  1VQ8 N;  4XEI A;  5KRS A;  4QS9 A;  3NH1 A;  5AQZ A;  1S5J A;  5LL6 Z;  4DTO A;  3WQT A;  4ISE A;  1KQS M;  4JKB A;  4NCB A;  4M3R A;  1KC8 O;  3IUC A;  3CC2 N;  4GKJ K;  3L4Q A;  1IV0 A;  4CGD A;  4CHY A;  3NMU A;  5HRR A;  5AZJ A;  2E6M A;  5FPN A;  1W7A A;  2EX3 A;  1HR0 K;  2FBX A;  3L2W A;  3Q7B A;  3AGK A;  4KHS A;  1ZBL A;  2FBT A;  3N4Q A;  3UKR A;  2W6K A;  5KGW A;  3LDL A;  5KQD A;  4KHN A;  4DU3 A;  1C1C A;  4YFU A;  1K8K B;  1NK6 A;  2QM1 A;  4HUF A;  4CZK A;  4F8R A;  3L6Q A;  4NLC A;  1J6Z A;  5HLF A;  3HP9 A;  3NCI A;  2Z1H A;  4BRQ A;  1U6Z A;  1DKG D;  3D7E O;  4PHT X;  1A5X A;  4GVE A;  2QWM A;  3MEG A;  4EHU A;  5M1K A;  2P5O A;  3VES A;  3D2F B;  5DM7 L;  4OLB A;  1VQN N;  5EY4 A;  4I9Q A;  1GLJ O;  3WNF A;  2D1K A;  3CQX A;  5CE3 A;  3VQ4 A;  4A62 A;  4NXM K;  2YKM A;  3V6D A;  1UOC A;  1RDC A;  2G8W A;  1XMQ K;  3OYC A;  2P9I B;  1GLF O;  4H0X B;  4BRF A;  5FPD A;  1VQO N;  3LDP A;  3L3U A;  1NGB A;  4DV6 K;  3H6E A;  3VEZ A;  1E4G T;  5LMN K;  3JSM A;  3QML A;  4QAG A;  1JL2 A;  3QES A;  4BGA A;  2ZD1 A;  1V4T A;  4R5P A;  2Q36 A;  1HYS A;  5FPM A;  2A42 A;  3EYZ A;  4JKG B;  4DF8 A;  2YHA A;  3PX6 A;  2RE2 A;  1IJJ A;  3V81 A;  2QWQ A;  3SLC A;  5GIO A;  1VQK N;  5EU7 A;  1HJR A;  3OYD A;  4CJP A;  2KHO A;  3AO2 A;  5FDL A;  4XH4 A;  3KTQ A;  4RW8 A;  1VSI A;  4RWT A;  4DTM A;  2D0P A;  3ZET B;  1DTQ A;  4MO5 A;  4CEA A;  1BIS A;  3AA2 A;  4KAZ A;  3C6H A;  2YJF A;  2I7P A;  1XQS C;  3FZK A;  4OPH A;  4ILG B;  4EZ6 A;  4ZTJ A;  1VQL N;  2QK9 A;  4I6M B;  2KFZ A;  2YV0 X;  2ASP A;  3ZSY A;  2UXC K;  2ZGZ A;  1TKZ A;  3E9O A;  3WXL A;  3WQU A;  1EKE A;  4JI1 K;  3ZCM A;  3G10 A;  2Q0U A;  4ELT A;  1J9A A;  4AHT A;  3DRP A;  2NRT A;  1TUU A;  2FBV A;  5BR8 K;  4V19 S;  1QQO A;  3ENO A;  3F9M A;  3OHR A;  3VGK A;  5BN9 A;  3G6E N;  4J2E A;  4FJ9 A;  1VSF A;  1NJX A;  3C0B A;  3AVN A;  4JV5 K;  3HVR A;  3J7Y P;  4O5F A;  3EZ5 A;  2I5J A;  1WUA A;  2HST A;  4PKH A;  4RCH A;  4CFB A;  5JMV A;  3MEC A;  4FCY A;  4C1N K;  1RT4 A;  1IKV A;  4CF8 A;  2PAV A;  3MWP A;  4XH1 A;  4DKW A;  3ID6 A;  1HNI A;  4Z4F A;  2F4V K;  1DTT A;  5BPN A;  1E4F T;  3BUZ B;  3CJB A;  3U8X A;  1RT7 A;  4AM7 A;  4IG3 A;  3D0P A;  3PO4 A;  3KLG A;  4DTX A;  2WUS A;  4ZHR A;  3EZW A;  1QS4 A;  5T7B A;  4B9S A;  1YF5 L;  1IKX A;  2D5R A;  2VG6 A;  3VQ9 A;  5C24 A;  4JI3 K;  4BE2 A;  1LW0 A;  3CD6 N;  3KK7 A;  5DMR A;  4LSL A;  4O8U A;  2FXU A;  4YOR A;  4K41 A;  4BC3 A;  4FOE A;  3MN6 A;  4FK2 A;  3SPY A;  4CJF A;  2NRZ A;  3TAR A;  3TU5 A;  3HP6 A;  3PO5 A;  5AQT A;  3G0Z A;  5C10 A;  4LF5 K;  1U2V A;  3NVM A;  3HI0 A;  2Y1I A;  4H0Y B;  2B6A A;  4LF6 K;  3V1Q A;  1XHZ A;  3SUP A;  4X64 K;  4IBN A;  3K5O A;  1JCE A;  1F21 A;  1JLB A;  2J4R A;  3KKS A;  3H08 A;  4J2D A;  5HP1 A;  3NGZ A;  1RTI A;  2O8E B;  1VK0 A;  4BR0 A;  4O4G A;  4J2B A;  2W40 A;  5JS2 A;  4CIE A;  1EXQ A;  4OPJ A;  1WBD A;  1VHX A;  1FK9 A;  3CPW M;  2OTL N;  4WYB A;  4RG8 A;  1QZ6 A;  2O8D A;  4E3S A;  2B5J A;  2GWK A;  1U47 A;  4CBW A;  1H1V A;  4FOI A;  1HNV A;  4FWQ A;  4FJX A;  5LJW A;  3KD1 E;  4DF4 A;  4IXC A;  1N32 K;  4FZX C;  4OGC A;  4XIU A;  3P4I A;  4FLU A;  1GLE G;  3CCL N;  4JI5 K;  4IO8 A;  4NYF A;  4LD0 A;  4GMJ B;  1VQ5 N;  2XY8 A;  3O9R A;  1T03 A;  4RW4 A;  1NKB A;  1JCF A;  4JNE A;  3VQC A;  4BY9 C;  2G8K A;  3THY B;  1SKS A;  2FC0 A;  3ULE A;  4X62 K;  2YHW A;  1TK5 A;  4C1N I;  3WNG A;  1LAV A;  2GTD A;  1RDU A;  4JRP A;  2CH6 A;  3WXJ A;  4JK8 A;  3TAN A;  2XHB A;  3QFP A;  2FSJ A;  1L5U A;  1UA1 A;  4B3S K;  4DTP A;  2QWO A;  1RBT A;  3TSU A;  3MXM A;  1KFD A;  4Z4C A;  3MX5 A;  3CQY A;  4CJQ A;  2Q1N A;  4B8C A;  4B1Y B;  3AVG A;  4BGB A;  3L3V A;  3NHG A;  4JLH A;  5K14 A;  3LDN A;  1ASW A;  1NJI O;  3SI6 A;  1HYV A;  2KQ2 A;  4BE1 A;  3U3G A;  4CHN A;  4CED A;  4CBX A;  1B9D A;  4B9V A;  1SL1 A;  3D6R A;  3DXK A;  4E1N A;  4CK1 A;  3EY1 A;  3AO5 A;  3AV9 A;  3MN9 A;  4IEE A;  4OJR A;  2ITM A;  4WE1 A;  4DFK A;  4K42 A;  4BR4 A;  4CE9 A;  5GAH P;  4YDU A;  3THW B;  2IAJ A;  2QWL A;  1DT9 A;  4CF2 A;  1U04 A;  2GBZ A;  4UY8 O;  5AR0 A;  1Z25 A;  3LL3 A;  3VGL A;  1T3V A;  1EO1 A;  4M3W A;  4DQI A;  4EIA A;  2DY4 A;  3I0R A;  1IO2 A;  4CGG A;  1ZBS A;  4BQZ A;  2OCE A;  3C7N A;  1GLC G;  2HW3 A;  3CIP A;  4IO9 L;  4DV5 K;  4PKI A;  3ZEU B;  3O3F A;  2VWK A;  3C6T A;  4GV9 A;  4PKG A;  2GEM A;  3OYA A;  2ASO A;  3CJA A;  4QS7 A;  1ILY A;  3CHW A;  4CGI A;  3UKU B;  1NGI A;  4ILH A;  3MXI A;  2HHS A;  5C0Y A;  2F8S A;  1RNH A;  3RRG A;  5MLC Q;  3KLE A;  4CJU A;  3NH0 A;  4YNQ A;  1YTU A;  1UWB A;  2P9P A;  1X1P A;  5AQU A;  1X3M A;  2X6N A;  5KRT A;  3VOV A;  4KRE A;  3P31 A;  4BDP A;  4O5B A;  3GG4 A;  3KHY A;  4ISG A;  1RDA A;  1TK0 A;  1QSY A;  4CJ4 A;  2O8B B;  2P9K A;  3ASM A;  1K8A O;  4YY3 K;  2HMP A;  4CZH A;  4BR2 A;  3CJC A;  3V9S A;  4DSL A;  1S6Q A;  4BWJ A;  3RR7 A;  1MA9 B;  5C12 A;  1D8Y A;  1EX4 A;  4DFM A;  2GV9 A;  4KHW A;  3DLL L;  3O1W A;  4DHY A;  4I2Q A;  4NLB A;  3ZLJ A;  4B9Q A;  3NAE A;  4KH6 A;  2JLE A;  1RTH A;  4JAX A;  4F3T A;  2E8A A;  2OPS A;  3QBX A;  3PIP L;  1SQK A;  1VRT A;  2IC3 A;  3W0L A;  5AQO A;  1ATR A;  2R7Y A;  5HRN A;  3MN5 A;  4L8R B;  1T6C A;  3HBT A;  2VYP A;  2FLO A;  3TAM A;  4PUO A;  3P39 A;  1BG3 A;  2YNF A;  4FWR A;  3L8B A;  3V4I A;  3AVL A;  1C0M A;  1TUY A;  2A1S A;  1RDB A;  3M5R A;  4CJV A;  3SYZ A;  3T1Y K;  3KWI A;  3SQ0 A;  3HPO A;  1QE1 A;  4B08 A;  4O55 A;  1NK9 A;  4BDY A;  1GLB G;  2A3Z A;  4HCC A;  1QQN A;  2HHX A;  4AHV A;  4B1U B;  4B3T K;  2ZF5 O;  1IH7 A;  3RMB A;  4E7I A;  5JIC A;  1LW2 A;  3F9K A;  1NGE A;  3ZX2 A;  4LH4 A;  2G8H A;  3K59 A;  2E1Z A;  4GY2 B;  4OX9 K;  4BQL A;  5F1X A;  3HM9 A;  2VWJ A;  3T1A A;  3CXC M;  4FJ8 A;  5GAD P;  5KI6 A;  4DV0 K;  2HVH A;  5C2F A;  3HOS A;  5AQX A;  3SCX A;  2FSK A;  3CJ9 A;  3WXI A;  2OPP A;  3O4N A;  2UXB K;  4G9Z A;  3AVH A;  1C1A A;  3SUQ A;  3O4Q A;  2HHV A;  2B4J A;  4LFA K;  2Z1G A; 
#chains in the Genus database with same CATH homology
 1J5O A;  1R0A A;  2XY6 A;  3NFA A;  5KTQ A;  2YKM A;  4AHS A;  3KK1 A;  3ZSO A;  3LWM A;  3V6D A;  1UOC A;  5J2P A;  1RDC A;  2G8W A;  4LSN A;  3OYC A;  1KSP A;  1YVU A;  4CJS A;  1ZYQ A;  3S3O A;  4DLE A;  4CF0 A;  4N47 A;  3TAP A;  3S3N A;  5FRO A;  5E41 A;  1SKR A;  4IDK A;  5CYQ A;  3P1G A;  4O0J A;  3K5M A;  3BDP A;  3L3U A;  4DFJ A;  1HYZ A;  3FFI A;  4CFA A;  2PY5 A;  4H8K A;  1TKD A;  1ZBH A;  1TGO A;  3TWH A;  3SJJ A;  1BCO A;  4FM2 A;  3NGY A;  3JSM A;  1CLQ A;  4QAG A;  1JL2 A;  4FM1 A;  1S1X A;  3HL8 A;  3QES A;  2ZD1 A;  1LWE A;  4R5P A;  1XHX A;  4PQU A;  1T7P A;  1SUQ A;  1KLM A;  4ZTF A;  4OKK A;  4UQG A;  4C8L A;  1HYS A;  3EYZ A;  4DF8 A;  3AA3 A;  2D0A A;  4FLW A;  4DS5 A;  3OYK A;  2YHA A;  1LV5 A;  3U6F A;  4M42 A;  1C1B A;  3PX6 A;  4KI4 A;  3LWL A;  2OPQ A;  3E01 A;  1FXX A;  3V81 A;  1TKT A;  4I2P A;  4PWD A;  1WSH A;  5EU7 A;  1HJR A;  1RBV A;  3OYD A;  4CJP A;  4LH5 A;  2YHB A;  3ZT1 A;  4Q5V A;  2ZQB A;  1EET A;  3AO2 A;  5J2Q A;  5FDL A;  4DSF A;  4AHU A;  2HNY A;  4CJR A;  4KI6 A;  1IKW A;  1S1V A;  3L2R A;  2ITG A;  3RMC A;  3PUF A;  3KTQ A;  4RW8 A;  4E89 A;  1VSI A;  3VQ7 A;  4DTM A;  1RIL A;  1DTQ A;  4CIG A;  2BDP A;  3S9H A;  4W5T A;  4AHR A;  4CEA A;  1BIS A;  3LAN A;  4CJT A;  3OYJ A;  2XY5 A;  1NJZ A;  1HQU A;  3AA2 A;  4KAZ A;  4DSE A;  4PY5 A;  4H4O A;  3KKR A;  4DU4 A;  5J2N A;  1XC9 A;  4CEF A;  2KZM A;  3OYM A;  4EZ6 A;  4ZTJ A;  4CEO A;  4QOZ B;  4FJK A;  2QK9 A;  2D0C A;  3VQA A;  1VRU A;  2E4L A;  3VQD A;  4B9N A;  2KFZ A;  3AVI A;  2YV0 X;  4KB1 A;  1NJY A;  5C25 A;  3QEP A;  3ZSY A;  4AH9 A;  4OPK A;  1U49 A;  3HYF A;  1TKZ A;  4KTW A;  4CER A;  3KJV A;  4BE0 A;  3QEI A;  2YNG A;  2RN2 A;  4HTU A;  4FJM A;  1EKE A;  3LP0 A;  3ZCM A;  3G10 A;  3ISN C;  5HRS A;  4J2A A;  5JS1 A;  4B9T A;  3DOL A;  1J9A A;  4AHT A;  4ELT A;  3DRP A;  3SQ4 A;  2FBV A;  3IG1 A;  4E7H A;  2F8T A;  1BIU A;  3QEX A;  4HCB A;  4FJ9 A;  4J2E A;  1JLA A;  4ELV A;  1VSF A;  2PYL A;  1NJX A;  3HJF A;  2ETJ A;  3AVN A;  3QLH A;  4QCL A;  3HVR A;  1GOA A;  3M8Q A;  3EZ5 A;  1BHL A;  1NK5 A;  5HBM A;  4DSK A;  4FJJ A;  2I5J A;  1VSM A;  4CFB A;  1WAJ A;  1WSE A;  3MEC A;  4JS4 A;  4ELU A;  3VQ8 A;  2OYQ A;  2QKB A;  3SZ2 A;  3OY9 A;  4Z4G A;  4FCY A;  3DRR A;  4N41 A;  4DSJ A;  2VG7 A;  1RT4 A;  1IKV A;  4CF8 A;  4E19 A;  3OYB A;  4HUG A;  4CJW A;  2HB5 A;  3AVC A;  1BL3 A;  1WSF A;  1HNI A;  4Z4F A;  4DU1 A;  3AVA A;  3AVJ A;  2G8F A;  1DTT A;  4GW6 A;  3TAB A;  1LWF A;  4PA1 A;  3NE6 A;  4FLY A;  4KHU A;  4HVJ A;  3DLG A;  3VN5 A;  1RT7 A;  3QIP A;  3L2Q A;  5J2M A;  1TK8 A;  4IG3 A;  2BGG A;  3D0P A;  1KTQ A;  3MEE A;  3NDK A;  3PO4 A;  1VSE A;  3NBP A;  1CZ9 A;  1NJW A;  4F3O A;  4DLG A;  3QEW A;  2KZZ A;  2HND A;  3KLG A;  4DTX A;  4ZHR A;  3DLK A;  1QS4 A;  4DQR A;  5T7B A;  4B9S A;  3DM2 A;  4Z0U A;  1TV6 A;  3LAM A;  1IKX A;  1BIZ A;  2D5R A;  2VG6 A;  4C8M A;  3VQ9 A;  5C24 A;  4CGH A;  3LP1 A;  5J1E A;  3LPU A;  3CQ8 A;  4NCA A;  3TI0 A;  1FKO A;  4CHP A;  4BE2 A;  2HMI A;  1LW0 A;  4RW7 A;  2O4G A;  4CFC A;  2AJQ A;  5DMR A;  4LSL A;  1X9W A;  3ZSV A;  3LZI A;  4DMN A;  3OYE A;  3PX4 A;  3LAL A;  3ZSX A;  3OJU A;  4NCG A;  4DQQ A;  2QKK A;  4FK2 A;  1WSI A;  4BAC A;  5CYM A;  3M8R A;  3SPY A;  3AVF A;  2OZM A;  1JKH A;  4CJF A;  5HRP A;  4M3Y A;  4B3O A;  4M3T A;  3WNE A;  1VSL A;  3HP6 A;  3TAR A;  4B9U A;  1S9G A;  3QNN A;  1L3S A;  3PO5 A;  1VSD A;  3G0Z A;  3K5L A;  1YT3 A;  5SZT A;  3HT3 A;  3QIN A;  2Y1I A;  1RTJ A;  4F2S A;  2B6A A;  3V1Q A;  2PYJ A;  1L3V A;  4FJ5 A;  3SQ1 A;  1XHZ A;  3SUP A;  4KTZ A;  4IBN A;  2YNH A;  2W42 A;  3K5O A;  3VQQ A;  1RT5 A;  1F21 A;  1JLB A;  2D0B A;  3KKS A;  1D9D A;  2Q3S A;  4CCH A;  3QEV A;  3H08 A;  3LZJ A;  1T05 A;  4J2D A;  3SV3 A;  4FJ7 A;  3DLE A;  3K2P A;  1U45 A;  3VQE A;  4FK4 A;  5HP1 A;  4NYN A;  4B8A B;  3K5N A;  3NGZ A;  1RTI A;  1TVR A;  3LP3 A;  1NOZ A;  1VK0 A;  3LPT A;  4MQ3 A;  1I3A A;  4CGJ A;  3V9X A;  3RRH A;  3RR8 A;  2XY7 A;  1IKY A;  3VQP A;  3ZT2 A;  1FKP A;  4O4G A;  1MU2 A;  3L2U A;  4FK0 A;  1HMV A;  4J2B A;  3P83 D;  4CIE A;  5JS2 A;  4OPJ A;  1EXQ A;  1JLE A;  3QET A;  4DTS A;  2KTQ A;  4K8Z A;  2G8V A;  2HHQ A;  3THV A;  1RBS A;  1FK9 A;  4CGF A;  2IOC A;  4CK2 A;  1S1U A;  3AA5 X;  4RG8 A;  1GOB A;  3VQ5 A;  1TL1 A;  1JXE A;  1KCF A;  2LSN A;  2DFE A;  3DYA A;  3ULD A;  2P5G A;  1JXB A;  4N56 A;  3CFO A;  1X9S A;  4E3S A;  1WAF A;  4N76 A;  1NK0 A;  2B5J A;  4W5N A;  1U47 A;  1QQC A;  3AVB A;  3DLR A;  3QO9 A;  1ASV A;  5KGX A;  4IKF A;  4Z4E A;  1HNV A;  1KVC A;  2IGI A;  4FJX A;  3KD1 E;  4DF4 A;  4FZY A;  4OKE A;  4B9L A;  1NKC A;  1SV5 A;  4FZX C;  4OGC A;  4W5Q A;  4W5O A;  1D9F A;  4XIU A;  4FJH A;  4FLU A;  3CG7 A;  4CEE A;  4NYF A;  4Z4H A;  4LD0 A;  3AO3 A;  1C0T A;  4H4M A;  4GMJ B;  3MAQ A;  3U3Y A;  1UA0 A;  1KFS A;  2XY8 A;  4MFB A;  1T03 A;  4RW4 A;  1NKB A;  1N5Y A;  3VQC A;  1NK8 A;  1A5V A;  4CHO A;  5DK5 A;  2G8K A;  1ASU A;  3P5J A;  1SKS A;  1Q9X A;  2FC0 A;  4CJK A;  4CF1 A;  3LP2 A;  4RW6 A;  5SWM A;  3SQ2 A;  1TK5 A;  2VG5 A;  3CYM A;  1CXU A;  1LAV A;  1REV A;  3WNG A;  3ZSQ A;  2Y1J A;  4JRP A;  4C8O A;  2WOM A;  4ID5 A;  1G15 A;  3TAN A;  4E7K A;  3DLH A;  2XHB A;  4KO0 A;  3LDS A;  3VA3 A;  1W0H A;  1L5U A;  4DQS A;  1DLO A;  1BGX T;  3AA4 A;  3ZSZ A;  4CES A;  1UA1 A;  4I7F A;  4DTP A;  3BGR A;  4FJG A;  2OZS A;  1RBT A;  4ID1 A;  4AHC A;  4CEB A;  5FRM A;  3HST B;  3MXM A;  1KFD A;  4OGE A;  4Z4C A;  4HHT A;  3OS2 A;  2RF2 A;  3PY8 A;  4CJQ A;  4B8C A;  1U4B A;  3WNH A;  4FLT A;  3AVG A;  1ZBF A;  3L3V A;  1RT6 A;  2FBY A;  4FJI A;  3M8P A;  2Z1J A;  3C94 A;  3NHG A;  1CZB A;  4JLH A;  1WSJ A;  3ZT4 A;  3PX0 A;  2G8U A;  4KHY A;  3AO1 A;  5K14 A;  3OYL A;  1HPZ A;  1Y97 A;  1ASW A;  2X74 A;  3NF8 A;  3SI6 A;  1NK4 A;  1HYV A;  3C95 A;  1A5W A;  2KQ2 A;  3KLI A;  3S3M A;  4M3U A;  5C42 A;  4E1M A;  4BE1 A;  1BCM A;  3CFP A;  4M3Z A;  3ALY A;  3U3G A;  1S6P A;  4CED A;  4CHN A;  1SL2 A;  1RTD A;  2ATQ A;  3KIO A;  4KKO A;  1B9D A;  4B9V A;  4IFV A;  1RT2 A;  3CM5 A;  4E7J A;  1SL1 A;  4O0I A;  4GVM A;  3HPH A;  4E1N A;  4CK1 A;  4CEC A;  3TAF A;  1JLF A;  4OLA A;  3EY1 A;  3AO5 A;  4CK3 A;  3AV9 A;  3OYH A;  3OS0 A;  4OJR A;  4DG1 A;  3V9Z A;  1QSS A;  2G8I A;  1Q9Y A;  4DFK A;  4WE1 A;  3OYF A;  1KRP A;  3V1O A;  4IG0 A;  4CE9 A;  1J53 A;  1TAU A;  1B9F A;  5D3G A;  4DQP A;  3SUN A;  2IAJ A;  4FYD A;  3B6P A;  3K58 A;  1WNS A;  3RTV A;  3MXJ A;  4TSX A;  2PZS A;  3T3F A;  4LY7 A;  1U04 A;  4CF2 A;  3SV4 A;  1NKE A;  1Z26 A;  2GBZ A;  4JRQ A;  1C0U A;  3KLF A;  1Z25 A;  4M3X A;  1JLQ A;  3IRX A;  4M3W A;  3RMA A;  4DQI A;  1S9E A;  2DY4 A;  3I0R A;  2BAN A;  3KD5 E;  4CHQ A;  3SNN A;  1IO2 A;  1BQN A;  3AVM A;  4CGG A;  2P1J A;  3OYG A;  1S1W A;  5I42 A;  3JYT A;  1JLC A;  2HW3 A;  3TAQ A;  1HRH A;  3OYN A;  3ZT3 A;  4W5R A;  2KFN A;  3CM6 A;  1GOC A;  3A2F A;  3O3F A;  3HXM A;  4KRF A;  3ZSR A;  2VWK A;  3C6T A;  2BE2 A;  1VSJ A;  4CIF A;  4CJL A;  3OYA A;  4KHQ A;  4Y1D A;  1UAX A;  3NF9 A;  4JS5 A;  4E7L A;  4CGI A;  3PV8 A;  1C6V A;  1LWC A;  4FM0 A;  4I9L A;  5CY4 A;  4M41 A;  3TAG A;  3HO1 A;  4M45 A;  4FVM A;  1LAW A;  5I3U A;  3MXI A;  4DWI A;  2HHT A;  2HHS A;  4CFD A;  2F8S A;  1RNH A;  3TR8 A;  5HRO A;  3IS9 A;  3RRG A;  2F96 A;  3KLE A;  1SL0 A;  2IDO A;  4EZ9 A;  3I0S A;  4Q0B A;  4CJU A;  3NH0 A;  3L2V A;  4HUE A;  4FLV A;  2WON A;  4YNQ A;  4BDZ A;  1JL1 A;  1YTU A;  1WSG A;  1UWB A;  2E6L A;  1X1P A;  4C8K A;  2X6N A;  4KPY A;  5KRT A;  1ITG A;  1VSK A;  4KRE A;  2HHW A;  1CXQ A;  4N5S A;  3OS1 A;  2GUI A;  4O5B A;  3V9U A;  1KLN A;  4BDP A;  1B92 A;  1I39 A;  1NOY A;  1L3U A;  1RDA A;  1HQE A;  4BWM A;  4Y1C A;  1TK0 A;  1QSY A;  2DTU A;  3F73 A;  4CJ4 A;  3UIQ A;  4FJL A;  3SPZ A;  1J54 A;  3ASM A;  4EP5 A;  4KTQ A;  2DFF A;  2DFH A;  2P51 A;  2RPI A;  5CZ2 A;  2OPR A;  1TAQ A;  2QXF A;  3QNO A;  3ZSW A;  1QHT A;  3V9S A;  2O4I A;  4DSL A;  1S6Q A;  3DOK A;  4BWJ A;  3RR7 A;  1D8Y A;  3HK2 A;  1D5A A;  1YTA A;  2YKN A;  1T8E A;  4K8X A;  1EX4 A;  4DFM A;  2GV9 A;  1KVB A;  4OKJ A;  3V9W A;  1IG9 A;  4KHW A;  2X78 A;  3CFR A;  4OVL A;  4DTU A;  3KLH A;  4I2Q A;  3DLB A;  1BI4 B;  4KV8 A;  5CZ1 A;  4F2R A;  1ZBU A;  4G1Q A;  3NAE A;  1VSH A;  3AVK A;  3KK2 A;  3KK3 A;  2JLE A;  3HPG A;  1RTH A;  2YNI A;  3NGI A;  4DFP A;  2A1R A;  1X9M A;  1N6Q A;  4CJ5 A;  3VA0 A;  4F3T A;  3RWU A;  2OPS A;  1TKX A;  3V1R A;  4E0D A;  4FLX A;  4FW1 A;  1VRT A;  2IC3 A;  2ZE2 A;  1XWL A;  2R7Y A;  1K6Y A;  2EHG A;  3D45 A;  3ZT0 A;  4FW2 A;  5HRN A;  2XO7 A;  4F4K A;  3DMJ A;  4CHZ A;  4L8R B;  3NF6 A;  4FJN A;  2IS3 A;  4RW9 A;  3TAM A;  2KW4 A;  4PUO A;  4CEZ A;  1O1W A;  4CJE A;  3TAE A;  3O3G A;  3L8B A;  2YNF A;  3V4I A;  2RKI A;  3AVL A;  1C0M A;  5KRS A;  3NH1 A;  4CF9 A;  3MED A;  3OJS A;  4AIL C;  1S5J A;  2A1S A;  4CEQ A;  4DTO A;  1RDB A;  5FRN A;  1QSL A;  3HVT A;  1QTM A;  4CJV A;  1RCH A;  3SYZ A;  1NK7 A;  3NH2 A;  3QER A;  2OA8 A;  3SQ0 A;  4KB0 A;  3HPO A;  1QE1 A;  1W9H A;  4O55 A;  4B08 A;  4NCB A;  4M3R A;  1NK9 A;  4B9M A;  3OYI A;  4IFY A;  3K57 A;  4BDY A;  1ZBI A;  2HHU A;  4HCC A;  3QIO A;  4CGD A;  4CHY A;  3M8S A;  4FXD A;  5HRR A;  2HHX A;  4AHV A;  1RBU A;  1U48 A;  3ITH A;  4KFB A;  3T19 A;  1IH7 A;  3RMB A;  2E6M A;  1Q8I A;  4E7I A;  2EX3 A;  1TL3 A;  2FBX A;  3L2W A;  4KHS A;  1ZBL A;  2FBT A;  3O3H A;  1LW2 A;  3F9K A;  3SUO A;  4Z4I A;  3VQB A;  4FZZ A;  3VQ6 A;  5KGW A;  4DTR A;  3OVN A;  4KHN A;  4LH4 A;  3RMD A;  4DSI A;  4DU3 A;  1C1C A;  4CJ3 A;  2HNZ A;  2Z1I A;  4YFU A;  3K59 A;  2G8H A;  3LAK A;  1NK6 A;  4HUF A;  1RBR A;  4F8R A;  4C8N A;  4ICL A;  1WN7 A;  3B6O A;  3C6U A;  3HM9 A;  2VWJ A;  4FLZ A;  4DTN A;  3T1A A;  2HVI A;  5HLF A;  4FJ8 A;  3HP9 A;  5KI6 A;  2HVH A;  3NCI A;  2XRI A;  2Z1H A;  1RT3 A;  1XI1 A;  1JLG A;  1L3T A;  3AO4 A;  3SCX A;  2JGU A;  4EP4 A;  4O44 A;  1A5X A;  1BQM A;  3DRS A;  3MEG A;  2OPP A;  2NUB A;  3NF7 A;  1RT1 A;  3O4N A;  4DS4 A;  2P5O A;  3AVH A;  1C1A A;  4OLB A;  3IAY A;  3I8D A;  3SUQ A;  4I9Q A;  1S1T A;  1WLJ A;  3O4Q A;  3WNF A;  2HHV A;  1BI4 A;  1RDD A;  3DI6 A;  4DTJ A;  2B4J A;  3VQ4 A;  1EP4 A;  1SKW A;  2X6S A;  1KVA A;  2Z1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...