5KGXA

Hiv1 catalytic core domain in complex with an inhibitor (2~{s})-2-[3-(3,4-dihydro-2~{h}-chromen-6-yl)-1-methyl-indol-2-yl]-2-[(2-methylpropan-2-yl)oxy]ethanoic acid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
153
structure length
134
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKTAWWAGIKQEESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Indole-based allosteric inhibitors of HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
molecule keywords Integrase
total genus 45
structure length 134
sequence length 153
ec nomenclature
pdb deposition date 2016-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5kgxA00
1BIUA 1WNSA 2LSNA 2B6AA 4CJPA 1T8EA 1IH7A 3OYHA 3V9XA 4OKEA 1CXUA 3VA0A 5DMRA 4ELTA 5C25A 4M3XA 1VSEA 3RMDA 3AVJA 1KLNA 3JYTA 4W5OA 1XC9A 2G8HA 1G15A 1A5XA 3OYCA 4Z4IA 4CJTA 1BHLA 2GBZA 3NF6A 4CJEA 3LAMA 3LP0A 3QERA 1CZBA 2FBXA 3NGZA 2QXFA 4NCBA 1W0HA 4KHWA 3ZT0A 2P1JA 4NYNA 5FRNA 3HP9A 4DU1A 5J2NA 2HNZA 5EU7A 3ZT2A 1NK4A 5JS2A 1DLOA 4CK1A 1RT2A 4N5SA 4OLAA 3QEPA 3NH2A 1IO2A 4M3RA 4HCBA 4KFBA 4GW6A 4KB1A 4FJ8A 2A1SA 3DLKA 3F9KA 1X9WA 4DQPA 1IKVA 5KGWA 5HBMA 1SL2A 2YNHA 4BWJA 3LPUA 3NCIA 3V9UA 1Q8IA 4ZHRA 3SQ2A 3DMJA 1LWCA 4JS4A 3QETA 4B9TA 4DSIA 4KHYA 4W5NA 3SUPA 5SWMA 3QEVA 5FDLA 3MEEA 3HM9A 4BE2A 3S3OA 3AVFA 5FROA 4FLTA 3ISNC 4DTPA 3AVLA 1KRPA 2F8SA 3DRPA 4FJKA 1ZBLA 2YNIA 2KFZA 3L2UA 4B9MA 3UIQA 3DRRA 3OYBA 1R0AA 1ASVA 1KTQA 1LV5A 4K8ZA 4E7HA 3K5LA 3SCXA 2D0AA 3VQ4A 1A5VA 4E7IA 1SKRA 4FJMA 1SUQA 2RF2A 1HPZA 3OYKA 4KTQA 4CEQA 1RT4A 4R5PA 4CEBA 2Z1GA 3CM6A 1Y97A 3DLEA 3OVNA 2D5RA 4CEDA 4CIEA 3O3FA 3TAFA 1J5OA 4HVJA 3ZSWA 5K14A 4M3YA 1C1AA 3OYJA 3P1GA 4DSLA 4DQQA 1RTDA 3K2PA 4FJLA 4DFPA 3K5OA 4KTWA 1CXQA 3QIPA 1KFDA 4H4MA 4H8KA 1X9SA 4ZTFA 4W5RA 5I3UA 2BDPA 4W5QA 3DOLA 4KO0A 3OS1A 1ZYQA 1ZBHA 3HJFA 4CJVA 4ICLA 4I2PA 2E4LA 3AVKA 4KHUA 2YHAA 4KV8A 2PYJA 5D3GA 4BE0A 3SV3A 4E7LA 4RW7A 4CGGA 1QSLA 3DLBA 1JL2A 3NAEA 1SV5A 4DTRA 3AA3A 3L2WA 4CF2A 2R7YA 1BI4B 1LAWA 1D5AA 5C42A 4HUEA 2ITGA 2IAJA 4RW6A 3PV8A 3I0SA 3NF8A 4FJIA 3O4QA 4FW1A 4AHUA 1JXEA 1S9GA 3MEDA 4LH5A 4DTXA 3LDSA 4OJRA 3OY9A 4MFBA 2XHBA 4Z4EA 3A2FA 1UOCA 1EKEA 3KJVA 4CK3A 2W42A 4DFMA 3DLHA 4FK0A 1JXBA 1TVRA 2D0BA 3U3GA 3HPGA 2FBTA 3WNHA 3C94A 4DSEA 1NOZA 3EYZA 4N76A 2KZMA 4AHCA 3IG1A 2O4IA 4QCLA 1JLBA 4C8OA 1QQCA 1S6PA 3OYIA 2GV9A 4CE9A 3KK1A 2VG6A 1T05A 2QK9A 4L8RB 1RT5A 4CGDA 2G8VA 3L3UA 3TABA 3HT3A 4CFDA 3OYGA 3MXIA 4CEEA 1TK5A 3HYFA 4FW2A 4QOZB 4CHQA 1RNHA 1VSFA 3P5JA 3AVIA 3L8BA 3CFRA 3T3FA 1C6VA 1JLCA 4OKKA 4CF9A 4FZYA 3V81A 1S1TA 1B9DA 3VQ8A 1S5JA 4FJ9A 3THVA 3ZT4A 2VWKA 4DLEA 4AHTA 4DQSA 1U47A 1TKDA 1WSHA 3SQ1A 1Q9XA 2P5OA 1K6YA 5FRMA 3TWHA 4CERA 3L2QA 1TK8A 5CYMA 3V9WA 1L3SA 4FM0A 4LH4A 3EY1A 3VQBA 4CJFA 4E0DA 1RDBA 4CJ4A 4FJNA 4FYDA 3SUNA 1HMVA 3DI6A 4CHPA 5I42A 3QEIA 4AILC 2X78A 1VSLA 2FBVA 1D9FA 4N41A 4KI4A 3V1RA 3RRGA 3LANA 3AVHA 4CEFA 4IFYA 2AJQA 3QEXA 3G10A 1J9AA 5J2QA 1IKYA 3C6UA 3NBPA 2Y1JA 1S1UA 4E1NA 4Q5VA 4DLGA 4KREA 4KRFA 2HHUA 2E6LA 4DFJA 1U48A 2YNGA 1NK5A 1MU2A 1TV6A 2Y1IA 4DS5A 5HRRA 3B6OA 4O4GA 3NF9A 3SUOA 2G8KA 1NJYA 4NYFA 1NK6A 4M3ZA 1J54A 1LAVA 4BDPA 2OZSA 2G8WA 2QKBA 5E41A 2HHWA 1D9DA 4EZ9A 3PY8A 4E7JA 4IKFA 3VQCA 4DQIA 4CJSA 2KFNA 1KVBA 2XY8A 3NDKA 4F4KA 5KI6A 4O44A 4CIGA 4BDYA 2HMIA 2IS3A 4KKOA 1WSEA 4JLHA 4I7FA 3AO3A 4Y1CA 4W5TA 3LZIA 2DFEA 4FM1A 3S3NA 1YTUA 4E19A 4N56A 3SI6A 4KAZA 3SNNA 4JRPA 1XHZA 3KLFA 4CF0A 3SPYA 3TARA 4CJQA 1T03A 4CCHA 1NKEA 4B9NA 3QEWA 4RW4A 1W9HA 4F3TA 4CGIA 2YHBA 1RBSA 3AVGA 1TKXA 4LD0A 3FFIA 2X74A 2KW4A 3M8SA 1RT1A 2BANA 4CIFA 1RTHA 1NKBA 4G1QA 2A1RA 1S1XA 3QNNA 4CJUA 3WNFA 1VSKA 1YTAA 4CGFA 4Q0BA 3LALA 4RG8A 2F8TA 1FK9A 2XY7A 1KLMA 1JL1A 3NH0A 4CJRA 2IDOA 1U49A 4B9VA 3K59A 1LW2A 1TAUA 4K8XA 3V1OA 2KTQA 3QNOA 1WSIA 3V9ZA 4C8NA 1HNIA 1XWLA 1QTMA 1HYZA 4CFCA 2PZSA 5HRPA 1QSSA 1HQEA 4YNQA 1N6QA 4FLWA 3LP2A 2D0CA 2VG7A 3AA4A 1NK9A 1KFSA 3NE6A 4CEAA 4J2DA 1WAFA 3V6DA 4I9QA 1QHTA 2XY6A 4FK4A 4DSKA 1I39A 1ASUA 4BDZA 4BWMA 3WNGA 3RMBA 4Z4CA 1BISA 3OJUA 3ZSYA 3HL8A 3H08A 4I2QA 3AO5A 4LSNA 4KPYA 3CM5A 2HVHA 4E1MA 1HJRA 4C8MA 4HUGA 3ITHA 4JRQA 4FJ5A 3DLGA 3LAKA 2EHGA 3OYMA 3V4IA 3PUFA 4FZZA 3NH1A 4FJXA 1GOAA 1A5WA 1EP4A 3QO9A 3VQ7A 4MQ3A 3RRHA 1KVCA 2DFHA 5HROA 4CF8A 2EX3A 4OPJA 1B9FA 2HB5A 3JSMA 3LP1A 1C1CA 3SQ0A 3D0PA 2XY5A 1KSPA 2YNFA 3PO4A 4EP4A 3VQEA 1JKHA 4BE1A 4LSLA 5HRNA 2ZE2A 3ULDA 3PX6A 4FJJA 4KHNA 2GUIA 4IFVA 1L5UA 1U45A 1O1WA 2YV0X 3DOKA 3TR8A 2B5JA 4CK2A 1NOYA 2P5GA 4B9SA 1S1VA 4CHOA 4C8LA 4AHSA 1IKWA 1RT6A 3TANA 3K57A 2KZZA 5KGXA 3SZ2A 1WSGA 4CHYA 4N47A 4O0IA 2PYLA 4HTUA 1RCHA 1RT3A 3M8PA 1ZBUA 2OPRA 3ZSRA 4PUOA 1CLQA 2VWJA 4DTMA 4GVMA 1RT7A 1WLJA 3AO2A 2KQ2A 1DTQA 1S6QA 3MECA 2HNYA 4CJ5A 4CHNA 3D45A 1UAXA 1Z25A 4HUFA 1NKCA 4Z4HA 1IKXA 3TAQA 4Z0UA 3OYLA 1VSMA 4FLZA 3KTQA 5KTQA 4KB0A 4Z4FA 4DQRA 1X1PA 5CZ2A 3PX0A 3RMCA 3OYAA 3E01A 1SKSA 1SKWA 3QLHA 1IG9A 1VSJA 2IOCA 4B8CA 3TAGA 1RILA 1D8YA 3KKSA 4F8RA 1Z26A 3V1QA 1YVUA 1EX4A 3ZSZA 3VN5A 3ASMA 3VQAA 3S3MA 4E89A 4M45A 5KRSA 3C6TA 5HLFA 1WN7A 1L3TA 1F21A 3KLHA 3BDPA 4DTOA 1GOBA 3AA5X 4BACA 3SPZA 3K5NA 3HVRA 2HHXA 5J1EA 3KD5E 3LWLA 4DTJA 2WONA 2O4GA 3ZCMA 1RTIA 4FZXC 4CESA 1RTJA 1VSIA 4FJ7A 4B9LA 1BCOA 4TSXA 1VRUA 5CYQA 1TKZA 4CHZA 1FKOA 3I8DA 4DTUA 2OZMA 1NK0A 4DSJA 3HO1A 4HCCA 2X6NA 4PWDA 3EZ5A 5DK5A 4CJLA 2OYQA 3OS2A 1UA1A 1RBTA 1TAQA 4AHVA 3KK2A 4DF8A 4ZTJA 1NJZA 4F3OA 3M8QA 2X6SA 2OPQA 1KCFA 3BGRA 4QAGA 3KLGA 3MXJA 4CFAA 4OPKA 1VSHA 3SV4A 1XHXA 4OKJA 3M8RA 4O55A 1S1WA 3KD1E 1L3UA 3RTVA 4M3TA 4YFUA 4JS5A 3NGIA 1LWEA 2P51A 1ZBFA 3P83D 3F73A 1U4BA 1HYVA 2Z1HA 3ZSVA 2ZQBA 4B9UA 1TKTA 2BGGA 3LPTA 3K5MA 1HYSA 2DFFA 3VQQA 2HNDA 2ATQA 2YKMA 1QS4A 3QIOA 3HP6A 1HNVA 4KHQA 4PQUA 4M42A 2NUBA 3ZSQA 1WAJA 3OJSA 4FJGA 3VQDA 1SL0A 4CGHA 3IAYA 4DSFA 1TK0A 4J2EA 4CJKA 1RBVA 4M41A 4FM2A 4FLVA 1TL3A 3L3VA 5HP1A 4DTNA 3AA2A 2HHVA 2Q3SA 3RR8A 3T1AA 4C8KA 4I9LA 2ZD1A 1RBUA 4H4OA 3DRSA 1HRHA 1NJXA 3T19A 3LZJA 3HK2A 3KIOA 1N5YA 3QESA 2PY5A 2DTUA 1WSJA 3G0ZA 4OVLA 4OGEA 2IC3A 1JLQA 1VRTA 2HVIA 1RDDA 2RKIA 2XRIA 3IS9A 1UWBA 3C95A 4CGJA 1BQNA 3VQ6A 1JLAA 5HRSA 4KTZA 1REVA 1BQMA 3AVAA 1FKPA 3PO5A 1JLGA 1BGXT 3TAMA 1BCMA 4B8AB 2HW3A 3CFOA 3MAQA 2G8IA 2OA8A 3KKRA 4CEOA 2ETJA 1KVAA 2Z1JA 3OYEA 3S9HA 3PX4A 3RMAA 2HHQA 3O4NA 1FXXA 3AVMA 1RDAA 3WNEA 4J2AA 3OYFA 4LY7A 4NCGA 1C0UA 3NFAA 3CQ8A 4FLYA 3IRXA 5KRTA 3CG7A 3O3HA 3SJJA 4OLBA 3V9SA 1LWFA 1TGOA 3KLIA 2XO7A 1XI1A 4IDKA 1NK8A 4CJ3A 4RW8A 3HPOA 4J2BA 1ZBIA 4FVMA 3VA3A 3RWUA 4FJHA 3TI0A 4CJWA 5CY4A 4M3WA 2I5JA 2B4JA 3DM2A 3SQ4A 1X9MA 1BL3A 4KHSA 3SUQA 1Q9YA 1SL1A 4DF4A 3O3GA 2DY4A 3NGYA 1BIZA 4IG3A 3AO1A 5J2MA 4CFBA 3U6FA 3B6PA 3VQ9A 1NK7A 4F2RA 4CF1A 1HQUA 4FLUA 3ALYA 3MXMA 4FK2A 4DWIA 4DU4A 4IG0A 2VG5A 3L2VA 4B08A 1U04A 1S9EA 3AVBA 3HSTB 3OYDA 3TAPA 1JLFA 4RW9A 3LWMA 3U3YA 4CEZA 4KI6A 4B3OA 3ZSXA 1B92A 3HPHA 3RR7A 4ELVA 4GMJB 3I0RA 1RBRA 5CZ1A 3LP3A 3VQPA 1CZ9A 4O5BA 4NCAA 1VSDA 3OYNA 1TL1A 3HVTA 4DG1A 3NHGA 4FLXA 1UA0A 1QSYA 2JLEA 1YT3A 2F96A 4FCYA 2IGIA 2G8UA 4XIUA 4DU3A 3TAEA 1QE1A 1BI4A 4FXDA 3ZT1A 4O0JA 3ZSOA 1EETA 2YKNA 4AH9A 5C24A 4PA1A 4HHTA 4AHRA 4DS4A 2OPSA 1L3VA 2QKKA 4ID5A 3NF7A 1NJWA 4IBNA 1VK0A 4E3SA 3OS0A 5JS1A 3ZT3A 4E7KA 4EZ6A 3KK3A 2FC0A 3CYMA 2RPIA 5T7BA 2WOMA 1I3AA 4DTSA 2RN2A 5J2PA 1ITGA 4PY5A 3AVNA 1RDCA 3K58A 4DFKA 1GOCA 4F2SA 4M3UA 4ELUA 2OPPA 1EXQA 1T7PA 2BE2A 1DTTA 3DYAA 5SZTA 4CECA 1ASWA 3QINA 4EP5A 4Z4GA 4OGCA 1J53A 3MEGA 3CFPA 4Y1DA 1LW0A 2JGUA 3AO4A 4UQGA 1WSFA 3KLEA 1JLEA 2HHTA 2HHSA 1C0MA 1C0TA 3AV9A 3AVCA 4DMNA 3SYZA 3L2RA 2FBYA 3HXMA 3VQ5A 2E6MA 4ID1A 1C1BA 3DLRA 4WE1A 2G8FA 2Z1IA
chains in the Genus database with same CATH superfamily
2LSNA 3JAMO 4O5FA 2ZM6K 1VSEA 4BR5A 1YUWA 3RMDA 3JYTA 1EWQA 2JWLA 3CIPA 3CCQN 2G8HA 4CJTA 1BHLA 1YIJN 4JI3K 4B3TK 1XUPO 2A41A 4NCBA 1NGIA 3CCVN 2HNZA 4CK1A 1VQ4N 4M3RA 4KFBA 4AM7A 4FJ8A 2A1SA 3A5MC 1HR0K 3E9OA 1OH8A 4DQPA 5KGWA 5DM6L 3SQ2A 4JS4A 3DJCA 3WXMB 2V7YA 3MEEA 4FPBA 3HM9A 3BZKA 4FLTA 4DTPA 2F8SA 5M1OA 4IO9L 3DRPA 4ISFA 4FJKA 3DXKB 3BF1A 2KFZA 3UIQA 2HBJA 3DRRA 5ELZA 3OYBA 3OW2M 3VQ4A 3WEEA 1IV0A 3ZEUA 4KTQA 2KLAA 2IVPA 4CEBA 1Y97A 1J5OA 4HVJA 1SAZA 3ZETA 3O80A 5TKYA 3K2PA 4A59A 4FJLA 1GLCG 2NRTA 3H3NO 5GAGP 3ATUA 3QBWA 4CJVA 4ICLA 2E4LA 3AVKA 1YJNN 3KHYA 2YHAA 4E7LA 4DR4K 2PBDA 3CXCM 3EO3A 5M1PA 2R7YA 4HUEA 4RW6A 3O4QA 4IOXA 4FWRA 4DTXA 4BG8A 3OY9A 1UOCA 1NBWA 1EKEA 4CK3A 2W42A 1NGHA 4JI1K 1JXBA 2YHWA 3U3GA 3MCAB 2WTUA 2OTLN 4XH4A 4IJNA 4N76A 2KZMA 3RSEA 2OTJN 1S3XA 1QQCA 1V4SA 1HNWK 3OYIA 2GV9A 2VG6A 3ZX3A 3TABA 3ZYYX 4QS7A 3MXIA 3HYFA 3SBTA 4FW2A 3T3FA 4LF7K 4FZYA 1QQNA 3THVA 1N36K 2A3ZA 2VWKA 5MLCQ 4DLEA 4DQSA 1TKDA 2P5OA 5AFUA 5BN9A 1QZ6A 5HOOA 2Q1NA 3VQBA 4H5WA 1RDBA 4FJNA 1VQLN 4JKCA 4U67L 2FLOA 4CHPA 2FF3B 5CHIA 3QBXA 1VSLA 4OPHA 5FPMA 5LMUK 1NG9A 3QEXA 3ID8A 1IKYA 4KREA 4XH5A 3SMPA 2Y1JA 4DLGA 4KRFA 3L6QA 4PHTX 2HHUA 5GAHP 1U48A 3IKMA 1NK5A 1VQKN 1MU2A 3SAFA 4DS5A 3NF9A 5AFUH 1QZ5A 4NYFA 1J54A 4DV3K 2OZSA 1GLDG 4EZ9A 3PY8A 3GBTA 3QFUA 4BDYA 4CIGA 4CZEA 1HJOA 4W5TA 4H0VB 4OX9K 3SI6A 5LL6Z 4WCEL 3SNNA 1XHZA 3TARA 4CCHA 1NKEA 1TYQB 4IOCL 2AA4A 3UKUB 4F3TA 2YHBA 2KW4A 2X74A 4WYBA 1RT1A 4OPAA 1BWFO 4PKIA 1VSKA 4Q0BA 2O8FA 2F8TA 1FK9A 3K9KA 4EFHA 3NH0A 4G9ZA 5KQDA 3V1OA 2KTQA 3QNOA 5AZIA 1HYZA 3MWTA 4FSVA 3CCSN 3TTCA 4FLWA 3J7YP 3MN7A 2D0CA 2NRXA 4DUYK 4NB4A 5BPMA 1NK9A 3CCMN 4I9QA 1QHTA 1HLUA 4E1JA 1U2VB 2V51B 3LM9A 3ZSYA 3HL8A 3AO5A 1C0GA 3HOTA 2E1ZA 5JICA 4C8MA 3CETA 1TUYA 3EE9A 4FJ5A 3OYMA 1VQNN 1A5WA 3VTHA 3VQ7A 4JHDB 4B9QA 2EX3A 1B9FA 3LP1A 4DV2K 4MDAA 2YNFA 5B8HA 5HRNA 3FFKB 3M3ZA 3D2EA 4CK2A 3UKRB 3AARA 1RDUA 3O08A 3VTIA 1RT6A 3QMLA 3K57A 2VGNA 1M1KO 1D4XA 1WSGA 1RT3A 2OPRA 1NM1A 1RFQA 4GVMA 1WLJA 2BUPA 4CHNA 1NKCA 4Z4HA 4A62A 3QB0A 4FWLA 4Z0UA 1VSMA 3AAPA 4Z4FA 1BUPA 4DQ8A 3VGLA 5DM7L 2E88A 1SKSA 1IBKK 3BEXA 3KKSA 1YVUA 5KPZA 2NLXA 2ZGYA 5HLFA 1F21A 2VGMA 4QS8A 1IG8A 4K41A 3LWLA 2P9LB 4FZXC 4TSXA 1TKZA 4CHZA 2X6NA 4PWDA 3EZ5A 1UA1A 5ADXH 1MWMA 4AHVA 3CCJN 4IEIA 1YVNA 3SV4A 4CFAA 4Y0WA 2P9NB 3WUHA 4O55A 3ATVA 2GWJA 3NGIA 4JKDA 3F73A 3ZX0A 5BPNA 1CZAN 3ZSVA 3LPTA 3EE8A 2DFFA 2RE2A 3LM2A 2YKMA 3QIOA 4PQUA 4WFAL 2NUBA 3ID6A 3OJSA 4GKKK 1SL0A 3IAYA 3LDOA 4YOYA 4GV6A 4A57A 1RBVA 3CCLN 4F9OA 3RR8A 2D0OA 4I9LA 5LMNK 3DRSA 1IJJA 4J8FA 3SK3A 3LZJA 1N5YA 5LJVA 1JLQA 4AQYK 1BU6O 3CC7N 1VRTA 3H1QA 1RDDA 3CCEN 1LCUA 5EY4A 3QFPA 3IS9A 4CGJA 3O8MA 4DUZK 1BQMA 3AVAA 3PO5A 2HW3A 4YOWA 1MA9B 3MAQA 2QWNA 2OA8A 3OYEA 1KVAA 4KH6A 4NXMK 3PX4A 5BREA 2YCHA 3WNEA 4J2AA 1DKGD 3OYFA 2VQEK 5A2QO 2QWMA 4I6MB 5JLFA 3THWB 3V9SA 1NK8A 4RW8A 2WUSA 4EAHD 4JEPA 2I5JA 2QWOA 3G71N 3NVMA 3WEEB 3ENHA 1SL1A 4YOVA 4CI6A 4IG3A 3AO1A 3VEZA 1ZBSA 4CD1A 3B6PA 2P9UA 5J2MA 4FLUA 4DWIA 4IG0A 4B1WB 4I6MA 1U04A 5LY3A 3TAPA 1U6ZA 4JYAK 1JLFA 1Z6RA 4GVEA 3LWMA 4CEZA 3U3YA 4KI6A 1B92A 4BQLA 3CJ7A 1RBRA 4DV0K 3VQPA 1CZ9A 3OYNA 3HVTA 1UA0A 3NHGA 2UUCK 1YT3A 2F96A 4XIUA 4DU3A 1QE1A 3P38A 4DR7K 4CZLA 2YKNA 4DS4A 4HHTA 4YORA 3PIPL 1GLAG 5AQYA 4ID5A 4IBNA 2OCEA 1VK0A 3H46O 1G99A 5JS1A 4JKEA 3KK3A 2NRZA 4BGAA 2YX6A 4RWTA 1RDCA 3K58A 4F2SA 2ZGZA 4ELUA 5EVZA 3ULEB 1VQON 1DTTA 4JD2B 4DCHA 1J53A 1Q86O 3CFPA 1BA0A 2NRHA 4Y1DA 3AO4A 3KLEA 2Q31A 2UXCK 3P31A 1C0MA 2HHSA 2J4RA 3VQ5A 4ID1A 1BIUA 4CJPA 4BVPA 1DT9A 3OYHA 4NLBA 4OKEA 1CXUA 2GWKA 1Q82O 4CJ7A 3H3OB 1XC9A 3SLCA 3UE5A 1A5XA 3A5LC 3LAMA 5AQIA 2FBXA 2QXFA 1YITN 3ZT0A 2P1JA 3KWGA 5FRNA 3HP9A 1NK4A 5EU7A 3ZT2A 2QW9A 1NGDA 1IO2A 4R79A 2F4VK 1IKVA 5HBMA 3SMSA 2YNHA 4JI0K 1HNZK 1Q8IA 3OBWA 3DMJA 4KHYA 3SUPA 3QEVA 4JKBA 1KRPA 1ZBLA 1IBMK 4B9MA 5AQFA 4MO4A 1P90A 1LV5A 2O8BA 4KHPK 2RF2A 5FPNA 1RT4A 4CEDA 2D5RA 4CIEA 1C1AA 4MLHA 2HBMA 3P1GA 5GADP 4JN4A 2HSTA 4DFPA 2YHXA 1CXQA 4H4MA 2FSNA 3OS1A 1OVQA 1ZBHA 4C1NI 3G4SN 1XC3A 4KHUA 3VMFB 2PYJA 2GEMA 5C15A 1QSLA 4RW7A 4MO5A 3NAEA 4K25A 1SV5A 4DTRA 5AQNA 4BRCA 2ITGA 3JS6A 3I0SA 1NWKA 3BUZB 4AHUA 3CQYA 4OJRA 4Z4EA 1I94K 3I33A 4O8UA 1J5EK 3DLHA 4FK0A 3M6GA 1TVRA 3MDQA 1T6DA 3HPGA 5GAEP 3FLCO 4M7YA 4FPAA 4C8OA 2O8EA 1T05A 2YHYA 4GV9A 2QK9A 2G8VA 3VGKA 3HT3A 4CFDA 3THXA 3O6WA 4GKJK 4QOZB 4CHQA 3CFRA 3AVIA 4OKKA 4CF9A 2HOEA 2HF4A 3VQ8A 1S5JA 2FF6A 3F9MA 3LDPA 3J7AP 1WSHA 2GX9A 3HOSA 4K0KK 4CERA 3L2QA 1TK8A 5CYMA 3I8BA 1VQMN 1XMOK 3SBGA 3O5BA 3SUNA 5KPRA 3DI6A 3Q7BA 5AR0A 3KVGA 2X78A 3V1RA 3LANA 2JWKA 5BRHA 1J9AA 5J2QA 4IWVA 1S1UA 3HI0A 1XQSC 3FZHA 2E6LA 2GUPA 4BVOA 4FWKA 1M90O 4M3ZA 4B1XB 4E7JA 1KXPA 4CJSA 3Q7CA 2XY8A 4F4KA 4BRGA 2HMIA 3H1VX 1WSEA 4JLHA 4I7FA 3AO3A 4N56A 1K9MO 4KAZA 3VERA 5AQXA 5EXWA 4CJQA 5AQVA 2UU9K 3P4IA 4IJAA 1W9HA 4BG9A 1RBSA 3AVGA 4LD0A 2QWPA 3FFIA 4G1QA 2E1YA 1W7AA 4JI5K 4JKGA 1Q81O 3WNFA 3LALA 3CMEN 3F5TA 1C0FA 2O8FB 4B9VA 3K59A 4YDUC 1GLJO 4NXNK 1HNIA 4CFCA 2VWBA 5KPTA 1QSSA 4YNQA 1N6QA 3LP2A 1QQMA 4BR0A 3J80O 3NE6A 1WAFA 4B3SK 2V7ZA 1I39A 3WNGA 1U2VA 4HTLA 4JI4K 4LSNA 2HVHA 4CZHA 3ITHA 5AQOA 4FZZA 1GOAA 1SS6A 4BRNA 4MQ3A 4JI8K 4CF8A 4BRPA 3D2FB 3JSMA 1YJ9N 3PO4A 3VF4A 4EP4A 1XNRK 3LL3A 3PX6A 2KHOA 3DOKA 4B9SA 4C8LA 4A2AA 3THYB 1DEJA 1IKWA 3VEYA 1KAXA 3SZ2A 4N47A 2FXUA 1HX1A 3MCPA 2PYLA 1RCHA 3O1WA 4PUOA 1CLQA 2ASPA 2VWJA 2VQFK 4CD3A 1RT7A 3R9PA 2KQ2A 4DR6K 2UUBK 3D45A 1Z25A 4FVUA 3BZCA 5KTQA 1KD1O 4KB0A 2GTDA 1OKJA 4JV5K 5CZ2A 2A6AA 3RMCA 4WQ4C 3ZX2A 3QLHA 3D6RA 2V52B 3TAGA 3T7ZA 4CZGA 1ATRA 2PFUA 2Q0UA 4K43A 3V1QA 3I56N 3ASMA 3VQAA 4M45A 3J81O 3C6TA 4ISEA 1L3TA 4A5BA 4DTOA 5C0YA 4BACA 1BDGA 2HHXA 4DTJA 4KH5A 2O4GA 1RTIA 4CESA 1NGAA 1BCOA 3I8DA 4FOIA 1HKGA 1NJZA 4ZTJA 3MN5A 3M8QA 3GL1A 2OPQA 1KCFA 3BGRA 3C7NA 3HBTA 3KLGA 3MXJA 4OPKA 1XHXA 3M8RA 5AQZA 1S1WA 3KD1E 1L3UA 4PKGA 1U4BA 1ZBFA 2ZQBA 4BRFA 4B9UA 3HP6A 2PAVA 1HNVA 1BG3A 4EHTA 3KK7A 1N34K 4QS9A 4DSFA 4CJKA 4M41A 4FLVA 4IOAL 4DTNA 3AA2A 4JAXA 4O8KA 2ZD1A 4H4OA 2RHKA 3C65A 1HRHA 1NJXA 4BRIA 3HK2A 3QESA 4C23A 4OVLA 4OGEA 3TU5A 4BRMA 2P9SB 2I7PA 5JMVA 4BR9A 1BQNA 4LF6K 4KTZA 1FKPA 5BN8A 3TAMA 1BCMA 2G8IA 3KKRA 3S9HA 3O4NA 3K9JA 1C0UA 3R1XA 5KRTA 3CG7A 2ASMA 3O3HA 4LF8K 1LWFA 1TGOA 4ILGB 1NMNA 5FPEA 3THWA 1XI1A 3NVKA 1ZBIA 4M3WA 3VA3A 3RWUA 2DPNA 3DM2A 3SQ4A 3SUQA 1Q9YA 3DXKA 1GLEG 4DF4A 3NGYA 4DV7K 1BIZA 2A5XA 4CFBA 3U6FA 5H1SQ 4F2RA 3MXMA 3L0QA 4DU4A 1QQOA 4IO8A 3P39A 3A0IX 4YOTA 1FJGK 4GY2B 3RR7A 2P9KA 4ELVA 3I0RA 4DKWA 4NCAA 3SAGA 5LJWA 3L4QA 4BRHA 3TAEA 4LF4K 4BRAA 1BOTO 4O0JA 4AH9A 5C24A 4PA1A 1JCGA 4E3SA 3OS0A 4K42A 4B1YB 4DTSA 2WOMA 2YI1A 1ITGA 1GOCA 1T6CA 2WBNA 1T7PA 2BE2A 3DYAA 3CPEA 3ULEA 4Z4GA 2Q97A 4UQGA 2JGUA 1WSFA 4BRDA 4M63C 4CVNE 1WOQA 3BF3A 4DMNA 5FPDA 2Q2RA 4FWOA 1WNSA 3FGUA 2B6AA 3A5OC 3CHWA 1T8EA 3R6MA 2P9IB 5C25A 1G15A 2VCPA 4Z4IA 3UKRA 2O8EB 3LP0A 1W97L 3QERA 4NYNA 5KQ8A 5J2NA 4PL7A 4ISGA 4N5SA 5GIOA 1RT2A 3CJ9A 3NH2A 4KB1A 4GW6A 3DLKA 3F9KA 2CGKA 5AZJA 2BH1A 1SL2A 4BWJA 3LPUA 3V9UA 1YHQN 4W5NA 1LWCA 3QETA 5SWMA 3AVFA 5FROA 3AVLA 1QHAA 3FZKA 5C12A 2YNIA 3L2UA 5F0XA 2ITMA 4CBWA 1A5VA 3OYKA 4R5PA 3CM6A 3DLEA 3OVNA 4L3QA 5K14A 5AZJB 3VEVA 1S22A 3OYJA 3C6HA 2GELA 4DQQA 1RTDA 3EKSA 2QEXN 1KFDA 4FWMA 1X9SA 4CZIA 4W5RA 5I3UA 2P9LA 4W5QA 2QTDA 3HJFA 4I2PA 4JKGB 5EX5A 3DLBA 1WUAA 2QA4N 4FL9A 1LAWA 3CQXA 3I55N 2NRVA 4FJIA 4FW1A 2A42A 1JXEA 1S9GA 4LH5A 1NNEA 3LDSA 2XHBA 4MFBA 3CC2N 3CMAN 3W3DA 1ATNA 2FSJA 3HZ6A 3ENOA 3HRGA 3G6EN 2D0BA 3WNHA 2FBTA 3C94A 1NOZA 4BC3A 3KWIA 4QCLA 1JLBA 4LC9B 3AGRA 1S6PA 4FWQA 3KK1A 3H45C 4LFAK 3C0BA 4L8RB 4CGDA 2E2OA 5E26A 1BA1A 3N4PA 1TK5A 5AQGA 3P5JA 4AHTA 1NGGA 1U47A 2E2PA 3VENA 1Q9XA 1K6YA 5JVHL 3AAQA 5FRMA 3V9WA 4LH4A 3EY1A 4CJFA 2IIRA 4E0DA 3HSCA 3WT0A 1HMVA 4A61A 5BR8K 5I42A 4AILC 3VEWA 4A2BA 1D9FA 2FBVA 1Y64A 4N41A 4KI4A 4CW7B 3RRGA 4CEFA 4IFYA 3C6UA 4Q5VA 3IUCA 4BRKA 4DFJA 2YNGA 1TV6A 5HRRA 2WC9A 3SUOA 2G8KA 4BGBA 1O13A 4BDPA 2QKBA 5E41A 2HHWA 1D9DA 4IKFA 1IBLK 3MWPA 1X3NA 2KFNA 1KVBA 4H5RA 3NDKA 3AGKA 1K8KB 4JKAA 1EO1A 4O44A 4KKOA 4CBXA 1QVGM 4E19A 4JRPA 3MMVA 4FOEA 4CF0A 3KLFA 3SPYA 4BR7A 1T03A 2EWSA 4RW4A 3LDQA 2KKZA 4FO0A 1HNXK 1TKXA 1RTHA 1NKBA 2A1RA 5BRDA 5EOYA 5TKWA 1JL1A 3PIOL 4H5VA 3F2KA 2P9PA 1WSIA 4C8NA 1XWLA 5HRPA 1N32K 1NLVA 1VAZA 4AM6A 2VG7A 3AA4A 1KFSA 3VESA 1ASUA 3M1FA 4BWMA 3RMBA 1Q7YO 4JI7K 2O8CA 5AQUA 4Z4CA 3PLAA 1BISA 2CH5A 3H08A 4I2QA 4KPYA 1HJRA 4DR3K 4WQ5C 4JRQA 3V4IA 5JLHA 3PUFA 4FJXA 1EP4A 3QO9A 3R3LA 1ZXOA 2DFHA 4EHUA 2W40A 2HB5A 1C1CA 2CGJA 2XY5A 1KSPA 2WFBA 1JKHA 3ULDA 3FZFA 2QI2A 1L5UA 1O1WA 2YV0X 3TR8A 2P5GA 3TSUA 4AHSA 2KZZA 5KGXA 3EKUA 4CHYA 3THYA 4O0IA 1Z05A 5M1QA 4HTUA 3ZSRA 2W6KA 4DR2K 4DTMA 1Q18A 1VQ7N 1ESVA 2P9SA 3AO2A 1S6QA 2QWRA 4CJ5A 1UAXA 4HUFA 1K8AO 3TAQA 3OYLA 3KTQA 3FE1A 5AJ3K 1X1PA 3GG4A 1IG9A 5M1KA 1WBDA 2IOCA 4B8CA 4KBOA 3U8XA 4BREA 1D8YA 3ZSZA 3VN5A 5FLXO 2P9UB 4E89A 3WXLA 4C1NK 3BDPA 3AA5X 3K5NA 3UKUA 3HVRA 4YDUA 4XH1A 4B3MK 4JKHA 1NGCA 2WONA 3ZCMA 4LFCK 1RTJA 1VSIA 5ADXA 1E4FT 1VRUA 5CYQA 4DTUA 1FW6A 4DSJA 4DB3A 1NK0A 3HO1A 3O9SA 5DK5A 1VQ6N 4F3OA 4DF8A 2X6SA 2YJEA 1JJ2M 4ILHA 3THXB 3N4QA 4M3TA 3RTVA 3TPQA 4JK7A 4JS5A 3FZLA 1LWEA 3P83D 2Z1HA 1OVYA 3D7EO 2BGGA 1HYSA 1YI2N 1QS4A 1E3MA 1WAJA 3RSEB 3WXIA 2OANA 4CZJA 2HHVA 3VF2A 4BC4A 5M1NA 4DV1K 2I7NA 3DXMB 3T1HK 3CCRN 2ZWHA 2HVIA 2RKIA 1MDUB 3OBYA 2A40A 1UWBA 3C95A 3MK6A 5HRSA 4FWPA 1REVA 4HWIA 4B8AB 5AQHA 5BRFA 3RMAA 3DXMA 1N8RO 1MWKA 4LY7A 4NCGA 3NFAA 3CQ8A 1EWRA 4FLYA 3IRXA 2NZTA 4OLBA 4LF9K 3KLIA 4IDKA 3OTOK 4FVMA 3TI0A 4CJWA 2ASOA 2E2NA 2B4JA 4IZ9A 5AQMA 3CCUN 1BL3A 4H0OA 4CZKA 1HKBA 1GLBG 3WXKA 1NK7A 5AQWA 1QVFM 4CF1A 1HQUA 2ZJQL 4H5TA 4FK2A 2VG5A 4H03B 4M7XA 3CJAA 1YAGA 1NMDA 1S9EA 3AVBA 4RW9A 1W2BM 3ZSXA 3SJHA 3HPHA 4GMJB 2NRWA 3BY5A 2HMPA 4O5BA 1VSDA 1T44A 3EN9A 3JXUA 4FCYA 2D1KA 4AF1A 3WQTA 1GLFO 1EETA 3CJBA 4AHRA 4Z94A 2OPSA 4BC5A 2QKKA 1EQYA 2IVNA 3TTFA 4IXCA 4E7KA 4EZ6A 2FC0A 2RPIA 3CYMA 4B1ZA 5T7BA 1I3AA 4WFNL 5J2PA 4PY5A 5I9EB 3LDLA 3D2FA 4DFKA 4YHHK 5SZTA 3BP8A 4CECA 3J8AA 3QINA 4EP5A 4JK9A 1JLEA 2BTFA 1RGIA 1SQKA 3AV9A 3AVCA 3SYZA 4X64K 2O8DB 3L2RA 2FBYA 4KH4A 3HXMA 1VQ9N 1HYVA 1HPMA 2G8FA 2Z1IA 3V6DA 3T1YK 1IH7A 3PSIA 3V9XA 2HBLA 3VA0A 5DMRA 4ELTA 4M3XA 4BR2A 3AVJA 1KLNA 4W5OA 1GLLO 4PKHA 5AQKA 3OYCA 3E66A 5JVGL 2GBZA 3NF6A 1KC8O 4CJEA 4LFBK 3GOIA 1CZBA 3D2EB 3NGZA 1NGBA 5IWAK 1W0HA 4KHWA 4DU1A 5JS2A 1DLOA 1K8KA 4OLAA 3QEPA 4HCBA 1X9WA 2UXDK 3NCIA 2QWQA 1HUXA 4ZHRA 5AQPA 2VYPA 4B9TA 4DSIA 4MLEA 5FDLA 4BE2A 3S3OA 3ISNC 3RVCA 1BO5O 1R0AA 1ASVA 1KTQA 3G25A 4GNIA 3WXJA 4K8ZA 4E7HA 3K5LA 3SCXA 2D0AA 4E7IA 1SKRA 4FJMA 1SUQA 1HPZA 4H0TB 4CEQA 3ZETB 2Z1GA 3O3FA 3TAFA 4M3YA 3ZSWA 3OA9A 3ENBA 1HKCA 4DSLA 4YOXA 3OHRA 3K5OA 4KTWA 4H8KA 3QIPA 2BDPA 4ZTFA 3DOLA 4KO0A 4X66K 1ZYQA 1VQ8N 4NLCA 3U4LA 4BROA 4KV8A 5D3GA 4BE0A 3SV3A 4CGGA 1JL2A 5GINA 3AA3A 3C7NB 4BRQA 4CF2A 1BI4B 4H0XB 3L2WA 1D5AA 5C42A 2IAJA 3PV8A 3NF8A 5AQSA 1XNQK 3MEDA 1KQSM 3A2FA 5BPLA 4LF5K 3KJVA 5M1FA 1NGEA 4DFMA 1VQ5N 4DSEA 3EYZA 4AHCA 3IG1A 4DR5K 2O4IA 4CE9A 1J6ZA 4JI2K 1RT5A 4X62K 3L3UA 3OYGA 1V4TA 3IFRA 4CEEA 1RNHA 1VSFA 3K0SA 3L8BA 1C6VA 1JLCA 1YXQA 3DLLL 3V81A 1S1TA 1B9DA 3VEXA 4FJ9A 4YOUA 3ZT4A 4DHYA 3VGMA 5AQTA 3SQ1A 4CZFA 3E9LA 3GE1A 3O1BA 3TWHA 1L3SA 3LDNA 3T69A 4FM0A 3GDQA 4A5AA 4CJ4A 4FYDA 2E20A 5AQQA 4B1VA 3QEIA 3E1YA 3CERA 5E84A 2AJQA 3AVHA 3G10A 4BQZA 1N33K 3NBPA 4E1NA 2Y1IA 1DGKN 3B6OA 4O4GA 3VF6A 1NJYA 1NK6A 1LAVA 2G8WA 1H1VA 3VQCA 4DQIA 4NO7A 4BR4A 5KI6A 2CGLA 2IS3A 4Y1CA 5C2FA 3ZEUB 4BY9C 4XEIA 3LZIA 2DFEA 2QM1A 4FM1A 3S3NA 1YTUA 2F9WA 3FZMA 3O9RA 1RDWX 3VEOA 3QDKA 4B9NA 3QEWA 3PSFA 3U9DA 3A5NC 4CGIA 3O9UA 3M8SA 2BANA 2F7TA 4CIFA 2IVOA 2HHHK 3HTVA 1S1XA 2ZJPL 4BRLA 3QNNA 4CJUA 1OH7A 5C2DA 1YTAA 1E4GT 4CGFA 3H6EA 4RG8A 2XY7A 1KLMA 4CJRA 2IDOA 1U49A 1TAUA 1LW2A 4K8XA 2HBKA 2D0PA 1OH6A 3V9ZA 1QTMA 2PZSA 5AQJA 1HQEA 4B1UB 3R8EA 3EEQA 3S41A 5HL7L 1KAZA 4J2DA 4CEAA 3C6AA 2F9TA 3J7ZO 1NGJA 2XY6A 4FK4A 4DSKA 4BDZA 3IMXA 3DAWA 3OJUA 1KAYA 3CM5A 4E1MA 4IFEA 4DV4K 4HUGA 4B3RK 3EZWA 3DLGA 3LAKA 2EHGA 3NH1A 3TSPA 3RRHA 1KVCA 5HROA 4OPJA 3VOVA 3TTDA 3SQ0A 3D0PA 4BE1A 3VQEA 4LSLA 4OO1J 2ZE2A 4FJJA 4KHNA 2GUIA 2QWLA 4IFVA 1U45A 2B5JA 4JKFA 4DV5K 1NOYA 1S1VA 4CHOA 2YJFA 4H0PA 3TANA 3ZLJA 2AP1A 3MX2A 5C10A 1OH5A 3M8PA 1ZBUA 4IEEA 1DTQA 2UYTA 3MECA 2HNYA 2CH6A 3E9PA 2ZF5O 1IKXA 1P8ZA 4DR1K 4FLZA 2ZJRL 1ILYA 4DQRA 3TSQA 3PX0A 3OYAA 2Q36A 3E01A 1SKWA 4CBUA 1VSJA 3SAHA 1RILA 2O8BB 2UUAK 2E8AA 2D4WA 1Z26A 4F8RA 1R59O 1SZ2A 1EX4A 3S3MA 5KRSA 2E2QA 1NGFA 1WN7A 3KLHA 1GOBA 3SPZA 5F2RA 3CF5L 5AZIB 5J1EA 4GV3A 1TYQA 1VHXA 2P9KB 1T3VA 4FJ7A 4B9LA 1FKOA 2OZMA 4HCCA 2E5LK 3FR0A 4CJLA 3O4WA 2OYQA 3CD6N 3M5RA 3OS2A 1RBTA 1TAQA 3CJCA 3KK2A 3WQUA 4WQ4A 4CZMA 2H3GX 4QAGA 2NRRA 1VSHA 4OKJA 4BC2A 2QXLA 5AQLA 4YFUA 3UB5A 2P51A 1WB9A 1X9JA 4UY8O 1TKTA 5BR9A 3K5MA 3VQQA 2FSKA 2HNDA 2ATQA 3MX5A 4KHQA 4JI6K 4M42A 3ZSQA 4FJGA 3VQDA 4CGHA 3W0LA 1TK0A 1K73O 4PL8A 4J2EA 3NMUA 4FM2A 5HP1A 1TL3A 3L3VA 2Q3SA 3T1AA 4C8KA 1RBUA 3CJ1A 3T19A 3KIOA 3VPZA 2PY5A 2DTUA 1WSJA 4YY3K 3G0ZA 4FWSA 2IC3A 3O9QA 1ATSA 4WF9L 3CI5A 4RTFD 2XRIA 4WQ5A 2P9IA 1JCFA 3VQ6A 1JLAA 3KZBA 1YJWN 4V19S 1JLGA 1BGXT 5F1XA 3MN6A 2O8DA 3CFOA 5CR4A 4CEOA 2ETJA 2Z1JA 4ILJA 2HHQA 3CC4N 4JHDA 4H0YB 2HF3A 1FXXA 3AVMA 1RDAA 3DWLA 3SJJA 2XO7A 1TUUA 4CJ3A 5CE3A 5GIPA 3HPOA 4J2BA 3EL2A 4FJHA 5CY4A 3B8AX 4RCHA 1X9MA 5AQRA 4KHSA 4WFBL 3L4IA 2W41A 3O3GA 2DY4A 3IDHA 1LOTB 3VQ9A 4FWNA 3CPWM 3ALYA 3L2VA 2Q0RA 4B08A 4H5NA 2P9NA 3HSTB 3OYDA 1X3MA 2P9PB 3QICA 4B3OA 4IDHA 3O9TA 1XMQK 5CZ1A 3LP3A 3MN9A 1TL1A 1ZC6A 3VETA 4DG1A 4FLXA 1VQPN 1QSYA 2JLEA 3HM8A 2IGIA 2G8UA 1BI4A 4FXDA 3ZT1A 3ZSOA 4JNEA 4X65K 2O8CB 4MDBA 1L3VA 1S72N 4JK8A 3NF7A 4EIAA 1NJWA 3A8YA 4U7BA 1NJIO 2W6LA 1WBBA 3ZT3A 2RN2A 3AVNA 1JCEA 4M3UA 3U9ZA 2OPPA 1EXQA 3AY9A 4JD2A 1YF5L 5IT9O 1ASWA 4DV6K 4OGCA 3MEGA 3KD5E 2HHTA 1LW0A 1C0TA 1NU0A 2E6MA 2UXBK 1C1BA 3DLRA 4WE1A 2NNWA
chains in the Genus database with same CATH topology
1BIUA 1WNSA 2LSNA 2B6AA 4CJPA 1T8EA 1IH7A 3OYHA 3V9XA 4OKEA 1CXUA 3VA0A 5DMRA 4ELTA 5C25A 4M3XA 1VSEA 3RMDA 3AVJA 1KLNA 3JYTA 4W5OA 1XC9A 2G8HA 1G15A 1A5XA 3OYCA 4Z4IA 4CJTA 1BHLA 2GBZA 3NF6A 4CJEA 3LAMA 3LP0A 3QERA 1CZBA 2FBXA 3NGZA 2QXFA 4NCBA 1W0HA 4KHWA 3ZT0A 2P1JA 4NYNA 5FRNA 3HP9A 4DU1A 5J2NA 2HNZA 5EU7A 3ZT2A 1NK4A 5JS2A 1DLOA 4CK1A 1RT2A 4N5SA 4OLAA 3QEPA 3NH2A 1IO2A 4M3RA 4HCBA 4KFBA 4GW6A 4KB1A 4FJ8A 2A1SA 3DLKA 3F9KA 1X9WA 4DQPA 1IKVA 5KGWA 5HBMA 1SL2A 2YNHA 4BWJA 3LPUA 3NCIA 3V9UA 1Q8IA 4ZHRA 3SQ2A 3DMJA 1LWCA 4JS4A 3QETA 4B9TA 4DSIA 4KHYA 4W5NA 3SUPA 5SWMA 3QEVA 5FDLA 3MEEA 3HM9A 4BE2A 3S3OA 3AVFA 5FROA 4FLTA 3ISNC 4DTPA 3AVLA 1KRPA 2F8SA 3DRPA 4FJKA 1ZBLA 2YNIA 2KFZA 3L2UA 4B9MA 3UIQA 3DRRA 3OYBA 1R0AA 1ASVA 1KTQA 1LV5A 4K8ZA 4E7HA 3K5LA 3SCXA 2D0AA 3VQ4A 1A5VA 4E7IA 1SKRA 4FJMA 1SUQA 2RF2A 1HPZA 3OYKA 4KTQA 4CEQA 1RT4A 4R5PA 4CEBA 2Z1GA 3CM6A 1Y97A 3DLEA 3OVNA 2D5RA 4CEDA 4CIEA 3O3FA 3TAFA 1J5OA 4HVJA 3ZSWA 5K14A 4M3YA 1C1AA 3OYJA 3P1GA 4DSLA 4DQQA 1RTDA 3K2PA 4FJLA 4DFPA 3K5OA 4KTWA 1CXQA 3QIPA 1KFDA 4H4MA 4H8KA 1X9SA 4ZTFA 4W5RA 5I3UA 2BDPA 4W5QA 3DOLA 4KO0A 3OS1A 1ZYQA 1ZBHA 3HJFA 4CJVA 4ICLA 4I2PA 2E4LA 3AVKA 4KHUA 2YHAA 4KV8A 2PYJA 5D3GA 4BE0A 3SV3A 4E7LA 4RW7A 4CGGA 1QSLA 3DLBA 1JL2A 3NAEA 1SV5A 4DTRA 3AA3A 3L2WA 4CF2A 2R7YA 1BI4B 1LAWA 1D5AA 5C42A 4HUEA 2ITGA 2IAJA 4RW6A 3PV8A 3I0SA 3NF8A 4FJIA 3O4QA 4FW1A 4AHUA 1JXEA 1S9GA 3MEDA 4LH5A 4DTXA 3LDSA 4OJRA 3OY9A 4MFBA 2XHBA 4Z4EA 3A2FA 1UOCA 1EKEA 3KJVA 4CK3A 2W42A 4DFMA 3DLHA 4FK0A 1JXBA 1TVRA 2D0BA 3U3GA 3HPGA 2FBTA 3WNHA 3C94A 4DSEA 1NOZA 3EYZA 4N76A 2KZMA 4AHCA 3IG1A 2O4IA 4QCLA 1JLBA 4C8OA 1QQCA 1S6PA 3OYIA 2GV9A 4CE9A 3KK1A 2VG6A 1T05A 2QK9A 4L8RB 1RT5A 4CGDA 2G8VA 3L3UA 3TABA 3HT3A 4CFDA 3OYGA 3MXIA 4CEEA 1TK5A 3HYFA 4FW2A 4QOZB 4CHQA 1RNHA 1VSFA 3P5JA 3AVIA 3L8BA 3CFRA 3T3FA 1C6VA 1JLCA 4OKKA 4CF9A 4FZYA 3V81A 1S1TA 1B9DA 3VQ8A 1S5JA 4FJ9A 3THVA 3ZT4A 2VWKA 4DLEA 4AHTA 4DQSA 1U47A 1TKDA 1WSHA 3SQ1A 1Q9XA 2P5OA 1K6YA 5FRMA 3TWHA 4CERA 3L2QA 1TK8A 5CYMA 3V9WA 1L3SA 4FM0A 4LH4A 3EY1A 3VQBA 4CJFA 4E0DA 1RDBA 4CJ4A 4FJNA 4FYDA 3SUNA 1HMVA 3DI6A 4CHPA 5I42A 3QEIA 4AILC 2X78A 1VSLA 2FBVA 1D9FA 4N41A 4KI4A 3V1RA 3RRGA 3LANA 3AVHA 4CEFA 4IFYA 2AJQA 3QEXA 3G10A 1J9AA 5J2QA 1IKYA 3C6UA 3NBPA 2Y1JA 1S1UA 4E1NA 4Q5VA 4DLGA 4KREA 4KRFA 2HHUA 2E6LA 4DFJA 1U48A 2YNGA 1NK5A 1MU2A 1TV6A 2Y1IA 4DS5A 5HRRA 3B6OA 4O4GA 3NF9A 3SUOA 2G8KA 1NJYA 4NYFA 1NK6A 4M3ZA 1J54A 1LAVA 4BDPA 2OZSA 2G8WA 2QKBA 5E41A 2HHWA 1D9DA 4EZ9A 3PY8A 4E7JA 4IKFA 3VQCA 4DQIA 4CJSA 2KFNA 1KVBA 2XY8A 3NDKA 4F4KA 5KI6A 4O44A 4CIGA 4BDYA 2HMIA 2IS3A 4KKOA 1WSEA 4JLHA 4I7FA 3AO3A 4Y1CA 4W5TA 3LZIA 2DFEA 4FM1A 3S3NA 1YTUA 4E19A 4N56A 3SI6A 4KAZA 3SNNA 4JRPA 1XHZA 3KLFA 4CF0A 3SPYA 3TARA 4CJQA 1T03A 4CCHA 1NKEA 4B9NA 3QEWA 4RW4A 1W9HA 4F3TA 4CGIA 2YHBA 1RBSA 3AVGA 1TKXA 4LD0A 3FFIA 2X74A 2KW4A 3M8SA 1RT1A 2BANA 4CIFA 1RTHA 1NKBA 4G1QA 2A1RA 1S1XA 3QNNA 4CJUA 3WNFA 1VSKA 1YTAA 4CGFA 4Q0BA 3LALA 4RG8A 2F8TA 1FK9A 2XY7A 1KLMA 1JL1A 3NH0A 4CJRA 2IDOA 1U49A 4B9VA 3K59A 1LW2A 1TAUA 4K8XA 3V1OA 2KTQA 3QNOA 1WSIA 3V9ZA 4C8NA 1HNIA 1XWLA 1QTMA 1HYZA 4CFCA 2PZSA 5HRPA 1QSSA 1HQEA 4YNQA 1N6QA 4FLWA 3LP2A 2D0CA 2VG7A 3AA4A 1NK9A 1KFSA 3NE6A 4CEAA 4J2DA 1WAFA 3V6DA 4I9QA 1QHTA 2XY6A 4FK4A 4DSKA 1I39A 1ASUA 4BDZA 4BWMA 3WNGA 3RMBA 4Z4CA 1BISA 3OJUA 3ZSYA 3HL8A 3H08A 4I2QA 3AO5A 4LSNA 4KPYA 3CM5A 2HVHA 4E1MA 1HJRA 4C8MA 4HUGA 3ITHA 4JRQA 4FJ5A 3DLGA 3LAKA 2EHGA 3OYMA 3V4IA 3PUFA 4FZZA 3NH1A 4FJXA 1GOAA 1A5WA 1EP4A 3QO9A 3VQ7A 4MQ3A 3RRHA 1KVCA 2DFHA 5HROA 4CF8A 2EX3A 4OPJA 1B9FA 2HB5A 3JSMA 3LP1A 1C1CA 3SQ0A 3D0PA 2XY5A 1KSPA 2YNFA 3PO4A 4EP4A 3VQEA 1JKHA 4BE1A 4LSLA 5HRNA 2ZE2A 3ULDA 3PX6A 4FJJA 4KHNA 2GUIA 4IFVA 1L5UA 1U45A 1O1WA 2YV0X 3DOKA 3TR8A 2B5JA 4CK2A 1NOYA 2P5GA 4B9SA 1S1VA 4CHOA 4C8LA 4AHSA 1IKWA 1RT6A 3TANA 3K57A 2KZZA 5KGXA 3SZ2A 1WSGA 4CHYA 4N47A 4O0IA 2PYLA 4HTUA 1RCHA 1RT3A 3M8PA 1ZBUA 2OPRA 3ZSRA 4PUOA 1CLQA 2VWJA 4DTMA 4GVMA 1RT7A 1WLJA 3AO2A 2KQ2A 1DTQA 1S6QA 3MECA 2HNYA 4CJ5A 4CHNA 3D45A 1UAXA 1Z25A 4HUFA 1NKCA 4Z4HA 1IKXA 3TAQA 4Z0UA 3OYLA 1VSMA 4FLZA 3KTQA 5KTQA 4KB0A 4Z4FA 4DQRA 1X1PA 5CZ2A 3PX0A 3RMCA 3OYAA 3E01A 1SKSA 1SKWA 3QLHA 1IG9A 1VSJA 2IOCA 4B8CA 3TAGA 1RILA 1D8YA 3KKSA 4F8RA 1Z26A 3V1QA 1YVUA 1EX4A 3ZSZA 3VN5A 3ASMA 3VQAA 3S3MA 4E89A 4M45A 5KRSA 3C6TA 5HLFA 1WN7A 1L3TA 1F21A 3KLHA 3BDPA 4DTOA 1GOBA 3AA5X 4BACA 3SPZA 3K5NA 3HVRA 2HHXA 5J1EA 3KD5E 3LWLA 4DTJA 2WONA 2O4GA 3ZCMA 1RTIA 4FZXC 4CESA 1RTJA 1VSIA 4FJ7A 4B9LA 1BCOA 4TSXA 1VRUA 5CYQA 1TKZA 4CHZA 1FKOA 3I8DA 4DTUA 2OZMA 1NK0A 4DSJA 3HO1A 4HCCA 2X6NA 4PWDA 3EZ5A 5DK5A 4CJLA 2OYQA 3OS2A 1UA1A 1RBTA 1TAQA 4AHVA 3KK2A 4DF8A 4ZTJA 1NJZA 4F3OA 3M8QA 2X6SA 2OPQA 1KCFA 3BGRA 4QAGA 3KLGA 3MXJA 4CFAA 4OPKA 1VSHA 3SV4A 1XHXA 4OKJA 3M8RA 4O55A 1S1WA 3KD1E 1L3UA 3RTVA 4M3TA 4YFUA 4JS5A 3NGIA 1LWEA 2P51A 1ZBFA 3P83D 3F73A 1U4BA 1HYVA 2Z1HA 3ZSVA 2ZQBA 4B9UA 1TKTA 2BGGA 3LPTA 3K5MA 1HYSA 2DFFA 3VQQA 2HNDA 2ATQA 2YKMA 1QS4A 3QIOA 3HP6A 1HNVA 4KHQA 4PQUA 4M42A 2NUBA 3ZSQA 1WAJA 3OJSA 4FJGA 3VQDA 1SL0A 4CGHA 3IAYA 4DSFA 1TK0A 4J2EA 4CJKA 1RBVA 4M41A 4FM2A 4FLVA 1TL3A 3L3VA 5HP1A 4DTNA 3AA2A 2HHVA 2Q3SA 3RR8A 3T1AA 4C8KA 4I9LA 2ZD1A 1RBUA 4H4OA 3DRSA 1HRHA 1NJXA 3T19A 3LZJA 3HK2A 3KIOA 1N5YA 3QESA 2PY5A 2DTUA 1WSJA 3G0ZA 4OVLA 4OGEA 2IC3A 1JLQA 1VRTA 2HVIA 1RDDA 2RKIA 2XRIA 3IS9A 1UWBA 3C95A 4CGJA 1BQNA 3VQ6A 1JLAA 5HRSA 4KTZA 1REVA 1BQMA 3AVAA 1FKPA 3PO5A 1JLGA 1BGXT 3TAMA 1BCMA 4B8AB 2HW3A 3CFOA 3MAQA 2G8IA 2OA8A 3KKRA 4CEOA 2ETJA 1KVAA 2Z1JA 3OYEA 3S9HA 3PX4A 3RMAA 2HHQA 3O4NA 1FXXA 3AVMA 1RDAA 3WNEA 4J2AA 3OYFA 4LY7A 4NCGA 1C0UA 3NFAA 3CQ8A 4FLYA 3IRXA 5KRTA 3CG7A 3O3HA 3SJJA 4OLBA 3V9SA 1LWFA 1TGOA 3KLIA 2XO7A 1XI1A 4IDKA 1NK8A 4CJ3A 4RW8A 3HPOA 4J2BA 1ZBIA 4FVMA 3VA3A 3RWUA 4FJHA 3TI0A 4CJWA 5CY4A 4M3WA 2I5JA 2B4JA 3DM2A 3SQ4A 1X9MA 1BL3A 4KHSA 3SUQA 1Q9YA 1SL1A 4DF4A 3O3GA 2DY4A 3NGYA 1BIZA 4IG3A 3AO1A 5J2MA 4CFBA 3U6FA 3B6PA 3VQ9A 1NK7A 4F2RA 4CF1A 1HQUA 4FLUA 3ALYA 3MXMA 4FK2A 4DWIA 4DU4A 4IG0A 2VG5A 3L2VA 4B08A 1U04A 1S9EA 3AVBA 3HSTB 3OYDA 3TAPA 1JLFA 4RW9A 3LWMA 3U3YA 4CEZA 4KI6A 4B3OA 3ZSXA 1B92A 3HPHA 3RR7A 4ELVA 4GMJB 3I0RA 1RBRA 5CZ1A 3LP3A 3VQPA 1CZ9A 4O5BA 4NCAA 1VSDA 3OYNA 1TL1A 3HVTA 4DG1A 3NHGA 4FLXA 1UA0A 1QSYA 2JLEA 1YT3A 2F96A 4FCYA 2IGIA 2G8UA 4XIUA 4DU3A 3TAEA 1QE1A 1BI4A 4FXDA 3ZT1A 4O0JA 3ZSOA 1EETA 2YKNA 4AH9A 5C24A 4PA1A 4HHTA 4AHRA 4DS4A 2OPSA 1L3VA 2QKKA 4ID5A 3NF7A 1NJWA 4IBNA 1VK0A 4E3SA 3OS0A 5JS1A 3ZT3A 4E7KA 4EZ6A 3KK3A 2FC0A 3CYMA 2RPIA 5T7BA 2WOMA 1I3AA 4DTSA 2RN2A 5J2PA 1ITGA 4PY5A 3AVNA 1RDCA 3K58A 4DFKA 1GOCA 4F2SA 4M3UA 4ELUA 2OPPA 1EXQA 1T7PA 2BE2A 1DTTA 3DYAA 5SZTA 4CECA 1ASWA 3QINA 4EP5A 4Z4GA 4OGCA 1J53A 3MEGA 3CFPA 4Y1DA 1LW0A 2JGUA 3AO4A 4UQGA 1WSFA 3KLEA 1JLEA 2HHTA 2HHSA 1C0MA 1C0TA 3AV9A 3AVCA 4DMNA 3SYZA 3L2RA 2FBYA 3HXMA 3VQ5A 2E6MA 4ID1A 1C1BA 3DLRA 4WE1A 2G8FA 2Z1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIU A;  1WNS A;  2LSN A;  2B6A A;  4CJP A;  1T8E A;  1IH7 A;  3OYH A;  3V9X A;  4OKE A;  1CXU A;  3VA0 A;  5DMR A;  4ELT A;  5C25 A;  4M3X A;  1VSE A;  3RMD A;  3AVJ A;  1KLN A;  3JYT A;  4W5O A;  1XC9 A;  2G8H A;  1G15 A;  1A5X A;  3OYC A;  4Z4I A;  4CJT A;  1BHL A;  2GBZ A;  3NF6 A;  4CJE A;  3LAM A;  3LP0 A;  3QER A;  1CZB A;  2FBX A;  3NGZ A;  2QXF A;  4NCB A;  1W0H A;  4KHW A;  3ZT0 A;  2P1J A;  4NYN A;  5FRN A;  3HP9 A;  4DU1 A;  5J2N A;  2HNZ A;  5EU7 A;  3ZT2 A;  1NK4 A;  5JS2 A;  1DLO A;  4CK1 A;  1RT2 A;  4N5S A;  4OLA A;  3QEP A;  3NH2 A;  1IO2 A;  4M3R A;  4HCB A;  4KFB A;  4GW6 A;  4KB1 A;  4FJ8 A;  2A1S A;  3DLK A;  3F9K A;  1X9W A;  4DQP A;  1IKV A;  5KGW A;  5HBM A;  1SL2 A;  2YNH A;  4BWJ A;  3LPU A;  3NCI A;  3V9U A;  1Q8I A;  4ZHR A;  3SQ2 A;  3DMJ A;  1LWC A;  4JS4 A;  3QET A;  4B9T A;  4DSI A;  4KHY A;  4W5N A;  3SUP A;  5SWM A;  3QEV A;  5FDL A;  3MEE A;  3HM9 A;  4BE2 A;  3S3O A;  3AVF A;  5FRO A;  4FLT A;  3ISN C;  4DTP A;  3AVL A;  1KRP A;  2F8S A;  3DRP A;  4FJK A;  1ZBL A;  2YNI A;  2KFZ A;  3L2U A;  4B9M A;  3UIQ A;  3DRR A;  3OYB A;  1R0A A;  1ASV A;  1KTQ A;  1LV5 A;  4K8Z A;  4E7H A;  3K5L A;  3SCX A;  2D0A A;  3VQ4 A;  1A5V A;  4E7I A;  1SKR A;  4FJM A;  1SUQ A;  2RF2 A;  1HPZ A;  3OYK A;  4KTQ A;  4CEQ A;  1RT4 A;  4R5P A;  4CEB A;  2Z1G A;  3CM6 A;  1Y97 A;  3DLE A;  3OVN A;  2D5R A;  4CED A;  4CIE A;  3O3F A;  3TAF A;  1J5O A;  4HVJ A;  3ZSW A;  5K14 A;  4M3Y A;  1C1A A;  3OYJ A;  3P1G A;  4DSL A;  4DQQ A;  1RTD A;  3K2P A;  4FJL A;  4DFP A;  3K5O A;  4KTW A;  1CXQ A;  3QIP A;  1KFD A;  4H4M A;  4H8K A;  1X9S A;  4ZTF A;  4W5R A;  5I3U A;  2BDP A;  4W5Q A;  3DOL A;  4KO0 A;  3OS1 A;  1ZYQ A;  1ZBH A;  3HJF A;  4CJV A;  4ICL A;  4I2P A;  2E4L A;  3AVK A;  4KHU A;  2YHA A;  4KV8 A;  2PYJ A;  5D3G A;  4BE0 A;  3SV3 A;  4E7L A;  4RW7 A;  4CGG A;  1QSL A;  3DLB A;  1JL2 A;  3NAE A;  1SV5 A;  4DTR A;  3AA3 A;  3L2W A;  4CF2 A;  2R7Y A;  1BI4 B;  1LAW A;  1D5A A;  5C42 A;  4HUE A;  2ITG A;  2IAJ A;  4RW6 A;  3PV8 A;  3I0S A;  3NF8 A;  4FJI A;  3O4Q A;  4FW1 A;  4AHU A;  1JXE A;  1S9G A;  3MED A;  4LH5 A;  4DTX A;  3LDS A;  4OJR A;  3OY9 A;  4MFB A;  2XHB A;  4Z4E A;  3A2F A;  1UOC A;  1EKE A;  3KJV A;  4CK3 A;  2W42 A;  4DFM A;  3DLH A;  4FK0 A;  1JXB A;  1TVR A;  2D0B A;  3U3G A;  3HPG A;  2FBT A;  3WNH A;  3C94 A;  4DSE A;  1NOZ A;  3EYZ A;  4N76 A;  2KZM A;  4AHC A;  3IG1 A;  2O4I A;  4QCL A;  1JLB A;  4C8O A;  1QQC A;  1S6P A;  3OYI A;  2GV9 A;  4CE9 A;  3KK1 A;  2VG6 A;  1T05 A;  2QK9 A;  4L8R B;  1RT5 A;  4CGD A;  2G8V A;  3L3U A;  3TAB A;  3HT3 A;  4CFD A;  3OYG A;  3MXI A;  4CEE A;  1TK5 A;  3HYF A;  4FW2 A;  4QOZ B;  4CHQ A;  1RNH A;  1VSF A;  3P5J A;  3AVI A;  3L8B A;  3CFR A;  3T3F A;  1C6V A;  1JLC A;  4OKK A;  4CF9 A;  4FZY A;  3V81 A;  1S1T A;  1B9D A;  3VQ8 A;  1S5J A;  4FJ9 A;  3THV A;  3ZT4 A;  2VWK A;  4DLE A;  4AHT A;  4DQS A;  1U47 A;  1TKD A;  1WSH A;  3SQ1 A;  1Q9X A;  2P5O A;  1K6Y A;  5FRM A;  3TWH A;  4CER A;  3L2Q A;  1TK8 A;  5CYM A;  3V9W A;  1L3S A;  4FM0 A;  4LH4 A;  3EY1 A;  3VQB A;  4CJF A;  4E0D A;  1RDB A;  4CJ4 A;  4FJN A;  4FYD A;  3SUN A;  1HMV A;  3DI6 A;  4CHP A;  5I42 A;  3QEI A;  4AIL C;  2X78 A;  1VSL A;  2FBV A;  1D9F A;  4N41 A;  4KI4 A;  3V1R A;  3RRG A;  3LAN A;  3AVH A;  4CEF A;  4IFY A;  2AJQ A;  3QEX A;  3G10 A;  1J9A A;  5J2Q A;  1IKY A;  3C6U A;  3NBP A;  2Y1J A;  1S1U A;  4E1N A;  4Q5V A;  4DLG A;  4KRE A;  4KRF A;  2HHU A;  2E6L A;  4DFJ A;  1U48 A;  2YNG A;  1NK5 A;  1MU2 A;  1TV6 A;  2Y1I A;  4DS5 A;  5HRR A;  3B6O A;  4O4G A;  3NF9 A;  3SUO A;  2G8K A;  1NJY A;  4NYF A;  1NK6 A;  4M3Z A;  1J54 A;  1LAV A;  4BDP A;  2OZS A;  2G8W A;  2QKB A;  5E41 A;  2HHW A;  1D9D A;  4EZ9 A;  3PY8 A;  4E7J A;  4IKF A;  3VQC A;  4DQI A;  4CJS A;  2KFN A;  1KVB A;  2XY8 A;  3NDK A;  4F4K A;  5KI6 A;  4O44 A;  4CIG A;  4BDY A;  2HMI A;  2IS3 A;  4KKO A;  1WSE A;  4JLH A;  4I7F A;  3AO3 A;  4Y1C A;  4W5T A;  3LZI A;  2DFE A;  4FM1 A;  3S3N A;  1YTU A;  4E19 A;  4N56 A;  3SI6 A;  4KAZ A;  3SNN A;  4JRP A;  1XHZ A;  3KLF A;  4CF0 A;  3SPY A;  3TAR A;  4CJQ A;  1T03 A;  4CCH A;  1NKE A;  4B9N A;  3QEW A;  4RW4 A;  1W9H A;  4F3T A;  4CGI A;  2YHB A;  1RBS A;  3AVG A;  1TKX A;  4LD0 A;  3FFI A;  2X74 A;  2KW4 A;  3M8S A;  1RT1 A;  2BAN A;  4CIF A;  1RTH A;  1NKB A;  4G1Q A;  2A1R A;  1S1X A;  3QNN A;  4CJU A;  3WNF A;  1VSK A;  1YTA A;  4CGF A;  4Q0B A;  3LAL A;  4RG8 A;  2F8T A;  1FK9 A;  2XY7 A;  1KLM A;  1JL1 A;  3NH0 A;  4CJR A;  2IDO A;  1U49 A;  4B9V A;  3K59 A;  1LW2 A;  1TAU A;  4K8X A;  3V1O A;  2KTQ A;  3QNO A;  1WSI A;  3V9Z A;  4C8N A;  1HNI A;  1XWL A;  1QTM A;  1HYZ A;  4CFC A;  2PZS A;  5HRP A;  1QSS A;  1HQE A;  4YNQ A;  1N6Q A;  4FLW A;  3LP2 A;  2D0C A;  2VG7 A;  3AA4 A;  1NK9 A;  1KFS A;  3NE6 A;  4CEA A;  4J2D A;  1WAF A;  3V6D A;  4I9Q A;  1QHT A;  2XY6 A;  4FK4 A;  4DSK A;  1I39 A;  1ASU A;  4BDZ A;  4BWM A;  3WNG A;  3RMB A;  4Z4C A;  1BIS A;  3OJU A;  3ZSY A;  3HL8 A;  3H08 A;  4I2Q A;  3AO5 A;  4LSN A;  4KPY A;  3CM5 A;  2HVH A;  4E1M A;  1HJR A;  4C8M A;  4HUG A;  3ITH A;  4JRQ A;  4FJ5 A;  3DLG A;  3LAK A;  2EHG A;  3OYM A;  3V4I A;  3PUF A;  4FZZ A;  3NH1 A;  4FJX A;  1GOA A;  1A5W A;  1EP4 A;  3QO9 A;  3VQ7 A;  4MQ3 A;  3RRH A;  1KVC A;  2DFH A;  5HRO A;  4CF8 A;  2EX3 A;  4OPJ A;  1B9F A;  2HB5 A;  3JSM A;  3LP1 A;  1C1C A;  3SQ0 A;  3D0P A;  2XY5 A;  1KSP A;  2YNF A;  3PO4 A;  4EP4 A;  3VQE A;  1JKH A;  4BE1 A;  4LSL A;  5HRN A;  2ZE2 A;  3ULD A;  3PX6 A;  4FJJ A;  4KHN A;  2GUI A;  4IFV A;  1L5U A;  1U45 A;  1O1W A;  2YV0 X;  3DOK A;  3TR8 A;  2B5J A;  4CK2 A;  1NOY A;  2P5G A;  4B9S A;  1S1V A;  4CHO A;  4C8L A;  4AHS A;  1IKW A;  1RT6 A;  3TAN A;  3K57 A;  2KZZ A;  5KGX A;  3SZ2 A;  1WSG A;  4CHY A;  4N47 A;  4O0I A;  2PYL A;  4HTU A;  1RCH A;  1RT3 A;  3M8P A;  1ZBU A;  2OPR A;  3ZSR A;  4PUO A;  1CLQ A;  2VWJ A;  4DTM A;  4GVM A;  1RT7 A;  1WLJ A;  3AO2 A;  2KQ2 A;  1DTQ A;  1S6Q A;  3MEC A;  2HNY A;  4CJ5 A;  4CHN A;  3D45 A;  1UAX A;  1Z25 A;  4HUF A;  1NKC A;  4Z4H A;  1IKX A;  3TAQ A;  4Z0U A;  3OYL A;  1VSM A;  4FLZ A;  3KTQ A;  5KTQ A;  4KB0 A;  4Z4F A;  4DQR A;  1X1P A;  5CZ2 A;  3PX0 A;  3RMC A;  3OYA A;  3E01 A;  1SKS A;  1SKW A;  3QLH A;  1IG9 A;  1VSJ A;  2IOC A;  4B8C A;  3TAG A;  1RIL A;  1D8Y A;  3KKS A;  4F8R A;  1Z26 A;  3V1Q A;  1YVU A;  1EX4 A;  3ZSZ A;  3VN5 A;  3ASM A;  3VQA A;  3S3M A;  4E89 A;  4M45 A;  5KRS A;  3C6T A;  5HLF A;  1WN7 A;  1L3T A;  1F21 A;  3KLH A;  3BDP A;  4DTO A;  1GOB A;  3AA5 X;  4BAC A;  3SPZ A;  3K5N A;  3HVR A;  2HHX A;  5J1E A;  3KD5 E;  3LWL A;  4DTJ A;  2WON A;  2O4G A;  3ZCM A;  1RTI A;  4FZX C;  4CES A;  1RTJ A;  1VSI A;  4FJ7 A;  4B9L A;  1BCO A;  4TSX A;  1VRU A;  5CYQ A;  1TKZ A;  4CHZ A;  1FKO A;  3I8D A;  4DTU A;  2OZM A;  1NK0 A;  4DSJ A;  3HO1 A;  4HCC A;  2X6N A;  4PWD A;  3EZ5 A;  5DK5 A;  4CJL A;  2OYQ A;  3OS2 A;  1UA1 A;  1RBT A;  1TAQ A;  4AHV A;  3KK2 A;  4DF8 A;  4ZTJ A;  1NJZ A;  4F3O A;  3M8Q A;  2X6S A;  2OPQ A;  1KCF A;  3BGR A;  4QAG A;  3KLG A;  3MXJ A;  4CFA A;  4OPK A;  1VSH A;  3SV4 A;  1XHX A;  4OKJ A;  3M8R A;  4O55 A;  1S1W A;  3KD1 E;  1L3U A;  3RTV A;  4M3T A;  4YFU A;  4JS5 A;  3NGI A;  1LWE A;  2P51 A;  1ZBF A;  3P83 D;  3F73 A;  1U4B A;  1HYV A;  2Z1H A;  3ZSV A;  2ZQB A;  4B9U A;  1TKT A;  2BGG A;  3LPT A;  3K5M A;  1HYS A;  2DFF A;  3VQQ A;  2HND A;  2ATQ A;  2YKM A;  1QS4 A;  3QIO A;  3HP6 A;  1HNV A;  4KHQ A;  4PQU A;  4M42 A;  2NUB A;  3ZSQ A;  1WAJ A;  3OJS A;  4FJG A;  3VQD A;  1SL0 A;  4CGH A;  3IAY A;  4DSF A;  1TK0 A;  4J2E A;  4CJK A;  1RBV A;  4M41 A;  4FM2 A;  4FLV A;  1TL3 A;  3L3V A;  5HP1 A;  4DTN A;  3AA2 A;  2HHV A;  2Q3S A;  3RR8 A;  3T1A A;  4C8K A;  4I9L A;  2ZD1 A;  1RBU A;  4H4O A;  3DRS A;  1HRH A;  1NJX A;  3T19 A;  3LZJ A;  3HK2 A;  3KIO A;  1N5Y A;  3QES A;  2PY5 A;  2DTU A;  1WSJ A;  3G0Z A;  4OVL A;  4OGE A;  2IC3 A;  1JLQ A;  1VRT A;  2HVI A;  1RDD A;  2RKI A;  2XRI A;  3IS9 A;  1UWB A;  3C95 A;  4CGJ A;  1BQN A;  3VQ6 A;  1JLA A;  5HRS A;  4KTZ A;  1REV A;  1BQM A;  3AVA A;  1FKP A;  3PO5 A;  1JLG A;  1BGX T;  3TAM A;  1BCM A;  4B8A B;  2HW3 A;  3CFO A;  3MAQ A;  2G8I A;  2OA8 A;  3KKR A;  4CEO A;  2ETJ A;  1KVA A;  2Z1J A;  3OYE A;  3S9H A;  3PX4 A;  3RMA A;  2HHQ A;  3O4N A;  1FXX A;  3AVM A;  1RDA A;  3WNE A;  4J2A A;  3OYF A;  4LY7 A;  4NCG A;  1C0U A;  3NFA A;  3CQ8 A;  4FLY A;  3IRX A;  5KRT A;  3CG7 A;  3O3H A;  3SJJ A;  4OLB A;  3V9S A;  1LWF A;  1TGO A;  3KLI A;  2XO7 A;  1XI1 A;  4IDK A;  1NK8 A;  4CJ3 A;  4RW8 A;  3HPO A;  4J2B A;  1ZBI A;  4FVM A;  3VA3 A;  3RWU A;  4FJH A;  3TI0 A;  4CJW A;  5CY4 A;  4M3W A;  2I5J A;  2B4J A;  3DM2 A;  3SQ4 A;  1X9M A;  1BL3 A;  4KHS A;  3SUQ A;  1Q9Y A;  1SL1 A;  4DF4 A;  3O3G A;  2DY4 A;  3NGY A;  1BIZ A;  4IG3 A;  3AO1 A;  5J2M A;  4CFB A;  3U6F A;  3B6P A;  3VQ9 A;  1NK7 A;  4F2R A;  4CF1 A;  1HQU A;  4FLU A;  3ALY A;  3MXM A;  4FK2 A;  4DWI A;  4DU4 A;  4IG0 A;  2VG5 A;  3L2V A;  4B08 A;  1U04 A;  1S9E A;  3AVB A;  3HST B;  3OYD A;  3TAP A;  1JLF A;  4RW9 A;  3LWM A;  3U3Y A;  4CEZ A;  4KI6 A;  4B3O A;  3ZSX A;  1B92 A;  3HPH A;  3RR7 A;  4ELV A;  4GMJ B;  3I0R A;  1RBR A;  5CZ1 A;  3LP3 A;  3VQP A;  1CZ9 A;  4O5B A;  4NCA A;  1VSD A;  3OYN A;  1TL1 A;  3HVT A;  4DG1 A;  3NHG A;  4FLX A;  1UA0 A;  1QSY A;  2JLE A;  1YT3 A;  2F96 A;  4FCY A;  2IGI A;  2G8U A;  4XIU A;  4DU3 A;  3TAE A;  1QE1 A;  1BI4 A;  4FXD A;  3ZT1 A;  4O0J A;  3ZSO A;  1EET A;  2YKN A;  4AH9 A;  5C24 A;  4PA1 A;  4HHT A;  4AHR A;  4DS4 A;  2OPS A;  1L3V A;  2QKK A;  4ID5 A;  3NF7 A;  1NJW A;  4IBN A;  1VK0 A;  4E3S A;  3OS0 A;  5JS1 A;  3ZT3 A;  4E7K A;  4EZ6 A;  3KK3 A;  2FC0 A;  3CYM A;  2RPI A;  5T7B A;  2WOM A;  1I3A A;  4DTS A;  2RN2 A;  5J2P A;  1ITG A;  4PY5 A;  3AVN A;  1RDC A;  3K58 A;  4DFK A;  1GOC A;  4F2S A;  4M3U A;  4ELU A;  2OPP A;  1EXQ A;  1T7P A;  2BE2 A;  1DTT A;  3DYA A;  5SZT A;  4CEC A;  1ASW A;  3QIN A;  4EP5 A;  4Z4G A;  4OGC A;  1J53 A;  3MEG A;  3CFP A;  4Y1D A;  1LW0 A;  2JGU A;  3AO4 A;  4UQG A;  1WSF A;  3KLE A;  1JLE A;  2HHT A;  2HHS A;  1C0M A;  1C0T A;  3AV9 A;  3AVC A;  4DMN A;  3SYZ A;  3L2R A;  2FBY A;  3HXM A;  3VQ5 A;  2E6M A;  4ID1 A;  1C1B A;  3DLR A;  4WE1 A;  2G8F A;  2Z1I A; 
#chains in the Genus database with same CATH topology
 2LSN A;  3JAM O;  4O5F A;  2ZM6 K;  1VSE A;  4BR5 A;  1YUW A;  3RMD A;  3JYT A;  1EWQ A;  2JWL A;  3CIP A;  3CCQ N;  2G8H A;  4CJT A;  1BHL A;  1YIJ N;  4JI3 K;  4B3T K;  1XUP O;  2A41 A;  4NCB A;  1NGI A;  3CCV N;  2HNZ A;  4CK1 A;  1VQ4 N;  4M3R A;  4KFB A;  4AM7 A;  4FJ8 A;  2A1S A;  3A5M C;  1HR0 K;  3E9O A;  1OH8 A;  4DQP A;  5KGW A;  5DM6 L;  3SQ2 A;  4JS4 A;  3DJC A;  3WXM B;  2V7Y A;  3MEE A;  4FPB A;  3HM9 A;  3BZK A;  4FLT A;  4DTP A;  2F8S A;  5M1O A;  4IO9 L;  3DRP A;  4ISF A;  4FJK A;  3DXK B;  3BF1 A;  2KFZ A;  3UIQ A;  2HBJ A;  3DRR A;  5ELZ A;  3OYB A;  3OW2 M;  3VQ4 A;  3WEE A;  1IV0 A;  3ZEU A;  4KTQ A;  2KLA A;  2IVP A;  4CEB A;  1Y97 A;  1J5O A;  4HVJ A;  1SAZ A;  3ZET A;  3O80 A;  5TKY A;  3K2P A;  4A59 A;  4FJL A;  1GLC G;  2NRT A;  3H3N O;  5GAG P;  3ATU A;  3QBW A;  4CJV A;  4ICL A;  2E4L A;  3AVK A;  1YJN N;  3KHY A;  2YHA A;  4E7L A;  4DR4 K;  2PBD A;  3CXC M;  3EO3 A;  5M1P A;  2R7Y A;  4HUE A;  4RW6 A;  3O4Q A;  4IOX A;  4FWR A;  4DTX A;  4BG8 A;  3OY9 A;  1UOC A;  1NBW A;  1EKE A;  4CK3 A;  2W42 A;  1NGH A;  4JI1 K;  1JXB A;  2YHW A;  3U3G A;  3MCA B;  2WTU A;  2OTL N;  4XH4 A;  4IJN A;  4N76 A;  2KZM A;  3RSE A;  2OTJ N;  1S3X A;  1QQC A;  1V4S A;  1HNW K;  3OYI A;  2GV9 A;  2VG6 A;  3ZX3 A;  3TAB A;  3ZYY X;  4QS7 A;  3MXI A;  3HYF A;  3SBT A;  4FW2 A;  3T3F A;  4LF7 K;  4FZY A;  1QQN A;  3THV A;  1N36 K;  2A3Z A;  2VWK A;  5MLC Q;  4DLE A;  4DQS A;  1TKD A;  2P5O A;  5AFU A;  5BN9 A;  1QZ6 A;  5HOO A;  2Q1N A;  3VQB A;  4H5W A;  1RDB A;  4FJN A;  1VQL N;  4JKC A;  4U67 L;  2FLO A;  4CHP A;  2FF3 B;  5CHI A;  3QBX A;  1VSL A;  4OPH A;  5FPM A;  5LMU K;  1NG9 A;  3QEX A;  3ID8 A;  1IKY A;  4KRE A;  4XH5 A;  3SMP A;  2Y1J A;  4DLG A;  4KRF A;  3L6Q A;  4PHT X;  2HHU A;  5GAH P;  1U48 A;  3IKM A;  1NK5 A;  1VQK N;  1MU2 A;  3SAF A;  4DS5 A;  3NF9 A;  5AFU H;  1QZ5 A;  4NYF A;  1J54 A;  4DV3 K;  2OZS A;  1GLD G;  4EZ9 A;  3PY8 A;  3GBT A;  3QFU A;  4BDY A;  4CIG A;  4CZE A;  1HJO A;  4W5T A;  4H0V B;  4OX9 K;  3SI6 A;  5LL6 Z;  4WCE L;  3SNN A;  1XHZ A;  3TAR A;  4CCH A;  1NKE A;  1TYQ B;  4IOC L;  2AA4 A;  3UKU B;  4F3T A;  2YHB A;  2KW4 A;  2X74 A;  4WYB A;  1RT1 A;  4OPA A;  1BWF O;  4PKI A;  1VSK A;  4Q0B A;  2O8F A;  2F8T A;  1FK9 A;  3K9K A;  4EFH A;  3NH0 A;  4G9Z A;  5KQD A;  3V1O A;  2KTQ A;  3QNO A;  5AZI A;  1HYZ A;  3MWT A;  4FSV A;  3CCS N;  3TTC A;  4FLW A;  3J7Y P;  3MN7 A;  2D0C A;  2NRX A;  4DUY K;  4NB4 A;  5BPM A;  1NK9 A;  3CCM N;  4I9Q A;  1QHT A;  1HLU A;  4E1J A;  1U2V B;  2V51 B;  3LM9 A;  3ZSY A;  3HL8 A;  3AO5 A;  1C0G A;  3HOT A;  2E1Z A;  5JIC A;  4C8M A;  3CET A;  1TUY A;  3EE9 A;  4FJ5 A;  3OYM A;  1VQN N;  1A5W A;  3VTH A;  3VQ7 A;  4JHD B;  4B9Q A;  2EX3 A;  1B9F A;  3LP1 A;  4DV2 K;  4MDA A;  2YNF A;  5B8H A;  5HRN A;  3FFK B;  3M3Z A;  3D2E A;  4CK2 A;  3UKR B;  3AAR A;  1RDU A;  3O08 A;  3VTI A;  1RT6 A;  3QML A;  3K57 A;  2VGN A;  1M1K O;  1D4X A;  1WSG A;  1RT3 A;  2OPR A;  1NM1 A;  1RFQ A;  4GVM A;  1WLJ A;  2BUP A;  4CHN A;  1NKC A;  4Z4H A;  4A62 A;  3QB0 A;  4FWL A;  4Z0U A;  1VSM A;  3AAP A;  4Z4F A;  1BUP A;  4DQ8 A;  3VGL A;  5DM7 L;  2E88 A;  1SKS A;  1IBK K;  3BEX A;  3KKS A;  1YVU A;  5KPZ A;  2NLX A;  2ZGY A;  5HLF A;  1F21 A;  2VGM A;  4QS8 A;  1IG8 A;  4K41 A;  3LWL A;  2P9L B;  4FZX C;  4TSX A;  1TKZ A;  4CHZ A;  2X6N A;  4PWD A;  3EZ5 A;  1UA1 A;  5ADX H;  1MWM A;  4AHV A;  3CCJ N;  4IEI A;  1YVN A;  3SV4 A;  4CFA A;  4Y0W A;  2P9N B;  3WUH A;  4O55 A;  3ATV A;  2GWJ A;  3NGI A;  4JKD A;  3F73 A;  3ZX0 A;  5BPN A;  1CZA N;  3ZSV A;  3LPT A;  3EE8 A;  2DFF A;  2RE2 A;  3LM2 A;  2YKM A;  3QIO A;  4PQU A;  4WFA L;  2NUB A;  3ID6 A;  3OJS A;  4GKK K;  1SL0 A;  3IAY A;  3LDO A;  4YOY A;  4GV6 A;  4A57 A;  1RBV A;  3CCL N;  4F9O A;  3RR8 A;  2D0O A;  4I9L A;  5LMN K;  3DRS A;  1IJJ A;  4J8F A;  3SK3 A;  3LZJ A;  1N5Y A;  5LJV A;  1JLQ A;  4AQY K;  1BU6 O;  3CC7 N;  1VRT A;  3H1Q A;  1RDD A;  3CCE N;  1LCU A;  5EY4 A;  3QFP A;  3IS9 A;  4CGJ A;  3O8M A;  4DUZ K;  1BQM A;  3AVA A;  3PO5 A;  2HW3 A;  4YOW A;  1MA9 B;  3MAQ A;  2QWN A;  2OA8 A;  3OYE A;  1KVA A;  4KH6 A;  4NXM K;  3PX4 A;  5BRE A;  2YCH A;  3WNE A;  4J2A A;  1DKG D;  3OYF A;  2VQE K;  5A2Q O;  2QWM A;  4I6M B;  5JLF A;  3THW B;  3V9S A;  1NK8 A;  4RW8 A;  2WUS A;  4EAH D;  4JEP A;  2I5J A;  2QWO A;  3G71 N;  3NVM A;  3WEE B;  3ENH A;  1SL1 A;  4YOV A;  4CI6 A;  4IG3 A;  3AO1 A;  3VEZ A;  1ZBS A;  4CD1 A;  3B6P A;  2P9U A;  5J2M A;  4FLU A;  4DWI A;  4IG0 A;  4B1W B;  4I6M A;  1U04 A;  5LY3 A;  3TAP A;  1U6Z A;  4JYA K;  1JLF A;  1Z6R A;  4GVE A;  3LWM A;  4CEZ A;  3U3Y A;  4KI6 A;  1B92 A;  4BQL A;  3CJ7 A;  1RBR A;  4DV0 K;  3VQP A;  1CZ9 A;  3OYN A;  3HVT A;  1UA0 A;  3NHG A;  2UUC K;  1YT3 A;  2F96 A;  4XIU A;  4DU3 A;  1QE1 A;  3P38 A;  4DR7 K;  4CZL A;  2YKN A;  4DS4 A;  4HHT A;  4YOR A;  3PIP L;  1GLA G;  5AQY A;  4ID5 A;  4IBN A;  2OCE A;  1VK0 A;  3H46 O;  1G99 A;  5JS1 A;  4JKE A;  3KK3 A;  2NRZ A;  4BGA A;  2YX6 A;  4RWT A;  1RDC A;  3K58 A;  4F2S A;  2ZGZ A;  4ELU A;  5EVZ A;  3ULE B;  1VQO N;  1DTT A;  4JD2 B;  4DCH A;  1J53 A;  1Q86 O;  3CFP A;  1BA0 A;  2NRH A;  4Y1D A;  3AO4 A;  3KLE A;  2Q31 A;  2UXC K;  3P31 A;  1C0M A;  2HHS A;  2J4R A;  3VQ5 A;  4ID1 A;  1BIU A;  4CJP A;  4BVP A;  1DT9 A;  3OYH A;  4NLB A;  4OKE A;  1CXU A;  2GWK A;  1Q82 O;  4CJ7 A;  3H3O B;  1XC9 A;  3SLC A;  3UE5 A;  1A5X A;  3A5L C;  3LAM A;  5AQI A;  2FBX A;  2QXF A;  1YIT N;  3ZT0 A;  2P1J A;  3KWG A;  5FRN A;  3HP9 A;  1NK4 A;  5EU7 A;  3ZT2 A;  2QW9 A;  1NGD A;  1IO2 A;  4R79 A;  2F4V K;  1IKV A;  5HBM A;  3SMS A;  2YNH A;  4JI0 K;  1HNZ K;  1Q8I A;  3OBW A;  3DMJ A;  4KHY A;  3SUP A;  3QEV A;  4JKB A;  1KRP A;  1ZBL A;  1IBM K;  4B9M A;  5AQF A;  4MO4 A;  1P90 A;  1LV5 A;  2O8B A;  4KHP K;  2RF2 A;  5FPN A;  1RT4 A;  4CED A;  2D5R A;  4CIE A;  1C1A A;  4MLH A;  2HBM A;  3P1G A;  5GAD P;  4JN4 A;  2HST A;  4DFP A;  2YHX A;  1CXQ A;  4H4M A;  2FSN A;  3OS1 A;  1OVQ A;  1ZBH A;  4C1N I;  3G4S N;  1XC3 A;  4KHU A;  3VMF B;  2PYJ A;  2GEM A;  5C15 A;  1QSL A;  4RW7 A;  4MO5 A;  3NAE A;  4K25 A;  1SV5 A;  4DTR A;  5AQN A;  4BRC A;  2ITG A;  3JS6 A;  3I0S A;  1NWK A;  3BUZ B;  4AHU A;  3CQY A;  4OJR A;  4Z4E A;  1I94 K;  3I33 A;  4O8U A;  1J5E K;  3DLH A;  4FK0 A;  3M6G A;  1TVR A;  3MDQ A;  1T6D A;  3HPG A;  5GAE P;  3FLC O;  4M7Y A;  4FPA A;  4C8O A;  2O8E A;  1T05 A;  2YHY A;  4GV9 A;  2QK9 A;  2G8V A;  3VGK A;  3HT3 A;  4CFD A;  3THX A;  3O6W A;  4GKJ K;  4QOZ B;  4CHQ A;  3CFR A;  3AVI A;  4OKK A;  4CF9 A;  2HOE A;  2HF4 A;  3VQ8 A;  1S5J A;  2FF6 A;  3F9M A;  3LDP A;  3J7A P;  1WSH A;  2GX9 A;  3HOS A;  4K0K K;  4CER A;  3L2Q A;  1TK8 A;  5CYM A;  3I8B A;  1VQM N;  1XMO K;  3SBG A;  3O5B A;  3SUN A;  5KPR A;  3DI6 A;  3Q7B A;  5AR0 A;  3KVG A;  2X78 A;  3V1R A;  3LAN A;  2JWK A;  5BRH A;  1J9A A;  5J2Q A;  4IWV A;  1S1U A;  3HI0 A;  1XQS C;  3FZH A;  2E6L A;  2GUP A;  4BVO A;  4FWK A;  1M90 O;  4M3Z A;  4B1X B;  4E7J A;  1KXP A;  4CJS A;  3Q7C A;  2XY8 A;  4F4K A;  4BRG A;  2HMI A;  3H1V X;  1WSE A;  4JLH A;  4I7F A;  3AO3 A;  4N56 A;  1K9M O;  4KAZ A;  3VER A;  5AQX A;  5EXW A;  4CJQ A;  5AQV A;  2UU9 K;  3P4I A;  4IJA A;  1W9H A;  4BG9 A;  1RBS A;  3AVG A;  4LD0 A;  2QWP A;  3FFI A;  4G1Q A;  2E1Y A;  1W7A A;  4JI5 K;  4JKG A;  1Q81 O;  3WNF A;  3LAL A;  3CME N;  3F5T A;  1C0F A;  2O8F B;  4B9V A;  3K59 A;  4YDU C;  1GLJ O;  4NXN K;  1HNI A;  4CFC A;  2VWB A;  5KPT A;  1QSS A;  4YNQ A;  1N6Q A;  3LP2 A;  1QQM A;  4BR0 A;  3J80 O;  3NE6 A;  1WAF A;  4B3S K;  2V7Z A;  1I39 A;  3WNG A;  1U2V A;  4HTL A;  4JI4 K;  4LSN A;  2HVH A;  4CZH A;  3ITH A;  5AQO A;  4FZZ A;  1GOA A;  1SS6 A;  4BRN A;  4MQ3 A;  4JI8 K;  4CF8 A;  4BRP A;  3D2F B;  3JSM A;  1YJ9 N;  3PO4 A;  3VF4 A;  4EP4 A;  1XNR K;  3LL3 A;  3PX6 A;  2KHO A;  3DOK A;  4B9S A;  4C8L A;  4A2A A;  3THY B;  1DEJ A;  1IKW A;  3VEY A;  1KAX A;  3SZ2 A;  4N47 A;  2FXU A;  1HX1 A;  3MCP A;  2PYL A;  1RCH A;  3O1W A;  4PUO A;  1CLQ A;  2ASP A;  2VWJ A;  2VQF K;  4CD3 A;  1RT7 A;  3R9P A;  2KQ2 A;  4DR6 K;  2UUB K;  3D45 A;  1Z25 A;  4FVU A;  3BZC A;  5KTQ A;  1KD1 O;  4KB0 A;  2GTD A;  1OKJ A;  4JV5 K;  5CZ2 A;  2A6A A;  3RMC A;  4WQ4 C;  3ZX2 A;  3QLH A;  3D6R A;  2V52 B;  3TAG A;  3T7Z A;  4CZG A;  1ATR A;  2PFU A;  2Q0U A;  4K43 A;  3V1Q A;  3I56 N;  3ASM A;  3VQA A;  4M45 A;  3J81 O;  3C6T A;  4ISE A;  1L3T A;  4A5B A;  4DTO A;  5C0Y A;  4BAC A;  1BDG A;  2HHX A;  4DTJ A;  4KH5 A;  2O4G A;  1RTI A;  4CES A;  1NGA A;  1BCO A;  3I8D A;  4FOI A;  1HKG A;  1NJZ A;  4ZTJ A;  3MN5 A;  3M8Q A;  3GL1 A;  2OPQ A;  1KCF A;  3BGR A;  3C7N A;  3HBT A;  3KLG A;  3MXJ A;  4OPK A;  1XHX A;  3M8R A;  5AQZ A;  1S1W A;  3KD1 E;  1L3U A;  4PKG A;  1U4B A;  1ZBF A;  2ZQB A;  4BRF A;  4B9U A;  3HP6 A;  2PAV A;  1HNV A;  1BG3 A;  4EHT A;  3KK7 A;  1N34 K;  4QS9 A;  4DSF A;  4CJK A;  4M41 A;  4FLV A;  4IOA L;  4DTN A;  3AA2 A;  4JAX A;  4O8K A;  2ZD1 A;  4H4O A;  2RHK A;  3C65 A;  1HRH A;  1NJX A;  4BRI A;  3HK2 A;  3QES A;  4C23 A;  4OVL A;  4OGE A;  3TU5 A;  4BRM A;  2P9S B;  2I7P A;  5JMV A;  4BR9 A;  1BQN A;  4LF6 K;  4KTZ A;  1FKP A;  5BN8 A;  3TAM A;  1BCM A;  2G8I A;  3KKR A;  3S9H A;  3O4N A;  3K9J A;  1C0U A;  3R1X A;  5KRT A;  3CG7 A;  2ASM A;  3O3H A;  4LF8 K;  1LWF A;  1TGO A;  4ILG B;  1NMN A;  5FPE A;  3THW A;  1XI1 A;  3NVK A;  1ZBI A;  4M3W A;  3VA3 A;  3RWU A;  2DPN A;  3DM2 A;  3SQ4 A;  3SUQ A;  1Q9Y A;  3DXK A;  1GLE G;  4DF4 A;  3NGY A;  4DV7 K;  1BIZ A;  2A5X A;  4CFB A;  3U6F A;  5H1S Q;  4F2R A;  3MXM A;  3L0Q A;  4DU4 A;  1QQO A;  4IO8 A;  3P39 A;  3A0I X;  4YOT A;  1FJG K;  4GY2 B;  3RR7 A;  2P9K A;  4ELV A;  3I0R A;  4DKW A;  4NCA A;  3SAG A;  5LJW A;  3L4Q A;  4BRH A;  3TAE A;  4LF4 K;  4BRA A;  1BOT O;  4O0J A;  4AH9 A;  5C24 A;  4PA1 A;  1JCG A;  4E3S A;  3OS0 A;  4K42 A;  4B1Y B;  4DTS A;  2WOM A;  2YI1 A;  1ITG A;  1GOC A;  1T6C A;  2WBN A;  1T7P A;  2BE2 A;  3DYA A;  3CPE A;  3ULE A;  4Z4G A;  2Q97 A;  4UQG A;  2JGU A;  1WSF A;  4BRD A;  4M63 C;  4CVN E;  1WOQ A;  3BF3 A;  4DMN A;  5FPD A;  2Q2R A;  4FWO A;  1WNS A;  3FGU A;  2B6A A;  3A5O C;  3CHW A;  1T8E A;  3R6M A;  2P9I B;  5C25 A;  1G15 A;  2VCP A;  4Z4I A;  3UKR A;  2O8E B;  3LP0 A;  1W97 L;  3QER A;  4NYN A;  5KQ8 A;  5J2N A;  4PL7 A;  4ISG A;  4N5S A;  5GIO A;  1RT2 A;  3CJ9 A;  3NH2 A;  4KB1 A;  4GW6 A;  3DLK A;  3F9K A;  2CGK A;  5AZJ A;  2BH1 A;  1SL2 A;  4BWJ A;  3LPU A;  3V9U A;  1YHQ N;  4W5N A;  1LWC A;  3QET A;  5SWM A;  3AVF A;  5FRO A;  3AVL A;  1QHA A;  3FZK A;  5C12 A;  2YNI A;  3L2U A;  5F0X A;  2ITM A;  4CBW A;  1A5V A;  3OYK A;  4R5P A;  3CM6 A;  3DLE A;  3OVN A;  4L3Q A;  5K14 A;  5AZJ B;  3VEV A;  1S22 A;  3OYJ A;  3C6H A;  2GEL A;  4DQQ A;  1RTD A;  3EKS A;  2QEX N;  1KFD A;  4FWM A;  1X9S A;  4CZI A;  4W5R A;  5I3U A;  2P9L A;  4W5Q A;  2QTD A;  3HJF A;  4I2P A;  4JKG B;  5EX5 A;  3DLB A;  1WUA A;  2QA4 N;  4FL9 A;  1LAW A;  3CQX A;  3I55 N;  2NRV A;  4FJI A;  4FW1 A;  2A42 A;  1JXE A;  1S9G A;  4LH5 A;  1NNE A;  3LDS A;  2XHB A;  4MFB A;  3CC2 N;  3CMA N;  3W3D A;  1ATN A;  2FSJ A;  3HZ6 A;  3ENO A;  3HRG A;  3G6E N;  2D0B A;  3WNH A;  2FBT A;  3C94 A;  1NOZ A;  4BC3 A;  3KWI A;  4QCL A;  1JLB A;  4LC9 B;  3AGR A;  1S6P A;  4FWQ A;  3KK1 A;  3H45 C;  4LFA K;  3C0B A;  4L8R B;  4CGD A;  2E2O A;  5E26 A;  1BA1 A;  3N4P A;  1TK5 A;  5AQG A;  3P5J A;  4AHT A;  1NGG A;  1U47 A;  2E2P A;  3VEN A;  1Q9X A;  1K6Y A;  5JVH L;  3AAQ A;  5FRM A;  3V9W A;  4LH4 A;  3EY1 A;  4CJF A;  2IIR A;  4E0D A;  3HSC A;  3WT0 A;  1HMV A;  4A61 A;  5BR8 K;  5I42 A;  4AIL C;  3VEW A;  4A2B A;  1D9F A;  2FBV A;  1Y64 A;  4N41 A;  4KI4 A;  4CW7 B;  3RRG A;  4CEF A;  4IFY A;  3C6U A;  4Q5V A;  3IUC A;  4BRK A;  4DFJ A;  2YNG A;  1TV6 A;  5HRR A;  2WC9 A;  3SUO A;  2G8K A;  4BGB A;  1O13 A;  4BDP A;  2QKB A;  5E41 A;  2HHW A;  1D9D A;  4IKF A;  1IBL K;  3MWP A;  1X3N A;  2KFN A;  1KVB A;  4H5R A;  3NDK A;  3AGK A;  1K8K B;  4JKA A;  1EO1 A;  4O44 A;  4KKO A;  4CBX A;  1QVG M;  4E19 A;  4JRP A;  3MMV A;  4FOE A;  4CF0 A;  3KLF A;  3SPY A;  4BR7 A;  1T03 A;  2EWS A;  4RW4 A;  3LDQ A;  2KKZ A;  4FO0 A;  1HNX K;  1TKX A;  1RTH A;  1NKB A;  2A1R A;  5BRD A;  5EOY A;  5TKW A;  1JL1 A;  3PIO L;  4H5V A;  3F2K A;  2P9P A;  1WSI A;  4C8N A;  1XWL A;  5HRP A;  1N32 K;  1NLV A;  1VAZ A;  4AM6 A;  2VG7 A;  3AA4 A;  1KFS A;  3VES A;  1ASU A;  3M1F A;  4BWM A;  3RMB A;  1Q7Y O;  4JI7 K;  2O8C A;  5AQU A;  4Z4C A;  3PLA A;  1BIS A;  2CH5 A;  3H08 A;  4I2Q A;  4KPY A;  1HJR A;  4DR3 K;  4WQ5 C;  4JRQ A;  3V4I A;  5JLH A;  3PUF A;  4FJX A;  1EP4 A;  3QO9 A;  3R3L A;  1ZXO A;  2DFH A;  4EHU A;  2W40 A;  2HB5 A;  1C1C A;  2CGJ A;  2XY5 A;  1KSP A;  2WFB A;  1JKH A;  3ULD A;  3FZF A;  2QI2 A;  1L5U A;  1O1W A;  2YV0 X;  3TR8 A;  2P5G A;  3TSU A;  4AHS A;  2KZZ A;  5KGX A;  3EKU A;  4CHY A;  3THY A;  4O0I A;  1Z05 A;  5M1Q A;  4HTU A;  3ZSR A;  2W6K A;  4DR2 K;  4DTM A;  1Q18 A;  1VQ7 N;  1ESV A;  2P9S A;  3AO2 A;  1S6Q A;  2QWR A;  4CJ5 A;  1UAX A;  4HUF A;  1K8A O;  3TAQ A;  3OYL A;  3KTQ A;  3FE1 A;  5AJ3 K;  1X1P A;  3GG4 A;  1IG9 A;  5M1K A;  1WBD A;  2IOC A;  4B8C A;  4KBO A;  3U8X A;  4BRE A;  1D8Y A;  3ZSZ A;  3VN5 A;  5FLX O;  2P9U B;  4E89 A;  3WXL A;  4C1N K;  3BDP A;  3AA5 X;  3K5N A;  3UKU A;  3HVR A;  4YDU A;  4XH1 A;  4B3M K;  4JKH A;  1NGC A;  2WON A;  3ZCM A;  4LFC K;  1RTJ A;  1VSI A;  5ADX A;  1E4F T;  1VRU A;  5CYQ A;  4DTU A;  1FW6 A;  4DSJ A;  4DB3 A;  1NK0 A;  3HO1 A;  3O9S A;  5DK5 A;  1VQ6 N;  4F3O A;  4DF8 A;  2X6S A;  2YJE A;  1JJ2 M;  4ILH A;  3THX B;  3N4Q A;  4M3T A;  3RTV A;  3TPQ A;  4JK7 A;  4JS5 A;  3FZL A;  1LWE A;  3P83 D;  2Z1H A;  1OVY A;  3D7E O;  2BGG A;  1HYS A;  1YI2 N;  1QS4 A;  1E3M A;  1WAJ A;  3RSE B;  3WXI A;  2OAN A;  4CZJ A;  2HHV A;  3VF2 A;  4BC4 A;  5M1N A;  4DV1 K;  2I7N A;  3DXM B;  3T1H K;  3CCR N;  2ZWH A;  2HVI A;  2RKI A;  1MDU B;  3OBY A;  2A40 A;  1UWB A;  3C95 A;  3MK6 A;  5HRS A;  4FWP A;  1REV A;  4HWI A;  4B8A B;  5AQH A;  5BRF A;  3RMA A;  3DXM A;  1N8R O;  1MWK A;  4LY7 A;  4NCG A;  3NFA A;  3CQ8 A;  1EWR A;  4FLY A;  3IRX A;  2NZT A;  4OLB A;  4LF9 K;  3KLI A;  4IDK A;  3OTO K;  4FVM A;  3TI0 A;  4CJW A;  2ASO A;  2E2N A;  2B4J A;  4IZ9 A;  5AQM A;  3CCU N;  1BL3 A;  4H0O A;  4CZK A;  1HKB A;  1GLB G;  3WXK A;  1NK7 A;  5AQW A;  1QVF M;  4CF1 A;  1HQU A;  2ZJQ L;  4H5T A;  4FK2 A;  2VG5 A;  4H03 B;  4M7X A;  3CJA A;  1YAG A;  1NMD A;  1S9E A;  3AVB A;  4RW9 A;  1W2B M;  3ZSX A;  3SJH A;  3HPH A;  4GMJ B;  2NRW A;  3BY5 A;  2HMP A;  4O5B A;  1VSD A;  1T44 A;  3EN9 A;  3JXU A;  4FCY A;  2D1K A;  4AF1 A;  3WQT A;  1GLF O;  1EET A;  3CJB A;  4AHR A;  4Z94 A;  2OPS A;  4BC5 A;  2QKK A;  1EQY A;  2IVN A;  3TTF A;  4IXC A;  4E7K A;  4EZ6 A;  2FC0 A;  2RPI A;  3CYM A;  4B1Z A;  5T7B A;  1I3A A;  4WFN L;  5J2P A;  4PY5 A;  5I9E B;  3LDL A;  3D2F A;  4DFK A;  4YHH K;  5SZT A;  3BP8 A;  4CEC A;  3J8A A;  3QIN A;  4EP5 A;  4JK9 A;  1JLE A;  2BTF A;  1RGI A;  1SQK A;  3AV9 A;  3AVC A;  3SYZ A;  4X64 K;  2O8D B;  3L2R A;  2FBY A;  4KH4 A;  3HXM A;  1VQ9 N;  1HYV A;  1HPM A;  2G8F A;  2Z1I A;  3V6D A;  3T1Y K;  1IH7 A;  3PSI A;  3V9X A;  2HBL A;  3VA0 A;  5DMR A;  4ELT A;  4M3X A;  4BR2 A;  3AVJ A;  1KLN A;  4W5O A;  1GLL O;  4PKH A;  5AQK A;  3OYC A;  3E66 A;  5JVG L;  2GBZ A;  3NF6 A;  1KC8 O;  4CJE A;  4LFB K;  3GOI A;  1CZB A;  3D2E B;  3NGZ A;  1NGB A;  5IWA K;  1W0H A;  4KHW A;  4DU1 A;  5JS2 A;  1DLO A;  1K8K A;  4OLA A;  3QEP A;  4HCB A;  1X9W A;  2UXD K;  3NCI A;  2QWQ A;  1HUX A;  4ZHR A;  5AQP A;  2VYP A;  4B9T A;  4DSI A;  4MLE A;  5FDL A;  4BE2 A;  3S3O A;  3ISN C;  3RVC A;  1BO5 O;  1R0A A;  1ASV A;  1KTQ A;  3G25 A;  4GNI A;  3WXJ A;  4K8Z A;  4E7H A;  3K5L A;  3SCX A;  2D0A A;  4E7I A;  1SKR A;  4FJM A;  1SUQ A;  1HPZ A;  4H0T B;  4CEQ A;  3ZET B;  2Z1G A;  3O3F A;  3TAF A;  4M3Y A;  3ZSW A;  3OA9 A;  3ENB A;  1HKC A;  4DSL A;  4YOX A;  3OHR A;  3K5O A;  4KTW A;  4H8K A;  3QIP A;  2BDP A;  4ZTF A;  3DOL A;  4KO0 A;  4X66 K;  1ZYQ A;  1VQ8 N;  4NLC A;  3U4L A;  4BRO A;  4KV8 A;  5D3G A;  4BE0 A;  3SV3 A;  4CGG A;  1JL2 A;  5GIN A;  3AA3 A;  3C7N B;  4BRQ A;  4CF2 A;  1BI4 B;  4H0X B;  3L2W A;  1D5A A;  5C42 A;  2IAJ A;  3PV8 A;  3NF8 A;  5AQS A;  1XNQ K;  3MED A;  1KQS M;  3A2F A;  5BPL A;  4LF5 K;  3KJV A;  5M1F A;  1NGE A;  4DFM A;  1VQ5 N;  4DSE A;  3EYZ A;  4AHC A;  3IG1 A;  4DR5 K;  2O4I A;  4CE9 A;  1J6Z A;  4JI2 K;  1RT5 A;  4X62 K;  3L3U A;  3OYG A;  1V4T A;  3IFR A;  4CEE A;  1RNH A;  1VSF A;  3K0S A;  3L8B A;  1C6V A;  1JLC A;  1YXQ A;  3DLL L;  3V81 A;  1S1T A;  1B9D A;  3VEX A;  4FJ9 A;  4YOU A;  3ZT4 A;  4DHY A;  3VGM A;  5AQT A;  3SQ1 A;  4CZF A;  3E9L A;  3GE1 A;  3O1B A;  3TWH A;  1L3S A;  3LDN A;  3T69 A;  4FM0 A;  3GDQ A;  4A5A A;  4CJ4 A;  4FYD A;  2E20 A;  5AQQ A;  4B1V A;  3QEI A;  3E1Y A;  3CER A;  5E84 A;  2AJQ A;  3AVH A;  3G10 A;  4BQZ A;  1N33 K;  3NBP A;  4E1N A;  2Y1I A;  1DGK N;  3B6O A;  4O4G A;  3VF6 A;  1NJY A;  1NK6 A;  1LAV A;  2G8W A;  1H1V A;  3VQC A;  4DQI A;  4NO7 A;  4BR4 A;  5KI6 A;  2CGL A;  2IS3 A;  4Y1C A;  5C2F A;  3ZEU B;  4BY9 C;  4XEI A;  3LZI A;  2DFE A;  2QM1 A;  4FM1 A;  3S3N A;  1YTU A;  2F9W A;  3FZM A;  3O9R A;  1RDW X;  3VEO A;  3QDK A;  4B9N A;  3QEW A;  3PSF A;  3U9D A;  3A5N C;  4CGI A;  3O9U A;  3M8S A;  2BAN A;  2F7T A;  4CIF A;  2IVO A;  2HHH K;  3HTV A;  1S1X A;  2ZJP L;  4BRL A;  3QNN A;  4CJU A;  1OH7 A;  5C2D A;  1YTA A;  1E4G T;  4CGF A;  3H6E A;  4RG8 A;  2XY7 A;  1KLM A;  4CJR A;  2IDO A;  1U49 A;  1TAU A;  1LW2 A;  4K8X A;  2HBK A;  2D0P A;  1OH6 A;  3V9Z A;  1QTM A;  2PZS A;  5AQJ A;  1HQE A;  4B1U B;  3R8E A;  3EEQ A;  3S41 A;  5HL7 L;  1KAZ A;  4J2D A;  4CEA A;  3C6A A;  2F9T A;  3J7Z O;  1NGJ A;  2XY6 A;  4FK4 A;  4DSK A;  4BDZ A;  3IMX A;  3DAW A;  3OJU A;  1KAY A;  3CM5 A;  4E1M A;  4IFE A;  4DV4 K;  4HUG A;  4B3R K;  3EZW A;  3DLG A;  3LAK A;  2EHG A;  3NH1 A;  3TSP A;  3RRH A;  1KVC A;  5HRO A;  4OPJ A;  3VOV A;  3TTD A;  3SQ0 A;  3D0P A;  4BE1 A;  3VQE A;  4LSL A;  4OO1 J;  2ZE2 A;  4FJJ A;  4KHN A;  2GUI A;  2QWL A;  4IFV A;  1U45 A;  2B5J A;  4JKF A;  4DV5 K;  1NOY A;  1S1V A;  4CHO A;  2YJF A;  4H0P A;  3TAN A;  3ZLJ A;  2AP1 A;  3MX2 A;  5C10 A;  1OH5 A;  3M8P A;  1ZBU A;  4IEE A;  1DTQ A;  2UYT A;  3MEC A;  2HNY A;  2CH6 A;  3E9P A;  2ZF5 O;  1IKX A;  1P8Z A;  4DR1 K;  4FLZ A;  2ZJR L;  1ILY A;  4DQR A;  3TSQ A;  3PX0 A;  3OYA A;  2Q36 A;  3E01 A;  1SKW A;  4CBU A;  1VSJ A;  3SAH A;  1RIL A;  2O8B B;  2UUA K;  2E8A A;  2D4W A;  1Z26 A;  4F8R A;  1R59 O;  1SZ2 A;  1EX4 A;  3S3M A;  5KRS A;  2E2Q A;  1NGF A;  1WN7 A;  3KLH A;  1GOB A;  3SPZ A;  5F2R A;  3CF5 L;  5AZI B;  5J1E A;  4GV3 A;  1TYQ A;  1VHX A;  2P9K B;  1T3V A;  4FJ7 A;  4B9L A;  1FKO A;  2OZM A;  4HCC A;  2E5L K;  3FR0 A;  4CJL A;  3O4W A;  2OYQ A;  3CD6 N;  3M5R A;  3OS2 A;  1RBT A;  1TAQ A;  3CJC A;  3KK2 A;  3WQU A;  4WQ4 A;  4CZM A;  2H3G X;  4QAG A;  2NRR A;  1VSH A;  4OKJ A;  4BC2 A;  2QXL A;  5AQL A;  4YFU A;  3UB5 A;  2P51 A;  1WB9 A;  1X9J A;  4UY8 O;  1TKT A;  5BR9 A;  3K5M A;  3VQQ A;  2FSK A;  2HND A;  2ATQ A;  3MX5 A;  4KHQ A;  4JI6 K;  4M42 A;  3ZSQ A;  4FJG A;  3VQD A;  4CGH A;  3W0L A;  1TK0 A;  1K73 O;  4PL8 A;  4J2E A;  3NMU A;  4FM2 A;  5HP1 A;  1TL3 A;  3L3V A;  2Q3S A;  3T1A A;  4C8K A;  1RBU A;  3CJ1 A;  3T19 A;  3KIO A;  3VPZ A;  2PY5 A;  2DTU A;  1WSJ A;  4YY3 K;  3G0Z A;  4FWS A;  2IC3 A;  3O9Q A;  1ATS A;  4WF9 L;  3CI5 A;  4RTF D;  2XRI A;  4WQ5 A;  2P9I A;  1JCF A;  3VQ6 A;  1JLA A;  3KZB A;  1YJW N;  4V19 S;  1JLG A;  1BGX T;  5F1X A;  3MN6 A;  2O8D A;  3CFO A;  5CR4 A;  4CEO A;  2ETJ A;  2Z1J A;  4ILJ A;  2HHQ A;  3CC4 N;  4JHD A;  4H0Y B;  2HF3 A;  1FXX A;  3AVM A;  1RDA A;  3DWL A;  3SJJ A;  2XO7 A;  1TUU A;  4CJ3 A;  5CE3 A;  5GIP A;  3HPO A;  4J2B A;  3EL2 A;  4FJH A;  5CY4 A;  3B8A X;  4RCH A;  1X9M A;  5AQR A;  4KHS A;  4WFB L;  3L4I A;  2W41 A;  3O3G A;  2DY4 A;  3IDH A;  1LOT B;  3VQ9 A;  4FWN A;  3CPW M;  3ALY A;  3L2V A;  2Q0R A;  4B08 A;  4H5N A;  2P9N A;  3HST B;  3OYD A;  1X3M A;  2P9P B;  3QIC A;  4B3O A;  4IDH A;  3O9T A;  1XMQ K;  5CZ1 A;  3LP3 A;  3MN9 A;  1TL1 A;  1ZC6 A;  3VET A;  4DG1 A;  4FLX A;  1VQP N;  1QSY A;  2JLE A;  3HM8 A;  2IGI A;  2G8U A;  1BI4 A;  4FXD A;  3ZT1 A;  3ZSO A;  4JNE A;  4X65 K;  2O8C B;  4MDB A;  1L3V A;  1S72 N;  4JK8 A;  3NF7 A;  4EIA A;  1NJW A;  3A8Y A;  4U7B A;  1NJI O;  2W6L A;  1WBB A;  3ZT3 A;  2RN2 A;  3AVN A;  1JCE A;  4M3U A;  3U9Z A;  2OPP A;  1EXQ A;  3AY9 A;  4JD2 A;  1YF5 L;  5IT9 O;  1ASW A;  4DV6 K;  4OGC A;  3MEG A;  3KD5 E;  2HHT A;  1LW0 A;  1C0T A;  1NU0 A;  2E6M A;  2UXB K;  1C1B A;  3DLR A;  4WE1 A;  2NNW A; 
#chains in the Genus database with same CATH homology
 1BIU A;  1WNS A;  2LSN A;  2B6A A;  4CJP A;  1T8E A;  1IH7 A;  3OYH A;  3V9X A;  4OKE A;  1CXU A;  3VA0 A;  5DMR A;  4ELT A;  5C25 A;  4M3X A;  1VSE A;  3RMD A;  3AVJ A;  1KLN A;  3JYT A;  4W5O A;  1XC9 A;  2G8H A;  1G15 A;  1A5X A;  3OYC A;  4Z4I A;  4CJT A;  1BHL A;  2GBZ A;  3NF6 A;  4CJE A;  3LAM A;  3LP0 A;  3QER A;  1CZB A;  2FBX A;  3NGZ A;  2QXF A;  4NCB A;  1W0H A;  4KHW A;  3ZT0 A;  2P1J A;  4NYN A;  5FRN A;  3HP9 A;  4DU1 A;  5J2N A;  2HNZ A;  5EU7 A;  3ZT2 A;  1NK4 A;  5JS2 A;  1DLO A;  4CK1 A;  1RT2 A;  4N5S A;  4OLA A;  3QEP A;  3NH2 A;  1IO2 A;  4M3R A;  4HCB A;  4KFB A;  4GW6 A;  4KB1 A;  4FJ8 A;  2A1S A;  3DLK A;  3F9K A;  1X9W A;  4DQP A;  1IKV A;  5KGW A;  5HBM A;  1SL2 A;  2YNH A;  4BWJ A;  3LPU A;  3NCI A;  3V9U A;  1Q8I A;  4ZHR A;  3SQ2 A;  3DMJ A;  1LWC A;  4JS4 A;  3QET A;  4B9T A;  4DSI A;  4KHY A;  4W5N A;  3SUP A;  5SWM A;  3QEV A;  5FDL A;  3MEE A;  3HM9 A;  4BE2 A;  3S3O A;  3AVF A;  5FRO A;  4FLT A;  3ISN C;  4DTP A;  3AVL A;  1KRP A;  2F8S A;  3DRP A;  4FJK A;  1ZBL A;  2YNI A;  2KFZ A;  3L2U A;  4B9M A;  3UIQ A;  3DRR A;  3OYB A;  1R0A A;  1ASV A;  1KTQ A;  1LV5 A;  4K8Z A;  4E7H A;  3K5L A;  3SCX A;  2D0A A;  3VQ4 A;  1A5V A;  4E7I A;  1SKR A;  4FJM A;  1SUQ A;  2RF2 A;  1HPZ A;  3OYK A;  4KTQ A;  4CEQ A;  1RT4 A;  4R5P A;  4CEB A;  2Z1G A;  3CM6 A;  1Y97 A;  3DLE A;  3OVN A;  2D5R A;  4CED A;  4CIE A;  3O3F A;  3TAF A;  1J5O A;  4HVJ A;  3ZSW A;  5K14 A;  4M3Y A;  1C1A A;  3OYJ A;  3P1G A;  4DSL A;  4DQQ A;  1RTD A;  3K2P A;  4FJL A;  4DFP A;  3K5O A;  4KTW A;  1CXQ A;  3QIP A;  1KFD A;  4H4M A;  4H8K A;  1X9S A;  4ZTF A;  4W5R A;  5I3U A;  2BDP A;  4W5Q A;  3DOL A;  4KO0 A;  3OS1 A;  1ZYQ A;  1ZBH A;  3HJF A;  4CJV A;  4ICL A;  4I2P A;  2E4L A;  3AVK A;  4KHU A;  2YHA A;  4KV8 A;  2PYJ A;  5D3G A;  4BE0 A;  3SV3 A;  4E7L A;  4RW7 A;  4CGG A;  1QSL A;  3DLB A;  1JL2 A;  3NAE A;  1SV5 A;  4DTR A;  3AA3 A;  3L2W A;  4CF2 A;  2R7Y A;  1BI4 B;  1LAW A;  1D5A A;  5C42 A;  4HUE A;  2ITG A;  2IAJ A;  4RW6 A;  3PV8 A;  3I0S A;  3NF8 A;  4FJI A;  3O4Q A;  4FW1 A;  4AHU A;  1JXE A;  1S9G A;  3MED A;  4LH5 A;  4DTX A;  3LDS A;  4OJR A;  3OY9 A;  4MFB A;  2XHB A;  4Z4E A;  3A2F A;  1UOC A;  1EKE A;  3KJV A;  4CK3 A;  2W42 A;  4DFM A;  3DLH A;  4FK0 A;  1JXB A;  1TVR A;  2D0B A;  3U3G A;  3HPG A;  2FBT A;  3WNH A;  3C94 A;  4DSE A;  1NOZ A;  3EYZ A;  4N76 A;  2KZM A;  4AHC A;  3IG1 A;  2O4I A;  4QCL A;  1JLB A;  4C8O A;  1QQC A;  1S6P A;  3OYI A;  2GV9 A;  4CE9 A;  3KK1 A;  2VG6 A;  1T05 A;  2QK9 A;  4L8R B;  1RT5 A;  4CGD A;  2G8V A;  3L3U A;  3TAB A;  3HT3 A;  4CFD A;  3OYG A;  3MXI A;  4CEE A;  1TK5 A;  3HYF A;  4FW2 A;  4QOZ B;  4CHQ A;  1RNH A;  1VSF A;  3P5J A;  3AVI A;  3L8B A;  3CFR A;  3T3F A;  1C6V A;  1JLC A;  4OKK A;  4CF9 A;  4FZY A;  3V81 A;  1S1T A;  1B9D A;  3VQ8 A;  1S5J A;  4FJ9 A;  3THV A;  3ZT4 A;  2VWK A;  4DLE A;  4AHT A;  4DQS A;  1U47 A;  1TKD A;  1WSH A;  3SQ1 A;  1Q9X A;  2P5O A;  1K6Y A;  5FRM A;  3TWH A;  4CER A;  3L2Q A;  1TK8 A;  5CYM A;  3V9W A;  1L3S A;  4FM0 A;  4LH4 A;  3EY1 A;  3VQB A;  4CJF A;  4E0D A;  1RDB A;  4CJ4 A;  4FJN A;  4FYD A;  3SUN A;  1HMV A;  3DI6 A;  4CHP A;  5I42 A;  3QEI A;  4AIL C;  2X78 A;  1VSL A;  2FBV A;  1D9F A;  4N41 A;  4KI4 A;  3V1R A;  3RRG A;  3LAN A;  3AVH A;  4CEF A;  4IFY A;  2AJQ A;  3QEX A;  3G10 A;  1J9A A;  5J2Q A;  1IKY A;  3C6U A;  3NBP A;  2Y1J A;  1S1U A;  4E1N A;  4Q5V A;  4DLG A;  4KRE A;  4KRF A;  2HHU A;  2E6L A;  4DFJ A;  1U48 A;  2YNG A;  1NK5 A;  1MU2 A;  1TV6 A;  2Y1I A;  4DS5 A;  5HRR A;  3B6O A;  4O4G A;  3NF9 A;  3SUO A;  2G8K A;  1NJY A;  4NYF A;  1NK6 A;  4M3Z A;  1J54 A;  1LAV A;  4BDP A;  2OZS A;  2G8W A;  2QKB A;  5E41 A;  2HHW A;  1D9D A;  4EZ9 A;  3PY8 A;  4E7J A;  4IKF A;  3VQC A;  4DQI A;  4CJS A;  2KFN A;  1KVB A;  2XY8 A;  3NDK A;  4F4K A;  5KI6 A;  4O44 A;  4CIG A;  4BDY A;  2HMI A;  2IS3 A;  4KKO A;  1WSE A;  4JLH A;  4I7F A;  3AO3 A;  4Y1C A;  4W5T A;  3LZI A;  2DFE A;  4FM1 A;  3S3N A;  1YTU A;  4E19 A;  4N56 A;  3SI6 A;  4KAZ A;  3SNN A;  4JRP A;  1XHZ A;  3KLF A;  4CF0 A;  3SPY A;  3TAR A;  4CJQ A;  1T03 A;  4CCH A;  1NKE A;  4B9N A;  3QEW A;  4RW4 A;  1W9H A;  4F3T A;  4CGI A;  2YHB A;  1RBS A;  3AVG A;  1TKX A;  4LD0 A;  3FFI A;  2X74 A;  2KW4 A;  3M8S A;  1RT1 A;  2BAN A;  4CIF A;  1RTH A;  1NKB A;  4G1Q A;  2A1R A;  1S1X A;  3QNN A;  4CJU A;  3WNF A;  1VSK A;  1YTA A;  4CGF A;  4Q0B A;  3LAL A;  4RG8 A;  2F8T A;  1FK9 A;  2XY7 A;  1KLM A;  1JL1 A;  3NH0 A;  4CJR A;  2IDO A;  1U49 A;  4B9V A;  3K59 A;  1LW2 A;  1TAU A;  4K8X A;  3V1O A;  2KTQ A;  3QNO A;  1WSI A;  3V9Z A;  4C8N A;  1HNI A;  1XWL A;  1QTM A;  1HYZ A;  4CFC A;  2PZS A;  5HRP A;  1QSS A;  1HQE A;  4YNQ A;  1N6Q A;  4FLW A;  3LP2 A;  2D0C A;  2VG7 A;  3AA4 A;  1NK9 A;  1KFS A;  3NE6 A;  4CEA A;  4J2D A;  1WAF A;  3V6D A;  4I9Q A;  1QHT A;  2XY6 A;  4FK4 A;  4DSK A;  1I39 A;  1ASU A;  4BDZ A;  4BWM A;  3WNG A;  3RMB A;  4Z4C A;  1BIS A;  3OJU A;  3ZSY A;  3HL8 A;  3H08 A;  4I2Q A;  3AO5 A;  4LSN A;  4KPY A;  3CM5 A;  2HVH A;  4E1M A;  1HJR A;  4C8M A;  4HUG A;  3ITH A;  4JRQ A;  4FJ5 A;  3DLG A;  3LAK A;  2EHG A;  3OYM A;  3V4I A;  3PUF A;  4FZZ A;  3NH1 A;  4FJX A;  1GOA A;  1A5W A;  1EP4 A;  3QO9 A;  3VQ7 A;  4MQ3 A;  3RRH A;  1KVC A;  2DFH A;  5HRO A;  4CF8 A;  2EX3 A;  4OPJ A;  1B9F A;  2HB5 A;  3JSM A;  3LP1 A;  1C1C A;  3SQ0 A;  3D0P A;  2XY5 A;  1KSP A;  2YNF A;  3PO4 A;  4EP4 A;  3VQE A;  1JKH A;  4BE1 A;  4LSL A;  5HRN A;  2ZE2 A;  3ULD A;  3PX6 A;  4FJJ A;  4KHN A;  2GUI A;  4IFV A;  1L5U A;  1U45 A;  1O1W A;  2YV0 X;  3DOK A;  3TR8 A;  2B5J A;  4CK2 A;  1NOY A;  2P5G A;  4B9S A;  1S1V A;  4CHO A;  4C8L A;  4AHS A;  1IKW A;  1RT6 A;  3TAN A;  3K57 A;  2KZZ A;  5KGX A;  3SZ2 A;  1WSG A;  4CHY A;  4N47 A;  4O0I A;  2PYL A;  4HTU A;  1RCH A;  1RT3 A;  3M8P A;  1ZBU A;  2OPR A;  3ZSR A;  4PUO A;  1CLQ A;  2VWJ A;  4DTM A;  4GVM A;  1RT7 A;  1WLJ A;  3AO2 A;  2KQ2 A;  1DTQ A;  1S6Q A;  3MEC A;  2HNY A;  4CJ5 A;  4CHN A;  3D45 A;  1UAX A;  1Z25 A;  4HUF A;  1NKC A;  4Z4H A;  1IKX A;  3TAQ A;  4Z0U A;  3OYL A;  1VSM A;  4FLZ A;  3KTQ A;  5KTQ A;  4KB0 A;  4Z4F A;  4DQR A;  1X1P A;  5CZ2 A;  3PX0 A;  3RMC A;  3OYA A;  3E01 A;  1SKS A;  1SKW A;  3QLH A;  1IG9 A;  1VSJ A;  2IOC A;  4B8C A;  3TAG A;  1RIL A;  1D8Y A;  3KKS A;  4F8R A;  1Z26 A;  3V1Q A;  1YVU A;  1EX4 A;  3ZSZ A;  3VN5 A;  3ASM A;  3VQA A;  3S3M A;  4E89 A;  4M45 A;  5KRS A;  3C6T A;  5HLF A;  1WN7 A;  1L3T A;  1F21 A;  3KLH A;  3BDP A;  4DTO A;  1GOB A;  3AA5 X;  4BAC A;  3SPZ A;  3K5N A;  3HVR A;  2HHX A;  5J1E A;  3KD5 E;  3LWL A;  4DTJ A;  2WON A;  2O4G A;  3ZCM A;  1RTI A;  4FZX C;  4CES A;  1RTJ A;  1VSI A;  4FJ7 A;  4B9L A;  1BCO A;  4TSX A;  1VRU A;  5CYQ A;  1TKZ A;  4CHZ A;  1FKO A;  3I8D A;  4DTU A;  2OZM A;  1NK0 A;  4DSJ A;  3HO1 A;  4HCC A;  2X6N A;  4PWD A;  3EZ5 A;  5DK5 A;  4CJL A;  2OYQ A;  3OS2 A;  1UA1 A;  1RBT A;  1TAQ A;  4AHV A;  3KK2 A;  4DF8 A;  4ZTJ A;  1NJZ A;  4F3O A;  3M8Q A;  2X6S A;  2OPQ A;  1KCF A;  3BGR A;  4QAG A;  3KLG A;  3MXJ A;  4CFA A;  4OPK A;  1VSH A;  3SV4 A;  1XHX A;  4OKJ A;  3M8R A;  4O55 A;  1S1W A;  3KD1 E;  1L3U A;  3RTV A;  4M3T A;  4YFU A;  4JS5 A;  3NGI A;  1LWE A;  2P51 A;  1ZBF A;  3P83 D;  3F73 A;  1U4B A;  1HYV A;  2Z1H A;  3ZSV A;  2ZQB A;  4B9U A;  1TKT A;  2BGG A;  3LPT A;  3K5M A;  1HYS A;  2DFF A;  3VQQ A;  2HND A;  2ATQ A;  2YKM A;  1QS4 A;  3QIO A;  3HP6 A;  1HNV A;  4KHQ A;  4PQU A;  4M42 A;  2NUB A;  3ZSQ A;  1WAJ A;  3OJS A;  4FJG A;  3VQD A;  1SL0 A;  4CGH A;  3IAY A;  4DSF A;  1TK0 A;  4J2E A;  4CJK A;  1RBV A;  4M41 A;  4FM2 A;  4FLV A;  1TL3 A;  3L3V A;  5HP1 A;  4DTN A;  3AA2 A;  2HHV A;  2Q3S A;  3RR8 A;  3T1A A;  4C8K A;  4I9L A;  2ZD1 A;  1RBU A;  4H4O A;  3DRS A;  1HRH A;  1NJX A;  3T19 A;  3LZJ A;  3HK2 A;  3KIO A;  1N5Y A;  3QES A;  2PY5 A;  2DTU A;  1WSJ A;  3G0Z A;  4OVL A;  4OGE A;  2IC3 A;  1JLQ A;  1VRT A;  2HVI A;  1RDD A;  2RKI A;  2XRI A;  3IS9 A;  1UWB A;  3C95 A;  4CGJ A;  1BQN A;  3VQ6 A;  1JLA A;  5HRS A;  4KTZ A;  1REV A;  1BQM A;  3AVA A;  1FKP A;  3PO5 A;  1JLG A;  1BGX T;  3TAM A;  1BCM A;  4B8A B;  2HW3 A;  3CFO A;  3MAQ A;  2G8I A;  2OA8 A;  3KKR A;  4CEO A;  2ETJ A;  1KVA A;  2Z1J A;  3OYE A;  3S9H A;  3PX4 A;  3RMA A;  2HHQ A;  3O4N A;  1FXX A;  3AVM A;  1RDA A;  3WNE A;  4J2A A;  3OYF A;  4LY7 A;  4NCG A;  1C0U A;  3NFA A;  3CQ8 A;  4FLY A;  3IRX A;  5KRT A;  3CG7 A;  3O3H A;  3SJJ A;  4OLB A;  3V9S A;  1LWF A;  1TGO A;  3KLI A;  2XO7 A;  1XI1 A;  4IDK A;  1NK8 A;  4CJ3 A;  4RW8 A;  3HPO A;  4J2B A;  1ZBI A;  4FVM A;  3VA3 A;  3RWU A;  4FJH A;  3TI0 A;  4CJW A;  5CY4 A;  4M3W A;  2I5J A;  2B4J A;  3DM2 A;  3SQ4 A;  1X9M A;  1BL3 A;  4KHS A;  3SUQ A;  1Q9Y A;  1SL1 A;  4DF4 A;  3O3G A;  2DY4 A;  3NGY A;  1BIZ A;  4IG3 A;  3AO1 A;  5J2M A;  4CFB A;  3U6F A;  3B6P A;  3VQ9 A;  1NK7 A;  4F2R A;  4CF1 A;  1HQU A;  4FLU A;  3ALY A;  3MXM A;  4FK2 A;  4DWI A;  4DU4 A;  4IG0 A;  2VG5 A;  3L2V A;  4B08 A;  1U04 A;  1S9E A;  3AVB A;  3HST B;  3OYD A;  3TAP A;  1JLF A;  4RW9 A;  3LWM A;  3U3Y A;  4CEZ A;  4KI6 A;  4B3O A;  3ZSX A;  1B92 A;  3HPH A;  3RR7 A;  4ELV A;  4GMJ B;  3I0R A;  1RBR A;  5CZ1 A;  3LP3 A;  3VQP A;  1CZ9 A;  4O5B A;  4NCA A;  1VSD A;  3OYN A;  1TL1 A;  3HVT A;  4DG1 A;  3NHG A;  4FLX A;  1UA0 A;  1QSY A;  2JLE A;  1YT3 A;  2F96 A;  4FCY A;  2IGI A;  2G8U A;  4XIU A;  4DU3 A;  3TAE A;  1QE1 A;  1BI4 A;  4FXD A;  3ZT1 A;  4O0J A;  3ZSO A;  1EET A;  2YKN A;  4AH9 A;  5C24 A;  4PA1 A;  4HHT A;  4AHR A;  4DS4 A;  2OPS A;  1L3V A;  2QKK A;  4ID5 A;  3NF7 A;  1NJW A;  4IBN A;  1VK0 A;  4E3S A;  3OS0 A;  5JS1 A;  3ZT3 A;  4E7K A;  4EZ6 A;  3KK3 A;  2FC0 A;  3CYM A;  2RPI A;  5T7B A;  2WOM A;  1I3A A;  4DTS A;  2RN2 A;  5J2P A;  1ITG A;  4PY5 A;  3AVN A;  1RDC A;  3K58 A;  4DFK A;  1GOC A;  4F2S A;  4M3U A;  4ELU A;  2OPP A;  1EXQ A;  1T7P A;  2BE2 A;  1DTT A;  3DYA A;  5SZT A;  4CEC A;  1ASW A;  3QIN A;  4EP5 A;  4Z4G A;  4OGC A;  1J53 A;  3MEG A;  3CFP A;  4Y1D A;  1LW0 A;  2JGU A;  3AO4 A;  4UQG A;  1WSF A;  3KLE A;  1JLE A;  2HHT A;  2HHS A;  1C0M A;  1C0T A;  3AV9 A;  3AVC A;  4DMN A;  3SYZ A;  3L2R A;  2FBY A;  3HXM A;  3VQ5 A;  2E6M A;  4ID1 A;  1C1B A;  3DLR A;  4WE1 A;  2G8F A;  2Z1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...