5KGXA

Hiv1 catalytic core domain in complex with an inhibitor (2~{s})-2-[3-(3,4-dihydro-2~{h}-chromen-6-yl)-1-methyl-indol-2-yl]-2-[(2-methylpropan-2-yl)oxy]ethanoic acid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
153
structure length
134
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKTAWWAGIKQEESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Indole-based allosteric inhibitors of HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
molecule keywords Integrase
total genus 45
structure length 134
sequence length 153
ec nomenclature
pdb deposition date 2016-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5kgxA00
3V1OA 2BDPA 2ETJA 2QXFA 3OYEA 3LWMA 3NFAA 1VSFA 1QE1A 4FLWA 1RT1A 5HRPA 3WNEA 3OYNA 4B9MA 5CY4A 1IKXA 4FLXA 3NAEA 1ASWA 3KKSA 5JS1A 1NK7A 3SQ1A 1SL1A 1C0MA 4FJMA 4CJLA 3EZ5A 1XHZA 4M3TA 1DTTA 4Z4CA 5C25A 2YHAA 4KTWA 1NK4A 4KV8A 3V9XA 3K57A 1TK5A 1N5YA 3TAEA 2YNFA 4FZXC 4XIUA 3LP0A 1RILA 1Q8IA 2O4GA 4MQ3A 5HRSA 3ZT3A 3E01A 1LWEA 1TKDA 4DSKA 2OPQA 4R5PA 4C8NA 4CEAA 1RBVA 5HBMA 4ID1A 4DTSA 3QETA 2FBVA 3HSTB 3ZSXA 4CFAA 1IKVA 2EX3A 4ZTFA 4CJVA 4KHWA 1BCMA 1GOAA 4CHOA 4E1MA 4BE1A 3QERA 4AHTA 3TAPA 4H8KA 3QIPA 4RW9A 4E1NA 5KRSA 1HJRA 1RDBA 1TVRA 1XHXA 3AVBA 1YVUA 1BL3A 2YV0X 3OJUA 3U6FA 2LSNA 4J2EA 1QQCA 3NDKA 1DLOA 1BIZA 3V1RA 3KTQA 4BACA 4CK2A 4CIGA 3O4QA 2E4LA 4CEQA 1RT3A 4KRFA 3VQAA 1JLAA 2HMIA 1WSGA 4BE2A 4DTJA 3ZSZA 1NJWA 1FKOA 1RBRA 4CHZA 4JRPA 4N47A 3U3YA 4NCBA 5DK5A 3AVMA 1SKSA 2HW3A 1TAQA 1QS4A 2HVHA 4CEBA 3HVRA 4GVMA 2A1RA 2XY8A 4FM2A 4M45A 1C0UA 4FK4A 4CJ5A 1RT7A 3LANA 4CGDA 3DOKA 1YT3A 3SV3A 4B8CA 3V9SA 3HO1A 1SKWA 4DQPA 4CERA 3M8SA 3AVIA 3AO5A 1ZBHA 3EY1A 4AHSA 4NCAA 3PV8A 4FLZA 4J2AA 4CHQA 4CJQA 3ZT1A 2YKNA 5KRTA 1XI1A 4Y1CA 3ITHA 1UOCA 4B9SA 4FXDA 2HHTA 4E19A 2RPIA 3S3OA 4K8ZA 1NJXA 4CJRA 3PY8A 1GOBA 3L2VA 3VQDA 2KW4A 2R7YA 1U4BA 1R0AA 1Y97A 3AVAA 1KVCA 4O4GA 4CIFA 1T7PA 1NJZA 2VG6A 4CF2A 4KREA 4DG1A 3OS0A 4ELUA 1VRUA 4FJXA 2OPRA 3LP2A 3CYMA 2HHSA 1T03A 4B08A 4CEZA 4O5BA 4BWJA 4CIEA 5CYMA 4CHNA 3DLRA 3NH2A 1WLJA 3KK2A 1NOYA 2KFZA 1IKYA 4DTMA 4CEOA 1HQUA 3NGIA 3L3VA 1HNVA 4C8KA 1RTDA 1VSMA 3KK3A 2IS3A 2VWKA 1CZBA 1SKRA 3OVNA 1QSSA 4IKFA 4N76A 3KLHA 1NKBA 3KD5E 1KTQA 1RBTA 4CEDA 1G15A 2ZD1A 4YNQA 3JYTA 4M3YA 3RMBA 4LD0A 3WNFA 3OY9A 2KFNA 1Q9YA 4BE0A 2FBYA 3DOLA 1J54A 3HYFA 4CCHA 3TAMA 4YFUA 3OYFA 3SJJA 1F21A 1WSFA 3OYDA 3THVA 2ZQBA 4CJTA 2PY5A 1JKHA 2Z1GA 2F96A 1BQNA 4FCYA 3P5JA 3AVLA 4DSLA 3SQ4A 1S1UA 1HQEA 1XWLA 2YNIA 3QEXA 3DRPA 4IDKA 4CJWA 3PO4A 2HVIA 5KGXA 1RTJA 1RTIA 3VQ9A 3NCIA 4FK2A 4JLHA 3AVCA 5CZ1A 2B4JA 3QEWA 2BANA 4HCBA 3C95A 4MFBA 5HRRA 4DQQA 3IS9A 4O0JA 3SCXA 2ITGA 4FJJA 1VSKA 3NGZA 4CJSA 4BDPA 3SUOA 3RR7A 1RBSA 3D0PA 4DWIA 4FJHA 3C6UA 4W5TA 3LZJA 2KZMA 4CHPA 4Z4EA 4DU1A 3F9KA 3KD1E 4OLBA 4UQGA 1TL3A 3VQPA 2P5GA 3FFIA 1JLGA 1C1BA 2RKIA 2YKMA 2YNGA 3KLIA 3OYLA 4RW6A 4IBNA 3LAKA 3QNNA 3TAQA 4F8RA 1W9HA 2XHBA 3VQBA 3HPOA 2HHWA 3L3UA 4F2RA 3C94A 4CJFA 2Y1JA 4G1QA 3PO5A 1S6QA 1J53A 4ZHRA 4FJ5A 3OYGA 3VQEA 4FLTA 4DTRA 4C8OA 4FLVA 2WOMA 4FJ9A 4B9TA 4EP4A 3TWHA 1VSLA 3NF7A 1X9SA 1IO2A 4C8LA 3AV9A 4DMNA 3QEPA 3O3GA 3AVJA 4PQUA 4FJ7A 1ZBLA 4DSJA 1KFDA 1BGXT 3KLGA 5CZ2A 3SQ2A 4B9VA 1L3VA 4B9NA 3OYCA 3AVGA 1LAVA 3HT3A 4F2SA 3PUFA 3VQ4A 3S9HA 1S6PA 3G10A 2OZSA 4LSLA 1K6YA 2HNDA 4Z4HA 3KLEA 1HYSA 4WE1A 1ZBUA 4LH4A 1ASUA 1UA1A 4DSIA 3P83D 1ZBIA 4PY5A 3HP6A 4QAGA 4DSEA 3EYZA 4DTOA 4AHVA 1C6VA 1LWFA 1RDAA 4Y1DA 4OKEA 3SUPA 4KHQA 1VRTA 1NKEA 1FKPA 1J5OA 5FROA 4HTUA 2GV9A 4OGEA 1BCOA 3DYAA 3NH1A 3V9ZA 1LWCA 4ELVA 3MXMA 2I5JA 3I0RA 1RDCA 4CFCA 4CGIA 1RT6A 1TL1A 1RT5A 4AH9A 4JRQA 3M8QA 3HK2A 3I8DA 3O4NA 4E7JA 5I42A 4Q0BA 1D5AA 3CFOA 2E6LA 1JXBA 3T3FA 3DLHA 1WN7A 1JLFA 1HPZA 2HB5A 2IGIA 5E41A 3SV4A 4DF8A 2KTQA 4FW2A 3T1AA 3D45A 3QEVA 2FBXA 1QTMA 1VSJA 1VSIA 3K59A 4B9LA 4EZ9A 3MXJA 3NHGA 1X9MA 4E3SA 3ULDA 4CGHA 3QINA 4ICLA 3RTVA 5SWMA 4O0IA 3LDSA 3ZT2A 3S3NA 2G8HA 2O4IA 1SL2A 4ID5A 2YHBA 3VQ6A 4BDYA 1EX4A 2W42A 4AILC 4FM1A 1WAFA 1SUQA 4I7FA 4RW8A 3CFRA 1NOZA 3S3MA 1U45A 4DQIA 4OPJA 3DRRA 3L2RA 3VQ7A 1BHLA 4CK3A 3KJVA 4H4MA 3ZT4A 4KKOA 2RN2A 2DFHA 3L8BA 1U47A 1S1XA 4JS4A 1D9DA 4CESA 3AVHA 4DFMA 3LAMA 1VSDA 3TAFA 4CJEA 4CFDA 2JGUA 4CJKA 2PYJA 3QLHA 3NF9A 4FLYA 3LWLA 1JLCA 1TK8A 4KI4A 4I9QA 3LPUA 4FW1A 3K5MA 4W5QA 1RBUA 3VQQA 3BGRA 1JLQA 4LSNA 2XRIA 5HROA 3IRXA 1TKTA 1L3TA 4AHRA 5I3UA 1Z25A 2ZE2A 4KHNA 2F8SA 3AVFA 4KFBA 2DTUA 4H4OA 4CEFA 4FJLA 3ZSOA 1NK5A 4HVJA 1RT4A 1ZYQA 5D3GA 3DLGA 4M42A 4FZYA 5T7BA 5C24A 1TKZA 4DS4A 4DU3A 4HUFA 2IDOA 1CLQA 2DY4A 2IC3A 4TSXA 3V9UA 3OJSA 4DF4A 3OYAA 2Q3SA 4FYDA 3O3HA 3HXMA 5KTQA 1QSLA 1KSPA 3P1GA 3PX0A 4O44A 3MEDA 3VA0A 2WONA 2X6SA 1KVBA 4FJNA 1U48A 2GUIA 3H08A 4PA1A 4ELTA 3RMCA 2OYQA 4B3OA 3NBPA 4DLEA 4E7KA 1KLNA 2OPSA 1S9EA 1WSJA 3VQ8A 4CJPA 3QIOA 4AHUA 4OPKA 4KB1A 4PUOA 4GMJB 4M3ZA 2BGGA 1D9FA 1RT2A 4NYNA 4CK1A 1X1PA 2KQ2A 4CF1A 3WNGA 2OA8A 2X74A 3DLEA 4RW7A 5CYQA 4CF9A 4C8MA 4M3WA 3NF6A 3HPHA 2NUBA 3ZSRA 4DSFA 2QK9A 4DFKA 1LW2A 1REVA 4OJRA 3VQCA 3RMDA 1I39A 2D5RA 3ZSVA 4M3UA 1YTUA 5C42A 2G8UA 2HHXA 3TR8A 1EP4A 4E89A 1VSHA 1A5VA 1JXEA 1IG9A 4W5NA 1HRHA 3HPGA 4RG8A 4CJUA 4DFPA 3V6DA 3VQ5A 3QNOA 3SUQA 1TK0A 4CF8A 2YNHA 2EHGA 3ZT0A 3OYKA 2D0AA 3UIQA 1S1WA 3L2UA 2VG5A 3DRSA 1W0HA 2ATQA 3OYIA 3K2PA 4CGGA 1KFSA 1BI4A 3IG1A 3F73A 3SPZA 4CJ4A 1JL1A 3AA2A 1TKXA 4HUEA 1QSYA 3K58A 5J2NA 4KHYA 3CQ8A 3CG7A 4FJIA 2G8IA 1VSEA 3ALYA 1QHTA 4FZZA 2VG7A 2PZSA 3SUNA 4DTNA 3SPYA 3HP9A 3AO3A 1SV5A 3ASMA 3LP1A 4CF0A 4CGFA 2XO7A 4E7IA 3PX4A 4Z4IA 3KIOA 5SZTA 3V4IA 2Z1JA 1S1TA 3NGYA 3L2QA 2QKBA 4W5OA 1BI4B 4E0DA 3T19A 3AVKA 1U49A 1WNSA 4M41A 3RRHA 3LZIA 1LV5A 4IFYA 1WSHA 3BDPA 2X78A 1D8YA 1ASVA 4NYFA 4Z4FA 1IH7A 4CGJA 4PWDA 3MXIA 4DQRA 2FBTA 3M8PA 3MEEA 3V1QA 5K14A 5J2PA 4KI6A 4GW6A 1LAWA 1UWBA 1XC9A 2A1SA 3B6PA 4KTQA 3M8RA 1KLMA 1U04A 1VK0A 3U3GA 3WNHA 1FK9A 2P1JA 3V81A 2OZMA 3IAYA 2AJQA 5DMRA 1O1WA 2B6AA 4BDZA 3C6TA 1UA0A 5KI6A 3VA3A 4CEEA 4FVMA 4BWMA 3RMAA 3DLBA 5FRNA 1CZ9A 1WSEA 3MAQA 3HVTA 4N41A 3AVNA 3DM2A 1RDDA 4CE9A 4CECA 2P51A 1T8EA 1B9FA 4RW4A 3NH0A 2BE2A 1X9WA 1CXUA 4I9LA 5EU7A 1NJYA 3LPTA 1TV6A 1RNHA 2Y1IA 2RF2A 1L3SA 4B9UA 4HCCA 1TGOA 4KAZA 2FC0A 1WAJA 3SZ2A 4DFJA 3KK1A 2HNYA 3O3FA 3OS1A 3AA4A 1A5WA 1HYVA 4F4KA 4OKJA 2DFEA 4IFVA 2G8KA 4I2PA 4M3RA 4FLUA 3HL8A 2G8FA 4KHUA 4J2BA 1RCHA 1S5JA 4LY7A 4N56A 4DTPA 1MU2A 4Z4GA 1S9GA 3KKRA 1JLBA 1NK0A 3OYMA 3ZSQA 3HJFA 1Z26A 1L5UA 2VWJA 4DQSA 4FJ8A 4OVLA 3B6OA 2HHVA 1Q9XA 2Z1IA 4Z0UA 3OS2A 2E6MA 3NE6A 1ITGA 1UAXA 3K5OA 1SL0A 2PYLA 4EZ6A 4QCLA 4ZTJA 1I3AA 4KO0A 4IG3A 3SYZA 2OPPA 3AA5X 1N6QA 2P5OA 4KPYA 2JLEA 3QO9A 4KHSA 1HNIA 1HMVA 1T05A 3RR8A 1RTHA 2KZZA 1JLEA 3ISNC 3HM9A 4OKKA 3JSMA 3SQ0A 4M3XA 3DI6A 3AA3A 1C1AA 2IOCA 4FM0A 4FJKA 3TARA 1B92A 3AO4A 4HUGA 1J9AA 1KVAA 3CM6A 3CFPA 1NK6A 1WSIA 1EETA 3A2FA 4N5SA 3TAGA 4OLAA 1EXQA 2XY6A 4FK0A 3LALA 3TABA 1NKCA 3G0ZA 4L8RB 2HHUA 4K8XA 3QESA 3TI0A 3LP3A 5J2MA 5HRNA 4CFBA 3SI6A 3I0SA 5HP1A 2G8WA 1EKEA 4NCGA 2DFFA 4Q5VA 4DTXA 3OYBA 1TAUA 1HYZA 1ZBFA 3NF8A 4I2QA 4AHCA 4OGCA 4DS5A 3CM5A 3ZSWA 4EP5A 2F8TA 1BQMA 1BISA 1C1CA 3DLKA 4IG0A 4J2DA 2G8VA 5KGWA 1LW0A 4B8AB 1YTAA 4KTZA 2HNZA 5FRMA 5J2QA 1JL2A 3SNNA 3L2WA 2GBZA 4W5RA 4HHTA 4E7LA 5HLFA 4KB0A 4QOZB 3PX6A 2B5JA 4F3OA 3RWUA 3OYJA 4CJ3A 2XY7A 5FDLA 5J1EA 4LH5A 2IAJA 3K5LA 2HHQA 1DTQA 1S1VA 5JS2A 2D0BA 4DLGA 1B9DA 1A5XA 1GOCA 3TANA 2Z1HA 3RRGA 1IKWA 3KLFA 3ZSYA 4CHYA 4FJGA 3V9WA 2XY5A 3QEIA 1KRPA 1C0TA 1NK9A 2D0CA 4O55A 3K5NA 3VN5A 3MEGA 4JS5A 4E7HA 1BIUA 3ZCMA 3AO1A 1FXXA 3AO2A 4DTUA 1KCFA 3MECA 3OYHA 1NK8A 1L3UA 4F3TA 4DU4A 1CXQA 2QKKA 2X6NA 3DMJA
chains in the Genus database with same CATH superfamily
5AJ3K 5FPNA 4OPAA 3AARA 4MO4A 1QE1A 3OYNA 1IKXA 1Q81O 1HKCA 4IOXA 1NK7A 3SQ1A 4BC2A 4LF6K 5JS1A 3AY9A 4FJMA 2ASPA 5MLCQ 1DTTA 3EO3A 4BR0A 4KTWA 3EN9A 3TAEA 2O4GA 4MQ3A 3E01A 1TKDA 2OPQA 2JWLA 1SAZA 2WFBA 5C12A 1DT9A 3CJAA 4BY9C 4CFAA 2QA4N 4DHYA 4CHOA 3QERA 4B9MA 4AHTA 4H8KA 5KRSA 2OCEA 4WF9L 3U6FA 3OJUA 2YV0X 2YJEA 3KTQA 3O4QA 2E4LA 3VQAA 2HMIA 1WSGA 5DK5A 3AVMA 2KLAA 4GKJK 3KWGA 4CZGA 3EKUA 1TAQA 4H5VA 2HW3A 3CQXA 4CEBA 2P9PB 3R8EA 4M45A 4CJ5A 3L6QA 4K42A 3AO5A 4JHDA 4FLZA 4CJQA 3TSPA 1QQOA 2I7PA 1XMOK 3ITHA 1UOCA 3CCSN 3A5MC 3S3OA 4K8ZA 3MN5A 3PY8A 1GOBA 3VQDA 1U4BA 1Y97A 4AF1A 3AVAA 1NG9A 1IV0A 1KVCA 3M5RA 1JCEA 1OH5A 2W6LA 3BEXA 5LL6Z 2VG6A 4CF2A 5AQOA 2AP1A 3TU5A 4JKGB 3LP2A 4FJXA 3CYMA 5BRFA 2NRTA 3KK2A 4WYBA 1IKYA 3TSUA 3EE9A 1VQ7N 1NU0A 4IXCA 3WEEB 3L3VA 1VSMA 3OVNA 1QSSA 4MLHA 1KTQA 4CEDA 2UYTA 1N8RO 2NRXA 3RMBA 4XEIA 2CH6A 4JK9A 4IJNA 2FBYA 3J8AA 3TAMA 4CVNE 3OYFA 2ZQBA 4MDBA 4FVUA 3CHWA 4DSLA 5M1QA 3VEWA 3THWB 1HQEA 2YNIA 3DRPA 1KAYA 4CJWA 3WQTA 4A61A 4H0XB 3AVCA 4A59A 4CBXA 2UXBK 2W6KA 2CGJA 2ITGA 1EQYA 2P9NB 2RHKA 4DWIA 4FJHA 3C6UA 2ZJPL 4Z4EA 1BO5O 2QTDA 3VQPA 1L3TA 3KLIA 1C1BA 4FWQA 2Q0UA 1W9HA 2VCPA 3L3UA 4CJFA 4G1QA 3OYGA 2I7NA 3RVCA 4C8LA 1YJNN 3FZMA 1BGXT 1L3VA 3D7EO 4F2SA 1GLFO 4O8KA 2OZSA 1K6YA 3ZYYX 4LH4A 1ASUA 4IO9L 1UA1A 1ILYA 3T7ZA 4AHVA 1LWFA 4OKEA 2QI2A 2YCHA 4HTUA 2GV9A 3NH1A 3V9ZA 4FOIA 3ZX0A 3CCMN 2F7TA 1NMNA 2I5JA 4C1NK 3I0RA 4PL7A 2VQFK 4CGIA 4YOXA 1BOTO 4BRLA 4F9OA 5I42A 2Q1NA 4ISGA 1WN7A 1HPZA 5E41A 3ZETB 3K59A 3CCJN 1XQSC 4ICLA 3H45C 2P9SA 3ZT2A 4Z94A 3VQ6A 1GLCG 4DQIA 3VTIA 3DRRA 2ASOA 3VQ7A 4DKWA 1YJWN 3L8BA 2PBDA 4BC5A 1U47A 1D9DA 4CESA 3KVGA 4DFMA 3TAFA 3HI0A 3QLHA 4BR7A 4FLYA 1VQKN 1MA9B 4I9QA 4W5QA 2O8DA 5DM7L 3BGRA 4JI3K 3VEOA 1TKTA 1Z25A 4QS9A 2NRHA 4H4OA 1NK5A 1XNQK 1RT4A 4EHUA 1EWQA 4DR3K 5D3GA 4DS4A 1TKZA 4H5NA 4BR5A 5JICA 1CLQA 4TSXA 4DF4A 1NGGA 3P1GA 3PX0A 4O44A 3MEDA 2WONA 1KVBA 3CQYA 1U48A 3H08A 3RMCA 4LF5K 4B3OA 5JMVA 5AQXA 1KLNA 5ADXA 1S9EA 4CJPA 3VQ8A 5AQJA 1Q82O 4YORA 4AHUA 3SAFA 4E1JA 4OPKA 4LF7K 4M3ZA 4WFBL 4I6MA 4CK1A 1NGDA 4CF1A 3WNGA 1VQMN 3DLEA 5CHIA 5CYQA 4CF9A 4C8MA 4B1UB 1T3VA 3NF6A 4CZMA 3LDLA 4OJRA 3VQCA 1I39A 5C42A 2G8UA 1EP4A 1VSHA 3JS6A 4QS7A 4W5NA 3VQ5A 4BQZA 4B1VA 3THYB 1P90A 3MWTA 3F2KA 4HTLA 4JI4K 3FFKB 3ZT0A 5GAGP 4X62K 3KWIA 4IJAA 3L2UA 1W0HA 3OYIA 2O4IA 3K2PA 1KFSA 3IG1A 4NCAA 4JAXA 5AFUH 5C10A 5J2NA 3CG7A 3ALYA 4FWLA 3ID8A 3ULEA 3HP9A 4CF0A 1ZC6A 5LJVA 4E7IA 3PX4A 4Z4IA 4DUZK 2Z1JA 1S1TA 3K9JA 1BI4B 3AVKA 4MO5A 4M41A 1W2BM 3BDPA 1WSHA 1ASVA 3CCVN 4NYFA 3S41A 4CGJA 3M8PA 3LM2A 3O8MA 4GW6A 1LAWA 1UWBA 4KTQA 2A1SA 4CD1A 1QVGM 2OZMA 3W3DA 3IAYA 5DMRA 3DLBA 3RMAA 1WBBA 1QHAA 3PIPL 4FWMA 3QMLA 3MAQA 3HVTA 3FZKA 1MDUB 3F9MA 3WXMB 1B9FA 4RW4A 1X9WA 1CXUA 3KK7A 3ENHA 2UUBK 1TV6A 2Y1IA 3GL1A 4HCCA 3TPQA 4KAZA 2FC0A 1WAJA 3SZ2A 2HNYA 5JLHA 3OS1A 3AA4A 5A2QO 4CBUA 3Q7BA 5BPMA 4IFVA 4JNEA 4FLUA 4KHUA 4YOTA 1RCHA 4JD2A 4N56A 3DWLA 1E4GT 2J4RA 1JLBA 1NK0A 3ZSQA 1L5UA 1GLJO 2VWJA 4DQSA 1H1VA 2HHVA 1Q9XA 2OTJN 3ZEUB 1KAXA 1T05A 1W97L 3MN7A 1G99A 1U6ZA 2GTDA 2O8CA 5F2RA 5AQTA 3AA3A 5GAHP 4FM0A 1J9AA 3NMUA 3SAHA 3WUHA 2XY6A 2HBLA 1NKCA 2HHUA 4L3QA 3SI6A 2P9LB 4DV1K 4DTXA 3H6EA 1TAUA 3NF8A 4DS5A 4I2QA 2F8TA 3VEZA 1FJGK 4EP5A 2HF3A 1BISA 4OX9K 4NLCA 4KH4A 5AZIA 1JL2A 4RCHA 3L2WA 4YY3K 5HLFA 3CC4N 4BRPA 1QQMA 5FDLA 2D4WA 5J1EA 3K5LA 4BRNA 2D0BA 5BR8K 3CC7N 1A5XA 1GOCA 4JYAK 3DXMA 2XY5A 3QEIA 4O55A 3VN5A 2QW9A 3MEGA 4JS5A 1FXXA 3AO2A 1KCFA 1NK8A 3Q7CA 3LWMA 3NFAA 4IEEA 4FLWA 4BRCA 1U2VB 3H3NO 3NAEA 4JI8K 4CZLA 5BPLA 1SL1A 1WUAA 5C2DA 4Z4CA 5C25A 2ASMA 3V9XA 3K57A 4XIUA 3LP0A 4YOWA 4CEAA 2O8FA 2FBVA 3MCPA 4E1MA 3QIPA 4E1NA 1RDBA 1YVUA 5AQGA 3J81O 1M1KO 3NDKA 2F9TA 3SMSA 4BACA 3ENBA 1RT3A 5BN9A 3ATUA 4DTJA 3VEXA 1RGIA 1FKOA 3AAQA 4JRPA 3LL3A 3C6AA 1QS4A 3FZLA 3HVRA 5AFUA 2A1RA 4JI6K 4JI5K 4FM2A 3SV3A 1YT3A 3J7YP 1U2VA 3HO1A 2HBJA 3M8SA 4BRDA 5AQKA 3GDQA 1YUWA 3PV8A 5KRTA 3IDHA 2O8FB 4E19A 2RPIA 3P38A 5HOOA 2KW4A 2R7YA 4JI1K 5AQLA 4PL8A 1T6DA 4M7YA 1NGEA 5EVZA 4DG1A 2P9UA 1KD1O 4ELUA 2OPRA 3CI5A 3SJHA 2HHSA 3ULEB 1NOYA 3H46O 2KFZA 3I56N 5B8HA 5BPNA 4C8KA 3KK3A 4IKFA 5AZJB 4N76A 3KLHA 1NKBA 3KD5E 1G15A 4M3YA 4PKHA 3DOLA 2FSJA 3HYFA 4YFUA 3OYDA 1WSFA 1JKHA 2F96A 1S1UA 3SMPA 3PO4A 1RTJA 4FK2A 1DGKN 2QM1A 4JLHA 3QEWA 3C95A 4MFBA 5HRRA 1HLUA 3SCXA 3O1WA 4CJSA 4BDPA 2ZJQL 1RBSA 5E26A 3LZJA 2KZMA 3I8BA 3PSFA 2NRWA 5TKWA 4CZKA 3KD1E 1WBDA 4OLBA 1NGFA 3EKSA 4UQGA 2QWPA 2P5GA 1JLGA 2RKIA 2YKMA 2YNGA 4ISFA 4F8RA 4PKGA 5TKYA 3LAKA 2EWSA 1XNRK 3QFUA 1HNWK 4F2RA 3C94A 3OTOK 3PO5A 1J53A 3CD6N 4DTRA 4C8OA 4FJ9A 2WOMA 1YITN 3TWHA 3SBTA 5JLFA 1Z6RA 3CMEN 1ZXOA 1HKBA 3AV9A 2P9KB 4DMNA 3AVJA 2P9PA 4B9NA 1LAVA 4B3MK 5JVHL 1S6PA 3G10A 2PAVA 5ELZA 3THYA 3A8YA 5F0XA 1TYQB 2HNDA 1HYSA 1YVNA 4WE1A 4PY5A 4O8UA 1S72N 4Y1DA 4WQ5C 4KHQA 1HNXK 5BN8A 3M1FA 1NBWA 3MXMA 2O8EB 4CFCA 5ADXH 1RT5A 4AH9A 3M8QA 4V19S 3I8DA 3CPWM 5AZJA 3T1YK 3CJ9A 1X3MA 1JXBA 3WXLA 2A41A 4FSVA 2IGIA 2KTQA 5M1NA 3SV4A 2P9SB 2YI1A 4YDUA 4JV5K 3QEVA 2FBXA 3PSIA 2QWQA 3NHGA 3FLCO 3ULDA 4K25A 3LDSA 4ID5A 2YHBA 2WTUA 3HSCA 4FM1A 1SUQA 1C0GA 1K9MO 4CK3A 3UB5A 3ZT4A 4KKOA 4JS4A 3AVHA 2PYJA 4CJEA 4CFDA 2JGUA 3ENOA 4CJKA 4KI4A 1TK8A 3LPUA 3K5MA 1RBUA 1JLQA 1QVFM 1JJ2M 2XRIA 3A5NC 4DV6K 3WXKA 4AHRA 5I3UA 3FGUA 2F8SA 4KFBA 4FJLA 3WEEA 4H0VB 1XC3A 3VENA 3MDQA 2IVNA 3SAGA 1YAGA 3DLGA 3RSEA 5AQIA 4BR4A 4U7BA 5C24A 2Q36A 3U8XA 4U67L 4DU3A 1VQPN 4HUFA 3ID6A 2IDOA 3O9SA 4FYDA 2YX6A 3OYAA 4JEPA 1QSLA 1KSPA 2Q0RA 3O1BA 4E7KA 2OPSA 1WSJA 4KHPK 3QIOA 3ZX3A 4KB1A 4PUOA 4CW7B 2KQ2A 2OA8A 4LFAK 1OVYA 2WBNA 5IWAK 5C0YA 2E2PA 4BVOA 4M3WA 3G25A 3HPHA 2E5LK 3ZSRA 4DSFA 3GE1A 3ZSVA 4B9QA 4M3UA 5AR0A 1NGIA 5EY4A 1A5VA 1JXEA 5F1XA 2E1ZA 3V6DA 1GLLO 3QNOA 3SUQA 4CF8A 1SS6A 2EHGA 5I9EB 3UIQA 2NRZA 1S1WA 5BREA 4BG9A 3F73A 3SPZA 4HUEA 1JL1A 4KHYA 3K58A 1TUUA 4DR1K 3UKUA 5AQWA 4DTNA 2V52B 3AO3A 1SV5A 3LP1A 4X66K 4BG8A 3V4IA 3NGYA 1QQNA 4E0DA 2WUSA 1U49A 1WNSA 1LV5A 4IFYA 2CGKA 3ZETA 2FBTA 5AQMA 5K14A 4WQ5A 3HOSA 3VEVA 3PLAA 1KLMA 1VK0A 3U3GA 2O8BA 3GG4A 2P1JA 1HX1A 1CZAN 1J5EK 2B6AA 4BDZA 3NVMA 4BC3A 3NVKA 5FRNA 1CZ9A 1E4FT 4EIAA 3HTVA 3AVNA 1RDDA 3N4PA 4CE9A 4CECA 2P9NA 3SK3A 2P51A 2BE2A 4KBOA 4I9LA 2W41A 3LPTA 2W40A 1BDGA 3G6EN 1TGOA 1O13A 4UY8O 4DFJA 1ATSA 1HYVA 4OKJA 3L4IA 2G8KA 4I2PA 2UUAK 4BREA 1MU2A 3BY5A 1MWKA 3OYMA 4DUYK 1Z26A 4IO8A 5CR4A 3VPZA 1BA1A 4FJ8A 5BRDA 4O5FA 2Z1IA 3C0BA 1SL0A 2OPPA 3AA5X 3QICA 4NXNK 2IVOA 3QO9A 4KHSA 1HNIA 1HMVA 3RR8A 2KZZA 2NRRA 3SQ0A 3HM9A 1N32K 3JSMA 1HPMA 4FJKA 3TTCA 3F5TA 4HUGA 1NK6A 3K0SA 1WSIA 3A2FA 4OLAA 1EXQA 2F9WA 3LALA 2FXUA 3QESA 2GWJA 2G8WA 5HRNA 5C15A 5M1KA 1LCUA 2FLOA 2DFFA 4Q5VA 3L4QA 3O4WA 4AHCA 3ZSWA 3U9DA 2D0PA 1BQMA 3DLKA 2Q2RA 1LW0A 1Q86O 3CPEA 4JKCA 1YTAA 4X65K 1EWRA 3VF2A 3SNNA 1KXPA 2GEMA 4LF4K 2GBZA 4W5RA 1ATRA 4QOZB 1N33K 4F3OA 3RWUA 3WXJA 4CJ3A 2IAJA 1S1VA 5JS2A 2UXCK 1B9DA 3TANA 2Z1HA 5AQFA 5EX5A 4DV2K 4FJGA 3FZFA 4CI6A 2ZM6K 3ZCMA 3CC2N 4PKIA 4RTFD 3OYHA 1L3UA 4DU4A 3C7NA 5FRMA 4BRFA 3V1OA 2ETJA 2QXFA 3OYEA 1VSFA 3WNEA 5AQPA 1K8KB 4HWIA 1ASWA 1NK4A 4KV8A 5E84A 1TK5A 1N5YA 4JI2K 4FZXC 2KHOA 1Q8IA 2ITMA 5HRSA 1LWEA 4R5PA 2GWKA 4ID1A 4DTSA 3HSTB 2NZTA 4DV7K 3ZSXA 5HL7L 2EX3A 4YDUC 3TAPA 4FJIA 4JK7A 1HJRA 1XHXA 1TVRA 3AVBA 3TTFA 3CF5L 3V1RA 4KH6A 4CZJA 4LF8K 4KRFA 3VESA 3WXIA 5GIPA 1JLAA 5KPZA 4CHZA 3U3YA 4IEIA 2HVHA 1S22A 1HR0K 4GVMA 2XY8A 4FK4A 1C0UA 1RT7A 3LANA 4CGDA 3DOKA 4G9ZA 4BRGA 4DQPA 1ZBHA 3EY1A 1HUXA 2NLXA 3QFPA 3ZT1A 2HHTA 1NJXA 1GLEG 4CJRA 1R0AA 2BH1A 4YOVA 4O4GA 4IWVA 4CIFA 4IFEA 1DEJA 1NJZA 4JD2B 4XH4A 4KREA 2VWBA 3P39A 4AQYK 3R1XA 4WFNL 4CEZA 4NXMK 4CIEA 3DLRA 1WLJA 1VQON 1NGAA 2QWMA 3VMFB 3ZEUA 3NGIA 1GLDG 1HNVA 1RTDA 2IS3A 2VWKA 1CZBA 1SKRA 3CCQN 2Q97A 1RBTA 4YNQA 2ZD1A 3JYTA 2GUPA 3WNFA 2KFNA 4BE0A 1ATNA 1VHXA 4BVPA 4DV5K 4CCHA 3SJJA 3OHRA 1NGJA 2P9LA 1BQNA 4FCYA 3P5JA 3AVLA 4B1XB 1RFQA 3C7NB 3SQ4A 1XWLA 3QEXA 4IDKA 3R6MA 4CZEA 2V7YA 4DV3K 2HVIA 3D6RA 5KGXA 1RTIA 4K43A 2CH5A 5CZ1A 2B4JA 3I55N 4HCBA 4JKHA 3IS9A 4O0JA 5BR9A 1KAZA 3RR7A 3UKUB 2HOEA 3BUZB 4CHPA 1NGBA 2O8DB 5AQUA 3F9KA 5LMUK 3IUCA 3VTHA 3OYLA 1ESVA 4FWOA 2XHBA 3HPOA 4FWSA 4H0YB 3H1VX 3R9PA 2Y1JA 1S6QA 2NNWA 4ZHRA 4FJ5A 5AQZA 4B9TA 4EP4A 4ISEA 3NF7A 1X9SA 1ZBLA 4DSJA 5CZ2A 4RWTA 3SQ2A 4B9VA 2JWKA 4FL9A 3PUFA 3S9HA 2E88A 1IJJA 1JCGA 4IOAL 4Z4HA 3BP8A 3AAPA 4FWKA 1ZBUA 4DSIA 3HP6A 4QAGA 3EYZA 4YOYA 1C6VA 1RDAA 3OBYA 1VRTA 3JXUA 1J5OA 5FROA 4GVEA 4OGEA 4CZIA 1YHQN 1NMDA 1BCOA 3DYAA 1LWCA 4H5TA 1RDCA 5M1OA 3O5BA 2HSTA 4JRQA 3HK2A 2E2OA 4JKEA 3HOTA 4JKGA 3O9QA 3O80A 4DR4K 1D5AA 2E6LA 3CFOA 3T3FA 3DLHA 2HB5A 4DF8A 3T1AA 1QTMA 3D45A 1VSJA 3BF1A 3CJ7A 3MXJA 1X9MA 4CBWA 3RTVA 1FW6A 5SWMA 4O0IA 3QDKA 3S3NA 2G8HA 4BRKA 1SL2A 2D0OA 3O9TA 1EX4A 4BDYA 4AILC 1BU6O 1W7AA 1WAFA 3S3MA 4RW8A 3CFRA 4ILHA 3KHYA 3L2RA 3KJVA 5LMNK 1S1XA 4BRAA 1VQ5N 3LAMA 1VSDA 4OO1J 3AGRA 1BUPA 3P4IA 3ATVA 1MWMA 2FSNA 3IMXA 4FWRA 4ILJA 3VQQA 4A57A 2HBMA 2WC9A 3IRXA 2YHWA 2AA4A 3J80O 3CXCM 2ZE2A 3AVFA 2DTUA 4CEFA 5EXWA 4HVJA 1ZYQA 5KPRA 4M42A 4FZYA 3DXKB 4JKBA 2IC3A 3OJSA 2Q3SA 3O3HA 4JKDA 5KTQA 1M90O 5AQQA 3R3LA 3NBPA 4DLEA 1OVQA 1WB9A 2UU9K 4H5WA 4JK8A 1RT2A 4FOEA 4NYNA 1X1PA 2X74A 4DR6K 5C2FA 4B1WB 3RMDA 3UKRB 2D5RA 3D2FB 1YTUA 3A0IX 4E89A 3I33A 1IG9A 3MK6A 4RG8A 1X9JA 3C6HA 4DFPA 1I94K 3CETA 2E20A 4A2BA 1TK0A 1KQSM 2YNHA 3W0LA 2D0AA 2VG5A 3E1YA 4KHWA 1BI4A 4CJ4A 1QSYA 1TKXA 3HBTA 3CQ8A 3GOIA 2G8IA 1VSEA 3HM8A 3SPYA 3KZBA 2XO7A 2UXDK 3ASMA 4CGFA 4M7XA 2YHXA 1XUPO 5SZTA 3L2QA 3T1HK 2X78A 3TSQA 2VQEK 3EL2A 5KPTA 1IH7A 5KQDA 3MXIA 4KI6A 3V1QA 4XH1A 3E9PA 4FPAA 3B6PA 4CZFA 1XC9A 1LOTB 3M8RA 1U04A 3WNHA 1FK9A 2OTLN 2AJQA 1O1WA 3C6TA 5KI6A 3VA3A 4CEEA 2QXLA 4FVMA 4BWMA 1YIJN 1WSEA 2P9KA 4N41A 3LDQA 3CCLN 1T8EA 1NJYA 4LFBK 4GV9A 2RF2A 4DR5K 3VGMA 3KK1A 3O3FA 1TYQA 3U9ZA 1OKJA 4M3RA 1D4XA 1S5JA 4DTPA 4Z4GA 1S9GA 3LDPA 3KKRA 3TTDA 5AQVA 4DV0K 3B6OA 4Z0UA 3OS2A 3VGKA 3NE6A 2PYLA 4EZ6A 4ZTJA 1I3AA 4KO0A 2P5OA 4KPYA 2JLEA 3K9KA 2ZJRL 3MCAB 5FPDA 3ISNC 4M3XA 4OKKA 3DI6A 1C1AA 4DV4K 3C65A 2QWNA 1B92A 3E9OA 1KVAA 2A6AA 3OBWA 3TABA 1N34K 4FPBA 4GV6A 3LP3A 4IOCL 5J2MA 4CFBA 5HP1A 1EKEA 4NCGA 2ZWHA 1ZBFA 5DM6L 4OGCA 3CM5A 4B8AB 4KTZA 2HNZA 5J2QA 2E2QA 2CGLA 3VF6A 4JKAA 2PFUA 3PX6A 3OYJA 2XY7A 3O9UA 2QWLA 1R59O 3BZCA 1DTQA 3CIPA 4DLGA 1Z05A 3RRGA 1IKWA 3KLFA 3ZSYA 4CHYA 3UE5A 4ILGB 1KRPA 5FPMA 2D0CA 3AGKA 3CCRN 3IFRA 3K5NA 4E7HA 3B8AX 2QWOA 2P9IA 3MECA 4F3TA 1CXQA 1OH8A 1HQUA 2BDPA 3EE8A 3D2EA 3QBWA 2D1KA 1RT1A 5HRPA 3VGLA 5CY4A 4FLXA 1VQLN 3KKSA 1C0MA 4CJLA 3EZ5A 1XHZA 4M3TA 1VQNN 2YHYA 2YHAA 4YHHK 2YNFA 1RILA 3N4QA 3ZT3A 4DSKA 4C8NA 3J7AP 1RBVA 5HBMA 1IBKK 4DQ8A 3QETA 5GADP 1OH7A 1IKVA 4ZTFA 4CJVA 1BCMA 1GOAA 4BE1A 4A62A 4RW9A 3MWPA 1BL3A 1J6ZA 3LM9A 4NB4A 2LSNA 4J2EA 1QQCA 1DLOA 1BIZA 3E66A 3P31A 4CK2A 4CIGA 4CEQA 2HHQA 1HKGA 4BE2A 3EZWA 3ZSZA 3GBTA 1NJWA 1BWFO 1RBRA 4N47A 4NCBA 5FPEA 4B3RK 1SKSA 1QZ5A 5IT9O 3LDNA 2QWRA 1RDWX 4B8CA 3V9SA 4EFHA 1SKWA 4CERA 3AVIA 4WCEL 4AHSA 4BGAA 5LY3A 5AQYA 4J2AA 4CHQA 3M6GA 2YKNA 3MX5A 1XI1A 4GKKK 4Y1CA 4B9SA 4FXDA 3OW2M 2P9UB 4CZHA 2E1YA 3L2VA 3G4SN 1GLAG 2HF4A 3FZHA 1YJ9N 4H03B 1T7PA 2A3ZA 3OS0A 4FO0A 1VRUA 1T03A 2QEXN 4B08A 4O5BA 4BWJA 4CHNA 5CYMA 3NH2A 5AQHA 4DTMA 5GINA 4CEOA 2VYPA 1DKGD 5M1FA 4DR2K 1HNZK 4BQLA 2P9IB 1JCFA 3VF4A 2O8BB 1RDUA 4KH5A 1WOQA 4DB3A 4LD0A 3HRGA 4H0TB 3OY9A 1Q9YA 4NO7A 1J54A 3THXA 4A5AA 3CJCA 2HMPA 3PIOL 2F4VK 1F21A 3THVA 4K41A 3FR0A 4CJTA 1ZBSA 3OA9A 2PY5A 2Z1GA 3DJCA 5M1PA 3CCEN 4CD3A 5AZIB 1K8KA 4JHDB 2A5XA 3VQ9A 3NCIA 2BANA 2RE2A 4DQQA 5BRHA 2FSKA 1SZ2A 4FJJA 1T6CA 3EEQA 1VSKA 3NGZA 4BGBA 3SUOA 3VERA 3DAWA 4FWNA 3D0PA 4W5TA 4DU1A 4C1NI 1TL3A 1IG8A 2E8AA 3FFIA 3CJ1A 3QNNA 4RW6A 1NM1A 4IBNA 3TAQA 1VQ4N 3VQBA 4M63C 2HHWA 3VQEA 4FLTA 4FLVA 3A5LC 4WQ4A 4LC9B 1Y64A 3DXMB 4WFAL 1VSLA 1IO2A 1HJOA 5AQNA 1V4SA 4FWPA 4GNIA 3QEPA 3O3GA 4PQUA 4FJ7A 1KFDA 3KLGA 3J7ZO 3MN6A 3AVGA 3OYCA 3HT3A 3THXB 3VQ4A 1NGCA 2O8CB 1VAZA 1GLBG 4LSLA 3KLEA 1ZBIA 3P83D 4DSEA 4DTOA 3U4LA 3SUPA 1X3NA 3ZX2A 1NKEA 1FKPA 2IVPA 4ELVA 4J8FA 2E2NA 2V7ZA 1RT6A 1TL1A 3SBGA 4LFCK 3O08A 3O4NA 4E7JA 4Q0BA 3FE1A 1JLFA 4AM6A 4FW2A 3QBXA 1K8AO 1IBLK 1VSIA 4B9LA 4EZ9A 2VGNA 4E3SA 4Y0WA 4B3TK 4CGHA 3QINA 1P8ZA 3E9LA 4C23A 1C0FA 4BC4A 3UKRA 2W42A 4I7FA 3VEYA 1U45A 4GV3A 1NOZA 1V4TA 4OPJA 2V51B 1BHLA 4H4MA 2RN2A 3MMVA 4DR7K 2DFHA 3G71N 1IBMK 2IIRA 2OANA 3NF9A 3LWLA 1JLCA 1E3MA 4FW1A 4K0KK 4LSNA 1YI2N 4EHTA 5HROA 4BROA 4YOUA 3THWA 4KHNA 3ZSOA 5T7BA 4A5BA 1NJIO 3LDOA 2DY4A 3V9UA 4H5RA 3HXMA 4DCHA 1Q18A 3VA0A 2X6SA 4FJNA 2GUIA 4PA1A 3VOVA 4AM7A 4ELTA 2OYQA 1YXQA 4BRQA 1BG3A 1SQKA 4GMJB 2BGGA 2GELA 1T44A 2ZGZA 1D9FA 3BF3A 4RW7A 4B1ZA 2GX9A 1VQ8N 2FF3B 2Q31A 2NUBA 4MDAA 3MN9A 2QK9A 4DFKA 1LW2A 1REVA 2HHXA 2YJFA 1NGHA 3TR8A 3WT0A 1HRHA 1S3XA 3HPGA 4CJUA 3M3ZA 1EO1A 3DLLL 3D2FA 4A2AA 3OYKA 3ZLJA 3DRSA 2ATQA 3CJBA 4CGGA 3O9RA 4JKFA 3AA2A 4B1YB 3A5OC 1QHTA 4BRIA 4FZZA 2VG7A 2PZSA 3SUNA 5AQRA 1VQ9N 3H3OB 3KIOA 2QKBA 1TUYA 3H1QA 4XH5A 4W5OA 2UUCK 3T19A 1OH6A 3RRHA 2NRVA 4JN4A 3LZIA 1QZ6A 1BA0A 1D8YA 4Z4FA 3CMAN 4PWDA 4EAHD 4DQRA 5J2PA 3MEEA 4QS8A 2FF6A 4OPHA 4H0PA 4X64K 3V81A 2VGMA 5KQ8A 1UA0A 3BZKA 4I6MB 5FLXO 3DM2A 4R79A 1N36K 3NH0A 1K73O 4BR9A 4GY2B 5EU7A 3CCUN 1RNHA 1L3SA 4B9UA 4IZ9A 2O8EA 5LJWA 4WQ4C 3SLCA 1A5WA 4F4KA 2DFEA 5CE3A 5AQSA 3DXKA 1KC8O 4CJ7A 2G8FA 3HL8A 4MLEA 4J2BA 4LY7A 3HJFA 4OVLA 3JAMO 2E6MA 1ITGA 1UAXA 3K5OA 2A40A 4BR2A 4QCLA 4IG3A 3SYZA 1N6QA 2HHHK 4JI7K 3QB0A 2H3GX 3D2EB 1RTHA 1JLEA 2IOCA 3TARA 2ZGYA 3AO4A 3CM6A 3CFPA 1EETA 3TAGA 4N5SA 3HZ6A 4JI0K 5EOYA 1NLVA 2BUPA 4FK0A 5GAEP 3G0ZA 4L8RB 4K8XA 3TI0A 3I0SA 3OYBA 4LF9K 1HYZA 5H1SQ 4NLBA 1C1CA 1NWKA 2HBKA 3CERA 4IDHA 5KGWA 4IG0A 2G8VA 3O6WA 4J2DA 3L0QA 4H0OA 3T69A 4BRHA 4PHTX 3WQUA 4HHTA 4E7LA 1XMQK 4KB0A 2A42A 3VETA 2B5JA 1YF5L 5GIOA 4LH5A 1VQ6N 2ZF5O 4B3SK 2KKZA 3V9WA 1C0TA 1NK9A 1NNEA 1Q7YO 3RSEB 1BIUA 2BTFA 3AO1A 4DTUA 5JVGL 2DPNA 3MX2A 3IKMA 4BRMA 2QKKA 2X6NA 3DMJA
chains in the Genus database with same CATH topology
3V1OA 2BDPA 2ETJA 2QXFA 3OYEA 3LWMA 3NFAA 1VSFA 1QE1A 4FLWA 1RT1A 5HRPA 3WNEA 3OYNA 4B9MA 5CY4A 1IKXA 4FLXA 3NAEA 1ASWA 3KKSA 5JS1A 1NK7A 3SQ1A 1SL1A 1C0MA 4FJMA 4CJLA 3EZ5A 1XHZA 4M3TA 1DTTA 4Z4CA 5C25A 2YHAA 4KTWA 1NK4A 4KV8A 3V9XA 3K57A 1TK5A 1N5YA 3TAEA 2YNFA 4FZXC 4XIUA 3LP0A 1RILA 1Q8IA 2O4GA 4MQ3A 5HRSA 3ZT3A 3E01A 1LWEA 1TKDA 4DSKA 2OPQA 4R5PA 4C8NA 4CEAA 1RBVA 5HBMA 4ID1A 4DTSA 3QETA 2FBVA 3HSTB 3ZSXA 4CFAA 1IKVA 2EX3A 4ZTFA 4CJVA 4KHWA 1BCMA 1GOAA 4CHOA 4E1MA 4BE1A 3QERA 4AHTA 3TAPA 4H8KA 3QIPA 4RW9A 4E1NA 5KRSA 1HJRA 1RDBA 1TVRA 1XHXA 3AVBA 1YVUA 1BL3A 2YV0X 3OJUA 3U6FA 2LSNA 4J2EA 1QQCA 3NDKA 1DLOA 1BIZA 3V1RA 3KTQA 4BACA 4CK2A 4CIGA 3O4QA 2E4LA 4CEQA 1RT3A 4KRFA 3VQAA 1JLAA 2HMIA 1WSGA 4BE2A 4DTJA 3ZSZA 1NJWA 1FKOA 1RBRA 4CHZA 4JRPA 4N47A 3U3YA 4NCBA 5DK5A 3AVMA 1SKSA 2HW3A 1TAQA 1QS4A 2HVHA 4CEBA 3HVRA 4GVMA 2A1RA 2XY8A 4FM2A 4M45A 1C0UA 4FK4A 4CJ5A 1RT7A 3LANA 4CGDA 3DOKA 1YT3A 3SV3A 4B8CA 3V9SA 3HO1A 1SKWA 4DQPA 4CERA 3M8SA 3AVIA 3AO5A 1ZBHA 3EY1A 4AHSA 4NCAA 3PV8A 4FLZA 4J2AA 4CHQA 4CJQA 3ZT1A 2YKNA 5KRTA 1XI1A 4Y1CA 3ITHA 1UOCA 4B9SA 4FXDA 2HHTA 4E19A 2RPIA 3S3OA 4K8ZA 1NJXA 4CJRA 3PY8A 1GOBA 3L2VA 3VQDA 2KW4A 2R7YA 1U4BA 1R0AA 1Y97A 3AVAA 1KVCA 4O4GA 4CIFA 1T7PA 1NJZA 2VG6A 4CF2A 4KREA 4DG1A 3OS0A 4ELUA 1VRUA 4FJXA 2OPRA 3LP2A 3CYMA 2HHSA 1T03A 4B08A 4CEZA 4O5BA 4BWJA 4CIEA 5CYMA 4CHNA 3DLRA 3NH2A 1WLJA 3KK2A 1NOYA 2KFZA 1IKYA 4DTMA 4CEOA 1HQUA 3NGIA 3L3VA 1HNVA 4C8KA 1RTDA 1VSMA 3KK3A 2IS3A 2VWKA 1CZBA 1SKRA 3OVNA 1QSSA 4IKFA 4N76A 3KLHA 1NKBA 3KD5E 1KTQA 1RBTA 4CEDA 1G15A 2ZD1A 4YNQA 3JYTA 4M3YA 3RMBA 4LD0A 3WNFA 3OY9A 2KFNA 1Q9YA 4BE0A 2FBYA 3DOLA 1J54A 3HYFA 4CCHA 3TAMA 4YFUA 3OYFA 3SJJA 1F21A 1WSFA 3OYDA 3THVA 2ZQBA 4CJTA 2PY5A 1JKHA 2Z1GA 2F96A 1BQNA 4FCYA 3P5JA 3AVLA 4DSLA 3SQ4A 1S1UA 1HQEA 1XWLA 2YNIA 3QEXA 3DRPA 4IDKA 4CJWA 3PO4A 2HVIA 5KGXA 1RTJA 1RTIA 3VQ9A 3NCIA 4FK2A 4JLHA 3AVCA 5CZ1A 2B4JA 3QEWA 2BANA 4HCBA 3C95A 4MFBA 5HRRA 4DQQA 3IS9A 4O0JA 3SCXA 2ITGA 4FJJA 1VSKA 3NGZA 4CJSA 4BDPA 3SUOA 3RR7A 1RBSA 3D0PA 4DWIA 4FJHA 3C6UA 4W5TA 3LZJA 2KZMA 4CHPA 4Z4EA 4DU1A 3F9KA 3KD1E 4OLBA 4UQGA 1TL3A 3VQPA 2P5GA 3FFIA 1JLGA 1C1BA 2RKIA 2YKMA 2YNGA 3KLIA 3OYLA 4RW6A 4IBNA 3LAKA 3QNNA 3TAQA 4F8RA 1W9HA 2XHBA 3VQBA 3HPOA 2HHWA 3L3UA 4F2RA 3C94A 4CJFA 2Y1JA 4G1QA 3PO5A 1S6QA 1J53A 4ZHRA 4FJ5A 3OYGA 3VQEA 4FLTA 4DTRA 4C8OA 4FLVA 2WOMA 4FJ9A 4B9TA 4EP4A 3TWHA 1VSLA 3NF7A 1X9SA 1IO2A 4C8LA 3AV9A 4DMNA 3QEPA 3O3GA 3AVJA 4PQUA 4FJ7A 1ZBLA 4DSJA 1KFDA 1BGXT 3KLGA 5CZ2A 3SQ2A 4B9VA 1L3VA 4B9NA 3OYCA 3AVGA 1LAVA 3HT3A 4F2SA 3PUFA 3VQ4A 3S9HA 1S6PA 3G10A 2OZSA 4LSLA 1K6YA 2HNDA 4Z4HA 3KLEA 1HYSA 4WE1A 1ZBUA 4LH4A 1ASUA 1UA1A 4DSIA 3P83D 1ZBIA 4PY5A 3HP6A 4QAGA 4DSEA 3EYZA 4DTOA 4AHVA 1C6VA 1LWFA 1RDAA 4Y1DA 4OKEA 3SUPA 4KHQA 1VRTA 1NKEA 1FKPA 1J5OA 5FROA 4HTUA 2GV9A 4OGEA 1BCOA 3DYAA 3NH1A 3V9ZA 1LWCA 4ELVA 3MXMA 2I5JA 3I0RA 1RDCA 4CFCA 4CGIA 1RT6A 1TL1A 1RT5A 4AH9A 4JRQA 3M8QA 3HK2A 3I8DA 3O4NA 4E7JA 5I42A 4Q0BA 1D5AA 3CFOA 2E6LA 1JXBA 3T3FA 3DLHA 1WN7A 1JLFA 1HPZA 2HB5A 2IGIA 5E41A 3SV4A 4DF8A 2KTQA 4FW2A 3T1AA 3D45A 3QEVA 2FBXA 1QTMA 1VSJA 1VSIA 3K59A 4B9LA 4EZ9A 3MXJA 3NHGA 1X9MA 4E3SA 3ULDA 4CGHA 3QINA 4ICLA 3RTVA 5SWMA 4O0IA 3LDSA 3ZT2A 3S3NA 2G8HA 2O4IA 1SL2A 4ID5A 2YHBA 3VQ6A 4BDYA 1EX4A 2W42A 4AILC 4FM1A 1WAFA 1SUQA 4I7FA 4RW8A 3CFRA 1NOZA 3S3MA 1U45A 4DQIA 4OPJA 3DRRA 3L2RA 3VQ7A 1BHLA 4CK3A 3KJVA 4H4MA 3ZT4A 4KKOA 2RN2A 2DFHA 3L8BA 1U47A 1S1XA 4JS4A 1D9DA 4CESA 3AVHA 4DFMA 3LAMA 1VSDA 3TAFA 4CJEA 4CFDA 2JGUA 4CJKA 2PYJA 3QLHA 3NF9A 4FLYA 3LWLA 1JLCA 1TK8A 4KI4A 4I9QA 3LPUA 4FW1A 3K5MA 4W5QA 1RBUA 3VQQA 3BGRA 1JLQA 4LSNA 2XRIA 5HROA 3IRXA 1TKTA 1L3TA 4AHRA 5I3UA 1Z25A 2ZE2A 4KHNA 2F8SA 3AVFA 4KFBA 2DTUA 4H4OA 4CEFA 4FJLA 3ZSOA 1NK5A 4HVJA 1RT4A 1ZYQA 5D3GA 3DLGA 4M42A 4FZYA 5T7BA 5C24A 1TKZA 4DS4A 4DU3A 4HUFA 2IDOA 1CLQA 2DY4A 2IC3A 4TSXA 3V9UA 3OJSA 4DF4A 3OYAA 2Q3SA 4FYDA 3O3HA 3HXMA 5KTQA 1QSLA 1KSPA 3P1GA 3PX0A 4O44A 3MEDA 3VA0A 2WONA 2X6SA 1KVBA 4FJNA 1U48A 2GUIA 3H08A 4PA1A 4ELTA 3RMCA 2OYQA 4B3OA 3NBPA 4DLEA 4E7KA 1KLNA 2OPSA 1S9EA 1WSJA 3VQ8A 4CJPA 3QIOA 4AHUA 4OPKA 4KB1A 4PUOA 4GMJB 4M3ZA 2BGGA 1D9FA 1RT2A 4NYNA 4CK1A 1X1PA 2KQ2A 4CF1A 3WNGA 2OA8A 2X74A 3DLEA 4RW7A 5CYQA 4CF9A 4C8MA 4M3WA 3NF6A 3HPHA 2NUBA 3ZSRA 4DSFA 2QK9A 4DFKA 1LW2A 1REVA 4OJRA 3VQCA 3RMDA 1I39A 2D5RA 3ZSVA 4M3UA 1YTUA 5C42A 2G8UA 2HHXA 3TR8A 1EP4A 4E89A 1VSHA 1A5VA 1JXEA 1IG9A 4W5NA 1HRHA 3HPGA 4RG8A 4CJUA 4DFPA 3V6DA 3VQ5A 3QNOA 3SUQA 1TK0A 4CF8A 2YNHA 2EHGA 3ZT0A 3OYKA 2D0AA 3UIQA 1S1WA 3L2UA 2VG5A 3DRSA 1W0HA 2ATQA 3OYIA 3K2PA 4CGGA 1KFSA 1BI4A 3IG1A 3F73A 3SPZA 4CJ4A 1JL1A 3AA2A 1TKXA 4HUEA 1QSYA 3K58A 5J2NA 4KHYA 3CQ8A 3CG7A 4FJIA 2G8IA 1VSEA 3ALYA 1QHTA 4FZZA 2VG7A 2PZSA 3SUNA 4DTNA 3SPYA 3HP9A 3AO3A 1SV5A 3ASMA 3LP1A 4CF0A 4CGFA 2XO7A 4E7IA 3PX4A 4Z4IA 3KIOA 5SZTA 3V4IA 2Z1JA 1S1TA 3NGYA 3L2QA 2QKBA 4W5OA 1BI4B 4E0DA 3T19A 3AVKA 1U49A 1WNSA 4M41A 3RRHA 3LZIA 1LV5A 4IFYA 1WSHA 3BDPA 2X78A 1D8YA 1ASVA 4NYFA 4Z4FA 1IH7A 4CGJA 4PWDA 3MXIA 4DQRA 2FBTA 3M8PA 3MEEA 3V1QA 5K14A 5J2PA 4KI6A 4GW6A 1LAWA 1UWBA 1XC9A 2A1SA 3B6PA 4KTQA 3M8RA 1KLMA 1U04A 1VK0A 3U3GA 3WNHA 1FK9A 2P1JA 3V81A 2OZMA 3IAYA 2AJQA 5DMRA 1O1WA 2B6AA 4BDZA 3C6TA 1UA0A 5KI6A 3VA3A 4CEEA 4FVMA 4BWMA 3RMAA 3DLBA 5FRNA 1CZ9A 1WSEA 3MAQA 3HVTA 4N41A 3AVNA 3DM2A 1RDDA 4CE9A 4CECA 2P51A 1T8EA 1B9FA 4RW4A 3NH0A 2BE2A 1X9WA 1CXUA 4I9LA 5EU7A 1NJYA 3LPTA 1TV6A 1RNHA 2Y1IA 2RF2A 1L3SA 4B9UA 4HCCA 1TGOA 4KAZA 2FC0A 1WAJA 3SZ2A 4DFJA 3KK1A 2HNYA 3O3FA 3OS1A 3AA4A 1A5WA 1HYVA 4F4KA 4OKJA 2DFEA 4IFVA 2G8KA 4I2PA 4M3RA 4FLUA 3HL8A 2G8FA 4KHUA 4J2BA 1RCHA 1S5JA 4LY7A 4N56A 4DTPA 1MU2A 4Z4GA 1S9GA 3KKRA 1JLBA 1NK0A 3OYMA 3ZSQA 3HJFA 1Z26A 1L5UA 2VWJA 4DQSA 4FJ8A 4OVLA 3B6OA 2HHVA 1Q9XA 2Z1IA 4Z0UA 3OS2A 2E6MA 3NE6A 1ITGA 1UAXA 3K5OA 1SL0A 2PYLA 4EZ6A 4QCLA 4ZTJA 1I3AA 4KO0A 4IG3A 3SYZA 2OPPA 3AA5X 1N6QA 2P5OA 4KPYA 2JLEA 3QO9A 4KHSA 1HNIA 1HMVA 1T05A 3RR8A 1RTHA 2KZZA 1JLEA 3ISNC 3HM9A 4OKKA 3JSMA 3SQ0A 4M3XA 3DI6A 3AA3A 1C1AA 2IOCA 4FM0A 4FJKA 3TARA 1B92A 3AO4A 4HUGA 1J9AA 1KVAA 3CM6A 3CFPA 1NK6A 1WSIA 1EETA 3A2FA 4N5SA 3TAGA 4OLAA 1EXQA 2XY6A 4FK0A 3LALA 3TABA 1NKCA 3G0ZA 4L8RB 2HHUA 4K8XA 3QESA 3TI0A 3LP3A 5J2MA 5HRNA 4CFBA 3SI6A 3I0SA 5HP1A 2G8WA 1EKEA 4NCGA 2DFFA 4Q5VA 4DTXA 3OYBA 1TAUA 1HYZA 1ZBFA 3NF8A 4I2QA 4AHCA 4OGCA 4DS5A 3CM5A 3ZSWA 4EP5A 2F8TA 1BQMA 1BISA 1C1CA 3DLKA 4IG0A 4J2DA 2G8VA 5KGWA 1LW0A 4B8AB 1YTAA 4KTZA 2HNZA 5FRMA 5J2QA 1JL2A 3SNNA 3L2WA 2GBZA 4W5RA 4HHTA 4E7LA 5HLFA 4KB0A 4QOZB 3PX6A 2B5JA 4F3OA 3RWUA 3OYJA 4CJ3A 2XY7A 5FDLA 5J1EA 4LH5A 2IAJA 3K5LA 2HHQA 1DTQA 1S1VA 5JS2A 2D0BA 4DLGA 1B9DA 1A5XA 1GOCA 3TANA 2Z1HA 3RRGA 1IKWA 3KLFA 3ZSYA 4CHYA 4FJGA 3V9WA 2XY5A 3QEIA 1KRPA 1C0TA 1NK9A 2D0CA 4O55A 3K5NA 3VN5A 3MEGA 4JS5A 4E7HA 1BIUA 3ZCMA 3AO1A 1FXXA 3AO2A 4DTUA 1KCFA 3MECA 3OYHA 1NK8A 1L3UA 4F3TA 4DU4A 1CXQA 2QKKA 2X6NA 3DMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V1O A;  2BDP A;  2ETJ A;  2QXF A;  3OYE A;  3LWM A;  3NFA A;  1VSF A;  1QE1 A;  4FLW A;  1RT1 A;  5HRP A;  3WNE A;  3OYN A;  4B9M A;  5CY4 A;  1IKX A;  4FLX A;  3NAE A;  1ASW A;  3KKS A;  5JS1 A;  1NK7 A;  3SQ1 A;  1SL1 A;  1C0M A;  4FJM A;  4CJL A;  3EZ5 A;  1XHZ A;  4M3T A;  1DTT A;  4Z4C A;  5C25 A;  2YHA A;  4KTW A;  1NK4 A;  4KV8 A;  3V9X A;  3K57 A;  1TK5 A;  1N5Y A;  3TAE A;  2YNF A;  4FZX C;  4XIU A;  3LP0 A;  1RIL A;  1Q8I A;  2O4G A;  4MQ3 A;  5HRS A;  3ZT3 A;  3E01 A;  1LWE A;  1TKD A;  4DSK A;  2OPQ A;  4R5P A;  4C8N A;  4CEA A;  1RBV A;  5HBM A;  4ID1 A;  4DTS A;  3QET A;  2FBV A;  3HST B;  3ZSX A;  4CFA A;  1IKV A;  2EX3 A;  4ZTF A;  4CJV A;  4KHW A;  1BCM A;  1GOA A;  4CHO A;  4E1M A;  4BE1 A;  3QER A;  4AHT A;  3TAP A;  4H8K A;  3QIP A;  4RW9 A;  4E1N A;  5KRS A;  1HJR A;  1RDB A;  1TVR A;  1XHX A;  3AVB A;  1YVU A;  1BL3 A;  2YV0 X;  3OJU A;  3U6F A;  2LSN A;  4J2E A;  1QQC A;  3NDK A;  1DLO A;  1BIZ A;  3V1R A;  3KTQ A;  4BAC A;  4CK2 A;  4CIG A;  3O4Q A;  2E4L A;  4CEQ A;  1RT3 A;  4KRF A;  3VQA A;  1JLA A;  2HMI A;  1WSG A;  4BE2 A;  4DTJ A;  3ZSZ A;  1NJW A;  1FKO A;  1RBR A;  4CHZ A;  4JRP A;  4N47 A;  3U3Y A;  4NCB A;  5DK5 A;  3AVM A;  1SKS A;  2HW3 A;  1TAQ A;  1QS4 A;  2HVH A;  4CEB A;  3HVR A;  4GVM A;  2A1R A;  2XY8 A;  4FM2 A;  4M45 A;  1C0U A;  4FK4 A;  4CJ5 A;  1RT7 A;  3LAN A;  4CGD A;  3DOK A;  1YT3 A;  3SV3 A;  4B8C A;  3V9S A;  3HO1 A;  1SKW A;  4DQP A;  4CER A;  3M8S A;  3AVI A;  3AO5 A;  1ZBH A;  3EY1 A;  4AHS A;  4NCA A;  3PV8 A;  4FLZ A;  4J2A A;  4CHQ A;  4CJQ A;  3ZT1 A;  2YKN A;  5KRT A;  1XI1 A;  4Y1C A;  3ITH A;  1UOC A;  4B9S A;  4FXD A;  2HHT A;  4E19 A;  2RPI A;  3S3O A;  4K8Z A;  1NJX A;  4CJR A;  3PY8 A;  1GOB A;  3L2V A;  3VQD A;  2KW4 A;  2R7Y A;  1U4B A;  1R0A A;  1Y97 A;  3AVA A;  1KVC A;  4O4G A;  4CIF A;  1T7P A;  1NJZ A;  2VG6 A;  4CF2 A;  4KRE A;  4DG1 A;  3OS0 A;  4ELU A;  1VRU A;  4FJX A;  2OPR A;  3LP2 A;  3CYM A;  2HHS A;  1T03 A;  4B08 A;  4CEZ A;  4O5B A;  4BWJ A;  4CIE A;  5CYM A;  4CHN A;  3DLR A;  3NH2 A;  1WLJ A;  3KK2 A;  1NOY A;  2KFZ A;  1IKY A;  4DTM A;  4CEO A;  1HQU A;  3NGI A;  3L3V A;  1HNV A;  4C8K A;  1RTD A;  1VSM A;  3KK3 A;  2IS3 A;  2VWK A;  1CZB A;  1SKR A;  3OVN A;  1QSS A;  4IKF A;  4N76 A;  3KLH A;  1NKB A;  3KD5 E;  1KTQ A;  1RBT A;  4CED A;  1G15 A;  2ZD1 A;  4YNQ A;  3JYT A;  4M3Y A;  3RMB A;  4LD0 A;  3WNF A;  3OY9 A;  2KFN A;  1Q9Y A;  4BE0 A;  2FBY A;  3DOL A;  1J54 A;  3HYF A;  4CCH A;  3TAM A;  4YFU A;  3OYF A;  3SJJ A;  1F21 A;  1WSF A;  3OYD A;  3THV A;  2ZQB A;  4CJT A;  2PY5 A;  1JKH A;  2Z1G A;  2F96 A;  1BQN A;  4FCY A;  3P5J A;  3AVL A;  4DSL A;  3SQ4 A;  1S1U A;  1HQE A;  1XWL A;  2YNI A;  3QEX A;  3DRP A;  4IDK A;  4CJW A;  3PO4 A;  2HVI A;  5KGX A;  1RTJ A;  1RTI A;  3VQ9 A;  3NCI A;  4FK2 A;  4JLH A;  3AVC A;  5CZ1 A;  2B4J A;  3QEW A;  2BAN A;  4HCB A;  3C95 A;  4MFB A;  5HRR A;  4DQQ A;  3IS9 A;  4O0J A;  3SCX A;  2ITG A;  4FJJ A;  1VSK A;  3NGZ A;  4CJS A;  4BDP A;  3SUO A;  3RR7 A;  1RBS A;  3D0P A;  4DWI A;  4FJH A;  3C6U A;  4W5T A;  3LZJ A;  2KZM A;  4CHP A;  4Z4E A;  4DU1 A;  3F9K A;  3KD1 E;  4OLB A;  4UQG A;  1TL3 A;  3VQP A;  2P5G A;  3FFI A;  1JLG A;  1C1B A;  2RKI A;  2YKM A;  2YNG A;  3KLI A;  3OYL A;  4RW6 A;  4IBN A;  3LAK A;  3QNN A;  3TAQ A;  4F8R A;  1W9H A;  2XHB A;  3VQB A;  3HPO A;  2HHW A;  3L3U A;  4F2R A;  3C94 A;  4CJF A;  2Y1J A;  4G1Q A;  3PO5 A;  1S6Q A;  1J53 A;  4ZHR A;  4FJ5 A;  3OYG A;  3VQE A;  4FLT A;  4DTR A;  4C8O A;  4FLV A;  2WOM A;  4FJ9 A;  4B9T A;  4EP4 A;  3TWH A;  1VSL A;  3NF7 A;  1X9S A;  1IO2 A;  4C8L A;  3AV9 A;  4DMN A;  3QEP A;  3O3G A;  3AVJ A;  4PQU A;  4FJ7 A;  1ZBL A;  4DSJ A;  1KFD A;  1BGX T;  3KLG A;  5CZ2 A;  3SQ2 A;  4B9V A;  1L3V A;  4B9N A;  3OYC A;  3AVG A;  1LAV A;  3HT3 A;  4F2S A;  3PUF A;  3VQ4 A;  3S9H A;  1S6P A;  3G10 A;  2OZS A;  4LSL A;  1K6Y A;  2HND A;  4Z4H A;  3KLE A;  1HYS A;  4WE1 A;  1ZBU A;  4LH4 A;  1ASU A;  1UA1 A;  4DSI A;  3P83 D;  1ZBI A;  4PY5 A;  3HP6 A;  4QAG A;  4DSE A;  3EYZ A;  4DTO A;  4AHV A;  1C6V A;  1LWF A;  1RDA A;  4Y1D A;  4OKE A;  3SUP A;  4KHQ A;  1VRT A;  1NKE A;  1FKP A;  1J5O A;  5FRO A;  4HTU A;  2GV9 A;  4OGE A;  1BCO A;  3DYA A;  3NH1 A;  3V9Z A;  1LWC A;  4ELV A;  3MXM A;  2I5J A;  3I0R A;  1RDC A;  4CFC A;  4CGI A;  1RT6 A;  1TL1 A;  1RT5 A;  4AH9 A;  4JRQ A;  3M8Q A;  3HK2 A;  3I8D A;  3O4N A;  4E7J A;  5I42 A;  4Q0B A;  1D5A A;  3CFO A;  2E6L A;  1JXB A;  3T3F A;  3DLH A;  1WN7 A;  1JLF A;  1HPZ A;  2HB5 A;  2IGI A;  5E41 A;  3SV4 A;  4DF8 A;  2KTQ A;  4FW2 A;  3T1A A;  3D45 A;  3QEV A;  2FBX A;  1QTM A;  1VSJ A;  1VSI A;  3K59 A;  4B9L A;  4EZ9 A;  3MXJ A;  3NHG A;  1X9M A;  4E3S A;  3ULD A;  4CGH A;  3QIN A;  4ICL A;  3RTV A;  5SWM A;  4O0I A;  3LDS A;  3ZT2 A;  3S3N A;  2G8H A;  2O4I A;  1SL2 A;  4ID5 A;  2YHB A;  3VQ6 A;  4BDY A;  1EX4 A;  2W42 A;  4AIL C;  4FM1 A;  1WAF A;  1SUQ A;  4I7F A;  4RW8 A;  3CFR A;  1NOZ A;  3S3M A;  1U45 A;  4DQI A;  4OPJ A;  3DRR A;  3L2R A;  3VQ7 A;  1BHL A;  4CK3 A;  3KJV A;  4H4M A;  3ZT4 A;  4KKO A;  2RN2 A;  2DFH A;  3L8B A;  1U47 A;  1S1X A;  4JS4 A;  1D9D A;  4CES A;  3AVH A;  4DFM A;  3LAM A;  1VSD A;  3TAF A;  4CJE A;  4CFD A;  2JGU A;  4CJK A;  2PYJ A;  3QLH A;  3NF9 A;  4FLY A;  3LWL A;  1JLC A;  1TK8 A;  4KI4 A;  4I9Q A;  3LPU A;  4FW1 A;  3K5M A;  4W5Q A;  1RBU A;  3VQQ A;  3BGR A;  1JLQ A;  4LSN A;  2XRI A;  5HRO A;  3IRX A;  1TKT A;  1L3T A;  4AHR A;  5I3U A;  1Z25 A;  2ZE2 A;  4KHN A;  2F8S A;  3AVF A;  4KFB A;  2DTU A;  4H4O A;  4CEF A;  4FJL A;  3ZSO A;  1NK5 A;  4HVJ A;  1RT4 A;  1ZYQ A;  5D3G A;  3DLG A;  4M42 A;  4FZY A;  5T7B A;  5C24 A;  1TKZ A;  4DS4 A;  4DU3 A;  4HUF A;  2IDO A;  1CLQ A;  2DY4 A;  2IC3 A;  4TSX A;  3V9U A;  3OJS A;  4DF4 A;  3OYA A;  2Q3S A;  4FYD A;  3O3H A;  3HXM A;  5KTQ A;  1QSL A;  1KSP A;  3P1G A;  3PX0 A;  4O44 A;  3MED A;  3VA0 A;  2WON A;  2X6S A;  1KVB A;  4FJN A;  1U48 A;  2GUI A;  3H08 A;  4PA1 A;  4ELT A;  3RMC A;  2OYQ A;  4B3O A;  3NBP A;  4DLE A;  4E7K A;  1KLN A;  2OPS A;  1S9E A;  1WSJ A;  3VQ8 A;  4CJP A;  3QIO A;  4AHU A;  4OPK A;  4KB1 A;  4PUO A;  4GMJ B;  4M3Z A;  2BGG A;  1D9F A;  1RT2 A;  4NYN A;  4CK1 A;  1X1P A;  2KQ2 A;  4CF1 A;  3WNG A;  2OA8 A;  2X74 A;  3DLE A;  4RW7 A;  5CYQ A;  4CF9 A;  4C8M A;  4M3W A;  3NF6 A;  3HPH A;  2NUB A;  3ZSR A;  4DSF A;  2QK9 A;  4DFK A;  1LW2 A;  1REV A;  4OJR A;  3VQC A;  3RMD A;  1I39 A;  2D5R A;  3ZSV A;  4M3U A;  1YTU A;  5C42 A;  2G8U A;  2HHX A;  3TR8 A;  1EP4 A;  4E89 A;  1VSH A;  1A5V A;  1JXE A;  1IG9 A;  4W5N A;  1HRH A;  3HPG A;  4RG8 A;  4CJU A;  4DFP A;  3V6D A;  3VQ5 A;  3QNO A;  3SUQ A;  1TK0 A;  4CF8 A;  2YNH A;  2EHG A;  3ZT0 A;  3OYK A;  2D0A A;  3UIQ A;  1S1W A;  3L2U A;  2VG5 A;  3DRS A;  1W0H A;  2ATQ A;  3OYI A;  3K2P A;  4CGG A;  1KFS A;  1BI4 A;  3IG1 A;  3F73 A;  3SPZ A;  4CJ4 A;  1JL1 A;  3AA2 A;  1TKX A;  4HUE A;  1QSY A;  3K58 A;  5J2N A;  4KHY A;  3CQ8 A;  3CG7 A;  4FJI A;  2G8I A;  1VSE A;  3ALY A;  1QHT A;  4FZZ A;  2VG7 A;  2PZS A;  3SUN A;  4DTN A;  3SPY A;  3HP9 A;  3AO3 A;  1SV5 A;  3ASM A;  3LP1 A;  4CF0 A;  4CGF A;  2XO7 A;  4E7I A;  3PX4 A;  4Z4I A;  3KIO A;  5SZT A;  3V4I A;  2Z1J A;  1S1T A;  3NGY A;  3L2Q A;  2QKB A;  4W5O A;  1BI4 B;  4E0D A;  3T19 A;  3AVK A;  1U49 A;  1WNS A;  4M41 A;  3RRH A;  3LZI A;  1LV5 A;  4IFY A;  1WSH A;  3BDP A;  2X78 A;  1D8Y A;  1ASV A;  4NYF A;  4Z4F A;  1IH7 A;  4CGJ A;  4PWD A;  3MXI A;  4DQR A;  2FBT A;  3M8P A;  3MEE A;  3V1Q A;  5K14 A;  5J2P A;  4KI6 A;  4GW6 A;  1LAW A;  1UWB A;  1XC9 A;  2A1S A;  3B6P A;  4KTQ A;  3M8R A;  1KLM A;  1U04 A;  1VK0 A;  3U3G A;  3WNH A;  1FK9 A;  2P1J A;  3V81 A;  2OZM A;  3IAY A;  2AJQ A;  5DMR A;  1O1W A;  2B6A A;  4BDZ A;  3C6T A;  1UA0 A;  5KI6 A;  3VA3 A;  4CEE A;  4FVM A;  4BWM A;  3RMA A;  3DLB A;  5FRN A;  1CZ9 A;  1WSE A;  3MAQ A;  3HVT A;  4N41 A;  3AVN A;  3DM2 A;  1RDD A;  4CE9 A;  4CEC A;  2P51 A;  1T8E A;  1B9F A;  4RW4 A;  3NH0 A;  2BE2 A;  1X9W A;  1CXU A;  4I9L A;  5EU7 A;  1NJY A;  3LPT A;  1TV6 A;  1RNH A;  2Y1I A;  2RF2 A;  1L3S A;  4B9U A;  4HCC A;  1TGO A;  4KAZ A;  2FC0 A;  1WAJ A;  3SZ2 A;  4DFJ A;  3KK1 A;  2HNY A;  3O3F A;  3OS1 A;  3AA4 A;  1A5W A;  1HYV A;  4F4K A;  4OKJ A;  2DFE A;  4IFV A;  2G8K A;  4I2P A;  4M3R A;  4FLU A;  3HL8 A;  2G8F A;  4KHU A;  4J2B A;  1RCH A;  1S5J A;  4LY7 A;  4N56 A;  4DTP A;  1MU2 A;  4Z4G A;  1S9G A;  3KKR A;  1JLB A;  1NK0 A;  3OYM A;  3ZSQ A;  3HJF A;  1Z26 A;  1L5U A;  2VWJ A;  4DQS A;  4FJ8 A;  4OVL A;  3B6O A;  2HHV A;  1Q9X A;  2Z1I A;  4Z0U A;  3OS2 A;  2E6M A;  3NE6 A;  1ITG A;  1UAX A;  3K5O A;  1SL0 A;  2PYL A;  4EZ6 A;  4QCL A;  4ZTJ A;  1I3A A;  4KO0 A;  4IG3 A;  3SYZ A;  2OPP A;  3AA5 X;  1N6Q A;  2P5O A;  4KPY A;  2JLE A;  3QO9 A;  4KHS A;  1HNI A;  1HMV A;  1T05 A;  3RR8 A;  1RTH A;  2KZZ A;  1JLE A;  3ISN C;  3HM9 A;  4OKK A;  3JSM A;  3SQ0 A;  4M3X A;  3DI6 A;  3AA3 A;  1C1A A;  2IOC A;  4FM0 A;  4FJK A;  3TAR A;  1B92 A;  3AO4 A;  4HUG A;  1J9A A;  1KVA A;  3CM6 A;  3CFP A;  1NK6 A;  1WSI A;  1EET A;  3A2F A;  4N5S A;  3TAG A;  4OLA A;  1EXQ A;  2XY6 A;  4FK0 A;  3LAL A;  3TAB A;  1NKC A;  3G0Z A;  4L8R B;  2HHU A;  4K8X A;  3QES A;  3TI0 A;  3LP3 A;  5J2M A;  5HRN A;  4CFB A;  3SI6 A;  3I0S A;  5HP1 A;  2G8W A;  1EKE A;  4NCG A;  2DFF A;  4Q5V A;  4DTX A;  3OYB A;  1TAU A;  1HYZ A;  1ZBF A;  3NF8 A;  4I2Q A;  4AHC A;  4OGC A;  4DS5 A;  3CM5 A;  3ZSW A;  4EP5 A;  2F8T A;  1BQM A;  1BIS A;  1C1C A;  3DLK A;  4IG0 A;  4J2D A;  2G8V A;  5KGW A;  1LW0 A;  4B8A B;  1YTA A;  4KTZ A;  2HNZ A;  5FRM A;  5J2Q A;  1JL2 A;  3SNN A;  3L2W A;  2GBZ A;  4W5R A;  4HHT A;  4E7L A;  5HLF A;  4KB0 A;  4QOZ B;  3PX6 A;  2B5J A;  4F3O A;  3RWU A;  3OYJ A;  4CJ3 A;  2XY7 A;  5FDL A;  5J1E A;  4LH5 A;  2IAJ A;  3K5L A;  2HHQ A;  1DTQ A;  1S1V A;  5JS2 A;  2D0B A;  4DLG A;  1B9D A;  1A5X A;  1GOC A;  3TAN A;  2Z1H A;  3RRG A;  1IKW A;  3KLF A;  3ZSY A;  4CHY A;  4FJG A;  3V9W A;  2XY5 A;  3QEI A;  1KRP A;  1C0T A;  1NK9 A;  2D0C A;  4O55 A;  3K5N A;  3VN5 A;  3MEG A;  4JS5 A;  4E7H A;  1BIU A;  3ZCM A;  3AO1 A;  1FXX A;  3AO2 A;  4DTU A;  1KCF A;  3MEC A;  3OYH A;  1NK8 A;  1L3U A;  4F3T A;  4DU4 A;  1CXQ A;  2QKK A;  2X6N A;  3DMJ A; 
#chains in the Genus database with same CATH topology
 5AJ3 K;  5FPN A;  4OPA A;  3AAR A;  4MO4 A;  1QE1 A;  3OYN A;  1IKX A;  1Q81 O;  1HKC A;  4IOX A;  1NK7 A;  3SQ1 A;  4BC2 A;  4LF6 K;  5JS1 A;  3AY9 A;  4FJM A;  2ASP A;  5MLC Q;  1DTT A;  3EO3 A;  4BR0 A;  4KTW A;  3EN9 A;  3TAE A;  2O4G A;  4MQ3 A;  3E01 A;  1TKD A;  2OPQ A;  2JWL A;  1SAZ A;  2WFB A;  5C12 A;  1DT9 A;  3CJA A;  4BY9 C;  4CFA A;  2QA4 N;  4DHY A;  4CHO A;  3QER A;  4B9M A;  4AHT A;  4H8K A;  5KRS A;  2OCE A;  4WF9 L;  3U6F A;  3OJU A;  2YV0 X;  2YJE A;  3KTQ A;  3O4Q A;  2E4L A;  3VQA A;  2HMI A;  1WSG A;  5DK5 A;  3AVM A;  2KLA A;  4GKJ K;  3KWG A;  4CZG A;  3EKU A;  1TAQ A;  4H5V A;  2HW3 A;  3CQX A;  4CEB A;  2P9P B;  3R8E A;  4M45 A;  4CJ5 A;  3L6Q A;  4K42 A;  3AO5 A;  4JHD A;  4FLZ A;  4CJQ A;  3TSP A;  1QQO A;  2I7P A;  1XMO K;  3ITH A;  1UOC A;  3CCS N;  3A5M C;  3S3O A;  4K8Z A;  3MN5 A;  3PY8 A;  1GOB A;  3VQD A;  1U4B A;  1Y97 A;  4AF1 A;  3AVA A;  1NG9 A;  1IV0 A;  1KVC A;  3M5R A;  1JCE A;  1OH5 A;  2W6L A;  3BEX A;  5LL6 Z;  2VG6 A;  4CF2 A;  5AQO A;  2AP1 A;  3TU5 A;  4JKG B;  3LP2 A;  4FJX A;  3CYM A;  5BRF A;  2NRT A;  3KK2 A;  4WYB A;  1IKY A;  3TSU A;  3EE9 A;  1VQ7 N;  1NU0 A;  4IXC A;  3WEE B;  3L3V A;  1VSM A;  3OVN A;  1QSS A;  4MLH A;  1KTQ A;  4CED A;  2UYT A;  1N8R O;  2NRX A;  3RMB A;  4XEI A;  2CH6 A;  4JK9 A;  4IJN A;  2FBY A;  3J8A A;  3TAM A;  4CVN E;  3OYF A;  2ZQB A;  4MDB A;  4FVU A;  3CHW A;  4DSL A;  5M1Q A;  3VEW A;  3THW B;  1HQE A;  2YNI A;  3DRP A;  1KAY A;  4CJW A;  3WQT A;  4A61 A;  4H0X B;  3AVC A;  4A59 A;  4CBX A;  2UXB K;  2W6K A;  2CGJ A;  2ITG A;  1EQY A;  2P9N B;  2RHK A;  4DWI A;  4FJH A;  3C6U A;  2ZJP L;  4Z4E A;  1BO5 O;  2QTD A;  3VQP A;  1L3T A;  3KLI A;  1C1B A;  4FWQ A;  2Q0U A;  1W9H A;  2VCP A;  3L3U A;  4CJF A;  4G1Q A;  3OYG A;  2I7N A;  3RVC A;  4C8L A;  1YJN N;  3FZM A;  1BGX T;  1L3V A;  3D7E O;  4F2S A;  1GLF O;  4O8K A;  2OZS A;  1K6Y A;  3ZYY X;  4LH4 A;  1ASU A;  4IO9 L;  1UA1 A;  1ILY A;  3T7Z A;  4AHV A;  1LWF A;  4OKE A;  2QI2 A;  2YCH A;  4HTU A;  2GV9 A;  3NH1 A;  3V9Z A;  4FOI A;  3ZX0 A;  3CCM N;  2F7T A;  1NMN A;  2I5J A;  4C1N K;  3I0R A;  4PL7 A;  2VQF K;  4CGI A;  4YOX A;  1BOT O;  4BRL A;  4F9O A;  5I42 A;  2Q1N A;  4ISG A;  1WN7 A;  1HPZ A;  5E41 A;  3ZET B;  3K59 A;  3CCJ N;  1XQS C;  4ICL A;  3H45 C;  2P9S A;  3ZT2 A;  4Z94 A;  3VQ6 A;  1GLC G;  4DQI A;  3VTI A;  3DRR A;  2ASO A;  3VQ7 A;  4DKW A;  1YJW N;  3L8B A;  2PBD A;  4BC5 A;  1U47 A;  1D9D A;  4CES A;  3KVG A;  4DFM A;  3TAF A;  3HI0 A;  3QLH A;  4BR7 A;  4FLY A;  1VQK N;  1MA9 B;  4I9Q A;  4W5Q A;  2O8D A;  5DM7 L;  3BGR A;  4JI3 K;  3VEO A;  1TKT A;  1Z25 A;  4QS9 A;  2NRH A;  4H4O A;  1NK5 A;  1XNQ K;  1RT4 A;  4EHU A;  1EWQ A;  4DR3 K;  5D3G A;  4DS4 A;  1TKZ A;  4H5N A;  4BR5 A;  5JIC A;  1CLQ A;  4TSX A;  4DF4 A;  1NGG A;  3P1G A;  3PX0 A;  4O44 A;  3MED A;  2WON A;  1KVB A;  3CQY A;  1U48 A;  3H08 A;  3RMC A;  4LF5 K;  4B3O A;  5JMV A;  5AQX A;  1KLN A;  5ADX A;  1S9E A;  4CJP A;  3VQ8 A;  5AQJ A;  1Q82 O;  4YOR A;  4AHU A;  3SAF A;  4E1J A;  4OPK A;  4LF7 K;  4M3Z A;  4WFB L;  4I6M A;  4CK1 A;  1NGD A;  4CF1 A;  3WNG A;  1VQM N;  3DLE A;  5CHI A;  5CYQ A;  4CF9 A;  4C8M A;  4B1U B;  1T3V A;  3NF6 A;  4CZM A;  3LDL A;  4OJR A;  3VQC A;  1I39 A;  5C42 A;  2G8U A;  1EP4 A;  1VSH A;  3JS6 A;  4QS7 A;  4W5N A;  3VQ5 A;  4BQZ A;  4B1V A;  3THY B;  1P90 A;  3MWT A;  3F2K A;  4HTL A;  4JI4 K;  3FFK B;  3ZT0 A;  5GAG P;  4X62 K;  3KWI A;  4IJA A;  3L2U A;  1W0H A;  3OYI A;  2O4I A;  3K2P A;  1KFS A;  3IG1 A;  4NCA A;  4JAX A;  5AFU H;  5C10 A;  5J2N A;  3CG7 A;  3ALY A;  4FWL A;  3ID8 A;  3ULE A;  3HP9 A;  4CF0 A;  1ZC6 A;  5LJV A;  4E7I A;  3PX4 A;  4Z4I A;  4DUZ K;  2Z1J A;  1S1T A;  3K9J A;  1BI4 B;  3AVK A;  4MO5 A;  4M41 A;  1W2B M;  3BDP A;  1WSH A;  1ASV A;  3CCV N;  4NYF A;  3S41 A;  4CGJ A;  3M8P A;  3LM2 A;  3O8M A;  4GW6 A;  1LAW A;  1UWB A;  4KTQ A;  2A1S A;  4CD1 A;  1QVG M;  2OZM A;  3W3D A;  3IAY A;  5DMR A;  3DLB A;  3RMA A;  1WBB A;  1QHA A;  3PIP L;  4FWM A;  3QML A;  3MAQ A;  3HVT A;  3FZK A;  1MDU B;  3F9M A;  3WXM B;  1B9F A;  4RW4 A;  1X9W A;  1CXU A;  3KK7 A;  3ENH A;  2UUB K;  1TV6 A;  2Y1I A;  3GL1 A;  4HCC A;  3TPQ A;  4KAZ A;  2FC0 A;  1WAJ A;  3SZ2 A;  2HNY A;  5JLH A;  3OS1 A;  3AA4 A;  5A2Q O;  4CBU A;  3Q7B A;  5BPM A;  4IFV A;  4JNE A;  4FLU A;  4KHU A;  4YOT A;  1RCH A;  4JD2 A;  4N56 A;  3DWL A;  1E4G T;  2J4R A;  1JLB A;  1NK0 A;  3ZSQ A;  1L5U A;  1GLJ O;  2VWJ A;  4DQS A;  1H1V A;  2HHV A;  1Q9X A;  2OTJ N;  3ZEU B;  1KAX A;  1T05 A;  1W97 L;  3MN7 A;  1G99 A;  1U6Z A;  2GTD A;  2O8C A;  5F2R A;  5AQT A;  3AA3 A;  5GAH P;  4FM0 A;  1J9A A;  3NMU A;  3SAH A;  3WUH A;  2XY6 A;  2HBL A;  1NKC A;  2HHU A;  4L3Q A;  3SI6 A;  2P9L B;  4DV1 K;  4DTX A;  3H6E A;  1TAU A;  3NF8 A;  4DS5 A;  4I2Q A;  2F8T A;  3VEZ A;  1FJG K;  4EP5 A;  2HF3 A;  1BIS A;  4OX9 K;  4NLC A;  4KH4 A;  5AZI A;  1JL2 A;  4RCH A;  3L2W A;  4YY3 K;  5HLF A;  3CC4 N;  4BRP A;  1QQM A;  5FDL A;  2D4W A;  5J1E A;  3K5L A;  4BRN A;  2D0B A;  5BR8 K;  3CC7 N;  1A5X A;  1GOC A;  4JYA K;  3DXM A;  2XY5 A;  3QEI A;  4O55 A;  3VN5 A;  2QW9 A;  3MEG A;  4JS5 A;  1FXX A;  3AO2 A;  1KCF A;  1NK8 A;  3Q7C A;  3LWM A;  3NFA A;  4IEE A;  4FLW A;  4BRC A;  1U2V B;  3H3N O;  3NAE A;  4JI8 K;  4CZL A;  5BPL A;  1SL1 A;  1WUA A;  5C2D A;  4Z4C A;  5C25 A;  2ASM A;  3V9X A;  3K57 A;  4XIU A;  3LP0 A;  4YOW A;  4CEA A;  2O8F A;  2FBV A;  3MCP A;  4E1M A;  3QIP A;  4E1N A;  1RDB A;  1YVU A;  5AQG A;  3J81 O;  1M1K O;  3NDK A;  2F9T A;  3SMS A;  4BAC A;  3ENB A;  1RT3 A;  5BN9 A;  3ATU A;  4DTJ A;  3VEX A;  1RGI A;  1FKO A;  3AAQ A;  4JRP A;  3LL3 A;  3C6A A;  1QS4 A;  3FZL A;  3HVR A;  5AFU A;  2A1R A;  4JI6 K;  4JI5 K;  4FM2 A;  3SV3 A;  1YT3 A;  3J7Y P;  1U2V A;  3HO1 A;  2HBJ A;  3M8S A;  4BRD A;  5AQK A;  3GDQ A;  1YUW A;  3PV8 A;  5KRT A;  3IDH A;  2O8F B;  4E19 A;  2RPI A;  3P38 A;  5HOO A;  2KW4 A;  2R7Y A;  4JI1 K;  5AQL A;  4PL8 A;  1T6D A;  4M7Y A;  1NGE A;  5EVZ A;  4DG1 A;  2P9U A;  1KD1 O;  4ELU A;  2OPR A;  3CI5 A;  3SJH A;  2HHS A;  3ULE B;  1NOY A;  3H46 O;  2KFZ A;  3I56 N;  5B8H A;  5BPN A;  4C8K A;  3KK3 A;  4IKF A;  5AZJ B;  4N76 A;  3KLH A;  1NKB A;  3KD5 E;  1G15 A;  4M3Y A;  4PKH A;  3DOL A;  2FSJ A;  3HYF A;  4YFU A;  3OYD A;  1WSF A;  1JKH A;  2F96 A;  1S1U A;  3SMP A;  3PO4 A;  1RTJ A;  4FK2 A;  1DGK N;  2QM1 A;  4JLH A;  3QEW A;  3C95 A;  4MFB A;  5HRR A;  1HLU A;  3SCX A;  3O1W A;  4CJS A;  4BDP A;  2ZJQ L;  1RBS A;  5E26 A;  3LZJ A;  2KZM A;  3I8B A;  3PSF A;  2NRW A;  5TKW A;  4CZK A;  3KD1 E;  1WBD A;  4OLB A;  1NGF A;  3EKS A;  4UQG A;  2QWP A;  2P5G A;  1JLG A;  2RKI A;  2YKM A;  2YNG A;  4ISF A;  4F8R A;  4PKG A;  5TKY A;  3LAK A;  2EWS A;  1XNR K;  3QFU A;  1HNW K;  4F2R A;  3C94 A;  3OTO K;  3PO5 A;  1J53 A;  3CD6 N;  4DTR A;  4C8O A;  4FJ9 A;  2WOM A;  1YIT N;  3TWH A;  3SBT A;  5JLF A;  1Z6R A;  3CME N;  1ZXO A;  1HKB A;  3AV9 A;  2P9K B;  4DMN A;  3AVJ A;  2P9P A;  4B9N A;  1LAV A;  4B3M K;  5JVH L;  1S6P A;  3G10 A;  2PAV A;  5ELZ A;  3THY A;  3A8Y A;  5F0X A;  1TYQ B;  2HND A;  1HYS A;  1YVN A;  4WE1 A;  4PY5 A;  4O8U A;  1S72 N;  4Y1D A;  4WQ5 C;  4KHQ A;  1HNX K;  5BN8 A;  3M1F A;  1NBW A;  3MXM A;  2O8E B;  4CFC A;  5ADX H;  1RT5 A;  4AH9 A;  3M8Q A;  4V19 S;  3I8D A;  3CPW M;  5AZJ A;  3T1Y K;  3CJ9 A;  1X3M A;  1JXB A;  3WXL A;  2A41 A;  4FSV A;  2IGI A;  2KTQ A;  5M1N A;  3SV4 A;  2P9S B;  2YI1 A;  4YDU A;  4JV5 K;  3QEV A;  2FBX A;  3PSI A;  2QWQ A;  3NHG A;  3FLC O;  3ULD A;  4K25 A;  3LDS A;  4ID5 A;  2YHB A;  2WTU A;  3HSC A;  4FM1 A;  1SUQ A;  1C0G A;  1K9M O;  4CK3 A;  3UB5 A;  3ZT4 A;  4KKO A;  4JS4 A;  3AVH A;  2PYJ A;  4CJE A;  4CFD A;  2JGU A;  3ENO A;  4CJK A;  4KI4 A;  1TK8 A;  3LPU A;  3K5M A;  1RBU A;  1JLQ A;  1QVF M;  1JJ2 M;  2XRI A;  3A5N C;  4DV6 K;  3WXK A;  4AHR A;  5I3U A;  3FGU A;  2F8S A;  4KFB A;  4FJL A;  3WEE A;  4H0V B;  1XC3 A;  3VEN A;  3MDQ A;  2IVN A;  3SAG A;  1YAG A;  3DLG A;  3RSE A;  5AQI A;  4BR4 A;  4U7B A;  5C24 A;  2Q36 A;  3U8X A;  4U67 L;  4DU3 A;  1VQP N;  4HUF A;  3ID6 A;  2IDO A;  3O9S A;  4FYD A;  2YX6 A;  3OYA A;  4JEP A;  1QSL A;  1KSP A;  2Q0R A;  3O1B A;  4E7K A;  2OPS A;  1WSJ A;  4KHP K;  3QIO A;  3ZX3 A;  4KB1 A;  4PUO A;  4CW7 B;  2KQ2 A;  2OA8 A;  4LFA K;  1OVY A;  2WBN A;  5IWA K;  5C0Y A;  2E2P A;  4BVO A;  4M3W A;  3G25 A;  3HPH A;  2E5L K;  3ZSR A;  4DSF A;  3GE1 A;  3ZSV A;  4B9Q A;  4M3U A;  5AR0 A;  1NGI A;  5EY4 A;  1A5V A;  1JXE A;  5F1X A;  2E1Z A;  3V6D A;  1GLL O;  3QNO A;  3SUQ A;  4CF8 A;  1SS6 A;  2EHG A;  5I9E B;  3UIQ A;  2NRZ A;  1S1W A;  5BRE A;  4BG9 A;  3F73 A;  3SPZ A;  4HUE A;  1JL1 A;  4KHY A;  3K58 A;  1TUU A;  4DR1 K;  3UKU A;  5AQW A;  4DTN A;  2V52 B;  3AO3 A;  1SV5 A;  3LP1 A;  4X66 K;  4BG8 A;  3V4I A;  3NGY A;  1QQN A;  4E0D A;  2WUS A;  1U49 A;  1WNS A;  1LV5 A;  4IFY A;  2CGK A;  3ZET A;  2FBT A;  5AQM A;  5K14 A;  4WQ5 A;  3HOS A;  3VEV A;  3PLA A;  1KLM A;  1VK0 A;  3U3G A;  2O8B A;  3GG4 A;  2P1J A;  1HX1 A;  1CZA N;  1J5E K;  2B6A A;  4BDZ A;  3NVM A;  4BC3 A;  3NVK A;  5FRN A;  1CZ9 A;  1E4F T;  4EIA A;  3HTV A;  3AVN A;  1RDD A;  3N4P A;  4CE9 A;  4CEC A;  2P9N A;  3SK3 A;  2P51 A;  2BE2 A;  4KBO A;  4I9L A;  2W41 A;  3LPT A;  2W40 A;  1BDG A;  3G6E N;  1TGO A;  1O13 A;  4UY8 O;  4DFJ A;  1ATS A;  1HYV A;  4OKJ A;  3L4I A;  2G8K A;  4I2P A;  2UUA K;  4BRE A;  1MU2 A;  3BY5 A;  1MWK A;  3OYM A;  4DUY K;  1Z26 A;  4IO8 A;  5CR4 A;  3VPZ A;  1BA1 A;  4FJ8 A;  5BRD A;  4O5F A;  2Z1I A;  3C0B A;  1SL0 A;  2OPP A;  3AA5 X;  3QIC A;  4NXN K;  2IVO A;  3QO9 A;  4KHS A;  1HNI A;  1HMV A;  3RR8 A;  2KZZ A;  2NRR A;  3SQ0 A;  3HM9 A;  1N32 K;  3JSM A;  1HPM A;  4FJK A;  3TTC A;  3F5T A;  4HUG A;  1NK6 A;  3K0S A;  1WSI A;  3A2F A;  4OLA A;  1EXQ A;  2F9W A;  3LAL A;  2FXU A;  3QES A;  2GWJ A;  2G8W A;  5HRN A;  5C15 A;  5M1K A;  1LCU A;  2FLO A;  2DFF A;  4Q5V A;  3L4Q A;  3O4W A;  4AHC A;  3ZSW A;  3U9D A;  2D0P A;  1BQM A;  3DLK A;  2Q2R A;  1LW0 A;  1Q86 O;  3CPE A;  4JKC A;  1YTA A;  4X65 K;  1EWR A;  3VF2 A;  3SNN A;  1KXP A;  2GEM A;  4LF4 K;  2GBZ A;  4W5R A;  1ATR A;  4QOZ B;  1N33 K;  4F3O A;  3RWU A;  3WXJ A;  4CJ3 A;  2IAJ A;  1S1V A;  5JS2 A;  2UXC K;  1B9D A;  3TAN A;  2Z1H A;  5AQF A;  5EX5 A;  4DV2 K;  4FJG A;  3FZF A;  4CI6 A;  2ZM6 K;  3ZCM A;  3CC2 N;  4PKI A;  4RTF D;  3OYH A;  1L3U A;  4DU4 A;  3C7N A;  5FRM A;  4BRF A;  3V1O A;  2ETJ A;  2QXF A;  3OYE A;  1VSF A;  3WNE A;  5AQP A;  1K8K B;  4HWI A;  1ASW A;  1NK4 A;  4KV8 A;  5E84 A;  1TK5 A;  1N5Y A;  4JI2 K;  4FZX C;  2KHO A;  1Q8I A;  2ITM A;  5HRS A;  1LWE A;  4R5P A;  2GWK A;  4ID1 A;  4DTS A;  3HST B;  2NZT A;  4DV7 K;  3ZSX A;  5HL7 L;  2EX3 A;  4YDU C;  3TAP A;  4FJI A;  4JK7 A;  1HJR A;  1XHX A;  1TVR A;  3AVB A;  3TTF A;  3CF5 L;  3V1R A;  4KH6 A;  4CZJ A;  4LF8 K;  4KRF A;  3VES A;  3WXI A;  5GIP A;  1JLA A;  5KPZ A;  4CHZ A;  3U3Y A;  4IEI A;  2HVH A;  1S22 A;  1HR0 K;  4GVM A;  2XY8 A;  4FK4 A;  1C0U A;  1RT7 A;  3LAN A;  4CGD A;  3DOK A;  4G9Z A;  4BRG A;  4DQP A;  1ZBH A;  3EY1 A;  1HUX A;  2NLX A;  3QFP A;  3ZT1 A;  2HHT A;  1NJX A;  1GLE G;  4CJR A;  1R0A A;  2BH1 A;  4YOV A;  4O4G A;  4IWV A;  4CIF A;  4IFE A;  1DEJ A;  1NJZ A;  4JD2 B;  4XH4 A;  4KRE A;  2VWB A;  3P39 A;  4AQY K;  3R1X A;  4WFN L;  4CEZ A;  4NXM K;  4CIE A;  3DLR A;  1WLJ A;  1VQO N;  1NGA A;  2QWM A;  3VMF B;  3ZEU A;  3NGI A;  1GLD G;  1HNV A;  1RTD A;  2IS3 A;  2VWK A;  1CZB A;  1SKR A;  3CCQ N;  2Q97 A;  1RBT A;  4YNQ A;  2ZD1 A;  3JYT A;  2GUP A;  3WNF A;  2KFN A;  4BE0 A;  1ATN A;  1VHX A;  4BVP A;  4DV5 K;  4CCH A;  3SJJ A;  3OHR A;  1NGJ A;  2P9L A;  1BQN A;  4FCY A;  3P5J A;  3AVL A;  4B1X B;  1RFQ A;  3C7N B;  3SQ4 A;  1XWL A;  3QEX A;  4IDK A;  3R6M A;  4CZE A;  2V7Y A;  4DV3 K;  2HVI A;  3D6R A;  5KGX A;  1RTI A;  4K43 A;  2CH5 A;  5CZ1 A;  2B4J A;  3I55 N;  4HCB A;  4JKH A;  3IS9 A;  4O0J A;  5BR9 A;  1KAZ A;  3RR7 A;  3UKU B;  2HOE A;  3BUZ B;  4CHP A;  1NGB A;  2O8D B;  5AQU A;  3F9K A;  5LMU K;  3IUC A;  3VTH A;  3OYL A;  1ESV A;  4FWO A;  2XHB A;  3HPO A;  4FWS A;  4H0Y B;  3H1V X;  3R9P A;  2Y1J A;  1S6Q A;  2NNW A;  4ZHR A;  4FJ5 A;  5AQZ A;  4B9T A;  4EP4 A;  4ISE A;  3NF7 A;  1X9S A;  1ZBL A;  4DSJ A;  5CZ2 A;  4RWT A;  3SQ2 A;  4B9V A;  2JWK A;  4FL9 A;  3PUF A;  3S9H A;  2E88 A;  1IJJ A;  1JCG A;  4IOA L;  4Z4H A;  3BP8 A;  3AAP A;  4FWK A;  1ZBU A;  4DSI A;  3HP6 A;  4QAG A;  3EYZ A;  4YOY A;  1C6V A;  1RDA A;  3OBY A;  1VRT A;  3JXU A;  1J5O A;  5FRO A;  4GVE A;  4OGE A;  4CZI A;  1YHQ N;  1NMD A;  1BCO A;  3DYA A;  1LWC A;  4H5T A;  1RDC A;  5M1O A;  3O5B A;  2HST A;  4JRQ A;  3HK2 A;  2E2O A;  4JKE A;  3HOT A;  4JKG A;  3O9Q A;  3O80 A;  4DR4 K;  1D5A A;  2E6L A;  3CFO A;  3T3F A;  3DLH A;  2HB5 A;  4DF8 A;  3T1A A;  1QTM A;  3D45 A;  1VSJ A;  3BF1 A;  3CJ7 A;  3MXJ A;  1X9M A;  4CBW A;  3RTV A;  1FW6 A;  5SWM A;  4O0I A;  3QDK A;  3S3N A;  2G8H A;  4BRK A;  1SL2 A;  2D0O A;  3O9T A;  1EX4 A;  4BDY A;  4AIL C;  1BU6 O;  1W7A A;  1WAF A;  3S3M A;  4RW8 A;  3CFR A;  4ILH A;  3KHY A;  3L2R A;  3KJV A;  5LMN K;  1S1X A;  4BRA A;  1VQ5 N;  3LAM A;  1VSD A;  4OO1 J;  3AGR A;  1BUP A;  3P4I A;  3ATV A;  1MWM A;  2FSN A;  3IMX A;  4FWR A;  4ILJ A;  3VQQ A;  4A57 A;  2HBM A;  2WC9 A;  3IRX A;  2YHW A;  2AA4 A;  3J80 O;  3CXC M;  2ZE2 A;  3AVF A;  2DTU A;  4CEF A;  5EXW A;  4HVJ A;  1ZYQ A;  5KPR A;  4M42 A;  4FZY A;  3DXK B;  4JKB A;  2IC3 A;  3OJS A;  2Q3S A;  3O3H A;  4JKD A;  5KTQ A;  1M90 O;  5AQQ A;  3R3L A;  3NBP A;  4DLE A;  1OVQ A;  1WB9 A;  2UU9 K;  4H5W A;  4JK8 A;  1RT2 A;  4FOE A;  4NYN A;  1X1P A;  2X74 A;  4DR6 K;  5C2F A;  4B1W B;  3RMD A;  3UKR B;  2D5R A;  3D2F B;  1YTU A;  3A0I X;  4E89 A;  3I33 A;  1IG9 A;  3MK6 A;  4RG8 A;  1X9J A;  3C6H A;  4DFP A;  1I94 K;  3CET A;  2E20 A;  4A2B A;  1TK0 A;  1KQS M;  2YNH A;  3W0L A;  2D0A A;  2VG5 A;  3E1Y A;  4KHW A;  1BI4 A;  4CJ4 A;  1QSY A;  1TKX A;  3HBT A;  3CQ8 A;  3GOI A;  2G8I A;  1VSE A;  3HM8 A;  3SPY A;  3KZB A;  2XO7 A;  2UXD K;  3ASM A;  4CGF A;  4M7X A;  2YHX A;  1XUP O;  5SZT A;  3L2Q A;  3T1H K;  2X78 A;  3TSQ A;  2VQE K;  3EL2 A;  5KPT A;  1IH7 A;  5KQD A;  3MXI A;  4KI6 A;  3V1Q A;  4XH1 A;  3E9P A;  4FPA A;  3B6P A;  4CZF A;  1XC9 A;  1LOT B;  3M8R A;  1U04 A;  3WNH A;  1FK9 A;  2OTL N;  2AJQ A;  1O1W A;  3C6T A;  5KI6 A;  3VA3 A;  4CEE A;  2QXL A;  4FVM A;  4BWM A;  1YIJ N;  1WSE A;  2P9K A;  4N41 A;  3LDQ A;  3CCL N;  1T8E A;  1NJY A;  4LFB K;  4GV9 A;  2RF2 A;  4DR5 K;  3VGM A;  3KK1 A;  3O3F A;  1TYQ A;  3U9Z A;  1OKJ A;  4M3R A;  1D4X A;  1S5J A;  4DTP A;  4Z4G A;  1S9G A;  3LDP A;  3KKR A;  3TTD A;  5AQV A;  4DV0 K;  3B6O A;  4Z0U A;  3OS2 A;  3VGK A;  3NE6 A;  2PYL A;  4EZ6 A;  4ZTJ A;  1I3A A;  4KO0 A;  2P5O A;  4KPY A;  2JLE A;  3K9K A;  2ZJR L;  3MCA B;  5FPD A;  3ISN C;  4M3X A;  4OKK A;  3DI6 A;  1C1A A;  4DV4 K;  3C65 A;  2QWN A;  1B92 A;  3E9O A;  1KVA A;  2A6A A;  3OBW A;  3TAB A;  1N34 K;  4FPB A;  4GV6 A;  3LP3 A;  4IOC L;  5J2M A;  4CFB A;  5HP1 A;  1EKE A;  4NCG A;  2ZWH A;  1ZBF A;  5DM6 L;  4OGC A;  3CM5 A;  4B8A B;  4KTZ A;  2HNZ A;  5J2Q A;  2E2Q A;  2CGL A;  3VF6 A;  4JKA A;  2PFU A;  3PX6 A;  3OYJ A;  2XY7 A;  3O9U A;  2QWL A;  1R59 O;  3BZC A;  1DTQ A;  3CIP A;  4DLG A;  1Z05 A;  3RRG A;  1IKW A;  3KLF A;  3ZSY A;  4CHY A;  3UE5 A;  4ILG B;  1KRP A;  5FPM A;  2D0C A;  3AGK A;  3CCR N;  3IFR A;  3K5N A;  4E7H A;  3B8A X;  2QWO A;  2P9I A;  3MEC A;  4F3T A;  1CXQ A;  1OH8 A;  1HQU A;  2BDP A;  3EE8 A;  3D2E A;  3QBW A;  2D1K A;  1RT1 A;  5HRP A;  3VGL A;  5CY4 A;  4FLX A;  1VQL N;  3KKS A;  1C0M A;  4CJL A;  3EZ5 A;  1XHZ A;  4M3T A;  1VQN N;  2YHY A;  2YHA A;  4YHH K;  2YNF A;  1RIL A;  3N4Q A;  3ZT3 A;  4DSK A;  4C8N A;  3J7A P;  1RBV A;  5HBM A;  1IBK K;  4DQ8 A;  3QET A;  5GAD P;  1OH7 A;  1IKV A;  4ZTF A;  4CJV A;  1BCM A;  1GOA A;  4BE1 A;  4A62 A;  4RW9 A;  3MWP A;  1BL3 A;  1J6Z A;  3LM9 A;  4NB4 A;  2LSN A;  4J2E A;  1QQC A;  1DLO A;  1BIZ A;  3E66 A;  3P31 A;  4CK2 A;  4CIG A;  4CEQ A;  2HHQ A;  1HKG A;  4BE2 A;  3EZW A;  3ZSZ A;  3GBT A;  1NJW A;  1BWF O;  1RBR A;  4N47 A;  4NCB A;  5FPE A;  4B3R K;  1SKS A;  1QZ5 A;  5IT9 O;  3LDN A;  2QWR A;  1RDW X;  4B8C A;  3V9S A;  4EFH A;  1SKW A;  4CER A;  3AVI A;  4WCE L;  4AHS A;  4BGA A;  5LY3 A;  5AQY A;  4J2A A;  4CHQ A;  3M6G A;  2YKN A;  3MX5 A;  1XI1 A;  4GKK K;  4Y1C A;  4B9S A;  4FXD A;  3OW2 M;  2P9U B;  4CZH A;  2E1Y A;  3L2V A;  3G4S N;  1GLA G;  2HF4 A;  3FZH A;  1YJ9 N;  4H03 B;  1T7P A;  2A3Z A;  3OS0 A;  4FO0 A;  1VRU A;  1T03 A;  2QEX N;  4B08 A;  4O5B A;  4BWJ A;  4CHN A;  5CYM A;  3NH2 A;  5AQH A;  4DTM A;  5GIN A;  4CEO A;  2VYP A;  1DKG D;  5M1F A;  4DR2 K;  1HNZ K;  4BQL A;  2P9I B;  1JCF A;  3VF4 A;  2O8B B;  1RDU A;  4KH5 A;  1WOQ A;  4DB3 A;  4LD0 A;  3HRG A;  4H0T B;  3OY9 A;  1Q9Y A;  4NO7 A;  1J54 A;  3THX A;  4A5A A;  3CJC A;  2HMP A;  3PIO L;  2F4V K;  1F21 A;  3THV A;  4K41 A;  3FR0 A;  4CJT A;  1ZBS A;  3OA9 A;  2PY5 A;  2Z1G A;  3DJC A;  5M1P A;  3CCE N;  4CD3 A;  5AZI B;  1K8K A;  4JHD B;  2A5X A;  3VQ9 A;  3NCI A;  2BAN A;  2RE2 A;  4DQQ A;  5BRH A;  2FSK A;  1SZ2 A;  4FJJ A;  1T6C A;  3EEQ A;  1VSK A;  3NGZ A;  4BGB A;  3SUO A;  3VER A;  3DAW A;  4FWN A;  3D0P A;  4W5T A;  4DU1 A;  4C1N I;  1TL3 A;  1IG8 A;  2E8A A;  3FFI A;  3CJ1 A;  3QNN A;  4RW6 A;  1NM1 A;  4IBN A;  3TAQ A;  1VQ4 N;  3VQB A;  4M63 C;  2HHW A;  3VQE A;  4FLT A;  4FLV A;  3A5L C;  4WQ4 A;  4LC9 B;  1Y64 A;  3DXM B;  4WFA L;  1VSL A;  1IO2 A;  1HJO A;  5AQN A;  1V4S A;  4FWP A;  4GNI A;  3QEP A;  3O3G A;  4PQU A;  4FJ7 A;  1KFD A;  3KLG A;  3J7Z O;  3MN6 A;  3AVG A;  3OYC A;  3HT3 A;  3THX B;  3VQ4 A;  1NGC A;  2O8C B;  1VAZ A;  1GLB G;  4LSL A;  3KLE A;  1ZBI A;  3P83 D;  4DSE A;  4DTO A;  3U4L A;  3SUP A;  1X3N A;  3ZX2 A;  1NKE A;  1FKP A;  2IVP A;  4ELV A;  4J8F A;  2E2N A;  2V7Z A;  1RT6 A;  1TL1 A;  3SBG A;  4LFC K;  3O08 A;  3O4N A;  4E7J A;  4Q0B A;  3FE1 A;  1JLF A;  4AM6 A;  4FW2 A;  3QBX A;  1K8A O;  1IBL K;  1VSI A;  4B9L A;  4EZ9 A;  2VGN A;  4E3S A;  4Y0W A;  4B3T K;  4CGH A;  3QIN A;  1P8Z A;  3E9L A;  4C23 A;  1C0F A;  4BC4 A;  3UKR A;  2W42 A;  4I7F A;  3VEY A;  1U45 A;  4GV3 A;  1NOZ A;  1V4T A;  4OPJ A;  2V51 B;  1BHL A;  4H4M A;  2RN2 A;  3MMV A;  4DR7 K;  2DFH A;  3G71 N;  1IBM K;  2IIR A;  2OAN A;  3NF9 A;  3LWL A;  1JLC A;  1E3M A;  4FW1 A;  4K0K K;  4LSN A;  1YI2 N;  4EHT A;  5HRO A;  4BRO A;  4YOU A;  3THW A;  4KHN A;  3ZSO A;  5T7B A;  4A5B A;  1NJI O;  3LDO A;  2DY4 A;  3V9U A;  4H5R A;  3HXM A;  4DCH A;  1Q18 A;  3VA0 A;  2X6S A;  4FJN A;  2GUI A;  4PA1 A;  3VOV A;  4AM7 A;  4ELT A;  2OYQ A;  1YXQ A;  4BRQ A;  1BG3 A;  1SQK A;  4GMJ B;  2BGG A;  2GEL A;  1T44 A;  2ZGZ A;  1D9F A;  3BF3 A;  4RW7 A;  4B1Z A;  2GX9 A;  1VQ8 N;  2FF3 B;  2Q31 A;  2NUB A;  4MDA A;  3MN9 A;  2QK9 A;  4DFK A;  1LW2 A;  1REV A;  2HHX A;  2YJF A;  1NGH A;  3TR8 A;  3WT0 A;  1HRH A;  1S3X A;  3HPG A;  4CJU A;  3M3Z A;  1EO1 A;  3DLL L;  3D2F A;  4A2A A;  3OYK A;  3ZLJ A;  3DRS A;  2ATQ A;  3CJB A;  4CGG A;  3O9R A;  4JKF A;  3AA2 A;  4B1Y B;  3A5O C;  1QHT A;  4BRI A;  4FZZ A;  2VG7 A;  2PZS A;  3SUN A;  5AQR A;  1VQ9 N;  3H3O B;  3KIO A;  2QKB A;  1TUY A;  3H1Q A;  4XH5 A;  4W5O A;  2UUC K;  3T19 A;  1OH6 A;  3RRH A;  2NRV A;  4JN4 A;  3LZI A;  1QZ6 A;  1BA0 A;  1D8Y A;  4Z4F A;  3CMA N;  4PWD A;  4EAH D;  4DQR A;  5J2P A;  3MEE A;  4QS8 A;  2FF6 A;  4OPH A;  4H0P A;  4X64 K;  3V81 A;  2VGM A;  5KQ8 A;  1UA0 A;  3BZK A;  4I6M B;  5FLX O;  3DM2 A;  4R79 A;  1N36 K;  3NH0 A;  1K73 O;  4BR9 A;  4GY2 B;  5EU7 A;  3CCU N;  1RNH A;  1L3S A;  4B9U A;  4IZ9 A;  2O8E A;  5LJW A;  4WQ4 C;  3SLC A;  1A5W A;  4F4K A;  2DFE A;  5CE3 A;  5AQS A;  3DXK A;  1KC8 O;  4CJ7 A;  2G8F A;  3HL8 A;  4MLE A;  4J2B A;  4LY7 A;  3HJF A;  4OVL A;  3JAM O;  2E6M A;  1ITG A;  1UAX A;  3K5O A;  2A40 A;  4BR2 A;  4QCL A;  4IG3 A;  3SYZ A;  1N6Q A;  2HHH K;  4JI7 K;  3QB0 A;  2H3G X;  3D2E B;  1RTH A;  1JLE A;  2IOC A;  3TAR A;  2ZGY A;  3AO4 A;  3CM6 A;  3CFP A;  1EET A;  3TAG A;  4N5S A;  3HZ6 A;  4JI0 K;  5EOY A;  1NLV A;  2BUP A;  4FK0 A;  5GAE P;  3G0Z A;  4L8R B;  4K8X A;  3TI0 A;  3I0S A;  3OYB A;  4LF9 K;  1HYZ A;  5H1S Q;  4NLB A;  1C1C A;  1NWK A;  2HBK A;  3CER A;  4IDH A;  5KGW A;  4IG0 A;  2G8V A;  3O6W A;  4J2D A;  3L0Q A;  4H0O A;  3T69 A;  4BRH A;  4PHT X;  3WQU A;  4HHT A;  4E7L A;  1XMQ K;  4KB0 A;  2A42 A;  3VET A;  2B5J A;  1YF5 L;  5GIO A;  4LH5 A;  1VQ6 N;  2ZF5 O;  4B3S K;  2KKZ A;  3V9W A;  1C0T A;  1NK9 A;  1NNE A;  1Q7Y O;  3RSE B;  1BIU A;  2BTF A;  3AO1 A;  4DTU A;  5JVG L;  2DPN A;  3MX2 A;  3IKM A;  4BRM A;  2QKK A;  2X6N A;  3DMJ A; 
#chains in the Genus database with same CATH homology
 3V1O A;  2BDP A;  2ETJ A;  2QXF A;  3OYE A;  3LWM A;  3NFA A;  1VSF A;  1QE1 A;  4FLW A;  1RT1 A;  5HRP A;  3WNE A;  3OYN A;  4B9M A;  5CY4 A;  1IKX A;  4FLX A;  3NAE A;  1ASW A;  3KKS A;  5JS1 A;  1NK7 A;  3SQ1 A;  1SL1 A;  1C0M A;  4FJM A;  4CJL A;  3EZ5 A;  1XHZ A;  4M3T A;  1DTT A;  4Z4C A;  5C25 A;  2YHA A;  4KTW A;  1NK4 A;  4KV8 A;  3V9X A;  3K57 A;  1TK5 A;  1N5Y A;  3TAE A;  2YNF A;  4FZX C;  4XIU A;  3LP0 A;  1RIL A;  1Q8I A;  2O4G A;  4MQ3 A;  5HRS A;  3ZT3 A;  3E01 A;  1LWE A;  1TKD A;  4DSK A;  2OPQ A;  4R5P A;  4C8N A;  4CEA A;  1RBV A;  5HBM A;  4ID1 A;  4DTS A;  3QET A;  2FBV A;  3HST B;  3ZSX A;  4CFA A;  1IKV A;  2EX3 A;  4ZTF A;  4CJV A;  4KHW A;  1BCM A;  1GOA A;  4CHO A;  4E1M A;  4BE1 A;  3QER A;  4AHT A;  3TAP A;  4H8K A;  3QIP A;  4RW9 A;  4E1N A;  5KRS A;  1HJR A;  1RDB A;  1TVR A;  1XHX A;  3AVB A;  1YVU A;  1BL3 A;  2YV0 X;  3OJU A;  3U6F A;  2LSN A;  4J2E A;  1QQC A;  3NDK A;  1DLO A;  1BIZ A;  3V1R A;  3KTQ A;  4BAC A;  4CK2 A;  4CIG A;  3O4Q A;  2E4L A;  4CEQ A;  1RT3 A;  4KRF A;  3VQA A;  1JLA A;  2HMI A;  1WSG A;  4BE2 A;  4DTJ A;  3ZSZ A;  1NJW A;  1FKO A;  1RBR A;  4CHZ A;  4JRP A;  4N47 A;  3U3Y A;  4NCB A;  5DK5 A;  3AVM A;  1SKS A;  2HW3 A;  1TAQ A;  1QS4 A;  2HVH A;  4CEB A;  3HVR A;  4GVM A;  2A1R A;  2XY8 A;  4FM2 A;  4M45 A;  1C0U A;  4FK4 A;  4CJ5 A;  1RT7 A;  3LAN A;  4CGD A;  3DOK A;  1YT3 A;  3SV3 A;  4B8C A;  3V9S A;  3HO1 A;  1SKW A;  4DQP A;  4CER A;  3M8S A;  3AVI A;  3AO5 A;  1ZBH A;  3EY1 A;  4AHS A;  4NCA A;  3PV8 A;  4FLZ A;  4J2A A;  4CHQ A;  4CJQ A;  3ZT1 A;  2YKN A;  5KRT A;  1XI1 A;  4Y1C A;  3ITH A;  1UOC A;  4B9S A;  4FXD A;  2HHT A;  4E19 A;  2RPI A;  3S3O A;  4K8Z A;  1NJX A;  4CJR A;  3PY8 A;  1GOB A;  3L2V A;  3VQD A;  2KW4 A;  2R7Y A;  1U4B A;  1R0A A;  1Y97 A;  3AVA A;  1KVC A;  4O4G A;  4CIF A;  1T7P A;  1NJZ A;  2VG6 A;  4CF2 A;  4KRE A;  4DG1 A;  3OS0 A;  4ELU A;  1VRU A;  4FJX A;  2OPR A;  3LP2 A;  3CYM A;  2HHS A;  1T03 A;  4B08 A;  4CEZ A;  4O5B A;  4BWJ A;  4CIE A;  5CYM A;  4CHN A;  3DLR A;  3NH2 A;  1WLJ A;  3KK2 A;  1NOY A;  2KFZ A;  1IKY A;  4DTM A;  4CEO A;  1HQU A;  3NGI A;  3L3V A;  1HNV A;  4C8K A;  1RTD A;  1VSM A;  3KK3 A;  2IS3 A;  2VWK A;  1CZB A;  1SKR A;  3OVN A;  1QSS A;  4IKF A;  4N76 A;  3KLH A;  1NKB A;  3KD5 E;  1KTQ A;  1RBT A;  4CED A;  1G15 A;  2ZD1 A;  4YNQ A;  3JYT A;  4M3Y A;  3RMB A;  4LD0 A;  3WNF A;  3OY9 A;  2KFN A;  1Q9Y A;  4BE0 A;  2FBY A;  3DOL A;  1J54 A;  3HYF A;  4CCH A;  3TAM A;  4YFU A;  3OYF A;  3SJJ A;  1F21 A;  1WSF A;  3OYD A;  3THV A;  2ZQB A;  4CJT A;  2PY5 A;  1JKH A;  2Z1G A;  2F96 A;  1BQN A;  4FCY A;  3P5J A;  3AVL A;  4DSL A;  3SQ4 A;  1S1U A;  1HQE A;  1XWL A;  2YNI A;  3QEX A;  3DRP A;  4IDK A;  4CJW A;  3PO4 A;  2HVI A;  5KGX A;  1RTJ A;  1RTI A;  3VQ9 A;  3NCI A;  4FK2 A;  4JLH A;  3AVC A;  5CZ1 A;  2B4J A;  3QEW A;  2BAN A;  4HCB A;  3C95 A;  4MFB A;  5HRR A;  4DQQ A;  3IS9 A;  4O0J A;  3SCX A;  2ITG A;  4FJJ A;  1VSK A;  3NGZ A;  4CJS A;  4BDP A;  3SUO A;  3RR7 A;  1RBS A;  3D0P A;  4DWI A;  4FJH A;  3C6U A;  4W5T A;  3LZJ A;  2KZM A;  4CHP A;  4Z4E A;  4DU1 A;  3F9K A;  3KD1 E;  4OLB A;  4UQG A;  1TL3 A;  3VQP A;  2P5G A;  3FFI A;  1JLG A;  1C1B A;  2RKI A;  2YKM A;  2YNG A;  3KLI A;  3OYL A;  4RW6 A;  4IBN A;  3LAK A;  3QNN A;  3TAQ A;  4F8R A;  1W9H A;  2XHB A;  3VQB A;  3HPO A;  2HHW A;  3L3U A;  4F2R A;  3C94 A;  4CJF A;  2Y1J A;  4G1Q A;  3PO5 A;  1S6Q A;  1J53 A;  4ZHR A;  4FJ5 A;  3OYG A;  3VQE A;  4FLT A;  4DTR A;  4C8O A;  4FLV A;  2WOM A;  4FJ9 A;  4B9T A;  4EP4 A;  3TWH A;  1VSL A;  3NF7 A;  1X9S A;  1IO2 A;  4C8L A;  3AV9 A;  4DMN A;  3QEP A;  3O3G A;  3AVJ A;  4PQU A;  4FJ7 A;  1ZBL A;  4DSJ A;  1KFD A;  1BGX T;  3KLG A;  5CZ2 A;  3SQ2 A;  4B9V A;  1L3V A;  4B9N A;  3OYC A;  3AVG A;  1LAV A;  3HT3 A;  4F2S A;  3PUF A;  3VQ4 A;  3S9H A;  1S6P A;  3G10 A;  2OZS A;  4LSL A;  1K6Y A;  2HND A;  4Z4H A;  3KLE A;  1HYS A;  4WE1 A;  1ZBU A;  4LH4 A;  1ASU A;  1UA1 A;  4DSI A;  3P83 D;  1ZBI A;  4PY5 A;  3HP6 A;  4QAG A;  4DSE A;  3EYZ A;  4DTO A;  4AHV A;  1C6V A;  1LWF A;  1RDA A;  4Y1D A;  4OKE A;  3SUP A;  4KHQ A;  1VRT A;  1NKE A;  1FKP A;  1J5O A;  5FRO A;  4HTU A;  2GV9 A;  4OGE A;  1BCO A;  3DYA A;  3NH1 A;  3V9Z A;  1LWC A;  4ELV A;  3MXM A;  2I5J A;  3I0R A;  1RDC A;  4CFC A;  4CGI A;  1RT6 A;  1TL1 A;  1RT5 A;  4AH9 A;  4JRQ A;  3M8Q A;  3HK2 A;  3I8D A;  3O4N A;  4E7J A;  5I42 A;  4Q0B A;  1D5A A;  3CFO A;  2E6L A;  1JXB A;  3T3F A;  3DLH A;  1WN7 A;  1JLF A;  1HPZ A;  2HB5 A;  2IGI A;  5E41 A;  3SV4 A;  4DF8 A;  2KTQ A;  4FW2 A;  3T1A A;  3D45 A;  3QEV A;  2FBX A;  1QTM A;  1VSJ A;  1VSI A;  3K59 A;  4B9L A;  4EZ9 A;  3MXJ A;  3NHG A;  1X9M A;  4E3S A;  3ULD A;  4CGH A;  3QIN A;  4ICL A;  3RTV A;  5SWM A;  4O0I A;  3LDS A;  3ZT2 A;  3S3N A;  2G8H A;  2O4I A;  1SL2 A;  4ID5 A;  2YHB A;  3VQ6 A;  4BDY A;  1EX4 A;  2W42 A;  4AIL C;  4FM1 A;  1WAF A;  1SUQ A;  4I7F A;  4RW8 A;  3CFR A;  1NOZ A;  3S3M A;  1U45 A;  4DQI A;  4OPJ A;  3DRR A;  3L2R A;  3VQ7 A;  1BHL A;  4CK3 A;  3KJV A;  4H4M A;  3ZT4 A;  4KKO A;  2RN2 A;  2DFH A;  3L8B A;  1U47 A;  1S1X A;  4JS4 A;  1D9D A;  4CES A;  3AVH A;  4DFM A;  3LAM A;  1VSD A;  3TAF A;  4CJE A;  4CFD A;  2JGU A;  4CJK A;  2PYJ A;  3QLH A;  3NF9 A;  4FLY A;  3LWL A;  1JLC A;  1TK8 A;  4KI4 A;  4I9Q A;  3LPU A;  4FW1 A;  3K5M A;  4W5Q A;  1RBU A;  3VQQ A;  3BGR A;  1JLQ A;  4LSN A;  2XRI A;  5HRO A;  3IRX A;  1TKT A;  1L3T A;  4AHR A;  5I3U A;  1Z25 A;  2ZE2 A;  4KHN A;  2F8S A;  3AVF A;  4KFB A;  2DTU A;  4H4O A;  4CEF A;  4FJL A;  3ZSO A;  1NK5 A;  4HVJ A;  1RT4 A;  1ZYQ A;  5D3G A;  3DLG A;  4M42 A;  4FZY A;  5T7B A;  5C24 A;  1TKZ A;  4DS4 A;  4DU3 A;  4HUF A;  2IDO A;  1CLQ A;  2DY4 A;  2IC3 A;  4TSX A;  3V9U A;  3OJS A;  4DF4 A;  3OYA A;  2Q3S A;  4FYD A;  3O3H A;  3HXM A;  5KTQ A;  1QSL A;  1KSP A;  3P1G A;  3PX0 A;  4O44 A;  3MED A;  3VA0 A;  2WON A;  2X6S A;  1KVB A;  4FJN A;  1U48 A;  2GUI A;  3H08 A;  4PA1 A;  4ELT A;  3RMC A;  2OYQ A;  4B3O A;  3NBP A;  4DLE A;  4E7K A;  1KLN A;  2OPS A;  1S9E A;  1WSJ A;  3VQ8 A;  4CJP A;  3QIO A;  4AHU A;  4OPK A;  4KB1 A;  4PUO A;  4GMJ B;  4M3Z A;  2BGG A;  1D9F A;  1RT2 A;  4NYN A;  4CK1 A;  1X1P A;  2KQ2 A;  4CF1 A;  3WNG A;  2OA8 A;  2X74 A;  3DLE A;  4RW7 A;  5CYQ A;  4CF9 A;  4C8M A;  4M3W A;  3NF6 A;  3HPH A;  2NUB A;  3ZSR A;  4DSF A;  2QK9 A;  4DFK A;  1LW2 A;  1REV A;  4OJR A;  3VQC A;  3RMD A;  1I39 A;  2D5R A;  3ZSV A;  4M3U A;  1YTU A;  5C42 A;  2G8U A;  2HHX A;  3TR8 A;  1EP4 A;  4E89 A;  1VSH A;  1A5V A;  1JXE A;  1IG9 A;  4W5N A;  1HRH A;  3HPG A;  4RG8 A;  4CJU A;  4DFP A;  3V6D A;  3VQ5 A;  3QNO A;  3SUQ A;  1TK0 A;  4CF8 A;  2YNH A;  2EHG A;  3ZT0 A;  3OYK A;  2D0A A;  3UIQ A;  1S1W A;  3L2U A;  2VG5 A;  3DRS A;  1W0H A;  2ATQ A;  3OYI A;  3K2P A;  4CGG A;  1KFS A;  1BI4 A;  3IG1 A;  3F73 A;  3SPZ A;  4CJ4 A;  1JL1 A;  3AA2 A;  1TKX A;  4HUE A;  1QSY A;  3K58 A;  5J2N A;  4KHY A;  3CQ8 A;  3CG7 A;  4FJI A;  2G8I A;  1VSE A;  3ALY A;  1QHT A;  4FZZ A;  2VG7 A;  2PZS A;  3SUN A;  4DTN A;  3SPY A;  3HP9 A;  3AO3 A;  1SV5 A;  3ASM A;  3LP1 A;  4CF0 A;  4CGF A;  2XO7 A;  4E7I A;  3PX4 A;  4Z4I A;  3KIO A;  5SZT A;  3V4I A;  2Z1J A;  1S1T A;  3NGY A;  3L2Q A;  2QKB A;  4W5O A;  1BI4 B;  4E0D A;  3T19 A;  3AVK A;  1U49 A;  1WNS A;  4M41 A;  3RRH A;  3LZI A;  1LV5 A;  4IFY A;  1WSH A;  3BDP A;  2X78 A;  1D8Y A;  1ASV A;  4NYF A;  4Z4F A;  1IH7 A;  4CGJ A;  4PWD A;  3MXI A;  4DQR A;  2FBT A;  3M8P A;  3MEE A;  3V1Q A;  5K14 A;  5J2P A;  4KI6 A;  4GW6 A;  1LAW A;  1UWB A;  1XC9 A;  2A1S A;  3B6P A;  4KTQ A;  3M8R A;  1KLM A;  1U04 A;  1VK0 A;  3U3G A;  3WNH A;  1FK9 A;  2P1J A;  3V81 A;  2OZM A;  3IAY A;  2AJQ A;  5DMR A;  1O1W A;  2B6A A;  4BDZ A;  3C6T A;  1UA0 A;  5KI6 A;  3VA3 A;  4CEE A;  4FVM A;  4BWM A;  3RMA A;  3DLB A;  5FRN A;  1CZ9 A;  1WSE A;  3MAQ A;  3HVT A;  4N41 A;  3AVN A;  3DM2 A;  1RDD A;  4CE9 A;  4CEC A;  2P51 A;  1T8E A;  1B9F A;  4RW4 A;  3NH0 A;  2BE2 A;  1X9W A;  1CXU A;  4I9L A;  5EU7 A;  1NJY A;  3LPT A;  1TV6 A;  1RNH A;  2Y1I A;  2RF2 A;  1L3S A;  4B9U A;  4HCC A;  1TGO A;  4KAZ A;  2FC0 A;  1WAJ A;  3SZ2 A;  4DFJ A;  3KK1 A;  2HNY A;  3O3F A;  3OS1 A;  3AA4 A;  1A5W A;  1HYV A;  4F4K A;  4OKJ A;  2DFE A;  4IFV A;  2G8K A;  4I2P A;  4M3R A;  4FLU A;  3HL8 A;  2G8F A;  4KHU A;  4J2B A;  1RCH A;  1S5J A;  4LY7 A;  4N56 A;  4DTP A;  1MU2 A;  4Z4G A;  1S9G A;  3KKR A;  1JLB A;  1NK0 A;  3OYM A;  3ZSQ A;  3HJF A;  1Z26 A;  1L5U A;  2VWJ A;  4DQS A;  4FJ8 A;  4OVL A;  3B6O A;  2HHV A;  1Q9X A;  2Z1I A;  4Z0U A;  3OS2 A;  2E6M A;  3NE6 A;  1ITG A;  1UAX A;  3K5O A;  1SL0 A;  2PYL A;  4EZ6 A;  4QCL A;  4ZTJ A;  1I3A A;  4KO0 A;  4IG3 A;  3SYZ A;  2OPP A;  3AA5 X;  1N6Q A;  2P5O A;  4KPY A;  2JLE A;  3QO9 A;  4KHS A;  1HNI A;  1HMV A;  1T05 A;  3RR8 A;  1RTH A;  2KZZ A;  1JLE A;  3ISN C;  3HM9 A;  4OKK A;  3JSM A;  3SQ0 A;  4M3X A;  3DI6 A;  3AA3 A;  1C1A A;  2IOC A;  4FM0 A;  4FJK A;  3TAR A;  1B92 A;  3AO4 A;  4HUG A;  1J9A A;  1KVA A;  3CM6 A;  3CFP A;  1NK6 A;  1WSI A;  1EET A;  3A2F A;  4N5S A;  3TAG A;  4OLA A;  1EXQ A;  2XY6 A;  4FK0 A;  3LAL A;  3TAB A;  1NKC A;  3G0Z A;  4L8R B;  2HHU A;  4K8X A;  3QES A;  3TI0 A;  3LP3 A;  5J2M A;  5HRN A;  4CFB A;  3SI6 A;  3I0S A;  5HP1 A;  2G8W A;  1EKE A;  4NCG A;  2DFF A;  4Q5V A;  4DTX A;  3OYB A;  1TAU A;  1HYZ A;  1ZBF A;  3NF8 A;  4I2Q A;  4AHC A;  4OGC A;  4DS5 A;  3CM5 A;  3ZSW A;  4EP5 A;  2F8T A;  1BQM A;  1BIS A;  1C1C A;  3DLK A;  4IG0 A;  4J2D A;  2G8V A;  5KGW A;  1LW0 A;  4B8A B;  1YTA A;  4KTZ A;  2HNZ A;  5FRM A;  5J2Q A;  1JL2 A;  3SNN A;  3L2W A;  2GBZ A;  4W5R A;  4HHT A;  4E7L A;  5HLF A;  4KB0 A;  4QOZ B;  3PX6 A;  2B5J A;  4F3O A;  3RWU A;  3OYJ A;  4CJ3 A;  2XY7 A;  5FDL A;  5J1E A;  4LH5 A;  2IAJ A;  3K5L A;  2HHQ A;  1DTQ A;  1S1V A;  5JS2 A;  2D0B A;  4DLG A;  1B9D A;  1A5X A;  1GOC A;  3TAN A;  2Z1H A;  3RRG A;  1IKW A;  3KLF A;  3ZSY A;  4CHY A;  4FJG A;  3V9W A;  2XY5 A;  3QEI A;  1KRP A;  1C0T A;  1NK9 A;  2D0C A;  4O55 A;  3K5N A;  3VN5 A;  3MEG A;  4JS5 A;  4E7H A;  1BIU A;  3ZCM A;  3AO1 A;  1FXX A;  3AO2 A;  4DTU A;  1KCF A;  3MEC A;  3OYH A;  1NK8 A;  1L3U A;  4F3T A;  4DU4 A;  1CXQ A;  2QKK A;  2X6N A;  3DMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...