5KGXA

Hiv1 catalytic core domain in complex with an inhibitor (2~{s})-2-[3-(3,4-dihydro-2~{h}-chromen-6-yl)-1-methyl-indol-2-yl]-2-[(2-methylpropan-2-yl)oxy]ethanoic acid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
153
structure length
134
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKTAWWAGIKQEESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Indole-based allosteric inhibitors of HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
total genus 45
structure length 134
sequence length 153
ec nomenclature
pdb deposition date 2016-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5kgxA00
3HPHA 4Z4HA 4DFJA 3SUNA 3PY8A 4Z4FA 1XI1A 5JS1A 1RT2A 3HL8A 4B08A 1L5UA 1JLBA 1ASVA 3DMJA 1CLQA 4B9TA 2KZMA 3V9XA 1J9AA 2F96A 1SUQA 4AHVA 3RMDA 1HQEA 4FJ5A 4KRFA 3PX6A 3SV4A 1ITGA 3T3FA 1K6YA 3C6TA 3OYAA 4B9SA 3C94A 1R0AA 3KD1E 5J1EA 5SWMA 3PX4A 3SJJA 3KK2A 3S9HA 4CJWA 1W9HA 5HRRA 4H8KA 4CEOA 4CIFA 3WNEA 1Z26A 1TKTA 4FJHA 2XY5A 1BL3A 1QE1A 3SCXA 1WAJA 3THVA 2PYJA 4FLXA 2YHAA 3NCIA 3VQ6A 1BIZA 4BACA 4DS4A 1IG9A 1RBTA 1RDAA 4AHUA 5HP1A 2HW3A 4W5RA 2RKIA 4F4KA 1LWEA 2ITGA 3CM5A 4C8KA 4KHUA 3QEVA 3B6PA 3L3UA 4O0IA 4N47A 3VQ8A 4N5SA 1RT4A 3S3NA 2FBYA 4PUOA 4CF2A 3OYGA 1XHZA 3P1GA 4CJPA 1UOCA 1KVCA 4BE0A 4FJ7A 1T7PA 4I7FA 3HK2A 5C25A 3RWUA 4HVJA 1ZYQA 1VSMA 4CJKA 4N56A 4KTQA 3OYKA 4J2DA 3SQ4A 3ISNC 4F2RA 5JS2A 3VQ5A 4KB0A 1TK5A 3MEGA 2HHVA 4KV8A 1VSKA 2GBZA 3VQ7A 2P1JA 3AO5A 3K58A 1Z25A 3NF8A 4CHQA 1D9DA 3L3VA 3ZCMA 1NKCA 4IG0A 4E7IA 3LP3A 1TKDA 2HHQA 4FZYA 2ZE2A 3KJVA 4E3SA 1SL1A 1FXXA 1RDCA 4DSEA 4MFBA 4CJUA 4CJQA 4EP5A 1QQCA 4R5PA 1RTJA 1U48A 3T19A 3M8RA 4EZ9A 1KCFA 1HJRA 3VQBA 4FLWA 1HPZA 2ATQA 4F8RA 2YV0X 4HTUA 5FRNA 3AO2A 4DQIA 1SKSA 1RT6A 1HYSA 1ZBUA 2IOCA 4CJVA 3TAQA 1D9FA 2HHTA 4ICLA 3CG7A 3DI6A 3WNHA 4Z4EA 5KGWA 2E6LA 3AA5X 3LP0A 4E7KA 3NF6A 4B8CA 1NJZA 4B9MA 5HROA 4CHNA 3QERA 4FJGA 3DLRA 4DTNA 3U6FA 1S1UA 1HRHA 4FJLA 2O4IA 1VRUA 4BE2A 1VSIA 3K2PA 1EP4A 1F21A 3ZSYA 1U47A 2DY4A 3LZIA 4ELVA 1A5XA 4DTPA 3MECA 2E4LA 4CGIA 4H4MA 2FBVA 4E7JA 4AHSA 1ASWA 1CXUA 4CERA 1TL1A 3RRHA 4CIGA 2BDPA 2HHXA 1WNSA 1JL2A 3NGZA 2XO7A 3QEXA 4KHYA 3AVMA 3OYLA 4B3OA 1CXQA 3C6UA 1MU2A 4DLGA 4LH5A 4ZHRA 5J2PA 3HO1A 2F8SA 1VSJA 2KFNA 3MXJA 2YNHA 1RTHA 1S1VA 5I42A 1IKYA 1WSIA 1HNVA 1RILA 4Z0UA 2YNFA 3OY9A 1VK0A 2DFHA 3ZT2A 3HP6A 3L2RA 3U3YA 1D8YA 4CGDA 4M3XA 3AVHA 1BIUA 1CZ9A 1B92A 3VQEA 1BQNA 1D5AA 1EETA 4AH9A 3G10A 4DSLA 3RMAA 1RDBA 4E1NA 2Z1HA 3KLEA 2IAJA 4Z4GA 3L2VA 4DTMA 3PX0A 4OKEA 3NGYA 4FLUA 3OYBA 4FJ9A 1NK5A 3PV8A 5HRNA 3ZT1A 4BWJA 1HMVA 4EZ6A 1ASUA 3DYAA 1IKWA 4DQRA 1JLQA 3QINA 5FDLA 3K5OA 3NAEA 4DFPA 4C8MA 4C8LA 3MXIA 1DTQA 2DFEA 4OPJA 1U4BA 2Z1JA 3V4IA 3QIPA 4FJNA 4M3TA 2ZQBA 2WOMA 4KFBA 3BGRA 1KLMA 2E6MA 4TSXA 4OPKA 3BDPA 3ZSWA 3TAFA 3SQ0A 3CFPA 3RR8A 4NCBA 4BDPA 4CHOA 3LAKA 3OJSA 2HHUA 2X6SA 5SZTA 4CJFA 1IH7A 3DLBA 2O4GA 3AVGA 4J2AA 1NKEA 1TKZA 1X9SA 5KRTA 3QETA 1S6QA 3ZSZA 2XY8A 3B6OA 4G1QA 4HHTA 2P5OA 1S1WA 4K8ZA 4NCGA 5KTQA 4W5NA 4CEAA 5CYMA 4OGCA 5J2NA 2QK9A 2X78A 1T05A 1BCOA 2HHSA 4CESA 4F3TA 3CFRA 3A2FA 4E89A 1YTUA 3HYFA 4HUFA 3QEWA 3KLHA 3TAGA 1JLCA 3NBPA 4IFVA 1GOAA 3NH0A 2G8WA 2HMIA 4OLAA 1WN7A 1SKWA 2OYQA 4IDKA 3KLGA 4CHYA 2G8FA 4UQGA 3LAMA 1TK0A 1Y97A 4FM1A 3V1OA 1WSJA 4ELTA 1KFSA 3NF9A 4M3UA 1JLGA 4KREA 3QO9A 2OPSA 4FCYA 4C8OA 3NGIA 3QEPA 2NUBA 3SPZA 4EP4A 4JS4A 1FKPA 3AVFA 2XY6A 2Y1IA 2D5RA 4FW2A 3LP1A 3NFAA 3ZSXA 4CFBA 2PZSA 1TKXA 3AVIA 4ID5A 4KTWA 2OPPA 1RCHA 3AV9A 1RDDA 2Q3SA 3NDKA 4MQ3A 1LAVA 3KK1A 4CHPA 3I0RA 2D0BA 4Q5VA 2I5JA 1TL3A 3O3GA 4KHSA 4CGFA 4KHQA 3VQ4A 3HM9A 2G8IA 4Y1DA 1RBRA 3SZ2A 4B9LA 4DSJA 3HJFA 1TAUA 2Z1GA 1LAWA 3ULDA 2Y1JA 3AVNA 4N41A 4AHRA 2HNZA 4RG8A 4JRPA 5J2QA 4M42A 4JS5A 4FVMA 4LSNA 3LWLA 3K5NA 3MAQA 4ZTFA 3TABA 1C0MA 1JL1A 4DTOA 2D0CA 5KI6A 2DFFA 3SUOA 1BQMA 2XHBA 1TGOA 3VQPA 3MEDA 4LH4A 3NH2A 4FM2A 4KKOA 3VA0A 1JXBA 3ZT3A 1KLNA 1KRPA 1HYZA 1NOZA 2P5GA 3V81A 2RPIA 4B9UA 4ID1A 3ZT0A 4CGHA 4RW7A 1IKXA 5C42A 1C6VA 3NF7A 4DTXA 4RW8A 4CFCA 1YVUA 2G8UA 5DK5A 3F73A 4M3YA 3V9WA 4O44A 4QAGA 1RBVA 5FROA 4DQSA 4QCLA 1NJWA 3CQ8A 2KQ2A 1NK6A 3KLIA 4DU3A 1NK7A 2AJQA 3SQ1A 4J2BA 1FKOA 3QESA 3K59A 3K5LA 4IKFA 1QHTA 4BWMA 1S1TA 4I2QA 1A5VA 3TAEA 3V9ZA 3L2QA 4FLYA 3DRPA 1KVAA 1BI4A 3TAPA 2YKNA 2HNDA 2P51A 4CJSA 5D3GA 3V9SA 1S9GA 1KTQA 3HSTB 4DS5A 4F3OA 3PUFA 1BCMA 3OVNA 3AVAA 3KLFA 3KTQA 3DLKA 4CHZA 1B9FA 2IS3A 3SV3A 4B9NA 5CY4A 4FJIA 1XHXA 4KHWA 3L2UA 1KFDA 3AVBA 4CE9A 4CEQA 3TWHA 3ASMA 4YNQA 3NH1A 1RNHA 4NYFA 1T8EA 1DTTA 2QKKA 5CYQA 3OS2A 2HB5A 3ZSOA 3EY1A 1LW2A 4CFAA 3ZSRA 4NCAA 3D0PA 1S6PA 1WAFA 4GW6A 4CEFA 4E1MA 2OZMA 3OJUA 4LD0A 3DRRA 4CF1A 4JRQA 5HLFA 3JYTA 1LWFA 4E19A 4YFUA 1RT3A 3AVCA 1KVBA 3MEEA 3VQQA 3HVRA 1TK8A 4KPYA 4CECA 4M3ZA 4PY5A 3P5JA 1Q9YA 1JLAA 4CJEA 3MXMA 2JGUA 4FW1A 1REVA 4GMJB 5DMRA 4CGJA 3OYJA 3EYZA 2OA8A 5CZ2A 3DLHA 1EXQA 3TAMA 4CJLA 5C24A 4Q0BA 3CM6A 3AVLA 5J2MA 4OKJA 3DOKA 3LALA 2D0AA 1TV6A 5CZ1A 4WE1A 4CEEA 3KIOA 4Z4CA 5KRSA 1S1XA 4CJ4A 2G8VA 1BI4B 1VRTA 3ZT4A 3EZ5A 4FJ8A 1SV5A 4LY7A 1X9WA 4CF8A 2XY7A 4DQQA 1BISA 2BE2A 3UIQA 3AA3A 3VQDA 2OPQA 3L2WA 1JLEA 2VG7A 2VG5A 2RN2A 3O3HA 1GOCA 4E0DA 1RBSA 3AVKA 3QNOA 2BANA 4RW4A 1WSEA 4IFYA 3S3MA 4W5TA 4DWIA 1ZBIA 4OVLA 1I3AA 3IAYA 1JKHA 4M3RA 4JLHA 1SL0A 3AO3A 3QIOA 4O55A 4RW6A 4DFKA 4FZZA 3OYDA 2QKBA 3V9UA 2OZSA 3HT3A 4F2SA 3WNFA 1LW0A 1Q8IA 3G0ZA 1T03A 4DMNA 1EX4A 3LDSA 4CJ5A 1C0TA 4FK4A 1JLFA 3PO5A 2HHWA 4FJKA 1C1CA 3D45A 3E01A 1VSDA 3AA4A 2B6AA 4NYNA 1JXEA 4Y1CA 1X9MA 1U49A 4FLVA 4DG1A 4K8XA 4KHNA 3C95A 3I0SA 3AA2A 1RT5A 2XRIA 4CEDA 3TARA 1UAXA 4W5QA 1QSYA 3LZJA 3KK3A 1HNIA 1RTIA 4CF9A 4DTRA 3AO1A 4LSLA 5E41A 1VSHA 4AHTA 3OS0A 3RTVA 2FC0A 2PY5A 4H4OA 3M8QA 1J53A 4CK1A 1NK4A 3OYHA 1LWCA 4M41A 1IO2A 3RMCA 4DLEA 3RR7A 4QOZB 1TVRA 3DLEA 3KKRA 1NK0A 1NOYA 4KO0A 1X1PA 3AVJA 2OPRA 3H08A 4O5BA 4CK3A 1C0UA 4I2PA 3ZSVA 4DTSA 1UA0A 2R7YA 2WONA 1CZBA 3ITHA 3LPUA 3OYNA 1W0HA 2YNGA 4J2EA 3O4NA 3HP9A 3VN5A 1C1BA 4CFDA 4CF0A 1XC9A 4CJTA 4FJXA 3L8BA 3V1QA 4DU4A 4FLTA 1L3UA 4DU1A 1L3TA 2IDOA 3QNNA 2HVIA 4CIEA 1HQUA 4BDZA 4DFMA 1B9DA 3VQAA 1RBUA 4DQPA 4HCBA 2BGGA 1VSFA 4O4GA 1WLJA 4CK2A 1QS4A 3RMBA 1G15A 2YKMA 2PYLA 2FBTA 1SL2A 1UWBA 3IS9A 1FK9A 2X74A 2ZD1A 2G8HA 2JLEA 4BDYA 2KTQA 2QXFA 2G8KA 4DSKA 1QSSA 5K14A 4FK2A 4O0JA 4PA1A 3RRGA 1L3VA 3NHGA 4AHCA 3CYMA 3O4QA 4IBNA 2W42A 4DSFA 1UA1A 2F8TA 1GOBA 2B5JA 1J54A 2VWKA 5I3UA 3OYEA 4E7HA 3ZSQA 5T7BA 2HNYA 3OYMA 1BGXT 3SUPA 2RF2A 2Z1IA 4FK0A 2YNIA 4L8RB 1IKVA 3HPOA 4W5OA 1NK9A 3F9KA 2VG6A 1J5OA 4KI6A 4FZXC 3KKSA 4ELUA 2HVHA 1C1AA 2LSNA 3FFIA 4CEZA 3K57A 1NK8A 4CGGA 1DLOA 1NJXA 3LPTA 3V6DA 3IG1A 1U04A 4CCHA 3P83D 3QEIA 1N6QA 5EU7A 1ZBHA 3OS1A 4B9VA 3LP2A 4DSIA 2IGIA 2GV9A 4KI4A 5HRPA 4FYDA 3LANA 1ZBLA 1QSLA 5HBMA 1I39A 3U3GA 3OYIA 2GUIA 3AO4A 4DF4A 1TAQA 3DRSA 4DTJA 3OYFA 4ZTJA 3HXMA 2FBXA 1NJYA 1WSFA 2EHGA 4CJ3A 1LV5A 3M8SA 3T1AA 3JSMA 1RTDA 4Z4IA 4KTZA 1RT7A 4OJRA 2DTUA 1YTAA 1QTMA 1BHLA 3HVTA 3SQ2A 2YHBA 3LWMA 4KB1A 4B8AB 4FJMA 3SUQA 3KD5E 1EKEA 3DM2A 3DOLA 3M8PA 3VQCA 3SPYA 1L3SA 3DLGA 1YT3A 2B4JA 1WSHA 4PQUA 1VSLA 3TR8A 4HUGA 5HRSA 3S3OA 1VSEA 3OYCA 4M3WA 4PWDA 3TANA 1RT1A 1Q9XA 3VQ9A 4OGEA 3SYZA 1O1WA 3V1RA 4M45A 3NE6A 2VWJA 1U45A 1N5YA 2KZZA 4AILC 4FM0A 3K5MA 1S9EA 4CJRA 1HYVA 5KGXA 3VA3A 2IC3A 4I9LA 2KFZA 4E7LA 1S5JA 3O3FA 2X6NA 4GVMA 4BE1A 3I8DA 4XIUA 4DTUA 1A5WA 3PO4A 1NKBA 2A1RA 4FLZA 1SKRA 4DF8A 4HCCA 4I9QA 3CFOA 4OKKA 2EX3A 1XWLA 4IG3A 4KAZA 3HPGA 3SI6A 4OLBA 1WSGA 3SNNA 4HUEA 4N76A 4FXDA 4FJJA 4RW9A 3ALYA 2A1SA 4CEBA 3QLHA 3WNGA 5FRMA 3TI0A 3IRXA 4C8NA 2KW4A 1ZBFA 1KSPA 2ETJA
chains in the Genus database with same CATH superfamily
5AQSA 4Z4HA 4O8UA 4DFJA 4Z4FA 1XI1A 5JS1A 1JLBA 1WUAA 2F96A 1SUQA 1OH8A 5DM7L 2HF4A 4FJ5A 2Q0UA 4A2AA 3T3FA 4B9SA 4BR7A 5F2RA 5J1EA 3SJJA 1YVNA 3S9HA 4CJWA 1W9HA 4H8KA 3FZHA 3WNEA 4JI6K 3L4QA 1VQ4N 1IG9A 3BZKA 2Q0RA 4AHUA 3UB5A 2E2OA 1BDGA 2IVPA 3ZEUB 1E4GT 1OH6A 3OYGA 1XHZA 5BPMA 4M7XA 4HVJA 1ZYQA 1VSMA 4CJKA 1FW6A 5CR4A 5JS2A 3VQ5A 3VQ7A 1N36K 1Z25A 3EE9A 4E7IA 2ZE2A 3KJVA 4E3SA 1SL1A 1RDCA 3A5NC 1SAZA 4EP5A 1QQCA 2I7NA 2Q31A 1U48A 3M8RA 3H1VX 4FLWA 2ATQA 4F8RA 4DQIA 1JCGA 4FOIA 1SKSA 1NGAA 1YIJN 2YI1A 2E6LA 5HROA 3U6FA 1S1UA 3GE1A 3DAWA 1VSIA 1OVYA 3ZSYA 5AQXA 3LZIA 1WBDA 4ELVA 4CGIA 4H4MA 4B1ZA 4E7JA 4AHSA 1ASWA 1CXUA 1TL1A 1WNSA 4JKGB 3CI5A 3DXKB 5F0XA 1MU2A 5J2PA 4ZHRA 2WFBA 1SQKA 1RTHA 1S1VA 5A2QO 3O9UA 2DFHA 4M3XA 3E9LA 1BIUA 3AVHA 1EETA 3HOSA 3VTHA 2NRTA 3L2VA 4DTMA 1NK5A 4BWJA 1HMVA 2QWRA 2O8FA 3GDQA 4DFPA 4C8LA 4IO9L 3ATVA 1P90A 4WF9L 1U4BA 2NRVA 3HOTA 3QIPA 3CCSN 4FJNA 3BGRA 4TSXA 4OPKA 2ZWHA 3TAFA 1D4XA 3CFPA 1S22A 2O4GA 3MDQA 1X9SA 3ZSZA 2XY8A 3B6OA 2P5OA 4OPAA 4OGCA 5J2NA 4E1JA 2OANA 4CZLA 1BCOA 4CESA 1T6DA 4I6MB 3HYFA 4HUFA 3CPWM 4OLAA 3NBPA 4IFVA 1BU6O 2HMIA 2E1ZA 4IDKA 3KLGA 4FWKA 4CHYA 4FM1A 3V1OA 1WSJA 3VPZA 4GKJK 1JLGA 4KREA 2P9NB 3G6EN 2OPSA 3NGIA 1V4SA 3SPZA 1K8AO 2QWMA 3THYB 4FW2A 1EWQA 3DXMB 4CFBA 1LOTB 3AVIA 5E84A 4KTWA 4BC4A 2OPPA 1RCHA 2QWNA 3O5BA 1RDDA 3KK1A 3CQYA 3VGLA 5GADP 4KHSA 4CGFA 3VQ4A 4FPAA 3MN9A 5EXWA 4PHTX 3HJFA 2F9TA 2Y1JA 2QW9A 4JRPA 3DJCA 4B1XB 3LDLA 2W41A 4FOEA 4JS5A 4FVMA 4ZTFA 4ILHA 2D0CA 4DTOA 4CI6A 2DFFA 1Q18A 3AAQA 4LH4A 3NH2A 1KLNA 3ZT0A 4RW7A 3OBWA 1C6VA 4DTXA 4RW8A 2V51B 2G8UA 4M3YA 3BY5A 1NJIO 4QAGA 2OCEA 4DQSA 1NJWA 3CQ8A 1NK6A 3KLIA 3O9TA 4EHUA 3K59A 3K5LA 1QHTA 3LDQA 4BWMA 4I2QA 1HX1A 3CCRN 3L2QA 3ULEB 1KVAA 5FPMA 4A61A 5I9EB 5JLHA 5KPTA 1K9MO 3MWTA 4CJSA 5D3GA 3V9SA 1KTQA 3HSTB 3OVNA 3AVAA 5AQJA 3SV3A 1B9FA 2YCHA 5CY4A 5M1FA 4CE9A 3TWHA 3NH1A 2E2PA 4WFNL 2RE2A 2HB5A 3ZSOA 2P9UA 3LDNA 1LW2A 3F2KA 1N33K 4JRQA 3JYTA 1ATSA 4YFUA 1RT3A 1TK8A 2OTLN 3FFKB 4DV4K 1REVA 5TKYA 3EYZA 3A5LC 4BC3A 4CJLA 4GV6A 1T3VA 4OKJA 2YJFA 5CZ1A 2ZGYA 4WE1A 3KIOA 4CEEA 4Z4CA 4JNEA 1BI4B 1VRTA 3ZT4A 4FJ8A 3CCQN 2I7PA 3D2FB 4DQQA 3L2WA 3O3HA 4CW7B 3O08A 1RBSA 3AVKA 5JLFA 2BANA 4DWIA 3CJ9A 1I3AA 3WXJA 4JLHA 3QIOA 4DFKA 4YORA 1IBKK 3V9UA 1VQKN 2OZSA 1NM1A 4CJ5A 2IVNA 4B9QA 1ILYA 2HHWA 5AQLA 1VSDA 3MCPA 3AA4A 4ILGB 1X9MA 5M1QA 5BR8K 2CGLA 3EN9A 4A2BA 3CC7N 3AA2A 2XRIA 4W5QA 3LZJA 4H5RA 1W7AA 3CCJN 1CZAN 3AO1A 3FZLA 3CCVN 1HLUA 4AHTA 3OS0A 3M8QA 4FWMA 4JKHA 4CK1A 1NK4A 1IO2A 3L4IA 4QOZB 1TVRA 4LFCK 1KAYA 4IJNA 3ZYYX 3H08A 4O5BA 3MN6A 1QVGM 1C0UA 3ZSVA 2VYPA 4YOXA 1J5EK 2JWLA 3OYNA 2YNGA 2IVOA 3C65A 3O4NA 3HP9A 3VN5A 4CFDA 1XC9A 4CJTA 3V1QA 4FLTA 3P4IA 1L3TA 3CETA 4DQPA 5M1OA 3EZWA 4GY2B 1G15A 2FBTA 1UWBA 3IS9A 2X74A 2ZD1A 4BDYA 1QQNA 3ID6A 2QXFA 3TTDA 5K14A 4FK2A 4O0JA 1L3VA 5ADXA 2F8TA 4KH6A 4BC5A 4E7HA 5C0YA 2HNYA 3OYMA 3R8EA 3QDKA 4L8RB 3HPOA 3NVKA 4CBWA 2VG6A 3O1WA 4JD2B 4ELUA 1C1AA 3K57A 4CEZA 1NK8A 5AQUA 3MX5A 5GIPA 1Q81O 3P83D 3QEIA 1N6QA 1ZBHA 3OS1A 4B9VA 4PKGA 5HRPA 3J8AA 1QSLA 3OYIA 4LF5K 2GUIA 3IUCA 3DRSA 3HXMA 1WSFA 4CJ3A 5H1SQ 3J7ZO 3JSMA 3VEYA 4Z4IA 1YTAA 2YHBA 3LWMA 3T69A 4LF4K 4PKIA 2ASPA 1N8RO 3DM2A 4OPHA 3VQCA 3SPYA 3K9KA 2EWSA 4PQUA 4LF6K 4IFEA 1VSEA 3OYCA 4M3WA 4PWDA 4BRQA 1XNRK 5E26A 1RT1A 1Q9XA 1TYQB 2GWKA 4OGEA 3SYZA 4A62A 1S9EA 4K25A 1NMNA 3VA3A 3UKUB 1OKJA 1S5JA 3O3FA 2X6NA 2YJEA 4DUYK 1SKRA 5LY3A 4AM6A 4I9QA 3CFOA 4HUEA 4FJJA 2A1SA 4KH4A 3WNGA 5FRMA 4A57A 3I8BA 1ZBFA 1KSPA 4EZ9A 1XQSC 2VQFK 1ZC6A 3HL8A 3DMJA 4IOCL 1Q7YO 2FSJA 4BRCA 3T1YK 3RMDA 1NGEA 3BEXA 4KRFA 3PX6A 3SV4A 1K6YA 3C6TA 1X3NA 4JI3K 3O9RA 3C94A 2H3GX 2DPNA 3CCLN 5HRRA 3LM2A 3SCXA 3THVA 1XUPO 1VQMN 4X62K 4BY9C 3THXB 1RDAA 3VETA 4FWSA 4W5RA 3IMXA 2RKIA 3CM5A 5AZJB 3M3ZA 4O0IA 4H0YB 4Z94A 2A41A 4I7FA 3HK2A 5C25A 3RWUA 4BROA 4N56A 4J2DA 3E66A 3ISNC 4KB0A 2P1JA 3DXKA 1E3MA 4CHQA 1D9DA 1M90O 4H0XB 3ZCMA 2E5LK 3OHRA 3EEQA 3LDOA 1TKDA 4K0KK 1FXXA 4MFBA 5GINA 4JI8K 2NLXA 2UU9K 3T19A 3GOIA 5FRNA 2FXUA 3UE5A 1Z6RA 3MCAB 5JICA 1D9FA 1HYSA 4JAXA 4V19S 4B1WB 2F8SA 4B8CA 4FJGA 2F7TA 1ATRA 3PLAA 3EL2A 1YAGA 3IFRA 1EP4A 1F21A 3WQTA 5LJWA 1U47A 2HHXA 1RDWX 4KHYA 4H5TA 3MX2A 2V52B 1VSJA 3LDPA 3MXJA 4IOXA 1IKYA 5ADXH 3OY9A 5AZIA 3ZT2A 2P9LB 4BRDA 4I6MA 1D5AA 1TUYA 3PX0A 4OKEA 4FLUA 4BQZA 3H1QA 5HRNA 4EZ6A 5AQTA 3WEEB 2E1YA 3DYAA 1JLQA 5FLXO 3DXMA 4RWTA 4FWNA 1HNXK 2P9SA 2DFEA 5C15A 4M3TA 3PSFA 1KLMA 1OVQA 2E6MA 3SQ0A 5AQKA 3CC4N 4IDHA 4CHOA 3LAKA 4IEEA 3OJSA 4CZGA 3AVGA 4MDAA 3E1YA 3MK6A 1NKEA 5KRTA 3QETA 1NGJA 4W5NA 1HKCA 1S1WA 5BRDA 5KTQA 2CH6A 3B8AX 1KC8O 1T05A 5BRFA 2HHSA 1YTUA 5KQ8A 3KLHA 5GAGP 4UQGA 3HRGA 1KFSA 3CMEN 2RHKA 4EP4A 4JS4A 1VQ5N 3AVFA 2XY6A 3NFAA 2E88A 1OH5A 2QTDA 3TSPA 4LF7K 1Z05A 2JWKA 3NDKA 3O4WA 4DR4K 4CHPA 1QZ6A 2D0BA 5AQHA 3O3GA 2HSTA 4UY8O 3ULEA 1RBRA 3AARA 2PAVA 4BRKA 3SZ2A 4HWIA 4BR4A 1GLJO 3FZMA 4DR5K 4BC2A 4AHRA 4M42A 3H6EA 3SMPA 3MAQA 3TABA 1JL1A 1BQMA 2XHBA 1TGOA 3MEDA 4KKOA 1JXBA 1KRPA 1NG9A 2P5GA 1C0GA 4JN4A 3TSQA 2RPIA 2WC9A 1J6ZA 3GBTA 4CFCA 4JYAK 5DK5A 3O1BA 5AQIA 1RBVA 4YY3K 4QCLA 4MLEA 1NK7A 3Q7CA 4BRGA 3SQ1A 1RDUA 1FKOA 4BGAA 2QXLA 3J7YP 1S1TA 4YHHK 3TAEA 2HBMA 4AQYK 4H5WA 1BI4A 2CGKA 1S9GA 4F3OA 4KH5A 3VGKA 1E4FT 3KLFA 4CHZA 2IS3A 1XHXA 1NMDA 1T6CA 1NBWA 1RNHA 3TTCA 2QKKA 3OS2A 3EY1A 3GL1A 2Q36A 4CFAA 1S6PA 1WAFA 2D4WA 4GW6A 5JMVA 4E1MA 2OZMA 4DR6K 2O8EB 4LD0A 4NXMK 2ZJRL 5HLFA 1LWFA 4E19A 1MWKA 4JHDB 4KPYA 1VHXA 4B1YB 1Q9YA 3MXMA 4CZHA 4FW1A 4CGJA 3TAMA 5C24A 1GLDG 4DV6K 3AVLA 1BOTO 3DOKA 3LALA 2D0AA 3C7NB 2HHHK 2FF3B 2CGJA 2G8VA 1SV5A 3CIPA 1XMQK 3BUZB 3O9QA 5BREA 4R79A 2BE2A 4JEPA 2VG7A 1NNEA 1WSEA 4W5TA 1ZBIA 5TKWA 3CCEN 4M3RA 1SL0A 1I94K 4O55A 4BREA 2P9KA 4FZZA 1VQLN 4FWQA 4JKBA 3HT3A 3G0ZA 1T03A 4JI1K 3LDSA 1EX4A 1GLBG 1U2VB 1JLFA 2PBDA 3RSEB 5C2FA 1NGBA 3D45A 4JI7K 4Y1CA 4GV9A 4FLVA 4K8XA 3I0SA 3TARA 2O8DB 3J81O 4DTRA 4LFAK 1N34K 3RTVA 1YHQN 1LWCA 1WOQA 1VQ6N 3H3NO 3F9MA 4PKHA 4XH5A 3TTFA 3RMCA 4KO0A 3SAHA 4CK3A 4DTSA 1UA0A 2WONA 4JV5K 4JD2A 2BUPA 3SAGA 1DT9A 2O8BA 4DU4A 2YHXA 3O9SA 3QNNA 3KZBA 1HQUA 3VQAA 1QS4A 2YKMA 2PYLA 2G8HA 2KTQA 4B3TK 1QSSA 1NGIA 4EIAA 3ZX0A 3RRGA 1TAUA 1YF5L 4IBNA 3WXLA 4AHCA 4DSFA 2F9WA 2Q2RA 1GOBA 2O8CB 2B5JA 4CJ7A 5I3UA 3ZSQA 3W3DA 3A5OC 1NGFA 3I56N 4W5OA 3UKRA 4KI6A 4FZXC 4JK7A 2NZTA 3FFIA 1NJXA 1DLOA 3AGRA 3V6DA 3IG1A 3M6GA 3QFPA 3QBWA 2BTFA 5EU7A 1M1KO 3LP2A 3UKUA 4FL9A 4JKFA 1W2BM 1XNQK 1NJYA 2FBXA 3ZX2A 1EWRA 1NGHA 3T1AA 4IJAA 1BHLA 3KWIA 4MDBA 5BN9A 3SQ2A 4B8AB 3KD5E 1EKEA 1L3SA 1Y64A 3DLGA 2B4JA 3MWPA 3TANA 2D1KA 1N5YA 3V1RA 4WQ4A 1U45A 1HPMA 2KZZA 4CD1A 4CZJA 4YOYA 3AAPA 2ASOA 4XIUA 4DTUA 3PO4A 2A1RA 4FLZA 3THXA 3VMFB 4DF8A 3SJHA 1YJWN 4OKKA 1WBBA 1OH7A 5AJ3K 2EX3A 4IG3A 3SI6A 5AZJA 4OLBA 1WSGA 4CEBA 3IRXA 3I33A 4C8NA 4YOTA 5F1XA 3ZETB 3J7AP 2ZF5O 4M7YA 3SUNA 3PY8A 2QWPA 1RT2A 1ASVA 2KZMA 5GAEP 1HQEA 3SAFA 4FWLA 4JI0K 1ITGA 3OYAA 1R0AA 5IWAK 3KD1E 3OA9A 4CEOA 4CIFA 2XY5A 1BL3A 1QE1A 1HNWK 4DKWA 3NCIA 1T44A 4O8KA 1BIZA 1NLVA 2GELA 4DS4A 1RBTA 4BR5A 5HP1A 4F4KA 1LWEA 2ITGA 4NLCA 4C8KA 4KHUA 3B6PA 4CZIA 4N5SA 3VQ8A 3S3NA 2FBYA 4PUOA 4CJPA 3F5TA 3G25A 4BE0A 4KTQA 1Q82O 2BH1A 3SQ4A 4F2RA 4GKKK 1TK5A 3MEGA 2GBZA 4IEIA 3THWA 4F9OA 2FF6A 3NF8A 3L3VA 5M1PA 2E2NA 3IKMA 4NXNK 2GX9A 2F4VK 4IG0A 3LP3A 1G99A 4FZYA 2UUCK 4DSEA 2P9IB 3TU5A 4CJQA 2AP1A 1NGDA 2P9LA 4BRMA 1HPZA 2PFUA 2QEXN 1RT6A 2IOCA 4CJVA 4X65K 3TAQA 2HHTA 3AA5X 1NJZA 4FJLA 3QERA 3DLRA 2O4IA 1HRHA 1IG8A 1VRUA 1DKGD 3VTIA 2D0OA 2ZGZA 2DY4A 3NVMA 4FWRA 3MECA 1QQOA 2FBVA 2BDPA 4CERA 1JCFA 3RRHA 1JL2A 3CJBA 3NGZA 1CXQA 3HO1A 2A3ZA 2YNHA 2V7YA 1RILA 1VK0A 4XH1A 3L2RA 3VQEA 1CZ9A 1B92A 4AH9A 3JAMO 3G10A 4DSLA 4E1NA 2IAJA 5AQGA 3NGYA 3T7ZA 4FJ9A 3ZT1A 5AFUA 1ASUA 3CC2N 4DQRA 5FDLA 2E8AA 1DTQA 3QICA 3VGMA 4OPJA 3CXCM 4B3SK 3V4IA 2J4RA 2WOMA 3ENHA 3U8XA 1GLLO 3ZEUA 3BDPA 3ZSWA 2QWQA 4O5FA 2HHUA 1IH7A 1H1VA 4J2AA 4IXCA 1TKZA 1S6QA 4K8ZA 4G1QA 4HHTA 4NCGA 4CEAA 2QK9A 2X78A 1GLEG 2ASMA 3CFRA 3A2FA 4E89A 4LFBK 1KAZA 3QEWA 1CLQA 1GOAA 5AQNA 1WN7A 2E20A 1SKWA 2OYQA 1JCEA 5FPNA 2G8FA 1TK0A 1Y97A 3QO9A 4ILJA 1Q86O 2Y1IA 4WQ5A 3IDHA 3VENA 2KHOA 2PZSA 1TKXA 4ID5A 4JK9A 4K42A 1VQ9N 3AV9A 4MQ3A 3CJAA 5KPRA 1X9JA 3C6AA 2E2QA 3I0RA 4JI2K 4KHQA 5AQZA 2WBNA 4WYBA 4Y1DA 4CBUA 4N41A 5J2QA 2HNZA 4RG8A 3WXIA 4JKGA 4H5VA 3LWLA 1BUPA 3K5NA 5GIOA 5JVGL 3KVGA 1C0MA 4RCHA 2P9PB 2VGMA 5KI6A 3SUOA 3R3LA 3VQPA 2VGNA 3LL3A 1NOZA 3VEVA 4DR1K 3Q7BA 5AR0A 2NRRA 3NF7A 4JKDA 1YVUA 3OW2M 5HL7L 3F73A 1SS6A 3V9WA 4O44A 2A42A 1BA0A 4JHDA 3A5MC 3JS6A 2KQ2A 1MDUB 4DU3A 2CH5A 3M1FA 1NU0A 4CZEA 4J2BA 1JJ2M 4IKFA 1A5VA 3C7NA 4FLYA 3DRPA 3EKSA 4DQ8A 2YKNA 2P51A 5LJVA 4WFAL 3HSCA 3QFUA 3PUFA 4B9NA 3KTQA 3DLKA 4FJIA 4CEQA 3ASMA 5M1KA 5LMUK 1T8EA 3U4LA 3KK7A 3ZSRA 4A5AA 4NCAA 3D0PA 3NMUA 4B1VA 4CF1A 2NRZA 3D7EO 1U2VA 3AVCA 3RSEA 3HVRA 4M3ZA 4PY5A 3CCMN 1JLAA 4CJEA 2JGUA 5DMRA 3DLHA 2P9NA 5CZ2A 3THYA 4Q0BA 5J2MA 4IZ9A 2O8DA 1VAZA 5KRSA 4CJ4A 4H5NA 1X9WA 2XY7A 1BISA 4PL7A 3UIQA 1JLEA 2VG5A 4IO8A 1GOCA 2NNWA 4OVLA 3IAYA 1JKHA 1KQSM 3BF1A 4BVOA 4RW6A 2QKBA 4YOWA 3OYDA 1VQ8N 4QS8A 4F2SA 1LW0A 1Q8IA 2FLOA 5C12A 1HUXA 3PO5A 1C1CA 2QWOA 3T1HK 3D2EB 1JXEA 3ZLJA 4DG1A 3VF6A 2KLAA 3C95A 1RT5A 3CERA 1UAXA 1QSYA 3VESA 3CHWA 4GVEA 1NWKA 4H0VB 5BRHA 1HNIA 3N4QA 4CF9A 4NO7A 1KD1O 2UUBK 4H4OA 1BG3A 4M41A 2O8CA 4DLEA 3RR7A 4LF8K 2HF3A 3DLEA 4X66K 1NOYA 1X1PA 2OPRA 3ENBA 1HKBA 4I2PA 3QMLA 1CZBA 3ITHA 3LPUA 1W0HA 4J2EA 2A40A 3P38A 1C1BA 3R6MA 4DV3K 1FJGK 4CF0A 3L8BA 1P8ZA 1L3UA 4DU1A 1IJJA 3BF3A 4CIEA 1S72N 1B9DA 2BGGA 1RBUA 4HCBA 3O80A 4O4GA 1WLJA 4CK2A 3RMBA 1SL2A 1BWFO 1FK9A 2JLEA 1VQON 3HM8A 1RGIA 3MN7A 5FPDA 4DSKA 3RVCA 4PA1A 1UA1A 3CYMA 2W42A 5C2DA 5AQMA 1J54A 1IV0A 4WQ5C 3AY9A 5AQVA 2RF2A 3D2FA 1NK9A 4BVPA 3OTOK 3KKSA 3LPTA 4BRNA 3N4PA 5MLCQ 3VEZA 2UYTA 2D0PA 4DSIA 2HBLA 2GV9A 4KI4A 4C1NK 4FYDA 3M5RA 3LANA 1ZBLA 1I39A 3AO4A 3HI0A 4CD3A 1GLAG 3OYFA 5EVZA 2VQEK 3M8SA 1ZBSA 3CPEA 3E9OA 4NB4A 4OJRA 3ATUA 2FSKA 3A8YA 1QTMA 3HVTA 3ZETA 4FJMA 3SUQA 3DOLA 3M8PA 4EHTA 3FZFA 4HTLA 1YT3A 1WSHA 3TR8A 4HUGA 5HRSA 3S3OA 3C6HA 3VQ9A 1O1WA 4M45A 3NE6A 2VWJA 4AILC 3K5MA 5KGXA 2IC3A 4I9LA 2GEMA 2KFZA 4KHPK 4BRIA 3VERA 4BE1A 1K8KB 3I8DA 4XH4A 1A5WA 1NKBA 4DV5K 3K0SA 4KBOA 1X3MA 5CHIA 1XWLA 4K43A 4KAZA 4N76A 3SNNA 1NGCA 3ALYA 2W6KA 3I55N 3QLHA 4JK8A 4BRHA 3TI0A 3SBTA 3KWGA 3HPHA 4IOAL 5AZIB 4B08A 1L5UA 1IBMK 3VEWA 4B9TA 3V9XA 2ZJPL 1J9AA 4AHVA 1S3XA 2GWJA 5FPEA 1ESVA 2P9IA 5SWMA 3PX4A 4EFHA 1NGGA 3KK2A 3ID8A 5LMNK 1Z26A 4LF9K 1TKTA 4FJHA 3FE1A 1WAJA 4BR9A 2PYJA 4FLXA 2YHAA 2P9SB 3VQ6A 4BACA 3CCUN 2GTDA 2HW3A 4EAHD 2VCPA 5AQQA 3QEVA 3L3UA 4N47A 3BZCA 1RT4A 3P31A 4CF2A 4WCEL 3P1GA 4DV2K 1QQMA 1UOCA 1KVCA 1QZ5A 3TSUA 4FJ7A 1T7PA 3CJ1A 3VF4A 5KPZA 1U6ZA 4U7BA 4DR3K 3OYKA 2HHVA 4CZFA 2AA4A 4KV8A 1VSKA 3HTVA 3AO5A 3K58A 1NKCA 4DB3A 1ZXOA 2HHQA 3SLCA 4CJUA 3ENOA 4DUZK 1QHAA 3O6WA 1RTJA 4R5PA 4JI4K 4JI5K 1KCFA 1HJRA 5LL6Z 3VQBA 2YV0X 4HTUA 3AO2A 1TYQA 3FR0A 1ZBUA 1QVFM 4ICLA 3CG7A 3DI6A 3WNHA 4Z4EA 5KGWA 3LP0A 3MMVA 4E7KA 3NF6A 4B9MA 4CHNA 4DTNA 1LCUA 4BE2A 4C23A 2ITMA 4BR0A 3K2PA 4FO0A 4BG9A 5CE3A 4DV1K 1A5XA 1GLFO 4DTPA 2E4LA 2A6AA 4CVNE 4CIGA 3KHYA 5KQDA 2XO7A 3QEXA 1YUWA 4YDUA 3AVMA 3OYLA 4DR2K 4B3OA 4DLGA 3C6UA 1K73O 4LH5A 3WUHA 2IIRA 2KFNA 3W0LA 5I42A 3MN5A 1WSIA 1HNVA 1KXPA 4Z0UA 2YNFA 4GV3A 3HP6A 3U3YA 1D8YA 4CGDA 1BQNA 3RMAA 1RDBA 3VEXA 2Z1HA 3KLEA 1WB9A 2NRXA 4Z4GA 2W6LA 3OYBA 4C1NI 5EY4A 3EO3A 4QS9A 3PV8A 1EQYA 3CF5L 1IKWA 4JKAA 3NAEA 3QINA 3K5OA 4C8MA 3MXIA 5HOOA 2WTUA 1YJNN 2Z1JA 4X64K 2ZQBA 1V4TA 4KFBA 1MA9B 3G4SN 3RR8A 4NCBA 4BDPA 1GLCG 2W40A 4JKCA 2X6SA 1R59O 4CJFA 4CZMA 5SZTA 3DLBA 1N32K 2KKZA 4BRFA 2QA4N 1YITN 2YHYA 5BR9A 5C10A 5CYMA 1DEJA 1HKGA 4F3TA 2P9PA 2OTJN 3P39A 2QWLA 3TAGA 1JLCA 2WUSA 2G8WA 3NH0A 3U9ZA 3CJ7A 1DGKN 4DV0K 2VWBA 3CMAN 3LAMA 3S41A 2V7ZA 4ELTA 3NF9A 4M3UA 4FCYA 4C8OA 5M1NA 3QEPA 2NUBA 2O8FB 1FKPA 3BP8A 3VEOA 2D5RA 3LP1A 3ZSXA 1VQNN 2Q3SA 1LAVA 4Q5VA 2I5JA 1TL3A 3VOVA 3HM9A 2G8IA 4B9LA 1SZ2A 4DSJA 1VQ7N 3DLLL 2Z1GA 1LAWA 3TPQA 3ULDA 3AVNA 5JVHL 2Q97A 4LSNA 2P9KB 4CBXA 2UUAK 3J80O 3QB0A 4FM2A 3VA0A 2Q1NA 3ZT3A 4ISGA 3C0BA 1HYZA 3V81A 5EOYA 4B9UA 4ID1A 4CGHA 1IKXA 5C42A 4BQLA 3PIPL 4FWOA 1W97L 5FROA 3DWLA 3L6QA 2UXBK 3EKUA 4B3MK 4OX9K 2AJQA 4DV7K 3PIOL 3WEEA 3SK3A 3QESA 2NRWA 3H46O 1BO5O 5IT9O 3QBXA 3V9ZA 2YX6A 4AF1A 3TAPA 5BN8A 4RTFD 2YHWA 2HNDA 2HMPA 5DM6L 4DS5A 1BCMA 4Y0WA 4U67L 3ZX3A 4KHWA 3OBYA 3L2UA 2O8BB 1KFDA 3AVBA 4ISEA 4YNQA 4YOVA 3CD6N 4NYFA 1DTTA 5CYQA 3VF2A 4CEFA 3FGUA 3OJUA 3DRRA 1EO1A 3PSIA 3VQQA 3MEEA 1KVBA 1IBLK 1XMOK 4CECA 4B3RK 3P5JA 3D2EA 4DHYA 1YI2N 4A59A 4GMJB 4FWPA 4M63C 3OYJA 2OA8A 1EXQA 4AM7A 3CM6A 3WQUA 1TV6A 1S1XA 4BRPA 4L3QA 3EZ5A 5AQFA 4LY7A 3H3OB 4CF8A 2A5XA 3UKRB 4DR7K 3AA3A 3VQDA 2OPQA 4E0DA 4YOUA 2RN2A 3CJCA 1MWMA 3HBTA 3QNOA 4RW4A 4IFYA 3S3MA 3FLCO 2UXCK 3SMSA 3SBGA 4NLBA 3WXMB 3CQXA 2P9UB 3AO3A 2UXDK 4MO5A 4ISFA 4YDUC 3WNFA 4DMNA 1C0TA 4J8FA 4FK4A 4FJKA 3E01A 4FVUA 2B6AA 4NYNA 4BRAA 1C0FA 1U49A 3H45C 4GNIA 4KHNA 4MLHA 4CEDA 2FSNA 3KK3A 3GG4A 3R1XA 3G71N 1RTIA 4QS7A 4LSLA 4WQ4C 5E41A 1VSHA 2FC0A 2PY5A 1J53A 3OYHA 4BGBA 2QM1A 2ZM6K 3KKRA 5AQRA 1NK0A 3U9DA 3AVJA 1YXQA 2HBKA 2R7YA 3L0QA 4H0TB 5GAHP 4BRLA 4FJXA 2IDOA 2HVIA 5BPLA 4DFMA 4BDZA 1VSFA 5B8HA 2O8EA 4PL8A 4LC9B 5ELZA 2G8KA 4WFBL 3NHGA 3O4QA 3FZKA 3O8MA 2NRHA 2VWKA 4H0PA 3OYEA 4MO4A 5T7BA 3LM9A 4H0OA 1BGXT 1RFQA 3SUPA 2Z1IA 4FK0A 2YNIA 1IKVA 3F9KA 4A5BA 1J5OA 2HVHA 2LSNA 4CGGA 2ZJQL 3A0IX 1U04A 4CCHA 1HR0K 2IGIA 5AQYA 3WT0A 1XC3A 4H03B 5HBMA 3U3GA 1K8KA 4DF4A 1TAQA 5AQWA 4DTJA 4BG8A 4FPBA 4ZTJA 3WXKA 2EHGA 2QI2A 3EE8A 1LV5A 5BPNA 1YJ9N 1RTDA 4KTZA 3D6RA 1RT7A 5AQOA 3THWB 5EX5A 3K9JA 2DTUA 3HZ6A 2GUPA 4KB1A 1HJOA 4FSVA 3E9PA 1ATNA 2HOEA 1VSLA 1O13A 4B1UB 1KAXA 4K41A 3AGKA 4FM0A 4DCHA 4CJRA 1HYVA 1VQPN 4CZKA 4E7LA 2HBJA 4GVMA 3R9PA 4HCCA 1BA1A 4XEIA 4OO1J 1TUUA 3HPGA 4FXDA 5AQPA 4RW9A 4IWVA 1HNZK 2KW4A 4G9ZA 4BR2A 3JXUA 5AFUH 2ETJA 4JKEA
chains in the Genus database with same CATH topology
3HPHA 4Z4HA 4DFJA 3SUNA 3PY8A 4Z4FA 1XI1A 5JS1A 1RT2A 3HL8A 4B08A 1L5UA 1JLBA 1ASVA 3DMJA 1CLQA 4B9TA 2KZMA 3V9XA 1J9AA 2F96A 1SUQA 4AHVA 3RMDA 1HQEA 4FJ5A 4KRFA 3PX6A 3SV4A 1ITGA 3T3FA 1K6YA 3C6TA 3OYAA 4B9SA 3C94A 1R0AA 3KD1E 5J1EA 5SWMA 3PX4A 3SJJA 3KK2A 3S9HA 4CJWA 1W9HA 5HRRA 4H8KA 4CEOA 4CIFA 3WNEA 1Z26A 1TKTA 4FJHA 2XY5A 1BL3A 1QE1A 3SCXA 1WAJA 3THVA 2PYJA 4FLXA 2YHAA 3NCIA 3VQ6A 1BIZA 4BACA 4DS4A 1IG9A 1RBTA 1RDAA 4AHUA 5HP1A 2HW3A 4W5RA 2RKIA 4F4KA 1LWEA 2ITGA 3CM5A 4C8KA 4KHUA 3QEVA 3B6PA 3L3UA 4O0IA 4N47A 3VQ8A 4N5SA 1RT4A 3S3NA 2FBYA 4PUOA 4CF2A 3OYGA 1XHZA 3P1GA 4CJPA 1UOCA 1KVCA 4BE0A 4FJ7A 1T7PA 4I7FA 3HK2A 5C25A 3RWUA 4HVJA 1ZYQA 1VSMA 4CJKA 4N56A 4KTQA 3OYKA 4J2DA 3SQ4A 3ISNC 4F2RA 5JS2A 3VQ5A 4KB0A 1TK5A 3MEGA 2HHVA 4KV8A 1VSKA 2GBZA 3VQ7A 2P1JA 3AO5A 3K58A 1Z25A 3NF8A 4CHQA 1D9DA 3L3VA 3ZCMA 1NKCA 4IG0A 4E7IA 3LP3A 1TKDA 2HHQA 4FZYA 2ZE2A 3KJVA 4E3SA 1SL1A 1FXXA 1RDCA 4DSEA 4MFBA 4CJUA 4CJQA 4EP5A 1QQCA 4R5PA 1RTJA 1U48A 3T19A 3M8RA 4EZ9A 1KCFA 1HJRA 3VQBA 4FLWA 1HPZA 2ATQA 4F8RA 2YV0X 4HTUA 5FRNA 3AO2A 4DQIA 1SKSA 1RT6A 1HYSA 1ZBUA 2IOCA 4CJVA 3TAQA 1D9FA 2HHTA 4ICLA 3CG7A 3DI6A 3WNHA 4Z4EA 5KGWA 2E6LA 3AA5X 3LP0A 4E7KA 3NF6A 4B8CA 1NJZA 4B9MA 5HROA 4CHNA 3QERA 4FJGA 3DLRA 4DTNA 3U6FA 1S1UA 1HRHA 4FJLA 2O4IA 1VRUA 4BE2A 1VSIA 3K2PA 1EP4A 1F21A 3ZSYA 1U47A 2DY4A 3LZIA 4ELVA 1A5XA 4DTPA 3MECA 2E4LA 4CGIA 4H4MA 2FBVA 4E7JA 4AHSA 1ASWA 1CXUA 4CERA 1TL1A 3RRHA 4CIGA 2BDPA 2HHXA 1WNSA 1JL2A 3NGZA 2XO7A 3QEXA 4KHYA 3AVMA 3OYLA 4B3OA 1CXQA 3C6UA 1MU2A 4DLGA 4LH5A 4ZHRA 5J2PA 3HO1A 2F8SA 1VSJA 2KFNA 3MXJA 2YNHA 1RTHA 1S1VA 5I42A 1IKYA 1WSIA 1HNVA 1RILA 4Z0UA 2YNFA 3OY9A 1VK0A 2DFHA 3ZT2A 3HP6A 3L2RA 3U3YA 1D8YA 4CGDA 4M3XA 3AVHA 1BIUA 1CZ9A 1B92A 3VQEA 1BQNA 1D5AA 1EETA 4AH9A 3G10A 4DSLA 3RMAA 1RDBA 4E1NA 2Z1HA 3KLEA 2IAJA 4Z4GA 3L2VA 4DTMA 3PX0A 4OKEA 3NGYA 4FLUA 3OYBA 4FJ9A 1NK5A 3PV8A 5HRNA 3ZT1A 4BWJA 1HMVA 4EZ6A 1ASUA 3DYAA 1IKWA 4DQRA 1JLQA 3QINA 5FDLA 3K5OA 3NAEA 4DFPA 4C8MA 4C8LA 3MXIA 1DTQA 2DFEA 4OPJA 1U4BA 2Z1JA 3V4IA 3QIPA 4FJNA 4M3TA 2ZQBA 2WOMA 4KFBA 3BGRA 1KLMA 2E6MA 4TSXA 4OPKA 3BDPA 3ZSWA 3TAFA 3SQ0A 3CFPA 3RR8A 4NCBA 4BDPA 4CHOA 3LAKA 3OJSA 2HHUA 2X6SA 5SZTA 4CJFA 1IH7A 3DLBA 2O4GA 3AVGA 4J2AA 1NKEA 1TKZA 1X9SA 5KRTA 3QETA 1S6QA 3ZSZA 2XY8A 3B6OA 4G1QA 4HHTA 2P5OA 1S1WA 4K8ZA 4NCGA 5KTQA 4W5NA 4CEAA 5CYMA 4OGCA 5J2NA 2QK9A 2X78A 1T05A 1BCOA 2HHSA 4CESA 4F3TA 3CFRA 3A2FA 4E89A 1YTUA 3HYFA 4HUFA 3QEWA 3KLHA 3TAGA 1JLCA 3NBPA 4IFVA 1GOAA 3NH0A 2G8WA 2HMIA 4OLAA 1WN7A 1SKWA 2OYQA 4IDKA 3KLGA 4CHYA 2G8FA 4UQGA 3LAMA 1TK0A 1Y97A 4FM1A 3V1OA 1WSJA 4ELTA 1KFSA 3NF9A 4M3UA 1JLGA 4KREA 3QO9A 2OPSA 4FCYA 4C8OA 3NGIA 3QEPA 2NUBA 3SPZA 4EP4A 4JS4A 1FKPA 3AVFA 2XY6A 2Y1IA 2D5RA 4FW2A 3LP1A 3NFAA 3ZSXA 4CFBA 2PZSA 1TKXA 3AVIA 4ID5A 4KTWA 2OPPA 1RCHA 3AV9A 1RDDA 2Q3SA 3NDKA 4MQ3A 1LAVA 3KK1A 4CHPA 3I0RA 2D0BA 4Q5VA 2I5JA 1TL3A 3O3GA 4KHSA 4CGFA 4KHQA 3VQ4A 3HM9A 2G8IA 4Y1DA 1RBRA 3SZ2A 4B9LA 4DSJA 3HJFA 1TAUA 2Z1GA 1LAWA 3ULDA 2Y1JA 3AVNA 4N41A 4AHRA 2HNZA 4RG8A 4JRPA 5J2QA 4M42A 4JS5A 4FVMA 4LSNA 3LWLA 3K5NA 3MAQA 4ZTFA 3TABA 1C0MA 1JL1A 4DTOA 2D0CA 5KI6A 2DFFA 3SUOA 1BQMA 2XHBA 1TGOA 3VQPA 3MEDA 4LH4A 3NH2A 4FM2A 4KKOA 3VA0A 1JXBA 3ZT3A 1KLNA 1KRPA 1HYZA 1NOZA 2P5GA 3V81A 2RPIA 4B9UA 4ID1A 3ZT0A 4CGHA 4RW7A 1IKXA 5C42A 1C6VA 3NF7A 4DTXA 4RW8A 4CFCA 1YVUA 2G8UA 5DK5A 3F73A 4M3YA 3V9WA 4O44A 4QAGA 1RBVA 5FROA 4DQSA 4QCLA 1NJWA 3CQ8A 2KQ2A 1NK6A 3KLIA 4DU3A 1NK7A 2AJQA 3SQ1A 4J2BA 1FKOA 3QESA 3K59A 3K5LA 4IKFA 1QHTA 4BWMA 1S1TA 4I2QA 1A5VA 3TAEA 3V9ZA 3L2QA 4FLYA 3DRPA 1KVAA 1BI4A 3TAPA 2YKNA 2HNDA 2P51A 4CJSA 5D3GA 3V9SA 1S9GA 1KTQA 3HSTB 4DS5A 4F3OA 3PUFA 1BCMA 3OVNA 3AVAA 3KLFA 3KTQA 3DLKA 4CHZA 1B9FA 2IS3A 3SV3A 4B9NA 5CY4A 4FJIA 1XHXA 4KHWA 3L2UA 1KFDA 3AVBA 4CE9A 4CEQA 3TWHA 3ASMA 4YNQA 3NH1A 1RNHA 4NYFA 1T8EA 1DTTA 2QKKA 5CYQA 3OS2A 2HB5A 3ZSOA 3EY1A 1LW2A 4CFAA 3ZSRA 4NCAA 3D0PA 1S6PA 1WAFA 4GW6A 4CEFA 4E1MA 2OZMA 3OJUA 4LD0A 3DRRA 4CF1A 4JRQA 5HLFA 3JYTA 1LWFA 4E19A 4YFUA 1RT3A 3AVCA 1KVBA 3MEEA 3VQQA 3HVRA 1TK8A 4KPYA 4CECA 4M3ZA 4PY5A 3P5JA 1Q9YA 1JLAA 4CJEA 3MXMA 2JGUA 4FW1A 1REVA 4GMJB 5DMRA 4CGJA 3OYJA 3EYZA 2OA8A 5CZ2A 3DLHA 1EXQA 3TAMA 4CJLA 5C24A 4Q0BA 3CM6A 3AVLA 5J2MA 4OKJA 3DOKA 3LALA 2D0AA 1TV6A 5CZ1A 4WE1A 4CEEA 3KIOA 4Z4CA 5KRSA 1S1XA 4CJ4A 2G8VA 1BI4B 1VRTA 3ZT4A 3EZ5A 4FJ8A 1SV5A 4LY7A 1X9WA 4CF8A 2XY7A 4DQQA 1BISA 2BE2A 3UIQA 3AA3A 3VQDA 2OPQA 3L2WA 1JLEA 2VG7A 2VG5A 2RN2A 3O3HA 1GOCA 4E0DA 1RBSA 3AVKA 3QNOA 2BANA 4RW4A 1WSEA 4IFYA 3S3MA 4W5TA 4DWIA 1ZBIA 4OVLA 1I3AA 3IAYA 1JKHA 4M3RA 4JLHA 1SL0A 3AO3A 3QIOA 4O55A 4RW6A 4DFKA 4FZZA 3OYDA 2QKBA 3V9UA 2OZSA 3HT3A 4F2SA 3WNFA 1LW0A 1Q8IA 3G0ZA 1T03A 4DMNA 1EX4A 3LDSA 4CJ5A 1C0TA 4FK4A 1JLFA 3PO5A 2HHWA 4FJKA 1C1CA 3D45A 3E01A 1VSDA 3AA4A 2B6AA 4NYNA 1JXEA 4Y1CA 1X9MA 1U49A 4FLVA 4DG1A 4K8XA 4KHNA 3C95A 3I0SA 3AA2A 1RT5A 2XRIA 4CEDA 3TARA 1UAXA 4W5QA 1QSYA 3LZJA 3KK3A 1HNIA 1RTIA 4CF9A 4DTRA 3AO1A 4LSLA 5E41A 1VSHA 4AHTA 3OS0A 3RTVA 2FC0A 2PY5A 4H4OA 3M8QA 1J53A 4CK1A 1NK4A 3OYHA 1LWCA 4M41A 1IO2A 3RMCA 4DLEA 3RR7A 4QOZB 1TVRA 3DLEA 3KKRA 1NK0A 1NOYA 4KO0A 1X1PA 3AVJA 2OPRA 3H08A 4O5BA 4CK3A 1C0UA 4I2PA 3ZSVA 4DTSA 1UA0A 2R7YA 2WONA 1CZBA 3ITHA 3LPUA 3OYNA 1W0HA 2YNGA 4J2EA 3O4NA 3HP9A 3VN5A 1C1BA 4CFDA 4CF0A 1XC9A 4CJTA 4FJXA 3L8BA 3V1QA 4DU4A 4FLTA 1L3UA 4DU1A 1L3TA 2IDOA 3QNNA 2HVIA 4CIEA 1HQUA 4BDZA 4DFMA 1B9DA 3VQAA 1RBUA 4DQPA 4HCBA 2BGGA 1VSFA 4O4GA 1WLJA 4CK2A 1QS4A 3RMBA 1G15A 2YKMA 2PYLA 2FBTA 1SL2A 1UWBA 3IS9A 1FK9A 2X74A 2ZD1A 2G8HA 2JLEA 4BDYA 2KTQA 2QXFA 2G8KA 4DSKA 1QSSA 5K14A 4FK2A 4O0JA 4PA1A 3RRGA 1L3VA 3NHGA 4AHCA 3CYMA 3O4QA 4IBNA 2W42A 4DSFA 1UA1A 2F8TA 1GOBA 2B5JA 1J54A 2VWKA 5I3UA 3OYEA 4E7HA 3ZSQA 5T7BA 2HNYA 3OYMA 1BGXT 3SUPA 2RF2A 2Z1IA 4FK0A 2YNIA 4L8RB 1IKVA 3HPOA 4W5OA 1NK9A 3F9KA 2VG6A 1J5OA 4KI6A 4FZXC 3KKSA 4ELUA 2HVHA 1C1AA 2LSNA 3FFIA 4CEZA 3K57A 1NK8A 4CGGA 1DLOA 1NJXA 3LPTA 3V6DA 3IG1A 1U04A 4CCHA 3P83D 3QEIA 1N6QA 5EU7A 1ZBHA 3OS1A 4B9VA 3LP2A 4DSIA 2IGIA 2GV9A 4KI4A 5HRPA 4FYDA 3LANA 1ZBLA 1QSLA 5HBMA 1I39A 3U3GA 3OYIA 2GUIA 3AO4A 4DF4A 1TAQA 3DRSA 4DTJA 3OYFA 4ZTJA 3HXMA 2FBXA 1NJYA 1WSFA 2EHGA 4CJ3A 1LV5A 3M8SA 3T1AA 3JSMA 1RTDA 4Z4IA 4KTZA 1RT7A 4OJRA 2DTUA 1YTAA 1QTMA 1BHLA 3HVTA 3SQ2A 2YHBA 3LWMA 4KB1A 4B8AB 4FJMA 3SUQA 3KD5E 1EKEA 3DM2A 3DOLA 3M8PA 3VQCA 3SPYA 1L3SA 3DLGA 1YT3A 2B4JA 1WSHA 4PQUA 1VSLA 3TR8A 4HUGA 5HRSA 3S3OA 1VSEA 3OYCA 4M3WA 4PWDA 3TANA 1RT1A 1Q9XA 3VQ9A 4OGEA 3SYZA 1O1WA 3V1RA 4M45A 3NE6A 2VWJA 1U45A 1N5YA 2KZZA 4AILC 4FM0A 3K5MA 1S9EA 4CJRA 1HYVA 5KGXA 3VA3A 2IC3A 4I9LA 2KFZA 4E7LA 1S5JA 3O3FA 2X6NA 4GVMA 4BE1A 3I8DA 4XIUA 4DTUA 1A5WA 3PO4A 1NKBA 2A1RA 4FLZA 1SKRA 4DF8A 4HCCA 4I9QA 3CFOA 4OKKA 2EX3A 1XWLA 4IG3A 4KAZA 3HPGA 3SI6A 4OLBA 1WSGA 3SNNA 4HUEA 4N76A 4FXDA 4FJJA 4RW9A 3ALYA 2A1SA 4CEBA 3QLHA 3WNGA 5FRMA 3TI0A 3IRXA 4C8NA 2KW4A 1ZBFA 1KSPA 2ETJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HPH A;  4Z4H A;  4DFJ A;  3SUN A;  3PY8 A;  4Z4F A;  1XI1 A;  5JS1 A;  1RT2 A;  3HL8 A;  4B08 A;  1L5U A;  1JLB A;  1ASV A;  3DMJ A;  1CLQ A;  4B9T A;  2KZM A;  3V9X A;  1J9A A;  2F96 A;  1SUQ A;  4AHV A;  3RMD A;  1HQE A;  4FJ5 A;  4KRF A;  3PX6 A;  3SV4 A;  1ITG A;  3T3F A;  1K6Y A;  3C6T A;  3OYA A;  4B9S A;  3C94 A;  1R0A A;  3KD1 E;  5J1E A;  5SWM A;  3PX4 A;  3SJJ A;  3KK2 A;  3S9H A;  4CJW A;  1W9H A;  5HRR A;  4H8K A;  4CEO A;  4CIF A;  3WNE A;  1Z26 A;  1TKT A;  4FJH A;  2XY5 A;  1BL3 A;  1QE1 A;  3SCX A;  1WAJ A;  3THV A;  2PYJ A;  4FLX A;  2YHA A;  3NCI A;  3VQ6 A;  1BIZ A;  4BAC A;  4DS4 A;  1IG9 A;  1RBT A;  1RDA A;  4AHU A;  5HP1 A;  2HW3 A;  4W5R A;  2RKI A;  4F4K A;  1LWE A;  2ITG A;  3CM5 A;  4C8K A;  4KHU A;  3QEV A;  3B6P A;  3L3U A;  4O0I A;  4N47 A;  3VQ8 A;  4N5S A;  1RT4 A;  3S3N A;  2FBY A;  4PUO A;  4CF2 A;  3OYG A;  1XHZ A;  3P1G A;  4CJP A;  1UOC A;  1KVC A;  4BE0 A;  4FJ7 A;  1T7P A;  4I7F A;  3HK2 A;  5C25 A;  3RWU A;  4HVJ A;  1ZYQ A;  1VSM A;  4CJK A;  4N56 A;  4KTQ A;  3OYK A;  4J2D A;  3SQ4 A;  3ISN C;  4F2R A;  5JS2 A;  3VQ5 A;  4KB0 A;  1TK5 A;  3MEG A;  2HHV A;  4KV8 A;  1VSK A;  2GBZ A;  3VQ7 A;  2P1J A;  3AO5 A;  3K58 A;  1Z25 A;  3NF8 A;  4CHQ A;  1D9D A;  3L3V A;  3ZCM A;  1NKC A;  4IG0 A;  4E7I A;  3LP3 A;  1TKD A;  2HHQ A;  4FZY A;  2ZE2 A;  3KJV A;  4E3S A;  1SL1 A;  1FXX A;  1RDC A;  4DSE A;  4MFB A;  4CJU A;  4CJQ A;  4EP5 A;  1QQC A;  4R5P A;  1RTJ A;  1U48 A;  3T19 A;  3M8R A;  4EZ9 A;  1KCF A;  1HJR A;  3VQB A;  4FLW A;  1HPZ A;  2ATQ A;  4F8R A;  2YV0 X;  4HTU A;  5FRN A;  3AO2 A;  4DQI A;  1SKS A;  1RT6 A;  1HYS A;  1ZBU A;  2IOC A;  4CJV A;  3TAQ A;  1D9F A;  2HHT A;  4ICL A;  3CG7 A;  3DI6 A;  3WNH A;  4Z4E A;  5KGW A;  2E6L A;  3AA5 X;  3LP0 A;  4E7K A;  3NF6 A;  4B8C A;  1NJZ A;  4B9M A;  5HRO A;  4CHN A;  3QER A;  4FJG A;  3DLR A;  4DTN A;  3U6F A;  1S1U A;  1HRH A;  4FJL A;  2O4I A;  1VRU A;  4BE2 A;  1VSI A;  3K2P A;  1EP4 A;  1F21 A;  3ZSY A;  1U47 A;  2DY4 A;  3LZI A;  4ELV A;  1A5X A;  4DTP A;  3MEC A;  2E4L A;  4CGI A;  4H4M A;  2FBV A;  4E7J A;  4AHS A;  1ASW A;  1CXU A;  4CER A;  1TL1 A;  3RRH A;  4CIG A;  2BDP A;  2HHX A;  1WNS A;  1JL2 A;  3NGZ A;  2XO7 A;  3QEX A;  4KHY A;  3AVM A;  3OYL A;  4B3O A;  1CXQ A;  3C6U A;  1MU2 A;  4DLG A;  4LH5 A;  4ZHR A;  5J2P A;  3HO1 A;  2F8S A;  1VSJ A;  2KFN A;  3MXJ A;  2YNH A;  1RTH A;  1S1V A;  5I42 A;  1IKY A;  1WSI A;  1HNV A;  1RIL A;  4Z0U A;  2YNF A;  3OY9 A;  1VK0 A;  2DFH A;  3ZT2 A;  3HP6 A;  3L2R A;  3U3Y A;  1D8Y A;  4CGD A;  4M3X A;  3AVH A;  1BIU A;  1CZ9 A;  1B92 A;  3VQE A;  1BQN A;  1D5A A;  1EET A;  4AH9 A;  3G10 A;  4DSL A;  3RMA A;  1RDB A;  4E1N A;  2Z1H A;  3KLE A;  2IAJ A;  4Z4G A;  3L2V A;  4DTM A;  3PX0 A;  4OKE A;  3NGY A;  4FLU A;  3OYB A;  4FJ9 A;  1NK5 A;  3PV8 A;  5HRN A;  3ZT1 A;  4BWJ A;  1HMV A;  4EZ6 A;  1ASU A;  3DYA A;  1IKW A;  4DQR A;  1JLQ A;  3QIN A;  5FDL A;  3K5O A;  3NAE A;  4DFP A;  4C8M A;  4C8L A;  3MXI A;  1DTQ A;  2DFE A;  4OPJ A;  1U4B A;  2Z1J A;  3V4I A;  3QIP A;  4FJN A;  4M3T A;  2ZQB A;  2WOM A;  4KFB A;  3BGR A;  1KLM A;  2E6M A;  4TSX A;  4OPK A;  3BDP A;  3ZSW A;  3TAF A;  3SQ0 A;  3CFP A;  3RR8 A;  4NCB A;  4BDP A;  4CHO A;  3LAK A;  3OJS A;  2HHU A;  2X6S A;  5SZT A;  4CJF A;  1IH7 A;  3DLB A;  2O4G A;  3AVG A;  4J2A A;  1NKE A;  1TKZ A;  1X9S A;  5KRT A;  3QET A;  1S6Q A;  3ZSZ A;  2XY8 A;  3B6O A;  4G1Q A;  4HHT A;  2P5O A;  1S1W A;  4K8Z A;  4NCG A;  5KTQ A;  4W5N A;  4CEA A;  5CYM A;  4OGC A;  5J2N A;  2QK9 A;  2X78 A;  1T05 A;  1BCO A;  2HHS A;  4CES A;  4F3T A;  3CFR A;  3A2F A;  4E89 A;  1YTU A;  3HYF A;  4HUF A;  3QEW A;  3KLH A;  3TAG A;  1JLC A;  3NBP A;  4IFV A;  1GOA A;  3NH0 A;  2G8W A;  2HMI A;  4OLA A;  1WN7 A;  1SKW A;  2OYQ A;  4IDK A;  3KLG A;  4CHY A;  2G8F A;  4UQG A;  3LAM A;  1TK0 A;  1Y97 A;  4FM1 A;  3V1O A;  1WSJ A;  4ELT A;  1KFS A;  3NF9 A;  4M3U A;  1JLG A;  4KRE A;  3QO9 A;  2OPS A;  4FCY A;  4C8O A;  3NGI A;  3QEP A;  2NUB A;  3SPZ A;  4EP4 A;  4JS4 A;  1FKP A;  3AVF A;  2XY6 A;  2Y1I A;  2D5R A;  4FW2 A;  3LP1 A;  3NFA A;  3ZSX A;  4CFB A;  2PZS A;  1TKX A;  3AVI A;  4ID5 A;  4KTW A;  2OPP A;  1RCH A;  3AV9 A;  1RDD A;  2Q3S A;  3NDK A;  4MQ3 A;  1LAV A;  3KK1 A;  4CHP A;  3I0R A;  2D0B A;  4Q5V A;  2I5J A;  1TL3 A;  3O3G A;  4KHS A;  4CGF A;  4KHQ A;  3VQ4 A;  3HM9 A;  2G8I A;  4Y1D A;  1RBR A;  3SZ2 A;  4B9L A;  4DSJ A;  3HJF A;  1TAU A;  2Z1G A;  1LAW A;  3ULD A;  2Y1J A;  3AVN A;  4N41 A;  4AHR A;  2HNZ A;  4RG8 A;  4JRP A;  5J2Q A;  4M42 A;  4JS5 A;  4FVM A;  4LSN A;  3LWL A;  3K5N A;  3MAQ A;  4ZTF A;  3TAB A;  1C0M A;  1JL1 A;  4DTO A;  2D0C A;  5KI6 A;  2DFF A;  3SUO A;  1BQM A;  2XHB A;  1TGO A;  3VQP A;  3MED A;  4LH4 A;  3NH2 A;  4FM2 A;  4KKO A;  3VA0 A;  1JXB A;  3ZT3 A;  1KLN A;  1KRP A;  1HYZ A;  1NOZ A;  2P5G A;  3V81 A;  2RPI A;  4B9U A;  4ID1 A;  3ZT0 A;  4CGH A;  4RW7 A;  1IKX A;  5C42 A;  1C6V A;  3NF7 A;  4DTX A;  4RW8 A;  4CFC A;  1YVU A;  2G8U A;  5DK5 A;  3F73 A;  4M3Y A;  3V9W A;  4O44 A;  4QAG A;  1RBV A;  5FRO A;  4DQS A;  4QCL A;  1NJW A;  3CQ8 A;  2KQ2 A;  1NK6 A;  3KLI A;  4DU3 A;  1NK7 A;  2AJQ A;  3SQ1 A;  4J2B A;  1FKO A;  3QES A;  3K59 A;  3K5L A;  4IKF A;  1QHT A;  4BWM A;  1S1T A;  4I2Q A;  1A5V A;  3TAE A;  3V9Z A;  3L2Q A;  4FLY A;  3DRP A;  1KVA A;  1BI4 A;  3TAP A;  2YKN A;  2HND A;  2P51 A;  4CJS A;  5D3G A;  3V9S A;  1S9G A;  1KTQ A;  3HST B;  4DS5 A;  4F3O A;  3PUF A;  1BCM A;  3OVN A;  3AVA A;  3KLF A;  3KTQ A;  3DLK A;  4CHZ A;  1B9F A;  2IS3 A;  3SV3 A;  4B9N A;  5CY4 A;  4FJI A;  1XHX A;  4KHW A;  3L2U A;  1KFD A;  3AVB A;  4CE9 A;  4CEQ A;  3TWH A;  3ASM A;  4YNQ A;  3NH1 A;  1RNH A;  4NYF A;  1T8E A;  1DTT A;  2QKK A;  5CYQ A;  3OS2 A;  2HB5 A;  3ZSO A;  3EY1 A;  1LW2 A;  4CFA A;  3ZSR A;  4NCA A;  3D0P A;  1S6P A;  1WAF A;  4GW6 A;  4CEF A;  4E1M A;  2OZM A;  3OJU A;  4LD0 A;  3DRR A;  4CF1 A;  4JRQ A;  5HLF A;  3JYT A;  1LWF A;  4E19 A;  4YFU A;  1RT3 A;  3AVC A;  1KVB A;  3MEE A;  3VQQ A;  3HVR A;  1TK8 A;  4KPY A;  4CEC A;  4M3Z A;  4PY5 A;  3P5J A;  1Q9Y A;  1JLA A;  4CJE A;  3MXM A;  2JGU A;  4FW1 A;  1REV A;  4GMJ B;  5DMR A;  4CGJ A;  3OYJ A;  3EYZ A;  2OA8 A;  5CZ2 A;  3DLH A;  1EXQ A;  3TAM A;  4CJL A;  5C24 A;  4Q0B A;  3CM6 A;  3AVL A;  5J2M A;  4OKJ A;  3DOK A;  3LAL A;  2D0A A;  1TV6 A;  5CZ1 A;  4WE1 A;  4CEE A;  3KIO A;  4Z4C A;  5KRS A;  1S1X A;  4CJ4 A;  2G8V A;  1BI4 B;  1VRT A;  3ZT4 A;  3EZ5 A;  4FJ8 A;  1SV5 A;  4LY7 A;  1X9W A;  4CF8 A;  2XY7 A;  4DQQ A;  1BIS A;  2BE2 A;  3UIQ A;  3AA3 A;  3VQD A;  2OPQ A;  3L2W A;  1JLE A;  2VG7 A;  2VG5 A;  2RN2 A;  3O3H A;  1GOC A;  4E0D A;  1RBS A;  3AVK A;  3QNO A;  2BAN A;  4RW4 A;  1WSE A;  4IFY A;  3S3M A;  4W5T A;  4DWI A;  1ZBI A;  4OVL A;  1I3A A;  3IAY A;  1JKH A;  4M3R A;  4JLH A;  1SL0 A;  3AO3 A;  3QIO A;  4O55 A;  4RW6 A;  4DFK A;  4FZZ A;  3OYD A;  2QKB A;  3V9U A;  2OZS A;  3HT3 A;  4F2S A;  3WNF A;  1LW0 A;  1Q8I A;  3G0Z A;  1T03 A;  4DMN A;  1EX4 A;  3LDS A;  4CJ5 A;  1C0T A;  4FK4 A;  1JLF A;  3PO5 A;  2HHW A;  4FJK A;  1C1C A;  3D45 A;  3E01 A;  1VSD A;  3AA4 A;  2B6A A;  4NYN A;  1JXE A;  4Y1C A;  1X9M A;  1U49 A;  4FLV A;  4DG1 A;  4K8X A;  4KHN A;  3C95 A;  3I0S A;  3AA2 A;  1RT5 A;  2XRI A;  4CED A;  3TAR A;  1UAX A;  4W5Q A;  1QSY A;  3LZJ A;  3KK3 A;  1HNI A;  1RTI A;  4CF9 A;  4DTR A;  3AO1 A;  4LSL A;  5E41 A;  1VSH A;  4AHT A;  3OS0 A;  3RTV A;  2FC0 A;  2PY5 A;  4H4O A;  3M8Q A;  1J53 A;  4CK1 A;  1NK4 A;  3OYH A;  1LWC A;  4M41 A;  1IO2 A;  3RMC A;  4DLE A;  3RR7 A;  4QOZ B;  1TVR A;  3DLE A;  3KKR A;  1NK0 A;  1NOY A;  4KO0 A;  1X1P A;  3AVJ A;  2OPR A;  3H08 A;  4O5B A;  4CK3 A;  1C0U A;  4I2P A;  3ZSV A;  4DTS A;  1UA0 A;  2R7Y A;  2WON A;  1CZB A;  3ITH A;  3LPU A;  3OYN A;  1W0H A;  2YNG A;  4J2E A;  3O4N A;  3HP9 A;  3VN5 A;  1C1B A;  4CFD A;  4CF0 A;  1XC9 A;  4CJT A;  4FJX A;  3L8B A;  3V1Q A;  4DU4 A;  4FLT A;  1L3U A;  4DU1 A;  1L3T A;  2IDO A;  3QNN A;  2HVI A;  4CIE A;  1HQU A;  4BDZ A;  4DFM A;  1B9D A;  3VQA A;  1RBU A;  4DQP A;  4HCB A;  2BGG A;  1VSF A;  4O4G A;  1WLJ A;  4CK2 A;  1QS4 A;  3RMB A;  1G15 A;  2YKM A;  2PYL A;  2FBT A;  1SL2 A;  1UWB A;  3IS9 A;  1FK9 A;  2X74 A;  2ZD1 A;  2G8H A;  2JLE A;  4BDY A;  2KTQ A;  2QXF A;  2G8K A;  4DSK A;  1QSS A;  5K14 A;  4FK2 A;  4O0J A;  4PA1 A;  3RRG A;  1L3V A;  3NHG A;  4AHC A;  3CYM A;  3O4Q A;  4IBN A;  2W42 A;  4DSF A;  1UA1 A;  2F8T A;  1GOB A;  2B5J A;  1J54 A;  2VWK A;  5I3U A;  3OYE A;  4E7H A;  3ZSQ A;  5T7B A;  2HNY A;  3OYM A;  1BGX T;  3SUP A;  2RF2 A;  2Z1I A;  4FK0 A;  2YNI A;  4L8R B;  1IKV A;  3HPO A;  4W5O A;  1NK9 A;  3F9K A;  2VG6 A;  1J5O A;  4KI6 A;  4FZX C;  3KKS A;  4ELU A;  2HVH A;  1C1A A;  2LSN A;  3FFI A;  4CEZ A;  3K57 A;  1NK8 A;  4CGG A;  1DLO A;  1NJX A;  3LPT A;  3V6D A;  3IG1 A;  1U04 A;  4CCH A;  3P83 D;  3QEI A;  1N6Q A;  5EU7 A;  1ZBH A;  3OS1 A;  4B9V A;  3LP2 A;  4DSI A;  2IGI A;  2GV9 A;  4KI4 A;  5HRP A;  4FYD A;  3LAN A;  1ZBL A;  1QSL A;  5HBM A;  1I39 A;  3U3G A;  3OYI A;  2GUI A;  3AO4 A;  4DF4 A;  1TAQ A;  3DRS A;  4DTJ A;  3OYF A;  4ZTJ A;  3HXM A;  2FBX A;  1NJY A;  1WSF A;  2EHG A;  4CJ3 A;  1LV5 A;  3M8S A;  3T1A A;  3JSM A;  1RTD A;  4Z4I A;  4KTZ A;  1RT7 A;  4OJR A;  2DTU A;  1YTA A;  1QTM A;  1BHL A;  3HVT A;  3SQ2 A;  2YHB A;  3LWM A;  4KB1 A;  4B8A B;  4FJM A;  3SUQ A;  3KD5 E;  1EKE A;  3DM2 A;  3DOL A;  3M8P A;  3VQC A;  3SPY A;  1L3S A;  3DLG A;  1YT3 A;  2B4J A;  1WSH A;  4PQU A;  1VSL A;  3TR8 A;  4HUG A;  5HRS A;  3S3O A;  1VSE A;  3OYC A;  4M3W A;  4PWD A;  3TAN A;  1RT1 A;  1Q9X A;  3VQ9 A;  4OGE A;  3SYZ A;  1O1W A;  3V1R A;  4M45 A;  3NE6 A;  2VWJ A;  1U45 A;  1N5Y A;  2KZZ A;  4AIL C;  4FM0 A;  3K5M A;  1S9E A;  4CJR A;  1HYV A;  5KGX A;  3VA3 A;  2IC3 A;  4I9L A;  2KFZ A;  4E7L A;  1S5J A;  3O3F A;  2X6N A;  4GVM A;  4BE1 A;  3I8D A;  4XIU A;  4DTU A;  1A5W A;  3PO4 A;  1NKB A;  2A1R A;  4FLZ A;  1SKR A;  4DF8 A;  4HCC A;  4I9Q A;  3CFO A;  4OKK A;  2EX3 A;  1XWL A;  4IG3 A;  4KAZ A;  3HPG A;  3SI6 A;  4OLB A;  1WSG A;  3SNN A;  4HUE A;  4N76 A;  4FXD A;  4FJJ A;  4RW9 A;  3ALY A;  2A1S A;  4CEB A;  3QLH A;  3WNG A;  5FRM A;  3TI0 A;  3IRX A;  4C8N A;  2KW4 A;  1ZBF A;  1KSP A;  2ETJ A; 
#chains in the Genus database with same CATH topology
 5AQS A;  4Z4H A;  4O8U A;  4DFJ A;  4Z4F A;  1XI1 A;  5JS1 A;  1JLB A;  1WUA A;  2F96 A;  1SUQ A;  1OH8 A;  5DM7 L;  2HF4 A;  4FJ5 A;  2Q0U A;  4A2A A;  3T3F A;  4B9S A;  4BR7 A;  5F2R A;  5J1E A;  3SJJ A;  1YVN A;  3S9H A;  4CJW A;  1W9H A;  4H8K A;  3FZH A;  3WNE A;  4JI6 K;  3L4Q A;  1VQ4 N;  1IG9 A;  3BZK A;  2Q0R A;  4AHU A;  3UB5 A;  2E2O A;  1BDG A;  2IVP A;  3ZEU B;  1E4G T;  1OH6 A;  3OYG A;  1XHZ A;  5BPM A;  4M7X A;  4HVJ A;  1ZYQ A;  1VSM A;  4CJK A;  1FW6 A;  5CR4 A;  5JS2 A;  3VQ5 A;  3VQ7 A;  1N36 K;  1Z25 A;  3EE9 A;  4E7I A;  2ZE2 A;  3KJV A;  4E3S A;  1SL1 A;  1RDC A;  3A5N C;  1SAZ A;  4EP5 A;  1QQC A;  2I7N A;  2Q31 A;  1U48 A;  3M8R A;  3H1V X;  4FLW A;  2ATQ A;  4F8R A;  4DQI A;  1JCG A;  4FOI A;  1SKS A;  1NGA A;  1YIJ N;  2YI1 A;  2E6L A;  5HRO A;  3U6F A;  1S1U A;  3GE1 A;  3DAW A;  1VSI A;  1OVY A;  3ZSY A;  5AQX A;  3LZI A;  1WBD A;  4ELV A;  4CGI A;  4H4M A;  4B1Z A;  4E7J A;  4AHS A;  1ASW A;  1CXU A;  1TL1 A;  1WNS A;  4JKG B;  3CI5 A;  3DXK B;  5F0X A;  1MU2 A;  5J2P A;  4ZHR A;  2WFB A;  1SQK A;  1RTH A;  1S1V A;  5A2Q O;  3O9U A;  2DFH A;  4M3X A;  3E9L A;  1BIU A;  3AVH A;  1EET A;  3HOS A;  3VTH A;  2NRT A;  3L2V A;  4DTM A;  1NK5 A;  4BWJ A;  1HMV A;  2QWR A;  2O8F A;  3GDQ A;  4DFP A;  4C8L A;  4IO9 L;  3ATV A;  1P90 A;  4WF9 L;  1U4B A;  2NRV A;  3HOT A;  3QIP A;  3CCS N;  4FJN A;  3BGR A;  4TSX A;  4OPK A;  2ZWH A;  3TAF A;  1D4X A;  3CFP A;  1S22 A;  2O4G A;  3MDQ A;  1X9S A;  3ZSZ A;  2XY8 A;  3B6O A;  2P5O A;  4OPA A;  4OGC A;  5J2N A;  4E1J A;  2OAN A;  4CZL A;  1BCO A;  4CES A;  1T6D A;  4I6M B;  3HYF A;  4HUF A;  3CPW M;  4OLA A;  3NBP A;  4IFV A;  1BU6 O;  2HMI A;  2E1Z A;  4IDK A;  3KLG A;  4FWK A;  4CHY A;  4FM1 A;  3V1O A;  1WSJ A;  3VPZ A;  4GKJ K;  1JLG A;  4KRE A;  2P9N B;  3G6E N;  2OPS A;  3NGI A;  1V4S A;  3SPZ A;  1K8A O;  2QWM A;  3THY B;  4FW2 A;  1EWQ A;  3DXM B;  4CFB A;  1LOT B;  3AVI A;  5E84 A;  4KTW A;  4BC4 A;  2OPP A;  1RCH A;  2QWN A;  3O5B A;  1RDD A;  3KK1 A;  3CQY A;  3VGL A;  5GAD P;  4KHS A;  4CGF A;  3VQ4 A;  4FPA A;  3MN9 A;  5EXW A;  4PHT X;  3HJF A;  2F9T A;  2Y1J A;  2QW9 A;  4JRP A;  3DJC A;  4B1X B;  3LDL A;  2W41 A;  4FOE A;  4JS5 A;  4FVM A;  4ZTF A;  4ILH A;  2D0C A;  4DTO A;  4CI6 A;  2DFF A;  1Q18 A;  3AAQ A;  4LH4 A;  3NH2 A;  1KLN A;  3ZT0 A;  4RW7 A;  3OBW A;  1C6V A;  4DTX A;  4RW8 A;  2V51 B;  2G8U A;  4M3Y A;  3BY5 A;  1NJI O;  4QAG A;  2OCE A;  4DQS A;  1NJW A;  3CQ8 A;  1NK6 A;  3KLI A;  3O9T A;  4EHU A;  3K59 A;  3K5L A;  1QHT A;  3LDQ A;  4BWM A;  4I2Q A;  1HX1 A;  3CCR N;  3L2Q A;  3ULE B;  1KVA A;  5FPM A;  4A61 A;  5I9E B;  5JLH A;  5KPT A;  1K9M O;  3MWT A;  4CJS A;  5D3G A;  3V9S A;  1KTQ A;  3HST B;  3OVN A;  3AVA A;  5AQJ A;  3SV3 A;  1B9F A;  2YCH A;  5CY4 A;  5M1F A;  4CE9 A;  3TWH A;  3NH1 A;  2E2P A;  4WFN L;  2RE2 A;  2HB5 A;  3ZSO A;  2P9U A;  3LDN A;  1LW2 A;  3F2K A;  1N33 K;  4JRQ A;  3JYT A;  1ATS A;  4YFU A;  1RT3 A;  1TK8 A;  2OTL N;  3FFK B;  4DV4 K;  1REV A;  5TKY A;  3EYZ A;  3A5L C;  4BC3 A;  4CJL A;  4GV6 A;  1T3V A;  4OKJ A;  2YJF A;  5CZ1 A;  2ZGY A;  4WE1 A;  3KIO A;  4CEE A;  4Z4C A;  4JNE A;  1BI4 B;  1VRT A;  3ZT4 A;  4FJ8 A;  3CCQ N;  2I7P A;  3D2F B;  4DQQ A;  3L2W A;  3O3H A;  4CW7 B;  3O08 A;  1RBS A;  3AVK A;  5JLF A;  2BAN A;  4DWI A;  3CJ9 A;  1I3A A;  3WXJ A;  4JLH A;  3QIO A;  4DFK A;  4YOR A;  1IBK K;  3V9U A;  1VQK N;  2OZS A;  1NM1 A;  4CJ5 A;  2IVN A;  4B9Q A;  1ILY A;  2HHW A;  5AQL A;  1VSD A;  3MCP A;  3AA4 A;  4ILG B;  1X9M A;  5M1Q A;  5BR8 K;  2CGL A;  3EN9 A;  4A2B A;  3CC7 N;  3AA2 A;  2XRI A;  4W5Q A;  3LZJ A;  4H5R A;  1W7A A;  3CCJ N;  1CZA N;  3AO1 A;  3FZL A;  3CCV N;  1HLU A;  4AHT A;  3OS0 A;  3M8Q A;  4FWM A;  4JKH A;  4CK1 A;  1NK4 A;  1IO2 A;  3L4I A;  4QOZ B;  1TVR A;  4LFC K;  1KAY A;  4IJN A;  3ZYY X;  3H08 A;  4O5B A;  3MN6 A;  1QVG M;  1C0U A;  3ZSV A;  2VYP A;  4YOX A;  1J5E K;  2JWL A;  3OYN A;  2YNG A;  2IVO A;  3C65 A;  3O4N A;  3HP9 A;  3VN5 A;  4CFD A;  1XC9 A;  4CJT A;  3V1Q A;  4FLT A;  3P4I A;  1L3T A;  3CET A;  4DQP A;  5M1O A;  3EZW A;  4GY2 B;  1G15 A;  2FBT A;  1UWB A;  3IS9 A;  2X74 A;  2ZD1 A;  4BDY A;  1QQN A;  3ID6 A;  2QXF A;  3TTD A;  5K14 A;  4FK2 A;  4O0J A;  1L3V A;  5ADX A;  2F8T A;  4KH6 A;  4BC5 A;  4E7H A;  5C0Y A;  2HNY A;  3OYM A;  3R8E A;  3QDK A;  4L8R B;  3HPO A;  3NVK A;  4CBW A;  2VG6 A;  3O1W A;  4JD2 B;  4ELU A;  1C1A A;  3K57 A;  4CEZ A;  1NK8 A;  5AQU A;  3MX5 A;  5GIP A;  1Q81 O;  3P83 D;  3QEI A;  1N6Q A;  1ZBH A;  3OS1 A;  4B9V A;  4PKG A;  5HRP A;  3J8A A;  1QSL A;  3OYI A;  4LF5 K;  2GUI A;  3IUC A;  3DRS A;  3HXM A;  1WSF A;  4CJ3 A;  5H1S Q;  3J7Z O;  3JSM A;  3VEY A;  4Z4I A;  1YTA A;  2YHB A;  3LWM A;  3T69 A;  4LF4 K;  4PKI A;  2ASP A;  1N8R O;  3DM2 A;  4OPH A;  3VQC A;  3SPY A;  3K9K A;  2EWS A;  4PQU A;  4LF6 K;  4IFE A;  1VSE A;  3OYC A;  4M3W A;  4PWD A;  4BRQ A;  1XNR K;  5E26 A;  1RT1 A;  1Q9X A;  1TYQ B;  2GWK A;  4OGE A;  3SYZ A;  4A62 A;  1S9E A;  4K25 A;  1NMN A;  3VA3 A;  3UKU B;  1OKJ A;  1S5J A;  3O3F A;  2X6N A;  2YJE A;  4DUY K;  1SKR A;  5LY3 A;  4AM6 A;  4I9Q A;  3CFO A;  4HUE A;  4FJJ A;  2A1S A;  4KH4 A;  3WNG A;  5FRM A;  4A57 A;  3I8B A;  1ZBF A;  1KSP A;  4EZ9 A;  1XQS C;  2VQF K;  1ZC6 A;  3HL8 A;  3DMJ A;  4IOC L;  1Q7Y O;  2FSJ A;  4BRC A;  3T1Y K;  3RMD A;  1NGE A;  3BEX A;  4KRF A;  3PX6 A;  3SV4 A;  1K6Y A;  3C6T A;  1X3N A;  4JI3 K;  3O9R A;  3C94 A;  2H3G X;  2DPN A;  3CCL N;  5HRR A;  3LM2 A;  3SCX A;  3THV A;  1XUP O;  1VQM N;  4X62 K;  4BY9 C;  3THX B;  1RDA A;  3VET A;  4FWS A;  4W5R A;  3IMX A;  2RKI A;  3CM5 A;  5AZJ B;  3M3Z A;  4O0I A;  4H0Y B;  4Z94 A;  2A41 A;  4I7F A;  3HK2 A;  5C25 A;  3RWU A;  4BRO A;  4N56 A;  4J2D A;  3E66 A;  3ISN C;  4KB0 A;  2P1J A;  3DXK A;  1E3M A;  4CHQ A;  1D9D A;  1M90 O;  4H0X B;  3ZCM A;  2E5L K;  3OHR A;  3EEQ A;  3LDO A;  1TKD A;  4K0K K;  1FXX A;  4MFB A;  5GIN A;  4JI8 K;  2NLX A;  2UU9 K;  3T19 A;  3GOI A;  5FRN A;  2FXU A;  3UE5 A;  1Z6R A;  3MCA B;  5JIC A;  1D9F A;  1HYS A;  4JAX A;  4V19 S;  4B1W B;  2F8S A;  4B8C A;  4FJG A;  2F7T A;  1ATR A;  3PLA A;  3EL2 A;  1YAG A;  3IFR A;  1EP4 A;  1F21 A;  3WQT A;  5LJW A;  1U47 A;  2HHX A;  1RDW X;  4KHY A;  4H5T A;  3MX2 A;  2V52 B;  1VSJ A;  3LDP A;  3MXJ A;  4IOX A;  1IKY A;  5ADX H;  3OY9 A;  5AZI A;  3ZT2 A;  2P9L B;  4BRD A;  4I6M A;  1D5A A;  1TUY A;  3PX0 A;  4OKE A;  4FLU A;  4BQZ A;  3H1Q A;  5HRN A;  4EZ6 A;  5AQT A;  3WEE B;  2E1Y A;  3DYA A;  1JLQ A;  5FLX O;  3DXM A;  4RWT A;  4FWN A;  1HNX K;  2P9S A;  2DFE A;  5C15 A;  4M3T A;  3PSF A;  1KLM A;  1OVQ A;  2E6M A;  3SQ0 A;  5AQK A;  3CC4 N;  4IDH A;  4CHO A;  3LAK A;  4IEE A;  3OJS A;  4CZG A;  3AVG A;  4MDA A;  3E1Y A;  3MK6 A;  1NKE A;  5KRT A;  3QET A;  1NGJ A;  4W5N A;  1HKC A;  1S1W A;  5BRD A;  5KTQ A;  2CH6 A;  3B8A X;  1KC8 O;  1T05 A;  5BRF A;  2HHS A;  1YTU A;  5KQ8 A;  3KLH A;  5GAG P;  4UQG A;  3HRG A;  1KFS A;  3CME N;  2RHK A;  4EP4 A;  4JS4 A;  1VQ5 N;  3AVF A;  2XY6 A;  3NFA A;  2E88 A;  1OH5 A;  2QTD A;  3TSP A;  4LF7 K;  1Z05 A;  2JWK A;  3NDK A;  3O4W A;  4DR4 K;  4CHP A;  1QZ6 A;  2D0B A;  5AQH A;  3O3G A;  2HST A;  4UY8 O;  3ULE A;  1RBR A;  3AAR A;  2PAV A;  4BRK A;  3SZ2 A;  4HWI A;  4BR4 A;  1GLJ O;  3FZM A;  4DR5 K;  4BC2 A;  4AHR A;  4M42 A;  3H6E A;  3SMP A;  3MAQ A;  3TAB A;  1JL1 A;  1BQM A;  2XHB A;  1TGO A;  3MED A;  4KKO A;  1JXB A;  1KRP A;  1NG9 A;  2P5G A;  1C0G A;  4JN4 A;  3TSQ A;  2RPI A;  2WC9 A;  1J6Z A;  3GBT A;  4CFC A;  4JYA K;  5DK5 A;  3O1B A;  5AQI A;  1RBV A;  4YY3 K;  4QCL A;  4MLE A;  1NK7 A;  3Q7C A;  4BRG A;  3SQ1 A;  1RDU A;  1FKO A;  4BGA A;  2QXL A;  3J7Y P;  1S1T A;  4YHH K;  3TAE A;  2HBM A;  4AQY K;  4H5W A;  1BI4 A;  2CGK A;  1S9G A;  4F3O A;  4KH5 A;  3VGK A;  1E4F T;  3KLF A;  4CHZ A;  2IS3 A;  1XHX A;  1NMD A;  1T6C A;  1NBW A;  1RNH A;  3TTC A;  2QKK A;  3OS2 A;  3EY1 A;  3GL1 A;  2Q36 A;  4CFA A;  1S6P A;  1WAF A;  2D4W A;  4GW6 A;  5JMV A;  4E1M A;  2OZM A;  4DR6 K;  2O8E B;  4LD0 A;  4NXM K;  2ZJR L;  5HLF A;  1LWF A;  4E19 A;  1MWK A;  4JHD B;  4KPY A;  1VHX A;  4B1Y B;  1Q9Y A;  3MXM A;  4CZH A;  4FW1 A;  4CGJ A;  3TAM A;  5C24 A;  1GLD G;  4DV6 K;  3AVL A;  1BOT O;  3DOK A;  3LAL A;  2D0A A;  3C7N B;  2HHH K;  2FF3 B;  2CGJ A;  2G8V A;  1SV5 A;  3CIP A;  1XMQ K;  3BUZ B;  3O9Q A;  5BRE A;  4R79 A;  2BE2 A;  4JEP A;  2VG7 A;  1NNE A;  1WSE A;  4W5T A;  1ZBI A;  5TKW A;  3CCE N;  4M3R A;  1SL0 A;  1I94 K;  4O55 A;  4BRE A;  2P9K A;  4FZZ A;  1VQL N;  4FWQ A;  4JKB A;  3HT3 A;  3G0Z A;  1T03 A;  4JI1 K;  3LDS A;  1EX4 A;  1GLB G;  1U2V B;  1JLF A;  2PBD A;  3RSE B;  5C2F A;  1NGB A;  3D45 A;  4JI7 K;  4Y1C A;  4GV9 A;  4FLV A;  4K8X A;  3I0S A;  3TAR A;  2O8D B;  3J81 O;  4DTR A;  4LFA K;  1N34 K;  3RTV A;  1YHQ N;  1LWC A;  1WOQ A;  1VQ6 N;  3H3N O;  3F9M A;  4PKH A;  4XH5 A;  3TTF A;  3RMC A;  4KO0 A;  3SAH A;  4CK3 A;  4DTS A;  1UA0 A;  2WON A;  4JV5 K;  4JD2 A;  2BUP A;  3SAG A;  1DT9 A;  2O8B A;  4DU4 A;  2YHX A;  3O9S A;  3QNN A;  3KZB A;  1HQU A;  3VQA A;  1QS4 A;  2YKM A;  2PYL A;  2G8H A;  2KTQ A;  4B3T K;  1QSS A;  1NGI A;  4EIA A;  3ZX0 A;  3RRG A;  1TAU A;  1YF5 L;  4IBN A;  3WXL A;  4AHC A;  4DSF A;  2F9W A;  2Q2R A;  1GOB A;  2O8C B;  2B5J A;  4CJ7 A;  5I3U A;  3ZSQ A;  3W3D A;  3A5O C;  1NGF A;  3I56 N;  4W5O A;  3UKR A;  4KI6 A;  4FZX C;  4JK7 A;  2NZT A;  3FFI A;  1NJX A;  1DLO A;  3AGR A;  3V6D A;  3IG1 A;  3M6G A;  3QFP A;  3QBW A;  2BTF A;  5EU7 A;  1M1K O;  3LP2 A;  3UKU A;  4FL9 A;  4JKF A;  1W2B M;  1XNQ K;  1NJY A;  2FBX A;  3ZX2 A;  1EWR A;  1NGH A;  3T1A A;  4IJA A;  1BHL A;  3KWI A;  4MDB A;  5BN9 A;  3SQ2 A;  4B8A B;  3KD5 E;  1EKE A;  1L3S A;  1Y64 A;  3DLG A;  2B4J A;  3MWP A;  3TAN A;  2D1K A;  1N5Y A;  3V1R A;  4WQ4 A;  1U45 A;  1HPM A;  2KZZ A;  4CD1 A;  4CZJ A;  4YOY A;  3AAP A;  2ASO A;  4XIU A;  4DTU A;  3PO4 A;  2A1R A;  4FLZ A;  3THX A;  3VMF B;  4DF8 A;  3SJH A;  1YJW N;  4OKK A;  1WBB A;  1OH7 A;  5AJ3 K;  2EX3 A;  4IG3 A;  3SI6 A;  5AZJ A;  4OLB A;  1WSG A;  4CEB A;  3IRX A;  3I33 A;  4C8N A;  4YOT A;  5F1X A;  3ZET B;  3J7A P;  2ZF5 O;  4M7Y A;  3SUN A;  3PY8 A;  2QWP A;  1RT2 A;  1ASV A;  2KZM A;  5GAE P;  1HQE A;  3SAF A;  4FWL A;  4JI0 K;  1ITG A;  3OYA A;  1R0A A;  5IWA K;  3KD1 E;  3OA9 A;  4CEO A;  4CIF A;  2XY5 A;  1BL3 A;  1QE1 A;  1HNW K;  4DKW A;  3NCI A;  1T44 A;  4O8K A;  1BIZ A;  1NLV A;  2GEL A;  4DS4 A;  1RBT A;  4BR5 A;  5HP1 A;  4F4K A;  1LWE A;  2ITG A;  4NLC A;  4C8K A;  4KHU A;  3B6P A;  4CZI A;  4N5S A;  3VQ8 A;  3S3N A;  2FBY A;  4PUO A;  4CJP A;  3F5T A;  3G25 A;  4BE0 A;  4KTQ A;  1Q82 O;  2BH1 A;  3SQ4 A;  4F2R A;  4GKK K;  1TK5 A;  3MEG A;  2GBZ A;  4IEI A;  3THW A;  4F9O A;  2FF6 A;  3NF8 A;  3L3V A;  5M1P A;  2E2N A;  3IKM A;  4NXN K;  2GX9 A;  2F4V K;  4IG0 A;  3LP3 A;  1G99 A;  4FZY A;  2UUC K;  4DSE A;  2P9I B;  3TU5 A;  4CJQ A;  2AP1 A;  1NGD A;  2P9L A;  4BRM A;  1HPZ A;  2PFU A;  2QEX N;  1RT6 A;  2IOC A;  4CJV A;  4X65 K;  3TAQ A;  2HHT A;  3AA5 X;  1NJZ A;  4FJL A;  3QER A;  3DLR A;  2O4I A;  1HRH A;  1IG8 A;  1VRU A;  1DKG D;  3VTI A;  2D0O A;  2ZGZ A;  2DY4 A;  3NVM A;  4FWR A;  3MEC A;  1QQO A;  2FBV A;  2BDP A;  4CER A;  1JCF A;  3RRH A;  1JL2 A;  3CJB A;  3NGZ A;  1CXQ A;  3HO1 A;  2A3Z A;  2YNH A;  2V7Y A;  1RIL A;  1VK0 A;  4XH1 A;  3L2R A;  3VQE A;  1CZ9 A;  1B92 A;  4AH9 A;  3JAM O;  3G10 A;  4DSL A;  4E1N A;  2IAJ A;  5AQG A;  3NGY A;  3T7Z A;  4FJ9 A;  3ZT1 A;  5AFU A;  1ASU A;  3CC2 N;  4DQR A;  5FDL A;  2E8A A;  1DTQ A;  3QIC A;  3VGM A;  4OPJ A;  3CXC M;  4B3S K;  3V4I A;  2J4R A;  2WOM A;  3ENH A;  3U8X A;  1GLL O;  3ZEU A;  3BDP A;  3ZSW A;  2QWQ A;  4O5F A;  2HHU A;  1IH7 A;  1H1V A;  4J2A A;  4IXC A;  1TKZ A;  1S6Q A;  4K8Z A;  4G1Q A;  4HHT A;  4NCG A;  4CEA A;  2QK9 A;  2X78 A;  1GLE G;  2ASM A;  3CFR A;  3A2F A;  4E89 A;  4LFB K;  1KAZ A;  3QEW A;  1CLQ A;  1GOA A;  5AQN A;  1WN7 A;  2E20 A;  1SKW A;  2OYQ A;  1JCE A;  5FPN A;  2G8F A;  1TK0 A;  1Y97 A;  3QO9 A;  4ILJ A;  1Q86 O;  2Y1I A;  4WQ5 A;  3IDH A;  3VEN A;  2KHO A;  2PZS A;  1TKX A;  4ID5 A;  4JK9 A;  4K42 A;  1VQ9 N;  3AV9 A;  4MQ3 A;  3CJA A;  5KPR A;  1X9J A;  3C6A A;  2E2Q A;  3I0R A;  4JI2 K;  4KHQ A;  5AQZ A;  2WBN A;  4WYB A;  4Y1D A;  4CBU A;  4N41 A;  5J2Q A;  2HNZ A;  4RG8 A;  3WXI A;  4JKG A;  4H5V A;  3LWL A;  1BUP A;  3K5N A;  5GIO A;  5JVG L;  3KVG A;  1C0M A;  4RCH A;  2P9P B;  2VGM A;  5KI6 A;  3SUO A;  3R3L A;  3VQP A;  2VGN A;  3LL3 A;  1NOZ A;  3VEV A;  4DR1 K;  3Q7B A;  5AR0 A;  2NRR A;  3NF7 A;  4JKD A;  1YVU A;  3OW2 M;  5HL7 L;  3F73 A;  1SS6 A;  3V9W A;  4O44 A;  2A42 A;  1BA0 A;  4JHD A;  3A5M C;  3JS6 A;  2KQ2 A;  1MDU B;  4DU3 A;  2CH5 A;  3M1F A;  1NU0 A;  4CZE A;  4J2B A;  1JJ2 M;  4IKF A;  1A5V A;  3C7N A;  4FLY A;  3DRP A;  3EKS A;  4DQ8 A;  2YKN A;  2P51 A;  5LJV A;  4WFA L;  3HSC A;  3QFU A;  3PUF A;  4B9N A;  3KTQ A;  3DLK A;  4FJI A;  4CEQ A;  3ASM A;  5M1K A;  5LMU K;  1T8E A;  3U4L A;  3KK7 A;  3ZSR A;  4A5A A;  4NCA A;  3D0P A;  3NMU A;  4B1V A;  4CF1 A;  2NRZ A;  3D7E O;  1U2V A;  3AVC A;  3RSE A;  3HVR A;  4M3Z A;  4PY5 A;  3CCM N;  1JLA A;  4CJE A;  2JGU A;  5DMR A;  3DLH A;  2P9N A;  5CZ2 A;  3THY A;  4Q0B A;  5J2M A;  4IZ9 A;  2O8D A;  1VAZ A;  5KRS A;  4CJ4 A;  4H5N A;  1X9W A;  2XY7 A;  1BIS A;  4PL7 A;  3UIQ A;  1JLE A;  2VG5 A;  4IO8 A;  1GOC A;  2NNW A;  4OVL A;  3IAY A;  1JKH A;  1KQS M;  3BF1 A;  4BVO A;  4RW6 A;  2QKB A;  4YOW A;  3OYD A;  1VQ8 N;  4QS8 A;  4F2S A;  1LW0 A;  1Q8I A;  2FLO A;  5C12 A;  1HUX A;  3PO5 A;  1C1C A;  2QWO A;  3T1H K;  3D2E B;  1JXE A;  3ZLJ A;  4DG1 A;  3VF6 A;  2KLA A;  3C95 A;  1RT5 A;  3CER A;  1UAX A;  1QSY A;  3VES A;  3CHW A;  4GVE A;  1NWK A;  4H0V B;  5BRH A;  1HNI A;  3N4Q A;  4CF9 A;  4NO7 A;  1KD1 O;  2UUB K;  4H4O A;  1BG3 A;  4M41 A;  2O8C A;  4DLE A;  3RR7 A;  4LF8 K;  2HF3 A;  3DLE A;  4X66 K;  1NOY A;  1X1P A;  2OPR A;  3ENB A;  1HKB A;  4I2P A;  3QML A;  1CZB A;  3ITH A;  3LPU A;  1W0H A;  4J2E A;  2A40 A;  3P38 A;  1C1B A;  3R6M A;  4DV3 K;  1FJG K;  4CF0 A;  3L8B A;  1P8Z A;  1L3U A;  4DU1 A;  1IJJ A;  3BF3 A;  4CIE A;  1S72 N;  1B9D A;  2BGG A;  1RBU A;  4HCB A;  3O80 A;  4O4G A;  1WLJ A;  4CK2 A;  3RMB A;  1SL2 A;  1BWF O;  1FK9 A;  2JLE A;  1VQO N;  3HM8 A;  1RGI A;  3MN7 A;  5FPD A;  4DSK A;  3RVC A;  4PA1 A;  1UA1 A;  3CYM A;  2W42 A;  5C2D A;  5AQM A;  1J54 A;  1IV0 A;  4WQ5 C;  3AY9 A;  5AQV A;  2RF2 A;  3D2F A;  1NK9 A;  4BVP A;  3OTO K;  3KKS A;  3LPT A;  4BRN A;  3N4P A;  5MLC Q;  3VEZ A;  2UYT A;  2D0P A;  4DSI A;  2HBL A;  2GV9 A;  4KI4 A;  4C1N K;  4FYD A;  3M5R A;  3LAN A;  1ZBL A;  1I39 A;  3AO4 A;  3HI0 A;  4CD3 A;  1GLA G;  3OYF A;  5EVZ A;  2VQE K;  3M8S A;  1ZBS A;  3CPE A;  3E9O A;  4NB4 A;  4OJR A;  3ATU A;  2FSK A;  3A8Y A;  1QTM A;  3HVT A;  3ZET A;  4FJM A;  3SUQ A;  3DOL A;  3M8P A;  4EHT A;  3FZF A;  4HTL A;  1YT3 A;  1WSH A;  3TR8 A;  4HUG A;  5HRS A;  3S3O A;  3C6H A;  3VQ9 A;  1O1W A;  4M45 A;  3NE6 A;  2VWJ A;  4AIL C;  3K5M A;  5KGX A;  2IC3 A;  4I9L A;  2GEM A;  2KFZ A;  4KHP K;  4BRI A;  3VER A;  4BE1 A;  1K8K B;  3I8D A;  4XH4 A;  1A5W A;  1NKB A;  4DV5 K;  3K0S A;  4KBO A;  1X3M A;  5CHI A;  1XWL A;  4K43 A;  4KAZ A;  4N76 A;  3SNN A;  1NGC A;  3ALY A;  2W6K A;  3I55 N;  3QLH A;  4JK8 A;  4BRH A;  3TI0 A;  3SBT A;  3KWG A;  3HPH A;  4IOA L;  5AZI B;  4B08 A;  1L5U A;  1IBM K;  3VEW A;  4B9T A;  3V9X A;  2ZJP L;  1J9A A;  4AHV A;  1S3X A;  2GWJ A;  5FPE A;  1ESV A;  2P9I A;  5SWM A;  3PX4 A;  4EFH A;  1NGG A;  3KK2 A;  3ID8 A;  5LMN K;  1Z26 A;  4LF9 K;  1TKT A;  4FJH A;  3FE1 A;  1WAJ A;  4BR9 A;  2PYJ A;  4FLX A;  2YHA A;  2P9S B;  3VQ6 A;  4BAC A;  3CCU N;  2GTD A;  2HW3 A;  4EAH D;  2VCP A;  5AQQ A;  3QEV A;  3L3U A;  4N47 A;  3BZC A;  1RT4 A;  3P31 A;  4CF2 A;  4WCE L;  3P1G A;  4DV2 K;  1QQM A;  1UOC A;  1KVC A;  1QZ5 A;  3TSU A;  4FJ7 A;  1T7P A;  3CJ1 A;  3VF4 A;  5KPZ A;  1U6Z A;  4U7B A;  4DR3 K;  3OYK A;  2HHV A;  4CZF A;  2AA4 A;  4KV8 A;  1VSK A;  3HTV A;  3AO5 A;  3K58 A;  1NKC A;  4DB3 A;  1ZXO A;  2HHQ A;  3SLC A;  4CJU A;  3ENO A;  4DUZ K;  1QHA A;  3O6W A;  1RTJ A;  4R5P A;  4JI4 K;  4JI5 K;  1KCF A;  1HJR A;  5LL6 Z;  3VQB A;  2YV0 X;  4HTU A;  3AO2 A;  1TYQ A;  3FR0 A;  1ZBU A;  1QVF M;  4ICL A;  3CG7 A;  3DI6 A;  3WNH A;  4Z4E A;  5KGW A;  3LP0 A;  3MMV A;  4E7K A;  3NF6 A;  4B9M A;  4CHN A;  4DTN A;  1LCU A;  4BE2 A;  4C23 A;  2ITM A;  4BR0 A;  3K2P A;  4FO0 A;  4BG9 A;  5CE3 A;  4DV1 K;  1A5X A;  1GLF O;  4DTP A;  2E4L A;  2A6A A;  4CVN E;  4CIG A;  3KHY A;  5KQD A;  2XO7 A;  3QEX A;  1YUW A;  4YDU A;  3AVM A;  3OYL A;  4DR2 K;  4B3O A;  4DLG A;  3C6U A;  1K73 O;  4LH5 A;  3WUH A;  2IIR A;  2KFN A;  3W0L A;  5I42 A;  3MN5 A;  1WSI A;  1HNV A;  1KXP A;  4Z0U A;  2YNF A;  4GV3 A;  3HP6 A;  3U3Y A;  1D8Y A;  4CGD A;  1BQN A;  3RMA A;  1RDB A;  3VEX A;  2Z1H A;  3KLE A;  1WB9 A;  2NRX A;  4Z4G A;  2W6L A;  3OYB A;  4C1N I;  5EY4 A;  3EO3 A;  4QS9 A;  3PV8 A;  1EQY A;  3CF5 L;  1IKW A;  4JKA A;  3NAE A;  3QIN A;  3K5O A;  4C8M A;  3MXI A;  5HOO A;  2WTU A;  1YJN N;  2Z1J A;  4X64 K;  2ZQB A;  1V4T A;  4KFB A;  1MA9 B;  3G4S N;  3RR8 A;  4NCB A;  4BDP A;  1GLC G;  2W40 A;  4JKC A;  2X6S A;  1R59 O;  4CJF A;  4CZM A;  5SZT A;  3DLB A;  1N32 K;  2KKZ A;  4BRF A;  2QA4 N;  1YIT N;  2YHY A;  5BR9 A;  5C10 A;  5CYM A;  1DEJ A;  1HKG A;  4F3T A;  2P9P A;  2OTJ N;  3P39 A;  2QWL A;  3TAG A;  1JLC A;  2WUS A;  2G8W A;  3NH0 A;  3U9Z A;  3CJ7 A;  1DGK N;  4DV0 K;  2VWB A;  3CMA N;  3LAM A;  3S41 A;  2V7Z A;  4ELT A;  3NF9 A;  4M3U A;  4FCY A;  4C8O A;  5M1N A;  3QEP A;  2NUB A;  2O8F B;  1FKP A;  3BP8 A;  3VEO A;  2D5R A;  3LP1 A;  3ZSX A;  1VQN N;  2Q3S A;  1LAV A;  4Q5V A;  2I5J A;  1TL3 A;  3VOV A;  3HM9 A;  2G8I A;  4B9L A;  1SZ2 A;  4DSJ A;  1VQ7 N;  3DLL L;  2Z1G A;  1LAW A;  3TPQ A;  3ULD A;  3AVN A;  5JVH L;  2Q97 A;  4LSN A;  2P9K B;  4CBX A;  2UUA K;  3J80 O;  3QB0 A;  4FM2 A;  3VA0 A;  2Q1N A;  3ZT3 A;  4ISG A;  3C0B A;  1HYZ A;  3V81 A;  5EOY A;  4B9U A;  4ID1 A;  4CGH A;  1IKX A;  5C42 A;  4BQL A;  3PIP L;  4FWO A;  1W97 L;  5FRO A;  3DWL A;  3L6Q A;  2UXB K;  3EKU A;  4B3M K;  4OX9 K;  2AJQ A;  4DV7 K;  3PIO L;  3WEE A;  3SK3 A;  3QES A;  2NRW A;  3H46 O;  1BO5 O;  5IT9 O;  3QBX A;  3V9Z A;  2YX6 A;  4AF1 A;  3TAP A;  5BN8 A;  4RTF D;  2YHW A;  2HND A;  2HMP A;  5DM6 L;  4DS5 A;  1BCM A;  4Y0W A;  4U67 L;  3ZX3 A;  4KHW A;  3OBY A;  3L2U A;  2O8B B;  1KFD A;  3AVB A;  4ISE A;  4YNQ A;  4YOV A;  3CD6 N;  4NYF A;  1DTT A;  5CYQ A;  3VF2 A;  4CEF A;  3FGU A;  3OJU A;  3DRR A;  1EO1 A;  3PSI A;  3VQQ A;  3MEE A;  1KVB A;  1IBL K;  1XMO K;  4CEC A;  4B3R K;  3P5J A;  3D2E A;  4DHY A;  1YI2 N;  4A59 A;  4GMJ B;  4FWP A;  4M63 C;  3OYJ A;  2OA8 A;  1EXQ A;  4AM7 A;  3CM6 A;  3WQU A;  1TV6 A;  1S1X A;  4BRP A;  4L3Q A;  3EZ5 A;  5AQF A;  4LY7 A;  3H3O B;  4CF8 A;  2A5X A;  3UKR B;  4DR7 K;  3AA3 A;  3VQD A;  2OPQ A;  4E0D A;  4YOU A;  2RN2 A;  3CJC A;  1MWM A;  3HBT A;  3QNO A;  4RW4 A;  4IFY A;  3S3M A;  3FLC O;  2UXC K;  3SMS A;  3SBG A;  4NLB A;  3WXM B;  3CQX A;  2P9U B;  3AO3 A;  2UXD K;  4MO5 A;  4ISF A;  4YDU C;  3WNF A;  4DMN A;  1C0T A;  4J8F A;  4FK4 A;  4FJK A;  3E01 A;  4FVU A;  2B6A A;  4NYN A;  4BRA A;  1C0F A;  1U49 A;  3H45 C;  4GNI A;  4KHN A;  4MLH A;  4CED A;  2FSN A;  3KK3 A;  3GG4 A;  3R1X A;  3G71 N;  1RTI A;  4QS7 A;  4LSL A;  4WQ4 C;  5E41 A;  1VSH A;  2FC0 A;  2PY5 A;  1J53 A;  3OYH A;  4BGB A;  2QM1 A;  2ZM6 K;  3KKR A;  5AQR A;  1NK0 A;  3U9D A;  3AVJ A;  1YXQ A;  2HBK A;  2R7Y A;  3L0Q A;  4H0T B;  5GAH P;  4BRL A;  4FJX A;  2IDO A;  2HVI A;  5BPL A;  4DFM A;  4BDZ A;  1VSF A;  5B8H A;  2O8E A;  4PL8 A;  4LC9 B;  5ELZ A;  2G8K A;  4WFB L;  3NHG A;  3O4Q A;  3FZK A;  3O8M A;  2NRH A;  2VWK A;  4H0P A;  3OYE A;  4MO4 A;  5T7B A;  3LM9 A;  4H0O A;  1BGX T;  1RFQ A;  3SUP A;  2Z1I A;  4FK0 A;  2YNI A;  1IKV A;  3F9K A;  4A5B A;  1J5O A;  2HVH A;  2LSN A;  4CGG A;  2ZJQ L;  3A0I X;  1U04 A;  4CCH A;  1HR0 K;  2IGI A;  5AQY A;  3WT0 A;  1XC3 A;  4H03 B;  5HBM A;  3U3G A;  1K8K A;  4DF4 A;  1TAQ A;  5AQW A;  4DTJ A;  4BG8 A;  4FPB A;  4ZTJ A;  3WXK A;  2EHG A;  2QI2 A;  3EE8 A;  1LV5 A;  5BPN A;  1YJ9 N;  1RTD A;  4KTZ A;  3D6R A;  1RT7 A;  5AQO A;  3THW B;  5EX5 A;  3K9J A;  2DTU A;  3HZ6 A;  2GUP A;  4KB1 A;  1HJO A;  4FSV A;  3E9P A;  1ATN A;  2HOE A;  1VSL A;  1O13 A;  4B1U B;  1KAX A;  4K41 A;  3AGK A;  4FM0 A;  4DCH A;  4CJR A;  1HYV A;  1VQP N;  4CZK A;  4E7L A;  2HBJ A;  4GVM A;  3R9P A;  4HCC A;  1BA1 A;  4XEI A;  4OO1 J;  1TUU A;  3HPG A;  4FXD A;  5AQP A;  4RW9 A;  4IWV A;  1HNZ K;  2KW4 A;  4G9Z A;  4BR2 A;  3JXU A;  5AFU H;  2ETJ A;  4JKE A; 
#chains in the Genus database with same CATH homology
 3HPH A;  4Z4H A;  4DFJ A;  3SUN A;  3PY8 A;  4Z4F A;  1XI1 A;  5JS1 A;  1RT2 A;  3HL8 A;  4B08 A;  1L5U A;  1JLB A;  1ASV A;  3DMJ A;  1CLQ A;  4B9T A;  2KZM A;  3V9X A;  1J9A A;  2F96 A;  1SUQ A;  4AHV A;  3RMD A;  1HQE A;  4FJ5 A;  4KRF A;  3PX6 A;  3SV4 A;  1ITG A;  3T3F A;  1K6Y A;  3C6T A;  3OYA A;  4B9S A;  3C94 A;  1R0A A;  3KD1 E;  5J1E A;  5SWM A;  3PX4 A;  3SJJ A;  3KK2 A;  3S9H A;  4CJW A;  1W9H A;  5HRR A;  4H8K A;  4CEO A;  4CIF A;  3WNE A;  1Z26 A;  1TKT A;  4FJH A;  2XY5 A;  1BL3 A;  1QE1 A;  3SCX A;  1WAJ A;  3THV A;  2PYJ A;  4FLX A;  2YHA A;  3NCI A;  3VQ6 A;  1BIZ A;  4BAC A;  4DS4 A;  1IG9 A;  1RBT A;  1RDA A;  4AHU A;  5HP1 A;  2HW3 A;  4W5R A;  2RKI A;  4F4K A;  1LWE A;  2ITG A;  3CM5 A;  4C8K A;  4KHU A;  3QEV A;  3B6P A;  3L3U A;  4O0I A;  4N47 A;  3VQ8 A;  4N5S A;  1RT4 A;  3S3N A;  2FBY A;  4PUO A;  4CF2 A;  3OYG A;  1XHZ A;  3P1G A;  4CJP A;  1UOC A;  1KVC A;  4BE0 A;  4FJ7 A;  1T7P A;  4I7F A;  3HK2 A;  5C25 A;  3RWU A;  4HVJ A;  1ZYQ A;  1VSM A;  4CJK A;  4N56 A;  4KTQ A;  3OYK A;  4J2D A;  3SQ4 A;  3ISN C;  4F2R A;  5JS2 A;  3VQ5 A;  4KB0 A;  1TK5 A;  3MEG A;  2HHV A;  4KV8 A;  1VSK A;  2GBZ A;  3VQ7 A;  2P1J A;  3AO5 A;  3K58 A;  1Z25 A;  3NF8 A;  4CHQ A;  1D9D A;  3L3V A;  3ZCM A;  1NKC A;  4IG0 A;  4E7I A;  3LP3 A;  1TKD A;  2HHQ A;  4FZY A;  2ZE2 A;  3KJV A;  4E3S A;  1SL1 A;  1FXX A;  1RDC A;  4DSE A;  4MFB A;  4CJU A;  4CJQ A;  4EP5 A;  1QQC A;  4R5P A;  1RTJ A;  1U48 A;  3T19 A;  3M8R A;  4EZ9 A;  1KCF A;  1HJR A;  3VQB A;  4FLW A;  1HPZ A;  2ATQ A;  4F8R A;  2YV0 X;  4HTU A;  5FRN A;  3AO2 A;  4DQI A;  1SKS A;  1RT6 A;  1HYS A;  1ZBU A;  2IOC A;  4CJV A;  3TAQ A;  1D9F A;  2HHT A;  4ICL A;  3CG7 A;  3DI6 A;  3WNH A;  4Z4E A;  5KGW A;  2E6L A;  3AA5 X;  3LP0 A;  4E7K A;  3NF6 A;  4B8C A;  1NJZ A;  4B9M A;  5HRO A;  4CHN A;  3QER A;  4FJG A;  3DLR A;  4DTN A;  3U6F A;  1S1U A;  1HRH A;  4FJL A;  2O4I A;  1VRU A;  4BE2 A;  1VSI A;  3K2P A;  1EP4 A;  1F21 A;  3ZSY A;  1U47 A;  2DY4 A;  3LZI A;  4ELV A;  1A5X A;  4DTP A;  3MEC A;  2E4L A;  4CGI A;  4H4M A;  2FBV A;  4E7J A;  4AHS A;  1ASW A;  1CXU A;  4CER A;  1TL1 A;  3RRH A;  4CIG A;  2BDP A;  2HHX A;  1WNS A;  1JL2 A;  3NGZ A;  2XO7 A;  3QEX A;  4KHY A;  3AVM A;  3OYL A;  4B3O A;  1CXQ A;  3C6U A;  1MU2 A;  4DLG A;  4LH5 A;  4ZHR A;  5J2P A;  3HO1 A;  2F8S A;  1VSJ A;  2KFN A;  3MXJ A;  2YNH A;  1RTH A;  1S1V A;  5I42 A;  1IKY A;  1WSI A;  1HNV A;  1RIL A;  4Z0U A;  2YNF A;  3OY9 A;  1VK0 A;  2DFH A;  3ZT2 A;  3HP6 A;  3L2R A;  3U3Y A;  1D8Y A;  4CGD A;  4M3X A;  3AVH A;  1BIU A;  1CZ9 A;  1B92 A;  3VQE A;  1BQN A;  1D5A A;  1EET A;  4AH9 A;  3G10 A;  4DSL A;  3RMA A;  1RDB A;  4E1N A;  2Z1H A;  3KLE A;  2IAJ A;  4Z4G A;  3L2V A;  4DTM A;  3PX0 A;  4OKE A;  3NGY A;  4FLU A;  3OYB A;  4FJ9 A;  1NK5 A;  3PV8 A;  5HRN A;  3ZT1 A;  4BWJ A;  1HMV A;  4EZ6 A;  1ASU A;  3DYA A;  1IKW A;  4DQR A;  1JLQ A;  3QIN A;  5FDL A;  3K5O A;  3NAE A;  4DFP A;  4C8M A;  4C8L A;  3MXI A;  1DTQ A;  2DFE A;  4OPJ A;  1U4B A;  2Z1J A;  3V4I A;  3QIP A;  4FJN A;  4M3T A;  2ZQB A;  2WOM A;  4KFB A;  3BGR A;  1KLM A;  2E6M A;  4TSX A;  4OPK A;  3BDP A;  3ZSW A;  3TAF A;  3SQ0 A;  3CFP A;  3RR8 A;  4NCB A;  4BDP A;  4CHO A;  3LAK A;  3OJS A;  2HHU A;  2X6S A;  5SZT A;  4CJF A;  1IH7 A;  3DLB A;  2O4G A;  3AVG A;  4J2A A;  1NKE A;  1TKZ A;  1X9S A;  5KRT A;  3QET A;  1S6Q A;  3ZSZ A;  2XY8 A;  3B6O A;  4G1Q A;  4HHT A;  2P5O A;  1S1W A;  4K8Z A;  4NCG A;  5KTQ A;  4W5N A;  4CEA A;  5CYM A;  4OGC A;  5J2N A;  2QK9 A;  2X78 A;  1T05 A;  1BCO A;  2HHS A;  4CES A;  4F3T A;  3CFR A;  3A2F A;  4E89 A;  1YTU A;  3HYF A;  4HUF A;  3QEW A;  3KLH A;  3TAG A;  1JLC A;  3NBP A;  4IFV A;  1GOA A;  3NH0 A;  2G8W A;  2HMI A;  4OLA A;  1WN7 A;  1SKW A;  2OYQ A;  4IDK A;  3KLG A;  4CHY A;  2G8F A;  4UQG A;  3LAM A;  1TK0 A;  1Y97 A;  4FM1 A;  3V1O A;  1WSJ A;  4ELT A;  1KFS A;  3NF9 A;  4M3U A;  1JLG A;  4KRE A;  3QO9 A;  2OPS A;  4FCY A;  4C8O A;  3NGI A;  3QEP A;  2NUB A;  3SPZ A;  4EP4 A;  4JS4 A;  1FKP A;  3AVF A;  2XY6 A;  2Y1I A;  2D5R A;  4FW2 A;  3LP1 A;  3NFA A;  3ZSX A;  4CFB A;  2PZS A;  1TKX A;  3AVI A;  4ID5 A;  4KTW A;  2OPP A;  1RCH A;  3AV9 A;  1RDD A;  2Q3S A;  3NDK A;  4MQ3 A;  1LAV A;  3KK1 A;  4CHP A;  3I0R A;  2D0B A;  4Q5V A;  2I5J A;  1TL3 A;  3O3G A;  4KHS A;  4CGF A;  4KHQ A;  3VQ4 A;  3HM9 A;  2G8I A;  4Y1D A;  1RBR A;  3SZ2 A;  4B9L A;  4DSJ A;  3HJF A;  1TAU A;  2Z1G A;  1LAW A;  3ULD A;  2Y1J A;  3AVN A;  4N41 A;  4AHR A;  2HNZ A;  4RG8 A;  4JRP A;  5J2Q A;  4M42 A;  4JS5 A;  4FVM A;  4LSN A;  3LWL A;  3K5N A;  3MAQ A;  4ZTF A;  3TAB A;  1C0M A;  1JL1 A;  4DTO A;  2D0C A;  5KI6 A;  2DFF A;  3SUO A;  1BQM A;  2XHB A;  1TGO A;  3VQP A;  3MED A;  4LH4 A;  3NH2 A;  4FM2 A;  4KKO A;  3VA0 A;  1JXB A;  3ZT3 A;  1KLN A;  1KRP A;  1HYZ A;  1NOZ A;  2P5G A;  3V81 A;  2RPI A;  4B9U A;  4ID1 A;  3ZT0 A;  4CGH A;  4RW7 A;  1IKX A;  5C42 A;  1C6V A;  3NF7 A;  4DTX A;  4RW8 A;  4CFC A;  1YVU A;  2G8U A;  5DK5 A;  3F73 A;  4M3Y A;  3V9W A;  4O44 A;  4QAG A;  1RBV A;  5FRO A;  4DQS A;  4QCL A;  1NJW A;  3CQ8 A;  2KQ2 A;  1NK6 A;  3KLI A;  4DU3 A;  1NK7 A;  2AJQ A;  3SQ1 A;  4J2B A;  1FKO A;  3QES A;  3K59 A;  3K5L A;  4IKF A;  1QHT A;  4BWM A;  1S1T A;  4I2Q A;  1A5V A;  3TAE A;  3V9Z A;  3L2Q A;  4FLY A;  3DRP A;  1KVA A;  1BI4 A;  3TAP A;  2YKN A;  2HND A;  2P51 A;  4CJS A;  5D3G A;  3V9S A;  1S9G A;  1KTQ A;  3HST B;  4DS5 A;  4F3O A;  3PUF A;  1BCM A;  3OVN A;  3AVA A;  3KLF A;  3KTQ A;  3DLK A;  4CHZ A;  1B9F A;  2IS3 A;  3SV3 A;  4B9N A;  5CY4 A;  4FJI A;  1XHX A;  4KHW A;  3L2U A;  1KFD A;  3AVB A;  4CE9 A;  4CEQ A;  3TWH A;  3ASM A;  4YNQ A;  3NH1 A;  1RNH A;  4NYF A;  1T8E A;  1DTT A;  2QKK A;  5CYQ A;  3OS2 A;  2HB5 A;  3ZSO A;  3EY1 A;  1LW2 A;  4CFA A;  3ZSR A;  4NCA A;  3D0P A;  1S6P A;  1WAF A;  4GW6 A;  4CEF A;  4E1M A;  2OZM A;  3OJU A;  4LD0 A;  3DRR A;  4CF1 A;  4JRQ A;  5HLF A;  3JYT A;  1LWF A;  4E19 A;  4YFU A;  1RT3 A;  3AVC A;  1KVB A;  3MEE A;  3VQQ A;  3HVR A;  1TK8 A;  4KPY A;  4CEC A;  4M3Z A;  4PY5 A;  3P5J A;  1Q9Y A;  1JLA A;  4CJE A;  3MXM A;  2JGU A;  4FW1 A;  1REV A;  4GMJ B;  5DMR A;  4CGJ A;  3OYJ A;  3EYZ A;  2OA8 A;  5CZ2 A;  3DLH A;  1EXQ A;  3TAM A;  4CJL A;  5C24 A;  4Q0B A;  3CM6 A;  3AVL A;  5J2M A;  4OKJ A;  3DOK A;  3LAL A;  2D0A A;  1TV6 A;  5CZ1 A;  4WE1 A;  4CEE A;  3KIO A;  4Z4C A;  5KRS A;  1S1X A;  4CJ4 A;  2G8V A;  1BI4 B;  1VRT A;  3ZT4 A;  3EZ5 A;  4FJ8 A;  1SV5 A;  4LY7 A;  1X9W A;  4CF8 A;  2XY7 A;  4DQQ A;  1BIS A;  2BE2 A;  3UIQ A;  3AA3 A;  3VQD A;  2OPQ A;  3L2W A;  1JLE A;  2VG7 A;  2VG5 A;  2RN2 A;  3O3H A;  1GOC A;  4E0D A;  1RBS A;  3AVK A;  3QNO A;  2BAN A;  4RW4 A;  1WSE A;  4IFY A;  3S3M A;  4W5T A;  4DWI A;  1ZBI A;  4OVL A;  1I3A A;  3IAY A;  1JKH A;  4M3R A;  4JLH A;  1SL0 A;  3AO3 A;  3QIO A;  4O55 A;  4RW6 A;  4DFK A;  4FZZ A;  3OYD A;  2QKB A;  3V9U A;  2OZS A;  3HT3 A;  4F2S A;  3WNF A;  1LW0 A;  1Q8I A;  3G0Z A;  1T03 A;  4DMN A;  1EX4 A;  3LDS A;  4CJ5 A;  1C0T A;  4FK4 A;  1JLF A;  3PO5 A;  2HHW A;  4FJK A;  1C1C A;  3D45 A;  3E01 A;  1VSD A;  3AA4 A;  2B6A A;  4NYN A;  1JXE A;  4Y1C A;  1X9M A;  1U49 A;  4FLV A;  4DG1 A;  4K8X A;  4KHN A;  3C95 A;  3I0S A;  3AA2 A;  1RT5 A;  2XRI A;  4CED A;  3TAR A;  1UAX A;  4W5Q A;  1QSY A;  3LZJ A;  3KK3 A;  1HNI A;  1RTI A;  4CF9 A;  4DTR A;  3AO1 A;  4LSL A;  5E41 A;  1VSH A;  4AHT A;  3OS0 A;  3RTV A;  2FC0 A;  2PY5 A;  4H4O A;  3M8Q A;  1J53 A;  4CK1 A;  1NK4 A;  3OYH A;  1LWC A;  4M41 A;  1IO2 A;  3RMC A;  4DLE A;  3RR7 A;  4QOZ B;  1TVR A;  3DLE A;  3KKR A;  1NK0 A;  1NOY A;  4KO0 A;  1X1P A;  3AVJ A;  2OPR A;  3H08 A;  4O5B A;  4CK3 A;  1C0U A;  4I2P A;  3ZSV A;  4DTS A;  1UA0 A;  2R7Y A;  2WON A;  1CZB A;  3ITH A;  3LPU A;  3OYN A;  1W0H A;  2YNG A;  4J2E A;  3O4N A;  3HP9 A;  3VN5 A;  1C1B A;  4CFD A;  4CF0 A;  1XC9 A;  4CJT A;  4FJX A;  3L8B A;  3V1Q A;  4DU4 A;  4FLT A;  1L3U A;  4DU1 A;  1L3T A;  2IDO A;  3QNN A;  2HVI A;  4CIE A;  1HQU A;  4BDZ A;  4DFM A;  1B9D A;  3VQA A;  1RBU A;  4DQP A;  4HCB A;  2BGG A;  1VSF A;  4O4G A;  1WLJ A;  4CK2 A;  1QS4 A;  3RMB A;  1G15 A;  2YKM A;  2PYL A;  2FBT A;  1SL2 A;  1UWB A;  3IS9 A;  1FK9 A;  2X74 A;  2ZD1 A;  2G8H A;  2JLE A;  4BDY A;  2KTQ A;  2QXF A;  2G8K A;  4DSK A;  1QSS A;  5K14 A;  4FK2 A;  4O0J A;  4PA1 A;  3RRG A;  1L3V A;  3NHG A;  4AHC A;  3CYM A;  3O4Q A;  4IBN A;  2W42 A;  4DSF A;  1UA1 A;  2F8T A;  1GOB A;  2B5J A;  1J54 A;  2VWK A;  5I3U A;  3OYE A;  4E7H A;  3ZSQ A;  5T7B A;  2HNY A;  3OYM A;  1BGX T;  3SUP A;  2RF2 A;  2Z1I A;  4FK0 A;  2YNI A;  4L8R B;  1IKV A;  3HPO A;  4W5O A;  1NK9 A;  3F9K A;  2VG6 A;  1J5O A;  4KI6 A;  4FZX C;  3KKS A;  4ELU A;  2HVH A;  1C1A A;  2LSN A;  3FFI A;  4CEZ A;  3K57 A;  1NK8 A;  4CGG A;  1DLO A;  1NJX A;  3LPT A;  3V6D A;  3IG1 A;  1U04 A;  4CCH A;  3P83 D;  3QEI A;  1N6Q A;  5EU7 A;  1ZBH A;  3OS1 A;  4B9V A;  3LP2 A;  4DSI A;  2IGI A;  2GV9 A;  4KI4 A;  5HRP A;  4FYD A;  3LAN A;  1ZBL A;  1QSL A;  5HBM A;  1I39 A;  3U3G A;  3OYI A;  2GUI A;  3AO4 A;  4DF4 A;  1TAQ A;  3DRS A;  4DTJ A;  3OYF A;  4ZTJ A;  3HXM A;  2FBX A;  1NJY A;  1WSF A;  2EHG A;  4CJ3 A;  1LV5 A;  3M8S A;  3T1A A;  3JSM A;  1RTD A;  4Z4I A;  4KTZ A;  1RT7 A;  4OJR A;  2DTU A;  1YTA A;  1QTM A;  1BHL A;  3HVT A;  3SQ2 A;  2YHB A;  3LWM A;  4KB1 A;  4B8A B;  4FJM A;  3SUQ A;  3KD5 E;  1EKE A;  3DM2 A;  3DOL A;  3M8P A;  3VQC A;  3SPY A;  1L3S A;  3DLG A;  1YT3 A;  2B4J A;  1WSH A;  4PQU A;  1VSL A;  3TR8 A;  4HUG A;  5HRS A;  3S3O A;  1VSE A;  3OYC A;  4M3W A;  4PWD A;  3TAN A;  1RT1 A;  1Q9X A;  3VQ9 A;  4OGE A;  3SYZ A;  1O1W A;  3V1R A;  4M45 A;  3NE6 A;  2VWJ A;  1U45 A;  1N5Y A;  2KZZ A;  4AIL C;  4FM0 A;  3K5M A;  1S9E A;  4CJR A;  1HYV A;  5KGX A;  3VA3 A;  2IC3 A;  4I9L A;  2KFZ A;  4E7L A;  1S5J A;  3O3F A;  2X6N A;  4GVM A;  4BE1 A;  3I8D A;  4XIU A;  4DTU A;  1A5W A;  3PO4 A;  1NKB A;  2A1R A;  4FLZ A;  1SKR A;  4DF8 A;  4HCC A;  4I9Q A;  3CFO A;  4OKK A;  2EX3 A;  1XWL A;  4IG3 A;  4KAZ A;  3HPG A;  3SI6 A;  4OLB A;  1WSG A;  3SNN A;  4HUE A;  4N76 A;  4FXD A;  4FJJ A;  4RW9 A;  3ALY A;  2A1S A;  4CEB A;  3QLH A;  3WNG A;  5FRM A;  3TI0 A;  3IRX A;  4C8N A;  2KW4 A;  1ZBF A;  1KSP A;  2ETJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...