4CF9A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
154
structure length
150
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 54
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cf9A00
3KK1A 1NK8A 1U4BA 4DTOA 4FZYA 2IC3A 3V1QA 1RT7A 2G8IA 1ZYQA 2HHUA 4W5TA 3TR8A 1DLOA 2IDOA 2WONA 3H08A 4CJRA 2Z1IA 2F96A 2X6SA 1LWFA 5J2PA 4B9MA 4RW9A 1UAXA 5HBMA 5J2MA 4O0JA 3AA4A 2G8KA 4J2AA 4M45A 4KAZA 1RTDA 2Q3SA 1J53A 2ITGA 5FDLA 1JXEA 3V1OA 1JLAA 2B4JA 2BE2A 1EP4A 4KRFA 2HVHA 1RILA 4IG3A 5KTQA 4IG0A 3OYMA 4F2SA 1NJXA 4CFCA 2IAJA 1JLGA 4FM2A 1D9DA 3L8BA 3KLHA 2GBZA 4AHCA 3LP2A 4CJQA 3B6PA 4BE1A 2XY6A 1ZBLA 4CEDA 1S1WA 3QNNA 3K5MA 1QSLA 4E7LA 3OYBA 2HW3A 3QEPA 4AHUA 4FLXA 1CXUA 1I39A 2OZSA 3ZCMA 4I9QA 1SV5A 2FBXA 3LWLA 3V9UA 1BHLA 3VN5A 2X78A 4FK2A 3TWHA 1D8YA 3IAYA 2P1JA 1J5OA 3BDPA 4FJXA 3DLGA 3KLIA 1NOYA 3ULDA 2QKKA 4KI4A 4M3UA 1S5JA 2G8HA 1KVCA 4CJ4A 1SKWA 5SWMA 3T1AA 1TGOA 5KGXA 1QSSA 4KB0A 1RT4A 1TL1A 3MAQA 4KHNA 4M3XA 3HK2A 4JRQA 1WLJA 4RW4A 2QK9A 1VSMA 3CM5A 4N5SA 3JSMA 4QOZB 4PUOA 4I2QA 4B9VA 1B9FA 3V1RA 4CF2A 3SYZA 4DSLA 3OYCA 3QETA 4FLYA 4Z4CA 5KGWA 4CJTA 3RMAA 2HNDA 4DLEA 3OVNA 1ITGA 4HCBA 3DMJA 2KFNA 3VQAA 3SQ2A 1IKXA 3KD5E 1VSHA 1HMVA 4O55A 1RDBA 3AVFA 4B9SA 1L3SA 2RN2A 4AHSA 4M3WA 5FROA 2OA8A 3HXMA 4CEFA 4KHUA 1RBSA 1GOBA 4ELVA 1FK9A 2HHVA 3NBPA 2XY8A 4JS5A 4BACA 1RDAA 4GW6A 3DYAA 1IH7A 4NYNA 1VSDA 1S1TA 4OPJA 3MEEA 2OYQA 2IS3A 3L2VA 4CK1A 2G8WA 3G0ZA 3LPUA 3M8QA 4CGDA 4C8LA 3L3UA 3VQPA 3AA5X 4KFBA 3NHGA 4E89A 3SUOA 2ATQA 4W5NA 3AO3A 2HNZA 3AVJA 4FJJA 4YFUA 1XHZA 5J2NA 1C6VA 3MXMA 3V6DA 4B9UA 3DRRA 3T19A 2GUIA 3OJUA 1GOCA 1RBRA 2VWKA 4E0DA 1TK0A 1B92A 4ID1A 3L3VA 4FLZA 3SUPA 3NFAA 3V4IA 4ELUA 2KZMA 4CF8A 1A5VA 3K5NA 4Z4FA 3P5JA 3IS9A 4LY7A 1RT5A 4AILC 3RRGA 5D3GA 4FM0A 3PUFA 3OYDA 1WSEA 2DFEA 4CEBA 4M3ZA 1IKVA 4FJ8A 1VRUA 4IKFA 2WOMA 2PYLA 4DQIA 1RDDA 3PX6A 1LV5A 3V81A 3PX0A 3EY1A 4Y1CA 4CHOA 4KHWA 4H8KA 4DTXA 2OPRA 3QO9A 1Y97A 4CF1A 1L3UA 3NF9A 3NF6A 3HVRA 4JS4A 2EX3A 2QXFA 2XY5A 5HP1A 1U45A 1HNVA 4CJVA 4OPKA 3D0PA 1BISA 4UQGA 3LPTA 3QEWA 4CGHA 1L5UA 1UWBA 4M3TA 5HRSA 3ZSYA 4CHZA 1W0HA 4FZZA 3D45A 4FLUA 4C8KA 3SZ2A 1JLCA 3P1GA 4CJPA 3OYKA 5T7BA 3ZSXA 3SCXA 1LWCA 3TAPA 1Q9XA 3HT3A 3RTVA 5SZTA 4FYDA 3BGRA 2B6AA 2KTQA 3OYLA 4CF9A 1QSYA 4GMJB 4FCYA 3QIPA 2HHSA 2AJQA 3VQ9A 2P5OA 4YNQA 1TK8A 5CYMA 3LANA 3LDSA 1L3VA 1G15A 4CFAA 4GVMA 4CGJA 1VSIA 3TANA 2E6MA 3EZ5A 2P51A 1QTMA 3CFPA 4F4KA 3KK3A 3AVIA 3DLKA 3SI6A 4DFJA 3ALYA 1IG9A 1TAUA 3PV8A 4F2RA 5HLFA 4DTMA 3NF7A 4R5PA 4FM1A 1BIZA 1WSGA 1TAQA 1RCHA 3HL8A 1EX4A 4FW2A 1Q9YA 3K57A 1N5YA 1T05A 3FFIA 3OYGA 4DU4A 2HHXA 4BWJA 5I3UA 1O1WA 3S3MA 1S6QA 3KKSA 3SPZA 4OLBA 4CGGA 3VA3A 1S1UA 4FK0A 3ZSOA 1T03A 1L3TA 4CJ3A 1YT3A 2YKMA 4F3OA 1EETA 3L2RA 4CJLA 2NUBA 3AVNA 3ZT2A 5KI6A 2DFHA 1C0UA 1SUQA 3CG7A 3AO1A 4QAGA 5E41A 3K58A 3PO5A 3VQ8A 3SUNA 1RT1A 1KCFA 1ZBIA 4ELTA 3G10A 1WN7A 2O4IA 3AO5A 4CF0A 3NH1A 1ASWA 1RT3A 4DTNA 3RRHA 1NK7A 3KIOA 4ID5A 4FJNA 2OZMA 3ZSRA 3DLRA 3U6FA 4BDZA 5CZ2A 3PY8A 2IOCA 4B3OA 3SQ0A 4DTPA 3C6TA 1HPZA 1HYZA 4O44A 1LAWA 1NKBA 3M8PA 3O3HA 1HYSA 3MXJA 1SL2A 2HB5A 3ZSWA 1VSKA 1X9SA 4DSJA 3L2UA 4IDKA 4DSKA 4EZ6A 3I8DA 4LSNA 1C1CA 2FC0A 4M41A 3VQ6A 4DFPA 3TAFA 3DRPA 1I3AA 2YNHA 4OGEA 5JS1A 3SUQA 1WSFA 4M42A 4CGFA 2VWJA 4KI6A 4KREA 4DF8A 2DY4A 3DLHA 1SL0A 2HHQA 4H4OA 3OYFA 2FBYA 1KLMA 3KK2A 1WSIA 4B9TA 1VSLA 4FJMA 4Z4GA 4OKKA 3DOKA 2X74A 1FXXA 4CJWA 3QEVA 1D5AA 3L2WA 1S9EA 4OVLA 4AHVA 3DLEA 4CESA 1TV6A 4OJRA 3LZIA 3ZT0A 4AHRA 1C1BA 3VQ5A 1S6PA 1DTQA 4E19A 2PY5A 4RG8A 3PO4A 2OPPA 1JLFA 2YNGA 3B6OA 4E7HA 1RT6A 3A2FA 2BGGA 4B8CA 3SPYA 2RKIA 3QEIA 4JLHA 2G8FA 4DSFA 4FJIA 2JGUA 4HVJA 2ZE2A 2KQ2A 4DTJA 3THVA 4TSXA 4CECA 3SV3A 5HRNA 4DSIA 1NJWA 1CLQA 3F73A 2DFFA 4I9LA 1UA1A 2OPQA 2X6NA 3KTQA 1HRHA 2D0AA 3AVBA 3K5OA 4E1NA 3DI6A 4BWMA 5J2QA 4O0IA 3ZT4A 3ZSQA 2LSNA 3VQDA 1BL3A 2F8TA 1LW2A 1XC9A 4N41A 1C0MA 1RBUA 4F3TA 3OYNA 3CM6A 3VQCA 4CEAA 1FKOA 3NGZA 1SKSA 4FJLA 1ZBFA 2FBVA 3C95A 4CEZA 4CHPA 4HUEA 4KB1A 2YKNA 4CCHA 2A1SA 2ETJA 4W5RA 3AVAA 4Z4HA 4FJKA 1BQMA 4QCLA 3LZJA 1A5WA 4AH9A 2JLEA 1JLEA 3CFOA 3HO1A 2VG6A 3TAEA 3LP0A 4CJUA 3T3FA 3S3OA 3OYJA 3TABA 4KHQA 3AVHA 4FJGA 3NH0A 1T8EA 1BCMA 1WSHA 4ZTFA 3O3GA 3TAGA 4C8MA 3AA2A 3HM9A 3AVKA 4CJKA 2HHTA 2Z1HA 2KW4A 4OLAA 2RF2A 3K59A 4CEQA 3QINA 3E01A 3P83D 3O4NA 3DRSA 2B5JA 3OY9A 3OJSA 3U3YA 3QERA 2A1RA 1NJYA 2P5GA 4K8ZA 5FRNA 3OYAA 5DK5A 1RTJA 1RNHA 1KLNA 4Z0UA 4CHQA 1RDCA 4FJHA 3CQ8A 4CIGA 3QESA 3L2QA 4CIFA 1VSJA 2Z1GA 4F8RA 4CFDA 3F9KA 4W5OA 2XHBA 5FRMA 4B9LA 3RMBA 4CJ5A 2Z1JA 3ITHA 2KZZA 3HPHA 4CFBA 1VSEA 4O5BA 4Q0BA 1KTQA 4EZ9A 4PA1A 5DMRA 1ZBHA 4Q5VA 4OKEA 1MU2A 3AVMA 3QIOA 4RW8A 5EU7A 3VA0A 3SNNA 1J9AA 4CHYA 1TL3A 4DQRA 3SQ4A 4BDPA 3K5LA 2FBTA 4E7KA 3SQ1A 4Y1DA 4LD0A 3VQEA 3V9SA 4FJ7A 3NE6A 4FLWA 2GV9A 1ASUA 3RMDA 1UA0A 3HJFA 3K2PA 1NOZA 3TAQA 2I5JA 1KRPA 4FJ9A 4DG1A 1X9MA 3QNOA 3ZT3A 1UOCA 2YNFA 1NK6A 2VG7A 3VQQA 1TKTA 1R0AA 1HQUA 4LSLA 4O4GA 5CYQA 1Z26A 3HP9A 3IG1A 4CEEA 1KVAA 4DQQA 1CZBA 5C25A 3OS2A 4DU1A 5KRTA 3ISNC 4B08A 1U04A 2HMIA 1C1AA 1BI4A 4I7FA 3OS1A 1SKRA 1HQEA 1S1VA 2VG5A 4AHTA 3CFRA 1RTIA 1Z25A 1ZBUA 5J1EA 3LWMA 1WAFA 2YNIA 4DMNA 4N56A 2IGIA 1GOAA 4E1MA 3AA3A 4BE2A 1TKDA 3MEDA 1WAJA 4N47A 1TKXA 4FW1A 4HUFA 1NKEA 2D0CA 3M8RA 4N76A 2HNYA 3V9XA 3NF8A 4B8AB 1Q8IA 1X9WA 4PY5A 1XWLA 4LH5A 1DTTA 3I0SA 4RW7A 4W5QA 3EYZA 2DTUA 1WNSA 1KFDA 3RR7A 4KPYA 1JLQA 3MECA 2HHWA 1NK4A 2RPIA 4KV8A 4I2PA 4CK3A 2R7YA 4E7IA 1TKZA 3KKRA 4KTZA 3ZSVA 4DQSA 4DWIA 3RWUA 4MQ3A 2F8SA 1VK0A 3TAMA 3VQ7A 1HJRA 3O4QA 4CGIA 5HRPA 2PZSA 1BIUA 3OS0A 3AO2A 2G8UA 2ZD1A 3LP1A 1N6QA 5C24A 4NYFA 3VQBA 3ASMA 3KLEA 3M8SA 4JRPA 2PYJA 3NDKA 3O3FA 1W9HA 4EP5A 4DQPA 4CIEA 3MEGA 4BDYA 2HVIA 1D9FA 4CJEA 1LWEA 3LAMA 3MXIA 2G8VA 4NCBA 5HROA 3RMCA 3JYTA 4L8RB 1F21A 3RR8A 2YHAA 1B9DA 1BQNA 4IBNA 3OYIA 3HVTA 4DSEA 1NK5A 1NK9A 2D5RA 4B9NA 4E3SA 3HP6A 4FK4A 1XI1A 1FKPA 3HPGA 3V9WA 2Y1JA 4NCAA 3KD1E 1YVUA 1RBVA 2XO7A 1A5XA 4CHNA 3SV4A 1JL2A 2XRIA 4OKJA 4DTUA 1JKHA 1NJZA 4FXDA 4DFMA 1J54A 2BDPA 1BI4B 1QE1A 1ASVA 3TARA 4IFVA 2QKBA 3NGYA 4FVMA 4KO0A 4C8NA 1QS4A 4M3RA 4HTUA 3ZT1A 1NK0A 4DFKA 3S3NA 1KSPA 5K14A 3LP3A 3V9ZA 3DLBA 4PWDA 4PQUA 4CJFA 3WNHA 2EHGA 3KJVA 1JLBA 4J2DA 3U3GA 4FZXC 3WNEA 2XY7A 2OPSA 1BCOA 4DF4A 4CJSA 1K6YA 1EXQA 3CYMA 4KKOA 4J2BA 3S9HA 1CZ9A 4FLTA 4DU3A 4CK2A 1QQCA 1RBTA 1U47A 4M3YA 3IRXA 4J2EA 3HPOA 3I0RA 1YTUA 4LH4A 5C42A 4HUGA 1BGXT 1EKEA 3OYEA 5HRRA 3C6UA 1RTHA 1JXBA 4H4MA 3AV9A 3WNGA 3HSTB 4MFBA 4XIUA 1U48A 4CEOA 5I42A 4EP4A 3PX4A 1WSJA 4KTWA 4C8OA 3UIQA 2KFZA 2W42A 1LW0A 1IKYA 3TI0A 1TVRA 4E7JA 4HHTA 4WE1A 4Z4EA 3NCIA 4ZTJA 1VSFA 3NH2A 2O4GA 4DTSA 3LAKA 3AVCA 1KFSA 1XHXA 1X1PA 2BANA 1U49A 4CERA 1IKWA 2E4LA 4HCCA 5KRSA 1REVA 5CY4A 1KVBA 1SL1A 1S9GA 4FJ5A 4Z4IA 4NCGA 2E6LA 1CXQA 4OGCA 3WNFA 4ZHRA 3LALA 3NGIA 4BE0A 3ZSZA 1HYVA 3DOLA 4DS5A 3AO4A 1LAVA 5JS2A 1NKCA 1TK5A 2ZQBA 4DLGA 3OYHA 2YHBA 3AVLA 1JL1A 3AVGA 4G1QA 4KTQA 3VQ4A 3HYFA 4IFYA 1HNIA 1RT2A 3NAEA 4CE9A 1T7PA 2YV0X 3C94A 2D0BA 3QLHA 4DS4A 1VRTA 3DM2A 4FLVA 1YTAA 4ICLA 3KLGA 3KLFA 4KHSA 3QEXA 2Y1IA 4K8XA 1S1XA 3SJJA 4DTRA 1C0TA 1QHTA 1IO2A 4RW6A 4KHYA 5CZ1A
chains in the Genus database with same CATH superfamily
1NK8A 4FL9A 2ASOA 4FZYA 5JLFA 3DXKA 1RT7A 2G8IA 4BR5A 4JI1K 2HHUA 3WT0A 4W5TA 1DLOA 2IDOA 3H08A 3QICA 1LWFA 4RW9A 1UAXA 2O8DA 1RTDA 2ZJRL 5FPEA 3QFUA 5H1SQ 1YUWA 4KRFA 2HVHA 4IOXA 4BR7A 4IG3A 4JI0K 2IAJA 4FM2A 5C10A 4BE1A 4LF7K 1S1WA 4CD1A 2GTDA 2OTLN 2OCEA 2QEXN 4AHUA 4EHTA 3I8BA 2QTDA 2X78A 3BZCA 1K73O 4FK2A 3LDLA 3KLIA 3FLCO 1NGCA 5AZIA 3VGLA 4KI4A 2A42A 1QSSA 3HK2A 3MAQA 1TYQA 3CCSN 4QOZB 4PUOA 4B9VA 1YJWN 4WQ5A 3UB5A 4GKKK 4EIAA 3ATUA 4FLYA 4CW7B 4KBOA 3UKRB 1ITGA 3VQAA 4BC2A 4BRDA 1ZXOA 4M3WA 5FROA 4BR9A 3DXMB 3HXMA 1VQLN 3FR0A 1RBSA 1GOBA 1SQKA 3WUHA 2XY8A 5TKYA 3BEXA 4GW6A 1IH7A 5AZJA 5E84A 1NNEA 3L6QA 2WFBA 4E89A 3SUOA 2ATQA 1JCGA 4IOCL 1ATSA 4YFUA 5EOYA 1C6VA 3V6DA 3DRRA 2GUIA 1RBRA 3I55N 5KQDA 4BG9A 2NNWA 2V51B 3U9ZA 2P9SA 5AQZA 2IVOA 3OYDA 1WSEA 4M3ZA 2O8BB 1VRUA 2WOMA 2PYLA 4DQIA 3EY1A 4Y1CA 4CHOA 3O6WA 4H8KA 3TU5A 4DTXA 4V19S 3NF9A 2EX3A 4NLBA 5HP1A 4OPKA 3CCQN 1D4XA 1BISA 4CVNE 4FLUA 3MWTA 1JLCA 4CJPA 3NMUA 1LWCA 3HT3A 2B6AA 3KWIA 2KTQA 3OYLA 2NZTA 1HX1A 1VQ5N 4A2AA 2E20A 3CF5L 2PFUA 5GIPA 2NRXA 2E6MA 4IO8A 3EZ5A 3CFPA 2D1KA 3ALYA 1IG9A 3D2EB 1TAUA 5HLFA 3NF7A 1MWMA 3HRGA 3TTCA 1EX4A 1Q9YA 5AQKA 1J6ZA 3FE1A 4H5VA 1IG8A 1KAXA 2HHXA 2HF4A 5E26A 4BWJA 1S6QA 3KKSA 3SPZA 2NRWA 4FWSA 4FK0A 1T03A 4Z94A 4CJLA 3AVNA 5GAEP 4QAGA 1Q82O 3VEOA 3PO5A 3VQ8A 5BPMA 4DR7K 3E66A 5C15A 2O8FA 2BTFA 2FF3B 2QM1A 3NH1A 3GG4A 3LDNA 1NK7A 4ID5A 1BO5O 1DT9A 2WTUA 4NO7A 3SQ0A 3M8PA 3O3HA 3FGUA 4BRGA 4OPHA 4DQ8A 1X9SA 1SL2A 4DR2K 2O8CA 2FC0A 3VQ6A 4R79A 3VF2A 4OGEA 1WSFA 4LF5K 4DV5K 4DF8A 3WXKA 3DLHA 1SL0A 1RFQA 3VF4A 2FBYA 3OYFA 1VSLA 4OKKA 1H1VA 1D5AA 4OVLA 2QWLA 3ZYYX 4JD2B 1T3VA 4WQ4A 4NXNK 3ZLJA 3RVCA 3L0QA 5AQOA 3CCEN 4E19A 4RG8A 4DV6K 2A40A 4GY2B 3B6OA 4E7HA 4FJIA 4DSFA 3H1QA 4HVJA 3THVA 3CQXA 4TSXA 1U2VA 1CLQA 3KTQA 2X6NA 1HRHA 4E1NA 4O0IA 3VQDA 5JLHA 4IFEA 3P39A 1XC9A 4RTFD 5HL7L 5GADP 2FBVA 4KB1A 3L4IA 2YKNA 5KPTA 2ETJA 3AVAA 4HWIA 4AH9A 3T3FA 4KHQA 3AVHA 2BH1A 3F9MA 5AQLA 3AGKA 1LOTB 1CZAN 4RCHA 3QBWA 3L4QA 3OJSA 2A1RA 2F7TA 2P5GA 3OYAA 5DK5A 4DV1K 4CZLA 1RNHA 4CHQA 1RDCA 4FJHA 3CQ8A 4DR5K 2W6KA 4YOTA 5FRMA 5CHIA 4CJ5A 3RMBA 3ITHA 3HPHA 4KHPK 1KTQA 4Y0WA 1ZBHA 4Q5VA 4IJNA 1MU2A 3QIOA 3SNNA 2ZWHA 1X3NA 3K5LA 3ZEUA 3V9SA 1OH5A 1YJ9N 3J7YP 2O8EB 1ASUA 3RMDA 3HJFA 3K2PA 3EO3A 1NOZA 2YJFA 2I5JA 4B3RK 4FJ9A 1X9MA 3GBTA 4KH6A 3ZT3A 3ENBA 2E1ZA 2YNFA 3AGRA 1NK6A 2E1YA 1YI2N 1HQUA 4LSLA 3HP9A 3IG1A 4H5RA 4CEEA 5HOOA 1CZBA 4DU1A 5KRTA 2E2NA 1YJNN 4B08A 4DUZK 1BI4A 4I7FA 5JVHL 2VG5A 3CFRA 4GVEA 5J1EA 3AY9A 4BE2A 3KK7A 1V4SA 5LJVA 1WAJA 4HUFA 4JI3K 4JKDA 3U4LA 2D0CA 4BRAA 4N76A 5CR4A 4PY5A 3NF8A 3SMPA 1Q8IA 3ZX2A 3T1HK 5LJWA 3I0SA 2W6LA 2OANA 4KPYA 3K9KA 2RPIA 3RWUA 1TKZA 4KTZA 4DWIA 4CGIA 3TAMA 3CJ1A 4B1VA 3O9RA 3OS0A 2G8UA 2ZD1A 5C24A 3VQBA 2QWPA 4EP5A 3W0LA 4BDYA 2ZGYA 1N8RO 1N34K 1D9FA 3O9QA 3ZEUB 4L8RB 3RR8A 3C6HA 1B9DA 4DSEA 4IBNA 3CCJN 2D5RA 2GX9A 1OH8A 4LC9B 4DR1K 3HP6A 1HLUA 2Y1JA 4X62K 1MDUB 4CHNA 4DTUA 1NJZA 1NG9A 3M1FA 1BI4B 3T69A 4H5TA 4FVMA 3QFPA 4M3RA 3EL2A 1KXPA 1OKJA 2E88A 4IEEA 5K14A 4B1YB 3V9ZA 4FWPA 2P9PA 4MDBA 3WNHA 2EHGA 3KJVA 2OPSA 1BCOA 1DKGD 1EXQA 3P4IA 3S9HA 1CZ9A 4FLTA 1RBTA 1U47A 1ESVA 3M6GA 4J2EA 3I0RA 5C42A 1RTHA 1JXBA 3AV9A 4MFBA 4KTWA 1NGBA 2W42A 1LW0A 3TI0A 2HBKA 2NRRA 1FW6A 2ZF5O 2BANA 1HJOA 4CERA 3J7AP 1IKWA 2E4LA 1EQYA 1KVBA 1SL1A 4DR3K 4JI4K 1S9GA 4CZJA 4DKWA 4CD3A 3NGIA 3ZSZA 4DS5A 3AO4A 5BPNA 1LAVA 4JK8A 3IMXA 1TK5A 4YY3K 1XNQK 3GL1A 4MO5A 3VQ4A 4BREA 1HNIA 3SBGA 2D0BA 2IIRA 1VRTA 2IVNA 4ICLA 2Y1IA 4DB3A 1C0TA 3OBWA 3CXCM 2HOEA 1IO2A 4KHYA 5CZ1A 3KK1A 4DTOA 4H0PA 4WFAL 2GEMA 1WOQA 4FWNA 2Z1IA 4JKBA 4B9MA 1IBKK 5AQUA 5HBMA 5J2MA 3AA4A 4J2AA 4M45A 4KAZA 3CCVN 2Q3SA 5FDLA 5GINA 1JXEA 3V1OA 4H0VB 2B4JA 1EP4A 4C1NK 1K8KB 4K43A 1RILA 1JLGA 1D9DA 4XH4A 2GBZA 4WFNL 3P31A 5LMNK 4YOUA 3QNNA 5M1QA 4E7LA 4BRIA 4GV9A 2HW3A 3QEPA 3C7NA 2OZSA 3GOIA 3TTFA 4JV5K 2FBXA 3V9UA 1BHLA 3VN5A 3TWHA 3VOVA 3WEEB 1J5OA 4FJXA 3MMVA 4A5AA 3N4PA 3THXA 3ULDA 2VWBA 1S5JA 2G8HA 4KB0A 4M3XA 4KHNA 4RW4A 3LM2A 3CM5A 3TPQA 2ITMA 4N5SA 4YOWA 2ZM6K 4YORA 1B9FA 4CF2A 2HF3A 3OYCA 1HNWK 4JKGA 3RMAA 3DMJA 2F9WA 4PKIA 3SQ2A 4E1JA 3E9OA 4B9SA 3D2FB 2PBDA 4A59A 4OO1J 4CEFA 4AQYK 4KHUA 1VQ6N 4ELVA 3VF6A 1FK9A 3NBPA 4EAHD 3TSPA 3DYAA 4NYNA 1HUXA 4OPJA 3MEEA 2OYQA 2IS3A 3L2VA 4A61A 3LPUA 4C8LA 3MN6A 3NHGA 3U8XA 2HNZA 3VTIA 4FJJA 4JI6K 1XHZA 3A5MC 2VWKA 4E0DA 1TK0A 4CZEA 4CF8A 3K5NA 2P9UB 3THXB 1VQMN 4AILC 1RT5A 1OVQA 3VENA 1T6CA 3WXJA 3ENOA 4FM0A 4CEBA 2DFEA 4FJ8A 3LDQA 4MLHA 1LV5A 1RDWX 2QXLA 3PX0A 3KZBA 1QQOA 3CPEA 3T7ZA 3HVRA 2XY5A 1HNVA 4CJVA 3D0PA 4JKGB 5ADXA 1L5UA 1UWBA 3MX5A 4CHZA 4FZZA 3D45A 4LF4K 4FPAA 1ATNA 3SZ2A 5T7BA 3SCXA 4IO9L 4U7BA 1Q9XA 4FYDA 1QSYA 4BRKA 3MWPA 4GMJB 4FCYA 3ZETA 1XMQK 4CBWA 4ISFA 4JK9A 2AJQA 3VQ9A 1TUUA 1VQKN 5CYMA 5M1FA 3FZFA 1RGIA 2VGNA 3TANA 5JS1A 1VSIA 2P51A 4DFJA 3PV8A 4FM1A 2GWKA 1BIZA 1TAQA 4FWMA 5BR8K 1GLEG 1N5YA 1T05A 2ZGZA 4BQLA 3S3MA 4CJ7A 1S1UA 1L3TA 4CJ3A 1YT3A 4F3OA 2P9KA 3L2RA 2FF6A 1SUQA 3AO1A 1NLVA 1NU0A 1KCFA 1RT1A 4FO0A 1WN7A 2O4IA 1WBBA 5AQFA 1ASWA 1RT3A 4OX9K 5GAHP 4FWKA 4FJNA 2I7NA 3ENHA 2OZMA 3M3ZA 3JS6A 4BDZA 3PY8A 4B3OA 4K0KK 5BPLA 3UKUA 2HB5A 4EZ6A 3I8DA 4LSNA 1C1CA 4DFPA 4M41A 3ZETB 2YNHA 3SUQA 1NGAA 3DXKB 3Q7BA 2HHQA 1Z6RA 3KK2A 1QZ6A 1KD1O 2CGLA 1FXXA 1HKGA 3QEVA 3VERA 1S9EA 2O8DB 3DLEA 4CESA 4B3MK 3ZX3A 4FWLA 4OJRA 4YDUA 1E4FT 4AHRA 1S6PA 2W41A 1JLFA 3G6EN 4FPBA 1XNRK 3A2FA 2BGGA 3QEIA 3E1YA 4JLHA 2G8FA 2KQ2A 2UYTA 4DTJA 2DFFA 4I9LA 5BRFA 2OPQA 3EZWA 3CERA 3HTVA 3NVKA 3ZT4A 4N41A 5M1PA 4F3TA 5AZIB 3OYNA 2I7PA 3OHRA 4HUEA 3C95A 4O8KA 2A1SA 1NM1A 1DEJA 3D6RA 1TYQB 3TAEA 4LFAK 3AAQA 3S3OA 3OYJA 3TABA 1T8EA 4JN4A 3HM9A 3O9UA 1EO1A 3I33A 1ATRA 2Z1HA 1XUPO 4OLAA 2RF2A 3K59A 1T44A 4CEQA 1OH6A 4B1ZA 2NRHA 4BRHA 1RTJA 4DV4K 3QBXA 2CH6A 4CIGA 3L2QA 4CIFA 4F8RA 2Z1GA 4I6MA 4W5OA 3IKMA 5AQMA 2Z1JA 1NMDA 4EZ9A 4PA1A 5AZJB 4BRNA 1YHQN 4RW8A 3VA0A 4CHYA 3SQ4A 2FBTA 3SQ1A 4LD0A 3VQEA 4WCEL 4FSVA 2GV9A 1UA0A 3CC7N 3S41A 1KRPA 3SAGA 3CJAA 3OW2M 3QNOA 1W7AA 4BR4A 1UOCA 2QWOA 4YOYA 5CYQA 2P9SB 4JK7A 1KVAA 5JICA 3CCRN 5TKWA 3OS2A 5JVGL 3OS1A 4AHTA 3MCAB 2YNIA 4DMNA 5JMVA 4E1MA 1TKDA 1NKEA 5AQJA 3V9XA 4B8AB 3E9LA 3TSUA 1E3MA 4LH5A 1DTTA 4RW7A 4W5QA 3OA9A 2DTUA 4A57A 3RR7A 3CIPA 3MECA 1BG3A 4I2PA 4PL8A 4DQSA 4BC5A 1K8AO 2PZSA 1HJRA 4PKHA 1BIUA 2NRZA 1N6QA 3WXIA 3KLEA 4JRPA 2PYJA 3NDKA 1I94K 4DQPA 3MEGA 3MN7A 1X3MA 4CJEA 1LWEA 3LAMA 3MXIA 1HR0K 4ILGB 3JYTA 2VQFK 2YHAA 4I9QA 4FWQA 1NK9A 4CZFA 4FK4A 2ASMA 1XI1A 3HPGA 1RBVA 2VCPA 1JL2A 1Z05A 4DFMA 1J54A 2KLAA 2BDPA 3WQUA 1ASVA 2YHWA 4KO0A 1QS4A 3HZ6A 4HTUA 3ZT1A 1NK0A 2O8FB 3S3NA 2FLOA 1T6DA 1DGKN 4PQUA 4MO4A 3U3GA 4A5BA 4F9OA 3E9PA 4IXCA 5C0YA 3CYMA 4KKOA 4J2BA 4DU3A 3GE1A 3Q7CA 3HPOA 1YTUA 5BN9A 2O8CB 4HUGA 3OYEA 3HSTB 2A5XA 4K41A 1WSJA 3BUZB 3UIQA 2UXBK 3FZMA 1TVRA 3CMAN 2YI1A 5ELZA 4Z4EA 3MX2A 3NCIA 4DTSA 2ZJPL 1U49A 4LF6K 4HCCA 5KRSA 4DV3K 4Z4IA 3IDHA 4OGCA 4YOXA 4BGAA 1HYVA 2QWRA 4B1WB 1C0FA 4JHDA 5JS2A 1NKCA 2ZQBA 4DLGA 3OYHA 2YHBA 4KTQA 3AVGA 3EEQA 3WXMB 3HYFA 3H3NO 4IFYA 1HKCA 3HI0A 1T7PA 2IVPA 3C94A 4BC3A 1U2VB 1IJJA 3QLHA 4JKEA 4FLVA 1YTAA 4IWVA 1S1XA 4DTRA 1U4BA 1W97L 2YCHA 3G4SN 3V1QA 4BRFA 1P90A 1ZYQA 2F96A 2X6SA 5J2PA 3EE8A 4O0JA 2G8KA 3CPWM 1IBMK 1J53A 1JLAA 2WUSA 5BRHA 5KTQA 1NJXA 4CFCA 3U9DA 1MWKA 3L8BA 4AHCA 4CJQA 4CEDA 3PIPL 4FOEA 1QSLA 4C23A 3OYBA 1S3XA 1XC3A 5AJ3K 4XH1A 4FLXA 1CXUA 3ZCMA 3BP8A 1SV5A 3LWLA 2P9IA 1D8YA 3IAYA 5AFUA 2HBMA 4DCHA 1NOYA 2Q31A 4M3UA 4DHYA 1ZC6A 4FWRA 1KVCA 4CJ4A 5KGXA 4NLCA 1WLJA 2QK9A 1VSMA 5B8HA 1GLJO 3CETA 3SYZA 1GLAG 3C0BA 3WQTA 4XH5A 3OVNA 1NWKA 5F1XA 3NVMA 1IKXA 5AQVA 3KD5E 1VSHA 1HMVA 3CI5A 4O55A 1RDBA 3KVGA 2RN2A 4AHSA 1HNXK 2OA8A 3KHYA 3O08A 5AQPA 1RDAA 1S1TA 5C12A 2P9NA 4A2BA 4CK1A 4DV7K 3L3UA 3MDQA 3AA5X 4KFBA 3SK3A 5M1KA 3AO3A 5DM6L 1QQMA 1QHAA 5J2NA 4B9UA 2UUAK 3OJUA 4MLEA 1GOCA 1BOTO 1WB9A 2P9IB 1B92A 4ID1A 4FLZA 3SUPA 3NFAA 3HOSA 2KZMA 4X64K 5D3GA 3PX6A 4QS7A 4KHWA 2HSTA 1QZ5A 3QO9A 1L3UA 1Y97A 4CF1A 4H0TB 3NF6A 4JS4A 1U45A 4CZKA 3LPTA 4CGHA 4JI7K 3R3LA 5HRSA 3ZSYA 1VQ7N 4YDUC 3MN5A 3P1GA 5C2FA 1KQSM 3R1XA 4O5FA 4ISEA 3BGRA 4X65K 1YAGA 3THWA 4CF9A 4DR4K 3O9SA 3CJBA 2P9PB 3BY5A 3QIPA 2HHSA 2AA4A 1W2BM 2FSNA 4BVOA 1TK8A 1G15A 4CFAA 3VEXA 4CGJA 4GV3A 4F4KA 2CGJA 3KK3A 3AVIA 1VQ4N 3K9JA 3VEVA 1BUPA 5AQRA 4F2RA 2NRTA 4R5PA 2KKZA 1WSGA 3QMLA 1RCHA 3HL8A 4FW2A 3K57A 3FFIA 5EX5A 1O1WA 5I3UA 3GDQA 1Q7YO 3ZSOA 1GLDG 2YKMA 2VGMA 1EETA 2Q0UA 1R59O 2NUBA 1Q81O 5KI6A 1C0UA 3CG7A 5I9EB 3THYA 4ELTA 3AO5A 4CF0A 3RSEA 1GLCG 4DTNA 3RRHA 3KIOA 3ZSRA 1VAZA 3VTHA 2IOCA 1HPMA 1HPZA 1HYZA 4J8FA 1LAWA 1HYSA 3MXJA 2VYPA 2A3ZA 3L2UA 5IWAK 3THWB 4M7XA 3TAFA 3PSIA 4H0OA 4M42A 4CGFA 4FJMA 1WSIA 3DOKA 3L2WA 5AQXA 4AHVA 3HM8A 4FOIA 5MLCQ 3ZT0A 1C1BA 3VQ5A 3ULEA 3EE9A 2OPPA 4BRQA 2YNGA 1RT6A 4B8CA 3SPYA 2JGUA 4M63C 4CECA 3SV3A 1NJWA 1UA1A 3C7NB 4JKCA 5EVZA 2CH5A 3LL3A 3DI6A 4BWMA 1C0GA 5A2QO 5J2QA 3VGKA 3ZSQA 2AP1A 1BL3A 2UU9K 2F8TA 5F2RA 1C0MA 1FKOA 3NGZA 4FJLA 4CEZA 4CHPA 3CJCA 4H0XB 4IDHA 4Z4HA 4FJKA 2Q1NA 3LZJA 4GKJK 2VG6A 4IZ9A 1ZBSA 4L3QA 1V4TA 4ZTFA 2QWQA 4WFBL 3TAGA 1BA0A 4NB4A 2KW4A 1LCUA 3QINA 3E01A 3P83D 3O4NA 2DPNA 2B5JA 3DRSA 3OY9A 3U3YA 4K8ZA 1NJYA 5FRNA 3CJ7A 3H45C 3H6EA 4Z0UA 4CZIA 3R9PA 1GLFO 3QESA 1VSJA 3PSFA 4CFDA 3F9KA 4DV0K 4Q0BA 3KWGA 1NGJA 1TL3A 4DQRA 4BDPA 1YIJN 2EWSA 4FJ7A 4FLWA 3A5LC 3A0IX 3TAQA 1E4GT 2F9TA 3SMSA 4DG1A 4JNEA 2VG7A 3VQQA 4JI8K 4MDAA 4O4GA 2ASPA 1Z26A 3UKRA 2RHKA 3ISNC 1U04A 1SKRA 1RTIA 1ZBUA 2CGKA 1WAFA 2NRVA 2IGIA 3DXMA 3C65A 1TKXA 1XWLA 3H3OB 3AARA 1KFDA 3AAPA 2HHWA 3H1VX 1NK4A 2BUPA 4CK3A 4KV8A 4E7IA 2R7YA 1IV0A 2GELA 1BU6O 5ADXH 3VQ7A 2E5LK 4NYFA 3ASMA 4CBXA 1QVFM 3O3FA 4EFHA 3CMEN 2H3GX 4B1UB 1NBWA 5HROA 1RDUA 1SZ2A 3VEZA 2O8BA 1BQNA 3OYIA 3HVTA 1NK5A 3UE5A 4B9NA 3VESA 3ID8A 3KD1E 2XO7A 2QW9A 2XRIA 1JKHA 4BROA 3VGMA 2P9KB 1U6ZA 1QVGM 3TARA 3CCLN 2GUPA 3NGYA 2QKBA 2Q36A 5AQNA 1JCFA 3LP3A 4QS9A 4PWDA 1KAYA 3J81O 1NGFA 1HNZK 4FZXC 3VETA 4DF4A 4CJSA 5AQTA 1M1KO 4CK2A 1QQCA 3UKUB 4M3YA 3IRXA 3OTOK 3D2EA 5HRRA 3C6UA 3WNGA 4LFBK 4IEIA 4XIUA 4C8OA 4CEOA 5I42A 4EP4A 3FFKB 2A41A 3O1WA 1IKYA 2HMPA 5EY4A 2J4RA 2HBLA 4E7JA 4B3SK 4HHTA 2O4GA 1XHXA 1X1PA 4ILHA 1Q18A 3VPZA 4JKFA 5CY4A 1P8ZA 3QB0A 4FJ5A 5FPNA 2E6LA 3ID6A 4ZHRA 3LALA 1NGDA 1NGGA 4UY8O 5M1OA 1JL1A 2YHXA 4YHHK 3CHWA 1FJGK 4DS4A 2HBJA 2UUBK 3KLGA 5DM7L 3QEXA 4K8XA 4JI2K 3SJJA 1QHTA 3F5TA 3R6MA 1CXQA 2PAVA 4RW6A 1HKBA 3LDPA 1N36K 3FZHA 2IC3A 5FPMA 4IJAA 3TR8A 3G71N 2WONA 4JKAA 4CJRA 2QWMA 2UXCK 4JD2A 2ITGA 2UXDK 2BE2A 4AM6A 4CZHA 3O9TA 3OYMA 4IG0A 4F2SA 2ZJQL 4LFCK 3KLHA 1ZBLA 3LP2A 3B6PA 5AQIA 2XY6A 4BRMA 4CBUA 4PKGA 3K5MA 2V52B 1Q86O 2HHHK 5KPZA 4I6MB 1I39A 4KH5A 1MA9B 2P1JA 3IUCA 3BDPA 1K9MO 3DLGA 2QKKA 3JAMO 4CZMA 1SKWA 5SWMA 3T1AA 1TGOA 1RT4A 1TL1A 3HSCA 4JRQA 1IBLK 1VQPN 5AR0A 3JSMA 2NLXA 4I2QA 3D7EO 2D0PA 2WBNA 3V1RA 3T1YK 4DSLA 3QETA 4CZGA 4Z4CA 5KGWA 2D4WA 4AF1A 4CJTA 2HNDA 4DLEA 4HCBA 2KFNA 2QWNA 2RE2A 2FXUA 4CI6A 3AVFA 1L3SA 4BVPA 4U67L 1QQNA 2HHVA 4JS5A 4BACA 5BN8A 1VSDA 4BRPA 5BREA 2G8WA 3G0ZA 3M8QA 4CGDA 3VQPA 4W5NA 4H5WA 2O8EA 3AVJA 2Q2RA 4O8UA 3MXMA 4WF9L 5AQYA 3T19A 1BWFO 5BRDA 3L3VA 3LM9A 3V4IA 4ELUA 1A5VA 4Z4FA 3FZLA 3P5JA 3IS9A 4LY7A 3RRGA 4BGBA 1N33K 3PUFA 3W3DA 1IKVA 5M1NA 4IKFA 4KH4A 4LF8K 1RDDA 4JYAK 3V81A 1KAZA 4GNIA 3VMFB 4BC4A 2OPRA 3SAFA 3HO1A 4FJGA 2QXFA 2JWLA 4UQGA 3QEWA 1EWRA 4M3TA 5F0XA 1W0HA 4C8KA 3OYKA 3ZSXA 3TAPA 1M90O 3RTVA 5SZTA 3H46O 4DUYK 1WUAA 3FZKA 4G9ZA 3BF1A 5KQ8A 4JAXA 2P5OA 4YNQA 2UUCK 3LANA 3LDSA 1YITN 1L3VA 1VQON 4BY9C 3SLCA 4GVMA 1QTMA 3DLKA 3MCPA 4H03B 3SI6A 2FSKA 3VEWA 2E2QA 4DTMA 5EXWA 5GAGP 4K25A 3A5NC 4K42A 3OYGA 4DU4A 2QI2A 1X9JA 4OLBA 2Q0RA 4CGGA 3O1BA 3VA3A 4DV2K 2E8AA 3ZT2A 2DFHA 5E41A 3K58A 3SUNA 2YHYA 1ZBIA 3G10A 2W40A 4JHDB 4B3TK 4BRLA 2VQEK 1O13A 1YF5L 5C2DA 4BQZA 3DLRA 3U6FA 5CZ2A 4DR6K 4DTPA 3C6TA 4O44A 3MK6A 3SAHA 1NKBA 1TUYA 3ZSWA 1VSKA 4DSJA 4DSKA 4IDKA 1NGEA 2V7ZA 1I3AA 3DRPA 2VWJA 4KI6A 4KREA 3M5RA 2DY4A 4H4OA 4Z4GA 1KLMA 4B9TA 2X74A 4CJWA 4H5NA 5AQQA 3LDOA 3DAWA 1TV6A 3LZIA 3B8AX 4NXMK 3CQYA 1BDGA 3JXUA 1DTQA 5IT9O 2PY5A 3PO4A 4QS8A 2JWKA 4BRCA 3EN9A 3TTDA 4H0YB 4EHUA 4WYBA 4ILJA 2RKIA 1JJ2M 3N4QA 2ZE2A 1G99A 5HRNA 4DSIA 3F73A 5FPDA 2D0AA 3AVBA 3K5OA 5LL6Z 2V7YA 2LSNA 1LW2A 1RBUA 3CM6A 3VQCA 4CEAA 1SKSA 1ZBFA 3MN9A 4YOVA 4A62A 4CCHA 4W5RA 1BQMA 3IFRA 4QCLA 5AFUH 1A5WA 2JLEA 1JLEA 3CFOA 3O80A 3LP0A 4CJUA 3VEYA 3NH0A 1BCMA 1WSHA 3O3GA 2KHOA 4C8MA 3PLAA 3AA2A 3AVKA 4CJKA 2HHTA 1K8KA 3C6AA 3QERA 5LY3A 4WQ5C 1KLNA 5LMUK 2YJEA 2OTJN 2XHBA 4B9LA 2KZZA 1SS6A 4CFBA 1VSEA 4O5BA 5DMRA 3WEEA 4OKEA 2P9NB 3AVMA 3CD6N 4JEPA 5EU7A 1XMOK 1BA1A 4FWOA 1J9AA 2YX6A 2Q97A 4E7KA 4Y1DA 3NE6A 4C1NI 4OPAA 3CCUN 4RWTA 1TKTA 1R0AA 4AM7A 5CE3A 1N32K 1ILYA 1XQSC 3DLLL 1J5EK 2P9LA 1YVNA 4DQQA 5C25A 2HMIA 1C1AA 1HQEA 1S1VA 1Z25A 3BZKA 3D2FA 3LWMA 1KC8O 4N56A 1GOAA 3BF3A 3AA3A 4IOAL 3MEDA 4N47A 4FW1A 1NMNA 5AQHA 3F2KA 4BR2A 3M8RA 2HNYA 1X9WA 2WC9A 3EYZA 1VQNN 1WNSA 2D0OA 1JLQA 3EKUA 3KKRA 2F8SA 3ZSVA 4MQ3A 2E2OA 1NJIO 1VK0A 3O4QA 5HRPA 2QA4N 1GLLO 1NGHA 3AO2A 3LP1A 3J8AA 1VHXA 3M8SA 1JCEA 1WBDA 1W9HA 4HTLA 4CIEA 3HBTA 2E2PA 2HVIA 2P9UA 4M7YA 2G8VA 3CJ9A 4NCBA 3RMCA 1F21A 3R8EA 3PIOL 4E3SA 3DJCA 3TSQA 3SJHA 4BG8A 1FKPA 3V9WA 4NCAA 4JI5K 1EWQA 3G25A 1YVUA 5AQWA 1A5XA 3O4WA 2P9LB 3J80O 3SV4A 4OKJA 4FXDA 3QDKA 1QE1A 3SBTA 2F4VK 4IFVA 1VQ8N 4C8NA 3EKSA 2A6AA 3THYB 3CCMN 4DFKA 1KSPA 3DLBA 3RSEB 4CJFA 1JLBA 4J2DA 2GWJA 3O5BA 3WNEA 2XY7A 1K6YA 5BR9A 3WXLA 5AQSA 1S22A 3ZX0A 4GV6A 4LH4A 1BGXT 1EKEA 4XEIA 4H4MA 3CC4N 1U48A 3PX4A 2KFZA 3I56N 3CC2N 3A5OC 5FLXO 3HOTA 4WE1A 1YXQA 4ZTJA 1VSFA 3NH2A 2FSJA 3LAKA 3AVCA 1KFSA 1GLBG 1REVA 1SAZA 4B1XB 4LF9K 4PHTX 4NCGA 3A8YA 4B9QA 3OBYA 3WNFA 4BE0A 3DOLA 4ISGA 5KPRA 3ULEB 3ATVA 4WQ4C 3AVLA 4G1QA 1S72N 5AQGA 4FVUA 1RT2A 3NAEA 4CE9A 4PL7A 1NGIA 2YV0X 3DWLA 4JKHA 4X66K 1OH7A 3P38A 4BR0A 3J7ZO 1VQ9N 3DM2A 3O8MA 1OVYA 3KLFA 4KHSA 3K0SA 1Y64A 5GIOA
chains in the Genus database with same CATH topology
3KK1A 1NK8A 1U4BA 4DTOA 4FZYA 2IC3A 3V1QA 1RT7A 2G8IA 1ZYQA 2HHUA 4W5TA 3TR8A 1DLOA 2IDOA 2WONA 3H08A 4CJRA 2Z1IA 2F96A 2X6SA 1LWFA 5J2PA 4B9MA 4RW9A 1UAXA 5HBMA 5J2MA 4O0JA 3AA4A 2G8KA 4J2AA 4M45A 4KAZA 1RTDA 2Q3SA 1J53A 2ITGA 5FDLA 1JXEA 3V1OA 1JLAA 2B4JA 2BE2A 1EP4A 4KRFA 2HVHA 1RILA 4IG3A 5KTQA 4IG0A 3OYMA 4F2SA 1NJXA 4CFCA 2IAJA 1JLGA 4FM2A 1D9DA 3L8BA 3KLHA 2GBZA 4AHCA 3LP2A 4CJQA 3B6PA 4BE1A 2XY6A 1ZBLA 4CEDA 1S1WA 3QNNA 3K5MA 1QSLA 4E7LA 3OYBA 2HW3A 3QEPA 4AHUA 4FLXA 1CXUA 1I39A 2OZSA 3ZCMA 4I9QA 1SV5A 2FBXA 3LWLA 3V9UA 1BHLA 3VN5A 2X78A 4FK2A 3TWHA 1D8YA 3IAYA 2P1JA 1J5OA 3BDPA 4FJXA 3DLGA 3KLIA 1NOYA 3ULDA 2QKKA 4KI4A 4M3UA 1S5JA 2G8HA 1KVCA 4CJ4A 1SKWA 5SWMA 3T1AA 1TGOA 5KGXA 1QSSA 4KB0A 1RT4A 1TL1A 3MAQA 4KHNA 4M3XA 3HK2A 4JRQA 1WLJA 4RW4A 2QK9A 1VSMA 3CM5A 4N5SA 3JSMA 4QOZB 4PUOA 4I2QA 4B9VA 1B9FA 3V1RA 4CF2A 3SYZA 4DSLA 3OYCA 3QETA 4FLYA 4Z4CA 5KGWA 4CJTA 3RMAA 2HNDA 4DLEA 3OVNA 1ITGA 4HCBA 3DMJA 2KFNA 3VQAA 3SQ2A 1IKXA 3KD5E 1VSHA 1HMVA 4O55A 1RDBA 3AVFA 4B9SA 1L3SA 2RN2A 4AHSA 4M3WA 5FROA 2OA8A 3HXMA 4CEFA 4KHUA 1RBSA 1GOBA 4ELVA 1FK9A 2HHVA 3NBPA 2XY8A 4JS5A 4BACA 1RDAA 4GW6A 3DYAA 1IH7A 4NYNA 1VSDA 1S1TA 4OPJA 3MEEA 2OYQA 2IS3A 3L2VA 4CK1A 2G8WA 3G0ZA 3LPUA 3M8QA 4CGDA 4C8LA 3L3UA 3VQPA 3AA5X 4KFBA 3NHGA 4E89A 3SUOA 2ATQA 4W5NA 3AO3A 2HNZA 3AVJA 4FJJA 4YFUA 1XHZA 5J2NA 1C6VA 3MXMA 3V6DA 4B9UA 3DRRA 3T19A 2GUIA 3OJUA 1GOCA 1RBRA 2VWKA 4E0DA 1TK0A 1B92A 4ID1A 3L3VA 4FLZA 3SUPA 3NFAA 3V4IA 4ELUA 2KZMA 4CF8A 1A5VA 3K5NA 4Z4FA 3P5JA 3IS9A 4LY7A 1RT5A 4AILC 3RRGA 5D3GA 4FM0A 3PUFA 3OYDA 1WSEA 2DFEA 4CEBA 4M3ZA 1IKVA 4FJ8A 1VRUA 4IKFA 2WOMA 2PYLA 4DQIA 1RDDA 3PX6A 1LV5A 3V81A 3PX0A 3EY1A 4Y1CA 4CHOA 4KHWA 4H8KA 4DTXA 2OPRA 3QO9A 1Y97A 4CF1A 1L3UA 3NF9A 3NF6A 3HVRA 4JS4A 2EX3A 2QXFA 2XY5A 5HP1A 1U45A 1HNVA 4CJVA 4OPKA 3D0PA 1BISA 4UQGA 3LPTA 3QEWA 4CGHA 1L5UA 1UWBA 4M3TA 5HRSA 3ZSYA 4CHZA 1W0HA 4FZZA 3D45A 4FLUA 4C8KA 3SZ2A 1JLCA 3P1GA 4CJPA 3OYKA 5T7BA 3ZSXA 3SCXA 1LWCA 3TAPA 1Q9XA 3HT3A 3RTVA 5SZTA 4FYDA 3BGRA 2B6AA 2KTQA 3OYLA 4CF9A 1QSYA 4GMJB 4FCYA 3QIPA 2HHSA 2AJQA 3VQ9A 2P5OA 4YNQA 1TK8A 5CYMA 3LANA 3LDSA 1L3VA 1G15A 4CFAA 4GVMA 4CGJA 1VSIA 3TANA 2E6MA 3EZ5A 2P51A 1QTMA 3CFPA 4F4KA 3KK3A 3AVIA 3DLKA 3SI6A 4DFJA 3ALYA 1IG9A 1TAUA 3PV8A 4F2RA 5HLFA 4DTMA 3NF7A 4R5PA 4FM1A 1BIZA 1WSGA 1TAQA 1RCHA 3HL8A 1EX4A 4FW2A 1Q9YA 3K57A 1N5YA 1T05A 3FFIA 3OYGA 4DU4A 2HHXA 4BWJA 5I3UA 1O1WA 3S3MA 1S6QA 3KKSA 3SPZA 4OLBA 4CGGA 3VA3A 1S1UA 4FK0A 3ZSOA 1T03A 1L3TA 4CJ3A 1YT3A 2YKMA 4F3OA 1EETA 3L2RA 4CJLA 2NUBA 3AVNA 3ZT2A 5KI6A 2DFHA 1C0UA 1SUQA 3CG7A 3AO1A 4QAGA 5E41A 3K58A 3PO5A 3VQ8A 3SUNA 1RT1A 1KCFA 1ZBIA 4ELTA 3G10A 1WN7A 2O4IA 3AO5A 4CF0A 3NH1A 1ASWA 1RT3A 4DTNA 3RRHA 1NK7A 3KIOA 4ID5A 4FJNA 2OZMA 3ZSRA 3DLRA 3U6FA 4BDZA 5CZ2A 3PY8A 2IOCA 4B3OA 3SQ0A 4DTPA 3C6TA 1HPZA 1HYZA 4O44A 1LAWA 1NKBA 3M8PA 3O3HA 1HYSA 3MXJA 1SL2A 2HB5A 3ZSWA 1VSKA 1X9SA 4DSJA 3L2UA 4IDKA 4DSKA 4EZ6A 3I8DA 4LSNA 1C1CA 2FC0A 4M41A 3VQ6A 4DFPA 3TAFA 3DRPA 1I3AA 2YNHA 4OGEA 5JS1A 3SUQA 1WSFA 4M42A 4CGFA 2VWJA 4KI6A 4KREA 4DF8A 2DY4A 3DLHA 1SL0A 2HHQA 4H4OA 3OYFA 2FBYA 1KLMA 3KK2A 1WSIA 4B9TA 1VSLA 4FJMA 4Z4GA 4OKKA 3DOKA 2X74A 1FXXA 4CJWA 3QEVA 1D5AA 3L2WA 1S9EA 4OVLA 4AHVA 3DLEA 4CESA 1TV6A 4OJRA 3LZIA 3ZT0A 4AHRA 1C1BA 3VQ5A 1S6PA 1DTQA 4E19A 2PY5A 4RG8A 3PO4A 2OPPA 1JLFA 2YNGA 3B6OA 4E7HA 1RT6A 3A2FA 2BGGA 4B8CA 3SPYA 2RKIA 3QEIA 4JLHA 2G8FA 4DSFA 4FJIA 2JGUA 4HVJA 2ZE2A 2KQ2A 4DTJA 3THVA 4TSXA 4CECA 3SV3A 5HRNA 4DSIA 1NJWA 1CLQA 3F73A 2DFFA 4I9LA 1UA1A 2OPQA 2X6NA 3KTQA 1HRHA 2D0AA 3AVBA 3K5OA 4E1NA 3DI6A 4BWMA 5J2QA 4O0IA 3ZT4A 3ZSQA 2LSNA 3VQDA 1BL3A 2F8TA 1LW2A 1XC9A 4N41A 1C0MA 1RBUA 4F3TA 3OYNA 3CM6A 3VQCA 4CEAA 1FKOA 3NGZA 1SKSA 4FJLA 1ZBFA 2FBVA 3C95A 4CEZA 4CHPA 4HUEA 4KB1A 2YKNA 4CCHA 2A1SA 2ETJA 4W5RA 3AVAA 4Z4HA 4FJKA 1BQMA 4QCLA 3LZJA 1A5WA 4AH9A 2JLEA 1JLEA 3CFOA 3HO1A 2VG6A 3TAEA 3LP0A 4CJUA 3T3FA 3S3OA 3OYJA 3TABA 4KHQA 3AVHA 4FJGA 3NH0A 1T8EA 1BCMA 1WSHA 4ZTFA 3O3GA 3TAGA 4C8MA 3AA2A 3HM9A 3AVKA 4CJKA 2HHTA 2Z1HA 2KW4A 4OLAA 2RF2A 3K59A 4CEQA 3QINA 3E01A 3P83D 3O4NA 3DRSA 2B5JA 3OY9A 3OJSA 3U3YA 3QERA 2A1RA 1NJYA 2P5GA 4K8ZA 5FRNA 3OYAA 5DK5A 1RTJA 1RNHA 1KLNA 4Z0UA 4CHQA 1RDCA 4FJHA 3CQ8A 4CIGA 3QESA 3L2QA 4CIFA 1VSJA 2Z1GA 4F8RA 4CFDA 3F9KA 4W5OA 2XHBA 5FRMA 4B9LA 3RMBA 4CJ5A 2Z1JA 3ITHA 2KZZA 3HPHA 4CFBA 1VSEA 4O5BA 4Q0BA 1KTQA 4EZ9A 4PA1A 5DMRA 1ZBHA 4Q5VA 4OKEA 1MU2A 3AVMA 3QIOA 4RW8A 5EU7A 3VA0A 3SNNA 1J9AA 4CHYA 1TL3A 4DQRA 3SQ4A 4BDPA 3K5LA 2FBTA 4E7KA 3SQ1A 4Y1DA 4LD0A 3VQEA 3V9SA 4FJ7A 3NE6A 4FLWA 2GV9A 1ASUA 3RMDA 1UA0A 3HJFA 3K2PA 1NOZA 3TAQA 2I5JA 1KRPA 4FJ9A 4DG1A 1X9MA 3QNOA 3ZT3A 1UOCA 2YNFA 1NK6A 2VG7A 3VQQA 1TKTA 1R0AA 1HQUA 4LSLA 4O4GA 5CYQA 1Z26A 3HP9A 3IG1A 4CEEA 1KVAA 4DQQA 1CZBA 5C25A 3OS2A 4DU1A 5KRTA 3ISNC 4B08A 1U04A 2HMIA 1C1AA 1BI4A 4I7FA 3OS1A 1SKRA 1HQEA 1S1VA 2VG5A 4AHTA 3CFRA 1RTIA 1Z25A 1ZBUA 5J1EA 3LWMA 1WAFA 2YNIA 4DMNA 4N56A 2IGIA 1GOAA 4E1MA 3AA3A 4BE2A 1TKDA 3MEDA 1WAJA 4N47A 1TKXA 4FW1A 4HUFA 1NKEA 2D0CA 3M8RA 4N76A 2HNYA 3V9XA 3NF8A 4B8AB 1Q8IA 1X9WA 4PY5A 1XWLA 4LH5A 1DTTA 3I0SA 4RW7A 4W5QA 3EYZA 2DTUA 1WNSA 1KFDA 3RR7A 4KPYA 1JLQA 3MECA 2HHWA 1NK4A 2RPIA 4KV8A 4I2PA 4CK3A 2R7YA 4E7IA 1TKZA 3KKRA 4KTZA 3ZSVA 4DQSA 4DWIA 3RWUA 4MQ3A 2F8SA 1VK0A 3TAMA 3VQ7A 1HJRA 3O4QA 4CGIA 5HRPA 2PZSA 1BIUA 3OS0A 3AO2A 2G8UA 2ZD1A 3LP1A 1N6QA 5C24A 4NYFA 3VQBA 3ASMA 3KLEA 3M8SA 4JRPA 2PYJA 3NDKA 3O3FA 1W9HA 4EP5A 4DQPA 4CIEA 3MEGA 4BDYA 2HVIA 1D9FA 4CJEA 1LWEA 3LAMA 3MXIA 2G8VA 4NCBA 5HROA 3RMCA 3JYTA 4L8RB 1F21A 3RR8A 2YHAA 1B9DA 1BQNA 4IBNA 3OYIA 3HVTA 4DSEA 1NK5A 1NK9A 2D5RA 4B9NA 4E3SA 3HP6A 4FK4A 1XI1A 1FKPA 3HPGA 3V9WA 2Y1JA 4NCAA 3KD1E 1YVUA 1RBVA 2XO7A 1A5XA 4CHNA 3SV4A 1JL2A 2XRIA 4OKJA 4DTUA 1JKHA 1NJZA 4FXDA 4DFMA 1J54A 2BDPA 1BI4B 1QE1A 1ASVA 3TARA 4IFVA 2QKBA 3NGYA 4FVMA 4KO0A 4C8NA 1QS4A 4M3RA 4HTUA 3ZT1A 1NK0A 4DFKA 3S3NA 1KSPA 5K14A 3LP3A 3V9ZA 3DLBA 4PWDA 4PQUA 4CJFA 3WNHA 2EHGA 3KJVA 1JLBA 4J2DA 3U3GA 4FZXC 3WNEA 2XY7A 2OPSA 1BCOA 4DF4A 4CJSA 1K6YA 1EXQA 3CYMA 4KKOA 4J2BA 3S9HA 1CZ9A 4FLTA 4DU3A 4CK2A 1QQCA 1RBTA 1U47A 4M3YA 3IRXA 4J2EA 3HPOA 3I0RA 1YTUA 4LH4A 5C42A 4HUGA 1BGXT 1EKEA 3OYEA 5HRRA 3C6UA 1RTHA 1JXBA 4H4MA 3AV9A 3WNGA 3HSTB 4MFBA 4XIUA 1U48A 4CEOA 5I42A 4EP4A 3PX4A 1WSJA 4KTWA 4C8OA 3UIQA 2KFZA 2W42A 1LW0A 1IKYA 3TI0A 1TVRA 4E7JA 4HHTA 4WE1A 4Z4EA 3NCIA 4ZTJA 1VSFA 3NH2A 2O4GA 4DTSA 3LAKA 3AVCA 1KFSA 1XHXA 1X1PA 2BANA 1U49A 4CERA 1IKWA 2E4LA 4HCCA 5KRSA 1REVA 5CY4A 1KVBA 1SL1A 1S9GA 4FJ5A 4Z4IA 4NCGA 2E6LA 1CXQA 4OGCA 3WNFA 4ZHRA 3LALA 3NGIA 4BE0A 3ZSZA 1HYVA 3DOLA 4DS5A 3AO4A 1LAVA 5JS2A 1NKCA 1TK5A 2ZQBA 4DLGA 3OYHA 2YHBA 3AVLA 1JL1A 3AVGA 4G1QA 4KTQA 3VQ4A 3HYFA 4IFYA 1HNIA 1RT2A 3NAEA 4CE9A 1T7PA 2YV0X 3C94A 2D0BA 3QLHA 4DS4A 1VRTA 3DM2A 4FLVA 1YTAA 4ICLA 3KLGA 3KLFA 4KHSA 3QEXA 2Y1IA 4K8XA 1S1XA 3SJJA 4DTRA 1C0TA 1QHTA 1IO2A 4RW6A 4KHYA 5CZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KK1 A;  1NK8 A;  1U4B A;  4DTO A;  4FZY A;  2IC3 A;  3V1Q A;  1RT7 A;  2G8I A;  1ZYQ A;  2HHU A;  4W5T A;  3TR8 A;  1DLO A;  2IDO A;  2WON A;  3H08 A;  4CJR A;  2Z1I A;  2F96 A;  2X6S A;  1LWF A;  5J2P A;  4B9M A;  4RW9 A;  1UAX A;  5HBM A;  5J2M A;  4O0J A;  3AA4 A;  2G8K A;  4J2A A;  4M45 A;  4KAZ A;  1RTD A;  2Q3S A;  1J53 A;  2ITG A;  5FDL A;  1JXE A;  3V1O A;  1JLA A;  2B4J A;  2BE2 A;  1EP4 A;  4KRF A;  2HVH A;  1RIL A;  4IG3 A;  5KTQ A;  4IG0 A;  3OYM A;  4F2S A;  1NJX A;  4CFC A;  2IAJ A;  1JLG A;  4FM2 A;  1D9D A;  3L8B A;  3KLH A;  2GBZ A;  4AHC A;  3LP2 A;  4CJQ A;  3B6P A;  4BE1 A;  2XY6 A;  1ZBL A;  4CED A;  1S1W A;  3QNN A;  3K5M A;  1QSL A;  4E7L A;  3OYB A;  2HW3 A;  3QEP A;  4AHU A;  4FLX A;  1CXU A;  1I39 A;  2OZS A;  3ZCM A;  4I9Q A;  1SV5 A;  2FBX A;  3LWL A;  3V9U A;  1BHL A;  3VN5 A;  2X78 A;  4FK2 A;  3TWH A;  1D8Y A;  3IAY A;  2P1J A;  1J5O A;  3BDP A;  4FJX A;  3DLG A;  3KLI A;  1NOY A;  3ULD A;  2QKK A;  4KI4 A;  4M3U A;  1S5J A;  2G8H A;  1KVC A;  4CJ4 A;  1SKW A;  5SWM A;  3T1A A;  1TGO A;  5KGX A;  1QSS A;  4KB0 A;  1RT4 A;  1TL1 A;  3MAQ A;  4KHN A;  4M3X A;  3HK2 A;  4JRQ A;  1WLJ A;  4RW4 A;  2QK9 A;  1VSM A;  3CM5 A;  4N5S A;  3JSM A;  4QOZ B;  4PUO A;  4I2Q A;  4B9V A;  1B9F A;  3V1R A;  4CF2 A;  3SYZ A;  4DSL A;  3OYC A;  3QET A;  4FLY A;  4Z4C A;  5KGW A;  4CJT A;  3RMA A;  2HND A;  4DLE A;  3OVN A;  1ITG A;  4HCB A;  3DMJ A;  2KFN A;  3VQA A;  3SQ2 A;  1IKX A;  3KD5 E;  1VSH A;  1HMV A;  4O55 A;  1RDB A;  3AVF A;  4B9S A;  1L3S A;  2RN2 A;  4AHS A;  4M3W A;  5FRO A;  2OA8 A;  3HXM A;  4CEF A;  4KHU A;  1RBS A;  1GOB A;  4ELV A;  1FK9 A;  2HHV A;  3NBP A;  2XY8 A;  4JS5 A;  4BAC A;  1RDA A;  4GW6 A;  3DYA A;  1IH7 A;  4NYN A;  1VSD A;  1S1T A;  4OPJ A;  3MEE A;  2OYQ A;  2IS3 A;  3L2V A;  4CK1 A;  2G8W A;  3G0Z A;  3LPU A;  3M8Q A;  4CGD A;  4C8L A;  3L3U A;  3VQP A;  3AA5 X;  4KFB A;  3NHG A;  4E89 A;  3SUO A;  2ATQ A;  4W5N A;  3AO3 A;  2HNZ A;  3AVJ A;  4FJJ A;  4YFU A;  1XHZ A;  5J2N A;  1C6V A;  3MXM A;  3V6D A;  4B9U A;  3DRR A;  3T19 A;  2GUI A;  3OJU A;  1GOC A;  1RBR A;  2VWK A;  4E0D A;  1TK0 A;  1B92 A;  4ID1 A;  3L3V A;  4FLZ A;  3SUP A;  3NFA A;  3V4I A;  4ELU A;  2KZM A;  4CF8 A;  1A5V A;  3K5N A;  4Z4F A;  3P5J A;  3IS9 A;  4LY7 A;  1RT5 A;  4AIL C;  3RRG A;  5D3G A;  4FM0 A;  3PUF A;  3OYD A;  1WSE A;  2DFE A;  4CEB A;  4M3Z A;  1IKV A;  4FJ8 A;  1VRU A;  4IKF A;  2WOM A;  2PYL A;  4DQI A;  1RDD A;  3PX6 A;  1LV5 A;  3V81 A;  3PX0 A;  3EY1 A;  4Y1C A;  4CHO A;  4KHW A;  4H8K A;  4DTX A;  2OPR A;  3QO9 A;  1Y97 A;  4CF1 A;  1L3U A;  3NF9 A;  3NF6 A;  3HVR A;  4JS4 A;  2EX3 A;  2QXF A;  2XY5 A;  5HP1 A;  1U45 A;  1HNV A;  4CJV A;  4OPK A;  3D0P A;  1BIS A;  4UQG A;  3LPT A;  3QEW A;  4CGH A;  1L5U A;  1UWB A;  4M3T A;  5HRS A;  3ZSY A;  4CHZ A;  1W0H A;  4FZZ A;  3D45 A;  4FLU A;  4C8K A;  3SZ2 A;  1JLC A;  3P1G A;  4CJP A;  3OYK A;  5T7B A;  3ZSX A;  3SCX A;  1LWC A;  3TAP A;  1Q9X A;  3HT3 A;  3RTV A;  5SZT A;  4FYD A;  3BGR A;  2B6A A;  2KTQ A;  3OYL A;  4CF9 A;  1QSY A;  4GMJ B;  4FCY A;  3QIP A;  2HHS A;  2AJQ A;  3VQ9 A;  2P5O A;  4YNQ A;  1TK8 A;  5CYM A;  3LAN A;  3LDS A;  1L3V A;  1G15 A;  4CFA A;  4GVM A;  4CGJ A;  1VSI A;  3TAN A;  2E6M A;  3EZ5 A;  2P51 A;  1QTM A;  3CFP A;  4F4K A;  3KK3 A;  3AVI A;  3DLK A;  3SI6 A;  4DFJ A;  3ALY A;  1IG9 A;  1TAU A;  3PV8 A;  4F2R A;  5HLF A;  4DTM A;  3NF7 A;  4R5P A;  4FM1 A;  1BIZ A;  1WSG A;  1TAQ A;  1RCH A;  3HL8 A;  1EX4 A;  4FW2 A;  1Q9Y A;  3K57 A;  1N5Y A;  1T05 A;  3FFI A;  3OYG A;  4DU4 A;  2HHX A;  4BWJ A;  5I3U A;  1O1W A;  3S3M A;  1S6Q A;  3KKS A;  3SPZ A;  4OLB A;  4CGG A;  3VA3 A;  1S1U A;  4FK0 A;  3ZSO A;  1T03 A;  1L3T A;  4CJ3 A;  1YT3 A;  2YKM A;  4F3O A;  1EET A;  3L2R A;  4CJL A;  2NUB A;  3AVN A;  3ZT2 A;  5KI6 A;  2DFH A;  1C0U A;  1SUQ A;  3CG7 A;  3AO1 A;  4QAG A;  5E41 A;  3K58 A;  3PO5 A;  3VQ8 A;  3SUN A;  1RT1 A;  1KCF A;  1ZBI A;  4ELT A;  3G10 A;  1WN7 A;  2O4I A;  3AO5 A;  4CF0 A;  3NH1 A;  1ASW A;  1RT3 A;  4DTN A;  3RRH A;  1NK7 A;  3KIO A;  4ID5 A;  4FJN A;  2OZM A;  3ZSR A;  3DLR A;  3U6F A;  4BDZ A;  5CZ2 A;  3PY8 A;  2IOC A;  4B3O A;  3SQ0 A;  4DTP A;  3C6T A;  1HPZ A;  1HYZ A;  4O44 A;  1LAW A;  1NKB A;  3M8P A;  3O3H A;  1HYS A;  3MXJ A;  1SL2 A;  2HB5 A;  3ZSW A;  1VSK A;  1X9S A;  4DSJ A;  3L2U A;  4IDK A;  4DSK A;  4EZ6 A;  3I8D A;  4LSN A;  1C1C A;  2FC0 A;  4M41 A;  3VQ6 A;  4DFP A;  3TAF A;  3DRP A;  1I3A A;  2YNH A;  4OGE A;  5JS1 A;  3SUQ A;  1WSF A;  4M42 A;  4CGF A;  2VWJ A;  4KI6 A;  4KRE A;  4DF8 A;  2DY4 A;  3DLH A;  1SL0 A;  2HHQ A;  4H4O A;  3OYF A;  2FBY A;  1KLM A;  3KK2 A;  1WSI A;  4B9T A;  1VSL A;  4FJM A;  4Z4G A;  4OKK A;  3DOK A;  2X74 A;  1FXX A;  4CJW A;  3QEV A;  1D5A A;  3L2W A;  1S9E A;  4OVL A;  4AHV A;  3DLE A;  4CES A;  1TV6 A;  4OJR A;  3LZI A;  3ZT0 A;  4AHR A;  1C1B A;  3VQ5 A;  1S6P A;  1DTQ A;  4E19 A;  2PY5 A;  4RG8 A;  3PO4 A;  2OPP A;  1JLF A;  2YNG A;  3B6O A;  4E7H A;  1RT6 A;  3A2F A;  2BGG A;  4B8C A;  3SPY A;  2RKI A;  3QEI A;  4JLH A;  2G8F A;  4DSF A;  4FJI A;  2JGU A;  4HVJ A;  2ZE2 A;  2KQ2 A;  4DTJ A;  3THV A;  4TSX A;  4CEC A;  3SV3 A;  5HRN A;  4DSI A;  1NJW A;  1CLQ A;  3F73 A;  2DFF A;  4I9L A;  1UA1 A;  2OPQ A;  2X6N A;  3KTQ A;  1HRH A;  2D0A A;  3AVB A;  3K5O A;  4E1N A;  3DI6 A;  4BWM A;  5J2Q A;  4O0I A;  3ZT4 A;  3ZSQ A;  2LSN A;  3VQD A;  1BL3 A;  2F8T A;  1LW2 A;  1XC9 A;  4N41 A;  1C0M A;  1RBU A;  4F3T A;  3OYN A;  3CM6 A;  3VQC A;  4CEA A;  1FKO A;  3NGZ A;  1SKS A;  4FJL A;  1ZBF A;  2FBV A;  3C95 A;  4CEZ A;  4CHP A;  4HUE A;  4KB1 A;  2YKN A;  4CCH A;  2A1S A;  2ETJ A;  4W5R A;  3AVA A;  4Z4H A;  4FJK A;  1BQM A;  4QCL A;  3LZJ A;  1A5W A;  4AH9 A;  2JLE A;  1JLE A;  3CFO A;  3HO1 A;  2VG6 A;  3TAE A;  3LP0 A;  4CJU A;  3T3F A;  3S3O A;  3OYJ A;  3TAB A;  4KHQ A;  3AVH A;  4FJG A;  3NH0 A;  1T8E A;  1BCM A;  1WSH A;  4ZTF A;  3O3G A;  3TAG A;  4C8M A;  3AA2 A;  3HM9 A;  3AVK A;  4CJK A;  2HHT A;  2Z1H A;  2KW4 A;  4OLA A;  2RF2 A;  3K59 A;  4CEQ A;  3QIN A;  3E01 A;  3P83 D;  3O4N A;  3DRS A;  2B5J A;  3OY9 A;  3OJS A;  3U3Y A;  3QER A;  2A1R A;  1NJY A;  2P5G A;  4K8Z A;  5FRN A;  3OYA A;  5DK5 A;  1RTJ A;  1RNH A;  1KLN A;  4Z0U A;  4CHQ A;  1RDC A;  4FJH A;  3CQ8 A;  4CIG A;  3QES A;  3L2Q A;  4CIF A;  1VSJ A;  2Z1G A;  4F8R A;  4CFD A;  3F9K A;  4W5O A;  2XHB A;  5FRM A;  4B9L A;  3RMB A;  4CJ5 A;  2Z1J A;  3ITH A;  2KZZ A;  3HPH A;  4CFB A;  1VSE A;  4O5B A;  4Q0B A;  1KTQ A;  4EZ9 A;  4PA1 A;  5DMR A;  1ZBH A;  4Q5V A;  4OKE A;  1MU2 A;  3AVM A;  3QIO A;  4RW8 A;  5EU7 A;  3VA0 A;  3SNN A;  1J9A A;  4CHY A;  1TL3 A;  4DQR A;  3SQ4 A;  4BDP A;  3K5L A;  2FBT A;  4E7K A;  3SQ1 A;  4Y1D A;  4LD0 A;  3VQE A;  3V9S A;  4FJ7 A;  3NE6 A;  4FLW A;  2GV9 A;  1ASU A;  3RMD A;  1UA0 A;  3HJF A;  3K2P A;  1NOZ A;  3TAQ A;  2I5J A;  1KRP A;  4FJ9 A;  4DG1 A;  1X9M A;  3QNO A;  3ZT3 A;  1UOC A;  2YNF A;  1NK6 A;  2VG7 A;  3VQQ A;  1TKT A;  1R0A A;  1HQU A;  4LSL A;  4O4G A;  5CYQ A;  1Z26 A;  3HP9 A;  3IG1 A;  4CEE A;  1KVA A;  4DQQ A;  1CZB A;  5C25 A;  3OS2 A;  4DU1 A;  5KRT A;  3ISN C;  4B08 A;  1U04 A;  2HMI A;  1C1A A;  1BI4 A;  4I7F A;  3OS1 A;  1SKR A;  1HQE A;  1S1V A;  2VG5 A;  4AHT A;  3CFR A;  1RTI A;  1Z25 A;  1ZBU A;  5J1E A;  3LWM A;  1WAF A;  2YNI A;  4DMN A;  4N56 A;  2IGI A;  1GOA A;  4E1M A;  3AA3 A;  4BE2 A;  1TKD A;  3MED A;  1WAJ A;  4N47 A;  1TKX A;  4FW1 A;  4HUF A;  1NKE A;  2D0C A;  3M8R A;  4N76 A;  2HNY A;  3V9X A;  3NF8 A;  4B8A B;  1Q8I A;  1X9W A;  4PY5 A;  1XWL A;  4LH5 A;  1DTT A;  3I0S A;  4RW7 A;  4W5Q A;  3EYZ A;  2DTU A;  1WNS A;  1KFD A;  3RR7 A;  4KPY A;  1JLQ A;  3MEC A;  2HHW A;  1NK4 A;  2RPI A;  4KV8 A;  4I2P A;  4CK3 A;  2R7Y A;  4E7I A;  1TKZ A;  3KKR A;  4KTZ A;  3ZSV A;  4DQS A;  4DWI A;  3RWU A;  4MQ3 A;  2F8S A;  1VK0 A;  3TAM A;  3VQ7 A;  1HJR A;  3O4Q A;  4CGI A;  5HRP A;  2PZS A;  1BIU A;  3OS0 A;  3AO2 A;  2G8U A;  2ZD1 A;  3LP1 A;  1N6Q A;  5C24 A;  4NYF A;  3VQB A;  3ASM A;  3KLE A;  3M8S A;  4JRP A;  2PYJ A;  3NDK A;  3O3F A;  1W9H A;  4EP5 A;  4DQP A;  4CIE A;  3MEG A;  4BDY A;  2HVI A;  1D9F A;  4CJE A;  1LWE A;  3LAM A;  3MXI A;  2G8V A;  4NCB A;  5HRO A;  3RMC A;  3JYT A;  4L8R B;  1F21 A;  3RR8 A;  2YHA A;  1B9D A;  1BQN A;  4IBN A;  3OYI A;  3HVT A;  4DSE A;  1NK5 A;  1NK9 A;  2D5R A;  4B9N A;  4E3S A;  3HP6 A;  4FK4 A;  1XI1 A;  1FKP A;  3HPG A;  3V9W A;  2Y1J A;  4NCA A;  3KD1 E;  1YVU A;  1RBV A;  2XO7 A;  1A5X A;  4CHN A;  3SV4 A;  1JL2 A;  2XRI A;  4OKJ A;  4DTU A;  1JKH A;  1NJZ A;  4FXD A;  4DFM A;  1J54 A;  2BDP A;  1BI4 B;  1QE1 A;  1ASV A;  3TAR A;  4IFV A;  2QKB A;  3NGY A;  4FVM A;  4KO0 A;  4C8N A;  1QS4 A;  4M3R A;  4HTU A;  3ZT1 A;  1NK0 A;  4DFK A;  3S3N A;  1KSP A;  5K14 A;  3LP3 A;  3V9Z A;  3DLB A;  4PWD A;  4PQU A;  4CJF A;  3WNH A;  2EHG A;  3KJV A;  1JLB A;  4J2D A;  3U3G A;  4FZX C;  3WNE A;  2XY7 A;  2OPS A;  1BCO A;  4DF4 A;  4CJS A;  1K6Y A;  1EXQ A;  3CYM A;  4KKO A;  4J2B A;  3S9H A;  1CZ9 A;  4FLT A;  4DU3 A;  4CK2 A;  1QQC A;  1RBT A;  1U47 A;  4M3Y A;  3IRX A;  4J2E A;  3HPO A;  3I0R A;  1YTU A;  4LH4 A;  5C42 A;  4HUG A;  1BGX T;  1EKE A;  3OYE A;  5HRR A;  3C6U A;  1RTH A;  1JXB A;  4H4M A;  3AV9 A;  3WNG A;  3HST B;  4MFB A;  4XIU A;  1U48 A;  4CEO A;  5I42 A;  4EP4 A;  3PX4 A;  1WSJ A;  4KTW A;  4C8O A;  3UIQ A;  2KFZ A;  2W42 A;  1LW0 A;  1IKY A;  3TI0 A;  1TVR A;  4E7J A;  4HHT A;  4WE1 A;  4Z4E A;  3NCI A;  4ZTJ A;  1VSF A;  3NH2 A;  2O4G A;  4DTS A;  3LAK A;  3AVC A;  1KFS A;  1XHX A;  1X1P A;  2BAN A;  1U49 A;  4CER A;  1IKW A;  2E4L A;  4HCC A;  5KRS A;  1REV A;  5CY4 A;  1KVB A;  1SL1 A;  1S9G A;  4FJ5 A;  4Z4I A;  4NCG A;  2E6L A;  1CXQ A;  4OGC A;  3WNF A;  4ZHR A;  3LAL A;  3NGI A;  4BE0 A;  3ZSZ A;  1HYV A;  3DOL A;  4DS5 A;  3AO4 A;  1LAV A;  5JS2 A;  1NKC A;  1TK5 A;  2ZQB A;  4DLG A;  3OYH A;  2YHB A;  3AVL A;  1JL1 A;  3AVG A;  4G1Q A;  4KTQ A;  3VQ4 A;  3HYF A;  4IFY A;  1HNI A;  1RT2 A;  3NAE A;  4CE9 A;  1T7P A;  2YV0 X;  3C94 A;  2D0B A;  3QLH A;  4DS4 A;  1VRT A;  3DM2 A;  4FLV A;  1YTA A;  4ICL A;  3KLG A;  3KLF A;  4KHS A;  3QEX A;  2Y1I A;  4K8X A;  1S1X A;  3SJJ A;  4DTR A;  1C0T A;  1QHT A;  1IO2 A;  4RW6 A;  4KHY A;  5CZ1 A; 
#chains in the Genus database with same CATH topology
 1NK8 A;  4FL9 A;  2ASO A;  4FZY A;  5JLF A;  3DXK A;  1RT7 A;  2G8I A;  4BR5 A;  4JI1 K;  2HHU A;  3WT0 A;  4W5T A;  1DLO A;  2IDO A;  3H08 A;  3QIC A;  1LWF A;  4RW9 A;  1UAX A;  2O8D A;  1RTD A;  2ZJR L;  5FPE A;  3QFU A;  5H1S Q;  1YUW A;  4KRF A;  2HVH A;  4IOX A;  4BR7 A;  4IG3 A;  4JI0 K;  2IAJ A;  4FM2 A;  5C10 A;  4BE1 A;  4LF7 K;  1S1W A;  4CD1 A;  2GTD A;  2OTL N;  2OCE A;  2QEX N;  4AHU A;  4EHT A;  3I8B A;  2QTD A;  2X78 A;  3BZC A;  1K73 O;  4FK2 A;  3LDL A;  3KLI A;  3FLC O;  1NGC A;  5AZI A;  3VGL A;  4KI4 A;  2A42 A;  1QSS A;  3HK2 A;  3MAQ A;  1TYQ A;  3CCS N;  4QOZ B;  4PUO A;  4B9V A;  1YJW N;  4WQ5 A;  3UB5 A;  4GKK K;  4EIA A;  3ATU A;  4FLY A;  4CW7 B;  4KBO A;  3UKR B;  1ITG A;  3VQA A;  4BC2 A;  4BRD A;  1ZXO A;  4M3W A;  5FRO A;  4BR9 A;  3DXM B;  3HXM A;  1VQL N;  3FR0 A;  1RBS A;  1GOB A;  1SQK A;  3WUH A;  2XY8 A;  5TKY A;  3BEX A;  4GW6 A;  1IH7 A;  5AZJ A;  5E84 A;  1NNE A;  3L6Q A;  2WFB A;  4E89 A;  3SUO A;  2ATQ A;  1JCG A;  4IOC L;  1ATS A;  4YFU A;  5EOY A;  1C6V A;  3V6D A;  3DRR A;  2GUI A;  1RBR A;  3I55 N;  5KQD A;  4BG9 A;  2NNW A;  2V51 B;  3U9Z A;  2P9S A;  5AQZ A;  2IVO A;  3OYD A;  1WSE A;  4M3Z A;  2O8B B;  1VRU A;  2WOM A;  2PYL A;  4DQI A;  3EY1 A;  4Y1C A;  4CHO A;  3O6W A;  4H8K A;  3TU5 A;  4DTX A;  4V19 S;  3NF9 A;  2EX3 A;  4NLB A;  5HP1 A;  4OPK A;  3CCQ N;  1D4X A;  1BIS A;  4CVN E;  4FLU A;  3MWT A;  1JLC A;  4CJP A;  3NMU A;  1LWC A;  3HT3 A;  2B6A A;  3KWI A;  2KTQ A;  3OYL A;  2NZT A;  1HX1 A;  1VQ5 N;  4A2A A;  2E20 A;  3CF5 L;  2PFU A;  5GIP A;  2NRX A;  2E6M A;  4IO8 A;  3EZ5 A;  3CFP A;  2D1K A;  3ALY A;  1IG9 A;  3D2E B;  1TAU A;  5HLF A;  3NF7 A;  1MWM A;  3HRG A;  3TTC A;  1EX4 A;  1Q9Y A;  5AQK A;  1J6Z A;  3FE1 A;  4H5V A;  1IG8 A;  1KAX A;  2HHX A;  2HF4 A;  5E26 A;  4BWJ A;  1S6Q A;  3KKS A;  3SPZ A;  2NRW A;  4FWS A;  4FK0 A;  1T03 A;  4Z94 A;  4CJL A;  3AVN A;  5GAE P;  4QAG A;  1Q82 O;  3VEO A;  3PO5 A;  3VQ8 A;  5BPM A;  4DR7 K;  3E66 A;  5C15 A;  2O8F A;  2BTF A;  2FF3 B;  2QM1 A;  3NH1 A;  3GG4 A;  3LDN A;  1NK7 A;  4ID5 A;  1BO5 O;  1DT9 A;  2WTU A;  4NO7 A;  3SQ0 A;  3M8P A;  3O3H A;  3FGU A;  4BRG A;  4OPH A;  4DQ8 A;  1X9S A;  1SL2 A;  4DR2 K;  2O8C A;  2FC0 A;  3VQ6 A;  4R79 A;  3VF2 A;  4OGE A;  1WSF A;  4LF5 K;  4DV5 K;  4DF8 A;  3WXK A;  3DLH A;  1SL0 A;  1RFQ A;  3VF4 A;  2FBY A;  3OYF A;  1VSL A;  4OKK A;  1H1V A;  1D5A A;  4OVL A;  2QWL A;  3ZYY X;  4JD2 B;  1T3V A;  4WQ4 A;  4NXN K;  3ZLJ A;  3RVC A;  3L0Q A;  5AQO A;  3CCE N;  4E19 A;  4RG8 A;  4DV6 K;  2A40 A;  4GY2 B;  3B6O A;  4E7H A;  4FJI A;  4DSF A;  3H1Q A;  4HVJ A;  3THV A;  3CQX A;  4TSX A;  1U2V A;  1CLQ A;  3KTQ A;  2X6N A;  1HRH A;  4E1N A;  4O0I A;  3VQD A;  5JLH A;  4IFE A;  3P39 A;  1XC9 A;  4RTF D;  5HL7 L;  5GAD P;  2FBV A;  4KB1 A;  3L4I A;  2YKN A;  5KPT A;  2ETJ A;  3AVA A;  4HWI A;  4AH9 A;  3T3F A;  4KHQ A;  3AVH A;  2BH1 A;  3F9M A;  5AQL A;  3AGK A;  1LOT B;  1CZA N;  4RCH A;  3QBW A;  3L4Q A;  3OJS A;  2A1R A;  2F7T A;  2P5G A;  3OYA A;  5DK5 A;  4DV1 K;  4CZL A;  1RNH A;  4CHQ A;  1RDC A;  4FJH A;  3CQ8 A;  4DR5 K;  2W6K A;  4YOT A;  5FRM A;  5CHI A;  4CJ5 A;  3RMB A;  3ITH A;  3HPH A;  4KHP K;  1KTQ A;  4Y0W A;  1ZBH A;  4Q5V A;  4IJN A;  1MU2 A;  3QIO A;  3SNN A;  2ZWH A;  1X3N A;  3K5L A;  3ZEU A;  3V9S A;  1OH5 A;  1YJ9 N;  3J7Y P;  2O8E B;  1ASU A;  3RMD A;  3HJF A;  3K2P A;  3EO3 A;  1NOZ A;  2YJF A;  2I5J A;  4B3R K;  4FJ9 A;  1X9M A;  3GBT A;  4KH6 A;  3ZT3 A;  3ENB A;  2E1Z A;  2YNF A;  3AGR A;  1NK6 A;  2E1Y A;  1YI2 N;  1HQU A;  4LSL A;  3HP9 A;  3IG1 A;  4H5R A;  4CEE A;  5HOO A;  1CZB A;  4DU1 A;  5KRT A;  2E2N A;  1YJN N;  4B08 A;  4DUZ K;  1BI4 A;  4I7F A;  5JVH L;  2VG5 A;  3CFR A;  4GVE A;  5J1E A;  3AY9 A;  4BE2 A;  3KK7 A;  1V4S A;  5LJV A;  1WAJ A;  4HUF A;  4JI3 K;  4JKD A;  3U4L A;  2D0C A;  4BRA A;  4N76 A;  5CR4 A;  4PY5 A;  3NF8 A;  3SMP A;  1Q8I A;  3ZX2 A;  3T1H K;  5LJW A;  3I0S A;  2W6L A;  2OAN A;  4KPY A;  3K9K A;  2RPI A;  3RWU A;  1TKZ A;  4KTZ A;  4DWI A;  4CGI A;  3TAM A;  3CJ1 A;  4B1V A;  3O9R A;  3OS0 A;  2G8U A;  2ZD1 A;  5C24 A;  3VQB A;  2QWP A;  4EP5 A;  3W0L A;  4BDY A;  2ZGY A;  1N8R O;  1N34 K;  1D9F A;  3O9Q A;  3ZEU B;  4L8R B;  3RR8 A;  3C6H A;  1B9D A;  4DSE A;  4IBN A;  3CCJ N;  2D5R A;  2GX9 A;  1OH8 A;  4LC9 B;  4DR1 K;  3HP6 A;  1HLU A;  2Y1J A;  4X62 K;  1MDU B;  4CHN A;  4DTU A;  1NJZ A;  1NG9 A;  3M1F A;  1BI4 B;  3T69 A;  4H5T A;  4FVM A;  3QFP A;  4M3R A;  3EL2 A;  1KXP A;  1OKJ A;  2E88 A;  4IEE A;  5K14 A;  4B1Y B;  3V9Z A;  4FWP A;  2P9P A;  4MDB A;  3WNH A;  2EHG A;  3KJV A;  2OPS A;  1BCO A;  1DKG D;  1EXQ A;  3P4I A;  3S9H A;  1CZ9 A;  4FLT A;  1RBT A;  1U47 A;  1ESV A;  3M6G A;  4J2E A;  3I0R A;  5C42 A;  1RTH A;  1JXB A;  3AV9 A;  4MFB A;  4KTW A;  1NGB A;  2W42 A;  1LW0 A;  3TI0 A;  2HBK A;  2NRR A;  1FW6 A;  2ZF5 O;  2BAN A;  1HJO A;  4CER A;  3J7A P;  1IKW A;  2E4L A;  1EQY A;  1KVB A;  1SL1 A;  4DR3 K;  4JI4 K;  1S9G A;  4CZJ A;  4DKW A;  4CD3 A;  3NGI A;  3ZSZ A;  4DS5 A;  3AO4 A;  5BPN A;  1LAV A;  4JK8 A;  3IMX A;  1TK5 A;  4YY3 K;  1XNQ K;  3GL1 A;  4MO5 A;  3VQ4 A;  4BRE A;  1HNI A;  3SBG A;  2D0B A;  2IIR A;  1VRT A;  2IVN A;  4ICL A;  2Y1I A;  4DB3 A;  1C0T A;  3OBW A;  3CXC M;  2HOE A;  1IO2 A;  4KHY A;  5CZ1 A;  3KK1 A;  4DTO A;  4H0P A;  4WFA L;  2GEM A;  1WOQ A;  4FWN A;  2Z1I A;  4JKB A;  4B9M A;  1IBK K;  5AQU A;  5HBM A;  5J2M A;  3AA4 A;  4J2A A;  4M45 A;  4KAZ A;  3CCV N;  2Q3S A;  5FDL A;  5GIN A;  1JXE A;  3V1O A;  4H0V B;  2B4J A;  1EP4 A;  4C1N K;  1K8K B;  4K43 A;  1RIL A;  1JLG A;  1D9D A;  4XH4 A;  2GBZ A;  4WFN L;  3P31 A;  5LMN K;  4YOU A;  3QNN A;  5M1Q A;  4E7L A;  4BRI A;  4GV9 A;  2HW3 A;  3QEP A;  3C7N A;  2OZS A;  3GOI A;  3TTF A;  4JV5 K;  2FBX A;  3V9U A;  1BHL A;  3VN5 A;  3TWH A;  3VOV A;  3WEE B;  1J5O A;  4FJX A;  3MMV A;  4A5A A;  3N4P A;  3THX A;  3ULD A;  2VWB A;  1S5J A;  2G8H A;  4KB0 A;  4M3X A;  4KHN A;  4RW4 A;  3LM2 A;  3CM5 A;  3TPQ A;  2ITM A;  4N5S A;  4YOW A;  2ZM6 K;  4YOR A;  1B9F A;  4CF2 A;  2HF3 A;  3OYC A;  1HNW K;  4JKG A;  3RMA A;  3DMJ A;  2F9W A;  4PKI A;  3SQ2 A;  4E1J A;  3E9O A;  4B9S A;  3D2F B;  2PBD A;  4A59 A;  4OO1 J;  4CEF A;  4AQY K;  4KHU A;  1VQ6 N;  4ELV A;  3VF6 A;  1FK9 A;  3NBP A;  4EAH D;  3TSP A;  3DYA A;  4NYN A;  1HUX A;  4OPJ A;  3MEE A;  2OYQ A;  2IS3 A;  3L2V A;  4A61 A;  3LPU A;  4C8L A;  3MN6 A;  3NHG A;  3U8X A;  2HNZ A;  3VTI A;  4FJJ A;  4JI6 K;  1XHZ A;  3A5M C;  2VWK A;  4E0D A;  1TK0 A;  4CZE A;  4CF8 A;  3K5N A;  2P9U B;  3THX B;  1VQM N;  4AIL C;  1RT5 A;  1OVQ A;  3VEN A;  1T6C A;  3WXJ A;  3ENO A;  4FM0 A;  4CEB A;  2DFE A;  4FJ8 A;  3LDQ A;  4MLH A;  1LV5 A;  1RDW X;  2QXL A;  3PX0 A;  3KZB A;  1QQO A;  3CPE A;  3T7Z A;  3HVR A;  2XY5 A;  1HNV A;  4CJV A;  3D0P A;  4JKG B;  5ADX A;  1L5U A;  1UWB A;  3MX5 A;  4CHZ A;  4FZZ A;  3D45 A;  4LF4 K;  4FPA A;  1ATN A;  3SZ2 A;  5T7B A;  3SCX A;  4IO9 L;  4U7B A;  1Q9X A;  4FYD A;  1QSY A;  4BRK A;  3MWP A;  4GMJ B;  4FCY A;  3ZET A;  1XMQ K;  4CBW A;  4ISF A;  4JK9 A;  2AJQ A;  3VQ9 A;  1TUU A;  1VQK N;  5CYM A;  5M1F A;  3FZF A;  1RGI A;  2VGN A;  3TAN A;  5JS1 A;  1VSI A;  2P51 A;  4DFJ A;  3PV8 A;  4FM1 A;  2GWK A;  1BIZ A;  1TAQ A;  4FWM A;  5BR8 K;  1GLE G;  1N5Y A;  1T05 A;  2ZGZ A;  4BQL A;  3S3M A;  4CJ7 A;  1S1U A;  1L3T A;  4CJ3 A;  1YT3 A;  4F3O A;  2P9K A;  3L2R A;  2FF6 A;  1SUQ A;  3AO1 A;  1NLV A;  1NU0 A;  1KCF A;  1RT1 A;  4FO0 A;  1WN7 A;  2O4I A;  1WBB A;  5AQF A;  1ASW A;  1RT3 A;  4OX9 K;  5GAH P;  4FWK A;  4FJN A;  2I7N A;  3ENH A;  2OZM A;  3M3Z A;  3JS6 A;  4BDZ A;  3PY8 A;  4B3O A;  4K0K K;  5BPL A;  3UKU A;  2HB5 A;  4EZ6 A;  3I8D A;  4LSN A;  1C1C A;  4DFP A;  4M41 A;  3ZET B;  2YNH A;  3SUQ A;  1NGA A;  3DXK B;  3Q7B A;  2HHQ A;  1Z6R A;  3KK2 A;  1QZ6 A;  1KD1 O;  2CGL A;  1FXX A;  1HKG A;  3QEV A;  3VER A;  1S9E A;  2O8D B;  3DLE A;  4CES A;  4B3M K;  3ZX3 A;  4FWL A;  4OJR A;  4YDU A;  1E4F T;  4AHR A;  1S6P A;  2W41 A;  1JLF A;  3G6E N;  4FPB A;  1XNR K;  3A2F A;  2BGG A;  3QEI A;  3E1Y A;  4JLH A;  2G8F A;  2KQ2 A;  2UYT A;  4DTJ A;  2DFF A;  4I9L A;  5BRF A;  2OPQ A;  3EZW A;  3CER A;  3HTV A;  3NVK A;  3ZT4 A;  4N41 A;  5M1P A;  4F3T A;  5AZI B;  3OYN A;  2I7P A;  3OHR A;  4HUE A;  3C95 A;  4O8K A;  2A1S A;  1NM1 A;  1DEJ A;  3D6R A;  1TYQ B;  3TAE A;  4LFA K;  3AAQ A;  3S3O A;  3OYJ A;  3TAB A;  1T8E A;  4JN4 A;  3HM9 A;  3O9U A;  1EO1 A;  3I33 A;  1ATR A;  2Z1H A;  1XUP O;  4OLA A;  2RF2 A;  3K59 A;  1T44 A;  4CEQ A;  1OH6 A;  4B1Z A;  2NRH A;  4BRH A;  1RTJ A;  4DV4 K;  3QBX A;  2CH6 A;  4CIG A;  3L2Q A;  4CIF A;  4F8R A;  2Z1G A;  4I6M A;  4W5O A;  3IKM A;  5AQM A;  2Z1J A;  1NMD A;  4EZ9 A;  4PA1 A;  5AZJ B;  4BRN A;  1YHQ N;  4RW8 A;  3VA0 A;  4CHY A;  3SQ4 A;  2FBT A;  3SQ1 A;  4LD0 A;  3VQE A;  4WCE L;  4FSV A;  2GV9 A;  1UA0 A;  3CC7 N;  3S41 A;  1KRP A;  3SAG A;  3CJA A;  3OW2 M;  3QNO A;  1W7A A;  4BR4 A;  1UOC A;  2QWO A;  4YOY A;  5CYQ A;  2P9S B;  4JK7 A;  1KVA A;  5JIC A;  3CCR N;  5TKW A;  3OS2 A;  5JVG L;  3OS1 A;  4AHT A;  3MCA B;  2YNI A;  4DMN A;  5JMV A;  4E1M A;  1TKD A;  1NKE A;  5AQJ A;  3V9X A;  4B8A B;  3E9L A;  3TSU A;  1E3M A;  4LH5 A;  1DTT A;  4RW7 A;  4W5Q A;  3OA9 A;  2DTU A;  4A57 A;  3RR7 A;  3CIP A;  3MEC A;  1BG3 A;  4I2P A;  4PL8 A;  4DQS A;  4BC5 A;  1K8A O;  2PZS A;  1HJR A;  4PKH A;  1BIU A;  2NRZ A;  1N6Q A;  3WXI A;  3KLE A;  4JRP A;  2PYJ A;  3NDK A;  1I94 K;  4DQP A;  3MEG A;  3MN7 A;  1X3M A;  4CJE A;  1LWE A;  3LAM A;  3MXI A;  1HR0 K;  4ILG B;  3JYT A;  2VQF K;  2YHA A;  4I9Q A;  4FWQ A;  1NK9 A;  4CZF A;  4FK4 A;  2ASM A;  1XI1 A;  3HPG A;  1RBV A;  2VCP A;  1JL2 A;  1Z05 A;  4DFM A;  1J54 A;  2KLA A;  2BDP A;  3WQU A;  1ASV A;  2YHW A;  4KO0 A;  1QS4 A;  3HZ6 A;  4HTU A;  3ZT1 A;  1NK0 A;  2O8F B;  3S3N A;  2FLO A;  1T6D A;  1DGK N;  4PQU A;  4MO4 A;  3U3G A;  4A5B A;  4F9O A;  3E9P A;  4IXC A;  5C0Y A;  3CYM A;  4KKO A;  4J2B A;  4DU3 A;  3GE1 A;  3Q7C A;  3HPO A;  1YTU A;  5BN9 A;  2O8C B;  4HUG A;  3OYE A;  3HST B;  2A5X A;  4K41 A;  1WSJ A;  3BUZ B;  3UIQ A;  2UXB K;  3FZM A;  1TVR A;  3CMA N;  2YI1 A;  5ELZ A;  4Z4E A;  3MX2 A;  3NCI A;  4DTS A;  2ZJP L;  1U49 A;  4LF6 K;  4HCC A;  5KRS A;  4DV3 K;  4Z4I A;  3IDH A;  4OGC A;  4YOX A;  4BGA A;  1HYV A;  2QWR A;  4B1W B;  1C0F A;  4JHD A;  5JS2 A;  1NKC A;  2ZQB A;  4DLG A;  3OYH A;  2YHB A;  4KTQ A;  3AVG A;  3EEQ A;  3WXM B;  3HYF A;  3H3N O;  4IFY A;  1HKC A;  3HI0 A;  1T7P A;  2IVP A;  3C94 A;  4BC3 A;  1U2V B;  1IJJ A;  3QLH A;  4JKE A;  4FLV A;  1YTA A;  4IWV A;  1S1X A;  4DTR A;  1U4B A;  1W97 L;  2YCH A;  3G4S N;  3V1Q A;  4BRF A;  1P90 A;  1ZYQ A;  2F96 A;  2X6S A;  5J2P A;  3EE8 A;  4O0J A;  2G8K A;  3CPW M;  1IBM K;  1J53 A;  1JLA A;  2WUS A;  5BRH A;  5KTQ A;  1NJX A;  4CFC A;  3U9D A;  1MWK A;  3L8B A;  4AHC A;  4CJQ A;  4CED A;  3PIP L;  4FOE A;  1QSL A;  4C23 A;  3OYB A;  1S3X A;  1XC3 A;  5AJ3 K;  4XH1 A;  4FLX A;  1CXU A;  3ZCM A;  3BP8 A;  1SV5 A;  3LWL A;  2P9I A;  1D8Y A;  3IAY A;  5AFU A;  2HBM A;  4DCH A;  1NOY A;  2Q31 A;  4M3U A;  4DHY A;  1ZC6 A;  4FWR A;  1KVC A;  4CJ4 A;  5KGX A;  4NLC A;  1WLJ A;  2QK9 A;  1VSM A;  5B8H A;  1GLJ O;  3CET A;  3SYZ A;  1GLA G;  3C0B A;  3WQT A;  4XH5 A;  3OVN A;  1NWK A;  5F1X A;  3NVM A;  1IKX A;  5AQV A;  3KD5 E;  1VSH A;  1HMV A;  3CI5 A;  4O55 A;  1RDB A;  3KVG A;  2RN2 A;  4AHS A;  1HNX K;  2OA8 A;  3KHY A;  3O08 A;  5AQP A;  1RDA A;  1S1T A;  5C12 A;  2P9N A;  4A2B A;  4CK1 A;  4DV7 K;  3L3U A;  3MDQ A;  3AA5 X;  4KFB A;  3SK3 A;  5M1K A;  3AO3 A;  5DM6 L;  1QQM A;  1QHA A;  5J2N A;  4B9U A;  2UUA K;  3OJU A;  4MLE A;  1GOC A;  1BOT O;  1WB9 A;  2P9I B;  1B92 A;  4ID1 A;  4FLZ A;  3SUP A;  3NFA A;  3HOS A;  2KZM A;  4X64 K;  5D3G A;  3PX6 A;  4QS7 A;  4KHW A;  2HST A;  1QZ5 A;  3QO9 A;  1L3U A;  1Y97 A;  4CF1 A;  4H0T B;  3NF6 A;  4JS4 A;  1U45 A;  4CZK A;  3LPT A;  4CGH A;  4JI7 K;  3R3L A;  5HRS A;  3ZSY A;  1VQ7 N;  4YDU C;  3MN5 A;  3P1G A;  5C2F A;  1KQS M;  3R1X A;  4O5F A;  4ISE A;  3BGR A;  4X65 K;  1YAG A;  3THW A;  4CF9 A;  4DR4 K;  3O9S A;  3CJB A;  2P9P B;  3BY5 A;  3QIP A;  2HHS A;  2AA4 A;  1W2B M;  2FSN A;  4BVO A;  1TK8 A;  1G15 A;  4CFA A;  3VEX A;  4CGJ A;  4GV3 A;  4F4K A;  2CGJ A;  3KK3 A;  3AVI A;  1VQ4 N;  3K9J A;  3VEV A;  1BUP A;  5AQR A;  4F2R A;  2NRT A;  4R5P A;  2KKZ A;  1WSG A;  3QML A;  1RCH A;  3HL8 A;  4FW2 A;  3K57 A;  3FFI A;  5EX5 A;  1O1W A;  5I3U A;  3GDQ A;  1Q7Y O;  3ZSO A;  1GLD G;  2YKM A;  2VGM A;  1EET A;  2Q0U A;  1R59 O;  2NUB A;  1Q81 O;  5KI6 A;  1C0U A;  3CG7 A;  5I9E B;  3THY A;  4ELT A;  3AO5 A;  4CF0 A;  3RSE A;  1GLC G;  4DTN A;  3RRH A;  3KIO A;  3ZSR A;  1VAZ A;  3VTH A;  2IOC A;  1HPM A;  1HPZ A;  1HYZ A;  4J8F A;  1LAW A;  1HYS A;  3MXJ A;  2VYP A;  2A3Z A;  3L2U A;  5IWA K;  3THW B;  4M7X A;  3TAF A;  3PSI A;  4H0O A;  4M42 A;  4CGF A;  4FJM A;  1WSI A;  3DOK A;  3L2W A;  5AQX A;  4AHV A;  3HM8 A;  4FOI A;  5MLC Q;  3ZT0 A;  1C1B A;  3VQ5 A;  3ULE A;  3EE9 A;  2OPP A;  4BRQ A;  2YNG A;  1RT6 A;  4B8C A;  3SPY A;  2JGU A;  4M63 C;  4CEC A;  3SV3 A;  1NJW A;  1UA1 A;  3C7N B;  4JKC A;  5EVZ A;  2CH5 A;  3LL3 A;  3DI6 A;  4BWM A;  1C0G A;  5A2Q O;  5J2Q A;  3VGK A;  3ZSQ A;  2AP1 A;  1BL3 A;  2UU9 K;  2F8T A;  5F2R A;  1C0M A;  1FKO A;  3NGZ A;  4FJL A;  4CEZ A;  4CHP A;  3CJC A;  4H0X B;  4IDH A;  4Z4H A;  4FJK A;  2Q1N A;  3LZJ A;  4GKJ K;  2VG6 A;  4IZ9 A;  1ZBS A;  4L3Q A;  1V4T A;  4ZTF A;  2QWQ A;  4WFB L;  3TAG A;  1BA0 A;  4NB4 A;  2KW4 A;  1LCU A;  3QIN A;  3E01 A;  3P83 D;  3O4N A;  2DPN A;  2B5J A;  3DRS A;  3OY9 A;  3U3Y A;  4K8Z A;  1NJY A;  5FRN A;  3CJ7 A;  3H45 C;  3H6E A;  4Z0U A;  4CZI A;  3R9P A;  1GLF O;  3QES A;  1VSJ A;  3PSF A;  4CFD A;  3F9K A;  4DV0 K;  4Q0B A;  3KWG A;  1NGJ A;  1TL3 A;  4DQR A;  4BDP A;  1YIJ N;  2EWS A;  4FJ7 A;  4FLW A;  3A5L C;  3A0I X;  3TAQ A;  1E4G T;  2F9T A;  3SMS A;  4DG1 A;  4JNE A;  2VG7 A;  3VQQ A;  4JI8 K;  4MDA A;  4O4G A;  2ASP A;  1Z26 A;  3UKR A;  2RHK A;  3ISN C;  1U04 A;  1SKR A;  1RTI A;  1ZBU A;  2CGK A;  1WAF A;  2NRV A;  2IGI A;  3DXM A;  3C65 A;  1TKX A;  1XWL A;  3H3O B;  3AAR A;  1KFD A;  3AAP A;  2HHW A;  3H1V X;  1NK4 A;  2BUP A;  4CK3 A;  4KV8 A;  4E7I A;  2R7Y A;  1IV0 A;  2GEL A;  1BU6 O;  5ADX H;  3VQ7 A;  2E5L K;  4NYF A;  3ASM A;  4CBX A;  1QVF M;  3O3F A;  4EFH A;  3CME N;  2H3G X;  4B1U B;  1NBW A;  5HRO A;  1RDU A;  1SZ2 A;  3VEZ A;  2O8B A;  1BQN A;  3OYI A;  3HVT A;  1NK5 A;  3UE5 A;  4B9N A;  3VES A;  3ID8 A;  3KD1 E;  2XO7 A;  2QW9 A;  2XRI A;  1JKH A;  4BRO A;  3VGM A;  2P9K B;  1U6Z A;  1QVG M;  3TAR A;  3CCL N;  2GUP A;  3NGY A;  2QKB A;  2Q36 A;  5AQN A;  1JCF A;  3LP3 A;  4QS9 A;  4PWD A;  1KAY A;  3J81 O;  1NGF A;  1HNZ K;  4FZX C;  3VET A;  4DF4 A;  4CJS A;  5AQT A;  1M1K O;  4CK2 A;  1QQC A;  3UKU B;  4M3Y A;  3IRX A;  3OTO K;  3D2E A;  5HRR A;  3C6U A;  3WNG A;  4LFB K;  4IEI A;  4XIU A;  4C8O A;  4CEO A;  5I42 A;  4EP4 A;  3FFK B;  2A41 A;  3O1W A;  1IKY A;  2HMP A;  5EY4 A;  2J4R A;  2HBL A;  4E7J A;  4B3S K;  4HHT A;  2O4G A;  1XHX A;  1X1P A;  4ILH A;  1Q18 A;  3VPZ A;  4JKF A;  5CY4 A;  1P8Z A;  3QB0 A;  4FJ5 A;  5FPN A;  2E6L A;  3ID6 A;  4ZHR A;  3LAL A;  1NGD A;  1NGG A;  4UY8 O;  5M1O A;  1JL1 A;  2YHX A;  4YHH K;  3CHW A;  1FJG K;  4DS4 A;  2HBJ A;  2UUB K;  3KLG A;  5DM7 L;  3QEX A;  4K8X A;  4JI2 K;  3SJJ A;  1QHT A;  3F5T A;  3R6M A;  1CXQ A;  2PAV A;  4RW6 A;  1HKB A;  3LDP A;  1N36 K;  3FZH A;  2IC3 A;  5FPM A;  4IJA A;  3TR8 A;  3G71 N;  2WON A;  4JKA A;  4CJR A;  2QWM A;  2UXC K;  4JD2 A;  2ITG A;  2UXD K;  2BE2 A;  4AM6 A;  4CZH A;  3O9T A;  3OYM A;  4IG0 A;  4F2S A;  2ZJQ L;  4LFC K;  3KLH A;  1ZBL A;  3LP2 A;  3B6P A;  5AQI A;  2XY6 A;  4BRM A;  4CBU A;  4PKG A;  3K5M A;  2V52 B;  1Q86 O;  2HHH K;  5KPZ A;  4I6M B;  1I39 A;  4KH5 A;  1MA9 B;  2P1J A;  3IUC A;  3BDP A;  1K9M O;  3DLG A;  2QKK A;  3JAM O;  4CZM A;  1SKW A;  5SWM A;  3T1A A;  1TGO A;  1RT4 A;  1TL1 A;  3HSC A;  4JRQ A;  1IBL K;  1VQP N;  5AR0 A;  3JSM A;  2NLX A;  4I2Q A;  3D7E O;  2D0P A;  2WBN A;  3V1R A;  3T1Y K;  4DSL A;  3QET A;  4CZG A;  4Z4C A;  5KGW A;  2D4W A;  4AF1 A;  4CJT A;  2HND A;  4DLE A;  4HCB A;  2KFN A;  2QWN A;  2RE2 A;  2FXU A;  4CI6 A;  3AVF A;  1L3S A;  4BVP A;  4U67 L;  1QQN A;  2HHV A;  4JS5 A;  4BAC A;  5BN8 A;  1VSD A;  4BRP A;  5BRE A;  2G8W A;  3G0Z A;  3M8Q A;  4CGD A;  3VQP A;  4W5N A;  4H5W A;  2O8E A;  3AVJ A;  2Q2R A;  4O8U A;  3MXM A;  4WF9 L;  5AQY A;  3T19 A;  1BWF O;  5BRD A;  3L3V A;  3LM9 A;  3V4I A;  4ELU A;  1A5V A;  4Z4F A;  3FZL A;  3P5J A;  3IS9 A;  4LY7 A;  3RRG A;  4BGB A;  1N33 K;  3PUF A;  3W3D A;  1IKV A;  5M1N A;  4IKF A;  4KH4 A;  4LF8 K;  1RDD A;  4JYA K;  3V81 A;  1KAZ A;  4GNI A;  3VMF B;  4BC4 A;  2OPR A;  3SAF A;  3HO1 A;  4FJG A;  2QXF A;  2JWL A;  4UQG A;  3QEW A;  1EWR A;  4M3T A;  5F0X A;  1W0H A;  4C8K A;  3OYK A;  3ZSX A;  3TAP A;  1M90 O;  3RTV A;  5SZT A;  3H46 O;  4DUY K;  1WUA A;  3FZK A;  4G9Z A;  3BF1 A;  5KQ8 A;  4JAX A;  2P5O A;  4YNQ A;  2UUC K;  3LAN A;  3LDS A;  1YIT N;  1L3V A;  1VQO N;  4BY9 C;  3SLC A;  4GVM A;  1QTM A;  3DLK A;  3MCP A;  4H03 B;  3SI6 A;  2FSK A;  3VEW A;  2E2Q A;  4DTM A;  5EXW A;  5GAG P;  4K25 A;  3A5N C;  4K42 A;  3OYG A;  4DU4 A;  2QI2 A;  1X9J A;  4OLB A;  2Q0R A;  4CGG A;  3O1B A;  3VA3 A;  4DV2 K;  2E8A A;  3ZT2 A;  2DFH A;  5E41 A;  3K58 A;  3SUN A;  2YHY A;  1ZBI A;  3G10 A;  2W40 A;  4JHD B;  4B3T K;  4BRL A;  2VQE K;  1O13 A;  1YF5 L;  5C2D A;  4BQZ A;  3DLR A;  3U6F A;  5CZ2 A;  4DR6 K;  4DTP A;  3C6T A;  4O44 A;  3MK6 A;  3SAH A;  1NKB A;  1TUY A;  3ZSW A;  1VSK A;  4DSJ A;  4DSK A;  4IDK A;  1NGE A;  2V7Z A;  1I3A A;  3DRP A;  2VWJ A;  4KI6 A;  4KRE A;  3M5R A;  2DY4 A;  4H4O A;  4Z4G A;  1KLM A;  4B9T A;  2X74 A;  4CJW A;  4H5N A;  5AQQ A;  3LDO A;  3DAW A;  1TV6 A;  3LZI A;  3B8A X;  4NXM K;  3CQY A;  1BDG A;  3JXU A;  1DTQ A;  5IT9 O;  2PY5 A;  3PO4 A;  4QS8 A;  2JWK A;  4BRC A;  3EN9 A;  3TTD A;  4H0Y B;  4EHU A;  4WYB A;  4ILJ A;  2RKI A;  1JJ2 M;  3N4Q A;  2ZE2 A;  1G99 A;  5HRN A;  4DSI A;  3F73 A;  5FPD A;  2D0A A;  3AVB A;  3K5O A;  5LL6 Z;  2V7Y A;  2LSN A;  1LW2 A;  1RBU A;  3CM6 A;  3VQC A;  4CEA A;  1SKS A;  1ZBF A;  3MN9 A;  4YOV A;  4A62 A;  4CCH A;  4W5R A;  1BQM A;  3IFR A;  4QCL A;  5AFU H;  1A5W A;  2JLE A;  1JLE A;  3CFO A;  3O80 A;  3LP0 A;  4CJU A;  3VEY A;  3NH0 A;  1BCM A;  1WSH A;  3O3G A;  2KHO A;  4C8M A;  3PLA A;  3AA2 A;  3AVK A;  4CJK A;  2HHT A;  1K8K A;  3C6A A;  3QER A;  5LY3 A;  4WQ5 C;  1KLN A;  5LMU K;  2YJE A;  2OTJ N;  2XHB A;  4B9L A;  2KZZ A;  1SS6 A;  4CFB A;  1VSE A;  4O5B A;  5DMR A;  3WEE A;  4OKE A;  2P9N B;  3AVM A;  3CD6 N;  4JEP A;  5EU7 A;  1XMO K;  1BA1 A;  4FWO A;  1J9A A;  2YX6 A;  2Q97 A;  4E7K A;  4Y1D A;  3NE6 A;  4C1N I;  4OPA A;  3CCU N;  4RWT A;  1TKT A;  1R0A A;  4AM7 A;  5CE3 A;  1N32 K;  1ILY A;  1XQS C;  3DLL L;  1J5E K;  2P9L A;  1YVN A;  4DQQ A;  5C25 A;  2HMI A;  1C1A A;  1HQE A;  1S1V A;  1Z25 A;  3BZK A;  3D2F A;  3LWM A;  1KC8 O;  4N56 A;  1GOA A;  3BF3 A;  3AA3 A;  4IOA L;  3MED A;  4N47 A;  4FW1 A;  1NMN A;  5AQH A;  3F2K A;  4BR2 A;  3M8R A;  2HNY A;  1X9W A;  2WC9 A;  3EYZ A;  1VQN N;  1WNS A;  2D0O A;  1JLQ A;  3EKU A;  3KKR A;  2F8S A;  3ZSV A;  4MQ3 A;  2E2O A;  1NJI O;  1VK0 A;  3O4Q A;  5HRP A;  2QA4 N;  1GLL O;  1NGH A;  3AO2 A;  3LP1 A;  3J8A A;  1VHX A;  3M8S A;  1JCE A;  1WBD A;  1W9H A;  4HTL A;  4CIE A;  3HBT A;  2E2P A;  2HVI A;  2P9U A;  4M7Y A;  2G8V A;  3CJ9 A;  4NCB A;  3RMC A;  1F21 A;  3R8E A;  3PIO L;  4E3S A;  3DJC A;  3TSQ A;  3SJH A;  4BG8 A;  1FKP A;  3V9W A;  4NCA A;  4JI5 K;  1EWQ A;  3G25 A;  1YVU A;  5AQW A;  1A5X A;  3O4W A;  2P9L B;  3J80 O;  3SV4 A;  4OKJ A;  4FXD A;  3QDK A;  1QE1 A;  3SBT A;  2F4V K;  4IFV A;  1VQ8 N;  4C8N A;  3EKS A;  2A6A A;  3THY B;  3CCM N;  4DFK A;  1KSP A;  3DLB A;  3RSE B;  4CJF A;  1JLB A;  4J2D A;  2GWJ A;  3O5B A;  3WNE A;  2XY7 A;  1K6Y A;  5BR9 A;  3WXL A;  5AQS A;  1S22 A;  3ZX0 A;  4GV6 A;  4LH4 A;  1BGX T;  1EKE A;  4XEI A;  4H4M A;  3CC4 N;  1U48 A;  3PX4 A;  2KFZ A;  3I56 N;  3CC2 N;  3A5O C;  5FLX O;  3HOT A;  4WE1 A;  1YXQ A;  4ZTJ A;  1VSF A;  3NH2 A;  2FSJ A;  3LAK A;  3AVC A;  1KFS A;  1GLB G;  1REV A;  1SAZ A;  4B1X B;  4LF9 K;  4PHT X;  4NCG A;  3A8Y A;  4B9Q A;  3OBY A;  3WNF A;  4BE0 A;  3DOL A;  4ISG A;  5KPR A;  3ULE B;  3ATV A;  4WQ4 C;  3AVL A;  4G1Q A;  1S72 N;  5AQG A;  4FVU A;  1RT2 A;  3NAE A;  4CE9 A;  4PL7 A;  1NGI A;  2YV0 X;  3DWL A;  4JKH A;  4X66 K;  1OH7 A;  3P38 A;  4BR0 A;  3J7Z O;  1VQ9 N;  3DM2 A;  3O8M A;  1OVY A;  3KLF A;  4KHS A;  3K0S A;  1Y64 A;  5GIO A; 
#chains in the Genus database with same CATH homology
 3KK1 A;  1NK8 A;  1U4B A;  4DTO A;  4FZY A;  2IC3 A;  3V1Q A;  1RT7 A;  2G8I A;  1ZYQ A;  2HHU A;  4W5T A;  3TR8 A;  1DLO A;  2IDO A;  2WON A;  3H08 A;  4CJR A;  2Z1I A;  2F96 A;  2X6S A;  1LWF A;  5J2P A;  4B9M A;  4RW9 A;  1UAX A;  5HBM A;  5J2M A;  4O0J A;  3AA4 A;  2G8K A;  4J2A A;  4M45 A;  4KAZ A;  1RTD A;  2Q3S A;  1J53 A;  2ITG A;  5FDL A;  1JXE A;  3V1O A;  1JLA A;  2B4J A;  2BE2 A;  1EP4 A;  4KRF A;  2HVH A;  1RIL A;  4IG3 A;  5KTQ A;  4IG0 A;  3OYM A;  4F2S A;  1NJX A;  4CFC A;  2IAJ A;  1JLG A;  4FM2 A;  1D9D A;  3L8B A;  3KLH A;  2GBZ A;  4AHC A;  3LP2 A;  4CJQ A;  3B6P A;  4BE1 A;  2XY6 A;  1ZBL A;  4CED A;  1S1W A;  3QNN A;  3K5M A;  1QSL A;  4E7L A;  3OYB A;  2HW3 A;  3QEP A;  4AHU A;  4FLX A;  1CXU A;  1I39 A;  2OZS A;  3ZCM A;  4I9Q A;  1SV5 A;  2FBX A;  3LWL A;  3V9U A;  1BHL A;  3VN5 A;  2X78 A;  4FK2 A;  3TWH A;  1D8Y A;  3IAY A;  2P1J A;  1J5O A;  3BDP A;  4FJX A;  3DLG A;  3KLI A;  1NOY A;  3ULD A;  2QKK A;  4KI4 A;  4M3U A;  1S5J A;  2G8H A;  1KVC A;  4CJ4 A;  1SKW A;  5SWM A;  3T1A A;  1TGO A;  5KGX A;  1QSS A;  4KB0 A;  1RT4 A;  1TL1 A;  3MAQ A;  4KHN A;  4M3X A;  3HK2 A;  4JRQ A;  1WLJ A;  4RW4 A;  2QK9 A;  1VSM A;  3CM5 A;  4N5S A;  3JSM A;  4QOZ B;  4PUO A;  4I2Q A;  4B9V A;  1B9F A;  3V1R A;  4CF2 A;  3SYZ A;  4DSL A;  3OYC A;  3QET A;  4FLY A;  4Z4C A;  5KGW A;  4CJT A;  3RMA A;  2HND A;  4DLE A;  3OVN A;  1ITG A;  4HCB A;  3DMJ A;  2KFN A;  3VQA A;  3SQ2 A;  1IKX A;  3KD5 E;  1VSH A;  1HMV A;  4O55 A;  1RDB A;  3AVF A;  4B9S A;  1L3S A;  2RN2 A;  4AHS A;  4M3W A;  5FRO A;  2OA8 A;  3HXM A;  4CEF A;  4KHU A;  1RBS A;  1GOB A;  4ELV A;  1FK9 A;  2HHV A;  3NBP A;  2XY8 A;  4JS5 A;  4BAC A;  1RDA A;  4GW6 A;  3DYA A;  1IH7 A;  4NYN A;  1VSD A;  1S1T A;  4OPJ A;  3MEE A;  2OYQ A;  2IS3 A;  3L2V A;  4CK1 A;  2G8W A;  3G0Z A;  3LPU A;  3M8Q A;  4CGD A;  4C8L A;  3L3U A;  3VQP A;  3AA5 X;  4KFB A;  3NHG A;  4E89 A;  3SUO A;  2ATQ A;  4W5N A;  3AO3 A;  2HNZ A;  3AVJ A;  4FJJ A;  4YFU A;  1XHZ A;  5J2N A;  1C6V A;  3MXM A;  3V6D A;  4B9U A;  3DRR A;  3T19 A;  2GUI A;  3OJU A;  1GOC A;  1RBR A;  2VWK A;  4E0D A;  1TK0 A;  1B92 A;  4ID1 A;  3L3V A;  4FLZ A;  3SUP A;  3NFA A;  3V4I A;  4ELU A;  2KZM A;  4CF8 A;  1A5V A;  3K5N A;  4Z4F A;  3P5J A;  3IS9 A;  4LY7 A;  1RT5 A;  4AIL C;  3RRG A;  5D3G A;  4FM0 A;  3PUF A;  3OYD A;  1WSE A;  2DFE A;  4CEB A;  4M3Z A;  1IKV A;  4FJ8 A;  1VRU A;  4IKF A;  2WOM A;  2PYL A;  4DQI A;  1RDD A;  3PX6 A;  1LV5 A;  3V81 A;  3PX0 A;  3EY1 A;  4Y1C A;  4CHO A;  4KHW A;  4H8K A;  4DTX A;  2OPR A;  3QO9 A;  1Y97 A;  4CF1 A;  1L3U A;  3NF9 A;  3NF6 A;  3HVR A;  4JS4 A;  2EX3 A;  2QXF A;  2XY5 A;  5HP1 A;  1U45 A;  1HNV A;  4CJV A;  4OPK A;  3D0P A;  1BIS A;  4UQG A;  3LPT A;  3QEW A;  4CGH A;  1L5U A;  1UWB A;  4M3T A;  5HRS A;  3ZSY A;  4CHZ A;  1W0H A;  4FZZ A;  3D45 A;  4FLU A;  4C8K A;  3SZ2 A;  1JLC A;  3P1G A;  4CJP A;  3OYK A;  5T7B A;  3ZSX A;  3SCX A;  1LWC A;  3TAP A;  1Q9X A;  3HT3 A;  3RTV A;  5SZT A;  4FYD A;  3BGR A;  2B6A A;  2KTQ A;  3OYL A;  4CF9 A;  1QSY A;  4GMJ B;  4FCY A;  3QIP A;  2HHS A;  2AJQ A;  3VQ9 A;  2P5O A;  4YNQ A;  1TK8 A;  5CYM A;  3LAN A;  3LDS A;  1L3V A;  1G15 A;  4CFA A;  4GVM A;  4CGJ A;  1VSI A;  3TAN A;  2E6M A;  3EZ5 A;  2P51 A;  1QTM A;  3CFP A;  4F4K A;  3KK3 A;  3AVI A;  3DLK A;  3SI6 A;  4DFJ A;  3ALY A;  1IG9 A;  1TAU A;  3PV8 A;  4F2R A;  5HLF A;  4DTM A;  3NF7 A;  4R5P A;  4FM1 A;  1BIZ A;  1WSG A;  1TAQ A;  1RCH A;  3HL8 A;  1EX4 A;  4FW2 A;  1Q9Y A;  3K57 A;  1N5Y A;  1T05 A;  3FFI A;  3OYG A;  4DU4 A;  2HHX A;  4BWJ A;  5I3U A;  1O1W A;  3S3M A;  1S6Q A;  3KKS A;  3SPZ A;  4OLB A;  4CGG A;  3VA3 A;  1S1U A;  4FK0 A;  3ZSO A;  1T03 A;  1L3T A;  4CJ3 A;  1YT3 A;  2YKM A;  4F3O A;  1EET A;  3L2R A;  4CJL A;  2NUB A;  3AVN A;  3ZT2 A;  5KI6 A;  2DFH A;  1C0U A;  1SUQ A;  3CG7 A;  3AO1 A;  4QAG A;  5E41 A;  3K58 A;  3PO5 A;  3VQ8 A;  3SUN A;  1RT1 A;  1KCF A;  1ZBI A;  4ELT A;  3G10 A;  1WN7 A;  2O4I A;  3AO5 A;  4CF0 A;  3NH1 A;  1ASW A;  1RT3 A;  4DTN A;  3RRH A;  1NK7 A;  3KIO A;  4ID5 A;  4FJN A;  2OZM A;  3ZSR A;  3DLR A;  3U6F A;  4BDZ A;  5CZ2 A;  3PY8 A;  2IOC A;  4B3O A;  3SQ0 A;  4DTP A;  3C6T A;  1HPZ A;  1HYZ A;  4O44 A;  1LAW A;  1NKB A;  3M8P A;  3O3H A;  1HYS A;  3MXJ A;  1SL2 A;  2HB5 A;  3ZSW A;  1VSK A;  1X9S A;  4DSJ A;  3L2U A;  4IDK A;  4DSK A;  4EZ6 A;  3I8D A;  4LSN A;  1C1C A;  2FC0 A;  4M41 A;  3VQ6 A;  4DFP A;  3TAF A;  3DRP A;  1I3A A;  2YNH A;  4OGE A;  5JS1 A;  3SUQ A;  1WSF A;  4M42 A;  4CGF A;  2VWJ A;  4KI6 A;  4KRE A;  4DF8 A;  2DY4 A;  3DLH A;  1SL0 A;  2HHQ A;  4H4O A;  3OYF A;  2FBY A;  1KLM A;  3KK2 A;  1WSI A;  4B9T A;  1VSL A;  4FJM A;  4Z4G A;  4OKK A;  3DOK A;  2X74 A;  1FXX A;  4CJW A;  3QEV A;  1D5A A;  3L2W A;  1S9E A;  4OVL A;  4AHV A;  3DLE A;  4CES A;  1TV6 A;  4OJR A;  3LZI A;  3ZT0 A;  4AHR A;  1C1B A;  3VQ5 A;  1S6P A;  1DTQ A;  4E19 A;  2PY5 A;  4RG8 A;  3PO4 A;  2OPP A;  1JLF A;  2YNG A;  3B6O A;  4E7H A;  1RT6 A;  3A2F A;  2BGG A;  4B8C A;  3SPY A;  2RKI A;  3QEI A;  4JLH A;  2G8F A;  4DSF A;  4FJI A;  2JGU A;  4HVJ A;  2ZE2 A;  2KQ2 A;  4DTJ A;  3THV A;  4TSX A;  4CEC A;  3SV3 A;  5HRN A;  4DSI A;  1NJW A;  1CLQ A;  3F73 A;  2DFF A;  4I9L A;  1UA1 A;  2OPQ A;  2X6N A;  3KTQ A;  1HRH A;  2D0A A;  3AVB A;  3K5O A;  4E1N A;  3DI6 A;  4BWM A;  5J2Q A;  4O0I A;  3ZT4 A;  3ZSQ A;  2LSN A;  3VQD A;  1BL3 A;  2F8T A;  1LW2 A;  1XC9 A;  4N41 A;  1C0M A;  1RBU A;  4F3T A;  3OYN A;  3CM6 A;  3VQC A;  4CEA A;  1FKO A;  3NGZ A;  1SKS A;  4FJL A;  1ZBF A;  2FBV A;  3C95 A;  4CEZ A;  4CHP A;  4HUE A;  4KB1 A;  2YKN A;  4CCH A;  2A1S A;  2ETJ A;  4W5R A;  3AVA A;  4Z4H A;  4FJK A;  1BQM A;  4QCL A;  3LZJ A;  1A5W A;  4AH9 A;  2JLE A;  1JLE A;  3CFO A;  3HO1 A;  2VG6 A;  3TAE A;  3LP0 A;  4CJU A;  3T3F A;  3S3O A;  3OYJ A;  3TAB A;  4KHQ A;  3AVH A;  4FJG A;  3NH0 A;  1T8E A;  1BCM A;  1WSH A;  4ZTF A;  3O3G A;  3TAG A;  4C8M A;  3AA2 A;  3HM9 A;  3AVK A;  4CJK A;  2HHT A;  2Z1H A;  2KW4 A;  4OLA A;  2RF2 A;  3K59 A;  4CEQ A;  3QIN A;  3E01 A;  3P83 D;  3O4N A;  3DRS A;  2B5J A;  3OY9 A;  3OJS A;  3U3Y A;  3QER A;  2A1R A;  1NJY A;  2P5G A;  4K8Z A;  5FRN A;  3OYA A;  5DK5 A;  1RTJ A;  1RNH A;  1KLN A;  4Z0U A;  4CHQ A;  1RDC A;  4FJH A;  3CQ8 A;  4CIG A;  3QES A;  3L2Q A;  4CIF A;  1VSJ A;  2Z1G A;  4F8R A;  4CFD A;  3F9K A;  4W5O A;  2XHB A;  5FRM A;  4B9L A;  3RMB A;  4CJ5 A;  2Z1J A;  3ITH A;  2KZZ A;  3HPH A;  4CFB A;  1VSE A;  4O5B A;  4Q0B A;  1KTQ A;  4EZ9 A;  4PA1 A;  5DMR A;  1ZBH A;  4Q5V A;  4OKE A;  1MU2 A;  3AVM A;  3QIO A;  4RW8 A;  5EU7 A;  3VA0 A;  3SNN A;  1J9A A;  4CHY A;  1TL3 A;  4DQR A;  3SQ4 A;  4BDP A;  3K5L A;  2FBT A;  4E7K A;  3SQ1 A;  4Y1D A;  4LD0 A;  3VQE A;  3V9S A;  4FJ7 A;  3NE6 A;  4FLW A;  2GV9 A;  1ASU A;  3RMD A;  1UA0 A;  3HJF A;  3K2P A;  1NOZ A;  3TAQ A;  2I5J A;  1KRP A;  4FJ9 A;  4DG1 A;  1X9M A;  3QNO A;  3ZT3 A;  1UOC A;  2YNF A;  1NK6 A;  2VG7 A;  3VQQ A;  1TKT A;  1R0A A;  1HQU A;  4LSL A;  4O4G A;  5CYQ A;  1Z26 A;  3HP9 A;  3IG1 A;  4CEE A;  1KVA A;  4DQQ A;  1CZB A;  5C25 A;  3OS2 A;  4DU1 A;  5KRT A;  3ISN C;  4B08 A;  1U04 A;  2HMI A;  1C1A A;  1BI4 A;  4I7F A;  3OS1 A;  1SKR A;  1HQE A;  1S1V A;  2VG5 A;  4AHT A;  3CFR A;  1RTI A;  1Z25 A;  1ZBU A;  5J1E A;  3LWM A;  1WAF A;  2YNI A;  4DMN A;  4N56 A;  2IGI A;  1GOA A;  4E1M A;  3AA3 A;  4BE2 A;  1TKD A;  3MED A;  1WAJ A;  4N47 A;  1TKX A;  4FW1 A;  4HUF A;  1NKE A;  2D0C A;  3M8R A;  4N76 A;  2HNY A;  3V9X A;  3NF8 A;  4B8A B;  1Q8I A;  1X9W A;  4PY5 A;  1XWL A;  4LH5 A;  1DTT A;  3I0S A;  4RW7 A;  4W5Q A;  3EYZ A;  2DTU A;  1WNS A;  1KFD A;  3RR7 A;  4KPY A;  1JLQ A;  3MEC A;  2HHW A;  1NK4 A;  2RPI A;  4KV8 A;  4I2P A;  4CK3 A;  2R7Y A;  4E7I A;  1TKZ A;  3KKR A;  4KTZ A;  3ZSV A;  4DQS A;  4DWI A;  3RWU A;  4MQ3 A;  2F8S A;  1VK0 A;  3TAM A;  3VQ7 A;  1HJR A;  3O4Q A;  4CGI A;  5HRP A;  2PZS A;  1BIU A;  3OS0 A;  3AO2 A;  2G8U A;  2ZD1 A;  3LP1 A;  1N6Q A;  5C24 A;  4NYF A;  3VQB A;  3ASM A;  3KLE A;  3M8S A;  4JRP A;  2PYJ A;  3NDK A;  3O3F A;  1W9H A;  4EP5 A;  4DQP A;  4CIE A;  3MEG A;  4BDY A;  2HVI A;  1D9F A;  4CJE A;  1LWE A;  3LAM A;  3MXI A;  2G8V A;  4NCB A;  5HRO A;  3RMC A;  3JYT A;  4L8R B;  1F21 A;  3RR8 A;  2YHA A;  1B9D A;  1BQN A;  4IBN A;  3OYI A;  3HVT A;  4DSE A;  1NK5 A;  1NK9 A;  2D5R A;  4B9N A;  4E3S A;  3HP6 A;  4FK4 A;  1XI1 A;  1FKP A;  3HPG A;  3V9W A;  2Y1J A;  4NCA A;  3KD1 E;  1YVU A;  1RBV A;  2XO7 A;  1A5X A;  4CHN A;  3SV4 A;  1JL2 A;  2XRI A;  4OKJ A;  4DTU A;  1JKH A;  1NJZ A;  4FXD A;  4DFM A;  1J54 A;  2BDP A;  1BI4 B;  1QE1 A;  1ASV A;  3TAR A;  4IFV A;  2QKB A;  3NGY A;  4FVM A;  4KO0 A;  4C8N A;  1QS4 A;  4M3R A;  4HTU A;  3ZT1 A;  1NK0 A;  4DFK A;  3S3N A;  1KSP A;  5K14 A;  3LP3 A;  3V9Z A;  3DLB A;  4PWD A;  4PQU A;  4CJF A;  3WNH A;  2EHG A;  3KJV A;  1JLB A;  4J2D A;  3U3G A;  4FZX C;  3WNE A;  2XY7 A;  2OPS A;  1BCO A;  4DF4 A;  4CJS A;  1K6Y A;  1EXQ A;  3CYM A;  4KKO A;  4J2B A;  3S9H A;  1CZ9 A;  4FLT A;  4DU3 A;  4CK2 A;  1QQC A;  1RBT A;  1U47 A;  4M3Y A;  3IRX A;  4J2E A;  3HPO A;  3I0R A;  1YTU A;  4LH4 A;  5C42 A;  4HUG A;  1BGX T;  1EKE A;  3OYE A;  5HRR A;  3C6U A;  1RTH A;  1JXB A;  4H4M A;  3AV9 A;  3WNG A;  3HST B;  4MFB A;  4XIU A;  1U48 A;  4CEO A;  5I42 A;  4EP4 A;  3PX4 A;  1WSJ A;  4KTW A;  4C8O A;  3UIQ A;  2KFZ A;  2W42 A;  1LW0 A;  1IKY A;  3TI0 A;  1TVR A;  4E7J A;  4HHT A;  4WE1 A;  4Z4E A;  3NCI A;  4ZTJ A;  1VSF A;  3NH2 A;  2O4G A;  4DTS A;  3LAK A;  3AVC A;  1KFS A;  1XHX A;  1X1P A;  2BAN A;  1U49 A;  4CER A;  1IKW A;  2E4L A;  4HCC A;  5KRS A;  1REV A;  5CY4 A;  1KVB A;  1SL1 A;  1S9G A;  4FJ5 A;  4Z4I A;  4NCG A;  2E6L A;  1CXQ A;  4OGC A;  3WNF A;  4ZHR A;  3LAL A;  3NGI A;  4BE0 A;  3ZSZ A;  1HYV A;  3DOL A;  4DS5 A;  3AO4 A;  1LAV A;  5JS2 A;  1NKC A;  1TK5 A;  2ZQB A;  4DLG A;  3OYH A;  2YHB A;  3AVL A;  1JL1 A;  3AVG A;  4G1Q A;  4KTQ A;  3VQ4 A;  3HYF A;  4IFY A;  1HNI A;  1RT2 A;  3NAE A;  4CE9 A;  1T7P A;  2YV0 X;  3C94 A;  2D0B A;  3QLH A;  4DS4 A;  1VRT A;  3DM2 A;  4FLV A;  1YTA A;  4ICL A;  3KLG A;  3KLF A;  4KHS A;  3QEX A;  2Y1I A;  4K8X A;  1S1X A;  3SJJ A;  4DTR A;  1C0T A;  1QHT A;  1IO2 A;  4RW6 A;  4KHY A;  5CZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...